1RG6A

Solution structure of the c-terminal domain of p63
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
PTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal domain of p63
rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords second splice variant p63
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1rg6A00
1V85A 3IDWA 4RQNA 3K1RB 3BS7A 3TADA 3BQ7A 3TACB 1SXEA 1OW5A 5JTIA 2FE9A 2L5YA 1PK3A 4NL9C 3KKAC 2QARA 5KNIA 1KW4A 2QB1A 2E8NA 2F8KA 2ESEA 2KG5A 2K4PA 1X66A 1X9XA 2K60A 5J8YC 2DKZA 2F44A 2GLEA 1UQVA 2DL0A 2D3DA 3H8MA 1JI7A 1WWVA 1V38A 1LKYB 5F3XB 2Y9TA 3BS5B 2Y9UA 3TADC 1SV4A 2KMDA 4IS7A 2EAMA 1SGGA 2EAPA 2QKQA 4MHVA 2KSOA 5J8YA 2QB0A 1SV0C 3HILA 4PZNA 3SEIA 1LKYA 2DKXA 3BS5A 1B0XA 3SENA 2KIVA 4NL9A 5L1MA 2E8PA 1SXDA 2EANA 2KE7A 5JU5A 2YTUA 1F0MA 3KKAA 1PK1A 4NJ8A 1DXSA 1OXJA 2KSOB 2QB0B 2LMRA 2EAOA 2JV3A 1Z1VA 4PZOA 2E8MA 2D8CA 4RQMA 2LPEA 1B4FA 2F3NA 2B6GA 1RG6A 2ES6A 1COKA 1PK1B 1X40A 1SV0A 1WWUA 5JRTA 1UCVA 2QARB 2E8OA
chains in the Genus database with same CATH superfamily
2GWSA 4EX7A 2H5XA 8ICCA 3BQTA 5AIBA 3G6VA 5J29A 2KZ3A 5KT5A 4M04A 4UARA 3M9MB 3PR5B 2FE9A 1VDVA 4BGDA 3QU2A 5KNIA 4ECVA 1U4BA 4I2JA 4I2BA 4A8EA 4XQ8A 2BCUA 5KAFU 4I29A 4DQSA 1BPZA 4O3RA 4DEZA 5A0LA 2JXJA 2HOFA 4CCHA 3A0HU 5T14A 4B9NA 4O5EA 1WWVA 4KLHA 3RH5A 1NNLA 3UXNA 4KLGA 2Y9UA 2BCQA 5ALXA 1PVRA 4F72A 2BPGA 2WF5A 4E0DA 3BQ1A 3JPNA 5GTHU 7ICNA 3C2KA 2IA6A 8ICKA 4JB3A 2B21A 5KL8B 5JU5A 3RBEA 2WF7A 3AQEA 4PGYA 1T7PA 3PW7A 3C5FA 3KHHA 3RFAA 2ZIWB 4QW9A 3QNMA 2HI0A 5KT7A 4I2DA 3D2SA 2RLTA 5AI0A 1YZ7A 4QZIA 2PMZF 5KFPA 3IHQB 2JMGA 7ICRA 4IRDA 5KFWA 4FS2A 3SAFA 1CI4A 3K1RB 4CF4A 3SV4A 3BQ7A 3QUQA 4C8OA 4UAZA 3JPQA 1ZD2P 3JPSA 1X6JA 3D2NA 3MR2A 5AKXA 4J9LA 8ICLA 4C80A 4FZMA 1MC8A 3PMLA 4R66A 3V6HA 1OUQA 1ZQVA 3I28A 1ZQDA 5J8YC 2PFOA 2P66A 3H4BA 3ALRA 1SL0A 1ZXIA 3M8RA 3V7JA 3KD3A 1NJXA 4JUZA 4CE6A 4EX6A 4PGQA 1SV4A 5KFKA 3I1YA 1S77D 5B66U 2QKQA 1XC9A 4UW9A 4NM2A 4F93B 2HBMA 2E1FA 3HILA 3UM9A 5KFHA 4EBDA 4EEKA 2PXIA 1S5LU 4C4RA 3AU6A 1B0XA 3M1YA 5J2HA 2EZXA 4EYIB 4Q44A 1HJPA 3NVWA 1KSPA 2LKYA 5KFVA 1MQ2A 3TAPA 3L5KA 2JEGA 4EBCA 4HAIA 3H8JA 8ICSA 2KJ9A 5BOLA 4KLQA 2EAOA 4EELA 4QZDA 1NK4A 1PVQA 2D8CA 3IV6A 5TZVA 3FM9A 5ALNA 3ZDEA 2ZTEA 2YMQA 5L1JA 1COKA 5ALRA 5J0PA 1NOMA 3NVYA 3RJKA 8ICYA 4KLJA 4DWIA 3T3FA 1QSYA 5HNKA 2ODGA 4C8NA 2KHVA 3IDWA 5KTQA 9ICSA 5DG7A 3C28A 2C2DA 1WG8A 3THVA 4F4KA 4KLEA 2ISPA 5CA7A 2ASLA 4KLOA 1FEZA 1ZQHA 3UMCA 1L7NA 2ZJAA 2QARA 4K4IA 1KTQA 3H0MB 2HHTA 3RJFA 1Q8KA 3NUQA 3QUBA 3PVXA 2N1RA 3WK5A 3OJSA 9ICOA 3MABA 2K60A 2DUYA 3BQ0A 4CF5A 2JZBA 3GV8B 2HMXA 1QH9A 2EH9A 2R8IA 4P0PA 9ICTA 3GV5B 5J2BA 4PPXA 5J0WA 1O08A 2PMZC 9ICHA 2LBOA 4O3MA 2LHTA 1SWWA 1ZQCA 4QIWF 2E5SA 4IQWA 4DS4A 4EYHB 2RQ5A 4XA5A 3KZIU 5KFJA 1SGGA 4RQ7A 2HHXA 2F76X 3N7RC 3ETLA 2BCRA 4DFPA 4NL9A 2K8BB 2XY7A 3QU5A 3F5AA 2HHVA 1TVAA 2Z7JA 5AIAA 1BPXA 2OH2A 7ICTA 9ICBA 2BDUA 4FBTA 2WTFA 4IL6U 4OJPA 2ZXIA 4KMOB 2FMQA 2V4QA 4PZOA 1LVHA 4O3NA 4KLUA 4RNMA 1FO4A 2WB1C 4RUAA 1RXWA 3RF9A 2Y1JA 4I2FA 1QQ7A 3EYZA 5HR7A 5KL1B 4RQ6A 2VKQA 2UVVA 3UQ0A 1COOA 1XSLA 4G3IA 4RNOA 1T4GA 3H8SA 1C20A 3F5EA 1N5XA 1C7YA 2WF8A 4O5CA 3GILA 1PUZA 1ZQXA 2I6XA 1D8BA 2HOIA 3SAGA 4RQNA 3PSTA 2GH1A 5F9LA 3H7IA 2LI6A 3QXGA 4ELUA 5KFRA 5AI5A 1SXEA 1RDFA 5BOMA 2IHNA 1TAUA 1H38A 5IIOA 2PFPA 2YB4A 4YG2A 4M9JA 2EDUA 4GIBA 4F5RA 2KZZA 2WAQC 1HIWA 1ZD5A 5HHHA 1V97A 4B9SA 2FLNA 2ZTCA 1ZOLA 3RRGA 1HEKA 4UATA 3DV9A 1KQQA 1ZQPA 1UHUA 5AI9A 3RH4A 2NO5A 1YZ6A 1Z19A 2DKZA 1N5WA 4QJFB 1ZQLA 3QUTA 3Q8MA 4PL1A 3QU7A 1Z4OA 2FMPA 1UA0A 9ICIA 3UQ2A 2BHNA 4RQ8A 3HW8A 1ZQJA 4QZCA 3RB3A 4RPZA 4B9LA 4OD0A 4YR2A 1DK2A 4F5NA 3Q8PB 4NLNA 2EZZA 1L3SA 3WKDA 4CF3A 4MHVA 3ONNA 3CNHA 3GIIA 1WCNA 4RQ3A 1MSWD 3D2QA 5KFZA 5B5EU 4QZ9A 3PR4A 2H3QA 8ICJA 3M9OB 4KX3A 5J0OA 4CNQA 5AKIA 5KFTA 3MGVA 5AKEA 4ED2A 3PO4A 4AYBC 5DG9A 1V9PA 2KKVA 5JRTA 1BVSA 2VJ5A 1NKEA 3AN1A 3C29A 2DQNB 5ALEA 1U48A 3TANA 3B9JA 2HHWA 3V6KA 5AKJA 4MF2A 1NJYA 4F8RA 2A19A 1MQ3A 1PZNA 2FLPA 3LWLA 