2AXTU

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
total genus 27
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2axtU01
5GTHU 5TISU 5KAIU 5B66U 5KAFU 5H2FU 2DUYA 3WU2U 5E79U 4IL6U 4UB6U 4PJ0U 5B5EU 3A0BU 1S5LU 4UB8U 3A0HU 5GTIU 3KZIU 2AXTU
chains in the Genus database with same CATH superfamily
4DSEA 3ZD9A 2JR5A 4KN7A 4Y2JA 3TKAA 2PKEA 1UA1A 2QLTA 2W11A 2V9WA 4AYBF 1SL2A 1UT5A 8ICIA 2B0CA 2EDUA 4C80A 5J2CA 2OH2A 4BX9C 2A1JB 3PVXA 5ALEA 2QARB 3FDSA 3K4GA 1X9WA 3IP4B 3O0FA 1SZHA 2AU0A 4EBCA 1ZQUA 3HKZF 3M7DA 1KW4A 2AGOA 3UPQA 3D2NA 4A8EA 3WKDA 3WK8A 5DG7A 1RYRA 4Q8FA 5KG1A 1XSPA 2KFZA 2XY5A 7ICNA 2DL0A 3M9NB 1J2NA 2WFAA 3ED5A 1ZQSA 5J0UA 3ZDDA 3RJJA 1H38A 1ZQKA 3ZDAA 2YB1A 2I5HA 5J2AA 4M2YA 2OCEA 1TKDA 3UXPA 4DSJA 5GTHU 3QZ8A 4DS5A 2JGAA 2BCVA 2C2RA 3AQFA 1ZQNA 1ZQVA 8ICJA 1L7PA 4QW8A 1B4FA 3TANA 2ZIUA 2EANA 4DSLA 2WB1C 9ICMA 4K4GA 4KLEA 8ICLA 5KFZA 5KL1B 4MFAA 3ETLA 4RQ8A 4QZ8A 3GILA 4RZRA 3B0XA 9ICNA 5EE0A 2ZIVA 2HOFA 1UPHA 4P0PA 4ED7A 5J0PA 2FMQA 3E2EA 2FPKA 4UATA 3JPOA 4U6PA 5CWRA 5CP2A 3F5EA 2YY6A 4OJLA 4UARA 2BQRA 2F44A 1SZPA 2XY7A 4RQ6A 7ICMA 4I28A 3AN1A 4I2EA 4F4XA 4GXIA 4EX7A 3GU3A 1X6JA 1JMSA 4K4IA 4I2DA 5AHXA 4UQGA 4XQ8A 3MABA 2HBKA 2IHMA 4NLKA 2F8LA 3DDHA 4HYKA 1A0PA 2QB0B 3KBBA 4X5VA 3NVVA 4KMUA 1FFUA 4MFFA 4NLNA 2C22A 1IV8A 2IOFK 5ALVA 2VKQA 5G5GA 2HBLA 3MDCA 4R66A 5BOMA 2ASLA 3N7PD 8ICVA 4EZ6A 4LZGA 4ECUA 4RT2A 9ICEA 2J6SA 1ZJNA 2HHUA 5J0OA 2ZUCA 1S8OA 2NRXA 4TURA 3PR4A 2ODGA 3BQ7A 2BZFA 1SIJA 3A0HU 4F72A 3C5FA 2CXYA 4GFJA 1FO4A 1KL9A 2G06A 2PXIA 1IIPA 5KFHA 1DK2A 1L3VA 1DGJA 5ALUA 4RQ4A 4FZLA 4PHEA 5IIJA 1L3SA 4FS1A 4I29A 3PSIA 5FP0A 4C4SA 4F71A 4KLTA 2HW3A 4QJFB 4I2AA 4C7ZA 2KVSA 5ALOA 1ZQXA 5J2EA 2QARA 3LDAA 4CF3A 3NVWA 4DF4A 3G6VA 1L6NA 4QWAA 2YB4A 1U4BA 3QX7A 4PHAA 2KD1A 4OJPA 4KLSA 2V4RA 2BQUA 3ALRA 4BXOA 4Y2QA 4BGDA 3VCBA 5GTIU 4O5KA 2UVUA 4YN4A 1ZQCA 3PX4A 4RPYA 4JV0A 3RTVA 3THVA 3SR6A 1WCLA 2JHDA 2ES6A 3J81j 1DGSA 4JV1A 2LYHA 2W9CA 1TAUA 2DKXA 1PK1B 9ICGA 4EELA 4JWMA 4EEKA 1ZQFA 5AKJA 5F9NA 4RT3A 5KFRA 2W3RA 4RNMA 1ZRMA 4F93B 4DL4A 4M9JA 1CI4A 1V97A 4R65A 5KT6A 1YT3A 3RH6A 1B43A 4O3MA 2ZXHA 3WK9A 3EUB2 4OO1J 4C8KA 2ATLA 4DL5A 1T94A 3C21A 4OD0A 2JV3A 4EYHB 5CEHA 5ALPA 5KFLA 3H7IA 4DFKA 2XCPA 1M6YA 4YQWA 1UT8A 2KZZA 3AMZA 2ZIWA 1SGGA 5ALFA 3SV3A 2D3DA 4P0QB 5AK6A 4IL6U 8ICQA 3TARA 5AKZA 3SZ2A 5DKWA 2XGQA 1F44A 3Q8LA 4F4ZA 1K1QA 4DEZA 4QWCA 2A1AA 4J9OA 2K8AA 1O03A 3SD7A 2Q0ZX 2DUYA 3ORYA 3IHQB 3QU7A 1YZ7A 1MSWD 2DBYA 3M1YA 4RNNA 1Q46A 4ELTA 2BQ3A 3OPXA 4P2HA 3AQEA 5DB6A 3I1YA 3QU9A 3M8SA 1SB3C 2RDIA 4BWMA 2Y1IA 2PI4A 1JIHA 3V7JA 4EBDA 1B22A 1XSNA 4M47A 3GZFA 1BNPA 3LVWA 4UAYA 1FIQA 4UB6U 4YMMA 5ALNA 4EBEA 1ZQLA 1SKSA 4GLXA 3Q8QB 1SV0C 5DGAA 2KV2A 3KKAA 2E5SA 3CW2C 1JALA 2DKZA 2PFPA 2NO5A 4IRCA 4Q44A 1RXWA 2W43A 4QIWF 3PW4A 4KLJA 3BDPA 2DQNB 8ICYA 4C7YA 1TE2A 5AM1A 3NVYA 2ZTCA 1SL0A 1K1SA 2UVWA 4TQSA 1Y88A 2ZJAA 3C28A 4KMOB 4UB1A 3F2BA 3ZDBA 1V85A 1DOQA 1V38A 1L3UA 2HDOA 4I2CA 3HKZC 4I27A 4TUQA 3PNCA 4USAA 5EOZA 1NK0A 4QZEA 1AROP 2KHQA 4PGXA 2KKPA 3WKBA 2IOHA 3HILA 5IIMA 2IMWP 5AKGA 4O5CA 3BS7A 4UB5A 2FDRA 1PVRA 1ZQTA 3RJFA 2MU2A 3T3FA 1N48A 1UCVA 4DSIA 4PGQA 4F91B 3KHLA 2E8NA 3E58A 3GV5B 2Y0SF 2ZJ5A 4NLBA 1HEKA 2ALZA 2Z7JA 4J03A 2HMXA 4BWJA 4QWDA 4MEYA 2EZXA 3TAPA 2FLLA 2Y9UA 1JXEA 3OSNA 2C2EA 1BGXT 5AM0A 2P6UA 1Z1VA 4UB3A 4J9QA 1QSLA 1YZ6A 4PJ0U 4BJQA 1L8LA 4P4MA 5HP4A 7ICRA 5J0YA 4QZDA 3MFHA 1HUOA 3SI8A 1S0MA 3CRXA 2VA8A 4GXKA 2K8BB 8ICEA 3BJYA 1KTQA 4CRXA 1XO1A 3DEEA 2LPEA 3NTUA 1ECWA 4QZFA 5KFIA 5ALIA 2C28A 2JMGA 2Q4TA 2KSOB 1NK5A 2F76X 1L7MA 4J9MA 5KNIA 2VANA 3TADA 1S76D 1MQ2A 5JUMA 4ACOA 2PMZF 