2AXTU

Crystal structure of photosystem ii from thermosynechococcus elongatus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards complete cofactor arrangement in the 3.0 A resolution structure of photosystem II
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein
total genus 27
structure length 98
sequence length 98
chains with identical sequence u
ec nomenclature
pdb deposition date 2005-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 2axtU01
4PJ0U 5KAFU 5H2FU 1S5LU 5TISU 3WU2U 4UB8U 2AXTU 3KZIU 5E79U 5GTHU 5GTIU 3A0HU 4IL6U 5B5EU 2DUYA 5B66U 4UB6U 3A0BU 5KAIU
chains in the Genus database with same CATH superfamily
4GFJA 4GXKA 3PZPA 3RF9A 3ISDA 2KHQA 2AGPA 3AQEA 5KAFU 4YVZA 2XCAA 4DFKA 2XICA 1CRXA 2JMGA 5ALPA 4C8KA 3TARA 5AICA 1NK8A 3CP8A 3C1ZA 3PW4A 3PX0A 2ZJAA 2BPGA 3MR2A 1Q3UA 5BOMA 2YB1A 2DPJA 1NOMA 3PW2A 4F2RA 5AK6A 1X42A 1A76A 2HW3A 4EBCA 4UAWA 2G09A 8ICXA 4M9LA 4FE3A 2JEIA 3IRUA 5J2DA 2M9NA 1VJ5A 2FLPA 4R66A 3OJSA 2HSZA 4ECUA 5AI8A 5IIIA 4P0QB 1ECWA 3ZDCA 3ZDEA 4CF3A 4PL2A 4FS2A 2Y9UA 5ALHA 3SR6A 3MR3A 1T94A 4OCZA 4RQ8A 3FYHA 3D2SA 2W8LA 2FLLA 8ICWA 4O5KA 2HBMA 5J2BA 1L7MA 1S0VA 1YZ6A 4I29A 3V7LA 5AKKA 4IQWA 1MSWD 4IQVA 1ZD3A 3OJUA 5J0WA 4PZNA 2ZIUA 4DOAA 2G08A 3ISCA 1KFDA 2O6KA 3TKAA 1Q46A 4QZEA 3ETRA 2PMZF 3L4PA 4O3SA 2ZXHA 4JMUA 1CI4A 2HHTA 4PJ0U 4JUZA 3H4BA 5KT6A 2W9BA 4B6JA 1GO3F 5AK4A 1YZ7A 1L3VA 4DOBA 2XY6A 3HRDD 1NK0A 3PW5A 5HR6A 4IQUA 3TAQA 1X9MA 2G07A 4KLQA 2P6UA 3DV9A 3AMZA 5KFOA 3C21A 4OO1J 2HHSA 1O03A 4FBTA 3HW8A 3F2CA 3JPOA 2PFOA 4DFPA 8ICIA 4PGXA 2UVRA 4KLTA 4RU9A 4F92B 5J0OA 1SL2A 5EWFA 1IG6A 4KN4A 3AU2A 3N7SC 4F5OA 4P4PA 3I1YA 2AXTU 1OUQA 5ALSA 3ZI4A 2KKPA 1IXRA 1DK3A 4DS5A 1S0OA 4HAIA 4M47A 4USAA 2NO4A 1UT8A 2F3NA 2LI6A 4YCXA 2H5XA 5DGBA 5KFTA 4E0DA 3RJGA 4K4IA 3LWMA 2ISOA 1D8LA 2ASJA 3ED5A 2F8KA 4EBDA 3JPTA 4CNQA 4FZMA 3SV3A 3AN1A 1DGJA 8ICGA 5DQGA 2V4QA 4JV2A 5ALYA 2LM1A 2KJ8A 4U6PA 1ZD5A 1JX4A 3PR5B 1DRGA 2RP5A 2ZIVA 2NRZA 1NJZA 4I2JA 1A0PA 4DWIA 3HILA 3NS1A 2NV3A 1X66A 2YY6A 4NM1A 5DB7A 3KZIU 2ZXIA 2D6FC 1Z4OA 4QZCA 4F50A 3RTVA 1ZQBA 5K4LA 4RQ7A 4R63A 3RB6A 1RXVA 1B4FA 5IILA 1IV8A 2KZMA 1U49A 4FO6A 2WB1C 3WK9A 1SV0A 3E58A 5KG5A 4ECWA 4F72A 4KLHA 2B6GA 2XIDA 1S0MA 3T5KA 4M6WB 3JPQA 5KTQA 5ALJA 1N60A 2FMPA 3PY8A 4AYBF 4YXJA 3TAPA 5D46A 1WG8A 4Q44A 5HHIA 5L1MA 2UVVA 5KG0A 2WF7A 2P66A 3ZDBA 5CR0A 2W9BB 2JGAA 5CHGA 3QZ7A 2IBKA 1TKDA 1IIPA 3NRZA 4EX6A 1X2IA 4YD1A 1T3NA 4EBEA 5IIJA 4TUPA 5J8YC 7ICSA 4M04A 5J2KA 3L3FX 1UPHA 9ICIA 2WAQF 1XU4A 1NK5A 3QU2A 3HPOA 2HOQA 1QQ6A 3D2NA 4CF5A 4XRHA 2I6XA 4OJOA 1QH9A 4FZNA 8ICTA 4I2AA 4Y2PA 2YMPA 4A8EA 4YP3A 3H0RB 1FFUA 4NL9C 4TUQA 2XGPA 2QARA 3G6XA 4FZLA 4ECXA 1Y88A 5CP2A 1N61A 8ICSA 2JH7A 4C0ZA 2OYYA 5AKHA 3IP4B 4UB3A 5L1JA 2KV2A 4KLGA 2LYAA 1ZOLA 2RHFA 5DG8A 2F44A 4I2GA 2BQUA 1URJA 4FFDA 5TZVA 2J6SA 3GIJA 4MFFA 1RQNA 1L5UA 5DBCA 5KFHA 1XWLA 2I1QA 2A1JA 4RQ3A 4YMNA 1TVAA 5D49A 1KLNA 3PO4A 2IHNA 1JALA 5CJ7A 3F2DA 5J2AA 3EW9A 1RM6C 1DGSA 1NKBA 2W9MA 2IOFA 3HT3A 4ECSA 5IINA 2HDOA 4ICAA 5JU5A 4GLXA 4ECTA 4YMMA 5J2FA 2R8JA 3QEAZ 1ZQGA 1NI3A 7ICOA 5KFSA 5F3XB 2EAOA 2GLEA 1VDVA 3WK5A 4P2HA 2ES6A 2J6TA 1O08A 3QUBA 5G5GA 2B0CA 9ICKA 3F5AA 2W3RA 1SXEA 2R8KA 2JEJA 2KHVA 2KSOA 5ALNA 2OXOA 3AU6A 7ICTA 2PI5A 4JV0A 3CYMA 4UB4A 3H40A 4CCHA 3RAQA 4PHPA 1WCLA 2HVIA 2ATLA 2KIWA 3N7PD 2XGQA 1J97A 2IMWP 1XSNA 4NLGA 4F93B 4QW9A 4C4TA 3MBYA 4PHEA 5J0PA 1K5OA 1IM4A 3GV8B 2C22A 4TQRA 2VKQA 1LB2B 2WAQC 2QKQA 4PHAA 1KDHA 2GOLA 5AIBA 1ZRNA 4DL7A 3V72A 7ICRA 3PV8A 9ICHA 2ZIXA 3MR5A 3NVWA 1HUZA 2ZG6A 1UHUA 2BZFA 4QWAA 4GC6A 4DFMA 1Z1BA 1QQ7A 2YX8A 4RT3A 4DLEA 1Q3VA 1NNLA 4IL6U 4KLUA 2H3FA 5F9NA 3QE9Y 1J2NA 2H3QA 4P4OA 3MGHA 