2E8NA

Solution structure of the c-terminal sam-domain of ephaa2: ephrin type-a receptor 2 precursor (ec 2.7.10.1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDVKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
molecule keywords Ephrin type-A receptor 2
total genus 19
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8nA00
3TADA 2E8NA 1SV0C 1UQVA 2GLEA 2EAPA 3BS5A 2EAMA 5KNIA 2LPEA 2KIVA 3SENA 1DXSA 1OW5A 2KSOA 4NL9A 4RQMA 4PZNA 3KKAC 2ES6A 1V38A 5J8YC 2KMDA 4NJ8A 2QARA 5JRTA 2D3DA 2K4PA 2DL0A 2F44A 2D8CA 1SV4A 4RQNA 2QKQA 2KSOB 2DKZA 1WWVA 1X40A 5J8YA 2JV3A 4IS7A 2F3NA 2Y9TA 5L1MA 1OXJA 2QARB 3KKAA 2EAOA 1F0MA 2QB1A 2E8OA 3SEIA 3HILA 3TADC 1RG6A 4NL9C 5F3XB 2Y9UA 1SGGA 3BS5B 3BS7A 1LKYB 2EANA 2K60A 2DKXA 1COKA 1V85A 1SV0A 1JI7A 5JTIA 1SXEA 2LMRA 3IDWA 2QB0B 1X66A 1PK1A 1KW4A 4PZOA 1X9XA 2B6GA 1UCVA 4MHVA 2E8MA 2YTUA 3H8MA 2KE7A 1LKYA 3TACB 2ESEA 3BQ7A 2F8KA 1WWUA 1Z1VA 2L5YA 5JU5A 1B0XA 1PK3A 3K1RB 2QB0A 1B4FA 1PK1B 1SXDA 2KG5A 2E8PA 2FE9A
chains in the Genus database with same CATH superfamily
4RQ6A 3BQ2A 3FYHA 2W7PA 3F5AA 4DSEA 2VIXA 5KAIU 1RM6C 2YMQA 2KSOA 2WTFA 3WKEA 1ZQBA 2ZUBA 2AQ0A 4AYBC 3FM9A 4FZMA 4F50A 3OJSA 4IL6U 4B9TA 3SV3A 3WK7A 2G06A 1IV8A 3ALRA 1HUZA 2W7OA 4RQNA 2J6SA 3GILA 4IQTA 5ALRA 1KBUA 4J9QA 3UMCA 2IOFA 1Z19A 4R65A 4EBCA 3NVYA 2KV2A 4RNOA 3JPNA 1F0MA 2HDOA 4KLQA 2QB1A 4DF4A 4IRCA 3RRGA 4U7CA 3D6JA 1YZ6A 3WK6A 3PV8A 1ZD4A 2KFZA 2BCSA 2PXIA 1A0PA 3WKCA 7ICFA 3Q8KA 7ICIA 2WB1F 9ICPA 5B66U 1ECWA 4F5PA 3NRWA 1KQQA 7ICSA 4OO1J 5CRXA 1OUQA 1S76D 3KHGA 2K8CB 3TACB 3Q8RB 3GU3A 1C20A 2A3VA 2F8KA 3RB0A 2XI9A 4PL1A 4BJQA 4YCXA 2PFOA 2LM4A 2K4EA 3B0XA 2XY6A 2UVRA 1XS9D 1M6YA 1PK1B 3ZDDA 1N48A 3UMGA 4UW9A 1MN8A 3AN1A 1AROP 5AKEA 1ZJNA 2YN4A 1ZQIA 3TAPA 3C1ZA 4RQ5A 4A8EA 3UQ2A 2G5HB 9ICEA 3TANA 1ZETA 5J0XA 3NUQA 5AM5A 2B21A 1L3UA 2OCEA 4BUGA 5J8YC 4JV2A 4B9NA 3ZDEA 1KFDA 4UBBA 1ZD2P 3UM9A 4PHPA 2G08A 5ALPA 7ICGA 2WF8A 1HEKA 1WCNA 5AK3A 3QU2A 5AM4A 4O3NA 4TQSA 3PW0A 4OJ5A 4Y2YA 4CF5A 5DQHA 1QLNA 4M9GA 1KSPA 3ISBA 5L1MA 2QARB 5CEHA 1TK0A 5AIBA 1JN3A 4DSLA 2KJ5A 5IINA 3ZDCA 5KG3A 3UXPA 1FIQA 2C22A 1Z00A 2KNJA 3EPGA 5AM0A 8ICGA 2ALZA 4BWJA 3HPOA 1ZQMA 4I2CA 1WUDA 1ZJMA 5CJ7A 5DB6A 3H7IA 1RXVA 2DQNB 3H0LB 1XC9A 4PJ0U 3F2DA 2HHWA 3M6KA 3ETRA 4UB8U 1S0MA 2Y1IA 2LM1A 1QSYA 1N5WA 3NVVA 4ECTA 3CNHA 4XRHA 2KKVA 5AICA 4F2SA 3AU6A 3T5LA 1TE2A 3C2KA 2BHNA 1WYGA 4RU9A 4DL7A 4MF2A 2EH9A 1Z4OA 5AI4A 2DPIA 3PVXA 3MGIA 3UMBA 4RQ8A 2KZMA 3WU2U 4M47A 1OW5A 4R8UA 4UB6U 5IILA 4IRDA 1Q3UA 1C7YA 4KN7A 4DLEA 3IG8A 1V38A 3RR8A 5ALWA 5KG0A 3RH6A 1D9FA 3QEBZ 4Y2UA 1NJXA 2F44A 5ALYA 2LYBA 1NK9A 1TAQA 2YY6A 3ORYA 4ED0A 2KVSA 4OCZA 2AJQA 1J2MA 5J2EA 4M2YA 9ICKA 2WFAA 1QQ6A 4QIWF 4KLFA 3FAHA 3WK5A 2W3RA 3MDCA 4C4TA 4B9MA 1KRPA 4M0AA 1NKEA 4CCHA 3RBEA 3EW9A 3F2BA 1NJZA 4ED2A 4ELVA 5T14A 4UAVA 3NRZA 4U6PA 3QUQA 3QZ8A 2RP5A 1V97A 5KAFU 3GQCA 3BZKA 4QWDA 1SKWA 1V85A 1JI7A 3EPIA 3V7JA 2GO7A 4KLUA 5DG9A 8ICRA 3RJKA 2UVWA 4IQWA 2V4RA 3V72A 2V4QA 4ECZA 1K1SA 3EYZA 3QXGA 4K4IA 1YT3A 2M0NA 3TAQA 4P4MA 3LVWA 3MR5A 4F4XA 2FMQA 1IM4A 3K75D 4QZAA 4MEYA 3SAGA 3MFIA 4R64A 3EWAA 8ICPA 4UASA 3U26A 3LWMA 4NLZA 5J2HA 2NRVA 2LYHA 4UARA 4DQPA 3LDAA 5CHGA 2HCFA 5KFRA 2NO4A 2I9GA 7ICRA 1LB2B 4Q43A 4F72A 4P0QB 4BXOB 1WCLA 3HW8A 1L3SA 5ALJA 4GXKA 4I2IA 3PX6A 9ICIA 2NYVA 2DKZA 5AKHA 1EXNA 1U4BA 5KFXA 2JH7A 2YB4A 4C7ZA 4YD1A 4K4HA 4US9A 2XY5A 9ICUA 5DG7A 2R8GA 2VKQA 2DUYA 4TQRA 3NGDA 2NRZA 4E0DA 2IA6A 3UPQA 4CDGA 4UQGA 2JEFA 4TUQA 4UB3A 3QU9A 1DOQA 5DDYA 3OTQA 1ZQGA 4PPXA 4RQ4A 3RJFA 2HW3A 2XVTA 2HVIA 1NK4A 5ALSA 2JR5A 4BDPA 2HHTA 5JTIA 3T5KA 3IDWA 3PR4A 3RJEA 1S97A 9ICGA 4EBEA 2HOQA 1AQ6A 4EZ9A 7ICNA 2YQEA 3ONNA 4DL3A 3K1ZA 2F2AB 2KE7A 5D49A 3G6XA 4DQIA 4I2AA 1ZQSA 4DL5A 3RJGA 4RUAA 3GV8B 4YFKA 2K8BB 1ZQJA 2A19A 2PMZC 4QZGA 1VDVA 2WAQC 2A1AA 4IQUA 5AI9A 2GOLA 1DGJA 2EAMA 2JEIA 5KFQA 4C7YA 2KIVA 4ED7A 2ZJAA 4JV0A 3RBDA 2EDUA 4EZ6A 3RB4A 4KLTA 4O3MA 4RQMA 9ICOA 4NV0A 1ZXIA 9ICFA 3QYPA 4EBDA 2NO5A 3HX0A 1RZTA 