2E8NA

Solution structure of the c-terminal sam-domain of ephaa2: ephrin type-a receptor 2 precursor (ec 2.7.10.1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDVKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
total genus 19
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8nA00
2K4PA 2KSOB 1OXJA 1SV4A 3BQ7A 1PK1B 2QB1A 1OW5A 1Z1VA 5J8YC 4NL9C 3KKAA 1V85A 3TADC 5JU5A 5JTIA 1DXSA 2E8PA 4NJ8A 1B0XA 5L1MA 4IS7A 4RQMA 3SENA 1KW4A 3SEIA 2KG5A 1F0MA 2FE9A 1JI7A 2QB0A 5F3XB 2QKQA 2LPEA 2DKZA 2D3DA 2F44A 3HILA 3KKAC 2EAMA 2K60A 1COKA 2Y9TA 4MHVA 1X9XA 2DKXA 3TACB 1LKYA 1WWUA 1PK1A 4PZNA 1X40A 1SXEA 2YTUA 3H8MA 2EAPA 1X66A 3BS5A 2QARA 1SV0A 2KE7A 2D8CA 5JRTA 2ES6A 2EANA 2F3NA 1WWVA 5KNIA 2ESEA 4PZOA 2Y9UA 2KIVA 2QB0B 1SGGA 2B6GA 1SXDA 2KSOA 2L5YA 3IDWA 2JV3A 2EAOA 2E8NA 2DL0A 1RG6A 1UQVA 1UCVA 1LKYB 2GLEA 5J8YA 1B4FA 4NL9A 1V38A 2E8MA 3TADA 3BS5B 2QARB 2KMDA 2LMRA 2E8OA 4RQNA 2F8KA 3BS7A 1PK3A 1SV0C 3K1RB
chains in the Genus database with same CATH superfamily
4QZBA 2KVSA 1ZQVA 5EE3A 4YR0A 5T14A 2FMQA 4HYKA 1ZQSA 2R18A 4OJ5A 3D2SA 5KG6A 2GWSA 1D9FA 5AK3A 3PR4A 4DLEA 4C8OA 4QWDA 1V9PA 2LKYA 2ZIWB 4UAUA 4O5CA 3ISDA 1Z1BA 4QWBA 3M9OB 4R65A 5L1IA 3WKBA 2EZYA 2MSNA 1TKDA 4BWJA 3FYHA 4BGDA 5KT6A 1ZQ1C 4KLHA 1XSNA 2VA2A 1JALA 2G08A 4I27A 2BPFA 3JPSA 2DKXA 1WWUA 4DSFA 1BPYA 4RPYA 3Q8SB 1S0MA 2FLLA 4ECVA 5F9NA 2BDPA 9ICCA 4P4OA 2F3NA 4NM2A 4RQ5A 5KFXA 2KIVA 2MA1A 3NS1A 5KFKA 7ICFA 4RQ0A 5KFCA 1PVPA 4DEZA 3IRUA 1NK0A 4NLNA 9ICAA 8ICLA 2WAQF 4B9NA 3D2QA 3LDAA 4F4WA 2JGAA 1ZQRA 3B0XA 1K5OA 3C2LA 3PY8A 2DBYA 3H40A 4OJOA 3DDHA 9ICRA 1NI3A 3UMGA 3N7RC 7ICHA 2P35A 4BJQA 1TK5A 2KOBA 5ALYA 2XCPA 2KSOB 1NKEA 2OEHA 3H0RB 2W9CA 1QQ6A 2A3VA 2E1FA 2EQYA 4UBCA 1XC9A 5KFAA 5AI4A 4YXMA 4F5QA 3SAFA 1D8BA 2JR5A 3KKAA 4I2JA 5L1KA 7ICKA 2HDOA 1N61A 1ED1A 3PMLA 1HUOA 1TAUA 3EPIA 1XNSA 1U45A 4KLGA 5KFGA 3UQ0A 1JXLA 4CF5A 1N5WA 4FS2A 2QB0A 4ACOA 5DDMA 2LYAA 3CNHA 4J9RA 2YQEA 1X9XA 7ICLA 4O3QA 3V7KA 1ZD2P 2KJ8A 5AKKA 3PX6A 2NRXA 2IOFK 3L4PA 5KG1A 4MEYA 4RT2A 1B22A 2D8CA 2EANA 3F53A 3UXNA 1WWVA 4UB6U 4B9UA 2W9BA 1Q3UA 3C1ZA 1KN5A 1X9SA 2B6GA 2YMPA 5J2JA 3RB0A 2BCUA 4EX6A 4C7YA 1KSPA 2XGQA 1CUKA 9ICTA 4QZCA 4F4YA 3UQ2A 2RQ5A 3BS5B 3C2MA 2G5IB 4BWMA 5D4BA 4TUQA 4KLUA 1SZPA 5J0RA 5J2HA 4UW9A 1O08A 1NK5A 2A1AA 4LZGA 5KFSA 5KFIA 1SKRA 2EH9A 3T3FA 2ZG6A 3GIJA 3M8RA 2AJQA 2K4HA 4DQRA 1BNPA 5CHGA 5HHIA 4BDPA 3E2EA 4KLEA 4DOAA 4YD2A 2BCQA 1Y88A 1A76A 4Y2JA 2J6UA 4PHAA 3CRXA 2HHTA 2HVIA 3A0HU 1FFVA 9ICGA 1ZQGA 1RZTA 1ZQCA 3RF9A 7ICIA 3SEIA 2BR0A 2EZXA 3ZDAA 5AICA 2IOHA 1TVAA 5DBAA 2K8CB 3NVWA 1L7PA 3ALRA 3TKAA 2KJ5A 4Q45A 2BKEA 3HW8A 4F5RA 1WYGA 3KKAC 3ORYA 4C8LA 7ICPA 4DFMA 4Y2YA 3JPRA 5KAIU 2VJ4A 5CJ7A 2F77X 5AM4A 5DBBA 2YTUA 1T4GA 3RBEA 1M6YA 5KFDA 3LYSA 4UB3A 5IIKA 3F5EA 4M6WA 1ZQHA 4KLLA 1PZNA 3RAQA 4DQPA 2ZIUA 2HCFA 2OHFA 3V6HA 5DG7A 5G5GA 2YMMA 3AU6A 1PVRA 2ASLA 3PSFA 2J6TA 5ALPA 4RUAA 1KEJA 4PL2A 2ATLA 3BQ1A 5EE0A 4RPZA 3GIMA 1JUDA 3RJKA 2QARB 3JPNA 3B9JA 4EYIB 4J03A 3PO5A 4P0QB 2DUYA 2V4RA 4AYBF 3ETLA 5J2DA 1CRXA 4RQ2A 5GTIU 4ECUA 4YP3A 3RB6A 2F1IA 3AL0B 2YB1A 3H0MB 3T79A 4FZLA 4JMUA 3KHHA 3MR3A 1T94A 4DL3A 4EENA 1FEZA 1S9FA 2HVHA 2KKPA 4CF3A 3Q8RB 4KLOA 2ZUCA 4OJ6A 3C23A 1NK8A 2KD1A 1PUZA 1QH9A 1IV8A 4JV0A 3SAGA 2R8KA 5AKJA 2BCVA 2NO5A 5C0YA 2Q0ZX 4I2IA 2QKQA 3T5JA 3D6JA 2I6XA 8ICKA 2FJ6A 5AIBA 2V9WA 5CEHA 4EZ9A 4Y2VA 2CPRA 2W3SA 2FPLA 5H2FU 5KFMA 2ZTCA 5IIJA 4R66A 4ECTA 5KAFU 4US9A 5KNIA 3E58A 4M47A 3IG5A 5J0YA 3PW0A 2KIWA 5D49A 2XY6A 4I2AA 2K8AA 4ED7A 4JWNA 1ZD3A 1Z00B 4UB8U 5A0LA 4YCXA 4XUSA 3QNMA 1UQVA 1UCVA 3AQEA 4IRDA 4KLTA 4JB3A 4DFKA 2YMLA 2GLEA 2ZUDA 4ECRA 9ICKA 1B4FA 1VJ5A 2J6SA 4O9MA 2A1JA 5AKIA 1H38A 1L5UA 2E1EA 4DSEA 4DQIA 3K1RB 4NXZA 2AU0A 5J2GA 2G06A 3PX4A 3ED5A 5AKEA 4F71A 8ICVA 1N60A 2ZIXA 4KLQA 1OW5A 4K4HA 3HKZF 3MFIA 4RQ3A 4FZMA 1SL1A 1L8OA 3MGHA 3L3FX 5DKWA 2P6RA 3L5KA 3AUOA 1OUQA 4GC7A 4MF8A 5AI0A 2E8PA 3GZFA 3KD3A 5L1MA 2AGPA 1L7NA 1XSPA 3CP8A 3TANA 4NLBA 2AGOA 3K1ZA 2W54A 