2AXTU

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
total genus 27
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2axtU01
5GTIU 3WU2U 4IL6U 1S5LU 4UB6U 5B66U 2AXTU 5H2FU 5B5EU 2DUYA 3A0HU 4UB8U 3KZIU 5KAIU 3A0BU 5GTHU 5E79U 4PJ0U 5KAFU 5TISU
chains in the Genus database with same CATH superfamily
2IOHA 2F2AB 5KFTA 4UAUA 1N62A 2FPLA 8ICZA 3GFKB 4MHVA 4EYHB 4MF2A 4TQSA 3THVA 3F2BA 3SAFA 4NV0A 2DPJA 7ICIA 2ISOA 2AHOB 5KFWA 4O3NA 3CYMA 5IILA 5HMLA 2ZJAA 3G6XA 4B9TA 2VJ5A 4M9JA 2W3RA 2BPFA 2BCQA 4JV2A 5ALUA 4CE6A 5BOMA 4FZMA 1C7YA 4ED2A 1D8YA 5KFLA 2JH7A 4KLSA 2JMGA 3WK5A 5J0QA 3ALRA 9ICBA 2FPKA 2KHVA 3RTVA 2KV2A 2XGQA 3TAQA 3TQ1A 3ISDA 7ICRA 4NXZA 2ALZA 5EE1A 4K4GA 2P6RA 5ALYA 8ICQA 5KFBA 4ACOA 4GLXA 1B43A 3C5FA 5CWRA 5L1MA 5ALLA 4J9LA 3ZDEA 4EBEA 4F4ZA 3QXGA 3PW4A 4F4KA 2MU2A 1TKDA 5J0OA 4DSKA 1K1QA 7ICEA 1ZQZA 4B6JA 4KN4A 4DFDA 2KJ5A 2E8PA 1L7MA 3H8MA 1F5SA 2WF5A 5KL1B 1NZBA 5DB9A 4UAWA 5J2FA 1MQ3A 1ZJNA 1SXDA 4US9A 5HR6A 2H5XA 1XO0A 2HDOA 2PFOA 2PKEA 3HT3A 2RDIA 8ICBA 2JXJA 1Y88A 1ZQXA 3UXOA 5HR7A 8ICUA 3QUTA 4QZIA 2WFAA 2WF8A 1UT5A 1K1SA 1RQNA 2JZBB 2ASJA 4P4MA 3PSTA 5J0TA 3SAHA 1Z19A 3SEIA 5A0LA 9ICRA 1NK5A 2WF6A 2OYYA 2PXIA 1QQ7A 4ECVA 4DSFA 5J2HA 4J9MA 4OJ6A 5ALXA 2KFZA 3SD7A 5KFJA 1JROA 2RLTA 3PW7A 3JPOA 3TARA 4DQQA 5DQHA 1CI4A 5J0UA 2VA3A 4C8KA 5AKXA 1ZXIA 3KKAA 4G3IA 2ZIWB 1BNOA 2EH9A 3AQEA 9ICMA 4RT2A 2GLEA 5KL8B 2DWQA 1SWVA 3QNMA 2WAQC 2VANA 3K4GA 4O5KA 5KFMA 4M9LA 4QZFA 8ICXA 5AI0A 7ICNA 3LYSA 4M0AA 5KFUA 2LMRA 2RHFA 3T79A 1NK7A 1NJZA 4K4HA 1ZQWA 4LVSA 4PHPA 4M9HA 1S0MA 5KFCA 4B9SA 4O3QA 2A3VA 4F50A 5AM1A 2N1RA 1IG6A 2PFNA 1Z3EB 1ZQRA 3WKDA 3HPOA 4MEYA 1LVHA 4IQUA 1KBUA 5AICA 2W3SA 4AYBC 5CA7A 1JI7A 1Z1VA 9ICVA 2KG5A 5AKGA 4MFCA 3SV4A 5DB7A 5AM3A 4RQ4A 3BQTA 5ALGA 2HOQA 1QSSA 2G08A 4NY8A 1TVAA 2VIXA 3V72A 1B22A 3NVVA 4Y2QA 4KLEA 7ICJA 4GXJA 3GDXA 2DL0A 3KZIU 3B9JA 2F8LA 2WB1F 3HP6A 3KD3A 5J2AA 2E8MA 4PZNA 4IC9A 1SXEA 4I2GA 2LYBA 2QARA 1A76A 5DG7A 4I27A 5AM0A 4B9VA 3C2KA 5ALOA 4OJLA 3SMVA 3HKZC 4Z6FA 2YTUA 2I1QA 2JH1A 3H7IA 5J0XA 4YXJA 1ZQIA 4RQ6A 5ALZA 2EQYA 3PVXA 1A0PA 5T14A 2OCEA 5J0YA 2AQ4A 4KLTA 5CEHA 2CPRA 2YB4A 1TAUA 2W8LA 1U47A 2IA6A 4RUCA 3ZDBA 4RNOA 2IHNA 4ELUA 5KG4A 4NLCA 4ELTA 3CRXA 4M6WB 4UB2A 2XC9A 5KFKA 1Z1BA 4I2JA 1PZNA 3S6JA 2DUYA 3BS5B 3L3FX 5KT5A 4QZAA 4CDGA 5AKIA 4DF8A 1N60A 4GFJA 3ISCA 3QZ7A 1GO3F 2EZXA 2HI0A 2NRTA 2NRXA 5KTQA 2AJQA 3WK7A 4RNNA 4F2SA 1SZPA 4EBDA 2FLLA 5IIKA 3JPSA 3A0BU 2DKZA 4PH5A 5KG6A 4J9RA 4RQMA 4UB5A 4PHAA 2NRWA 4DFJA 5IIJA 1KTQA 4TUPA 1LV5A 3M6KA 2JZBA 1ZQTA 2FMQA 2YQEA 5L9XA 3JPQA 7ICHA 1SZHA 1U48A 8ICAA 1BPDA 1L7OA 2XY5A 4FE3A 1QH9A 4JK1A 2EAMA 2KJ8A 2EDUA 2HHUA 1N61A 2DGZA 1V9PA 1L7PA 1WUDA 8ICRA 4MFAA 3ZDAA 2KK0A 5EE9A 1SV0A 2YY6A 1XU4A 5ALKA 4Y2TA 2ZIWA 4QIWF 5KFDA 4ECYA 3ICXA 2OXOA 4KN7A 5C0YA 2I6XA 2QKQA 3EYZA 3AU2A 4JV0A 4QZEA 1YZ6A 1ZQLA 1KL9A 3H4BA 2BCSA 2WF7A 3N28A 4DSIA 2W8KA 1HEKA 3WKBA 3GIIA 4QWEA 1L7NA 5F3XB 1BPYA 1BPBA 4FFDA 2KNJA 1XNSA 1RPLA 1KEJA 5J2EA 3WK9A 2I9GA 3OTQA 7ICTA 1M6YA 2KICA 4QZHA 4GIBA 4OD0A 3EPGA 3PV8A 4RU9A 3L4PA 2LBOA 3IM1A 7ICKA 5ALDA 3OSPA 3OJSA 2P35A 2ESEA 5KT6A 2F1JA 3Q8RB 3PX0A 4YD2A 9ICWA 3PMNA 3KOOA 4USAA 4X5VA 2BQ3A 2ZJ8A 3MR6A 3OHAA 3Q8MA 7ICFA 4Y2VA 1UHUA 1UT8A 4NM1A 1JMSA 2LYAA 3PR5B 4JB3A 3RB3A 5DB8A 1T94A 3TACB 3ZDCA 2UVUA 2ZTCA 2K4EA 4O3PA 5KG0A 3PSPA 1ECWA 2HVHA 1O03A 2H3VA 4C4RA 4QZDA 4UB4A 1HJPA 2J6UA 7ICQA 5EWGA 5B66U 2ZIVB 1RYRA 1L6NA 1NK4A 2YB1A 3WK6A 3SI8A 8ICHA 3A0HU 3RJJA 2G09A 3JPTA 2XCPA 3BZCA 4K4IA 1N5WA 4NLKA 1MN8A 4P2HA 3T5KA 1ZJMA 2DPIA 2OH2A 8ICIA 3OJUA 1J2MA 1TV9A 2DBYA 5HMMA 1NZPA 5AIBA 2KTQA 1EXNA 4P0QB 