2E8NA

Solution structure of the c-terminal sam-domain of ephaa2: ephrin type-a receptor 2 precursor (ec 2.7.10.1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDVKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
molecule keywords Ephrin type-A receptor 2
total genus 19
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8nA00
3TADA 2B6GA 2DL0A 2KIVA 3TACB 5J8YA 2KMDA 1B4FA 2E8NA 1SV4A 2QARA 3K1RB 1B0XA 2DKXA 5J8YC 1PK3A 1DXSA 2D3DA 1SV0A 5JTIA 2QARB 1LKYA 1KW4A 2K60A 3BS5A 4RQMA 3KKAC 1SGGA 4NL9A 1Z1VA 4NJ8A 2QKQA 4IS7A 1UCVA 1WWUA 1X40A 2E8OA 4RQNA 5L1MA 4PZNA 3SEIA 2D8CA 2EAMA 2YTUA 3BS7A 4PZOA 2F3NA 2EAOA 2L5YA 2E8MA 1V38A 3IDWA 2KG5A 2F8KA 1RG6A 5F3XB 2DKZA 2JV3A 4MHVA 1SXDA 2F44A 1SXEA 2KE7A 2KSOA 1UQVA 3H8MA 1X66A 4NL9C 5KNIA 2FE9A 1F0MA 2E8PA 3HILA 2QB0B 3SENA 2EAPA 2QB1A 1COKA 2Y9UA 2Y9TA 2KSOB 2LMRA 1OW5A 2K4PA 1PK1A 1WWVA 1X9XA 5JU5A 2QB0A 3KKAA 1OXJA 2GLEA 5JRTA 1LKYB 3BS5B 3TADC 1PK1B 2ESEA 1JI7A 2EANA 1V85A 3BQ7A 2ES6A 1SV0C 2LPEA
chains in the Genus database with same CATH superfamily
4K4HA 2OHFA 2HBKA 2MAXA 2DQNB 3ETRA 2IHNA 3SQIA 1DK3A 2KMDA 4UATA 3RR8A 2JEIA 4RQ2A 4OJ6A 1RXWA 1MC8A 1ZQIA 1U48A 1QCKA 1SKWA 3D6JA 1KEJA 2K8CB 4PHDA 1BGXT 2ZJ8A 2BHNA 1NK6A 4KLGA 4QZDA 4F71A 3SV3A 8ICGA 3H0MB 4FS1A 4RPYA 1HUZA 1LV5A 1S77D 1NKCA 5CRXA 1COOA 2G5IB 1YZ6A 2D8CA 5ALKA 1BPEA 4P4PA 5ALUA 3KHGA 1B22A 4UW9A 5EE1A 3B0XA 2VA8A 4NXZA 5J2KA 5AK4A 4QZHA 2EQYA 1L3TA 4NL9C 4R65A 4NWIA 7ICJA 9ICNA 1ZD5A 2F8LA 2P6RA 2JXJA 5FP0A 2G0AA 4LZDA 2IA6A 5GTHU 1IXRA 3NVZA 3CP8A 3SD7A 1CEZA 2IOHA 4UB2A 1KDHA 1CI4A 2F1JA 7ICKA 1KLNA 3GV7B 1IG6A 8ICSA 3E0FA 1ZETA 5JRTA 3BQ2A 3H0LB 4ECQA 2PMZC 3Q8MA 3PX6A 4GC7A 1L7PA 3BQ7A 3QE9Y 1NZPA 2HHQA 3V6HA 5KFUA 4ELUA 1T8EA 2QARA 2PFPA 3GZFA 4UAWA 5J0PA 3Q8SB 5DG7A 4UASA 4XA5A 2HHUA 5ALNA 3CW2C 3QUTA 5DB8A 4FFDA 1KSPA 2FPKA 1Q3UA 5IIJA 4NY8A 2KIWA 2K89A 2H3IA 4R8UB 1ZD4A 4PL2A 4QIWC 3JPNA 1Q3VA 3R9KA 2NRXA 4MF8A 4EYIB 2HHXA 4CE6A 2HHSA 2YN4A 1X2IA 3KHHA 1FFVA 4O5CA 3ISDA 3SMVA 3V7JA 4C4RA 3RJKA 3FDSA 4QIWF 4M9GA 5KFTA 1CRXA 2BCRA 4R66A 3SYZA 1M6YA 3KOOA 5KAIU 8ICYA 2AJQA 4PHAA 5AK3A 1NJXA 5C5JA 3NVWA 5KFHA 5AKZA 2EAPA 4UB6U 4XUSA 3SAHA 1COKA 4ED0A 3HJEA 2QLTA 2ISPA 1MSWD 1WWVA 1X9XA 5K4LA 1SKRA 4EZ6A 4PGQA 3D2SA 5L1IA 3JPTA 4A8EA 4DFJA 4RQ1A 4O3RA 3PSTA 4QZ9A 1V97A 3T5KA 7ICIA 5CEHA 3TADA 4BUGA 4OO1J 5J8YA 3G6XA 3DV9A 1A76A 1T94A 4JB3A 1BPZA 3C23A 4UAYA 1ZQHA 4KN7A 1MQ2A 2DKXA 2F1IA 1XSPA 3BZCA 5CA7A 4QZIA 1S97A 5IIIA 1N5WA 4NLGA 8ICQA 3I76A 3HX0A 3QU7A 4RUCA 3WKEA 5DQHA 2JHDA 3JPQA 5KFBA 3IG5A 2WHEA 2W9AA 5KG2A 2AGQA 4IQTA 2A3VA 2HHVA 4YFKA 9ICMA 8ICKA 1KFDA 3PW0A 8ICUA 3EYZA 2PFOA 5KT3A 8ICRA 4MFCA 2GOLA 5DG8A 2KKPA 1H38A 5AM0A 2BCVA 3LYSA 4LJXA 5L1JA 4C8LA 2LYBA 1L7NA 3HKZF 5EOZA 2KHVA 5J2EA 4YMNA 2E3TA 4GXJA 4YMMA 5ALSA 4TQSA 3QUCA 1Z00A 1TV9A 2AGOA 2W55A 2QB1A 2YB4A 2H3QA 4YMOA 4DWIA 2AU0A 2LMRA 1SZHA 7ICUA 3LDAA 1UA0A 3RBDA 3UXPA 4DCCA 1ZQJA 2KJ8A 5DKWA 3C1ZA 3IHQB 3Q8LA 4DL7A 7ICTA 5J0YA 2MUTA 2BGWA 1WCLA 5J0WA 3OSPA 2HSZA 5KG3A 3OPXA 5HR7A 1BNPA 4MFAA 4B9MA 4O3PA 3HKZC 2DL0A 3H4DA 2DBYA 3MR5A 2ZG6A 4I2CA 4DOBA 4DQIA 4QWDA 5EWFA 2FDRA 3F53A 4JUZA 7ICFA 4DQSA 4J9NA 3ISBA 2HHWA 3PX0A 3CYMA 1DXSA 4P0QB 5AI4A 2HOFA 5ALEA 3ZDEA 5ALXA 4ACOA 2H3ZA 4PL1A 4Z6FA 4DSIA 5TISU 1SWWA 4I2IA 3NGDA 5KFDA 4ELTA 3C21A 4B9SA 5AICA 1TKDA 4MEXA 2FLPA 2UVVA 5T14A 5ALYA 2DUYA 3QZ8A 4TUPA 4O0IA 1X40A 2WB1C 5AI9A 3SR6A 3ONNA 2XIDA 1DRGA 4PZOA 3T5LA 5L9XA 9ICAA 3PZPA 2F3NA 2Q4TA 4RT3A 1NK4A 1CUKA 4O5EA 1NJYA 2F8KA 2W9CA 2OXOA 4HAIA 1ZQGA 3BQ0A 3WKBA 2AH5A 5G5GA 5KFKA 2CPRA 4OCZA 4RPXA 7ICSA 5KFWA 2XCAA 5HR6A 5J2JA 4O3SA 4AYBF 1JROA 5CJ7A 3RJIA 4M6WB 3V6JA 1F0MA 3JPPA 4KLIA 3CRXA 1EXNA 2K4EA 4ZH4A 4Q8FA 4ED8A 3CNHA 1NZBA 4M6WA 8ICHA 4F4YA 4P4MA 2YMMA 2WF9A 3QYPA 1D9DA 2VJ5A 5ALLA 2ZUDA 2KK0A 4F2RA 4YP3A 5J2IA 4YD2A 3Q8KA 5IIKA 2E5SA 4UAZA 3K4GA 4JWMA 3K1ZA 1NK5A 4XQ8A 1J2MA 4ECWA 1ZQEA 1PVPA 4YXJA 3NASA 1S9FA 2A19A 4QZ8A 4F93B 3F2DA 3AMZA 2FMPA 1HIWA 5AKEA 