1RG6A

Solution structure of the c-terminal domain of p63
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
PTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords second splice variant p63
publication title Solution structure of the C-terminal domain of p63
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1rg6A00
1JI7A 1X66A 2EAMA 2QB1A 1PK1B 1OW5A 1SV0C 2QB0B 2F8KA 1Z1VA 2EAPA 1UCVA 1COKA 2JV3A 1B4FA 3BQ7A 2F3NA 3K1RB 1SXEA 1SXDA 4NL9A 2D8CA 2E8MA 1X40A 5JRTA 1PK3A 4IS7A 4MHVA 2K4PA 2Y9TA 5J8YA 1SV4A 2FE9A 2QKQA 1LKYA 4NL9C 1OXJA 3KKAA 3SEIA 2E8NA 2LPEA 2YTUA 5J8YC 1F0MA 5KNIA 2KSOA 1LKYB 3KKAC 2KE7A 2EAOA 3BS7A 2DKZA 2K60A 2E8OA 2EANA 1KW4A 1X9XA 2ES6A 1WWVA 3IDWA 4NJ8A 1B0XA 4PZNA 2B6GA 2F44A 2Y9UA 3SENA 5L1MA 2ESEA 1WWUA 4RQMA 3TADA 3HILA 1V85A 2GLEA 2QARA 4PZOA 2DL0A 3BS5A 1UQVA 1V38A 2KMDA 5JU5A 2L5YA 3TADC 1PK1A 2KG5A 2LMRA 2QB0A 1DXSA 2KSOB 1RG6A 4RQNA 5JTIA 2KIVA 3TACB 1SV0A 3H8MA 5F3XB 2D3DA 2DKXA 2QARB 2E8PA 3BS5B 1SGGA
chains in the Genus database with same CATH superfamily
4F4YA 9ICIA 4Y2TA 5EWGA 3WK9A 4Z6EA 9ICUA 1TK0A 2ZIWB 3PW7A 5AHXA 2XY7A 1ECWA 5J0WA 2EAPA 1ZQXA 1SB3C 3M6KA 5KFGA 4U7CA 4QW9A 4F93B 1H38A 4JWMA 1B4FA 4CF4A 5IIMA 2JR5A 1XC9A 2HOQA 5AKKA 1NK9A 4TUQA 1BNOA 1ZD5A 1UT5A 4I29A 2D8CA 5KFUA 1A0PA 5J0QA 1K1SA 4RQ0A 7ICSA 2OM6A 2KVSA 1PVQA 3HKZC 4ECZA 3ZI4A 1SKRA 4M9JA 1QQ7A 1IXRA 2WF9A 2LI6A 3HPOA 2WAQF 5AKHA 1KSPA 1UT8A 3M8SA 4TQRA 1BPYA 3C1YA 2EAOA 2HBLA 5AK4A 5ALKA 1CI4A 5HHHA 3WKDA 4I27A 4J9RA 2ES6A 4RUCA 1HIWA 5AIAA 5ALQA 3C21A 4YVZA 9ICJA 2R8GA 3IDWA 4B6JA 1B0XA 2HHWA 8ICKA 1F44A 3EZ5A 2XY5A 7ICUA 5KFFA 4RPXA 1F5SA 1N63A 2RP5A 4CRXA 1ZQCA 3EPIA 1LV5A 1X6JA 1Q3VA 3RTVA 2W9AA 3UXNA 9ICRA 1U48A 4YMOA 8ICCA 4J9SA 1NK6A 2IHNA 4EZ9A 5KG6A 5KAIU 2JMGA 2LMRA 2CN1A 4C8KA 4DS4A 4RQNA 7ICHA 4RNNA 2PMZC 2PI5A 3QU7A 4RQ2A 2KKPA 2ATLA 5KG1A 2LM4A 4ELTA 5FP0A 2RDJA 1X9SA 8ICZA 3NUQA 4R63A 4QZCA 3G6VA 5J2FA 4RQ8A 8ICFA 4YMNA 4UBCA 1UA0A 3K1ZA 1M6YA 1ZQYA 4PHPA 2W7PA 3M9OB 3RB0A 3O0FA 2XIDA 9ICNA 2XVTA 4C8OA 2JEIA 1Z3EB 4BWJA 1PK3A 4Z6FA 1HUOA 8ICYA 1HEKA 4R65A 2CXYA 2ZTCA 2KVCA 5J0OA 5ALIA 4ECVA 4B9LA 2XY6A 4BX9C 4KX3A 4K4HA 2OCEA 2F77X 4DO9A 5AM5A 4XA5A 7ICTA 3V6KA 2YTUA 2JEGA 4RQ5A 2O6KA 3KZXA 2ZTEA 5KNIA 3AU2A 4YR0A 2BKEA 4I2EA 4DQQA 8ICIA 4JWNA 5J0SA 3WKBA 2BCQA 3SV3A 3V7JA 5DBAA 5J0TA 1V97A 1SWWA 5KFJA 4C4RA 2B6GA 3T5JA 4J9OA 4P0QB 3RF9A 4FBTA 4G9BA 3PO4A 1WWUA 4QZ9A 4FZLA 2IOFA 1SZHA 1WYGA 1ZXIA 4JV1A 5CHGA 4OJ6A 5DLFA 1V38A 4EX6A 3GV7B 1U4BA 3N7PD 4QZAA 5ALVA 1IV8A 1KKXA 3D2QA 5HR6A 2MUTB 5AKIA 3RB3A 5C0YA 3GZFA 7ICFA 8ICUA 2OEHA 4IR9A 4EYIB 1RDFA 1TAUA 2MAXA 4Q44A 4KLTA 5CRXA 2ZIVB 3GIIA 2NRVA 8ICOA 2WB1C 2HHTA 2IMWP 3GQCA 4DQIA 1DGJA 2K4EA 3M8RA 4JV0A 1ZYQA 3NTUA 5DKWA 4Y2UA 2NO4A 3IN5A 5KFAA 3CP8A 5KFMA 2Q4TA 3JPQA 4IRCA 5DQGA 1JXEA 2HVHA 3HRDD 5BOLA 1ZJNA 8ICSA 3FDSA 4MHVA 3BDPA 5DQHA 1S97A 3ZDEA 4ELUA 5DQIA 3C5FA 4RT3A 2FI1A 1ZQGA 3BQ2A 3SZ2A 3AL0B 7ICEA 2R8HA 1DK3A 4YQWA 1UPHA 4ECTA 4DSJA 2NYVA 7ICPA 8ICVA 3H8JA 2NRZA 3WK5A 4EELA 1LVHA 2K60A 2F1HA 3Q8QB 5KFHA 1NI3A 3Q8LA 2AQ0A 4NM2A 1L7PA 4J9NA 4OJ5A 3NGDA 4NJ8A 1S0OA 4PZNA 2Y9UA 9ICFA 2I6XA 3AN1A 3ETRA 3BQTA 1WCNA 2HHQA 1ZQIA 3AQFA 5L1IA 1JUDA 1V85A 2M9NA 4P4MA 3H8WA 3T5HA 8ICBA 2QARA 2WF6A 4O9MA 4YP3A 4IRKA 3M9MB 3F2BA 1X9WA 1LB2B 4PL2A 2RLTA 4P0PB 3TACB 4OCZA 4UB4A 2UVVA 2JGAA 1OUQA 4F2RA 1NKCA 2HW3A 1KEJA 3MGVA 1BPEA 3RH6A 5E79U 4FE3A 1URJA 5CWRA 3HWTA 3GV8B 4Q43A 1ZQFA 3PW0A 4FFDA 4CE6A 5J2AA 3PR5B 3FAHA 4UAVA 5KG5A 5DDYA 1K5OA 1ZD4A 1SXEA 4DS5A 3RJKA 2KP7A 5DB9A 3D2SA 1DOQA 1JX4A 2Y9TA 3QUTA 4OD0A 2QKQA 8ICPA 2BQRA 4KX5A 4ED2A 3ZDCA 3QZ7A 1T8EA 2YMQA 3UQ0A 2H3FA 2P6UA 4EZ6A 5ALXA 2J6UA 3WU2U 3GIJA 2R18A 3PW4A 1S77D 9ICWA 2XICA 3ZD9A 3PY8A 2AGOA 1XNSA 4RQ6A 4DL3A 4AP9A 2KIWA 2YX8A 4UARA 4AYBC 2W9BB 4KLHA 3ICXA 4K4GA 2Z7JA 3NASA 2P35A 2BPGA 1Q8KA 1KTQA 3PX4A 5J2HA 3MR6A 1ZQOA 1TAMA 4DSFA 5KAFU 2WTFA 5AKYA 3NS1A 1S76D 2FLNA 3BS5A 3G6YA 5DB7A 4GXIA 8ICQA 4CNQA 2L5YA 3TFRA 2Y0SC 