1HIWA

Trimeric hiv-1 matrix protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
115
structure length
115
Chain Sequence
VLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Matrix protein
molecule keywords HIV-1 MATRIX PROTEIN
publication title Crystal structures of the trimeric human immunodeficiency virus type 1 matrix protein: implications for membrane association and assembly.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 40
structure length 115
sequence length 115
chains with identical sequence B, C, Q, R, S
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1996-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00540 Gag_p17 gag gene protein p17 (matrix protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hiwA00
1UPHA 2JMGA 2K4HA 2LYAA 1HEKA 2K4IA 4IC9A 2NV3A 1A6SA 4ICAA 1TAMA 2K4EA 2H3FA 2HMXA 2H3VA 1HIWA 1ED1A 2N1RA 2LYBA 1ECWA 2H3QA 4JMUA 2H3IA 2H3ZA 1L6NA 2GOLA
chains in the Genus database with same CATH superfamily
4Z6EA 2G06A 3KFUF 2XICA 3SAHA 2P66A 4KITB 4B9SA 5DBCA 2ZJAA 2ASJA 2E1EA 2E8MA 1Z1BA 3TADA 3SEIA 2IA6A 5HP4A 4C8KA 4QZIA 8ICEA 7ICUA 1ZQOA 4FBTA 4KLQA 4QZ9A 3QUBA 5KFRA 3U26A 4I27A 4F2SA 2FPKA 3V6KA 4MF8A 3KOOA 5K4LA 1ZQGA 2A1JB 2F1HA 5ALLA 5C0YA 2W54A 3MR3A 2F8LA 3RB3A 2ZTDA 4FFDA 4UARA 3H4DA 5KFGA 5KFWA 4UAUA 4RNOA 4KTQA 3ICXA 2BCSA 2VA2A 3ZDAA 1SKRA 4RNNA 4J9OA 3MGVA 3GILA 2BPFA 4YVZA 4IC9A 1FEZA 3PW0A 1MN8A 4O5EA 2OM6A 5KFPA 2ZIWB 1IXRA 4BGDA 1A0PA 4RUCA 3KZIU 4US9A 1ZQUA 4YXMA 5KFHA 2R8IA 4ED2A 4BX9C 1TK0A 2JV3A 1B0XA 4Y2SA 4UBCA 3RJFA 3OSPA 3Q8MA 5DG8A 2LPEA 2ZIWA 4CF5A 3F2CA 1XSNA 4DQQA 3ZDCA 1RM6C 3H0LB 3JPQA 2HCFA 4NLBA 1KN5A 3NS1A 5DG9A 4YMNA 1VLBA 1MQ2A 3MBYA 4I2BA 2KZ3A 4O3RA 4BXOB 3DV9A 4I2CA 2C2RA 2WB1F 2BGWA 2DPJA 2FI1A 3F53A 2CN1A 3N28A 5J2HA 4R64A 5KG7A 4DF4A 7ICOA 3ZI4A 4YR0A 3HPOA 4Q44A 1XC9A 4OD0A 4KLGA 5ALFA 2ZIXA 3JPOA 3E0FA 3PMNA 3G6YA 4IQUA 4KLJA 2W3RA 4EX6A 3TQ1A 9ICRA 3T3FA 4O3QA 4RPZA 3KHLA 3KKAC 2ISPA 3QUQA 3N7PD 4PGXA 4JUZA 5J0XA 4JMUA 5AK6A 2P35A 5KFYA 4TURA 1N5XA 3K75D 1Z4NA 2QB0B 4UW9A 4OO1J 1TAQA 1WYGA 2LKYA 4QZDA 4C7YA 3V72A 4Y2PA 7ICPA 3KBBA 5DB9A 5ALXA 7ICFA 5F9NA 1ZRNA 1SXDA 4K4HA 7ICNA 5KFAA 4RNMA 5F9LA 3RFAA 2BCVA 2QB0A 2IMWP 3QZ8A 3Q8PB 1CUKA 3RJJA 2VKQA 2KG5A 3IG8A 5AI9A 3QUCA 4IQWA 2Y9TA 3OHAA 3A0BU 3D2QA 4DEZA 3RH4A 5KT4A 1T7PA 4RQMA 5EWEA 5D4BA 4EZ9A 2F76X 3THVA 2C22A 4KLLA 3AUOA 3H8SA 2F1IA 2GWSA 5DDMA 3MFIA 2FMQA 1S0MA 4F4XA 2JMGA 3H0MB 2K8CB 5KG0A 4F92B 5J0WA 3LK9A 4JK1A 3C1YA 3M8RA 4HAIA 2E5SA 2Q4TA 1AROP 9ICKA 5D49A 5L1IA 4ECXA 3OJSA 2V9WA 4M9GA 1XS9D 1NJYA 4FZLA 1T3NA 9ICBA 2EAOA 2B21A 4DFPA 9ICXA 3ZDEA 4PPXA 1X9SA 1KFTA 1Z00B 4ED8A 4ECYA 1SV0A 4NL9A 4IRCA 3E58A 3N7SC 3FYHA 4J03A 2FMSA 5EOZA 2NYVA 2BPGA 2XY5A 1XNSA 5DG7A 2JRZA 5BOMA 3EUB2 1L3TA 5KFMA 4YR3A 4OJPA 1DXSA 1Z00A 1NKCA 4NXZA 2BCQA 1CI4A 3HP6A 3L4PA 4Y2YA 4EX7A 4F5NA 3NASA 4QWCA 2VJ5A 3H7IA 1YZ6A 3RTVA 4CF3A 5AM5A 4DS4A 4GC7A 2H3QA 3BS5B 7ICVA 2YMMA 2FMPA 3DDHA 1ZQ1C 5AKEA 1XO1A 2MA1A 4O3PA 4J9MA 4NM2A 1SZHA 4DL3A 1OUQA 2G0AA 2KTQA 3WK9A 4RQNA 1T4GA 3BS5A 3SR6A 3TFRA 1F5SA 3PR4A 4C7ZA 4M0AA 1HUZA 2UVWA 3TANA 2K4IA 5AKGA 4O5KA 3RR7A 1UT5A 2V4QA 1RPLA 3L5KA 1NK8A 3MFHA 5KFLA 3C2KA 3OHBA 1X9WA 2AXTU 3UMCA 5KFTA 3M6ZA 5L1LA 9ICLA 1B22A 1XU4A 3BZKA 4QW8A 1Q46A 5J0SA 4DLGA 1Z1VA 1HJPA 2AH5A 1U9LA 2YMPA 1XO0A 3GIKA 1QCKA 3KTQA 2AU0A 5KG4A 1ZD5A 4PZNA 4F5PA 2KOBA 5KFCA 2G5HB 1S5LU 5AK4A 9ICIA 5ALEA 5KAFU 3GZFA 5KG2A 1SKSA 4YD2A 9ICEA 4I2GA 3F2BA 4ECRA 4NLCA 1N48A 5AICA 4IS7A 1QQ7A 2XY6A 1C7YA 5ALZA 1U4BA 4JV2A 4QIWC 3M9MB 3GV5B 4DWIA 2JR5A 1ZQIA 5J2FA 1ZETA 3T5HA 4UAYA 2HSZA 3ZDDA 1NK5A 1BPEA 3GDXA 1ZQKA 3C2LA 1QSSA 9ICVA 2HVHA 2XCAA 3PSPA 5ALMA 4NLZA 4EBDA 1H38A 4C4RA 8ICQA 1NKBA 5CA7A 4QWAA 1XSPA 7ICHA 5J0QA 2YB4A 5HHIA 2JEIA 5DB6A 2Z7JA 3QNMA 5KG1A 2HHUA 2W3SA 1ZQXA 2C28A 4O3SA 1YT3A 4UB3A 2ISOA 4KLTA 2KIWA 1O08A 1D9DA 5ALRA 4NM1A 4CRXA 1KKXA 4DL2A 1FFVA 2KVSA 1X6IA 4DSIA 2WFAA 5KT6A 2IHMA 2OH2A 1J97A 1ZJMA 4CNQA 5HR7A 3NUQA 2EZXA 3BQ7A 3H8MA 5KT7A 1FFUA 2JGAA 1WG8A 3SI8A 1QQ5A 2XY7A 2LM4A 3RR8A 4Q45A 5AKKA 2AHOB 3NGDA 4NLGA 1NKEA 3ORYA 5J2KA 2PI4A 1C20A 3RJHA 1NJWA 4EEYA 5G5HA 4RT2A 1UA0A 2FLLA 3PW2A 2E8PA 5AI6A 1BPZA 3ETRA 1FIQA 1ZQNA 