5AI0A 1KW4A 3SAGA 2PI5A 3ZDCA 1L7OA 2ZJ5A 2MUTB 3GIJA 1AQ6A 4DF8A 7ICNA 5AIAA 1HUOA 2LKYA 3HWTA 4OJOA 1WWUA 4M2YA 5L1MA 5D46A 4DL3A 2UVUA 4Z6CA 5HHIA 1KFSA 1ZQ1C 2IBKA 2KD1A 1RYUA 2R18A 4KLTA 2BCUA 2L5YA 3UPQA 1FO4A 5ALQA 3RJJA 4I2EA 2DKZA 4MHVA 1L7MA 2AGPA 2C22A 8ICXA 3M6KA 4M9JA 3MABA 3HT3A 4NLKA 2ZXIA 2HCFA 1ZQNA 9ICVA 2PFQA 4DSFA 2AQ4A 2W43A 2KOBA 3GV5B 1U4BA 1OW5A 4Y2XA 4GLXA 2FI1A 4QJFB 4CF4A 2KV2A 4RUAA 4QZFA 4DL2A 5KFLA 3PX4A 3KKAA 4C8NA 1OXJA 1JMSA 4IR9A 1ED1A 2CRXA 2XO7A 2W9CB 1A77A 4YVZA 1J97A 3DDHA 2ZTEA 2I5HA 1NJZA 2G09A 1L3VA 3MR3A 1N62A 4IRDA 1N5XA 4P0PB 5KFYA 1JALA 4KITB 3RBEA 3PSFA 4GIBA 5J8YC 5AM1A 1T4GA 1ZQSA 4B9NA 2R8HA 8ICBA 4IQVA 2ZUCA 2IOFK 4KLSA 4RQMA 5KFQA 1S10A 5KFZA 1WUDA 2J6UA 4MEYA 3H8WA 1RXVA 4DL6A 3ZDBA 1DGSA 2VA3A 3C5FA 4RPZA 2WTFA 1U47A 4GC6A 4GFJA 3LWLA 3QU9A 3SEIA 4J9PA 2Q0ZX 3PMNA 3GIIA 4O3NA 2ZIXA 2I6XA 1BPXA 2JEJA 1X9SA 1ZQCA 1N2XA 4YQWA 7ICVA 4RQ7A 5ALHA 2ODGA 3WK4A 3A0HU 4BDPA 4F5NA 2KSOA 3RRGA 4IR1A 2JRZA 1FEZA 3GU3A 7ICRA 4DFDA 1ZQRA 3RF9A 3MR6A 2HVHA 4QWAA 3GIMA 1N48A 5G5HA 1JIHA 1WCNA 4C7ZA 4BWJA 2KN7A 9ICHA 4J9KA 3V7KA 3ZD9A 5DDMA 4EEYA 4F5PA 3L3FX 4Y2RA 2AHOB 1X9WA 1Z3EB 3PR4A 4DLEA 4FS2A 5DG9A 3QEBZ 1K1SA 4Y2PA 1JN3A 2F1HA 4G9BA 3L4PA 4U7CA 2ZTDA 3RB0A 5KT2A 2NYVA 9ICQA 5J0OA 2XY7A 1KTQA 1KFTA 4YG2A 5GTIU 1GO3F 4US9A 1B0XA 2VA2A 1Y88A 3AU6A 2EDUA 4R64A 4ECRA 2V4QA 1PK3A 3PMLA 2W3RA 1ZQLA 4RT2A 2BDPA 1RYRA 3ICXA 1ZQQA 4F50A 1XC9A 4QWEA 3F5AA 1Z1VA 4I2JA 2NRWA 5J2HA 4PPXA 4KMUA 1P7DA 4NM1A 3WKCA 4DEZA 4DL5A 2V4RA 3MR2A 3TI0A 4DS4A 1KQQA 1YZ7A 3SV4A 2JEGA 4EELA 4ECVA 4EX6A 3RJHA 3LK9A 9ICKA 1ZD3A 2J6TA 4UB8U 5ALDA 2MSNA 2E8MA 1J2NA 1MQ3A 3K75D 2WF5A 5KFEA 2VIXA 1DOQA 5ALVA 8ICJA 4I28A 5B5EU 2DGZA 3H8SA 5AKYA 4DSLA 2ZXHA 3TQ1A 5IIMA 3H7IA 3OHAA 1JUDA 3F5EA 3UXNA 2OH2A 4KN4A 5EE9A 2K8BB 3MDAA 4DSEA 3AQEA 2Y9UA 3EW9A 4UARA 3OJSA 5JU5A 4QZAA 4UB4A 5KFPA 1XSLA 1D8BA 2BPCA 2K8AA 2W9MA 4DOCA 5KG1A 4YR2A 4ED2A 3M8RA 3PV8A 4M9HA 5DLGA 2RQ5A 4IL6U 4CNQA 1RYSA 2E1EA 5AKHA 5ALJA 3RB4A 5J2DA 4IRCA 3GFKB 4DS5A 4NV0A 4DQPA 1SV4A 4LVSA 1ZQXA 5KT6A 1Q8KA 1PVRA 2ZIWA 3NVVA 2W11A 1JXLA 4F2SA 2RHFA 1KL9A 4RQ8A 2GWSA 9ICGA 4KLQA 1SL0A 1SGGA 5AI8A 3JPOA 1IIPA 4UB5A 1ZQWA 4B9UA 1L8OA 1YT3A 2YTUA 4AYBC 3V7LA 3DEEA 5KTQA 2G5HB 1S5LU 4C8MA 1TE2A 2EAOA 2C2DA 1SZPA 2KG5A 4QNLA 2BPGA 5KG4A 1RG6A 7ICGA 2F44A 2KE7A 4JV1A 3RB3A 3PVXA 2WAQF 3O0FA 3IG8A 2K4IA 4BJQA 1O08A 2YY6A 5J0QA 1XNSA 4AP9A 1ZD2P 4HYKA 5L1LA 2ZIVA 4BXOB 1RPLA 1PK1A 4Y2TA 1UHUA 1O03A 4K4IA 1K5OA 2ZIUB 3NTUA 2BQRA 4Y2UA 2H3FA 5E79U 2GLEA 4C0ZA 4X5VA 1HJPA 2ZIVB 3LVWA 3MGIA 5JUMA 1BPYA 3QU4A 2R8KA 3OJUA 2EH9A 4O3QA 4JK1A 2ES6A 5KFFA 5CP2A 1IM4A 1UT5A 3TACB 4NLNA 3KHLA 2ATLA 2HBMA 4C7YA 3AU2A 3AN1A 3RJGA 3AEVA 1ZRNA 5DB9A 2W8KA 3UQ2A 4P4OA 5J2FA 2IOFA 3LVVA 4CDGA 1LKYA 3BS5A 1XS9D 2FPLA 2PKEA 2W7OA 3KTQA 5ALFA 4B6JA 2WFAA 2QKQA 2FLNA 2AQ0A 4FZMA 4DF4A 5AI6A 4ICAA 1S76D 4Y2QA 1F44A 4P2HA 2EAMA 3UMBA 4FO6A 4C4TA 3EZ5A 1U9LA 3TARA 2BQUA 5AKXA 4WJ3B 4EBCA 3IDWA 5J2BA 4KTQA 4ZOHC 3TFSA 2HBJA 2BDUA 3C28A 2LYHA 1Z19A 5AIBA 2E8PA 2FJ6A 2G06A 3SENA 4ED1A 4Q8EA 4F4KA 3RH5A 4M47A 8ICTA 2YB1A 2HI0A 5EWEA 4EZ9A 3RH4A 1C20A 4RNNA 4KX3A 3WK6A 4EENA 1LVHA 2MRLA 4E0DA 1LB2B 3OHBA 1L3UA 1N56A 3TADC 1TK8A 4TURA 3M8SA 3SI8A 5ALZA 4J9RA 1T3QA 4RU9A 1AROP 3UQ0A 1JI7A 4Q45A 1ZQBA 4CRXA 3VCBA 4B9VA 1SV0C 4FBTA 1URJA 3C2KA 1MN8A 5DGBA 3JPRA 2LI6A 4NM2A 5BOLA 5AKKA 4ED6A 4Q43A 1KN5A 4R8UA 2HW3A 1T3NA 4TQRA 5B66U 8ICNA 1NK9A 2W03A 5HP4A 9ICUA 3IN5A 2QARB 4KLHA 1N60A 4M04A 4PGYA 5EWGA 4DLGA 1KKXA 2NRVA 5ALGA 3NVYA 1RM6C 5DLFA 4QZEA 5KFVA 3RAQA 3AL0B 4KLDA 3H40A 2JEFA 4KLFA 1Z1BA 1L3SA 3V72A 3KHRA 7ICOA 4J03A 8ICZA 1KBUA 4O9MA 3ALRA 3BS7A 2H5XA 5DQGA 2W8LA 3OGUA 1SL1A 1FFUA 5KG5A 4FZLA 1PZNA 2YMPA 4KLEA 4J9LA 2JV3A 4RNOA 1KRPA 2RDIA 2FE9A 3ISCA 2OEHA 3SZ2A 4J9SA 2XY5A 2BCQA 5ALTA 4J9MA 1DK2A 5CB1A 1QSSA 2LHTA 3EWAA 3QUBA 4LZGA 8ICMA 2Y9TA 1ZXIA 2AXTU 5KT4A 3QX7A 4C8OA 2N1RA 5KFSA 2W04A 4UAVA 2F76X 3QUQA 2E1FA 4NLZA 1QQ7A 