3HJEA

Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
704
structure length
704
Chain Sequence
MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDELGGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEEEKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRDYPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNKIGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDELVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNCSQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDKFHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKNDEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMFNNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPVVFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ST0929, a putative glycosyl transferase from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii str. 7
molecule tags Transferase
molecule keywords 704aa long hypothetical glycosyltransferase
total genus 284
structure length 704
sequence length 704
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09196 DUF1953 Domain of unknown function (DUF1953)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Maltooligosyl trehalose synthase; domain 4 3hjeA04
1.10.150.200 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Maltooligosyl trehalose synthase; domain 3 3hjeA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3hjeA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3hjeA01
3.30.1590.10 Alpha Beta 2-Layer Sandwich Maltooligosyl trehalose synthase, domain 2 Maltooligosyl trehalose synthase, domain 2 3hjeA02
2JIWA 3VGHA 4CN1A 1MXGA 2X2YA 2YKKA 3FHAA 2O9PA 3N12A 4D1IA 1NWSA 4P7LA 2VJXA 2VX7A 4HMEA 1DWGM 3ZT6A 1OINA 4OUEA 2DT3A 1VENA 1JF5A 1WB0A 1CGYA 2FDMA 4QLKA 3TP4A 3M07A 4AD5A 1ZBVA 4AXNA 3CV5A 3SUWA 1HVXA 2BY0A 1V6UA 2A3CA 1J0HA 9CGTA 3ARSA 3M46A 3WBAA 3ZJ6A 4CVUA 1LJYA 1ITCA 3PZNA 1V0MA 1EGZA 4HZ7A 2WMJA 3ZM8A 3VSTA 3GNOA 1HJVA 1QHZA 1B90A 2V5CA 3SUVA 4V28A 4OBSA 4FNUA 1UKPA 1GHRA 2BY2A 3HG4A 4W5UA 4JL1A 2VR4A 8A3HA 1NARA 1NP0A 2D0GA 4C7GA 4W5ZA 2VQTA 2E4TA 1JNDA 3W28A 4HZ6A 4XX6A 1VAHA 3WNKA 2RGMA 4L4OA 4AZHA 3B9AA 5JBFA 4PEEA 2WWDA 5D9NA 2IXUA 3WDHA 4U5KA 2XIBA 3QGVA 5A94A 1C8QA 2D73A 4AC1X 3GXTA 1DTUA 4R5EA 3WY3A 2WC4A 2XG9A 3FNDA 5CSUA 1H49A 4LYRA 2XVNA 3OLIA 2YBTA 2G3JA 3WNLA 3ZR5A 3JUGA 4Q7NA 5I23A 2CPUA 2J74A 1CECA 3SCVA 5GNZA 3SCTA 2AAAA 3AHVA 4R27A 1XD1A 5FD0A 2O92A 3D51A 4CCCA 3WEZA 1G5AA 1OGGA 3PN8A 3NUKA 1QHPA 4PTMA 1E70M 4TVCA 3W25A 4JFUA 1F4HA 5M17A 3I3BA 3MU7A 4ML4A 5AC5A 1BLIA 1HTYA 4LGXA 2E8YA 2C0HA 1MQRA 3FN9A 3SUTA 5FL1A 1OD0A 1VB9A 1I1XA 3PZIA 4EE9A 3EJTA 4N42A 4FLOA 4W88A 5I6SA 3EBVA 4CU6A 1LQ0A 4PN2A 3AMCA 4H41A 2JEPA 2WMIB 3RJXA 2VT0A 2CBVA 1ZB5A 2IGTA 5GQBA 4ZE4A 1TMQA 2VR5A 3GDBA 4W7UA 1FA2A 1QNQA 3LXAA 2D1ZA 3J7HA 2ZX5A 1FHLA 3MKKA 1IZJA 4V2XA 2VUYA 4W8AA 1QX1A 4M1RA 2XFRA 4CCEA 3PZGA 1HVQA 1B3ZA 4HPHA 3BGAA 4AIEA 3DDGA 4QP0A 4NF7A 1KTCA 1WP6A 1HWWA 3S5YA 2IUZA 1FFQA 3LMYA 3EJRA 3BAXA 4CU7A 3VX1A 2ZXQA 4DWSA 1CIUA 2Z1SA 4UFMA 5DF0A 1QVBA 2WHKA 4KRTA 2FE0A 3VGBA 3N17A 1XH1A 3DYOA 2WZHA 3WQ6A 5I2UA 3AXIA 2J8GA 5IXEA 1UD4A 5CQ1A 1BYBA 2G8ZA 3ARPA 3WSUA 4X0VA 3BSHA 3II1A 2XGBA 2A3EA 2W92A 1OWQA 2BY1A 2BVTA 1ZBKA 4OKDA 1V6XA 2MANA 2VRQA 4D71A 3L4UA 3BVXA 4UQBA 4D6GA 3IAQA 1BF2A 5FIPA 1HP5A 4PMRA 4DM2A 4HU8A 3AROA 3VSUA 2FH6A 4B3LA 5BCAA 1NOWA 3EYPA 3VX0A 3AXHA 4GI9A 4B16A 1TQTA 3B8SA 2VI0A 3VMOA 4PUEA 1XCXA 4UQDA 1QI3A 3UG3A 1BYDA 3A4WA 5EMYA 2BXZA 3CZEA 1B3WA 2ZIDA 4F8XA 2VL4A 4NRRA 1A47A 3DX4A 2DDXA 5A6KA 1HKJA 4NZCA 3KLKA 1WCGA 3AIRA 4D1JA 1WE5A 2D0FA 2JIEA 1E4LA 1UUQA 5EBAA 1FH7A 1JYVA 3VM5A 3O6AA 1BHGA 3LXBA 1DHKA 1X1NA 3VIFA 1W1YA 4W87A 3BCFA 2CIPA 4S3JA 3ZT7A 4TX8A 4DWSB 1BYAA 1QI0A 2XTKA 2GK1A 3CIVA 1UQZA 3CZ8A 1H11A 4HA1A 1TVPA 4PSPA 3F5LA 4P8UA 1JZ4A 1HJUA 4AEFA 2O9OA 2WSPA 4MNKA 2WVVB 5JBEA 4GQRA 2G41A 3GTNA 4WSJA 2DT0A 1C91A 1BVZA 3HN3A 4CGTA 5CJ5A 1SR0A 3T0DA 5A3HA 4GO8A 5EB8A 3L2MA 4UZSA 2D3NA 4E8DA 3UR8A 1JL8A 1CWYA 4GZIA 1EQPA 3ARUA 1JGIA 1H09A 2AMGA 4AY1A 4PMXA 1V6WA 3UETA 1GNXA 2EXOA 4KH2A 4E8CA 2O9TA 5AYIA 4Z2HA 3WQ8A 2OYKA 1C92A 1VJSA 3AZRA 3WF3A 4PTXA 3IJ7A 2JALA 5BROA 3OLEA 4D6FA 3WNNA 1E6XM 2WMFA 3DHPA 2E9LA 3PZQA 1W3LA 4FK9A 1C7SA 3CHCA 4ZENA 4MTVA 3U7BA 5M5DA 2QPUA 1PAMA 4JZ5A 1NQ6A 4PMDA 3ARVA 4F9DA 1GOMA 2WLYA 3K1DA 2J78A 4MPKA 1WDRA 4JFVA 3OA5A 3VD5A 2J7CA 2ZUSA 3CTTA 1JAEA 1V08A 2XVLA 3WUBA 1GOOA 2VRKA 1E55A 4TX6A 5D8ZA 2XVPA 3WUGA 5E0FA 3UEQA 2WB5A 1AQHA 1BPLB 4AIUA 3SCOA 3RM9A 1OT1A 2J7EA 3DYMA 4BQ4A 1XSIA 3BLPX 4PBGA 1W1VA 4CCDA 4MAVA 5DO8A 4U3AA 2ZX6A 2OLHA 3F5KA 4Z2GA 3K4DA 3SCSA 1GJUA 4TVDA 4U31A 4LYQA 2DSZA 2J62A 1ITXA 1ISYA 3SUUA 3NDZA 4D6CA 2HISA 1IZKA 1EXPA 1W3HA 1H2JA 4MNJA 3MSGA 1BG9A 2D2OA 1V3LA 4A3YA 2B31A 5JUVA 1W3KA 4IPNB 2ZUWA 1MFVA 1QNPA 4AMCA 2OWXA 3AS3A 1TZ7A 1QNRA 3ZR6A 2V3GA 5IFTA 2OW7A 1EDQA 4UFLA 3GM8A 5CLTA 1HL9A 1SZNA 4B9ZA 4DO4A 2J79A 5A8NA 4J28A 5HPOA 2C7FA 3EDDA 5CPSA 5FL0A 4U2YA 4AEEA 2JE8A 2BHYA 2E9BA 3OZPA 1E1FA 4HP5A 2E9MA 1E6RA 4TVUA 1RH9A 3VVGA 5A8PA 3KZSA 1FP9A 1W9DM 5DT7A 3W37A 1HKMA 5JIPA 3VIKA 1ZL1A 3ARRA 1LG1A 3GXMA 1UD3A 1UA3A 1TQVA 2WMKA 