5L1JA 2EQYA 2FJ6A 1BPYA 4NXZA 3N7PD 5HHHA 1N56A 5AK5A 2KTQA 5AKLA 4ACOA 9ICHA 4NLBA 1A77A 3GDXA 4GC7A 4MFCA 2W9AA 2WHEA 3V7LA 5KTQA 3TQ1A 4AP9A 2W9CA 9ICCA 5KG7A 4WJ3B 2KHVA 2GH1A 4LVSA 3AUOA 3PSTA 1SKRA 5F9LA 3IM1A 2YMMA 4MFAA 2ZG6A 5AK4A 1SWVA 4JUZA 4ELTA 1VLBA 5ALIA 3M9OB 1KL9A 4O0IA 3KZIU 2AXTU 2XCAA 3OPXA 3MC1A 5AKGA 4ECVA 4G9BA 1U49A 3WKBA 2YMLA 4YMOA 1X9SA 9ICRA 5ALMA 1Q8KA 4C4SA 1S8OA 2L5YA 5KFHA 4FS2A 2K4IA 4O9MA 1SL1A 4I2BA 3PX4A 3ZDBA 1RXWA 4DWIA 2Z7JA 4IR1A 4J9OA 4J9PA 4I2HA 3BJYA 3RB6A 3WK8A 5J2KA 4ECRA 1PUZA 3OSPA 3H40A 2FI1A 4M9LA 1UA0A 4ZH4A 4QW9A 1PZNA 5KFMA 3E2EA 3RTVA 2KMDA 2ZXHA 5L1KA 5J29A 3DV9A 3SAFA 1XSNA 2BQ3A 3MGVA 2B0CA 2D3DA 3QZ7A 3LWLA 5L9XA 1CRXA 2QKQA 5HMMA 4M9HA 3AM9A 2W8LA 2VA2A 3SQIA 4UAWA 5J8YA 5KG6A 4PGXA 2D6FC 1ZQDA 1CEZA 9ICXA 3ZDAA 4QZIA 3NASA 4DO9A 3TADC 4NL9C 5BOLA 2ASJA 4I29A 4PL2A 1T4GA 1XO0A 4Y2JA 4YR2A 3BS7A 4RQ0A 4O3SA 5KL8B 3SZ2A 5KFPA 1KFTA 2HHXA 1IXRA 3C1YA 2MU2A 4XQ8A 3UXNA 1ZQHA 4YMNA 3PW7A 1UCVA 3V6HA 4B9SA 2ZIVA 5ALHA 3H8MA 2HHSA 8ICIA 4KMUA 1LVHA 9ICMA 3I76A 3DDHA 5DBCA 2IHNA 7ICJA 1Z1VA 3THVA 5KG1A 5KFJA 5JU5A 5J0UA 1B0XA 1ZRNA 4Z6EA 2E1EA 8ICVA 1K5OA 3HJEA 5H2FU 5AKYA 1B43A 2K4HA 5J2JA 3PO5A 2KD1A 2KG5A 4EYIB 3RFAA 2BPCA 4M04A 4QZFA 5A0LA 1S0VA 2JRZA 3CP8A 4DFMA 1XNSA 2BQUA 4NL9A 5DKWA 3KHLA 1L7PA 4GXJA 2PFNA 1NNLA 2N1RA 1UT8A 4DFKA 1UPHA 3RH5A 4YXJA 9ICQA 2DL0A 5AI8A 2IHMA 1SV4A 1ZQUA 8ICBA 1BVSA 2ZUCA 5K4LA 2ZTEA 3M1YA 3BZCA 2JMGA 2XCPA 4QIWC 1NK0A 3QEAZ 4M9JA 1XSLA 1N2XA 4KLSA 2XICA 3NS1A 4YN4A 4USAA 1NJWA 4P4OA 4DL4A 3PSIA 1T94A 3JPRA 1UT5A 3C23A 2DKXA 1COKA 2ZTCA 1SV0A 4C8NA 3N97B 5HHIA 2RQ5A 4ECXA 1PK1A 4YMMA 4I28A 3MR6A 4IR9A 4YD2A 2BCVA 5IIIA 3C29A 2J6TA 5KFNA 2OHFA 5EOZA 2R8HA 4LJXA 2ATLA 4ECSA 5IIKA 5J2AA 1QTMA 4PHEA 5KFLA 2KJ9A 4KLJA 5GTHU 4EX7A 1X9WA 1D8BA 4MFFA 1SXDA 2E8NA 1UQVA 3MABA 4C8MA 3SV4A 5ALOA 5CR0A 8ICWA 4F91B 5BOMA 5AI5A 1KEJA 2ZTDA 1K1QA 3C2MA 3CRXA 4OJLA 4PGYA 3GIJA 5J0SA 4P0QA 4DQRA 4NJ8A 1SWWA 2A1JB 4X5VA 4EELA 4KLIA 4I27A 1HIWA 3FC4A 5J2BA 4RQ2A 4Y2RA 2MSNA 4HYKA 3KOOA 4Q8EA 2Y0SF 1NZBA 2JHDA 1ZQRA 2H3ZA 3QX7A 1J2NA 3NTUA 3I1YA 1X6JA 2JV3A 4RZRA 4KX5A 1N62A 1U45A 8ICLA 1L7MA 2F1JA 1Y88A 1PVPA 5D4BA 1D8YA 4UAZA 3QUTA 4C8KA 4B9LA 3RAQA 4FZLA 3NVWA 3SR6A 3Q8SB 4RT3A 2ASDA 1J97A 1LKYB 2R18A 5DB8A 2LYAA 8ICAA 5J2FA 2KVCA 2BGWA 3B0YA 4RQ7A 3J81j 5KFBA 2XC9A 3T3FA 2MUTA 2W54A 3RF9A 3OGUA 4PH5A 5J0QA 3MGHA 3KHRA 1TKDA 4ECUA 2ZIXB 2R8IA 3AL0B 1ZD3A 3Q8QB 5KFZA 1BPXA 3A0BU 4JMUA 5J0RA 5AM3A 2LKYA 7ICMA 2QB0A 4Z6DA 4LZDA 4GFJA 4IRKA 3CYMA 1F5SA 3QNMA 4DCCA 8ICHA 2ZIWA 2OWOA 3D2NA 2GLEA 3ZI4A 5CA7A 4KLMA 4DLGA 3KHHA 2OEHA 8ICYA 2P6UA 4F8RA 1WG8A 3BDPA 4FZNA 3S6JA 1BNOA 2JH1A 5HMLA 2AH5A 4PZNA 2AGPA 3C28A 4F4YA 2IOFK 4PHAA 4C4RA 3H0RB 1ZQVA 3RB3A 2ZJ8A 3IP4B 4O5KA 1QH9A 4Q45A 3AQFA 4P0PA 3L5KA 5EWFA 5EE0A 1RPLA 2FPKA 4BXOA 5TISU 1ZQCA 4IS7A 2A1JA 5KT6A 4B6JA 3KBBA 1L7NA 4Y2TA 2BCRA 4KX3A 2HMXA 4Y2VA 2YB1A 5EE9A 1T7PA 4I2JA 5ALNA 1NI3A 4ED1A 4UB2A 3M6ZA 3SYZA 3ZD8A 2IBKA 4FO6A 2W3SA 3BS5B 5E79U 2BDUA 5KFGA 3E0FA 2BZFA 2Q0ZX 3RJHA 5EE3A 4PGQA 4J9LA 4F93B 7ICVA 2IOHA 4DS5A 3I28A 1BPZA 1TK8A 3AQEA 1TK5A 2MAXA 4PZOA 5DLGA 2B6GA 2RDIA 3F2CA 3HT3A 4J9NA 1L6NA 2ZIUA 2XIDA 4UBCA 1JALA 3RAXA 2W11A 4JWMA 1LKYA 4I2DA 2MA1A 2V9WA 4KLLA 5KFTA 4KLDA 4J9SA 1ZYQA 2F77X 2BCQA 1ZQYA 4FBTA 2NRWA 5DGBA 4NLKA 1S5LU 1B4FA 4O3OA 1NK6A 2Y1JA 4G3IA 3TADA 1JRPA 5AM1A 4RPYA 1NZPA 2W9CB 2AHOB 4EEYA 5EWGA 2JGAA 2LPEA 4JB3A 4YXMA 4YQWA 1U48A 2LHTA 5EWEA 4F4WA 2E3TA 1F44A 8ICNA 2AU0A 3MDAA 2YMPA 3H8JA 5KFVA 2W9BB 2QARA 5AKJA 3PX0A 9ICAA 3HKZF 5KFKA 5ALQA 5AK6A 2C2EA 3G6YA 4DSKA 4BGDA 1NK8A 9ICLA 9ICNA 4DSIA 1B22A 1NKBA 1P7DA 1WWVA 4DSJA 3PZPA 3Q8PB 4CRXA 4QW8A 2M9NA 4F2RA 1ZQFA 2KKPA 4DOBA 5B5EU 3JPOA 2XY7A 2FPMA 2PKEA 5F3XB 2KIWA 1LV5A 3C21A 2HSZA 4F5QA 4GXIA 2PFQA 4JWNA 5J0WA 3IG5A 4YP3A 3BQ0A 4UB1A 4O3RA 2HHUA 5EE1A 2C2DA 4AYBF 2C2RA 1PVQA 4I2FA 1COOA 1ZD5A 5BPCA 3GIMA 4DSFA 4LZGA 3ISCA 2WF7A 3D2SA 1ZRMA 3QUCA 1X9XA 9ICJA 2LBOA 