2O6KA

Crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
YSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0346 protein MW1311
publication title Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 24
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2o6kA00
2O6KA 2FJ6A 2KVSA
chains in the Genus database with same CATH superfamily
1XSNA 1ZYQA 3I28A 2KSOB 4F4WA 4PZOA 2ZUCA 1Z1BA 5KT3A 4BWJA 1L3SA 8ICZA 1NJZA 1SB3C 1LV5A 2JEJA 4OCZA 4F50A 5ALJA 5KFNA 4DL6A 1ZQJA 1Q8KA 1V97A 3H0RB 4K4IA 1ZQQA 3IRUA 2ISOA 4ED8A 5ALSA 3T5HA 2KZMA 3WK9A 4YR2A 3EYZA 1O03A 1KDHA 5J2EA 3H8SA 7ICEA 1D8BA 1F44A 8ICUA 3Q8PB 1Z1VA 4UB8U 1ZQCA 9ICBA 1BPEA 1CUKA 3Q8RB 2B0CA 2ZIUB 1QTMA 4B9TA 2ZTEA 4Y2JA 4UAUA 1AROP 4M9NA 4BXOB 3GFKB 4DQSA 9ICPA 4ACOA 2R8KA 2EAPA 1JXEA 2R8GA 4E0DA 3H4BA 4EBCA 3O0FA 2HHTA 1MSWD 3BQ2A 4RQ7A 2W9AA 1NKBA 3GV7B 3H7IA 3C2MA 5IIIA 5J0RA 2YMPA 2RDJA 1QSSA 1ZRNA 4DLGA 1X42A 1WWUA 3UXNA 2WB1F 2G07A 4RNNA 1X66A 2XY5A 1X9SA 5KFQA 3MGVA 4KMUA 1SV0C 4F8RA 2KG5A 3HKZF 1SV0A 1SKSA 1PZNA 3RRHA 1JMSA 4UB5A 8ICQA 2V4RA 1SL0A 1T94A 1RPLA 2O6KA 4ELTA 2F76X 2W9MA 4QW8A 4JK1A 4Z6EA 3SAFA 9ICLA 1L7PA 4YP3A 3BS7A 5AI4A 2PMZF 3B9JA 3C23A 4KLMA 5DQHA 1WWVA 1V9PA 5J2BA 1QLNA 1JALA 3BS5B 2IHNA 2F1IA 1DGJA 2QB0B 3KHHA 4C8MA 2GLEA 4KMOB 1T8EA 3V7KA 4I2AA 2JEFA 4DL3A 3CRXA 2K8CB 4UAVA 1YZ7A 5AHXA 3WKCA 1S0OA 4OJLA 1NNLA 4QIWF 5CJ7A 3RR8A 3BJYA 5DQGA 3PMNA 3QZ8A 5DBCA 1KSPA 4PPXA 4DL7A 3ZD8A 3OJUA 2Y0SF 4QZ8A 4Z6CA 5DB7A 4RQ6A 5HR6A 2KKPA 2E8OA 5J2IA 3BDPA 5BOLA 5L1MA 2GO7A 2AQ0A 4DCCA 4U6PA 4KLQA 1ZQUA 3H4DA 5CR0A 4F5NA 3LYSA 1HIWA 3VC8A 4GFJA 3NUQA 5DLFA 2FPLA 7ICPA 4DS5A 