1N56A 1F0MA 3WU2U 1Q8KA 3WKDA 3MR6A 2Z7JA 5ALHA 5EWGA 2BDUA 4F5NA 3OPXA 2BPGA 8ICGA 5F9LA 2Y9TA 3DV9A 4P0PA 4F92B 3HX0A 4EELA 2FPKA 4OO1J 1SXEA 4PH5A 4UB5A 4FZNA 2MUTA 2BCRA 1WCLA 2ZTDA 5ALOA 2LYHA 1L3TA 1TV9A 2W43A 2ESEA 4NY8A 3PV8A 2H3VA 4YMMA 1SXDA 1S0NA 9ICIA 3AQFA 4RNNA 1XSLA 1LKYB 2RHFA 5AKGA 1NK6A 2HHXA 3FC4A 2KHVA 5AKHA 5AKZA 4IR1A 4AP9A 4ECXA 3N97B 5AI8A 4M9LA 4UARA 2Y0SF 2PMZC 3BZCA 1SZHA 1Z4NA 5AKLA 1J2NA 1UA1A 4BX9C 4ED8A 3RTVA 7ICTA 1D8LA 4YFKA 5CR0A 4O3MA 2FMPA 3RH6A 5J2EA 7ICOA 2KZ3A 1ZOLA 1BPBA 5DG9A 1S0VA 3UXPA 2DGZA 4CNQA 3K75D 4KMUA 1SKWA 2OXOA 3ZI4A 4DSJA 4C8KA 4O0IA 3OGUA 5AKYA 4CDGA 1ZJNA 5ALWA 1JI7A 1KFTA 3GV5B 3QEAZ 2DKZA 4PGYA 2D3DA 5J2KA 3OHAA 2PXIA 4K4IA 5ALRA 2ZIVB 2EZZA 2OYYA 4ECWA 2JH1A 2AXTU 1FIQA 1X40A 3PX0A 2NRWA 3BQ0A 4ECQA 3N7SC 3UMBA 1CI4A 2KFNA 3QUQA 1T3NA 2K4EA 4TQRA 1KQQA 3SAHA 3Q8MA 3RH4A 2Y9UA 4NLGA 5AK5A 2JZBB 3M7DA 3RFAA 4KLMA 2L5YA 3IV6A 1UA0A 3GIIA 2PFQA 3KZIU 5KFVA 3MBYA 3KBBA 2CRXA 5KG2A 2W3RA 1WG8A 5KG5A 3WK6A 4C7ZA 4QZDA 3PO4A 3QU7A 2V4QA 8ICUA 2RDJA 4DWIA 4C80A 2HHVA 3GDXA 4UB1A 1L7OA 4MFCA 3FAHA 8ICOA 2P66A 4PHDA 2AH5A 3CW2C 1ZQDA 5L1JA 1J2MA 3ZD8A 2H3ZA 1UHUA 2Y1IA 4IQTA 3MFHA 1N2XA 5KL8B 1ZQKA 3SQIA 4Q8FA 3C5GA 2ZJ8A 1ZQQA 3HT3A 1KBUA 5KFWA 4O3NA 2ZUBA 3MDAA 1HEKA 3CYMA 2FLNA 9ICHA 9ICLA 3SMVA 4UAZA 4RT3A 3V72A 2XY7A 4Y2UA 3LWMA 1DGSA 3H4DA 3LVVA 2BQ3A 4P0QA 4I2CA 3OSNA 1KKXA 5KFOA 5DB6A 5ALSA 2F2AB 4FE3A 4YN4A 1N48A 4RNMA 2PFNA 5KT7A 1V97A 3FM9A 1RQLA 2W7OA 3OTQA 4YXJA 4PZNA 7ICQA 2G0AA 4GXKA 4ZH4A 4DLGA 1U48A 2DF4B 5EWEA 3PSTA 2RP5A 1GO3F 2N1RA 4QZHA 3BJYA 9ICVA 1DOQA 2K89A 2DPJA 3H8WA 3I76A 3H0LB 2HBJA 3HPOA 4M04A 4Q44A 2DL0A 5IIOA 5AI6A 4Y2PA 5DLFA 2KK0A 5J8YA 1C20A 4EEKA 2LM4A 1CEZA 1NK4A 1ZQPA 3Q8LA 2E8MA 4J9QA 1K1QA 4FBTA 2W11A 1MC8A 2LMRA 4Z6EA 5TISU 3QUBA 7ICJA 3BS7A 1BGXT 3SV3A 4YQWA 2CXYA 3QYPA 1X42A 4Q43A 2BQRA 4DL7A 3PSPA 2BQUA 4ELUA 1PK1B 2IA6A 1BVSA 3M6ZA 3OJSA 2KZMA 8ICHA 4ELVA 2BPCA 3RH5A 4O5EA 4F50A 5K4LA 1NJYA 5AM3A 4NLZA 3TARA 8ICAA 4M9GA 4F4ZA 4FO6A 2B0CA 3ETRA 1DK2A 5HMMA 3H8JA 1KTQA 4GIBA 5KFJA 2WB1C 4PHEA 3I1YA 9ICUA 5CWRA 4U7CA 2YB4A 3IG8A 2F1JA 3RB4A 4YR3A 1L3SA 9ICOA 4PHPA 3G6YA 3BDPA 2A19A 2W8KA 4TQSA 3OSPA 4DSIA 1P7DA 8ICBA 5GTHU 3SZ2A 3H8MA 2KFZA 8ICXA 2KVCA 2PI4A 3C5FA 2KE7A 3PW4A 3T5LA 1NNLA 3MABA 1Q3VA 2G07A 1LB2B 4BXOA 4KN7A 5AHXA 1C7YA 4PJ0U 4DL5A 5KFRA 2HSZA 1URJA 4NL9A 4GLXA 4I2DA 3TAPA 3DEEA 4R8UA 2JRZA 4TUPA 2E8OA 1ZJMA 1RXVA 4Y2SA 2NYVA 2FI1A 1TAMA 3MGVA 5BOMA 4Y2QA 2IMWP 3UXOA 1SB3C 2DFLA 5ALVA 4CRXA 3T5KA 5ALTA 4NWIA 1XS9D 4IR9A 4IQUA 1TK8A 4CGZA 1NJWA 1MQ3A 2KTQA 3Q8KA 2ISPA 2RRDA 2WTFA 5J8YC 1SWWA 5AKXA 1ZQYA 1T8EA 9ICWA 2YY6A 1BPXA 3TFRA 5J2IA 8ICWA 2W9CB 4I2FA 4A8EA 3JPTA 1SL2A 3KFUF 1KW4A 5ALKA 4DF8A 4J9PA 1X9WA 4M0AA 3RAXA 4C4SA 2AGQA 3SV4A 1BNOA 2LI6A 2LM1A 3KOOA 1NJXA 3QE9Y 4UAVA 2K60A 1ZQAA 2KJ9A 2DPIA 1XO1A 1JIHA 2KZZA 3V6JA 4ED0A 5AIAA 2EAPA 3EZ5A 5JRTA 2C22A 1U47A 3JPQA 4O3PA 2QB0B 3IDWA 4E0DA 2JV3A 3N4MB 2K8BB 4I2GA 3T5HA 5ALLA 1NK9A 2AQ0A 3QU4A 1NZBA 1AQ6A 3N7PD 2WF8A 4DSKA 4O3OA 4DS4A 2R8GA 3AM9A 1A77A 1S0OA 5HMLA 9ICSA 4F93B 4O3SA 2GO7A 2OH2A 2W9BB 2K4PA 3QU9A 3MR2A 5J0SA 4M9NA 5C5JA 2PFPA 4KTQA 2ZIWA 3BQ7A 1N62A 2ODGA 5ALNA 8ICCA 3EW9A 2ASJA 4IC9A 5AM5A 3WK5A 8ICTA 1X9MA 5KFFA 1X6JA 2C2RA 4M9JA 3H7IA 3ONNA 4NL9C 1ZD5A 4QWEA 7ICRA 5J2FA 4YMOA 3N28A 4YD1A 5DG8A 5L9XA 1N63A 4OJPA 5J0XA 4UAYA 9ICXA 2WF6A 3TFSA 5ALUA 5DLGA 1S97A 5EE1A 4Z6CA 3HJEA 9ICFA 3HWTA 3TQ1A 1S8OA 4IS7A 4KITB 1WUDA 4IL6U 3M6KA 5KG0A 5ALEA 3WK7A 5DB8A 4TURA 1RQNA 2KG5A 1UT5A 1ZQEA 3U26A 2F44A 5HR6A 3OJUA 4OJLA 3RBDA 9ICPA 2IHMA 3RRHA 3HP6A 4UQGA 4WJ3B 4KN4A 4G9BA 5G5HA 3RR7A 3ZDEA 4JK1A 4Q8EA 4C8MA 2HHWA 1KFDA 2C28A 4DF4A 1ZQWA 3JPPA 4JWMA 5BPCA 5DGBA 2HI0A 5AM2A 4ICAA 4KMOB 2LBOA 1JRPA 5D46A 2KSOA 4ECZA 2HHUA 2HMXA 5DB9A 5DGAA 3V6KA 2I1QA 4DL2A 4B9LA 1T7PA 1BPEA 1RG6A 4J9LA 3RJFA 2KHQA 4K4GA 2JEJA 2EDUA 3KHLA 1Z3EB 2PI5A 3QX7A 3SI8A 1ZQXA 4RQ6A 4Z6FA 3ZDBA 4XQ8A 3M8SA 1D9DA 5ALGA 4O3RA 2H3IA 8ICPA 4M6WB 5AM0A 2OCEA 2WF5A 4B9SA 1XWLA 3G6VA 1O03A 5J0QA 4GC6A 3QU5A 3F5AA 3SYZA 2P6UA 3NVVA 3LVWA 4FS1A 2G09A 3M1YA 1MSWD 5KFNA 4F8RA 5CB1A 2KKVA 5KFPA 3JPOA 1L8LA 3K4GA 5ALMA 3GILA 1JX4A 5KFEA 3WK9A 2PFOA 5J2AA 2PMZF 1ECWA 3GFKB 1B0XA 2JXJA 4Y2TA 2BZFA 3PVXA 5KFHA 4UATA 5KT3A 1F44A 3QUTA 4JUZA 5FP0A 4TUSA 4XA5A 2I9GA 2YN4A 4CE6A 4QIWC 2FPMA 4EZ6A 2RDIA 4QWAA 4RZRA 3HILA 3RB3A 4USAA 1DK3A 1L3VA 1PK1A 9ICMA 2JEGA 3HRDD 2XY5A 1QCKA 1QSLA 7ICEA 3BS5A 5ALQA 5KT2A 8ICYA 2UVUA 2E5SA 1FO4A 1HUZA 3BQ2A 5ALZA 3KHRA 5KFTA 4PZOA 3F2CA 3GV7B 2VA3A 2ZXHA 2E8NA 4NLCA 4MFFA 1HJPA 5J2CA 4ECSA 4F5PA 3PSIA 3PW5A 1U4BA 1FFUA 1VLBA 4J9NA 1F5SA 4I2EA 1ZQTA 1KDHA 1V38A 2ZJAA 1KL9A 4B9TA 2JHDA 3J81j 1JMSA 8ICRA 9ICEA 1RYSA 9ICBA 4PPXA 4ED6A 4IQWA 3S6JA 1S10A 1MA7A 3H4BA 5AI5A 4QZGA 4DFJA 1UPHA 3C21A 5DB7A 1LV5A 4EYHB 8ICNA 3RJGA 1XO0A 5KFLA 4FBUA 2HBLA 5ALJA 5ALXA 1IG6A 3NRZA 1NJZA 3PW2A 4DQQA 4P2HA 1VDVA 3SR6A 2A1JB 4J9OA 3RJIA 4UB2A 1SWVA 2MAXA 5ALDA 4DFPA 1ZQNA 3C1YA 1D8YA 3PZPA 5EE9A 2XCAA 3WKEA 9ICJA 5E79U 8ICFA 1B43A 2G5HB 4NJ8A 3WK8A 3WKCA 2JMGA 2UVVA 2ZIXB 4QZEA 4ECYA 4NM1A 1IM4A 4BUGA 1TAQA 1ZQZA 3UMCA 2HOIA 2GOLA 4YMNA 3MGIA 3TAQA 2WAQC 3ISBA 1QSSA 1COKA 5KFYA 5AI9A 5B66U 2VKQA 4MHVA 4IRCA 2B21A 2DWQA 2BCSA 5IINA 5AM1A 5DQIA 3WKAA 2AHOB 2HOQA 4B9VA 5IILA 2QARA 4M2YA 3QXGA 4F4XA 2IBKA 5DQHA 2ES6A 1HIWA 3QU2A 3NGDA 3C29A 2W04A 2FMSA 3NUQA 3M9NB 4UAWA 3GQCA 2HHQA 3Q8PB 3E0FA 4PGQA 3PMNA 1QQ7A 2QLTA 1ZRNA 4US8A 5J2BA 2UVWA 4UBBA 2OWOA 2ZJ5A 4P0PB 1ZRMA 3ZDDA 3I28A 8ICMA 3ZDCA 1T3QA 2F1HA 4KX3A 1MN8A 2MUTB 4RPXA 2KMDA 4F4KA 4RU9A 8ICSA 3QUCA 2R8IA 3GU3A 2W55A 3AEVA 2M0NA 9ICNA 4EX7A 4G3IA 1EXNA 4FFDA 4I28A 1BPDA 2K4IA 1SV4A 4UB4A 2VA8A 4GFJA 7ICMA 2QB1A 2XGPA 5KT5A 3NRWA 2R8JA 4LJXA 2BHNA 2WF9A 4RQ7A 4F72A 3EYZA 4YVZA 1ZQBA 2YMQA 3F2DA 3AU2A 1YT3A 2NV3A 1DXSA 5KG4A 1A0PA 1UT8A 3ICXA 4DS5A 2PKEA 1RXWA 3FDSA 3QZ7A 7ICNA 4GXJA 5TZVA 3WK4A 5IIMA 4EBEA 4OCZA 2LPEA 3R9KA 1U49A 5IIIA 2VJ5A 1Z00A 5DBCA 2HOFA 1NOMA 4HAIA 5KFZA 3NVYA 3TACB 1Z19A 1S76D 4F5OA 2VIXA 2ASDA 2CN1A 3M9MB 2R8HA 1S5LU 1SV0A 2UVRA 2WB1F 3RJEA 3F2BA 2AQ4A 1PVQA 4IQVA 4GXIA 1L6NA 5BOLA 2HHSA 3EPGA 3VCBA 1NK7A 2EAOA 4QW9A 1ZXIA 5KG7A 7ICSA 5J0PA 2YX8A 5J0WA 1XU4A 3MC1A 1ZQOA 2XO7A 1QTMA 2JH7A 5ALIA 3TADA 2O6KA 2ALZA 4O5KA 3BZKA 1SIJA 3GIKA 3SD7A 4Z6DA 2ZTEA 2KEYA 2H3QA 5HNKA 2DQNB 3NASA 2JEFA 1LVHA 4QWCA 4RQ8A 2Y1JA 2W9MA 2W03A 4IRKA 2ISOA 3D2NA 4DOBA 1Z1VA 3RJHA 1Z4OA 2VANA 2RLTA 7ICGA 5KT4A 2NRZA 3IN5A 5JTIA 5KFQA 4EBCA 3AMZA 3MR5A 4ELTA 9ICQA 4DCCA 1ZQMA 2KNJA 2E3TA 5J0UA 3SENA 4B6JA 4MFAA 3KZXA 4DFDA 1K1SA 4KLFA 5JUMA 2FE9A 2NRTA 2H5XA 3KHGA 2KICA 4R63A 1KFSA 1LKYA 4LVSA 4X5VA 8ICEA 5AK6A 1SL0A 8ICZA 2BGWA 4ZOHC 4AYBC 3KTQA 1NKBA 4QZFA 3Q8QB 4PGXA 5J0OA 1L3UA 2FLPA 4DL6A 2JEIA 1WCNA 1IIPA 4U6PA 4QNLA 4RQ4A 3BQTA 2W7PA 2D6FC 1Q46A 5KG3A 1AROP 2WHEA 4F3OA 3LWLA 5KFBA 3IM1A 4DL4A 1ZD4A 2XICA 4QJFB 4RNOA 4RQNA 1ZQLA 2F8KA 8ICJA 1SV0C 1JXEA 4P4PA 4DQSA 3RRGA 2H3FA 4C8NA 5EOZA 3LK9A 1NZPA 4CF4A 4KLSA 2OM6A 2F8LA 1TK0A 4P4MA 5CA7A 2W9AA 1RPLA 4QZAA 4YR2A 5CRXA 3PW7A 1V85A 4RQ1A 3TADC 4Y2RA 2NRVA 5JU5A 3PR5B 3THVA 1IXRA 2ZIVA 1JN3A 4I29A 4J9SA 4NLKA 4CCHA 8ICIA 4RQMA 1YZ7A 4KX5A 1RDFA 3A0BU 1S77D 3MDCA 3PNCA 3UPQA 1U9LA 2XIDA 4LZDA 5F3XB 2ZXIA 2C2EA 2JZBA 4B9MA 4DSLA 3V7LA 4XRHA 4I2HA 4MF2A 7ICVA 1KRPA 1N5XA 5DQGA 3OHBA 4DOCA 3RR8A 1X66A 4JV1A 2HBKA 2XI9A 1TFRA 5AK4A 4QZ8A 1RM6C 1SGGA 5KL1B 5KTQA 1MQ2A 4ED1A 1DGJA 3O0FA 3HKZC 1KLNA 2KV2A 5ALFA 2HBMA 4JV2A 2WF7A 1X6IA 1QQ5A 2KN7A 3EUB2 3TI0A 5CP2A 4ED2A 2GH1A 4QZIA 3G6XA 1PK3A 1ZQIA 4BXOB 1ZETA 1NKCA 3GV8B 5EWFA 2NO4A 3VC8A 5J29A 5L1LA 1OXJA 1A6SA 2FDRA 2WFAA 1X2IA 4Y2XA 1JROA 5HHHA 2W8LA 4ED3A 4EEYA 3IP4B 4R64A 2MRLA 4KLIA 3UM9A 4R8UB 4DO9A 4NV0A 4KLJA 4C4RA 5DDYA 4I2BA 3EWAA 3H8SA 3IHQB 3C28A 1ZQJA 2IHNA 2ZIUB 3V7JA 4J9MA 4C4TA 1YZ6A 1RYUA 4QW8A 2I5HA 4F2RA 2LHTA 3B0YA 3C2KA 1SKSA 4MEXA 4J9KA 2LYBA 5J0TA 2MU2A 1ZYQA 1J97A 1DRGA 1COOA 4EBDA 2EAMA 1TE2A 2Q4TA 2M9NA 3NTUA 5KFUA 4F2SA 8ICQA 1BPZA 2Y0SC 2HW3A 1ZQFA 2IOFA 4PL1A 2F76X 4F91B 3QEBZ 1ZQUA 4YG2A 3RJJA 2KP7A 3ISCA 2XC9A 4QIWF 5HP4A 3NVZA 4OD0A 1QLNA 3QZ8A 1RYRA 4RUCA 1QSYA 5B5EU 4M9HA 4UASA 3ZD9A 4C0ZA 4KLDA 7ICUA 2XVTA 4QZ9A 5HR7A 3AN1A 1L7MA 2C2DA
