3KKAA

Co-crystal structure of the sam domains of epha1 and epha2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
DGIPYRTVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGITLPGHQKRILCSIQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-A RECEPTOR 1
publication title Co-Crystal Structure of the SAM Domains of Human Ephrin Type-A Receptor 1 and Human Ephrin Type-A Receptor 2
rcsb
source organism Homo sapiens
total genus 19
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3kkaA00
2EANA 3TACB 4PZOA 3BS5B 1B4FA 5J8YC 1OW5A 2B6GA 3TADA 1SV0C 2KMDA 2QARA 4IS7A 1Z1VA 1LKYB 1UCVA 4NJ8A 1UQVA 1PK3A 1SV4A 2E8MA 2DKZA 4RQMA 2QB1A 3KKAA 1RG6A 3SENA 2KIVA 2LPEA 2D8CA 2F8KA 2K60A 2KE7A 3SEIA 3BQ7A 2QB0B 1COKA 2JV3A 3H8MA 1X66A 1SV0A 5L1MA 3IDWA 2E8PA 1SXEA 2FE9A 1OXJA 1WWUA 5KNIA 2ESEA 5JTIA 1WWVA 2QKQA 4NL9C 2Y9UA 2E8OA 5F3XB 3BS5A 1PK1B 2K4PA 1LKYA 1X40A 2KSOB 5J8YA 3TADC 2EAOA 2L5YA 1V85A 2ES6A 3HILA 1JI7A 3KKAC 1PK1A 2YTUA 2E8NA 4RQNA 3K1RB 2Y9TA 2QB0A 1SGGA 2DKXA 1F0MA 1DXSA 1B0XA 5JRTA 2DL0A 1V38A 2KG5A 2GLEA 5JU5A 2F44A 1X9XA 4PZNA 2F3NA 2LMRA 2D3DA 2QARB 4NL9A 1SXDA 4MHVA 1KW4A 2KSOA 2EAPA 3BS7A 2EAMA
chains in the Genus database with same CATH superfamily
3KD3A 1TAUA 1C20A 2EZZA 4YXMA 1X9SA 5GTIU 4BJQA 3KTQA 5ALPA 3UMBA 4ED2A 2ZG6A 2EDUA 2K8BB 1MSWD 2OCEA 4O9MA 1FEZA 4RQ6A 4CGZA 4F5QA 4O5CA 5K4LA 3RH5A 1ZQ1C 5KFKA 1QQ5A 5DKWA 8ICCA 2BKEA 4J03A 1XNSA 2WF6A 2AQ0A 2BPGA 2JGAA 1SV0A 5L1MA 1NOMA 2W9CB 9ICXA 1DGJA 4QWCA 4C0ZA 7ICTA 3PNCA 1MA7A 1ZQRA 5JTIA 4CCHA 5BOMA 3HP6A 4Q44A 3C2KA 4O3OA 1J2MA 2E8OA 5CA7A 1KSPA 2K8CB 1S77D 1S97A 4I2CA 2VJ5A 4C4TA 3JPNA 2YY6A 4JMUA 5HHHA 4TQSA 4I27A 2NYVA 2K4HA 3PVXA 4QZCA 1ZQNA 3B0XA 4OCZA 4UB1A 3AL0B 3HILA 1ZXIA 1ZQJA 2YTUA 3M9OB 3ETLA 2I5HA 1YT3A 5DB9A 1WCNA 2AH5A 5J2BA 4F4WA 3PY8A 1B0XA 5JRTA 4CF4A 2DL0A 2MA1A 1IG6A 2ALZA 2R8GA 4Z6DA 3GDXA 3G6YA 1XC9A 3RJJA 5KFVA 3KHRA 4KLHA 2ZJ8A 4MHVA 3WKAA 3FYHA 3CNHA 5KFFA 1XO1A 3K4GA 5IIMA 3M6KA 2OYYA 4R8UA 5J8YC 4EBCA 1PZNA 2LKYA 4IS7A 3V7KA 2KVSA 4B9MA 5KFRA 3M8RA 4RQMA 3UMCA 2HBMA 1U47A 1QTMA 1NJZA 4ED7A 4DO9A 4O3MA 1KFDA 3UQ0A 5ALTA 4CE6A 2K60A 4F8RA 4Y2PA 5AI6A 4DL2A 9ICNA 1RQNA 2H3FA 1LVHA 4EENA 4UB6U 2QLTA 5KL8B 1RXVA 1NJYA 3F53A 1TK8A 3THVA 1X9MA 2AJQA 3TQ1A 3F5EA 2XIDA 5KT7A 5J0TA 8ICEA 5DQGA 4ECWA 4DL4A 4OJOA 3VC8A 3GV7B 2J6UA 2ZTDA 3V7LA 5G5HA 4C8MA 4YMNA 1Z3EB 3PR4A 2E1EA 4UATA 1L7PA 2RP5A 5J2FA 1D8BA 8ICYA 2BGWA 2L5YA 1RQLA 2LBOA 3MGVA 5AM0A 3PV8A 2ODGA 2JZBA 3PX4A 2W55A 4RNMA 4QJFB 1SGGA 2V4RA 4JB3A 4R66A 1HUZA 9ICAA 4ECZA 1ZQOA 2ZJAA 2K89A 7ICKA 1NKBA 1D8YA 1ZQXA 2PXIA 4JV0A 2BDPA 5EWGA 2RDJA 4ACOA 1RYUA 2F44A 2WHEA 2HHVA 4JV1A 3MDCA 5C0YA 5AKZA 5H2FU 2IA6A 5CWRA 1QQ7A 4KN7A 4CF5A 4DL5A 3GZFA 1WUDA 4PZOA 1B43A 1OW5A 5DGAA 1FFUA 5ALMA 2YB1A 5AI4A 2YMLA 4DFPA 8ICAA 4NLZA 5KT4A 5KFNA 5DLGA 4BX9C 1T8EA 2XCAA 9ICWA 2KZZA 1QSLA 4JK1A 1SIJA 3C29A 1NK8A 3ZDCA 4LVSA 2AGOA 5KFXA 2A1JB 2MAXA 3GU3A 4CRXA 3RJEA 5J2DA 2FMSA 2WTFA 4YFKA 4EYHB 3E2EA 3IG8A 2FPKA 1SKSA 7ICSA 4F4YA 1D9FA 2LI6A 3TARA 3SR6A 4DSIA 3OPXA 3RFAA 3BQTA 2K4EA 2EH9A 4KMOB 4KLJA 5ALDA 2KSOB 2KJ9A 2J6SA 2HBLA 5J8YA 1ZQBA 1N62A 2DWQA 4DS5A 4RQ8A 4LJXA 2FMQA 1V85A 2AHOB 4J9KA 2ISOA 4KMUA 3GV8B 1XSPA 1A0PA 2FMPA 1ZQHA 3MR2A 1FFVA 2AQ4A 5KFIA 2XGPA 4YN4A 1BNOA 3Q8QB 4QZ9A 5ALSA 4PJ0U 2RRDA 1JUDA 3CRXA 4OD0A 8ICUA 2YQEA 1NK6A 1EXNA 2EQYA 5KG7A 4FE3A 4NLKA 5L1KA 1HJPA 1ZETA 1XS9D 4DSEA 5DG9A 2HBKA 1KFSA 5KFJA 2J6TA 3RRHA 1C7YA 4DLGA 1NJWA 5ALZA 2HHXA 8ICXA 2ZTEA 1PUZA 4ECVA 3HJEA 2HHWA 3T79A 3AQEA 3CYMA 4Y2JA 3SAHA 1KQQA 2KJ8A 4GC7A 3S6JA 4B9NA 4KN4A 4IQWA 4DQQA 1ZJMA 3IM1A 4IRDA 3M9NB 3NASA 5EWEA 4PH5A 2FE9A 1UA0A 4J9RA 2KV2A 4I28A 1TAMA 3C28A 2W9BB 1ZQMA 3H40A 3J81j 3GIIA 2G08A 1NK5A 1ZQEA 3K1ZA 1NJXA 3MGHA 5DQHA 5KFDA 5L1IA 3F5AA 7ICEA 8ICSA 3M1YA 4QZIA 8ICLA 1TAQA 2UVVA 5AM4A 4US9A 2W7OA 3TFSA 1CUKA 1ZQZA 3KKAC 1KL9A 4GXIA 2GOLA 1BVSA 1ZQSA 1XSNA 3QX7A 5J0RA 2Y1IA 3O0FA 1KEJA 2JEGA 2KG5A 3MR5A 2CN1A 2BR0A 1AQ6A 2Y1JA 3PO4A 3ETRA 1BNPA 5F9LA 