2E8NA

Solution structure of the c-terminal sam-domain of ephaa2: ephrin type-a receptor 2 precursor (ec 2.7.10.1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
b'GSSGSSGEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDVKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ephrin type-A receptor 2
publication title Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)
rcsb
source organism Homo sapiens
molecule tags Transferase, signaling protein
total genus 19
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8nA00
2KG5A 1B0XA 4PZNA 2EANA 5J8YA 4MHVA 1KW4A 2EAOA 3KKAC 3TACB 2QKQA 4RQNA 2DL0A 2QB0B 2YTUA 2DKZA 2KSOB 2Y9UA 1SXEA 1LKYA 1OW5A 1DXSA 5L1MA 2JV3A 2E8MA 2L5YA 1WWVA 1PK1A 3HILA 2FE9A 1OXJA 2D8CA 1UCVA 1LKYB 4IS7A 2EAPA 3KKAA 4PZOA 1SXDA 1PK1B 2Y9TA 5JU5A 1COKA 2B6GA 1SGGA 5KNIA 2LMRA 2ES6A 1Z1VA 2K4PA 3BS7A 1UQVA 2KIVA 2QB1A 2D3DA 2F44A 2EAMA 1X9XA 3K1RB 2KE7A 1V38A 2LPEA 3H8MA 2E8OA 1SV0C 4NL9C 1X66A 4NJ8A 2F8KA 1RG6A 1SV0A 4NL9A 2KMDA 2ESEA 2QARA 1X40A 1JI7A 2K60A 3BS5A 1WWUA 3BQ7A 1V85A 2E8NA 3IDWA 3SENA 1B4FA 2GLEA 1F0MA 3TADC 5JRTA 2DKXA 4RQMA 2E8PA 2QARB 3TADA 2QB0A 1PK3A 3BS5B 5JTIA 5F3XB 1SV4A 3SEIA 2F3NA 2KSOA 5J8YC
chains in the Genus database with same CATH superfamily
2BQ3A 4DQRA 4P2HA 8ICLA 1K1QA 1SB3C 1T3QA 5KG7A 5T14A 2VANA 2H3VA 3RJGA 3QU7A 1N48A 4OJLA 3SQIA 3WKBA 3QU2A 3RTVA 2BZFA 5KFNA 1LKYA 1SWWA 2PMZC 1O03A 4Z6DA 3ISCA 1S10A 2HBKA 3PX4A 4Q8EA 4CE6A 3MABA 5DBBA 3VCBA 4I2DA 5GTHU 3JPPA 1KEJA 4DSFA 3RJFA 2GH1A 3PO4A 3QEAZ 4NV0A 3KHHA 4FZLA 3N7PD 4O5KA 5ALTA 1XS9D 2FI1A 5L1KA 3AEVA 2BDUA 1L3TA 4BWMA 5F9LA 8ICOA 5KFYA 1X9WA 2F1HA 1ZQXA 4R8UB 5ALVA 4M6WA 3LVVA 5AKJA 3EWAA 4UB3A 2FPLA 2DPIA 4RQ8A 3FYHA 2DGZA 4PGQA 1SV0A 4B9NA 4OCZA 1X40A 4GFJA 4BJQA 1FFVA 4F4KA 2KVSA 2C22A 4O3QA 5KFAA 5BOMA 3SENA 2AHOB 2DWQA 5KFIA 4QWCA 3BDPA 2GLEA 5KFOA 4XRHA 3WK8A 3C28A 1TK8A 3UM9A 4I28A 8ICTA 9ICSA 2LKYA 2IHMA 3PW5A 9ICAA 5G5HA 2EANA 5KT6A 4Y2QA 3GIMA 4BGDA 2CRXA 2KFNA 3KKAC 4Y2JA 5KFEA 4MEXA 1ZQGA 7ICJA 3NTUA 4UB6U 1ZD2P 5AKYA 5DB7A 3PW4A 2LI6A 4ED2A 4F92B 2W9CB 4DFPA 5KAFU 1HUZA 1QCKA 3D2SA 1CI4A 1ZQKA 1CEZA 4DEZA 5L1JA 2FE9A 4MFFA 1NJXA 4I2AA 2OEHA 3BQ2A 4B9UA 5CB1A 2FLLA 3MFHA 2LM4A 1TAMA 4LVSA 2XO7A 5DB9A 3JPRA 4GXIA 1OUQA 4R8UA 2RP5A 7ICUA 2C28A 4A8EA 3AN1A 2HDOA 5AIAA 4J9SA 1FIQA 3BS7A 4YMNA 9ICBA 1A76A 3TARA 3SD7A 2H3ZA 4PGYA 2WF9A 3QUTA 5ALPA 3C2MA 1ZQZA 2FMPA 2KE7A 3N28A 5TZVA 5KFLA 1TK0A 4YVZA 3PO5A 5KFXA 5KG4A 4MF8A 1WYGA 3AMZA 4IL6U 5J0QA 2EZXA 5KL1B 7ICMA 5FP0A 3MR3A 2FPMA 4DCCA 1Z4NA 2MRLA 3PSIA 1JI7A 3C2KA 7ICRA 1NNLA 1XC9A 1ZOLA 3PSFA 1A77A 2CPRA 5AM4A 4F71A 5HP4A 2DKXA 1N63A 1X6JA 4QZFA 8ICUA 4DFJA 1V97A 3TADA 5J2JA 4DL3A 5J0OA 2G08A 4JV0A 4M9JA 4KLMA 2C2DA 2Y0SC 2F3NA 3R9KA 2UVWA 1ZQBA 4M9LA 2W9CA 2NYVA 1TKDA 2ZIXA 1Z00B 2EAOA 3TACB 3KHRA 1A6SA 4RQNA 4DL4A 1NKEA 2ZIVB 3PSPA 4F2SA 4DOBA 3QU4A 2JR5A 4M04A 5J0WA 2HHQA 5EWFA 3BJYA 1L8OA 1ZETA 1ZQCA 1SL2A 2CN1A 8ICPA 7ICOA 2KHQA 2BCRA 4J9NA 4TUPA 2G0AA 3TKAA 3SYZA 5L1LA 1ZQFA 4F5QA 1IXRA 4GXJA 3UMGA 1SXDA 4I2HA 4NLZA 5ALUA 2R8GA 1ZQAA 5AM0A 1COKA 4J9OA 3UMCA 4R64A 2V4RA 2H3FA 2ES6A 3SZ2A 4NLCA 4ECVA 2D3DA 4TQSA 3H0MB 2PI5A 1X9XA 8ICYA 2KVCA 1Q8KA 2GWSA 4UB1A 2E8OA 1SV0C 4KLOA 3E2EA 2M9NA 1RG6A 2KMDA 1Q3VA 4YQWA 1U49A 2KKPA 4RPZA 4IRKA 1BVSA 1NJYA 1JX4A 4MFAA 4QIWC 3V7LA 2JZBB 3HKZC 1VLBA 2XICA 5KFWA 1F0MA 1Z00A 1Z1BA 4M47A 2DQNB 1KQQA 3DDHA 4F5RA 2E8PA 4O0IA 2AQ0A 4LZGA 2WB1F 5KFDA 1F44A 1VJ5A 4KLSA 4O5CA 2VKQA 1JXEA 4I2GA 1KW4A 3T5LA 4EX6A 2ZJAA 2Y1JA 3C21A 4J9RA 9ICUA 3D6JA 3PX0A 4M2YA 9ICFA 2ZIWB 3ZDBA 2IMWP 1M6YA 4DLEA 3RRHA 1XSLA 4JK1A 3QZ8A 3ISBA 1MQ3A 1SKRA 5ALXA 3TI0A 4XUSA 5D46A 2FDRA 5EOZA 3M8RA 2L5YA 4DSJA 5DGBA 4ELUA 4JWNA 4PZOA 8ICMA 1ZD3A 2PMZF 2LBOA 7ICHA 5HMMA 4ECTA 2KTQA 2YMPA 1COOA 5KFMA 5AM5A 4C8KA 1BPZA 2LYHA 5AI9A 4GXKA 1ED1A 1HJPA 4NXZA 4KMUA 2W8KA 4PL2A 2EAMA 1KN5A 2G06A 5KFTA 3RR8A 3NRWA 5AK5A 1DK3A 4Y2RA 5GTIU 4J9PA 3U26A 1UPHA 2JZBA 4C8MA 3H8MA 4EZ9A 3T3FA 5J0SA 2YMMA 1IIPA 4CF3A 3KFUF 