1SL0A 4QZ8A 1UA1A 4O5CA 2MSNA 4DOCA 5ALOA 4YCXA 2RRDA 1JUDA 1Z3EB 2FPMA 5AKHA 5ALJA 5G5GA 2XVTA 2E8NA 4B9NA 5KFVA 1TE2A 5IIMA 1PVPA 4I2AA 1TK8A 1V38A 1SL2A 3AU2A 5DLFA 4QZBA 4UQGA 2PKEA 1K1SA 1XWLA 1ZXIA 3IRUA 1VJ5A 4DS5A 2AJQA 4P4MA 1RXVA 1S0OA 1ZQHA 2BQ3A 5KFOA 2ZG6A 4Y2QA 9ICTA 1OW5A 4TUSA 3PX4A 1KLNA 8ICHA 3DEEA 1J2MA 4Y2UA 4QNLA 2JEFA 5J2BA 3T5LA 2LMRA 5DQGA 4QW9A 1L7OA 2ZIVB 1NI3A 4QIWF 4KMOB 1ZQYA 4KMUA 2VA3A 5J0TA 2BKEA 1L3UA 4IRKA 1DGJA 2MRLA 4I2JA 4IQTA 1PUZA 2K4PA 2D8CA 3LVVA 2ZIVA 4IR9A 4X5VA 2HBKA 4OJ6A 5TZVA 1ZYQA 3UQ0A 4YP3A 8ICOA 5KNIA 2R8KA 4JWMA 1ZQEA 5J0RA 5DBAA 1ZQQA 1D8LA 4EYHB 4O3OA 4GXKA 4UB8U 2KJ5A 5ALGA 3Q8RB 4YMMA 7ICTA 3AMZA 3SQIA 4G9BA 3ETLA 4J9RA 3IDWA 2DUYA 3UMBA 2GOLA 1GO3F 1ZQCA 5KFNA 1UPHA 1LB2B 9ICMA 1SGGA 3MC1A 4FZNA 3QU2A 2KJ8A 4E0DA 5HMLA 5DGAA 7ICEA 9ICSA 3D6JA 3PW7A 2HOIA 2H3FA 3K1RB 1BPXA 1OXJA 3PW5A 1JX4A 3ED5A 1KQQA 4DOAA 4RQ7A 2Q0ZX 4F4YA 4C0ZA 3BJYA 3SENA 5ALVA 5J8YC 1V85A 3HILA 3JPSA 3PW4A 4GC6A 2W9CB 4RQ6A 4F5OA 3IM1A 2XO7A 3C21A 1KL9A 3RJEA 4DL6A 4QZAA 4XQ8A 1D9FA 4ECSA 2F2AB 3B0XA 1KTQA 5DB7A 4I2HA 2VANA 4CE6A 3SD7A 3BQ0A 4ECZA 3T79A 1U47A 5AM0A 4P0PB 2W9CA 2KFNA 3QUTA 1L3VA 4OCZA 8ICUA 2W9MA 4C4TA 4QZEA 9ICNA 2RQ5A 1D8BA 2XGPA 4RQ8A 3BQ1A 3UXNA 4B9TA 3CYMA 2K8AA 3NVZA 1B4FA 4KLMA 1PZNA 2RDIA 4P0PA 3QZ7A 8ICRA 4IRDA 1DOQA 1BGXT 1URJA 2ZIXB 4I2EA 3H8JA 1TKDA 1ZQSA 4TUPA 4NV0A 4DLEA 5T14A 4RQ4A 5KFBA 3QX7A 3RJGA 1X66A 3GIIA 5CHGA 3TAQA 4UASA 1QSLA 3HT3A 8ICIA 1Z4OA 1L5UA 4NLKA 2DPIA 4UB2A 3FC4A 3RBDA 8ICKA 2JH1A 1NZBA 3BQTA 4NWIA 3QU4A 2ZTCA 2KEYA 3C5FA 3QE9Y 3UPQA 2BHNA 3A0HU 1D8YA 2LYBA 1ZQFA 3Q8SB 3QYPA 1S0NA 3WK8A 2H3ZA 4F91B 2F77X 4GFJA 3IV6A 3K4GA 5DLGA 4Y2RA 1L3SA 2HVIA 4Q8FA 1T94A 1A6SA 2WAQC 4K4IA 3IP4B 3UXOA 4P4PA 8ICSA 2IOFA 1X40A 4M9JA 5CP2A 2IOHA 2AQ0A 2HMXA 5CWRA 3UM9A 4EBCA 5AKYA 3H4BA 5KG3A 4F4KA 1X42A 4RUAA 5J2EA 1PVRA 2ESEA 5AM3A 2C2EA 2LYHA 4NJ8A 1UQVA 4M2YA 1ZQZA 3KHRA 3NRZA 3SV3A 3WKBA 2N1RA 4J9KA 3FDSA 2MUTB 3LWMA 2QLTA 4B9LA 5AKLA 1LKYB 3ZD8A 5EWGA 1MC8A 3NVWA 4M47A 2E8OA 4RQ1A 2HBJA 2KVCA 4DFJA 3RF9A 2WF5A 2BDUA 3PSIA 5GTIU 3G6VA 1RYUA 3NVVA 1Q3VA 2MUTA 2ZTEA 5J0YA 1LKYA 5F3XB 4O3MA 5ALQA 2DFLA 1WCNA 1RZTA 5A0LA 3I76A 2JZBB 5KL8B 1DK3A 4CF4A 1JXEA 3I1YA 3I28A 5J0OA 2F44A 3G6XA 2VJ4A 3GIMA 8ICPA 1VDVA 1ZD4A 3KKAA 3TKAA 2WHEA 2YMQA 3HX0A 3EWAA 5JTIA 4ECTA 5J0PA 4PL1A 3PZPA 2QARB 2JZBA 4RPXA 1BNOA 2BQUA 2RDJA 2O6KA 5IINA 1X2IA 2HDOA 2ASLA 3TARA 4P0QB 3AEVA 1L7PA 4DL7A 1TAUA 3SV4A 1N61A 2YN4A 4ECWA 3VC8A 4F71A 5AM4A 2LI6A 3PY8A 4ZH4A 5ALTA 1ED1A 2QARA 4AP9A 4K4GA 2E1FA 2HHQA 4ED7A 3LYSA 4P0QA 4PL2A 4B9UA 2JHDA 2LM1A 5ALUA 3M9OB 3AQFA 4MEXA 1X6JA 1S77D 2FPLA 7ICKA 5AIAA 2ZUDA 3HRDD 2I9GA 2I1QA 2RHFA 4MF2A 3TACB 2B0CA 3RH6A 1L7MA 2WAQF 1J2NA 5B66U 2M0NA 4CGZA 2R18A 5KT5A 2RP5A 2PXIA 9ICPA 2EAMA 3WKDA 5J2AA 1RXWA 5AKZA 1S97A 1TV9A 2IHNA 2W8KA 3PMLA 1QH9A 2L5YA 1A77A 3JPPA 3T5KA 1SKWA 5KG5A 4I2FA 2G07A 5KG6A 4HYKA 3AL0B 9ICCA 4J9PA 3KHHA 1B43A 5J2IA 3RRHA 4J9SA 1ECWA 1DRGA 5DQHA 2A19A 2J6UA 4MEYA 4DOBA 1HEKA 2NO5A 1ZRMA 2NV3A 4QWDA 3MR2A 1PK1B 4KLSA 1AQ6A 1KRPA 4M04A 1BPBA 1UHUA 3LDAA 1JXLA 3B0YA 1JI7A 2HOFA 3D2NA 1NZPA 3CNHA 2PFNA 4CDGA 4IR1A 2NRVA 3H40A 4FBUA 1PK1A 4PH5A 5KFDA 4G3IA 1NK6A 5J2GA 5ALKA 3GQCA 3J81j 2UVVA 4OJ5A 3ZD9A 2W8LA 5J0UA 4PJ0U 1K5OA 4O0IA 2ES6A 4YD1A 5CRXA 3MGHA 4MHVA 1MSWD 1S8OA 2EQYA 2KICA 3HW8A 9ICAA 4YG2A 4MFCA 4EBEA 2W43A 3K1ZA 1SWVA 4B9MA 4FE3A 3SYZA 4DFDA 2FE9A 2XC9A 1IG6A 4US8A 5J2DA 1UT8A 1HIWA 2YQEA 5KT2A 3HKZC 4DSJA 2P6RA 4C8LA 4C80A 5JRTA 9ICJA 5ALDA 3GV7B 2KMDA 2LHTA 7ICIA 1N60A 3MR6A 4PHAA 2KP7A 3C28A 5KT3A 1K1QA 2FJ6A 1N5WA 2K4EA 2ZJ5A 3RBEA 4RQ3A 2XI9A 5J2CA 3T5JA 3CP8A 2IBKA 3QXGA 4UAZA 3BZCA 3UMGA 5ALHA 2I5HA 2AGOA 5HNKA 4F5QA 1X9MA 2W03A 4ECVA 9ICFA 4EELA 1TAMA 2HBLA 4Q8EA 2KKVA 2EZYA 4ELVA 4UB1A 4DQRA 2UVRA 4PHPA 1NJXA 8ICJA 4J9LA 2LBOA 5IIIA 4ED6A 1QSYA 4RPYA 4LJXA 4QZFA 3TADC 2D3DA 3V7KA 3AQEA 5EWFA 9ICWA 7ICLA 4EEKA 4TUQA 2AGQA 4O3NA 5AI8A 1KFSA 4QZHA 2P6UA 2OWOA 4A8EA 3OPXA 3KHGA 2ZUBA 1TFRA 3CW2C 3GV8B 4F5RA 1S10A 1Q8KA 5L1MA 4PGYA 1BPDA 3SZ2A 9ICGA 3PVXA 4EENA 4Z6CA 1L7NA 4DCCA 4F93B 5BOLA 2ATLA 4KX3A 3OJUA 2DBYA 2DQNB 5DBBA 3BS7A 3PV8A 2V4RA 5E79U 4F50A 8ICGA 3CRXA 1ZJNA 2KZZA 