2E8NA

Solution structure of the c-terminal sam-domain of ephaa2: ephrin type-a receptor 2 precursor (ec 2.7.10.1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
88
structure length
88
Chain Sequence
GSSGSSGEGVPFRTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDVKRIGVRLPGHQKRIAYSLLGLKDQVNTVGIPISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, signaling protein
molecule keywords Ephrin type-A receptor 2
publication title Solution structure of the C-terminal SAM-domain of EphaA2: Ephrin type-A receptor 2 precursor (EC 2.7.10.1)
rcsb
source organism Homo sapiens
total genus 19
structure length 88
sequence length 88
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2e8nA00
2EANA 1V85A 2K4PA 2E8MA 1SGGA 1B4FA 1X40A 1KW4A 2KE7A 2YTUA 1OW5A 1PK1A 2DKZA 1LKYA 2EAPA 4NL9A 3BS7A 1F0MA 2F3NA 3BQ7A 3KKAC 1PK3A 1SXDA 2L5YA 5J8YC 2F8KA 2FE9A 2DKXA 3KKAA 1DXSA 2GLEA 3K1RB 2Y9UA 4PZNA 2QB0A 2QARA 1SV4A 1SV0C 2E8NA 1UQVA 2KSOA 1COKA 2QARB 1PK1B 4RQMA 1LKYB 1SV0A 3TACB 2KMDA 3TADC 2E8PA 2D8CA 1X9XA 2E8OA 2JV3A 2F44A 2EAOA 5J8YA 3BS5A 2ESEA 5JTIA 1V38A 3TADA 1RG6A 4PZOA 2D3DA 2LMRA 5JRTA 5KNIA 2QB0B 3HILA 3H8MA 4RQNA 1X66A 2ES6A 5JU5A 4NL9C 2KSOB 1Z1VA 1WWUA 2QKQA 2Y9TA 2LPEA 2QB1A 4NJ8A 1UCVA 2K60A 1B0XA 2EAMA 1OXJA 1SXEA 2KIVA 5F3XB 4IS7A 3SENA 2DL0A 2KG5A 5L1MA 1WWVA 3BS5B 1JI7A 3IDWA 2B6GA 3SEIA 4MHVA
chains in the Genus database with same CATH superfamily
5AI9A 7ICGA 3QUBA 1V85A 4QZIA 4J9QA 4UAUA 2YMPA 9ICIA 3C28A 1KW4A 4ED8A 1AQ6A 4KLSA 3MR3A 5J0WA 5IIMA 4NLNA 2W8LA 1X9SA 4ECUA 3DEEA 5KG7A 3BQ7A 2ZJ5A 1UPHA 3EPIA 1C20A 4NLKA 4Y2PA 5J8YC 3SI8A 2KICA 4R65A 3M8SA 4NLBA 1FFUA 2RDIA 3H0RB 5KFAA 2HI0A 1Q3UA 1NOMA 4F2RA 4FZNA 4P4PA 1XO1A 2P6RA 1D9FA 1RQLA 4UARA 2E8NA 8ICTA 1BNOA 4KLIA 2KEYA 3MR2A 4IQWA 4OO1J 2ZTEA 1U9LA 4I2FA 1RXVA 4YMOA 7ICMA 3KOOA 2C2EA 1X6IA 5HMLA 3V72A 4QZDA 3G6XA 5HHHA 4RQ4A 2HCFA 3TAPA 4DQPA 3NVWA 4I2BA 5ALFA 5JUMA 4I28A 3OHAA 1V97A 4KLOA 3I1YA 4RNOA 3UPQA 8ICGA 4NLGA 2YX8A 9ICSA 4ZOHC 9ICHA 4F93B 4NL9C 1XSLA 8ICUA 4GC7A 3NTUA 2H5XA 2BCRA 5AICA 4DS4A 2JXJA 2YB4A 4ECXA 5DLFA 4O3RA 2Y9TA 3HW8A 4BWMA 4NJ8A 4YXJA 2XCPA 4C0ZA 4TUQA 4ED2A 3IV6A 3HX0A 5ALWA 1B0XA 3H40A 7ICUA 4GXKA 4P0PA 3T5LA 2ZXHA 3FC4A 5AK6A 4I2AA 3C1YA 1S0OA 1ZD3A 3OGUA 1ZQNA 3GV8B 3KBBA 1Z4OA 2BCSA 3LWMA 1RPLA 1N5WA 3EYZA 5AI8A 3EZ5A 4QZBA 3M9MB 1PUZA 3PNCA 2AGOA 7ICKA 4RQ1A 3PR5B 4IRKA 3D2QA 5F9NA 2UVWA 8ICFA 1VLBA 2K89A 2HVIA 5J0XA 4DEZA 2L5YA 4M9GA 5KFEA 3T5KA 4P0PB 2XO7A 4J9PA 1KDHA 1S8OA 4ED6A 3EWAA 4Y2RA 2BQUA 5ALYA 3HRDD 1JX4A 1Y88A 3CYMA 2W9MA 4O3OA 2QARB 1NJXA 2N1RA 1FEZA 3RJJA 9ICAA 3TADC 3SAHA 1DK3A 1X9MA 2W43A 1T3NA 2E8PA 4M9JA 4NWIA 5JTIA 4DSEA 5KT6A 9ICEA 4GC6A 5KG4A 3GILA 1GO3F 4M9LA 2CRXA 3QNMA 2GH1A 5CHGA 1MSWD 1ZQYA 2AH5A 4M6WA 5CWRA 2JEFA 2ZIUA 4RU9A 5EWFA 1ZQTA 4EYHB 2I6XA 5D46A 4US8A 3AN1A 3QUQA 3V6JA 3H4DA 3RH6A 3RJIA 5J2KA 5F3XB 4IS7A 4Y2UA 1QQ5A 1ZOLA 5DGBA 3QUTA 2ZIVA 4DL5A 2XICA 3A0HU 3ZDBA 4ELTA 5J2EA 4QWEA 1MN8A 4QZCA 3QEAZ 4EX6A 7ICEA 1P7DA 1SKRA 3RBDA 2VJ4A 9ICXA 8ICVA 4F5OA 4FS1A 2A19A 3RAQA 5ALLA 4M6WB 4TUSA 4MFFA 2ZIUB 3QZ7A 1L8OA 1RYSA 2JH7A 4UB5A 2FMSA 1Z00A 5KFJA 1L7OA 4NV0A 1L3SA 4IL6U 8ICYA 5J0YA 2W9AA 2ISOA 1ZQCA 4BXOA 2IOFK 4F50A 3ZDDA 5AM2A 1CUKA 2ASLA 1K1SA 7ICQA 3PO5A 1N2XA 2DWQA 1ZRNA 3QU4A 1O03A 1F44A 4BJQA 4C7ZA 1IG6A 2ZIWA 5AIAA 4RNMA 3M9OB 2B0CA 3LVVA 7ICIA 2BCQA 2YQEA 1Z00B 2Q4TA 1HJPA 2OCEA 3WKDA 1KKXA 2ZUDA 1IV8A 2BQRA 3CNHA 1RG6A 4PZOA 4DOAA 4BXOB 4DFKA 4G9BA 2RHFA 4GXIA 9ICFA 1SWVA 1ZQUA 4Z6EA 1T7PA 2XY7A 4FS2A 2W11A 1Z1BA 4TQSA 4I29A 4R66A 2NRVA 4HAIA 5TZVA 3CRXA 4F4WA 4PH5A 3QX7A 4DL7A 2ZIWB 2XVTA 5BPCA 2QB1A 5KFRA 1PVQA 4QZFA 3V7LA 1VJ5A 3U26A 4BWJA 2W9BA 2F76X 8ICAA 1TE2A 1JALA 1JROA 2HBLA 3EUB2 3F2CA 1WWVA 4ECWA 1K1QA 2UVRA 5KFHA 2W8KA 2WAQF 1SGGA 3GIJA 5ALEA 5DQIA 5T14A 1ZQIA 3VCBA 2EZXA 2MSNA 2KFNA 4K4HA 3WU2U 1KL9A 2VA8A 2NO4A 3FAHA 4GIBA 3WKBA 3NGDA 2PI4A 4RQ2A 5DBCA 2W9BB 2FDRA 3THVA 2R18A 4KLLA 3OHBA 1JRPA 2NO5A 2NRWA 5L9XA 2GLEA 3K1RB 7ICSA 1VDVA 3WK9A 8ICBA 3A0BU 