3PR4A 2MUTB 1D8LA 2L5YA 4M0AA 4YXJA 1JN3A 4C0ZA 3PZPA 1C20A 1N2XA 5KFUA 3MDCA 4M2YA 3Q8QB 5KG7A 4DSFA 2BQRA 4O3SA 2HHWA 5JRTA 4X5VA 8ICPA 5EWEA 2IOHA 7ICUA 5HMLA 5DB6A 5CA7A 1L3UA 4KLDA 1RM6C 1ZQPA 4I27A 4Y2UA 3HILA 5ALDA 5KG2A 5KG1A 5J0QA 2V9WA 2NO4A 3C1YA 5EE9A 1V85A 3DV9A 1RYUA 4B9LA 4DL2A 1PUZA 1XSPA 2IHMA 4PH5A 4QJFB 9ICMA 1KKXA 3AN1A 2A19A 4U7CA 3E2EA 2EAMA 4KLEA 2JXJA 2W04A 3TAPA 1LKYA 2AHOB 4QW9A 3AQFA 1BPZA 4IR1A 4FFDA 3SR6A 4DQPA 9ICWA 2GH1A 4BWMA 2J6SA 5J8YC 5FP0A 5AK3A 3SMVA 4F93B 2ZIVB 5DGAA 4QWEA 3C5GA 1XS9D 5KFDA 3C21A 1SWVA 1A77A 4YMNA 3TKAA 2NO5A 4R66A 4M9JA 5CHGA 2QARA 1MQ3A 1B22A 1SGGA 5AM5A 4UAYA 1B0XA 3F2BA 4DOAA 3T5JA 3OHAA 3HP6A 5EE3A 2XICA 4YVZA 8ICLA 2C28A 2VANA 1XC9A 3G6XA 4NLCA 8ICXA 2ZXIA 5L1LA 4IQUA 1XO1A 3PO5A 1U49A 2ASDA 5DG7A 3M9MB 4PGQA 3Q8MA 4RQMA 8ICOA 4ECXA 9ICVA 3DDHA 3T79A 4O3QA 1N5XA 5KFWA 1KBUA 4QZDA 3RAXA 5KTQA 5J2DA 4Q44A 1L7MA 3NTUA 5EOZA 2W43A 5F9NA 5DB8A 2E3TA 3D2QA 3KHLA 3SZ2A 4GXKA 3ISCA 2DF4B 5ALKA 1S0NA 1UHUA 3N4MB 1XU4A 7ICOA 2MAXA 4R63A 4F4XA 3RJHA 5IIJA 1TFRA 2HBMA 5CB1A 1BVSA 3V6JA 4YMOA 3M8SA 3MFHA 5ALMA 2R8HA 4KN4A 2OYYA 3JPNA 5KFXA 2B21A 3PSPA 3SEIA 1N62A 5J0XA 1XWLA 4Y2YA 3PNCA 4TUPA 1OXJA 3AU6A 1DK3A 4P4MA 4B9MA 3NVYA 3PW0A 1KFTA 3GDXA 2K8BB 3QNMA 5J2KA 2W8KA 3ZDAA 3NVWA 4GC7A 2EDUA 4QZAA 2JGAA 1F5SA 1SZHA 5ALXA 3OHBA 9ICGA 1ED1A 3K1RB 3QX7A 4OJPA 2JR5A 4BUGA 1N60A 4XA5A 5F9LA 4C8KA 4Y2TA 5KG6A 2HMXA 2HHUA 2MSNA 4ECRA 2MA1A 4K4GA 5KFLA 4GC6A 4O5KA 4I2IA 4M6WA 4UATA 1L8OA 2W9CB 4RQ8A 2EZXA 4P0PA 3HX0A 1KLNA 2KHQA 4KLGA 3V6HA 4YR3A 3JPTA 3PW5A 3QUQA 4RQ0A 4RZRA 2W8LA 4I2HA 4IL6U 4R8UB 3GV5B 3WK4A 7ICNA 3PSFA 