4QWEA 1KSPA 5AK3A 2AQ4A 1RQNA 2F3NA 4IL6U 4RQ2A 1L6NA 4DQPA 1O03A 5CJ7A 5J29A 3WK4A 3RRGA 5KFQA 2CXYA 1CRXA 4EYIB 4DSFA 1ZQDA 4C8MA 5ALNA 3V6JA 1QQ6A 3HKZF 3M1YA 3D2SA 3IG5A 5IIJA 4R66A 2NO4A 1U48A 1ZOLA 2W9AA 3RB6A 5KFUA 4KX5A 2W11A 4UAWA 2K8BB 4BJQA 1N56A 2DL0A 2NRXA 1SIJA 4P4OA 2ZJ8A 3JPNA 7ICMA 2DWQA 4CCHA 4KLDA 4DF8A 4RZRA 2XIDA 2Y9UA 5AI4A 3H8WA 2G09A 2NRZA 1L8OA 3WK5A 9ICQA 8ICLA 2QKQA 3EYZA 5AI5A 1KDHA 4YFKA 3Q8QB 7ICGA 3JPRA 1IIPA 2DKZA 4DFKA 5IIOA 2KFZA 1Y88A 2KD1A 2ZXIA 4Q43A 4PHDA 3IHQB 1ZQBA 1WWUA 4Y2JA 2ALZA 5D46A 2Y1IA 4QWBA 3EPGA 4DQSA 2W9BB 4QZCA 2A1JA 3OTQA 3IN5A 1BVSA 2KJ9A 3TI0A 5KFZA 4PHEA 2FDRA 4Z6FA 3KZXA 5DKWA 1WCLA 4RT3A 2DF4B 3S6JA 4I2DA 5AKIA 1HUOA 2HHXA 1LVHA 3NTUA 4UATA 3PNCA 2W9BA 2HHVA 2KHVA 4FS2A 1ZQPA 4KLOA 3QU5A 5EE3A 5EE1A 1SZPA 5IIKA 2C2DA 2R8GA 2YMLA 2BCUA 4R65A 4UB4A 2LYAA 5AM1A 3WKEA 1NJZA 9ICHA 4YN4A 4NLNA 2OCEA 2KSOB 3ISDA 1CEZA 5C5JA 3EZ5A 3SMVA 5DDYA 3B9JA 3WK7A 5CB1A 4EZ6A 2DGZA 4WJ3B 4M9HA 4DL4A 3MR5A 1PK3A 4UBBA 3ZDBA 4ACOA 3HWTA 2KSOA 1S76D 4FZMA 1JROA 2KHQA 4B9VA 4F8RA 3VCBA 4BXOA 1SXEA 4XA5A 4AYBC 4J9QA 4UAVA 3O0FA 2PFQA 2KKPA 5EE0A 1L8LA 2JH7A 5BPCA 2Y1JA 5B5EU 5KFSA 2OYYA 1BNPA 1SV0C 4NL9C 3FAHA 2ASDA 3UXPA 3RB0A 1ZQWA 5J8YA 4RU9A 1MA7A 3AM9A 9ICUA 2EZZA 2G5IB 2QB1A 2KN7A 1F0MA 3MDCA 5KTQA 5KFKA 3MABA 5L9XA 2H3IA 1KBUA 4DO9A 2XCPA 4BWMA 1FO4A 1WWVA 1N63A 1DK2A 1SB3C 1COKA 4XUSA 3V6HA 1ZQAA 4QJFB 2Y0SC 3RJIA 1NNLA 4KLHA 8ICNA 4UB6U 4RQ0A 4NY8A 1RG6A 5DGBA 5AIBA 5IILA 4F4ZA 3OSNA 5JUMA 5DB8A 4TQSA 1XSLA 2GH1A 2D6FC 2W55A 3RB4A 1KFDA 1COOA 5AK5A 2JXJA 8ICCA 2OEHA 8ICZA 2GO7A 5AHXA 4KLUA 5KL1B 2EAPA 5KAIU 5HHHA 3MDAA 2HHTA 2BQRA 4XRHA 4ELTA 8ICBA 5DQIA 4TQRA 1JALA 5ALYA 2HW3A 1V9PA 3WK6A 5ALSA 1NK7A 2F8KA 2E3TA 3GU3A 3GIJA 7ICJA 2A1AA 2PMZC 1ZD2P 3F2DA 2EDUA 4Y2XA 2ODGA 1UCVA 5AKXA 2WF9A 4RQ5A 2WF7A 4JB3A 5KFEA 5KFJA 1ZQMA 4MFAA 5EE9A 1JRPA 2K60A 1NK9A 2J6TA 2BZFA 3F5EA 3MGIA 4KLEA 3AU6A 5FP0A 3PO4A 1JIHA 2HOQA 1M6YA 4JWNA 4M6WB 2HBMA 2W7OA 2KK0A 2FLPA 1PVQA 7ICRA 1KEJA 3EW9A 4FS1A 1SV4A 2K4HA 4C8NA 4JV1A 4KN4A 2BR0A 3BQ2A 1IM4A 2KE7A 2K89A 4AYBF 1SL1A 1IV8A 2IOFK 4Y2VA 4ECQA 2PFOA 7ICSA 2EANA 2WF8A 4M6WA 4ELUA 2H3VA 8ICWA 2R8JA 3PX0A 4U6PA 4QZGA 9ICOA 1F44A 4GXJA 5KFXA 2XGQA 5AKJA 1N2XA 2EH9A 4DL5A 2F1JA 2GLEA 2PFPA 4PGQA 2HHWA 4I2IA 3N97B 3RAXA 4F4WA 1DGSA 5AI0A 3UQ2A 1ZQLA 3N7RC 4OJOA 4P2HA 5JU5A 4U7CA 5L1JA 2OXOA 3V7LA 4KLIA 3RJKA 4R8UB 2Y0SF 4OJLA 4ICAA 2OHFA 2HHSA 3RH5A 1X9XA 5GTHU 2RLTA 4DSLA 3TAPA 1Q3UA 3HJEA 3SAGA 4GXIA 1RDFA 4R8UA 2AGPA 3GFKB 1V97A 4Y2TA 4DSEA 2ZUCA 2VA8A 4C4SA 4LVSA 2KNJA 1JMSA 4J9NA 3C5GA 1U49A 1N62A 2I6XA 4C8OA 5ALWA 2YTUA 4M9NA 3PX6A 3KD3A 1JN3A 5KFIA 2W04A 2KZMA 2BCRA 2PMZF 5ALPA 2ZIUB 3SAFA 4I28A 3H0RB 3QU7A 4BWJA 3M6KA 4YR2A 3LVWA 4F72A 4IQVA 3PO5A 2HI0A 3C1ZA 4KN7A 3OGUA 3LWLA 3M8SA 1QLNA 5KFFA 1NK4A 1U45A 2ZIUA 4YMOA 3ONNA 3JPTA 3C2MA 8ICMA 2PI5A 1ZQTA 1ZD3A 2CPRA 3BDPA 5HMMA 7ICQA 1RYRA 4ED3A 2BPCA 4PZOA 2ZXHA 1T8EA 1YZ7A 3QEAZ 2UVUA 2WTFA 2DKXA 3ALRA 3TFSA 4JV0A 3ISCA 2MU2A 8ICYA 2YX8A 1P7DA 3WU2U 4O9MA 1QTMA 5L1KA 4LZGA 1A76A 2G08A 4R63A 2R8HA 4F3OA 1ZQJA 4USAA 1KW4A 1S0VA 2MAXA 4UB5A 4YXJA 2JEJA 1WUDA 1LV5A 3V7JA 1SWWA 2J6SA 1RYSA 5ALIA 1S9FA 3C23A 5CR0A 4F2RA 2KIVA 4I29A 5TISU 8ICTA 4ZOHC 8ICAA 4DSKA 3WKAA 2B6GA 4Z6DA 4GLXA 3QU9A 4ECUA 3Q8KA 3L3FX 2JEGA 3EPIA 3F5AA 5J2JA 2BDPA 3PSTA 3RAQA 5HR6A 3E2EA 8ICVA 1ZQRA 1NOMA 2A3VA 2W7PA 3AN1A 4BDPA 3NRWA 5CEHA 1TVAA 3NVYA 2VIXA 4FO6A 1T3QA 2WB1C 2FLNA 2NRWA 3FM9A 3QEBZ 1Z19A 8ICFA 3C29A 4B6JA 2M9NA 1EXNA 2H5XA 2CRXA 4GIBA 1MQ3A 4BUGA 2NRTA 4M9LA 4YQWA 4MFFA 8ICXA 1ZQVA 3Q8LA 4KLFA 2KV2A 4DQIA 2WF6A 3ISBA 4LZDA 4DFMA 1RQLA 1BPYA 3N4MB 3M9NB 2YY6A 1NK0A 5H2FU 5AM2A 3M7DA 3PSFA 3WKCA 1TK5A 2YB1A 3R9KA 4ED0A 4ED1A 3PR5B
chains in the Genus database with same CATH topology
