2KICA

N-nafy. n-terminal domain of nafy
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
96
structure length
96
Chain Sequence
MVTPVNMSRETALRIALAARALPGTTVGQLLEILHQRIEGPLTEESLQGVSVTDLKIGLAGSEEDVDMLDTPMSALKDAVRILWGEAEVDSLPQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding,metal transport
molecule keywords Nitrogenase gamma subunit
publication title Biological activity and solution structure of the apo-dinitrogenase binding domain of NafY
rcsb
source organism Azotobacter vinelandii
total genus 11
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2009-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16844 DIMCO_N Dinitrogenase iron-molybdenum cofactor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.590 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kicA00
2KICA
chains in the Genus database with same CATH superfamily
7ICMA 4JB3A 3N7PD 3RJHA 7ICVA 9ICQA 3GIJA 4PGXA 5F9NA 9ICWA 1Z1BA 4UAYA 5KFXA 4GC7A 1WCNA 3C5FA 2HOFA 2E1FA 4G9BA 2A19A 1XSNA 3BZCA 5J8YA 2KKPA 1PZNA 5HHHA 3FAHA 2KIVA 3B0XA 1XS9D 5AM2A 2W3SA 2H3IA 4NJ8A 4F93B 2P35A 1SKSA 5ALFA 4OJ6A 3M1YA 4UAVA 3F5EA 4QZ8A 1KLNA 5J2CA 1NK9A 2MUTB 1C20A 2W9CA 2ZIUB 2ZXIA 4DQPA 2XY6A 1D9DA 4DFMA 3KZIU 4MEYA 4KLEA 1L8OA 1WG8A 3RB3A 1ZETA 1BPXA 9ICNA 1K1QA 1IXRA 5KFZA 3IG5A 4YXMA 3BQ0A 1MQ2A 1X40A 4QWEA 2BR0A 1EXNA 4TUSA 1X2IA 2G5IB 3MGHA 1ZD3A 1Q46A 2YMPA 4RUCA 5ALZA 5ALPA 1ZJNA 1ZQOA 2KJ8A 4Z6CA 2PKEA 4NLCA 1UCVA 2ZTEA 3RJIA 2F2AB 5DGAA 3EZ5A 2W04A 1NKCA 3JPQA 2C2EA 4DSFA 3GFKB 3TADA 3QNMA 5KFWA 4R65A 4QWAA 3Q8KA 3K1ZA 3BS5B 2Y1IA 2JEGA 1TAQA 2EDUA 2RQ5A 4UARA 3V72A 2LYAA 4R8UA 4EBEA 4IRDA 5KFKA 7ICTA 5AM5A 4I2GA 3M8SA 5AI8A 3S6JA 2LMRA 1WYGA 4QWCA 8ICYA 5DB7A 3SV3A 2ZIWA 4ED1A 3TADC 3PW2A 3MDCA 2H3FA 3QUCA 1ECWA 2KK0A 5AM0A 2BCVA 4IR9A 3M6KA 4M04A 3I76A 4AYBC 8ICFA 9ICUA 1TE2A 2RDIA 1IM4A 1D8YA 2KSOB 1UQVA 3OPXA 1QSSA 5C5JA 1TK5A 3TAPA 3IHQB 3PNCA 2Q4TA 4IQWA 1LB2B 5KG1A 2WAQF 1SIJA 4TUPA 4ECXA 4OJPA 4O3PA 5AI6A 5IIJA 9ICRA 3C23A 3QZ7A 4C8MA 1RYUA 1Z4OA 4DOCA 3AQEA 3ALRA 4QZ9A 3GIKA 9ICLA 2XIDA 3M7DA 4GXJA 4NM1A 1NKBA 1CRXA 4CRXA 2A1JA 5ALWA 3VCBA 4FS1A 2PFPA 5KFUA 1F0MA 2ASJA 4QWBA 2DF4B 5L1IA 3O0FA 4MEXA 2QARB 3UQ0A 1CUKA 3WKCA 5ALVA 2YTUA 4UATA 4ECVA 4PH5A 2YMQA 2NV3A 4F5RA 1NJXA 4O3QA 5J0YA 1L3SA 4P0PB 4ECQA 4DL2A 2W54A 5J0WA 4RQ5A 4MF2A 4Y2YA 4KTQA 5KG7A 5IILA 4DFJA 1GO3F 4PZOA 4XUSA 3G6XA 1QQ5A 4DL4A 1L5UA 3PR5B 2IHNA 2ISPA 5ALHA 4YMOA 4EYIB 4NV0A 3OJSA 1B22A 3IM1A 5D46A 3FDSA 7ICPA 3WK8A 2KD1A 2RRDA 9ICCA 3QUQA 3KOOA 5ALKA 3PX6A 2PFQA 1ZQMA 3H8JA 4B9NA 4PPXA 4M6WB 3QE9Y 2LYHA 3SAGA 5KFBA 3RH4A 5KT4A 2M0NA 4DSLA 1KTQA 3RB0A 4I2IA 2HW3A 3GZFA 4O3MA 4UQGA 3TARA 3C28A 4F4WA 4UAZA 9ICXA 3TAQA 4YG2A 2I5HA 4UBBA 1QCKA 1FO4A 1TK8A 4RPYA 1N60A 4G3IA 3EPIA 4RQ4A 1TV9A 3NVVA 2LKYA 5E79U 4BJQA 1L7MA 1ZQGA 4C4TA 2RHFA 2BCRA 2B0CA 4J9OA 1N5XA 5TISU 2ZIXA 1NOMA 1JIHA 1ZQEA 4QNLA 5EE3A 2G08A 1TK0A 2YMLA 4U7CA 3GQCA 4BWJA 1B4FA 2NO4A 5KFCA 1HUZA 3QU9A 1HEKA 4NY8A 2ZJAA 2PXIA 5IIIA 5G5GA 1ZQKA 3EPGA 1U45A 8ICUA 1NNLA 1FFVA 4Y2JA 4M2YA 1IV8A 8ICRA 4GLXA 1U4BA 4IQVA 4ELVA 3L5KA 2BQUA 4NLNA 4QZBA 2ASDA 1P7DA 2JXJA 3RH6A 4I2HA 2ZUDA 5KT5A 1T94A 1BNPA 5ALNA 4OCZA 4O9MA 2BCUA 2WAQC 2F1JA 1QSLA 2N1RA 4UAWA 3HW8A 2W9AA 1ZQPA 5KFYA 1ZQZA 2F44A 7ICGA 4JK1A 5J29A 3OSPA 3M8RA 1ZQVA 4M9LA 5ALOA 4DEZA 4DO9A 1PVQA 5IIKA 4F4YA 2Y9UA 3UMCA 3SENA 4ECSA 3A0BU 4Y2QA 3TKAA 3RJFA 2YY6A 3EWAA 2PFOA 5ALMA 4R8UB 4QIWF 3NUQA 4FS2A 4EENA 1MQ3A 2XC9A 1Q8KA 4ELTA 8ICJA 2D3DA 4CGZA 2XY5A 1ZOLA 1N2XA 2MA1A 2K4HA 3RH5A 1ZQ1C 5HP4A 2ZIWB 4IL6U 2QLTA 1X66A 2ASLA 9ICJA 4F5QA 3K4GA 2HBMA 4QZAA 3V6JA 3TFRA 4PHAA 3AU6A 2C22A 5KFEA 5J2HA 2F1HA 5G5HA 2K4EA 5AI5A 3PSFA 5KT2A 3NASA 1SL1A 3SEIA 4P4MA 4Q8EA 2YB4A 2A1AA 3LWMA 2HSZA 1ZD4A 3D6JA 3Q8LA 2K8CB 5ALUA 5AK3A 3D2QA 4C0ZA 1L7PA 2A3VA 1N56A 3BQ2A 1NK0A 4NM2A 2JH7A 4ECWA 1LKYA 3OJUA 1KW4A 4RQMA 2M9NA 4BWMA 2FE9A 4YD1A 4ECUA 3LWLA 2R8IA 1TVAA 1DOQA 5GTIU 5J2FA 1V85A 3R9KA 1WUDA 8ICAA 2A1JB 1HJPA 4USAA 1H38A 4PHDA 5L1JA 2HVIA 1JX4A 3RJJA 1QQ7A 3QXGA 3MR2A 4ACOA 3AL0B 5KFMA 1T4GA 3Q8RB 3WK6A 5CJ7A 5DG8A 4I2BA 9ICFA 4RQ2A 4Q8FA 9ICIA 2E8MA 5KFHA 3IV6A 3FM9A 4TQSA 2QARA 4RQ3A 