1MQ2A 2YMLA 4CF5A 4PHDA 3V6HA 3OSPA 3HWTA 1QQ6A 2C2EA 3G6YA 1F5SA 3HW8A 2E8NA 3QNMA 2G07A 2DUYA 4J9LA 2DBYA 2NO5A 3TADC 4YR3A 2HCFA 1S8OA 4RQMA 4ED6A 1D8LA 4QZCA 5F3XB 1KKXA 2UVUA 2ZIWA 4QW9A 5KT7A 4Y2VA 4Q44A 7ICEA 2KV2A 2F2AB 1QQ5A 2KN7A 2A3VA 3AUOA 1NK8A 2I1QA 2R8KA 9ICRA 3DV9A 2A1JB 1JN3A 1XO0A 4F4XA 4ECQA 3IV6A 4M9NA 4QZ8A 4RPXA 4ED0A 2A1AA 1TVAA 1IG6A 4FZNA 4RQ2A 2HOIA 5ALIA 4UW9A 1WWVA 4IC9A 1EXNA 1MC8A 1U9LA 1AROP 5CRXA 3PW2A 3ONNA 4OJ6A 5ALEA 3TANA 3KKAA 1DK2A 5AKXA 3RB6A 5KFUA 1ZQPA 4US8A 2WF5A 2E3TA 4B9VA 2B6GA 2JHDA 4RQ6A 4RUAA 3PVXA 2W9BB 5J2GA 1O08A 3MC1A 5AK3A 2W54A 1KFSA 4YP3A 2W11A 3Q8KA 2WAQC 1T94A 4RQ0A 4XA5A 1V9PA 4NM2A 1V38A 5J0UA 4KLEA 3JPSA 2ASDA 2FMSA 1UA1A 2HHTA 4DFKA 2RRDA 4LJXA 4DL5A 4DSIA 4O3RA 4KX3A 1H38A 1N56A 2HHUA 3G6VA 4DL2A 4QZAA 4FS2A 4ED1A 4TUQA 5J2HA 4QZBA 5JRTA 4ZOHC 4K4GA 3M6ZA 4EBDA 1FO4A 4LZDA 1MSWD 5HHHA 1LB2B 2A1JA 2EH9A 4PZNA 2VJ4A 5KFKA 4CRXA 5J8YA 2MU2A 1T3NA 4F5NA 4NLBA 4Z6EA 3AM9A 3WU2U 9ICJA 2AJQA 5DDMA 2Y0SF 4GC6A 3RB0A 1JUDA 5HHIA 4JB3A 3V6JA 4QZGA 4IQWA 2ZXIA 3M1YA 5KT3A 4EBEA 7ICLA 5AIBA 3WK5A 2AGQA 2RHFA 4JWMA 5J2CA 4Y2PA 2W9BA 2HOFA 3WKDA 5KFCA 4DQPA 5AKGA 3WK4A 1SWVA 2W04A 3UQ0A 1T8EA 1NK4A 3H8WA 4Y2XA 2N1RA 5CJ7A 3M7DA 4PPXA 3Q8SB 3FDSA 2H3QA 3J81j 3UMBA 5KFGA 3F2DA 1UQVA 5KFHA 2F76X 5KG2A 4Q8FA 2GO7A 4G9BA 4I2BA 3AU6A 5HNKA 4MEYA 1ZQVA 4CNQA 3GILA 3OSNA 3TAPA 2W7OA 5DLFA 5KFQA 1QLNA 5HMLA 3LYSA 4EEYA 3GIJA 4M9GA 3UXNA 1ZQWA 2W8LA 2AXTU 4TQRA 3H0LB 3JPTA 4B9SA 4FZMA 8ICIA 5J0PA 2IA6A 7ICQA 4BDPA 3M8SA 5ALDA 1Q3UA 5B66U 1RYSA 4QNLA 1L7MA 1PK3A 3LWLA 2KZZA 2A19A 3DEEA 4C80A 4QIWF 3KHLA 3SAHA 3BQ0A 2OXOA 3HKZF 2K8CB 3PR4A 3OJSA 2EDUA 3KTQA 1BNPA 4O3NA 7ICKA 3ETRA 4DOCA 3K1ZA 3BZCA 1ZQRA 3PX6A 9ICMA 3KZIU 5KG3A 4E0DA 3IG5A 5L1IA 4NLNA 2E8MA 2OM6A 2VA2A 2KOBA 5J0RA 4QWDA 3QXGA 9ICGA 4ICAA 3HT3A 1OXJA 1UCVA 2W03A 4F5OA 2NRTA 5CP2A 4C0ZA 2FPKA 5J2KA 3Q8RB 8ICBA 2OWOA 2KHVA 4EYHB 2ZIXB 3SR6A 4BWJA 1HUOA 3N4MB 3KD3A 4JMUA 5KNIA 2W9MA 2LMRA 1XO1A 1XSPA 4AP9A 5ALKA 1L6NA 4GC7A 4IR1A 3JPNA 4J03A 1TK5A 2WHEA 2ISPA 1YZ7A 4DSKA 1BPYA 3A0HU 3AU2A 3ED5A 5EE1A 3GQCA 3Q8PB 5J2EA 3ZDAA 4IQUA 4KLHA 4J9QA 2ESEA 2DF4B 4I2CA 3OJUA 4B9LA 4M0AA 1ZQUA 2IOHA 3NRZA 1ZRNA 1DRGA 1ZD5A 3C23A 2OHFA 3C5FA 1GO3F 2IOFA 5DB6A 3QZ7A 2ATLA 5IIMA 5D49A 1U45A 8ICFA 5J8YC 4DO9A 5DDYA 3SI8A 1ZQJA 5KT2A 1SZPA 9ICKA 1NJZA 2AGOA 3PW0A 1BNOA 2I5HA 2XVTA 4HAIA 2DPJA 1OW5A 2Y1IA 3B0XA 4C7YA 5ALWA 1KTQA 9ICQA 2ZIUB 4K4HA 4IS7A 2ZTCA 3Q8QB 1Z19A 5AHXA 3HPOA 5BPCA 2RQ5A 2KJ5A 1PVRA 2JEGA 4Y2UA 2OH2A 3PY8A 9ICPA 4KLGA 2PKEA 2BGWA 4KN4A 5IILA 7ICGA 2FJ6A 3JPOA 4QWEA 4IRDA 3BQ1A 3RR7A 3NUQA 4OJ5A 3M9NB 4EENA 4U6PA 4O3OA 9ICIA 4NJ8A 3THVA 8ICXA 4RQ7A 1QTMA 3NVWA 5KL8B 2NRXA 1BGXT 4C4TA 1WG8A 4ECWA 2MA1A 5AM1A 4FBUA 3EPGA 8ICCA 2WAQF 4P0PB 2IOFK 1UT5A 3LK9A 4O3SA 4BX9C 4CDGA 1ZQNA 4ECUA 8ICAA 4PHPA 5J0YA 2P35A 1CUKA 4OO1J 2HVHA 5DQGA 1SV4A 4QZ9A 3BZKA 8ICQA 3ICXA 4RQ1A 2GOLA 3NS1A 9ICVA 2MUTB 4EEKA 4R66A 2ZIUA 1D9FA 2BCQA 3WKAA 4RU9A 3G6XA 2F77X 3T5HA 2V9WA 1K1SA 4Y2TA 3HILA 5KFVA 3D2NA 1S5LU 2JRZA 5CA7A 3LVWA 1TAUA 1D8YA 3IRUA 4FE3A 3I76A 3PSTA 3MGHA 5KT5A 4UAVA 5ALGA 4UQGA 1PVQA 1RZTA 1UHUA 5KG0A 2K89A 5J0TA 3CP8A 1JXLA 4YD1A 3KOOA 1K5OA 4DF4A 2J6TA 1KFTA 2CXYA 2K8AA 4P0PA 4F4ZA 3GDXA 4NY8A 9ICNA 3OHAA 3B0YA 1U4BA 3CRXA 4BUGA 4R63A 3MR6A 3ZDCA 7ICNA 4KLQA 5KFBA 3TAQA 2F8KA 4NL9A 5ALFA 4QZEA 4KMOB 1ZD4A 2K60A 2JGAA 2KKVA 4TURA 3ZDDA 1B4FA 2WFAA 3T5KA 4UAYA 4K4IA 4GLXA 3C1YA 2HBLA 3NGDA 4ED8A 2BDPA 5EWGA 1BPEA 4NWIA 3PNCA 2NV3A 2KFZA 4IR9A 5F9NA 2MUTA 2HSZA 2ZJ8A 3I1YA 5KG1A 4B9MA 2MAXA 4Z6CA 2B21A 2BPFA 1ECWA 3QE9Y 1KRPA 2BHNA 1CRXA 4F4WA 1L3SA 1ZYQA 5AICA 2FLPA 4DSEA 3PV8A 7ICVA 4DQIA 2DKZA 3Q8MA 2K4IA 2XC9A 2JH1A 4RNNA 5AM3A 3UXOA 3EZ5A 1ZQEA 1DXSA 3QX7A 3ALRA 1RQLA 5DKWA 1J2MA 4ACOA 1L7OA 2OYYA 5ALOA 3H0RB 5DB8A 2AH5A 1U48A 3NVZA 5ALMA 4IRCA 4BXOB 3ZD8A 2RDJA 2YQEA 1RM6C 2G09A 2KJ8A 3ORYA 1ZQHA 2AQ4A 3LDAA 4HYKA 3MBYA 5KG5A 1SZHA 2K4EA 1KFDA 2I9GA 1RYRA 3F2BA 4US9A 1SL1A 2F44A 3PMLA 4QZHA 