1RG6A

Solution structure of the c-terminal domain of p63
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
PTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords second splice variant p63
publication title Solution structure of the C-terminal domain of p63
rcsb
source organism Homo sapiens
total genus 13
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2003-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1rg6A00
2K4PA 2Y9TA 3TADC 2EAPA 4RQMA 1SGGA 4IS7A 2B6GA 1V38A 2ES6A 2KSOA 2E8PA 4MHVA 2FE9A 1LKYA 2KSOB 2D3DA 3TACB 2EAMA 2KG5A 1LKYB 3TADA 2KIVA 5J8YA 2F3NA 3H8MA 2Y9UA 2DKZA 1KW4A 2KE7A 1RG6A 2EANA 1X40A 3KKAC 2DL0A 2QB0A 2F44A 5KNIA 5JU5A 4NL9A 4PZNA 3HILA 2QB0B 1COKA 2LPEA 3SENA 1V85A 4NJ8A 2GLEA 2D8CA 1B4FA 1OW5A 2L5YA 1X66A 1SV0C 4RQNA 1WWUA 5JTIA 1DXSA 1OXJA 2YTUA 1X9XA 1PK3A 5L1MA 1F0MA 3BS5A 2KMDA 1JI7A 4PZOA 3IDWA 3BS5B 2F8KA 3SEIA 3K1RB 2LMRA 1UCVA 1SXDA 2E8NA 3KKAA 1UQVA 2QB1A 2EAOA 2JV3A 5J8YC 2K60A 1B0XA 5JRTA 1SV4A 2QKQA 2ESEA 5F3XB 1SXEA 2DKXA 4NL9C 3BS7A 1PK1A 2E8OA 1SV0A 2QARA 1PK1B 2E8MA 1WWVA 2QARB 3BQ7A 1Z1VA
chains in the Genus database with same CATH superfamily
4J9PA 3T5HA 4CF4A 4ED1A 2PFOA 2W55A 5J2JA 3ISCA 2PFPA 4IR9A 2F2AB 4R8UB 4LVSA 1NK8A 5KFUA 4ED0A 2ZUCA 1SZHA 3CRXA 4TUSA 2W3RA 1S0OA 3KZXA 3EW9A 5KFMA 3F5EA 2ZTEA 2ZUBA 3V7LA 5KL1B 3FAHA 2FI1A 5J2GA 2G06A 4TUPA 5AI9A 5E79U 2LYAA 2HOIA 2KHVA 4YMMA 5CEHA 4OO1J 1NK9A 3ZD9A 5D4BA 2W9CB 3V72A 4F4KA 4QW8A 5ALZA 5KFQA 1MQ3A 2L5YA 2JGAA 3UQ2A 1N48A 2JEIA 5KFYA 4CNQA 3TARA 4GFJA 2LYBA 3RR8A 4YN4A 4UB8U 3RH6A 2W9BA 2Q4TA 1TKDA 4DWIA 2HOFA 1ZQAA 3RH4A 4YG2A 2R8KA 1XSLA 2NRZA 4UASA 4UB5A 2XGPA 7ICKA 2KKPA 1T7PA 2A1JA 2YY6A 4Z6DA 2MU2A 1PK1A 3ORYA 3HRDD 5GTHU 4I2DA 1B4FA 4QZDA 3Q8LA 3TADC 1ZD3A 2ZJ8A 4DSKA 4F2SA 4O3NA 3HJEA 1ZQCA 5EOZA 4NXZA 1Z00B 3WK8A 3EZ5A 1LB2B 2KG5A 3TANA 4RQ7A 4F5PA 2V9WA 4YR2A 2E3TA 3V7JA 1RG6A 3KKAC 5IIMA 4UARA 3MR2A 2BZFA 4USAA 4FE3A 2WAQF 3Q8QB 9ICKA 4NLNA 4NLKA 3C1YA 3MDCA 3FDSA 4P0PB 1SV0C 2HHUA 1KKXA 3GV8B 4O3RA 5J2AA 2CPRA 3RFAA 3VC8A 1PK3A 5DLGA 2C2DA 3TFRA 5AK6A 4U6PA 4ICAA 2K8BB 1SL2A 4F8RA 5ALUA 2BHNA 1NJWA 1SWVA 4IQTA 2C2RA 4US8A 3E0FA 1JALA 1ZQXA 4EEKA 4F2RA 4Y2XA 2K4EA 1ZQQA 2HI0A 2QB1A 2V4QA 1TE2A 5KFKA 4J9LA 7ICOA 3F2CA 4NM2A 1L3UA 1SL1A 4RQ5A 3QZ8A 5B66U 3RB6A 3PSPA 3GIJA 1RYRA 5J2HA 1IG6A 4HYKA 2IHMA 3RJIA 5AKYA 4I2FA 5TISU 9ICPA 8ICGA 2HCFA 4O5CA 2KJ5A 9ICSA 2RRDA 4NV0A 5AM1A 3QUBA 1ZQRA 4LJXA 3Q8SB 1UT5A 4MFFA 2KSOB 5IIOA 4QZBA 4JV2A 3NUQA 4RNMA 3NRZA 4NY8A 3AM9A 4KLIA 5AKXA 1SB3C 3SV4A 4F92B 2F3NA 2RP5A 8ICNA 2KEYA 2JZBB 4ECWA 4XA5A 3M1YA 2KVSA 5AKJA 2HSZA 3PSFA 2XGQA 7ICMA 5EWEA 4FS2A 4QZHA 2QB0B 3F2DA 3N4MB 1N63A 4CCHA 2LPEA 1J2MA 4O9MA 4C4TA 2W43A 2ZIWA 4NJ8A 3N97B 1FFVA 2ATLA 2KZMA 2UVRA 3UQ0A 1YZ6A 1VLBA 1Q3VA 3EWAA 4EX7A 4EZ9A 4PL1A 1URJA 3TQ1A 1EXNA 2XI9A 2XY7A 4JB3A 4C4SA 5DBAA 3PR5B 2ZJAA 2PFNA 2E8NA 5DG9A 4HAIA 3NVVA 4EX6A 4C7ZA 1BNPA 3LK9A 3OTQA 9ICUA 4R64A 2F1IA 2IBKA 4Y2JA 4AYBC 2LKYA 2BPCA 4US9A 3DEEA 4C8NA 3TAPA 2W9AA 3RAQA 4Q8EA 2W04A 1NKEA 5AHXA 8ICBA 5KTQA 9ICGA 3HWTA 1AQ6A 2BCUA 1S77D 4IQVA 8ICMA 3T5KA 1Z1VA 3IN5A 4DOCA 4F3OA 3UMCA 7ICTA 5J0RA 3C29A 2VANA 4YMOA 2KVCA 4IS7A 4ECTA 1DGJA 2FLPA 4KLMA 7ICNA 4J9RA 1RPLA 3OJUA 5AK5A 4Y2QA 5AM2A 3D6JA 3WKDA 5KFNA 2JH7A 5J2BA 1KBUA 4F4XA 3D2QA 3T3FA 4MEXA 1KSPA 3LYSA 3G6VA 1RZTA 5ALWA 1XO1A 4PJ0U 4NWIA 5DDMA 3KHHA 3IG5A 3QU2A 8ICXA 3PW5A 1S97A 1NKBA 2H5XA 5KFTA 4RNNA 2ZG6A 4KLTA 3BZKA 5EWGA 1QTMA 2YMMA 5J0TA 1NK0A 2VA3A 4K4GA 9ICOA 5J0OA 8ICJA 4K4HA 2MAXA 3LWLA 4Y2PA 4I27A 1NJZA 3MFIA 1WUDA 5CB1A 3AUOA 3PVXA 3NVZA 5KFOA 2KJ8A 4YCXA 4P4PA 3KKAA 4UAUA 1TV9A 1QH9A 4R66A 1ZRMA 1NNLA 5KFWA 5HR7A 1PVQA 5ALJA 2AJQA 3QXGA 1D8YA 3QX7A 3B0XA 3QUQA 1SV0A 4PGYA 1ZQTA 5J0PA 3B0YA 2WF5A 5DBBA 1MSWD 2QARB 2ZJ5A 1S0MA 1Q8KA 2BR0A 1WYGA 2YB4A 2WTFA 5KG0A 3IG8A 4UB6U 1RYUA 2JH1A 2QLTA 3N7RC 3DV9A 3QZ7A 3DDHA 2D3DA 5AM4A 4DL5A 5DGBA 4E0DA 5KFEA 5KG5A 1X42A 5DKWA 5AI0A 4DFMA 1L7NA 3F53A 2BDUA 5ALSA 3L4PA 4F71A 