1SL1A 5GTIU 4RPYA 1RXWA 2K4PA 3LVVA 4UARA 3I76A 2V4RA 5ALKA 2ODGA 2JEFA 4ED8A 1L6NA 5J29A 1MQ2A 3RJJA 3M6ZA 3WK4A 3TFSA 2DF4B 1L3UA 3BQ1A 9ICVA 2NO5A 1RYRA 4Z6DA 3SD7A 5KFDA 1D9DA 9ICFA 4EELA 3T79A 2RQ5A 3JPSA 5AK3A 4RQ6A 4ED0A 4R65A 5AM0A 4UAZA 5ALWA 2CRXA 1X9XA 1PK3A 4C7YA 3EWAA 9ICPA 2C2RA 4RNOA 1C20A 4BWJA 4Y2UA 3MGVA 4GXIA 3PW0A 3OHBA 4C80A 1SV0C 1ZRMA 1KSPA 5A0LA 2PFPA 1ZQIA 1MN8A 1JXLA 5KG4A 1NJYA 4BDPA 3UXPA 2W9CB 2CPRA 2YMMA 4CGZA 5CRXA 1RZTA 5DG7A 4DL6A 2Y1IA 3ETLA 5KFJA 2XC9A 1U48A 1KQQA 2HHVA 1Z00A 4RQ4A 3MABA 2DKZA 4QNLA 5C0YA 4DOCA 1ZQZA 4QZ8A 3GIKA 4YFKA 2DQNB 5KFWA 3NVVA 4RUCA 2MA1A 4Y2TA 1RPLA 8ICPA 7ICMA 5ALVA 4F71A 4DQQA 3H0LB 3SAHA 2W11A 5L1IA 3DDHA 1N48A 2WHEA 1TV9A 4KITB 5KG6A 1ZQXA 4Q43A 3SV4A 5D4BA 1QLNA 4XA5A 5EE9A 4F2SA 1FO4A 5IIOA 2I5HA 2WFAA 2XY7A 4IR9A 1N2XA 3SMVA 4UASA 1S77D 2W7PA 5EE3A 1B22A 1ZQUA 1FFVA 9ICAA 1SWWA 4NM2A 1NKCA 3NRWA 1ZD4A 3H7IA 2YMLA 9ICBA 1KKXA 3M9OB 1V85A 2GO7A 3TADA 5JUMA 3IN5A 2KP7A 4RQ1A 3QU9A 1TE2A 4I2EA 3NTUA 1MQ3A 4DCCA 4K4HA 8ICLA 5AK5A 3OPXA 1L8OA 3AQFA 4DQRA 3PSFA 2PKEA 2G0AA 3T5JA 2EAPA 2VJ5A 3C1YA 4NLBA 4O3QA 4KMOB 1S10A 5KFPA 4DLGA 3KHGA 2NRWA 2HBKA 5F9LA 3OGUA 3ISBA 5EWEA 4ELUA 3B0YA 5KFGA 5KL8B 2BKEA 3O0FA 2C2EA 4UB6U 2DL0A 4PHDA 2BCQA 4UW9A 5DQHA 3JPPA 1NK9A 1ZQTA 3C2KA 3WKEA 2F76X 4XUSA 4ECQA 1F44A 8ICAA 2DUYA 2ZIWB 1Z00B 3BQTA 2RLTA 2KE7A 3PX4A 2MUTA 5AKYA 1D9FA 5J2IA 3H4DA 4DL4A 3NASA 2NRTA 1S76D 4PPXA 2EZZA 9ICSA 5DLGA 1A77A 3HJEA 5ALQA 4MF8A 2ASDA 3BS5A 2KNJA 2Y0SF 4MFAA 5J0QA 1TAMA 1PK1A 3MFHA 2AHOB 5KT5A 3RJFA 2BDPA 3M1YA 1L3TA 1NKEA 4J9MA 4F5NA 1TAQA 4BX9C 4YG2A 4Y2VA 1SKRA 3H8JA 4B9NA 2E5SA 3MGIA 1HJPA 1PK1B 5HMMA 1HIWA 4C4RA 5JRTA 1PZNA 1WUDA 2ZIVB 2ZJ8A 2NYVA 3NVYA 4GIBA 3T3FA 2KG5A 3NUQA 4ZOHC 4BXOA 4EEYA 3H8WA 4NV0A 2K8BB 7ICEA 4I2HA 4GXJA 5GTHU 1D8BA 3Q8PB 5DLFA 1KBUA 1N56A 3BS7A 5AKLA 3C23A 3LWLA 2ZIWA 4RQMA 1COOA 1FIQA 2E1FA 1BNOA 3FM9A 3C29A 5CEHA 3SZ2A 2HMXA 2BGWA 2Q4TA 5DKWA 1ZXIA 1BPBA 4ED3A 4QZ9A 2JZBA 2E8PA 4KMUA 1QTMA 1SWVA 4BUGA 4JV1A 4MFCA 4LVSA 2GH1A 2MU2A 2RRDA 1ZQSA 1BGXT 1U4BA 3OSPA 2E8OA 5AM1A 3EYZA 1JIHA 3HWTA 5DDYA 3OTQA 1DK2A 2KJ9A 2FPMA 4UB5A 4Z6EA 2OEHA 2EANA 2VA8A 1PVRA 2K60A 1U45A 3KOOA 4UAYA 2D3DA 5HNKA 4F8RA 5ALDA 5ALFA 4R8UB 4ECZA 4US9A 2ZUDA 2W7OA 4J9SA 2F8LA 1ZQEA 5AM5A 2FPLA 2HHUA 3N7RC 3V6KA 1X6JA 1TK8A 1KRPA 1LVHA 1J2MA 2Y9TA 5ALZA 1AROP 4PH5A 1SGGA 4YXMA 1KN5A 5AKJA 5KFQA 1SZPA 4J9NA 9ICRA 3ALRA 3BDPA 3RAXA 2W03A 3T5LA 2A1JB 4QZGA 3TANA 4ED6A 3ONNA 4YD2A 2QARB 2E3TA 8ICQA 2MAXA 2OH2A 1XO0A 2EZXA 4M9GA 3F53A 3LK9A 4KLSA 4O3MA 4R64A 4ACOA 2BQ3A 1N63A 4NWIA 3M6KA 5B5EU 4F4KA 5ALLA 1QCKA 2W55A 1ZQHA 4M9JA 4QZHA 4I2FA 5TISU 4DL3A 7ICNA 3C5FA 2KJ5A 4QZIA 2LYHA 4B9SA 3I28A 4P0PB 5AKZA 4QZAA 3CRXA 1CEZA 5J2EA 2JEGA 4FBUA 1SKSA 4QW8A 2GWSA 2ZTDA 5KFBA 2W9CA 2YB4A 5KG7A 4K4GA 3FDSA 5J0XA 3M7DA 2IA6A 3QEBZ 5AM4A 3UM9A 1X9SA 2BCSA 4ZH4A 4EX7A 9ICXA 4C4SA 4DQIA 2HHWA 5J2HA 2NRXA 2LMRA 4JWNA 4DSEA 4XQ8A 3ZDDA 4GC7A 3UMGA 3ICXA 4Y2XA 3QNMA 5J2JA 2E1EA 2A3VA 4Z6FA 3Q8QB 2F1JA 5KFNA 4YR0A 2ZUCA 1C7YA 3RR8A 4MHVA 2F2AB 2HVHA 3MDAA 5AI5A 3UQ2A 3GV5B 4B9TA 3KFUF 1S97A 2RDJA 1WCNA 4OJPA 4WJ3B 4EYHB 3PSPA 4QWBA 2FJ6A 5ALGA 4Z6CA 4EENA 1SL0A 5AKIA 3SAGA 3Q8RB 2KK0A 2WF5A 2ZIXB 1SV4A 1L7NA 5KFCA 4ED1A 3UMCA 2HOIA 5AM2A 1Q8KA 2KICA 4UAUA 1T8EA 2KKVA 2VA2A 5AI4A 3BQ2A 5J0YA 1HEKA 4C8NA 4C8LA 3LVWA 3M9MB 4O9MA 3WU2U 1L8LA 1RG6A 5J0TA 4YMOA 1L7PA 3D2QA 1XC9A 8ICZA 3B9JA 4C7ZA 5KNIA 2D8CA 2AQ0A 4ED7A 2A1AA 1KFTA 3GFKB 4UQGA 3Q8MA 3ZD8A 3K4GA 2AH5A 2P6RA 4RZRA 4J9PA 3WK7A 3KTQA 2KSOB 9ICMA 2F77X 4KX3A 3QU5A 5J0SA 5AM3A 4J9OA 4B9VA 3NGDA 4M2YA 1PVPA 1ZJNA 2VJ4A 4O3NA 2N1RA 5KAIU 1ZQJA 2HHQA 1NZPA 