3Q8PB 3AM9A 1T3NA 1UA0A 3MC1A 1KQQA 1Z4NA 5EWEA 4I2FA 1O03A 2W9MA 3FC4A 4FZLA 4KLLA 3OHAA 3MR5A 3AEVA 5EWGA 4PJ0U 4DFDA 3C1ZA 5ALLA 3KFUF 4GIBA 2BQRA 4P0PA 1F44A 4F2SA 2FI1A 1N62A 1ZQQA 2HBLA 1U49A 3WK7A 3TACB 3TFSA 4F4ZA 1NK8A 2KZZA 4JV1A 3LVVA 1PK1A 3RTVA 4DFPA 3PO5A 5J2EA 1ZQNA 2B21A 1J2MA 3QU5A 1SZPA 5J2GA 3AU2A 5AKZA 4B6JA 9ICEA 3T5KA 4ICAA 1SV4A 4M6WA 3GIMA 1S0MA 4KLUA 3ZDCA 3SQIA 3CP8A 2Q0ZX 3V6KA 5B66U 4Q44A 3PMLA 5HHIA 3UPQA 3N28A 2VA2A 2I6XA 5ALTA 2IOHA 3H4DA 5HNKA 5J2BA 4U6PA 4Q45A 1U9LA 4FBTA 5KFRA 7ICIA 2BCQA 3N7SC 1URJA 1S10A 2F1IA 2ZIXB 3L3FX 3GV8B 2KKVA 4J9PA 3JPPA 2P6UA 2WF7A 3RRHA 4J9NA 2JMGA 2UVRA 5L9XA 4QIWC 4Y2PA 2Y9TA 2NRTA 1AROP 2ODGA 3NVZA 3QU4A 1C7YA 2BPCA 1VLBA 5A0LA 5AKGA 5KG0A 1XSPA 5J2IA 5KT7A 1YZ6A 1N48A 3N97B 2FPMA 1B43A 2DGZA 9ICSA 5CRXA 4IRCA 3QEAZ 1UPHA 2DUYA 2XI9A 4C8NA 5C0YA 4GFJA 5DKWA 4CF3A 4F2RA 2ATLA 4M0AA 9ICHA 1ZQUA 4I2EA 4NWIA 2ESEA 4J03A 3PR4A 1F5SA 2KJ9A 4QJFB 4B9MA 2W03A 2IHMA 4UB6U 1T7PA 5J0UA 1TAMA 3PW4A 3NRWA 4US8A 4F92B 2MSNA 2GLEA 5KFIA 3GDXA 4YQWA 1BGXT 4ECZA 5J0QA 5FP0A 9ICVA 5DQHA 1V97A 4J9KA 5DG7A 5T14A 4KLMA 2W55A 2ZJ5A 3JPNA 1BPDA 3WKBA 5J0XA 2IOFK 4IQUA 3ZDBA 1J2NA 4OJOA 4EX6A 5KFNA 1KFTA 1J97A 5L1LA 9ICBA 5AI9A 5AKLA 1RZTA 4UASA 3SV4A 4QZDA 5KL1B 2R18A 2D6FC 2E1EA 5H2FU 4F50A 4GXIA 1ZD2P 4YN4A 5KG2A 3RF9A 5EWFA 1KFSA 4DQRA 4XQ8A 4O5CA 5ALDA 1XU4A 4YCXA 3PSPA 4M9GA 4DSEA 1SB3C 5J2AA 4O0IA 3SZ2A 2XVTA 2CXYA 4DL6A 5DLGA 3U26A 4QWDA 4ED2A 1SXEA 2KIWA 2OXOA 3KD3A 2J6TA 3KKAC 2KZMA 4YFKA 1QQ6A 5ALRA 3M9NB 1XNSA 2IMWP 8ICXA 3T3FA 2VJ5A 2Y0SF 3OGUA 3V7KA 3E2EA 2HCFA 5KG3A 2HHUA 5DB8A 2EAOA 2HBKA 3UMBA 4FFDA 1LKYB 2JHDA 4YR3A 1X42A 1ZJMA 5GTHU 4RNNA 2P6RA 1B0XA 1S0VA 5CP2A 4KLFA 1NK6A 4GXKA 5KFGA 2WTFA 2NRVA 5KG5A 2FPKA 3WK5A 2WHEA 1KDHA 2K89A 5KL8B 5AKXA 3ICXA 1RYSA 5K4LA 5AM4A 2MRLA 3CYMA 3IN5A 1KL9A 4I2AA 2E3TA 2YN4A 1L7OA 4DOAA 3ISCA 2KFNA 8ICCA 3RB6A 4EBDA 4R64A 2PMZF 2W8LA 4EYHB 2G0AA 3RR8A 9ICTA 3LYSA 2KEYA 4WJ3B 2J6SA 4MFFA 3ZDEA 1DXSA 1ZQTA 2C2DA 4J9QA 4C7YA 2AQ0A 2DPJA 4BDPA 1ZQJA 4KLOA 2E8OA 3ZD9A 4Z6DA 2JRZA 3ZD8A 1PK1B 1ZQWA 1X9SA 3SI8A 3NTUA 2GH1A 1BNOA 2VJ4A 2EZZA 4Y2VA 5KG4A 3MFHA 2YQEA 4KLTA 3RJGA 4PHEA 4JV2A 2AQ4A 3AMZA 4DFKA 5HMMA 5L1KA 4B9UA 1NK5A 1JXLA 3E58A 3WU2U 3NGDA 4IS7A 1S76D 3T5LA 1O08A 1ZQLA 4ECTA 3PSIA 2WB1F 3SAHA 4M47A 5AKHA 1KRPA 1FEZA 4KLJA 2J6UA 8ICSA 4ED7A 2BPFA 1Z1VA 1FIQA 2UVVA 1ZQBA 1L7NA 8ICVA 3LDAA 4ED0A 4I27A 4Y2SA 3TI0A 4KLSA 3BS7A 7ICUA 3PW7A 4BX9C 5J2KA 4ZOHC 4QZGA 5DBAA 1N61A 1RQLA 4P4PA 4C8OA 4DLGA 3H8SA 4RT3A 1T3QA 3MR3A 1TFRA 3HKZF 2R8HA 5BOMA 1SZHA 2EQYA 3HILA 2XGQA 1KFDA 4RQNA 2PI4A 3F2BA 2WF5A 3QEBZ 1UT5A 2K8AA 3Q8MA 1NK7A 4C8KA 4YR0A 3I1YA 8ICTA 2ZUCA 1Y88A 5KG6A 1V38A 2EZYA 2XCPA 4I28A 4J9RA 3H7IA 3SD7A 5J2DA 2JH1A 2DBYA 3QUBA 5KTQA 1A6SA 1Z00B 1S97A 3WKAA 5HMLA 2ALZA 4NLKA 3QU2A 4PGQA 1NJYA 4UBCA 2WF8A 3RJKA 5EOZA 3T5JA 1NJWA 2JZBB 3K1RB 3KHGA 4O3RA 3AUOA 3QUTA 2WFAA 3KHLA 8ICHA 4ELUA 2ZXHA 1L3VA 4F4XA 2ZJ8A 2KFZA 4F3OA 2E8NA 2KJ5A 3TQ1A 2XICA 2V4RA 3RAQA 2CPRA 4PGYA 1X9XA 7ICQA 4Y2XA 1JN3A 2K60A 4UB8U 4QW9A 1ZQCA 3ZDAA 5KFOA 2LM1A 4QZFA 4Y2RA 5IINA 5J0RA 1BPEA 3N7RC 2KNJA 3PMNA 4P0QB 4B9VA 1LV5A 3MFIA 3PX4A 4YVZA 3L4PA 2Y1JA 4Z6EA 1N63A 1SKRA 4I29A 3WKDA 9ICOA 2BDUA 3ZI4A 2AGOA 2FMQA 4IR1A 5DBBA 3QZ8A 4JWNA 3EUB2 2P66A 2HBJA 4JUZA 3KHHA 2BZFA 2VKQA 1Z19A 2FPLA 1X9WA 5ALGA 4CCHA 2K4IA 3C2MA 1A76A 2BDPA 1RPLA 1UA1A 4YXJA 5ALSA 4CF4A 2DFLA 4RQ6A 2ZIVB 4M9JA 3PSTA 2VA8A 3RBDA 1QH9A 3OHBA 1V9PA 2DQNB 2G5HB 4RQ7A 3QU7A 1D8BA 2CN1A 4NLZA 3E0FA 3G6YA 2WB1C 3V7LA 1Q3UA 3HPOA 2K4PA 1S0NA 4FZNA 4RQ8A 2W3RA 3AN1A 7ICFA 4JMUA 2HHTA 1L3TA 4UW9A 4CDGA 4KN4A 1XO0A 4DWIA 2LI6A 5AIAA 2FDRA 1JXEA 4MFAA 4O3NA 4F71A 4NLBA 2UVUA 2AGQA 4C4RA 2NRZA 5ALIA 1XWLA 7ICLA 1QLNA 2DKZA 2W9BA 3QYPA 2KVSA 2FLPA 4FBUA 5KFTA 4C8LA 5KFSA 2EZXA 4RQ1A 5KFFA 3HKZC 7ICHA 4I2JA 1DRGA 4PZNA 3WK4A 1JRPA 2OCEA 2JGAA 3EW9A 5L1MA 1SL0A 5KAIU 3BQ7A 8ICLA 1XSLA 5JUMA 1SXDA 4DL7A 2KMDA 3RB4A 5BPCA 2HMXA 4RQ0A 3IG8A 2W43A 1TAUA 8ICNA 4RPXA 2ISOA 4FE3A 3ETRA 3RR7A 1L6NA 2BGWA 4DL5A 4AYBF 2AXTU 1QTMA 2XGPA 3SYZA 1DK3A 4UB4A 1ZD5A 4DS5A 1SWWA 1NI3A 1RDFA 4DF4A 4HYKA 2NO5A 2EH9A 4EBCA 4C4SA 4DL3A 