5KNIA 5BPCA 2M0NA 4QZCA 1BPZA 4PZNA 8ICIA 3V7KA 1L6NA 1Z4OA 4BXOB 2KZ3A 4YD1A 4BDPA 3PX0A 5KT6A 4QZAA 3SENA 2NRXA 2UVVA 3UXNA 5C5JA 2C22A 3IV6A 3Q8RB 2ZTCA 9ICJA 5EE1A 3WKBA 3O0FA 2R8GA 2ZUDA 4NLZA 2ZIUB 1OXJA 2W9MA 2IMWP 1F0MA 2OHFA 5HHHA 5AI5A 3PX6A 2WB1C 4DOAA 4YR3A 5F9NA 2FPKA 3NASA 2FJ6A 1XO0A 2R8IA 5IINA 3IRUA 4O3PA 5CJ7A 2EH9A 2PI5A 3T5LA 4KLOA 5D49A 5J8YC 1O03A 3HW8A 3BJYA 5KT7A 4TQSA 4UB3A 4X5VA 2CN1A 4OJ5A 5CR0A 1ZQ1C 4JUZA 5B5EU 5KAIU 2HBMA 5EE3A 3SV3A 3SYZA 2N1RA 2HHSA 4B9NA 1KLNA 2DPIA 1J97A 2AGOA 3JPOA 4QZIA 4K4IA 4I2CA 3QU7A 4BX9C 4R8UA 3NGDA 1L8LA 3LDAA 4MF2A 8ICEA 3PW0A 1B22A 4KLSA 3QEAZ 5D46A 4C8KA 4QIWF 1SGGA 1KDHA 2B6GA 3KOOA 2R18A 3K75D 4MHVA 3GIIA 3GQCA 1N62A 2JR5A 2YX8A 5ALNA 4Z6CA 1CI4A 5J0QA 3KHLA 4F50A 2ALZA 7ICJA 1ZRNA 5KG3A 2KIVA 2JEFA 4DQIA 2WAQC 2KE7A 3SI8A 4UAVA 1CUKA 3CYMA 4M6WB 4ECSA 4YXMA 2W9CA 2UVWA 2DGZA 3D2SA 4DSEA 4JK1A 3V6HA 1T8EA 2ISPA 1BPXA 3QUCA 5HNKA 4QWCA 4EYHB 1P7DA 3F5AA 5KFPA 1RDFA 5JTIA 1DXSA 4F5NA 8ICOA 2LBOA 8ICTA 4ED7A 4IQUA 1FIQA 1JI7A 2HBJA 4RNOA 4RQ8A 4RQ2A 1UCVA 4QZEA 3M8RA 5DBCA 4RUAA 4ED8A 4DFPA 3PX4A 1O08A 3JPRA 2ISOA 4Q44A 3C28A 1QQ7A 1L3VA 2FDRA 2G5HB 5AIBA 2EAOA 2JV3A 4QWDA 2GOLA 1XSNA 2KN7A 2MA1A 4F4WA 1B0XA 2PXIA 2LI6A 3WKCA 4AP9A 1D9FA 3C5GA 4MF8A 5J0XA 3QUTA 3WK7A 2DBYA 4RPZA 1ECWA 4WJ3B 3H7IA 3SAHA 4DS4A 1BNOA 4M2YA 2F1JA 5A0LA 1UPHA 2H3VA 2VIXA 1UA0A 2KKVA 1ZXIA 3WK4A 3TI0A 5AK4A 4Q45A 4B9TA 4BUGA 3UMBA 1S8OA 1Z00A 4J03A 4DL6A 3L5KA 1Z19A 4RUCA 1LVHA 3JPQA 4QZ8A 9ICIA 2HHVA 3QYPA 3Q8PB 5DGAA 3E2EA 5KFXA 7ICUA 3GFKB 5EWFA 3HPOA 2P66A 2H3FA 4I2IA 2VJ4A 1RXVA 4KX5A 4ELVA 4FO6A 4C7YA 4DLEA 5L9XA 4PPXA 1JUDA 1S5LU 1N2XA 2GWSA 3RTVA 2J6SA 3ISDA 2D8CA 4P0PA 4RU9A 1DOQA 2LHTA 9ICNA 2YMQA 2YN4A 5AIAA 2BDPA 1X66A 2A3VA 8ICFA 3GZFA 5ALIA 3RBDA 1ZYQA 4BWMA 1SIJA 8ICHA 4J9OA 3AMZA 4OJOA 2FMSA 4Y2YA 4O0IA 3LVWA 2KMDA 2W8KA 7ICQA 1DK2A 5KFVA 3THVA 3F2BA 1GO3F 1XWLA 1SXDA 2P6RA 5DB8A 1T3QA 5KT2A 2KV2A 3G6YA 2Y1JA 1L7MA 9ICLA 3AQEA 3MGHA 1NZPA 4JWNA 4DO9A 7ICFA 1U49A 3ED5A 4C0ZA 1U45A 2ZXHA 3AU2A 1MA7A 2JRZA 2WF9A 3GDXA 3RBEA 5IIJA 2E8MA 1ZQNA 4DF8A 3BQ7A 5KFDA 4ELUA 4ECUA 5KFIA 4ED2A 2FPLA 5CP2A 2R8JA 2RLTA 4F91B 5AICA 1XS9D 4P0QB 2KSOA 5KFHA 4DFJA 4DQQA 5KFAA 5G5HA 2JZBA 5J8YA 3PMNA 4F4YA 4ZOHC 3IM1A 4IC9A 3C2MA 2W7OA 2QB0A 3RR7A 1BPDA 1KN5A 4M9NA 5JU5A 1XNSA 5J2CA 5ALMA 3B9JA 1SL0A 3MR3A 2KIWA 2PMZF 3H0RB 4CRXA 1NI3A 3ZDBA 2F8LA 2IA6A 2F77X 4IL6U 4O3OA 1JN3A 1KL9A 2MUTB 4R63A 4IQWA 1IM4A 1OW5A 3ZI4A 1VJ5A 2B0CA 2V4RA 1SKWA 4F5QA 3H4DA 2XO7A 4TURA 3VCBA 3WK5A 5KT3A 2W8LA 2ASDA 5ALOA 4UATA 5ALYA 4Q43A 1U9LA 3I28A 1BPYA 2XY6A 3C2LA 2H3IA 7ICSA 3RRGA 4F5RA 3JPPA 2HHWA 4KLJA 4IR1A 2CRXA 5T14A 1XC9A 4C8MA 1PVRA 3OSPA 3HX0A 4EENA 1F5SA 3TAQA 3H8JA 4P2HA 2IHNA 5DDYA 3N7PD 1OUQA 4G3IA 4FFDA 1N56A 1ZOLA 2G09A 1KTQA 2NV3A 5J2KA 4J9NA 2VA8A 3WKAA 4KLDA 4CGZA 4DSLA 4BJQA 1BGXT 5HP4A 3ICXA 1ZD4A 2Y1IA 1ZQGA 2RDIA 3FC4A 1MN8A 4DSJA 3OSNA 2K4IA 4RQMA 3GIKA 2DFLA 5KG2A 4FZLA 3TFSA 4Z6FA 4F72A 3HKZC 4B9MA 2AH5A 2ZIXB 9ICMA 2K89A 1LKYB 4Y2RA 2Y0SF 7ICIA 3CW2C 2E1EA 5ALHA 1ZQEA 1KW4A 2HDOA 1TAUA 3KBBA 5AI8A 2KK0A 2OXOA 4EYIB 5KG1A 3Q8MA 2G08A 4M9JA 1TAQA 3M9MB 3FYHA 2IOFK 2GLEA 4J9MA 5L1KA 2BCVA 1ZQUA 3M6KA 2RQ5A 3BQ1A 3RJFA 1AROP 5EE0A 8ICZA 5ALGA 4UAYA 2ZIVB 3JPTA 2VA2A 2E1FA 3MABA 4ED6A 3RB4A 3BQ2A 4YXJA 3RF9A 8ICCA 4EZ6A 5ALRA 2NRVA 5L1IA 3BS5B 1ZJMA 1T94A 5KG7A 3NVYA 1QSYA 4IRKA 5CHGA 2KP7A 3N28A 4KLFA 7ICPA 1JROA 2BQRA 1N5WA 2K60A 3PW2A 3QU9A 7ICRA 3MC1A 3WKEA 5KG6A 5F3XB 3BZCA 2E8OA 3A0BU 5HHIA 4PHPA 2QARA 4PL2A 2HHXA 3K4GA 4GXKA 4ECVA 2JEJA 3EPIA 9ICEA 2JEGA 1HUOA 1ZQBA 4GIBA 1ZQIA 8ICRA 2FLLA 2AQ0A 2KZZA 5AI4A 2C28A 2BQUA 2E8PA 1DGSA 4G9BA 4RQ3A 1RYSA 2EAMA 4MEYA 2A1AA 1QCKA 1SKRA 2O6KA 4QZGA 2NRTA 1ZQHA 1HEKA 4I2AA 2RDJA 2G07A 2AGQA 1NJXA 4BXOA 7ICLA 3RB3A 5C0YA 4Y2UA 4MFCA 3D2NA 4GXJA 8ICQA 2HVIA 1X9WA 1V85A 4M9HA 4F93B 1ZQSA 1KEJA 3PW4A 2Q0ZX 3SQIA 1DRGA 2ZIUA 1ZQPA 4OCZA 4QZ9A 1WWUA 2NO4A 4M9LA 3M7DA 3KHRA 9ICCA 3FM9A 3QE9Y 1T4GA 2AHOB 3UXOA 