1HIWA

Trimeric hiv-1 matrix protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
VLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 MATRIX PROTEIN
publication title Crystal structures of the trimeric human immunodeficiency virus type 1 matrix protein: implications for membrane association and assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Matrix protein
total genus 40
structure length 115
sequence length 115
chains with identical sequence B, C, Q, R, S
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hiwA00
1HEKA 2H3VA 4ICAA 2H3IA 4IC9A 1ECWA 2JMGA 2H3ZA 1L6NA 2NV3A 2H3FA 2LYBA 2H3QA 2LYAA 1UPHA 1TAMA 1HIWA 2HMXA 2GOLA 1A6SA 1ED1A 2N1RA 2K4IA 2K4EA 4JMUA 2K4HA
chains in the Genus database with same CATH superfamily
1HEKA 1D9FA 1LKYA 1DRGA 5ALWA 4ICAA 5IIOA 2XGQA 1SL0A 4QWAA 4DFJA 4F5OA 3RB3A 3NS1A 2IOFK 4YN4A 4Q43A 2LM1A 1C20A 3MC1A 1RXVA 4DLGA 4O3RA 2D8CA 2D6FC 4Y2XA 3R9KA 1QTMA 4P4MA 3I1YA 4HYKA 1ZQBA 3PO5A 3EYZA 1XNSA 4EEKA 3OHBA 4XQ8A 4PGQA 4QWEA 5AI4A 3C5FA 7ICRA 4TUQA 4NLKA 3AEVA 2RQ5A 3SZ2A 1ZRNA 5ALHA 3EPIA 3PX0A 4F92B 3MDCA 1ZQAA 5ALRA 2J6UA 4M2YA 9ICFA 4PZOA 2LKYA 2ZIVB 3LVVA 2ASJA 3LWMA 7ICTA 4RPYA 8ICEA 4KLDA 1KTQA 9ICQA 4CF4A 4FS1A 1FIQA 2W8KA 3LYSA 1UT5A 3SMVA 4DS5A 3H4BA 2FMQA 4Q8EA 5KT4A 4XRHA 4ED7A 1WWUA 5ALSA 4YXMA 8ICSA 4Y2QA 5G5HA 5BOMA 2W9MA 2KICA 3BQ2A 1BNPA 5E79U 2KEYA 1JROA 2KSOA 4KLIA 9ICLA 1YZ6A 2A1JA 2KHVA 4RPXA 5CEHA 1S76D 2CPRA 3UM9A 7ICJA 3TKAA 1WCNA 1ZQMA 1JMSA 5AK6A 1L8OA 1KW4A 5J0SA 5DG7A 8ICOA 2LI6A 4IS7A 5C0YA 4Q45A 3I76A 4QJFB 3VCBA 3KTQA 4KMUA 3M9NB 4KLGA 1QQ5A 1JXLA 3J81j 4GFJA 1T94A 3NVZA 2NO5A 1IM4A 3TADC 1U47A 4DO9A 3SAFA 1JIHA 4NY8A 5DB9A 5GTHU 3B0YA 1S10A 3PY8A 4R65A 2PFNA 3H40A 4JV2A 5A0LA 2BQRA 1L8LA 5AKYA 3DDHA 4YXJA 4UASA 3F2CA 3WKDA 3ZDDA 2KMDA 2FE9A 8ICRA 4IRKA 9ICNA 4EYIB 4O3OA 1DGSA 1J97A 1JXEA 5KFKA 1ZQOA 3AMZA 2BR0A 5DLGA 2KOBA 1RQLA 5DBCA 2ZIUB 4UQGA 2Q0ZX 4NLBA 2NRTA 4JV0A 5D49A 3ZDEA 2AGOA 2ZJ8A 3L5KA 2V9WA 2XY6A 2HHTA 1Z00B 1L5UA 2IBKA 2QB1A 4ECUA 4DL7A 5L1IA 2C2RA 5CJ7A 1AROP 1TV9A 5JU5A 1N5XA 2KKPA 1ZD2P 8ICQA 4M04A 4F4KA 4A8EA 5AKLA 1HJPA 3QXGA 2PXIA 2I9GA 3H8MA 4RT2A 1ZQVA 4QZBA 2VA8A 2G5IB 4MHVA 5G5GA 2NO4A 2MRLA 3MABA 4ECQA 1D8YA 4UAUA 1VLBA 3M6ZA 4KLMA 4UB1A 2H5XA 4DSIA 9ICBA 2FLNA 1L6NA 7ICIA 1ZQCA 5KNIA 3QEAZ 2ZJAA 1UCVA 1MSWD 3SENA 3AUOA 3HPOA 1L3UA 1KFDA 4M6WA 5EWFA 2XICA 4UAYA 5F3XB 2WAQF 4RQ0A 5AK5A 4FE3A 1TAQA 2AGQA 4Z6CA 9ICAA 2BCVA 5ALIA 3AL0B 7ICSA 1ZJNA 4J03A 3A0HU 5J8YC 4RU9A 1QLNA 1TK0A 4I2IA 4F5NA 5KFBA 4AYBC 3TAQA 4B9VA 3L4PA 1K1SA 4PHAA 4RNOA 4EEYA 1KKXA 1SL1A 4NXZA 3HT3A 1SV0A 4B6JA 4BGDA 2LYHA 2JEJA 4QZAA 2ZIWB 2JEFA 3IG8A 5J2AA 3N28A 3UQ2A 3TFSA 2ISOA 4FO6A 4B9SA 1K5OA 4CF3A 4RQMA 4LZDA 2EZZA 4OJLA 2OM6A 2W9CA 1NJYA 5H2FU 4DCCA 5F9LA 5AHXA 2DPJA 2DFLA 2W8LA 3N97B 2XY5A 3KD3A 2Y1JA 3IRUA 1ZYQA 2JZBA 3M9OB 4RQ4A 3QUTA 3RJKA 2KFNA 1NZBA 2BDPA 4RT3A 2WF8A 1ZQZA 2IHMA 4B9NA 1SGGA 4MF8A 1U45A 3KHRA 5J2HA 4DL3A 9ICGA 2F2AB 1BPEA 3M9MB 3LVWA 2ZUCA 2HBLA 2R18A 4QWBA 2ZG6A 4RUAA 4EX7A 5KFWA 1X42A 4P4OA 2PKEA 3B0XA 5DDMA 2EAPA 5EE0A 3QNMA 2FDRA 4TQSA 4P0PB 7ICQA 1UQVA 2BPFA 3PMNA 4UAZA 7ICNA 2HDOA 4AP9A 1WUDA 4QZIA 5KT7A 2ZTCA 2QKQA 4Y2SA 1U48A 2BGWA 3C28A 4DL6A 1Y88A 1DGJA 4J9MA 5J2JA 3K4GA 3H8WA 4YMMA 5HNKA 2I1QA 4RQ2A 3OTQA 1EXNA 4RQ8A 3WK6A 2F8KA 2BCSA 3QU7A 5J0WA 1ZQKA 2F3NA 9ICUA 4F72A 9ICWA 5J0XA 1TK8A 4FBUA 2EH9A 1NK7A 4DOAA 4O0IA 4I2EA 9ICXA 5KFQA 4QIWC 4IQVA 1UA1A 4FFDA 1RG6A 5AKJA 4DQQA 3KZIU 4TUPA 2BCRA 5CWRA 2KE7A 1ZQSA 1QSLA 5CB1A 3N7SC 2QB0A 2PFOA 2LYAA 1N61A 3H0RB 5HP4A 1V85A 2VANA 3MGHA 1MN8A 1ZQQA 1T7PA 8ICGA 3LWLA 1B4FA 3IP4B 2V4QA 3V6HA 1ZQHA 4Q8FA 5CRXA 3D2SA 4G3IA 4KTQA 5J2KA 5B66U 4O3NA 2AQ0A 2Y9UA 1NOMA 2D3DA 1KRPA 3FYHA 4USAA 4YFKA 2WF7A 2VKQA 2ZIXA 2PMZF 1KEJA 2KIVA 1X66A 1S9FA 1N2XA 3N4MB 3PSTA 3V6KA 1CUKA 5AK4A 3RH6A 2W9BA 4I2AA 2UVWA 4M47A 3RTVA 2ALZA 4DL2A 3JPRA 2KK0A 4ED8A 5KL8B 1FEZA 4F4XA 3KZXA 3QUCA 2PFQA 2H3IA 2PFPA 3WK8A 2K8BB 3KKAC 9ICHA 2XVTA 2IMWP 4RPZA 4Z6DA 3D2NA 3FDSA 1UHUA 2VA2A 9ICRA 2KV2A 1KN5A 3SR6A 1N5WA 3C1YA 7ICOA 4EBCA 3SQIA 1NK9A 3KFUF 1PVRA 2YB4A 2F76X 1D8BA 5KFDA 1NKCA 2JXJA 3QUQA 1QQ7A 3H0MB 2XGPA 1N48A 2HHVA 3T5JA 