5J0SA 2YMQA 2KHVA 4F4KA 3TARA 4IRCA 2F1HA 5ALUA 4UQGA 4ECSA 3HWTA 3C2LA 4KLHA 4I2GA 2LYHA 4DQQA 5KFCA 3QYPA 4J9NA 5D49A 1N56A 4YMMA 3F2DA 4F2SA 2NYVA 3BDPA 3WKAA 3PX0A 9ICJA 2DQNB 1FIQA 1WCLA 1U4BA 2NRTA 7ICFA 2WHEA 1TKDA 4EX7A 4Z6FA 3RF9A 1UHUA 1ZJNA 5L1IA 5KFZA 1X66A 7ICOA 2FLLA 1RYUA 3RR7A 3E58A 4US9A 1L3TA 4P4MA 1TK0A 2OXOA 3RH4A 3ORYA 5J2JA 3Q8KA 4M04A 1B43A 4OJ5A 2W9CB 4TUPA 5KG6A 3Q8LA 2ASJA 4Y2VA 3PV8A 3I28A 4RQ8A 1KSPA 2PFNA 4C4SA 2KIVA 4KMOB 3Q8SB 1ZQWA 1ZD2P 3CP8A 3WK8A 4EYIB 4BGDA 3UMCA 4RQ6A 5KFWA 3M8RA 2C22A 9ICBA 2RLTA 4RUCA 4DSJA 2G09A 4B6JA 4O3MA 4QW8A 2JZBB 5KG2A 3RB6A 1LKYA 4KX5A 1Z3EB 3BS7A 2FLNA 2CPRA 2VKQA 3HPOA 1WUDA 4JUZA 3H8WA 2AGPA 2ODGA 3UQ2A 1ZD5A 3AQFA 1BNPA 3SV4A 2H3VA 1J2NA 4UB8U 4KN7A 2IMWP 4KLTA 1SWWA 3BQTA 3ZDAA 4PZNA 5ALQA 3AM9A 2WF7A 3KHRA 3QEBZ 1Q46A 1LKYB 3N28A 5KFBA 3AU6A 3TFSA 1KQQA 1XC9A 4MF8A 3BZKA 5KTQA 4C8KA 4NM1A 2XI9A 5AKZA 4PHPA 5L1KA 3N97B 4PPXA 3TADA 4DFJA 1Q3VA 1JN3A 4KTQA 3SAGA 3QZ8A 3OJSA 3GDXA 2OH2A 4CF3A 1J2MA 3N7PD 4RQNA 4F72A 2ALZA 1ZQBA 1MC8A 3WK4A 1QQ6A 5AI4A 3GV7B 2Y1JA 5AM0A 4GLXA 7ICNA 3B0XA 4B9SA 1ZQKA 2IOHA 1MQ2A 1KFSA 5AM1A 1TAMA 5D4BA 4ICAA 1SXEA 2XY5A 4LZDA 2XCAA 1XNSA 2FPLA 3V7JA 4O3SA 2KFZA 2J6UA 2AJQA 3N7RC 4MHVA 3ZD8A 2RDJA 1U48A 3RJHA 2HSZA 4PL1A 1X40A 1N61A 1ZQPA 1UA1A 2DGZA 3MGIA 3OSPA 1SB3C 2G08A 3KHGA 2C28A 1NKCA 1DGJA 5KFIA 3AQEA 3D6JA 3AUOA 4ECVA 3CW2C 3WKCA 4P4OA 4UASA 1SZPA 4R8UB 3ETLA 3PVXA 1XO0A 1DXSA 3VC8A 1CRXA 4USAA 3MABA 2UVVA 2W55A 4Y2YA 4EEYA 1LVHA 2VA2A 3EPGA 7ICJA 2EZZA 5DG8A 5ALNA 1DOQA 3RB0A 1COKA 2WF5A 4GFJA 4RNNA 8ICZA 3ZI4A 3MGVA 5KFPA 5HNKA 3M6KA 4CE6A 2P66A 5KFSA 3D2NA 1ZQRA 3ZD9A 5ALVA 4YP3A 2R8JA 4EEKA 2E1EA 2LKYA 3MFHA 2LYBA 1WYGA 2LBOA 2WF8A 5ALOA 3C5GA 2HDOA 2JMGA 1Z4NA 1X42A 4QWDA 4KLMA 1T8EA 2IOFA 1HUOA 2KN7A 4LZGA 5CA7A 2WAQC 2WF9A 5CB1A 1BPBA 1ZQEA 4IRDA 4UBCA 3JPPA 4OJOA 3ONNA 5FP0A 5KFVA 3G6VA 7ICTA 1LV5A 5J2HA 1TV9A 4B9MA 4QWBA 5AKXA 4DFMA 2ZTDA 4JB3A 1NK8A 4B9LA 5J2GA 4RT3A 2VJ5A 1L8LA 3NASA 4DCCA 3F5EA 2YMLA 1XSPA 3KD3A 4DOCA 1S5LU 3KKAC 4KLGA 5G5HA 1O08A 2FE9A 4UB6U 3TI0A 3Q8RB 3C1ZA 3H8SA 2BGWA 1ZQHA 4KMUA 5B5EU 2F1IA 2QARA 9ICNA 3KHLA 3MR5A 8ICEA 4CNQA 3PX6A 4YN4A 3JPQA 4XRHA 1S76D 3HT3A 3WK6A 1RQNA 4QZGA 4K4GA 5ALJA 4QZHA 5KFGA 5DB6A 1QCKA 2JV3A 4DQSA 2W54A 9ICCA 2EAOA 4UB1A 5AM4A 4JWMA 1V38A 2E3TA 4PL2A 4O5CA 3SV3A 3OTQA 4NY8A 2J6SA 4J03A 4Q45A 3G6YA 2EZYA 4TURA 4EZ9A 4I2DA 5KT5A 2CN1A 2IHMA 1L7NA 4Y2JA 3QUCA 2R8IA 2KHQA 4QZEA 2EAMA 5KT4A 2FMQA 2RRDA 2BPFA 2GO7A 3GU3A 3C2MA 4QIWF 1TAQA 4JV0A 2KZMA 3NVZA 2C2RA 1FO4A 5DB9A 2LYAA 3SAFA 4RUAA 1NZPA 2KKPA 3GIKA 1M6YA 2KE7A 5KFMA 1BPEA 5EOZA 5C0YA 4F71A 2FI1A 4KLFA 2M9NA 2MUTA 5H2FU 3QU5A 2K8CB 1ZYQA 2HBKA 3PMLA 1ZQVA 1T94A 4F5NA 5AK3A 2BQ3A 2MAXA 4YR0A 4YVZA 1N5XA 4Y2QA 2C2DA 1L3UA 4DL3A 4JMUA 2O6KA 1BGXT 3EW9A 4NLZA 3GIMA 8ICSA 2DFLA 1S77D 2MUTB 1D8BA 4DS5A 3KZIU 3BS5A 2KJ9A 3QU2A 5KFTA 2KZ3A 1KTQA 2H3IA 3GIIA 1S0MA 5CRXA 9ICWA 4QZ9A 4X5VA 2KNJA 4B9TA 1BVSA 3ISBA 4DFDA 5ALGA 2W3SA 4NLCA 3QE9Y 1SKSA 5IIJA 5IIOA 3PSFA 2BZFA 4O0IA 2VIXA 5KFDA 1Q8KA 4YCXA 1IM4A 4BDPA 3SENA 4MFAA 2KG5A 4UAWA 2VA3A 3BS5B 3Q8MA 3BQ2A 3NS1A 4ECYA 3IN5A 5KT2A 4DWIA 5KG5A 1DGSA 3TQ1A 4IQUA 2BHNA 2YTUA 1QSSA 2EAPA 5EE9A 3GZFA 1L6NA 4GXJA 4DOBA 4IQVA 3PO4A 3SZ2A 2A1AA 2RP5A 3PW4A 2A1JA 5J2IA 3RBEA 2YB1A 4Y2XA 4QW9A 2JEGA 2QB0A 1NNLA 4YD2A 4RZRA 3KFUF 4QZAA 4NXZA 2PMZC 2ZJAA 4RPZA 1NK4A 5G5GA 5KG3A 2Y0SC 3MGHA 3SYZA 5L1LA 3RJKA 2J6TA 4JV2A 2DF4B 4JV1A 2DBYA 3NUQA 2FMPA 4MFCA 9ICUA 8ICNA 2BR0A 1X9XA 7ICLA 2F44A 5J8YA 5ALHA 2A1JB 3QU7A 2B21A 1UT8A 2D3DA 1OUQA 5ALRA 4QZ8A 4FE3A 5J2AA 3M7DA 1N48A 8ICLA 2QB0B 3H8JA 3H8MA 3L5KA 3RRGA 1SIJA 3K1ZA 4DSFA 3RJFA 5EE3A 2JR5A 5JU5A 3B0YA 8ICRA 3ZDCA 2F77X 1ZQOA 1NK6A 1N63A 1Z1VA 5B66U 2W9CA 3UQ0A 4DFPA 1KRPA 2PXIA 4F8RA 2HBJA 1FFVA 2OHFA 4AYBF 2AXTU 3M1YA 4C8NA 5HR6A 2BCUA 4IR9A 5L1MA 5KAFU 3IRUA 2KD1A 2LM1A 5C5JA 2JZBA 2Y1IA 1N62A 3SQIA 2PFOA 1S0NA 4ELUA 2DKZA 4NL9A 2RQ5A 2I9GA 3SMVA 3Q8QB 2KTQA 3JPSA 1S0VA 4ECZA 3MBYA 5KAIU 2JH1A 8ICXA 1KEJA 