3KKAA

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
DGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 1
total genus 19
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaA00
2Y9TA 2B6GA 2KIVA 4IS7A 5L1MA 2QKQA 1X40A 4PZNA 2EAMA 3SENA 1X9XA 2KSOA 2JV3A 1V38A 2K60A 5JU5A 2QB1A 2D3DA 2DKXA 5F3XB 1SXDA 2D8CA 2LMRA 3H8MA 2GLEA 2DL0A 3K1RB 4RQMA 2KMDA 1DXSA 4RQNA 1PK3A 5KNIA 1V85A 2L5YA 1WWUA 3IDWA 2QB0A 1KW4A 1OXJA 1SV4A 2K4PA 3BQ7A 4NJ8A 1X66A 1SV0C 3BS7A 4NL9C 3TADC 2E8OA 2YTUA 2ESEA 5J8YC 4MHVA 4NL9A 2FE9A 1UCVA 2E8NA 3BS5B 3BS5A 2F8KA 2QB0B 5JRTA 2F3NA 2F44A 1WWVA 1F0MA 3SEIA 2EAOA 2Y9UA 2DKZA 4PZOA 2E8MA 1B4FA 1B0XA 1RG6A 1SGGA 3HILA 5J8YA 1LKYA 2QARB 2QARA 2KE7A 2LPEA 3TACB 1SV0A 1JI7A 1PK1B 1PK1A 2EAPA 3TADA 1OW5A 3KKAC 2KSOB 1UQVA 2E8PA 1COKA 1SXEA 2EANA 1LKYB 5JTIA 1Z1VA 3KKAA 2ES6A 2KG5A
chains in the Genus database with same CATH superfamily
4YMMA 3HP6A 1KQQA 5L1IA 5AIAA 2MAXA 2HBMA 8ICUA 4Q43A 5ALGA 2GWSA 2JGAA 2KV2A 2IA6A 4BWJA 1FO4A 4HYKA 2I1QA 8ICGA 1B22A 1SXDA 2R8GA 2OEHA 8ICAA 4RNMA 2GLEA 4YXMA 3DEEA 4O3SA 1DXSA 5AM1A 3OGUA 8ICRA 3NRZA 4RQ4A 4LVSA 3PW5A 1QSLA 3QYPA 5C5JA 5J2AA 2KN7A 1D9FA 4KLSA 4BXOA 1NJYA 2MSNA 3C5GA 3ED5A 5KFKA 1UCVA 3C1YA 2WFAA 4JK1A 1BPZA 4DQIA 3RAQA 4DFKA 2ZIVB 1S5LU 3VC8A 4EEYA 4C8KA 4RQ0A 1QCKA 3NUQA 2FPLA 4R63A 2XCAA 4F2SA 4PHEA 3RJIA 2YMQA 1EXNA 5J8YA 1LKYA 3K4GA 3SYZA 3QU4A 9ICFA 4K4HA 2IBKA 3NGDA 4CF3A 2F8LA 2UVVA 2AHOB 1L3VA 2HHTA 1A6SA 2YMPA 5L1JA 4YMOA 4NLBA 3WKEA 5G5HA 4JB3A 2R18A 1Q8KA 2Y1IA 8ICWA 3IG8A 4UBBA 1L8LA 3OJSA 3HKZC 4UB6U 4FBUA 2LM4A 4FZLA 5CHGA 1ZQHA 4R8UB 3GV8B 4K4IA 2ASDA 4I2HA 1RYSA 1ZD4A 4RNNA 4XUSA 5KFTA 1WCNA 2WF9A 2LMRA 2DPIA 3RBEA 3GIJA 1T3NA 2VJ5A 5ALJA 3PX4A 1CUKA 4Z6FA 5KFPA 1SL2A 1VJ5A 4F4WA 2RRDA 5ALPA 4F92B 3EPGA 2K8AA 4RQNA 1JUDA 3RJKA 2JH1A 4B6JA 4EX7A 3MGHA 1F44A 1KW4A 2CXYA 2Q4TA 2LM1A 2PKEA 1O03A 2ZTCA 3CP8A 1ZOLA 5ALDA 4B9LA 4JWMA 4Y2SA 2KK0A 4FFDA 4TQSA 3HJEA 5AI5A 2ZIWA 4JV2A 2KHVA 1BVSA 2W54A 1S97A 2G0AA 2HMXA 4NM2A 2J6TA 9ICXA 2F3NA 2P66A 4EYIB 8ICFA 2KJ9A 2W04A 4I2IA 2W11A 1ZQNA 2HOQA 3FM9A 2XY5A 4IRCA 3F2CA 2DKZA 3E58A 5EE9A 5IIOA 1B0XA 1KL9A 2DGZA 4LJXA 3Q8QB 5CA7A 5KFHA 4DQPA 3KFUF 3LK9A 3KHHA 2LI6A 4CGZA 3TADA 1WG8A 7ICIA 4DSFA 3PW2A 4ZOHC 4OCZA 1OW5A 1TV9A 2ZTDA 3LVVA 4KLEA 2FPMA 4KX5A 5AKJA 1RZTA 1Y88A 1V9PA 2Y0SF 4BGDA 2W3SA 1J2NA 1S77D 2RQ5A 4FS1A 1SL0A 1YT3A 9ICEA 2W43A 2JRZA 5ALRA 3UQ2A 2ZIXB 3Q8MA 2JV3A 2BQUA 4YG2A 5IINA 1KFSA 2D6FC 8ICCA 4CE6A 2ZIWB 4C7YA 4IR9A 5L9XA 5DQIA 4XRHA 5AKGA 4F93B 1Z1BA 1OXJA 3WK7A 2AH5A 4QZCA 1A77A 2EQYA 4UB8U 4NLCA 4YR0A 3L4PA 1KFTA 5J29A 3QE9Y 1SZPA 2WF7A 1N5XA 4CDGA 5J8YC 4ECVA 1JN3A 4BXOB 4UBCA 3H4BA 2R8IA 2FE9A 9ICCA 2B0CA 1IV8A 2E8NA 3UXOA 4J9QA 1A76A 3BS5A 4R65A 1BPEA 1UHUA 3Q8PB 5DKWA 4QWDA 2GOLA 3FDSA 3OPXA 3GZFA 1JXLA 2ZTEA 2Y9UA 2IOFA 5KFZA 3UXNA 3RH4A 4RQ7A 3RJEA 3AU6A 1Z3EB 4IQUA 4RPXA 4UB4A 4YXJA 3V72A 4F5PA 1PVRA 4ELUA 3TANA 3B0YA 1RXWA 3NASA 3MFIA 2ZIXA 2XO7A 4DFDA 2WF8A 2VA3A 4YMNA 1ZQUA 2EANA 1S0VA 4USAA 5ALOA 3MDAA 3G6YA 3T5LA 4J9SA 1DK3A 1K1SA 2BCQA 4PZNA 4IR1A 4BUGA 2P6UA 3S6JA 2KZMA 1TAMA 1ZQJA 5KG4A 3J81j 5ALZA 3KOOA 2K60A 3C5FA 5DG9A 2WTFA 3JPSA 4C4RA 5AKYA 3NVZA 3PR5B 4F3OA 2JEFA 1XS9D 2B21A 2OCEA 1KN5A 2HHSA 1B43A 5ALUA 4MEXA 1U4BA 3IDWA 2AJQA 1ZETA 3LDAA 3MR2A 5G5GA 3PY8A 4ECTA 1K5OA 4QZHA 4M9NA 4NL9A 4DS4A 4DSKA 9ICJA 5KAIU 3JPNA 1F5SA 4C80A 1RYUA 1Q46A 3SQIA 3M9OB 5KL8B 1JMSA 3NS1A 1ZQXA 4UB2A 2NYVA 1HUOA 3LWMA 2QLTA 3GDXA 3ZDEA 5DBAA 4DS5A 1T3QA 2VJ4A 2RLTA 2YMMA 4UW9A 4ICAA 3H4DA 5CWRA 5KT6A 5KFAA 2EZZA 4UB1A 2JH7A 5HHIA 2KKVA 2H3QA 2Z7JA 3BJYA 5DQHA 4F4KA 3K75D 4C4SA 2PFPA 1ZD2P 2KJ5A 5CJ7A 3G6VA 2EAPA 1NJZA 4ED7A 4US9A 5KG1A 5ALHA 4NLKA 2A19A 3RFAA 4MFAA 2BGWA 4UASA 4RQ5A 3JPQA 2HHXA 3TFSA 4M2YA 4XQ8A 2XI9A 5AK3A 2ZIUB 2VIXA 1NOMA 3AUOA 3MR6A 4M04A 3RJHA 3RAXA 5AKIA 5E79U 3GILA 2KP7A 5JU5A 2HVHA 3MDCA 3QU9A 4QW9A 4C0ZA 4KLQA 1NK7A 1HIWA 2FLNA 3E0FA 3T3FA 9ICUA 2ZJAA 2BCRA 2EH9A 1Z19A 