1W9UA 4XB3A 2WHJA 4EANA 3MI6A 5LA0A 2PC8A 2UY3A 4BQ2A 3RIKA 1QOXA 5ECUA 3CUGA 4OZOA 1RPKA 3WEOA 5AYBA 3N11A 4F66A 4B3KA 2VTFA 4CD8A 3A4XA 3VIGA 1KBKA 4M24A 4E2OA 3CZNA 3EMQA 3RM4A 1UR8A 3ZJ8A 4J7RA 2X0HA 2GFTA 3VDAA 1WNOA 3CO4A 1NOUA 1KGUA 5E1QA 3OBAA 1QBBA 2TAAA 4AMWA 1JNEA 3U5YA 2W4XA 3ALGA 1TCMA 1S46A 4Z2LA 2X0YA 5BXTA 3L2LA 5JBDA 1E6ZA 3RPMA 2J8FA 1EQCA 1U30A 3A6OA 1KR0A 3MMWA 1EA9C 1ECEA 2FH8A 3W0KA 4RE3A 1GOQA 4UNIA 5C71A 3EDJA 3LRKA 2ZX7A 2ZX8A 2CHOA 1TA3A 2WKLA 2CKRA 1E0VA 1J9YA 1NOFA 4HZ8A 1RP9A 1US2A 3ZSSA 2PWHA 4DUVA 3GXIA 2G3NA 1O7DC 1A3HA 3N13A 4YHEA 4FNSA 1B3VA 2G3MA 3VNZA 1PEZA 3VMNA 1HXJA 4M8UA 3ZOAA 3OLDA 3U57A 1C8XA 1WDQA 1GVYA 1CYGA 4PMOA 2XM2A 2FHFA 1E5JA 5IHSA 4UOZA 5A6BA 1VEOA 3BMWA 2J25A 2J7FA 4P8XA 1JI2A 1QI4A 2CITA 2EADA 3EJSA 3B9EA 2YBUA 2PI6A 1MW3A 3LPGA 2DIJA 2CCRA 1BVNP 3WY4A 2CEQA 1H5VA 1I75A 1M53A 2DQXA 2EBNA 2VO5A 4UFKA 5GPRA 2J7DA 4ZXLA 1OGBA 4P8VA 1JAKA 3N04A 3IJ9A 3K8LA 2XSAA 1HNYA 1U2YA 2WMGA 3WD0A 2VRJA 1GQKA 1XHGA 2JEQA 3W26A 4PMZA 1PBGA 3WN6A 1HP4A 3GNRA 3LPOA 1GONA 1KB3A 1FH9A 5HPCA 1UWRA 3W27A 3HZ3A 2WVTA 1XH0A 3DYPA 2Y5EA 1MYRA 3AYRA 2NW0A 3WMCA 2J4GA 1J0KA 2C8NA 1PZ3A 1QW9A 4DO5A 1K9FA 4HA3A 3WH9A 1VBRA 3ZO9A 5GNYA 5FCZA 1DWFM 6TAAA 1I1WA 2VQUA 4TUFA 4FLSA 1UR0A 4PMQA 1PIFA 3GBDA 1W9BM 5E6ZA 3ARYA 5CGMA 4Q22A 2F1AA 2OWCA 5A8QA 3RMEA 1ISXA 4DO6A 1HX0A 1E71M 2UY4A 2PBGA 1B3YA 1V02A 1V6YA 1NM9A 1IT0A 1UR9A 4QAWA 5CZKA 5E70A 5HBFA 1FH8A 1ESWA 2HVMA 1KTBA 1Q6EA 1WDPA 2WC3A 2XM1A 3AHXA 3PZ9A 3ZQ9A 4DWSC 5ABFB 1DWHM 3AJ7A 4JKLA 2XGIA 3A47A 3CUHA 2EPMX 1EHNA 4GZEA 2ZWYA 2VMFA 5F7UA 4U3CA 1M04A 1R7AA 2VURA 1J0YA 4AZ7A 4JCLA 3SCUA 3VIPA 4XZBA 4EKJA 2CESA 4MJ2A 1MWOA 1UR2A 2GJXA 4Z2IA 5E09A 3WY2A 4UQ9A 2VNCA 1ODUA 1E9LA 4MDOA 1CDGA 4MNMA 2V3FA 3THCA 1HJXA 4UOJA 2XVGA 3ARXA 3VD7A 1TQSA 1V3IA 2WXDM 1HKKA 5A6AA 1WAWA 4FNQA 3WQ4A 3SCQA 2E8ZA 4B9YA 4CUCA 5M3WA 1HF6A 1PX8A 2J77A 5AC4A 1JZ8A 2A3BA 4BA0A 4CD4A 4MB3A 2VOTA 4PYSA 2FGLA 4ZXOA 3HMCA 2W66A 2WLZA 4OBRA 3TA9A 3WL0A 1VF8A 5A2BA 4E4PA 1UWQA 4JFSA 1N82A 4JAWA 2ZUNA 3N18A 4X0NA 1US3A 1VFFA 3WQWA 3WNMA 1B3XA 5A6SA 3DX3A 4W93A 1CZ1A 1V0LA 1V3JA 3WQVA 1QNOA 3FW6A 3CLWA 1CLXA 4KWUA 2WAGA 2DIEA 4MAZA 2VZVA 2VZTA 4IPLA 1VFMA 3WFLA 1DWIM 2DPEA 3IANA 5A6LA 2BHUA 4FF5A 2ZWZA 4W8LA 4NX0A 2PWGA 4BQ5A 4LPCA 2GVYA 1GHSA 3VNYA 4H04A 3SURA 3EJUA 3W4RA 1KXTA 3BUPA 2Y8VA 3ZT5A 1JI1A 1AVAA 3PBGA 3MUY1 1XCWA 5HDRA 4OJYA 1UD6A 4D6DA 4Z2JA 4HOZA 3CHEA 1KQYA 4J3UA 1E1EA 2EJ1A 1E40A 2WMHA 2PWDA 2F7QA 3DECA 4W89A 5BXRA 3AIBA 3AS2A 4NSBA 3IGUA 2X09A 3D3AA 1J0IA 4P7OA 2F1BA 3A5VA 2CBIA 4NZFA 2WVVA 4U33A 1EOMA 3RILA 4GI8A 2ZICA 5I77A 1XD0A 1ISZA 4TTGA 3SCPA 1LLOA 1G9HA 2Y8KA 2YFOA 3BUIA 1EOKA 4HPGA 2CETA 3W53A 2QPSA 1UASA 1B31A 3BUDA 1GOWA 1M01A 2XUCA 4CD5A 4WKFA 1TFVA 3MV11 3D50A 1QI2A 4WIWA 3L4TA 2FYVA 3AHZA 4EK7A 2GJXB 1LF1A 4MB5A 5BYWA 2YIHA 4V27A 5A69A 3W29A 4MNLA 2XVKA 1UZ4A 4W84A 3POCA 1BGGA 5I79A 3T0AA 2ZUMA 1H3GA 5C8BB 4RL3A 3GBEA 3DX2A 3PHAA 3VILA 2EAEA 5FKYA 2VZOA 2BV9A 5D9MA 4K68A 1WZAA 1DP0A 1KFWA 4BF7A 3BSGA 1W91A 4AZIA 1PX3A 3WF2A 3WF0A 4NXSA 1VEMA 4H2CA 4URIA 2WVSA 4F9JA 2E0PA 4TOQA 3OGVA 2GSJA 2GJRA 3WFZA 1YQ2A 3AHYA 3VGGA 5ABFA 3CUIA 4C7DA 1GJWA 2J75A 1QHOA 3VO0A 4M56A 2OW6A 2V3DA 1W2PA 2A3HA 5HOSA 3SEPA 3M6DA 3NYDA 2WCAA 4TXEA 1CGXA 5BRPA 2WNWA 2YL5A 4KRUA 4PRWA 4AWEA 3A21A 5I24A 2WCSA 3H55A 1ZU8A 4GINA 3CUJA 3BMVA 4MDPA 1R46A 1TUXA 4XUYA 2A3AA 2RGLA 3VOCA 3WNPA 4BZYA 3DHUA 4B15A 3CZKA 1M03A 3AFBA 1UWUA 4CN4A 3LRLA 2ZUTA 3WMBA 1JIBA 3IK2A 1XRVA 4LXFA 2VZUA 1CXFA 2WHLA 4AIOA 1OM0A 3LXCA 4M29A 4AD2A 1UH2A 2FHBA 3CMGA 4YHGA 3APGA 1B2YA 1DWAM 3DC0A 3T08A 1X6LA 2WWCA 1R33A 4PUDA 8CGTA 3N9KA 3AS1A 1H1NA 1UWTA 3CPUA 3GH7A 2Y24A 5I78A 4AD0A 2PB1A 1Q6CA 1ZS2A 3GXFA 3HG5A 2BVYA 3WENA 1J18A 1B0IA 3ZIZA 2QMKA 4WK9A 3FXYA 3WNOA 3T09A 2GDUA 2E40A 1O7AA 4KGLA 1GQJA 3BAYA 2V38A 3BXWA 3BH4A 3RO8A 1E0XA 2X05A 2ZX9A 1QI5A 4W7WA 2BHZA 4AD3A 4W85A 3W82A 2VVNA 1GQLA 4PMUA 1CXLA 1G1YA 5A1AA 3NSNA 1CPUA 2XN1A 1UYQA 1HT6A 4H8VA 4W7VA 3PZMA 4ACYA 3WIJA 4J27A 1VFOA 3HU7A 2GUYA 1C3FA 1H41A 2F7PA 1GPFA 2YL6A 4AYSA 4H7VA 1ODZA 4J3TA 3ALFA 2WMIA 4MADA 1UD2A 2EPOA 3WH8A 3WH6A 2EPNA 1W1TA 2GDVA 2DEPA 1OBAA 1JDCA 2JF6A 2VVSA 4GKLA 3CZJA 1HKIA 3ZJ7A 1V0KA 1SYTA 1UKOA 4FNPA 1UQYA 1E4NA 3UERA 2OWWA 1QBAA 3AOFA 1D3CA 3U5UA 1QPKA 4KMQA 2VCAA 4AISA 1OIFA 4IUGA 1JD9A 2OSWA 1X6NA 3BAWA 2W91A 1PS3A 3A3HA 2BS9A 1FP8A 5AY7A 3K4AA 1JYNA 1MW1A 4QLJA 1ISVA 1AQ0A 1MW2A 4J3VA 3WDQA 2XWEA 7A3HA 3T2PA 5D9PA 3TOPA 2XFYA 1Q4NX 1NWUA 3PTMA 2DT2A 3L4WA 1LL7A 4U5IA 1H0IA 2D24A 3ECQA 4P8WA 4U2ZA 5A8OA 5FOOA 3GNPA 1EHAA 1B1YA 1KR1A 2X8RA 1JXJA 1XV8A 4ZFMA 2JFEX 3K8KA 1PZ2A 3WMSA 2QMJA 1K9TA 1XYZA 1RP8A 1KGXA 1E5NA 1MQQA 1E0WA 3LPFA 4WKAA 4OGZA 3WEMA 1V0NA 4IM4A 4OOUA 1U33A 4WKHA 3WF1A 2G3IA 3AICA 4GPNA 2EO7A 4P7NA 5I5RA 1UD8A 1L8NA 3L4XA 1QNSA 2W67A 1JZ5A 1G94A 1TVNA 3KL3A 3VMPA 4UCFA 1JFHA 1PIGA 1FHDA 3AZTA 2DSKA 3WELA 3EJPA 3CBWA 1ZJBA 1CXHA 2ESCA 3CZGA 3WUFA 1V3HA 4HTYA 3EMCA 3FAWA 3I3EA 3T0BA 3ZMRA 3W38A 1G01A 3O9NA 1OT2A 1NH6A 4UFHA 1BQCA 2E3ZA 3NIYA 1CXEA 4W8BA 3RJYA 2CERA 1E73M 1CTNA 3D4ZA 4UQAA 1E6SM 2FGZA 1KWGA 1SFSA 1C93A 3FAXA 