3HJEA

Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
704
structure length
704
Chain Sequence
b'MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDELGGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEEEKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRDYPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNKIGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDELVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNCSQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDKFHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKNDEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMFNNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPVVFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 704aa long hypothetical glycosyltransferase
publication title Structure of ST0929, a putative glycosyl transferase from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii str. 7
molecule tags Transferase
total genus 284
structure length 704
sequence length 704
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09196 DUF1953 Domain of unknown function (DUF1953)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Maltooligosyl trehalose synthase; domain 4 3hjeA04
1.10.150.200 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Maltooligosyl trehalose synthase; domain 3 3hjeA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3hjeA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3hjeA01
3.30.1590.10 Alpha Beta 2-Layer Sandwich Maltooligosyl trehalose synthase, domain 2 Maltooligosyl trehalose synthase, domain 2 3hjeA02
3BAWA 2PWDA 1ISXA 7TAAA 4S3JA 4A4AA 1HJSA 2VVNA 3VDAA 1QWNA 3MV01 2XFFA 1QVBA 4J3UA 1W1PA 3AFBA 1E56A 2Y2WA 1E0XA 1NM9A 1W9XA 1GPFA 3SCNA 3AMKA 3A5VA 3NUKA 3EJQA 4PCSA 1WZMA 2V5CA 1UQYA 3WD0A 3WQ4A 2ZICA 2CCRA 3U7VA 4AZIA 2ZUUA 3VM5A 1TZ7A 3CIVA 3VMOA 1TA3A 5I77A 4W86A 3WNOA 3ARXA 2A3EA 2X05A 5IXEA 5E09A 2EAEA 4OUEA 3M07A 1HKMA 4P7RA 4UFKA 3ZR6A 4GPNA 4R27A 5A6KA 2XJ7A 1LL4A 3K8MA 3PTQA 1E5NA 1VB9A 4FLRA 3UR8A 1C3FA 4CVUA 4M80A 3VNZA 3RM4A 5A1AA 1W1TA 3AHXA 5HOSA 3QGVA 3ARZA 1V3MA 3LMYA 2WVUA 1UH3A 1UKOA 1JD9A 1NOWA 3THDA 4MNKA 1V6UA 1E9LA 4CVWA 1JI2A 1WZLA 2J8FA 5M5DA 2WC7A 2VC9A 1BG4A 4D71A 3CUFA 2ALWA 1VBRA 3MO4A 4H41A 3OA5A 3FW6A 3VIGA 4FNSA 3WH7A 3ZR5A 5JBFA 3VGHA 2FGLA 1CGWA 1KTCA 4QLJA 4AW7A 3VVGA 3THCA 3GNRA 2GJXA 3GZAA 1HKKA 2CHOA 1E6SM 2O9RA 3BCFA 4XZWA 1PX8A 2EXOA 5FKYA 1XYFA 1E1FA 1PX4A 4RE3A 1RP9A 3CZEA 1C93A 2WLZA 4TXEA 1UUQA 5A94A 1JDAA 5CZKA 3UG3A 1CLXA 1EDTA 4GZJA 1JYXA 2WMFA 2XWEA 3VX0A 4D6CA 1ZJBA 2NSXA 1UR8A 2BVTA 4IPNB 1V0NA 3SCSA 3T0DA 3NDZA 3OZPA 2BXYA 4GI9A 1B3VA 1WNOA 3KL3A 1DEDA 4GXPA 1W2VA 1H4PA 1AMYA 3RCNA 5LA1A 5E1QA 4PBGA 3WIJA 3BAIA 1VEMA 4F8XA 1H0GA 3OB8A 1UR2A 1MYRA 1NP0A 4HOZA 1V6XA 3TOPA 4FK9A 4LX4A 5BRQA 3VIFA 1XC6A 3BMWA 2EBNA 1W9BM 1C8YA 3BC9A 1KQZA 4XB3A 1QNPA 3U5YA 2X2YA 3AIRA 2GK1B 1CXEA 1OBAA 2VUYA 4PMYA 4U3CA 1BHGA 1QNOA 4MNLA 5TD4A 2VMFA 8CGTA 2EQDA 2VRKA 4HMDA 2GJRA 1X6LA 2WZIA 1R47A 1CXFA 1CECA 1W32A 3CGTA 1B3YA 1AQHA 4D6DA 1KTBA 1W91A 2QPSA 1GJWA 1UD3A 4MTVA 2D20A 1TR1A 3WH8A 3KE0A 3BVXA 1E15A 1BYDA 1NARA 1W2PA 2F1AA 3WQ8A 4WSKA 4XUYA 1R85A 1OCQA 1CTNA 1M01A 3PN8A 2DSUA 1MW2A 3S5ZA 4CCCA 1JFXA 3N13A 4HU0A 1B3ZA 1UHVA 2YFNA 3SUUA 1DHKA 2PB1A 3VSVA 2WBKA 3WNMA 1J0JA 3EMQA 1QNRA 1KFWA 4Z2GA 2D24A 5FL1A 2FE0A 1BVNP 1XGZA 4CN4A 5I5RA 2ZIDA 4FLSA 4NZJA 1W1YA 3SCOA 4UQ9A 3W24A 1BFNA 3WQVA 4ATWA 1B90A 4JZ5A 3W4RA 3IAQA 4Z2HA 1WKYA 2ESCA 1VEPA 3A4XA 1TA3B 2EPKX 1KQYA 3TA9A 3MS8A 5BCAA 2JE8A 4GINA 3N17A 1PIFA 2J78A 2O9TA 3ECQA 5JBDA 3D52A 3N9KA 4AZCA 2W4XA 5FL0A 5AY7A 1J0IA 1SFSA 3ZMRA 1B0IA 3WEOA 2WHJA 2XM2A 2FHCA 1OGGA 4V27A 1Q6DA 5D9OA 1HL8A 3WD3A 2RGMA 1ZBCA 2F7RA 1E5JA 4IUGA 4PN2A 5AC5A 5CSYA 1US2A 1NWTA 4UQAA 2DT3A 4H04A 4QFUA 4AMWA 5I3DA 3T2QA 1FH8A 2QMKA 4CD7A 2G3NA 1QI0A 3EMCA 3WDHA 1V0KA 5DT7A 4PCTA 4UFJA 4KH2A 3QHMA 1H0IA 4UR9A 4YHEA 3AIBA 4DWSD 1Q4NX 4TX6A 2YA1A 1JXJA 2GJXB 3SUSA 4PEEA 1PX3A 3M46A 1IZJA 4IISA 1V3JA 3BUDA 4GZEA 4ZENA 3AISA 4ZE5A 4ZFMA 3EDFA 4DUWA 3VMNA 1UWSA 3BVTA 3GYCA 3SIMA 1PZ2A 3UETA 4LQ1A 1Z32X 1DWJM 5GNZA 5AC4A 1PEZA 1GQLA 3LXCA 2BVYA 2VTFA 4F9DA 3TV8A 1Y7VA 4D1JA 1CYGA 4LYRA 4M56A 1WDRA 2PWFA 3B9EA 1UKPA 4X0NA 4FNPA 3AS1A 2BS9A 3WN6A 4PTMA 2V38A 2WCSA 4J28A 4WKHA 1SMDA 4ACZA 1N82A 4GQQA 1BPLB 3U57A 3EDKA 2VJXA 4QCFA 3H53A 3ZJ8A 2E9BA 2YIHA 4DO4A 2W92A 2CEQA 4D6JA 3AIWA 2YKKA 1FHLA 4OZOA 1UZ1A 1E1EA 4NXSA 1DP0A 1BYCA 3WH5A 3OLEA 1ZB5A 1TQSA 5FD0A 2J74A 3VIOA 1E40A 1E6ZA 4D1IA 1GOKA 2XFYA 3TTSA 4UOJA 3WUGA 5HXMA 3BUPA 3AHTA 3ARQA 2ZXBA 4WSJA 3M7SA 4PTWA 2W63A 2FH8A 3L2MA 1XYZA 4V28A 3VIIA 4NF7A 4E8CA 5CLWA 1JNEA 1HKIA 5HPCA 3SUTA 2F18A 2WVSA 3MUY1 2W66A 2GDVA 2WXDM 1L0PA 2GDUA 5A2BA 2OWWA 1DWIM 2WM0A 3T0AA 1MW1A 2HVMA 4LYQA 1IZKA 4JCMA 5A2AA 1V3LA 2G3MA 2J7FA 4WJXA 3ALFA 1ODUA 2YBTA 3WFLA 4ZXLA 1ZBWA 3VX1A 3BLPX 1BG9A 2DIJA 4W89A 1HXKA 2W61A 3SURA 3MU7A 1QW9A 4AIUA 3EDDA 4MDPA 1E6PA 1CPUA 2PC8A 1DWHM 5ABHA 5EFFA 1XSIA 4UQDA 1WAWA 3AZRA 4XZBA 2XSBA 5HDRA 1FFQA 4JIEA 1VRXA 4TVDA 3VIJA 5CLTA 2PWHA 2HISA 1UD2A 1VEOA 1CBGA 4MDOA 3L4YA 1TMQA 4P8WA 4JFVA 