3KKAA

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
DGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-A RECEPTOR 1
publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaA00
2JV3A 2K60A 1OW5A 1SXDA 3BS7A 3TADC 2KSOA 2YTUA 1PK1B 2B6GA 3IDWA 1UQVA 2ES6A 2LPEA 1RG6A 2LMRA 1Z1VA 1SV0A 2E8OA 2QKQA 1V85A 2EAMA 2F3NA 1PK1A 2QARB 5KNIA 2EAOA 4NL9A 4RQNA 2E8NA 1B0XA 5L1MA 3K1RB 1JI7A 3TACB 4PZNA 2KIVA 2DKZA 2E8MA 1WWVA 3KKAC 2Y9UA 2QARA 3BS5B 1LKYB 5JRTA 5JU5A 1SGGA 2KG5A 1COKA 2QB0B 1X66A 2D3DA 2K4PA 3BS5A 1LKYA 2EAPA 5J8YC 1PK3A 1X40A 1SV4A 2QB0A 3BQ7A 5F3XB 3H8MA 3TADA 2D8CA 2QB1A 2F8KA 4IS7A 1KW4A 2DKXA 2GLEA 1V38A 4MHVA 2FE9A 2DL0A 1DXSA 3KKAA 2E8PA 2ESEA 1SV0C 2KMDA 1X9XA 2L5YA 4PZOA 1UCVA 2EANA 1B4FA 1SXEA 2Y9TA 4NL9C 2KSOB 5JTIA 3HILA 1F0MA 5J8YA 2F44A 1WWUA 3SENA 2KE7A 3SEIA 4NJ8A 1OXJA 4RQMA
chains in the Genus database with same CATH superfamily
4ZH4A 2KN7A 4QIWC 2JEGA 4TUPA 2YY6A 5ALIA 2GWSA 1ZETA 2LKYA 3JPRA 1ZJMA 3HJEA 1RG6A 4QZ8A 2LMRA 8ICZA 2KFZA 2FDRA 1NJXA 2KOBA 2E1FA 1TK5A 2FLLA 5EWEA 1OUQA 4DCCA 3F2BA 3LK9A 5KFCA 4MFFA 5KFEA 4GXIA 4FS1A 1ZQSA 2QARA 2ASJA 3PSIA 2EZXA 3PSTA 2H3QA 2W43A 4KLSA 1RQNA 4KLMA 3GIMA 3IP4B 2IBKA 1UT8A 4F2SA 9ICUA 5L1JA 4Q44A 3A0HU 3HWTA 5AKIA 1JRPA 3SD7A 2ZUDA 3BQ7A 3RJFA 2BKEA 3QNMA 1NK0A 1RYUA 5AI8A 4U6PA 2GLEA 3MR5A 8ICPA 5HP4A 9ICQA 1TVAA 5ALTA 4YR0A 1VDVA 3T5KA 3HP6A 4B6JA 5KFTA 2KZ3A 5J2EA 4O5KA 4F2RA 7ICMA 1MN8A 1GO3F 4DQIA 8ICEA 2V4QA 4PZOA 4ZOHC 2DPJA 1JALA 3UQ2A 3WKDA 3OGUA 5DBBA 2ATLA 1L3SA 4USAA 3GV8B 2EZZA 2RP5A 5GTIU 1RXWA 5KG3A 3PR4A 4YXJA 3RH4A 3PX4A 4DSEA 4RQMA 1QSLA 3BS7A 4US9A 4QZBA 2AGOA 3QU7A 3F53A 4O3SA 9ICBA 2C2EA 2JEFA 2VA8A 1TAUA 3OHAA 3MR3A 3PNCA 1L3TA 9ICIA 4M0AA 2Y0SC 4O3NA 4JMUA 1WCLA 1ZQHA 2WHEA 4I28A 5ALSA 3QU4A 5ALUA 2OCEA 3OJUA 3KHRA 3CYMA 3NVZA 1RQLA 3AEVA 3C23A 1ZQGA 5KFOA 5AHXA 3BZKA 2P35A 4GXJA 9ICSA 1SKSA 1QQ6A 8ICHA 1BGXT 4QWEA 4I2GA 4P0PA 1TV9A 2BCUA 4B9UA 1CRXA 2XVTA 4F5RA 4EZ9A 3VC8A 3WK6A 1ECWA 3NVYA 5EWFA 4XUSA 1V38A 4Y2SA 2R8HA 2FE9A 1KLNA 3M9NB 4I2BA 5J0XA 4YD2A 7ICRA 5ALVA 4KLJA 4QZEA 2LYBA 2ZTCA 3CW2C 4NM2A 1IM4A 1D8BA 4BX9C 2HCFA 4NL9C 2KSOB 4FZNA 4JK1A 1A77A 3CP8A 2G09A 4ECSA 2FPMA 4P0QA 4NY8A 4NLCA 1OXJA 2JV3A 2K60A 4J9PA 1QQ7A 1T8EA 4EEYA 1S77D 2K4IA 4NLNA 4HYKA 4F4WA 2MUTB 2ZXHA 4NLBA 5DGBA 2ZIXB 4C8NA 2PFOA 1JXLA 5CP2A 1HUOA 2BPFA 2UVVA 5KFSA 4RQ2A 1JIHA 1SKRA 2OHFA 2K4HA 3PR5B 4MEYA 5BPCA 9ICAA 4Y2QA 3RJHA 4PJ0U 4O3PA 4BUGA 3H0RB 3Q8LA 2FPLA 1U47A 5E79U 1ZQWA 3T5LA 5EE3A 1ZQCA 2RHFA 9ICPA 5CR0A 2ZIWB 3HX0A 3TAQA 3M6ZA 2ISPA 1MSWD 3I28A 2EDUA 2ASDA 1COOA 2GO7A 1B43A 5CA7A 4ELVA 3PMNA 1FO4A 5KG1A 4IQUA 4RT2A 1ZQNA 2DKXA 1S0MA 2DL0A 2FLNA 4RZRA 8ICWA 4IQTA 4ELUA 2XY6A 2A1AA 3IN5A 1B22A 8ICCA 5CJ7A 5ALEA 5HR6A 3WKAA 2KD1A 1Z4OA 2ZJAA 1UCVA 3JPOA 2EANA 2Y9TA 3H7IA 4UB8U 1PUZA 1YZ6A 2JHDA 2W7OA 9ICGA 4EELA 8ICQA 1WG8A 1NI3A 3D2QA 3M7DA 3QU2A 2KHVA 2NRVA 3PSPA 2PXIA 7ICGA 4I2IA 3T79A 5AKLA 2ES6A 4F4YA 4AYBF 2ZIUB 1KN5A 1T3QA 1FEZA 5ALWA 3PV8A 1Z00B 4EBDA 1Q8KA 4F92B 1BPYA 5A0LA 2EQYA 4UARA 4JB3A 2CPRA 4YFKA 5KFBA 3QUCA 1SB3C 2HBJA 4YN4A 1C20A 5ALRA 4PGYA 3FAHA 1X42A 5KFUA 4M2YA 9ICHA 4CE6A 1URJA 2DKZA 2OEHA 3KKAC 4B9VA 1RYSA 3THVA 1S9FA 1SWVA 5AKYA 4F91B 5J29A 7ICNA 3ZD9A 4UBBA 1ZOLA 5IINA 2W9AA 2NO5A 3GV5B 3BS5A 2AXTU 1C7YA 2EAPA 4RU9A 3CNHA 5KT5A 2W04A 5ALKA 2HVHA 2D6FC 2HVIA 1KTQA 5KL1B 4RPXA 4ECVA 3N28A 3RB6A 1FIQA 4Y2JA 3A0BU 2ZIVA 5ALPA 4US8A 4ED8A 1XSLA 3G6YA 4KLHA 1N61A 2Z7JA 4JUZA 2LM4A 2W3SA 3Q8QB 5DB6A 4QWBA 1TFRA 1WCNA 5L1KA 2JEIA 4YVZA 2HOQA 3V6JA 5JTIA 1XSPA 4CGZA 5J8YA 1WWUA 3RTVA 3QU9A 2GOLA 3PVXA 5DG9A 3WK4A 1S5LU 1ZQYA 4KMUA 5KL8B 1ZYQA 5AKXA 2BQRA 3TQ1A 1UQVA 2K8CB 5DQIA 5AM0A 1K1QA 4Q8FA 8ICOA 8ICVA 7ICLA 2E8OA 8ICJA 4R66A 3FDSA 1TAQA 9ICTA 1HJPA 4YMNA 4QZIA 3TFSA 4Z6EA 2K89A 5DG8A 5EE1A 1JI7A 5KAFU 2R8GA 4QZCA 1U45A 1L3UA 5H2FU 2KIVA 1CI4A 2E8MA 3ETLA 2GH1A 2W9BB 2WF8A 4BWMA 1LKYB 3MDCA 4C0ZA 4IRDA 4UQGA 4OJLA 2K4EA 4DL7A 1KRPA 3J81j 