4B9TA 3UXOA 4QW8A 2H5XA 5AHXA 3RBEA 1WWVA 3A0HU 1OXJA 1U47A 3RRGA 3V7JA 1A0PA 5AK5A 4K4GA 1S9FA 3HWTA 2ZTCA 5F3XB 4ZH4A 5AKKA 3HP6A 5KFVA 4YMMA 4YD2A 4LJXA 2AU0A 2HI0A 4KX5A 3ETLA 3D2SA 1ZQDA 5J0SA 4DSKA 4O3SA 2KE7A 2AJQA 4NXZA 4OD0A 2GO7A 4CF5A 2BQ3A 2IOFA 4MHVA 5KT3A 2MAXA 2BPGA 5ALXA 4JV0A 3C2LA 4DS4A 4A8EA 1ZQHA 4BXOA 7ICRA 1SV0A 2K8BB 2I1QA 3H40A 1Q3VA 4PL2A 8ICPA 4UB5A 1YT3A 4MF8A 1ZYQA 4CE6A 3UMGA 7ICOA 4O3OA 1PK3A 5DGBA 3H0MB 2QB0B 5AKJA 3ORYA 2ZG6A 3ZDDA 3CRXA 3MR6A 2L5YA 4XRHA 5CHGA 5F9LA 4IQTA 4UB2A 3PO4A 5J8YC 5J2JA 4F8RA 5KNIA 3Q8SB 4DLEA 3T5HA 3NVWA 4TUQA 4RU9A 1RG6A 4NLGA 3KTQA 4EZ9A 2H3QA 5JU5A 4P4OA 1Z00A 1SV0C 2QKQA 2WF9A 1BPZA 8ICMA 3LK9A 2DPIA 4Y2UA 4US9A 2RDJA 2RLTA 3UXPA 2JZBA 2BHNA 2W8KA 3SR6A 4QZCA 2KG5A 3H4BA 4UAUA 3HT3A 4DQSA 3CW2C 2FMSA 3N4MB 1OUQA 2FLNA 7ICSA 4DSIA 2HHVA 2F76X 2YX8A 1CEZA 2G06A 2VIXA 3KBBA 3KKAA 4Q43A 2XCAA 1ZQAA 5IIMA 1KSPA 5EE9A 2HOIA 2JEIA 2LM4A 3Q8QB 5J0OA 4DOBA 4J9LA 2QB1A 4P0QA 4RPZA 3PZPA 2VA3A 3HX0A 1HUOA 5ALJA 2Z7JA 2YMMA 3PY8A 4ED3A 3H8WA 4AP9A 3IP4B 2IBKA 2HDOA 1RXVA 2C2RA 2ES6A 3TANA 4RNMA 1K5OA 4ECYA 3H0RB 2EAMA 1PVPA 2F8LA 3FYHA 4DQIA 8ICKA 2MU2A 2KV2A 3PV8A 4F4KA 2R8KA 3F2CA 9ICKA 4O5EA 3DDHA 2LYBA 2ZIVA 1SGGA 4KLQA 2ZTDA 3UXNA 3PX0A 1RYRA 4O5KA 3B9JA 2FLLA 4GC6A 2UVWA 4BUGA 4M9HA 4IRKA 2R8GA 3MGIA 1ZQIA 2RP5A 2VANA 3UM9A 3ISDA 2JEJA 3ED5A 3NVYA 4NL9A 3JPRA 3BDPA 3KHRA 1TKDA 4OO1J 2LPEA 2W9BB 2DL0A 3PW5A 2GOLA 7ICJA 1WCLA 1BVSA 5CWRA 5KFQA 3M6ZA 1DGSA 5AM3A 4P2HA 5BOLA 1ZXIA 2D8CA 5AICA 3BQ1A 1S8OA 2V9WA 3B0YA 1KN5A 3GV7B 4YR2A 4NL9C 2F8KA 3H8MA 1BPBA 1WWUA 4LZGA 1RXWA 1A77A 4K4HA 5HR7A 4KMUA 3PVXA 3ISBA 4ED6A 5JRTA 1MSWD 2WF6A 4F5OA 1M6YA 5KFPA 5D49A 4KLIA 1OW5A 1ZQXA 2PFNA 3QX7A 5J0TA 2GWSA 4KLDA 1VDVA 3UQ2A 1UHUA 1SWVA 3BQTA 4X5VA 4ECRA 4YP3A 2IA6A 1RQNA 1YZ7A 2EANA 5HR6A 2NYVA 4LZDA 4UB3A 4M9NA 5KT6A 2G07A 9ICMA 8ICEA 1S77D 2OYYA 3WK9A 2H3VA 4LVSA 1COKA 1XC9A 5AK4A 2AGPA 2AH5A 4XA5A 5ALQA 2OHFA 5DB9A 1KBUA 5KFDA 4F91B 8ICOA 1QSYA 4CNQA 3F2DA 1L8LA 1DK2A 2NRWA 5DDMA 3J81j 3C29A 4BXOB 4YMNA 5CR0A 4E0DA 2HHXA 1RM6C 2KICA 3D2NA 3C5GA 2W7PA 5B5EU 2KHVA 2W11A 5ALEA 3MABA 1X6JA 2EAPA 2C28A 3SAFA 2HHSA 1Z3EB 1JALA 2O6KA 4PL1A 1UT8A 8ICBA 1HIWA 3OTQA 2W9CB 1BPYA 2KVCA 7ICNA 5ALYA 3K75D 2Y0SC 2DWQA 4F5NA 4C7ZA 3C21A 2QB0A 1NJZA 4KLHA 4F72A 4J9SA 4RT2A 2MUTA 1T8EA 4C80A 1DGJA 2ZIUA 3F53A 5EE0A 5DQIA 3C1YA 2LHTA 8ICZA 2LBOA 7ICEA 2BCSA 4EELA 4BGDA 1ZQYA 9ICPA 3I28A 1U48A 1IG6A 3DEEA 2H3ZA 5J0PA 3ONNA 2HHWA 4DSJA 1ZQFA 2PI5A 9ICGA 3SMVA 3DV9A 1FFUA 3LVWA 5IIOA 1XO1A 5DB6A 2BKEA 4RNOA 4K4IA 1K1SA 2E8PA 8ICQA 3RFAA 3GILA 4HAIA 3THVA 4KX3A 1JROA 2I9GA 3AQFA 4OJLA 3EYZA 1NK4A 1JUDA 5AI0A 1AQ6A 2PMZC 3IRUA 5CB1A 3M9MB 1ZRMA 3F5AA 2KN7A 2CRXA 5D4BA 5DDYA 3HRDD 5DG9A 3MBYA 5AKEA 2R8JA 4QZHA 1MA7A 1JI7A 5AI4A 1KEJA 3BS5A 7ICKA 1ZQRA 5AM1A 4R63A 5KFJA 3MGVA 5TZVA 3MDAA 5KFAA 3OSNA 2ZUBA 4DCCA 1NKEA 4RUAA 4RZRA 1S5LU 4EZ6A 1X6IA 1IIPA 3KZXA 4EEKA 2KHQA 5AKYA 4DQQA 4Y2TA 1COOA 3CNHA 2FMPA 3JPSA 4TURA 1NZBA 1LVHA 1MC8A 1PUZA 8ICIA 2KSOA 3M9OB 1X9MA 4KLGA 2OM6A 4EX7A 2KZ3A 3WKEA 5DBCA 2KTQA 4F5PA 4EEYA 3GU3A 2YB1A 2FJ6A 4I2CA 1MN8A 5AKIA 8ICGA 3G6VA 3GV5B 4ED8A 4FO6A 3NS1A 2OH2A 1JMSA 4KMOB 3H0LB 2JV3A 1SKWA 5CA7A 3GIIA 3RAXA 4JWMA 5KAFU 1D9FA 1CI4A 2JR5A 3RJEA 8ICWA 2F77X 4UB1A 1KKXA 2XO7A 4Z6FA 2W7OA 3VC8A 1VJ5A 3T79A 9ICAA 5KFLA 5DLFA 2KOBA 3C2KA 3V6HA 2NRXA 4OJ5A 3JPTA 1ZRNA 5AK6A 4J9MA 2DKXA 2XY7A 3HJEA 2G09A 4KN7A 5EE1A 2HOQA 2V4QA 2E5SA 1D8LA 5JTIA 4FZMA 2OEHA 1N5WA 2OWOA 4TQRA 3NRZA 1S0OA 4IC9A 4R66A 4PHPA 2AHOB 4QZEA 2JEFA 4B9SA 4DF8A 1NZPA 2F3NA 4MFCA 2HHQA 1PVRA 5CEHA 4QZIA 5AIBA 2HVHA 4KITB 3IDWA 2B6GA 1ZQSA 5DQGA 3PW0A 1ED1A 1L3UA 3JPOA 1SL2A 2KP7A 3BZKA 4I2DA 4B9LA 3BJYA
chains in the Genus database with same CATH topology
