2AXTU

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
b'EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 27
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2axtU01
4UB8U 3A0HU 4PJ0U 5GTIU 5B5EU 5H2FU 4UB6U 5E79U 5KAFU 4IL6U 2AXTU 2DUYA 3KZIU 5GTHU 5B66U 5TISU 3A0BU 5KAIU 1S5LU 3WU2U
chains in the Genus database with same CATH superfamily
3ALRA 4F91B 3TKAA 3PX0A 2ZIWA 2G5HB 4DLEA 5DB6A 3TADA 3M9NB 2W9CB 4RQ1A 4CNQA 3Q8RB 5E79U 1N5XA 8ICBA 1ZQUA 4QZFA 1ZQQA 5AK6A 1QQ5A 4QZCA 3F2BA 1TVAA 3J81j 4Y2SA 3PW0A 2J6SA 4B9TA 3I76A 5KT6A 5DG7A 3WKBA 1DRGA 5J0WA 4NM1A 2PI4A 3AL0B 1RQNA 4KMUA 4BXOB 5FP0A 3SV4A 3GQCA 1NK6A 4KLUA 4Z6FA 3D2SA 4KLEA 3C28A 2IA6A 4YMMA 5CRXA 2AQ0A 3A0BU 4FS2A 2JEIA 5F9NA 1Q46A 3NASA 1NJXA 1BPDA 4NLNA 1J97A 2WHEA 1ZD2P 4PH5A 2DGZA 3LK9A 1SWVA 5KL1B 2XIDA 5L9XA 3PR5B 2GO7A 4UAWA 1SKWA 2F77X 5KFOA 1UT8A 4F4XA 4RNNA 2NYVA 2BR0A 2WTFA 1V38A 2DWQA 3VCBA 8ICOA 3L3FX 2HBMA 4ECTA 1SB3C 1WCLA 3BQ2A 1COKA 3HW8A 4NL9A 5AM4A 1SL1A 3QU5A 2VIXA 2Y1IA 4DL2A 2FPMA 3MDCA 2CXYA 5AI8A 1IXRA 2BPGA 2KIVA 5KTQA 2ZUBA 2I9GA 2ZIXA 2KN7A 8ICEA 5ALXA 2F1IA 2V4QA 1C7YA 1B22A 3DDHA 5ALFA 2ASJA 3UM9A 4YVZA 2XO7A 1N60A 5AKKA 1QSYA 2J6TA 5EE3A 4QW8A 4MFAA 4IL6U 4RQNA 2HW3A 3KZIU 9ICCA 1NJZA 1BNPA 4A8EA 1PZNA 4FZMA 7ICIA 4TQRA 4RQMA 2ZTCA 5AI0A 3GIJA 4QZAA 1N56A 5AIBA 1ZETA 4ELUA 1V85A 4F4ZA 4UB6U 4Y2UA 3C5GA 2E1FA 1L7NA 1U4BA 3F53A 4I28A 3QU9A 2ZJAA 1DOQA 3N7RC 2KJ5A 5HP4A 3IP4B 1HUOA 2UVRA 4MHVA 5IIJA 3PW4A 4JWNA 4DFDA 1AQ6A 9ICEA 1U9LA 3WK5A 4ED0A 1MQ3A 5DLGA 4TUSA 3SYZA 3ICXA 1B0XA 4EYHB 3WKAA 2VKQA 3SAHA 4KLQA 2EAPA 2BQUA 3UXNA 3IHQB 4Z6CA 4C0ZA 2F76X 3RB6A 4C8KA 5KG2A 4ED7A 1U48A 3H4BA 1UHUA 3ISDA 4FO6A 2DPIA 1B43A 2R8KA 2W54A 3PSTA 2E8NA 2LKYA 1K1QA 7ICJA 2Y0SC 3T5JA 4C4RA 4P4PA 1PK1A 4KLTA 1KFDA 2C2RA 3GIKA 3D2QA 5ALYA 2FMSA 9ICNA 3HKZC 3H4DA 4M6WB 8ICYA 4J9NA 4M9GA 1ZQYA 4Z6DA 2Y9UA 3QUBA 3RJEA 3KZXA 3H8JA 3TARA 4C80A 3I1YA 5DBBA 3QYPA 3IG8A 3RF9A 2YX8A 2W3RA 5L1KA 4KLFA 5J2AA 1K1SA 5J0QA 4GC7A 9ICSA 4RPYA 1ZQ1C 4QIWC 1N5WA 9ICQA 3MABA 2RHFA 4IQWA 5JU5A 3WK7A 1NOMA 4M2YA 2WAQF 2OCEA 1ZQJA 2DKZA 1J2NA 4KLHA 2HVIA 4YD2A 1UQVA 3L4PA 5HNKA 5DG9A 1ZJNA 4QWEA 1XO1A 2HSZA 2MSNA 3F2DA 2KVCA 4DSLA 3UPQA 3N97B 5CJ7A 4RQ3A 2KHQA 4PL1A 4F5QA 2B6GA 2HHXA 2G09A 4P2HA 2ZJ5A 2HVHA 2KV2A 1Z4NA 1KW4A 5J0OA 4EZ6A 4J9SA 1TK0A 2YB4A 4QW9A 3LYSA 2E8OA 3K4GA 5KFBA 4UATA 7ICHA 1FIQA 1RG6A 1A76A 4YQWA 4KLJA 3RB0A 2HCFA 4O3RA 1JIHA 3SQIA 2JHDA 4F5NA 1DGSA 2GLEA 5DDMA 8ICMA 3B0YA 4RNOA 3DEEA 4IC9A 3TAPA 2PXIA 4C7ZA 3BQTA 2N1RA 4QZDA 1HEKA 2HOIA 4I2EA 3QEBZ 1KFSA 1ZQEA 3QU4A 3C29A 2WFAA 1ZQIA 4O0IA 2NRWA 3TADC 4BGDA 3GV7B 5ALGA 5EOZA 4CF4A 4JK1A 1Y88A 4G9BA 4ECYA 3WK6A 1XC9A 1ZD5A 4DOAA 3C5FA 5KFGA 4I2GA 4QNLA 1KBUA 8ICSA 3T79A 5KT2A 3MR6A 3V7LA 1O03A 3JPQA 2ZIVB 2OYYA 3I28A 2W9CA 7ICGA 3KHGA 4KTQA 2KVSA 4YP3A 4DLGA 2BPFA 4DEZA 2W8KA 3A0HU 4ED6A 3MR2A 2PMZF 8ICFA 2M9NA 5ALIA 1ZJMA 3RAXA 2I6XA 1YZ6A 2L5YA 1BNOA 2IOHA 2C28A 4PGYA 1XSPA 3UQ0A 3C2KA 3RJJA 8ICJA 3PZPA 2XI9A 4BJQA 5DBCA 5T14A 2E5SA 4I2DA 2C2DA 2IHMA 4JV1A 4OJ5A 2WF8A 4ELTA 2DQNB 1BVSA 4NL9C 2XY7A 3H7IA 3ZI4A 3TQ1A 3F2CA 2H5XA 1CRXA 2HHTA 3KBBA 3PY8A 2YB1A 2K8BB 3G6XA 1O08A 4CCHA 5JRTA 2LM1A 2EZXA 4UB3A 3AU2A 2HOFA 2F1JA 4KN7A 4DL5A 5D4BA 5BOLA 3RB4A 2LYHA 9ICGA 4Q8EA 1ZQKA 3HT3A 4M9NA 1NZPA 3GV8B 2BCUA 2FPKA 1NK7A 3PO5A 2LYBA 3QU7A 3RBDA 1ZQTA 2BCVA 4GIBA 1QH9A 4ECQA 1OXJA 1AROP 4X5VA 5HMMA 4NV0A 3V6JA 3C23A 3QUQA 1KQQA 3EW9A 5J29A 2YMMA 3EPGA 1Q8KA 1L5UA 1V97A 4KLIA 9ICBA 1NK5A 2KTQA 3NVYA 1L3TA 2MUTB 5J0PA 4Y2RA 1XS9D 4DQPA 1ZXIA 1RQLA 5AKIA 2KSOB 3ETRA 3QE9Y 1ZQBA 1NZBA 5KAFU 2WF9A 9ICKA 3SEIA 