3KKAA

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
b'DGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-A RECEPTOR 1
publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 19
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaA00
5JU5A 1LKYB 1SXEA 3K1RB 3KKAA 1X9XA 4MHVA 1SV4A 2D3DA 1SGGA 1PK1B 1V38A 5JRTA 5J8YC 1F0MA 2EAPA 2E8NA 3SEIA 3BS5B 2K60A 2KIVA 2QKQA 2D8CA 3BS5A 2F8KA 3TADC 5L1MA 2LMRA 4NJ8A 5J8YA 2DL0A 5KNIA 4RQNA 3BQ7A 3KKAC 2QB0A 2E8MA 2F44A 4IS7A 3TADA 1DXSA 3SENA 2GLEA 1RG6A 2EAMA 2KG5A 1B4FA 2EAOA 5F3XB 2L5YA 2E8OA 2KE7A 1OW5A 2F3NA 2YTUA 5JTIA 1V85A 1Z1VA 2DKXA 1WWVA 2KSOA 2E8PA 2QB0B 1OXJA 2Y9TA 3BS7A 1SV0C 4PZOA 2LPEA 1X66A 1KW4A 1JI7A 1SV0A 1X40A 3H8MA 2KMDA 2ESEA 1UCVA 2FE9A 2EANA 2KSOB 2Y9UA 3TACB 2QARA 4PZNA 2DKZA 1B0XA 1LKYA 4NL9A 1WWUA 2QB1A 4RQMA 3HILA 2ES6A 1PK3A 2K4PA 1PK1A 1SXDA 2B6GA 3IDWA 1COKA 2QARB 4NL9C 1UQVA 2JV3A
chains in the Genus database with same CATH superfamily
3NGDA 1IV8A 1A6SA 1X9XA 3C2KA 3PW7A 5E79U 1SV4A 1X42A 5ALQA 4Z6CA 1AQ6A 5JRTA 1A77A 1KFDA 4QWDA 4ED2A 5DBCA 2E8NA 5KFMA 1U49A 5ALXA 4FE3A 3ALRA 2B21A 2DL0A 1XU4A 4RQNA 3V7LA 5KNIA 3JPTA 7ICRA 8ICEA 2IMWP 4F2SA 4IR9A 5D4BA 3WK8A 1XSLA 1DXSA 4NM1A 3EZ5A 8ICYA 2EAMA 4OJ5A 1TV9A 8ICZA 5KFQA 1Q3VA 5A0LA 3GQCA 4EYIB 3BQ1A 1QCKA 1ZD4A 4B9TA 3FM9A 4FS1A 4YD2A 1V85A 2PXIA 1Z1VA 1HIWA 5KG6A 3RJGA 4R65A 2VKQA 4UASA 2FMQA 1FO4A 2WF7A 5KFNA 1N60A 2AQ4A 4BUGA 1N62A 5HHHA 1ZQXA 4M04A 4QZEA 3Q8MA 4EX6A 5DB8A 3M1YA 4ED7A 8ICWA 4DEZA 2FE9A 2ZJ5A 2W7OA 1L6NA 3AU2A 2Y9UA 5DBBA 2CN1A 4F8RA 5DLFA 3UM9A 1SZHA 5KG0A 3MR3A 4B9SA 1JROA 8ICFA 3QUQA 4F4XA 4ZOHC 1JXEA 2RLTA 2VANA 3VCBA 2V4RA 2HOQA 2C28A 5AKXA 2ASJA 8ICJA 3RF9A 3MGHA 4DFJA 2LHTA 4PGXA 5DGBA 8ICOA 3SQIA 4C8MA 1NK5A 1CEZA 9ICPA 4J9SA 3KHRA 4FZMA 2G07A 3RH6A 1ZRNA 5ALVA 2PFQA 5KFSA 2NRWA 1L3VA 4KX5A 5AI9A 3BS5B 1ZQKA 1PUZA 4P0QA 2MA1A 4F5NA 3UMBA 2PFOA 4MFCA 4KLQA 1L7PA 4B9NA 4R64A 4TQSA 5J0RA 2JH7A 3TFSA 5AIAA 1XO0A 3C2MA 3DV9A 2W43A 1FIQA 2HDOA 5H2FU 4DSEA 4I2JA 3QNMA 5AHXA 4QZ9A 5KG2A 4DOBA 4Z6EA 2ISPA 2QB0B 1OXJA 9ICLA 1TK0A 1D8LA 4TUSA 5ALPA 4M9GA 3UXPA 2EZXA 4P2HA 3BJYA 1UCVA 4PPXA 3BZCA 4EZ6A 2XVTA 3LDAA 5KFYA 2AQ0A 5J2AA 3Q8RB 2FI1A 2RQ5A 3C21A 2HHUA 9ICSA 1NJXA 4Y2JA 4F50A 3OJUA 4EELA 3IHQB 3MC1A 5HMMA 5DG8A 2QB1A 3HILA 4OJOA 4C8KA 4DQRA 1NKBA 2BGWA 2F1JA 3BDPA 4RT3A 3ONNA 3MR6A 2PI4A 1XSPA 1SWWA 4O3NA 4O3PA 4C8OA 2BQUA 4BX9C 4O5EA 1COKA 3NVZA 1FFUA 1TKDA 4UB1A 3IV6A 4J03A 4UW9A 3KKAA 2KHQA 5AKLA 2A1JB 3GIMA 3U26A 2BCRA 2D3DA 4JWNA 5ALNA 2IA6A 4DL4A 8ICRA 5J8YC 5DBAA 5KG4A 1T4GA 5ALZA 5KT7A 3DDHA 5KG3A 3PR5B 5J0QA 4P4MA 4YFKA 5ALKA 5AKEA 4MF8A 1B4FA 2BCSA 1V97A 3QZ8A 3AUOA 1DK2A 2ZIWB 4R63A 4ED6A 4BJQA 4EBDA 1ZJNA 7ICPA 1J2NA 4GLXA 1UHUA 2YTUA 1O08A 1F5SA 2HVIA 4MEYA 2OWOA 1ZQGA 4FS2A 2AU0A 4C80A 4F5QA 4CGZA 3C2LA 1QSSA 1BNPA 1JI7A 2HOFA 4R8UB 1JXLA 3ZDBA 3KD3A 3AMZA 5BOLA 2Q0ZX 2VA8A 2FLLA 9ICRA 5J0TA 3SAFA 3UXOA 2HOIA 2OCEA 3H8JA 2IHMA 4M9HA 4R66A 3BQ2A 5D49A 3TAPA 3GV5B 1BPZA 3JPNA 3M7DA 8ICGA 2KK0A 2ZJ8A 4FFDA 4PL1A 5AKIA 1S9FA 3F5EA 4QWAA 4Y2VA 2W9CA 4Y2XA 9ICKA 1N61A 3OSNA 2Y1JA 1WCNA 4MFAA 3RTVA 2MRLA 3ED5A 1ED1A 1UT5A 5DDMA 4M6WB 5KFJA 9ICMA 9ICBA 4O3QA 5L1JA 5EE3A 3FC4A 4RQ3A 2KV2A 1WUDA 1K1QA 5ALJA 2I5HA 1L7OA 4IQWA 3SEIA 2DWQA 3SZ2A 4CF5A 5L1MA 1N5WA 2KFZA 2QB0A 4QZFA 3CNHA 4TURA 3C23A 5ALLA 1FEZA 2GLEA 1Q8KA 2KG5A 1CI4A 1RG6A 3RB3A 4YMMA 1S76D 3ZD8A 2BDPA 5HR7A 1QQ5A 2F3NA 2PI5A 5KFAA 4NLBA 1SKWA 2HHXA 3H0MB 3I28A 2ZTEA 5CB1A 8ICSA 5KFWA 1QSLA 4UAZA 5L9XA 3ZD9A 2ZJAA 4RQ8A 4KITB 5C5JA 5HR6A 1IXRA 4ED1A 1UA0A 8ICMA 2KMDA 2ESEA 1Z4OA 2V4QA 3C5GA 4J9QA 4DL6A 1X6JA 3L5KA 5AK3A 1ZQAA 5KT6A 2G06A 1ZXIA 3GV8B 2EANA 2DFLA 2AGQA 5J0PA 4ECUA 4PZNA 3T5LA 1JUDA 4O3OA 4M9NA 7ICKA 2WTFA 1KKXA 4EENA 4RQMA 4RNOA 7ICTA 1B22A 4DLEA 1UA1A 9ICFA 2OH2A 1L3UA 4C8NA 2B6GA 1NK9A 5AM0A 2NRZA 7ICEA 4ED0A 2CRXA 4JK1A 1ZQRA 1UQVA 4IC9A 4DFMA 4MHVA 3PX4A 9ICHA 1X9SA 4NLZA 4YXMA 2ZIWA 3KZXA 2XICA 4QZIA 3ORYA 2UVWA 