1DRGA 2NV3A 3N7PD 4PL2A 2K89A 3GU3A 2YB1A 1YT3A 3N7RC 3H0RB 2JGAA 5T14A 2KNJA 3DEEA 2H3ZA 1HEKA 5KL8B 4P0QB 3ICXA 3K1ZA 3PSFA 1PVPA 3ONNA 4P0PB 2F8LA 5HR6A 1Z1BA 3H0MB 2YB4A 4ICAA 4BX9C 2KV2A 2ZG6A 2LYAA 2HOFA 2MRLA 2OH2A 2E1FA 4KMOB 1GO3F 3SMVA 3SQIA 3H0LB 3CP8A 3CRXA 2K8CB 2KKPA 4OJOA 2BDUA 3F2CA 3CYMA 3LVWA 3D2QA 4C0ZA 3IN5A 2HMXA 3HKZF 2LYBA 2ZIVA 2G07A 3IG8A 1SZHA 2A3VA 3RFAA 2H3QA 2H3IA 2OYYA 2JH7A 4NV0A 2H3VA 2HBJA 4U6PA 2PMZF 2F77X 4KX3A 2ZIWA 3F2BA 3HKZC 4FE3A 1P7DA 2G0AA 2KD1A 2VKQA 3AQFA 2RRDA 4OJLA 3LYSA 2K8AA 2H3FA 5KL1B 2R18A 4BUGA 4OJ6A 1Z19A 1L6NA 1ECWA 2PMZC 4AYBF 2D6FC 3N7SC 1URJA 2KEYA 2K4IA 2E1EA 3F5EA 1T94A 3M6KA 1WUDA 2ZIXB 3L3FX 2W7OA 3RF9A 2KKVA 3VC8A 4WJ3B 2RP5A 3T79A 1KBUA 4AYBC 3SAGA 3F5AA 2CRXA 2WAQC 2N1RA 2KOBA 3PSPA 2JMGA 2M0NA 2ZIUB 2ZXIA 4OJ5A 4OO1J 1MA7A 3OPXA 4ACOA 4QIWC 2ZIVB 3F2DA 3AL0B 2GOLA 2XVTA 3PSTA 3C29A 3GZFA 2JH1A 1OUQA 4O3MA 2G09A 2DQNB 2HOQA 2G5HB 2KICA 3D2NA 2GH1A 3C28A 1PVQA 2Q4TA 1A6SA 2E5SA 5A0LA 2VJ4A 2F76X 2W7PA 2YX8A 3M6ZA 1D8BA 2KHVA 4FZMA 2CN1A 2G06A 2VIXA 2KIWA 3E0FA 3MGVA 2OXOA 2WB1C 1Q3UA 3IG5A 2WAQF 1A0PA 3SAFA 4OJPA 4FZNA 4PL1A 2HOIA 2LKYA 1XNSA 2G5IB 2DGZA 4QIWF 4IC9A 4BJQA 2VJ5A 4FZLA 3NUQA 1HIWA 2Y0SF 4JMUA 5CRXA 1UPHA 4CDGA 2XI9A 5C0YA 1XO0A 4CGZA 2KVCA 2ZXHA 2RHFA 2HBKA 3ALRA 3AQEA 4GFJA 4P0QA 2Y0SC 2XIDA 3KFUF 4KX5A 3D2SA 2MA1A 1IIPA 4P0PA 2K4HA 3KZXA 3PZPA 1PVRA 1ZQ1C 2KJ5A 3M7DA 1F44A 2JHDA 2KJ8A 2KHQA 2XICA 3PSIA 2WB1F 4NWIA 5HR7A 1CRXA 4CRXA 2CPRA 2ZIXA 2HBLA 2ZIWB 4NLCA 3VCBA 2Z7JA 3SAHA 4NLBA 2KJ9A 4QJFB 2W03A 2DF4B 2F2AB 1NZBA 3IP4B 3O0FA 2ZIUA 1ED1A 1TAMA 3F53A 4QNLA 3NRWA 2LHTA 2HBMA 2W04A 2G08A 2OM6A 2LBOA 3LVVA 4A8EA 4U7CA 2K8BB 1Q3VA 2K4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIC A; 
#chains in the Genus database with same CATH topology
 7ICM A;  4JB3 A;  3N7P D;  3RJH A;  7ICV A;  9ICQ A;  3GIJ A;  4PGX A;  5F9N A;  9ICW A;  1Z1B A;  4UAY A;  5KFX A;  4GC7 A;  1WCN A;  3C5F A;  2HOF A;  2E1F A;  4G9B A;  2A19 A;  1XSN A;  3BZC A;  5J8Y A;  2KKP A;  1PZN A;  5HHH A;  3FAH A;  2KIV A;  3B0X A;  1XS9 D;  5AM2 A;  2W3S A;  2H3I A;  4NJ8 A;  4F93 B;  2P35 A;  1SKS A;  5ALF A;  4OJ6 A;  3M1Y A;  4UAV A;  3F5E A;  4QZ8 A;  1KLN A;  5J2C A;  1NK9 A;  2MUT B;  1C20 A;  2W9C A;  2ZIU B;  2ZXI A;  4DQP A;  2XY6 A;  1D9D A;  4DFM A;  3KZI U;  4MEY A;  4KLE A;  1L8O A;  1WG8 A;  3RB3 A;  1ZET A;  1BPX A;  9ICN A;  1K1Q A;  1IXR A;  5KFZ A;  3IG5 A;  4YXM A;  3BQ0 A;  1MQ2 A;  1X40 A;  4QWE A;  2BR0 A;  1EXN A;  4TUS A;  1X2I A;  2G5I B;  3MGH A;  1ZD3 A;  1Q46 A;  2YMP A;  4RUC A;  5ALZ A;  5ALP A;  1ZJN A;  1ZQO A;  2KJ8 A;  4Z6C A;  2PKE A;  4NLC A;  1UCV A;  2ZTE A;  3RJI A;  2F2A B;  5DGA A;  3EZ5 A;  2W04 A;  1NKC A;  3JPQ A;  2C2E A;  4DSF A;  3GFK B;  3TAD A;  3QNM A;  5KFW A;  4R65 A;  4QWA A;  3Q8K A;  3K1Z A;  3BS5 B;  2Y1I A;  2JEG A;  1TAQ A;  2EDU A;  2RQ5 A;  4UAR A;  3V72 A;  2LYA A;  4R8U A;  4EBE A;  4IRD A;  5KFK A;  7ICT A;  5AM5 A;  4I2G A;  3M8S A;  5AI8 A;  3S6J A;  2LMR A;  1WYG A;  4QWC A;  8ICY A;  5DB7 A;  3SV3 A;  2ZIW A;  4ED1 A;  3TAD C;  3PW2 A;  3MDC A;  2H3F A;  3QUC A;  1ECW A;  2KK0 A;  5AM0 A;  2BCV A;  4IR9 A;  3M6K A;  4M04 A;  3I76 A;  4AYB C;  8ICF A;  9ICU A;  1TE2 A;  2RDI A;  1IM4 A;  1D8Y A;  2KSO B;  1UQV A;  3OPX A;  1QSS A;  5C5J A;  1TK5 A;  3TAP A;  3IHQ B;  3PNC A;  2Q4T A;  4IQW A;  1LB2 B;  5KG1 A;  2WAQ F;  1SIJ A;  4TUP A;  4ECX A;  4OJP A;  4O3P A;  5AI6 A;  5IIJ A;  9ICR A;  3C23 A;  3QZ7 A;  4C8M A;  1RYU A;  1Z4O A;  4DOC A;  3AQE A;  3ALR A;  4QZ9 A;  3GIK A;  9ICL A;  2XID A;  3M7D A;  4GXJ A;  4NM1 A;  1NKB A;  1CRX A;  4CRX A;  2A1J A;  5ALW A;  3VCB A;  4FS1 A;  2PFP A;  5KFU A;  1F0M A;  2ASJ A;  4QWB A;  2DF4 B;  5L1I A;  3O0F A;  4MEX A;  2QAR B;  3UQ0 A;  1CUK A;  3WKC A;  5ALV A;  2YTU A;  4UAT A;  4ECV A;  4PH5 A;  2YMQ A;  2NV3 A;  4F5R A;  1NJX A;  4O3Q A;  5J0Y A;  1L3S A;  4P0P B;  4ECQ A;  4DL2 A;  2W54 A;  5J0W A;  4RQ5 A;  4MF2 A;  4Y2Y A;  4KTQ A;  5KG7 A;  5IIL A;  4DFJ A;  1GO3 F;  4PZO A;  4XUS A;  3G6X A;  1QQ5 A;  4DL4 A;  1L5U A;  3PR5 B;  2IHN A;  2ISP A;  5ALH A;  4YMO A;  4EYI B;  4NV0 A;  3OJS A;  1B22 A;  3IM1 A;  5D46 A;  3FDS A;  7ICP A;  3WK8 A;  2KD1 A;  2RRD A;  9ICC A;  3QUQ A;  3KOO A;  5ALK A;  3PX6 A;  2PFQ A;  1ZQM A;  3H8J A;  4B9N A;  4PPX A;  4M6W B;  3QE9 Y;  2LYH A;  3SAG A;  5KFB A;  3RH4 A;  5KT4 A;  2M0N A;  4DSL A;  1KTQ A;  3RB0 A;  4I2I A;  2HW3 A;  3GZF A;  4O3M A;  4UQG A;  3TAR A;  3C28 A;  4F4W A;  4UAZ A;  9ICX A;  3TAQ A;  4YG2 A;  