3HJEA

Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
704
structure length
704
Chain Sequence
MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDELGGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEEEKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRDYPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNKIGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDELVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNCSQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDKFHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKNDEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMFNNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPVVFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ST0929, a putative glycosyl transferase from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii str. 7
molecule tags Transferase
molecule keywords 704aa long hypothetical glycosyltransferase
total genus 284
structure length 704
sequence length 704
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09196 DUF1953 Domain of unknown function (DUF1953)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Maltooligosyl trehalose synthase; domain 4 3hjeA04
1.10.150.200 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Maltooligosyl trehalose synthase; domain 3 3hjeA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3hjeA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3hjeA01
3.30.1590.10 Alpha Beta 2-Layer Sandwich Maltooligosyl trehalose synthase, domain 2 Maltooligosyl trehalose synthase, domain 2 3hjeA02
3AICA 1JZ8A 3CMJA 5I6SA 1EDGA 3AOFA 3ZO9A 1UZ1A 4PBGA 5A2BA 3CIVA 1JI1A 2F1AA 1TMQA 1TQSA 5A69A 1FFQA 3AIBA 1HJQA 1WDPA 3IGUA 2XJ7A 2WM0A 3WNPA 1TUXA 2YA2A 5A6AA 3ZOAA 1NQ6A 2JEPA 2WMIB 4PMVA 3IK2A 3LMYA 8CGTA 2W4XA 5HOSA 4HTYA 1B3ZA 5ABFB 2WSPA 5A6BD 2ZX5A 3TV8A 1CXEA 3VDHA 3NSMA 3VUPA 2VO5A 3PZUA 3AQUA 3L4XA 4JFWA 4CKQA 4CD6A 2O9OA 4F79A 3WD0A 3THCA 3VIHA 2ZX8A 1V6VA 2ZUMA 1B90A 1UG6A 3N13A 2CESA 3BAKA 4PMRA 1HL9A 1U30A 1B2YA 4UFIA 1OD0A 4FLRA 1H11A 3PBGA 2G3JA 4MJ4A 3EDFA 4UOJA 1M01A 2ALWA 2PBOA 5E0CA 3F5KA 3VGDA 1F4AA 4UFHA 4V28A 3VOCA 4A3HA 1V3JA 4X0VA 1W1PA 1H2JA 3QR3A 1RP9A 1UQYA 1HP5A 1OD8A 3F5LA 4OBSA 5A8QA 2BXYA 3NJ3A 3SEPA 1WPCA 2GVYA 2G3IA 4QDMA 3VDBA 3PZGA 2OYLA 2RGMA 3A21A 5IFTA 2VT0A 4LX4A 3A4AA 1UD3A 1MXGA 4AZ5A 3OZOA 4D6JA 5IDIA 1GOIA 3MMWA 1HXKA 3EYPA 2XTKA 4W5UA 3WN6A 3ZR5A 3PZNA 3UG3A 3T2PA 1HT6A 4AMXA 4ATDA 3K4AA 3CMGA 1J0JA 1MFVA 3RJXA 4W93A 4AWEA 1CLVA 5DO8A 3U57A 3WQ4A 1CXKA 1JNDA 3SIMA 3APGA 2WYSA 4CGTA 1HKJA 4DUWA 5E6ZA 1XH2A 3WL1A 1EDQA 5FCZA 1QW8A 3U5YA 1QI3A 3HU7A 4QLKA 1H0GA 3W27A 3DYPA 2XFRA 1C7TA 3IAQA 1MFUA 2F2HA 3A47A 1A3HA 2CERA 3VGFA 3AMLA 2WMHA 3FHAA 2QMJA 3ZT6A 1GQLA 4S3JA 3AJ7A 2VX4A 4BS0A 2X0YA 2EACA 1LQ0A 4WKHA 2DDXA 1W1VA 1R7OA 1BPLB 2J75A 4QP0A 1W9UA 3SCSA 4W87A 1QOXA 3DYOA 1AQ0A 4KGJA 5CPSA 5E0FA 1NH6A 4UZSA 1UD5A 1PX8A 4CU8A 1UR2A 4YPJA 2E4TA 4L4OA 1FH8A 1BGGA 2AOSA 2UY5A 3CPUA 3PTKA 2BFGA 1W9PA 4H41A 2VVNA 1FHDA 3BMVA 4HU0A 4JHZA 1ZS2A 2VRQA 3EJQA 3OGVA 4ACZA 5I78A 3SUSA 4RE2A 1HVXA 3BAIA 4DWSB 2E9LA 2DSVA 4NZFA 2J7BA 1KGUA 2EADA 2DEPA 2WPGA 2NT0A 4V2XA 4IUGA 3K8KA 1GZJA 1V0MA 1XYFA 1WKYA 4C7DA 1JD9A 2WVUA 2FGLA 5EFFA 2E0PA 1FP8A 2FGZA 2D23A 5GNZA 1EO5A 1DWIM 1GOMA 3WQ8A 4J27A 3T2OA 1X1NA 4TOQA 4AD3A 1UASA 1NM9A 2EAEA 4ZXLA 3NSNA 1CXHA 2GUYA 3FY1A 1MVYA 3BAJA 3QHMA 3B9DA 2WMIA 1OT2A 2FDMA 3SCVA 3ARXA 1UH3A 2JF7A 1CWYA 4AZBA 1H49A 3U7BA 3SURA 4W8BA 3WUFA 3WNMA 5M5DA 3RIKA 2BY1A 1FH9A 1W3HA 4GZIA 2HISA 4CVUA 1SR0A 1ZBWA 4D1JA 3G6MA 5A2AA 3DECA 3WDRA 2VZOA 4NSBA 3VD3A 4KRUA 8A3HA 3K8MA 2EPNA 3AZSA 3GXNA 1QVBA 4X9YA 3NIYA 4D6GA 3KL0A 3OLEA 9CGTA 3WD3A 1DEDA 4B3LA 4XUYA 1E0WA 4XB3A 3CH9A 4J3XA 5A1AA 5FL0A 1I1XA 3VKKA 2W63A 1BYDA 2NT1A 3A24A 2WZIA 3VM7A 2V3GA 1GORA 4PRWA 4KGLA 1CXFA 1B9ZA 2VCAA 2D0HA 5AC5A 1BLIA 2WKLA 3A23A 1O7DC 2WHKA 2B31A 3TA9A 3WY1A 1JF5A 4E8DA 3A22A 3VSVA 3VTRA 4M29A 4EAMA 5IFPA 2YBTA 3I3DA 2YLAA 1Q6CA 5BXPA 4L4PA 1LLOA 1W1TA 2BVDA 4Y7EA 2DT2A 6A3HA 3WF4A 2J7EA 2G8ZA 1NWTA 4PMQA 4C7FA 4DWSC 3ECQA 1BSIA 4X0NA 4H8VA 2WXDM 2DQXA 3LXAA 2Y5EA 4D6CA 3MUAA 3T09A 1C7SA 5JIWA 3CZNA 1BHGA 2WAGA 2F8QA 2JIWA 1DWHM 3OBAA 2QHAA 1VEMA 4HMEA 5CLTA 3CZEA 1L0PA 3RM4A 3GYCA 3FAXA 4LYRA 3ZIZA 3GXIA 1O7AA 3AI0A 1C3FA 4F66A 2CPUA 4XZWA 3PZQA 4AZCA 5ABHA 1UWQA 1KTBA 1UWIA 1JFXA 4IPLA 1UWUA 1UR9A 1OIFA 2J79A 4WF7A 1KQZA 2XVPA 3L2LA 3WF3A 4ZXOA 2D0GA 1K9TA 4TX8A 1RPKA 4EKJA 2VRJA 3ALFA 2WVTA 3L4ZA 4FNRA 2IXUA 3N1AA 1V3HA 1Q6EA 4OIFA 1HKIA 5I77A 3IJ7A 3FN9A 4JL1A 1B1YA 3AMDA 1BYBA 4M81A 4BZYA 4UQEA 3DHPA 1OT1A 5C71A 1DTUA 4U2ZA 3NSXA 4DWSA 3ALGA 2UY2A 2XFFA 4PEEA 4M8UA 1BTCA 4CCEA 1XV8A 3ARRA 4TTUA 1SMAA 2VR5A 1MQRA 2J7FA 4TVCA 2WWCA 2EJ1A 1UWRA 4AYGA 4Z2LA 3N12A 4IM4A 3WUBA 5CJ5A 1R8LA 2Z1SA 2WBGA 2CBJA 1J0IA 4B9ZA 4MDPA 2YDRA 4HMDA 2YDSA 3WMSA 1ZBVA 2ZOXA 1UD6A 1QNPA 2XGBA 3BLKA 1MYRA 1V02E 3W6MA 5D8ZA 2GJPA 1DWJM 3AXIA 3BUBA 3N17A 1UYQA 4B3KA 1V6XA 1HJVA 2W61A 1GVYA 3DX3A 1LL4A 4EANA 1OWQA 3POCA 3EJTA 2VOTA 2WMFA 3WQ5A 2A3BA 3ZSTA 1TVNA 4PYSA 4WJXA 2Y8VA 3DX2A 3A6OA 1HNYA 1HXJA 3EDEA 2XVLA 