5KFXA 2J6TA 4RQ2A 4ELUA 9ICGA 5ALMA 4DL2A 5K4LA 2Y0SC 3KKAC 2E8MA 2F44A 2GH1A 4OJ6A 4DQIA 1KQQA 1MQ2A 1KL9A 2VIXA 5L1KA 1PVRA 1LB2B 2L5YA 3GU3A 4YN4A 4R8UA 2NRVA 1ZQYA 3NUQA 3JPPA 1SKRA 2R8HA 1QH9A 3NVYA 4IQVA 3HKZF 5KFZA 3PX6A 3L3FX 3QU4A 3WU2U 1WWVA 4DWIA 1RXVA 4PZOA 3OPXA 2LPEA 4I2AA 5BOMA 4LJXA 2KFNA 3TARA 2ZUCA 4NM2A 3ZI4A 5J2GA 2G5IB 4Q8FA 4I2FA 2BDUA 2GWSA 4G3IA 4KMUA 4F5RA 3HRDD 1ZQFA 5DKWA 2NRXA 1RQLA 3MGIA 4Z6FA 4M6WA 3F5AA 4Y2PA 5AKJA 8ICQA 3ZDEA 1BVSA 4O0IA 2OM6A 2MU2A 2BCVA 5DQHA 4QZHA 2YMQA 3TAQA 1JMSA 4RQ0A 4O5CA 4HAIA 4C7YA 3K4GA 1JRPA 5CWRA 4DF8A 2KICA 5AKKA 4US8A 4Y2TA 4I2EA 4KLHA 1K5OA 9ICVA 4IRCA 4K4GA 4OJLA 3V7KA 1ZQIA 2XY7A 3RBDA 3FAHA 2BPCA 4RQ6A 1VLBA 1BPEA 4NWIA 5J2HA 4EX7A 1NK8A 2ZUDA 9ICNA 2LMRA 5J8YA 3RJIA 4XQ8A 1NK0A 5BPCA 4PHDA 3C1ZA 1ZOLA 4Q43A 3D6JA 3SENA 4DF4A 3LWLA 3RAXA 2WHEA 3UQ2A 5KFUA 1JN3A 2XCPA 4EEYA 2DKXA 2XGQA 2W8LA 2ZXHA 1N63A 2NO5A 4CNQA 5KFIA 4TQRA 3WKEA 4UBBA 1MN8A 4EBCA 2G08A 1K1SA 1X40A 4PH5A 2H3ZA 3EPIA 3J81j 3PW4A 1ZQZA 5CJ7A 5ALDA 2W8KA 4ECVA 7ICGA 2YB1A 2MAXA 5CEHA 3KHLA 3QEBZ 4Y2QA 2KJ8A 5J0UA 3RR7A 2RDIA 2R8GA 3E0FA 4NLNA 4KLGA 2LYHA 1KTQA 1IG6A 2F2AB 1ZQDA 2K8BB 1ZQQA 2WF8A 4CF3A 4RQ4A 5L1IA 3DEEA 1Z19A 4QZGA 2FJ6A 4GC6A 5AKYA 1OUQA 3RJJA 4IQTA 4BXOB 3V7JA 4KTQA 1NJYA 3RB0A 4QNLA 3A0BU 1A76A 4ECTA 1Z00B 3BQ0A 3PW5A 2EZYA 2KIVA 2Y1IA 1NKEA 3D2QA 2V9WA 4QZAA 1CUKA 1S0OA 2VJ4A 4QIWF 4RU9A 3AL0B 1ZQUA 1RDFA 2QLTA 1C7YA 4KLTA 1RYUA 1BGXT 5AICA 1ZQHA 3H4DA 2AGOA 3Q8QB 2EAOA 4PGQA 1EXNA 1URJA 2E8OA 5KFRA 4ZH4A 3QEAZ 5JTIA 3PMLA 3GILA 1ZQBA 2EQYA 4F93B 2Q4TA 1ZQWA 3MGVA 2E8PA 4C0ZA 5J2BA 2XCAA 5HP4A 1KN5A 2JEFA 3QX7A 4OJPA 3AN1A 1KW4A 5J0YA 4DQSA 3NASA 4B9MA 8ICCA 3RRHA 2XY6A 4QWBA 3M8SA 4GXIA 3IP4B 4KN4A 1J97A 2BKEA 4DOCA 4KLLA 3B0YA 1TAMA 4F92B 5EWFA 1B0XA 2C2DA 1ZQEA 4WJ3B 4F4WA 2KTQA 1U4BA 3RFAA 2EZZA 5G5GA 2H3IA 2ALZA 4F72A 7ICUA 4KLFA 4DS5A 4DCCA 5KFOA 4I27A 4O3MA 5J0XA 3NRZA 2ZUBA 2QARB 2E1FA 3H0LB 4XA5A 4PJ0U 2HVHA 3RRGA 5DG7A 4X5VA 2C22A 3A0HU 1XS9D 4F4ZA 1NJZA 4XRHA 2LYBA 4KN7A 4JV2A 2KZZA 4J9OA 1PK1B 2W04A 7ICVA 1F0MA 5J2IA 5T14A 4K4IA 3OHBA 4BWJA 4DLGA 2D6FC 2RP5A 4UAWA 3GZFA 5IIJA 4FO6A 4I2GA 3I76A 5AKZA 4U7CA 3M9OB 3SV4A 5ALHA 4QZDA 1QQ6A 4QIWC 5AI0A 5GTHU 1OW5A 4KX3A 3KFUF 3TFRA 4QZBA 4F3OA 4FBUA 1MSWD 4IQUA 1SB3C 4M9JA 2Y9TA 2IOFA 5IIIA 4J9KA 3MR5A 3MBYA 3H4BA 1NK7A 7ICFA 1C20A 5KFGA 4F5PA 4PHEA 3Q8KA 3NS1A 2BHNA 4QW8A 4OD0A 3WK4A 5J2KA 1BPDA 2W9BB 1U9LA 1ZQ1C 4XUSA 2G0AA 4E0DA 1Q46A 4BXOA 9ICUA 3SAHA 3S6JA 1PK3A 3M8RA 2KZ3A 3WK9A 5B5EU 2FPLA 3ISDA 1Z00A 4TUPA 5AI6A 2W7PA 5KFVA 5J0OA 2XIDA 3QUTA 1L5UA 3E58A 2ATLA 5F9NA 5IIMA 5J0SA 1T3QA 2YQEA 4YVZA 3KHGA 4RPXA 8ICLA 3KTQA 2BPFA 4RQ1A 4I2CA 4M2YA 2IBKA 2HBMA 2HBJA 7ICSA 2KJ9A 3F2DA 7ICJA 4TUQA 2JGAA 4YP3A 2P35A 1RM6C 1YT3A 5AK5A 8ICPA 2XGPA 5EWEA 2M0NA 3IN5A 3BS5A 1ZD3A 3V6KA 3TADC 1D9FA 2ZIVB 5CHGA 3T3FA 4JV1A 8ICKA 3BQ7A 4NLCA 4QWCA 2ZIUB 2XI9A 4HYKA 1A0PA 3V6JA 4MF2A 2E1EA 5EE9A 8ICIA 3K75D 4DSFA 3RB4A 3LWMA 2XY5A 3Q8PB 3CP8A 1BPXA 2LKYA 5FP0A 4ICAA 2JEJA 1JALA 5KT2A 2W54A 2I6XA 2JHDA 3QU7A 1S10A 4NY8A 3C5FA 3QUCA 3M9NB 2VA3A 4OO1J 5GTIU 3QUBA 2G09A 1XSNA 2HSZA 3JPRA 3G6YA 2ZTDA 1VDVA 1RQNA 4IR1A 1U47A 1SIJA 3WKBA 1Z4NA 1SWVA 1BPBA 4J9LA 2QARA 1XWLA 1TE2A 5CRXA 3QZ7A 4KLOA 3GV7B 5KT3A 4J9MA 4IRDA 3PV8A 5KFDA 2LI6A 1PK1A 3MR2A 1CRXA 5DG9A 5EOZA 4ELTA 4ECSA 3PR4A 5TISU 1SZPA 2YY6A 1V9PA 5AM3A 1JX4A 3UXNA 1FFVA 4DL7A 1BPYA 4I2HA 9ICEA 1S8OA 1SXEA 1D8BA 4RUAA 5IILA 2A1JA 1TVAA 3QU2A 5IIKA 3EYZA 3KOOA 4B9VA 2QKQA 1NJWA 5DQIA 2OEHA 2NYVA 2AGPA 3BQTA 4FZLA 2A3VA 2IOHA 4YR0A 4CRXA 5ALRA 5KG1A 2BR0A 5KFEA 3WKDA 2CXYA 4ECXA 3PY8A 4NLGA 4KLIA 3RH4A 4YR2A 3C1YA 1T7PA 3PSPA 1ZQMA 5HNKA 3TANA 2JEIA 3WKCA 3OGUA 3MFHA 1H38A 3ICXA 1O03A 4UB4A 1L7NA 2W9BA 3G6VA 2H3FA 3LVWA 2ZXIA 5KAIU 1NNLA 4Q45A 3F2CA 5TZVA 4U6PA 2KVCA 1DGJA 4CDGA 1TK8A 1HUOA 2KP7A 4F91B 7ICOA 1KDHA 4RQ5A 4I2DA 4DQQA 1U48A 3N4MB 5J2JA 5DGAA 4ED3A 5DB7A 1J2MA 1Y88A 3ZDCA 5DQGA 2ES6A 2GO7A 2H3QA 4NXZA 