2KICA

N-nafy. n-terminal domain of nafy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MVTPVNMSRETALRIALAARALPGTTVGQLLEILHQRIEGPLTEESLQGVSVTDLKIGLAGSEEDVDMLDTPMSALKDAVRILWGEAEVDSLPQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biological activity and solution structure of the apo-dinitrogenase binding domain of NafY
rcsb
source organism Azotobacter vinelandii
molecule tags Protein binding,metal transport
molecule keywords Nitrogenase gamma subunit
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16844 DIMCO_N Dinitrogenase iron-molybdenum cofactor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.590 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kicA00
2KICA
chains in the Genus database with same CATH superfamily
4I2DA 1TAMA 5J2BA 3BQTA 2R8IA 3PW4A 1XSNA 3IN5A 5EE3A 4P0QB 2N1RA 2XY6A 5DDYA 3EZ5A 3MABA 2JEGA 2D3DA 2RDIA 4MF8A 1L7MA 4KLMA 2YQEA 5KFTA 5KFDA 1ZD4A 4YQWA 8ICOA 3B0XA 1S77D 4FS1A 1B43A 1ZOLA 4FE3A 4AP9A 4Y2VA 2A1JA 3MFIA 4Z6DA 3H0LB 4I2BA 4EBCA 3Q8SB 2LMRA 2WB1F 3SENA 1BPDA 8ICYA 1S76D 4A8EA 5ALYA 4FS2A 2ZIWA 3AEVA 4QZGA 9ICAA 4BJQA 5HR6A 4ECTA 2AGOA 3CP8A 4RQ2A 3PZPA 2W9BA 3V6KA 3RH5A 3F5EA 2HHUA 2DL0A 5IIJA 1T8EA 1UPHA 5ALSA 3N7SC 4YXMA 3H4DA 3DV9A 3G6XA 9ICJA 2W11A 3IHQB 1U49A 2IOFA 2EH9A 4EX7A 3PSPA 4KMUA 5F9LA 4RZRA 1L5UA 2A1AA 2LHTA 2BPCA 3ETLA 2KIVA 2AQ0A 5CHGA 1TK0A 4B9NA 2H3FA 1U47A 2Q0ZX 5L1IA 1N61A 1NK5A 4P0PB 5DB6A 3AQFA 2HMXA 2Z7JA 1ZQUA 4F4KA 3H7IA 2FI1A 1JX4A 7ICOA 2FMQA 4ZH4A 3GIJA 3NVVA 1DRGA 2KHVA 2ZG6A 2OHFA 2PI5A 1SXDA 2KZMA 3I76A 2FMSA 2K60A 4J9LA 3WU2U 2K8CB 2E1FA 5HHIA 4C4RA 3N28A 1X6JA 2LBOA 4CRXA 1V38A 2LPEA 4QZBA 1RPLA 8ICQA 2J6SA 5DGBA 2HHWA 2G5HB 2YMLA 4DQQA 3DEEA 9ICFA 3MR3A 2RLTA 1TFRA 3LVWA 3SQIA 8ICWA 4KLFA 1FEZA 4P4MA 1X66A 5ALNA 9ICUA 4ELUA 5J2IA 4OD0A 4M9NA 3Q8KA 5E79U 4O5EA 2EZYA 2O6KA 4DLEA 1SGGA 4YR0A 2NRXA 1KDHA 4I2IA 4UARA 2JZBA 1C7YA 1B4FA 3SI8A 3GIMA 3WK6A 5G5GA 3N97B 8ICFA 7ICUA 5CR0A 1CEZA 4YD2A 1X9MA 2Y1JA 4C8LA 1WUDA 4PHEA 5JU5A 3M6ZA 2WFAA 5C5JA 5B5EU 4I28A 5AI5A 4U7CA 2ISOA 3M8SA 4I2AA 5KFEA 1Z00A 4QW9A 2IMWP 2P66A 4PPXA 1LKYA 1M6YA 4NL9A 1RYRA 3QYPA 3GIIA 1NZPA 5AI4A 1RQLA 1X40A 4M47A 2FPLA 4BWMA 3QEBZ 2ZIXA 1XO1A 3GILA 2VA2A 3Q8MA 4J9NA 5D46A 3BS5A 2W9CA 4DFJA 4KLQA 2W9AA 2F2AB 2K4IA 4MFAA 4IRCA 4KLEA 1ZJNA 2KEYA 1L7NA 2KMDA 2F1IA 3Q8RB 5KFPA 1X42A 1Q46A 2RHFA 1SB3C 4RQ3A 1ZD3A 1BPYA 4RQ0A 3AUOA 5DKWA 1ZQBA 4GXIA 4B9LA 8ICCA 5ALKA 3A0HU 3CRXA 1TK8A 2FLNA 2NRVA 3C1YA 4Q8FA 3GQCA 5HMLA 1EXNA 1L6NA 5DB7A 3UQ0A 1A6SA 2IBKA 3C2MA 3AM9A 5KT7A 4O3QA 4GXKA 5DBCA 4I2JA 5AKZA 3GV7B 3MR6A 3OHBA 5J8YA 5J0RA 1PUZA 4OJPA 3PVXA 1RDFA 1S0OA 3K4GA 3VCBA 7ICQA 4PJ0U 3TFSA 4EZ6A 3OJSA 2BZFA 4J03A 4JB3A 2E3TA 2G08A 1YT3A 4RQ6A 4FZLA 1COOA 2V4QA 3RAXA 5DQGA 3MGVA 5J2HA 4ECSA 1J2NA 3N7PD 5AKXA 5AM4A 5KAFU 2ZUCA 3O0FA 4YVZA 2KG5A 5KFBA 3D2SA 2WAQF 4I29A 2FMPA 1ZRMA 1ZQLA 1XNSA 2IOHA 5J0WA 5AKGA 1CI4A 5KFVA 1JXLA 1DK3A 3F2CA 3PR5B 3RJJA 2KKVA 4KLHA 2ZIUB 7ICMA 2FPKA 1Z1VA 2WF9A 3H8SA 3AQEA 5BOLA 1WCNA 3GV8B 3PSTA 1ZQMA 3OSNA 2AGQA 1P7DA 9ICQA 4M04A 1SV0C 4ECRA 4PGYA 4EZ9A 1K5OA 3H8MA 4O9MA 3QUBA 1PK1A 2EDUA 1ZQKA 3KKAA 2KSOA 3V7KA 1K1SA 2W9BB 3QU5A 1ZQQA 3V7LA 1COKA 3I1YA 1TE2A 4J9SA 4IS7A 4QZEA 2WF8A 3PR4A 3RH4A 4E0DA 3F53A 3LYSA 2ZUBA 1NK4A 9ICPA 2ZIVA 5ALQA 2LI6A 4DL6A 2KV2A 2ATLA 4KITB 4U6PA 1CUKA 3SV4A 7ICPA 4MEXA 2BDPA 1ZRNA 4Y2TA 5DG7A 2F3NA 3UQ2A 2KJ5A 2BHNA 3VC8A 5ALIA 2NO5A 5CJ7A 1JRPA 4C8MA 4DSEA 3CNHA 4HAIA 1QCKA 1NJWA 4DL4A 3ICXA 3SMVA 1YZ7A 4YMMA 2H5XA 1A77A 1SWWA 4GIBA 4ED8A 4P0PA 5C0YA 4YFKA 4US8A 3KFUF 1UT5A 1TV9A 2B21A 2PFPA 8ICXA 2EQYA 5HHHA 1S0NA 1TKDA 4PZNA 4DSLA 2PI4A 1ZQZA 1IV8A 3QU7A 1J2MA 3RH6A 1UT8A 2JEJA 1F5SA 1ZQXA 4IQVA 2UVRA 1ZQYA 5ALFA 3RR8A 4PHAA 2OCEA 2KICA 1Q3UA 4BWJA 3C2KA 2KP7A 3PW2A 3ISDA 2W8KA 2Y9TA 7ICRA 3KOOA 4JK1A 3F2BA 1U45A 1NJYA 4J9MA 3RRGA 4KN4A 1FFUA 2BDUA 2IOFK 1ZQEA 4FBTA 5KFAA 2BCRA 4K4GA 3QUQA 1JXEA 2QARB 3KHHA 2PFOA 2BCVA 3F5AA 2EAPA 2VKQA 2NYVA 2PFQA 3V72A 1BPBA 4BXOB 3HP6A 3PO4A 4UASA 4RPXA 4M6WA 5L1JA 1X6IA 3BJYA 1SKRA 5KFRA 3CW2C 2WF7A 5EE9A 1ZXIA 5AHXA 3C5FA 3TQ1A 8ICIA 5DLFA 3JPOA 4O0IA 2LYHA 4G3IA 4NLGA 2WHEA 4DCCA 