3B0YA 4UAYA 3L5KA 3UQ0A 2F1IA 2FI1A 9ICNA 1RZTA 3C28A 4I2EA 9ICQA 4M6WA 3Q8LA 2W9BB 3C2MA 2MSNA 4FZLA 4QZGA 1TK5A 8ICYA 3BS5A 3LDAA 3RH6A 5J2BA 4KLDA 4TQRA 2UVRA 4US8A 1OXJA 2C2DA 3K75D 1BPZA 8ICKA 4F72A 4IL6U 5KFQA 1KQQA 2F76X 1PUZA 2KVCA 5AM4A 4C4SA 2HOFA 3MR3A 3MGHA 1JRPA 4FS1A 4M47A 3Q8SB 3MFHA 3GILA 3PW5A 3IHQB 2GH1A 5DG8A 2LPEA 2V9WA 4Q8EA 5KFSA 5DDYA 4Z6EA 3CP8A 5JUMA 1NOMA 4NJ8A 5AK4A 3M8RA 3LWMA 1WCLA 1WWVA 4ED7A 5ALPA 3MDAA 2R8GA 2JHDA 4P4OA 1PK3A 3H8JA 5AK5A 5ALQA 1RXWA 2NRVA 4UQGA 1S0NA 5CB1A 8ICWA 2KIWA 3HW8A 5D4BA 4J03A 2VJ4A 3WKCA 3HJEA 4E0DA 2OHFA 1IM4A 1X9SA 2ZTEA 5TISU 1ZD2P 9ICJA 1Q8KA 3RJHA 2XIDA 5AKKA 4CNQA 3M8SA 3WK4A 1FFVA 2BQUA 2MUTB 4YMNA 1BGXT 1Q46A 3RB4A 4UB8U 3E58A 1S8OA 1V85A 3AN1A 4KX3A 1SL1A 1HUZA 3F5EA 3KTQA 4J9SA 1JALA 4Y2RA 4RQ8A 4G9BA 4LJXA 2WHEA 9ICPA 5KFOA 4EZ6A 2XICA 5AI6A 2IOFK 4CRXA 7ICVA 4C4TA 1UA0A 3H0LB 5DLGA 3N97B 3H40A 2JEIA 2HVIA 1SKWA 2HHQA 3MDCA 5AI4A 2PI5A 2FJ6A 4O3RA 2XO7A 3VC8A 1ZQMA 4ELVA 4IR1A 4PHEA 4KLMA 3D2QA 5AI8A 3KHLA 1COKA 5EOZA 3OHBA 5EWEA 5D46A 1T4GA 1ZD5A 5KG7A 4PGQA 3BZKA 2R8IA 2KP7A 5HHHA 2KEYA 4GXKA 3Q8PB 2FLNA 5KFFA 3V7LA 3PNCA 2RQ5A 3KKAC 1TE2A 1X6JA 2A1JB 4DFPA 2KOBA 3JPNA 5D49A 1XO1A 5AM5A 4BXOB 7ICLA 4DL6A 3RH4A 4RQ5A 4CGZA 5ALRA 2I5HA 2ZIVA 3M9NB 1WWUA 3IRUA 2AXTU 3AU6A 4B9MA 3IG5A 3RAQA 2P66A 4ECUA 4XA5A 5J2GA 2R8KA 1NKCA 3JPRA 3IN5A 5CRXA 2Y1JA 1ZOLA 4XRHA 2WB1C 4P0PB 1X9XA 5HNKA 4YD1A 2Y1IA 2AH5A 5IINA 2EAPA 2YN4A 2NO5A 3BDPA 2MA1A 1X9MA 5H2FU 2JR5A 4KTQA 4R8UB 1N5XA 4ECWA 4O0IA 3LWLA 4TUSA 1RQLA 4RZRA 3V6KA 4NLNA 3PMLA 4M9NA 4C0ZA 1SGGA 1F0MA 2W9BA 4DQSA 5KG2A 5AKYA 3RB6A 2AU0A 3PY8A 2HHVA 4LZGA 5JRTA 5EE0A 1ZQFA 4F5RA 4YFKA 2PI4A 2YMQA 7ICUA 3PX4A 2F3NA 5JTIA 9ICLA 2B0CA 5KG3A 4Q44A 3GV8B 3EPIA 2O6KA 4CF4A 3PO5A 4BGDA 2KKPA 3TADA 2EANA 1S76D 3M7DA 3H0MB 1F44A 4XUSA 2UVVA 3RJKA 1ZRNA 2DF4B 3TKAA 1ZQHA 5DBAA 1N56A 3SZ2A 2NYVA 5J2IA 5ALIA 4FS2A 1TAMA 2A19A 4C7ZA 5J0PA 2OEHA 3Q8QB 2KHQA 1ZQGA 4IRDA 1SIJA 2NRZA 4UB3A 1RYUA 1CUKA 4J9OA 1PVPA 4YR0A 3WKEA 2RDJA 1X6IA 2KD1A 3NVZA 4F3OA 2K4HA 2ISPA 5ALJA 5FP0A 2EZYA 3UMCA 3RF9A 2F1HA 4OJ5A 2XY7A 3UQ2A 2ZG6A 2EZZA 2K8BB 3QU2A 3GZFA 3BQ7A 1VLBA 3D6JA 3WKAA 2ZUCA 2B21A 4FO6A 2KVSA 4EX7A 4RQ7A 4JWNA 2LHTA 2KSOB 2R18A 3N4MB 4RQ0A 2Q0ZX 3RJIA 2BGWA 3TI0A 5KG5A 1IV8A 1PVRA 3D2NA 5ALTA 1Q3VA 2ATLA 2IMWP 5J8YA 3J81j 4ZH4A 4BUGA 3TANA 2G0AA 4OJPA 4F91B 3MR5A 4NLGA 3KZXA 4BWMA 3O0FA 1BVSA 2H3QA 3EUB2 4RQ3A 4DF4A 2W9CB 2HHSA 9ICAA 3MC1A 3M1YA 1S97A 4QIWC 1D8BA 4YMMA 1FEZA 4HAIA 4TURA 4RQNA 3V6HA 3UXPA 3T5HA 4KLOA 3NASA 1L3UA 1VDVA 5KFZA 3KHGA 1KDHA 1WCNA 4EBCA 1QLNA 5AKHA 4I2FA 4ECQA 1DXSA 5C5JA 4RPYA 1NJYA 2LM1A 1XSLA 2YMLA 5JU5A 3TAPA 4WJ3B 1D9DA 4A8EA 1S9FA 1SV0C 4QZ9A 4Y2JA 4IQWA 2EAOA 4BDPA 2ZXIA 4O9MA 2A1JA 2FPMA 3UMBA 5ALVA 3N7SC 2G06A 2JV3A 3EWAA 3ZI4A 4BXOA 5J2DA 4Q43A 3NRWA 3SYZA 5ALMA 3KHHA 4IRCA 2Y0SF 5E79U 4BJQA 2WTFA 3E0FA 4F71A 4UATA 4Y2PA 4Z6CA 5AHXA 3RH5A 1ZETA 2KZZA 5KFAA 4JWMA 4CF3A 2HW3A 3D2SA 5AM2A 2JEGA 3KHRA 2W9MA 1KW4A 1ZQ1C 3FC4A 2IOFA 7ICSA 8ICMA 5AKJA 1UA1A 2DFLA 2K4PA 3OPXA 1HUOA 7ICMA 1ZQNA 5F9LA 4F92B 3H4DA 1L5UA 2G5IB 2K4IA 4QZBA 4NL9A 5AIAA 1ZQKA 3RR8A 4R8UA 5L1KA 3GU3A 3RBEA 3C2LA 4PHDA 1Z4OA 3BQ1A 3ISBA 4BWJA 4QZCA 4YR3A 1S77D 3HRDD 3N7RC 2IHMA 3QX7A 4ECXA 4YP3A 3AQFA 1MA7A 4QWAA 4ED0A 5AKZA 8ICTA 1T7PA 4U6PA 4M2YA 5J0SA 3QE9Y 2WF9A 5KT2A 2W04A 1UPHA 1RYSA 3LVWA 3UM9A 4UASA 4P4PA 1ZQAA 3NS1A 2K8CB 1X66A 4DEZA 8ICEA 1TK0A 3QU5A 3DEEA 5TZVA 4JV1A 3EZ5A 1D8LA 1QQ6A 3MR2A 2NO4A 2D3DA 2ZUDA 4MF8A 5KFYA 2CN1A 1T3QA 1T3NA 3RJEA 3SV3A 2XI9A 2LKYA 4IQVA 2H3ZA 4YG2A 2D8CA 1NJXA 1IIPA 2FLPA 4QWCA 1PVQA 3CW2C 