1HIWA

Trimeric hiv-1 matrix protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
VLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the trimeric human immunodeficiency virus type 1 matrix protein: implications for membrane association and assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Matrix protein
molecule keywords HIV-1 MATRIX PROTEIN
total genus 40
structure length 115
sequence length 115
chains with identical sequence B, C, Q, R, S
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hiwA00
2H3VA 1TAMA 2H3IA 4JMUA 1ECWA 2JMGA 2LYBA 2K4HA 2K4IA 2LYAA 1HEKA 1HIWA 1L6NA 2HMXA 2H3QA 2H3FA 1ED1A 2GOLA 1UPHA 4IC9A 2NV3A 2K4EA 4ICAA 1A6SA 2N1RA 2H3ZA
chains in the Genus database with same CATH superfamily
1FO4A 3AMZA 2F44A 2AQ4A 5AIBA 3H4DA 2FMPA 4J9KA 1ZQIA 5ALLA 4ECZA 4YMNA 3OHBA 3C23A 1S0MA 4UB4A 3GFKB 1RG6A 1NKBA 1UT5A 2AGOA 3AEVA 3VC8A 2PMZF 3C2MA 2JZBA 4DLEA 3LWLA 1L3TA 2H3ZA 4IQTA 5J0SA 2E1EA 2W03A 2ZIUA 4F93B 4LJXA 4BX9C 3T3FA 4YCXA 3J81j 5KT6A 3RJIA 4R8UA 1ZQOA 3TQ1A 4A8EA 2GH1A 4Z6FA 1NK6A 4C8OA 3KHGA 1NK4A 7ICLA 1LB2B 2KP7A 9ICQA 4KLEA 2PI4A 4UB1A 2QB0A 4Z6CA 3AM9A 4C7YA 4ECVA 1ZQNA 4OD0A 1ZRNA 2QARB 1KFDA 5HHHA 2Q4TA 3I76A 2HHXA 2HHVA 4MHVA 4GC6A 3EUB2 3N7RC 4GFJA 5B66U 5EWGA 2FLPA 5AICA 3PX0A 4JK1A 5DBCA 2XGQA 2ZIXB 3PW5A 1N48A 5DBAA 4ECUA 2WF7A 5E79U 4MF8A 2WF8A 4OJLA 3MR3A 2ZUCA 1L6NA 1X6IA 5DGBA 3QU7A 2RHFA 5EWFA 2KOBA 3T5HA 1BPEA 4DSEA 5J0TA 2M0NA 3IRUA 4OCZA 5HNKA 5CEHA 2ZXIA 4M9HA 3PVXA 2RP5A 5DQGA 2RRDA 4P4OA 4EELA 5KFZA 2VJ5A 3ZDAA 3L3FX 9ICWA 4O0IA 4DOBA 1AQ6A 9ICEA 4IR9A 1A77A 2DKZA 5AIAA 5KFOA 2ZJAA 3JPRA 4GLXA 1PVRA 2R8KA 1WWUA 2YX8A 4FZLA 2JRZA 3H8WA 1A6SA 3CW2C 3WKEA 1ZQWA 2NO4A 5GTIU 4UAVA 3PNCA 5KFAA 2KN7A 2AQ0A 1HIWA 2KJ9A 4WJ3B 4Y2YA 5AKJA 4I2EA 4KLQA 3F5EA 4J9SA 3QEAZ 1QQ6A 1X9MA 3HKZF 4ECXA 2ZIWA 4FO6A 8ICCA 1ZQMA 4CNQA 2E8PA 1IXRA 2KKPA 5CB1A 4PJ0U 1SZHA 3E0FA 1DOQA 4F8RA 5AM3A 2R18A 4B6JA 7ICUA 3UMBA 2WB1F 5KFRA 4DOAA 3QU9A 3NUQA 3MABA 4ACOA 1ZQAA 1HUOA 1J97A 2BQRA 4US8A 3HP6A 1L3UA 2WF5A 2CN1A 2W43A 3SAHA 3RJHA 3NRZA 5ALQA 4RT2A 4F5PA 1ZJMA 3WKCA 3LVVA 1DGSA 5IIKA 3BQ1A 1KDHA 2ODGA 7ICOA 2HOQA 5KFNA 4DL6A 2LKYA 3SD7A 4MFCA 3GV7B 8ICZA 2JV3A 2UVRA 2Y1JA 2KIVA 3JPQA 3HX0A 1D9FA 1NZBA 2YB1A 1SIJA 2IOHA 8ICPA 3H0LB 3I1YA 2BCUA 2QARA 3PW4A 1YT3A 3KBBA 4DL5A 1YZ7A 2HVIA 1Q8KA 2LI6A 4Z6EA 3TANA 2B0CA 4J9OA 2FPKA 7ICMA 5AM2A 4EBEA 2FPLA 5ALOA 2A1JA 2DF4B 5CRXA 5EWEA 4O3QA 5AM0A 7ICTA 1RDFA 4LZDA 5K4LA 4DSJA 3JPNA 4F4YA 3WK6A 9ICTA 1U4BA 2H3IA 3ZD9A 2ISPA 3FDSA 5KT5A 4UATA 2CPRA 5D4BA 3PW0A 2XI9A 1ZJNA 4OJ5A 5ALKA 3NS1A 1WG8A 5DB8A 3LVWA 3PSTA 1KN5A 2NV3A 1Q46A 4J9LA 3RRGA 4P0PA 2AJQA 4R8UB 4BXOB 1S9FA 2XO7A 3RB0A 3QX7A 1MQ2A 4O3SA 1OUQA 4ELUA 4IL6U 2ASLA 3HT3A 1KEJA 1T3NA 3RJGA 5IIOA 5J2AA 2BZFA 4ED8A 4NM2A 3M7DA 5HP4A 7ICNA 2I5HA 8ICSA 1ECWA 1L7MA 2K4HA 4DOCA 3NVVA 3CYMA 2DQNB 4M9JA 2QB1A 4KLFA 4HYKA 3DV9A 5HMLA 2CXYA 2VA2A 4DL4A 5A0LA 3IG5A 3IP4B 2KICA 1ZQYA 4UB5A 3N4MB 3PMLA 1BPZA 3IN5A 5IIMA 5J0XA 2W8KA 3C21A 4Y2VA 1IIPA 1QTMA 4UB8U 2KFNA 2P35A 1FFVA 1VLBA 2EANA 4CF3A 4J9NA 1ZQ1C 3LDAA 3MDAA 2DPIA 2PMZC 1TFRA 2ATLA 2ISOA 5ALUA 4AP9A 5J0QA 5ALZA 2ES6A 1ZQGA 4OJOA 1FFUA 3HJEA 4Y2TA 4RQ5A 3RR8A 4IQUA 8ICKA 3DDHA 1JRPA 1BPYA 1O08A 3OPXA 2ZJ8A 3GZFA 1IV8A 3ZI4A 5DB6A 3M6KA 3C5FA 2ZXHA 8ICVA 5DG9A 5DB7A 7ICPA 5IIIA 4EX6A 5FP0A 2GOLA 5KFHA 3OSNA 8ICOA 3QUQA 4KITB 2ZUDA 4F2RA 2BDUA 3PO5A 8ICRA 4K4IA 5DQIA 4DEZA 1IG6A 4PH5A 4JV0A 4FS2A 4EYHB 2PFPA 5KAIU 4U6PA 2FLLA 3UQ2A 4KX3A 1L3SA 2XY7A 2Z7JA 2G08A 2KZZA 1JI7A 3GV5B 4P4MA 5AKHA 4P2HA 3AU2A 5DLFA 3RBEA 3LWMA 4UASA 4TUPA 2I1QA 2A1AA 4BDPA 4Y2UA 4RQ6A 3RRHA 3ZDEA 4EX7A 2C2RA 3ED5A 1T94A 4XQ8A 5KFEA 4BWMA 2I6XA 3M6ZA 4YXJA 4KLMA 2KVCA 5ALHA 2HHUA 2G0AA 3QU2A 2GLEA 4KLIA 4FFDA 5GTHU 2JH1A 4DLGA 3EPIA 2UVUA 1QLNA 5IILA 3NVYA 5KFMA 3C29A 1A76A 2DBYA 2HOIA 1TK0A 1L7NA 4JV1A 1QQ5A 2UVVA 3N28A 7ICGA 4QZBA 4RQ1A 3CRXA 3GIJA 2DKXA 3EYZA 1N2XA 1T7PA 3ISCA 3AUOA 3GV8B 4I2CA 1JXLA 4M6WB 1ZRMA 3Q8KA 5CA7A 3HILA 4ECTA 1ZQVA 5DBBA 2KJ5A 2I9GA 4OJPA 4YG2A 4DS4A 4LVSA 4I27A 1B22A 2EH9A 4PZNA 1XU4A 3PSIA 4DFPA 3M8SA 1D8LA 3ICXA 4FS1A 4NLGA 3M9OB 1JUDA 3C2KA 3GILA 2KZMA 4Y2SA 4F5RA 5AI6A 