4RQ4A 5ALSA 4DSJA 4GC7A 9ICRA 3RJHA 1RYSA 3ZDAA 3GZFA 4QZFA 3ZDCA 5J0YA 8ICFA 1D8YA 2ZUDA 5AK4A 5HHIA 3QU9A 2PKEA 1L3UA 2YB1A 8ICXA 3WKBA 5DB7A 2D3DA 3QU4A 2IOFA 5CHGA 4YFKA 2W3SA 1PVPA 3E2EA 2K8CB 2NYVA 3RTVA 3BQ2A 1DRGA 5AI6A 5KG1A 4J9OA 5KFFA 2AGOA 4MFCA 3M9NB 2MU2A 7ICFA 3UXOA 2ZTDA 1JXLA 1BNOA 5IIJA 3E0FA 3SENA 2YX8A 3UMBA 5J2AA 5KFEA 5L1MA 3MDAA 7ICVA 5KFGA 7ICIA 5KT3A 5J0TA 1NJZA 5KFLA 1PK1A 4R8UB 3M8SA 5CR0A 1NK9A 1TFRA 3MR6A 1BPYA 4I27A 3OPXA 1CEZA 2FDRA 2W9BA 1Q46A 2KP7A 4DFDA 4DSFA 1B22A 2VANA 1DGSA 3IM1A 4Y2UA 5JUMA 4I2IA 4DQRA 4DOCA 5AK6A 1WWUA 4G9BA 1UPHA 4I2CA 1QTMA 2QARB 1RXVA 3NASA 5KFDA 4UAWA 3ISDA 2BR0A 2XY6A 2G09A 4Z6DA 4NLZA 5AM4A 4F4ZA 2YMMA 5J0UA 2MA1A 4PJ0U 2W9AA 4YD1A 4PL2A 5AM1A 4P4MA 2L5YA 4QNLA 4Q45A 3BZKA 5AM2A 4F4WA 7ICLA 4YR0A 2HBLA 2RDJA 1BPBA 1A77A 3TQ1A 4O0IA 5EE3A 3B0YA 2ZUBA 3U26A 8ICVA 2KEYA 2CN1A 1Z1BA 1QSSA 1RPLA 2DL0A 9ICXA 1Z4NA 1IV8A 1L8OA 3WK4A 1IM4A 2WB1F 5J2JA 8ICUA 5ALGA 4B9TA 7ICQA 4RNNA 3BZCA 5K4LA 4O3QA 2XCAA 2FPLA 2DBYA 1N60A 1L6NA 2H3IA 1KFTA 8ICOA 4C4SA 2EAMA 2IOHA 1SL2A 2EAPA 4JK1A 3AU2A 1UT8A 3WK6A 1DK3A 2BPCA 2BGWA 4IQUA 3BS5A 2IMWP 2NRTA 4LVSA 2DF4B 4F2RA 1SXDA 3LWMA 2OWOA 4MFAA 5ALQA 4DSIA 2YTUA 4BWMA 1MA7A 5KFIA 3NRZA 5CB1A 4I28A 2ZUCA 1IXRA 4KLLA 9ICPA 5ALDA 3Q8RB 2ZIVA 1JALA 2I5HA 3VCBA 5ALOA 2J6SA 4ZH4A 3RBDA 2OYYA 2E1EA 5KG2A 3HPOA 4DFMA 2E8OA 3V7LA 5AKLA 3GV7B 2W03A 2HBJA 2MSNA 5ALKA 1XSPA 4O3SA 4B9MA 3TADA 7ICGA 2W04A 3H0LB 5DGBA 4M9GA 2M9NA 1ZD4A 1N56A 3L3FX 4Q8EA 5DDYA 3SR6A 3RR7A 2QB1A 4YN4A 1EXNA 2W9CA 4QZ8A 3TAQA 4KLDA 5L1LA 3TFSA 1K1QA 4DQPA 2BZFA 2W11A 4ELVA 2DWQA 4NWIA 4FZLA 4NV0A 3S6JA 2HW3A 4IR9A 7ICEA 5BPCA 2AQ4A 5F3XB 2AGPA 2FJ6A 1X6IA 5DBBA 5KG7A 1J2MA 3TADC 9ICWA 5E79U 3I76A 2H3ZA 8ICEA 4Y2SA 4R65A 4UQGA 2R18A 4UB4A 3CRXA 3PX4A 2ZIXB 2DKXA 4J9NA 3RRHA 4BUGA 5DB9A 4F5PA 2NRVA 4PHDA 2Q0ZX 1WYGA 3SD7A 1F5SA 5IIKA 3F2CA 3PSFA 1DXSA 3V72A 1OXJA 2K89A 3OSNA 2KSOB 2AQ0A 4DFJA 3J81j 2JV3A 5DQGA 3RJGA 1NK7A 2B6GA 2R8HA 1NKBA 5AK3A 9ICLA 4BJQA 5HR6A 4QWAA 4J03A 5CEHA 1ZETA 4NLBA 4QZGA 4JV1A 4P0QA 1ZQTA 3BS7A 5J2DA 3AUOA 4YVZA 1N61A 2HHQA 1ED1A 4O3OA 2XGQA 3F2BA 1BPDA 4C7ZA 2KFZA 4DSLA 2BCSA 2DFLA 1JX4A 5ALTA 2A1JB 3EUB2 2C22A 2LM1A 4RT3A 4IR1A 1L5UA 2FI1A 4YMOA 1LV5A 2FPMA 2RRDA 2G5IB 2Y0SF 4P2HA 2LYHA 3WK8A 1SL1A 2BQRA 8ICPA 4IQVA 3LVVA 5KG5A 1ZJNA 2XCPA 1JI7A 5KFAA 1NI3A 2EZYA 1MN8A 2O6KA 1T8EA 4GC6A 9ICAA 1LB2B 4Y2YA 1RQLA 5H2FU 1TAQA 2AJQA 4KLSA 4YR3A 3ED5A 2F1HA 5J8YA 1SV0C 3B0XA 4B9VA 4PZNA 3SEIA 1LKYA 2VA3A 3CYMA 1B43A 4Y2PA 3GQCA 2XVTA 2E8PA 5J2GA 2KFNA 2W9MA 1KFDA 2C28A 4YD2A 4Q43A 3NVVA 1HUOA 5AM3A 4UAYA 4MFFA 3RAQA 4GLXA 4Z6FA 4ED3A 4QZHA 1KKXA 3C23A 4C8KA 1BNPA 3QZ7A 2R8JA 1ECWA 8ICMA 4ED1A 3N97B 1RG6A 2ES6A 4RQ5A 2HHSA 3H8WA 1QQ6A 3L4PA 9ICEA 4R63A 1XWLA 2KV2A 7ICKA 2W9CB 2KVCA 2UVWA 1ZQKA 4AP9A 1TK5A 2YMLA 4IRKA 3LYSA 4NL9C 1BGXT 3T5KA 2C2EA 1RQNA 1VJ5A 4Q8FA 4QWEA 2ZIUA 1HUZA 5DQHA 4ICAA 3M7DA 4NLCA 3IRUA 3WK9A 3H8MA 5KAIU 4TQRA 3TKAA 3GDXA 3WKEA 4YCXA 9ICQA 4NXZA 4PGXA 3LDAA 2KMDA 2P35A 1J2NA 2AU0A 5KT6A 4IS7A 2BDPA 1RYUA 2K4HA 5J0SA 3PX0A 3KTQA 3RJEA 1ZJMA 1NZPA 3TARA 1T94A 4UB6U 3PO5A 5HP4A 2NRXA 2JGAA 3D6JA 4MEYA 3K4GA 2KN7A 4DCCA 1WCLA 3C5GA 2NO4A 1FIQA 2JEJA 2B0CA 2DPJA 3KHLA 3OTQA 2LYAA 1XSNA 5KT2A 4UBCA 4DLGA 7ICHA 2F1JA 4OJOA 2OM6A 1N2XA 3T5HA 4PHPA 4DL2A 1Z00B 2C2RA 4ELTA 5EWEA 3ZI4A 3V6JA 7ICUA 4I2GA 5AKHA 1ZYQA 4NM1A 5KFYA 1ZQOA 1TAMA 1SKSA 2WFAA 4NLKA 1OW5A 2XIDA 5JTIA 5ALUA 5AKKA 7ICJA 3GU3A 5J0XA 4NLGA 4FBUA 3MFIA 9ICCA 4UB8U 3RB6A 2W7PA 4OJ6A 1UT5A 4QZBA 3EPIA 5DB6A 1VLBA 2KK0A 5ALZA 3IG5A 2XY5A 4XUSA 4C8LA 2ESEA 4DL7A 1XO1A 1XO0A 2HBKA 3N4MB 2KTQA 1X9XA 5KFNA 4UB5A 2HHUA 2HVHA 4JV2A 2HVIA 1T3QA 4M9HA 1V38A 1LKYB 4J9MA 3QEBZ 2G0AA 2MAXA 3SAHA 5DDMA 2K8AA 2ZJ5A 3EWAA 5ALFA 1ZQGA 2HDOA 4PH5A 3AM9A 3UMGA 4RZRA 5F9NA 4IRCA 3RB4A 3MGIA 4DOAA 5J2IA 4Y2JA 3QZ8A 4FZNA 4R64A 2FPKA 1N48A 2MUTA 1URJA 1ZQSA 2KE7A 4MF8A 4LJXA 4CGZA 4YMMA 2EQYA 5D49A 1RZTA 3KZXA 4K4GA 4US8A 2GOLA 5AICA 