4PHEA 2DBYA 4PJ0U 5ALTA 4J9NA 5J2JA 3S6JA 3OPXA 4PZNA 3NVVA 2XCAA 3EW9A 2NYVA 2AGPA 2PI5A 5J2HA 2ALZA 5AKEA 4IR9A 1WYGA 2F1JA 5JUMA 3ONNA 4CE6A 3EZ5A 3OJSA 2HVIA 7ICRA 4Y2RA 2W9BA 3J81j 2B6GA 2RRDA 4QZBA 2DKXA 7ICGA 3ED5A 2E5SA 4YD1A 2EH9A 5ALWA 4KX3A 2G09A 2HI0A 3PR5B 4O3RA 5IIMA 2KZZA 4I2BA 4J9MA 2W3SA 4C4RA 4ECQA 3ZDEA 4DF4A 4O5CA 3E0FA 3PW2A 1NK4A 3RH4A 3RBEA 3RBDA 4BJQA 2R8JA 1IXRA 5HMMA 3F5AA 1SKRA 1NZBA 7ICIA 4YMMA 3IM1A 4J9LA 4KX5A 2KIWA 5EE1A 1ZQRA 3M6KA 3UM9A 3MR3A 1ZQGA 1ZD3A 3C28A 5BPCA 5KT4A 5BOMA 3G6YA 1RXVA 2ES6A 4RPYA 3ORYA 3CP8A 2OWOA 4Q43A 4GXIA 1Z3EB 5C0YA 4FZLA 5JU5A 4JV0A 4Q8FA 2HCFA 3IN5A 3LVVA 1Z4OA 3QZ7A 3RB0A 5KFJA 2XY6A 4C4TA 3FM9A 2LBOA 4QWBA 1AQ6A 5HP4A 1A76A 5KFRA 3UPQA 2KSOA 2E8NA 2KEYA 2OHFA 2F2AB 4NLGA 1QSLA 3H0MB 2EANA 3PSTA 8ICIA 2NRZA 3LWLA 4UQGA 1LB2B 2FPMA 2A1JB 2K4EA 3JPSA 3AL0B 4AP9A 1XNSA 3MR6A 1B43A 4R64A 5AKIA 3ISBA 2KZ3A 1VDVA 1D8YA 2K8AA 1K1QA 4RNOA 1Q3UA 3PW4A 5ALLA 5B66U 3PX0A 4JV2A 1OUQA 3WK5A 4ED7A 2XGPA 5DDYA 2ZIUA 2YY6A 2IBKA 2EZZA 4UB4A 2HHVA 2HOQA 2Y1IA 1TAMA 4JUZA 4F4ZA 4BXOA 2AJQA 5J0SA 2OXOA 4R65A 5HNKA 4UW9A 3PSIA 3GV8B 3A0HU 5AKXA 2JEIA 3BQ7A 4M9HA 4UBBA 3U26A 3OSNA 2HW3A 3GZFA 5K4LA 5T14A 5KL8B 4KLUA 2KTQA 5D49A 2RP5A 5ALHA 4RUAA 1NK7A 3RJEA 3MR2A 1LVHA 2FPKA 2CN1A 2XO7A 2ZUBA 1SKWA 9ICQA 2E8MA 5ALQA 1HUOA 1T3NA 4ICAA 2PI4A 5E79U 2RQ5A 4IRCA 4KLHA 3UQ0A 4YG2A 4ECVA 2BCQA 5A0LA 4F5RA 4RQ5A 1DGSA 3QE9Y 3RJIA 1ZD2P 5TZVA 2JMGA 8ICTA 5G5HA 3Q8SB 3PV8A 4IQWA 3LVWA 2CRXA 4F91B 2EQYA 3AUOA 5D4BA 2W54A 1RZTA 3BS5A 2HHXA 1XO0A 1H38A 2F8KA 2NV3A 2QB0A 2WAQC 8ICFA 1U9LA 5KG0A 3EPIA 4CF4A 3UMCA 9ICFA 4ED1A 3RR7A 