2VZUA 1NWSA 3KLKA 2OW7A 2OYLA 1UD5A 2VX4A 1LWHA 1TCMA 4AZCB 4UOZA 3WQ6A 1J0HA 2YOCA 3KWXA 2CBJA 4CUCA 2WANA 3AROA 3S6TA 3VSTA 3FY1A 1OT1A 1CZ1A 1GQJA 2WHKA 3A6OA 1I75A 4UZSA 1W3JA 3AS3A 2D0GA 1HL9A 3NIYA 3WMBA 4D6FA 2ZX8A 1UD8A 3WSUA 4J3WA 3KL5A 4JL2A 3CMJA 1UG6A 1YHTA 3LPPA 1IV8A 2BXZA 1BQCA 2WMGA 4NXKA 4J3XA 1QX1A 1BYAA 5A69A 5JUVA 1CXKA 4AIOA 3QHNA 1EA9C 3CMGA 1G5AA 3OGRA 4WKAA 2GUYA 2ZXAA 4PMUA 4EE9A 4DWSB 5AYIA 4KWUA 4C7DA 3MMDA 1SZNA 1E0VA 5ABFA 3EJUA 2F7QA 3CZ8A 2GK1A 2WVVA 2ZE0A 1V0LA 1RH9A 3A4AA 4MB3A 2WC4A 2CBVA 1E73M 5DEZA 3W53A 1MQQA 3GM8A 1R34A 1C7TA 1R7OA 2XUCA 1D3CA 3BXWA 5EB8A 2J79A 2C7FA 2DT0A 2A3CA 2Y4SA 4S3KA 3HG2A 1CLVA 3UESA 1WO2A 3W26A 2Y8KA 3GH7A 3WL1A 2X2JA 4M81A 1EQPA 3AIVA 3MANA 1QHOA 3WD1A 4FF5A 3BAYA 2WHMA 1UWUA 1RP8A 4TOQA 3HG4A 1W9DM 1XSJA 4E2OA 3VD9A 2WPGA 4W87A 3PTKA 1UH4A 1J0KA 1D2KA 3IGUA 1GHSA 1O6IA 3WQ5A 1ZJAA 3ARVA 5D8ZA 1A3HA 1E3ZA 4HTYA 3WEMA 4BZYA 7CGTA 1LLOA 2DH2A 3WEZA 2QV4A 1BLIA 1UKQA 1JZ7A 2J75A 1Q6GA 4QLKA 3DHPA 1YQ2A 2YDSA 2VCBA 1K9EA 1HNYA 2WVTA 4LPCA 3SCTA 3VDHA 1MW3A 2OYMA 4U5KA 4M24A 2X0YA 2IXVA 1BSIA 2IXUA 1JAEA 1J18A 1GOWA 3CZGA 2D2OA 3CO4A 1R75A 5I23A 2VCAA 1GOMA 3DX1A 3B9DA 2EO7A 3D3AA 4OBSA 2G8ZA 3GH4A 2OWXA 4HMCA 8A3HA 1WPCA 1X6NA 3IAPA 3S2CA 1Q6FA 3EJSA 4JFTA 4NZFA 2DDXA 3NJ3A 1L8NA 1G0CA 2FYVA 5DF0A 1UH2A 1J12A 3BGAA 2EEXA 4EAMA 5EBAA 3SCQA 1OD0A 1V03A 1XCWA 1U33A 2ZX5A 2ZWZA 3L4ZA 3CV5A 5A95A 3ZT7A 5CJ5A 2VI0A 1A47A 3D4YA 1NH6A 4GIAA 4W8LA 2WKLA 3DX2A 1XH0A 2WB5A 1AVAA 1TVPA 3W28A 2UY5A 4D6IA 4D6HA 3FHQA 2XIBA 1JNDA 4W8AA 3W38A 2WNWA 1TVNA 1V02A 2E8YA 3LX9A 4TVCA 3A23A 4OOZA 1ESWA 1JXKA 1UD4A 3U5UA 2BVDA 4UFIA 1UR4A 3F5LA 1NWUA 2E9LA 1M7XA 3D50A 4TUFA 3RJYA 3WD2A 1VFUA 4FMVA 1QHZA 1JZ5A 3K8LA 3G6LA 3WF4A 1GNXA 1W1VA 4WLCA 4F9JA 3ZSSA 2CESA 2CYGA 4Z2IA 3WY3A 2D1ZA 3WDRA 4P7NA 1OM0A 1F4HA 2V3DA 1OB0A 1FP8A 4CKQA 4D72A 3CHDA 4EKJA 1JZ8A 1EH9A 4AC1X 4J7RA 1EDQA 3A3HA 2WZHA 1TG7A 3BUBA 2J62A 1E0WA 1OD8A 2CPUA 1KXHA 3ARYA 2IGTA 2BV9A 2A3BA 4W7VA 3GNPA 2BY2A 2JIEA 5BROA 1EIBA 4D6GA 4B16A 4NI3A 1KWGA 1BGGA 2X2HA 1UYQA 5A8OA 2JFEX 4W8BA 2PWGA 1EHAA 4OOUA 2RGLA 4MNJA 4JFUA 1IT0A 1KWKA 4HA1A 3O6AA 3AI0A 5ABFB 3GXMA 4PRWA 3WMCA 1JD7A 4GO8A 2X2IA 3CUIA 2WVVB 1EO7A 1B2YA 5A8NA 1ISZA 2YA2A 2X0HA 1DWFM 3CZLA 3J7HA 5LYRA 1CGUA 4BF7A 1KGWA 2WW5A 3B8SA 2EABA 1EOMA 3S5YA 4M29A 3T2PA 2XN1A 2ZWYA 3DYMA 1JZ6A 2D23A 5A6LA 4UTFA 2YLAA 1V3IA 3VILA 4N42A 4H8VA 2EJ1A 4X9YA 4MNMA 3VOCA 3VD7A 1UKTA 1WZKA 1HN1A 3M6DA 4JHOA 3CZKA 4UFLA 3L4WA 2BHZA 3BAKA 2TAAA 1FH7A 2OWCA 3RIKA 1GOOA 5GQBA 4DO6A 3VD5A 1K6AA 1JG9A 3VPLA 1R8LA 2ZX6A 1QNSA 1XSKA 2CITA 5D9MA 4ATDA 2D0FA 3CZJA 1WE5A 2JALA 3T08A 2EADA 4CU7A 3MSGA 1VFFA 4RL3A 3UG4A 4QAWA 4WKFA 4JHZA 1LQ0A 2CBIA 2A3HA 3PTMA 1EGZA 4CD8A 4TVUA 5CPQA 3DX3A 3DECA 5A6SA 4U5IA 4BCEA 2XIIA 3K8KA 1UA7A 3BSHA 1GQKA 4GZIA 4HPGA 2VNCA 2D3LA 2O9OA 2WZEA 1HF6A 4P8XA 1HJXA 4W5UA 4DUXA 3W0KA 3WY1A 4B9ZA 4C7GA 5I2UA 1LWJA 4AYSA 5CGTA 3U7BA 5HNNA 4JKKA 2E9MA 3AIEA 1EO5A 2D22A 3CHCA 1TQVA 3PZOA 4NSBA 5A8QA 2Z1SA 5E70A 4U31A 3EJRA 2DGAA 2NW0A 1MFUA 3VMPA 2BNJA 2O9PA 3VO0A 3AYRA 4W93A 3T0BA 4QDMA 1VBUA 2ZXQA 4MPKA 2WKGA 4E4PA 4NRRA 3GTNA 1WDSA 2JF6A 1TQTA 4B15A 3ZOAA 2PBOA 3VIKA 1OWQA 2VZSA 1GZJA 3SEPA 3DYPA 2CKRA 1GOQA 1JF5A 5D9PA 1HT6A 4BQ5A 5CG0A 1US3A 4DWSA 4AZ7A 1UR0A 4U33A 2J47A 6CGTA 1UASA 3W29A 4W88A 1QW8A 2ZX7A 3WUFA 5A2CA 3IJ9A 5BYWA 3DYOA 3VSUA 1UWQA 3PZVA 3HJEA 3GBDA 2JIWA 1H49A 4YHGA 2W91A 4DUVA 4PTVA 5M03A 3VKKA 2VX5A 5CPTA 1B31A 2F8QA 3O2LA 1TQWA 2AAAA 2J7EA 2VR4A 2CERA 3OGVA 1BAGA 2XVNA 1E70M 4JCLA 3CUJA 4DO5A 1EQCA 4HZ8A 3K1DA 4MB5A 4AWEA 4HU8A 3EDJA 3OG2A 3AMDA 5IDIA 2WWDA 3CH9A 3CBWA 1E4IA 1MQRA 1F4AA 3TTQA 4B3LA 3ZSTA 1CEOA 3WMSA 2WMHA 4B3KA 1K9TA 1E43A 2CIPA 2B31A 1KCKA 3VD4A 4W7WA 1G9HA 1JGIA 4NX0A 1UWTA 4JFWA 3A24A 3ARTA 1DTUA 4PTXA 4F66A 2GJPA 3BAJA 4AISA 2NT1A 3W6LA 1OSEA 3BVVA 4P7OA 1GOIA 1KR1A 4CGTA 5CXPA 1ISWA 1GORA 1VIWA 3RPMA 2AMGA 3K4DA 3NDYA 1GONA 3O9NA 3SUWA 1O7DC 1TUXA 5C70A 4CN6A 1V6VA 4M1RA 3I3DA 4JL1A 4UFHA 3CTTA 2X8RA 3PHAA 3WBAA 3T09A 1WCGA 1ZBKA 1J0YA 4PMVA 3SCVA 1DWGM 2ZUMA 1KBKA 2G4FA 3ZQ9A 3WUBA 4FNQA 3WKZA 3WBEA 3QHOA 1ODZA 2F2HA 4BQ2A 3BMVA 1G1YA 2BY1A 3GXPA 1E6NA 3N1AA 1Q6CA 2Q8XA 3OLDA 1R7AA 1D7FA 2J7HA 3AYSA 2ZXDA 5CQ1A 2XN0A 3WF1A 2QHAA 3MUIA 5BWFA 5D9NA 1LJYA 3OZOA 4H8UA 1E3XA 5GPRA 3GXTA 2D73A 2YLLA 1VF8A 1UD6A 4U2ZA 1UOKA 5EFDA 4PMNA 3WDJA 5E9AA 1I1WA 4H8HA 3POCA 1JF6A 1PAMA 3PZQA 1E72M 1UKSA 1E4NA 2WMKA 3MMUA 3UCQA 4CD6A 1CGXA 3OIHA 2PF0A 2J25A 3TTOA 1ZL1A 4N0RA 1KB3A 3HMCA 3F4VA 1VENA 2DSKA 4QCEA 3II1A 3AIUA 3N11A 4XX6A 1CXHA 4AD4A 5I79A 3MUZ1 4Y7EA 3FN9A 1QHPA 3AQUA 1XD0A 3DC0A 3N12A 2E40A 3WH9A 1DWAM 5BXRA 4V2XA 4AZBA 3TP4A 1PJ9A 3PZUA 3AICA 1P6WA 1XD1A 1MQPA 2F7OA 4PSRA 1VFOA 5A6MA 2UWFA 4J27A 5A6BD 2Y5EA 3FAXA 4W84A 1KCLA 2UY2A 4OKDA 1JAKA 2EPLX 2WK2A 2XFRA 3CHFA 2VO5A 3AS2A 3DHUA 3F5KA 4URIA 3LPFA 1U2YA 4JKLA 2X09A 3ZJKA 4FNTA 4WF7A 2WSKA 5CSUA 1CWYA 1W3KA 4L4OA 1OIMA 3EMZA 2OW6A 3NSNA 2EPMX 1QI3A 3PZTA 3W27A 4A3HA 3ARSA 3GXIA 5I78A 3OGSA 1JYVA 1HVXA 4LYPA 2JEQA 4FNUA 2XPKA 1BGAA 1R86A 4J3TA 4CD4A 2DIEA 3NSXA 2GVYA 1BVZA 1SR0A 2BHYA 2V3EA 4UZUA 