4Y2PA 3HKZF 1S9FA 5J2HA 2G0AA 4RQ7A 1T3QA 1ZOLA 2ALZA 3RJGA 2QB0A 2R8HA 5J2IA 5KFFA 8ICWA 2JEFA 2RP5A 4F5OA 4Q8FA 1S0MA 2H3IA 4RQ5A 4IR9A 3CNHA 3RRGA 5HHHA 4QZEA 5AKXA 1IIPA 1RXWA 5KG1A 3ZDBA 3M6KA 2OXOA 5ALJA 3E58A 2AHOB 3JPOA 4QZHA 3JPRA 3PSPA 3R9KA 5KFHA 9ICLA 4EX6A 2OHFA 2FI1A 4U6PA 1XU4A 3THVA 2K4HA 4HAIA 1KKXA 3CYMA 1FFVA 2ES6A 4KLGA 3S6JA 3WU2U 5EE1A 5J0RA 4NLCA 3FDSA 5CR0A 4TQSA 1K5OA 1M6YA 1XSNA 3H40A 2R18A 5AI5A 3WK4A 4Q45A 3H0LB 1Q3VA 7ICKA 3RAQA 2AXTU 4DQSA 2ZUCA 5KFJA 2WF5A 1Z00A 5G5GA 4O3PA 1QCKA 2F2AB 4YR0A 8ICXA 2XICA 4B9VA 4P0QB 2LPEA 9ICMA 2ZTDA 4ED1A 8ICAA 2W9BB 4EZ9A 2GWSA 4DSFA 8ICHA 4IQTA 4ECWA 3BS7A 2C2EA 3IRUA 1F5SA 1X66A 5AKLA 2KHVA 1F44A 2Y1JA 3NVWA 1BPYA 2OEHA 3MGHA 3O0FA 2KG5A 1S0OA 1KFTA 1ZQOA 4OJPA 4DSIA 5CEHA 1TE2A 1LKYB 8ICRA 1L3SA 2LBOA 2JZBB 4R64A 2CRXA 4KLLA 7ICTA 3ZDCA 1S77D 1J2MA 4UW9A 4J9PA 4F71A 1L6NA 5CHGA 4IRKA 1ZQGA 3KKAA 1TFRA 5G5HA 2H3QA 4ED3A 2Y9TA 3GZFA 4NLKA 5DDYA 4BWMA 3OSNA 2PMZC 2VJ5A 2FLLA 1QQ7A 2PFPA 4QZ9A 2HHSA 4RQ8A 2MA1A 2EAMA 1X40A 7ICPA 1S5LU 9ICHA 3BJYA 3OJSA 1ZYQA 1WUDA 3JPSA 1NNLA 3EUB2 2EZYA 4I2JA 2LI6A 4F2SA 4TUPA 3BS5B 3RJHA 4Q44A 4ICAA 1SKSA 3AMZA 2DFLA 7ICMA 3B0XA 4DSKA 3RJIA 8ICZA 4PPXA 2DKXA 2A1JB 1OW5A 1X9SA 2G5IB 2HBLA 2KZZA 3QUCA 5ALMA 7ICFA 3NVZA 1WCNA 4R8UA 1COOA 2KKPA 1D9DA 5EWFA 4M04A 1T4GA 4NY8A 4NLZA 3GIIA 2EANA 2ZIVA 2W11A 3QEAZ 3G6YA 5AI4A 4DS5A 3WKCA 4Z6EA 5J2GA 4YR2A 2I1QA 2JR5A 5KFTA 3PO4A 1KN5A 4C8MA 3E2EA 3MGIA 4KLDA 3ISCA 2D3DA 4R65A 4O5EA 4PGXA 4R63A 3GV5B 2KFNA 4JV0A 5ALVA 1CEZA 4US9A 3KFUF 8ICLA 5KFWA 5D46A 2C22A 4FE3A 2XY6A 4ED2A 4CE6A 1YT3A 4ECZA 3HPOA 1HIWA 2JH7A 3HJEA 4ZOHC 1MSWD 7ICVA 5KT5A 4RQ0A 5J2CA 1RXVA 1NKBA 3RR8A 4RT3A 3F5EA 4NWIA 5J8YA 3L5KA 1A0PA 5DB8A 3MGVA 4J9QA 4PHEA 3M7DA 4I27A 1X9MA 4NLGA 4FFDA 2JXJA 1L8OA 4IRDA 5J0UA 1ZQZA 3FC4A 5C5JA 5HR6A 2XCAA 4BDPA 1S0VA 3GILA 4OCZA 2KICA 4PL2A 5GTHU 2XC9A 2HDOA 3OHBA 2KP7A 2QKQA 4I2FA 2ZIWB 2XGPA 4QZGA 2F3NA 3ETLA 8ICVA 5DGAA 4I29A 2ATLA 3ZDAA 3TAQA 4UARA 4UB5A 4MF2A 1DK3A 5IIOA 2AU0A 2D8CA 4TURA 5DG8A 2ASLA 2YMPA 1JX4A 2XVTA 3MR3A 3SI8A 2PKEA 3Q8MA 5KFSA 5ALRA 4B9MA 5IILA 4ELVA 2HBKA 4F5RA 4EEYA 4G3IA 1JI7A 3GIMA 1WYGA 4FBUA 2RDJA 5ALSA 5KFEA 4IS7A 4BWJA 4O3MA 5DQGA 1D9FA 2JRZA 4EBEA 5B66U 2HMXA 5L1LA 3DV9A 5ALDA 4C8NA 1ZQHA 4P0PA 5AM3A 2K8CB 4ED8A 2QARB 2KEYA 1FFUA 5AM0A 4USAA 4Y2JA 5F3XB 2H3ZA 4QWAA 4DL3A 1XSLA 5HHIA 4BX9C 4MEXA 4ECSA 1DK2A 1UA0A 2LM4A 2P6UA 1HUZA 1IG6A 1ZQCA 2LMRA 4M0AA 1IV8A 2BDUA 2VA3A 5J0YA 2BGWA 1N63A 1F0MA 4DQQA 4K4GA 3D6JA 4OJOA 1ED1A 3AUOA 2ODGA 2HHUA 4IR1A 2ZIXB 3EYZA 1XNSA 2G06A 4YCXA 1PVQA 2EDUA 4JWMA 3T5HA 2KJ9A 2H3VA 4CF3A 4XUSA 2RDIA 1HJPA 4K4HA 2BCRA 3PX4A 3JPTA 1XO0A 4UB4A 2R8IA 3QNMA 3FYHA 2IMWP 4PGQA 3N28A 3CW2C 1SL2A 1S10A 2Q0ZX 5DQIA 4HYKA 4YXJA 4DOCA 4DCCA 2JMGA 4OO1J 2IHNA 3V7KA 2K89A 3M9MB 3UMBA 5KFKA 3NS1A 4TUQA 2KMDA 3HP6A 3TANA 4GXKA 1NK8A 4KX3A 4O3OA 2E3TA 5AKZA 3MC1A 1JN3A 2GH1A 2QB1A 4BXOA 4B9SA 4J9MA 1SGGA 3UXOA 3SMVA 4GXIA 2PFQA 1MC8A 2MU2A 3M1YA 3ZD9A 4YD1A 5CA7A 3Q8KA 3JPPA 4DFMA 3UMCA 2HOQA 2WB1F 3OGUA 5IINA 4ECVA 4DSEA 3HRDD 3K1ZA 1IM4A 9ICWA 3KKAC 9ICAA 2J6UA 2BZFA 2YN4A 2KZMA 3BQ0A 3AQEA 1VLBA 5HMLA 8ICUA 5TISU 4AYBC 3QZ7A 1PVRA 3KOOA 4IQVA 3D2NA 3OSPA 5CB1A 3C2MA 3PR4A 5KFDA 1RYUA 3NUQA 4O3NA 7ICUA 1PK1B 5AIAA 3RH4A 2F8KA 4DF4A 3MBYA 2NO5A 1KEJA 5IIMA 1NK9A 1X6IA 3PNCA 1U45A 9ICUA 7ICOA 2FDRA 1MQ2A 3HX0A 4LZDA 3T5LA 4LZGA 5KG3A 9ICVA 1A6SA 2ZXHA 2KOBA 1ZQWA 5KFZA 3M8SA 3LDAA 3SZ2A 1NK4A 1FEZA 1X42A 2JGAA 1ZD3A 1BGXT 2HBJA 1SIJA 2DUYA 5TZVA 4UAVA 5KG7A 4MF8A 2BQRA 5KFNA 2LYAA 1L7OA 3SV3A 1QTMA 5KFCA 2W7OA 4ECXA 3E0FA 3Q8SB 1X6JA 2KKVA 5DB7A 