2O6KA

Crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
YSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0346 protein MW1311
publication title Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 24
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2o6kA00
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH superfamily
4XA5A 3K75D 3HP6A 2G5HB 2YTUA 3FM9A 1RYUA 4PZOA 1ZQ1C 2LM1A 2ZUBA 2HI0A 3AN1A 4C4SA 1L3TA 2BQUA 2H5XA 2OWOA 2VIXA 4F5NA 3QE9Y 1SB3C 3M9OB 4B9LA 3QZ8A 1X6JA 3BQ0A 3JPQA 2VJ5A 5JUMA 4BGDA 2Y1JA 4QWBA 3S6JA 1QCKA 1RYRA 1ZOLA 2IOFA 3DV9A 3NTUA 2BR0A 3Q8PB 8ICAA 4FZLA 4QIWC 2ISPA 4GIBA 4OJLA 2ZUCA 4EZ9A 3M9NB 4UASA 3RF9A 2ISOA 1PK1B 1ZQOA 5J0WA 1ED1A 2LKYA 4G3IA 2KVSA 4QJFB 4ECVA 1DXSA 1SV0C 2Z7JA 3EUB2 2AQ0A 1D9DA 1NNLA 3PR5B 5CWRA 1BNOA 8ICGA 2FPMA 5AI0A 3QXGA 3VC8A 4QZCA 4PHPA 2B6GA 2M9NA 4C8LA 5ALZA 1TAMA 2XCPA 3KZXA 5J8YA 2OXOA 8ICHA 4O3RA 5AKJA 3M7DA 4I2CA 1C20A 2ZIXB 1S9FA 5KFTA 1ZQNA 4KLDA 1ECWA 3UMGA 1BPZA 5J0XA 2ZUDA 3M8SA 4JB3A 5ALOA 3MGIA 1Q3VA 3BZKA 2D3DA 1U47A 2XY5A 1ZQYA 3C5GA 5KFWA 1D8BA 3H7IA 4Y2SA 2HOFA 4OO1J 3LVVA 3SMVA 5HNKA 5DDMA 3ISDA 3EW9A 3N4MB 1EXNA 5DG8A 3MR2A 3V7KA 1ZQLA 2R8GA 1WG8A 5DQIA 4UAYA 2FPKA 7ICMA 3RJJA 1JI7A 3QYPA 1KDHA 3C28A 1NK8A 1S5LU 3B0YA 3UXNA 2KIVA 1N2XA 3MFIA 3H0MB 4O3OA 1SGGA 4AP9A 4Y2TA 1VDVA 3BQ7A 3N7SC 4O3MA 2KFNA 2I1QA 4BJQA 2YB4A 9ICMA 1SIJA 4UB6U 4Q44A 1SKSA 7ICIA 1FO4A 3MGVA 1JN3A 5KT2A 3QZ7A 2PMZC 1BPXA 2E1EA 2W55A 2ZJ8A 3C1ZA 5DBAA 3QU7A 3L5KA 4XRHA 4KLUA 3BQ2A 1COOA 1QLNA 2O6KA 4NV0A 5ALHA 3MBYA 2K4PA 4E0DA 3RR8A 4CF4A 4QW8A 3IDWA 3MDAA 3ONNA 2YX8A 1KBUA 3QX7A 4UW9A 4G9BA 5F9NA 2ASJA 3GZFA 1SXDA 4ED7A 3V6KA 1ZQBA 5CEHA 4F71A 4EX6A 5J0OA 4QZEA 4F5OA 2QKQA 2XVTA 3SAFA 2HHTA 2K4EA 4NLZA 4DOCA 2DWQA 1Z4NA 4QWDA 7ICOA 5TZVA 1XC9A 1ZQEA 4J9SA 4DSKA 5AKGA 2EDUA 4YR3A 4YN4A 5KG3A 4DOAA 2PI5A 3C29A 3ALRA 2ZXHA 4KLFA 2KE7A 4EYIB 2J6TA 4K4HA 4BXOA 3RH4A 2WAQF 4FFDA 3ED5A 4QZGA 2FJ6A 2JH1A 4F3OA 2OHFA 3NVZA 1ZQAA 2KMDA 4GFJA 3KHGA 4M6WB 5KFDA 2HCFA 7ICFA 1COKA 5L1MA 2ZIUA 1MC8A 1NK9A 1F0MA 4DSEA 4BWJA 3HILA 5ALYA 1TFRA 1TK8A 4KLQA 4ED0A 2MRLA 2KZMA 4F5RA 1AROP 4M9NA 3GV5B 3T5JA 4J9QA 2G08A 5DBBA 2C2EA 2EZYA 2W8KA 2HBKA 1YZ6A 3QU2A 4P0QA 2C22A 3H8MA 3PZPA 1Q8KA 8ICNA 1IIPA 1SL1A 2HMXA 1S0OA 1Z00A 5KFQA 8ICYA 4PHAA 3QUQA 5EWFA 1ZD5A 4MF8A 2WTFA 2GO7A 2XICA 2W9BA 2KHVA 2BPFA 2RRDA 1P7DA 1L3VA 1T94A 1VJ5A 9ICIA 3OSPA 8ICTA 4I2BA 4QZ8A 1XO1A 1V97A 3WKCA 3GIMA 4BWMA 4B9NA 4US8A 1KLNA 1HEKA 1ZD3A 4ECSA 2AHOB 3V7JA 3LVWA 4EZ6A 4FS1A 3GDXA 1NZBA 3GV8B 5CB1A 3GU3A 3K4GA 2AH5A 3C5FA 5ALPA 4IQTA 3F2BA 3BQTA 1NI3A 4USAA 4KLEA 5AIAA 5AK6A 2AXTU 4QWCA 1O08A 2YMPA 1QH9A 1Z4OA 1SL2A 2HBMA 4PH5A 4F8RA 5J2KA 4PPXA 3PX0A 1TAQA 4ED6A 5EE9A 2YMMA 1RZTA 4QW9A 3D2NA 1IM4A 5AI5A 3WK4A 3C2KA 4Z6DA 5KFRA 2P66A 4OD0A 3UQ0A 4YG2A 4Y2YA 4JV0A 2RP5A 2JEJA 2JMGA 5J0SA 2F77X 4MEXA 1IG6A 3HX0A 5CRXA 3RFAA 4BUGA 5KFNA 4DO9A 5ALLA 4Q45A 2K89A 4B9MA 3RB3A 2KP7A 2DPJA 4NWIA 2ZIWB 2DKZA 3CRXA 1S10A 4I2GA 5DGAA 1U9LA 2BCUA 2KEYA 2PXIA 4P4MA 2F1IA 5KT3A 3EYZA 3OTQA 2JEGA 4NLKA 5KFMA 1L3UA 1MQ2A 4ELVA 3F2DA 4M2YA 9ICPA 4NLCA 4YQWA 4K4GA 3QEBZ 3HWTA 1KSPA 1SWWA 5KFPA 1XSPA 2HSZA 2GWSA 2JZBA 2ZIVA 2XGQA 5G5GA 2AGPA 3M8RA 3KKAA 3MDCA 4ED3A 1ZD4A 5B66U 3MFHA 4DL3A 2EAPA 5L1LA 5FP0A 2FLPA 7ICVA 5DGBA 1NK4A 3TI0A 4YMOA 1B0XA 8ICXA 7ICLA 2H3FA 2PFNA 1DK3A 5KFJA 2I5HA 2VKQA 5HP4A 4R8UA 1KL9A 4EENA 3CW2C 4RZRA 4GXKA 4I2HA 8ICZA 5EE1A 3I1YA 2G0AA 4C8NA 2KKPA 2P35A 1K5OA 4RQ5A 4YR2A 2F8LA 1RQNA 4F72A 4ECZA 2FMSA 3IM1A 3PSIA 3UXPA 1RQLA 2F44A 4KLMA 2YY6A 5ALEA 5BOMA 