chains in the Genus database with same CATH topology
2K4PA 2KSOB 1OXJA 1SV4A 3BQ7A 1PK1B 2QB1A 1OW5A 1Z1VA 5J8YC 4NL9C 3KKAA 1V85A 3TADC 5JU5A 5JTIA 1DXSA 2E8PA 4NJ8A 1B0XA 5L1MA 4IS7A 4RQMA 3SENA 1KW4A 3SEIA 2KG5A 1F0MA 2FE9A 1JI7A 2QB0A 5F3XB 2QKQA 2LPEA 2DKZA 2D3DA 2F44A 3HILA 3KKAC 2EAMA 2K60A 1COKA 2Y9TA 4MHVA 1X9XA 2DKXA 3TACB 1LKYA 1WWUA 1PK1A 4PZNA 1X40A 1SXEA 2YTUA 3H8MA 2EAPA 1X66A 3BS5A 2QARA 1SV0A 2KE7A 2D8CA 5JRTA 2ES6A 2EANA 2F3NA 1WWVA 5KNIA 2ESEA 4PZOA 2Y9UA 2KIVA 2QB0B 1SGGA 2B6GA 1SXDA 2KSOA 2L5YA 3IDWA 2JV3A 2EAOA 2E8NA 2DL0A 1RG6A 1UQVA 1UCVA 1LKYB 2GLEA 5J8YA 1B4FA 4NL9A 1V38A 2E8MA 3TADA 3BS5B 2QARB 2KMDA 2LMRA 2E8OA 4RQNA 2F8KA 3BS7A 1PK3A 1SV0C 3K1RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4P A;  2KSO B;  1OXJ A;  1SV4 A;  3BQ7 A;  1PK1 B;  2QB1 A;  1OW5 A;  1Z1V A;  5J8Y C;  4NL9 C;  3KKA A;  1V85 A;  3TAD C;  5JU5 A;  5JTI A;  1DXS A;  2E8P A;  4NJ8 A;  1B0X A;  5L1M A;  4IS7 A;  4RQM A;  3SEN A;  1KW4 A;  3SEI A;  2KG5 A;  1F0M A;  2FE9 A;  1JI7 A;  2QB0 A;  5F3X B;  2QKQ A;  2LPE A;  2DKZ A;  2D3D A;  2F44 A;  3HIL A;  3KKA C;  2EAM A;  2K60 A;  1COK A;  2Y9T A;  4MHV A;  1X9X A;  2DKX A;  3TAC B;  1LKY A;  1WWU A;  1PK1 A;  4PZN A;  1X40 A;  1SXE A;  2YTU A;  3H8M A;  2EAP A;  1X66 A;  3BS5 A;  2QAR A;  1SV0 A;  2KE7 A;  2D8C A;  5JRT A;  2ES6 A;  2EAN A;  2F3N A;  1WWV A;  5KNI A;  2ESE A;  4PZO A;  2Y9U A;  2KIV A;  2QB0 B;  1SGG A;  2B6G A;  1SXD A;  2KSO A;  2L5Y A;  3IDW A;  2JV3 A;  2EAO A;  2E8N A;  2DL0 A;  1RG6 A;  1UQV A;  1UCV A;  1LKY B;  2GLE A;  5J8Y A;  1B4F A;  4NL9 A;  1V38 A;  2E8M A;  3TAD A;  3BS5 B;  2QAR B;  2KMD A;  2LMR A;  2E8O A;  4RQN A;  2F8K A;  3BS7 A;  1PK3 A;  1SV0 C;  3K1R B; 
#chains in the Genus database with same CATH topology
 4QZB A;  2KVS A;  1ZQV A;  5EE3 A;  4YR0 A;  5T14 A;  2FMQ A;  4HYK A;  1ZQS A;  2R18 A;  4OJ5 A;  3D2S A;  5KG6 A;  2GWS A;  1D9F A;  5AK3 A;  3PR4 A;  4DLE A;  4C8O A;  4QWD A;  1V9P A;  2LKY A;  2ZIW B;  4UAU A;  4O5C A;  3ISD A;  1Z1B A;  4QWB A;  3M9O B;  4R65 A;  5L1I A;  3WKB A;  2EZY A;  2MSN A;  1TKD A;  4BWJ A;  3FYH A;  4BGD A;  5KT6 A;  1ZQ1 C;  4KLH A;  1XSN A;  2VA2 A;  1JAL A;  2G08 A;  4I27 A;  2BPF A;  3JPS A;  2DKX A;  1WWU A;  4DSF A;  1BPY A;  4RPY A;  3Q8S B;  1S0M A;  2FLL A;  4ECV A;  5F9N A;  2BDP A;  9ICC A;  4P4O A;  2F3N A;  4NM2 A;  4RQ5 A;  5KFX A;  2KIV A;  2MA1 A;  3NS1 A;  5KFK A;  7ICF A;  4RQ0 A;  5KFC A;  1PVP A;  4DEZ A;  3IRU A;  1NK0 A;  4NLN A;  9ICA A;  8ICL A;  2WAQ F;  4B9N A;  3D2Q A;  3LDA A;  4F4W A;  2JGA A;  1ZQR A;  3B0X A;  1K5O A;  3C2L A;  3PY8 A;  2DBY A;  3H40 A;  4OJO A;  3DDH A;  9ICR A;  1NI3 A;  3UMG A;  3N7R C;  7ICH A;  2P35 A;  4BJQ A;  1TK5 A;  2KOB A;  5ALY A;  2XCP A;  2KSO B;  1NKE A;  2OEH A;  3H0R B;  2W9C A;  1QQ6 A;  2A3V A;  2E1F A;  2EQY A;  4UBC A;  1XC9 A;  5KFA A;  5AI4 A;  4YXM A;  4F5Q A;  3SAF A;  1D8B A;  2JR5 A;  3KKA A;  4I2J A;  5L1K A;  7ICK A;  2HDO A;  1N61 A;  1ED1 A;  3PML A;  1HUO A;  1TAU A;  3EPI A;  1XNS A;  1U45 A;  4KLG A;  5KFG A;  3UQ0 A;  1JXL A;  4CF5 A;  1N5W A;  4FS2 A;  2QB0 A;  4ACO A;  5DDM A;  2LYA A;  3CNH A;  4J9R A;  2YQE A;  1X9X A;  7ICL A;  4O3Q A;  3V7K A;  1ZD2 P;  2KJ8 A;  5AKK A;  3PX6 A;  2NRX A;  2IOF K;  3L4P A;  5KG1 A;  4MEY A;  4RT2 A;  1B22 A;  2D8C A;  2EAN A;  3F53 A;  3UXN A;  1WWV A;  4UB6 U;  4B9U A;  2W9B A;  1Q3U A;  3C1Z A;  1KN5 A;  1X9S A;  2B6G A;  2YMP A;  5J2J A;  3RB0 A;  2BCU A;  4EX6 A;  4C7Y A;  1KSP A;  2XGQ A;  1CUK A;  9ICT A;  4QZC A;  4F4Y A;  3UQ2 A;  2RQ5 A;  3BS5 B;  3C2M A;  2G5I B;  4BWM A;  5D4B A;  4TUQ A;  4KLU A;  1SZP A;  5J0R A;  5J2H A;  4UW9 A;  1O08 A;  1NK5 A;  2A1A A;  4LZG