1L3UA 3UPQA 3HRDD 3K1RB 1FEZA 3K75D 3QUQA 2C2RA 2R18A 2NO4A 5EE9A 3KHGA 1N60A 3FM9A 8ICNA 4KLFA 3BQ7A 2XY5A 5DLGA 5TISU 3RFAA 3HX0A 2BCSA 1S9FA 4C4RA 4FO6A 1JROA 5CR0A 4QWAA 2QARB 4ELVA 3BS5B 2IHNA 4UAUA 1P7DA 3N97B 1D8BA 5KFJA 4M9HA 1JIHA 4P4PA 2ALZA 4C8OA 4TUSA 1RDFA 2JXJA 5AK4A 4I2JA 3RB3A 3QEBZ 2EZZA 2WF6A 3LWMA 5AK6A 2Y9UA 4PJ0U 1SIJA 2Q0ZX 3GV8B 4YXJA 2ZG6A 1B43A 5L1MA 4OD0A 3MFIA 2ASJA 4BXOA 1SL0A 5KFRA 2D8CA 2BCUA 1XSNA 4CCHA 3L3FX 1NKCA 4CGZA 7ICTA 9ICWA 5IIJA 2Y9TA 4GIBA 1TAQA 5JU5A 1KSPA 3RAQA 3A0BU 2D6FC 2XCAA 5G5GA 4PHAA 4P4OA 2XY6A 9ICCA 3AQFA 5K4LA 4EELA 3H7IA 5AKEA 4ELTA 5ALJA 4DOAA 3F5AA 5J2DA 5BOLA 2BPCA 2HHVA 2EZYA 1ZQDA 2FMQA 3C5GA 4F8RA 1C20A 3ZD9A 4NL9C 5DBCA 1NKBA 3I28A 5DBAA 5CHGA 3RBDA 3Q8LA 2QARA 4OJOA 4RT3A 3BS5A 1WWUA 2HBJA 3UQ2A 2JEIA 3H40A 4JV1A 3B9JA 5KG6A 3H8SA 4Y2SA 3RJJA 3L4PA 3QUCA 4PL1A 5L9XA 1PZNA 3RH4A 4G3IA 1UA0A 3SEIA 3JPQA 2BR0A 1ZQSA 2VJ5A 2HOQA 5EE3A 1BPXA 3MR5A 1NOMA 2W3RA 4DQQA 1N61A 2QKQA 1ZQTA 3BQTA 4QJFB 4P0QA 1ZRMA 3F5EA 3EYZA 5AI8A 1B22A 1ZQYA 4ED7A 4UARA 2ZXHA 1D9DA 3C1ZA 3NVYA 3PR5B 1QSSA 4Y2YA 3M6KA 3HJEA 2JV3A 8ICRA 4C4SA 4EZ6A 1KL9A 3AQEA 2W3SA 5AKIA 4DWIA 1SKSA 3E58A 4ECXA 4Q45A 2VIXA 1T7PA 8ICKA 4DSLA 4B9TA 3RJHA 2DFLA 2KZ3A 3N7RC 4YFKA 5AKKA 3RJKA 3GV7B 5EWEA 4ECZA 1J97A 4J9KA 1A0PA 3UXPA 2QB1A 5AI5A 5DG8A 3RB4A 2VA8A 4C8LA 1BPBA 2P6RA 2QLTA 4ECSA 8ICVA 1L8LA 3NVVA 2PFNA 2R8IA 5ALNA 4DS4A 3EW9A 4IQTA 2HHSA 3H4BA 1NK9A 1Z4OA 2YB1A 2J6UA 1QQ7A 4UATA 4FBTA 4KLDA 4YMOA 2LYAA 3EUB2 4WJ3B 1JRPA 5ALYA 5KFPA 1NI3A 3PW7A 1KLNA 5IIKA 3WKEA 5J2IA 5ALQA 4O3PA 5JTIA 4I2EA 4F72A 4KN7A 1KBUA 5IIOA 2WF7A 2YX8A 2G5HB 1WCLA 4MHVA 5AKHA 2W43A 4Q43A 2O6KA 2VA3A 4I2IA 1TE2A 4PHEA 3GIIA 5DG7A 5AKZA 1XWLA 2DL0A 4UAZA 9ICLA 2KSOB 3QU5A 5EE0A 7ICSA 3H4DA 1S77D 2IBKA 2ISOA 3RH5A 5ALHA 1Q46A 4YXMA 4RQ4A 2WTFA 1IV8A 1S76D 4UB2A 3IHQB 3IM1A 1XU4A 2EAPA 2XIDA 4ECRA 1N5XA 5D4BA 9ICEA 2KIWA 5ALZA 5KFSA 1NZPA 1MA7A 2KK0A 4DFMA 1SGGA 2RDIA 2ZJ5A 3PZPA 2WF8A 3F2CA 1RPLA 4NLGA 1NJWA 4YG2A 2K4HA 4C7ZA 4I2FA 3MDCA 3T79A 1S0MA 2E1FA 3SAGA 4AYBC 4DS5A 3WK7A 1AQ6A 1WCNA 1NK0A 2KZMA 1ZQ1C 2MSNA 1U47A 2HHWA 2K8BB 4PH5A 3TFSA 1S0NA 5KTQA 2NRZA 1ZQMA 3M9OB 4FS1A 4YCXA 1HEKA 4F2RA 1J2NA 2HBMA 5J2AA 2PI4A 3E0FA 1NK6A 4DFDA 1NZBA 2HI0A 1QSYA 4DF8A 4NLKA 2BCVA 2XGQA 3RJEA 1URJA 4DL7A 4JUZA 2HVIA 3O0FA 4NM1A 2KSOA 5IIIA 4YD2A 4UB8U 1Z3EB 2KG5A 3NASA 1B0XA 4EX7A 4F91B 3M9MB 1BPDA 5CWRA 4RNOA 3MGVA 1ZQLA 3RRGA 1DGSA 3KBBA 2XGPA 2PFPA 5AI0A 2LYBA 3GU3A 4YR2A 4DQSA 3RAXA 3ISDA 4KLIA 1YZ6A 1HIWA 3MGIA 3D2QA 4I27A 3QYPA 1PK1B 1L7PA 4MF2A 5C0YA 3QU9A 2BQUA 3TFRA 8ICSA 4F93B 4KITB 2KIVA 1LVHA 3GV5B 1L3VA 2B0CA 2I6XA 4PGXA 3IP4B 2F1IA 3WK6A 4YR0A 1X6IA 2OCEA 2R8HA 2P6UA 3TQ1A 1ZQQA 3AL0B 2ZIVA 2XCPA 1LV5A 4J9MA 5HR6A 4KX5A 5KFZA 9ICOA 2AU0A 3V72A 1V85A 1IM4A 2Q4TA 1X9SA 7ICIA 2UVVA 1WUDA 5KFFA 1S0VA 4UASA 3SV4A 4YMMA 4O5EA 2KD1A 2E1EA 2NRVA 1RYUA 2YB4A 5E79U 4CF4A 1ZXIA 1YT3A 2YN4A 2JMGA 1JALA 2QB0B 2YTUA 3MR2A 4XQ8A 1KDHA 4YN4A 3FAHA 2V4QA 3V6KA 3OPXA 8ICGA 1TFRA 4UB5A 1NK7A 1DOQA 3FC4A 2XI9A 4UBBA 2KP7A 4ED3A 1PK1A 5JUMA 2Z7JA 2JEFA 2W9AA 2M0NA 4RQ3A 5DQHA 3ZI4A 3IG8A 4KLUA 1N5WA 2JH7A 2PFQA 4X5VA 4F50A 2RLTA 5ALRA 2KEYA 2E5SA 4OJPA 2R8JA 1NK5A 8ICEA 4P4MA 4Z6FA 7ICFA 5DG9A 1PUZA 4C8NA 4F4YA 1Z1VA 3OTQA 5A0LA 3T5JA 1VDVA 5CEHA 8ICZA 4IQVA 1Y88A 1L5UA 1T4GA 8ICHA 4KLLA 3SV3A 1S0OA 1RXVA 4FFDA 2ZTEA 4DL6A 3SAFA 2LPEA 1X2IA 3SMVA 2W7PA 5AKLA 4MFCA 1X66A 2H5XA 2PXIA 4F3OA 5J0XA 3RBEA 3C29A 2F1JA 3RJIA 1RQNA 4UB4A 3IN5A 7ICPA 1N2XA 3ZDEA 1JMSA 3IDWA 5J2BA 2UVRA 5IINA 1SKWA 3QUBA 4EBCA 1C7YA 3N7SC 4QWBA 1L7NA 1X9MA 1S97A 4UBCA 4O9MA 4KLTA 2BQRA 2PFOA 4USAA 4B6JA 5AM2A 2QB0A 3V7JA 2BKEA 5AI4A 1RXWA 3S6JA 5J29A 4F5PA 4KTQA 4RUCA 5J2FA 5ALSA 4RNMA 3WKCA 2XY7A 1SXEA 2AGPA 9ICTA 1XNSA 8ICWA 2ZUDA 2BPGA 2J6SA 4JV2A 4RT2A 4QZDA 3OHBA 4RQ5A 2HW3A 8ICJA 3F53A 2FLNA 2ZUBA 2KJ9A 1DGJA 5DQIA 3VC8A 1LKYB 3RF9A 3HP6A 3RH6A 2ODGA 3C2LA 1UT8A 2NRWA 1PVPA 2YY6A 4ECYA 5B5EU 3L5KA 3MDAA 9ICHA 1X42A 3GIKA 5DGAA 4KLJA 1FFUA 2K4PA 5KT4A 4P0QB 2LHTA 5ALLA 2LM1A 4ZH4A 3H8JA 4QZIA 3KZXA 2W55A 3GZFA 1MN8A 2ASLA 2EQYA 3V7KA 5KAIU 2ZTDA 3ETLA 2G5IB 1ZJNA 3CW2C 1QSLA 2YMQA 3K4GA 5AI6A 4DLGA 3OGUA 4UAWA 2ZUCA 2KNJA 3GFKB 5HR7A 2F8LA 5C5JA 4RZRA 3PMNA 1ZQOA 1QH9A 3CYMA 2WB1C 4AYBF 2H3IA 4I29A 4M6WB 1N62A 2HMXA 4EYIB 1ZJMA 4R65A 4O3MA 2P66A 3CNHA 2HHXA 9ICXA 3EPIA 4RPYA 5H2FU 2JEJA 4U7CA 1TV9A 4QW8A 3WK9A 1ZQIA 2KICA
