2O6KA

Crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
YSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0346 protein MW1311
publication title Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218.
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 24
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2o6kA00
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH superfamily
3M9OB 8ICFA 2W3SA 2LPEA 4DSKA 2L5YA 4I2JA 2ZIWB 4CNQA 4EZ6A 9ICPA 1B43A 5KL1B 5J0UA 4F93B 5HHIA 3HPOA 4C4SA 2R8HA 5KT2A 1ZQTA 2E8PA 3EZ5A 5CA7A 3MC1A 5KFXA 5ALKA 3F53A 1JMSA 3SI8A 1A76A 5C0YA 4C0ZA 4DSEA 3ZD8A 4UB3A 5BPCA 1KFDA 2RQ5A 5AI9A 1JALA 2YTUA 2HHVA 3HILA 1JI7A 2KSOB 2ZG6A 4DOCA 5KFHA 4ZOHC 3BZKA 4J9OA 2V4QA 1FO4A 2ASJA 4UB4A 3MR2A 3Q8RB 1RYSA 2JZBA 3HRDD 5F3XB 2JEFA 4J9SA 3V7JA 2W8LA 5TZVA 1X2IA 1XNSA 1KN5A 4O3OA 1RDFA 3GIJA 2HSZA 3IG8A 5ALNA 1UHUA 4I2AA 2HOQA 1RQLA 1D9FA 5K4LA 5ALJA 4DQQA 3EUB2 2PFQA 9ICIA 2VA3A 9ICQA 5ALUA 1X40A 4ELVA 1NI3A 2XY7A 4I2DA 2KEYA 2Z7JA 4UB8U 3AM9A 2LM1A 4WJ3B 3IG5A 9ICXA 3BQ7A 3RRGA 2NRTA 3MR6A 5KG6A 1NKCA 2JEGA 3GILA 1U45A 2QKQA 8ICZA 4RQMA 3WK6A 3PO4A 2KK0A 3RFAA 2LMRA 5KT4A 1N48A 2IOFA 2ZIWA 1DXSA 5EWGA 5AI5A 5DBCA 4NV0A 4YR3A 4Y2PA 1B22A 1SXEA 1OUQA 1N2XA 3T5JA 1BPXA 5KFYA 1BPDA 3BS5B 1ZQHA 7ICTA 5EE3A 5H2FU 1L7NA 2EH9A 4DLGA 1L5UA 1PZNA 1SL1A 4QIWF 4DCCA 1X9MA 3CRXA 1TK0A 2Q0ZX 1ZD2P 3PMNA 4FBTA 1XSNA 3ZDCA 4C4RA 2KSOA 2K8BB 5ALYA 2CPRA 3EWAA 2HHQA 1BPBA 3RBDA 3F2BA 7ICNA 1ZQAA 1MA7A 2E8MA 4C8MA 4P2HA 1UA0A 2HMXA 2K8AA 3NRZA 3QUQA 3K4GA 3PVXA 2NV3A 2Y9UA 4XQ8A 2W54A 1Z3EB 3I1YA 3BJYA 2BGWA 2HVHA 4NWIA 2G0AA 2F76X 1KKXA 2FMQA 4M9JA 2R8GA 4RQ8A 3UMCA 8ICXA 3M8SA 4KMUA 3BQ0A 4PJ0U 2BHNA 1NK8A 2HDOA 3IRUA 4FZNA 4O3PA 5J2DA 7ICGA 5KG2A 5IIJA 5L1LA 3PZPA 3KTQA 3QUCA 5HHHA 1YZ7A 2BPCA 2W9BB 1X9WA 1S77D 2NRVA 3L5KA 4EBEA 4I2HA 2R8IA 4YFKA 3MFIA 4RQ4A 5KFPA 1U49A 3KBBA 4US8A 4ECXA 4K4GA 2XICA 4UAVA 3RR7A 3ZDBA 1ZQUA 1VJ5A 2R8KA 1B4FA 4QZDA 4ED3A 3BS5A 2OXOA 5CJ7A 4QNLA 3S6JA 4NL9C 8ICMA 2VIXA 3PX6A 2YMMA 4P4OA 1ZQPA 3JPPA 4RQNA 3RJIA 4CRXA 1CUKA 2JR5A 5J2GA 3HX0A 4ECVA 2FLNA 4USAA 4RQ1A 2A1AA 3PW5A 1BNPA 9ICWA 3H4BA 2NYVA 3RBEA 4QW9A 3SAHA 4KLJA 3ALRA 4DSLA 1ZQNA 4F4WA 4DL2A 4YR2A 4C8LA 2XY5A 5AM0A 4F5RA 3JPNA 3E0FA 4O5KA 4EX7A 4IQWA 1ZQSA 3TADA 5AKJA 1N5XA 4MEXA 3RJEA 3D2SA 2P66A 3U26A 4PZOA 4DF8A 2E5SA 5IILA 5ALOA 1Q46A 2HBLA 3WK7A 1DRGA 2EQYA 2KG5A 4KLSA 4DQPA 2W9BA 1S76D 5KFCA 4J9MA 1V85A 3T5KA 3NRWA 5AM2A 4QZGA 4MFFA 3RB0A 4QIWC 1QSYA 2HVIA 1SV4A 4O5EA 1N63A 2MRLA 8ICQA 3ISCA 5G5GA 2WF9A 3PNCA 3WKAA 7ICPA 2IOHA 4KTQA 3ZI4A 5KT7A 4F5OA 4Z6FA 8ICNA 1JX4A 5TISU 4JK1A 4F5PA 1UT5A 3MFHA 5B66U 3UQ0A 5HR7A 4RQ7A 2FMPA 1TKDA 4KX5A 4K4HA 1AQ6A 9ICJA 4FS2A 4DEZA 5DG9A 4ECZA 2ASLA 5KFQA 1ZQRA 1BVSA 5AKXA 9ICRA 9ICGA 2RRDA 2WAQF 5J8YC 5EE1A 2XCAA 1Z1VA 2YX8A 3IV6A 3IHQB 4OCZA 1MQ2A 8ICGA 1XU4A 3LVWA 5HMMA 4I2IA 4PL2A 5KG7A 4BGDA 5DKWA 3EYZA 3OSPA 4DL3A 2HHXA 1UT8A 4TQSA 3HWTA 2D6FC 3NVVA 2KMDA 4KITB 3C28A 2YMLA 4DS5A 3NVZA 3ZDEA 4MFCA 2AQ4A 4NLNA 3QU2A 2F3NA 3H7IA 3RJGA 4DL6A 3BS7A 7ICJA 2HI0A 3AQEA 2CN1A 1JRPA 1L3UA 4OO1J 4B9SA 4F92B 1Z1BA 5HP4A 1XWLA 2E1FA 5AK4A 2KOBA 2H3QA 1RXVA 1J2MA 4C7ZA 4X5VA 1ZYQA 5J2KA 3G6VA 2ATLA 2PFOA 1ZQIA 2Q4TA 2B21A 4YMNA 1N61A 3VC8A 2IHMA 2H3FA 2ZXHA 3KOOA 3GV5B 4DS4A 1T3NA 4U7CA 4FS1A 4M9LA 2ZIVB 4Y2SA 2FPMA 2NO5A 2BQ3A 1IXRA 9ICAA 2KHVA 2XI9A 3HP6A 4ED8A 4FZLA 9ICLA 5J2EA 2PFNA 3IP4B 1L8OA 3GV8B 4DSJA 4Q45A 4BDPA 2KHQA 3RF9A 5KFWA 1PVQA 4KLUA 1KW4A 3C2KA 1SGGA 3DV9A 2FPKA 2KNJA 2LHTA 4B9UA 3JPTA 3LK9A 2G5HB 5ALSA 1ZQJA 1OXJA 3I76A 2P35A 