4I2HA 9ICCA 4Q8EA 4PPXA 3H40A 3K4GA 4DWIA 2O6KA 5AHXA 2E8OA 4BUGA 3OGUA 2UVWA 1S0NA 3Q8PB 8ICLA 2V9WA 8ICNA 4CF5A 5KG4A 4IQVA 2G09A 1KLNA 3RJJA 2KD1A 2LHTA 2HDOA 4KX5A 1MQ3A 9ICGA 4F3OA 1DK3A 4QNLA 4RPZA 1TVAA 3L4PA 1URJA 4RUCA 4C0ZA 2XY5A 3K1RB 3WK7A 1ZQTA 7ICSA 3RB3A 4J9MA 1JXEA 4QWBA 3V7LA 2XIDA 4EYIB 2DPJA 3IDWA 2BGWA 4UAUA 1BNOA 4F4ZA 2BPCA 3PSFA 2ZIVB 2HCFA 4QWDA 5KL1B 3LK9A 1RYUA 5D46A 2EAPA 1RYRA 4O5CA 5DLGA 3SV4A 4DL2A 4G9BA 4YD2A 1JALA 2M9NA 9ICIA 1KFTA 3WKDA 1N60A 1SL0A 3D2QA 5HMMA 3RR7A 3ORYA 3T79A 3K75D 5AM1A 2F1IA 9ICPA 1JROA 5J2EA 2ASDA 9ICBA 9ICVA 5ALJA 2Y1IA 2J6UA 4JWMA 3RJKA 2KHVA 5DG8A 1NKCA 3R9KA 2PFNA 2V4RA 3PX6A 2KV2A 4R66A 1MA7A 3ISBA 2K4EA 2XCAA 3UXNA 2Y0SF 3E58A 4QZGA 4RQ0A 2A3VA 3KKAC 5ALDA 4QW8A 2D8CA 3NVWA 1U47A 3OHAA 4EBCA 1TAQA 3D6JA 3L5KA 3SAGA 4X5VA 1XO0A 2NRTA 4P0PB 1KBUA 3TADC 2K8CB 3SMVA 5AM4A 3V72A 1PZNA 2HBJA 4DS5A 3A0HU 5KT4A 3D2SA 3U26A 4F72A 3B0YA 1SB3C 1QH9A 4B9MA 4GC7A 1TAMA 3AQFA 1JN3A 2JZBB 2IBKA 5AI4A 1HUZA 5EOZA 5IIJA 2ZTCA 3SEIA 4I2BA 2MSNA 2IHMA 3NGDA 4KN4A 4RPYA 1SKRA 2C28A 1ZQQA 1ZQSA 1Z00A 5DQHA 3MGIA 5J2JA 7ICIA 2YB4A 5AKKA 2ALZA 1LVHA 1KTQA 4UAWA 2W3SA 2P6UA 1S97A 3LYSA 5EE1A 3ONNA 4TQSA 2AGQA 3F5AA 2YTUA 5EE9A 5BOMA 4ED7A 5AKIA 5DGAA 5CJ7A 1B43A 4MEYA 3RJFA 5J2HA 2KMDA 5G5HA 1GO3F 4OJ6A 1ZQZA 4UQGA 3ETRA 1LV5A 1ZQCA 3QU4A 4C7ZA 2JXJA 2J6TA 2H3FA 4UAZA 5KG1A 1Z3EB 4M2YA 1U49A 4DFMA 2HBMA 2WB1C 2HHQA 1LKYB 3FC4A 1B4FA 4RQ3A 1AROP 4PHDA 3MGHA 8ICHA 3HW8A 3MFHA 2K60A 5B5EU 2YN4A 4CRXA 3ZDBA 4KMOB 9ICUA 4M6WA 4BXOA 4NLBA 4DSKA 5L1LA 4C8LA 4R63A 4RQ2A 1X2IA 2EZZA 4IRCA 4UB2A 1CI4A 9ICKA 5ALMA 4KLJA 4ECSA 2J6SA 1RQNA 1X42A 4O3MA 4I2FA 5KTQA 2Q0ZX 5HR7A 1NKEA 4ECQA 1RPLA 1TK5A 1D9DA 1UQVA 2OH2A 3BQ0A 1VDVA 5JTIA 2P66A 1KKXA 1QSSA 3PX4A 2V4QA 4B9LA 1X40A 1WWVA 4RU9A 4DCCA 4FBUA 1K1QA 1L5UA 1FIQA 5J2IA 4RPXA 1L7OA 3T5JA 3MGVA 5L1IA 2BKEA 9ICHA 1X66A 3PMNA 1Z1BA 4PHPA 1SL1A 3M9NB 3N7SC 4YP3A 4B9NA 1ZXIA 1BVSA 4GXIA 2LYHA 2VA8A 4FZNA 2RDIA 2NRZA 2MU2A 2MAXA 4DQQA 1A0PA 8ICGA 1CEZA 2KVSA 1DRGA 3OJUA 4IRDA 2WFAA 9ICRA 5KFIA 5TZVA 1DXSA 3WK4A 1CUKA 2WTFA 2F1HA 1SGGA 2IHNA 4R65A 5J2FA 9ICAA 5C0YA 4J9RA 1ZQEA 1LKYA 3WK9A 1L8OA 2LM4A 2W7OA 2K4PA 5AK6A 2F3NA 5BPCA 5KFTA 2YY6A 3F2BA 1HJPA 4O3OA 3RB4A 2DWQA 4EZ6A 5KG5A 4C8KA 2VJ4A 1BPDA 4I2IA 4ED2A 4CDGA 1NK9A 5ALTA 1FEZA 3RAQA 2FPMA 4Y2XA 3KOOA 3PR5B 1L7PA 4IR1A 8ICQA 3BQ7A 3UPQA 3G6XA 3D2NA 3TFRA 5L1JA 3QUCA 5KFQA 1SL2A 1KL9A 3O0FA 3UMCA 2Y9UA 3KKAA 2YMQA 5L1KA 4ELVA 1TK8A 4ECRA 4EZ9A 4ELTA 1PUZA 2LPEA 4FZMA 5ALFA 4F2SA 2KE7A 4JV2A 3RB6A 4F5OA 2WF6A 2FJ6A 1X9XA 3GDXA 2XICA 2VA3A 4YR0A 5EE0A 4CF4A 3HPOA 3FYHA 4M04A 1V97A 4RQ8A 4O3PA 4YMOA 2C22A 3H8SA 5AI8A 1NZPA 4TURA 4DFDA 2RLTA 4EEKA 4EEYA 4XRHA 4GXJA 2IMWP 8ICXA 3G6YA 1MC8A 2HMXA 5KT2A 1RQLA 2HI0A 5J0YA 5KNIA 3NRWA 1NNLA 1SXEA 1BNPA 5ALWA 3OJSA 3E2EA 4ED3A 3RBDA 1S10A 2MA1A 7ICRA 1ZD2P 5J0OA 3ALRA 4ZOHC 2OCEA 3TI0A 1ZD3A 2G5IB 1XC9A 5AK3A 5HHIA 3VCBA 4QIWC 4M9LA 2K4IA 3BQTA 4M0AA 3MR2A 3ETLA 5KFXA 3IHQB 1ZQDA 1JMSA 5L9XA 2KIWA 3GIIA 1T3QA 2BPFA 1SV0C 4KLSA 4USAA 1RZTA 5JU5A 2HSZA 2KSOA 4QZ8A 4QZIA 4KTQA 2ZG6A 5CHGA 3M8RA 4F4WA 4M9NA 5KFVA 1SKSA 2HW3A 2YMPA 4MFAA 2CRXA 4NLCA 4JUZA 2C2DA 3I28A 7ICKA 3SQIA 3C5GA 1T4GA 5AKEA 4F50A 8ICAA 1OW5A 3T5LA 3KFUF 2W9BB 4ED1A 4DSFA 3GIKA 2QKQA 4C4SA 2BHNA 3PW2A 4C4RA 1XO1A 1UA0A 3H0RB 5KFFA 4KLUA 5HR6A 1S5LU 1S76D 2KJ8A 1D8BA 4C80A 5KFSA 1PK3A 1Z4NA 4Y2JA 1UCVA 3MC1A 3ZDDA 5AI5A 4I2JA 5F9LA 7ICQA 1NK7A 1J2MA 2W9AA 4QZCA 2BCVA 2W3RA 4RNOA 2RQ5A 2LM1A 4NWIA 5CR0A 1RYSA 1ZQLA 4O5EA 1NK5A 2OM6A 5KFKA 2ESEA 3UQ0A 1ZD4A 1B0XA 4O3NA 2OXOA 8ICYA 4ICAA 2H5XA 4F5QA 1U48A 2W55A 3N7PD 1N63A 1HEKA 5J0RA 3T5KA 1KW4A 3B0XA 5AI9A 1WCLA 1Z00B 2HVHA 4J03A 2ZIVA 4BWJA 3V7KA 4XUSA 5KT3A 2PXIA 4ECWA 4RQ4A 4US9A 5KFBA 4EENA 2IOFK 1MN8A 3FAHA 1NJXA 1P7DA 7ICEA 4E0DA 2JEFA 5EE3A 5KFJA 5AKYA 1XSPA 1L8LA 1L3VA 2KKVA 3WK8A 4QIWF 4Q8FA 3AL0B 4O3RA 2W9BA 1SV4A 2EAMA 2OHFA 5AM5A 2BCRA 4TUQA 4F91B 2GWSA 3M1YA 1C20A 8ICJA 5TISU 4CGZA 3MBYA 3BQ2A 2JH7A 2KEYA 1U45A 3PV8A 4DQRA 3SV3A 4K4GA 1V85A 4DFKA 5J0WA 4ED0A 4NXZA 4I2AA 2W9CA 2FLNA 1BPBA 4R64A 3GU3A 1ZD5A 4B9UA 5J2BA 4PZOA 5KFLA 3RH4A 4DQIA 4YFKA 4UW9A 2EZXA 2C2EA 