3BDPA 2NRVA 5KT4A 1L7NA 2F8KA 2NRXA 3T3FA 2KK0A 2W9AA 5EOZA 1KQQA 3RR7A 3ZD9A 1NJWA 2KICA 1OXJA 1UT8A 4F91B 2BGWA 4KN7A 5KG7A 3ISBA 1A77A 8ICQA 3T79A 3IN5A 3DEEA 3QNMA 5KFFA 2XI9A 4P4PA 4Q8FA 1X9SA 5HR7A 3ISCA 3F53A 4UARA 9ICHA 5DG7A 3WKAA 4IL6U 3OPXA 1KTQA 5EE3A 2BQ3A 2IHNA 5KT7A 3CP8A 3SQIA 3PO4A 1WWUA 2ESEA 3PO5A 2BHNA 4UB8U 4ED1A 2KG5A 2KJ9A 3RJGA 4RQMA 5IINA 2ZJAA 4GC7A 1UHUA 4PGXA 1J2MA 4QIWF 2HHWA 3SEIA 4QZDA 1J2NA 4ECXA 5JTIA 1L8OA 1N56A 2K8AA 2XIDA 1DGJA 2PFQA 5CJ7A 3RAQA 2Q4TA 4O0IA 2KSOB 2HBJA 1ZQDA 1XU4A 2KV2A 4QWAA 4JV1A 4IQVA 4KLGA 1WWVA 2MAXA 3H40A 2DUYA 5ALIA 1HUOA 3EZ5A 3T5HA 4NXZA 5J2FA 5AKXA 2HHVA 3H8SA 5KFKA 4QZHA 2RDJA 4KTQA 5KFIA 3NASA 3TARA 1ZQFA 3F5AA 1OUQA 4MFFA 4AYBF 3ETRA 1L5UA 2A1AA 5J8YC 3NRWA 1ZJMA 4C8KA 3H0RB 5J0RA 2KN7A 1X9MA 4YCXA 3MR3A 1ZQRA 5AKEA 4KITB 3QU5A 4RQ6A 2C2RA 2NV3A 4TUQA 4RQNA 2W8LA 4YFKA 4CGZA 1C7YA 3KBBA 5EE0A 4B9SA 3AEVA 1ZQPA 3WK9A 1MA7A 2FLNA 1FFUA 2MUTB 3M6ZA 3IG8A 3PSPA 4FO6A 2YN4A 4UQGA 3PV8A 4P0PA 5AM4A 3U26A 4XUSA 4ECRA 3N7PD 3F5EA 1A76A 1BPDA 2ZTCA 7ICRA 3HW8A 2F2AB 2ALZA 3AU6A 3KFUF 1XWLA 2D6FC 5C0YA 2J6UA 5ALUA 8ICCA 4PL2A 2PFOA 8ICVA 2VA3A 2I6XA 3H8WA 1V9PA 2P6RA 2DFLA 3L3FX 1K1QA 4OJOA 2A1JB 4J9NA 2ZTEA 1CI4A 2JHDA 3LWMA 1T3QA 4KX3A 3NVWA 4DL7A 3M9MB 1HJPA 4DL5A 2Y1IA 2AGOA 2R8JA 1ZXIA 3G6VA 1T8EA 4CNQA 1HIWA 4O5KA 5KT5A 3OHBA 3AQEA 1U48A 3IG5A 1LKYB 3H4BA 7ICUA 1CEZA 3BS5A 3D6JA 3FC4A 4MHVA 4WJ3B 4O3QA 5J2IA 4EEYA 5D49A 1V38A 4EELA 5D46A 4RPZA 3IRUA 2XY7A 3N28A 4EX7A 3K1ZA 4DQIA 4KLIA 3JPRA 1QQ5A 2EZXA 4DS4A 2XY6A 4DCCA 1ZQVA 2NRTA 3RJHA 1TKDA 5JRTA 1UA0A 5AI9A 2NYVA 4KLOA 9ICBA 4PJ0U 4DQRA 5KL8B 4P2HA 2AU0A 4US9A 2WFAA 1NK5A 2BCQA 3PW7A 4YMNA 1NK6A 9ICAA 3MR6A 5E79U 1SKWA 2QARA 3WKEA 1JX4A 4F4XA 3RRHA 1PK3A 5ALWA 5KT6A 4UB5A 1DK2A 2LYHA 2K60A 1NOMA 4M6WA 2BKEA 3KOOA 2G06A 2H3IA 2E8NA 5KG1A 5HMMA 2A19A 5J0YA 9ICOA 1SXEA 3H8JA 5KFVA 2LM4A 2IMWP 1V85A 3T5KA 2UVWA 4CE6A 4YVZA 2W54A 9ICCA 4EYHB 2UVRA 4K4IA 8ICUA 1B22A 2H3VA 3RBEA 4O5EA 1X40A 1D8LA 2HBLA 1ZQXA 2LYBA 2JRZA 5DB8A 5TISU 2DBYA 5C5JA 4DFPA 4C7YA 1XSLA 5AKIA 2KHQA 4NL9A 1JXLA 1ZRNA 1N61A 4JUZA 4RPYA 2BDUA 2PFPA 4ECUA 2HVIA 2JR5A 4RPXA 7ICGA 3TAQA 2W9CA 3SI8A 1NK7A 5KG5A 3SAGA 3G6XA 4F2RA 2E8MA 4ICAA 1PVQA 2K8CB 3B9JA 2ODGA 5HHHA 1KKXA 2KZ3A 4UBCA 2R8HA 4RU9A 5KG2A 5KFXA 1ZQTA 1RG6A 4PZNA 5IIIA 1BPYA 2NRWA 1KW4A 2WF6A 4Y2QA 4TUPA 5ALVA 2LI6A 4F5QA 3TADA 1N63A 1ZQIA 3PMNA 1N48A 2GLEA 3JPOA 3AUOA 3QEAZ 4KX5A 4EBCA 3D2QA 3I76A 4GC6A 9ICGA 1SV4A 2CPRA 2Y0SF 4BXOB 2JGAA 4C4RA 9ICEA 4CCHA 5J2HA 2CN1A 2LMRA 1NK0A 1A6SA 1NKCA 2FLLA 4TQSA 1PVPA 1S0NA 5KG6A 1QQ6A 3WK7A 5DLGA 1JMSA 5DB9A 5ALKA 2HHXA 4IQUA 1YZ7A 5EWGA 1ZQHA 1N5XA 5AKZA 1X2IA 1NJYA 1K1SA 4J9KA 1NKBA 4B9UA 3GILA 2AGQA 4Q43A 3NUQA 2WF5A 4DLGA 3RJFA 2VA2A 3N7RC 5L1KA 4MFAA 2XO7A 4F93B 1FEZA 1U45A 4I2EA 1ZJNA 3RRGA 1BGXT 4UB1A 3PW5A 5DQHA 4KLSA 4XQ8A 3EWAA 3PVXA 4UB4A 3LK9A 4M9LA 2KZZA 2ZTDA 4U7CA 1Q3UA 3IV6A 1WCNA 2LBOA 3WK8A 4P0QB 4DFJA 2RLTA 1U49A 1MSWD 1TAUA 1QSLA 5J29A 4Q8EA 4Y2UA 4I2DA 2W04A 2FDRA 4DSIA 7ICEA 5KTQA 5IIMA 1QTMA 3L4PA 3AMZA 2W9BB 1D8YA 4KLHA 1T4GA 1TE2A 3JPNA 4C4TA 1KFTA 4LZDA 4Z6FA 4IQWA 1PZNA 8ICWA 4IC9A 2VA8A 3AU2A 3RB0A 4RT2A 3ZI4A 1UPHA 2KD1A 1KEJA 2RDIA 4I28A 3GIIA 4B9TA 5J2JA 9ICSA 2OH2A 5J0TA 2KJ8A 8ICBA 2ZXIA 4F4ZA 4KLJA 4HYKA 2E8PA 2NO5A 5KFGA 9ICWA 2AQ4A 5KFLA 4UB3A 5BOLA 1ZETA 5ALJA 4ELTA 3JPSA 4UAZA 4Y2RA 1XS9D 2QB0A 3V6JA 8ICRA 1NJZA 3E58A 4UAUA 3KKAC 5DQGA 2GOLA 5AKHA 3C23A 1TV9A 3SAHA 4FE3A 4M9HA 4M9GA 4DQQA 4M47A 1ZQJA 3HKZC 5ALFA 3GV7B 4IRCA 4DL4A 4J9MA 3RB4A 8ICOA 3NVYA 2L5YA 