1ISWA 1JDAA 4WF7A 1GORA 3AQUA 5CLWA 2X2IA 1E43A 2ZXBA 3OG2A 4LYPA 4GXPA 3CZLA 4UOQA 1MFUA 5TD4A 1UR4A 3AIVA 4MB4A 3WKZA 5A8MA 1UD5A 3AMGA 3AIWA 3KL5A 1DWJM 1CGTA 1EIBA 3WDJA 4GIAA 4PSRA 3BLBA 3WDRA 1EO5A 3OGRA 1HJQA 1JDDA 3A23A 5ABGA 3EJQA 3KLLA 4PCSA 2IXVA 3FHQA 4QLLA 3WD1A 3MUIA 1CLVA 2XSBA 1VJZA 3VM7A 5DFAA 1UWSA 1ZJAA 1VRXA 4AYGA 1BSIA 3BVUA 2XN2A 5CG0A 3NSMA 3PZUA 2F18A 4MJ4A 1KQZA 2X2HA 4J3WA 4PCTA 6A3HA 2Q8XA 1UKTA 1MQPA 1C90A 1D7FA 3CMJA 2CXGA 1QWUA 2D23A 1OB0A 2CKSA 2VC9A 1WO2A 4PTWA 1Q6DA 3LPPA 3OLGA 1MXDA 3RM8A 5A95A 4J3XA 2DT1A 3OB8A 2EEXA 3F5JA 1TQWA 5HNNA 5A2AA 4NXKA 1HIZA 3GXNA 1EH9A 4HOXA 5LYRA 4HU0A 4GI6A 3AZSA 2F8QA 2NT1A 1J0JA 2V3EA 2AOSA 3AIUA 3MMDA 1D2KA 1KXHA 3CHDA 2YDSA 4A3HA 3OGSA 4C7FA 1JG9A 2D0HA 1C8YA 3GXDA 4YPJA 4UFIA 3KEHA 1ZBCA 4PMVA 2QV4A 1KCKA 1KXVA 1PJ9A 5CSYA 3TTYA 1OD8A 1J10A 5CPQA 4D6JA 4D6IA 4HMCA 4GO9A 1V02E 4JHZA 1Y7VA 3T2QA 2YA1A 1HL8A 3IAPA 1YHTA 5M03A 3ARTA 3PTKA 5HXMA 1LL4A 3VGFA 1GW1A 4A4AA 3NDYA 1EDGA 4AZ6A 2J47A 2EPLX 3DX0A 2ZE0A 2QF8A 1KBBA 3RCNA 5ABEA 2YL8A 1OSEA 4M80A 3L4VA 1GVIA 1WKYA 1H4PA 3VD4A 2WYSA 1JFXA 4H8HA 1OCQA 1R87A 2YA2A 3E1F1 2WSKA 2CBUA 3K8MA 3VDHA 2D22A 1LG2A 1TA3B 4XV0A 3VKKA 2F7OA 4JKMA 7TAAA 3QHMA 1CGUA 1XYFA 4M81A 4AZCA 1AMYA 1NP2A 4JFWA 3N15A 2BVDA 1T0OA 2WPGA 7CGTA 1BTCA 2QLYA 2YDQA 4D72A 3AI0A 3MV01 2GJPA 1RD6A 1CGWA 4BCEA 2Y2WA 4HOWA 1E3XA 3DDFA 1B30A 2YLLA 1KCLA 1E4IA 2W5FA 3I3DA 4FMVA 3SCWA 4JCMA 4QCFA 1Z32X 3VDCA 3PTQA 4Z2KA 1XH2A 5DEZA 2PBOA 3WBEA 3AYSA 1R8LA 3MSDA 4RE4A 2CNCA 1BG4A 2WKGA 3CH9A 1HJSA 2G4FA 2WZEA 3CHFA 3AXXA 1VBUA 4N0RA 1R34A 2YFNA 1JF6A 5A6BD 2VX6A 4JHOA 1UH3A 1UHVA 3VSVA 2DSUA 5EFFA 3U7VA 1R75A 4WJXA 2DSWA 3AMKA 5CGTA 3AHTA 1GQIA 4NRSA 4FLQA 4DUXA 3H54A 3AIQA 3VD3A 3MMUA 3GH5A 1CEOA 2BXYA 5LA2A 1E4MM 1GOIA 1JZ3A 3GXPA 2WBKA 2CHNA 1LWHA 1E6PA 1WZLA 3BLKA 3WD4A 5DT5A 4FNRA 4NZJA 4F79A 1GOKA 3WH5A 1HJWA 3WQ5A 3G6LA 2O9RA 4ZE5A 2YJQA 1VIWA 1TE1A 3UR7A 3W6MA 2UWFA 4WLCA 3QHOA 4AD4A 3HG3A 1IV8A 1KGWA 2BY3A 2XFFA 2UY2A 5BWFA 1E6QM 1WDSA 1E15A 2XN0A 1JXKA 2EQDA 5IFPA 5IDIA 2ALWA 3CGTA 1VFUA 2XIIA 4CN6A 3MS8A 5BXSA 1W9XA 1KWKA 3KL0A 3VINA 1R85A 3BAIA 3MO4A 2OYMA 4IISA 4UQEA 1CXIA 3VTRA 4NI3A 4JFTA 3UCQA 5I3DA 3CC1A 3NCOA 4MB1A 2QHAA 1UOKA 1E72M 3VIJA 3EDFA 4CKQA 1W9PA 2VCBA 4PTVA 3ARQA 5LA1A 1NWTA 2J7HA 5I0DA 1UWIA 4P7QA 3MUZ1 2DSVA 2V5DA 1W9VA 3VIIA 5A6MA 4PMYA 1UG6A 3BUQA 5A2CA 3RDKA 4AW7A 3LRMA 1E6NA 4TTUA 1G0CA 3D4YA 1JZ7A 2JF7A 3KWXA 2YDRA 3WF4A 5JIWA 1XSJA 3TTQA 3VIMA 2OSYA 3S5ZA 3S6TA 1L0PA 1Q6FA 1K9DA 1WZKA 3IJ8A 4J3SA 2WZIA 3W24A 5BXPA 1AQMA 4AZBA 3EDEA 3WDIA 2VX5A 3N1AA 3GYCA 2WM0A 3SIMA 3T2OA 3OIHA 2W63A 3F4VA 3A22A 1W2VA 1HXKA 3L4YA 4UZUA 2VX4A 3FY1A 1DEDA 2YA0A 1XC6A 1W1PA 5CPTA 1QWNA 1BFNA 2WHMA 2PWFA 2WCGA 4DUWA 2EPKX 1CENA 1R47A 3OZOA 3SCRA 3TV8A 3BVTA 3M7SA 1UA7A 3W6LA 4AZ5A 2FHCA 1J12A 5E6YA 1W3JA 2W62A 3EDKA 2YL9A 3AISA 3LX9A 2XJ7A 3AMLA 4W86A 3S2CA 3PZTA 5D8WA 3CUFA 1R86A 4JL2A 4RE2A 4ATWA 2GK1B 1J0ZA 3VGDA 5KEZA 3BC9A 1H0GA 1UR1A 1V6VA 3VDBA 5EFDA 3MUAA 1FFRA 1VEPA 2YLAA 3A24A 3MANA 4UTFA 3HG2A 5GNXA 3GZAA 4EAMA 3VIOA 2Z1KA 1PX4A 5D4YA 4PMNA 2J7BA 2XHYA 3QOMA 2NT0A 3VU2A 2PWEA 2DH2A 3BAKA 4Y7EA 4GZJA 4CVWA 2WK2A 3HJEA 4ZEPA 4JIEA 1SMAA 1ZBWA 1EDTA 1OIMA 1LWJA 3SCNA 3EMZA 2XYLA 1EO7A 1V3MA 5E0CA 2DH3A 3VUPA 2X1IA 3TONA 1UZ1A 3ARWA 3CZSA 2UY5A 1MVYA 2VCCA 2F7RA 5BRQA 3WUEA 4AZGA 2Y4SA 5KZ6A 1FOBA 1CBGA 2BNJA 5IHRA 2CBJA 3NJ3A 3AIEA 1HN1A 4LX4A 4LQ1A 3WD3A 3BAJA 2EABA 3A4AA 1BAGA 2WW5A 1BGAA 1BYCA 2EACA 3NSXA 4UFJA 3QR3A 4HMDA 6CGTA 5A6JA 2F2HA 3SUSA 4ACZA 3L4ZA 3POHA 4L4PA 1QW8A 5C70A 4HA4A 2NSXA 1XSKA 2ZUUA 2ZXAA 3WH7A 3BVWA 1K6AA 4AMXA 1O6IA 3K46A 2W61A 1JYWA 1JYXA 4CU8A 4UR9A 4GQQA 4D6HA 3WD2A 1KXQA 2D20A 2DGAA 3QOKA 1J11A 1M7XA 4QCEA 2YOCA 3TTSA 3TTOA 4QDMA 1W32A 1J01A 1GCYA 1P6WA 1TR1A 4XZWA 1LL6A 2OSXA 2VZSA 4AD1A 1CGVA 3ZSTA 3PZVA 2WC7A 3WDPP 2WBGA 3GH4A 3KE0A 1GUVA 4OIFA 1F4AA 3UG5A 3DX1A 1E56A 3BUBA 4OOZA 4H8UA 1TG7A 5D9OA 3B9DA 5CXPA 1CNVA 3ZJKA 1K9EA 1WPCA 2ZOXA 4DM1A 1TQUA 4FNTA 4YN5A 4QFUA 4ATDA 4X9YA 2ZXDA 3PZOA 3THDA 1MW0A 3UG4A 1E3ZA 4JKKA 3W81A 2ZUVA 4ACZB 3UESA 4KGJA 3VIHA 4AZCB 3VPLA 1V03A 4BS0A 2OYLA 1JZ2A 2CYGA 1JD7A 1V3KA 3G6MA 2PF0A 5E9AA 1NWRA 1SMDA 1UKQA 3BCDA 5ABHA 4P7RA 1UKSA 1C7TA 3D52A 3ARZA 3QHNA 1XGZA 4FLRA 4BQ3A 2J7GA 2XWDA 4DWSD 4D6EA 1JZ6A 1GZJA 3H53A 3WL1A 4CD7A 1OGSA 4WSKA 3AMDA 3BVVA 2D3LA 4CD6A 3WY1A 3O2LA 1B9ZA 2WANA 4UQCA 3AS0A 1UH4A 3D5HA 2F61A 2X2JA 1WZMA 5DMYA 4ATLA 1CXKA 1R7OA 2XPKA 3VGEA 4M82A 1PPIA 2BFGA 2WVUA 4S3KA 3VD9A 1Q6GA
chains in the Genus database with same CATH superfamily