2Z7JA 3RBEA 3THVA 2HI0A 3OSNA 3ORYA 2K4HA 1UA1A 1XNSA 5DG9A 5B66U 2MUTB 3K1RB 4RNMA 2KZ3A 4TUSA 2BQRA 1QQ5A 2VANA 2V9WA 3MDCA 4BWMA 2KD1A 4QWDA 5BPCA 8ICVA 5AKXA 4FS1A 1ZQYA 3QX7A 2ESEA 4MF2A 8ICMA 2DFLA 5KFKA 5DB8A 1K1SA 2UVUA 2LM4A 2BPFA 3J81j 2JXJA 4YR3A 8ICNA 4O5CA 2HOFA 3AUOA 2KVCA 3UXOA 3PX6A 2IOHA 1KFSA 4RQ2A 1D8YA 5E79U 4BJQA 4G3IA 3UQ0A 2JH1A 2JHDA 2WF9A 4I2DA 3K1ZA 7ICUA 2F1IA 4UB2A 4EZ6A 1SXDA 3QUTA 3V7KA 4NJ8A 2BCUA 1JI7A 1ZQ1C 1L7OA 4CE6A 5AHXA 1S9FA 2VA3A 2FI1A 2PI4A 1N5WA 2LBOA 3WK6A 3QZ8A 4JWMA 1XSLA 9ICUA 3MC1A 2YN4A 2FDRA 3RJKA 2K4EA 3PO5A 1LKYB 4RQ0A 3SEIA 4ED2A 4KLIA 4KLDA 4NLZA 1MC8A 2W8KA 2W9AA 2B21A 1NK7A 5AKGA 9ICTA 4I2BA 1PUZA 2BPCA 2BCRA 5EE1A 3M8RA 3AM9A 2K4IA 2WTFA 1UA0A 2AGQA 2EQYA 3KKAA 3VCBA 3EZ5A 2A19A 2JV3A 2IOFK 2XO7A 2AGOA 1QSLA 4RPZA 3E0FA 4DFJA 4ELVA 4ELTA 3GILA 1DXSA 4IRDA 2NRVA 5J0RA 1ZQOA 2WF8A 3HKZF 5CB1A 2LKYA 4RPXA 3SQIA 2EH9A 3RB0A 2HBLA 4BXOB 4O0IA 4KLJA 5AIAA 2EDUA 2YTUA 4O3OA 4DSFA 2K89A 3RH6A 1WYGA 3A0BU 3BQ7A 3PSTA 2H3VA 4IS7A 3PR4A 1X6IA 4US8A 1ZQNA 5L1KA 1ZQKA 8ICCA 4LJXA 3T5HA 2M0NA 3KD3A 5DBBA 3DEEA 3CW2C 1QSYA 1BPZA 1V9PA 1PVQA 1VLBA 2BHNA 9ICEA 3VC8A 3PVXA 3KHHA 2W54A 4J9KA 4KX5A 1BPYA 4NY8A 1JRPA 2IHMA 3G6YA 3C5GA 4O3RA 2AQ4A 4UAVA 4DF8A 2XCPA 1U47A 2FE9A 4Y2JA 3KBBA 5KFYA 1Z3EB 5J2CA 3GIIA 1M6YA 3SAFA 1LKYA 3M8SA 2G5IB 4F4YA 2VIXA 5KG3A 2KOBA 1F5SA 2AU0A 5KFEA 4QWEA 3GZFA 4IC9A 5KG1A 1XS9D 4IQTA 4CF4A 5HHHA 5J0UA 3HX0A 1K1QA 9ICOA 2K8CB 2H3ZA 1ZQWA 1P7DA 4NLNA 5HP4A 2R18A 3RH4A 4Q8FA 2EAMA 4JB3A 4J9LA 3OHAA 3MFIA 5AKEA 5DB9A 4RQ5A 5KFVA 2W43A 7ICHA 4F4ZA 9ICLA 2C2DA 2W3SA 1ZQVA 1TK0A 4QWCA 4ECVA 3UMBA 1ZQPA 2HBJA 4HYKA 1MA7A 3RH5A 1JMSA 3V6JA 2LHTA 2DKXA 2KEYA 3U26A 3F2BA 1T7PA 3KZXA 1B43A 3HKZC 2G5HB 2UVWA 4NLKA 3FAHA 1S8OA 5ALUA 1NK4A 2MRLA 2MSNA 5ALXA 5ALEA 4DL2A 5DGAA 7ICGA 2OM6A 2EZYA 2OCEA 4I2IA 1CUKA 1KL9A 4R8UA 5KFFA 2I9GA 1A6SA 1ZQLA 3JPRA 5H2FU 5KT7A 2XVTA 3GQCA 3PSIA 1JUDA 3N97B 4B9UA 3A0HU 3QUQA 1OXJA 5BOLA 3C2MA 1BPXA 2PXIA 3GU3A 1KW4A 1YT3A 3HP6A 8ICYA 4I27A 8ICKA 2H3IA 1Z4NA 4MEYA 4NLCA 8ICFA 5CWRA 1RYSA 4OJ6A 3WKAA 4P4MA 1ZQFA 2Q0ZX 3RRGA 2OHFA 4DQSA 1H38A 1JXEA 4KLOA 4QIWC 4YQWA 4DSJA 4KLMA 8ICHA 4DF4A 2F1HA 4F5QA 4M6WA 8ICBA 8ICOA 3C2LA 5DQIA 2W04A 2KN7A 3LDAA 3BQ0A 4EYIB 1DOQA 1B0XA 1N5XA 2DGZA 4CRXA 1ED1A 2ALZA 4PGYA 3L5KA 1ZQQA 3WKDA 4I2CA 4LZGA 1COKA 2LPEA 3S6JA 4J03A 3RR7A 3IM1A 7ICQA 4AYBC 1UT5A 3MR6A 2E8NA 4LZDA 2DPIA 4F4WA 4KN7A 1UCVA 3SI8A 4F5RA 4Y2RA 1V97A 2J6UA 5DBAA 5J2GA 4ECRA 2BDUA 5ALTA 4YN4A 8ICJA 4M0AA 3Q8SB 2XY5A 2WB1F 5KFMA 4OJLA 2FLNA 4KLLA 1ZQAA 3ZD9A 7ICKA 5L1LA 2FPKA 3TQ1A 2HCFA 2ASLA 4YR2A 1LV5A 5HMLA 3N28A 3SENA 2BCVA 1QSSA 9ICGA 4UB8U 2QLTA 4X5VA 1F0MA 1N62A 3IDWA 2QB0B 3CNHA 1WWUA 2JR5A 1Z19A 4J9RA 2KIVA 2WF6A 3GV7B 1NJWA 1S5LU 3D6JA 3IG8A 3TFRA 3BS5B 4O3PA 3TADC 1RYUA 4DSKA 1TFRA 4O5EA 1ZQCA 2YQEA 1NZBA 2QB0A 4G9BA 2OWOA 5G5HA 2G06A 4OD0A 4DQPA 1ZQMA 1FEZA 2CXYA 4M9HA 9ICJA 5AI9A 4ECYA 1EXNA 5EE0A 7ICPA 2LYBA 3GDXA 3UPQA 4UATA 4TURA 2C28A 4OJ5A 5KFRA 1RQLA 4QJFB 2XI9A 5ALRA 4DS4A 2Y0SC 4Y2QA 4I28A 3SYZA 5ALIA 3TI0A 3ZDAA 3PMLA 4EEKA 1SKWA 4F3OA 1S0NA 1X40A 3WKCA 3N4MB 4DSLA 7ICIA 4RT2A 2QB1A 4P0PA 4Q8EA 9ICCA 3PW7A 2ZTEA 3IG5A 1NK6A 1X9WA 1ZQRA 5ALOA 1SB3C 5EWGA 3TACB 2Y1JA 5IIMA 1KTQA 5KL1B 3F5EA 5HR7A 5CA7A 1SIJA 5KFLA 4EZ9A 1RDFA 3K75D 4Q45A 4Y2SA 5C5JA 2FMSA 4KLFA 2AJQA 1T4GA 1SZHA 2DWQA 3UXNA 1BNPA 4PZOA 2ZIUB 4F91B 4DO9A 4JK1A 3EUB2 1T3QA 3Q8KA 3KKAC 4IRCA 5KFUA 4U7CA 4PGQA 3PMNA 9ICQA 4PL1A 4IRKA 3BZCA 1ZETA 4UBBA 5ALMA 1XO1A 3RJIA 4B9MA 8ICUA 3Q8LA 4DEZA 3IHQB 1XSPA 3JPNA 2ZUBA 2FMQA 3AL0B 2KVSA 3KHLA 3WKBA 1JROA 2RDIA 3LYSA 3H8MA 3RFAA 1NJXA 3E2EA 3IV6A 1Z1VA 