2KICA

N-nafy. n-terminal domain of nafy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MVTPVNMSRETALRIALAARALPGTTVGQLLEILHQRIEGPLTEESLQGVSVTDLKIGLAGSEEDVDMLDTPMSALKDAVRILWGEAEVDSLPQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogenase gamma subunit
publication title Biological activity and solution structure of the apo-dinitrogenase binding domain of NafY
rcsb
source organism Azotobacter vinelandii
molecule tags Protein binding,metal transport
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16844 DIMCO_N Dinitrogenase iron-molybdenum cofactor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.590 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kicA00
2KICA
chains in the Genus database with same CATH superfamily
1TV9A 2CPRA 4YR2A 2AGQA 4RQ3A 5IIOA 2VA8A 2ODGA 1KW4A 1DK3A 9ICWA 4F71A 5C0YA 4JWMA 3BZKA 2OM6A 5KFPA 2K4HA 1KRPA 2KN7A 3T5KA 2KFNA 3F2CA 3CW2C 4P4OA 1SXDA 1X6IA 2JXJA 2B0CA 3SI8A 1ZQCA 5ALIA 1XO0A 2KJ9A 4DQQA 1OW5A 3FM9A 2C2RA 8ICUA 1Z4NA 3NGDA 2XC9A 3ZDEA 5AI9A 5KG1A 4J9NA 1MC8A 3SZ2A 3MR5A 4RPZA 4NLGA 3CYMA 2AH5A 4MF8A 5DLGA 2KKVA 2DKXA 2HOQA 1ED1A 2P66A 3RFAA 1RPLA 4CGZA 5J2DA 1N2XA 3L4PA 4ECWA 5DGBA 5AM5A 5ALUA 4EBEA 4DS5A 3C1YA 4OJLA 2FLPA 2EAPA 3HJEA 2QKQA 4M6WA 4AP9A 2XVTA 4NM1A 3C2MA 3NVWA 3F5EA 3WKCA 5G5GA 4FS1A 5L1KA 4UQGA 1O08A 3ETLA 1BGXT 5J2JA 3SR6A 5IILA 5F9NA 1ZQMA 3AEVA 1X9MA 4QZFA 4DSIA 4K4GA 8ICEA 2YX8A 2XGPA 2W9AA 5AKXA 3GFKB 4QW8A 2I9GA 2A1JA 4GFJA 3RTVA 2YMMA 2HOIA 4AYBF 4Y2YA 5KG7A 2W3RA 1S77D 4DO9A 3AMZA 1ZQNA 1RXWA 5ALEA 2KVSA 1U48A 5J0YA 4ICAA 3ZD9A 5KFUA 1CRXA 5J0TA 4OJ6A 4NY8A 5HHHA 4G3IA 5HR7A 3KHGA 1DGSA 3RB4A 3HILA 2F8KA 1TKDA 2YMPA 5KFNA 2EANA 1ZYQA 3QEBZ 3BS5A 4DFDA 4M9JA 4J9MA 2JMGA 3H8WA 4C4RA 5AK4A 2UVWA 3ZD8A 2BCUA 2HVHA 3T5LA 1CEZA 5ALYA 4UB6U 1NK5A 3RB0A 2K8CB 4F2SA 1TAMA 4UBCA 2N1RA 3JPOA 4GXJA 4M04A 2BCQA 1RG6A 5DG9A 4IRCA 3LWMA 1BPBA 5B5EU 4EZ9A 7ICOA 3IG8A 2KNJA 3GV7B 2JHDA 4I2DA 1ZQYA 4CF4A 2XGQA 4ECRA 5HR6A 3EWAA 3MDCA 5AKZA 9ICMA 4YXJA 2LKYA 3THVA 1ZRNA 1PUZA 1SKSA 1B0XA 1RYRA 2E8PA 4TURA 2HBKA 7ICFA 8ICQA 4QNLA 1K1SA 4DSJA 1ZQTA 4I29A 3T5JA 5KT4A 2IMWP 2YMLA 3I1YA 3LWLA 3UMCA 2PFNA 5ALOA 4QWCA 4NM2A 3AQFA 9ICEA 3EW9A 9ICAA 1JRPA 5JU5A 2EAMA 2OXOA 5IIJA 4UAVA 2EAOA 2CN1A 4RT2A 1ZQJA 2JEFA 4O3NA 1X6JA 1ZQBA 3ZDAA 4Z6EA 4NLZA 3BQTA 1XNSA 5AM3A 9ICQA 1JMSA 2W3SA 3OTQA 4YP3A 1J2NA 4Y2UA 3ICXA 1RXVA 4I2EA 1PVRA 3SQIA 5KT5A 4EEKA 2B6GA 4QWDA 1S5LU 1UPHA 5DB6A 3MBYA 1X9XA 5KFZA 4LVSA 3UQ0A 5J2EA 3GDXA 3GQCA 9ICXA 1L7OA 4O3QA 1GO3F 4ELVA 3N28A 5CB1A 3RH4A 5KFGA 3WKBA 5GTIU 2DKZA 5KFCA 2FI1A 4BX9C 1D8LA 5E79U 4F4KA 1L3VA 7ICKA 2F76X 3TAPA 4MFAA 4FBTA 5AKYA 2KMDA 5KAIU 2OWOA 4C8MA 4DSEA 5KAFU 1SV4A 2W9CA 2UVVA 4EEYA 3OJSA 4B9NA 5A0LA 5KG3A 5GTHU 2EZZA 2FMQA 7ICNA 1V9PA 3HPOA 4O5CA 8ICSA 2JV3A 1KFTA 5DDMA 2ISOA 2V9WA 3MDAA 5AKGA 2Y9UA 2K8BB 2ISPA 2F1JA 2XO7A 4QZ9A 4XQ8A 3PMNA 9ICPA 1ZQZA 2IOFK 4EYIB 2HHTA 7ICHA 1J2MA 2NO4A 1U47A 1TE2A 4YMMA 3G6VA 3V7KA 2BPFA 8ICZA 2KZZA 2IA6A 4FO6A 1ZQEA 3IM1A 2G06A 1XC9A 3OHBA 3QZ8A 4DQIA 3RJFA 4NLNA 4B9TA 3ALRA 1Z3EB 3BZCA 5AI8A 3RR7A 3PR4A 5AKEA 1ZQKA 2BDPA 5AM0A 4RQ0A 4YQWA 4GXKA 1SIJA 1S8OA 2W55A 4UAYA 2DUYA 9ICIA 1ZXIA 4O3SA 1L6NA 1SV0C 5DQGA 4RU9A 4KLJA 3E0FA 3V7LA 5KFRA 2HHXA 1ZQWA 1L7NA 3PW0A 4O3PA 5KFXA 1BPYA 1LVHA 1ZQ1C 5DB8A 4QZAA 3CRXA 8ICIA 4UB1A 2ZIVB 4NLBA 3C23A 4PGXA 3Q8PB 2W43A 2E3TA 3PO4A 4EBCA 3NS1A 4US9A 2JEGA 4O5KA 3UXOA 3C5GA 3RBDA 2F1IA 4C0ZA 4ED1A 2ZUCA 3MR3A 1CI4A 1S76D 2OYYA 3BQ1A 5T14A 1ZD5A 2ZIUB 4MFFA 4UAUA 9ICNA 7ICSA 2KKPA 5AI0A 4QWBA 3KZXA 3JPRA 4UB3A 2LYHA 2YN4A 1X40A 5DBCA 1QH9A 1UCVA 3RJEA 2KSOB 2KVCA 9ICFA 8ICHA 4JK1A 4J9RA 3QEAZ 2KFZA 5KFJA 2RQ5A 4DWIA 7ICEA 3R9KA 4QZ8A 4IQVA 2HBMA 1JALA 8ICTA 3JPNA 3SENA 5AKJA 4JMUA 1D9FA 9ICJA 2GLEA 2BQUA 4NLKA 3TFRA 5CRXA 1MN8A 2H3ZA 2KG5A 2HHQA 2BCRA 2F8LA 5AK3A 1ZQOA 1ZQDA 3ISBA 4YR3A 3PW2A 1HUZA 3PO5A 2W9BA 1Z1VA 3RJJA 4XA5A 1A6SA 1WCNA 4HYKA 4OJ5A 5EOZA 4CRXA 2IOFA 3UMGA 3B9JA 1LV5A 3GIMA 5J8YC 3BQ0A 4QW9A 2PMZC 4ECSA 5J0RA 2JH1A 3Q8KA 1U9LA 3LYSA 3EUB2 1HUOA 4WJ3B 3LVVA 7ICPA 1NJWA 4DLGA 3KFUF 3HT3A 2KZMA 3RB6A 3IP4B 2PI5A 1PK3A 4YXMA 1KFSA 4Q8EA 4J9QA 