4YD1A 5ALMA 1SXDA 2WTFA 3PSIA 2ISPA 3Q8PB 4EBCA 4CRXA 4UBBA 3M6ZA 3KKAA 1LB2B 2I1QA 4UB4A 1T3QA 2XIDA 1QTMA 5EE0A 4ELVA 2MU2A 2G07A 5AKHA 1ZD4A 3LDAA 4ED7A 2WB1F 5TISU 1D8YA 1BPDA 2PFQA 4RQMA 4DL4A 5DG9A 5DG7A 1HUZA 3V6HA 1X9WA 4P2HA 8ICPA 2P35A 2JEJA 2E8OA 4O3NA 5K4LA 3TANA 2KJ5A 2HHQA 3HKZF 2W03A 2NRXA 4J9KA 3HILA 3T5JA 3WK7A 5J2FA 5DBBA 1L7PA 1MQ3A 2HHTA 4OJPA 4QIWC 3FM9A 5CEHA 4Z6CA 3HP6A 3GV5B 5KFUA 2R8GA 1KN5A 2ZXIA 4O3PA 3RFAA 1HEKA 4FBUA 2DL0A 5J2CA 2LI6A 8ICMA 1XWLA 3GFKB 3LWLA 3OJUA 4CF4A 4Y2TA 2H3QA 5J0TA 3SEIA 2EANA 2NRZA 4ED3A 9ICVA 3HJEA 2HOQA 3NVYA 4I2JA 2K4PA 2W7OA 5GTHU 2F8LA 3L3FX 4LJXA 3GQCA 4UAZA 3PSPA 4NM2A 1PK1A 4O5KA 3UXOA 5AKJA 3UM9A 3E0FA 2G5HB 2JGAA 3H4BA 1PVPA 4R8UA 1SZHA 5EWGA 1PK3A 3I76A 3K75D 1UT5A 1ZQFA 4PHEA 4I2EA 1NKEA 5ALKA 3FDSA 2BPCA 3C29A 4KLDA 4F5PA 3E2EA 3N7SC 4I27A 4WJ3B 2Q0ZX 1SV0C 4ED0A 3PW7A 2A3VA 2BPGA 2LHTA 1RYRA 5KFLA 1PK1B 5J29A 4Z6DA 3TACB 1ZQQA 4MF2A 2KMDA 3ALRA 3WK5A 5ALPA 1RM6C 4CDGA 1NK0A 2OWOA 3QXGA 1XS9D 2WFAA 4M9NA 2LMRA 5IIKA 2R8KA 5CJ7A 1C7YA 4EZ6A 4C80A 3IHQB 4M0AA 5HMMA 4QWAA 2ZG6A 1XU4A 2OM6A 4C4TA 1NK5A 1TFRA 2PMZF 4CCHA 4C7YA 3MR6A 4XQ8A 3KHHA 5J0OA 2HW3A 1U45A 3AMZA 3T3FA 2Y0SF 1QH9A 9ICMA 3H0MB 5ALZA 4I2HA 4Q44A 4C4RA 4FO6A 1JI7A 3IM1A 2B6GA 4G3IA 3MFIA 3ETRA 3BJYA 5L1JA 5KT7A 4F4YA 3RRHA 5AKYA 4DL2A 4JWNA 1BPZA 3KTQA 2KIWA 2HHUA 5F9LA 5KT3A 5KFYA 3D2SA 2JHDA 3R9KA 1V9PA 4OJLA 5J0UA 2ZIXA 9ICPA 1YZ7A 3L4PA 4F5QA 1NKBA 3S6JA 2DKXA 4YG2A 4MEXA 4BUGA 3PW0A 4J9RA 2K4EA 3PMNA 4IC9A 5AIBA 4UATA 3UXNA 1X6JA 3ZDEA 8ICQA 1SL1A 3MC1A 4DSKA 2AHOB 4ZH4A 5AI0A 5IIIA 2HOIA 3ED5A 4XUSA 2UVUA 3PY8A 2FPKA 3DDHA 1CEZA 4PJ0U 9ICLA 2ZIXB 1ZQXA 3QU9A 1TK8A 5KFKA 2BCVA 5AK5A 5DB8A 2G5IB 4TQRA 1TAUA 5DBAA 2D6FC 1YT3A 4O9MA 3BZCA 2ES6A 3OSNA 4AYBC 2FJ6A 2IA6A 2GOLA 2HHSA 4J9SA 1WWUA 2LPEA 3TAQA 2P6UA 1IIPA 2BKEA 4F91B 3B9JA 1NJZA 7ICVA 4RQ5A 2OEHA 2AQ0A 3NVVA 4RT2A 2EH9A 1ZQDA 1ZQSA 3KZXA 3PZPA 2EQYA 4Q8EA 3C21A 9ICTA 4PGXA 2ZTCA 1BPXA 1ZRMA 4F5RA 2DPJA 4ECQA 4UAYA 4LVSA 2MA1A 2QLTA 3JPNA 1U49A 1D9DA 1F0MA 2F3NA 2FPMA 4KX3A 2DUYA 4F4XA 1A6SA 1L3VA 2F1JA 4CF5A 5KG1A 2WB1C 2IBKA 4FZMA 4AP9A 2ZJ8A 5ALSA 2JEIA 5DDMA 4QJFB 1SV4A 2ZUBA 5DLGA 4EELA 4F4ZA 1ZQMA 2KK0A 3T79A 3HKZC 4CGZA 1ZQJA 4O5EA 4C8LA 7ICRA 1TK5A 4KLEA 4K4IA 2XY6A 2D8CA 1F5SA 1ZQAA 2KJ8A 3PSTA 2KVSA 1S10A 3RJGA 4F92B 4I2IA 5KNIA 5KFQA 2ASDA 2V9WA 4FZLA 3ISCA 3J81j 2E5SA 5IINA 4P0QA 2QKQA 1NK9A 4I2CA 8ICHA 5AKIA 4KLUA 2CXYA 4DSIA 5DB7A 2XGPA 2K60A 1D8LA 3NRZA 1J97A 4UAVA 2HHWA 2NV3A 4PHDA 4DF4A 7ICPA 1JMSA 5KL1B 1MA7A 3RJEA 2KKVA 4QNLA 1UA0A 1DK2A 7ICHA 1HIWA 2ZIVB 2E8MA 3RB4A 3ICXA 3NRWA 4Y2SA 5ALIA 4DO9A 4XA5A 5BOMA 4B9UA 2K4HA 4M2YA 2YY6A 4P0QB 3F2BA 1JXLA 1QSYA 1ECWA 2V4QA 4PGQA 1N60A 9ICGA 2EDUA 2F2AB 1ZJMA 4DL6A 4PGYA 2WF6A 1WG8A 2F8KA 5J0RA 2DPIA 4MEYA 5ALXA 2FLPA 3IG8A 2Z7JA 5BOLA 4KLQA 3C2KA 4RQ7A 2V4RA 4J9MA 4ECTA 3WKEA 4OD0A 2AQ4A 1SV0A 1COOA 3ISDA 3JPTA 4RPYA 2M0NA 1NI3A 2W7PA 1ZQ1C 3C5FA 1A0PA 5HHIA 2ESEA 1SKWA 5HR7A 2BDPA 4KN4A 1KLNA 3UMGA 5KFXA 5JRTA 4KLJA 1SL2A 1WCNA 2XGQA 3PW2A 2HMXA 3PX4A 8ICJA 3LVWA 3UMBA 2W3RA 3T5HA 2HHXA 2HHVA 1RDFA 1UCVA 2K8BB 2H3FA 5KFFA 1OXJA 1B22A 4M47A 5EE1A 2KZZA 8ICWA 2K4IA 1KFTA 3BQ1A 2LM4A 1ZETA 3JPOA 1ED1A 4E0DA 5KFNA 4B9VA 3BQ0A 5DDYA 1KBUA 4J9OA 3TKAA 4DLGA 4Q43A 4B9NA 3RR8A 2HOFA 1B4FA 3AU2A 1URJA 4QWCA 2I5HA 1OW5A 4EBDA 3RH5A 3F53A 4IQTA 5KL8B 5J0QA 4C8MA 5CR0A 3MDAA 5AI5A 4YMNA 3TFRA 1NJWA 3F5AA 1RZTA 2KP7A 2IHNA 1ZXIA 5AHXA 4ACOA 1A76A 3RB3A 4RPXA 3H7IA 3PR4A 1Z19A 1ZQGA 4FFDA 5GTIU 4U7CA 5DGAA 8ICKA 3K4GA 3MDCA 4YR2A 3LK9A 5AM5A 1JXEA 2JRZA 1JIHA 4YR3A 4OCZA 3LYSA 4R63A 5AI6A 2ATLA 5AKEA 8ICOA 9ICKA 2YMMA 2H3ZA 1CI4A 3H0LB 1H38A 1NK7A 2KOBA 3M9NB 4RQ3A 1T4GA 2GWSA 4M9HA 4JK1A 1IXRA 4UB2A 4EBEA 2G0AA 1DRGA 8ICIA 4EENA 5AKKA 4RQ0A 4DSLA 2AU0A 3O0FA 1KFDA 5DKWA 3FYHA 1K5OA 5AM3A 2KVCA 5KG0A 4U6PA 4YFKA 4PHAA 4UW9A 3IDWA 4FBTA 5E79U 5IILA 4YXMA 2ZUCA 1PZNA 4R64A 5A0LA 3AEVA 1PVRA 3V7KA 2E1FA 5DQGA 5CP2A 1TVAA 4YQWA 3SR6A 1A77A 4DQIA 2R8HA 1S9FA 1XSNA 1ZQZA 1AROP 5AKLA 3RTVA 3AL0B 2Y9UA 3V6KA 4DF8A 4DQRA 8ICCA 1SL0A 1BPYA 4OJ6A 1ZQLA 5ALDA 5J0PA 3OPXA 1UQVA 3DV9A 2KSOA 4F3OA 3C23A 4KITB 3RAXA 1YZ6A 2BDUA 4O3QA 3UXPA 9ICOA 2W04A 2YN4A 1NJYA 1S97A 5ALTA 4HYKA 1X2IA 2HVHA 2KV2A 4BX9C 3N4MB 2G06A 5EWEA 3SD7A 1QQ7A 2OYYA 1QLNA 4C8OA 3IP4B 1RXWA 5AK4A 4DLEA 2K8AA 1L7MA 5J2DA 5DQHA 2XC9A 3IG5A 4ECRA 2AGQA 2PKEA 9ICQA 3PW5A 2PFPA 4UB3A 2KSOB 5J2BA 1QSLA 5HP4A 1U47A 2MRLA 1L5UA 9ICRA 2HBMA 1NZBA 4A8EA 2PI5A 5AKGA 1JUDA 4ED1A 5KFOA 4J9LA 4Q8FA 2VANA 4IR1A 3JPRA 1EXNA
