2KICA

N-nafy. n-terminal domain of nafy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
b'MVTPVNMSRETALRIALAARALPGTTVGQLLEILHQRIEGPLTEESLQGVSVTDLKIGLAGSEEDVDMLDTPMSALKDAVRILWGEAEVDSLPQPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogenase gamma subunit
publication title Biological activity and solution structure of the apo-dinitrogenase binding domain of NafY
rcsb
source organism Azotobacter vinelandii
molecule tags Protein binding,metal transport
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16844 DIMCO_N Dinitrogenase iron-molybdenum cofactor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.590 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kicA00
2KICA
chains in the Genus database with same CATH superfamily
1OUQA 4FO6A 1PUZA 4KLSA 3IP4B 1XS9D 4O3PA 1Z00A 3L3FX 7ICNA 3IHQB 4XA5A 1ZQQA 2PMZF 4BXOB 3WKAA 3FM9A 2FPMA 4U7CA 2WTFA 4KTQA 4KLOA 1ZQEA 1Z1BA 4MHVA 4YR3A 3ISDA 5AKEA 1LKYA 4PH5A 4X5VA 1KEJA 2K8AA 2J6UA 4FZLA 8ICIA 3LVVA 5DQHA 4UB5A 5J29A 1ED1A 3CRXA 2K4IA 5DBAA 1HJPA 1KN5A 5KFXA 4M2YA 5C5JA 3NASA 2EZYA 3QXGA 1ZYQA 4YXJA 1ZQJA 4O3SA 1S9FA 4J9KA 2AQ4A 3HKZF 2AU0A 2NV3A 5K4LA 3PSPA 4DL6A 5FP0A 4O3RA 4RPZA 1DK2A 5IILA 5KT5A 5ALIA 4NY8A 3C1YA 3PMLA 5AHXA 2F8KA 8ICWA 2QLTA 1ZQ1C 5AM1A 4KLMA 1WWVA 1NKEA 1Q46A 4RPXA 4QIWC 4B9NA 5ALFA 4EBCA 3NTUA 2UVUA 2NO5A 3TFRA 2EQYA 2RP5A 3KOOA 4I2JA 5DLFA 4RNOA 4CGZA 3SD7A 3N7PD 2FE9A 2V4QA 2IOFA 2W04A 1IG6A 4UAUA 1L8OA 3I76A 4IRKA 2YX8A 2CXYA 3L4PA 4R65A 3F53A 2CPRA 2ZTCA 1NZPA 4ECVA 2VKQA 1QSLA 5DG8A 3MR6A 1HEKA 4ICAA 2BPGA 7ICKA 1J2MA 4I28A 4TUPA 4J9QA 4O3NA 2DFLA 1RXWA 1N2XA 9ICVA 1WG8A 1RM6C 1WUDA 1PVPA 4PHPA 2Z7JA 4ELVA 2MUTB 5ALNA 1L3UA 4DSEA 1S8OA 9ICWA 4OJLA 3D6JA 2Y9UA 5AK6A 4Y2QA 2UVWA 3RBDA 3RB4A 4KLFA 2R8GA 1NOMA 1RQNA 4FBTA 1KFTA 3VCBA 3IDWA 4DSFA 2WF8A 4DO9A 2BHNA 4JB3A 4RQ0A 9ICTA 5KAIU 1TV9A 1XC9A 3I1YA 1NK8A 1N62A 4F50A 4JWNA 3K75D 3WK6A 4KLGA 1B0XA 1NK9A 3IRUA 2Y9TA 2W3SA 4FBUA 4CF4A 2NO4A 3SV4A 3RH6A 1KBUA 1KFSA 5HMLA 4U6PA 3T5JA 3UMCA 3D2NA 1EXNA 3CW2C 3OGUA 4F5QA 3NRZA 3JPNA 1WCLA 4KLEA 4RT3A 2KSOB 4ECTA 9ICAA 2F8LA 5KT2A 2NRZA 1URJA 3LYSA 4RQ2A 4DQPA 4F3OA 3BS5B 5GTIU 1TK5A 4LZDA 5ALDA 1BVSA 2KP7A 2Q0ZX 4CE6A 4I2AA 2ZXIA 2IHMA 2XC9A 4UQGA 3H0LB 4YP3A 3PW0A 3G6YA 2G09A 9ICCA 4NLBA 1CEZA 5KFOA 4F93B 2YQEA 2RHFA 2J6SA 2MU2A 4QJFB 4DL2A 1BGXT 4UAWA 1T7PA 1SV4A 4O5EA 4PL1A 5KG0A 4QZCA 3HKZC 2PI4A 3KZXA 3Q8LA 2H3ZA 1CI4A 3T3FA 3QE9Y 3PR4A 3TKAA 3ONNA 2BCUA 2HW3A 2QB0B 2OCEA 8ICYA 3ED5A 3PMNA 4ZOHC 2E5SA 5IIKA 1Y88A 1KTQA 3GIMA 4R8UA 3JPOA 2G0AA 3N4MB 2ZTDA 4UBBA 2IA6A 2ZIUB 1MQ2A 5CEHA 2L5YA 3IG5A 2W9CB 4QWAA 2KKPA 2W9BB 3KFUF 4ED3A 4AYBF 1Z3EB 2BKEA 1QTMA 3SV3A 4XRHA 7ICVA 1X42A 5B66U 4XUSA 1Z1VA 9ICMA 2I1QA 1RYRA 4ECXA 1NJWA 1WWUA 2ASLA 2HOFA 1TAMA 7ICQA 3TARA 1A77A 4QZ8A 4Q43A 1ZD2P 2K4EA 7ICEA 3TQ1A 2RDJA 3IN5A 4PZNA 1PK1A 3DEEA 4F4ZA 1PVRA 4NLZA 5DQIA 1F0MA 3IV6A 2H3QA 4GLXA 7ICOA 2LKYA 5KFCA 2HBJA 5J0WA 3WKBA 2JGAA 5KFRA 4J9RA 4J9MA 3AU2A 2BCVA 3NRWA 9ICHA 4I2DA 1RYUA 4O3MA 4NM2A 4B9TA 4BDPA 3SR6A 5KFKA 3KKAA 3F5EA 5J2KA 1ZJNA 2LM4A 1IV8A 2F1IA 4C4TA 2N1RA 1SKWA 3K1ZA 4YMOA 4I2CA 4KITB 3B9JA 3KHGA 3JPSA 4DSKA 4I2EA 3RAXA 2A1JB 5KFQA 3JPRA 4F5PA 4GC7A 2BQ3A 4CF5A 1N61A 4F4KA 4I2FA 4PGYA 1QSYA 2F76X 4Y2PA 2OM6A 5KFLA 1SGGA 3N7RC 5CB1A 4TUQA 3GFKB 2FPKA 3V6HA 4F2RA 4F8RA 2PFOA 4HYKA 2MRLA 1KKXA 4O5CA 1QSSA 4TUSA 4USAA 5J2GA 1T94A 1YT3A 2PXIA 2LMRA 3QU5A 4FE3A 4PGXA 2ZUDA 7ICLA 4DL4A 1P7DA 1QQ6A 4DSIA 4OD0A 1UHUA 1NI3A 3C5GA 1M6YA 2XVTA 1JMSA 1XSPA 3CP8A 3QU2A 4TQRA 1SV0C 4PL2A 4ECZA 1F44A 3PW2A 4RQ7A 1ZQMA 9ICSA 2DBYA 7ICSA 3RJKA 3UQ2A 5DB6A 4P2HA 1X66A 3OHAA 3EPIA 1BPZA 5J0PA 1ZD5A 3M1YA 3EWAA 4NL9A 4ECQA 3SAGA 2HHVA 3GV7B 5DQGA 1ZQLA 4EBDA 4P0QA 1ZOLA 4IQTA 2R8KA 2XO7A 2KVCA 5F3XB 4Z6CA 1MA7A 2HBKA 3CYMA 4NLNA 4NXZA 4ECWA 3RH5A 4FZNA 3UM9A 4QW9A 2BDUA 2YTUA 5DDYA 8ICLA 4AYBC 1RYSA 3H4DA 2JHDA 5KT6A 2YY6A 4J9OA 2AGQA 1SZHA 1UCVA 1N48A 3V72A 1WCNA 4O3QA 2MSNA 4IQVA 3U26A 3MDCA 1ZD4A 1NK5A 8ICSA 5KT7A 1JX4A 4EENA 4RNMA 1Z00B 1MSWD 1KL9A 3I28A 3TANA 1S77D 4UB6U 4M9NA 2EAPA 1D8BA 4J9LA 5IIOA 4PHDA 3LWMA 4M47A 2BQUA 1KDHA 2W54A 2WHEA 4UATA 1LKYB 1ZD3A 