1H38A 1TVAA 3EYZA 5TISU 5KFQA 4NWIA 2WB1F 4OJOA 1S97A 1PK1A 4NXZA 4USAA 1QSSA 1SWWA 3S6JA 3RR8A 4MFCA 2R18A 2AGPA 2BQ3A 2PFPA 4ECYA 4Z6DA 9ICGA 3B0YA 4QZCA 1ZQGA 5EE9A 2W04A 3UPQA 3H0RB 5AKHA 3FC4A 1SKRA 3PW7A 2LYBA 4FS2A 3C2KA 1ZETA 1QQ5A 5EE1A 3C5FA 4B9SA 1ZQUA 5AKIA 4M2YA 2J6SA 1LKYB 2W03A 4UARA 5ALQA 3QU2A 4F4YA 2P6RA 4X5VA 5CWRA 3C29A 4LJXA 4CCHA 3PZPA 5KL8B 5CP2A 5ALVA 3M1YA 5CHGA 1WCLA 3WK7A 5KFHA 3IV6A 4DFMA 4I2BA 3IHQB 3FYHA 2F77X 3SV4A 4R65A 3MFIA 1YZ7A 1PVQA 4C4TA 3PX4A 1U4BA 3HRDD 1S0MA 8ICYA 5AKLA 3PX6A 3QX7A 2Z7JA 5KTQA 1FFVA 5J2KA 2MU2A 2QB0A 4IRDA 1BNOA 4ZH4A 1SB3C 4I28A 4KN7A 3TQ1A 5KT6A 2GO7A 5KG4A 3K75D 4DQPA 1D8BA 3TI0A 4PPXA 5AK5A 4KLUA 3ED5A 3ORYA 2UVUA 2GOLA 4DOCA 5KG2A 1S0VA 4G9BA 4GIBA 3OPXA 2XI9A 4DSKA 4DL5A 2D8CA 2NV3A 2AU0A 2OEHA 1S0OA 3M8RA 2FLNA 4UB8U 2KIWA 3A0BU 4I2CA 4FE3A 2HHUA 4YN4A 4JV0A 1UHUA 5HP4A 3GZFA 5F9LA 9ICKA 4DF4A 1LB2B 1ZD2P 1NK9A 4J9PA 1XU4A 4BXOB 4YCXA 3VC8A 4P0PA 4RQ2A 1YZ6A 1NOMA 1SL2A 2KJ8A 4QIWC 1NK7A 1N5XA 5DB9A 2D6FC 2LM4A 4O5EA 2DF4B 3N97B 2K89A 2VA2A 2C2DA 4C7ZA 2NYVA 3U26A 2ZJ5A 4DL7A 2DFLA 9ICHA 9ICOA 3ZI4A 3AU2A 5DBBA 3T3FA 3RJGA 1KSPA 5CR0A 3J81j 3KHHA 2XCAA 1UA1A 5IIMA 7ICVA 7ICIA 3H8MA 2WB1C 3AL0B 4UB2A 1Z4OA 7ICMA 2JEIA 4IL6U 2AGOA 4B9VA 3QUBA 3PSFA 2E8MA 3PNCA 1DGJA 2NRXA 1JN3A 3E2EA 4QWEA 5J2GA 4UW9A 1QTMA 8ICLA 2JEJA 2ZTDA 2I5HA 5J2FA 2BR0A 3NVZA 2XIDA 2EZYA 4UAZA 4PH5A 3Q8LA 5AM4A 4XUSA 3QZ7A 2NO5A 7ICQA 4IR1A 2CRXA 2ZJ8A 4F5QA 1L8LA 5KFMA 1XSLA 3RJIA 1IV8A 5ALDA 3BDPA 4ELTA 4IQTA 1AQ6A 3Q8MA 3HKZF 5L1LA 3SAHA 9ICVA 2KV2A 4I2GA 4J9SA 4PGYA 5D49A 3D2SA 2E8OA 3UQ2A 1ZQLA 5J0PA 4Y2QA 1RQNA 2O6KA 4DCCA 2P6UA 4KLSA 4KMOB 2ZIVA 3NUQA 1A0PA 5HMMA 1T94A 4PJ0U 2G0AA 5D4BA 2R8KA 2FPMA 3LK9A 2WAQF 3L3FX 2BPCA 2EDUA 2WHEA 3DV9A 3VCBA 2BGWA 3Q8QB 1N5WA 2K60A 3PX0A 2M9NA 1X66A 3T5HA 2R8JA 1SZHA 5AI6A 4IQUA 2VJ4A 2ZIUA 4CDGA 2ALZA 2DPIA 2HCFA 5AIBA 3SV3A 1F5SA 3NVYA 2PI4A 2NRVA 2HSZA 1QSLA 2AHOB 4M9NA 1MA7A 2RDIA 5BOLA 2H3QA 2HVIA 5J2HA 1XSPA 3GIIA 3I28A 4PHEA 2KSOA 1ZQVA 9ICBA 1D8YA 3PW5A 1Z1BA 1NKBA 4QZHA 4RQ5A 8ICAA 4FZLA 1U49A 1O03A 1T8EA 3H0LB 5IIKA 4FZNA 3AUOA 1B4FA 3DDHA 3RRHA 3PSIA 3WK6A 3V6KA 3QXGA 3TARA 4RQ8A 4P4MA 2FMSA 5ALTA 4Y2XA 4AYBC 4PHDA 1MSWD 2YTUA 2E1EA 4C80A 1KN5A 2ZTEA 2W8LA 3RH6A 4F5NA 3TANA 2FJ6A 3TADA 3ISDA 4R8UA 1DXSA 4I2IA 4Q45A 2AXTU 2HHVA 2K4PA 2ASJA 2W8KA 2QB1A 1IM4A 3MR6A 4DSLA 1A76A 4RPXA 1QQ7A 1RQLA 2CXYA 1RYUA 1KL9A 5JTIA 2OCEA 4GC7A 1BPEA 9ICUA 3PSPA 2MSNA 3BS5B 4MEYA 1NKEA 4ED6A 2IBKA 1V97A 3JPQA 5AHXA 3KBBA 2A3VA 2WFAA 9ICCA 3LVWA 3QU5A 3MGHA 4Y2RA 4IQWA 2DBYA 4BGDA 4O9MA 2LM1A 4I2JA 1QSYA 4YG2A 1SXEA 4RQ1A 3M8SA 1SGGA 3KZIU 2WF9A 3KD3A 5DKWA 5ALKA 1JROA 3QE9Y 2ESEA 8ICFA 5L9XA 4JUZA 3WK5A 4P2HA 5FP0A 1AROP 1JXLA 1BPDA 1N63A 4QZGA 5IIIA 1SWVA 2LHTA 2ZTCA 2E8NA 3PSTA 2ES6A 1L3TA 1KFDA 3WK8A 3H4BA 1ZJMA 3RBEA 4K4HA 3BS7A 1TFRA 3AU6A 5DQHA 4FBUA 1QCKA 4YVZA 4ED2A 4RPYA 1TAUA 1K1QA 4B9LA 4O0IA 2Y1JA 5KG6A 2PXIA 9ICSA 4P4PA 2DPJA 3WKAA 4ED3A 5J0XA 2KE7A 5J2AA 2YB1A 4M9GA 3CP8A 4E0DA 4RNOA 5L1JA 2DWQA 3ZDDA 2RRDA 5JUMA 1EXNA 1WYGA 5DG7A 1Q8KA 3KHRA 4MHVA 2EH9A 4C8OA 1ZJNA 3PW4A 3NASA 4KX3A 2EQYA 2H3IA 1L3SA 3V6HA 2W54A 1IIPA 4RQ4A 5ALMA 4BWJA 5J2CA 4M0AA 2LYAA 2XCPA 4KITB 4RT3A 3NRZA 3WKDA 1COKA 1JUDA 4I2FA 1OXJA 4DL6A 1ZOLA 1DOQA 4F92B 1N60A 2PKEA 4P0QB 2JRZA 2NRTA 4GC6A 1NK6A 4O3RA 2XICA 2MUTB 4Z6FA 2BHNA 3ETRA 3O0FA 2ZJAA 3SAFA 8ICCA 2YMQA 3GV5B 2G09A 2W9MA 2VIXA 3LDAA 8ICPA 4IS7A 4YFKA 4DEZA 1U45A 3UXNA 3TFSA 3IDWA 5DB7A 4Y2PA 8ICRA 1RM6C 4DQSA 2BDUA 1P7DA 2I6XA 3KKAA 2HHSA 2V4QA 4TUQA 1L3UA 1KLNA 2LBOA 1CUKA 5KFSA 4F72A 2ATLA 4FZMA 5HMLA 4DFJA 2I1QA 4F93B 4BXOA 2XY5A 7ICJA 2WF8A 4ECXA 3UMBA 1T3NA 3H8SA 4KLHA 2JGAA 2VANA 2KD1A 3M7DA 5J2IA 5ALFA 2IHNA 5DDYA 1B22A 4F91B 4ECTA 4C7YA 4ED7A 4J9LA 2AQ0A 2KTQA 5ALXA 2KEYA 2IHMA 2JH7A 4ACOA 2P35A 1F0MA 4CNQA 2HOFA 2E5SA 4I27A 2KHVA 1PVPA 2LMRA 1BPZA 3MGIA 5DG8A 3PV8A 1FO4A 3H0MB 1X42A 4QZEA 4F5PA 4KLFA 4KX5A 3OJUA 1SL1A 4DF8A 1ZD3A 4J9OA 2OH2A 1JX4A 4QZBA 4M9LA 5DQIA 5AM1A 4I2HA 4RQ6A 4LZDA 4JV2A 1K5OA 2ZIXB 4US8A 2RLTA 5KL1B 5KFKA 1OUQA 5D46A 1BNPA 3WK4A 4NL9A 2J6TA 4BUGA 2G5IB 1ZQSA 4C8LA 2BZFA 8ICGA 4EENA 