4I2GA 5ALEA 3R9KA 1COKA 4YVZA 3N7PD 3L4PA 1GO3F 2KP7A 3K1RB 1KSPA 4KLHA 3QEAZ 1ZQWA 3C1YA 2ZJ8A 1HJPA 1ZETA 4J9QA 3KHRA 2KZMA 1T4GA 2WF7A 4BWMA 5J2CA 7ICEA 2G5IB 3ETLA 2B0CA 1P7DA 3QUTA 2K4EA 2Y9TA 3SQIA 4RQ3A 2N1RA 3JPOA 1F0MA 4RQ6A 5KG1A 5AKKA 3LWLA 1ZQXA 4CF5A 1A0PA 2WAQC 2XO7A 1QQ6A 1SV0C 2JMGA 5JRTA 2C2DA 3M1YA 2ZIVA 1S8OA 8ICUA 4BXOB 1S9FA 1YT3A 3WK8A 4RPYA 1TAQA 4M2YA 4C8NA 2A3VA 3PY8A 2BCUA 9ICEA 2NRWA 5KAIU 2ODGA 1BGXT 1TK8A 4BWJA 2HBJA 3Q8QB 3RB3A 2O6KA 2KIWA 2WTFA 3Q8MA 1VDVA 1NK4A 2BPFA 4KX3A 5DG7A 1QLNA 1Z00B 5JUMA 4EELA 1DGSA 3GU3A 4Y2TA 7ICVA 4EYHB 1HEKA 3CW2C 4MFAA 1UQVA 1ZQDA 5ALGA 2P6UA 5J29A 1SL0A 5J0QA 4R8UB 2ZIUB 3PW0A 4Q8FA 4I2BA 1K1SA 2OCEA 4IC9A 3CYMA 5KT3A 2HBMA 1ZD3A 3SR6A 2KFNA 2AU0A 3M6ZA 4F4KA 3FAHA 2QB0B 3UXPA 4GC7A 4JV1A 1NJYA 4MEYA 4RPZA 3TADC 5KFUA 4RU9A 4ECWA 2PMZF 3H8MA 3FC4A 7ICFA 3ETRA 4AYBF 4LVSA 4O3MA 3HW8A 1KDHA 4DLEA 4ED1A 4I29A 5J2AA 3PSIA 1KTQA 3QNMA 1V97A 4JMUA 3AU6A 1MSWD 4O3SA 1D8BA 1NJXA 1T94A 1FFVA 4BXOA 3H40A 4Y2YA 4TUPA 2VKQA 3J81j 2VANA 3BDPA 4YMOA 2OHFA 1RPLA 5HMLA 3N4MB 1Z4OA 4HAIA 4M6WB 4YD1A 1S0OA 4GXKA 5EWFA 1PVRA 1COOA 3ORYA 3M7DA 9ICUA 1Z00A 4M04A 2C28A 4EBCA 2IBKA 3FYHA 5KT6A 2GOLA 3DEEA 4B9LA 3GV7B 2BDPA 3GIIA 8ICYA 4R8UA 2JH1A 2ZIUA 4Z6CA 3C5FA 1LKYB 5DQHA 8ICAA 3GQCA 5CRXA 8ICOA 3ZDDA 4PGQA 2DPJA 2F77X 4FO6A 3KHLA 2E3TA 1TE2A 4LZDA 1IM4A 2QB0A 1KLNA 1SWWA 4QWBA 5DDMA 2RLTA 2G06A 2EZXA 4BJQA 3WK9A 1N5WA 4BX9C 5L1MA 5ALVA 3MR3A 4QZBA 3C2LA 3V6JA 2XY6A 4KLMA 5KFOA 3RJFA 3DDHA 1KBUA 3MGHA 1V38A 3F5EA 5KG3A 3IN5A 1NJZA 1NK6A 4XA5A 5AKYA 2JV3A 2I1QA 2ZJAA 4EBDA 4I28A 1DK2A 2YQEA 3HKZF 4QZAA 3BZCA 2VJ4A 4ED6A 1PUZA 1XO1A 2ZUCA 3WKDA 3KZXA 4ECUA 4M6WA 5KFJA 1ZRNA 5KFZA 3M6KA 5AKEA 2ISOA 5F9LA 2AHOB 2P6RA 3EPIA 5ALHA 3RR8A 4RQ2A 1C7YA 3SMVA 5AK6A 3F2CA 1LKYA 3OPXA 2PMZC 1L7OA 5J2HA 1FIQA 5KTQA 4PL1A 1HUZA 3JPRA 1SL2A 3QUBA 1PVPA 4KLGA 1SZHA 2F8LA 1LVHA 1PK1B 2ZXIA 3UQ2A 1KRPA 1WG8A 5KFLA 1NKBA 3KHHA 4J9LA 4ICAA 2KJ9A 4UBBA 2WF6A 2FDRA 1T7PA 2WFAA 4CE6A 8ICWA 3F5AA 2MUTB 4NXZA 3PW7A 5KG0A 3JPSA 1X9XA 4DOAA 4YP3A 1L3VA 1D8YA 1RG6A 3WK5A 5AM5A 4Y2VA 3LWMA 2G07A 2QLTA 1BPZA 1NZBA 2W9CB 2KN7A 3OHBA 3QZ8A 8ICHA 4UAZA 1XSLA 5GTIU 2KV2A 4G3IA 1SWVA 2BDUA 1T8EA 5KFNA 3KFUF 3Q8SB 1S0VA 4DOBA 3PR4A 8ICEA 3RAXA 1NK7A 4IS7A 4QZ8A 4NM2A 1SB3C 3V6KA 4DQRA 4ECTA 2JEJA 2H3ZA 2XCPA 2OWOA 5CHGA 4F4ZA 2ESEA 5DB7A 7ICSA 3B0YA 4M47A 1RYRA 3SZ2A 4DFDA 3H8WA 5FP0A 4BUGA 2YB1A 4I2FA 3NVWA 3WKBA 1XO0A 1NNLA 8ICRA 4RQ0A 3RRHA 2J6UA 3RJKA 4G9BA 2Y0SF 3QX7A 2DFLA 3Q8LA 1H38A 5J0OA 2GH1A 4JWMA 4HYKA 2AXTU 4CDGA 1PK1A 2MU2A 4C8KA 1IG6A 3H4DA 2RHFA 8ICCA 4YR0A 3WK4A 4F91B 1NJWA 4GXJA 1TAUA 1TK5A 2LBOA 5CR0A 9ICMA 4UB1A 7ICQA 5EWEA 4QZHA 2MUTA 1AROP 4RNOA 3AQFA 9ICNA 2LI6A 4OJOA 5KG4A 3Q8PB 1EXNA 1ZD5A 7ICLA 3C1ZA 7ICIA 9ICBA 4R64A 2W9CA 5ALZA 4NLKA 3N28A 4Z6EA 4ELTA 2KZZA 2BCVA 1RYUA 4NLCA 2W04A 1LV5A 4E0DA 2IA6A 2W9AA 2EZZA 8ICTA 4OJLA 1S5LU 4RPXA 5DBBA 2QARB 4UATA 2A19A 1XC9A 1D9DA 1SXDA 4R66A 4I2EA 1ZQLA 2KVSA 4IQUA 3EW9A 4CCHA 3TACB 3K75D 3B9JA 3V7LA 4Y2JA 5AK3A 1NZPA 1KFTA 5ALFA 4PZNA 4F8RA 2BPGA 4UBCA 2OM6A 2BQUA 1OW5A 2K89A 2Y1IA 1Z19A 7ICOA 4ECRA 3T79A 2W03A 3H8JA 2K4IA 3AMZA 3E2EA 2FLPA 4I2CA 2BZFA 3HJEA 4Y2RA 3C21A 1L7MA 1QSSA 4JUZA 4PGYA 2AGPA 8ICPA 3PW4A 5KFIA 4B9TA 2KZ3A 4Q8EA 1CEZA 2DUYA 1BPEA 1F44A 2W55A 3BQTA 3UMGA 5A0LA 4YQWA 5KFKA 4R65A 3TAPA 2XC9A 3ZD9A 3UXNA 3ED5A 3TFRA 2J6TA 4KLIA 5ALQA 1CRXA 4P4MA 5KFDA 2UVRA 4PHPA 1IV8A 1O03A 1F5SA 5J2JA 5EE9A 3A0BU 2QARA 5J2BA 2BKEA 5T14A 2FMSA 2BCSA 3G6YA 4LJXA 4P0PB 1JXEA 3AEVA 5DBAA 5J0YA 1QQ7A 5AK5A 2DPIA 1ZQMA 