5AK5A 3K4GA 1IM4A 3ZI4A 3H8WA 2LYAA 5KFTA 4B9VA 1L7OA 1NK0A 3AQFA 3BQ7A 2G07A 4K4GA 3QEBZ 1SL1A 4QZAA 2W55A 4UASA 1IIPA 3N28A 1TFRA 5J2HA 4I2BA 4EYHB 5DLGA 5EWEA 4O5KA 2B0CA 2HMXA 4KX5A 3Q8PB 1JXEA 4C8NA 5HNKA 2CN1A 4B9UA 4J9NA 4I27A 3AN1A 5AI9A 4RPYA 3GIKA 3AL0B 1D9FA 4DF4A 3QUTA 8ICCA 2KD1A 1H38A 7ICHA 2ZG6A 8ICZA 2HI0A 3QEAZ 3NVYA 3C29A 3ETLA 4ED8A 5AM0A 3HP6A 5DBCA 1VDVA 3UPQA 4DOCA 1C20A 1N63A 5HR7A 3WK4A 3Q8SB 2E1EA 3HILA 3THVA 4F5RA 2BQRA 2JH1A 4R64A 3T5HA 3ZD8A 2A1AA 2W9MA 2HSZA 2KZMA 2KJ5A 4M9JA 1ZQCA 1ZQDA 7ICPA 5AKLA 3GV5B 4JV1A 1FFUA 1ZRMA 4F4XA 1ZJMA 4F5NA 3ETRA 4YVZA 2G06A 2JV3A 1ZQBA 2DL0A 1TK8A 2I5HA 5AK4A 1Z19A 1N60A 5HP4A 5AKKA 3HX0A 9ICUA 2DGZA 5ALKA 5EWGA 1Z4NA 2AQ0A 4MEXA 4C8MA 1AQ6A 5AKYA 5EE0A 2KHQA 1XO1A 8ICVA 2HOIA 3RB6A 3NVVA 1N5XA 1C7YA 2PFQA 5KFJA 4DSLA 1HUZA 4RT2A 2K4PA 5J2JA 2W03A 4Y2YA 4O9MA 2NRXA 2EDUA 4BWMA 1ZQWA 5L1IA 4EEKA 1RZTA 3AM9A 4M6WB 1SKSA 1KW4A 3LK9A 3B0YA 8ICHA 2YMQA 1LV5A 4XQ8A 5EWFA 1SIJA 2ZJ5A 4PZOA 5AI0A 2KN7A 2K89A 3OHBA 5KFAA 2MAXA 2C2RA 5J2IA 3TACB 2R8HA 2OHFA 3ORYA 2E1FA 4DEZA 2I6XA 5H2FU 5IINA 1QCKA 1JUDA 2M9NA 2UVRA 1UT5A 1ZQYA 5KNIA 2OXOA 5IIJA 4QZEA 4B6JA 4O0IA 3M8SA 3GZFA 3T5KA 4UB4A 5AKJA 3EZ5A 4DFMA 2AXTU 3AUOA 4KLLA 4DFJA 3QU7A 5BOMA 3E0FA 4F2SA 4YG2A 3Q8QB 4FFDA 7ICFA 1X9MA 2Y1JA 4RUAA 3UXOA 4KLIA 3GV8B 2WAQF 3RRGA 3SYZA 2ZUBA 2ZIXA 8ICQA 4RQMA 3TADC 2XY7A 2ISOA 4JV2A 4OO1J 4DQSA 2DF4B 1NKBA 5AI8A 2DKXA 2VA8A 5KFFA 1NJZA 9ICLA 2PKEA 4BWJA 4NL9C 1K1SA 2FPLA 3EPGA 1ZQKA 4I2IA 2KK0A 4QZFA 5KG4A 2KZZA 2O6KA 3ZDBA 1ZQXA 5D4BA 3E2EA 1FFVA 2BCSA 2YMPA 3T5LA 1KSPA 5GTHU 5ALOA 2F77X 3MGVA 2FMQA 1XNSA 5J0YA 5AM2A 2ZUCA 1SL2A 3HW8A 2LM1A 3SAHA 2PMZC 2QB1A 1V97A 2RRDA 5J0OA 5B5EU 2EH9A 1ZQSA 9ICOA 2DPIA 1RXVA 5ALVA 1XSLA 2KIWA 1UA0A 4DL7A 5C0YA 1K1QA 4PHAA 9ICJA 4YMMA 2AGPA 4YR0A 1WYGA 1PK1B 3HT3A 1COOA 3IM1A 3UQ0A 3Q8RB 1AROP 3M9MB 4EBEA 3QNMA 1LVHA 4KLDA 2EZXA 2HHUA 2F1JA 3MFHA 3PW4A 5DKWA 5J8YA 3C28A 1X9XA 1RG6A 4IL6U 1T3QA 3RF9A 1D8YA 4K4HA 2VJ5A 5AM5A 4YR2A 4ECSA 3RJGA 4JK1A 2KKVA 2HCFA 9ICRA 3M6KA 2XICA 2ALZA 1UT8A 3DV9A 4GXJA 4HAIA 4J9SA 5J2BA 1L3VA 5ALYA 3BQTA 3LDAA 2ZIVA 5JUMA 2ZIWA 1JI7A 2RLTA 4UBCA 2PFNA 2IMWP 2A3VA 3UXNA 2W7PA 3PX6A 3H8JA 1XSNA 3KTQA 2ODGA 2BCRA 2NRWA 1TK0A 3HJEA 5ALSA 3SI8A 3MGIA 4CDGA 4Q8FA 2KEYA 4PGQA 1D8LA 2FLPA 1OXJA 3CNHA 4M0AA 2VIXA 2V9WA 3QUBA 3IG8A 1NK4A 3H40A 2EAOA 4C7ZA 2BGWA 1FIQA 5KG7A 3MC1A 5AKHA 3KD3A 8ICNA 1JALA 5DG9A 4OJ5A 4M9HA 5ALMA 4K4IA 3RJEA 3QZ8A 5KL8B 1DK3A 2D3DA 3ISBA 2VANA 4F71A 8ICKA 3FC4A 4NLCA 5KFZA 2IOFK 2M0NA 3RJIA 3C23A 1PVQA 2FLNA 4UB3A 3OPXA 3FYHA 2WF9A 5KL1B 3RJJA 3KZIU 2NRTA 4RQ3A 1HUOA 3Q8KA 4UB2A 2RQ5A 2HHQA 4OCZA 5KG6A 2KJ8A 2GWSA 2F1HA 3PO4A 3B0XA 2KMDA 4MFCA 5G5GA 2IBKA 3RH4A 2QARA 4DQQA 1ZQRA 4KLJA 1ZRNA 1ECWA 5CP2A 4UARA 2W9BA 1NKCA 4G9BA 4C8OA 3JPQA 2R8JA 5ALEA 5F9LA 4EX6A 2IHNA 4RUCA 2H5XA 2UVVA 2G5IB 3GIIA 1GO3F 3UMGA 3PW5A 1A0PA 4PPXA 2HVIA 2HHWA 2DKZA 5AIAA 1SWVA 2HDOA 4B9SA 2JEGA 5KFUA 1X6IA 4GXIA 3ICXA 5KFBA 4ED7A 2A19A 1S5LU 4IC9A 5G5HA 5CJ7A 2BR0A 2IOHA 1ZQUA 4ACOA 2KE7A 4ED1A 2W3RA 4Z6FA 5AI4A 4RQ5A 5ALJA 2ESEA 1S0NA 4YFKA 1DRGA 1J97A 8ICXA 2ZXHA 5KFMA 1MQ3A 8ICPA 1BPEA 9ICIA 4MFFA 4RU9A 9ICGA 3G6XA 3PX4A 8ICGA 5HHIA 3F2BA 4C80A 2PI5A 5EE1A 4GFJA 4P0PB 4EYIB 4ED2A 2JZBA 5L1KA 5KFIA 2W8KA 3GDXA 4NV0A 4US9A 8ICMA 1KFDA 3OSPA 1ZQOA 2P6UA 2YN4A 5AKXA 4TURA 3GIJA 2E8PA 4CNQA 2Y1IA 8ICFA 4KLTA 4QZ9A 2KICA 4M9LA 2FMPA 3GU3A 3RB0A 4NM1A 3V7LA 7ICUA 4O3OA 4DL5A 1NJYA 2PFPA 1S0MA 3ZDDA 2HOQA 5J0UA 4TQSA 1KQQA 2LI6A 2XY5A 5KFNA 3NUQA 1JROA 5E79U 3BJYA 1BPYA 3BS7A 2HHTA 5ALWA 4KLUA 5J0RA 3N97B 3G6VA 3H8MA 8ICJA 5AKZA 4YXMA 3V6KA 3MR2A 3PSIA 3QUCA 2KFNA 4JMUA 4KLQA 1FEZA 3GILA 2WF7A 2JEIA 3ZD9A 5EE3A 4DQRA 1ZQPA 4DS5A 5DGBA 2KOBA 1SB3C 2EAMA 7ICJA 2AHOB 1F5SA 3WK7A 1T4GA 3QUQA 2XCAA 1XO0A 1L3SA 4DS4A 1HIWA 4IR1A 3GQCA 1U47A 3KHHA 4FS1A 1BNPA 4PJ0U 4DFDA 1TVAA 3H8SA 2EANA 5CRXA 4IQUA 4NLKA 5F9NA 5DB7A 3WU2U 3ZDAA 1NK7A 3QZ7A 1COKA 2H3IA 4C8LA 5KG5A 3NVZA 2P35A 1TAUA 2W8LA 2G08A 4IQWA 4DOAA 1O03A 3SENA 2F44A 3OJUA 2KTQA 5JRTA 4Y2XA 4QZGA 2LYHA 3TI0A 4YQWA 1T8EA 1T3NA 5ALRA 2BPFA 3RTVA 2ZTEA 5J0XA 1MN8A 4KN7A 8ICUA 2F2AB 