2VJ5A 2R8KA 7ICEA 4OJPA 2N1RA 2XCAA 2OWOA 3GU3A 3AUOA 2OH2A 3SAGA 3EYZA 1F44A 1L5UA 2KJ5A 1L7OA 3QZ7A 4DQQA 7ICOA 4DO9A 1KW4A 2DWQA 2IA6A 1TE2A 5AM5A 1N48A 4O5CA 5C0YA 1QTMA 5ALDA 2KVSA 2W03A 2L5YA 4I2DA 1YT3A 1Z1BA 1AQ6A 3V7LA 2BCVA 4B9SA 4G3IA 5AIBA 1XC9A 4C4RA 1U4BA 3HILA 3RJJA 2AGQA 5L1LA 3LWLA 2HHVA 2AHOB 4RQ5A 5AM3A 3SEIA 4PHDA 1BPXA 2R18A 8ICTA 4QZHA 3M9OB 1OW5A 1S76D 5KT4A 4F5QA 4LZGA 1PK1B 3FYHA 1QLNA 4YP3A 8ICMA 2IOFA 3LDAA 4J9NA 4ECUA 2HDOA 3O0FA 5KFFA 1NKCA 3I76A 1ZQEA 3WU2U 4JWNA 4G9BA 4C8OA 3OSPA 1V85A 1TK0A 4NLGA 1WYGA 4Y2RA 5BOMA 1UHUA 3L4PA 1A6SA 2E8NA 2HOFA 2XCPA 1O08A 3ICXA 4J9RA 5AKJA 5KFAA 3NRZA 2PFNA 2XI9A 4KLQA 4MEXA 3H0LB 1D9DA 3PW2A 4HAIA 3JPPA 4XA5A 4EX6A 5J2DA 4YG2A 2UVRA 1BNOA 1BPDA 1COKA 4GC6A 4I2AA 8ICRA 2KZMA 4DQPA 2WF5A 1NK9A 3V7JA 2VKQA 3F2CA 4KMOB 4XRHA 4CRXA 3GZFA 5KG7A 2ODGA 4PHPA 3OSNA 4KLFA 5ALZA 2FJ6A 5DLFA 2M0NA 4ACOA 2ESEA 5J2AA 1ZQZA 1CEZA 2H3VA 2LI6A 3UXPA 4M9GA 3C21A 2WF6A 3L3FX 1ZD3A 1V9PA 1X9MA 2JGAA 1HUZA 2KJ9A 1SKWA 3AM9A 8ICLA 1XNSA 2W55A 5ALYA 2A1JB 2F44A 4RQ0A 3UXOA 3B0YA 3PW7A 3GIKA 5ALXA 4QW9A 2KSOA 3RH5A 4FFDA 3B9JA 4UAUA 2BQ3A 3PO4A 3V6KA 2J6TA 2BR0A 3GIJA 1D8YA 4UB2A 3RAXA 2HHSA 5ALLA 5C5JA 3SQIA 2O6KA 2EAOA 2E3TA 1L8OA 2HHTA 5KFRA 2MUTA 4RQ4A 2ZIXA 5TISU 5AKZA 1WWVA 2WAQC 4P2HA 3RRGA 4M6WB 5DGAA 4WJ3B 1BPEA 1IXRA 2NYVA 2WB1F 4DFMA 2F1IA 5J2CA 4DLGA 9ICNA 2A19A 5DB7A 5J2GA 3ONNA 4R8UB 2HBKA 4DFDA 4DSIA 2DQNB 1ZD4A 5IIMA 3F2DA 2W8KA 4DF4A 1PK3A 2ZIWA 2G5IB 1DRGA 4UB3A 3M8SA 2W54A 1ZQKA 5KFPA 4I2JA 3QYPA 2KIWA 2Q4TA 4C7ZA 3IM1A 1LVHA 1NJZA 4BWJA 4K4GA 3RJGA 3QUTA 2LYAA 9ICKA 1XWLA 5ALMA 1ZQDA 2E8PA 3FC4A 2LBOA 2YMQA 1NJWA 3AMZA 4B9LA 1SV0C 4DL4A 3SI8A 2KMDA 7ICQA 5J2IA 1L6NA 5CWRA 4QZFA 2JEJA 1ZD5A 1F5SA 3EPGA 4ELTA 1N62A 3GFKB 2EH9A 1V97A 4CCHA 1ZRNA 5T14A 2DPIA 3QU5A 5DDMA 2Y1IA 1X6JA 3IG8A 4FBTA 2W8LA 1RXVA 9ICEA 3G6XA 2ZTDA 2MAXA 3PX6A 1ZQJA 1XU4A 4Q8EA 2HBLA 4UB5A 2LPEA 2JRZA 4F5PA 1ZQFA 1QSYA 2KFNA 4JV1A 3OTQA 3TANA 3RJKA 3T5HA 3SV3A 4DQRA 2F2AB 2ZIUA 4KLLA 3EUB2 5L1MA 5J0RA 4NLZA 3KBBA 1ED1A 1XSNA 4Y2UA 3D2NA 1Z00A 5KG5A 2MU2A 1NKBA 4KTQA 2CXYA 4KN4A 4DLEA 4F3OA 3Q8KA 3TI0A 2IOHA 2WF9A 1X9WA 3KOOA 3IHQB 4DFPA 2LYHA 5JU5A 2P6UA 7ICKA 1SGGA 4BXOB 4C8LA 4MF8A 3KHGA 2VA3A 2QB0B 4EYHB 3C2KA 3MBYA 4C8MA 2R8JA 5IILA 3C5FA 1NKEA 3AU2A 4CF3A 2V9WA 2C28A 5AK5A 4O0IA 5AK4A 4RNOA 4U7CA 5AIAA 1ZQUA 4RQ1A 5EE9A 5J0TA 7ICHA 5F3XB 5AI9A 3H40A 4DL2A 2QB1A 5ALJA 3PX0A 4ED1A 4MHVA 1KEJA 5DDYA 1T7PA 3WK5A 9ICMA 1Y88A 4B9TA 2PMZC 3HKZF 3M9MB 3EZ5A 4UBCA 4QIWF 1N56A 3LYSA 3JPQA 4C8KA 8ICAA 2RDJA 2AH5A 5AM1A 2G5HB 3ZDBA 1ZQ1C 2M9NA 3BQ1A 5F9LA 4YR2A 2HI0A 2B6GA 2NO4A 3IDWA 2KEYA 3F5EA 5HHHA 1L3VA 4ED7A 2YB4A 4J9LA 4DWIA 2W7PA 2K8BB 3ZDCA 2B0CA 4F4ZA 2BGWA 4IRKA 8ICNA 3RB3A 5EOZA 1FFVA 1TAMA 3RRHA 2Q0ZX 2EAMA 1AROP 4RQ6A 3RBEA 2KKPA 4O3OA 4C80A 2V4RA 4CF5A 5AICA 4CDGA 5AKGA 4Q43A 1L7PA 4O3QA 1ZQLA 1RZTA 3QEAZ 4RQ7A 4KLDA 2H3ZA 5DB8A 1PVPA 2WF7A 5J0PA 4Y2TA 2F1JA 5ALNA 3OPXA 4ED0A 4DFJA 5KFZA 4KLEA 1KSPA 3SAFA 2NRTA 2W9BA 2K4PA 1LKYA 4ICAA 2FMQA 1Q3UA 5CEHA 1DK2A 8ICFA 4QWCA 4KLUA 5ALGA 4F8RA 9ICLA 3SAHA 2BPCA 3H8WA 2MA1A 1NK5A 5KFIA 2D8CA 2F8KA 2HMXA 3HRDD 1TKDA 5J2BA 3UMBA 3C2MA 1QSSA 5KT3A 3KTQA 3GQCA 3KZIU 3ISDA 1DGJA 3RB4A 3MGHA 4E0DA 2RDIA 4UASA 4C4TA 5AI0A 5KG2A 1SXEA 4GC7A 3RJIA 2DGZA 2KHQA 4P4PA 5G5GA 1LB2B 3L5KA 1TK8A 3IRUA 4OJOA 1SXDA 2Y0SF 4IQVA 3GIIA 2BCQA 1ZQOA 2PFPA 2KTQA 1T3NA 3IG5A 3VCBA 1PVQA 1Z1VA 2FLPA 4QWDA 3M6KA 4I27A 1M6YA 4DOBA 4DL6A 2W9MA 4F72A 5DBCA 4ECZA 1PK1A 2W9CB 3MC1A 4NL9A 4ED3A 3AL0B 2XC9A 2HHXA 4TUSA 2PFQA 4JV2A 3DDHA 4OD0A 2KV2A 3UQ0A 5DKWA 2G0AA 4DEZA 3UM9A 7ICFA 3NTUA 3ISCA 4OJ6A 5DQGA 3RF9A 2KNJA 3MFIA 4ECXA 2YB1A 2I6XA 3NUQA 3JPTA 3SZ2A 3AU6A 4KLTA 4I29A 5TZVA 1U48A 1DOQA 3PMLA 4M9LA 3RFAA 2CRXA 4IR1A 2OM6A 3K1ZA 1H38A 5L1IA 4FE3A 1XS9D 1QCKA 2F8LA 4FBUA 5KFDA 4RQ8A 8ICIA 4KN7A 4KITB 1XO1A 4DS4A 4RUAA 2YMMA 3UXNA 2JH1A 2BQUA 8ICGA 3OJSA 1D8LA 2W3RA 1QH9A 4RQ3A 2JR5A 4KLIA 3RH6A 