3HJEA

Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
704
structure length
704
Chain Sequence
MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDELGGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEEEKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRDYPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNKIGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDELVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNCSQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDKFHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKNDEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMFNNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPVVFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 704aa long hypothetical glycosyltransferase
publication title Structure of ST0929, a putative glycosyl transferase from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii str. 7
total genus 284
structure length 704
sequence length 704
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09196 DUF1953 Domain of unknown function (DUF1953)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Maltooligosyl trehalose synthase; domain 4 3hjeA04
1.10.150.200 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Maltooligosyl trehalose synthase; domain 3 3hjeA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3hjeA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3hjeA01
3.30.1590.10 Alpha Beta 2-Layer Sandwich Maltooligosyl trehalose synthase, domain 2 Maltooligosyl trehalose synthase, domain 2 3hjeA02
4CN6A 2UY5A 4UZUA 4D6FA 1HP4A 1V6XA 4GIAA 5A6KA 1GPFA 3UESA 3BVUA 2VR4A 1Q6DA 5DT5A 1FA2A 3MSDA 1J18A 2VRJA 1SFSA 4JFWA 4Z2KA 2DPEA 2W61A 1WB0A 3IANA 4BS0A 1TE1A 3VMPA 5IFTA 1FH7A 1E0XA 4JL1A 2EPKX 4AD0A 3A3HA 3VNYA 3CMJA 2BXZA 5I24A 1B3VA 3VIKA 3PN8A 1WZLA 1WDQA 2ZX6A 4J3SA 4MDPA 1ZBVA 4D6CA 3WBAA 5TD4A 3D3AA 3CZGA 3UR8A 2OWCA 3SCPA 5BXRA 3F5KA 5IHSA 3CBWA 3DHPA 2W92A 3LPGA 4B3LA 2D0GA 4GZEA 1UD6A 1ZBWA 3L4VA 3A4AA 2VQTA 2BVDA 1JFHA 3B8SA 4ACZA 5CZKA 4P8WA 4EK7A 3W53A 4DM1A 5M5DA 1PIFA 4JCMA 1HXJA 3TA9A 4MB4A 3EJPA 2DIEA 4C7FA 2QHAA 2VQUA 1BFNA 4QAWA 1WPCA 3II1A 3DYPA 1N82A 5CGTA 3N13A 3WQVA 2D24A 3H54A 4GXPA 3W26A 1QBAA 1BYAA 1UWTA 3OZOA 4OOUA 3GXMA 1JD9A 5GNZA 3WH7A 3ZJKA 2ALWA 5LA2A 2CKRA 2XFRA 5GNXA 2WMIA 4MNJA 4EKJA 2XN1A 3LXCA 1B0IA 1H11A 1UR1A 1UZ4A 5BYWA 1E6QM 4BQ4A 3PZVA 1ZU8A 4HPHA 3AHZA 1UD2A 4MNLA 2E9BA 8A3HA 5HOSA 4D6EA 3CUHA 3QHMA 3W25A 4CVWA 4HMCA 1HJVA 3O6AA 3GNPA 1WKYA 1GNXA 2WHMA 2B31A 3F5JA 2ZUMA 1E6RA 3M46A 4TOQA 1KTCA 2WMGA 2A3HA 2PWDA 2VO5A 5D8ZA 3SCOA 1R47A 1VJSA 2JIWA 3GH4A 4PBGA 5HBFA 3RJXA 4AZCB 3ZMRA 3AS0A 1LL6A 1O7DC 3WENA 2BHYA 3NUKA 1CXLA 2DGAA 6CGTA 3CZNA 3G6LA 3W29A 5A95A 1PPIA 2XWDA 3A47A 4HP5A 3VO0A 2MANA 5EBAA 4ACYA 4W5ZA 4BQ3A 1KXHA 2WZEA 3ALFA 1SMAA 2XYLA 2VI0A 4S3JA 5M17A 1ZS2A 2J7HA 5CG0A 1EH9A 1G1YA 3NYDA 2WCSA 1EDQA 3POHA 5A6JA 5JBFA 4URIA 3UR7A 3GZAA 2F1BA 3PZ9A 2WVVB 5FL0A 1KQZA 1UWRA 5I5RA 4OBRA 2GFTA 1JZ8A 3S5YA 3BUIA 4PRWA 3AYSA 1V6YA 4U3AA 1J11A 3JUGA 1LG2A 4JKMA 3L2MA 3BCFA 5CGMA 4D1JA 3WQ6A 2YIHA 4D72A 2V38A 5DEZA 2CBUA 3D5HA 2W62A 1GONA 2W66A 3GBDA 4TUFA 3H55A 3SUSA 4HMEA 2V3GA 3VUPA 3RJYA 1X6NA 5M03A 3VSVA 3WEMA 2OSXA 4C7DA 1K9EA 3LX9A 1ISVA 4WKFA 1TFVA 2XFYA 3EJSA 1UD8A 3DX3A 1M04A 2VTFA 1EDGA 2W4XA 1CXIA 4ZE4A 4U31A 1UZ1A 2EBNA 1DP0A 3K4DA 3HMCA 4PTMA 3HG5A 2XPKA 3AXHA 2F1AA 1CGXA 1W9UA 1CXKA 4CCEA 1QWNA 1QNRA 2VJXA 3FXYA 3NJ3A 4GINA 2EPOA 2X2HA 5ABHA 3VIHA 1W9XA 2E0PA 4X9YA 3ZJ8A 1XV8A 2FHBA 3AHYA 4CU6A 4V28A 1UQZA 2YDQA 3RM9A 2BY0A 3BVTA 1NWUA 3AMDA 4M29A 4NRRA 3BCDA 1OSEA 2YA2A 2Y24A 4W89A 2CBIA 1WZMA 4NSBA 1V3LA 1FP8A 4CGTA 3IGUA 5A3HA 3WD0A 4AW7A 2AOSA 2WHKA 4AZ7A 1W1PA 2C8NA 3ARTA 3SEPA 1TA3B 1VFUA 1KWGA 4WF7A 3UCQA 1H0IA 1QW8A 4PMDA 1ZJAA 3QR3A 1QNSA 2E9LA 3VIPA 3POCA 4CD6A 1LL7A 4X0NA 4KGJA 1B31A 1CLXA 1AQMA 4UFHA 9CGTA 3QOMA 4MB5A 3A6OA 4J3WA 4MTVA 1A3HA 2GDVA 2CERA 1OD8A 1FHDA 3WEZA 1VFMA 3WH9A 4E4PA 5FOOA 1EIBA 4Q7NA 2WLZA 1KXTA 1RH9A 2XFFA 2XIBA 4JL2A 3ZO9A 4J7RA 5F7UA 8CGTA 4GI6A 5JBDA 2OLHA 4AEFA 3W82A 1VJZA 1CENA 5A8NA 2VZUA 5I0DA 1J0KA 3TTSA 4N0RA 1UR2A 2JEQA 4PMNA 2GSJA 3WF4A 3VGDA 3LRLA 1E15A 4AD4A 3ARQA 3KE0A 1PEZA 4TX6A 4P8UA 1JYXA 4UOQA 2Q8XA 4W87A 1TQUA 3WNMA 1UOKA 4DWSA 2RGLA 1H41A 3T09A 4JFVA 3D4YA 1VAHA 2WNWA 2ZWYA 4TVCA 2WYSA 3W24A 4W8BA 3M7SA 3CZ8A 4WKAA 1VBUA 3CLWA 3BVVA 4MB1A 3DDFA 1NARA 4P7RA 1C90A 4TVUA 1GCYA 5JIWA 1FFRA 2WB5A 2DSZA 3L4ZA 3VU2A 1DWJM 3WNPA 2JEPA 3L4XA 3T2PA 2G3NA 5D9NA 3HZ3A 3MUZ1 3HN3A 4U2ZA 1JI2A 2VX7A 1J0ZA 3RILA 4JKLA 2D1ZA 2WW5A 3N15A 2J7GA 3VD3A 2ZUVA 5A2AA 1JXJA 2YDSA 4AD1A 4CN4A 3FHAA 2O92A 2ZXBA 2F7RA 1B9ZA 1JZ4A 2XWEA 1BPLB 3U7BA 3OB8A 1KR1A 3MUAA 2PF0A 3WELA 3EDJA 1QWUA 1XSIA 1XH2A 1BVZA 4BQ5A 3ARRA 4AD5A 1GJWA 4UNIA 3RDKA 1GUVA 1GOMA 2VX4A 2ZOXA 4CU7A 1M53A 2FYVA 2BNJA 1CGYA 4FNSA 4MJ2A 1QW9A 1H4PA 3A24A 2AAAA 5FD0A 1HJQA 3LXBA 3RPMA 4JAWA 3VGBA 4HU0A 1MW0A 3SUWA 3WH8A 3KWXA 2ZUNA 1OCQA 1E6PA 3OLIA 3UG3A 4AEEA 3SCUA 1V3IA 1OIMA 2WSKA 1VENA 5FIPA 2G4FA 1OT2A 5I79A 4ZEPA 2A3BA 3CTTA 4D6HA 3WDHA 1KBBA 3VDBA 3GXPA 4OJYA 1Q6GA 4N42A 