2AXTU 4B9UA 1PVQA 1SL1A 3GFKB 1SXDA 2AH5A 3H8WA 3EWAA 2ISOA 8ICAA 4DSLA 4P4OA 5KL1B 9ICIA 3CYMA 3EW9A 5KAFU 3Q8LA 3ZDAA 2ZIUA 4UB2A 4I2BA 1L3TA 5JU5A 1ZQLA 3K1RB 4BDPA 2W55A 1L8LA 2HBKA 4GFJA 5EE0A 3ETRA 3WK5A 4DSIA 2F8LA 5KFLA 4P0QB 2K60A 4C4SA 3NVVA 7ICIA 3ISBA 1N2XA 2I9GA 3OHAA 2C2RA 5JUMA 7ICQA 1ZQSA 5HHIA 2XC9A 1KBUA 3B0XA 4OCZA 3M6ZA 3N28A 3CW2C 2FLPA 3MDAA 8ICVA 2KE7A 5DLGA 4DL5A 4RNNA 3JPOA 1TK5A 4AP9A 3RH5A 5ALFA 5CA7A 2PMZF 3HWTA 2BQRA 2RHFA 1RYSA 2Z7JA 3BZKA 4C4RA 4IRKA 2F77X 3SI8A 4BWMA 3PSTA 4JUZA 4Y2SA 1X9MA 3N97B 2FPKA 2W3RA 1TAQA 4LZDA 3G6XA 1KEJA 2HHTA 2KSOB 3Q8SB 1M6YA 9ICAA 3HKZC 5KG5A 2BZFA 1ZD5A 4MEXA 2WF9A 3HT3A 2AJQA 8ICXA 4A8EA 1AROP 2ASDA 2LM1A 1RZTA 4PHPA 4JWMA 2HHQA 2PKEA 2DBYA 5ALEA 5AIBA 2DQNB 1S0NA 2P66A 3RJKA 5KTQA 4GC7A 3OSPA 4I28A 2R8JA 3IDWA 5ALSA 4RZRA 2PFPA 4LZGA 1IIPA 1QLNA 4FZNA 3H0RB 4M0AA 5KFKA 3SD7A 4YQWA 2KN7A 5ALGA 3GDXA 1SGGA 2LYAA 2HI0A 2HMXA 1IM4A 4JB3A 2A1AA 2F76X 2WF5A 2KKPA 2HHVA 1T3NA 1MA7A 2NO4A 3L4PA 3TADA 1B43A 3AQFA 1SL2A 1F44A 3M6KA 1SL0A 1VJ5A 4ACOA 4P0PB 5D46A 1P7DA 2OHFA 4B6JA 4QW9A 1BNOA 3N7PD 2KHVA 5KFTA 3PVXA 1D9DA 1X2IA 2PMZC 3RB6A 1S97A 2KOBA 4YG2A 4F4KA 5AKGA 4GIBA 7ICLA 2F1HA 2J6UA 3BS7A 3RJEA 4EEKA 2MUTB 2YB4A 9ICQA 4NLKA 3WKAA 1UPHA 2J6SA 5ALUA 4F71A 1N56A 2IOFK 4Z6DA 4UARA 2HHWA 3RR8A 4PHAA 3O0FA 2YMPA 2A19A 4QJFB 4YMNA 2AHOB 2I1QA 2WAQF 3N7RC 4IL6U 2JRZA 3RBEA 4O3SA 2YMLA 3T5KA 2ASLA 3NRWA 4I29A 4UB6U 4NL9A 2JH1A 1WWUA 1KFSA 3H40A 2R18A 2M9NA 3SR6A 4F5OA 2K4PA 4P4PA 2W9CB 5F9LA 2KEYA 3QYPA 4C4TA 3SAGA 1HEKA 3SMVA 5KT5A 4DL3A 5KL8B 4UB8U 2JV3A 4RPZA 3RJFA 7ICMA 4KLMA 5J2DA 2NRTA 2P6RA 2KD1A 4J9RA 2LM4A 4DSKA 3IM1A 4KLEA 8ICBA 5EWGA 2D8CA 4EBEA 3PNCA 1UT8A 4ECYA 3V72A 2RDJA 4O3RA 3PZPA 4QZ8A 4IS7A 4ECWA 2JEGA 9ICCA 4J9NA 1NK4A 4DS4A 3QXGA 2HHSA 4RUCA 5KFCA 3SV3A 4JV0A 4UB3A 1Z3EB 5ALOA 5F3XB 5DB6A 1DOQA 1WYGA 3TQ1A 4ELVA 3KZIU 3E2EA 3VC8A 1TFRA 1JIHA 3UMCA 5G5HA 4M9LA 3FYHA 2WFAA 4UATA 2KKVA 4QZCA 2KSOA 1L3SA 1KFTA 4G9BA 1SV0C 4Y2UA 2DPIA 3PO4A 4KLUA 2OYYA 5KFBA 4ED8A 2WB1F 1TAUA 1NI3A 3EUB2 2NV3A 3KBBA 3H8MA 4CF4A 1ZD2P 5AI5A 1WG8A 2K4EA 1D8YA 2W3SA 4YMOA 2C2EA 2WAQC 3NTUA 5L1LA 1ZYQA 2FLNA 4C8LA 2R8KA 1S5LU 4YR3A 3M9MB 4YXJA 3CRXA 5AM4A 5ALIA 3MFIA 3EPGA 4DFDA 2KNJA 3PW0A 3GIIA 2XO7A 2H3VA 5J2CA 1COOA 2VA2A 3OJSA 4ECRA 2K4IA 1GO3F 5KT4A 3C29A 4I2IA 4UAVA 4DFPA 2BCUA 4M47A 4KLSA 4P0PA 4CE6A 3KHHA 1V38A 1XO1A 1L8OA 3TI0A 2EH9A 8ICHA 3AM9A 2K8CB 4AYBF 4C7ZA 4RNMA 2WF6A 5AK4A 2K89A 1T94A 3LVVA 1ZQTA 2DF4B 2HCFA 4US9A 2MUTA 3GIKA 4MFFA 4RT2A 2JXJA 5J0WA 3PSIA 1KSPA 1WCLA 3HX0A 3QU9A 4F4YA 1L7MA 2VJ5A 3C28A 1ECWA 2IHNA 2BCQA 2RRDA 4O9MA 3MABA 1HUZA 3LK9A 1RXWA 3IG5A 3AQEA 1LVHA 2FMPA 4ECZA 5KFFA 1ZQJA 2LBOA 2H5XA 3UMGA 1YZ6A 2WB1C 2BPGA 5AI4A 5IINA 1NK6A 4DOAA 1ZETA 2ZIXB 1PVPA 1KRPA 1Q3UA 3FDSA 2KVSA 3TACB 4LVSA 3ISCA 2YMMA 7ICNA 3QE9Y 5ALWA 3R9KA 2B0CA 8ICUA 2YX8A 2Y0SF 5CR0A 4RPYA 4O5KA 1N48A 2ZTCA 8ICNA 1S0VA 3HJEA 4ECQA 4NL9C 2W03A 2G5HB 2KIWA 3WK7A 1LKYB 1XC9A 1QSYA 4Y2RA 3F53A 1PZNA 2JZBB 2ZG6A 2EAPA 2FPMA 3IRUA 4KMOB 5ALTA 3T5HA 3PX0A 1NZBA 4NJ8A 4J9PA 4PGYA 2EDUA 4AYBC 3LYSA 2K8AA 1KLNA 2YN4A 4FBTA 3K1ZA 4NV0A 5J29A 3UQ0A 5HMLA 1RPLA 2KZMA 2HBLA 4EZ9A 3SYZA 2MSNA 1QTMA 3OTQA 2O6KA 2F1IA 1XNSA 1MQ3A 1ZRMA 3HW8A 3THVA 3QU5A 1DRGA 2BQ3A 2W9AA 3H7IA 4BGDA 1X9WA 1NKCA 2JR5A 4UB5A 3PW2A 1ZQNA 2UVUA 1RYRA 2DKZA 1YZ7A 2HW3A 2W11A 5AKHA 3H8SA 4YCXA 2K4HA 9ICOA 4DSJA 5AI8A 3AU6A 5DB9A 5J2FA 2JMGA 4QWEA 1T8EA 2FMSA 4YD1A 2P6UA 4GXKA 3JPSA 4Q8EA 2W9MA 1ZQVA 3B9JA 3MDCA 3V6HA 4B9LA 3HPOA 4KLJA 1ZQCA 3HP6A 5KG7A 2OXOA 9ICXA 3WK6A 4DFKA 2FDRA 2DUYA 2F8KA 9ICTA 2ZIVA 3RAQA 3NVWA 2E5SA 4UAUA 3ETLA 3PO5A 4UQGA 1DK3A 1X6IA 3UPQA 3F2BA 3N7SC 5B66U 2ODGA 5AM5A 4K4HA 2R8IA 1ZQOA 2DPJA 2ZIXA 1U45A 1S77D 5AK6A 4CCHA 1N5XA 4JMUA 3I1YA 9ICWA 1ZJMA 2E3TA 8ICTA 4Q44A 2PFNA 1X66A 3ZDDA 2UVRA 5ALYA 1SV0A 5IIOA 2KJ5A 1NZPA 3T5JA 3D2NA 3AEVA 5C0YA 4Y2YA 5KFPA 1S0MA 1Z1BA 4F2RA 2UVVA 1DGSA 2N1RA 4UBCA 3PMNA 1QQ7A 3IG8A 5CP2A 9ICJA 5DDYA 4EYHB 3RJHA 1LKYA 4PL2A 3GIJA 4UAYA 1SKSA 7ICHA 3JPQA 5EE1A 3TKAA 4USAA 4GXJA 3PSFA 3T79A 3D2SA 2GOLA 2JZBA 1HJPA 1NOMA 4DO9A 4DQPA 2DGZA 1LV5A 5AM2A 2CPRA 1ZQPA 5AM1A 5KFHA 5J2EA 4KLDA 4RQ7A 1MC8A