2OSXA 2WVVA 1XD0A 5LA0A 2FHCA 1R75A 4AW7A 3ZJ7A 2WSKA 4PTXA 1OINA 1R85A 4Q22A 4RE3A 3ARPA 1MW3A 4UR9A 2EABA 1V0KA 1TQTA 5FIPA 2PWFA 3WELA 1ISYA 4D6DA 3BSGA 4HP5A 2OWWA 2E9BA 1VFFA 1Q4NX 1ISWA 1C92A 3PZIA 4TX6A 5D9OA 1SZNA 2GK1B 1OSEA 4FLSA 5BROA 4BCEA 4MJ2A 1UR1A 1NWSA 3B8SA 3N15A 2QLYA 1OBAA 3WNLA 1NARA 1S46A 1ESWA 2VRKA 1IZKA 2YOCA 4CN6A 3I3BA 1M7XA 4FNPA 1HVQA 2EEXA 1ITXA 4HOWA 1EHAA 5GNYA 1VJZA 3CHDA 2X1IA 4HMCA 5EBAA 1E3ZA 3VMOA 1FA2A 4MADA 2TAAA 1V08A 4B15A 2BHYA 3UESA 1UHVA 1R47A 2WVSA 3VDAA 1LF1A 3VIMA 3WD2A 3WD4A 1KXTA 3W26A 3VGBA 4U3AA 5AC4A 4DUXA 1TA3A 3WY2A 3SUTA 3MMUA 4WIWA 4WSKA 4BQ4A 4GINA 2Y24A 4UCFA 1GUVA 3BC9A 2EPLX 3DHUA 4URIA 3E1F1 4J7RA 5ABFA 1ISXA 2OSYA 1IT0A 3WQVA 2CBVA 4GKLA 1YQ2A 5JBEA 1UWTA 5E09A 3WUGA 3W38A 3ARSA 1UZ4A 5A3HA 5LA1A 1JDCA 1OGGA 3WH7A 2V3FA 1ZU8A 4MB5A 4IISA 3AXHA 3L4YA 3WSUA 3PZ9A 1CGWA 3ARTA 1DHKA 4AMWA 1QPKA 4YN5A 1EQPA 3WF0A 2VCBA 3UETA 2XN0A 5I2UA 1NWRA 1TE1A 1QNSA 1VIWA 1NOUA 2J7HA 3CC1A 2X09A 3AHXA 4P8WA 3HJEA 5ABEA 3SUUA 3UR8A 1J11A 3LRLA 4U5IA 1QW9A 1HTYA 1LL7A 3N18A 3WH6A 3L4WA 3SUWA 1BVZA 1MW1A 3POHA 5GPRA 1OGSA 2WHMA 1VF8A 3LRMA 2VR4A 3VSTA 4RE4A 1E40A 4U2YA 3UG5A 3A4WA 3HG4A 1E15A 4LQ1A 2DPEA 3WMCA 1PS3A 1IZJA 1CGVA 2J8GA 1VFUA 3MUIA 4AMCA 1RP8A 4QAWA 2VUYA 3BAXA 4Z2GA 5AYBA 4JKMA 3D3AA 1A47A 3MKKA 1JAEA 1CBGA 2CNCA 4HZ6A 2YFOA 3W28A 4NXSA 2YBUA 2G3MA 5A6MA 1WDRA 2PF0A 2VJXA 2A3HA 1MW2A 4AIOA 2VC9A 4GIAA 2WC7A 3TTSA 1GONA 1GQIA 1NOWA 2PC8A 2BNJA 1ODZA 4AD4A 3OGRA 5JBDA 3GNPA 1GOWA 3WQ6A 4WKAA 1OIMA 5A6LA 2ZX9A 1OCQA 2PI6A 3O9NA 1E0VA 3AHZA 1I75A 4NF7A 3EJUA 4YHGA 1KGWA 3MV11 4QFUA 2XVKA 4J3SA 4PMOA 1QI5A 1WZMA 1GQJA 2WC3A 3VIGA 3D4YA 4W7WA 3GZAA 4NI3A 1Y7VA 7CGTA 1L8NA 3K46A 1CXLA 4HOZA 1HP4A 2O9RA 3SCOA 2VNCA 3BVTA 3IJ8A 4MB4A 4UQCA 4OJYA 1B3YA 1VRXA 1J0YA 1E4MM 2X0HA 4E8CA 3NYDA 2DT1A 3DDGA 4CVWA 2JALA 1VFMA 4GO9A 1C8XA 2JFEX 1XRVA 4MB3A 2XVNA 2AMGA 3MSGA 3H54A 1WNOA 3EJPA 1E43A 3VNYA 1J01A 2D24A 2ZXDA 2O92A 4AEFA 4ATLA 2WB5A 4HU8A 2YFNA 1UR0A 2VVSA 1GCYA 3ZJKA 3SCTA 1PIFA 4CCDA 5C70A 1TQVA 3O6AA 7TAAA 3H55A 3SCUA 4MNJA 3VIFA 2CXGA 1EGZA 3CHEA 3WNNA 5A6KA 3VIIA 4PMDA 3VGHA 4H2CA 3W37A 2VZSA 1WDQA 4TUFA 4A4AA 2ZUVA 1BFNA 3LPFA 3TTQA 2QF8A 3AXXA 1W3KA 2WLZA 2GDVA 1PZ3A 1XC6A 1W2PA 1K9DA 3OA5A 3CZLA 1W3LA 1UKQA 3CUFA 4PTMA 1TVPA 2NSXA 2DGAA 4JAWA 2FHFA 4HA4A 1GPFA 4UFKA 1E9LA 3LXBA 2WMGA 3BXWA 1CTNA 1KR1A 1BG4A 1V6UA 1BYCA 2ZUSA 3VD7A 2YDQA 4HOXA 1HKKA 5JBFA 1KB3A 1B3WA 2CYGA 2C7FA 1CGXA 4MAZA 3T0AA 5I23A 1LWJA 3AZTA 4BQ3A 2IXVA 3MI6A 3S2CA 1XSKA 5IHSA 2DH2A 4AD5A 1W2VA 3IANA 1XD1A 4J3WA 1E3XA 3WNOA 1CXIA 3D52A 2CHOA 2F7RA 5FOOA 2VCCA 1KXQA 1K9FA 3U5UA 1CGTA 1QI4A 1NP0A 1UOKA 5BWFA 1GOQA 1PZ2A 1UWSA 3VDCA 5DEZA 5FD0A 3HG2A 1QI0A 3AISA 1JZ6A 2F7PA 3DDFA 1MWOA 4JKLA 3H53A 3PTQA 1C91A 3WNKA 1ZJBA 3EMZA 5D9NA 2C0HA 2D3NA 4P7OA 3CZKA 5GNXA 1EA9C 3AROA 3FNDA 5HDRA 1KBBA 1C8YA 1N82A 2WZHA 1CIUA 2IUZA 1JYVA 4B9YA 5I5RA 3ZT7A 5JIPA 5AY7A 1QWUA 3ZJ6A 1WZKA 3CUIA 1KTCA 4OBRA 1TZ7A 1US3A 1JXKA 2ZUTA 5HPOA 2VX5A 1YHTA 5A6JA 2WCGA 2J7DA 4D1IA 4DO5A 2E40A 2IGTA 1B0IA 1AVAA 5F7UA 1HN1A 2V38A 4GZJA 4FLQA 2O9TA 2ZIDA 3L4VA 2VURA 2V3EA 3IJ9A 5E70A 1JAKA 3EDJA 3BAWA 1EQCA 3CHFA 2V5CA 4PMUA 1V3MA 5FKYA 1WO2A 2XGIA 4OGZA 3AIVA 2X2YA 5E6YA 1E6RA 3D51A 2J74A 5EB8A 7A3HA 4GO8A 2E3ZA 1U2YA 3OZPA 4PMNA 4W89A 2WHJA 4GPNA 2VZTA 3WD1A 4W8AA 4ZFMA 4PSPA 1QI2A 4LPCA 2BXZA 4UFMA 4H8UA 1DWAM 2CITA 1XGZA 2Z1KA 2CHNA 1T0OA 1H4PA 3VIJA 1WP6A 2CIPA 1JZ5A 1J0HA 3VM5A 1E1FA 1FOBA 3GH5A 2UWFA 2VI0A 3T2QA 2OYMA 4OKDA 3VSUA 3GXTA 1K9EA 3K4DA 2CKRA 2X8RA 3FHQA 1OB0A 3W53A 3VNZA 5CZKA 5CG0A 3W81A 3ARYA 1ECEA 3B9EA 3ARUA 1F4HA 3UCQA 1GVIA 2YA1A 3GXPA 4ML4A 1QNQA 3ZSSA 3HN3A 5A8MA 1XSJA 3LX9A 3PZVA 1E71M 1PPIA 1KR0A 1UA3A 3VMPA 4DO6A 1E1EA 3GNRA 1VEPA 2RGLA 1KBKA 5CGMA 1DWFM 4LYPA 1DP0A 1E6PA 2V5DA 3NDYA 3TP4A 1X6NA 1HJWA 1JZ4A 5DT5A 1JIBA 1XCXA 3OGSA 2ZUUA 1GW1A 1FHLA 4JFUA 4FK9A 1G1YA 5A6SA 5CGTA 1PEZA 1V0LA 4HA3A 3KE0A 2WKGA 2OWCA 4PMZA 3VO0A 3UERA 3HZ3A 2J78A 4W86A 1WZAA 1BQCA 1O6IA 3W25A 1UD8A 1QHOA 3LRKA 4HZ8A 1HKMA 1UKOA 3BGAA 3BLPX 4DO4A 1EIBA 1EOKA 3MO4A 3EBVA 3WFLA 4E2OA 4XZBA 1R86A 3HG5A 3GH7A 1G01A 3EJSA 1GHSA 3DX1A 3WFZA 3CZJA 3O2LA 2Y4SA 3WH8A 3UEQA 3L2MA 2WCAA 5D9MA 3AYRA 1EOMA 2GJXA 1H5VA 3D50A 4F8XA 3BAYA 2E8YA 1TR1A 3K8LA 4ATWA 1JZ2A 3TONA 1C93A 4AZCB 1JD7A 1VAHA 1UA7A 2W91A 4IPNB 2D2OA 4J3TA 3AIRA 1E5JA 1ZBKA 1PBGA 3GM8A 5M17A 3WKZA 5A94A 1KWKA 2QMKA 1NOFA 1PJ9A 2W92A 1JDAA 3BUQA 4N0RA 2XUCA 1TA3B 4W7VA 2YKKA 1SMDA 2J8FA 2XFYA 3KL3A 2X2IA 3AS2A 4U33A 1AQHA 2ZICA 4AD2A 3CZSA 3DX4A 2GSJA 4CD8A 1NP2A 1H09A 2J77A 1QHZA 2WHLA 4QLJA 1R34A 1BYAA 2GJRA 2BVYA 5A8PA 5M3WA 2XWEA 1E5NA 5CPTA 4J28A 1XH1A 4K68A 4NZJA 3RILA 1CYGA 4M24A 1E4LA 3OLGA 3RO8A 5IHRA 2EBNA 2YL6A 3RPMA 1QHPA 3VMNA 4Z2IA 4W85A 3N04A 2GJXB 3WDQA 3EJRA 1W9XA 2CCRA 4DUVA 4WLCA 2ZX7A 3DX0A 3QOKA 4LGXA 2UY4A 4D6FA 5DT7A 5HPCA 3II1A 3EMQA 1CGUA 1J12A 3AHVA 1B31A 2D3LA 4AY1A 3BCDA 4UNIA 3WEZA 1H3GA 4PUDA 5LA2A 4JCLA 3W24A 1VENA 4JFSA 3QOMA 4P8XA 3GXDA 3M07A 1GOOA 3OIHA 4F9JA 3HMCA 2WVVB 4BA0A 2J47A 4Z2KA 2F1BA 4BQ5A 4QLLA 1WE5A 3KLKA 2XSBA 4Z2HA 3BH4A 4FLOA 3QGVA 1KXHA 2ZX6A 