3HJEA

Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
704
structure length
704
Chain Sequence
MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDELGGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEEEKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRDYPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNKIGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDELVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNCSQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDKFHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKNDEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMFNNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPVVFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 704aa long hypothetical glycosyltransferase
publication title Structure of ST0929, a putative glycosyl transferase from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii str. 7
molecule tags Transferase
total genus 284
structure length 704
sequence length 704
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09196 DUF1953 Domain of unknown function (DUF1953)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Maltooligosyl trehalose synthase; domain 4 3hjeA04
1.10.150.200 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Maltooligosyl trehalose synthase; domain 3 3hjeA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3hjeA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3hjeA01
3.30.1590.10 Alpha Beta 2-Layer Sandwich Maltooligosyl trehalose synthase, domain 2 Maltooligosyl trehalose synthase, domain 2 3hjeA02
1J01A 1UASA 2W63A 1UH2A 3IGUA 4JFWA 1WNOA 1R8LA 3ARQA 3QOMA 3QGVA 5E0CA 2A3EA 3MO4A 5D4YA 3BC9A 4DM2A 3SUTA 3PZMA 2CBIA 4KMQA 1ISVA 2J7HA 2WCAA 3IK2A 5LA2A 5F7UA 1C92A 5HOSA 3HG2A 3WQVA 3WH7A 1DP0A 1CXFA 1BYBA 1AMYA 1GOIA 2QV4A 3DX0A 1XSKA 1B3ZA 4CKQA 5HNNA 2CNCA 4QCFA 5HPCA 3CBWA 1CTNA 3II1A 2J8GA 4U33A 2DSUA 3WNPA 1IT0A 1R7AA 4BQ2A 2G3JA 5E9AA 1UQYA 3UR7A 4PUEA 1V08A 5EMYA 3BLPX 4LPCA 3N11A 4AZGA 4BF7A 4W86A 4CUCA 1W1TA 1GW1A 1CXKA 2XN0A 2DSVA 1FP9A 4FK9A 1UD2A 4PN2A 1UHVA 2WANA 2WHJA 3KL5A 3SCTA 3ARZA 1BYAA 2ZX8A 5D9PA 3S5YA 4TVUA 5A6LA 2CETA 2IXUA 4X0VA 4Y7EA 2J25A 2DQXA 2VURA 3DDFA 4CN6A 1FFRA 2F7OA 3SCSA 1H09A 3BAIA 3EJPA 1HN1A 2NT1A 2F7PA 3D4YA 2VOTA 3WNMA 1GZJA 3TTSA 1V6XA 1ZBCA 2Z1KA 4UFIA 1WDQA 4FNQA 3VDHA 2VNCA 3GXTA 4UFMA 3W29A 1V0NA 1V02A 1TQUA 3VIKA 1JZ3A 4PTXA 1LLOA 2CHNA 1K9TA 4NXKA 5C70A 2JF7A 4IM4A 4FNPA 1HJXA 1BPLB 3W27A 4MJ4A 3VIMA 3CUGA 4DWSB 1UWRA 1PAMA 4FLQA 2E0PA 3ZSSA 2XWDA 2UY3A 2UY5A 4M1RA 3L2MA 1E6XM 2GJXB 1H2JA 2EABA 3D51A 2E8YA 1C7SA 3WENA 1LL7A 1GOWA 2CESA 1UUQA 4U31A 2ZWYA 4S3KA 1E4MM 1V03A 5ABHA 1MW1A 1HJQA 3WY4A 4H41A 1GUVA 2WMIB 2E9LA 1A47A 1NWRA 1G5AA 2BHYA 5JBEA 3OGSA 4J28A 3AZRA 1W1VA 2DPEA 4GO8A 2D73A 4P8WA 3I3EA 3WEZA 1UKOA 1JZ5A 3VGFA 3DHPA 5A69A 3LRLA 2WZEA 3T09A 3WFLA 3JUGA 3UESA 1UZ1A 1E1FA 3RCNA 3W53A 4R5EA 2DDXA 3SURA 1Y7VA 2ESCA 2V3EA 1U33A 3ZJ6A 1A3HA 2ZX6A 1GHRA 1GOOA 3CZ8A 3ZJKA 4PMVA 1FA2A 3ECQA 2Y8VA 3AMCA 2GJPA 4GO9A 4PYSA 1JZ2A 3EMQA 4WF7A 1BSIA 1W9VA 3W28A 3QHOA 4WIWA 3D52A 2VZTA 2D20A 3NDYA 3LPFA 1EOKA 2XIBA 1JXJA 1E5JA 3DX1A 3MS8A 4UQEA 5HBFA 2XFRA 1B3XA 3W25A 4ZE4A 3LRKA 1LG2A 4WKHA 5JBDA 1KWKA 4RL3A 1OGBA 3WD1A 3RM9A 4ATLA 2VZOA 2WMIA 1VFMA 1IZJA 4AD2A 3BVWA 2VCBA 2DT3A 4GPNA 4M82A 1NQ6A 2WNWA 1LQ0A 3GH5A 1RPKA 3KEHA 2F1AA 2VI0A 3WMBA 1NARA 6A3HA 5FL1A 1TCMA 3T0AA 2DIEA 4LGXA 1OT1A 2OLHA 2YA1A 4PMZA 3PZNA 5IDIA 3UETA 2CCRA 4XZWA 4H7VA 4ACZA 4GI8A 2J4GA 4DO4A 3SCOA 1VEMA 3CHFA 2EAEA 1NM9A 3RIKA 1CENA 3N1AA 5BXTA 1UKSA 5HXMA 1HT6A 4HOXA 1AVAA 5C8BB 1TFVA 2YDQA 2VJXA 4PMUA 2X0YA 1FH9A 3CTTA 1UYQA 3PZQA 5BXPA 5C71A 1VAHA 5A2BA 1WZMA 3VIJA 1XHGA 4TX8A 2QPUA 2ZXAA 1HP5A 5GNYA 2F1BA 1TQVA 4JAWA 5LA0A 3A4XA 1OM0A 1XH2A 2X0HA 3BXWA 2CKRA 3LPPA 3AHTA 4B3KA 5DT7A 2BXYA 3PTMA 5ABEA 4TTUA 2BY2A 2VL4A 1K9DA 2BY3A 1OBAA 2VX7A 5LYRA 7CGTA 1PX8A 3SCRA 2WLZA 2A3HA 3UG4A 4NX0A 1O6IA 2BXZA 4AD0A 2ZX5A 2GK1A 3T0BA 1B3YA 3PZ9A 5BXSA 3W37A 4CVWA 4UCFA 4P7QA 1BYCA 1QI0A 1ZU8A 3WD3A 4F8XA 1UD6A 2C7FA 1C8YA 4P7LA 2FDMA 1U30A 4MB3A 1UQZA 2J7BA 1XV8A 4TOQA 1H49A 1J10A 1W91A 1LF1A 4B3LA 1V3JA 4C7GA 3IJ8A 2AMGA 5FOOA 3EDJA 2PF0A 2OW7A 3OZPA 3RM8A 3BAJA 1E5NA 4PSRA 4PMQA 1ZBKA 2NT0A 3FW6A 4J27A 2JF6A 2GJRA 1BF2A 2JEPA 4CN1A 3PZVA 5AC4A 1EQPA 2FH8A 2EEXA 3EJQA 1PPIA 5M5DA 2DH2A 3GXFA 1MW0A 1H5VA 3WL0A 1PJ9A 2VTFA 2VO5A 3WQ5A 2GUYA 3J7HA 1CIUA 3VX1A 4AZ5A 3W6LA 5CGTA 1QOXA 1CGUA 1B30A 1FP8A 3VD4A 5BRQA 1E15A 1V6UA 4CCDA 1TQSA 3K4AA 1ISWA 1CZ1A 4ZFMA 4NZCA 3K4DA 1BG9A 4GKLA 1JNEA 3AZSA 1ITXA 2XWEA 2W5FA 1JDAA 4GQRA 1UOKA 3MSGA 4MADA 1HX0A 1HXJA 1KQZA 1Q6CA 1HJUA 1HL9A 2WBGA 1HKKA 3M6DA 3L4XA 3WEMA 3AHZA 4V27A 3BCDA 1G94A 1EDTA 4BA0A 2X2YA 5EFDA 3KL3A 1KXQA 4U2YA 3W38A 4W87A 2ZX9A 1GNXA 4WK9A 4QDMA 2EADA 4YPJA 2BV9A 3GXNA 3G6LA 3A22A 1SFSA 3UG3A 2CBVA 5A2CA 3BSHA 2PBGA 4TX6A 2W92A 4HOZA 3BLBA 3B9EA 1CXEA 1VIWA 1XSJA 3OA5A 2EPKX 2YJQA 3O9NA 1EH9A 4X9YA 3THDA 2J47A 4M24A 1G9HA 4M81A 1GQJA 2NSXA 4ZEPA 1CXHA 4OOUA 1VB9A 1UKPA 2PWDA 3ZMRA 2J74A 3E1F1 3QHMA 1SZNA 4UR9A 3WMCA 4W8AA 3SUUA 5CSUA 2GSJA 