2I5H A;  4UBB A;  1QCK A;  1FO4 A;  1TK8 A;  4RPY A;  1N60 A;  4G3I A;  3EPI A;  4RQ4 A;  1TV9 A;  3NVV A;  2LKY A;  5E79 U;  4BJQ A;  1L7M A;  1ZQG A;  4C4T A;  2RHF A;  2BCR A;  2B0C A;  4J9O A;  1N5X A;  5TIS U;  2ZIX A;  1NOM A;  1JIH A;  1ZQE A;  4QNL A;  5EE3 A;  2G08 A;  1TK0 A;  2YML A;  4U7C A;  3GQC A;  4BWJ A;  1B4F A;  2NO4 A;  5KFC A;  1HUZ A;  3QU9 A;  1HEK A;  4NY8 A;  2ZJA A;  2PXI A;  5III A;  5G5G A;  1ZQK A;  3EPG A;  1U45 A;  8ICU A;  1NNL A;  1FFV A;  4Y2J A;  4M2Y A;  1IV8 A;  8ICR A;  4GLX A;  1U4B A;  4IQV A;  4ELV A;  3L5K A;  2BQU A;  4NLN A;  4QZB A;  2ASD A;  1P7D A;  2JXJ A;  3RH6 A;  4I2H A;  2ZUD A;  5KT5 A;  1T94 A;  1BNP A;  5ALN A;  4OCZ A;  4O9M A;  2BCU A;  2WAQ C;  2F1J A;  1QSL A;  2N1R A;  4UAW A;  3HW8 A;  2W9A A;  1ZQP A;  5KFY A;  1ZQZ A;  2F44 A;  7ICG A;  4JK1 A;  5J29 A;  3OSP A;  3M8R A;  1ZQV A;  4M9L A;  5ALO A;  4DEZ A;  4DO9 A;  1PVQ A;  5IIK A;  4F4Y A;  2Y9U A;  3UMC A;  3SEN A;  4ECS A;  3A0B U;  4Y2Q A;  3TKA A;  3RJF A;  2YY6 A;  3EWA A;  2PFO A;  5ALM A;  4R8U B;  4QIW F;  3NUQ A;  4FS2 A;  4EEN A;  1MQ3 A;  2XC9 A;  1Q8K A;  4ELT A;  8ICJ A;  2D3D A;  4CGZ A;  2XY5 A;  1ZOL A;  1N2X A;  2MA1 A;  2K4H A;  3RH5 A;  1ZQ1 C;  5HP4 A;  2ZIW B;  4IL6 U;  2QLT A;  1X66 A;  2ASL A;  9ICJ A;  4F5Q A;  3K4G A;  2HBM A;  4QZA A;  3V6J A;  3TFR A;  4PHA A;  3AU6 A;  2C22 A;  5KFE A;  5J2H A;  2F1H A;  5G5H A;  2K4E A;  5AI5 A;  3PSF A;  5KT2 A;  3NAS A;  1SL1 A;  3SEI A;  4P4M A;  4Q8E A;  2YB4 A;  2A1A A;  3LWM A;  2HSZ A;  1ZD4 A;  3D6J A;  3Q8L A;  2K8C B;  5ALU A;  5AK3 A;  3D2Q A;  4C0Z A;  1L7P A;  2A3V A;  1N56 A;  3BQ2 A;  1NK0 A;  4NM2 A;  2JH7 A;  4ECW A;  1LKY A;  3OJU A;  1KW4 A;  4RQM A;  2M9N A;  4BWM A;  2FE9 A;  4YD1 A;  4ECU A;  3LWL A;  2R8I A;  1TVA A;  1DOQ A;  5GTI U;  5J2F A;  1V85 A;  3R9K A;  1WUD A;  8ICA A;  2A1J B;  1HJP A;  4USA A;  1H38 A;  4PHD A;  5L1J A;  2HVI A;  1JX4 A;  3RJJ A;  1QQ7 A;  3QXG A;  3MR2 A;  4ACO A;  3AL0 B;  5KFM A;  1T4G A;  3Q8R B;  3WK6 A;  5CJ7 A;  5DG8 A;  4I2B A;  9ICF A;  4RQ2 A;  4Q8F A;  9ICI A;  2E8M A;  5KFH A;  3IV6 A;  3FM9 A;  4TQS A;  2QAR A;  4RQ3 A;  3Q8P B;  3AM9 A;  1T3N A;  1UA0 A;  3MC1 A;  1KQQ A;  1Z4N A;  5EWE A;  4I2F A;  1O03 A;  2W9M A;  3FC4 A;  4FZL A;  4KLL A;  3OHA A;  3MR5 A;  3AEV A;  5EWG A;  4PJ0 U;  4DFD A;  3C1Z A;  5ALL A;  3KFU F;  4GIB A;  2BQR A;  4P0P A;  1F44 A;  4F2S A;  2FI1 A;  1N62 A;  1ZQQ A;  2HBL A;  1U49 A;  3WK7 A;  3TAC B;  3TFS A;  4F4Z A;  1NK8 A;  2KZZ A;  4JV1 A;  3LVV A;  1PK1 A;  3RTV A;  4DFP A;  3PO5 A;  5J2E A;  1ZQN A;  2B21 A;  1J2M A;  3QU5 A;  1SZP A;  5J2G A;  3AU2 A;  5AKZ A;  4B6J A;  9ICE A;  3T5K A;  4ICA A;  1SV4 A;  4M6W A;  3GIM A;  1S0M A;  4KLU A;  3ZDC A;  3SQI A;  3CP8 A;  2Q0Z X;  3V6K A;  5B66 U;  4Q44 A;  3PML A;  5HHI A;  3UPQ A;  3N28 A;  2VA2 A;  2I6X A;  5ALT A;  2IOH A;  3H4D A;  5HNK A;  5J2B A;  4U6P A;  4Q45 A;  1U9L A;  4FBT A;  5KFR A;  7ICI A;  2BCQ A;  3N7S C;  1URJ A;  1S10 A;  2F1I A;  2ZIX B;  3L3F X;  3GV8 B;  2KKV A;  4J9P A;  3JPP A;  2P6U A;  2WF7 A;  3RRH A;  4J9N A;  2JMG A;  2UVR A;  5L9X A;  4QIW C;  4Y2P A;  2Y9T A;  2NRT A;  1ARO P;  2ODG A;  3NVZ A;  3QU4 A;  1C7Y A;  2BPC A;  1VLB A;  5A0L A;  5AKG A;  5KG0 A;  1XSP A;  5J2I A;  5KT7 A;  1YZ6 A;  1N48 A;  3N97 B;  2FPM A;  1B43 A;  2DGZ A;  9ICS A;  5CRX A;  4IRC A;  3QEA Z;  1UPH A;  2DUY A;  2XI9 A;  4C8N A;  5C0Y A;  4GFJ A;  5DKW A;  4CF3 A;  4F2R A;  2ATL A;  4M0A A;  9ICH A;  1ZQU A;  4I2E A;  4NWI A;  2ESE A;  4J03 A;  3PR4 A;  1F5S A;  2KJ9 A;  4QJF B;  4B9M A;  2W03 A;  2IHM A;  4UB6 U;  1T7P A;  5J0U A;  1TAM A;  3PW4 A;  3NRW A;  4US8 A;  4F92 B;  2MSN A;  2GLE A;  5KFI A;  3GDX A;  4YQW A;  1BGX T;  4ECZ A;  5J0Q A;  5FP0 A;  9ICV A;  5DQH A;  1V97 A;  4J9K A;  5DG7 A;  5T14 A;  4KLM A;  2W55 A;  2ZJ5 A;  3JPN A;  1BPD A;  3WKB A;  5J0X A;  2IOF K;  4IQU A;  3ZDB A;  1J2N A;  4OJO A;  4EX6 A;  5KFN A;  1KFT A;  1J97 A;  5L1L A;  9ICB A;  5AI9 A;  5AKL A;  1RZT A;  4UAS A;  3SV4 A;  4QZD A;  5KL1 B;  2R18 A;  2D6F C;  2E1E A;  5H2F U;  4F50 A;  4GXI A;  1ZD2 P;  4YN4 A;  5KG2 A;  3RF9 