4UAVA 3RAXA 4F3OA 2HHSA 3GIJA 1BVSA 3I28A 4OO1J 3QZ8A 4IQTA 4US9A 4QNLA 1LKYB 4DSFA 3BS7A 3BQ1A 2NRVA 1V38A 4TQRA 4UB3A 3RB0A 4U7CA 3DEEA 4RQNA 2C2DA 2HHQA 3TFRA 1XSLA 2E3TA 7ICLA 2EANA 3N7RC 4UB8U 4F93B 1BNOA 2W55A 3H7IA 1ZRMA 3Q8KA 3MBYA 3G6YA 3ETLA 1V9PA 1MA7A 2WHEA 3QU5A 4GXIA 2ZXIA 4I2JA 2ZTDA 4R64A 2E8NA 3PSPA 4UB6U 2BKEA 1NNLA 3H8SA 1ZQTA 1QSYA 4B9UA 4C0ZA 3UQ0A 4OJ5A 3NTUA 2ZJ5A 3HP6A 2HI0A 4KMOB 9ICMA 2A1AA 4KLQA 2AHOB 1NKEA 2K89A 3UPQA 4PZNA 5DG9A 2JEGA 3T79A 4RQ1A 1X6JA 3HWTA 8ICLA 3SD7A 2ATLA 5BOLA 1NK4A 3SI8A 5AI0A 4I2GA 2KZMA 5L1KA 2QARA 1TKDA 1DXSA 3O0FA 3PW7A 2MSNA 1S97A 5IIIA 2KIWA 2KJ5A 4C8OA 2WF9A 3BDPA 3TACB 4BWJA 4IRCA 2A1JB 1ZQWA 3TADA 5KFCA 5ALOA 1X9MA 1T8EA 4DFDA 1ZQ1C 3AU2A 4FBTA 5ALLA 5KG0A 1D8LA 2AQ4A 2R8JA 2M9NA 2MA1A 1ZQLA 3GDXA 4EENA 3HJEA 4YR0A 5HR7A 1N63A 3WU2U 5J0YA 1N56A 1P7DA 4DQRA 4F4WA 2KKVA 4MFFA 4CGZA 1ZQEA 1XSNA 5KT5A 1SXDA 2W3RA 2ZIVA 2FLLA 3QU9A 2RRDA 4PL2A 4KLOA 1SWVA 5DGAA 5D4BA 1B22A 3Q8PB 2K4PA 4O3QA 2C22A 5HHHA 1CEZA 1RZTA 3UXOA 3RB4A 3ZI4A 5DB6A 1J2NA 5KFJA 5AKGA 1XO0A 1M6YA 1DK3A 1ZQDA 1IG6A 1KDHA 4X5VA 4ED6A 2MUTB 3H4DA 1IXRA 2ZTEA 3CRXA 1A0PA 1UPHA 1GO3F 5ALGA 4UB2A 3JPQA 4LJXA 5J2FA 3RJEA 4BXOB 3RR8A 4LZGA 2YQEA 1ZD4A 5JRTA 3BJYA 3JPPA 2XCAA 2E8OA 5KAIU 4ED3A 2BHNA 1UA0A 2FMPA 3HW8A 5DBAA 4BDPA 4NM1A 2OYYA 3QX7A 5ALNA 2PI4A 3OJUA 2KZ3A 5ALUA 3PW5A 3QU2A 4F2SA 2YX8A 4KN7A 2HHWA 2HOIA 4KLHA 4TURA 4RNNA 4DSKA 4JV1A 2EZYA 4KLSA 4DOBA 2W7OA 2VIXA 5J8YA 5AICA 2MU2A 4C4TA 3TARA 2HOQA 1F0MA 4F4ZA 2A3VA 4IRDA 4KLUA 5J2BA 1XO1A 1S8OA 4B9MA 4XUSA 2HBKA 4F71A 5J0QA 4K4IA 5KG5A 3WK4A 1Z19A 3WK9A 2ZIUA 5HMMA 4J9NA 1D9DA 4M9NA 4C8KA 4QZEA 2JH1A 3IV6A 3GV8B 5KG3A 2XI9A 1SKRA 3PSFA 1Z00A 9ICEA 4GC7A 3NVWA 3MGIA 2VJ4A 3FM9A 4CNQA 2W43A 3GU3A 4PGXA 4KX5A 5DDYA 4NL9C 3JPNA 4PL1A 1XSPA 4QWCA 2JGAA 2W03A 5ALPA 3KHHA 4QWDA 1S0NA 8ICPA 3ISCA 5KT3A 4AYBF 1KSPA 4P0QB 4BUGA 2W9AA 1KLNA 2WAQC 5DLFA 3BS5B 3KOOA 1QQ6A 3JPSA 2R8KA 3NASA 1RM6C 3FC4A 1WCLA 5KFHA 2WF6A 4Q44A 2GO7A 2Q4TA 5ALQA 3E2EA 2NYVA 2P35A 3GIMA 3ALRA 4F5QA 4GC6A 3NGDA 3GIIA 4GXJA 2Z7JA 1ZXIA 3PVXA 8ICUA 3THVA 5KFVA 7ICGA 5EE9A 2P66A 2XC9A 4CF5A 4DQPA 4I27A 4RNMA 3V6JA 3M7DA 2NRWA 3NRWA 3RJJA 5DQHA 5TISU 3UMBA 1B0XA 8ICWA 2R8HA 5J0RA 3U26A 1Z4OA 1Q3VA 4OJ6A 4Y2YA 2WB1F 5TZVA 4NLNA 4JWNA 2NRXA 2YMQA 3PW2A 4I28A 4YD1A 1RPLA 4CE6A 1JRPA 1RYUA 2FPLA 1FO4A 3BQ7A 4ELVA 3QZ7A 5EWEA 4DFPA 1TK5A 1NI3A 1ZQXA 3IHQB 3T5LA 2ZIWA 2HVIA 5KFIA 5KFEA 5J0TA 1PUZA 2H3FA 4PHPA 3QYPA 4C8NA 4CDGA 4DL4A 3OJSA 2XY7A 2VA3A 1T4GA 1N62A 4RZRA 3JPTA 2LHTA 3AU6A 3HILA 1Z4NA 4DQIA 2DKXA 3E0FA 3C5GA 2G08A 3MGVA 3GQCA 2JRZA 4IL6U 3MR6A 4KLTA 3ISDA 3RJFA 5AKEA 1RYSA 2W04A 4YD2A 3MR5A 3HKZF 2HBMA 2AJQA 2W11A 1ZQPA 1X6IA 3TI0A 4EBEA 3SEIA 1KFSA 2DWQA 1L7MA 2K8AA 2W54A 3M8SA 1WG8A 3F2DA 7ICFA 2FMSA 4UAWA 1K1QA 3M1YA 1OUQA 3ZD8A 2P6RA 3EZ5A 5KG6A 4QZCA 4KITB 2WTFA 4OD0A 5DQIA 3AM9A 9ICTA 3RB6A 4P0PA 4DL5A 2LMRA 4QIWF 5KFPA 4ECRA 4KLLA 4QW9A 3GV5B 3ONNA 5AKIA 5AM0A 3PSIA 1HUOA 4F91B 3MR2A 4F50A 3PMLA 9ICJA 3Q8MA 5DB7A 4C80A 5KFOA 1QH9A 5ALXA 4PH5A 1OW5A 1O03A 4IQWA 4KLFA 3RJIA 2C28A 4R8UB 4C8LA 4NJ8A 3EUB2 2Y1IA 2KNJA 3NVYA 2I5HA 1IV8A 2ZIXB 4NM2A 1CRXA 4DOCA 4UB5A 5J2IA 3CP8A 1PVPA 2OHFA 4J9KA 3KKAA 1KQQA 9ICOA 2DPIA 9ICCA 3ORYA 3OSNA 2PI5A 1BGXT 3F5AA 2UVVA 4BWMA 5J2EA 4BX9C 4PPXA 9ICKA 5KFTA 5IIJA 4O5KA 3PR4A 2DUYA 4Z6EA 5JUMA 4DLEA 2KVSA 3Q8LA 1FFVA 1ZQRA 2F1JA 5ALDA 2BQUA 3RBDA 1HIWA 3C29A 1RXWA 1HUZA 4C8MA 3SAGA 9ICVA 3NRZA 4UARA 4ELUA 3QE9Y 4DSJA 2PMZC 2MAXA 4PGYA 4F8RA 1U9LA 4UBCA 2BCUA 3WKBA 5K4LA 1UT8A 3ZD9A 5F9NA 5AI6A 3M8RA 2KVCA 2ZXHA 1JALA 2J6SA 5HMLA 4ECWA 2VJ5A 4M9JA 5KFGA 2H3VA 4RQ6A 4ECSA 5KFFA 2RDJA 2IOFA 5KFNA 1ZJMA 4F2RA 8ICNA 3PNCA 1O08A 1ZD3A 3K75D 3RR7A 4DF8A 5EE3A 1ED1A 2R8IA 4PHEA 3ETRA 3PO4A 4DEZA 1PK1B 5CR0A 1T3QA 2EQYA 2HCFA 1ZQYA 3QUBA 2KN7A 4RQ5A 4IC9A 3GZFA 5KFRA 3F5EA 2KHQA 3WKCA 3GILA 1NJZA 1SB3C 3TAPA 3UMCA 4F5RA 3PX4A 1F44A 5HHIA 2XIDA 2YTUA 4KLJA 3RJGA 2FI1A 4F5PA 2Y0SC 2FPKA 2K60A 4YR2A 2UVUA 4J9RA 2W3SA 5AM2A 3H8JA 3C21A 5AIAA 3TQ1A 1CI4A 1Q8KA 2AH5A 1NKBA 1NZPA 4P4PA 1V97A 4YQWA 2QARB 4R63A 1B43A 5AM5A 2JV3A 1L7OA 3C2LA 4EBDA 2A19A 2YY6A 3CYMA 4OJPA 4US8A 2JMGA 1KBUA 