4DQPA 3OGUA 2ZTDA 2HHSA 4IC9A 1WWVA 3PX4A 2W03A 4BX9C 2C28A 4DEZA 4EEYA 1MQ3A 5ALGA 3UXNA 3QUCA 2WF5A 1SL2A 2VA3A 4UAVA 4JUZA 2LYAA 5ALMA 5J2CA 2BCQA 4RNNA 3IV6A 4C0ZA 3MBYA 2CN1A 2NO4A 4F5PA 3JPRA 4F91B 3HPOA 3WKEA 1XS9D 2ZIUA 2WB1C 2A19A 7ICVA 3QZ8A 5HNKA 1JALA 1N60A 5KFQA 4NY8A 1X2IA 5ALOA 2BQRA 4Q44A 2JMGA 3BS7A 4Y2PA 9ICTA 3M9OB 5J29A 5KFIA 3C2LA 4YR3A 1OUQA 4O3NA 8ICMA 1UQVA 1PVRA 5DQHA 2W55A 3C23A 4NM2A 1X9WA 2XY7A 4ZOHC 4Y2YA 3LDAA 4FO6A 5F9NA 4XQ8A 2R8HA 5KG3A 2ZTCA 4Q43A 4DQRA 1KKXA 3SV3A 2K89A 1NJXA 2ESEA 4ICAA 1Z00B 1URJA 5EWFA 4O5KA 5KG1A 3MGIA 1L3TA 1ZQNA 1IIPA 4ECYA 2XC9A 5KFLA 8ICUA 3WKCA 3ONNA 3T5JA 3RR7A 4RNOA 3PY8A 2OYYA 4IR9A 9ICWA 4RQ8A 3A0BU 4YXJA 4DL2A 5KFCA 2KZ3A 3WK8A 2XVTA 3ISBA 2ZJAA 4ED6A 3T5KA 2DPIA 5ALJA 4DOBA 8ICLA 1S0MA 1WWUA 1RYSA 3QU2A 3UXOA 4J9RA 1XSPA 2KTQA 4QWBA 2XO7A 1FO4A 1K1QA 1ZQVA 4IL6U 1JN3A 1SWVA 3V7JA 3V6JA 5AK5A 1RZTA 3FM9A 5KFOA 2XI9A 3KZIU 3NGDA 2BR0A 3IM1A 3BQ2A 2EAOA 3EPGA 4CDGA 5KT2A 3IDWA 5AKJA 3OSPA 2ZJ5A 4UB6U 2KJ9A 2KKPA 5AK6A 3EYZA 1NK0A 3RJIA 3RFAA 5J0TA 3KD3A 4NLBA 2QB1A 2P6UA 3BS5B 4ED7A 1IM4A 1DK2A 5JUMA 1LV5A 4UB8U 5H2FU 3MDCA 2JH1A 3ED5A 2JR5A 1T3QA 4ELTA 4UB1A 2J6UA 1F44A 2XGQA 5F3XB 2KFNA 1O03A 1KLNA 4F4WA 2KK0A 5KFNA 2H3QA 5EE1A 2EAMA 2MSNA 1Z3EB 2BCUA 4QWCA 1JMSA 9ICLA 1RQNA 5AKIA 1S9FA 3TACB 5J0SA 1ZQCA 2XGPA 3GDXA 1PVPA 8ICKA 2LKYA 3C29A 4Q8EA 3PMNA 2I9GA 2W3RA 1B22A 2Q4TA 3SAHA 4US9A 2E8PA 5TISU 3C21A 2E5SA 3WK5A 9ICOA 3K75D 3TFRA 5JRTA 3S6JA 3TANA 4BGDA 1YZ6A 5KFJA 1KFDA 4UB3A 1PVQA 4RNMA 9ICBA 8ICEA 1XU4A 2KZZA 2D8CA 4CF3A 4O5CA 2ASLA 5J2EA 1IG6A 3J81j 9ICEA 3I28A 2WTFA 4C80A 3M7DA 1KFTA 1F0MA 1VLBA 2EZZA 4UW9A 3QNMA 1LVHA 4ELVA 2VJ5A 4I2EA 4KLSA 3LWLA 4IQWA 4TQSA 2HHTA 5DGAA 4KLOA 1JIHA 5D4BA 3JPNA 1QSLA 1HUZA 5CEHA 5KG2A 1Q8KA 8ICSA 1TK5A 3CYMA 1ZQDA 2JH7A 1B0XA 5KG4A 4DL5A 1DGJA 2YX8A 3PX0A 1SXEA 2K4EA 2PKEA 2CXYA 5KFSA 4M2YA 7ICEA 4DS5A 3TADA 2C22A 1UA1A 2RDJA 2I1QA 1X9XA 4F93B 3BDPA 3KHLA 2W3SA 3F2DA 3H8JA 1ZQPA 4NLZA 3HX0A 3NRWA 2WAQC 2E8NA 5J0XA 2F44A 1ZD5A 2EANA 4IQTA 3GIKA 3Q8LA 1IXRA 1T4GA 2RQ5A 3RJFA 4O3MA 1ZD2P 3RF9A 4NM1A 5J0UA 5KTQA 4RQMA 8ICZA 2AXTU 4DFMA 8ICHA 3QEAZ 3M8RA 1XSLA 1DOQA 3D6JA 2F77X 5ALWA 4Z6EA 4RT2A 1L8LA 5KT6A 5T14A 2H3ZA 1S8OA 1L7PA 1S97A 3M1YA 5EWGA 3BQ0A 2IA6A 3GV5B 1BPZA 2BGWA 2BPGA 2MU2A 4UAUA 2A1JB 2FLLA 3AL0B 2V4RA 1PK1B 1JI7A 3TAQA 3IG8A 5G5HA 3NS1A 4F71A 5CB1A 1N62A 4EYHB 2F1JA 4DFDA 1JROA 3RAQA 4JMUA 4ECQA 2I5HA 2MAXA 5B66U 5DB8A 3EWAA 2YY6A 2Y9UA 3WK7A 3QX7A 3B9JA 3ETRA 2ZIVB 3BZKA 3IP4B 4KLLA 4LJXA 1MA7A 4QWDA 4F5NA 3AU6A 3RB4A 4ED3A 2PMZF 2YMPA 2W9MA 3KZXA 9ICGA 2MRLA 2ZIWB 4KN7A 2R8GA 2YMMA 3RTVA 4B9TA 1BGXT 7ICKA 5L1MA 5BOMA 2AQ4A 5AM5A 9ICCA 3TARA 4J9KA 4QZFA 1XO0A 2HDOA 5KFYA 4HYKA 4Y2XA 3PW0A 4DL7A 2B0CA 3ALRA 3RJHA 3FDSA 1KL9A 2R8KA 2QB0A 4GFJA 2VJ4A 2HOFA 1KW4A 2JEFA 3FYHA 3KTQA 1ZQAA 4CCHA 4PL1A 3JPTA 2HBKA 5J0QA 4EYIB 2KOBA 2OEHA 1DGSA 4NV0A 1N48A 2KIWA 5CP2A 2Y1IA 3RRHA 4K4IA 3SD7A 4R65A 3N4MB 5KFMA 5IIKA 4BXOA 5AI0A 2HHVA 2GWSA 1HIWA 1QQ7A 1SKSA 4PGXA 5ALEA 4CE6A 5J0PA 2W7PA 2HVIA 3NRZA 5KG6A 4EEKA 5J2DA 2HBLA 8ICBA 2G06A 1ZQ1C 1U48A 4F50A 7ICSA 4BDPA 2JXJA 5K4LA 4CGZA 4R64A 4DL3A 3HILA 1J97A 2W04A 4PL2A 1A76A 1RXWA 4DLGA 8ICRA 1BNPA 5AK4A 3HWTA 4XA5A 1N2XA 1BVSA 4NWIA 7ICNA 4FZMA 3H0MB 4RUAA 3RJKA 4K4HA 4JWNA 4NXZA 4KMOB 1NI3A 1V85A 1KTQA 2ZXIA 5AK3A 3V6HA 4ED1A 4M9HA 8ICVA 2GO7A 2MUTA 4F4XA 2ISPA 5DDMA 4TURA 4B9MA 2HOQA 4JWMA 3ZI4A 4MFCA 1RG6A 3JPQA 4DO9A 4GC7A 4YP3A 3G6YA 1TAUA 2ASJA 5CRXA 1L8OA 3N7RC 4UQGA 3E0FA 4OJLA 2KHQA 5KT3A 2LM1A 2XCPA 1SZHA 2HSZA 4OJ5A 2JV3A 2HW3A 2ES6A 4F2RA 2KE7A 2C2DA 5KFXA 1KBUA 3OPXA 3M6KA 2ALZA 1KSPA 3KHRA 4QW8A 4EENA 2J6TA 4C8NA 4MFFA 2G0AA 4PZOA 8ICNA 4Z6CA 5J2AA 4O3OA 1SV4A 2W7OA 4UAWA 3E58A 2XCAA 1SV0A 4NLNA 4GC6A 1KRPA 2K8AA 3C1ZA 4KTQA 2NV3A 2G5IB 1A0PA 1AQ6A 3RBDA 1SL0A 2ASDA 2IHNA 2JZBB 3PSIA 5AI9A 3QZ7A 4Y2RA 4M9GA 2C2EA 4M9JA 3KHGA 4EBDA 5HP4A 1H38A 3TI0A 7ICLA 4RQ4A 1QSSA 3AN1A 1V9PA 1NK9A 5ALVA 5TZVA 3ZDBA 5ALZA 2RP5A 2HVHA 2W9CB 2DF4B 2UVWA 2JHDA 3HRDD 3H4BA 2WF6A 3ZDDA 3SZ2A 1ZQIA 1QH9A 2ZJ8A 2M0NA 1SL1A 4RT3A 3C28A 2QARA 5BPCA 8ICAA 2DBYA 1WG8A 1NK8A 2YN4A 1TVAA 