2HI0A 1ZQXA 2V9WA 4GC6A 3H0RB 4RT2A 4UAUA 3H0MB 4RNMA 3BZKA 1KL9A 1OUQA 3NRZA 3HWTA 4FBTA 2UVVA 3NRWA 4RQ4A 2A19A 1PK3A 1L8LA 3FM9A 1KRPA 4B9UA 4QWBA 1NKCA 1D8YA 1SV4A 5DQHA 2F1HA 5DB9A 4WJ3B 2UVUA 2FJ6A 1S97A 1SL0A 2P66A 2HHWA 1URJA 2ISPA 2KIWA 1TAMA 1KLNA 1KTQA 4Y2VA 5AI6A 5L1JA 2NRTA 3ZD8A 2YMLA 2FMPA 3PV8A 3EZ5A 5J8YC 4GXJA 4U7CA 8ICIA 3PSFA 3GU3A 4AP9A 2ESEA 2BDPA 4O9MA 4DFPA 3AEVA 4FZNA 2K60A 5KNIA 3UQ2A 3ONNA 4QWCA 4P4MA 2BKEA 4RQ2A 7ICRA 5AM1A 4C7YA 1TAUA 3K75D 4O5KA 3Q8QB 2DPJA 3C1YA 2I5HA 5AKJA 3OPXA 7ICSA 4M6WA 1ZRMA 3MDAA 1VDVA 1BPBA 2EH9A 3PSIA 4CF5A 1LV5A 2RQ5A 3SD7A 9ICIA 3FAHA 1D8BA 3RBEA 3WKDA 4NLBA 3UXPA 4DL7A 3JPNA 4CGZA 5ALLA 2QLTA 1SXEA 2G08A 4UQGA 3G6VA 4DO9A 1T7PA 2JEJA 4DF8A 3BQ1A 3C1ZA 1T8EA 4QZBA 5KFPA 4MEYA 1CUKA 3MR5A 4IQUA 3F5AA 3QUTA 3NGDA 5L1MA 2W8LA 4J9RA 1QLNA 2D6FC 3RJFA 4EYIB 1ZD4A 2W3SA 2BCSA 5KFXA 4KN4A 5J0XA 1UT5A 2VA2A 3CRXA 3SAGA 3M6ZA 4YG2A 4JUZA 1S8OA 2EAOA 4PHPA 8ICNA 1FO4A 2KZ3A 3BQ7A 4RQ6A 2YY6A 4RPZA 5ALQA 3BDPA 4QZIA 4KMOB 4JMUA 5BPCA 3ZDDA 5AKYA 3OJUA 5AHXA 5EWEA 1T94A 8ICPA 4Y2TA 2NRZA 2MRLA 2BPCA 4ECRA 4UB8U 2ZIUB 4XQ8A 2QARA 3WKEA 3N4MB 5ALWA 3ORYA 5BOMA 2A1AA 4I2IA 5KFQA 5JTIA 4NJ8A 1SKRA 1SWWA 5HR7A 3EWAA 2EQYA 1SV0A 1VJ5A 4I2HA 2XCPA 1DGJA 2BCQA 3T3FA 1LVHA 5J0TA 4I2AA 4P4OA 2W9MA 5CP2A 1BPEA 5ALHA 4XRHA 1ZQRA 3RTVA 5KT7A 1BPXA 2BHNA 5KL8B 2E8MA 5KG4A 4EBCA 4PHDA 1NK0A 3MFIA 3HILA 4O5CA 2WB1C 1N62A 5CWRA 4US8A 9ICXA 2GOLA 9ICJA 4MFCA 1WWUA 2W55A 3TFSA 4ZH4A 5AI9A 4B9NA 4RUCA 2F44A 2A3VA 2IOFK 1WWVA 4XA5A 1EXNA 2ASDA 3C2LA 1ZQFA 4AYBF 4DL6A 5KFYA 4RZRA 4EX7A 7ICEA 5DGBA 2PI5A 3AU6A 4M9LA 4BUGA 5ALOA 4PJ0U 4Y2QA 5A0LA 4Q43A 1WG8A 4CDGA 3KHLA 3KHRA 4J03A 4LJXA 5KG6A 5J2BA 2JV3A 2QB0B 3PW7A 3IN5A 2WF6A 2P35A 2B21A 2R8JA 5KFIA 5DLFA 3TFRA 3AM9A 1U49A 4UB1A 4FS1A 1JXEA 4F2RA 4F50A 3VC8A 4F8RA 3IDWA 1JMSA 1V9PA 1RYRA 3PX6A 2M0NA 3PVXA 3MFHA 1P7DA 1U47A 3H8WA 5AM5A 3LWMA 4C8LA 1N48A 2NV3A 4B9LA 2JH1A 5AKGA 1TK8A 3V6KA 4UBCA 5J2DA 1ZQVA 3IV6A 4Y2YA 3AQFA 1RDFA 4JB3A 1L7PA 2Z7JA 3PW2A 4IRCA 5AKEA 5KAIU 2MAXA 1Z1VA 2DBYA 1S76D 5ALNA 2VANA 8ICTA 3NTUA 1ECWA 2W9AA 5L1IA 1Z00B 2RRDA 3SAFA 2R8GA 4EELA 2AGOA 9ICOA 1UPHA 4YMNA 2DF4B 4GLXA 4KLMA 2WF7A 2FPLA 2F8LA 5KT4A 4CRXA 4RU9A 9ICRA 4OJLA 3LVWA 5EWGA 2MUTA 5KFUA 2G07A 3TI0A 2KSOA 3B9JA 3RH6A 4NM2A 1MA7A 4YFKA 3V72A 4DSJA 1NKEA 3RR7A 2HHVA 5JUMA 4QWDA 2V4RA 4UASA 3SR6A 4PZNA 2FE9A 4J9OA 5GTIU 1KDHA 4KLOA 2W7PA 3ED5A 5IIKA 4RUAA 1UCVA 4DS4A 4O3QA 5AK3A 4K4IA 4UBBA 9ICPA 3RRHA 2KFZA 1NI3A 4YR3A 2AQ4A 2FLPA 2FMQA 1BPZA 5KFRA 3H8SA 3WK9A 5EE9A 5AM2A 2DL0A 1QSLA 1TK5A 1GO3F 4OJ6A 2LHTA 5KFMA 2ZXIA 4C4TA 4F4KA 4YXMA 1ZQMA 4M9HA 1ZQAA 5J2FA 4F72A 1SZPA 2B0CA 3KHHA 1Z19A 4YMOA 5ALTA 3LWLA 4I2CA 1RZTA 1C20A 1RPLA 2KNJA 1X9WA 2NO4A 3AN1A 4I2BA 1S0NA 1RM6C 1ZQDA 4QZ8A 1T3NA 3Q8PB 4F93B 3N7SC 5D49A 4UAYA 3V6HA 4LVSA 4JV2A 4ECUA 1YZ7A 4DQRA 3QX7A 1MN8A 9ICFA 2KJ8A 5KG0A 3RFAA 3RB3A 4R8UB 1H38A 7ICQA 3M8RA 3BZCA 4KX5A 5H2FU 1RYSA 4P0QA 4UAZA 9ICTA 3Q8LA 5DBAA 2H3FA 1Q3UA 1TAQA 2W9BA 1D8LA 5ALKA 4DFKA 3QU2A 2W04A 1JXLA 4UB2A 5F9LA 3K1RB 4OD0A 2NRVA 2Q4TA 3KTQA 3ZDEA 3OHAA 5J2KA 3RJKA 5J2JA 2PFNA 2ZUDA 1QSSA 2ZJ8A 2OM6A 3T5KA 4M9JA 1LKYA 2KK0A 4ACOA 2JZBA 7ICNA 1SV0C 1SZHA 3M9OB 5KT3A 5ALEA 3PW5A 4Y2XA 4RPXA 3SENA 2EZZA 1PUZA 2AH5A 2YMQA 2ZIUA 2AJQA 3C21A 5KFVA 1NJYA 1ZQPA 4KITB 2JEGA 1XWLA 1A77A 4F4YA 3PMNA 4O3SA 4M47A 5IIIA 3QZ8A 3NVVA 3TACB 5DKWA 4EBDA 5AK5A 2K8AA 2XY5A 3QXGA 5J0SA 1LB2B 5KG5A 2E1EA 4DWIA 2ZTEA 3WK8A 3CP8A 1X9XA 1TV9A 4DQIA 2UVWA 7ICLA 1B4FA 5J2EA 4J9KA 2W03A 3BS5A 1ZQNA 1CI4A 3ISBA 1TKDA 4EENA 8ICGA 4EEKA 5C0YA 1N61A 3LVVA 4PZOA 2A1JA 3OTQA 4F92B 