chains in the Genus database with same CATH topology
2KG5A 1B0XA 4PZNA 2EANA 5J8YA 4MHVA 1KW4A 2EAOA 3KKAC 3TACB 2QKQA 4RQNA 2DL0A 2QB0B 2YTUA 2DKZA 2KSOB 2Y9UA 1SXEA 1LKYA 1OW5A 1DXSA 5L1MA 2JV3A 2E8MA 2L5YA 1WWVA 1PK1A 3HILA 2FE9A 1OXJA 2D8CA 1UCVA 1LKYB 4IS7A 2EAPA 3KKAA 4PZOA 1SXDA 1PK1B 2Y9TA 5JU5A 1COKA 2B6GA 1SGGA 5KNIA 2LMRA 2ES6A 1Z1VA 2K4PA 3BS7A 1UQVA 2KIVA 2QB1A 2D3DA 2F44A 2EAMA 1X9XA 3K1RB 2KE7A 1V38A 2LPEA 3H8MA 2E8OA 1SV0C 4NL9C 1X66A 4NJ8A 2F8KA 1RG6A 1SV0A 4NL9A 2KMDA 2ESEA 2QARA 1X40A 1JI7A 2K60A 3BS5A 1WWUA 3BQ7A 1V85A 2E8NA 3IDWA 3SENA 1B4FA 2GLEA 1F0MA 3TADC 5JRTA 2DKXA 4RQMA 2E8PA 2QARB 3TADA 2QB0A 1PK3A 3BS5B 5JTIA 5F3XB 1SV4A 3SEIA 2F3NA 2KSOA 5J8YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG5 A;  1B0X A;  4PZN A;  2EAN A;  5J8Y A;  4MHV A;  1KW4 A;  2EAO A;  3KKA C;  3TAC B;  2QKQ A;  4RQN A;  2DL0 A;  2QB0 B;  2YTU A;  2DKZ A;  2KSO B;  2Y9U A;  1SXE A;  1LKY A;  1OW5 A;  1DXS A;  5L1M A;  2JV3 A;  2E8M A;  2L5Y A;  1WWV A;  1PK1 A;  3HIL A;  2FE9 A;  1OXJ A;  2D8C A;  1UCV A;  1LKY B;  4IS7 A;  2EAP A;  3KKA A;  4PZO A;  1SXD A;  1PK1 B;  2Y9T A;  5JU5 A;  1COK A;  2B6G A;  1SGG A;  5KNI A;  2LMR A;  2ES6 A;  1Z1V A;  2K4P A;  3BS7 A;  1UQV A;  2KIV A;  2QB1 A;  2D3D A;  2F44 A;  2EAM A;  1X9X A;  3K1R B;  2KE7 A;  1V38 A;  2LPE A;  3H8M A;  2E8O A;  1SV0 C;  4NL9 C;  1X66 A;  4NJ8 A;  2F8K A;  1RG6 A;  1SV0 A;  4NL9 A;  2KMD A;  2ESE A;  2QAR A;  1X40 A;  1JI7 A;  2K60 A;  3BS5 A;  1WWU A;  3BQ7 A;  1V85 A;  2E8N A;  3IDW A;  3SEN A;  1B4F A;  2GLE A;  1F0M A;  3TAD C;  5JRT A;  2DKX A;  4RQM A;  2E8P A;  2QAR B;  3TAD A;  2QB0 A;  1PK3 A;  3BS5 B;  5JTI A;  5F3X B;  1SV4 A;  3SEI A;  2F3N A;  2KSO A;  5J8Y C; 
#chains in the Genus database with same CATH topology
 2BQ3 A;  4DQR A;  4P2H A;  8ICL A;  1K1Q A;  1SB3 C;  1T3Q A;  5KG7 A;  5T14 A;  2VAN A;  2H3V A;  3RJG A;  3QU7 A;  1N48 A;  4OJL A;  3SQI A;  3WKB A;  3QU2 A;  3RTV A;  2BZF A;  5KFN A;  1LKY A;  1SWW A;  2PMZ C;  1O03 A;  4Z6D A;  3ISC A;  1S10 A;  2HBK A;  3PX4 A;  4Q8E A;  4CE6 A;  3MAB A;  5DBB A;  3VCB A;  4I2D A;  5GTH U;  3JPP A;  1KEJ A;  4DSF A;  3RJF A;  2GH1 A;  3PO4 A;  3QEA Z;  4NV0 A;  3KHH A;  4FZL A;  3N7P D;  4O5K A;  5ALT A;  1XS9 D;  2FI1 A;  5L1K A;  3AEV A;  2BDU A;  1L3T A;  4BWM A;  5F9L A;  8ICO A;  5KFY A;  1X9W A;  2F1H A;  1ZQX A;  4R8U B;  5ALV A;  4M6W A;  3LVV A;  5AKJ A;  3EWA A;  4UB3 A;  2FPL A;  2DPI A;  4RQ8 A;  3FYH A;  2DGZ A;  4PGQ A;  1SV0 A;  4B9N A;  4OCZ A;  1X40 A;  4GFJ A;  4BJQ A;  1FFV A;  4F4K A;  2KVS A;  2C22 A;  4O3Q A;  5KFA A;  5BOM A;  3SEN A;  2AHO B;  2DWQ A;  5KFI A;  4QWC A;  3BDP A;  2GLE A;  5KFO A;  4XRH A;  3WK8 A;  3C28 A;  1TK8 A;  3UM9 A;  4I28 A;  8ICT A;  9ICS A;  2LKY A;  2IHM A;  3PW5 A;  9ICA A;  5G5H A;  2EAN A;  5KT6 A;  4Y2Q A;  3GIM A;  4BGD A;  2CRX A;  2KFN A;  3KKA C;  4Y2J A;  5KFE A;  4MEX A;  1ZQG A;  7ICJ A;  3NTU A;  4UB6 U;  1ZD2 P;  5AKY A;  5DB7 A;  3PW4 A;  2LI6 A;  4ED2 A;  4F92 B;  2W9C B;  4DFP A;  5KAF U;  1HUZ A;  1QCK A;  3D2S A;  1CI4 A;  1ZQK A;  1CEZ A;  4DEZ A;  5L1J A;  2FE9 A;  4MFF A;  1NJX A;  4I2A A;  2OEH A;  3BQ2 A;  4B9U A;  5CB1 A;  2FLL A;  3MFH A;  2LM4 A;  1TAM A;  4LVS A;  2XO7 A;  5DB9 A;  3JPR A;  4GXI A;  1OUQ A;  4R8U A;  2RP5 A;  7ICU A;  2C28 A;  4A8E A;  3AN1 A;  2HDO A;  5AIA A;  4J9S A;  1FIQ A;  3BS7 A;  4YMN A;  9ICB A;  1A76 A;  3TAR A;  3SD7 A;  2H3Z A;  4PGY A;  2WF9 A;  3QUT A;  5ALP A;  3C2M A;  1ZQZ A;  2FMP A;  2KE7 A;  3N28 A;  5TZV A;  5KFL A;  1TK0 A;  4YVZ A;  3PO5 A;  5KFX A;  5KG4 