2AXTU

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 27
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2axtU01
5B66U 3A0BU 5TISU 5KAIU 4PJ0U 3A0HU 2AXTU 4IL6U 4UB6U 4UB8U 3KZIU 2DUYA 5E79U 5GTIU 3WU2U 5B5EU 5KAFU 1S5LU 5H2FU 5GTHU
chains in the Genus database with same CATH superfamily
2ES6A 4LVSA 3M8SA 1TKDA 3HILA 3PSTA 2Q4TA 1JIHA 3IP4B 5KT4A 4QZBA 3PW2A 2ZTDA 4DFMA 5CP2A 1B0XA 3DDHA 5E79U 2HHUA 3PW5A 4ECTA 4QZDA 4UAYA 3NRZA 4F2SA 4EZ6A 9ICWA 2YB1A 5ALSA 5KT7A 4BWJA 2K60A 5KT3A 5AM4A 4TQSA 4NXZA 5J0TA 3Q8QB 3CNHA 4PZNA 3UMCA 3F2CA 2OXOA 5KG1A 4R63A 1S8OA 2R18A 1V97A 4QWEA 4ED8A 4IR1A 1NK6A 1N62A 3NRWA 3QYPA 2K8BB 4F4XA 3PW4A 4Q8EA 9ICCA 2IMWP 5BOLA 3D2SA 2ZJ5A 1SKSA 3E2EA 2D8CA 2IOHA 4I29A 5IIMA 2NRWA 1T94A 4PL2A 2KTQA 1ZQSA 1S9FA 2CXYA 2FPKA 4J9LA 4QWCA 2JRZA 1BNOA 8ICAA 4F92B 3H0LB 2IOFA 4UB6U 2XIDA 3KHHA 5EOZA 3RJEA 3ISCA 2Y0SF 1BPBA 2R8IA 1ZQBA 4I2FA 4J9OA 2J6UA 4FO6A 7ICJA 2JEGA 4DSLA 3RJGA 2Y9UA 4NLGA 2W43A 5EWEA 3MBYA 4DQQA 3EWAA 3N7RC 2R8KA 4KLQA 3M9NB 5KFZA 2JZBA 1IIPA 5KFLA 4J9SA 1UCVA 3PZPA 4F2RA 2W8LA 5AI4A 3N97B 8ICLA 2HHXA 4P4PA 3IM1A 3PX4A 5KFFA 3D6JA 2KEYA 8ICTA 1AROP 4Y2YA 3UXPA 4JWNA 3TANA 1QH9A 4RQ5A 4PHAA 2A1JB 9ICTA 2H3QA 1CI4A 2XY6A 4EENA 2HI0A 3QEAZ 3QU4A 2PFNA 1DK3A 4I28A 4DLGA 2YMQA 5KFJA 3KKAC 3SR6A 4UQGA 3KZIU 3ED5A 4YG2A 3C2LA 5ALNA 2Y9TA 4DQRA 4NL9A 2ZXHA 1O03A 4DQIA 3PSIA 1BPEA 3MR5A 3AL0B 2YY6A 3WK9A 5AKIA 4DO9A 3RRHA 3TKAA 2E8PA 3PNCA 1D9DA 4US8A 5DQIA 2LPEA 3CRXA 1COKA 4M9LA 4O3RA 5KL8B 4DQPA 4F5NA 1SZPA 4KLUA 3OTQA 4KN4A 3RB6A 2I5HA 2LYHA 4UAZA 5DLFA 2DGZA 3D2QA 1ZQUA 4QJFB 5ALVA 1KTQA 5CR0A 2BDUA 1ZQLA 2IBKA 3MDAA 3IG8A 2V4QA 2ESEA 4HYKA 2EZZA 4B9VA 4Y2XA 4QZEA 4PHPA 4M9HA 4C8NA 2WAQF 4G3IA 1ZQXA 5KFDA 4BWMA 1HEKA 7ICTA 5A0LA 1ZQVA 2MSNA 2XVTA 4FS1A 3MR6A 2MA1A 3B9JA 4BXOA 2JV3A 4WJ3B 4IRKA 3BQ1A 2AU0A 4AYBF 2AGQA 4CF3A 4G9BA 4B9SA 1JUDA 1C20A 3N7PD 3M8RA 2E5SA 2PMZF 9ICHA 2UVVA 2DPIA 8ICOA 4OJOA 2K4HA 2QB0A 2XGQA 5ALHA 7ICLA 1XWLA 2K89A 1X9MA 5AKYA 3SAFA 5J0UA 1ZQEA 3LYSA 3V7LA 3AUOA 4FS2A 1VDVA 2C28A 3EPGA 1NKBA 4F3OA 5DGBA 1J2MA 3PMLA 4ACOA 1JN3A 8ICQA 4F91B 4O3SA 1UT8A 1A77A 2P66A 2H3VA 7ICUA 1NOMA 4F5PA 3MR3A 4PGXA 4RPXA 4CGZA 4NL9C 2DUYA 7ICVA 3V72A 3KBBA 4EEYA 5ALRA 4UBBA 2E1EA 1SV0A 4KN7A 1WCNA 2MUTB 5HMMA 1U45A 4ECUA 4KLLA 2KV2A 4C4RA 2PXIA 3Q8LA 4NM2A 2B0CA 1ZQCA 1SWWA 3QUTA 4QIWC 1RXVA 5J0OA 2BPGA 3SAHA 1O08A 4F4ZA 3GILA 5CWRA 4QWAA 1M6YA 5G5HA 2W7PA 2KSOB 3MDCA 2F8KA 4J9MA 2KIVA 4DF4A 1X66A 3AQEA 2Y1JA 2ZIXA 4PGYA 3OGUA 2HBKA 2DKXA 2F44A 9ICIA 1L7PA 5KT6A 5B5EU 1NZBA 3B0XA 3SAGA 1XC9A 5ALXA 4ED3A 3C1ZA 5EE1A 4YXJA 2M9NA 4KX5A 4GXJA 3RJIA 2IHNA 4IQUA 4Y2PA 5J2EA 2BCUA 2DFLA 4C7YA 4TUSA 1NKEA 5AKEA 3U26A 3C21A 1KL9A 3UQ0A 2MUTA 5KFAA 3OSPA 1RQLA 4EX7A 3LWMA 3BQTA 3EUB2 1N5WA 5D46A 4P4OA 1FFVA 1XO0A 1NJZA 2KP7A 5J29A 3LK9A 4P0QB 4ED1A 3TACB 5L1MA 4RQNA 5KAIU 1XNSA 3QU7A 8ICWA 3SMVA 1ZQFA 1T7PA 1ZETA 1KSPA 3RH6A 2W9CA 9ICOA 2ZIUB 3FC4A 3NVZA 4EYHB 4UAVA 3N4MB 2W9BA 4UB5A 9ICUA 4P0QA 2YN4A 4KLGA 2G06A 4OJLA 4FZNA 4B9UA 4ECVA 1Z00A 1ZQPA 3JPOA 4Y2QA 2KZMA 2HVHA 2KFZA 2L5YA 9ICVA 1JMSA 4ED7A 4EBEA 4RQMA 5ALMA 1SV0C 5D49A 4QZHA 1ZQ1C 2ZIWB 3NVVA 1HUOA 3M9OB 4Y2SA 1MA7A 1S97A 5DB6A 5CA7A 4RNNA 1ED1A 4PH5A 2G5HB 3IG5A 4QZAA 4X5VA 4NM1A 4K4HA 1KN5A 4FZMA 1KFSA 4I2HA 2GO7A 2I1QA 1T3NA 3C5FA 5C5JA 4EEKA 5AM3A 2DWQA 3FM9A 3C28A 4O9MA 2W7OA 2FJ6A 5J2IA 2W3SA 3MGIA 2BQ3A 1SL1A 2XGPA 1KDHA 2E8OA 5KFTA 4Y2UA 2KMDA 7ICRA 1D9FA 5D4BA 1MC8A 1IM4A 2CPRA 4Q43A 2WF5A 1COOA 2F76X 3Q8PB 2WTFA 1Z19A 2WF9A 4J03A 4QNLA 4DL3A 4ELTA 2AHOB 4JUZA 2PMZC 5KFXA 2HVIA 4Z6EA 3RF9A 2OM6A 2KICA 3OJSA 4TQRA 1RXWA 