3HJEA

Crystal structure of sulfolobus tokodaii hypothetical maltooligosyl trehalose synthase
Total Genus 284
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
284
sequence length
704
structure length
704
Chain Sequence
MKLLSTYRLQPMKFSEIRNRLDYFVELGVTHLYLSPVLKARPGSTHGYDVVDYNTINDELGGEEEYIRLIDEAKSKGLGIIQDIVPNHMAVHHTNWRLMDVLKKGRHSRYYNYFDFYEEEEKIRIPILGDRNFKITYVNDEPYLDYYGNLFPINDEGRNYLNDIEKLLKVQYYELVDWRDYPSYRRFFAVNELIAVRQELEWVFEDSHSKILSFEVDGYRIDHIDGLFKPEEYLRRLKNKIGNKHIFVEKILSIGEKLRWDFIDGTTGYDFLNYSNLLFTDNEDKMTEIYKNILDIDLDELVKETKKKIIDTLFKHDIERISMMLGVNYEEIKEFLSCLKVYRTYITENDFRDEEIIRNCSQKVYESMKKNVTAFMKLQQYMPAVFAKAYEDTVLFIYNRLISLNEVGSDLHYYSISCDKFHEFNLKRVGTLSFNATSTHDTKFSEDVRMRISAISEIPDEWAKKVNEWHNILNPNIDKNDEYRLYQTIVGSFDGFNNEYKERLKAHMIKALREAKVHTDWVNVNTEYEKKMTYLIDKMFNNEKFMESFLEFESKIDKMGKVKSLSLVALKITSPGVADFYQGLENFRYLLTDPDNRRPVVFSELPKRYEEGLFNNGRIKAYVTKVLLNLRKSMKDFFINSEYKPLKLQKGLCGFMRGDKVLVIVKTLNRDYDIEIDGEYTDVITDETVRGRVKVDKLPLILVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of ST0929, a putative glycosyl transferase from Sulfolobus tokodaii
pubmed doi rcsb
source organism Sulfolobus tokodaii str. 7
molecule tags Transferase
molecule keywords 704aa long hypothetical glycosyltransferase
total genus 284
structure length 704
sequence length 704
ec nomenclature
pdb deposition date 2009-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09196 DUF1953 Domain of unknown function (DUF1953)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.470 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Maltooligosyl trehalose synthase; domain 4 3hjeA04
1.10.150.200 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Maltooligosyl trehalose synthase; domain 3 3hjeA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3hjeA05
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3hjeA01
3.30.1590.10 Alpha Beta 2-Layer Sandwich Maltooligosyl trehalose synthase, domain 2 Maltooligosyl trehalose synthase, domain 2 3hjeA02
2E0PA 3VX1A 2WZIA 3AIRA 4FF5A 4AD3A 1WKYA 3NUKA 1V3LA 3CUJA 1DP0A 3HG4A 5D9MA 2CBUA 4QDMA 5BROA 3NIYA 3CLWA 3MSGA 2GJXB 3MMUA 4GIAA 5FCZA 3GXMA 4PCTA 5BRPA 3BVTA 1OSEA 5D8WA 1UKOA 1IZJA 5EB8A 4Z2LA 1G9HA 1PX4A 1XV8A 4D1IA 3ZO9A 3ZM8A 4D6CA 3IJ7A 1AQ0A 1E5NA 1PX3A 2CKRA 2HVMA 3B9EA 1FFQA 1RH9A 3GXDA 2W92A 2VO5A 1HP5A 4U3CA 4JFVA 2OWWA 1GONA 1OGBA 1PZ3A 4JFTA 3PZGA 2Q8XA 2FHFA 3VD7A 1HL8A 1V0NA 1QWNA 2QLYA 1RP8A 4C7FA 4X0VA 1NM9A 8A3HA 4MAVA 5HXMA 4GO8A 1GW1A 1Q6CA 4QLLA 2ALWA 1E6SM 2VCCA 3ZJ6A 1BYAA 1V08A 4LPCA 1SFSA 1I1XA 1NWSA 3L4UA 3AROA 3EMZA 4HP5A 2VTFA 3W0KA 1ODUA 4PSRA 4B3KA 3H53A 4TTGA 2BVDA 4XV0A 1VFMA 3IK2A 1B3WA 5JBFA 4PEEA 2UWFA 3ARZA 1BG4A 1X6LA 2G41A 3AZRA 4TX8A 1ISWA 4HMCA 4BQ2A 3WL1A 5A8NA 3EYPA 3U5YA 1KCLA 1MFVA 3RJXA 3EDDA 2BVTA 2XFFA 2XG9A 1B2YA 2Y8KA 1BYDA 2ZUTA 3VOCA 1CXIA 5A6JA 1GQJA 4PMRA 3WUBA 1KCKA 1CWYA 1EO5A 2PI6A 1R75A 4ATWA 3ARSA 3WD1A 1GZJA 2TAAA 1UA7A 1SMAA 2YA1A 1FA2A 4MNLA 4PMYA 4EE9A 5A8PA 5I3DA 3SCNA 1C3FA 5DEZA 2J7DA 1GPFA 3ARWA 2ZUWA 5ABEA 3W38A 1XYZA 1EXPA 2VT0A 4DM2A 1V6UA 5LA2A 3WMBA 1UWTA 5FD0A 1HJWA 3WSUA 4FLRA 1CDGA 1E6QM 1J12A 2WM0A 3U7VA 3AHYA 1BVNP 4H8UA 5E6YA 1JYVA 5HPCA 1UR8A 3VIIA 3GXNA 2XHYA 5IDIA 1UKSA 1BFNA 1BHGA 4KH2A 3ZMRA 4TTUA 2EBNA 1J0JA 4JCMA 1UD4A 3N13A 4HZ6A 2J7BA 1H5VA 3AYSA 2WWCA 2B31A 2YFNA 1C8XA 5C8BB 2DQXA 3PZIA 2PWFA 2WMGA 4YHEA 1B3VA 3NDYA 1TFVA 5D9NA 1OT1A 2F7RA 3VDAA 4N42A 5ABGA 3ARPA 1JIBA 2EQDA 3IANA 3QR3A 3RM8A 4MAZA 1C7SA 4UQAA 4WLCA 4GQRA 3UETA 4TVCA 1A47A 1HVXA 3EMQA 2WB5A 2WAGA 3F5KA 3ZSTA 3CUGA 3U5UA 3OLGA 4AYGA 3N15A 3SCUA 3WUFA 1CLXA 2WHKA 1GQIA 1UR1A 1V6YA 1UKTA 4S3JA 1RPKA 3CUIA 1KTCA 1JI2A 3FAXA 3TTYA 1BTCA 2WMKA 1UA3A 1WO2A 3EJUA 3F4VA 4P8XA 3VKKA 4BQ3A 1JF6A 3VIMA 2WZEA 1CXEA 1XCWA 3W6MA 4GI8A 4DUVA 2D24A 5I23A 1XSIA 3GDBA 4HOXA 2XN2A 2VR4A 1QNSA 3THCA 1ITCA 3VU2A 1WDQA 2ZXBA 3AFBA 2YA2A 1G0CA 3VTRA 3WNNA 1NOWA 1ODZA 1JD7A 3M7SA 9CGTA 1PIFA 2EPLX 2WCAA 1UD5A 4B9ZA 3EDEA 3CHEA 2W61A 3WMCA 3WNMA 4PUDA 2Y24A 4PYSA 1BF2A 4CD7A 2IGTA 1E6XM 4NXKA 3MUZ1 1B30A 2W63A 4FMVA 1JXKA 1UZ4A 1HKJA 3GBEA 1K9FA 3EDFA 3WBAA 1SR0A 4AZIA 4ATDA 1H11A 2JF7A 3OGVA 2A3CA 5DT7A 2GJPA 5I79A 3AS1A 1MQPA 5IHRA 2PWHA 1MW1A 4AMWA 1BLIA 2F7PA 4CD8A 3MU7A 2Y5EA 4W7WA 1KQYA 2CEQA 3MS8A 4AD5A 2F61A 1W2VA 4OBSA 4FNRA 3CHFA 4W84A 4M8UA 3LRKA 1XHGA 3KLKA 3S2CA 5CPQA 4W88A 5LA1A 3MUIA 2NW0A 1B3XA 3WKZA 3SEPA 2PF0A 2VX5A 2CIPA 5A1AA 4CKQA 2D23A 3W28A 4U3AA 3UR7A 3BMVA 4CN6A 2J7HA 3RILA 2E9LA 3BLPX 2WZHA 2G3JA 4OOZA 3KL5A 2DDXA 5CGTA 4AEEA 1C90A 3A4AA 2VR5A 1WZAA 1J0YA 1OGGA 3MV11 5IFPA 2VVNA 5CXPA 3VMNA 2BXYA 1G01A 1GVYA 1PZ2A 1ZB5A 1ITXA 3DX4A 1UQZA 3PTKA 2Y8VA 4MDOA 1ISVA 1D3CA 4LGXA 1UH3A 3WF3A 1TMQA 1E4NA 4NZCA 1OD8A 3TTQA 3CH9A 2DSUA 5E0CA 3RM4A 2XWDA 4UFKA 3VNYA 1GOIA 1QNPA 1HKIA 2VC9A 1ZBKA 1KXHA 4M1RA 4J27A 3EMCA 1WZLA 4J3XA 1PIGA 1X1NA 3GH4A 1ZL1A 4CN4A 3ZT5A 4GKLA 1CXHA 1QNRA 5A6KA 3SIMA 2V3EA 2ZX9A 2O9TA 2XPKA 3BLBA 4ML4A 1WDSA 2XM2A 4ACZA 2DT2A 2UY5A 2VZOA 2WC4A 2XTKA 1W91A 1GJWA 3S5ZA 2W62A 2XJ7A 1E3XA 4HTYA 3WH5A 2VRKA 3CIVA 1WAWA 3MANA 4NZJA 2ZIDA 4AZCB 1E40A 1WP6A 3OG2A 1C91A 1DEDA 1EDQA 3EJPA 1QBBA 3WNOA 1L0PA 5IHSA 3T09A 3BAYA 4CVUA 2O9OA 1TQVA 