3ZDBA 1F5SA 3D6JA 5KFLA 3FAHA 1S0MA 3C2MA 2BCQA 2GH1A 5AI5A 5DG8A 1VJ5A 2EZXA 1JX4A 2G07A 2KSOB 4QZ8A 4O5EA 5C5JA 3OPXA 4PHDA 1BPZA 3JPOA 3WKAA 1J2MA 1MC8A 1WYGA 4MEXA 1COOA 1ZQNA 2HHUA 2YB1A 2JR5A 4JK1A 5FP0A 1S5LU 4ELTA 2YN4A 4JMUA 2BDUA 2KTQA 1BPYA 3PW4A 4UATA 1TE2A 4UW9A 4DS4A 1BPDA 1A76A 1XS9D 4MF2A 4F4YA 4U6PA 3V7KA 1XU4A 2BPCA 2BQ3A 4DF4A 4DFMA 3LDAA 7ICUA 4KLEA 2KG5A 5KG7A 4NV0A 3K1RB 9ICPA 3EW9A 4CRXA 4LVSA 4YMNA 5D46A 2FPMA 1LV5A 1LVHA 2R8GA 1L3VA 5ALTA 3PZPA 5ALKA 1KFTA 3RRGA 5ALYA 4UBBA 2HHXA 3KHLA 5KT2A 8ICFA 4GIBA 3Q8RB 4ECYA 5ALFA 2DQNB 3K1ZA 3IM1A 4TUSA 3AQEA 5KG2A 1NJXA 4QZHA 4J9PA 2QLTA 1X9SA 8ICCA 3G6VA 1ZD5A 7ICKA 3WK7A 5AKXA 5KFSA 2ZUDA 7ICPA 2UVRA 3ED5A 1PK3A 3V72A 4B9LA 1TAMA 3SV3A 4ECXA 3RF9A 1ZQGA 1ZQIA 5CA7A 2B0CA 1S0VA 1Z1VA 2IOHA 2J6TA 3BQTA 4QZDA 4R66A 5L1LA 2L5YA 4I2DA 4FS2A 2AU0A 3KHGA 2ZUBA 2CRXA 3EPGA 2YMPA 3RRHA 5AM4A 1Q46A 1WWVA 4J9OA 2EAMA 3NVVA 1T3NA 2GOLA 2RDIA 4Y2UA 9ICIA 8ICZA 4QZFA 2OWOA 2WF5A 5AM3A 8ICYA 5KFUA 3T5HA 4NL9A 4ECZA 3N7PD 9ICSA 4YMOA 4UB4A 2MUTA 2F8LA 1RDFA 2CN1A 5IIKA 4K4HA 4EX6A 3GIKA 2F1HA 3F53A 2DKZA 2IA6A 4YG2A 4BXOA 4M6WB 1NK5A 3V7JA 3EWAA 5KTQA 3HRDD 4K4GA 4NLCA 1RQNA 5ALJA 3MFHA 8ICKA 1ECWA 1X40A 3NUQA 2E1EA 1URJA 2G5HB 1QSSA 5KT6A 2ODGA 1JI7A 5CHGA 5KFYA 3PV8A 4B9TA 3MFIA 2CXYA 8ICIA 5BPCA 4RUCA 2KJ8A 2JHDA 4G9BA 5AKKA 1FFUA 2AXTU 2V4RA 1X9XA 4YVZA 3AQFA 3DV9A 4J9SA 2OH2A 5KG4A 5AI8A 3WK5A 2ESEA 4XA5A 8ICMA 2HBJA 3B9JA 1SL2A 4MFCA 2K4IA 4NLZA 4FZNA 5GTIU 1NJWA 5KFAA 2DL0A 2W9CB 2Y9TA 1X9WA 3OHAA 2KJ9A 4ZH4A 2E5SA 5KAFU 2LYBA 3OGUA 2H3QA 4JUZA 3GV7B 5AKZA 2I6XA 3L3FX 4OCZA 5J2CA 2HMXA 1N60A 2JZBB 2P6UA 2AGPA 2GLEA 3BZCA 4M9HA 1S77D 7ICMA 1L7NA 4Z6FA 4MFAA 2GWSA 3ZDAA 2EAOA 4I2BA 4BJQA 2YMLA 4QZ9A 5J29A 5L9XA 3M6KA 8ICAA 5AI9A 4DFKA 2KFZA 4WJ3B 4C7ZA 1DK2A 4FZLA 4P0QA 3C23A 5DGBA 3BS5A 1TAUA 2BPGA 5J0PA 1H38A 2DGZA 1NK6A 1A77A 2YMMA 3CW2C 1COKA 2HVHA 5KL1B 3TANA 1OXJA 4DSLA 1SKWA 1Q3UA 1X2IA 1DOQA 2NRZA 4NLGA 2LPEA 5IILA 4YP3A 3F2BA 1MQ2A 2FLPA 1IIPA 2WB1C 1L3TA 4O3MA 3RH5A 4RQ7A 2ASDA 1L7PA 4IQUA 3IDWA 1SV0C 5KFMA 8ICBA 3RAQA 4JWMA 1SV4A 1SZHA 3V7LA 3T5KA 1TFRA 1YZ7A 2RP5A 8ICVA 4M9LA 3QEBZ 2E1FA 4DQSA 5IIMA 2JEIA 2KP7A 3RH4A 2O6KA 2G0AA 8ICJA 4EELA 4JB3A 1Z3EB 4YCXA 4M9GA 1BPXA 1LB2B 5AKHA 5CP2A 1SKSA 4J9LA 4EZ9A 2H3ZA 1XWLA 3HKZC 2QB0B 4I2FA 4GXKA 4O3PA 7ICHA 4I2HA 2HW3A 2M0NA 4YR3A 1S0OA 1ZQJA 2E8MA 3A0BU 4Y2TA 4RQ3A 3CNHA 3G6XA 5J0OA 3SV4A 3RBEA 4DWIA 1TVAA 2XCPA 4O9MA 5IINA 4ED2A 2KD1A 4C4RA 2BZFA 8ICHA 1SWWA 2K4EA 3Q8SB 4HAIA 5DBBA 2E8PA 4ED1A 5KFZA 1JUDA 2F44A 4I29A 5ALVA 2B21A 4EYHB 2ASLA 3ICXA 4QZGA 1BPBA 1MQ3A 2W9BB 2FJ6A 3PR5B 4IR9A 2HSZA 4KX3A 1L3SA 4ACOA 1PZNA 3ISBA 2ISPA 2K4HA 3BZKA 5B5EU 5L1JA 3BQ0A 4Y2VA 5AK3A 1KL9A 1SXEA 3MR3A 2WFAA 4Y2JA 1PVQA 4J9QA 1RYRA 4R8UA 4NWIA 4CCHA 4M0AA 4DSEA 4IR1A 2DF4B 3S6JA 2W7PA 2LM4A 1ZOLA 5JTIA 1U4BA 1ZQFA 4O5CA 4KN4A 3T3FA 3D2QA 2G09A 3MDAA 4ECVA 3OSPA 1C7YA 2DBYA 5DB8A 2OCEA 3GFKB 2NV3A 5J0UA 3C2KA 5L1MA 5ALMA 1NK0A 4EZ6A 1YT3A 5KFXA 2N1RA 4E0DA 4P2HA 1SIJA 3Q8QB 3SAHA 2C2EA 3E58A 5AM1A 4ED0A 4ZOHC 7ICVA 3QU4A 5AIBA 4GLXA 3C1ZA 5DKWA 1ZQUA 1QCKA 2F77X 2B6GA 1U49A 3PX6A 2RHFA 1A6SA 3UXPA 1NK8A 5ALEA 4C4SA 3IN5A 4ECTA 4QW8A 5EWGA 1SZPA 5J2DA 2OXOA 4Y2PA 1VDVA 3HX0A 5KG1A 3RJHA 5HR6A 5DQGA 4Y2RA 4I2CA 2ES6A 3LK9A 1JN3A 5EE1A 3H0LB 2OEHA 1Z1BA 5EOZA 3UXNA 7ICEA 3VC8A 3IG5A 3PW0A 8ICXA 3RFAA 1XC9A 2K8CB 4FZMA 2XO7A 4MEYA 3SYZA 3UMGA 8ICTA 2LBOA 2IHNA 2Y0SF 2EDUA 4C7YA 1AQ6A 3KBBA 3ZDCA 5T14A 4PJ0U 2HOFA 5J2GA 3AN1A 2KZZA 5ALZA 2G06A 1ZETA 2JH7A 3WKEA 2F1IA 4O3SA 1PK1A 4OJOA 2RLTA
chains in the Genus database with same CATH topology