4DL3A 3EPGA 5KG7A 1PVQA 3BJYA 5J29A 1F0MA 3EW9A 2YQEA 1PK1B 2ZTDA 4PHAA 1UHUA 1MSWD 1N56A 3C1YA 4PGQA 1PVPA 1F44A 4IRKA 3A0BU 1K1SA 2JEJA 3QZ7A 2F1JA 4NLNA 5AKZA 5J2GA 2W54A 1V9PA 4KN7A 3H8JA 3BS5B 1XSNA 1X9SA 3BZCA 3WU2U 3TKAA 5AI0A 1S0OA 4F4KA 1WUDA 2LMRA 4MFFA 5ALIA 3N97B 5ALNA 1NJYA 3KZIU 5ALEA 2ZIWB 3CP8A 5KG6A 2F8KA 4QZAA 4CE6A 9ICJA 4C8MA 4NV0A 2WAQC 1V38A 5AKLA 2JEGA 4G3IA 8ICEA 2ZJ5A 4RNNA 4NJ8A 4Z6DA 5BOLA 4J9PA 4UBCA 2KTQA 8ICUA 3NVZA 3JPPA 4P0QA 4QZEA 5AK4A 3GQCA 3TAPA 4XA5A 2ZUBA 3WK5A 4UB3A 3HKZC 4FBTA 9ICOA 4TUSA 1NJWA 2B21A 2HBLA 2G07A 3EWAA 3HWTA 1M6YA 2Y0SC 4MF2A 2W11A 1Z1VA 9ICLA 5KFUA 1ZQPA 5DDYA 3TFSA 8ICIA 2DFLA 3V6JA 1Z19A 2VKQA 3RTVA 1ZQUA 5ALRA 1PK1A 2Y9TA 3SR6A 3KHRA 4NLKA 2AXTU 3KHLA 2NRXA 4UB6U 1N62A 4BGDA 1KSPA 4J9QA 4ECYA 4PGYA 4YMMA 5DB9A 3K1ZA 2VANA 1X6JA 1ZQHA 4AYBF 5KFYA 1C7YA 1F5SA 3F2DA 3BZKA 3AQEA 4DF8A 2KFZA 3QNMA 1J2NA 4F4XA 2BQ3A 4IQWA 4IC9A 3SI8A 2F77X 4F92B 5G5GA 1QCKA 9ICSA 3SYZA 5JRTA 2NRWA 3RH6A 2BR0A 1Y88A 2LBOA 1WCNA 4RZRA 3TARA 3BS7A 4IS7A 4Q44A 1TAUA 8ICFA 3IV6A 3QUTA 2E3TA 2NRVA 1NOMA 4NY8A 3SZ2A 2FI1A 4MEXA 2A19A 4HAIA 4CCHA 2XCPA 1N5XA 1KQQA 1QSYA 3KTQA 2LYAA 4KMUA 5J8YA 4RNMA 4DSLA 8ICWA 5AK5A 1QQ7A 2E8NA 2JR5A 5L1MA 1BGXT 2MUTB 2D6FC 4YR2A 3TACB 2EAOA 5J0UA 3OTQA 5ALVA 2DUYA 1KRPA 5KL8B 1X9WA 3C2LA 2YMMA 3CNHA 3H8MA 5F9NA 4UAYA 2WAQF 4B9SA 4I28A 2XC9A 2W9CB 3ZD8A 1TKDA 3KZXA 2RDJA 2KHQA 1UPHA 1S8OA 4ED6A 2AU0A 2OYYA 2E8MA 3UXPA 1N61A 5ALYA 3QEBZ 2R8GA 5AKGA 2JEIA 1S0VA 4ZH4A 2H3VA 4DL7A 4GXKA 1COOA 3G6VA 2EDUA 5ALXA 4I29A 2XY6A 4YR3A 4DQSA 4QW9A 3KHHA 3UXOA 3Q8MA 3QXGA 4QWEA 4RUAA 2QLTA 2PI5A 3WKBA 3THVA 2HBKA 4O9MA 2WF9A 4P4PA 5KFWA 3GIMA 4YN4A 3IM1A 2EZYA 1NK8A 3BS5A 3IG8A 4FE3A 5F3XB 3AU6A 1S77D 4DF4A 2BDPA 4O5KA 2R8HA 4PL2A 4DSIA 1UT8A 1ED1A 4KLTA 3V7JA 4F5NA 7ICFA 2DL0A 1XS9D 3ISDA 2IOFA 2ASJA 2F2AB 1JX4A 4KLOA 2OEHA 5C5JA 3RF9A 2NO5A 4YVZA 1NK0A 1ZQJA 2WHEA 2IA6A 3ZDCA 3Q8RB 1TV9A 3MFIA 2KNJA 2K8AA 1CRXA 1Z4OA 4QZHA 5KFPA 4NL9C 4QWAA 1RM6C 4PHEA 4QZDA 2VIXA 1SZPA 1DGJA 3NASA 1COKA 2FDRA 4NL9A 5KFDA 2P6RA 1RXVA 2DGZA 1NI3A 3C1ZA 4KLHA 4M9GA 3F2CA 2K8BB 3AN1A 2NYVA 2FMSA 9ICMA 4LZGA 5KT7A 2FMQA 1SWWA 3RH5A 4KLDA 5J2CA 2KK0A 1ZYQA 5ALPA 1EXNA 4DQPA 1VJ5A 4JWNA 4QJFB 1QSLA 2HHSA 1WYGA 4B9VA 2W9MA 3BDPA 4P0QB 4KLLA 2JMGA 2FE9A 4JB3A 2W7PA 4UBBA 3EZ5A 1XSLA 7ICHA 3QUBA 3Q8QB 2BCQA 3MR6A 1H38A 2PFOA 3PSPA 2F76X 3DEEA 2D3DA 3PY8A 2HHTA 3HRDD 5J8YC 7ICJA 3RFAA 3JPTA 1SKWA 4Q45A 3F53A 5KG0A 4Y2QA 4B9TA 4C8NA 7ICVA 4Q43A 2JHDA 4PGXA 4F71A 1KFSA 4PL1A 5IINA 1K5OA 2EQYA 2L5YA 1ZQFA 3PR4A 4YXMA 1XWLA 3PO4A 2LYBA 5D49A 4RT3A 3S6JA 2AH5A 3M9MB 5KFCA 5KG3A 1ZQBA 4TQRA 2K89A 2OWOA 5DG7A 5KAFU 1O03A 5AKXA 4RQMA 1OXJA 3JPSA 2B6GA 5J2DA 2HHWA 5DKWA 1ZQXA 2BPGA 1ZETA 2G06A 4U7CA 1SV0A 5ALSA 3RJEA 2JGAA 3PZPA 4QZFA 3Q8LA 4KLGA 3V6HA 4RQNA 5JUMA 2QB0B 3SAFA 3JPOA 2MRLA 2BCSA 5KFGA 2GO7A 4M47A 3QE9Y 4YQWA 1UA1A 3Q8SB 4BJQA 2W04A 4RQ7A 2E5SA 2KG5A 9ICFA 2MUTA 3B9JA 3C28A 1BPXA 4YD1A 4QWCA 2E1FA 3OSPA 3WKAA 3H4BA 3UM9A 2ZIXA 4I2DA 2BQUA 3RAXA 2XVTA 1RXWA 4JMUA 5CP2A 1SXDA 5T14A 2W8LA 1NJZA 3QYPA 3MR5A 4K4HA 2ZIUB 4C4TA 2KSOB 2YMLA 1SWVA 3FM9A 3V6KA 2R8JA 3PW7A 2F8LA 5ALGA 8ICMA 1N5WA 4EBDA 3MDCA 2R8IA 9ICXA 3TADA 4DO9A 1ZOLA 8ICBA 2PKEA 1ZQRA 1IM4A 4DFJA 9ICNA 1Q3VA 3SENA 4AYBC 1U9LA 4I2GA 2H3QA 4Y2RA 8ICTA 4NLZA 2HOFA 2AHOB 3NTUA 4GIBA 2A1JB 4QZ9A 3TAQA 3QZ8A 3H7IA 2KZ3A 3UMGA 1T8EA 3QU5A 5H2FU 4Y2PA 5J2KA 4NM1A 1JIHA 4OO1J 2G5HB 2ZTEA 1YZ6A 5CWRA 5KG2A 1Q3UA 2PFQA 2XGPA 1ZQKA 3H0MB 3KD3A 2AGPA 4UARA 5DDMA 1XNSA 1DK2A 1TE2A 2N1RA 5J0PA 1D8YA
chains in the Genus database with same CATH topology