chains in the Genus database with same CATH topology
2EANA 1V85A 2K4PA 2E8MA 1SGGA 1B4FA 1X40A 1KW4A 2KE7A 2YTUA 1OW5A 1PK1A 2DKZA 1LKYA 2EAPA 4NL9A 3BS7A 1F0MA 2F3NA 3BQ7A 3KKAC 1PK3A 1SXDA 2L5YA 5J8YC 2F8KA 2FE9A 2DKXA 3KKAA 1DXSA 2GLEA 3K1RB 2Y9UA 4PZNA 2QB0A 2QARA 1SV4A 1SV0C 2E8NA 1UQVA 2KSOA 1COKA 2QARB 1PK1B 4RQMA 1LKYB 1SV0A 3TACB 2KMDA 3TADC 2E8PA 2D8CA 1X9XA 2E8OA 2JV3A 2F44A 2EAOA 5J8YA 3BS5A 2ESEA 5JTIA 1V38A 3TADA 1RG6A 4PZOA 2D3DA 2LMRA 5JRTA 5KNIA 2QB0B 3HILA 3H8MA 4RQNA 1X66A 2ES6A 5JU5A 4NL9C 2KSOB 1Z1VA 1WWUA 2QKQA 2Y9TA 2LPEA 2QB1A 4NJ8A 1UCVA 2K60A 1B0XA 2EAMA 1OXJA 1SXEA 2KIVA 5F3XB 4IS7A 3SENA 2DL0A 2KG5A 5L1MA 1WWVA 3BS5B 1JI7A 3IDWA 2B6GA 3SEIA 4MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  1V85 A;  2K4P A;  2E8M A;  1SGG A;  1B4F A;  1X40 A;  1KW4 A;  2KE7 A;  2YTU A;  1OW5 A;  1PK1 A;  2DKZ A;  1LKY A;  2EAP A;  4NL9 A;  3BS7 A;  1F0M A;  2F3N A;  3BQ7 A;  3KKA C;  1PK3 A;  1SXD A;  2L5Y A;  5J8Y C;  2F8K A;  2FE9 A;  2DKX A;  3KKA A;  1DXS A;  2GLE A;  3K1R B;  2Y9U A;  4PZN A;  2QB0 A;  2QAR A;  1SV4 A;  1SV0 C;  2E8N A;  1UQV A;  2KSO A;  1COK A;  2QAR B;  1PK1 B;  4RQM A;  1LKY B;  1SV0 A;  3TAC B;  2KMD A;  3TAD C;  2E8P A;  2D8C A;  1X9X A;  2E8O A;  2JV3 A;  2F44 A;  2EAO A;  5J8Y A;  3BS5 A;  2ESE A;  5JTI A;  1V38 A;  3TAD A;  1RG6 A;  4PZO A;  2D3D A;  2LMR A;  5JRT A;  5KNI A;  2QB0 B;  3HIL A;  3H8M A;  4RQN A;  1X66 A;  2ES6 A;  5JU5 A;  4NL9 C;  2KSO B;  1Z1V A;  1WWU A;  2QKQ A;  2Y9T A;  2LPE A;  2QB1 A;  4NJ8 A;  1UCV A;  2K60 A;  1B0X A;  2EAM A;  1OXJ A;  1SXE A;  2KIV A;  5F3X B;  4IS7 A;  3SEN A;  2DL0 A;  2KG5 A;  5L1M A;  1WWV A;  3BS5 B;  1JI7 A;  3IDW A;  2B6G A;  3SEI A;  4MHV A; 
#chains in the Genus database with same CATH topology
 5AI9 A;  7ICG A;  3QUB A;  1V85 A;  4QZI A;  4J9Q A;  4UAU A;  2YMP A;  9ICI A;  3C28 A;  1KW4 A;  4ED8 A;  1AQ6 A;  4KLS A;  3MR3 A;  5J0W A;  5IIM A;  4NLN A;  2W8L A;  1X9S A;  4ECU A;  3DEE A;  5KG7 A;  3BQ7 A;  2ZJ5 A;  1UPH A;  3EPI A;  1C20 A;  4NLK A;  4Y2P A;  5J8Y C;  3SI8 A;  2KIC A;  4R65 A;  3M8S A;  4NLB A;  1FFU A;  2RDI A;  3H0R B;  5KFA A;  2HI0 A;  1Q3U A;  1NOM A;  4F2R A;  4FZN A;  4P4P A;  1XO1 A;  2P6R A;  1D9F A;  1RQL A;  4UAR A;  2E8N A;  8ICT A;  1BNO A;  4KLI A;  2KEY A;  3MR2 A;  4IQW A;  4OO1 J;  2ZTE A;  1U9L A;  4I2F A;  1RXV A;  4YMO A;  7ICM A;  3KOO A;  2C2E A;  1X6I A;  5HML A;  3V72 A;  4QZD A;  3G6X A;  5HHH A;  4RQ4 A;  2HCF A;  3TAP A;  4DQP A;  3NVW A;  4I2B A;  5ALF A;  5JUM A;  4I28 A;  3OHA A;  1V97 A;  4KLO A;  3I1Y A;  4RNO A;  3UPQ A;  8ICG A;  4NLG A;  2YX8 A;  9ICS A;  4ZOH C;  9ICH A;  4F93 B;  4NL9 C;  1XSL A;  8ICU A;  4GC7 A;  3NTU A;  2H5X A;  2BCR A;  5AIC A;  4DS4 A;  2JXJ A;  2YB4 A;  4ECX A;  5DLF A;  4O3R A;  2Y9T A;  3HW8 A;  4BWM A;  4NJ8 A;  4YXJ A;  2XCP A;  4C0Z A;  4TUQ A;  4ED2 A;  3IV6 A;  3HX0 A;  5ALW A;  1B0X A;  3H40 A;  7ICU A;  4GXK A;  4P0P A;  3T5L A;  2ZXH A;  3FC4 A;  5AK6 A;  4I2A A;  3C1Y A;  1S0O A;  1ZD3 A;  3OGU A;  1ZQN A;  3GV8 B;  3KBB A;  1Z4O A;  2BCS A;  3LWM A;  1RPL A;  1N5W A;  3EYZ A;  5AI8 A;  3EZ5 A;  4QZB A;  3M9M B;  1PUZ A;  3PNC A;  2AGO A;  7ICK A;  4RQ1 A;  3PR5 B;  4IRK A;  3D2Q A;  5F9N A;  2UVW A;  8ICF A;  1VLB A;  2K89 A;  2HVI A;  5J0X A;  4DEZ A;  2L5Y A;  4M9G A;  5KFE A;  3T5K A;  4P0P B;  2XO7 A;  4J9P A;  1KDH A;  1S8O A;  4ED6 A;  3EWA A;  4Y2R A;  2BQU A;  5ALY A;  3HRD D;  1JX4 A;  1Y88 A;  3CYM A;  2W9M A;  4O3O A;  2QAR B;  1NJX A;  2N1R A;  1FEZ A;  3RJJ A;  9ICA A;  3TAD C;  3SAH A;  1DK3 A;  1X9M A;  2W43 A;  1T3N A;  2E8P A;  4M9J A;  4NWI A;  5JTI A;  4DSE A;  5KT6 A;  9ICE A;  4GC6 A;  5KG4 A;  3GIL A;  1GO3 F;  4M9L A;  2CRX A;  3QNM A;  2GH1 A;  5CHG A;  1MSW D;  1ZQY A;  2AH5 A;  4M6W A;  5CWR A;  2JEF A;  2ZIU A;  4RU9 A;  5EWF A;  1ZQT A;  4EYH B;  2I6X A;  5D46 A;  4US8 A;  3AN1 A;  3QUQ A;  3V6J A;  3H4D A;  3RH6 A;  3RJI A;  5J2K A;  5F3X B;  4IS7 A;  4Y2U A;  1QQ5 A;  1ZOL A;  5DGB A;  3QUT A;  2ZIV A;  4DL5 A;  2XIC A;  3A0H U;  3ZDB A;  4ELT A;  5J2E A;  4QWE A;  1MN8 A;  4QZC A;  3QEA Z;  4EX6 A;  7ICE A;  1P7D A;  1SKR A;  3RBD A;  2VJ4 A;  9ICX A;  8ICV A;  4F5O A;  4FS1 A;  2A19 A;  3RAQ A;  5ALL A;  4M6W B;  4TUS A;  4MFF A;  2ZIU B;  3QZ7 A;  1L8O A;  1RYS A;  2JH7 A;  4UB5 A;  2FMS A;  1Z00 A;  5KFJ A;  1L7O A;  4NV0 A;  1L3S A;  4IL6 U;  8ICY A;  5J0Y A;  2W9A A;  2ISO A;  1ZQC A;  4BXO A;  2IOF K;  4F50 A;  3ZDD A;  5AM2 A;  1CUK A;  2ASL A;  1K1S A;  7ICQ A;  3PO5 A;  1N2X A;  2DWQ A;  1ZRN A;  3QU4 A;  1O03 A;  1F44 A;  4BJQ A;  4C7Z A;  1IG6 A;  2ZIW A;  5AIA A;  4RNM A;  3M9O B;  2B0C A;  3LVV A;  7ICI A;  2BCQ A;  2YQE A;  1Z00 B;  2Q4T A;  1HJP A;  2OCE A;  3WKD A;  1KKX A;  2ZUD A;  1IV8 A;  2BQR A;  3CNH A;  1RG6 A;  4PZO A;  4DOA A;  4BXO B;  4DFK A;  4G9B A;  2RHF A;  4GXI A;  9ICF A;  1SWV A;  1ZQU A;  4Z6E A;  1T7P A;  2XY7 A;  4FS2 A;  2W11 A;  1Z1B A;  4TQS A;  4I29 A;  4R66 A;  2NRV A;  4HAI A;  5TZV A;  3CRX A;  4F4W A;  4PH5 A;  3QX7 A;  4DL7 A;  2ZIW B;  2XVT A;  5BPC A;  2QB1 A;  5KFR A;  1PVQ A;  4QZF A;  3V7L A;  1VJ5 A;  3U26 A;  4BWJ A;  2W9B A;  2F76 X;  8ICA A;  1TE2 A;  1JAL A;  1JRO A;  2HBL A;  3EUB 2;  3F2C A;  1WWV A;  4ECW A;  1K1Q A;  2UVR A;  5KFH A;  2W8K A;  2WAQ F;  1SGG A;  3GIJ A;  5ALE A;  5DQI A;  5T14 A;  1ZQI A;  3VCB A;  2EZX A;  2MSN A;  2KFN A;  4K4H A;  3WU2 U;  1KL9 A;  2VA8 A;  2NO4 A;  3FAH A;  4GIB A;  3WKB A;  3NGD A;  2PI4 A;  4RQ2 A;  5DBC A;  2W9B B;  2FDR A;  3THV A;  2R18 A;  4KLL A;  3OHB A;  1JRP A;  2NO5 A;  2NRW A;  5L9X A;  2GLE A;  3K1R B;  7ICS A;  1VDV A;  3WK9 A;  8ICB A;  3A0B U;  5J0S A;  2YMQ A;  2KHV A;  4F4K A;  3TAR A;  4IRC A;  2F1H A;  5ALU A;  4UQG A;  4ECS A;  3HWT A;  3C2L A;  4KLH A;  4I2G A;  2LYH A;  4DQQ A;  5KFC A;  3QYP A;  4J9N A;  5D49 A;  1N56 A;  4YMM A;  3F2D A;  4F2S A;  2NYV A;  3BDP A;  3WKA A;  3PX0 A;  9ICJ A;  2DQN B;  1FIQ A;  1WCL A;  1U4B A;  2NRT A;  7ICF A;  2WHE A;  1TKD A;  4EX7 A;  4Z6F A;  3RF9 A;  1UHU A;  1ZJN A;  5L1I A;  5KFZ A;  1X66 A;  7ICO A;  2FLL A;  1RYU A;  3RR7 A;  3E58 A;  4US9 A;  1L3T A;  4P4M A;  1TK0 A;  2OXO A;  3RH4 A;  3ORY A;  5J2J A;  3Q8K A;  4M04 A;  1B43 A;  4OJ5 A;  2W9C B;  4TUP A;  5KG6 A;  3Q8L A;  2ASJ A;  4Y2V A;  3PV8 A;  3I28 A;  4RQ8 A;  1KSP A;  2PFN A;  4C4S A;  2KIV A;  4KMO B;  3Q8S B;  1ZQW A;  1ZD2 P;  3CP8 A;  3WK8 A;  4EYI B;  4BGD A;  3UMC A;  4RQ6 A;  5KFW A;  3M8R A;  2C22 A;  9ICB A;  2RLT A;  4RUC A;  4DSJ A;  2G09 A;  4B6J A;  4O3M A;  4QW8 A;  2JZB B;  5KG2 A;  3RB6 A;  1LKY A;  4KX5 A;  1Z3E B;  3BS7 A;  2FLN A;  2CPR A;  2VKQ A;  3HPO A;  1WUD A;  4JUZ A;  3H8W A;  2AGP A;  2ODG A;  3UQ2 A;  1ZD5 A;  3AQF A;  1BNP A;  3SV4 A;  2H3V A;  1J2N A;  4UB8 U;  4KN7 A;  2IMW P;  4KLT A;  1SWW A;  3BQT A;  3ZDA A;  4PZN A;  5ALQ A;  3AM9 A;  2WF7 A;  3KHR A;  3QEB Z;  1Q46 A;  1LKY B;  3N28 A;  5KFB A;  3AU6 A;  3TFS A;  1KQQ A;  1XC9 A;  4MF8 A;  3BZK A;  5KTQ A;  4C8K A;  4NM1 A;  2XI9 A;  5AKZ A;  4PHP A;  5L1K A;  3N97 B;  4PPX A;  3TAD A;  4DFJ A;  1Q3V A;  1JN3 A;  4KTQ A;  3SAG A;  3QZ8 A;  3OJS A;  3GDX A;  2OH2 A;  4CF3 A;  1J2M A;  3N7P D;  4RQN A;  4F72 A;  2ALZ A;  1ZQB A;  1MC8 A;  3WK4 A;  1QQ6 A;  5AI4 A;  3GV7 B;  2Y1J A;  5AM0 A;  4GLX A;  7ICN A;  3B0X A;  4B9S A;  1ZQK A;  2IOH A;  1MQ2 A;  1KFS A;  5AM1 A;  1TAM A;  5D4B A;  4ICA A;  1SXE A;  2XY5 A;  4LZD A;  2XCA A;  1XNS A;  2FPL A;  3V7J A;  4O3S A;  2KFZ A;  2J6U A;  2AJQ A;  3N7R C;  4MHV