1IGCL 4E6MA 3VFUB 3FHAA 3EH1A 5LIKX 5FYJL 3TEVA 1WHPA 1QABA 5ALOA 2JLLA 5EC2A 4KK8D 4K94C 1XL9A 3OVQA 2CLHA 1FLRH 2K3PA 4PGCB 2WOQA 2NY1D 1UA6H 1YRNB 3M7OA 3V5DB 1GKQA 2DTML 1WQ5A 3BT2L 5CJOL 3SDXA 4GW5A 3IMUA 5DMJB 2APFA 2QDDA 1DJIA 4PJGF 5FI8A 1IYXA 4WTWA 8A3HA 1E9QB 4YTRA 3LZFL 1NP0A 4MF2A 2QVKA 2XAHA 1FHUA 1M6UA 1PZNA 3BS5A 2XICA 4ZQCA 4XNZC 1OAQH 5K5OA 2CR6A 2N8GA 1Q9WA 2RBLA 4RBPH 4PIRF 2IXUA 2VXTH 4N9EA 2YK1H 2E19A 2WWMC 4JTQA 4X80H 5HVHB 4NC8A 2QCOA 4XOCA 1Z4NA 1AQKH 7FABL 5KZMA 1P7QD 4LG3A 1XBXA 4X7SH 3GV5B 1BMZA 3S4TA 3KOYA 1ACZA 2YBTA 3WXWL 1A22B 3D2UA 4XC3H 2P24B 2GO7A 3BR6A 1UB6A 2PPEA 4ELME 2GGIA 4XPBL 1IF1A 4GWEA 2X28A 4NQDB 4OBTA 1DFBL 1PHWA 3K4JA 1FF5A 2HOSA 1JT0A 4TVCA 1O3RA 2M0CA 2FQDA 4ES4A 3QPHA 1UHSA 1F7BA 2WCPA 5FL1A 4BJ5C 2WJDA 4PCYA 3C86A 4DN3H 3RI5F 4Q8QA 3KS0J 3KLHD 5GTIC 1DQVA 4LESA 5EIIA 3SW6A 4BY7J 5C0CB 4G9FD 4L8DA 4Y52J 1XIHA 5CBEA 2Q10A 4H41A 2JEPA 3DGDA 1BQHA 4ZZ9A 1OP5K 4PHXA 5DLML 4ES9A 2XFRA 1BD2E 4CCMA 3BGAA 4IMAA 5BZDB 5I3KA 5CN1A 1HL4A 3ZTEA 5B21A 4IL6U 1XIWB 3VAEA 1QFUL 4MY9A 2FL5B 3JWDC 2FE0A 1MHEA 1ZHBB 1TE2A 3KP1A 2HRGA 5IXEA 1X5MA 1HHHA 1T38A 1B0XA 1XB6A 3VVWA 1R49A 2C4FT 2DTSA 2UWEF 5JNYA 4OJ5A 3RFZB 2W92A 2A3EA 4UB9A 3OQ8A 1YEEH 4Y16C 3ROUA 2WAQC 3LB6C 4HKJA 4AYBN 5IVZB 5EU5B 3DJSA 1ZAIA 3OJSA 5DA4A 5AYXA 3A4WA 5MKGA 4RGMB 4YJ5A 1XR2A 1HKQA 4PTTB 4EN3D 2D7TL 3VKCA 1Z9MA 1WCGA 3R7RA 4B2DA 5GAHJ 2G75A 3S1WA 1YTKA 3LBCA 4CCKA 2XT1B 1Y0LA 3RGVA 2IPKA 4RGNC 3LHYA 2ZIXB 1MQ3A 4US6A 2KZZA 1H11A 1TVPA 4OFIA 4G1KA 1PZSA 3NSJA 1AU7A 2V6CA 3NRFA 4LVOB 3C23A 5D32A 4YZFE 3K4KA 3RJGA 3M41A 1FZOB 5DCDA 1OEZW 4NI6A 4NHUA 4ALDA 1U6GA 3FT4A 3T0DA 4Y4HB 2W27A 4LEBA 4Z2YA 1AIFA 3M45A 4U6XB 2EDOA 3FXMA 4JTGA 5I1LB 1GGCL 2RQ5A 4OI8A 1JNNH 3OYCA 3RWEB 4R34A 1UUMA 3W1LA 3K2GA 1QUMA 2NRVA 4HCRL 4XXDA 4C56A 3F2CA 1SV0A 4C55A 1MCRA 3H9JA 3C0QA 3X14B 5DK0A 3VQMA 2JEJA 1MNUH 3O3EB 1NQ6A 3PGFL 1GOMA 2FCBA 2PURA 1YY8B 2ZUSA 2HHVA 4PZVA 2ASLA 4ASNA 3F84A 4GCXA 3E02A 2R29L 3IG5A 4W9EC 2NNRA 1TTFA 1U8HA 4YE4L 4S0HB 4JQIL 2GOKA 4XN2A 2Q4TA 3SDDC 1UB5B 4PJ5E 4J4PC 2NXNB 2CE6A 2ZAHA 3P9LB 4B3EA 4BXUA 4GBXA 2J62A 1K6QL 1XH3B 2H6UA 4FI4A 3KVKA 3H9HB 3ZMVA 5AI0A 1I8AA 4UAOB 5JUVA 3N43F 1USTA 4XP6H 4U1IA 4F8RA 1F1GA 4GW1A 3AU1B 3CC2I 1SZNA 2A74C 2VXSH 3V6FA 5B7YA 3PQYE 2HWZH 1NCTA 2JELH 1K8IB 1RIHL 3OKLB 4XK2A 4HK5A 1ENHA 5AVTB 4F91B 1QQ5A 1JKOC 4TVUA 3IMVA 1HE7A 1XWVA 1YEFL 3WN5A 3TJEL 2VXNA 3H42H 2IXQB 4J6IA 5KG4A 3SE4C 4BH7B 2YK1L 1XAUA 1XCTA 3BE1L 4JHVA 5FKAB 2X0UA 3FTUA 3RIKA 5J1TC 2BMBA 5HMEA 1A6AB 3IFOA 1FEZA 2IVFC 3QR2A 1WNOA 5SX5H 8ICXA 5A8GA 1PKLA 5JLZA 1F1ZA 4OKVB 5KHDA 1QVOA 2MCPH 3M88A 3U9UB 3BDDA 1U30A 3HBLA 2H32A 2WADA 3V3WA 2JB5L 3IEAA 1S2VA 5IIJA 3W7HA 5DURB 2ZX7A 1YT3A 3WBYA 4HAMA 4OUUA 3FK6A 4X5RA 3DENA 4TO8A 4D9QD 2COMA 2KH2B 3VI3B 1SN5A 2VR7A 2HV5A 4A2HA 4M8UA 1HINL 2I5HA 3QC6X 1NPUA 4F7MB 3TW7A 1UT9A 2J25A 2CV1A 5LHEA 2EADA 2C7UA 3C18A 4KX5A 3G24A 3RTVA 3NPXA 1ZQAA 3FFCE 3WY4A 1KBJA 5B39G 4ZXLA 2YUWA 1SHSA 2NY6C 4JIIX 4ESBA 2R5ZB 1F56A 4BFKA 4IQLA 4HYWA 3FF8A 4CBPA 1DVZA 4KJPD 3EOYG 3LB0A 1BVWA 3N9RA 1G4EA 2NW0A 4JRYD 1KEML 3SSJA 1QW9A 1SYSB 4MDIA 5C44J 4MQSB 3RZWA 4EM1A 1O9VA 3F0CA 1T0FC 3QNXA 1BJMA 4P04A 5K9QI 4BHYA 4F3HA 1SAUA 4KX7A 2V5TA 3QRGH 3IRQA 2DDAA 3Q2CA 1V6YA 4ZD3L 1ZFJA 1TITA 3TZVD 1KCBA 4YDLB 4C8MA 1M6OB 4U1GC 2PPFA 3H7IA 5F7KC 2BNQB 1ZHLB 1DVJA 3TN0A 1TNMA 3JYCA 5DY2A 1B2WL 3QPXL 5ID1A 1JGDB 2X4OB 2ZWYA 4FXGB 2EC8A 4HIIA 1KLZA 4NO0B 3TEYA 2PPAA 3ASWA 1LM8V 2M8GX 3DX5A 4YDVA 4LFHD 1B4RA 1A3RL 2BYVE 2E7BA 3CSYA 4ORIA 4YWGL 2V3FA 4C1LA 4XRSA 1MJ8L 4X98A 3L2WA 4B3XA 3ZN0A 3ZI4A 4QRPD 4J5NA 1RSFA 3WQ4A 3KVQA 2XACC 5IBLC 1RBAA 2H6RA 2ZOUA 3PM6A 5HJYA 4KLIA 3ZDBA 2WKJA 3EB3A 5DD0H 5CEYB 1JUFA 4DKFL 3UJSA 3MCLL 1UWGH 2P5EB 2XC9A 1DBKL 1R0MA 5CEXB 2IAMC 1IILE 3MLZL 1KLYA 4QT5A 3V4PL 2C1PB 4IPLA 1G4SA 3U6XA 1A65A 1YQAA 5KFNA 3HPFA 1UG2A 4G8AC 5PCYA 1GHSA 2XUWA 3E38A 4UM8B 2ZCKH 4M62H 1NIAA 4EDXA 2QCDB 3P0YL 1KTQA 1PB0A 1TKWB 4DQWA 2K9UA 4YBLC 2Y9YA 2BVMA 1GAFH 1NCAH 4ZC3A 3Q6FA 1A4KB 3T4AA 1KQYA 3W9DA 1KELL 5KSBF 1E0EA 2PP7A 2WYIA 2TCTA 2DJ4A 4XOTA 2W9EH 3MUXA 3A5VA 1T04B 2BW5A 2OJ1A 4HSQA 2C3ZA 3UNDA 4OV9A 3OAUL 1IUYA 1Y0UA 8ICWA 1CX9A 4O6JA 1EAPB 2CQXA 1XD0A 1Y8QB 5GAGJ 3MBEC 1QTWA 4C6EA 3BUDA 5GZOC 4YDJA 2VEKA 2QQKH 3MV11 2WIIB 5D8JL 1F9CA 1T33A 3WHXB 3WG6A 3P40A 2UY7A 2MHAA 2XVKA 2IOIA 2Q6WB 3BLFA 1HL2A 4IW4C 5I79A 2V5LA 4Y2OB 2Y5TA 4RL3A 2ZNWA 1TVDA 1CK0L 4GXOA 2EAEA 4Z7NF 3CBJB 3SBFA 5DD1H 5FGBA 1J8VA 2FATL 4M7KH 1VEMA 1WIUA 4LLLA 4HSAC 4OZHF 1FIEA 4V2CB 1DYZA 4LVHB 4ZZDA 5F2MA 5DC9B 3K6SA 3LNGA 5TE7L 1A5KC 3HT3A 1OCTC 4U3SA 4LCYB 4ZBCA 5D4RA 1SOKA 4O12A 3GSOB 4L8CB 4A6DA 3DHFA 2NO4A 5AI9A 5I9QC 1CGXA 2H2SD 5SX5K 5DWUH 3OBKA 3P9IA 2Q86B 2WZAA 2NY6B 4I2DA 4M7JH 1P84J 4YGVB 4KVCL 1E7VA 3BS7A 1XX5A 3OXSA 1PWMA 4RPQA 5FF2A 5B38A 1VFBB 4ICMA 1SZFA 2R8SL 2ADGA 4KN7X 5LQBH 4EZMA 3VYRB 1MWAH 4B96A 4WWPA 1EUTA 4XNXL 4GOSA 1NCCL 4CMMB 3QXTA 3FO1A 3UAJA 3E8VA 2AERT 2M1KA 3KS6A 1J18A 4I87A 5JI6A 4PHDA 2WWKO 1KCWA 1DU0A 3AT8A 4Y4HD 3NK4A 2IQTA 4I2IA 2V5BA 1A50A 4W85A 4LVBA 3ITVA 3NQOA 1A1MA 3PZMA 5JIQA 3VC6A 4FFTA 2VN3A 3SOBL 3PS6A 4B09A 2Q0ZX 2R56L 3VEPA 2NY2D 4J3TA 5I00A 3S1XA 1FUYA 3CSGA 3FIGA 2SEBB 1JCKA 3FB8A 4FABL 4JG1L 2ZZ6A 2QZQA 4MQ7A 5DZVA 1S78D 4LBEA 4M00A 2XB5A 3KFUF 3OR6B 4Z6AT 2ZFAA 1H9TA 4MCMA 1PJRA 2JH7A 3DJTA 1N5YL 2R0KH 5KVFH 2K6ZA 3E3QC 2Y1YA 2I07B 1UGNA 4RUBA 1MLCB 2PCEA 3O9WC 3QQ4B 1EZVX 2PMHA 4W9LC 1AWCA 2MBFA 5HP4A 1MVUA 1J6PA 7REQB 4P4OA 2IT0A 3P4OA 5G1MA 4DPQA 2HXIA 3KYDB 4YEJA 1FHNA 4XP5H 3UWYA 2YR1A 1NDWA 2FB4L 2KDZA 1SD7A 4BFJA 3GYEA 4WEMB 2UBPC 4DL4A 1RR8C 4ED0A 1XV8A 1L3UA 5CR1A 2KVSA 2JFEX 3CN3A 1ONQA 1ZOLA 5JOPE 