3T5HA 4F5NA 4K4GA 2ESEA 3RR7A 4ICAA 4UB4A 4C80A 2HI0A 5HR7A 5AI0A 4Q44A 3PW4A 1S77D 4O3PA 1RYSA 2KOBA 1DK2A 5KL1B 3QUBA 4RPZA 1MC8A 2E8MA 1CI4A 4QWAA 4EYHB 1U9LA 2YX8A 1ZQ1C 4OJPA 3FDSA 3H4BA 2HBKA 2FLPA 4F92B 2E5SA 2G5IB 5J0OA 3MR3A 2XO7A 1Z4NA 4J9MA 4UAYA 2OM6A 2NV3A 2WF5A 2RLTA 4MEXA 2W43A 3V6JA 4CF4A 5JRTA 1RDFA 1RQLA 2H3VA 5AKIA 3ISDA 3BQ1A 3KFUF 1U47A 5DG8A 2KK0A 3DEEA 2G09A 2DF4B 4UATA 3HKZC 4Y2SA 2DGZA 1X40A 1ZQNA 2F3NA 2W9BA 2P66A 4QZDA 4NM1A 3M7DA 1DRGA 1ZQTA 3AEVA 1SZHA 3PR5B 2Q4TA 2HHQA 2NRXA 3Q8MA 2I1QA 7ICPA 3IN5A 2BQRA 1D9DA 4JV1A 1ZQZA 4QZHA 3GZFA 1JIHA 2MRLA 1NK5A 3O0FA 4KLEA 2KP7A 4ECYA 3LVVA 1SL2A 1X66A 4O5CA 8ICEA 1KW4A 1X6IA 5ALUA 1S10A 1MA7A 4KTQA 1BPDA 1X2IA 1V9PA 2ZXIA 1WWUA 4NLNA 3HRDD 4ED3A 1TV9A 1ZQWA 5KFUA 3N7SC 5FP0A 4KITB 2F1HA 5ALVA 2KN7A 1DK3A 1T3NA 1FFVA 1SZPA 5KFWA 7ICUA 2F76X 1SV0C 2JXJA 4OJ6A 2HOFA 8ICQA 1MQ3A 3A0HU 1KN5A 1N61A 2ZUDA 1XSPA 4TURA 3B9JA 3M8SA 1A76A 5KFIA 8ICXA 3V7KA 1RYRA 1A6SA 4US8A 4DQSA 3L4PA 3TFSA 1NK7A 1KDHA 1TFRA 5J0YA 4Y2PA 2KSOB 5DQIA 3M8RA 2ISOA 4RQ1A 2EZYA 4BX9C 9ICSA 2OH2A 3Q8LA 2CRXA 1T3QA 4QZEA 2ZJ5A 4XA5A 2VA3A 1SB3C 1S0OA 1XO1A 5AKKA 3KTQA 4DF8A 3HILA 4HAIA 2J6UA 4J03A 5AKXA 2AQ4A 1ZOLA 1KKXA 1L8OA 5J2CA 2H3FA 3AU2A 1Q3VA 5D46A 5IIMA 1JXEA 3KZXA 5KFOA 5ALZA 8ICKA 1RYUA 2YTUA 4F4KA 4QWCA 2BR0A 3JPQA 2ZIVB 3QU7A 3GV7B 7ICEA 5JUMA 3K1RB 1URJA 5DGAA 5AHXA 2CN1A 5ALDA 9ICWA 2EAPA 3BS5A 4M9NA 5CWRA 5KNIA 1MSWD 4NLGA 2PI5A 4P2HA 3SI8A 3SENA 1DXSA 2WF9A 1HJPA 3KKAC 3WKDA 2FLNA 2W04A 3PSPA 1JX4A 2ASLA 3RRHA 3L3FX 1KTQA 3PNCA 9ICVA 2NRTA 2DBYA 2CXYA 2R8KA 2D8CA 2E1FA 5KFCA 4F5RA 5DQGA 1S9FA 5IIOA 4F71A 3G6VA 2KJ8A 1T8EA 2WF6A 5C5JA 5DB7A 4ZOHC 4Y2QA 4CE6A 2FMSA 1IIPA 2P35A 1NJYA 5KFFA 1D8LA 1BPEA 7ICHA 1O08A 3PMNA 3N28A 3SEIA 1BNPA 1RG6A 4PHDA 3LK9A 4FS1A 2Y9UA 4ED8A 3M9MB 3ICXA 2HBLA 4B9UA 2RRDA 4RPXA 5F9NA 2OYYA 3ZD9A 2K89A 1ED1A 3RJIA 2O6KA 1H38A 5J2GA 3EZ5A 3HWTA 5KG4A 1SKSA 9ICBA 8ICZA 2W03A 3E58A 8ICUA 3SAHA 4DOCA 4GIBA 1JXLA 2W8KA 5L1LA 4YVZA 3AMZA 2I5HA 5KFSA 5G5GA 4QWBA 1L7OA 2DFLA 1YZ7A 1N5XA 3T79A 5KT7A 5KFEA 2PFPA 5KT3A 4QJFB 3WK4A 1Z3EB 1UA1A 4UAUA 1FFUA 4C8OA 3H8WA 1ZQKA 4OJOA 5ALLA 3C5FA 2E8PA 4BWMA 2ODGA 2KZZA 3N7RC 2VJ5A 5C0YA 1ZQEA 5KG2A 4IQVA 2MUTB 1QCKA 1SIJA 1X42A 3TI0A 5TZVA 5HNKA 4Q8FA 2JEGA 4KLOA 4CF3A 3R9KA 4M6WA 4J9RA 1XU4A 3BQTA 2HOIA 4KLHA 5ALXA 5J0PA 2DPJA 4FBUA 8ICOA 4Y2XA 4NLCA 2BPGA 1QQ5A 2KICA 2W9MA 1KLNA 5J2DA 1NKCA 5IIJA 1JUDA 3D2QA 2JEJA 2QLTA 3MFHA 3QE9Y 1OXJA 4GC6A 2UVUA 3KKAA 2EAOA 4DS4A 4MF8A 3H0MB 1SL0A 3GFKB 7ICTA 8ICTA 5ALFA 3GIKA 3QU4A 3F53A 4ED6A 3VCBA 4IC9A 4RQ3A 2KFNA 5KT4A 1ZQPA 2RDJA 4FE3A 5KFDA 3GIIA 3SD7A 5KT5A 7ICKA 2QB0B 5ALTA 4CGZA 1L8LA 3M9NB 2FLLA 4DOAA 3C2LA 3K4GA 3IHQB 2HBMA 2KZ3A 4F3OA 5ALEA 2AGQA 1ZQQA 1Z00B 3PMLA 2HVHA 7ICQA 5AKZA 5AM2A 4I2GA 4TUSA 1N60A 2LI6A 2P6RA 5DLFA 1KFSA 4YR0A 1S0NA 1O03A 2VANA 2K8AA 4TUPA 5J2IA 2ZIXA 3RH4A 1JMSA 3PSFA 4ECQA 1FO4A 5L1IA 4YG2A 5AI6A 4C8LA 1IG6A 3TFRA 8ICJA 8ICCA 2G0AA 4DFJA 1QSSA 4QWEA 2CPRA 3TARA 4JK1A 4KMOB 3F5EA 3TKAA 2ES6A 3WKAA 5J0TA 3HP6A 2JZBB 3ETLA 4FFDA 2KEYA 1L3TA 4YR3A 2H3QA 2BCUA 2K4PA 3WK9A 1N63A 4F5OA 3MBYA 4CNQA 5DBAA 3MR2A 4R8UB 1Z1BA 3OHAA 1X9MA 3GV5B 1BPBA 5GTIU 2GWSA 2Y9TA 2W55A 2DWQA 4QNLA 5DDMA 8ICMA 2ISPA 3RJJA 1ZQXA 1RQNA 1ZQOA 2WB1C 4DFDA 2EANA 5ALGA 4DL6A 2F8LA 5G5HA 2FMPA 3JPTA 7ICOA 5HR6A 4M6WB 4EEKA 2C28A 2XGQA 1HUOA 1TAUA 1SXEA 4EX6A 4UB5A 1ZQLA 3UQ0A 3EUB2 4NY8A 2EZZA 4QZ8A 3JPSA 4C0ZA 4O3QA 4MHVA 1MQ2A 4QZCA 3QU5A 2BPFA 4O5EA 3CW2C 3OSNA 2AGOA 1FEZA 3BQ7A 4RNMA 1BGXT 4R66A 3IRUA 4GLXA 3N4MB 2ZIUB 1XWLA 5KFYA 5ALKA 4DFPA 3NVZA 4EENA 2G07A 4OD0A 4XUSA 3H4DA 2Y0SC 3VC8A 1ZQAA 5HP4A 2I6XA 2HHVA 3OJUA 1Q46A 4KLGA 5DB9A 3PO4A 3LYSA 4F4ZA 5AIAA 4QZBA 4DQQA 3PW5A 7ICLA 3H8SA 2H3IA 3ED5A 2RHFA 2OXOA 3PY8A 5CP2A 3PW2A 4RUCA 3V6KA 4QZ9A 9ICTA 4KN4A 4P0PB 4ELUA 1L5UA 4R63A 2FDRA 5KFAA 2R8JA 1NOMA 1TVAA 4DEZA 1GO3F 2ZIWB 8ICSA 3SMVA 2UVVA 3T5JA 2E8OA 1TAMA 2BKEA 4Z6FA 4DL2A 1SGGA 4B9VA 3OHBA 3JPPA 2KHQA 2PMZF 4RT2A 1UHUA 2VJ4A 1L3VA 2K60A 2F1IA 3UXOA 4RNNA 2H5XA 2JZBA 5KT2A 5CB1A 2LMRA 4ECWA 2XGPA 2BDPA 2FPLA 3IV6A 1VJ5A 3KD3A 1PVRA 4NWIA 1QQ7A 2PI4A 1CUKA 2IMWP 8ICFA 4I2EA 4P4PA 1JROA 2HBJA 4J9KA 1PK3A 1QSLA 4NM2A 5KG5A 3C5GA 5DBBA 2WAQF 2VA8A 1DGSA 4Z6CA 2EZXA 2FE9A