1QTMA 4UBCA 5KFPA 4DS4A 4NLZA 2W03A 4PL2A 1NK6A 1QCKA 4QW9A 3C1YA 5CP2A 9ICKA 4HYKA 3C23A 3G6YA 4KLQA 2YX8A 3T5JA 2FMPA 1XSNA 4DLEA 1X42A 3RJGA 4FBTA 4YMOA 2KSOA 1U9LA 2RRDA 5DG9A 1MC8A 4UBBA 3GIMA 2R8HA 1S5LU 2AGQA 1P7DA 2K60A 2PMZF 4UAZA 5ALSA 4J9KA 3NRZA 1NK0A 4KLFA 1NJWA 4RNMA 3DV9A 2E8OA 4I2AA 4I2DA 5KFXA 5DLFA 1QQ5A 5DB6A 4M9GA 3QUBA 4UAVA 8ICSA 1X9WA 1S0VA 2W9CA 2BCVA 4ED1A 3QU7A 3ZD8A 4DOCA 4JMUA 3V7KA 4F5NA 2VA2A 1O08A 4GXIA 1JUDA 2YMPA 2BR0A 3IP4B 4IS7A 8ICJA 5G5HA 8ICFA 4Y2XA 3BS7A 2K8AA 1D9FA 4KMUA 5GTIU 4Q45A 4RQ2A 2ZJ5A 1KFTA 1NNLA 3NVYA 5KNIA 3MGVA 3MGIA 5IIOA 1YT3A 1XSPA 2AGPA 1X40A 4UB1A 2FE9A 2HHXA 8ICNA 2QARB 2J6TA 9ICTA 1DGSA 4YR2A 5J2JA 4DS5A 2BHNA 4J9PA 3C29A 1J2NA 3UPQA 1ZQBA 1JX4A 4F5QA 3SAGA 8ICLA 2G07A 3QU9A 4I28A 1NK8A 1ZQOA 1U45A 3SR6A 2Q4TA 2JEJA 1RXVA 2AGOA 4U7CA 2BCRA 2DQNB 3GIKA 4F4XA 9ICUA 1DK3A 2ZIUB 2ZXHA 3M6ZA 3RBDA 2PFPA 5KFIA 4DQPA 3JPPA 9ICGA 4I2HA 1V38A 2XGPA 4BX9C 4J9QA 3AUOA 3RAXA 4Y2YA 4DL5A 4MEXA 1JIHA 4J9NA 3FDSA 3AEVA 4DL3A 5GTHU 1QSLA 5K4LA 5DGAA 1IXRA 3UMGA 3TFRA 4DLGA 4UB6U 1TFRA 1ZQSA 4R64A 2KE7A 4UW9A 1CEZA 2R8JA 4C80A 3V6JA 4KLGA 4QWDA 1CRXA 2GO7A 3MBYA 2LM4A 1VJ5A 1SKSA 2JGAA 1ZQVA 3Q8KA 4DO9A 5CHGA 3C21A 3PR4A 4R66A 4DCCA 4CCHA 3B0XA 1U49A 3K1RB 5DQGA 9ICEA 2ZIXB 1DRGA 3C5GA 2CXYA 2L5YA 5ALEA 2HHTA 4DSEA 1MQ2A 3T3FA 4NLBA 5KAIU 3ZD9A 5KFNA 5DDMA 8ICPA 4KLLA 3MABA 5AI5A 3UXNA 3NVWA 4LZDA 1AROP 2W55A 3NTUA 4F8RA 3ORYA 3GV7B 4OJOA 4OO1J 3FAHA 4C8OA 2K89A 1T8EA 4I2BA 4PGYA 5KFGA 4YCXA 5IIMA 1DGJA 1SWWA 3ETLA 4XQ8A 3LVVA 1Z00B 3BQ2A 3RFAA 5KFRA 1BPEA 3I76A 3MFIA 2ODGA 1TK8A 2W54A 3BJYA 2FDRA 3WK8A 3HILA 4P0QA 3H8SA 1C20A 5BOLA 1RM6C 9ICSA 4IR9A 3QEAZ 1KN5A 1SL0A 2C2RA 2Y9UA 4C7YA 1J97A 1NI3A 5KFVA 5KFEA 1ZQJA 3KBBA 5DKWA 5B5EU 8ICCA 4ZOHC 5F9NA 7ICPA 1JXEA 3TADC 4ED8A 4O3SA 3ED5A 3NGDA 2W7OA 4DSLA 4F2RA 7ICOA 2WAQF 3LK9A 4R65A 2QB1A 1K5OA 5AKEA 5J2CA 1SKRA 3KFUF 1YZ7A 2ZUBA 4DOAA 4PZOA 4CF5A 1MSWD 5BPCA 4DFKA 3QYPA 2BQRA 3GIJA 1PK1B 2BKEA 5ALFA 3E2EA 4I2IA 5KT3A 2ASLA 1FFUA 4FBUA 4EELA 4OCZA 5KT7A 4UARA 4Y2SA 4O3OA 3RB0A 2GWSA 4YN4A 3QU4A 4YXMA 4YQWA 4KLUA 5CJ7A 1ZQUA 3M9OB 4KITB 4ECSA 4PPXA 5KT4A 1XWLA 3N7PD 4QZ8A 4AYBF 1FO4A 1Q3UA 4R63A 2E8NA 2BPCA 2GOLA 5ALWA 1H38A 4KMOB 4EENA 2OWOA 1SL2A 4RQ1A 3FM9A 2C2EA 3OSNA 2MUTA 5J0WA 1U4BA 1LKYB 4JUZA 1DOQA 3G6VA 2D6FC 3PO4A 5J8YC 2BDPA 3RJFA 5HHIA 2ZIUA 2QB0B 4ECRA 4YVZA 1BNPA 4ED3A 5KAFU 1S0OA 5DBCA 1ZD4A 2G5HB 5AKLA 4EX6A 4Q8FA 1A77A 3PZPA 1ZQQA 3F2DA 2LYHA 9ICIA 5J2KA 3U26A 4EEYA 4DWIA 2XCAA 4EZ9A 4I2CA 1ZQDA 3OGUA 5ALHA 1AQ6A 2J6SA 2Y0SC 3M9MB 1UCVA 2E3TA 2Y9TA 2B6GA 4KLHA 2UVWA 1N48A 1L3TA 1NKBA 2CRXA 2BDUA 1ZQCA 9ICXA 5KFHA 2P6UA 9ICFA 1KLNA 3HKZF 1XS9D 2H3FA 2KZMA 2C28A 3IG8A 1ZRMA 2W7PA 3TFSA 2KFNA 2Z7JA 3HX0A 5L1LA 3DDHA 2NV3A 3NUQA 2E1EA 2HHWA 3FYHA 4M04A 3GQCA 2ES6A 4F93B 4KX5A 2KZ3A 2HCFA 2ZIXA 4QNLA 4O5EA 4F5OA 3AMZA 2KMDA 1RG6A 2RP5A 4DFMA 2ZTDA 8ICVA 5DQIA 1S10A 3K1ZA 9ICOA 3ETRA 1A6SA 5L1JA 1ZQEA 4ECZA 3SQIA 2VKQA 1L3VA 3R9KA 1QSYA 3PW2A 5DBBA 5EE3A 2KKVA 1KSPA 2BPGA 5EWFA 2E1FA 2KIVA 1NKEA 7ICGA 5AK6A 1JXLA 3I1YA 1COOA 1ZQYA 1HIWA 5DGBA 4P0PA 2VA8A 4DOBA 1DK2A 4PL1A 4QJFB 4KLJA 4AP9A 4B9UA 4NL9C 1XC9A 3ONNA 3IV6A 3WU2U 1Z00A 3F53A 4O5CA 4F4WA 2M0NA 2V4RA 4DQRA 1Z4NA 4GC6A 1N2XA 1B4FA 4ICAA 4NWIA 3QZ8A 2MAXA 1SV4A 3BQ0A 3CNHA 2H3IA 2E5SA 1V97A 2F77X 2KJ9A 4O3MA 1URJA 4QWBA 4RUAA 2XVTA 2HBMA 2HMXA 2JRZA 3QUQA 5KG1A 3SENA 3T5LA 1L8LA 1TAQA 3HWTA 4DSJA 8ICGA 4GC7A 2IBKA 1NK9A 2HOIA 3IDWA 3ZDDA 2W9AA 3PW0A 1N63A 9ICCA 2W43A 1RDFA 2PFQA 2QLTA 2OM6A 1ZQPA 2PMZC 4PGXA 4MFFA 1ED1A 1L8OA 1LB2B 2ASDA 9ICHA 1KFSA 1WYGA 4C8MA 3GV5B 5G5GA 