3JPSA 4CF3A 4EX7A 2MRLA 2BCVA 3WKEA 1HEKA 5AK6A 2PFQA 2K4EA 4BDPA 3G6YA 1HIWA 2ZIWB 7ICGA 5ALHA 2L5YA 4EYHB 4C8NA 1N61A 1MQ3A 3A0HU 3MC1A 2F3NA 4ELUA 9ICLA 3F53A 2ZUDA 2FDRA 8ICBA 3M9MB 3D2QA 4DL4A 1VDVA 2JZBB 4XRHA 4C8KA 1ZD4A 5KG0A 4U6PA 1L7PA 4DSFA 5KFFA 1D9DA 4CE6A 2FMPA 4NLCA 4PHAA 3RRGA 1NK0A 3SAGA 5ALSA 5AICA 9ICRA 1N56A 2A1AA 2QARB 1IXRA 1V85A 2LPEA 4R66A 1HJPA 2W9BB 9ICTA 2KOBA 2BCSA 1C20A 4J9KA 2W7PA 5KFVA 3RF9A 2UVRA 3AM9A 2W7OA 4JV1A 1UQVA 4QZIA 3FDSA 1PZNA 3TADC 1Z00B 3OSPA 2M0NA 3AN1A 2VKQA 3ZDBA 3MFHA 2C28A 1SKWA 1XO1A 2BKEA 1ZQIA 3CNHA 3ZDCA 2F1HA 2RDJA 1NI3A 8ICOA 4DOBA 5J8YA 3D2NA 5DLFA 3OSNA 4ECUA 2XY6A 3QYPA 5ALGA 1XWLA 4BJQA 4YMNA 2FLLA 2YQEA 3D6JA 5BPCA 4KLLA 4BWMA 4ED8A 3GV8B 5J0WA 4OCZA 2XY7A 4M9HA 5KFDA 1ECWA 1PK1B 3C21A 4R63A 3F5AA 1F44A 3IRUA 2W11A 8ICNA 4KLOA 8ICMA 4K4IA 2KHQA 5C5JA 4GXIA 5B66U 1FEZA 4TQSA 8ICJA 2HHWA 2KIVA 4Q8FA 2WTFA 4IRKA 4YD1A 2YB4A 3GIKA 4PL1A 2Y0SF 2MAXA 4PZOA 5AKKA 2LI6A 4PL2A 2ZXHA 5AI5A 4ECZA 1J97A 2KP7A 4KLIA 1COOA 4GLXA 1NJXA 3EZ5A 3EPIA 1XSNA 2PFOA 1WUDA 2KZ3A 2NRZA 1L8OA 5K4LA 4MF2A 5ALPA 4OJPA 1NZPA 3QU9A 2G5HB 2KJ5A 4CF5A 1ZQPA 1Q3UA 5KT3A 3N7SC 2WF7A 3N7PD 5J2BA 1RYSA 1ZQQA 2H3FA 4F4WA 3C1ZA 1NZBA 4F4XA 4QJFB 3PVXA 1ZQHA 4RUCA 4Q44A 2WF6A 1KKXA 1FFUA 2EZXA 4OO1J 1UT8A 3AQEA 4JWNA 5HNKA 4RUAA 5KFOA 4KLEA 1NK8A 3V7JA 5KT7A 5KG5A 4RQ7A 3GIJA 2FPLA 5KFYA 4DFPA 2QB0B 4Y2TA 4B6JA 3UM9A 3QUCA 2V4RA 5F3XB 4YMOA 4I2AA 4F3OA 2ASLA 5KT2A 4M6WB 1Z19A 2K4IA 2OHFA 4Y2VA 2HDOA 4IR9A 2ZG6A 4F8RA 1N48A 2ZUBA 5KFLA 2ASDA 2C22A 3F2BA 1SL0A 1X9SA 2KK0A 1ZRMA 4UATA 4QWAA 2A1JB 3MGVA 3IN5A 4MEXA 4TUPA 3IG5A 1V38A 3NVVA 4P0QA 2H3VA 1S9FA 5ALZA 3JPTA 2F2AB 3HWTA 2MUTA 2C2EA 4P0PB 5EE0A 4Y2SA 4DS4A 2IOHA 4KN4A 4Q43A 3TACB 2B21A 3HW8A 4Y2JA 3KKAC 3K1ZA 1UT5A 4RNMA 3N4MB 4F4ZA 3C2LA 1QQ6A 3RJKA 1DRGA 3N7RC 3V6JA 3RAXA 5DGAA 1ZQAA 5AM2A 2G08A 2PMZF 2HBLA 1NKCA 1WWVA 2Q4TA 3PR5B 3BQ7A 5J0OA 2VJ5A 4KLGA 2AQ4A 4DOAA 2BPGA 4R64A 3SD7A 3WK9A 5DBAA 2DQNB 2A19A 5L1MA 2NRWA 4PHPA 1JIHA 1KBUA 3RB3A 4C4SA 3WU2U 2H5XA 2R8IA 1MQ2A 3I76A 5AIAA 4KLMA 2HW3A 1B43A 4YD2A 4F5OA 5KFBA 1T7PA 3HX0A 4HAIA 3PMLA 3T79A 2YY6A 1FIQA 3ONNA 4M47A 4UB4A 1WWUA 3KOOA 3RH5A 1T4GA 2D3DA 4PZNA 1QLNA 2Y0SC 5H2FU 1ZQFA 1VLBA 2AJQA 1YT3A 2HI0A 4RQMA 1T3QA 1WG8A 5EWEA 4ECQA 3KTQA 1KTQA 5EWFA 8ICXA 3OHAA 4KLTA 4EELA 1BPXA 2DL0A 1NNLA 3M9NB 2HBJA 1L7MA 3NRWA 3HKZC 1IG6A 1JI7A 5CA7A 8ICWA 1S0NA 7ICTA 4PGQA 4DFKA 1C7YA 5J29A 3H4DA 5KFIA 4UB5A 4KLDA 4NJ8A 3DEEA 5JRTA 1LKYA 4NL9C 5AI4A 3K1RB 2ZIXA 3M9OB 5L1IA 4ED0A 4O3MA 1L5UA 2F44A 4TQRA 1A77A 3UXPA 3L5KA 4KTQA 2WAQC 3SMVA 5J0QA 2QLTA 1X9WA 3NTUA 1TAQA 4B9MA 1S10A 5J0SA 2Y9TA 4F5RA 4KLQA 5KNIA 5ALNA 3MR2A 2KICA 3SEIA 4DL2A 8ICVA 3K4GA 3EPGA 2BQRA 2WF5A 4J03A 2RHFA 1ZQRA 8ICKA 1TK8A 2FPKA 1TK5A 5KFEA 1NJZA 5IINA 2RP5A 3RJHA 1VJ5A 1BVSA 2VA3A 4EZ6A 4OD0A 1XS9D 7ICUA 3JPPA 2ZIWA 4UBBA 1Q3VA 4TUSA 3H7IA 4RZRA 2DGZA 2JR5A 4ZOHC 2E1FA 3B0XA 5TZVA 3BJYA 1TK0A 1RZTA 2R8GA 4EX6A 3QNMA 4UASA 5KFAA 4QZDA 1SZPA 2JZBA 1KQQA 3GU3A 3QU4A 4Z6CA 1NK4A 2W9CB 4U7CA 4YR0A 4DQRA 3M6ZA 2HMXA 4F50A 4O3OA 4UAWA 3H8JA 4NV0A 1X2IA 1URJA 4IC9A 4F2RA 5J0UA 5CEHA 2ZXIA 2GWSA 2QARA 3E58A 4R8UB 4RQNA 3QUQA 3FAHA 1Q46A 4DLEA 2Y1IA 3H40A 4A8EA 3GILA 3RAQA 5ALLA 5ALJA 5KFWA 3V72A 3KHLA 3TAQA 1KDHA 1UA0A 3PY8A 4ECVA 3OGUA 3SYZA 4QIWF 1DK2A 5EWGA 1Z00A 1M6YA 1Y88A 3QU7A 3F2DA 4DL3A 5CJ7A 3QUTA 4KMUA 2K8AA 1N62A 2G07A 2Q0ZX 5HHIA 1NJYA 3C28A 4RNNA 3MABA 5BOMA 2FE9A 3G6XA 5KFTA 5EE3A 7ICLA 3ISCA 2R8HA 3Q8SB 7ICRA 2GH1A 4JB3A 2MA1A 1KEJA 3M6KA 4B9UA 5ALWA 1SV0A 1ZQXA 3TKAA 3BQ2A 1RDFA 3HP6A 2J6UA 4LZGA 1JXEA 5ALRA 4EBDA 3Q8RB 5G5HA 4FFDA
chains in the Genus database with same CATH topology