1ZXIA 4UBCA 4OJ6A 2D3DA 4QIWF 2Q0ZX 8ICBA 1B43A 3L4PA 1GO3F 1A0PA 3C1YA 1S0MA 2F1JA 4JV1A 1JALA 3BZCA 3BDPA 4O3MA 5BPCA 1U9LA 1BPXA 3H8JA 3H8WA 3BQ0A 4ED0A 4RQ7A 3UM9A 1KFDA 5J0PA 5KFWA 2JEFA 2ZUBA 5TZVA 4MHVA 8ICYA 2XY7A 1ZOLA 5HHIA 3MGHA 4C8MA 5KFCA 2BZFA 4Z6DA 4IL6U 3KHLA 2PI4A 2HCFA 4F5QA 3MABA 4O5KA 5KFKA 2EAPA 2ASJA 1XS9D 1N61A 4GXKA 5ALZA 3MGVA 2K4PA 1NK8A 3F2DA 3RH5A 4I2CA 1J97A 4CE6A 4KLHA 4FFDA 3D2NA 9ICSA 2NRZA 5HMLA 5K4LA 4F71A 1MSWD 9ICMA 3NASA 2ATLA 3KFUF 2JEIA 3QU9A 1RM6C 3ALRA 4UASA 2R8JA 1U4BA 2PKEA 2P6RA 3OSNA 4XQ8A 2F3NA 7ICMA 3VC8A 1ECWA 3GIKA 1FFUA 3RBDA 2KFNA 1P7DA 4AP9A 5ALYA 4DL7A 1SB3C 3C2MA 1ZQZA 3CYMA 1S0VA 3GQCA 1L7MA 1ZQIA 3BJYA 4HAIA 3Q8SB 1QLNA 4IQTA 1CEZA 1Z1VA 1IG6A 3RR7A 1JI7A 4OCZA 2BQUA 4F50A 2KKPA 3MC1A 4C80A 3T5JA 4F4KA 4DWIA 2A1JA 1NI3A 3QXGA 1ZQGA 1XSPA 3HP6A 3EYZA 2KVSA 2A1AA 5ALIA 3PMNA 1ZQRA 2G0AA 2D6FC 2F77X 1C7YA 4KTQA 4DL2A 2BCQA 4DLEA 4UATA 1V38A 4IQVA 1IV8A 1NNLA 5AKKA 5AKXA 1N63A 2N1RA 5KNIA 4QW9A 3UMGA 2ASLA 1KRPA 4KLDA 1NK9A 4NLZA 2BCRA 1QSSA 1PVRA 8ICSA 5J2BA 1XO1A 3H8MA 4QZIA 2YTUA 5J0XA 3V6HA 5DB7A 4EBDA 1QQ6A 1A6SA 1Z00B 3ORYA 2EH9A 4Z6FA 1NJWA 3SQIA 3WKAA 2OH2A 2P35A 5HNKA 4BDPA 2QLTA 2VIXA 1BGXT 5AIAA 1OW5A 2JEJA 3ICXA 5J0YA 3KHGA 2V9WA 2HBJA 5AK4A 4P4MA 3T3FA 1MQ3A 2ZUCA 5KFMA 8ICHA 3BS5A 3ZDEA 4GIBA 3RFAA 2W9CB 5ALWA 5ALLA 3CW2C 4DSJA 1CUKA 2K8CB 5CB1A 8ICJA 5EWGA 3IDWA 3E58A 4C7ZA 4IRDA 2ZUDA 1UQVA 4C4TA 5KFEA 1HUZA 5AKGA 2G07A 2DPJA 2RLTA 5ALKA 2HBMA 4ECXA 2RP5A 1ZQAA 3BZKA 3Q8KA 2EDUA 3WK8A 5DBBA 3F2BA 1D8YA 4ECYA 1X9SA 4QZ8A 3C23A 4EELA 4GXIA 3KHRA 1JXEA 1K1QA 1UPHA 5DB8A 4RNOA 3JPPA 4I2AA 1ZQQA 5KG0A 3I28A 5AI8A 1L8LA 4DS5A 2KN7A 2O6KA 2JZBB 1Y88A 4QZ9A 1FIQA 1IXRA 1F5SA 3QZ8A 5ALQA 4ED2A 4UB8U 2W9BB 3H7IA 2ZTEA 4U7CA 4EYIB 2UVUA 4NLBA 5KT2A 4Y2TA 2LYAA 1EXNA 4CNQA 4RUCA 4RQ2A 5GTHU 2CN1A 3BQ2A 3RB4A 3KKAA 3MFHA 1NKCA 2V4RA 4DSIA 3M6ZA 3KTQA 2YMPA 4Y2JA 2KOBA 4GFJA 5DBAA 3ZD9A 3SYZA 4YD2A 3FYHA 2QARB 2YB4A 4XRHA 2BPCA 5L9XA 2OHFA 4PZOA 5L1IA 1UA0A 3GZFA 4USAA 2DF4B 1OXJA 4YMNA 5KFIA 3RTVA 4RT3A 4Y2VA 3SI8A 3QX7A 5H2FU 1T4GA 8ICEA 5IIOA 2WF7A 3QU2A 2WB1F 4YCXA 2WF6A 2HHTA 2KHVA 3HT3A 4RPYA 2BR0A 5KFNA 2LI6A 2DQNB 4FBTA 1L3SA 3PO4A 3OPXA 2KKVA 7ICGA 4KMUA 2ZXIA 1SV4A 3GIJA 4DOCA 1TAMA 7ICFA 5J0SA 3RRGA 5ALDA 2VA3A 5KG6A 1HJPA 2FMQA 2G09A 1L3UA 1ZD3A 1YZ6A 4C8KA 2FLNA 3Q8MA 1A76A 1H38A 3WK5A 5AK5A 3E0FA 4MEYA 4CCHA 3SD7A 2KIWA 3WK7A 4YR0A 4DSFA 1WWUA 4O5CA 4I2IA 1WWVA 4KLMA 1Z4OA 8ICXA 5JTIA 1LKYB 1U47A 1ZQYA 3PVXA 1N56A 3PO5A 2KSOA 2MRLA 2KD1A 2OCEA 2WB1C 1AQ6A 3CP8A 3H4DA 4JWMA 2AQ0A 4ECWA 1V85A 3V7JA 3TAPA 3G6XA 2C22A 2F1IA 3I1YA 1X42A 3IN5A 1DK2A 5DDYA 3I76A 4UB4A 1ZQJA 4C8LA 2HW3A 1FO4A 5KFBA 2KHQA 4NV0A 4BX9C 5TISU 2ASDA 4FE3A 3K1ZA 3LVWA 2WAQC 3PX0A 1D8BA 4GLXA 1CRXA 2EAMA 5ALGA 5ALPA 5J2HA 1NJXA 3HX0A 1XSLA 4FBUA 5IILA 4M6WA 1RYRA 3H4BA 2YMMA 5DLGA 5F9LA 3A0HU 3V7KA 5J0QA 3LWLA 1TAQA 5DQGA 1ZQOA 3SV4A 2IHMA 2ZIWA 4KLSA 1SKWA 4IS7A 3GU3A 2PFOA 4JMUA 4J9KA 5F9NA 3ONNA 4MF8A 9ICRA 1KKXA 2FLLA 1PUZA 5FP0A 4PPXA 5AIBA 2ISPA 2K4IA 2GH1A 4KLFA 4MFCA 2JMGA 4CF4A 4NLCA 2XCPA 4RT2A 2XCAA 5DQHA 4U6PA 1NJYA 4US9A 4EZ9A 3HRDD 4R65A 3AMZA 1JX4A 2Y0SC 4O3NA 4XUSA 1KFTA 1YZ7A 1J2NA 3ISDA 4P0PA 2LM1A 2HHQA 3NUQA 1ZJMA 2ZIXB 1VLBA 3WKCA 2HHSA 4M2YA 4IRCA 1X2IA 5JUMA 4R66A 3F53A 4R8UA 2VA8A 5KL1B 5T14A 4B9NA 2K4EA 2VJ5A 4Q44A 3ZD8A 3OHAA 4P0PB 1SWVA 5KFHA 3Q8RB 7ICOA 4O0IA 2W55A 4J9QA 4ZOHC 2J6SA 2JGAA 3PY8A 1L3TA 1PZNA 1F44A 4M9GA 5AKJA 4NY8A 3SENA 3QU5A 3ETRA 4M0AA 5DKWA 2W03A 2XC9A 2I9GA 3FDSA 3F5EA 1PVQA 2BCSA 2R8HA 2HHVA 1SGGA 3JPRA 4JK1A 5EE9A 4ECSA 4KLEA 1TVAA 4RQ3A 3ZDAA 