2BQ3A 4MFFA 2ISOA 1ZQLA 4QJFB 2OWOA 2E8PA 2FLNA 2K4EA 2K4PA 2PFOA 8ICKA 5AKHA 1L3VA 2YTUA 3KD3A 2Y0SF 2NRXA 1NJWA 5AK4A 2KD1A 4YN4A 1ZQSA 4DL4A 2XGQA 1SXDA 4GFJA 4KLSA 4F4WA 3RH5A 1PVPA 2KE7A 1JRPA 4PHAA 4FZLA 3EPIA 2K4IA 3V7JA 5K4LA 4C4SA 4F3OA 3IG5A 5KFAA 4C8OA 4P0PB 4J9LA 8ICQA 4DFJA 1JALA 2VA8A 5EE0A 3H8MA 1DXSA 1KSPA 2W43A 4B6JA 1QQ6A 1L7MA 5ALZA 3IM1A 2CPRA 5B5EU 1ZRNA 2AGQA 1JROA 3PMLA 3GFKB 4DOBA 2OH2A 4NXZA 2WAQC 1UA1A 5KFLA 5AICA 2CN1A 5ALUA 4QIWF 2O6KA 4R66A 2P6RA 2RLTA 2IOFA 1Z3EB 1X2IA 2YQEA 2HHQA 3N7PD 2AGPA 8ICCA 1N2XA 1JUDA 2IBKA 4F5PA 1Z1BA 1L3UA 2VJ4A 2ZG6A 4E0DA 5ALPA 3GDXA 1Z4OA 3U26A 3UMGA
chains in the Genus database with same CATH topology
4UB8U 3A0HU 4PJ0U 5GTIU 5B5EU 5H2FU 4UB6U 5E79U 5KAFU 4IL6U 2AXTU 2DUYA 3KZIU 5GTHU 5B66U 5TISU 3A0BU 5KAIU 1S5LU 3WU2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 U;  3A0H U;  4PJ0 U;  5GTI U;  5B5E U;  5H2F U;  4UB6 U;  5E79 U;  5KAF U;  4IL6 U;  2AXT U;  2DUY A;  3KZI U;  5GTH U;  5B66 U;  5TIS U;  3A0B U;  5KAI U;  1S5L U;  3WU2 U; 
#chains in the Genus database with same CATH topology
 3ALR A;  4F91 B;  3TKA A;  3PX0 A;  2ZIW A;  2G5H B;  4DLE A;  5DB6 A;  3TAD A;  3M9N B;  2W9C B;  4RQ1 A;  4CNQ A;  3Q8R B;  5E79 U;  1N5X A;  8ICB A;  1ZQU A;  4QZF A;  1ZQQ A;  5AK6 A;  1QQ5 A;  4QZC A;  3F2B A;  1TVA A;  3J81 j;  4Y2S A;  3PW0 A;  2J6S A;  4B9T A;  3I76 A;  5KT6 A;  5DG7 A;  3WKB A;  1DRG A;  5J0W A;  4NM1 A;  2PI4 A;  3AL0 B;  1RQN A;  4KMU A;  4BXO B;  5FP0 A;  3SV4 A;  3GQC A;  1NK6 A;  4KLU A;  4Z6F A;  3D2S A;  4KLE A;  3C28 A;  2IA6 A;  4YMM A;  5CRX A;  2AQ0 A;  3A0B U;  4FS2 A;  2JEI A;  5F9N A;  1Q46 A;  3NAS A;  1NJX A;  1BPD A;  4NLN A;  1J97 A;  2WHE A;  1ZD2 P;  4PH5 A;  2DGZ A;  3LK9 A;  1SWV A;  5KL1 B;  2XID A;  5L9X A;  3PR5 B;  2GO7 A;  4UAW A;  1SKW A;  2F77 X;  5KFO A;  1UT8 A;  4F4X A;  4RNN A;  2NYV A;  2BR0 A;  2WTF A;  1V38 A;  2DWQ A;  3VCB A;  8ICO A;  3L3F X;  2HBM A;  4ECT A;  1SB3 C;  1WCL A;  3BQ2 A;  1COK A;  3HW8 A;  4NL9 A;  5AM4 A;  1SL1 A;  3QU5 A;  2VIX A;  2Y1I A;  4DL2 A;  2FPM A;  3MDC A;  2CXY A;  5AI8 A;  1IXR A;  2BPG A;  2KIV A;  5KTQ A;  2ZUB A;  2I9G A;  2ZIX A;  2KN7 A;  8ICE A;  5ALX A;  2F1I A;  2V4Q A;  1C7Y A;  1B22 A;  3DDH A;  5ALF A;  2ASJ A;  3UM9 A;  4YVZ A;  2XO7 A;  1N60 A;  5AKK A;  1QSY A;  2J6T A;  5EE3 A;  4QW8 A;  4MFA A;  4IL6 U;  4RQN A;  2HW3 A;  3KZI U;  9ICC A;  1NJZ A;  1BNP A;  4A8E A;  1PZN A;  4FZM A;  7ICI A;  4TQR A;  4RQM A;  2ZTC A;  5AI0 A;  3GIJ A;  4QZA A;  1N56 A;  5AIB A;  1ZET A;  4ELU A;  1V85 A;  4F4Z A;  4UB6 U;  4Y2U A;  3C5G A;  2E1F A;  1L7N A;  1U4B A;  3F53 A;  4I28 A;  3QU9 A;  2ZJA A;  1DOQ A;  3N7R C;  2KJ5 A;  5HP4 A;  3IP4 B;  1HUO A;  2UVR A;  4MHV A;  5IIJ A;  3PW4 A;  4JWN A;  4DFD A;  1AQ6 A;  9ICE A;  1U9L A;  3WK5 A;  4ED0 A;  1MQ3 A;  5DLG A;  4TUS A;  3SYZ A;  3ICX A;  1B0X A;  4EYH B;  3WKA A;  2VKQ A;  3SAH A;  4KLQ A;  2EAP A;  2BQU A;  3UXN A;  3IHQ B;  4Z6C A;  4C0Z A;  2F76 X;  3RB6 A;  4C8K A;  5KG2 A;  4ED7 A;  1U48 A;  3H4B A;  1UHU A;  3ISD A;  4FO6 A;  2DPI A;  1B43 A;  2R8K A;  2W54 A;  3PST A;  2E8N A;  2LKY A;  1K1Q A;  7ICJ A;  2Y0S C;  3T5J A;  4C4R A;  4P4P A;  1PK1 A;  4KLT A;  1KFD A;  2C2R A;  3GIK A;  3D2Q A;  5ALY A;  2FMS A;  9ICN A;  3HKZ C;  3H4D A;  4M6W B;  8ICY A;  4J9N A;  4M9G A;  1ZQY A;  4Z6D A;  2Y9U A;  3QUB A;  3RJE A;  3KZX A;  3H8J A;  3TAR A;  4C80 A;  3I1Y A;  5DBB A;  3QYP A;  3IG8 A;  3RF9 A;  2YX8 A;  2W3R A;  5L1K A;  4KLF A;  5J2A A;  1K1S A;  5J0Q A;  4GC7 A;  9ICS A;  4RPY A;  1ZQ1 C;  4QIW C;  1N5W A;  9ICQ A;  3MAB A;  