1A6SA 2QB0B 3PMNA 2DPIA 3F2DA 3T79A 3FDSA 3PSPA 2KD1A 4ECWA 5DQIA 4RUCA 4YP3A 2XC9A 1AQ6A 2G5HB 5DKWA 4BXOA 4ECXA 2RP5A 4EEYA 5KFOA 5CRXA 5AKGA 5IIMA 3ETRA 3MFHA 1IIPA 3ZDDA 2KOBA 5DBCA 4J9RA 5J0RA 4ECUA 1PK3A 2RDIA 4F71A 2OEHA 3MBYA 1SZPA 4U6PA 1Z00A 3EW9A 5J2FA 3PY8A 5KFMA 5EWFA 1KW4A 2AXTU 1JMSA 2HSZA 4M0AA 3BJYA 2PI5A 3V7KA 9ICJA 3H0RB 2F8KA 3SI8A 2KG5A 2K4PA 1N63A 3IP4B 4O3PA 5G5GA 4YXJA 4ED6A 1L8LA 1X9WA 2XICA 4DS5A 4HYKA 2VIXA 2JR5A 4USAA 3C2LA 3HRDD 4M6WB 3PNCA 4AYBF 4ACOA 4EZ6A 3M6KA 1ZQEA 1ZQYA 3K1ZA 5KFCA 4TURA 3HKZF 2JH1A 1RM6C 2VA2A 2D6FC 5KG4A 3RAXA 2LYBA 4PHAA 1KBUA 3FAHA 3PV8A 3EPGA 8ICGA 8ICNA 2CPRA 1S76D 1L7MA 3SMVA 1QSLA 2KKPA 3WU2U 2BPFA 4ECYA 2LPEA 1FFUA 1S8OA 8ICAA 1B4FA 1JUDA 2KIWA 5CJ7A 1QCKA 2YMPA 4KX5A 4KTQA 4B6JA 2JEIA 3JPPA 2QLTA 2R8KA 2ZIUB 2ZIVB 5ALVA 1S0OA 3T5JA 2W54A 2G08A 2OXOA 1U45A 5AHXA 2ISOA 2F77X 4KITB 3KHGA 4DQIA 1QQ5A 4KLIA 5DBAA 2RHFA 5ALWA 1SB3C 2WAQF 7ICOA 2G06A 5D4BA 4LZGA 5AKZA 5AI8A 4O9MA 4DLEA 1U9LA 4DF4A 3QYPA 3OJUA 4M2YA 4KMUA 4EBEA 2KICA 4ECZA 4DL6A 3IN5A 4MEXA 4RQ0A 2P6RA 5J0QA 2MUTB 9ICUA 1ZQAA 2JZBB 2VJ4A 2F8LA 3DDHA 4GXJA 1XNSA 1ZQIA 3UXPA 3N7PD 2HCFA 2BQUA 2FLLA 2W8LA 1ZQUA 1K5OA 4U7CA 2ZXHA 1L3TA 2IHMA 4FS1A 2P6UA 3UPQA 3MC1A 5ALIA 1D9DA 4XRHA 1NK6A 3E58A 3HT3A 2ZIXA 1X42A 3MR3A 1Z1VA 4F4XA 1ZQWA 2GO7A 4C0ZA 3QEAZ 2YQEA 2K4EA 1XS9D 2Q4TA 2ZG6A 5DB8A 1AROP 3WKCA 9ICGA 2HOQA 2A3VA 2W7OA 3Q8SB 2PI4A 4M47A 1X40A 1SV0A 4TQSA 1UCVA 3KFUF 4UAUA 1DGJA 3RR8A 3HJEA 3QE9Y 3R9KA 3RJIA 4F91B 3T5LA 1NKCA 3GIKA 2WHEA 2E3TA 2JRZA 1O03A 2NRWA 4OJ5A 3KKAC 1KLNA 4P0PB 5KFBA 5EOZA 4BX9C 4UB2A 5ALMA 1CUKA 4Z6EA 5EE0A 1Z3EB 2VA8A 4C8MA 2KJ5A 2V9WA 2W3RA 1ZQMA 3OHAA 1KN5A 7ICMA 1TKDA 3C1ZA 3PW0A 2G07A 3ZDBA 4I2AA 3CW2C 3ZD9A 4US9A 3PW5A 3AQFA 4ECTA 3BS5B 3PX6A 5ALLA 5HMMA 2KVSA 3LVWA 3NRWA 3O0FA 1KEJA 4BWJA 5IILA 2WF9A 5J2CA 9ICVA 1KFSA 5C5JA 3TFRA 1S0NA 5J2EA 2KZMA 1NJWA 4ECRA 4ECQA 3KBBA 1TK0A 4F3OA 4Y2VA 3NTUA 2OCEA 4DF8A 5EE1A 5TISU 1L7PA 1S97A 1JN3A 3C21A 1F0MA 4PHEA 1NZBA 4NJ8A 3PZPA 4C7YA 4ED0A 5ALPA 2UVRA 3BDPA 4F2SA 1X2IA 2KJ8A 8ICBA 3H40A 4P0QB 4RQMA 3AEVA 5KT4A 3AL0B 1NK8A 3K75D 5L9XA 8ICHA 1X9MA 4DSKA 1ZRNA 4B9UA 8ICRA 1Y88A 4O5KA 9ICKA 2DGZA 2A1JA 4IC9A 4IQTA 3SQIA 5KFXA 4RQ1A 5J2KA 4UASA 8ICZA 3C1YA 4OJLA 5DGAA 4GXKA 3MGHA 3Q8KA 2I9GA 5DG8A 5L1KA 1JRPA 2AH5A 4KLFA 4CRXA 3Q8LA 4JMUA 2E8NA 3JPOA 4M6WA 2XI9A 4NY8A 4ED8A 4ECSA 5EE9A 4GXIA 4DFKA 1NK0A 3ORYA 4J9QA 2YY6A 3ICXA 3OHBA 4KN4A 3N7SC 2V4RA 2ATLA 2XO7A 1X9SA 8ICQA 4KLMA 5KG6A 3N28A 2W43A 4ED7A 5AKYA 2KSOA 5GTIU 1SIJA 1A0PA 5IIIA 4DO9A 1M6YA 3HKZC 2A1AA 2W8KA 5IINA 4CDGA 3JPRA 3IG8A 4DSEA 1RYRA 3M6ZA 2JEFA 1ZQZA 4J9PA 4FFDA 1JXEA 2KHQA 3KKAA 3SYZA 3GIJA 3PSIA 2ASDA 5KG0A 4RU9A 1KL9A 4FO6A 1JROA 4QW8A 3LK9A 4Y2XA 5L1IA 4LZDA 4DL5A 3RB0A 4ZOHC 1U49A 3NVZA 5DLFA 1ZQBA 4R8UA 3Q8QB 3TI0A 5D46A 3NGDA 5ALYA 2LM4A 1V85A 5KFUA 4TUSA 2UVUA 4I2HA 4M9LA 4RPXA 4UB1A 3KOOA 2KNJA 4QZAA 4TUPA 1ZQFA 4BDPA 3WK7A 4OO1J 3DEEA 4UAVA 5KG3A 2Y1IA 1QLNA 1UA1A 2JHDA 1SKRA 5AI4A 3ISCA 7ICPA 1Q3VA 5ALHA 1L3VA 4RQ2A 2PFQA 3G6XA 3QUCA 1P7DA 1YT3A 4JWNA 3PW2A 4Y2QA 1ZQQA 4Y2RA 1UQVA 1S10A 1D8LA 1S0VA 4P4OA 1ZQRA 4F4YA 4QZEA 1D9FA 2Y9TA 3FYHA 4I2EA 1GO3F 2BCVA 3GFKB 4FE3A 1SKWA 8ICTA 2F2AB 3ZD8A 2NRZA 2CXYA 5FP0A 4C4TA 2BQ3A 2NV3A 4UB3A 2CRXA 1A76A 5AM5A 2XGPA 3JPTA 2W55A 3VC8A 3SZ2A 3A0BU 5EWGA 2MRLA 4YMNA 2W9BB 3GIMA 1ZQ1C 2F1IA 3KHRA 2KIVA 1ZD3A 4JWMA 4X5VA 1IG6A 4TUQA 2AGQA 3OGUA 3HWTA 3C2MA 1ZQNA 4M9NA 2FMSA 8ICIA 2LMRA 4Z6CA 2ZJ8A 2K4IA 1N62A 1FFVA 2E8MA 5CP2A 4QWBA 4EENA 2PFNA 1KRPA 1J97A 3NS1A 4KN7A 1PK1B 3RH6A 1CRXA 3FC4A 1XU4A 5KFQA 2ZIWA 2R8GA 1SWVA 4RPYA 1TV9A 3TACB 2OHFA 4F5QA 3EZ5A 3G6YA 1BPEA 8ICWA 7ICSA 4OCZA 4F5OA 1JIHA 4Y2TA 1KDHA 5AM0A 2ASJA 1ZRMA 3WKAA 2M0NA 4JV0A 3QX7A 2YN4A 1WUDA 1X66A 5KFSA 2F44A 2GLEA 9ICMA 2H3FA 2BKEA 3MDCA 4F92B 4P4PA 1K1SA 1T3NA 1Q3UA 3OSPA 3H4DA 4K4HA 2AHOB 2WF6A 3ISBA 9ICNA 4J9SA 5DLGA 2I1QA 9ICFA 1TK8A 5ALJA 2J6UA 4QIWC 1DOQA 3F53A 4DL3A 2QB0A 2H3VA 4DQQA 2ALZA 2Y0SC 4RT2A 4YQWA 3AMZA 2JH7A 1F44A 4F50A 2EANA 5AK5A 1TE2A 3HX0A 3RJJA 5C0YA 4QWCA 5G5HA 3CP8A 5HMLA 4DOBA 3SV3A 3PW4A 4EZ9A 3HP6A 4BXOB 4WJ3B 1S9FA 4J9KA 2F3NA 1SZHA 4DL4A 1NK5A 1S0MA 4QWDA 5CWRA 4KLTA 3MR5A 4UBBA 1U47A 4YXMA 2IOFK 1L7OA 2IBKA 4GFJA 2J6TA