5TISU 1SV0C 2AGQA 5KFDA 1ZJNA 9ICHA 1NZPA 2E3TA 2HSZA 5HP4A 2C2EA 2ZG6A 3HT3A 1U49A 2ASJA 2ESEA 3DDHA 8ICNA 2W8KA 3Q8LA 2JZBA 4KLUA 9ICPA 5J0UA 3IV6A 1BPYA 2F44A 2YX8A 2NO5A 5AKKA 5AIBA 5J0PA 1F0MA 3SEIA 3OSNA 2AXTU 2GO7A 2H5XA 1SGGA 9ICLA 4QNLA 5DDYA 2KKPA 5ALQA 3N7PD 5AKHA 5ALWA 5AICA 3MABA 3WK6A 1Q3VA 4MFFA 2VA8A 2HVIA 1NJWA 1PK1B 5EE1A 1ZQKA 4R66A 4O5CA 1H38A 3KKAC 4FZNA 4IRDA 1CRXA 2HBJA 5AK4A 5ALLA 3M8RA 5DLFA 1ZQYA 3T79A 4KLJA 1TE2A 4DOCA 3QX7A 4IS7A 3D6JA 1X40A 3NVVA 4F91B 2I9GA 3CYMA 4BWMA 5KFQA 1O08A 3F53A 3PSTA 3BDPA 5GTIU 3SV4A 1ZQCA 4B9NA 1PZNA 1XO1A 3Q8SB 1DK2A 4DF4A 4Q8EA 3EYZA 8ICOA 4DO9A 5KTQA 1PK3A 5DB9A 1ZQSA 2NV3A 2PI5A 1L3SA 3C21A 4I2AA 2P6RA 1N5WA 3KD3A 4KLGA 3TADC 1UT8A 2E8OA 4EBDA 5KFSA 4DL3A 1RDFA 3BQ0A 3RBDA 4Z6DA 4QW8A 1TFRA 2G5HB 1MQ3A 4C8LA 4E0DA 4MFCA 4PL1A 1JROA 5AKZA 4PL2A 5ALTA 1N56A 4O3PA 1WWVA 4RU9A 2ZJ5A 3F2BA 2BZFA 4PGXA 4DSEA 3V7JA 1PVPA 4TUQA 9ICVA 3FC4A 2F77X 2KD1A 5ALYA 3SD7A 1NK9A 1ZQMA 5AM5A 4DEZA 4NXZA 2ZUBA 3CNHA 1PVQA 3RB3A 4Q44A 4Y2PA 2R8JA 1A0PA 1Z00A 2OM6A 2UVWA 1QQ5A 3CRXA 2E8PA 4DQSA 2K89A 1MC8A 3NTUA 1LKYB 2DQNB 5EE3A 4JWNA 3JPOA 4ED3A 2GH1A 1LV5A 2KIVA 3PV8A 3SI8A 8ICSA 4AYBC 3WK8A 2EAMA 4NY8A 2JR5A 4U6PA 3ALRA 2N1RA 2D8CA 1IG6A 2MRLA 3QXGA 2XGQA 3SR6A 3SAHA 3RJFA 1BGXT 3MFHA 1BPXA 4B9MA 3FYHA 3HRDD 2PMZC 2W9AA 3IN5A 5DGAA 3AU2A 4WJ3B 2BKEA 4IQTA 1BPDA 4DSLA 4I2CA 4I2GA 4MF8A 2RP5A 1S0OA 4J9LA 4FZMA 2J6SA 1VLBA 9ICOA 3HWTA 2PI4A 4QWBA 7ICQA 4DCCA 2MUTB 3PMLA 1U9LA 8ICEA 5KT2A 1C7YA 4F4XA 7ICFA 3QEAZ 5J2GA 4UAUA 2OXOA 1N62A 3UMBA 2W3RA 4YQWA 4F8RA 4MF2A 4UATA 5EOZA 5F9NA 4OJ6A 7ICUA 1PK1A 5J0OA 3LVWA 1K1QA 3RB4A 5HR7A 2I5HA 4F72A 4RT3A 4O3OA 1L7MA 1MSWD 5KFGA 2ALZA 4IC9A 2YMLA 4DFJA 2PFOA 4EELA 5ALMA 2KIWA 3M7DA 1SL1A 2QKQA 1L3TA 3A0HU 3UQ0A 4DL5A 4ED1A 1X9XA 1ZQRA 5AKLA 2HHQA 2WHEA 2KNJA 4CF4A 4K4GA 1DOQA 2F76X 5J2HA 3MGIA 3H8MA 5DB7A 5GTHU 4RQMA 2ASLA 5DG8A 4J9NA 4BJQA 3ISBA 2DF4B 2L5YA 5AM4A 3WKBA 3WK9A 4P0PB 2NRWA 4GXIA 4KLLA 7ICJA 2PMZF 4MEYA 4P0QA 1JALA 1T94A 4O0IA 1ZQFA 3FAHA 3IHQB 3M6KA 4EYHB 2K4HA 1QSSA 2ISPA 3UMCA 1ZQBA 1L8OA 5JUMA 1NI3A 2C2RA 2K4IA 1S10A 2NRTA 5J2CA 2QB0B 3QUQA 4ECXA 9ICQA 2UVRA 2RDIA 4O3MA 3H8JA 2PXIA 1U47A 2E8MA 2IHNA 5J2JA 1SIJA 1VDVA 4I2EA 4DL2A 3M9MB 4Z6CA 5HNKA 3THVA 2KE7A 5BOMA 2KFNA 3PNCA 3I1YA 2XGPA 3M6ZA 5AKEA 1X9SA 2WAQC 2FMQA 4O3NA 4RPYA 4ECZA 4RUCA 1U45A 1N63A 3H8WA 3RR8A 3IP4B 3NRWA 1QH9A 3F5EA 3GIKA 4O9MA 5AI0A 4HAIA 2Y9TA 1ZYQA 1NK6A 2DPJA 5K4LA 5DLGA 5KT3A 3RTVA 2HI0A 1HEKA 1N2XA 3PSIA 3L3FX 1ZRMA 5T14A 2NO4A 5KFFA 1HJPA 4O3RA 1V38A 3TAPA 5ALKA 2BPFA 2QB1A 2DKXA 1AQ6A 5J0RA 2R8HA 1UT5A 4EEKA 5J2IA 3ISCA 2A1AA 4QJFB 1MA7A 5KFUA 3SV3A 2XVTA 1MQ2A 4DSJA 5KNIA 5KG3A 2JEGA 7ICVA 1SKRA 5DQGA 2YB1A 5AK5A 3ZDDA 2W9CB 1FFVA 1N61A 4RQ2A 5C0YA 4DF8A 5EWFA 3PW7A 4Y2JA 4IQVA 4JMUA 1QTMA 4IL6U 5J0TA 8ICQA 4YD1A 4TQRA 5ALSA 3QU2A 1KSPA 7ICHA 5JRTA 2JHDA 5ALEA 1CEZA 4C4TA 2Y0SC 2JXJA 4TUSA 2MUTA 5L1KA 2M9NA 2EZYA 2RDJA 4IQWA 2K8CB 5J0QA 3VCBA 2RHFA 3EZ5A 3WU2U 4F4ZA 5KT5A 1MN8A 4PJ0U 3UMGA 3V6HA 2PFQA 3JPRA 3H40A 5J2DA 2JEJA 4QWAA 4GLXA 2BPCA 2F2AB 3KTQA 2KVSA 2H3FA 9ICSA 2FI1A 3T5JA 1SKWA 2V4QA 4YR3A 4M47A 4DFMA 2KTQA 3IM1A 3TARA 1ZQOA 4I29A 3A0BU 1L6NA 5CP2A 2ZXIA 1V97A 5DBBA 1NK8A 3TI0A 4Y2RA 3OHAA 1ZQEA 8ICVA 3N28A 4LZGA 2K4EA 1JXEA 1IXRA 2EDUA 1RYRA 5F3XB 8ICYA 2Y1JA 3QEBZ 3EW9A 1TK0A 5ALIA 5H2FU 4RQ8A 3ZDAA 4I2JA 4M6WA 1WWUA 4F4YA 3QNMA 4EBEA 5KG5A 4P4MA 3RH5A 1X66A 4GC6A 1ZQDA 3BS7A 1NK0A 2W55A 4YN4A 4P0QB 7ICKA 5KFXA 1UA0A 2XICA 5KFLA 4M0AA 1ZXIA 4RQ6A 1NKBA 3HW8A 1GO3F 3MGVA 4NM1A 2XY7A 3SAFA 2EZXA 2DWQA 5IIMA 1P7DA 4F71A 1ZQVA 5ALFA 3D2SA 4F50A 1L7OA 4YD2A 4O5KA 2AGOA 2BCSA 3D2QA 3PSPA 2IMWP 3PR4A 1PUZA 1RG6A 2IOFK 3O0FA 4ECWA 4DL4A 5D49A 3OHBA 4Y2VA 2QARB 5AM3A 1J2MA 5IIIA 2HBKA 4DOBA 1JI7A 5AI4A 1KRPA 2H3ZA 2W7OA 3WK5A 3N97B 5KAFU 3EWAA 4GC7A 4C8NA 8ICHA 3KHLA 3H0LB 2E1FA 4Q45A 4KLFA 1SZHA 1Z4NA 2ES6A 2HBLA 2BDUA 3T5KA 1HUZA 1WUDA 1ZD5A 4I27A 9ICGA 2JEIA 9ICIA 