4JFSA 5HBFA 1NOUA 1NWRA 2WHLA 1J0ZA 1X1NA 2OSXA 5IFTA 2FHBA 1Q6EA 3JUGA 1KBBA 3SCUA 3ARWA 1BTCA 3AIQA 2DT1A 3IJ8A 1V6YA 4HA3A 1XHGA 1NQ6A 3I3BA 4AYGA 1KXQA 3EDEA 3W82A 3MI6A 1QOXA 3BLBA 2YJQA 2F1BA 2W5FA 2D0HA 3DDGA 3UG5A 1B30A 3WD4A 2CETA 3LXBA 3HG3A 1PPIA 3A22A 1HJQA 5D4YA 3QR3A 1VAHA 5LA0A 6A3HA 3W37A 1OGSA 3CPUA 1H5VA 3AMGA 2VX6A 3VGDA 4BQ4A 1PZ3A 2E3ZA 3WDIA 1K9FA 3FHAA 2J7CA 4UQBA 2BHUA 2W67A 1MWOA 1E4LA 3IJ7A 4PUDA 2VT0A 3FXYA 1FFRA 2J4GA 3MKKA 2DSWA 4BS0A 1ITXA 4OIFA 4W85A 3WUEA 2XVLA 3B9AA 1JZ2A 2OYKA 2FGZA 3LRMA 3EYPA 2VZTA 1UWRA 3SCPA 4AD2A 3K4AA 5D8WA 2F61A 1EOKA 2YL8A 2CHNA 1CGTA 2WMIB 1CIUA 4AZ5A 4KMQA 1XRVA 3LXAA 5F7UA 3BVUA 4AD0A 3PZIA 4PMRA 3VD3A 1H1NA 3ALGA 3VIPA 2XSAA 2DSZA 4Z2LA 1E6QM 4PMDA 7A3HA 1QBAA 2CXGA 3AMLA 2D3NA 3KL0A 1V08A 4W7UA 1JZ4A 3A4WA 2WYSA 1V0MA 3WDPP 2WBGA 1RD6A 1XH2A 1JZ3A 1G01A 1FHDA 1ISYA 5I6SA 1W3HA 1ZS2A 4AZ6A 2J7GA 1M53A 3PZ9A 3LRLA 2XG9A 5A6AA 3L4XA 4FLOA 1R87A 4BQ3A 2VQTA 1E55A 1E4MM 1JI1A 1ZU8A 3RMEA 4UCFA 3W81A 4CN1A 1MW0A 3WQWA 3GXNA 4NZCA 3GXDA 3NYDA 2O92A 4X0VA 4Z2KA 2YDRA 4AEEA 1NP2A 1HXJA 3ZM8A 3G6MA 1J11A 2OSWA 3EJTA 5M17A 3PZGA 2JF7A 4GKLA 2G3JA 1B3XA 1VFMA 1EDGA 1CENA 2QPUA 4CU8A 1G94A 5BXTA 3OLGA 4P8VA 4UQCA 1LG2A 2CNCA 5ECUA 2XHYA 2AOSA 2YL5A 3L2LA 3ARUA 4HZ6A 4CCDA 4ACYA 2BY0A 3T2OA 5IHRA 4IPLA 3BH4A 3ZIZA 2G3IA 3VDCA 4TX8A 1R33A 4CU6A 1J01A 2ZUVA 3VGGA 2Z1KA 5BXPA 2XYLA 4K68A 1CXIA 3WDQA 2C8NA 3APGA 3W25A 1TE1A 1HP5A 1E71M 4MJ2A 2DT2A 2UY3A 3WNNA 3BLKA 2YA0A 3WY4A 1JIBA 1KXVA 1GQIA 1W3LA 3EBVA 4W5ZA 1ZBVA 5ABGA 2DH3A 1HTYA 4GO9A 4HMEA 5BXSA 5IHSA 1UQZA 3RJXA 4Q7NA 3GDBA 4AD5A 3CHEA 3RM8A 4BA0A 2OLHA 1JYWA 1CXLA 1HKJA 4KGJA 2QLYA 3LRKA 4KRUA 1R46A 3KEHA 4C7FA 4TTUA 2QF8A 2EACA 5LA2A 3FNDA 2EPNA 2G41A 5FCZA 3AOFA 3UERA 2UY4A 3D4ZA 2FHFA 5KZ6A 3K46A 1ECEA 3KLLA 2A3AA 2VR5A 3ZT6A 4P7LA 2PWEA 3MSDA 3WELA 1W9VA 3N04A 3HU7A 3D5HA 1H11A 2VX7A 3OBAA 2CBUA 1HJUA 2Y24A 5A8PA 5M3WA 5DMYA 1HJWA 1EHNA 3AHVA 4R5EA 3WL0A 4LGXA 4GI6A 1QI2A 3BSGA 3FAWA 1M03A 1JDDA 1C8XA 3OLIA 1WP6A 1LL7A 1KXTA 4MAZA 5FIPA 4UNIA 4EANA 4RE4A 1HX0A 1W9PA 5DO8A 3ZJ7A 3H54A 4HP5A 4J3VA 6TAAA 4OBRA 2V3GA 2ZUWA 3ARRA 1FOBA 4PMQA 2XGIA 1QPKA 3L4TA 2EPOA 1TQUA 5EMYA 1SYTA 4M8UA 4UOQA 2WLYA 1JYNA 1TFVA 2PBGA 1ITCA 4IM4A 1OIFA 3D51A 2WCAA 5E0CA 2V3FA 1S46A 3WNPA 4WK9A 3BUQA 5E6ZA 4B9YA 1GVYA 1GW1A 3BAXA 3QOMA 1PBGA 1CNVA 3TONA 5ABEA 1HVQA 1C8QA 4UFMA 4XV0A 4ZXOA 4HOWA 2YBUA 5HPOA 2V5DA 4JKMA 4YN5A 3CZNA 1C90A 3VU2A 2VZOA 1QNQA 3ZJ6A 3WF0A 4Q22A 1V02E 1W9UA 3PZNA 3BVWA 4PYSA 1GJUA 5AYBA 1XCXA 1HJVA 3AXXA 2VZVA 3MV11 2YL9A 3GXFA 3N15A 3AMCA 2PI6A 1OT2A 2J8GA 1WZAA 3A21A 1H2JA 2VCCA 2VOTA 2CKSA 5A8MA 1CGYA 1QWUA 2WMJA 4AMXA 1XV8A 1EXPA 4CCEA 1CDGA 1V6WA 2WWCA 2BY3A 2XVPA 3RO8A 4Z2JA 3HZ3A 3CC1A 3CLWA 1UA3A 4UQEA 2J7BA 3NSMA 2W62A 5E6YA 4QP0A 4AXNA 4ATLA 5DT5A 3CUHA 4PMOA 3BUIA 3VGEA 2ZX9A 3GNOA 4P8UA 3ZO9A 4ZEPA 4HA4A 1LF1A 5C71A 4YPJA 4PUEA 4CD5A 1UR9A 3AHZA 1LG1A 4JAWA 4KGLA 3SCRA 2E0PA 2QMJA 2VVSA 5IFPA 5I24A 3DDFA 3I3EA 1PS3A 5JBEA 1UZ4A 4FLQA 1BYBA 1WDPA 1RPKA 3W6MA 3IANA 1WDQA 5FOOA 1J10A 2XWDA 3WNKA 5JIWA 5BRPA 1U30A 1QI4A 4ML4A 4J3SA 4EK7A 5E0FA 1H41A 3AXHA 3UR7A 2E4TA 3NCOA 4KRTA 3WFZA 5CGMA 2OSYA 2BFGA 1LL6A 3SCWA 4AIEA 1SMAA 1AQMA 3LPOA 5A3HA 1T0OA 2WCGA 2J77A 1O7AA 2DEPA 4A3YA 4AD1A 4RE2A 3VUPA 2DQXA 4GI8A 1C91A 2DSVA 2WMIA 3E1F1 2XN2A 1UWIA 4PMXA 2XM1A 3VGFA 2VQUA 2J7DA 3WY2A 3QOKA 4L4PA 2WAGA 3KZSA 1I1XA 3CZSA 1C7SA 3DX4A 2IUZA 2XVKA 2FH6A 3VIMA 3F5JA 3TTYA 5JIPA 1JDCA 1QBBA 1HP4A 1MVYA 2MANA 3VNYA 3AHYA 1B3WA 3VINA 4F79A 3WF2A 1PIGA 3HN3A 3AS0A 1B9ZA 1JL8A 4U3AA 1GVIA 4OGZA 1VJZA 3HG5A 3VM7A 1KR0A 3PBGA 1GCYA 4MJ4A 3AZSA 1HWWA 4PSPA 1XH1A 3L4UA 1ISVA 2VRQA 5CPSA 1GHRA 2NT0A 2DPEA 4AZGA 1FP9A 2WSPA 3VIHA 3A47A 1CGVA 4HOXA 1FH9A 1KGXA 3DX0A 4MB4A 4E8DA 1HIZA 3EJPA 1WB0A 5I0DA 2XTKA 4M82A 3WF3A 3WENA 1AQ0A 4MAVA 2YDQA 1V3KA 3LPGA 5KEZA 1FA2A 2JEPA 3IK2A 4HZ7A 4TTGA 1M04A 3POHA 2VURA 3RM9A 4FNRA 3ZT5A 3N18A 4NRSA 2ZOXA 4AZHA 2FDMA 3AZTA 2ZUNA 3BCDA 5GNXA 3RDKA 3L4VA 4AD3A 1VJSA 1MXGA 4QLLA 4MB1A 2Y8VA 4H7VA 5A6BA 1UR1A 5GNYA 3SUVA 2YFOA 1K9DA 9CGTA 3GBEA 2VRJA 1QI5A 4H2CA 4LXFA 4WIWA 3RILA 3H55A 1OGBA 3VTRA 1KGUA 1E6XM 2GFTA 4P7QA 2XGBA 4AY1A 2WC3A 4HPHA 3WNLA 2YL6A 5C8BB 1H09A 1H3GA 3AJ7A 3MMWA 2ZUSA 3UEQA 4U2YA 1MXDA 1JFHA 2E8ZA 4PMZA 4AEFA 3GH5A 2F7PA 3PZMA 1B1YA 1V3HA 4ZE4A 2X1IA 1E6RA 2VL4A 1MFVA 2C0HA 1C92A 2ZUTA 3MUAA 4DM2A 4AMCA 1J9YA 1OINA 4D6EA 1NOFA 3VGBA 3WH6A 4DWSC 4MADA 4DM1A 4GQRA 4OJYA 3ARPA 5A6JA 1GUVA 3VDBA 3AXIA 4ACZB 5DFAA 2XVGA 3CUGA 2GSJA 1BF2A
chains in the Genus database with same CATH superfamily