chains in the Genus database with same CATH topology
3TADA 2E8NA 1SV0C 1UQVA 2GLEA 2EAPA 3BS5A 2EAMA 5KNIA 2LPEA 2KIVA 3SENA 1DXSA 1OW5A 2KSOA 4NL9A 4RQMA 4PZNA 3KKAC 2ES6A 1V38A 5J8YC 2KMDA 4NJ8A 2QARA 5JRTA 2D3DA 2K4PA 2DL0A 2F44A 2D8CA 1SV4A 4RQNA 2QKQA 2KSOB 2DKZA 1WWVA 1X40A 5J8YA 2JV3A 4IS7A 2F3NA 2Y9TA 5L1MA 1OXJA 2QARB 3KKAA 2EAOA 1F0MA 2QB1A 2E8OA 3SEIA 3HILA 3TADC 1RG6A 4NL9C 5F3XB 2Y9UA 1SGGA 3BS5B 3BS7A 1LKYB 2EANA 2K60A 2DKXA 1COKA 1V85A 1SV0A 1JI7A 5JTIA 1SXEA 2LMRA 3IDWA 2QB0B 1X66A 1PK1A 1KW4A 4PZOA 1X9XA 2B6GA 1UCVA 4MHVA 2E8MA 2YTUA 3H8MA 2KE7A 1LKYA 3TACB 2ESEA 3BQ7A 2F8KA 1WWUA 1Z1VA 2L5YA 5JU5A 1B0XA 1PK3A 3K1RB 2QB0A 1B4FA 1PK1B 1SXDA 2KG5A 2E8PA 2FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD A;  2E8N A;  1SV0 C;  1UQV A;  2GLE A;  2EAP A;  3BS5 A;  2EAM A;  5KNI A;  2LPE A;  2KIV A;  3SEN A;  1DXS A;  1OW5 A;  2KSO A;  4NL9 A;  4RQM A;  4PZN A;  3KKA C;  2ES6 A;  1V38 A;  5J8Y C;  2KMD A;  4NJ8 A;  2QAR A;  5JRT A;  2D3D A;  2K4P A;  2DL0 A;  2F44 A;  2D8C A;  1SV4 A;  4RQN A;  2QKQ A;  2KSO B;  2DKZ A;  1WWV A;  1X40 A;  5J8Y A;  2JV3 A;  4IS7 A;  2F3N A;  2Y9T A;  5L1M A;  1OXJ A;  2QAR B;  3KKA A;  2EAO A;  1F0M A;  2QB1 A;  2E8O A;  3SEI A;  3HIL A;  3TAD C;  1RG6 A;  4NL9 C;  5F3X B;  2Y9U A;  1SGG A;  3BS5 B;  3BS7 A;  1LKY B;  2EAN A;  2K60 A;  2DKX A;  1COK A;  1V85 A;  1SV0 A;  1JI7 A;  5JTI A;  1SXE A;  2LMR A;  3IDW A;  2QB0 B;  1X66 A;  1PK1 A;  1KW4 A;  4PZO A;  1X9X A;  2B6G A;  1UCV A;  4MHV A;  2E8M A;  2YTU A;  3H8M A;  2KE7 A;  1LKY A;  3TAC B;  2ESE A;  3BQ7 A;  2F8K A;  1WWU A;  1Z1V A;  2L5Y A;  5JU5 A;  1B0X A;  1PK3 A;  3K1R B;  2QB0 A;  1B4F A;  1PK1 B;  1SXD A;  2KG5 A;  2E8P A;  2FE9 A; 
#chains in the Genus database with same CATH topology
 4RQ6 A;  3BQ2 A;  3FYH A;  2W7P A;  3F5A A;  4DSE A;  2VIX A;  5KAI U;  1RM6 C;  2YMQ A;  2KSO A;  2WTF A;  3WKE A;  1ZQB A;  2ZUB A;  2AQ0 A;  4AYB C;  3FM9 A;  4FZM A;  4F50 A;  3OJS A;  4IL6 U;  4B9T A;  3SV3 A;  3WK7 A;  2G06 A;  1IV8 A;  3ALR A;  1HUZ A;  2W7O A;  4RQN A;  2J6S A;  3GIL A;  4IQT A;  5ALR A;  1KBU A;  4J9Q A;  3UMC A;  2IOF A;  1Z19 A;  4R65 A;  4EBC A;  3NVY A;  2KV2 A;  4RNO A;  3JPN A;  1F0M A;  2HDO A;  4KLQ A;  2QB1 A;  4DF4 A;  4IRC A;  3RRG A;  4U7C A;  3D6J A;  1YZ6 A;  3WK6 A;  3PV8 A;  1ZD4 A;  2KFZ A;  2BCS A;  2PXI A;  1A0P A;  3WKC A;  7ICF A;  3Q8K A;  7ICI A;  2WB1 F;  9ICP A;  5B66 U;  1ECW A;  4F5P A;  3NRW A;  1KQQ A;  7ICS A;  4OO1 J;  5CRX A;  1OUQ A;  1S76 D;  3KHG A;  2K8C B;  3TAC B;  3Q8R B;  3GU3 A;  1C20 A;  2A3V A;  2F8K A;  3RB0 A;  2XI9 A;  4PL1 A;  4BJQ A;  4YCX A;  2PFO A;  2LM4 A;  2K4E A;  3B0X A;  2XY6 A;  2UVR A;  1XS9 D;  1M6Y A;  1PK1 B;  3ZDD A;  1N48 A;  3UMG A;  4UW9 A;  1MN8 A;  3AN1 A;  1ARO P;  5AKE A;  1ZJN A;  2YN4 A;  1ZQI A;  3TAP A;  3C1Z A;  4RQ5 A;  4A8E A;  3UQ2 A;  2G5H B;  9ICE A;  3TAN A;  1ZET A;  5J0X A;  3NUQ A;  5AM5 A;  2B21 A;  1L3U A;  2OCE A;  4BUG A;  5J8Y C;  4JV2 A;  4B9N A;  3ZDE A;  1KFD A;  4UBB A;  1ZD2 P;  3UM9 A;  4PHP A;  2G08 A;  5ALP A;  7ICG A;  2WF8 A;  1HEK A;  1WCN A;  5AK3 A;  3QU2 A;  5AM4 A;  4O3N A;  4TQS A;  3PW0 A;  4OJ5 A;  4Y2Y A;  4CF5 A;  5DQH A;  1QLN A;  4M9G A;  1KSP A;  3ISB A;  5L1M A;  2QAR B;  5CEH A;  1TK0 A;  5AIB A;  1JN3 A;  4DSL A;  2KJ5 A;  5IIN A;  3ZDC A;  5KG3 A;  3UXP A;  1FIQ A;  2C22 A;  1Z00 A;  2KNJ A;  3EPG A;  5AM0 A;  8ICG A;  2ALZ A;  4BWJ A;  3HPO A;  1ZQM A;  4I2C A;  1WUD A;  1ZJM A;  5CJ7 A;  5DB6 A;  3H7I A;  1RXV A;  2DQN B;  3H0L B;  1XC9 A;  4PJ0 U;  3F2D A;  2HHW A;  3M6K A;  3ETR A;  4UB8 U;  1S0M A;  2Y1I A;  2LM1 A;  1QSY A;  1N5W A;  3NVV A;  4ECT A;  3CNH A;  4XRH