2G09A 1HEKA 4GFJA 3M7DA 3NRWA 4QNLA 3IP4B 2W7OA 1T94A 1DRGA 2CRXA 2G07A 5HR7A 4ICAA 3M6ZA 2VIXA 5CRXA 2F2AB 3LVWA 3OPXA 2HBLA 2HOQA 3D2SA 2H3ZA 2R18A 2NV3A 1P7DA 1L6NA 2ZG6A 4U7CA 2A3VA 2KKVA 1Q3VA 2KJ9A 2E5SA 3HKZC 2LYBA 4OJ6A 2H3QA 4CGZA 3DEEA 2WB1F 3L3FX 2HBKA 1YT3A 2YB1A 2HMXA 2GOLA 4P0PB 3SAFA 1ED1A 2N1RA 1Z19A 2XICA 2ZIUA 2D6FC 2ZIVA 3SAHA 2KNJA 2WAQF 4JMUA 3N7RC 2BDUA 1WUDA 4FE3A 2VKQA 3N7PD 2ZIXA 2PMZF 2M0NA 2ZIXB 1CRXA 2RRDA 4PL2A 2JH1A 1XNSA 4BJQA 5A0LA 2F8LA 3CP8A 4IC9A 1PVPA 3GZFA 2ZIWA 2CN1A 4U6PA 3AL0B 2XI9A 3F5EA 2KHQA 3M6KA 3PSTA 3PSFA 3C28A 3F2CA 2H3FA 3F53A 4WJ3B 1MA7A 4FZLA 4AYBC 2F77X 4CDGA 4P0QA 1F44A 2XIDA 2KD1A 2ZXIA 2VJ4A 3F5AA 3PSPA 2RHFA 1A6SA 4NV0A 2DGZA 3IN5A 4CRXA 3GU3A 2KOBA 4KX5A 1XO0A 2K4EA 2ZIUB 2LKYA 2ZIVB 4BX9C 3LVVA 5KL8B 2OXOA 2LHTA 5KL1B 2Y0SC 3KZXA 4NLBA 4C0ZA 4OJ5A 4PL1A 3E0FA 4NLCA 1Q3UA 5HR6A 2G08A 2H3IA 3MGVA 4KMOB 3PZPA 3F2BA 2JGAA 1ECWA 3ICXA 2W03A 2K89A 3H0LB 3LYSA 3NUQA 2K8BB 2E1EA 2ZIWB 3SMVA 1URJA 3IG8A 3T79A 1Z1BA 2G5HB 2XVTA 2W04A 1IIPA 2WB1C 3CRXA 1A0PA 3HKZF 2HBMA 3IG5A 3VC8A 1UPHA 3RFAA 4AYBF 1GO3F 2DQNB 4O3MA 3K1ZA 2K8CB 1HIWA 4QIWC 3C29A 3SAGA 3AQEA 4FZMA 4P0QB 3O0FA 4BUGA 3D2NA 2KICA 2KJ8A 2K8AA 2WAQC 2JHDA 4KX3A 4ACOA 2KIWA 3F2DA 2KV2A 4OJLA 2KJ5A 2PMZC 2K4HA 2LBOA 2KEYA 2OM6A 2Y0SF 2KHVA 2KKPA 3CYMA 1OUQA 3AQFA 4OJPA 3SQIA 2Q4TA 2CPRA 3KFUF 1PVRA 1SZHA 2YB4A 2F76X 5T14A 2OYYA 2JMGA 2OH2A 1D8BA 4A8EA 3ALRA 1PVQA 2RP5A 3N7SC 2HOFA 1KBUA 1ZQ1C 2LYAA 4NWIA 2Z7JA 1TAMA 3H0RB 3H0MB 4P0PA 2E1FA 3RF9A 2HBJA 2G06A 5C0YA 2JH7A 2DF4B 2KVCA 4QIWF 2W7PA 4QJFB 2ZXHA 2K4IA 2MA1A 3VCBA 2G5IB 2GH1A 2YX8A 1NZBA 4FZNA 2G0AA 2HOIA 3ONNA 2VJ5A 3PSIA 4OJOA 3D2QA 4OO1J 2H3VA 2MRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  2H3V A;  4ICA A;  2H3I A;  4IC9 A;  1ECW A;  2JMG A;  2H3Z A;  1L6N A;  2NV3 A;  2H3F A;  2LYB A;  2H3Q A;  2LYA A;  1UPH A;  1TAM A;  1HIW A;  2HMX A;  2GOL A;  1A6S A;  1ED1 A;  2N1R A;  2K4I A;  2K4E A;  4JMU A;  2K4H A; 
#chains in the Genus database with same CATH topology
 1HEK A;  1D9F A;  1LKY A;  1DRG A;  5ALW A;  4ICA A;  5IIO A;  2XGQ A;  1SL0 A;  4QWA A;  4DFJ A;  4F5O A;  3RB3 A;  3NS1 A;  2IOF K;  4YN4 A;  4Q43 A;  2LM1 A;  1C20 A;  3MC1 A;  1RXV A;  4DLG A;  4O3R A;  2D8C A;  2D6F C;  4Y2X A;  3R9K A;  1QTM A;  4P4M A;  3I1Y A;  4HYK A;  1ZQB A;  3PO5 A;  3EYZ A;  1XNS A;  4EEK A;  3OHB A;  4XQ8 A;  4PGQ A;  4QWE A;  5AI4 A;  3C5F A;  7ICR A;  4TUQ A;  4NLK A;  3AEV A;  2RQ5 A;  3SZ2 A;  1ZRN A;  5ALH A;  3EPI A;  3PX0 A;  4F92 B;  3MDC A;  1ZQA A;  5ALR A;  2J6U A;  4M2Y A;  9ICF A;  4PZO A;  2LKY A;  2ZIV B;  3LVV A;  2ASJ A;  3LWM A;  7ICT A;  4RPY A;  8ICE A;  4KLD A;  1KTQ A;  9ICQ A;  4CF4 A;  4FS1 A;  1FIQ A;  2W8K A;  3LYS A;  1UT5 A;  3SMV A;  4DS5 A;  3H4B A;  2FMQ A;  4Q8E A;  5KT4 A;  4XRH A;  4ED7 A;  1WWU A;  5ALS A;  4YXM A;  8ICS A;  4Y2Q A;  5G5H A;  5BOM A;  2W9M A;  2KIC A;  3BQ2 A;  1BNP A;  5E79 U;  2KEY A;  1JRO A;  2KSO A;  4KLI A;  9ICL A;  1YZ6 A;  2A1J A;  2KHV A;  4RPX A;  5CEH A;  1S76 D;  2CPR A;  3UM9 A;  7ICJ A;  3TKA A;  1WCN A;  1ZQM A;  1JMS A;  5AK6 A;  1L8O A;  1KW4 A;  5J0S A;  5DG7 A;  8ICO A;  2LI6 A;  4IS7 A;  5C0Y A;  4Q45 A;  3I76 A;  4QJF B;  3VCB A;  3KTQ A;  4KMU A;  3M9N B;  4KLG A;  1QQ5 A;  1JXL A;  3J81 j;  4GFJ A;  1T94 A;  3NVZ A;  2NO5 A;  1IM4 A;  3TAD C;  1U47 A;  4DO9 A;  3SAF A;  1JIH A;  4NY8 A;  5DB9 A;  5GTH U;  3B0Y A;  1S10 A;  3PY8 A;  4R65 A;  2PFN A;  3H40 A;  4JV2 A;  5A0L A;  2BQR A;  1L8L A;  5AKY A;  3DDH A;  4YXJ A;  4UAS A;  3F2C A;  3WKD A;  3ZDD A;  2KMD A;  2FE9 A;  8ICR A;  4IRK A;  9ICN A;  4EYI B;  4O3O A;  1DGS A;  1J97 A;  1JXE A;  5KFK A;  1ZQO A;  3AMZ A;  2BR0 A;  5DLG A;  2KOB A;  1RQL A;  5DBC A;  2ZIU B;  4UQG A;  2Q0Z X;  4NLB A;  2NRT A;  4JV0 A;  5D49 A;  3ZDE A;  2AGO A;  2ZJ8 A;  3L5K A;  2V9W A;  2XY6 A;  2HHT A;  1Z00 B;  1L5U A;  2IBK A;  2QB1 A;  4ECU A;  4DL7 A;  5L1I A;  2C2R A;  5CJ7 A;  1ARO P;  1TV9 A;  5JU5 A;  1N5X A;  2KKP A;  1ZD2 P;  8ICQ A;  4M04 A;  4F4K A;  4A8E A;  5AKL A;  1HJP A;  3QXG A;  2PXI A;  2I9G A;  3H8M A;  4RT2 A;  1ZQV A;  4QZB A;  2VA8 A;  2G5I B;  4MHV A;  5G5G A;  2NO4 A;  2MRL A;  3MAB A;  4ECQ A;  1D8Y A;  4UAU A;  1VLB A;  3M6Z A;  4KLM A;  4UB1 A;  2H5X A;  4DSI A;  9ICB A;  2FLN A;  1L6N A;  7ICI A;  1ZQC A;  5KNI A;  3QEA Z;  2ZJA A;  1UCV A;  1MSW D;  3SEN A;  3AUO A;  3HPO A;  1L3U A;  1KFD A;  4M6W A;  5EWF A;  2XIC A;  4UAY A;  5F3X B;  2WAQ F;  4RQ0 A;  5AK5 A;  4FE3 A;  1TAQ A;  2AGQ A;  4Z6C A;  9ICA A;  2BCV A;  5ALI A;  3AL0 B;  7ICS A;  1ZJN A;  4J03 A;  3A0H U;  5J8Y C;  4RU9 A;  1QLN A;  1TK0 A;  4I2I A;  4F5N A;  5KFB A;  4AYB C;  3TAQ A;  4B9V A;  3L4P A;  1K1S