2HSZA 4RUCA 5AM4A 3NS1A 3QE9Y 8ICSA 5KG0A 2HW3A 5F9NA 2C2DA 5KFLA 4M9HA 3BJYA 4I2HA 3N7SC 3FM9A 3TARA 2A1JA 3H8SA 2IHNA 2K8AA 4F50A 3V7KA 1X6IA 5KFGA 2ZUCA 2BCRA 1ZQQA 4UAWA 5K4LA 5KFVA 4RQNA 1BPBA 2KICA 5AI6A 3NRWA 4YR3A 4PGXA 1RDFA 4PHEA 2HBMA 7ICTA 4PZNA 5G5HA 4LVSA 3ED5A 4PL2A 3WK7A 2XY7A 4B9NA 2HHUA 4QZAA 3C29A 2E1EA 1UT5A 5J0OA 2KK0A 5KFHA 2JXJA 2ALZA 2BDUA 3H4DA 1PZNA 1ZXIA 5EE0A 1N2XA 4FO6A 4C4SA 1UA0A 5KFNA 4M6WA 4X5VA 1ZQIA 2LM1A 2QLTA 2I1QA 1NK8A 2CN1A 2H3FA 3ZDEA 5KAIU 3LWMA 3F5AA 4R8UA 3TADA 1SZHA 5CB1A 4DL3A 2HOIA 3KKAA 1CUKA 2XIDA 9ICFA 3PSFA 1KKXA 1ZQPA 2ZJ8A 8ICBA 2VANA 4I2CA 4EENA 4K4HA 2KVCA 3WK8A 1UA1A 3Q8SB 4EEKA 3WK9A 3BQTA 2PI5A 4TQSA 9ICRA 5D46A 1JMSA 4Y2YA 3AQFA 2ZG6A 5ALFA 4Z6CA 3BQ0A 1S0OA 3D6JA 5IIJA 4UB6U 2KKVA 3QEBZ 5BOLA 4NXZA 5B66U 1NK6A 5HMLA 3EPIA 4MFAA 8ICUA 1DK3A 2F3NA 3MABA 2YN4A 2DBYA 1B0XA 1KFDA 1JN3A 4PL1A 4AYBC 2AQ0A 2IHMA 2KZZA 2Y1JA 5J2FA 1S8OA 3LVVA 4TQRA 2ISOA 4P4OA 1K1SA 5GTHU 1YZ7A 5KFWA 1IV8A 3BQ2A 4DOCA 5D4BA 5J0UA 1MC8A 5AKKA 4GXKA 1JXEA 1ZQRA 1ZD2P 4QZ9A 2P66A 4RT3A 1J2MA 4IL6U 3PY8A 3RAQA 3WKBA 2H3IA 4BXOA 1X40A 2JZBB 2ZUBA 1WUDA 2QB0A 2F76X 3H8MA 2PI4A 4Y2VA 1JROA 5D49A 5KFQA 4YMOA 1L7MA 1N63A 3TFRA 3GV7B 5DB9A 4ECYA 7ICSA 1L7NA 4DSFA 5ALHA 1Z3EB 3UMCA 3WKEA 5KTQA 5KFJA 4OJ5A 2FPKA 3R9KA 4QZGA 2AU0A 2YX8A 4Z6DA 5L9XA 2RRDA 4MFCA 1KFSA 1P7DA 1SIJA 2C22A 3SENA 2VA2A 2KE7A 4IQWA 1X2IA 3AQEA 3Q8MA 4B9MA 2NRWA 5KT7A 3Q8PB 4F4XA 1KL9A 4KX3A 4Y2PA 2G07A 3C1ZA 3C28A 3N7PD 3DEEA 4EX7A 3C2LA 1FFUA 4M9JA 2JH7A 3K4GA 3RR7A 3D2SA 5KNIA 2QARB 3V6HA 1ZQVA 4R63A 3M8RA 4F71A 7ICPA 3KFUF 2I9GA 8ICKA 5KFYA 1XO0A 5IIKA 4J9QA 1MA7A 5AK6A 2EZYA 2NRZA 2Y9UA 3B0XA 1A76A 5ALQA 2F1HA 3SR6A 1SL2A 4AP9A 5KFXA 3TAPA 1Z4NA 4NV0A 4BJQA 2D3DA 1ZQBA 2YMLA 3ORYA 9ICCA 4DSKA 1RYRA 5J2HA 2UVWA 2J6SA 5J8YC 4OCZA 3PZPA 3M1YA 3RJEA 3EWAA 1SV4A 2ZXIA 4ECWA 2G08A 3CRXA 4EYIB 4RPZA 4Q45A 2F77X 4JV0A 4QW8A 4UB1A 1N60A 2A3VA 1EXNA 5DBAA 4GLXA 4O5EA 1HEKA 3H8JA 4PPXA 4IC9A 4ED6A 2XGQA 8ICYA 1Q3VA 3QXGA 3E2EA 3QUBA 3UMGA 5J2JA 3NVWA 5DQHA 2H5XA 2B21A 1MQ3A 5FP0A 1IG6A 9ICWA 3HT3A 1ZJNA 4K4IA 5JUMA 2VIXA 1NNLA 4EBCA 3MR6A 2BCSA 4M47A 2JMGA 5KG4A 2AJQA 4ED2A 4IR9A 2DFLA 3GILA 3E58A 1NJYA 3PW0A 5CRXA 3SMVA 4M04A 1DGSA 4FS2A 2BHNA 2VJ4A 4QZDA 4YXMA 2MRLA 1NK7A 3KD3A 1IIPA 5DG7A 4DS5A 3K1RB 2BZFA 4EZ6A 1O03A 2WTFA 4DOAA 2RQ5A 4CF4A 1SWWA 4DSJA 2W9CA 1X9SA 3RBDA 4P0PB 1S0NA 2OYYA 2ZTEA 2OXOA 1JUDA 1NK4A 3NVVA 2YQEA 3SYZA 4NLKA 5J0SA 5J2KA 2E5SA 4F93B 1Q46A 3BZCA 3JPSA 2P6RA 2ZJ5A 2FI1A 4TURA 5AKEA 3T3FA 4TUQA 3EW9A 3WKCA 2NV3A 2HHWA 4ECTA 3ETRA 4IS7A 3SV4A 1DXSA 1NOMA 4KX5A 2XO7A 1ZQTA 3NGDA 1UPHA 4GIBA 2W11A 3Q8RB 4P0QB 4M9NA 4YD1A 1QQ5A 7ICJA 4EBEA 1U49A 2BDPA 1T94A 1KFTA 4RNNA 3KHHA 4UAVA 9ICJA 4XQ8A 3PW5A 4J03A 3KHLA 4RPYA 3ZI4A 1SL0A 1S97A 4R64A 4QNLA 1B4FA 1VJ5A 2FMPA 5AKHA 5IIOA 8ICXA 2PKEA 3TADC 3MR2A 1BVSA 4KLOA 5HMMA 1K5OA 1SL1A 2LHTA 1ZQXA 1SV0A 5AI5A 3JPNA 5KFKA 4LZDA 3QZ8A 2QKQA 3MGVA 2WAQF 1U9LA 5AI4A 7ICIA 3QX7A 4IRCA 2AGPA 4PHAA 3DV9A 4F5NA 4LJXA 2NRXA 4GFJA 5CHGA 1MQ2A 5HR7A 4I2FA 1Z19A 2XICA 2WFAA 1KDHA 3AN1A 5DLGA 4KLGA 7ICUA 2KP7A 4DF8A 9ICXA 4DFKA 3BDPA 1L8LA 4R65A 1KQQA 3GDXA 1J2NA 4A8EA 2BPGA 1NZPA 1JX4A 2XY5A 1ZQMA 2WB1C 1S0VA 2R8IA 3ZDAA 2HHQA 2C2RA 5J0YA 4Z6FA 9ICOA 4UAZA 3IV6A 1ZQAA 2KJ8A 1LV5A 1RM6C 1J97A 1X9XA 4DSLA 4UW9A 5AM2A 4QWAA 2G06A 3C5GA 3UPQA 4YCXA 4PH5A 3HPOA 3MGIA 5ALOA 2UVUA 1PVRA 4MF2A 3RR8A 4FZMA 4FZLA 1F0MA 4J9OA 4UATA 5KFMA 3G6VA 3PO5A 4NJ8A 4YQWA 4F4KA 5KT2A 2IMWP 3HW8A 4ECRA 1HIWA 3I1YA 4NWIA 5EWGA 2YTUA 5HNKA 3RB0A 1S10A 3NASA 4Y2XA 3KZXA 5B5EU 2FMSA 1BPZA 3LVWA 2YMPA 3E0FA 2AQ4A 5J0WA 3PW4A 4NM1A 7ICVA 1SZPA 1KBUA 4DQSA 2DUYA 3TACB 3N7RC 2IOFK 4I2EA 3BS5B 3ZD8A 9ICVA 3ALRA 4CNQA 4JWMA 4YMMA 1N5WA 4UAYA 4J9MA 3QUQA 4O3MA 4J9SA 3K75D 4C7YA 2XGPA 2KG5A 4BGDA 1X66A 3N97B 4P4MA 4ECQA 2RLTA 1BNPA 5J0QA 4DL5A 5AK3A 5KT6A 3MFHA 3T5JA 2ZIVB 5HHIA 2PMZF 4RNMA 1T4GA 2J6UA 4BDPA 4UB4A 3H0MB 2MSNA 3C1YA 4PGQA 2ASLA 3OHBA 1RPLA 3ISBA 3U26A 1ZRMA 4QJFB 4O3RA 2JZBA 3MDAA 3S6JA 2I5HA 5KG6A 3H4BA 5IIIA 2DF4B 1N5XA 1D9FA 3TKAA 1NZBA 4J9KA 3V72A 1VLBA 3HKZC 1A0PA 4OO1J 3ZDDA 5JRTA 4O9MA 4F5OA 3N4MB