3UXOA 3H0MB 4ED0A 4DQSA 2KIWA 1D8LA 1SKWA 4EZ9A 3H0RB 5DLFA 2AQ0A 4LJXA 1C7YA 4UB8U 2JXJA 3F2DA 4YVZA 3C5GA 1PK3A 2LMRA 2YQEA 3SEIA 3RBDA 4KLFA 2YN4A 7ICQA 5KG7A 1URJA 4YXMA 3PZPA 1COKA 2ZXIA 3JPPA 1ZQHA 2HVHA 2PI5A 2HHTA 1ZXIA 3ICXA 3KKAC 1S77D 2P66A 3GFKB 1NK8A 3K1RB 1SXEA 3G6XA 5AKIA 2KJ8A 3RFAA 2KKVA 3PSPA 4YG2A 2OEHA 2E1FA 4KLOA 2LM4A 3PW2A 4PL1A 3T79A 3RJHA 2GH1A 5EWGA 1QSYA 1SXDA 4B9UA 1TFRA 3Q8SB 2MA1A 5JTIA 1XSLA 2G08A 2FMPA 2HOIA 3T5LA 4NLZA 2R8IA 2HVIA 5J2DA 1X40A 4OJ5A 4JUZA 3ZD8A 1DRGA 3PO4A 1CEZA 3EPIA 1WG8A 3EWAA 1VJ5A 4M9HA 4DQIA 2ZIXA 3JPQA 2B21A 4F5QA 5J29A 7ICFA 5K4LA 3M9OB 2XI9A 5T14A 2H3ZA 2BCRA 1Z00A 2LHTA 4M04A 2WAQF 1MN8A 3VC8A 4CF4A 4DL6A 2WF6A 4IRDA 3PO5A 1NJXA 5KAIU 1MC8A 1XU4A 1FFVA 2MUTA 4EENA 3EZ5A 7ICKA 4Y2UA 2WHEA 3QUQA 5ALYA 2YMMA 1XWLA 3MBYA 2HOQA 1PVPA 2AH5A 2WF5A 5J0WA 3HRDD 5C0YA 5EWFA 1BNOA 1OW5A 1ZQJA 5JRTA 5AIAA 4IR1A 3UMGA 1T8EA 5ALTA 1Z1BA 4C4TA 4ELVA 3NS1A 4ED8A 1UQVA 2GO7A 3PSTA 1N56A 3AM9A 3TI0A 3CNHA 1RYUA 3EYZA 3C1YA 2W9BB 3WKAA 5AKLA 1L5UA 4DQPA 2KJ9A 3PW7A 4QZIA 5DBBA 5KT2A 5HNKA 4J9KA 2UVVA 4LZDA 7ICUA 4F5RA 5J2HA 3WKCA 5KFVA 4Q8EA 3HJEA 3QUCA 3DV9A 5L1LA 2FPMA 2VA2A 4HAIA 1NZBA 2RLTA 1ZOLA 4DL3A 3PMLA 4FFDA 2K4PA 4O3NA 4RQ1A 5KFPA 2OXOA 3RJEA 9ICUA 1X2IA 3TADC 4YMOA 1RPLA 3QXGA 2NV3A 1N5XA 1PVQA 5AKXA 3G6YA 3QU2A 2XC9A 4CCHA 5EE3A 4YD2A 2AGPA 1JXLA 5DQGA 2ASDA 1JRPA 3GIIA 2KNJA 2KIVA 1DK3A 1Z19A 3F53A 2W3SA 1TK8A 4M6WA 1QTMA 4TUSA 5J0XA 2KZ3A 1WWUA 7ICSA 2G09A 4M9NA 4NXZA 4QZ9A 5KFEA 4IQTA 5ALWA 4RQ7A 3Q8KA 1UA0A 2MAXA 3V6HA 2P6RA 4YR2A 3H8SA 1LKYB 8ICCA 1ZETA 1C20A 3BZCA 3WKEA 2ISOA 5ALLA 2YMPA 4UAWA 4LVSA 2NRVA 3QUBA 3BQ0A 2HSZA 3BS5B 3ISDA 4R8UB 4Y2XA 3QEAZ 1QLNA 3BQTA 4YR3A 2W8KA 4Z6DA 5ALJA 2FI1A 1ZQMA 2ZUDA 2JEJA 4I2JA 1SV0A 5J8YC 9ICAA 1RXVA 3C2LA 3NGDA 2DWQA 2OWOA 5IINA 3PW5A 2H3QA 2G07A 4J9NA 2KJ5A 5ALSA 2R8KA 4YFKA 4RQ0A 1X42A 1COOA 3KHRA 5L1JA 5HMMA 2A1JA 9ICSA 4UBBA 2K60A 5DB8A 4F3OA 1O08A 7ICTA 3MR6A 5C5JA 2XIDA 2L5YA 8ICGA 3QZ7A 1Z4NA 1BPEA 2LYAA 2YTUA 7ICEA 4IQUA 4Y2VA 2D6FC 1NI3A 4J9PA 2MRLA 4KN4A 9ICOA 2G0AA 5AI9A 2XY6A 2AGQA 3D6JA 1KFDA 1TVAA 8ICBA 4R64A 1B0XA 2H3FA 4PPXA 4FBTA 5H2FU 2F2AB 5KFKA 1WWVA 3Q8PB 1IG6A 5HR7A 1S5LU 1U48A 4ECWA 4F2RA 5KG0A 4EYIB 3RJGA 3MFIA 4O9MA 9ICBA 2XICA 5IILA 2E1EA 1SWVA 8ICTA 5DB7A 3HP6A 5AM2A 1RQNA 3SENA 5J0SA 5ALKA 3ISCA 3RF9A 2KN7A 4YP3A 4US8A 1PZNA 9ICPA 3KD3A 3WK4A 1S0OA 1XS9D 4RQ5A 2AXTU 4K4HA 1S0VA 1J97A 3QNMA 1SWWA 2JEFA 5ALGA 2EAMA 4BUGA 2K4IA 1T3NA 5DQHA 1NNLA 1U9LA 5KFFA 8ICHA 4PZNA 2BGWA 8ICKA 5AI5A 4ECYA 2RP5A 3PMNA 5B5EU 5HHHA 3FAHA 9ICVA 4NWIA 3IG8A 1ZD5A 1NJYA 3QE9Y 5KT3A 1S97A 4P4OA 3V6JA 5ALMA 9ICHA 5F3XB 5KFMA 1NJZA 5J0QA 1NK7A 3WU2U 4C4RA 2W7OA 2JZBB 1D9FA 5AI0A 4M9GA 8ICMA 2QB0A 3C2KA 4NM1A 4KLDA 1OXJA 4F5PA 1SV4A 5KG3A 4FZNA 2FE9A 1QH9A 1L7NA 2RDJA 3LWLA 5L1MA 3CYMA 1A77A 4KX3A 4RPZA 3MDAA 2F77X 5CR0A 1ZYQA 1ZQ1C 4IR9A 1GO3F 3OTQA 1D9DA 2NYVA 5F9LA 4UW9A 2W54A 7ICVA 2UVRA 1KLNA 7ICIA 5KFCA 4KITB 1LKYA 2CRXA 4F50A 4JB3A 4EEYA 3SAHA 4C8OA 5EE9A 2DGZA 3BS5A 4AYBC 4R8UA 3M6KA 1JROA 2R8HA 1WCNA 8ICOA 4JWNA 4Q45A 1RM6C 3AUOA 8ICNA 2NO4A 4RQMA 4RNOA 2XGPA 1EXNA 1HIWA 9ICFA 2Y9TA 4IS7A 2YX8A 2HHXA 5KFYA 1SKRA 2GLEA 4O3PA 2PFNA 9ICKA 4QWEA 4F2SA 1SL1A 4GC7A 2E3TA 4O5EA 4FE3A 3QUTA 5D49A 1JI7A 3UXNA 4MF2A 3GIJA 3JPRA 4Z6CA 2KOBA 5KG2A 1RZTA 3SYZA 3GDXA 1OUQA 3PW0A 5L1IA 4JV2A 4RQ2A 3KHGA 3MR3A 3JPSA 5D4BA 4QWBA 5AK4A 2K8CB 2WAQC 4P4PA 2E8PA 3AU2A 5IIIA 4KLGA 4FBUA 4NLCA 4UB4A 4J9RA 4QZGA 1NOMA 2ZIUB 3V6KA 2LM1A 5KFWA 1RYSA 1D8BA 1PK1A 2FLPA 2YMLA 1NJWA 3PR5B 2K4EA 1NK6A 2XO7A 1PUZA 5AIBA 2QKQA 1BPYA 4F5OA 2LI6A 4DFDA 3RAXA 