A;  4PHA A;  4RNO A;  4EEY A;  1KKX A;  1SL1 A;  4NXZ A;  3HT3 A;  1SV0 A;  4B6J A;  4BGD A;  2LYH A;  2JEJ A;  4QZA A;  2ZIW B;  2JEF A;  3IG8 A;  5J2A A;  3N28 A;  3UQ2 A;  3TFS A;  2ISO A;  4FO6 A;  4B9S A;  1K5O A;  4CF3 A;  4RQM A;  4LZD A;  2EZZ A;  4OJL A;  2OM6 A;  2W9C A;  1NJY A;  5H2F U;  4DCC A;  5F9L A;  5AHX A;  2DPJ A;  2DFL A;  2W8L A;  3N97 B;  2XY5 A;  3KD3 A;  2Y1J A;  3IRU A;  1ZYQ A;  2JZB A;  3M9O B;  4RQ4 A;  3QUT A;  3RJK A;  2KFN A;  1NZB A;  2BDP A;  4RT3 A;  2WF8 A;  1ZQZ A;  2IHM A;  4B9N A;  1SGG A;  4MF8 A;  1U45 A;  3KHR A;  5J2H A;  4DL3 A;  9ICG A;  2F2A B;  1BPE A;  3M9M B;  3LVW A;  2ZUC A;  2HBL A;  2R18 A;  4QWB A;  2ZG6 A;  4RUA A;  4EX7 A;  5KFW A;  1X42 A;  4P4O A;  2PKE A;  3B0X A;  5DDM A;  2EAP A;  5EE0 A;  3QNM A;  2FDR A;  4TQS A;  4P0P B;  7ICQ A;  1UQV A;  2BPF A;  3PMN A;  4UAZ A;  7ICN A;  2HDO A;  4AP9 A;  1WUD A;  4QZI A;  5KT7 A;  2ZTC A;  2QKQ A;  4Y2S A;  1U48 A;  2BGW A;  3C28 A;  4DL6 A;  1Y88 A;  1DGJ A;  4J9M A;  5J2J A;  3K4G A;  3H8W A;  4YMM A;  5HNK A;  2I1Q A;  4RQ2 A;  3OTQ A;  1EXN A;  4RQ8 A;  3WK6 A;  2F8K A;  2BCS A;  3QU7 A;  5J0W A;  1ZQK A;  2F3N A;  9ICU A;  4F72 A;  9ICW A;  5J0X A;  1TK8 A;  4FBU A;  2EH9 A;  1NK7 A;  4DOA A;  4O0I A;  4I2E A;  9ICX A;  5KFQ A;  4QIW C;  4IQV A;  1UA1 A;  4FFD A;  1RG6 A;  5AKJ A;  4DQQ A;  3KZI U;  4TUP A;  2BCR A;  5CWR A;  2KE7 A;  1ZQS A;  1QSL A;  5CB1 A;  3N7S C;  2QB0 A;  2PFO A;  2LYA A;  1N61 A;  3H0R B;  5HP4 A;  1V85 A;  2VAN A;  3MGH A;  1MN8 A;  1ZQQ A;  1T7P A;  8ICG A;  3LWL A;  1B4F A;  3IP4 B;  2V4Q A;  3V6H A;  1ZQH A;  4Q8F A;  5CRX A;  3D2S A;  4G3I A;  4KTQ A;  5J2K A;  5B66 U;  4O3N A;  2AQ0 A;  2Y9U A;  1NOM A;  2D3D A;  1KRP A;  3FYH A;  4USA A;  4YFK A;  2WF7 A;  2VKQ A;  2ZIX A;  2PMZ F;  1KEJ A;  2KIV A;  1X66 A;  1S9F A;  1N2X A;  3N4M B;  3PST A;  3V6K A;  1CUK A;  5AK4 A;  3RH6 A;  2W9B A;  4I2A A;  2UVW A;  4M47 A;  3RTV A;  2ALZ A;  4DL2 A;  3JPR A;  2KK0 A;  4ED8 A;  5KL8 B;  1FEZ A;  4F4X A;  3KZX A;  3QUC A;  2PFQ A;  2H3I A;  2PFP A;  3WK8 A;  2K8B B;  3KKA C;  9ICH A;  2XVT A;  2IMW P;  4RPZ A;  4Z6D A;  3D2N A;  3FDS A;  1UHU A;  2VA2 A;  9ICR A;  2KV2 A;  1KN5 A;  3SR6 A;  1N5W A;  3C1Y A;  7ICO A;  4EBC A;  3SQI A;  1NK9 A;  3KFU F;  1PVR A;  2YB4 A;  2F76 X;  1D8B A;  5KFD A;  1NKC A;  2JXJ A;  3QUQ A;  1QQ7 A;  3H0M B;  2XGP A;  1N48 A;  2HHV A;  3T5J A;  4UAV A;  3RAX A;  4F3O A;  2HHS A;  3GIJ A;  1BVS A;  3I28 A;  4OO1 J;  3QZ8 A;  4IQT A;  4US9 A;  4QNL A;  1LKY B;  4DSF A;  3BS7 A;  3BQ1 A;  2NRV A;  1V38 A;  4TQR A;  4UB3 A;  3RB0 A;  4U7C A;  3DEE A;  4RQN A;  2C2D A;  2HHQ A;  3TFR A;  1XSL A;  2E3T A;  7ICL A;  2EAN A;  3N7R C;  4UB8 U;  4F93 B;  1BNO A;  2W55 A;  3H7I A;  1ZRM A;  3Q8K A;  3MBY A;  3G6Y A;  3ETL A;  1V9P A;  1MA7 A;  2WHE A;  3QU5 A;  4GXI A;  2ZXI A;  4I2J A;  2ZTD A;  4R64 A;  2E8N A;  3PSP A;  4UB6 U;  2BKE A;  1NNL A;  3H8S A;  1ZQT A;  1QSY A;  4B9U A;  4C0Z A;  3UQ0 A;  4OJ5 A;  3NTU A;  2ZJ5 A;  3HP6 A;  2HI0 A;  4KMO B;  9ICM A;  2A1A A;  4KLQ A;  2AHO B;  1NKE A;  2K89 A;  3UPQ A;  4PZN A;  5DG9 A;  2JEG A;  3T79 A;  4RQ1 A;  1X6J A;  3HWT A;  8ICL A;  3SD7 A;  2ATL A;  5BOL A;  1NK4 A;  3SI8 A;  5AI0 A;  4I2G A;  2KZM A;  5L1K A;  2QAR A;  1TKD A;  1DXS A;  3O0F A;  3PW7 A;  2MSN A;  1S97 A;  5III A;  2KIW A;  2KJ5 A;  4C8O A;  2WF9 A;  3BDP A;  3TAC B;  4BWJ A;  4IRC A;  2A1J B;  1ZQW A;  3TAD A;  5KFC A;  5ALO A;  1X9M A;  1T8E A;  4DFD A;  1ZQ1 C;  3AU2 A;  4FBT A;  5ALL A;  5KG0 A;  1D8L A;  2AQ4 A;  2R8J A;  2M9N A;  2MA1 A;  1ZQL A;  3GDX A;  4EEN A;  3HJE A;  4YR0 A;  5HR7 A;  1N63 A;  3WU2 U;  5J0Y A;  1N56 A;  1P7D A;  4DQR A;  4F4W A;  2KKV A;  4MFF A;  4CGZ A;  1ZQE A;  1XSN A;  5KT5 A;  1SXD A;  2W3R A;  2ZIV A;  2FLL A;  3QU9 A;  2RRD A;  4PL2 A;  4KLO A;  1SWV A;  5DGA A;  5D4B A;  1B22 A;  3Q8P B;  2K4P A;  4O3Q A;  2C22 A;  5HHH A;  1CEZ A;  1RZT A;  3UXO A;  3RB4 A;  3ZI4 A;  5DB6 A;  1J2N A;  5KFJ A;  5AKG A;  1XO0 A;  1M6Y A;  1DK3 A;  1ZQD A;  1IG6 A;  1KDH A;  4X5V A;  4ED6 A;  2MUT B;  3H4D A;  1IXR A;  2ZTE A;  3CRX A;  1A0P A;  1UPH A;  1GO3 F;  5ALG A;  