4I2BA 9ICWA 4PGXA 2KFNA 1ZQAA 3UMGA 4MF2A 3M1YA 3M7DA 2XC9A 4O3MA 2RRDA 2ESEA 1UT8A 4CF5A 3TAQA 1ZOLA 3AQFA 2EANA 3OTQA 8ICWA 4QZGA 3L5KA 1L8LA 2WAQC 1PVQA 2DWQA 4FZNA 2KIVA 4PHEA 5KFMA 5AM4A 5KAFU 2HHTA 2E8NA 4JMUA 2VANA 1SKSA 5KFGA 4J9QA 3TKAA 2C28A 1U49A 1D9FA 3PNCA 3WU2U 3A0BU 2MA1A 2IMWP 4I29A 5KFJA 3GILA 7ICLA 4F5RA 3RH6A 1ZQVA 4KLUA 1HEKA 2KNJA 1SV0A 5AHXA 3MFHA 2PFNA 3E58A 8ICAA 5EE0A 3LWMA 5J0SA 2Y1JA 2KZMA 4IQUA 3J81j 2K4HA 2YMQA 3KFUF 4PH5A 1WYGA 3G6YA 4ECSA 1UPHA 4ECUA 1VDVA 1U45A 3HP6A 3TANA 1QH9A 1VJ5A 4EBEA 2P66A 2P6UA 3C2LA 5AKGA 9ICOA 4DO9A 2R8JA 5F9NA 2NRZA 3SAFA 5HHHA 2KZ3A 3FAHA 2XICA 1SB3C 2KJ5A 4USAA 3N7SC 3PO4A 2B21A 4Q44A 3QEAZ 4ECYA 4OJLA 1S0NA 3I28A 5ALWA 2M9NA 4ECZA 1S0OA 1ZYQA 1X9MA 4F4ZA 1QTMA 2NV3A 4YCXA 2VJ4A 3RB6A 4MFFA 2C2EA 5DDYA 1XSNA 3MGVA 3KZXA 2HBLA 1RQLA 2MU2A 1ECWA 1NKBA 8ICEA 4RZRA 8ICPA 5KL8B 4C4SA 2OYYA 3EPIA 3M6ZA 3C5GA 1D8YA 5ALRA 3ETLA 2B6GA 4QW8A 4P0QA 8ICIA 1TK0A 4DQQA 2JR5A 3QU2A 1NOMA 5DBAA 1ZQOA 5AKIA 1RQNA 4CCHA 5AK5A 1B43A 1XWLA 3TAPA 2C2RA 3QU5A 5AI5A 2HOIA 2D3DA 3U26A 5DB7A 1WG8A 5L1KA 2JH1A 3Q8QB 3QXGA 4DSKA 1ZQPA 5A0LA 3IP4B 2EZXA 2W3SA 2FLLA 3GV8B 3N4MB 3PO5A 2PXIA 4NJ8A 3UM9A 3WKDA 3F2BA 2E8OA 2OCEA 4RQNA 2F77X 2BCSA 5KFNA 1ZQMA 2RDJA 1ZQYA 1SWVA 4ELVA 5KFAA 1BPBA 1QSLA 4OJPA 4I2FA 3G6VA 1NNLA 2BZFA 5KG6A 4US8A 2DPIA 3N7PD 2UVRA 3HPOA 1F5SA 5AM3A 2PI4A 2KFZA 1X66A 4BGDA 1N63A 3H0RB 3BQTA 2WB1F 3FM9A 4KLLA 3ZDAA 2LYAA 4P0PA 1Q46A 4CF3A 2J6SA 4F4XA 3F2CA 1QSYA 2KTQA 4QZCA 5J2CA 5BOMA 3PY8A 2JZBA 3PSIA 4PJ0U 2KVCA 1Z4NA 4KMOB 2HDOA 8ICLA 5F9LA 3PW7A 1NK0A 1DGJA 4PHPA 1TAQA 4TUSA 1XO1A 5CWRA 9ICIA 3NUQA 3JPSA 1Z00B 3PSPA 2HOQA 2GH1A 2P35A 5J0XA 3N97B 1ZJNA 1NK7A 1OUQA 4EYHB 2EZZA 7ICPA 5KL1B 2CXYA 4F3OA 4EEKA 4RQ6A 4YXMA 2GO7A 5IIOA 1BVSA 3KKAC 7ICMA 4TUQA 1ZQZA 4FBUA 3KBBA 1XO0A 2OWOA 2ZJAA 4F92B 3NRZA 3C2MA 5ALIA 2A1JA 5IILA 9ICTA 4EX7A 9ICEA 2G08A 4OJ5A 5CHGA 1S0MA 3S6JA 3ED5A 4QWBA 2A1JB 4YD1A 5F3XB 5AM2A 3M9NB 2ASJA 3PR5B 3EUB2 2WF6A 3H8MA 4JV2A 1N61A 2DPJA 5D49A 4G3IA 2JH7A 3ORYA 3M9OB 1UA1A 1T7PA 2NO4A 2NO5A 5KG7A 9ICBA 4F8RA 1ZQTA 4K4GA 5HNKA 4DQRA 4F4WA 5KT7A 3KZIU 4NLBA 2KP7A 4ECXA 4M0AA 3RRHA 4F91B 2FMQA 1K1QA 4GXIA 1TAUA 5J0UA 4YR0A 4U6PA 2KJ9A 1X6IA 4F72A 2UVWA 1L6NA 4NLCA 1B4FA 2LBOA 3GIKA 3HW8A 1TFRA 4OD0A 1ZQUA 2NRTA 4KLOA 2Y1IA 5J0TA 4UB1A 2VKQA 4I2HA 1S0VA 2KEYA 3C29A 4GXKA 2JZBB 4I2GA 5ALMA 3AUOA 2BPFA 3BJYA 9ICFA 3PW5A 4XRHA 3B9JA 2ZIXB 4FE3A 8ICVA 3RJEA 4KLMA 4DFPA 4O5KA 5HMLA 4QW9A 3HRDD 2EZYA 1A0PA 4KX5A 5ALOA 1C7YA 3QZ7A 2ISOA 4QZBA 3NS1A 7ICQA 3D2QA 3ZDDA 3MBYA 1SXDA 2DFLA 9ICCA 4C80A 4UBBA 5AKLA 2BR0A 4R63A 2F2AB 3T5HA 3HILA 2QB0B 2H3VA 5C0YA 3B0YA 2B0CA 3E2EA 1SL2A 3H4BA 2R8IA 2KSOB 1Z4OA 2O6KA 1PUZA 3WKAA 3V6KA 3BDPA 4YR3A 1RDFA 4ECTA 3T5JA 2M0NA 2QB0A 4BX9C 3TFRA 2ASLA 2I9GA 2WF8A 5KT5A 5DBBA 3ZI4A 3UXOA 4Z6DA 1ZQDA 2Y0SF 2XGQA 4ED3A 2G07A 1X42A 2CN1A 5KFOA 5DB6A 2R8GA 3K1RB 4RQ3A 1RZTA 1X6JA 2XGPA 1ZJMA 3IRUA 2V9WA 2I1QA 2Y0SC 3MDCA 3OSNA 3Q8RB 5AM5A 4DOAA 5JTIA 2Z7JA 2JMGA 3IM1A 2ALZA 3RTVA 1JXEA 4I27A 4Z6EA 1XU4A 4NL9A 2A1AA 5DQIA 3WK8A 5D4BA 3T79A 3M9MB 5J0RA 2BQ3A 5HMMA 2W9BB 3EPGA 8ICOA 2KHQA 4J9OA 4I2AA 5ALPA 4C8KA 4KLJA 2D6FC 4RQ0A 5KG0A 2FMSA 4DSJA 4M9LA 4JWNA 4CGZA 3PW2A 3FC4A 5J29A 1ZQFA 1A6SA 4IQWA 1V38A 2HMXA 9ICXA 1SXEA 1UQVA 4IRKA 2W54A 9ICLA 4RQ5A 4YN4A 2OM6A 3ZD8A 3D2NA 5CR0A 5H2FU 3GDXA 2XI9A 2XCPA 2LM4A 4UB3A 5TZVA 4DL4A 4Y2VA 1NJWA 2KICA 1LKYB 4IC9A 4B9LA 4DFMA 3BS5B 4Y2SA 5KFCA 3THVA 1JRPA 3RFAA 4QWCA 1S8OA 2IHMA 1BPDA 1V85A 5AK6A 5KFIA 1TK5A 2DF4B 2ZIWB 4F5OA 3C1YA 3WK5A 4RNMA 7ICHA 5J2AA 2JGAA 3RR7A 5IINA 3VC8A 1VLBA 2LM1A 2RLTA 3MC1A 3NRWA 2YMLA 1QQ6A 1ZQKA 9ICJA 1NI3A 4UAUA 2W7PA 3WK9A 2K60A 5J2GA 2PMZF 5AKJA 4EBDA 4Y2JA 1MA7A 1NKEA 3Q8PB 4IS7A 3BQ1A 3UMCA 2KKVA 1UCVA 4JV0A 3PW4A 3BZKA 9ICPA 2XY6A 3I1YA 1V9PA 4F5QA 7ICEA 4DFKA 2HVIA 3N7RC 1TAMA 4UQGA 3GQCA 1BNOA 2RP5A 1ZRMA 1D8LA 4O3OA 3WK7A 8ICCA 1TVAA 2WF7A 3KD3A 1IV8A 3RJFA 4BXOA 5KFXA 3AM9A 5KNIA 9ICSA 3H8JA 2BKEA 3FYHA 1QLNA 2YX8A 2ASDA 4B9TA 4BWMA 3N28A 4I2DA 1JX4A 4ED7A 5EE3A 3MFIA 2W9BA 3IV6A 2K4PA 2KZZA 5DGAA 5KFRA 4RQ4A 2KVSA 4Y2YA 1QQ5A 2ZUBA 5DBCA 4M9NA 2YQEA 3RAXA 2XVTA 1L5UA 1FIQA 2ZTCA 2FPMA 1PK1B 3QNMA 5BPCA 3T3FA 8ICFA 1NK8A 1SIJA 2ZIUA 4UBCA 4PZNA 9ICRA 3MGHA 2LPEA