3IG5A 2F1IA 1ZD3A 5KFAA 2W55A 2ZIVB 5KG5A 3S6JA 3TFSA 4P0PB 4PZOA 3RB3A 5KFGA 4IQVA 1WYGA 3AL0B 4DOBA 1ZQIA 5KFQA 1KDHA 4B9SA 2I6XA 2EZYA 4ED3A 9ICLA 2KZMA 3KFUF 3IRUA 2BCQA 5HR6A 2DFLA 4R63A 1T3QA 3T5KA 3ONNA 4MFCA 4CF5A 4RU9A 2GWSA 2HBMA 4ZH4A 3FYHA 4DL2A 5KFOA 3F5AA 4P0QA 3D2SA 1BPDA 3OHBA 2ZJ8A 4YXJA 2DPJA 4C8MA 4GIBA 3NVZA 7ICJA 3RRGA 5KT5A 2BPGA 2LBOA 2AQ4A 5AK5A 2VJ4A 2E8MA 8ICAA 4DO9A 3V7LA 4DFMA 4B9TA 5IIOA 4O3RA 1P7DA 4B9LA 2R18A 1JUDA 1QQ6A 2IOFA 5KL8B 2QB1A 1BPZA 3H4BA 2GOLA 4F4KA 3HWTA 2OHFA 5B66U 3JPNA 5A0LA 3NASA 1U45A 5L9XA 5DBCA 4KTQA 2KG5A 1N5WA 1TK5A 4RPXA 4NL9A 7ICPA 4RUCA 2HHWA 4ED6A 3ISBA 4FO6A 1ZQAA 3UMBA 2W03A 4KLLA 4OJ6A 2VIXA 1Z4OA 4DQQA 3GV7B 3I76A 4I2GA 2EH9A 2F8KA 5AM4A 2KICA 5AI4A 3KOOA 1BPXA 5J8YA 4RQNA 1ZQPA 2J6TA 1RQLA 3C1ZA 4MHVA 5DB9A 5AM5A 1LVHA 3HT3A 2R8GA 2DPIA 1CRXA 3BQ2A 2VJ5A 2N1RA 5TZVA 3RR8A 2PFOA 4CNQA 1KBUA 3H4DA 2ISPA 3H40A 3QU5A 1NKEA 3UM9A 4IRKA 4BXOB 3JPTA 3I28A 4DFJA 1N61A 3SAFA 2H5XA 3ZI4A 4UAZA 4O3QA 2YMQA 2A19A 3BQ1A 4TQRA 3GQCA 5CRXA 1WUDA 5AICA 2V4QA 5AK3A 4UBCA 4UASA 4DOCA 1F0MA 2VA3A 5KFXA 4EX6A 3RAQA 5DDYA 2W9CB 2F3NA 5DG9A 4QZHA 3RR7A 4KLQA 8ICWA 3LYSA 4ECSA 4Y2PA 3RRHA 3RB6A 2ZTDA 2D8CA 1ZQOA 5KT4A 3ZDCA 3RB4A 4NJ8A 3RB0A 4PHPA 2RRDA 3MGVA 5AKKA 4F4WA 3Q8MA 3LK9A 1L8OA 4CDGA 5KFTA 1X66A 5KFSA 4PHDA 4NM2A 4I2FA 2IA6A 5AM3A 5KFBA 2MSNA 2KVCA 1NKBA 2ZIWB 3MGIA 3TQ1A 2HHVA 5IIKA 3AEVA 2CPRA 2ZG6A 5CB1A 4OCZA 2FJ6A 5KFJA 3HX0A 4DS4A 1DXSA 2NRTA 2NRWA 4DSFA 5TISU 1TV9A 1L3TA 4NV0A 2I1QA 1ZD4A 2H3VA 3Q8RB 2W9AA 5ALHA 1KFSA 5DLGA 3U26A 3T5JA 2IHNA 3MR2A 1QQ5A 5KFDA 9ICCA 4MF8A 2W7PA 3IN5A 2KSOA 4G3IA 7ICLA 2KK0A 4RQ3A 5CJ7A 1ZQDA 3N7RC 4U7CA 4Y2SA 3UQ2A 2BPFA 1XO0A 4KX5A 1X9XA 3PY8A 5BOLA 5J2JA 3SQIA 2J6UA 2DF4B 1X6IA 4NL9C 3N28A 2HI0A 8ICFA 3MC1A 3TACB 3UQ0A 1N62A 1MA7A 4ICAA 3TFRA 3R9KA 5KG6A 2K4HA 2WTFA 3H8MA 3SV4A 3AU6A 2KEYA 5EWEA 2XCAA 5KFUA 1BVSA 3C2MA 1KRPA 3OHAA 1QQ7A 1A6SA 4J9SA 4C8NA 4BDPA 1ZQEA 1NK9A 2CN1A 4Y2RA 4FZMA 1ZQGA 3SMVA 2WF8A 4PH5A 3ETRA 1TAMA 7ICGA 1V9PA 2JH7A 2F1HA 2OYYA 1ZQZA 3M6ZA 1IM4A 9ICQA 4F5NA 2ASJA 2JEIA 4JMUA 3H8WA 3NRZA 4QIWC 4JK1A 9ICIA 4DLGA 1XNSA 2G5IB 3L5KA 2HCFA 4IC9A 1KKXA 3SAGA 4O3OA 3NRWA 1ZQBA 2E8OA 1JN3A 3B0YA 2KHVA 3H8JA 3KHHA 5JU5A 4QZBA 3KZIU 3UMCA 1IXRA 2PFQA 2AJQA 5AKEA 4DCCA 8ICPA 1VDVA 4DSKA 2BCUA 1LV5A 2F1JA 4B9NA 3C29A 5ALZA 2AHOB 2FPLA 3IV6A 3K75D 4Z6EA 3KZXA 1T4GA 1ZQQA 3EW9A 2XVTA 3CP8A 1Z3EB 1N2XA 2WB1F 4KLIA 1RDFA 1XC9A 1AQ6A 1N60A 3HW8A 1MQ3A 2KFNA 1BPBA 4E0DA 1QCKA 4QZAA 2Y0SC 1CUKA 4MEXA 4DOAA 5J2BA 3WK5A 3OGUA 2W04A 1NKCA 4YMNA 4I2IA 3PSFA 4DWIA 2ZTEA 1K5OA 1LB2B 3FC4A 2BHNA 2W9BA 2JH1A 2OM6A 2K89A 1U47A 1Q3UA 2RHFA 2EZZA 4XRHA 3RJIA 1F5SA 2Y1JA 3TAQA 4UAUA 2EAOA 3B9JA 4F4YA 4DF8A 5DDMA 7ICHA 1A76A 9ICTA 4PGYA 3WK7A 8ICRA 5ALDA 4NLGA 3A0BU 4GC6A 3IM1A 5ALRA 5AKHA 1HUZA 3L4PA 5J0TA 4KLUA 4O0IA 8ICXA 3OJSA 1JX4A 1J2MA 5AKYA 5J2IA 3RH4A 1U49A 5AI8A 3N7SC 2NRZA 1VLBA 5CA7A 4ECQA 2PMZC 5KFNA 5G5HA 2M9NA 4QNLA 2HHSA 1ED1A 1ZD2P 2H3IA 2B6GA 5L1KA 1X9SA 2HBJA 3PX6A 3FM9A 4OJOA 9ICRA 3QYPA 3QEBZ 4XUSA 4QW9A 4ED1A 4AP9A 4C0ZA 4Y2YA 4Z6FA 1HJPA 4F8RA 2RQ5A 4WJ3B 3HPOA 3OSPA 4YCXA 4DL7A 4J9LA 5EE1A 2W9MA 3GIKA 4ED2A 5DG8A 3T5HA 2LYBA 4I2BA 2BPCA 2BDPA 9ICWA 4ELUA 1ZJMA 5J2FA 3BZKA 8ICZA 3PV8A 4IQWA 1KFTA 3RH5A 4G9BA 4PL2A 3ZDEA 4YD1A 3F2CA 5KG4A 3LWMA 9ICJA 5J2GA 4QZCA 3EPGA 2ZIXB 2KE7A 1X9MA 4Q43A 5KT7A 3H0LB 2EQYA 4KLHA 5BPCA 1S9FA 5HHIA 3IDWA 3OJUA 2R8JA 8ICSA 1ZQWA 1Z00B 5HMLA 3C23A 3N4MB 1S0NA 2IBKA 4ZOHC 1KQQA 2WF7A 2W8LA 3PX0A 2FLNA 3KTQA 4M9LA 2O6KA 4CE6A 4DLEA 1NK4A 4FS2A 4RUAA 4XA5A 3GV8B 2KP7A 5D46A 2MUTB 2BR0A 5KTQA 2A3VA 