4PEEA 1RH9A 2G41A 5M03A 2J62A 3UCQA 4B16A 2XVGA 1KXHA 4ACYA 2IUZA 2WPGA 1UH4A 2VVSA 2EXOA 2EPOA 2WMFA 2FE0A 1VEOA 2V38A 1WZAA 2ZXBA 2XSBA 1AQ0A 3VD7A 3OIHA 4M29A 3WD0A 1QI4A 3CZGA 3W81A 1GQKA 1N82A 1KR1A 4C7FA 2WZIA 3TTQA 3FY1A 2A3BA 4DO5A 1LWHA 4UQ9A 3AIBA 2Y8KA 1UWSA 3OZOA 3HG5A 2GDUA 1J11A 1PIGA 1UR0A 1KBBA 4DUVA 4V28A 2CKSA 3QHNA 3U7BA 3D5HA 1XSIA 4UQBA 5DMYA 1C8XA 3UEQA 1W9DM 1X6LA 2J7GA 2WW5A 1OB0A 2XUCA 4W7VA 3DHUA 3TONA 3H54A 1J9YA 1QI2A 3A47A 1PEZA 1UD3A 5CJ5A 3A6OA 2GVYA 3PZOA 3UERA 4DWSC 1KGXA 2CERA 2XFYA 3AIEA 1CGVA 5CXPA 4DUWA 5ABFA 1SMDA 1UH3A 2O9RA 4Z2LA 1BGGA 3U5YA 4FLOA 1CXLA 3SUSA 5CZKA 1OD8A 1QBAA 4HTYA 2O92A 2X2IA 2DGAA 1J0YA 1B3WA 1BFNA 1V6WA 3SUVA 5I2UA 1C90A 1TQTA 3WNLA 4Q7NA 2XSAA 1BAGA 3CUJA 4R27A 3WDQA 4QLKA 1HTYA 4LYRA 4A3YA 1UWUA 2WVVA 4JHZA 4D6HA 2BY1A 3MSDA 1HNYA 4L4OA 1R46A 1OT2A 3NSXA 2VRQA 3M7SA 4WSJA 5ABGA 1GQLA 3T08A 5DO8A 4NXSA 4PCSA 1PS3A 2WC4A 4B9ZA 5IFPA 3WQ4A 3SEPA 3WKZA 5A6AA 4DO6A 5I6SA 2BFGA 1FFQA 1XYZA 1C7TA 3H53A 1VJSA 1TMQA 4N42A 4WKAA 5D9NA 4E4PA 3FHQA 3CZLA 4W8LA 3W24A 3H55A 1JAEA 2WM0A 2MANA 3AS0A 1QHZA 3CZKA 3AROA 3A23A 1MFVA 3WH8A 4D6CA 2EQDA 4GZEA 3AOFA 4P7OA 3NYDA 4EAMA 3TP4A 4PSPA 1OINA 1JI1A 2VRJA 3O2LA 3RDKA 1E0VA 3AS2A 3WDRA 2OSWA 3ARWA 1EXPA 4NZFA 2FHBA 1QW9A 4FNTA 4TTGA 3WD2A 4MNMA 1V6YA 5A8PA 1G1YA 2D3LA 1CNVA 3M07A 3AMGA 1GCYA 1VEPA 1MXDA 2ZXQA 4HZ8A 2WCSA 1OD0A 1HIZA 3ZJ8A 4XX6A 1GONA 1QHPA 2JFEX 4CD6A 1NWUA 2CYGA 4AEEA 2QF8A 4HPGA 1H0IA 1NWSA 3WSUA 1UR9A 4H04A 4AEFA 4BQ5A 1R85A 2XVLA 2D22A 1H3GA 5JIPA 1E43A 1M03A 2WHLA 3AS3A 4AYGA 2ZWZA 4AZCA 3FNDA 4X0NA 3HN3A 2OYLA 1CECA 5A6BA 4LYQA 1WE5A 1GORA 2G4FA 1ZS2A 2OWXA 3T0DA 5CSYA 2GDVA 3WDHA 4HPHA 2WVTA 3PZUA 3AIWA 2DSZA 1UD5A 4JFVA 3ARYA 2BVYA 1VFFA 1M53A 4WKFA 2VT0A 1K6AA 3N15A 2XHYA 1UWTA 3POHA 1UD4A 3NIYA 2G8ZA 4Z2IA 3AJ7A 4WSKA 4EANA 1GVIA 4EE9A 1W1YA 1CXIA 4FLSA 3WNOA 1HJSA 3AMDA 3N9KA 4UZSA 2EBNA 2VUYA 3L4WA 3BVXA 3LXBA 3A24A 3GNOA 4BQ4A 4AMXA 2FYVA 1WPCA 2IGTA 3GH7A 2Q8XA 2ZUMA 3L4TA 2V5CA 4PRWA 3GBEA 4ATWA 1BGAA 3AICA 1KGUA 4FLRA 1HWWA 3VMNA 4U5IA 3W26A 4ACZB 2CITA 4N0RA 1S46A 3CHCA 1FOBA 2D2OA 4GZIA 4CGTA 2WB5A 4UFHA 4UFKA 3HG4A 2A3CA 5IHSA 3FAXA 1DTUA 1XD0A 3EJRA 5AYIA 1XD1A 1V0MA 3HMCA 3IJ9A 1J0ZA 2Y5EA 4D6EA 5A3HA 4H8UA 4YHGA 4AY1A 4GQQA 3M46A 4HP5A 1QBBA 1DWHM 5A8MA 2YFNA 1H41A 1E0XA 1WAWA 4AD1A 3AI0A 5HPOA 4HA4A 3ARSA 5I3DA 2WXDM 3K8KA 5DT5A 4AD3A 4KGJA 4ZENA 1QNRA 3SCVA 4CU7A 3IANA 2XN1A 5IFTA 1PZ3A 4QCEA 1AQHA 1H4PA 1C3FA 3ZIZA 2X2HA 2WVUA 1B31A 1W32A 2GK1B 2B31A 3SCNA 4UTFA 4HA1A 2D3NA 3VIOA 1GOQA 3L2LA 5BROA 3BAKA 1JD9A 4QLJA 2G3MA 2F61A 3RJXA 3L4ZA 1M01A 2J7EA 4J3VA 1EQCA 3AYSA 2YL8A 3IJ7A 5AY7A 2WSKA 4AZ7A 4JZ5A 4WJXA 1MWOA 3W6MA 4IISA 1LG1A 1JYVA 1BQCA 4GIAA 3HJEA 2DEPA 3MI6A 3ARXA 1ESWA 4XV0A 3VGEA 1LJYA 1E3ZA 1EDQA 1QNSA 1JIBA 1EA9C 3ZT5A 2QMKA 1JZ8A 1G01A 1BTCA 5GNXA 5CG0A 3A5VA 3DYOA 4M80A 4PMYA 3WELA 4KRTA 3DX2A 3AXIA 3WL1A 1PX3A 1JDDA 2DT0A 3HG3A 2WKLA 4CVUA 2XPKA 1UR2A 3CZJA 1YHTA 4FNRA 2WKGA 1UKTA 4AZHA 2WLYA 5A6BD 1GJUA 4GZJA 1KTCA 1ISXA 1WKYA 3MKKA 1D3CA 4HU8A 3N04A 3SCQA 3VUPA 1D2KA 3VO0A 1E71M 3WBAA 1AQMA 3VSUA 4GI9A 5E6ZA 1VENA 2WCGA 1DWAM 3BUQA 2WAGA 1J18A 2TAAA 5A95A 1WDSA 1IZKA 3BVUA 1CBGA 4TUFA 2YBTA 4DUXA 2WMKA 1CGYA 3I3BA 3S2CA 2X05A 3QOKA 4CCCA 3K8LA 4LXFA 3CUFA 1TR1A 3GNPA 4J3TA 2VX6A 3WF2A 1LL4A 1O7AA 3BVTA 3VVGA 3OLDA 3RM4A 2C8NA 4FMVA 2WHMA 1E6QM 4PMDA 3WN6A 3LRMA 1HJVA 1XC6A 4CN4A 4JKMA 3I3DA 3BUPA 4A4AA 2FHFA 4UFLA 4V2XA 3GZAA 1ITCA 4KWUA 4IPNB 4OKDA 4JKKA 2X1IA 1LWJA 1W3JA 5BCAA 4UNIA 4MNLA 2XVNA 3VSVA 2PB1A 3BH4A 1V3MA 5D8WA 3WNKA 3DX3A 4QFUA 2BHZA 5KZ6A 2W4XA 1I75A 1JI2A 2ZUNA 1QPKA 1HVQA 2ZOXA 1BLIA 3MUAA 3EJSA 3OLIA 4W7WA 3CIVA 5CLWA 5E6YA 1HL8A 4P8XA 4JFTA 1GJWA 1XCWA 5DF0A 3GNRA 2O9OA 1Q6DA 1TG7A 1O7DC 4MDPA 3ZM8A 4W93A 2A3AA 3WF0A 4RE3A 5KEZA 3WIJA 4ZE5A 4PMXA 5M17A 5DFAA 2XVPA 3BLKA 3B9DA 1JF6A 6CGTA 5I77A 4PMRA 1KFWA 1JYXA 3EDEA 1HKJA 2ZE0A 3N18A 3ARVA 3OB8A 3VNZA 1NP0A 2EPMX 4U3CA 5D9MA 3VILA 1EIBA 4FF5A 3HU7A 1CGTA 1HKIA 2YIHA 2VCCA 3UG5A 1HP4A 3T2QA 1CYGA 2XFFA 3GH4A 3BAYA 3U7VA 2OYKA 4H2CA 2PWHA 4MTVA 4YN5A 3EJTA 4PMNA 4J7RA 1MYRA 4Q22A 2VRKA 3VM5A 2CXGA 2YOCA 1E73M 4W8BA 5CLTA 2V5DA 4MNKA 3WBEA 5HDRA 1FHLA 1CGWA 4TXEA 1XH1A 2PBOA 1QNOA 5AC5A 2EJ1A 3W4RA 1C93A 3N12A 3WFZA 1I1XA 3NSMA 4HZ7A 4HMEA 4W84A 1TZ7A 3MV11 2Y24A 3ARUA 1E0WA 5M3WA 2D0HA 4XB3A 1JF5A 4JIEA 2QLYA 4K68A 5ABFB 1ZJAA 3CUHA 5FCZA 3CZSA 1ODUA 2FH6A 3SUWA 3EJUA 1ODZA 1KB3A 2WC3A 4AYSA 2PWEA 3NCOA 2ZUVA 3WDPP 3BUDA 5GPRA 5EB8A 2AOSA 3OGRA 1BG4A 3CZEA 2WVVB 5E70A 1JFHA 5JIWA 3GBDA 4IUGA 1E4LA 3CH9A 1PZ2A 1UR4A 1RP8A 5CQ1A 3SCPA 3DX4A 1JZ7A 2YL6A 3WQ8A 5EBAA 4CCEA 3WH9A 1PIFA 3EBVA 4F9DA 2J78A 1JXKA 3WDJA 3BMWA 1X6NA 1V02E 2V3FA 5GQBA 3WH6A 4EK7A 1ISZA 3VTRA 1W9PA 2ZICA 4JL1A 2DSWA 2E9MA 2WWDA 1W3HA 1ISYA 1UR1A 3L4VA 2EPNA 1V0LA 3KZSA 2W91A 4MAZA 2ALWA 1XGZA 2J77A 1V3HA 4E2OA 1MQPA 3AHXA 4D6FA 4WLCA 2E9BA 4YHEA 3F5KA 4BS0A 4FNUA 3WD4A 1JZ6A 2WVSA 2BS9A 1B0IA 3BAWA 1TA3A 2VZUA 3NSNA 4MPKA 4B15A 3VGHA 4D6IA 3BAXA 2FGLA 1EHAA 4NZJA 1QW8A 1KWGA 1SMAA 4P7NA 1OGSA 1KBKA 4FNSA 5A6JA 1XH0A 5I5RA 3A3HA 2BHUA 3MUIA 2WYSA 3K8MA 1WZKA 