1E5JA 3VM7A 1C8QA 2BVTA 1UA3A 1W2VA 1HKJA 4UQBA 1GORA 3T08A 2WSPA 4AZ5A 2YL9A 3MO4A 3EYPA 1JYNA 1R8LA 5A6AA 5A1AA 2OW7A 3MI6A 1ZBKA 3LPFA 1HL9A 2D3LA 4K68A 4CD7A 1V3JA 1HVXA 1HTYA 3D4ZA 4J27A 1R85A 5BRPA 4KRTA 1GVYA 2E8YA 1XHGA 4GO9A 1E1EA 3AZRA 4U5KA 3I3EA 1E1FA 3MSGA 1MWOA 3BAJA 3LPPA 1K9DA 1WDRA 1HN1A 2JF6A 2XGBA 2F2HA 1ITXA 4D6JA 1QOXA 3WF2A 4D6GA 3OLDA 1HKMA 1ZBCA 4CD5A 3ZQ9A 1E6XM 1GOIA 3OGVA 3RCNA 4LQ1A 4GZJA 3WF1A 3N9KA 1HKIA 4FNTA 1T0OA 4QDMA 3KEHA 2E3ZA 1JDAA 3VKKA 2Z1KA 4W8AA 4PCSA 3D52A 3BVXA 2VURA 4X0VA 4P8XA 4UOZA 3O2LA 2CIPA 4QLKA 7A3HA 1JAEA 3THDA 2GJXA 1L0PA 1MW3A 3VGHA 4QLLA 1RD6A 1U33A 4U2YA 2G3JA 3EMCA 4W88A 5LYRA 3WDIA 1W9DM 2YFNA 3MS8A 1C91A 1W1YA 4AZBA 2D20A 1GOQA 3NSMA 2YBUA 3VD4A 1BAGA 3VMNA 2WHJA 1M7XA 3VSUA 1E71M 1OIFA 4Z2GA 3K46A 5ABFA 1QX1A 1W3LA 3PTQA 1UWIA 2CITA 3AMGA 4PMUA 1JZ2A 1IZJA 3N17A 3FHQA 2CETA 4DUXA 1CXHA 2J4GA 1QNPA 2WLYA 3W0KA 1ZL1A 3GBEA 2J8FA 2D22A 3CMGA 4M82A 4UOJA 1ISWA 3WSUA 3T0BA 4J3XA 1NWSA 5I78A 1UD4A 1HJXA 2WMKA 3HG2A 3S2CA 2XVGA 5C70A 3ZSTA 1TQTA 2FHFA 3ZT7A 1Q6FA 2Y2WA 1UKTA 3VDCA 1CECA 5FCZA 4PN2A 2V5DA 3BLKA 2TAAA 4B16A 5E09A 1JFXA 2OYLA 1SMDA 1C8YA 3VDAA 2FHCA 3AI0A 4V27A 3WFLA 5LA0A 3WMBA 2DT3A 1E5NA 1HX0A 4J3TA 4DO4A 1XCWA 3FAXA 4H2CA 3BMVA 4MJ4A 3TV8A 1C8XA 1R33A 5CLTA 4XV0A 1W2PA 5LA1A 3EMZA 1JI1A 4BA0A 1B2YA 1WZKA 3AICA 5AY7A 2W5FA 4L4OA 2YA0A 2O9TA 5A6SA 2X1IA 2D73A 1E6SM 3WH5A 2WZHA 1FH8A 4LPCA 4KMQA 4OUEA 1GJUA 3AIUA 3N18A 5D8WA 2FGLA 1E70M 2EACA 4P7LA 5JBEA 3EDEA 3ZT5A 3BSGA 2E8ZA 1LLOA 3W81A 5CPTA 2WC3A 3PBGA 3K8KA 3WDRA 3TTYA 2VZTA 3GH7A 2NW0A 3WD2A 1GZJA 4WSJA 3WF3A 1KGXA 5E0CA 2C7FA 3NDZA 4XZWA 1KTBA 5I2UA 2DEPA 4LGXA 2V3FA 4ATDA 4OIFA 2OWXA 1BGAA 1E56A 3AS1A 2G8ZA 5EB8A 5IXEA 4CUCA 1ZB5A 2VVNA 1EXPA 4JIEA 1WDPA 1E9LA 1UKQA 5DF0A 3VIOA 2YDRA 2J77A 4FNRA 1R86A 2DSWA 1C7SA 1S46A 1HP5A 2GK1B 2Y8VA 3SUTA 3CHEA 3W6MA 1MXGA 3TOPA 1H49A 2QMKA 2PB1A 3AMKA 6A3HA 1VFFA 1W9VA 4F9DA 3AROA 4AIUA 1WAWA 2X2YA 4IPLA 2BXYA 3SCNA 3VPLA 4LYRA 4HTYA 1EQPA 1EA9C 3IAPA 1TUXA 1NWTA 3AFBA 4PUDA 4GI9A 5DFAA 3AZSA 4UFLA 4CD4A 2OYMA 3AS2A 4AZCA 2D0FA 3W6LA 2VMFA 2FGZA 2F18A 4UR9A 2AMGA 3SIMA 2O9OA 4Z2LA 2VR5A 1HJWA 3T2OA 1EOKA 4J3VA 3UG4A 1CYGA 1B30A 1WO2A 3VD7A 3CUFA 3A23A 3B9EA 4U5IA 3GYCA 3MV01 5AC5A 1BYBA 1LWHA 4L4PA 1OGSA 3W37A 3A4WA 1V02A 4B3KA 1JD7A 1LJYA 1RP8A 4QP0A 2EABA 2NT0A 2WXDM 1ZJBA 5E0FA 1E4IA 7TAAA 1HXKA 3BSHA 4YPJA 4XUYA 1I75A 2YL8A 2WVVA 2YL5A 1VEMA 1IZKA 1E43A 2EPLX 4AYGA 1GHSA 4YHGA 1J0HA 2JF7A 2DSKA 1U30A 5E6ZA 3GNRA 3WUBA 2J7DA 4ZXOA 3MKKA 2IXVA 4P8VA 1IT0A 1HWWA 1KGUA 4U33A 2WK2A 2WM0A 1Q6CA 1QI3A 3DX4A 1ODZA 4TX8A 4M24A 2VRKA 2JIEA 3OBAA 1XSJA 1NQ6A 3K8LA 5BXPA 1JGIA 1TQVA 1X6LA 1UHVA 2IUZA 2ZX8A 1YHTA 3BAXA 3AIVA 2J7EA 1JZ7A 2FH6A 4AMCA 3WD1A 3AYRA 5BROA 1GOKA 3AIEA 1PS3A 1HJUA 1DWAM 1UG6A 1E55A 3O9NA 1DTUA 2WWCA 1LQ0A 3WUGA 3BXWA 5CQ1A 4KH2A 2DDXA 2XM2A 2UY3A 3SCSA 4MAVA 1R87A 4EAMA 2NT1A 3GXFA 3LRKA 1KQYA 3BAIA 4JHOA 1VRXA 2DH3A 3DX0A 1W3JA 1BVNP 2WVTA 1DWIM 3DECA 3QHNA 1TZ7A 1WCGA 1VEOA 1OT1A 3LPOA 4GZIA 4ZFMA 1J10A 4JFUA 1ESWA 1C93A 4ZXLA 4P7QA 1EGZA 2BFGA 3AIBA 3DX1A 3QGVA 1KGWA 1HIZA 3TTQA 1JL8A 4HZ6A 3VINA 5DO8A 4TXEA 2XGIA 1TA3A 3BUDA 1QHOA 2GVYA 1GQIA 4UZSA 3BVWA 2CXGA 3DX2A 3RIKA 1US3A 1V03A 2HISA 3GM8A 3IJ8A 3EBVA 3ZR5A 1J9YA 2WWDA 2J8GA 1BQCA 3WKZA 4D71A 2DQXA 2VCAA 4PTVA 1H3GA 3WQ4A 1VIWA 3SCWA 1V02E 4HZ7A 4FF5A 1C3FA 5AYIA 4OBSA 1JXKA 3WMSA 2EPMX 3WQ5A 4PMOA 1GOWA 5A69A 2BY2A 3BLPX 4HOZA 4WJXA 1JZ6A 2O9PA 4LX4A 1J0IA 2QPUA 1TQWA 1NP2A 3DC0A 4FLQA 1B3WA 1NH6A 2X05A 2BHZA 4PMRA 2X2JA 3CUGA 5E6YA 4BQ2A 4ZENA 1B1YA 4IM4A 1GOOA 1BHGA 1US2A 4AZIA 1QI4A 3WUEA 3QOKA 2VC9A 2J25A 2PWEA 1J12A 4NZFA 1R7OA 2VNCA 3LRMA 5FL1A 3EJTA 4MADA 4BF7A 1UR8A 5A8OA 3I3DA 1D3CA 2GJRA 1AQ0A 1CWYA 1KR0A 3EDDA 1PZ2A 2OYKA 2FH8A 4AMWA 1IV8A 3ZOAA 3NIYA 3SCVA 2E9MA 5IFPA 1MVYA 4FLOA 4TVDA 1SZNA 3VILA 5A6LA 1CGTA 1CNVA 3EJRA 3GDBA 4UQCA 4RL3A 4TTGA 4FNQA 3OLEA 2V5CA 1R46A 1HJSA 3OG2A 1ISZA 1GW1A 3TP4A 1E4NA 1OB0A 3WNLA 2F7PA 1GHRA 2J47A 3U5YA 4IISA 1HKKA 2YLLA 4WIWA 2J75A 4D6DA 4BCEA 2WANA 1X1NA 1A47A 3AS3A 3L4WA 2YOCA 4PMXA 4E8CA 2ZXAA 1VFOA 1Q4NX 2WAGA 1V6UA 6TAAA 1DEDA 2PWHA 5IHRA 4AC1X 1UKSA 1L8NA 2DH2A 3CUIA 2WHLA 1HT6A 3VGEA 2CKSA 4UQEA 4FK9A 2BS9A 3GXNA 1GVIA 3W38A 3M07A 4AZGA 2NSXA 1VB9A 3CZSA 1WE5A 3APGA 5GQBA 2ZUSA 3ALGA 4CVUA 2QPSA 3D50A 4XZBA 3WF0A 2OSYA 1LL4A 4Y7EA 3UERA 3VMOA 2A3EA 3IJ9A 2VOTA 4EANA 1FHLA 3FY1A 3PTMA 4FNPA 1BYCA 3GXTA 3D51A 4JCLA 4ATWA 3OIHA 1V08A 1H5VA 1CZ1A 1FH9A 1W9PA 1UH3A 4CCDA 5HDRA 4W7WA 1XYFA 2YKKA 4EE9A 3CV5A 3K1DA 2ZXDA 3GXDA 3OGSA 4M56A 2IGTA 4DO6A 4M81A 2IXUA 2CEQA 2JE8A 5D9MA 2ZXQA 3WDJA 1MYRA 3FAWA 2XN2A 3VD9A 3HG3A 2X09A 1NM9A 1K6AA 4OZOA 5JUVA 1O7AA 2XM1A 4RE2A 2PI6A 4AIOA 4YHEA 4FMVA 1P6WA 1XCXA 3AHTA 3WEOA 1G0CA 2CHNA 3OLGA 3VIIA 4Z2IA 1OWQA 3B9DA 2DT1A 3HU7A 3ZR6A 1M01A 4GQQA 3FNDA 1JDDA 2YFOA 3ECQA 2F7QA 1QHZA 3FN9A 3DDGA 1D2KA 1OGBA 3SCRA 4QLJA 4NXSA 3U7VA 5I3DA 1BF2A 2XTKA 4W84A 4WSKA 4AYSA 2WC4A 1V3KA 1CTNA 3PZQA 4HA1A 2BY3A 2DSVA 2VCCA 1Q6EA 3IK2A 2W63A 1E40A 3WQ8A 1XGZA 4HA3A 4W5UA 3CZKA 2D2OA 2G41A 3CZLA 1UKOA 4AY1A 2EJ1A 4NRSA 1RP9A 4UCFA 