2XWEA 2EO7A 2MANA 2JEPA 4AISA 4E2OA 4AZBA 2ZWYA 2YIHA 3CMJA 4JFUA 3ARXA 1US3A 3WENA 1EOKA 1IT0A 2VQUA 2WCGA 3S6TA 4MADA 1UZ1A 4BF7A 3SCQA 1VJSA 3VD5A 3AS3A 3RIKA 1J11A 2WXDM 2X0HA 2VX4A 2BY3A 4OOUA 3AMLA 1JAKA 3AMCA 2E8ZA 1XCXA 3CZ8A 2YDRA 2PWGA 2ZICA 1NWTA 2WBKA 2VCBA 3TA9A 3T2PA 3K8LA 3W26A 1OB0A 4UZUA 1PAMA 2X2HA 4NZFA 5A2BA 3I3DA 1P6WA 1QWUA 2G8ZA 1QI5A 1Z32X 3W81A 4JIEA 2W66A 2J7EA 5CGMA 1NP0A 4D6IA 1W3KA 4IUGA 1LLOA 3PZUA 2F7OA 2JFEX 3KL0A 4XZBA 3BAXA 3OIHA 2FGZA 1GUVA 3UR8A 1M03A 5JUVA 3WD3A 2QPUA 3CZKA 1VBUA 4PMNA 2VZSA 1KFWA 2VI0A 3AMGA 3T0BA 4P7QA 2XVGA 4WSKA 3TV8A 1EQPA 1BYCA 3GNRA 4HMDA 5DFAA 1J9YA 4QFUA 3CZSA 4V28A 2E8YA 2EABA 2ZUSA 2VOTA 1GJUA 4C7GA 1HNYA 2PWEA 2J78A 3WDIA 4FNSA 1TQTA 3BCFA 2EEXA 1WPCA 3FY1A 4F9DA 2D0FA 2YL9A 3G6MA 4UQEA 3N9KA 4LYQA 2WMFA 3W4RA 2DSVA 1Q6GA 1DWIM 5BXRA 4AYSA 2YL6A 4PRWA 3WNPA 2DSKA 2EPNA 2GDVA 4DWSC 4L4PA 1QHZA 4BCEA 1HWWA 2XVKA 2OLHA 2WSKA 1QPKA 3I3EA 4QAWA 1QW9A 4NRRA 1CYGA 1VAHA 5HDRA 1W9UA 3LRLA 4D6FA 2Z1SA 2EPOA 2X2IA 1L8NA 4AD2A 3WF0A 5A3HA 3ZQ9A 1IZKA 3WELA 2WWDA 3QHMA 1E56A 5A6BD 1EGZA 4Z2IA 3OLDA 3ECQA 2VZUA 4Q22A 2GFTA 5ABHA 4GZIA 1WZKA 1TA3B 4Z2JA 3N17A 5HOSA 4KRTA 1MFUA 3GZAA 1XRVA 4MNMA 1ZJBA 1XH1A 1K9TA 1W9PA 4J7RA 3WQ6A 2WVVA 1QI2A 2OW6A 4EKJA 2HISA 3BH4A 3UG4A 2BY2A 4KWUA 3BCDA 3WQ8A 1BQCA 2EPKX 1R7AA 3N04A 4MPKA 3VILA 3BSHA 1ZU8A 2BHZA 1AQHA 3A5VA 3DHPA 1NARA 3PTQA 3APGA 3S5YA 3HG5A 3MV01 4RE4A 4HZ8A 3AIEA 2J47A 3PHAA 4M29A 2AMGA 3WY1A 5M03A 4OGZA 1WB0A 3D4YA 2OYMA 4Q7NA 3GNOA 2ZX6A 4S3KA 3HMCA 3PZ9A 1E0XA 5BRQA 1E6ZA 3BUDA 3ARQA 2OW7A 4HOWA 2J7CA 1HN1A 2CHNA 2J8GA 1XGZA 1JDCA 2XFYA 4CCDA 4CN1A 3T08A 3SUUA 5BYWA 1E6NA 2XSBA 4FNQA 1WE5A 1V03A 1GVIA 4JFWA 1QX1A 4TOQA 2X8RA 3IJ9A 1VEPA 1LWJA 2A3BA 2RGMA 3OGSA 4HPGA 2ZX7A 1JAEA 3L2MA 3WDQA 3J7HA 4AXNA 4PMVA 3WQWA 1UD3A 4Z2KA 4NSBA 2CXGA 1RD6A 2PB1A 3MI6A 1JNEA 3W29A 4MB3A 4HA1A 1U30A 4QLJA 3RM9A 1LQ0A 1OIMA 3EDJA 2J4GA 4LYPA 3FHQA 1E0VA 1MQRA 3OBAA 3A47A 1J0IA 2J75A 1HVQA 2ZXDA 2BY1A 3TP4A 1GOOA 1JF5A 4QCEA 1KB3A 4IPLA 1TA3A 5M3WA 5LYRA 1OGSA 3K8KA 3L4YA 3ZJKA 1XH0A 3VSUA 5IFTA 3WUEA 2FDMA 3NCOA 3GXTA 4ACYA 1HF6A 2VNCA 1DWFM 2XYLA 3VGFA 3FNDA 1OWQA 2GK1B 2WHMA 3BUBA 2X1IA 1CGVA 1A3HA 2D20A 2ZWZA 2ZUVA 3MKKA 4OJYA 3CZJA 5D8ZA 3DYOA 1UOKA 4ZENA 2GVYA 3A23A 3L4XA 1W2PA 4X9YA 1MXGA 1CXFA 3BUPA 3FHAA 1W1VA 3PZNA 4YPJA 4B15A 4UTFA 3CO4A 2YBTA 5A6SA 4P7RA 4FLSA 1DWGM 2XIIA 4J3TA 1W3JA 4AIEA 4M81A 3BMWA 4UOJA 3CHDA 1EDTA 2V5DA 1FH8A 4FK9A 1KQZA 3VX0A 4HA3A 4CGTA 3A4XA 2FH6A 2QMKA 4D1JA 3GYCA 4Z2HA 1BVZA 1JZ6A 2E9MA 5CPSA 3II1A 2E9BA 2XVNA 2NT1A 1I1WA 4GQQA 4GXPA 1TQWA 2F8QA 4CVWA 3AIVA 1N82A 3PTMA 3A6OA 4TVUA 2VX6A 3GTNA 3RJYA 4PTVA 4W85A 3SCOA 1NWUA 5BXPA 2OWXA 4CU7A 4U2YA 4MB5A 3DX1A 3EJSA 1TVNA 3ZOAA 3H55A 1FH7A 5LA0A 2DIEA 2EACA 3VD4A 2DH2A 3WN6A 1GORA 2Z1KA 2JALA 3ARVA 4W86A 3LXBA 2W91A 3UG5A 4DO5A 3VGDA 4LX4A 1J01A 2DT1A 2OSXA 2WVUA 1KBKA 3L2LA 4PSPA 3A22A 3PZOA 2EADA 2CESA 1K9DA 3VIPA 3ZT7A 1F4AA 1GQKA 3LXCA 2YJQA 1KTBA 2ZX8A 1UHVA 5KEZA 1DWHM 1CZ1A 2WYSA 5DT5A 2VL4A 4WKAA 3AICA 1VIWA 5GNXA 1CGYA 1SYTA 4UCFA 4UOZA 3GH7A 2XN1A 4LXFA 3IJ8A 3PBGA 5JBDA 2VVSA 2W5FA 3POHA 1X6NA 1CGXA 1JDAA 1WDRA 5E0FA 3VIFA 5FOOA 3EJTA 3O2LA 3VMPA 1OBAA 1UD8A 4J28A 3VM7A 1E6PA 3CHCA 3AMKA 5CZKA 5AC4A 1KGUA 3DC0A 1VEOA 1UWUA 5D4YA 1KGWA 4TUFA 2E4TA 2D1ZA 3VO0A 2VZTA 5A8MA 1SZNA 5I24A 4AD1A 4ZE4A 2VX7A 4W7UA 1S46A 1FHLA 4PUEA 2VQTA 1CGWA 3VVGA 2JF6A 3HG2A 2GDUA 4W8LA 3AZTA 4U5IA 3L4WA 3EBVA 5HBFA 4W89A 4URIA 4A3YA 1W1TA 5I6SA 3PN8A 3VINA 1CECA 4EANA 4MNJA 1H49A 1AVAA 5I2UA 4DUWA 5D9PA 2XN0A 3WY2A 5CLTA 5JIPA 5DF0A 1CXLA 4MJ2A 3CUFA 4W93A 4U31A 3OLEA 4U2ZA 2VRQA 3AOFA 4Z2GA 1XH2A 3NYDA 1AMYA 1VENA 3WEZA 1E0WA 4BS0A 1TVPA 5AYIA 3WL0A 2WMIA 3BAJA 4JKMA 1ISXA 2VZVA 1UASA 2WBGA 5HNNA 4Y7EA 3VGEA 1CPUA 1KXVA 2XIBA 1R7OA 1T0OA 2OSWA 5IXEA 4CU6A 3GNPA 3WY4A 1E73M 2PWDA 4CU8A 1H4PA 1C92A 3AI0A 2FE0A 3L4ZA 1R86A 3K4DA 3CPUA 2UY2A 3SCRA 2CNCA 4W8BA 4NF7A 2DSZA 3DDFA 3CGTA 2XGBA 2J62A 2DT0A 3ARTA 1Q4NX 4B3LA 1H0IA 1BSIA 3WNLA 2D73A 3GXIA 4W8AA 1EO7A 3ZJ8A 1UUQA 3CZGA 5EFFA 3RCNA 1B3YA 3NDZA 5A69A 1FFRA 1F4HA 3WFLA 2ZXQA 4BA0A 2J8FA 3QGVA 1M04A 1IV8A 4H04A 4UNIA 2F7QA 4J3UA 4QLKA 4CD4A 4D6GA 3PZMA 3VGGA 3VSTA 3A21A 4JL1A 1NH6A 1ISYA 4WK9A 2V3FA 4YN5A 5FKYA 4M56A 3KLLA 4CD5A 2CBIA 4WKFA 5BXSA 3ALFA 5CG0A 3WH7A 4UFJA 1JNDA 3ARUA 4PN2A 3SCVA 1B1YA 3AYRA 1FH9A 2XFRA 1HKKA 2WPGA 2XSAA 1R46A 1ZBVA 5M17A 3O6AA 2WMIB 1R85A 3NSXA 1H3GA 1V6VA 2BV9A 3VNZA 3K8MA 2CPUA 3WBEA 2DGAA 1J0KA 4LYRA 4W5ZA 3AXIA 2FHCA 3DX3A 4PBGA 1U2YA 1OCQA 1JYXA 4AEFA 1CTNA 2D22A 3KWXA 1ZBCA 3VDCA 2JEQA 4UFMA 3LPGA 4D71A 5GNZA 5EMYA 4AZHA 3BAIA 1B3ZA 2ZUNA 3E1F1 4PMQA 6A3HA 1M7XA 3DX0A 1LWHA 3K1DA 1MYRA 3WEMA 4QP0A 1FOBA 1WNOA 3HJEA 1ZBWA 1C93A 3N1AA 5E1QA 4HMEA 2YL8A 5ABFB 2A3AA 2J7FA 3MMWA 3I3BA 1EOMA 1QNQA 1CIUA 3WF4A 1JGIA 1PPIA 2V3GA 2ZX5A 3WD0A 3WH6A 3BC9A 4X0NA 2W4XA 3OB8A 4UR9A 1HIZA 2XM1A 1JZ7A 2C7FA 4N0RA 3THDA 2WLYA 3SUSA 2DIJA 4RL3A 1HX0A 2VUYA 5FL0A 2UY3A 4MDPA 3PZVA 5C71A 1XC6A 2DSWA 2NT0A 5I5RA 2YDQA 2CETA 1BGGA 4U33A 5DMYA 5A8OA 3FW6A 1GNXA 1QHOA 1VFFA 3NSNA 4JL2A 1UR9A 5ABFA 4AZ7A 3EDKA 1DHKA 2XUCA 4UQBA 4P8WA 4UQCA 4JZ5A 3CZNA 1HJQA 1XSJA 4D72A 