5EOZA 7ICLA 4IR1A 3R9KA 4UB1A 2KFNA 2ZTCA 3QXGA 3FC4A 3V7JA 5AI6A 9ICWA 4F4XA 2KFZA 2BR0A 3KHRA 5KG2A 4QZFA 3RB4A 7ICVA 2YMQA 1UQVA 2PFQA 1ZQDA 2JZBB 1V38A 2L5YA 1ZJMA 4P0QA 4NXZA 3M9NB 1JN3A 1ZD2P 3QUCA 5L9XA 3RBDA 2HHXA 4KLEA 4DFDA 4C8OA 3H0MB 8ICEA 1TAUA 4QZBA 1AQ6A 4C8MA 2KZZA 9ICNA 5KFZA 3V6HA 4B9LA 3QU4A 2R8HA 2CN1A 3PNCA 4NL9A 2PMZC 3EPIA 2PFNA 4KTQA 4UBCA 1WWVA 4J9QA 4RQNA 5KFIA 5FP0A 2ZJ5A 4DL5A 3AEVA 4QZDA 1U9LA 3RRHA 5KFXA 5DDMA 1L3SA 5JTIA 1OW5A 2R8GA 3BZKA 1KEJA 1TK5A 5IIKA 2DBYA 4DSIA 5J8YA 3G6VA 3QU7A 3NVZA 1HUOA 3GIMA 4MEXA 4RNNA 2R8IA 4AP9A 3EPGA 1BVSA 4M9NA 1ZYQA 2ISPA 5T14A 2K8AA 3B0XA 5KFAA 2JRZA 3BJYA 4BGDA 2KTQA 7ICFA 4RUAA 2P35A 5KT3A 2KMDA 3C28A 7ICJA 3H8SA 2E8MA 5AI0A 3RJHA 8ICRA 4CDGA 1BPDA 4TQSA 5DB6A 3QYPA 5KT2A 1BPEA 4QIWF 5KT4A 3WK8A 3RJEA 4Y2YA 4F5PA 3RB3A
chains in the Genus database with same CATH topology
4PJ0U 5KAFU 5H2FU 1S5LU 5TISU 3WU2U 4UB8U 2AXTU 3KZIU 5E79U 5GTHU 5GTIU 3A0HU 4IL6U 5B5EU 2DUYA 5B66U 4UB6U 3A0BU 5KAIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 U;  5KAF U;  5H2F U;  1S5L U;  5TIS U;  3WU2 U;  4UB8 U;  2AXT U;  3KZI U;  5E79 U;  5GTH U;  5GTI U;  3A0H U;  4IL6 U;  5B5E U;  2DUY A;  5B66 U;  4UB6 U;  3A0B U;  5KAI U; 
#chains in the Genus database with same CATH topology
 4GFJ A;  4GXK A;  3PZP A;  3RF9 A;  3ISD A;  2KHQ A;  2AGP A;  3AQE A;  5KAF U;  4YVZ A;  2XCA A;  4DFK A;  2XIC A;  1CRX A;  2JMG A;  5ALP A;  4C8K A;  3TAR A;  5AIC A;  1NK8 A;  3CP8 A;  3C1Z A;  3PW4 A;  3PX0 A;  2ZJA A;  2BPG A;  3MR2 A;  1Q3U A;  5BOM A;  2YB1 A;  2DPJ A;  1NOM A;  3PW2 A;  4F2R A;  5AK6 A;  1X42 A;  1A76 A;  2HW3 A;  4EBC A;  4UAW A;  2G09 A;  8ICX A;  4M9L A;  4FE3 A;  2JEI A;  3IRU A;  5J2D A;  2M9N A;  1VJ5 A;  2FLP A;  4R66 A;  3OJS A;  2HSZ A;  4ECU A;  5AI8 A;  5III A;  4P0Q B;  1ECW A;  3ZDC A;  3ZDE A;  4CF3 A;  4PL2 A;  4FS2 A;  2Y9U A;  5ALH A;  3SR6 A;  3MR3 A;  1T94 A;  4OCZ A;  4RQ8 A;  3FYH A;  3D2S A;  2W8L A;  2FLL A;  8ICW A;  4O5K A;  2HBM A;  5J2B A;  1L7M A;  1S0V A;  1YZ6 A;  4I29 A;  3V7L A;  5AKK A;  4IQW A;  1MSW D;  4IQV A;  1ZD3 A;  3OJU A;  5J0W A;  4PZN A;  2ZIU A;  4DOA A;  2G08 A;  3ISC A;  1KFD A;  2O6K A;  3TKA A;  1Q46 A;  4QZE A;  3ETR A;  2PMZ F;  3L4P A;  4O3S A;  2ZXH A;  4JMU A;  1CI4 A;  2HHT A;  4PJ0 U;  4JUZ A;  3H4B A;  5KT6 A;  2W9B A;  4B6J A;  1GO3 F;  5AK4 A;  1YZ7 A;  1L3V A;  4DOB A;  2XY6 A;  3HRD D;  1NK0 A;  3PW5 A;  5HR6 A;  4IQU A;  3TAQ A;  1X9M A;  2G07 A;  4KLQ A;  2P6U A;  3DV9 A;  3AMZ A;  5KFO A;  3C21 A;  4OO1 J;  2HHS A;  1O03 A;  4FBT A;  3HW8 A;  3F2C A;  3JPO A;  2PFO A;  4DFP A;  8ICI A;  4PGX A;  2UVR A;  4KLT A;  4RU9 A;  4F92 B;  5J0O A;  1SL2 A;  5EWF A;  1IG6 A;  4KN4 A;  3AU2 A;  3N7S C;  4F5O A;  4P4P A;  3I1Y A;  2AXT U;  1OUQ A;  5ALS A;  3ZI4 A;  2KKP A;  1IXR A;  1DK3 A;  4DS5 A;  1S0O A;  4HAI A;  4M47 A;  4USA A;  2NO4 A;  1UT8 A;  2F3N A;  2LI6 A;  4YCX A;  2H5X A;  5DGB A;  5KFT A;  4E0D A;  3RJG A;  4K4I A;  3LWM A;  2ISO A;  1D8L A;  2ASJ A;  3ED5 A;  2F8K A;  4EBD A;  3JPT A;  4CNQ A;  4FZM A;  3SV3 A;  3AN1 A;  1DGJ A;  8ICG A;  5DQG A;  2V4Q A;  4JV2 A;  5ALY A;  2LM1 A;  2KJ8 A;  4U6P A;  1ZD5 A;  1JX4 A;  3PR5 B;  1DRG A;  2RP5 A;  2ZIV A;  2NRZ A;  1NJZ A;  4I2J A;  1A0P A;  4DWI A;  3HIL A;  3NS1 A;  2NV3 A;  1X66 A;  2YY6 A;  4NM1 A;  5DB7 A;  3KZI U;  2ZXI A;  2D6F C;  1Z4O A;  4QZC A;  4F50 A;  3RTV A;  1ZQB A;  5K4L A;  4RQ7 A;  4R63 A;  3RB6 A;  1RXV A;  1B4F A;  5IIL A;  1IV8 A;  2KZM A;  1U49 A;  4FO6 A;  2WB1 C;  3WK9 A;  1SV0 A;  3E58 A;  5KG5 A;  4ECW A;  4F72 A;  4KLH A;  2B6G A;  2XID A;  1S0M A;  3T5K A;  4M6W B;  3JPQ A;  