chains in the Genus database with same CATH topology
5JU5A 1LKYB 1SXEA 3K1RB 3KKAA 1X9XA 4MHVA 1SV4A 2D3DA 1SGGA 1PK1B 1V38A 5JRTA 5J8YC 1F0MA 2EAPA 2E8NA 3SEIA 3BS5B 2K60A 2KIVA 2QKQA 2D8CA 3BS5A 2F8KA 3TADC 5L1MA 2LMRA 4NJ8A 5J8YA 2DL0A 5KNIA 4RQNA 3BQ7A 3KKAC 2QB0A 2E8MA 2F44A 4IS7A 3TADA 1DXSA 3SENA 2GLEA 1RG6A 2EAMA 2KG5A 1B4FA 2EAOA 5F3XB 2L5YA 2E8OA 2KE7A 1OW5A 2F3NA 2YTUA 5JTIA 1V85A 1Z1VA 2DKXA 1WWVA 2KSOA 2E8PA 2QB0B 1OXJA 2Y9TA 3BS7A 1SV0C 4PZOA 2LPEA 1X66A 1KW4A 1JI7A 1SV0A 1X40A 3H8MA 2KMDA 2ESEA 1UCVA 2FE9A 2EANA 2KSOB 2Y9UA 3TACB 2QARA 4PZNA 2DKZA 1B0XA 1LKYA 4NL9A 1WWUA 2QB1A 4RQMA 3HILA 2ES6A 1PK3A 2K4PA 1PK1A 1SXDA 2B6GA 3IDWA 1COKA 2QARB 4NL9C 1UQVA 2JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JU5 A;  1LKY B;  1SXE A;  3K1R B;  3KKA A;  1X9X A;  4MHV A;  1SV4 A;  2D3D A;  1SGG A;  1PK1 B;  1V38 A;  5JRT A;  5J8Y C;  1F0M A;  2EAP A;  2E8N A;  3SEI A;  3BS5 B;  2K60 A;  2KIV A;  2QKQ A;  2D8C A;  3BS5 A;  2F8K A;  3TAD C;  5L1M A;  2LMR A;  4NJ8 A;  5J8Y A;  2DL0 A;  5KNI A;  4RQN A;  3BQ7 A;  3KKA C;  2QB0 A;  2E8M A;  2F44 A;  4IS7 A;  3TAD A;  1DXS A;  3SEN A;  2GLE A;  1RG6 A;  2EAM A;  2KG5 A;  1B4F A;  2EAO A;  5F3X B;  2L5Y A;  2E8O A;  2KE7 A;  1OW5 A;  2F3N A;  2YTU A;  5JTI A;  1V85 A;  1Z1V A;  2DKX A;  1WWV A;  2KSO A;  2E8P A;  2QB0 B;  1OXJ A;  2Y9T A;  3BS7 A;  1SV0 C;  4PZO A;  2LPE A;  1X66 A;  1KW4 A;  1JI7 A;  1SV0 A;  1X40 A;  3H8M A;  2KMD A;  2ESE A;  1UCV A;  2FE9 A;  2EAN A;  2KSO B;  2Y9U A;  3TAC B;  2QAR A;  4PZN A;  2DKZ A;  1B0X A;  1LKY A;  4NL9 A;  1WWU A;  2QB1 A;  4RQM A;  3HIL A;  2ES6 A;  1PK3 A;  2K4P A;  1PK1 A;  1SXD A;  2B6G A;  3IDW A;  1COK A;  2QAR B;  4NL9 C;  1UQV A;  2JV3 A; 
#chains in the Genus database with same CATH topology
 3NGD A;  1IV8 A;  1A6S A;  1X9X A;  3C2K A;  3PW7 A;  5E79 U;  1SV4 A;  1X42 A;  5ALQ A;  4Z6C A;  1AQ6 A;  5JRT A;  1A77 A;  1KFD A;  4QWD A;  4ED2 A;  5DBC A;  2E8N A;  5KFM A;  1U49 A;  5ALX A;  4FE3 A;  3ALR A;  2B21 A;  2DL0 A;  1XU4 A;  4RQN A;  3V7L A;  5KNI A;  3JPT A;  7ICR A;  8ICE A;  2IMW P;  4F2S A;  4IR9 A;  5D4B A;  3WK8 A;  1XSL A;  1DXS A;  4NM1 A;  3EZ5 A;  8ICY A;  2EAM A;  4OJ5 A;  1TV9 A;  8ICZ A;  5KFQ A;  1Q3V A;  5A0L A;  3GQC A;  4EYI B;  3BQ1 A;  1QCK A;  1ZD4 A;  4B9T A;  3FM9 A;  4FS1 A;  4YD2 A;  1V85 A;  2PXI A;  1Z1V A;  1HIW A;  5KG6 A;  3RJG A;  4R65 A;  2VKQ A;  4UAS A;  2FMQ A;  1FO4 A;  2WF7 A;  5KFN A;  1N60 A;  2AQ4 A;  4BUG A;  1N62 A;  5HHH A;  1ZQX A;  4M04 A;  4QZE A;  3Q8M A;  4EX6 A;  5DB8 A;  3M1Y A;  4ED7 A;  8ICW A;  4DEZ A;  2FE9 A;  2ZJ5 A;  2W7O A;  1L6N A;  3AU2 A;  2Y9U A;  5DBB A;  2CN1 A;  4F8R A;  5DLF A;  3UM9 A;  1SZH A;  5KG0 A;  3MR3 A;  4B9S A;  1JRO A;  8ICF A;  3QUQ A;  4F4X A;  4ZOH C;  1JXE A;  2RLT A;  2VAN A;  3VCB A;  2V4R A;  2HOQ A;  2C28 A;  5AKX A;  2ASJ A;  8ICJ A;  3RF9 A;  3MGH A;  4DFJ A;  2LHT A;  4PGX A;  5DGB A;  8ICO A;  3SQI A;  4C8M A;  1NK5 A;  1CEZ A;  9ICP A;  4J9S A;  3KHR A;  4FZM A;  2G07 A;  3RH6 A;  1ZRN A;  5ALV A;  2PFQ A;  5KFS A;  2NRW A;  1L3V A;  4KX5 A;  5AI9 A;  3BS5 B;  1ZQK A;  1PUZ A;  4P0Q A;  2MA1 A;  4F5N A;  3UMB A;  2PFO A;  4MFC A;  4KLQ A;  1L7P A;  4B9N A;  4R64 A;  4TQS A;  5J0R A;  2JH7 A;  3TFS A;  5AIA A;  1XO0 A;  3C2M A;  3DV9 A;  2W43 A;  1FIQ A;  2HDO A;  5H2F U;  4DSE A;  4I2J A;  3QNM A;  5AHX A;  4QZ9 A;  5KG2 A;  4DOB A;  4Z6E A;  2ISP A;  2QB0 B;  1OXJ A;  9ICL A;  1TK0 A;  1D8L A;  4TUS A;  5ALP A;  4M9G A;  3UXP A;  2EZX A;  4P2H A;  3BJY A;  1UCV A;  4PPX A;  3BZC A;  4EZ6 A;  2XVT A;  3LDA A;  5KFY A;  2AQ0 A;  5J2A A;  3Q8R B;  2FI1 A;  2RQ5 A;  3C21 A;  2HHU A;  9ICS A;  1NJX A;  4Y2J A;  4F50 A;  3OJU A;  4EEL A;  3IHQ B;  