2YLAA 5A95A 4PMOA 1CBGA 4HPHA 5D9OA 4PMDA 4AC1X 1EIBA 1GOWA 1TG7A 1DTUA 4UOQA 3AQUA 4IM4A 2BNJA 1JFHA 3AXHA 2WANA 3MUY1 5JIWA 1V3MA 3F5JA 5AY7A 4AMXA 3ZR5A 1W9VA 3W25A 4B16A 1D7FA 2BXZA 2X2YA 1TQUA 4R5EA 3AISA 4JKLA 1NOFA 2J7GA 3AS0A 5ECUA 3OLIA 1EDGA 4NRSA 3PZQA 2XVLA 1UKQA 2WNWA 3ZT6A 3KZSA 1XD1A 3WY3A 1KXQA 3DDGA 2CKSA 2Y4SA 3FXYA 1HJXA 1NQ6A 2CBVA 2QF8A 4F9JA 2FYVA 1LF1A 1OM0A 3UG3A 3T2QA 1CGUA 4F79A 4H2CA 3HG3A 4ZFMA 1KR1A 3VMOA 4HU8A 4DO4A 4W5UA 1E43A 1E5JA 2D0GA 1GOKA 1LJYA 4FLOA 1RP9A 2J79A 3O9NA 3WDPP 1WDPA 1ZS2A 1Q6FA 3MSDA 2RGLA 2PC8A 2WC3A 4GPNA 3GXPA 2VCAA 3SCTA 3B8SA 4W87A 3SCPA 4OUEA 5FIPA 4D6JA 1E6RA 1VBRA 3BXWA 1V3IA 5A8QA 4PMZA 1HT6A 3AZSA 3WNKA 4PTWA 5A6AA 2OYLA 5C70A 1E4MM 4NX0A 4CD6A 1VRXA 4MB1A 4P7NA 3U7BA 4WIWA 2QMJA 5A6LA 2XVPA 3NJ3A 3MUAA 1JZ8A 1R8LA 4AIOA 2GK1A 4ZE5A 2YBUA 2O92A 4PTMA 1HP4A 3OZPA 1DWJM 1GHRA 1C7TA 2X09A 3CV5A 4FNPA 1PEZA 5CQ1A 1V0MA 5A6MA 4GI6A 1W9BM 4MJ4A 4V27A 5AYBA 3VIOA 3WFZA 1GQLA 2YFOA 3CMGA 1G1YA 2ZXAA 1KGXA 2J77A 3ZIZA 2F2HA 4UFIA 1XYFA 1VFOA 3A4WA 3GXFA 3AXXA 4WF7A 3CC1A 1NP2A 3MO4A 2VJXA 1O7DC 1E3ZA 7TAAA 2GSJA 2GJXA 2WMHA 2BY0A 1E4IA 1HJVA 3W82A 1CGTA 2F1AA 1B31A 1UWIA 3LPFA 3ARYA 1J0ZA 1JYWA 2D0HA 2WVSA 2O9PA 3QHNA 3WQ4A 5CSUA 1QVBA 1JFXA 2VRJA 5BXTA 4DUXA 1XD0A 3BGAA 1LG1A 4W7VA 3WD2A 4ZXLA 2WHJA 1VB9A 2BS9A 3VIKA 7CGTA 2YOCA 5A2AA 6CGTA 1GHSA 2XGIA 4H7VA 3DYPA 1BG9A 1HKMA 3BVVA 2QV4A 1EA9C 3ARRA 4HOZA 3T0AA 4C7DA 3VPLA 3D4ZA 3IGUA 1DWAM 2OWCA 1FHDA 4M80A 3GH5A 3SUVA 3M07A 1UD2A 4PMUA 3RO8A 1M53A 1UWRA 1O7AA 3BAWA 1UQYA 1EHNA 3AJ7A 4ACZB 4AZGA 2EXOA 3D3AA 2YDSA 3VGBA 2DPEA 2JIWA 3CZLA 2FGLA 1WCGA 2EJ1A 1SMDA 3W53A 5KZ6A 1JXJA 3RPMA 4E8CA 1E70M 1UH4A 3IAPA 4DO6A 4A3HA 4DWSA 5EBAA 1VEMA 5E9AA 1HXJA 1LL7A 2BVYA 1JYNA 2WCSA 4TXEA 1UG6A 4KRUA 3A3HA 1QBAA 3OA5A 2GUYA 3LPOA 2A3EA 4OIFA 3VIHA 4QCFA 5I0DA 4UQ9A 4AWEA 1R33A 5A2CA 4XUYA 3UEQA 4AW7A 4P8VA 4J3WA 4EK7A 3UESA 2AOSA 5TD4A 1G94A 1MW0A 2D3LA 5AC5A 4MNKA 1XSKA 2YKKA 1R87A 1JL8A 1V02E 3B9DA 4V2XA 3BUQA 3W24A 1MQQA 1VFUA 1UR4A 1GOMA 3D51A 4JHZA 4H41A 4ZEPA 3BVXA 2WC7A 4WKHA 3N12A 5E6ZA 3BUIA 3GBDA 3ZJ7A 1H41A 4KGLA 3VDBA 3N11A 3WD4A 1BPLB 2G3MA 3DX2A 1LG2A 5A94A 4AY1A 1GOQA 3M6DA 2E3ZA 2D3NA 2FHBA 3VM5A 5DO8A 3VIJA 3BVWA 1Q6DA 4DWSD 4F8XA 3CTTA 2EAEA 1VJZA 3TTSA 4AD0A 4UFLA 4CCEA 4MTVA 3SCSA 1V3JA 4MB4A 2E40A 2NSXA 1UWSA 3LXAA 2GJRA 3VD9A 1W3HA 1V02A 4M82A 4J3SA 2BHUA 3D50A 2F18A 4F66A 3GM8A 1UH2A 1ZJAA 1E72M 3KL3A 1V3KA 1BYBA 3CZEA 1C8YA 4E8DA 1B0IA 2BFGA 4EAMA 5F7UA 3DECA 3ALGA 4AZ6A 1I75A 4A4AA 3DYMA 1QW8A 1O6IA 1E71M 1JI1A 4GO9A 1W9XA 1US2A 2J74A 2G3IA 2YLLA 3WF2A 4UFHA 4OKDA 1H09A 4P7LA 2IXVA 3QOKA 3KEHA 1NWRA 2CCRA 4NI3A 1UR0A 1E4LA 1CENA 3IAQA 4XX6A 3CUHA 4HZ7A 3LMYA 1Q6EA 1NOUA 1W9DM 1FP8A 5I78A 1EQCA 2CERA 1MW3A 3WDRA 1QHPA 3AIQA 1QI3A 4JFSA 3SURA 1OD0A 2YA0A 4BQ5A 3SCWA 3EJQA 1V0KA 4L4OA 3WF1A 1ECEA 1MW2A 1LL4A 4KGJA 3OZOA 3H54A 3CBWA 2F1BA 3N18A 3LRMA 3RDKA 4J3VA 3TTOA 2WMJA 4H8HA 1HTYA 2ESCA 3NSMA 3BAKA 3VDHA 3WUGA 3KE0A 4XZWA 2ZUUA 3AIBA 5CLWA 2VURA 2DH3A 2WHLA 2X05A 2C0HA 4HA4A 1PBGA 3EJRA 1V3HA 1W1PA 4LQ1A 3UERA 1MVYA 4H8VA 3TOPA 1W1YA 1KBBA 3WQ5A 1UWQA 5FL1A 4GINA 2G3NA 3POCA 3PZTA 4TX6A 3WH8A 2PBGA 4AZCA 4WJXA 4K68A 4AIUA 1UYQA 3AMDA 2WK2A 4PCSA 4FNTA 1B90A 1TR1A 3K46A 2V3DA 3VSVA 1UKPA 4YHGA 2WVTA 1E1EA 1D2KA 1E9LA 2PBOA 4D6HA 1JDDA 4JCLA 4OZOA 4UZSA 3DHUA 1KWGA 3QHOA 4TVDA 2X0YA 3F5LA 4AD4A 2V5CA 1H1NA 3L4TA 2WW5A 7A3HA 3OGRA 2D2OA 1V0LA 4JKKA 2X2JA 1ISZA 5CSYA 2WVVB 2DEPA 3W27A 4AMCA 4D6EA 1JZ5A 1E1FA 3BSGA 3HZ3A 1M01A 5GPRA 8CGTA 1Y7VA 2BHYA 1E15A 1VF8A 1TCMA 1AQMA 1JZ2A 4JHOA 2OSYA 5GNYA 2EPMX 1H2JA 1KXTA 3RMEA 2FH8A 2A3HA 1MWOA 1R47A 1G5AA 2UY4A 6TAAA 4IPNB 4M24A 3D5HA 1R34A 1PX8A 5BWFA 1JZ3A 1TZ7A 3UCQA 1V6WA 1LL6A 3WIJA 2J25A 4CCCA 3A24A 1WZMA 4IISA 3D52A 3T0DA 1OINA 3T2OA 4BZYA 3B9AA 5M5DA 2ZUMA 2DT3A 4GZJA 4DM1A 1HJUA 3AHZA 2CBJA 2OYKA 4WSJA 1CXKA 3BLKA 4R27A 4GI9A 3HU7A 3WDJA 1K9EA 3LX9A 4KMQA 3VUPA 4OBRA 2JIEA 2JE8A 1JD9A 5E70A 4RE3A 1TQSA 4U5KA 3AHXA 4RE2A 2WLZA 3W37A 4AZ5A 1OT2A 1QI0A 3LPPA 1FP9A 1KR0A 4ATLA 4HU0A 1J18A 4P8UA 2CHOA 3K4AA 2QHAA 3AHVA 3AIUA 3VGHA 4P7OA 1E55A 3SUWA 3WH9A 1YHTA 2Y2WA 1W32A 1K6AA 2WSPA 2V38A 1HJSA 1H0GA 5I77A 2ZE0A 4FLQA 2AAAA 1PJ9A 1QI4A 1EHAA 1QNOA 3WQVA 4XB3A 2YL5A 1JZ4A 3L4VA 2WKGA 3AHTA 1MXDA 2QPSA 2CITA 3QOMA 1CEOA 1GCYA 4GZEA 3SUTA 2G4FA 5CJ5A 1YQ2A 4B9YA 2O9RA 3M46A 4DWSB 1UR2A 3FN9A 3WMSA 3MMDA 5HPOA 1TUXA 1EH9A 4PMXA 1HXKA 1BAGA 1B9ZA 4FNUA 3WDHA 1W3LA 1KWKA 1OIFA 2IXUA 2W67A 3U57A 3ZR6A 1U33A 2CYGA 2C8NA 5JBEA 4ZXOA 5GQBA 5CPTA 1CNVA 2WKLA 1QOXA 3VIGA 3FAWA 1TE1A 1C8QA 3W6LA 4UQDA 1JG9A 1V6XA 1BGAA 5A6BA 1J0HA 1UD6A 2ZOXA 1CLVA 1PS3A 3HN3A 4D6DA 4BQ4A 2VMFA 1J10A 3G6LA 3TONA 3VD3A 3AIWA 3JUGA 3BVUA 4JAWA 5E09A 1HL9A 4PTXA 4E4PA 3WEOA 1ESWA 5BCAA 4CUCA 4NXSA 3AS2A 2IUZA 5EFDA 3ZSSA
chains in the Genus database with same CATH superfamily