5KTQ A;  5ALJ A;  1N60 A;  2FMP A;  3PY8 A;  4AYB F;  4YXJ A;  3TAP A;  5D46 A;  1WG8 A;  4Q44 A;  5HHI A;  5L1M A;  2UVV A;  5KG0 A;  2WF7 A;  2P66 A;  3ZDB A;  5CR0 A;  2W9B B;  2JGA A;  5CHG A;  3QZ7 A;  2IBK A;  1TKD A;  1IIP A;  3NRZ A;  4EX6 A;  1X2I A;  4YD1 A;  1T3N A;  4EBE A;  5IIJ A;  4TUP A;  5J8Y C;  7ICS A;  4M04 A;  5J2K A;  3L3F X;  1UPH A;  9ICI A;  2WAQ F;  1XU4 A;  1NK5 A;  3QU2 A;  3HPO A;  2HOQ A;  1QQ6 A;  3D2N A;  4CF5 A;  4XRH A;  2I6X A;  4OJO A;  1QH9 A;  4FZN A;  8ICT A;  4I2A A;  4Y2P A;  2YMP A;  4A8E A;  4YP3 A;  3H0R B;  1FFU A;  4NL9 C;  4TUQ A;  2XGP A;  2QAR A;  3G6X A;  4FZL A;  4ECX A;  1Y88 A;  5CP2 A;  1N61 A;  8ICS A;  2JH7 A;  4C0Z A;  2OYY A;  5AKH A;  3IP4 B;  4UB3 A;  5L1J A;  2KV2 A;  4KLG A;  2LYA A;  1ZOL A;  2RHF A;  5DG8 A;  2F44 A;  4I2G A;  2BQU A;  1URJ A;  4FFD A;  5TZV A;  2J6S A;  3GIJ A;  4MFF A;  1RQN A;  1L5U A;  5DBC A;  5KFH A;  1XWL A;  2I1Q A;  2A1J A;  4RQ3 A;  4YMN A;  1TVA A;  5D49 A;  1KLN A;  3PO4 A;  2IHN A;  1JAL A;  5CJ7 A;  3F2D A;  5J2A A;  3EW9 A;  1RM6 C;  1DGS A;  1NKB A;  2W9M A;  2IOF A;  3HT3 A;  4ECS A;  5IIN A;  2HDO A;  4ICA A;  5JU5 A;  4GLX A;  4ECT A;  4YMM A;  5J2F A;  2R8J A;  3QEA Z;  1ZQG A;  1NI3 A;  7ICO A;  5KFS A;  5F3X B;  2EAO A;  2GLE A;  1VDV A;  3WK5 A;  4P2H A;  2ES6 A;  2J6T A;  1O08 A;  3QUB A;  5G5G A;  2B0C A;  9ICK A;  3F5A A;  2W3R A;  1SXE A;  2R8K A;  2JEJ A;  2KHV A;  2KSO A;  5ALN A;  2OXO A;  3AU6 A;  7ICT A;  2PI5 A;  4JV0 A;  3CYM A;  4UB4 A;  3H40 A;  4CCH A;  3RAQ A;  4PHP A;  1WCL A;  2HVI A;  2ATL A;  2KIW A;  3N7P D;  2XGQ A;  1J97 A;  2IMW P;  1XSN A;  4NLG A;  4F93 B;  4QW9 A;  4C4T A;  3MBY A;  4PHE A;  5J0P A;  1K5O A;  1IM4 A;  3GV8 B;  2C22 A;  4TQR A;  2VKQ A;  1LB2 B;  2WAQ C;  2QKQ A;  4PHA A;  1KDH A;  2GOL A;  5AIB A;  1ZRN A;  4DL7 A;  3V72 A;  7ICR A;  3PV8 A;  9ICH A;  2ZIX A;  3MR5 A;  3NVW A;  1HUZ A;  2ZG6 A;  1UHU A;  2BZF A;  4QWA A;  4GC6 A;  4DFM A;  1Z1B A;  1QQ7 A;  2YX8 A;  4RT3 A;  4DLE A;  1Q3V A;  1NNL A;  4IL6 U;  4KLU A;  2H3F A;  5F9N A;  3QE9 Y;  1J2N A;  2H3Q A;  4P4O A;  3MGH A;  1SL1 A;  5GTI U;  4RPY A;  1RXW A;  2K4P A;  3LVV A;  4UAR A;  3I76 A;  2V4R A;  5ALK A;  2ODG A;  2JEF A;  4ED8 A;  1L6N A;  5J29 A;  1MQ2 A;  3RJJ A;  3M6Z A;  3WK4 A;  3TFS A;  2DF4 B;  1L3U A;  3BQ1 A;  9ICV A;  2NO5 A;  1RYR A;  4Z6D A;  3SD7 A;  5KFD A;  1D9D A;  9ICF A;  4EEL A;  3T79 A;  2RQ5 A;  3JPS A;  5AK3 A;  4RQ6 A;  4ED0 A;  4R65 A;  5AM0 A;  4UAZ A;  5ALW A;  2CRX A;  1X9X A;  1PK3 A;  4C7Y A;  3EWA A;  9ICP A;  2C2R A;  4RNO A;  1C20 A;  4BWJ A;  4Y2U A;  3MGV A;  4GXI A;  3PW0 A;  3OHB A;  4C80 A;  1SV0 C;  1ZRM A;  1KSP A;  5A0L A;  2PFP A;  1ZQI A;  1MN8 A;  1JXL A;  5KG4 A;  1NJY A;  4BDP A;  3UXP A;  2W9C B;  2CPR A;  2YMM A;  4CGZ A;  5CRX A;  1RZT A;  5DG7 A;  4DL6 A;  2Y1I A;  3ETL A;  5KFJ A;  2XC9 A;  1U48 A;  1KQQ A;  2HHV A;  1Z00 A;  4RQ4 A;  3MAB A;  2DKZ A;  4QNL A;  5C0Y A;  4DOC A;  1ZQZ A;  4QZ8 A;  3GIK A;  4YFK A;  2DQN B;  5KFW A;  3NVV A;  4RUC A;  2MA1 A;  4Y2T A;  1RPL A;  8ICP A;  7ICM A;  5ALV A;  4F71 A;  4DQQ A;  3H0L B;  3SAH A;  2W11 A;  5L1I A;  3DDH A;  1N48 A;  2WHE A;  1TV9 A;  4KIT B;  5KG6 A;  1ZQX A;  4Q43 A;  3SV4 A;  5D4B A;  1QLN A;  4XA5 A;  5EE9 A;  4F2S A;  1FO4 A;  5IIO A;  2I5H A;  2WFA A;  2XY7 A;  4IR9 A;  1N2X A;  3SMV A;  4UAS A;  1S77 D;  2W7P A;  5EE3 A;  1B22 A;  1ZQU A;  1FFV A;  9ICA A;  1SWW A;  4NM2 A;  1NKC A;  3NRW A;  1ZD4 A;  3H7I A;  2YML A;  9ICB A;  1KKX A;  3M9O B;  1V85 A;  2GO7 A;  3TAD A;  5JUM A;  3IN5 A;  2KP7 A;  4RQ1 A;  3QU9 A;  1TE2 A;  4I2E A;  3NTU A;  1MQ3 A;  4DCC