2N1RA 5KT2A 1ZQUA 4M6WB 5DLFA 2ZIUB 1ZQYA 2W04A 3HKZF 3EWAA 4XUSA 1ZQPA 3BS5B 3SV4A 2KNJA 3RAXA 2OM6A 2EZXA 1SV0C 5JUMA 3AU6A 2A19A 4CNQA 3QU5A 3SAFA 4Z6EA 2BQRA 2H3IA 3RH4A 1IIPA 4OO1J 2W3SA 3SENA 4MFCA 3KZXA 3CW2C 2ZIVA 2LM4A 2F8KA 4DEZA 1LB2B 3H4DA 3ISBA 3LK9A 1A76A 3ZDAA 2QB0B 5DG8A 9ICOA 1YZ7A 4Y2VA 4FS2A 2JXJA 3LWMA 4RUAA 8ICZA 2HMXA 1PVRA 3RB6A 4X5VA 1JX4A 1AROP 4QW9A 4Y2SA 4M9JA 4M9HA 3FC4A 1RPLA 4RQ5A 4DOAA 1ZOLA 3U26A 1ZQCA 5HMMA 2Z7JA 1SZHA 5ALLA 4QIWC 1JXLA 2DPJA 2UVRA 5T14A 4DLEA 2ASLA 1ZRNA 5J2AA 2FLNA 4PHEA 4NLNA 3KFUF 3N7SC 3UXOA 3C23A 1KTQA 1VDVA 4PGYA 1ZD2P 3C2MA 2KP7A 1UT8A 3QU2A 2ASJA 1NI3A 3D2QA 5ALIA 4RQ2A 4M2YA 2W9CA 1DRGA 2BPFA 4RPZA 8ICJA 1FIQA 5ALWA 3RJKA 4OJ6A 5DGBA 1Y88A 5J2CA 3M8SA 4KLQA 4C4SA 3Q8KA 8ICGA 3DDHA 1Q46A 3PX6A 4DL7A 4Y2TA 5CEHA 3WKCA 4R65A 2FLLA 1YZ6A 7ICVA 2MUTB 3C21A 1L5UA 4NLCA 4P0PB 2KK0A 1UCVA 3RJIA 5KG5A 2ZUDA 1RYSA 2C2DA 1QLNA 1SV4A 1Q3UA 4KLUA 3KKAA 4DF8A 5ALVA 4I2BA 5KL1B 2D8CA 2NRVA 4O5EA 3SEIA 2G09A 5L1LA 1COKA 3B9JA 4M47A 2NO5A 1S8OA 1JALA 4F71A 4IC9A 4EBEA 4QZHA 3GIMA 4NL9C 2KKVA 3PW5A 2I6XA 2JH1A 2OXOA 4RPYA 2C22A 5F3XB 3H7IA 5GTHU 4YCXA 4ELUA 1BPBA 3N7PD 5HP4A 3ALRA 3JPSA 2VA3A 4ECQA 1L6NA 5KT3A 3TADC 2HOFA 2VKQA 2RHFA 4DS4A 1U9LA 4I2JA 3PW4A 3BDPA 1WG8A 5B66U 2A1AA 3LWLA 4RUCA 4RNNA 4ECTA 2H3QA 1QCKA 4MFAA 2ASDA 2ZIXB 3H0MB 4DSKA 4KLOA 3SI8A 2R8JA 4B9TA 5KFSA 3PO5A 4PZNA 5CP2A 8ICIA 1HIWA 1ZQQA 3WKEA 2ZTCA 1SXDA 3RR8A 3D6JA 1V97A 3WK4A 2YX8A 2EAPA 3AUOA 5ALUA 2W03A 4KTQA 9ICSA 3HT3A 3WK7A 1KKXA 4Y2XA 3QEBZ 2DKZA 4UB3A 4KLDA 2W9AA 4KLGA 5IILA 3ZD9A 3NGDA 4C4RA 2KIVA 1ZQVA 3QU4A 4DQRA 5L9XA 2BQ3A 2FPLA 2PI5A 7ICQA 2V9WA 4J9MA 4KITB 1KFTA 4ED3A 2JV3A 4K4IA 3SAGA 3RJGA 2BQUA 1L8OA 2H3VA 4BGDA 2ESEA 1QSYA 1D8LA 3IV6A 1NKEA 8ICHA 3ISDA 4UB5A 2HSZA 7ICFA 2ISPA 3F2CA 2FI1A 2EZYA 2DGZA 5HHIA 1TVAA 3AM9A 3E58A 4RNOA 2XY5A 3PW7A 2OHFA 3G6VA 1PK1A 1Z4NA 3MFIA 4QW8A 5AI0A 2Y9TA 2A1JA 3BZCA 2W43A 3FDSA 4B9UA 2DKXA 4DFMA 4YP3A 1DXSA 4QZFA 1H38A 3N7RC 1V38A 4FZLA 2WB1C 4MEYA 4J9PA 1J2NA 3RAQA 3NVYA 4MEXA 1JXEA 2LYBA 4Z6CA 1SKWA 4NL9A 3OJSA 5CHGA 4C7ZA 2DF4B 2KSOA 4QZDA 4GC6A 4FS1A 8ICVA 1BPYA 3UM9A 3RH6A 3RB3A 1BPEA 2CPRA 3MGIA 3TADA 1NK9A 4Q45A 1K5OA 2G5HB 3QU9A 4M9LA 2BPCA 9ICLA 2QB1A 3LYSA 2LM1A 1KN5A 4QWBA 7ICMA 5ALRA 4PHAA 1CRXA 5IIJA 4QZ8A 1NZBA 2IBKA 2KE7A 4F72A 4UB4A 3TAPA 4G9BA 2M0NA 3BQ7A 1NK4A 2WF9A 5CRXA 1T94A 1SKRA 1ZQDA 2MU2A 1SXEA 1L8LA 4ECXA 5F9NA 1WWUA 2VIXA 3KOOA 2CRXA 3HW8A 4J9SA 4GIBA 2WB1F 2VA2A 3NS1A 4I2DA 8ICNA 1PK1B 8ICWA 1KBUA 2K4PA 3OHBA 1X40A 4FFDA 3H0LB 2BCUA 5TZVA 4F3OA 2RQ5A 3PSPA 3PSIA 4P0QB 9ICIA 1UHUA 1TK5A 1ZD4A 4US8A 3QUCA 4UAVA 2E8NA 5D4BA 3BJYA 2ZIWB 4HAIA 3C5GA 1L7MA 3NVVA 4CDGA 1SWVA 4OJLA 5EE0A 4BUGA 4O3PA 5J2JA 3I1YA 1ZQFA 2GLEA 3OHAA 2W9BA 5J2EA 2WFAA 3BQ2A 2HHQA 1TFRA 1URJA 4YG2A 1F44A 1ZQAA 4UAUA 2KHQA 3ZD8A 2EAMA 2JEJA 4UAZA 5IIOA 1XO0A 1S0VA 2ZJ5A 5DB8A 3AU2A 1SL1A 4R64A 2QARA 3ICXA 4J9OA 1K1SA 2FLPA 5ALEA 3AMZA 2ZXHA 2W8KA 2HW3A 4GLXA 4F50A 4EELA 2VA8A 4QWDA 2HOIA 2W9MA 3NTUA 2KN7A 4Z6FA 3A0BU 3IDWA 1BPZA 4ICAA 2DQNB 4RQ4A 4M6WA 1N48A 2ZIUA 3JPTA 2KKPA 4ED8A 3V72A 4ELVA 5HR6A 9ICEA 4AYBC 3BS5A 4YD2A 2GO7A 4LZDA 3K75D 4J9NA 5KG1A 3WK6A 1ZQTA 1IV8A 2PMZC 5IIIA 5KFEA 4K4HA 2KEYA 3KHGA 4P4OA 5KG6A 4AP9A 3MR3A 1Z4OA 2P6RA 4ED6A 5AIBA 1S0OA 1L7OA 3GILA 4FBTA 2E5SA 2QB0A 3C2LA 3PW0A 1U49A 1RZTA 4I2AA 4B9SA 3UPQA 1Z19A 2P35A 2G07A 2WF7A 4IQTA 3RB0A 1JIHA 1N61A 4F93B 2QARB 5KFBA 1Z00B 5DBAA 5TISU 4NM2A 4RT2A 3R9KA 3TACB 2F2AB 4J9QA 2HBJA 3GFKB 5AM2A 1TKDA 8ICFA 2LYAA 1L3TA 3GIJA 4I2FA 4DOCA 1SL2A 4AYBF 3QZ8A 2PFPA 9ICCA 2WF5A 4EEYA 2BDUA 5CB1A 5DB7A 3OTQA 3MC1A 4Y2QA 3NRZA 2JHDA 4TUSA 1MQ2A 2E3TA 1A77A 2LPEA 9ICHA 2DPIA 2JRZA 3AEVA 3EW9A 4UASA 2IMWP 3DEEA 5AI9A 3ED5A 7ICRA 2PKEA 3ZDBA 2BHNA 2XO7A 4DF4A 3LVWA 4Q8FA 2FDRA 2QKQA 3TKAA 3C1ZA 5EWFA 1VLBA 4KX3A 1D9DA 5KG4A 1L7NA 5AKXA 4IR9A 4F2RA 2C2RA 1UPHA 3ZI4A 9ICUA 3MDAA 2MUTA 5KT5A 4YXJA 4I2GA 3HRDD 4P0PA 4QNLA 4C8OA 2EAOA 2F1JA 2IOHA 1X2IA 5BPCA 2KJ5A 2NRTA 