5KFZA 9ICXA 4YMOA 1Q3VA 3UPQA 3T3FA 1QSYA 2HI0A 4M6WB 5DQIA 2CRXA 4LVSA 9ICRA 4ED0A 4KLTA 4QJFB 3L3FX 2JRZA 3IG5A 2BKEA 1O08A 3FAHA 1T94A 2MUTB 5DBAA 3HKZF 2R18A 3JPSA 5J0YA 1XWLA 5KG0A 3RJGA 4YMNA 2PXIA 4DSIA 9ICVA 2DWQA 4LZDA 1L7OA 2YTUA 3SAFA 4RQ5A 4DWIA 7ICIA 2CPRA 2YMQA 7ICTA 2HHQA 5AM2A 4Y2UA 3UMCA 1D8BA 4DOAA 1MSWD 3EW9A 1D9DA 3LVVA 3D2NA 2XY5A 1GO3F 4IRDA 4I2HA 1Y88A 3RBEA 1LKYB 5KL8B 4AYBF 4IQUA 4QZ9A 1NK7A 5AM1A 3U26A 4F92B 3D2QA 4GLXA 4I2CA 4QZCA 1ZQHA 3L4PA 4YD1A 5KFHA 1N63A 3AU2A 1OXJA 4F5QA 5L9XA 3QE9Y 3MR5A 3MFHA 1NNLA 5KFGA 1X9SA 4R8UB 2KVCA 3RB3A 4EX6A 4F4YA 5AIAA 4KLJA 3ZDAA 1D9FA 4F2SA 3PW5A 4M9LA 4FFDA 5AKLA 1QTMA 4QIWC 5KG7A 4TQRA 8ICJA 4F5RA 5ALHA 3WK9A 5J2KA 4J9PA 7ICFA 2PFNA 1AROP 3PV8A 1SZPA 5DG9A 4RQNA 2F8LA 3LWMA 1ZQRA 3HT3A 5ALPA 3H0RB 2YB1A 3IRUA 2I6XA 3R9KA 3GZFA 1FFVA 4QZ8A 2DPJA 4OO1J 4OJ6A 4NJ8A 3SR6A 2XICA 1JUDA 2AGPA 4ECVA 4R63A 1NJZA 4P4OA 4GXJA 2ODGA 2G07A 4ECZA 1SKWA 3ZD8A 1U9LA 4USAA 5DB9A 3M9MB 4XRHA 2DGZA 2AU0A 9ICMA 1ZQGA 8ICGA 2HCFA 4B9VA 4F5OA 2P35A 2BQUA 1HEKA 4ECWA 2G09A 2ZUDA 5KL1B 1KFSA 2KNJA 3Q8QB 5AICA 1N56A 4KX3A 1N5WA 2GOLA 1C20A 5AKHA 4F4ZA 5AM3A 4PH5A 4B9UA 3RJEA 5AKKA 4KX5A 5L1LA 2AHOB 3H40A 2Y0SC 3Q8PB 3OJUA 4YG2A 2HHXA 1NOMA 4Y2JA 8ICPA 3NVWA 1D8YA 3NTUA 3AMZA 3MGHA 2LYBA 3M9NB 4LZGA 4QZAA 2YB4A 2P6RA 4C8OA 3ISCA 1ZQJA 4TUSA 4J9OA 2MA1A 1BPXA 4Q45A 4C7ZA 2K4HA 2NRTA 5EWEA 9ICSA 4ECUA 1Z19A 4UBBA 2V9WA 1NKCA 1ED1A 4O3SA 3BQ7A 4TUPA 2EZXA 3ZDEA 2HBJA 5KT4A 4J9QA 2H3VA 3TAPA 4RU9A 5DG8A 4FBUA 9ICKA 4DOCA 4M0AA 4NLKA 2HOIA 3ZDCA 3KBBA 4PHDA 3EPIA 2DKXA 4FZNA 2C2RA 1Z4OA 3C5GA 3FC4A 1Z1BA 5ALRA 1MN8A 1BNOA 4RPYA 1D8LA 4G9BA 4P0QA 5L1KA 2W8LA 2IHMA 4EBEA 2B6GA 5HR7A 5IIIA 1HJPA 1MQ2A 1NZBA 2BQ3A 3PSFA 3OTQA 2GLEA 3K1RB 4Z6FA 2F76X 4OJOA 2K8BB 4UB2A 3T5LA 1UCVA 1VJ5A 2XIDA 1ZJMA 4C8KA 1S5LU 2FLPA 1TAQA 4YR2A 4ECXA 3UM9A 4DF8A 3NUQA 4AYBC 4UATA 2FJ6A 2F1HA 2KVSA 3THVA 2UVVA 5KNIA 1S10A 4F72A 5EE0A 4XUSA 3WK4A 1FIQA 2VIXA 1UA0A 8ICTA 2KSOB 1DXSA 2F8KA 9ICIA 3GFKB 5KFKA 2AJQA 2KJ8A 4PGQA 4MF2A 1KEJA 4DFPA 1L3SA 4ED2A 2JGAA 4ACOA 2OH2A 4QZDA 4MHVA 2UVUA 4DFKA 2R8JA 5DLGA 4B6JA 2OWOA 4C4TA 2M9NA 4QZHA 2KN7A 3SYZA 4UAZA 4RQ1A 5ALXA 4R66A 4PHPA 2Y0SF 5AKYA 4F8RA 1L3VA 5AM0A 3SEIA 3ORYA 1V97A 2DKZA 3PMLA 3TKAA 4TUQA 5KT5A 2FPMA 4O3RA 4WJ3B 1ZQTA 5AI8A 3T5HA 1QLNA 5GTHU 2H3IA 3SAGA 4UB4A 1BPEA 4DF4A 4O3PA 5CA7A 3PO5A 4BUGA 1UHUA 5AKEA 2E1EA 4KLUA 3B0YA 4UB5A 1U4BA 5A0LA 3QXGA 4EELA 1ZYQA 4YN4A 3L5KA 4RUCA 4I2GA 3K1ZA 5D49A 3KKAC 1WYGA 2VA8A 2ZTEA 1XC9A 1NKEA 2QLTA 2OM6A 3G6VA 4F3OA 2KD1A 4JV0A 2NRZA 1N5XA 1MC8A 5ALDA 1QQ6A 3UXPA 1QQ5A 4CF4A 3WKAA 4OCZA 1T3NA 5IILA 3H8WA 3PX6A 3QU9A 1L3UA 1RXVA 2DUYA 2VANA 3RB6A 5KFUA 2BCSA 1NKBA 2A3VA 9ICHA 2ZXHA 4Y2SA 2RRDA 5IIOA 1LB2B 4NL9C 1VDVA 4CF5A 3HKZC 4I27A 5J2JA 3HJEA 4C7YA 3UMBA 1ZQWA 5IINA 1T7PA 2DFLA 4QWEA 1PZNA 2HBMA 4IR1A 3ZD9A 5J0OA 1RM6C 3DDHA 3GU3A 4KLGA 1PK3A 4IRKA 2W43A 3NVZA 5JTIA 2QKQA 3OHAA 9ICNA 4JV2A 4Y2QA 3UMGA 3WKBA 4QWAA 2QB0B 3TADC 4MEYA 4RQ7A 4CNQA 1HUOA 2L5YA 5ALUA 3MDAA 5GTIU 4KLIA 3WKDA 3BZCA 1ZETA 2BPFA 2AH5A 4NLCA 1S0VA 5HMMA 4QZIA 4QNLA 7ICGA 2PMZC 3QUTA 4RPZA 5J8YC 2LM4A 1OW5A 1NK6A 7ICJA 5ALLA 4UBCA 1Z4NA 4B9SA 1KN5A 5AI6A 4P4PA 2OXOA 4R8UA 4DQSA 5AIBA 4QIWF 2KFZA 3PW7A 2E8OA 1KQQA 4X5VA 4DSJA 4KLDA 3NASA 1CRXA 3LK9A 3JPPA 5KFWA 1ECWA 1ZQSA 4UAYA 4DQIA 4DS4A 3E2EA 5FP0A 3MC1A 5KAIU 4DSFA 4YCXA 2FDRA 1RYUA 2ZIXB 7ICHA 5EOZA 2FE9A 3QU4A 3RB0A 2GH1A 3BQ1A 2D6FC 5ALTA 3HW8A 5KFFA 5J2FA 5DBBA 1ZQFA 4DSKA 2JEIA 1SIJA 4C4SA 4JV1A 4I2FA 5IIMA 2E8MA 5KG5A 3T79A 2K4PA 3MR2A 3EUB2 2DQNB 5CWRA 3PNCA 3NVYA 4P2HA 2W54A 5J2GA 1ZQOA 2NRWA 1WCLA
chains in the Genus database with same CATH topology