3MC1 A;  5HMM A;  5DG8 A;  2QB1 A;  3HIL A;  4OJO A;  4C8K A;  4DQR A;  1NKB A;  2BGW A;  2F1J A;  3BDP A;  4RT3 A;  3ONN A;  3MR6 A;  2PI4 A;  1XSP A;  1SWW A;  4O3N A;  4O3P A;  4C8O A;  2BQU A;  4BX9 C;  4O5E A;  1COK A;  3NVZ A;  1FFU A;  1TKD A;  4UB1 A;  3IV6 A;  4J03 A;  4UW9 A;  3KKA A;  2KHQ A;  5AKL A;  2A1J B;  3GIM A;  3U26 A;  2BCR A;  2D3D A;  4JWN A;  5ALN A;  2IA6 A;  4DL4 A;  8ICR A;  5J8Y C;  5DBA A;  5KG4 A;  1T4G A;  5ALZ A;  5KT7 A;  3DDH A;  5KG3 A;  3PR5 B;  5J0Q A;  4P4M A;  4YFK A;  5ALK A;  5AKE A;  4MF8 A;  1B4F A;  2BCS A;  1V97 A;  3QZ8 A;  3AUO A;  1DK2 A;  2ZIW B;  4R63 A;  4ED6 A;  4BJQ A;  4EBD A;  1ZJN A;  7ICP A;  1J2N A;  4GLX A;  1UHU A;  2YTU A;  1O08 A;  1F5S A;  2HVI A;  4MEY A;  2OWO A;  1ZQG A;  4FS2 A;  2AU0 A;  4C80 A;  4F5Q A;  4CGZ A;  3C2L A;  1QSS A;  1BNP A;  1JI7 A;  2HOF A;  4R8U B;  1JXL A;  3ZDB A;  3KD3 A;  3AMZ A;  5BOL A;  2Q0Z X;  2VA8 A;  2FLL A;  9ICR A;  5J0T A;  3SAF A;  3UXO A;  2HOI A;  2OCE A;  3H8J A;  2IHM A;  4M9H A;  4R66 A;  3BQ2 A;  5D49 A;  3TAP A;  3GV5 B;  1BPZ A;  3JPN A;  3M7D A;  8ICG A;  2KK0 A;  2ZJ8 A;  4FFD A;  4PL1 A;  5AKI A;  1S9F A;  3F5E A;  4QWA A;  4Y2V A;  2W9C A;  4Y2X A;  9ICK A;  1N61 A;  3OSN A;  2Y1J A;  1WCN A;  4MFA A;  3RTV A;  2MRL A;  3ED5 A;  1ED1 A;  1UT5 A;  5DDM A;  4M6W B;  5KFJ A;  9ICM A;  9ICB A;  4O3Q A;  5L1J A;  5EE3 A;  3FC4 A;  4RQ3 A;  2KV2 A;  1WUD A;  1K1Q A;  5ALJ A;  2I5H A;  1L7O A;  4IQW A;  3SEI A;  2DWQ A;  3SZ2 A;  4CF5 A;  5L1M A;  1N5W A;  2KFZ A;  2QB0 A;  4QZF A;  3CNH A;  4TUR A;  3C23 A;  5ALL A;  1FEZ A;  2GLE A;  1Q8K A;  2KG5 A;  1CI4 A;  1RG6 A;  3RB3 A;  4YMM A;  1S76 D;  3ZD8 A;  2BDP A;  5HR7 A;  1QQ5 A;  2F3N A;  2PI5 A;  5KFA A;  4NLB A;  1SKW A;  2HHX A;  3H0M B;  3I28 A;  2ZTE A;  5CB1 A;  8ICS A;  5KFW A;  1QSL A;  4UAZ A;  5L9X A;  3ZD9 A;  2ZJA A;  4RQ8 A;  4KIT B;  5C5J A;  5HR6 A;  1IXR A;  4ED1 A;  1UA0 A;  8ICM A;  2KMD A;  2ESE A;  1Z4O A;  2V4Q A;  3C5G A;  4J9Q A;  4DL6 A;  1X6J A;  3L5K A;  5AK3 A;  1ZQA A;  5KT6 A;  2G06 A;  1ZXI A;  3GV8 B;  2EAN A;  2DFL A;  2AGQ A;  5J0P A;  4ECU A;  4PZN A;  3T5L A;  1JUD A;  4O3O A;  4M9N A;  7ICK A;  2WTF A;  1KKX A;  4EEN A;  4RQM A;  4RNO A;  7ICT A;  1B22 A;  4DLE A;  1UA1 A;  9ICF A;  2OH2 A;  1L3U A;  4C8N A;  2B6G A;  1NK9 A;  5AM0 A;  2NRZ A;  7ICE A;  4ED0 A;  2CRX A;  4JK1 A;  1ZQR A;  1UQV A;  4IC9 A;  4DFM A;  4MHV A;  3PX4 A;  9ICH A;  1X9S A;  4NLZ A;  4YXM A;  2ZIW A;  3KZX A;  2XIC A;  4QZI A;  3ORY A;  2UVW A;  5KFX A;  2J6T A;  4RQ2 A;  4ELU A;  9ICG A;  5ALM A;  4DL2 A;  5K4L A;  2Y0S C;  3KKA C;  2E8M A;  2F44 A;  2GH1 A;  4OJ6 A;  4DQI A;  1KQQ A;  1MQ2 A;  1KL9 A;  2VIX A;  5L1K A;  1PVR A;  1LB2 B;  2L5Y A;  3GU3 A;  4YN4 A;  4R8U A;  2NRV A;  1ZQY A;  3NUQ A;  3JPP A;  1SKR A;  2R8H A;  1QH9 A;  3NVY A;  4IQV A;  3HKZ F;  5KFZ A;  3PX6 A;  3L3F X;  3QU4 A;  3WU2 U;  1WWV A;  4DWI A;  1RXV A;  4PZO A;  3OPX A;  2LPE A;  4I2A A;  5BOM A;  4LJX A;  2KFN A;  3TAR A;  2ZUC A;  4NM2 A;  3ZI4 A;  5J2G A;  2G5I B;  4Q8F A;  4I2F A;  2BDU A;  2GWS A;  4G3I A;  4KMU A;  4F5R A;  3HRD D;  1ZQF A;  5DKW A;  2NRX A;  1RQL A;  3MGI A;  4Z6F A;  4M6W A;  3F5A A;  4Y2P A;  5AKJ A;  8ICQ A;  3ZDE A;  1BVS A;  4O0I A;  2OM6 A;  2MU2 A;  2BCV A;  5DQH A;  4QZH A;  2YMQ A;  3TAQ A;  1JMS A;  4RQ0 A;  4O5C A;  4HAI A;  4C7Y A;  3K4G A;  1JRP A;  5CWR A;  4DF8 A;  2KIC A;  5AKK A;  4US8 A;  4Y2T A;  4I2E A;  4KLH A;  1K5O A;  9ICV A;  4IRC A;  4K4G A;  4OJL A;  3V7K A;  1ZQI A;  2XY7 A;  3RBD A;  3FAH A;  2BPC A;  4RQ6 A;  1VLB A;  1BPE A;  4NWI A;  5J2H A;  4EX7 A;  1NK8 A;  2ZUD A;  9ICN A;  2LMR A;  5J8Y A;  3RJI A;  4XQ8 A;  1NK0 A;  5BPC A;  4PHD A;  3C1Z A;  1ZOL A;  4Q43 A;  3D6J A;  3SEN A;  4DF4 A;  3LWL A;  3RAX A;  2WHE A;  3UQ2 A;  5KFU A;  1JN3 A;  2XCP A;  4EEY A;  2DKX A;  2XGQ A;  2W8L A;  2ZXH A;  1N63 A;  2NO5 A;  4CNQ A;  5KFI A;  4TQR A;  3WKE A;  4UBB A;  