A;  2KKV A;  5AIC A;  4F2S A;  3AU6 A;  3T5L A;  1TE2 A;  3C2K A;  2BHN A;  1WYG A;  4RU9 A;  4DL7 A;  4MF2 A;  2EH9 A;  1Z4O A;  5AI4 A;  2DPI A;  3PVX A;  3MGI A;  3UMB A;  4RQ8 A;  2KZM A;  3WU2 U;  4M47 A;  1OW5 A;  4R8U A;  4UB6 U;  5IIL A;  4IRD A;  1Q3U A;  1C7Y A;  4KN7 A;  4DLE A;  3IG8 A;  1V38 A;  3RR8 A;  5ALW A;  5KG0 A;  3RH6 A;  1D9F A;  3QEB Z;  4Y2U A;  1NJX A;  2F44 A;  5ALY A;  2LYB A;  1NK9 A;  1TAQ A;  2YY6 A;  3ORY A;  4ED0 A;  2KVS A;  4OCZ A;  2AJQ A;  1J2M A;  5J2E A;  4M2Y A;  9ICK A;  2WFA A;  1QQ6 A;  4QIW F;  4KLF A;  3FAH A;  3WK5 A;  2W3R A;  3MDC A;  4C4T A;  4B9M A;  1KRP A;  4M0A A;  1NKE A;  4CCH A;  3RBE A;  3EW9 A;  3F2B A;  1NJZ A;  4ED2 A;  4ELV A;  5T14 A;  4UAV A;  3NRZ A;  4U6P A;  3QUQ A;  3QZ8 A;  2RP5 A;  1V97 A;  5KAF U;  3GQC A;  3BZK A;  4QWD A;  1SKW A;  1V85 A;  1JI7 A;  3EPI A;  3V7J A;  2GO7 A;  4KLU A;  5DG9 A;  8ICR A;  3RJK A;  2UVW A;  4IQW A;  2V4R A;  3V72 A;  2V4Q A;  4ECZ A;  1K1S A;  3EYZ A;  3QXG A;  4K4I A;  1YT3 A;  2M0N A;  3TAQ A;  4P4M A;  3LVW A;  3MR5 A;  4F4X A;  2FMQ A;  1IM4 A;  3K75 D;  4QZA A;  4MEY A;  3SAG A;  3MFI A;  4R64 A;  3EWA A;  8ICP A;  4UAS A;  3U26 A;  3LWM A;  4NLZ A;  5J2H A;  2NRV A;  2LYH A;  4UAR A;  4DQP A;  3LDA A;  5CHG A;  2HCF A;  5KFR A;  2NO4 A;  2I9G A;  7ICR A;  1LB2 B;  4Q43 A;  4F72 A;  4P0Q B;  4BXO B;  1WCL A;  3HW8 A;  1L3S A;  5ALJ A;  4GXK A;  4I2I A;  3PX6 A;  9ICI A;  2NYV A;  2DKZ A;  5AKH A;  1EXN A;  1U4B A;  5KFX A;  2JH7 A;  2YB4 A;  4C7Z A;  4YD1 A;  4K4H A;  4US9 A;  2XY5 A;  9ICU A;  5DG7 A;  2R8G A;  2VKQ A;  2DUY A;  4TQR A;  3NGD A;  2NRZ A;  4E0D A;  2IA6 A;  3UPQ A;  4CDG A;  4UQG A;  2JEF A;  4TUQ A;  4UB3 A;  3QU9 A;  1DOQ A;  5DDY A;  3OTQ A;  1ZQG A;  4PPX A;  4RQ4 A;  3RJF A;  2HW3 A;  2XVT A;  2HVI A;  1NK4 A;  5ALS A;  2JR5 A;  4BDP A;  2HHT A;  5JTI A;  3T5K A;  3IDW A;  3PR4 A;  3RJE A;  1S97 A;  9ICG A;  4EBE A;  2HOQ A;  1AQ6 A;  4EZ9 A;  7ICN A;  2YQE A;  3ONN A;  4DL3 A;  3K1Z A;  2F2A B;  2KE7 A;  5D49 A;  3G6X A;  4DQI A;  4I2A A;  1ZQS A;  4DL5 A;  3RJG A;  4RUA A;  3GV8 B;  4YFK A;  2K8B B;  1ZQJ A;  2A19 A;  2PMZ C;  4QZG A;  1VDV A;  2WAQ C;  2A1A A;  4IQU A;  5AI9 A;  2GOL A;  1DGJ A;  2EAM A;  2JEI A;  5KFQ A;  4C7Y A;  2KIV A;  4ED7 A;  2ZJA A;  4JV0 A;  3RBD A;  2EDU A;  4EZ6 A;  3RB4 A;  4KLT A;  4O3M A;  4RQM A;  9ICO A;  4NV0 A;  1ZXI A;  9ICF A;  3QYP A;  4EBD A;  2NO5 A;  3HX0 A;  1RZT A;  5L1J A;  2EQY A;  2FJ6 A;  1BPY A;  4NXZ A;  3N7P D;  5HHH A;  1N56 A;  5AK5 A;  2KTQ A;  5AKL A;  4ACO A;  9ICH A;  4NLB A;  1A77 A;  3GDX A;  4GC7 A;  4MFC A;  2W9A A;  2WHE A;  3V7L A;  5KTQ A;  3TQ1 A;  4AP9 A;  2W9C A;  9ICC A;  5KG7 A;  4WJ3 B;  2KHV A;  2GH1 A;  4LVS A;  3AUO A;  3PST A;  1SKR A;  5F9L A;  3IM1 A;  2YMM A;  4MFA A;  2ZG6 A;  5AK4 A;  1SWV A;  4JUZ A;  4ELT A;  1VLB A;  5ALI A;  3M9O B;  1KL9 A;  4O0I A;  3KZI U;  2AXT U;  2XCA A;  3OPX A;  3MC1 A;  5AKG A;  4ECV A;  4G9B A;  1U49 A;  3WKB A;  2YML A;  4YMO A;  1X9S A;  9ICR A;  5ALM A;  1Q8K A;  4C4S A;  1S8O A;  2L5Y A;  5KFH A;  4FS2 A;  2K4I A;  4O9M A;  1SL1 A;  4I2B A;  3PX4 A;  3ZDB A;  1RXW A;  4DWI A;  2Z7J A;  4IR1 A;  4J9O A;  4J9P A;  4I2H A;  3BJY A;  3RB6 A;  3WK8 A;  5J2K A;  4ECR A;  1PUZ A;  3OSP A;  3H40 A;  2FI1 A;  4M9L A;  1UA0 A;  4ZH4 A;  4QW9 A;  1PZN A;  5KFM A;  3E2E A;  3RTV A;  2KMD A;  2ZXH A;  5L1K A;  5J29 A;  3DV9 A;  3SAF A;  1XSN A;  2BQ3 A;  3MGV A;  2B0C A;  2D3D A;  3QZ7 A;  3LWL A;  5L9X A;  1CRX A;  2QKQ A;  5HMM A;  4M9H A;  3AM9 A;  2W8L A;  2VA2 A;  3SQI A;  4UAW A;  5J8Y A;  5KG6 A;  4PGX A;  2D6F C;  1ZQD A;  1CEZ A;  9ICX A;  3ZDA A;  4QZI A;  3NAS A;  4DO9 A;  3TAD C;  4NL9 C;  5BOL A;  2ASJ A;  4I29 A;  4PL2 A;  1T4G A;  1XO0 A;  4Y2J A;  4YR2 A;  3BS7 A;  4RQ0 A;  4O3S A;  5KL8 B;  3SZ2 A;  5KFP A;  1KFT A;  2HHX A;  1IXR A;  3C1Y A;  2MU2 A;  4XQ8 A;  3UXN A;  1ZQH A;  4YMN A;  3PW7 A;  1UCV A;  3V6H A;  4B9S A;  