2ZDSA 2CC0A 4JTLA 5HYJB 1TT6A 5HDQH 2OO6A 3W39A 12E8L 3M43A 3CLWA 4YBLB 1H3PL 2VC5A 3I53A 3EPMA 5BNGA 2IPFA 1WD8A 1CGSL 3RX7A 2DL0A 3QUBA 1G7IB 3PTDA 2NY1C 1TXKA 3PDOA 4ONFL 2JI3A 1PLBA 4ANWA 3HG1D 1M3JA 1E5NA 1QFWM 4IMEA 2XNAB 3TURA 4X83A 4K71B 1OGBA 2DUXA 1BFVH 2X4NA 3ASNH 4P0DA 2WO2B 1OQOA 5TH2B 4MAVA 1YYCA 2D1VA 4ELME 5CSRA 2NQ5A 2XN9E 2A4AA 2ZAGA 4EJVA 4S1SL 5GRJH 3NGDA 4P3CL 5KT5A 2QXWA 3L4UA 1H6EA 4A7SA 1S5IH 4UBPC 4BJTA 4IRJB 5JUMA 3C2MA 4UUVA 4IIGA 2PGWA 5E6IB 4GG8B 1RXWA 4WSGA 1IIIA 1SN0A 1QRQA 2R2EB 1X6LA 4TNEA 4ZMYA 1MFDH 3FF7A 5HHIA 4KWWA 3SDOA 3CESA 4YTUA 4IMDA 4KXZH 1JWMB 5DRWA 2ARJQ 1L6SA 2FB4L 1EERB 3C6SA 1WBJA 3KHDA 2E75C 2WD0A 2D8KA 4DSFA 1JJ8C 3ULQB 1ZT4A 2TAAA 3EA3A 5CZTA 3VYNA 3UPAA 5TBOA 1YPZF 1AA1B 4ZZ9A 1F13A 1BPDA 3PREA 3SGUA 3WMPA 1HJWA 3I6KA 2NYXA 1BVNP 1ZK9A 4H88H 1N6UA 1XIBA 2NY6B 1Y8BA 1XLLA 3GXNA 1BNOA 2D1HA 1BOGB 5LAXA 2QQKL 1CYWA 2P5LC 4P0QA 3ES6B 3U0WH 4KTQA 3BLFA 3AYSA 3FMRA 3W7LA 4N2AA 2NY2C 3HG1B 1OD9A 2WC2A 3MROA 4BFEA 1C8XA 3O8XC 5GRXG 4H8PA 1LP6A 2FJSA 1E50A 3PJSB 2G7HA 4ERSL 5I8OL 3K81A 2ZYFA 4P99A 4G1MA 4HGWB 1FWXA 2HVBA 3GT6A 2B7PA 1GW9A 3QJZA 3P4LA 5EC2B 3MLYL 4UB8C 1FHNA 5AVQB 4P46D 1FFVA 3GJEA 3ENLA 2WB5A 4XBGB 4HGWA 2I32A 2STTA 4PUMA 4Y4KA 5E7FA 9ANTA 4M5ZH 3VTAA 3TU9A 1JI2A 3SDDA 1QBML 4IL6C 2IW5A 3WQPA 2AEPL 4ZT1A 1DBJL 4QOKA 3RR4A 3EOTL 3LH2L 2A6DB 5F4WA 4HOXA 1XDJA 1MCJA 4NXZA 2PDQA 2ZADA 5ALBL 1XYMA 1PIFA 2FLRT 1UR3M 1SOQA 2HWGA 5CVRA 3OKDB 2W61A 3O9WC 3QORC 2Y24A 3RVTD 3WTSC 1ETA1 1JZDC 3PWJB 4H7CA 1QACA 4OZIE 3GTQJ 1BFTA 2ZJRF 5F7YC 2QSHX 3DOSB 3E6FA 3BV7A 5F7DB 1SVCP 1RK5A 1I27A 1JTXA 1KT2B 5E3LA 3WIIL 4QWDA 4B9NA 2V2WB 4LSTH 2QVFB 4OCWL 1JFQH 4D0BA 5E79C 2VUNA 4YSQA 1ORQB 2D31B 5M7QA 4B5XA 3UBXI 4M6XA 1MRQA 5I1JH 4JFEB 4M8UA 3LRKA 1KC5L 4H26B 5FF0A 3SEPA 4LK4A 2QBYA 2CIPA 4UT6L 4J3OF 4JX0A 2BZCA 4BDYA 2ZG1A 3PFQA 2WAEA 1E28A 3KHQA 4IXXA 2AJXL 3W2VA 1EWEA 1TZIA 5D72H 2H1PH 5L6YH 1G4SA 3UA4A 3V0WH 4JO4H 3N1GC 4A29A 2EIJB 1PLGH 2HPTA 4HWEL 3GIQA 4CC0A 3MA9L 5BV7B 1XGPA 1FQ0A 3VNYA 4AHQA 4QGCA 4XE0A 1ZBKA 2YCIX 4PBVC 4J27A 3WQGA 1IKNA 1LKYB 3W1UA 1XIDA 4J3XA 1E3FA 2BP0B 2FEEI 1ZL1A 5IW6A 5LWYH 4GLXA 4UAUA 1S9XA 4Q4EA 3G4SI 3QFJE 1I4FB 4GVIA 2XOTA 2XO7A 3MRCB 1ZQLA 2IGFH 2XM2A 4E5XA 4RZKA 3QLDA 4GQPH 4BL0B 1MDMB 1CJYA 5E4OA 5JQHC 2ZTKA 4WO4B 1GKRA 2GOUA 4RPQA 1QBBA 4A7TA 1ZV9A 3FF5A 4EIUA 3GXUB 3JPQA 3GWZA 4LVSA 4XHJD 4AZBA 2Z27A 1OX5A 2WNXA 1IFRA 5CZXD 1HDDC 3HKFA 4AVHA 3BKJH 3ULUD 4M0AA 5TFSH 1D1AA 3EKZA 4RZCB 4II2A 1WGXA 2XWTA 2QEJA 1YEFH 1RDFA 3K7AJ 1IJ9A 2B15A 4WHBA 4AEHH 2W9CB 2OZ4H 1XG1A 3GSOA 5XINA 4R3UA 4ZMAT 4ZXBD 3TZVA 3BAXA 2G9WA 5DTDA 1OGAB 1M03A 4DPQA 4P7QA 1YS6A 2F7IA 4KTYA 1SGGA 1X66A 2B1HL 5LGNA 3QXVA 3VWJA 1EC9A 3BRGC 2ICWB 3HKZF 2E8YA 2EABA 4G1EB 4C7GA 5AAPA 2DF3A 1BVSA 4EX6A 2GFBB 2FB3A 2R8SH 3O6ML 3DNKA 2CM6A 5D9SA 5K1VA 1MQKL 5XIMA 5J11C 4P3WA 3EAKA 3LS4L 3L9RA 2GSIB 4PJEA 1Q6GA 1YMMB 3WNPA 4Z76B 5DS8A 1YIOA 1TB3A 1SLVA 3ZTDC 2YGOA 5D5ME 1WXYA 3KJ6L 4A5MA 3H2AA 1E3OC 2HVKA 1X5FA 5HP4A 4OD1L 4DP9X 3IU4L 3N40P 4PLJD 5IV2B 3L3KB 1NC4D 4O3SA 1IGCL 1URIA 4PJ0U 2CMPA 3UM9A 2I9UA 3K2KA 1D9EA 2BP1A 2VJ8A 4I99C 3ECHA 5DD5H 3N2JA 2HG5A 1WOBA 4PWGA 1HKLH 2BSRB 4HWZB 3ZWTA 1Z3EB 2P26A 1AHWC 5CLXA 4P2RA 2PO6D 3GFXA 2EE2A 2LY9A 2HISA 4QRRE 4RK8A 3HPLB 5ITFA 2N7BA 4AK1A 3D25B 2KYIA 1SKSA 4V15A 2BHZA 1AQHA 1FHUA 1NARA 3MW7A 3HG5A 3MV01 1H38A 3K4MA 3AIEA 1IAII 1PUFA 5CEHA 1WAAE 2JKNA 5J0TA 4A37A 1ONRA 3PZ9A 1E67A 5J3LA 3LENA 1Z9OA 3B5GA 3JTTB 3LNEA 5D96B 1DDHA 2X53A 2F4OB 2DQMA 5B38A 2ZF8A 1KJ3H 4OV4A 4PJCB 1I85A 1Q9WB 5DEGB 3WDQA 1O7DE 5JPNC 4OM0L 4RMQA 5T14A 3B4UA 1GW0A 3Q8BA 1Y39A 4CNUA 2IS4A 3GJFA 3G5EA 2K8MA 1F76A 2GSEA 4OGAC 1G7PA 3SDCD 4EI5D 1GOOA 1JF5A 4WI4A 3I6KB 1UXWA 4XA5A 4CMHB 3RU8H 3C08H 1NQKA 2Y9TA 2AJUL 5ALMA 4GYKA 4A6YH 1AL7A 2DORA 3QQDA 2V8LA 4NDLA 3MZ8A 3CMEI 2UVFA 4ALAL 2G08A 4R4BB 3ZRSA 5DUML 4XXCC 4DJMA 4XB8A 3CU1A 3RG6A 1KC7A 1KLGA 3B7YA 1YNPA 2A0LD 3URNA 1OAUL 1XGRA 1TO4A 2EKJA 3VXUD 3KPSD 3C12A 3HT3A 1IIHA 4GNKB 1TEGA 3QO1A 2E9MA 2HZGA 2XVNA 3LGGA 3KWUA 1I1WA 4Y8EA 1BZ9A 3G5XA 4O5LL 2N0KA 2F8QA 2IA0A 1OPGH 5REQB 3GTNA 1OR7C 5IT2H 3OSPA 4FGMA 1F3DH 2Z1KA 3F83A 5J89A 4O1FA 3KZYA 2M83A 3VGDA 3I6LD 3GTGJ 5L1IA 3LI1A 1JV2A 1DQJA 2NX5E 4AAJA 5D33A 1Y18A 2KRHA 2D7NA 2EADA 2VDOH 3VIPA 3M8SA 2PW2B 1RPQA 3OR7A 3GD6A 3LXCA 2NW3B 1NLDL 2AKRA 4XLHA 2VL4A 3O81A 3UAEA 5FKAA 2V9KA 4ZODA 4MJHA 4LXFA 5MEOB 1DJSA 5ISZA 3FCSA 3L8QA 3GIVB 2XXGA 1JTPA 4CAGA 1WDRA 5AKJA 1LBLA 3VUSA 4MYXA 5C9JA 4TNVF 1H7RA 3LJ3A 1TQBB 3MOAL 5D4YA 3S16J 3A0HC 3V4VB 1L2UA 3ISPA 4PWKA 5A8MA 3OPZL 3ZR8X 4LCWD 4KEVA 1AU7A 1PYFA 1YYLH 1INQB 3M1OA 3UZYA 4WJ5A 3KLHC 4WIQA 4Y2XA 5SWUA 3WLQA 2VR7A 1JJ6C 1BPVA 3GR4A 1XUZA 3HOUJ 3DF8A 4J4PA 5JHDE 4C4KO 3RBEA 3GEFA 2VRQA 3RWEB 1E0OB 2IPQX 4PQXA 2Q3ZA 2RTTA 3NH7H 5E6RB 3B0VC 4ECTA 4FTDA 1MBGA 3B1TA 2P4WA 1KPRB 3T65B 3ZZLA 4PPTA 5KVDE 1UASA 2NLJA 4KK6C 5IT3A 2ZXCA 4PULA 3WFCH 5FESA 2GXGA 2VDRL 3OMZA 1OK0A 4UTBH 3KP1A 1TVHB 3EEZA 1H4PA 4HF0A 3NAAL 2W03A 3HM7A 4UR7A 1KA8A 1JKPC 4Q6IC 2DSZA 2H9GA 5CR0A 3IWPA 2O6EA 1IEXA 4F4YA 3GXIA 4HW0A 3V55A 2HBMA 1KTLA 5T33L 4E7LA 1D5MA 5A69A 4Q2ZB 3MCMA 4Z7UF 4Y4HC 1E9OB 2YPKB 5LHDA 3IJLA 4RCAA 1ISYA 2OQLA 3D69A 1S8NA 4O1DA 2E5DA 2BHNA 1VFCA 3GDCA 2KIVA 1V27A 4AYBA 4S23A 4UFJA 1TIWA 4YFXF 4ZB2A 3HOGA 1DVUA 1R46A 2G96A 1VGKA 1K4DB 3O6AA 2JA6J 3K0YA 5KTEL 3SKMA 2BV9A 2P50A 4PIBA 4ODSL 1I1AB 3C2GA 3X2QB 1TW3A 4WW2A 3DETC 3IDXH 1XSDA 1IGTB 3DRQA 4F55A 2P8MB 5AKEA 1YNLH 4EMSA 5DGQA 