1OINA 1K9FA 3WY3A 2PBOA 1J01A 1UR0A 3WBEA 1PX4A 1CXEA 1NP0A 2J74A 3EDKA 4QFUA 2J7BA 1W3HA 1CXFA 3KLLA 2PBGA 1H1NA 3ARUA 4NZJA 5DT7A 2PWFA 1PX8A 1HVQA 3F4VA 4A4AA 1BLIA 4M80A 2WMJA 3GNOA 5ABGA 1U2YA 3GH5A 2A3CA 3MMDA 2V3DA 3AMLA 4B9YA 2UWFA 4R27A 3VVGA 2XVLA 4ACZB 4DUVA 4UFMA 3LMYA 3NDYA 1H0GA 4HZ8A 2WCGA 1OM0A 5BWFA 3VX1A 4CD8A 1WP6A 1B3ZA 4AD2A 1XRVA 4AISA 5I23A 3ZIZA 1D7FA 1WNOA 4FLSA 3CC1A 4CCCA 3CHFA 3WMCA 2ZICA 3E1F1 5BXTA 4GPNA 5CSYA 2WVSA 1EOMA 5D9OA 1E3ZA 1QBBA 2WMIB 3AHVA 3L4YA 4UTFA 1UWQA 1TVNA 4OOZA 2YBTA 1BG4A 3ZJ7A 1G94A 2DSUA 4M8UA 3VNZA 2F61A 5CXPA 1NOWA 4CU8A 4MNKA 1SR0A 1UA7A 1PZ3A 1UQYA 1TVPA 5EFFA 3WL1A 1GQJA 3MV11 1CDGA 3BMWA 2F7OA 1EO5A 2ZUUA 4NF7A 1I1WA 4XB3A 4PYSA 4C7GA 1QPKA 2EAEA 4MB3A 5CPSA 3G6MA 4AD3A 2WC7A 3A4XA 2HVMA 2XSAA 4KGLA 3VIJA 1XD0A 1QI2A 5GNYA 1BSIA 4HPGA 2CPUA 1WDSA 3N04A 3CZEA 3SCTA 1JYWA 1H09A 5BCAA 2XVKA 3U57A 3NCOA 1KB3A 1OD0A 1EHAA 3UEQA 1TR1A 1DWGM 5FKYA 4H41A 2RGMA 2WKLA 1LF1A 5ECUA 4P7OA 2Z1SA 1UD5A 3WY1A 5HXMA 2VZOA 4U3CA 3CHDA 3GXIA 3VIGA 3U5UA 4FLRA 2ZUTA 3KL0A 2VRQA 1UR9A 1UASA 5BXSA 1QNOA 5EMYA 3GTNA 2FDMA 3THCA 3TTOA 2BVYA 3UG5A 1JZ3A 2EADA 4NZCA 2J62A 3VGFA 2EXOA 4H7VA 1NOUA 3MUIA 3SCQA 3MU7A 1CGWA 4W93A 1EHNA 3T0AA 1W1VA 3RO8A 3HG4A 1MQRA 2J78A 1KCKA 1HL8A 2GK1A 3WD4A 5M3WA 4IUGA 4A3YA 1DHKA 3T2QA 2ZE0A 3WNOA 2Y8KA 2FE0A 1EDTA 5C8BB 4AXNA 3PZMA 3WN6A 3S6TA 1K9TA 1F4AA 5D9PA 1AVAA 4F79A 3KL5A 5A94A 3ZSSA 2WMFA 3EDFA 1KCLA 2DT2A 3PZUA 4DM2A 1BTCA 1MXDA 2A3AA 3CZJA 1V0KA 4W7VA 3EJUA 2DIJA 2WBGA 2OW6A 1QI0A 7CGTA 3KLKA 4HMDA 3ZT6A 2XUCA 3RMEA 3ARXA 2G3IA 1JAKA 3DYOA 4D6IA 1CLVA 3W4RA 4AZ6A 4UFJA 1E4LA 2WKGA 3A5VA 2WVUA 1TG7A 3ARPA 1ECEA 5E1QA 3VIFA 3ZJ6A 1EO7A 1E4MM 3L4UA 2WPGA 3CHCA 3VDHA 3PZOA 5KEZA 5CJ5A 3SUVA 4QCEA 1W91A 4UFIA 4PSRA 3AIWA 3AXXA 4FNUA 5A6BA 4PUEA 2CYGA 2W67A 1UWUA 1PBGA 4WK9A 4D1IA 2WZIA 1R34A 3IJ7A 4M1RA 2XHYA 4NXKA 4P7NA 3AMCA 1UH4A 1BGGA 4S3KA 2VZVA 2VUYA 2VVSA 3AJ7A 4E8DA 2X0YA 1V0LA 2ESCA 1E0WA 1KXQA 1JIBA 2X2IA 2PC8A 3OGRA 1TMQA 1SYTA 1V6WA 3BC9A 4HA4A 3AQUA 3L4TA 4J28A 1AQHA 1B3XA 3PZNA 4H8VA 5CPQA 4KRUA 1OGGA 5GPRA 5KZ6A 4Q22A 1JG9A 1R7AA 1KWKA 2XVPA 3ARZA 3N1AA 3EMQA 2YA1A 2XIIA 1JNEA 4JKKA 1CEOA 2VL4A 4ML4A 1UWSA 4R5EA 4PMZA 3ZM8A 4OKDA 4DWSC 1B3YA 1I1XA 2QMJA 5CLWA 3CGTA 4B9ZA 2XVNA 1CPUA 2D23A 4PEEA 1VEPA 3WIJA 3K4AA 4TTUA 1ODUA 1UD3A 4JFTA 1UH2A 2D3NA 2J79A 3DYMA 2VX5A 4AZHA 3N12A 1XC6A 3AZTA 4W85A 1CGUA 3MUY1 3RM8A 1VBRA 3RM4A 1CIUA 4UQAA 2OSWA 5E70A 3QHOA 2GUYA 1AMYA 3CPUA 3AXIA 1G5AA 4DUWA 4Z2JA 4PTWA 1TCMA 3BUBA 4PTXA 5CSUA 4PSPA 1C7TA 1UUQA 1MFUA 5E9AA 4DWSB 3WY2A 2VCBA 1UR4A 1UYQA 5JIPA 1HNYA 3BAYA 4GQRA 1MW2A 3VOCA 3BH4A 3HJEA 2DT0A 3ARVA 4DO5A 4V2XA 3MMWA 2OWWA 3WFZA 1QI5A 4PCTA 3VGGA 4Z2HA 3IAQA 2X0HA 4BZYA 1Y7VA 2QV4A 2CBJA 1F4HA 3CIVA 5EFDA 3PZTA 2QLYA 3FW6A 1EQCA 3DHUA 2ZWZA 1HF6A 3F5LA 1MQQA 3ARWA 4UQDA 4F8XA 4PMQA 1LG1A 3AIQA 2UY4A 1MW1A 3OA5A 1OBAA 5HNNA 3J7HA 3SUUA 1W1TA 1UKPA 3I3BA 5A8MA 1ITCA 1NOFA 1MFVA 3PHAA 4WLCA 3ARSA 1FP9A 2UY2A 1J0YA 1JDCA 2GDUA 3BUPA 1XSKA 3NSNA 1E6ZA 4PMYA 1MQPA 1V3HA 3VD5A 3WNNA 2ZX5A 1ISXA 1C92A 4A3HA 5HPCA 3N11A 2ZIDA 1JF6A 2ZX7A 3KZSA 5A6BD 2D0HA 2CHOA 2CBVA 2J7CA 2WMHA 4HU8A 2Y4SA 3PTKA 3BAKA 1FOBA 1DWFM 2YL6A 4AIEA 3WH6A 3PZIA 4H8UA 4W7UA 1E73M 3L2LA 3AOFA 3CH9A 1QNQA 2CCRA 3WD3A 4LYQA 3BGAA 3NSXA 2XN0A 2XG9A 2V3EA 3UETA 1PAMA 3WUFA 1E72M 4AWEA 3M6DA 1YQ2A 1J0JA 1KFWA 3SURA 2BY1A 4CN1A 4XX6A 4MDOA 3WL0A 1CGVA 3B9AA 2E40A 1M03A 1W32A 3AHXA 4QCFA 5A8QA 4GO8A 1O6IA 4JHZA 3BAWA 1B90A 3WY4A 5DMYA 3VTRA 3BUQA 1G01A 3TONA 3WNKA 1V0MA 1QVBA 3PZGA 2ZUWA 4F66A 1KBKA 4WKHA 3W27A 2F8QA 1ISYA 1PX3A 4JFSA 1H2JA 2WBKA 2EO7A 2YLAA 1JF5A 4H8HA 3VM5A 2XSBA 2CNCA 1GQLA 3LXAA 5D4YA 1CBGA 4HOWA 2VT0A 4LYPA 3AISA 1XD1A 1LWJA 1BG9A 5C71A 2J7FA 1W3KA 3BLBA 1G9HA 3S5ZA 4RE4A 5AYBA 5ABEA 2Y5EA 4UQ9A 1WZAA 4H04A 3WDQA 4JZ5A 4W86A 5A2CA 2EEXA 4ZE5A 4OGZA 2GJPA 1XH1A 1R75A 4RE3A 3A21A 2VX6A 4ATLA 4LXFA 2G3MA 5HPOA 5AC4A 1KXVA 4HOXA 1XYZA 4AMXA 4MPKA 1PIGA 3WDPP 3A22A 5A6MA 4GI8A 3WQWA 1QHPA 4E2OA 4F9JA 1JYVA 2XJ7A 2EPNA 3CO4A 2QF8A 5I6SA 3MANA 1JNDA 1V6VA 4B15A 4NI3A 3CUJA 4PMVA 2GJXB 4IPNB 4J3UA 3H53A 4MAZA 4DWSD 1RPKA 4W8LA 3EJQA 3VSTA 3T0DA 1E3XA 5BRQA 4CKQA 1W9BM 2WCAA 1BYDA 4MNMA 2PWGA 1PJ9A 3W28A 3OZPA 3VX0A 5I77A 3ARYA 1DWHM 5ABFB 3VIMA 3AIRA 2BV9A 2JALA 4NX0A 2EQDA 1GQKA 2ZX9A 4UFKA 5A8PA 2CESA 2X8RA 2C0HA 3MMUA 1V0NA 2O9RA 1FFQA 2JFEX 2BHUA 4KWUA 1TQSA 1XH0A 3K8MA 2E4TA 1E6NA 1NWRA 2VZSA 2W91A 4GKLA 5A2BA 5IDIA 1Z32X 2YJQA 3KL3A 1VF8A 1V3MA 4YN5A 1JZ5A 1E0VA
chains in the Genus database with same CATH superfamily