A;  3ZD8 A;  2RDJ A;  1U48 A;  3RJH A;  2HSZ A;  4PL1 A;  1X40 A;  1N61 A;  1ZQP A;  1UA1 A;  2DGZ A;  3MGI A;  3OSP A;  1SB3 C;  2G08 A;  3KHG A;  2C28 A;  1NKC A;  1DGJ A;  5KFI A;  3AQE A;  3D6J A;  3AUO A;  4ECV A;  3CW2 C;  3WKC A;  4P4O A;  4UAS A;  1SZP A;  4R8U B;  3ETL A;  3PVX A;  1XO0 A;  1DXS A;  3VC8 A;  1CRX A;  4USA A;  3MAB A;  2UVV A;  2W55 A;  4Y2Y A;  4EEY A;  1LVH A;  2VA2 A;  3EPG A;  7ICJ A;  2EZZ A;  5DG8 A;  5ALN A;  1DOQ A;  3RB0 A;  1COK A;  2WF5 A;  4GFJ A;  4RNN A;  8ICZ A;  3ZI4 A;  3MGV A;  5KFP A;  5HNK A;  3M6K A;  4CE6 A;  2P66 A;  5KFS A;  3D2N A;  1ZQR A;  3ZD9 A;  5ALV A;  4YP3 A;  2R8J A;  4EEK A;  2E1E A;  2LKY A;  3MFH A;  2LYB A;  1WYG A;  2LBO A;  2WF8 A;  5ALO A;  3C5G A;  2HDO A;  2JMG A;  1Z4N A;  1X42 A;  4QWD A;  4KLM A;  1T8E A;  2IOF A;  1HUO A;  2KN7 A;  4LZG A;  5CA7 A;  2WAQ C;  2WF9 A;  5CB1 A;  1BPB A;  1ZQE A;  4IRD A;  4UBC A;  3JPP A;  4OJO A;  3ONN A;  5FP0 A;  5KFV A;  3G6V A;  7ICT A;  1LV5 A;  5J2H A;  1TV9 A;  4B9M A;  4QWB A;  5AKX A;  4DFM A;  2ZTD A;  4JB3 A;  1NK8 A;  4B9L A;  5J2G A;  4RT3 A;  2VJ5 A;  1L8L A;  3NAS A;  4DCC A;  3F5E A;  2YML A;  1XSP A;  3KD3 A;  4DOC A;  1S5L U;  3KKA C;  4KLG A;  5G5H A;  1O08 A;  2FE9 A;  4UB6 U;  3TI0 A;  3Q8R B;  3C1Z A;  3H8S A;  2BGW A;  1ZQH A;  4KMU A;  5B5E U;  2F1I A;  2QAR A;  9ICN A;  3KHL A;  3MR5 A;  8ICE A;  4CNQ A;  3PX6 A;  4YN4 A;  3JPQ A;  4XRH A;  1S76 D;  3HT3 A;  3WK6 A;  1RQN A;  4QZG A;  4K4G A;  5ALJ A;  4QZH A;  5KFG A;  5DB6 A;  1QCK A;  2JV3 A;  4DQS A;  2W54 A;  9ICC A;  2EAO A;  4UB1 A;  5AM4 A;  4JWM A;  1V38 A;  2E3T A;  4PL2 A;  4O5C A;  3SV3 A;  3OTQ A;  4NY8 A;  2J6S A;  4J03 A;  4Q45 A;  3G6Y A;  2EZY A;  4TUR A;  4EZ9 A;  4I2D A;  5KT5 A;  2CN1 A;  2IHM A;  1L7N A;  4Y2J A;  3QUC A;  2R8I A;  2KHQ A;  4QZE A;  2EAM A;  5KT4 A;  2FMQ A;  2RRD A;  2BPF A;  2GO7 A;  3GU3 A;  3C2M A;  4QIW F;  1TAQ A;  4JV0 A;  2KZM A;  3NVZ A;  2C2R A;  1FO4 A;  5DB9 A;  2LYA A;  3SAF A;  4RUA A;  1NZP A;  2KKP A;  3GIK A;  1M6Y A;  2KE7 A;  5KFM A;  1BPE A;  5EOZ A;  5C0Y A;  4F71 A;  2FI1 A;  4KLF A;  2M9N A;  2MUT A;  5H2F U;  3QU5 A;  2K8C B;  1ZYQ A;  2HBK A;  3PML A;  1ZQV A;  1T94 A;  4F5N A;  5AK3 A;  2BQ3 A;  2MAX A;  4YR0 A;  4YVZ A;  1N5X A;  4Y2Q A;  2C2D A;  1L3U A;  4DL3 A;  4JMU A;  2O6K A;  1BGX T;  3EW9 A;  4NLZ A;  3GIM A;  8ICS A;  2DFL A;  1S77 D;  2MUT B;  1D8B A;  4DS5 A;  3KZI U;  3BS5 A;  2KJ9 A;  3QU2 A;  5KFT A;  2KZ3 A;  1KTQ A;  2H3I A;  3GII A;  1S0M A;  5CRX A;  9ICW A;  4QZ9 A;  4X5V A;  2KNJ A;  4B9T A;  1BVS A;  3ISB A;  4DFD A;  5ALG A;  2W3S A;  4NLC A;  3QE9 Y;  1SKS A;  5IIJ A;  5IIO A;  3PSF A;  2BZF A;  4O0I A;  2VIX A;  5KFD A;  1Q8K A;  4YCX A;  1IM4 A;  4BDP A;  3SEN A;  4MFA A;  2KG5 A;  4UAW A;  2VA3 A;  3BS5 B;  3Q8M A;  3BQ2 A;  3NS1 A;  4ECY A;  3IN5 A;  5KT2 A;  4DWI A;  5KG5 A;  1DGS A;  3TQ1 A;  4IQU A;  2BHN A;  2YTU A;  1QSS A;  2EAP A;  5EE9 A;  3GZF A;  1L6N A;  4GXJ A;  4DOB A;  4IQV A;  3PO4 A;  3SZ2 A;  2A1A A;  2RP5 A;  3PW4 A;  2A1J A;  5J2I A;  3RBE A;  2YB1 A;  4Y2X A;  4QW9 A;  2JEG A;  2QB0 A;  1NNL A;  4YD2 A;  4RZR A;  3KFU F;  4QZA A;  4NXZ A;  2PMZ C;  2ZJA A;  4RPZ A;  1NK4 A;  5G5G A;  5KG3 A;  2Y0S C;  3MGH A;  3SYZ A;  5L1L A;  3RJK A;  2J6T A;  4JV2 A;  2DF4 B;  4JV1 A;  2DBY A;  3NUQ A;  2FMP A;  4MFC A;  9ICU A;  8ICN A;  2BR0 A;  1X9X A;  7ICL A;  2F44 A;  5J8Y A;  5ALH A;  2A1J B;  3QU7 A;  2B21 A;  1UT8 A;  2D3D A;  1OUQ A;  5ALR A;  4QZ8 A;  4FE3 A;  5J2A A;  3M7D A;  1N48 A;  8ICL A;  2QB0 B;  3H8J A;  3H8M A;  3L5K A;  3RRG A;  1SIJ A;  3K1Z A;  4DSF A;  3RJF A;  5EE3 A;  2JR5 A;  5JU5 A;  3B0Y A;  8ICR A;  3ZDC A;  2F77 X;  1ZQO A;  1NK6 A;  1N63 A;  1Z1V A;  5B66 U;  2W9C A;  3UQ0 A;  4DFP A;  1KRP A;  2PXI A;  4F8R A;  2HBJ A;  1FFV A;  2OHF A;  4AYB F;  2AXT U;  3M1Y A;  4C8N A;  5HR6 A;  2BCU A;  4IR9 A;  5L1M A;  5KAF U;  3IRU A;  2KD1 A;  2LM1 A;  5C5J A;  2JZB A;  2Y1I A;  1N62 A;  3SQI A;  2PFO A;  1S0N A;  