A;  4K4H A;  8ICL A;  5AK5 A;  3OPX A;  1L8O A;  3AQF A;  4DQR A;  3PSF A;  2PKE A;  2G0A A;  3T5J A;  2EAP A;  2VJ5 A;  3C1Y A;  4NLB A;  4O3Q A;  4KMO B;  1S10 A;  5KFP A;  4DLG A;  3KHG A;  2NRW A;  2HBK A;  5F9L A;  3OGU A;  3ISB A;  5EWE A;  4ELU A;  3B0Y A;  5KFG A;  5KL8 B;  2BKE A;  3O0F A;  2C2E A;  4UB6 U;  2DL0 A;  4PHD A;  2BCQ A;  4UW9 A;  5DQH A;  3JPP A;  1NK9 A;  1ZQT A;  3C2K A;  3WKE A;  2F76 X;  4XUS A;  4ECQ A;  1F44 A;  8ICA A;  2DUY A;  2ZIW B;  1Z00 B;  3BQT A;  2RLT A;  2KE7 A;  3PX4 A;  2MUT A;  5AKY A;  1D9F A;  5J2I A;  3H4D A;  4DL4 A;  3NAS A;  2NRT A;  1S76 D;  4PPX A;  2EZZ A;  9ICS A;  5DLG A;  1A77 A;  3HJE A;  5ALQ A;  4MF8 A;  2ASD A;  3BS5 A;  2KNJ A;  2Y0S F;  4MFA A;  5J0Q A;  1TAM A;  1PK1 A;  3MFH A;  2AHO B;  5KT5 A;  3RJF A;  2BDP A;  3M1Y A;  1L3T A;  1NKE A;  4J9M A;  4F5N A;  1TAQ A;  4BX9 C;  4YG2 A;  4Y2V A;  1SKR A;  3H8J A;  4B9N A;  2E5S A;  3MGI A;  1HJP A;  1PK1 B;  5HMM A;  1HIW A;  4C4R A;  5JRT A;  1PZN A;  1WUD A;  2ZIV B;  2ZJ8 A;  2NYV A;  3NVY A;  4GIB A;  3T3F A;  2KG5 A;  3NUQ A;  4ZOH C;  4BXO A;  4EEY A;  3H8W A;  4NV0 A;  2K8B B;  7ICE A;  4I2H A;  4GXJ A;  5GTH U;  1D8B A;  3Q8P B;  5DLF A;  1KBU A;  1N56 A;  3BS7 A;  5AKL A;  3C23 A;  3LWL A;  2ZIW A;  4RQM A;  1COO A;  1FIQ A;  2E1F A;  1BNO A;  3FM9 A;  3C29 A;  5CEH A;  3SZ2 A;  2HMX A;  2BGW A;  2Q4T A;  5DKW A;  1ZXI A;  1BPB A;  4ED3 A;  4QZ9 A;  2JZB A;  2E8P A;  4KMU A;  1QTM A;  1SWV A;  4BUG A;  4JV1 A;  4MFC A;  4LVS A;  2GH1 A;  2MU2 A;  2RRD A;  1ZQS A;  1BGX T;  1U4B A;  3OSP A;  2E8O A;  5AM1 A;  3EYZ A;  1JIH A;  3HWT A;  5DDY A;  3OTQ A;  1DK2 A;  2KJ9 A;  2FPM A;  4UB5 A;  4Z6E A;  2OEH A;  2EAN A;  2VA8 A;  1PVR A;  2K60 A;  1U45 A;  3KOO A;  4UAY A;  2D3D A;  5HNK A;  4F8R A;  5ALD A;  5ALF A;  4R8U B;  4ECZ A;  4US9 A;  2ZUD A;  2W7O A;  4J9S A;  2F8L A;  1ZQE A;  5AM5 A;  2FPL A;  2HHU A;  3N7R C;  3V6K A;  1X6J A;  1TK8 A;  1KRP A;  1LVH A;  1J2M A;  2Y9T A;  5ALZ A;  1ARO P;  4PH5 A;  1SGG A;  4YXM A;  1KN5 A;  5AKJ A;  5KFQ A;  1SZP A;  4J9N A;  9ICR A;  3ALR A;  3BDP A;  3RAX A;  2W03 A;  3T5L A;  2A1J B;  4QZG A;  3TAN A;  4ED6 A;  3ONN A;  4YD2 A;  2QAR B;  2E3T A;  8ICQ A;  2MAX A;  2OH2 A;  1XO0 A;  2EZX A;  4M9G A;  3F53 A;  3LK9 A;  4KLS A;  4O3M A;  4R64 A;  4ACO A;  2BQ3 A;  1N63 A;  4NWI A;  3M6K A;  5B5E U;  4F4K A;  5ALL A;  1QCK A;  2W55 A;  1ZQH A;  4M9J A;  4QZH A;  4I2F A;  5TIS U;  4DL3 A;  7ICN A;  3C5F A;  2KJ5 A;  4QZI A;  2LYH A;  4B9S A;  3I28 A;  4P0P B;  5AKZ A;  4QZA A;  3CRX A;  1CEZ A;  5J2E A;  2JEG A;  4FBU A;  1SKS A;  4QW8 A;  2GWS A;  2ZTD A;  5KFB A;  2W9C A;  2YB4 A;  5KG7 A;  4K4G A;  3FDS A;  5J0X A;  3M7D A;  2IA6 A;  3QEB Z;  5AM4 A;  3UM9 A;  1X9S A;  2BCS A;  4ZH4 A;  4EX7 A;  9ICX A;  4C4S A;  4DQI A;  2HHW A;  5J2H A;  2NRX A;  2LMR A;  4JWN A;  4DSE A;  4XQ8 A;  3ZDD A;  4GC7 A;  3UMG A;  3ICX A;  4Y2X A;  3QNM A;  5J2J A;  2E1E A;  2A3V A;  4Z6F A;  3Q8Q B;  2F1J A;  5KFN A;  4YR0 A;  2ZUC A;  1C7Y A;  3RR8 A;  4MHV A;  2F2A B;  2HVH A;  3MDA A;  5AI5 A;  3UQ2 A;  3GV5 B;  4B9T A;  3KFU F;  1S97 A;  2RDJ A;  1WCN A;  4OJP A;  4WJ3 B;  4EYH B;  3PSP A;  4QWB A;  2FJ6 A;  5ALG A;  4Z6C A;  4EEN A;  1SL0 A;  5AKI A;  3SAG A;  3Q8R B;  2KK0 A;  2WF5 A;  2ZIX B;  1SV4 A;  1L7N A;  5KFC A;  4ED1 A;  3UMC A;  2HOI A;  5AM2 A;  1Q8K A;  2KIC A;  4UAU A;  1T8E A;  2KKV A;  2VA2 A;  5AI4 A;  3BQ2 A;  5J0Y A;  1HEK A;  4C8N A;  4C8L A;  3LVW A;  3M9M B;  4O9M A;  3WU2 U;  1L8L A;  1RG6 A;  5J0T A;  4YMO A;  1L7P A;  3D2Q A;  1XC9 A;  8ICZ A;  3B9J A;  4C7Z A;  5KNI A;  2D8C A;  2AQ0 A;  4ED7 A;  2A1A A;  1KFT A;  3GFK B;  4UQG A;  3Q8M A;  3ZD8 A;  3K4G A;  2AH5 A;  2P6R A;  4RZR A;  4J9P A;  3WK7 A;  3KTQ A;  2KSO B;  9ICM A;  2F77 X;  4KX3 A;  3QU5 A;  5J0S A;  5AM3 A;  4J9O A;  4B9V A;  3NGD A;  4M2Y A;  1PVP A;  1ZJN A;  2VJ4 A;  4O3N A;  2N1R A;  5KAI U;  1ZQJ A;  2HHQ A;  1NZP A;  2Z7J A;  3RBE A;  3THV A;  2HI0 A;  3OSN A;  3ORY A;  2K4H A;  1UA1 A;  1XNS A;  5DG9 A;  5B66 U;  2MUT B;  3K1R B;  4RNM A;  2KZ3 A;  4TUS A;  2BQR A;  1QQ5 A;  2VAN A;  2V9W A;  3MDC A;  4BWM A;  2KD1 A;  4QWD A;  5BPC A;  8ICV A;  5AKX A;  4FS1 A;  1ZQY A;  3QX7 A;  2ESE A;  4MF2 A;  8ICM A;  2DFL A;  5KFK A;  5DB8 A;  1K1S A;  2UVU A;  2LM4 A;  2BPF A;  3J81 j;  2JXJ A;  4YR3 A;  8ICN A;  4O5C A;  2HOF A;  3AUO A;  2KVC A;  3UXO A;  3PX6 A;  2IOH A;  1KFS A;  4RQ2 A;  1D8Y A;  5E79 U;  4BJQ A;  4G3I A;  3UQ0 A;  2JH1 A;  2JHD A;  2WF9 A;  4I2D A;  3K1Z A;  7ICU A;  2F1I A;  4UB2 A;  4EZ6 A;  1SXD A;  3QUT A;  3V7K A;  4NJ8 A;  2BCU A;  1JI7 A;  1ZQ1 C;  1L7O A;  4CE6 A;  5AHX A;  1S9F A;  2VA3 A;  2FI1 A;  2PI4 A;  1N5W A;  2LBO A;  3WK6 A;  3QZ8 A;  4JWM A;  1XSL A;  9ICU A;  3MC1 A;  2YN4 A;  2FDR A;  3RJK A;  2K4E A;  3PO5 A;  1LKY B;  4RQ0 A;  3SEI A;  4ED2 A;  4KLI A;  4KLD A;  4NLZ A;  1MC8 A;  2W8K A;  2W9A A;  2B21 A;  1NK7 A;  5AKG A;  9ICT A;  4I2B A;  1PUZ A;  2BPC A;  2BCR A;  5EE1 A;  3M8R A;  3AM9 A;  2K4I A;  2WTF A;  1UA0 A;  2AGQ A;  2EQY A;  3KKA A;  3VCB A;  3EZ5 A;  2A19 A;  2JV3 A;  2IOF K;  2XO7 A;  2AGO A;  1QSL A;  4RPZ A;  3E0F A;  4DFJ A;  4ELV A;  4ELT A;  3GIL A;  1DXS A;  4IRD A;  2NRV A;  5J0R A;  1ZQO A;  2WF8 A;  3HKZ F;  5CB1 A;  2LKY A;  4RPX A;  3SQI A;  2EH9 A;  3RB0 A;  2HBL A;  4BXO B;  4O0I A;  4KLJ A;  5AIA A;  2EDU A;  2YTU A;  4O3O A;  4DSF A;  2K89 A;  3RH6 A;  1WYG A;  3A0B U;  3BQ7 A;  3PST A;  2H3V A;  4IS7 A;  3PR4 A;  1X6I A;  4US8 A;  1ZQN A;  5L1K A;  1ZQK A;  8ICC A;  4LJX A;  3T5H A;  2M0N A;  3KD3 A;  5DBB A;  3DEE A;  3CW2 C;  1QSY A;  1BPZ A;  1V9P A;  1PVQ A;  1VLB A;  2BHN A;  9ICE A;  3VC8 A;  3PVX A;  3KHH A;  2W54 A;  4J9K A;  4KX5 A;  1BPY A;  4NY8 A;  1JRP A;  2IHM A;  3G6Y A;  3C5G A;  4O3R A;  2AQ4 A;  4UAV A;  4DF8 A;  2XCP A;  1U47 A;  2FE9 A;  4Y2J A;  3KBB A;  5KFY A;  1Z3E B;  5J2C A;  3GII A;  1M6Y A;  3SAF A;  1LKY A;  3M8S A;  2G5I B;  4F4Y A;  2VIX A;  5KG3 A;  2KOB A;  1F5S A;  2AU0 A;  5KFE A;  4QWE A;  3GZF A;  4IC9 A;  5KG1 A;  1XS9 D;  4IQT A;  4CF4 A;  5HHH A;  5J0U A;  3HX0 A;  1K1Q A;  9ICO A;  2K8C B;  2H3Z A;  1ZQW A;  1P7D A;  4NLN A;  5HP4 A;  2R18 A;  3RH4 A;  4Q8F A;  2EAM A;  4JB3 A;  4J9L A;  3OHA A;  3MFI A;  5AKE A;  5DB9 A;  4RQ5 A;  5KFV A;  2W43 A;  7ICH A;  4F4Z A;  9ICL A;  2C2D A;  2W3S A;  1ZQV A;  1TK0 A;  4QWC A;  4ECV A;  3UMB A;  1ZQP A;  2HBJ A;  4HYK A;  1MA7 A;  3RH5 A;  1JMS A;  3V6J A;  2LHT A;  2DKX A;  2KEY A;  3U26 A;  3F2B A;  1T7P A;  3KZX A;  1B43 A;  3HKZ C;  2G5H B;  2UVW A;  4NLK A;  3FAH A;  1S8O A;  5ALU A;  1NK4 A;  2MRL A;  2MSN A;  5ALX A;  5ALE A;  4DL2 A;  5DGA A;  7ICG A;  2OM6 A;  2EZY A;  2OCE A;  4I2I A;  1CUK A;  1KL9 A;  4R8U A;  5KFF A;  2I9G A;  1A6S A;  1ZQL A;  3JPR A;  5H2F U;  5KT7 A;  2XVT A;  3GQC A;  3PSI A;  1JUD A;  3N97 B;  4B9U A;  3A0H U;  3QUQ A;  1OXJ A;  5BOL A;  3C2M A;  1BPX A;  2PXI A;  3GU3 A;  1KW4 A;  1YT3 A;  3HP6 A;  8ICY A;  4I27 A;  8ICK A;  2H3I A;  1Z4N A;  4MEY A;  4NLC A;  8ICF A;  5CWR A;  1RYS A;  4OJ6 A;  3WKA A;  4P4M A;  1ZQF A;  2Q0Z X;  3RRG A;  2OHF A;  4DQS A;  1H38 A;  1JXE A;  4KLO A;  4QIW C;  4YQW A;  4DSJ A;  4KLM A;  8ICH A;  4DF4 A;  2F1H A;  4F5Q A;  4M6W A;  8ICB A;  8ICO A;  3C2L A;  5DQI A;  2W04 A;  2KN7 