4FNUA 3ZMRA 2EXOA 3M6DA 2J25A 5A6BA 5IXEA 3VIKA 2FE0A 2WCSA 1JF6A 3WEMA 4CD5A 2VZVA 4JFVA 2WZEA 5CLWA 1J0KA 3VD9A 5TD4A 4UOQA 2EQDA 4CU7A 3DC0A 3ARWA 3CHCA 3BVWA 3F5JA 2FH6A 3BSHA 4J3VA 1QX1A 3G6LA 1V3IA 2D22A 2J7GA 1W91A 3N9KA 4D71A 1M03A 4XV0A 1H41A 3TTOA 1BVNP 3SCQA 1B3VA 1SFSA 3ZQ9A 3VPLA 3UR7A 1LJYA 1HF6A 3AS3A 1JG9A 2WK2A 4AXNA 3CTTA 5HNNA 5D9PA 3RM8A 1M04A 2XM2A 4PTWA 1J10A 1FFRA 4JL2A 3M46A 3FXYA 3ZT5A 2XSAA 4A3YA 1KGXA 5DFAA 4XX6A 4UQAA 2VX6A 4U5KA 1JZ7A 2J62A 1GHRA 1J9YA 3MUY1 4W88A 2EO7A 1KWGA 4J3UA 1MQQA 2XYLA 3MU7A 4V27A 2W66A 4DM2A 1SYTA 3L4UA 4HPGA 1G0CA 6TAAA 2PWGA 1NWUA 4QCEA 3WDPP 4EK7A 3PHAA 3W82A 1CENA 3AIWA 1MQPA 1ZJAA 4U3CA 2PWEA 2CETA 1RH9A 4N42A 3U7VA 1P6WA 3HG3A 5HBFA 4GI9A 3LPGA 5JUVA 5HXMA 3KWXA 4RL3A 4Q7NA 1I1WA 4W84A 3WF1A 2GDUA 4PCSA 2CEQA 5EMYA 3M7SA 5CXPA 1VBRA 4M56A 1ITCA 3KEHA 4GXPA 2VQUA 1MW0A 3BVUA 1Q6GA 2XN1A 5I3DA 4NRRA 4S3KA 2WANA 2VTFA 1UKSA 3RMEA 4NZCA 1HX0A 5A8OA 2Q8XA 3RJYA 1QNOA 4MNMA 3PZOA 2WLYA 1D2KA 1U33A 2VQTA 4HZ7A 4MTVA 1HWWA 2BV9A 1TQUA 2DSKA 1TFVA 3PZMA 3GBDA 4UQDA 3ZR6A 3VX1A 2GK1A 3OLDA 1R87A 2BY2A 3AMKA 1E4NA 3NDZA 3PN8A 3CBWA 2DSZA 2D73A 1JDDA 1G94A 4JIEA 4OOZA 2FHBA 1E72M 3AHYA 3SUVA 1E70M 3UG4A 1C90A 2PWHA 3MUZ1 2Y2WA 2QPUA 4JFTA 3GDBA 1JYWA 3ZM8A 4R5EA 2DIJA 1WDSA 1X6LA 1VB9A 4TVDA 2OWXA 2DT0A 4PCTA 1E6XM 3RM9A 1FP9A 3SCRA 1Q6FA 1UUQA 1VBUA 3F4VA 4JZ5A 3J7HA 2EPMX 1QWNA 4DWSD 4JKKA 4KRTA 2DT3A 4OUEA 3ARVA 3W4RA 3W6LA 2EPOA 4Z2JA 3BMWA 3WDJA 1XYZA 4TTGA 3CLWA 1HIZA 3NCOA 2X2JA 4MDOA 4P7QA 2PB1A 1CEOA 4CD4A 3D4ZA 1W1YA 1KCLA 5BRQA 2ZWZA 1LL6A 2ZUNA 1LG1A 4AD0A 3T0DA 2YJQA 1GJUA 2C8NA 4W7UA 1C8QA 2VMFA 2VL4A 2CBUA 1R46A 3ZJ8A 1TG7A 1CECA 2VX7A 3BLBA 1E73M 2F61A 3WY4A 4FNQA 2OSWA 3LPPA 1ISVA 2BS9A 3BCFA 1W9DM 2D1ZA 5GQBA 4ZENA 2WC4A 3EMCA 4WKFA 4CD7A 2F7OA 4AD1A 4QCFA 1W9BM 2QPSA 3AYSA 3VINA 3BUDA 1ODUA 2WWDA 4MNKA 2FYVA 3WY3A 2ZE0A 1GOKA 3WEOA 5CQ1A 6CGTA 3CGTA 5BYWA 1EDTA 2Y8KA 1KQYA 1CDGA 4JCMA 1GQKA 1JZ3A 2GFTA 4PMYA 4M1RA 3THDA 5BXTA 4HA1A 5I24A 3S5YA 5BXSA 2XIIA 5KEZA 5I79A 2OLHA 5C8BB 2DH3A 1WCGA 1B30A 3CZGA 3SCWA 3W0KA 3OB8A 4CU6A 3WDIA 3SCNA 1CZ1A 4AZHA 3WF2A 4FF5A 4UQBA 2A3AA 4UOZA 3TTYA 4P8VA 3FW6A 4ACYA 1Z32X 1VJSA 2BY3A 3WDHA 1JXJA 2XIBA 3WMBA 4F9DA 3BVVA 2G4FA 1GJWA 3AMGA 4UFJA 5BCAA 3WL0A 2BHZA 3AIEA 1E4IA 4AIUA 2OW7A 1XCWA 5EFDA 3EDDA 3CV5A 5BXRA 5D4YA 4AZ7A 1XH0A 2J4GA 2F7QA 1XSIA 4UFLA 3WQWA 3KLLA 4KMQA 5KZ6A 1E6NA 2JIEA 3GH4A 3KZSA 5CPQA 3CUJA 4P7LA 3KL5A 3SCPA 4EE9A 3QHOA 3AS0A 1JGIA 1W32A 5A95A 4W8LA 4M82A 1V6YA 1R33A 3WUEA 4MB1A 2DSWA 3I3EA 4DM1A 4CCCA 2CKSA 3AZRA 3BUIA 1UR8A 1G5AA 4GZEA 1KCKA 1PAMA 2A3CA 1HL8A 2A3EA 4HPHA 2WMJA 1BG9A 2OYKA 2W62A 2XVGA 5DF0A 2JF6A 3AIQA 1JI2A 3W29A 2V3DA 1J0ZA 1JNEA 4UZUA 5AYIA 1E6ZA 1FH7A 1EO7A 1V0NA 3NUKA 1CGYA 4ZE4A 1UKTA 3WH9A 1M53A 3WENA 4BF7A 1CLXA 2X05A 3JUGA 3VIOA 2W5FA 4AZGA 4H04A 3A3HA 2AAAA 4GQRA 1ISZA 1K6AA 2MANA 3AMCA 1UD4A 5ECUA 4R27A 5ABGA 1ZB5A 1EH9A 1UD2A 3VVGA 2PWDA 1KXVA 2WMKA 4FMVA 5BRPA 2YL8A 1E55A 2YL5A 3MANA 4ZE5A 3WIJA 4KH2A 1W3JA 4GI8A 3T08A 4D6HA 3ARQA 2XPKA 4PSRA 2ZXQA 1E0XA 2NW0A 3QHNA 2BY0A 3S5ZA 1KFWA 2O9PA 1TQWA 2CBIA 1JFHA 5E9AA 3AFBA 1UQZA 3RDKA 1ZBCA 4AIEA 4D72A 4JHOA 2G41A 1LWHA 1IV8A 1WB0A 1QBAA 3IAPA 4P7NA 3DYMA 3AIUA 4ACZB 3S6TA 3B9AA 1B3XA 2J7CA 5I0DA 1HJSA 4W5ZA 1PX4A 3AHTA 1EHNA 1UR4A 4ZEPA 1CPUA 2ESCA 1Q6DA 1V3KA 4LYQA 4NXKA 3GXFA 1EXPA 2XG9A 5DMYA 2WBKA 4UTFA 4AZ6A 4GQQA 4AYSA 1E56A 5FL1A 4GI6A 2D20A 2JEQA 3N11A 2OW6A 4PTVA 1WAWA 3WBAA 2ZUWA 2G3NA 2W67A 1D7FA 3CO4A 2BHUA 2YL9A 1BF2A 4FNTA 2X2HA 2F18A 4MPKA 3OLIA 3VGEA 1GNXA 2QV4A 1LG2A 1QBBA 1JYNA 2XN2A 3A5VA 4C7GA 4MNLA 2XWDA 3GNOA 4H8HA 2E8ZA 4WSJA 4AEEA 1JL8A 5M03A 4CN4A 4E4PA 4D6IA 5LYRA 3MMDA 1US2A 4WK9A 2WNWA 2E9MA 1WZLA 1PIGA 3PTMA 1TCMA 3TOPA 1AQMA 2HVMA 3LPOA 1CNVA 3OG2A 3ARZA 5CSUA 4U31A 1R7AA 1D3CA 3MSDA 3LXCA 1MXDA 3CUHA 4BQ2A 1G9HA 2D0FA 4P8UA 2YA0A 3A4XA 3T0BA 1UH2A 2YIHA 3BVXA 3VD4A 3CUGA 3EDKA 3VGGA 4YHEA 5A8NA 4NX0A 4UQ9A 3VIPA 3WH5A 4AC1X 4OZOA 1PX3A 3L4TA 5D8WA 3VD5A 4LXFA 2YLLA 3VILA 4CN1A 2EPKX 3K1DA 1UKPA 5A2CA 1E6QM 1QNRA 4M80A 4PN2A 4MAVA 1DWGM 2WW5A 2ZXBA 1W9VA 4NRSA 2DIEA 3VX0A 3D5HA 1VFOA 4TXEA 1OM0A 3VU2A 1V03A 3PZTA 4KWUA 1VEOA 1V02A 3MV01 2VZUA 3AS1A 1RD6A 4D6EA 2DSUA 2ZXAA 1E6SM 1BAGA 4AISA 2ZWYA 1UH4A 3GXMA 3CZ8A 1OGBA 3WBEA 3GTNA 4PMXA 4FNSA 4TVUA 4P7RA 1AMYA 1V3LA 5E1QA 2PBGA 3MS8A 4CUCA 1HJXA 1J18A 4B16A 1V6WA 1HJUA 2XM1A 2UY3A 4OOUA 1H0IA 3GBEA 3RCNA 1XHGA 2XHYA 2FH8A 5CSYA 4PUEA 1H1NA 1JYXA 4H7VA 2BVTA 3BUPA 1ZL1A 4AZIA 1BGAA 3FAWA 2JE8A
chains in the Genus database with same CATH superfamily