2RHF A;  4IQW A;  5JU5 A;  3WK7 A;  1NOM A;  4M2Y A;  2WAQ F;  2OCE A;  1ZQJ A;  2DKZ A;  1J2N A;  4KLH A;  2HVI A;  4YD2 A;  1UQV A;  3L4P A;  5HNK A;  5DG9 A;  1ZJN A;  4QWE A;  1XO1 A;  2HSZ A;  2MSN A;  3F2D A;  2KVC A;  4DSL A;  3UPQ A;  3N97 B;  5CJ7 A;  4RQ3 A;  2KHQ A;  4PL1 A;  4F5Q A;  2B6G A;  2HHX A;  2G09 A;  4P2H A;  2ZJ5 A;  2HVH A;  2KV2 A;  1Z4N A;  1KW4 A;  5J0O A;  4EZ6 A;  4J9S A;  1TK0 A;  2YB4 A;  4QW9 A;  3LYS A;  2E8O A;  3K4G A;  5KFB A;  4UAT A;  7ICH A;  1FIQ A;  1RG6 A;  1A76 A;  4YQW A;  4KLJ A;  3RB0 A;  2HCF A;  4O3R A;  1JIH A;  3SQI A;  2JHD A;  4F5N A;  1DGS A;  2GLE A;  5DDM A;  8ICM A;  3B0Y A;  4RNO A;  3DEE A;  4IC9 A;  3TAP A;  2PXI A;  4C7Z A;  3BQT A;  2N1R A;  4QZD A;  1HEK A;  2HOI A;  4I2E A;  3QEB Z;  1KFS A;  1ZQE A;  3QU4 A;  3C29 A;  2WFA A;  1ZQI A;  4O0I A;  2NRW A;  3TAD C;  4BGD A;  3GV7 B;  5ALG A;  5EOZ A;  4CF4 A;  4JK1 A;  1Y88 A;  4G9B A;  4ECY A;  3WK6 A;  1XC9 A;  1ZD5 A;  4DOA A;  3C5F A;  5KFG A;  4I2G A;  4QNL A;  1KBU A;  8ICS A;  3T79 A;  5KT2 A;  3MR6 A;  3V7L A;  1O03 A;  3JPQ A;  2ZIV B;  2OYY A;  3I28 A;  2W9C A;  7ICG A;  3KHG A;  4KTQ A;  2KVS A;  4YP3 A;  4DLG A;  2BPF A;  4DEZ A;  2W8K A;  3A0H U;  4ED6 A;  3MR2 A;  2PMZ F;  8ICF A;  2M9N A;  5ALI A;  1ZJM A;  3RAX A;  2I6X A;  1YZ6 A;  2L5Y A;  1BNO A;  2IOH A;  2C28 A;  4PGY A;  1XSP A;  3UQ0 A;  3C2K A;  3RJJ A;  8ICJ A;  3PZP A;  2XI9 A;  4BJQ A;  5DBC A;  5T14 A;  2E5S A;  4I2D A;  2C2D A;  2IHM A;  4JV1 A;  4OJ5 A;  2WF8 A;  4ELT A;  2DQN B;  1BVS A;  4NL9 C;  2XY7 A;  3H7I A;  3ZI4 A;  3TQ1 A;  3F2C A;  2H5X A;  1CRX A;  2HHT A;  3KBB A;  3PY8 A;  2YB1 A;  2K8B B;  3G6X A;  1O08 A;  4CCH A;  5JRT A;  2LM1 A;  2EZX A;  4UB3 A;  3AU2 A;  2HOF A;  2F1J A;  4KN7 A;  4DL5 A;  5D4B A;  5BOL A;  3RB4 A;  2LYH A;  9ICG A;  4Q8E A;  1ZQK A;  3HT3 A;  4M9N A;  1NZP A;  3GV8 B;  2BCU A;  2FPK A;  1NK7 A;  3PO5 A;  2LYB A;  3QU7 A;  3RBD A;  1ZQT A;  2BCV A;  4GIB A;  1QH9 A;  4ECQ A;  1OXJ A;  1ARO P;  4X5V A;  5HMM A;  4NV0 A;  3V6J A;  3C23 A;  3QUQ A;  1KQQ A;  3EW9 A;  5J29 A;  2YMM A;  3EPG A;  1Q8K A;  1L5U A;  1V97 A;  4KLI A;  9ICB A;  1NK5 A;  2KTQ A;  3NVY A;  1L3T A;  2MUT B;  5J0P A;  4Y2R A;  1XS9 D;  4DQP A;  1ZXI A;  1RQL A;  5AKI A;  2KSO B;  3ETR A;  3QE9 Y;  1ZQB A;  1NZB A;  5KAF U;  2WF9 A;  9ICK A;  3SEI A;  4Y2P A;  3HKZ F;  1S9F A;  5J2H A;  2G0A A;  4RQ7 A;  1T3Q A;  1ZOL A;  2ALZ A;  3RJG A;  2QB0 A;  2R8H A;  5J2I A;  5KFF A;  8ICW A;  2JEF A;  2RP5 A;  4F5O A;  4Q8F A;  1S0M A;  2H3I A;  4RQ5 A;  4IR9 A;  3CNH A;  3RRG A;  5HHH A;  4QZE A;  5AKX A;  1IIP A;  1RXW A;  5KG1 A;  3ZDB A;  3M6K A;  2OXO A;  5ALJ A;  3E58 A;  2AHO B;  3JPO A;  4QZH A;  3JPR A;  3PSP A;  3R9K A;  5KFH A;  9ICL A;  4EX6 A;  2OHF A;  2FI1 A;  4U6P A;  1XU4 A;  3THV A;  2K4H A;  4HAI A;  1KKX A;  3CYM A;  1FFV A;  2ES6 A;  4KLG A;  3S6J A;  3WU2 U;  5EE1 A;  5J0R A;  4NLC A;  3FDS A;  5CR0 A;  4TQS A;  1K5O A;  1M6Y A;  1XSN A;  3H40 A;  2R18 A;  5AI5 A;  3WK4 A;  4Q45 A;  3H0L B;  1Q3V A;  7ICK A;  3RAQ A;  2AXT U;  4DQS A;  2ZUC A;  5KFJ A;  2WF5 A;  1Z00 A;  5G5G A;  4O3P A;  1QCK A;  2F2A B;  4YR0 A;  8ICX A;  2XIC A;  4B9V A;  4P0Q B;  2LPE A;  9ICM A;  2ZTD A;  4ED1 A;  8ICA A;  2W9B B;  4EZ9 A;  2GWS A;  4DSF A;  8ICH A;  4IQT A;  4ECW A;  3BS7 A;  2C2E A;  3IRU A;  1F5S A;  1X66 A;  5AKL A;  2KHV A;  1F44 A;  2Y1J A;  3NVW A;  1BPY A;  2OEH A;  3MGH A;  3O0F A;  2KG5 A;  1S0O A;  1KFT A;  1ZQO A;  4OJP A;  4DSI A;  5CEH A;  1TE2 A;  1LKY B;  8ICR A;  1L3S A;  2LBO A;  2JZB B;  4R64 A;  2CRX A;  4KLL A;  7ICT A;  