2F1IA 2Y0SC 2ZTCA 1NK9A 1TAMA 5J0XA 5ALDA 3G6XA 2FI1A 4IL6U 5L1JA 5KFBA 7ICMA 2AH5A 3NS1A 1UA1A 7ICKA 1DOQA 2I9GA 1UPHA 1B0XA 4Q44A 3ZDAA 2PI4A 3L3FX 2ES6A 1U9LA 3ICXA 2NO4A 1ZQGA 4GXIA 7ICRA 2UVWA 4NLBA 8ICKA 3RH6A 1JIHA 2A1JB 5AICA 2YY6A 2DF4B 4PGXA 3IM1A 3I28A 2DQNB 4QZEA 3RB4A 2WF8A 3F2DA 4P4PA 3MGIA 8ICLA 1A6SA 3SYZA 4M9NA 2WHEA 4B9MA 2BQRA 4DFJA 4IR9A 2LM4A 3H0RB 2W3RA 1X9SA 5EOZA 2GO7A 5KG5A 2EZYA 2JXJA 4I27A 4Q43A 4EZ9A 3V6HA 4OJ6A 2V9WA 4F2SA 2F8KA 1K5OA 1RM6C 3PSTA 2DL0A 4ELUA 1WCNA 1WWUA 5AKGA 4P0QB 3C5GA 2ALZA 4Y2UA 1WWVA 4DQIA 3RTVA 3H0MB 2C2RA 1QSLA 2XGQA 1WUDA 4P0PA 3MBYA 4MF2A 5G5HA 2K8CB 5L9XA 4OJ5A 1HUOA 4KLQA 3UMBA 2FE9A 4DL4A 2BCQA 2H3VA 3GDXA 3PV8A 5KFTA 4F72A 5DLFA 2ASDA 1K1QA 2FLLA 4EEKA 4K4IA 3MR5A 2YMPA 2KFZA 1X42A 4GFJA 3M8RA 1ZQEA 1ZQ1C 4UW9A 9ICKA 1JN3A 2RDIA 4DL7A 4DQSA 2F1HA 3GIKA 4KN7A 2A1JA 2CXYA 3SAFA 3QU7A 3MGVA 4IR1A 3QEBZ 3OSNA 2E1EA 2LKYA 4RT2A 4GC6A 5DB6A 1ZXIA 1XSPA 2R8JA 2KIVA 2DWQA 5AKIA 3M9MB 2YMQA 2M0NA 4UB2A 5JU5A 3RH4A 3ISDA 4FFDA 4TUQA 3NGDA 2ZTEA 1KEJA 4PHDA 4UB6U 3MDCA 2D3DA 1TV9A 1N60A 4QJFB 5DGBA 3PO5A 1TVAA 1X6JA 2D8CA 5J0TA 4P0QA 5AI0A 2HOFA 5J8YA 2EDUA 2KVCA 4YXMA 2CRXA 5F9NA 3RH5A 4RT3A 2AGOA 2EAOA 1BNOA 4MF8A 5C5JA 4RNNA 4DF4A 5CEHA 2ISPA 4EEYA 3AL0B 9ICCA 2G09A 4F71A 1A77A 5D46A 4F50A 1N56A 2NRZA 4UASA 4JV2A 3D2QA 2EAMA 2J6SA 1DK3A 1SKSA 4CF4A 2MA1A 2C22A 2H5XA 3M9NB 2F2AB 2GLEA 4TUSA 3C23A 1ZJMA 3SV3A 2IOFK 4KLFA 8ICSA 4UAUA 2EAPA 3QE9Y 3SENA 1ECWA 4PHAA 4DFMA 1DGJA 3BQ2A 4M0AA 1ZD4A 5AIBA 5DQIA 5DGAA 1U48A 4DO9A 3PX0A 8ICIA 4J03A 1Q3UA 3C29A 3UXOA 1BPYA 1S0NA 4DSFA 2YN4A 5GTHU 1NK0A 3AN1A 2F1JA 2HOIA 1WYGA 3TAQA 4US9A 5ALRA 2I6XA 2HW3A 5J0SA 2HHWA 1N62A 2XIDA 2AJQA 9ICOA 4GLXA 2PXIA 4IQVA 2BR0A 1RQNA 1SZPA 5KFMA 5KFSA 1JUDA 2W7OA 5BOLA 4KLLA 4F3OA 5ALTA 2DKXA 3N7RC 4M9GA 2OH2A 3SD7A 2KTQA 1MC8A 4OD0A 1XS9D 4B9NA 4AP9A 3Q8KA 3UM9A 4QZ9A 4FE3A 4YN4A 2KJ5A 4QWCA 1Y88A 5ALXA 4AYBC 3AUOA 4ECYA 4J9RA 2DGZA 2K4HA 1V9PA 4C8OA 3KZIU 2QB1A 3OHAA 5AKZA 4J9KA 4Z6DA 3EPGA 1S97A 1UCVA 4O3NA 5KL8B 5DB9A 4J9PA 1Z4NA 4IRCA 1SV0A 1D8LA 2IHNA 2WF5A 2R18A 3THVA 3QU4A 2ZTDA 4LZGA 4EX6A 3D2NA 5BOMA 1ZQZA 2JHDA 2KD1A 3D6JA 2LYHA 3PR5B 2ZUBA 5AI4A 1KFSA 2XVTA 2LYAA 2ZIXB 3WKEA 4O3RA 1X6IA 3PSFA 3RB6A 3H8SA 3KKAA 3RAQA 3SV4A 3GFKB 1QTMA 4U6PA 4QZIA 1C20A 2JGAA 4PH5A 3LVVA 4FBUA 2OEHA 5E79U 2WB1F 5AI6A 1L8LA 3PSPA 3E58A 5AM4A 2RDJA 3C2MA 3NUQA 3QXGA 5ALLA 2MAXA 5DB8A 4F4XA 4QZFA 2UVVA 2VA2A 4ECQA 4DFPA 2DKZA 4RZRA 1FFUA 2EANA 2RP5A 4R63A 3CP8A 9ICVA 3T5LA 3IDWA 5ALIA 3NASA 1HIWA 5CP2A 5L1IA 3JPQA 4IRDA 1SKWA 3TKAA 3HKZC 4IRKA 4UB5A 4GIBA 4JB3A 4KMOB 1X66A 3SAGA 5AM3A 2E8OA 3PW2A 3OTQA 1NKEA 5JTIA 3N7SC 4M9HA 2F44A 5AKLA 2K60A 3RJHA 4ED7A 5EE0A 5IIIA 4UARA 1ZQBA 2Y1JA 5HNKA 4RQ5A 1LB2B 1MN8A 5KFAA 1ZQKA 2C2EA 1ZQQA 9ICTA 3ISBA 4QWDA 4Y2QA 5AKHA 4EENA 4ED0A 2VA8A 7ICHA 1L6NA 1QH9A 2ZIXA 5D4BA 1VLBA 5KT5A 4F5QA 1RZTA 1CI4A 2XGPA 2JEIA 1S10A 3NTUA 5KFFA 1NK5A 4JV0A 1URJA 2W9MA 9ICSA 2PKEA 1MQ3A 4C80A 2JRZA 5B5EU 4O0IA 2FPLA 4YXJA 3MDAA 4C4TA 5HR6A 5ALPA 2KKVA 3CNHA 3TANA 2HCFA 1QQ5A 2BCRA 1ZOLA 3FM9A 4B6JA 1RXWA 4ACOA 3OJUA 1T3QA 4KLEA 2KE7A 3OGUA 4CGZA 3FDSA 5J2IA 1L3TA 4UAWA 3B0XA 4TQRA 3PMLA 4ECSA 4RNMA 3GZFA 4YG2A 2IMWP 2HHTA 5IIOA 5J2FA 2KJ8A 2ZUDA 3A0HU 1L7PA 3OJSA 5J0RA 1PK3A 3V7KA 1ZQYA 2W8KA 2OYYA 3QZ7A 2AGQA 2FJ6A 3LYSA 2MSNA 2ZJ5A 4KLTA 4PHEA 5IIMA 2NRXA 5AHXA 4F5NA 8ICVA 2B6GA 1J97A 1TFRA 1M6YA 3LDAA 3WU2U 1ZJNA 2E8NA 3NVYA 3RJJA 4JWNA 5J0PA 4EYIB 4NY8A 2M9NA 4KLOA 5KFRA 2WB1C 5L1KA 5KFGA 1O08A 2W11A 4DL5A 1SKRA 4NM1A 5DG8A 3TARA 5AIAA 3KHGA 1U4BA 