1TAMA 3F2CA 2H3VA 2Y0SF 2KKVA 2ZIUB 2F8LA 2KEYA 2K8CB 1SZHA 2E1FA 2CRXA 4OJ5A 3AL0B 3IN5A 2HOIA 4P0QB 3AQEA 4CRXA 3H0RB 2N1RA 3M7DA 3IG8A 2LBOA 2YB1A 4QJFB 3PSTA 1KBUA 1HIWA 2LYAA 3M6KA 3L3FX 3OPXA 4NLCA 3GZFA 2G5HB 2RHFA 2XI9A 2VJ5A 4JMUA 4C0ZA 2W7PA 1P7DA 3DEEA 3IG5A 4FZNA 4WJ3B 2CN1A 4OO1J 4QNLA 2PMZC 4OJ6A 2KICA 3LVWA 1Q3UA 4CDGA 3SQIA 2G0AA 1Z1BA 2XICA 2H3IA 2HBLA 3SAGA 1T94A 2G06A 4P0QA 1ZQ1C 2KJ9A 2ZIVB 2R18A 3CYMA 2KKPA 3HKZF 2W7OA 3CRXA 3IP4B 4FE3A 2JH7A 4BUGA 3RFAA 2ZIUA 2OXOA 1MA7A 5HR7A 2G07A 2E1EA 2WB1C 4CGZA 5A0LA 2PMZF 1NZBA 4NLBA 3F2BA 3H0LB 3PSFA 4QIWF 2YX8A 2K8AA 2F76X 2W04A 4OJOA 4PL2A 2K8BB 3SAFA 1L6NA 2K4EA 2WB1F 2BDUA 2DGZA 2NV3A 3K1ZA 2CPRA 3KZXA 2G5IB 1A0PA 1CRXA 2JH1A 2XIDA 1A6SA 2JMGA 2MRLA 3F53A 1ECWA 2ZIWB 4A8EA 1D8BA 3LYSA 2OM6A 2ZIVA 3LVVA 3NUQA 4AYBC 3D2NA 2ZIWA 4NWIA 1GO3F 1HEKA 2KD1A 4FZMA 2G09A 3H0MB 4BJQA 1OUQA 3PSIA 1F44A 5HR6A 5KL1B 5KL8B 3CP8A 2KNJA 2KV2A 4AYBF 1PVRA 3PZPA 4OJPA 4U6PA 2H3QA 4KMOB 3F2DA 4KX3A 1XO0A 2GOLA 3F5AA 3VCBA 2ZXIA 1WUDA 2VIXA 2VKQA 2ZIXB 3F5EA 3D2QA 3NRWA 2WAQC 3M6ZA 2GH1A 1UPHA 2A3VA 3ALRA 2D6FC 3N7SC 2KJ5A 2ZXHA 2RRDA 3VC8A 4KX5A 4U7CA 2G08A 2K89A 4GFJA 2VJ4A 1YT3A 3HKZC 2KJ8A 4O3MA 2HOFA 3PSPA 2RP5A 2Y0SC 4ICAA 3RF9A 1PVPA 4FZLA 1URJA 2LKYA 2HOQA 2DF4B 2LHTA 3C29A 2JHDA 3MGVA 2H3FA 2KVCA 2LYBA 1IIPA 3ICXA 2YB4A 3N7PD 3SMVA 2Q4TA 3SAHA 4P0PB 2HBMA 3ONNA 2M0NA 2JGAA 3C28A 4ACOA 2MA1A 2OYYA 3AQFA 3GU3A 2F77X 3T79A 2OH2A 2HMXA 2K4HA 2Z7JA 2HBKA 3O0FA 2DQNB 4PL1A 4P0PA 2E5SA 5C0YA 2KOBA 2XVTA 2ZIXA 1Z19A 3D2SA 3KFUF 2WAQF 5T14A 1ED1A 2H3ZA 4IC9A 4QIWC 4NV0A 5CRXA 3N7RC 2KIWA 3E0FA 1XNSA 1DRGA 2HBJA 2KHVA 2W03A 2F2AB 2KHQA 2K4IA 2ZG6A 4OJLA 4BX9C 1PVQA 1Q3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIC A; 
#chains in the Genus database with same CATH topology
 4I2D A;  1TAM A;  5J2B A;  3BQT A;  2R8I A;  3PW4 A;  1XSN A;  3IN5 A;  5EE3 A;  4P0Q B;  2N1R A;  2XY6 A;  5DDY A;  3EZ5 A;  3MAB A;  2JEG A;  2D3D A;  2RDI A;  4MF8 A;  1L7M A;  4KLM A;  2YQE A;  5KFT A;  5KFD A;  1ZD4 A;  4YQW A;  8ICO A;  3B0X A;  1S77 D;  4FS1 A;  1B43 A;  1ZOL A;  4FE3 A;  4AP9 A;  4Y2V A;  2A1J A;  3MFI A;  4Z6D A;  3H0L B;  4I2B A;  4EBC A;  3Q8S B;  2LMR A;  2WB1 F;  3SEN A;  1BPD A;  8ICY A;  1S76 D;  4A8E A;  5ALY A;  4FS2 A;  2ZIW A;  3AEV A;  4QZG A;  9ICA A;  4BJQ A;  5HR6 A;  4ECT A;  2AGO A;  3CP8 A;  4RQ2 A;  3PZP A;  2W9B A;  3V6K A;  3RH5 A;  3F5E A;  2HHU A;  2DL0 A;  5IIJ A;  1T8E A;  1UPH A;  5ALS A;  3N7S C;  4YXM A;  3H4D A;  3DV9 A;  3G6X A;  9ICJ A;  2W11 A;  3IHQ B;  1U49 A;  2IOF A;  2EH9 A;  4EX7 A;  3PSP A;  4KMU A;  5F9L A;  4RZR A;  1L5U A;  2A1A A;  2LHT A;  2BPC A;  3ETL A;  2KIV A;  2AQ0 A;  5CHG A;  1TK0 A;  4B9N A;  2H3F A;  1U47 A;  2Q0Z X;  5L1I A;  1N61 A;  1NK5 A;  4P0P B;  5DB6 A;  3AQF A;  2HMX A;  2Z7J A;  1ZQU A;  4F4K A;  3H7I A;  2FI1 A;  1JX4 A;  7ICO A;  2FMQ A;  4ZH4 A;  3GIJ A;  3NVV A;  1DRG A;  2KHV A;  2ZG6 A;  2OHF A;  2PI5 A;  1SXD A;  2KZM A;  3I76 A;  2FMS A;  2K60 A;  4J9L A;  3WU2 U;  2K8C B;  2E1F A;  5HHI A;  4C4R A;  3N28 A;  1X6J A;  2LBO A;  4CRX A;  1V38 A;  2LPE A;  4QZB A;  1RPL A;  8ICQ A;  2J6S A;  5DGB A;  2HHW A;  2G5H B;  2YML A;  4DQQ A;  3DEE A;  9ICF A;  3MR3 A;  2RLT A;  1TFR A;  3LVW A;  3SQI A;  8ICW A;  4KLF A;  1FEZ A;  4P4M A;  1X66 A;  5ALN A;  9ICU A;  4ELU A;  5J2I A;  4OD0 A;  4M9N A;  3Q8K A;  5E79 U;  4O5E A;  2EZY A;  2O6K A;  4DLE A;  1SGG A;  4YR0 A;  2NRX A;  1KDH A;  4I2I A;  4UAR A;  2JZB A;  1C7Y A;  1B4F A;  3SI8 A;  3GIM A;  3WK6 A;  5G5G A;  3N97 B;  8ICF A;  7ICU A;  5CR0 A;  1CEZ A;  4YD2 A;  1X9M A;  2Y1J A;  4C8L A;  1WUD A;  4PHE A;  5JU5 A;  3M6Z A;  2WFA A;  5C5J A;  5B5E U;  4I28 A;  5AI5 A;  4U7C A;  2ISO A;  3M8S A;  4I2A A;  5KFE A;  1Z00 A;  4QW9 A;  2IMW P;  2P66 A;  4PPX A;  1LKY A;  1M6Y A;  4NL9 A;  1RYR A;  3QYP A;  3GII A;  1NZP A;  5AI4 A;  1RQL A;  1X40 A;  4M47 A;  2FPL A;  4BWM A;  3QEB Z;  2ZIX A;  1XO1 A;  3GIL A;  2VA2 A;  3Q8M A;  4J9N A;  5D46 A;  3BS5 A;  2W9C A;  4DFJ A;  4KLQ A;  2W9A A;  2F2A B;  2K4I A;  4MFA A;  4IRC A;  4KLE A;  1ZJN A;  2KEY A;  1L7N A;  2KMD A;  2F1I A;  3Q8R B;  5KFP A;  1X42 A;  1Q46 A;  2RHF A;  1SB3 C;  4RQ3 A;  1ZD3 A;  1BPY A;  4RQ0 A;  3AUO A;  5DKW A;  1ZQB A;  4GXI A;  4B9L A;  8ICC A;  5ALK A;  3A0H U;  3CRX A;  1TK8 A;  2FLN A;  2NRV A;  3C1Y A;  4Q8F A;  3GQC A;  5HML A;  1EXN A;  1L6N A;  5DB7 A;  3UQ0 A;  1A6S A;  2IBK A;  3C2M A;  3AM9 A;  5KT7 A;  4O3Q A;  4GXK A;  5DBC A;  4I2J A;  5AKZ A;  3GV7 B;  3MR6 A;  3OHB A;  5J8Y A;  5J0R A;  1PUZ A;  4OJP A;  3PVX A;  1RDF A;  