3ZDC A;  1S77 D;  1J2M A;  4UW9 A;  4J9P A;  4F71 A;  1L6N A;  5CHG A;  4IRK A;  1ZQG A;  3KKA A;  1TFR A;  5G5H A;  2H3Q A;  4ED3 A;  2Y9T A;  3GZF A;  4NLK A;  5DDY A;  4BWM A;  3OSN A;  2PMZ C;  2VJ5 A;  2FLL A;  1QQ7 A;  2PFP A;  4QZ9 A;  2HHS A;  4RQ8 A;  2MA1 A;  2EAM A;  1X40 A;  7ICP A;  1S5L U;  9ICH A;  3BJY A;  3OJS A;  1ZYQ A;  1WUD A;  3JPS A;  1NNL A;  3EUB 2;  2EZY A;  4I2J A;  2LI6 A;  4F2S A;  4TUP A;  3BS5 B;  3RJH A;  4Q44 A;  4ICA A;  1SKS A;  3AMZ A;  2DFL A;  7ICM A;  3B0X A;  4DSK A;  3RJI A;  8ICZ A;  4PPX A;  2DKX A;  2A1J B;  1OW5 A;  1X9S A;  2G5I B;  2HBL A;  2KZZ A;  3QUC A;  5ALM A;  7ICF A;  3NVZ A;  1WCN A;  4R8U A;  1COO A;  2KKP A;  1D9D A;  5EWF A;  4M04 A;  1T4G A;  4NY8 A;  4NLZ A;  3GII A;  2EAN A;  2ZIV A;  2W11 A;  3QEA Z;  3G6Y A;  5AI4 A;  4DS5 A;  3WKC A;  4Z6E A;  5J2G A;  4YR2 A;  2I1Q A;  2JR5 A;  5KFT A;  3PO4 A;  1KN5 A;  4C8M A;  3E2E A;  3MGI A;  4KLD A;  3ISC A;  2D3D A;  4R65 A;  4O5E A;  4PGX A;  4R63 A;  3GV5 B;  2KFN A;  4JV0 A;  5ALV A;  1CEZ A;  4US9 A;  3KFU F;  8ICL A;  5KFW A;  5D46 A;  2C22 A;  4FE3 A;  2XY6 A;  4ED2 A;  4CE6 A;  1YT3 A;  4ECZ A;  3HPO A;  1HIW A;  2JH7 A;  3HJE A;  4ZOH C;  1MSW D;  7ICV A;  5KT5 A;  4RQ0 A;  5J2C A;  1RXV A;  1NKB A;  3RR8 A;  4RT3 A;  3F5E A;  4NWI A;  5J8Y A;  3L5K A;  1A0P A;  5DB8 A;  3MGV A;  4J9Q A;  4PHE A;  3M7D A;  4I27 A;  1X9M A;  4NLG A;  4FFD A;  2JXJ A;  1L8O A;  4IRD A;  5J0U A;  1ZQZ A;  3FC4 A;  5C5J A;  5HR6 A;  2XCA A;  4BDP A;  1S0V A;  3GIL A;  4OCZ A;  2KIC A;  4PL2 A;  5GTH U;  2XC9 A;  2HDO A;  3OHB A;  2KP7 A;  2QKQ A;  4I2F A;  2ZIW B;  2XGP A;  4QZG A;  2F3N A;  3ETL A;  8ICV A;  5DGA A;  4I29 A;  2ATL A;  3ZDA A;  3TAQ A;  4UAR A;  4UB5 A;  4MF2 A;  1DK3 A;  5IIO A;  2AU0 A;  2D8C A;  4TUR A;  5DG8 A;  2ASL A;  2YMP A;  1JX4 A;  2XVT A;  3MR3 A;  3SI8 A;  2PKE A;  3Q8M A;  5KFS A;  5ALR A;  4B9M A;  5IIL A;  4ELV A;  2HBK A;  4F5R A;  4EEY A;  4G3I A;  1JI7 A;  3GIM A;  1WYG A;  4FBU A;  2RDJ A;  5ALS A;  5KFE A;  4IS7 A;  4BWJ A;  4O3M A;  5DQG A;  1D9F A;  2JRZ A;  4EBE A;  5B66 U;  2HMX A;  5L1L A;  3DV9 A;  5ALD A;  4C8N A;  1ZQH A;  4P0P A;  5AM3 A;  2K8C B;  4ED8 A;  2QAR B;  2KEY A;  1FFU A;  5AM0 A;  4USA A;  4Y2J A;  5F3X B;  2H3Z A;  4QWA A;  4DL3 A;  1XSL A;  5HHI A;  4BX9 C;  4MEX A;  4ECS A;  1DK2 A;  1UA0 A;  2LM4 A;  2P6U A;  1HUZ A;  1IG6 A;  1ZQC A;  2LMR A;  4M0A A;  1IV8 A;  2BDU A;  2VA3 A;  5J0Y A;  2BGW A;  1N63 A;  1F0M A;  4DQQ A;  4K4G A;  3D6J A;  4OJO A;  1ED1 A;  3AUO A;  2ODG A;  2HHU A;  4IR1 A;  2ZIX B;  3EYZ A;  1XNS A;  2G06 A;  4YCX A;  1PVQ A;  2EDU A;  4JWM A;  3T5H A;  2KJ9 A;  2H3V A;  4CF3 A;  4XUS A;  2RDI A;  1HJP A;  4K4H A;  2BCR A;  3PX4 A;  3JPT A;  1XO0 A;  4UB4 A;  2R8I A;  3QNM A;  3FYH A;  2IMW P;  4PGQ A;  3N28 A;  3CW2 C;  1SL2 A;  1S10 A;  2Q0Z X;  5DQI A;  4HYK A;  4YXJ A;  4DOC A;  4DCC A;  2JMG A;  4OO1 J;  2IHN A;  3V7K A;  2K89 A;  3M9M B;  3UMB A;  5KFK A;  3NS1 A;  4TUQ A;  2KMD A;  3HP6 A;  3TAN A;  4GXK A;  1NK8 A;  4KX3 A;  4O3O A;  2E3T A;  5AKZ A;  3MC1 A;  1JN3 A;  2GH1 A;  2QB1 A;  4BXO A;  4B9S A;  4J9M A;  1SGG A;  3UXO A;  3SMV A;  4GXI A;  2PFQ A;  1MC8 A;  2MU2 A;  3M1Y A;  3ZD9 A;  4YD1 A;  5CA7 A;  3Q8K A;  3JPP A;  4DFM A;  3UMC A;  2HOQ A;  2WB1 F;  3OGU A;  5IIN A;  4ECV A;  4DSE A;  3HRD D;  3K1Z A;  1IM4 A;  9ICW A;  3KKA C;  9ICA A;  2J6U A;  2BZF A;  2YN4 A;  2KZM A;  3BQ0 A;  3AQE A;  1VLB A;  5HML A;  8ICU A;  5TIS U;  4AYB C;  3QZ7 A;  1PVR A;  3KOO A;  4IQV A;  3D2N A;  3OSP A;  5CB1 A;  3C2M A;  3PR4 A;  5KFD A;  1RYU A;  3NUQ A;  4O3N