4UQDA 4E8CA 3AYRA 3MMWA 4OJYA 4XZBA 2WK2A 4OUEA 3WQ6A 4P7RA 1R34A 4CU6A 2E8ZA 3DDGA 4TVCA 4BQ3A 4U5KA 3AXXA 2VMFA 1IV8A 2VVNA 1E72M 3WUEA 3LXAA 4S3JA 1VRXA 5A2AA 3NJ3A 3BCFA 2OWCA 1JFXA 5A6SA 1TVPA 3DC0A 4L4PA 1CWYA 2OW6A 3K46A 4AZCB 3VMOA 2VQUA 3LXCA 2IXVA 1BVZA 3ALFA 1UWQA 5JBFA 2UY4A 2G3NA 4H8HA 1J0JA 2UWFA 3LMYA 3KWXA 3VM7A 3AIUA 2G3IA 2J8FA 1CPUA 4U2ZA 3VINA 3PN8A 3ZT6A 1KTBA 3WNNA 3AZTA 3AHYA 3VSTA 4P8UA 2W62A 1P6WA 3ZOAA 2E3ZA 1W2VA 5CGMA 4W5UA 4B9YA 3ZJ7A 1FH8A 3LPOA 1JDCA 5I0DA 2J75A 2EPLX 4AZBA 1KGWA 1E4NA 1UWIA 2F7RA 1MQRA 9CGTA 1KXVA 2VZSA 2X09A 3ARPA 4D6GA 1KCKA 1QWNA 1E56A 3WEOA 1ZB5A 1RD6A 3PZGA 1T0OA 3MV01 4M56A 1E6RA 3GXMA 3MMDA 4KGLA 3FHAA 4JKLA 5FKYA 1C8QA 2EO7A 4PTWA 5GNZA 1JNDA 1L0PA 3BUBA 3ARTA 1GQIA 2RGMA 3O6AA 4ML4A 1B1YA 2EACA 5A6MA 1Q6FA 3B8SA 2XN2A 2OWWA 1EGZA 3PTKA 1WZLA 2XVKA 1NOFA 3RO8A 2Z1SA 3S6TA 5A8QA 3CGTA 4W7UA 1XYFA 1OWQA 2O9PA 2D24A 3ZSTA 3MUY1 4AZ6A 4TVDA 4AIEA 5I79A 1ZBVA 2WC7A 1OGGA 1EHNA 1XRVA 3WY3A 1WO2A 1BHGA 1NH6A 3OG2A 4Z2JA 2J7DA 1UG6A 3MUZ1 1C91A 4UQCA 1VJZA 1JL8A 3LX9A 3AQUA 2W66A 4J3UA 1H1NA 4E8DA 4HA3A 2JEQA 4JFSA 1J0KA 3IAPA 3VPLA 4KRUA 3ARRA 1DWFM 3AIQA 3VMPA 4OGZA 8CGTA 3WY1A 3VIGA 4XUYA 1KR0A 3AISA 4BCEA 2WSPA 1YQ2A 1QNPA 4W89A 4AMWA 2YA2A 3A4WA 4D1JA 2JALA 1W1PA 5I78A 1DHKA 2ZUWA 3APGA 3EDDA 3AMKA 3MMUA 2WMHA 4JHOA 3BGAA 3CHEA 1R87A 1UA7A 5E09A 4AWEA 1TE1A 2CPUA 2V3GA 3EMZA 1SYTA 4AC1X 1VBUA 1Q4NX 2F18A 3CLWA 3VIPA 3T2OA 3CHDA 3POCA 1ZBWA 3ZT7A 2ZX7A 3GXPA 3PZTA 5A6KA 3U57A 1R7OA 3ZQ9A 2VX4A 1JG9A 4JCLA 3DYMA 4PUDA 3SCUA 3TV8A 2CIPA 1E6PA 4MB5A 4GI6A 3FAWA 1F4AA 1V3KA 1HXKA 4AIOA 1B9ZA 1I1WA 4CD5A 1UA3A 4HOWA 1D7FA 1GVYA 3GTNA 4MB1A 1JZ4A 1SR0A 1ZJBA 4W5ZA 3WUBA 1MVYA 4MNJA 2YDRA 4OBRA 1F4HA 1PBGA 5D9OA 1TVNA 3K1DA 2X8RA 4JFUA 2FGZA 2JIWA 3IAQA 4UOJA 4DWSA 3OLGA 4ZXOA 4W85A 1B90A 1US2A 2OYMA 3GM8A 5IXEA 2O9TA 4LYPA 2XM1A 5BYWA 3AHVA 4F79A 4UQAA 4QP0A 5E0FA 2GJXA 2ZIDA 2DSKA 1B2YA 4AZIA 1E1EA 1NOUA 2HVMA 2VCAA 1ZL1A 1OIMA 3RMEA 1R86A 3WY2A 2J7FA 4CD8A 4AISA 1WP6A 1GOMA 1EDGA 2D0FA 4MB4A 1UD8A 4J3SA 1Q6EA 1W2PA 3BVVA 1K9EA 4NRRA 7A3HA 2VX5A 1G0CA 1CEOA 4AXNA 1XCXA 1B3VA 5CPSA 3PZIA 2YKKA 3TOPA 4AMCA 2ZUUA 2XG9A 1V3IA 3ZR6A 2WHKA 2J7CA 4CU8A 2PI6A 2YLAA 4M8UA 4QAWA 3BSGA 4CD4A 3KLKA 1V6VA 4PTVA 3CZNA 2BVTA 2YBUA 2JE8A 1R75A 4AD4A 1UKQA 1R33A 1J0HA 1M04A 2E40A 2XTKA 5BWFA 3AS1A 4D6DA 2WZHA 3VD5A 1VFOA 3ZR5A 4AIUA 2HISA 1RP9A 3AIRA 2D23A 2XYLA 1K9FA 4UZUA 2QHAA 2YFOA 1EOMA 4MDOA 3F5LA 4PMOA 8A3HA 2PWGA 1E40A 5FD0A 1QHOA 1WDPA 1FH7A 3KE0A 1FHDA 4NI3A 4LX4A 4Z2HA 4OBSA 1KXTA 4UFJA 7TAAA 1NOWA 2ZXDA 1W3KA 3AXHA 2CBJA 5IHRA 2VR4A 2VC9A 3EMCA 3B9AA 1OSEA 3MU7A 4AD5A 3QR3A 1U2YA 4J3XA 4OZOA 2YL5A 1H0GA 4ATDA 4Z2KA 1DEDA 5I23A 3VOCA 3PTQA 4LQ1A 1L8NA 3EYPA 1GHSA 3PHAA 4PBGA 2D0GA 3L4YA 1UR8A 4CD7A 3EDFA 1EO5A 1DWIM 3KL0A 3F5JA 3VGBA 1V0KA 1W3LA 3VDAA 3CC1A 4J3WA 1GPFA 3VDBA 3A4AA 4GINA 4MJ2A 4MAVA 1JD7A 2QPSA 2BY0A 2Y4SA 3THCA 5CPQA 5I24A 1QX1A 1MW2A 2WWCA 3ZO9A 1E70M 3VIHA 1WDRA 1VF8A 4D6JA 3TTYA 2GFTA 4UOZA 2C0HA 2BVDA 2PC8A 3AIVA 5DEZA 4HMDA 5A1AA 2FHCA 3NDZA 3VNYA 1HF6A 3VU2A 3PBGA 1MW3A 3EDKA 1E3XA 1GOKA 4D72A 1E6ZA 1PX4A 1HJWA 3WQWA 1JAKA 5LA1A 4H8VA 3BMVA 1BYDA 1Z32X 5CPTA 1J0IA 4F9JA 3TA9A 3GDBA 3DECA 1CLVA 2JIEA 3WF4A 4EKJA 3SCWA 2VZVA 4DWSD 1NWTA 1OIFA 3CV5A 2E4TA 2WMGA 4D1IA 1QNQA 3FXYA 4QLLA 1ECEA 5E1QA 3RILA 3AMLA 4P8VA 1NP2A 3S5ZA 3W0KA 5EFFA 4HMCA 5A94A 3F4VA 3OLEA 4NF7A 3U5UA 3D3AA 4Z2GA 4AW7A 3N13A 1TQWA 1DWGM 2RGLA 3GYCA 3D50A 2Y2WA 3D4ZA 1MXGA 4KH2A 5ECUA 3VX0A 2W61A 3WMSA 2DH3A 2X2JA 2J79A 5BXRA 5FL0A 5AYBA 3CPUA 1DWJM 2XGBA 3CMGA 5BRPA 1OCQA 3GXDA 2WBKA 1E9LA 1US3A 4NRSA 1X1NA 4RE2A 4HU0A 4GXPA 4F66A 2UY2A 3MANA 2XGIA 2ZUSA 2F2HA 2VQTA 3RJYA 2CHOA 1E4IA 4BZYA 3VIFA 3G6MA 4A3HA 1HVXA 2OSXA 3RPMA 3TTOA 1KCLA 4C7DA 1QVBA 4ZXLA 1LL6A 1TA3B 2D1ZA 1W9UA 1W9XA 3KLLA 5TD4A 3CMJA 3A21A 2PWFA 2YDSA 3VDCA 2QMJA 4D71A 4IPLA 3OBAA 5A8NA 2F7QA 3VD9A 2XM2A 4PTMA 2OSYA 2W67A 1E55A 2YL9A 1CDGA 3N17A 3WF3A 6TAAA 2DT2A 3WUFA 4DM1A 5JUVA 5FIPA 3CUIA 1CGXA 4OIFA 1V3LA 3WDIA 1HKMA 2CBUA 2CEQA 2XIIA 1KQYA 5A8OA 4NSBA 3VGGA 4JL2A 3WH5A 3CO4A 2NW0A 1QI5A 3HZ3A 1W9BM 1QWUA 1QI3A 3WUGA 3W82A 1EO7A 1BVNP 1J12A 5D8ZA 4HZ6A 2AAAA 1MFUA 4OOZA 3L4UA 4U3AA 3OGVA 1VBRA 2WMJA 1CLXA 3VKKA 4UOQA 1UZ4A 3GXIA 2BNJA 2ZUTA 3VIIA 4W88A 3BUIA 3T2PA 3SIMA 1JGIA 1E6SM 4PCTA 1M7XA 1H11A 3VD3A 1VFUA 2F8QA 1Q6GA 2VR5A 1JYWA 1WB0A 4JCMA 4URIA 3DYPA 3AFBA 3WF1A 3UR8A 3ALGA 1TUXA 2V3DA 3LPGA 1E6NA 2XJ7A 2DIJA 2DT1A 1R47A 1JYNA 1MQQA 3NUKA 3FN9A 2YLLA 2YA0A 1WCGA 4RE4A 3VGDA
chains in the Genus database with same CATH superfamily