4ECRA 3RB3A 4DF8A 3RAXA 2F2AB 3UMBA 4J9PA 4J9RA 5B66U 4RZRA 1DRGA 2ODGA 5ALTA 5J2KA 4LJXA 2ZTCA 9ICLA 1Z3EB 2G08A 4BUGA 1TFRA 4ICAA 2HHWA 2E8MA 5BOMA 2A3VA 4DL6A 1HIWA 2FPMA 1KW4A 3RAQA 3GIIA 2NRVA 4B9TA 3NTUA 3GV8B 1BPZA 5ALJA 4CF5A 1X9XA 5ALEA 4YXMA 1SZHA 4QW8A 1XU4A 4TUPA 4DCCA 1BVSA 2AXTU 5KFPA 2JXJA 1TK0A 5AK6A 2NO5A 4ED6A 1NK5A 4B9LA 3QUCA 2LYBA 1XSNA 2EZYA 9ICPA 2YMLA 5J2JA 4YP3A 1JRPA 3M1YA 4M04A 4FZLA 1YT3A 2BQRA 3ZDBA 4KITB 1L7NA 4PHDA 2BHNA 2QARA 2RHFA 2VANA 1RG6A 5DBCA 3EPIA 1TK5A 4IC9A 4MFFA 2Z7JA 3DV9A 2KZZA 3LDAA 2GWSA 3EZ5A 5CJ7A 2WHEA 3QNMA 1K5OA 1DGJA 2ZIVB 2YX8A 4BJQA 2XO7A 3M9MB 3HJEA 4OJPA 9ICJA 5L1JA 1ZD5A 1RYUA 5EWFA 3RBEA 2KK0A 3RJJA 4ECZA 3T5HA 3PW7A 8ICFA 3IRUA 5AICA 3TAQA 2PI5A 4Q8FA 4KX3A 2J6TA 5KG2A 3K4GA 4DSKA 2FI1A 8ICVA 2KE7A 2M0NA 4PL1A 5IIIA 1JROA 3RJFA 2NRXA 3QUQA 2C2DA 1QSYA 3EW9A 4ECQA 3ZDDA 2KVCA 2RDIA 4DFJA 5F3XB 3N28A 2Y1IA 4P2HA 3NGDA 4JV0A 1SL2A 3MFIA 3KD3A 1S5LU 1MQ2A 4LZDA 2AGOA 2MAXA 5AM2A 1S10A 5L1KA 3L5KA 3KZXA 5AI9A 5L1LA 8ICCA 4C0ZA 2OYYA 5HR6A 2W9AA 3IV6A 3H40A 3WU2U 4LZGA 5KG5A 4E0DA 2OWOA 1B4FA 4EBCA 5KFQA 2W04A 3M6KA 4JV2A 2AGPA 1ZQMA 2FMPA 3C29A 5KFUA 5AKZA 2B21A 2HMXA 4PJ0U 4F5OA 5JRTA 4YVZA 2RQ5A 5KG4A 2BCVA 2H3FA 4UB3A 5CHGA 4MFAA 3SEIA 2OEHA 1L7OA 1D8LA 3F5AA 8ICGA 4DL4A 1TV9A 2NV3A 5KFVA 4ZH4A 3NVWA 2ALZA 4YMMA 4R64A 4O5EA 3SZ2A 1UT5A 2AH5A 2ZJ8A 4M6WB 2GLEA 1ZQKA 3UQ2A 8ICZA 1BPDA 3AQFA 3WK6A 4IQWA 5AKHA 3FAHA 4JB3A 4TURA 5DG7A 2FDRA 4I2BA 3AN1A 3BQ7A 1DXSA 4O3QA 7ICSA 5C0YA 5IIKA 1K1SA 4M9JA 4RNMA 1NZPA 1SXEA 3JPSA 3V6KA 3HPOA 2UVWA 2VKQA 5J0RA 5ALUA 3WKEA 1SIJA 4KLIA 5DDMA 2RRDA 3VCBA 4EX6A 1ZD2P 3BS7A 3NVYA 3M7DA 4Y2RA 2BPFA 3ZI4A 1NK7A 4K4GA 4DS4A 4DL5A 2HDOA 4NLKA 3THVA 1ZRNA 5KG3A 5J8YA 1ZQTA 4MF2A 3JPNA 1ZYQA 4B6JA 5KT5A 2ISOA 4RQ0A 3PSFA 5KFSA 4RQ4A 4UB2A 1S0NA 5AK3A 4F5RA 4I2EA 4Q45A 1KBUA 2YQEA 4YD1A 1PVPA 4ELUA 1FEZA 2KZ3A 3UPQA 5HR7A 3C2KA 7ICIA 1B22A 5DG9A 2H3IA 4DOAA 4C8OA 7ICQA 5J2DA 3H0RB 2K8AA 1NK4A 3TI0A 2NRTA 5KFOA 1RYSA 5ALFA 2E8NA 3G6YA 4I2JA 4KLJA 3NS1A 4RQ1A 3KOOA 4B9MA 1ZQDA 4Z6CA 5CEHA 2C2EA 1Q8KA 3GDXA 4ELVA 1S0OA 1WUDA 3QUBA 5DG8A 5J2GA 1LB2B 1LV5A 2W11A 2W3RA 3LVVA 2H3ZA 2E3TA 2IOFK 1RPLA 4BGDA 3TFRA 2QKQA 3AU6A 3TFSA 8ICNA 5G5GA 3J81j 1T3QA 2EZXA 4QZCA 4QWDA 4I27A 3R9KA 4QZFA 2XICA 1TAUA 1ZRMA 9ICBA 5GTIU 1U49A 2A19A 2FPLA 2ZIUA 1RDFA 2W8KA 2ZIVA 8ICPA 5KFYA 1MN8A 1SL0A 5J2CA 1F0MA 4UARA 1Z4NA 3DEEA 1JXLA 4NWIA 5J8YC 1QQ7A 4CDGA 3TARA 3JPQA 5DGAA 1PK1A 4R8UB 3ZDCA 2VJ4A 5ALOA 2G5IB 3BS5B 2EANA 1L3VA 3H0MB 2NO4A 4F93B 3S6JA 5HP4A 4TUQA 4YR2A 3QE9Y 4NLNA 2KG5A 2KJ5A 2DL0A 3QZ7A 1ZJNA 4F4WA 3K75D 2CRXA 5KTQA 8ICUA 1PK1B 5AM1A 2H5XA 7ICKA 1TK8A 1QSLA 2WF8A 1RZTA 2R8GA 1KEJA 4YMOA 4MEXA 1BNPA 1DOQA 3B0YA 2HOFA 1X6IA 2HBLA 1SXDA 1LVHA 5EE0A 5AI5A 4F8RA 1WCLA 2EQYA 3OHBA 2KNJA 4NJ8A 5AM0A 2KJ9A 3GFKB 3V6JA 3ETLA 5AI6A 4UW9A 4KLTA 1OUQA 2LMRA 2AQ4A 4RPZA 3TADC 1X40A 2FE9A 1QCKA 3C5GA 1ZQNA 4O3PA 1BPYA 2W54A 2JR5A 9ICQA 1T8EA 1S76D 5J0WA 8ICIA 2BGWA 4M9NA 2ZG6A 4XA5A 4DQSA 1N48A 2NYVA 3HKZC 2PFPA 4UAWA 4RQ6A 4UB1A 4DFPA 4YQWA 4CRXA 4DEZA 1Q3VA 1UA1A 2BDPA 1V9PA 1KQQA 5JU5A 3HW8A 1QQ5A 3JPTA 2HOIA 2AJQA 2HSZA 3WKBA 4A8EA 5IINA 1RQNA 2KJ8A 4IR9A 8ICRA 4YFKA 4PHEA 4GC6A 3L3FX 3PSPA 5AM5A 4F72A 4DFDA 5KFRA 5KG7A 1DGSA 2MU2A 1ZD4A 3IHQB 3UXNA 3O0FA 3GIMA 3K1RB 4RQ8A 9ICKA 1NK0A 7ICPA 2GOLA 1ZQHA 4F4YA 4OO1J 3PV8A 3HWTA 4GC7A 2LBOA 1ZQWA 1Q3UA 5KAFU 9ICEA 4RUAA 2WFAA 1L8OA 2VA2A 1N60A 2QB1A 3WK4A 2IA6A 5AHXA 3WKDA 3RJKA 4UAUA 3AU2A 3N7SC 2JH1A 4I2DA 4OD0A 2RDJA 2DBYA 3UXOA 3PR4A 2LKYA 1PK3A 5DB9A 4BXOB 4YN4A 1Z1BA 7ICHA 3TADA 1URJA 2ZJAA 4M47A 5HHHA 3GV5B 3SV3A 