3WQCA 1MI5D 4XO7A 3VI4F 2YGVA 1EC8A 3IUDA 4P9ML 1A5NC 2WZ0A 4TS6A 2XZ7A 4HUVA 3MV8A 5K4LA 3NEHA 4LRNH 2EDMA 2G2PA 2OMWA 3KWWB 2IS2A 3JRHA 4P5KB 1TK5A 5JZ7D 4RE0A 2W4XA 3O9WA 4UR9A 1FLRL 2XM1A 1L9OA 1J5HA 3EH4B 2HPIA 5DR5H 2PEVA 3M6YA 1ZVYA 4N0UE 1ZSXA 5KVGE 3IRSA 1TCRA 3BGFC 3ZYOA 2QKIB 1IGJA 2OZ4A 1I7TB 1GNXA 2D8CA 1TLKA 1D5ZA 4H1LG 4ZOEA 5MEOA 4NO3B 2J88A 2V8MA 2ZJSH 1ZHFA 1HJQA 3P8IA 3UFIA 2CLFA 4UNOA 4MX7A 3GSUB 1GYNA 1TPEA 3KFWX 1JFHA 1BFOB 4XMPH 4FA7B 4G43B 3ZCOA 3DHFA 4PG2C 1FL3A 1SHSA 2DMBA 1LDSA 4AX3A 5IJKA 2GITA 2VC0A 4H2HA 4DZ5A 2EG6A 2GL5A 4N9HA 2PDUA 4PJAA 1JT0A 4FXGB 1KXQA 3IMSA 3L1GA 3TA3D 3T2QA 3EYVB 4IGSA 4DPAX 4JREC 3QMRA 3FSOA 2NRAC 4DO4A 3R94A 1GOKA 2V2XB 3QDGD 2GOXB 3QUXB 3IBOA 1STZA 3V35A 2ZKZA 3QO1B 2RNGA 3QU6A 2BO0A 4LCVA 4G80B 2EBIA 2E1DA 1VBRA 3P0WA 4MLRA 3V0IA 5FO5A 4GRWB 3HJ0A 3VAEA 3SEQA 1KCRH 1WH0A 2X3AA 1VRXA 2VDLH 4YHPB 4PP1D 1LRQA 5BRZE 1T3QA 2NV3A 1ADSA 5IHHA 2Y31A 1AD1A 1LT8A 1K83J 3ZY7A 4JDVA 3RWHA 1DWJM 2CHRA 1IAWA 1C7TA 4R2GB 2ITDA 5DS2A 2JF1A 4JP0A 4NRYB 3UBPC 3TN3A 4MJ4A 3HB3B 1OQFA 2HFFB 3BV4A 2X4RB 3MV7D 3TCEA 2J77A 3IK4A 3QYEA 1O0VA 3AXXA 4H13C 4E2VA 4UW9A 2VXQA 4OQTA 1KULA 2BY0A 4DWDA 3Q6FB 1CGTA 1FSKC 1XCQB 4PJDA 4M7ZB 4X0KA 3ZVIA 4O2EA 4AGOA 4UAVA 3GHSA 4NRZA 5F1OB 1UZCA 1HKMA 3OKLB 3GD1C 4WFGD 3JTTA 4C6CA 1DWAM 1LO0H 4WKZA 4R33A 4ZMVA 2JKRM 3V6ZA 4RQ5A 3N91A 3FUNA 3QDAA 3R0AA 4P3DA 2NRTA 1UHMA 1UQVA 3GMRA 1T83C 2XY7A 2IG2L 4U6VH 3H7IA 3D3AA 4PCNA 2BFVL 1Z48A 3R0JA 3DU0A 5LBSA 4RZ5A 3UJTL 5ITFB 4TIMA 3IDIA 3GG8A 1NBYA 2IALB 4GKSB 4MQ9F 1WPKA 4UMSA 3HFYA 1E27A 5JORB 1BI3A 1A1OB 4TM9A 5H37A 2IS7A 2DOEA 2A3EA 4GYPC 3VIHA 2OCCH 4MZ2A 3ZMVA 5FGCB 3PYCA 3AWOA 4AWEA 3RIFK 3WD5H 3F6VA 3RUGA 3TESA 3INUL 4BHBA 2X16A 1G94A 5T3XH 1PSKL 1KBVA 1HXYB 2NX3A 2YSWA 2OM6A 4EZ6A 5F9OH 1PE1A 2W8LA 1EANA 2NV9A 1V02E 2Y69B 1TJ1A 3O6FA 1MQQA 3GSNH 3L3KA 5D7JB 2COQA 4H41A 1DDNA 3E2HB 1TQCC 4E0RB 2KZMA 1S4IA 3MOQA 4A3LJ 2QHRH 2B59B 2MUCA 5EU7C 2Z1VA 5DT1H 2GSIA 4AOFA 2X1TA 3NL5A 3CTTA 3IJYA 3JTGA 4JAMA 4UFLA 4MTVA 4I01A 1D9DA 1I3QJ 1JPDX 3RB3A 1VHPA 1Q3VA 1W3HA 4FQLH 3OTQA 4YC2C 1YW8A 1QO3B 3RZCB 4XBEL 3EBGA 2WBJC 4WI9A 3T8XB 2E9GA 1F11A 2C9AA 1GVDA 1A5MC 1BEYH 3EJCA 4A4AA 3TFSA 2EVFA 3DYMA 2B9SA 3GG0A 2FQEA 3QU9A 5ALPA 3SMVA 3RY5A 4NZ3A 3RIAF 5ADOL 2EDFA 3SE9H 1GTNA 2MAXA 3WKDA 1K3UA 5HD8D 2K40A 4FS1A 1A7PL 4ELDA 1VQNI 1X5AA 3MR9B 2DT7B 4PUUA 4M02A 2UXFA 4QS6A 4BQ5A 2HN7A 4I5RA 1NDWA 4FS9A 4Z0XA 5AHFA 2WWKT 5EEZA 4K3EL 3N18A 1O5PA 1G0XA 1H60A 1IW7F 4H8HA 43C9B 1PKOA 4NP7A 2V0TA 4BH7A 4QRPD 2O7OA 4QJ3B 3NRWA 2PO6B 3ZHDA 4XX1G 3QP5A 3L3GB 1D5VA 1IWBA 3UERA 1W8OA 1QFOA 1E6OH 5C09D 1KBBA 5HYIA 4O4WA 4DX3A 5JHMA 1U5TB 3BPWA 4DP7X 1MDMA 2C9VA 2XAJA 4LVBA 2JZYA 2PO6A 1X4OA 1E1EA 3MRBA 1JMZA 3DTKA 1JVLA 1YZZA 4OOIA 4OZOA 2JVGA 3ESNA 3V0VB 2V5CA 1H1NA 4ZOAA 1RKWA 4KITB 2WZTA 3MNWB 1F6PA 2D2OA 2PZ0A 1TTFA 4B91A 3QRLA 3GUTB 4D6EA 1YIJI 1J8HD 4HXAH 1VYPX 1VF8A 1S7TB 2BSTB 1R9XA 3V7SA 1LYQA 4O15A 2KPWA 4JY6B 1A9EA 3QW4B 2C7UA 2L7KA 2QHLA 1BG1A 3RMEA 3OB0K 5T9BG 1DGSA 4GUCA 1O1HA 3WFDL 3EF4A 4BJ5C 2XIOA 1PW3A 2ODIA 4KFZC 3BR6A 3C2YA 3IFOB 2JH2A 4U6YB 4EE2A 3MGOB 1CDIA 1DN0A 3G6DH 4NWUL 1N67A 4AVOA 4KO5A 2J3SA 3IG5A 2KL6A 3ZMEA 1O6SB 3CK0H 3B04A 1BLNB 4DFMA 2H3KA 1M1XA 1N48A 4UTBL 3KXQA 1OGAD 4B5SA 3VFTB 4Y5XA 2HMXA 5KFSA 2DLFH 5IEHB 1JV5A 3PL6D 1GVRA 1FVDA 1G9EA 3RDTA 1Z00B 1BGXT 4ONVA 2LKYA 5GS0D 4PHEA 2GW5A 1LDCA 1JROA 5ANME 3ZN0A 5KBDA 1XVSA 2IT0A 1UOVA 3C5QA 3W7RA 4E0RA 3ITYA 4P8UA 2NQLA 1UJ3C 2QHAA 2D4DA 4ZSTA 1ZRMA 2RALA 5D1ZI 3KPNB 2F2EA 3F8BA 3PO5A 3R4KA 3HPSA 1QUNA 4XWGL 2PJRB 1M6JA 1M7UA 3L21A 5CC5A 1P0NA 5F6FA 5EBUA 4MQTB 4OZHB 1E27B 5JORA 1OCCH 4YHLH 1I2PA 2VDGA 5ALYA 4Q8MA 1Y5XA 3CFKB 3VQLA 3PNZA 2QKMB 5FUZL 4LB5A 4HISA 4Y4KB 2B0CA 4IMFA 2WXHA 1C8QA 1O66A 4OUUA 1W0TA 3UJIL 4D5FA 2CAKA 4LLMA 5C0ND 3EETA 3DIFA 4N2NA 2DUYA 4B7IA 5F08A 5EL1A 1S3KH 2FYYA 3AIWA 4O1EA 3ITGA 4GKZA 3BRDA 4PTXA 4QWQA 4CRXA 1ZK8A 1V4YA 1BYOA 1LROA 3GC3A 3CXFA 2PDWA 1NJZA 4B4HA 4A8EA 3AT0A 3PGCB 4YDVA 3KZZA 2E7XA 4YIRX 2VQCA 4R64A 4LLQB 3T0CA 5IJBC 4H6RA 4DQ2A 1HILB 2XGQA 4FKHA 1XF4A 2R29H 4HV8A 5ACZA 1I1CA 3UTTE 3JS3A 3TYDA 4MSSA 3ZOBA 1IZJA 3LZNA 4D1IA 3ZO9A 4CQBA 1A4KA 4RRPA 4Q6IA 3T3PE 4KKQA 3BZEA 3FIGA 5L8LB 1IXRA 4JFTA 3PZGA 2K70A 3VD7A 2LHAA 1HL8A 1WQVT 4Q74A 2GY5A 1ED3B 3F6IA 1IQWH 3VG9B 4GA8A 1P92A 1I1XA 1D5YA 4B9CA 1E9PA 2JKXA 2I5YL 1Q8KA 2R2EA 2AV7A 2Y0MA 1OZMA 2UWFA 3QU5A 3FTXA 3VFTA 3QEGH 4HMCA 3U5YA 1KCLA 1GC1H 5CNHA 4S05A 4WFEE 1A6SA 5FGBA 3FTZA 1ZKGA 3MKGA 4W9KC 2XFFA 1RXOB 1E2ZA 3H8NA 4PJLA 4IOTA 3H7VA 1HI6A 3ARSA 3QDJD 3WD1A 4ZPVA 2ATPA 1NCHA 2J1ZA 2KZGA 4E9YA 1YEEH 2J7DA 3GR8A 1TVAA 3BW2A 1EIXA 5LA2A 3WK5A 3VXRE 1QH9A 5KFVA 3I6GA 3PDOB 3BT9A 4C56B 1EV7A 3SIZA 2XHYA 1KJVB 1BHGA 3GUTA 4DCQB 3QJTB 2R0WL 4MX7B 4N6QA 1DIKA 2ENJA 4HZ6A 3RN6A 2WWCA 4QDGA 3RL1A 5HNRA 1Z9LA 2UXXA 3OIXA 1R3JA 9ICVA 2QZRA 4HPYL 4LLUA 1Y65A 3MJ6A 1HH6B 3FK4A 1XDMA 3QPXL 4GXVH 4G6MH 1QBLL 4PWIA 5L9XA 1CR9H 1MAML 1CG9B 5DDHB 3LSPA 5KFEA 5C7HA 2A9NH 3WLNA 1VACA 2OMZA 4KLQA 4EDWH 1ZEAH 5CR1A 3M7DA 4FR1A 1GXPA 4WDUA 4IIQA 3CUGA 4QO1B 3ZLFA 4AYGA 3K6FA 4RZBA 4WOZA 3DJTA 1XSPA 2WMKA 5I1IL 1T1ZB 5KVGH 4OCRH 2P5NA 2VN6A 