1MN8 A;  4EBC A;  2G08 A;  1K1S A;  1X40 A;  4PH5 A;  2H3Z A;  3EPI A;  3J81 j;  3PW4 A;  1ZQZ A;  5CJ7 A;  5ALD A;  2W8K A;  4ECV A;  7ICG A;  2YB1 A;  2MAX A;  5CEH A;  3KHL A;  3QEB Z;  4Y2Q A;  2KJ8 A;  5J0U A;  3RR7 A;  2RDI A;  2R8G A;  3E0F A;  4NLN A;  4KLG A;  2LYH A;  1KTQ A;  1IG6 A;  2F2A B;  1ZQD A;  2K8B B;  1ZQQ A;  2WF8 A;  4CF3 A;  4RQ4 A;  5L1I A;  3DEE A;  1Z19 A;  4QZG A;  2FJ6 A;  4GC6 A;  5AKY A;  1OUQ A;  3RJJ A;  4IQT A;  4BXO B;  3V7J A;  4KTQ A;  1NJY A;  3RB0 A;  4QNL A;  3A0B U;  1A76 A;  4ECT A;  1Z00 B;  3BQ0 A;  3PW5 A;  2EZY A;  2KIV A;  2Y1I A;  1NKE A;  3D2Q A;  2V9W A;  4QZA A;  1CUK A;  1S0O A;  2VJ4 A;  4QIW F;  4RU9 A;  3AL0 B;  1ZQU A;  1RDF A;  2QLT A;  1C7Y A;  4KLT A;  1RYU A;  1BGX T;  5AIC A;  1ZQH A;  3H4D A;  2AGO A;  3Q8Q B;  2EAO A;  4PGQ A;  1EXN A;  1URJ A;  2E8O A;  5KFR A;  4ZH4 A;  3QEA Z;  5JTI A;  3PML A;  3GIL A;  1ZQB A;  2EQY A;  4F93 B;  2Q4T A;  1ZQW A;  3MGV A;  2E8P A;  4C0Z A;  5J2B A;  2XCA A;  5HP4 A;  1KN5 A;  2JEF A;  3QX7 A;  4OJP A;  3AN1 A;  1KW4 A;  5J0Y A;  4DQS A;  3NAS A;  4B9M A;  8ICC A;  3RRH A;  2XY6 A;  4QWB A;  3M8S A;  4GXI A;  3IP4 B;  4KN4 A;  1J97 A;  2BKE A;  4DOC A;  4KLL A;  3B0Y A;  1TAM A;  4F92 B;  5EWF A;  1B0X A;  2C2D A;  1ZQE A;  4WJ3 B;  4F4W A;  2KTQ A;  1U4B A;  3RFA A;  2EZZ A;  5G5G A;  2H3I A;  2ALZ A;  4F72 A;  7ICU A;  4KLF A;  4DS5 A;  4DCC A;  5KFO A;  4I27 A;  4O3M A;  5J0X A;  3NRZ A;  2ZUB A;  2QAR B;  2E1F A;  3H0L B;  4XA5 A;  4PJ0 U;  2HVH A;  3RRG A;  5DG7 A;  4X5V A;  2C22 A;  3A0H U;  1XS9 D;  4F4Z A;  1NJZ A;  4XRH A;  2LYB A;  4KN7 A;  4JV2 A;  2KZZ A;  4J9O A;  1PK1 B;  2W04 A;  7ICV A;  1F0M A;  5J2I A;  5T14 A;  4K4I A;  3OHB A;  4BWJ A;  4DLG A;  2D6F C;  2RP5 A;  4UAW A;  3GZF A;  5IIJ A;  4FO6 A;  4I2G A;  3I76 A;  5AKZ A;  4U7C A;  3M9O B;  3SV4 A;  5ALH A;  4QZD A;  1QQ6 A;  4QIW C;  5AI0 A;  5GTH U;  1OW5 A;  4KX3 A;  3KFU F;  3TFR A;  4QZB A;  4F3O A;  4FBU A;  1MSW D;  4IQU A;  1SB3 C;  4M9J A;  2Y9T A;  2IOF A;  5III A;  4J9K A;  3MR5 A;  3MBY A;  3H4B A;  1NK7 A;  7ICF A;  1C20 A;  5KFG A;  4F5P A;  4PHE A;  3Q8K A;  3NS1 A;  2BHN A;  4QW8 A;  4OD0 A;  3WK4 A;  5J2K A;  1BPD A;  2W9B B;  1U9L A;  1ZQ1 C;  4XUS A;  2G0A A;  4E0D A;  1Q46 A;  4BXO A;  9ICU A;  3SAH A;  3S6J A;  1PK3 A;  3M8R A;  2KZ3 A;  3WK9 A;  5B5E U;  2FPL A;  3ISD A;  1Z00 A;  4TUP A;  5AI6 A;  2W7P A;  5KFV A;  5J0O A;  2XID A;  3QUT A;  1L5U A;  3E58 A;  2ATL A;  5F9N A;  5IIM A;  5J0S A;  1T3Q A;  2YQE A;  4YVZ A;  3KHG A;  4RPX A;  8ICL A;  3KTQ A;  2BPF A;  4RQ1 A;  4I2C A;  4M2Y A;  2IBK A;  2HBM A;  2HBJ A;  7ICS A;  2KJ9 A;  3F2D A;  7ICJ A;  4TUQ A;  2JGA A;  4YP3 A;  2P35 A;  1RM6 C;  1YT3 A;  5AK5 A;  8ICP A;  2XGP A;  5EWE A;  2M0N A;  3IN5 A;  3BS5 A;  1ZD3 A;  3V6K A;  3TAD C;  1D9F A;  2ZIV B;  5CHG A;  3T3F A;  4JV1 A;  8ICK A;  3BQ7 A;  4NLC A;  4QWC A;  2ZIU B;  2XI9 A;  4HYK A;  1A0P A;  3V6J A;  4MF2 A;  2E1E A;  5EE9 A;  8ICI A;  3K75 D;  4DSF A;  3RB4 A;  3LWM A;  2XY5 A;  3Q8P B;  3CP8 A;  1BPX A;  2LKY A;  5FP0 A;  4ICA A;  2JEJ A;  1JAL A;  5KT2 A;  2W54 A;  2I6X A;  2JHD A;  3QU7 A;  1S10 A;  4NY8 A;  3C5F A;  3QUC A;  3M9N B;  2VA3 A;  4OO1 J;  5GTI U;  3QUB A;  2G09 A;  1XSN A;  2HSZ A;  3JPR A;  3G6Y A;  2ZTD A;  1VDV A;  1RQN A;  4IR1 A;  1U47 A;  1SIJ A;  3WKB A;  1Z4N A;  1SWV A;  1BPB A;  4J9L A;  2QAR A;  1XWL A;  1TE2 A;  5CRX A;  3QZ7 A;  4KLO A;  3GV7 B;  5KT3 A;  4J9M A;  4IRD A;  3PV8 A;  5KFD A;  2LI6 A;  1PK1 A;  3MR2 A;  1CRX A;  5DG9 A;  5EOZ A;  4ELT A;  4ECS A;  3PR4 A;  5TIS U;  1SZP A;  2YY6 A;  1V9P A;  5AM3 A;  1JX4 A;  3UXN A;  1FFV A;  4DL7 A;  1BPY A;  4I2H A;  9ICE A;  1S8O A;  1SXE A;  1D8B A;  4RUA A;  5IIL A;  2A1J A;  1TVA A;  3QU2 A;  5IIK A;  3EYZ A;  3KOO A;  4B9V A;  2QKQ A;  1NJW A;  5DQI A;  2OEH A;  2NYV A;  2AGP A;  3BQT A;  4FZL A;  2A3V A;  2IOH A;  4YR0 A;  4CRX A;  5ALR A;  5KG1 A;  2BR0 A;  5KFE