7ICRA 8ICAA 1U4BA 1TKDA 2E8OA 4GC6A 3WK8A 2JEFA 5AM4A 4JV0A 1TE2A 4NJ8A 3R9KA 3BQ0A 5KFVA 5HHHA 4F4WA 1RDFA 4ELTA 1NZBA 5BPCA 5JTIA 3KBBA 5EOZA 2Q4TA 8ICEA 5DB9A 1VJ5A 2G5HB 2GO7A 3H4BA 5J2DA 1DXSA 3MGHA 1X6JA 5AICA 3KKAC 1V38A 4DQIA 4CRXA 4QZIA 1RQLA 4Y2VA 5KFHA 3UXPA 4QZBA 2QKQA 4GIBA 2ZIXB 2XI9A 4UW9A 7ICGA 4C4SA 3J81j 1ZQIA 3RBEA 4A8EA 7ICIA 3PVXA 1NJXA 4YD2A 3AU6A 4YCXA 3PNCA 5IIMA 4AP9A 2W7OA 3WKCA 3E58A 4MF2A 3ALRA 2WB1F 3F5AA 3H7IA 2BCQA 3ZDCA 2DUYA 4J03A 3Q8MA 4RQ4A 2K60A 4BXOA 1K5OA 4DLEA 3PO5A 3BZCA 3BQ2A 3NS1A 4UB8U 3F2CA 2OWOA 4QWBA 4QZDA 4ELUA 1LB2B 4P4MA 1L6NA 5J2AA 2AH5A 1IXRA 5HR6A 9ICXA 5KG2A 3D2SA 4Q44A 5L1JA 2D8CA 4QW8A 1SV0A 3KHLA 2AJQA 1A6SA 3AMZA 4NWIA 1SL0A 2HBLA 2E8MA 2ZJ8A 4KN4A 1L5UA 2V4RA 1SZPA 9ICEA 3LVWA 3MR5A 3MBYA 3BQ1A 1BPDA 3HWTA 3C5FA 2K8CB 2YMMA 5KFEA 1UQVA 1L7NA 4CF3A 4G3IA 4BX9C 1Q3VA 3UMBA 4Y2SA 1ZQFA 9ICQA 1QQ7A 3V6JA 5J2FA 2HBMA 2YMLA 2ASDA 4RQ6A 2LPEA 4R8UB 3S6JA 4BJQA 4M6WA 4PHEA 2W9AA 2BPCA 4MEYA 4EZ9A 3V7KA 5L1MA 1XWLA 3QX7A 1ZQZA 2ZIVB 3QYPA 2ZIWB 1XU4A 4CCHA 4DLGA 1X40A 2C2EA 2VJ4A 1PZNA 2KJ9A 2B21A 1UA1A 1L7PA 5KG1A 3M8RA 3N7SC 3C2KA 2XGPA 3L5KA 2W43A 1DGSA 2XIDA 2KHVA 1Z4OA 1ZQHA 1U49A 1L3TA 3SQIA 5D46A 3EUB2 4DOBA 4LZGA 2KG5A 5ALLA 4OJPA 4MF8A 9ICKA 4YN4A 2MUTA 3HRDD 1O08A 3C1ZA 5T14A 5DBBA 2J6TA 1OW5A 4DSJA 4MFAA 3RFAA 2HHSA 2P6RA 4OJ6A 3QU4A 3M9OB 4F72A 5J2EA 3M6ZA 3MFIA 3LWLA 1U9LA 4RZRA 2KFZA 4B9LA 2DQNB 4QWCA 1J2NA 1CUKA 3MDAA 1L8LA 3PV8A 5AKIA 4UAVA 1Q3UA 3BDPA 3O0FA 1TAQA 3PR5B 4C7YA 4OJOA 3M9NB 2BZFA 2ASJA 1X2IA 2HHXA 2FMSA 1DGJA 1ZQAA 3ISCA 5KFYA 2QARB 2H3FA 4JWMA 2GOLA 3JPTA 9ICNA 1YZ6A 5TISU 2WB1C 2KSOA 4YMNA 1YZ7A 4IS7A 2WF5A 4QWEA 4ED6A 3C2LA 4Q8EA 3BS5A 3NGDA 2R8IA 1NNLA 4ZH4A 2JMGA 2JH7A 4UB1A 1JIHA 5HMMA 4NLGA 3PSFA 3WK5A 4Q45A 5KAFU 4LJXA 3PX0A 4IR9A 5KG3A 5KT3A 4DFKA 2R18A 4DF8A 5CHGA 1D9DA 4IRCA 2E8NA 4Z6DA 5CWRA 4DCCA 5AI5A 4R66A 3PSTA 4I2GA 2E3TA 4KMOB 5ALXA 2WAQC 3A0BU 5IIIA 1A76A 4UAYA 5TZVA 3WKDA 5BOLA 2QB0A 2JEJA 5DB8A 2XY6A 8ICBA 1CRXA 5JU5A 2LBOA 2OEHA 4IRDA 1V85A 1X9WA 4US8A 2CRXA 2OH2A 3RR8A 2D6FC 2Y0SF 2RDIA 4B9MA 5KT4A 8ICTA 4RQ1A 2ZIUA 3KHRA 2JZBB 2XGQA 2W9CA 4I2HA 1VLBA 1QH9A 4P0QB 1JXLA 1JN3A 2YB4A 2H3VA 2MA1A 2W11A 9ICPA 1QLNA 5ALZA 3NVWA 4ECRA 4Y2TA 1S10A 3AQEA 3D2QA 2ES6A 5ALUA 4J9PA 2XCPA 5ALPA 3WK9A 4P4PA 5ALTA 3FDSA 3SZ2A 7ICTA 4M9GA 3SEIA 2VA3A 3RJHA 3HPOA 4DWIA 1Q8KA 4KMUA 4BUGA 1ZETA 2FDRA 2JXJA 2JRZA 3H0MB 1QQ5A 3RR7A 2DPJA 1ZQTA 9ICFA 1S0VA 4Y2RA 2OYYA 3TFSA 3V7JA 1U48A 3QU9A 1DOQA 5KFPA 4KLHA 3C21A 2HVHA 4EELA 1V9PA 4EZ6A 1FO4A 5KFGA 3TADA 4RQNA 4JUZA 2P66A 1MC8A 3RAQA 2DWQA 3EYZA 1KRPA 2GLEA 1B4FA 3ZDEA 2KVSA 2A1JA 5KTQA 3RJFA 2KNJA 2ZJAA 2KV2A 1UPHA 1N56A 2C2DA 2FLLA 2ATLA 4I29A 3F2DA 1JRPA 4DL3A 1BPBA 4LVSA 5CR0A 4QIWF 4F92B 3AEVA 1B43A 5AI6A 3EW9A 4RQ8A 4F4YA 3TAPA 5AKGA 4QNLA 2B6GA 3RB3A 4EEYA 3OSNA 2WF6A 3TAQA 4RNNA 4FZMA 4QWDA 3MABA 1X9SA 4DFPA 4E0DA 1SKRA 1BPXA 1PK3A 1SXEA 5J2CA 4C0ZA 5J0SA 2FI1A 2KZ3A 5EE9A 3SMVA 3RRHA 3PW7A 4FS2A 5DGAA 1KLNA 4EX7A 5AIBA 4ECYA 1U45A 4P4OA 1ZQNA 5AM3A 2LYBA 4F5OA 1L7MA 1S0OA 4UAZA 5KFSA 4YD1A 1BNOA 1S76D 2K4HA 3MR3A 4ED0A 2C22A 2KIVA 5L1LA 4Y2UA 1N5WA 3M7DA 1S97A 5A0LA 4ECUA 2YB1A 3WKEA 2C28A 2LHTA 2VA2A 3FAHA 4Z6EA 5J0QA 4KX3A 5CA7A 3DDHA 1ZQGA 5DG7A 3PZPA 4P0PA 2GH1A 3K1RB 3BZKA 2ISPA 2AGOA 5J8YC 4QZHA 5D49A 2WFAA 2I9GA 2Y0SC 2NYVA 2NRVA 5AK3A 3JPPA 1ZQVA 2F3NA 3A0HU 5L9XA 5ALHA 5J0TA 5ALGA 3C2MA 3OTQA 3VC8A 2FJ6A 3H0RB 7ICMA 1SWWA 2JR5A 2BDPA 5KFWA 8ICOA 3PY8A 5DDMA 4BGDA 3SAFA 1NK6A 1B22A 4R63A 8ICRA 5ALQA 4GXKA 4WJ3B 4M04A 4Y2JA 4C4RA 9ICBA 2K8BB 1ZXIA 4F91B 1SXDA 4C8KA 2EZZA 3OJSA 3T79A 1RPLA 5KFDA
chains in the Genus database with same CATH topology