A;  5KFS A;  5KFI A;  1SKR A;  2EH9 A;  3T3F A;  2ZG6 A;  3GIJ A;  3M8R A;  2AJQ A;  2K4H A;  4DQR A;  1BNP A;  5CHG A;  5HHI A;  4BDP A;  3E2E A;  4KLE A;  4DOA A;  4YD2 A;  2BCQ A;  1Y88 A;  1A76 A;  4Y2J A;  2J6U A;  4PHA A;  3CRX A;  2HHT A;  2HVI A;  3A0H U;  1FFV A;  9ICG A;  1ZQG A;  1RZT A;  1ZQC A;  3RF9 A;  7ICI A;  3SEI A;  2BR0 A;  2EZX A;  3ZDA A;  5AIC A;  2IOH A;  1TVA A;  5DBA A;  2K8C B;  3NVW A;  1L7P A;  3ALR A;  3TKA A;  2KJ5 A;  4Q45 A;  2BKE A;  3HW8 A;  4F5R A;  1WYG A;  3KKA C;  3ORY A;  4C8L A;  7ICP A;  4DFM A;  4Y2Y A;  3JPR A;  5KAI U;  2VJ4 A;  5CJ7 A;  2F77 X;  5AM4 A;  5DBB A;  2YTU A;  1T4G A;  3RBE A;  1M6Y A;  5KFD A;  3LYS A;  4UB3 A;  5IIK A;  3F5E A;  4M6W A;  1ZQH A;  4KLL A;  1PZN A;  3RAQ A;  4DQP A;  2ZIU A;  2HCF A;  2OHF A;  3V6H A;  5DG7 A;  5G5G A;  2YMM A;  3AU6 A;  1PVR A;  2ASL A;  3PSF A;  2J6T A;  5ALP A;  4RUA A;  1KEJ A;  4PL2 A;  2ATL A;  3BQ1 A;  5EE0 A;  4RPZ A;  3GIM A;  1JUD A;  3RJK A;  2QAR B;  3JPN A;  3B9J A;  4EYI B;  4J03 A;  3PO5 A;  4P0Q B;  2DUY A;  2V4R A;  4AYB F;  3ETL A;  5J2D A;  1CRX A;  4RQ2 A;  5GTI U;  4ECU A;  4YP3 A;  3RB6 A;  2F1I A;  3AL0 B;  2YB1 A;  3H0M B;  3T79 A;  4FZL A;  4JMU A;  3KHH A;  3MR3 A;  1T94 A;  4DL3 A;  4EEN A;  1FEZ A;  1S9F A;  2HVH A;  2KKP A;  4CF3 A;  3Q8R B;  4KLO A;  2ZUC A;  4OJ6 A;  3C23 A;  1NK8 A;  2KD1 A;  1PUZ A;  1QH9 A;  1IV8 A;  4JV0 A;  3SAG A;  2R8K A;  5AKJ A;  2BCV A;  2NO5 A;  5C0Y A;  2Q0Z X;  4I2I A;  2QKQ A;  3T5J A;  3D6J A;  2I6X A;  8ICK A;  2FJ6 A;  5AIB A;  2V9W A;  5CEH A;  4EZ9 A;  4Y2V A;  2CPR A;  2W3S A;  2FPL A;  5H2F U;  5KFM A;  2ZTC A;  5IIJ A;  4R66 A;  4ECT A;  5KAF U;  4US9 A;  5KNI A;  3E58 A;  4M47 A;  3IG5 A;  5J0Y A;  3PW0 A;  2KIW A;  5D49 A;  2XY6 A;  4I2A A;  2K8A A;  4ED7 A;  4JWN A;  1ZD3 A;  1Z00 B;  4UB8 U;  5A0L A;  4YCX A;  4XUS A;  3QNM A;  1UQV A;  1UCV A;  3AQE A;  4IRD A;  4KLT A;  4JB3 A;  4DFK A;  2YML A;  2GLE A;  2ZUD A;  4ECR A;  9ICK A;  1B4F A;  1VJ5 A;  2J6S A;  4O9M A;  2A1J A;  5AKI A;  1H38 A;  1L5U A;  2E1E A;  4DSE A;  4DQI A;  3K1R B;  4NXZ A;  2AU0 A;  5J2G A;  2G06 A;  3PX4 A;  3ED5 A;  5AKE A;  4F71 A;  8ICV A;  1N60 A;  2ZIX A;  4KLQ A;  1OW5 A;  4K4H A;  3HKZ F;  3MFI A;  4RQ3 A;  4FZM A;  1SL1 A;  1L8O A;  3MGH A;  3L3F X;  5DKW A;  2P6R A;  3L5K A;  3AUO A;  1OUQ A;  4GC7 A;  4MF8 A;  5AI0 A;  2E8P A;  3GZF A;  3KD3 A;  5L1M A;  2AGP A;  1L7N A;  1XSP A;  3CP8 A;  3TAN A;  4NLB A;  2AGO A;  3K1Z A;  2W54 A;  1N56 A;  1F0M A;  3WU2 U;  1Q8K A;  3WKD A;  3MR6 A;  2Z7J A;  5ALH A;  5EWG A;  2BDU A;  4F5N A;  3OPX A;  2BPG A;  8ICG A;  5F9L A;  2Y9T A;  3DV9 A;  4P0P A;  4F92 B;  3HX0 A;  4EEL A;  2FPK A;  4OO1 J;  1SXE A;  4PH5 A;  4UB5 A;  4FZN A;  2MUT A;  2BCR A;  1WCL A;  2ZTD A;  5ALO A;  2LYH A;  1L3T A;  1TV9 A;  2W43 A;  2ESE A;  4NY8 A;  3PV8 A;  2H3V A;  4YMM A;  1SXD A;  1S0N A;  9ICI A;  3AQF A;  4RNN A;  1XSL A;  1LKY B;  2RHF A;  5AKG A;  1NK6 A;  2HHX A;  3FC4 A;  2KHV A;  5AKH A;  5AKZ A;  4IR1 A;  4AP9 A;  4ECX A;  3N97 B;  5AI8 A;  4M9L A;  4UAR A;  2Y0S F;  2PMZ C;  3BZC A;  1SZH A;  1Z4N A;  5AKL A;  1J2N A;  1UA1 A;  4BX9 C;  4ED8 A;  3RTV A;  7ICT A;  1D8L A;  4YFK A;  5CR0 A;  4O3M A;  2FMP A;  3RH6 A;  5J2E A;  7ICO A;  2KZ3 A;  1ZOL A;  1BPB A;  5DG9 A;  1S0V A;  3UXP A;  2DGZ A;  4CNQ A;  3K75 D;  4KMU A;  1SKW A;  2OXO A;  3ZI4 A;  4DSJ A;  4C8K A;  4O0I A;  3OGU A;  5AKY A;  4CDG A;  1ZJN A;  5ALW A;  1JI7 A;  1KFT A;  3GV5 B;  3QEA Z;  2DKZ A;  4PGY A;  2D3D A;  5J2K A;  3OHA A;  2PXI A;  4K4I A;  5ALR A;  2ZIV B;  2EZZ A;  2OYY A;  4ECW A;  2JH1 A;  2AXT U;  1FIQ A;  1X40 A;  3PX0 A;  2NRW A;  3BQ0 A;  4ECQ A;  3N7S C;  3UMB A;  1CI4 A;  2KFN A;  3QUQ A;  1T3N A;  2K4E A;  4TQR A;  1KQQ A;  3SAH A;  3Q8M A;  3RH4 A;  2Y9U A;  4NLG A;  5AK5 A;  2JZB B;  3M7D A;  3RFA A;  4KLM A;  2L5Y A;  3IV6 A;  1UA0 A;  3GII A;  2PFQ A;  3KZI U;  5KFV A;  3MBY A;  3KBB A;  2CRX A;  