4D6FA 2O0TA 5I1KL 2XY6A 1SUHA 2VLRA 2KE7A 3EX2A 2VRJA 4JVUA 2DPEA 3G1MA 1H0DB 4O0QA 4XO8A 4ENED 3HA1A 2ZWLT 2MOGA 2MKWA 2HEOA 4ZD3H 4J8RB 3L95B 2XXGA 4P49A 1Q9KB 3DO7B 2EXTA 3FKKA 2HOIA 3V8KA 2WF8A 1C1EL 4MY1A 3WKML 2VUKA 1QLFB 3BZ5A 3PS7A 3LLDA 2ADJA 4JX0A 1SXZA 2JB6A 4YBLB 5JTIA 2A74A 1GY2A 3TADC 2BVDA 2X9YA 3OVRA 5DDGA 4PJCF 3NAAH 2YCKX 2RDXA 4GBXB 2D2JA 3KBWA 5EOCJ 5BXFB 4DQAA 4OIIH 4WVXA 5EOCH 3DETD 3JT0A 9ICXA 5DUMH 5A7BA 3CCQI 3DV6B 4R26H 2G0LA 1L5UA 4WDXA 4PTTA 5DJZB 3H56A 3ZDXE 4S2CA 4WWCA 2K9LA 4Y4HC 4KLMA 2R5ZB 5E6IC 4X7SL 3AY4C 3WX7A 3VFNB 3OYXA 3RDIA 1L8OA 4XN1A 3WK1A 1GEHA 1V51A 3U4BH 3TC9A 4BKSC 1MCHA 3D34A 1HJVA 3O6AA 4Q32A 5C0CD 3EH2A 3FMGH 4HLZG 4G7VH 3RA7L 1KTCA 1QSYA 1EYEA 2OV0A 3MBEA 1AR2A 2EK5A 5E8DL 5FDWA 3LHYA 2Z1VA 4O02A 4LBUA 3GDTA 4BXOA 3CFKA 3VWJA 5LKNA 5EOZA 2CHRA 5H8DA 4IR9A 1EHXA 5E03A 3HMJG 1UZCA 3DPDA 4C7ZA 1TMLA 1FA4A 2B9SA 2EDQA 4FR6A 5E94B 3E96A 4B5TA 3QA3B 1H7WA 4XD5A 2PZ0A 4V33A 3WXVH 2KJ9A 4RLDA 4MCZB 2ESVD 4TLTA 2PDWA 1ENHA 1LTDA 4ZMQA 5DBUA 4KOBA 2DQGL 4GP8B 4KKAC 3F8UB 1V9PA 2C2EA 2BP5M 4PHAA 4Z0JA 3LHPL 3QLDA 3PY9A 1T7PA 4HQQH 1I9JL 3MN8A 4PRWA 3WO3B 1BBYA 1CWVA 3DRTA 3FTWA 3JUGA 1KDIA 3FQWB 4AQ8A 4FD0A 3RG1C 4ZUSA 4J2QA 2R23B 5IJKC 3ABKB 3OJMB 1CLKA 4NPKA 4NO0A 4X6EA 3EYFA 3SV3A 3WEMA 4IGHA 3KOFA 3KTCA 5KFDA 3JTTB 2W4XA 2FR4B 4JFEA 4U31A 2DZEA 4WWKD 3B9VA 4OZIB 3Q2CA 1SWWA 4NQ1A 3B2XA 3C2AH 4U7DA 2VJXA 3NH7H 3UGEA 2E0PA 1MCCA 3AHYA 3ULUE 4V28A 2YDQA 1KC5L 3QXBA 4KJYB 2NLIA 4LG0B 3ESUF 1F4YH 2Y24A 3AB0C 4GBXD 2F08A 3CN0A 3G04B 3PL8A 3S9YA 3CCUI 1TPB1 3K6SB 5TDOB 1JZFA 1YEJL 4I2IA 4X0NA 2WW8A 1A3ZA 3WN5B 3IB4A 3BZFB 4O19A 1RL1A 3MABA 4DAGL 2WNZA 1G9NH 3VQLA 2NNYA 5D72L 1V05A 1MCWW 1T1ZA 2B14A 3EWXA 2N3JA 1GA2A 1OD8A 3QUXB 4AWXB 3WEZA 5TDNA 1EJVC 2GQAA 3H8WA 4E4PA 3R8QA 3CP8A 3DROA 1KXTA 3IG5A 3L21A 1FQ0A 3BLFA 1KNOA 2VKHA 1ZVSB 3GHPA 3W82A 4AH2A 1IC1A 3K1GA 3UYRH 2EVGA 4QEEA 2C4FT 3VGDA 1D6EA 3MMYB 1YMHB 1FF5A 3CDCA 4EPDC 3GDMA 3EH5B 4DWSA 1H41A 4MA1B 3D4YA 2WNWA 4P46B 4X5RA 3PBWA 2GC7C 3VFMB 3ZBMA 4HUVA 2AQOA 3CPGA 1COBA 1LDJA 1V8EA 3QQ3A 3HQPA 2XZ9A 3MRGB 5IFAL 4U05A 4LV4A 1U6GA 5E4AA 4Q9QL 2XTJC 1FWFC 2VDRL 3VU2A 3P0VH 4XNUL 3HZ3A 4I2CA 1XIWA 4IDLA 1DXEA 2I85A 3FU5A 4K23L 3OYNA 4ZMVA 4WF2A 4OD3H 1ZIBA 1WUZA 2V2TB 5BNXD 3V6FA 2WW5A 4KCTA 3LKNB 1JXJA 5DHDA 1XCTA 1DO5A 3S4SB 1GYNA 3W2MA 4Y19E 4ACPA 1JGGA 4JHWH 4KQ0A 4PIBA 3LSKA 4S05A 5E8PB 1CF1A 3LA2A 1P53A 4BI7A 3LN3A 3W39B 4UHTA 1GOMA 1GUVA 1KACB 2FYVA 5HHNA 4EVNB 4NUMA 1OP5K 2A4CA 4G9FD 3V6OE 3QWNA 5M2FX 3UTQA 3UTPE 3HFTA 5D1XC 4UTAH 2WUCH 1U83A 4MJ5B 1RCOB 1G6NA 5F9DC 3F21A 2WLHA 3QXVA 3H9HA 3QG7H 4C6KA 3WDHA 4QXGH 4CC0A 3ES8A 3PR4A 1N5YL 5FAGA 2KN7A 1OP9A 3VM7A 3P74A 4L4MA 3V9EA 2ZDRA 4AZ5A 1TJ0A 5HYJE 4MTDA 4FF7A 1JDEA 4FRWA 2DT5A 4LEOB 5HYFA 4JWNA 1RHFA 4Z7UF 2DYPA 4OJAA 4EF8A 1FZPB 4LOVA 2VEPA 3BR5A 4NM2A 2XGBA 1ULYA 2E86A 4LLWA 1WDRA 2JF6A 4LCVA 1F8MA 2ITDB 2XIDA 4IRSC 4UI2A 5AUMB 1HG3A 3RCNA 4X5WA 5F7KC 3EBGA 4GZJA 1CD1A 4QDMA 2ELKA 2Z1KA 1I8LC 4EJUA 5HLTA 1J05B 3WQFA 3QRGL 4QLKA 1A0EA 1JUMA 1LLAA 5KHDA 4KZEL 1FC2D 4P46D 2D20A 4NKDB 3NFSH 3NIFE 1UURA 3I6KA 3GEZA 3S48A 2N7BA 4NQED 5BV7H 2O5NA 4XCFL 3M4OJ 4RLQA 3OWTA 1TIUA 5AD0A 5IBTH 1I3GH 2FGWL 2PI5A 5FRMA 2DFEA 2W24A 3S2DJ 1CL7H 5J9PB 4ZYHA 3HTLX 4XNXL 3SGDH 1ZL1A 4FR1A 3HUJB 4UOJA 2E6FA 2FDRA 5KG2A 3GJFH 3DKXA 5CQGA 5DYMA 4NQDB 3MT1A 1O4XA 1WCLA 1NCDH 2PX9A 3FSVA 1TPWA 1TJGL 1NGYA 4JG0L 1Q0XH 1K2DB 1UMLA 1P7IA 4EX6A 1PZ5B 3ZN0A 3LQRA 1F5ZA 4FO4A 3K74B 5J5EA 1LQ2A 2Z1WA 2UUDH 3W22A 4IIEA 5T3XH 1YDNA 1PG7W 5F2FA 1YDOA 4X0KB 5E79C 4EACA 4D9RD 4XBKA 3ULVD 3UJEA 1XCWA 3EA2A 4XHJD 4MJ4A 3TV8A 5LA1A 1W2PA 5JXAL 5JZ7D 1RZPA 2AGPA 7ICUA 4WQOA 1VQTA 5H2ZA 3QVQA 3DX9A 3LNFA 4H7ZA 2N1RA 3UA4A 1Y1VJ 4UINL 2ZJ2A 3LIZH 4GY0A 4PYHA 8FABB 2I24N 5IJVB 4JPGA 4P7LA 1IC5H 4QXTB 3EJZD 1MDLA 4TXVB 3BN9C 1LFPA 3TP3A 4N85A 4YUEL 2VZTA 3W83A 1ZQSA 1R19A 1Y5VA 4BQBA 4AQ1C 1FY6A 5K9XA 1FYKA 2Y7MA 4MQ7A 4DP1X 1ZTXL 4LGXA 4JXCA 3WLWD 3PFMA 4OF8A 2OWXA 4N2YA 2HKXA 3MPGA 5ID0A 1I8KA 3RX2A 1EIXA 4CNUA 2FK9A 3CFJB 1BSLA 2J77A 4IUOA 1R86A 3DI0A 1KPVA 2OR9L 5J0PA 4M7KL 5ID1A 3BO9A 4QHUA 2E3VA 4OD1H 4FFZL 4RZBA 2PB1A 1M2VA 1W9VA 3WJJC 4LYRA 3RKQA 4NNYB 3ITXA 4NI6A 3OYIA 3O2VH 3AS2A 2KHAA 3OPXA 4PUKA 2BIHA 1X5IA 4GC6A 2GGIA 2XF5A 3MYZA 4WEVX 2F18A 1SFEA 2RN7A 3A9IA 3QDJA 2GUBA 1IVLA 5KYNA 2P8LA 3GYCA 3NZHH 1HIWA 3N4MB 4I90A 4K7PX 4UTLA 2IWKA 1R3TA 1JD7A 2QT6A 1B3JA 1Z7AA 4JPVH 2QCDA 3V7PA 3NIDE 4R3SB 3ZL2A 4CCHA 3TFSA 1QRKA 1P0SE 1HEKA 4I8YA 2QQBA 4LVDA 1V7MH 3D2UA 3WUBA 2LR8A 2DWEA 1F44A 2UXTA 1XMEB 3EEZA 3UZYA 3KCLA 1KB9K 4M24A 5F6IC 2H3NB 3C6EA 3N97A 1JGIA 2DY3A 5IOKA 3RUGE 3FU0A 1DBML 3UFIA 3WD1A 2I32A 2IADB 1R3QA 4G6DA 2WWCA 2Y7SA 2A9CA 4DFJA 3QIWB 3SCSA 2ZADA 1R0AL 4JY5L 3IN0A 3CXFA 2DH3A 4OZHF 5INCB 4JS3A 3E6HA 4YHZH 2XH7A 1UA0A 4Z7WE 4ELME 2A79A 2RC4A 2HRPH 3M9MB 2IPFA 3PF3A 1BGXT 2PLJA 1P5VA 3BUDA 1KCXA 3DVGA 2CXGA 2QEXI 4ZW6A 4QIRA 1NAKL 4W1UA 2EZXA 5E4IA 1U8KA 3DVNA 1F6PA 2G4GA 3ZR5A 1X3WB 2YPRA 5BS0B 2Z7YA 1BD0A 2HBJA 2AJUH 1BVSA 2B1AL 1FAIH 5KVGL 1EPVA 3E2HC 2G5BB 3ISYA 4NM4H 2DOAA 1OC6A 3WIHL 3R79A 4FF5A 2XT1B 1LCOA 3L2UA 2H6PB 3KFTA 4O5EA 1RK1A 1TNMA 4NT0A 5AKSA 4HOZA 2O9PA 4Y5XC 2X6CA 4GVIA 1LJ9A 5AW9B 4N2BA 4FLQA 3IDWA 5ILSA 4KU1A 1UJ3B 3CUGA 1KIPB 3QZ7A 2JVUA 4UM8B 1UOLA 1B1YA 2L7FP 3ZDDA 5DANA 1XGQB 4JQVA 1US2A 3P9CA 3STEA 2C7UA 4RQMA 2XV6B 4JFFE 2NXHA 5DD6A 4N0UA 2DLFH 3OKMB 2XGDA 4YJZL 3UC0L 4W68A 1KR0A 3VQMA 5MEPA 2O30A 1MVYA 3SQLA 1C5DB 4K9EC 4FKKA 3GDBA 3S2LA 1DFBH 2CM6A 4P0PA 1HI6A 2ZA3A 3ANUA 2OTWB 2R1WB 2X89D 5FM4A 2HOFA 4BCEA 3BP7B 4KVPA 1RG6A 4L3CB 2IBZX 4KITB 2K4IA 1DQTA 1ACZA 2RMNA 3U36A 1PYMA 1U0JA 5D2TA 4FE3A 3ELFA 1X5MA 3LZOA 