5ALXA 1ZQYA 8ICUA 4DFPA 1UHUA 1D8YA 1NZPA 4US9A 3MGHA 1FEZA 3GIMA 4DQRA 1RG6A 3M8RA 5AI6A 1TAQA 2ZUBA 4B6JA 4KLMA 4B9VA 3QU4A 4O3SA 1QSSA 1L7OA 4TUPA 5KAFU 1KSPA 1N63A 5CHGA 5J2KA 3V72A 4CGZA 3E0FA 5DGBA 3RJKA 3NUQA 3V7KA 2BCSA 2JRZA 3D2QA 7ICOA 4F92B 2BKEA 1Q3VA 4ECZA 4NY8A 2HHQA 4I2HA 4C8LA 2LKYA 2M0NA 1T7PA 5J0RA 2JEGA 2WF9A 3WK6A 5DBAA 3MR5A 4M0AA 1ZRNA 2EAPA 4YR0A 4UB2A 2C2DA 3LVVA 4UAVA 3RBEA 1KEJA 3K1ZA 4B9MA 4M6WB 2JZBA 4ECTA 4ECRA 3M9MB 2I9GA 3N97B 2G5HB 4ECVA 2BDUA 1Q8KA 4GXJA 2KMDA 2FMSA 5E79U 1S10A 5ALQA 1KN5A 4ECXA 2KTQA 3L3FX 9ICXA 2ESEA 5DQIA 1TK0A 2P35A 4Y2TA 1ZQRA
chains in the Genus database with same CATH topology
5GTHU 5TISU 5KAIU 5B66U 5KAFU 5H2FU 2DUYA 3WU2U 5E79U 4IL6U 4UB6U 4PJ0U 5B5EU 3A0BU 1S5LU 4UB8U 3A0HU 5GTIU 3KZIU 2AXTU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH U;  5TIS U;  5KAI U;  5B66 U;  5KAF U;  5H2F U;  2DUY A;  3WU2 U;  5E79 U;  4IL6 U;  4UB6 U;  4PJ0 U;  5B5E U;  3A0B U;  1S5L U;  4UB8 U;  3A0H U;  5GTI U;  3KZI U;  2AXT U; 
#chains in the Genus database with same CATH topology
 4DSE A;  3ZD9 A;  2JR5 A;  4KN7 A;  4Y2J A;  3TKA A;  2PKE A;  1UA1 A;  2QLT A;  2W11 A;  2V9W A;  4AYB F;  1SL2 A;  1UT5 A;  8ICI A;  2B0C A;  2EDU A;  4C80 A;  5J2C A;  2OH2 A;  4BX9 C;  2A1J B;  3PVX A;  5ALE A;  2QAR B;  3FDS A;  3K4G A;  1X9W A;  3IP4 B;  3O0F A;  1SZH A;  2AU0 A;  4EBC A;  1ZQU A;  3HKZ F;  3M7D A;  1KW4 A;  2AGO A;  3UPQ A;  3D2N A;  4A8E A;  3WKD A;  3WK8 A;  5DG7 A;  1RYR A;  4Q8F A;  5KG1 A;  1XSP A;  2KFZ A;  2XY5 A;  7ICN A;  2DL0 A;  3M9N B;  1J2N A;  2WFA A;  3ED5 A;  1ZQS A;  5J0U A;  3ZDD A;  3RJJ A;  1H38 A;  1ZQK A;  3ZDA A;  2YB1 A;  2I5H A;  5J2A A;  4M2Y A;  2OCE A;  1TKD A;  3UXP A;  4DSJ A;  5GTH U;  3QZ8 A;  4DS5 A;  2JGA A;  2BCV A;  2C2R A;  3AQF A;  1ZQN A;  1ZQV A;  8ICJ A;  1L7P A;  4QW8 A;  1B4F A;  3TAN A;  2ZIU A;  2EAN A;  4DSL A;  2WB1 C;  9ICM A;  4K4G A;  4KLE A;  8ICL A;  5KFZ A;  5KL1 B;  4MFA A;  3ETL A;  4RQ8 A;  4QZ8 A;  3GIL A;  4RZR A;  3B0X A;  9ICN A;  5EE0 A;  2ZIV A;  2HOF A;  1UPH A;  4P0P A;  4ED7 A;  5J0P A;  2FMQ A;  3E2E A;  2FPK A;  4UAT A;  3JPO A;  4U6P A;  5CWR A;  5CP2 A;  3F5E A;  2YY6 A;  4OJL A;  4UAR A;  2BQR A;  2F44 A;  1SZP A;  2XY7 A;  4RQ6 A;  7ICM A;  4I28 A;  3AN1 A;  4I2E A;  4F4X A;  4GXI A;  4EX7 A;  3GU3 A;  1X6J A;  1JMS A;  4K4I A;  4I2D A;  5AHX A;  4UQG A;  4XQ8 A;  3MAB A;  2HBK A;  2IHM A;  4NLK A;  2F8L A;  3DDH A;  4HYK A;  1A0P A;  2QB0 B;  3KBB A;  4X5V A;  3NVV A;  4KMU A;  1FFU A;  4MFF A;  4NLN A;  2C22 A;  1IV8 A;  2IOF K;  5ALV A;  2VKQ A;  5G5G A;  2HBL A;  3MDC A;  4R66 A;  5BOM A;  2ASL A;  3N7P D;  8ICV A;  4EZ6 A;  4LZG A;  4ECU A;  4RT2 A;  9ICE A;  2J6S A;  1ZJN A;  2HHU A;  5J0O A;  2ZUC A;  1S8O A;  2NRX A;  4TUR A;  3PR4 A;  2ODG A;  3BQ7 A;  2BZF A;  1SIJ A;  3A0H U;  4F72 A;  3C5F A;  2CXY A;  4GFJ A;  1FO4 A;  1KL9 A;  2G06 A;  2PXI A;  1IIP A;  5KFH A;  1DK2 A;  1L3V A;  1DGJ A;  5ALU A;  4RQ4 A;  4FZL A;  4PHE A;  5IIJ A;  1L3S A;  4FS1 A;  4I29 A;  3PSI A;  5FP0 A;  4C4S A;  4F71 A;  4KLT A;  2HW3 A;  4QJF B;  4I2A A;  4C7Z A;  2KVS A;  5ALO A;  1ZQX A;  5J2E A;  2QAR A;  3LDA A;  4CF3 A;  3NVW A;  4DF4 A;  3G6V A;  1L6N A;  4QWA A;  2YB4 A;  1U4B A;  3QX7 A;  4PHA A;  2KD1 A;  4OJP A;  4KLS A;  2V4R A;  2BQU A;  3ALR A;  4BXO A;  4Y2Q A;  4BGD A;  3VCB A;  5GTI U;  4O5K A;  2UVU A;  4YN4 A;  1ZQC A;  3PX4 A;  4RPY A;  4JV0 A;  3RTV A;  3THV A;  3SR6 A;  1WCL A;  2JHD A;  2ES6 A;  3J81 j;  1DGS A;  4JV1 A;  2LYH A;  2W9C A;  1TAU A;  2DKX A;  1PK1 B;  9ICG A;  4EEL A;  4JWM A;  4EEK A;  1ZQF