5KG2 A;  2W3R A;  1WG8 A;  5KG5 A;  3WK6 A;  4C7Z A;  4QZD A;  3PO4 A;  3QU7 A;  2V4Q A;  8ICU A;  2RDJ A;  4DWI A;  4C80 A;  2HHV A;  3GDX A;  4UB1 A;  1L7O A;  4MFC A;  3FAH A;  8ICO A;  2P66 A;  4PHD A;  2AH5 A;  3CW2 C;  1ZQD A;  5L1J A;  1J2M A;  3ZD8 A;  2H3Z A;  1UHU A;  2Y1I A;  4IQT A;  3MFH A;  1N2X A;  5KL8 B;  1ZQK A;  3SQI A;  4Q8F A;  3C5G A;  2ZJ8 A;  1ZQQ A;  3HT3 A;  1KBU A;  5KFW A;  4O3N A;  2ZUB A;  3MDA A;  1HEK A;  3CYM A;  2FLN A;  9ICH A;  9ICL A;  3SMV A;  4UAZ A;  4RT3 A;  3V72 A;  2XY7 A;  4Y2U A;  3LWM A;  1DGS A;  3H4D A;  3LVV A;  2BQ3 A;  4P0Q A;  4I2C A;  3OSN A;  1KKX A;  5KFO A;  5DB6 A;  5ALS A;  2F2A B;  4FE3 A;  4YN4 A;  1N48 A;  4RNM A;  2PFN A;  5KT7 A;  1V97 A;  3FM9 A;  1RQL A;  2W7O A;  3OTQ A;  4YXJ A;  4PZN A;  7ICQ A;  2G0A A;  4GXK A;  4ZH4 A;  4DLG A;  1U48 A;  2DF4 B;  5EWE A;  3PST A;  2RP5 A;  1GO3 F;  2N1R A;  4QZH A;  3BJY A;  9ICV A;  1DOQ A;  2K89 A;  2DPJ A;  3H8W A;  3I76 A;  3H0L B;  2HBJ A;  3HPO A;  4M04 A;  4Q44 A;  2DL0 A;  5IIO A;  5AI6 A;  4Y2P A;  5DLF A;  2KK0 A;  5J8Y A;  1C20 A;  4EEK A;  2LM4 A;  1CEZ A;  1NK4 A;  1ZQP A;  3Q8L A;  2E8M A;  4J9Q A;  1K1Q A;  4FBT A;  2W11 A;  1MC8 A;  2LMR A;  4Z6E A;  5TIS U;  3QUB A;  7ICJ A;  3BS7 A;  1BGX T;  3SV3 A;  4YQW A;  2CXY A;  3QYP A;  1X42 A;  4Q43 A;  2BQR A;  4DL7 A;  3PSP A;  2BQU A;  4ELU A;  1PK1 B;  2IA6 A;  1BVS A;  3M6Z A;  3OJS A;  2KZM A;  8ICH A;  4ELV A;  2BPC A;  3RH5 A;  4O5E A;  4F50 A;  5K4L A;  1NJY A;  5AM3 A;  4NLZ A;  3TAR A;  8ICA A;  4M9G A;  4F4Z A;  4FO6 A;  2B0C A;  3ETR A;  1DK2 A;  5HMM A;  3H8J A;  1KTQ A;  4GIB A;  5KFJ A;  2WB1 C;  4PHE A;  3I1Y A;  9ICU A;  5CWR A;  4U7C A;  2YB4 A;  3IG8 A;  2F1J A;  3RB4 A;  4YR3 A;  1L3S A;  9ICO A;  4PHP A;  3G6Y A;  3BDP A;  2A19 A;  2W8K A;  4TQS A;  3OSP A;  4DSI A;  1P7D A;  8ICB A;  5GTH U;  3SZ2 A;  3H8M A;  2KFZ A;  8ICX A;  2KVC A;  2PI4 A;  3C5F A;  2KE7 A;  3PW4 A;  3T5L A;  1NNL A;  3MAB A;  1Q3V A;  2G07 A;  1LB2 B;  4BXO A;  4KN7 A;  5AHX A;  1C7Y A;  4PJ0 U;  4DL5 A;  5KFR A;  2HSZ A;  1URJ A;  4NL9 A;  4GLX A;  4I2D A;  3TAP A;  3DEE A;  4R8U A;  2JRZ A;  4TUP A;  2E8O A;  1ZJM A;  1RXV A;  4Y2S A;  2NYV A;  2FI1 A;  1TAM A;  3MGV A;  5BOM A;  4Y2Q A;  2IMW P;  3UXO A;  1SB3 C;  2DFL A;  5ALV A;  4CRX A;  3T5K A;  5ALT A;  4NWI A;  1XS9 D;  4IR9 A;  4IQU A;  1TK8 A;  4CGZ A;  1NJW A;  1MQ3 A;  2KTQ A;  3Q8K A;  2ISP A;  2RRD A;  2WTF A;  5J8Y C;  1SWW A;  5AKX A;  1ZQY A;  1T8E A;  9ICW A;  2YY6 A;  1BPX A;  3TFR A;  5J2I A;  8ICW A;  2W9C B;  4I2F A;  4A8E A;  3JPT A;  1SL2 A;  3KFU F;  1KW4 A;  5ALK A;  4DF8 A;  4J9P A;  1X9W A;  4M0A A;  3RAX A;  4C4S A;  2AGQ A;  3SV4 A;  1BNO A;  2LI6 A;  2LM1 A;  3KOO A;  1NJX A;  3QE9 Y;  4UAV A;  2K60 A;  1ZQA A;  2KJ9 A;  2DPI A;  1XO1 A;  1JIH A;  2KZZ A;  3V6J A;  4ED0 A;  5AIA A;  2EAP A;  3EZ5 A;  5JRT A;  2C22 A;  1U47 A;  3JPQ A;  4O3P A;  2QB0 B;  3IDW A;  4E0D A;  2JV3 A;  3N4M B;  2K8B B;  4I2G A;  3T5H A;  5ALL A;  1NK9 A;  2AQ0 A;  3QU4 A;  1NZB A;  1AQ6 A;  3N7P D;  2WF8 A;  4DSK A;  4O3O A;  4DS4 A;  2R8G A;  3AM9 A;  1A77 A;  1S0O A;  5HML A;  9ICS A;  4F93 B;  4O3S A;  2GO7 A;  2OH2 A;  2W9B B;  2K4P A;  3QU9 A;  3MR2 A;  5J0S A;  4M9N A;  5C5J A;  2PFP A;  4KTQ A;  2ZIW A;  3BQ7 A;  1N62 A;  2ODG A;  5ALN A;  8ICC A;  3EW9 A;  2ASJ A;  4IC9 A;  5AM5 A;  3WK5 A;  8ICT A;  1X9M A;  5KFF A;  1X6J A;  2C2R A;  4M9J A;  3H7I A;  3ONN A;  4NL9 C;  1ZD5 A;  4QWE A;  7ICR A;  5J2F A;  4YMO A;  3N28 A;  4YD1 A;  5DG8 A;  5L9X A;  1N63 A;  4OJP A;  5J0X A;  4UAY A;  9ICX A;  2WF6 A;  3TFS A;  5ALU A;  5DLG A;  1S97 A;  5EE1 A;  4Z6C A;  3HJE A;  9ICF A;  3HWT A;  3TQ1 A;  1S8O A;  4IS7 A;  4KIT B;  1WUD A;  4IL6 U;  3M6K A;  5KG0 A;  5ALE A;  3WK7 A;  5DB8 A;  4TUR A;  1RQN A;  2KG5 A;  1UT5 A;  1ZQE A;  3U26 A;  2F44 A;  5HR6 A;  3OJU A;  4OJL A;  3RBD A;  9ICP A;  2IHM A;  3RRH A;  3HP6 A;  4UQG A;  4WJ3 B;  4KN4 A;  