1S0O A;  3K4G A;  3VCB A;  7ICQ A;  4PJ0 U;  3TFS A;  4EZ6 A;  3OJS A;  2BZF A;  4J03 A;  4JB3 A;  2E3T A;  2G08 A;  1YT3 A;  4RQ6 A;  4FZL A;  1COO A;  2V4Q A;  3RAX A;  5DQG A;  3MGV A;  5J2H A;  4ECS A;  1J2N A;  3N7P D;  5AKX A;  5AM4 A;  5KAF U;  2ZUC A;  3O0F A;  4YVZ A;  2KG5 A;  5KFB A;  3D2S A;  2WAQ F;  4I29 A;  2FMP A;  1ZRM A;  1ZQL A;  1XNS A;  2IOH A;  5J0W A;  5AKG A;  1CI4 A;  5KFV A;  1JXL A;  1DK3 A;  3F2C A;  3PR5 B;  3RJJ A;  2KKV A;  4KLH A;  2ZIU B;  7ICM A;  2FPK A;  1Z1V A;  2WF9 A;  3H8S A;  3AQE A;  5BOL A;  1WCN A;  3GV8 B;  3PST A;  1ZQM A;  3OSN A;  2AGQ A;  1P7D A;  9ICQ A;  4M04 A;  1SV0 C;  4ECR A;  4PGY A;  4EZ9 A;  1K5O A;  3H8M A;  4O9M A;  3QUB A;  1PK1 A;  2EDU A;  1ZQK A;  3KKA A;  2KSO A;  3V7K A;  1K1S A;  2W9B B;  3QU5 A;  1ZQQ A;  3V7L A;  1COK A;  3I1Y A;  1TE2 A;  4J9S A;  4IS7 A;  4QZE A;  2WF8 A;  3PR4 A;  3RH4 A;  4E0D A;  3F53 A;  3LYS A;  2ZUB A;  1NK4 A;  9ICP A;  2ZIV A;  5ALQ A;  2LI6 A;  4DL6 A;  2KV2 A;  2ATL A;  4KIT B;  4U6P A;  1CUK A;  3SV4 A;  7ICP A;  4MEX A;  2BDP A;  1ZRN A;  4Y2T A;  5DG7 A;  2F3N A;  3UQ2 A;  2KJ5 A;  2BHN A;  3VC8 A;  5ALI A;  2NO5 A;  5CJ7 A;  1JRP A;  4C8M A;  4DSE A;  3CNH A;  4HAI A;  1QCK A;  1NJW A;  4DL4 A;  3ICX A;  3SMV A;  1YZ7 A;  4YMM A;  2H5X A;  1A77 A;  1SWW A;  4GIB A;  4ED8 A;  4P0P A;  5C0Y A;  4YFK A;  4US8 A;  3KFU F;  1UT5 A;  1TV9 A;  2B21 A;  2PFP A;  8ICX A;  2EQY A;  5HHH A;  1S0N A;  1TKD A;  4PZN A;  4DSL A;  2PI4 A;  1ZQZ A;  1IV8 A;  3QU7 A;  1J2M A;  3RH6 A;  1UT8 A;  2JEJ A;  1F5S A;  1ZQX A;  4IQV A;  2UVR A;  1ZQY A;  5ALF A;  3RR8 A;  4PHA A;  2OCE A;  2KIC A;  1Q3U A;  4BWJ A;  3C2K A;  2KP7 A;  3PW2 A;  3ISD A;  2W8K A;  2Y9T A;  7ICR A;  3KOO A;  4JK1 A;  3F2B A;  1U45 A;  1NJY A;  4J9M A;  3RRG A;  4KN4 A;  1FFU A;  2BDU A;  2IOF K;  1ZQE A;  4FBT A;  5KFA A;  2BCR A;  4K4G A;  3QUQ A;  1JXE A;  2QAR B;  3KHH A;  2PFO A;  2BCV A;  3F5A A;  2EAP A;  2VKQ A;  2NYV A;  2PFQ A;  3V72 A;  1BPB A;  4BXO B;  3HP6 A;  3PO4 A;  4UAS A;  4RPX A;  4M6W A;  5L1J A;  1X6I A;  3BJY A;  1SKR A;  5KFR A;  3CW2 C;  2WF7 A;  5EE9 A;  1ZXI A;  5AHX A;  3C5F A;  3TQ1 A;  8ICI A;  5DLF A;  3JPO A;  4O0I A;  2LYH A;  4G3I A;  4NLG A;  2WHE A;  4DCC A;  4DQP A;  3OGU A;  2ZTD A;  2HHS A;  4IC9 A;  1WWV A;  3PX4 A;  2W03 A;  4BX9 C;  2C28 A;  4DEZ A;  4EEY A;  1MQ3 A;  5ALG A;  3UXN A;  3QUC A;  2WF5 A;  1SL2 A;  2VA3 A;  4UAV A;  4JUZ A;  2LYA A;  5ALM A;  5J2C A;  2BCQ A;  4RNN A;  3IV6 A;  4C0Z A;  3MBY A;  2CN1 A;  2NO4 A;  4F5P A;  3JPR A;  4F91 B;  3HPO A;  3WKE A;  1XS9 D;  2ZIU A;  2WB1 C;  2A19 A;  7ICV A;  3QZ8 A;  5HNK A;  1JAL A;  1N60 A;  5KFQ A;  4NY8 A;  1X2I A;  5ALO A;  2BQR A;  4Q44 A;  2JMG A;  3BS7 A;  4Y2P A;  9ICT A;  3M9O B;  5J29 A;  5KFI A;  3C2L A;  4YR3 A;  1OUQ A;  4O3N A;  8ICM A;  1UQV A;  1PVR A;  5DQH A;  2W55 A;  3C23 A;  4NM2 A;  1X9W A;  2XY7 A;  4ZOH C;  4Y2Y A;  3LDA A;  4FO6 A;  5F9N A;  4XQ8 A;  2R8H A;  5KG3 A;  2ZTC A;  4Q43 A;  4DQR A;  1KKX A;  3SV3 A;  2K89 A;  1NJX A;  2ESE A;  4ICA A;  1Z00 B;  1URJ A;  5EWF A;  4O5K A;  5KG1 A;  3MGI A;  1L3T A;  1ZQN A;  1IIP A;  4ECY A;  2XC9 A;  5KFL A;  8ICU A;  3WKC A;  3ONN A;  3T5J A;  3RR7 A;  4RNO A;  3PY8 A;  2OYY A;  4IR9 A;  9ICW A;  4RQ8 A;  3A0B U;  4YXJ A;  4DL2 A;  5KFC A;  2KZ3 A;  3WK8 A;  2XVT A;  3ISB A;  2ZJA A;  4ED6 A;  3T5K A;  2DPI A;  5ALJ A;  4DOB A;  8ICL A;  1S0M A;  1WWU A;  1RYS A;  3QU2 A;  3UXO A;  4J9R A;  1XSP A;  2KTQ A;  4QWB A;  2XO7 A;  1FO4 A;  1K1Q A;  1ZQV A;  4IL6 U;  1JN3 A;  1SWV A;  3V7J A;  3V6J A;  5AK5 A;  1RZT A;  3FM9 A;  5KFO A;  2XI9 A;  3KZI U;  3NGD A;  2BR0 A;  3IM1 A;  3BQ2 A;  2EAO A;  3EPG A;  4CDG A;  5KT2 A;  3IDW A;  5AKJ A;  3OSP A;  2ZJ5 A;  4UB6 U;  2KJ9 A;  2KKP A;  5AK6 A;  3EYZ A;  1NK0 A;  3RJI A;  3RFA A;  5J0T A;  3KD3 A;  4NLB A;  2QB1 A;  2P6U A;  3BS5 B;  4ED7 A;  1IM4 A;  1DK2 A;  5JUM A;  1LV5 A;  4UB8 U;  5H2F U;  3MDC A;  2JH1 A;  3ED5 A;  2JR5 A;  1T3Q A;  4ELT A;  4UB1 A;  2J6U A;  1F44 A;  2XGQ A;  5F3X B;  2KFN A;  1O03 A;  1KLN A;  4F4W A;  2KK0 A;  5KFN A;  2H3Q A;  5EE1 A;  