5L1LA 3H7IA 3MC1A 4F5OA 1Q3UA 4RT2A 2ZUCA 3SENA 2O6KA 1BPBA 2KOBA 4Y2UA 1FEZA 2C2DA 2KSOA 3H0MB 5KFOA 2M0NA 4QZ8A 1KDHA 1KTQA 1RQLA 3C23A 5DB8A 4B9TA 3NVYA 3PZPA 8ICIA 3R9KA 2DUYA 1T8EA 7ICMA 5KFRA 3QUBA 4QZGA 3KHRA 2ODGA 4J9KA 4G3IA 2BCUA 1S9FA 3SZ2A 5J2BA 4NLGA 2CN1A 4GXKA 2BR0A 3AQEA 2JZBB 2A1JA 4F5RA 1OUQA 4C7ZA 3BS5B 1ZRNA 4OO1J 3KHGA 3V7KA 4I28A 9ICWA 1L5UA 4F2RA 2V4RA 5BOLA 4NLNA 4KN4A 2FDRA 2YB4A 3ICXA 1XO0A 5J2EA 1URJA 2DBYA 1NZBA 3AM9A 5J2FA 2G09A 3BZKA 2FLPA 1NK4A 2IHMA 1KBUA 4KX3A 3ISDA 1ZQQA 2W03A 4DOAA 4R64A 4DL7A 5J0XA 3EUB2 2KZZA 5KFCA 5AM0A 2KSOB 4FO6A 3IG5A 3F5AA 2KFZA 2WB1F 1X9WA 4DLGA 1FIQA 1J97A 3QZ7A 5EWGA 5KFVA 3M1YA 4F5QA 3KBBA 1LVHA 7ICOA 3ZD8A 3V7LA 4J9OA 4R8UA 4KLMA 3AN1A 4KN7A 1NK5A 5HMMA 2VA2A 4QWEA 4A8EA 3TQ1A 4UB5A 2FJ6A 3UPQA 4BX9C 1QSYA 1YZ6A 3MR5A 2ATLA 1ZQZA 4P2HA 2XCPA 4KLIA 2C28A 5AK6A 7ICNA 1SV4A 2LBOA 4GIBA 2BDPA 3UXPA 5HHHA 1JX4A 3ZDBA 3QU7A 4NL9C 4EZ6A 4RQ1A 3U26A 2YTUA 4YVZA 4EENA 2HHVA 3ZI4A 4PHPA 5KG7A 2I6XA 5KT4A 3ETLA 4M9LA 4Q8FA 4OJLA 1NKCA 1L3UA 2OH2A 4PGYA 3RJJA 2F8KA 7ICEA 1CI4A 2OWOA 3WKCA 5KFJA 4PHDA 2EAOA 3LWLA 2W9BB 5AI9A 4YFKA 3BQ2A 1L7PA 2QARA 2F1IA 4AP9A 3PW0A 5D4BA 2CPRA 3JPPA 1QQ6A 5ALNA 3V6JA 7ICTA 2G5IB 2ZJ8A 2KHQA 3QZ8A 5AHXA 4UB3A 2IOHA 3V6KA 4ELTA 2H3VA 3L5KA 4OJ5A 4ECYA 1SXEA 4QIWF 5DDMA 9ICTA 2LYBA 4DL6A 5HMLA 4CNQA 2ZIUA 8ICPA 3ZDCA 5J2KA 4NV0A 2XY6A 1ZQWA 4FE3A 1UA1A 3C28A 3ORYA 4UAZA 2BCVA 4RZRA 4YP3A 4B9SA 4M9JA 4TUPA 4GFJA 2VANA 5KFNA 4ELVA 4QZEA 4DSIA 1KFDA 4Y2TA 4B9UA 3PSFA 3GIMA 3D2NA 2W8LA 2K8BB 2KMDA 4C8MA 1XSPA 3DV9A 2QB0A 1XSNA 5FP0A 3G6XA 2W7PA 5CRXA 8ICLA 3KZIU 2WF5A 5DGBA 3GQCA 3M9NB 5DG7A 4OJOA 4I2DA 3RH6A 3C1ZA 4JV1A 2NRVA 3C2KA 4KMUA 4KMOB 5EWEA 2OYYA 1FFUA 1X6JA 1ZD3A 5KFBA 5KG2A 4PH5A 1LB2B 4M9HA 4QZAA 2JMGA 3HX0A 5IIJA 2H3IA 5AI6A 2FMSA 3C2MA 2V9WA 1KLNA 1S76D 2KICA 4RUAA 9ICKA 2VKQA 3AMZA 3IRUA 2HCFA 1RM6C 2LPEA 2FPKA 4DQRA 5IIKA 1X9MA 5AI8A 5J0SA 2MA1A 1IM4A 1XNSA 2LYAA 3PW4A 3AQFA 4ECUA 2W9BA 5BPCA 1ZQAA 4QZIA 1COKA 3H8SA 4ED6A 4ECRA 2LYHA 1QLNA 3KKAA 2BQ3A 5EE0A 1KKXA 2HW3A 1NNLA 2B6GA 4OD0A 3BQTA 3UM9A 4DWIA 5L1MA 8ICKA 2NRXA 3N4MB 1D8YA 1WYGA 4GXJA 5J0YA 5KFWA 3WKAA 4Y2XA 1XC9A 1XSLA 8ICJA 4TURA 1ZQTA 1T7PA 4KLDA 8ICBA 4DQQA 5KFYA 1AROP 3RB6A 4PPXA 1ZQIA 2E1EA 2J6UA 1DGJA 1RXVA 2W9MA 4EBCA 4MHVA 3NVWA 5HR6A 1RQNA 3K1ZA 4ACOA 2ZUDA 3MBYA 3GIIA 1NKEA 2ISOA 4CRXA 4O5EA 4UAWA 4Y2YA 3I28A 3Q8RB 7ICGA 5TZVA 1UPHA 4U7CA 4EZ9A 7ICPA 2W9CA 3I76A 3PX0A 1TAUA 3QUCA 4J9MA 3GV5B 1S0NA 1JIHA 8ICXA 4C8OA 3SMVA 1X2IA 3HPOA 1S0MA 5AKXA 3GV7B 4I2BA 2LHTA 1SV0A 4RNOA 1L7NA 1ZQLA 4RPZA 3BZCA 4J9PA 2AQ0A 1Z00B 4ZH4A 3PX6A 4EX6A 3RRHA 3E2EA 5JTIA 4P4PA 4QZ9A 3AL0B 3RB0A 4Y2QA 5KT7A 2OHFA 5ALVA 1M6YA 2R8KA 1X6IA 4KTQA 3PMNA 4ED2A 7ICRA 3Q8KA 5KL1B 2FLLA 4XA5A 4BDPA 2UVUA 4YR2A 2HHWA 4ECSA 3PVXA 5CEHA 1JRPA 4IRKA 2D3DA 4LZDA 4F5NA 4JUZA 4Z6EA 3T5HA 3K1RB 2AQ4A 3PO5A 4UAVA 1DGSA 3B0XA 4G9BA 4US8A 4QZBA 3GFKB 3ONNA 2YY6A 4KLOA 3RJGA 2C22A 3PO4A 2HOIA 1D8LA 2WF6A 3JPTA 1TK5A 7ICLA 2WB1C 3TFRA 5DBCA 8ICTA 1WCLA 4NLZA 3ETRA 1YZ7A 1NJXA 4CCHA 4QZFA 1ED1A 8ICMA 4M6WB 3BQ1A 3HKZF 3GU3A 4P4OA 3RF9A 3OJUA 5KFIA 4JV0A 2XIDA 4FS2A 1IIPA 1ZQ1C 3RRGA 1T4GA 1S8OA 1C20A 1COOA 5A0LA 2BHNA 3ZD9A 4DFPA 9ICAA 3QUTA 1BNOA 3OSPA 1ZQPA 4PHAA 3SAGA 2P35A 1XWLA 1D9DA 3CW2C 2F1HA 9ICRA 2A3VA 4ED8A 5D46A 2AU0A 4QWCA 1SKSA 5IILA 3KZXA 2HOFA 2G08A 3RR7A 4KLTA 3WK4A 2KG5A 2G06A 2CRXA 4UARA 1SWWA 1Z4OA 1ZJMA 4UQGA 3LYSA 3M8SA 3TAQA 4AYBF 5J0WA 4M9GA 9ICBA 4ED0A 4J03A 5KG0A 5AM2A 3QU5A 5CR0A 3AEVA 2AGPA 1TAQA 2PFNA 5KFEA 5KG6A 5DB6A 1X42A 2ZXHA 1DRGA 2KZ3A 2YN4A 1SWVA 3B9JA 4RQ3A 1BNPA 2DL0A 2A1JB 5KFMA 3EPIA 2MU2A 2HHUA 2BPGA 4YCXA 4QIWC 1V85A 1QQ7A 2K4PA 4P0PA 2E5SA 2ZIVA 3BQ7A 4NJ8A 4PGQA 7ICSA 2KJ8A 9ICMA 2KVCA 1TVAA 1TKDA 1RPLA 2BQRA 4DLEA 3F2DA 3MR3A 5CB1A 1ECWA 1SB3C 2Q0ZX 4KITB 2FMPA 3N7SC 4QZDA 1N48A 1TK8A 4CF5A 3OTQA 4NWIA 5B5EU 2F1JA 4PZOA 1B4FA 8ICZA 3HILA 5F9LA 2NRZA 2WAQF 4O3QA 1XU4A 1KEJA 4UAYA 3H0RB 3TACB 2LKYA 4B9VA 2G07A 2XC9A 9ICNA 4X5VA 2YQEA 2HDOA 3C2LA 3TKAA 4I2FA 4OJPA 2KEYA 3WKDA 1ZQGA 4FBTA 3C29A 5ALXA 1UQVA 4ECQA 4J9RA 1U48A 1D8BA 4KLHA 2DFLA 5B66U 1Z1VA 3N7RC 1N60A