8ICWA 4ECRA 5DB7A 1A6SA 4JV0A 2AXTU 4GC6A 1QLNA 1WCLA 1CRXA 3SEIA 3OPXA 1NK5A 2PI4A 2RHFA 3K1ZA 2HW3A 2VKQA 1L3TA 1ZQVA 5K4LA 2BKEA 4J9KA 3AL0B 3H4BA 2BQ3A 3GILA 5KFBA 4QWAA 1N61A 5KAFU 3NS1A 4A8EA 2FPMA 2WF6A 3RH5A 2B21A 3Q8KA 1NKCA 3C5FA 4ECZA 3RRHA 4DL3A 8ICVA 1SKSA 4B9VA 2HBKA 4DSFA 2I9GA 4DL4A 2AGPA 4QJFB 2KNJA 3EUB2 4M47A 9ICRA 2FE9A 2YB1A 3C23A 2BPGA 2KHQA 3QNMA 3TACB 2XIDA 2OEHA 5J29A 1U47A 1ZETA 3UMGA 1KFDA 4Y2TA 5AKLA 4P4OA 1ZQZA 1ZD2P 2DKZA 5AM3A 4RT2A 5AKZA 3ETRA 4OJ6A 4M6WA 9ICBA 1Y88A 3PSTA 4R65A 1S0NA 3N7SC 5ALFA 8ICYA 5DQIA 1NZBA 2W03A 8ICLA 8ICPA 2K8AA 5AI6A 2P35A 4Y2SA 4NLCA 1KRPA 5L1LA 4PH5A 1QQ6A 2PFQA 1RQNA 2K4HA 2KJ9A 4B9UA 5HMMA 4ED3A 2GH1A 4J9SA 1RXWA 1TAMA 3T5JA 4IRCA 2DF4B 4C80A 1K1SA 1ZJNA 1C20A 1J2NA 2ASJA 1Q3UA 2XVTA 4M04A 3C21A 3H8SA 4YMNA 1PVPA 1JMSA 2NRWA 5J2EA 2LM4A 1YZ7A 1F44A 4KTQA 1UT8A 3BQ0A 2LYHA 4QZFA 3NTUA 5DG8A 3S6JA 8ICKA 2BCRA 1SV4A 2QKQA 5J2DA 3BS7A 5IIIA 5FP0A 1IV8A 2BGWA 2ZTDA 3KD3A 5ALKA 4QWBA 2R8HA 2XICA 3AEVA 5DG7A 4YFKA 4KN7A 1Z1BA 4I2EA 1ZQYA 1XSPA 2ES6A 3PV8A 5F9LA 4OJPA 2NO5A 5GTIU 4O3QA 5J2IA 2ASLA 4DQPA 2PMZC 1LV5A 5DQGA 4DOBA 3A0HU 3ZDCA 5JUMA 1NK7A 2PKEA 2I6XA 5J2FA 4O5EA 4PHEA 4UAZA 3H0MB 3JPNA 9ICWA 2W7PA 4DL2A 3AN1A 5CWRA 3KFUF 3GV5B 1JIHA 3SR6A 4KLUA 1TVAA 1ZQJA 1ZQLA 4RQNA 3KZIU 4DEZA 1ZQDA 1N5XA 2WB1F 2IOHA 5KFCA 4O3MA 1TK8A 5AKEA 2M9NA 2W9BB 3M8SA 1C7YA 2ZXIA 3K1RB 5J0UA 5J0YA 3GV7B 1ZQFA 1FFUA 4Y2VA 1COOA 4PHAA 5KFFA 4XUSA 2ESEA 5G5GA 4XRHA 3MR5A 2DKXA 2YMPA 3QU4A 4NL9C 2A1JB 4P4MA 4DF4A 1ED1A 1L7PA 3PNCA 3IHQB 1PK1B 3PW7A 4JV1A 4UBCA 1TFRA 2Y9TA 1X6IA 1WG8A 4I2HA 1WCNA 4FBUA 1S0VA 4CE6A 2Y0SC 4P0QA 3UXPA 1S76D 4ZH4A 3KHGA 5EE9A 5CRXA 2OH2A 3WK9A 1A76A 2OM6A 4UBBA 2F1HA 1M6YA 1PUZA 4OD0A 4MFAA 4CF3A 2WF7A 2CXYA 4KLGA 9ICXA 4F4ZA 3H40A 1A77A 5ALQA 5ALXA 3CP8A 1Z4NA 3H8MA 2IOFA 2KICA 4DQRA 2Y9UA 2BPFA 2I5HA 4NLGA 3SMVA 2DL0A 4QW9A 5BOLA 4LZGA 2D6FC 5DQHA 3ALRA 2MUTA 1KFTA 3OGUA 3HP6A 3MR6A 5KT4A 3OHAA 5KFSA 3ZD8A 5AKHA 4KX3A 2DPJA 4DS5A 3GIMA 4JMUA 4B9LA 3OJSA 1FEZA 1TK0A 2XCPA 1X9SA 4RQ6A 2YMLA 2KTQA 4KMOB 3JPSA 2F76X 2AQ4A 8ICUA 2YQEA 4C8OA 2HHTA 2VJ5A 5AM0A 3PO4A 3RAXA 4FS1A 2DQNB 4EEYA 5ALTA 5JRTA 3H8WA 4EBCA 5L1JA 4KMUA 5IIKA 4DSIA 1U4BA 3MDAA 1MQ2A 3MFHA 3RJKA 2W11A 2AU0A 1N60A 4QNLA 5KFGA 5AKIA 4YD2A 2EAPA 1SZPA 1JX4A 1V38A 4RQ1A 4JWMA 4UB4A 1NOMA 4RQ0A 2ZIXA 1LKYA 3ZDDA 4KLHA 2C2EA 3PR4A 2FMPA 4KN4A 4ECXA 2H3QA 4RPXA 4DCCA 2GO7A 5ALLA 4YQWA 1HJPA 1Z3EB 1V9PA 3E58A 3EPGA 4QWEA 4NM1A 4PGXA 2KFNA 3PZPA 2MRLA 1ZD5A 3CNHA 1S10A 2JMGA 2ZIWB 4GC7A 4PHDA 2ZIVA 4CDGA 4F5OA 5J0WA 4KLQA 1V97A 1QSLA 4I2BA 2FMQA 3MGIA 1X9XA 3ISBA 5L1MA 4YR0A 4ECYA 9ICFA 1JRPA 1RM6C 2BCQA 3BS5A 3M9NB 4DQSA 4Q8FA 4KLLA 4FBTA 4PZOA 3EYZA 3NRWA 1Q46A 1BVSA 1CEZA 4ECQA 7ICEA 1FO4A 4UW9A 2FLNA 2W3SA 4UB2A 3NVWA 3T79A 1H38A 5KFZA 3V6KA 3KTQA 2OYYA 5DLFA 1D9DA 5AKKA 4RQ4A 2Z7JA 4UQGA 1L3SA 9ICHA 4C4RA 4C8LA 2WFAA 7ICGA 4DL7A 1WWVA 4XQ8A 3AU6A 4U7CA 5J0SA 5BOMA 4YP3A 4RPYA 3RJEA 4KLEA 2K4PA 3L3FX 1BPBA 3UPQA 4ELTA 2OCEA 3RJHA 2K8CB 4I29A 2J6UA 2EZZA 2XC9A 4RT3A 1VDVA 5TZVA 2HOQA 2EZXA 2EZYA 3ETLA 2MSNA 4QIWC 4YVZA 3TADA 3U26A 5ALDA 4DFDA 3M9OB 1SWWA 1X40A 5CA7A 4IRDA 3J81j 3G6XA 8ICAA 3M6ZA 1ZQMA 4NL9A 2A19A 4B6JA 2WHEA 1ZQOA 1L5UA 4BWJA 2HHQA 4Z6EA 2HMXA 2E5SA 4EELA 4EBEA 3MBYA 5HMLA 3SAGA 1NJYA 5ALEA 2BCSA 4J9QA 2HBLA 1X9MA 5DB9A 4O3SA 4M9GA 3OHBA 3PSIA 3R9KA 5DB6A 4FZNA 3SZ2A 2JXJA 1L7OA 1T3NA 3SD7A 1KQQA 3RB0A 3IDWA 5ALPA 4I28A 2HVHA 7ICHA 2XCAA 4GLXA 5KFLA 3BQTA 1RQLA 1IXRA 5IILA 4UAWA 3BDPA 5H2FU 3AQFA 3V6JA 3TKAA 2UVUA 1A0PA 1QQ5A 1TK5A 4I2GA 1K1QA 4TUQA 4GXIA 2XY5A 4DLGA 1X2IA 2EQYA 2JHDA 1JXLA 1KFSA 3ZDEA 4AYBF 3HKZF 1D8BA 1DK3A 2J6TA 4RZRA 4O5KA 3H0LB 1ZQKA 1L8OA 3I76A 5AKGA 4B9SA 4EBDA 5ALVA 3QEBZ 1HIWA 7ICVA 1S9FA 1U48A 2NYVA 3ZDAA 3LVVA 1ZQWA 2EANA 3LWMA 2F44A 3RJJA 3ONNA 4NLBA 5KL8B 3HILA 3RJGA 2KFZA 1HUZA 3WK6A 1COKA 5KT5A 4OJLA 1X6JA 9ICAA 4FZMA 1PZNA 1JXEA 5AK3A 3IP4B 4TQRA 2DWQA 1UA1A 4PGQA 2EDUA 2LM1A 4KITB 3HT3A 1B43A 1NK4A 2H3ZA 1BPEA 2YTUA 5HR6A 1QSSA 5AM5A 4CF5A 9ICQA 2DUYA 9ICTA 4UB1A 3SAFA 2KD1A 2F8KA 3MGVA 5KFRA 2LMRA 1D8LA 4ACOA 9ICVA 4M0AA 3WU2U 2OWOA 3PMLA 5KG4A 2G0AA 1UQVA 3PY8A 2W54A 4I2JA 1YT3A 4BGDA 1NK6A 8ICSA 3PO5A 3QU5A 1MC8A 1XU4A 3I1YA 2WF8A 4LZDA 2G5IB 2I1QA 5KFJA 1SXEA 2P6UA 2KOBA 2ODGA 4DFKA 3C2KA 1IIPA 1K5OA 1UHUA 3UM9A 3GU3A 3C1ZA