4G9B A;  5G5H A;  3RR7 A;  3ZDE A;  4JK1 A;  4Q8E A;  4C8M A;  2HHW A;  1KFD A;  2C28 A;  4DF4 A;  1ZQW A;  3JPP A;  4JWM A;  5BPC A;  5DGB A;  2HI0 A;  5AM2 A;  4ICA A;  4KMO B;  2LBO A;  1JRP A;  5D46 A;  2KSO A;  4ECZ A;  2HHU A;  2HMX A;  5DB9 A;  5DGA A;  3V6K A;  2I1Q A;  4DL2 A;  4B9L A;  1T7P A;  1BPE A;  1RG6 A;  4J9L A;  3RJF A;  2KHQ A;  4K4G A;  2JEJ A;  2EDU A;  3KHL A;  1Z3E B;  2PI5 A;  3QX7 A;  3SI8 A;  1ZQX A;  4RQ6 A;  4Z6F A;  3ZDB A;  4XQ8 A;  3M8S A;  1D9D A;  5ALG A;  4O3R A;  2H3I A;  8ICP A;  4M6W B;  5AM0 A;  2OCE A;  2WF5 A;  4B9S A;  1XWL A;  3G6V A;  1O03 A;  5J0Q A;  4GC6 A;  3QU5 A;  3F5A A;  3SYZ A;  2P6U A;  3NVV A;  3LVW A;  4FS1 A;  2G09 A;  3M1Y A;  1MSW D;  5KFN A;  4F8R A;  5CB1 A;  2KKV A;  5KFP A;  3JPO A;  1L8L A;  3K4G A;  5ALM A;  3GIL A;  1JX4 A;  5KFE A;  3WK9 A;  2PFO A;  5J2A A;  2PMZ F;  1ECW A;  3GFK B;  1B0X A;  2JXJ A;  4Y2T A;  2BZF A;  3PVX A;  5KFH A;  4UAT A;  5KT3 A;  1F44 A;  3QUT A;  4JUZ A;  5FP0 A;  4TUS A;  4XA5 A;  2I9G A;  2YN4 A;  4CE6 A;  4QIW C;  2FPM A;  4EZ6 A;  2RDI A;  4QWA A;  4RZR A;  3HIL A;  3RB3 A;  4USA A;  1DK3 A;  1L3V A;  1PK1 A;  9ICM A;  2JEG A;  3HRD D;  2XY5 A;  1QCK A;  1QSL A;  7ICE A;  3BS5 A;  5ALQ A;  5KT2 A;  8ICY A;  2UVU A;  2E5S A;  1FO4 A;  1HUZ A;  3BQ2 A;  5ALZ A;  3KHR A;  5KFT A;  4PZO A;  3F2C A;  3GV7 B;  2VA3 A;  2ZXH A;  2E8N A;  4NLC A;  4MFF A;  1HJP A;  5J2C A;  4ECS A;  4F5P A;  3PSI A;  3PW5 A;  1U4B A;  1FFU A;  1VLB A;  4J9N A;  1F5S A;  4I2E A;  1ZQT A;  1KDH A;  1V38 A;  2ZJA A;  1KL9 A;  4B9T A;  2JHD A;  3J81 j;  1JMS A;  8ICR A;  9ICE A;  1RYS A;  9ICB A;  4PPX A;  4ED6 A;  4IQW A;  3S6J A;  1S10 A;  1MA7 A;  3H4B A;  5AI5 A;  4QZG A;  4DFJ A;  1UPH A;  3C21 A;  5DB7 A;  1LV5 A;  4EYH B;  8ICN A;  3RJG A;  1XO0 A;  5KFL A;  4FBU A;  2HBL A;  5ALJ A;  5ALX A;  1IG6 A;  3NRZ A;  1NJZ A;  3PW2 A;  4DQQ A;  4P2H A;  1VDV A;  3SR6 A;  2A1J B;  4J9O A;  3RJI A;  4UB2 A;  1SWV A;  2MAX A;  5ALD A;  4DFP A;  1ZQN A;  3C1Y A;  1D8Y A;  3PZP A;  5EE9 A;  2XCA A;  3WKE A;  9ICJ A;  5E79 U;  8ICF A;  1B43 A;  2G5H B;  4NJ8 A;  3WK8 A;  3WKC A;  2JMG A;  2UVV A;  2ZIX B;  4QZE A;  4ECY A;  4NM1 A;  1IM4 A;  4BUG A;  1TAQ A;  1ZQZ A;  3UMC A;  2HOI A;  2GOL A;  4YMN A;  3MGI A;  3TAQ A;  2WAQ C;  3ISB A;  1QSS A;  1COK A;  5KFY A;  5AI9 A;  5B66 U;  2VKQ A;  4MHV A;  4IRC A;  2B21 A;  2DWQ A;  2BCS A;  5IIN A;  5AM1 A;  5DQI A;  3WKA A;  2AHO B;  2HOQ A;  4B9V A;  5IIL A;  2QAR A;  4M2Y A;  3QXG A;  4F4X A;  2IBK A;  5DQH A;  2ES6 A;  1HIW A;  3QU2 A;  3NGD A;  3C29 A;  2W04 A;  2FMS A;  3NUQ A;  3M9N B;  4UAW A;  3GQC A;  2HHQ A;  3Q8P B;  3E0F A;  4PGQ A;  3PMN A;  1QQ7 A;  2QLT A;  1ZRN A;  4US8 A;  5J2B A;  2UVW A;  4UBB A;  2OWO A;  2ZJ5 A;  4P0P B;  1ZRM A;  3ZDD A;  3I28 A;  8ICM A;  3ZDC A;  1T3Q A;  2F1H A;  4KX3 A;  1MN8 A;  2MUT B;  4RPX A;  2KMD A;  4F4K A;  4RU9 A;  8ICS A;  3QUC A;  2R8I A;  3GU3 A;  2W55 A;  3AEV A;  2M0N A;  9ICN A;  4EX7 A;  4G3I A;  1EXN A;  4FFD A;  4I28 A;  1BPD A;  2K4I A;  1SV4 A;  4UB4 A;  2VA8 A;  4GFJ A;  7ICM A;  2QB1 A;  2XGP A;  5KT5 A;  3NRW A;  2R8J A;  4LJX A;  2BHN A;  2WF9 A;  4RQ7 A;  4F72 A;  3EYZ A;  4YVZ A;  1ZQB A;  2YMQ A;  3F2D A;  3AU2 A;  1YT3 A;  2NV3 A;  1DXS A;  5KG4 A;  1A0P A;  1UT8 A;  3ICX A;  4DS5 A;  2PKE A;  1RXW A;  3FDS A;  3QZ7 A;  7ICN A;  4GXJ A;  5TZV A;  3WK4 A;  5IIM A;  4EBE A;  4OCZ A;  2LPE A;  3R9K A;  1U49 A;  5III A;  2VJ5 A;  1Z00 A;  5DBC A;  2HOF A;  1NOM A;  4HAI A;  5KFZ A;  3NVY A;  3TAC B;  1Z19 A;  1S76 D;  4F5O A;  2VIX A;  2ASD A;  2CN1 A;  3M9M B;  2R8H A;  1S5L U;  1SV0 A;  2UVR A;  2WB1 F;  3RJE A;  3F2B A;  2AQ4 A;  1PVQ A;  4IQV A;  4GXI A;  1L6N A;  5BOL A;  2HHS A;  3EPG A;  3VCB A;  1NK7 A;  2EAO A;  4QW9 A;  1ZXI A;  5KG7 A;  7ICS A;  5J0P A;  2YX8 A;  5J0W A;  1XU4 A;  3MC1 A;  1ZQO A;  2XO7 A;  1QTM A;  2JH7 A;  5ALI A;  3TAD A;  2O6K A;  2ALZ A;  4O5K A;  3BZK A;  1SIJ A;  3GIK A;  3SD7 A;  4Z6D A;  2ZTE A;  2KEY A;  2H3Q A;  5HNK A;  2DQN B;  3NAS A;  2JEF A;  1LVH A;  4QWC A;  4RQ8 A;  2Y1J A;  2W9M A;  2W03 A;  4IRK A;  2ISO A;  3D2N A;  4DOB A;  1Z1V A;  3RJH A;  1Z4O A;  2VAN A;  2RLT A;  7ICG A;  5KT4 A;  2NRZ A;  3IN5 A;  5JTI A;  5KFQ A;  4EBC A;  3AMZ A;  3MR5 A;  4ELT A;  9ICQ A;  4DCC A;  1ZQM A;  2KNJ A;  2E3T A;  5J0U A;  3SEN A;  4B6J A;  4MFA A;  3KZX A;  4DFD A;  1K1S A;  4KLF A;  5JUM A;  2FE9 A;  2NRT A;  2H5X A;  3KHG A;  2KIC A;  4R63 A;  1KFS A;  1LKY A;  4LVS A;  4X5V A;  8ICE A;  5AK6 A;  1SL0 A;  8ICZ A;  2BGW A;  4ZOH C;  4AYB C;  3KTQ A;  1NKB A;  4QZF A;  3Q8Q B;  4PGX A;  5J0O A;  1L3U A;  2FLP A;  4DL6 A;  2JEI A;  1WCN A;  1IIP A;  4U6P A;  4QNL A;  4RQ4 A;  3BQT A;  2W7P A;  2D6F C;  1Q46 A;  5KG3 A;  1ARO P;  2WHE A;  4F3O A;  3LWL A;  5KFB A;  3IM1 A;  4DL4 A;  1ZD4 A;  2XIC A;  4QJF B;  4RNO A;  4RQN A;  1ZQL A;  2F8K A;  8ICJ A;  1SV0 C;  1JXE A;  4P4P A;  4DQS A;  3RRG A;  2H3F A;  4C8N A;  5EOZ A;  3LK9 A;  1NZP A;  4CF4 A;  4KLS A;  2OM6 A;  2F8L A;  1TK0 A;  4P4M A;  5CA7 A;  2W9A A;  1RPL A;  4QZA A;  4YR2 A;  5CRX A;  3PW7 A;  1V85 A;  4RQ1 A;  3TAD C;  4Y2R A;  2NRV A;  5JU5 A;  3PR5 B;  3THV A;  1IXR A;  2ZIV A;  1JN3 A;  4I29 A;  4J9S A;  4NLK A;  4CCH A;  8ICI A;  4RQM A;  1YZ7 A;  4KX5 A;  1RDF A;  3A0B U;  1S77 D;  3MDC A;  3PNC A;  3UPQ A;  1U9L A;  2XID A;  4LZD A;  5F3X B;  2ZXI A;  2C2E A;  2JZB A;  4B9M A;  4DSL A;  3V7L A;  4XRH A;  4I2H A;  4MF2 A;  7ICV A;  1KRP A;  1N5X A;  5DQG A;  3OHB A;  4DOC A;  3RR8 A;  1X66 A;  4JV1 A;  2HBK A;  2XI9 A;  1TFR A;  5AK4 A;  4QZ8 A;  1RM6 C;  1SGG A;  5KL1 B;  5KTQ A;  1MQ2 A;  4ED1 A;  1DGJ A;  3O0F A;  3HKZ C;  1KLN A;  2KV2 A;  5ALF A;  2HBM A;  4JV2 A;  2WF7 A;  1X6I A;  1QQ5 A;  2KN7 A;  3EUB 2;  3TI0 A;  5CP2 A;  4ED2 A;  2GH1 A;  4QZI A;  3G6X A;  1PK3 A;  1ZQI A;  4BXO B;  1ZET A;  1NKC A;  3GV8 B;  5EWF A;  2NO4 A;  3VC8 A;  5J29 A;  5L1L A;  1OXJ A;  1A6S A;  2FDR A;  2WFA A;  1X2I A;  4Y2X A;  1JRO A;  5HHH A;  2W8L A;  4ED3 A;  4EEY A;  3IP4 B;  4R64 A;  2MRL A;  4KLI A;  3UM9 A;  4R8U B;  4DO9 A;  4NV0 A;  4KLJ A;  4C4R A;  5DDY A;  4I2B A;  3EWA A;  3H8S A;  3IHQ B;  3C28 A;  1ZQJ A;  2IHN A;  2ZIU B;  3V7J A;  4J9M A;  4C4T A;  1YZ6 A;  1RYU A;  4QW8 A;  2I5H A;  4F2R A;  2LHT A;  3B0Y A;  3C2K A;  1SKS A;  4MEX A;  4J9K A;  2LYB A;  5J0T A;  2MU2 A;  1ZYQ A;  1J97 A;  1DRG A;  1COO A;  4EBD A;  2EAM A;  1TE2 A;  2Q4T A;  2M9N A;  3NTU A;  5KFU A;  4F2S A;  8ICQ A;  1BPZ A;  2Y0S C;  2HW3 A;  1ZQF A;  2IOF A;  4PL1 A;  2F76 X;  4F91 B;  3QEB Z;  1ZQU A;  4YG2 A;  3RJJ A;  2KP7 A;  3ISC A;  2XC9 A;  4QIW F;  5HP4 A;  3NVZ A;  4OD0 A;  1QLN A;  3QZ8 A;  1RYR A;  4RUC A;  1QSY A;  5B5E U;  4M9H A;  4UAS A;  3ZD9 A;  4C0Z A;  4KLD A;  7ICU A;  2XVT A;  4QZ9 A;  5HR7 A;  3AN1 A;  1L7M A;  2C2D A; 
#chains in the Genus database with same CATH homology
 2K4P A;  2KSO B;  1OXJ A;  1SV4 A;  3BQ7 A;  1PK1 B;  2QB1 A;  1OW5 A;  1Z1V A;  5J8Y C;  4NL9 C;  3KKA A;  1V85 A;  3TAD C;  5JU5 A;  5JTI A;  1DXS A;  2E8P A;  4NJ8 A;  1B0X A;  5L1M A;  4IS7 A;  4RQM A;  3SEN A;  1KW4 A;  3SEI A;  2KG5 A;  1F0M A;  2FE9 A;  1JI7 A;  2QB0 A;  5F3X B;  2QKQ A;  2LPE A;  2DKZ A;  2D3D A;  2F44 A;  3HIL A;  3KKA C;  2EAM A;  2K60 A;  1COK A;  2Y9T A;  4MHV A;  1X9X A;  2DKX A;  3TAC B;  1LKY A;  1WWU A;  1PK1 A;  4PZN A;  1X40 A;  1SXE A;  2YTU A;  3H8M A;  2EAP A;  1X66 A;  3BS5 A;  2QAR A;  1SV0 A;  2KE7 A;  2D8C A;  5JRT A;  2ES6 A;  2EAN A;  2F3N A;  1WWV A;  5KNI A;  2ESE A;  4PZO A;  2Y9U A;  2KIV A;  2QB0 B;  1SGG A;  2B6G A;  1SXD A;  2KSO A;  2L5Y A;  3IDW A;  2JV3 A;  2EAO A;  2E8N A;  2DL0 A;  1RG6 A;  1UQV A;  1UCV A;  1LKY B;  2GLE A;  5J8Y A;  1B4F A;  4NL9 A;  1V38 A;  2E8M A;  3TAD A;  3BS5 B;  2QAR B;  2KMD A;  2LMR A;  2E8O A;  4RQN A;  2F8K A;  3BS7 A;  1PK3 A;  1SV0 C;  3K1R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...