chains in the Genus database with same CATH topology
2Y9TA 2B6GA 2KIVA 4IS7A 5L1MA 2QKQA 1X40A 4PZNA 2EAMA 3SENA 1X9XA 2KSOA 2JV3A 1V38A 2K60A 5JU5A 2QB1A 2D3DA 2DKXA 5F3XB 1SXDA 2D8CA 2LMRA 3H8MA 2GLEA 2DL0A 3K1RB 4RQMA 2KMDA 1DXSA 4RQNA 1PK3A 5KNIA 1V85A 2L5YA 1WWUA 3IDWA 2QB0A 1KW4A 1OXJA 1SV4A 2K4PA 3BQ7A 4NJ8A 1X66A 1SV0C 3BS7A 4NL9C 3TADC 2E8OA 2YTUA 2ESEA 5J8YC 4MHVA 4NL9A 2FE9A 1UCVA 2E8NA 3BS5B 3BS5A 2F8KA 2QB0B 5JRTA 2F3NA 2F44A 1WWVA 1F0MA 3SEIA 2EAOA 2Y9UA 2DKZA 4PZOA 2E8MA 1B4FA 1B0XA 1RG6A 1SGGA 3HILA 5J8YA 1LKYA 2QARB 2QARA 2KE7A 2LPEA 3TACB 1SV0A 1JI7A 1PK1B 1PK1A 2EAPA 3TADA 1OW5A 3KKAC 2KSOB 1UQVA 2E8PA 1COKA 1SXEA 2EANA 1LKYB 5JTIA 1Z1VA 3KKAA 2ES6A 2KG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y9T A;  2B6G A;  2KIV A;  4IS7 A;  5L1M A;  2QKQ A;  1X40 A;  4PZN A;  2EAM A;  3SEN A;  1X9X A;  2KSO A;  2JV3 A;  1V38 A;  2K60 A;  5JU5 A;  2QB1 A;  2D3D A;  2DKX A;  5F3X B;  1SXD A;  2D8C A;  2LMR A;  3H8M A;  2GLE A;  2DL0 A;  3K1R B;  4RQM A;  2KMD A;  1DXS A;  4RQN A;  1PK3 A;  5KNI A;  1V85 A;  2L5Y A;  1WWU A;  3IDW A;  2QB0 A;  1KW4 A;  1OXJ A;  1SV4 A;  2K4P A;  3BQ7 A;  4NJ8 A;  1X66 A;  1SV0 C;  3BS7 A;  4NL9 C;  3TAD C;  2E8O A;  2YTU A;  2ESE A;  5J8Y C;  4MHV A;  4NL9 A;  2FE9 A;  1UCV A;  2E8N A;  3BS5 B;  3BS5 A;  2F8K A;  2QB0 B;  5JRT A;  2F3N A;  2F44 A;  1WWV A;  1F0M A;  3SEI A;  2EAO A;  2Y9U A;  2DKZ A;  4PZO A;  2E8M A;  1B4F A;  1B0X A;  1RG6 A;  1SGG A;  3HIL A;  5J8Y A;  1LKY A;  2QAR B;  2QAR A;  2KE7 A;  2LPE A;  3TAC B;  1SV0 A;  1JI7 A;  1PK1 B;  1PK1 A;  2EAP A;  3TAD A;  1OW5 A;  3KKA C;  2KSO B;  1UQV A;  2E8P A;  1COK A;  1SXE A;  2EAN A;  1LKY B;  5JTI A;  1Z1V A;  3KKA A;  2ES6 A;  2KG5 A; 
#chains in the Genus database with same CATH topology
 4YMM A;  3HP6 A;  1KQQ A;  5L1I A;  5AIA A;  2MAX A;  2HBM A;  8ICU A;  4Q43 A;  5ALG A;  2GWS A;  2JGA A;  2KV2 A;  2IA6 A;  4BWJ A;  1FO4 A;  4HYK A;  2I1Q A;  8ICG A;  1B22 A;  1SXD A;  2R8G A;  2OEH A;  8ICA A;  4RNM A;  2GLE A;  4YXM A;  3DEE A;  4O3S A;  1DXS A;  5AM1 A;  3OGU A;  8ICR A;  3NRZ A;  4RQ4 A;  4LVS A;  3PW5 A;  1QSL A;  3QYP A;  5C5J A;  5J2A A;  2KN7 A;  1D9F A;  4KLS A;  4BXO A;  1NJY A;  2MSN A;  3C5G A;  3ED5 A;  5KFK A;  1UCV A;  3C1Y A;  2WFA A;  4JK1 A;  1BPZ A;  4DQI A;  3RAQ A;  4DFK A;  2ZIV B;  1S5L U;  3VC8 A;  4EEY A;  4C8K A;  4RQ0 A;  1QCK A;  3NUQ A;  2FPL A;  4R63 A;  2XCA A;  4F2S A;  4PHE A;  3RJI A;  2YMQ A;  1EXN A;  5J8Y A;  1LKY A;  3K4G A;  3SYZ A;  3QU4 A;  9ICF A;  4K4H A;  2IBK A;  3NGD A;  4CF3 A;  2F8L A;  2UVV A;  2AHO B;  1L3V A;  2HHT A;  1A6S A;  2YMP A;  5L1J A;  4YMO A;  4NLB A;  3WKE A;  5G5H A;  4JB3 A;  2R18 A;  1Q8K A;  2Y1I A;  8ICW A;  3IG8 A;  4UBB A;  1L8L A;  3OJS A;  3HKZ C;  4UB6 U;  4FBU A;  2LM4 A;  4FZL A;  5CHG A;  1ZQH A;  4R8U B;  3GV8 B;  4K4I A;  2ASD A;  4I2H A;  1RYS A;  1ZD4 A;  4RNN A;  4XUS A;  5KFT A;  1WCN A;  2WF9 A;  2LMR A;  2DPI A;  3RBE A;  3GIJ A;  1T3N A;  2VJ5 A;  5ALJ A;  3PX4 A;  1CUK A;  4Z6F A;  5KFP A;  1SL2 A;  1VJ5 A;  4F4W A;  2RRD A;  5ALP A;  4F92 B;  3EPG A;  2K8A A;  4RQN A;  1JUD A;  3RJK A;  2JH1 A;  4B6J A;  4EX7 A;  3MGH A;  1F44 A;  1KW4 A;  2CXY A;  2Q4T A;  2LM1 A;  2PKE A;  1O03 A;  2ZTC A;  3CP8 A;  1ZOL A;  5ALD A;  4B9L A;  4JWM A;  4Y2S A;  2KK0 A;  4FFD A;  4TQS A;  3HJE A;  5AI5 A;  2ZIW A;  4JV2 A;  2KHV A;  1BVS A;  2W54 A;  1S97 A;  2G0A A;  2HMX A;  4NM2 A;  2J6T A;  9ICX A;  2F3N A;  2P66 A;  4EYI B;  8ICF A;  2KJ9 A;  2W04 A;  4I2I A;  2W11 A;  1ZQN A;  2HOQ A;  3FM9 A;  2XY5 A;  4IRC A;  3F2C A;  2DKZ A;  3E58 A;  5EE9 A;  5IIO A;  1B0X A;  1KL9 A;  2DGZ A;  4LJX A;  3Q8Q B;  5CA7 A;  5KFH A;  4DQP A;  3KFU F;  3LK9 A;  3KHH A;  2LI6 A;  4CGZ A;  3TAD A;  1WG8 