4NM2A 1PK1A 2YMMA 1KRPA 2XY6A 1OW5A 4PJ0U 4ED6A 3VCBA 2A1AA 2F44A 5AK3A 2LI6A 4TUQA 2V4QA 5ALNA 3V7JA 4ECTA 4EEKA 3AM9A 1X2IA 2KN7A 3H0RB 5L1IA 4RT3A 3QEBZ 4RPXA 5AI9A 2HBJA 2HSZA 2MRLA 3RRHA 1ZYQA 1FIQA 4DQIA 2F8KA 2DKXA 1B0XA 4IRKA 1OUQA 4Z6DA 4RPZA 5J29A 4QW8A 4B9LA 1KFDA 3PSFA 2JEFA 4I29A 1LKYA 1UQVA 4DL4A 4IQTA 3C1ZA 2QB0A 1L3SA 8ICOA 4EYIB 4C8NA 4F4YA 2BCUA 3AL0B 2AQ0A 1ZD3A 5IIIA 4DL2A 4DL7A 4KLIA 3I28A 5J0RA 4F5PA 5HP4A 1JN3A 4C8LA 2HBLA 5CR0A 4B9NA 3RR7A 3QUCA 1KKXA 2BZFA 3F2CA 1WG8A 1SB3C 3F5AA 2W11A 4Y2UA 3RRGA 2FMSA 1BPXA 3H8WA 3PSIA 3PX6A 2C22A 2M9NA 3EW9A 4FZNA 2HBKA
chains in the Genus database with same CATH topology
5GTIU 3WU2U 4IL6U 1S5LU 4UB6U 5B66U 2AXTU 5H2FU 5B5EU 2DUYA 3A0HU 4UB8U 3KZIU 5KAIU 3A0BU 5GTHU 5E79U 4PJ0U 5KAFU 5TISU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI U;  3WU2 U;  4IL6 U;  1S5L U;  4UB6 U;  5B66 U;  2AXT U;  5H2F U;  5B5E U;  2DUY A;  3A0H U;  4UB8 U;  3KZI U;  5KAI U;  3A0B U;  5GTH U;  5E79 U;  4PJ0 U;  5KAF U;  5TIS U; 
#chains in the Genus database with same CATH topology
 2IOH A;  2F2A B;  5KFT A;  4UAU A;  1N62 A;  2FPL A;  8ICZ A;  3GFK B;  4MHV A;  4EYH B;  4MF2 A;  4TQS A;  3THV A;  3F2B A;  3SAF A;  4NV0 A;  2DPJ A;  7ICI A;  2ISO A;  2AHO B;  5KFW A;  4O3N A;  3CYM A;  5IIL A;  5HML A;  2ZJA A;  3G6X A;  4B9T A;  2VJ5 A;  4M9J A;  2W3R A;  2BPF A;  2BCQ A;  4JV2 A;  5ALU A;  4CE6 A;  5BOM A;  4FZM A;  1C7Y A;  4ED2 A;  1D8Y A;  5KFL A;  2JH7 A;  4KLS A;  2JMG A;  3WK5 A;  5J0Q A;  3ALR A;  9ICB A;  2FPK A;  2KHV A;  3RTV A;  2KV2 A;  2XGQ A;  3TAQ A;  3TQ1 A;  3ISD A;  7ICR A;  4NXZ A;  2ALZ A;  5EE1 A;  4K4G A;  2P6R A;  5ALY A;  8ICQ A;  5KFB A;  4ACO A;  4GLX A;  1B43 A;  3C5F A;  5CWR A;  5L1M A;  5ALL A;  4J9L A;  3ZDE A;  4EBE A;  4F4Z A;  3QXG A;  3PW4 A;  4F4K A;  2MU2 A;  1TKD A;  5J0O A;  4DSK A;  1K1Q A;  7ICE A;  1ZQZ A;  4B6J A;  4KN4 A;  4DFD A;  2KJ5 A;  2E8P A;  1L7M A;  3H8M A;  1F5S A;  2WF5 A;  5KL1 B;  1NZB A;  5DB9 A;  4UAW A;  5J2F A;  1MQ3 A;  1ZJN A;  1SXD A;  4US9 A;  5HR6 A;  2H5X A;  1XO0 A;  2HDO A;  2PFO A;  2PKE A;  3HT3 A;  2RDI A;  8ICB A;  2JXJ A;  1Y88 A;  1ZQX A;  3UXO A;  5HR7 A;  8ICU A;  3QUT A;  4QZI A;  2WFA A;  2WF8 A;  1UT5 A;  1K1S A;  1RQN A;  2JZB B;  2ASJ A;  4P4M A;  3PST A;  5J0T A;  3SAH A;  1Z19 A;  3SEI A;  5A0L A;  9ICR A;  1NK5 A;  2WF6 A;  2OYY A;  2PXI A;  1QQ7 A;  4ECV A;  4DSF A;  5J2H A;  4J9M A;  4OJ6 A;  5ALX A;  2KFZ A;  3SD7 A;  5KFJ A;  1JRO A;  2RLT A;  3PW7 A;  3JPO A;  3TAR A;  4DQQ A;  5DQH A;  1CI4 A;  5J0U A;  2VA3 A;  4C8K A;  5AKX A;  1ZXI A;  3KKA A;  4G3I A;  2ZIW B;  1BNO A;  2EH9 A;  3AQE A;  9ICM A;  4RT2 A;  2GLE A;  5KL8 B;  2DWQ A;  1SWV A;  3QNM A;  2WAQ C;  2VAN A;  3K4G A;  4O5K A;  5KFM A;  4M9L A;  4QZF A;  8ICX A;  5AI0 A;  7ICN A;  3LYS A;  4M0A A;  5KFU A;  2LMR A;  2RHF A;  3T79 A;  1NK7 A;  1NJZ A;  4K4H A;  1ZQW A;  4LVS A;  4PHP A;  4M9H A;  1S0M A;  5KFC A;  4B9S A;  4O3Q A;  2A3V A;  4F50 A;  5AM1 A;  2N1R A;  1IG6 A;  2PFN A;  1Z3E B;  1ZQR A;  3WKD A;  3HPO A;  4MEY A;  1LVH A;  4IQU A;  1KBU A;  5AIC A;  2W3S A;  4AYB C;  5CA7 A;  1JI7 A;  1Z1V A;  9ICV A;  2KG5 A;  5AKG A;  4MFC A;  3SV4 A;  5DB7 A;  5AM3 A;  4RQ4 A;  3BQT A;  5ALG A;  2HOQ A;  1QSS A;  2G08 A;  4NY8 A;  1TVA A;  2VIX A;  3V72 A;  1B22 A;  3NVV A;  4Y2Q A;  4KLE A;  7ICJ A;  4GXJ A;  3GDX A;  2DL0 A;  3KZI U;  3B9J A;  2F8L A;  2WB1 F;  3HP6 A;  3KD3 A;  5J2A A;  2E8M A;  4PZN A;  4IC9 A;  1SXE A;  4I2G A;  2LYB A;  2QAR A;  1A76 A;  5DG7 A;  4I27 A;  5AM0 A;  4B9V A;  3C2K A;  5ALO A;  4OJL A;  3SMV A;  3HKZ C;  4Z6F A;  2YTU A;  2I1Q A;  2JH1 A;  3H7I A;  5J0X A;  4YXJ A;  1ZQI A;  4RQ6 A;  5ALZ A;  2EQY A;  3PVX A;  1A0P A;  5T14 A;  2OCE A;  5J0Y A;  2AQ4 A;  4KLT A;  5CEH A;  2CPR A;  2YB4 A;  1TAU A;  2W8L A;  1U47 A;  2IA6 A;  4RUC A;  3ZDB A;  4RNO A;  2IHN A;  4ELU A;  5KG4 A;  4NLC A;  4ELT A;  3CRX A;  4M6W B;  4UB2 A;  2XC9 A;  5KFK A;  1Z1B A;  4I2J A;  1PZN A;  3S6J A;  2DUY A;  3BS5 B;  3L3F X;  5KT5 A;  4QZA A;  4CDG A;  5AKI A;  4DF8 A;  1N60 A;  4GFJ A;  3ISC A;  3QZ7 A;  1GO3 F;  2EZX A;  2HI0 A;  2NRT A;  2NRX A;  5KTQ A;  2AJQ A;  3WK7 A;  4RNN A;  4F2S A;  1SZP A;  4EBD A;  2FLL A;  5IIK A;  3JPS A;  3A0B U;  2DKZ A;  4PH5 A;  5KG6 A;  4J9R A;  4RQM A;  4UB5 A;  4PHA A;  2NRW A;  4DFJ A;  5IIJ A;  1KTQ A;  4TUP A;  1LV5 A;  3M6K A;  2JZB A;  1ZQT A;  2FMQ A;  2YQE A;  5L9X A;  3JPQ A;  7ICH A;  1SZH A;  1U48 A;  8ICA A;  1BPD A;  1L7O A;  2XY5 A;  4FE3 A;  1QH9 A;  4JK1 A;  2EAM A;  2KJ8 A;  2EDU A;  2HHU A;  1N61 A;  2DGZ A;  1V9P A;  1L7P A;  1WUD A;  8ICR A;  4MFA A;  3ZDA A;  2KK0 A;  5EE9 A;  1SV0 A;  2YY6 A;  1XU4 A;  5ALK A;  4Y2T A;  2ZIW A;  4QIW F;  5KFD A;  4ECY A;  3ICX A;  2OXO A;  4KN7 A;  5C0Y A;  2I6X A;  2QKQ A;  3EYZ A;  3AU2 A;  4JV0 A;  4QZE A;  1YZ6 A;  1ZQL A;  1KL9 A;  3H4B A;  2BCS A;  2WF7 A;  3N28 A;  4DSI A;  2W8K A;  1HEK A;  3WKB A;  3GII A;  4QWE A;  1L7N A;  5F3X B;  1BPY A;  1BPB A;  4FFD A;  2KNJ A;  1XNS A;  1RPL A;  1KEJ A;  5J2E A;  3WK9 A;  2I9G A;  3OTQ A;  7ICT A;  1M6Y A;  2KIC A;  4QZH A;  4GIB A;  4OD0 A;  3EPG A;  3PV8 A;  4RU9 A;  3L4P A;  2LBO A;  3IM1 A;  7ICK A;  5ALD A;  3OSP A;  3OJS A;  2P35 A;  2ESE A;  5KT6 A;  2F1J A;  3Q8R B;  3PX0 A;  4YD2 A;  9ICW A;  3PMN A;  3KOO A;  4USA A;  4X5V A;  2BQ3 A;  2ZJ8 A;  3MR6 A;  3OHA A;  3Q8M A;  7ICF A;  4Y2V A;  1UHU A;  1UT8 A;  4NM1 A;  1JMS A;  2LYA A;  3PR5 B;  4JB3 A;  3RB3 A;  5DB8 A;  1T94 A;  3TAC B;  3ZDC A;  2UVU A;  2ZTC A;  2K4E A;  4O3P A;  5KG0 A;  3PSP A;  1ECW A;  2HVH A;  1O03 A;  2H3V A;  4C4R A;  4QZD A;  4UB4 A;  1HJP A;  2J6U A;  7ICQ A;  5EWG A;  5B66 U;  2ZIV B;  1RYR A;  1L6N A;  1NK4 A;  2YB1 A;  3WK6 A;  3SI8 A;  8ICH A;  3A0H U;  3RJJ A;  2G09 A;  3JPT A;  2XCP A;  3BZC A;  4K4I A;  1N5W A;  4NLK A;  1MN8 A;  4P2H A;  3T5K A;  1ZJM A;  2DPI A;  2OH2 A;  8ICI A;  3OJU A;  1J2M A;  1TV9 A;  2DBY A;  5HMM A;  1NZP A;  5AIB A;  2KTQ A;  1EXN A;  4P0Q B;  3B0Y A;  4UAY A;  3L5K A;  3UQ0 A;  2F1I A;  2FI1 A;  9ICN A;  1RZT A;  3C28 A;  4I2E A;  9ICQ A;  4M6W A;  3Q8L A;  2W9B B;  3C2M A;  2MSN A;  4FZL A;  4QZG A;  1TK5 A;  8ICY A;  3BS5 A;  3LDA A;  3RH6 A;  5J2B A;  4KLD A;  4TQR A;  2UVR A;  4US8 A;  1OXJ A;  2C2D A;  3K75 D;  1BPZ A;  8ICK A;  4F72 A;  4IL6 U;  5KFQ A;  1KQQ A;  2F76 X;  1PUZ A;  2KVC A;  5AM4 A;  4C4S A;  2HOF A;  3MR3 A;  3MGH A;  1JRP A;  4FS1 A;  4M47 A;  3Q8S B;  3MFH A;  3GIL A;  3PW5 A;  3IHQ B;  2GH1 A;  5DG8 A;  2LPE A;  2V9W A;  4Q8E A;  5KFS A;  5DDY A;  4Z6E A;  3CP8 A;  5JUM A;  1NOM A;  4NJ8 A;  5AK4 A;  3M8R A;  3LWM A;  1WCL A;  1WWV A;  4ED7 A;  5ALP A;  3MDA A;  2R8G A;  2JHD A;  4P4O A;  1PK3 A;  3H8J A;  5AK5 A;  5ALQ A;  1RXW A;  2NRV A;  4UQG A;  1S0N A;  5CB1 A;  8ICW A;  2KIW A;  3HW8 A;  5D4B A;  4J03 A;  2VJ4 A;  3WKC A;  3HJE A;  4E0D A;  2OHF A;  1IM4 A;  1X9S A;  2ZTE A;  5TIS U;  1ZD2 P;  9ICJ A;  1Q8K A;  3RJH A;  2XID A;  5AKK A;  4CNQ A;  3M8S A;  3WK4 A;  1FFV A;  2BQU A;  2MUT B;  4YMN A;  1BGX T;  1Q46 A;  3RB4 A;  4UB8 U;  3E58 A;  1S8O A;  1V85 A;  3AN1 A;  4KX3 A;  1SL1 A;  1HUZ A;  3F5E A;  3KTQ A;  4J9S A;  1JAL A;  4Y2R A;  4RQ8 A;  4G9B A;  