2CPRA 3KZXA 4GFJA 4NWIA 2WB1F 4OJOA 3PSIA 2HOIA 2LBOA 2GOLA 4AYBF 1Z19A 2K4IA 2MRLA 2XIDA 1HEKA 2OXOA 4FZMA 2Y0SC 5C0YA 2ZG6A 3GU3A 1ECWA 2CN1A 2OM6A 4AYBC 4U7CA 3OPXA 3F5AA 2K4HA 3M6ZA 2XI9A 1F44A 2HMXA 2K4EA 2CRXA 2E1EA 1HIWA 1YT3A 2ZIWB 2R18A 2KVCA 3F2CA 4NV0A 1URJA 4IC9A 2NV3A 2KHQA 1XNSA 3F2BA 2W04A 2ZXIA 4ICAA 2YB1A 1CRXA 3CP8A 4OJ6A 2JGAA 3HKZF 2KIWA 2G06A 2KD1A 3M7DA 3SAHA 2KV2A 4FE3A 3ICXA 2YB4A 3F53A 2Y0SF 4PL1A 3MGVA 1PVRA 2HBJA 3NRWA 2RRDA 3H0RB 3IN5A 3SQIA 3D2SA 1XO0A 3HKZC 5HR7A 2KJ9A 2HBMA 3ALRA 2LYBA 3D2QA 3GZFA 4PL2A 4A8EA 3IG5A 2ZXHA 4P0QA 2H3VA 4U6PA 1UPHA 2KEYA 4NLCA 4KMOB 2F2AB 4KX3A 2ZIVA 4JMUA 1WUDA 2H3IA 3PSPA 3NUQA 3VC8A 3SAGA 4P0PA 1A0PA 1IIPA 3DEEA 2JH7A 4ACOA 1T94A 4P0PB 2JMGA 5CRXA 1L6NA 2HOFA 2LYAA 2W03A 2G0AA 1GO3F 2H3ZA 4OJPA 3CYMA 4QIWF 2WAQF 2ZIXA 2E5SA 3E0FA 2KKVA 2F8LA 4O3MA 2A3VA 3L3FX 2G5HB 3LVWA 2HOQA 1ED1A 2K8CB 3C29A 2KJ5A 2KHVA 2KJ8A 1Q3UA 3K1ZA 4QIWC 3F2DA 1TAMA 3N7SC 2WAQC 2N1RA 3SMVA 5KL8B 3VCBA 3PZPA 1PVPA 3RFAA 4BX9C 1A6SA 1DRGA 3N7PD 3N7RC 2D6FC 4CGZA 1ZQ1C 2H3FA 2K8AA 2G07A 2KOBA 2DF4B 2F76X 4P0QB 3H0MB 1SZHA 3C28A 2K89A 1NZBA 3IG8A 4OJ5A 2KNJA 4QJFB 2VJ4A 2ZIUA 2W7PA 2JHDA 3RF9A 4CDGA 3CRXA 2KICA 4KX5A 2G08A 2ZIVB 2PMZF 4NLBA 2F77X 2HBLA 2W7OA 2OH2A 4CRXA 5HR6A 2XICA 2Q4TA 4OJLA 1PVQA 4OO1J 2VJ5A 2RHFA 2LKYA 2PMZC 2XVTA 3AQEA 3F5EA 1MA7A 2JH1A 2ZIXB 3O0FA 3LYSA 3SAFA 4WJ3B 2M0NA 2RP5A 4C0ZA 2VKQA 2GH1A 2H3QA 2G09A 2HBKA 2VIXA 2Z7JA 2WB1C 3LVVA 5KL1B 3AL0B 2MA1A 2DQNB 4QNLA 1OUQA 3ONNA 2ZIWA 2LHTA 3M6KA 3KFUF 5A0LA 1Z1BA 1Q3VA 1KBUA 3D2NA 2DGZA 4FZLA 2G5IB 4BUGA 3IP4B 3PSTA 2OYYA 3H0LB 3PSFA 2YX8A 4FZNA 2E1FA 5T14A 2ZIUB 2BDUA 1P7DA 1D8BA 2K8BB 4BJQA 3T79A 2KKPA 3AQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIC A; 
#chains in the Genus database with same CATH topology
 1TV9 A;  2CPR A;  4YR2 A;  2AGQ A;  4RQ3 A;  5IIO A;  2VA8 A;  2ODG A;  1KW4 A;  1DK3 A;  9ICW A;  4F71 A;  5C0Y A;  4JWM A;  3BZK A;  2OM6 A;  5KFP A;  2K4H A;  1KRP A;  2KN7 A;  3T5K A;  2KFN A;  3F2C A;  3CW2 C;  4P4O A;  1SXD A;  1X6I A;  2JXJ A;  2B0C A;  3SI8 A;  1ZQC A;  5ALI A;  1XO0 A;  2KJ9 A;  4DQQ A;  1OW5 A;  3FM9 A;  2C2R A;  8ICU A;  1Z4N A;  3NGD A;  2XC9 A;  3ZDE A;  5AI9 A;  5KG1 A;  4J9N A;  1MC8 A;  3SZ2 A;  3MR5 A;  4RPZ A;  4NLG A;  3CYM A;  2AH5 A;  4MF8 A;  5DLG A;  2KKV A;  2DKX A;  2HOQ A;  1ED1 A;  2P66 A;  3RFA A;  1RPL A;  4CGZ A;  5J2D A;  1N2X A;  3L4P A;  4ECW A;  5DGB A;  5AM5 A;  5ALU A;  4EBE A;  4DS5 A;  3C1Y A;  4OJL A;  2FLP A;  2EAP A;  3HJE A;  2QKQ A;  4M6W A;  4AP9 A;  2XVT A;  4NM1 A;  3C2M A;  3NVW A;  3F5E A;  3WKC A;  5G5G A;  4FS1 A;  5L1K A;  4UQG A;  1O08 A;  3ETL A;  1BGX T;  5J2J A;  3SR6 A;  5IIL A;  5F9N A;  1ZQM A;  3AEV A;  1X9M A;  4QZF A;  4DSI A;  4K4G A;  8ICE A;  2YX8 A;  2XGP A;  2W9A A;  5AKX A;  3GFK B;  4QW8 A;  2I9G A;  2A1J A;  4GFJ A;  3RTV A;  2YMM A;  2HOI A;  4AYB F;  4Y2Y A;  5KG7 A;  2W3R A;  1S77 D;  4DO9 A;  3AMZ A;  1ZQN A;  1RXW A;  5ALE A;  2KVS A;  1U48 A;  5J0Y A;  4ICA A;  3ZD9 A;  5KFU A;  1CRX A;  5J0T A;  4OJ6 A;  4NY8 A;  5HHH A;  4G3I A;  5HR7 A;  3KHG A;  1DGS A;  3RB4 A;  3HIL A;  2F8K A;  1TKD A;  2YMP A;  5KFN A;  2EAN A;  1ZYQ A;  3QEB Z;  3BS5 A;  4DFD A;  4M9J A;  4J9M A;  2JMG A;  3H8W A;  4C4R A;  5AK4 A;  2UVW A;  3ZD8 A;  2BCU A;  2HVH A;  3T5L A;  1CEZ A;  5ALY A;  4UB6 U;  1NK5 A;  3RB0 A;  2K8C B;  4F2S A;  1TAM A;  4UBC A;  2N1R A;  3JPO A;  4GXJ A;  4M04 A;  2BCQ A;  1RG6 A;  5DG9 A;  4IRC A;  3LWM A;  1BPB A;  5B5E U;  4EZ9 A;  7ICO A;  3IG8 A;  2KNJ A;  3GV7 B;  2JHD A;  4I2D A;  1ZQY A;  4CF4 A;  2XGQ A;  4ECR A;  5HR6 A;  3EWA A;  3MDC A;  5AKZ A;  9ICM A;  4YXJ A;  2LKY A;  3THV A;  1ZRN A;  1PUZ A;  1SKS A;  1B0X A;  1RYR A;  2E8P A;  4TUR A;  2HBK A;  7ICF A;  8ICQ A;  4QNL A;  1K1S A;  4DSJ A;  1ZQT A;  4I29 A;  3T5J A;  5KT4 A;  2IMW P;  2YML A;  3I1Y A;  3LWL A;  3UMC A;  2PFN A;  5ALO A;  4QWC A;  4NM2 A;  3AQF A;  9ICE A;  3EW9 A;  9ICA A;  1JRP A;  5JU5 A;  2EAM A;  2OXO A;  5IIJ A;  4UAV A;  2EAO A;  2CN1 A;  4RT2 A;  1ZQJ A;  2JEF A;  4O3N A;  1X6J A;  1ZQB A;  3ZDA A;  4Z6E A;  4NLZ A;  3BQT A;  1XNS A;  5AM3 A;  9ICQ A;  1JMS A;  2W3S A;  3OTQ A;  4YP3 A;  1J2N A;  4Y2U A;  3ICX A;  1RXV A;  4I2E A;  1PVR A;  3SQI A;  5KT5 A;  4EEK A;  2B6G A;  4QWD A;  1S5L U;  1UPH A;  5DB6 A;  3MBY A;  1X9X A;  5KFZ A;  4LVS A;  3UQ0 A;  5J2E A;  3GDX A;  3GQC A;  9ICX A;  1L7O A;  4O3Q A;  1GO3 F;  4ELV A;  3N28 A;  5CB1 A;  3RH4 A;  5KFG A;  3WKB A;  5GTI U;  2DKZ A;  5KFC A;  2FI1 A;  4BX9 C;  1D8L A;  5E79 U;  4F4K A;  1L3V A;  7ICK A;  2F76 X;  