1OUQA 4O3MA 2HMXA 4KX5A 2ZXIA 2YX8A 2G5HB 2F77X 3LVWA 2YB4A 2H3VA 2CN1A 2MA1A 3H0LB 3IP4B 4QNLA 3MGVA 3ICXA 3F53A 3D2SA 1Q3UA 2CPRA 1XNSA 2K8CB 2VIXA 2G09A 3L3FX 4IC9A 2VKQA 3O0FA 4NLBA 2PMZF 3IG8A 1HEKA 4ICAA 4BX9C 3F5EA 3SAHA 4FZMA 3PSIA 4ACOA 3SAGA 1Q3VA 2RHFA 2PMZC 4OJOA 3AL0B 4QJFB 4JMUA 4U7CA 2N1RA 3AQEA 2HBMA 2RRDA 3D2QA 4PL1A 3K1ZA 4P0QA 1Z1BA 4CRXA 4C0ZA 1DRGA 4BJQA 4OJ5A 2K89A 2KOBA 2H3FA 2KVCA 3HKZC 2KD1A 2ZIXB 3KZXA 3SMVA 1MA7A 2K8AA 2H3ZA 2HBKA 2GOLA 2KIWA 2XI9A 2ZG6A 1WUDA 2ZXHA 1PVPA 2Z7JA 3CYMA 4FZLA 3ONNA 2E1FA 2WB1C 3C29A 1XO0A 3LVVA 1HIWA 5KL8B 5C0YA 1ED1A 3CRXA 4A8EA 2K4IA 2LYBA 2ZIVB 2E5SA 4OJLA 4NLCA 4FZNA 2BDUA 2ZIWB 3F2BA 4AYBC 5CRXA 5HR7A 4GFJA 4P0PB 2G0AA 2M0NA 2K4HA 4BUGA 2E1EA 2F76X 2JHDA 2OM6A 2OXOA 2VJ4A 2JH1A 3N7RC 2JMGA 2ZIUB 2W7OA 1PVQA 3H0MB 3M7DA 3HKZF 2JH7A 2NV3A 4NV0A 5A0LA 2YB1A 2KJ9A 3OPXA 3PSPA 3VCBA 3PSFA 2LHTA 1SZHA 2H3IA 3ALRA 3GZFA 3IG5A 2KJ5A 5KL1B 3N7SC 4KX3A 2WB1F 3F5AA 2KKPA 2G08A 3KFUF 3E0FA 2XIDA 2KHVA 3PZPA 2G06A 2MRLA 4P0PA 2OYYA 2GH1A 2R18A 3C28A 4AYBF 2KJ8A 3RF9A 3SQIA 1T94A 1Z19A 1YT3A 2VJ5A 2Y0SC 3PSTA 1ZQ1C 2WAQF 4KMOB 4FE3A 2KKVA 3F2CA 1D8BA 2HOFA 2ZIXA 2WAQC 2DGZA 3M6KA 2KICA 2XICA 1TAMA 3VC8A 4OJPA 4QIWC 3GU3A 1ECWA 3H0RB 1P7DA 1L6NA 1KBUA 2K4EA 2F2AB 4OO1J 4U6PA 5T14A 2Q4TA 2DF4B 2XVTA 3D2NA 1CRXA 2KNJA 2ZIVA 2LBOA 2LYAA 2RP5A 3RFAA 2ZIWA 3SAFA 3IN5A 5HR6A 2KHQA 2KV2A 2F8LA 2G5IB 3AQFA 1UPHA 3DEEA 4OJ6A 1PVRA 2A3VA 2CRXA 2HOIA 2OH2A 4CGZA 1GO3F 2W7PA 2D6FC 3CP8A 3N7PD 4WJ3B 1A0PA 1URJA 2HOQA 2Y0SF 3F2DA 2G07A 3LYSA 3M6ZA 2H3QA 2LKYA 2ZIUA 1A6SA 2W04A 2HBJA 2K8BB 4NWIA 1IIPA 2HBLA 2JGAA 4PL2A 1F44A 2W03A 4QIWF 4CDGA 1NZBA 3NUQA 3NRWA 3T79A 2DQNB 2KEYA 4P0QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIC A; 
#chains in the Genus database with same CATH topology
 1OUQ A;  4FO6 A;  1PUZ A;  4KLS A;  3IP4 B;  1XS9 D;  4O3P A;  1Z00 A;  3L3F X;  7ICN A;  3IHQ B;  4XA5 A;  1ZQQ A;  2PMZ F;  4BXO B;  3WKA A;  3FM9 A;  2FPM A;  4U7C A;  2WTF A;  4KTQ A;  4KLO A;  1ZQE A;  1Z1B A;  4MHV A;  4YR3 A;  3ISD A;  5AKE A;  1LKY A;  4PH5 A;  4X5V A;  1KEJ A;  2K8A A;  2J6U A;  4FZL A;  8ICI A;  3LVV A;  5DQH A;  4UB5 A;  5J29 A;  1ED1 A;  3CRX A;  2K4I A;  5DBA A;  1HJP A;  1KN5 A;  5KFX A;  4M2Y A;  5C5J A;  3NAS A;  2EZY A;  3QXG A;  1ZYQ A;  4YXJ A;  1ZQJ A;  4O3S A;  1S9F A;  4J9K A;  2AQ4 A;  3HKZ F;  2AU0 A;  2NV3 A;  5K4L A;  3PSP A;  4DL6 A;  5FP0 A;  4O3R A;  4RPZ A;  1DK2 A;  5IIL A;  5KT5 A;  5ALI A;  4NY8 A;  3C1Y A;  3PML A;  5AHX A;  2F8K A;  8ICW A;  2QLT A;  1ZQ1 C;  5AM1 A;  4KLM A;  1WWV A;  1NKE A;  1Q46 A;  4RPX A;  4QIW C;  4B9N A;  5ALF A;  4EBC A;  3NTU A;  2UVU A;  2NO5 A;  3TFR A;  2EQY A;  2RP5 A;  3KOO A;  4I2J A;  5DLF A;  4RNO A;  4CGZ A;  3SD7 A;  3N7P D;  2FE9 A;  2V4Q A;  2IOF A;  2W04 A;  1IG6 A;  4UAU A;  1L8O A;  3I76 A;  4IRK A;  2YX8 A;  2CXY A;  3L4P A;  4R65 A;  3F53 A;  2CPR A;  2ZTC A;  1NZP A;  4ECV A;  2VKQ A;  1QSL A;  5DG8 A;  3MR6 A;  1HEK A;  4ICA A;  2BPG A;  7ICK A;  1J2M A;  4I28 A;  4TUP A;  4J9Q A;  4O3N A;  2DFL A;  1RXW A;  1N2X A;  9ICV A;  1WG8 A;  1RM6 C;  1WUD A;  1PVP A;  4PHP A;  2Z7J A;  4ELV A;  2MUT B;  5ALN A;  1L3U A;  4DSE A;  1S8O A;  9ICW A;  4OJL A;  3D6J A;  2Y9U A;  5AK6 A;  4Y2Q A;  2UVW A;  3RBD A;  3RB4 A;  4KLF A;  2R8G A;  1NOM A;  1RQN A;  4FBT A;  1KFT A;  3VCB A;  3IDW A;  4DSF A;  2WF8 A;  4DO9 A;  2BHN A;  4JB3 A;  4RQ0 A;  9ICT A;  5KAI U;  1TV9 A;  1XC9 A;  3I1Y A;  1NK8 A;  1N62 A;  4F50 A;  4JWN A;  3K75 D;  3WK6 A;  4KLG A;  1B0X A;  1NK9 A;  3IRU A;  2Y9T A;  2W3S A;  4FBU A;  4CF4 A;  2NO4 A;  3SV4 A;  3RH6 A;  1KBU A;  1KFS A;  5HML A;  4U6P A;  3T5J A;  3UMC A;  3D2N A;  1EXN A;  3CW2 C;  3OGU A;  4F5Q A;  3NRZ A;  3JPN A;  1WCL A;  4KLE A;  4RT3 A;  2KSO B;  4ECT A;  9ICA A;  2F8L A;  5KT2 A;  2NRZ A;  1URJ A;  3LYS A;  4RQ2 A;  4DQP A;  4F3O A;  3BS5 B;  5GTI U;  1TK5 A;  4LZD A;  5ALD A;  1BVS A;  2KP7 A;  2Q0Z X;  4CE6 A;  4I2A A;  2ZXI A;  2IHM A;  2XC9 A;  4UQG A;  3H0L B;  4YP3 A;  3PW0 A;  3G6Y A;  2G09 A;  9ICC A;  4NLB A;  1CEZ A;  5KFO A;  4F93 B;  2YQE A;  2RHF A;  2J6S A;  2MU2 A;  4QJF B;  4DL2 A;  1BGX T;  4UAW A;  1T7P A;  1SV4 A;  4O5E A;  4PL1 A;  5KG0 A;  4QZC A;  3HKZ C;  2PI4 A;  3KZX A;  3Q8L A;  2H3Z A;  1CI4 A;  3T3F A;  3QE9 Y;  3PR4 A;  3TKA A;  3ONN A;  2BCU A;  2HW3 A;  2QB0 B;  2OCE A;  8ICY A;  3ED5 A;  3PMN A;  4ZOH C;  2E5S A;  5IIK A;  1Y88 A;  1KTQ A;  3GIM A;  4R8U A;  3JPO A;  2G0A A;  3N4M B;  2ZTD A;  4UBB A;  2IA6 A;  2ZIU B;  1MQ2 A;  5CEH A;  2L5Y A;  3IG5 A;  2W9C B;  4QWA A;  2KKP A;  2W9B