2C2RA 4YR3A 1X9WA 9ICFA 4J9NA 3RH4A 5CRXA 3GV7B 1KLNA 5EE3A 3G6VA 2FLPA 7ICNA 2XY5A 1WYGA 2PFQA 4C4SA 1LKYA 5IIJA 2P6UA 2JH7A 8ICKA 4AYBC 4KMOB 4DFKA 3T79A 2UVRA 9ICGA 3AEVA 1L6NA 3T5KA 1X6JA 8ICMA 1QTMA 2F8LA 1UHUA 2I6XA 2XI9A 9ICXA 3PW0A 5KFGA 1Q46A 3AM9A 2FMSA 3ISBA 2F1HA 4DSEA 2B6GA 3TQ1A 3HKZF 3QEBZ 3A0BU 3RJHA 2EAOA 7ICEA 3RR8A 2DKZA 9ICNA 1U48A 1SKRA 2BKEA 4PGQA 1N5XA 1VJ5A 2JHDA 3RB0A 2LM4A 3PX6A 2QB0B 4RU9A 1N2XA 3H8SA 5AKLA 4O3OA 5J2FA 4KLOA 4I2GA 9ICAA 2LHTA 5AI0A 3PR5B 1TE2A 2E1FA 3MR2A 4K4IA 3OJUA 4OJ5A 3T5LA 2W9MA 1S77D 4QWBA 1WG8A 5J2AA 4DOBA 1L5UA 4QZGA 2HOQA
chains in the Genus database with same CATH topology
5B66U 3A0BU 5TISU 5KAIU 4PJ0U 3A0HU 2AXTU 4IL6U 4UB6U 4UB8U 3KZIU 2DUYA 5E79U 5GTIU 3WU2U 5B5EU 5KAFU 1S5LU 5H2FU 5GTHU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 U;  3A0B U;  5TIS U;  5KAI U;  4PJ0 U;  3A0H U;  2AXT U;  4IL6 U;  4UB6 U;  4UB8 U;  3KZI U;  2DUY A;  5E79 U;  5GTI U;  3WU2 U;  5B5E U;  5KAF U;  1S5L U;  5H2F U;  5GTH U; 
#chains in the Genus database with same CATH topology
 2ES6 A;  4LVS A;  3M8S A;  1TKD A;  3HIL A;  3PST A;  2Q4T A;  1JIH A;  3IP4 B;  5KT4 A;  4QZB A;  3PW2 A;  2ZTD A;  4DFM A;  5CP2 A;  1B0X A;  3DDH A;  5E79 U;  2HHU A;  3PW5 A;  4ECT A;  4QZD A;  4UAY A;  3NRZ A;  4F2S A;  4EZ6 A;  9ICW A;  2YB1 A;  5ALS A;  5KT7 A;  4BWJ A;  2K60 A;  5KT3 A;  5AM4 A;  4TQS A;  4NXZ A;  5J0T A;  3Q8Q B;  3CNH A;  4PZN A;  3UMC A;  3F2C A;  2OXO A;  5KG1 A;  4R63 A;  1S8O A;  2R18 A;  1V97 A;  4QWE A;  4ED8 A;  4IR1 A;  1NK6 A;  1N62 A;  3NRW A;  3QYP A;  2K8B B;  4F4X A;  3PW4 A;  4Q8E A;  9ICC A;  2IMW P;  5BOL A;  3D2S A;  2ZJ5 A;  1SKS A;  3E2E A;  2D8C A;  2IOH A;  4I29 A;  5IIM A;  2NRW A;  1T94 A;  4PL2 A;  2KTQ A;  1ZQS A;  1S9F A;  2CXY A;  2FPK A;  4J9L A;  4QWC A;  2JRZ A;  1BNO A;  8ICA A;  4F92 B;  3H0L B;  2IOF A;  4UB6 U;  2XID A;  3KHH A;  5EOZ A;  3RJE A;  3ISC A;  2Y0S F;  1BPB A;  2R8I A;  1ZQB A;  4I2F A;  4J9O A;  2J6U A;  4FO6 A;  7ICJ A;  2JEG A;  4DSL A;  3RJG A;  2Y9U A;  4NLG A;  2W43 A;  5EWE A;  3MBY A;  4DQQ A;  3EWA A;  3N7R C;  2R8K A;  4KLQ A;  3M9N B;  5KFZ A;  2JZB A;  1IIP A;  5KFL A;  4J9S A;  1UCV A;  3PZP A;  4F2R A;  2W8L A;  5AI4 A;  3N97 B;  8ICL A;  2HHX A;  4P4P A;  3IM1 A;  3PX4 A;  5KFF A;  3D6J A;  2KEY A;  8ICT A;  1ARO P;  4Y2Y A;  3UXP A;  4JWN A;  3TAN A;  1QH9 A;  4RQ5 A;  4PHA A;  2A1J B;  9ICT A;  2H3Q A;  1CI4 A;  2XY6 A;  4EEN A;  2HI0 A;  3QEA Z;  3QU4 A;  2PFN A;  1DK3 A;  4I28 A;  4DLG A;  2YMQ A;  5KFJ A;  3KKA C;  3SR6 A;  4UQG A;  3KZI U;  3ED5 A;  4YG2 A;  3C2L A;  5ALN A;  2Y9T A;  4DQR A;  4NL9 A;  2ZXH A;  1O03 A;  4DQI A;  3PSI A;  1BPE A;  3MR5 A;  3AL0 B;  2YY6 A;  3WK9 A;  5AKI A;  4DO9 A;  3RRH A;  3TKA A;  2E8P A;  3PNC A;  1D9D A;  4US8 A;  5DQI A;  2LPE A;  3CRX A;  1COK A;  4M9L A;  4O3R A;  5KL8 B;  4DQP A;  4F5N A;  1SZP A;  4KLU A;  3OTQ A;  4KN4 A;  3RB6 A;  2I5H A;  2LYH A;  4UAZ A;  5DLF A;  2DGZ A;  3D2Q A;  1ZQU A;  4QJF B;  5ALV A;  1KTQ A;  5CR0 A;  2BDU A;  1ZQL A;  2IBK A;  3MDA A;  3IG8 A;  2V4Q A;  2ESE A;  4HYK A;  2EZZ A;  4B9V A;  4Y2X A;  4QZE A;  4PHP A;  4M9H A;  4C8N A;  2WAQ F;  4G3I A;  1ZQX A;  5KFD A;  4BWM A;  1HEK A;  7ICT A;  5A0L A;  1ZQV A;  2MSN A;  2XVT A;  4FS1 A;  3MR6 A;  2MA1 A;  3B9J A;  4BXO A;  2JV3 A;  4WJ3 B;  4IRK A;  3BQ1 A;  2AU0 A;  4AYB F;  2AGQ A;  4CF3 A;  4G9B A;  4B9S A;  1JUD A;  1C20 A;  3N7P D;  3M8R A;  2E5S A;  2PMZ F;  9ICH A;  2UVV A;  2DPI A;  8ICO A;  4OJO A;  2K4H A;  2QB0 A;  2XGQ A;  5ALH A;  7ICL A;  1XWL A;  2K89 A;  1X9M A;  5AKY A;  3SAF A;  