A;  7ICI A;  4DSF A;  3PW2 A;  4ZOH C;  4OCZ A;  1OW5 A;  1TV9 A;  2ZTD A;  3LVV A;  4KLE A;  2FPM A;  4KX5 A;  5AKJ A;  1RZT A;  1Y88 A;  1V9P A;  2Y0S F;  4BGD A;  2W3S A;  1J2N A;  1S77 D;  2RQ5 A;  4FS1 A;  1SL0 A;  1YT3 A;  9ICE A;  2W43 A;  2JRZ A;  5ALR A;  3UQ2 A;  2ZIX B;  3Q8M A;  2JV3 A;  2BQU A;  4YG2 A;  5IIN A;  1KFS A;  2D6F C;  8ICC A;  4CE6 A;  2ZIW B;  4C7Y A;  4IR9 A;  5L9X A;  5DQI A;  4XRH A;  5AKG A;  4F93 B;  1Z1B A;  1OXJ A;  3WK7 A;  2AH5 A;  4QZC A;  1A77 A;  2EQY A;  4UB8 U;  4NLC A;  4YR0 A;  3L4P A;  1KFT A;  5J29 A;  3QE9 Y;  1SZP A;  2WF7 A;  1N5X A;  4CDG A;  5J8Y C;  4ECV A;  1JN3 A;  4BXO B;  4UBC A;  3H4B A;  2R8I A;  2FE9 A;  9ICC A;  2B0C A;  1IV8 A;  2E8N A;  3UXO A;  4J9Q A;  1A76 A;  3BS5 A;  4R65 A;  1BPE A;  1UHU A;  3Q8P B;  5DKW A;  4QWD A;  2GOL A;  3FDS A;  3OPX A;  3GZF A;  1JXL A;  2ZTE A;  2Y9U A;  2IOF A;  5KFZ A;  3UXN A;  3RH4 A;  4RQ7 A;  3RJE A;  3AU6 A;  1Z3E B;  4IQU A;  4RPX A;  4UB4 A;  4YXJ A;  3V72 A;  4F5P A;  1PVR A;  4ELU A;  3TAN A;  3B0Y A;  1RXW A;  3NAS A;  3MFI A;  2ZIX A;  2XO7 A;  4DFD A;  2WF8 A;  2VA3 A;  4YMN A;  1ZQU A;  2EAN A;  1S0V A;  4USA A;  5ALO A;  3MDA A;  3G6Y A;  3T5L A;  4J9S A;  1DK3 A;  1K1S A;  2BCQ A;  4PZN A;  4IR1 A;  4BUG A;  2P6U A;  3S6J A;  2KZM A;  1TAM A;  1ZQJ A;  5KG4 A;  3J81 j;  5ALZ A;  3KOO A;  2K60 A;  3C5F A;  5DG9 A;  2WTF A;  3JPS A;  4C4R A;  5AKY A;  3NVZ A;  3PR5 B;  4F3O A;  2JEF A;  1XS9 D;  2B21 A;  2OCE A;  1KN5 A;  2HHS A;  1B43 A;  5ALU A;  4MEX A;  1U4B A;  3IDW A;  2AJQ A;  1ZET A;  3LDA A;  3MR2 A;  5G5G A;  3PY8 A;  4ECT A;  1K5O A;  4QZH A;  4M9N A;  4NL9 A;  4DS4 A;  4DSK A;  9ICJ A;  5KAI U;  3JPN A;  1F5S A;  4C80 A;  1RYU A;  1Q46 A;  3SQI A;  3M9O B;  5KL8 B;  1JMS A;  3NS1 A;  1ZQX A;  4UB2 A;  2NYV A;  1HUO A;  3LWM A;  2QLT A;  3GDX A;  3ZDE A;  5DBA A;  4DS5 A;  1T3Q A;  2VJ4 A;  2RLT A;  2YMM A;  4UW9 A;  4ICA A;  3H4D A;  5CWR A;  5KT6 A;  5KFA A;  2EZZ A;  4UB1 A;  2JH7 A;  5HHI A;  2KKV A;  2H3Q A;  2Z7J A;  3BJY A;  5DQH A;  4F4K A;  3K75 D;  4C4S A;  2PFP A;  1ZD2 P;  2KJ5 A;  5CJ7 A;  3G6V A;  2EAP A;  1NJZ A;  4ED7 A;  4US9 A;  5KG1 A;  5ALH A;  4NLK A;  2A19 A;  3RFA A;  4MFA A;  2BGW A;  4UAS A;  4RQ5 A;  3JPQ A;  2HHX A;  3TFS A;  4M2Y A;  4XQ8 A;  2XI9 A;  5AK3 A;  2ZIU B;  2VIX A;  1NOM A;  3AUO A;  3MR6 A;  4M04 A;  3RJH A;  3RAX A;  5AKI A;  5E79 U;  3GIL A;  2KP7 A;  5JU5 A;  2HVH A;  3MDC A;  3QU9 A;  4QW9 A;  4C0Z A;  4KLQ A;  1NK7 A;  1HIW A;  2FLN A;  3E0F A;  3T3F A;  9ICU A;  2ZJA A;  2BCR A;  2EH9 A;  1Z19 A;  5TIS U;  1SV0 C;  2AGQ A;  5KFD A;  1ZJN A;  9ICH A;  1NZP A;  2E3T A;  2HSZ A;  5HP4 A;  2C2E A;  2ZG6 A;  3HT3 A;  1U49 A;  2ASJ A;  2ESE A;  3DDH A;  8ICN A;  2W8K A;  3Q8L A;  2JZB A;  4KLU A;  9ICP A;  5J0U A;  3IV6 A;  1BPY A;  2F44 A;  2YX8 A;  2NO5 A;  5AKK A;  5AIB A;  5J0P A;  1F0M A;  3SEI A;  3OSN A;  2AXT U;  2GO7 A;  2H5X A;  1SGG A;  9ICL A;  4QNL A;  5DDY A;  2KKP A;  5ALQ A;  3N7P D;  5AKH A;  5ALW A;  5AIC A;  3MAB A;  3WK6 A;  1Q3V A;  4MFF A;  2VA8 A;  2HVI A;  1NJW A;  1PK1 B;  5EE1 A;  1ZQK A;  4R66 A;  4O5C A;  1H38 A;  3KKA C;  4FZN A;  4IRD A;  1CRX A;  2HBJ A;  5AK4 A;  5ALL A;  3M8R A;  5DLF A;  1ZQY A;  3T79 A;  4KLJ A;  1TE2 A;  4DOC A;  3QX7 A;  4IS7 A;  3D6J A;  1X40 A;  3NVV A;  4F91 B;  2I9G A;  3CYM A;  4BWM A;  5KFQ A;  1O08 A;  3F53 A;  3PST A;  3BDP A;  5GTI U;  3SV4 A;  1ZQC A;  4B9N A;  1PZN A;  1XO1 A;  3Q8S B;  1DK2 A;  4DF4 A;  4Q8E A;  3EYZ A;  8ICO A;  4DO9 A;  5KTQ A;  1PK3 A;  5DB9 A;  1ZQS A;  2NV3 A;  2PI5 A;  1L3S A;  3C21 A;  4I2A A;  2P6R A;  1N5W A;  3KD3 A;  4KLG A;  3TAD C;  1UT8 A;  2E8O A;  4EBD A;  5KFS A;  4DL3 A;  1RDF A;  3BQ0 A;  3RBD A;  4Z6D A;  4QW8 A;  1TFR A;  2G5H B;  1MQ3 A;  4C8L A;  4E0D A;  4MFC A;  4PL1 A;  1JRO A;  5AKZ A;  4PL2 A;  5ALT A;  1N56 A;  4O3P A;  1WWV A;  4RU9 A;  2ZJ5 A;  3F2B A;  2BZF A;  4PGX A;  4DSE A;  3V7J