4UB2 A;  3JPQ A;  4LJX A;  5J2F A;  3RJE A;  4BXO B;  3RR8 A;  4LZG A;  2YQE A;  1ZD4 A;  5JRT A;  3BJY A;  3JPP A;  2XCA A;  2E8O A;  5KAI U;  4ED3 A;  2BHN A;  1UA0 A;  2FMP A;  3HW8 A;  5DBA A;  4BDP A;  4NM1 A;  2OYY A;  3QX7 A;  5ALN A;  2PI4 A;  3OJU A;  2KZ3 A;  5ALU A;  3PW5 A;  3QU2 A;  4F2S A;  2YX8 A;  4KN7 A;  2HHW A;  2HOI A;  4KLH A;  4TUR A;  4RNN A;  4DSK A;  4JV1 A;  2EZY A;  4KLS A;  4DOB A;  2W7O A;  2VIX A;  5J8Y A;  5AIC A;  2MU2 A;  4C4T A;  3TAR A;  2HOQ A;  1F0M A;  4F4Z A;  2A3V A;  4IRD A;  4KLU A;  5J2B A;  1XO1 A;  1S8O A;  4B9M A;  4XUS A;  2HBK A;  4F71 A;  5J0Q A;  4K4I A;  5KG5 A;  3WK4 A;  1Z19 A;  3WK9 A;  2ZIU A;  5HMM A;  4J9N A;  1D9D A;  4M9N A;  4C8K A;  4QZE A;  2JH1 A;  3IV6 A;  3GV8 B;  5KG3 A;  2XI9 A;  1SKR A;  3PSF A;  1Z00 A;  9ICE A;  4GC7 A;  3NVW A;  3MGI A;  2VJ4 A;  3FM9 A;  4CNQ A;  2W43 A;  3GU3 A;  4PGX A;  4KX5 A;  5DDY A;  4NL9 C;  3JPN A;  4PL1 A;  1XSP A;  4QWC A;  2JGA A;  2W03 A;  5ALP A;  3KHH A;  4QWD A;  1S0N A;  8ICP A;  3ISC A;  5KT3 A;  4AYB F;  1KSP A;  4P0Q B;  4BUG A;  2W9A A;  1KLN A;  2WAQ C;  5DLF A;  3BS5 B;  3KOO A;  1QQ6 A;  3JPS A;  2R8K A;  3NAS A;  1RM6 C;  3FC4 A;  1WCL A;  5KFH A;  2WF6 A;  4Q44 A;  2GO7 A;  2Q4T A;  5ALQ A;  3E2E A;  2NYV A;  2P35 A;  3GIM A;  3ALR A;  4F5Q A;  4GC6 A;  3NGD A;  3GII A;  4GXJ A;  2Z7J A;  1ZXI A;  3PVX A;  8ICU A;  3THV A;  5KFV A;  7ICG A;  5EE9 A;  2P66 A;  2XC9 A;  4CF5 A;  4DQP A;  4I27 A;  4RNM A;  3V6J A;  3M7D A;  2NRW A;  3NRW A;  3RJJ A;  5DQH A;  5TIS U;  3UMB A;  1B0X A;  8ICW A;  2R8H A;  5J0R A;  3U26 A;  1Z4O A;  1Q3V A;  4OJ6 A;  4Y2Y A;  2WB1 F;  5TZV A;  4NLN A;  4JWN A;  2NRX A;  2YMQ A;  3PW2 A;  4I28 A;  4YD1 A;  1RPL A;  4CE6 A;  1JRP A;  1RYU A;  2FPL A;  1FO4 A;  3BQ7 A;  4ELV A;  3QZ7 A;  5EWE A;  4DFP A;  1TK5 A;  1NI3 A;  1ZQX A;  3IHQ B;  3T5L A;  2ZIW A;  2HVI A;  5KFI A;  5KFE A;  5J0T A;  1PUZ A;  2H3F A;  4PHP A;  3QYP A;  4C8N A;  4CDG A;  4DL4 A;  3OJS A;  2XY7 A;  2VA3 A;  1T4G A;  1N62 A;  4RZR A;  3JPT A;  2LHT A;  3AU6 A;  3HIL A;  1Z4N A;  4DQI A;  2DKX A;  3E0F A;  3C5G A;  2G08 A;  3MGV A;  3GQC A;  2JRZ A;  4IL6 U;  3MR6 A;  4KLT A;  3ISD A;  3RJF A;  5AKE A;  1RYS A;  2W04 A;  4YD2 A;  3MR5 A;  3HKZ F;  2HBM A;  2AJQ A;  2W11 A;  1ZQP A;  1X6I A;  3TI0 A;  4EBE A;  3SEI A;  1KFS A;  2DWQ A;  1L7M A;  2K8A A;  2W54 A;  3M8S A;  1WG8 A;  3F2D A;  7ICF A;  2FMS A;  4UAW A;  1K1Q A;  3M1Y A;  1OUQ A;  3ZD8 A;  2P6R A;  3EZ5 A;  5KG6 A;  4QZC A;  4KIT B;  2WTF A;  4OD0 A;  5DQI A;  3AM9 A;  9ICT A;  3RB6 A;  4P0P A;  4DL5 A;  2LMR A;  4QIW F;  5KFP A;  4ECR A;  4KLL A;  4QW9 A;  3GV5 B;  3ONN A;  5AKI A;  5AM0 A;  3PSI A;  1HUO A;  4F91 B;  3MR2 A;  4F50 A;  3PML A;  9ICJ A;  3Q8M A;  5DB7 A;  4C80 A;  5KFO A;  1QH9 A;  5ALX A;  4PH5 A;  1OW5 A;  1O03 A;  4IQW A;  4KLF A;  3RJI A;  2C28 A;  4R8U B;  4C8L A;  4NJ8 A;  3EUB 2;  2Y1I A;  2KNJ A;  3NVY A;  2I5H A;  1IV8 A;  2ZIX B;  4NM2 A;  1CRX A;  4DOC A;  4UB5 A;  5J2I A;  3CP8 A;  1PVP A;  2OHF A;  4J9K A;  3KKA A;  1KQQ A;  9ICO A;  2DPI A;  9ICC A;  3ORY A;  3OSN A;  2PI5 A;  1BGX T;  3F5A A;  2UVV A;  4BWM A;  5J2E A;  4BX9 C;  4PPX A;  9ICK A;  5KFT A;  5IIJ A;  4O5K A;  3PR4 A;  2DUY A;  4Z6E A;  5JUM A;  4DLE A;  2KVS A;  3Q8L A;  1FFV A;  1ZQR A;  2F1J A;  5ALD A;  2BQU A;  3RBD A;  1HIW A;  3C29 A;  1RXW A;  1HUZ A;  4C8M A;  3SAG A;  9ICV A;  3NRZ A;  4UAR A;  4ELU A;  3QE9 Y;  4DSJ A;  2PMZ C;  2MAX A;  4PGY A;  4F8R A;  1U9L A;  4UBC A;  2BCU A;  3WKB A;  5K4L A;  1UT8 A;  3ZD9 A;  5F9N A;  5AI6 A;  3M8R A;  2KVC A;  2ZXH A;  1JAL A;  2J6S A;  5HML A;  4ECW A;  2VJ5 A;  4M9J A;  5KFG A;  2H3V A;  4RQ6 A;  4ECS A;  5KFF A;  2RDJ A;  2IOF A;  5KFN A;  1ZJM A;  4F2R A;  8ICN A;  3PNC A;  1O08 A;  1ZD3 A;  3K75 D;  3RR7 A;  4DF8 A;  5EE3 A;  1ED1 A;  2R8I A;  4PHE A;  3ETR A;  3PO4 A;  4DEZ A;  1PK1 B;  5CR0 A;  1T3Q A;  2EQY A;  2HCF A;  1ZQY A;  3QUB A;  2KN7 A;  4RQ5 A;  4IC9 A;  3GZF A;  5KFR A;  3F5E A;  2KHQ A;  3WKC A;  3GIL A;  1NJZ A;  1SB3 C;  3TAP A;  3UMC A;  4F5R A;  3PX4 A;  1F44 A;  5HHI A;  2XID A;  2YTU A;  4KLJ A;  3RJG A;  2FI1 A;  