4I29A 3V6HA 7ICUA 3ISCA 3T5JA 5KFMA 2P6UA 2E1FA 2ZUBA 3QZ7A 4DL6A 3KZIU 3IG5A 4EYIB 2NRZA 4JWMA 4RQ3A 5AM5A 4NWIA 5KG2A 1ZJNA 2F1IA 3Q8RB 2KVCA 5DG7A 3ZDEA 1BPXA 5KAIU 3N97B 3OSPA 4BDPA 1RYRA 4KLEA 2JR5A 3G6XA 2AGQA 1NKCA 2BCRA 3HPOA 3NVZA 3SQIA 3GV5B 4JUZA 2ATLA 1KW4A 4YR0A 4QWEA 1RXWA 4UAYA 2HDOA 3EZ5A 2MRLA 4HYKA 1Z1VA 1LKYB 2RDIA 3QUTA 4C7YA 2NRXA 3QNMA 2PFNA 3NVWA 3IHQB 4M0AA 2ZXIA 4PPXA 1N5WA 1IM4A 2GH1A 2ZIXA 5HNKA 3N28A 3AN1A 2HHUA 3SMVA 4O0IA 3OJUA 4F5PA 4QZEA 2KZMA 4UBBA 4YVZA 1CI4A 8ICMA 1DGSA 1S10A 5KNIA 3PW2A 3F2DA 2P66A 1S9FA 9ICPA 4YR2A 1X9WA 4QIWF 5AIAA 2O6KA 1V9PA 4UB8U 4KLIA 3I76A 3V7JA 1X42A 4F4KA 2ZUCA 5KFUA 2B0CA 2XCPA 2R18A 3GQCA 2K4IA 4NV0A 2VJ4A 1ECWA 3JPPA 5J2GA 2NRWA 3WK8A 1QSSA 2AXTU 7ICJA 1GO3F 2KZ3A 4G3IA 5AHXA 2B21A 3RB4A 2G0AA 5KFCA 1TV9A 3Q8SB 5KFQA 1F0MA 4DWIA 1QQ6A 4LZGA 4B9VA 4UW9A 2V4QA 1FO4A 1S5LU 2PFQA 1ED1A 1T4GA 5FP0A 2F3NA 3F2BA 4IRKA 1O03A 1XWLA 9ICTA 2OH2A 5ALOA 3EYZA 4DCCA 3KHHA 3RTVA 2VANA 1ZYQA 1N2XA 2NO4A 4PL1A 2BCSA 1NK7A 5KFZA 4YD1A 9ICGA 2KHVA 2Q4TA 5CR0A 1PK3A 1U48A 3V6KA 7ICIA 1F5SA 3TFRA 3Q8MA 2HCFA 4JV2A 3I28A 2M9NA 1BGXT 4ZH4A 4I2HA 1ZQLA 4O3NA 4IQVA 4OJPA 4F5RA 3H8MA 1MC8A 2E8PA 1VJ5A 5J0QA 3RJFA 4F5OA 3UXPA 2R8IA 2IHNA 4K4GA 5G5GA 2FPMA 1U4BA 3NRWA 1ZRMA 3WKDA 5HR7A 3OGUA 3M7DA 3A0HU 4RQ1A 2HVHA 5EE3A 4ECYA 2W11A 3DV9A 4EX6A 2G5IB 4C8NA 8ICPA 5AKLA 2NV3A 4UB2A 3BQ0A 2YMQA 3QYPA 1SWWA 2XGQA 4RQNA 2KICA 1SZPA 3LDAA 4EEKA 5J0PA 5AICA 4DQIA 2XI9A 4U7CA 2LHTA 5KFTA 3KHLA 5A0LA 1PVPA 2LMRA 2RLTA 4F91B 1S76D 1MN8A 4XQ8A 7ICHA 1ZQGA 3SZ2A 1NK0A 5AKKA 4P0QA 4F92B 7ICLA 4I2EA 2I1QA 1UA1A 2KD1A 2YMPA 4RZRA 7ICGA 5B5EU 3RJHA 2KMDA 1ZQIA 4Y2UA 1T3NA 3SD7A 2ZIWA 1ZQKA 3QU7A 4NLBA 3L5KA 1PVQA 2I9GA 4Q8EA 5ALQA 3IN5A 1N5XA 4O3RA 5KFWA 4P4PA 4KLSA 4IL6U 8ICRA 4YQWA 1X66A 4BXOA 5AM3A 2JMGA 1A6SA 4RT3A 9ICQA 2XICA 3PR5B 2LYHA 2MSNA 1U45A 3FAHA 5KFHA 1MQ3A 1B22A 5EE9A 1X6IA 4DL3A 3ORYA 5IINA 4F4XA 1N56A 1O08A 3WK5A 4P2HA 4KLFA 1ZQWA 2F77X 4TUQA 2CXYA 3RF9A 1OUQA 7ICOA 4UBCA 3V6JA 3PMNA 9ICRA 4IQUA 4R8UB 4NM1A 3M9MB 8ICKA 4USAA 1JI7A 4QZGA 4ECSA 4OJ5A 5DQIA 1CEZA 1KRPA 4ELTA 5J0WA 1M6YA 4R63A 5L1JA 3PSTA 4Q43A 5J2IA 2C2EA 2K8AA 4RQ0A 4WJ3B 4PGXA 4UQGA 3SYZA 3WKBA 1KLNA 3ZDDA 4BWJA 2JH7A 2HOQA 9ICMA 4DSLA 3IP4B 2IOFA 4PHPA 5KTQA 5AKEA 4UARA 3BS7A 5EE1A 5DDMA 5AK3A 3D2NA 3RRGA 8ICBA 4J9LA 5DBBA 1JMSA 4JWNA 3UQ2A 3Q8LA 3PMLA 3TANA 2E8MA 4BXOB 1JRPA 4F4ZA 1TK0A 2DUYA 3CP8A 5J0YA 2JZBB 2W54A 2DBYA 5KG0A 4B9LA 5KFGA 2F76X 4QWAA 2C28A 3VCBA 2KTQA 1TE2A 2H3ZA 2Q0ZX 3EUB2 1OXJA 1Z00A 5ALNA 1T3QA 3T5HA 1P7DA 4PL2A 4YMMA 4GXJA 4KLLA 3TI0A 3H0RB 7ICNA 5ALGA 3MBYA 4FBUA 1N63A 3C1YA 1X6JA 2OWOA 5ALFA 2BZFA 1Q8KA 3GIKA 2IHMA 4QZAA 3IRUA 5AI8A 5AKJA 3L3FX 3EPIA 2GWSA 3H4BA 3B0YA 1UT5A 1T7PA 2KFZA 4PHDA 3PZPA 1S0MA 3AQFA 4B6JA 4EZ6A 4MF8A 3OSNA 2W3RA 3MABA 1ZD3A 3D2SA 2UVUA 1K1QA 5ALHA 5DB6A 3T3FA 4ECRA 4PGQA 5E79U 3H8SA 2PI4A 4P4MA 4QZBA 1NNLA 4C80A 2D3DA 4NXZA 5J0UA 3TAQA 9ICVA 9ICKA 1BPDA 5CJ7A 4MF2A 3MFHA 2EANA 2UVWA 4Y2RA 5AKHA 3M6ZA 4NLGA 1HEKA 5AKGA 1B4FA 2BCQA 3HKZC 3FM9A 4NJ8A 2HHTA 4C8KA 1NZPA 2YB4A 4XA5A 3UXNA 1DK2A 4ED0A 2WAQC 2XY6A 1RDFA 1XSLA 2G06A 3H8WA 1L3SA 5AK5A 8ICTA 2Y0SC 2A3VA 3QE9Y 5C5JA 5D49A 2XY7A 5AKYA 2XVTA 4DSFA 1JROA 2WF8A 2YMMA 3PSFA 1L3VA 2JEIA 1WWVA 2Y9UA 3EPGA 1L3UA 5KG3A 4RPXA 2PMZF 4BWMA 5KFLA 4RU9A 4O3QA 4FO6A 2W7PA 1LKYA 9ICFA 3C5FA 5J2HA 1S0NA 2AU0A 5AM1A 2ES6A 5EOZA 1SL0A 3LVVA 3QUQA 3JPQA 3L4PA 3T5LA 4TUPA 1DOQA 5ALXA 5IIKA 2D6FC 4DFKA 4XRHA 2OEHA 4O5KA 5J0SA 5J29A 1J97A 2DFLA 5J0XA 4A8EA 3WK9A 4NY8A 1DK3A 3KBBA 4TQRA 5AK6A 5ALYA 2WAQF 3BQ1A 5KT6A 1WYGA 3WU2U 1X9XA 4DSJA 2Y0SF 7ICPA 4DFJA 4EZ9A 2HI0A 3SV3A 5ALJA 4RQ7A 4Y2YA 1HUOA 4DOBA 5AK4A 4C8LA 2JEFA 5KFPA 3BZKA 1ZD5A 3JPRA 9ICJA 4YMOA 1SB3C 5DDYA 1Q3VA 2B6GA 2R8HA 4UAWA 4KLTA 4FZNA 3HWTA 4CF3A 4MFFA 2W8LA 4M9NA 2BCVA 5KFYA 1UQVA 4DQPA 5DBCA 3JPOA 4IRCA 1RG6A 3E0FA 5HMLA 4I2IA 3NUQA 1KDHA 3ONNA 4KX5A 3T5KA 4M04A 1IXRA 9ICBA 4ECUA 4O3SA 3H8JA 2YN4A 4F5NA 3HX0A 1LV5A 3RBEA 2KOBA 4EX7A 3MR6A 1N60A 2IOFK 3PX0A 3QUBA 5KFOA 5BOLA 1XU4A 5AKIA 4M9GA 8ICOA 3UMGA 2XC9A 2KFNA 3Q8PB 1COOA 1WCLA 4GXKA 8ICQA 4U6PA 2HHSA 2AGPA 3K1RB 4IR1A 2FJ6A 5AI5A 1RM6C 4DQSA 4F2SA 4ZOHC 4ED1A 1JN3A 2R8KA 4EBDA 5J2KA 4E0DA 4GFJA 3N4MB 4YR3A 2ZIVB 5J0OA 2KIWA 5ALKA 3RR7A 2F1HA 1Z1BA 2F8LA 5JU5A 5D46A 1QH9A 4DFDA 4KLMA 3RBDA 4FZMA 2HVIA 5KFAA 3QXGA 3QEAZ 4TURA 2PFOA 2H5XA 5KAFU