4MS8D 3ARDC 3LKOB 1EDGA 4HJGA 4KWWA 3CIVA 3WJXA 1XWYA 4N2GA 4OH2A 2CXYA 4W9KC 2JKTM 1I7ZA 4N6FA 2Q71A 1X5XA 3WUWG 5IILA 4UBDD 4KRZA 4H83A 2XJ7A 3C5ZC 5FEBA 3IK2A 5TF1L 4WFHE 4CDGC 3SO7A 3I74A 1AR1B 1B6AA 2CZDA 4UTWA 1YAZA 3MACL 2IH1A 3GINA 5FD6A 3TPKA 1IIGA 2CM6A 2VO5A 2DWTA 3CSYB 3L5XL 1XUUA 2HRPL 1RSFA 4XP4H 3D33A 1MO0A 4HOBA 3V0IA 5IWLC 1RALA 1RKWA 3JWNG 3D1MC 4KTEH 1J5HA 2XZQH 1U30A 5FDWA 4A6DA 4Y2YA 4OOIA 3EGDA 4F9PC 3N40P 2X2GA 4HK3J 4MIMA 3X1GA 4JY9A 2ZA2A 3P8IA 2D03L 2Y2TA 3QQ4B 2AGJH 2ZRYA 3PPCA 4RNRB 4FXRA 4DF1A 4K94H 4OAWB 1WOBA 4XWOD 4NC6A 1ETZA 2QKIB 5CQGA 5A8QA 4K9EH 1Q3NA 3MODL 3PZGA 3NSFA 4IPIA 2DBYA 1EH6A 4NFCA 3P4MA 2LKPA 2OMXA 1E4WH 5A16A 2WSQA 1VH7A 4XA5A 3PZNA 1IF2A 3S1GA 3LFKA 2P0IA 3BO8B 4I48A 3HG1A 2UY7B 1MMDA 5IHBA 3OQ8A 3O6MH 4MZ3A 4X7SH 5TK2A 2FX9L 2WY3B 5IQ7L 1IAII 3B43A 1BREA 4Q4EA 4XN9A 3B6CA 1JNNL 4A8RA 2E56A 4IEJA 3V52H 1S5WA 1OCRH 3NR0A 5LNGA 2W27A 3CK5A 4AWXB 1J9QA 3IAQA 5AM1A 4J2XA 4FASD 5T1KA 5FO8B 1ZVYA 5LNEA 2CBPA 1FUNA 5KVFE 2OMWB 5F4XA 3K70D 4A05A 3KM8A 3CMEI 1PX8A 1S5LU 2BOBA 4ECVA 2AOSA 3VUAA 4OU0A 2BNRE 2WQXA 4C1NB 2BSDA 4AUBA 4TV5A 3G6DH 2EKGA 5JW3L 2PFHA 3SUSA 5JLWA 4Y2DB 1TJ0A 2I25N 2Z35A 5CJ8A 4OZFA 3LZRA 3TZVC 3US9A 4DP1X 3ZZLA 1WKYA 1F4XL 1JD9A 2HTKD 2K9NA 1FP8A 4MQ7B 5HS8A 5E4IA 4V1DE 2D23A 2BPBA 5JH1A 3K13A 3V6FA 4RQ0A 3NQ7A 3ZW3A 5KFHA 3L9BA 1UWEH 4W9EC 3BPCA 5G5IA 2NX3A 2LNBA 4MD4A 1O3QA 3F2DA 5FRMA 3GDXA 1OR7A 1T1ZB 5K9JL 4QDGA 2YLKA 2E6PA 5K3VA 1UW9A 5T1MA 3WV0A 4OIAA 5FGBC 3V4GA 3T0WA 1YNTF 3UNTA 3AZSA 5HYJA 3GXNA 4DP8X 1ZEAH 5D1QB 3T65B 3DROA 5EU4B 4A67A 2CH0A 1XO1A 3KLAA 4IQVA 3FNKA 2NT1A 5AG8A 3I6LE 3B3BA 3VM7A 2LY9A 1A6WH 2B2XL 1CXFA 5IVOA 2HHWA 4JFPB 3WE6B 1A5AA 2GSMB 4ETSA 4X7TA 1H0DB 1YDOA 4HB7A 5HVFB 3QBUA 5SX4H 5AWNL 5SWSA 3P69A 4LITA 3PWNA 2LABA 3T0YA 3QC0A 3TP3A 2CO5A 3GTTA 4UTMA 1DSYA 3MCKB 3NPWA 2PYFA 3VFPB 2VUMJ 4XNQA 3CMYA 3LKQA 3HOGA 5DHVH 1DQQB 3U4EA 1TQXA 3UC0L 4MNGE 3KHGA 1RY0A 1LNUA 3PO5A 3LH2H 2O5RA 5HTSA 3CUPA 4N2BA 3UR3C 1BHGA 1QR1B 4OD0A 1I0BA 4ML9A 3UIZA 5D6DA 3BT0A 2LHAA 1AS6A 2YPRA 1RJYA 3K4JA 5EE0A 3FDGA 2UYLA 2AJSL 3ZKMC 4GP8B 3GO2A 3KHDA 1UM6H 1GK8A 1NDWA 4Z7VA 3G6AA 1PSKL 3ALFA 3D0AA 2WP3T 5I77A 3DSFL 1HQRA 1WS8A 3W7RA 5BS0B 1J8HA 1FLTX 4M81A 3DFOA 1DQJB 4QHKJ 4YQWA 3DI1A 1CI4A 4PS4L 2WWMD 1XRSA 4KOCA 1XDMA 1NG6A 2I9GA 4CCEA 5FUZL 3I50H 3O3BA 2O03A 3VE0A 2GQ3A 2Y07H 3T8VA 1A5BA 1FWRA 4JDVB 2UZIL 1S7SA 2VLJB 5I30L 5D4HA 2EQYA 3IXTA 1E2VA 1BG1A 5KAIU 2YUWA 1DWJM 3KYKH 1OZUA 4GAFB 2VFGA 3WL9A 2WLLA 3FB5A 4PE8A 5F7WC 1M65A 4Y2LA 1RNLA 2I5UA 3ISPA 3CZUB 3GB7A 3CYJA 4KEMA 1JN6B 1RJLB 4U1NA 3OYFA 1RIUH 3N14A 3QUXC 2GSHA 5LA0A 5L3BA 4ANKA 2VR6A 1RPLA 3MACH 1I1FB 4PTXA 4TNGA 4WTXA 4X83A 4NCC2 4NYYA 1PFOA 1RUML 4JN8A 1DDNA 1GLNA 2A7BA 1MJ7L 1Z6KA 3TBVA 1X4XA 2RAMA 4GCVA 4US9A 1C92A 4UIMB 5C0JB 1Z7JA 1MJ8L 4WAFA 1R5WA 2GO7A 1RL1A 2VC5A 5BQDA 2F6KA 4RV8A 3WBWA 1FWHC 2BSRB 5LO7A 4P2YA 4I9TA 3LSMA 2XKUA 3LGGA 2HMCA 3UTQB 1I8LC 3W70A 2KIQA 1A6VH 1K4HA 4QJ3B 1XG4A 4JFFB 5EBWB 1ADQL 1MY5A 3KEDA 3WJJA 5CJXC 5JQIB 1XSXA 4YIIA 4YAQB 1A6AA 4ZO6A 2FBOJ 4LLYA 2Y61A 5IINA 3S46A 1ZQQA 5JXAL 5D32A 3WY2A 4H0EA 2J1WA 2I7GA 1AGEA 4M8QB 1O5PA 4OTXL 3C6EA 2PO6A 2CLVA 5EBMB 3WIIL 1X5AA 3U4BL 3V52L 3DA0A 1S7XA 4P8QA 3FXJA 2VE6B 5ACZB 1U1JA 1DJHA 3GX4X 4A2MA 3KBVA 4XOBA 3O06A 4N3TA 3QU7A 3ARTA 3BX7C 3HBGA 1QPKA 5EMJA 2DWQA 3M0VA 4Z7UF 4LC6A 4RFNB 4GEJA 4IHXA 1N0LA 4FYSA 3SZKC 2WTEA 3P4OB 2FLBT 3POHA 2DDQH 3D0VA 1XCFA 2BCKB 4WD0A 4QHLA 1FLRL 1IRXA 3AN1A 4NYLB 1G9ML 1UZ8A 3L23A 4DL7A 3VB8A 3NPVA 1CICC 4I9AA 2W9MA 1KY7A 3EPIA 1G9MC 4QAWA 4MJIE 3D3AA 1JN3A 1CBGA 4HZ6A 5D8JH 2YBUA 4JIQA 1MQ2A 3U0TA 3VE0B 5K9JH 4LS1A 1TTGA 1K5NB 1R3JA 1XLJA 1OTTD 4DK6A 3RWIA 4C91A 3GHEH 1XMWA 2ZNXA 5JQ6H 5GZOD 1JRHI 3ZD9A 3D25A 1GOWA 4KLDA 3PW0A 3QH3B 3EA1A 3DLAA 4QIWN 2A6EF 2XVKA 3GFYA 2OO6A 4QRUB 3CCQI 1F8MA 2D5VA 2RH9A 2ZMEC 2HBJA 4G6CA 3B0UX 1PHQA 2W24A 2OL3H 1A3RL 3IJ8A 2EEAA 5ANHA 5DD3H 1T80A 5E23A 4N0CC 4QTHA 3JPRA 4WRHA 1AI1H 4OCXL 4UUIA 5KZCB 3LKRA 3BKMH 4L2YA 4AVIA 4E7HA 1C8XA 2E5BA 3V2AR 3EJPA 2RQ5A 1TP4A 1V4RA 3ZDEA 1AGDB 3LH9A 1EEYB 1OP9A 3F0CA 2FDBP 2ITEA 2PTUA 3TK7A 2H32A 1LRTA 3Q13A 4HIEB 1UHMA 4XO5A 1P5UA 5EEYA 2QDVA 4G6KL 2QEXI 3VUSA 1FCBA 4XP1H 4B5VA 5C55A 4ABQA 3EO9L 4J9KA 1YX1A 4TUFA 1WDQA 5AYYA 3IHQB 4TULL 1PE1A 1N8IA 1Q94B 3GIQA 1AK5A 4IBWA 1YMYA 2PKEA 1W3LA 1D6VL 4FTVE 2WQUA 3B5GA 5LGXA 1QTSA 4QEGA 1U4FA 2B59B 3LXBA 2I9TA 1JHHA 1NDZA 4NL9C 4E9QA 2YDQA 5DG8A 4FOUA 1UUSA 1B1BA 3OX8B 3UZVA 5CINH 5GJTH 4Y4FD 3CFBB 4QRBA 5JHAA 4JDZA 4LKXA 1FVCB 4LCCC 4FRWA 4YSTA 5K4XA 5IW6B 3TN0C 3GTLJ 2NY0D 3U5UA 1QMUA 4MNHA 3CFJB 3V36A 4DYJA 2X1PA 3G8EA 4WKXA 6PCYA 3TS8A 2R59A 1LCOA 1WKEA 1QO3B 4PMJA 4AV4A 3EO1A 4KPHH 2ABAA 4YYCA 2FR4A 5DMIH 4ANUA 1SMOA 2R5ZA 1HLVA 4JDTL 1O57A 8ICNA 4S10A 1MD0A 2OZUA 1VYPX 3BOFA 4JTAA 3KZ8A 3KPSE 4WJ3B 3P4OA 4RDUA 3MCZA 7ICSA 5CUSL 4OZFB 3JVGC 3H6AA 3CWGA 3HUJB 4IOFD 3QLDA 1R23A 4XC3H 5DCFA 3IDUA 3KXFB 4K3EH 4FG4A 3IJ9A 4QITA 1DUZA 3FB7B 2CDGA 3EJZD 3AB0C 2F58H 1W5CC 5E6YA 1NGWA 9ICUA 4FQ2H 4ZNEA 4JE0A 3OZPA 4F8NA 4O2FB 1QO3A 2QADB 3G2GA 1THAA 3UXOA 2NS7A 2HWZL 4G56A 3LU2A 1KBGH 4U1JB 2BXZA 2YQEA 1EFZA 4JFYA 4I3GA 1OL0A 3BKYH 3QW3A 1KCRL 1YECH 4UB0H 2CC0A 2IPQX 1SW3A 5KFOA 5FKPB 1T96A 4YXMA 32C2B 3OR1C 3AY2A 4AIXA 2CKRA 4L8SC 2UY7A 5CZKA 3K4CA 1ACIA 1IWAA 2YX0A 1YEIH 3ZSSA 1BV8A 5E8IA 3CQJA 1YSOA 3SBQA 4BJQA 4F15B 2R39A 3NQCA 4QLRA 1QSSA 2XPYA 1E6PA 5BV7L 1W7PD 1IVLA 1JZ4A 1HOCB 2HZDA 1EVUA 4NT6B 4AH7A 1H3UA 5CEZE 1SDAB 3DO7B 4R4NC 4E0RB 3ULUF 2V5JA 3W25A 1AQKL 1EK3A 1QHOA 1X8CA 4G6AD 3JVGA 2QFRA 3BGAA 4K2SA 1FVDA 4YWGL 4XZBA 3CFJA 3VJ6A 4AL8H 1YG2A 1FHGA 1S6NA 1BYOA 1MELA 6ENLA 4Y9AA 3VWKB 4RGRA 3IGHX 