4OJ5A 3PSTA 2ATLA 4ECQA 2HDOA 4KMUA 3M6KA 4F4KA 1PUZA 5J0QA 4OJ6A 3BZCA 2IBKA 3PW0A 2ZG6A 4C80A 4RQ7A 5B5EU 2WB1C 9ICQA 2G07A 1ZQMA 2W7PA 1TK0A 2BCSA 2QB1A 1ZYQA 2NRZA 4ECTA 7ICTA 5ALRA 3DDHA 2ZJ5A 3OJUA 2EH9A 3QUBA 1WUDA 4JK1A 4J9PA 1S0VA 2B21A 5CR0A 3OHAA 9ICJA 4PGYA 4UATA 5KFUA 5K4LA 4F4YA 2DKXA 1RXWA 2FPLA 1L7OA 3KD3A 1X9WA 3ZDDA 3TANA 2R8IA 1BNPA 1SZHA 4F4WA 1JXEA 3PW2A 4ZOHC 4RNNA 2KSOA 1N60A 4GXIA 4Y2XA 5DDYA 3FDSA 2GH1A 5KFYA 4R63A 4TURA 1RPLA 3MR5A 3Q8KA 1URJA 2KVCA 4I27A 3OJSA 3HPOA 1NZPA 4CF5A 5AKKA 1MN8A 4OJPA 2OEHA 1BVSA 3MABA 4NLNA 1PK1A 5ALMA 2E5SA 2P6UA 4OCZA 8ICPA 8ICMA 1S0MA 1DOQA 3AQFA 2HVHA 3IHQB 2E3TA 5KG0A 3UM9A 1ZQKA 2BQRA 4GLXA 3CNHA 5CP2A 2KOBA 5J2AA 4ECYA 1IV8A 4CDGA 2W7OA 2M0NA 3SV3A 2CRXA 1U4BA 4ED8A 4I29A 3TQ1A 1D9FA 5HMLA 1KFSA 5KFHA 3H0LB 5G5HA 4M9JA 2MUTA 3BS7A 1M6YA 4DF8A 4LJXA 2YB1A 2NO4A 2ASLA 3NS1A 1HUZA 2FMQA 5L1JA 2ZIXA 2EAOA 1JRPA 5AHXA 4RQ8A 4J9OA 4J9RA 1DRGA 2WHEA 2RHFA 1BPEA 3O0FA 5AI6A 5J2BA 4JWNA 4EBEA 3VCBA 3UPQA 3C2MA 5L9XA 3RH5A 5KL1B 3LYSA 2KFZA 4KLLA 4RQ0A 4UAVA 5KAFU 3R9KA 2WF8A 2A1JA 2XCAA 1FFVA 4YXJA 4QZBA 4O9MA 4DWIA 1SWVA 5AM0A 2DF4B 5DBCA 4TQRA 3B0XA 3ETLA 4DOBA 4HAIA 1RDFA 3Q8RB 4DS5A 2FE9A 2BCRA 4DFMA 4TUSA 3THVA 2DPIA 1LKYA 7ICKA 3OSNA 2H3ZA 1T3NA 1SV0A 1A0PA 2VANA 5J2GA 4AYBC 4JV2A 4JWMA 3D2SA 3RB6A 1N5WA 4Z6EA 1DGSA 2DGZA 1NKEA 9ICXA 1Z3EB 4PGQA 2KNJA 4GXJA 1LVHA 1L3SA 4IS7A 2W11A 2E1FA 2BDPA 3ZDAA 4B6JA 2KTQA 9ICLA 1FIQA 1UCVA 3SENA 4KN4A 5KFAA 8ICJA 3N97B 4M0AA 1UQVA 3ORYA 2HOQA 2PMZF 1UT5A 4IRKA 5ALGA 3Q8QB 4FZMA 2HHSA 5T14A 3ZDCA 5J2EA 4P0PB 1JUDA 7ICQA 1Z1VA 2JEFA 2V9WA 4C0ZA 2QLTA 4FBTA 1LB2B 5ALXA 3WK6A 3EPIA 4P4OA 2F1JA 2F76X 4NLGA 4M04A 4O3SA 3ZDBA 4RQ4A 3TFSA 3AM9A 3T5LA 4IR1A 3RH6A 2JXJA 3GIKA 1L6NA 4Y2JA 4MFCA 3WKDA 1Y88A 7ICJA 4F2SA 2R18A 3RJKA 4BDPA 3EPGA 8ICIA 4YD1A 1XSNA 3GIJA 3BS5B 4DLEA 4DL2A 2FMPA 2ES6A 4F50A 1ZQWA 4RQ1A 2YQEA 1UA1A 1ZQQA 2HW3A 1CUKA 4RUAA 9ICRA 2PKEA 4I2JA 4C8OA 5IIJA 4NL9C 3Q8SB 4MF2A 3OGUA 1B4FA 4UB2A 4I2FA 5J2DA 2G09A 9ICFA 5A0LA 3QU4A 5ALQA 3RAXA 1GO3F 1S8OA 5AK4A 3SV4A 5GTHU 1QQ7A 3BJYA 2KKVA 5DG9A 1TK5A 4Z6CA 2VJ4A 2YMLA 4PHDA 5J0UA 4QNLA 2HOIA 2FI1A 1JROA 3NVVA 4Y2PA 2JH7A 2C2DA 2QARB 4DEZA 4EEKA 3JPPA 2Y9TA 3H4DA 1ZQSA 2E8OA 3TADC 2ASDA 5HR6A 4QZFA 3A0HU 3WKBA 2DL0A 2W43A 3PW4A 5JU5A 4FBUA 5AKYA 5ALSA 3UMCA 2W3RA 3RJEA 3LWLA 3C2LA 4YR0A 4RQ3A 5J2CA 3WK5A 3HRDD 5AI8A 3SZ2A 2WAQC 5KNIA 2LYAA 2JV3A 4F92B 5ALTA 4JMUA 5AKLA 4NM2A 3GFKB 1X6IA 9ICNA 1J97A 4UBBA 2IOHA 3ICXA 1Z19A 3PMLA 4RNMA 1X42A 4DFKA 2IA6A 4U6PA 2V4RA 1O03A 2ZIUB 5KFSA 5ALNA 2HHQA 3J81j 1SL0A 3LDAA 1VLBA 4LVSA 3QUTA 4RQ2A 4PL1A 4QZ9A 4PHEA 2W9CB 2OCEA 1ZD2P 3IP4B 1TVAA 4YP3A 4ACOA 3UQ2A 3A0BU 1XO0A 2UVUA 5DKWA 2W9MA 2Y9UA 4CRXA 4I2AA 5HHIA 4YD2A 1S77D 2N1RA 5KFCA 3G6YA 1AQ6A 1JALA 3KTQA 2IOFK 1X9XA 1JIHA 4IRDA 2Y0SC 1YT3A 5AM3A 5ALDA 4O5CA 2WF7A 5IIKA 4RUCA 3UXOA 3PY8A 9ICUA 4O3NA 1Z00B 4Y2VA 2ZIWA 3KHRA 2K4HA 3MC1A 4F5PA 2MSNA 4CF3A 3HT3A 3Q8MA 3E2EA 4UAWA 3SD7A 4EBDA 5DLFA 3JPTA 1ZRMA 1PVRA 5F3XB 2I9GA 3QU9A 2MA1A 5AK3A 3F2CA 5KAIU 3V72A 4KMOB 8ICLA 1KFDA 2WF9A 1IXRA 5AICA 2HHUA 2W3SA 1NJXA 1F5SA 3I28A 4I2IA 4DFDA 5GTIU 3PX4A 7ICPA 5AK5A 3M1YA 5AI4A 3HKZF 3TFRA 4FS2A 4QZIA 4LZGA 2K8BB 2BZFA 1WYGA 3FAHA 3TAPA 2UVVA 3TACB 2CXYA 8ICSA 4J03A 2KJ5A 2LHTA 3QUCA 2MU2A 5AIBA 5KFBA 5KFEA 7ICNA 4NY8A 3RBDA 1QSYA 4RT3A 1RYSA 4DF4A 1Q46A 1BPBA 5H2FU 2XGPA 4DSFA 1SKRA 2KIWA 3C21A 2WB1F 4QWEA 4B9VA 3AL0B 1ZQGA 5AM5A 1QSSA 4BX9C 2R8KA 1SZPA 1MQ3A 3FYHA 1OW5A 2XC9A 4R65A 4QZAA 2EQYA 2BCVA 2JEIA 4C7ZA 2G5IB 4YXMA 3MGHA 3SR6A 3GQCA 