chains in the Genus database with same CATH topology
2JV3A 2K60A 1OW5A 1SXDA 3BS7A 3TADC 2KSOA 2YTUA 1PK1B 2B6GA 3IDWA 1UQVA 2ES6A 2LPEA 1RG6A 2LMRA 1Z1VA 1SV0A 2E8OA 2QKQA 1V85A 2EAMA 2F3NA 1PK1A 2QARB 5KNIA 2EAOA 4NL9A 4RQNA 2E8NA 1B0XA 5L1MA 3K1RB 1JI7A 3TACB 4PZNA 2KIVA 2DKZA 2E8MA 1WWVA 3KKAC 2Y9UA 2QARA 3BS5B 1LKYB 5JRTA 5JU5A 1SGGA 2KG5A 1COKA 2QB0B 1X66A 2D3DA 2K4PA 3BS5A 1LKYA 2EAPA 5J8YC 1PK3A 1X40A 1SV4A 2QB0A 3BQ7A 5F3XB 3H8MA 3TADA 2D8CA 2QB1A 2F8KA 4IS7A 1KW4A 2DKXA 2GLEA 1V38A 4MHVA 2FE9A 2DL0A 1DXSA 3KKAA 2E8PA 2ESEA 1SV0C 2KMDA 1X9XA 2L5YA 4PZOA 1UCVA 2EANA 1B4FA 1SXEA 2Y9TA 4NL9C 2KSOB 5JTIA 3HILA 1F0MA 5J8YA 2F44A 1WWUA 3SENA 2KE7A 3SEIA 4NJ8A 1OXJA 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV3 A;  2K60 A;  1OW5 A;  1SXD A;  3BS7 A;  3TAD C;  2KSO A;  2YTU A;  1PK1 B;  2B6G A;  3IDW A;  1UQV A;  2ES6 A;  2LPE A;  1RG6 A;  2LMR A;  1Z1V A;  1SV0 A;  2E8O A;  2QKQ A;  1V85 A;  2EAM A;  2F3N A;  1PK1 A;  2QAR B;  5KNI A;  2EAO A;  4NL9 A;  4RQN A;  2E8N A;  1B0X A;  5L1M A;  3K1R B;  1JI7 A;  3TAC B;  4PZN A;  2KIV A;  2DKZ A;  2E8M A;  1WWV A;  3KKA C;  2Y9U A;  2QAR A;  3BS5 B;  1LKY B;  5JRT A;  5JU5 A;  1SGG A;  2KG5 A;  1COK A;  2QB0 B;  1X66 A;  2D3D A;  2K4P A;  3BS5 A;  1LKY A;  2EAP A;  5J8Y C;  1PK3 A;  1X40 A;  1SV4 A;  2QB0 A;  3BQ7 A;  5F3X B;  3H8M A;  3TAD A;  2D8C A;  2QB1 A;  2F8K A;  4IS7 A;  1KW4 A;  2DKX A;  2GLE A;  1V38 A;  4MHV A;  2FE9 A;  2DL0 A;  1DXS A;  3KKA A;  2E8P A;  2ESE A;  1SV0 C;  2KMD A;  1X9X A;  2L5Y A;  4PZO A;  1UCV A;  2EAN A;  1B4F A;  1SXE A;  2Y9T A;  4NL9 C;  2KSO B;  5JTI A;  3HIL A;  1F0M A;  5J8Y A;  2F44 A;  1WWU A;  3SEN A;  2KE7 A;  3SEI A;  4NJ8 A;  1OXJ A;  4RQM A; 
#chains in the Genus database with same CATH topology
 4ZH4 A;  2KN7 A;  4QIW C;  2JEG A;  4TUP A;  2YY6 A;  5ALI A;  2GWS A;  1ZET A;  2LKY A;  3JPR A;  1ZJM A;  3HJE A;  1RG6 A;  4QZ8 A;  2LMR A;  8ICZ A;  2KFZ A;  2FDR A;  1NJX A;  2KOB A;  2E1F A;  1TK5 A;  2FLL A;  5EWE A;  1OUQ A;  4DCC A;  3F2B A;  3LK9 A;  5KFC A;  4MFF A;  5KFE A;  4GXI A;  4FS1 A;  1ZQS A;  2QAR A;  2ASJ A;  3PSI A;  2EZX A;  3PST A;  2H3Q A;  2W43 A;  4KLS A;  1RQN A;  4KLM A;  3GIM A;  3IP4 B;  2IBK A;  1UT8 A;  4F2S A;  9ICU A;  5L1J A;  4Q44 A;  3A0H U;  3HWT A;  5AKI A;  1JRP A;  3SD7 A;  2ZUD A;  3BQ7 A;  3RJF A;  2BKE A;  3QNM A;  1NK0 A;  1RYU A;  5AI8 A;  4U6P A;  2GLE A;  3MR5 A;  8ICP A;  5HP4 A;  9ICQ A;  1TVA A;  5ALT A;  4YR0 A;  1VDV A;  3T5K A;  3HP6 A;  4B6J A;  5KFT A;  2KZ3 A;  5J2E A;  4O5K A;  4F2R A;  7ICM A;  1MN8 A;  1GO3 F;  4DQI A;  8ICE A;  2V4Q A;  4PZO A;  4ZOH C;  2DPJ A;  1JAL A;  3UQ2 A;  3WKD A;  3OGU A;  5DBB A;  2ATL A;  1L3S A;  4USA A;  3GV8 B;  2EZZ A;  2RP5 A;  5GTI U;  1RXW A;  5KG3 A;  3PR4 A;  4YXJ A;  3RH4 A;  3PX4 A;  4DSE A;  4RQM A;  1QSL A;  3BS7 A;  4US9 A;  4QZB A;  2AGO A;  3QU7 A;  3F53 A;  4O3S A;  9ICB A;  2C2E A;  2JEF A;  2VA8 A;  1TAU A;  3OHA A;  3MR3 A;  3PNC A;  1L3T A;  9ICI A;  4M0A A;  2Y0S C;  4O3N A;  4JMU A;  1WCL A;  1ZQH A;  2WHE A;  4I28 A;  5ALS A;  3QU4 A;  5ALU A;  2OCE A;  3OJU A;  3KHR A;  3CYM A;  3NVZ A;  1RQL A;  3AEV A;  3C23 A;  1ZQG A;  5KFO A;  5AHX A;  3BZK A;  2P35 A;  4GXJ A;  9ICS A;  1SKS A;  1QQ6 A;  8ICH A;  1BGX T;  4QWE A;  4I2G A;  4P0P A;  1TV9 A;  2BCU A;  4B9U A;  1CRX A;  2XVT A;  4F5R A;  4EZ9 A;  3VC8 A;  3WK6 A;  1ECW A;  3NVY A;  5EWF A;  4XUS A;  1V38 A;  4Y2S A;  2R8H A;  2FE9 A;  1KLN A;  3M9N B;  4I2B A;  5J0X A;  4YD2 A;  7ICR A;  5ALV A;  4KLJ A;  4QZE A;  2LYB A;  2ZTC A;  3CW2 C;  4NM2 A;  1IM4 A;  1D8B A;  4BX9 C;  2HCF A;  4NL9 C;  2KSO B;  4FZN A;  4JK1 A;  1A77 A;  3CP8 A;  2G09 A;  4ECS A;  2FPM A;  4P0Q A;  4NY8 A;  4NLC A;  1OXJ A;  2JV3 A;  2K60 