2WHEA 2F44A 1L7OA 1HJPA 1NKEA 4CF5A 3L3FX 3JPQA 4JWMA 4C7YA 2UVRA 4J9RA 4M47A 5J2CA 4HYKA 4RQ3A 3PW7A 5KFKA 3H8WA 5KG3A 3BQ0A 2LYHA 4C8OA 5CRXA 2KHVA 1KRPA 4WJ3B 4EX7A 3B0XA 1NJXA 1BPDA 1Z19A 3C2KA 1TAUA 3JPRA 3V6KA 2VA8A 2YMLA 4RNMA 5GTHU 5CWRA 5TISU 5AI0A 5AM1A 2KN7A 3BQTA 4YXMA 4Y2SA 2W3RA 1ZQKA 4LJXA 1SL1A 2JEGA 2HDOA 4NL9C 4NL9A 2F77X 2J6TA 2KD1A 1S97A 3C2LA 2MUTA 4TURA 4MEXA 2VA3A 3IG8A 4O9MA 5AKLA 3SQIA 4QWCA 3EUB2 1V38A 4UASA 9ICJA 4YR0A 8ICAA 2JV3A 4DQRA 2VJ4A 5DKWA 2KKVA 5EE0A 1ZJMA 5KT2A 1UCVA 4C4SA 5L9XA 3UXPA 3AEVA 4NLKA 1S8OA 5KAIU 2FLPA 8ICHA 4KLTA 2EAOA 8ICEA 2AH5A 1PVPA 1L3VA 1VLBA 3N28A 5L1KA 2J6UA 5AM4A 2WF7A 3OSPA 3ZDDA 1YT3A 3F5EA 1TAQA 3G6VA 4MF8A 4YFKA 4UAWA 9ICSA 5JTIA 5AK5A 5AI8A 2H3FA 4GIBA 1S0VA 3L5KA 4MHVA 2YB1A 2ZTCA 4P2HA 5KFIA 1U45A 1O08A 5AKGA 2BZFA 4IQTA 1X6JA 2G0AA 2C2EA 2WF5A 2BCRA 2KOBA 2KE7A 2LYBA 5KFCA 3AM9A 4RUCA 3C1ZA 3CW2C 3H8JA 2ZIVA 7ICMA 1A0PA 4KLLA 4AYBC 5KNIA 4J9KA 2QB1A 2A3VA 4KLOA 4ED0A 3MFIA 3BZKA 3QU7A 2LM1A 5J8YA 5KT6A 3N7SC 5ALRA 3F53A 3ETRA 3OGUA 2FLNA 7ICJA 4G9BA 1ZQZA 2YB4A 1UPHA 2DQNB 3GIKA 3K4GA 4PHAA 2C2DA 2R18A 5KG4A 4EZ9A 5J0OA 3CYMA 4I2JA 2DKZA 3QYPA 4NV0A 5ALFA 3FDSA 7ICLA 2G08A 2ZJ8A 3TQ1A 3UXOA 2BDPA 2ASJA 1HEKA 3IP4B 2KNJA 2VJ5A 2E1FA 4I29A 3D6JA 2ZUDA 1ZRMA 4LZDA 4TUSA 5EWFA 1ZQVA 3Q8KA 1FFVA 4FBUA 4J03A 2DPJA 2XGQA 2PFQA 4QZGA 2ZIWB 2DUYA 4DS4A 4EBDA 4HAIA 8ICJA 2FJ6A 2HBLA 2BQ3A 1Q46A 1QCKA 1S77D 1U4BA 3F2DA 5AI6A 3NRZA 1N48A 4EZ6A 2KK0A 2WF8A 4NM1A 4EEYA 2K89A 1ZQMA 1ZQFA 1NK6A 4KITB 5DDMA 4UB1A 2W7PA 5DBAA 2NRVA 4ED3A 4FS1A 2JRZA 5J0TA 4BGDA 2BPCA 2ZJ5A 2W03A 3OTQA 2JZBB 4K4HA 4Q45A 3QEBZ 