2C28A 4DL6A 1Z1BA 3Q8LA 2DQNB 4ELUA 2J6SA 2H3QA 3KHHA 3HJEA 1RXVA 3WU2U 3RJIA 1ZQZA 2QB0B 3PR4A 4C8MA 5KFZA 2YMQA 4KLTA 8ICEA 1H38A 1KRPA 3PNCA 4IR9A 4NLBA 2EANA 4X5VA 2RQ5A 4NM1A 5AM1A 4DSJA 5KFOA 8ICFA 4ED2A 2F1HA 4ZH4A 3KZIU 1S76D 2Q0ZX 5KG4A 2JZBB 2ZIVB 1F44A 9ICKA 4NJ8A 5EWEA 4RNOA 1KN5A 3NRZA 2AJQA 4DSLA 3NGDA 4J9LA 3V7LA 3PX6A 5AM2A 2A3VA 2F3NA 1ZQCA 4R64A 1X66A 2B0CA 3K1RB 4FZNA 4R8UB 1T7PA 2W03A 3TKAA 7ICSA 1S97A 4A8EA 4YMMA 9ICTA 3KHLA 1L7PA 5DB7A 8ICKA 2OYYA 2D8CA 1ZQUA 2V4QA 1N62A 2EZZA 1L7MA 5F9LA 2BPCA 3ZD8A 3ZDEA 1LV5A 1B43A 2EAMA 9ICVA 5D4BA 3RTVA 2BPGA 1CRXA 2PI4A 4MEYA 5IIOA 3SYZA 1WCLA 3UMBA 4DQPA 3C1YA 2LPEA 1RM6C 3PSFA 5J0PA 4R66A 5IILA 3V6HA 4O3PA 5CHGA 2OM6A 4ECWA 5CA7A 5DB6A 2K4IA 5BPCA 5L1IA 1L8LA 3CYMA 4DQSA 3E0FA 1XNSA 2IHMA 3BQ1A 7ICHA
chains in the Genus database with same CATH topology
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6K A;  2KVS A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 4XA5 A;  3K75 D;  3HP6 A;  2G5H B;  2YTU A;  3FM9 A;  1RYU A;  4PZO A;  1ZQ1 C;  2LM1 A;  2ZUB A;  2HI0 A;  3AN1 A;  4C4S A;  1L3T A;  2BQU A;  2H5X A;  2OWO A;  2VIX A;  4F5N A;  3QE9 Y;  1SB3 C;  3M9O B;  4B9L A;  3QZ8 A;  1X6J A;  3BQ0 A;  3JPQ A;  2VJ5 A;  5JUM A;  4BGD A;  2Y1J A;  4QWB A;  3S6J A;  1QCK A;  1RYR A;  1ZOL A;  2IOF A;  3DV9 A;  3NTU A;  2BR0 A;  3Q8P B;  8ICA A;  4FZL A;  4QIW C;  2ISP A;  4GIB A;  4OJL A;  2ZUC A;  4EZ9 A;  3M9N B;  4UAS A;  3RF9 A;  2ISO A;  1PK1 B;  1ZQO A;  5J0W A;  1ED1 A;  2LKY A;  4G3I A;  2KVS A;  4QJF B;  4ECV A;  1DXS A;  1SV0 C;  2Z7J A;  3EUB 2;  2AQ0 A;  1D9D A;  1NNL A;  3PR5 B;  5CWR A;  1BNO A;  8ICG A;  2FPM A;  5AI0 A;  3QXG A;  3VC8 A;  4QZC A;  4PHP A;  2B6G A;  2M9N A;  4C8L A;  5ALZ A;  1TAM A;  2XCP A;  3KZX A;  5J8Y A;  2OXO A;  8ICH A;  4O3R A;  5AKJ A;  3M7D A;  4I2C A;  1C20 A;  2ZIX B;  1S9F A;  5KFT A;  1ZQN A;  4KLD A;  1ECW A;  3UMG A;  1BPZ A;  5J0X A;  2ZUD A;  3M8S A;  4JB3 A;  5ALO A;  3MGI A;  1Q3V A;  3BZK A;  2D3D A;  1U47 A;  2XY5 A;  1ZQY A;  3C5G A;  5KFW A;  1D8B A;  3H7I A;  4Y2S A;  2HOF A;  4OO1 J;  3LVV A;  3SMV A;  5HNK A;  5DDM A;  3ISD A;  3EW9 A;  3N4M B;  1EXN A;  5DG8 A;  3MR2 A;  3V7K A;  1ZQL A;  2R8G A;  1WG8 A;  5DQI A;  4UAY A;  2FPK A;  7ICM A;  3RJJ A;  1JI7 A;  3QYP A;  1KDH A;  3C28 A;  1NK8 A;  1S5L U;  3B0Y A;  3UXN A;  2KIV A;  1N2X A;  3MFI A;  3H0M B;  4O3O A;  1SGG A;  4AP9 A;  4Y2T A;  1VDV A;  3BQ7 A;  3N7S C;  4O3M A;  2KFN A;  2I1Q A;  4BJQ A;  2YB4 A;  9ICM A;  1SIJ A;  4UB6 U;  4Q44 A;  1SKS A;  7ICI A;  1FO4 A;  3MGV A;  1JN3 A;  5KT2 A;  3QZ7 A;  2PMZ C;  1BPX A;  2E1E A;  2W55 A;  2ZJ8 A;  3C1Z A;  5DBA A;  3QU7 A;  3L5K A;  4XRH A;  4KLU A;  3BQ2 A;  1COO A;  1QLN A;  2O6K A;  4NV0 A;  5ALH A;  3MBY A;  2K4P A;  4E0D A;  3RR8 A;  4CF4 A;  4QW8 A;  3IDW A;  3MDA A;  3ONN A;  2YX8 A;  1KBU A;  3QX7 A;  4UW9 A;  4G9B A;  5F9N A;  2ASJ A;  3GZF A;  1SXD A;  4ED7 A;  3V6K A;  1ZQB A;  5CEH A;  4F71 A;  4EX6 A;  5J0O A;  4QZE A;  4F5O A;  2QKQ A;  2XVT A;  3SAF A;  2HHT A;  2K4E A;  4NLZ A;  4DOC A;  2DWQ A;  1Z4N A;  4QWD A;  7ICO A;  5TZV A;  1XC9 A;  1ZQE A;  4J9S A;  4DSK A;  5AKG A;  2EDU A;  4YR3 A;  4YN4 A;  5KG3 A;  4DOA A;  2PI5 A;  3C29 A;  3ALR A;  2ZXH A;  4KLF A;  2KE7 A;  4EYI B;  2J6T A;  4K4H A;  4BXO A;  3RH4 A;  2WAQ F;  4FFD A;  3ED5 A;  4QZG A;  2FJ6 A;  2JH1 A;  4F3O A;  2OHF A;  3NVZ A;  1ZQA A;  2KMD A;  4GFJ A;  3KHG A;  4M6W B;  5KFD A;  2HCF A;  7ICF A;  1COK A;  5L1M A;  2ZIU A;  1MC8 A;  1NK9 A;  1F0M A;  4DSE A;  4BWJ A;  3HIL A;  5ALY A;  1TFR A;  1TK8 A;  4KLQ A;  4ED0 A;  2MRL A;  2KZM A;  4F5R A;  1ARO P;  4M9N A;  3GV5 B;  3T5J A;  4J9Q A;  2G08 A;  5DBB A;  2C2E A;  2EZY A;  2W8K A;  2HBK A;  1YZ6 A;  3QU2 A;  4P0Q A;  2C22 A;  3H8M A;  3PZP A;  1Q8K A;  8ICN A;  1IIP A;  1SL1 A;  2HMX A;  1S0O A;  1Z00 A;  5KFQ A;  8ICY A;  4PHA A;  3QUQ A;  5EWF A;  1ZD5 A;  4MF8 A;  2WTF A;  2GO7 A;  2XIC A;  2W9B A;  2KHV A;  2BPF A;  2RRD A;  1P7D A;  1L3V A;  1T94 A;  1VJ5 A;  9ICI A;  3OSP A;  8ICT A;  4I2B A;  4QZ8 A;  1XO1 A;  1V97 A;  3WKC A;  3GIM A;  4BWM A;  4B9N A;  4US8 A;  1KLN A;  1HEK A;  1ZD3 A;  4ECS A;  2AHO B;  3V7J A;  3LVW A;  4EZ6 A;  4FS1 A;  3GDX A;  1NZB A;  3GV8 B;  5CB1 A;  3GU3 A;  3K4G A;  2AH5 A;  3C5F A;  5ALP A;  4IQT A;  3F2B A;  3BQT A;  1NI3 A;  4USA A;  4KLE A;  5AIA A;  5AK6 A;  2AXT U;  4QWC A;  1O08 A;  2YMP A;  1QH9 A;  1Z4O A;  1SL2 A;  2HBM A;  4PH5 A;  4F8R A;  5J2K A;  4PPX A;  3PX0 A;  1TAQ A;  4ED6 A;  5EE9 A;  2YMM A;  1RZT A;  4QW9 A;  3D2N A;  1IM4 A;  5AI5 A;  3WK4 A;  3C2K A;  4Z6D A;  5KFR A;  2P66 A;  4OD0 A;  3UQ0 A;  4YG2 A;  4Y2Y A;  4JV0 A;  2RP5 A;  2JEJ A;  2JMG A;  5J0S A;  2F77 X;  4MEX A;  1IG6 A;  3HX0 A;  5CRX A;  3RFA A;  4BUG A;  5KFN A;  4DO9 A;  5ALL A;  4Q45 A;  2K89 A;  4B9M A;  3RB3 A;  2KP7 A;  2DPJ A;  4NWI A;  2ZIW B;  2DKZ A;  3CRX A;  1S10 A;  4I2G A;  5DGA A;  1U9L A;  2BCU A;  2KEY A;  2PXI A;  4P4M A;  2F1I A;  5KT3 A;  3EYZ A;  3OTQ A;  2JEG A;  4NLK A;  5KFM A;  1L3U A;  1MQ2 A;  4ELV A;  3F2D A;  4M2Y A;  9ICP A;  4NLC A;  4YQW A;  4K4G A;  3QEB Z;  3HWT A;  1KSP A;  1SWW A;  5KFP A;  1XSP A;  2HSZ A;  2GWS A;  2JZB A;  2ZIV A;  2XGQ A;  5G5G A;  2AGP A;  3M8R A;  3KKA A;  3MDC A;  4ED3 A;  1ZD4 A;  5B66 U;  3MFH A;  4DL3 A;  2EAP A;  5L1L A;  5FP0 A;  2FLP A;  7ICV A;  5DGB A;  1NK4 A;  3TI0 A;  4YMO A;  1B0X A;  8ICX A;  7ICL A;  2H3F A;  2PFN A;  1DK3 A;  5KFJ A;  2I5H A;  2VKQ A;  5HP4 A;  4R8U A;  1KL9 A;  4EEN A;  3CW2 C;  4RZR A;  4GXK A;  4I2H A;  8ICZ A;  5EE1 A;  3I1Y A;  2G0A A;  4C8N A;  2KKP A;  2P35 A;  1K5O A;  4RQ5 A;  4YR2 A;  2F8L A;  1RQN A;  4F72 A;  4ECZ A;  2FMS A;  3IM1 A;  3PSI A;  3UXP A;  1RQL A;  2F44 A;  4KLM A;  2YY6 A;  5ALE A;  5BOM A;  3BDP A;  2NRV A;  5KT4 A;  1L7N A;  2F8K A;  2NRX A;  3T3F A;  2KK0 A;  2W9A A;  5EOZ A;  1KQQ A;  3RR7 A;  3ZD9 A;  1NJW A;  2KIC A;  1OXJ A;  1UT8 A;  4F91 B;  2BGW A;  4KN7 A;  5KG7 A;  3ISB A;  1A77 A;  8ICQ A;  3T79 A;  3IN5 A;  3DEE A;  3QNM A;  5KFF A;  2XI9 A;  4P4P A;  4Q8F A;  1X9S A;  5HR7 A;  3ISC A;  3F53 A;  4UAR A;  9ICH A;  5DG7 A;  3WKA A;  4IL6 U;  3OPX A;  1KTQ A;  5EE3 A;  2BQ3 A;  2IHN A;  5KT7 A;  3CP8 A;  3SQI A;  3PO4 A;  1WWU A;  2ESE A;  3PO5 A;  2BHN A;  4UB8 U;  4ED1 A;  2KG5 A;  2KJ9 A;  3RJG A;  4RQM A;  5IIN A;  2ZJA A;  4GC7 A;  1UHU A;  4PGX A;  1J2M A;  4QIW F;  2HHW A;  3SEI A;  4QZD A;  1J2N A;  4ECX A;  5JTI A;  1L8O A;  1N56 A;  2K8A A;  2XID A;  1DGJ A;  2PFQ A;  5CJ7 A;  3RAQ A;  2Q4T A;  4O0I A;  2KSO B;  2HBJ A;  1ZQD A;  1XU4 A;  2KV2 A;  4QWA A;  4JV1 A;  4IQV A;  4KLG A;  1WWV A;  2MAX A;  3H40 A;  2DUY A;  5ALI A;  1HUO A;  3EZ5 A;  3T5H A;  4NXZ A;  5J2F A;  5AKX A;  2HHV A;  3H8S A;  5KFK A;  4QZH A;  2RDJ A;  4KTQ A;  5KFI A;  3NAS A;  3TAR A;  1ZQF A;  3F5A A;  1OUQ A;  4MFF A;  4AYB F;  3ETR A;  1L5U A;  2A1A A;  5J8Y C;  3NRW A;  1ZJM A;  4C8K A;  3H0R B;  5J0R A;  2KN7 A;  1X9M A;  4YCX A;  3MR3 A;  1ZQR A;  5AKE A;  4KIT B;  3QU5 A;  4RQ6 A;  2C2R A;  2NV3 A;  4TUQ A;  4RQN A;  2W8L A;  4YFK A;  4CGZ A;  1C7Y