chains in the Genus database with same CATH topology
3TADA 2B6GA 2DL0A 2KIVA 3TACB 5J8YA 2KMDA 1B4FA 2E8NA 1SV4A 2QARA 3K1RB 1B0XA 2DKXA 5J8YC 1PK3A 1DXSA 2D3DA 1SV0A 5JTIA 2QARB 1LKYA 1KW4A 2K60A 3BS5A 4RQMA 3KKAC 1SGGA 4NL9A 1Z1VA 4NJ8A 2QKQA 4IS7A 1UCVA 1WWUA 1X40A 2E8OA 4RQNA 5L1MA 4PZNA 3SEIA 2D8CA 2EAMA 2YTUA 3BS7A 4PZOA 2F3NA 2EAOA 2L5YA 2E8MA 1V38A 3IDWA 2KG5A 2F8KA 1RG6A 5F3XB 2DKZA 2JV3A 4MHVA 1SXDA 2F44A 1SXEA 2KE7A 2KSOA 1UQVA 3H8MA 1X66A 4NL9C 5KNIA 2FE9A 1F0MA 2E8PA 3HILA 2QB0B 3SENA 2EAPA 2QB1A 1COKA 2Y9UA 2Y9TA 2KSOB 2LMRA 1OW5A 2K4PA 1PK1A 1WWVA 1X9XA 5JU5A 2QB0A 3KKAA 1OXJA 2GLEA 5JRTA 1LKYB 3BS5B 3TADC 1PK1B 2ESEA 1JI7A 2EANA 1V85A 3BQ7A 2ES6A 1SV0C 2LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD A;  2B6G A;  2DL0 A;  2KIV A;  3TAC B;  5J8Y A;  2KMD A;  1B4F A;  2E8N A;  1SV4 A;  2QAR A;  3K1R B;  1B0X A;  2DKX A;  5J8Y C;  1PK3 A;  1DXS A;  2D3D A;  1SV0 A;  5JTI A;  2QAR B;  1LKY A;  1KW4 A;  2K60 A;  3BS5 A;  4RQM A;  3KKA C;  1SGG A;  4NL9 A;  1Z1V A;  4NJ8 A;  2QKQ A;  4IS7 A;  1UCV A;  1WWU A;  1X40 A;  2E8O A;  4RQN A;  5L1M A;  4PZN A;  3SEI A;  2D8C A;  2EAM A;  2YTU A;  3BS7 A;  4PZO A;  2F3N A;  2EAO A;  2L5Y A;  2E8M A;  1V38 A;  3IDW A;  2KG5 A;  2F8K A;  1RG6 A;  5F3X B;  2DKZ A;  2JV3 A;  4MHV A;  1SXD A;  2F44 A;  1SXE A;  2KE7 A;  2KSO A;  1UQV A;  3H8M A;  1X66 A;  4NL9 C;  5KNI A;  2FE9 A;  1F0M A;  2E8P A;  3HIL A;  2QB0 B;  3SEN A;  2EAP A;  2QB1 A;  1COK A;  2Y9U A;  2Y9T A;  2KSO B;  2LMR A;  1OW5 A;  2K4P A;  1PK1 A;  1WWV A;  1X9X A;  5JU5 A;  2QB0 A;  3KKA A;  1OXJ A;  2GLE A;  5JRT A;  1LKY B;  3BS5 B;  3TAD C;  1PK1 B;  2ESE A;  1JI7 A;  2EAN A;  1V85 A;  3BQ7 A;  2ES6 A;  1SV0 C;  2LPE A; 
#chains in the Genus database with same CATH topology
 4K4H A;  2OHF A;  2HBK A;  2MAX A;  2DQN B;  3ETR A;  2IHN A;  3SQI A;  1DK3 A;  2KMD A;  4UAT A;  3RR8 A;  2JEI A;  4RQ2 A;  4OJ6 A;  1RXW A;  1MC8 A;  1ZQI A;  1U48 A;  1QCK A;  1SKW A;  3D6J A;  1KEJ A;  2K8C B;  4PHD A;  1BGX T;  2ZJ8 A;  2BHN A;  1NK6 A;  4KLG A;  4QZD A;  4F71 A;  3SV3 A;  8ICG A;  3H0M B;  4FS1 A;  4RPY A;  1HUZ A;  1LV5 A;  1S77 D;  1NKC A;  5CRX A;  1COO A;  2G5I B;  1YZ6 A;  2D8C A;  5ALK A;  1BPE A;  4P4P A;  5ALU A;  3KHG A;  1B22 A;  4UW9 A;  5EE1 A;  3B0X A;  2VA8 A;  4NXZ A;  5J2K A;  5AK4 A;  4QZH A;  2EQY A;  1L3T A;  4NL9 C;  4R65 A;  4NWI A;  7ICJ A;  9ICN A;  1ZD5 A;  2F8L A;  2P6R A;  2JXJ A;  5FP0 A;  2G0A A;  4LZD A;  2IA6 A;  5GTH U;  1IXR A;  3NVZ A;  3CP8 A;  3SD7 A;  1CEZ A;  2IOH A;  4UB2 A;  1KDH A;  1CI4 A;  2F1J A;  7ICK A;  1KLN A;  3GV7 B;  1IG6 A;  8ICS A;  3E0F A;  1ZET A;  5JRT A;  3BQ2 A;  3H0L B;  4ECQ A;  2PMZ C;  3Q8M A;  3PX6 A;  4GC7 A;  1L7P A;  3BQ7 A;  3QE9 Y;  1NZP A;  2HHQ A;  3V6H A;  5KFU A;  4ELU A;  1T8E A;  2QAR A;  2PFP A;  3GZF A;  4UAW A;  5J0P A;  3Q8S B;  5DG7 A;  4UAS A;  4XA5 A;  2HHU A;  5ALN A;  3CW2 C;  3QUT A;  5DB8 A;  4FFD A;  1KSP A;  2FPK A;  1Q3U A;  5IIJ A;  4NY8 A;  2KIW A;  2K89 A;  2H3I A;  4R8U B;  1ZD4 A;  4PL2 A;  4QIW C;  3JPN A;  1Q3V A;  3R9K A;  2NRX A;  4MF8 A;  4EYI B;  2HHX A;  4CE6 A;  2HHS A;  2YN4 A;  1X2I A;  3KHH A;  1FFV A;  4O5C A;  3ISD A;  3SMV A;  3V7J A;  4C4R A;  3RJK A;  3FDS A;  4QIW F;  4M9G A;  5KFT A;  1CRX A;  2BCR A;  4R66 A;  3SYZ A;  1M6Y A;  3KOO A;  5KAI U;  8ICY A;  2AJQ A;  4PHA A;  5AK3 A;  1NJX A;  5C5J A;  3NVW A;  5KFH A;  5AKZ A;  2EAP A;  4UB6 U;  4XUS A;  3SAH A;  1COK A;  4ED0 A;  3HJE A;  2QLT A;  2ISP A;  1MSW D;  1WWV A;  1X9X A;  5K4L A;  1SKR A;  4EZ6 A;  4PGQ A;  3D2S A;  5L1I A;  3JPT A;  4A8E A;  4DFJ A;  4RQ1 A;  4O3R A;  3PST A;  4QZ9 A;  1V97 A;  3T5K A;  7ICI A;  5CEH