3B0UX 2QGYA 3DK2A 4JFDA 5B3SH 1ACYL 4OLZH 4IM4A 1QNTA 2DV6A 4OOUA 3NGFA 1MI5E 3UADA 2CKNA 5HDGA 1UD8A 4AGPA 2R7OA 1VQLI 1TVNA 5KVDL 2ALAA 4TM9A 5KVGE 4WUUE 5HDOA 3G1RA 4FOJA 4ALAH 5D93C 1CXHA 1G6NA 2ZTDA 2K4AA 5C6TH 3CZGA 2FQIA 4GYBA 4RZ6A 5HUOA 4Z7UF 3U7WL 2QJJA 1UJPA 3D9AH 5JU5A 4O1DA 5IPAA 4ICWA 4E9TA 1GORA 3ZVVA 4Z7UA 4GQ9L 5L1IA 2R94A 3HC2A 4A0YA 4LK0F 4A5NA 3GQFA 5E9XA 1U4BA 4M47A 4HFWB 5KFZA 2GSEA 4EO5A 1RLDA 2D4DA 5E2JA 2IW5A 1GKOA 2Z7GA 3KP5A 3IRRA 2P45B 2CPRA 1WRFA 3STCA 4DBQA 3VFRA 2P28B 1CTOA 2Y2ZA 3NSMA 1KFLA 3IB4A 2X2HA 1HDPA 3BPOB 3P5ZA 3QEQE 2FDSA 2V79A 1S5IH 2LF7A 4UVBA 4KJYA 3WFAA 2PXYA 3LDBC 3W9EB 4KJZA 1DFBH 3HMXH 4G6ML 4RFEA 4I5RA 1YYMH 1IZCA 1D1BA 1YJDL 2ISWA 2K0RA 3OB8A 5EMMA 1MRCH 3GSUA 2X30A 1X9UA 4A3GJ 2NT1A 5J2BA 2YDSA 2QXWA 1IFRA 1PZUB 4ML9A 3QBUA 3KEHA 2YPIA 1DGWY 1RMFL 1ADSA 1KM0A 5CPQA 1Y7VA 2HI0A 3BCBA 5JVGF 1UC4A 3T8TA 3W2JA 4KMOB 4QXUH 4IMEA 1IQDA 1B22A 3O6FB 5GS2H 2V68A 3MRNA 4H8HA 1OCQA 4KZ0A 2AJ3B 1U3YA 4X9IA 1WKDA 2WO4A 4XV0A 5IESH 3TO6A 2EIJB 3D1NI 4HULB 1X5GA 3GV8B 1G8XA 3HMXL 2I9TB 1MJ7L 4YEFA 1RYUA 1T0OA 3RJFA 3WLBB 3FYYA 3LHWA 2EG8A 2K86A 3GMRB 4NN7C 5DBTA 4OW6A 2HJFA 5FACA 3TJXA 3IN2A 1AIZA 2Y5TB 4HGWA 2W5FA 5H37G 2KIFA 4FMVA 2IG2H 3GBNH 4R96B 7ICHA 2OAZA 4GOAA 2J6VA 1AH0A 5IIMA 3NEHA 1YDYA 1SD6A 4F8NA 3B5TA 3M6ZA 2X40A 3SDAB 3FBQA 2LKYA 3HLKA 3OV8A 4C6JA 5KW9L 3NIDB 5E4EC 2NVXJ 1PP7U 3FDYA 1C12B 4BXFA 3UY7A 5C0NC 3LRSA 3BDYL 1R75A 4QXTB 4WJXA 4NBYB 3T77B 1HW1A 5GHWL 3TJHD 3NH7L 3VFTA 4AE0A 1F3TA 2PP0A 3ZZLA 3NQ8A 2W85A 3LEVH 2JGYA 4QWQA 5A16A 1JZ3A 3GXPA 5HNFA 5B3JE 1R23A 5DEQA 3K70D 2NXYB 4RA3A 2NLYA 4UHTA 1SXDA 2XVBA 2QVFB 4HKZA 2BX7A 4QJFB 2HNEA 4OIRF 1HJWA 4G7QB 4NKOB 1XGOA 2XA3A 3PPSA 4R4BB 1FDJA 1U36A 3G71I 4E70A 4A5MA 3TIDA 2KP7A 1RZ8B 4PV8B 1X7SA 2CWEA 4QTGA 1GG1A 3VINA 1R85A 3BAIA 4AB4A 3B0VC 5KSWA 3UCQA 2BVQB 1FWRA 2YRPA 4I18B 4FA8A 9ICQA 3WUWA 1CICA 4PTVA 3K1PA 2XGDA 4A93J 5CMAB 2J7HA 3F7YA 4CZCA 1YG9A 1X5HA 5EOQL 3BUQA 4KKBD 4L9LB 4NNYA 4I2EA 2ZIVA 2RH9A 3IFLL 2HG5B 4FCHA 3DVGB 4R64A 5JYLA 2EH8H 1JN6B 1D5ZB 3B2PA 5HLIA 5AVXB 1T80A 4G8GB 3I1YA 3BIKB 4OI9A 3TO4C 1YNQA 3C2KA 1ND0A 4MZ1A 2A21A 4FRWA 1I7TB 4CA0A 4Z7OF 3OZOA 5FYJU 2RDXA 1K70A 4OCXH 4LITA 1UA7A 4H83A 3CQIA 3AG1H 4FQCL 4L9LA 2ADYA 4BJHA 4NDMA 1O3TA 4UB2A 4RNRA 4AL8L 4Y2JA 3LLXA 3Q4DA 4NT0A 2ZKZA 1Q72H 2X1DA 4ODVH 1XIWC 1I3UA 4NUWA 1TX0A 5KFGA 4WXDA 4B9SA 2FYMA 4DPCX 2LR4A 5ALKA 4RE2A 3S16J 5CEXA 1YEHL 1JMSA 4X5VA 1F3DH 1HH9A 1N7MH 2WV8A 2KHVA 3V0GA 2YEZB 1ZQGA 1W1B1 4PGJA 2BSLA 1BD2B 1JN3A 1CI3M 4H88H 3QC5X 2HVNA 1OCCB 1YZZA 2WK2A 3CK0L 1Z69A 4YK4C 4XPAL 3TONA 5CN3A 1UZ1A 1QVTA 4QWAA 3CZSA 2OM6A 5IM7A 1UHMA 4ED2A 4HXBL 1F1DA 9XIMA 2DQWA 1MPAL 4ADUA 4AZGA 4PH5A 4YWSA 3UKGA 4P2QD 5CJBA 5EO1B 4OF5A 1U3EM 2FEZA 3M43A 2PW2B 5IW3A 3NSCA 5E2TL 4HJ0D 3O8GA 4UFJA 4KICA 4XKVA 1T20A 4B5NA 3ZBMA 3WAKA 3L4ZA 3R61A 1YIJI 4M1DL 5AUMA 2ZUUA 2W25A 1DBJH 3TN4A 1K6AA 2NY0D 3CMOH 2BP3A 3L7RA 4GC3A 1KRCC 5DG9A 3WD2A 1SY6H 4CH7A 1K1SA 5KVEH 3ONCA 4DKFH 2I1OA 4PRPA 1NF7A 4PS3A 4FQJL 4DGIL 4QDMA 3TTOA 1N3NA 3O6LL 1J01A 4N6EA 4GIEA 2J6WA 2H8WA 3RF9A 1PVNA 4TUSA 3G0UA 1EFXB 1ZYQA 1NLBL 5FF6B 3PPCA 1P4BL 1IXOA 2VSDA 3V5CA 3AJXA 1RUNA 1FBAA 3DVNA 5BRBA 4KHXL 3IJDA 3X2QH 2R5YA 3B9JA 4GRIA 1WPCA 1GVSA 2ZWNA 2R8JA 3BKMH 4B5ZA 1SMYF 1KLGB 3TCLB 4JDYA 3BV7A 5ALUA 3B4NA 2QKQA 3QUBA 1E4XL 3WODF 5J2AA 3P61A 3VC5A 4CSSA 2ID3A 5F6IB 3FM9A 1ETKA 3PBWA 3WG7B 2DQFA 1IAIM 5DR5H 1OB1A 3LA7A 3OSKA 2KZ3A 2QZ5A 3Q6GH 3Q2DA 3VZXA 2ZIUA 1SVDA 3GM0A 4XPTL 2EDDA 2K9QA 3WY1A 5C08A 1FVEB 3DCFA 4YHYC 3I9GH 1ZQNA 3MLSH 3ICJA 9ICNA 5JHMA 3O8XD 1NFPA 1LOQA 5ECVA 4MYWB 2BNRE 4XZMX 3CWGA 4L4TA 1XO1A 2CD0A 1OM0A 4G9FA 4CE6A 4PJ7A 5AHXA 4J9KA 4P7LA 1W5NA 2VJXA 4R53A 4RLDA 3GMNB 3MBXL 4HNOA 2BBFA 2TRSA 4ELMA 3M07A 4OM1L 2BY0A 3LSOA 4C6BA 3PUGA 4H1LG 4D8OA 3ZDYE 1KKXA 3QHTC 3A67H 1LJYA 1ITCA 4NASA 1BVSA 1DQQA 4AL8H 3O45B 1TV5A 1F3DJ 3PUDA 4PLNC 3KEQA 3IHQB 2VQ4A 2KQRA 3LQAH 5ESQB 4JGUA 3HRSA 4RIRB 5ICXA 5AM2A 4WQ6A 3IUDA 4LSVL 3QV7A 2CJJA 2E4TA 2ZQKA 1MCNA 4BK5A 1IKOP 5ISZB 1UB3A 3NA9L 4JFEE 4NPYA 3CHVA 3P30L 1TVHB 4G8XA 4R5VA 4MA7L 4Q9BA 3I84A 3GAYA 1G3TA 4XAWH 5DGAA 5EY5A 4D2JA 4U5KA 1O5PA 1OP4A 1LO2H 3UJEA 4O0IA 4ZB2A 2AZAA 4GS7C 4AC1X 2A38A 1DTUA 1X3UA 1D5RA 3NTYA 5DMIH 2GHWB 2P8BA 4Y6GA 3IU4H 3AG3H 5CLSA 4Y2LA 4ZQNA 3T04D 3DTUB 4JO1H 3F12B 2G3FA 4DJEC 1YEIH 4WFED 5GSVB 3NUKA 2XX1A 1E0OB 2VLMD 1U8MA 2DOCA 3IJSA 1OC7A 1XC5A 2EKSA 3FN9A 1O9WA 1VB9A 3IU3A 2E9JA 4WHCA 4WHDA 3K10A 3G5XA 3DTIA 5I6SA 3S8FB 4E2VA 3FU8A 4ZPVA 4RM3A 3SDAA 2OMVB 1CD0A 2IGTA 5DT1H 4OJAA 2J12B 2F1HA 3NGDA 2JA8J 4HNVA 1O7DE 1SZGA 1UPPA 4KLLA 5L1JA 3QW4B 3C6LD 2DPDA 1TQJA 1X98A 3BAXA 3I10A 4I77L 1IN5A 4CF3A 1M6OA 1YBQA 5FA4B 5GGRY 3QYSA 3CDYA 4O8RA 4QRSA 1T5XB 1YNKL 4E42A 5FK9B 4ACTA 2V9VA 4MVBD 1PTGA 3HBZA 4TNEA 4HYKA 2YSWA 4ZFOL 4NCDA 2NDGA 2BY1A 5AKTA 3KHGA 2Z31B 4OF7A 3BROA 4MFFA 4A63A 1BF2A 3W5MA 4LL4A 3AROA 2R9HD 2YCLA 3VSUA 2XH4A 3PIQB 5EORL 4DO7A 1XR9A 1OW0C 1TQTA 3GLZA 2VI0A 4K3JH 5AZ0A 4PUEA 4B41A 3KS5A 3G5EA 4WI0B 2TSYA 3CZEA 1B3WA 1KONA 4I3RH 4U6YA 2J6XA 3WXVH 2VL4A 3WS3B 3K0WA 4NRRA 1YW7A 3SDAD 2KL6A 4G71B 3BJ6A 