4LJX A;  2WHE A;  9ICP A;  5KFO A;  4EZ6 A;  2XIC A;  5AI6 A;  2IOF K;  4CRX A;  7ICV A;  4C4T A;  1UA0 A;  3H0L B;  5DLG A;  3N97 B;  3H40 A;  2JEI A;  2HVI A;  1SKW A;  2HHQ A;  3MDC A;  5AI4 A;  2PI5 A;  2FJ6 A;  4O3R A;  2XO7 A;  3VC8 A;  1ZQM A;  4ELV A;  4IR1 A;  4PHE A;  4KLM A;  3D2Q A;  5AI8 A;  3KHL A;  1COK A;  5EOZ A;  3OHB A;  5EWE A;  5D46 A;  1T4G A;  1ZD5 A;  5KG7 A;  4PGQ A;  3BZK A;  2R8I A;  2KP7 A;  5HHH A;  2KEY A;  4GXK A;  3Q8P B;  2FLN A;  5KFF A;  3V7L A;  3PNC A;  2RQ5 A;  3KKA C;  1TE2 A;  1X6J A;  2A1J B;  4DFP A;  2KOB A;  3JPN A;  5D49 A;  1XO1 A;  5AM5 A;  4BXO B;  7ICL A;  4DL6 A;  3RH4 A;  4RQ5 A;  4CGZ A;  5ALR A;  2I5H A;  2ZIV A;  3M9N B;  1WWU A;  3IRU A;  2AXT U;  3AU6 A;  4B9M A;  3IG5 A;  3RAQ A;  2P66 A;  4ECU A;  4XA5 A;  5J2G A;  2R8K A;  1NKC A;  3JPR A;  3IN5 A;  5CRX A;  2Y1J A;  1ZOL A;  4XRH A;  2WB1 C;  4P0P B;  1X9X A;  5HNK A;  4YD1 A;  2Y1I A;  2AH5 A;  5IIN A;  2EAP A;  2YN4 A;  2NO5 A;  3BDP A;  2MA1 A;  1X9M A;  5H2F U;  2JR5 A;  4KTQ A;  4R8U B;  1N5X A;  4ECW A;  4O0I A;  3LWL A;  4TUS A;  1RQL A;  4RZR A;  3V6K A;  4NLN A;  3PML A;  4M9N A;  4C0Z A;  1SGG A;  1F0M A;  2W9B A;  4DQS A;  5KG2 A;  5AKY A;  3RB6 A;  2AU0 A;  3PY8 A;  2HHV A;  4LZG A;  5JRT A;  5EE0 A;  1ZQF A;  4F5R A;  4YFK A;  2PI4 A;  2YMQ A;  7ICU A;  3PX4 A;  2F3N A;  5JTI A;  9ICL A;  2B0C A;  5KG3 A;  4Q44 A;  3GV8 B;  3EPI A;  2O6K A;  4CF4 A;  3PO5 A;  4BGD A;  2KKP A;  3TAD A;  2EAN A;  1S76 D;  3M7D A;  3H0M B;  1F44 A;  4XUS A;  2UVV A;  3RJK A;  1ZRN A;  2DF4 B;  3TKA A;  1ZQH A;  5DBA A;  1N56 A;  3SZ2 A;  2NYV A;  5J2I A;  5ALI A;  4FS2 A;  1TAM A;  2A19 A;  4C7Z A;  5J0P A;  2OEH A;  3Q8Q B;  2KHQ A;  1ZQG A;  4IRD A;  1SIJ A;  2NRZ A;  4UB3 A;  1RYU A;  1CUK A;  4J9O A;  1PVP A;  4YR0 A;  3WKE A;  2RDJ A;  1X6I A;  2KD1 A;  3NVZ A;  4F3O A;  2K4H A;  2ISP A;  5ALJ A;  5FP0 A;  2EZY A;  3UMC A;  3RF9 A;  2F1H A;  4OJ5 A;  2XY7 A;  3UQ2 A;  2ZG6 A;  2EZZ A;  2K8B B;  3QU2 A;  3GZF A;  3BQ7 A;  1VLB A;  3D6J A;  3WKA A;  2ZUC A;  2B21 A;  4FO6 A;  2KVS A;  4EX7 A;  4RQ7 A;  4JWN A;  2LHT A;  2KSO B;  2R18 A;  3N4M B;  4RQ0 A;  2Q0Z X;  3RJI A;  2BGW A;  3TI0 A;  5KG5 A;  1IV8 A;  1PVR A;  3D2N A;  5ALT A;  1Q3V A;  2ATL A;  2IMW P;  5J8Y A;  3J81 j;  4ZH4 A;  4BUG A;  3TAN A;  2G0A A;  4OJP A;  4F91 B;  3MR5 A;  4NLG A;  3KZX A;  4BWM A;  3O0F A;  1BVS A;  2H3Q A;  3EUB 2;  4RQ3 A;  4DF4 A;  2W9C B;  2HHS A;  9ICA A;  3MC1 A;  3M1Y A;  1S97 A;  4QIW C;  1D8B A;  4YMM A;  1FEZ A;  4HAI A;  4TUR A;  4RQN A;  3V6H A;  3UXP A;  3T5H A;  4KLO A;  3NAS A;  1L3U A;  1VDV A;  5KFZ A;  3KHG A;  1KDH A;  1WCN A;  4EBC A;  1QLN A;  5AKH A;  4I2F A;  4ECQ A;  1DXS A;  5C5J A;  4RPY A;  1NJY A;  2LM1 A;  1XSL A;  2YML A;  5JU5 A;  3TAP A;  4WJ3 B;  1D9D A;  4A8E A;  1S9F A;  1SV0 C;  4QZ9 A;  4Y2J A;  4IQW A;  2EAO A;  4BDP A;  2ZXI A;  4O9M A;  2A1J A;  2FPM A;  3UMB A;  5ALV A;  3N7S C;  2G06 A;  2JV3 A;  3EWA A;  3ZI4 A;  4BXO A;  5J2D A;  4Q43 A;  3NRW A;  3SYZ A;  5ALM A;  3KHH A;  4IRC A;  2Y0S F;  5E79 U;  4BJQ A;  2WTF A;  3E0F A;  4F71 A;  4UAT A;  4Y2P A;  4Z6C A;  5AHX A;  3RH5 A;  1ZET A;  2KZZ A;  5KFA A;  4JWM A;  4CF3 A;  2HW3 A;  3D2S A;  5AM2 A;  2JEG A;  3KHR A;  2W9M A;  1KW4 A;  1ZQ1 C;  3FC4 A;  2IOF A;  7ICS A;  8ICM A;  5AKJ A;  1UA1 A;  2DFL A;  2K4P A;  3OPX A;  1HUO A;  7ICM A;  1ZQN A;  5F9L A;  4F92 B;  3H4D A;  1L5U A;  2G5I B;  2K4I A;  4QZB A;  4NL9 A;  5AIA A;  1ZQK A;  3RR8 A;  4R8U A;  5L1K A;  3GU3 A;  3RBE A;  3C2L A;  4PHD A;  1Z4O A;  3BQ1 A;  3ISB A;  4BWJ A;  4QZC A;  4YR3 