1EOMA 2ADGB 2R0WL 4KNUA 1HSBA 1WBZB 2NXYC 2B0SL 2FZ3A 3TWCH 1I3GH 4MHHG 1UT9A 3S8WA 2XTSA 5A94A 5EWIL 3PVFA 4GY4A 1RLWA 2A1WH 4ODVH 3VFRA 4AOFA 4HCRH 4W7VA 4NXZA 5IYBJ 4Y96A 2C1PA 2NVAA 2PMZC 5HDLA 4H9MA 1U0QA 2P42B 2BVEA 5AW9B 4JPKH 1QSZA 1BYAA 1TKWB 5M3WA 5B4MC 2KICA 2DUYA 1YEGL 4HG2A 1E4LA 1S9YA 1AGDA 4O2FA 4JMNA 4Z2IA 2FEDC 1ZVHA 2Z25A 1CURA 5KT2A 3EJRA 2Z33A 1PVHA 3T8LA 4EZMA 1HEJC 4YHKL 5JOPE 3G3LA 4A68A 4DGIL 3SQIA 1ZXIA 4C59B 4D6FA 5AAPA 5F1NB 3T40A 5FAJA 2WN2A 4OCXH 3ZVHB 5E5RB 5GS0L 1DBBL 1ZJIA 3FTZA 4EXQA 3H9ZA 1R5WB 3H9HA 4XLEA 3V6FB 3KP6A 4Z2HA 4I2GA 5D6CA 3MGAA 4BELD 3EFOB 2NY2D 3H7BA 3ZMRA 5BVPH 1F5ZA 4R33A 4ZD3H 3WEMA 1QTMA 1YN7A 3NG5A 4HAFA 3OYEA 5EPDA 5GZOA 3CHCA 5TNVA 4PZNA 4B3ZA 3ABUA 2NUTB 1XAKA 1VPXA 1BVNP 3VVWA 4Q7DA 4EYHB 2VDIA 2Q76B 3NASA 4BSJA 2WAEA 4IF4A 2VDLH 2IBBA 1FNGA 1M04A 3SQBB 3I4PA 1OKRA 4JL2A 8XIAA 3M46A 3WLQA 2DZXA 1SO6A 4UOW0 4ALAH 4JRLA 3NQKA 1HWHB 5DD5H 3S9ZA 5BZDA 3VYUB 4CL7A 3VXPB 3CXOA 2XAHA 2K4EA 5F1SA 3HOWJ 3NO1A 2WXRA 3OB0K 5LIYX 1NDTA 3OAZK 5T33L 3JTSB 4F9LC 2CETA 4I48B 3V4VB 3HZYB 3CBJB 4WI4A 3BLYA 1T56A 3WF1A 1Q9OB 4XLCA 2CEQA 2ENPA 1DP3A 3DU5A 2HPTA 4CNIB 2QR6A 3BURA 3DERA 2XN1A 1V27A 4NRRA 2VAJA 4ASTA 1SLVA 4AX7A 3RYRA 2OJED 1KD0A 1U8JA 3B0PA 1D5VA 3HVNA 2Q5BA 4DEFA 3F4CA 3SQSA 2I5QA 5GTIU 4LVOB 4E41A 2XDFA 1UZDA 2H3BA 2V9UA 4PJHB 3UD6A 4HUXB 1OO2A 4YDNA 4C56E 3NDZA 3ZQ7A 5F7BA 2WTRB 3A0BU 2WNNA 3D2UA 3DHDA 4R97C 4FF7A 3BG5A 3LG3A 2X1SA 4BM7A 4ZTJA 1AHWC 2K4AA 4ZUUB 1IC7L 1NCAH 5DVLA 5LRRA 3C6LB 3BJTA 3F4VA 1XGUB 4JZ5A 3FU7A 2ARWA 1KFKA 9ICBA 2B4GA 1KTNA 1KBWA 3UJJH 4OQTL 5T3XL 2BDNL 2X2JA 4PJGE 3DROB 3RX2A 1KCLA 2GSIA 4ZQOA 3AFLA 4JZJC 1CE6A 4A66A 4ZMLA 3LEYL 5D2NB 2R94A 2PLCA 3CMOL 3TZVD 2J3SA 4KEVA 3QQ4A 3PFQA 2PZNA 2CBTA 3KOZA 4A3UA 4IXAA 5AVUB 4MA3B 2WAQF 1RIVH 2NX5A 3F1QA 3Q7JA 2ORBH 1UFUA 1V7AA 4N0YL 2H3DA 4L9LA 2K4IA 3LKQB 5D2NA 3LIZH 1A5SA 2NSQA 4TYUA 1DVSA 4OD2B 3HPJB 5FUCE 4EPSA 3PGFL 3TLQA 2XRAH 5EG0A 3GSWB 3GTXA 3U0HA 4M6MH 3F85A 1H0DA 4LBRA 1RFDL 4AQ1C 1Z48A 3VCLA 2IPWA 2CW0F 1EWEA 2WV3A 4Q97A 4OCSL 3BC8A 1I7ZB 1YRKA 1C5CL 2YGPA 5HHOA 1V6TA 3JCUC 4WFGE 1HA8A 4HKXA 1ZHNA 1XCQB 4FF5A 2XVCA 4UQBA 3FRPA 2D4DA 3RWCB 1L6PA 4S2SA 4Y4HD 3W83A 1J8HE 3DJRA 4RZ4A 3FFCA 3ZXWA 4FCHA 1WSST 4NZRH 2NS8A 1L3TA 2J9YA 4AIUA 2HR3A 1SC7A 2B7DT 1ZA3A 1QSFD 1R6RA 3KZSA 2NY4C 1SAXA 4JK0D 3KL5A 4GO1A 3A4JA 3NA9H 4UM9A 4M82A 1X38A 3TOBA 3PO2J 2P8LA 2IG2H 3PULA 2B81A 1G5AA 5IHWA 2VFEA 1PQZA 4DPBX 4BKTC 1SY6H 2PD5A 4PREB 1NGQL 2A3EA 4DKDC 3RAJH 3U4FA 5LLQA 3LS4L 2G2PA 1ACYH 3WU1A 3F8UB 9ICTA 1X3ZB 1E27A 1JCLA 4NGHL 5GS0H 5J11C 4U1NB 2FJKA 4FYTA 3BIKB 3S0PA 4UNUA 1N75A 4LB6B 3WKEA 1M7JA 4H6QA 4AIKA 4INFA 3GSNL 5CMAB 3HR5B 4KWOA 2ZG3A 4N2KA 1EH9A 4D0BA 3URBA 2VKEA 2NV1A 3DX6A 5HVWA 3UC2A 4A3LJ 1JR1A 4OKVA 4QNEA 1OGTA 4A63A 2WV8A 3MLZL 4JBRA 4HPYH 4Y9GA 1ZBCA 3BQTA 4JM2B 3VCRA 5J6GA 4A2GA 1WK0A 1J79A 2E36A 2LM4A 3BQ6A 2CG9X 4ZI8A 4IRSD 1GT0C 1S2TA 2MRYA 4Y5XB 5CIPH 2Y0SN 2UWEF 4F5QA 2KKQA 4Z7VB 4NQ1A 3ZQCA 2AJVH 4U1SA 1X7TA 4PTVA 1S3KL 1LZOA 4YSRA 1YYVA 4F5CE 2W54A 3CO4A 1A5NC 4HJFA 5FHAL 1MCHA 3T6ZA 2APSA 3PYCA 1DUYA 2X30A 3TC6A 1ZAIA 1RUKL 1U8LA 2FYYA 4IEFB 1I82A 1Y6NR 4N8CH 4H6RA 4KNQA 1DQWA 5LGNA 5KJ7E 4DKFL 5I6MA 1HAWA 3M1BB 1HEZB 3CUHA 3HOXJ 1EBPA 4O0ZA 1SXCA 1QRNE 3VI4B 2YGNA 2YIHA 4GKSA 4RUBA 4YFNF 3SAFA 1S5HB 2OVLA 4O17A 3TUUA 1OF0A 3QDMD 5KFUA 3IFOB 2EPKX 4XZ9A 1QNRA 4P4OA 4Z6EA 1WICA 2L9NA 5AIBA 1WQVT 4NUWA 2E7LA 3S1UA 3OAUH 3INOA 1R3KB 4DS5A 3FO0L 4TXEA 3R94A 4HUXA 2QUMA 4L8DA 4S3EA 4HCLA 2N8GA 5DKWA 3CJPA 1E5UI 3IRSA 5DURB 1X9QA 3OZYA 1B5TA 1FBIH 4V1XA 3UZQA 3OR6B 1IAKA 3VH8A 3LV5A 1F2XK 1JX4A 4JE4B 2NCMA 5GRUH 4CUCA 5F0LB 2R82A 4KPHL 1SM9A 3KBBA 3OSFA 5D8KB 4KCWA 3NIDF 2Z7WA 2BGNE 2HYFA 4R34A 4GKNB 1K7FA 1K83J 1MCRA 3DI2B 1IGTB 3WTSC 1TDQA 4JZJB 3SFZA 3RB0A 1P7IA 2JQZA 4JY5H 3ATDA 3AICA 3OPZL 4UTBA 3ESOA 1EJWC 5I00A 1HXMA 5I6SA 2FQEA 1U8MA 4Y4KC 1QGPA 5AKQA 2VQ4A 3FEQA 1RUQH 3MI3A 8ICRA 1NK8A 4DJFC 2WM0A 3FOLA 3TT1L 4GOAA 3SO3C 5A2JH 4PMVA 2FSEA 1TQCB 3GPEA 4E9YA 1C5DB 1HILB 4PCKA 1WV2A 4YVUA 4H8NA 4HAIA 2F5AH 2KZGA 5DLMH 1F6KA 2ISOA 1ZQ1C 1H11A 3D39E 3BI9X 2FNPA 2Y7QA 3F03K 3MBDA 4GRLB 4AYEC 2WLNA 2K7PA 7PAZA 2N1RA 1XZ0B 5CKGA 4FG0A 2XY7A 3OM3B 3N44B 1MRQA 4R5VA 2VDPL 4QOKE 4Q8EA 1E1CB 3CW2C 1G0XA 5BV7H 1MJUL 1Z2KA 5J0BA 2VERA 1MNUH 3KWSA 3P93A 3ID7A 1JDEA 4UNTA 5DRNB 4Q6KA 3B8VA 4DLFA 3RFZA 4DUWA 1MCOH 1OC5A 4LLNA 4CCOA 2C1IA 2J88H 4OFIA 4Z7WF 3QJUB 4FTVA 2WADA 2XFRA 3ED5A 3CC2I 3UNGC 3A47A 2CERA 3TO2B 1I6HJ 1U8BA 1K3UA 4XN4A 4HSRA 2H9AB 3AU1B 4X7FC 1W1VA 2CUEA 4ANWA 3BDKA 4YIRX 1KSPA 2AXTC 4DYQA 3PREA 1HHIA 1WBYB 2VDPB 1EGMA 2NVYJ 4ZTXA 3HL2A 2PGEA 2GVGA 4C6DA 3PPSA 1I0DA 1QASA 4ZNEE 2PP0A 3LA3A 1JVKA 4Q2ZA 3PS7A 1L9RA 2E9LA 2NY7L 4NZFA 3Q8AA 3HC2A 3MZYA 3LHZA 1QSFA 2DEPA 5I3FA 5KFPA 1IRFA 1KLGA 2XAUA 1Z5LB 3RFZC 1XYFA 4M7SA 4PYHA 3RO6A 3E6FA 1PL3A 5GNZA 4HPYL 4FFYH 4HBCH 3NTCL 1EO8L 4J27A 1DQUA 5FR3A 4EI5B 5C0RL 3I71A 1Z4OA 4Y19D 3LVWA 3BEWB 5F1OB 3KXFD 3BZDA 3DFTA 1T38A 4Z7NE 3R8HA 2G2RB 3G6MA 2EQRA 1GGOA 1TIMA 1FWDC 4JM2F 4Y5YA 4LK0F 3WJJC 3WD5H 1F8TH 5T1LD 3TOYA 4EXAA 3TCLA 3TIMA 1UACH 1V5JA 3CH9A 