4YWIA 4EAYA 5DG7A 1MRDL 4ABVA 1E4LA 5I30L 1YNLH 4ABWA 5EPDA 2P48B 4TNGA 1JVLA 3X12A 5FUOL 3QXUA 2YTUA 4LSPH 4KK9D 1IGFL 1W1YA 1N0LB 4OZFH 3U9PH 5D33A 3EWWA 4L5FH 1BZ8A 4RDYA 3F5LA 4ZMOA 3KYNA 3DK0A 4C7ZA 2A7PA 4R8WH 2LU4A 4FNLL 3GTNA 3WNJA 1AD9B 1SR0A 4XRHA 4D8ZA 4GO8A 3F7KA 1JRHI 3ZDWA 3RVWD 3S34L 2D3NA 5HGHB 5DRWA 2WNXA 2GJ6D 2F3NA 1H09A 2Z33A 5B66C 1FIGL 4ANKA 4E8CA 1XRFA 4DPRA 1FNHA 3EJJX 3MRHA 4U3HA 4IMCA 5AYIA 2P9RA 4JQIA 4WDTA 5E5UB 4RH4A 5KG3A 1J0RA 4Q4SA 3KDMA 4Y2PA 4M3FA 2QQLH 2IS7A 2E8MA 2AKMA 3ES6A 2JCWA 5KT4A 4PG9A 3L3HB 3SE8L 3VJ6A 4IFKB 1HINH 1I8MB 3U7BA 4QTHA 2X1TA 4MPKA 3APFA 4L8SC 3OA5A 3WJMB 2FD6H 1KEGL 3MKVA 5KFTA 1SMOA 2XVCA 1WZ1H 3RVTD 3FHNA 1KM6A 1U6AL 3X1BA 1NJZA 3DTXA 4J2MA 4FE7A 1FNGA 4F2MB 1JPIA 1NWOA 2Z35A 4AIUA 2J7EA 2GLOA 1W1VA 2OR9L 4LVNB 1XSXA 1X5XA 5DO8A 4WXCA 2CLVB 3KR3H 3F5KA 3SCSA 1NCGA 3SI9A 4NUPA 3U2IA 3I75A 3NDZA 4YN3A 5BQ7B 4BK8A 4IFKA 3IJIA 1AG0A 3OKMA 5FO9B 2Q0OA 2BVEA 1E8XA 3L3IA 4L4TD 2RDIA 4ONFH 2AF2A 5EN2B 3W9DB 1RM6C 4WXHA 4E7HA 3O8XA 4DCQB 5C6MA 1BJ1H 3JWNC 4E9YA 3GO1H 4L18B 1U8HB 1CFQA 3TGXA 4TOYH 3QNMA 4HP5A 5AB9A 4BFGA 3LSJA 5L3BA 3ARRA 3V4VB 2HJPA 1QLFA 1KA9F 1D5BB 9PCYA 5ECUA 2BHFA 3SCMC 3WTYC 1KGJA 4JFPA 1BIIA 4PJFA 1X39A 2R1LA 1NOUA 1KGUA 3P9WB 4UATA 1QXLA 5D1QA 3HS9A 3HRUA 2EXWC 3MREA 4H8QA 1K83J 3QPTA 5AW5B 4IC9A 3MGAA 4JM4H 2CUEA 3QZWB 1ZD5A 4QYOB 4HLEA 2GQ9A 2FRHA 4Z7QF 4CQCA 3MD2A 3QU5A 4UNIA 1JUFB 1ZLVK 4QRNA 3FKIJ 4LF2A 3TO7A 4XX1G 1RP9A 4WY0F 2FA5A 1ZALA 5J4YA 2I27N 4H6KA 4PMOA 2RCSH 3T0XA 3CC4I 4N2BA 3CDHA 5EWFA 1QT1A 3W0WE 1G9MC 4OAWA 3CZUB 4B9FA 3PM1A 2CZEA 4XNMA 4JV0A 4DL3A 1JK9A 4JN2B 3EJSA 5C09A 1EEZA 2PI6A 2ZSVB 4KKQA 2BXVA 3GX4X 3VFWB 1VFHA 4YFDB 3U30C 4IUOA 3VA2C 1OGBA 2G0EA 3CLQA 3S5NA 2HFEA 4Y5VB 1JGLH 4M3EA 5I02A 2ISPA 4A8RA 4EN3B 2JEQA 1UWRA 5E93A 2YN5A 1VLXA 4M61A 1GW0A 1NPJA 2ATAA 3D39D 1GJPA 1XH0A 1ET7A 1B5TA 1X6UA 2R1WB 3WMCA 1J7VR 1ZXQA 1M7UA 1Z9LA 2A1YA 3ZO9A 5GNYA 2VQUA 2X6YA 3LVWA 4LLMB 3CAKA 3WE1A 2PMZC 1ISXA 4AUYA 1TSRA 3UEZA 3SDBA 3E96A 1U47A 3F8NA 3HMWH 3OR7B 4HJJH 3GTFA 4GLXA 4DP8X 5F1KC 3KYCB 3L17A 4UNOA 1FL6B 4G1MA 2Z7WA 3LSTA 3VXSB 1REQA 2CLPA 4RAHA 5FKNA 4KY1H 4GAYA 5K93A 1J87A 3SB0A 2XGIA 2A1WL 3SADA 2F5BH 3RTQA 5AECA 3N97B 3SAZA 4EKXA 3DUSB 1BWVA 3K75D 1R6WA 4Y8EA 4QUOA 3PB2A 3BWUF 3L3IB 1BLNA 4L48A 3C8HA 4HN8A 4FFVC 1WAWA 4UAZA 4AQZA 2OPJA 2YZ8A 2BPGA 3O4LE 3GI9H 3SGEI 4DFJA 4UW9A 2EKGA 4GAJL 3RQ3A 1EJVC 5DDHA 5I7GA 2W60B 5DZPA 5E1ZB 4DEFA 2COBA 1PUZA 2MEJB 1INDH 1FBSA 1LTXA 2Y07L 2GJZB 3WNMA 1ZV2A 3MBEB 3EBIA 3WQVA 4DAGL 3VUAA 4AVZA 4Y8AA 5EG0A 4PUWA 4S1QH 3H8SA 3P2DA 2ARJA 4BSWA 3WX7A 3GVAA 5AAMA 3NK3A 2X3CA 1T0NB 5J0BA 3HQOA 3VE7A 2WTRA 3NXFA 4GXUM 1I45A 5HHQA 4YMNA 4TQ8A 2Q1ZB 4JRXD 3GMNA 2OZ4L 1A7PH 3HV9A 2ADAA 1FAKT 5KT5A 2E74C 3W4RA 3MUY1 4G7HF 4ZUWB 3H1CA 4NO0A 3F3HA 3UO1L 4HOZA 3AFHA 2KISA 1NDZA 2EJ1A 1E40A 1RK6A 2F7QA 2D3VA 1PUFB 4K3EL 1ZLSH 1LZOA 1MOEA 2RKHA 4DNHA 2NVTJ 1DQLL 2VKHA 1ZLWH 5AK6A 3HR5B 3LAPA 4YH6A 2ZICA 3TT1H 1ISZA 2UV3A 3DBPA 1OF2A 3W53A 2QPSA 3PP4L 1LFBA 2KKPA 2FR4B 1E5ZA 4MFDA 3NIFE 4W9FC 1IM4A 1Z3NA 2GJXB 2QJDA 4KX9A 1RDFA 5BYWA 4V1XA 1EIXA 1RCOB 1Z89A 2PWUA 1OCOB 3G1AA 5KT2A 4UQ3B 1HZHH 4IMKC 4NC2B 2P5EA 3S35X 5IUCA 3I9GL 3A6BL 3NASA 2EC9U 1MMFA 5DI8A 2W59A 5CEYA 4M9NA 4F8OA 5ALYA 4H2CA 2AQNA 4PMJA 3MODH 1JS4A 3IJ6A 5INDB 4N2EA 1I7RB 5CINH 3GRWH 4Z7OB 2NY4D 2LLNA 5LDSA 1QHOA 2Y1IA 2LHAA 3VFPB 4PJ8C 1ZE3H 2NY5L 3NCXA 3PHOB 1MBJA 2V3DA 4P57B 1FSHA 4K4GA 5C7ZA 5EBLB 2DD8L 2WNWA 4KDTC 1MNUL 3CUPA 4NJ9H 3JPTA 5KINA 3CH1B 3JZ7A 3SPIA 2DU2A 2C91A 3KRUA 3U21A 2H32B 2XOTA 2O1AA 1H6FA 3QQWA 1AUSL 1LO5A 1S7QB 4O58H 1GYAA 5EU6E 3TBYB 3T08A 5JFRA 1NC4B 4ZTEA 2CFFA 1YI2I 3GH7A 4MCZA 3TXZA 3UMNA 3OAYK 4JMUA 4YL4A 4AD0A 5F88A 1ZS2A 1HI6B 5AYUL 3GXFA 1EAPA 1J5OH 3T77A 1IVTA 4J19A 4QOKA 1TAMA 4NQVA 1MDAA 3V6BR 2CA4A 3Q65A 4UTBL 1E5UI 4TVSa 1OYYA 2B2XH 5GS1B 4P2RA 4QRRA 3EO9H 4YSUA 3SENA 4K37A 1VDVA 1YXYA 1TJXA 3PSFA 3VXSD 1L6GA 3S4SA 4DEUA 5GS0D 3LHTA 2UVVA 1XS2A 2DQ6A 1Q6RA 2GGGA 4FXKA 4NRYA 5LBVA 2YZ5A 1AR2A 3TBVA 3U4AA 5IB2B 3ALFA 2A9BA 2VQ1A 3MJ9L 5KG5A 1W1TA 1YZ6A 4RZ4A 3L8QA 5JXAL 3G08B 2JF6A 4MDJB 4X6EB 8PAZA 5A2LH 3GDRA 2CO5A 4LLUB 1AHDP 5DQPA 2R1YB 1J1XL 3GSNB 3WO8A 5AY7A 3FUKA 5CEZH 4JEJA 2PGEA 4OFQA 3B02A 2PFQA 4Y9GA 4C6QA 3CCSI 4DBEA 5DD5L 3RWHA 4HZLA 3T8QA 1Q4NX 4KDVA 2G08A 5LBSA 4M3DA 1CDBA 4F80A 4X80L 2EDMA 4N25A 3V6OE 3RAQA 4LVSA 4GRWH 2EYTB 5FGMA 1GT0C 2WGXA 3GI9L 3LKRA 5E99H 1DDTA 2DIKA 3MRIB 4H40A 3X3FH 4RLQA 2DUAA 2DMBA 1KBPA 1TWHJ 1IZ1A 1XBDA 4BXXJ 4PPTA 1EX1A 1R1VA 3MBXH 5JXAH 1L8NA 5DD3L 1JGDA 5JMUA 3W9EA 1MRFH 2B39A 9ICCA 4IXXA 3FS9A 2L04A 2DDBA 1WFOA 4LL9A 4A3DJ 4K07A 4PP1C 1ZJBA 2WLIA 1ZAHA 3P3SA 3BGMA 5I30H 2CZ5A 1T7LA 2ZYRA 2YLHA 3PBVA 3PNCA 3NPSC 2DTMH 4UT9H 2QHRH 3GW2A 4UB0H 4W8BA 2FZDA 4LCWE 2C9SA 4IIHA 4TNWF 1SFSA 1G7PB 1V27A 3QEUB 1QNIA 3GBNL 3RLVA 1JR1A 1X3WB 1A7OL 4KZDL 1CWVA 1KM2A 1A5FL 3VFCA 3CTLA 3FVMA 4N2AA 3VXQB 2N3JA 3G9AB 1UCVA 1RZJL 3KL5A 1DWJM 1EIBA 1JP5A 1T2QL 2FMSA 3EOSA 4GIAA 4B9NA 1R38A 5KAIU 2HR3A 5CP3A 2AJSH 3VE9A 5FFXA 2OL3B 4GC7A 1PKQB 4ZMZA 2LGNA 1VJZA 2IEPA 4Y1AB 3F8BA 3GO5A 2FK9A 4LEEA 2ME0A 