A;  4J9P A;  1QQ7 A;  1T8E A;  4EEY A;  1S77 D;  2K4I A;  4NLN A;  4HYK A;  4F4W A;  2MUT B;  2ZXH A;  4NLB A;  5DGB A;  2ZIX B;  4C8N A;  2PFO A;  1JXL A;  5CP2 A;  1HUO A;  2BPF A;  2UVV A;  5KFS A;  4RQ2 A;  1JIH A;  1SKR A;  2OHF A;  2K4H A;  3PR5 B;  4MEY A;  5BPC A;  9ICA A;  4Y2Q A;  3RJH A;  4PJ0 U;  4O3P A;  4BUG A;  3H0R B;  3Q8L A;  2FPL A;  1U47 A;  5E79 U;  1ZQW A;  3T5L A;  5EE3 A;  1ZQC A;  2RHF A;  9ICP A;  5CR0 A;  2ZIW B;  3HX0 A;  3TAQ A;  3M6Z A;  2ISP A;  1MSW D;  3I28 A;  2EDU A;  2ASD A;  1COO A;  2GO7 A;  1B43 A;  5CA7 A;  4ELV A;  3PMN A;  1FO4 A;  5KG1 A;  4IQU A;  4RT2 A;  1ZQN A;  2DKX A;  1S0M A;  2DL0 A;  2FLN A;  4RZR A;  8ICW A;  4IQT A;  4ELU A;  2XY6 A;  2A1A A;  3IN5 A;  1B22 A;  8ICC A;  5CJ7 A;  5ALE A;  5HR6 A;  3WKA A;  2KD1 A;  1Z4O A;  2ZJA A;  1UCV A;  3JPO A;  2EAN A;  2Y9T A;  3H7I A;  4UB8 U;  1PUZ A;  1YZ6 A;  2JHD A;  2W7O A;  9ICG A;  4EEL A;  8ICQ A;  1WG8 A;  1NI3 A;  3D2Q A;  3M7D A;  3QU2 A;  2KHV A;  2NRV A;  3PSP A;  2PXI A;  7ICG A;  4I2I A;  3T79 A;  5AKL A;  2ES6 A;  4F4Y A;  4AYB F;  2ZIU B;  1KN5 A;  1T3Q A;  1FEZ A;  5ALW A;  3PV8 A;  1Z00 B;  4EBD A;  1Q8K A;  4F92 B;  1BPY A;  5A0L A;  2EQY A;  4UAR A;  4JB3 A;  2CPR A;  4YFK A;  5KFB A;  3QUC A;  1SB3 C;  2HBJ A;  4YN4 A;  1C20 A;  5ALR A;  4PGY A;  3FAH A;  1X42 A;  5KFU A;  4M2Y A;  9ICH A;  4CE6 A;  1URJ A;  2DKZ A;  2OEH A;  3KKA C;  4B9V A;  1RYS A;  3THV A;  1S9F A;  1SWV A;  5AKY A;  4F91 B;  5J29 A;  7ICN A;  3ZD9 A;  4UBB A;  1ZOL A;  5IIN A;  2W9A A;  2NO5 A;  3GV5 B;  3BS5 A;  2AXT U;  1C7Y A;  2EAP A;  4RU9 A;  3CNH A;  5KT5 A;  2W04 A;  5ALK A;  2HVH A;  2D6F C;  2HVI A;  1KTQ A;  5KL1 B;  4RPX A;  4ECV A;  3N28 A;  3RB6 A;  1FIQ A;  4Y2J A;  3A0B U;  2ZIV A;  5ALP A;  4US8 A;  4ED8 A;  1XSL A;  3G6Y A;  4KLH A;  1N61 A;  2Z7J A;  4JUZ A;  2LM4 A;  2W3S A;  3Q8Q B;  5DB6 A;  4QWB A;  1TFR A;  1WCN A;  5L1K A;  2JEI A;  4YVZ A;  2HOQ A;  3V6J A;  5JTI A;  1XSP A;  4CGZ A;  5J8Y A;  1WWU A;  3RTV A;  3QU9 A;  2GOL A;  3PVX A;  5DG9 A;  3WK4 A;  1S5L U;  1ZQY A;  4KMU A;  5KL8 B;  1ZYQ A;  5AKX A;  2BQR A;  3TQ1 A;  1UQV A;  2K8C B;  5DQI A;  5AM0 A;  1K1Q A;  4Q8F A;  8ICO A;  8ICV A;  7ICL A;  2E8O A;  8ICJ A;  4R66 A;  3FDS A;  1TAQ A;  9ICT A;  1HJP A;  4YMN A;  4QZI A;  3TFS A;  4Z6E A;  2K89 A;  5DG8 A;  5EE1 A;  1JI7 A;  5KAF U;  2R8G A;  4QZC A;  1U45 A;  1L3U A;  5H2F U;  2KIV A;  1CI4 A;  2E8M A;  3ETL A;  2GH1 A;  2W9B B;  2WF8 A;  4BWM A;  1LKY B;  3MDC A;  4C0Z A;  4IRD A;  4UQG A;  4OJL A;  2K4E A;  4DL7 A;  1KRP A;  3J81 j;  2VJ5 A;  2R8K A;  7ICE A;  4OJP A;  2N1R A;  2XCA A;  2OWO A;  3GU3 A;  3AUO A;  2OH2 A;  3SAG A;  3EYZ A;  1F44 A;  1L5U A;  2KJ5 A;  1L7O A;  3QZ7 A;  4DQQ A;  7ICO A;  4DO9 A;  1KW4 A;  2DWQ A;  2IA6 A;  1TE2 A;  5AM5 A;  1N48 A;  4O5C A;  5C0Y A;  1QTM A;  5ALD A;  2KVS A;  2W03 A;  2L5Y A;  4I2D A;  1YT3 A;  1Z1B A;  1AQ6 A;  3V7L A;  2BCV A;  4B9S A;  4G3I A;  5AIB A;  1XC9 A;  4C4R A;  1U4B A;  3HIL A;  3RJJ A;  2AGQ A;  5L1L A;  3LWL A;  2HHV A;  2AHO B;  4RQ5 A;  5AM3 A;  3SEI A;  4PHD A;  1BPX A;  2R18 A;  8ICT A;  4QZH A;  3M9O B;  1OW5 A;  1S76 D;  5KT4 A;  4F5Q A;  4LZG A;  1PK1 B;  3FYH A;  1QLN A;  4YP3 A;  8ICM A;  2IOF A;  3LDA A;  4J9N A;  4ECU A;  2HDO A;  3O0F A;  5KFF A;  1NKC A;  3I76 A;  1ZQE A;  3WU2 U;  4JWN A;  4G9B A;  4C8O A;  3OSP A;  1V85 A;  1TK0 A;  4NLG A;  1WYG A;  4Y2R A;  5BOM A;  1UHU A;  3L4P A;  1A6S A;  2E8N A;  2HOF A;  2XCP A;  1O08 A;  3ICX A;  4J9R A;  5AKJ A;  5KFA A;  3NRZ A;  2PFN A;  2XI9 A;  4KLQ A;  4MEX A;  3H0L B;  1D9D A;  3PW2 A;  4HAI A;  3JPP A;  4XA5 A;  4EX6 A;  5J2D A;  4YG2 A;  2UVR A;  1BNO A;  1BPD A;  1COK A;  4GC6 A;  4I2A A;  8ICR A;  2KZM A;  4DQP A;  2WF5 A;  1NK9 A;  3V7J A;  2VKQ A;  3F2C A;  4KMO B;  4XRH A;  4CRX A;  3GZF A;  5KG7 A;  2ODG A;  4PHP A;  3OSN A;  4KLF A;  5ALZ A;  2FJ6 A;  5DLF A;  2M0N A;  4ACO A;  2ESE A;  