1PVPA 1F44A 2H3VA 3SAFA 3H0LB 2A3VA 2G5IB 4P0QB 3IN5A 2MRLA 3F2BA 3VCBA 4QIWC 2ZXIA 2JMGA 2RP5A 3N7PD 2K4IA 4CRXA 1HEKA 1YT3A 2RRDA 3K1ZA 2W7PA 4KMOB 1IIPA 2VJ5A 4AYBF 3SAGA 3L3FX 2VJ4A 4BJQA 1XO0A 3F2DA 4P0PB 4NLBA 1KBUA 1T94A 2K8CB 2W04A 3AQEA 2E5SA 3PSPA 2KIWA 3SMVA 4CDGA 2F76X 2DF4B 3DEEA 4BUGA 2HBJA 2HBKA 2ZIVA 5CRXA 3C28A 1ZQ1C 4IC9A 2E1FA 3M6ZA 2PMZC 1PVRA 2F77X 3VC8A 2PMZF 2YX8A 4FZLA 3RFAA 2G09A 3D2SA 1A6SA 1WUDA 3F53A 3D2NA 2KVCA 2ZG6A 2ZIXA 2H3ZA 2XVTA 2E1EA 2KD1A 2G0AA 2W03A 3IG8A 4FE3A 1TAMA 2H3IA 2ZIUA 3AQFA 3O0FA 4JMUA 4BX9C 5T14A 1P7DA 2LHTA 2LBOA 4KX5A 2ZIUB 2ZIWB 1HIWA 2KJ9A 4O3MA 2JHDA 2CRXA 3CP8A 4NLCA 4OJOA 4WJ3B 4PL2A 5HR7A 2CPRA 3F5EA 3SQIA 1ED1A 2JH1A 2KKVA 4QIWF 4QNLA 3AL0B 4NV0A 1URJA 2GH1A 2WAQC 3HKZF 4A8EA 2F8LA 2XI9A 4C0ZA 4OJ5A 2ZIWA 2OH2A 4PL1A 3C29A 2HOIA 2KKPA 4FZMA 2F2AB 3OPXA 3LVWA 3KFUF 1SZHA 3GZFA 3PSTA 2NV3A 3E0FA 4P0PA 3RF9A 2R18A 2XIDA 3M6KA 2YB4A 3CRXA 2ZXHA 1Q3VA 3H0RB 2LYBA 2KNJA 3PSFA 2K8AA 2ZIVB 4P0QA 2LYAA 4AYBC 1CRXA 4CGZA 2XICA 3LYSA 2Q4TA 5HR6A 2JH7A 2KEYA 1OUQA 2H3QA 5KL1B 2WB1F 3ONNA 3N7RC 4GFJA 3NUQA 2KJ8A 2HOFA 2GOLA 3HKZC 4ACOA 3F5AA 3MGVA 2K89A 1D8BA 1Z1BA 2BDUA 2VIXA 3N7SC 2HBLA 2G07A 2D6FC 4FZNA 1GO3F 2ZIXB 2KJ5A 2CN1A 3D2QA 1A0PA 2Y0SC 4OJPA 3SAHA 3GU3A 4OJ6A 3M7DA 1DRGA 3T79A 2DGZA 4OO1J 5KL8B 2G5HB 3LVVA 1ECWA 3F2CA 4OJLA 2K4HA 2K8BB 3CYMA 4NWIA 2HOQA 2WAQF 1Q3UA 2HMXA 4U6PA 1L6NA 2G06A 2H3FA 2KHVA 2LKYA 4KX3A 4U7CA 2DQNB 2RHFA 2Z7JA 2OM6A 1PVQA 2G08A 1Z19A 2JGAA 2VKQA 3H0MB 3NRWA 2KOBA 5C0YA 3PZPA 3KZXA 2KHQA 2KV2A 2HBMA 3PSIA 1MA7A 1NZBA 2WB1C 1UPHA 2YB1A 2OYYA 4QJFB 1XNSA 2K4EA 2OXOA 2MA1A 3ICXA 4ICAA 2M0NA 3ALRA 2Y0SF 2W7OA 2N1RA 5A0LA 3IG5A 3IP4B 2KICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3V A;  1TAM A;  2H3I A;  4JMU A;  1ECW A;  2JMG A;  2LYB A;  2K4H A;  2K4I A;  2LYA A;  1HEK A;  1HIW A;  1L6N A;  2HMX A;  2H3Q A;  2H3F A;  1ED1 A;  2GOL A;  1UPH A;  4IC9 A;  2NV3 A;  2K4E A;  4ICA A;  1A6S A;  2N1R A;  2H3Z A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  3AMZ A;  2F44 A;  2AQ4 A;  5AIB A;  3H4D A;  2FMP A;  4J9K A;  1ZQI A;  5ALL A;  4ECZ A;  4YMN A;  3OHB A;  3C23 A;  1S0M A;  4UB4 A;  3GFK B;  1RG6 A;  1NKB A;  1UT5 A;  2AGO A;  3AEV A;  3VC8 A;  2PMZ F;  3C2M A;  2JZB A;  4DLE A;  3LWL A;  1L3T A;  2H3Z A;  4IQT A;  5J0S A;  2E1E A;  2W03 A;  2ZIU A;  4F93 B;  4LJX A;  4BX9 C;  3T3F A;  4YCX A;  3J81 j;  5KT6 A;  3RJI A;  4R8U A;  1ZQO A;  3TQ1 A;  4A8E A;  2GH1 A;  4Z6F A;  1NK6 A;  4C8O A;  3KHG A;  1NK4 A;  7ICL A;  1LB2 B;  2KP7 A;  9ICQ A;  4KLE A;  2PI4 A;  4UB1 A;  2QB0 A;  4Z6C A;  3AM9 A;  4C7Y A;  4ECV A;  1ZQN A;  4OD0 A;  1ZRN A;  2QAR B;  1KFD A;  5HHH A;  2Q4T A;  3I76 A;  2HHX A;  2HHV A;  4MHV A;  4GC6 A;  3EUB 2;  3N7R C;  4GFJ A;  5B66 U;  5EWG A;  2FLP A;  5AIC A;  3PX0 A;  4JK1 A;  5DBC A;  2XGQ A;  2ZIX B;  3PW5 A;  1N48 A;  5DBA A;  4ECU A;  2WF7 A;  5E79 U;  4MF8 A;  2WF8 A;  4OJL A;  3MR3 A;  2ZUC A;  1L6N A;  1X6I A;  5DGB A;  3QU7 A;  2RHF A;  5EWF A;  2KOB A;  3T5H A;  1BPE A;  4DSE A;  5J0T A;  2M0N A;  3IRU A;  4OCZ A;  5HNK A;  5CEH A;  2ZXI A;  4M9H A;  3PVX A;  2RP5 A;  5DQG A;  2RRD A;  4P4O A;  4EEL A;  5KFZ A;  2VJ5 A;  3ZDA A;  3L3F X;  9ICW A;  4O0I A;  4DOB A;  1AQ6 A;  9ICE A;  4IR9 A;  1A77 A;  2DKZ A;  5AIA A;  5KFO A;  2ZJA A;  3JPR A;  4GLX A;  1PVR A;  2R8K A;  1WWU A;  2YX8 A;  4FZL A;  2JRZ A;  3H8W A;  1A6S A;  3CW2 C;  3WKE A;  1ZQW A;  2NO4 A;  5GTI U;  4UAV A;  3PNC A;  5KFA A;  2KN7 A;  2AQ0 A;  1HIW A;  2KJ9 A;  4WJ3 B;  4Y2Y A;  5AKJ A;  4I2E A;  4KLQ A;  3F5E A;  4J9S A;  3QEA Z;  1QQ6 A;  1X9M A;  3HKZ F;  4ECX A;  2ZIW A;  4FO6 A;  8ICC A;  1ZQM A;  4CNQ A;  2E8P A;  1IXR A;  2KKP A;  5CB1 A;  4PJ0 U;  1SZH A;  3E0F A;  1DOQ A;  4F8R A;  5AM3 A;  2R18 A;  4B6J A;  7ICU A;  3UMB A;  2WB1 F;  5KFR A;  4DOA A;  3QU9 A;  3NUQ A;  3MAB A;  4ACO A;  1ZQA A;  1HUO A;  1J97 A;  2BQR A;  4US8 A;  3HP6 A;  1L3U A;  2WF5 A;  2CN1 A;  2W43 A;  3SAH A;  3RJH A;  3NRZ A;  5ALQ A;  4RT2 A;  4F5P A;  1ZJM A;  3WKC A;  3LVV A;  1DGS A;  5IIK A;  3BQ1 A;  1KDH A;  2ODG A;  7ICO A;  2HOQ A;  5KFN A;  4DL6 A;  2LKY A;  3SD7 A;  4MFC A;  3GV7 B;  8ICZ A;  2JV3 A;  2UVR A;  2Y1J A;  2KIV A;  3JPQ A;  3HX0 A;  1D9F A;  1NZB A;  2YB1 A;  1SIJ A;  2IOH A;  8ICP A;  3H0L B;  3I1Y A;  2BCU A;  2QAR A;  3PW4 A;  1YT3 A;  3KBB A;  4DL5 A;  1YZ7 A;  2HVI A;  1Q8K A;  2LI6 A;  4Z6E A;  3TAN A;  2B0C A;  4J9O A;  2FPK A;  7ICM A;  5AM2 A;  4EBE A;  2FPL A;  5ALO A;  2A1J A;  2DF4 B;  5CRX A;  5EWE A;  4O3Q A;  5AM0 A;  7ICT A;  1RDF A;  4LZD A;  5K4L A;  4DSJ A;  3JPN A;  4F4Y A;  3WK6 A;  9ICT A;  1U4B A;  2H3I A;  3ZD9 A;  2ISP A;  3FDS A;  5KT5 A;  4UAT A;  2CPR A;  