4ECUA 2QLTA 4DQPA 3N4MB 1IM4A 1S9FA 4KLIA 5DB8A 5F3XB 1N62A 1PUZA 5JUMA 4US8A 3VC8A 1B22A 3KBBA 2KJ5A 4RQ4A 1Q46A 2VA3A 1Z1VA 3V7KA 3F53A 1ZQZA 2YB4A 2XCPA 5KFDA 5KL8B 3NRWA 1N2XA 1TK8A 1RXWA 4I2HA 5IIJA 1JRPA 1VLBA 5CA7A 4UW9A 4I2FA 5AKGA 2VANA 3C2KA 2E8MA 1A77A 3PNCA 3T79A 4ICAA 3MFIA 2AGQA 1LKYA 3IM1A 5B66U 1NOMA 5AM1A 5GTHU 1SKWA 4IL6U 1BPXA 4I2JA 4DSKA 3KHGA 3SI8A 5IIOA 4QZBA 3JPPA 2KZMA 4IR1A 3BS7A 3D6JA 2FMPA 2ZIUB 2LYHA 1X9XA 3H0RB 3M7DA 2KV2A 1C20A 1SWVA 3MFHA 2C2EA 5J2JA 3QU5A 3ORYA 3N97B 3HW8A 4NLBA 4FZNA 4BGDA 3PMLA 9ICPA 3C29A 9ICEA 5KT5A 3ONNA 3HT3A 3SENA 2ESEA 5DLGA 4I2BA 2KJ8A 4M9HA 4F50A 4OJPA 3H7IA 4P2HA 5AI8A 3IG5A 4GIBA 2D6FC 1PK1A 4KLSA 2XCAA 5ALWA 5HP4A 1ZQBA 4M6WB 1XU4A 2OWOA 1A76A 3H4BA 2M0NA 2KZZA 4ZH4A 1NKBA 2Y1JA 3HX0A 2QB0B 3AQEA 1Z19A 5DG7A 5AK6A 2A1JA 4O3NA 2WFAA 5ALTA 4NXZA 1XS9D 2ODGA 3OJUA 3BQ7A 4DCCA 3UXOA 8ICWA 1ZQLA 3TI0A 4O3PA 4F91B 2IOFK 3TFSA 2G5IB 1BPBA 2P6RA 1BNPA 3SAHA 2KFNA 3RJFA 4NLKA 4PGYA 8ICRA 2YMMA 1KL9A 3EPGA 2HHVA 1NZPA 5KG7A 2HDOA 4EBEA 8ICAA 1ZRMA 1ED1A 1F0MA 2K8CB 4F2SA 3V6JA 5KG3A 1X2IA 3I1YA 2HOIA 4QZ8A 2NRWA 1KLNA 1AROP 3CYMA 1ZQAA 3B9JA 2V9WA 3B0XA 2AHOB 4CDGA 4FS2A 1QQ5A 4YG2A 3H8SA 4B9TA 1ZQHA 2CRXA 3RH5A 4YD1A 2KMDA 4UAWA 2BR0A 2F1JA 1PVRA 1TAQA 4EYHB 1DGSA 2DBYA 4RPZA 3U26A 2A3VA 4QZHA 1KDHA 4QZGA 5ALJA 9ICQA 3L4PA 2ISOA 1XSLA 4ED1A 1WUDA 2LKYA 1BGXT 3QNMA 1N5XA 4PL1A 3ISCA 4R64A 2DGZA 1VDVA 4I2CA 1RYUA 4F4XA 5ALUA 4KLMA 2EZZA 1D8BA 2G09A 5AI5A 2AQ4A 1S8OA 2BCVA 4NL9A 3C1ZA 2ISPA 1BVSA 2H5XA 3PX0A 2OH2A 1KFSA 5DGBA 4EENA 1RM6C 1SV4A 4P4PA 4KITB 4NL9C 1Y88A 9ICXA 4OJLA 4B9SA 2XI9A 1KN5A 1T3QA 4MFAA 4FZMA 2FPLA 4Y2JA 3VCBA 2J6TA 4B9VA 4Y2XA 4DLEA 5J2DA 4MF2A 2W9CB 4Y2SA 2ASLA 1HJPA 4KLFA 5J0XA 5DB6A 7ICLA 4OJOA 2ZG6A 4YD2A 5KT3A 4ECYA 2ZIXB 3D2NA 4DSIA 4US9A 5ALLA 2ZTDA 5BPCA 1V9PA 1WWVA 3EW9A 2BQ3A 1FFVA 3FYHA 3CNHA 3C5GA 1A6SA 1YZ7A 4XUSA 3JPNA 1QSYA 5EE9A 3T3FA 2E3TA 3NVVA 3M9NB 4PHAA 2KKVA 2JEJA 3FC4A 3HKZF 3OSPA 3E58A 5JU5A 3UMGA 3AEVA 2W43A 1L5UA 2JZBB 2PFQA 4YXMA 3LWMA 3EWAA 3LYSA 1XWLA 5AKZA 3PO5A 2JEFA 4KMUA 3TAPA 4ECXA 5D4BA 3RR8A 1N56A 4RU9A 4GC6A 2AU0A 1QSSA 4P4OA 3GDXA 4KMOB 1Z00B 1JIHA 3QXGA 3MDCA 2KICA 4Y2QA 1ZQTA 5HMLA 3LDAA 4KLEA 3CW2C 1T3NA 1COKA 4UAYA 1K1QA 5D46A 3JPOA 1KRPA 4DFMA 2BCRA 3PV8A 4MF8A 4CGZA 1S5LU 1L3VA 2BPFA 1SXDA 5J2EA 5AM4A 4I2DA 3J81j 3F5EA 3JPRA 2W11A 9ICBA 1JROA 2EDUA 3RBDA 3RJHA 1N5WA 1NK7A 1NK4A 3KKAA 4O3QA 3KHHA 5IIIA 2PMZF 5KFTA 5DBBA 3Q8MA 5KFNA 4EEYA 5EWEA 1XSPA 4ECSA 2VJ4A 1DRGA 1IIPA 3KKAC 2KE7A 3MC1A 3UPQA 3MABA 3SMVA 2E8OA 3G6XA 2IBKA 2HMXA 3HJEA 2FMSA 3THVA 2FPMA 5HR7A 4R8UA 4KN7A 3MR3A 4F5OA 4DL5A 4TUPA 1L7NA 2F44A 1S10A 4YCXA 3SD7A 2ZXIA 1UHUA 2FMQA 4YXJA 1D8YA 4BXOA 4JMUA 1ZQUA 2EZYA 4JB3A 2IHMA 3LVWA 4XRHA 5KFPA 4NV0A 2ZIWA 4EX7A 4B9UA 2GWSA 4F72A 2KIVA 2H3VA 2E8PA 5L1JA 3OJSA 4KN4A 2B0CA 5AM0A 3QYPA 2QB1A 3QUCA 1NNLA 4QW8A 4RZRA 4M47A 1TFRA 5KT2A 2ZUDA 1NK0A 3UM9A 2BDUA 4DOAA 3V6HA 2ZXHA 1S0NA 5AM2A 7ICVA 1QCKA 5HNKA 4ED3A 2C28A 5ALHA 4B9MA 4F3OA 4YMMA 2JXJA 4UBBA 2GOLA 5ALMA 5ALGA 2DUYA 2W8KA 4PGQA 3JPTA 5G5GA 5ALOA 4F5RA 4UASA 4TUSA 2KFZA 3N28A 2PI4A 4DSEA 3SEIA 5KFIA 4RT2A 1JN3A 5KFVA 3QZ8A 2ASJA 2K89A 1AQ6A 2KD1A 1ZQSA 3SYZA 4PJ0U 4U6PA 4CCHA 2VA8A 4BJQA 2WB1F 5H2FU 1KFTA 1COOA 4BUGA 5EOZA 2KNJA 3ZDAA 4YFKA 4I2GA 1NK8A 1ZQDA 3MR2A 3LK9A 4HAIA 4MEYA 5KFOA 2UVRA 2J6SA 1VJ5A 1ZRNA 4M0AA 5HHIA 4NLNA 3I76A 4QWCA 9ICHA 2YB1A 3RB4A 2R8JA 1U9LA 2KG5A 5AI6A 2IA6A 2OXOA 4ED8A 4ECQA 4RNOA 3K4GA 5AKXA 1RQLA 3BZKA 3WK7A 4UB8U 3WK8A 3QUBA 4ECRA 1X66A 4C7ZA 3MR5A 2C2RA 2F8KA 4GXJA 3NVZA 5KFWA 3SR6A 1NJWA 8ICNA 3UMBA 1UCVA 2K8AA 3PSTA 1KBUA 4M2YA 1C7YA 4HYKA 3TAQA 2F76X 2G06A 3KD3A 1J2NA 1X6IA 3PMNA 1FIQA 4LZGA 5AI0A 5DDMA 5ALFA 2K4HA 2BCSA 4NY8A 5KL1B 4CF5A 3RH4A 2E8NA 4DL2A 3L5KA 7ICRA 2VA2A 4IQWA 9ICVA 2W54A 3RJIA 3E2EA 5AM3A 1SL0A 4P0QA 2EANA 4UQGA 4JK1A 1X42A 1P7DA 2FPKA 7ICKA 4ED6A 4RQ1A 8ICMA 1S0MA 1ZQMA 2LYBA 4I2IA 1ZD3A 4CF3A 1KFDA 5J0RA 4GLXA 4RNMA 4KLOA 4F4KA 