A;  5AKJ A;  5F9N A;  4RT3 A;  5KFR A;  2W3R A;  4RNM A;  1ZRM A;  4F93 B;  4DL4 A;  4M9J A;  1CI4 A;  1V97 A;  4R65 A;  5KT6 A;  1YT3 A;  3RH6 A;  1B43 A;  4O3M A;  2ZXH A;  3WK9 A;  3EUB 2;  4OO1 J;  4C8K A;  2ATL A;  4DL5 A;  1T94 A;  3C21 A;  4OD0 A;  2JV3 A;  4EYH B;  5CEH A;  5ALP A;  5KFL A;  3H7I A;  4DFK A;  2XCP A;  1M6Y A;  4YQW A;  1UT8 A;  2KZZ A;  3AMZ A;  2ZIW A;  1SGG A;  5ALF A;  3SV3 A;  2D3D A;  4P0Q B;  5AK6 A;  4IL6 U;  8ICQ A;  3TAR A;  5AKZ A;  3SZ2 A;  5DKW A;  2XGQ A;  1F44 A;  3Q8L A;  4F4Z A;  1K1Q A;  4DEZ A;  4QWC A;  2A1A A;  4J9O A;  2K8A A;  1O03 A;  3SD7 A;  2Q0Z X;  2DUY A;  3ORY A;  3IHQ B;  3QU7 A;  1YZ7 A;  1MSW D;  2DBY A;  3M1Y A;  4RNN A;  1Q46 A;  4ELT A;  2BQ3 A;  3OPX A;  4P2H A;  3AQE A;  5DB6 A;  3I1Y A;  3QU9 A;  3M8S A;  1SB3 C;  2RDI A;  4BWM A;  2Y1I A;  2PI4 A;  1JIH A;  3V7J A;  4EBD A;  1B22 A;  1XSN A;  4M47 A;  3GZF A;  1BNP A;  3LVW A;  4UAY A;  1FIQ A;  4UB6 U;  4YMM A;  5ALN A;  4EBE A;  1ZQL A;  1SKS A;  4GLX A;  3Q8Q B;  1SV0 C;  5DGA A;  2KV2 A;  3KKA A;  2E5S A;  3CW2 C;  1JAL A;  2DKZ A;  2PFP A;  2NO5 A;  4IRC A;  4Q44 A;  1RXW A;  2W43 A;  4QIW F;  3PW4 A;  4KLJ A;  3BDP A;  2DQN B;  8ICY A;  4C7Y A;  1TE2 A;  5AM1 A;  3NVY A;  2ZTC A;  1SL0 A;  1K1S A;  2UVW A;  4TQS A;  1Y88 A;  2ZJA A;  3C28 A;  4KMO B;  4UB1 A;  3F2B A;  3ZDB A;  1V85 A;  1DOQ A;  1V38 A;  1L3U A;  2HDO A;  4I2C A;  3HKZ C;  4I27 A;  4TUQ A;  3PNC A;  4USA A;  5EOZ A;  1NK0 A;  4QZE A;  1ARO P;  2KHQ A;  4PGX A;  2KKP A;  3WKB A;  2IOH A;  3HIL A;  5IIM A;  2IMW P;  5AKG A;  4O5C A;  3BS7 A;  4UB5 A;  2FDR A;  1PVR A;  1ZQT A;  3RJF A;  2MU2 A;  3T3F A;  1N48 A;  1UCV A;  4DSI A;  4PGQ A;  4F91 B;  3KHL A;  2E8N A;  3E58 A;  3GV5 B;  2Y0S F;  2ZJ5 A;  4NLB A;  1HEK A;  2ALZ A;  2Z7J A;  4J03 A;  2HMX A;  4BWJ A;  4QWD A;  4MEY A;  2EZX A;  3TAP A;  2FLL A;  2Y9U A;  1JXE A;  3OSN A;  2C2E A;  1BGX T;  5AM0 A;  2P6U A;  1Z1V A;  4UB3 A;  4J9Q A;  1QSL A;  1YZ6 A;  4PJ0 U;  4BJQ A;  1L8L A;  4P4M A;  5HP4 A;  7ICR A;  5J0Y A;  4QZD A;  3MFH A;  1HUO A;  3SI8 A;  1S0M A;  3CRX A;  2VA8 A;  4GXK A;  2K8B B;  8ICE A;  3BJY A;  1KTQ A;  4CRX A;  1XO1 A;  3DEE A;  2LPE A;  3NTU A;  1ECW A;  4QZF A;  5KFI A;  5ALI A;  2C28 A;  2JMG A;  2Q4T A;  2KSO B;  1NK5 A;  2F76 X;  1L7M A;  4J9M A;  5KNI A;  2VAN A;  3TAD A;  1S76 D;  1MQ2 A;  5JUM A;  4ACO A;  2PMZ F;  3UXO A;  3H0M B;  4ED0 A;  4DQS A;  2KIW A;  1D8L A;  1SKW A;  4EZ9 A;  3H0R B;  5DLF A;  2AQ0 A;  4LJX A;  1C7Y A;  4UB8 U;  2JXJ A;  3F2D A;  4YVZ A;  3C5G A;  1PK3 A;  2LMR A;  2YQE A;  3SEI A;  3RBD A;  4KLF A;  2YN4 A;  7ICQ A;  5KG7 A;  1URJ A;  4YXM A;  3PZP A;  1COK A;  2ZXI A;  3JPP A;  1ZQH A;  2HVH A;  2PI5 A;  2HHT A;  1ZXI A;  3ICX A;  3KKA C;  1S77 D;  2P66 A;  3GFK B;  1NK8 A;  3K1R B;  1SXE A;  3G6X A;  5AKI A;  2KJ8 A;  3RFA A;  2KKV A;  3PSP A;  4YG2 A;  2OEH A;  2E1F A;  4KLO A;  2LM4 A;  3PW2 A;  4PL1 A;  3T79 A;  3RJH A;  2GH1 A;  5EWG A;  1QSY A;  1SXD A;  4B9U A;  1TFR A;  3Q8S B;  2MA1 A;  5JTI A;  1XSL A;  2G08 A;  2FMP A;  2HOI A;  3T5L A;  4NLZ A;  2R8I A;  2HVI A;  5J2D A;  1X40 A;  4OJ5 A;  4JUZ A;  3ZD8 A;  1DRG A;  3PO4 A;  1CEZ A;  3EPI A;  1WG8 A;  3EWA A;  1VJ5 A;  4M9H A;  4DQI A;  2ZIX A;  3JPQ A;  2B21 A;  4F5Q A;  5J29 A;  7ICF A;  5K4L A;  3M9O B;  2XI9 A;  5T14 A;  2H3Z A;  2BCR A;  1Z00 A;  2LHT A;  4M04 A;  2WAQ F;  1MN8 A;  3VC8 A;  4CF4 A;  4DL6 A;  2WF6 A;  4IRD A;  3PO5 A;  1NJX A;  5KAI U;  1MC8 A;  1XU4 A;  1FFV A;  2MUT A;  4EEN A;  3EZ5 A;  7ICK A;  4Y2U A;  2WHE A;  3QUQ A;  5ALY A;  2YMM A;  1XWL A;  