5FF7A 3UJIL 4GW5A 3TQPA 2XGEA 1Y0LB 2GBAA 3OKEA 4GMTH 1XBXA 2FJSA 4OCNC 3GSNA 4I7VA 4Z9KB 3QIWD 3MQ0A 2YBRA 1JPMA 3WG7H 4HU4A 1QSEB 2IPGA 4TQ8A 1Q65A 5IM7A 4YYCA 2WXRA 1OGAB 2QQ8A 1UB3A 3D51A 1BQHB 2CSPA 1H5VA 5D09A 4FQXA 4HYKA 1B72A 3RHGA 1RZKL 5J4VA 1ZH5A 2VXVL 5F44A 3GXDA 3T8VA 3S35L 2Q2EA 3KYMB 4WW1B 2QPXA 2HEJA 3O05A 2LP0A 3QHTC 1H89C 3IXTB 3FUHA 5B3JF 1G59A 2DL9A 1RUOA 2PN6A 2RKXA 1P6WA 4MUPA 1N2RA 2ISFA 4PJGA 1IFHH 1HL2A 1USTA 4KZDL 1EH7A 1KRCC 1NCGA 1XIGA 3QJHA 1I8IB 5GS2H 3M1ZA 2X10A 4X5VA 2UY6A 4RISH 4G9YA 1W16A 3SRFA 5L4IA 1UGKA 1QWKA 2YN3A 3U7VA 1GTEA 1PZSA 3PBVA 2PCYA 4A0ZA 2E9JA 3JWDC 1E40A 1UQSB 2R7TA 2J8TA 4B5SA 4G42B 4W5UA 5E5UB 3W9DB 2G41A 3R10A 5FGCE 3KD3A 1C5CL 3VJ6A 4NJAH 1YNTF 4PJEE 1HEHC 5IB1A 1JPIA 1S2TA 3P2BA 4PJBB 1Q38A 1AZCA 5JH2A 5E2JA 3RF9A 3S1WA 1JRCA 3WIAA 2KX9A 5G1MA 3MO1A 3ARGC 1U2YA 5I6MA 3HPOA 5HJ3A 4LCIL 2UWFA 3MW7A 2BVEA 1PZBA 2WCGA 4ES4A 3FC4A 3TH4T 4NJ8A 4HJ0D 3CVBA 3HPLA 1DIKA 5BWFA 5JVTA 3T2NH 4ZMYA 2B1HH 2P9RA 5JUMA 4EQ2A 1EJWC 2A6NA 2VE6A 3HI1B 2GGEA 2XF6A 5DYOB 2CWEA 2JA7J 3O9WA 1G94A 4PR5A 4MFAA 4JDVB 1EF3A 2V5MA 2KLOA 3LBCA 4S3FA 3I9V2 3NRFA 3I53A 7ICQA 5GS1B 1QSED 3MC5A 1OW0C 3GU2A 1I0BA 1OGAD 2KVSA 4M9NA 3A4XA 4A2FA 4JO3L 2HVMA 1X1PA 5DRCA 2K3FA 5D8JL 3BZGA 1XS9A 3CZEA 2FSEB 3DLAA 3GX4X 4AGQA 1W4MA 3RB6A 3QPHA 1INDH 4LHUB 1EHAA 2ATPB 3K1KC 3I65A 3HPGA 4GKZA 2WKLA 4PLOB 3SE3A 4QNEA 5I3IA 4PB4A 2NNFA 1RXWA 3W57A 1YEKH 4QNWA 1TO5A 3VIGA 4JFOA 2VRQA 5C0JA 2EVHA 4H4KC 3KYNB 2OR7A 4GRMA 1X44A 2FQIA 3S3SA 2EADA 2FO4B 3DTEA 5MKGB 1R3HB 3VXSA 4JFDA 4OZ4A 1MQRA 5DWPA 1OX5A 1J88A 4XMZA 5T8GA 4G70B 4LQFH 4JTGA 4AHQA 3SQBB 4E2BA 2FE0A 1Z5HA 1U95A 3NDYE 1QSFA 2DP3A 2NYZA 4WJ8A 1IXCA 4PD4K 4ENNA 5LJYH 4NZ1A 1Q9LB 1MSSA 5A94A 2OMYB 4GMSL 3HPSA 4CDGA 4I77H 4CCLA 1H7OA 2KKOA 1ECZA 5M3FJ 3CZJA 1F58H 4M4RA 1BXBA 2DIJA 3P3RA 2VH5L 1LM1A 2R8WA 1S5IH 3ARXA 3CSGA 1RUAL 3F58L 3QUMB 4HJEA 3QRBA 1FSHA 3FQXA 4LPWA 3EOBA 2OJPA 1S9VB 5DUPL 2YC1A 5DS2A 4OLXH 2Z7UA 4FLHA 2VI6A 3DX5A 5CJ5A 3M0JA 2EV0A 4DEUA 1I1YB 2VHLA 1OCBA 1E6JH 1TWAJ 5LGXA 2CQVA 2I5GA 2R2BA 4HS8H 2VZVA 3LN4B 4JPIB 2PCPA 1NIAA 3H7RA 2DQUH 2MSNA 3QQNA 2R14A 1DLFL 2KRFA 2H2SD 5D05A 3LSGA 3V4VB 2INEA 4CQCA 2HE8A 1HEZA 3PX0A 3PZNA 4NNCA 3PHOA 1XYCA 5FJPA 5KZ6A 2XVPA 4IEJA 1R7AA 3N1AA 2V9WA 3OMAB 4K8EA 4ML4A 2VL4A 1AG1O 2MFNA 4OKDA 2QMJA 5JHDA 5D70L 3LSHA 3KDMB 2CS3A 2X0LA 2QFPA 4A37A 5J13C 4JWMA 5I6XB 5CP7A 3VFUB 2LE9A 1LEIA 3QNYA 3BUVA 1EC7A 5HI5C 3JPOA 4JG5A 3LGGA 2NNNA 3DYMA 4ZUVB 1A77A 1FL5B 1FN4A 2RCSH 4MGRA 3N42B 4W85A 3UQ2A 4KLGA 2A1AA 8TIMA 2XY1A 5K39A 5E70A 2ZYRA 2ZYHA 4J6RL 2IQTA 1NBZB 4XWGL 4PSPA 5EBMA 1UUQA 1MVFA 5KN5B 3Q3GB 5JIPA 5AVHA 4I5UA 2GSIA 2D2GA 4YEEA 4JO1H 2VA3A 2X7LB 4Q6YA 4I0AA 1NMCB 4I9MA 1FI8C 2QV4A 3KDNA 3NN8B 3ZOBA 3ZU8A 1PUZA 3QUYA 1KCUH 5FB8B 3FOLB 3V95A 2NY0D 5DZVA 4EXAA 4ZPTB 2CG9X 2CQQA 5D2LF 2XGZA 5AOUA 3BKYL 1BC7C 1NJXA 3B43A 4XD6A 5F9OH 2VFHA 5HNRA 4TUQA 4XBGB 1UADC 3PHAA 3GSXB 5LRRA 4XIAA 5IW6A 4L4TD 4A05A 2L9VA 1R2SA 4DVOA 4E9QA 4BNCA 1X39A 1ZA3B 1OYYA 5H94A 4I2GA 2ZX7A 5GRYA 3EYQD 3NJMA 3NIFB 2R7OA 2AKRA 4GISA 1C7YA 1MRFL 2Y4SA 1EJ7L 1JWUB 1RCXB 4RMTA 3FB5A 4IBSA 2C6YA 3QEHB 1R4MB 2XWZA 3VTAA 4EZ6A 4J40A 2HSAA 1X5KA 3UETA 4Z78B 2AQFA 4WXYA 1L7IL 4FYSA 2RGSA 4YXJA 3P3BA 4AVZA 2GWSA 2F1JA 5ESVA 3OYEA 5FKPA 3FA5A 1R9TJ 5EZJB 5IP7J 2QQLH 4MZIA 3PXJA 3NGJA 1X3UA 2WB1N 4ZRGA 3TC3A 4BZ1L 4YWSA 4L1BA 3ZTEA 2Z34A 4KEUA 4TV3A 3ISCA 1BQGA 2K4AA 5ALUA 1I85A 2VLJE 1UWXH 1ZWIA 2FT6A 2F8VA 1B3OA 4M6NL 4FCYA 3W1LA 2GKIA 3HE6B 3APYA 3NRPA 4DQOL 1LWJA 2B20A 9ICVA 2JKXA 4RVBA 4Z7NE 3CDFA 2E2JJ 3ILEA 3S5ZA 3O11A 1OAXL 5ABEA 4C55A 1D5VA 2HVHA 1XGPA 1FAKT 2IMNA 5ANHA 3IFPA 2LT9A 1K8DA 3WK9A 3MBWA 3L3HA 3SQOL 2A6IA 1YAZA 1MNUH 4Z6EA 2WGNB 3SR7A 1ADQH 5C07D 2A1JB 4BWUA 4K3HA 3KTQA 4MAZA 1T6SA 4AXKA 3T0DA 4PJDA 4DX3A 3OZPA 3HZJA 1A3LH 1RH8A 2IG2H 3HW8A 4Y13A 4ZQCA 2VD9A 1GDTA 2L3DA 5D8LB 5D4SA 5I15L 1GQKA 2ZX9A 2ZCKL 3ZLQC 4JQ2A 5DC9B 5HWJA 4IMLB 3MUGA 3K8MA 2AQ2A 3ARBC 1R1UA 1RR7A 2OZ4A 2HX7A 3QUML 4PRPB 4ES8A 2B4GA 3EOAA 2KL6A 4ENMA 2AQWA 3TAPA 4YG2A 2GLOA 4B1RA 1WH0A 1HP4A 2X4NB 4OFCA 3RWFA 3KLNA 4LL4A 4K3DL 2PLKA 1JKOC 4PCKA 1X6UA 2ASHA 1N6UA 3L2RA 1SM9A 2LREA 4JL1A 3OBKA 3LS4L 1Y07A 3T65B 4ZQRA 1N2XA 2EDBA 4JFYA 2VXUH 2A9NH 1SANA 5GS3A 3K1PA 2CFFA 2VELA 1U8QA 1ZBVA 3FB8A 3V4VL 2E27L 3QFJB 4YN3A 3UR8A 3JU2A 3SCPA 3CF2A 2KFZA 4X6FA 1DR9A 2GUOB 1NEZB 3DHPA 3KXFE 4RPXA 2D0GA 3RZOJ 3AM9A 3VXUA 5J1AA 5CEXA 1GGIH 3D25A 1JFHA 3B8SA 1MKMA 5CZKA 5F7HA 1VBHA 4I1PA 2AXWA 3U2ZA 3F7LA 4OJLA 5KFKA 2ZTBA 3B5TA 1LP9F 3RGTA 1Y65A 4RPZA 2D24A 3HTUA 1IRXA 2YSRA 1BYAA 2R6OA 5MENB 8ICYA 5CCGE 2LR4A 2PXYB 4BYHA 1Q3VA 1G7HB 4P9HH 5GNXA 5C0CE 1J9QA 2EJAA 3ZTJG 2QAFA 5ICYA 2GT9A 3C60A 2DI9A 1R5WB 1UD2A 2XG4A 2GUUA 3TYEA 5KG7A 1Y6KR 4D3CL 8A3HA 4BQNA 2ARJA 1SKSA 3B40A 1U36A 4O5LL 5CKSA 3NIGF 4HPYH 1F45A 2WKOA 3VI4B 5ACLA 1RM6C 4GFSA 1MEIA 3BKCL 3UBXI 4HZLB 4XD3A 2HHUA 4HJ1A 2CJUL 1IGTB 2KKQA 2D7TL 1Z1DA 2YMLA 1IE4A 6REQA 1SJHB 4B7LA 1HE7A 1KYDA 4P2QB 2QKIC 1F13A 3CYJA 4B6JA 9ICPA 3U9IA 1KGJA 3F7JA 2CNZA 3PO2J 3AT0A 1FWRA 4Y89A 3OIPA 1WKMA 2MANA 4PJ5A 4K8RC 2YAQA 4HCRA 5I0WA 