chains in the Genus database with same CATH topology
2K4PA 2Y9TA 3TADC 2EAPA 4RQMA 1SGGA 4IS7A 2B6GA 1V38A 2ES6A 2KSOA 2E8PA 4MHVA 2FE9A 1LKYA 2KSOB 2D3DA 3TACB 2EAMA 2KG5A 1LKYB 3TADA 2KIVA 5J8YA 2F3NA 3H8MA 2Y9UA 2DKZA 1KW4A 2KE7A 1RG6A 2EANA 1X40A 3KKAC 2DL0A 2QB0A 2F44A 5KNIA 5JU5A 4NL9A 4PZNA 3HILA 2QB0B 1COKA 2LPEA 3SENA 1V85A 4NJ8A 2GLEA 2D8CA 1B4FA 1OW5A 2L5YA 1X66A 1SV0C 4RQNA 1WWUA 5JTIA 1DXSA 1OXJA 2YTUA 1X9XA 1PK3A 5L1MA 1F0MA 3BS5A 2KMDA 1JI7A 4PZOA 3IDWA 3BS5B 2F8KA 3SEIA 3K1RB 2LMRA 1UCVA 1SXDA 2E8NA 3KKAA 1UQVA 2QB1A 2EAOA 2JV3A 5J8YC 2K60A 1B0XA 5JRTA 1SV4A 2QKQA 2ESEA 5F3XB 1SXEA 2DKXA 4NL9C 3BS7A 1PK1A 2E8OA 1SV0A 2QARA 1PK1B 2E8MA 1WWVA 2QARB 3BQ7A 1Z1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4P A;  2Y9T A;  3TAD C;  2EAP A;  4RQM A;  1SGG A;  4IS7 A;  2B6G A;  1V38 A;  2ES6 A;  2KSO A;  2E8P A;  4MHV A;  2FE9 A;  1LKY A;  2KSO B;  2D3D A;  3TAC B;  2EAM A;  2KG5 A;  1LKY B;  3TAD A;  2KIV A;  5J8Y A;  2F3N A;  3H8M A;  2Y9U A;  2DKZ A;  1KW4 A;  2KE7 A;  1RG6 A;  2EAN A;  1X40 A;  3KKA C;  2DL0 A;  2QB0 A;  2F44 A;  5KNI A;  5JU5 A;  4NL9 A;  4PZN A;  3HIL A;  2QB0 B;  1COK A;  2LPE A;  3SEN A;  1V85 A;  4NJ8 A;  2GLE A;  2D8C A;  1B4F A;  1OW5 A;  2L5Y A;  1X66 A;  1SV0 C;  4RQN A;  1WWU A;  5JTI A;  1DXS A;  1OXJ A;  2YTU A;  1X9X A;  1PK3 A;  5L1M A;  1F0M A;  3BS5 A;  2KMD A;  1JI7 A;  4PZO A;  3IDW A;  3BS5 B;  2F8K A;  3SEI A;  3K1R B;  2LMR A;  1UCV A;  1SXD A;  2E8N A;  3KKA A;  1UQV A;  2QB1 A;  2EAO A;  2JV3 A;  5J8Y C;  2K60 A;  1B0X A;  5JRT A;  1SV4 A;  2QKQ A;  2ESE A;  5F3X B;  1SXE A;  2DKX A;  4NL9 C;  3BS7 A;  1PK1 A;  2E8O A;  1SV0 A;  2QAR A;  1PK1 B;  2E8M A;  1WWV A;  2QAR B;  3BQ7 A;  1Z1V A; 
#chains in the Genus database with same CATH topology
 4J9P A;  3T5H A;  4CF4 A;  4ED1 A;  2PFO A;  2W55 A;  5J2J A;  3ISC A;  2PFP A;  4IR9 A;  2F2A B;  4R8U B;  4LVS A;  1NK8 A;  5KFU A;  4ED0 A;  2ZUC A;  1SZH A;  3CRX A;  4TUS A;  2W3R A;  1S0O A;  3KZX A;  3EW9 A;  5KFM A;  3F5E A;  2ZTE A;  2ZUB A;  3V7L A;  5KL1 B;  3FAH A;  2FI1 A;  5J2G A;  2G06 A;  4TUP A;  5AI9 A;  5E79 U;  2LYA A;  2HOI A;  2KHV A;  4YMM A;  5CEH A;  4OO1 J;  1NK9 A;  3ZD9 A;  5D4B A;  2W9C B;  3V72 A;  4F4K A;  4QW8 A;  5ALZ A;  5KFQ A;  1MQ3 A;  2L5Y A;  2JGA A;  3UQ2 A;  1N48 A;  2JEI A;  5KFY A;  4CNQ A;  3TAR A;  4GFJ A;  2LYB A;  3RR8 A;  4YN4 A;  4UB8 U;  3RH6 A;  2W9B A;  2Q4T A;  1TKD A;  4DWI A;  2HOF A;  1ZQA A;  3RH4 A;  4YG2 A;  2R8K A;  1XSL A;  2NRZ A;  4UAS A;  4UB5 A;  2XGP A;  7ICK A;  2KKP A;  1T7P A;  2A1J A;  2YY6 A;  4Z6D A;  2MU2 A;  1PK1 A;  3ORY A;  3HRD D;  5GTH U;  4I2D A;  1B4F A;  4QZD A;  3Q8L A;  3TAD C;  1ZD3 A;  2ZJ8 A;  4DSK A;  4F2S A;  4O3N A;  3HJE A;  1ZQC A;  5EOZ A;  4NXZ A;  1Z00 B;  3WK8 A;  3EZ5 A;  1LB2 B;  2KG5 A;  3TAN A;  4RQ7 A;  4F5P A;  2V9W A;  4YR2 A;  2E3T A;  3V7J A;  1RG6 A;  3KKA C;  5IIM A;  4UAR A;  3MR2 A;  2BZF A;  4USA A;  4FE3 A;  2WAQ F;  3Q8Q B;  9ICK A;  4NLN A;  4NLK A;  3C1Y A;  3MDC A;  3FDS A;  4P0P B;  1SV0 C;  2HHU A;  1KKX A;  3GV8 B;  4O3R A;  5J2A A;  2CPR A;  3RFA A;  3VC8 A;  1PK3 A;  5DLG A;  2C2D A;  3TFR A;  5AK6 A;  4U6P A;  4ICA A;  2K8B B;  1SL2 A;  4F8R A;  5ALU A;  2BHN A;  1NJW A;  1SWV A;  4IQT A;  2C2R A;  4US8 A;  3E0F A;  1JAL A;  1ZQX A;  4EEK A;  4F2R A;  4Y2X A;  2K4E A;  1ZQQ A;  2HI0 A;  2QB1 A;  2V4Q A;  1TE2 A;  5KFK A;  4J9L A;  7ICO A;  3F2C A;  4NM2 A;  1L3U A;  1SL1 A;  4RQ5 A;  3QZ8 A;  5B66 U;  3RB6 A;  3PSP A;  3GIJ A;  1RYR A;  5J2H A;  1IG6 A;  4HYK A;  2IHM A;  3RJI A;  5AKY A;  4I2F A;  5TIS U;  9ICP A;  8ICG A;  2HCF A;  4O5C A;  