4G7HF 2FSDA 5DTDA 2WXGA 4Y2DC 4RGUA 4GSUA 1R8LA 5CJBA 2EA4A 2RFXB 1A66A 3QM3A 5E0CA 4FQXC 3RG6A 4HWEH 3C6LC 3STBA 1L3UA 3C0SA 4L64A 1ISVA 2A77H 2MABA 3M1BB 1D9EA 3RIAF 4EXPX 2WCAA 3EO0B 1C92A 2XPWA 4HISA 3EH2A 4S0SD 5BOOA 4LL9A 1SXEA 2MGQA 2K4HA 4PJ0U 3VFRA 4QXIA 3UJRA 3FUHA 4WHDA 4HAGA 1FP1D 2UYLA 2VXSH 3FBQA 3VH8A 1YQVH 4PJ5B 1FAKT 1F3JB 4WGHA 1PEWA 4AWJC 1IBDA 1NKBA 3ULAB 1NGZB 3LNQA 3BLPX 1XR2A 4LPCA 1TQIA 4US6A 4GUPA 5LHDA 3FIWA 2WB7A 4CUCA 4RAGA 4AC4A 1J0RA 4JFQA 1CXKA 2DLIA 2XN0A 2BDUA 3MRNA 2ATMA 3L1FA 3GHBL 2X1TA 1SM3H 3PWNB 1HZHH 1SVZA 5A6LA 3NRPA 4RAHA 3LYEA 2QJDA 3CSBA 1IE7C 2YCKX 3DDFA 4TYUA 4TKWA 3GDRA 1AANA 2F7PA 1BPYA 4X9HA 2HZTA 4UT6A 5IK3A 2EDUA 2EDBA 5KVDL 5GS2D 2E27H 1AQKH 3QU7A 2ZG2A 3DVGB 4AG0A 3W6VA 3VZXA 4FQCH 1TQUA 4HNVA 4N68A 5JZ7C 1DCLA 2IDQA 4M6UA 4D5CA 3HZVB 4FG0A 4HKPA 1XGYL 4IM4A 3GYEA 4WW2A 3S97C 2DI3A 5HJDA 3OJDA 4XX5A 4LRNH 3VI4F 3DLLF 2M9HA 1TE6A 1PQZA 5ETUA 3CQKA 1FSEA 4B92A 1N48A 4G3YH 4QCIB 4BIKA 1UWGL 4W68A 4LAMA 3VODA 2A73B 5KBKA 2A6DA 1MAMH 3DEUA 4XZLX 2NYKA 3CQFA 1NOAA 5ICXA 5D1ZA 3FULA 1ZQIA 2NXYD 4F8RA 3DOSB 3VSKA 4EDXB 1OAZH 3QU2A 2CO7B 2EUVA 1LM8V 5FC9A 3QCUH 4XBSA 4U88A 3RAXA 4KJYB 5IR1B 3ME0A 4M7LL 4B48A 2O4QA 2CZEA 2CUHA 3UESA 4PJCA 4YK4C 2A3VA 5L4FA 1WDWA 4GRMA 2CJTA 3FEQA 2V3EA 3AW5A 1SFJA 1GHCA 3VWKB 5F7FA 5BOFA 4X61A 4M9HA 2ITDB 4XTRC 2ZSHB 2RGSA 4WF7A 2O4MA 1BSIA 3W28A 3EUHA 2Y69B 2RJGA 3CYVA 1HXMA 1RZFH 1AH0A 3SE9L 4ICMA 4S1RH 1Z3EB 3D25B 4M62H 3UJIL 3DX1A 1Q1VA 3ZUCA 1KXTB 1U49A 4QWBA 2TSAA 4EUPH 4P2CG 2GTZA 3DEQA 3WD1A 4ATLA 3UZQA 3K2UH 4F93B 1HZYA 2FR4A 4UUJB 2VDNB 2NYZA 4HV8A 1GSKA 2VLME 1IAOA 2G75B 3WMBA 4LCYA 1KCXA 5G4HC 1DEEB 1M1SA 4HK5A 3KHDA 1F90H 2QVOA 3VNIA 4ACZA 5D7IE 5K1VA 2LABA 4Q7IA 3KM8A 4RMBA 3ILQD 4N0YH 2KS0A 3MLRL 5A2BA 4XPFH 1WZMA 3EWXA 3DUUA 4NQED 5GNYA 4JAWA 2HCZX 4QY8B 2I60L 3DDMA 1LEBA 5JVLA 3AHTA 2IPUG 3TR9A 3U9GA 2ZOWA 4PJ5D 3JPOA 4U1LA 4P5TA 3GIZL 4KXAA 4D0DA 2IPQX 3ZYOA 4REQA 2MOGA 2J6EA 5EO0B 1F8MA 3GDLA 3QPEA 1TTQA 4O5LL 4KXZI 1AXTL 2J71A 4P5UA 4AD0A 3LDAA 1G3TA 5EGOB 3BZEA 3PVXA 2VQLA 5K59F 4GY7A 5L0QB 1TG8A 3G0SA 5FOBB 4L2YA 1IKFL 2C7FA 4GAGH 1VADA 4TTDC 2DLHA 2VLKD 1H49A 4P2OD 2FUTA 3IJ8A 3EDJA 5I16A 1T3FA 4LF2A 2BOCA 1R5VA 1EYEA 4L9YA 1X38A 3DJSA 1BF2A 4YNYB 5FKKA 1CBVH 2VTFA 4N2LA 1E5YA 4EEEA 3W2MA 4C91A 1XXFC 1C8VA 2GZWA 2VONA 1S1PA 3HZYA 4KI5E 1FP8A 2WO3B 1TMLA 5BRQA 2YXFA 2OV7A 4PGLA 4PUBH 3RKWA 2PETA 5AVVB 2M4GA 4O57A 4NZCA 4X4XA 4GKLA 2FT8A 3UVAA 1UMQA 5CCHE 2VITA 1ITXA 4I3RL 5JFRA 1IGTB 4KDWA 3GTTA 2WSDA 3IEBA 3MSGA 2FPKA 3WAJA 2R94A 3BQ1A 3G6AB 4N9GB 2JKEA 4JTHA 5ESAA 1KRMA 4R3SB 1D7KA 4HSOA 1UFGA 3W38A 5D7EA 4MAYB 4WK9A 2D5VA 4M7ZC 2DMKA 3A22A 1MJAA 2GOLA 4HF5H 3M44A 3IVKB 2P5PA 1XBRA 3UZXA 1A0PA 2Z27A 3ZY7A 3B8TA 3EW9A 3AU1B 2EZLA 3PRZA 2JA5J 1SFDA 3IU3A 3OP2A 1C5CL 2FPYA 1GHFL 2QBYA 3E1F1 3QHMA 3V8LA 4Y7NJ 3CUPA 5EOZA 1Z67A 3F5WA 5DJ2A 2SEBA 4LDOB 2NSOA 1DTNA 2KLTA 1Y0NA 3ZE0E 4M29A 4YAQA 5I17A 3LKQB 5D1ZC 4B5XA 4C7FA 3QJQB 1YMMA 2WZIA 3TTQA 3Q1SL 5DA4A 4RUCA 1DUYA 1WJ5A 1JGEA 3PWJA 5E2UL 3WE6A 3NN8B 4L0YB 3FSZA 5EV7A 3H7IA 4M6WB 4I2FA 2OTUB 2DP3A 2CWNA 2JF1A 1KZQA 3PY2A 3PNRB 4UDTB 5HODA 5AAMA 1WAAE 3APFA 2WW5A 3NQFA 4QLCU 2PLTA 3IVUA 1TFHA 3LK6A 4DTGL 4DFJA 1BZ8A 4X6BB 2VLRB 2VDKB 5D8LB 3CN1A 1I8IA 2YUVA 4J9QA 3KYKH 1H7OA 5IBLC 3P4OA 4Z0XA 3GO2A 5G4WA 4KJQD 2ZNZA 3AM8A 3SUSA 3EUHC 4PHDA 3HGSA 2I6XA 1Y0EA 1V6WA 5AZ2L 1MZHA 2KK0A 5ALTA 3TZVB 2IANA 1CF8H 5GJTH 4XN5A 2CAKA 5AK3A 2JVGA 1HSBB 3L7EB 4D6HA 3SV3A 5MERA 4OJEH 1IXOA 1QWGA 1O95A 1FYTB 5D37A 4MHBA 3WQ4A 3QUMH 3RRQA 2QDGA 4UMBA 1I8LA 5CHGA 1HOCA 4AQZA 3WIHH 1CO1A 4N6RB 3HAEA 3T8MA 3P2DA 1CDCA 1LXMA 2NZ9C 4JFZL 3V8JA 1R3TA 3W24A 3VWJB 1MFMA 3BT0A 4LG3A 5AOJA 5SV4A 1WZ1L 4D6CA 2X1QA 3I1YA 1MCPL 2EFPA 5B8CA 4QT5B 3P9WB 1EXPA 2VI6A 3WG7H 3T0EB 2BQ3A 4I29A 1A4LA 1HCFX 1MRFL 4UDUA 4TTGA 5F96L 2KQNA 4LLUB 4XT1C 3BCAA 1NM4A 1MMAA 1Q9OB 5I74C 2AS5M 3M07A 5F89B 1E4WL 2QSQA 3AMGA 3IC7A 3FM9A 4HX7A 4OIAA 1AODA 4JQFA 3ZD9A 1ONVA 1DN0B 3TMQA 5LBVA 2YD0A 1A3WA 5KANI 4LJ3A 1I2OA 3EOAA 3L5IA 1W2KT 5FGBA 2IWFA 5C0ND 3X1GA 1K78B 3CS2A 1E43A 3L5JA 1OFQA 2QSCH 4KK6C 4GUHA 2OCCH 1IFHH 4ISVA 4GH1A 1SOXA 2C14A 4F3OA 4LYQA 3O9WB 2GITB 5FP0A 4YXJA 1UD5A 1ROWA 3ARYA 5KS9B 1DZ0A 4Y2RA 1F2XK 5ES4B 3POHA 2HLAB 3LIZA 1WIUA 2ZWSA 7FABH 4CRXA 3IJDA 2W85A 2NS7A 3B9KD 4KUMA 3UMTA 4BHCA 1O1HA 2K0RA 3V0IA 4TU1A 2DA6A 2BERA 1U8JB 4MEYF 4AVIA 4M71A 4RZRA 2FYVA 4YZWA 2XPVA 2Q8XA 4BELD 1YEWA 3GBEA 1HEKA 3MR9B 5J2JA 5DJCA 5DHYB 2VUNA 1XGTB 4AM0B 2MD0A 2FTWA 2O5ZL 1U3ZA 4C8KA 4ELKA 2ITFA 4E4UA 2HJFB 2KVCA 2H2PC 4YIQB 4XMZA 1RKRA 4A69C 4GQ0A 3G5VB 4TNWK 2MLGA 2P43B 4YHGA 2PODA 4KRZA 3FMGL 4WRHA 4ZO9A 2XG4A 3PWVB 3MRJA 2PFQA 4B2DA 4HIXH 4YYFA 4HA4A 2WXDM 3QQNA 4RLFA 1BX2A 4OZHB 1EX0A 5A40E 4PWEA 2VLRD 5FYKL 1NKOA 2WVUA 4P9HH 1WWUA 4I8DA 3GRIA 4E0RA 2WNKA 2AC0A 4UARA 5D5MB 3T0VA 2R9HD 3WHE1 4TM9A 1MNUH 1KLUB 1P4LA 3NSDA 3RJXA 1HCVA 1RNLA 3ED5A 4NJAH 3F8UB 1PG7X 2IW5A 2XI9A 1MWOA 4H44C 4OM0L 1RQBA 3MWMA 5L2KE 4YSQA 2XO7A 2D7TL 1E3ZA 3L3FX 2QTEA 1XSOA 4FLHA 1N77A 4EI6B 2I7OA 5HD8D 4OFYA 5GRZA 3H3VK 3KPOB 1YMYA 3M41A 3BWAB 4YEEA 4GFBA 4RGXA 1JVNA 4DP0X 4A3GJ 2XPKA 1GEQA 1FL5A 2IMMA 2Z31A 1PAZA 4PV9B 1R5GA 4IHTA 4UT7H 1UUNA 3MKKA 2UZKA 4H83A 1VFAB 3BDXA 3F7YB 4LAOA 4YH6A 2WCGA 9ICLA 3HP6A 2EDLA 3GFYA 2BZNA 4EEYA 2A07F 4WW1B 4NUJB 1UB5A 4NDMA 1F6LL 5E4EC 4UBBA 5FUOH 1DJGA 2ZA1A 3N44B 3F01A 3ZKND 5LXGH 1V54B 3EYQD 3W1UA 1HJVA 5LQBH 5EBMB 5HHMB 1KMGA 3CCVI 3GZAA 2C3HA 3RFZB 3MBXH 1DR9A 3FT4B 3TFKC 4A2LA 2NS0A 4MNLA 4W9GC 4EZLA 1F8IA 3CDFA 2R6OA 4RW3A 2X4RB 3HI1B 3GVRA 2HFEB 1E1CA 5H94B 1PG7H 5LN4A 1DFBL 4MDPA 1VQKI 1NDYA 4YFXF 3P73A 4G6JH 2JH2A 2R7RA 5I77A 3MFFB 