3OPXA 3T79A 4CRXA 2G06A 4P0QA 4PL2A 2JMGA 2JHDA 4KMOB 4QIWF 1IIPA 2XICA 5CRXA 4P0PB 2WB1F 3H0MB 2K8CB 3SAHA 2OYYA 2KD1A 2K4IA 2ZXIA 1PVRA 3F53A 1WUDA 2KICA 3KFUF 2CN1A 2MRLA 3AQFA 2OH2A 2E1EA 2KNJA 2E5SA 3K1ZA 1D8BA 2Q4TA 1MA7A 3F5EA 1Z1BA 4FE3A 3LVVA 5HR7A 2HOQA 2G5IB 3NUQA 1HIWA 3M6ZA 3HKZC 2N1RA 2ZIVA 2JGAA 2RHFA 2HBMA 3LYSA 2ZIXA 3CYMA 2K8AA 2H3IA 3E0FA 3IN5A 2W7OA 1PVQA 4P0PA 4KX3A 2KJ9A 2WAQF 1KBUA 2LHTA 2HBKA 2M0NA 4FZLA 2DQNB 4OJ6A 4CGZA 2R18A 2RP5A 2K4HA 2W04A 1URJA 5C0YA 2ZIXB 3KZXA 1XO0A 2DF4B 2PMZF 2HBJA 2K89A 2KVCA 4AYBF 2ZIUB 3C28A 3SAFA 3RF9A 3H0RB 3CRXA 2G07A 2KOBA 4NV0A 2K4EA 2BDUA 3L3FX 3N7SC 3M6KA 3PSIA 2F8LA 3LVWA 1Q3VA 4QJFB 2KHVA 3AL0B 2KJ5A 5T14A 2H3VA 2Y0SC 3F5AA 2XI9A 3N7PD 2G5HB 3CP8A 4U6PA 1XNSA 3SQIA 1ECWA 3PSTA 5HR6A 3GZFA 3ICXA 4JMUA 1DRGA 1F44A 4O3MA 1L6NA 2GOLA 3F2BA 1GO3F 1UPHA 4NLCA 2LYAA 1HEKA 4FZNA 2ZIUA 3MGVA 2W7PA 4OJPA 3ONNA 2A3VA 3NRWA 2JH1A 2KJ8A 4IC9A 5A0LA 2NV3A 2W03A 1NZBA 1CRXA 2RRDA 4OO1J 2VIXA 5KL8B 4QIWC 4NWIA 2LKYA 2XVTA 3HKZF 2WB1C 2GH1A 1TAMA 3D2SA 2HBLA 2OM6A 1PVPA 2HOIA 2D6FC 2ZIWB 2KEYA 2KKVA 1A0PA 2H3FA 3IG5A 3SMVA 2VJ4A 2HOFA 2VJ5A 3D2NA 1Z19A 2CPRA 3C29A 4KX5A 3N7RC 2LYBA 2DGZA 4OJOA 5KL1B 2H3QA 2K8BB 4CDGA 2CRXA 4BX9C 4WJ3B 3RFAA 4BUGA 2H3ZA 4C0ZA 4U7CA 2LBOA 4BJQA 2F77X 4ACOA 3PSPA 4GFJA 4PL1A 2ZXHA 3PZPA 1ZQ1C 2VKQA 2OXOA 3IG8A 2KV2A 2ZG6A 1T94A 4P0QB 1A6SA 2WAQC 2ZIWA 3ALRA 3AQEA 3F2CA 2Y0SF 2YB4A 3IP4B 4FZMA 4OJLA 2MA1A 2XIDA 4ICAA 2Z7JA 3D2QA 2KHQA 3GU3A 3DEEA 3VC8A 2G09A 3M7DA 3H0LB 3VCBA 4QNLA 1SZHA 2HMXA 2PMZC 2YX8A 1YT3A 2G0AA 3PSFA 2F76X 4NLBA 4AYBC 3F2DA 1OUQA 1P7DA 2KIWA 3O0FA 1ED1A 2YB1A 2F2AB 2KKPA 4OJ5A 1Q3UA 3SAGA 2G08A 2JH7A 2E1FA 4A8EA 2ZIVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPH A;  2JMG A;  2K4H A;  2LYA A;  1HEK A;  2K4I A;  4IC9 A;  2NV3 A;  1A6S A;  4ICA A;  1TAM A;  2K4E A;  2H3F A;  2HMX A;  2H3V A;  1HIW A;  1ED1 A;  2N1R A;  2LYB A;  1ECW A;  2H3Q A;  4JMU A;  2H3I A;  2H3Z A;  1L6N A;  2GOL A; 
#chains in the Genus database with same CATH topology
 4Z6E A;  2G06 A;  3KFU F;  2XIC A;  3SAH A;  2P66 A;  4KIT B;  4B9S A;  5DBC A;  2ZJA A;  2ASJ A;  2E1E A;  2E8M A;  1Z1B A;  3TAD A;  3SEI A;  2IA6 A;  5HP4 A;  4C8K A;  4QZI A;  8ICE A;  7ICU A;  1ZQO A;  4FBT A;  4KLQ A;  4QZ9 A;  3QUB A;  5KFR A;  3U26 A;  4I27 A;  4F2S A;  2FPK A;  3V6K A;  4MF8 A;  3KOO A;  5K4L A;  1ZQG A;  2A1J B;  2F1H A;  5ALL A;  5C0Y A;  2W54 A;  3MR3 A;  2F8L A;  3RB3 A;  2ZTD A;  4FFD A;  4UAR A;  3H4D A;  5KFG A;  5KFW A;  4UAU A;  4RNO A;  4KTQ A;  3ICX A;  2BCS A;  2VA2 A;  3ZDA A;  1SKR A;  4RNN A;  4J9O A;  3MGV A;  3GIL A;  2BPF A;  4YVZ A;  4IC9 A;  1FEZ A;  3PW0 A;  1MN8 A;  4O5E A;  2OM6 A;  5KFP A;  2ZIW B;  1IXR A;  4BGD A;  1A0P A;  4RUC A;  3KZI U;  4US9 A;  1ZQU A;  4YXM A;  5KFH A;  2R8I A;  4ED2 A;  4BX9 C;  1TK0 A;  2JV3 A;  1B0X A;  4Y2S A;  4UBC A;  3RJF A;  3OSP A;  3Q8M A;  5DG8 A;  2LPE A;  2ZIW A;  4CF5 A;  3F2C A;  1XSN A;  4DQQ A;  3ZDC A;  1RM6 C;  3H0L B;  3JPQ A;  2HCF A;  4NLB A;  1KN5 A;  3NS1 A;  5DG9 A;  4YMN A;  1VLB A;  1MQ2 A;  3MBY A;  4I2B A;  2KZ3 A;  4O3R A;  4BXO B;  3DV9 A;  4I2C A;  2C2R A;  2WB1 F;  2BGW A;  2DPJ A;  2FI1 A;  3F53 A;  2CN1 A;  3N28 A;  5J2H A;  4R64 A;  5KG7 A;  4DF4 A;  7ICO A;  3ZI4 A;  4YR0 A;  3HPO A;  4Q44 A;  1XC9 A;  4OD0 A;  4KLG A;  5ALF A;  2ZIX A;  3JPO A;  3E0F A;  3PMN A;  3G6Y A;  4IQU A;  4KLJ A;  2W3R A;  4EX6 A;  3TQ1 A;  9ICR A;  3T3F A;  4O3Q A;  4RPZ A;  3KHL A;  3KKA C;  2ISP A;  3QUQ A;  3N7P D;  4PGX A;  4JUZ A;  5J0X A;  4JMU A;  5AK6 A;  2P35 A;  5KFY A;  4TUR A;  1N5X A;  3K75 D;  1Z4N A;  2QB0 B;  4UW9 A;  4OO1 J;  1TAQ A;  1WYG A;  2LKY A;  4QZD A;  4C7Y A;  3V72 A;  4Y2P A;  7ICP A;  3KBB A;  5DB9 A;  5ALX A;  7ICF A;  5F9N A;  1ZRN A;  1SXD A;  4K4H A;  7ICN A;  5KFA A;  4RNM A;  5F9L A;  3RFA A;  2BCV A;  2QB0 A;  2IMW P;  3QZ8 A;  3Q8P B;  1CUK A;  3RJJ A;  2VKQ A;  2KG5 A;  3IG8 A;  5AI9 A;  3QUC A;  4IQW A;  2Y9T A;  3OHA A;  3A0B U;  3D2Q A;  4DEZ A;  3RH4 A;  5KT4 A;  1T7P A;  4RQM A;  5EWE A;  5D4B A;  4EZ9 A;  2F76 X;  3THV A;  2C22 A;  4KLL A;  3AUO A;  3H8S A;  2F1I A;  2GWS A;  5DDM A;  3MFI A;  2FMQ A;  1S0M A;  4F4X A;  2JMG A;  3H0M B;  2K8C B;  5KG0 A;  4F92 B;  5J0W A;  3LK9 A;  4JK1 A;  3C1Y A;  3M8R A;  4HAI A;  2E5S A;  2Q4T A;  1ARO P;  9ICK A;  5D49 A;  5L1I A;  4ECX A;  3OJS A;  2V9W A;  4M9G A;  1XS9 D;  1NJY A;  4FZL A;  1T3N A;  9ICB A;  2EAO A;  2B21 A;  4DFP A;  9ICX A;  3ZDE A;  4PPX A;  1X9S A;  1KFT A;  1Z00 B;  4ED8 A;  4ECY A;  1SV0 A;  4NL9 A;  4IRC A;  3E58 A;  3N7S C;  3FYH A;  4J03 