5J0U A;  1ZQE A;  3LYS A;  3V7L A;  3AUO A;  4FS2 A;  1VDV A;  2C28 A;  3EPG A;  1NKB A;  4F3O A;  5DGB A;  1J2M A;  3PML A;  4ACO A;  1JN3 A;  8ICQ A;  4F91 B;  4O3S A;  1UT8 A;  1A77 A;  2P66 A;  2H3V A;  7ICU A;  1NOM A;  4F5P A;  3MR3 A;  4PGX A;  4RPX A;  4CGZ A;  4NL9 C;  2DUY A;  7ICV A;  3V72 A;  3KBB A;  4EEY A;  5ALR A;  4UBB A;  2E1E A;  1SV0 A;  4KN7 A;  1WCN A;  2MUT B;  5HMM A;  1U45 A;  4ECU A;  4KLL A;  2KV2 A;  4C4R A;  2PXI A;  3Q8L A;  4NM2 A;  2B0C A;  1ZQC A;  1SWW A;  3QUT A;  4QIW C;  1RXV A;  5J0O A;  2BPG A;  3SAH A;  1O08 A;  4F4Z A;  3GIL A;  5CWR A;  4QWA A;  1M6Y A;  5G5H A;  2W7P A;  2KSO B;  3MDC A;  2F8K A;  4J9M A;  2KIV A;  4DF4 A;  1X66 A;  3AQE A;  2Y1J A;  2ZIX A;  4PGY A;  3OGU A;  2HBK A;  2DKX A;  2F44 A;  9ICI A;  1L7P A;  5KT6 A;  5B5E U;  1NZB A;  3B0X A;  3SAG A;  1XC9 A;  5ALX A;  4ED3 A;  3C1Z A;  5EE1 A;  4YXJ A;  2M9N A;  4KX5 A;  4GXJ A;  3RJI A;  2IHN A;  4IQU A;  4Y2P A;  5J2E A;  2BCU A;  2DFL A;  4C7Y A;  4TUS A;  1NKE A;  5AKE A;  3U26 A;  3C21 A;  1KL9 A;  3UQ0 A;  2MUT A;  5KFA A;  3OSP A;  1RQL A;  4EX7 A;  3LWM A;  3BQT A;  3EUB 2;  1N5W A;  5D46 A;  4P4O A;  1FFV A;  1XO0 A;  1NJZ A;  2KP7 A;  5J29 A;  3LK9 A;  4P0Q B;  4ED1 A;  3TAC B;  5L1M A;  4RQN A;  5KAI U;  1XNS A;  3QU7 A;  8ICW A;  3SMV A;  1ZQF A;  1T7P A;  1ZET A;  1KSP A;  3RH6 A;  2W9C A;  9ICO A;  2ZIU B;  3FC4 A;  3NVZ A;  4EYH B;  4UAV A;  3N4M B;  2W9B A;  4UB5 A;  9ICU A;  4P0Q A;  2YN4 A;  4KLG A;  2G06 A;  4OJL A;  4FZN A;  4B9U A;  4ECV A;  1Z00 A;  1ZQP A;  3JPO A;  4Y2Q A;  2KZM A;  2HVH A;  2KFZ A;  2L5Y A;  9ICV A;  1JMS A;  4ED7 A;  4EBE A;  4RQM A;  5ALM A;  1SV0 C;  5D49 A;  4QZH A;  1ZQ1 C;  2ZIW B;  3NVV A;  1HUO A;  3M9O B;  4Y2S A;  1MA7 A;  1S97 A;  5DB6 A;  5CA7 A;  4RNN A;  1ED1 A;  4PH5 A;  2G5H B;  3IG5 A;  4QZA A;  4X5V A;  4NM1 A;  4K4H A;  1KN5 A;  4FZM A;  1KFS A;  4I2H A;  2GO7 A;  2I1Q A;  1T3N A;  3C5F A;  5C5J A;  4EEK A;  5AM3 A;  2DWQ A;  3FM9 A;  3C28 A;  4O9M A;  2W7O A;  2FJ6 A;  5J2I A;  2W3S A;  3MGI A;  2BQ3 A;  1SL1 A;  2XGP A;  1KDH A;  2E8O A;  5KFT A;  4Y2U A;  2KMD A;  7ICR A;  1D9F A;  5D4B A;  1MC8 A;  1IM4 A;  2CPR A;  4Q43 A;  2WF5 A;  1COO A;  2F76 X;  3Q8P B;  2WTF A;  1Z19 A;  2WF9 A;  4J03 A;  4QNL A;  4DL3 A;  4ELT A;  2AHO B;  4JUZ A;  2PMZ C;  5KFX A;  2HVI A;  4Z6E A;  3RF9 A;  2OM6 A;  2KIC A;  3OJS A;  4TQR A;  1RXW A;  1ZXI A;  4UBC A;  4OJ6 A;  2D3D A;  4QIW F;  2Q0Z X;  8ICB A;  1B43 A;  3L4P A;  1GO3 F;  1A0P A;  3C1Y A;  1S0M A;  2F1J A;  4JV1 A;  1JAL A;  3BZC A;  3BDP A;  4O3M A;  5BPC A;  1U9L A;  1BPX A;  3H8J A;  3H8W A;  3BQ0 A;  4ED0 A;  4RQ7 A;  3UM9 A;  1KFD A;  5J0P A;  5KFW A;  2JEF A;  2ZUB A;  5TZV A;  4MHV A;  8ICY A;  2XY7 A;  1ZOL A;  5HHI A;  3MGH A;  4C8M A;  5KFC A;  2BZF A;  4Z6D A;  4IL6 U;  3KHL A;  2PI4 A;  2HCF A;  4F5Q A;  3MAB A;  4O5K A;  5KFK A;  2EAP A;  2ASJ A;  1XS9 D;  1N61 A;  4GXK A;  5ALZ A;  3MGV A;  2K4P A;  1NK8 A;  3F2D A;  3RH5 A;  4I2C A;  1J97 A;  4CE6 A;  4KLH A;  4FFD A;  3D2N A;  9ICS A;  2NRZ A;  5HML A;  5K4L A;  4F71 A;  1MSW D;  9ICM A;  3NAS A;  2ATL A;  3KFU F;  2JEI A;  3QU9 A;  1RM6 C;  3ALR A;  4UAS A;  2R8J A;  1U4B A;  2PKE A;  2P6R A;  3OSN A;  4XQ8 A;  2F3N A;  7ICM A;  3VC8 A;  1ECW A;  3GIK A;  1FFU A;  3RBD A;  2KFN A;  1P7D A;  4AP9 A;  5ALY A;  4DL7 A;  1SB3 C;  3C2M A;  1ZQZ A;  3CYM A;  1S0V A;  3GQC A;  1L7M A;  1ZQI A;  3BJY A;  4HAI A;  3Q8S B;  1QLN A;  4IQT A;  1CEZ A;  1Z1V A;  1IG6 A;  3RR7 A;  1JI7 A;  4OCZ A;  2BQU A;  4F50 A;  2KKP A;  3MC1 A;  4C80 A;  3T5J A;  4F4K A;  4DWI