A;  4MF8 A;  1WYG A;  3AMZ A;  4IL6 U;  5J0Q A;  2EZX A;  5KL1 B;  7ICM A;  5FP0 A;  3MR3 A;  2FPM A;  4DCC A;  1Z4N A;  2MRL A;  3PSI A;  1JI7 A;  3C2K A;  7ICR A;  1NNL A;  1XC9 A;  1ZOL A;  3PSF A;  1A77 A;  2CPR A;  5AM4 A;  4F71 A;  5HP4 A;  2DKX A;  1N63 A;  1X6J A;  4QZF A;  8ICU A;  4DFJ A;  1V97 A;  3TAD A;  5J2J A;  4DL3 A;  5J0O A;  2G08 A;  4JV0 A;  4M9J A;  4KLM A;  2C2D A;  2Y0S C;  2F3N A;  3R9K A;  2UVW A;  1ZQB A;  4M9L A;  2W9C A;  2NYV A;  1TKD A;  2ZIX A;  1Z00 B;  2EAO A;  3TAC B;  3KHR A;  1A6S A;  4RQN A;  4DL4 A;  1NKE A;  2ZIV B;  3PSP A;  4F2S A;  4DOB A;  3QU4 A;  2JR5 A;  4M04 A;  5J0W A;  2HHQ A;  5EWF A;  3BJY A;  1L8O A;  1ZET A;  1ZQC A;  1SL2 A;  2CN1 A;  8ICP A;  7ICO A;  2KHQ A;  2BCR A;  4J9N A;  4TUP A;  2G0A A;  3TKA A;  3SYZ A;  5L1L A;  1ZQF A;  4F5Q A;  1IXR A;  4GXJ A;  3UMG A;  1SXD A;  4I2H A;  4NLZ A;  5ALU A;  2R8G A;  1ZQA A;  5AM0 A;  1COK A;  4J9O A;  3UMC A;  4R64 A;  2V4R A;  2H3F A;  2ES6 A;  3SZ2 A;  4NLC A;  4ECV A;  2D3D A;  4TQS A;  3H0M B;  2PI5 A;  1X9X A;  8ICY A;  2KVC A;  1Q8K A;  2GWS A;  4UB1 A;  2E8O A;  1SV0 C;  4KLO A;  3E2E A;  2M9N A;  1RG6 A;  2KMD A;  1Q3V A;  4YQW A;  1U49 A;  2KKP A;  4RPZ A;  4IRK A;  1BVS A;  1NJY A;  1JX4 A;  4MFA A;  4QIW C;  3V7L A;  2JZB B;  3HKZ C;  1VLB A;  2XIC A;  5KFW A;  1F0M A;  1Z00 A;  1Z1B A;  4M47 A;  2DQN B;  1KQQ A;  3DDH A;  4F5R A;  2E8P A;  4O0I A;  2AQ0 A;  4LZG A;  2WB1 F;  5KFD A;  1F44 A;  1VJ5 A;  4KLS A;  4O5C A;  2VKQ A;  1JXE A;  4I2G A;  1KW4 A;  3T5L A;  4EX6 A;  2ZJA A;  2Y1J A;  3C21 A;  4J9R A;  9ICU A;  3D6J A;  3PX0 A;  4M2Y A;  9ICF A;  2ZIW B;  3ZDB A;  2IMW P;  1M6Y A;  4DLE A;  3RRH A;  1XSL A;  4JK1 A;  3QZ8 A;  3ISB A;  1MQ3 A;  1SKR A;  5ALX A;  3TI0 A;  4XUS A;  5D46 A;  2FDR A;  5EOZ A;  3M8R A;  2L5Y A;  4DSJ A;  5DGB A;  4ELU A;  4JWN A;  4PZO A;  8ICM A;  1ZD3 A;  2PMZ F;  2LBO A;  7ICH A;  5HMM A;  4ECT A;  2KTQ A;  2YMP A;  1COO A;  5KFM A;  5AM5 A;  4C8K A;  1BPZ A;  2LYH A;  5AI9 A;  4GXK A;  1ED1 A;  1HJP A;  4NXZ A;  4KMU A;  2W8K A;  4PL2 A;  2EAM A;  1KN5 A;  2G06 A;  5KFT A;  3RR8 A;  3NRW A;  5AK5 A;  1DK3 A;  4Y2R A;  5GTI U;  4J9P A;  3U26 A;  1UPH A;  2JZB A;  4C8M A;  3H8M A;  4EZ9 A;  3T3F A;  5J0S A;  2YMM A;  1IIP A;  4CF3 A;  3KFU F;  1MQ2 A;  2YML A;  4CF5 A;  4PHD A;  3V6H A;  3OSP A;  3HWT A;  1QQ6 A;  2C2E A;  3G6Y A;  1F5S A;  3HW8 A;  2E8N A;  3QNM A;  2G07 A;  2DUY A;  4J9L A;  2DBY A;  2NO5 A;  3TAD C;  4YR3 A;  2HCF A;  1S8O A;  4RQM A;  4ED6 A;  1D8L A;  4QZC A;  5F3X B;  1KKX A;  2UVU A;  2ZIW A;  4QW9 A;  5KT7 A;  4Y2V A;  4Q44 A;  7ICE A;  2KV2 A;  2F2A B;  1QQ5 A;  2KN7 A;  2A3V A;  3AUO A;  1NK8 A;  2I1Q A;  2R8K A;  9ICR A;  3DV9 A;  2A1J B;  1JN3 A;  1XO0 A;  4F4X A;  4ECQ A;  3IV6 A;  4M9N A;  4QZ8 A;  4RPX A;  4ED0 A;  2A1A A;  1TVA A;  1IG6 A;  4FZN A;  4RQ2 A;  2HOI A;  5ALI A;  4UW9 A;  1WWV A;  4IC9 A;  1EXN A;  1MC8 A;  1U9L A;  1ARO P;  5CRX A;  3PW2 A;  3ONN A;  4OJ6 A;  5ALE A;  3TAN A;  3KKA A;  1DK2 A;  5AKX A;  3RB6 A;  5KFU A;  1ZQP A;  4US8 A;  2WF5 A;  2E3T A;  4B9V A;  2B6G A;  2JHD A;  4RQ6 A;  4RUA A;  3PVX A;  2W9B B;  5J2G A;  1O08 A;  3MC1 A;  5AK3 A;  2W54 A;  1KFS A;  4YP3 A;  2W11 A;  3Q8K A;  2WAQ C;  1T94 A;  4RQ0 A;  4XA5 A;  1V9P A;  4NM2 A;  1V38 A;  5J0U A;  4KLE A;  3JPS A;  2ASD A;  2FMS A;  1UA1 A;  2HHT A;  4DFK A;  2RRD A;  4LJX A;  4DL5 A;  4DSI A;  4O3R A;  4KX3 A;  1H38 A;  1N56 A;  2HHU A;  3G6V A;  4DL2 A;  4QZA A;  4FS2 A;  4ED1 A;  4TUQ A;  5J2H A;  4QZB A;  5JRT A;  4ZOH C;  4K4G A;  3M6Z A;  4EBD A;  1FO4 A;  4LZD A;  1MSW D;  5HHH A;  1LB2 B;  2A1J A;  2EH9 A;  4PZN A;  2VJ4 A;  5KFK A;  4CRX A;  5J8Y A;  2MU2 A;  1T3N A;  4F5N A;  4NLB A;  4Z6E A;  3AM9 A;  3WU2 U;  9ICJ A;  2AJQ A;  5DDM A;  2Y0S F;  4GC6 A;  3RB0 A;  1JUD A;  5HHI A;  4JB3 A;  3V6J A;  4QZG A;  4IQW A;  2ZXI A;  3M1Y A;  5KT3 A;  4EBE A;  7ICL A;  5AIB A;  3WK5 A;  2AGQ A;  2RHF A;  4JWM A;  5J2C A;  4Y2P A;  