3TAP A;  4MFA A;  4FBT A;  5AKY A;  2KMD A;  5KAI U;  2OWO A;  4C8M A;  4DSE A;  5KAF U;  1SV4 A;  2W9C A;  2UVV A;  4EEY A;  3OJS A;  4B9N A;  5A0L A;  5KG3 A;  5GTH U;  2EZZ A;  2FMQ A;  7ICN A;  1V9P A;  3HPO A;  4O5C A;  8ICS A;  2JV3 A;  1KFT A;  5DDM A;  2ISO A;  2V9W A;  3MDA A;  5AKG A;  2Y9U A;  2K8B B;  2ISP A;  2F1J A;  2XO7 A;  4QZ9 A;  4XQ8 A;  3PMN A;  9ICP A;  1ZQZ A;  2IOF K;  4EYI B;  2HHT A;  7ICH A;  1J2M A;  2NO4 A;  1U47 A;  1TE2 A;  4YMM A;  3G6V A;  3V7K A;  2BPF A;  8ICZ A;  2KZZ A;  2IA6 A;  4FO6 A;  1ZQE A;  3IM1 A;  2G06 A;  1XC9 A;  3OHB A;  3QZ8 A;  4DQI A;  3RJF A;  4NLN A;  4B9T A;  3ALR A;  1Z3E B;  3BZC A;  5AI8 A;  3RR7 A;  3PR4 A;  5AKE A;  1ZQK A;  2BDP A;  5AM0 A;  4RQ0 A;  4YQW A;  4GXK A;  1SIJ A;  1S8O A;  2W55 A;  4UAY A;  2DUY A;  9ICI A;  1ZXI A;  4O3S A;  1L6N A;  1SV0 C;  5DQG A;  4RU9 A;  4KLJ A;  3E0F A;  3V7L A;  5KFR A;  2HHX A;  1ZQW A;  1L7N A;  3PW0 A;  4O3P A;  5KFX A;  1BPY A;  1LVH A;  1ZQ1 C;  5DB8 A;  4QZA A;  3CRX A;  8ICI A;  4UB1 A;  2ZIV B;  4NLB A;  3C23 A;  4PGX A;  3Q8P B;  2W43 A;  2E3T A;  3PO4 A;  4EBC A;  3NS1 A;  4US9 A;  2JEG A;  4O5K A;  3UXO A;  3C5G A;  3RBD A;  2F1I A;  4C0Z A;  4ED1 A;  2ZUC A;  3MR3 A;  1CI4 A;  1S76 D;  2OYY A;  3BQ1 A;  5T14 A;  1ZD5 A;  2ZIU B;  4MFF A;  4UAU A;  9ICN A;  7ICS A;  2KKP A;  5AI0 A;  4QWB A;  3KZX A;  3JPR A;  4UB3 A;  2LYH A;  2YN4 A;  1X40 A;  5DBC A;  1QH9 A;  1UCV A;  3RJE A;  2KSO B;  2KVC A;  9ICF A;  8ICH A;  4JK1 A;  4J9R A;  3QEA Z;  2KFZ A;  5KFJ A;  2RQ5 A;  4DWI A;  7ICE A;  3R9K A;  4QZ8 A;  4IQV A;  2HBM A;  1JAL A;  8ICT A;  3JPN A;  3SEN A;  5AKJ A;  4JMU A;  1D9F A;  9ICJ A;  2GLE A;  2BQU A;  4NLK A;  3TFR A;  5CRX A;  1MN8 A;  2H3Z A;  2KG5 A;  2HHQ A;  2BCR A;  2F8L A;  5AK3 A;  1ZQO A;  1ZQD A;  3ISB A;  4YR3 A;  3PW2 A;  1HUZ A;  3PO5 A;  2W9B A;  1Z1V A;  3RJJ A;  4XA5 A;  1A6S A;  1WCN A;  4HYK A;  4OJ5 A;  5EOZ A;  4CRX A;  2IOF A;  3UMG A;  3B9J A;  1LV5 A;  3GIM A;  5J8Y C;  3BQ0 A;  4QW9 A;  2PMZ C;  4ECS A;  5J0R A;  2JH1 A;  3Q8K A;  1U9L A;  3LYS A;  3EUB 2;  1HUO A;  4WJ3 B;  3LVV A;  7ICP A;  1NJW A;  4DLG A;  3KFU F;  3HT3 A;  2KZM A;  3RB6 A;  3IP4 B;  2PI5 A;  1PK3 A;  4YXM A;  1KFS A;  4Q8E A;  4J9Q A;  1H38 A;  1TVA A;  3EYZ A;  5TIS U;  5KFQ A;  4NWI A;  2WB1 F;  4OJO A;  1S97 A;  1PK1 A;  4NXZ A;  4USA A;  1QSS A;  1SWW A;  3S6J A;  3RR8 A;  4MFC A;  2R18 A;  2AGP A;  2BQ3 A;  2PFP A;  4ECY A;  4Z6D A;  9ICG A;  3B0Y A;  4QZC A;  1ZQG A;  5EE9 A;  2W04 A;  3UPQ A;  3H0R B;  5AKH A;  3FC4 A;  1SKR A;  3PW7 A;  2LYB A;  4FS2 A;  3C2K A;  1ZET A;  1QQ5 A;  5EE1 A;  3C5F A;  4B9S A;  1ZQU A;  5AKI A;  4M2Y A;  2J6S A;  1LKY B;  2W03 A;  4UAR A;  5ALQ A;  3QU2 A;  4F4Y A;  2P6R A;  4X5V A;  5CWR A;  3C29 A;  4LJX A;  4CCH A;  3PZP A;  5KL8 B;  5CP2 A;  5ALV A;  3M1Y A;  5CHG A;  1WCL A;  3WK7 A;  5KFH A;  3IV6 A;  4DFM A;  4I2B A;  3IHQ B;  3FYH A;  2F77 X;  3SV4 A;  4R65 A;  3MFI A;  1YZ7 A;  1PVQ A;  4C4T A;  3PX4 A;  1U4B A;  3HRD D;  1S0M A;  8ICY A;  5AKL A;  3PX6 A;  3QX7 A;  2Z7J A;  5KTQ A;  1FFV A;  5J2K A;  2MU2 A;  2QB0 A;  4IRD A;  1BNO A;  4ZH4 A;  1SB3 C;  4I28 A;  4KN7 A;  3TQ1 A;  5KT6 A;  2GO7 A;  5KG4 A;  3K75 D;  4DQP A;  1D8B A;  3TI0 A;  4PPX A;  5AK5 A;  4KLU A;  3ED5 A;  3ORY A;  2UVU A;  2GOL A;  4DOC A;  5KG2 A;  1S0V A;  4G9B A;  4GIB A;  3OPX A;  2XI9 A;  4DSK A;  4DL5 A;  2D8C A;  2NV3 A;  2AU0 A;  2OEH A;  1S0O A;  3M8R A;  2FLN A;  4UB8 U;  2KIW A;  3A0B U;  4I2C A;  4FE3 A;  2HHU A;  4YN4 A;  4JV0 A;  1UHU A;  5HP4 A;  3GZF A;  5F9L A;  9ICK A;  4DF4 A;  1LB2 B;  1ZD2 P;  1NK9 A;  4J9P A;  1XU4 A;  4BXO B;  4YCX A;  3VC8 A;  4P0P A;  4RQ2 A;  1YZ6 A;  1NOM A;  1SL2 A;  2KJ8 A;  4QIW C;  1NK7 A;  1N5X A;  5DB9 A;  2D6F C;  2LM4 A;  4O5E A;  2DF4 B;  3N97 B;  2K89 A;  2VA2 A;  2C2D A;  4C7Z A;  2NYV A;  3U26 A;  2ZJ5 A;  4DL7 A;  2DFL A;  9ICH A;  9ICO A;  3ZI4 A;  3AU2 A;  5DBB A;  3T3F A;  3RJG A;  1KSP A;  5CR0 A;  3J81 j;  3KHH A;  2XCA A;  1UA1 A;  5IIM A;  7ICV A;  7ICI A;  3H8M A;  2WB1 C;  3AL0 B;  4UB2 A;  1Z4O A;  7ICM A;  2JEI A;  4IL6 U;  2AGO A;  