4ELU A;  2DKZ A;  4NL9 A;  2RQ5 A;  2I9G A;  3SMV A;  3Q8Q B;  2KTQ A;  3JPS A;  1S0V A;  4ECZ A;  3MBY A;  5KAI U;  2JH1 A;  8ICX A;  1KEJ A;  4YD1 A;  5ALM A;  1SXD A;  2WTF A;  3PSI A;  2ISP A;  3Q8P B;  4EBC A;  4CRX A;  4UBB A;  3M6Z A;  3KKA A;  1LB2 B;  2I1Q A;  4UB4 A;  1T3Q A;  2XID A;  1QTM A;  5EE0 A;  4ELV A;  2MU2 A;  2G07 A;  5AKH A;  1ZD4 A;  3LDA A;  4ED7 A;  2WB1 F;  5TIS U;  1D8Y A;  1BPD A;  2PFQ A;  4RQM A;  4DL4 A;  5DG9 A;  5DG7 A;  1HUZ A;  3V6H A;  1X9W A;  4P2H A;  8ICP A;  2P35 A;  2JEJ A;  2E8O A;  4O3N A;  5K4L A;  3TAN A;  2KJ5 A;  2HHQ A;  3HKZ F;  2W03 A;  2NRX A;  4J9K A;  3HIL A;  3T5J A;  3WK7 A;  5J2F A;  5DBB A;  1L7P A;  1MQ3 A;  2HHT A;  4OJP A;  4QIW C;  3FM9 A;  5CEH A;  4Z6C A;  3HP6 A;  3GV5 B;  5KFU A;  2R8G A;  1KN5 A;  2ZXI A;  4O3P A;  3RFA A;  1HEK A;  4FBU A;  2DL0 A;  5J2C A;  2LI6 A;  8ICM A;  1XWL A;  3GFK B;  3LWL A;  3OJU A;  4CF4 A;  4Y2T A;  2H3Q A;  5J0T A;  3SEI A;  2EAN A;  2NRZ A;  4ED3 A;  9ICV A;  3HJE A;  2HOQ A;  3NVY A;  4I2J A;  2K4P A;  2W7O A;  5GTH U;  2F8L A;  3L3F X;  4LJX A;  3GQC A;  4UAZ A;  3PSP A;  4NM2 A;  1PK1 A;  4O5K A;  3UXO A;  5AKJ A;  3UM9 A;  3E0F A;  2G5H B;  2JGA A;  3H4B A;  1PVP A;  4R8U A;  1SZH A;  5EWG A;  1PK3 A;  3I76 A;  3K75 D;  1UT5 A;  1ZQF A;  4PHE A;  4I2E A;  1NKE A;  5ALK A;  3FDS A;  2BPC A;  3C29 A;  4KLD A;  4F5P A;  3E2E A;  3N7S C;  4I27 A;  4WJ3 B;  2Q0Z X;  1SV0 C;  4ED0 A;  3PW7 A;  2A3V A;  2BPG A;  2LHT A;  1RYR A;  5KFL A;  1PK1 B;  5J29 A;  4Z6D A;  3TAC B;  1ZQQ A;  4MF2 A;  2KMD A;  3ALR A;  3WK5 A;  5ALP A;  1RM6 C;  4CDG A;  1NK0 A;  2OWO A;  3QXG A;  1XS9 D;  2WFA A;  4M9N A;  2LMR A;  5IIK A;  2R8K A;  5CJ7 A;  1C7Y A;  4EZ6 A;  4C80 A;  3IHQ B;  4M0A A;  5HMM A;  4QWA A;  2ZG6 A;  1XU4 A;  2OM6 A;  4C4T A;  1NK5 A;  1TFR A;  2PMZ F;  4CCH A;  4C7Y A;  3MR6 A;  4XQ8 A;  3KHH A;  5J0O A;  2HW3 A;  1U45 A;  3AMZ A;  3T3F A;  2Y0S F;  1QH9 A;  9ICM A;  3H0M B;  5ALZ A;  4I2H A;  4Q44 A;  4C4R A;  4FO6 A;  1JI7 A;  3IM1 A;  2B6G A;  4G3I A;  3MFI A;  3ETR A;  3BJY A;  5L1J A;  5KT7 A;  4F4Y A;  3RRH A;  5AKY A;  4DL2 A;  4JWN A;  1BPZ A;  3KTQ A;  2KIW A;  2HHU A;  5F9L A;  5KT3 A;  5KFY A;  3D2S A;  2JHD A;  3R9K A;  1V9P A;  4OJL A;  5J0U A;  2ZIX A;  9ICP A;  1YZ7 A;  3L4P A;  4F5Q A;  1NKB A;  3S6J A;  2DKX A;  4YG2 A;  4MEX A;  4BUG A;  3PW0 A;  4J9R A;  2K4E A;  3PMN A;  4IC9 A;  5AIB A;  4UAT A;  3UXN A;  1X6J A;  3ZDE A;  8ICQ A;  1SL1 A;  3MC1 A;  4DSK A;  2AHO B;  4ZH4 A;  5AI0 A;  5III A;  2HOI A;  3ED5 A;  4XUS A;  2UVU A;  3PY8 A;  2FPK A;  3DDH A;  1CEZ A;  4PJ0 U;  9ICL A;  2ZIX B;  1ZQX A;  3QU9 A;  1TK8 A;  5KFK A;  2BCV A;  5AK5 A;  5DB8 A;  2G5I B;  4TQR A;  1TAU A;  5DBA A;  2D6F C;  1YT3 A;  4O9M A;  3BZC A;  2ES6 A;  3OSN A;  4AYB C;  2FJ6 A;  2IA6 A;  2GOL A;  2HHS A;  4J9S A;  1WWU A;  2LPE A;  3TAQ A;  2P6U A;  1IIP A;  2BKE A;  4F91 B;  3B9J A;  1NJZ A;  7ICV A;  4RQ5 A;  2OEH A;  2AQ0 A;  3NVV A;  4RT2 A;  2EH9 A;  1ZQD A;  1ZQS A;  3KZX A;  3PZP A;  2EQY A;  4Q8E A;  3C21 A;  9ICT A;  4PGX A;  2ZTC A;  1BPX A;  1ZRM A;  4F5R A;  2DPJ A;  4ECQ A;  4UAY A;  4LVS A;  2MA1 A;  2QLT A;  3JPN A;  1U49 A;  1D9D A;  1F0M A;  2F3N A;  2FPM A;  4KX3 A;  2DUY A;  4F4X A;  1A6S A;  1L3V A;  2F1J A;  4CF5 A;  5KG1 A;  2WB1 C;  2IBK A;  4FZM A;  4AP9 A;  2ZJ8 A;  5ALS A;  2JEI A;  5DDM A;  4QJF B;  1SV4 A;  2ZUB A;  5DLG A;  4EEL A;  4F4Z A;  1ZQM A;  2KK0 A;  3T79 A;  3HKZ C;  4CGZ A;  1ZQJ A;  4O5E A;  4C8L A;  7ICR A;  1TK5 A;  4KLE A;  4K4I A;  2XY6 A;  2D8C A;  1F5S A;  1ZQA A;  2KJ8 A;  3PST A;  2KVS A;  1S10 A;  3RJG A;  4F92 B;  4I2I A;  5KNI A;  5KFQ A;  2ASD A;  2V9W A;  4FZL A;  3ISC A;  3J81 j;  2E5S A;  5IIN A;  4P0Q A;  2QKQ A;  1NK9 A;  4I2C A;  8ICH A;  5AKI A;  4KLU A;  2CXY A;  4DSI A;  5DB7 A;  2XGP A;  2K60 A;  1D8L A;  3NRZ A;  1J97 A;  4UAV A;  2HHW A;  2NV3 A;  4PHD A;  4DF4 A;  7ICP A;  1JMS A;  5KL1 B;  1MA7 A;  3RJE A;  2KKV A;  4QNL A;  1UA0 A;  1DK2 A;  7ICH A;  