B;  3KFU F;  4ED3 A;  4AYB F;  1Z3E B;  2BKE A;  1QTM A;  3SV3 A;  4XRH A;  7ICV A;  1X42 A;  5B66 U;  4XUS A;  1Z1V A;  9ICM A;  2I1Q A;  1RYR A;  4ECX A;  1NJW A;  1WWU A;  2ASL A;  2HOF A;  1TAM A;  7ICQ A;  3TAR A;  1A77 A;  4QZ8 A;  4Q43 A;  1ZD2 P;  2K4E A;  7ICE A;  3TQ1 A;  2RDJ A;  3IN5 A;  4PZN A;  1PK1 A;  3DEE A;  4F4Z A;  1PVR A;  4NLZ A;  5DQI A;  1F0M A;  3IV6 A;  2H3Q A;  4GLX A;  7ICO A;  2LKY A;  5KFC A;  2HBJ A;  5J0W A;  3WKB A;  2JGA A;  5KFR A;  4J9R A;  4J9M A;  3AU2 A;  2BCV A;  3NRW A;  9ICH A;  4I2D A;  1RYU A;  4O3M A;  4NM2 A;  4B9T A;  4BDP A;  3SR6 A;  5KFK A;  3KKA A;  3F5E A;  5J2K A;  1ZJN A;  2LM4 A;  1IV8 A;  2F1I A;  4C4T A;  2N1R A;  1SKW A;  3K1Z A;  4YMO A;  4I2C A;  4KIT B;  3B9J A;  3KHG A;  3JPS A;  4DSK A;  4I2E A;  3RAX A;  2A1J B;  5KFQ A;  3JPR A;  4F5P A;  4GC7 A;  2BQ3 A;  4CF5 A;  1N61 A;  4F4K A;  4I2F A;  4PGY A;  1QSY A;  2F76 X;  4Y2P A;  2OM6 A;  5KFL A;  1SGG A;  3N7R C;  5CB1 A;  4TUQ A;  3GFK B;  2FPK A;  3V6H A;  4F2R A;  4F8R A;  2PFO A;  4HYK A;  2MRL A;  1KKX A;  4O5C A;  1QSS A;  4TUS A;  4USA A;  5J2G A;  1T94 A;  1YT3 A;  2PXI A;  2LMR A;  3QU5 A;  4FE3 A;  4PGX A;  2ZUD A;  7ICL A;  4DL4 A;  1P7D A;  1QQ6 A;  4DSI A;  4OD0 A;  1UHU A;  1NI3 A;  3C5G A;  1M6Y A;  2XVT A;  1JMS A;  1XSP A;  3CP8 A;  3QU2 A;  4TQR A;  1SV0 C;  4PL2 A;  4ECZ A;  1F44 A;  3PW2 A;  4RQ7 A;  1ZQM A;  9ICS A;  2DBY A;  7ICS A;  3RJK A;  3UQ2 A;  5DB6 A;  4P2H A;  1X66 A;  3OHA A;  3EPI A;  1BPZ A;  5J0P A;  1ZD5 A;  3M1Y A;  3EWA A;  4NL9 A;  4ECQ A;  3SAG A;  2HHV A;  3GV7 B;  5DQG A;  1ZQL A;  4EBD A;  4P0Q A;  1ZOL A;  4IQT A;  2R8K A;  2XO7 A;  2KVC A;  5F3X B;  4Z6C A;  1MA7 A;  2HBK A;  3CYM A;  4NLN A;  4NXZ A;  4ECW A;  3RH5 A;  4FZN A;  3UM9 A;  4QW9 A;  2BDU A;  2YTU A;  5DDY A;  8ICL A;  4AYB C;  1RYS A;  3H4D A;  2JHD A;  5KT6 A;  2YY6 A;  4J9O A;  2AGQ A;  1SZH A;  1UCV A;  1N48 A;  3V72 A;  1WCN A;  4O3Q A;  2MSN A;  4IQV A;  3U26 A;  3MDC A;  1ZD4 A;  1NK5 A;  8ICS A;  5KT7 A;  1JX4 A;  4EEN A;  4RNM A;  1Z00 B;  1MSW D;  1KL9 A;  3I28 A;  3TAN A;  1S77 D;  4UB6 U;  4M9N A;  2EAP A;  1D8B A;  4J9L A;  5IIO A;  4PHD A;  3LWM A;  4M47 A;  2BQU A;  1KDH A;  2W54 A;  2WHE A;  4UAT A;  1LKY B;  1ZD3 A;  5AK5 A;  3K4G A;  1IM4 A;  3ZI4 A;  3H8W A;  2LYA A;  5KFT A;  4B9V A;  1L7O A;  1NK0 A;  3AQF A;  3BQ7 A;  2G07 A;  4K4G A;  3QEB Z;  1SL1 A;  4QZA A;  2W55 A;  4UAS A;  1IIP A;  3N28 A;  1TFR A;  5J2H A;  4I2B A;  4EYH B;  5DLG A;  5EWE A;  4O5K A;  2B0C A;  2HMX A;  4KX5 A;  3Q8P B;  1JXE A;  4C8N A;  5HNK A;  2CN1 A;  4B9U A;  4J9N A;  4I27 A;  3AN1 A;  5AI9 A;  4RPY A;  3GIK A;  3AL0 B;  1D9F A;  4DF4 A;  3QUT A;  8ICC A;  2KD1 A;  1H38 A;  7ICH A;  2ZG6 A;  8ICZ A;  2HI0 A;  3QEA Z;  3NVY A;  3C29 A;  3ETL A;  4ED8 A;  5AM0 A;  3HP6 A;  5DBC A;  1VDV A;  3UPQ A;  4DOC A;  1C20 A;  1N63 A;  5HR7 A;  3WK4 A;  3Q8S B;  2E1E A;  3HIL A;  3THV A;  4F5R A;  2BQR A;  2JH1 A;  4R64 A;  3T5H A;  3ZD8 A;  2A1A A;  2W9M A;  2HSZ A;  2KZM A;  2KJ5 A;  4M9J A;  1ZQC A;  1ZQD A;  7ICP A;  5AKL A;  3GV5 B;  4JV1 A;  1FFU A;  1ZRM A;  4F4X A;  1ZJM A;  4F5N A;  3ETR A;  4YVZ A;  2G06 A;  2JV3 A;  1ZQB A;  2DL0 A;  1TK8 A;  2I5H A;  5AK4 A;  1Z19 A;  1N60 A;  5HP4 A;  5AKK A;  3HX0 A;  9ICU A;  2DGZ A;  5ALK A;  5EWG A;  1Z4N A;  2AQ0 A;  4MEX A;  4C8M A;  1AQ6 A;  5AKY A;  5EE0 A;  2KHQ A;  1XO1 A;  8ICV A;  2HOI A;  3RB6 A;  3NVV A;  1N5X A;  1C7Y A;  2PFQ A;  5KFJ A;  4DSL A;  1HUZ A;  4RT2 A;  2K4P A;  5J2J A;  2W03 A;  4Y2Y A;  4O9M A;  2NRX A;  2EDU A;  4BWM A;  1ZQW A;  5L1I A;  4EEK A;  1RZT A;  3AM9 A;  4M6W B;  1SKS A;  1KW4 A;  3LK9 A;  3B0Y A;  8ICH A;  2YMQ A;  1LV5 A;  4XQ8 A;  5EWF A;  1SIJ A;  2ZJ5 A;  4PZO A;  5AI0 A;  2KN7 A;  2K89 A;  3OHB A;  5KFA A;  2MAX A;  2C2R A;  5J2I A;  3TAC B;  2R8H A;  2OHF A;  3ORY A;  2E1F A;  4DEZ A;  2I6X A;  5H2F U;  5IIN A;  1QCK A;  1JUD A;  2M9N A;  2UVR A;  1UT5 A;  1ZQY A;  5KNI A;  2OXO A;  5IIJ A;  4QZE A;  4B6J A;  4O0I A;  3M8S A;  3GZF A;  3T5K A;  4UB4 A;  5AKJ A;  3EZ5 A;  4DFM A;  2AXT U;  3AUO A;  4KLL A;  4DFJ A;  3QU7 A;  5BOM A;  