1K7AA 5TE4H 4D7BA 1P0NA 1JHFA 2F77X 1D5RA 4GA8A 1NJYA 4F0SA 4K1GA 1P6CA 2MOVA 4M2YA 1THCA 3EO9H 1S5TA 3QPXL 1EGVA 1ZAIA 3BAYA 2E1WA 4MTVA 3IMTA 2ZB9A 4MNKA 5FGBC 4ZFCA 4PCYA 2CZVA 1JEZA 2ED7A 3MLTA 2PTZA 4MHHG 3PFRA 2FZ3A 3PAVA 3VYUB 1H9DA 2X6WA 1C93A 3N12A 3MV9D 5ABZA 4AC0A 2ARJQ 4MWAB 2VQHA 2D0HA 2VUMJ 1X98A 1T5XA 2ZNYA 3U7WH 4R84A 2HTMA 3GUGA 4XMLH 2GTWB 1J8SA 3UTZB 1LVHA 1XGDA 3O05A 5C0IA 3SDAA 4ELDA 2Y1HA 5F9NA 4FFVD 4GJJA 3U25A 3B0VC 3ID7A 5E70A 5AW6B 4LIQL 2J8UA 3C8NA 4OLEA 4JIPA 2BPFA 3NXFA 3HTLX 2NX1A 4IL6C 3WQ8A 4N2DA 5EBAA 4CCEA 4Y9EA 4G43B 5I3IA 1Y6KR 2G3ZA 2Y62A 2ERJC 1D1CA 4LCWD 2C18A 4KKQA 3VTRA 1NJWA 2MNRA 3M64A 1WGVA 1A64A 1TX0A 2BHNA 2ALWA 4R2GC 4JNMA 4D6FA 5JDJA 1CURA 2QVFB 2ADYA 3A9IA 3NTUA 1DQDH 1YEHL 1N7ML 3DFPA 5H37A 4RDBA 3VXOB 4XD3A 3CCUI 2OP4H 1WF5A 3BN9D 5IDZA 2W57A 1KOAA 2YPKB 2YUWA 3GIPA 5ALQA 1UQSB 4W9ZA 1FNHA 4OJYA 4XZBA 1S7VA 5IJCC 1Y8BA 3L3IB 2Y3NA 4F20A 2GY5A 2VT3A 1ZQQA 3P40A 3W7CA 5L3GA 2ID3A 1SZRA 3GAKA 2HDJA 1DL7L 1JHTA 2AVGA 1MHEA 3VOHA 3FH7A 5I75C 4HJIA 4J12A 5MEOA 7ICEA 2ESVE 3VM7A 1CCZA 1ZHLA 4DWIA 3L9FA 1CPUA 4E8GA 3C23A 3KP4A 4U7DA 2HRPL 5BOMA 3QQ9C 1Y1UA 2W62A 2Y5TA 3VFUA 4DERA 1RETA 1RZ7H 1Z5LB 3ZYIA 3HG0A 1OHLA 1K7FA 4X98A 4ZW3A 1QWNA 1H0DA 3B1TA 4KVCL 2OEMA 5IMLB 1IEBB 3BX7C 1SXZA 4FA8A 5FYKE 4DBDA 3T1FA 2Z31C 3U48A 4ML4A 3TNNB 2VLJD 2BODX 1Q6FA 4RZ6A 3U9WA 2JQZA 2FSEB 3PTKA 3H2NA 1L3NA 1F3DH 1NOFA 3IKTA 3IRZA 1TWWA 4Q3MA 2B4CL 4HK3N 2D24A 2XKUA 4B27A 3R0KA 3GMOA 2DUZA 2E74C 3JTBA 3EFOA 3CYJA 2R1LA 3LEVL 3FPXA 3NVYA 1UA6H 3V6OA 5EWIH 4KY2A 3BEVB 4E8DA 3KWWB 4HA3A 4YTUA 3BG6A 3SKNA 4PJEA 3N4MB 3BE1L 4DOZA 1QQ5A 2CBTA 2ZRVA 1S7XB 4GFSA 2RMNA 2A6JA 2VD9A 3WY1A 5H4ZA 3EJJX 3AISA 3ERPA 3SB3A 5IIIA 4UT9H 5IIKA 3WLWD 2ZXHA 2HOTA 4NUQA 3R7QA 5JIQA 2D31A 4E9TA 3RKYA 1NBZB 1A50A 3RKPA 2AK1L 3TCLB 5B1BB 4ZNCD 3PZTA 2WMPA 3GHRA 2MCPH 4C5YA 9ICFA 1SNRA 4PUDA 3GW0A 3ZHFA 1EZVX 3T8XA 1K8CA 4AU0A 4U3XA 5T33H 3BIKB 4ODWA 4DKEH 5CC7A 2I24N 4RDQF 4RNIA 3UYRL 3FM3A 2E4FA 4WX2A 1F36A 5JMRA 2HDDA 4MIMA 5DCDA 2IGOA 3V0WL 3RU6A 4F79A 2CG4A 1IIKA 2WLNA 4GJIA 3CJQB 3QEQA 5DVMA 4CADB 2HJKA 1S5IL 2XINA 1OV8A 1TJIL 2WXOA 5JW5A 3DI0A 5ALGA 3FCSB 3WK9A 2WYHA 1OAXL 2FPTA 3VNMA 3H9SB 2IXQB 4UMSA 4LEXH 1JR1A 4JTRA 2J7CA 3DX7B 4RFEB 3F72A 1AGCB 4GMTH 1TJ1A 2J5OA 1R23A 2JKRM 3VFPA 6PTDA 3TC3A 3LZOA 1DVTA 1IAIH 2H4EA 4AYBA 3TYUA 5H35B 2D23A 4A8RA 3ALXA 1GLNA 2VE9A 4F8TA 2YX8A 1FHDA 2QQLH 3PNVA 5I2IB 1GW0A 3NA4A 4HD5A 3CDLA 2ACJA 7PTDA 1SL1A 3G6YA 5I1GH 4AD5A 2CLEA 1FRGH 4ICXA 1KPRB 2A4EA 5BW6A 2FGWL 4IXXA 3IGKA 3BW2A 4XI5C 1XGEA 4O3NA 4UILL 3IDJB 4Y1AB 3M0KA 4JHBA 2CRMA 3I9IA 3P0VH 4Z6AT 4F55A 5EC2A 3CESA 4DSFA 1FYMA 3THCA 2MD5A 3O2DL 4OGXL 5CLZA 1MBFA 3G22A 1E70M 4HH8A 3VIHA 5SWQB 1FWIC 1YFHA 3GTQJ 3B9JA 1NHAA 5DD1H 4Z6YA 1RUAL 3EBGA 1IR2A 3VU2A 2DDBA 4HULB 1UC6A 3VA6A 4N2FA 3TBWA 3RNKB 5LA1A 3FK4A 3QYPA 2O30A 3KPSA 4JAMB 1E5UI 1J0IA 4C57C 3L1EA 3HGJA 3TA9A 4RRPA 4FFZH 4F2ME 3MA9L 4DWSD 3LK9A 4HQMA 4DCCA 1DANT 4XVJL 5JLWA 4CDGA 1ZVYA 1L6ZA 2OMYA 2RRDA 1LT8A 1YEYA 3ARBC 4UTWA 1ECEA 3BZ4A 1T8EA 1SZEA 3QE5A 1EP3A 4A2EA 3R06B 2EAPA 1MQKH 2V4LA 1XIWC 3NIDB 4ZSOA 4C6FA 4HUXA 3MDCA 3RJJA 1WS8A 4Y2OB 3K80A 3BDKA 5I1AA 1R3IH 4KXBA 2DQFA 2OCFD 4I7HA 1M2VB 4XR6A 2EXYC 2UY2A 1DPMA 5J47A 2OS7A 4CEUC 1KFDA 4WHYG 2ZUSA 2XGIA 2BZ7A 4R88A 2LKXA 4JFXB 1KIPB 5DJAA 3WXWH 3GSOA 1RYSA 5SWZE 3RWFB 3O8HA 2ACUA 3B8IA 3TTOA 4IRHA 3ARFA 1V27A 1J05B 3AL0C 4C3JJ 3SQRA 3QA3A 3N17A 1FC2D 1L6GA 1CGXA 4ALAH 5CHNA 3L9YA 3NWSA 4XD5A 3SV4A 2GJZB 1J1XH 1DGRM 4M5SA 4YL9A 1KQYA 3KTQA 5U7SA 5D5UB 4LARL 2OCJA 3HZ3A 5AOLA 3MQIA 5FEWA 2XPGB 2HS6A 3FXJA 1ZQMA 2VL5B 1RJLB 3BRFA 3H9SD 1ETZA 4WI2A 4Y5VB 1BZ7A 5D71H 5ALXA 1Q38A 2Z0UA 2HPTA 2P50A 1NK6A 3D3VA 3I5UA 3N28A 1CI3M 4ZRGA 1JCYA 4XPBL 5EDNA 3ZQIA 3CMYA 3VFWB 3FYIB 3LPGA 3OGUA 2GQAA 1BZQK 4FNLH 2W9EL 2F8VA 2YLLA 1Q7QA 4WXYA 3W39B 1RU9H 1V8EA 2OR9L 4C6LA 3DIPA 5M2FX 4V19K 3H0RB 1NANH 5BOZG 1EXHA 3ATEA 3WO4B 4JFHE 4GY4A 1VACB 4Y5YA 2YRPA 2WF6A 3GW2A 3RX9A 4NUMA 4ZMOA 5KVFH 4RLDA 5E9DD 2YBRB 2NX5D 3QYEA 3SKJH 1QFUL 3E6MA 3S3MA 3HB3B 5F7UA 1J5TA 1IB5A 3C3WA 3K5SA 3LHUA 1W3IA 5K7HA 1BVOA 3F2CA 3DX0A 3W7HA 4PJNA 1YN7B 2IWGA 1HKLL 2Q0ZX 2ESHA 3N7PD 1PLCA 4NB5A 2QQ8A 4BQ2A 2G3JA 4ED1A 1X2IA 4DZAA 1JIHA 4PUEA 1V08A 1DXFA 2Y85A 3TF7C 2UZXB 3FGCA 4JN8A 4X7FC 2BW3B 2P81A 2AQRA 4U05A 5HHXH 3F64A 3NASA 5GGTL 4EE2A 2YAEA 1I1YB 4Z42C 1WPKA 1EMTH 1ZQSA 2IXUA 1OPGL 2ALZA 5MEPA 2VLAA 1FFRA 3OEXA 3T6WA 4ZPVB 3TEZA 3IXAB 1E9QA 1VQ7I 2I9GA 3B5HA 4PRNA 1ITQA 5BOPA 4Y4KB 1LDPH 5C09A 3NQAA 3GXTA 3EJYD 2R2HB 3O8AA 2XH2A 1LKYB 5HANA 5ICUA 3TYCA 3PWPE 2WZ6A 2G08A 1ZRUA 5C70A 1LLOA 4YVZA 4ONGL 3VXUB 5FYLL 3WHCA 4HAKA 4MMYA 4AZ8B 1AHDP 5DZJA 5JOFB 3O45B 2BLEA 1C5DB 4MO7A 1F11A 5E08L 1KCRL 4CYCA 3QUXC 3WENA 2CESA 4YDJA 4U31A 3GBML 2OMAA 4LW7A 4KNSA 4L8CB 3FUNA 3H26A 3UA3A 1T94A 5I82A 3WOVA 3NRWA 2OPJA 3BVDB 2R56H 2DGZA 3TANA 3QW9A 3AXMA 4KZEH 4QZAA 3JZ7A 3I75B 3QIWC 3KBMA 4OLUL 5IVZA 1DQTA 3KDMB 2VN2A 2XWTB 4LFHD 3WBYA 8XIAA 2EIZA 5K2ZA 5HI5D 4O2FB 4GW5B 2FJ1A 4HJ0D 3WCYA 5EU6B 2HBLA 5CSSA 5TK4A 2HHUA 2L5HA 5D05A 1HKWA 5EBLA 4G7SB 4DGWB 1MWAL 4KROD 3EEZA 4L1SA 