chains in the Genus database with same CATH topology
2EANA 3TACB 4PZOA 3BS5B 1B4FA 5J8YC 1OW5A 2B6GA 3TADA 1SV0C 2KMDA 2QARA 4IS7A 1Z1VA 1LKYB 1UCVA 4NJ8A 1UQVA 1PK3A 1SV4A 2E8MA 2DKZA 4RQMA 2QB1A 3KKAA 1RG6A 3SENA 2KIVA 2LPEA 2D8CA 2F8KA 2K60A 2KE7A 3SEIA 3BQ7A 2QB0B 1COKA 2JV3A 3H8MA 1X66A 1SV0A 5L1MA 3IDWA 2E8PA 1SXEA 2FE9A 1OXJA 1WWUA 5KNIA 2ESEA 5JTIA 1WWVA 2QKQA 4NL9C 2Y9UA 2E8OA 5F3XB 3BS5A 1PK1B 2K4PA 1LKYA 1X40A 2KSOB 5J8YA 3TADC 2EAOA 2L5YA 1V85A 2ES6A 3HILA 1JI7A 3KKAC 1PK1A 2YTUA 2E8NA 4RQNA 3K1RB 2Y9TA 2QB0A 1SGGA 2DKXA 1F0MA 1DXSA 1B0XA 5JRTA 2DL0A 1V38A 2KG5A 2GLEA 5JU5A 2F44A 1X9XA 4PZNA 2F3NA 2LMRA 2D3DA 2QARB 4NL9A 1SXDA 4MHVA 1KW4A 2KSOA 2EAPA 3BS7A 2EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  3TAC B;  4PZO A;  3BS5 B;  1B4F A;  5J8Y C;  1OW5 A;  2B6G A;  3TAD A;  1SV0 C;  2KMD A;  2QAR A;  4IS7 A;  1Z1V A;  1LKY B;  1UCV A;  4NJ8 A;  1UQV A;  1PK3 A;  1SV4 A;  2E8M A;  2DKZ A;  4RQM A;  2QB1 A;  3KKA A;  1RG6 A;  3SEN A;  2KIV A;  2LPE A;  2D8C A;  2F8K A;  2K60 A;  2KE7 A;  3SEI A;  3BQ7 A;  2QB0 B;  1COK A;  2JV3 A;  3H8M A;  1X66 A;  1SV0 A;  5L1M A;  3IDW A;  2E8P A;  1SXE A;  2FE9 A;  1OXJ A;  1WWU A;  5KNI A;  2ESE A;  5JTI A;  1WWV A;  2QKQ A;  4NL9 C;  2Y9U A;  2E8O A;  5F3X B;  3BS5 A;  1PK1 B;  2K4P A;  1LKY A;  1X40 A;  2KSO B;  5J8Y A;  3TAD C;  2EAO A;  2L5Y A;  1V85 A;  2ES6 A;  3HIL A;  1JI7 A;  3KKA C;  1PK1 A;  2YTU A;  2E8N A;  4RQN A;  3K1R B;  2Y9T A;  2QB0 A;  1SGG A;  2DKX A;  1F0M A;  1DXS A;  1B0X A;  5JRT A;  2DL0 A;  1V38 A;  2KG5 A;  2GLE A;  5JU5 A;  2F44 A;  1X9X A;  4PZN A;  2F3N A;  2LMR A;  2D3D A;  2QAR B;  4NL9 A;  1SXD A;  4MHV A;  1KW4 A;  2KSO A;  2EAP A;  3BS7 A;  2EAM A; 
#chains in the Genus database with same CATH topology
 3KD3 A;  1TAU A;  1C20 A;  2EZZ A;  4YXM A;  1X9S A;  5GTI U;  4BJQ A;  3KTQ A;  5ALP A;  3UMB A;  4ED2 A;  2ZG6 A;  2EDU A;  2K8B B;  1MSW D;  2OCE A;  4O9M A;  1FEZ A;  4RQ6 A;  4CGZ A;  4F5Q A;  4O5C A;  5K4L A;  3RH5 A;  1ZQ1 C;  5KFK A;  1QQ5 A;  5DKW A;  8ICC A;  2BKE A;  4J03 A;  1XNS A;  2WF6 A;  2AQ0 A;  2BPG A;  2JGA A;  1SV0 A;  5L1M A;  1NOM A;  2W9C B;  9ICX A;  1DGJ A;  4QWC A;  4C0Z A;  7ICT A;  3PNC A;  1MA7 A;  1ZQR A;  5JTI A;  4CCH A;  5BOM A;  3HP6 A;  4Q44 A;  3C2K A;  4O3O A;  1J2M A;  2E8O A;  5CA7 A;  1KSP A;  2K8C B;  1S77 D;  1S97 A;  4I2C A;  2VJ5 A;  4C4T A;  3JPN A;  2YY6 A;  4JMU A;  5HHH A;  4TQS A;  4I27 A;  2NYV A;  2K4H A;  3PVX A;  4QZC A;  1ZQN A;  3B0X A;  4OCZ A;  4UB1 A;  3AL0 B;  3HIL A;  1ZXI A;  1ZQJ A;  2YTU A;  3M9O B;  3ETL A;  2I5H A;  1YT3 A;  5DB9 A;  1WCN A;  2AH5 A;  5J2B A;  4F4W A;  3PY8 A;  1B0X A;  5JRT A;  4CF4 A;  2DL0 A;  2MA1 A;  1IG6 A;  2ALZ A;  2R8G A;  4Z6D A;  3GDX A;  3G6Y A;  1XC9 A;  3RJJ A;  5KFV A;  3KHR A;  4KLH A;  2ZJ8 A;  4MHV A;  3WKA A;  3FYH A;  3CNH A;  5KFF A;  1XO1 A;  3K4G A;  5IIM A;  3M6K A;  2OYY A;  4R8U A;  5J8Y C;  4EBC A;  1PZN A;  2LKY A;  4IS7 A;  3V7K A;  2KVS A;  4B9M A;  5KFR A;  3M8R A;  4RQM A;  3UMC A;  2HBM A;  1U47 A;  1QTM A;  1NJZ A;  4ED7 A;  4DO9 A;  4O3M A;  1KFD A;  3UQ0 A;  5ALT A;  4CE6 A;  2K60 A;  4F8R A;  4Y2P A;  5AI6 A;  4DL2 A;  9ICN A;  1RQN A;  2H3F A;  1LVH A;  4EEN A;  4UB6 U;  2QLT A;  5KL8 B;  1RXV A;  1NJY A;  3F53 A;  1TK8 A;  3THV A;  1X9M A;  2AJQ A;  3TQ1 A;  3F5E A;  2XID A;  5KT7 A;  5J0T A;  8ICE A;  5DQG A;  4ECW A;  4DL4 A;  4OJO A;  3VC8 A;  3GV7 B;  2J6U A;  2ZTD A;  3V7L A;  5G5H A;  4C8M A;  4YMN A;  1Z3E B;  3PR4 A;  2E1E A;  4UAT A;  1L7P A;  2RP5 A;  5J2F A;  1D8B A;  8ICY A;  2BGW A;  2L5Y A;  1RQL