1X9QA 1NBZB 3KLHC 5A2QK 4I3RL 3O3BB 1QVBA 2A83A 1ETZB 3GSVB 5DBCA 3AFBA 2Y2WA 5L6YH 1FMWA 1TVAA 4KBXA 4HYVA 1D7DA 4C5ZA 2EP6A 4XUGA 3NUKA 1F90H 4UAWA 4ZYEA 2E25A 2M7BA 5IV2B 2AQTA 1BBYA 4NB5A 4QGYA 2M5WA 5IR1A 2MUCA 3HDDA 2FUG2 3O4LB 2H32A 4XHQA 5FEZA 1FYTA 2EFPA 2PDFA 4QM1A 4R85A 1QLEH 1ADOA 4R27A 3DWTA 3GMOA 3C60B 5BOOA 1NANH 2QQ6A 1HXDA 4AQLA 4MDRA 3GG0A 4BWLA 4A63A 1GMIA 3W88A 1UENA 2DKSA 4ENED 5JW3H 3NSDA 1WUEA 3CESA 4NZRL 4MWAB 3OA5A 4N2BA 1QFHA 1FZKB 1T20B 3VNMA 1EZSA 3I7SA 3O45B 3ICXA 5E24E 5ERWA 1XYFA 3KLAB 5L4MA 4EQQA 4G8AC 3REVA 2LR8A 1JUSA 1I3GH 1PKLA 5E03A 4JRYA 1SO5A 4GACA 3PFRA 3LKNB 5D7IE 2FXAA 4KLEA 1XB8A 4LSUL 3KL3A 3EHBC 1LYQA 4XIMA 4DZAA 1WA3A 1F4KA 4I7HA 3HBPA 2WJEA 2RBLA 3TU6A 2VKWA 2YARA 5A3IC 4WOZA 3PB2A 3K72A 4BUPA 4BK8A 4YWGH 3RSNA 3QE5A 4G72B 4DKFH 3V2AR 2XC9A 1DQUA 2VWTA 4XMYA 1N48A 3IWZA 1SFXA 3U5YA 1PYFA 3QCVL 3GLLA 8ICIA 3OV8A 4AEOA 3ERMA 1QNOA 4MNLA 4GG6B 3W84A 4CYCA 2GJRA 3PWNB 3DP7A 4ODHL 5HMDA 4RRPG 1PKNA 3K5XA 1OK6A 2X1XR 4NUQA 2CIKA 2VHLA 2CHDA 3JAMK 1S77D 1O5QA 1OEZW 1KFJA 1DIOA 2C3WA 3WQ8A 4IRDA 1R6RA 4JJHA 1CTNA 2ISSA 2GDQA 1UHVA 1ASPA 5IFHL 4KTEL 3VSVA 1ZR2A 2AJUL 5CMAB 4IIQB 4YTRA 2PN5A 1KFWA 1A25A 1F1DA 5JIQA 4YR3A 1ECYA 5F4SA 2CA3A 4X6DB 4UYPA 2W0PA 3WKPA 3W24A 1BFNA 4KUZH 3FQ1A 1SJEB 2X88A 5L1MA 1HLVA 4K2EA 2XG5B 3C86A 1SO6A 4RGRA 2HKOA 2C14A 1H7RA 3HR6A 4A5MA 1BPBA 4N0BA 5IHLB 1J0IA 2G4EA 1RZ7L 5ALSA 2WHJA 3QU3A 4L1SA 2IHNA 4I2GA 2FHCA 1OF2A 1OGGA 2CW7A 3H85A 4V27A 4QHKJ 2A7BA 3O6FC 4QRSB 3BKJL 5I2IA 5C2GA 4TPRH 2Y22A 5ALTA 2CA4A 3RBDA 4YH6A 4PP2B 4YIQA 2PEVA 4UR9A 3DTXA 2WTOA 5F88A 1Y1VJ 3WHXB 4KLOA 4S11A 3GK8L 4H0EA 4EOWH 4I5BA 2JGYA 1J1PL 4IISA 5IHBA 3E2HC 3PG9A 5C0QA 1W8OA 5JHLL 1WKFA 2RKXA 3FT9A 3UO1H 2J5LC 1L9MA 1TNSA 4N1EA 4B9JA 4D2NA 3CXHJ 2QQKL 1WZ2A 4DLGA 3D33A 2CLEA 3PQYD 5B7FA 4KAQH 4QZBA 5DEFA 4W6WB 4ZRGA 5KSVA 1H9GA 4HT1L 4FA6A 5FF4A 5FM4A 1H1YA 5D4JA 4QQUA 3UXAA 2XGQA 1P5UB 1TQIA 1PFOA 5ALBL 3H53A 3NTCL 1PP7U 2J5WA 1LTDA 3HPJA 5JW4M 1SJHA 2DBLL 4PLNC 3MWCA 5MEPA 1TJXA 2ZJPF 4HWZB 3WH5A 4PJGE 4XKYA 2LLKA 1H7XA 4YTUA 4DYJA 2OULB 5EN3A 3ARQA 1HL4A 4D1QA 1G4SA 4XXDB 4Y8FA 4OCXH 1JNEA 2YXXA 4FE7A 4P2OA 2L5QA 1JCJA 1DIEA 3GEWB 3A0BC 1WX0A 2IO5A 2W66A 1ZXKA 3CJRB 4APQA 1JPFA 4QGCA 1YC8A 3DU0A 2MOGA 3ANUA 5ABTA 3SBWC 5CZVH 2HVMA 3N73A 1V3LA 3V6OE 3ALFA 1BM7A 3V0FA 3BLPX 4P5KB 1RUAH 2EJRA 1M1SA 1UPPA 1BX2A 3N3EA 1HKWA 3JZUA 1H51A 5ABHA 3HXLA 4UQDA 3AZRA 4XTRC 3MRGB 3WTUA 1WG8A 4MA7L 1AWCA 3HM7A 3CFBB 3SMVA 2HXOA 3VFNB 4QG9A 1ZKGA 1A5UA 5L6UA 5FGCB 4O3OA 1OZQA 1ACYL 5FK9A 1XD7A 5D4HA 4UT7H 1D1BA 2YOCA 5ALRA 2V5LA 2Z29A 5I7GA 1L6ZA 1OT1A 4C4KT 2WHKA 2H41A 1BJAA 3L7EB 4AIKA 4FXKA 4L48A 1I75A 5J89A 8ICZA 1C16B 2XROA 4IBTA 4B53A 2ZZUT 3HQOA 1TV5A 3CUOA 2B0SH 2XRAH 2VN4A 2NX3A 3U2JA 4EVZA 5B1AH 3C6LB 2P5NA 3HC0A 3CFJA 1ZGDA 2INZA 2L5YA 1TTPA 4DEPC 4QRRD 1VCAA 2OTDA 1H88C 3H7LA 3MMDA 2PLMA 4NQEB 4H4NA 1HXYB 5AC6A 5I28A 1A2YB 3ELAT 4YSUA 5E8PA 5LBSL 5SWSB 3GDKA 3Q05A 2J79A 7ICSA 2C7FA 2JFCA 2KZVA 4Y2XA 5IB2A 2FSEA 4OZFH 1EUAA 2FBHA 3LMJL 3UESA 3MZNA 3US1A 2R5YB 3IDUA 4TSBH 5LNEA 3I9GH 7ICPA 4ZO8A 2MABA 4F3FA 5J5DA 1VGKA 5DFTA 3V0TA 3EYZA 1GS7A 3UYIA 1S5IH 3FFCB 4Y5XB 4ILSA 1ZE3H 4RQ0A 1DQIA 8ICCA 8ICSA 3HMXL 4XAGA 4BDVB 1Q3UA 3DPDA 4HD9A 1AI1H 2RD0A 1UQSB 4HTYA 1WJCA 2PDLA 4PTTA 1LQ2A 3HAEB 1N5WA 3CWGA 1UKQA 5KG4A 3D0VA 1BPEA 1X5XA 2YDSA 2DCEA 4N0UA 1J5CA 5ICUA 1T3FA 5I5IA 3KPRD 1QFEA 1SR9A 2K3FA 5FKOA 1EEZB 1RPQA 2X0YA 4M24A 3RK8A 4NUBA 1XIBA 4H8WL 4XD4A 3B3IA 3BUYA 3R4DA 3RB7A 3CO4A 4WK2B 1OE1A 3DKHA 1BBJA 5KAQG 2G8ZA 1E67A 2IBGA 3L54A 3GHBH 1H8NA 1WBJA 1KM1A 2E2IJ 3GTXA 3OIOA 3FTSA 2B14A 5D6CA 2BVQA 2C3XA 5DANA 1IEBB 2FYVA 3MNWA 4S3EA 3OKLB 1A9EB 3LQLA 4FEMA 3GKWH 4DEUA 2NO5A 1BM9A 3B37A 4NC2B 4JKPH 5SV3A 1G43A 3DX2A 4PRIE 1AVAA 4N6RA 4QYAA 1GTNA 1U3HC 4LLDA 3QFJA 1HE8A 1MJ7L 5F96H 2CK0H 1PUFB 2A74C 3AFHA 4ODXB 1V9PA 3Q5FA 4XRCA 4XZHA 3WQDA 1O9VA 5TGBA 2OU2A 4ZYGA 2VPRA 4HBKA 1X4XA 2PDQA 1ZTVA 2IPUK 5DMGC 2RALA 4C6FA 3CHDA 5I09A 2BLEA 4XMXA 1I9RH 1XC4A 3HOWJ 1TG7A 2J62A 1E0WA 4DFHA 1OD8A 3OXSA 2QR0B 5GGRY 4B9PA 1MCNA 4ZAKA 2K4HA 3IGAB 1W3IA 4LL1A 4QNWA 3QJHB 3KUMA 4L8CA 5FFLA 4MSSA 43CAB 1NDYA 4X5WB 5KUKA 3AI0A 2OTJI 4X63A 4DYRA 1ZE3C 1IG6A 3FT2B 4LEEA 2Z7ZA 3RZOJ 1EO7A 5HDOA 2YA2A 1QACA 1QYGH 4TURA 4HKZA 5DK0A 2BGSA 3BYYA 4L1GA 1L0OC 3NPSC 2W9DH 1W36D 4MS6A 3BPNC 4N2CA 3M6DA 3CZKA 5JPNB 4I8YA 2WN2A 2PP1A 1YW7A 1HF0A 1JWSB 4MJIE 1Q7MA 2WADA 4G9FA 5AHNA 1XRTA 3GCMA 2A0NA 4CSTA 2D0FA 2ESHA 3EYIA 4RQ5A 3J81Z 4OQTH 3CCRI 1DE6A 2APXA 2BERA 5FFZA 1D5ZB 1YE4A 4ZW8A 5T3ZH 3CLOA 1I1AB 4HHLA 2DY3A 1JXSA 3IUDA 4L6OA 5CPQA 5F70A 3H3VK 3NH7H 1THCA 3H35A 1KN2L 1OFAA 4YU1A 2ZDSA 1GQKA 1U4FA 1S2AA 3O6MH 4N8VB 4FE3A 2Y0SF 1BZ7B 4BFBD 1XLAA 1YEIH 3U83A 1I1CA 4RISH 1F8IA 4XHJD 5I3FA 1TJIH 4FP1A 1VSCA 1V7NH 4MDIB 3EJRA 6REQB 3DXAB 3TADA 4AEIL 1XUZA 1JRBA 2FECI 3W7OA 4UB6C 4JHVA 2X6UA 4YVVA 3O05A 4EV0A 1YAZA 2AXTC 4NUPA 3RU8L 1GGCL 1UP3A 2I9UA 4OU1A 2J55A 2Y06H 3HGYA 3E6BA 1FHGA 4AYBN 2CXYA 4DWSA 2KSOA 4UDTA 1URZA 1DSFH 4UNTA 4PJAA 3WUFA 3N2JA 5GGQH 1R2SA 3P9KA 1A22B 4XMPL 3HJEA 5XIMA 5JR3A 2F54A 4YHGA 2ZWLT 1ADDA 3G1YA 1B0WA 3KAOA 3PWJA 2VR4A 2D6FC 4PJBE 4F2UA 4M9XA 5HODA 3WUWB 1KMGA 2XIJA 3ZTJH 5DD1H 4ZPTB 3B9KA 3EDJA 3AMDA 2FJ6A 4GXVH 1E4IA 5GJTL 1EVUA 3ZKND 3ZSTA 4KV5F 4N9DA 3JRBA 3WLNA 2E7BA 1KCKA 1A4LA 3FU0A 3NGFA 4KY1H 1IILE 2COBA 1VGEL 1OSEA 4WV1B 3JWDH 4NJ8A 4NAQA 4BCYA 5K9OB 4Y2OA 3UMNA 4YLBA 4XN1A 2AMGA 4JM4L 3W9ZA 1JPIA 2C4FT 1IGIL 1TTFA 3U0PB 2AV7B 4JL1A 5C2BL 2IGMA 4HDVA 2WB7A 1S6NA 1VZ0A 1LBFA 4LH8A 2VDMH 2V9PA 3ZQ9A 4NDMA 3OL4A 1QSFA 3KWSA 3OC8A 3UOAB 1A31A 2PCQA 4IKNA 2OZ4L 2F2HA 4AIBA 2EYSA 4FYTA 3GWQA 1P5VB 4WRLA 