A;  3KBB A;  5EE0 A;  4B9S A;  3AEV A;  1ZQP A;  3WK9 A;  1MA7 A;  2FLN A;  1FFU A;  2MUT B;  3M6Z A;  3IG8 A;  3PSP A;  4FO6 A;  2YN4 A;  4UQG A;  3PV8 A;  4P0P A;  5AM4 A;  3U26 A;  4XUS A;  4ECR A;  3N7P D;  3F5E A;  1A76 A;  1BPD A;  2ZTC A;  7ICR A;  3HW8 A;  2F2A B;  2ALZ A;  3AU6 A;  3KFU F;  1XWL A;  2D6F C;  5C0Y A;  2J6U A;  5ALU A;  8ICC A;  4PL2 A;  2PFO A;  8ICV A;  2VA3 A;  2I6X A;  3H8W A;  1V9P A;  2P6R A;  2DFL A;  3L3F X;  1K1Q A;  4OJO A;  2A1J B;  4J9N A;  2ZTE A;  1CI4 A;  2JHD A;  3LWM A;  1T3Q A;  4KX3 A;  3NVW A;  4DL7 A;  3M9M B;  1HJP A;  4DL5 A;  2Y1I A;  2AGO A;  2R8J A;  1ZXI A;  3G6V A;  1T8E A;  4CNQ A;  1HIW A;  4O5K A;  5KT5 A;  3OHB A;  3AQE A;  1U48 A;  3IG5 A;  1LKY B;  3H4B A;  7ICU A;  1CEZ A;  3BS5 A;  3D6J A;  3FC4 A;  4MHV A;  4WJ3 B;  4O3Q A;  5J2I A;  4EEY A;  5D49 A;  1V38 A;  4EEL A;  5D46 A;  4RPZ A;  3IRU A;  2XY7 A;  3N28 A;  4EX7 A;  3K1Z A;  4DQI A;  4KLI A;  3JPR A;  1QQ5 A;  2EZX A;  4DS4 A;  2XY6 A;  4DCC A;  1ZQV A;  2NRT A;  3RJH A;  1TKD A;  5JRT A;  1UA0 A;  5AI9 A;  2NYV A;  4KLO A;  9ICB A;  4PJ0 U;  4DQR A;  5KL8 B;  4P2H A;  2AU0 A;  4US9 A;  2WFA A;  1NK5 A;  2BCQ A;  3PW7 A;  4YMN A;  1NK6 A;  9ICA A;  3MR6 A;  5E79 U;  1SKW A;  2QAR A;  3WKE A;  1JX4 A;  4F4X A;  3RRH A;  1PK3 A;  5ALW A;  5KT6 A;  4UB5 A;  1DK2 A;  2LYH A;  2K60 A;  1NOM A;  4M6W A;  2BKE A;  3KOO A;  2G06 A;  2H3I A;  2E8N A;  5KG1 A;  5HMM A;  2A19 A;  5J0Y A;  9ICO A;  1SXE A;  3H8J A;  5KFV A;  2LM4 A;  2IMW P;  1V85 A;  3T5K A;  2UVW A;  4CE6 A;  4YVZ A;  2W54 A;  9ICC A;  4EYH B;  2UVR A;  4K4I A;  8ICU A;  1B22 A;  2H3V A;  3RBE A;  4O5E A;  1X40 A;  1D8L A;  2HBL A;  1ZQX A;  2LYB A;  2JRZ A;  5DB8 A;  5TIS U;  2DBY A;  5C5J A;  4DFP A;  4C7Y A;  1XSL A;  5AKI A;  2KHQ A;  4NL9 A;  1JXL A;  1ZRN A;  1N61 A;  4JUZ A;  4RPY A;  2BDU A;  2PFP A;  4ECU A;  2HVI A;  2JR5 A;  4RPX A;  7ICG A;  3TAQ A;  2W9C A;  3SI8 A;  1NK7 A;  5KG5 A;  3SAG A;  3G6X A;  4F2R A;  2E8M A;  4ICA A;  1PVQ A;  2K8C B;  3B9J A;  2ODG A;  5HHH A;  1KKX A;  2KZ3 A;  4UBC A;  2R8H A;  4RU9 A;  5KG2 A;  5KFX A;  1ZQT A;  1RG6 A;  4PZN A;  5III A;  1BPY A;  2NRW A;  1KW4 A;  2WF6 A;  4Y2Q A;  4TUP A;  5ALV A;  2LI6 A;  4F5Q A;  3TAD A;  1N63 A;  1ZQI A;  3PMN A;  1N48 A;  2GLE A;  3JPO A;  3AUO A;  3QEA Z;  4KX5 A;  4EBC A;  3D2Q A;  3I76 A;  4GC6 A;  9ICG A;  1SV4 A;  2CPR A;  2Y0S F;  4BXO B;  2JGA A;  4C4R A;  9ICE A;  4CCH A;  5J2H A;  2CN1 A;  2LMR A;  1NK0 A;  1A6S A;  1NKC A;  2FLL A;  4TQS A;  1PVP A;  1S0N A;  5KG6 A;  1QQ6 A;  3WK7 A;  5DLG A;  1JMS A;  5DB9 A;  5ALK A;  2HHX A;  4IQU A;  1YZ7 A;  5EWG A;  1ZQH A;  1N5X A;  5AKZ A;  1X2I A;  1NJY A;  1K1S A;  4J9K A;  1NKB A;  4B9U A;  3GIL A;  2AGQ A;  4Q43 A;  3NUQ A;  2WF5 A;  4DLG A;  3RJF A;  2VA2 A;  3N7R C;  5L1K A;  4MFA A;  2XO7 A;  4F93 B;  1FEZ A;  1U45 A;  4I2E A;  1ZJN A;  3RRG A;  1BGX T;  4UB1 A;  3PW5 A;  5DQH A;  4KLS A;  4XQ8 A;  3EWA A;  3PVX A;  4UB4 A;  3LK9 A;  4M9L A;  2KZZ A;  2ZTD A;  4U7C A;  1Q3U A;  3IV6 A;  1WCN A;  2LBO A;  3WK8 A;  4P0Q B;  4DFJ A;  2RLT A;  1U49 A;  1MSW D;  1TAU A;  1QSL A;  5J29 A;  4Q8E A;  4Y2U A;  4I2D A;  2W04 A;  2FDR A;  4DSI A;  7ICE A;  5KTQ A;  5IIM A;  1QTM A;  3L4P A;  3AMZ A;  2W9B B;  1D8Y A;  4KLH A;  1T4G A;  1TE2 A;  3JPN A;  4C4T A;  1KFT A;  4LZD A;  4Z6F A;  4IQW A;  1PZN A;  8ICW A;  4IC9 A;  2VA8 A;  3AU2 A;  3RB0 A;  4RT2 A;  3ZI4 A;  1UPH A;  2KD1 A;  1KEJ A;  2RDI A;  4I28 A;  3GII A;  4B9T A;  5J2J A;  9ICS A;  2OH2 A;  5J0T A;  2KJ8 A;  8ICB