A;  5EWF A;  1KFS A;  4DQR A;  4XQ8 A;  4O5C A;  5ALD A;  1XU4 A;  4YCX A;  3PSP A;  4M9G A;  4DSE A;  1SB3 C;  5J2A A;  4O0I A;  3SZ2 A;  2XVT A;  2CXY A;  4DL6 A;  5DLG A;  3U26 A;  4QWD A;  4ED2 A;  1SXE A;  2KIW A;  2OXO A;  3KD3 A;  2J6T A;  3KKA C;  2KZM A;  4YFK A;  1QQ6 A;  5ALR A;  3M9N B;  1XNS A;  2IMW P;  8ICX A;  3T3F A;  2VJ5 A;  2Y0S F;  3OGU A;  3V7K A;  3E2E A;  2HCF A;  5KG3 A;  2HHU A;  5DB8 A;  2EAO A;  2HBK A;  3UMB A;  4FFD A;  1LKY B;  2JHD A;  4YR3 A;  1X42 A;  1ZJM A;  5GTH U;  4RNN A;  2P6R A;  1B0X A;  1S0V A;  5CP2 A;  4KLF A;  1NK6 A;  4GXK A;  5KFG A;  2WTF A;  2NRV A;  5KG5 A;  2FPK A;  3WK5 A;  2WHE A;  1KDH A;  2K89 A;  5KL8 B;  5AKX A;  3ICX A;  1RYS A;  5K4L A;  5AM4 A;  2MRL A;  3CYM A;  3IN5 A;  1KL9 A;  4I2A A;  2E3T A;  2YN4 A;  1L7O A;  4DOA A;  3ISC A;  2KFN A;  8ICC A;  3RB6 A;  4EBD A;  4R64 A;  2PMZ F;  2W8L A;  4EYH B;  2G0A A;  3RR8 A;  9ICT A;  3LYS A;  2KEY A;  4WJ3 B;  2J6S A;  4MFF A;  3ZDE A;  1DXS A;  1ZQT A;  2C2D A;  4J9Q A;  4C7Y A;  2AQ0 A;  2DPJ A;  4BDP A;  1ZQJ A;  4KLO A;  2E8O A;  3ZD9 A;  4Z6D A;  2JRZ A;  3ZD8 A;  1PK1 B;  1ZQW A;  1X9S A;  3SI8 A;  3NTU A;  2GH1 A;  1BNO A;  2VJ4 A;  2EZZ A;  4Y2V A;  5KG4 A;  3MFH A;  2YQE A;  4KLT A;  3RJG A;  4PHE A;  4JV2 A;  2AQ4 A;  3AMZ A;  4DFK A;  5HMM A;  5L1K A;  4B9U A;  1NK5 A;  1JXL A;  3E58 A;  3WU2 U;  3NGD A;  4IS7 A;  1S76 D;  3T5L A;  1O08 A;  1ZQL A;  4ECT A;  3PSI A;  2WB1 F;  3SAH A;  4M47 A;  5AKH A;  1KRP A;  1FEZ A;  4KLJ A;  2J6U A;  8ICS A;  4ED7 A;  2BPF A;  1Z1V A;  1FIQ A;  2UVV A;  1ZQB A;  1L7N A;  8ICV A;  3LDA A;  4ED0 A;  4I27 A;  4Y2S A;  3TI0 A;  4KLS A;  3BS7 A;  7ICU A;  3PW7 A;  4BX9 C;  5J2K A;  4ZOH C;  4QZG A;  5DBA A;  1N61 A;  1RQL A;  4P4P A;  4C8O A;  4DLG A;  3H8S A;  4RT3 A;  1T3Q A;  3MR3 A;  1TFR A;  3HKZ F;  2R8H A;  5BOM A;  1SZH A;  2EQY A;  3HIL A;  2XGQ A;  1KFD A;  4RQN A;  2PI4 A;  3F2B A;  2WF5 A;  3QEB Z;  1UT5 A;  2K8A A;  3Q8M A;  1NK7 A;  4C8K A;  4YR0 A;  3I1Y A;  8ICT A;  2ZUC A;  1Y88 A;  5KG6 A;  1V38 A;  2EZY A;  2XCP A;  4I28 A;  4J9R A;  3H7I A;  3SD7 A;  5J2D A;  2JH1 A;  2DBY A;  3QUB A;  5KTQ A;  1A6S A;  1Z00 B;  1S97 A;  3WKA A;  5HML A;  2ALZ A;  4NLK A;  3QU2 A;  4PGQ A;  1NJY A;  4UBC A;  2WF8 A;  3RJK A;  5EOZ A;  3T5J A;  1NJW A;  2JZB B;  3K1R B;  3KHG A;  4O3R A;  3AUO A;  3QUT A;  2WFA A;  3KHL A;  8ICH A;  4ELU A;  2ZXH A;  1L3V A;  4F4X A;  2ZJ8 A;  2KFZ A;  4F3O A;  2E8N A;  2KJ5 A;  3TQ1 A;  2XIC A;  2V4R A;  3RAQ A;  2CPR A;  4PGY A;  1X9X A;  7ICQ A;  4Y2X A;  1JN3 A;  2K60 A;  4UB8 U;  4QW9 A;  1ZQC A;  3ZDA A;  5KFO A;  2LM1 A;  4QZF A;  4Y2R A;  5IIN A;  5J0R A;  1BPE A;  3N7R C;  2KNJ A;  3PMN A;  4P0Q B;  4B9V A;  1LV5 A;  3MFI A;  3PX4 A;  4YVZ A;  3L4P A;  2Y1J A;  4Z6E A;  1N63 A;  1SKR A;  4I29 A;  3WKD A;  9ICO A;  2BDU A;  3ZI4 A;  2AGO A;  2FMQ A;  4IR1 A;  5DBB A;  3QZ8 A;  4JWN A;  3EUB 2;  2P66 A;  2HBJ A;  4JUZ A;  3KHH A;  2BZF A;  2VKQ A;  1Z19 A;  2FPL A;  1X9W A;  5ALG A;  4CCH A;  2K4I A;  3C2M A;  1A76 A;  2BDP A;  1RPL A;  1UA1 A;  4YXJ A;  5ALS A;  4CF4 A;  2DFL A;  4RQ6 A;  2ZIV B;  4M9J A;  3PST A;  2VA8 A;  3RBD A;  1QH9 A;  3OHB A;  1V9P A;  2DQN B;  2G5H B;  4RQ7 A;  3QU7 A;  1D8B A;  2CN1 A;  4NLZ A;  3E0F A;  3G6Y A;  2WB1 C;  3V7L A;  1Q3U A;  3HPO A;  2K4P A;  1S0N A;  4FZN A;  4RQ8 A;  2W3R A;  3AN1 A;  7ICF A;  4JMU A;  2HHT A;  1L3T A;  4UW9 A;  4CDG A;  4KN4 A;  1XO0 A;  4DWI A;  2LI6 A;  5AIA A;  2FDR A;  1JXE A;  4MFA A;  4O3N A;  4F71 A;  4NLB A;  2UVU A;  2AGQ A;  4C4R A;  2NRZ A;  5ALI A;  1XWL A;  7ICL A;  1QLN A;  2DKZ A;  2W9B A;  3QYP A;  2KVS A;  2FLP A;  4FBU A;  5KFT A;  4C8L A;  5KFS A;  2EZX A;  4RQ1 A;  5KFF A;  3HKZ C;  7ICH A;  4I2J A;  1DRG A;  4PZN A;  3WK4 A;  1JRP A;  2OCE A;  2JGA A;  3EW9 A;  5L1M A;  1SL0 A;  5KAI U;  3BQ7 A;  8ICL A;  1XSL A;  5JUM A;  1SXD A;  4DL7 A;  2KMD A;  3RB4 A;  5BPC A;  2HMX A;  4RQ0 A;  3IG8 A;  2W43 A;  1TAU A;  8ICN A;  4RPX A;  2ISO A;  4FE3 A;  3ETR A;  3RR7 A;  1L6N A;  2BGW A;  4DL5 A;  4AYB F;  2AXT U;  1QTM A;  2XGP A;  3SYZ A;  1DK3 A;  4UB4 A;  1ZD5 A;  4DS5 A;  1SWW