A;  7ICU A;  1PK1 B;  5AIA A;  3RH4 A;  2F8K A;  4DF4 A;  3MBY A;  2NO5 A;  1KEJ A;  5IIM A;  1NK9 A;  1X6I A;  3PNC A;  1U45 A;  9ICU A;  7ICO A;  2FDR A;  1MQ2 A;  3HX0 A;  4LZD A;  3T5L A;  4LZG A;  5KG3 A;  9ICV A;  1A6S A;  2ZXH A;  2KOB A;  1ZQW A;  5KFZ A;  3M8S A;  3LDA A;  3SZ2 A;  1NK4 A;  1FEZ A;  1X42 A;  2JGA A;  1ZD3 A;  1BGX T;  2HBJ A;  1SIJ A;  2DUY A;  5TZV A;  4UAV A;  5KG7 A;  4MF8 A;  2BQR A;  5KFN A;  2LYA A;  1L7O A;  3SV3 A;  1QTM A;  5KFC A;  2W7O A;  4ECX A;  3E0F A;  3Q8S B;  1X6J A;  2KKV A;  5DB7 A;  2HI0 A;  1ZQX A;  2V9W A;  4GC6 A;  3H0R B;  4RT2 A;  4UAU A;  3H0M B;  4RNM A;  3BZK A;  1KL9 A;  1OUQ A;  3NRZ A;  3HWT A;  4FBT A;  2UVV A;  3NRW A;  4RQ4 A;  2A19 A;  1PK3 A;  1L8L A;  3FM9 A;  1KRP A;  4B9U A;  4QWB A;  1NKC A;  1D8Y A;  1SV4 A;  5DQH A;  2F1H A;  5DB9 A;  4WJ3 B;  2UVU A;  2FJ6 A;  1S97 A;  1SL0 A;  2P66 A;  2HHW A;  1URJ A;  2ISP A;  2KIW A;  1TAM A;  1KLN A;  1KTQ A;  4Y2V A;  5AI6 A;  5L1J A;  2NRT A;  3ZD8 A;  2YML A;  2FMP A;  3PV8 A;  3EZ5 A;  5J8Y C;  4GXJ A;  4U7C A;  8ICI A;  3PSF A;  3GU3 A;  4AP9 A;  2ESE A;  2BDP A;  4O9M A;  4DFP A;  3AEV A;  4FZN A;  2K60 A;  5KNI A;  3UQ2 A;  3ONN A;  4QWC A;  4P4M A;  2BKE A;  4RQ2 A;  7ICR A;  5AM1 A;  4C7Y A;  1TAU A;  3K75 D;  4O5K A;  3Q8Q B;  2DPJ A;  3C1Y A;  2I5H A;  5AKJ A;  3OPX A;  7ICS A;  4M6W A;  1ZRM A;  3MDA A;  1VDV A;  1BPB A;  2EH9 A;  3PSI A;  4CF5 A;  1LV5 A;  2RQ5 A;  3SD7 A;  9ICI A;  3FAH A;  1D8B A;  3RBE A;  3WKD A;  4NLB A;  3UXP A;  4DL7 A;  3JPN A;  4CGZ A;  5ALL A;  2QLT A;  1SXE A;  2G08 A;  4UQG A;  3G6V A;  4DO9 A;  1T7P A;  2JEJ A;  4DF8 A;  3BQ1 A;  3C1Z A;  1T8E A;  4QZB A;  5KFP A;  4MEY A;  1CUK A;  3MR5 A;  4IQU A;  3F5A A;  3QUT A;  3NGD A;  5L1M A;  2W8L A;  4J9R A;  1QLN A;  2D6F C;  3RJF A;  4EYI B;  1ZD4 A;  2W3S A;  2BCS A;  5KFX A;  4KN4 A;  5J0X A;  1UT5 A;  2VA2 A;  3CRX A;  3SAG A;  3M6Z A;  4YG2 A;  4JUZ A;  1S8O A;  2EAO A;  4PHP A;  8ICN A;  1FO4 A;  2KZ3 A;  3BQ7 A;  4RQ6 A;  2YY6 A;  4RPZ A;  5ALQ A;  3BDP A;  4QZI A;  4KMO B;  4JMU A;  5BPC A;  3ZDD A;  5AKY A;  3OJU A;  5AHX A;  5EWE A;  1T94 A;  8ICP A;  4Y2T A;  2NRZ A;  2MRL A;  2BPC A;  4ECR A;  4UB8 U;  2ZIU B;  4XQ8 A;  2QAR A;  3WKE A;  3N4M B;  5ALW A;  3ORY A;  5BOM A;  2A1A A;  4I2I A;  5KFQ A;  5JTI A;  4NJ8 A;  1SKR A;  1SWW A;  5HR7 A;  3EWA A;  2EQY A;  1SV0 A;  1VJ5 A;  4I2H A;  2XCP A;  1DGJ A;  2BCQ A;  3T3F A;  1LVH A;  5J0T A;  4I2A A;  4P4O A;  2W9M A;  5CP2 A;  1BPE A;  5ALH A;  4XRH A;  1ZQR A;  3RTV A;  5KT7 A;  1BPX A;  2BHN A;  5KL8 B;  2E8M A;  5KG4 A;  4EBC A;  4PHD A;  1NK0 A;  3MFI A;  3HIL A;  4O5C A;  2WB1 C;  1N62 A;  5CWR A;  4US8 A;  9ICX A;  2GOL A;  9ICJ A;  4MFC A;  1WWU A;  2W55 A;  3TFS A;  4ZH4 A;  5AI9 A;  4B9N A;  4RUC A;  2F44 A;  2A3V A;  2IOF K;  1WWV A;  4XA5 A;  1EXN A;  2ASD A;  3C2L A;  1ZQF A;  4AYB F;  4DL6 A;  5KFY A;  4RZR A;  4EX7 A;  7ICE A;  5DGB A;  2PI5 A;  3AU6 A;  4M9L A;  4BUG A;  5ALO A;  4PJ0 U;  4Y2Q A;  5A0L A;  4Q43 A;  1WG8 A;  4CDG A;  3KHL A;  3KHR A;  4J03 A;  4LJX A;  5KG6 A;  5J2B A;  2JV3 A;  2QB0 B;  3PW7 A;  3IN5 A;  2WF6 A;  2P35 A;  2B21 A;  2R8J A;  5KFI A;  5DLF A;  3TFR A;  3AM9 A;  1U49 A;  4UB1 A;  4FS1 A;  1JXE A;  4F2R A;  4F50 A;  3VC8 A;  4F8R A;  3IDW A;  1JMS A;  1V9P A;  1RYR A;  3PX6 A;  2M0N A;  3PVX A;  3MFH A;  1P7D A;  1U47 A;  3H8W A;  5AM5 A;  3LWM A;  4C8L A;  1N48 A;  2NV3 A;  4B9L A;  2JH1 A;  5AKG A;  1TK8 A;  3V6K A;  4UBC A;  5J2D A;  1ZQV A;  3IV6 A;  4Y2Y A;  3AQF A;  1RDF A;  4JB3 A;  1L7P A;  2Z7J A;  3PW2 A;  4IRC A;  5AKE A;  5KAI