A;  2ZXI A;  4F4Z A;  4KLJ A;  4HYK A;  2E8P A;  2NO5 A;  5KFG A;  9ICW A;  2AQ4 A;  5KFL A;  4UB3 A;  5BOL A;  1ZET A;  5ALJ A;  4ELT A;  3JPS A;  4UAZ A;  4Y2R A;  1XS9 D;  2QB0 A;  3V6J A;  8ICR A;  1NJZ A;  3E58 A;  4UAU A;  3KKA C;  5DQG A;  2GOL A;  5AKH A;  3C23 A;  1TV9 A;  3SAH A;  4FE3 A;  4M9H A;  4M9G A;  4DQQ A;  4M47 A;  1ZQJ A;  3HKZ C;  5ALF A;  3GV7 B;  4IRC A;  4DL4 A;  4J9M A;  3RB4 A;  8ICO A;  3NVY A;  2L5Y A;  4OJ5 A;  3PST A;  2ATL A;  4ECQ A;  2HDO A;  4KMU A;  3M6K A;  4F4K A;  1PUZ A;  5J0Q A;  4OJ6 A;  3BZC A;  2IBK A;  3PW0 A;  2ZG6 A;  4C80 A;  4RQ7 A;  5B5E U;  2WB1 C;  9ICQ A;  2G07 A;  1ZQM A;  2W7P A;  1TK0 A;  2BCS A;  2QB1 A;  1ZYQ A;  2NRZ A;  4ECT A;  7ICT A;  5ALR A;  3DDH A;  2ZJ5 A;  3OJU A;  2EH9 A;  3QUB A;  1WUD A;  4JK1 A;  4J9P A;  1S0V A;  2B21 A;  5CR0 A;  3OHA A;  9ICJ A;  4PGY A;  4UAT A;  5KFU A;  5K4L A;  4F4Y A;  2DKX A;  1RXW A;  2FPL A;  1L7O A;  3KD3 A;  1X9W A;  3ZDD A;  3TAN A;  2R8I A;  1BNP A;  1SZH A;  4F4W A;  1JXE A;  3PW2 A;  4ZOH C;  4RNN A;  2KSO A;  1N60 A;  4GXI A;  4Y2X A;  5DDY A;  3FDS A;  2GH1 A;  5KFY A;  4R63 A;  4TUR A;  1RPL A;  3MR5 A;  3Q8K A;  1URJ A;  2KVC A;  4I27 A;  3OJS A;  3HPO A;  1NZP A;  4CF5 A;  5AKK A;  1MN8 A;  4OJP A;  2OEH A;  1BVS A;  3MAB A;  4NLN A;  1PK1 A;  5ALM A;  2E5S A;  2P6U A;  4OCZ A;  8ICP A;  8ICM A;  1S0M A;  1DOQ A;  3AQF A;  2HVH A;  3IHQ B;  2E3T A;  5KG0 A;  3UM9 A;  1ZQK A;  2BQR A;  4GLX A;  3CNH A;  5CP2 A;  2KOB A;  5J2A A;  4ECY A;  1IV8 A;  4CDG A;  2W7O A;  2M0N A;  3SV3 A;  2CRX A;  1U4B A;  4ED8 A;  4I29 A;  3TQ1 A;  1D9F A;  5HML A;  1KFS A;  5KFH A;  3H0L B;  5G5H A;  4M9J A;  2MUT A;  3BS7 A;  1M6Y A;  4DF8 A;  4LJX A;  2YB1 A;  2NO4 A;  2ASL A;  3NS1 A;  1HUZ A;  2FMQ A;  5L1J A;  2ZIX A;  2EAO A;  1JRP A;  5AHX A;  4RQ8 A;  4J9O A;  4J9R A;  1DRG A;  2WHE A;  2RHF A;  1BPE A;  3O0F A;  5AI6 A;  5J2B A;  4JWN A;  4EBE A;  3VCB A;  3UPQ A;  3C2M A;  5L9X A;  3RH5 A;  5KL1 B;  3LYS A;  2KFZ A;  4KLL A;  4RQ0 A;  4UAV A;  5KAF U;  3R9K A;  2WF8 A;  2A1J A;  2XCA A;  1FFV A;  4YXJ A;  4QZB A;  4O9M A;  4DWI A;  1SWV A;  5AM0 A;  2DF4 B;  5DBC A;  4TQR A;  3B0X A;  3ETL A;  4DOB A;  4HAI A;  1RDF A;  3Q8R B;  4DS5 A;  2FE9 A;  2BCR A;  4DFM A;  4TUS A;  3THV A;  2DPI A;  1LKY A;  7ICK A;  3OSN A;  2H3Z A;  1T3N A;  1SV0 A;  1A0P A;  2VAN A;  5J2G A;  4AYB C;  4JV2 A;  4JWM A;  3D2S A;  3RB6 A;  1N5W A;  4Z6E A;  1DGS A;  2DGZ A;  1NKE A;  9ICX A;  1Z3E B;  4PGQ A;  2KNJ A;  4GXJ A;  1LVH A;  1L3S A;  4IS7 A;  2W11 A;  2E1F A;  2BDP A;  3ZDA A;  4B6J A;  2KTQ A;  9ICL A;  1FIQ A;  1UCV A;  3SEN A;  4KN4 A;  5KFA A;  8ICJ A;  3N97 B;  4M0A A;  1UQV A;  3ORY A;  2HOQ A;  2PMZ F;  1UT5 A;  4IRK A;  5ALG A;  3Q8Q B;  4FZM A;  2HHS A;  5T14 A;  3ZDC A;  5J2E A;  4P0P B;  1JUD A;  7ICQ A;  1Z1V A;  2JEF A;  2V9W A;  4C0Z A;  2QLT A;  4FBT A;  1LB2 B;  5ALX A;  3WK6 A;  3EPI A;  4P4O A;  2F1J A;  2F76 X;  4NLG A;  4M04 A;  4O3S A;  3ZDB A;  4RQ4 A;  3TFS A;  3AM9 A;  3T5L A;  4IR1 A;  3RH6 A;  2JXJ A;  3GIK A;  1L6N A;  4Y2J A;  4MFC A;  3WKD A;  1Y88 A;  7ICJ A;  4F2S A;  2R18 A;  3RJK A;  4BDP A;  3EPG A;  8ICI A;  4YD1 A;  1XSN A;  3GIJ A;  3BS5 B;  4DLE A;  4DL2 A;  2FMP A;  2ES6 A;  4F50 A;  1ZQW A;  4RQ1 A;  2YQE A;  1UA1 A;  1ZQQ A;  2HW3 A;  1CUK A;  4RUA A;  9ICR A;  2PKE A;  4I2J A;  4C8O A;  5IIJ A;  4NL9 C;  3Q8S B;  4MF2 A;  3OGU A;  1B4F A;  4UB2 A;  4I2F A;  5J2D A;  2G09 A;  9ICF A;  5A0L A;  3QU4 A;  5ALQ A;  3RAX A;  1GO3 F;  1S8O A;  5AK4 A;  3SV4 A;  