A;  1NI3 A;  1RDF A;  4DF4 A;  4HYK A;  2NO5 A;  2EH9 A;  4EBC A;  4C4S A;  4DL3 A;  4B9T A;  3UXO A;  4QW8 A;  2H5X A;  5AHX A;  3RBE A;  1WWV A;  3A0H U;  1OXJ A;  1U47 A;  3RRG A;  3V7J A;  1A0P A;  5AK5 A;  4K4G A;  1S9F A;  3HWT A;  2ZTC A;  5F3X B;  4ZH4 A;  5AKK A;  3HP6 A;  5KFV A;  4YMM A;  4YD2 A;  4LJX A;  2AU0 A;  2HI0 A;  4KX5 A;  3ETL A;  3D2S A;  1ZQD A;  5J0S A;  4DSK A;  4O3S A;  2KE7 A;  2AJQ A;  4NXZ A;  4OD0 A;  2GO7 A;  4CF5 A;  2BQ3 A;  2IOF A;  4MHV A;  5KT3 A;  2MAX A;  2BPG A;  5ALX A;  4JV0 A;  3C2L A;  4DS4 A;  4A8E A;  1ZQH A;  4BXO A;  7ICR A;  1SV0 A;  2K8B B;  2I1Q A;  3H40 A;  1Q3V A;  4PL2 A;  8ICP A;  4UB5 A;  1YT3 A;  4MF8 A;  1ZYQ A;  4CE6 A;  3UMG A;  7ICO A;  4O3O A;  1PK3 A;  5DGB A;  3H0M B;  2QB0 B;  5AKJ A;  3ORY A;  2ZG6 A;  3ZDD A;  3CRX A;  3MR6 A;  2L5Y A;  4XRH A;  5CHG A;  5F9L A;  4IQT A;  4UB2 A;  3PO4 A;  5J8Y C;  5J2J A;  4F8R A;  5KNI A;  3Q8S B;  4DLE A;  3T5H A;  3NVW A;  4TUQ A;  4RU9 A;  1RG6 A;  4NLG A;  3KTQ A;  4EZ9 A;  2H3Q A;  5JU5 A;  4P4O A;  1Z00 A;  1SV0 C;  2QKQ A;  2WF9 A;  1BPZ A;  8ICM A;  3LK9 A;  2DPI A;  4Y2U A;  4US9 A;  2RDJ A;  2RLT A;  3UXP A;  2JZB A;  2BHN A;  2W8K A;  3SR6 A;  4QZC A;  2KG5 A;  3H4B A;  4UAU A;  3HT3 A;  4DQS A;  3CW2 C;  2FMS A;  3N4M B;  1OUQ A;  2FLN A;  7ICS A;  4DSI A;  2HHV A;  2F76 X;  2YX8 A;  1CEZ A;  2G06 A;  2VIX A;  3KBB A;  3KKA A;  4Q43 A;  2XCA A;  1ZQA A;  5IIM A;  1KSP A;  5EE9 A;  2HOI A;  2JEI A;  2LM4 A;  3Q8Q B;  5J0O A;  4DOB A;  4J9L A;  2QB1 A;  4P0Q A;  4RPZ A;  3PZP A;  2VA3 A;  3HX0 A;  1HUO A;  5ALJ A;  2Z7J A;  2YMM A;  3PY8 A;  4ED3 A;  3H8W A;  4AP9 A;  3IP4 B;  2IBK A;  2HDO A;  1RXV A;  2C2R A;  2ES6 A;  3TAN A;  4RNM A;  1K5O A;  4ECY A;  3H0R B;  2EAM A;  1PVP A;  2F8L A;  3FYH A;  4DQI A;  8ICK A;  2MU2 A;  2KV2 A;  3PV8 A;  4F4K A;  2R8K A;  3F2C A;  9ICK A;  4O5E A;  3DDH A;  2LYB A;  2ZIV A;  1SGG A;  4KLQ A;  2ZTD A;  3UXN A;  3PX0 A;  1RYR A;  4O5K A;  3B9J A;  2FLL A;  4GC6 A;  2UVW A;  4BUG A;  4M9H A;  4IRK A;  2R8G A;  3MGI A;  1ZQI A;  2RP5 A;  2VAN A;  3UM9 A;  3ISD A;  2JEJ A;  3ED5 A;  3NVY A;  4NL9 A;  3JPR A;  3BDP A;  3KHR A;  1TKD A;  4OO1 J;  2LPE A;  2W9B B;  2DL0 A;  3PW5 A;  2GOL A;  7ICJ A;  1WCL A;  1BVS A;  5CWR A;  5KFQ A;  3M6Z A;  1DGS A;  5AM3 A;  4P2H A;  5BOL A;  1ZXI A;  2D8C A;  5AIC A;  3BQ1 A;  1S8O A;  2V9W A;  3B0Y A;  1KN5 A;  3GV7 B;  4YR2 A;  4NL9 C;  2F8K A;  3H8M A;  1BPB A;  1WWU A;  4LZG A;  1RXW A;  1A77 A;  4K4H A;  5HR7 A;  4KMU A;  3PVX A;  3ISB A;  4ED6 A;  5JRT A;  1MSW D;  2WF6 A;  4F5O A;  1M6Y A;  5KFP A;  5D49 A;  4KLI A;  1OW5 A;  1ZQX A;  2PFN A;  3QX7 A;  5J0T A;  2GWS A;  4KLD A;  1VDV A;  3UQ2 A;  1UHU A;  1SWV A;  3BQT A;  4X5V A;  4ECR A;  4YP3 A;  2IA6 A;  1RQN A;  1YZ7 A;  2EAN A;  5HR6 A;  2NYV A;  4LZD A;  4UB3 A;  4M9N A;  5KT6 A;  2G07 A;  9ICM A;  8ICE A;  1S77 D;  2OYY A;  3WK9 A;  2H3V A;  4LVS A;  1COK A;  1XC9 A;  5AK4 A;  2AGP A;  2AH5 A;  4XA5 A;  5ALQ A;  2OHF A;  5DB9 A;  1KBU A;  5KFD A;  4F91 B;  8ICO A;  1QSY A;  4CNQ A;  3F2D A;  1L8L A;  1DK2 A;  2NRW A;  5DDM A;  3J81 j;  3C29 A;  4BXO B;  4YMN A;  5CR0 A;  4E0D A;  2HHX A;  1RM6 C;  2KIC A;  3D2N A;  3C5G A;  2W7P A;  5B5E U;  2KHV A;  2W11 A;  5ALE A;  3MAB A;  1X6J A;  2EAP A;  2C28 A;  3SAF A;  2HHS A;  1Z3E B;  1JAL A;  2O6K A;  4PL1 A;  1UT8 A;  8ICB A;  1HIW A;  3OTQ A;  2W9C B;  1BPY A;  2KVC A;  7ICN A;  5ALY A;  3K75 D;  2Y0S C;  2DWQ A;  4F5N A;  4C7Z A;  3C21 A;  2QB0 A;  1NJZ A;  4KLH A;  4F72 A;  4J9S A;  4RT2 A;  2MUT A;  1T8E A;  4C80 A;  1DGJ A;  2ZIU A;  3F53 A;  5EE0 A;  5DQI A;  3C1Y A;  2LHT A;  8ICZ A;  2LBO A;  7ICE A;  2BCS A;  4EEL A;  4BGD A;  1ZQY A;  9ICP A;  3I28 A;  1U48 A;  1IG6 A;  3DEE A;  2H3Z A;  5J0P A;  3ONN A;  2HHW A;  4DSJ A;  1ZQF A;  2PI5 A;  9ICG A;  3SMV A;  3DV9 A;  1FFU A;  3LVW A;  5IIO A;  1XO1 A;  5DB6 A;  2BKE A;  4RNO A;  4K4I A;  1K1S A;  2E8P A;  8ICQ A;  3RFA A;  3GIL A;  4HAI A;  3THV A;  4KX3 A;  1JRO A;  2I9G A;  3AQF A;  4OJL A;  3EYZ A;  1NK4 A;  1JUD A;  5AI0 A;  1AQ6 A;  2PMZ C;  3IRU A;  5CB1 A;  3M9M B;  1ZRM A;  3F5A A;  