A;  1PVP A;  4TUQ A;  9ICV A;  3FC4 A;  2F77 X;  2KD1 A;  5ALY A;  3SD7 A;  1NK9 A;  1ZQM A;  5AM5 A;  4DEZ A;  4NXZ A;  2ZUB A;  3CNH A;  1PVQ A;  3RB3 A;  4Q44 A;  4Y2P A;  2R8J A;  1A0P A;  1Z00 A;  2OM6 A;  2UVW A;  1QQ5 A;  3CRX A;  2E8P A;  4DQS A;  2K89 A;  1MC8 A;  3NTU A;  1LKY B;  2DQN B;  5EE3 A;  4JWN A;  3JPO A;  4ED3 A;  2GH1 A;  1LV5 A;  2KIV A;  3PV8 A;  3SI8 A;  8ICS A;  4AYB C;  3WK8 A;  2EAM A;  4NY8 A;  2JR5 A;  4U6P A;  3ALR A;  2N1R A;  2D8C A;  1IG6 A;  2MRL A;  3QXG A;  2XGQ A;  3SR6 A;  3SAH A;  3RJF A;  1BGX T;  3MFH A;  1BPX A;  4B9M A;  3FYH A;  3HRD D;  2PMZ C;  2W9A A;  3IN5 A;  5DGA A;  3AU2 A;  4WJ3 B;  2BKE A;  4IQT A;  1BPD A;  4DSL A;  4I2C A;  4I2G A;  4MF8 A;  2RP5 A;  1S0O A;  4J9L A;  4FZM A;  2J6S A;  1VLB A;  9ICO A;  3HWT A;  2PI4 A;  4QWB A;  7ICQ A;  4DCC A;  2MUT B;  3PML A;  1U9L A;  8ICE A;  5KT2 A;  1C7Y A;  4F4X A;  7ICF A;  3QEA Z;  5J2G A;  4UAU A;  2OXO A;  1N62 A;  3UMB A;  2W3R A;  4YQW A;  4F8R A;  4MF2 A;  4UAT A;  5EOZ A;  5F9N A;  4OJ6 A;  7ICU A;  1PK1 A;  5J0O A;  3LVW A;  1K1Q A;  3RB4 A;  5HR7 A;  2I5H A;  4F72 A;  4RT3 A;  4O3O A;  1L7M A;  1MSW D;  5KFG A;  2ALZ A;  4IC9 A;  2YML A;  4DFJ A;  2PFO A;  4EEL A;  5ALM A;  2KIW A;  3M7D A;  1SL1 A;  2QKQ A;  1L3T A;  3A0H U;  3UQ0 A;  4DL5 A;  4ED1 A;  1X9X A;  1ZQR A;  5AKL A;  2HHQ A;  2WHE A;  2KNJ A;  4CF4 A;  4K4G A;  1DOQ A;  2F76 X;  5J2H A;  3MGI A;  3H8M A;  5DB7 A;  5GTH U;  4RQM A;  2ASL A;  5DG8 A;  4J9N A;  4BJQ A;  3ISB A;  2DF4 B;  2L5Y A;  5AM4 A;  3WKB A;  3WK9 A;  4P0P B;  2NRW A;  4GXI A;  4KLL A;  7ICJ A;  2PMZ F;  4MEY A;  4P0Q A;  1JAL A;  1T94 A;  4O0I A;  1ZQF A;  3FAH A;  3IHQ B;  3M6K A;  4EYH B;  2K4H A;  1QSS A;  2ISP A;  3UMC A;  1ZQB A;  1L8O A;  5JUM A;  1NI3 A;  2C2R A;  2K4I A;  1S10 A;  2NRT A;  5J2C A;  2QB0 B;  3QUQ A;  4ECX A;  9ICQ A;  2UVR A;  2RDI A;  4O3M A;  3H8J A;  2PXI A;  1U47 A;  2E8M A;  2IHN A;  5J2J A;  1SIJ A;  1VDV A;  4I2E A;  4DL2 A;  3M9M B;  4Z6C A;  5HNK A;  3THV A;  2KE7 A;  5BOM A;  2KFN A;  3PNC A;  3I1Y A;  2XGP A;  3M6Z A;  5AKE A;  1X9S A;  2WAQ C;  2FMQ A;  4O3N A;  4RPY A;  4ECZ A;  4RUC A;  1U45 A;  1N63 A;  3H8W A;  3RR8 A;  3IP4 B;  3NRW A;  1QH9 A;  3F5E A;  3GIK A;  4O9M A;  5AI0 A;  4HAI A;  2Y9T A;  1ZYQ A;  1NK6 A;  2DPJ A;  5K4L A;  5DLG A;  5KT3 A;  3RTV A;  2HI0 A;  1HEK A;  1N2X A;  3PSI A;  3L3F X;  1ZRM A;  5T14 A;  2NO4 A;  5KFF A;  1HJP A;  4O3R A;  1V38 A;  3TAP A;  5ALK A;  2BPF A;  2QB1 A;  2DKX A;  1AQ6 A;  5J0R A;  2R8H A;  1UT5 A;  4EEK A;  5J2I A;  3ISC A;  2A1A A;  4QJF B;  1MA7 A;  5KFU A;  3SV3 A;  2XVT A;  1MQ2 A;  4DSJ A;  5KNI A;  5KG3 A;  2JEG A;  7ICV A;  1SKR A;  5DQG A;  2YB1 A;  5AK5 A;  3ZDD A;  2W9C B;  1FFV A;  1N61 A;  4RQ2 A;  5C0Y A;  4DF8 A;  5EWF A;  3PW7 A;  4Y2J A;  4IQV A;  4JMU A;  1QTM A;  4IL6 U;  5J0T A;  8ICQ A;  4YD1 A;  4TQR A;  5ALS A;  3QU2 A;  1KSP A;  7ICH A;  5JRT A;  2JHD A;  5ALE A;  1CEZ A;  4C4T A;  2Y0S C;  2JXJ A;  4TUS A;  2MUT A;  5L1K A;  2M9N A;  2EZY A;  2RDJ A;  4IQW A;  2K8C B;  5J0Q A;  3VCB A;  2RHF A;  3EZ5 A;  3WU2 U;  4F4Z A;  5KT5 A;  1MN8 A;  4PJ0 U;  3UMG A;  3V6H A;  2PFQ A;  3JPR A;  3H40 A;  5J2D A;  2JEJ A;  4QWA A;  4GLX A;  2BPC A;  2F2A B;  3KTQ A;  2KVS A;  2H3F A;  9ICS A;  2FI1 A;  3T5J A;  1SKW A;  2V4Q A;  4YR3 A;  4M47 A;  4DFM A;  2KTQ A;  3IM1 A;  3TAR A;  1ZQO A;  4I29 A;  3A0B U;  1L6N A;  5CP2 A;  2ZXI A;  1V97 A;  5DBB A;  1NK8 A;  3TI0 A;  4Y2R A;  3OHA A;  1ZQE A;  8ICV A;  3N28 A;  4LZG A;  2K4E A;  1JXE A;  1IXR A;  2EDU A;  1RYR A;  5F3X B;  8ICY A;  2Y1J A;  3QEB Z;  3EW9 A;  1TK0 A;  5ALI A;  5H2F U;  4RQ8 A;  3ZDA A;  4I2J A;  4M6W A;  1WWU A;  4F4Y A;  3QNM A;  4EBE A;  5KG5 A;  4P4M A;  3RH5 A;  1X66 A;  4GC6 A;  1ZQD A;  3BS7 A;  1NK0 A;  2W55 A;  4YN4 A;  4P0Q B;  7ICK A;  5KFX A;  1UA0 A;  2XIC A;  5KFL A;  4M0A A;  1ZXI A;  4RQ6 A;  1NKB A;  3HW8 A;  1GO3 F;  3MGV A;  