1R7AA 2QZQA 4P3CH 1TIWA 1E3OC 5EBLA 3I65A 4FJZA 4N9BA 3V3WA 3ZLHA 2DMBA 1VH7A 4R5TA 4A2UA 3FGCB 4ETSA 1X96A 1G7HB 1DANT 4ZDOA 5E9AA 3N2XA 1FPQA 4AL8H 1NBQA 2WMKA 2OQRA 4IRSC 4DJAA 4K5OA 1KXTB 2B6GA 2KT6A 3UP8A 2EO1A 1CXHA 3WIAA 5C08D 1K7FA 5BXRA 4TMPA 2ZIUA 3LK9A 1XD1A 4U1NA 3SYOA 5KFIA 5DC2A 1Z3RA 4K7PY 3M0MA 5A6MA 4J27A 2QCNA 3S47A 2NW2B 2D7NA 4RFEB 2F19L 4JFFA 4PG2A 2XFRA 4GBXA 5BO1L 3UAAA 5BNXD 1CF1A 2ZMEA 4BKLA 4XBSA 4O4VA 2E2JJ 3E3QC 2ZTDA 5EU4A 3W27A 3ARSA 2WZAA 3KHLA 3AAZA 4LYPA 3HVNA 1IQ8A 2CDEA 1LUJB 3O41A 1XGSA 3JWDC 4IMLB 3TL4X 2OMUA 4PFHA 4H9VA 1P7DA 1GT0C 2X4HA 2G30A 4ZS6C 3P77B 3MA9H 1U5VA 2ASDA 1J0ZA 4LMYA 3BJTA 2JIXB 1OR7C 3KPNB 3VC6A 3U7YL 2FEEI 4RQ3A 1EJRC 2AXFB 4U0VA 2B7OA 5FAGA 5J47A 3SADA 3UG5A 1XF4A 1TLHB 3HG3A 1GGOA 1AGDB 4HLYA 4PZNA 3RKDC 2GOMA 1L5GA 3EYFB 3MOAH 3LN5A 2P0OA 1T5WB 2W67A 1CF7B 4BSWA 1XINA 5BOJA 1MWOA 1E4LA 4ENJA 2UXNA 1XBZA 3ZE1F 1DBML 1FFRA 3LQQA 3MKKA 4MZ8A 3FYPA 2PJRA 2ZOKB 4XKBA 1KKXA 1UWRA 4TNVK 5KFJA 3EOYG 4AL8C 4BFAA 1ZT1B 4LOEA 4IIHA 1A4KB 2H8ZA 4Q8FA 3VD3A 5FO5A 2KHMA 1L9OA 5I1GH 2R8IA 2C3GA 2FMQA 1P0BA 3ED5A 3MV7B 3K9TA 1MWAH 1R6WA 2BLFA 3PABB 4CMHC 3ULAB 4EI6A 3IUHA 4D8AA 1NCCH 4DN4L 2J6SA 1WT5A 4HIXH 2WOBA 3EHBB 3AG4B 4RNHA 2Q2LA 1FFOA 2PS2A 4JFOA 3J7AO 1ISYA 2XJLA 2NVTJ 5HMFA 4D9QE 3DO7B 4DQSA 4F71A 3CSGA 4BZ1A 3DG6A 4I0CC 4UTIA 2V9KA 3DTEA 4DZBB 5K4ZA 2H7WA 4PB0H 8ICBA 1OTSD 3TAKA 2VDLB 2X4SB 3K1MA 3IDNB 4PLKD 1EUNA 2HVSA 4YIRX 2R7WA 2HQNA 4FF7A 3DMMD 3NQ8A 1YX1A 2BTMA 4K39A 2DDQL 5C0IA 1YEGH 1GYUA 1YYMH 3BGMA 1PCWA 4UQCA 1BIIA 1LG2A 3KM2A 3TDUC 4GKSA 1C1EH 1IC8A 3ARFD 4DFIA 4TNWK 3B2XA 4TX8A 1QLEB 1J01A 3MRHA 4NBYB 2Z1KA 4XPBH 2KRFA 3NVYA 1TWSA 4M8QB 3BLKA 2LK2A 4H1LA 3DG7A 4KMFA 3TR2A 5LKYA 5DQ9B 3HAEG 4CCLA 4B7LA 1MFDH 3R10A 35C8H 5L1JA 1FHNA 5DFVC 2OMZA 2ESVA 1JYWA 3NGBC 2QLYA 5L3EA 5D55A 1LT8A 3L09A 4X6BA 1WDAA 5DT1L 1KCRL 3LOCA 1T4WA 3B9NA 4XPHL 2R69H 3GTQJ 2A3AA 5D9SA 2OR8A 3U9UB 3IKCB 4JPVL 4NAMA 2A85A 2HJFB 4L3EB 3UTTD 1H63A 1EFXA 3HKZC 4QJ3B 2CBUA 5KBLA 2P3YA 4R5EA 5F0MB 3QW3A 4QZCA 1XBYA 5GJMA 2VC6A 2QDEA 4H5SB 2JLLA 2OJPA 4EPDC 1WP6A 4O0IA 1FSKC 3II2A 3QBTB 4LRNL 4UNIA 5T5FH 3W0WB 5GGTH 2WBWB 1QSVA 5F0PB 3ZJ7A 4PMQA 5CP2A 1QPKA 3ZTDC 1A14H 1TZOA 4ICWA 4L37A 4U1SA 3CAFA 4KTYA 4FPSA 1CCWB 1U58B 3IGFA 4ALAL 1LDSA 3GSOA 3G5VA 1GVYA 3BAXA 3FA4A 2Z27A 2YMXL 2HBVA 1C9WA 3E0JB 2AKZA 4HOWA 5HPOA 1BZ9A 2GGIA 1PQZB 1WZ1L 5B1JC 4AVOA 4GJTB 3RTQC 3QULA 1XCXA 3VYRB 3HYIA 3C3NA 2I26N 5B4MD 4RIRA 3JZEA 1DBKL 3FQTB 3PAYA 2AVFA 1H8LA 1H2JA 4LLYB 4GYFA 1ZENA 4ELUA 1BFOA 1XLDA 4YX2L 3L2VA 1J7VR 2CLRB 2C9SA 4Y5YA 3T3FA 1MDMB 2BE5F 1LO3H 1LPQA 3NACL 4QOKB 5EULV 4OVXA 4O0ZA 3HS0A 1PZNA 1LG1A 5IEHA 4HPQA 3UXOA 4DFDA 3V0WL 4XBEL 2OP4H 1UVQA 2HDDA 3ZDAA 4YSAA 3VWKC 1IEVA 3K2UH 3AXHA 3O4LD 4XPFH 3C2RA 1A7QH 3SJNA 5GAEJ 3UH8A 4CKVX 4AQEA 2PR4L 3TV3L 3HPXA 4PBDA 4Z3FA 1H3PL 3FB8B 7ICIA 4AQ1A 4NP7A 5CN3A 3EOTH 7ICVA 2W88A 3IKTA 2XIMA 3BR2A 3T6XA 4MQVA 3WIHL 5IT2H 1UA0A 1B9NA 2N01B 1UWIA 3PSVA 3IJYB 3QZWA 1YXYA 4L4MA 2AANA 4MWAD 1I1XA 2IAMA 2COQA 1EWDA 1X42A 5J1SC 4QNEA 3VIMA 4LRTA 4IRJB 4PP1C 3RWJA 3WQFA 2VJIA 4N8VG 4ERAA 3BO9A 1CVRA 1B9ZA 2QW5A 4N0CC 3ASNH 4U1MB 5KSAA 1TX0A 3L1OL 4M1BA 3AZSA 1HWWA 2NTFA 3ROUA 3C75A 3TBSB 3V4VL 3IN2A 2ZCHH 1ISVA 1FNEB 1K8IB 5HNRA 2NT0A 1OB1B 1UXSA 2FLRT 4R96B 1KFDA 3CJPA 3WE6B 3S6DA 1CE1H 5IW6A 4PB9H 3ISCA 2HE5A 3L65A 2DDBA 2Y23A 4LCIL 3UADA 1UWEL 2NVQJ 3AEVA 2GAZA 1V79A 2ZXCA 1BDYA 5DLFA 5EWIH 3QVQA 4DIAA 4IJTA 5F3HB 5GIRB 4M48L 2VOPA 3HW8A 1VA9A 1HE7A 2F6KA 4D7PA 4UF7C 4Z7NF 5I5JA 2JKEA 2XB5A 3WUWG 4BCXA 1H89C 4MCZB 1X39A 3KBMA 4LK4A 4WIWA 2FYYA 4UAZA 1ILSA 4ED8A 2GFTA 4R66A 4AY1A 2NAZA 4BXOA 5BQ7A 5KT4A 1T2JA 4TSAH 3CV6A 2P5WE 5FI8A 5J2GA 2WYHA 5KBDA 1SN5A 1I7TA 2BC4A 1JFHA 3L3IA 4WO4C 2F7PA 4DCQA 2VL4A 2R39A 2X4UA 3KCOA 5J13C 4JO3L 2QSVA 5E6UB 1K02A 4D6EA 4OZGB 3WH6A 1CD0A 2ZKMX 3WMPA 5AKSA 4OLWH 3HE7C 3R1GH 4EJTA 2FT8A 2VONA 3OHXB 1L2UA 4OV6F 2X41A 1MIML 5AZEH 2CD0A 4S1SL 5CIPB 3WEXA 2E35A 4B09A 4EACA 3TO6A 3SDDC 1XGEA 5EMLA 2WKOF 5INCB 3SOBL 1W9XA 1X4YA 4B4FA 5HGAA 4FI8A 5ETUB 1I7RA 3OKKA 3QPSA 3R25A 2R8SL 2GLKA 3SY8A 2NOYA 5DHYB 1UFUA 2GTZB 4TUUA 2VLLA 3VXMA 2QBYA 1UM4H 2MU2A 3WHE1 5I77A 5D70L 2CMRL 2QVFB 4IIZA 4DGUA 4KXCA 3U46A 2E6PA 2OMNA 5E94A 1VFAA 3H12A 1N61A 3MLSH 4LRSA 4J9JA 4N2YA 5EH1A 3EB4A 1BMZA 4M80A 3QIBA 2W60B 3PNVA 3JVGC 3QGVA 2V8ZA 3M0LA 4RGUA 1VQTA 3F12B 2HKHL 4Z7WB 3LCGA 4WHYH 2OKOA 4RMTA 3H9SA 3J2PA 2RACA 2G50A 3KBPA 3OVPA 3CFQA 3V5KB 2VC2H 2X89D 1TR7A 2OTUB 1J8HA 3P30L 2GTWA 3SJVE 1PX8A 4LCYB 3R19A 3TC9A 4G8GE 4PB5A 2WLZA 1C93A 5BNGA 4GRLA 5HDNA 3HE6A 1P4LA 2K4BA 2JK3A 1ZQHA 1G7IB 2CM6A 3ZMSA 4MD4A 5TIMA 3VWBA 1DEDA 2M1BA 1ZQDA 4ZQKA 1P9MC 1ZSDA 5KVEE 1VLXA 2XPGA 2E74C 4FZ8L 3PFYA 3TQ0A 1SXAA 4QRAA 4DGIL 3BCBA 2UXGA 2VGFA 4PMYA 2O5NA 3M8JA 1J86A 2EQDA 1IWBA 1HEKA 2VEFA 2YCKX 3KHJA 1VERA 5I1EL 3BLIA 3QIWC 1F07A 5DB7A 3D4CA 4AX6A 4PGHA 3DU6A 4URKA 2Z2UA 4UAYA 2WLKA 2V2DA 3EIFA 2XTSA 1YEFL 1Q72H 3WBYA 3GNXA 4YBLB 4NNPH 4XNMA 4C6LA 1IKFH 3MLUH 3D2QA 2FSDA 4P55A 1MI5B 5EEYA 4F0SA 3IK4A 2ISYA 2F9RA 4KF1A 1NIBA 3PPCA 1EZ2A 4HGKC 3TWCL 2ZRVA 3F4NA 1YECL 4CVXA 2ZIDA 3PDOA 