chains in the Genus database with same CATH topology
1V85A 3IDWA 4RQNA 3K1RB 3BS7A 3TADA 3BQ7A 3TACB 1SXEA 1OW5A 5JTIA 2FE9A 2L5YA 1PK3A 4NL9C 3KKAC 2QARA 5KNIA 1KW4A 2QB1A 2E8NA 2F8KA 2ESEA 2KG5A 2K4PA 1X66A 1X9XA 2K60A 5J8YC 2DKZA 2F44A 2GLEA 1UQVA 2DL0A 2D3DA 3H8MA 1JI7A 1WWVA 1V38A 1LKYB 5F3XB 2Y9TA 3BS5B 2Y9UA 3TADC 1SV4A 2KMDA 4IS7A 2EAMA 1SGGA 2EAPA 2QKQA 4MHVA 2KSOA 5J8YA 2QB0A 1SV0C 3HILA 4PZNA 3SEIA 1LKYA 2DKXA 3BS5A 1B0XA 3SENA 2KIVA 4NL9A 5L1MA 2E8PA 1SXDA 2EANA 2KE7A 5JU5A 2YTUA 1F0MA 3KKAA 1PK1A 4NJ8A 1DXSA 1OXJA 2KSOB 2QB0B 2LMRA 2EAOA 2JV3A 1Z1VA 4PZOA 2E8MA 2D8CA 4RQMA 2LPEA 1B4FA 2F3NA 2B6GA 1RG6A 2ES6A 1COKA 1PK1B 1X40A 1SV0A 1WWUA 5JRTA 1UCVA 2QARB 2E8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V85 A;  3IDW A;  4RQN A;  3K1R B;  3BS7 A;  3TAD A;  3BQ7 A;  3TAC B;  1SXE A;  1OW5 A;  5JTI A;  2FE9 A;  2L5Y A;  1PK3 A;  4NL9 C;  3KKA C;  2QAR A;  5KNI A;  1KW4 A;  2QB1 A;  2E8N A;  2F8K A;  2ESE A;  2KG5 A;  2K4P A;  1X66 A;  1X9X A;  2K60 A;  5J8Y C;  2DKZ A;  2F44 A;  2GLE A;  1UQV A;  2DL0 A;  2D3D A;  3H8M A;  1JI7 A;  1WWV A;  1V38 A;  1LKY B;  5F3X B;  2Y9T A;  3BS5 B;  2Y9U A;  3TAD C;  1SV4 A;  2KMD A;  4IS7 A;  2EAM A;  1SGG A;  2EAP A;  2QKQ A;  4MHV A;  2KSO A;  5J8Y A;  2QB0 A;  1SV0 C;  3HIL A;  4PZN A;  3SEI A;  1LKY A;  2DKX A;  3BS5 A;  1B0X A;  3SEN A;  2KIV A;  4NL9 A;  5L1M A;  2E8P A;  1SXD A;  2EAN A;  2KE7 A;  5JU5 A;  2YTU A;  1F0M A;  3KKA A;  1PK1 A;  4NJ8 A;  1DXS A;  1OXJ A;  2KSO B;  2QB0 B;  2LMR A;  2EAO A;  2JV3 A;  1Z1V A;  4PZO A;  2E8M A;  2D8C A;  4RQM A;  2LPE A;  1B4F A;  2F3N A;  2B6G A;  1RG6 A;  2ES6 A;  1COK A;  1PK1 B;  1X40 A;  1SV0 A;  1WWU A;  5JRT A;  1UCV A;  2QAR B;  2E8O A; 
#chains in the Genus database with same CATH topology
 2GWS A;  4EX7 A;  2H5X A;  8ICC A;  3BQT A;  5AIB A;  3G6V A;  5J29 A;  2KZ3 A;  5KT5 A;  4M04 A;  4UAR A;  3M9M B;  3PR5 B;  2FE9 A;  1VDV A;  4BGD A;  3QU2 A;  5KNI A;  4ECV A;  1U4B A;  4I2J A;  4I2B A;  4A8E A;  4XQ8 A;  2BCU A;  5KAF U;  4I29 A;  4DQS A;  1BPZ A;  4O3R A;  4DEZ A;  5A0L A;  2JXJ A;  2HOF A;  4CCH A;  3A0H U;  5T14 A;  4B9N A;  4O5E A;  1WWV A;  4KLH A;  3RH5 A;  1NNL A;  3UXN A;  4KLG A;  2Y9U A;  2BCQ A;  5ALX A;  1PVR A;  4F72 A;  2BPG A;  2WF5 A;  4E0D A;  3BQ1 A;  3JPN A;  5GTH U;  7ICN A;  3C2K A;  2IA6 A;  8ICK A;  4JB3 A;  2B21 A;  5KL8 B;  5JU5 A;  3RBE A;  2WF7 A;  3AQE A;  4PGY A;  1T7P A;  3PW7 A;  3C5F A;  3KHH A;  3RFA A;  2ZIW B;  4QW9 A;  3QNM A;  2HI0 A;  5KT7 A;  4I2D A;  3D2S A;  2RLT A;  5AI0 A;  1YZ7 A;  4QZI A;  2PMZ F;  5KFP A;  3IHQ B;  2JMG A;  7ICR A;  4IRD A;  5KFW A;  4FS2 A;  3SAF A;  1CI4 A;  3K1R B;  4CF4 A;  3SV4 A;  3BQ7 A;  3QUQ A;  4C8O A;  4UAZ A;  3JPQ A;  1ZD2 P;  3JPS A;  1X6J A;  3D2N A;  3MR2 A;  5AKX A;  4J9L A;  8ICL A;  4C80 A;  4FZM A;  1MC8 A;  3PML A;  4R66 A;  3V6H A;  1OUQ A;  1ZQV A;  3I28 A;  1ZQD A;  5J8Y C;  2PFO A;  2P66 A;  3H4B A;  3ALR A;  1SL0 A;  1ZXI A;  3M8R A;  3V7J A;  3KD3 A;  1NJX A;  4JUZ A;  4CE6 A;  4EX6 A;  4PGQ A;  1SV4 A;  5KFK A;  3I1Y A;  1S77 D;  5B66 U;  2QKQ A;  1XC9 A;  4UW9 A;  4NM2 A;  4F93 B;  2HBM A;  2E1F A;  3HIL A;  3UM9 A;  5KFH A;  4EBD A;  4EEK A;  2PXI A;  1S5L U;  4C4R A;  3AU6 A;  1B0X A;  3M1Y A;  5J2H A;  2EZX A;  4EYI B;  4Q44 A;  1HJP A;  3NVW A;  1KSP A;  2LKY A;  5KFV A;  1MQ2 A;  3TAP A;  3L5K A;  2JEG A;  4EBC A;  4HAI A;  3H8J A;  8ICS A;  2KJ9 A;  5BOL A;  4KLQ A;  2EAO A;  4EEL A;  4QZD A;  1NK4 A;  1PVQ A;  2D8C A;  3IV6 A;  5TZV A;  3FM9 A;  5ALN A;  3ZDE A;  2ZTE A;  2YMQ A;  5L1J A;  1COK A;  5ALR A;  5J0P A;  1NOM A;  3NVY A;  3RJK A;  8ICY A;  4KLJ A;  4DWI A;  3T3F A;  1QSY A;  5HNK A;  