3MBY A;  2HOQ A;  1PVP A;  2AH5 A;  2WF5 A;  5J0W A;  3HRD D;  5C0Y A;  5EWF A;  1BNO A;  1OW5 A;  1ZQJ A;  5JRT A;  5AIA A;  4IR1 A;  3UMG A;  1T8E A;  5ALT A;  1Z1B A;  4C4T A;  4ELV A;  3NS1 A;  4ED8 A;  1UQV A;  2GO7 A;  3PST A;  1N56 A;  3AM9 A;  3TI0 A;  3CNH A;  1RYU A;  3EYZ A;  3C1Y A;  2W9B B;  3WKA A;  5AKL A;  1L5U A;  4DQP A;  2KJ9 A;  3PW7 A;  4QZI A;  5DBB A;  5KT2 A;  5HNK A;  4J9K A;  2UVV A;  4LZD A;  7ICU A;  4F5R A;  5J2H A;  3WKC A;  5KFV A;  4Q8E A;  3HJE A;  3QUC A;  3DV9 A;  5L1L A;  2FPM A;  2VA2 A;  4HAI A;  1NZB A;  2RLT A;  1ZOL A;  4DL3 A;  3PML A;  4FFD A;  2K4P A;  4O3N A;  4RQ1 A;  5KFP A;  2OXO A;  3RJE A;  9ICU A;  1X2I A;  3TAD C;  4YMO A;  1RPL A;  3QXG A;  2NV3 A;  1N5X A;  1PVQ A;  5AKX A;  3G6Y A;  3QU2 A;  2XC9 A;  4CCH A;  5EE3 A;  4YD2 A;  2AGP A;  1JXL A;  5DQG A;  2ASD A;  1JRP A;  3GII A;  2KNJ A;  2KIV A;  1DK3 A;  1Z19 A;  3F53 A;  2W3S A;  1TK8 A;  4M6W A;  1QTM A;  4TUS A;  5J0X A;  2KZ3 A;  1WWU A;  7ICS A;  2G09 A;  4M9N A;  4NXZ A;  4QZ9 A;  5KFE A;  4IQT A;  5ALW A;  4RQ7 A;  3Q8K A;  1UA0 A;  2MAX A;  3V6H A;  2P6R A;  4YR2 A;  3H8S A;  1LKY B;  8ICC A;  1ZET A;  1C20 A;  3BZC A;  3WKE A;  2ISO A;  5ALL A;  2YMP A;  4UAW A;  4LVS A;  2NRV A;  3QUB A;  3BQ0 A;  2HSZ A;  3BS5 B;  3ISD A;  4R8U B;  4Y2X A;  3QEA Z;  1QLN A;  3BQT A;  4YR3 A;  2W8K A;  4Z6D A;  5ALJ A;  2FI1 A;  1ZQM A;  2ZUD A;  2JEJ A;  4I2J A;  1SV0 A;  5J8Y C;  9ICA A;  1RXV A;  3C2L A;  3NGD A;  2DWQ A;  2OWO A;  5IIN A;  3PW5 A;  2H3Q A;  2G07 A;  4J9N A;  2KJ5 A;  5ALS A;  2R8K A;  4YFK A;  4RQ0 A;  1X42 A;  1COO A;  3KHR A;  5L1J A;  5HMM A;  2A1J A;  9ICS A;  4UBB A;  2K60 A;  5DB8 A;  4F3O A;  1O08 A;  7ICT A;  3MR6 A;  5C5J A;  2XID A;  2L5Y A;  8ICG A;  3QZ7 A;  1Z4N A;  1BPE A;  2LYA A;  2YTU A;  7ICE A;  4IQU A;  4Y2V A;  2D6F C;  1NI3 A;  4J9P A;  2MRL A;  4KN4 A;  9ICO A;  2G0A A;  5AI9 A;  2XY6 A;  2AGQ A;  3D6J A;  1KFD A;  1TVA A;  8ICB A;  4R64 A;  1B0X A;  2H3F A;  4PPX A;  4FBT A;  5H2F U;  2F2A B;  5KFK A;  1WWV A;  3Q8P B;  1IG6 A;  5HR7 A;  1S5L U;  1U48 A;  4ECW A;  4F2R A;  5KG0 A;  4EYI B;  3RJG A;  3MFI A;  4O9M A;  9ICB A;  2XIC A;  5IIL A;  2E1E A;  1SWV A;  8ICT A;  5DB7 A;  3HP6 A;  5AM2 A;  1RQN A;  3SEN A;  5J0S A;  5ALK A;  3ISC A;  3RF9 A;  2KN7 A;  4YP3 A;  4US8 A;  1PZN A;  9ICP A;  3KD3 A;  3WK4 A;  1S0O A;  1XS9 D;  4RQ5 A;  2AXT U;  4K4H A;  1S0V A;  1J97 A;  3QNM A;  1SWW A;  2JEF A;  5ALG A;  2EAM A;  4BUG A;  2K4I A;  1T3N A;  5DQH A;  1NNL A;  1U9L A;  5KFF A;  8ICH A;  4PZN A;  2BGW A;  8ICK A;  5AI5 A;  4ECY A;  2RP5 A;  3PMN A;  5B5E U;  5HHH A;  3FAH A;  9ICV A;  4NWI A;  3IG8 A;  1ZD5 A;  1NJY A;  3QE9 Y;  5KT3 A;  1S97 A;  4P4O A;  3V6J A;  5ALM A;  9ICH A;  5F3X B;  5KFM A;  1NJZ A;  5J0Q A;  1NK7 A;  3WU2 U;  4C4R A;  2W7O A;  2JZB B;  1D9F A;  5AI0 A;  4M9G A;  8ICM A;  2QB0 A;  3C2K A;  4NM1 A;  4KLD A;  1OXJ A;  4F5P A;  1SV4 A;  5KG3 A;  4FZN A;  2FE9 A;  1QH9 A;  1L7N A;  2RDJ A;  3LWL A;  5L1M A;  3CYM A;  1A77 A;  4KX3 A;  4RPZ A;  3MDA A;  2F77 X;  5CR0 A;  1ZYQ A;  1ZQ1 C;  4IR9 A;  1GO3 F;  3OTQ A;  1D9D A;  2NYV A;  5F9L A;  4UW9 A;  2W54 A;  7ICV A;  2UVR A;  1KLN A;  7ICI A;  5KFC A;  4KIT B;  1LKY A;  2CRX A;  4F50 A;  4JB3 A;  4EEY A;  3SAH A;  4C8O A;  5EE9 A;  2DGZ A;  3BS5 A;  4AYB C;  4R8U A;  3M6K A;  1JRO A;  2R8H A;  1WCN A;  8ICO A;  4JWN A;  4Q45 A;  1RM6 C;  3AUO A;  8ICN A;  2NO4 A;  4RQM A;  4RNO A;  2XGP A;  1EXN A;  1HIW A;  9ICF A;  2Y9T A;  4IS7 A;  2YX8 A;  2HHX A;  5KFY A;  1SKR A;  2GLE A;  4O3P A;  2PFN A;  9ICK A;  4QWE A;  4F2S