2AQ0A 4YD2A 1ZQCA 2GWSA 4XUSA 3PX4A 3T5HA 1S0MA 2HHUA 8ICJA 3QU9A 5D49A 1QCKA 2KICA 1NOMA 2W7PA 2LYBA 4CF3A 4MHVA 1U47A 1ED1A 4F2RA 2H3IA 4A8EA 4QWEA 5KFVA 1KQQA 3QYPA 4NLGA 1ZQOA 4DWIA 3TQ1A 5KAFU 3HT3A 3T3FA 1ZQVA 4ED2A 2V4RA 3H0LB 2K4PA 4XRHA 7ICUA 4KLDA 2HBKA 5KFEA 4FZMA 3KD3A 3K1ZA 4TURA 5IIKA 2I5HA 4NL9A 5IINA 5DLGA 3VCBA 4DFKA 3WKCA 4QZCA 1KL9A 3GIMA 4O3QA 5J0WA 1SIJA 2HHSA 4QWAA 4NLZA 4UQGA 4O5CA 5ALWA 5KNIA 4OJPA 4YMMA 4RUCA 8ICBA 1J2NA 4C7YA 4KN4A 3SEIA 1WCLA 3BQ1A 4UAYA 3O0FA 9ICFA 4F4YA 2JH7A 3ONNA 5CB1A 3UPQA 3AU2A 2UVUA 2KKPA 4ZH4A 4NJ8A 2G08A 1Q3VA 1ZQFA 4PPXA 2JZBB 1JROA 4RUAA 2W43A 4IQTA 2PFPA 1YZ6A 4J9NA 3MABA 1FEZA 4Y2XA 4QW8A 1Q8KA 1ZRMA 1JXLA 2PI5A 1L3SA 5AI8A 5ALMA 4B9VA 3TFSA 2DBYA 4YCXA 3KKAC 5DDYA 2VJ5A 3V72A 3N97B 3TI0A 4DSIA 5AM1A 1IIPA 5DQGA 4O9MA 5CWRA 9ICHA 3QU5A 2YB4A
chains in the Genus database with same CATH topology
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6K A;  2KVS A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 3M9O B;  8ICF A;  2W3S A;  2LPE A;  4DSK A;  2L5Y A;  4I2J A;  2ZIW B;  4CNQ A;  4EZ6 A;  9ICP A;  1B43 A;  5KL1 B;  5J0U A;  4F93 B;  5HHI A;  3HPO A;  4C4S A;  2R8H A;  5KT2 A;  1ZQT A;  2E8P A;  3EZ5 A;  5CA7 A;  3MC1 A;  5KFX A;  5ALK A;  3F53 A;  1JMS A;  3SI8 A;  1A76 A;  5C0Y A;  4C0Z A;  4DSE A;  3ZD8 A;  4UB3 A;  5BPC A;  1KFD A;  2RQ5 A;  5AI9 A;  1JAL A;  2YTU A;  2HHV A;  3HIL A;  1JI7 A;  2KSO B;  2ZG6 A;  4DOC A;  5KFH A;  4ZOH C;  3BZK A;  4J9O A;  2V4Q A;  1FO4 A;  2ASJ A;  4UB4 A;  3MR2 A;  3Q8R B;  1RYS A;  2JZB A;  3HRD D;  5F3X B;  2JEF A;  4J9S A;  3V7J A;  2W8L A;  5TZV A;  1X2I A;  1XNS A;  1KN5 A;  4O3O A;  1RDF A;  3GIJ A;  2HSZ A;  3IG8 A;  5ALN A;  1UHU A;  4I2A A;  2HOQ A;  1RQL A;  1D9F A;  5K4L A;  5ALJ A;  4DQQ A;  3EUB 2;  2PFQ A;  9ICI A;  2VA3 A;  9ICQ A;  5ALU A;  1X40 A;  4ELV A;  1NI3 A;  2XY7 A;  4I2D A;  2KEY A;  2Z7J A;  4UB8 U;  3AM9 A;  2LM1 A;  4WJ3 B;  3IG5 A;  9ICX A;  3BQ7 A;  3RRG A;  2NRT A;  3MR6 A;  5KG6 A;  1NKC A;  2JEG A;  3GIL A;  1U45 A;  2QKQ A;  8ICZ A;  4RQM A;  3WK6 A;  3PO4 A;  2KK0 A;  3RFA A;  2LMR A;  5KT4 A;  1N48 A;  2IOF A;  2ZIW A;  1DXS A;  5EWG A;  5AI5 A;  5DBC A;  4NV0 A;  4YR3 A;  4Y2P A;  1B22 A;  1SXE A;  1OUQ A;  1N2X A;  3T5J A;  1BPX A;  5KFY A;  1BPD A;  3BS5 B;  1ZQH A;  7ICT A;  5EE3 A;  5H2F U;  1L7N A;  2EH9 A;  4DLG A;  1L5U A;  1PZN A;  1SL1 A;  4QIW F;  4DCC A;  1X9M A;  3CRX A;  1TK0 A;  2Q0Z X;  1ZD2 P;  3PMN A;  4FBT A;  1XSN A;  3ZDC A;  4C4R A;  2KSO A;  2K8B B;  5ALY A;  2CPR A;  3EWA A;  2HHQ A;  1BPB A;  3RBD A;  3F2B A;  7ICN A;  1ZQA A;  1MA7 A;  2E8M A;  4C8M A;  4P2H A;  1UA0 A;  2HMX A;  2K8A A;  3NRZ A;  3QUQ A;  3K4G A;  3PVX A;  2NV3 A;  2Y9U A;  4XQ8 A;  2W54 A;  1Z3E B;  3I1Y A;  3BJY A;  2BGW A;  2HVH A;  4NWI A;  2G0A A;  2F76 X;  1KKX A;  2FMQ A;  4M9J A;  2R8G A;  4RQ8 A;  3UMC A;  8ICX A;  3M8S A;  4KMU A;  3BQ0 A;  4PJ0 U;  2BHN A;  1NK8 A;  2HDO A;  3IRU A;  4FZN A;  4O3P A;  5J2D A;  7ICG A;  5KG2 A;  5IIJ A;  5L1L A;  3PZP A;  3KTQ A;  3QUC A;  5HHH A;  1YZ7 A;  2BPC A;  2W9B B;  1X9W A;  1S77 D;  2NRV A;  3L5K A;  4EBE A;  4I2H A;  2R8I A;  4YFK A;  3MFI A;  4RQ4 A;  5KFP A;  1U49 A;  3KBB A;  4US8 A;  4ECX A;  4K4G A;  2XIC A;  4UAV A;  3RR7 A;  3ZDB A;  1ZQU A;  1VJ5 A;  2R8K A;  1B4F A;  4QZD A;  4ED3 A;  3BS5 A;  2OXO A;  5CJ7 A;  4QNL A;  3S6J A;  4NL9 C;  8ICM A;  2VIX A;  3PX6 A;  2YMM A;  4P4O A;  1ZQP A;  3JPP A;  4RQN A;  3RJI A;  4CRX A;  1CUK A;  2JR5 A;  5J2G A;  3HX0 A;  4ECV A;  2FLN A;  4USA A;  4RQ1 