2W9B A;  2HOF A;  3WKD A;  5KFC A;  4DQP A;  5AKG A;  3WK4 A;  1SWV A;  2W04 A;  3UQ0 A;  1T8E A;  1NK4 A;  3H8W A;  4Y2X A;  2N1R A;  5CJ7 A;  3M7D A;  4PPX A;  3Q8S B;  3FDS A;  2H3Q A;  3J81 j;  3UMB A;  5KFG A;  3F2D A;  1UQV A;  5KFH A;  2F76 X;  5KG2 A;  4Q8F A;  2GO7 A;  4G9B A;  4I2B A;  3AU6 A;  5HNK A;  4MEY A;  1ZQV A;  4CNQ A;  3GIL A;  3OSN A;  3TAP A;  2W7O A;  5DLF A;  5KFQ A;  1QLN A;  5HML A;  3LYS A;  4EEY A;  3GIJ A;  4M9G A;  3UXN A;  1ZQW A;  2W8L A;  2AXT U;  4TQR A;  3H0L B;  3JPT A;  4B9S A;  4FZM A;  8ICI A;  5J0P A;  2IA6 A;  7ICQ A;  4BDP A;  3M8S A;  5ALD A;  1Q3U A;  5B66 U;  1RYS A;  4QNL A;  1L7M A;  1PK3 A;  3LWL A;  2KZZ A;  2A19 A;  3DEE A;  4C80 A;  4QIW F;  3KHL A;  3SAH A;  3BQ0 A;  2OXO A;  3HKZ F;  2K8C B;  3PR4 A;  3OJS A;  2EDU A;  3KTQ A;  1BNP A;  4O3N A;  7ICK A;  3ETR A;  4DOC A;  3K1Z A;  3BZC A;  1ZQR A;  3PX6 A;  9ICM A;  3KZI U;  5KG3 A;  4E0D A;  3IG5 A;  5L1I A;  4NLN A;  2E8M A;  2OM6 A;  2VA2 A;  2KOB A;  5J0R A;  4QWD A;  3QXG A;  9ICG A;  4ICA A;  3HT3 A;  1OXJ A;  1UCV A;  2W03 A;  4F5O A;  2NRT A;  5CP2 A;  4C0Z A;  2FPK A;  5J2K A;  3Q8R B;  8ICB A;  2OWO A;  2KHV A;  4EYH B;  2ZIX B;  3SR6 A;  4BWJ A;  1HUO A;  3N4M B;  3KD3 A;  4JMU A;  5KNI A;  2W9M A;  2LMR A;  1XO1 A;  1XSP A;  4AP9 A;  5ALK A;  1L6N A;  4GC7 A;  4IR1 A;  3JPN A;  4J03 A;  1TK5 A;  2WHE A;  2ISP A;  1YZ7 A;  4DSK A;  1BPY A;  3A0H U;  3AU2 A;  3ED5 A;  5EE1 A;  3GQC A;  3Q8P B;  5J2E A;  3ZDA A;  4IQU A;  4KLH A;  4J9Q A;  2ESE A;  2DF4 B;  4I2C A;  3OJU A;  4B9L A;  4M0A A;  1ZQU A;  2IOH A;  3NRZ A;  1ZRN A;  1DRG A;  1ZD5 A;  3C23 A;  2OHF A;  3C5F A;  1GO3 F;  2IOF A;  5DB6 A;  3QZ7 A;  2ATL A;  5IIM A;  5D49 A;  1U45 A;  8ICF A;  5J8Y C;  4DO9 A;  5DDY A;  3SI8 A;  1ZQJ A;  5KT2 A;  1SZP A;  9ICK A;  1NJZ A;  2AGO A;  3PW0 A;  1BNO A;  2I5H A;  2XVT A;  4HAI A;  2DPJ A;  1OW5 A;  2Y1I A;  3B0X A;  4C7Y A;  5ALW A;  1KTQ A;  9ICQ A;  2ZIU B;  4K4H A;  4IS7 A;  2ZTC A;  3Q8Q B;  1Z19 A;  5AHX A;  3HPO A;  5BPC A;  2RQ5 A;  2KJ5 A;  1PVR A;  2JEG A;  4Y2U A;  2OH2 A;  3PY8 A;  9ICP A;  4KLG A;  2PKE A;  2BGW A;  4KN4 A;  5IIL A;  7ICG A;  2FJ6 A;  3JPO A;  4QWE A;  4IRD A;  3BQ1 A;  3RR7 A;  3NUQ A;  4OJ5 A;  3M9N B;  4EEN A;  4U6P A;  4O3O A;  9ICI A;  4NJ8 A;  3THV A;  8ICX A;  4RQ7 A;  1QTM A;  3NVW A;  5KL8 B;  2NRX A;  1BGX T;  4C4T A;  1WG8 A;  4ECW A;  2MA1 A;  5AM1 A;  4FBU A;  3EPG A;  8ICC A;  2WAQ F;  4P0P B;  2IOF K;  1UT5 A;  3LK9 A;  4O3S A;  4BX9 C;  4CDG A;  1ZQN A;  4ECU A;  8ICA A;  4PHP A;  5J0Y A;  2P35 A;  1CUK A;  4OO1 J;  2HVH A;  5DQG A;  1SV4 A;  4QZ9 A;  3BZK A;  8ICQ A;  3ICX A;  4RQ1 A;  2GOL A;  3NS1 A;  9ICV A;  2MUT B;  4EEK A;  4R66 A;  2ZIU A;  1D9F A;  2BCQ A;  3WKA A;  4RU9 A;  3G6X A;  2F77 X;  3T5H A;  2V9W A;  1K1S A;  4Y2T A;  3HIL A;  5KFV A;  3D2N A;  1S5L U;  2JRZ A;  5CA7 A;  3LVW A;  1TAU A;  1D8Y A;  3IRU A;  4FE3 A;  3I76 A;  3PST A;  3MGH A;  5KT5 A;  4UAV A;  5ALG A;  4UQG A;  1PVQ A;  1RZT A;  1UHU A;  5KG0 A;  2K89 A;  5J0T A;  3CP8 A;  1JXL A;  4YD1 A;  3KOO A;  1K5O A;  4DF4 A;  2J6T A;  1KFT A;  2CXY A;  2K8A A;  4P0P A;  4F4Z A;  3GDX A;  4NY8 A;  9ICN A;  3OHA A;  3B0Y A;  1U4B A;  3CRX A;  4BUG A;  4R63 A;  3MR6 A;  3ZDC A;  7ICN A;  4KLQ A;  5KFB A;  3TAQ A;  2F8K A;  4NL9 A;  5ALF A;  4QZE A;  4KMO B;  1ZD4 A;  2K60 A;  2JGA A;  2KKV A;  4TUR A;  3ZDD A;  1B4F A;  2WFA A;  3T5K A;  4UAY A;  4K4I A;  4GLX A;  3C1Y A;  2HBL A;  3NGD A;  4ED8 A;  2BDP A;  5EWG A;  1BPE A;  4NWI A;  3PNC A;  2NV3 A;  2KFZ A;  4IR9 A;  5F9N A;  2MUT A;  2HSZ A;  2ZJ8 A;  3I1Y A;  5KG1 A;  4B9M A;  2MAX A;  4Z6C A;  2B21 A;  2BPF A;  1ECW A;  3QE9 Y;  1KRP A;  2BHN A;  1CRX A;  4F4W A;  1L3S A;  1ZYQ A;  5AIC A;  2FLP A;  4DSE A;  3PV8 A;  7ICV A;  4DQI A;  2DKZ A;  3Q8M A;  2K4I A;  2XC9 A;  2JH1 A;  4RNN A;  5AM3 A;  3UXO A;  3EZ5 A;  1ZQE A;  1DXS A;  3QX7 A;  3ALR A;  1RQL A;  5DKW A;  1J2M A;  4ACO A;  1L7O A;  2OYY A;  5ALO