3ALFA 2J1WA 2IGKA 2F4IA 2XYLA 1VIZA 2OMWB 3A13A 3TSMA 5JBFA 3MLWL 1XPXA 3QW3A 5REQA 3O3EA 3P0WA 4R7VA 1KQZA 3JPTA 5I5RA 5DQJB 1ZFJA 3V6ZB 2N01B 4NZUH 3OB0K 1WFJA 1FP2A 1T0FA 2GHWB 1K1QA 3ONCA 4PRPD 4JKMA 5AKEA 2Z7WA 5DWUL 1M7OA 3CO8A 2YQBA 2E1NA 4EN3A 4ZNEE 1QR4A 3GG0A 3O2DL 1FIGL 2PFPA 4AJ0A 3GI8L 2DQDL 1X6NA 4RUBA 3LQAL 2OSXA 1FKXA 4YZFF 3VCNA 5E7BA 4UNOA 1K72A 3IFLH 4OAWB 3BZJA 4JN1L 4PG9A 1CGXA 4R83A 1W9UA 1JZGA 3W07A 3MRCA 2X40A 2BVWA 1QNRA 3NJ3A 2DWDB 2IHNA 2PYFA 4A3MJ 1SFOJ 3GIVA 3RM9A 1S9YA 4XPHH 2P5NA 3BCDA 5IZ7A 3RWGB 3LZPA 4XMUA 1IEAB 3QJFB 5K1JA 1FP8A 3QN3A 5A3HA 3D2QA 2CO6B 5EULV 3ZQFA 4KKLC 1KWGA 1ONXA 3U0WH 4HYWA 3PDOA 4POZC 3MQIA 4G9DA 2PXYD 3I9GL 3L09A 3QDGB 1NFDF 4IC9A 4I6KA 2UWEA 4Y8AA 2QFRA 4N9OB 2NUYA 4CRXA 2EINH 4JTSA 2C71A 3QOMA 3NZQA 4Y5YB 5AC7A 4GQPH 4RFNC 1ZDSA 4Y4FA 4C1NA 3TVMB 3FF8A 4ZZLA 1LFBA 4NV0A 2B0MA 4J1OA 1X9MA 2KEYA 4ECYA 3UZXA 3U7YH 4DOBA 4HUUB 3GFYA 4B9PA 2XFFA 5F7UA 3DXAA 2MMXA 3OXRA 4XT1C 1DYSA 1VJZA 3F8CA 4R96A 4HBLA 3M1BB 2VBYA 4AQAA 1K5WA 1MWAB 3IG8A 4UOQA 4P2QD 4LRIC 1YTDA 2FQ3A 2RGLA 3GG7A 4HHGA 1NFGA 5F0PB 3OVPA 3U6WA 3SDDC 3NA4A 3NESA 3NFNA 1AZZC 1RDFA 2F5EA 3TXZA 4DF8A 5CIPH 3QORA 1B4EA 1NGWB 4IGBA 4YLWA 3KX6A 1YADA 4K1WA 3S6OA 3H8AA 2GAZB 4Q7IA 4PWJA 4YR6A 3MYJB 3L4ZA 3WNPA 2OFJA 3WYZA 4MJIA 5HDBE 1IBGH 2XJLA 4U2ZA 1MH5A 3QEGH 1YDVA 4R7OA 5TAOA 5JPNB 1B6AA 4HG2A 5LNVA 2BBFA 4OWRB 2QB0A 4OZIE 2O92A 1GL4B 5G4EA 3MBXL 3U7BA 3BFWA 3E3VA 1SYSB 2AL1A 8ICNA 6XIAA 2F68X 2JJTC 2FX8H 3UJ2A 1GJWA 1CG9B 3IKCB 1JR1A 3NQVA 3ZYJA 4UTBA 5L2KB 2Y06H 1Z77A 4PB0H 1QP1A 3O06A 4R5XA 1UWGH 4MF2A 1YTEA 5JORB 1IN8A 4UQIM 4BZ2H 2VDPH 4M6OH 4D9QD 3FIGA 4D5FA 3OZMA 1OIMA 4JV1A 4N1HB 2AXJA 2W9CB 1Q1PA 4HUXA 5D38A 2CLZB 3CIAA 1AA1B 5L8JB 3AKZA 1IC0A 4OJYA 2Q8BH 5HMFA 2D5VA 3OKLA 1T5KA 4HKXA 4S3GA 2BWDA 4UT9H 3QDGD 4FXGA 4NAFB 8ICVA 1L7TH 4YLCA 2PDYA 9XIMA 2D3LA 3PNUA 1QA9A 2R0LL 3P11L 5E2UH 5D4HA 5A0LA 3CUPB 5F7WC 4L80A 4Q4IA 3BDKA 1FYMA 4OIAA 1YJDL 4M7JH 1MF2H 1QOXA 1NDZA 3C1YA 5L1JA 4KPHH 3QYNA 4KHXL 2OBGA 1TQCC 3DOPA 4LE8A 5GGSY 4NJ9L 2IBDA 3R58A 4YVNA 1NKEA 4PCQA 4X0VA 3UAJC 2OGYA 4UOZA 4I0PC 4O3QA 2EDXA 3ATDA 2PO6A 3ID7A 1RD6A 1XMWA 3VWKC 3CAVA 4B92A 3SDAC 5GAGJ 3K1ZA 7ICGA 4OIPF 1FGNL 5HGDA 1PQZB 3QO1A 1T89C 1D5ZA 3VC6A 2CW8A 3GBNL 1BAFL 2EKGA 3I4KA 1JZ2A 1IZJA 3EHBB 3B7RL 5I1IL 2DQMA 4O1AA 2CJ3A 4J3OD 3R8RA 3I59B 2KJ8A 4GRLC 5C0AB 5LBSH 3HAEG 3TZVC 3K30A 1RALA 3MCG1 5DEFA 3ZLFA 4D9RE 4JR9H 3ULVE 4EEKA 4JFZL 3H0GJ 1Q6FA 5FCZA 2BSSB 4APQA 3BLKA 1R3RA 3EGJA 1OPCA 5BVJB 1SZGA 2AV7A 4XZUA 3P5ZA 2R0WL 3WFLA 1JGDA 4AC2A 4GY7A 2DT3A 2CK0L 1MLBA 4I18A 3RLSA 4DO4A 5JHLL 3FAXA 1SJBA 2VQGA 5CLTA 3DX8A 2VOOA 2W9BA 3TCTA 4XLCA 4D9PA 5EA0H 1RYSA 1UM4L 1GV2A 4C6IA 4E38A 1GGOA 3UMGA 2F54B 3ZT5A 4G7EA 1EJSC 4KLJA 1X4YA 3DKHA 2JV6A 1ZOLA 3DI2B 4OZFG 1GVEA 1NDWA 4H1ZA 2R2EB 5B4MC 1OCWH 4HXAH 1IIGA 3PIQB 3MNZB 1QLEB 5AHIA 2EA4A 4RT2A 2JSCA 2YUWA 3GFLA 5C4XJ 2YD7A 3IU4L 1D7KA 1JPTL 5CGYC 5HHIA 1FFOB 2ADIB 1UW9A 4DP6X 3WTSA 2KTQA 1PVNA 3BH9B 1CO1A 4OKVA 5DMIL 4NJGA 4OFVA 4FNLL 1K7EA 3OAYH 3CHEA 2ON3A 1QVOA 2UXFA 1GC1H 1KQQA 1P4UA 4UNKA 2E7FA 3IMBA 3RIRA 4XBFA 2XZQL 4UNLA 2P5WB 2PXIA 3ESNA 1SQ2N 1TTBA 1N18A 3CLOA 3W6LA 4WDTA 4GYPC 2Y7OA 4KCUA 2O9OA 1TTFA 2ZG1A 5DQGA 4A6EA 1FOXA 2O5YL 1WTLA 4WI2A 5F3FA 3KXQA 3HUJE 1JUBA 1JNJA 4JKPH 1B0RB 1YNKL 4NQDE 4MQ9F 1OK6A 3MAJA 1NEUA 3QO0A 1AGFB 1CI1A 3EHBD 1T41A 2RQEA 1XLAA 4YE4H 1IZKA 2HJFA 3VQ1C 2LYBA 3AMZA 1ZHKA 2HMIC 3OHXC 4AV4A 4QROA 4XNAA 2ATAA 2GEEA 3MKKA 5FA3A 1MMSA 2UXNA 3SAHA 5F1IA 2JIEA 4NZDA 5E6RB 2PGRA 5KFTA 3U4AA 3P60A 2WYZA 1UHVA 3TFKC 2RJHA 3QUZD 2J7EA 1JZ7A 3T5JA 5BROA 3OAWA 3FQNB 1EL3A 3WG9A 4OF3A 3VFOB 1E9OB 1I4FA 5KW9L 4Y19A 3P61A 1QPRA 2GQ9A 1GHCA 2HHXA 2K9FB 2VWEC 1KLUB 4JN6A 3DBXB 3GTLJ 2I57A 4IRJA 5HHOB 3H0DA 2FCBA 1NCJA 4ZFMA 5D7SH 1K5NA 4KMFA 1VPOL 2UVWA 2F54D 4IJ3C 4MNQD 5K1YA 1MRAA 3PPSA 3TTQA 3TJPA 3V6OA 2ENPA 4BHUA 5F2LA 5KVRA 3I02A 4UZSA 2N4IA 2ZAIA 1DBAH 1BQCA 4PGQA 3LZLA 5JW4Q 4D71A 1FL3B 2CU0A 5AW5B 5CLYA 3DTXA 1U8OA 5CB1A 2UZYB 3KOXA 5AHNA 2ICWB 3IIVA 5TISU 3FUIA 4QXUL 4QRPB 2PCFB 2WSYA 3MFFA 1TQWA 2H27A 1DBTA 1NP2A 4HIPA 4GFXA 3BOLA 1KEML 3IACA 5TE7H 2Y5TA 4Y2UA 2Y5QA 2GK0A 4GRIA 5K9JH 2CQNA 1YE6A 3UZZA 3CT7A 4HQVA 1YX1A 5DRNB 4BF7A 3CCYA 3VZYA 4I48B 2XWBA 5IY5B 3NIYA 3QDMA 2RRDA 1M7JA 3RURA 1JCVA 3DKWA 1PB0A 1NTDA 1ISZA 1SFKA 3DPBA 1FC3A 4R90H 5A2QZ 4I01A 5I1DB 4D6DA 4MSSA 1NANI 4BGLA 3VFZA 1WWAX 1YXCA 5FUCE 2WWYA 2Q7YA 2H6UA 5DQ9A 4P2RD 1Q4NX 6TAAA 1MSWD 4AC1X 5K9DA 2BWIA 5F96L 5F1SA 2K4EA 1HT6A 4GAAA 3QGAC 4OGXL 4HSHA 4NILA 3P93A 1HCYA 2CYYA 3F53A 2A4ZA 3DFPA 3HMWH 1P1ZB 5F1UA 4I09A 5GQBA 4JFPA 2X1QA 4WU7A 3QQDB 1LL4A 3APMA 4GSUA 4WNJA 1FHLA 4R7LA 4DJDD 1OHLA 3BZDA 4WAFA 1JV5B 5HHOD 1S5HB 4CZZA 1KYUA 1EXHA 2ZJ8A 1KSPA 4DW2L 2EIKH 2ODIA 4GAYB 3OJUA 2HZDA 1MPAL 2JE8A 2MH2A 4M1GH 1UP2A 1SB3C 5A2IH 4TQRA 3KZZA 4ENKA 4M5YH 2EH7H 1DQDH 4WO4B 5HTSA 4NHUA 4AT6B 2JK3A 4KNSA 1J7KA 5HMMA 3EYSL 4NN6B 1W15A 5AKTA 2AF2A 3L0GA 3LQQA 4GYJA 3BCJA 4HLXA 4KKZA 1QCKA 4D0BA 3BPWA 5LFAA 3MCKB 2LYAA 2X4UA 1EERB 3GKWL 1BW5A 4KVCL 1OJLA 2DM7A 2ESVB 4QLJA 4QRPD 3SD5A 3AW5A 5I66A 3MROA 4W6XB 3CPLA 