2ZIV A;  5ALH A;  3H8M A;  2HHS A;  8ICI A;  4KMU A;  1LVH A;  9ICM A;  3I76 A;  3DDH A;  5DBC A;  2IHN A;  7ICJ A;  1Z1V A;  3THV A;  5KG1 A;  5KFJ A;  5JU5 A;  5J0U A;  1B0X A;  1ZRN A;  4Z6E A;  2E1E A;  8ICV A;  1K5O A;  3HJE A;  5H2F U;  5AKY A;  1B43 A;  2K4H A;  5J2J A;  3PO5 A;  2KD1 A;  2KG5 A;  4EYI B;  3RFA A;  2BPC A;  4M04 A;  4QZF A;  5A0L A;  1S0V A;  2JRZ A;  3CP8 A;  4DFM A;  1XNS A;  2BQU A;  4NL9 A;  5DKW A;  3KHL A;  1L7P A;  4GXJ A;  2PFN A;  1NNL A;  2N1R A;  1UT8 A;  4DFK A;  1UPH A;  3RH5 A;  4YXJ A;  9ICQ A;  2DL0 A;  5AI8 A;  2IHM A;  1SV4 A;  1ZQU A;  8ICB A;  1BVS A;  2ZUC A;  5K4L A;  2ZTE A;  3M1Y A;  3BZC A;  2JMG A;  2XCP A;  4QIW C;  1NK0 A;  3QEA Z;  4M9J A;  1XSL A;  1N2X A;  4KLS A;  2XIC A;  3NS1 A;  4YN4 A;  4USA A;  1NJW A;  4P4O A;  4DL4 A;  3PSI A;  1T94 A;  3JPR A;  1UT5 A;  3C23 A;  2DKX A;  1COK A;  2ZTC A;  1SV0 A;  4C8N A;  3N97 B;  5HHI A;  2RQ5 A;  4ECX A;  1PK1 A;  4YMM A;  4I28 A;  3MR6 A;  4IR9 A;  4YD2 A;  2BCV A;  5III A;  3C29 A;  2J6T A;  5KFN A;  2OHF A;  5EOZ A;  2R8H A;  4LJX A;  2ATL A;  4ECS A;  5IIK A;  5J2A A;  1QTM A;  4PHE A;  5KFL A;  2KJ9 A;  4KLJ A;  5GTH U;  4EX7 A;  1X9W A;  1D8B A;  4MFF A;  1SXD A;  2E8N A;  1UQV A;  3MAB A;  4C8M A;  3SV4 A;  5ALO A;  5CR0 A;  8ICW A;  4F91 B;  5BOM A;  5AI5 A;  1KEJ A;  2ZTD A;  1K1Q A;  3C2M A;  3CRX A;  4OJL A;  4PGY A;  3GIJ A;  5J0S A;  4P0Q A;  4DQR A;  4NJ8 A;  1SWW A;  2A1J B;  4X5V A;  4EEL A;  4KLI A;  4I27 A;  1HIW A;  3FC4 A;  5J2B A;  4RQ2 A;  4Y2R A;  2MSN A;  4HYK A;  3KOO A;  4Q8E A;  2Y0S F;  1NZB A;  2JHD A;  1ZQR A;  2H3Z A;  3QX7 A;  1J2N A;  3NTU A;  3I1Y A;  1X6J A;  2JV3 A;  4RZR A;  4KX5 A;  1N62 A;  1U45 A;  8ICL A;  1L7M A;  2F1J A;  1Y88 A;  1PVP A;  5D4B A;  1D8Y A;  4UAZ A;  3QUT A;  4C8K A;  4B9L A;  3RAQ A;  4FZL A;  3NVW A;  3SR6 A;  3Q8S B;  4RT3 A;  2ASD A;  1J97 A;  1LKY B;  2R18 A;  5DB8 A;  2LYA A;  8ICA A;  5J2F A;  2KVC A;  2BGW A;  3B0Y A;  4RQ7 A;  3J81 j;  5KFB A;  2XC9 A;  3T3F A;  2MUT A;  2W54 A;  3RF9 A;  3OGU A;  4PH5 A;  5J0Q A;  3MGH A;  3KHR A;  1TKD A;  4ECU A;  2ZIX B;  2R8I A;  3AL0 B;  1ZD3 A;  3Q8Q B;  5KFZ A;  1BPX A;  3A0B U;  4JMU A;  5J0R A;  5AM3 A;  2LKY A;  7ICM A;  2QB0 A;  4Z6D A;  4LZD A;  4GFJ A;  4IRK A;  3CYM A;  1F5S A;  3QNM A;  4DCC A;  8ICH A;  2ZIW A;  2OWO A;  3D2N A;  2GLE A;  3ZI4 A;  5CA7 A;  4KLM A;  4DLG A;  3KHH A;  2OEH A;  8ICY A;  2P6U A;  4F8R A;  1WG8 A;  3BDP A;  4FZN A;  3S6J A;  1BNO A;  2JH1 A;  5HML A;  2AH5 A;  4PZN A;  2AGP A;  3C28 A;  4F4Y A;  2IOF K;  4PHA A;  4C4R A;  3H0R B;  1ZQV A;  3RB3 A;  2ZJ8 A;  3IP4 B;  4O5K A;  1QH9 A;  4Q45 A;  3AQF A;  4P0P A;  3L5K A;  5EWF A;  5EE0 A;  1RPL A;  2FPK A;  4BXO A;  5TIS U;  1ZQC A;  4IS7 A;  2A1J A;  5KT6 A;  4B6J A;  3KBB A;  1L7N A;  4Y2T A;  2BCR A;  4KX3 A;  2HMX A;  4Y2V A;  2YB1 A;  5EE9 A;  1T7P A;  4I2J A;  5ALN A;  1NI3 A;  4ED1 A;  4UB2 A;  3M6Z A;  3SYZ A;  3ZD8 A;  2IBK A;  4FO6 A;  2W3S A;  3BS5 B;  5E79 U;  2BDU A;  5KFG A;  3E0F A;  2BZF A;  2Q0Z X;  3RJH A;  5EE3 A;  4PGQ A;  4J9L A;  4F93 B;  7ICV A;  2IOH A;  4DS5 A;  3I28 A;  1BPZ A;  1TK8 A;  3AQE A;  1TK5 A;  2MAX A;  4PZO A;  5DLG A;  2B6G A;  2RDI A;  3F2C A;  3HT3 A;  4J9N A;  1L6N A;  2ZIU A;  2XID A;  4UBC A;  1JAL A;  3RAX A;  2W11 A;  4JWM A;  1LKY A;  4I2D A;  2MA1 A;  2V9W A;  4KLL A;  5KFT A;  4KLD A;  4J9S A;  1ZYQ A;  2F77 X;  2BCQ A;  1ZQY A;  4FBT A;  2NRW A;  5DGB A;  4NLK A;  1S5L U;  1B4F A;  4O3O A;  1NK6 A;  2Y1J A;  4G3I A;  3TAD A;  1JRP A;  5AM1 A;  4RPY A;  1NZP A;  2W9C B;  2AHO B;  4EEY A;  5EWG A;  2JGA A;  2LPE A;  4JB3 A;  4YXM A;  4YQW A;  1U48 A;  2LHT A;  5EWE A;  4F4W A;  2E3T A;  1F44 A;  8ICN A;  2AU0 A;  3MDA A;  2YMP A;  3H8J A;  5KFV A;  2W9B B;  2QAR A;  5AKJ A;  3PX0 A;  9ICA A;  3HKZ F;  5KFK A;  5ALQ A;  5AK6 A;  2C2E A;  3G6Y A;  4DSK A;  4BGD A;  1NK8 A;  9ICL A;  9ICN A;  4DSI A;  1B22 A;  1NKB A;  1P7D A;  1WWV A;  