A;  2A1A A;  3PW5 A;  1BNP A;  9ICW A;  3H4B A;  2NYV A;  3RBE A;  4QW9 A;  3SAH A;  4KLJ A;  3ALR A;  4DSL A;  1ZQN A;  4F4W A;  4DL2 A;  4YR2 A;  4C8L A;  2XY5 A;  5AM0 A;  4F5R A;  3JPN A;  3E0F A;  4O5K A;  4EX7 A;  4IQW A;  1ZQS A;  3TAD A;  5AKJ A;  1N5X A;  4MEX A;  3RJE A;  3D2S A;  2P66 A;  3U26 A;  4PZO A;  4DF8 A;  2E5S A;  5IIL A;  5ALO A;  1Q46 A;  2HBL A;  3WK7 A;  1DRG A;  2EQY A;  2KG5 A;  4KLS A;  4DQP A;  2W9B A;  1S76 D;  5KFC A;  4J9M A;  1V85 A;  3T5K A;  3NRW A;  5AM2 A;  4QZG A;  4MFF A;  3RB0 A;  4QIW C;  1QSY A;  2HVI A;  1SV4 A;  4O5E A;  1N63 A;  2MRL A;  8ICQ A;  3ISC A;  5G5G A;  2WF9 A;  3PNC A;  3WKA A;  7ICP A;  2IOH A;  4KTQ A;  3ZI4 A;  5KT7 A;  4F5O A;  4Z6F A;  8ICN A;  1JX4 A;  5TIS U;  4JK1 A;  4F5P A;  1UT5 A;  3MFH A;  5B66 U;  3UQ0 A;  5HR7 A;  4RQ7 A;  2FMP A;  1TKD A;  4KX5 A;  4K4H A;  1AQ6 A;  9ICJ A;  4FS2 A;  4DEZ A;  5DG9 A;  4ECZ A;  2ASL A;  5KFQ A;  1ZQR A;  1BVS A;  5AKX A;  9ICR A;  9ICG A;  2RRD A;  2WAQ F;  5J8Y C;  5EE1 A;  2XCA A;  1Z1V A;  2YX8 A;  3IV6 A;  3IHQ B;  4OCZ A;  1MQ2 A;  8ICG A;  1XU4 A;  3LVW A;  5HMM A;  4I2I A;  4PL2 A;  5KG7 A;  4BGD A;  5DKW A;  3EYZ A;  3OSP A;  4DL3 A;  2HHX A;  1UT8 A;  4TQS A;  3HWT A;  2D6F C;  3NVV A;  2KMD A;  4KIT B;  3C28 A;  2YML A;  4DS5 A;  3NVZ A;  3ZDE A;  4MFC A;  2AQ4 A;  4NLN A;  3QU2 A;  2F3N A;  3H7I A;  3RJG A;  4DL6 A;  3BS7 A;  7ICJ A;  2HI0 A;  3AQE A;  2CN1 A;  1JRP A;  1L3U A;  4OO1 J;  4B9S A;  4F92 B;  1Z1B A;  5HP4 A;  1XWL A;  2E1F A;  5AK4 A;  2KOB A;  2H3Q A;  1RXV A;  1J2M A;  4C7Z A;  4X5V A;  1ZYQ A;  5J2K A;  3G6V A;  2ATL A;  2PFO A;  1ZQI A;  2Q4T A;  2B21 A;  4YMN A;  1N61 A;  3VC8 A;  2IHM A;  2H3F A;  2ZXH A;  3KOO A;  3GV5 B;  4DS4 A;  1T3N A;  4U7C A;  4FS1 A;  4M9L A;  2ZIV B;  4Y2S A;  2FPM A;  2NO5 A;  2BQ3 A;  1IXR A;  9ICA A;  2KHV A;  2XI9 A;  3HP6 A;  4ED8 A;  4FZL A;  9ICL A;  5J2E A;  2PFN A;  3IP4 B;  1L8O A;  3GV8 B;  4DSJ A;  4Q45 A;  4BDP A;  2KHQ A;  3RF9 A;  5KFW A;  1PVQ A;  4KLU A;  1KW4 A;  3C2K A;  1SGG A;  3DV9 A;  2FPK A;  2KNJ A;  2LHT A;  4B9U A;  3JPT A;  3LK9 A;  2G5H B;  5ALS A;  1ZQJ A;  1OXJ A;  3I76 A;  2P35 A;  4I2G A;  5ALE A;  3R9K A;  1COK A;  4YVZ A;  3N7P D;  3L4P A;  1GO3 F;  2KP7 A;  3K1R B;  1KSP A;  4KLH A;  3QEA Z;  1ZQW A;  3C1Y A;  2ZJ8 A;  1HJP A;  1ZET A;  4J9Q A;  3KHR A;  2KZM A;  1T4G A;  2WF7 A;  4BWM A;  5J2C A;  7ICE A;  2G5I B;  3ETL A;  2B0C A;  1P7D A;  3QUT A;  2K4E A;  2Y9T A;  3SQI A;  4RQ3 A;  2N1R A;  3JPO A;  1F0M A;  4RQ6 A;  5KG1 A;  5AKK A;  3LWL A;  1ZQX A;  4CF5 A;  1A0P A;  2WAQ C;  2XO7 A;  1QQ6 A;  1SV0 C;  2JMG A;  5JRT A;  2C2D A;  3M1Y A;  2ZIV A;  1S8O A;  8ICU A;  4BXO B;  1S9F A;  1YT3 A;  3WK8 A;  4RPY A;  1TAQ A;  4M2Y A;  4C8N A;  2A3V A;  3PY8 A;  2BCU A;  9ICE A;  2NRW A;  5KAI U;  2ODG A;  1BGX T;  1TK8 A;  4BWJ A;  2HBJ A;  3Q8Q B;  3RB3 A;  2O6K A;  2KIW A;  2WTF A;  3Q8M A;  1VDV A;  1NK4 A;  2BPF A;  4KX3 A;  5DG7 A;  1QLN A;  1Z00 B;  5JUM A;  4EEL A;  1DGS A;  3GU3 A;  4Y2T A;  7ICV A;  4EYH B;  1HEK A;  3CW2 C;  4MFA A;  1UQV A;  1ZQD A;  5ALG A;  2P6U A;  5J29 A;  1SL0 A;  5J0Q A;  4R8U B;  2ZIU B;  3PW0 A;  4Q8F A;  4I2B A;  1K1S A;  2OCE A;  4IC9 A;  3CYM A;  5KT3 A;  2HBM A;  1ZD3 A;  3SR6 A;  2KFN A;  2AU0 A;  3M6Z A;  4F4K A;  3FAH A;  2QB0 B;  3UXP A;  4GC7 A;  4JV1 A;  1NJY A;  4MEY A;  4RPZ A;  3TAD C;  5KFU A;  4RU9 A;  4ECW A;  2PMZ F;  3H8M A;  3FC4 A;  7ICF A;  3ETR A;  4AYB F;  4LVS A;  4O3M A;  3HW8 A;  1KDH A;  4DLE A;  4ED1 A;  4I29 A;  5J2A A;  3PSI A;  