2EAM A;  2MSN A;  1Z3E B;  2BCU A;  4QWC A;  1JMS A;  9ICL A;  1RQN A;  5AKI A;  1S9F A;  3TAC B;  5J0S A;  1ZQC A;  2XGP A;  3GDX A;  1PVP A;  8ICK A;  2LKY A;  3C29 A;  4Q8E A;  3PMN A;  2I9G A;  2W3R A;  1B22 A;  2Q4T A;  3SAH A;  4US9 A;  2E8P A;  5TIS U;  3C21 A;  2E5S A;  3WK5 A;  9ICO A;  3K75 D;  3TFR A;  5JRT A;  3S6J A;  3TAN A;  4BGD A;  1YZ6 A;  5KFJ A;  1KFD A;  4UB3 A;  1PVQ A;  4RNM A;  9ICB A;  8ICE A;  1XU4 A;  2KZZ A;  2D8C A;  4CF3 A;  4O5C A;  2ASL A;  5J2E A;  1IG6 A;  3J81 j;  9ICE A;  3I28 A;  2WTF A;  4C80 A;  3M7D A;  1KFT A;  1F0M A;  1VLB A;  2EZZ A;  4UW9 A;  3QNM A;  1LVH A;  4ELV A;  2VJ5 A;  4I2E A;  4KLS A;  3LWL A;  4IQW A;  4TQS A;  2HHT A;  5DGA A;  4KLO A;  1JIH A;  5D4B A;  3JPN A;  1QSL A;  1HUZ A;  5CEH A;  5KG2 A;  1Q8K A;  8ICS A;  1TK5 A;  3CYM A;  1ZQD A;  2JH7 A;  1B0X A;  5KG4 A;  4DL5 A;  1DGJ A;  2YX8 A;  3PX0 A;  1SXE A;  2K4E A;  2PKE A;  2CXY A;  5KFS A;  4M2Y A;  7ICE A;  4DS5 A;  3TAD A;  2C22 A;  1UA1 A;  2RDJ A;  2I1Q A;  1X9X A;  4F93 B;  3BDP A;  3KHL A;  2W3S A;  3F2D A;  3H8J A;  1ZQP A;  4NLZ A;  3HX0 A;  3NRW A;  2WAQ C;  2E8N A;  5J0X A;  2F44 A;  1ZD5 A;  2EAN A;  4IQT A;  3GIK A;  3Q8L A;  1IXR A;  1T4G A;  2RQ5 A;  3RJF A;  4O3M A;  1ZD2 P;  3RF9 A;  4NM1 A;  5J0U A;  5KTQ A;  4RQM A;  8ICZ A;  2AXT U;  4DFM A;  8ICH A;  3QEA Z;  3M8R A;  1XSL A;  1DOQ A;  3D6J A;  2F77 X;  5ALW A;  4Z6E A;  4RT2 A;  1L8L A;  5KT6 A;  5T14 A;  2H3Z A;  1S8O A;  1L7P A;  1S97 A;  3M1Y A;  5EWG A;  3BQ0 A;  2IA6 A;  3GV5 B;  1BPZ A;  2BGW A;  2BPG A;  2MU2 A;  4UAU A;  2A1J B;  2FLL A;  3AL0 B;  2V4R A;  1PK1 B;  1JI7 A;  3TAQ A;  3IG8 A;  5G5H A;  3NS1 A;  4F71 A;  5CB1 A;  1N62 A;  4EYH B;  2F1J A;  4DFD A;  1JRO A;  3RAQ A;  4JMU A;  4ECQ A;  2I5H A;  2MAX A;  5B66 U;  5DB8 A;  3EWA A;  2YY6 A;  2Y9U A;  3WK7 A;  3QX7 A;  3B9J A;  3ETR A;  2ZIV B;  3BZK A;  3IP4 B;  4KLL A;  4LJX A;  1MA7 A;  4QWD A;  4F5N A;  3AU6 A;  3RB4 A;  4ED3 A;  2PMZ F;  2YMP A;  2W9M A;  3KZX A;  9ICG A;  2MRL A;  2ZIW B;  4KN7 A;  2R8G A;  2YMM A;  3RTV A;  4B9T A;  1BGX T;  7ICK A;  5L1M A;  5BOM A;  2AQ4 A;  5AM5 A;  9ICC A;  3TAR A;  4J9K A;  4QZF A;  1XO0 A;  2HDO A;  5KFY A;  4HYK A;  4Y2X A;  3PW0 A;  4DL7 A;  2B0C A;  3ALR A;  3RJH A;  3FDS A;  1KL9 A;  2R8K A;  2QB0 A;  4GFJ A;  2VJ4 A;  2HOF A;  1KW4 A;  2JEF A;  3FYH A;  3KTQ A;  1ZQA A;  4CCH A;  4PL1 A;  3JPT A;  2HBK A;  5J0Q A;  4EYI B;  2KOB A;  2OEH A;  1DGS A;  4NV0 A;  1N48 A;  2KIW A;  5CP2 A;  2Y1I A;  3RRH A;  4K4I A;  3SD7 A;  4R65 A;  3N4M B;  5KFM A;  5IIK A;  4BXO A;  5AI0 A;  2HHV A;  2GWS A;  1HIW A;  1QQ7 A;  1SKS A;  4PGX A;  5ALE A;  4CE6 A;  5J0P A;  2W7P A;  2HVI A;  3NRZ A;  5KG6 A;  4EEK A;  5J2D A;  2HBL A;  8ICB A;  2G06 A;  1ZQ1 C;  1U48 A;  4F50 A;  7ICS A;  4BDP A;  2JXJ A;  5K4L A;  4CGZ A;  4R64 A;  4DL3 A;  3HIL A;  1J97 A;  2W04 A;  4PL2 A;  1A76 A;  1RXW A;  4DLG A;  8ICR A;  1BNP A;  5AK4 A;  3HWT A;  4XA5 A;  1N2X A;  1BVS A;  4NWI A;  7ICN A;  4FZM A;  3H0M B;  4RUA A;  3RJK A;  4K4H A;  4JWN A;  4NXZ A;  4KMO B;  1NI3 A;  1V85 A;  1KTQ A;  2ZXI A;  5AK3 A;  3V6H A;  4ED1 A;  4M9H A;  8ICV A;  2GO7 A;  2MUT A;  4F4X A;  2ISP A;  5DDM A;  4TUR A;  4B9M A;  2HOQ A;  4JWM A;  3ZI4 A;  4MFC A;  1RG6 A;  3JPQ A;  4DO9 A;  4GC7 A;  4YP3 A;  3G6Y A;  1TAU A;  2ASJ A;  5CRX A;  1L8O A;  3N7R C;  4UQG A;  3E0F A;  4OJL A;  2KHQ A;  5KT3 A;  2LM1 A;  2XCP A;  1SZH A;  2HSZ A;  4OJ5 A;  2JV3 A;  2HW3 A;  2ES6 A;  4F2R A;  2KE7 A;  2C2D A;  5KFX A;  1KBU A;  3OPX A;  3M6K A;  2ALZ A;  1KSP A;  3KHR A;  4QW8 A;  4EEN A;  2J6T A;  4C8N A;  4MFF A;  2G0A A;  4PZO A;  8ICN A;  4Z6C A;  5J2A A;  4O3O A;  1SV4 A;  2W7O A;  4UAW A;  3E58 A;  2XCA A;  1SV0 A;  4NLN A;  4GC6 A;  1KRP A;  2K8A A;  3C1Z A;  4KTQ A;  2NV3 A;  2G5I B;  1A0P A;  1AQ6 A;  3RBD A;  1SL0 A;  2ASD A;  2IHN A;  2JZB B;  3PSI A;  5AI9 A;  3QZ7 A;  4Y2R A;  4M9G A;  2C2E A;  4M9J A;  3KHG A;  4EBD A;  5HP4 A;  1H38 A;  3TI0 A;  7ICL A;  4RQ4 A;  1QSS A;  3AN1 A;  1V9P A;  1NK9 A;  5ALV A;  5TZV A;  3ZDB A;  5ALZ A;  2RP5 A;  2HVH A;  2W9C B;  2DF4 B;  2UVW A;  