2KJ5 A;  9ICS A;  2RRD A;  4NV0 A;  5AM1 A;  3QUB A;  1ZQR A;  4LJX A;  3Q8S B;  1UT5 A;  4MFF A;  2KSO B;  5IIO A;  4QZB A;  4JV2 A;  3NUQ A;  4RNM A;  3NRZ A;  4NY8 A;  3AM9 A;  4KLI A;  5AKX A;  1SB3 C;  3SV4 A;  4F92 B;  2F3N A;  2RP5 A;  8ICN A;  2KEY A;  2JZB B;  4ECW A;  4XA5 A;  3M1Y A;  2KVS A;  5AKJ A;  2HSZ A;  3PSF A;  2XGQ A;  7ICM A;  5EWE A;  4FS2 A;  4QZH A;  2QB0 B;  3F2D A;  3N4M B;  1N63 A;  4CCH A;  2LPE A;  1J2M A;  4O9M A;  4C4T A;  2W43 A;  2ZIW A;  4NJ8 A;  3N97 B;  1FFV A;  2ATL A;  2KZM A;  2UVR A;  3UQ0 A;  1YZ6 A;  1VLB A;  1Q3V A;  3EWA A;  4EX7 A;  4EZ9 A;  4PL1 A;  1URJ A;  3TQ1 A;  1EXN A;  2XI9 A;  2XY7 A;  4JB3 A;  4C4S A;  5DBA A;  3PR5 B;  2ZJA A;  2PFN A;  2E8N A;  5DG9 A;  4HAI A;  3NVV A;  4EX6 A;  4C7Z A;  1BNP A;  3LK9 A;  3OTQ A;  9ICU A;  4R64 A;  2F1I A;  2IBK A;  4Y2J A;  4AYB C;  2LKY A;  2BPC A;  4US9 A;  3DEE A;  4C8N A;  3TAP A;  2W9A A;  3RAQ A;  4Q8E A;  2W04 A;  1NKE A;  5AHX A;  8ICB A;  5KTQ A;  9ICG A;  3HWT A;  1AQ6 A;  2BCU A;  1S77 D;  4IQV A;  8ICM A;  3T5K A;  1Z1V A;  3IN5 A;  4DOC A;  4F3O A;  3UMC A;  7ICT A;  5J0R A;  3C29 A;  2VAN A;  4YMO A;  2KVC A;  4IS7 A;  4ECT A;  1DGJ A;  2FLP A;  4KLM A;  7ICN A;  4J9R A;  1RPL A;  3OJU A;  5AK5 A;  4Y2Q A;  5AM2 A;  3D6J A;  3WKD A;  5KFN A;  2JH7 A;  5J2B A;  1KBU A;  4F4X A;  3D2Q A;  3T3F A;  4MEX A;  1KSP A;  3LYS A;  3G6V A;  1RZT A;  5ALW A;  1XO1 A;  4PJ0 U;  4NWI A;  5DDM A;  3KHH A;  3IG5 A;  3QU2 A;  8ICX A;  3PW5 A;  1S97 A;  1NKB A;  2H5X A;  5KFT A;  4RNN A;  2ZG6 A;  4KLT A;  3BZK A;  5EWG A;  1QTM A;  2YMM A;  5J0T A;  1NK0 A;  2VA3 A;  4K4G A;  9ICO A;  5J0O A;  8ICJ A;  4K4H A;  2MAX A;  3LWL A;  4Y2P A;  4I27 A;  1NJZ A;  3MFI A;  1WUD A;  5CB1 A;  3AUO A;  3PVX A;  3NVZ A;  5KFO A;  2KJ8 A;  4YCX A;  4P4P A;  3KKA A;  4UAU A;  1TV9 A;  1QH9 A;  4R66 A;  1ZRM A;  1NNL A;  5KFW A;  5HR7 A;  1PVQ A;  5ALJ A;  2AJQ A;  3QXG A;  1D8Y A;  3QX7 A;  3B0X A;  3QUQ A;  1SV0 A;  4PGY A;  1ZQT A;  5J0P A;  3B0Y A;  2WF5 A;  5DBB A;  1MSW D;  2QAR B;  2ZJ5 A;  1S0M A;  1Q8K A;  2BR0 A;  1WYG A;  2YB4 A;  2WTF A;  5KG0 A;  3IG8 A;  4UB6 U;  1RYU A;  2JH1 A;  2QLT A;  3N7R C;  3DV9 A;  3QZ7 A;  3DDH A;  2D3D A;  5AM4 A;  4DL5 A;  5DGB A;  4E0D A;  5KFE A;  5KG5 A;  1X42 A;  5DKW A;  5AI0 A;  4DFM A;  1L7N A;  3F53 A;  2BDU A;  5ALS A;  3L4P A;  4F71 A;  5KNI A;  5BPC A;  2M0N A;  4QZC A;  1BPZ A;  4PZN A;  8ICI A;  3V7K A;  1L6N A;  1Z4O A;  4BXO B;  2KZ3 A;  4YD1 A;  4BDP A;  3PX0 A;  5KT6 A;  4QZA A;  3SEN A;  2NRX A;  2UVV A;  3UXN A;  5C5J A;  2C22 A;  3IV6 A;  3Q8R B;  2ZTC A;  9ICJ A;  5EE1 A;  3WKB A;  3O0F A;  2R8G A;  2ZUD A;  4NLZ A;  2ZIU B;  1OXJ A;  2W9M A;  2IMW P;  1F0M A;  2OHF A;  5HHH A;  5AI5 A;  3PX6 A;  2WB1 C;  4DOA A;  4YR3 A;  5F9N A;  2FPK A;  3NAS A;  2FJ6 A;  1XO0 A;  2R8I A;  5IIN A;  3IRU A;  4O3P A;  5CJ7 A;  2EH9 A;  2PI5 A;  3T5L A;  4KLO A;  5D49 A;  5J8Y C;  1O03 A;  3HW8 A;  3BJY A;  5KT7 A;  4TQS A;  4UB3 A;  4X5V A;  2CN1 A;  4OJ5 A;  5CR0 A;  1ZQ1 C;  4JUZ A;  5B5E U;  5KAI U;  2HBM A;  5EE3 A;  3SV3 A;  3SYZ A;  2N1R A;  2HHS A;  4B9N A;  1KLN A;  2DPI A;  1J97 A;  2AGO A;  3JPO A;  4QZI A;  4K4I A;  4I2C A;  3QU7 A;  4BX9 C;  4R8U A;  3NGD A;  1L8L A;  3LDA A;  4MF2 A;  8ICE A;  3PW0 A;  1B22 A;  4KLS A;  3QEA Z;  5D46 A;  4C8K A;  4QIW F;  1SGG A;  1KDH A;  2B6G A;  3KOO A;  2R18 A;  3K75 D;  4MHV A;  3GII A;  3GQC A;  1N62 A;  2JR5 A;  2YX8 A;  5ALN A;  4Z6C A;  1CI4 A;  5J0Q A;  3KHL A;  4F50 A;  2ALZ A;  7ICJ A;  1ZRN A;  5KG3 A;  2KIV A;  2JEF A;  4DQI A;  2WAQ C;  2KE7 A;  3SI8 A;  4UAV A;  1CUK A;  3CYM A;  4M6W B;  4ECS A;  4YXM A;  2W9C A;  2UVW A;  2DGZ A;  3D2S A;  4DSE A;  4JK1 A;  3V6H A;  1T8E A;  2ISP A;  1BPX A;  3QUC A;  5HNK A;  4QWC A;  4EYH B;  1P7D A;  3F5A A;  5KFP A;  1RDF A;  5JTI A;  1DXS A;  4F5N A;  8ICO A;  2LBO A;  8ICT A;  4ED7 A;  4IQU A;  1FIQ A;  1JI7 A;  2HBJ A;  4RNO A;  4RQ8 A;  4RQ2 A;  1UCV A;  4QZE A;  3M8R A;  5DBC A;  4RUA A;  4ED8 A;  4DFP A;  3PX4 A;  1O08 A;  3JPR A;  2ISO A;  4Q44 A;  3C28 A;  1QQ7 A;  1L3V A;  2FDR A;  2G5H B;  5AIB A;  2EAO A;  2JV3 A;  4QWD A;  2GOL A;  1XSN A;  2KN7 A;  2MA1 A;  4F4W A;  1B0X A;  2PXI A;  2LI6 A;  3WKC A;  4AP9 A;  1D9F A;  3C5G A;  4MF8 A;  5J0X A;  3QUT A;  3WK7 A;  2DBY A;  4RPZ A;  1ECW A;  4WJ3 B;  3H7I A;  3SAH A;  4DS4 A;  1BNO A;  4M2Y A;  2F1J A;  5A0L A;  1UPH A;  2H3V A;  2VIX A;  1UA0 A;  2KKV A;  1ZXI A;  3WK4 A;  3TI0 A;  5AK4 A;  4Q45 A;  4B9T A;  4BUG A;  3UMB A;  1S8O A;  1Z00 A;  4J03 A;  4DL6 A;  3L5K A;  1Z19 A;  4RUC A;  1LVH A;  3JPQ A;  4QZ8 A;  9ICI A;  2HHV A;  3QYP A;  3Q8P B;  5DGA A;  3E2E A;  5KFX A;  7ICU A;  3GFK B;  5EWF A;  3HPO A;  2P66 A;  2H3F A;  4I2I A;  2VJ4 A;  1RXV A;  4KX5 A;  4ELV A;  4FO6 A;  4C7Y A;  4DLE A;  5L9X A;  4PPX A;  1JUD A;  1S5L U;  1N2X A;  2GWS A;  3RTV A;  2J6S A;  3ISD A;  2D8C A;  4P0P A;  4RU9 A;  1DOQ A;  2LHT A;  9ICN A;  2YMQ A;  2YN4 A;  5AIA A;  2BDP A;  1X66 A;  2A3V A;  8ICF A;  3GZF A;  5ALI A;  3RBD A;  1ZYQ A;  4BWM A;  1SIJ A;  8ICH A;  4J9O A;  3AMZ A;  4OJO A;  2FMS A;  4Y2Y A;  4O0I A;  3LVW A;  2KMD A;  2W8K A;  7ICQ A;  1DK2 A;  5KFV A;  3THV A;  3F2B A;  1GO3 F;  1XWL A;  1SXD A;  2P6R A;  5DB8 A;  1T3Q A;  5KT2 A;  2KV2 A;  3G6Y A;  2Y1J A;  1L7M A;  9ICL A;  3AQE A;  3MGH A;  1NZP A;  4JWN A;  4DO9 A;  7ICF A;  1U49 A;  3ED5 A;  4C0Z A;  1U45 A;  2ZXH A;  3AU2 A;  1MA7 A;  2JRZ A;  2WF9 A;  3GDX A;  3RBE A;  5IIJ A;  2E8M A;  1ZQN A;  4DF8 A;  3BQ7 A;  5KFD A;  4ELU A;  4ECU A;  5KFI A;  4ED2 A;  2FPL A;  5CP2 A;  2R8J A;  2RLT A;  4F91 B;  5AIC A;  1XS9 D;  4P0Q B;  2KSO A;  5KFH A;  4DFJ A;  4DQQ A;  5KFA A;  5G5H A;  2JZB A;  5J8Y A;  3PMN A;  4F4Y A;  4ZOH C;  3IM1 A;  4IC9 A;  3C2M A;  2W7O A;  2QB0 A;  3RR7 A;  1BPD A;  1KN5 A;  4M9N A;  5JU5 A;  1XNS A;  5J2C A;  5ALM A;  3B9J A;  1SL0 A;  3MR3 A;  2KIW A;  2PMZ F;  3H0R B;  4CRX A;  1NI3 A;  3ZDB A;  2F8L A;  2IA6 A;  2F77 X;  4IL6 U;  4O3O A;  1JN3 A;  1KL9 A;  2MUT B;  4R63 A;  4IQW A;  1IM4 A;  1OW5 A;  3ZI4 A;  1VJ5 A;  2B0C A;  2V4R A;  1SKW A;  4F5Q A;  3H4D A;  2XO7 A;  4TUR A;  3VCB A;  3WK5 A;  5KT3 A;  2W8L A;  2ASD A;  5ALO A;  4UAT A;  5ALY A;  4Q43 A;  1U9L A;  3I28 A;  1BPY A;  2XY6 A;  3C2L A;  2H3I A;  7ICS A;  3RRG A;  4F5R A;  3JPP A;  2HHW A;  4KLJ A;  4IR1 A;  2CRX A;  5T14 A;  1XC9 A;  4C8M A;  1PVR A;  3OSP A;  3HX0 A;  4EEN A;  1F5S A;  3TAQ A;  3H8J A;  4P2H A;  2IHN A;  5DDY A;  3N7P D;  1OUQ A;  4G3I A;  4FFD A;  1N56 A;  1ZOL A;  2G09 A;  1KTQ A;  2NV3 A;  5J2K A;  4J9N A;  2VA8 A;  3WKA A;  4KLD A;  4CGZ A;  4DSL A;  4BJQ A;  1BGX T;  5HP4 A;  3ICX A;  1ZD4 A;  2Y1I A;  1ZQG A;  2RDI A;  3FC4 A;  1MN8 A;  4DSJ A;  3OSN A;  2K4I A;  4RQM A;  3GIK A;  2DFL A;  5KG2 A;  4FZL A;  3TFS A;  4Z6F A;  4F72 A;  3HKZ C;  4B9M A;  2AH5 A;  2ZIX B;  9ICM A;  2K89 A;  1LKY B;  4Y2R A;  2Y0S F;  7ICI A;  3CW2 C;  2E1E A;  5ALH A;  1ZQE A;  1KW4 A;  2HDO A;  1TAU A;  3KBB A;  5AI8 A;  2KK0 A;  2OXO A;  4EYI B;  5KG1 A;  3Q8M A;  2G08 A;  4M9J A;  1TAQ A;  3M9M B;  3FYH A;  2IOF K;  2GLE A;  4J9M A;  5L1K A;  2BCV A;  1ZQU A;  3M6K A;  2RQ5 A;  3BQ1 A;  3RJF A;  1ARO P;  5EE0 A;  8ICZ A;  5ALG A;  4UAY A;  2ZIV B;  3JPT A;  2VA2 A;  2E1F A;  3MAB A;  4ED6 A;  3RB4 A;  3BQ2 A;  4YXJ A;  3RF9 A;  8ICC A;  4EZ6 A;  5ALR A;  2NRV A;  5L1I A;  3BS5 B;  1ZJM A;  1T94 A;  5KG7 A;  3NVY A;  1QSY A;  4IRK A;  5CHG A;  2KP7 A;  3N28 A;  4KLF A;  7ICP A;  1JRO A;  2BQR A;  1N5W A;  2K60 A;  3PW2 A;  3QU9 A;  7ICR A;  3MC1 A;  3WKE A;  5KG6 A;  5F3X B;  3BZC A;  2E8O A;  3A0B U;  5HHI A;  4PHP A;  2QAR A;  4PL2 A;  2HHX A;  3K4G A;  4GXK A;  4ECV A;  2JEJ A;  3EPI A;  9ICE A;  2JEG A;  1HUO A;  1ZQB A;  4GIB A;  1ZQI A;  8ICR A;  2FLL A;  2AQ0 A;  2KZZ A;  5AI4 A;  2C28 A;  2BQU A;  2E8P A;  1DGS A;  4G9B A;  4RQ3 A;  1RYS A;  2EAM A;  4MEY A;  2A1A A;  1QCK A;  1SKR A;  2O6K A;  4QZG A;  2NRT