4ZZ9A 5A1AA 1DBBH 3CQFA 5FL0A 2ZYFA 3NQ2A 3TJHD 1U42A 3C2MA 1BQ5A 2VCAA 1ZE3C 3HMJG 3TA9A 1X4PA 2DQFB 1KBUA 4L0ZA 9ICNA 3ERXA 3RR4A 3M45A 2M5WA 3WTTA 1OFRA 3G1FA 1R24B 2XCMC 3FXIC 4BUGA 4L4MA 5H20A 2QW5A 1FCGA 2I10A 5KT3A 3H3UA 2E6QA 1Q6OA 1K70A 2DMPA 2A6IA 1OAKL 1PKOA 5GGQH 4X0NA 2DAVA 1P4XA 3FHEA 3K4MA 4K23H 4GW5A 4D6CA 5DEJA 4S11A 2A1AA 3MUAA 3CQPA 4AGNA 5KSAC 3TYFB 2RNGA 5HMLA 3OZMA 4P4KB 2XASA 4X61A 1DWHM 2BJML 1J7KA 3PJNA 3RU8H 2FXAA 2MAXA 2C9RA 3G04B 3VEPA 2Z7ZA 3CAQA 4TSAH 5AAMA 1OQOA 2OFJA 2H3KA 1AHWA 2GEEA 3QDHA 4JPVL 3KGUA 2E2JJ 1OIFA 1K1QA 4XZLX 3UX9B 3BQ0A 1RLBA 1VI0A 1OY3B 3D12B 3SN0A 4FQXA 5AW0B 3DVGA 4Y1TA 2DBLH 5HNHA 3FSVA 4LVNB 1H9VA 1LQSR 1A8ZA 1RA5A 3I4MJ 2RJHA 1LE9B 5HI4C 3N9GL 3HPGA 3ZE1E 5KTEL 2QEJA 3ZQHA 2UZYA 3M43A 4TL4A 1FXPA 4M8UA 2KN7A 1IAIH 3C5ZA 4HHHA 9ICPA 1A2YA 2ZOKA 4ETQA 2G5WA 1LEIB 1IR1A 4RAHA 3MKLA 4KIFA 4E9TA 1VLBA 1PEWA 5EA0H 3QV6A 1OF6A 2GJPA 4KI5D 3IJYA 1E50A 3UO1L 1M6UA 2HMID 3F5AA 5M7QA 4FAMA 4PLNC 1D8BA 1F73A 3A0BC 4BSWA 4OD3L 1YJDC 1U92A 1E67A 4NLAA 3B7RL 3BW3A 1FNEA 4BK8A 4UTJA 1T89C 4LEQA 1CQTA 3ARPA 1MEWA 2CK2A 4X0KA 3O11A 4RQ7A 4S23A 3GLAA 3KD3A 4TX6A 5D9OA 3TJLA 1UFMA 1Q9WA 4E9WA 3Q8EA 5HHNA 4E0CA 4LLDA 2DTRA 2W9AA 5T3XH 4LF2A 2OXHB 2QARA 1GVFA 2K9MA 4HDVA 4WNQB 3HNVL 4LG0B 4LCIH 1RHHB 4AX6A 4M62H 1OFBA 4IOSA 4HK7A 4ZYDA 3EKGA 5GNYA 4PJXF 1E3ZA 3BGJA 2GOUA 3P11L 1HC8A 3KVMA 2PEXA 3ZDDA 4MADA 3P6LA 3ILPB 5F1UA 1UHVA 2WVSA 2ZZ6A 4DQ2A 4MX7B 2KLTA 5DJZA 5AKHA 1RIVL 1KM6A 2V2WA 4BQ4A 4QXWA 1R5HA 5DZJA 3SDXF 2QLTA 3MJWA 4OIQF 2Z4QA 2WBJA 3MHFA 1ZLEA 2J12B 3WODF 2G9HB 3DRQB 4KO9A 5IB4B 2DY2A 3MX0A 1IEVA 1ETA1 3SQNA 4QPQA 4YL9A 5E6SB 4HKXB 4OF5A 4M1BA 1ZSHA 3WLIA 3MBXL 4BL0B 2K86A 4PGDA 1EEUA 1MBFA 3JSOA 1A9EA 1JJKA 2YN4A 1MW1A 4UB4A 3R7RA 2YHGA 4ZZLA 3MBEA 5LGHL 4WO4A 3F4NA 3ITTA 2L01A 1HQRB 3HS8A 5FYLE 2HS8A 1A3XA 1KL9A 5D1XB 2Z9OA 3SN1A 1GKEA 2JN6A 3WGVB 1XR9B 4JLRB 1KPVA 4AMCA 5MERB 5LHEA 4HCGA 1PXGA 3M1OA 2DK5A 2ZTDA 2XIOA 2HYJA 3W28A 1YY8B 1SN2A 4U6VL 2VONA 4A1RA 1WKDA 3BUVA 1SY6L 5G4MA 4JQIA 4JRWA 3EF4A 4QWDA 4KS0A 3KPLB 2CBOA 3HEFA 4MEXF 1KY6A 4P46C 5C09B 4H3DA 3LD5A 2F8KA 3KBEA 1AAJA 4PJIA 4W4OA 3MLSL 3MV7A 3MV11 3ZXAC 1CDBA 3FQUA 4PMOA 1WZMA 4XNQB 1UGKA 5DUBB 5MHSD 3OAYH 3FA4A 7CGTA 3F7RA 1JNHA 1KN5A 1OHLA 3DUGA 1IM3A 5KAQG 3PFMA 1PS9A 1Q8JA 4NN6B 1EF4A 2EVIA 1G6RH 4XBPB 4P2QE 3RH4A 1WNOA 1E43A 1TTUA 2IC2A 5EUOF 3W2KA 3MLVH 1QUMA 2KL6A 5C70A 3F05A 2Z93A 2C6QA 5HHNB 1AKPA 3EH1A 3VYRB 3MY9A 5ICFA 2E8OA 1VBHA 4G8GD 3P9MA 1W5TA 1T3QA 1LVEA 3RU8L 2XV2A 5MEOB 1TSRA 1BFNA 1V7YA 1EHXA 4QNPF 5ISZB 3T5JA 2WLZA 2GDVA 4DRSA 2CBQA 4P5KA 4F7MB 5JHUA 3BWAB 3CSBA 1EX1A 4AV0A 2P5KA 1H15A 1VQ9I 3AM9A 5K7ZA 1DLHA 2QSQA 1N59B 2NY1B 1K79A 4XMKH 2DH2A 5K39A 1BFOA 1FBQA 5TTRA 4J3WA 4Z6AT 3LSJA 3D52A 1YPIA 4BZ2L 1PL9A 2CW7A 1BQUA 2J27A 3A01B 1MRAA 5IQ7H 1NQBA 3KPSB 3VVVA 1QI0A 3BKJL 2R24A 4QXUH 3R0AA 2EH9A 4IF2A 4OJAA 2WOBA 2DZSA 2D3NA 3MMTA 3K0WA 2L4AA 4Z78A 2EDXA 3I68A 1IW7F 3PIQB 1F9CA 1KTCA 2QCEA 2NY6C 4H8WL 3LCLA 4YPGB 1UVQB 3CVIL 2KDOA 4PRPB 2IGTA 5AZ2L 1JSYA 3IJLA 2GJNA 5J8YA 4Y4RA 2BWQA 5ALCH 5F1IB 1TMCB 1NU5A 3B6SB 5I8OH 3PW4A 1HKSA 5FKYA 5ALNA 2JB5L 3AIVA 4GAJH 2F53A 2NQ9A 3EG9A 3D51A 4XRCB 3QY6A 4GO8A 2ES6A 1HBXG 3S6OA 4GK8A 2G2RA 5I75B 5JXQA 5E99L 4O52A 2EUXA 3NL3A 4Z3EA 2C4XA 5LJYH 5L9XA 1EA3A 2RP5A 1KEGL 5T5FL 3MRNA 3W7IA 4ZB2A 2B1HH 5FFLA 4Q9RH 1QK0A 4WHTB 5EEGA 2WJFA 1LEIA 3T2NL 4YHPB 1T7VA 3C8NA 3K4DA 2KZZA 4FXGB 4S2SB 3KFUF 3W81A 4D5CA 4O9MA 2LLLA 3IXTB 4N1EA 5KFGA 4MKNA 4IQUA 5HHOD 3WTVC 3IN5A 2ZPKH 2RCSH 4QRSA 4AF0B 3AU2A 1R71A 1NCOA 3PZVA 4LP8A 2PLJA 4OV5B 3BQUC 3QUMH 4A04A 3WMPA 1YEWA 5IESH 4QCIB 3HJ0A 3FTSA 1RUAH 3ARFD 1FL5A 2ZUUA 2LFBA 1A7OL 1BC8C 2CM5A 4A3FJ 3LK9A 4B5UA 1W3TA 3B8YA 3VXUE 3B7TA 3LQGA 1JHFA 2YR3A 2EG8A 4D9LL 2BP0A 1WZAA 3QDGB 4CZZA 9ICHA 1YNYA 2IWKA 1TZGL 2OCFD 2VD8A 2IW5A 4JQAA 4BKLB 1OGPA 4KLOA 1ORSB 2BNUB 3X12B 4C9YA 4KA4A 5F0MB 4L9JA 1JJ6C 3JPTA 4ZBCA 4XVTL 1J88A 2CHRA 4BKXA 4GW5B 3ITYA 5A6IA 3PAYA 1EJUC 1VSCA 3KWVA 3ABMB 4LAKA 5E8NB 3MRCB 5A3IC 3I4NJ 4M48L 3L2MA 4N90E 4R8WL 1N4XL 4L8DB 1RV6X 2C7UA 2V81A 3C5JA 3JXAA 3QOEA 1CFMA 2J9ZA 2W91A 1I1AD 1E5JA 2M8EA 4PB3A 4KVCL 1WD9A 3L9RA 4HV8B 1OOAA 5M95B 1BQLL 4YTUA 3B97A 1S76D 2Z65C 3QUXD 3TCEA 4F7KA 4DKEH 4KAQH 2J4WL 4M19A 1H6TA 4E5TA 4WWKC 2Q86B 3CWHA 1C08A 1XT5A 2GJRA 4G5DA 1R3HB 3X1BA 4H2AA 2CHWA 4NZJA 4N8PA 1CYGA 4R7OA 3PM6A 3OLGA 5EOQH 2IAMD 1BEYH 5LBSL 4R3SB 8FABA 4X22A 5ABDE 2O4QA 4WNSA 1W6WA 2KUTA 1KPUB 3MLWH 2VXUL 5FOJA 2C9PA 4XKBA 1RD5A 2NRWA 3CB8A 4R2GD 2X9YA 4AIZA 2A9MH 3WLTA 3WEZA 1H3GA 2ACJA 1KKRA 1T83A 4RFOL 1ODDA 3MRKA 3W87A 3W1ZA 2JGYA 3KLOA 3QG6A 3FK6A 4ITVA 1JV5B 1CL7I 4ADGA 3PAOA 1RU9L 1EPVA 4AEIH 3NTCH 3HOUJ 3T1BA 3PJRA 3BESR 4YE4L 2C15A 2CV2A 2VN3A 1L7OA 1P9QC 1ZLUK 3RTRA 1Z05A 4KDTC 2FEEI 2ALDA 4L7ZA 3DC0A 1U41A 2XVTA 1T2QH 4X63A 2FH6A 2BP8A 2CRZA 2XIGA 1H41A 4UUTA 1I8KB 4KEZA 5FJOA 3MV7D 3M41A 2JWTA 1QHHD 4U6YB 4NQWA 3VPLA 1F8TL 4NVTA 5DS1A 1WPKA 5FA4B 4WJ8A 1UACL 1DIDA 3RWCA 3AREA 4B9GA 4M0AA 5FHBL 3XINA 2BVWA 4AXWB 1GKQA 4XXWA 2VX6A 5LXXA 2ADIB 3WEXB 3W2JA 5TQ0L 1F3DH 1NI3A 1H5YA 2KLRA 3P80A 2FGBA 4QTIL 1BIBA 