2JHD A;  3HRD D;  3H4B A;  2WF6 A;  3ZDD A;  3SZ2 A;  1ZQI A;  1QH9 A;  2ZJ8 A;  2M0N A;  1SL1 A;  4RT3 A;  3C28 A;  2QAR A;  5BPC A;  8ICA A;  2DBY A;  1WG8 A;  1NK8 A;  2YN4 A;  1TVA A;  5KFZ A;  9ICX A;  4YMO A;  1Q3V A;  3UPQ A;  3T3F A;  1QSY A;  2HI0 A;  4M6W B;  5DQI A;  2CRX A;  4LVS A;  9ICR A;  4ED0 A;  4KLT A;  4QJF B;  3L3F X;  2JRZ A;  3IG5 A;  2BKE A;  1O08 A;  3FAH A;  1T94 A;  2MUT B;  5DBA A;  3HKZ F;  2R18 A;  3JPS A;  5J0Y A;  1XWL A;  5KG0 A;  3RJG A;  4YMN A;  2PXI A;  4DSI A;  9ICV A;  2DWQ A;  4LZD A;  1L7O A;  2YTU A;  3SAF A;  4RQ5 A;  4DWI A;  7ICI A;  2CPR A;  2YMQ A;  7ICT A;  2HHQ A;  5AM2 A;  4Y2U A;  3UMC A;  1D8B A;  4DOA A;  1MSW D;  3EW9 A;  1D9D A;  3LVV A;  3D2N A;  2XY5 A;  1GO3 F;  4IRD A;  4I2H A;  1Y88 A;  3RBE A;  1LKY B;  5KL8 B;  4AYB F;  4IQU A;  4QZ9 A;  1NK7 A;  5AM1 A;  3U26 A;  4F92 B;  3D2Q A;  4GLX A;  4I2C A;  4QZC A;  1ZQH A;  3L4P A;  4YD1 A;  5KFH A;  1N63 A;  3AU2 A;  1OXJ A;  4F5Q A;  5L9X A;  3QE9 Y;  3MR5 A;  3MFH A;  1NNL A;  5KFG A;  1X9S A;  4R8U B;  2KVC A;  3RB3 A;  4EX6 A;  4F4Y A;  5AIA A;  4KLJ A;  3ZDA A;  1D9F A;  4F2S A;  3PW5 A;  4M9L A;  4FFD A;  5AKL A;  1QTM A;  4QIW C;  5KG7 A;  4TQR A;  8ICJ A;  4F5R A;  5ALH A;  3WK9 A;  5J2K A;  4J9P A;  7ICF A;  2PFN A;  1ARO P;  3PV8 A;  1SZP A;  5DG9 A;  4RQN A;  2F8L A;  3LWM A;  1ZQR A;  3HT3 A;  5ALP A;  3H0R B;  2YB1 A;  3IRU A;  2I6X A;  3R9K A;  3GZF A;  1FFV A;  4QZ8 A;  2DPJ A;  4OO1 J;  4OJ6 A;  4NJ8 A;  3SR6 A;  2XIC A;  1JUD A;  2AGP A;  4ECV A;  4R63 A;  1NJZ A;  4P4O A;  4GXJ A;  2ODG A;  2G07 A;  4ECZ A;  1SKW A;  3ZD8 A;  1U9L A;  4USA A;  5DB9 A;  3M9M B;  4XRH A;  2DGZ A;  2AU0 A;  9ICM A;  1ZQG A;  8ICG A;  2HCF A;  4B9V A;  4F5O A;  2P35 A;  2BQU A;  1HEK A;  4ECW A;  2G09 A;  2ZUD A;  5KL1 B;  1KFS A;  2KNJ A;  3Q8Q B;  5AIC A;  1N56 A;  4KX3 A;  1N5W A;  2GOL A;  1C20 A;  5AKH A;  4F4Z A;  5AM3 A;  4PH5 A;  4B9U A;  3RJE A;  5AKK A;  4KX5 A;  5L1L A;  2AHO B;  3H40 A;  2Y0S C;  3Q8P B;  3OJU A;  4YG2 A;  2HHX A;  1NOM A;  4Y2J A;  8ICP A;  3NVW A;  1D8Y A;  3NTU A;  3AMZ A;  3MGH A;  2LYB A;  3M9N B;  4LZG A;  4QZA A;  2YB4 A;  2P6R A;  4C8O A;  3ISC A;  1ZQJ A;  4TUS A;  4J9O A;  2MA1 A;  1BPX A;  4Q45 A;  4C7Z A;  2K4H A;  2NRT A;  5EWE A;  9ICS A;  4ECU A;  1Z19 A;  4UBB A;  2V9W A;  1NKC A;  1ED1 A;  4O3S A;  3BQ7 A;  4TUP A;  2EZX A;  3ZDE A;  2HBJ A;  5KT4 A;  4J9Q A;  2H3V A;  3TAP A;  4RU9 A;  5DG8 A;  4FBU A;  9ICK A;  4DOC A;  4M0A A;  4NLK A;  2HOI A;  3ZDC A;  3KBB A;  4PHD A;  3EPI A;  2DKX A;  4FZN A;  2C2R A;  1Z4O A;  3C5G A;  3FC4 A;  1Z1B A;  5ALR A;  1MN8 A;  1BNO A;  4RPY A;  1D8L A;  4G9B A;  4P0Q A;  5L1K A;  2W8L A;  2IHM A;  4EBE A;  2B6G A;  5HR7 A;  5III A;  1HJP A;  1MQ2 A;  1NZB A;  2BQ3 A;  3PSF A;  3OTQ A;  2GLE A;  3K1R B;  4Z6F A;  2F76 X;  4OJO A;  2K8B B;  4UB2 A;  3T5L A;  1UCV A;  1VJ5 A;  2XID A;  1ZJM A;  4C8K A;  1S5L U;  2FLP A;  1TAQ A;  4YR2 A;  4ECX A;  3UM9 A;  4DF8 A;  3NUQ A;  4AYB C;  4UAT A;  2FJ6 A;  2F1H A;  2KVS A;  3THV A;  2UVV A;  5KNI A;  1S10 A;  4F72 A;  5EE0 A;  4XUS A;  3WK4 A;  1FIQ A;  2VIX A;  1UA0 A;  8ICT A;  2KSO B;  1DXS A;  2F8K A;  9ICI A;  3GFK B;  5KFK A;  2AJQ A;  2KJ8 A;  4PGQ A;  4MF2 A;  1KEJ A;  4DFP A;  1L3S A;  4ED2 A;  2JGA A;  4ACO A;  2OH2 A;  4QZD A;  4MHV A;  2UVU A;  4DFK A;  2R8J A;  5DLG A;  4B6J A;  2OWO A;  4C4T A;  2M9N A;  4QZH A;  2KN7 A;  3SYZ A;  4UAZ A;  4RQ1 A;  5ALX A;  4R66 A;  4PHP A;  2Y0S F;  5AKY A;  4F8R A;  1L3V A;  5AM0 A;  3SEI A;  3ORY A;  1V97 A;  2DKZ A;  3PML A;  3TKA A;  4TUQ A;  5KT5 A;  2FPM A;  4O3R A;  4WJ3 B;  1ZQT A;  5AI8 A;  3T5H A;  1QLN A;  5GTH U;  2H3I A;  3SAG A;  4UB4 A;  1BPE A;  4DF4 A;  4O3P A;  5CA7 A;  3PO5 A;  4BUG A;  1UHU A;  5AKE A;  2E1E A;  4KLU A;  3B0Y A;  4UB5 A;  1U4B A;  5A0L A;  3QXG A;  4EEL A;  1ZYQ A;  4YN4 A;  3L5K A;  4RUC A;  4I2G A;  3K1Z A;  5D49 A;  3KKA C;  1WYG A;  2VA8 A;  2ZTE A;  1XC9 A;  1NKE A;  2QLT A;  2OM6 A;  3G6V A;  4F3O A;  2KD1 A;  4JV0 A;  2NRZ A;  1N5X A;  1MC8 A;  5ALD A;  1QQ6 A;  3UXP A;  1QQ5 A;  4CF4 A;  3WKA A;  4OCZ A;  1T3N A;  5IIL