A;  1ZQH A;  1HEK A;  4I2A A;  2RDJ A;  2G07 A;  2AGQ A;  1NJX A;  4BXO A;  7ICL A;  3RB3 A;  5C0Y A;  4Y2U A;  4MFC A;  3D2N A;  4GXJ A;  8ICQ A;  2HVI A;  1X9W A;  1V85 A;  4M9H A;  4F93 B;  1ZQS A;  1KEJ A;  3PW4 A;  2Q0Z X;  3SQI A;  1DRG A;  2ZIU A;  1ZQP A;  4OCZ A;  4QZ9 A;  1WWU A;  2NO4 A;  4M9L A;  3M7D A;  3KHR A;  9ICC A;  3FM9 A;  3QE9 Y;  1T4G A;  2AHO B;  3UXO A;  8ICW A;  4ECR A;  5DB7 A;  1A6S A;  4JV0 A;  2AXT U;  4GC6 A;  1QLN A;  1WCL A;  1CRX A;  3SEI A;  3OPX A;  1NK5 A;  2PI4 A;  2RHF A;  3K1Z A;  2HW3 A;  2VKQ A;  1L3T A;  1ZQV A;  5K4L A;  2BKE A;  4J9K A;  3AL0 B;  3H4B A;  2BQ3 A;  3GIL A;  5KFB A;  4QWA A;  1N61 A;  5KAF U;  3NS1 A;  4A8E A;  2FPM A;  2WF6 A;  3RH5 A;  2B21 A;  3Q8K A;  1NKC A;  3C5F A;  4ECZ A;  3RRH A;  4DL3 A;  8ICV A;  1SKS A;  4B9V A;  2HBK A;  4DSF A;  2I9G A;  4DL4 A;  2AGP A;  4QJF B;  2KNJ A;  3EUB 2;  4M47 A;  9ICR A;  2FE9 A;  2YB1 A;  3C23 A;  2BPG A;  2KHQ A;  3QNM A;  3TAC B;  2XID A;  2OEH A;  5J29 A;  1U47 A;  1ZET A;  3UMG A;  1KFD A;  4Y2T A;  5AKL A;  4P4O A;  1ZQZ A;  1ZD2 P;  2DKZ A;  5AM3 A;  4RT2 A;  5AKZ A;  3ETR A;  4OJ6 A;  4M6W A;  9ICB A;  1Y88 A;  3PST A;  4R65 A;  1S0N A;  3N7S C;  5ALF A;  8ICY A;  5DQI A;  1NZB A;  2W03 A;  8ICL A;  8ICP A;  2K8A A;  5AI6 A;  2P35 A;  4Y2S A;  4NLC A;  1KRP A;  5L1L A;  4PH5 A;  1QQ6 A;  2PFQ A;  1RQN A;  2K4H A;  2KJ9 A;  4B9U A;  5HMM A;  4ED3 A;  2GH1 A;  4J9S A;  1RXW A;  1TAM A;  3T5J A;  4IRC A;  2DF4 B;  4C80 A;  1K1S A;  1ZJN A;  1C20 A;  1J2N A;  2ASJ A;  1Q3U A;  2XVT A;  4M04 A;  3C21 A;  3H8S A;  4YMN A;  1PVP A;  1JMS A;  2NRW A;  5J2E A;  2LM4 A;  1YZ7 A;  1F44 A;  4KTQ A;  1UT8 A;  3BQ0 A;  2LYH A;  4QZF A;  3NTU A;  5DG8 A;  3S6J A;  8ICK A;  2BCR A;  1SV4 A;  2QKQ A;  5J2D A;  3BS7 A;  5III A;  5FP0 A;  1IV8 A;  2BGW A;  2ZTD A;  3KD3 A;  5ALK A;  4QWB A;  2R8H A;  2XIC A;  3AEV A;  5DG7 A;  4YFK A;  4KN7 A;  1Z1B A;  4I2E A;  1ZQY A;  1XSP A;  2ES6 A;  3PV8 A;  5F9L A;  4OJP A;  2NO5 A;  5GTI U;  4O3Q A;  5J2I A;  2ASL A;  4DQP A;  2PMZ C;  1LV5 A;  5DQG A;  4DOB A;  3A0H U;  3ZDC A;  5JUM A;  1NK7 A;  2PKE A;  2I6X A;  5J2F A;  4O5E A;  4PHE A;  4UAZ A;  3H0M B;  3JPN A;  9ICW A;  2W7P A;  4DL2 A;  3AN1 A;  5CWR A;  3KFU F;  3GV5 B;  1JIH A;  3SR6 A;  4KLU A;  1TVA A;  1ZQJ A;  1ZQL A;  4RQN A;  3KZI U;  4DEZ A;  1ZQD A;  1N5X A;  2WB1 F;  2IOH A;  5KFC A;  4O3M A;  1TK8 A;  5AKE A;  2M9N A;  2W9B B;  3M8S A;  1C7Y A;  2ZXI A;  3K1R B;  5J0U A;  5J0Y A;  3GV7 B;  1ZQF A;  1FFU A;  4Y2V A;  1COO A;  4PHA A;  5KFF A;  4XUS A;  2ESE A;  5G5G A;  4XRH A;  3MR5 A;  2DKX A;  2YMP A;  3QU4 A;  4NL9 C;  2A1J B;  4P4M A;  4DF4 A;  1ED1 A;  1L7P A;  3PNC A;  3IHQ B;  1PK1 B;  3PW7 A;  4JV1 A;  4UBC A;  1TFR A;  2Y9T A;  1X6I A;  1WG8 A;  4I2H A;  1WCN A;  4FBU A;  1S0V A;  4CE6 A;  2Y0S C;  4P0Q A;  3UXP A;  1S76 D;  4ZH4 A;  3KHG A;  5EE9 A;  5CRX A;  2OH2 A;  3WK9 A;  1A76 A;  2OM6 A;  4UBB A;  2F1H A;  1M6Y A;  1PUZ A;  4OD0 A;  4MFA A;  4CF3 A;  2WF7 A;  2CXY A;  4KLG A;  9ICX A;  4F4Z A;  3H40 A;  1A77 A;  5ALQ A;  5ALX A;  3CP8 A;  1Z4N A;  3H8M A;  2IOF A;  2KIC A;  4DQR A;  2Y9U A;  2BPF A;  2I5H A;  4NLG A;  3SMV A;  2DL0 A;  4QW9 A;  5BOL A;  4LZG A;  2D6F C;  5DQH A;  3ALR A;  2MUT A;  1KFT A;  3OGU A;  3HP6 A;  3MR6 A;  5KT4 A;  3OHA A;  5KFS A;  3ZD8 A;  5AKH A;  4KX3 A;  2DPJ A;  4DS5 A;  3GIM A;  4JMU A;  4B9L A;  3OJS A;  1FEZ A;  1TK0 A;  2XCP A;  1X9S A;  4RQ6 A;  2YML A;  2KTQ A;  4KMO B;  3JPS A;  2F76 X;  2AQ4 A;  8ICU A;  2YQE A;  4C8O A;  2HHT A;  2VJ5 A;  5AM0 A;  3PO4 A;  3RAX A;  4FS1 A;  2DQN B;  4EEY A;  5ALT A;  5JRT A;  3H8W A;  4EBC A;  5L1J A;  4KMU A;  5IIK A;  4DSI A;  1U4B A;  3MDA A;  1MQ2 A;  3MFH A;  3RJK A;  2W11 A;  2AU0 A;  1N60 A;  4QNL A;  5KFG A;  5AKI A;  4YD2 A;  2EAP A;  1SZP A;  1JX4 A;  1V38 A;  4RQ1 A;  4JWM A;  4UB4 A;  1NOM A;  4RQ0 A;  2ZIX A;  1LKY A;  3ZDD A;  4KLH A;  2C2E A;  3PR4 A;  2FMP A;  4KN4 A;  4ECX