2KN7 A;  2CRX A;  5D4B A;  5DDY A;  3HRD D;  5DG9 A;  3MBY A;  5AKE A;  2R8J A;  4QZH A;  1MA7 A;  1JI7 A;  5AI4 A;  1KEJ A;  3BS5 A;  7ICK A;  1ZQR A;  5AM1 A;  4R63 A;  5KFJ A;  3MGV A;  5TZV A;  3MDA A;  5KFA A;  3OSN A;  2ZUB A;  4DCC A;  1NKE A;  4RUA A;  4RZR A;  1S5L U;  4EZ6 A;  1X6I A;  1IIP A;  3KZX A;  4EEK A;  2KHQ A;  5AKY A;  4DQQ A;  4Y2T A;  1COO A;  3CNH A;  2FMP A;  3JPS A;  4TUR A;  1NZB A;  1LVH A;  1MC8 A;  1PUZ A;  8ICI A;  2KSO A;  3M9O B;  1X9M A;  4KLG A;  2OM6 A;  4EX7 A;  2KZ3 A;  3WKE A;  5DBC A;  2KTQ A;  4F5P A;  4EEY A;  3GU3 A;  2YB1 A;  2FJ6 A;  4I2C A;  1MN8 A;  5AKI A;  8ICG A;  3G6V A;  3GV5 B;  4ED8 A;  4FO6 A;  3NS1 A;  2OH2 A;  1JMS A;  4KMO B;  3H0L B;  2JV3 A;  1SKW A;  5CA7 A;  3GII A;  3RAX A;  4JWM A;  5KAF U;  1D9F A;  1CI4 A;  2JR5 A;  3RJE A;  8ICW A;  2F77 X;  4UB1 A;  1KKX A;  2XO7 A;  4Z6F A;  2W7O A;  3VC8 A;  1VJ5 A;  3T79 A;  9ICA A;  5KFL A;  5DLF A;  2KOB A;  3C2K A;  3V6H A;  2NRX A;  4OJ5 A;  3JPT A;  1ZRN A;  5AK6 A;  4J9M A;  2DKX A;  2XY7 A;  3HJE A;  2G09 A;  4KN7 A;  5EE1 A;  2HOQ A;  2V4Q A;  2E5S A;  1D8L A;  5JTI A;  4FZM A;  2OEH A;  1N5W A;  2OWO A;  4TQR A;  3NRZ A;  1S0O A;  4IC9 A;  4R66 A;  4PHP A;  2AHO B;  4QZE A;  2JEF A;  4B9S A;  4DF8 A;  1NZP A;  2F3N A;  4MFC A;  2HHQ A;  1PVR A;  5CEH A;  4QZI A;  5AIB A;  2HVH A;  4KIT B;  3IDW A;  2B6G A;  1ZQS A;  5DQG A;  3PW0 A;  1ED1 A;  1L3U A;  3JPO A;  1SL2 A;  2KP7 A;  3BZK A;  4I2D A;  4B9L A;  3BJY A; 
#chains in the Genus database with same CATH homology
 1DRG A;  2NV3 A;  3N7P D;  4PL2 A;  2K89 A;  3GU3 A;  2YB1 A;  1YT3 A;  3N7R C;  3H0R B;  2JGA A;  5T14 A;  2KNJ A;  3DEE A;  2H3Z A;  1HEK A;  5KL8 B;  4P0Q B;  3ICX A;  3K1Z A;  3PSF A;  1PVP A;  3ONN A;  4P0P B;  2F8L A;  5HR6 A;  1Z1B A;  3H0M B;  2YB4 A;  4ICA A;  4BX9 C;  2KV2 A;  2ZG6 A;  2LYA A;  2HOF A;  2MRL A;  2OH2 A;  2E1F A;  4KMO B;  1GO3 F;  3SMV A;  3SQI A;  3H0L B;  3CP8 A;  3CRX A;  2K8C B;  2KKP A;  4OJO A;  2BDU A;  3F2C A;  3CYM A;  3LVW A;  3D2Q A;  4C0Z A;  3IN5 A;  2HMX A;  3HKZ F;  2LYB A;  2ZIV A;  2G07 A;  3IG8 A;  1SZH A;  2A3V A;  3RFA A;  2H3Q A;  2H3I A;  2OYY A;  2JH7 A;  4NV0 A;  2H3V A;  2HBJ A;  4U6P A;  2PMZ F;  2F77 X;  4KX3 A;  2ZIW A;  3F2B A;  3HKZ C;  4FE3 A;  1P7D A;  2G0A A;  2KD1 A;  2VKQ A;  3AQF A;  2RRD A;  4OJL A;  3LYS A;  2K8A A;  2H3F A;  5KL1 B;  2R18 A;  4BUG A;  4OJ6 A;  1Z19 A;  1L6N A;  1ECW A;  2PMZ C;  4AYB F;  2D6F C;  3N7S C;  1URJ A;  2KEY A;  2K4I A;  2E1E A;  3F5E A;  1T94 A;  3M6K A;  1WUD A;  2ZIX B;  3L3F X;  2W7O A;  3RF9 A;  2KKV A;  3VC8 A;  4WJ3 B;  2RP5 A;  3T79 A;  1KBU A;  4AYB C;  3SAG A;  3F5A A;  2CRX A;  2WAQ C;  2N1R A;  2KOB A;  3PSP A;  2JMG A;  2M0N A;  2ZIU B;  2ZXI A;  4OJ5 A;  4OO1 J;  1MA7 A;  3OPX A;  4ACO A;  4QIW C;  2ZIV B;  3F2D A;  3AL0 B;  2GOL A;  2XVT A;  3PST A;  3C29 A;  3GZF A;  2JH1 A;  1OUQ A;  4O3M A;  2G09 A;  2DQN B;  2HOQ A;  2G5H B;  2KIC A;  3D2N A;  2GH1 A;  3C28 A;  1PVQ A;  2Q4T A;  1A6S A;  2E5S A;  5A0L A;  2VJ4 A;  2F76 X;  2W7P A;  2YX8 A;  3M6Z A;  1D8B A;  2KHV A;  4FZM A;  2CN1 A;  2G06 A;  2VIX A;  2KIW A;  3E0F A;  3MGV A;  2OXO A;  2WB1 C;  1Q3U A;  3IG5 A;  2WAQ F;  1A0P A;  3SAF A;  4OJP A;  4FZN A;  4PL1 A;  2HOI A;  2LKY A;  1XNS A;  2G5I B;  2DGZ A;  4QIW F;  4IC9 A;  4BJQ A;  2VJ5 A;  4FZL A;  3NUQ A;  1HIW A;  2Y0S F;  4JMU A;  5CRX A;  1UPH A;  4CDG A;  2XI9 A;  5C0Y A;  1XO0 A;  4CGZ A;  2KVC A;  2ZXH A;  2RHF A;  2HBK A;  3ALR A;  3AQE A;  4GFJ A;  4P0Q A;  2Y0S C;  2XID A;  3KFU F;  4KX5 A;  3D2S A;  2MA1 A;  1IIP A;  4P0P A;  2K4H A;  3KZX A;  3PZP A;  1PVR A;  1ZQ1 C;  2KJ5 A;  3M7D A;  1F44 A;  2JHD A;  2KJ8 A;  2KHQ A;  2XIC A;  3PSI A;  2WB1 F;  4NWI A;  5HR7 A;  1CRX A;  4CRX A;  2CPR A;  2ZIX A;  2HBL A;  2ZIW B;  4NLC A;  3VCB A;  2Z7J A;  3SAH A;  4NLB A;  2KJ9 A;  4QJF B;  2W03 A;  2DF4 B;  2F2A B;  1NZB A;  3IP4 B;  3O0F A;  2ZIU A;  1ED1 A;  1TAM A;  3F53 A;  4QNL A;  3NRW A;  2LHT A;  2HBM A;  2W04 A;  2G08 A;  2OM6 A;  2LBO A;  3LVV A;  4A8E A;  4U7C A;  2K8B B;  1Q3V A;  2K4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...