A;  2A1J A;  1NI3 A;  3QXG A;  1ZQG A;  1XSP A;  3HP6 A;  3EYZ A;  2KVS A;  2A1A A;  5ALI A;  3PMN A;  1ZQR A;  2G0A A;  2D6F C;  2F77 X;  1C7Y A;  4KTQ A;  4DL2 A;  2BCQ A;  4DLE A;  4UAT A;  1V38 A;  4IQV A;  1IV8 A;  1NNL A;  5AKK A;  5AKX A;  1N63 A;  2N1R A;  5KNI A;  4QW9 A;  3UMG A;  2ASL A;  1KRP A;  4KLD A;  1NK9 A;  4NLZ A;  2BCR A;  1QSS A;  1PVR A;  8ICS A;  5J2B A;  1XO1 A;  3H8M A;  4QZI A;  2YTU A;  5J0X A;  3V6H A;  5DB7 A;  4EBD A;  1QQ6 A;  1A6S A;  1Z00 B;  3ORY A;  2EH9 A;  4Z6F A;  1NJW A;  3SQI A;  3WKA A;  2OH2 A;  2P35 A;  5HNK A;  4BDP A;  2QLT A;  2VIX A;  1BGX T;  5AIA A;  1OW5 A;  2JEJ A;  3ICX A;  5J0Y A;  3KHG A;  2V9W A;  2HBJ A;  5AK4 A;  4P4M A;  3T3F A;  1MQ3 A;  2ZUC A;  5KFM A;  8ICH A;  3BS5 A;  3ZDE A;  4GIB A;  3RFA A;  2W9C B;  5ALW A;  5ALL A;  3CW2 C;  4DSJ A;  1CUK A;  2K8C B;  5CB1 A;  8ICJ A;  5EWG A;  3IDW A;  3E58 A;  4C7Z A;  4IRD A;  2ZUD A;  1UQV A;  4C4T A;  5KFE A;  1HUZ A;  5AKG A;  2G07 A;  2DPJ A;  2RLT A;  5ALK A;  2HBM A;  4ECX A;  2RP5 A;  1ZQA A;  3BZK A;  3Q8K A;  2EDU A;  3WK8 A;  5DBB A;  3F2B A;  1D8Y A;  4ECY A;  1X9S A;  4QZ8 A;  3C23 A;  4EEL A;  4GXI A;  3KHR A;  1JXE A;  1K1Q A;  1UPH A;  5DB8 A;  4RNO A;  3JPP A;  4I2A A;  1ZQQ A;  5KG0 A;  3I28 A;  5AI8 A;  1L8L A;  4DS5 A;  2KN7 A;  2O6K A;  2JZB B;  1Y88 A;  4QZ9 A;  1FIQ A;  1IXR A;  1F5S A;  3QZ8 A;  5ALQ A;  4ED2 A;  4UB8 U;  2W9B B;  3H7I A;  2ZTE A;  4U7C A;  4EYI B;  2UVU A;  4NLB A;  5KT2 A;  4Y2T A;  2LYA A;  1EXN A;  4CNQ A;  4RUC A;  4RQ2 A;  5GTH U;  2CN1 A;  3BQ2 A;  3RB4 A;  3KKA A;  3MFH A;  1NKC A;  2V4R A;  4DSI A;  3M6Z A;  3KTQ A;  2YMP A;  4Y2J A;  2KOB A;  4GFJ A;  5DBA A;  3ZD9 A;  3SYZ A;  4YD2 A;  3FYH A;  2QAR B;  2YB4 A;  4XRH A;  2BPC A;  5L9X A;  2OHF A;  4PZO A;  5L1I A;  1UA0 A;  3GZF A;  4USA A;  2DF4 B;  1OXJ A;  4YMN A;  5KFI A;  3RTV A;  4RT3 A;  4Y2V A;  3SI8 A;  3QX7 A;  5H2F U;  1T4G A;  8ICE A;  5IIO A;  2WF7 A;  3QU2 A;  2WB1 F;  4YCX A;  2WF6 A;  2HHT A;  2KHV A;  3HT3 A;  4RPY A;  2BR0 A;  5KFN A;  2LI6 A;  2DQN B;  4FBT A;  1L3S A;  3PO4 A;  3OPX A;  2KKV A;  7ICG A;  4KMU A;  2ZXI A;  1SV4 A;  3GIJ A;  4DOC A;  1TAM A;  7ICF A;  5J0S A;  3RRG A;  5ALD A;  2VA3 A;  5KG6 A;  1HJP A;  2FMQ A;  2G09 A;  1L3U A;  1ZD3 A;  1YZ6 A;  4C8K A;  2FLN A;  3Q8M A;  1A76 A;  1H38 A;  3WK5 A;  5AK5 A;  3E0F A;  4MEY A;  4CCH A;  3SD7 A;  2KIW A;  3WK7 A;  4YR0 A;  4DSF A;  1WWU A;  4O5C A;  4I2I A;  1WWV A;  4KLM A;  1Z4O A;  8ICX A;  5JTI A;  1LKY B;  1U47 A;  1ZQY A;  3PVX A;  1N56 A;  3PO5 A;  2KSO A;  2MRL A;  2KD1 A;  2OCE A;  2WB1 C;  1AQ6 A;  3CP8 A;  3H4D A;  4JWM A;  2AQ0 A;  4ECW A;  1V85 A;  3V7J A;  3TAP A;  3G6X A;  2C22 A;  2F1I A;  3I1Y A;  1X42 A;  3IN5 A;  1DK2 A;  5DDY A;  3I76 A;  4UB4 A;  1ZQJ A;  4C8L A;  2HW3 A;  1FO4 A;  5KFB A;  2KHQ A;  4NV0 A;  4BX9 C;  5TIS U;  2ASD A;  4FE3 A;  3K1Z A;  3LVW A;  2WAQ C;  3PX0 A;  1D8B A;  4GLX A;  1CRX A;  2EAM A;  5ALG A;  5ALP A;  5J2H A;  1NJX A;  3HX0 A;  1XSL A;  4FBU A;  5IIL A;  4M6W A;  1RYR A;  3H4B A;  2YMM A;  5DLG A;  5F9L A;  3A0H U;  3V7K A;  5J0Q A;  3LWL A;  1TAQ A;  5DQG A;  1ZQO A;  3SV4 A;  2IHM A;  2ZIW A;  4KLS A;  1SKW A;  4IS7 A;  3GU3 A;  2PFO A;  4JMU A;  4J9K A;  5F9N A;  3ONN A;  4MF8 A;  9ICR A;  1KKX A;  2FLL A;  1PUZ A;  5FP0 A;  4PPX A;  5AIB A;  2ISP A;  2K4I A;  2GH1 A;  4KLF A;  4MFC A;  2JMG A;  4CF4 A;  4NLC A;  2XCP A;  4RT2 A;  2XCA A;  5DQH A;  4U6P A;  1NJY A;  4US9 A;  4EZ9 A;  3HRD D;  4R65 A;  3AMZ A;  1JX4 A;  2Y0S C;  4O3N A;  4XUS A;  1KFT A;  1YZ7 A;  1J2N A;  3ISD A;  4P0P A;  