1FL6A 1MHCB 4P4PA 3DIFB 2Q8XA 4KNUA 2D23A 4YD2A 1N3NB 4Q6IC 4Y4HA 1LBLA 1E51A 1U8IA 2HDDA 1W16A 1WO2A 3MACL 4PTWA 1SL0A 4MA3B 2YZRA 6REQB 3DV4A 3FUMA 4GP4B 1SFDA 2I5GA 2VW6A 2D9CA 1N75A 5LYRA 2RGSA 7ICSA 5EUOB 1M5WA 4FIQA 2LU7A 4HUVB 4Y4HC 3CHDA 4NQDE 2ZTKA 2ISOA 3BPLC 1OE3A 2DZAA 4JFXA 4JM2B 1NMCC 3DFSA 2E5BA 2WTOA 4R4NC 4AKOA 5CINL 3CSPA 1EC8A 5HINA 1O6TA 4KKLC 3DO4A 1YHTA 5E51A 3OX8A 1ASPA 1VADB 3KGSA 4N0UA 3KXFA 5C0CE 1W56A 4AVFA 3BV4A 3UR2A 1L6FA 3HPGA 3VWBA 12E8H 1J6OA 4QZ9A 4NKIH 5DMKA 3IV8A 4KMLB 2B0SL 1A6QA 3GZQA 4L9YA 2Q2EA 4TSCL 1OL0A 2XPWA 2CJUH 5D7LB 4FSAA 3T2NL 3CFDA 4XVUC 4EXQA 2VLRD 1BBJA 3N1FC 2PDLA 1AMYA 5FYLL 3M0YA 3QEQB 1AA7A 3MV9E 5FUCC 4FBTA 4DK5A 3B8UA 4YAQB 5DZLA 3S37H 2F1IA 3OO2A 5EBWA 2HKHL 1T83C 4QNPF 4XVTH 1TUPA 4EBEA 3BG6A 2H1PL 4G8EA 4XCNA 3AWOA 4HSOA 5T1KA 7ICLA 2EO9A 1ZTXL 2Y9ZA 4XONA 1GIGH 4EXPX 2G7UA 2XO7A 3GSUB 4YEEA 5KG2A 1P92A 3GMEA 1FAIH 1R5YA 5LLQA 5CN2A 2YB4A 4DOHB 2BNQE 3QPLA 5F1JA 4BK4A 2OMWA 1FCBA 1D5YA 3BY6A 3MVPA 3G6EI 7ICJA 3CV2A 2Y0MA 5KBPA 4KZEH 1KRAC 1FPQA 3NDOA 3GH5A 3MKYB 2BIHA 2BXYA 3I6EA 3ULVE 4Z0JA 4I9XA 4DQSA 2UUDK 1XF4B 2QCLA 1A7QL 4DOAA 2ETHA 5KANI 3FN3A 2VN4A 2DMPA 1ZKAA 5FYKD 2W6RA 4JREC 4RMBA 1X40A 3K81A 4DLFA 2XIIA 4CN6A 1WAUA 3NSYA 5IBUB 4AQ8A 4RQ3A 5JTWA 5TK4A 1NCBL 3FNKA 2Z7KA 2GH1A 1KKOA 5BPPA 3II3A 2GWNA 1AACA 2DQEH 3VIJA 4QHMB 4O17A 4FXKC 5I0DA 3FB6B 5GS1C 4MZIA 4M6NL 4LSQH 5ICUA 4CNUA 1RJRA 1X5ZA 2GY7B 3U8GA 2K85A 4TTUA 3JTBA 2DIBA 1G1KA 4EENA 1SLXA 4YVUA 2JF7A 5GZOD 2GVEA 3MMEB 1L0PA 4KLEA 3F6LA 2HEOA 1MJUL 3IJ8A 2WZIA 4KPLA 2N1KA 2GIVA 4NO5B 1A4JA 1W8NA 1UACH 2YUXA 3TYAA 3RGVB 5D5MF 1WVZA 2GQAA 5CKTA 3ZTNH 3GYCA 2ICSA 4QRPA 3GK8H 2ROYA 3X17A 2IPWA 3O41B 3G08A 3DFGA 3CM4A 2K4IA 4EIGB 5E5MB 5IGXL 3V4BA 4XLHA 2CXKA 2YQ2A 2PWFA 1EXNA 3SCRA 5DQIA 4DBWA 3KX2A 1OK8A 5B4MD 2D8KA 1R3JA 3EPNA 4HW0A 2Q8BL 1FWFC 2ICWJ 4IJRA 3QTPA 5B80A 4YG2A 1H88C 2FZ8A 2CC0A 5LNEA 1PK1B 5KJRL 4G11A 1OZQA 4LSPL 1E0UA 1BM3H 1XX9C 1CFVH 2J6SA 3TZVA 2ZOWA 5EFIB 3MUAA 1BBYA 1JROA 3TBIA 4PY7B 4YC2C 1KIQA 3MANA 3KPNB 3QFJA 3P9MA 5D4YA 2L7FP 9ICHA 3OGUA 1US0A 5CBIA 2IJ0C 1OIMA 4B3ZA 1IFHL 2TSBA 1UACL 3GTHA 5FF6A 1QSEA 3IDIA 2GB2A 4I1RA 1U9NA 2VASA 5J0SA 2VMJA 4OF8A 4MS8D 2DV0A 1NY1A 3KW7A 4LK1F 1U8OB 2NLIA 3WOVA 4OB5L 4U7DA 4N2NA 4H1LA 3BURA 4L9VA 1HN1A 4LX4A 3BAJA 5AICA 5A2QK 4NQCA 1X2NA 3SO3C 4E2DA 2APSA 3CWOX 1A4AA 3BVNA 4DQRA 2ZXAA 3PWIA 4A7GA 2DF3A 2W55A 3GLXA 2V2HA 1A5SA 4OD1H 4KT2A 1I4FA 3PUEA 1DVFD 5KJ7E 3QIUC 4LRSA 4L9ZA 2YOCA 2DLEA 4QXGH 5E9DD 1YX5A 2A3LA 4YPGB 2PYED 3W00A 4F7PB 1LQ2A 4Y5VA 2PFHA 3IDIB 1F41A 1VFSA 3IH2A 1A7QH 1CD1A 2B08A 4S1QL 2BC4B 4M7JL 2RC4A 5E17F 4JPWH 4UR8A 1M1SA 3LTYA 2CK2A 5AIBA 2A05A 5TE7H 3HI6L 2JCCA 1E4KA 4JKKA 3OAZH 4XQ6A 4U1NA 4G8FB 5C6WH 3KTSA 3GC3A 1V03A 1EEYA 2CYGA 1SMDA 4UBCA 2ITDB 5CP7A 4QRPE 3M17A 2J44A 1TWWA 3WFBL 5GS2D 2R91A 3K7AJ 3GMQA 1GIGL 2AS5M 2Z34A 1N5AA 2BP8B 3BKCH 3IJEB 3F8MA 1JE8A 2VH5H 2YPVL 3QG7L 4PWJA 5G5GA 1HS6A 5DI8B 2VE6A 5CFAA 2O0YA 1CF7B 2BQ3A 4DZ8B 4X2UA 4S3KA 4A66A 2PRLA 1X4YA 3MRMA 1GGOA 3WLTA 2R0LH 1XVSA 4ETYA 1JBJA 4Q8PA 3B06A 2OO6A 1JPHA 3GHTA 4L9TA 4ABQA 4YZFF 1AGBA 2QJHA 2FDMA 2IGNA 4P5KB 3DUGA 3CCYA 5F64A 5D7IB 2DFHA 4CQDA 4XVJL 2VKDA 1OLLA 2VJIA 1CFQB 4LG0B 1CG9A 3SM0A 2O6KA 1A7NH 1UUOA 2DB8A 2AL2B 3GBML 4P8QA 4DQ2A 3MOQA 4A05A 3OYZA 3K1MA 2IPTL 1QHZA 1CIDA 3BR2A 4JFFB 1H50A 4U0WA 1CFNA 3TH6A 3BTIA 4JL1A 1M2VA 3PWPA 4YFLF 4KT6A 1T1XB 2GOLA 1TTPA 3NWRA 4JZJB 3W28A 2KZ1B 1F90L 3JBG7 2M83A 2VA3A 4AZHA 4C56D 4US9A 5DQDL 3S36L 4IRSA 4RESB 1KFEA 3KCLA 3FAHA 4NN6B 1X2IA 5C9ZA 4M3KB 4F2UA 3KZ8A 3OU8A 2P49B 4Y1AD 3NJMA 1KFDA 1BM9A 3KWUA 1VQ9I 3OL4A 5F9OH 1H7OA 5FP0A 1E28A 1SU5A 5DURD 3H26A 3AWNA 5I1CL 4HZFA 1Q94B 1T8EA 4ED1A 5EYRA 2R7EA 3RPKA 1NUGA 4Q4ZF 1OJLA 2Z9OA 1S2WA 4P2YA 5IBTH 4GW1B 1RG6A 4JS7A 3L3OC 2EKCA 4LGXA 5H35A 5U4NA 1MQRA 1R0AH 2HQNA 5SWSB 4LOFA 4U05A 3RGVD 4GUOA 3QVQA 2EQYA 2O4EA 2BJML 2HKOA 4DHLA 5C0FA 5ICEA 3HHSA 3MRIA 2F6UA 2WMIB 2L7QA 2VDPB 3DEUA 3KHQA 1PP8F 4IRJD 1F3JA 2DXIA 1IZJA 3NESA 1ENUA 1N7KA 5DZOA 3TQPA 4E9VA 4XMKH 1PEWA 2W0KA 4EEYA 4UB6C 4JRLA 1IR2A 4HBQA 1PDZA 4ZUUA 4NF7A 3ECBB 1FWDC 4X5PA 3O6FD 4NVTA 3QZAA 3B7YA 2Z9TA 2WHKA 5F7AA 4RBPK 3VXUB 1O6SB 3B3IB 1XLMA 3FT2B 3WGUB 1JHLL 2DM3A 4E0DA 4B9TA 1FORH 4XZ9A 2YQEA 4UYQA 5LCVH 3II1A 1CBVH 1W5MA 4L0PB 1AR1D 1KN4L 4OIBA 5CIPH 2UZXB 2QDGA 3V7JA 4PJ9B 4CSPA 1DPUA 4O3OA 2APVA 4TPRH 2VLRB 5E9DB 3QO0A 2WWYA 2OCCH 2A9NH 1RZKL 3EOAA 3WI9A 4D0PA 4GI9A 1T4WA 1TEYA 3FU7B 1XCXA 3QGKC 3GMPB 1EJOH 4AVNA 3QUMA 3CE1A 4QE5A 4F8XA 3OL3A 3UA3A 3PGCB 3D3VB 1KN2H 3DI0A 1T66C 4JO1L 2KZWA 3N9GL 5F4XA 3IJQA 3GS6A 1EJOL 4JDEB 2R0LL 5F1UA 3QHFH 4S2SA 3RSNA 2V9RA 3VXNB 1TO3A 2CDGB 3ISYA 1N0XL 2ID6A 5KOMC 1ZT7B 4YHZL 1AD0A 1PNCA 1UQZA 4HWBL 3NP3A 4KQ3L 2C13A 1BR4A 3IVKA 2Z26A 1U3JA 4DK3A 1SVLA 5EDSA 3FRUB 4XZLX 4LCCC 1IGIL 5KUKA 4MX7A 3QYFA 4BGLA 8RUCA 4JFQB 4JG9A 4UZSA 3TFKD 5H6QA 3CVHB 2P0OA 3KOFA 1PKYA 5CR0A 2BRRL 2LBFB 4JO4L 4CGUB 4AY1A 1FCQA 1P7QA 1MCQA 3DBLB 3WK5A 4LLYA 3SKOB 2O9TA 1HXYB 4JM0A 4Z2HA 4XO8A 2EZXA 2F2KA 3BGJA 1LORA 3EHBD 2EV5A 3RKQA 3WJZA 4XCYB 3ZKQD 1JKQC 5FCUL 1TF4A 2FJUB 1A5NC 