5D4B A;  3PW0 A;  2XI9 A;  1ZJN A;  4OJ5 A;  5ALK A;  3NS1 A;  1WG8 A;  5DB8 A;  3LVW A;  3PST A;  1KN5 A;  2NV3 A;  1Q46 A;  4J9L A;  3RRG A;  4P0P A;  2AJQ A;  4R8U B;  4BXO B;  1S9F A;  2XO7 A;  3RB0 A;  3QX7 A;  1MQ2 A;  4O3S A;  1OUQ A;  4ELU A;  4IL6 U;  2ASL A;  3HT3 A;  1KEJ A;  1T3N A;  3RJG A;  5IIO A;  5J2A A;  2BZF A;  4ED8 A;  4NM2 A;  3M7D A;  5HP4 A;  7ICN A;  2I5H A;  8ICS A;  1ECW A;  1L7M A;  2K4H A;  4DOC A;  3NVV A;  3CYM A;  2DQN B;  4M9J A;  2QB1 A;  4KLF A;  4HYK A;  3DV9 A;  5HML A;  2CXY A;  2VA2 A;  4DL4 A;  5A0L A;  3IG5 A;  3IP4 B;  2KIC A;  1ZQY A;  4UB5 A;  3N4M B;  3PML A;  1BPZ A;  3IN5 A;  5IIM A;  5J0X A;  2W8K A;  3C21 A;  4Y2V A;  1IIP A;  1QTM A;  4UB8 U;  2KFN A;  2P35 A;  1FFV A;  1VLB A;  2EAN A;  4CF3 A;  4J9N A;  1ZQ1 C;  3LDA A;  3MDA A;  2DPI A;  2PMZ C;  1TFR A;  2ATL A;  2ISO A;  5ALU A;  4AP9 A;  5J0Q A;  5ALZ A;  2ES6 A;  1ZQG A;  4OJO A;  1FFU A;  3HJE A;  4Y2T A;  4RQ5 A;  3RR8 A;  4IQU A;  8ICK A;  3DDH A;  1JRP A;  1BPY A;  1O08 A;  3OPX A;  2ZJ8 A;  3GZF A;  1IV8 A;  3ZI4 A;  5DB6 A;  3M6K A;  3C5F A;  2ZXH A;  8ICV A;  5DG9 A;  5DB7 A;  7ICP A;  5III A;  4EX6 A;  5FP0 A;  2GOL A;  5KFH A;  3OSN A;  8ICO A;  3QUQ A;  4KIT B;  2ZUD A;  4F2R A;  2BDU A;  3PO5 A;  8ICR A;  4K4I A;  5DQI A;  4DEZ A;  1IG6 A;  4PH5 A;  4JV0 A;  4FS2 A;  4EYH B;  2PFP A;  5KAI U;  4U6P A;  2FLL A;  3UQ2 A;  4KX3 A;  1L3S A;  2XY7 A;  2Z7J A;  2G08 A;  2KZZ A;  1JI7 A;  3GV5 B;  4P4M A;  5AKH A;  4P2H A;  3AU2 A;  5DLF A;  3RBE A;  3LWM A;  4UAS A;  4TUP A;  2I1Q A;  2A1A A;  4BDP A;  4Y2U A;  4RQ6 A;  3RRH A;  3ZDE A;  4EX7 A;  2C2R A;  3ED5 A;  1T94 A;  4XQ8 A;  5KFE A;  4BWM A;  2I6X A;  3M6Z A;  4YXJ A;  4KLM A;  2KVC A;  5ALH A;  2HHU A;  2G0A A;  3QU2 A;  2GLE A;  4KLI A;  4FFD A;  5GTH U;  2JH1 A;  4DLG A;  3EPI A;  2UVU A;  1QLN A;  5IIL A;  3NVY A;  5KFM A;  3C29 A;  1A76 A;  2DBY A;  2HOI A;  1TK0 A;  1L7N A;  4JV1 A;  1QQ5 A;  2UVV A;  3N28 A;  7ICG A;  4QZB A;  4RQ1 A;  3CRX A;  3GIJ A;  2DKX A;  3EYZ A;  1N2X A;  1T7P A;  3ISC A;  3AUO A;  3GV8 B;  4I2C A;  1JXL A;  4M6W B;  1ZRM A;  3Q8K A;  5CA7 A;  3HIL A;  4ECT A;  1ZQV A;  5DBB A;  2KJ5 A;  2I9G A;  4OJP A;  4YG2 A;  4DS4 A;  4LVS A;  4I27 A;  1B22 A;  2EH9 A;  4PZN A;  1XU4 A;  3PSI A;  4DFP A;  3M8S A;  1D8L A;  3ICX A;  4FS1 A;  4NLG A;  3M9O B;  1JUD A;  3C2K A;  3GIL A;  2KZM A;  4Y2S A;  4F5R A;  5AI6 A;  4I2H A;  9ICC A;  4Q8E A;  4PPX A;  3H40 A;  3K4G A;  4DWI A;  2O6K A;  5AHX A;  2E8O A;  4BUG A;  3OGU A;  2UVW A;  1S0N A;  3Q8P B;  8ICL A;  2V9W A;  8ICN A;  4CF5 A;  5KG4 A;  4IQV A;  2G09 A;  1KLN A;  3RJJ A;  2KD1 A;  2LHT A;  2HDO A;  4KX5 A;  1MQ3 A;  9ICG A;  4F3O A;  1DK3 A;  4QNL A;  4RPZ A;  1TVA A;  3L4P A;  1URJ A;  4RUC A;  4C0Z A;  2XY5 A;  3K1R B;  3WK7 A;  1ZQT A;  7ICS A;  3RB3 A;  4J9M A;  1JXE A;  4QWB A;  3V7L A;  2XID A;  4EYI B;  2DPJ A;  3IDW A;  2BGW A;  4UAU A;  1BNO A;  4F4Z A;  2BPC A;  3PSF A;  2ZIV B;  2HCF A;  4QWD A;  5KL1 B;  3LK9 A;  1RYU A;  5D46 A;  2EAP A;  1RYR A;  4O5C A;  5DLG A;  3SV4 A;  4DL2 A;  4G9B A;  4YD2 A;  1JAL A;  2M9N A;  9ICI A;  1KFT A;  3WKD A;  1N60 A;  1SL0 A;  3D2Q A;  5HMM A;  3RR7 A;  3ORY A;  3T79 A;  3K75 D;  5AM1 A;  2F1I A;  9ICP A;  1JRO A;  5J2E A;  2ASD A;  9ICB A;  9ICV A;  5ALJ A;  2Y1I A;  2J6U A;  4JWM A;  3RJK A;  2KHV A;  5DG8 A;  1NKC A;  3R9K A;  2PFN A;  2V4R A;  3PX6 A;  2KV2 A;  4R66 A;  1MA7 A;  3ISB A;  2K4E A;  2XCA A;  3UXN A;  2Y0S F;  3E58 A;  4QZG A;  4RQ0 A;  2A3V A;  3KKA C;  5ALD A;  4QW8 A;  2D8C A;  3NVW A;  1U47 A;  3OHA A;  4EBC A;  1TAQ A;  3D6J A;  3L5K A;  3SAG A;  4X5V A;  1XO0 A;  2NRT A;  4P0P B;  1KBU A;  3TAD C;  2K8C B;  3SMV A;  5AM4 A;  3V72 A;  1PZN A;  2HBJ A;  4DS5 A;  3A0H U;  5KT4 A;  3D2S A;  3U26 A;  4F72 A;  3B0Y A;  1SB3 C;  1QH9 A;  4B9M A;  4GC7 A;  1TAM A;  3AQF A;  1JN3 A;  2JZB B;  2IBK A;  5AI4 A;  1HUZ A;  5EOZ A;  5IIJ A;  2ZTC A;  3SEI A;  4I2B A;  2MSN A;  2IHM A;  3NGD A;  4KN4 A;  4RPY A;  1SKR A;  2C28 A;  1ZQQ A;  1ZQS A;  1Z00 A;  5DQH A;  3MGI A;  5J2J A;  7ICI A;  2YB4 A;  5AKK A;  2ALZ A;  1LVH A;  1KTQ A;  4UAW A;  2W3S A;  