4B9V A;  3QUB A;  3PSF A;  2E8M A;  3PNC A;  1DGJ A;  2NRX A;  1JN3 A;  3E2E A;  4QWE A;  5J2G A;  4UW9 A;  1QTM A;  8ICL A;  2JEJ A;  2ZTD A;  2I5H A;  5J2F A;  2BR0 A;  3NVZ A;  2XID A;  2EZY A;  4UAZ A;  4PH5 A;  3Q8L A;  5AM4 A;  4XUS A;  3QZ7 A;  2NO5 A;  7ICQ A;  4IR1 A;  2CRX A;  2ZJ8 A;  4F5Q A;  1L8L A;  5KFM A;  1XSL A;  3RJI A;  1IV8 A;  5ALD A;  3BDP A;  4ELT A;  4IQT A;  1AQ6 A;  3Q8M A;  3HKZ F;  5L1L A;  3SAH A;  9ICV A;  2KV2 A;  4I2G A;  4J9S A;  4PGY A;  5D49 A;  3D2S A;  2E8O A;  3UQ2 A;  1ZQL A;  5J0P A;  4Y2Q A;  1RQN A;  2O6K A;  4DCC A;  2P6U A;  4KLS A;  4KMO B;  2ZIV A;  3NUQ A;  1A0P A;  5HMM A;  1T94 A;  4PJ0 U;  2G0A A;  5D4B A;  2R8K A;  2FPM A;  3LK9 A;  2WAQ F;  3L3F X;  2BPC A;  2EDU A;  2WHE A;  3DV9 A;  3VCB A;  2BGW A;  3Q8Q B;  1N5W A;  2K60 A;  3PX0 A;  2M9N A;  1X66 A;  3T5H A;  2R8J A;  1SZH A;  5AI6 A;  4IQU A;  2VJ4 A;  2ZIU A;  4CDG A;  2ALZ A;  2DPI A;  2HCF A;  5AIB A;  3SV3 A;  1F5S A;  3NVY A;  2PI4 A;  2NRV A;  2HSZ A;  1QSL A;  2AHO B;  4M9N A;  1MA7 A;  2RDI A;  5BOL A;  2H3Q A;  2HVI A;  5J2H A;  1XSP A;  3GII A;  3I28 A;  4PHE A;  2KSO A;  1ZQV A;  9ICB A;  1D8Y A;  3PW5 A;  1Z1B A;  1NKB A;  4QZH A;  4RQ5 A;  8ICA A;  4FZL A;  1U49 A;  1O03 A;  1T8E A;  3H0L B;  5IIK A;  4FZN A;  3AUO A;  1B4F A;  3DDH A;  3RRH A;  3PSI A;  3WK6 A;  3V6K A;  3QXG A;  3TAR A;  4RQ8 A;  4P4M A;  2FMS A;  5ALT A;  4Y2X A;  4AYB C;  4PHD A;  1MSW D;  2YTU A;  2E1E A;  4C80 A;  1KN5 A;  2ZTE A;  2W8L A;  3RH6 A;  4F5N A;  3TAN A;  2FJ6 A;  3TAD A;  3ISD A;  4R8U A;  1DXS A;  4I2I A;  4Q45 A;  2AXT U;  2HHV A;  2K4P A;  2ASJ A;  2W8K A;  2QB1 A;  1IM4 A;  3MR6 A;  4DSL A;  1A76 A;  4RPX A;  1QQ7 A;  1RQL A;  2CXY A;  1RYU A;  1KL9 A;  5JTI A;  2OCE A;  4GC7 A;  1BPE A;  9ICU A;  3PSP A;  2MSN A;  3BS5 B;  4MEY A;  1NKE A;  4ED6 A;  2IBK A;  1V97 A;  3JPQ A;  5AHX A;  3KBB A;  2A3V A;  2WFA A;  9ICC A;  3LVW A;  3QU5 A;  3MGH A;  4Y2R A;  4IQW A;  2DBY A;  4BGD A;  4O9M A;  2LM1 A;  4I2J A;  1QSY A;  4YG2 A;  1SXE A;  4RQ1 A;  3M8S A;  1SGG A;  3KZI U;  2WF9 A;  3KD3 A;  5DKW A;  5ALK A;  1JRO A;  3QE9 Y;  2ESE A;  8ICF A;  5L9X A;  4JUZ A;  3WK5 A;  4P2H A;  5FP0 A;  1ARO P;  1JXL A;  1BPD A;  1N63 A;  4QZG A;  5III A;  1SWV A;  2LHT A;  2ZTC A;  2E8N A;  3PST A;  2ES6 A;  1L3T A;  1KFD A;  3WK8 A;  3H4B A;  1ZJM A;  3RBE A;  4K4H A;  3BS7 A;  1TFR A;  3AU6 A;  5DQH A;  4FBU A;  1QCK A;  4YVZ A;  4ED2 A;  4RPY A;  1TAU A;  1K1Q A;  4B9L A;  4O0I A;  2Y1J A;  5KG6 A;  2PXI A;  9ICS A;  4P4P A;  2DPJ A;  3WKA A;  4ED3 A;  5J0X A;  2KE7 A;  5J2A A;  2YB1 A;  4M9G A;  3CP8 A;  4E0D A;  4RNO A;  5L1J A;  2DWQ A;  3ZDD A;  2RRD A;  5JUM A;  1EXN A;  1WYG A;  5DG7 A;  1Q8K A;  3KHR A;  4MHV A;  2EH9 A;  4C8O A;  1ZJN A;  3PW4 A;  3NAS A;  4KX3 A;  2EQY A;  2H3I A;  1L3S A;  3V6H A;  2W54 A;  1IIP A;  4RQ4 A;  5ALM A;  4BWJ A;  5J2C A;  4M0A A;  2LYA A;  2XCP A;  4KIT B;  4RT3 A;  3NRZ A;  3WKD A;  1COK A;  1JUD A;  4I2F A;  1OXJ A;  4DL6 A;  1ZOL A;  1DOQ A;  4F92 B;  1N60 A;  2PKE A;  4P0Q B;  2JRZ A;  2NRT A;  4GC6 A;  1NK6 A;  4O3R A;  2XIC A;  2MUT B;  4Z6F A;  2BHN A;  3ETR A;  3O0F A;  2ZJA A;  3SAF A;  8ICC A;  2YMQ A;  3GV5 B;  2G09 A;  2W9M A;  2VIX A;  3LDA A;  8ICP A;  4IS7 A;  4YFK A;  4DEZ A;  1U45 A;  3UXN A;  3TFS A;  3IDW A;  5DB7 A;  4Y2P A;  8ICR A;  1RM6 C;  4DQS A;  2BDU A;  1P7D A;  2I6X A;  3KKA A;  2HHS A;  2V4Q A;  4TUQ A;  1L3U A;  1KLN A;  2LBO A;  1CUK A;  5KFS A;  4F72 A;  2ATL A;  4FZM A;  5HML A;  4DFJ A;  2I1Q A;  4F93 B;  4BXO A;  2XY5 A;  7ICJ A;  2WF8 A;  4ECX A;  3UMB A;  1T3N A;  3H8S A;  4KLH A;  2JGA A;  2VAN A;  2KD1 A;  3M7D A;  5J2I A;  5ALF A;  2IHN A;  5DDY A;  1B22 A;  4F91 B;  4ECT A;  4C7Y A;  4ED7 A;  4J9L A;  2AQ0 A;  2KTQ A;  5ALX A;  2KEY A;  2IHM A;  2JH7 A;  4ACO A;  2P35 A;  1F0M A;  4CNQ A;  2HOF A;  2E5S A;  4I27 A;  2KHV A;  1PVP A;  2LMR A;  1BPZ A;  3MGI A;  5DG8 A;  3PV8 A;  1FO4 A;  3H0M B;  1X42 A;  4QZE A;  4F5P A;  4KLF A;  4KX5 A;  3OJU A;  1SL1 A;  4DF8 A;  1ZD3 A;  4J9O A;  2OH2 A;  1JX4 A;  4QZB A;  4M9L A;  5DQI A;  5AM1 A;  4I2H A;  4RQ6 A;  4LZD