1CFVH 5I23A 1V6TA 5CZVH 2GGEA 2ZCLH 3THCA 4D8PB 3HUJB 1IGTA 4Z77B 1VA9A 3S96B 1HHIB 1A7QL 1I1AA 1MD0A 1HLVA 3M7SA 3RRGA 1NUFA 1RUOA 3GQCA 3JTSA 1H61A 1YEKH 3KCPB 1AQ8A 3BPNB 5GVJA 3RX4A 3C09C 1XTLA 3LSKA 2F74B 3O6MH 4XHQA 4WEEA 3JW4A 1OGTA 2G75B 3M8RA 4N4YB 2V6CA 4A68A 4BFOA 5LBGA 3HE7D 4X6DB 5GIRB 2C3GA 2PWHA 2JJTC 3OYBA 4JDZA 2C6QA 3A1YA 1DQDL 5ALRA 2G7UA 3MLTB 2BCQA 2HT3D 2NXZD 4LVNB 1SGKA 3K4ZA 2K6YA 4FERA 4MS8C 4R8HA 2QDDA 4W88A 1AJ7L 1LLWA 4G6QA 1I7ZA 4LGWA 4L1LA 4GW1B 2E47A 4IGHA 4JZJC 4HBQA 4MDIB 1NCAL 2J7HA 3B8UA 1KCVL 2BKEA 2E9LA 1I60A 4AEHL 2WZHA 4UNLA 3KRUA 3PL6A 1SY6H 1KPRA 3LTVA 3F7JA 3PVFA 4GAGL 2HLEB 5FWRA 4MASA 4GSQA 1ZB5A 1SEUA 3S32A 4IS6B 5I19H 3MO1B 5IW3A 1GG1A 3MHGA 4DIAA 1G6RA 4AM0Q 3RM4A 3MO7A 3V4VH 3T4WA 2VC9A 3UWQA 4OLWL 4H6EA 2CR6A 4ZMWA 1OOWA 1WZLA 2L8AA 4DPRA 4O3OA 3J81j 4LJXA 4L5IA 1DQUA 2K45A 3CUXA 3L0GA 5A6KA 4M8VA 1WUZA 2HHWA 3GNDA 3FTWA 1PTAA 5B7YA 3QAZC 4AF0A 1WJDA 2A74C 4QHRA 1LP9E 2HE8A 3ROOA 4QTIL 3J7YJ 4AWXB 2EC9T 4RX4A 3STZB 3KPPB 2C15A 2IO5A 3MANA 2YW4A 3L3HA 3CCQI 3QUKA 4G8GA 1AIZA 7FABH 4E68A 3NJVA 4ZCWA 2LFEA 1PY4A 4W9IC 3RX2A 3ZDDA 2B2XH 4L18A 4XD6A 2YCLB 2I8DA 1YBQA 4OF0A 3RWJB 1H15B 5ISZB 3TWCL 1OFRA 2ZOUA 5DI8B 4MF4A 2UY7A 3F12A 2D2GA 1OIOA 2GUOB 1LL1A 5C9UA 3HNVL 5KANI 4A05A 3QODA 4HZLA 1A7RH 2G5WA 1S7QB 3RPUA 3KM2A 2X2HA 3CFEA 2QCGA 4XK4A 3SQRA 1XBXA 1KN5A 4E7SA 2YBRA 1P6WA 3W86A 3H9SE 1S39A 4JIEA 5IOBA 1NP0A 3MRPA 3ZRCC 3KL0A 1TKWB 2J56A 2CLKA 1JCVA 3V5KA 3WD3A 4L4TE 4PMNA 2XH2A 1M7JA 3NA8A 3OAUH 4JN2B 4JTAA 1EQPA 3UKGA 4KZDL 2W80C 1KFDA 1FH5H 4NQSB 2K85A 5KBMA 1P0SE 4HJWA 4BACA 5BOOA 4OY9A 2QLVB 1WWWX 4IFKA 3CJTB 1KRMA 4OJOA 1F18A 1UPHA 1F4YL 4A3DJ 1YE9A 4MD5B 5ALLA 2APTA 3H3ZA 4FMFA 3RX9A 4NQWB 2VGLM 2Y7DA 1FIGH 2VQ4A 4AM3A 4QAWA 4NRRA 3HOXJ 3LHWA 3K4KA 4BH8A 4Z0SA 2XSXA 3OG6B 4FXGA 2QUVA 2BSLA 3GNML 1IZKA 1OV8A 2YN4A 2MSPA 3RPIA 1VFSA 3OAUL 4X6DF 1R5ID 3P77A 5JPMB 4H9TA 2RVCA 1MCDA 4LALA 3UZXA 3GJFB 2I69A 2ALZA 1EKEA 2JELH 5DVNA 4NIRA 1BBDL 1BQCA 4TSBL 4Z3GA 3T2NL 2CRXA 1Z9SA 1PK3A 4RIRA 4UCGA 1QSZA 1MW7A 2VFFA 1ND0B 4N8VA 5SWZD 1FIAA 4I5XA 3IDGB 4Q7NA 4Y8AA 4X6CF 3P62A 1AY1L 1DDHB 4AYBN 2KHQA 4C60A 1E6ZA 3BUDA 2Y5JA 2GA1A 4XKCA 2Y7OA 3VWKA 4L4TA 2N0MA 2MPVA 3SR6A 4B0MM 5BYWA 5FXCH 1X7QA 3ZYZA 2GAZB 1GVIA 1U8QB 4JFWA 1QX1A 4QJ1A 4ZX6A 5MHSD 3J27A 3MV8B 1SZRA 3OGSA 4KW2A 3NPXA 5I6NA 4UM8A 1KTQA 3VH8B 1Z6TA 1IRAY 5FYLD 1N78A 3BPCA 5CC6A 3GV8B 1J0IA 3S8WA 2P24A 4QCEA 2Q2EA 1CDCA 2G07A 1CD0A 4ADJA 1OGSA 1RXLA 2CKBH 3NZ8A 4BWUA 3W1RA 4ACYA 4ODHL 2R18A 3ZZ1A 2WAQA 1TMCB 2XUWA 5C7VA 1QLEB 4J9JA 1YC8A 4P55A 1R3HA 1A3HA 4F8LA 4PJAE 3KWVA 4LZGA 3EYFB 3D69B 2OR9L 3H24A 2GVYA 4MF2A 3WK2A 3BUPA 1VADB 1LBFA 2DWTA 1W1VA 3PZNA 4M3JA 4QTGA 2Y69H 2BW3B 3GRGA 2IH3B 4HG4J 2N1TE 2QMKA 1ZHLA 3QUMH 2F6UA 5I6MA 1UM5H 5F2LA 4EF3A 1KRPA 2Z99A 2FATH 4C3IJ 3I02B 3U4BL 5J8CA 5AB1A 2PTTA 4ONFH 2ADFL 1N82A 8ICTA 3PTMA 4B9UA 5JW3H 4UV7L 4I27A 3I4EA 4Y16C 2YX7A 4TV7A 2VLKD 2MPAH 1OISA 4LJZF 1X5KA 3NIDF 3WN6A 2E4FA 3MFFB 3DIVA 4BEUA 3Q06A 2R7EA 5HDQL 4KJPC 3W7NA 2JZBB 3BLEA 3U3HA 3W2DL 1DBKH 1IRGA 4EUPA 1LOLA 1U8IA 4A8RA 2DLHA 4PJFB 4HA0A 3TA3A 1F9CA 1GEHA 3K2AA 1V77A 1N6VA 4UDUB 3KR3H 4X4XB 4PRHB 3WIHL 3NFNA 1J5CA 8ICEA 2BVUA 5A2JH 3UBXB 4HAMA 4XRFA 3ZHFA 1WHUA 1XR9A 4PRDA 4DJFA 1ZA6A 4OF5A 3TE9A 4QXGL 2R59A 5KFRA 3ISCA 4UNKA 3U4KA 3BKCH 3U1QA 5CZKA 5A16B 1MCHA 2OF7A 3DKXA 1ZS8A 2O7SA 5TDOB 5ABDE 2V5YA 3ZPLA 1RKRA 5FDYA 1USZA 9ICKA 4P9FA 3HG2A 3NPZB 2AJSH 3KHRA 2M45A 1S38A 5KANG 1F86A 5E8IA 2PR4H 1D9KA 1DU6A 1AMKA 3N4FA 5EO0A 4HVXA 1HSAA 4YO0B 1MZZA 2CLOA 4XZIA 1DXFA 1JHLH 2ADFH 3AOFA 3T4CA 3OJVC 2EFOA 3NYDA 4I1PA 3WTYA 2Y7EA 3KPOA 4XCCH 1TZIB 2X9ZA 2VDMB 5DYOB 8ICMA 4C8MA 4KO9A 4EBDA 4MVAA 3GUWA 3VXSD 4M43H 5LQBL 1SFOJ 4H19A 2LAAA 2C79A 3ZN6A 4PJBE 1FY7A 4W4NA 5KG7A 4KXAA 4K8GA 3MNZA 1A5KC 5C6WH 4ELMA 3T6XA 3AYVA 1MVUA 3HZKA 4AQEA 4LS2A 4A35A 5DMKA 4ZTFA 4FQXD 4A6DA 1RPUA 1Y0LA 1RCOB 3WLTA 1T1YA 1SD4A 5DG8A 4YXLL 2OLDA 3U7AA 1X2IA 1TITA 4H44C 2AS5M 4YTTA 2J8FA 3BZ6A 1P69B 3VC8A 3OWTA 3H40A 3T44A 5GADJ 3ULVL 4OZIF 1DYZA 3ZIMA 4M3KB 1WC7B 1E3HA 3GG1A 3WGHA 3LZFL 1F3RB 1BV8A 2XSAA 3DG3A 4ZSOB 5HDBE 2DFIA 3HXLA 4JVPA 2G37A 1N8FA 1HKVA 3EYYA 1T7LA 4BSWB 3N2XA 3FO2B 3I5UA 2FHCA 2W1OA 5HDOA 1G3SA 2LF7A 1PYWA 1ZBCA 1NEZB 1Z6RA 1FNNA 2MCAA 3UFYA 1U1HA 1CF7A 3WGUB 1DPUA 3RBGA 4KH9A 1FWWA 1N8WA 4CHUA 3MC5A 5AI9A 1A1NA 2B4CL 3TYFA 4HMEA 5BOEA 1CFBA 4C2TA 5ABFB 3DVIA 3MMWA 4WX9A 1YEJL 4WFHE 1AD0B 2XXCB 4DOZA 2X1UA 5DJYA 1MIEL 1U8LA 3G04B 4J03A 5J1RA 3LSIA 5HMLA 1XYBA 4A2MA 5B39A 5F0FA 4H9VA 2V6EA 4G7SB 5DD3H 5JU5A 3PHOB 4K38A 2YAOA 5ABFA 3HLKA 3GDLA 4YK4C 4WWID 5DC0A 2XUCA 4NO0B 3CZNA 4NJKA 3I7RA 3FM5A 2R1WA 1EH8A 3N14A 1G6CA 2FB2A 2VH5L 1ZQGA 3JZEA 4P2OB 5DMMA 1NGWB 1U9KA 1SHMA 3US1A 1KM2A 4KI5D 3V72A 1FHGA 3A6CH 1T8EA 2VSCA 25C8H 3LZ5A 3BN3B 3H6JA 3P0YH 2IQTA 3MWCA 2ADGB 4JJ5B 2ATKB 2IP2A 4FQQA 5JXEC 2QF8A 2FYVA 4I2HA 1P7TB 3CH1A 3N1PC 3M8JA 5IIMA 1ZRDA 2GJ6E 2XIGA 5H91A 1S7SB 1KR1A 5DBTA 2C1OA 4L4MA 4ETYA 1EEZB 3K6OA 2MLGA 4UVCA 2DEXX 1FRGH 3L5JA 5T1MA 3KBMA 2RGLA 1L3TA 4MA1B 2JGYA 4ABQA 1P7HL 2X48A 1XDSA 4H0EA 3I2CH 2QAPA 1ZQJA 4PMZA 5FA4A 3THAA 3C6EA 5DQJB 3QUYA 2OB3A 4RFEA 5CMAB 4FB7A 