A;  2FMS A;  5EOZ A;  2NYV A;  2BPG A;  2XY5 A;  1XNS A;  5DG7 A;  2JRZ A;  5BOM A;  3EUB 2;  1L3T A;  5KFM A;  4YR3 A;  4OJP A;  1DXS A;  1Z00 A;  1NKC A;  4NXZ A;  2BCQ A;  1CI4 A;  3HP6 A;  3L4P A;  4Y2Y A;  4EX7 A;  4F5N A;  3NAS A;  4QWC A;  2VJ5 A;  3H7I A;  1YZ6 A;  3RTV A;  4CF3 A;  5AM5 A;  4DS4 A;  4GC7 A;  2H3Q A;  3BS5 B;  7ICV A;  2YMM A;  2FMP A;  3DDH A;  1ZQ1 C;  5AKE A;  1XO1 A;  2MA1 A;  4O3P A;  4J9M A;  4NM2 A;  1SZH A;  4DL3 A;  1OUQ A;  2G0A A;  2KTQ A;  3WK9 A;  4RQN A;  1T4G A;  3BS5 A;  3SR6 A;  3TFR A;  1F5S A;  3PR4 A;  4C7Z A;  4M0A A;  1HUZ A;  2UVW A;  3TAN A;  2K4I A;  5AKG A;  4O5K A;  3RR7 A;  1UT5 A;  2V4Q A;  1RPL A;  3L5K A;  1NK8 A;  3MFH A;  5KFL A;  3C2K A;  3OHB A;  1X9W A;  2AXT U;  3UMC A;  5KFT A;  3M6Z A;  5L1L A;  9ICL A;  1B22 A;  1XU4 A;  3BZK A;  4QW8 A;  1Q46 A;  5J0S A;  4DLG A;  1Z1V A;  1HJP A;  2AH5 A;  1U9L A;  2YMP A;  1XO0 A;  3GIK A;  1QCK A;  3KTQ A;  2AU0 A;  5KG4 A;  1ZD5 A;  4PZN A;  4F5P A;  2KOB A;  5KFC A;  2G5H B;  1S5L U;  5AK4 A;  9ICI A;  5ALE A;  5KAF U;  3GZF A;  5KG2 A;  1SKS A;  4YD2 A;  9ICE A;  4I2G A;  3F2B A;  4ECR A;  4NLC A;  1N48 A;  5AIC A;  4IS7 A;  1QQ7 A;  2XY6 A;  1C7Y A;  5ALZ A;  1U4B A;  4JV2 A;  4QIW C;  3M9M B;  3GV5 B;  4DWI A;  2JR5 A;  1ZQI A;  5J2F A;  1ZET A;  3T5H A;  4UAY A;  2HSZ A;  3ZDD A;  1NK5 A;  1BPE A;  3GDX A;  1ZQK A;  3C2L A;  1QSS A;  9ICV A;  2HVH A;  2XCA A;  3PSP A;  5ALM A;  4NLZ A;  4EBD A;  1H38 A;  4C4R A;  8ICQ A;  1NKB A;  5CA7 A;  4QWA A;  1XSP A;  7ICH A;  5J0Q A;  2YB4 A;  5HHI A;  2JEI A;  5DB6 A;  2Z7J A;  3QNM A;  5KG1 A;  2HHU A;  2W3S A;  1ZQX A;  2C28 A;  4O3S A;  1YT3 A;  4UB3 A;  2ISO A;  4KLT A;  2KIW A;  1O08 A;  1D9D A;  5ALR A;  4NM1 A;  4CRX A;  1KKX A;  4DL2 A;  1FFV A;  2KVS A;  1X6I A;  4DSI A;  2WFA A;  5KT6 A;  2IHM A;  2OH2 A;  1J97 A;  1ZJM A;  4CNQ A;  5HR7 A;  3NUQ A;  2EZX A;  3BQ7 A;  3H8M A;  5KT7 A;  1FFU A;  2JGA A;  1WG8 A;  3SI8 A;  1QQ5 A;  2XY7 A;  2LM4 A;  3RR8 A;  4Q45 A;  5AKK A;  2AHO B;  3NGD A;  4NLG A;  1NKE A;  3ORY A;  5J2K A;  2PI4 A;  1C20 A;  3RJH A;  1NJW A;  4EEY A;  5G5H A;  4RT2 A;  1UA0 A;  2FLL A;  3PW2 A;  2E8P A;  5AI6 A;  1BPZ A;  3ETR A;  1FIQ A;  1ZQN A;  1SL0 A;  4QZ8 A;  1UA1 A;  4O5C A;  2MSN A;  4DOC A;  5ALO A;  4YCX A;  2RRD A;  1JUD A;  1Z3E B;  2FPM A;  5AKH A;  5ALJ A;  5G5G A;  2XVT A;  2E8N A;  4B9N A;  5KFV A;  1TE2 A;  5IIM A;  1PVP A;  4I2A A;  1TK8 A;  1V38 A;  1SL2 A;  3AU2 A;  5DLF A;  4QZB A;  4UQG A;  2PKE A;  1K1S A;  1XWL A;  1ZXI A;  3IRU A;  1VJ5 A;  4DS5 A;  2AJQ A;  4P4M A;  1RXV A;  1S0O A;  1ZQH A;  2BQ3 A;  5KFO A;  2ZG6 A;  4Y2Q A;  9ICT A;  1OW5 A;  4TUS A;  3PX4 A;  1KLN A;  8ICH A;  3DEE A;  1J2M A;  4Y2U A;  4QNL A;  2JEF A;  5J2B A;  3T5L A;  2LMR A;  5DQG A;  4QW9 A;  1L7O A;  2ZIV B;  1NI3 A;  4QIW F;  4KMO B;  1ZQY A;  4KMU A;  2VA3 A;  5J0T A;  2BKE A;  1L3U A;  4IRK A;  1DGJ A;  2MRL A;  4I2J A;  4IQT A;  1PUZ A;  2K4P A;  2D8C A;  3LVV A;  2ZIV A;  4IR9 A;  4X5V A;  2HBK A;  4OJ6 A;  5TZV A;  1ZYQ A;  3UQ0 A;  4YP3 A;  8ICO A;  5KNI A;  2R8K A;  4JWM A;  1ZQE A;  5J0R A;  5DBA A;  1ZQQ A;  1D8L A;  4EYH B;  4O3O A;  4GXK A;  4UB8 U;  2KJ5 A;  5ALG A;  3Q8R B;  4YMM A;  7ICT A;  3AMZ A;  3SQI A;  4G9B A;  3ETL A;  4J9R A;  3IDW A;  2DUY A;  3UMB A;  2GOL A;  1GO3 F;  1ZQC A;  5KFN A;  1UPH A;  1LB2 B;  9ICM A;  1SGG A;  3MC1 A;  4FZN A;  3QU2 A;  2KJ8 A;  4E0D A;  5HML A;  5DGA A;  7ICE A;  9ICS A;  3D6J A;  3PW7 A;  2HOI A;  2H3F A;  3K1R B;  1BPX A;  1OXJ A;  3PW5 A;  1JX4 A;  3ED5 A;  1KQQ A;  4DOA A;  4RQ7 A;  2Q0Z X;  4F4Y A;  4C0Z A;  3BJY A;  3SEN A;  5ALV A;  5J8Y C;  1V85 A;  3HIL A;  3JPS A;  3PW4 A;  4GC6 A;  2W9C B;  4RQ6 A;  4F5O A;  3IM1 A;  2XO7 A;  3C21 A;  1KL9 A;  3RJE A;  4DL6 A;  4QZA A;  4XQ8 A;  1D9F A;  4ECS A;  2F2A B;  3B0X A;  1KTQ A;  5DB7 A;  4I2H A;  2VAN A;  4CE6 A;  3SD7 A;  3BQ0 A;  4ECZ A;  3T79 A;  1U47 A;  5AM0 A;  4P0P B;  2W9C A;  2KFN A;  3QUT A;  1L3V A;  4OCZ A;  8ICU A;  2W9M A;  4C4T A;  4QZE A;  9ICN A;  2RQ5 A;  1D8B A;  2XGP A;  4RQ8 A;  3BQ1 A;  3UXN A;  4B9T A;  3CYM A;  2K8A A;  3NVZ A;  1B4F A;  4KLM A;  1PZN A;  2RDI A;  4P0P