1KTQ A;  3QNM A;  1V97 A;  4JMU A;  3AU6 A;  1MSW D;  4O3S A;  1D8B A;  1NJX A;  1T94 A;  1FFV A;  4BXO A;  3H40 A;  4Y2Y A;  4TUP A;  2VKQ A;  3J81 j;  2VAN A;  3BDP A;  4YMO A;  2OHF A;  1RPL A;  5HML A;  3N4M B;  1Z4O A;  4HAI A;  4M6W B;  4YD1 A;  1S0O A;  4GXK A;  5EWF A;  1PVR A;  1COO A;  3ORY A;  3M7D A;  9ICU A;  1Z00 A;  4M04 A;  2C28 A;  4EBC A;  2IBK A;  3FYH A;  5KT6 A;  2GOL A;  3DEE A;  4B9L A;  3GV7 B;  2BDP A;  3GII A;  8ICY A;  4R8U A;  2JH1 A;  2ZIU A;  4Z6C A;  3C5F A;  1LKY B;  5DQH A;  8ICA A;  3GQC A;  5CRX A;  8ICO A;  3ZDD A;  4PGQ A;  2DPJ A;  2F77 X;  4FO6 A;  3KHL A;  2E3T A;  1TE2 A;  4LZD A;  1IM4 A;  2QB0 A;  1KLN A;  1SWW A;  4QWB A;  5DDM A;  2RLT A;  2G06 A;  2EZX A;  4BJQ A;  3WK9 A;  1N5W A;  4BX9 C;  5L1M A;  5ALV A;  3MR3 A;  4QZB A;  3C2L A;  3V6J A;  2XY6 A;  4KLM A;  5KFO A;  3RJF A;  3DDH A;  1KBU A;  3MGH A;  1V38 A;  3F5E A;  5KG3 A;  3IN5 A;  1NJZ A;  1NK6 A;  4XA5 A;  5AKY A;  2JV3 A;  2I1Q A;  2ZJA A;  4EBD A;  4I28 A;  1DK2 A;  2YQE A;  3HKZ F;  4QZA A;  3BZC A;  2VJ4 A;  4ED6 A;  1PUZ A;  1XO1 A;  2ZUC A;  3WKD A;  3KZX A;  4ECU A;  4M6W A;  5KFJ A;  1ZRN A;  5KFZ A;  3M6K A;  5AKE A;  2ISO A;  5F9L A;  2AHO B;  2P6R A;  3EPI A;  5ALH A;  3RR8 A;  4RQ2 A;  1C7Y A;  3SMV A;  5AK6 A;  3F2C A;  1LKY A;  3OPX A;  2PMZ C;  1L7O A;  5J2H A;  1FIQ A;  5KTQ A;  4PL1 A;  1HUZ A;  3JPR A;  1SL2 A;  3QUB A;  1PVP A;  4KLG A;  1SZH A;  2F8L A;  1LVH A;  1PK1 B;  2ZXI A;  3UQ2 A;  1KRP A;  1WG8 A;  5KFL A;  1NKB A;  3KHH A;  4J9L A;  4ICA A;  2KJ9 A;  4UBB A;  2WF6 A;  2FDR A;  1T7P A;  2WFA A;  4CE6 A;  8ICW A;  3F5A A;  2MUT B;  4NXZ A;  3PW7 A;  5KG0 A;  3JPS A;  1X9X A;  4DOA A;  4YP3 A;  1L3V A;  1D8Y A;  1RG6 A;  3WK5 A;  5AM5 A;  4Y2V A;  3LWM A;  2G07 A;  2QLT A;  1BPZ A;  1NZB A;  2W9C B;  2KN7 A;  3OHB A;  3QZ8 A;  8ICH A;  4UAZ A;  1XSL A;  5GTI U;  2KV2 A;  4G3I A;  1SWV A;  2BDU A;  1T8E A;  5KFN A;  3KFU F;  3Q8S B;  1S0V A;  4DOB A;  3PR4 A;  8ICE A;  3RAX A;  1NK7 A;  4IS7 A;  4QZ8 A;  4NM2 A;  1SB3 C;  3V6K A;  4DQR A;  4ECT A;  2JEJ A;  2H3Z A;  2XCP A;  2OWO A;  5CHG A;  4F4Z A;  2ESE A;  5DB7 A;  7ICS A;  3B0Y A;  4M47 A;  1RYR A;  3SZ2 A;  4DFD A;  3H8W A;  5FP0 A;  4BUG A;  2YB1 A;  4I2F A;  3NVW A;  3WKB A;  1XO0 A;  1NNL A;  8ICR A;  4RQ0 A;  3RRH A;  2J6U A;  3RJK A;  4G9B A;  2Y0S F;  3QX7 A;  2DFL A;  3Q8L A;  1H38 A;  5J0O A;  2GH1 A;  4JWM A;  4HYK A;  2AXT U;  4CDG A;  1PK1 A;  2MU2 A;  4C8K A;  1IG6 A;  3H4D A;  2RHF A;  8ICC A;  4YR0 A;  3WK4 A;  4F91 B;  1NJW A;  4GXJ A;  1TAU A;  1TK5 A;  2LBO A;  5CR0 A;  9ICM A;  4UB1 A;  7ICQ A;  5EWE A;  4QZH A;  2MUT A;  1ARO P;  4RNO A;  3AQF A;  9ICN A;  2LI6 A;  4OJO A;  5KG4 A;  3Q8P B;  1EXN A;  1ZD5 A;  7ICL A;  3C1Z A;  7ICI A;  9ICB A;  4R64 A;  2W9C A;  5ALZ A;  4NLK A;  3N28 A;  4Z6E A;  4ELT A;  2KZZ A;  2BCV A;  1RYU A;  4NLC A;  2W04 A;  1LV5 A;  4E0D A;  2IA6 A;  2W9A A;  2EZZ A;  8ICT A;  4OJL A;  1S5L U;  4RPX A;  5DBB A;  2QAR B;  4UAT A;  2A19 A;  1XC9 A;  1D9D A;  1SXD A;  4R66 A;  4I2E A;  1ZQL A;  2KVS A;  4IQU A;  3EW9 A;  4CCH A;  3TAC B;  3K75 D;  3B9J A;  3V7L A;  4Y2J A;  5AK3 A;  1NZP A;  1KFT A;  5ALF A;  4PZN A;  4F8R A;  2BPG A;  4UBC A;  2OM6 A;  2BQU A;  1OW5 A;  2K89 A;  2Y1I A;  1Z19 A;  7ICO A;  4ECR A;  3T79 A;  2W03 A;  3H8J A;  2K4I A;  3AMZ A;  3E2E A;  2FLP A;  4I2C A;  2BZF A;  3HJE A;  4Y2R A;  3C21 A;  1L7M A;  1QSS A;  4JUZ A;  4PGY A;  2AGP A;  8ICP A;  3PW4 A;  5KFI A;  4B9T A;  2KZ3 A;  4Q8E A;  1CEZ A;  2DUY A;  1BPE A;  1F44 A;  2W55 