3DV9A 1X9MA 2BPCA 1QLNA 1RPLA 2MUTA 1YZ6A 3TADA 3FM9A 9ICGA 3HILA 4PHEA 2DPIA 5CB1A 1U49A 4QNLA 2ZUBA 3Q8SB 3RRGA 3TADC 4Z6DA 4DSLA 4NM1A 3C28A 1QSLA 2KSOB 2ZIVA 5KG2A 3E0FA 4XQ8A 2WAQC 2JH7A 3ED5A 4OO1J 2AGPA 1OW5A 4X5VA 8ICXA 4M9GA 5ALZA 1L7MA 3PSPA 2RHFA 3S6JA 3ISBA 5IILA 4MEXA 5DG9A 3QU9A 4KLDA 1T94A 2ZUCA 4PGXA 4DL7A 8ICJA 4FO6A 8ICGA 3C2MA 9ICTA 4F92B 2NRTA 3GIMA 3LVVA 4C4TA 1L7OA 4J03A 5AKEA 2Y0SF 5T14A 3EUB2 1ZQ1C 3WKAA 5KT6A 2I5HA 5AICA 1L3TA 2LPEA 4DFKA 4IRDA 4TURA 4J9LA 4Y2VA 2H3IA 5K4LA 5KFKA 2B21A 4ZOHC 4C4SA 3V72A 1TE2A 3RJGA 2HHSA 3ZDDA 3OHAA 2W8LA 5J29A 3R9KA 2JHDA 3BZCA 4Q8FA 1D9DA 7ICQA 2MSNA 1ZQKA 3ZD8A 8ICLA 2XC9A 2KOBA 2UVUA 4P0PA 3WKCA 2HSZA 1UQVA 4ELVA 1NJYA 3SAFA 4E0DA 2K8BB 1JALA 3IP4B 1RG6A 3PX6A 4O5EA 4YN4A 7ICMA 2D3DA 2QARB 4EEKA 2ALZA 2DFLA 2WHEA 3GFKB 2E1EA 4ECWA 5KFRA 5KFSA 9ICAA 1L6NA 4FS1A 4NWIA 2LYAA 5IIKA 2LM1A 2KHQA 4KLLA 3OTQA 2FDRA 3EYZA 2A1AA 4RUAA 4KLGA 2G08A 4QWDA 1ZQRA 2OYYA 1QH9A 4RPYA 5KFEA 1NJXA 2EZXA 4O3OA 1CRXA 5ALPA 5KTQA 2JRZA 2PKEA 5JRTA 4BWMA 5AI4A 2K4PA 3C23A 2XO7A 2BDPA 1SIJA 2W03A 4RQ7A 2IOHA 1CEZA 1WCLA 5KFZA 2ZJAA 4I2AA 2F2AB 4JUZA 4BDPA 3RRHA 5GTIU 2W9BA 4IC9A 3PSIA 4QIWF 3Q8PB 3OPXA 3N7RC 4FBUA 2YMPA 4KLQA 9ICKA 5BOMA 2YMLA 4DF8A 2WF7A 4O5KA 4Y2PA 1J97A 1RYRA 4DLGA 3Q8KA 5KT4A 4USAA 5CJ7A 5KT7A 2KTQA 4NLCA 3JPSA 2RQ5A 5DG8A 2H3ZA 3DEEA 3ALRA 1ZQWA 3H40A 1TK5A 4I28A 3MGHA 5L1MA 4C8LA 4PH5A 2YQEA 3TKAA 2PFNA 3BJYA 5J2IA 4J9QA 3RAXA 4GFJA 1N61A 1NZBA 1L3UA 2KJ9A 2G07A 3QEAZ 5J0UA 7ICNA 5EE0A 4PPXA 4IQTA 5AI9A 1ZQQA 2FLLA 4M9NA 4UAUA 2K4IA 2FLPA 3B0YA 2PFPA 5EWFA 5L1KA 4F5QA 4PHDA 3BS5B 3CRXA 1SL2A 1L8OA 1JI7A 2E5SA 2EAMA 4QZFA 1TV9A 3T5LA 1RQNA 3ISDA 4UAZA 3QU4A 1JXLA 5ALEA 4DWIA 2AH5A 3RR7A 3MDAA 2WF5A 3AMZA 4O3MA 5J2KA 2HHXA 5KFYA 1T4GA 3QUQA 3N7SC 1U47A 3K1RB 3KOOA 5L9XA 5CR0A 9ICMA 2PXIA 4LJXA 2XGPA 5KFLA 2DPJA 2NV3A 2N1RA 2KHVA 2LBOA 2YN4A 2G0AA 2G5HB 4O3SA 2ZIUA 3K75D 1TVAA 3BQ0A 2W55A 4DL6A 2KSOA 1XO0A 1LKYB 1GO3F 4LVSA 1MQ2A 2LHTA 4DFPA 3A0HU 5AKLA 3F5AA 3PSFA 3TQ1A 4C0ZA 2BZFA 3WK4A 2A19A 2KEYA 2W3SA 3IV6A 3RB6A 2KN7A 4RQMA 1KQQA 4J9MA 3NRZA 2HBMA 4YR2A 3OGUA 3PW5A 2HHUA 4O0IA 4M6WA 4KLUA 5EE1A 2GLEA 8ICHA 4PZOA 3TARA 4O3RA 4NLGA 1ZQJA 2V4RA 2VIXA 2VKQA 3RAQA 2ZJ5A 1XO1A 2RRDA 1O08A 2DQNB 2QB0A 4DOCA 1QQ6A 3Q8RB 5CEHA 2DKXA 1D9FA 5TISU 4EBDA 1SGGA 1Q3UA 2BCUA 2HBJA 1FO4A 1PK1B 5CP2A 2XGQA 4QWAA 4M9LA 4F4ZA 2DWQA 5A0LA 3I28A 4EBCA 2NO5A 5HMMA 5AIBA 4J9PA 3PW2A 2BHNA 1PVPA 3SAGA 3L3FX 2F3NA 5ALDA 2MA1A 2ZJ8A 4Y2RA 2A1JB 4A8EA 3RJEA 5KFCA 4KLJA 4IS7A 4UB2A 5J8YA 2KK0A 2H3QA 3WKEA 1EXNA 4UATA 1CUKA 5EE3A 1T7PA 3BQ1A 4Y2YA 2W9MA 2F8LA 3AM9A 5J8YC 2MRLA 1MA7A 7ICGA 8ICEA 8ICTA 3MBYA 4UB5A 3TANA 1PZNA 5ALSA 2DKZA 1RXVA 5J2BA 1L3SA 3HP6A 9ICSA 4KTQA 3OSNA 3AU6A 2C2DA 2HCFA 3GILA 4MFCA 2NRXA 4DFDA 2R8KA 7ICIA 4QZDA 3GIKA 2DF4B 3QX7A 4QZEA 1ZQEA 5ALYA 2EH9A 1MC8A 5ALRA 1ZETA 3H0MB 3IG8A 2HI0A 4UB1A 5KFQA 2YY6A 4YR3A 1JMSA 1NK5A 5AKJA 3M1YA 4R66A 4DQSA 4C8NA 2GH1A 3QU2A 1U45A 3WK6A 2I1QA 2OHFA 2VJ5A 3NVWA 3MGIA 4QWEA 2V4QA 9ICCA 4LZDA 2W3RA 1NKEA 4C7YA 3AUOA 3LWLA 4ED7A 4IQVA 1SZPA 3OHBA 1X40A 2R8IA 2W9CA 5B5EU 3SV4A 3T5KA 4QWBA 1OXJA 3C2LA 5KFBA 4Q8EA 4IQUA 3M6ZA 1RZTA 2ZIXA 4DF4A 1MN8A 1ZD2P 4B9NA 3H4DA 4F8RA 3PR4A 5F9NA 2BGWA 1IG6A 1YT3A 1ZOLA 2E1FA 2AXTU 1RYSA 3F2CA 3GU3A 1MQ3A 1SKSA 4ED0A 3KHRA 3UQ2A 5C5JA 5KG4A 1FFUA 5L1LA 2Y1IA 2JZBA 5DBCA 3ZDBA 1NJZA 4QJFB 2I9GA 1ZJMA 4QZIA 1Z1BA 1SL1A 2DL0A 3RFAA 3A0BU 5F9LA 1TKDA 1WG8A 4ACOA 1N48A 1HUZA 2GO7A 4M04A 2Q0ZX 5DGAA 1Z00A 1DXSA 2ASDA 5TZVA 5JTIA 5G5HA 3PVXA 1SV0A 4F5PA 3RBEA 4WJ3B 2MU2A 1O03A 1J2MA 1XSNA 2PFOA 3V7LA 4Z6CA 1BPZA 3KTQA 4G3IA 3PZPA 1SV0C 5AK5A 3F2DA 4C8MA 5ALNA 5J2GA 1Z4NA 2HOFA 1ZQPA 2HBKA 2JV3A 4C80A 4DFJA 1BPDA 2F1IA 5AK3A 4NLZA 1B43A 3H0LB 2BQUA 2C22A 2RDIA 2EQYA 4TQSA 4UB3A 2AJQA 2JH1A 2P66A 1UA1A 4DEZA 3ETLA 4RQ3A 2FE9A 2W04A 4DOBA 4GXKA 7ICJA 4AYBF 4F71A 3GV5B 3IRUA 9ICOA 2W7OA 3NVYA 4DL4A 4GC7A 3UMCA 9ICLA 5J0PA 4DQRA 1FEZA 1ZQVA 3KZIU 1QTMA 4O5CA 2CPRA 4F5NA 1KW4A 1DK2A 3KHLA 5IINA 3QEBZ 1N60A 2HVIA 2FJ6A 3DDHA 3KFUF 3UXPA 2UVWA 3QE9Y 1MSWD 7ICOA 5D49A 3SQIA 4QIWC 1Z4OA 5J2CA 1ZQNA 3RJJA 2KZ3A 4R8UB 3IHQB 1D8LA 4MFFA 4UB6U 5KG0A 5J0YA 4Q45A 4JV2A 4K4IA 4J9KA 4F4WA 5KFXA 1S0VA 1L8LA 3H8MA 4BXOB 2WF8A