A;  3QZ7 A;  8ICR A;  4IRD A;  1DOQ A;  1BGX T;  1URJ A;  2ZIX B;  4I2E A;  3H8J A;  1TKD A;  1ZQS A;  4TUP A;  4NV0 A;  4DLE A;  5T14 A;  4RQ4 A;  5KFB A;  3QX7 A;  3RJG A;  1X66 A;  3GII A;  5CHG A;  3TAQ A;  4UAS A;  1QSL A;  3HT3 A;  8ICI A;  1Z4O A;  1L5U A;  4NLK A;  2DPI A;  4UB2 A;  3FC4 A;  3RBD A;  8ICK A;  2JH1 A;  1NZB A;  3BQT A;  4NWI A;  3QU4 A;  2ZTC A;  2KEY A;  3C5F A;  3QE9 Y;  3UPQ A;  2BHN A;  3A0H U;  1D8Y A;  2LYB A;  1ZQF A;  3Q8S B;  3QYP A;  1S0N A;  3WK8 A;  2H3Z A;  4F91 B;  2F77 X;  4GFJ A;  3IV6 A;  3K4G A;  5DLG A;  4Y2R A;  1L3S A;  2HVI A;  4Q8F A;  1T94 A;  1A6S A;  2WAQ C;  4K4I A;  3IP4 B;  3UXO A;  4P4P A;  8ICS A;  2IOF A;  1X40 A;  4M9J A;  5CP2 A;  2IOH A;  2AQ0 A;  2HMX A;  5CWR A;  3UM9 A;  4EBC A;  5AKY A;  3H4B A;  5KG3 A;  4F4K A;  1X42 A;  4RUA A;  5J2E A;  1PVR A;  2ESE A;  5AM3 A;  2C2E A;  2LYH A;  4NJ8 A;  1UQV A;  4M2Y A;  1ZQZ A;  3KHR A;  3NRZ A;  3SV3 A;  3WKB A;  2N1R A;  4J9K A;  3FDS A;  2MUT B;  3LWM A;  2QLT A;  4B9L A;  5AKL A;  1LKY B;  3ZD8 A;  5EWG A;  1MC8 A;  3NVW A;  4M47 A;  2E8O A;  4RQ1 A;  2HBJ A;  2KVC A;  4DFJ A;  3RF9 A;  2WF5 A;  2BDU A;  3PSI A;  5GTI U;  3G6V A;  1RYU A;  3NVV A;  1Q3V A;  2MUT A;  2ZTE A;  5J0Y A;  1LKY A;  5F3X B;  4O3M A;  5ALQ A;  2DFL A;  1WCN A;  1RZT A;  5A0L A;  3I76 A;  2JZB B;  5KL8 B;  1DK3 A;  4CF4 A;  1JXE A;  3I1Y A;  3I28 A;  5J0O A;  2F44 A;  3G6X A;  2VJ4 A;  3GIM A;  8ICP A;  1VDV A;  1ZD4 A;  3KKA A;  3TKA A;  2WHE A;  2YMQ A;  3HX0 A;  3EWA A;  5JTI A;  4ECT A;  5J0P A;  4PL1 A;  3PZP A;  2QAR B;  2JZB A;  4RPX A;  1BNO A;  2BQU A;  2RDJ A;  2O6K A;  5IIN A;  1X2I A;  2HDO A;  2ASL A;  3TAR A;  4P0Q B;  3AEV A;  1L7P A;  4DL7 A;  1TAU A;  3SV4 A;  1N61 A;  2YN4 A;  4ECW A;  3VC8 A;  4F71 A;  5AM4 A;  2LI6 A;  3PY8 A;  4ZH4 A;  5ALT A;  1ED1 A;  2QAR A;  4AP9 A;  4K4G A;  2E1F A;  2HHQ A;  4ED7 A;  3LYS A;  4P0Q A;  4PL2 A;  4B9U A;  2JHD A;  2LM1 A;  5ALU A;  3M9O B;  3AQF A;  4MEX A;  1X6J A;  1S77 D;  2FPL A;  7ICK A;  5AIA A;  2ZUD A;  3HRD D;  2I9G A;  2I1Q A;  2RHF A;  4MF2 A;  3TAC B;  2B0C A;  3RH6 A;  1L7M A;  2WAQ F;  1J2N A;  5B66 U;  2M0N A;  4CGZ A;  2R18 A;  5KT5 A;  2RP5 A;  2PXI A;  9ICP A;  2EAM A;  3WKD A;  5J2A A;  1RXW A;  5AKZ A;  1S97 A;  1TV9 A;  2IHN A;  2W8K A;  3PML A;  1QH9 A;  2L5Y A;  1A77 A;  3JPP A;  3T5K A;  1SKW A;  5KG5 A;  4I2F A;  2G07 A;  5KG6 A;  4HYK A;  3AL0 B;  9ICC A;  4J9P A;  3KHH A;  1B43 A;  5J2I A;  3RRH A;  4J9S A;  1ECW A;  1DRG A;  5DQH A;  2A19 A;  2J6U A;  4MEY A;  4DOB A;  1HEK A;  2NO5 A;  1ZRM A;  2NV3 A;  4QWD A;  3MR2 A;  1PK1 B;  4KLS A;  1AQ6 A;  1KRP A;  4M04 A;  1BPB A;  1UHU A;  3LDA A;  1JXL A;  3B0Y A;  1JI7 A;  2HOF A;  3D2N A;  1NZP A;  3CNH A;  2PFN A;  4CDG A;  4IR1 A;  2NRV A;  3H40 A;  4FBU A;  1PK1 A;  4PH5 A;  5KFD A;  4G3I A;  1NK6 A;  5J2G A;  5ALK A;  3GQC A;  3J81 j;  2UVV A;  4OJ5 A;  3ZD9 A;  2W8L A;  5J0U A;  4PJ0 U;  1K5O A;  4O0I A;  2ES6 A;  4YD1 A;  5CRX A;  3MGH A;  4MHV A;  1MSW D;  1S8O A;  2EQY A;  2KIC A;  3HW8 A;  9ICA A;  4YG2 A;  4MFC A;  4EBE A;  2W43 A;  3K1Z A;  1SWV A;  4B9M A;  4FE3 A;  3SYZ A;  4DFD A;  2FE9 A;  2XC9 A;  1IG6 A;  4US8 A;  5J2D A;  1UT8 A;  1HIW A;  2YQE A;  5KT2 A;  3HKZ C;  4DSJ A;  2P6R A;  4C8L A;  4C80 A;  5JRT A;  9ICJ A;  5ALD A;  3GV7 B;  2KMD A;  2LHT A;  7ICI A;  1N60 A;  3MR6 A;  4PHA A;  2KP7 A;  3C28 A;  5KT3 A;  1K1Q A;  2FJ6 A;  1N5W A;  2K4E A;  2ZJ5 A;  3RBE A;  4RQ3 A;  2XI9 A;  5J2C A;  3T5J A;  3CP8 A;  2IBK A;  3QXG A;  4UAZ A;  3BZC A;  3UMG A;  5ALH A;  2I5H A;  2AGO A;  5HNK A;  4F5Q A;  1X9M A;  2W03 A;  4ECV A;  9ICF A;  4EEL A;  1TAM A;  2HBL A;  4Q8E A;  2KKV A;  2EZY A;  4ELV A;  4UB1 A;  4DQR A;  2UVR A;  4PHP A;  1NJX A;  8ICJ A;  4J9L A;  2LBO A;  5III A;  4ED6 A;  1QSY A;  4RPY A;  4LJX A;  4QZF A;  3TAD C;  2D3D A;  3V7K A;  3AQE A;  5EWF A;  9ICW A;  7ICL A;  4EEK A;  4TUQ A;  2AGQ A;  4O3N A;  5AI8 A;  1KFS A;  4QZH A;  2P6U A;  2OWO A;  4A8E A;  3OPX A;  3KHG A;  2ZUB A;  1TFR A;  3CW2 C;  3GV8 B;  4F5R A;  1S10 A;  1Q8K A;  5L1M A;  4PGY A;  1BPD A;  3SZ2 A;  9ICG A;  3PVX A;  4EEN A;  4Z6C A;  1L7N A;  4DCC A;  4F93 B;  5BOL A;  