5CBBA 5TDNA 3QW4B 1TWZA 3D46A 3B4UA 4MXVF 3VFOB 3DJTA 1YBQA 5G5HA 2HDWA 3K1NA 1ZV9A 3AZUA 4FQ1H 2GQ8A 3HOJA 3MZ8A 4A6DA 3UR2A 5FFXA 5JH1A 3EGDB 3RVXD 1WWVA 1FFTB 4IRZH 4X6AJ 1EEXA 2D7MA 3SENA 3DHMA 4W68A 4LL9A 1JWMB 1NGXB 2V7HB 2CAKA 3WD3A 2FGWH 4Y1AE 4NQ1A 3HKZN 2OO0A 5JIKA 4U7CA 3C6LD 1AHKA 3SN1A 4IMEA 5FYKD 4CO8A 1T89A 1F3DH 1LHZA 1FL3B 2HWZH 5DR5H 3E0VA 1S9XB 5CR0A 3ISPA 2XV3A 2KVSA 2KH2B 3W6JB 4NQED 3LI0A 2VDRH 3X2QB 2RCSL 2YDAA 2M1KA 5E8EA 4ECZA 1MFMA 3P02A 5SWSD 4ZZLA 1EQWA 3W72A 3W56A 3LXCA 1FJ1A 4FQQB 4V19K 2Y3AA 5J12C 3VACA 4F1ZA 2FPKA 4FNPA 1A36A 3H3ZA 4UNVA 2BS9A 1HW6A 3FFCD 2XH2A 4FP8L 3WN6A 3GSNH 5CHNA 5CVIA 5DGRA 5AZ1A 1G6RL 4Q4SA 4C6JA 4GQQA 4LC6A 3DNKA 2E9BA 4FDWA 3HX0A 3DEUA 4LU5H 5JYLA 4Y0GA 2HT4D 1FUNA 1LO5A 3QORB 1DP0A 4JGNA 2IDQA 3BR3A 5GRZA 3C28A 3MRKA 4F37F 1E6JH 5HGDA 2YX8A 3LL7A 4IHOB 4QDWA 5IB5B 2UWEF 3RGTA 1RUSA 3L2MA 1WBYA 3QUYB 2HVQA 4IIDA 4A3JJ 1MSSA 5HPCA 5TE4H 1J8SA 2F18A 1O3TA 4Y8AA 4R0LC 2I32A 1FRBA 4Y13A 3KS0J 3QH2A 1A4JB 4MKSA 3FOLA 3HC4H 3VXSA 3VA6A 3FMRA 3V4PH 3FM3A 1KFTA 4I1PA 4JY9A 5JI6A 1FC2D 4Z0BL 4MDPA 3VH8G 4WF2A 3ARBB 5EFFA 3BSZL 5T1LB 1QNZL 1T21B 3CAWA 3QYEA 1QQDB 1RL1A 3QJFB 1I4FB 1G87A 5C5JA 4MO7A 3RHGA 5IQ7L 3ZQFA 1ENHA 1J0HA 1VD6A 2L0DA 3K4BA 3FY1A 4GRWH 1UG0A 2P81A 1DU0A 3G04A 4AX3A 4EI5B 4LGPB 4YXMA 2VITA 4ELMA 4P1WA 3QDGE 4UBDC 2HSZA 1UOZA 1NUGA 3B4NA 4QHRA 2AERT 3QFWA 3LI1A 1E28A 4EE2A 4M4RA 4JFHD 1HQTA 3H3PL 1FIQA 4XNYH 1HHKB 3F7VB 3DN5A 5CPNA 5I3KA 4IKIA 4Q45A 1EA9C 5DJYA 5FYKL 3QPTA 2ILLA 3DG3A 1EBGA 2L0KA 2OSLB 3Q2NA 5ABFA 3BWGA 4PJ7A 2VDMB 4Z7OB 3ABGA 3B2VL 2WVVA 2EIBA 4NFBA 2B59A 2EZ0C 4Z0JA 4XAFA 2A4EA 2HLFD 1C7TA 5EFIA 3GTIA 2QKMB 2C91A 2Q6WA 5M5YJ 5C55A 1CFTA 3PHQB 1CT8B 1ORSA 4UQ3B 4D7NA 5J5RA 5IJVA 3ZMNA 5FDWA 3Q37A 1UWUA 2OMWB 1XSJA 5FGBC 5C07D 2ALAA 1RPUA 1UH4A 5D2NA 4OQVA 1DTNA 5CNHA 1Z3EB 1ZJAA 2GWSA 1UHSA 3PGFH 5D7SL 3S1WA 3OP2A 4AVKA 5G2WA 1I1AD 5IJKA 2MCAA 3UAJD 1OEPA 3TC3A 4KISA 2WVTA 4LPCA 3HOYJ 5FB2A 1U45A 5FF7A 4X3ZA 1GOWA 1URLA 1F1ZA 1WCBA 3X3GL 3FYOA 2EO7A 5F9OL 1ODDA 3SO3B 4OBSA 3EWWA 3DXAD 4HD5A 4RSYA 1R3JB 3G5YA 4AVPA 4JFTA 4K38A 2EE6A 2DDXA 5C6MA 3KEYA 4TLSA 5AM0A 1TK0A 5L2KD 4G2AA 3FULA 2Z16A 1BGXT 5EBAA 1KYOJ 3ZDCA 4ED3A 1MW7A 2X4RB 2XGZA 3B8WA 4BK9A 3MR3A 5C0EB 5EGRA 1ZY9A 2J8UE 3BDDA 1R1VA 4LCWA 4O1FA 1BECA 1OAUL 3D0AA 3O3EA 6ALDA 3QH3A 5GGVH 1ZHKA 1Z2KA 3LX9A 1EJOL 3PP7A 5EO9B 4MNHB 3C2GA 1G9NH 1FX6A 3W1MA 3VFSB 3CIAA 2A4ZA 3S9YA 4LBAA 1ZQAA 3SO5A 4WUUE 2NSQA 5GRVK 4D72A 3TNBA 3LYSA 2YPLE 4YELA 1FQ0A 4IQUA 3SYCA 3GNPA 4EN3A 1T5AA 4HA8A 2VWSA 1WH0A 3P9LA 4G1MB 4EELA 3QFDB 3ONCA 1OSPH 2HLEB 1YTEA 2EDNA 2LHAA 4FASD 2NY6B 2W1OA 2DWTA 4HSTA 5I0YA 4TQSA 1CGPA 5CBEA 3LS5H 4A6YH 1IC5L 1HWHB 3N6QA 4DIQA 1HDPA 4UTFA 5J0BA 2AITA 5E6IA 1MWAB 2V17H 2RQ5A 2OWCA 3CSTA 3GLZA 4FG4A 4O5VA 3VD5A 4WFGD 4HZAA 1JG9A 1R8LA 1YMHA 1QNSA 1BJZA 1Q9WA 4S05A 4EZMA 3W2MA 1RK1B 3W9DA 3YPIA 2F77X 2YCLA 4F7CB 1M7IA 1KYUA 2QTEA 4X61A 5IRPA 2GEQA 5C2UB 4CD8A 1RURL 1V55H 4ZTPL 4IOCF 3DECA 2E7LC 4GY0A 4U5IA 3SE9H 4TQIA 5LHDA 2JK5A 3B2UD 3NVTA 1NLBH 1XUUA 1RZ8A 3HFMH 1Q0YL 3UDWA 4H4IA 3OMZA 3MJ7A 3D6GA 4LJ3A 1AG0A 4JKKA 3T5XA 2IGLA 3GVGA 1FY7A 1DGWY 5A8QA 1CRXA 4XBKA 4RFOL 4Y52J 1MFUA 2IW0A 5L4JA 2CZ5A 2PKEA 4ZX5A 2HTJA 2KQNA 4ZPVB 4N5ED 1TAUA 1XX1A 4IGBA 1NMAL 2DQUH 4I7ZC 2BPFA 4U1GC 1OWQA 4L9NA 5FYLH 4H01A 4EF3A 2B1AL 1FFVA 4F0KA 1F11B 4Z7AA 3DYOA 4N3TA 4IMFA 1IXCA 2COVD 1QBLL 5I6XC 3MJ6A 3OMAB 3KFUF 3FZUC 3F8CA 4F2EA 2CERA 1HC1A 2JIXD 4KZDL 3GIZL 1IWAA 1EQCA 4BA8A 3MUCA 4MB5A 2Z24A 5EEWA 3ROLA 4HQQH 3OG2A 4MYAA 5FR3A 2B08A 4R9OA 2NYVA 1CFSB 4HQMA 1S7SA 5E8GA 3QDHA 2VOOA 4I18A 3ZDYE 2JRTA 2IFGA 3EXTA 3QV7A 5CC5A 1RBAA 2I5GA 3WLJA 4H00A 2HDOA 2H1LA 5T3ZE 4HSRA 1U8JA 3BLFA 3W1LA 4LF2A 2VXQA 2DZAA 1S7QA 4DS4A 3TEYA 1N0LB 4KDTA 4PJGB 2QCDA 3D7PA 5CJ7A 3PYCA 5F21B 2ES6A 5K9JL 1GGTA 1O7DC 3N4MA 2QBWA 2X8RA 1XZWA 3T5KA 2VLAA 1U8OA 2BASA 1WCGA 3VEPA 3GDCA 4QRBA 4MRCA 3L0NA 4FQHA 1U8IB 2WD0A 4XX5A 2CLKA 1RBOB 3L95A 1I3UA 1A9BA 1MJUL 3SPJA 1AE6H 5JMOC 2JA8J 1RZGB 4MXQC 3MV7D 1GW9A 3M44A 1YS7A 4IQDA 4YHLL 2A77H 3RH5A 2LSOA 2ID5A 2ZXDA 4G5AA 1FP2A 3DFSA 3GILA 2QHAA 4UB6U 5BRZA 2VLKA 2HVIA 2DMHA 2AQ0A 1S0NA 4W9FC 4OLYH 4OV9A 1K7XA 2FIQA 3FSZA 2HT2D 1SQMA 2CDGB 5J6GB 2VJ0A 3I50L 3WDJA 2ZKYA 4NI6A 1YPZA 3OX8A 4L0ZB 1RUQL 1KBLA 4ZK8A 4AUYA 2IPUG 1EF2A 3T8QA 3TTOA 1AXSA 3EYYA 4DL5A 4JO5A 4U1HB 4O17A 4BE0A 4CCNA 1Y5XA 5EORH 3AIUA 1NCOA 2NVDA 5FUOH 3MUZ1 4EUPH 1M7UA 3E3QE 1BOYA 3TL5A 2E1WA 2AI0L 4HEMA 4XOBA 2F7OA 4TUKL 3LS9A 2K4PA 3SCMC 2KZWA 4GW4B 1JAKA 1PWMA 3QUXB 2WK2A 3KCCA 1ZQZA 3JRFA 2Z31A 3QLDA 3IU4H 5AIAA 4E5TA 2K02A 4EXPX 1W3KA 4K4GA 3OYXA 1YEJL 1SKRA 1YYAA 4W4OA 2W85A 1OX5A 1UB6B 2XXGA 3CZFA 4OM1L 4LIQE 4RGOL 2AO9A 4P46B 1B57A 4IMCA 3GU1A 2YC1B 1NOUA 1KELH 2OT0A 3JUGA 5DU7A 3N85L 3ATAA 4J2PA 1NANI 4GI4A 2VB5A 4RSVA 2ZC8A 3Q7JA 4TUOA 3K5SA 7ICLA 3ASNB 3WD4A 2WLHA 1HYSC 1RY0A 2R9RA 1PUEE 4PRTA 5HI4C 4OFCA 1QO2A 4PS4L 3W1PA 1R3TA 4BZ2H 1JV5A 4L3ED 5HDGA 2HJLA 2JJSC 5KVEH 5J1UA 4UQBA 5F64A 3W9EB 2F5EA 3Q0HA 2F8IA 4CC4A 4O4WA 4JQAA 3H4GA 3B40A 3IGLA 3VTAA 2DSWA 5IY5B 3W0WD 4S0HA 1D5XA 1F6AA 4JEQA 3KWTA 2DA4A 3PREA 