3JVGC 5SWQB 2X6VA 5HS7A 1BCIA 3QNZA 2J1KA 3QRLA 2JK5A 1ZVYA 2X6UA 3FV9A 3LQMA 1W37A 4L9ZA 1V7AA 4UV9A 5G2HA 2RQ8A 5LGKA 3RLGA 4TNVF 4C54A 3PWVB 4BGDA 1PX4A 2AK1H 1NP0A 3GHRA 3OJSA 2VEFA 2O03A 1XBRA 3IIZA 1A5OC 3GS4A 4IL6U 3EA1A 3CJRB 1OSZB 3GNOA 2CG4A 3DURB 3N1MC 4YS1A 3GW2A 5E24E 2DL2A 5M5XJ 1TVHB 1B4FA 4ACZB 1D5BB 1FY7A 2K6WA 3AG3B 4WWKB 4HZ8A 2W60A 4H26A 3DTKA 1WP6A 1WAAF 2QW5A 3CLQA 2AMXA 3D5SC 3PUCA 3C87A 4DKTA 4QWCA 2YN4A 5GIRA 5BZWB 4YHMH 2JQZA 3D6NA 2HT3D 4OOZA 4AU0A 1QSEE 3H7VA 1PU0A 1NCCH 1OGAE 1SR0A 1T6MA 4FFYL 2DQ6A 3G6YA 1Y0NA 4JFXA 5AL8A 3MLUH 1G9ML 5DB6A 3FB7B 1RVGA 3TBWA 2W9EH 4G11A 5C0YA 1NCHA 2G0EA 3RUGA 2DV6A 1UYWL 2COMA 1TVAA 1NUDA 1B4KA 3W7IA 5AIQA 4HCIA 2DN7A 3FRPG 1KFJA 1JCLA 1QO0D 3HKZC 4TQSA 4RZCA 1IL1B 1U4BA 1KB3A 1DCEA 1OD0A 1DLHB 4YDLC 4KWWA 4CGZA 5ECUA 2DQHL 4A6YA 4Z7WA 1KLZA 1TJ2A 4UTKA 1ETJA 4MCNA 3E2VA 1BA9A 3WO8A 3GTNA 4WO4D 4RMWA 5JNYA 1JZ3A 4GSDH 4UB0H 2R29H 1Z0NA 2XH0A 2J56A 1ZE3C 1A6IA 3M6KA 1JTXA 1T7ZA 4XP6H 2YYUA 2JWTA 2OCCB 2IH8A 5CSZA 5B7MA 3C2RA 4X7CC 3JV6B 4AXNA 1GOXA 4ETSA 3WMQA 3CFEA 1WJCA 1F5TA 4UB9A 3WJXA 5G2WA 2Z31A 4PJBE 2FNAA 1NLBH 4UDUA 3C86A 3GIKA 5CINL 1FP5A 4REQA 4R8HA 3EYOA 1YKWA 3EJUA 4XOBA 4A3RA 1FDZA 4NN7C 4XMXA 9ICJA 5AOJA 5JUEL 4FYTA 1ODDA 2XZAL 2VDOH 2GOMA 2M2EA 2VOMA 4AZ6A 1KW4A 7PTDA 1RQNA 2BGCA 5HDBB 2KMUA 1BIHA 3PUDA 2O6FA 4MUZA 4JFFA 5AALA 4LSBA 4NRYA 3JWNE 4E9SA 3EGSB 2JQ7A 2PTDA 3S1XA 4HSOA 1A6UL 2QJDA 1FJLA 3QRHA 3AMCA 4TQTA 1BGGA 5EF3A 2PCEA 3I75A 2VUYA 1A7OL 3GR4A 4GW1A 4G9FB 3FGCB 2G5UA 3EWYA 4L5EA 5IP4A 4Y9PA 2W07B 5D7JA 5D1ZI 3PANA 4HA4A 5D1QC 1RURL 4RS8A 3ARDC 1RZ7L 3TIEA 4RGMB 4A39A 5GPRA 1OGGA 4TQEH 1WJEA 2YA1A 4PL2A 2XIIA 3TAOA 4DYJA 1T1WA 1OJXA 1JI7A 3NQGA 5AI0A 3ABQA 1SF3A 4NGHH 5KG9A 2YQGA 5D49A 4DK3A 3CL8A 1JCYA 4KVNH 1DQUA 5EFIB 5DXXA 3M7FB 5CJ7A 2G30A 1X5ZA 2HR3A 3OHMB 2C34A 3CVCA 4I1RA 1WA2X 1CGUA 1JPEA 3C5JB 4UT7L 6FABL 1AMYA 1MN8A 2PLCA 5A5WA 1D6VH 1UMQA 2WA0A 1P48A 3MB9A 2HVIA 3RBGA 4HU3A 3WK0A 2VIRB 4LSVL 4PMFA 2GQHA 4RFEB 2G50A 3HQNA 2XPGA 2XAJA 3KOOA 2OZTA 4JIIX 2R39A 2JF1A 1AIFA 1Z0XA 1F4HA 1R5ID 4C58B 5J0YA 3R0MA 5DO2D 3SI8A 5JLZA 1UP3A 1OGTA 3RITA 4JYFA 4RUCA 2R0ZL 1F07A 2GZXA 4K38A 4H5SA 5FK9B 3NEOA 1NH3A 4NQEB 1CDJA 3BQZA 1JCNA 1LLWA 2UY2A 5EU7E 5T33H 4KERA 4XX1E 3S3CB 1LROA 1TZZA 3GGWB 4P9ML 1V3HA 5CVJA 4RMUA 1ISXA 5CSBA 4FULA 2JXMA 3VNDA 4MEXF 3QXWA 5K5OA 3IJYB 1UC5A 2PC4A 4HU8A 4NQTA 1LQ1A 4PRRA 3PZIA 4W7UA 1E73M 1QO2A 4AGLA 5KBDA 2P66A 2D8CA 2DFAA 3HUGB 3EEGA 4B5ZA 1U58B 5JQHC 2V67A 4IMCA 4DVRH 1CLOL 1XGEA 2MHAA 4UB2A 3SPIA 5G5DB 1MNMC 1XO8A 1ZLVH 1QT1A 1R3KA 1M7IB 1JHFA 2QVHA 9ICBA 4IJBA 3MRBA 4TNGA 5KFFA 3VUSA 4UT6H 5GTIU 2XY5A 3OKNB 3TONA 3SYAA 4PUBH 3P0GB 3GS7A 5DCDA 3R5EA 1LUCB 2WYHA 2E5BA 3ONNA 1TEGA 3IT8D 3V8OA 4E9XA 3O2WL 3NARA 1FIQA 3AISA 2VPLA 1XD1A 2BMKB 5J1SC 5FECB 5L7XH 4F8RA 4G43A 2YXGA 3SXYA 4A04A 1LBLA 4DBEA 4YTQA 9ICLA 3BR0A 4ANXA 2DBJA 1UZGA 1H62A 4JZ5A 1F5SA 4NXZA 2EEXA 3D5OF 2W59A 1RZ8B 3FT2B 2PTXA 5J0TA 3IE4A 2RNGA 1AIZA 4Y4KC 3WJSA 2YCIX 1R5VA 5AC4A 2NVYJ 4QZAA 2XKUA 4L9LA 3WDPP 2UZKA 5TK2A 2FD6L 3WQWA 4F9JA 4WOQA 3H1CA 1AOHA 3H2OA 3CO4A 4LB4A 1IEBA 3LVEA 1NGQL 1VHNA 4A3FJ 1RZMA 1SXBA 4LEBA 3O6FA 4V19K 3C29A 1BXXA 1WQVT 1P1XA 2CCWA 4MZYA 5ICGA 1WFUA 4AJYV 5J1TC 4GXUN 3H5RA 4O4YL 4CMHC 3S6JA 1NGZA 4ERSL 3EF7A 2ZTDA 1TZAA 2DUAA 5C92A 3C6CA 2X8RA 3ROOA 2PRMA 1CTMA 2DV0A 4XORA 1O9WA 1U91B 2A21A 4DO7A 4YN5A 2HLFD 2FUTA 4DCQA 2LLKA 2R92J 4KDWA 3TR2A 3E5QA 1LNUB 3VZZA 1LK2B 2FLBT 5I6OA 3E5BA 4DSEA 2E7LC 1UT5A 5IW3A 2VDKH 5LGYA 2JZBA 3FKUS 2ID3A 3SHSA 1UC4A 4X8CA 1ZVNA 4RGOH 3F85A 1XFPA 2ZX6A 2IH3B 3MRDB 1RERA 2ZYSA 3GMLB 3F5KA 5M1TA 5C08B 3UJFA 2BP0B 4AWTA 3L4VA 5KFIA 4A8NA 1H5BC 3BWUF 5IEKA 2BFVH 3MLZH 4QR7A 3QU3A 3BICA 5J2IA 1PIFA 4ZA0A 3EJPA 1EEZA 2YN5A 2YS4A 1K5OA 1FHVA 5GNZA 3B97A 3CFQA 1LGVA 2G97A 4CQDA 3RR1A 4B48A 2E9GA 3VFVA 3OS2A 1TJIH 2YMTA 3TC7A 4TL5A 4AYEC 1T0NB 3RBEA 2PJRB 1E6QM 4BQ4A 1D3GA 1JROA 4XWOD 1ZV5A 4B5EA 2KC0A 1GEQA 3BR1A 3RPIA 2J57A 4FS9A 5I74C 4JYKA 2EYRB 4G8FB 5IR1B 2EF9A 4TOQA 3OIOA 4QXVA 2A6HF 1O57A 3KR3L 2M1KA 3MBYA 4Z3HA 1QFHA 4W4OA 2SFPA 2XWJA 2K8MA 1UVQB 5EBAA 4BQ3A 1T20B 2L9SA 4JK1X 5C0QA 5DHVA 1SMAA 2HCZX 4PRPE 3P3SA 1CQYA 2WY8Q 5JMRA 1KJ3H 1EDQA 4F0KA 1IC8A 2CLRA 3UR7A 1LVEA 5FKAA 1MNDA 3BWZA 1MCSA 1LO2L 4OBRA 4BWLA 3RTQC 4P5RA 5BMFH 4I02A 1V6YA 1S97A 1M2OA 3DMMA 3CVIL 4UB5A 1OCJA 3RYMA 3BCFA 2QGUA 3LMJH 1I3QJ 3L2IA 4DJFC 4OM1H 4D72A 2AQRA 5DTFB 3V5KB 1GONA 2QELA 4JBAA 3HSEA 1YS7A 3SY0A 1DBKL 1CIDA 1ORSA 3VUPA 3QFJE 1TTJA 1ZSDB 4DELA 1RULL 3ULVL 4GVFA 5LWYL 4I9AA 5ETUB 4KROC 4L37B 3TOAA 1NFBA 3SO3B 3OSVA 4EWND 3FXYA 4JMUA 1QLRA 4JHAH 3M0MA 1L5GA 3T81A 1XLJA 4KS0A 5MENE 4WD0A 2VC1A 5FEZA 1HHHB 5C08D 1A4JB 4PJFB 2VXSL 2V63A 2O9LA 5H37H 4KICA 1F8TH 5BQ7A 3S3DB 1W1A1 2ZIWB 2CBIA 4YEFA 2YD5A 2PP3A 2OM6A 3MRLA 4D5CA 1FWAC 2ZMEC 3T5HA 4LSQH 3BGMA 3BY6A 7ICFA 3SENA 4JM0A 3VVWA 2P3YA 3ZHFA 2E35A 4AIHA 4CC1A 1SJVA 1QNSA 1DGSA 3VI4E 1N3NB 2GVEA 1MQ3A 4CDHA 4Y0GA 4LIQH 3QCUL 4Q3MA 2FXAA 1FHDA 5AAPA 2BSTB 4Y16C 2Z29A 3BXNB 3GD1C 4PIRF 4ZUUA 1TZIB 1SJXA 4P2QE 2FZ3A 4JL2A 3QBTB 5D2WA 4XXWA 3FUEA 1ZQ1C 1OP3K 1D5IH 