A;  4JV2 A;  1K5O A;  2ZIX B;  4US8 A;  2RLT A;  5KL1 B;  5KFK A;  1OUQ A;  5D46 A;  1BNP A;  3WK4 A;  4NL9 A;  2J6T A;  4BUG A;  2G5I B;  1ZQS A;  4C8L A;  2BZF A;  8ICG A;  4EEN A;  3JPS A;  4CF3 A;  4EX7 A;  2MRL A;  2BCV A;  3WKE A;  1HEK A;  5AK6 A;  2PFQ A;  2K4E A;  4BDP A;  3G6Y A;  1HIW A;  2ZIW B;  7ICG A;  5ALH A;  2L5Y A;  4EYH B;  4C8N A;  1N61 A;  1MQ3 A;  3A0H U;  3MC1 A;  2F3N A;  4ELU A;  9ICL A;  3F53 A;  2ZUD A;  2FDR A;  8ICB A;  3M9M B;  3D2Q A;  4DL4 A;  1VDV A;  2JZB B;  4XRH A;  4C8K A;  1ZD4 A;  5KG0 A;  4U6P A;  1L7P A;  4DSF A;  5KFF A;  1D9D A;  4CE6 A;  2FMP A;  4NLC A;  4PHA A;  3RRG A;  1NK0 A;  3SAG A;  5ALS A;  5AIC A;  9ICR A;  1N56 A;  2A1A A;  2QAR B;  1IXR A;  1V85 A;  2LPE A;  4R66 A;  1HJP A;  2W9B B;  9ICT A;  2KOB A;  2BCS A;  1C20 A;  4J9K A;  2W7P A;  5KFV A;  3RF9 A;  2UVR A;  3AM9 A;  2W7O A;  4JV1 A;  1UQV A;  4QZI A;  3FDS A;  1PZN A;  3TAD C;  1Z00 B;  3OSP A;  2M0N A;  3AN1 A;  2VKQ A;  3ZDB A;  3MFH A;  2C28 A;  1SKW A;  1XO1 A;  2BKE A;  1ZQI A;  3CNH A;  3ZDC A;  2F1H A;  2RDJ A;  1NI3 A;  8ICO A;  4DOB A;  5J8Y A;  3D2N A;  5DLF A;  3OSN A;  4ECU A;  2XY6 A;  3QYP A;  5ALG A;  1XWL A;  4BJQ A;  4YMN A;  2FLL A;  2YQE A;  3D6J A;  5BPC A;  4KLL A;  4BWM A;  4ED8 A;  3GV8 B;  5J0W A;  4OCZ A;  2XY7 A;  4M9H A;  5KFD A;  1ECW A;  1PK1 B;  3C21 A;  4R63 A;  3F5A A;  1F44 A;  3IRU A;  2W11 A;  8ICN A;  4KLO A;  8ICM A;  4K4I A;  2KHQ A;  5C5J A;  4GXI A;  5B66 U;  1FEZ A;  4TQS A;  8ICJ A;  2HHW A;  2KIV A;  4Q8F A;  2WTF A;  4IRK A;  4YD1 A;  2YB4 A;  3GIK A;  4PL1 A;  2Y0S F;  2MAX A;  4PZO A;  5AKK A;  2LI6 A;  4PL2 A;  2ZXH A;  5AI5 A;  4ECZ A;  1J97 A;  2KP7 A;  4KLI A;  1COO A;  4GLX A;  1NJX A;  3EZ5 A;  3EPI A;  1XSN A;  2PFO A;  1WUD A;  2KZ3 A;  2NRZ A;  1L8O A;  5K4L A;  4MF2 A;  5ALP A;  4OJP A;  1NZP A;  3QU9 A;  2G5H B;  2KJ5 A;  4CF5 A;  1ZQP A;  1Q3U A;  5KT3 A;  3N7S C;  2WF7 A;  3N7P D;  5J2B A;  1RYS A;  1ZQQ A;  2H3F A;  4F4W A;  3C1Z A;  1NZB A;  4F4X A;  4QJF B;  3PVX A;  1ZQH A;  4RUC A;  4Q44 A;  2WF6 A;  1KKX A;  1FFU A;  2EZX A;  4OO1 J;  1UT8 A;  3AQE A;  4JWN A;  5HNK A;  4RUA A;  5KFO A;  4KLE A;  1NK8 A;  3V7J A;  5KT7 A;  5KG5 A;  4RQ7 A;  3GIJ A;  2FPL A;  5KFY A;  4DFP A;  2QB0 B;  4Y2T A;  4B6J A;  3UM9 A;  3QUC A;  2V4R A;  5F3X B;  4YMO A;  4I2A A;  4F3O A;  2ASL A;  5KT2 A;  4M6W B;  1Z19 A;  2K4I A;  2OHF A;  4Y2V A;  2HDO A;  4IR9 A;  2ZG6 A;  4F8R A;  1N48 A;  2ZUB A;  5KFL A;  2ASD A;  2C22 A;  3F2B A;  1SL0 A;  1X9S A;  2KK0 A;  1ZRM A;  4UAT A;  4QWA A;  2A1J B;  3MGV A;  3IN5 A;  4MEX A;  4TUP A;  3IG5 A;  1V38 A;  3NVV A;  4P0Q A;  2H3V A;  1S9F A;  5ALZ A;  3JPT A;  2F2A B;  3HWT A;  2MUT A;  2C2E A;  4P0P B;  5EE0 A;  4Y2S A;  4DS4 A;  2IOH A;  4KN4 A;  4Q43 A;  3TAC B;  2B21 A;  3HW8 A;  4Y2J A;  3KKA C;  3K1Z A;  1UT5 A;  4RNM A;  3N4M B;  4F4Z A;  3C2L A;  1QQ6 A;  3RJK A;  1DRG A;  3N7R C;  3V6J A;  3RAX A;  5DGA A;  1ZQA A;  5AM2 A;  2G08 A;  2PMZ F;  2HBL A;  1NKC A;  1WWV A;  2Q4T A;  3PR5 B;  3BQ7 A;  5J0O A;  2VJ5 A;  4KLG A;  2AQ4 A;  4DOA A;  2BPG A;  4R64 A;  3SD7 A;  3WK9 A;  5DBA A;  2DQN B;  2A19 A;  5L1M A;  2NRW A;  4PHP A;  1JIH A;  1KBU A;  3RB3 A;  4C4S A;  3WU2 U;  2H5X A;  2R8I A;  1MQ2 A;  3I76 A;  5AIA A;  4KLM A;  2HW3 A;  1B43 A;  4YD2 A;  4F5O A;  5KFB A;  1T7P A;  3HX0 A;  4HAI A;  3PML A;  3T79 A;  2YY6 A;  1FIQ A;  3ONN A;  4M47 A;  4UB4 A;  1WWU A;  3KOO A;  3RH5 A;  1T4G A;  2D3D A;  4PZN A;  1QLN A;  2Y0S C;  5H2F U;  1ZQF A;  1VLB A;  2AJQ A;  1YT3 A;  2HI0 A;  4RQM A;  1T3Q A;  1WG8 A;  5EWE A;  4ECQ A;  3KTQ A;  1KTQ A;  5EWF A;  8ICX A;  3OHA A;  4KLT A;  4EEL A;  1BPX A;  2DL0 A;  1NNL A;  3M9N B;  2HBJ A;  1L7M A;  3NRW A;  3HKZ C;  1IG6 A;  1JI7 A;  5CA7 A;  8ICW A;  1S0N A;  7ICT A;  4PGQ A;  4DFK A;  1C7Y A;  5J29 A;  3H4D A;  5KFI A;  4UB5 A;  4KLD A;  4NJ8 A;  3DEE A;  5JRT A;  1LKY A;  4NL9 C;  5AI4 A;  3K1R B;  2ZIX A;  3M9O B;  5L1I A;  4ED0 A;  4O3M A;  1L5U A;  2F44 A;  4TQR A;  1A77 A;  3UXP A;  3L5K A;  4KTQ A;  2WAQ C;  3SMV A;  5J0Q A;  2QLT A;  1X9W A;  3NTU A;  1TAQ A;  4B9M A;  1S10 