2ODG A;  4C8N A;  2KHV A;  3IDW A;  5KTQ A;  9ICS A;  5DG7 A;  3C28 A;  2C2D A;  1WG8 A;  3THV A;  4F4K A;  4KLE A;  2ISP A;  5CA7 A;  2ASL A;  4KLO A;  1FEZ A;  1ZQH A;  3UMC A;  1L7N A;  2ZJA A;  2QAR A;  4K4I A;  1KTQ A;  3H0M B;  2HHT A;  3RJF A;  1Q8K A;  3NUQ A;  3QUB A;  3PVX A;  2N1R A;  3WK5 A;  3OJS A;  9ICO A;  3MAB A;  2K60 A;  2DUY A;  3BQ0 A;  4CF5 A;  2JZB A;  3GV8 B;  2HMX A;  1QH9 A;  2EH9 A;  2R8I A;  4P0P A;  9ICT A;  3GV5 B;  5J2B A;  4PPX A;  5J0W A;  1O08 A;  2PMZ C;  9ICH A;  2LBO A;  4O3M A;  2LHT A;  1SWW A;  1ZQC A;  4QIW F;  2E5S A;  4IQW A;  4DS4 A;  4EYH B;  2RQ5 A;  4XA5 A;  3KZI U;  5KFJ A;  1SGG A;  4RQ7 A;  2HHX A;  2F76 X;  3N7R C;  3ETL A;  2BCR A;  4DFP A;  4NL9 A;  2K8B B;  2XY7 A;  3QU5 A;  3F5A A;  2HHV A;  1TVA A;  2Z7J A;  5AIA A;  1BPX A;  2OH2 A;  7ICT A;  9ICB A;  2BDU A;  4FBT A;  2WTF A;  4IL6 U;  4OJP A;  2ZXI A;  4KMO B;  2FMQ A;  2V4Q A;  4PZO A;  1LVH A;  4O3N A;  4KLU A;  4RNM A;  1FO4 A;  2WB1 C;  4RUA A;  1RXW A;  3RF9 A;  2Y1J A;  4I2F A;  1QQ7 A;  3EYZ A;  5HR7 A;  5KL1 B;  4RQ6 A;  2VKQ A;  2UVV A;  3UQ0 A;  1COO A;  1XSL A;  4G3I A;  4RNO A;  1T4G A;  3H8S A;  1C20 A;  3F5E A;  1N5X A;  1C7Y A;  2WF8 A;  4O5C A;  3GIL A;  1PUZ A;  1ZQX A;  2I6X A;  1D8B A;  2HOI A;  3SAG A;  4RQN A;  3PST A;  2GH1 A;  5F9L A;  3H7I A;  2LI6 A;  3QXG A;  4ELU A;  5KFR A;  5AI5 A;  1SXE A;  1RDF A;  5BOM A;  2IHN A;  1TAU A;  1H38 A;  5IIO A;  2PFP A;  2YB4 A;  4YG2 A;  4M9J A;  2EDU A;  4GIB A;  4F5R A;  2KZZ A;  2WAQ C;  1HIW A;  1ZD5 A;  5HHH A;  1V97 A;  4B9S A;  2FLN A;  2ZTC A;  1ZOL A;  3RRG A;  1HEK A;  4UAT A;  3DV9 A;  1KQQ A;  1ZQP A;  1UHU A;  5AI9 A;  3RH4 A;  2NO5 A;  1YZ6 A;  1Z19 A;  2DKZ A;  1N5W A;  4QJF B;  1ZQL A;  3QUT A;  3Q8M A;  4PL1 A;  3QU7 A;  1Z4O A;  2FMP A;  1UA0 A;  9ICI A;  3UQ2 A;  2BHN A;  4RQ8 A;  3HW8 A;  1ZQJ A;  4QZC A;  3RB3 A;  4RPZ A;  4B9L A;  4OD0 A;  4YR2 A;  1DK2 A;  4F5N A;  3Q8P B;  4NLN A;  2EZZ A;  1L3S A;  3WKD A;  4CF3 A;  4MHV A;  3ONN A;  3CNH A;  3GII A;  1WCN A;  4RQ3 A;  1MSW D;  3D2Q A;  5KFZ A;  5B5E U;  4QZ9 A;  3PR4 A;  2H3Q A;  8ICJ A;  3M9O B;  4KX3 A;  5J0O A;  4CNQ A;  5AKI A;  5KFT A;  3MGV A;  5AKE A;  4ED2 A;  3PO4 A;  4AYB C;  5DG9 A;  1V9P A;  2KKV A;  5JRT A;  1BVS A;  2VJ5 A;  1NKE A;  3AN1 A;  3C29 A;  2DQN B;  5ALE A;  1U48 A;  3TAN A;  3B9J A;  2HHW A;  3V6K A;  5AKJ A;  4MF2 A;  1NJY A;  4F8R A;  2A19 A;  1MQ3 A;  1PZN A;  2FLP A;  3LWL A;  4RQ4 A;  5ALS A;  4DSJ A;  4GC7 A;  9ICR A;  3RJH A;  1RYS A;  3ZDA A;  3GZF A;  4QZF A;  3ZDC A;  5J0Y A;  8ICF A;  1D8Y A;  2ZUD A;  5AK4 A;  5HHI A;  3QU9 A;  2PKE A;  1L3U A;  2YB1 A;  8ICX A;  3WKB A;  5DB7 A;  2D3D A;  3QU4 A;  2IOF A;  5CHG A;  4YFK A;  2W3S A;  1PVP A;  3E2E A;  2K8C B;  2NYV A;  3RTV A;  3BQ2 A;  1DRG A;  5AI6 A;  5KG1 A;  4J9O A;  5KFF A;  2AGO A;  4MFC A;  3M9N B;  2MU2 A;  7ICF A;  3UXO A;  2ZTD A;  1JXL A;  1BNO A;  5IIJ A;  3E0F A;  3SEN A;  2YX8 A;  3UMB A;  5J2A A;  5KFE A;  5L1M A;  3MDA A;  7ICV A;  5KFG A;  7ICI A;  5KT3 A;  5J0T A;  1NJZ A;  5KFL A;  1PK1 A;  4R8U B;  3M8S A;  5CR0 A;  1NK9 A;  1TFR A;  3MR6 A;  1BPY A;  4I27 A;  3OPX A;  1CEZ A;  2FDR A;  2W9B A;  1Q46 A;  2KP7 A;  4DFD A;  4DSF A;  1B22 A;  2VAN A;  1DGS A;  3IM1 A;  4Y2U A;  5JUM A;  4I2I A;  4DQR A;  4DOC A;  5AK6 A;  1WWU A;  4G9B A;  1UPH A;  4I2C A;  1QTM A;  2QAR B;  1RXV A;  3NAS A;  5KFD A;  4UAW A;  3ISD A;  2BR0 A;  2XY6 A;  2G09 A;  4Z6D A;  4NLZ A;  5AM4 A;  4F4Z A;  2YMM A;  5J0U A;  2MA1 A;  4PJ0 U;  2W9A A;  4YD1 A;  4PL2 A;  5AM1 A;  4P4M A;  2L5Y A;  4QNL A;  4Q45 A;  3BZK A;  5AM2 A;  4F4W A;  7ICL A;  4YR0 A;  2HBL A;  2RDJ A;  1BPB A;  1A77 A;  3TQ1 A;  4O0I A;  5EE3 A;  3B0Y A;  2ZUB A;  3U26 A;  8ICV A;  2KEY A;  2CN1 A;  1Z1B A;  1QSS A;  1RPL A;  2DL0 A;  9ICX A;  1Z4N A;  1IV8 A;  1L8O A;  3WK4 A;  1IM4 A;  2WB1 F;  5J2J A;  8ICU A;  5ALG A;  4B9T A;  7ICQ A;  4RNN A;  3BZC A;  5K4L A;  4O3Q