5J2A A;  1ZQZ A;  1CEZ A;  2H3V A;  2LI6 A;  3UXP A;  4M9G A;  3C21 A;  2WF6 A;  3L3F X;  1ZD3 A;  1V9P A;  1X9M A;  2JGA A;  1HUZ A;  2KJ9 A;  1SKW A;  3AM9 A;  8ICL A;  1XNS A;  2W55 A;  5ALY A;  2A1J B;  2F44 A;  4RQ0 A;  3UXO A;  3B0Y A;  3PW7 A;  3GIK A;  5ALX A;  4QW9 A;  2KSO A;  3RH5 A;  4FFD A;  3B9J A;  4UAU A;  2BQ3 A;  3PO4 A;  3V6K A;  2J6T A;  2BR0 A;  3GIJ A;  1D8Y A;  4UB2 A;  3RAX A;  2HHS A;  5ALL A;  5C5J A;  3SQI A;  2O6K A;  2EAO A;  2E3T A;  1L8O A;  2HHT A;  5KFR A;  2MUT A;  4RQ4 A;  2ZIX A;  5TIS U;  5AKZ A;  1WWV A;  2WAQ C;  4P2H A;  3RRG A;  4M6W B;  5DGA A;  4WJ3 B;  1BPE A;  1IXR A;  2NYV A;  2WB1 F;  4DFM A;  2F1I A;  5J2C A;  4DLG A;  9ICN A;  2A19 A;  5DB7 A;  5J2G A;  3ONN A;  4R8U B;  2HBK A;  4DFD A;  4DSI A;  2DQN B;  1ZD4 A;  5IIM A;  3F2D A;  2W8K A;  4DF4 A;  1PK3 A;  2ZIW A;  2G5I B;  1DRG A;  4UB3 A;  3M8S A;  2W54 A;  1ZQK A;  5KFP A;  4I2J A;  3QYP A;  2KIW A;  2Q4T A;  4C7Z A;  3IM1 A;  1LVH A;  1NJZ A;  4BWJ A;  4K4G A;  3RJG A;  3QUT A;  2LYA A;  9ICK A;  1XWL A;  5ALM A;  1ZQD A;  2E8P A;  3FC4 A;  2LBO A;  2YMQ A;  1NJW A;  3AMZ A;  4B9L A;  1SV0 C;  4DL4 A;  3SI8 A;  2KMD A;  7ICQ A;  5J2I A;  1L6N A;  5CWR A;  4QZF A;  2JEJ A;  1ZD5 A;  1F5S A;  3EPG A;  4ELT A;  1N62 A;  3GFK B;  2EH9 A;  1V97 A;  4CCH A;  1ZRN A;  5T14 A;  2DPI A;  3QU5 A;  5DDM A;  2Y1I A;  1X6J A;  3IG8 A;  4FBT A;  2W8L A;  1RXV A;  9ICE A;  3G6X A;  2ZTD A;  2MAX A;  3PX6 A;  1ZQJ A;  1XU4 A;  4Q8E A;  2HBL A;  4UB5 A;  2LPE A;  2JRZ A;  4F5P A;  1ZQF A;  1QSY A;  2KFN A;  4JV1 A;  3OTQ A;  3TAN A;  3RJK A;  3T5H A;  3SV3 A;  4DQR A;  2F2A B;  2ZIU A;  4KLL A;  3EUB 2;  5L1M A;  5J0R A;  4NLZ A;  3KBB A;  1ED1 A;  1XSN A;  4Y2U A;  3D2N A;  1Z00 A;  5KG5 A;  2MU2 A;  1NKB A;  4KTQ A;  2CXY A;  4KN4 A;  4DLE A;  4F3O A;  3Q8K A;  3TI0 A;  2IOH A;  2WF9 A;  1X9W A;  3KOO A;  3IHQ B;  4DFP A;  2LYH A;  5JU5 A;  2P6U A;  7ICK A;  1SGG A;  4BXO B;  4C8L A;  4MF8 A;  3KHG A;  2VA3 A;  2QB0 B;  4EYH B;  3C2K A;  3MBY A;  4C8M A;  2R8J A;  5IIL A;  3C5F A;  1NKE A;  3AU2 A;  4CF3 A;  2V9W A;  2C28 A;  5AK5 A;  4O0I A;  5AK4 A;  4RNO A;  4U7C A;  5AIA A;  1ZQU A;  4RQ1 A;  5EE9 A;  5J0T A;  7ICH A;  5F3X B;  5AI9 A;  3H40 A;  4DL2 A;  2QB1 A;  5ALJ A;  3PX0 A;  4ED1 A;  4MHV A;  1KEJ A;  5DDY A;  1T7P A;  3WK5 A;  9ICM A;  1Y88 A;  4B9T A;  2PMZ C;  3HKZ F;  3M9M B;  3EZ5 A;  4UBC A;  4QIW F;  1N56 A;  3LYS A;  3JPQ A;  4C8K A;  8ICA A;  2RDJ A;  2AH5 A;  5AM1 A;  2G5H B;  3ZDB A;  1ZQ1 C;  2M9N A;  3BQ1 A;  5F9L A;  4YR2 A;  2HI0 A;  2B6G A;  2NO4 A;  3IDW A;  2KEY A;  3F5E A;  5HHH A;  1L3V A;  4ED7 A;  2YB4 A;  4J9L A;  4DWI A;  2W7P A;  2K8B B;  3ZDC A;  2B0C A;  4F4Z A;  2BGW A;  4IRK A;  8ICN A;  3RB3 A;  5EOZ A;  1FFV A;  1TAM A;  3RRH A;  2Q0Z X;  2EAM A;  1ARO P;  4RQ6 A;  3RBE A;  2KKP A;  4O3O A;  4C80 A;  2V4R A;  4CF5 A;  5AIC A;  4CDG A;  5AKG A;  4Q43 A;  1L7P A;  4O3Q A;  1ZQL A;  1RZT A;  3QEA Z;  4RQ7 A;  4KLD A;  2H3Z A;  5DB8 A;  1PVP A;  2WF7 A;  5J0P A;  4Y2T A;  2F1J A;  5ALN A;  3OPX A;  4ED0 A;  4DFJ A;  5KFZ A;  4KLE A;  1KSP A;  3SAF A;  2NRT A;  2W9B A;  2K4P A;  1LKY A;  4ICA A;  2FMQ A;  1Q3U A;  5CEH A;  1DK2 A;  8ICF A;  4QWC A;  4KLU A;  5ALG A;  4F8R A;  9ICL A;  3SAH A;  2BPC A;  3H8W A;  2MA1 A;  1NK5 A;  5KFI A;  2D8C A;  2F8K A;  2HMX A;  3HRD D;  1TKD A;  5J2B A;  3UMB A;  3C2M A;  1QSS A;  5KT3 A;  3KTQ A;  3GQC A;  3KZI U;  3ISD A;  1DGJ A;  3RB4 A;  3MGH A;  4E0D A;  2RDI A;  4UAS A;  4C4T A;  5AI0 A;  5KG2 A;  1SXE A;  4GC7 A;  3RJI A;  2DGZ A;  2KHQ A;  4P4P A;  5G5G A;  1LB2 B;  3L5K A;  1TK8 A;  3IRU A;  4OJO A;  1SXD A;  2Y0S F;  4IQV A;  3GII A;  2BCQ A;  1ZQO A;  2PFP A;  2KTQ A;  1T3N A;  3IG5 A;  3VCB A;  1PVQ A;  1Z1V A;  2FLP A;  4QWD A;  3M6K A;  4I27 A;  1M6Y A;  4DOB A;  4DL6 A;  2W9M A;  4F72 A;  5DBC A;  4ECZ A;  1PK1 A;  2W9C B;  3MC1 A;  4NL9 A;  4ED3 A;  3AL0 B;  2XC9 A;  2HHX