A;  3TAD A;  4BUG A;  4OO1 J;  5J8Y A;  3G6X A;  3DV9 A;  1A76 A;  1T94 A;  4JB3 A;  1BPZ A;  3C23 A;  4UAY A;  1ZQH A;  4KN7 A;  1MQ2 A;  2DKX A;  2F1I A;  1XSP A;  3BZC A;  5CA7 A;  4QZI A;  1S97 A;  5III A;  1N5W A;  4NLG A;  8ICQ A;  3I76 A;  3HX0 A;  3QU7 A;  4RUC A;  3WKE A;  5DQH A;  2JHD A;  3JPQ A;  5KFB A;  3IG5 A;  2WHE A;  2W9A A;  5KG2 A;  2AGQ A;  4IQT A;  2A3V A;  2HHV A;  4YFK A;  9ICM A;  8ICK A;  1KFD A;  3PW0 A;  8ICU A;  3EYZ A;  2PFO A;  5KT3 A;  8ICR A;  4MFC A;  2GOL A;  5DG8 A;  2KKP A;  1H38 A;  5AM0 A;  2BCV A;  3LYS A;  4LJX A;  5L1J A;  4C8L A;  2LYB A;  1L7N A;  3HKZ F;  5EOZ A;  2KHV A;  5J2E A;  4YMN A;  2E3T A;  4GXJ A;  4YMM A;  5ALS A;  4TQS A;  3QUC A;  1Z00 A;  1TV9 A;  2AGO A;  2W55 A;  2QB1 A;  2YB4 A;  2H3Q A;  4YMO A;  4DWI A;  2AU0 A;  2LMR A;  1SZH A;  7ICU A;  3LDA A;  1UA0 A;  3RBD A;  3UXP A;  4DCC A;  1ZQJ A;  2KJ8 A;  5DKW A;  3C1Z A;  3IHQ B;  3Q8L A;  4DL7 A;  7ICT A;  5J0Y A;  2MUT A;  2BGW A;  1WCL A;  5J0W A;  3OSP A;  2HSZ A;  5KG3 A;  3OPX A;  5HR7 A;  1BNP A;  4MFA A;  4B9M A;  4O3P A;  3HKZ C;  2DL0 A;  3H4D A;  2DBY A;  3MR5 A;  2ZG6 A;  4I2C A;  4DOB A;  4DQI A;  4QWD A;  5EWF A;  2FDR A;  3F53 A;  4JUZ A;  7ICF A;  4DQS A;  4J9N A;  3ISB A;  2HHW A;  3PX0 A;  3CYM A;  1DXS A;  4P0Q B;  5AI4 A;  2HOF A;  5ALE A;  3ZDE A;  5ALX A;  4ACO A;  2H3Z A;  4PL1 A;  4Z6F A;  4DSI A;  5TIS U;  1SWW A;  4I2I A;  3NGD A;  5KFD A;  4ELT A;  3C21 A;  4B9S A;  5AIC A;  1TKD A;  4MEX A;  2FLP A;  2UVV A;  5T14 A;  5ALY A;  2DUY A;  3QZ8 A;  4TUP A;  4O0I A;  1X40 A;  2WB1 C;  5AI9 A;  3SR6 A;  3ONN A;  2XID A;  1DRG A;  4PZO A;  3T5L A;  5L9X A;  9ICA A;  3PZP A;  2F3N A;  2Q4T A;  4RT3 A;  1NK4 A;  1CUK A;  4O5E A;  1NJY A;  2F8K A;  2W9C A;  2OXO A;  4HAI A;  1ZQG A;  3BQ0 A;  3WKB A;  2AH5 A;  5G5G A;  5KFK A;  2CPR A;  4OCZ A;  4RPX A;  7ICS A;  5KFW A;  2XCA A;  5HR6 A;  5J2J A;  4O3S A;  4AYB F;  1JRO A;  5CJ7 A;  3RJI A;  4M6W B;  3V6J A;  1F0M A;  3JPP A;  4KLI A;  3CRX A;  1EXN A;  2K4E A;  4ZH4 A;  4Q8F A;  4ED8 A;  3CNH A;  1NZB A;  4M6W A;  8ICH A;  4F4Y A;  4P4M A;  2YMM A;  2WF9 A;  3QYP A;  1D9D A;  2VJ5 A;  5ALL A;  2ZUD A;  2KK0 A;  4F2R A;  4YP3 A;  5J2I A;  4YD2 A;  3Q8K A;  5IIK A;  2E5S A;  4UAZ A;  3K4G A;  4JWM A;  3K1Z A;  1NK5 A;  4XQ8 A;  1J2M A;  4ECW A;  1ZQE A;  1PVP A;  4YXJ A;  3NAS A;  1S9F A;  2A19 A;  4QZ8 A;  4F93 B;  3F2D A;  3AMZ A;  2FMP A;  1HIW A;  5AKE A;  5AI0 A;  1KW4 A;  3SAG A;  2PI5 A;  3ZDC A;  1L7O A;  2ZJ5 A;  2MUT B;  3GIJ A;  1AQ6 A;  4DF8 A;  7ICN A;  5AIA A;  1HUO A;  2LKY A;  3HWT A;  4OJO A;  1WWU A;  4M2Y A;  5L1M A;  5D46 A;  4DL3 A;  2UVU A;  4Z6C A;  5HHI A;  1KFS A;  1ZQ1 C;  2IBK A;  2KD1 A;  1RYU A;  2R18 A;  4KLT A;  2BCU A;  2L5Y A;  3UPQ A;  1FO4 A;  5ALQ A;  3RJJ A;  4I2E A;  2DKZ A;  4MHV A;  1L7M A;  2AGP A;  2C22 A;  8ICX A;  3M6K A;  4M9J A;  3MAB A;  3HT3 A;  4NLK A;  2ZXI A;  2HCF A;  1ZQN A;  9ICV A;  2PFQ A;  4DSF A;  2AQ4 A;  2W43 A;  2KOB A;  3GV5 B;  1U4B A;  1OW5 A;  4Y2X A;  4GLX A;  2FI1 A;  4QJF B;  4CF4 A;  2KV2 A;  4RUA A;  4QZF A;  4DL2 A;  5KFL A;  3PX4 A;  3KKA A;  4C8N A;  1OXJ A;  1JMS A;  4IR9 A;  1ED1 A;  2CRX A;  2XO7 A;  2W9C B;  1A77 A;  4YVZ A;  1J97 A;  3DDH A;  2ZTE A;  2I5H A;  1NJZ A;  2G09 A;  1L3V A;  3MR3 A;  1N62 A;  4IRD A;  1N5X A;  4P0P B;  5KFY A;  1JAL A;  4KIT B;  3RBE A;  3PSF A;  4GIB A;  5J8Y C;  5AM1 A;  1T4G A;  1ZQS A;  4B9N A;  2R8H A;  8ICB A;  4IQV A;  2ZUC A;  2IOF K;  4KLS A;  4RQM A;  5KFQ A;  1S10 A;  5KFZ A;  1WUD A;  2J6U A;  4MEY A;  3H8W A;  1RXV A;  4DL6 A;  3ZDB A;  1DGS A;  2VA3 A;  3C5F A;  4RPZ A;  2WTF A;  1U47 A;  4GC6 A;  4GFJ A;  3LWL A;  3QU9 A;  3SEI A;  4J9P A;  2Q0Z X;  3PMN A;  3GII A;  4O3N A;  2ZIX A;  2I6X A;  1BPX A;  2JEJ A;  1X9S A;  1ZQC A;  1N2X A;  4YQW A;  7ICV A;  4RQ7 A;  5ALH A;  2ODG A;  3WK4 A;  3A0H U;  4BDP A;  4F5N A;  2KSO A;  3RRG A;  4IR1 A;  2JRZ A;  1FEZ A;  3GU3 A;  