5F9JB 3UPRB 2XXFA 3RAOA 1W1IE 1MZBA 4P0PA 3FRPB 3O3UN 4MQ7A 1P5VA 3VJ6A 3W25A 3I6KA 1JK9A 4KFOA 3BTJA 1LO5B 4UM9A 1A7BA 2I1OA 3GG8A 4LZKA 3ZHDA 1OOWA 1VFMA 5DMKA 2YXOA 5L8LB 3BPNB 4BH7B 3WU2U 4ENMA 2M5WA 1K3UA 4XOEA 4K7YA 4EN3A 2MSNA 2IEPA 2VI0A 5J06A 4K8GA 5FYJE 3RU8L 2JJTA 1PDKB 1SW0A 4LVFA 1GT8A 4J40A 3DZ1A 2LRDA 1XF4B 4DP4X 4FO6A 4ORGA 4IS6B 5D1ZI 4PJFA 1HUZA 3RIKA 1AA1B 5HHVL 3C9NB 2XSDC 5E56A 3WTVA 4G11A 1NQKA 1KEMH 3VKDA 3GIQA 5ALUA 2QPUA 4LPVA 3C5ZC 1JOIA 3QDJE 4F58L 4CF5A 5IQ7H 3MGOA 4K9JA 3MV7E 2V6EA 4ZBJA 3S2HJ 2M26A 3FTYA 4POZD 3IMBA 4DEWA 4ACTA 2H3ZA 2LTQB 3LA3A 5EEZA 2JCCE 3UG4A 4HZMA 2BVQA 1KUMA 1U5TC 4CVWA 4NQCB 3HOWJ 1BQGA 1JTXA 3C4UA 4H7CA 3TIEB 4M03A 1B9MA 3RVWD 3QFJA 3CSGA 4GVIA 2J7BA 1C9WA 1Z0XA 3CBJB 3MRKB 5FOOA 3PW7A 5IGXH 2E75C 1ZBKA 4Y4KD 2JKSA 2JF6A 2PO6A 4IHSA 5C0BB 2XG5B 2FH8A 3DXAA 4Y90A 1L0QA 3WL0A 2VO5A 1YVLA 4O3PA 1F8TL 1JUFA 3WE3A 1SW3A 4P4KA 2VOOA 4DF1A 3P2BA 3GGWA 4ORIA 3TEVA 2K5CA 4PRRA 5I09A 3IE4A 2LVSA 3B6AA 4ALDA 3A0OA 3STLB 4I6VA 1SXSA 3DEWA 2K4IA 5L1JA 5KFRA 2FPVA 4ZFMA 2JUCA 2NQDA 3RVUD 5CU5A 3TT1H 4JJOA 4LPTA 5F1UA 2WXQA 3TVMA 4G5ZH 4PV8B 2HBXA 4R5TA 3EG9A 2R7TA 1LB2B 3ELAT 3WEMA 4GBXB 3H5NA 1SFLA 1WWVA 4F33B 2PGRA 3H3UA 4AEOA 1AJ2A 3E8UH 5HHIA 3KS0J 3PVFA 2Z35B 3S5SA 2EH7L 4QDMA 1WBJA 5A2CA 4FE3A 4FAMA 2RB8A 2DV6A 1JNNH 4ONVA 3CVHH 4XMUA 4L4JA 4K3HA 2IJ0C 2RQQA 1DV7A 5EU6D 4M81A 3TM6A 5FKLA 4NOFA 1NGQH 1XGUB 5CEYA 4I99C 3OZ9H 1VB9A 4Y2SA 4CCNA 4UR9A 4WFFD 1FWHC 1RH9A 2G41A 1J09A 1M2OA 4FZLA 1S5HB 1D5XB 2XVGA 4XZIA 2Z5UA 2D2WA 4DXVA 5I3JA 3QJZA 2V38A 1CZ8L 2J4WL 1S0OA 2C2DA 1DBML 4NQWA 1KBLA 2R8HA 1N82A 2JHDA 3VFOB 4UINL 1FBQA 4XIMA 2NRVA 2FNAA 3TNMB 2DLEA 1UOVA 1RHHA 2DL9A 5KAFC 4HPYL 1X3DA 4M6MH 1JZEA 2OU2A 2X0LA 1SY6H 3UEQA 2AK4A 2ZP9A 2JB6A 2UWEB 4ANJA 1MDMB 3HOJA 5M5XJ 5FYLE 1QI2A 2OMTA 1VJIA 2GVYA 4ZG1A 5J7CC 3UERA 2HWGA 1T8XA 3C5SB 4IRSC 3FX3A 5CMAA 1ZCCA 1QBAA 1VQ4I 4HOBA 4G9FA 2HQNA 1K79A 3MRHA 3IV3A 4IIFA 4HUMB 2XN9D 1ZQ1C 4J01A 3HUJB 3S36X 3GBGA 4AHPA 4I0PB 2LLKA 4LYRA 1TLMA 3ZTJH 3MSDA 3VI2A 3SYAA 3TMOA 3TYGL 3VKJA 3MRFB 2CGRH 4FP1A 4DYJA 4M7JH 1I4FB 5AOKA 1DE4A 2FNBA 2AJ3B 2CU7A 4TQHA 4XXDA 2ZUCA 3IIZA 1AJ7H 5I6SA 1NKRA 4M6VA 4ZAKA 1FFQA 4MQXC 5BVJA 4CC4C 4M93B 1UHMA 4NQCD 2BCMA 1RZKH 2JJTC 3S7GA 5FEPA 2DWTA 2WBJB 1JTPA 1WG3A 1QHZA 3JWNE 2PPFA 4DQWA 3NJLA 2NYYC 3T3ME 1E0OB 4YHMH 1MUCA 4EAMA 5CS7A 1G9MC 2YPLA 2YO3A 4H1LA 3FUJA 5LCVL 4EATA 4F7TB 4O58H 3BYYA 3OKMA 4Y16B 1GTHA 2MUCA 1R38A 1P4CA 2MC4A 3GMNA 4J5NA 2GVEA 1X7QA 2DV0A 3BSZL 4HZLB 4FE4A 3WL9A 2HOFA 1XJBA 3NYZA 3CAVA 1K6QH 3EGSA 4NLGA 1P1ZB 3MXVH 1A2YB 3NM3A 3GVQA 4WKZA 1XF0A 3RJQB 2KOBA 2VE6B 1MIEL 2FYYA 2ZXQA 3ARED 2C19A 1OD0A 3ITXA 5B7YA 4IHWA 2LU3A 5JHFA 3GRWA 3VCRA 2QF8A 4QNPF 1I8MB 1XG3A 1YNPA 1O9WA 1PYWA 3BGJA 1M6OB 4H6EA 2BNQD 1XR9B 3W1MA 3D12B 4J3OC 1SV0C 5BZDB 3T5XA 3Q3GB 2WD0A 5JIPA 1CK0H 1M03A 3VACA 2CUJA 2VHLA 4KDTA 4LOVA 3DX5A 3TNBA 8ICSA 4RZBA 3S36H 4BEQA 2GDVA 1G8XA 4OD3H 4ELMB 2DOCA 4GBXD 3OHIA 4L5JA 3V0VA 1ETXA 1KYWA 3SBQA 8PAZA 2HG5A 2XHYA 1QDSA 2X1SA 4Q4MA 2P5LC 1A5UA 1L6NA 1PD6A 1HJSA 4BK5A 1OCCB 1T6BX 2HVRA 2PO6C 3MRCB 5JQ6L 1NPNA 1MJUH 3JTSB 2CHWA 5FO9B 2R8KA 3PGFH 1R24A 4MFEA 4LSSL 4BQ4A 3WU0A 3DPBB 3GHUA 3D9AL 2GOMA 2V5CA 4PRWA 4P4KC 5K5RA 3A0HU 1MC8A 3P4NA 3MYJA 1NAML 3MVTA 4S11A 3GFZA 2FLLA 2APWA 4L3EB 4N0RA 1K6OA 3GWJA 4CCZA 2X9WA 3DX6A 3NAAL 5JNYA 2QS8A 4YL2A 3L5WA 2YD2A 1ZQUA 3EYOA 3UTQB 3GSNL 4K9EC 3FSAA 4O02A 1MI5B 4KN4X 4GFJA 3NDZE 2MHAA 2Y07H 5KSBB 1A6AB 1UQVA 4AY1A 3FU8A 3SOBL 1U6AL 1QSEB 2M2DA 4EI0A 3OYNA 2IDUA 5HI4D 1WFXA 4BDZA 3VXPA 2XC7A 3C6LA 4AD3A 2Z7KA 4RZ4A 2BNUA 1JXSA 1GW6A 4HKBB 1W32A 4ZB0A 2IDTA 4O4WA 2GK1B 2BO0A 3NQKA 2DLFL 2B0SH 2DPJA 3UY7A 4XN3A 3B9VA 3MMYB 4IG2B 2ISPA 1Z9LA 2CIIB 4DGIH 1NL0L 1MCOL 3DIVA 4HKXA 1QVOA 4HKZB 2QIWA 3CFBA 3ZWTA 1TJPA 2P0WA 5A2QZ 3KRZA 4DVBB 1EDQA 4FXKC 1QPPA 2QMKA 1JZ8A 1IO4C 4HIHA 5JXAL 3O3EA 3A5VA 4TV6A 1R6WA 2ROXA 5KTEH 1T5WB 4NPYB 3CVIL 4M3DA 2Q1EA 1LP9E 1ZY9A 3GMRB 3S3BB 2IP2A 1L9NA 1BXXA 8ICYA 2LYCA 4PRTA 3BW9B 2NY1B 4QRRA 4IOIB 4JUTA 4AF0B 4B4HA 4U7MA 2X9ZA 1XZ0A 4NAEA 1MRDH 3ZRSA 3LSTA 3VFMA 5KG9B 3SDDA 3QOKA 2NZIA 4CCCA 3G6JE 4PW4A 5EE1A 1NCWL 2H8PB 3QO0A 4XP5H 3VRJA 2MCAA 1LEKA 3GZQA 3QWQB 4L8SB 3RMJA 1TJGH 2W43A 3VRLF 3RUGE 1UGNA 3LRMA 3IL2A 3I3DA 3F58L 4P2QA 1Z1BA 5ILTL 1V10A 2IPUK 5FECB 9ICXA 2XA8L 1TVAA 1ILUA 4IZZA 1GMEA 1BSLA 5KSAC 3X13A 2W4XA 2HFFB 5E6YA 4OZIE 5HR6A 5BOEA 3PG8A 5EIVA 5CBIA 1FNEA 3IFOA 4KHTL 3TSMA 4W93A 2NY0D 5E4AA 3WYZA 3O3BB 1BWWA 1FI8C 4PJDF 4NM8H 3MJYA 2QADB 6CGTA 4F7MB 4Z78B 1SVLA 4DBUA 1PYFA 3BG5A 3O1NA 4KLUA 2IS1A 3MCMA 4UIKH 1GV2A 1ZLSL 2V6CA 3IDYB 3VILA 3ILQC 2B7NA 1XCTB 4MQSB 1HP4A 1P1VA 2IV8A 4HAFA 4Q22A 2ZCZA 4OFQA 2CXGA 1GMIA 1ZQGA 1ZSDB 2CFOA 1HQRB 4X5QA 1RURH 1FHLA 2W0FB 5AC5A 1QHQA 1CU4H 2ZZ5A 2FAUA 4H5SB 4L3ED 4KW2A 3PMNA 3HLAB 3U9UA 4Y19A 3CWNA 4W9CC 4KDTC 1PKNA 2VQ1A 1XLDA 2GC4C 2EPFA 4CZZA 2CALA 1UYWH 3QFWA 4P2RE 1QSED 3LZRA 3CZEA 4YSDA 4X9SA 5I8CB 1FHGA 1OPOA 3IDMB 3W84A 1FZOB 2IDSA 2FL5A 4FXGA 3SYQA 2KDGA 3NPUA 4P2OC 3LTSA 3NT0A 1EGJL 3DOHA 3U4EB 4PMEA 1ZAJA 4PH6A 4XZ9A 2W65A 2E36A 5DB7A 2IAIA 3M3YJ 1UM5H 2QSTA 