4DSJ A;  3PZP A;  3Q8P B;  4CRX A;  4QW8 A;  2M9N A;  4F2R A;  1ZQF A;  2KKP A;  4DOB A;  5B5E U;  3JPO A;  2XY7 A;  2FPM A;  2PKE A;  5F3X B;  2KIW A;  1LV5 A;  3C21 A;  2HSZ A;  4F5Q A;  4GXI A;  2PFQ A;  4JWN A;  5J0W A;  3IG5 A;  4YP3 A;  3BQ0 A;  4UB1 A;  4O3R A;  2HHU A;  5EE1 A;  2C2D A;  4AYB F;  2C2R A;  1PVQ A;  4I2F A;  1COO A;  1ZD5 A;  5BPC A;  3GIM A;  4DSF A;  4LZG A;  3ISC A;  2WF7 A;  3D2S A;  1ZRM A;  3QUC A;  1X9X A;  9ICJ A;  2LBO A;  3T5H A;  4F5N A;  4K4G A;  2ESE A;  3RR7 A;  4ICA A;  4UB4 A;  4C80 A;  2HI0 A;  5HR7 A;  5AI0 A;  4Q44 A;  3PW4 A;  1S77 D;  4O3P A;  1RYS A;  2KOB A;  1DK2 A;  5KL1 B;  3QUB A;  4RPZ A;  1MC8 A;  2E8M A;  1CI4 A;  4QWA A;  4EYH B;  1U9L A;  2YX8 A;  1ZQ1 C;  4OJP A;  3FDS A;  3H4B A;  2HBK A;  2FLP A;  4F92 B;  2E5S A;  2G5I B;  5J0O A;  3MR3 A;  2XO7 A;  1Z4N A;  4J9M A;  4UAY A;  2OM6 A;  2NV3 A;  2WF5 A;  2RLT A;  4MEX A;  2W43 A;  3V6J A;  4CF4 A;  5JRT A;  1RDF A;  1RQL A;  2H3V A;  5AKI A;  3ISD A;  3BQ1 A;  3KFU F;  1U47 A;  5DG8 A;  2KK0 A;  3DEE A;  2G09 A;  2DF4 B;  4UAT A;  3HKZ C;  4Y2S A;  2DGZ A;  1X40 A;  1ZQN A;  2F3N A;  2W9B A;  2P66 A;  4QZD A;  4NM1 A;  3M7D A;  1DRG A;  1ZQT A;  3AEV A;  1SZH A;  3PR5 B;  2Q4T A;  2HHQ A;  2NRX A;  3Q8M A;  2I1Q A;  7ICP A;  3IN5 A;  2BQR A;  1D9D A;  4JV1 A;  1ZQZ A;  4QZH A;  3GZF A;  1JIH A;  2MRL A;  1NK5 A;  3O0F A;  4KLE A;  2KP7 A;  4ECY A;  3LVV A;  1SL2 A;  1X66 A;  4O5C A;  8ICE A;  1KW4 A;  1X6I A;  5ALU A;  1S10 A;  1MA7 A;  4KTQ A;  1BPD A;  1X2I A;  1V9P A;  2ZXI A;  1WWU A;  4NLN A;  3HRD D;  4ED3 A;  1TV9 A;  1ZQW A;  5KFU A;  3N7S C;  5FP0 A;  4KIT B;  2F1H A;  5ALV A;  2KN7 A;  1DK3 A;  1T3N A;  1FFV A;  1SZP A;  5KFW A;  7ICU A;  2F76 X;  1SV0 C;  2JXJ A;  4OJ6 A;  2HOF A;  8ICQ A;  1MQ3 A;  3A0H U;  1KN5 A;  1N61 A;  2ZUD A;  1XSP A;  4TUR A;  3B9J A;  3M8S A;  1A76 A;  5KFI A;  8ICX A;  3V7K A;  1RYR A;  1A6S A;  4US8 A;  4DQS A;  3L4P A;  3TFS A;  1NK7 A;  1KDH A;  1TFR A;  5J0Y A;  4Y2P A;  2KSO B;  5DQI A;  3M8R A;  2ISO A;  4RQ1 A;  2EZY A;  4BX9 C;  9ICS A;  2OH2 A;  3Q8L A;  2CRX A;  1T3Q A;  4QZE A;  2ZJ5 A;  4XA5 A;  2VA3 A;  1SB3 C;  1S0O A;  1XO1 A;  5AKK A;  3KTQ A;  4DF8 A;  3HIL A;  4HAI A;  2J6U A;  4J03 A;  5AKX A;  2AQ4 A;  1ZOL A;  1KKX A;  1L8O A;  5J2C A;  2H3F A;  3AU2 A;  1Q3V A;  5D46 A;  5IIM A;  1JXE A;  3KZX A;  5KFO A;  5ALZ A;  8ICK A;  1RYU A;  2YTU A;  4F4K A;  4QWC A;  2BR0 A;  3JPQ A;  2ZIV B;  3QU7 A;  3GV7 B;  7ICE A;  5JUM A;  3K1R B;  1URJ A;  5DGA A;  5AHX A;  2CN1 A;  5ALD A;  9ICW A;  2EAP A;  3BS5 A;  4M9N A;  5CWR A;  5KNI A;  1MSW D;  4NLG A;  2PI5 A;  4P2H A;  3SI8 A;  3SEN A;  1DXS A;  2WF9 A;  1HJP A;  3KKA C;  3WKD A;  2FLN A;  2W04 A;  3PSP A;  1JX4 A;  2ASL A;  3RRH A;  3L3F X;  1KTQ A;  3PNC A;  9ICV A;  2NRT A;  2DBY A;  2CXY A;  2R8K A;  2D8C A;  2E1F A;  5KFC A;  4F5R A;  5DQG A;  1S9F A;  5IIO A;  4F71 A;  3G6V A;  2KJ8 A;  1T8E A;  2WF6 A;  5C5J A;  5DB7 A;  4ZOH C;  4Y2Q A;  4CE6 A;  2FMS A;  1IIP A;  2P35 A;  1NJY A;  5KFF A;  1D8L A;  1BPE A;  7ICH A;  1O08 A;  3PMN A;  3N28 A;  3SEI A;  1BNP A;  1RG6 A;  4PHD A;  3LK9 A;  4FS1 A;  2Y9U A;  4ED8 A;  3M9M B;  3ICX A;  2HBL A;  4B9U A;  2RRD A;  4RPX A;  5F9N A;  2OYY A;  3ZD9 A;  2K89 A;  1ED1 A;  3RJI A;  2O6K A;  1H38 A;  5J2G A;  3EZ5 A;  3HWT A;  5KG4 A;  1SKS A;  9ICB A;  8ICZ A;  2W03 A;  3E58 A;  8ICU A;  3SAH A;  4DOC A;  4GIB A;  1JXL A;  2W8K A;  5L1L A;  4YVZ A;  3AMZ A;  2I5H A;  5KFS A;  5G5G A;  4QWB A;  1L7O A;  2DFL A;  1YZ7 A;  1N5X A;  3T79 A;  5KT7 A;  5KFE A;  2PFP A;  5KT3 A;  4QJF B;  3WK4 A;  1Z3E B;  1UA1 A;  4UAU A;  1FFU A;  4C8O A;  3H8W A;  1ZQK A;  4OJO A;  5ALL A;  3C5F A;  2E8P A;  4BWM A;  2ODG A;  2KZZ A;  3N7R C;  2VJ5 A;  5C0Y A;  1ZQE A;  5KG2 A;  4IQV A;  2MUT B;  1QCK A;  1SIJ A;  1X42 A;  3TI0 A;  5TZV A;  5HNK A;  4Q8F A;  2JEG A;  4KLO A;  4CF3 A;  3R9K A;  4M6W A;  4J9R A;  1XU4 A;  3BQT A;  2HOI