5M5DA 1PAMA 5D5MA 5G4HC 2DI7A 2RJGA 5JXEA 4JFVA 4XRFA 1TZGL 1IXRC 1JAEA 3CDGB 3S3MA 4KY2A 5D5UB 3JV6A 2YD9A 3UEQA 2IDQA 4NIRA 1SKSA 2GUOA 5HGAB 4N5UA 5I8EB 2C1GA 1HFUA 2VOOA 2ADFH 3H9HA 1AGCB 4RWYH 3PRZA 3L7EA 2A9AA 2VISA 4HC1A 1FDZA 1AMKA 1CTMA 2UVWA 1LO0L 2AXHA 3BD4A 4C4RA 1RUQH 3EFFB 5HR6A 2PDFA 3V0TA 2AABH 3ZIMA 1ZD4A 2VOPA 3QC3A 4KRMB 3DSNB 3FXGA 4RIRA 5DRZA 4U1MB 3KZYA 4KNTA 4PJGB 3MJ7A 5CLTA 1H3UA 4TVPD 4B9ZA 1UA6L 4XSLA 1OCNA 1QYGL 3WV0A 5A8NA 4WV1A 4GKNB 3EDDA 4LFUA 1VCBC 4IF2A 1MJBA 1OISA 7REQA 4PJAA 2E9BA 4HT3A 1A14H 2KSOB 3FFCB 3FQWA 2QADD 4RMTA 3MQTA 1ZL1A 4POUB 2FZBA 1KDIA 4A21A 2AGQA 2ENSA 2QKIA 3RA7L 2XSJC 2E5EA 2ALZA 1F8IA 4QTHB 4N8CH 4B3KA 2OULB 4DPBX 1KBKA 4E2OA 2VR6A 1KPVA 2FBOJ 2PLYA 4R5XA 3GTLJ 2JA5J 1NJ9A 4R2GD 2W82A 5IQ7L 4Q4EA 2VXQL 2P6UA 1M57B 4RUAA 4EJ1C 2YPLE 5KSBE 4IBTA 1SDDB 1RZFL 2DQDL 3V0IA 3FYEB 1IGML 1WA0X 2E27H 4P2RB 4QRRB 5LN8A 1YYCA 2CHOA 3WIFA 1SAXA 4O3SA 2NYKA 3B34A 4KROD 5FJUA 3FMGH 1E5AA 2G3NA 1O7DC 2RB8A 4QOKB 4ENMA 1WDQA 4HH9B 3G6JB 4B43A 5IHSA 1WSST 3DO3A 1J9TA 4X4ME 2MAXA 2IV8A 1ZZMA 4X8GA 1W0MA 4KQ3H 4MD4B 4WNQB 1D1CA 3O11B 4NQXA 3ARFC 4Q7IA 4L8BB 3A64A 2G0WA 1VQNI 1OTUC 1HNYA 2G9HA 1MCJA 1HKLH 2VQCA 1G7QA 2LRDA 3K7UA 3QIWC 2BG5A 3O0LA 3GO1L 1LB2A 1UOZA 2PFNA 4F40A 5HWMA 1KM5A 2Y5EA 3AYRA 4Q9CA 4BDPA 3GV7B 4AENA 4K9EL 5I8OH 2O55A 3HOUJ 4IK6A 1IWBA 5AW3B 5IM51 4A3BJ 1HOMA 5CGMA 5INCA 3G0SA 3RMEA 4HBKA 2Z31A 5IIEB 4EJTA 5C0JA 1E71M 1ILSA 2EDEA 2KX9A 1NM9A 3EDPA 3U0WL 4J9MA 3JR2A 4HIJA 3WYZA 5HBFA 4F0RA 2GL5A 4OCLC 1F13A 4PD4J 2HLAA 4NO2A 3WQPA 3AHXA 2H3NB 1ZE3C 3KEDA 2OR8A 4ZMAT 5LNWA 1I3AA 4E3TA 2FNBA 4ZZKA 5F9WB 1ZGLA 1K4SA 3A47A 1WAAA 1EHNA 2I9LA 3S37L 4L8BA 2CUZA 1R7AA 3RR7A 5BS6A 3ITCA 4YDZA 2C1OB 4WEVX 2OG9A 1H5YA 5DUBA 5AG9A 3X3GL 1UXSA 2GJXA 3HHGA 1DN0A 5JH1A 2VNCA 1XGTB 1IR1A 1JPSL 2NY2B 1OX5A 2XJLA 3IETB 3LVVA 2P6SA 5LG6A 4YHNA 4IIQB 4JHWH 4EPDC 3W7KA 1EEZB 3LQLA 2HHQA 4N6FA 5TRDA 3SCQA 4P57A 4BXOB 5AYUH 5AB0A 3DTXB 3Q58A 3TVAA 3S1GA 5BNGA 4NGHL 2HTMA 1EF2A 1E8ZA 3V0VB 4HUMB 2B2XL 3PCYA 3O3BB 4OZGA 1MJ8H 3SO5A 4JAWA 3L5LA 1CDCA 2KHAA 3N18A 2G5HB 3WQWA 5DBBA 2FQ4A 3Q8BA 4W93A 1JPFA 4KPHL 2FE9A 3A02A 2L7MP 2P8LA 4XR8C 4OE7A 4XLEA 5GS0C 3UXFA 4AQ1A 1RQLA 4KDPA 5F1IA 2IAMD 1EHKB 5I1HL 3SQIA 2DFAA 2FECL 3UJJL 4O00A 3UZZA 2F2AB 4UIKL 4LMQI 1HUOA 4P2OB 4WTZA 4Q4RA 2WUCH 4MVBC 1MJAA 1CE1H 2X10A 3L5MA 2PLCA 4NY8A 4XKYA 2C9UA 1QRND 3D0AA 2P4AB 1XLFA 4YMPA 1F86A 4D0DB 4KLSA 4FXJA 2AL2A 5SWUA 3RNQA 2E2IJ 1TWFJ 4OIAA 4NZFA 3TVMB 4H5SB 5I1EL 3UBXB 4GI8A 4X6BB 1NOMA 1NCIA 5DDGA 3S6OA 2Y7QA 1T03L 5I77A 4FTHA 4EF9A 4NFDA 2UXXA 3DETC 1IGCH 5T1DH 3A1YA 4Z7WF 4GMSL 5DQGA 2EDTA 1OD7A 1Z0NA 3MBFA 4JM2C 3BPLB 3BCJA 5FEXA 3POCA 4DGYH 4F55A 2VITA 3NYKA 2Y06L 2CIKB 5C8BB 3W2KA 2EICA 3GBEA 3MBEA 3C60D 3KLNA 4RB1A 1WZAA 9ICLA 3BSGA 1T08B 2VIRA 1LO3L 3H2NA 4B5TA 3VXUD 4WGXA 4F9JA 3GMQB 1E30A 3QEHB 4AP9A 3FO0H 3J80Z 5ERIA 2A6IA 2M0MA 3SGKC 3FUNA 1GJWA 1WGVA 1MI5D 3QDMA 5GGQH 1OM3L 1DJGA 5HOSA 3GUDA 4KERA 3QDGA 4DYQA 2BVLA 2YL5A 5FKKA 2RRDA 4X0GA 1TU2A 2WCSA 1S29A 5F2LA 3ZOBA 1D9EA 2XIQA 1NDGB 2R9RA 3CMMA 1G59A 5TPWH 4PEKA 4BZYA 3HG1E 1UAAA 2LFBA 2FBRA 1WTLA 1VACA 5H37A 1JIBA 5CP2A 1QEXA 2VZUA 1NEZG 1WC7B 1D8BA 4AIOA 4M29A 4AD2A 2FDRA 3PSPA 4JEGB 4Y4KB 4M6UA 3KPTA 2FHBA 1QLEL 3HG1D 5EF3A 3HRPA 5HNRA 3T5JA 1AJ7L 1MJ9A 3V8LA 1ZHLA 3VE0A 4FEMA 3GZOA 3C2GA 3G5YB 1C9DA 2DL0A 3H3KA 3GZKA 1YAZA 1MBFA 3KPHA 2WZPA 5E2VL 3H4WA 5J1AB 1BVLA 3EB4A 4H01A 4NQSA 3MPCA 4US8A 2E40A 1WBXA 4DQQA 1FQ9C 2EHHA 4QS5A 3VWKD 5CIPB 2X0VA 3GC5A 2AV1A 3HG1A 4N90E 5H8MA 4AD3A 3QZWA 3HOJA 1Y8RB 5C5YA 4LANA 5D2WA 1TRIA 4UB5A 2XN1A 4PRPE 4FCYA 3W2DH 3A3YB 1A04A 4P0PA 5FW6A 3P4MB 1RZKH 2VC6A 3DV9A 1G7LB 1CB2A 3H9YA 5I73C 5AVYB 2I5YL 4AUUA 3RKDC 4YYCA 3FCTB 2ESEA 5K1YA 1JDFA 3CZJA 3E6FA 5IB4A 1WQ2A 4AGNA 4C5YA 3SAFA 4KKLD 5EWIH 1HXMA 3QDGD 4P4MA 3DURB 2JXMB 5BZAA 1MI5A 4GUIA 1ZTRA 2Y5QA 1CB4A 1X6NA 6REQA 2XX0A 1PS3A 2FB3A 2NV1A 3K4AA 1RSCA 3SJMA 1AHWC 4WO4A 1J8HD 3GZNB 3B3BA 4HWBH 1VPYA 4PR4A 3WDQA 2P76A 2GBAA 2XFYA 3ZKNC 3MBED 2O56A 3S98A 4NNXA 3G6DH 5F8QC 5EE1A 1U8JA 4U2ZA 4XPTH 4A68A 5CZTA 1INEH 4ZNEA 5FO9A 3VFGH 1YYVA 4HJ1A 2J1ZA 3P4NB 3ZXWA 1RV8A 2KERA 2M87A 1SD5A 4IIFA 2EC9T 5T3XL 1WFJA 2A74B 4RAYA 1EYWA 1W1ZA 5DHXB 2AVFA 3U4EB 2NX3A 2QQ8A 1V0NA 2BO0A 4G8TA 4G8IB 3AICA 1U93B 5GISL 4BSVA 2AXGA 2H2PC 3TESA 5E3LA 3PL8A 3ZGHA 3E97A 2V8MA 4Z7AA 4H0GA 4KRZA 4Y7OC 2CQQA 1DL3A 2OPTA 2JCCF 4NAEB 4X99A 4ZI8A 1SQMA 3EO1B 3TF7C 1DN2A 1JHFA 4UDTA 4CMHC 1DJQA 3WUFA 2IDTA 2ENPA 4RQ6A 3U4BH 4BEUA 3NYZA 2F76X 5EA0H 4AVIA 2X6BA 1F61A 4GG9A 3E2HC 1F6AA 3AU1A 3R89A 4AY7A 3LB6D 2BR0A 4YSEA 1E90A 4DVBA 1PQZA 3FUJA 3CZLA 2RUSA 1LLAA 3HLAA 5ECGA 1FH2A 1YYAA 1OGPA 4C91A 3HLAB 3V8OA 4BL0B 2MABA 4EI6B 3WKZA 2G06A 1QNZL 1MRQA 5CC7A 2WN2A 5SWSE 1IEXA 3CSFA 2LQRA 4BEHA 5F0FA 4GPVA 3AQDA 3VI4B 5ILUA 3TA4D 3OMNB 2O7SA 1UADC 4MLIA 2K6WA 3L3OA 1UB5A 1WCNA 3BVUA 5D8KB 1I7ZA 1NGQH 1XLKA 4G8GE 3QSRA 5IW1A 3I71A 2E1DA 2E6AA 3LZNA 3KHOA 4PRBA 1MXDA 1IRZA 2V8LA 3VRJA 4MNHB 43CAA 3LSRA 5E7BA 3AG4B 2PTTA 3APNA 4IFOA 2VGFA 3E6CC 1FYTD 4I0PA 5EOCH 1IVLA 2XZAL 1OAZH 5I8CA 4V1YA 5BOXA 3WS3A 1D2KA 1Q5MA <