1E9PA 1N26A 3T1FA 5F1NB 1T5XB 1XMXA 1SXDA 3H9SB 5E95B 3TW7A 1KPUA 4FETA 3EJYC 3SSZA 3RGVA 1MA7A 3TKYA 1J8VA 1PCKA 5KTQA 3DBHB 3T09A 1L6PA 2AJZB 1UROA 2YQ2A 1DQLH 3ITGA 3TO4B 4W8BA 5HY9A 2ME0A 2VP8A 5K5YA 2HOAA 4MB1A 2X6MA 1HUVA 2E1MB 1NARA 4EX7A 2GCYA 4WWID 3QM3A 3U9UA 1QTWA 4P5MB 4KKBC 1MI5B 3QTGA 1KFAH 3KZIU 5F4WA 2DAVA 4JEQA 3HRTA 4YHYC 5LGTA 2VX7A 4POYA 9ICAA 3VI3E 4JKLA 4F3FA 43C9B 2IPTL 3HNSL 5IQ7L 2J7GA 4HX7A 2ZUVA 2R1KA 4RSVA 1AGDA 3C6LB 1BVKA 4JM2F 5J4MA 4POUB 3BP5A 3DKYA 1RUMH 3F3HA 2BNQD 1XSIA 4D9QE 2VDIA 1XH2A 4R8UB 1T1XA 3ILPA 3AM8C 2V7FA 3FDYA 3NNTA 2DPIA 1JN6A 2CDGB 4MJ2A 5DRIA 5HDQH 4PGZA 4TLUA 4RNRB 3R13A 5B1KA 2B63J 3LHVA 1EGJL 2EAOA 2Z4TA 5AKQA 1E9QB 1FBUA 2V2WA 4J4PC 3NVYA 4ZVJA 1JZEA 1E6PA 3OLIA 2VUOA 1HEJC 4J9QA 3QDGE 4WW2A 1WX0A 2XWCA 5D6EA 4MQVA 5B39A 3FDSA 3TV3H 3KZ8A 5G4WA 2JEIA 3QBUA 3VB9A 3KXFA 1FNNA 4G7YH 3TIDA 4UQBA 3FXLA 4F2FA 3BLEA 4UB1A 4I3SH 4DZ8B 1R8LA 2IEKA 3NJXA 3OZKA 1V77A 3D4ZA 4NAJA 2C1PA 1Z7LA 1WICA 3QY8A 5KAFC 3W2AA 1GKPA 4IYKA 1DJHA 3AG4B 5CN2A 1PCWA 5J6SA 1DQMH 3UJRA 3HFML 5C0CA 4KIRA 3SDCB 5KBMA 1KIUB 3SJVA 3S9DB 4A35A 3T71A 3W6JB 5F9WC 4JTJA 1E4KA 4RT3A 4G2AA 5TFSH 3H9SD 3W1RA 2VENA 5HSFA 1SOKA 1LB2A 1I53A 5D5WB 2FIKB 1KBGH 4MDIA 3THDA 1NCBL 1INEL 1S3KH 3NGBB 1X5HA 5IIJA 1P2CB 2RJMA 2TRTA 1RK5A 5GJSH 3NSMA 3TO4D 3R19A 3BWAA 4G7RB 1OIFA 5JPMA 5K9KB 1FO4A 2WN3A 3RY6A 5EEXA 1BZ9B 3US9A 2A69F 1GYVA 3ANYA 1A31A 2Q3ZA 4DFMA 1OQFA 4NJKA 2V6CA 1MI5D 2AXTC 5IKCB 5EY5A 2VA2A 3AXMA 2ZP9A 3E2EA 5K5RA 3H22A 2O3FA 2KIVA 2Z35B 1XLHA 5ALQA 4O1FA 5L2KE 1EJ8A 3F03K 1EGMA 3C6LD 2W6RA 3HKZF 3VDAA 3S1NJ 3Q6GH 1H0DA 4FERA 1CQKA 2F5AH 1HKVA 5AYZA 1UWEL 1VJIA 1SVMA 5HDNA 3EZ5A 4JVWA 4J8RA 3L95A 4ZNEA 2M9HA 2VKDA 1Q9KA 1WZKA 1OYAA 3EUKL 3QJSB 3DO7A 4LLNA 4OMYA 2DQTL 1WYIA 3QYCA 4I13B 4M7LH 1FH8A 1TU2B 2EEDA 5HJDA 4GGHA 4Q4MA 3MBDA 4AVNA 1YYMH 3S37X 3L3IA 3PSWA 2FGLA 3B06A 3H26A 3DF8A 3PFQA 1OPGH 1X5FA 2P0IA 4GBXA 5AW4B 4GQBA 4HJIA 3ULSB 5BXFA 1NJYA 2IANB 1UGNA 1KGXA 1J09A 3I1YA 4XMTA 3DV6A 5DJZA 2HK1A 2X4QB 2ZDSA 2K9UA 1PY9A 4HS6B 1KU2A 1PG7X 4IQLA 4QNLA 5DVLA 4KIBA 1GZHC 2R5ZA 3FRUB 5AKGA 3HGSA 2B5IC 4XN9A 2GB2A 7FABH 3TEUA 2FEEI 3SO7A 1Q85A 2Y8VA 3SUTA 1BPEA 3FQRB 2F9BT 3SDCD 3HC0B 2ELHA 3RDJA 5FWRA 4Q4ZF 1SXCA 2NY0B 1LKXA 2PLYA 5DJ2B 3T0EB 4JBRA 4A7GF 3G6AB 5J2CA 4Y6GA 4PWEA 2ZQ0A 3TBCA 2FGZA 4CZCA 1OYBA 4KI5E 4BHPA 2R8JA 1REIA 1KLNA 4XXDB 3LEYH 2UVEA 4J3VA 1V5GA 5EMUA 1B30A 2HG0A 2R7EB 2C3HA 4L4TB 4U5IA 3IWVA 5E94A 5E8IA 3QA3A 5C0AE 3ZN6A 1TV2A 4MCZA 5DT1L 3CAFA 1A5CA 4AGOA 3B6CA 5BQDA 2X85A 3Q9SA 2R7WA 4YPJA 4LVOC 1OB1B 1FH2A 4M6WB 2DORA 3APFA 4ASNA 4AYGA 3OQEA 4YHGA 1W8NA 3WJMB 1W0VB 5E6ZA 3WCZA 3FQWA 4IRIA 4UYQA 4PB9H 1AJZA 5EU6B 4ZODA 3JZYA 4DUOA 2R23A 2VM4A 3GMMB 3K8LA 1GG1A 5F7EL 4GCVA 1EF2A 1HA8A 1E9IA 2ALRA 3FCSB 5ADPL 1FSKC 3DGBA 3GFZA 2MRYA 2WQVA 4B9JA 3ZW3A 4OZIA 1JT6A 2F54E 4BWMA 4TL4A 4H0LC 2GWRA 2E7BA 2X30A 1A6TB 3QU7A 4N6QA 4GS7C 2WP3O 1OT1A 4LG0A 4NB5A 2KMDA 4IP5A 3TACB 4PMJA 3WL9B 2RD0A 4BXSV 1ESWA 4DF4A 4HLEA 1PKQB 3MJ6A 4ZR8A 3KEYA 5H91A 5ICEA 1AXTL 3TW6A 1X2NA 3Q48A 3AU6A 3G04A 5FUZH 2IAND 1KM3A 1X9SA 4YSOA 4PG2C 3K6SA 4Q4EA 5BS6A 3RNKB 4F8LA 3QI9D 4L9XA 4PUMA 5TDOA 4OVVA 3WN5A 3BZFA 1IGIH 4TSCL 1EZVX 1KEJA 5C07B 3UC2A 5BQTA 4G6AC 1D9KC 2P5WE 2J8HA 3QUXA 2ASLA 2A1WH 3BQTA 4I7ZC 1PZNA 1IGJB 5IEHB 2M87A 2QS8A 1DOQA 1A02N 1P43A 3BLPX 4WJXA 2XU9A 2HRHA 2LKPA 3ZQCA 4EDXB 1UXWB 1ZVSA 1X9LA 1GWJA 4AMKL 3H21A 3IUOA 3SGKA 2X44D 3RRGA 1A64A 3OKOB 3T0ED 1MIEL 5EJCA 1YMHA 1B59A 3RYPA 4XTRC 3PJNA 3ZPDA 3NOEA 4QHPA 1C16A 1ON1A 3KPSA 3T3PF 2Z00A 1X66A 2NY4C 5TQ2H 4C3JJ 4KN7X 4P46A 3Q2VA 4LCCB 1F5WA 4FFZA 3RAQA 2FH8A 3U25A 2QUTA 4YCPA 4YE0A 4XC1H 2CBOA 3CYMA 4RQ6A 1VFAB 4Q56A 1FWXA 3MRGA 1OTTC 2QQNH 5KSUB 4L8CB 5SX4I 2J5OA 1OB0A 1IBZA 3STBA 1HKKA 4FISA 3LFUA 2MOQA 3KHQA 2J75A 2V2TA 2HKFL 2K3TA 3H12A 4XKBA 2OP4H 2Q8LA 3LKNA 4HNCA 1A14H 4XAYA 2H0EA 1TJHH 4UV7H 4X5PA 1VFOA 4O00A 5EU6D 1IE5A 1CD9B 1HTIA 3GW3A 5FR3A 2WHLA 2IPQX 4GMEA 4PGJA 4BY3A 3UXDA 5DZNA 5ALGA 5E8PA 1L9SA 3CCHA 3GXNA 5AG9A 3W39A 5DMKA 5HHOE 1RZTA 1D5MB 2CW0F 2HQRA 4PGXA 1FG2B 3W88A 3VODA 4EVNA 4BJLA 4MLIA 1K4SA 1WISA 2ZJSL 2VXQL 2HX8A 2IOOA 3B4NA 4IS6B 3CIXA 1PFCA 2IWEA 4EANA 4ABUA 4IMDA 4MJ5A 1X9WA 2BC4B 5IB3B 4CCKA 2HLAA 4M9PA 4U3SB 4FTDA 4P2OC 5I1JL 4M72A 2QYGA 4RK8A 3LNHA 4ADUA 1MUWA 4I5XA 4L9NA 3PHQB 1Q1JL 4E42B 3HG3A 2BCVA 4BRVA 1DCLA 1MH4A 4W70A 2XM1A 3MA9H 4J19A 3J81Z 2PI6A 1T21B 3D3VB 4YHEA 2OZ6A 1VFCA 3U2IA 4QRPE 2Y1VA 3L1GA 4MYWB 4WSGA 1NLDL 1GSKA 2XACC 1PVPA 3LGDA 1JE6A 3B2PA 3LFKA 4M3PA 1WG3A 5D7IF 2JCWA 1KZYA 5F0LB 3P9KA 1W8OA 4LOCA 3JWOC 2CQKA 3MV7A 2ITDA 1W5PA 1KTRL 2FBRA 1F4XL 5F3HA 1NCNA 4NAQA 4TO8A 1BF6A 4FIRA 5D7LD 3TQKA 4JPKH 4IQJA 2VQ1B 1UIPA 5GS0H 2A7NA 1K6YA 3W3OA 5GGUB 4UCFA 4R3UA 3WIHA 2DDQH 2PBOA 3QULB 2BZTA 3AG2H 2LHTA 4NCDA 2YARA 1CXFA 4M48H 4NKDA 4MYPA 3VOJA 2H94A 1MFDL 4TLKA 1NIEA 4QZ9A 5I19H 3F4VA 2H0JA 1AJ2A 4Y9EA 3OYLA 3Q0HA 3VVGA 5J9PA 2IA2A 5JVLA 3TAKA 1L0QA 2ALDA 4KJPC 3HUJA 3U4EB 3LLXA 4AISA 4NQDA 1AD4A 3CHFA 1XIMA 1GHFH 4GPNA 3HX0A 1EOMA 5F4XA 2Z1BA 3GIZH 3SAGA 2CH0A 1K2DA 1UWQA 1ZQLA 1KFGA 1PZ5A 1TFPA 4X0KA 4EUPH 2L7EA