2P6U A;  1S97 A;  3LYS A;  5EE1 A;  3ONN A;  4TQS A;  2AGQ A;  3F5A A;  2YTU A;  5EE9 A;  5BOM A;  4ED7 A;  5AKI A;  5DGA A;  5CJ7 A;  1B43 A;  4MEY A;  3RJF A;  5J2H A;  2KMD A;  5G5H A;  1GO3 F;  4OJ6 A;  1ZQZ A;  4UQG A;  3ETR A;  1LV5 A;  1ZQC A;  3QU4 A;  4C7Z A;  2JXJ A;  2J6T A;  2H3F A;  4UAZ A;  5KG1 A;  1Z3E B;  4M2Y A;  1U49 A;  4DFM A;  2HBM A;  2WB1 C;  2HHQ A;  1LKY B;  3FC4 A;  1B4F A;  4RQ3 A;  1ARO P;  4PHD A;  3MGH A;  8ICH A;  3HW8 A;  3MFH A;  2K60 A;  5B5E U;  2YN4 A;  4CRX A;  3ZDB A;  4KMO B;  9ICU A;  4M6W A;  4BXO A;  4NLB A;  4DSK A;  5L1L A;  4C8L A;  4R63 A;  4RQ2 A;  1X2I A;  2EZZ A;  4IRC A;  4UB2 A;  1CI4 A;  9ICK A;  5ALM A;  4KLJ A;  4ECS A;  2J6S A;  1RQN A;  1X42 A;  4O3M A;  4I2F A;  5KTQ A;  2Q0Z X;  5HR7 A;  1NKE A;  4ECQ A;  1RPL A;  1TK5 A;  1D9D A;  1UQV A;  2OH2 A;  3BQ0 A;  1VDV A;  5JTI A;  2P66 A;  1KKX A;  1QSS A;  3PX4 A;  2V4Q A;  4B9L A;  1X40 A;  1WWV A;  4RU9 A;  4DCC A;  4FBU A;  1K1Q A;  1L5U A;  1FIQ A;  5J2I A;  4RPX A;  1L7O A;  3T5J A;  3MGV A;  5L1I A;  2BKE A;  9ICH A;  1X66 A;  3PMN A;  1Z1B A;  4PHP A;  1SL1 A;  3M9N B;  3N7S C;  4YP3 A;  4B9N A;  1ZXI A;  1BVS A;  4GXI A;  2LYH A;  2VA8 A;  4FZN A;  2RDI A;  2NRZ A;  2MU2 A;  2MAX A;  4DQQ A;  1A0P A;  8ICG A;  1CEZ A;  2KVS A;  1DRG A;  3OJU A;  4IRD A;  2WFA A;  9ICR A;  5KFI A;  5TZV A;  1DXS A;  3WK4 A;  1CUK A;  2WTF A;  2F1H A;  1SGG A;  2IHN A;  4R65 A;  5J2F A;  9ICA A;  5C0Y A;  4J9R A;  1ZQE A;  1LKY A;  3WK9 A;  1L8O A;  2LM4 A;  2W7O A;  2K4P A;  5AK6 A;  2F3N A;  5BPC A;  5KFT A;  2YY6 A;  3F2B A;  1HJP A;  4O3O A;  3RB4 A;  2DWQ A;  4EZ6 A;  5KG5 A;  4C8K A;  2VJ4 A;  1BPD A;  4I2I A;  4ED2 A;  4CDG A;  1NK9 A;  5ALT A;  1FEZ A;  3RAQ A;  2FPM A;  4Y2X A;  3KOO A;  3PR5 B;  1L7P A;  4IR1 A;  8ICQ A;  3BQ7 A;  3UPQ A;  3G6X A;  3D2N A;  3TFR A;  5L1J A;  3QUC A;  5KFQ A;  1SL2 A;  1KL9 A;  3O0F A;  3UMC A;  2Y9U A;  3KKA A;  2YMQ A;  5L1K A;  4ELV A;  1TK8 A;  4ECR A;  4EZ9 A;  4ELT A;  1PUZ A;  2LPE A;  4FZM A;  5ALF A;  4F2S A;  2KE7 A;  4JV2 A;  3RB6 A;  4F5O A;  2WF6 A;  2FJ6 A;  1X9X A;  3GDX A;  2XIC A;  2VA3 A;  4YR0 A;  5EE0 A;  4CF4 A;  3HPO A;  3FYH A;  4M04 A;  1V97 A;  4RQ8 A;  4O3P A;  4YMO A;  2C22 A;  3H8S A;  5AI8 A;  1NZP A;  4TUR A;  4DFD A;  2RLT A;  4EEK A;  4EEY A;  4XRH A;  4GXJ A;  2IMW P;  8ICX A;  3G6Y A;  1MC8 A;  2HMX A;  5KT2 A;  1RQL A;  2HI0 A;  5J0Y A;  5KNI A;  3NRW A;  1NNL A;  1SXE A;  1BNP A;  5ALW A;  3OJS A;  3E2E A;  4ED3 A;  3RBD A;  1S10 A;  2MA1 A;  7ICR A;  1ZD2 P;  5J0O A;  3ALR A;  4ZOH C;  2OCE A;  3TI0 A;  1ZD3 A;  2G5I B;  1XC9 A;  5AK3 A;  5HHI A;  3VCB A;  4QIW C;  4M9L A;  2K4I A;  3BQT A;  4M0A A;  3MR2 A;  3ETL A;  5KFX A;  3IHQ B;  1ZQD A;  1JMS A;  5L9X A;  2KIW A;  3GII A;  1T3Q A;  2BPF A;  1SV0 C;  4KLS A;  4USA A;  1RZT A;  5JU5 A;  2HSZ A;  2KSO A;  4QZ8 A;  4QZI A;  4KTQ A;  2ZG6 A;  5CHG A;  3M8R A;  4F4W A;  4M9N A;  5KFV A;  1SKS A;  2HW3 A;  2YMP A;  4MFA A;  2CRX A;  4NLC A;  4JUZ A;  2C2D A;  3I28 A;  7ICK A;  3SQI A;  3C5G A;  1T4G A;  5AKE A;  4F50 A;  8ICA A;  1OW5 A;  3T5L A;  3KFU F;  2W9B B;  4ED1 A;  4DSF A;  3GIK A;  2QKQ A;  4C4S A;  2BHN A;  3PW2 A;  4C4R A;  1XO1 A;  1UA0 A;  3H0R B;  5KFF A;  4KLU A;  5HR6 A;  1S5L U;  1S76 D;  2KJ8 A;  1D8B A;  4C80 A;  5KFS A;  1PK3 A;  1Z4N A;  4Y2J A;  1UCV A;  3MC1 A;  3ZDD A;  5AI5 A;  4I2J A;  5F9L A;  7ICQ A;  1NK7 A;  1J2M A;  2W9A A;  4QZC A;  2BCV A;  2W3R A;  4RNO A;  2RQ5 A;  2LM1 A;  4NWI A;  5CR0 A;  1RYS A;  1ZQL A;  4O5E A;  1NK5 A;  2OM6 A;  5KFK A;  2ESE A;  3UQ0 A;  1ZD4 A;  1B0X A;  4O3N A;  2OXO A;  8ICY A;  4ICA A;  2H5X A;  4F5Q A;  1U48 A;  2W55 A;  3N7P D;  1N63 A;  1HEK A;  5J0R A;  3T5K A;  1KW4 A;  3B0X A;  5AI9 A;  1WCL A;  1Z00 B;  2HVH A;  4J03 A;  2ZIV A;  4BWJ A;  3V7K A;  4XUS A;  5KT3 A;  2PXI A;  4ECW A;  4RQ4 A;  4US9 A;  5KFB A;  4EEN A;  2IOF K;  1MN8 A;  3FAH A;  1NJX A;  1P7D A;  7ICE A;  4E0D A;  2JEF A;  5EE3 A;  5KFJ A;  5AKY A;  1XSP A;  1L8L A;  1L3V A;  2KKV A;  3WK8 A;  4QIW F;  4Q8F A;  3AL0 B;  4O3R A;  2W9B A;  1SV4 A;  2EAM A;  2OHF A;  5AM5 A;  2BCR A;  4TUQ A;  4F91 B;  