2LM1 A;  2HHQ A;  3NUQ A;  1ZJM A;  2ZIX B;  1VLB A;  3WKC A;  2HHS A;  4M2Y A;  4IRC A;  1X2I A;  5JUM A;  4R66 A;  3F53 A;  4R8U A;  2VA8 A;  5KL1 B;  5T14 A;  4B9N A;  2K4E A;  2VJ5 A;  4Q44 A;  3ZD8 A;  3OHA A;  4P0P B;  1SWV A;  5KFH A;  3Q8R B;  7ICO A;  4O0I A;  2W55 A;  4J9Q A;  4ZOH C;  2J6S A;  2JGA A;  3PY8 A;  1L3T A;  1PZN A;  1F44 A;  4M9G A;  5AKJ A;  4NY8 A;  3SEN A;  3QU5 A;  3ETR A;  4M0A A;  5DKW A;  2W03 A;  2XC9 A;  2I9G A;  3FDS A;  3F5E A;  1PVQ A;  2BCS A;  2R8H A;  2HHV A;  1SGG A;  3JPR A;  4JK1 A;  5EE9 A;  4ECS A;  4KLE A;  1TVA A;  4RQ3 A;  3ZDA A;  4ECR A;  3RB3 A;  4DF8 A;  3RAX A;  2F2A B;  3UMB A;  4J9P A;  4J9R A;  5B66 U;  4RZR A;  1DRG A;  2ODG A;  5ALT A;  5J2K A;  4LJX A;  2ZTC A;  9ICL A;  1Z3E B;  2G08 A;  4BUG A;  1TFR A;  4ICA A;  2HHW A;  2E8M A;  5BOM A;  2A3V A;  4DL6 A;  1HIW A;  2FPM A;  1KW4 A;  3RAQ A;  3GII A;  2NRV A;  4B9T A;  3NTU A;  3GV8 B;  1BPZ A;  5ALJ A;  4CF5 A;  1X9X A;  5ALE A;  4YXM A;  1SZH A;  4QW8 A;  1XU4 A;  4TUP A;  4DCC A;  1BVS A;  2AXT U;  5KFP A;  2JXJ A;  1TK0 A;  5AK6 A;  2NO5 A;  4ED6 A;  1NK5 A;  4B9L A;  3QUC A;  2LYB A;  1XSN A;  2EZY A;  9ICP A;  2YML A;  5J2J A;  4YP3 A;  1JRP A;  3M1Y A;  4M04 A;  4FZL A;  1YT3 A;  2BQR A;  3ZDB A;  4KIT B;  1L7N A;  4PHD A;  2BHN A;  2QAR A;  2RHF A;  2VAN A;  1RG6 A;  5DBC A;  3EPI A;  1TK5 A;  4IC9 A;  4MFF A;  2Z7J A;  3DV9 A;  2KZZ A;  3LDA A;  2GWS A;  3EZ5 A;  5CJ7 A;  2WHE A;  3QNM A;  1K5O A;  1DGJ A;  2ZIV B;  2YX8 A;  4BJQ A;  2XO7 A;  3M9M B;  3HJE A;  4OJP A;  9ICJ A;  5L1J A;  1ZD5 A;  1RYU A;  5EWF A;  3RBE A;  2KK0 A;  3RJJ A;  4ECZ A;  3T5H A;  3PW7 A;  8ICF A;  3IRU A;  5AIC A;  3TAQ A;  2PI5 A;  4Q8F A;  4KX3 A;  2J6T A;  5KG2 A;  3K4G A;  4DSK A;  2FI1 A;  8ICV A;  2KE7 A;  2M0N A;  4PL1 A;  5III A;  1JRO A;  3RJF A;  2NRX A;  3QUQ A;  2C2D A;  1QSY A;  3EW9 A;  4ECQ A;  3ZDD A;  2KVC A;  2RDI A;  4DFJ A;  5F3X B;  3N28 A;  2Y1I A;  4P2H A;  3NGD A;  4JV0 A;  1SL2 A;  3MFI A;  3KD3 A;  1S5L U;  1MQ2 A;  4LZD A;  2AGO A;  2MAX A;  5AM2 A;  1S10 A;  5L1K A;  3L5K A;  3KZX A;  5AI9 A;  5L1L A;  8ICC A;  4C0Z A;  2OYY A;  5HR6 A;  2W9A A;  3IV6 A;  3H40 A;  3WU2 U;  4LZG A;  5KG5 A;  4E0D A;  2OWO A;  1B4F A;  4EBC A;  5KFQ A;  2W04 A;  3M6K A;  4JV2 A;  2AGP A;  1ZQM A;  2FMP A;  3C29 A;  5KFU A;  5AKZ A;  2B21 A;  2HMX A;  4PJ0 U;  4F5O A;  5JRT A;  4YVZ A;  2RQ5 A;  5KG4 A;  2BCV A;  2H3F A;  4UB3 A;  5CHG A;  4MFA A;  3SEI A;  2OEH A;  1L7O A;  1D8L A;  3F5A A;  8ICG A;  4DL4 A;  1TV9 A;  2NV3 A;  5KFV A;  4ZH4 A;  3NVW A;  2ALZ A;  4YMM A;  4R64 A;  4O5E A;  3SZ2 A;  1UT5 A;  2AH5 A;  2ZJ8 A;  4M6W B;  2GLE A;  1ZQK A;  3UQ2 A;  8ICZ A;  1BPD A;  3AQF A;  3WK6 A;  4IQW A;  5AKH A;  3FAH A;  4JB3 A;  4TUR A;  5DG7 A;  2FDR A;  4I2B A;  3AN1 A;  3BQ7 A;  1DXS A;  4O3Q A;  7ICS A;  5C0Y A;  5IIK A;  1K1S A;  4M9J A;  4RNM A;  1NZP A;  1SXE A;  3JPS A;  3V6K A;  3HPO A;  2UVW A;  2VKQ A;  5J0R A;  5ALU A;  3WKE A;  1SIJ A;  4KLI A;  5DDM A;  2RRD A;  3VCB A;  4EX6 A;  1ZD2 P;  3BS7 A;  3NVY A;  3M7D A;  4Y2R A;  2BPF A;  3ZI4 A;  1NK7 A;  4K4G A;  4DS4 A;  4DL5 A;  2HDO A;  4NLK A;  3THV A;  1ZRN A;  5KG3 A;  5J8Y A;  1ZQT A;  4MF2 A;  3JPN A;  1ZYQ A;  4B6J A;  5KT5 A;  2ISO A;  4RQ0 A;  3PSF A;  5KFS A;  4RQ4 A;  4UB2 A;  1S0N A;  5AK3 A;  4F5R A;  4I2E A;  4Q45 A;  1KBU A;  2YQE A;  4YD1 A;  1PVP A;  4ELU A;  1FEZ A;  2KZ3 A;  3UPQ A;  5HR7 A;  3C2K A;  7ICI A;  1B22 A;  5DG9 A;  2H3I A;  4DOA A;  4C8O A;  7ICQ A;  5J2D A;  3H0R B;  2K8A A;  1NK4 A;  3TI0 A;  2NRT A;  5KFO A;  1RYS A;  5ALF A;  2E8N