3E0F A;  4F2S A;  4YG2 A;  3Q8Q B;  4FFD A;  7ICF A;  1X9M A;  2Y1J A;  4RUA A;  3UXO A;  4KLI A;  3GV8 B;  2WAQ F;  3RRG A;  3SYZ A;  2ZUB A;  2ZIX A;  8ICQ A;  4RQM A;  3TAD C;  2XY7 A;  2ISO A;  4JV2 A;  4OO1 J;  4DQS A;  2DF4 B;  1NKB A;  5AI8 A;  2DKX A;  2VA8 A;  5KFF A;  1NJZ A;  9ICL A;  2PKE A;  4BWJ A;  4NL9 C;  1K1S A;  2FPL A;  3EPG A;  1ZQK A;  4I2I A;  2KK0 A;  4QZF A;  5KG4 A;  2KZZ A;  2O6K A;  3ZDB A;  1ZQX A;  5D4B A;  3E2E A;  1FFV A;  2BCS A;  2YMP A;  3T5L A;  1KSP A;  5GTH U;  5ALO A;  2F77 X;  3MGV A;  2FMQ A;  1XNS A;  5J0Y A;  5AM2 A;  2ZUC A;  1SL2 A;  3HW8 A;  2LM1 A;  3SAH A;  2PMZ C;  2QB1 A;  1V97 A;  2RRD A;  5J0O A;  5B5E U;  2EH9 A;  1ZQS A;  9ICO A;  2DPI A;  1RXV A;  5ALV A;  1XSL A;  2KIW A;  1UA0 A;  4DL7 A;  5C0Y A;  1K1Q A;  4PHA A;  9ICJ A;  4YMM A;  2AGP A;  4YR0 A;  1WYG A;  1PK1 B;  3HT3 A;  1COO A;  3IM1 A;  3UQ0 A;  3Q8R B;  1ARO P;  3M9M B;  4EBE A;  3QNM A;  1LVH A;  4KLD A;  2EZX A;  2HHU A;  2F1J A;  3MFH A;  3PW4 A;  5DKW A;  5J8Y A;  3C28 A;  1X9X A;  1RG6 A;  4IL6 U;  1T3Q A;  3RF9 A;  1D8Y A;  4K4H A;  2VJ5 A;  5AM5 A;  4YR2 A;  4ECS A;  3RJG A;  4JK1 A;  2KKV A;  2HCF A;  9ICR A;  3M6K A;  2XIC A;  2ALZ A;  1UT8 A;  3DV9 A;  4GXJ A;  4HAI A;  4J9S A;  5J2B A;  1L3V A;  5ALY A;  3BQT A;  3LDA A;  2ZIV A;  5JUM A;  2ZIW A;  1JI7 A;  2RLT A;  4UBC A;  2PFN A;  2IMW P;  2A3V A;  3UXN A;  2W7P A;  3PX6 A;  3H8J A;  1XSN A;  3KTQ A;  2ODG A;  2BCR A;  2NRW A;  1TK0 A;  3HJE A;  5ALS A;  3SI8 A;  3MGI A;  4CDG A;  4Q8F A;  2KEY A;  4PGQ A;  1D8L A;  2FLP A;  1OXJ A;  3CNH A;  4M0A A;  2VIX A;  2V9W A;  3QUB A;  3IG8 A;  1NK4 A;  3H40 A;  2EAO A;  4C7Z A;  2BGW A;  1FIQ A;  5KG7 A;  3MC1 A;  5AKH A;  3KD3 A;  8ICN A;  1JAL A;  5DG9 A;  4OJ5 A;  4M9H A;  5ALM A;  4K4I A;  3RJE A;  3QZ8 A;  5KL8 B;  1DK3 A;  2D3D A;  3ISB A;  2VAN A;  4F71 A;  8ICK A;  3FC4 A;  4NLC A;  5KFZ A;  2IOF K;  2M0N A;  3RJI A;  3C23 A;  1PVQ A;  2FLN A;  4UB3 A;  3OPX A;  3FYH A;  2WF9 A;  5KL1 B;  3RJJ A;  3KZI U;  2NRT A;  4RQ3 A;  1HUO A;  3Q8K A;  4UB2 A;  2RQ5 A;  2HHQ A;  4OCZ A;  5KG6 A;  2KJ8 A;  2GWS A;  2F1H A;  3PO4 A;  3B0X A;  2KMD A;  4MFC A;  5G5G A;  2IBK A;  3RH4 A;  2QAR A;  4DQQ A;  1ZQR A;  4KLJ A;  1ZRN A;  1ECW A;  5CP2 A;  4UAR A;  2W9B A;  1NKC A;  4G9B A;  4C8O A;  3JPQ A;  2R8J A;  5ALE A;  5F9L A;  4EX6 A;  2IHN A;  4RUC A;  2H5X A;  2UVV A;  2G5I B;  3GII A;  1GO3 F;  3UMG A;  3PW5 A;  1A0P A;  4PPX A;  2HVI A;  2HHW A;  2DKZ A;  5AIA A;  1SWV A;  2HDO A;  4B9S A;  2JEG A;  5KFU A;  1X6I A;  4GXI A;  3ICX A;  5KFB A;  4ED7 A;  2A19 A;  1S5L U;  4IC9 A;  5G5H A;  5CJ7 A;  2BR0 A;  2IOH A;  1ZQU A;  4ACO A;  2KE7 A;  4ED1 A;  2W3R A;  4Z6F A;  5AI4 A;  4RQ5 A;  5ALJ A;  2ESE A;  1S0N A;  4YFK A;  1DRG A;  1J97 A;  8ICX A;  2ZXH A;  5KFM A;  1MQ3 A;  8ICP A;  1BPE A;  9ICI A;  4MFF A;  4RU9 A;  9ICG A;  3G6X A;  3PX4 A;  8ICG A;  5HHI A;  3F2B A;  4C80 A;  2PI5 A;  5EE1 A;  4GFJ A;  4P0P B;  4EYI B;  4ED2 A;  2JZB A;  5L1K A;  5KFI A;  2W8K A;  3GDX A;  4NV0 A;  4US9 A;  8ICM A;  1KFD A;  3OSP A;  1ZQO A;  2P6U A;  2YN4 A;  5AKX A;  4TUR A;  3GIJ A;  2E8P A;  4CNQ A;  2Y1I A;  8ICF A;  4KLT A;  4QZ9 A;  2KIC A;  4M9L A;  2FMP A;  3GU3 A;  3RB0 A;  4NM1 A;  3V7L A;  7ICU A;  4O3O A;  4DL5 A;  1NJY A;  2PFP A;  1S0M A;  3ZDD A;  2HOQ A;  5J0U A;  4TQS A;  1KQQ A;  2LI6 A;  2XY5 A;  5KFN A;  3NUQ A;  1JRO A;  5E79 U;  3BJY A;  1BPY A;  3BS7 A;  2HHT A;  5ALW A;  4KLU A;  5J0R A;  3N97 B;  3G6V A;  3H8M A;  8ICJ A;  5AKZ A;  4YXM A;  3V6K A;  3MR2 A;  3PSI A;  3QUC A;  2KFN A;  4JMU A;  4KLQ A;  1FEZ A;  3GIL A;  2WF7 A;  2JEI A;  3ZD9 A;  5EE3 A;  4DQR A;  1ZQP A;  4DS5 A;  5DGB A;  2KOB A;  1SB3 C;  2EAM A;  7ICJ A;  2AHO B;  1F5S A;  3WK7 A;  1T4G A;  3QUQ A;  2XCA A;  1XO0 A;  1L3S A;  4DS4 A;  1HIW A;  4IR1 A;  3GQC A;  1U47 A;  3KHH A;  4FS1 A;  1BNP A;  4PJ0 U;  4DFD A;  1TVA A;  3H8S A;  2EAN A;  5CRX A;  4IQU A;  4NLK A;  5F9N A;  5DB7 A;  3WU2 U;  3ZDA A;  1NK7 A;  3QZ7 A;  1COK A;  2H3I A;  4C8L A;  5KG5 A;  3NVZ A;  2P35 A;  1TAU A;  2W8L A;  2G08 A;  4IQW A;  4DOA A;  1O03 A;  