chains in the Genus database with same CATH topology
1JI7A 1X66A 2EAMA 2QB1A 1PK1B 1OW5A 1SV0C 2QB0B 2F8KA 1Z1VA 2EAPA 1UCVA 1COKA 2JV3A 1B4FA 3BQ7A 2F3NA 3K1RB 1SXEA 1SXDA 4NL9A 2D8CA 2E8MA 1X40A 5JRTA 1PK3A 4IS7A 4MHVA 2K4PA 2Y9TA 5J8YA 1SV4A 2FE9A 2QKQA 1LKYA 4NL9C 1OXJA 3KKAA 3SEIA 2E8NA 2LPEA 2YTUA 5J8YC 1F0MA 5KNIA 2KSOA 1LKYB 3KKAC 2KE7A 2EAOA 3BS7A 2DKZA 2K60A 2E8OA 2EANA 1KW4A 1X9XA 2ES6A 1WWVA 3IDWA 4NJ8A 1B0XA 4PZNA 2B6GA 2F44A 2Y9UA 3SENA 5L1MA 2ESEA 1WWUA 4RQMA 3TADA 3HILA 1V85A 2GLEA 2QARA 4PZOA 2DL0A 3BS5A 1UQVA 1V38A 2KMDA 5JU5A 2L5YA 3TADC 1PK1A 2KG5A 2LMRA 2QB0A 1DXSA 2KSOB 1RG6A 4RQNA 5JTIA 2KIVA 3TACB 1SV0A 3H8MA 5F3XB 2D3DA 2DKXA 2QARB 2E8PA 3BS5B 1SGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JI7 A;  1X66 A;  2EAM A;  2QB1 A;  1PK1 B;  1OW5 A;  1SV0 C;  2QB0 B;  2F8K A;  1Z1V A;  2EAP A;  1UCV A;  1COK A;  2JV3 A;  1B4F A;  3BQ7 A;  2F3N A;  3K1R B;  1SXE A;  1SXD A;  4NL9 A;  2D8C A;  2E8M A;  1X40 A;  5JRT A;  1PK3 A;  4IS7 A;  4MHV A;  2K4P A;  2Y9T A;  5J8Y A;  1SV4 A;  2FE9 A;  2QKQ A;  1LKY A;  4NL9 C;  1OXJ A;  3KKA A;  3SEI A;  2E8N A;  2LPE A;  2YTU A;  5J8Y C;  1F0M A;  5KNI A;  2KSO A;  1LKY B;  3KKA C;  2KE7 A;  2EAO A;  3BS7 A;  2DKZ A;  2K60 A;  2E8O A;  2EAN A;  1KW4 A;  1X9X A;  2ES6 A;  1WWV A;  3IDW A;  4NJ8 A;  1B0X A;  4PZN A;  2B6G A;  2F44 A;  2Y9U A;  3SEN A;  5L1M A;  2ESE A;  1WWU A;  4RQM A;  3TAD A;  3HIL A;  1V85 A;  2GLE A;  2QAR A;  4PZO A;  2DL0 A;  3BS5 A;  1UQV A;  1V38 A;  2KMD A;  5JU5 A;  2L5Y A;  3TAD C;  1PK1 A;  2KG5 A;  2LMR A;  2QB0 A;  1DXS A;  2KSO B;  1RG6 A;  4RQN A;  5JTI A;  2KIV A;  3TAC B;  1SV0 A;  3H8M A;  5F3X B;  2D3D A;  2DKX A;  2QAR B;  2E8P A;  3BS5 B;  1SGG A; 
#chains in the Genus database with same CATH topology
 4F4Y A;  9ICI A;  4Y2T A;  5EWG A;  3WK9 A;  4Z6E A;  9ICU A;  1TK0 A;  2ZIW B;  3PW7 A;  5AHX A;  2XY7 A;  1ECW A;  5J0W A;  2EAP A;  1ZQX A;  1SB3 C;  3M6K A;  5KFG A;  4U7C A;  4QW9 A;  4F93 B;  1H38 A;  4JWM A;  1B4F A;  4CF4 A;  5IIM A;  2JR5 A;  1XC9 A;  2HOQ A;  5AKK A;  1NK9 A;  4TUQ A;  1BNO A;  1ZD5 A;  1UT5 A;  4I29 A;  2D8C A;  5KFU A;  1A0P A;  5J0Q A;  1K1S A;  4RQ0 A;  7ICS A;  2OM6 A;  2KVS A;  1PVQ A;  3HKZ C;  4ECZ A;  3ZI4 A;  1SKR A;  4M9J A;  1QQ7 A;  1IXR A;  2WF9 A;  2LI6 A;  3HPO A;  2WAQ F;  5AKH A;  1KSP A;  1UT8 A;  3M8S A;  4TQR A;  1BPY A;  3C1Y A;  2EAO A;  2HBL A;  5AK4 A;  5ALK A;  1CI4 A;  5HHH A;  3WKD A;  4I27 A;  4J9R A;  2ES6 A;  4RUC A;  1HIW A;  5AIA A;  5ALQ A;  3C21 A;  4YVZ A;  9ICJ A;  2R8G A;  3IDW A;  4B6J A;  1B0X A;  2HHW A;  8ICK A;  1F44 A;  3EZ5 A;  2XY5 A;  7ICU A;  5KFF A;  4RPX A;  1F5S A;  1N63 A;  2RP5 A;  4CRX A;  1ZQC A;  3EPI A;  1LV5 A;  1X6J A;  1Q3V A;  3RTV A;  2W9A A;  3UXN A;  9ICR A;  1U48 A;  4YMO A;  8ICC A;  4J9S A;  1NK6 A;  2IHN A;  4EZ9 A;  5KG6 A;  5KAI U;  2JMG A;  2LMR A;  2CN1 A;  4C8K A;  4DS4 A;  4RQN A;  7ICH A;  4RNN A;  2PMZ C;  2PI5 A;  3QU7 A;  4RQ2 A;  2KKP A;  2ATL A;  5KG1 A;  2LM4 A;  4ELT A;  5FP0 A;  2RDJ A;  1X9S A;  8ICZ A;  3NUQ A;  4R63 A;  4QZC A;  3G6V A;  5J2F A;  4RQ8 A;  8ICF A;  4YMN A;  4UBC A;  1UA0 A;  3K1Z A;  1M6Y A;  1ZQY A;  4PHP A;  2W7P A;  3M9O B;  3RB0 A;  3O0F A;  2XID A;  9ICN A;  2XVT A;  4C8O A;  2JEI A;  1Z3E B;  4BWJ A;  1PK3 A;  4Z6F A;  1HUO A;  8ICY A;  1HEK A;  4R65 A;  2CXY A;  2ZTC A;  2KVC A;  5J0O A;  5ALI A;  4ECV A;  4B9L A;  2XY6 A;  4BX9 C;  4KX3 A;  4K4H A;  2OCE A;  2F77 X;  4DO9 A;  5AM5 A;  4XA5 A;  7ICT A;  3V6K A;  2YTU A;  2JEG A;  4RQ5 A;  2O6K A;  3KZX A;  2ZTE A;  5KNI A;  3AU2 A;  4YR0 A;  2BKE A;  4I2E A;  4DQQ A;  8ICI A;  4JWN A;  5J0S A;  3WKB A;  2BCQ A;  3SV3 A;  3V7J A;  