3RB3A 5J0WA 1HUZA 4B9NA 2VA2A 3PVXA 1ZQNA 2WF6A 1WCNA 4US8A 4OO1J 4UARA 1L7NA 4QZIA 3UMBA 4G3IA 1TV9A 4F2RA 5KFTA 2IMWP 5AM0A 2WAQF 1XSLA 4QWDA 2FE9A 4EBEA 2ESEA 9ICNA 3H8MA 1IV8A 4TUQA 2WF9A 4P4OA 2LKYA 2K4HA 3V72A 1FIQA 2C22A 2W11A 4Q8EA 2BPFA 1SL2A 1COOA 4OD0A 5IILA 4R8UA 3E58A 4ED2A 5AKYA 4OJ6A 2W7OA 3ICXA 5AKZA 5AI9A 1RXWA 3KD3A 2F8LA 4YCXA 8ICKA 4I2GA 4MFCA 3M7DA 8ICBA 2BCVA 4C7ZA 5AKHA 3RH6A 1JXLA 2AXTU 2HSZA 3ISDA 4FO6A 1DK2A 1UT5A 4DSLA 1ZQTA 4GLXA 2D3DA 1U48A 1N56A 4ZH4A 2Y1JA 4ED6A 2MRLA 4QZCA 2K4PA 4EENA 1DXSA 4TQRA 3MABA 3WU2U 7ICKA 2K60A 1Z00B 2I1QA 4BDPA 5HHHA 2YTUA 3M9OB 2CXYA 4C8LA 4ECUA 5DG9A 4EYIB 5KFEA 4DFJA 1J2NA 3QU9A 1QQ6A 2XC9A 3D2NA 4O3MA 4NLNA 1MA7A 2ZXHA 2K4IA 4ECZA 1MN8A 1Y88A 2Q0ZX 5G5GA 2V4QA 3RJJA 2LMRA 8ICNA 4DSEA 2AGOA 1X9WA 5KFPA 3FC4A 4YN4A 2WFAA 3AU2A 1B4FA 4DFMA 1NJYA 3IDWA 4OJ5A 2PFNA 2DGZA 2DWQA 4F3OA 2H3ZA 3PX6A 2RDIA 5KFMA 2XVTA 2KVCA 1NZPA 3I76A 1SIJA 3FAHA 7ICSA 2RLTA 1N61A 1TKDA 1L6NA 3TADC 5IIOA 3MBYA 1FEZA 3TADA 2ZIXB 4AYBF 1GO3F 5KFAA 4QZ9A 1IIPA 2KMDA 4EEKA 3MGIA 4KLSA 1K1SA 4DL5A 3THVA 1PK1B 5J2GA 2OEHA 4ELUA 3KFUF 3BZCA 3CNHA 3M9NB 4XRHA 4PL1A 3PX4A 4P0QB 7ICTA 4IRKA 3GQCA 1ZETA 1ZQDA 4CRXA 4F5OA 5KT7A 1JRPA 4UB6U 2PFPA 1IG6A 4RQ2A 2BQUA 4PHDA 3IG5A 3LDAA 1NK8A 3M1YA 3TANA 2DL0A 2FMSA 4PHPA 7ICFA 5ALNA 3RFAA 4QNLA 4J9SA 3AMZA 3QUCA 4CGZA 3NASA 5C5JA 2Y9UA 1BPBA 4US9A 4NXZA 1J2MA 1WUDA 1X2IA 1RYSA 2JH1A 2D6FC 2Y9TA 4DF8A 3N7RC 4JB3A 1SWWA 1NK0A 2G5HB 2LM4A 3RAQA 3I1YA 1N63A 1SZPA 5KFHA 3TFRA 2BKEA 1BNOA 3MR5A 2NRTA 2JH7A 9ICHA 1X9XA 5KFBA 2DFLA 4DLEA 4UB3A 4MEYA 1QQ7A 1D9DA 4NWIA 4FE3A 4F72A 4CNQA 4P4PA 4IS7A 2YMQA 