A;  5J0S A;  2Y9T A;  4F5R A;  4KLQ A;  5KNI A;  5ALN A;  3MR2 A;  2KIC A;  3SEI A;  4DL2 A;  8ICV A;  3K4G A;  3EPG A;  2BQR A;  2WF5 A;  4J03 A;  2RHF A;  1ZQR A;  8ICK A;  1TK8 A;  2FPK A;  1TK5 A;  5KFE A;  1NJZ A;  5IIN A;  2RP5 A;  3RJH A;  1VJ5 A;  1BVS A;  2VA3 A;  4EZ6 A;  4OD0 A;  1XS9 D;  7ICU A;  3JPP A;  2ZIW A;  4UBB A;  1Q3V A;  4TUS A;  3H7I A;  4RZR A;  2DGZ A;  2JR5 A;  4ZOH C;  2E1F A;  3B0X A;  5TZV A;  3BJY A;  1TK0 A;  1RZT A;  2R8G A;  4EX6 A;  3QNM A;  4UAS A;  5KFA A;  4QZD A;  1SZP A;  2JZB A;  1KQQ A;  3GU3 A;  3QU4 A;  4Z6C A;  1NK4 A;  2W9C B;  4U7C A;  4YR0 A;  4DQR A;  3M6Z A;  2HMX A;  4F50 A;  4O3O A;  4UAW A;  3H8J A;  4NV0 A;  1X2I A;  1URJ A;  4IC9 A;  4F2R A;  5J0U A;  5CEH A;  2ZXI A;  2GWS A;  2QAR A;  3E58 A;  4R8U B;  4RQN A;  3QUQ A;  3FAH A;  1Q46 A;  4DLE A;  2Y1I A;  3H40 A;  4A8E A;  3GIL A;  3RAQ A;  5ALL A;  5ALJ A;  5KFW A;  3V72 A;  3KHL A;  3TAQ A;  1KDH A;  1UA0 A;  3PY8 A;  4ECV A;  3OGU A;  3SYZ A;  4QIW F;  1DK2 A;  5EWG A;  1Z00 A;  1M6Y A;  1Y88 A;  3QU7 A;  3F2D A;  4DL3 A;  5CJ7 A;  3QUT A;  4KMU A;  2K8A A;  1N62 A;  2G07 A;  2Q0Z X;  5HHI A;  1NJY A;  3C28 A;  4RNN A;  3MAB A;  5BOM A;  2FE9 A;  3G6X A;  5KFT A;  5EE3 A;  7ICL A;  3ISC A;  2R8H A;  3Q8S B;  7ICR A;  2GH1 A;  4JB3 A;  2MA1 A;  1KEJ A;  3M6K A;  4B9U A;  5ALW A;  1SV0 A;  1ZQX A;  3TKA A;  3BQ2 A;  1RDF A;  3HP6 A;  2J6U A;  4LZG A;  1JXE A;  5ALR A;  4EBD A;  3Q8R B;  5G5H A;  4FFD A; 
#chains in the Genus database with same CATH homology
 2CPR A;  3KZX A;  4GFJ A;  4NWI A;  2WB1 F;  4OJO A;  3PSI A;  2HOI A;  2LBO A;  2GOL A;  4AYB F;  1Z19 A;  2K4I A;  2MRL A;  2XID A;  1HEK A;  2OXO A;  4FZM A;  2Y0S C;  5C0Y A;  2ZG6 A;  3GU3 A;  1ECW A;  2CN1 A;  2OM6 A;  4AYB C;  4U7C A;  3OPX A;  3F5A A;  2K4H A;  3M6Z A;  2XI9 A;  1F44 A;  2HMX A;  2K4E A;  2CRX A;  2E1E A;  1HIW A;  1YT3 A;  2ZIW B;  2R18 A;  2KVC A;  3F2C A;  4NV0 A;  1URJ A;  4IC9 A;  2NV3 A;  2KHQ A;  1XNS A;  3F2B A;  2W04 A;  2ZXI A;  4ICA A;  2YB1 A;  1CRX A;  3CP8 A;  4OJ6 A;  2JGA A;  3HKZ F;  2KIW A;  2G06 A;  2KD1 A;  3M7D A;  3SAH A;  2KV2 A;  4FE3 A;  3ICX A;  2YB4 A;  3F53 A;  2Y0S F;  4PL1 A;  3MGV A;  1PVR A;  2HBJ A;  3NRW A;  2RRD A;  3H0R B;  3IN5 A;  3SQI A;  3D2S A;  1XO0 A;  3HKZ C;  5HR7 A;  2KJ9 A;  2HBM A;  3ALR A;  2LYB A;  3D2Q A;  3GZF A;  4PL2 A;  4A8E A;  3IG5 A;  2ZXH A;  4P0Q A;  2H3V A;  4U6P A;  1UPH A;  2KEY A;  4NLC A;  4KMO B;  2F2A B;  4KX3 A;  2ZIV A;  4JMU A;  1WUD A;  2H3I A;  3PSP A;  3NUQ A;  3VC8 A;  3SAG A;  4P0P A;  1A0P A;  1IIP A;  3DEE A;  2JH7 A;  4ACO A;  1T94 A;  4P0P B;  2JMG A;  5CRX A;  1L6N A;  2HOF A;  2LYA A;  2W03 A;  2G0A A;  1GO3 F;  2H3Z A;  4OJP A;  3CYM A;  4QIW F;  2WAQ F;  2ZIX A;  2E5S A;  3E0F A;  2KKV A;  2F8L A;  4O3M A;  2A3V A;  3L3F X;  2G5H B;  3LVW A;  2HOQ A;  1ED1 A;  2K8C B;  3C29 A;  2KJ5 A;  2KHV A;  2KJ8 A;  1Q3U A;  3K1Z A;  4QIW C;  3F2D A;  1TAM A;  3N7S C;  2WAQ C;  2N1R A;  3SMV A;  5KL8 B;  3VCB A;  3PZP A;  1PVP A;  3RFA A;  4BX9 C;  1A6S A;  1DRG A;  3N7P D;  3N7R C;  2D6F C;  4CGZ A;  1ZQ1 C;  2H3F A;  2K8A A;  2G07 A;  2KOB A;  2DF4 B;  2F76 X;  4P0Q B;  3H0M B;  1SZH A;  3C28 A;  2K89 A;  1NZB A;  3IG8 A;  4OJ5 A;  2KNJ A;  4QJF B;  2VJ4 A;  2ZIU A;  2W7P A;  2JHD A;  3RF9 A;  4CDG A;  3CRX A;  2KIC A;  4KX5 A;  2G08 A;  2ZIV B;  2PMZ F;  4NLB A;  2F77 X;  2HBL A;  2W7O A;  2OH2 A;  4CRX A;  5HR6 A;  2XIC A;  2Q4T A;  4OJL A;  1PVQ A;  4OO1 J;  2VJ5 A;  2RHF A;  2LKY A;  2PMZ C;  2XVT A;  3AQE A;  3F5E A;  1MA7 A;  2JH1 A;  2ZIX B;  3O0F A;  3LYS A;  3SAF A;  4WJ3 B;  2M0N A;  2RP5 A;  4C0Z A;  2VKQ A;  2GH1 A;  2H3Q A;  2G09 A;  2HBK A;  2VIX A;  2Z7J A;  2WB1 C;  3LVV A;  5KL1 B;  3AL0 B;  2MA1 A;  2DQN B;  4QNL A;  1OUQ A;  3ONN A;  2ZIW A;  2LHT A;  3M6K A;  3KFU F;  5A0L A;  1Z1B A;  1Q3V A;  1KBU A;  3D2N A;  2DGZ A;  4FZL A;  2G5I B;  4BUG A;  3IP4 B;  3PST A;  2OYY A;  3H0L B;  3PSF A;  2YX8 A;  4FZN A;  2E1F A;  5T14 A;  2ZIU B;  2BDU A;  1P7D A;  1D8B A;  2K8B B;  4BJQ A;  3T79 A;  2KKP A;  3AQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...