1K8DB 1A5FH 2AK1L 5J2KA 4X1EA 1NFDF 1H5BB 3G6JE 3KR3L 3BP5B 2NXZB 1L0XA 2D7NA 1VCGA 1WAUA 1VFBB 2ZD0A 2GOLA 4EJWA 3ILQC 3GDKA 4ZPTA 8ICLA 1RH9A 1GAFL 3D3VE 3U7VA 5KSUB 4BWUA 1L6ZA 4G1EB 2CKNA 1F2QA 2Z91A 1TPB1 4WCGA 2LF8A 3UCRA 1SJDA 5ALSA 4AQ1B 4MJ5A 5GSRA 3QV8A 1HCRA 4JJ5B 3D3FA 3H1CA 4U7DA 7ICEA 1ITQA 4F57H 3VFCA 1JIHA 3IPBA 1H8AC 4S04A 3PANA 5IFHH 4UQDA 5F04A 2DBLL 1ONEA 1ET7A 1EEXA 1I9CB 1LT8A 3BG3A 1BOGA 4BSVB 2GQAA 2D73A 3INUL 1XC4A 3P2DA 1G4MA 2ZG2A 1YDNA 5J6SA 2GIVA 2BERA 2GQHA 2A0LC 5C08B 4RX4D 1PLGH 1MJAA 4PQXA 5CZVH 3FSAA 5F3HA 3QVQA 6PAXA 4TVDA 4QRUA 2RMNA 3RG1C 3V9EA 2CZVA 5FW7A 1PHWA 2L5HA 3HA1A 1F07A 3ARVA 2DY3A 2K4JA 4X7DC 3TESA 2YS4A 4XAZA 3GG7A 2XJLA 4CD4A 1JMZA 4LIQL 3F83A 1QA6A 2ZUNA 1D5XB 2KAUC 5AKVA 4HW6A 2VL4A 3QA3B 1QSEE 5F2GA 3ARGA 4FX7A 5E3LA 5IRPA 3WY4A 4ECTA 3NJKA 4XGZB 2H5XA 3BCFA 3Q45A 2D1ZA 1EWDA 1H3XA 4BFRA 2POZA 3O3AB 4EAYA 1K1DA 1VCAA 2ATKA 2JF1A 1FEZA 3WY3A 3ZUCA 2XWBB 3DG7A 3U1SL 4JIIX 4O54A 1OCNA 4ECNA 1N0LB 5BMFH 4PFOA 4IWWA 2BFVL 5AW8B 4ZZFA 4E2VA 5SWQB 2OLHA 3RR1A 2O6FA 3TA4D 4LPUA 1E2XA 3SCWA 4DK5A 3V16A 3WF2A 3QEQD 4OFCA 3KLQA 3H6JA 1N4XH 2R51A 4X8XA 4XAWH 1MFCL 2BO0A 2RDIA 3C12A 5EZJA 2AL2A 3ONNA 5E0KA 5HWMA 1F90H 1XYLA 2ZFWA 3EUHA 3B2UD 4IEFA 5E8DH 2RQ8A 3AIEA 3IS0X 5EFDA 3R19A 4DK3A 2FGWH 2LAAA 3FRPB 2W9BB 3IMRA 2JIEA 1L5GA 4K36A 5CPQA 3GZQA 1WA2X 4A21A 4NZTH 4N2DA 2VPRA 4OI8A 1RDFA 4AC2A 2C9XA 4MB1A 4RZ5A 4BEQA 4YVXA 4XNXH 5EOQL 1W72L 2HVJA 3EBAA 1KUMA 3CCMI 4PLKC 3NZUA 3GHUA 2OYKA 2HQ5A 1UENA 4NAFB 1CYXA 4EVZA 5C9KA 5F72S 1WSUA 2JT1A 2K6ZA 4ENNA 4J3ZA 1IKNA 1ASOA 1MREL 5FJRA 4H0LC 3TADA 3JS3A 4RFOH 4PLJD 4LNCA 1I9IH 4QMEA 4BHYA 2QYOA 1NZBA 4D3CL 1B43A 3LEXB 5GJPA 3CD6I 2AAAA 3GUDA 4HA8A 1YRNA 1CE1H 1JERA 3IJYB 2Z5UA 1KXQE 4MKVA 3WG7H 2E3VA 4FJYA 1AWCA 4I2IA 4K8RD 1MAMH 4ZC3A 3SEIA 3LQLA 5CZTA 4KH2A 3NFPB 3ILQD 5J1AB 3S5ZA 4L4VB 4P2RA 4CILA 3W6YA 4RFNC 1H0MA 4F92B 2M2DA 5CD3B 5KS9B 3LDAA 2PAJA 3MHGA 5E24E 1YECL 5F8RC 3GZKA 5AVWB 2CSOA 3OKKB 2FEZA 1YDPA 4O8RA 1V3KA 4WFFE 1HKTA 3SDAA 3GG0A 2JB6A 5F8QC 3P84A 4KKXA 4AYSA 5DC2A 3LLXA 1U91A 2DYPB 4DFKA 3CXHK 3QPXH 3LNEA 4MJIB 3VPRA 1QBBA 1MH5A 3W76A 3MI2A 1MHHB 5I71B 3Q1SL 4QLWA 1MHCB 3G73A 3TBIA 3OXSB 5HYJD 3MJ8B 2D9CA 3PTMA 1U8RA 2J1YA 2FT7A 1CNVA 4U31A 3QCTL 1MXDA 2J6SA 4HD5A 1VQMI 4HKZB 3M5ZA 3T0BA 4QO1A 3Q5OA 5J29A 3T3FA 1P1VA 4G72B 3AG1H 2P52A 1G69A 3JWDL 4RR4A 5DRZB 5D4SA 5B1BH 4KKBD 4YWGH 3PUFA 1KJ2B 2JB6B 4IPJA 3EDPA 4CN1A 2Z4QB 3FU8A 5HJXA 3K1DA 2A61A 1S5IL 1XBRA 4IMEA 5E1ZB 2PFBA 4OF8A 4HVXA 2RDPA 2IFFL 5AD0B 1AFSA 3AY4A 2ZXAA 3QIUA 2XPZA 5AI5A 3TYDA 3SV3A 4PWGA 1I3GL 5F6IC 3T4CA 3GXMA 3JV0A 3HWTA 4JX6A 3VSQA 2E5SA 1QO5A 5KW9H 3B9KA 3V6OE 2AS5M 3V0TA 1XWVA 1PLGL 5E1QA 2ZA3A 1YTKA 3I1YA 1SPQA 2BNRD 1N3NB 2Z8WC 1NFKA 2A83B 2DPDA 2EDQA 1XHGA 3MPGA 1RQHA 3MYJA 2B1OA 4A7SA 3ERMA 3V4VL 1L6SA 3WHBA 4AZIA 3O11B 5DJ0B 3LOTA 1UZ1A 3QP6A 4GYPC 5HHXH 4FFWD 5J13C 1CQKA 5IIEA 4X5WA 4DQSA 3VD1A 3VFVA 5ALCL 4U1MA 3UACA 5MEPA 2DDQL 1A02N 3WNPA 2YA2A 1CIDA 5A6AA 4F2SA 3LMYA 3SM0A 3K2UL 5HOSA 2DLGA 5F3BB 3AB0B 3RRHA 2YEQA 3NSMA 3VUPA 3I6RA 1COKA 4PJCB 1EBGA 1WCLA 2UXVA 1T0MA 5FYKE 2X1TA 1B90A 1EV2E 1N6QH 1FV1B 5EDXA 1VLWA 1TWDA 4QHPA 4J12A 2HHSA 1D7KA 1AXTH 5DQHA 4MJ4A 3QY8A 5KSAA 1PV8A 2OA9A 3VOCA 4A3HA 3P77B 3P0XA 4AP9A 3ZCOA 3VNKA 1L7IL 5AKZA 2X4PB 4PGXA 1UPPA 2ATAA 3I02B 5L3GA 4XAWL 1M7DB 4LEOB 2MUCA 1N62A 2DDBA 1GPWA 2K3FA 3VZXA 1TJHL 5CJXA 1BYPA 3L65A 3HOVJ 5E3MA 1NY1A 4I0BA 3OHAA 3ZDAA 3SDCD 1A7PL 1YEJL 1FXQA 2O7OA 1PCSA 3T2PA 3ZDWA 1U8NA 2K8BB 4NKIL 2E1WA 4K3ZA 3WGHA 1CXKA 2FX8H 4PL1A 3DJ9A 2OJEB 4CGTA 5IMMB 3UMGA 4ECUA 5LIWX 3GXUB 3ARGD 2GG1A 1HNGA 2ZJAA 3LZ5A 1DXFA 4ORGA 4Y1AA 4Z7UB 4OWRB 3FKJA 5MEQA 5KSAB 4XVDA 2G50A 8ICIA 3QEQE 1A3HA 4GEIA 4PJIF 4GLEA 5D70L 1J8HD 2EACA 1BPLB 3KOWA 3IE9A 1W9UA 3H6OA 5L4MA 2D69A 1UD5A 1JVLA 1L9TA 1FH8A 2CU0A 4GBXD 3VAEA 5AL8A 2AJ3B 4E41E 1K7EA 3VE7A 1W9PA 1G1KA 2WAHA 4O2EB 3NCYS 3X2QH 3UNDA 2O6EA 3WTYC 4RE2A 2IF7A 2LHTA 4XMTA 4KWVA 2DSVA 2JCCE 3H36A 2OZ4L 5ESQA 4RBPH 1IC8A 4NC2B 3D06A 1JPIA 1GZJA 2P81A 3UWYA 1DJYA 1PD0A 2V69A 2EH7H 2RQQA 4LVEA 1CXHA 3RAXA 3FY1A 3SDYH 4PL2A 5FLXZ 2FDMA 3C21A 2ECCA 3V1PA 3GW0A 1DQXA 4CVUA 1ZBWA 3D18B 4IOSD 2IQAA 1FX7A 3SKMA 3GDLA 2ZIUA 3ZTJH 4MUPA 2P5WD 4OTKA 2I6XA 5IW1B 3QO1B 3BSMA 3OLEA 4DQOH 2X7LB 4MD5A 2OMNA 4N7QA 3V5DB 4UT9A 4FZNA 2A38A 4PJ9D 1P0BA 4AM0Q 4DXKA 4NRYA 3S35X 1B9ZA 1AFVL 2PG4A 2D0HA 3PG9A 5T1JA 3SKOB 4FQHA 4JZOB 5HYIA 5HNKA 2J6XA 1JPSL 2GI0A 5JUEL 1FPQA 6A3HA 3MLRH 5G4WA 1AW5A 1YNKL 2Y7LA 2DJIA 3EH4B 1FWIC 1XIWD 5KVGE 1OTUC 2X1XR 1T2QL 5JHDE 4XQ6A 3F9KA 1FL3A 3WQDA 5JHLL 5AL0A 5EEZA 3T09A 3OYXA 4TLSA 3GVQA 2DKSA 4ENKA 3A67H 1ZKGA 3HKZF 4UB1A 3MCOA 1ELSA 3DMMC 2XH0A 1FAKT 2R29A 3FUJA 3PZQA 4KZ0A 2M1KA 1JFXA 1UWUA 4UWMA 5CZ0A 4MQXD 2HX8A 3FS9A 2XKPA 5KL8B 3F7YA 2VRJA 2JK5B 4DF2A 4O14A 4MTDA 4WTZA 2AXGA 3GZPA 2IXUA 3RPIA 2JEFA 1KLFB 1RZKC 4NT0A 1JKQC 3VXOA 3HUJA 1SW7A 2MLKA 3OOPA 2Y5QA 2KZHA 4NAFA 1TZLA 4UQEA 1WJFA 4XNDA 3VXMA 3W2VA 5BNGA 4P3CL 3Q2VA 5C9UA 1BTCA 4IIFA 2K45A 4ESKA 5FLMJ 2VR5A 1A04A 1VPOL 2OV0A 4I3RL 4TVCA 5AVXB 1Z8AA 4XMLL 2BE5F 4AENA 4Q8OA 5IHZA 2HFFA 4QRNA 