A;  3WKD A;  2CXY A;  4ECX A;  3PY8 A;  4NLG A;  4KLI A;  3RH4 A;  4YR2 A;  3C1Y A;  1T7P A;  3PSP A;  1ZQM A;  5HNK A;  3TAN A;  2JEI A;  3WKC A;  3OGU A;  3MFH A;  1H38 A;  3ICX A;  1O03 A;  4UB4 A;  1L7N A;  2W9B A;  3G6V A;  2H3F A;  3LVW A;  2ZXI A;  5KAI U;  1NNL A;  4Q45 A;  3F2C A;  5TZV A;  4U6P A;  2KVC A;  1DGJ A;  4CDG A;  1TK8 A;  1HUO A;  2KP7 A;  4F91 B;  7ICO A;  1KDH A;  4RQ5 A;  4I2D A;  4DQQ A;  1U48 A;  3N4M B;  5J2J A;  5DGA A;  4ED3 A;  5DB7 A;  1J2M A;  1Y88 A;  3ZDC A;  5DQG A;  2ES6 A;  2GO7 A;  2H3Q A;  4NXZ A;  2AXT U;  4B9U A;  1PVQ A;  1SL1 A;  3GFK B;  1SXD A;  2AH5 A;  3H8W A;  3EWA A;  2ISO A;  8ICA A;  4DSL A;  4P4O A;  5KL1 B;  9ICI A;  3CYM A;  3EW9 A;  5KAF U;  3Q8L A;  3ZDA A;  2ZIU A;  4UB2 A;  4I2B A;  1L3T A;  5JU5 A;  1ZQL A;  3K1R B;  4BDP A;  2W55 A;  1L8L A;  2HBK A;  4GFJ A;  5EE0 A;  3ETR A;  3WK5 A;  4DSI A;  2F8L A;  5KFL A;  4P0Q B;  2K60 A;  4C4S A;  3NVV A;  7ICI A;  3ISB A;  1N2X A;  2I9G A;  3OHA A;  2C2R A;  5JUM A;  7ICQ A;  1ZQS A;  5HHI A;  2XC9 A;  1KBU A;  3B0X A;  4OCZ A;  3M6Z A;  3N28 A;  3CW2 C;  2FLP A;  3MDA A;  8ICV A;  2KE7 A;  5DLG A;  4DL5 A;  4RNN A;  3JPO A;  1TK5 A;  4AP9 A;  3RH5 A;  5ALF A;  5CA7 A;  2PMZ F;  3HWT A;  2BQR A;  2RHF A;  1RYS A;  2Z7J A;  3BZK A;  4C4R A;  4IRK A;  2F77 X;  3SI8 A;  4BWM A;  3PST A;  4JUZ A;  4Y2S A;  1X9M A;  3N97 B;  2FPK A;  2W3R A;  1TAQ A;  4LZD A;  3G6X A;  1KEJ A;  2HHT A;  2KSO B;  3Q8S B;  1M6Y A;  9ICA A;  3HKZ C;  5KG5 A;  2BZF A;  1ZD5 A;  4MEX A;  2WF9 A;  3HT3 A;  2AJQ A;  8ICX A;  4A8E A;  1ARO P;  2ASD A;  2LM1 A;  1RZT A;  4PHP A;  4JWM A;  2HHQ A;  2PKE A;  2DBY A;  5ALE A;  5AIB A;  2DQN B;  1S0N A;  2P66 A;  3RJK A;  5KTQ A;  4GC7 A;  3OSP A;  4I28 A;  2R8J A;  3IDW A;  5ALS A;  4RZR A;  2PFP A;  4LZG A;  1IIP A;  1QLN A;  4FZN A;  3H0R B;  4M0A A;  5KFK A;  3SD7 A;  4YQW A;  2KN7 A;  5ALG A;  3GDX A;  1SGG A;  2LYA A;  2HI0 A;  2HMX A;  1IM4 A;  4JB3 A;  2A1A A;  2F76 X;  2WF5 A;  2KKP A;  2HHV A;  1T3N A;  1MA7 A;  2NO4 A;  3L4P A;  3TAD A;  1B43 A;  3AQF A;  1SL2 A;  1F44 A;  3M6K A;  1SL0 A;  1VJ5 A;  4ACO A;  4P0P B;  5D46 A;  1P7D A;  2OHF A;  4B6J A;  4QW9 A;  1BNO A;  3N7P D;  2KHV A;  5KFT A;  3PVX A;  1D9D A;  1X2I A;  2PMZ C;  3RB6 A;  1S97 A;  2KOB A;  4YG2 A;  4F4K A;  5AKG A;  4GIB A;  7ICL A;  2F1H A;  2J6U A;  3BS7 A;  3RJE A;  4EEK A;  2MUT B;  2YB4 A;  9ICQ A;  4NLK A;  3WKA A;  1UPH A;  2J6S A;  5ALU A;  4F71 A;  1N56 A;  2IOF K;  4Z6D A;  4UAR A;  2HHW A;  3RR8 A;  4PHA A;  3O0F A;  2YMP A;  2A19 A;  4QJF B;  4YMN A;  2AHO B;  2I1Q A;  2WAQ F;  3N7R C;  4IL6 U;  2JRZ A;  3RBE A;  4O3S A;  2YML A;  3T5K A;  2ASL A;  3NRW A;  4I29 A;  4UB6 U;  4NL9 A;  2JH1 A;  1WWU A;  1KFS A;  3H40 A;  2R18 A;  2M9N A;  3SR6 A;  4F5O A;  2K4P A;  4P4P A;  2W9C B;  5F9L A;  2KEY A;  3QYP A;  4C4T A;  3SAG A;  1HEK A;  3SMV A;  5KT5 A;  4DL3 A;  5KL8 B;  4UB8 U;  2JV3 A;  4RPZ A;  3RJF A;  7ICM A;  4KLM A;  5J2D A;  2NRT A;  2P6R A;  2KD1 A;  4J9R A;  2LM4 A;  4DSK A;  3IM1 A;  4KLE A;  8ICB A;  5EWG A;  2D8C A;  4EBE A;  3PNC A;  1UT8 A;  4ECY A;  3V72 A;  2RDJ A;  4O3R A;  3PZP A;  4QZ8 A;  4IS7 A;  4ECW A;  2JEG A;  9ICC A;  4J9N A;  1NK4 A;  4DS4 A;  3QXG A;  2HHS A;  4RUC A;  5KFC A;  3SV3 A;  4JV0 A;  4UB3 A;  1Z3E B;  5ALO A;  5F3X B;  5DB6 A;  1DOQ A;  1WYG A;  3TQ1 A;  4ELV A;  3KZI U;  3E2E A;  3VC8 A;  1TFR A;  1JIH A;  3UMC A;  5G5H A;  4M9L A;  3FYH A;  2WFA A;  4UAT A;  2KKV A;  4QZC A;  2KSO A;  1L3S A;  1KFT A;  4G9B A;  1SV0 C;  4Y2U A;  2DPI A;  3PO4 A;  4KLU A;  2OYY A;  5KFB A;  4ED8 A;  2WB1 F;  1TAU A;  1NI3 A;  3EUB 2;  2NV3 A;  3KBB A;  3H8M A;  4CF4 A;  1ZD2 P;  5AI5 A;  1WG8 A;  2K4E A;  1D8Y A;  2W3S A;  4YMO A;  2C2E A;  2WAQ C;  3NTU A;  5L1L A;  1ZYQ A;  2FLN A;  4C8L A;  2R8K A;  1S5L U;  4YR3 A;  3M9M B;  4YXJ A;  3CRX A;  5AM4 A;  5ALI A;  3MFI A;  3EPG A;  4DFD A;  2KNJ A;  3PW0 A;  3GII A;  2XO7 A;  