A;  4TUS A;  2PFQ A;  4JV2 A;  3DDH A;  4OD0 A;  2KV2 A;  3UQ0 A;  5DKW A;  2G0A A;  4DEZ A;  3UM9 A;  7ICF A;  3NTU A;  3ISC A;  4OJ6 A;  5DQG A;  3RF9 A;  2KNJ A;  3MFI A;  4ECX A;  2YB1 A;  2I6X A;  3NUQ A;  3JPT A;  3SZ2 A;  3AU6 A;  4KLT A;  4I29 A;  5TZV A;  1U48 A;  1DOQ A;  3PML A;  4M9L A;  3RFA A;  2CRX A;  4IR1 A;  2OM6 A;  3K1Z A;  1H38 A;  5L1I A;  4FE3 A;  1XS9 D;  1QCK A;  2F8L A;  4FBU A;  5KFD A;  4RQ8 A;  8ICI A;  4KN7 A;  4KIT B;  1XO1 A;  4DS4 A;  4RUA A;  2YMM A;  3UXN A;  2JH1 A;  2BQU A;  8ICG A;  3OJS A;  1D8L A;  2W3R A;  1QH9 A;  4RQ3 A;  2JR5 A;  4KLI A;  3RH6 A;  2HSZ A;  4RUC A;  5AM4 A;  3NS1 A;  3QE9 Y;  8ICS A;  5KG0 A;  2HW3 A;  5F9N A;  2C2D A;  5KFL A;  4M9H A;  3BJY A;  4I2H A;  3N7S C;  3FM9 A;  3TAR A;  2A1J A;  3H8S A;  2IHN A;  2K8A A;  4F50 A;  3V7K A;  1X6I A;  5KFG A;  2ZUC A;  2BCR A;  1ZQQ A;  4UAW A;  5K4L A;  5KFV A;  4RQN A;  1BPB A;  2KIC A;  5AI6 A;  3NRW A;  4YR3 A;  4PGX A;  1RDF A;  4PHE A;  2HBM A;  7ICT A;  4PZN A;  5G5H A;  4LVS A;  3ED5 A;  4PL2 A;  3WK7 A;  2XY7 A;  4B9N A;  2HHU A;  4QZA A;  3C29 A;  2E1E A;  1UT5 A;  5J0O A;  2KK0 A;  5KFH A;  2JXJ A;  2ALZ A;  2BDU A;  3H4D A;  1PZN A;  1ZXI A;  5EE0 A;  1N2X A;  4FO6 A;  4C4S A;  1UA0 A;  5KFN A;  4M6W A;  4X5V A;  1ZQI A;  2LM1 A;  2QLT A;  2I1Q A;  1NK8 A;  2CN1 A;  2H3F A;  3ZDE A;  5KAI U;  3LWM A;  3F5A A;  4R8U A;  3TAD A;  1SZH A;  5CB1 A;  4DL3 A;  2HOI A;  3KKA A;  1CUK A;  2XID A;  9ICF A;  3PSF A;  1KKX A;  1ZQP A;  2ZJ8 A;  8ICB A;  2VAN A;  4I2C A;  4EEN A;  4K4H A;  2KVC A;  3WK8 A;  1UA1 A;  3Q8S B;  4EEK A;  3WK9 A;  3BQT A;  2PI5 A;  4TQS A;  9ICR A;  5D46 A;  1JMS A;  4Y2Y A;  3AQF A;  2ZG6 A;  5ALF A;  4Z6C A;  3BQ0 A;  1S0O A;  3D6J A;  5IIJ A;  4UB6 U;  2KKV A;  3QEB Z;  5BOL A;  4NXZ A;  5B66 U;  1NK6 A;  5HML A;  3EPI A;  4MFA A;  8ICU A;  1DK3 A;  2F3N A;  3MAB A;  2YN4 A;  2DBY A;  1B0X A;  1KFD A;  1JN3 A;  4PL1 A;  4AYB C;  2AQ0 A;  2IHM A;  2KZZ A;  2Y1J A;  5J2F A;  1S8O A;  3LVV A;  4TQR A;  2ISO A;  4P4O A;  1K1S A;  5GTH U;  1YZ7 A;  5KFW A;  1IV8 A;  3BQ2 A;  4DOC A;  5D4B A;  5J0U A;  1MC8 A;  5AKK A;  4GXK A;  1JXE A;  1ZQR A;  1ZD2 P;  4QZ9 A;  2P66 A;  4RT3 A;  1J2M A;  4IL6 U;  3PY8 A;  3RAQ A;  3WKB A;  2H3I A;  4BXO A;  1X40 A;  2JZB B;  2ZUB A;  1WUD A;  2QB0 A;  2F76 X;  3H8M A;  2PI4 A;  4Y2V A;  1JRO A;  5D49 A;  5KFQ A;  4YMO A;  1L7M A;  1N63 A;  3TFR A;  3GV7 B;  5DB9 A;  4ECY A;  7ICS A;  1L7N A;  4DSF A;  5ALH A;  1Z3E B;  3UMC A;  3WKE A;  5KTQ A;  5KFJ A;  4OJ5 A;  2FPK A;  3R9K A;  4QZG A;  2AU0 A;  2YX8 A;  4Z6D A;  5L9X A;  2RRD A;  4MFC A;  1KFS A;  1P7D A;  1SIJ A;  2C22 A;  3SEN A;  2VA2 A;  2KE7 A;  4IQW A;  1X2I A;  3AQE A;  3Q8M A;  4B9M A;  2NRW A;  5KT7 A;  3Q8P B;  4F4X A;  1KL9 A;  4KX3 A;  4Y2P A;  2G07 A;  3C1Z A;  3C28 A;  3N7P D;  3DEE A;  4EX7 A;  3C2L A;  1FFU A;  4M9J A;  2JH7 A;  3K4G A;  3RR7 A;  3D2S A;  5KNI A;  2QAR B;  3V6H A;  1ZQV A;  4R63 A;  3M8R A;  4F71 A;  7ICP A;  3KFU F;  2I9G A;  8ICK A;  5KFY A;  1XO0 A;  5IIK A;  4J9Q A;  1MA7 A;  5AK6 A;  2EZY A;  2NRZ A;  2Y9U A;  3B0X A;  1A76 A;  5ALQ A;  2F1H A;  3SR6 A;  1SL2 A;  4AP9 A;  5KFX A;  3TAP A;  1Z4N A;  4NV0 A;  4BJQ A;  2D3D A;  1ZQB A;  2YML A;  3ORY A;  9ICC A;  4DSK A;  1RYR A;  5J2H A;  2UVW A;  2J6S A;  5J8Y C;  4OCZ A;  3PZP A;  3M1Y A;  3RJE A;  3EWA A;  1SV4 A;  2ZXI A;  4ECW A;  2G08 A;  3CRX A;  4EYI B;  4RPZ A;  4Q45 A;  2F77 X;  4JV0 A;  4QW8 A;  4UB1 A;  1N60 A;  2A3V A;  1EXN A;  5DBA A;  4GLX A;  4O5E A;  1HEK A;  3H8J A;  4PPX A;  4IC9 A;  4ED6 A;  2XGQ A;  8ICY A;  1Q3V A;  3QXG A;  3E2E A;  3QUB A;  3UMG A;  5J2J A;  3NVW A;  5DQH A;  2H5X A;  2B21 A;  1MQ3 A;  5FP0 A;  1IG6 A;  9ICW A;  3HT3 A;  1ZJN A;  4K4I A;  5JUM A;  2VIX A;  1NNL A;  4EBC A;  3MR6 A;  2BCS A;  4M47 A;  2JMG A;  5KG4 A;  2AJQ A;  4ED2 A;  4IR9 A;  2DFL A;  3GIL A;  3E58 A;  1NJY A;  3PW0 A;  5CRX A;  3SMV A;  4M04 