3FVMA 5AW6B 4GYBA 3K4AA 3TU9A 3PAVA 2APWA 3B0VC 3IJHA 2XLLA 1UC4A 4X4YA 4B5EA 4TSCH 4NIKB 1S9HA 3CNHA 1I2RA 4R9XA 2WV8A 4M7SA 4YTSA 2GKIA 4PLJC 4BACA 1QPMA 3M7DA 1F76A 4OD2B 3ZTJG 1AZ2A 1XIWC 2PNDA 2QELA 2RNGA 5D38A 2FTYA 2I07B 5L2JB 4PRIB 3CMMA 1NEZB 1HKLL 3SN6N 4AQ8A 3G5XB 1X1CA 1KFBA 2P5EE 4ECXA 1ZS2A 4ZXBC 1LEIA 4K3ZA 4LRIA 1UYWL 4ZYKA 3N2OA 2XG9A 1KTRL 5KINA 1KPVB 3VCLB 2H2PC 2AL2A 3KP6A 1E4MM 3TMOA 2J88H 4QOKD 2VDLL 1UT8A 2XTJC 4OIAA 3L9EA 3ZBMA 2Y1JA 3EWXA 3T6VA 1TWHJ 1RJYA 5EF1A 1PJWA 4US8A 1I7UB 1CENA 2LMDA 5L6YL 4HDIB 3LWFA 3QHTC 1NSJA 5TF1H 2RA1A 4POZC 4PCKA 1F90L 4J2MA 4LLNA 4KFZC 4OU0A 5I6PA 3ZX1A 3TEZA 4PFOA 3L2LA 2IOFA 1ADSA 3ET9F 1BOBA 2ZTKA 1CK0H 3QCUH 2PRMA 4EBDA 3EBHA 1QLEL 4WI8A 2AABL 3MSYA 4WEVX 4FHKA 5DJCB 1MMFA 2I1QA 4HWNA 2EINH 4IKLA 1T66D 1H62A 4JXCA 1B72A 4XAKE 5BXSA 4MJIB 1I0DA 2XI9A 4IRJD 4NSKA 2G0EA 2EA4A 3LNMA 2A4AA 4OQ1A 3CMOH 4F1SA 2HDCA 5EMMA 3UY8A 5LBVA 4W9KC 4A04A 3V6HA 3NQBA 4QQ3A 1OV8A 5HANA 4ZUTB 1Y0LA 3QXTA 1SZGA 3HU7A 2I9EA 1DXSA 5IHUH 3BZCA 5TE7H 1X66A 1QI2A 4G8IB 1S1RA 3ZD8A 2XYCA 4PRAA 2EH8L 5E00B 5DO8A 4J3VA 4KT6A 4R4NC 3JPTA 3SAGA 4PJMA 2PYEE 3W7NA 2BQ3A 2WXIA 4NZ8A 5HDKA 1TQUA 5EMYA 3HUJA 5CSRA 2PBGA 1OIFA 2DKMA 3W7EA 5E0CA 4MQXC 2BGWA 3K4NA 3WLTA 2XY5A 3Q94A 1FWGC 4NN7C 2XRLA 3HB3C 3S9DB 2YLHA 4XLFA 5KYXB 2NQ9A 4IU3B 3BH8B 4O53A 3LGGA 1YFHA 1JNHA 1Q6LA 2QJJA 4AM0B 2LKPA 4BH9A 3GJEB 1MQ3A 2X38A 2UX6A 3ZKMD 3CUPB 4QX4A 3KFWX 3MWMA 1CGYA 4PJBB 2IOIA 5CF3A 4CCEA 3NJJA 2A1JA 1U42A 4UQEA 1E9OA 5DT5A 3W5NA 3ZE2B 4OIOF 2DW7A 3V7KA 2OCCH 2ENYA 5L1KA 3NA9H 2I85A 3HCVB 5CEYB 2QMJA 3DDFA 2EV5A 1W5CC 2KZ1B 1F61A 3VUSA 2XGPA 3TT3H 1U30A 2OTWB 2IH8A 5HHQB 1OYBA 4GK8A 3ZKSD 1HHIB 2ZXJA 1T6MA 5HNFA 3BUVA 3MO1B 5LSMA 3S2JA 4KUCF 1OXYA 2IS4A 3ORJA 4CSSA 4A12A 2W9AA 2QSQA 5E8NB 3GZOA 2WCGA 3VUPA 4TPRL 1CG9B 4XCFH 1IDYA 3MPGA 4C56E 4JEGB 3W7MA 3B2DC 1D0YA 1NCTA 2G0LA 1DVFC 2GSGB 3M7OA 3HRDD 1MDRA 3QOKA 2D2HA 1C7SA 1QBMH 2CZEA 4H4KC 1KN4L 3PW2A 4EOWL 1RUKH 1QBBA 4KCUA 3E74A 1JZGA 4HG2A 4A8RA 2R29L 2NYZA 3ETTA 3VTMA 1MCPH 4AXWB 3MYPA 1TWGJ 4B9IA 3ZVHA 5ALQA 3ABLH 3GMPB 2VT3A 4BF9A 1LNWA 4IPIA 3MYOA 2DQCH 2DV0A 4PC8A 3MKYB 3B9VA 2H3ZA 1AJZA 2ACRA 3URNA 3GXOA 3IGKA 2ARJA 1UJ8A 1TV2A 3OSVA 1XKYA 1QO3A 1YRKA 5LG1A 4UTBA 3ARDC 2HMIC 4EM0B 4O19A 2I5UA 4HEPA 2EZXA 4ETYA 3ZQIA 2PFBA 3IWFA 1I60A 2HA1A 3U7WH 4I9XA 3TW7A 1T1WB 3HM5A 3ZMDA 4NKDB 4AVHA 1NNLA 4AGQA 1Q2RA 2Y8VA 4PJAF 3I6TA 2QSFX 8ICOA 1O7LA 3TBTA 3FCUB 4KI5F 1K9DA 1NCHA 4ERSL 3KWUA 2W8CA 1P4UA 1T1ZA 1TPVA 2IAIA 1OGBA 4C5YA 4RLQA 3NCBB 3HHSB 4G5DA 2A1AA 3UYPB 4GYPC 1A3QA 4KX8A 4WU5A 4G3IA 3K6DA 5CZVL 2DLEA 1XH3A 1DEEB 1XF2B 1B1YA 1T04B 1V3HA 5BS0A 4YSEA 3PPGA 4E0CA 2CQKA 2WAQA 4MMZC 3KP2A 1J9YA 2VL5A 1NOFA 1JGDB 1GIGL 2ELJA 3PWPA 2NR6D 4UV4H 2ZRUA 1FIPA 3P9WB 5D30A 3G1XA 1MI5D 2Q8AH 3T8LA 1IV6A 4L80A 2FVNA 3EF4A 1GUVA 1KU3A 5DMLA 2L9NA 4WI0B 5FKYA 2PDJA 1H60A 4NWUL 3DV4B 3IPWA 4IHSA 3QI9C 1ZD5A 3MOQA 5KFKA 5F7BA 4P61A 1U49A 1NM9A 4FHJA 3SCNA 4IXAA 3EJQA 4LAOA 3OKOA 4BJLA 1F02I 4IMKA 3OR6B 2CCRA 1FWXA 3TBVA 2NUYA 4XG1A 3EDPA 4F9PC 3DX7A 3AG3H 1YE9A 3AREC 4EWJA 2W59A 5AZ2H 1AGFB 3QRHA 2B0SL 5IVZA 2A21A 3OAZH 1E5NA 3UR8A 3VNZA 5AKHA 4M9LA 3UX9B 5AB3A 1UB3A 3PNYA 4QY8A 1JUBA 3GBMH 4LLWB 1IRGA 1UKOA 1ZS8A 3ZR5A 3JR2A 2GFBB 2NCMA 4MQSB 4N9CA 2BOBA 1KTCA 3CWHA 2OI9B 2E36A 2NRZA 2PSNA 1IAOB 1PX4A 4FNLH 3ESMA 1LOLA 4TXEA 1XG4A 3S37H 4C80A 3CBRA 4L9TA 4TSBL 5IF0B 3I9GL 4JG9A 3HJZA 4A6EA 4OJOA 1EJVC 3LKOB 4YLCA 3DOSB 1BI1A 3BR6A 3D2NA 4KOBA 4BQ6A 2GK0A 3BP8A 5J04A 1RVFH 2P8TA 1W8GA 2WQRA 1S3KH 3F8UB 4N9GA 3WIJA 4N2KA 4OJFH 1TU2B 1NKRA 1SHWA 4B3ZA 3S3OA 4GRIA 1XGPB 3QORD 4Y3OA 2IOMA 4ONHB 3IFPB 2DM4A 1PE1A 2G2RB 1U8HA 3S14J 3T1GA 4LVBA 1FVCB 4O2FA 2XGCA 1HL2A 2DWEB 3QUYD 1UQVA 3UGVA 5AKXA 1J5HA 1W5TA 1NGYA 3HOVJ 2UVWA 3GHBL 3CGTA 5GPAA 2CLHA 2NUPB 1AQHA 2Q09A 1EUTA 2DUZA 1E0EA 2CW8A 2R2CA 2V2XA 4MTVA 4WY7H 4PJDE 3OXRB 5MKGA 1SL0A 4WSKA 3HOXJ 2HN7A 3ARBD 1R5IA 4F52A 3REQB 5T1LD 5D8LB 2KT0A 1VKFA 4QHUB 2CK0L 4FO4A 4XVEA 1FCQA 5TZVA 3HC2A 2LFGA 4KX5A 1XGTA 2OXHA 4WEUD 3V6ZB 3ATFA 4LLMB 4ASNA 2PPDA 4ATWA 1O4XA 3C5ZA 3OMIB 4HWEH 1H7WA 1CI5A 4XE5B 3TN4A 3ZKQD 4GINA 4EI5D 1F43A 4K8HA 3GTTA 3W22A 3L7RA 4EVIA 2VFFA 3I85A 1G1OA 1NEZG 1ELSA 5LGZA 1BIAA 1ZCRA 5M2FX 2V8MA 1JF1B 2BNUB 4OE7A 4IUGA 4AUXA 4N1HB 2YK1H 3M0YA 4XI5C 4HF5H 1HXMB 4W9EC 4H19A 2E6DA 2ZA1A 3EMCA 2H26B 3QHMA 1H0IA 2P43B 4XKVA 4XC3H 3IYLW 3X1GA 2CCVA 2JB6A 5EBWA 4PGBB 3MJ9L 3CD6I 2KHQA 5AIPA 3TJIA 5FO8A 1H3TA 4RPQA 2A6JB 1DV7A 2NY2C 4AF0B 2N8GA 2V5MA 2R93J 3CUQB 1D8WA 2B4CH 2UYLA 5KT3A 5KVFH 2OV7A 5KFMA 4KVPA 5T91A 3EGXA 1W54A 5J1YA 1IX2A 1M65A 2DQJH 1V6TA 3W70A 2BZFA 1DLHB 4H9YA 3VI3A 3DFPA 5JRTA 1FAIH 1N82A 3CSBA 3ZE2E 3FRPB 1P0DA 1PY0A 2E6JA 2H94A 5FSEC 1ITBB 4OZIA 2WJ7A 2W92A 3P3RA 2BSSA 4OZOA 1XGQA 5IFJA 1Z5LA 5BMZA 1K6QL 2RDUA 4C2MJ 4JFEA 1FPTH 1J9SA 1YNTB 3VIOA 4XGZA 3PJXA 1USTA 3LKPA 5IB4A 4D1IA 2XFYA 4J9QA 5FLXK 4HSAC 5DD3L 3TSMA 4QWDA 1YEIL 2I7SA 1A6UH 1TJIL 3OKEA 2OZTA 5DA4A 1G9EA 1GZPB 1P5BA 3SGZA 4I0AA 3MUY1 1JV2B 1V7YA 5D37A 4QHLB 4LCCB 4RK8A 5F04A 2OWWA 1HJBC 4OO1J 4LIQH 3VVVA 3O8XC 5EJCA 1H0MA 1NIFA 3QWOB 3EFOA 2BIPA 