7ICR A;  4DFD A;  1ZQR A;  3RF9 A;  3MR6 A;  2HVH A;  4QWA A;  3GIM A;  1N48 A;  5G5H A;  1JIH A;  1WCN A;  4C7Z A;  4BWJ A;  2KN7 A;  9ICH A;  4J9K A;  3V7K A;  3ZD9 A;  5DDM A;  4EEY A;  4F5P A;  3L3F X;  4Y2R A;  2AHO B;  1X9W A;  1Z3E B;  3PR4 A;  4DLE A;  4FS2 A;  5DG9 A;  3QEB Z;  1K1S A;  4Y2P A;  1JN3 A;  2F1H A;  4G9B A;  3L4P A;  4U7C A;  2ZTD A;  3RB0 A;  5KT2 A;  2NYV A;  9ICQ A;  5J0O A;  2XY7 A;  1KTQ A;  1KFT A;  4YG2 A;  5GTI U;  1GO3 F;  4US9 A;  1B0X A;  2VA2 A;  1Y88 A;  3AU6 A;  2EDU A;  4R64 A;  4ECR A;  2V4Q A;  1PK3 A;  3PML A;  2W3R A;  1ZQL A;  4RT2 A;  2BDP A;  1RYR A;  3ICX A;  1ZQQ A;  4F50 A;  1XC9 A;  4QWE A;  3F5A A;  1Z1V A;  4I2J A;  2NRW A;  5J2H A;  4PPX A;  4KMU A;  1P7D A;  4NM1 A;  3WKC A;  4DEZ A;  4DL5 A;  2V4R A;  3MR2 A;  3TI0 A;  4DS4 A;  1KQQ A;  1YZ7 A;  3SV4 A;  2JEG A;  4EEL A;  4ECV A;  4EX6 A;  3RJH A;  3LK9 A;  9ICK A;  1ZD3 A;  2J6T A;  4UB8 U;  5ALD A;  2MSN A;  2E8M A;  1J2N A;  1MQ3 A;  3K75 D;  2WF5 A;  5KFE A;  2VIX A;  1DOQ A;  5ALV A;  8ICJ A;  4I28 A;  5B5E U;  2DGZ A;  3H8S A;  5AKY A;  4DSL A;  2ZXH A;  3TQ1 A;  5IIM A;  3H7I A;  3OHA A;  1JUD A;  3F5E A;  3UXN A;  2OH2 A;  4KN4 A;  5EE9 A;  2K8B B;  3MDA A;  4DSE A;  3AQE A;  2Y9U A;  3EW9 A;  4UAR A;  3OJS A;  5JU5 A;  4QZA A;  4UB4 A;  5KFP A;  1XSL A;  1D8B A;  2BPC A;  2K8A A;  2W9M A;  4DOC A;  5KG1 A;  4YR2 A;  4ED2 A;  3M8R A;  3PV8 A;  4M9H A;  5DLG A;  2RQ5 A;  4IL6 U;  4CNQ A;  1RYS A;  2E1E A;  5AKH A;  5ALJ A;  3RB4 A;  5J2D A;  4IRC A;  3GFK B;  4DS5 A;  4NV0 A;  4DQP A;  1SV4 A;  4LVS A;  1ZQX A;  5KT6 A;  1Q8K A;  1PVR A;  2ZIW A;  3NVV A;  2W11 A;  1JXL A;  4F2S A;  2RHF A;  1KL9 A;  4RQ8 A;  2GWS A;  9ICG A;  4KLQ A;  1SL0 A;  1SGG A;  5AI8 A;  3JPO A;  1IIP A;  4UB5 A;  1ZQW A;  4B9U A;  1L8O A;  1YT3 A;  2YTU A;  4AYB C;  3V7L A;  3DEE A;  5KTQ A;  2G5H B;  1S5L U;  4C8M A;  1TE2 A;  2EAO A;  2C2D A;  1SZP A;  2KG5 A;  4QNL A;  2BPG A;  5KG4 A;  1RG6 A;  7ICG A;  2F44 A;  2KE7 A;  4JV1 A;  3RB3 A;  3PVX A;  2WAQ F;  3O0F A;  3IG8 A;  2K4I A;  4BJQ A;  1O08 A;  2YY6 A;  5J0Q A;  1XNS A;  4AP9 A;  1ZD2 P;  4HYK A;  5L1L A;  2ZIV A;  4BXO B;  1RPL A;  1PK1 A;  4Y2T A;  1UHU A;  1O03 A;  4K4I A;  1K5O A;  2ZIU B;  3NTU A;  2BQR A;  4Y2U A;  2H3F A;  5E79 U;  2GLE A;  4C0Z A;  4X5V A;  1HJP A;  2ZIV B;  3LVW A;  3MGI A;  5JUM A;  1BPY A;  3QU4 A;  2R8K A;  3OJU A;  2EH9 A;  4O3Q A;  4JK1 A;  2ES6 A;  5KFF A;  5CP2 A;  1IM4 A;  1UT5 A;  3TAC B;  4NLN A;  3KHL A;  2ATL A;  2HBM A;  4C7Y A;  3AU2 A;  3AN1 A;  3RJG A;  3AEV A;  1ZRN A;  5DB9 A;  2W8K A;  3UQ2 A;  4P4O A;  5J2F A;  2IOF A;  3LVV A;  4CDG A;  1LKY A;  3BS5 A;  1XS9 D;  2FPL A;  2PKE A;  2W7O A;  3KTQ A;  5ALF A;  4B6J A;  2WFA A;  2QKQ A;  2FLN A;  2AQ0 A;  4FZM A;  4DF4 A;  5AI6 A;  4ICA A;  1S76 D;  4Y2Q A;  1F44 A;  4P2H A;  2EAM A;  3UMB A;  4FO6 A;  4C4T A;  3EZ5 A;  1U9L A;  3TAR A;  2BQU A;  5AKX A;  4WJ3 B;  4EBC A;  3IDW A;  5J2B A;  4KTQ A;  4ZOH C;  3TFS A;  2HBJ A;  2BDU A;  3C28 A;  2LYH A;  1Z19 A;  5AIB A;  2E8P A;  2FJ6 A;  2G06 A;  3SEN A;  4ED1 A;  4Q8E A;  4F4K A;  3RH5 A;  4M47 A;  8ICT A;  2YB1 A;  2HI0 A;  5EWE A;  4EZ9 A;  3RH4 A;  1C20 A;  4RNN A;  4KX3 A;  3WK6 A;  4EEN A;  1LVH A;  2MRL A;  4E0D A;  1LB2 B;  3OHB A;  1L3U A;  1N56 A;  3TAD C;  1TK8 A;  4TUR A;  3M8S A;  3SI8 A;  5ALZ A;  4J9R A;  1T3Q A;  4RU9 A;  1ARO P;  3UQ0 A;  1JI7 A;  4Q45 A;  1ZQB A;  4CRX A;  3VCB A;  4B9V A;  1SV0 C;  4FBT A;  1URJ A;  3C2K A;  1MN8 A;  5DGB A;  3JPR A;  2LI6 A;  4NM2 A;  5BOL A;  5AKK A;  4ED6 A;  4Q43 A;  1KN5 A;  4R8U A;  2HW3 A;  1T3N A;  4TQR A;  5B66 U;  8ICN A;  1NK9 A;  2W03 A;  5HP4 A;  9ICU A;  3IN5 A;  2QAR B;  4KLH A;  1N60 A;  4M04 A;  4PGY A;  5EWG A;  4DLG A;  1KKX A;  2NRV A;  5ALG A;  3NVY A;  1RM6 C;  5DLF A;  4QZE A;  5KFV A;  3RAQ A;  3AL0 B;  4KLD A;  3H40 A;  2JEF A;  4KLF A;  1Z1B A;  1L3S A;  3V72 A;  3KHR A;  7ICO A;  4J03 A;  8ICZ A;  1KBU A;  