A;  2XCA A;  2FPL A;  2DBY A;  1N60 A;  1L6N A;  2H3I A;  1KFT A;  8ICO A;  4C4S A;  2EAM A;  2IOH A;  1SL2 A;  2EAP A;  4JK1 A;  3AU2 A;  1UT8 A;  3WK6 A;  1DK3 A;  2BPC A;  2BGW A;  4IQU A;  3BS5 A;  2IMW P;  2NRT A;  4LVS A;  2DF4 B;  4F2R A;  1SXD A;  3LWM A;  2OWO A;  4MFA A;  5ALQ A;  4DSI A;  2YTU A;  4BWM A;  1MA7 A;  5KFI A;  3NRZ A;  5CB1 A;  4I28 A;  2ZUC A;  1IXR A;  4KLL A;  9ICP A;  5ALD A;  3Q8R B;  2ZIV A;  1JAL A;  2I5H A;  3VCB A;  5ALO A;  2J6S A;  4ZH4 A;  3RBD A;  2OYY A;  2E1E A;  5KG2 A;  3HPO A;  4DFM A;  2E8O A;  3V7L A;  5AKL A;  3GV7 B;  2W03 A;  2HBJ A;  2MSN A;  5ALK A;  1XSP A;  4O3S A;  4B9M A;  3TAD A;  7ICG A;  2W04 A;  3H0L B;  5DGB A;  4M9G A;  2M9N A;  1ZD4 A;  1N56 A;  3L3F X;  4Q8E A;  5DDY A;  3SR6 A;  3RR7 A;  2QB1 A;  4YN4 A;  1EXN A;  2W9C A;  4QZ8 A;  3TAQ A;  4KLD A;  5L1L A;  3TFS A;  1K1Q A;  4DQP A;  2BZF A;  2W11 A;  4ELV A;  2DWQ A;  4NWI A;  4FZL A;  4NV0 A;  3S6J A;  2HW3 A;  4IR9 A;  7ICE A;  5BPC A;  2AQ4 A;  5F3X B;  2AGP A;  2FJ6 A;  1X6I A;  5DBB A;  5KG7 A;  1J2M A;  3TAD C;  9ICW A;  5E79 U;  3I76 A;  2H3Z A;  8ICE A;  4Y2S A;  4R65 A;  4UQG A;  2R18 A;  4UB4 A;  3CRX A;  3PX4 A;  2ZIX B;  2DKX A;  4J9N A;  3RRH A;  4BUG A;  5DB9 A;  4F5P A;  2NRV A;  4PHD A;  2Q0Z X;  1WYG A;  3SD7 A;  1F5S A;  5IIK A;  3F2C A;  3PSF A;  1DXS A;  3V72 A;  1OXJ A;  2K89 A;  3OSN A;  2KSO B;  2AQ0 A;  4DFJ A;  3J81 j;  2JV3 A;  5DQG A;  3RJG A;  1NK7 A;  2B6G A;  2R8H A;  1NKB A;  5AK3 A;  9ICL A;  4BJQ A;  5HR6 A;  4QWA A;  4J03 A;  5CEH A;  1ZET A;  4NLB A;  4QZG A;  4JV1 A;  4P0Q A;  1ZQT A;  3BS7 A;  5J2D A;  3AUO A;  4YVZ A;  1N61 A;  2HHQ A;  1ED1 A;  4O3O A;  2XGQ A;  3F2B A;  1BPD A;  4C7Z A;  2KFZ A;  4DSL A;  2BCS A;  2DFL A;  1JX4 A;  5ALT A;  2A1J B;  3EUB 2;  2C22 A;  2LM1 A;  4RT3 A;  4IR1 A;  1L5U A;  2FI1 A;  4YMO A;  1LV5 A;  2FPM A;  2RRD A;  2G5I B;  2Y0S F;  4P2H A;  2LYH A;  3WK8 A;  1SL1 A;  2BQR A;  8ICP A;  4IQV A;  3LVV A;  5KG5 A;  1ZJN A;  2XCP A;  1JI7 A;  5KFA A;  1NI3 A;  2EZY A;  1MN8 A;  2O6K A;  1T8E A;  4GC6 A;  9ICA A;  1LB2 B;  4Y2Y A;  1RQL A;  5H2F U;  1TAQ A;  2AJQ A;  4KLS A;  4YR3 A;  3ED5 A;  2F1H A;  5J8Y A;  1SV0 C;  3B0X A;  4B9V A;  4PZN A;  3SEI A;  1LKY A;  2VA3 A;  3CYM A;  1B43 A;  4Y2P A;  3GQC A;  2XVT A;  2E8P A;  5J2G A;  2KFN A;  2W9M A;  1KFD A;  2C28 A;  4YD2 A;  4Q43 A;  3NVV A;  1HUO A;  5AM3 A;  4UAY A;  4MFF A;  3RAQ A;  4GLX A;  4Z6F A;  4ED3 A;  4QZH A;  1KKX A;  3C23 A;  4C8K A;  1BNP A;  3QZ7 A;  2R8J A;  1ECW A;  8ICM A;  4ED1 A;  3N97 B;  1RG6 A;  2ES6 A;  4RQ5 A;  2HHS A;  3H8W A;  1QQ6 A;  3L4P A;  9ICE A;  4R63 A;  1XWL A;  2KV2 A;  7ICK A;  2W9C B;  2KVC A;  2UVW A;  1ZQK A;  4AP9 A;  1TK5 A;  2YML A;  4IRK A;  3LYS A;  4NL9 C;  1BGX T;  3T5K A;  2C2E A;  1RQN A;  1VJ5 A;  4Q8F A;  4QWE A;  2ZIU A;  1HUZ A;  5DQH A;  4ICA A;  3M7D A;  4NLC A;  3IRU A;  3WK9 A;  3H8M A;  5KAI U;  4TQR A;  3TKA A;  3GDX A;  3WKE A;  4YCX A;  9ICQ A;  4NXZ A;  4PGX A;  3LDA A;  2KMD A;  2P35 A;  1J2N A;  2AU0 A;  5KT6 A;  4IS7 A;  2BDP A;  1RYU A;  2K4H A;  5J0S A;  3PX0 A;  3KTQ A;  3RJE A;  1ZJM A;  1NZP A;  3TAR A;  1T94 A;  4UB6 U;  3PO5 A;  5HP4 A;  2NRX A;  2JGA A;  3D6J A;  4MEY A;  3K4G A;  2KN7 A;  4DCC A;  1WCL A;  3C5G A;  2NO4 A;  1FIQ A;  2JEJ A;  2B0C A;  2DPJ A;  3KHL A;  3OTQ A;  2LYA A;  1XSN A;  5KT2 A;  4UBC A;  4DLG A;  7ICH A;  2F1J A;  4OJO A;  2OM6 A;  1N2X A;  3T5H A;  4PHP A;  4DL2 A;  1Z00 B;  2C2R A;  4ELT A;  5EWE A;  3ZI4 A;  3V6J A;  7ICU A;  4I2G A;  5AKH A;  1ZYQ A;  4NM1 A;  5KFY A;  1ZQO A;  1TAM A;  1SKS A;  2WFA A;  4NLK A;  1OW5 A;  2XID A;  5JTI A;  5ALU A;  5AKK A;  7ICJ A;  3GU3 A;  5J0X A;  4NLG A;  4FBU A;  3MFI A;  9ICC A;  4UB8 U;  3RB6 A;  2W7P A;  4OJ6 A;  1UT5 A;  4QZB A;  3EPI A;  5DB6 A;  1VLB A;  2KK0 A;  5ALZ A;  3IG5 A;  2XY5 A;  4XUS A;  4C8L A;  2ESE A;  4DL7 A;  1XO1 A;  1XO0 A;  2HBK A;  3N4M B;  2KTQ A;  1X9X A;  5KFN A;  