2H3V A;  5J2C A;  1COO A;  2VA2 A;  3OJS A;  4ECR A;  2K4I A;  1GO3 F;  5KT4 A;  3C29 A;  4I2I A;  4UAV A;  4DFP A;  2BCU A;  4M47 A;  4KLS A;  4P0P A;  4CE6 A;  3KHH A;  1V38 A;  1XO1 A;  1L8O A;  3TI0 A;  2EH9 A;  8ICH A;  3AM9 A;  2K8C B;  4AYB F;  4C7Z A;  4RNM A;  2WF6 A;  5AK4 A;  2K89 A;  1T94 A;  3LVV A;  1ZQT A;  2DF4 B;  2HCF A;  4US9 A;  2MUT A;  3GIK A;  4MFF A;  4RT2 A;  2JXJ A;  5J0W A;  3PSI A;  1KSP A;  1WCL A;  3HX0 A;  3QU9 A;  4F4Y A;  1L7M A;  2VJ5 A;  3C28 A;  1ECW A;  2IHN A;  2BCQ A;  2RRD A;  4O9M A;  3MAB A;  1HUZ A;  3LK9 A;  1RXW A;  3IG5 A;  3AQE A;  1LVH A;  2FMP A;  4ECZ A;  5KFF A;  1ZQJ A;  2LBO A;  2H5X A;  3UMG A;  1YZ6 A;  2WB1 C;  2BPG A;  5AI4 A;  5IIN A;  1NK6 A;  4DOA A;  1ZET A;  2ZIX B;  1PVP A;  1KRP A;  1Q3U A;  3FDS A;  2KVS A;  3TAC B;  4LVS A;  3ISC A;  2YMM A;  7ICN A;  3QE9 Y;  5ALW A;  3R9K A;  2B0C A;  8ICU A;  2YX8 A;  2Y0S F;  5CR0 A;  4RPY A;  4O5K A;  1N48 A;  2ZTC A;  8ICN A;  1S0V A;  3HJE A;  4ECQ A;  4NL9 C;  2W03 A;  2G5H B;  2KIW A;  3WK7 A;  1LKY B;  1XC9 A;  1QSY A;  4Y2R A;  3F53 A;  1PZN A;  2JZB B;  2ZG6 A;  2EAP A;  2FPM A;  3IRU A;  4KMO B;  5ALT A;  3T5H A;  3PX0 A;  1NZB A;  4NJ8 A;  4J9P A;  4PGY A;  2EDU A;  4AYB C;  3LYS A;  2K8A A;  1KLN A;  2YN4 A;  4FBT A;  3K1Z A;  4NV0 A;  5J29 A;  3UQ0 A;  5HML A;  1RPL A;  2KZM A;  2HBL A;  4EZ9 A;  3SYZ A;  2MSN A;  1QTM A;  3OTQ A;  2O6K A;  2F1I A;  1XNS A;  1MQ3 A;  1ZRM A;  3HW8 A;  3THV A;  3QU5 A;  1DRG A;  2BQ3 A;  2W9A A;  3H7I A;  4BGD A;  1X9W A;  1NKC A;  2JR5 A;  4UB5 A;  3PW2 A;  1ZQN A;  2UVU A;  1RYR A;  2DKZ A;  1YZ7 A;  2HW3 A;  2W11 A;  5AKH A;  3H8S A;  4YCX A;  2K4H A;  9ICO A;  4DSJ A;  5AI8 A;  3AU6 A;  5DB9 A;  5J2F A;  2JMG A;  4QWE A;  1T8E A;  2FMS A;  4YD1 A;  2P6U A;  4GXK A;  3JPS A;  4Q8E A;  2W9M A;  1ZQV A;  3B9J A;  3MDC A;  3V6H A;  4B9L A;  3HPO A;  4KLJ A;  1ZQC A;  3HP6 A;  5KG7 A;  2OXO A;  9ICX A;  3WK6 A;  4DFK A;  2FDR A;  2DUY A;  2F8K A;  9ICT A;  2ZIV A;  3RAQ A;  3NVW A;  2E5S A;  4UAU A;  3ETL A;  3PO5 A;  4UQG A;  1DK3 A;  1X6I A;  3UPQ A;  3F2B A;  3N7S C;  5B66 U;  2ODG A;  5AM5 A;  4K4H A;  2R8I A;  1ZQO A;  2DPJ A;  2ZIX A;  1U45 A;  1S77 D;  5AK6 A;  4CCH A;  1N5X A;  4JMU A;  3I1Y A;  9ICW A;  1ZJM A;  2E3T A;  8ICT A;  4Q44 A;  2PFN A;  1X66 A;  3ZDD A;  2UVR A;  5ALY A;  1SV0 A;  5IIO A;  2KJ5 A;  1NZP A;  3T5J A;  3D2N A;  3AEV A;  5C0Y A;  4Y2Y A;  5KFP A;  1S0M A;  1Z1B A;  4F2R A;  2UVV A;  1DGS A;  2N1R A;  4UBC A;  3PMN A;  1QQ7 A;  3IG8 A;  5CP2 A;  9ICJ A;  5DDY A;  4EYH B;  3RJH A;  1LKY A;  4PL2 A;  3GIJ A;  4UAY A;  1SKS A;  7ICH A;  3JPQ A;  5EE1 A;  3TKA A;  4USA A;  4GXJ A;  3PSF A;  3T79 A;  3D2S A;  2GOL A;  2JZB A;  1HJP A;  1NOM A;  4DO9 A;  4DQP A;  2DGZ A;  1LV5 A;  5AM2 A;  2CPR A;  1ZQP A;  5AM1 A;  5KFH A;  5J2E A;  4KLD A;  4RQ7 A;  1MC8 A; 
#chains in the Genus database with same CATH homology
 5JU5 A;  1LKY B;  1SXE A;  3K1R B;  3KKA A;  1X9X A;  4MHV A;  1SV4 A;  2D3D A;  1SGG A;  1PK1 B;  1V38 A;  5JRT A;  5J8Y C;  1F0M A;  2EAP A;  2E8N A;  3SEI A;  3BS5 B;  2K60 A;  2KIV A;  2QKQ A;  2D8C A;  3BS5 A;  2F8K A;  3TAD C;  5L1M A;  2LMR A;  4NJ8 A;  5J8Y A;  2DL0 A;  5KNI A;  4RQN A;  3BQ7 A;  3KKA C;  2QB0 A;  2E8M A;  2F44 A;  4IS7 A;  3TAD A;  1DXS A;  3SEN A;  2GLE A;  1RG6 A;  2EAM A;  2KG5 A;  1B4F A;  2EAO A;  5F3X B;  2L5Y A;  2E8O A;  2KE7 A;  1OW5 A;  2F3N A;  2YTU A;  5JTI A;  1V85 A;  1Z1V A;  2DKX A;  1WWV A;  2KSO A;  2E8P A;  2QB0 B;  1OXJ A;  2Y9T A;  3BS7 A;  1SV0 C;  4PZO A;  2LPE A;  1X66 A;  1KW4 A;  1JI7 A;  1SV0 A;  1X40 A;  3H8M A;  2KMD A;  2ESE A;  1UCV A;  2FE9 A;  2EAN A;  2KSO B;  2Y9U A;  3TAC B;  2QAR A;  4PZN A;  2DKZ A;  1B0X A;  1LKY A;  4NL9 A;  1WWU A;  2QB1 A;  4RQM A;  3HIL A;  2ES6 A;  1PK3 A;  2K4P A;  1PK1 A;  1SXD A;  2B6G A;  3IDW A;  1COK A;  2QAR B;  4NL9 C;  1UQV A;  2JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...