4GRWF 3GSQB 2ZICA 4Z3FA 4UNLA 4JREC 1D8WA 5A0LA 4Z7QF 4NZTL 1V3HA 3W3CA 3FTGA 3QP6A 3MJ7B 1LEIA 2G50A 3HG9A 3JXAA 4M6QA 1YRRA 4X9IA 4Z3JA 3VYTB 4HBCL 3ZRGA 4MNGB 4U1NA 3APNA 3GS7A 2VB6A 2XAHA 3S15J 3B0YA 4NSKB 3TAKA 4MKMA 4V2BA 5ICGA 1EH8A 3PDOA 4B9GA 25C8L 5ALKA 1UC4A 2BWDA 3LKOA 1SQMA 3K0YA 2WK2A 2DQGL 3TYDA 4MG4A 3FXIC 4IJ3C 1E28B 3FWEA 4P7RA 2GEEA 5IG7B 3TBSB 2CKBB 4OGQC 1Q94B 4HJTA 4W1UA 2FA5A 4JLRB 2VVNA 1BEYH 2CU9A 4ZFFA 4YIIA 4AOFA 2BSSB 1ME9A 3W7JA 3LKSA 5FYKU 3OC8A 1VZGA 2GC7C 5I8OH 2NSQA 4Z7VE 5JBFA 1J0JA 3SDCB 3RHWF 4CCKA 1GYCA 5K5YA 3NQCA 1URZA 1KCVL 2J27A 1QEXA 1ZRCA 3GTVA 3AHYA 3N85H 4P8UA 4MSWB 4W5UA 3NQOA 4TQEL 3BD5A 1M7DB 2EPLX 5J0XA 1BFOB 1XHHA 4D5FA 3IFPB 2X51A 2XKOA 3PZGA 5CFAA 3CZUB 3HR6A 1F6AB 4JY9A 5TAOA 5E2WL 3KBHE 2B21A 4MF2A 4BZ1A 5FKYA 1JK8A 3P5JA 4UT6L 1IGFL 1M6JA 1M6YA 4P5OA 2R69H 3FXLA 1KCUL 2OWWA 4AEHH 4QZHA 3GIVB 1NI3A 1AR2A 3CGTA 4BJLA 5EYWA 5HJYA 4MA7L 4XX1G 5GAGJ 1P43A 2WC7A 2QGEA 3AY4C 2X4SA 3OZLA 4MXVE 3OSGA 2AGKA 4WUKH 3SDDC 4A6YA 2BCUA 4Q8OA 1NLDH 2X4UB 3W5MA 1I8UA 4GIYA 2I9LA 2WLIB 1O12A 4HXAL 3QXVA 2O61B 4Q4RA 4JEJA 2JEQA 4GXMA 3GKWH 1JERA 3RI5F 2K40A 5FFZA 2K4EA 1L8OA 2F9RA 2AAVA 4AG4L 3J8F7 3MV8A 1KTNA 1YE4A 4ZSUA 3N2CA 3NCJH 2ZIXB 4D1JA 1W1PA 5I78A 1QBML 3AMKA 4JPWL 4AWEA 4DOHB 1SYTA 4GIRA 5D6FA 2F18A 2VWTA 3B37A 2HVJA 3GSXB 3KP5A 3QQ0A 4JCLA 5ADOL 4Y9MA 1KN5A 1TC3C 3ZTDC 1RY8A 1V3KA 1B9ZA 5LVEA 1JFQL 5BMZA 3GTIA 1R1UA 3PANA 2JA2A 4W5ZA 3WUBA 2P4AB 4EZJA 4MNJA 5B66U 1SPQA 2YDRA 1LMIA 2IEKA 3IH4A 2O6DA 2AJYH 4DZPA 1IXRC 1K4DA 5HUOA 2Z9TA 1MBGA 2HXAA 1ZD4A 2C6YA 5AFDA 4LLQB 8ICEA 4CMHC 1Q4WA 5AYUH 5I8EA 4YHLH 4AZIA 5IBUB 2X7LB 2FIRT 4TSAH 4HC1A 2APSA 1XFBA 5DURD 4DZIA 1R86A 2ZUXA 5MP6H 3FTSA 4O2EB 5AVUB 1QPQA 2NVUB 1TR9A 4AGMA 3TBIA 1IGML 3ZKQD 1GS6X 2XKNA 3R9KA 4J2XA 2ORBL 3DCFA 1AD4A 1TYRA 3CFNA 5FDYA 3L67A 1L7TH 3HS0B 2BASA 1B4JL 1UG9A 4Z9KB 4CHUA 5D09A 4LRTA 1QLEB 1WFTA 4HK0B 4XWOD 5DUMH 4QITA 4TO8A 4ABUA 4A21A 2QR0B 2DZVA 2IXSA 5CN1A 3XINA 4Z7WE 5D2NC 3BZDA 2BC4B 1BW5A 5DQ9A 3E1ZA 2WZHA 1JGGA 4FXGC 2QSHX 3QY7A 2VSKB 3MRGB 4X7TB 2YFOA 5A2KH 1E5BA 5GIRA 5FD0A 2ZCHH 3FF7A 2V69A 3CFQA 4TN9A 4AGPA 1V97A 3SDCD 2B1HL 4LWWA 4A35A 7TAAA 4PRBA 5F7EL 5CBAB 3LCFA 4BBSJ 2KKVA 4XA5A 3SPVB 1MVFA 2PCPB 4OD2A 3GTFA 2X4TA 8ICAA 3LN4A 3FYPA 1JULA 3TW7A 3WKMH 5DLML 1L8NA 1GHSA 3OKOA 2OT1A 1S9XA 3ATYA 4NBZB 2VYOA 4YCXA 3GTPJ 4EBQH 3CC1A 5C0JB 3RX3A 1MFAH 1ZOLA 4ZMWA 3A4AA 1KT2B 4ZO8A 1F2QA 3ITOA 3UMCA 1MFCH 1TX2A 2G4JA 5CPRB 4PJHF 5JW3H 3NVZA 4AP9A 1KLZA 1VFTA 3NXLA 1YTEA 2PF8A 4LV9A 1E6ZA 4J3BA 2CH8A 2DD8L 3ZDZE 5FV1L 5K9KB 4F3HA 3GDBA 3V6JA 5DVKA 1CLVA 3SCWA 4GSQA 5C8JB 4RMQA 3SQOH 5DJYA 4XCYB 3KLNA 1BIAA 3IM1A 2P7TA 3PQYE 5EF1A 4LCVA 3IIPA 5E99H 1DPRA 1FY6A 3ZDYE 3GYCA 2FTAA 3RGVA 4GCXA 4GKTA 4EX6A 3QPQC 1JUDA 4OR1A 2IAMA 5DCMB 2F4OB 1AI1H 4OUUA 4QHNA 4GXPA 4PLJD 4F66A 5DMGD 3MANA 5H8PA 1ON2A 3OBKA 2HWVA 1XGQB 2FO4A 2WAHA 3VCCA 9ANTA 3ZQGA 2XACC 3LS5L 1E4IA 4NJHA 1A4BA 5E2TH 3BLLA 1VJ5A 3OX8A 2J1YA 3JWDH 4LEOB 2K85A 4FS1A 4O00A 3V6ZA 2XFGB 2XM2A 1EV2E 3VWKD 5I73C 2BZDA 4NZUL 4XMPH 1HKMA 2WM1A 4C54A 2H32H 4DZ5A 3BQUB 2VP8A 2Q20A 3K1ZA 2MFNA 4IL0A 4XVSH 4PJIA 3CO4A 2GBYA 4GS7C 1D5BB 1KW4A 2Z24A 2IPJA 4JK1A 3EYQC 4FTHA 3MCOA 5FAAA 4IW4C 3RWIA 3P3UA 4FX4A 1W3NA 3CFCH 1NFDA 3F04A 4KUCD 3PP3K 1MFUA 3QORC 1HUOA 2E7FA 2CDFA 2R4SH 4UWQB 3R6IA 1UZ4A 5KVDE 2K3PA 2VPRA 3QUKA 2YU9J 2FQDA 4LOUC 3G1SA 4PCTA 1YLVA 4G9PA 2VC1A 3S35X 2ISWA 4JHAL 2Y1ZA 3RIRA 3H4XA 4HNOA 4HS3A 3WIFB 1OSZA 4MNQB 3RDTB 2CWRA 1E6NA 1JHKL 1ADWA 3FU7A 2VPLA 3DURB 3DFHA 4PJAA 2BOFX 1BBDL 1WCGA 3LB6C 1J01A 2CO3A 4IEFB 3RWGA 2K45A 3K75D 1TJXA 4JYDA 3QVQA 1TREA 3LZFH 5DYFA 4LSUL 5KVEH 1JN6B 4PJBB 5EZJB 8ICOA 4KMQA 1NLBL 4JM2A 2OZ6A 5HOSA 2VA3A 3KWUA 2CO1A 4NNAA 3S3JA 4P9ML 3EWUA 3ALPA 3C2BA 1S8DA 4S1QL 5C0DB 2ZD0A 1AIZA 1R5WA 4W9TA 1FP5A 1BR2A 4IOCF 3LEYL 4AMKL 1LRTA 2QSVA 4YSRA 5EMYA 1AGFB 2GJ6A 3NFSH 1U78A 2Y6SD 1USSA 1E4XH 3Q6GL 4XPGH 4NKIH 4OAYA 5ECGA 2VELA 2HE5A 1UD2A 4ZOHC 1NCCH 3BD4A 5IB4A 3BS5A 3ARZA 2IHMA 3QZEA 3KTSA 5AVNA 1ETB1 4U4IA 2P5WA 2DL0A 3U6RA 1MVUA 3FBKA 1K8IA 3G5ZA 1DQLH 5T1LB 3S35H 1DZBA 3Q9VA 4PB0H 1KC5L 3WE1A 4RPPA 1EWDA 2A2IA 3S2MA 1IC7L 1WUEA 3TKAA 3HILA 5I9QC 2H3XC 4R4BB 4NUGL 1G7PB 5DHMC 4CYDA 3HC7A 1AMKA 3R4KA 4U3SA 3WEXA 4A2DA 2PGFA 1V0NA 3RGBA 4NL1A 4NAFA 5CGYD 1UCRA 4JY6B 1W72H 3EX6A 4QOKA 4QZIA 2XWDA 1KTKE 3BP6A 3GI8H 1OAUH 3NM1A 4NYYA 1Q0YL 3LIZL 2V37A 2XNAA 4DPPA 3ULSA 1IM4A 1O6TA 4ZX6A 2GWRA 3N43F 2BSED 1OC6A 4MAYD 4K73A 2G5WA 3FT3A 2I8DA 1BD2E 3GM0A 3SOTA 4S1DD 4R8HA 3W0WA 1QNZL 2WIIA 2PTTA 3UC2A 1N3NA 3B97A 1THAA 2NVAA 2WZEA 2R7XA 2KRCA 4LLGF 3GIKA 2V30A 3BQUD 3UTSA 1QZYA 5FYJU 2A61A 1EF4A 2Z8RA 3V2AR 3AAMA 5TPWL 3MRIA 1JZ2A 3RGVC 1W9VA 4QROA 1E8ZA 4R7OA 3ABTA 2IAMC 4Q8UA 1EC8A 4KMFA 4PD4K 3CP2A 1ENHA 2WN2A 7ICOA 4LCQA 3H4BA 4XNUH 1C7YA 1KWKA 2VEFA 4L4MA 1GO3F 1OSPH 3RM9A 5IQMA 1UWYA 1Z1WA 4ECLA 2BR0A 5L88L 1D1BA 1NMAL 5I1CH 2RFGA 1K61A 1UXLA 1TIUA 3MN8A 2GXBA 4WJEA 3P0XA 1VQNI 4EPEC 4G7RB 1L7IL 2CLKA 1NARA 3SZGA 3V5DA 4P05A 4LUSB 3REQB 5DD0L 2PMHA 1YTYA 2GIYA 3OKDA 2WOYA 5AIPA 3TZVD 1YW9A 1EB3A 2FCBA 3KLOA 2IPTH 3W6JB 4WOZA 1TPVA 