5GTH U;  1QQ7 A;  3BJY A;  2KKV A;  5DG9 A;  1TK5 A;  4Z6C A;  2VJ4 A;  2YML A;  4PHD A;  5J0U A;  4QNL A;  2HOI A;  2FI1 A;  1JRO A;  3NVV A;  4Y2P A;  2JH7 A;  2C2D A;  2QAR B;  4DEZ A;  4EEK A;  3JPP A;  2Y9T A;  3H4D A;  1ZQS A;  2E8O A;  3TAD C;  2ASD A;  5HR6 A;  4QZF A;  3A0H U;  3WKB A;  2DL0 A;  2W43 A;  3PW4 A;  5JU5 A;  4FBU A;  5AKY A;  5ALS A;  3UMC A;  2W3R A;  3RJE A;  3LWL A;  3C2L A;  4YR0 A;  4RQ3 A;  5J2C A;  3WK5 A;  3HRD D;  5AI8 A;  3SZ2 A;  2WAQ C;  5KNI A;  2LYA A;  2JV3 A;  4F92 B;  5ALT A;  4JMU A;  5AKL A;  4NM2 A;  3GFK B;  1X6I A;  9ICN A;  1J97 A;  4UBB A;  2IOH A;  3ICX A;  1Z19 A;  3PML A;  4RNM A;  1X42 A;  4DFK A;  2IA6 A;  4U6P A;  2V4R A;  1O03 A;  2ZIU B;  5KFS A;  5ALN A;  2HHQ A;  3J81 j;  1SL0 A;  3LDA A;  1VLB A;  4LVS A;  3QUT A;  4RQ2 A;  4PL1 A;  4QZ9 A;  4PHE A;  2W9C B;  2OCE A;  1ZD2 P;  3IP4 B;  1TVA A;  4YP3 A;  4ACO A;  3UQ2 A;  3A0B U;  1XO0 A;  2UVU A;  5DKW A;  2W9M A;  2Y9U A;  4CRX A;  4I2A A;  5HHI A;  4YD2 A;  1S77 D;  2N1R A;  5KFC A;  3G6Y A;  1AQ6 A;  1JAL A;  3KTQ A;  2IOF K;  1X9X A;  1JIH A;  4IRD A;  2Y0S C;  1YT3 A;  5AM3 A;  5ALD A;  4O5C A;  2WF7 A;  5IIK A;  4RUC A;  3UXO A;  3PY8 A;  9ICU A;  4O3N A;  1Z00 B;  4Y2V A;  2ZIW A;  3KHR A;  2K4H A;  3MC1 A;  4F5P A;  2MSN A;  4CF3 A;  3HT3 A;  3Q8M A;  3E2E A;  4UAW A;  3SD7 A;  4EBD A;  5DLF A;  3JPT A;  1ZRM A;  1PVR A;  5F3X B;  2I9G A;  3QU9 A;  2MA1 A;  5AK3 A;  3F2C A;  5KAI U;  3V72 A;  4KMO B;  8ICL A;  1KFD A;  2WF9 A;  1IXR A;  5AIC A;  2HHU A;  2W3S A;  1NJX A;  1F5S A;  3I28 A;  4I2I A;  4DFD A;  5GTI U;  3PX4 A;  7ICP A;  5AK5 A;  3M1Y A;  5AI4 A;  3HKZ F;  3TFR A;  4FS2 A;  4QZI A;  4LZG A;  2K8B B;  2BZF A;  1WYG A;  3FAH A;  3TAP A;  2UVV A;  3TAC B;  2CXY A;  8ICS A;  4J03 A;  2KJ5 A;  2LHT A;  3QUC A;  2MU2 A;  5AIB A;  5KFB A;  5KFE A;  7ICN A;  4NY8 A;  3RBD A;  1QSY A;  4RT3 A;  1RYS A;  4DF4 A;  1Q46 A;  1BPB A;  5H2F U;  2XGP A;  4DSF A;  1SKR A;  2KIW A;  3C21 A;  2WB1 F;  4QWE A;  4B9V A;  3AL0 B;  1ZQG A;  5AM5 A;  1QSS A;  4BX9 C;  2R8K A;  1SZP A;  1MQ3 A;  3FYH A;  1OW5 A;  2XC9 A;  4R65 A;  4QZA A;  2EQY A;  2BCV A;  2JEI A;  4C7Z A;  2G5I B;  4YXM A;  3MGH A;  3SR6 A;  3GQC A;  2C28 A;  4DL6 A;  1Z1B A;  3Q8L A;  2DQN B;  4ELU A;  2J6S A;  2H3Q A;  3KHH A;  3HJE A;  1RXV A;  3WU2 U;  3RJI A;  1ZQZ A;  2QB0 B;  3PR4 A;  4C8M A;  5KFZ A;  2YMQ A;  4KLT A;  8ICE A;  1H38 A;  1KRP A;  3PNC A;  4IR9 A;  4NLB A;  2EAN A;  4X5V A;  2RQ5 A;  4NM1 A;  5AM1 A;  4DSJ A;  5KFO A;  8ICF A;  4ED2 A;  2F1H A;  4ZH4 A;  3KZI U;  1S76 D;  2Q0Z X;  5KG4 A;  2JZB B;  2ZIV B;  1F44 A;  9ICK A;  4NJ8 A;  5EWE A;  4RNO A;  1KN5 A;  3NRZ A;  2AJQ A;  4DSL A;  3NGD A;  4J9L A;  3V7L A;  3PX6 A;  5AM2 A;  2A3V A;  2F3N A;  1ZQC A;  4R64 A;  1X66 A;  2B0C A;  3K1R B;  4FZN A;  4R8U B;  1T7P A;  2W03 A;  3TKA A;  7ICS A;  1S97 A;  4A8E A;  4YMM A;  9ICT A;  3KHL A;  1L7P A;  5DB7 A;  8ICK A;  2OYY A;  2D8C A;  1ZQU A;  2V4Q A;  1N62 A;  2EZZ A;  1L7M A;  5F9L A;  2BPC A;  3ZD8 A;  3ZDE A;  1LV5 A;  1B43 A;  2EAM A;  9ICV A;  5D4B A;  3RTV A;  2BPG A;  1CRX A;  2PI4 A;  4MEY A;  5IIO A;  3SYZ A;  1WCL A;  3UMB A;  4DQP A;  3C1Y A;  2LPE A;  1RM6 C;  3PSF A;  5J0P A;  4R66 A;  5IIL A;  3V6H A;  4O3P A;  5CHG A;  2OM6 A;  4ECW A;  5CA7 A;  5DB6 A;  2K4I A;  5BPC A;  5L1I A;  1L8L A;  3CYM A;  4DQS A;  3E0F A;  1XNS A;  2IHM A;  3BQ1 A;  7ICH A; 
#chains in the Genus database with same CATH homology
 2O6K A;  2KVS A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...