4UB5 A;  2HHU A;  2HVH A;  4JV2 A;  2HVI A;  1T3Q A;  4M9H A;  1V38 A;  1LKY B;  4J9M A;  3QEB Z;  2G0A A;  2MAX A;  3SAH A;  5DDM A;  2K8A A;  2ZJ5 A;  3EWA A;  5ALF A;  1ZQG A;  2HDO A;  4PH5 A;  3AM9 A;  3UMG A;  4RZR A;  5F9N A;  4IRC A;  3RB4 A;  3MGI A;  4DOA A;  5J2I A;  4Y2J A;  3QZ8 A;  4FZN A;  4R64 A;  2FPK A;  1N48 A;  2MUT A;  1URJ A;  1ZQS A;  2KE7 A;  4MF8 A;  4LJX A;  4CGZ A;  4YMM A;  2EQY A;  5D49 A;  1RZT A;  3KZX A;  4K4G A;  4US8 A;  2GOL A;  5AIC A;  1A6S A;  2QB0 B;  3PMN A;  2DPI A;  3F2D A;  3T79 A;  3FDS A;  3PSP A;  2KD1 A;  4ECW A;  5DQI A;  4RUC A;  4YP3 A;  2XC9 A;  1AQ6 A;  2G5H B;  5DKW A;  4BXO A;  4ECX A;  2RP5 A;  4EEY A;  5KFO A;  5CRX A;  5AKG A;  5IIM A;  3ETR A;  3MFH A;  1IIP A;  3ZDD A;  2KOB A;  5DBC A;  4J9R A;  5J0R A;  4ECU A;  1PK3 A;  2RDI A;  4F71 A;  2OEH A;  3MBY A;  1SZP A;  4U6P A;  1Z00 A;  3EW9 A;  5J2F A;  3PY8 A;  5KFM A;  5EWF A;  1KW4 A;  2AXT U;  1JMS A;  2HSZ A;  4M0A A;  3BJY A;  2PI5 A;  3V7K A;  9ICJ A;  3H0R B;  2F8K A;  3SI8 A;  2KG5 A;  2K4P A;  1N63 A;  3IP4 B;  4O3P A;  5G5G A;  4YXJ A;  4ED6 A;  1L8L A;  1X9W A;  2XIC A;  4DS5 A;  4HYK A;  2VIX A;  2JR5 A;  4USA A;  3C2L A;  3HRD D;  4M6W B;  3PNC A;  4AYB F;  4ACO A;  4EZ6 A;  3M6K A;  1ZQE A;  1ZQY A;  3K1Z A;  5KFC A;  4TUR A;  3HKZ F;  2JH1 A;  1RM6 C;  2VA2 A;  2D6F C;  5KG4 A;  3RAX A;  2LYB A;  4PHA A;  1KBU A;  3FAH A;  3PV8 A;  3EPG A;  8ICG A;  8ICN A;  2CPR A;  1S76 D;  1L7M A;  3SMV A;  1QSL A;  2KKP A;  3WU2 U;  2BPF A;  4ECY A;  2LPE A;  1FFU A;  1S8O A;  8ICA A;  1B4F A;  1JUD A;  2KIW A;  5CJ7 A;  1QCK A;  2YMP A;  4KX5 A;  4KTQ A;  4B6J A;  2JEI A;  3JPP A;  2QLT A;  2R8K A;  2ZIU B;  2ZIV B;  5ALV A;  1S0O A;  3T5J A;  2W54 A;  2G08 A;  2OXO A;  1U45 A;  5AHX A;  2ISO A;  2F77 X;  4KIT B;  3KHG A;  4DQI A;  1QQ5 A;  4KLI A;  5DBA A;  2RHF A;  5ALW A;  1SB3 C;  2WAQ F;  7ICO A;  2G06 A;  5D4B A;  4LZG A;  5AKZ A;  5AI8 A;  4O9M A;  4DLE A;  1U9L A;  4DF4 A;  3QYP A;  3OJU A;  4M2Y A;  4KMU A;  4EBE A;  2KIC A;  4ECZ A;  4DL6 A;  3IN5 A;  4MEX A;  4RQ0 A;  2P6R A;  5J0Q A;  2MUT B;  9ICU A;  1ZQA A;  2JZB B;  2VJ4 A;  2F8L A;  3DDH A;  4GXJ A;  1XNS A;  1ZQI A;  3UXP A;  3N7P D;  2HCF A;  2BQU A;  2FLL A;  2W8L A;  1ZQU A;  1K5O A;  4U7C A;  2ZXH A;  1L3T A;  2IHM A;  4FS1 A;  2P6U A;  3UPQ A;  3MC1 A;  5ALI A;  1D9D A;  4XRH A;  1NK6 A;  3E58 A;  3HT3 A;  2ZIX A;  1X42 A;  3MR3 A;  1Z1V A;  4F4X A;  1ZQW A;  2GO7 A;  4C0Z A;  3QEA Z;  2YQE A;  2K4E A;  1XS9 D;  2Q4T A;  2ZG6 A;  5DB8 A;  1ARO P;  3WKC A;  9ICG A;  2HOQ A;  2A3V A;  2W7O A;  3Q8S B;  2PI4 A;  4M47 A;  1X40 A;  1SV0 A;  4TQS A;  1UCV A;  3KFU F;  4UAU A;  1DGJ A;  3RR8 A;  3HJE A;  3QE9 Y;  3R9K A;  3RJI A;  4F91 B;  3T5L A;  1NKC A;  3GIK A;  2WHE A;  2E3T A;  2JRZ A;  1O03 A;  2NRW A;  4OJ5 A;  3KKA C;  1KLN A;  4P0P B;  5KFB A;  5EOZ A;  4BX9 C;  4UB2 A;  5ALM A;  1CUK A;  4Z6E A;  5EE0 A;  1Z3E B;  2VA8 A;  4C8M A;  2KJ5 A;  2V9W A;  2W3R A;  1ZQM A;  3OHA A;  1KN5 A;  7ICM A;  1TKD A;  3C1Z A;  3PW0 A;  2G07 A;  3ZDB A;  4I2A A;  3CW2 C;  3ZD9 A;  4US9 A;  3PW5 A;  3AQF A;  4ECT A;  3BS5 B;  3PX6 A;  5ALL A;  5HMM A;  2KVS A;  3LVW A;  3NRW A;  3O0F A;  1KEJ A;  4BWJ A;  5IIL A;  2WF9 A;  5J2C A;  9ICV A;  1KFS A;  5C5J A;  3TFR A;  1S0N A;  5J2E A;  2KZM A;  1NJW A;  4ECR A;  4ECQ A;  3KBB A;  1TK0 A;  4F3O A;  4Y2V A;  3NTU A;  2OCE A;  4DF8 A;  5EE1 A;  5TIS U;  1L7P A;  1S97 A;  1JN3 A;  3C21 A;  1F0M A;  4PHE A;  1NZB A;  4NJ8 A;  3PZP A;  4C7Y A;  4ED0 A;  5ALP A;  2UVR A;  3BDP A;  4F2S A;  1X2I A;  2KJ8 A;  8ICB A;  3H40 A;  4P0Q B;  4RQM A;  3AEV A;  5KT4 A;  3AL0 B;  1NK8 A;  3K75 D;  5L9X A;  8ICH A;  1X9M A;  4DSK A;  1ZRN A;  4B9U A;  8ICR A;  1Y88 A;  4O5K A;  9ICK A;  2DGZ A;  2A1J A;  4IC9 A;  4IQT A;  3SQI A;  5KFX A;  4RQ1 A;  5J2K A;  4UAS A;  8ICZ A;  3C1Y A;  4OJL A;  5DGA A;  4GXK A;  3MGH A;  3Q8K A;  2I9G A;  5DG8 A;  5L1K A;  1JRP A;  2AH5 A;  