2JVUA 1I8AA 1CFQA 5DEFA 2LF8A 4YXKL 4OB5L 1S9KC 1T7VA 1FYTD 1MSWD 4U1MA 4WUUE 4HWUA 2Z2UA 3H42H 1JE6A 2CHRA 3WLWC 2OTWA 3NVTA 3S17J 1C08A 1JWUB 3DSFH 3CDHA 1UBSA 4TTUA 3ZE1E 1NPJA 1YC8A 1A53A 5KG6A 4BAYA 1OTSD 3VWJD 1MEIA 4M6OL 1FG2B 3T9PA 3PHQB 1FWSA 3HW8A 1AO7A 3K4CA 2K4JA 4WCYL 2KPMA 1A1MA 3GE7A 3N6JA 3KZIC 3B04A 1BYCA 4C6OA 5JPMB 3T0ED 4P7LA 4XKYA 1DXSA 4J9RA 5T1LD 4ZD3H 3QUYA 3FSWA 3U1KA 1N9PA 2VMEA 5DT1H 2FIKB 4JM2C 3V7KA 5K5OA 3DTXA 2JEPA 4C65A 3F03K 2GCYB 3Q0WA 2EEXA 4HQQL 3SI8A 4FQIH 5M5DA 1WTLA 2EXTA 2X12A 5D7IF 2Y9TA 3EADA 4E41E 3HM7A 2F19L 2CUFA 2BVPB 3O9WD 5FS5A 3MDJA 4LSTL 3ZL4H 3SGJC 4WI3A 1KBGH 1H7XA 1B3IA 2MH9A 4GEJA 2HW3A 2DQTL 3PIPF 3U2JA 1VYRA 1DLHB 1DJXA 1KJ2H 5E0QA 4G1MA 3MNVB 5D7JC 2UUDK 4WO4B 5D2LA 2CQQA 4BACA 4PLOB 3KXQA 4OJOA 4XWGH 4MLRA 4P2YA 2TODA 3K13A 1DUZA 2W55A 1T3QA 1KLGB 2IBZX 5KSUB 4CCHA 1BYOA 5J3HC 1KXQA 4QRUA 4IOFD 2BV9A 3W7MA 3H9QA 4OJAA 3BSHA 2K9NA 3VXTB 5HJXA 2MUTB 2X1CA 4X9YA 2Z28A 2X1DA 1OK4A 2GAUA 5DB9A 1XIFA 4ZEPA 1CXHA 3BYTA 1Y0LA 4GACA 1Z0MA 4MDIA 3N06B 4DNMA 5AIQA 1XIEA 4JN1L 5MI0C 3GZ6A 2R0ZH 3N0PB 3NJVA 2ZXCA 4A3LJ 3ZMTA 1UWEH 4KN7A 2X1RA 2JLLA 3DTIA 3SAHA 2G60H 2VVSA 4BXUA 2YZRA 3WD0A 4I4WB 1KF9B 4JTKA 3S2WA 1I1AB 3FQNB 2FMLA 3UR2A 3YPIA 5IM51 2BDPA 4XCFH 1G6CA 5ALPA 4KI5F 5LGJB 2XFWA 3G2BA 5EMLA 4IMEA 2JRTA 1A6WH 1UM6H 1B4KA 2CLVA 2R23A 5BW7C 3D5HA 3BQ2A 4PRIE 4OT1H 3D0VA 1KTDA 5ILVA 2EEAA 5BQ7A 1XW8A 5HHHA 3PABB 3G5YB 1BNPA 4CNNA 1J9YA 5GGRB 1X4ZA 5E17F 2OR7A 1UD3A 3UYPA 3HHSB 4DWSC 1KGXA 3QRGH 1QU4A 3NQGA 4B5ZA 2NNFA 4E2DA 3MRQA 2K6WA 3EYVA 2XTJB 1J0YA 3OVRA 1J97A 5HDOA 1YJDH 4BBWA 4FX6M 3UCRA 3WDQA 3HW7A 3BZCA 3EKLA 3F84A 5EA9A 4Y2NA 3S16J 3M7SA 4WSJA 4N0UB 1JDEA 5JXED 3H85A 1ZYQA 3T08A 2M0MA 4BY3A 2TRTA 4DO6A 4E6MA 4LY8A 3F05A 3NCWA 1C7TA 1EXGA 3H53A 3IU4L 1H6FA 3LOTA 5DCFA 4ZTXA 1K8ZA 3LCHA 2F6UA 5GADJ 3RPIA 5D2YA 4NWUL 5DC2A 3ZE0F 3LMZA 8ICGA 3TA4D 1KJMB 4YHYC 4XAKD 2EC8A 3I65A 5FHBL 4H0GA 1F4XL 1T4WA 1B4FA 3GHSA 5HHMD 3O2LA 3ARBA 3K2AA 2Q3XA 4IQDA 8ICBA 3HPJB 3BVNB 3L95B 4WK2B 4UTBH 4LRIC 1WAAF 5I6XC 5A8PA 1XIWA 5F3BB 2H6PB 5DEJA 1BF6A 3P9CA 2EIJB 3STZA 2CLHA 4Z2YA 4ZQNA 1IAKB 1GONA 4YC2C 5HHQA 1G4RA 2CYGA 2H8XA 4YLWA 1I1RA 2QUTA 1ZLWK 1DBAL 5GSVB 1IEWA 3PFQA 2DL2A 1NEZB 5HJ3B 3L3DA 3DC8A 1OCOH 2PYFA 1YW1A 1QJWA 4A2FA 1CEZA 4BH8B 4UV4H 5IJKC 1J8RA 4R4ND 2JRZA 2OWXA 1V7ML 5GS0D 2C2EA 1J86A 1TAMA 1OM3L 4M9OA 3QUYC 1T0NA 4L8DB 3N15A 5HDWA 4KKCC 1RJZA 4FT8A 3FRUA 4FLSA 3WNOA 2J6XA 4DEPB 3KWTA 3R60A 3GLCA 4DGYH 3QODA 1JPST 4BXOB 4WENB 5E79U 1KBIA 3U4FA 4QHLB 1AHWB 2XZAH 4AB4A 4AENB 2CDGB 5HGBA 1E4HA 3AYTA 4MWAD 3CJJA 4WK0B 2ZUMA 4F9LC 2HPIA 5EMMA 3CDCA 3O4LE 4ATWA 3AT0A 2D1VA 5TDPB 1V4YA 2L3DA 3T05A 3AG2B 4NZ1A 1NUFA 3HPFA 4FFWD 3BQTA 5LXEA 4B60A 1PTZA 3UJEA 2DDQH 4B0MB 2GT9A 4K3GA 3UBXI 1HCZA 5CEZL 4IOAF 2AJSH 1ZSXA 1TCRB 2WQSA 4GIBA 1I1AD 3KM2A 3EJRA 5I1LA 3VOEA 1R5IA 1J0ZA 3I6SA 4G2AA 1XIMA 2DZWA 2XSXA 3MUHL 4I28A 4GQQA 4HP5A 5LSMA 1X7SA 4MHVA 2CCVA 3NZHH 2CW8A 4KPHH 5I3DA 2ZZ2A 1CIDA 3U7AA 1EDYA 4WDUA 5H2FC 1U8KA 3SYPA 1IT8A 4C1LA 3S8PA 1GXPA 1GEHA 2R4RL 3KHRA 2VXTH 1LO3H 1UPMB 4IR1A 1DK3A 2EYTB 3QDME 4E9SA 4NLBA 5C0AA 1P7QB 2DM3A 2RJMA 1FEXA 2R7UA 4IISA 1OKEA 3H2AA 3HJEA 3GSWA 1JIBA 3R0MA 1FQ9C 3QHFH 4RGMB 1A7QL 1FZMB 3EXJA 4E5XG 4P1WA 4UNUA 3DX2A 2MG4A 2DT0A 32C2B 4EEKA 3BARA 4N2CA 2WKGA 4Q97A 2NRWA 2WLYA 1VFCA 2WJEA 4RGOL 1Z00B 4CQ8A 3VRIB 3SCQA 2DYSB 4I9AA 1HKQA 1NCTA 4J8RA 1JF1A 2ODHA 4FCAA 2RNGA 1P0BA 3S37X 1W6TA 1OK0A 3BEWB 2QKMB 4LCRA 4BKLA 1A6SA 4DUXA 4RLQA 3T7VA 4G7VL 3ZMSA 5HI5C 4QW9A 5IZ7A 3RM4A 4KK5D 4GKZA 4DLMA 4R34A 4LIQE 3GU1A 4JFEA 4TUJB 4BWJA 4C4KO 4BUGA 4NN7B 3U26A 3QUXA 4JWMA 1TZOA 4YBQC 3EW3B 5DSCB 4KROC 4HAMA 3P93A 4HLYA 5B1AH 4QFUA 2BHZA 5LBSA 2IMNA 2MH4A 5KCMA 3L3JA 1KFEA 1ICSA 2E5NA 2ENQA 3HV9A 1JPTH 1YEEL 1GVOA 1TG7A 2YSWA 1REPC 3BROA 4L37A 3G04A 3PJWA 2XRAH 4WI5A 2GK0A 3QIWA 4WY0B 5DFAA 5MHBA 4HDIA 1LEGA 3HRMA 3EDEA 1XIHA 4G9BA 1IRFA 3ARVA 4Z1AA 1TMCB 1JWMA 5HVFB 1ZRMA 3GMMA 1EIBA 4FF5A 5HPMA 3KVQA 1ZANH 4KNUA 3UPCA 2E7XA 4Y15A 4UQ3A 2ELKA 3DPUA 4IP4A 3H6JA 3ABMH 3S37H 1CQYA 4HAIA 2BMBA 1FHNA 4TXEA 3Q44A 1Q66A 1D6VL 4EWND 1M5WA 3FMQA 4I01A 1L3LA 4MJ5A 1UADC 4NVTA 1DO6A 4KJPD 1SUJA 4G8GA 5HBBA 5FO8B 1XH3A 3ZS4A 1Z9OA 5IW6B 3CZSA 2YD8A 2I5GA 1Q72L 2A5UA 5F64A 1A5MC 5D4SA 5JH2A 4IFRA 3CCEI 2K3TA 1Z1DA 2ZKXA 3KZYA 1HGYA 3RPUA 1SD7A 1UXSB 4F2BA 3FU9A 3EB2A 5T1DL 4HA8A 1KB5H 2EIKH 2W84A 2V2DA 3LCYA 2QW5A 3R18A 4FX5A 3M4OJ 1FO0H 3OQ8A 4BINA 2OWOA 2DPUA 4A6EA 2REQA 4KOCA 4RT2A 4Y9OA 2QHRL 3FUFA 2FZDA 4PY7A 3TKYA 1SLWA 3C5ZA 5CSRA 4WEVX 1EBAA 1NCBH 3DVNB 1XGZA 3SPJA 2E56A 2GKIA 3BZGA 4WU5B 2DW5A 3E3QE 1IN4A 3D3FA 1Z3GL 1YO4A 1BQLH 1KPUB 3O2WL 4OZGA 1TA3A 2O56A 4ABQA 1XXDC 4MA3A 1EHAA 4Z7UA 5C7XH 2PTYA 1AE6L 2E3VA 1U5TA 4PRAB 2Y31A 2YXMA 3RVUC 1RPLA 7ICUA 5LAXA 1WHUA 2P8CA 2K3HA 4L4TA 1JGSA 1N6QH 4MTMA 4F1ZA 1I3QJ 2DLLA 2F5BL 3BZKA 2P44B 2OVLA 2OJZH 4U5KA 2XDVA 4FR6A 1ZENA 3CUQB 3ITGA 4RIRA 5CVJA 2L7QA 5LHGA 5A2AA 1LTXA 4M9SA 2A1JB 3PTDA 3U4BH 4RETB 1LGVA 1CWYA 1ZWIA 3HSEA 1KN4L 3HN5A 5CEZE 1B6UA 1QRNB 3KP0A 4CF3A 4Y1AD 2AKRA 2EG7A 4NY2A 3LI0A 1MHHA 4MYXA 1ZT4A 5D2XA 1ZHKA 4TV5A