A;  4KLH A;  5ALX A;  5J0P A;  2DPJ A;  4FBU A;  8ICO A;  4Y2X A;  4NLC A;  2BPG A;  1QQ5 A;  2KIC A;  2W9M A;  1KLN A;  5J2D A;  1NKC A;  5IIJ A;  1JUD A;  3D2Q A;  2JEJ A;  2QLT A;  3MFH A;  3QE9 Y;  1OXJ A;  4GC6 A;  2UVU A;  3KKA A;  2EAO A;  4DS4 A;  4MF8 A;  3H0M B;  1SL0 A;  3GFK B;  7ICT A;  8ICT A;  5ALF A;  3GIK A;  3QU4 A;  3F53 A;  4ED6 A;  3VCB A;  4IC9 A;  4RQ3 A;  2KFN A;  5KT4 A;  1ZQP A;  2RDJ A;  4FE3 A;  5KFD A;  3GII A;  3SD7 A;  5KT5 A;  7ICK A;  2QB0 B;  5ALT A;  4CGZ A;  1L8L A;  3M9N B;  2FLL A;  4DOA A;  3C2L A;  3K4G A;  3IHQ B;  2HBM A;  2KZ3 A;  4F3O A;  5ALE A;  2AGQ A;  1ZQQ A;  1Z00 B;  3PML A;  2HVH A;  7ICQ A;  5AKZ A;  5AM2 A;  4I2G A;  4TUS A;  1N60 A;  2LI6 A;  2P6R A;  5DLF A;  1KFS A;  4YR0 A;  1S0N A;  1O03 A;  2VAN A;  2K8A A;  4TUP A;  5J2I A;  2ZIX A;  3RH4 A;  1JMS A;  3PSF A;  4ECQ A;  1FO4 A;  5L1I A;  4YG2 A;  5AI6 A;  4C8L A;  1IG6 A;  3TFR A;  8ICJ A;  8ICC A;  2G0A A;  4DFJ A;  1QSS A;  4QWE A;  2CPR A;  3TAR A;  4JK1 A;  4KMO B;  3F5E A;  3TKA A;  2ES6 A;  3WKA A;  5J0T A;  3HP6 A;  2JZB B;  3ETL A;  4FFD A;  2KEY A;  1L3T A;  4YR3 A;  2H3Q A;  2BCU A;  2K4P A;  3WK9 A;  1N63 A;  4F5O A;  3MBY A;  4CNQ A;  5DBA A;  3MR2 A;  4R8U B;  1Z1B A;  3OHA A;  1X9M A;  3GV5 B;  1BPB A;  5GTI U;  2GWS A;  2Y9T A;  2W55 A;  2DWQ A;  4QNL A;  5DDM A;  8ICM A;  2ISP A;  3RJJ A;  1ZQX A;  1RQN A;  1ZQO A;  2WB1 C;  4DFD A;  2EAN A;  5ALG A;  4DL6 A;  2F8L A;  5G5H A;  2FMP A;  3JPT A;  7ICO A;  5HR6 A;  4M6W B;  4EEK A;  2C28 A;  2XGQ A;  1HUO A;  1TAU A;  1SXE A;  4EX6 A;  4UB5 A;  1ZQL A;  3UQ0 A;  3EUB 2;  4NY8 A;  2EZZ A;  4QZ8 A;  3JPS A;  4C0Z A;  4O3Q A;  4MHV A;  1MQ2 A;  4QZC A;  3QU5 A;  2BPF A;  4O5E A;  3CW2 C;  3OSN A;  2AGO A;  1FEZ A;  3BQ7 A;  4RNM A;  1BGX T;  4R66 A;  3IRU A;  4GLX A;  3N4M B;  2ZIU B;  1XWL A;  5KFY A;  5ALK A;  4DFP A;  3NVZ A;  4EEN A;  2G07 A;  4OD0 A;  4XUS A;  3H4D A;  2Y0S C;  3VC8 A;  1ZQA A;  5HP4 A;  2I6X A;  2HHV A;  3OJU A;  1Q46 A;  4KLG A;  5DB9 A;  3PO4 A;  3LYS A;  4F4Z A;  5AIA A;  4QZB A;  4DQQ A;  3PW5 A;  7ICL A;  3H8S A;  2H3I A;  3ED5 A;  2RHF A;  2OXO A;  3PY8 A;  5CP2 A;  3PW2 A;  4RUC A;  3V6K A;  4QZ9 A;  9ICT A;  4KN4 A;  4P0P B;  4ELU A;  1L5U A;  4R63 A;  2FDR A;  5KFA A;  2R8J A;  1NOM A;  1TVA A;  4DEZ A;  1GO3 F;  2ZIW B;  8ICS A;  3SMV A;  2UVV A;  3T5J A;  2E8O A;  1TAM A;  2BKE A;  4Z6F A;  4DL2 A;  1SGG A;  4B9V A;  3OHB A;  3JPP A;  2KHQ A;  2PMZ F;  4RT2 A;  1UHU A;  2VJ4 A;  1L3V A;  2K60 A;  2F1I A;  3UXO A;  4RNN A;  2H5X A;  2JZB A;  5KT2 A;  5CB1 A;  2LMR A;  4ECW A;  2XGP A;  2BDP A;  2FPL A;  3IV6 A;  1VJ5 A;  3KD3 A;  1PVR A;  4NWI A;  1QQ7 A;  2PI4 A;  1CUK A;  2IMW P;  8ICF A;  4I2E A;  4P4P A;  1JRO A;  2HBJ A;  4J9K A;  1PK3 A;  1QSL A;  4NM2 A;  5KG5 A;  3C5G A;  5DBB A;  2WAQ F;  2VA8 A;  1DGS A;  4Z6C A;  2EZX A;  2FE9 A; 
#chains in the Genus database with same CATH homology
 3TAD A;  2E8N A;  1SV0 C;  1UQV A;  2GLE A;  2EAP A;  3BS5 A;  2EAM A;  5KNI A;  2LPE A;  2KIV A;  3SEN A;  1DXS A;  1OW5 A;  2KSO A;  4NL9 A;  4RQM A;  4PZN A;  3KKA C;  2ES6 A;  1V38 A;  5J8Y C;  2KMD A;  4NJ8 A;  2QAR A;  5JRT A;  2D3D A;  2K4P A;  2DL0 A;  2F44 A;  2D8C A;  1SV4 A;  4RQN A;  2QKQ A;  2KSO B;  2DKZ A;  1WWV A;  1X40 A;  5J8Y A;  2JV3 A;  4IS7 A;  2F3N A;  2Y9T A;  5L1M A;  1OXJ A;  2QAR B;  3KKA A;  2EAO A;  1F0M A;  2QB1 A;  2E8O A;  3SEI A;  3HIL A;  3TAD C;  1RG6 A;  4NL9 C;  5F3X B;  2Y9U A;  1SGG A;  3BS5 B;  3BS7 A;  1LKY B;  2EAN A;  2K60 A;  2DKX A;  1COK A;  1V85 A;  1SV0 A;  1JI7 A;  5JTI A;  1SXE A;  2LMR A;  3IDW A;  2QB0 B;  1X66 A;  1PK1 A;  1KW4 A;  4PZO A;  1X9X A;  2B6G A;  1UCV A;  4MHV A;  2E8M A;  2YTU A;  3H8M A;  2KE7 A;  1LKY A;  3TAC B;  2ESE A;  3BQ7 A;  2F8K A;  1WWU A;  1Z1V A;  2L5Y A;  5JU5 A;  1B0X A;  1PK3 A;  3K1R B;  2QB0 A;  1B4F A;  1PK1 B;  1SXD A;  2KG5 A;  2E8P A;  2FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...