4O9M A;  3ALR A;  3BS7 A;  2H5X A;  5DQG A;  2W8L A;  3OGU A;  1SL1 A;  1FFU A;  5KG5 A;  4FZL A;  1PZN A;  2YMP A;  4KLE A;  4J9L A;  2JV3 A;  4RNO A;  1KRP A;  2RDI A;  2FE9 A;  3ISC A;  2OEH A;  3SZ2 A;  4J9S A;  2XY5 A;  2BCQ A;  5ALT A;  4J9M A;  1DK2 A;  5CB1 A;  1QSS A;  2LHT A;  3EWA A;  3QUB A;  4LZG A;  8ICM A;  2Y9T A;  1ZXI A;  2AXT U;  5KT4 A;  3QX7 A;  4C8O A;  2N1R A;  5KFS A;  2W04 A;  4UAV A;  2F76 X;  3QUQ A;  2E1F A;  4NLZ A;  1QQ7 A;  4I2B A;  9ICW A;  4PGX A;  2KFN A;  1ZQA A;  3UMG A;  4MF2 A;  3M1Y A;  3M7D A;  2XC9 A;  4O3M A;  2RRD A;  2ESE A;  1UT8 A;  4CF5 A;  3TAQ A;  1ZOL A;  3AQF A;  2EAN A;  3OTQ A;  8ICW A;  4QZG A;  3L5K A;  1L8L A;  2WAQ C;  1PVQ A;  2DWQ A;  4FZN A;  2KIV A;  4PHE A;  5KFM A;  5AM4 A;  5KAF U;  2HHT A;  2E8N A;  4JMU A;  2VAN A;  1SKS A;  5KFG A;  4J9Q A;  3TKA A;  2C28 A;  1U49 A;  1D9F A;  3PNC A;  3WU2 U;  3A0B U;  2MA1 A;  2IMW P;  4I29 A;  5KFJ A;  3GIL A;  7ICL A;  4F5R A;  3RH6 A;  1ZQV A;  4KLU A;  1HEK A;  2KNJ A;  1SV0 A;  5AHX A;  3MFH A;  2PFN A;  3E58 A;  8ICA A;  5EE0 A;  3LWM A;  5J0S A;  2Y1J A;  2KZM A;  4IQU A;  3J81 j;  2K4H A;  2YMQ A;  3KFU F;  4PH5 A;  1WYG A;  3G6Y A;  4ECS A;  1UPH A;  4ECU A;  1VDV A;  1U45 A;  3HP6 A;  3TAN A;  1QH9 A;  1VJ5 A;  4EBE A;  2P66 A;  2P6U A;  3C2L A;  5AKG A;  9ICO A;  4DO9 A;  2R8J A;  5F9N A;  2NRZ A;  3SAF A;  5HHH A;  2KZ3 A;  3FAH A;  2XIC A;  1SB3 C;  2KJ5 A;  4USA A;  3N7S C;  3PO4 A;  2B21 A;  4Q44 A;  3QEA Z;  4ECY A;  4OJL A;  1S0N A;  3I28 A;  5ALW A;  2M9N A;  4ECZ A;  1S0O A;  1ZYQ A;  1X9M A;  4F4Z A;  1QTM A;  2NV3 A;  4YCX A;  2VJ4 A;  3RB6 A;  4MFF A;  2C2E A;  5DDY A;  1XSN A;  3MGV A;  3KZX A;  2HBL A;  1RQL A;  2MU2 A;  1ECW A;  1NKB A;  8ICE A;  4RZR A;  8ICP A;  5KL8 B;  4C4S A;  2OYY A;  3EPI A;  3M6Z A;  3C5G A;  1D8Y A;  5ALR A;  3ETL A;  2B6G A;  4QW8 A;  4P0Q A;  8ICI A;  1TK0 A;  4DQQ A;  2JR5 A;  3QU2 A;  1NOM A;  5DBA A;  1ZQO A;  5AKI A;  1RQN A;  4CCH A;  5AK5 A;  1B43 A;  1XWL A;  3TAP A;  2C2R A;  3QU5 A;  5AI5 A;  2HOI A;  2D3D A;  3U26 A;  5DB7 A;  1WG8 A;  5L1K A;  2JH1 A;  3Q8Q B;  3QXG A;  4DSK A;  1ZQP A;  5A0L A;  3IP4 B;  2EZX A;  2W3S A;  2FLL A;  3GV8 B;  3N4M B;  3PO5 A;  2PXI A;  4NJ8 A;  3UM9 A;  3WKD A;  3F2B A;  2E8O A;  2OCE A;  4RQN A;  2F77 X;  2BCS A;  5KFN A;  1ZQM A;  2RDJ A;  1ZQY A;  1SWV A;  4ELV A;  5KFA A;  1BPB A;  1QSL A;  4OJP A;  4I2F A;  3G6V A;  1NNL A;  2BZF A;  5KG6 A;  4US8 A;  2DPI A;  3N7P D;  2UVR A;  3HPO A;  1F5S A;  5AM3 A;  2PI4 A;  2KFZ A;  1X66 A;  4BGD A;  1N63 A;  3H0R B;  3BQT A;  2WB1 F;  3FM9 A;  4KLL A;  3ZDA A;  2LYA A;  4P0P A;  1Q46 A;  4CF3 A;  2J6S A;  4F4X A;  3F2C A;  1QSY A;  2KTQ A;  4QZC A;  5J2C A;  5BOM A;  3PY8 A;  2JZB A;  3PSI A;  4PJ0 U;  2KVC A;  1Z4N A;  4KMO B;  2HDO A;  8ICL A;  5F9L A;  3PW7 A;  1NK0 A;  1DGJ A;  4PHP A;  1TAQ A;  4TUS A;  1XO1 A;  5CWR A;  9ICI A;  3NUQ A;  3JPS A;  1Z00 B;  3PSP A;  2HOQ A;  2GH1 A;  2P35 A;  5J0X A;  3N97 B;  1ZJN A;  1NK7 A;  1OUQ A;  4EYH B;  2EZZ A;  7ICP A;  5KL1 B;  2CXY A;  4F3O A;  4EEK A;  4RQ6 A;  4YXM A;  2GO7 A;  5IIO A;  1BVS A;  3KKA C;  7ICM A;  4TUQ A;  1ZQZ A;  4FBU A;  3KBB A;  1XO0 A;  2OWO A;  2ZJA A;  4F92 B;  3NRZ A;  3C2M A;  5ALI A;  2A1J A;  5IIL A;  9ICT A;  4EX7 A;  9ICE A;  2G08 A;  4OJ5 A;  5CHG A;  1S0M A;  3S6J A;  3ED5 A;  4QWB A;  2A1J B;  4YD1 A;  5F3X B;  5AM2 A;  3M9N B;  2ASJ A;  3PR5 B;  3EUB 2;  2WF6 A;  3H8M A;  4JV2 A;  1N61 A;  2DPJ A;  5D49 A;  4G3I A;  2JH7 A;  3ORY A;  3M9O B;  1UA1 A;  1T7P A;  2NO4 A;  2NO5 A;  5KG7 A;  9ICB A;  4F8R A;  1ZQT A;  4K4G A;  5HNK A;  4DQR A;  4F4W A;  5KT7 A;  3KZI U;  4NLB A;  2KP7 A;  4ECX A;  4M0A A;  3RRH A;  4F91 B;  2FMQ A;  1K1Q A;  4GXI A;  1TAU A;  5J0U A;  4YR0 A;  4U6P A;  2KJ9 A;  1X6I A;  4F72 A;  2UVW A;  1L6N A;  4NLC A;  1B4F A;  2LBO A;  3GIK A;  3HW8 A;  1TFR A;  4OD0 A;  1ZQU A;  2NRT A;  4KLO A;  2Y1I A;  5J0T A;  4UB1 A;  2VKQ A;  4I2H A;  1S0V A;  2KEY A;  3C29 A;  4GXK A;  2JZB B;  4I2G A;  5ALM A;  3AUO A;  2BPF A;  3BJY A;  9ICF A;  3PW5 A;  4XRH A;  3B9J A;  2ZIX B;  4FE3 A;  8ICV A;  3RJE A;  4KLM A;  4DFP A;  4O5K A;  5HML A;  4QW9 A;  3HRD D;  2EZY A;  1A0P A;  4KX5 A;  5ALO A;  1C7Y A;  3QZ7 A;  2ISO A;  4QZB A;  3NS1 A;  7ICQ A;  3D2Q A;  3ZDD A;  3MBY A;  1SXD A;  2DFL A;  9ICC A;  4C80 A;  4UBB A;  5AKL A;  2BR0 A;  4R63 A;  2F2A B;  3T5H A;  3HIL A;  2QB0 B;  2H3V A;  5C0Y A;  3B0Y A;  2B0C A;  3E2E A;  1SL2 A;  3H4B A;  2R8I A;  2KSO B;  1Z4O A;  2O6K A;  1PUZ A;  3WKA A;  3V6K A;  3BDP A;  4YR3 A;  1RDF A;  4ECT A;  3T5J A;  2M0N A;  2QB0 A;  4BX9 C;  3TFR A;  2ASL A;  2I9G A;  2WF8 A;  5KT5 A;  5DBB A;  3ZI4 A;  3UXO A;  4Z6D A;  1ZQD A;  2Y0S F;  2XGQ A;  4ED3 A;  2G07 A;  1X42 A;  2CN1 A;  5KFO A;  5DB6 A;  2R8G A;  3K1R B;  4RQ3 A;  1RZT A;  1X6J A;  2XGP A;  1ZJM A;  3IRU A;  2V9W A;  2I1Q A;  2Y0S C;  3MDC A;  3OSN A;  3Q8R B;  5AM5 A;  4DOA A;  5JTI A;  2Z7J A;  2JMG A;  3IM1 A;  2ALZ A;  3RTV A;  1JXE A;  4I27 A;  4Z6E A;  1XU4 A;  4NL9 A;  2A1A A;  5DQI A;  3WK8 A;  5D4B A;  3T79 A;  3M9M B;  5J0R A;  2BQ3 A;  5HMM A;  2W9B B;  3EPG A;  8ICO A;  2KHQ A;  4J9O A;  4I2A A;  5ALP A;  4C8K A;  4KLJ A;  2D6F C;  4RQ0 A;  5KG0 A;  2FMS A;  4DSJ A;  4M9L A;  4JWN A;  4CGZ A;  3PW2 A;  3FC4 A;  5J29 A;  1ZQF A;  1A6S A;  4IQW A;  1V38 A;  2HMX A;  9ICX A;  1SXE A;  1UQV A;  4IRK A;  2W54 A;  9ICL A;  4RQ5 A;  4YN4 A;  2OM6 A;  3ZD8 A;  3D2N A;  5CR0 A;  5H2F U;  3GDX A;  2XI9 A;  2XCP A;  2LM4 A;  4UB3 A;  5TZV A;  4DL4 A;  4Y2V A;  1NJW A;  2KIC A;  1LKY B;  4IC9 A;  4B9L A;  4DFM A;  3BS5 B;  4Y2S A;  5KFC A;  3THV A;  1JRP A;  3RFA A;  4QWC A;  1S8O A;  2IHM A;  1BPD A;  1V85 A;  5AK6 A;  5KFI A;  1TK5 A;  2DF4 B;  2ZIW B;  4F5O A;  3C1Y A;  3WK5 A;  4RNM A;  7ICH A;  5J2A A;  2JGA A;  3RR7 A;  5IIN A;  3VC8 A;  1VLB A;  2LM1 A;  2RLT A;  3MC1 A;  3NRW A;  2YML A;  1QQ6 A;  1ZQK A;  9ICJ A;  1NI3 A;  4UAU A;  2W7P A;  3WK9 A;  2K60 A;  5J2G A;  2PMZ F;  5AKJ A;  4EBD A;  4Y2J A;  1MA7 A;  1NKE A;  3Q8P B;  4IS7 A;  3BQ1 A;  3UMC A;  2KKV A;  1UCV A;  4JV0 A;  3PW4 A;  3BZK A;  9ICP A;  2XY6 A;  3I1Y A;  1V9P A;  4F5Q A;  7ICE A;  4DFK A;  2HVI A;  3N7R C;  1TAM A;  4UQG A;  3GQC A;  1BNO A;  2RP5 A;  1ZRM A;  1D8L A;  4O3O A;  3WK7 A;  8ICC A;  1TVA A;  2WF7 A;  3KD3 A;  1IV8 A;  3RJF A;  4BXO A;  5KFX A;  3AM9 A;  5KNI A;  9ICS A;  3H8J A;  2BKE A;  3FYH A;  1QLN A;  2YX8 A;  2ASD A;  4B9T A;  4BWM A;  3N28 A;  4I2D A;  1JX4 A;  4ED7 A;  5EE3 A;  3MFI A;  2W9B A;  3IV6 A;  2K4P A;  2KZZ A;  5DGA A;  5KFR A;  4RQ4 A;  2KVS A;  4Y2Y A;  1QQ5 A;  2ZUB A;  5DBC A;  4M9N A;  2YQE A;  3RAX A;  2XVT A;  1L5U A;  1FIQ A;  2ZTC A;  2FPM A;  1PK1 B;  3QNM A;  5BPC A;  3T3F A;  8ICF A;  1NK8 A;  1SIJ A;  2ZIU A;  4UBC A;  4PZN A;  9ICR A;  3MGH A;  2LPE A; 
#chains in the Genus database with same CATH homology
 3TAD A;  2B6G A;  2DL0 A;  2KIV A;  3TAC B;  5J8Y A;  2KMD A;  1B4F A;  2E8N A;  1SV4 A;  2QAR A;  3K1R B;  1B0X A;  2DKX A;  5J8Y C;  1PK3 A;  1DXS A;  2D3D A;  1SV0 A;  5JTI A;  2QAR B;  1LKY A;  1KW4 A;  2K60 A;  3BS5 A;  4RQM A;  3KKA C;  1SGG A;  4NL9 A;  1Z1V A;  4NJ8 A;  2QKQ A;  4IS7 A;  1UCV A;  1WWU A;  1X40 A;  2E8O A;  4RQN A;  5L1M A;  4PZN A;  3SEI A;  2D8C A;  2EAM A;  2YTU A;  3BS7 A;  4PZO A;  2F3N A;  2EAO A;  2L5Y A;  2E8M A;  1V38 A;  3IDW A;  2KG5 A;  2F8K A;  1RG6 A;  5F3X B;  2DKZ A;  2JV3 A;  4MHV A;  1SXD A;  2F44 A;  1SXE A;  2KE7 A;  2KSO A;  1UQV A;  3H8M A;  1X66 A;  4NL9 C;  5KNI A;  2FE9 A;  1F0M A;  2E8P A;  3HIL A;  2QB0 B;  3SEN A;  2EAP A;  2QB1 A;  1COK A;  2Y9U A;  2Y9T A;  2KSO B;  2LMR A;  1OW5 A;  2K4P A;  1PK1 A;  1WWV A;  1X9X A;  5JU5 A;  2QB0 A;  3KKA A;  1OXJ A;  2GLE A;  5JRT A;  1LKY B;  3BS5 B;  3TAD C;  1PK1 B;  2ESE A;  1JI7 A;  2EAN A;  1V85 A;  3BQ7 A;  2ES6 A;  1SV0 C;  2LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...