A;  1S77 D;  3HRD D;  3N7R C;  2IHM A;  3QX7 A;  4ECX A;  4YP3 A;  3AQF A;  1MA7 A;  4QWA A;  4ED0 A;  5AKZ A;  8ICT A;  1T7P A;  4U6P A;  4M2Y A;  5J0S A;  3QE9 Y;  2WF9 A;  5KT2 A;  2W04 A;  1UPH A;  1RYS A;  3LVW A;  3UM9 A;  4UAS A;  4P4P A;  1ZQA A;  3NS1 A;  2K8C B;  1X66 A;  4DEZ A;  8ICE A;  1TK0 A;  3QU5 A;  3DEE A;  5TZV A;  4JV1 A;  3EZ5 A;  1D8L A;  1QQ6 A;  3MR2 A;  2NO4 A;  2D3D A;  2ZUD A;  4MF8 A;  5KFY A;  2CN1 A;  1T3Q A;  1T3N A;  3RJE A;  3SV3 A;  2XI9 A;  2LKY A;  4IQV A;  2H3Z A;  4YG2 A;  2D8C A;  1NJX A;  1IIP A;  2FLP A;  4QWC A;  1PVQ A;  3CW2 C;  1QTM A;  4UBC A;  5KFP A;  4DS4 A;  4NLZ A;  2W03 A;  4PL2 A;  1NK6 A;  1QCK A;  4QW9 A;  3C1Y A;  5CP2 A;  9ICK A;  4HYK A;  3C23 A;  3G6Y A;  4KLQ A;  2YX8 A;  3T5J A;  2FMP A;  1XSN A;  4DLE A;  1X42 A;  3RJG A;  4FBT A;  4YMO A;  2KSO A;  1U9L A;  2RRD A;  5DG9 A;  1MC8 A;  4UBB A;  3GIM A;  2R8H A;  1S5L U;  2AGQ A;  1P7D A;  2K60 A;  2PMZ F;  4UAZ A;  5ALS A;  4J9K A;  3NRZ A;  1NK0 A;  4KLF A;  1NJW A;  4RNM A;  3DV9 A;  2E8O A;  4I2A A;  4I2D A;  5KFX A;  5DLF A;  1QQ5 A;  5DB6 A;  4M9G A;  3QUB A;  4UAV A;  8ICS A;  1X9W A;  1S0V A;  2W9C A;  2BCV A;  4ED1 A;  3QU7 A;  3ZD8 A;  4DOC A;  4JMU A;  3V7K A;  4F5N A;  2VA2 A;  1O08 A;  4GXI A;  1JUD A;  2YMP A;  2BR0 A;  3IP4 B;  4IS7 A;  8ICJ A;  5G5H A;  8ICF A;  4Y2X A;  3BS7 A;  2K8A A;  1D9F A;  4KMU A;  5GTI U;  4Q45 A;  4RQ2 A;  2ZJ5 A;  1KFT A;  1NNL A;  3NVY A;  5KNI A;  3MGV A;  3MGI A;  5IIO A;  1YT3 A;  1XSP A;  2AGP A;  1X40 A;  4UB1 A;  2FE9 A;  2HHX A;  8ICN A;  2QAR B;  2J6T A;  9ICT A;  1DGS A;  4YR2 A;  5J2J A;  4DS5 A;  2BHN A;  4J9P A;  3C29 A;  1J2N A;  3UPQ A;  1ZQB A;  1JX4 A;  4F5Q A;  3SAG A;  8ICL A;  2G07 A;  3QU9 A;  4I28 A;  1NK8 A;  1ZQO A;  1U45 A;  3SR6 A;  2Q4T A;  2JEJ A;  1RXV A;  2AGO A;  4U7C A;  2BCR A;  2DQN B;  3GIK A;  4F4X A;  9ICU A;  1DK3 A;  2ZIU B;  2ZXH A;  3M6Z A;  3RBD A;  2PFP A;  5KFI A;  4DQP A;  3JPP A;  9ICG A;  4I2H A;  1V38 A;  2XGP A;  4BX9 C;  4J9Q A;  3AUO A;  3RAX A;  4Y2Y A;  4DL5 A;  4MEX A;  1JIH A;  4J9N A;  3FDS A;  3AEV A;  4DL3 A;  5GTH U;  1QSL A;  5K4L A;  5DGA A;  1IXR A;  3UMG A;  3TFR A;  4DLG A;  4UB6 U;  1TFR A;  1ZQS A;  4R64 A;  2KE7 A;  4UW9 A;  1CEZ A;  2R8J A;  4C80 A;  3V6J A;  4KLG A;  4QWD A;  1CRX A;  2GO7 A;  3MBY A;  2LM4 A;  1VJ5 A;  1SKS A;  2JGA A;  1ZQV A;  3Q8K A;  4DO9 A;  5CHG A;  3C21 A;  3PR4 A;  4R66 A;  4DCC A;  4CCH A;  3B0X A;  1U49 A;  3K1R B;  5DQG A;  9ICE A;  2ZIX B;  1DRG A;  3C5G A;  2CXY A;  2L5Y A;  5ALE A;  2HHT A;  4DSE A;  1MQ2 A;  3T3F A;  4NLB A;  5KAI U;  3ZD9 A;  5KFN A;  5DDM A;  8ICP A;  4KLL A;  3MAB A;  5AI5 A;  3UXN A;  3NVW A;  4LZD A;  1ARO P;  2W55 A;  3NTU A;  4F8R A;  3ORY A;  3GV7 B;  4OJO A;  4OO1 J;  3FAH A;  4C8O A;  2K89 A;  1T8E A;  4I2B A;  4PGY A;  5KFG A;  4YCX A;  5IIM A;  1DGJ A;  1SWW A;  3ETL A;  4XQ8 A;  3LVV A;  1Z00 B;  3BQ2 A;  3RFA A;  5KFR A;  1BPE A;  3I76 A;  3MFI A;  2ODG A;  1TK8 A;  2W54 A;  3BJY A;  2FDR A;  3WK8 A;  3HIL A;  4P0Q A;  3H8S A;  1C20 A;  5BOL A;  1RM6 C;  9ICS A;  4IR9 A;  3QEA Z;  1KN5 A;  1SL0 A;  2C2R A;  2Y9U A;  4C7Y A;  1J97 A;  1NI3 A;  5KFV A;  5KFE A;  1ZQJ A;  3KBB A;  5DKW A;  5B5E U;  8ICC A;  4ZOH C;  5F9N A;  7ICP A;  1JXE A;  3TAD C;  4ED8 A;  4O3S A;  3ED5 A;  3NGD A;  2W7O A;  4DSL A;  4F2R A;  7ICO A;  2WAQ F;  3LK9 A;  4R65 A;  2QB1 A;  1K5O A;  5AKE A;  5J2C A;  1SKR A;  3KFU F;  1YZ7 A;  2ZUB A;  4DOA A;  4PZO A;  4CF5 A;  1MSW D;  5BPC A;  4DFK A;  3QYP A;  2BQR A;  3GIJ A;  1PK1 B;  2BKE A;  5ALF A;  3E2E A;  4I2I A;  5KT3 A;  2ASL