A;  3BQT A;  3UMG A;  5A0L A;  4YQW A;  5KFK A;  4R65 A;  3TAP A;  2XC9 A;  3ZD9 A;  3UXN A;  3ED5 A;  3TFR A;  2J6T A;  4KLI A;  5ALQ A;  1CRX A;  4P4M A;  5KFD A;  2UVR A;  4PHP A;  1IV8 A;  1O03 A;  1F5S A;  5J2J A;  5EE9 A;  3A0B U;  2QAR A;  5J2B A;  2BKE A;  5T14 A;  2FMS A;  2BCS A;  3G6Y A;  4LJX A;  4P0P B;  1JXE A;  3AEV A;  5DBA A;  5J0Y A;  1QQ7 A;  5AK5 A;  2DPI A;  1ZQM A;  2F1I A;  2Y0S C;  2ZTC A;  1NK9 A;  1TAM A;  5J0X A;  5ALD A;  3G6X A;  2FI1 A;  4IL6 U;  5L1J A;  5KFB A;  7ICM A;  2AH5 A;  3NS1 A;  1UA1 A;  7ICK A;  1DOQ A;  2I9G A;  1UPH A;  1B0X A;  4Q44 A;  3ZDA A;  2PI4 A;  3L3F X;  2ES6 A;  1U9L A;  3ICX A;  2NO4 A;  1ZQG A;  4GXI A;  7ICR A;  2UVW A;  4NLB A;  8ICK A;  3RH6 A;  1JIH A;  2A1J B;  5AIC A;  2YY6 A;  2DF4 B;  4PGX A;  3IM1 A;  3I28 A;  2DQN B;  4QZE A;  3RB4 A;  2WF8 A;  3F2D A;  4P4P A;  3MGI A;  8ICL A;  1A6S A;  3SYZ A;  4M9N A;  2WHE A;  4B9M A;  2BQR A;  4DFJ A;  4IR9 A;  2LM4 A;  3H0R B;  2W3R A;  1X9S A;  5EOZ A;  2GO7 A;  5KG5 A;  2EZY A;  2JXJ A;  4I27 A;  4Q43 A;  4EZ9 A;  3V6H A;  4OJ6 A;  2V9W A;  4F2S A;  2F8K A;  1K5O A;  1RM6 C;  3PST A;  2DL0 A;  4ELU A;  1WCN A;  1WWU A;  5AKG A;  4P0Q B;  3C5G A;  2ALZ A;  4Y2U A;  1WWV A;  4DQI A;  3RTV A;  3H0M B;  2C2R A;  1QSL A;  2XGQ A;  1WUD A;  4P0P A;  3MBY A;  4MF2 A;  5G5H A;  2K8C B;  5L9X A;  4OJ5 A;  1HUO A;  4KLQ A;  3UMB A;  2FE9 A;  4DL4 A;  2BCQ A;  2H3V A;  3GDX A;  3PV8 A;  5KFT A;  4F72 A;  5DLF A;  2ASD A;  1K1Q A;  2FLL A;  4EEK A;  4K4I A;  3MR5 A;  2YMP A;  2KFZ A;  1X42 A;  4GFJ A;  3M8R A;  1ZQE A;  1ZQ1 C;  4UW9 A;  9ICK A;  1JN3 A;  2RDI A;  4DL7 A;  4DQS A;  2F1H A;  3GIK A;  4KN7 A;  2A1J A;  2CXY A;  3SAF A;  3QU7 A;  3MGV A;  4IR1 A;  3QEB Z;  3OSN A;  2E1E A;  2LKY A;  4RT2 A;  4GC6 A;  5DB6 A;  1ZXI A;  1XSP A;  2R8J A;  2KIV A;  2DWQ A;  5AKI A;  3M9M B;  2YMQ A;  2M0N A;  4UB2 A;  5JU5 A;  3RH4 A;  3ISD A;  4FFD A;  4TUQ A;  3NGD A;  2ZTE A;  1KEJ A;  4PHD A;  4UB6 U;  3MDC A;  2D3D A;  1TV9 A;  1N60 A;  4QJF B;  5DGB A;  3PO5 A;  1TVA A;  1X6J A;  2D8C A;  5J0T A;  4P0Q A;  5AI0 A;  2HOF A;  5J8Y A;  2EDU A;  2KVC A;  4YXM A;  2CRX A;  5F9N A;  3RH5 A;  4RT3 A;  2AGO A;  2EAO A;  1BNO A;  4MF8 A;  5C5J A;  4RNN A;  4DF4 A;  5CEH A;  2ISP A;  4EEY A;  3AL0 B;  9ICC A;  2G09 A;  4F71 A;  1A77 A;  5D46 A;  4F50 A;  1N56 A;  2NRZ A;  4UAS A;  4JV2 A;  3D2Q A;  2EAM A;  2J6S A;  1DK3 A;  1SKS A;  4CF4 A;  2MA1 A;  2C22 A;  2H5X A;  3M9N B;  2F2A B;  2GLE A;  4TUS A;  3C23 A;  1ZJM A;  3SV3 A;  2IOF K;  4KLF A;  8ICS A;  4UAU A;  2EAP A;  3QE9 Y;  3SEN A;  1ECW A;  4PHA A;  4DFM A;  1DGJ A;  3BQ2 A;  4M0A A;  1ZD4 A;  5AIB A;  5DQI A;  5DGA A;  1U48 A;  4DO9 A;  3PX0 A;  8ICI A;  4J03 A;  1Q3U A;  3C29 A;  3UXO A;  1BPY A;  1S0N A;  4DSF A;  2YN4 A;  5GTH U;  1NK0 A;  3AN1 A;  2F1J A;  2HOI A;  1WYG A;  3TAQ A;  4US9 A;  5ALR A;  2I6X A;  2HW3 A;  5J0S A;  2HHW A;  1N62 A;  2XID A;  2AJQ A;  9ICO A;  4GLX A;  2PXI A;  4IQV A;  2BR0 A;  1RQN A;  1SZP A;  5KFM A;  5KFS A;  1JUD A;  2W7O A;  5BOL A;  4KLL A;  4F3O A;  5ALT A;  2DKX A;  3N7R C;  4M9G A;  2OH2 A;  3SD7 A;  2KTQ A;  1MC8 A;  4OD0 A;  1XS9 D;  4B9N A;  4AP9 A;  3Q8K A;  3UM9 A;  4QZ9 A;  4FE3 A;  4YN4 A;  2KJ5 A;  4QWC A;  1Y88 A;  5ALX A;  4AYB C;  3AUO A;  4ECY A;  4J9R A;  2DGZ A;  2K4H A;  1V9P A;  4C8O A;  3KZI U;  2QB1 A;  3OHA A;  5AKZ A;  4J9K A;  4Z6D A;  3EPG A;  1S97 A;  1UCV A;  4O3N A;  5KL8 B;  5DB9 A;  4J9P A;  1Z4N A;  4IRC A;  1SV0 A;  1D8L A;  2IHN A;  2WF5 A;  2R18 A;  3THV A;  3QU4 A;  2ZTD