2GWS A;  3M1Y A;  1C20 A;  8ICJ A;  5TIS U;  4CGZ A;  3MBY A;  3BQ2 A;  2JH7 A;  2KEY A;  1U45 A;  3PV8 A;  4DQR A;  3SV3 A;  4K4G A;  1V85 A;  4DFK A;  5J0W A;  4ED0 A;  4NXZ A;  4I2A A;  2W9C A;  2FLN A;  1BPB A;  4R64 A;  3GU3 A;  1ZD5 A;  4B9U A;  5J2B A;  4PZO A;  5KFL A;  3RH4 A;  4DQI A;  4YFK A;  4UW9 A;  2EZX A;  2C2E A;  4DL3 A;  3EPG A;  5KG7 A;  1PVQ A;  3BJY A;  5J29 A;  1F0M A;  3EW9 A;  2YQE A;  1PK1 B;  2ZTD A;  4PHA A;  1UHU A;  1MSW D;  1N56 A;  3C1Y A;  4PGQ A;  1PVP A;  1F44 A;  4IRK A;  3A0B U;  1K1S A;  2JEJ A;  3QZ7 A;  2F1J A;  4NLN A;  5AKZ A;  5J2G A;  2W54 A;  1V9P A;  4KN7 A;  3H8J A;  3BS5 B;  1XSN A;  1X9S A;  3BZC A;  3WU2 U;  3TKA A;  5AI0 A;  1S0O A;  4F4K A;  1WUD A;  2LMR A;  4MFF A;  5ALI A;  3N97 B;  5ALN A;  1NJY A;  3KZI U;  5ALE A;  2ZIW B;  3CP8 A;  5KG6 A;  2F8K A;  4QZA A;  4CE6 A;  9ICJ A;  4C8M A;  4NV0 A;  2WAQ C;  1V38 A;  5AKL A;  2JEG A;  4G3I A;  8ICE A;  2ZJ5 A;  4RNN A;  4NJ8 A;  4Z6D A;  5BOL A;  4J9P A;  4UBC A;  2KTQ A;  8ICU A;  3NVZ A;  3JPP A;  4P0Q A;  4QZE A;  5AK4 A;  3GQC A;  3TAP A;  4XA5 A;  2ZUB A;  3WK5 A;  4UB3 A;  3HKZ C;  4FBT A;  9ICO A;  4TUS A;  1NJW A;  2B21 A;  2HBL A;  2G07 A;  3EWA A;  3HWT A;  1M6Y A;  2Y0S C;  4MF2 A;  2W11 A;  1Z1V A;  9ICL A;  5KFU A;  1ZQP A;  5DDY A;  3TFS A;  8ICI A;  2DFL A;  3V6J A;  1Z19 A;  2VKQ A;  3RTV A;  1ZQU A;  5ALR A;  1PK1 A;  2Y9T A;  3SR6 A;  3KHR A;  4NLK A;  2AXT U;  3KHL A;  2NRX A;  4UB6 U;  1N62 A;  4BGD A;  1KSP A;  4J9Q A;  4ECY A;  4PGY A;  4YMM A;  5DB9 A;  3K1Z A;  2VAN A;  1X6J A;  1ZQH A;  4AYB F;  5KFY A;  1C7Y A;  1F5S A;  3F2D A;  3BZK A;  3AQE A;  4DF8 A;  2KFZ A;  3QNM A;  1J2N A;  4F4X A;  2BQ3 A;  4IQW A;  4IC9 A;  3SI8 A;  2F77 X;  4F92 B;  5G5G A;  1QCK A;  9ICS A;  3SYZ A;  5JRT A;  2NRW A;  3RH6 A;  2BR0 A;  1Y88 A;  2LBO A;  1WCN A;  4RZR A;  3TAR A;  3BS7 A;  4IS7 A;  4Q44 A;  1TAU A;  8ICF A;  3IV6 A;  3QUT A;  2E3T A;  2NRV A;  1NOM A;  4NY8 A;  3SZ2 A;  2FI1 A;  4MEX A;  2A19 A;  4HAI A;  4CCH A;  2XCP A;  1N5X A;  1KQQ A;  1QSY A;  3KTQ A;  2LYA A;  4KMU A;  5J8Y A;  4RNM A;  4DSL A;  8ICW A;  5AK5 A;  1QQ7 A;  2E8N A;  2JR5 A;  5L1M A;  1BGX T;  2MUT B;  2D6F C;  4YR2 A;  3TAC B;  2EAO A;  5J0U A;  3OTQ A;  5ALV A;  2DUY A;  1KRP A;  5KL8 B;  1X9W A;  3C2L A;  2YMM A;  3CNH A;  3H8M A;  5F9N A;  4UAY A;  2WAQ F;  4B9S A;  4I28 A;  2XC9 A;  2W9C B;  3ZD8 A;  1TKD A;  3KZX A;  2RDJ A;  2KHQ A;  1UPH A;  1S8O A;  4ED6 A;  2AU0 A;  2OYY A;  2E8M A;  3UXP A;  1N61 A;  5ALY A;  3QEB Z;  2R8G A;  5AKG A;  2JEI A;  1S0V A;  4ZH4 A;  2H3V A;  4DL7 A;  4GXK A;  1COO A;  3G6V A;  2EDU A;  5ALX A;  4I29 A;  2XY6 A;  4YR3 A;  4DQS A;  4QW9 A;  3KHH A;  3UXO A;  3Q8M A;  3QXG A;  4QWE A;  4RUA A;  2QLT A;  2PI5 A;  3WKB A;  3THV A;  2HBK A;  4O9M A;  2WF9 A;  4P4P A;  5KFW A;  3GIM A;  4YN4 A;  3IM1 A;  2EZY A;  1NK8 A;  3BS5 A;  3IG8 A;  4FE3 A;  5F3X B;  3AU6 A;  1S77 D;  4DF4 A;  2BDP A;  4O5K A;  2R8H A;  4PL2 A;  4DSI A;  1UT8 A;  1ED1 A;  4KLT A;  3V7J A;  4F5N A;  7ICF A;  2DL0 A;  1XS9 D;  3ISD A;  2IOF A;  2ASJ A;  2F2A B;  1JX4 A;  4KLO A;  2OEH A;  5C5J A;  3RF9 A;  2NO5 A;  4YVZ A;  1NK0 A;  1ZQJ A;  2WHE A;  2IA6 A;  3ZDC A;  3Q8R B;  1TV9 A;  3MFI A;  2KNJ A;  2K8A A;  1CRX A;  1Z4O A;  4QZH A;  5KFP A;  4NL9 C;  4QWA A;  1RM6 C;  4PHE A;  4QZD A;  2VIX A;  1SZP A;  1DGJ A;  3NAS A;  1COK A;  2FDR A;  4NL9 A;  5KFD A;  2P6R A;  1RXV A;  2DGZ A;  1NI3 A;  3C1Z A;  4KLH A;  4M9G A;  3F2C A;  2K8B B;  3AN1 A;  2NYV A;  2FMS A;  9ICM A;  4LZG A;  5KT7 A;  2FMQ A;  1SWW A;  3RH5 A;  4KLD A;  5J2C A;  2KK0 A;  1ZYQ A;  5ALP A;  1EXN A;  4DQP A;  1VJ5 A;  4JWN A;  4QJF B;  1QSL A;  2HHS A;  1WYG A;  4B9V A;  2W9M A;  3BDP A;  4P0Q B;  4KLL A;  2JMG A;  2FE9 A;  4JB3 A;  2W7P A;  4UBB A;  3EZ5 A;  1XSL A;  7ICH A;  3QUB A;  3Q8Q B;  2BCQ A;  3MR6 A;  1H38 A;  2PFO A;  3PSP A;  2F76 X;  3DEE A;  2D3D A;  3PY8 A;  2HHT A;  3HRD D;  5J8Y C;  7ICJ A;  3RFA A;  3JPT A;  1SKW A;  4Q45 A;  3F53 A;  5KG0 A;  4Y2Q A;  4B9T A;  4C8N A;  7ICV A;  4Q43 A;  2JHD A;  4PGX A;  4F71 A;  1KFS A;  4PL1 A;  5IIN A;  1K5O A;  2EQY A;  2L5Y