A;  1FFU A;  4FBU A;  4EEL A;  4OCZ A;  5KT7 A;  4UAR A;  4Y2S A;  4O3O A;  3RB0 A;  2GWS A;  4YN4 A;  3QU4 A;  4YXM A;  4YQW A;  4KLU A;  5CJ7 A;  1ZQU A;  3M9O B;  4KIT B;  4ECS A;  4PPX A;  5KT4 A;  1XWL A;  3N7P D;  4QZ8 A;  4AYB F;  1FO4 A;  1Q3U A;  4R63 A;  2E8N A;  2BPC A;  2GOL A;  5ALW A;  1H38 A;  4KMO B;  4EEN A;  2OWO A;  1SL2 A;  4RQ1 A;  3FM9 A;  2C2E A;  3OSN A;  2MUT A;  5J0W A;  1U4B A;  1LKY B;  4JUZ A;  1DOQ A;  3G6V A;  2D6F C;  3PO4 A;  5J8Y C;  2BDP A;  3RJF A;  5HHI A;  2ZIU A;  2QB0 B;  4ECR A;  4YVZ A;  1BNP A;  4ED3 A;  5KAF U;  1S0O A;  5DBC A;  1ZD4 A;  2G5H B;  5AKL A;  4EX6 A;  4Q8F A;  1A77 A;  3PZP A;  1ZQQ A;  3F2D A;  2LYH A;  9ICI A;  5J2K A;  3U26 A;  4EEY A;  4DWI A;  2XCA A;  4EZ9 A;  4I2C A;  1ZQD A;  3OGU A;  5ALH A;  1AQ6 A;  2J6S A;  2Y0S C;  3M9M B;  1UCV A;  2E3T A;  2Y9T A;  2B6G A;  4KLH A;  2UVW A;  1N48 A;  1L3T A;  1NKB A;  2CRX A;  2BDU A;  1ZQC A;  9ICX A;  5KFH A;  2P6U A;  9ICF A;  1KLN A;  3HKZ F;  1XS9 D;  2H3F A;  2KZM A;  2C28 A;  3IG8 A;  1ZRM A;  2W7P A;  3TFS A;  2KFN A;  2Z7J A;  3HX0 A;  5L1L A;  3DDH A;  2NV3 A;  3NUQ A;  2E1E A;  2HHW A;  3FYH A;  4M04 A;  3GQC A;  2ES6 A;  4F93 B;  4KX5 A;  2KZ3 A;  2HCF A;  2ZIX A;  4QNL A;  4O5E A;  4F5O A;  3AMZ A;  2KMD A;  1RG6 A;  2RP5 A;  4DFM A;  2ZTD A;  8ICV A;  5DQI A;  1S10 A;  3K1Z A;  9ICO A;  3ETR A;  1A6S A;  5L1J A;  1ZQE A;  4ECZ A;  3SQI A;  2VKQ A;  1L3V A;  3R9K A;  1QSY A;  3PW2 A;  5DBB A;  5EE3 A;  2KKV A;  1KSP A;  2BPG A;  5EWF A;  2E1F A;  2KIV A;  1NKE A;  7ICG A;  5AK6 A;  1JXL A;  3I1Y A;  1COO A;  1ZQY A;  1HIW A;  5DGB A;  4P0P A;  2VA8 A;  4DOB A;  1DK2 A;  4PL1 A;  4QJF B;  4KLJ A;  4AP9 A;  4B9U A;  4NL9 C;  1XC9 A;  3ONN A;  3IV6 A;  3WU2 U;  1Z00 A;  3F53 A;  4O5C A;  4F4W A;  2M0N A;  2V4R A;  4DQR A;  1Z4N A;  4GC6 A;  1N2X A;  1B4F A;  4ICA A;  4NWI A;  3QZ8 A;  2MAX A;  1SV4 A;  3BQ0 A;  3CNH A;  2H3I A;  2E5S A;  1V97 A;  2F77 X;  2KJ9 A;  4O3M A;  1URJ A;  4QWB A;  4RUA A;  2XVT A;  2HBM A;  2HMX A;  2JRZ A;  3QUQ A;  5KG1 A;  3SEN A;  3T5L A;  1L8L A;  1TAQ A;  3HWT A;  4DSJ A;  8ICG A;  4GC7 A;  2IBK A;  1NK9 A;  2HOI A;  3IDW A;  3ZDD A;  2W9A A;  3PW0 A;  1N63 A;  9ICC A;  2W43 A;  1RDF A;  2PFQ A;  2QLT A;  2OM6 A;  1ZQP A;  2PMZ C;  4PGX A;  4MFF A;  1ED1 A;  1L8O A;  1LB2 B;  2ASD A;  9ICH A;  1KFS A;  1WYG A;  4C8M A;  3GV5 B;  5G5G A;  4NM2 A;  1PK1 A;  2YMM A;  1KRP A;  2XY6 A;  1OW5 A;  4PJ0 U;  4ED6 A;  3VCB A;  2A1A A;  2F44 A;  5AK3 A;  2LI6 A;  4TUQ A;  2V4Q A;  5ALN A;  3V7J A;  4ECT A;  4EEK A;  3AM9 A;  1X2I A;  2KN7 A;  3H0R B;  5L1I A;  4RT3 A;  3QEB Z;  4RPX A;  5AI9 A;  2HBJ A;  2HSZ A;  2MRL A;  3RRH A;  1ZYQ A;  1FIQ A;  4DQI A;  2F8K A;  2DKX A;  1B0X A;  4IRK A;  1OUQ A;  4Z6D A;  4RPZ A;  5J29 A;  4QW8 A;  4B9L A;  1KFD A;  3PSF A;  2JEF A;  4I29 A;  1LKY A;  1UQV A;  4DL4 A;  4IQT A;  3C1Z A;  2QB0 A;  1L3S A;  8ICO A;  4EYI B;  4C8N A;  4F4Y A;  2BCU A;  3AL0 B;  2AQ0 A;  1ZD3 A;  5III A;  4DL2 A;  4DL7 A;  4KLI A;  3I28 A;  5J0R A;  4F5P A;  5HP4 A;  1JN3 A;  4C8L A;  2HBL A;  5CR0 A;  4B9N A;  3RR7 A;  3QUC A;  1KKX A;  2BZF A;  3F2C A;  1WG8 A;  1SB3 C;  3F5A A;  2W11 A;  4Y2U A;  3RRG A;  2FMS A;  1BPX A;  3H8W A;  3PSI A;  3PX6 A;  2C22 A;  2M9N A;  3EW9 A;  4FZN A;  2HBK A; 
#chains in the Genus database with same CATH homology
 5GTI U;  3WU2 U;  4IL6 U;  1S5L U;  4UB6 U;  5B66 U;  2AXT U;  5H2F U;  5B5E U;  2DUY A;  3A0H U;  4UB8 U;  3KZI U;  5KAI U;  3A0B U;  5GTH U;  5E79 U;  4PJ0 U;  5KAF U;  5TIS U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...