A;  4LZG A;  4EX6 A;  3D2N A;  5BOM A;  1ZQZ A;  2JHD A;  2KD1 A;  3D6J A;  2LYH A;  3PR5 B;  2ZUB A;  5AI4 A;  1KFS A;  2XVT A;  2LYA A;  2ZIX B;  3WKE A;  4O3R A;  1X6I A;  3PSF A;  3RB6 A;  3H8S A;  3KKA A;  3RAQ A;  3SV4 A;  3GFK B;  1QTM A;  4U6P A;  4QZI A;  1C20 A;  2JGA A;  4PH5 A;  3LVV A;  4FBU A;  2OEH A;  5E79 U;  2WB1 F;  5AI6 A;  1L8L A;  3PSP A;  3E58 A;  5AM4 A;  2RDJ A;  3C2M A;  3NUQ A;  3QXG A;  5ALL A;  2MAX A;  5DB8 A;  4F4X A;  4QZF A;  2UVV A;  2VA2 A;  4ECQ A;  4DFP A;  2DKZ A;  4RZR A;  1FFU A;  2EAN A;  2RP5 A;  4R63 A;  3CP8 A;  9ICV A;  3T5L A;  3IDW A;  5ALI A;  3NAS A;  1HIW A;  5CP2 A;  5L1I A;  3JPQ A;  4IRD A;  1SKW A;  3TKA A;  3HKZ C;  4IRK A;  4UB5 A;  4GIB A;  4JB3 A;  4KMO B;  1X66 A;  3SAG A;  5AM3 A;  2E8O A;  3PW2 A;  3OTQ A;  1NKE A;  5JTI A;  3N7S C;  4M9H A;  2F44 A;  5AKL A;  2K60 A;  3RJH A;  4ED7 A;  5EE0 A;  5III A;  4UAR A;  1ZQB A;  2Y1J A;  5HNK A;  4RQ5 A;  1LB2 B;  1MN8 A;  5KFA A;  1ZQK A;  2C2E A;  1ZQQ A;  9ICT A;  3ISB A;  4QWD A;  4Y2Q A;  5AKH A;  4EEN A;  4ED0 A;  2VA8 A;  7ICH A;  1L6N A;  1QH9 A;  2ZIX A;  5D4B A;  1VLB A;  5KT5 A;  4F5Q A;  1RZT A;  1CI4 A;  2XGP A;  2JEI A;  1S10 A;  3NTU A;  5KFF A;  1NK5 A;  4JV0 A;  1URJ A;  2W9M A;  9ICS A;  2PKE A;  1MQ3 A;  4C80 A;  2JRZ A;  5B5E U;  4O0I A;  2FPL A;  4YXJ A;  3MDA A;  4C4T A;  5HR6 A;  5ALP A;  2KKV A;  3CNH A;  3TAN A;  2HCF A;  1QQ5 A;  2BCR A;  1ZOL A;  3FM9 A;  4B6J A;  1RXW A;  4ACO A;  3OJU A;  1T3Q A;  4KLE A;  2KE7 A;  3OGU A;  4CGZ A;  3FDS A;  5J2I A;  1L3T A;  4UAW A;  3B0X A;  4TQR A;  3PML A;  4ECS A;  4RNM A;  3GZF A;  4YG2 A;  2IMW P;  2HHT A;  5IIO A;  5J2F A;  2KJ8 A;  2ZUD A;  3A0H U;  1L7P A;  3OJS A;  5J0R A;  1PK3 A;  3V7K A;  1ZQY A;  2W8K A;  2OYY A;  3QZ7 A;  2AGQ A;  2FJ6 A;  3LYS A;  2MSN A;  2ZJ5 A;  4KLT A;  4PHE A;  5IIM A;  2NRX A;  5AHX A;  4F5N A;  8ICV A;  2B6G A;  1J97 A;  1TFR A;  1M6Y A;  3LDA A;  3WU2 U;  1ZJN A;  2E8N A;  3NVY A;  3RJJ A;  4JWN A;  5J0P A;  4EYI B;  4NY8 A;  2M9N A;  4KLO A;  5KFR A;  2WB1 C;  5L1K A;  5KFG A;  1O08 A;  2W11 A;  4DL5 A;  1SKR A;  4NM1 A;  5DG8 A;  3TAR A;  5AIA A;  3KHG A;  1U4B A;  2AQ0 A;  4YD2 A;  1ZQC A;  2GWS A;  4XUS A;  3PX4 A;  3T5H A;  1S0M A;  2HHU A;  8ICJ A;  3QU9 A;  5D49 A;  1QCK A;  2KIC A;  1NOM A;  2W7P A;  2LYB A;  4CF3 A;  4MHV A;  1U47 A;  1ED1 A;  4F2R A;  2H3I A;  4A8E A;  4QWE A;  5KFV A;  1KQQ A;  3QYP A;  4NLG A;  1ZQO A;  4DWI A;  3TQ1 A;  5KAF U;  3HT3 A;  3T3F A;  1ZQV A;  4ED2 A;  2V4R A;  3H0L B;  2K4P A;  4XRH A;  7ICU A;  4KLD A;  2HBK A;  5KFE A;  4FZM A;  3KD3 A;  3K1Z A;  4TUR A;  5IIK A;  2I5H A;  4NL9 A;  5IIN A;  5DLG A;  3VCB A;  4DFK A;  3WKC A;  4QZC A;  1KL9 A;  3GIM A;  4O3Q A;  5J0W A;  1SIJ A;  2HHS A;  4QWA A;  4NLZ A;  4UQG A;  4O5C A;  5ALW A;  5KNI A;  4OJP A;  4YMM A;  4RUC A;  8ICB A;  1J2N A;  4C7Y A;  4KN4 A;  3SEI A;  1WCL A;  3BQ1 A;  4UAY A;  3O0F A;  9ICF A;  4F4Y A;  2JH7 A;  3ONN A;  5CB1 A;  3UPQ A;  3AU2 A;  2UVU A;  2KKP A;  4ZH4 A;  4NJ8 A;  2G08 A;  1Q3V A;  1ZQF A;  4PPX A;  2JZB B;  1JRO A;  4RUA A;  2W43 A;  4IQT A;  2PFP A;  1YZ6 A;  4J9N A;  3MAB A;  1FEZ A;  4Y2X A;  4QW8 A;  1Q8K A;  1ZRM A;  1JXL A;  2PI5 A;  1L3S A;  5AI8 A;  5ALM A;  4B9V A;  3TFS A;  2DBY A;  4YCX A;  3KKA C;  5DDY A;  2VJ5 A;  3V72 A;  3N97 B;  3TI0 A;  4DSI A;  5AM1 A;  1IIP A;  5DQG A;  4O9M A;  5CWR A;  9ICH A;  3QU5 A;  2YB4 A; 
#chains in the Genus database with same CATH homology
 2O6K A;  2KVS A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...