A;  3H0R B;  5DB8 A;  2AH5 A;  1U48 A;  3NVZ A;  5ALM A;  4IRC A;  4BXO B;  3ZD8 A;  2RDJ A;  2YQE A;  1RM6 C;  2G09 A;  2KJ8 A;  3ORY A;  1ZQH A;  2AQ4 A;  3LDA A;  4HYK A;  3MBY A;  5KG5 A;  1SZH A;  2K4E A;  1KFD A;  2I9G A;  1RYR A;  3F2B A;  4US9 A;  1SL1 A;  2F44 A;  3PML A;  4QZH A;  1L3U A;  3UPQ A;  3HRD D;  3K1R B;  1FEZ A;  3K75 D;  3QUQ A;  2C2R A;  2R18 A;  2NO4 A;  5EE9 A;  3KHG A;  1N60 A;  3FM9 A;  8ICN A;  4KLF A;  3BQ7 A;  2XY5 A;  5DLG A;  5TIS U;  3RFA A;  3HX0 A;  2BCS A;  1S9F A;  4C4R A;  4FO6 A;  1JRO A;  5CR0 A;  4QWA A;  2QAR B;  4ELV A;  3BS5 B;  2IHN A;  4UAU A;  1P7D A;  3N97 B;  1D8B A;  5KFJ A;  4M9H A;  1JIH A;  4P4P A;  2ALZ A;  4C8O A;  4TUS A;  1RDF A;  2JXJ A;  5AK4 A;  4I2J A;  3RB3 A;  3QEB Z;  2EZZ A;  2WF6 A;  3LWM A;  5AK6 A;  2Y9U A;  4PJ0 U;  1SIJ A;  2Q0Z X;  3GV8 B;  4YXJ A;  2ZG6 A;  1B43 A;  5L1M A;  4OD0 A;  3MFI A;  2ASJ A;  4BXO A;  1SL0 A;  5KFR A;  2D8C A;  2BCU A;  1XSN A;  4CCH A;  3L3F X;  1NKC A;  4CGZ A;  7ICT A;  9ICW A;  5IIJ A;  2Y9T A;  4GIB A;  1TAQ A;  5JU5 A;  1KSP A;  3RAQ A;  3A0B U;  2D6F C;  2XCA A;  5G5G A;  4PHA A;  4P4O A;  2XY6 A;  9ICC A;  3AQF A;  5K4L A;  4EEL A;  3H7I A;  5AKE A;  4ELT A;  5ALJ A;  4DOA A;  3F5A A;  5J2D A;  5BOL A;  2BPC A;  2HHV A;  2EZY A;  1ZQD A;  2FMQ A;  3C5G A;  4F8R A;  1C20 A;  3ZD9 A;  4NL9 C;  5DBC A;  1NKB A;  3I28 A;  5DBA A;  5CHG A;  3RBD A;  3Q8L A;  2QAR A;  4OJO A;  4RT3 A;  3BS5 A;  1WWU A;  2HBJ A;  3UQ2 A;  2JEI A;  3H40 A;  4JV1 A;  3B9J A;  5KG6 A;  3H8S A;  4Y2S A;  3RJJ A;  3L4P A;  3QUC A;  4PL1 A;  5L9X A;  1PZN A;  3RH4 A;  4G3I A;  1UA0 A;  3SEI A;  3JPQ A;  2BR0 A;  1ZQS A;  2VJ5 A;  2HOQ A;  5EE3 A;  1BPX A;  3MR5 A;  1NOM A;  2W3R A;  4DQQ A;  1N61 A;  2QKQ A;  1ZQT A;  3BQT A;  4QJF B;  4P0Q A;  1ZRM A;  3F5E A;  3EYZ A;  5AI8 A;  1B22 A;  1ZQY A;  4ED7 A;  4UAR A;  2ZXH A;  1D9D A;  3C1Z A;  3NVY A;  3PR5 B;  1QSS A;  4Y2Y A;  3M6K A;  3HJE A;  2JV3 A;  8ICR A;  4C4S A;  4EZ6 A;  1KL9 A;  3AQE A;  2W3S A;  5AKI A;  4DWI A;  1SKS A;  3E58 A;  4ECX A;  4Q45 A;  2VIX A;  1T7P A;  8ICK A;  4DSL A;  4B9T A;  3RJH A;  2DFL A;  2KZ3 A;  3N7R C;  4YFK A;  5AKK A;  3RJK A;  3GV7 B;  5EWE A;  4ECZ A;  1J97 A;  4J9K A;  1A0P A;  3UXP A;  2QB1 A;  5AI5 A;  5DG8 A;  3RB4 A;  2VA8 A;  4C8L A;  1BPB A;  2P6R A;  2QLT A;  4ECS A;  8ICV A;  1L8L A;  3NVV A;  2PFN A;  2R8I A;  5ALN A;  4DS4 A;  3EW9 A;  4IQT A;  2HHS A;  3H4B A;  1NK9 A;  1Z4O A;  2YB1 A;  2J6U A;  1QQ7 A;  4UAT A;  4FBT A;  4KLD A;  4YMO A;  2LYA A;  3EUB 2;  4WJ3 B;  1JRP A;  5ALY A;  5KFP A;  1NI3 A;  3PW7 A;  1KLN A;  5IIK A;  3WKE A;  5J2I A;  5ALQ A;  4O3P A;  5JTI A;  4I2E A;  4F72 A;  4KN7 A;  1KBU A;  5IIO A;  2WF7 A;  2YX8 A;  2G5H B;  1WCL A;  4MHV A;  5AKH A;  2W43 A;  4Q43 A;  2O6K A;  2VA3 A;  4I2I A;  1TE2 A;  4PHE A;  3GII A;  5DG7 A;  5AKZ A;  1XWL A;  2DL0 A;  4UAZ A;  9ICL A;  2KSO B;  3QU5 A;  5EE0 A;  7ICS A;  3H4D A;  1S77 D;  2IBK A;  2ISO A;  3RH5 A;  5ALH A;  1Q46 A;  4YXM A;  4RQ4 A;  2WTF A;  1IV8 A;  1S76 D;  4UB2 A;  3IHQ B;  3IM1 A;  1XU4 A;  2EAP A;  2XID A;  4ECR A;  1N5X A;  5D4B A;  9ICE A;  2KIW A;  5ALZ A;  5KFS A;  1NZP A;  1MA7 A;  2KK0 A;  4DFM A;  1SGG A;  2RDI A;  2ZJ5 A;  3PZP A;  2WF8 A;  3F2C A;  1RPL A;  4NLG A;  1NJW A;  4YG2 A;  2K4H A;  4C7Z A;  4I2F A;  3MDC A;  3T79 A;  1S0M A;  2E1F A;  3SAG A;  4AYB C;  4DS5 A;  3WK7 A;  1AQ6 A;  1WCN A;  1NK0 A;  2KZM A;  1ZQ1 C;  2MSN A;  1U47 A;  2HHW A;  2K8B B;  4PH5 A;  3TFS A;  1S0N A;  5KTQ A;  2NRZ A;  1ZQM A;  3M9O B;  4FS1 A;  4YCX A;  1HEK A;  4F2R A;  1J2N A;  2HBM A;  5J2A A;  2PI4 A;  3E0F A;  1NK6 A;  4DFD A;  1NZB A;  2HI0 A;  1QSY A;  4DF8 A;  4NLK A;  2BCV A;  2XGQ A;  3RJE A;  1URJ A;  4DL7 A;  4JUZ A;  2HVI A;  3O0F A;  4NM1 A;  2KSO A;  5III A;  4YD2 A;  4UB8 U;  1Z3E B;  2KG5 A;  3NAS A;  1B0X A;  4EX7 A;  4F91 B;  3M9M B;  1BPD A;  5CWR A;  4RNO A;  3MGV A;  1ZQL A;  3RRG A;  1DGS A;  3KBB A;  2XGP A;  2PFP A;  