2ATL A;  4KX3 A;  3OJU A;  2DBY A;  2DQN B;  5DBB A;  3BS7 A;  3PV8 A;  2V4R A;  5E79 U;  4F50 A;  8ICG A;  3CRX A;  1ZJN A;  2KZZ A;  4QWE A;  1KSP A;  5AK3 A;  2AQ4 A;  1RQN A;  2F3N A;  4IL6 U;  4RQ2 A;  1L6N A;  4DQP A;  1O03 A;  5CJ7 A;  5J29 A;  3WK4 A;  3RRG A;  5KFQ A;  2CXY A;  1CRX A;  4EYI B;  4DSF A;  1ZQD A;  4C8M A;  5ALN A;  3V6J A;  1QQ6 A;  3HKZ F;  3M1Y A;  3D2S A;  3IG5 A;  5IIJ A;  4R66 A;  2NO4 A;  1U48 A;  1ZOL A;  2W9A A;  3RB6 A;  5KFU A;  4KX5 A;  2W11 A;  4UAW A;  2K8B B;  4BJQ A;  1N56 A;  2DL0 A;  2NRX A;  1SIJ A;  4P4O A;  2ZJ8 A;  3JPN A;  7ICM A;  2DWQ A;  4CCH A;  4KLD A;  4DF8 A;  4RZR A;  2XID A;  2Y9U A;  5AI4 A;  3H8W A;  2G09 A;  2NRZ A;  1L8O A;  3WK5 A;  9ICQ A;  8ICL A;  2QKQ A;  3EYZ A;  5AI5 A;  1KDH A;  4YFK A;  3Q8Q B;  7ICG A;  3JPR A;  1IIP A;  2DKZ A;  4DFK A;  5IIO A;  2KFZ A;  1Y88 A;  2KD1 A;  2ZXI A;  4Q43 A;  4PHD A;  3IHQ B;  1ZQB A;  1WWU A;  4Y2J A;  2ALZ A;  5D46 A;  2Y1I A;  4QWB A;  3EPG A;  4DQS A;  2W9B B;  4QZC A;  2A1J A;  3OTQ A;  3IN5 A;  1BVS A;  2KJ9 A;  3TI0 A;  5KFZ A;  4PHE A;  2FDR A;  4Z6F A;  3KZX A;  5DKW A;  1WCL A;  4RT3 A;  2DF4 B;  3S6J A;  4I2D A;  5AKI A;  1HUO A;  2HHX A;  1LVH A;  3NTU A;  4UAT A;  3PNC A;  2W9B A;  2HHV A;  2KHV A;  4FS2 A;  1ZQP A;  4KLO A;  3QU5 A;  5EE3 A;  5EE1 A;  1SZP A;  5IIK A;  2C2D A;  2R8G A;  2YML A;  2BCU A;  4R65 A;  4UB4 A;  2LYA A;  5AM1 A;  3WKE A;  1NJZ A;  9ICH A;  4YN4 A;  4NLN A;  2OCE A;  2KSO B;  3ISD A;  1CEZ A;  5C5J A;  3EZ5 A;  3SMV A;  5DDY A;  3B9J A;  3WK7 A;  5CB1 A;  4EZ6 A;  2DGZ A;  4WJ3 B;  4M9H A;  4DL4 A;  3MR5 A;  1PK3 A;  4UBB A;  3ZDB A;  4ACO A;  3HWT A;  2KSO A;  1S76 D;  4FZM A;  1JRO A;  2KHQ A;  4B9V A;  4F8R A;  3VCB A;  4BXO A;  1SXE A;  4XA5 A;  4AYB C;  4J9Q A;  4UAV A;  3O0F A;  2PFQ A;  2KKP A;  5EE0 A;  1L8L A;  2JH7 A;  5BPC A;  2Y1J A;  5B5E U;  5KFS A;  2OYY A;  1BNP A;  1SV0 C;  4NL9 C;  3FAH A;  2ASD A;  3UXP A;  3RB0 A;  1ZQW A;  5J8Y A;  4RU9 A;  1MA7 A;  3AM9 A;  9ICU A;  2EZZ A;  2G5I B;  2QB1 A;  2KN7 A;  1F0M A;  3MDC A;  5KTQ A;  5KFK A;  3MAB A;  5L9X A;  2H3I A;  1KBU A;  4DO9 A;  2XCP A;  4BWM A;  1FO4 A;  1WWV A;  1N63 A;  1DK2 A;  1SB3 C;  1COK A;  4XUS A;  3V6H A;  1ZQA A;  4QJF B;  2Y0S C;  3RJI A;  1NNL A;  4KLH A;  8ICN A;  4UB6 U;  4RQ0 A;  4NY8 A;  1RG6 A;  5DGB A;  5AIB A;  5IIL A;  4F4Z A;  3OSN A;  5JUM A;  5DB8 A;  4TQS A;  1XSL A;  2GH1 A;  2D6F C;  2W55 A;  3RB4 A;  1KFD A;  1COO A;  5AK5 A;  2JXJ A;  8ICC A;  2OEH A;  8ICZ A;  2GO7 A;  5AHX A;  4KLU A;  5KL1 B;  2EAP A;  5KAI U;  5HHH A;  3MDA A;  2HHT A;  2BQR A;  4XRH A;  4ELT A;  8ICB A;  5DQI A;  4TQR A;  1JAL A;  5ALY A;  2HW3 A;  1V9P A;  3WK6 A;  5ALS A;  1NK7 A;  2F8K A;  2E3T A;  3GU3 A;  3GIJ A;  7ICJ A;  2A1A A;  2PMZ C;  1ZD2 P;  3F2D A;  2EDU A;  4Y2X A;  2ODG A;  1UCV A;  5AKX A;  2WF9 A;  4RQ5 A;  2WF7 A;  4JB3 A;  5KFE A;  5KFJ A;  1ZQM A;  4MFA A;  5EE9 A;  1JRP A;  2K60 A;  1NK9 A;  2J6T A;  2BZF A;  3F5E A;  3MGI A;  4KLE A;  3AU6 A;  5FP0 A;  3PO4 A;  1JIH A;  2HOQ A;  1M6Y A;  4JWN A;  4M6W B;  2HBM A;  2W7O A;  2KK0 A;  2FLP A;  1PVQ A;  7ICR A;  1KEJ A;  3EW9 A;  4FS1 A;  1SV4 A;  2K4H A;  4C8N A;  4JV1 A;  4KN4 A;  2BR0 A;  3BQ2 A;  1IM4 A;  2KE7 A;  2K89 A;  4AYB F;  1SL1 A;  1IV8 A;  2IOF K;  4Y2V A;  4ECQ A;  2PFO A;  7ICS A;  2EAN A;  2WF8 A;  4M6W A;  4ELU A;  2H3V A;  8ICW A;  2R8J A;  3PX0 A;  4U6P A;  4QZG A;  9ICO A;  1F44 A;  4GXJ A;  5KFX A;  2XGQ A;  5AKJ A;  1N2X A;  2EH9 A;  4DL5 A;  2F1J A;  2GLE A;  2PFP A;  4PGQ A;  2HHW A;  4I2I A;  3N97 B;  3RAX A;  4F4W A;  1DGS A;  5AI0 A;  3UQ2 A;  1ZQL A;  3N7R C;  4OJO A;  4P2H A;  5JU5 A;  4U7C A;  5L1J A;  2OXO A;  3V7L A;  4KLI A;  3RJK A;  4R8U B;  2Y0S F;  4OJL A;  4ICA A;  2OHF A;  2HHS A;  3RH5 A;  1X9X A;  5GTH U;  2RLT A;  4DSL A;  3TAP A;  1Q3U A;  3HJE A;  3SAG A;  4GXI A;  1RDF A;  4R8U A;  2AGP A;  3GFK B;  1V97 A;  4Y2T A;  4DSE A;  2ZUC A;  2VA8 A;  4C4S A;  4LVS A;  2KNJ A;  1JMS A;  4J9N A;  3C5G A;  1U49 A;  1N62 A;  2I6X A;  4C8O A;  5ALW A;  2YTU A;  4M9N A;  3PX6 A;  3KD3 A;  1JN3 A;  5KFI A;  2W04 A;  2KZM A;  2BCR A;  2PMZ F;  5ALP A;  2ZIU B;  3SAF A;  4I28 