5DBA A;  5J0T A;  1V97 A;  1SWW A;  5KFJ A;  4C4R A;  2B6G A;  3T5J A;  4J9O A;  4P0Q B;  3RF9 A;  4FBT A;  4G9B A;  3PO4 A;  1WWU A;  4QZ9 A;  4FZL A;  2IOF A;  1SZH A;  1WYG A;  1ZXI A;  4JV1 A;  5CHG A;  4OJ6 A;  5DLF A;  1V38 A;  4EX6 A;  3GV7 B;  1U4B A;  3N7P D;  4QZA A;  5ALV A;  1IV8 A;  1KKX A;  3D2Q A;  5HR6 A;  2MUT B;  5AKI A;  3RB3 A;  5C0Y A;  3GZF A;  7ICF A;  8ICU A;  2OEH A;  4IR9 A;  4EYI B;  1RDF A;  1TAU A;  2MAX A;  4Q44 A;  4KLT A;  5CRX A;  2ZIV B;  3GII A;  2NRV A;  8ICO A;  2WB1 C;  2HHT A;  2IMW P;  3GQC A;  4DQI A;  1DGJ A;  2K4E A;  3M8R A;  4JV0 A;  1ZYQ A;  3NTU A;  5DKW A;  4Y2U A;  2NO4 A;  3IN5 A;  5KFA A;  3CP8 A;  5KFM A;  2Q4T A;  3JPQ A;  4IRC A;  5DQG A;  1JXE A;  2HVH A;  3HRD D;  5BOL A;  1ZJN A;  8ICS A;  3FDS A;  4MHV A;  3BDP A;  5DQH A;  1S97 A;  3ZDE A;  4ELU A;  5DQI A;  3C5F A;  4RT3 A;  2FI1 A;  1ZQG A;  3BQ2 A;  3SZ2 A;  3AL0 B;  7ICE A;  2R8H A;  1DK3 A;  4YQW A;  1UPH A;  4ECT A;  4DSJ A;  2NYV A;  7ICP A;  8ICV A;  3H8J A;  2NRZ A;  3WK5 A;  4EEL A;  1LVH A;  2K60 A;  2F1H A;  3Q8Q B;  5KFH A;  1NI3 A;  3Q8L A;  2AQ0 A;  4NM2 A;  1L7P A;  4J9N A;  4OJ5 A;  3NGD A;  4NJ8 A;  1S0O A;  4PZN A;  2Y9U A;  9ICF A;  2I6X A;  3AN1 A;  3ETR A;  3BQT A;  1WCN A;  2HHQ A;  1ZQI A;  3AQF A;  5L1I A;  1JUD A;  1V85 A;  2M9N A;  4P4M A;  3H8W A;  3T5H A;  8ICB A;  2QAR A;  2WF6 A;  4O9M A;  4YP3 A;  4IRK A;  3M9M B;  3F2B A;  1X9W A;  1LB2 B;  4PL2 A;  2RLT A;  4P0P B;  3TAC B;  4OCZ A;  4UB4 A;  2UVV A;  2JGA A;  1OUQ A;  4F2R A;  1NKC A;  2HW3 A;  1KEJ A;  3MGV A;  1BPE A;  3RH6 A;  5E79 U;  4FE3 A;  1URJ A;  5CWR A;  3HWT A;  3GV8 B;  4Q43 A;  1ZQF A;  3PW0 A;  4FFD A;  4CE6 A;  5J2A A;  3PR5 B;  3FAH A;  4UAV A;  5KG5 A;  5DDY A;  1K5O A;  1ZD4 A;  1SXE A;  4DS5 A;  3RJK A;  2KP7 A;  5DB9 A;  3D2S A;  1DOQ A;  1JX4 A;  2Y9T A;  3QUT A;  4OD0 A;  2QKQ A;  8ICP A;  2BQR A;  4KX5 A;  4ED2 A;  3ZDC A;  3QZ7 A;  1T8E A;  2YMQ A;  3UQ0 A;  2H3F A;  2P6U A;  4EZ6 A;  5ALX A;  2J6U A;  3WU2 U;  3GIJ A;  2R18 A;  3PW4 A;  1S77 D;  9ICW A;  2XIC A;  3ZD9 A;  3PY8 A;  2AGO A;  1XNS A;  4RQ6 A;  4DL3 A;  4AP9 A;  2KIW A;  2YX8 A;  4UAR A;  4AYB C;  2W9B B;  4KLH A;  3ICX A;  4K4G A;  2Z7J A;  3NAS A;  2P35 A;  2BPG A;  1Q8K A;  1KTQ A;  3PX4 A;  5J2H A;  3MR6 A;  1ZQO A;  1TAM A;  4DSF A;  5KAF U;  2WTF A;  5AKY A;  3NS1 A;  1S76 D;  2FLN A;  3BS5 A;  3G6Y A;  5DB7 A;  4GXI A;  8ICQ A;  4CNQ A;  2L5Y A;  3TFR A;  2Y0S C;  4ECU A;  2QLT A;  4DQP A;  3N4M B;  1IM4 A;  1S9F A;  4KLI A;  5DB8 A;  5F3X B;  1N62 A;  1PUZ A;  5JUM A;  4US8 A;  3VC8 A;  1B22 A;  3KBB A;  2KJ5 A;  4RQ4 A;  1Q46 A;  2VA3 A;  1Z1V A;  3V7K A;  3F53 A;  1ZQZ A;  2YB4 A;  2XCP A;  5KFD A;  5KL8 B;  3NRW A;  1N2X A;  1TK8 A;  1RXW A;  4I2H A;  5IIJ A;  1JRP A;  1VLB A;  5CA7 A;  4UW9 A;  4I2F A;  5AKG A;  2VAN A;  3C2K A;  2E8M A;  1A77 A;  3PNC A;  3T79 A;  4ICA A;  3MFI A;  2AGQ A;  1LKY A;  3IM1 A;  5B66 U;  1NOM A;  5AM1 A;  5GTH U;  1SKW A;  4IL6 U;  1BPX A;  4I2J A;  4DSK A;  3KHG A;  3SI8 A;  5IIO A;  4QZB A;  3JPP A;  2KZM A;  4IR1 A;  3BS7 A;  3D6J A;  2FMP A;  2ZIU B;  2LYH A;  1X9X A;  3H0R B;  3M7D A;  2KV2 A;  1C20 A;  1SWV A;  3MFH A;  2C2E A;  5J2J A;  3QU5 A;  3ORY A;  3N97 B;  3HW8 A;  4NLB A;  4FZN A;  4BGD A;  3PML A;  9ICP A;  3C29 A;  9ICE A;  5KT5 A;  3ONN A;  3HT3 A;  3SEN A;  2ESE A;  5DLG A;  4I2B A;  2KJ8 A;  4M9H A;  4F50 A;  4OJP A;  3H7I A;  4P2H A;  5AI8 A;  3IG5 A;  4GIB A;  2D6F C;  1PK1 A;  4KLS A;  2XCA A;  5ALW A;  5HP4 A;  1ZQB A;  4M6W B;  1XU4 A;  2OWO A;  1A76 A;  3H4B A;  2M0N A;  2KZZ A;  4ZH4 A;  1NKB A;  2Y1J A;  3HX0 A;  2QB0 B;  3AQE A;  1Z19 A;  5DG7 A;  5AK6 A;  2A1J A;  4O3N A;  2WFA A;  5ALT A;  4NXZ A;  1XS9 D;  2ODG A;  3OJU A;  3BQ7 A;  4DCC A;  3UXO A;  8ICW A;  1ZQL A;  3TI0 A;  4O3P A;  4F91 B;  2IOF K;  3TFS A;  2G5I B;  1BPB A;  2P6R A;  1BNP A;  3SAH A;  2KFN A;  3RJF A;  4NLK A;  4PGY A;  8ICR A;  2YMM A;  1KL9 