4F5P A;  2Y0S C;  2FPK A;  2K60 A;  4YR2 A;  2UVU A;  4J9R A;  2W3S A;  5AM2 A;  3H8J A;  3C21 A;  5AIA A;  3TQ1 A;  1CI4 A;  1Q8K A;  2AH5 A;  1NKB A;  1NZP A;  4P4P A;  1V97 A;  4YQW A;  2QAR B;  4R63 A;  1B43 A;  5AM5 A;  2JV3 A;  1L7O A;  3C2L A;  4EBD A;  2A19 A;  2YY6 A;  3CYM A;  4OJP A;  4US8 A;  2JMG A;  1KBU A;  3ZDB A;  1F5S A;  3D6J A;  5KFL A;  3FAH A;  1S0M A;  3C2M A;  2BCQ A;  2GH1 A;  5AI5 A;  5DG8 A;  1VJ5 A;  2EZX A;  1JX4 A;  2G07 A;  2KSO B;  4QZ8 A;  4O5E A;  5C5J A;  3OPX A;  4PHD A;  1BPZ A;  3JPO A;  3WKA A;  1J2M A;  1MC8 A;  1WYG A;  4MEX A;  1COO A;  1ZQN A;  2HHU A;  2YB1 A;  2JR5 A;  4JK1 A;  5FP0 A;  1S5L U;  4ELT A;  2YN4 A;  4JMU A;  2BDU A;  2KTQ A;  1BPY A;  3PW4 A;  4UAT A;  1TE2 A;  4UW9 A;  4DS4 A;  1BPD A;  1A76 A;  1XS9 D;  4MF2 A;  4F4Y A;  4U6P A;  3V7K A;  1XU4 A;  2BPC A;  2BQ3 A;  4DF4 A;  4DFM A;  3LDA A;  7ICU A;  4KLE A;  2KG5 A;  5KG7 A;  4NV0 A;  3K1R B;  9ICP A;  3EW9 A;  4CRX A;  4LVS A;  4YMN A;  5D46 A;  2FPM A;  1LV5 A;  1LVH A;  2R8G A;  1L3V A;  5ALT A;  3PZP A;  5ALK A;  1KFT A;  3RRG A;  5ALY A;  4UBB A;  2HHX A;  3KHL A;  5KT2 A;  8ICF A;  4GIB A;  3Q8R B;  4ECY A;  5ALF A;  2DQN B;  3K1Z A;  3IM1 A;  4TUS A;  3AQE A;  5KG2 A;  1NJX A;  4QZH A;  4J9P A;  2QLT A;  1X9S A;  8ICC A;  3G6V A;  1ZD5 A;  7ICK A;  3WK7 A;  5AKX A;  5KFS A;  2ZUD A;  7ICP A;  2UVR A;  3ED5 A;  1PK3 A;  3V72 A;  4B9L A;  1TAM A;  3SV3 A;  4ECX A;  3RF9 A;  1ZQG A;  1ZQI A;  5CA7 A;  2B0C A;  1S0V A;  1Z1V A;  2IOH A;  2J6T A;  3BQT A;  4QZD A;  4R66 A;  5L1L A;  2L5Y A;  4I2D A;  4FS2 A;  2AU0 A;  3KHG A;  2ZUB A;  2CRX A;  3EPG A;  2YMP A;  3RRH A;  5AM4 A;  1Q46 A;  1WWV A;  4J9O A;  2EAM A;  3NVV A;  1T3N A;  2GOL A;  2RDI A;  4Y2U A;  9ICI A;  8ICZ A;  4QZF A;  2OWO A;  2WF5 A;  5AM3 A;  8ICY A;  5KFU A;  3T5H A;  4NL9 A;  4ECZ A;  3N7P D;  9ICS A;  4YMO A;  4UB4 A;  2MUT A;  2F8L A;  1RDF A;  2CN1 A;  5IIK A;  4K4H A;  4EX6 A;  3GIK A;  2F1H A;  3F53 A;  2DKZ A;  2IA6 A;  4YG2 A;  4BXO A;  4M6W B;  1NK5 A;  3V7J A;  3EWA A;  5KTQ A;  3HRD D;  4K4G A;  4NLC A;  1RQN A;  5ALJ A;  3MFH A;  8ICK A;  1ECW A;  1X40 A;  3NUQ A;  2E1E A;  1URJ A;  2G5H B;  1QSS A;  5KT6 A;  2ODG A;  1JI7 A;  5CHG A;  5KFY A;  3PV8 A;  4B9T A;  3MFI A;  2CXY A;  8ICI A;  5BPC A;  4RUC A;  2KJ8 A;  2JHD A;  4G9B A;  5AKK A;  1FFU A;  2AXT U;  2V4R A;  1X9X A;  4YVZ A;  3AQF A;  3DV9 A;  4J9S A;  2OH2 A;  5KG4 A;  5AI8 A;  3WK5 A;  2ESE A;  4XA5 A;  8ICM A;  2HBJ A;  3B9J A;  1SL2 A;  4MFC A;  2K4I A;  4NLZ A;  4FZN A;  5GTI U;  1NJW A;  5KFA A;  2DL0 A;  2W9C B;  2Y9T A;  1X9W A;  3OHA A;  2KJ9 A;  4ZH4 A;  2E5S A;  5KAF U;  2LYB A;  3OGU A;  2H3Q A;  4JUZ A;  3GV7 B;  5AKZ A;  2I6X A;  3L3F X;  4OCZ A;  5J2C A;  2HMX A;  1N60 A;  2JZB B;  2P6U A;  2AGP A;  2GLE A;  3BZC A;  4M9H A;  1S77 D;  7ICM A;  1L7N A;  4Z6F A;  4MFA A;  2GWS A;  3ZDA A;  2EAO A;  4I2B A;  4BJQ A;  2YML A;  4QZ9 A;  5J29 A;  5L9X A;  3M6K A;  8ICA A;  5AI9 A;  4DFK A;  2KFZ A;  4WJ3 B;  4C7Z A;  1DK2 A;  4FZL A;  4P0Q A;  3C23 A;  5DGB A;  3BS5 A;  1TAU A;  2BPG A;  5J0P A;  1H38 A;  2DGZ A;  1NK6 A;  1A77 A;  2YMM A;  3CW2 C;  1COK A;  2HVH A;  5KL1 B;  3TAN A;  1OXJ A;  4DSL A;  1SKW A;  1Q3U A;  1X2I A;  1DOQ A;  2NRZ A;  4NLG A;  2LPE A;  5IIL A;  4YP3 A;  3F2B A;  1MQ2 A;  2FLP A;  1IIP A;  2WB1 C;  1L3T A;  4O3M A;  3RH5 A;  4RQ7 A;  2ASD A;  1L7P A;  4IQU A;  3IDW A;  1SV0 C;  5KFM A;  8ICB A;  3RAQ A;  4JWM A;  1SV4 A;  1SZH A;  3V7L A;  3T5K A;  1TFR A;  1YZ7 A;  2RP5 A;  8ICV A;  4M9L A;  3QEB Z;  2E1F A;  4DQS A;  5IIM A;  2JEI A;  2KP7 A;  3RH4 A;  2O6K A;  2G0A A;  8ICJ A;  4EEL A;  4JB3 A;  1Z3E B;  4YCX A;  4M9G A;  1BPX A;  1LB2 B;  5AKH A;  5CP2 A;  1SKS A;  4J9L A;  4EZ9 A;  2H3Z A;  1XWL A;  3HKZ C;  2QB0 B;  4I2F A;  4GXK A;  4O3P A;  7ICH A;  4I2H A;  2HW3 A;  2M0N A;  4YR3 A;  1S0O A;  1ZQJ A;  2E8M A;  3A0B U;  4Y2T A;  4RQ3 A;  3CNH A;  3G6X A;  5J0O A;  3SV4 A;  3RBE A;  4DWI A;  1TVA A;  2XCP A;  4O9M A;  5IIN A;  4ED2 A;  2KD1 A;  4C4R A;  2BZF A;  8ICH A;  1SWW A;  2K4E A;  3Q8S B;  4HAI A;  5DBB A;  2E8P A;  4ED1 A;  5KFZ A;  1JUD A;  2F44 A;  4I29 