A;  1ZQF A;  3PR4 A;  4YXM A;  1XWL A;  3PO4 A;  2LYB A;  5D49 A;  4RT3 A;  3S6J A;  2AH5 A;  3M9M B;  5KFC A;  5KG3 A;  1ZQB A;  4TQR A;  2K89 A;  2OWO A;  5DG7 A;  5KAF U;  1O03 A;  5AKX A;  4RQM A;  1OXJ A;  3JPS A;  2B6G A;  5J2D A;  2HHW A;  5DKW A;  1ZQX A;  2BPG A;  1ZET A;  2G06 A;  4U7C A;  1SV0 A;  5ALS A;  3RJE A;  2JGA A;  3PZP A;  4QZF A;  3Q8L A;  4KLG A;  3V6H A;  4RQN A;  5JUM A;  2QB0 B;  3SAF A;  3JPO A;  2MRL A;  2BCS A;  5KFG A;  2GO7 A;  4M47 A;  3QE9 Y;  4YQW A;  1UA1 A;  3Q8S B;  4BJQ A;  2W04 A;  4RQ7 A;  2E5S A;  2KG5 A;  9ICF A;  2MUT A;  3B9J A;  3C28 A;  1BPX A;  4YD1 A;  4QWC A;  2E1F A;  3OSP A;  3WKA A;  3H4B A;  3UM9 A;  2ZIX A;  4I2D A;  2BQU A;  3RAX A;  2XVT A;  1RXW A;  4JMU A;  5CP2 A;  1SXD A;  5T14 A;  2W8L A;  1NJZ A;  3QYP A;  3MR5 A;  4K4H A;  2ZIU B;  4C4T A;  2KSO B;  2YML A;  1SWV A;  3FM9 A;  3V6K A;  2R8J A;  3PW7 A;  2F8L A;  5ALG A;  8ICM A;  1N5W A;  4EBD A;  3MDC A;  2R8I A;  9ICX A;  3TAD A;  4DO9 A;  1ZOL A;  8ICB A;  2PKE A;  1ZQR A;  1IM4 A;  4DFJ A;  9ICN A;  1Q3V A;  3SEN A;  4AYB C;  1U9L A;  4I2G A;  2H3Q A;  4Y2R A;  8ICT A;  4NLZ A;  2HOF A;  2AHO B;  3NTU A;  4GIB A;  2A1J B;  4QZ9 A;  3TAQ A;  3QZ8 A;  3H7I A;  2KZ3 A;  3UMG A;  1T8E A;  3QU5 A;  5H2F U;  4Y2P A;  5J2K A;  4NM1 A;  1JIH A;  4OO1 J;  2G5H B;  2ZTE A;  1YZ6 A;  5CWR A;  5KG2 A;  1Q3U A;  2PFQ A;  2XGP A;  1ZQK A;  3H0M B;  3KD3 A;  2AGP A;  4UAR A;  5DDM A;  1XNS A;  1DK2 A;  1TE2 A;  2N1R A;  5J0P A;  1D8Y A; 
#chains in the Genus database with same CATH homology
 1PVP A;  1F44 A;  2H3V A;  3SAF A;  3H0L B;  2A3V A;  2G5I B;  4P0Q B;  3IN5 A;  2MRL A;  3F2B A;  3VCB A;  4QIW C;  2ZXI A;  2JMG A;  2RP5 A;  3N7P D;  2K4I A;  4CRX A;  1HEK A;  1YT3 A;  2RRD A;  3K1Z A;  2W7P A;  4KMO B;  1IIP A;  2VJ5 A;  4AYB F;  3SAG A;  3L3F X;  2VJ4 A;  4BJQ A;  1XO0 A;  3F2D A;  4P0P B;  4NLB A;  1KBU A;  1T94 A;  2K8C B;  2W04 A;  3AQE A;  2E5S A;  3PSP A;  2KIW A;  3SMV A;  4CDG A;  2F76 X;  2DF4 B;  3DEE A;  4BUG A;  2HBJ A;  2HBK A;  2ZIV A;  5CRX A;  3C28 A;  1ZQ1 C;  4IC9 A;  2E1F A;  3M6Z A;  2PMZ C;  1PVR A;  2F77 X;  3VC8 A;  2PMZ F;  2YX8 A;  4FZL A;  3RFA A;  2G09 A;  3D2S A;  1A6S A;  1WUD A;  3F53 A;  3D2N A;  2KVC A;  2ZG6 A;  2ZIX A;  2H3Z A;  2XVT A;  2E1E A;  2KD1 A;  2G0A A;  2W03 A;  3IG8 A;  4FE3 A;  1TAM A;  2H3I A;  2ZIU A;  3AQF A;  3O0F A;  4JMU A;  4BX9 C;  5T14 A;  1P7D A;  2LHT A;  2LBO A;  4KX5 A;  2ZIU B;  2ZIW B;  1HIW A;  2KJ9 A;  4O3M A;  2JHD A;  2CRX A;  3CP8 A;  4NLC A;  4OJO A;  4WJ3 B;  4PL2 A;  5HR7 A;  2CPR A;  3F5E A;  3SQI A;  1ED1 A;  2JH1 A;  2KKV A;  4QIW F;  4QNL A;  3AL0 B;  4NV0 A;  1URJ A;  2GH1 A;  2WAQ C;  3HKZ F;  4A8E A;  2F8L A;  2XI9 A;  4C0Z A;  4OJ5 A;  2ZIW A;  2OH2 A;  4PL1 A;  3C29 A;  2HOI A;  2KKP A;  4FZM A;  2F2A B;  3OPX A;  3LVW A;  3KFU F;  1SZH A;  3GZF A;  3PST A;  2NV3 A;  3E0F A;  4P0P A;  3RF9 A;  2R18 A;  2XID A;  3M6K A;  2YB4 A;  3CRX A;  2ZXH A;  1Q3V A;  3H0R B;  2LYB A;  2KNJ A;  3PSF A;  2K8A A;  2ZIV B;  4P0Q A;  2LYA A;  4AYB C;  1CRX A;  4CGZ A;  2XIC A;  3LYS A;  2Q4T A;  5HR6 A;  2JH7 A;  2KEY A;  1OUQ A;  2H3Q A;  5KL1 B;  2WB1 F;  3ONN A;  3N7R C;  4GFJ A;  3NUQ A;  2KJ8 A;  2HOF A;  2GOL A;  3HKZ C;  4ACO A;  3F5A A;  3MGV A;  2K89 A;  1D8B A;  1Z1B A;  2BDU A;  2VIX A;  3N7S C;  2HBL A;  2G07 A;  2D6F C;  4FZN A;  1GO3 F;  2ZIX B;  2KJ5 A;  2CN1 A;  3D2Q A;  1A0P A;  2Y0S C;  4OJP A;  3SAH A;  3GU3 A;  4OJ6 A;  3M7D A;  1DRG A;  3T79 A;  2DGZ A;  4OO1 J;  5KL8 B;  2G5H B;  3LVV A;  1ECW A;  3F2C A;  4OJL A;  2K4H A;  2K8B B;  3CYM A;  4NWI A;  2HOQ A;  2WAQ F;  1Q3U A;  2HMX A;  4U6P A;  1L6N A;  2G06 A;  2H3F A;  2KHV A;  2LKY A;  4KX3 A;  4U7C A;  2DQN B;  2RHF A;  2Z7J A;  2OM6 A;  1PVQ A;  2G08 A;  1Z19 A;  2JGA A;  2VKQ A;  3H0M B;  3NRW A;  2KOB A;  5C0Y A;  3PZP A;  3KZX A;  2KHQ A;  2KV2 A;  2HBM A;  3PSI A;  1MA7 A;  1NZB A;  2WB1 C;  1UPH A;  2YB1 A;  2OYY A;  4QJF B;  1XNS A;  2K4E A;  2OXO A;  2MA1 A;  3ICX A;  4ICA A;  2M0N A;  3ALR A;  2Y0S F;  2W7O A;  2N1R A;  5A0L A;  3IG5 A;  3IP4 B;  2KIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...