1MFAL 3R11A 1I8MA 4G1NA 5JVGF 4X5QA 1S8DA 5HHXL 3MV9E 3OZLA 3SPHA 2P10A 3AXIA 3OOUA 8ICHA 3UPRB 1HO1A 3N0PB 1CU4H 2Y1AA 2VOTA 3BP7B 4L2LA 4RSYA 2YCLA 1ZA6B 3MTRA 4HJJL 4YAQA 4B9FA 1GGTA 4S1SL 4K38A 5PCYA 1UB6B 3MV8D 1TLMA 4K2EA 2BCSA 1Q90A 4GI4A 4JICA 5CBEB 1N64H 4M6XA 5T5FA 4DN3L 4EAEA 3DGBA 5KNIA 1TYGA 4PBWD 3ONBA 1NICA 3DFPA 3H92A 5EF1A 2OCCB 3PZIA 4J6IA 1SZNA 3LHWA 3BTLA 2P7TB 3MLTA 2BPFA 3ULQB 4QY8B 3FWEA 4JFHD 5J06A 3C1ZA 5DJDA 2VDQB 2XQBL 3OQ3B 3RMJA 2DIBA 4K7VA 1KLUB 5L2KE 4CADA 2XG5B 3VYSB 3VXME 4PJGB 4R97B 2GUOB 4NQEE 1YVLA 5J2AA 2MOVA 5ALGA 4D0DA 3DURA 5DFVD 4YIWA 3EGSB 2Y24A 4TUJA 2YYTA 5D2NC 3C60C 3BS5B 4UAOC 3FT9A 1T7WA 1PK1A 2W11A 2OX5A 1IT0A 4A7TA 5BMFL 4PV1C 3RBDA 3NMEA 2CLZA 1FFUA 4MB5A 4FHAA 1R3JB 2IDFA 2BEOA 2DQIL 3CJJA 4YN5A 5ACMA 1CLYL 5KVEL 3LRGA 2VE6A 5ACZA 1M1EB 3KTSA 2ACRA 3VA6A 5JIKA 2EFOA 1O94A 3WFCH 4KNYA 1FYKA 2XKNB 4U5IA 1QW9A 2G7UA 1HTYA 1XSVA 4BX9C 3ZUNC 1LP9A 1ZQGA 5KSAD 5EU6D 3SDAC 1FGVH 1ZQDA 1XDJA 4KK5C 3QIUD 3JRCA 1OV8A 2VSKB 2DWDA 2YAEA 5T1MB 4MCMA 2VABA 2HFEA 4A22A 3ZE1F 1RK0B 3TJPA 3FEMA 1F11A 2ZSHB 4YBLB 3B5TA 5CH9A 5T5NG 1RLDA 2ZDRA 2CD0A 3V0GA 1BZQK 1WDRA 5LBSA 1V05A 1K77A 1TTYA 4ABVA 3P0YH 4CSTA 4ICMA 3DPBB 2EG6A 1QOPA 2NSOA 5HHVH 4HYTB 1CX9A 4BD4A 2FRHA 5JBDA 4NQCB 5J6GB 3PG2A 4MGGA 3TDFA 1J6PA 4ZUUA 4M9HA 1W5OA 1EP3A 5TE4H 3GQCA 5ALWA 3U2SB 4KISA 1K5NA 1NIDA 2A9CA 3LI0A 2AJXH 3OMAB 3UJFA 4FAAB 1Q1VA 3WEXA 2GTWB 1CD0A 2ADIA 2VM4A 4PR5A 3HSFA 1JN6A 1UB6A 1UWXK 4OLUL 3BKCL 3DBLB 2DT1A 3UTSA 4QF1B 2JALA 3R6IA 3QJAA 1JGGA 3Q05A 4K1GA 4XBFA 2LBOA 5K9OB 1V8EA 4NM1A 2ZXDA 4HOMA 5D1QD 1IT9L 5KSBE 1KIRA 1AHDP 4ERSH 2X1WL 1SDDA 7TAAA 4ZOHC 4PJCA 2OZ8A 5EZOH 1AOZA 4HKBB 1LJ9A 1Q9OA 3GZFA 3VWJD 3MP3A 2N1TE 2HG5A 1HH6A 2TSYA 5DZVA 4Z0JA 2FTWA 5D4JA 3GBMH 4Z7IA 3NIFB 1ES0B 4HX4A 4BU2A 3G1OA 4E7JA 3GILA 3QULB 3LKSB 1GPFA 3GT6A 7ENLA 1RSYA 1ETZB 2OU4A 3MRJA 4KLEA 2FSWA 2DT6A 1I1AA 4QYOB 1MNDA 2CYGA 3L2CA 2CO7B 8ICYA 3VXQB 1B4LA 3HEIB 3H2CA 4M8QA 3UQNA 5J5RA 3UMBA 1Z44A 4NC8A 4ZCWA 3KUMA 4AC7C 4PGZA 2HA1A 4AQOA 1QR1A 1MFMA 3MGTA 2QEZA 3G9AB 3WBYA 2OTUA 4JKLA 4OCLC 4TMCA 3ZYIA 4GIEA 4W9TA 3H53A 1GWJA 1HL5A 4K71B 4YHZL 4PJ6A 1O7DE 1C91A 2Q86A 4DWDA 4WKZA 2XX0A 4JTUA 2C0HA 4ICCX 3J80Z 2AEQL 3V4PA 2VRAA 2UZXB 4UNKA 4RMNA 2WZHA 1KIUA 4J3OH 3ZJ6A 1PD1A 1W5MA 1TZ7A 4KI5C 3T3PE 1REPC 4BYYA 2CFFA 2XFWA 3EKLA 1ID2A 3LQAC 1OANA 1R4XA 3TYEA 4XLNF 3X13B 5CB1A 5CBAB 5L2JA 3JPQA 3NXFA 2P46B 2O9TA 1TLHB 1LO3H 2AJ3A 3L4VA 2VURA 1QH9A 3SDXA 3LSGA 3A5FA 5GRJH 5DJYB 4U1LB 3AITA 1OB1B 4RNOA 4PGCA 1M9SA 1EEZA 3AT9A 5DUPL 2PDIA 3EJYC 3QJOA 2WXFA 2VL5A 1HOMA 3TBWA 4M6WA 4RQ2A 1S9FA 3SPJA 4JBSA 4RDQF 3N0AA 3NQMA 3RDTC 3ARDB 4J9MA 4A2UA 2MMXA 2NNXA 1YXDA 2X6BA 4PWJA 3MRHB 4OKDA 2G0AA 3ZTNL 4FXKC 2X8RA 2GQ9A 1C9WA 1ZDSA 4GRSA 4UBBA 4ZX6A 1UCBH 2XWTB 2PJRB 5I19L 2LBFA 4PJ9A 3M5VA 1OHQA 2PXYA 5A8MA 1XSJA 1FO0H 3VMPA 4LALA 3GNRA 1S5NA 3C60B 3HW7A 3AWEA 3T8QA 5HLGA 2IHMA 3NNTA 5D2LB 1XCXA 1FHLA 3GC5A 4EE2A 1LK2B 4HWBL 5FF6A 5PAZA 3GIZH 1QUNB 3NCCB 4BH7A 3GSNH 1V0LA 3X1NA 1G43A 5JPMA 2XY1A 3GMPB 4CNOA 2FE3A 3ESPA 3RPBA 3SE4A 4GSXA 5GHWH 5AI0A 1O6VA 4LVFA 1WDDA 1CG9B 2J13A 2NW3A 3IGAA 1L7MA 3DX1A 3GU9A 2MHAB 4XBGB 1NBZA 4JTEA 2TRSA 4IRIA 4TXVB 5IUSA 1GKRA 4J3OD 2QDDA 4NSKA 3K8LA 1NINA 4MS8C 3DX7A 2XPGA 1BQGA 5CSZB 5KJRH 1NDYA 1ZQMA 2JZBB 1ET8A 1HSAB 5KBPA 4HUUA 5D7IF 1WYIA 1JK8B 4LHUA 5AOUA 4TN9A 2J7LA 3PHQA 1XIHA 4YVPA 1QP1A 3WKZA 5DMJB 3GMRA 2W92A 3H3PH 4Y9CA 2XUCA 2YPVH 1UJ3A 3DX4A 2PZ0A 5CILH 3ZR4A 3REQA 5C07D 4GKOA 2DK8A 2FNWA 2XWEA 1LO4H 1MF2H 3VKAA 1Y1UA 4FBUA 1A4KA 4TX9A 2D2HA 1NMAH 1H5BC 3O4LE 4D7PA 5J2HA 4F7PA 3QMSA 4PJXB 3F01A 5B38B 4H9TA 1PP8F 3IN0A 3KVKA 3L5MA 2NQJA 2Q0OA 1EQWA 3OIQA 5DRXB 5HPCA 3B6SA 2GK2A 3RI4A 3KHHA 2IDCA 3TNBA 3FQ4A 5TFSL 2AV1B 1PZSA 2EEFA 1I7TA 3IJDA 5DR5L 2AQQA 2VC2L 4D7BA 2Q0ZX 1U2CA 3OL2A 1ZRUA 5EL1A 1URIA 2HTLD 5JUMA 3VFTA 2KV2A 4XPGH 2XWBA 7ICRA 1G7UA 1YEFL 3NVVA 1P4UA 4JNYA 1PB0A 1TO5A 4OQ1A 1CW2A 4JHVA 2GBYA 3S5NA 2NDGA 2GPZA 4XV0A 3E9TA 5DWUL 5DBTA 5AVZB 1B3VA 3HZVB 3ZQ9A 2FI1A 3QKEA 4PJFF 4XXDA 2VH5L 1WCBA 4PBVC 1FVEA 5DZPA 5EEHA 3NQVA 1ZYRF 4OR1A 1DLHB 4TO8A 3ZT5A 2GIYA 4FG2A 2HX7A 4H19A 1NGPL 1H3VA 5D2VA 1X4ZA 1EA0A 3TAPA 2UXTA 3HLAA 4J3UA 1GPOL 4UVCA 4B9JA 4AQEB 3IKVA 4P4RA 4CHUA 4WFGD 5IJBC 1TOXA 3QORD 1L7NA 3OKNB 1ONQB 3HR6A 4WWKB 4XLHA 1OYIA 4A55A 4BQBA 1CN4A 4YR6A 4Q7NA 2EE0A 3FO2B 3QUYD 3FCGA 3S5LG 4I18C 2ZMEA 2Z0UA 2QCFA 3ZE0B 3SPVA 3C5SA 5FX3A 1VBRA 3SMVA 1ED3A 2Y6ZA 4QPEA 5I1GH 1Q72L 2ENYA 1KGJA 1TWZA 2DJUA 2ELKA 5L7XL 2B77A 5M1TA 1MHCA 2NYZA 3WFHB 3RUGF 1Q66A 3VAVA 1EJ8A 4K3DH 3BUYB 1ZJMA 2ZVIA 2QGYA 1F4YL 2GSGB 2AVGA 2H90A 2E9JA 3J81j 1SZPA 1MSEC 2Q7AA 4PV9B 3F65A 2R8JA 1HEHC 3BYTA 3HPZA 5DANA 2BIHA 4AQ8A 1M1SA 4DVRL 4XC1L 2JZYA 3F00A 3OYZA 4GQ0A 4IRCA 3F7VA 2C9UA 4M4PA 5FYJH 2EPMX 1V7NL 4DWSD 5DEFA 4OF0A 4M6AA 4KJQD 4IPAA 1AD9B 1TZ8A 2HOTA 4FQJL 4IMLA 3JPSA 2BW3A 4DLEA 2VITB 3MLXH 1QTYT 2QR0B 4YSSA 4RGNB 3HE7B 4AD0A 2P28B 5DCBA 4XLAA 1NK3P 4ZO7A 3O6FA 2DOCA 2VMFA 3MRRB 4LCWE 3IUIA 4MMXB 4HFUH 2LQRA 2D7OA 1Y88A 1KF9B 4ZODA 3LPPA 3D0CA 2NDFA 5AVRB 4HF5L 5B8CC 3E0LA 4Y9EA 3H0TA 4OV9A 5IM7A 2WWDA 1GOKA <