A;  1SL1 A;  4GC7 A;  2E3T A;  4O5E A;  4FE3 A;  3QUT A;  5D49 A;  1JI7 A;  3UXN A;  4MF2 A;  3GIJ A;  3JPR A;  4Z6C A;  2KOB A;  5KG2 A;  1RZT A;  3SYZ A;  3GDX A;  1OUQ A;  3PW0 A;  5L1I A;  4JV2 A;  4RQ2 A;  3KHG A;  3MR3 A;  3JPS A;  5D4B A;  4QWB A;  5AK4 A;  2K8C B;  2WAQ C;  4P4P A;  2E8P A;  3AU2 A;  5III A;  4KLG A;  4FBU A;  4NLC A;  4UB4 A;  4J9R A;  4QZG A;  1NOM A;  2ZIU B;  3V6K A;  2LM1 A;  5KFW A;  1RYS A;  1D8B A;  1PK1 A;  2FLP A;  2YML A;  1NJW A;  3PR5 B;  2K4E A;  1NK6 A;  2XO7 A;  1PUZ A;  5AIB A;  2QKQ A;  1BPY A;  4F5O A;  2LI6 A;  4DFD A;  3RAX A;  3IG5 A;  2F1I A;  1ZD3 A;  5KFA A;  2W55 A;  2ZIV B;  5KG5 A;  3S6J A;  3TFS A;  4P0P B;  4PZO A;  3RB3 A;  5KFG A;  4IQV A;  1WYG A;  3AL0 B;  4DOB A;  1ZQI A;  5KFQ A;  1KDH A;  4B9S A;  2I6X A;  2EZY A;  4ED3 A;  9ICL A;  2KZM A;  3KFU F;  3IRU A;  2BCQ A;  5HR6 A;  2DFL A;  4R63 A;  1T3Q A;  3T5K A;  3ONN A;  4MFC A;  4CF5 A;  4RU9 A;  2GWS A;  2HBM A;  4ZH4 A;  3FYH A;  4DL2 A;  5KFO A;  3F5A A;  4P0Q A;  3D2S A;  1BPD A;  3OHB A;  2ZJ8 A;  4YXJ A;  2DPJ A;  4C8M A;  4GIB A;  3NVZ A;  7ICJ A;  3RRG A;  5KT5 A;  2BPG A;  2LBO A;  2AQ4 A;  5AK5 A;  2VJ4 A;  2E8M A;  8ICA A;  4DO9 A;  3V7L A;  4DFM A;  4B9T A;  5IIO A;  4O3R A;  1P7D A;  4B9L A;  2R18 A;  1JUD A;  1QQ6 A;  2IOF A;  5KL8 B;  2QB1 A;  1BPZ A;  3H4B A;  2GOL A;  4F4K A;  3HWT A;  2OHF A;  5B66 U;  3JPN A;  5A0L A;  3NAS A;  1U45 A;  5L9X A;  5DBC A;  4KTQ A;  2KG5 A;  1N5W A;  1TK5 A;  4RPX A;  4NL9 A;  7ICP A;  4RUC A;  2HHW A;  4ED6 A;  3ISB A;  4FO6 A;  1ZQA A;  3UMB A;  2W03 A;  4KLL A;  4OJ6 A;  2VIX A;  1Z4O A;  4DQQ A;  3GV7 B;  3I76 A;  4I2G A;  2EH9 A;  2F8K A;  5AM4 A;  2KIC A;  5AI4 A;  3KOO A;  1BPX A;  5J8Y A;  4RQN A;  1ZQP A;  2J6T A;  1RQL A;  3C1Z A;  4MHV A;  5DB9 A;  5AM5 A;  1LVH A;  3HT3 A;  2R8G A;  2DPI A;  1CRX A;  3BQ2 A;  2VJ5 A;  2N1R A;  5TZV A;  3RR8 A;  2PFO A;  4CNQ A;  1KBU A;  3H4D A;  2ISP A;  3H40 A;  3QU5 A;  1NKE A;  3UM9 A;  4IRK A;  4BXO B;  3JPT A;  3I28 A;  4DFJ A;  1N61 A;  3SAF A;  2H5X A;  3ZI4 A;  4UAZ A;  4O3Q A;  2YMQ A;  2A19 A;  3BQ1 A;  4TQR A;  3GQC A;  5CRX A;  1WUD A;  5AIC A;  2V4Q A;  5AK3 A;  4UBC A;  4UAS A;  4DOC A;  1F0M A;  2VA3 A;  5KFX A;  4EX6 A;  3RAQ A;  5DDY A;  2W9C B;  2F3N A;  5DG9 A;  4QZH A;  3RR7 A;  4KLQ A;  8ICW A;  3LYS A;  4ECS A;  4Y2P A;  3RRH A;  3RB6 A;  2ZTD A;  2D8C A;  1ZQO A;  5KT4 A;  3ZDC A;  3RB4 A;  4NJ8 A;  3RB0 A;  4PHP A;  2RRD A;  3MGV A;  5AKK A;  4F4W A;  3Q8M A;  3LK9 A;  1L8O A;  4CDG A;  5KFT A;  1X66 A;  5KFS A;  4PHD A;  4NM2 A;  4I2F A;  2IA6 A;  5AM3 A;  5KFB A;  2MSN A;  2KVC A;  1NKB A;  2ZIW B;  3MGI A;  3TQ1 A;  2HHV A;  5IIK A;  3AEV A;  2CPR A;  2ZG6 A;  5CB1 A;  4OCZ A;  2FJ6 A;  5KFJ A;  3HX0 A;  4DS4 A;  1DXS A;  2NRT A;  2NRW A;  4DSF A;  5TIS U;  1TV9 A;  1L3T A;  4NV0 A;  2I1Q A;  1ZD4 A;  2H3V A;  3Q8R B;  2W9A A;  5ALH A;  1KFS A;  5DLG A;  3U26 A;  3T5J A;  2IHN A;  3MR2 A;  1QQ5 A;  5KFD A;  9ICC A;  4MF8 A;  2W7P A;  3IN5 A;  2KSO A;  4G3I A;  7ICL A;  2KK0 A;  4RQ3 A;  5CJ7 A;  1ZQD A;  3N7R C;  4U7C A;  4Y2S A;  3UQ2 A;  2BPF A;  1XO0 A;  4KX5 A;  1X9X A;  3PY8 A;  5BOL A;  5J2J A;  3SQI A;  2J6U A;  2DF4 B;  1X6I A;  4NL9 C;  3N28 A;  2HI0 A;  8ICF A;  3MC1 A;  3TAC B;  3UQ0 A;  1N62 A;  1MA7 A;  4ICA A;  3TFR A;  3R9K A;  5KG6 A;  2K4H A;  2WTF A;  3H8M A;  3SV4 A;  3AU6 A;  2KEY A;  5EWE A;  2XCA A;  5KFU A;  1BVS A;  3C2M A;  1KRP A;  3OHA A;  1QQ7 A;  1A6S A;  4J9S A;  4C8N A;  4BDP A;  1ZQE A;  1NK9 A;  2CN1 A;  4Y2R A;  4FZM A;  1ZQG A;  3SMV A;  2WF8 A;  4PH5 A;  3ETR A;  1TAM