4NM1 A;  2XY7 A;  3SAF A;  2EZX A;  2DWQ A;  5IIM A;  1P7D A;  4F71 A;  1ZQV A;  5ALF A;  3D2S A;  4F50 A;  1L7O A;  4YD2 A;  4O5K A;  2AGO A;  2BCS A;  3D2Q A;  3PSP A;  2IMW P;  3PR4 A;  1PUZ A;  1RG6 A;  2IOF K;  3O0F A;  4ECW A;  4DL4 A;  5D49 A;  3OHB A;  4Y2V A;  2QAR B;  5AM3 A;  1J2M A;  5III A;  2HBK A;  4DOB A;  1JI7 A;  5AI4 A;  1KRP A;  2H3Z A;  2W7O A;  3WK5 A;  3N97 B;  5KAF U;  3EWA A;  4GC7 A;  4C8N A;  8ICH A;  3KHL A;  3H0L B;  2E1F A;  4Q45 A;  4KLF A;  1SZH A;  1Z4N A;  2ES6 A;  2HBL A;  2BDU A;  3T5K A;  1HUZ A;  1WUD A;  1ZD5 A;  4I27 A;  9ICG A;  2JEI A;  9ICI A;  5L1L A;  3H7I A;  3MC1 A;  4F5O A;  1Q3U A;  4RT2 A;  2ZUC A;  3SEN A;  2O6K A;  1BPB A;  2KOB A;  4Y2U A;  1FEZ A;  2C2D A;  2KSO A;  3H0M B;  5KFO A;  2M0N A;  4QZ8 A;  1KDH A;  1KTQ A;  1RQL A;  3C23 A;  5DB8 A;  4B9T A;  3NVY A;  3PZP A;  8ICI A;  3R9K A;  2DUY A;  1T8E A;  7ICM A;  5KFR A;  3QUB A;  4QZG A;  3KHR A;  2ODG A;  4J9K A;  4G3I A;  2BCU A;  1S9F A;  3SZ2 A;  5J2B A;  4NLG A;  2CN1 A;  4GXK A;  2BR0 A;  3AQE A;  2JZB B;  2A1J A;  4F5R A;  1OUQ A;  4C7Z A;  3BS5 B;  1ZRN A;  4OO1 J;  3KHG A;  3V7K A;  4I28 A;  9ICW A;  1L5U A;  4F2R A;  2V4R A;  5BOL A;  4NLN A;  4KN4 A;  2FDR A;  2YB4 A;  3ICX A;  1XO0 A;  5J2E A;  1URJ A;  2DBY A;  1NZB A;  3AM9 A;  5J2F A;  2G09 A;  3BZK A;  2FLP A;  1NK4 A;  2IHM A;  1KBU A;  4KX3 A;  3ISD A;  1ZQQ A;  2W03 A;  4DOA A;  4R64 A;  4DL7 A;  5J0X A;  3EUB 2;  2KZZ A;  5KFC A;  5AM0 A;  2KSO B;  4FO6 A;  3IG5 A;  3F5A A;  2KFZ A;  2WB1 F;  1X9W A;  4DLG A;  1FIQ A;  1J97 A;  3QZ7 A;  5EWG A;  5KFV A;  3M1Y A;  4F5Q A;  3KBB A;  1LVH A;  7ICO A;  3ZD8 A;  3V7L A;  4J9O A;  4R8U A;  4KLM A;  3AN1 A;  4KN7 A;  1NK5 A;  5HMM A;  2VA2 A;  4QWE A;  4A8E A;  3TQ1 A;  4UB5 A;  2FJ6 A;  3UPQ A;  4BX9 C;  1QSY A;  1YZ6 A;  3MR5 A;  2ATL A;  1ZQZ A;  4P2H A;  2XCP A;  4KLI A;  2C28 A;  5AK6 A;  7ICN A;  1SV4 A;  2LBO A;  4GIB A;  2BDP A;  3UXP A;  5HHH A;  1JX4 A;  3ZDB A;  3QU7 A;  4NL9 C;  4EZ6 A;  4RQ1 A;  3U26 A;  2YTU A;  4YVZ A;  4EEN A;  2HHV A;  3ZI4 A;  4PHP A;  5KG7 A;  2I6X A;  5KT4 A;  3ETL A;  4M9L A;  4Q8F A;  4OJL A;  1NKC A;  1L3U A;  2OH2 A;  4PGY A;  3RJJ A;  2F8K A;  7ICE A;  1CI4 A;  2OWO A;  3WKC A;  5KFJ A;  4PHD A;  2EAO A;  3LWL A;  2W9B B;  5AI9 A;  4YFK A;  3BQ2 A;  1L7P A;  2QAR A;  2F1I A;  4AP9 A;  3PW0 A;  5D4B A;  2CPR A;  3JPP A;  1QQ6 A;  5ALN A;  3V6J A;  7ICT A;  2G5I B;  2ZJ8 A;  2KHQ A;  3QZ8 A;  5AHX A;  4UB3 A;  2IOH A;  3V6K A;  4ELT A;  2H3V A;  3L5K A;  4OJ5 A;  4ECY A;  1SXE A;  4QIW F;  5DDM A;  9ICT A;  2LYB A;  4DL6 A;  5HML A;  4CNQ A;  2ZIU A;  8ICP A;  3ZDC A;  5J2K A;  4NV0 A;  2XY6 A;  1ZQW A;  4FE3 A;  1UA1 A;  3C28 A;  3ORY A;  4UAZ A;  2BCV A;  4RZR A;  4YP3 A;  4B9S A;  4M9J A;  4TUP A;  4GFJ A;  2VAN A;  5KFN A;  4ELV A;  4QZE A;  4DSI A;  1KFD A;  4Y2T A;  4B9U A;  3PSF A;  3GIM A;  3D2N A;  2W8L A;  2K8B B;  2KMD A;  4C8M A;  1XSP A;  3DV9 A;  2QB0 A;  1XSN A;  5FP0 A;  3G6X A;  2W7P A;  5CRX A;  8ICL A;  3KZI U;  2WF5 A;  5DGB A;  3GQC A;  3M9N B;  5DG7 A;  4OJO A;  4I2D A;  3RH6 A;  3C1Z A;  4JV1 A;  2NRV A;  3C2K A;  4KMU A;  4KMO B;  5EWE A;  2OYY A;  1FFU A;  1X6J A;  1ZD3 A;  5KFB A;  5KG2 A;  4PH5 A;  1LB2 B;  4M9H A;  4QZA A;  2JMG A;  3HX0 A;  5IIJ A;  2H3I A;  5AI6 A;  2FMS A;  3C2M A;  2V9W A;  1KLN A;  1S76 D;  2KIC A;  4RUA A;  9ICK A;  2VKQ A;  3AMZ A;  3IRU A;  2HCF A;  1RM6 C;  2LPE A;  2FPK A;  4DQR A;  5IIK A;  1X9M A;  5AI8 A;  5J0S A;  2MA1 A;  1IM4 A;  1XNS A;  2LYA A;  3PW4 A;  3AQF A;  4ECU A;  2W9B A;  5BPC A;  1ZQA A;  4QZI A;  1COK A;  3H8S A;  4ED6 A;  4ECR A;  2LYH A;  1QLN A;  3KKA A;  2BQ3 A;  5EE0 A;  1KKX A;  2HW3 A;  1NNL A;  2B6G A;  4OD0 A;  3BQT A;  3UM9 A;  4DWI A;  5L1M A;  8ICK A;  2NRX A;  3N4M B;  1D8Y A;  1WYG A;  4GXJ A;  5J0Y A;  5KFW A;  3WKA A;  4Y2X A;  1XC9 A;  1XSL A;  8ICJ A;  4TUR A;  1ZQT A;  1T7P A;  4KLD A;  8ICB A;  4DQQ A;  