A;  2H3Q A;  4RPX A;  4DCC A;  2GO7 A;  5ALL A;  4YQW A;  1HJP A;  1Z3E B;  1V9P A;  3E58 A;  3EPG A;  4QWE A;  4NM1 A;  4PGX A;  2KFN A;  3PZP A;  2MRL A;  1ZD5 A;  3CNH A;  1S10 A;  2JMG A;  2ZIW B;  4GC7 A;  4PHD A;  2ZIV A;  4CDG A;  4F5O A;  5J0W A;  4KLQ A;  1V97 A;  1QSL A;  4I2B A;  2FMQ A;  3MGI A;  1X9X A;  3ISB A;  5L1M A;  4YR0 A;  4ECY A;  9ICF A;  1JRP A;  1RM6 C;  2BCQ A;  3BS5 A;  3M9N B;  4DQS A;  4Q8F A;  4KLL A;  4FBT A;  4PZO A;  3EYZ A;  3NRW A;  1Q46 A;  1BVS A;  1CEZ A;  4ECQ A;  7ICE A;  1FO4 A;  4UW9 A;  2FLN A;  2W3S A;  4UB2 A;  3NVW A;  3T79 A;  1H38 A;  5KFZ A;  3V6K A;  3KTQ A;  2OYY A;  5DLF A;  1D9D A;  5AKK A;  4RQ4 A;  2Z7J A;  4UQG A;  1L3S A;  9ICH A;  4C4R A;  4C8L A;  2WFA A;  7ICG A;  4DL7 A;  1WWV A;  4XQ8 A;  3AU6 A;  4U7C A;  5J0S A;  5BOM A;  4YP3 A;  4RPY A;  3RJE A;  4KLE A;  2K4P A;  3L3F X;  1BPB A;  3UPQ A;  4ELT A;  2OCE A;  3RJH A;  2K8C B;  4I29 A;  2J6U A;  2EZZ A;  2XC9 A;  4RT3 A;  1VDV A;  5TZV A;  2HOQ A;  2EZX A;  2EZY A;  3ETL A;  2MSN A;  4QIW C;  4YVZ A;  3TAD A;  3U26 A;  5ALD A;  4DFD A;  3M9O B;  1SWW A;  1X40 A;  5CA7 A;  4IRD A;  3J81 j;  3G6X A;  8ICA A;  3M6Z A;  1ZQM A;  4NL9 A;  2A19 A;  4B6J A;  2WHE A;  1ZQO A;  1L5U A;  4BWJ A;  2HHQ A;  4Z6E A;  2HMX A;  2E5S A;  4EEL A;  4EBE A;  3MBY A;  5HML A;  3SAG A;  1NJY A;  5ALE A;  2BCS A;  4J9Q A;  2HBL A;  1X9M A;  5DB9 A;  4O3S A;  4M9G A;  3OHB A;  3PSI A;  3R9K A;  5DB6 A;  4FZN A;  3SZ2 A;  2JXJ A;  1L7O A;  1T3N A;  3SD7 A;  1KQQ A;  3RB0 A;  3IDW A;  5ALP A;  4I28 A;  2HVH A;  7ICH A;  2XCA A;  4GLX A;  5KFL A;  3BQT A;  1RQL A;  1IXR A;  5IIL A;  4UAW A;  3BDP A;  5H2F U;  3AQF A;  3V6J A;  3TKA A;  2UVU A;  1A0P A;  1QQ5 A;  1TK5 A;  4I2G A;  1K1Q A;  4TUQ A;  4GXI A;  2XY5 A;  4DLG A;  1X2I A;  2EQY A;  2JHD A;  1JXL A;  1KFS A;  3ZDE A;  4AYB F;  3HKZ F;  1D8B A;  1DK3 A;  2J6T A;  4RZR A;  4O5K A;  3H0L B;  1ZQK A;  1L8O A;  3I76 A;  5AKG A;  4B9S A;  4EBD A;  5ALV A;  3QEB Z;  1HIW A;  7ICV A;  1S9F A;  1U48 A;  2NYV A;  3ZDA A;  3LVV A;  1ZQW A;  2EAN A;  3LWM A;  2F44 A;  3RJJ A;  3ONN A;  4NLB A;  5KL8 B;  3HIL A;  3RJG A;  2KFZ A;  1HUZ A;  3WK6 A;  1COK A;  5KT5 A;  4OJL A;  1X6J A;  9ICA A;  4FZM A;  1PZN A;  1JXE A;  5AK3 A;  3IP4 B;  4TQR A;  2DWQ A;  1UA1 A;  4PGQ A;  2EDU A;  2LM1 A;  4KIT B;  3HT3 A;  1B43 A;  1NK4 A;  2H3Z A;  1BPE A;  2YTU A;  5HR6 A;  1QSS A;  5AM5 A;  4CF5 A;  9ICQ A;  2DUY A;  9ICT A;  4UB1 A;  3SAF A;  2KD1 A;  2F8K A;  3MGV A;  5KFR A;  2LMR A;  1D8L A;  4ACO A;  9ICV A;  4M0A A;  3WU2 U;  2OWO A;  3PML A;  5KG4 A;  2G0A A;  1UQV A;  3PY8 A;  2W54 A;  4I2J A;  1YT3 A;  4BGD A;  1NK6 A;  8ICS A;  3PO5 A;  3QU5 A;  1MC8 A;  1XU4 A;  3I1Y A;  2WF8 A;  4LZD A;  2G5I B;  2I1Q A;  5KFJ A;  1SXE A;  2P6U A;  2KOB A;  2ODG A;  4DFK A;  3C2K A;  1IIP A;  1K5O A;  1UHU A;  3UM9 A;  3GU3 A;  3C1Z A; 
#chains in the Genus database with same CATH homology
 2K4P A;  2Y9T A;  3TAD C;  2EAP A;  4RQM A;  1SGG A;  4IS7 A;  2B6G A;  1V38 A;  2ES6 A;  2KSO A;  2E8P A;  4MHV A;  2FE9 A;  1LKY A;  2KSO B;  2D3D A;  3TAC B;  2EAM A;  2KG5 A;  1LKY B;  3TAD A;  2KIV A;  5J8Y A;  2F3N A;  3H8M A;  2Y9U A;  2DKZ A;  1KW4 A;  2KE7 A;  1RG6 A;  2EAN A;  1X40 A;  3KKA C;  2DL0 A;  2QB0 A;  2F44 A;  5KNI A;  5JU5 A;  4NL9 A;  4PZN A;  3HIL A;  2QB0 B;  1COK A;  2LPE A;  3SEN A;  1V85 A;  4NJ8 A;  2GLE A;  2D8C A;  1B4F A;  1OW5 A;  2L5Y A;  1X66 A;  1SV0 C;  4RQN A;  1WWU A;  5JTI A;  1DXS A;  1OXJ A;  2YTU A;  1X9X A;  1PK3 A;  5L1M A;  1F0M A;  3BS5 A;  2KMD A;  1JI7 A;  4PZO A;  3IDW A;  3BS5 B;  2F8K A;  3SEI A;  3K1R B;  2LMR A;  1UCV A;  1SXD A;  2E8N A;  3KKA A;  1UQV A;  2QB1 A;  2EAO A;  2JV3 A;  5J8Y C;  2K60 A;  1B0X A;  5JRT A;  1SV4 A;  2QKQ A;  2ESE A;  5F3X B;  1SXE A;  2DKX A;  4NL9 C;  3BS7 A;  1PK1 A;  2E8O A;  1SV0 A;  2QAR A;  1PK1 B;  2E8M A;  1WWV A;  2QAR B;  3BQ7 A;  1Z1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...