A;  3H8W A;  3PX6 A;  3QU9 A;  1L3U A;  1RXV A;  2DUY A;  2VAN A;  3RB6 A;  5KFU A;  2BCS A;  1NKB A;  2A3V A;  9ICH A;  2ZXH A;  4Y2S A;  2RRD A;  5IIO A;  1LB2 B;  4NL9 C;  1VDV A;  4CF5 A;  3HKZ C;  4I27 A;  5J2J A;  3HJE A;  4C7Y A;  3UMB A;  1ZQW A;  5IIN A;  1T7P A;  2DFL A;  4QWE A;  1PZN A;  2HBM A;  4IR1 A;  3ZD9 A;  5J0O A;  1RM6 C;  3DDH A;  3GU3 A;  4KLG A;  1PK3 A;  4IRK A;  2W43 A;  3NVZ A;  5JTI A;  2QKQ A;  3OHA A;  9ICN A;  4JV2 A;  4Y2Q A;  3UMG A;  3WKB A;  4QWA A;  2QB0 B;  3TAD C;  4MEY A;  4RQ7 A;  4CNQ A;  1HUO A;  2L5Y A;  5ALU A;  3MDA A;  5GTI U;  4KLI A;  3WKD A;  3BZC A;  1ZET A;  2BPF A;  2AH5 A;  4NLC A;  1S0V A;  5HMM A;  4QZI A;  4QNL A;  7ICG A;  2PMZ C;  3QUT A;  4RPZ A;  5J8Y C;  2LM4 A;  1OW5 A;  1NK6 A;  7ICJ A;  5ALL A;  4UBC A;  1Z4N A;  4B9S A;  1KN5 A;  5AI6 A;  4P4P A;  2OXO A;  4R8U A;  4DQS A;  5AIB A;  4QIW F;  2KFZ A;  3PW7 A;  2E8O A;  1KQQ A;  4X5V A;  4DSJ A;  4KLD A;  3NAS A;  1CRX A;  3LK9 A;  3JPP A;  5KFW A;  1ECW A;  1ZQS A;  4UAY A;  4DQI A;  4DS4 A;  3E2E A;  5FP0 A;  3MC1 A;  5KAI U;  4DSF A;  4YCX A;  2FDR A;  1RYU A;  2ZIX B;  7ICH A;  5EOZ A;  2FE9 A;  3QU4 A;  3RB0 A;  2GH1 A;  3BQ1 A;  2D6F C;  5ALT A;  3HW8 A;  5KFF A;  5J2F A;  5DBB A;  1ZQF A;  4DSK A;  2JEI A;  1SIJ A;  4C4S A;  4JV1 A;  4I2F A;  5IIM A;  2E8M A;  5KG5 A;  3T79 A;  2K4P A;  3MR2 A;  3EUB 2;  2DQN B;  5CWR A;  3PNC A;  3NVY A;  4P2H A;  2W54 A;  5J2G A;  1ZQO A;  2NRW A;  1WCL A; 
#chains in the Genus database with same CATH homology
 1TAM A;  3F2C A;  2H3V A;  2Y0S F;  2KKV A;  2ZIU B;  2F8L A;  2KEY A;  2K8C B;  1SZH A;  2E1F A;  2CRX A;  4OJ5 A;  3AL0 B;  3IN5 A;  2HOI A;  4P0Q B;  3AQE A;  4CRX A;  3H0R B;  2N1R A;  3M7D A;  3IG8 A;  2LBO A;  2YB1 A;  4QJF B;  3PST A;  1KBU A;  1HIW A;  2LYA A;  3M6K A;  3L3F X;  3OPX A;  4NLC A;  3GZF A;  2G5H B;  2RHF A;  2XI9 A;  2VJ5 A;  4JMU A;  4C0Z A;  2W7P A;  1P7D A;  3DEE A;  3IG5 A;  4FZN A;  4WJ3 B;  2CN1 A;  4OO1 J;  4QNL A;  2PMZ C;  4OJ6 A;  2KIC A;  3LVW A;  1Q3U A;  4CDG A;  3SQI A;  2G0A A;  1Z1B A;  2XIC A;  2H3I A;  2HBL A;  3SAG A;  1T94 A;  2G06 A;  4P0Q A;  1ZQ1 C;  2KJ9 A;  2ZIV B;  2R18 A;  3CYM A;  2KKP A;  3HKZ F;  2W7O A;  3CRX A;  3IP4 B;  4FE3 A;  2JH7 A;  4BUG A;  3RFA A;  2ZIU A;  2OXO A;  1MA7 A;  5HR7 A;  2G07 A;  2E1E A;  2WB1 C;  4CGZ A;  5A0L A;  2PMZ F;  1NZB A;  4NLB A;  3F2B A;  3H0L B;  3PSF A;  4QIW F;  2YX8 A;  2K8A A;  2F76 X;  2W04 A;  4OJO A;  4PL2 A;  2K8B B;  3SAF A;  1L6N A;  2K4E A;  2WB1 F;  2BDU A;  2DGZ A;  2NV3 A;  3K1Z A;  2CPR A;  3KZX A;  2G5I B;  1A0P A;  1CRX A;  2JH1 A;  2XID A;  1A6S A;  2JMG A;  2MRL A;  3F53 A;  1ECW A;  2ZIW B;  4A8E A;  1D8B A;  3LYS A;  2OM6 A;  2ZIV A;  3LVV A;  3NUQ A;  4AYB C;  3D2N A;  2ZIW A;  4NWI A;  1GO3 F;  1HEK A;  2KD1 A;  4FZM A;  2G09 A;  3H0M B;  4BJQ A;  1OUQ A;  3PSI A;  1F44 A;  5HR6 A;  5KL1 B;  5KL8 B;  3CP8 A;  2KNJ A;  2KV2 A;  4AYB F;  1PVR A;  3PZP A;  4OJP A;  4U6P A;  2H3Q A;  4KMO B;  3F2D A;  4KX3 A;  1XO0 A;  2GOL A;  3F5A A;  3VCB A;  2ZXI A;  1WUD A;  2VIX A;  2VKQ A;  2ZIX B;  3F5E A;  3D2Q A;  3NRW A;  2WAQ C;  3M6Z A;  2GH1 A;  1UPH A;  2A3V A;  3ALR A;  2D6F C;  3N7S C;  2KJ5 A;  2ZXH A;  2RRD A;  3VC8 A;  4KX5 A;  4U7C A;  2G08 A;  2K89 A;  4GFJ A;  2VJ4 A;  1YT3 A;  3HKZ C;  2KJ8 A;  4O3M A;  2HOF A;  3PSP A;  2RP5 A;  2Y0S C;  4ICA A;  3RF9 A;  1PVP A;  4FZL A;  1URJ A;  2LKY A;  2HOQ A;  2DF4 B;  2LHT A;  3C29 A;  2JHD A;  3MGV A;  2H3F A;  2KVC A;  2LYB A;  1IIP A;  3ICX A;  2YB4 A;  3N7P D;  3SMV A;  2Q4T A;  3SAH A;  4P0P B;  2HBM A;  3ONN A;  2M0N A;  2JGA A;  3C28 A;  4ACO A;  2MA1 A;  2OYY A;  3AQF A;  3GU3 A;  2F77 X;  3T79 A;  2OH2 A;  2HMX A;  2K4H A;  2Z7J A;  2HBK A;  3O0F A;  2DQN B;  4PL1 A;  4P0P A;  2E5S A;  5C0Y A;  2KOB A;  2XVT A;  2ZIX A;  1Z19 A;  3D2S A;  3KFU F;  2WAQ F;  5T14 A;  1ED1 A;  2H3Z A;  4IC9 A;  4QIW C;  4NV0 A;  5CRX A;  3N7R C;  2KIW A;  3E0F A;  1XNS A;  1DRG A;  2HBJ A;  2KHV A;  2W03 A;  2F2A B;  2KHQ A;  2K4I A;  2ZG6 A;  4OJL A;  4BX9 C;  1PVQ A;  1Q3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...