1T1XB 3MBEC 4RZKA 5LD2C 4JFDA 2DPIA 1ZWIA 3WI9A 1H3UA 5AAWC 1MRAA 2NRAC 3IHQB 2FMOA 1P53A 4HNNA 3BDYL 4XZBA 4N2HA 1CT5A 3KPMA 5GGQL 3VRIA 3N6YA 2VE9A 2PWHA 4BWTA 3UTZA 1CBGA 2LRDA 3NZGA 4W1UA 2Q7NA 3B6SA 2HOTA 1ZGLA 1TPFA 3Q9PA 3U1SH 3NO1A 4AZCB 4WJ5A 2VFIA 2EIMH 4O2CA 3AABA 3RVUD 1Z9SB 4CUCA 5EO0B 4ZMOA 2V79A 1N55A 3AROA 3S6TA 1TQMA 3SPIA 1F4WH 3A6OA 4OY9A 3AS3A 2FECL 4WY0F 2X1EA 1BVKB 5FV2A 2YXOA 4D6FA 2QUUA 1PZBA 3VE7A 1XGRA 5JHDA 1W0TA 2B4CC 2YGVA 2FJFA 5LN8A 3T4AA 4YAQA 1BQCA 2BXZA 2WMGA 4WEEA 1A1NB 1DVSA 2AEPL 5TDOA 2CH8A 4Z76A 4YPGA 8PAZA 1TUPA 2WF7A 2MD5A 2NY6D 3QHNA 2EHHA 1JT0A 2ISWA 2GUYA 5EYRA 2Y7DA 5E5MA 4PRNB 3PL6C 4E7JA 2IWGA 4OMYA 1SZNA 2WNQA 3HV8A 3OL3A 1YJDL 4RNFA 4KQ4L 2P5WB 2VDML 1R3LB 4ZSOE 2DW4A 1AOZA 3F21A 3LLFA 3WGHA 3ABMB 4NQCB 1OTTD 2ZXHA 3I6EA 3ITVA 2WQAA 1QHOA 2XKNB 3BAYA 5EOTA 1OQXA 4P3CL 3HO8A 1DBAH 1T6SA 5KFUA 8FABB 3FKRA 1U2WA 5ALXA 4F7EA 3GX4X 3UROR 4HN8A 2MGQA 1Z00A 5I5MA 2MW8A 1Q6GA 3V0VB 3FOKA 2HX9A 4CF3A 3DHPA 3KX2A 2CRXA 3BVJA 4I4WB 4NNBA 1JNNL 2FEDD 9ICQA 3CXDH 3FTWA 5HGHB 4Z95L 3OEXA 5CFAA 3PVXA 1P7TA 1H61A 4GRWE 4N8CH 4PY7A 1B4RA 4LNRA 1ZQSA 1K3IA 2ZSVB 1CB4A 4IGNA 4CUGA 3D06A 4D0BB 4X1EA 4ZG1A 4RMWA 2LLNA 3RGBA 2JGQA 2ROYA 5AYZA 1FP1D 4U88A 4QZ8A 1VQPI 3NEXA 3MRDA 1U5JA 4W9LC 5AUMA 2FD6L 1T56A 1IBGL 2DQGL 3IL2A 3ZQLA 4N0YH 4BY1J 1DN2A 4K5PA 1UJPA 3SGKC 3PGCB 4W8LA 3PNRB 5AONA 1Q9LB 1OC6A 5MENB 3UA3A 5A8GA 1CB7B 3QZMA 3S6CA 4FC3E 3FQNB 1RCXB 1MMAA 3PV6B 2R0ZL 4I7VA 1RYRA 3O07A 2NRXA 1FSEA 3SJVB 4G8GB 2IMNA 5IGXL 2C5DC 3MI2A 3W1XA 2MUTA 2EE0A 3ZSSA 4F8LA 2CESA 4JG1H 2NV1A 2R92J 1E4KC 4X4ZA 4NRXA 1ADQA 1OB0A 4HS8H 1FP8A 3PO4A 1IGCH 4LK0F 1OOAA 4JTSA 2HVJA 5JLWA 5I06A 4QWAA 1OVDA 2IGTA 2WZMA 2PYFA 3MOAL 1U3JA 3FXJA 3JV4B 4OLUL 4F2TA 4O5EA 4OOUA 2P48B 2Z65C 4PJFB 3DSNA 4HJFA 5JNYB 5KVRA 5JW4N 1WJ3A 1VBGA 4PGLA 2CMPA 1EZUA 3JYBA 4WFFE 4Q8UA 1NFGA 3S5LA 2FRGP 4BF7A 32C2B 4CVZB 1KGWA 1RQEA 4WJEA 3KPSE 4XZUB 2HTKC 4YDJB 2V2TB 3KBBA 2P8MB 5AKYA 1I7ZA 2JJTC 4NKIL 4IDJL 3NQ6A 4AWTA 4B4HA 1CYXA 4M1GH 2JF1A 5H6QA 3D3VE 1X4PA 1Q45A 2ADFH 2FEEL 1DP3A 3RQIA 3K2IA 2VWEC 3V9CA 2LFEA 1MWAL 3I6LE 3LU2A 3IMWA 1NCCL 5CHGA 5FF6A 1JHKH 4ODWA 4NLZA 1FI8C 5E56A 2QQAA 2JJWA 4M62L 4PJHF 4FETA 4B5VA 1OHLA 3WU1B 2DKXA 9ICUA 4XN2A 3UPCA 1A35A 3V4UH 3O6FB 5CG7A 3QUMA 1T4GA 1ZAOA 3GK0A 2LTQC 2L54A 3VRJB 4QMEA 1HJXA 1LWJA 1D8BA 3S96B 3VH8B 1NCWH 1ZPTA 1B6DA 3N2TA 2Y9TA 2IQAB 4Q9CA 1QU4A 3MKVA 4Y1AB 4R8UB 1YYML 3VC5A 3E2HB 2WQVA 4MRBA 2XGXA 5JU6A 3BW2A 3MTWA 3BE1L 3OIXA 2CUAA 2J5LB 3QUXD 4Y2WA 2YGOA 4E4PA 4PWIA 1WDSA 3DOHA 3GSQA 4WY0A 1JTPA 3HI5H 3KPLB 3ESNA 2JRZA 1YZZA 4P2CG 4LEOA 4GT7A 3LHPH 3MR9B 1XBVA 2CR6A 3KRSA 3IDMB 1JF5A 1P6BA 2VJ5A 4X8JA 1I6XA 4HKPA 4DBQA 4BIKA 4PBFA 1SSGA 1H7NA 3F5EA 1PUDA 3HGJA 2EINB 4P46D 4KI1A 2AQOA 2X1OA 5I30H 1KLNA 1IC4H 4PTVA 1I8JA 3HIFA 2DS4A 5AKTA 3QHFL 4ES8A 4DGVL 3MLVH 2AAAA 3GNML 5B1KA 3CWNA 4KKZA 5JXAH 3BZ4B 3SV4A 1IXRA 4I9MA 1HL5A 3L3OA 3MTRA 3WLQA 1CEOA 3VU1A 4WI5A 2R69L 3OJDB 1ZGAA 1I8IA 1R6VA 1VPQA 3QDJA 4TNGA 3HA1A 1L2QA 1QO0D 3ARTA 1F3RB 3HMWL 5JW5A 2ZCLH 3F8MA 4ZD3H 2IOOA 2EV6A 4CGTA 3VFCA 2LT9A 3RFAA 3NSYA 1F58L 1K61A 3FFDB 1SAUA 4P0DA 4I2XE 4CQAA 1MJBA 1TUXA 4NFCA 4EIBA 4TF4A 2Q10A 3A01B 1E5UI 2W4SA 5GZOD 1KM2A 1A7BA 1PKMA 3C60D 3H2AA 5IIMA 2JEFA 1A14L 1QEWA 2M34A 1Y18A 1UEMA 3RTRA 4DAGH 2P6SA 1FDYA 3IRSA 4GW5B 4YWSA 3SM0A 4IOSA 2BY1A 2FYMA 4QISA 3N1AA 1IUYA 3FQ2A 4ZNEE 3WLBB 5FYLE 4LJZF 4PRID 3OR7B 4M3HA 2J7HA 3T40A 1SEQH 3S8PA 1Z66A 2OOFA 4KRPC 3MUIA 3Q43A 4EIGB 3O3RA 1HINL 3MQ0A 1PYVA 3EGSA 2Z1VA 5BZDA 1T38A 3ZDZE 1EEYA 4KK5C 4JPIA 3UU0A 1ESOA 2B9BA 3FXIC 2IJLA 4QEHA 2Y5SA 4HCGA 2YZ1A 4M7LH 1KB3A 4I48B 3ZHFA 2OCCB 3RIAF 2HG5B 3VA2C 1F5TA 1V4RA 4OIPF 4WJG3 1JKRC 3HGRA 3PK7A 3QDGB 5I79A 1FOYA 4DEPB 4PG9B 2HBLA 3LIZA 2K8BB 3AICA 1IC0A 1AYOA 2OP4L 3RL1A 4DJEC 2UWFA 4ABUA 4B9NA 1KV3A 3EW9A 3K2UL 2G7UA 2VDIA 4XPFL 3NCJH 5JR1L 1XFBA 3URAA 2NVUB 2WSKA 2G75A 1O94A 1RVKA 4QWWD 5CVJA 1F00I 5KG6A 2V2WB 2OW6A 3KGTA 4L1XA 4LNCA 3PZTA 1NFIA 1T2KA 2Z8WC 3GR7A 3RWDB 1IE5A 3FRPG 3I9AA 4DF0A 2GJ6E 4S1FA 3G4SI 3I75A 2VQ1A 3OVQA 3PM1A 4HNVA 3HI1A 3LSJA 2BHYA 1MHEA 5HBFA 4MJID 5IFTA 1THAA 3BJOA 3ARWA 1G9MH 4YMOA 3MOBH 2FLMA 4NQCE 1K83J 3M1BB 5T1MB 3LVWA 2PCPB 3DSFL 3LOWA 1XZ0A 3QY6A 1TTYA 3SKNB 2G7HA 1AGCA 2DKZA 1VDVA 2WUCH 3KWWA 3RO6A 1QOKA 3B7UX 4KO5A 5AYTA 5EWFA 2ZCHL 3EO0A 2R56L 1TV7A 5CD3B 1XS9A 2AKRB 4PJHA 1FRGH 1D5MB 1LO0H 1PDNC 3CPLA 7REQB 1MFAH 3WL9B 3QEZA 3C1DA 5JTWA 4IVNA 3WFBL 5F1SA 3F03K 1RAMA 2XBTA 3GG7A 2P4AB 1U3HB 4LLUA 3UCDA 5EWIL 2L7ZA 4DPAX 3SDBA 3BFQG 5B1AB 4KPLA 3BVUA 1X5YA 4HGMA 4AD0A 2H8PA 1CBVL 1K78B 2A74B 1Z69A 4X6CF 1HTIA 5ANME 1PBYA 5TQ0H 3O06A 3A4WA 2J8UB 4RDZA 1U8CA 2WBGA 1RD6A 4LP5A 2DA6A 4PGJA 1PDKB 2XTJE 2J1WA 3WS3A 3V5CA 5MENE 3IGSA 5I6SA 2GQAA 2BV6A 2J7GA 3PWLA 1M6YA 5K59F 4OZFB 4WI6A 4Z0SA 2N56A 2EH9A 5D2LF 4ELMF 1Z0XA 2DZXA 1VZGA 3TX4A 3BRFA 5DCMA 2VE6A 3R1GL 3G6XA 4WUUB 1WWCA 3FPYA 1SXSA 3S36H 3VFMB 5AZEL 3NOIA 3K2AA 5MERA 2YPLB 4JPQA 2V5YA 4LPYA 4DHGA 1X5MA 2QPUA 1ZOLA 1NJ9B 1BFVH 1W3NA 3H7VA 4IOFD 2NXZC 3QNZB 4QHMA 1G9MC 5EZLA 3UAEA 3NPSB 4NNYA 1JIHA 3APFA 2CLMA 3WXVL 4MFAA 3JWNH