A;  2LBO A;  3MGV A;  5AM0 A;  3PV8 A;  2ODG A;  2JZB A;  3PX4 A;  2W55 A;  4RNM A;  4QJF B;  1SGG A;  2V4R A;  4JB3 A;  4R66 A;  1HUZ A;  9ICA A;  4ECZ A;  1ZQO A;  2ZJA A;  2K89 A;  7ICK A;  1NKB A;  1D8Y A;  1ZQX A;  2PXI A;  4JV0 A;  2BDP A;  5EWG A;  2RDJ A;  4ACO A;  1RYU A;  2F44 A;  2WHE A;  2HHV A;  4JV1 A;  3MDC A;  5C0Y A;  5AKZ A;  5H2F U;  2IA6 A;  5CWR A;  1QQ7 A;  4KN7 A;  4CF5 A;  4DL5 A;  3GZF A;  1WUD A;  4PZO A;  1B43 A;  1OW5 A;  5DGA A;  1FFU A;  5ALM A;  2YB1 A;  5AI4 A;  2YML A;  4DFP A;  8ICA A;  4NLZ A;  5KT4 A;  5KFN A;  5DLG A;  4BX9 C;  1T8E A;  2XCA A;  9ICW A;  2KZZ A;  1QSL A;  4JK1 A;  1SIJ A;  3C29 A;  1NK8 A;  3ZDC A;  4LVS A;  2AGO A;  5KFX A;  2A1J B;  2MAX A;  3GU3 A;  4CRX A;  3RJE A;  5J2D A;  2FMS A;  2WTF A;  4YFK A;  4EYH B;  3E2E A;  3IG8 A;  2FPK A;  1SKS A;  7ICS A;  4F4Y A;  1D9F A;  2LI6 A;  3TAR A;  3SR6 A;  4DSI A;  3OPX A;  3RFA A;  3BQT A;  2K4E A;  2EH9 A;  4KMO B;  4KLJ A;  5ALD A;  2KSO B;  2KJ9 A;  2J6S A;  2HBL A;  5J8Y A;  1ZQB A;  1N62 A;  2DWQ A;  4DS5 A;  4RQ8 A;  4LJX A;  2FMQ A;  1V85 A;  2AHO B;  4J9K A;  2ISO A;  4KMU A;  3GV8 B;  1XSP A;  1A0P A;  2FMP A;  1ZQH A;  3MR2 A;  1FFV A;  2AQ4 A;  5KFI A;  2XGP A;  4YN4 A;  1BNO A;  3Q8Q B;  4QZ9 A;  5ALS A;  4PJ0 U;  2RRD A;  1JUD A;  3CRX A;  4OD0 A;  8ICU A;  2YQE A;  1NK6 A;  1EXN A;  2EQY A;  5KG7 A;  4FE3 A;  4NLK A;  5L1K A;  1HJP A;  1ZET A;  1XS9 D;  4DSE A;  5DG9 A;  2HBK A;  1KFS A;  5KFJ A;  2J6T A;  3RRH A;  1C7Y A;  4DLG A;  1NJW A;  5ALZ A;  2HHX A;  8ICX A;  2ZTE A;  1PUZ A;  4ECV A;  3HJE A;  2HHW A;  3T79 A;  3AQE A;  3CYM A;  4Y2J A;  3SAH A;  1KQQ A;  2KJ8 A;  4GC7 A;  3S6J A;  4B9N A;  4KN4 A;  4IQW A;  4DQQ A;  1ZJM A;  3IM1 A;  4IRD A;  3M9N B;  3NAS A;  5EWE A;  4PH5 A;  2FE9 A;  1UA0 A;  4J9R A;  2KV2 A;  4I28 A;  1TAM A;  3C28 A;  2W9B B;  1ZQM A;  3H40 A;  3J81 j;  3GII A;  2G08 A;  1NK5 A;  1ZQE A;  3K1Z A;  1NJX A;  3MGH A;  5DQH A;  5KFD A;  5L1I A;  3F5A A;  7ICE A;  8ICS A;  3M1Y A;  4QZI A;  8ICL A;  1TAQ A;  2UVV A;  5AM4 A;  4US9 A;  2W7O A;  3TFS A;  1CUK A;  1ZQZ A;  3KKA C;  1KL9 A;  4GXI A;  2GOL A;  1BVS A;  1ZQS A;  1XSN A;  3QX7 A;  5J0R A;  2Y1I A;  3O0F A;  1KEJ A;  2JEG A;  2KG5 A;  3MR5 A;  2CN1 A;  2BR0 A;  1AQ6 A;  2Y1J A;  3PO4 A;  3ETR A;  1BNP A;  5F9L A;  2N1R A;  5KT2 A;  1ZQU A;  4M6W B;  5DLF A;  2ZIU B;  1ZQY A;  2W04 A;  3HKZ F;  3EWA A;  4XUS A;  1ZQP A;  3BS5 B;  3SV4 A;  2KNJ A;  3RAX A;  2OM6 A;  2EZX A;  1SV0 C;  5JUM A;  3AU6 A;  2A19 A;  4CNQ A;  3QU5 A;  3SAF A;  4Z6E A;  2BQR A;  2H3I A;  3RH4 A;  1IIP A;  4OO1 J;  2W3S A;  3SEN A;  4MFC A;  3KZX A;  3CW2 C;  2ZIV A;  2LM4 A;  2F8K A;  4DEZ A;  1LB2 B;  3H4D A;  3ISB A;  3LK9 A;  1A76 A;  3ZDA A;  2QB0 B;  5DG8 A;  9ICO A;  1YZ7 A;  4Y2V A;  4FS2 A;  2JXJ A;  3LWM A;  4RUA A;  8ICZ A;  2HMX A;  1PVR A;  3RB6 A;  4X5V A;  1JX4 A;  1ARO P;  4QW9 A;  4Y2S A;  4M9J A;  4M9H A;  3FC4 A;  1RPL A;  4RQ5 A;  4DOA A;  1ZOL A;  3U26 A;  1ZQC A;  5HMM A;  2Z7J A;  1SZH A;  5ALL A;  4QIW C;  1JXL A;  2DPJ A;  2UVR A;  5T14 A;  4DLE A;  2ASL A;  1ZRN A;  5J2A A;  2FLN A;  4PHE A;  4NLN A;  3KFU F;  3N7S C;  3UXO A;  3C23 A;  1KTQ A;  1VDV A;  4PGY A;  1ZD2 P;  3C2M A;  2KP7 A;  1UT8 A;  3QU2 A;  2ASJ A;  1NI3 A;  3D2Q A;  5ALI A;  4RQ2 A;  4M2Y A;  2W9C A;  1DRG A;  2BPF A;  4RPZ A;  8ICJ A;  1FIQ A;  5ALW A;  3RJK A;  4OJ6 A;  5DGB A;  1Y88 A;  5J2C A;  3M8S A;  4KLQ A;  4C4S A;  3Q8K A;  8ICG A;  3DDH A;  1Q46 A;  3PX6 A;  4DL7 A;  4Y2T A;  5CEH A;  3WKC A;  4R65 A;  2FLL A;  1YZ6 A;  7ICV A;  2MUT B;  3C21 A;  1L5U A;  4NLC A;  4P0P B;  2KK0 A;  1UCV A;  3RJI A;  5KG5 A;  2ZUD A;  1RYS A;  2C2D A;  1QLN A;  1SV4 A;  1Q3U A;  4KLU A;  3KKA A;  4DF8 A;  5ALV A;  4I2B A;  5KL1 B;  2D8C A;  2NRV A;  4O5E A;  3SEI A;  2G09 A;  5L1L A;  1COK A;  3B9J A;  4M47 A;  2NO5 A;  1S8O A;  1JAL A;  4F71 A;  4IC9 A;  4EBE A;  4QZH A;  3GIM A;  4NL9 C;  2KKV A;  3PW5 A;  2I6X A;  2JH1 A;  2OXO A;  4RPY A;  2C22 A;  5F3X B;  3H7I A;  5GTH U;  4YCX A;  4ELU A;  1BPB A;  3N7P D;  5HP4 A;  3ALR A;  3JPS A;  2VA3 A;  4ECQ A;  1L6N A;  5KT3 A;  3TAD C;  2HOF A;  2VKQ A;  2RHF A;  4DS4 A;  1U9L A;  4I2J A;  3PW4 A;  3BDP A;  1WG8 A;  5B66 U;  2A1A A;  3LWL A;  4RUC A;  4RNN A;  4ECT A;  2H3Q A;  1QCK A;  4MFA A;  2ASD A;  2ZIX B;  3H0M B;  4DSK A;  4KLO A;  3SI8 A;  2R8J A;  4B9T A;  5KFS A;  3PO5 A;  4PZN A;  5CP2 A;  8ICI A;  1HIW A;  1ZQQ A;  3WKE A;  2ZTC A;  1SXD A;  3RR8 A;  3D6J A;  1V97 A;  3WK4 A;  2YX8 A;  2EAP A;  3AUO A;  5ALU A;  2W03 A;  4KTQ A;  9ICS A;  3HT3 A;  3WK7 A;  1KKX A;  4Y2X A;  3QEB Z;  2DKZ A;  4UB3 A;  4KLD A;  2W9A A;  4KLG A;  5IIL A;  3ZD9 A;  3NGD A;  4C4R A;  2KIV A;  1ZQV A;  3QU4 A;  4DQR A;  5L9X A;  2BQ3 A;  2FPL A;  2PI5 A;  7ICQ A;  2V9W A;  4J9M A;  4KIT B;  1KFT A;  4ED3 A;  2JV3 A;  4K4I A;  3SAG A;  3RJG A;  2BQU A;  1L8O A;  2H3V A;  4BGD A;  2ESE A;  1QSY A;  1D8L A;  3IV6 A;  1NKE A;  8ICH A;  3ISD A;  4UB5 A;  2HSZ A;  7ICF A;  2ISP A;  3F2C A;  2FI1 A;  2EZY A;  2DGZ A;  5HHI A;  1TVA A;  3AM9 A;  3E58 A;  4RNO A;  2XY5 A;  3PW7 A;  2OHF A;  3G6V A;  1PK1 A;  1Z4N A;  3MFI A;  4QW8 A;  5AI0 A;  2Y9T A;  2A1J A;  3BZC A;  2W43 A;  3FDS A;  4B9U A;  2DKX A;  4DFM A;  4YP3 A;  1DXS A;  4QZF A;  1H38 A;  3N7R C;  1V38 A;  4FZL A;  2WB1 C;  4MEY A;  4J9P A;  1J2N A;  3RAQ A;  3NVY A;  4MEX A;  1JXE A;  2LYB A;  4Z6C A;  1SKW A;  4NL9 A;  3OJS A;  5CHG A;  4C7Z A;  2DF4 B;  2KSO A;  4QZD A;  4GC6 A;  4FS1 A;  8ICV A;  1BPY A;  3UM9 A;  3RH6 A;  3RB3 A;  1BPE A;  2CPR A;  3MGI A;  3TAD A;  1NK9 A;  4Q45 A;  1K5O A;  2G5H B;  3QU9 A;  4M9L A;  2BPC A;  9ICL A;  2QB1 A;  3LYS A;  2LM1 A;  1KN5 A;  4QWB A;  7ICM A;  5ALR A;  4PHA A;  1CRX A;  5IIJ A;  4QZ8 A;  1NZB A;  2IBK A;  2KE7 A;  4F72 A;  4UB4 A;  3TAP A;  4G9B A;  2M0N A;  3BQ7 A;  1NK4 A;  2WF9 A;  5CRX A;  1T94 A;  1SKR A;  1ZQD A;  2MU2 A;  1SXE A;  1L8L A;  4ECX A;  5F9N A;  1WWU A;  2VIX A;  3KOO A;  2CRX A;  3HW8 A;  4J9S A;  4GIB A;  2WB1 F;  2VA2 A;  3NS1 A;  4I2D A;  8ICN A;  1PK1 B;  8ICW A;  1KBU A;  2K4P A;  3OHB A;  1X40 A;  4FFD A;  3H0L B;  2BCU A;  5TZV A;  4F3O A;  2RQ5 A;  3PSP A;  3PSI A;  4P0Q B;  9ICI A;  1UHU A;  1TK5 A;  1ZD4 A;  4US8 A;  3QUC A;  4UAV A;  2E8N A;  5D4B A;  3BJY A;  2ZIW B;  4HAI A;  3C5G A;  1L7M A;  3NVV A;  4CDG A;  1SWV A;  4OJL A;  5EE0 A;  4BUG A;  4O3P A;  5J2J A;  3I1Y A;  1ZQF A;  2GLE A;  3OHA A;  2W9B A;  5J2E A;  2WFA A;  3BQ2 A;  2HHQ A;  1TFR A;  1URJ A;  4YG2 A;  1F44 A;  1ZQA A;  4UAU A;  2KHQ A;  3ZD8 A;  2EAM A;  2JEJ A;  4UAZ A;  5IIO A;  1XO0 A;  1S0V A;  2ZJ5 A;  5DB8 A;  3AU2 A;  1SL1 A;  4R64 A;  2QAR A;  3ICX A;  4J9O A;  1K1S A;  2FLP A;  5ALE A;  3AMZ A;  2ZXH A;  2W8K A;  2HW3 A;  4GLX A;  4F50 A;  4EEL A;  2VA8 A;  4QWD A;  2HOI A;  2W9M A;  3NTU A;  2KN7 A;  4Z6F A;  3A0B U;  3IDW A;  1BPZ A;  4ICA A;  2DQN B;  4RQ4 A;  4M6W A;  1N48 A;  2ZIU A;  3JPT A;  2KKP A;  4ED8 A;  3V72 A;  4ELV A;  5HR6 A;  9ICE A;  4AYB C;  3BS5 A;  4YD2 A;  2GO7 A;  4LZD A;  3K75 D;  4J9N A;  5KG1 A;  3WK6 A;  1ZQT A;  1IV8 A;  2PMZ C;  5III A;  5KFE A;  4K4H A;  2KEY A;  3KHG A;  4P4O A;  5KG6 A;  4AP9 A;  3MR3 A;  1Z4O A;  2P6R A;  4ED6 A;  5AIB A;  1S0O A;  1L7O A;  3GIL A;  4FBT A;  2E5S A;  2QB0 A;  3C2L A;  3PW0 A;  1U49 A;  1RZT A;  4I2A A;  4B9S A;  3UPQ A;  1Z19 A;  2P35 A;  2G07 A;  2WF7 A;  4IQT A;  3RB0 A;  1JIH A;  1N61 A;  4F93 B;  2QAR B;  5KFB A;  1Z00 B;  5DBA A;  5TIS U;  4NM2 A;  4RT2 A;  3R9K A;  3TAC B;  2F2A B;  4J9Q A;  2HBJ A;  3GFK B;  5AM2 A;  1TKD A;  8ICF A;  2LYA A;  1L3T A;  3GIJ A;  4I2F A;  4DOC A;  1SL2 A;  4AYB F;  3QZ8 A;  2PFP A;  9ICC A;  2WF5 A;  4EEY A;  2BDU A;  5CB1 A;  5DB7 A;  3OTQ A;  3MC1 A;  4Y2Q A;  3NRZ A;  2JHD A;  4TUS A;  1MQ2 A;  2E3T A;  1A77 A;  2LPE A;  9ICH A;  2DPI A;  2JRZ A;  3AEV A;  3EW9 A;  4UAS A;  2IMW P;  3DEE A;  5AI9 A;  3ED5 A;  7ICR A;  2PKE A;  3ZDB A;  2BHN A;  2XO7 A;  4DF4 