A;  3G6Y A;  4I2J A;  4KLJ A;  3NS1 A;  4RQ1 A;  3KOO A;  4B9M A;  1ZQD A;  4Z6C A;  5CEH A;  2C2E A;  1Q8K A;  3GDX A;  4ELV A;  1S0O A;  1WUD A;  3QUB A;  5DG8 A;  5J2G A;  1LB2 B;  1LV5 A;  2W11 A;  2W3R A;  3LVV A;  2H3Z A;  2E3T A;  2IOF K;  1RPL A;  4BGD A;  3TFR A;  2QKQ A;  3AU6 A;  3TFS A;  8ICN A;  5G5G A;  3J81 j;  1T3Q A;  2EZX A;  4QZC A;  4QWD A;  4I27 A;  3R9K A;  4QZF A;  2XIC A;  1TAU A;  1ZRM A;  9ICB A;  5GTI U;  1U49 A;  2A19 A;  2FPL A;  2ZIU A;  1RDF A;  2W8K A;  2ZIV A;  8ICP A;  5KFY A;  1MN8 A;  1SL0 A;  5J2C A;  1F0M A;  4UAR A;  1Z4N A;  3DEE A;  1JXL A;  4NWI A;  5J8Y C;  1QQ7 A;  4CDG A;  3TAR A;  3JPQ A;  5DGA A;  1PK1 A;  4R8U B;  3ZDC A;  2VJ4 A;  5ALO A;  2G5I B;  3BS5 B;  2EAN A;  1L3V A;  3H0M B;  2NO4 A;  4F93 B;  3S6J A;  5HP4 A;  4TUQ A;  4YR2 A;  3QE9 Y;  4NLN A;  2KG5 A;  2KJ5 A;  2DL0 A;  3QZ7 A;  1ZJN A;  4F4W A;  3K75 D;  2CRX A;  5KTQ A;  8ICU A;  1PK1 B;  5AM1 A;  2H5X A;  7ICK A;  1TK8 A;  1QSL A;  2WF8 A;  1RZT A;  2R8G A;  1KEJ A;  4YMO A;  4MEX A;  1BNP A;  1DOQ A;  3B0Y A;  2HOF A;  1X6I A;  2HBL A;  1SXD A;  1LVH A;  5EE0 A;  5AI5 A;  4F8R A;  1WCL A;  2EQY A;  3OHB A;  2KNJ A;  4NJ8 A;  5AM0 A;  2KJ9 A;  3GFK B;  3V6J A;  3ETL A;  5AI6 A;  4UW9 A;  4KLT A;  1OUQ A;  2LMR A;  2AQ4 A;  4RPZ A;  3TAD C;  1X40 A;  2FE9 A;  1QCK A;  3C5G A;  1ZQN A;  4O3P A;  1BPY A;  2W54 A;  2JR5 A;  9ICQ A;  1T8E A;  1S76 D;  5J0W A;  8ICI A;  2BGW A;  4M9N A;  2ZG6 A;  4XA5 A;  4DQS A;  1N48 A;  2NYV A;  3HKZ C;  2PFP A;  4UAW A;  4RQ6 A;  4UB1 A;  4DFP A;  4YQW A;  4CRX A;  4DEZ A;  1Q3V A;  1UA1 A;  2BDP A;  1V9P A;  1KQQ A;  5JU5 A;  3HW8 A;  1QQ5 A;  3JPT A;  2HOI A;  2AJQ A;  2HSZ A;  3WKB A;  4A8E A;  5IIN A;  1RQN A;  2KJ8 A;  4IR9 A;  8ICR A;  4YFK A;  4PHE A;  4GC6 A;  3L3F X;  3PSP A;  5AM5 A;  4F72 A;  4DFD A;  5KFR A;  5KG7 A;  1DGS A;  2MU2 A;  1ZD4 A;  3IHQ B;  3UXN A;  3O0F A;  3GIM A;  3K1R B;  4RQ8 A;  9ICK A;  1NK0 A;  7ICP A;  2GOL A;  1ZQH A;  4F4Y A;  4OO1 J;  3PV8 A;  3HWT A;  4GC7 A;  2LBO A;  1ZQW A;  1Q3U A;  5KAF U;  9ICE A;  4RUA A;  2WFA A;  1L8O A;  2VA2 A;  1N60 A;  2QB1 A;  3WK4 A;  2IA6 A;  5AHX A;  3WKD A;  3RJK A;  4UAU A;  3AU2 A;  3N7S C;  2JH1 A;  4I2D A;  4OD0 A;  2RDJ A;  2DBY A;  3UXO A;  3PR4 A;  2LKY A;  1PK3 A;  5DB9 A;  4BXO B;  4YN4 A;  1Z1B A;  7ICH A;  3TAD A;  1URJ A;  2ZJA A;  4M47 A;  5HHH A;  3GV5 B;  3SV3 A;  2C2R A;  4YR3 A;  1X9W A;  9ICF A;  4J9N A;  3RH4 A;  5CRX A;  3GV7 B;  1KLN A;  5EE3 A;  3G6V A;  2FLP A;  7ICN A;  2XY5 A;  1WYG A;  2PFQ A;  4C4S A;  1LKY A;  5IIJ A;  2P6U A;  2JH7 A;  8ICK A;  4AYB C;  4KMO B;  4DFK A;  3T79 A;  2UVR A;  9ICG A;  3AEV A;  1L6N A;  3T5K A;  1X6J A;  8ICM A;  1QTM A;  2F8L A;  1UHU A;  2I6X A;  2XI9 A;  9ICX A;  3PW0 A;  5KFG A;  1Q46 A;  3AM9 A;  2FMS A;  3ISB A;  2F1H A;  4DSE A;  2B6G A;  3TQ1 A;  3HKZ F;  3QEB Z;  3A0B U;  3RJH A;  2EAO A;  7ICE A;  3RR8 A;  2DKZ A;  9ICN A;  1U48 A;  1SKR A;  2BKE A;  4PGQ A;  1N5X A;  1VJ5 A;  2JHD A;  3RB0 A;  2LM4 A;  3PX6 A;  2QB0 B;  4RU9 A;  1N2X A;  3H8S A;  5AKL A;  4O3O A;  5J2F A;  4KLO A;  4I2G A;  9ICA A;  2LHT A;  5AI0 A;  3PR5 B;  1TE2 A;  2E1F A;  3MR2 A;  4K4I A;  3OJU A;  4OJ5 A;  3T5L A;  2W9M A;  1S77 D;  4QWB A;  1WG8 A;  5J2A A;  4DOB A;  1L5U A;  4QZG A;  2HOQ A; 
#chains in the Genus database with same CATH homology
 5B66 U;  3A0B U;  5TIS U;  5KAI U;  4PJ0 U;  3A0H U;  2AXT U;  4IL6 U;  4UB6 U;  4UB8 U;  3KZI U;  2DUY A;  5E79 U;  5GTI U;  3WU2 U;  5B5E U;  5KAF U;  1S5L U;  5H2F U;  5GTH U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...