5KFY A;  1ARO P;  3RB6 A;  4PPX A;  1ZQI A;  2E1E A;  2J6U A;  1DGJ A;  1RXV A;  2W9M A;  4EBC A;  4MHV A;  3NVW A;  5HR6 A;  1RQN A;  3K1Z A;  4ACO A;  2ZUD A;  3MBY A;  3GII A;  1NKE A;  2ISO A;  4CRX A;  4O5E A;  4UAW A;  4Y2Y A;  3I28 A;  3Q8R B;  7ICG A;  5TZV A;  1UPH A;  4U7C A;  4EZ9 A;  7ICP A;  2W9C A;  3I76 A;  3PX0 A;  1TAU A;  3QUC A;  4J9M A;  3GV5 B;  1S0N A;  1JIH A;  8ICX A;  4C8O A;  3SMV A;  1X2I A;  3HPO A;  1S0M A;  5AKX A;  3GV7 B;  4I2B A;  2LHT A;  1SV0 A;  4RNO A;  1L7N A;  1ZQL A;  4RPZ A;  3BZC A;  4J9P A;  2AQ0 A;  1Z00 B;  4ZH4 A;  3PX6 A;  4EX6 A;  3RRH A;  3E2E A;  5JTI A;  4P4P A;  4QZ9 A;  3AL0 B;  3RB0 A;  4Y2Q A;  5KT7 A;  2OHF A;  5ALV A;  1M6Y A;  2R8K A;  1X6I A;  4KTQ A;  3PMN A;  4ED2 A;  7ICR A;  3Q8K A;  5KL1 B;  2FLL A;  4XA5 A;  4BDP A;  2UVU A;  4YR2 A;  2HHW A;  4ECS A;  3PVX A;  5CEH A;  1JRP A;  4IRK A;  2D3D A;  4LZD A;  4F5N A;  4JUZ A;  4Z6E A;  3T5H A;  3K1R B;  2AQ4 A;  3PO5 A;  4UAV A;  1DGS A;  3B0X A;  4G9B A;  4US8 A;  4QZB A;  3GFK B;  3ONN A;  2YY6 A;  4KLO A;  3RJG A;  2C22 A;  3PO4 A;  2HOI A;  1D8L A;  2WF6 A;  3JPT A;  1TK5 A;  7ICL A;  2WB1 C;  3TFR A;  5DBC A;  8ICT A;  1WCL A;  4NLZ A;  3ETR A;  1YZ7 A;  1NJX A;  4CCH A;  4QZF A;  1ED1 A;  8ICM A;  4M6W B;  3BQ1 A;  3HKZ F;  3GU3 A;  4P4O A;  3RF9 A;  3OJU A;  5KFI A;  4JV0 A;  2XID A;  4FS2 A;  1IIP A;  1ZQ1 C;  3RRG A;  1T4G A;  1S8O A;  1C20 A;  1COO A;  5A0L A;  2BHN A;  3ZD9 A;  4DFP A;  9ICA A;  3QUT A;  1BNO A;  3OSP A;  1ZQP A;  4PHA A;  3SAG A;  2P35 A;  1XWL A;  1D9D A;  3CW2 C;  2F1H A;  9ICR A;  2A3V A;  4ED8 A;  5D46 A;  2AU0 A;  4QWC A;  1SKS A;  5IIL A;  3KZX A;  2HOF A;  2G08 A;  3RR7 A;  4KLT A;  3WK4 A;  2KG5 A;  2G06 A;  2CRX A;  4UAR A;  1SWW A;  1Z4O A;  1ZJM A;  4UQG A;  3LYS A;  3M8S A;  3TAQ A;  4AYB F;  5J0W A;  4M9G A;  9ICB A;  4ED0 A;  4J03 A;  5KG0 A;  5AM2 A;  3QU5 A;  5CR0 A;  3AEV A;  2AGP A;  1TAQ A;  2PFN A;  5KFE A;  5KG6 A;  5DB6 A;  1X42 A;  2ZXH A;  1DRG A;  2KZ3 A;  2YN4 A;  1SWV A;  3B9J A;  4RQ3 A;  1BNP A;  2DL0 A;  2A1J B;  5KFM A;  3EPI A;  2MU2 A;  2HHU A;  2BPG A;  4YCX A;  4QIW C;  1V85 A;  1QQ7 A;  2K4P A;  4P0P A;  2E5S A;  2ZIV A;  3BQ7 A;  4NJ8 A;  4PGQ A;  7ICS A;  2KJ8 A;  9ICM A;  2KVC A;  1TVA A;  1TKD A;  1RPL A;  2BQR A;  4DLE A;  3F2D A;  3MR3 A;  5CB1 A;  1ECW A;  1SB3 C;  2Q0Z X;  4KIT B;  2FMP A;  3N7S C;  4QZD A;  1N48 A;  1TK8 A;  4CF5 A;  3OTQ A;  4NWI A;  5B5E U;  2F1J A;  4PZO A;  1B4F A;  8ICZ A;  3HIL A;  5F9L A;  2NRZ A;  2WAQ F;  4O3Q A;  1XU4 A;  1KEJ A;  4UAY A;  3H0R B;  3TAC B;  2LKY A;  4B9V A;  2G07 A;  2XC9 A;  9ICN A;  4X5V A;  2YQE A;  2HDO A;  3C2L A;  3TKA A;  4I2F A;  4OJP A;  2KEY A;  3WKD A;  1ZQG A;  4FBT A;  3C29 A;  5ALX A;  1UQV A;  4ECQ A;  4J9R A;  1U48 A;  1D8B A;  4KLH A;  2DFL A;  5B66 U;  1Z1V A;  3N7R C;  1N60 A; 
#chains in the Genus database with same CATH homology
 2Y9T A;  2B6G A;  2KIV A;  4IS7 A;  5L1M A;  2QKQ A;  1X40 A;  4PZN A;  2EAM A;  3SEN A;  1X9X A;  2KSO A;  2JV3 A;  1V38 A;  2K60 A;  5JU5 A;  2QB1 A;  2D3D A;  2DKX A;  5F3X B;  1SXD A;  2D8C A;  2LMR A;  3H8M A;  2GLE A;  2DL0 A;  3K1R B;  4RQM A;  2KMD A;  1DXS A;  4RQN A;  1PK3 A;  5KNI A;  1V85 A;  2L5Y A;  1WWU A;  3IDW A;  2QB0 A;  1KW4 A;  1OXJ A;  1SV4 A;  2K4P A;  3BQ7 A;  4NJ8 A;  1X66 A;  1SV0 C;  3BS7 A;  4NL9 C;  3TAD C;  2E8O A;  2YTU A;  2ESE A;  5J8Y C;  4MHV A;  4NL9 A;  2FE9 A;  1UCV A;  2E8N A;  3BS5 B;  3BS5 A;  2F8K A;  2QB0 B;  5JRT A;  2F3N A;  2F44 A;  1WWV A;  1F0M A;  3SEI A;  2EAO A;  2Y9U A;  2DKZ A;  4PZO A;  2E8M A;  1B4F A;  1B0X A;  1RG6 A;  1SGG A;  3HIL A;  5J8Y A;  1LKY A;  2QAR B;  2QAR A;  2KE7 A;  2LPE A;  3TAC B;  1SV0 A;  1JI7 A;  1PK1 B;  1PK1 A;  2EAP A;  3TAD A;  1OW5 A;  3KKA C;  2KSO B;  1UQV A;  2E8P A;  1COK A;  1SXE A;  2EAN A;  1LKY B;  5JTI A;  1Z1V A;  3KKA A;  2ES6 A;  2KG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...