3SEN A;  2F44 A;  3OJU A;  2KTQ A;  5JRT A;  4Y2X A;  4QZG A;  2LYH A;  3TI0 A;  4YQW A;  1T8E A;  1T3N A;  5ALR A;  2BPF A;  3RTV A;  2ZTE A;  5J0X A;  1MN8 A;  4KN7 A;  8ICU A;  2F2A B;  7ICR A;  8ICA A;  1U4B A;  1TKD A;  2E8O A;  4GC6 A;  3WK8 A;  2JEF A;  5AM4 A;  4JV0 A;  1TE2 A;  4NJ8 A;  3R9K A;  3BQ0 A;  5KFV A;  5HHH A;  4F4W A;  1RDF A;  4ELT A;  1NZB A;  5BPC A;  5JTI A;  3KBB A;  5EOZ A;  2Q4T A;  8ICE A;  5DB9 A;  1VJ5 A;  2G5H B;  2GO7 A;  3H4B A;  5J2D A;  1DXS A;  3MGH A;  1X6J A;  5AIC A;  3KKA C;  1V38 A;  4DQI A;  4CRX A;  4QZI A;  1RQL A;  4Y2V A;  5KFH A;  3UXP A;  4QZB A;  2QKQ A;  4GIB A;  2ZIX B;  2XI9 A;  4UW9 A;  7ICG A;  4C4S A;  3J81 j;  1ZQI A;  3RBE A;  4A8E A;  7ICI A;  3PVX A;  1NJX A;  4YD2 A;  3AU6 A;  4YCX A;  3PNC A;  5IIM A;  4AP9 A;  2W7O A;  3WKC A;  3E58 A;  4MF2 A;  3ALR A;  2WB1 F;  3F5A A;  3H7I A;  2BCQ A;  3ZDC A;  2DUY A;  4J03 A;  3Q8M A;  4RQ4 A;  2K60 A;  4BXO A;  1K5O A;  4DLE A;  3PO5 A;  3BZC A;  3BQ2 A;  3NS1 A;  4UB8 U;  3F2C A;  2OWO A;  4QWB A;  4QZD A;  4ELU A;  1LB2 B;  4P4M A;  1L6N A;  5J2A A;  2AH5 A;  1IXR A;  5HR6 A;  9ICX A;  5KG2 A;  3D2S A;  4Q44 A;  5L1J A;  2D8C A;  4QW8 A;  1SV0 A;  3KHL A;  2AJQ A;  1A6S A;  3AMZ A;  4NWI A;  1SL0 A;  2HBL A;  2E8M A;  2ZJ8 A;  4KN4 A;  1L5U A;  2V4R A;  1SZP A;  9ICE A;  3LVW A;  3MR5 A;  3MBY A;  3BQ1 A;  1BPD A;  3HWT A;  3C5F A;  2K8C B;  2YMM A;  5KFE A;  1UQV A;  1L7N A;  4CF3 A;  4G3I A;  4BX9 C;  1Q3V A;  3UMB A;  4Y2S A;  1ZQF A;  9ICQ A;  1QQ7 A;  3V6J A;  5J2F A;  2HBM A;  2YML A;  2ASD A;  4RQ6 A;  2LPE A;  4R8U B;  3S6J A;  4BJQ A;  4M6W A;  4PHE A;  2W9A A;  2BPC A;  4MEY A;  4EZ9 A;  3V7K A;  5L1M A;  1XWL A;  3QX7 A;  1ZQZ A;  2ZIV B;  3QYP A;  2ZIW B;  1XU4 A;  4CCH A;  4DLG A;  1X40 A;  2C2E A;  2VJ4 A;  1PZN A;  2KJ9 A;  2B21 A;  1UA1 A;  1L7P A;  5KG1 A;  3M8R A;  3N7S C;  3C2K A;  2XGP A;  3L5K A;  2W43 A;  1DGS A;  2XID A;  2KHV A;  1Z4O A;  1ZQH A;  1U49 A;  1L3T A;  3SQI A;  5D46 A;  3EUB 2;  4DOB A;  4LZG A;  2KG5 A;  5ALL A;  4OJP A;  4MF8 A;  9ICK A;  4YN4 A;  2MUT A;  3HRD D;  1O08 A;  3C1Z A;  5T14 A;  5DBB A;  2J6T A;  1OW5 A;  4DSJ A;  4MFA A;  3RFA A;  2HHS A;  2P6R A;  4OJ6 A;  3QU4 A;  3M9O B;  4F72 A;  5J2E A;  3M6Z A;  3MFI A;  3LWL A;  1U9L A;  4RZR A;  2KFZ A;  4B9L A;  2DQN B;  4QWC A;  1J2N A;  1CUK A;  3MDA A;  1L8L A;  3PV8 A;  5AKI A;  4UAV A;  1Q3U A;  3BDP A;  3O0F A;  1TAQ A;  3PR5 B;  4C7Y A;  4OJO A;  3M9N B;  2BZF A;  2ASJ A;  1X2I A;  2HHX A;  2FMS A;  1DGJ A;  1ZQA A;  3ISC A;  5KFY A;  2QAR B;  2H3F A;  4JWM A;  2GOL A;  3JPT A;  9ICN A;  1YZ6 A;  5TIS U;  2WB1 C;  2KSO A;  4YMN A;  1YZ7 A;  4IS7 A;  2WF5 A;  4QWE A;  4ED6 A;  3C2L A;  4Q8E A;  3BS5 A;  3NGD A;  2R8I A;  1NNL A;  4ZH4 A;  2JMG A;  2JH7 A;  4UB1 A;  1JIH A;  5HMM A;  4NLG A;  3PSF A;  3WK5 A;  4Q45 A;  5KAF U;  4LJX A;  3PX0 A;  4IR9 A;  5KG3 A;  5KT3 A;  4DFK A;  2R18 A;  4DF8 A;  5CHG A;  1D9D A;  4IRC A;  2E8N A;  4Z6D A;  5CWR A;  4DCC A;  5AI5 A;  4R66 A;  3PST A;  4I2G A;  2E3T A;  4KMO B;  5ALX A;  2WAQ C;  3A0B U;  5III A;  1A76 A;  4UAY A;  5TZV A;  3WKD A;  5BOL A;  2QB0 A;  2JEJ A;  5DB8 A;  2XY6 A;  8ICB A;  1CRX A;  5JU5 A;  2LBO A;  2OEH A;  4IRD A;  1V85 A;  1X9W A;  4US8 A;  2CRX A;  2OH2 A;  3RR8 A;  2D6F C;  2Y0S F;  2RDI A;  4B9M A;  5KT4 A;  8ICT A;  4RQ1 A;  2ZIU A;  3KHR A;  2JZB B;  2XGQ A;  2W9C A;  4I2H A;  1VLB A;  1QH9 A;  4P0Q B;  1JXL A;  1JN3 A;  2YB4 A;  2H3V A;  2MA1 A;  2W11 A;  9ICP A;  1QLN A;  5ALZ A;  3NVW A;  4ECR A;  4Y2T A;  1S10 A;  3AQE A;  3D2Q A;  2ES6 A;  5ALU A;  4J9P A;  2XCP A;  5ALP A;  3WK9 A;  4P4P A;  5ALT A;  3FDS A;  3SZ2 A;  7ICT A;  4M9G A;  3SEI A;  2VA3 A;  3RJH A;  3HPO A;  4DWI A;  1Q8K A;  4KMU A;  4BUG A;  1ZET A;  2FDR A;  2JXJ A;  2JRZ A;  3H0M B;  1QQ5 A;  3RR7 A;  2DPJ A;  1ZQT A;  9ICF A;  1S0V A;  4Y2R A;  2OYY A;  3TFS A;  3V7J A;  1U48 A;  3QU9 A;  1DOQ A;  5KFP A;  4KLH A;  3C21 A;  2HVH A;  4EEL A;  1V9P A;  4EZ6 A;  1FO4 A;  5KFG A;  3TAD A;  4RQN A;  4JUZ A;  2P66 A;  1MC8 A;  3RAQ A;  2DWQ A;  3EYZ A;  1KRP A;  2GLE A;  1B4F A;  3ZDE A;  2KVS