A;  3EPG A;  2HHV A;  1NZP A;  5KG7 A;  2HDO A;  4EBE A;  8ICA A;  1ZRM A;  1ED1 A;  1F0M A;  2K8C B;  4F2S A;  3V6J A;  5KG3 A;  1X2I A;  3I1Y A;  2HOI A;  4QZ8 A;  2NRW A;  1KLN A;  1ARO P;  3CYM A;  1ZQA A;  3B9J A;  2V9W A;  3B0X A;  2AHO B;  4CDG A;  4FS2 A;  1QQ5 A;  4YG2 A;  3H8S A;  4B9T A;  1ZQH A;  2CRX A;  3RH5 A;  4YD1 A;  2KMD A;  4UAW A;  2BR0 A;  2F1J A;  1PVR A;  1TAQ A;  4EYH B;  1DGS A;  2DBY A;  4RPZ A;  3U26 A;  2A3V A;  4QZH A;  1KDH A;  4QZG A;  5ALJ A;  9ICQ A;  3L4P A;  2ISO A;  1XSL A;  4ED1 A;  1WUD A;  2LKY A;  1BGX T;  3QNM A;  1N5X A;  4PL1 A;  3ISC A;  4R64 A;  2DGZ A;  1VDV A;  4I2C A;  1RYU A;  4F4X A;  5ALU A;  4KLM A;  2EZZ A;  1D8B A;  2G09 A;  5AI5 A;  2AQ4 A;  1S8O A;  2BCV A;  4NL9 A;  3C1Z A;  2ISP A;  1BVS A;  2H5X A;  3PX0 A;  2OH2 A;  1KFS A;  5DGB A;  4EEN A;  1RM6 C;  1SV4 A;  4P4P A;  4KIT B;  4NL9 C;  1Y88 A;  9ICX A;  4OJL A;  4B9S A;  2XI9 A;  1KN5 A;  1T3Q A;  4MFA A;  4FZM A;  2FPL A;  4Y2J A;  3VCB A;  2J6T A;  4B9V A;  4Y2X A;  4DLE A;  5J2D A;  4MF2 A;  2W9C B;  4Y2S A;  2ASL A;  1HJP A;  4KLF A;  5J0X A;  5DB6 A;  7ICL A;  4OJO A;  2ZG6 A;  4YD2 A;  5KT3 A;  4ECY A;  2ZIX B;  3D2N A;  4DSI A;  4US9 A;  5ALL A;  2ZTD A;  5BPC A;  1V9P A;  1WWV A;  3EW9 A;  2BQ3 A;  1FFV A;  3FYH A;  3CNH A;  3C5G A;  1A6S A;  1YZ7 A;  4XUS A;  3JPN A;  1QSY A;  5EE9 A;  3T3F A;  2E3T A;  3NVV A;  3M9N B;  4PHA A;  2KKV A;  2JEJ A;  3FC4 A;  3HKZ F;  3OSP A;  3E58 A;  5JU5 A;  3UMG A;  3AEV A;  2W43 A;  1L5U A;  2JZB B;  2PFQ A;  4YXM A;  3LWM A;  3EWA A;  3LYS A;  1XWL A;  5AKZ A;  3PO5 A;  2JEF A;  4KMU A;  3TAP A;  4ECX A;  5D4B A;  3RR8 A;  1N56 A;  4RU9 A;  4GC6 A;  2AU0 A;  1QSS A;  4P4O A;  3GDX A;  4KMO B;  1Z00 B;  1JIH A;  3QXG A;  3MDC A;  2KIC A;  4Y2Q A;  1ZQT A;  5HML A;  3LDA A;  4KLE A;  3CW2 C;  1T3N A;  1COK A;  4UAY A;  1K1Q A;  5D46 A;  3JPO A;  1KRP A;  4DFM A;  2BCR A;  3PV8 A;  4MF8 A;  4CGZ A;  1S5L U;  1L3V A;  2BPF A;  1SXD A;  5J2E A;  5AM4 A;  4I2D A;  3J81 j;  3F5E A;  3JPR A;  2W11 A;  9ICB A;  1JRO A;  2EDU A;  3RBD A;  3RJH A;  1N5W A;  1NK7 A;  1NK4 A;  3KKA A;  4O3Q A;  3KHH A;  5III A;  2PMZ F;  5KFT A;  5DBB A;  3Q8M A;  5KFN A;  4EEY A;  5EWE A;  1XSP A;  4ECS A;  2VJ4 A;  1DRG A;  1IIP A;  3KKA C;  2KE7 A;  3MC1 A;  3UPQ A;  3MAB A;  3SMV A;  2E8O A;  3G6X A;  2IBK A;  2HMX A;  3HJE A;  2FMS A;  3THV A;  2FPM A;  5HR7 A;  4R8U A;  4KN7 A;  3MR3 A;  4F5O A;  4DL5 A;  4TUP A;  1L7N A;  2F44 A;  1S10 A;  4YCX A;  3SD7 A;  2ZXI A;  1UHU A;  2FMQ A;  4YXJ A;  1D8Y A;  4BXO A;  4JMU A;  1ZQU A;  2EZY A;  4JB3 A;  2IHM A;  3LVW A;  4XRH A;  5KFP A;  4NV0 A;  2ZIW A;  4EX7 A;  4B9U A;  2GWS A;  4F72 A;  2KIV A;  2H3V A;  2E8P A;  5L1J A;  3OJS A;  4KN4 A;  2B0C A;  5AM0 A;  3QYP A;  2QB1 A;  3QUC A;  1NNL A;  4QW8 A;  4RZR A;  4M47 A;  1TFR A;  5KT2 A;  2ZUD A;  1NK0 A;  3UM9 A;  2BDU A;  4DOA A;  3V6H A;  2ZXH A;  1S0N A;  5AM2 A;  7ICV A;  1QCK A;  5HNK A;  4ED3 A;  2C28 A;  5ALH A;  4B9M A;  4F3O A;  4YMM A;  2JXJ A;  4UBB A;  2GOL A;  5ALM A;  5ALG A;  2DUY A;  2W8K A;  4PGQ A;  3JPT A;  5G5G A;  5ALO A;  4F5R A;  4UAS A;  4TUS A;  2KFZ A;  3N28 A;  2PI4 A;  4DSE A;  3SEI A;  5KFI A;  4RT2 A;  1JN3 A;  5KFV A;  3QZ8 A;  2ASJ A;  2K89 A;  1AQ6 A;  2KD1 A;  1ZQS A;  3SYZ A;  4PJ0 U;  4U6P A;  4CCH A;  2VA8 A;  4BJQ A;  2WB1 F;  5H2F U;  1KFT A;  1COO A;  4BUG A;  5EOZ A;  2KNJ A;  3ZDA A;  4YFK A;  4I2G A;  1NK8 A;  1ZQD A;  3MR2 A;  3LK9 A;  4HAI A;  4MEY A;  5KFO A;  2UVR A;  2J6S A;  1VJ5 A;  1ZRN A;  4M0A A;  5HHI A;  4NLN A;  3I76 A;  4QWC A;  9ICH A;  2YB1 A;  3RB4 A;  2R8J A;  1U9L A;  2KG5 A;  5AI6 A;  2IA6 A;  2OXO A;  4ED8 A;  4ECQ A;  4RNO A;  3K4G A;  5AKX A;  1RQL A;  3BZK A;  3WK7 A;  4UB8 U;  3WK8 A;  3QUB A;  4ECR A;  1X66 A;  4C7Z A;  3MR5 A;  2C2R A;  2F8K A;  4GXJ A;  3NVZ A;  5KFW A;  3SR6 A;  1NJW A;  8ICN A;  3UMB A;  1UCV A;  2K8A A;  3PST A;  1KBU A;  4M2Y A;  1C7Y A;  4HYK A;  3TAQ A;  2F76 X;  2G06 A;  3KD3 A;  1J2N A;  1X6I A;  3PMN A;  1FIQ A;  4LZG A;  5AI0 A;  5DDM A;  5ALF A;  2K4H A;  2BCS A;  4NY8 A;  5KL1 B;  4CF5 A;  3RH4 A;  2E8N A;  4DL2 A;  3L5K A;  7ICR A;  2VA2 A;  4IQW A;  9ICV A;  2W54 A;  3RJI A;  3E2E A;  5AM3 A;  1SL0 A;  4P0Q A;  2EAN A;  4UQG A;  4JK1 A;  1X42 A;  1P7D A;  2FPK A;  7ICK A;  4ED6 A;  4RQ1 A;  8ICM A;  1S0M A;  1ZQM A;  2LYB A;  4I2I A;  1ZD3 A;  4CF3 A;  1KFD A;  5J0R A;  4GLX A;  4RNM A;  4KLO A;  4F4K A;  3DV9 A;  1X9M A;  2BPC A;  1QLN A;  1RPL A;  2MUT A;  1YZ6 A;  3TAD A;  3FM9 A;  9ICG A;  3HIL A;  4PHE A;  2DPI A;  5CB1 A;  1U49 A;  4QNL A;  2ZUB A;  3Q8S B;  3RRG A;  3TAD C;  4Z6D A;  4DSL A;  4NM1 A;  3C28 A;  1QSL A;  2KSO B;  2ZIV A;  5KG2 A;  3E0F A;  4XQ8 A;  2WAQ C;  2JH7 A;  3ED5 A;  4OO1 J;  2AGP A;  1OW5 A;  4X5V A;  8ICX A;  4M9G A;  5ALZ A;  1L7M A;  3PSP A;  2RHF A;  3S6J A;  3ISB A;  5IIL A;  4MEX A;  5DG9 A;  3QU9 A;  4KLD A;  1T94 A;  2ZUC A;  4PGX A;  4DL7 A;  8ICJ A;  4FO6 A;  8ICG A;  3C2M A;  9ICT A;  4F92 B;  2NRT A;  3GIM A;  3LVV A;  4C4T A;  1L7O A;  4J03 A;  5AKE A;  2Y0S F;  5T14 A;  3EUB 2;  1ZQ1 C;  3WKA A;  5KT6 A;  2I5H A;  5AIC A;  1L3T A;  2LPE A;  4DFK A;  4IRD A;  4TUR A;  4J9L A;  4Y2V A;  2H3I A;  5K4L A;  5KFK A;  2B21 A;  4ZOH C;  4C4S A;  3V72 A;  1TE2 A;  3RJG A;  2HHS A;  3ZDD A;  3OHA A;  2W8L A;  5J29 A;  3R9K A;  2JHD A;  3BZC A;  4Q8F A;  1D9D A;  7ICQ A;  2MSN A;  1ZQK A;  3ZD8 A;  8ICL A;  2XC9 A;  2KOB A;  2UVU A;  4P0P A;  3WKC A;  2HSZ A;  1UQV A;  4ELV A;  1NJY A;  3SAF A;  4E0D A;  2K8B B;  1JAL A;  3IP4 B;  1RG6 A;  3PX6 A;  4O5E A;  4YN4 A;  7ICM A;  2D3D A;  2QAR B;  4EEK A;  2ALZ A;  2DFL A;  2WHE A;  3GFK B;  2E1E A;  4ECW A;  5KFR A;  5KFS A;  9ICA A;  1L6N A;  4FS1 A;  4NWI A;  2LYA A;  5IIK A;  2LM1 A;  2KHQ A;  4KLL A;  3OTQ A;  2FDR A;  3EYZ A;  2A1A A;  4RUA A;  4KLG A;  2G08 A;  4QWD A;  1ZQR A;  2OYY A;  1QH9 A;  4RPY A;  5KFE A;  1NJX A;  2EZX A;  4O3O A;  1CRX A;  5ALP A;  5KTQ A;  2JRZ A;  2PKE A;  5JRT A;  4BWM A;  5AI4 A;  2K4P A;  3C23 A;  2XO7 A;  2BDP A;  1SIJ A;  2W03 A;  4RQ7 A;  2IOH A;  1CEZ A;  1WCL A;  5KFZ A;  2ZJA A;  4I2A A;  2F2A B;  4JUZ A;  4BDP A;  3RRH A;  5GTI U;  2W9B A;  4IC9 A;  3PSI A;  4QIW F;  3Q8P B;  3OPX A;  3N7R C;  4FBU A;  2YMP A;  4KLQ A;  9ICK A;  5BOM A;  2YML A;  4DF8 A;  2WF7 A;  4O5K A;  4Y2P A;  1J97 A;  1RYR A;  4DLG A;  3Q8K A;  5KT4 A;  4USA A;  5CJ7 A;  5KT7 A;  2KTQ A;  4NLC A;  3JPS A;  2RQ5 A;  5DG8 A;  2H3Z A;  3DEE A;  3ALR A;  1ZQW A;  3H40 A;  1TK5 A;  4I28 A;  3MGH A;  5L1M A;  4C8L A;  4PH5 A;  2YQE A;  3TKA A;  2PFN A;  3BJY A;  5J2I A;  4J9Q A;  3RAX A;  4GFJ A;  1N61 A;  1NZB A;  1L3U A;  2KJ9 A;  2G07 A;  3QEA Z;  5J0U A;  7ICN A;  5EE0 A;  4PPX A;  4IQT A;  5AI9 A;  1ZQQ A;  2FLL A;  4M9N A;  4UAU A;  2K4I A;  2FLP A;  3B0Y A;  2PFP A;  5EWF A;  5L1K A;  4F5Q A;  4PHD A;  3BS5 B;  3CRX A;  1SL2 A;  1L8O A;  1JI7 A;  2E5S A;  2EAM A;  4QZF A;  1TV9 A;  3T5L A;  1RQN A;  3ISD A;  4UAZ A;  3QU4 A;  1JXL A;  5ALE A;  4DWI A;  2AH5 A;  3RR7 A;  3MDA A;  2WF5 A;  3AMZ A;  4O3M A;  5J2K A;  2HHX A;  5KFY A;  1T4G A;  3QUQ A;  3N7S C;  1U47 A;  3K1R B;  3KOO A;  5L9X A;  5CR0 A;  9ICM A;  2PXI A;  4LJX A;  2XGP A;  5KFL A;  2DPJ A;  2NV3 A;  2N1R A;  2KHV A;  2LBO A;  2YN4 A;  2G0A A;  2G5H B;  4O3S A;  2ZIU A;  3K75 D;  1TVA A;  3BQ0 A;  2W55 A;  4DL6 A;  2KSO A;  1XO0 A;  1LKY B;  1GO3 F;  4LVS A;  1MQ2 A;  2LHT A;  4DFP A;  3A0H U;  5AKL A;  3F5A A;  3PSF A;  3TQ1 A;  4C0Z A;  2BZF A;  3WK4 A;  2A19 A;  2KEY A;  2W3S A;  3IV6 A;  3RB6 A;  2KN7 A;  4RQM A;  1KQQ A;  4J9M A;  3NRZ A;  2HBM A;  4YR2 A;  3OGU A;  3PW5 A;  2HHU A;  4O0I A;  4M6W A;  4KLU A;  5EE1 A;  2GLE A;  8ICH A;  4PZO A;  3TAR A;  4O3R A;  4NLG A;  1ZQJ A;  2V4R A;  2VIX A;  2VKQ A;  3RAQ A;  2ZJ5 A;  1XO1 A;  2RRD A;  1O08 A;  2DQN B;  2QB0 A;  4DOC A;  1QQ6 A;  3Q8R B;  5CEH A;  2DKX A;  1D9F A;  5TIS U;  4EBD A;  