A;  3LVW A;  4Q8F A;  2FDR A;  2QKQ A;  3TKA A;  3C1Z A;  5EWF A;  1VLB A;  4KX3 A;  1D9D A;  5KG4 A;  1L7N A;  5AKX A;  4IR9 A;  4F2R A;  2C2R A;  1UPH A;  3ZI4 A;  9ICU A;  3MDA A;  2MUT A;  5KT5 A;  4YXJ A;  4I2G A;  3HRD D;  4P0P A;  4QNL A;  4C8O A;  2EAO A;  2F1J A;  2IOH A;  1X2I A;  5BPC A;  2KJ5 A;  2NRT A;  4I29 A;  3V6H A;  7ICU A;  3ISC A;  3T5J A;  5KFM A;  2P6U A;  2E1F A;  2ZUB A;  3QZ7 A;  4DL6 A;  3KZI U;  3IG5 A;  4EYI B;  2NRZ A;  4JWM A;  4RQ3 A;  5AM5 A;  4NWI A;  5KG2 A;  1ZJN A;  2F1I A;  3Q8R B;  2KVC A;  5DG7 A;  3ZDE A;  1BPX A;  5KAI U;  3N97 B;  3OSP A;  4BDP A;  1RYR A;  4KLE A;  2JR5 A;  3G6X A;  2AGQ A;  1NKC A;  2BCR A;  3HPO A;  3NVZ A;  3SQI A;  3GV5 B;  4JUZ A;  2ATL A;  1KW4 A;  4YR0 A;  4QWE A;  1RXW A;  4UAY A;  2HDO A;  3EZ5 A;  2MRL A;  4HYK A;  1Z1V A;  1LKY B;  2RDI A;  3QUT A;  4C7Y A;  2NRX A;  3QNM A;  2PFN A;  3NVW A;  3IHQ B;  4M0A A;  2ZXI A;  4PPX A;  1N5W A;  1IM4 A;  2GH1 A;  2ZIX A;  5HNK A;  3N28 A;  3AN1 A;  2HHU A;  3SMV A;  4O0I A;  3OJU A;  4F5P A;  4QZE A;  2KZM A;  4UBB A;  4YVZ A;  1CI4 A;  8ICM A;  1DGS A;  1S10 A;  5KNI A;  3PW2 A;  3F2D A;  2P66 A;  1S9F A;  9ICP A;  4YR2 A;  1X9W A;  4QIW F;  5AIA A;  2O6K A;  1V9P A;  4UB8 U;  4KLI A;  3I76 A;  3V7J A;  1X42 A;  4F4K A;  2ZUC A;  5KFU A;  2B0C A;  2XCP A;  2R18 A;  3GQC A;  2K4I A;  4NV0 A;  2VJ4 A;  1ECW A;  3JPP A;  5J2G A;  2NRW A;  3WK8 A;  1QSS A;  2AXT U;  7ICJ A;  1GO3 F;  2KZ3 A;  4G3I A;  5AHX A;  2B21 A;  3RB4 A;  2G0A A;  5KFC A;  1TV9 A;  3Q8S B;  5KFQ A;  1F0M A;  4DWI A;  1QQ6 A;  4LZG A;  4B9V A;  4UW9 A;  2V4Q A;  1FO4 A;  1S5L U;  2PFQ A;  1ED1 A;  1T4G A;  5FP0 A;  2F3N A;  3F2B A;  4IRK A;  1O03 A;  1XWL A;  9ICT A;  2OH2 A;  5ALO A;  3EYZ A;  4DCC A;  3KHH A;  3RTV A;  2VAN A;  1ZYQ A;  1N2X A;  2NO4 A;  4PL1 A;  2BCS A;  1NK7 A;  5KFZ A;  4YD1 A;  9ICG A;  2KHV A;  2Q4T A;  5CR0 A;  1PK3 A;  1U48 A;  3V6K A;  7ICI A;  1F5S A;  3TFR A;  3Q8M A;  2HCF A;  4JV2 A;  3I28 A;  2M9N A;  1BGX T;  4ZH4 A;  4I2H A;  1ZQL A;  4O3N A;  4IQV A;  4OJP A;  4F5R A;  3H8M A;  1MC8 A;  2E8P A;  1VJ5 A;  5J0Q A;  3RJF A;  4F5O A;  3UXP A;  2R8I A;  2IHN A;  4K4G A;  5G5G A;  2FPM A;  1U4B A;  3NRW A;  1ZRM A;  3WKD A;  5HR7 A;  3OGU A;  3M7D A;  3A0H U;  4RQ1 A;  2HVH A;  5EE3 A;  4ECY A;  2W11 A;  3DV9 A;  4EX6 A;  2G5I B;  4C8N A;  8ICP A;  5AKL A;  2NV3 A;  4UB2 A;  3BQ0 A;  2YMQ A;  3QYP A;  1SWW A;  2XGQ A;  4RQN A;  2KIC A;  1SZP A;  3LDA A;  4EEK A;  5J0P A;  5AIC A;  4DQI A;  2XI9 A;  4U7C A;  2LHT A;  5KFT A;  3KHL A;  5A0L A;  1PVP A;  2LMR A;  2RLT A;  4F91 B;  1S76 D;  1MN8 A;  4XQ8 A;  7ICH A;  1ZQG A;  3SZ2 A;  1NK0 A;  5AKK A;  4P0Q A;  4F92 B;  7ICL A;  4I2E A;  2I1Q A;  1UA1 A;  2KD1 A;  2YMP A;  4RZR A;  7ICG A;  5B5E U;  3RJH A;  2KMD A;  1ZQI A;  4Y2U A;  1T3N A;  3SD7 A;  2ZIW A;  1ZQK A;  3QU7 A;  4NLB A;  3L5K A;  1PVQ A;  2I9G A;  4Q8E A;  5ALQ A;  3IN5 A;  1N5X A;  4O3R A;  5KFW A;  4P4P A;  4KLS A;  4IL6 U;  8ICR A;  4YQW A;  1X66 A;  4BXO A;  5AM3 A;  2JMG A;  1A6S A;  4RT3 A;  9ICQ A;  2XIC A;  3PR5 B;  2LYH A;  2MSN A;  1U45 A;  3FAH A;  5KFH A;  1MQ3 A;  1B22 A;  5EE9 A;  1X6I A;  4DL3 A;  3ORY A;  5IIN A;  4F4X A;  1N56 A;  1O08 A;  3WK5 A;  4P2H A;  4KLF A;  1ZQW A;  2F77 X;  4TUQ A;  2CXY A;  3RF9 A;  1OUQ A;  7ICO A;  4UBC A;  3V6J A;  3PMN A;  9ICR A;  4IQU A;  4R8U B;  4NM1 A;  3M9M B;  8ICK A;  4USA A;  1JI7 A;  4QZG A;  4ECS A;  4OJ5 A;  5DQI A;  1CEZ A;  1KRP A;  4ELT A;  5J0W A;  1M6Y A;  4R63 A;  5L1J A;  3PST A;  4Q43 A;  5J2I A;  2C2E A;  2K8A A;  4RQ0 A;  4WJ3 B;  4PGX A;  4UQG A;  3SYZ A;  3WKB A;  1KLN A;  3ZDD A;  4BWJ A;  2JH7 A;  2HOQ A;  9ICM A;  4DSL A;  3IP4 B;  2IOF A;  4PHP A;  5KTQ A;  5AKE A;  4UAR A;  3BS7 A;  5EE1 A;  5DDM A;  5AK3 A;  3D2N A;  3RRG A;  8ICB A;  4J9L A;  5DBB A;  1JMS A;  4JWN A;  3UQ2 A;  3Q8L A;  3PML A;  3TAN A;  2E8M A;  4BXO B;  1JRP A;  4F4Z A;  1TK0 A;  2DUY A;  3CP8 A;  5J0Y A;  2JZB B;  2W54 