U;  2MAX A;  1Z1V A;  2DBY A;  1S76 D;  5ALN A;  2VAN A;  8ICT A;  3NTU A;  1ECW A;  2W9A A;  5L1I A;  1Z00 B;  2RRD A;  3SAF A;  2R8G A;  4EEL A;  2AGO A;  9ICO A;  1UPH A;  4YMN A;  2DF4 B;  4GLX A;  4KLM A;  2WF7 A;  2FPL A;  2F8L A;  5KT4 A;  4CRX A;  4RU9 A;  9ICR A;  4OJL A;  3LVW A;  5EWG A;  2MUT A;  5KFU A;  2G07 A;  3TI0 A;  2KSO A;  3B9J A;  3RH6 A;  4NM2 A;  1MA7 A;  4YFK A;  3V72 A;  4DSJ A;  1NKE A;  3RR7 A;  2HHV A;  5JUM A;  4QWD A;  2V4R A;  4UAS A;  3SR6 A;  4PZN A;  2FE9 A;  4J9O A;  5GTI U;  1KDH A;  4KLO A;  2W7P A;  3ED5 A;  5IIK A;  4RUA A;  1UCV A;  4DS4 A;  4O3Q A;  5AK3 A;  4K4I A;  4UBB A;  9ICP A;  3RRH A;  2KFZ A;  1NI3 A;  4YR3 A;  2AQ4 A;  2FLP A;  2FMQ A;  1BPZ A;  5KFR A;  3H8S A;  3WK9 A;  5EE9 A;  5AM2 A;  2DL0 A;  1QSL A;  1TK5 A;  1GO3 F;  4OJ6 A;  2LHT A;  5KFM A;  2ZXI A;  4C4T A;  4F4K A;  4YXM A;  1ZQM A;  4M9H A;  1ZQA A;  5J2F A;  4F72 A;  1SZP A;  2B0C A;  3KHH A;  1Z19 A;  4YMO A;  5ALT A;  3LWL A;  4I2C A;  1RZT A;  1C20 A;  1RPL A;  2KNJ A;  1X9W A;  2NO4 A;  3AN1 A;  4I2B A;  1S0N A;  1RM6 C;  1ZQD A;  4QZ8 A;  1T3N A;  3Q8P B;  4F93 B;  3N7S C;  5D49 A;  4UAY A;  3V6H A;  4LVS A;  4JV2 A;  4ECU A;  1YZ7 A;  4DQR A;  3QX7 A;  1MN8 A;  9ICF A;  2KJ8 A;  5KG0 A;  3RFA A;  3RB3 A;  4R8U B;  1H38 A;  7ICQ A;  3M8R A;  3BZC A;  4KX5 A;  5H2F U;  1RYS A;  4P0Q A;  4UAZ A;  9ICT A;  3Q8L A;  5DBA A;  2H3F A;  1Q3U A;  1TAQ A;  2W9B A;  1D8L A;  5ALK A;  4DFK A;  3QU2 A;  2W04 A;  1JXL A;  4UB2 A;  5F9L A;  3K1R B;  4OD0 A;  2NRV A;  2Q4T A;  3KTQ A;  3ZDE A;  3OHA A;  5J2K A;  3RJK A;  5J2J A;  2PFN A;  2ZUD A;  1QSS A;  2ZJ8 A;  2OM6 A;  3T5K A;  4M9J A;  1LKY A;  2KK0 A;  4ACO A;  2JZB A;  7ICN A;  1SV0 C;  1SZH A;  3M9O B;  5KT3 A;  5ALE A;  3PW5 A;  4Y2X A;  4RPX A;  3SEN A;  2EZZ A;  1PUZ A;  2AH5 A;  2YMQ A;  2ZIU A;  2AJQ A;  3C21 A;  5KFV A;  1NJY A;  1ZQP A;  4KIT B;  2JEG A;  1XWL A;  1A77 A;  4F4Y A;  3PMN A;  4O3S A;  4M47 A;  5III A;  3QZ8 A;  3NVV A;  3TAC B;  5DKW A;  4EBD A;  5AK5 A;  2K8A A;  2XY5 A;  3QXG A;  5J0S A;  1LB2 B;  5KG5 A;  2E1E A;  4DWI A;  2ZTE A;  3WK8 A;  3CP8 A;  1X9X A;  1TV9 A;  4DQI A;  2UVW A;  7ICL A;  1B4F A;  5J2E A;  4J9K A;  2W03 A;  3BS5 A;  1ZQN A;  1CI4 A;  3ISB A;  1TKD A;  4EEN A;  8ICG A;  4EEK A;  5C0Y A;  1N61 A;  3LVV A;  4PZO A;  2A1J A;  3OTQ A;  4F92 B;  2BQ3 A;  4MFF A;  2ISO A;  1ZQL A;  4QJF B;  2OWO A;  2E8P A;  2FLN A;  2K4E A;  2K4P A;  2PFO A;  8ICK A;  5AKH A;  1L3V A;  2YTU A;  3KD3 A;  2Y0S F;  2NRX A;  1NJW A;  5AK4 A;  2KD1 A;  4YN4 A;  1ZQS A;  4DL4 A;  2XGQ A;  1SXD A;  4GFJ A;  4KLS A;  4F4W A;  3RH5 A;  1PVP A;  2KE7 A;  1JRP A;  4PHA A;  4FZL A;  3EPI A;  2K4I A;  3V7J A;  5K4L A;  4C4S A;  4F3O A;  3IG5 A;  5KFA A;  4C8O A;  4P0P B;  4J9L A;  8ICQ A;  4DFJ A;  1JAL A;  2VA8 A;  5EE0 A;  3H8M A;  1DXS A;  1KSP A;  2W43 A;  4B6J A;  1QQ6 A;  1L7M A;  5ALZ A;  3IM1 A;  2CPR A;  5B5E U;  1ZRN A;  2AGQ A;  1JRO A;  3PML A;  3GFK B;  4DOB A;  2OH2 A;  4NXZ A;  2WAQ C;  1UA1 A;  5KFL A;  5AIC A;  2CN1 A;  5ALU A;  4QIW F;  2O6K A;  4R66 A;  2P6R A;  2RLT A;  2IOF A;  1Z3E B;  1X2I A;  2YQE A;  2HHQ A;  3N7P D;  2AGP A;  8ICC A;  1N2X A;  1JUD A;  2IBK A;  4F5P A;  1Z1B A;  1L3U A;  2VJ4 A;  2ZG6 A;  4E0D A;  5ALP A;  3GDX A;  1Z4O A;  3U26 A;  3UMG A; 
#chains in the Genus database with same CATH homology
 4UB8 U;  3A0H U;  4PJ0 U;  5GTI U;  5B5E U;  5H2F U;  4UB6 U;  5E79 U;  5KAF U;  4IL6 U;  2AXT U;  2DUY A;  3KZI U;  5GTH U;  5B66 U;  5TIS U;  3A0B U;  5KAI U;  1S5L U;  3WU2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...