A;  1DGS A;  4FS2 A;  2BHN A;  2VJ4 A;  4QZD A;  4YXM A;  2MRL A;  1NK7 A;  3KD3 A;  1IIP A;  5DG7 A;  4DS5 A;  3K1R B;  2BZF A;  4EZ6 A;  1O03 A;  2WTF A;  4DOA A;  2RQ5 A;  4CF4 A;  1SWW A;  4DSJ A;  2W9C A;  1X9S A;  3RBD A;  4P0P B;  1S0N A;  2OYY A;  2ZTE A;  2OXO A;  1JUD A;  1NK4 A;  3NVV A;  2YQE A;  3SYZ A;  4NLK A;  5J0S A;  5J2K A;  2E5S A;  4F93 B;  1Q46 A;  3BZC A;  3JPS A;  2P6R A;  2ZJ5 A;  2FI1 A;  4TUR A;  5AKE A;  3T3F A;  4TUQ A;  3EW9 A;  3WKC A;  2NV3 A;  2HHW A;  4ECT A;  3ETR A;  4IS7 A;  3SV4 A;  1DXS A;  1NOM A;  4KX5 A;  2XO7 A;  1ZQT A;  3NGD A;  1UPH A;  4GIB A;  2W11 A;  3Q8R B;  4P0Q B;  4M9N A;  4YD1 A;  1QQ5 A;  7ICJ A;  4EBE A;  1U49 A;  2BDP A;  1T94 A;  1KFT A;  4RNN A;  3KHH A;  4UAV A;  9ICJ A;  4XQ8 A;  3PW5 A;  4J03 A;  3KHL A;  4RPY A;  3ZI4 A;  1SL0 A;  1S97 A;  4R64 A;  4QNL A;  1B4F A;  1VJ5 A;  2FMP A;  5AKH A;  5IIO A;  8ICX A;  2PKE A;  3TAD C;  3MR2 A;  1BVS A;  4KLO A;  5HMM A;  1K5O A;  1SL1 A;  2LHT A;  1ZQX A;  1SV0 A;  5AI5 A;  3JPN A;  5KFK A;  4LZD A;  3QZ8 A;  2QKQ A;  3MGV A;  2WAQ F;  1U9L A;  5AI4 A;  7ICI A;  3QX7 A;  4IRC A;  2AGP A;  4PHA A;  3DV9 A;  4F5N A;  4LJX A;  2NRX A;  4GFJ A;  5CHG A;  1MQ2 A;  5HR7 A;  4I2F A;  1Z19 A;  2XIC A;  2WFA A;  1KDH A;  3AN1 A;  5DLG A;  4KLG A;  7ICU A;  2KP7 A;  4DF8 A;  9ICX A;  4DFK A;  3BDP A;  1L8L A;  4R65 A;  1KQQ A;  3GDX A;  1J2N A;  4A8E A;  2BPG A;  1NZP A;  1JX4 A;  2XY5 A;  1ZQM A;  2WB1 C;  1S0V A;  2R8I A;  3ZDA A;  2HHQ A;  2C2R A;  5J0Y A;  4Z6F A;  9ICO A;  4UAZ A;  3IV6 A;  1ZQA A;  2KJ8 A;  1LV5 A;  1RM6 C;  1J97 A;  1X9X A;  4DSL A;  4UW9 A;  5AM2 A;  4QWA A;  2G06 A;  3C5G A;  3UPQ A;  4YCX A;  4PH5 A;  3HPO A;  3MGI A;  5ALO A;  2UVU A;  1PVR A;  4MF2 A;  3RR8 A;  4FZM A;  4FZL A;  1F0M A;  4J9O A;  4UAT A;  5KFM A;  3G6V A;  3PO5 A;  4NJ8 A;  4YQW A;  4F4K A;  5KT2 A;  2IMW P;  3HW8 A;  4ECR A;  1HIW A;  3I1Y A;  4NWI A;  5EWG A;  2YTU A;  5HNK A;  3RB0 A;  1S10 A;  3NAS A;  4Y2X A;  3KZX A;  5B5E U;  2FMS A;  1BPZ A;  3LVW A;  2YMP A;  3E0F A;  2AQ4 A;  5J0W A;  3PW4 A;  4NM1 A;  7ICV A;  1SZP A;  1KBU A;  4DQS A;  2DUY A;  3TAC B;  3N7R C;  2IOF K;  4I2E A;  3BS5 B;  3ZD8 A;  9ICV A;  3ALR A;  4CNQ A;  4JWM A;  4YMM A;  1N5W A;  4UAY A;  4J9M A;  3QUQ A;  4O3M A;  4J9S A;  3K75 D;  4C7Y A;  2XGP A;  2KG5 A;  4BGD A;  1X66 A;  3N97 B;  4P4M A;  4ECQ A;  2RLT A;  1BNP A;  5J0Q A;  4DL5 A;  5AK3 A;  5KT6 A;  3MFH A;  3T5J A;  2ZIV B;  5HHI A;  2PMZ F;  4RNM A;  1T4G A;  2J6U A;  4BDP A;  4UB4 A;  3H0M B;  2MSN A;  3C1Y A;  4PGQ A;  2ASL A;  3OHB A;  1RPL A;  3ISB A;  3U26 A;  1ZRM A;  4QJF B;  4O3R A;  2JZB A;  3MDA A;  3S6J A;  2I5H A;  5KG6 A;  3H4B A;  5III A;  2DF4 B;  1N5X A;  1D9F A;  3TKA A;  1NZB A;  4J9K A;  3V72 A;  1VLB A;  3HKZ C;  1A0P A;  4OO1 J;  3ZDD A;  5JRT A;  4O9M A;  4F5O A;  3N4M B; 
#chains in the Genus database with same CATH homology
 2JV3 A;  2K60 A;  1OW5 A;  1SXD A;  3BS7 A;  3TAD C;  2KSO A;  2YTU A;  1PK1 B;  2B6G A;  3IDW A;  1UQV A;  2ES6 A;  2LPE A;  1RG6 A;  2LMR A;  1Z1V A;  1SV0 A;  2E8O A;  2QKQ A;  1V85 A;  2EAM A;  2F3N A;  1PK1 A;  2QAR B;  5KNI A;  2EAO A;  4NL9 A;  4RQN A;  2E8N A;  1B0X A;  5L1M A;  3K1R B;  1JI7 A;  3TAC B;  4PZN A;  2KIV A;  2DKZ A;  2E8M A;  1WWV A;  3KKA C;  2Y9U A;  2QAR A;  3BS5 B;  1LKY B;  5JRT A;  5JU5 A;  1SGG A;  2KG5 A;  1COK A;  2QB0 B;  1X66 A;  2D3D A;  2K4P A;  3BS5 A;  1LKY A;  2EAP A;  5J8Y C;  1PK3 A;  1X40 A;  1SV4 A;  2QB0 A;  3BQ7 A;  5F3X B;  3H8M A;  3TAD A;  2D8C A;  2QB1 A;  2F8K A;  4IS7 A;  1KW4 A;  2DKX A;  2GLE A;  1V38 A;  4MHV A;  2FE9 A;  2DL0 A;  1DXS A;  3KKA A;  2E8P A;  2ESE A;  1SV0 C;  2KMD A;  1X9X A;  2L5Y A;  4PZO A;  1UCV A;  2EAN A;  1B4F A;  1SXE A;  2Y9T A;  4NL9 C;  2KSO B;  5JTI A;  3HIL A;  1F0M A;  5J8Y A;  2F44 A;  1WWU A;  3SEN A;  2KE7 A;  3SEI A;  4NJ8 A;  1OXJ A;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...