A;  2DBY A;  5KG0 A;  4B9L A;  5KFG A;  2F76 X;  4QWA A;  2C28 A;  3VCB A;  2KTQ A;  1TE2 A;  2H3Z A;  2Q0Z X;  3EUB 2;  1OXJ A;  1Z00 A;  5ALN A;  1T3Q A;  3T5H A;  1P7D A;  4PL2 A;  4YMM A;  4GXJ A;  4KLL A;  3TI0 A;  3H0R B;  7ICN A;  5ALG A;  3MBY A;  4FBU A;  1N63 A;  3C1Y A;  1X6J A;  2OWO A;  5ALF A;  2BZF A;  1Q8K A;  3GIK A;  2IHM A;  4QZA A;  3IRU A;  5AI8 A;  5AKJ A;  3L3F X;  3EPI A;  2GWS A;  3H4B A;  3B0Y A;  1UT5 A;  1T7P A;  2KFZ A;  4PHD A;  3PZP A;  1S0M A;  3AQF A;  4B6J A;  4EZ6 A;  4MF8 A;  3OSN A;  2W3R A;  3MAB A;  1ZD3 A;  3D2S A;  2UVU A;  1K1Q A;  5ALH A;  5DB6 A;  3T3F A;  4ECR A;  4PGQ A;  5E79 U;  3H8S A;  2PI4 A;  4P4M A;  4QZB A;  1NNL A;  4C80 A;  2D3D A;  4NXZ A;  5J0U A;  3TAQ A;  9ICV A;  9ICK A;  1BPD A;  5CJ7 A;  4MF2 A;  3MFH A;  2EAN A;  2UVW A;  4Y2R A;  5AKH A;  3M6Z A;  4NLG A;  1HEK A;  5AKG A;  1B4F A;  2BCQ A;  3HKZ C;  3FM9 A;  4NJ8 A;  2HHT A;  4C8K A;  1NZP A;  2YB4 A;  4XA5 A;  3UXN A;  1DK2 A;  4ED0 A;  2WAQ C;  2XY6 A;  1RDF A;  1XSL A;  2G06 A;  3H8W A;  1L3S A;  5AK5 A;  8ICT A;  2Y0S C;  2A3V A;  3QE9 Y;  5C5J A;  5D49 A;  2XY7 A;  5AKY A;  2XVT A;  4DSF A;  1JRO A;  2WF8 A;  2YMM A;  3PSF A;  1L3V A;  2JEI A;  1WWV A;  2Y9U A;  3EPG A;  1L3U A;  5KG3 A;  4RPX A;  2PMZ F;  4BWM A;  5KFL A;  4RU9 A;  4O3Q A;  4FO6 A;  2W7P A;  1LKY A;  9ICF A;  3C5F A;  5J2H A;  1S0N A;  2AU0 A;  5AM1 A;  2ES6 A;  5EOZ A;  1SL0 A;  3LVV A;  3QUQ A;  3JPQ A;  3L4P A;  3T5L A;  4TUP A;  1DOQ A;  5ALX A;  5IIK A;  2D6F C;  4DFK A;  4XRH A;  2OEH A;  4O5K A;  5J0S A;  5J29 A;  1J97 A;  2DFL A;  5J0X A;  4A8E A;  3WK9 A;  4NY8 A;  1DK3 A;  3KBB A;  4TQR A;  5AK6 A;  5ALY A;  2WAQ F;  3BQ1 A;  5KT6 A;  1WYG A;  3WU2 U;  1X9X A;  4DSJ A;  2Y0S F;  7ICP A;  4DFJ A;  4EZ9 A;  2HI0 A;  3SV3 A;  5ALJ A;  4RQ7 A;  4Y2Y A;  1HUO A;  4DOB A;  5AK4 A;  4C8L A;  2JEF A;  5KFP A;  3BZK A;  1ZD5 A;  3JPR A;  9ICJ A;  4YMO A;  1SB3 C;  5DDY A;  1Q3V A;  2B6G A;  2R8H A;  4UAW A;  4KLT A;  4FZN A;  3HWT A;  4CF3 A;  4MFF A;  2W8L A;  4M9N A;  2BCV A;  5KFY A;  1UQV A;  4DQP A;  5DBC A;  3JPO A;  4IRC A;  1RG6 A;  3E0F A;  5HML A;  4I2I A;  3NUQ A;  1KDH A;  3ONN A;  4KX5 A;  3T5K A;  4M04 A;  1IXR A;  9ICB A;  4ECU A;  4O3S A;  3H8J A;  2YN4 A;  4F5N A;  3HX0 A;  1LV5 A;  3RBE A;  2KOB A;  4EX7 A;  3MR6 A;  1N60 A;  2IOF K;  3PX0 A;  3QUB A;  5KFO A;  5BOL A;  1XU4 A;  5AKI A;  4M9G A;  8ICO A;  3UMG A;  2XC9 A;  2KFN A;  3Q8P B;  1COO A;  1WCL A;  4GXK A;  8ICQ A;  4U6P A;  2HHS A;  2AGP A;  3K1R B;  4IR1 A;  2FJ6 A;  5AI5 A;  1RM6 C;  4DQS A;  4F2S A;  4ZOH C;  4ED1 A;  1JN3 A;  2R8K A;  4EBD A;  5J2K A;  4E0D A;  4GFJ A;  3N4M B;  4YR3 A;  2ZIV B;  5J0O A;  2KIW A;  5ALK A;  3RR7 A;  2F1H A;  1Z1B A;  2F8L A;  5JU5 A;  5D46 A;  1QH9 A;  4DFD A;  4KLM A;  3RBD A;  4FZM A;  2HVI A;  5KFA A;  3QXG A;  3QEA Z;  4TUR A;  2PFO A;  2H5X A;  5KAF U; 
#chains in the Genus database with same CATH homology
 2EAN A;  3TAC B;  4PZO A;  3BS5 B;  1B4F A;  5J8Y C;  1OW5 A;  2B6G A;  3TAD A;  1SV0 C;  2KMD A;  2QAR A;  4IS7 A;  1Z1V A;  1LKY B;  1UCV A;  4NJ8 A;  1UQV A;  1PK3 A;  1SV4 A;  2E8M A;  2DKZ A;  4RQM A;  2QB1 A;  3KKA A;  1RG6 A;  3SEN A;  2KIV A;  2LPE A;  2D8C A;  2F8K A;  2K60 A;  2KE7 A;  3SEI A;  3BQ7 A;  2QB0 B;  1COK A;  2JV3 A;  3H8M A;  1X66 A;  1SV0 A;  5L1M A;  3IDW A;  2E8P A;  1SXE A;  2FE9 A;  1OXJ A;  1WWU A;  5KNI A;  2ESE A;  5JTI A;  1WWV A;  2QKQ A;  4NL9 C;  2Y9U A;  2E8O A;  5F3X B;  3BS5 A;  1PK1 B;  2K4P A;  1LKY A;  1X40 A;  2KSO B;  5J8Y A;  3TAD C;  2EAO A;  2L5Y A;  1V85 A;  2ES6 A;  3HIL A;  1JI7 A;  3KKA C;  1PK1 A;  2YTU A;  2E8N A;  4RQN A;  3K1R B;  2Y9T A;  2QB0 A;  1SGG A;  2DKX A;  1F0M A;  1DXS A;  1B0X A;  5JRT A;  2DL0 A;  1V38 A;  2KG5 A;  2GLE A;  5JU5 A;  2F44 A;  1X9X A;  4PZN A;  2F3N A;  2LMR A;  2D3D A;  2QAR B;  4NL9 A;  1SXD A;  4MHV A;  1KW4 A;  2KSO A;  2EAP A;  3BS7 A;  2EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...