A;  3LDA A;  3BQ0 A;  4EYI B;  1DOQ A;  1B0X A;  1N5X A;  2DGZ A;  4CRX A;  1ED1 A;  2ALZ A;  4PGY A;  3L5K A;  1ZQQ A;  3WKD A;  4I2C A;  4LZG A;  1COK A;  2LPE A;  3S6J A;  4J03 A;  3RR7 A;  3IM1 A;  7ICQ A;  4AYB C;  1UT5 A;  3MR6 A;  2E8N A;  4LZD A;  2DPI A;  4F4W A;  4KN7 A;  1UCV A;  3SI8 A;  4F5R A;  4Y2R A;  1V97 A;  2J6U A;  5DBA A;  5J2G A;  4ECR A;  2BDU A;  5ALT A;  4YN4 A;  8ICJ A;  4M0A A;  3Q8S B;  2XY5 A;  2WB1 F;  5KFM A;  4OJL A;  2FLN A;  4KLL A;  1ZQA A;  3ZD9 A;  7ICK A;  5L1L A;  2FPK A;  3TQ1 A;  2HCF A;  2ASL A;  4YR2 A;  1LV5 A;  5HML A;  3N28 A;  3SEN A;  2BCV A;  1QSS A;  9ICG A;  4UB8 U;  2QLT A;  4X5V A;  1F0M A;  1N62 A;  3IDW A;  2QB0 B;  3CNH A;  1WWU A;  2JR5 A;  1Z19 A;  4J9R A;  2KIV A;  2WF6 A;  3GV7 B;  1NJW A;  1S5L U;  3D6J A;  3IG8 A;  3TFR A;  3BS5 B;  4O3P A;  3TAD C;  1RYU A;  4DSK A;  1TFR A;  4O5E A;  1ZQC A;  2YQE A;  1NZB A;  2QB0 A;  4G9B A;  2OWO A;  5G5H A;  2G06 A;  4OD0 A;  4DQP A;  1ZQM A;  1FEZ A;  2CXY A;  4M9H A;  9ICJ A;  5AI9 A;  4ECY A;  1EXN A;  5EE0 A;  7ICP A;  2LYB A;  3GDX A;  3UPQ A;  4UAT A;  4TUR A;  2C28 A;  4OJ5 A;  5KFR A;  1RQL A;  4QJF B;  2XI9 A;  5ALR A;  4DS4 A;  2Y0S C;  4Y2Q A;  4I28 A;  3SYZ A;  5ALI A;  3TI0 A;  3ZDA A;  3PML A;  4EEK A;  1SKW A;  4F3O A;  1S0N A;  1X40 A;  3WKC A;  3N4M B;  4DSL A;  7ICI A;  4RT2 A;  2QB1 A;  4P0P A;  4Q8E A;  9ICC A;  3PW7 A;  2ZTE A;  3IG5 A;  1NK6 A;  1X9W A;  1ZQR A;  5ALO A;  1SB3 C;  5EWG A;  3TAC B;  2Y1J A;  5IIM A;  1KTQ A;  5KL1 B;  3F5E A;  5HR7 A;  5CA7 A;  1SIJ A;  5KFL A;  4EZ9 A;  1RDF A;  3K75 D;  4Q45 A;  4Y2S A;  5C5J A;  2FMS A;  4KLF A;  2AJQ A;  1T4G A;  1SZH A;  2DWQ A;  3UXN A;  1BNP A;  4PZO A;  2ZIU B;  4F91 B;  4DO9 A;  4JK1 A;  3EUB 2;  1T3Q A;  3Q8K A;  3KKA C;  4IRC A;  5KFU A;  4U7C A;  4PGQ A;  3PMN A;  9ICQ A;  4PL1 A;  4IRK A;  3BZC A;  1ZET A;  4UBB A;  5ALM A;  1XO1 A;  3RJI A;  4B9M A;  8ICU A;  3Q8L A;  4DEZ A;  3IHQ B;  1XSP A;  3JPN A;  2ZUB A;  2FMQ A;  3AL0 B;  2KVS A;  3KHL A;  3WKB A;  1JRO A;  2RDI A;  3LYS A;  3H8M A;  3RFA A;  1NJX A;  3E2E A;  3IV6 A;  1Z1V A;  5EOZ A;  7ICL A;  4IR1 A;  3R9K A;  4UB1 A;  2KFN A;  2ZTC A;  3QXG A;  3FC4 A;  3V7J A;  5AI6 A;  9ICW A;  4F4X A;  2KFZ A;  2BR0 A;  3KHR A;  5KG2 A;  4QZF A;  3RB4 A;  7ICV A;  2YMQ A;  1UQV A;  2PFQ A;  1ZQD A;  2JZB B;  1V38 A;  2L5Y A;  1ZJM A;  4P0Q A;  4NXZ A;  3M9N B;  1JN3 A;  1ZD2 P;  3QUC A;  5L9X A;  3RBD A;  2HHX A;  4KLE A;  4DFD A;  4C8O A;  3H0M B;  8ICE A;  1TAU A;  4QZB A;  1AQ6 A;  4C8M A;  2KZZ A;  9ICN A;  5KFZ A;  3V6H A;  4B9L A;  3QU4 A;  2R8H A;  2CN1 A;  3PNC A;  4NL9 A;  2PMZ C;  3EPI A;  2PFN A;  4KTQ A;  4UBC A;  1WWV A;  4J9Q A;  4RQN A;  5KFI A;  5FP0 A;  2ZJ5 A;  4DL5 A;  3AEV A;  4QZD A;  1U9L A;  3RRH A;  5KFX A;  5DDM A;  1L3S A;  5JTI A;  1OW5 A;  2R8G A;  3BZK A;  1KEJ A;  1TK5 A;  5IIK A;  2DBY A;  4DSI A;  5J8Y A;  3G6V A;  3QU7 A;  3NVZ A;  1HUO A;  3GIM A;  4MEX A;  4RNN A;  2R8I A;  4AP9 A;  3EPG A;  1BVS A;  4M9N A;  1ZYQ A;  2ISP A;  5T14 A;  2K8A A;  3B0X A;  5KFA A;  2JRZ A;  3BJY A;  4BGD A;  2KTQ A;  7ICF A;  4RUA A;  2P35 A;  5KT3 A;  2KMD A;  3C28 A;  7ICJ A;  3H8S A;  2E8M A;  5AI0 A;  3RJH A;  8ICR A;  4CDG A;  1BPD A;  4TQS A;  5DB6 A;  3QYP A;  5KT2 A;  1BPE A;  4QIW F;  5KT4 A;  3WK8 A;  3RJE A;  4Y2Y A;  4F5P A;  3RB3 A; 
#chains in the Genus database with same CATH homology
 4PJ0 U;  5KAF U;  5H2F U;  1S5L U;  5TIS U;  3WU2 U;  4UB8 U;  2AXT U;  3KZI U;  5E79 U;  5GTH U;  5GTI U;  3A0H U;  4IL6 U;  5B5E U;  2DUY A;  5B66 U;  4UB6 U;  3A0B U;  5KAI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...