4KLF A;  4CRX A;  3Q8L A;  4JMU A;  2E8N A;  3JPO A;  4M6W A;  2XI9 A;  4NY8 A;  4ED8 A;  4ECS A;  5EE9 A;  4GXI A;  4DFK A;  1NK0 A;  3ORY A;  4J9Q A;  2YY6 A;  3ICX A;  3OHB A;  4KN4 A;  3N7S C;  2V4R A;  2ATL A;  2XO7 A;  1X9S A;  8ICQ A;  4KLM A;  5KG6 A;  3N28 A;  2W43 A;  4ED7 A;  5AKY A;  2KSO A;  5GTI U;  1SIJ A;  1A0P A;  5III A;  4DO9 A;  1M6Y A;  3HKZ C;  2A1A A;  2W8K A;  5IIN A;  4CDG A;  3JPR A;  3IG8 A;  4DSE A;  1RYR A;  3M6Z A;  2JEF A;  1ZQZ A;  4J9P A;  4FFD A;  1JXE A;  2KHQ A;  3KKA A;  3SYZ A;  3GIJ A;  3PSI A;  2ASD A;  5KG0 A;  4RU9 A;  1KL9 A;  4FO6 A;  1JRO A;  4QW8 A;  3LK9 A;  4Y2X A;  5L1I A;  4LZD A;  4DL5 A;  3RB0 A;  4ZOH C;  1U49 A;  3NVZ A;  5DLF A;  1ZQB A;  4R8U A;  3Q8Q B;  3TI0 A;  5D46 A;  3NGD A;  5ALY A;  2LM4 A;  1V85 A;  5KFU A;  4TUS A;  2UVU A;  4I2H A;  4M9L A;  4RPX A;  4UB1 A;  3KOO A;  2KNJ A;  4QZA A;  4TUP A;  1ZQF A;  4BDP A;  3WK7 A;  4OO1 J;  3DEE A;  4UAV A;  5KG3 A;  2Y1I A;  1QLN A;  1UA1 A;  2JHD A;  1SKR A;  5AI4 A;  3ISC A;  7ICP A;  1Q3V A;  5ALH A;  1L3V A;  4RQ2 A;  2PFQ A;  3G6X A;  3QUC A;  1P7D A;  1YT3 A;  4JWN A;  3PW2 A;  4Y2Q A;  1ZQQ A;  4Y2R A;  1UQV A;  1S10 A;  1D8L A;  1S0V A;  4P4O A;  1ZQR A;  4F4Y A;  4QZE A;  1D9F A;  2Y9T A;  3FYH A;  4I2E A;  1GO3 F;  2BCV A;  3GFK B;  4FE3 A;  1SKW A;  8ICT A;  2F2A B;  3ZD8 A;  2NRZ A;  2CXY A;  5FP0 A;  4C4T A;  2BQ3 A;  2NV3 A;  4UB3 A;  2CRX A;  1A76 A;  5AM5 A;  2XGP A;  3JPT A;  2W55 A;  3VC8 A;  3SZ2 A;  3A0B U;  5EWG A;  2MRL A;  4YMN A;  2W9B B;  3GIM A;  1ZQ1 C;  2F1I A;  3KHR A;  2KIV A;  1ZD3 A;  4JWM A;  4X5V A;  1IG6 A;  4TUQ A;  2AGQ A;  3OGU A;  3HWT A;  3C2M A;  1ZQN A;  4M9N A;  2FMS A;  8ICI A;  2LMR A;  4Z6C A;  2ZJ8 A;  2K4I A;  1N62 A;  1FFV A;  2E8M A;  5CP2 A;  4QWB A;  4EEN A;  2PFN A;  1KRP A;  1J97 A;  3NS1 A;  4KN7 A;  1PK1 B;  3RH6 A;  1CRX A;  3FC4 A;  1XU4 A;  5KFQ A;  2ZIW A;  2R8G A;  1SWV A;  4RPY A;  1TV9 A;  3TAC B;  2OHF A;  4F5Q A;  3EZ5 A;  3G6Y A;  1BPE A;  8ICW A;  7ICS A;  4OCZ A;  4F5O A;  1JIH A;  4Y2T A;  1KDH A;  5AM0 A;  2ASJ A;  1ZRM A;  3WKA A;  2M0N A;  4JV0 A;  3QX7 A;  2YN4 A;  1WUD A;  1X66 A;  5KFS A;  2F44 A;  2GLE A;  9ICM A;  2H3F A;  2BKE A;  3MDC A;  4F92 B;  4P4P A;  1K1S A;  1T3N A;  1Q3U A;  3OSP A;  3H4D A;  4K4H A;  2AHO B;  2WF6 A;  3ISB A;  9ICN A;  4J9S A;  5DLG A;  2I1Q A;  9ICF A;  1TK8 A;  5ALJ A;  2J6U A;  4QIW C;  1DOQ A;  3F53 A;  4DL3 A;  2QB0 A;  2H3V A;  4DQQ A;  2ALZ A;  2Y0S C;  4RT2 A;  4YQW A;  3AMZ A;  2JH7 A;  1F44 A;  4F50 A;  2EAN A;  5AK5 A;  1TE2 A;  3HX0 A;  3RJJ A;  5C0Y A;  4QWC A;  5G5H A;  3CP8 A;  5HML A;  4DOB A;  3SV3 A;  3PW4 A;  4EZ9 A;  3HP6 A;  4BXO B;  4WJ3 B;  1S9F A;  4J9K A;  2F3N A;  1SZH A;  4DL4 A;  1NK5 A;  1S0M A;  4QWD A;  5CWR A;  4KLT A;  3MR5 A;  4UBB A;  1U47 A;  4YXM A;  2IOF K;  1L7O A;  2IBK A;  4GFJ A;  2J6T A; 
#chains in the Genus database with same CATH homology
 1V85 A;  3IDW A;  4RQN A;  3K1R B;  3BS7 A;  3TAD A;  3BQ7 A;  3TAC B;  1SXE A;  1OW5 A;  5JTI A;  2FE9 A;  2L5Y A;  1PK3 A;  4NL9 C;  3KKA C;  2QAR A;  5KNI A;  1KW4 A;  2QB1 A;  2E8N A;  2F8K A;  2ESE A;  2KG5 A;  2K4P A;  1X66 A;  1X9X A;  2K60 A;  5J8Y C;  2DKZ A;  2F44 A;  2GLE A;  1UQV A;  2DL0 A;  2D3D A;  3H8M A;  1JI7 A;  1WWV A;  1V38 A;  1LKY B;  5F3X B;  2Y9T A;  3BS5 B;  2Y9U A;  3TAD C;  1SV4 A;  2KMD A;  4IS7 A;  2EAM A;  1SGG A;  2EAP A;  2QKQ A;  4MHV A;  2KSO A;  5J8Y A;  2QB0 A;  1SV0 C;  3HIL A;  4PZN A;  3SEI A;  1LKY A;  2DKX A;  3BS5 A;  1B0X A;  3SEN A;  2KIV A;  4NL9 A;  5L1M A;  2E8P A;  1SXD A;  2EAN A;  2KE7 A;  5JU5 A;  2YTU A;  1F0M A;  3KKA A;  1PK1 A;  4NJ8 A;  1DXS A;  1OXJ A;  2KSO B;  2QB0 B;  2LMR A;  2EAO A;  2JV3 A;  1Z1V A;  4PZO A;  2E8M A;  2D8C A;  4RQM A;  2LPE A;  1B4F A;  2F3N A;  2B6G A;  1RG6 A;  2ES6 A;  1COK A;  1PK1 B;  1X40 A;  1SV0 A;  1WWU A;  5JRT A;  1UCV A;  2QAR B;  2E8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...