1HIW A;  2ZIV B;  2E8M A;  3RB4 A;  3ICX A;  3NRW A;  4Y2S A;  5ALI A;  4DO9 A;  4XA5 A;  5BOM A;  4B9U A;  2K4H A;  4M2Y A;  2YY6 A;  4P0Q B;  3F2B A;  1JXL A;  1QSY A;  1ECW A;  2V4Q A;  4PGQ A;  1N60 A;  9ICG A;  2EDU A;  2F2A B;  1ZJM A;  4DL6 A;  4PGY A;  2WF6 A;  1WG8 A;  2F8K A;  5J0R A;  2DPI A;  4MEY A;  5ALX A;  2FLP A;  3IG8 A;  2Z7J A;  5BOL A;  4KLQ A;  3C2K A;  4RQ7 A;  2V4R A;  4J9M A;  4ECT A;  3WKE A;  4OD0 A;  2AQ4 A;  1SV0 A;  1COO A;  3ISD A;  3JPT A;  4RPY A;  2M0N A;  1NI3 A;  2W7P A;  1ZQ1 C;  3C5F A;  1A0P A;  5HHI A;  2ESE A;  1SKW A;  5HR7 A;  2BDP A;  4KN4 A;  1KLN A;  3UMG A;  5KFX A;  5JRT A;  4KLJ A;  1SL2 A;  1WCN A;  2XGQ A;  3PW2 A;  2HMX A;  3PX4 A;  8ICJ A;  3LVW A;  3UMB A;  2W3R A;  3T5H A;  2HHX A;  2HHV A;  1RDF A;  1UCV A;  2K8B B;  2H3F A;  5KFF A;  1OXJ A;  1B22 A;  4M47 A;  5EE1 A;  2KZZ A;  8ICW A;  2K4I A;  1KFT A;  3BQ1 A;  2LM4 A;  1ZET A;  3JPO A;  1ED1 A;  4E0D A;  5KFN A;  4B9V A;  3BQ0 A;  5DDY A;  1KBU A;  4J9O A;  3TKA A;  4DLG A;  4Q43 A;  4B9N A;  3RR8 A;  2HOF A;  1B4F A;  3AU2 A;  1URJ A;  4QWC A;  2I5H A;  1OW5 A;  4EBD A;  3RH5 A;  3F53 A;  4IQT A;  5KL8 B;  5J0Q A;  4C8M A;  5CR0 A;  3MDA A;  5AI5 A;  4YMN A;  3TFR A;  1NJW A;  3F5A A;  1RZT A;  2KP7 A;  2IHN A;  1ZXI A;  5AHX A;  4ACO A;  1A76 A;  3RB3 A;  4RPX A;  3H7I A;  3PR4 A;  1Z19 A;  1ZQG A;  4FFD A;  5GTI U;  4U7C A;  5DGA A;  8ICK A;  3K4G A;  3MDC A;  4YR2 A;  3LK9 A;  5AM5 A;  1JXE A;  2JRZ A;  1JIH A;  4YR3 A;  4OCZ A;  3LYS A;  4R63 A;  5AI6 A;  2ATL A;  5AKE A;  8ICO A;  9ICK A;  2YMM A;  2H3Z A;  1CI4 A;  3H0L B;  1H38 A;  1NK7 A;  2KOB A;  3M9N B;  4RQ3 A;  1T4G A;  2GWS A;  4M9H A;  4JK1 A;  1IXR A;  4UB2 A;  4EBE A;  2G0A A;  1DRG A;  8ICI A;  4EEN A;  5AKK A;  4RQ0 A;  4DSL A;  2AU0 A;  3O0F A;  1KFD A;  5DKW A;  3FYH A;  1K5O A;  5AM3 A;  2KVC A;  5KG0 A;  4U6P A;  4YFK A;  4PHA A;  4UW9 A;  3IDW A;  4FBT A;  5E79 U;  5IIL A;  4YXM A;  2ZUC A;  1PZN A;  4R64 A;  5A0L A;  3AEV A;  1PVR A;  3V7K A;  2E1F A;  5DQG A;  5CP2 A;  1TVA A;  4YQW A;  3SR6 A;  1A77 A;  4DQI A;  2R8H A;  1S9F A;  1XSN A;  1ZQZ A;  1ARO P;  5AKL A;  3RTV A;  3AL0 B;  2Y9U A;  3V6K A;  4DF8 A;  4DQR A;  8ICC A;  1SL0 A;  1BPY A;  4OJ6 A;  1ZQL A;  5ALD A;  5J0P A;  3OPX A;  1UQV A;  3DV9 A;  2KSO A;  4F3O A;  3C23 A;  4KIT B;  3RAX A;  1YZ6 A;  2BDU A;  4O3Q A;  3UXP A;  9ICO A;  2W04 A;  2YN4 A;  1NJY A;  1S97 A;  5ALT A;  4HYK A;  1X2I A;  2HVH A;  2KV2 A;  4BX9 C;  3N4M B;  2G06 A;  5EWE A;  3SD7 A;  1QQ7 A;  2OYY A;  1QLN A;  4C8O A;  3IP4 B;  1RXW A;  5AK4 A;  4DLE A;  2K8A A;  1L7M A;  5J2D A;  5DQH A;  2XC9 A;  3IG5 A;  4ECR A;  2AGQ A;  2PKE A;  9ICQ A;  3PW5 A;  2PFP A;  4UB3 A;  2KSO B;  5J2B A;  1QSL A;  5HP4 A;  1U47 A;  2MRL A;  1L5U A;  9ICR A;  2HBM A;  1NZB A;  4A8E A;  2PI5 A;  5AKG A;  1JUD A;  4ED1 A;  5KFO A;  4J9L A;  4Q8F A;  2VAN A;  4IR1 A;  3JPR A;  1EXN A; 
#chains in the Genus database with same CATH homology
 2EAN A;  1V85 A;  2K4P A;  2E8M A;  1SGG A;  1B4F A;  1X40 A;  1KW4 A;  2KE7 A;  2YTU A;  1OW5 A;  1PK1 A;  2DKZ A;  1LKY A;  2EAP A;  4NL9 A;  3BS7 A;  1F0M A;  2F3N A;  3BQ7 A;  3KKA C;  1PK3 A;  1SXD A;  2L5Y A;  5J8Y C;  2F8K A;  2FE9 A;  2DKX A;  3KKA A;  1DXS A;  2GLE A;  3K1R B;  2Y9U A;  4PZN A;  2QB0 A;  2QAR A;  1SV4 A;  1SV0 C;  2E8N A;  1UQV A;  2KSO A;  1COK A;  2QAR B;  1PK1 B;  4RQM A;  1LKY B;  1SV0 A;  3TAC B;  2KMD A;  3TAD C;  2E8P A;  2D8C A;  1X9X A;  2E8O A;  2JV3 A;  2F44 A;  2EAO A;  5J8Y A;  3BS5 A;  2ESE A;  5JTI A;  1V38 A;  3TAD A;  1RG6 A;  4PZO A;  2D3D A;  2LMR A;  5JRT A;  5KNI A;  2QB0 B;  3HIL A;  3H8M A;  4RQN A;  1X66 A;  2ES6 A;  5JU5 A;  4NL9 C;  2KSO B;  1Z1V A;  1WWU A;  2QKQ A;  2Y9T A;  2LPE A;  2QB1 A;  4NJ8 A;  1UCV A;  2K60 A;  1B0X A;  2EAM A;  1OXJ A;  1SXE A;  2KIV A;  5F3X B;  4IS7 A;  3SEN A;  2DL0 A;  2KG5 A;  5L1M A;  1WWV A;  3BS5 B;  1JI7 A;  3IDW A;  2B6G A;  3SEI A;  4MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...