2OYLA 4LCYA 1HZLA 3NN8B 3U30C 3OC8A 3UMGA 3ANVA 4YEFA 3D2UB 4Q97A 4FNPA 4A3EJ 1MJUH 4XP5L 3QC3A 3JRFA 4K8EA 1W16A 3FCTA 3HGRA 3KLNA 4XD4A 1TQJA 5FGSA 2ISPA 4ZQRA 4S39A 2XWTB 1O3TA 5F7MC 4EENA 2GSJA 7TAAA 4L0ZB 1GXEA 2WMHA 1JGEB 1E4IA 3W85A 3S2JA 1KTJA 4C4KT 3MZTA 1B31A 3M47A 2F44A 2ZUBA 3IH3A 5BPDA 1MCOH 1M4KA 4GRLB 3STGA 3HAEA 5IJDC 4H7VA 5K9OA 7ICEA 5JQIB 4O02L 1IBGL 4BKLB 1J93A 2PKDA 2RGSA 3A03A 3M07A 5T5NG 3RVXC 1DIEA 4B50A 4NAMA 4GUHA 2IIJA 5FYLH 2VKWA 4LSPL 2A3TA 4Z7IA 2MRLA 3MRCA 1FNEA 4CZCA 3WKNA 2K5CA 2R0ZL 1NL0L 1WCGA 3GTIA 3RPMA 4Q47A 1Q94B 1XX9C 2BP0A 1CI5A 4Q8EA 4XAWH 3LEXA 3TIDA 1HINL 4A67A 4UARA 1EZUA 3I6RA 2JMWA 2E7HA 2DOFA 3GRBA 4JDYA 1R33A 4E42B 5A2CA 1U8NB 4QRFA 2ZIUB 2VC6A 2AOSA 3NCMA 2ZUDA 3IXTB 5TD4A 3AG3B 1QATA 1BM7A 3G1OA 3TADC 2LYCA 3EWDA 5JW3L 2CWEA 2GBVA 2NV2A 1XLHA 3PBYA 3BQ5A 3D51A 4CNIB 2F1HA 2CR3A 3BVXA 4B92A 3N12A 2I9TB 2IWKA 1OCPA 4QDPA 2DA1A 32C2B 3R11A 3G2BA 3BDBA 4OCNC 2RJHA 5K7FA 2PLKA 2Q8BH 1OLTA 1KPVB 5K93A 4FA8A 1WSUA 1C5BH 3VZXA 3TTSA 2P5EA 4LEXL 2OCCB 1B3IA 3SYQA 2E2HJ 3VD9A 2JUGA 3IJQA 4NQDB 2DOCA 2V2TB 1C08B 2YUSA 4BCXA 1FOYA 4DF1A 3KL3A 4UY8I 4BEIA 5ILTH 3OYZA 5J2KA 2IGNA 1C8YA 3N0PB 1WTGT 1YHQI 4AQ8C 1R2RA 5MP6H 1P7TA 5D37A 4F2FA 1W9XA 4GWEA 1OAZH 1IC7H 4MMXA 4HMNA 1H09A 2IXVA 4BDVA 1K7XA 2CCRA 3MUHL 4GG6F 3VI4E 3MVTA 3IAQA 4HZ7A 2V7FA 3OZ9L 4JPWH 4HLYA 3I76A 2D7OA 4R8UA 4URTB 2C71A 2XPWA 1KCXA 1D3GA 1I2OA 4PH5A 2GQ9A 1NNLA 2GJLA 1RQEA 3FQXA 1QSEB 3OJSA 3W3CA 2DZWA 3OIOA 3I6LE 3ASNB 5J8LA 4IU3A 4LU5L 4QWWD 3QAQA 1N0XL 4ZFOL 2IH1A 1BR4A 3ETTA 3OL2A 2W8KA 3N0AA 4ZMZA 4Y1AB 5F7AA 2O72A 1ZJNA 1G1CA 4CSWA 3OHBA 5GS0L 3EKGA 3PWUB 3P9IA 3GMNA 1RZGA 1BQUA 1JF1B 2IWFA 1JDEA 1XB4A 2AU0A 1TJPA 3BWGA 1UYQA 3CVHA 5KOMC 1T1XA 1W0MA 5GGQL 4KMLB 4B6ZA 4DYJA 2PBOA 4DBWA 3H0LB 3VA6A 4UTJA 4MQXC 3DHUA 3AB0C 5E8DL 5C9WA 3MI2A 4MA3A 4A93J 4QJ5B 7A3HA 3TAPA 1NY1A 1IWPA 1MJAA 4J9NA 2DT5A 4O4YH 5FHBH 3SW6A 1JUPA 3VCLB 4FA6A 4JJOA 3UZEC 2D03L 2YXGA 5F89B 3RGVB 2M87A 1SFTA 5I0ZA 3GNMH 1PY9A 2R51A 1L9PA 4L2YA 5T5FH 2L04A 3ITVA 5MENB 2EH7H 4PRNB 2EUXA 3NCCB 1U8MA 2UY4A 1SJEA 4A2SA 1XF1A 1WC7A 3I6SA 4WR3A 2PKEA 4IBUA 3GS0A 4RDYA 3OS0A 4NC2B 3VI4B 1ZXIA 5GRVK 3CXHJ 2ZJAA 4DNLA 2WB1C 5ABZA 3AFHA 4KJWD 5FO9B 4BA8A 3FBNB 2X4QA 3PPFA 4A2HA 4GI9A 7ICQA 3VFGH 2YGNA 5DMKB 2QPEB 3QSRA 1ZD4A 3ULUL 1ZQKA 3AL0C 3UZVB 3VXNA 4OQ1A 5E70A 2NVQJ 3PO4A 4KXDA 3HZYB 2IV9A 2YXMA 3K4BA 1RYRA 4GKNA 5E1XA 3PANA 2XN9D 2ZRXA 2YMXL 1RG6A 1HW6A 1MFAH 3SDCC 4U7CA 4CJ0A 2FBHA 1DLHA 1EP1A 4PR5B 2Y2ZA 4JN2A 1ZCOA 1XF3B 2ARJB 2OMVA 4I09A 3GM0A 2MA1A 1HJSA 1NFAA 4U0YA 1N60A 2E3TA 2AAAA 3M45A 1GTEA 4K7VA 1S7VA 2YZ1A 4DQOH 4X7TA 5K5RA 4OMYA 4HF5H 4HUWA 1S7WB 1XG4A 5E8NB 1S8DB 3HBZA 2H45A 5FJTA 5CJ5A 3NWSA 2OAZA 2WXQA 2ED9A 3L9FA 3T04D 2PMHA 4B9KC 4XMPL 2AQFA 1U91B 3PK7A 6REQA 2WWKO 5B5EC 2CYGA 2UZYA 5BS0E 3PF2A 2VIRA 5CPTA 2P5VA 4PC8A 4R7LA 5FFLA 2QKIA 4N0YH 4X5QA 2CM5A 4RUBA 1XGSA 4D6DA 4RGMB 4QEEA 3S1MJ 4W9JC 1UT8A 4GC6A 4R79A 3AS2A 5IESL 4AIDA 2MTPA 4JG5A 5KVEL 4XO4A 3E80A 1BPYA 3DC8A 1WFNA 4OCMC 4IRGA 3AW5A 4JM4H 3ECVA 5DJ2B 4NUPA 4QRAA 4NNXB 3GIZL 4Z6AT 4IH3A 3EYSL 5L3CA 2LLNA 4X6EB 4EI5A 5FCZA 3GXMA 1JZJA 4JFFA 5FCUH 4NZRL 2Q7YB 5K9JL 3FU0A 4UB9A 3LWFA 3DRQB 1NIAA 3NK3A 1WBHA 1SFHA 4U3HA 2UXVA 5FCSH 1BIIB 1MH5A 1Z05A 2HR3A 3ILPA 1SLUA 5AYZA 1LRNA 3QI9D 1BRLB 1NAKL 2ISFA 2W7PA 4E2DA 1V5EA 2QLYA 2P4AB 2H6OA 3ZTNH 2B20A 5G5IA 1IAIL 1IE5A 1QEWB 4QLLA 2PCPA 2HBVA 1S7RB 2W9MA 2AXWA 5ALQA 2V2TA 2NMSA 3AROA 3OAYK 4HP5A 4FZNA 4FXJA 1KIPA 5IT9K 4J9OA 4WJG3 4XV0A 4P2OC 3BZ5A 1W5OA 1ZV2A 3MLVL 1FYHB 3PY2A 3VOEA 3UD6A 5A2QZ 1B2YA 3K72B 4PREB 2VMDA 5T1LA 2CJTA 1KCKA 1CWYA 1EO5A 2X9WA 1R3QA 3RLGA 3FDKA 1R3HB 2DFHA 3UWWA 1RQBA 3QULB 4LCWB 4FCAA 4D5CA 2HROA 5ABEA 4BSVB 3IAGC 4Q6XA 2NWRA 4ISVA 1OW5A 3N3MA 4EACA 3WSUA 1F8TH 4JRXD 2BCKA 2N01B 5KSAD 3QRFM 3M5ZA 5IB1B 3HUJA 1SFKA 2W3ZA 1AXIB 1GCFA 2RLTA 2ZP9A 4AEOA 2YOAA 5IB4A 4JFQA 3IV3A 2GHZA 3IJEA 4XOEA 4BX9C 5DJ6A 4K7YA 3BTNA 3VFNA 4OHQA 5C0FA 3KYMB 4ROQA 1Z3GL 3K4WA 3VGAB 2CA4A 2H94A 3KUMA 2IXQA 3W9ZA 2O6FA 3SI8A 4KQ4H 5F96L 3I6TA 4BQOA 3NR0A 4PJIE 2ZIWA 4W6XB 3SZTA 1VACB 4UQAA 3KBWA 5CPMA 1Z3NA 4IPPA 1RULH 1WCBA 4G7ZF 1BEXA 4ADTA 1J59A 5ENLA 3DMMD 2EZKA 1AG0A 5IFAL 4RNOA 2HDWA 1GQIA 1A3RL 2IAMD 4PFEA 3RG1C 1V5XA 4UM9D 4UMCA 1OFDA 1E2VA 3LZOA 3H7RA 1A14H 3MLSH 5CS7A 2AJ3A 1GGCH 3KLDA 4LNYA 5FYKH 3W2JA 4EPDC 5DBBA 1NCDH 3VTRA 1NOWA 1Q1VA 2OYYA 2E9WA 4NG3A 4B9ZA 3Q2DA 5JNYB 1DQWA 4IP4A 4PJHF 4WTWA 3OYIA 2MSYA 4HZMA 2WINA 2IGTA 3D2UA 4G42A 3MUZ1 4RMRA 4ICAA 2J6VA 2ATPB 5AK4A 4YXMA 2XWBB 3FJ6A 4XKWA 1GH7A 2ESVE 3OYXA 2GJPA 3G6AA 4LCQA 4K7PX 1MW1A 2EZ0C 1U3YA 1BLIA 4BWJA 3OF6D 3F58L 1E0TA 4AD5A 4JFDD 1RH8A 2J1WA 5DD4A 3RA7L 3WNIA 4G6JL 2AFNA 4FOJA 4BGDA 4OBSA 1XLFA 4IFKB 3OYLA 1ZJMA 1AG1O 3MUIA 4FJ6A 3SEIA 2QCFA 2FA5A 4XNZC 4OJFH 3OWRA 4XPHL 5KTQA 2PGRA 5EUOB 1TPB1 1FWGC 5F93C 4OOZA 4Y7OC 1XIWB 2HKFH 1C90A 4XG1A 3I71A 4MXQC 2P44B 3A4AA 3V5KB 1W2KT 5DDYA 1US0A 4P5TA 2BXYA 1U5JA 2VLRD 1V5GA 2DSUA 1S7QA 3HVNA 4PRBA 4UFKA 4LK1F 3CSGA 2NQZA 2J6UA 1EF3A 3NQOA 2B6GA 4WI2A 1YNKL 2PUQT 5I15H 4HXBH 2XY2A 4RISL 3PG9A 3UAJD 2JXMA 1L7TL 4Y4HB 3E9TA 5C7ZA 1XO0A 1A6IA 5JTIA 2ZX9A 3CIQA 2OXGA 3LNIA 