A;  3H0R B;  3QU7 A;  4BWJ A;  3M6K A;  4YR2 A;  3LVW A;  4F72 A;  4IQV A;  3PO5 A;  2HI0 A;  3C1Z A;  4KN7 A;  3OGU A;  3LWL A;  3M8S A;  1QLN A;  5KFF A;  1NK4 A;  1U45 A;  2ZIU A;  4YMO A;  3ONN A;  3JPT A;  3C2M A;  8ICM A;  2PI5 A;  1ZQT A;  1ZD3 A;  2CPR A;  3BDP A;  5HMM A;  7ICQ A;  1RYR A;  4ED3 A;  2BPC A;  4PZO A;  2ZXH A;  1T8E A;  1YZ7 A;  3QEA Z;  2UVU A;  2WTF A;  2DKX A;  3ALR A;  3TFS A;  4JV0 A;  3ISC A;  2MU2 A;  8ICY A;  2YX8 A;  1P7D A;  3WU2 U;  4O9M A;  1QTM A;  5L1K A;  4LZG A;  1A76 A;  2G08 A;  4R63 A;  2R8H A;  4F3O A;  1ZQJ A;  4USA A;  1KW4 A;  1S0V A;  2MAX A;  4UB5 A;  4YXJ A;  2JEJ A;  1WUD A;  1LV5 A;  3V7J A;  1SWW A;  2J6S A;  1RYS A;  5ALI A;  1S9F A;  3C23 A;  5CR0 A;  4F2R A;  2KIV A;  4I29 A;  5TIS U;  8ICT A;  4ZOH C;  8ICA A;  4DSK A;  3WKA A;  2B6G A;  4Z6D A;  4GLX A;  3QU9 A;  4ECU A;  3Q8K A;  3L3F X;  2JEG A;  3EPI A;  3F5A A;  5J2J A;  2BDP A;  3PST A;  3RAQ A;  5HR6 A;  3E2E A;  8ICV A;  1ZQR A;  1NOM A;  2A3V A;  2W7P A;  3AN1 A;  4BDP A;  3NRW A;  5CEH A;  1TVA A;  3NVY A;  2VIX A;  4FO6 A;  1T3Q A;  2WB1 C;  2FLN A;  2NRW A;  3FM9 A;  3QEB Z;  1Z19 A;  8ICF A;  3C29 A;  4B6J A;  2M9N A;  1EXN A;  2H5X A;  2CRX A;  4GIB A;  1MQ3 A;  4BUG A;  2NRT A;  4M9L A;  4YQW A;  4MFF A;  8ICX A;  1ZQV A;  3Q8L A;  4KLF A;  2KV2 A;  4DQI A;  2WF6 A;  3ISB A;  4LZD A;  4DFM A;  1RQL A;  1BPY A;  3N4M B;  3M9N B;  2YY6 A;  1NK0 A;  5H2F U;  5AM2 A;  3M7D A;  3PSF A;  3WKC A;  1TK5 A;  2YB1 A;  3R9K A;  4ED0 A;  4ED1 A;  3PR5 B; 
#chains in the Genus database with same CATH homology
 3OPX A;  3T79 A;  4CRX A;  2G06 A;  4P0Q A;  4PL2 A;  2JMG A;  2JHD A;  4KMO B;  4QIW F;  1IIP A;  2XIC A;  5CRX A;  4P0P B;  2WB1 F;  3H0M B;  2K8C B;  3SAH A;  2OYY A;  2KD1 A;  2K4I A;  2ZXI A;  1PVR A;  3F53 A;  1WUD A;  2KIC A;  3KFU F;  2CN1 A;  2MRL A;  3AQF A;  2OH2 A;  2E1E A;  2KNJ A;  2E5S A;  3K1Z A;  1D8B A;  2Q4T A;  1MA7 A;  3F5E A;  1Z1B A;  4FE3 A;  3LVV A;  5HR7 A;  2HOQ A;  2G5I B;  3NUQ A;  1HIW A;  3M6Z A;  3HKZ C;  2N1R A;  2ZIV A;  2JGA A;  2RHF A;  2HBM A;  3LYS A;  2ZIX A;  3CYM A;  2K8A A;  2H3I A;  3E0F A;  3IN5 A;  2W7O A;  1PVQ A;  4P0P A;  4KX3 A;  2KJ9 A;  2WAQ F;  1KBU A;  2LHT A;  2HBK A;  2M0N A;  4FZL A;  2DQN B;  4OJ6 A;  4CGZ A;  2R18 A;  2RP5 A;  2K4H A;  2W04 A;  1URJ A;  5C0Y A;  2ZIX B;  3KZX A;  1XO0 A;  2DF4 B;  2PMZ F;  2HBJ A;  2K89 A;  2KVC A;  4AYB F;  2ZIU B;  3C28 A;  3SAF A;  3RF9 A;  3H0R B;  3CRX A;  2G07 A;  2KOB A;  4NV0 A;  2K4E A;  2BDU A;  3L3F X;  3N7S C;  3M6K A;  3PSI A;  2F8L A;  3LVW A;  1Q3V A;  4QJF B;  2KHV A;  3AL0 B;  2KJ5 A;  5T14 A;  2H3V A;  2Y0S C;  3F5A A;  2XI9 A;  3N7P D;  2G5H B;  3CP8 A;  4U6P A;  1XNS A;  3SQI A;  1ECW A;  3PST A;  5HR6 A;  3GZF A;  3ICX A;  4JMU A;  1DRG A;  1F44 A;  4O3M A;  1L6N A;  2GOL A;  3F2B A;  1GO3 F;  1UPH A;  4NLC A;  2LYA A;  1HEK A;  4FZN A;  2ZIU A;  3MGV A;  2W7P A;  4OJP A;  3ONN A;  2A3V A;  3NRW A;  2JH1 A;  2KJ8 A;  4IC9 A;  5A0L A;  2NV3 A;  2W03 A;  1NZB A;  1CRX A;  2RRD A;  4OO1 J;  2VIX A;  5KL8 B;  4QIW C;  4NWI A;  2LKY A;  2XVT A;  3HKZ F;  2WB1 C;  2GH1 A;  1TAM A;  3D2S A;  2HBL A;  2OM6 A;  1PVP A;  2HOI A;  2D6F C;  2ZIW B;  2KEY A;  2KKV A;  1A0P A;  2H3F A;  3IG5 A;  3SMV A;  2VJ4 A;  2HOF A;  2VJ5 A;  3D2N A;  1Z19 A;  2CPR A;  3C29 A;  4KX5 A;  3N7R C;  2LYB A;  2DGZ A;  4OJO A;  5KL1 B;  2H3Q A;  2K8B B;  4CDG A;  2CRX A;  4BX9 C;  4WJ3 B;  3RFA A;  4BUG A;  2H3Z A;  4C0Z A;  4U7C A;  2LBO A;  4BJQ A;  2F77 X;  4ACO A;  3PSP A;  4GFJ A;  4PL1 A;  2ZXH A;  3PZP A;  1ZQ1 C;  2VKQ A;  2OXO A;  3IG8 A;  2KV2 A;  2ZG6 A;  1T94 A;  4P0Q B;  1A6S A;  2WAQ C;  2ZIW A;  3ALR A;  3AQE A;  3F2C A;  2Y0S F;  2YB4 A;  3IP4 B;  4FZM A;  4OJL A;  2MA1 A;  2XID A;  4ICA A;  2Z7J A;  3D2Q A;  2KHQ A;  3GU3 A;  3DEE A;  3VC8 A;  2G09 A;  3M7D A;  3H0L B;  3VCB A;  4QNL A;  1SZH A;  2HMX A;  2PMZ C;  2YX8 A;  1YT3 A;  2G0A A;  3PSF A;  2F76 X;  4NLB A;  4AYB C;  3F2D A;  1OUQ A;  1P7D A;  2KIW A;  3O0F A;  1ED1 A;  2YB1 A;  2F2A B;  2KKP A;  4OJ5 A;  1Q3U A;  3SAG A;  2G08 A;  2JH7 A;  2E1F A;  4A8E A;  2ZIV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...