1SGG A;  1Q3U A;  2BCU A;  2HBJ A;  1FO4 A;  1PK1 B;  5CP2 A;  2XGQ A;  4QWA A;  4M9L A;  4F4Z A;  2DWQ A;  5A0L A;  3I28 A;  4EBC A;  2NO5 A;  5HMM A;  5AIB A;  4J9P A;  3PW2 A;  2BHN A;  1PVP A;  3SAG A;  3L3F X;  2F3N A;  5ALD A;  2MA1 A;  2ZJ8 A;  4Y2R A;  2A1J B;  4A8E A;  3RJE A;  5KFC A;  4KLJ A;  4IS7 A;  4UB2 A;  5J8Y A;  2KK0 A;  2H3Q A;  3WKE A;  1EXN A;  4UAT A;  1CUK A;  5EE3 A;  1T7P A;  3BQ1 A;  4Y2Y A;  2W9M A;  2F8L A;  3AM9 A;  5J8Y C;  2MRL A;  1MA7 A;  7ICG A;  8ICE A;  8ICT A;  3MBY A;  4UB5 A;  3TAN A;  1PZN A;  5ALS A;  2DKZ A;  1RXV A;  5J2B A;  1L3S A;  3HP6 A;  9ICS A;  4KTQ A;  3OSN A;  3AU6 A;  2C2D A;  2HCF A;  3GIL A;  4MFC A;  2NRX A;  4DFD A;  2R8K A;  7ICI A;  4QZD A;  3GIK A;  2DF4 B;  3QX7 A;  4QZE A;  1ZQE A;  5ALY A;  2EH9 A;  1MC8 A;  5ALR A;  1ZET A;  3H0M B;  3IG8 A;  2HI0 A;  4UB1 A;  5KFQ A;  2YY6 A;  4YR3 A;  1JMS A;  1NK5 A;  5AKJ A;  3M1Y A;  4R66 A;  4DQS A;  4C8N A;  2GH1 A;  3QU2 A;  1U45 A;  3WK6 A;  2I1Q A;  2OHF A;  2VJ5 A;  3NVW A;  3MGI A;  4QWE A;  2V4Q A;  9ICC A;  4LZD A;  2W3R A;  1NKE A;  4C7Y A;  3AUO A;  3LWL A;  4ED7 A;  4IQV A;  1SZP A;  3OHB A;  1X40 A;  2R8I A;  2W9C A;  5B5E U;  3SV4 A;  3T5K A;  4QWB A;  1OXJ A;  3C2L A;  5KFB A;  4Q8E A;  4IQU A;  3M6Z A;  1RZT A;  2ZIX A;  4DF4 A;  1MN8 A;  1ZD2 P;  4B9N A;  3H4D A;  4F8R A;  3PR4 A;  5F9N A;  2BGW A;  1IG6 A;  1YT3 A;  1ZOL A;  2E1F A;  2AXT U;  1RYS A;  3F2C A;  3GU3 A;  1MQ3 A;  1SKS A;  4ED0 A;  3KHR A;  3UQ2 A;  5C5J A;  5KG4 A;  1FFU A;  5L1L A;  2Y1I A;  2JZB A;  5DBC A;  3ZDB A;  1NJZ A;  4QJF B;  2I9G A;  1ZJM A;  4QZI A;  1Z1B A;  1SL1 A;  2DL0 A;  3RFA A;  3A0B U;  5F9L A;  1TKD A;  1WG8 A;  4ACO A;  1N48 A;  1HUZ A;  2GO7 A;  4M04 A;  2Q0Z X;  5DGA A;  1Z00 A;  1DXS A;  2ASD A;  5TZV A;  5JTI A;  5G5H A;  3PVX A;  1SV0 A;  4F5P A;  3RBE A;  4WJ3 B;  2MU2 A;  1O03 A;  1J2M A;  1XSN A;  2PFO A;  3V7L A;  4Z6C A;  1BPZ A;  3KTQ A;  4G3I A;  3PZP A;  1SV0 C;  5AK5 A;  3F2D A;  4C8M A;  5ALN A;  5J2G A;  1Z4N A;  2HOF A;  1ZQP A;  2HBK A;  2JV3 A;  4C80 A;  4DFJ A;  1BPD A;  2F1I A;  5AK3 A;  4NLZ A;  1B43 A;  3H0L B;  2BQU A;  2C22 A;  2RDI A;  2EQY A;  4TQS A;  4UB3 A;  2AJQ A;  2JH1 A;  2P66 A;  1UA1 A;  4DEZ A;  3ETL A;  4RQ3 A;  2FE9 A;  2W04 A;  4DOB A;  4GXK A;  7ICJ A;  4AYB F;  4F71 A;  3GV5 B;  3IRU A;  9ICO A;  2W7O A;  3NVY A;  4DL4 A;  4GC7 A;  3UMC A;  9ICL A;  5J0P A;  4DQR A;  1FEZ A;  1ZQV A;  3KZI U;  1QTM A;  4O5C A;  2CPR A;  4F5N A;  1KW4 A;  1DK2 A;  3KHL A;  5IIN A;  3QEB Z;  1N60 A;  2HVI A;  2FJ6 A;  3DDH A;  3KFU F;  3UXP A;  2UVW A;  3QE9 Y;  1MSW D;  7ICO A;  5D49 A;  3SQI A;  4QIW C;  1Z4O A;  5J2C A;  1ZQN A;  3RJJ A;  2KZ3 A;  4R8U B;  3IHQ B;  1D8L A;  4MFF A;  4UB6 U;  5KG0 A;  5J0Y A;  4Q45 A;  4JV2 A;  4K4I A;  4J9K A;  4F4W A;  5KFX A;  1S0V A;  1L8L A;  3H8M A;  4BXO B;  2WF8 A; 
#chains in the Genus database with same CATH homology
 1JI7 A;  1X66 A;  2EAM A;  2QB1 A;  1PK1 B;  1OW5 A;  1SV0 C;  2QB0 B;  2F8K A;  1Z1V A;  2EAP A;  1UCV A;  1COK A;  2JV3 A;  1B4F A;  3BQ7 A;  2F3N A;  3K1R B;  1SXE A;  1SXD A;  4NL9 A;  2D8C A;  2E8M A;  1X40 A;  5JRT A;  1PK3 A;  4IS7 A;  4MHV A;  2K4P A;  2Y9T A;  5J8Y A;  1SV4 A;  2FE9 A;  2QKQ A;  1LKY A;  4NL9 C;  1OXJ A;  3KKA A;  3SEI A;  2E8N A;  2LPE A;  2YTU A;  5J8Y C;  1F0M A;  5KNI A;  2KSO A;  1LKY B;  3KKA C;  2KE7 A;  2EAO A;  3BS7 A;  2DKZ A;  2K60 A;  2E8O A;  2EAN A;  1KW4 A;  1X9X A;  2ES6 A;  1WWV A;  3IDW A;  4NJ8 A;  1B0X A;  4PZN A;  2B6G A;  2F44 A;  2Y9U A;  3SEN A;  5L1M A;  2ESE A;  1WWU A;  4RQM A;  3TAD A;  3HIL A;  1V85 A;  2GLE A;  2QAR A;  4PZO A;  2DL0 A;  3BS5 A;  1UQV A;  1V38 A;  2KMD A;  5JU5 A;  2L5Y A;  3TAD C;  1PK1 A;  2KG5 A;  2LMR A;  2QB0 A;  1DXS A;  2KSO B;  1RG6 A;  4RQN A;  5JTI A;  2KIV A;  3TAC B;  1SV0 A;  3H8M A;  5F3X B;  2D3D A;  2DKX A;  2QAR B;  2E8P A;  3BS5 B;  1SGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...