2H3BA 3IXAB 1ZQSA 5AOMA 4ML4A 1ZQQA 3NIDB 4U28A 3MGHA 4EDXB 3M88A 5EFIA 4G12A 1E3XA 4ENJA 5ALEA 2YYUA 2VE6B 3BJ91 4XOAA 1DU0A 5KBKA 3QXUA 4OCZA 5ICYB 4ADIA 3H9SA 3ZPDA 3CV1A 3MT1A 3SDGA 3RU8X 2VXDA 5AIAA 5IQ9A 1NANI 2E2IJ 2HQAA 2F6XA 4KDTA 3BUVA 3S6TA 1BPEA 3NCEB 2ZJ2A 2RAGA 3AMCA 1U95A 1F02I 1XBRA 2PWGA 4YG2F 4GRMB 1CO1A 9ICJA 5E9DB 3UIYA 3P9MB 3IJHB 4UZUA 2Y0SN 4U1KB 4NC1C 2KERA 2Z2UA 2JA7J 2Z7WA 5I6OA 3QIBC 1EAPA 2DQFB 4PB0H 3PJWA 2PMUA 5BO1L 3M0LA 4L80A 2FGZA 4IBYA 3QTGA 1N0LB 1VBUA 3W07A 3UXOA 1KFWA 4P57A 4AV4A 4BQ9A 5HHOD 2XF6A 1HW1A 3HFMH 2W94A 1C1EH 1ETKA 2MNUA 3ILQD 3HGOA 1A3ZA 4Z3TA 1JULA 2VOTA 3S47A 1NDGA 4XOCA 1RAKA 4HKXA 3UTQB 5FGRA 4I2JA 3RFZA 1YUHB 1ZSHA 2YD8A 2XKSA 1MA7A 4IOCF 2GLEA 2XA8H 2VZ3A 5C09E 2BE5F 4QT5B 1HSTA 5TISC 1AHWB 1KA9F 3KCCA 4JRYD 2K60A 2FX8H 1AZNA 4AT6A 4IXHA 2R2HB 3WFDH 2J6XA 3I3EA 3KPLA 3WHBA 2ODHA 2DJXA 3W1MA 5EN2B 2DMTA 1IFHH 4BBWA 1EGJH 2FVKA 4WWOA 3TC6A 4GSXA 4XLAA 3NOYA 1F44A 1F5SA 4OLZL 3OHXB 2XZQH 1XAUA 3SAZA 1EGZA 3OLDA 3NVQA 4DYRA 1N5AA 4XBKA 3D4CA 2CXYA 4BHPA 4FJZA 3U9GA 4O51B 3CO6C 2UY6A 1N19A 3AL0B 2DQHL 2PFPA 2OMXA 4EI0A 2Y72A 1PUDA 1BIBA 4DSKA 3C5GA 4DJDC 1ENUA 1H6UA 1FLRH 1ZU8A 1R38A 4Z3EA 1HH9A 3SDCB 3BTJA 2DPIA 2X6CA 1LDKB 2X6BA 1B9NA 2L9VA 3WY1A 4HCLA 5M03A 3LNGA 4AWSA 1U3HC 2R94A 2OYMA 5FCUL 1JUSA 2IQ0A 3U46A 3B5HA 3C5ZD 3KW7A 4IJBA 3WGGA 3ULUC 2PCFB 1G3WA 3FQ1A 4MWAA 1U8KA 2PGFA 4NFDA 4XR8C 3LV3A 3E5PA 4ZPTB 1EXGA 1OJXA 2W9EL 5HS7A 3WCYA 1V03A 4K6AA 3O8GA 5L1LA 3W0WB 3RL1B 2E8MA 1EB3A 5I1AB 3H2PA 2EK5A 4H8QA 2AI0H 1IEQA 2OP4L 1KW4A 1MHHB 4L0ZA 2A6KA 5DCCA 7ICSA 3IMWA 4NQ1A 5CBAA 5AD0B 3G5VA 3I6GB 1S5WA 3EXTA 5DK0A 4BUHA 4U6TA 4Q48A 3N4EA 1OK8A 4OV6F 4C7ZA 4RGMC 3VE0B 1TBXA 4E41E 1G2HA 4E6KG 1TO3A 1XGYL 3LEYL 2H1PL 3ESUF 1Q66A 3RGVD 2ZWZA 2ZUVA 5D8ZA 1IEIA 4DPPA 2H32B 3P4NA 2C28A 1U8OA 4M6AA 4B3ZA 2AJQA 4P7RA 5GJNA 2YC1B 4FLSA 4B5NA 4DXKA 1SPQA 1FH8A 1P9QC 2D31A 4HNVA 3O6KH 1SNRA 3LSJA 2C2EA 3WQFA 2M3AA 1BVZA 4TVPD 5DHMC 4HKPA 3NZSA 5CPSA 4BFKA 4I77H 4JWMA 3NH7L 2B59A 4GXPA 4O8RA 1TQWA 3ATEA 4ZRGA 1V05A 2KKQA 5JR3A 1T6BX 4MKMA 3SCOA 4WGHA 2MNJB 2NXHA 1PDKA 4HJGA 4XCFH 3EBAA 5HVGB 3VFGL 3FF8A 2DQJH 2B7DT 3V9FA 3SZPA 5BO0D 5KYXA 3WU2C 1I9EA 3NEXA 4GAAA 3S37X 2DBLL 3LXBA 3W83A 1P4AA 2PDPA 3V16A 4EF8A 1L4IA 4QWWC 4DO5A 1S8OA 4LCSA 4PW3A 1LFPA 3ISRA 2G60L 4L3EB 2WQVA 2PDGA 2YQEA 1T56A 2I25N 4U1KA 4TV5A 5FJPA 2LH9A 5JUEL 3D12B 4N68A 4YSAA 1JGGA 1HXMA 1RUPH 1OCBA 4N2GA 5EDNA 4QW8A 2AEWA 1HQRA 5EULV 4PJHB 2VH5H 3OD3A 1LNUB 2IDUA 4Y2PA 2H1XA 2A7RA 2VABA 3UQ0A 2XC7A 4LVFA 5B4MC 4Z7QE 1U8QA 3EOUA 4LVOB 4YPGB 1A4BA 3EJTA 3W7HA 5E2VH 3URBA 2CGRH 1U6AL 3KCOA 2E4TA 3LWMA 2XQBL 4YWGH 3L9YA 3DV6B 4ZE4A 1PJRA 2OO0A 2VDOL 1D8KA 2HGCA 1Z69A 3KYNB 3N7RC 2JF6A 2ZC1A 4PWFA 1EGVA 3H0RB 3JT2A 1CDYA 4JPQA 4XXWC 3VINA 4HD9A 2WXGA 4EANA 2W24A 2J9YA 4V33A 3GRWL 1S9YB 2BDNL 1GKPA 3S2DJ 3FRPA 3D1NI 1ZAHA 3DKYA 1CZ8L 2LC2A 2ORBL 4QPOA 2OCEA 5JHDD 1MEWA 1QK0A 1ZPUA 4EBQL 3C0JA 3HAEG 4WTZG 1XS2A 5LAPA 1WAEA 5CGBA 1GHCA 1F0LA 4BS0A 4DSYA 2VKHA 1TVPA 1F58L 3JQOB 1YEHL 4JKMA 1JPSL 5HNNA 1SO3A 4XC3L 4EJTA 5GS3A 4ZOHC 3JWDH 5DK3A 4HSHA 4ICXA 3OZ9H 4JPWL 3MOBL 5EU4B 2MGQA 2JSFA 2Q2LA 3WFHA 2XWJA 4F57L 1T1YB 2Z93B 5HYQA 3JPNA 2YLKA 5EO9A 2BB0A 3TO4A 1UUQA 1GOXA 2NCEA 3NDZA 3EZ8A 2QWWA 3S0CA 3C8HA 3ESMA 4CD4A 4B9FA 4YQXL 1MBFA 2QQLH 1VBHA 4M56A 3P0XA 5HMMA 1L6ZA 2RA1A 2O61B 1B8IB 3ORYA 5TISU 5M17A 5C0CE 1PVQA 4ZL1A 1VQLI 3OA3A 3N9RA 3H26A 3KPOB 5ICXB 1YN7A 3MCKA 4JBRA 1S9KC 2Z7YA 1MI5B 5HHPB 3ETRA 3MYJB 1FFOA 3OM3B 4P06A 5KVRA 4EBCA 4PHPA 4YDIH 4AEFA 4G8EA 4GIOA 2HCFA 5GNZA 5AYTA 1YECH 3KFTA 3AUJA 4FG2A 3U21A 4FE7A 4NO3A 3HJEA 2EZLA 4A6YB 4HAKA 1CUOA 4JQ4A 2PR4L 3C75A 2CQQA 3Q9VA 1VHCA 3MDUA 1EJSC 4PJBA 4Y4FA 2DQTH 1TVDA 1BKSA 1P1VA 3QIBB 4MJIA 4Q6YA 3GG7A 1HX0A 3ARDA 3FQ4A 2BQ3A 3KEDA 1KELH 3SBWA 2YDQA 1Y0UA 2E7BA 3UDWC 3UTTA 3DRTB 1XIFA 4PUBL 1U93A 2X9DA 1S6NA 2B3IA 2HWZL 3V7AE 1D7KA 5AM2A 2UZXB 1DSFL 4DL2A 4LARL 2O5ZH 3UTZA 3BXNB 5LHGA 4AC1X 4YMPA 3DMMB 3O8HA 2P8BA 2N8GA 1J4EA 3KNBB 5EA0L 1DQQA 4IF2A 4YD1A 2A1AA 2ZFUA 1QO5A 1GYAA 4IKFA 2R4RL 2E8OA 3BIKB 3MSPA 4JTIA 3BSZA 2OM5A 2ZIXA 5B7ZA 1IJWC 4YHZL 1VGKB 3ZDYF 4XP6H 5DRNA 2BCMA 2EZXA 2KP7A 1QWKA 3MBXL 1BOAA 2NW2A 3V5DA 3ZW3A 5D05A 4FNLL 2F15A 4L29A 2YARA 4WI0B 4IO9F 4UQ3A 4ORZC 4Q2ZA 5AECA 3L67A 3Q58A 1RZ4A 2HYGD 1S9VA 3AQXA 3SCTA 3U4BH 1AGFA 2QLZA 6ALDA 1ERNA 2QR6A 2AQQA 3CDGA 1W0VA 1KBGL 1LB2B 3VU1A 5D2YA 3F03K 3SRFA 4OFVA 4NNAA 3GO2A 1EJWC 5BNKA 3UACA 2CALA 1IM3B 1O95A 3L3JA 3TL4X 1JZ8A 4Y9NA 3VABA 2VLRB 2DFAA 2H8PB 2YBUA 3SADA 3GB6A 4N24A 3DGRA 1H89C 2CZFA 3FM9A 3IVSA 3TOBA 3QVQA 1ZDSA 1W9BM 2XRAH 5IBLD 1C9WA 2A5HA 4Z77A 3UGRA 4F4KA 4PLJC 4G5ZH 4PCFA 5G5DA 4XUGA 1IL1B 4HUUB 5DY2A 2LAGB 4NP4L 1RJQA 1NGQH 2GJXA 2H7WA 1AJ2A 4K2UL 1B54A 2UZXA 3QIBD 4YBLC 2A6JA 1J0ZA 3VXTB 1TR7A 3T07A 1DK2A 4I18C 4Z3HA 2XX1A 3PP4H 3MPGA 2E1NA 2YXXA 3VFRA 1OSPH 1S76D 2VSKB 5A2AA 2ZUQC 3V7CA 4XN9A 5B8CC 3ME0A 4IPAA 4QWCA 4BY1J 1FXPA 2HFHA 3SE8L 2QENA 5EDXA 4WDXA 4S3AA 4PMUA 1SV0A 1YDVA 4U7DA 1N7ML 2QQBA 1X9UA 4IMLB 3CC5B 1PMYA 4Z2YA 5SX5K 3C1DA 1NK8A 3GI8L 1BBJA 4Q0XL 4FAMA 2YDSA 2MHAA 1F5TA 2BVLA 5IVXA 1B5TA 2EJ1A 1BVKB 1Z0MA 3NIFF 4NLKA 2EDLA <