A;  7ICG A;  1V9P A;  2JH7 A;  2F1H A;  2OYY A;  1ZQZ A;  3M6Z A;  1IM4 A;  9ICQ A;  4F5N A;  2ASJ A;  2JEI A;  4JMU A;  3H8W A;  3NRZ A;  4QIW C;  4JK1 A;  9ICI A;  4DLG A;  1XNS A;  2G5I B;  3L5K A;  2HCF A;  4IC9 A;  1KKX A;  3SAG A;  4O3O A;  3NRW A;  1ZQB A;  2E8O A;  1JN3 A;  3B0Y A;  2KHV A;  3H8J A;  3KHH A;  5JU5 A;  4QZB A;  3KZI U;  3UMC A;  1IXR A;  2PFQ A;  2AJQ A;  5AKE A;  4DCC A;  8ICP A;  1VDV A;  4DSK A;  2BCU A;  1LV5 A;  2F1J A;  4B9N A;  3C29 A;  5ALZ A;  2AHO B;  2FPL A;  3IV6 A;  3K75 D;  4Z6E A;  3KZX A;  1T4G A;  1ZQQ A;  3EW9 A;  2XVT A;  3CP8 A;  1Z3E B;  1N2X A;  2WB1 F;  4KLI A;  1RDF A;  1XC9 A;  1AQ6 A;  1N60 A;  3HW8 A;  1MQ3 A;  2KFN A;  1BPB A;  4E0D A;  1QCK A;  4QZA A;  2Y0S C;  1CUK A;  4MEX A;  4DOA A;  5J2B A;  3WK5 A;  3OGU A;  2W04 A;  1NKC A;  4YMN A;  4I2I A;  3PSF A;  4DWI A;  2ZTE A;  1K5O A;  1LB2 B;  3FC4 A;  2BHN A;  2W9B A;  2JH1 A;  2OM6 A;  2K89 A;  1U47 A;  1Q3U A;  2RHF A;  2EZZ A;  4XRH A;  3RJI A;  1F5S A;  2Y1J A;  3TAQ A;  4UAU A;  2EAO A;  3B9J A;  4F4Y A;  4DF8 A;  5DDM A;  7ICH A;  1A76 A;  9ICT A;  4PGY A;  3WK7 A;  8ICR A;  5ALD A;  4NLG A;  3A0B U;  4GC6 A;  3IM1 A;  5ALR A;  5AKH A;  1HUZ A;  3L4P A;  5J0T A;  4KLU A;  4O0I A;  8ICX A;  3OJS A;  1JX4 A;  1J2M A;  5AKY A;  5J2I A;  3RH4 A;  1U49 A;  5AI8 A;  3N7S C;  2NRZ A;  1VLB A;  5CA7 A;  4ECQ A;  2PMZ C;  5KFN A;  5G5H A;  2M9N A;  4QNL A;  2HHS A;  1ED1 A;  1ZD2 P;  2H3I A;  2B6G A;  5L1K A;  1X9S A;  2HBJ A;  3PX6 A;  3FM9 A;  4OJO A;  9ICR A;  3QYP A;  3QEB Z;  4XUS A;  4QW9 A;  4ED1 A;  4AP9 A;  4C0Z A;  4Y2Y A;  4Z6F A;  1HJP A;  4F8R A;  2RQ5 A;  4WJ3 B;  3HPO A;  3OSP A;  4YCX A;  4DL7 A;  4J9L A;  5EE1 A;  2W9M A;  3GIK A;  4ED2 A;  5DG8 A;  3T5H A;  2LYB A;  4I2B A;  2BPC A;  2BDP A;  9ICW A;  4ELU A;  1ZJM A;  5J2F A;  3BZK A;  8ICZ A;  3PV8 A;  4IQW A;  1KFT A;  3RH5 A;  4G9B A;  4PL2 A;  3ZDE A;  4YD1 A;  3F2C A;  5KG4 A;  3LWM A;  9ICJ A;  5J2G A;  4QZC A;  3EPG A;  2ZIX B;  2KE7 A;  1X9M A;  4Q43 A;  5KT7 A;  3H0L B;  2EQY A;  4KLH A;  5BPC A;  1S9F A;  5HHI A;  3IDW A;  3OJU A;  2R8J A;  8ICS A;  1ZQW A;  1Z00 B;  5HML A;  3C23 A;  3N4M B;  1S0N A;  2IBK A;  4ZOH C;  1KQQ A;  2WF7 A;  2W8L A;  3PX0 A;  2FLN A;  3KTQ A;  4M9L A;  2O6K A;  4CE6 A;  4DLE A;  1NK4 A;  4FS2 A;  4RUA A;  4XA5 A;  3GV8 B;  2KP7 A;  5D46 A;  2MUT B;  2BR0 A;  5KTQ A;  2A3V A;  5ALX A;  1ZQY A;  8ICU A;  4DFP A;  1UHU A;  1D8Y A;  1NZP A;  4US9 A;  3MGH A;  1FEZ A;  3GIM A;  4DQR A;  1RG6 A;  3M8R A;  5AI6 A;  1TAQ A;  2ZUB A;  4B6J A;  4KLM A;  4B9V A;  3QU4 A;  4O3S A;  1QSS A;  1L7O A;  4TUP A;  5KAF U;  1KSP A;  1N63 A;  5CHG A;  5J2K A;  3V72 A;  4CGZ A;  3E0F A;  5DGB A;  3RJK A;  3NUQ A;  3V7K A;  2BCS A;  2JRZ A;  3D2Q A;  7ICO A;  4F92 B;  2BKE A;  1Q3V A;  4ECZ A;  4NY8 A;  2HHQ A;  4I2H A;  4C8L A;  2LKY A;  2M0N A;  1T7P A;  5J0R A;  2JEG A;  2WF9 A;  3WK6 A;  5DBA A;  3MR5 A;  4M0A A;  1ZRN A;  2EAP A;  4YR0 A;  4UB2 A;  2C2D A;  3LVV A;  4UAV A;  3RBE A;  1KEJ A;  3K1Z A;  4B9M A;  4M6W B;  2JZB A;  4ECT A;  4ECR A;  3M9M B;  2I9G A;  3N97 B;  2G5H B;  4ECV A;  2BDU A;  1Q8K A;  4GXJ A;  2KMD A;  2FMS A;  5E79 U;  1S10 A;  5ALQ A;  1KN5 A;  4ECX A;  2KTQ A;  3L3F X;  9ICX A;  2ESE A;  5DQI A;  1TK0 A;  2P35 A;  4Y2T A;  1ZQR A; 
#chains in the Genus database with same CATH homology
 5GTH U;  5TIS U;  5KAI U;  5B66 U;  5KAF U;  5H2F U;  2DUY A;  3WU2 U;  5E79 U;  4IL6 U;  4UB6 U;  4PJ0 U;  5B5E U;  3A0B U;  1S5L U;  4UB8 U;  3A0H U;  5GTI U;  3KZI U;  2AXT U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...