5AI0 A;  2LYB A;  3GU3 A;  4YR2 A;  4DQS A;  3RAX A;  3ISD A;  4KLI A;  1YZ6 A;  1HIW A;  3MGI A;  3D2Q A;  4I27 A;  3QYP A;  1PK1 B;  1L7P A;  4MF2 A;  5C0Y A;  3QU9 A;  2BQU A;  3TFR A;  8ICS A;  4F93 B;  4KIT B;  2KIV A;  1LVH A;  3GV5 B;  1L3V A;  2B0C A;  2I6X A;  4PGX A;  3IP4 B;  2F1I A;  3WK6 A;  4YR0 A;  1X6I A;  2OCE A;  2R8H A;  2P6U A;  3TQ1 A;  1ZQQ A;  3AL0 B;  2ZIV A;  2XCP A;  1LV5 A;  4J9M A;  5HR6 A;  4KX5 A;  5KFZ A;  9ICO A;  2AU0 A;  3V72 A;  1V85 A;  1IM4 A;  2Q4T A;  1X9S A;  7ICI A;  2UVV A;  1WUD A;  5KFF A;  1S0V A;  4UAS A;  3SV4 A;  4YMM A;  4O5E A;  2KD1 A;  2E1E A;  2NRV A;  1RYU A;  2YB4 A;  5E79 U;  4CF4 A;  1ZXI A;  1YT3 A;  2YN4 A;  2JMG A;  1JAL A;  2QB0 B;  2YTU A;  3MR2 A;  4XQ8 A;  1KDH A;  4YN4 A;  3FAH A;  2V4Q A;  3V6K A;  3OPX A;  8ICG A;  1TFR A;  4UB5 A;  1NK7 A;  1DOQ A;  3FC4 A;  2XI9 A;  4UBB A;  2KP7 A;  4ED3 A;  1PK1 A;  5JUM A;  2Z7J A;  2JEF A;  2W9A A;  2M0N A;  4RQ3 A;  5DQH A;  3ZI4 A;  3IG8 A;  4KLU A;  1N5W A;  2JH7 A;  2PFQ A;  4X5V A;  4F50 A;  2RLT A;  5ALR A;  2KEY A;  2E5S A;  4OJP A;  2R8J A;  1NK5 A;  8ICE A;  4P4M A;  4Z6F A;  7ICF A;  5DG9 A;  1PUZ A;  4C8N A;  4F4Y A;  1Z1V A;  3OTQ A;  5A0L A;  3T5J A;  1VDV A;  5CEH A;  8ICZ A;  4IQV A;  1Y88 A;  1L5U A;  1T4G A;  8ICH A;  4KLL A;  3SV3 A;  1S0O A;  1RXV A;  4FFD A;  2ZTE A;  4DL6 A;  3SAF A;  2LPE A;  1X2I A;  3SMV A;  2W7P A;  5AKL A;  4MFC A;  1X66 A;  2H5X A;  2PXI A;  4F3O A;  5J0X A;  3RBE A;  3C29 A;  2F1J A;  3RJI A;  1RQN A;  4UB4 A;  3IN5 A;  7ICP A;  1N2X A;  3ZDE A;  1JMS A;  3IDW A;  5J2B A;  2UVR A;  5IIN A;  1SKW A;  3QUB A;  4EBC A;  1C7Y A;  3N7S C;  4QWB A;  1L7N A;  1X9M A;  1S97 A;  4UBC A;  4O9M A;  4KLT A;  2BQR A;  2PFO A;  4USA A;  4B6J A;  5AM2 A;  2QB0 A;  3V7J A;  2BKE A;  5AI4 A;  1RXW A;  3S6J A;  5J29 A;  4F5P A;  4KTQ A;  4RUC A;  5J2F A;  5ALS A;  4RNM A;  3WKC A;  2XY7 A;  1SXE A;  2AGP A;  9ICT A;  1XNS A;  8ICW A;  2ZUD A;  2BPG A;  2J6S A;  4JV2 A;  4RT2 A;  4QZD A;  3OHB A;  4RQ5 A;  2HW3 A;  8ICJ A;  3F53 A;  2FLN A;  2ZUB A;  2KJ9 A;  1DGJ A;  5DQI A;  3VC8 A;  1LKY B;  3RF9 A;  3HP6 A;  3RH6 A;  2ODG A;  3C2L A;  1UT8 A;  2NRW A;  1PVP A;  2YY6 A;  4ECY A;  5B5E U;  3L5K A;  3MDA A;  9ICH A;  1X42 A;  3GIK A;  5DGA A;  4KLJ A;  1FFU A;  2K4P A;  5KT4 A;  4P0Q B;  2LHT A;  5ALL A;  2LM1 A;  4ZH4 A;  3H8J A;  4QZI A;  3KZX A;  2W55 A;  3GZF A;  1MN8 A;  2ASL A;  2EQY A;  3V7K A;  5KAI U;  2ZTD A;  3ETL A;  2G5I B;  1ZJN A;  3CW2 C;  1QSL A;  2YMQ A;  3K4G A;  5AI6 A;  4DLG A;  3OGU A;  4UAW A;  2ZUC A;  2KNJ A;  3GFK B;  5HR7 A;  2F8L A;  5C5J A;  4RZR A;  3PMN A;  1ZQO A;  1QH9 A;  3CYM A;  2WB1 C;  4AYB F;  2H3I A;  4I29 A;  4M6W B;  1N62 A;  2HMX A;  4EYI B;  1ZJM A;  4R65 A;  4O3M A;  2P66 A;  3CNH A;  2HHX A;  9ICX A;  3EPI A;  4RPY A;  5H2F U;  2JEJ A;  4U7C A;  1TV9 A;  4QW8 A;  3WK9 A;  1ZQI A;  2KIC A; 
#chains in the Genus database with same CATH homology
 2KG5 A;  1B0X A;  4PZN A;  2EAN A;  5J8Y A;  4MHV A;  1KW4 A;  2EAO A;  3KKA C;  3TAC B;  2QKQ A;  4RQN A;  2DL0 A;  2QB0 B;  2YTU A;  2DKZ A;  2KSO B;  2Y9U A;  1SXE A;  1LKY A;  1OW5 A;  1DXS A;  5L1M A;  2JV3 A;  2E8M A;  2L5Y A;  1WWV A;  1PK1 A;  3HIL A;  2FE9 A;  1OXJ A;  2D8C A;  1UCV A;  1LKY B;  4IS7 A;  2EAP A;  3KKA A;  4PZO A;  1SXD A;  1PK1 B;  2Y9T A;  5JU5 A;  1COK A;  2B6G A;  1SGG A;  5KNI A;  2LMR A;  2ES6 A;  1Z1V A;  2K4P A;  3BS7 A;  1UQV A;  2KIV A;  2QB1 A;  2D3D A;  2F44 A;  2EAM A;  1X9X A;  3K1R B;  2KE7 A;  1V38 A;  2LPE A;  3H8M A;  2E8O A;  1SV0 C;  4NL9 C;  1X66 A;  4NJ8 A;  2F8K A;  1RG6 A;  1SV0 A;  4NL9 A;  2KMD A;  2ESE A;  2QAR A;  1X40 A;  1JI7 A;  2K60 A;  3BS5 A;  1WWU A;  3BQ7 A;  1V85 A;  2E8N A;  3IDW A;  3SEN A;  1B4F A;  2GLE A;  1F0M A;  3TAD C;  5JRT A;  2DKX A;  4RQM A;  2E8P A;  2QAR B;  3TAD A;  2QB0 A;  1PK3 A;  3BS5 B;  5JTI A;  5F3X B;  1SV4 A;  3SEI A;  2F3N A;  2KSO A;  5J8Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...