A;  2A1J A;  5KTQ A;  3RJF A;  2KNJ A;  2ZJA A;  2KV2 A;  1UPH A;  1N56 A;  2C2D A;  2FLL A;  2ATL A;  4I29 A;  3F2D A;  1JRP A;  4DL3 A;  1BPB A;  4LVS A;  5CR0 A;  4QIW F;  4F92 B;  3AEV A;  1B43 A;  5AI6 A;  3EW9 A;  4RQ8 A;  4F4Y A;  3TAP A;  5AKG A;  4QNL A;  2B6G A;  3RB3 A;  4EEY A;  3OSN A;  2WF6 A;  3TAQ A;  4RNN A;  4FZM A;  4QWD A;  3MAB A;  1X9S A;  4DFP A;  4E0D A;  1SKR A;  1BPX A;  1PK3 A;  1SXE A;  5J2C A;  4C0Z A;  5J0S A;  2FI1 A;  2KZ3 A;  5EE9 A;  3SMV A;  3RRH A;  3PW7 A;  4FS2 A;  5DGA A;  1KLN A;  4EX7 A;  5AIB A;  4ECY A;  1U45 A;  4P4O A;  1ZQN A;  5AM3 A;  2LYB A;  4F5O A;  1L7M A;  1S0O A;  4UAZ A;  5KFS A;  4YD1 A;  1BNO A;  1S76 D;  2K4H A;  3MR3 A;  4ED0 A;  2C22 A;  2KIV A;  5L1L A;  4Y2U A;  1N5W A;  3M7D A;  1S97 A;  5A0L A;  4ECU A;  2YB1 A;  3WKE A;  2C28 A;  2LHT A;  2VA2 A;  3FAH A;  4Z6E A;  5J0Q A;  4KX3 A;  5CA7 A;  3DDH A;  1ZQG A;  5DG7 A;  3PZP A;  4P0P A;  2GH1 A;  3K1R B;  3BZK A;  2ISP A;  2AGO A;  5J8Y C;  4QZH A;  5D49 A;  2WFA A;  2I9G A;  2Y0S C;  2NYV A;  2NRV A;  5AK3 A;  3JPP A;  1ZQV A;  2F3N A;  3A0H U;  5L9X A;  5ALH A;  5J0T A;  5ALG A;  3C2M A;  3OTQ A;  3VC8 A;  2FJ6 A;  3H0R B;  7ICM A;  1SWW A;  2JR5 A;  2BDP A;  5KFW A;  8ICO A;  3PY8 A;  5DDM A;  4BGD A;  3SAF A;  1NK6 A;  1B22 A;  4R63 A;  8ICR A;  5ALQ A;  4GXK A;  4WJ3 B;  4M04 A;  4Y2J A;  4C4R A;  9ICB A;  2K8B B;  1ZXI A;  4F91 B;  1SXD A;  4C8K A;  2EZZ A;  3OJS A;  3T79 A;  1RPL A;  5KFD A; 
#chains in the Genus database with same CATH homology
 1OUQ A;  4O3M A;  2HMX A;  4KX5 A;  2ZXI A;  2YX8 A;  2G5H B;  2F77 X;  3LVW A;  2YB4 A;  2H3V A;  2CN1 A;  2MA1 A;  3H0L B;  3IP4 B;  4QNL A;  3MGV A;  3ICX A;  3F53 A;  3D2S A;  1Q3U A;  2CPR A;  1XNS A;  2K8C B;  2VIX A;  2G09 A;  3L3F X;  4IC9 A;  2VKQ A;  3O0F A;  4NLB A;  2PMZ F;  3IG8 A;  1HEK A;  4ICA A;  4BX9 C;  3F5E A;  3SAH A;  4FZM A;  3PSI A;  4ACO A;  3SAG A;  1Q3V A;  2RHF A;  2PMZ C;  4OJO A;  3AL0 B;  4QJF B;  4JMU A;  4U7C A;  2N1R A;  3AQE A;  2HBM A;  2RRD A;  3D2Q A;  4PL1 A;  3K1Z A;  4P0Q A;  1Z1B A;  4CRX A;  4C0Z A;  1DRG A;  4BJQ A;  4OJ5 A;  2K89 A;  2KOB A;  2H3F A;  2KVC A;  3HKZ C;  2KD1 A;  2ZIX B;  3KZX A;  3SMV A;  1MA7 A;  2K8A A;  2H3Z A;  2HBK A;  2GOL A;  2KIW A;  2XI9 A;  2ZG6 A;  1WUD A;  2ZXH A;  1PVP A;  2Z7J A;  3CYM A;  4FZL A;  3ONN A;  2E1F A;  2WB1 C;  3C29 A;  1XO0 A;  3LVV A;  1HIW A;  5KL8 B;  5C0Y A;  1ED1 A;  3CRX A;  4A8E A;  2K4I A;  2LYB A;  2ZIV B;  2E5S A;  4OJL A;  4NLC A;  4FZN A;  2BDU A;  2ZIW B;  3F2B A;  4AYB C;  5CRX A;  5HR7 A;  4GFJ A;  4P0P B;  2G0A A;  2M0N A;  2K4H A;  4BUG A;  2E1E A;  2F76 X;  2JHD A;  2OM6 A;  2OXO A;  2VJ4 A;  2JH1 A;  3N7R C;  2JMG A;  2ZIU B;  2W7O A;  1PVQ A;  3H0M B;  3M7D A;  3HKZ F;  2JH7 A;  2NV3 A;  4NV0 A;  5A0L A;  2YB1 A;  2KJ9 A;  3OPX A;  3PSP A;  3VCB A;  3PSF A;  2LHT A;  1SZH A;  2H3I A;  3ALR A;  3GZF A;  3IG5 A;  2KJ5 A;  5KL1 B;  3N7S C;  4KX3 A;  2WB1 F;  3F5A A;  2KKP A;  2G08 A;  3KFU F;  3E0F A;  2XID A;  2KHV A;  3PZP A;  2G06 A;  2MRL A;  4P0P A;  2OYY A;  2GH1 A;  2R18 A;  3C28 A;  4AYB F;  2KJ8 A;  3RF9 A;  3SQI A;  1T94 A;  1Z19 A;  1YT3 A;  2VJ5 A;  2Y0S C;  3PST A;  1ZQ1 C;  2WAQ F;  4KMO B;  4FE3 A;  2KKV A;  3F2C A;  1D8B A;  2HOF A;  2ZIX A;  2WAQ C;  2DGZ A;  3M6K A;  2KIC A;  2XIC A;  1TAM A;  3VC8 A;  4OJP A;  4QIW C;  3GU3 A;  1ECW A;  3H0R B;  1P7D A;  1L6N A;  1KBU A;  2K4E A;  2F2A B;  4OO1 J;  4U6P A;  5T14 A;  2Q4T A;  2DF4 B;  2XVT A;  3D2N A;  1CRX A;  2KNJ A;  2ZIV A;  2LBO A;  2LYA A;  2RP5 A;  3RFA A;  2ZIW A;  3SAF A;  3IN5 A;  5HR6 A;  2KHQ A;  2KV2 A;  2F8L A;  2G5I B;  3AQF A;  1UPH A;  3DEE A;  4OJ6 A;  1PVR A;  2A3V A;  2CRX A;  2HOI A;  2OH2 A;  4CGZ A;  1GO3 F;  2W7P A;  2D6F C;  3CP8 A;  3N7P D;  4WJ3 B;  1A0P A;  1URJ A;  2HOQ A;  2Y0S F;  3F2D A;  2G07 A;  3LYS A;  3M6Z A;  2H3Q A;  2LKY A;  2ZIU A;  1A6S A;  2W04 A;  2HBJ A;  2K8B B;  4NWI A;  1IIP A;  2HBL A;  2JGA A;  4PL2 A;  1F44 A;  2W03 A;  4QIW F;  4CDG A;  1NZB A;  3NUQ A;  3NRW A;  3T79 A;  2DQN B;  2KEY A;  4P0Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...