A;  5ALV A;  2B21 A;  4EYH B;  2ASL A;  3ICX A;  4QZG A;  1BPB A;  1MQ3 A;  2W9B B;  2FJ6 A;  3PR5 B;  4IR9 A;  2HSZ A;  4KX3 A;  1L3S A;  4ACO A;  1PZN A;  3ISB A;  2ISP A;  2K4H A;  3BZK A;  5B5E U;  5L1J A;  3BQ0 A;  4Y2V A;  5AK3 A;  1KL9 A;  1SXE A;  3MR3 A;  2WFA A;  4Y2J A;  1PVQ A;  4J9Q A;  1RYR A;  4R8U A;  4NWI A;  4CCH A;  4M0A A;  4DSE A;  4IR1 A;  2DF4 B;  3S6J A;  2W7P A;  2LM4 A;  1ZOL A;  5JTI A;  1U4B A;  1ZQF A;  4O5C A;  4KN4 A;  3T3F A;  3D2Q A;  2G09 A;  3MDA A;  4ECV A;  3OSP A;  1C7Y A;  2DBY A;  5DB8 A;  2OCE A;  3GFK B;  2NV3 A;  5J0U A;  3C2K A;  5L1M A;  5ALM A;  1NK0 A;  4EZ6 A;  1YT3 A;  5KFX A;  2N1R A;  4E0D A;  4P2H A;  1SIJ A;  3Q8Q B;  3SAH A;  2C2E A;  3E58 A;  5AM1 A;  4ED0 A;  4ZOH C;  7ICV A;  3QU4 A;  5AIB A;  4GLX A;  3C1Z A;  5DKW A;  1ZQU A;  1QCK A;  2F77 X;  2B6G A;  1U49 A;  3PX6 A;  2RHF A;  1A6S A;  3UXP A;  1NK8 A;  5ALE A;  4C4S A;  3IN5 A;  4ECT A;  4QW8 A;  5EWG A;  1SZP A;  5J2D A;  2OXO A;  4Y2P A;  1VDV A;  3HX0 A;  5KG1 A;  3RJH A;  5HR6 A;  5DQG A;  4Y2R A;  4I2C A;  2ES6 A;  3LK9 A;  1JN3 A;  5EE1 A;  3H0L B;  2OEH A;  1Z1B A;  5EOZ A;  3UXN A;  7ICE A;  3VC8 A;  3IG5 A;  3PW0 A;  8ICX A;  3RFA A;  1XC9 A;  2K8C B;  4FZM A;  2XO7 A;  4MEY A;  3SYZ A;  3UMG A;  8ICT A;  2LBO A;  2IHN A;  2Y0S F;  2EDU A;  4C7Y A;  1AQ6 A;  3KBB A;  3ZDC A;  5T14 A;  4PJ0 U;  2HOF A;  5J2G A;  3AN1 A;  2KZZ A;  5ALZ A;  2G06 A;  1ZET A;  2JH7 A;  3WKE A;  2F1I A;  4O3S A;  1PK1 A;  4OJO A;  2RLT A; 
#chains in the Genus database with same CATH homology
 2G09 A;  1HEK A;  4GFJ A;  3M7D A;  3NRW A;  4QNL A;  3IP4 B;  2W7O A;  1T94 A;  1DRG A;  2CRX A;  2G07 A;  5HR7 A;  4ICA A;  3M6Z A;  2VIX A;  5CRX A;  2F2A B;  3LVW A;  3OPX A;  2HBL A;  2HOQ A;  3D2S A;  2H3Z A;  2R18 A;  2NV3 A;  1P7D A;  1L6N A;  2ZG6 A;  4U7C A;  2A3V A;  2KKV A;  1Q3V A;  2KJ9 A;  2E5S A;  3HKZ C;  2LYB A;  4OJ6 A;  2H3Q A;  4CGZ A;  3DEE A;  2WB1 F;  3L3F X;  2HBK A;  1YT3 A;  2YB1 A;  2HMX A;  2GOL A;  4P0P B;  3SAF A;  1ED1 A;  2N1R A;  1Z19 A;  2XIC A;  2ZIU A;  2D6F C;  2ZIV A;  3SAH A;  2KNJ A;  2WAQ F;  4JMU A;  3N7R C;  2BDU A;  1WUD A;  4FE3 A;  2VKQ A;  3N7P D;  2ZIX A;  2PMZ F;  2M0N A;  2ZIX B;  1CRX A;  2RRD A;  4PL2 A;  2JH1 A;  1XNS A;  4BJQ A;  5A0L A;  2F8L A;  3CP8 A;  4IC9 A;  1PVP A;  3GZF A;  2ZIW A;  2CN1 A;  4U6P A;  3AL0 B;  2XI9 A;  3F5E A;  2KHQ A;  3M6K A;  3PST A;  3PSF A;  3C28 A;  3F2C A;  2H3F A;  3F53 A;  4WJ3 B;  1MA7 A;  4FZL A;  4AYB C;  2F77 X;  4CDG A;  4P0Q A;  1F44 A;  2XID A;  2KD1 A;  2ZXI A;  2VJ4 A;  3F5A A;  3PSP A;  2RHF A;  1A6S A;  4NV0 A;  2DGZ A;  3IN5 A;  4CRX A;  3GU3 A;  2KOB A;  4KX5 A;  1XO0 A;  2K4E A;  2ZIU B;  2LKY A;  2ZIV B;  4BX9 C;  3LVV A;  5KL8 B;  2OXO A;  2LHT A;  5KL1 B;  2Y0S C;  3KZX A;  4NLB A;  4C0Z A;  4OJ5 A;  4PL1 A;  3E0F A;  4NLC A;  1Q3U A;  5HR6 A;  2G08 A;  2H3I A;  3MGV A;  4KMO B;  3PZP A;  3F2B A;  2JGA A;  1ECW A;  3ICX A;  2W03 A;  2K89 A;  3H0L B;  3LYS A;  3NUQ A;  2K8B B;  2E1E A;  2ZIW B;  3SMV A;  1URJ A;  3IG8 A;  3T79 A;  1Z1B A;  2G5H B;  2XVT A;  2W04 A;  1IIP A;  2WB1 C;  3CRX A;  1A0P A;  3HKZ F;  2HBM A;  3IG5 A;  3VC8 A;  1UPH A;  3RFA A;  4AYB F;  1GO3 F;  2DQN B;  4O3M A;  3K1Z A;  2K8C B;  1HIW A;  4QIW C;  3C29 A;  3SAG A;  3AQE A;  4FZM A;  4P0Q B;  3O0F A;  4BUG A;  3D2N A;  2KIC A;  2KJ8 A;  2K8A A;  2WAQ C;  2JHD A;  4KX3 A;  4ACO A;  2KIW A;  3F2D A;  2KV2 A;  4OJL A;  2KJ5 A;  2PMZ C;  2K4H A;  2LBO A;  2KEY A;  2OM6 A;  2Y0S F;  2KHV A;  2KKP A;  3CYM A;  1OUQ A;  3AQF A;  4OJP A;  3SQI A;  2Q4T A;  2CPR A;  3KFU F;  1PVR A;  1SZH A;  2YB4 A;  2F76 X;  5T14 A;  2OYY A;  2JMG A;  2OH2 A;  1D8B A;  4A8E A;  3ALR A;  1PVQ A;  2RP5 A;  3N7S C;  2HOF A;  1KBU A;  1ZQ1 C;  2LYA A;  4NWI A;  2Z7J A;  1TAM A;  3H0R B;  3H0M B;  4P0P A;  2E1F A;  3RF9 A;  2HBJ A;  2G06 A;  5C0Y A;  2JH7 A;  2DF4 B;  2KVC A;  4QIW F;  2W7P A;  4QJF B;  2ZXH A;  2K4I A;  2MA1 A;  3VCB A;  2G5I B;  2GH1 A;  2YX8 A;  1NZB A;  4FZN A;  2G0A A;  2HOI A;  3ONN A;  2VJ5 A;  3PSI A;  4OJO A;  3D2Q A;  4OO1 J;  2H3V A;  2MRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...