8ICWA 5AK4A 5L1JA 3MDAA 4FZMA 4KLJA 3V7LA 4F4YA 3SYZA 2AU0A 3N97B 4RT3A 4PGYA 2WTFA 3RJFA 3GIIA 3QUBA 1ECWA 5KFFA 5EWGA 4J9PA 2VIXA 8ICVA 2ZTDA 3SENA 2I5HA 4NM2A 1SXDA 1RQLA 3AQEA 2FDRA 2OH2A 2GOLA 2BDUA 2PKEA 5ALZA 2XIDA 1X9MA 1K5OA 4RT2A 1F0MA 2GWSA 3RJKA 2UVUA 1KTQA 1JX4A 5ALVA 1UQVA 2BHNA 3PMLA 1RDFA 4F5PA 3QXGA 2FI1A 1S9FA 4Z6FA 1SV4A 3SAGA 3VCBA 3T5LA 4FZNA 7ICHA 9ICEA 8ICMA 1NKCA 9ICAA 2HOIA 4LZGA 4DQQA 7ICVA 1UA0A 1UA1A 4ELVA 1CEZA 2P66A 4B9UA 1M6YA 2LYAA 2F1HA 1D9FA 3KKAC 2JHDA 5ALIA 4QZHA 3KKAA 2KV2A 3QU5A 3LWMA 8ICRA 1BGXT 5KFSA 9ICXA 2MU2A 4FBTA 4I2DA 1ZQWA 3TFSA 5ALYA 5AKKA 5J29A 3EWAA 1ZD5A 3LK9A 1KEJA 2D8CA 4O3PA 1RYRA 1Q3VA 3SD7A 1JUDA 2HHSA 2YQEA 3HJEA 3QU2A 4DQIA 1URJA 2KJ5A 2H5XA 5IIKA 3MGHA 3WK8A 4DO9A 4KLFA 1COKA 1J97A 1NI3A 5CP2A 1A6SA 4CDGA 1ZQYA 1N5WA 2I9GA 5H2FU 8ICYA 2KJ8A 4A8EA 2OCEA 3RTVA 4J9QA 3WKDA 4RPZA 4DOCA 5KFZA 1T4GA 5F3XB 5J2AA 3N7PD 3SAHA 4F4KA 4BX9C 5KFGA 4Z6DA 1TVAA 5AM3A 4OJOA 2HHQA 4DFDA 3ALRA 3IV6A 3KHGA 3WK7A 1Z4NA 5DGBA 3C5FA 9ICKA 1QSYA 3UQ2A 2RHFA 3JPOA 2N1RA 4LVSA 2OM6A 5GTIU 3KBBA 9ICCA 2ODGA 2LPEA 5HR7A 3RRGA 9ICIA 5AKJA 3UMGA 2ASLA 4I2CA 1DOQA 2BPGA 1ZQHA 5AIAA 3ZDCA 5ALPA 2LI6A 1FO4A 5HHIA 5DQIA 4DSKA 5IINA 4ZOHC 4J9OA 1S76D 4UBCA 5ALGA 4NJ8A 4GXJA 4C8NA 2YMMA 2KFNA 5ALUA 5AK6A 4C80A 4DWIA 1LKYB 4QZFA 2YX8A 4IRDA 2XCPA 2IA6A 4DL4A 3KTQA 2IOFA 3BQ1A 5J0YA 2AQ4A 3M8RA 4Y2VA 2M9NA 2AGQA 3QEAZ 2HBKA 2UVWA 3GILA 3L4PA 5KL1B 2KIVA 3FYHA 4USAA 2ZIWA 4M04A 2QARB 5J0PA 3M6ZA 3K1ZA 2HOFA 1KL9A 4DFKA 1JI7A 1S5LU 1C7YA 1X6IA 4KLIA 3ZD9A 1KFDA 3WK6A 3WKAA 3KZXA 5AM2A 3WKEA 3H0LB 2CPRA 5ALOA 2ZG6A 5KFOA 2ISPA 1PK3A 5B5EU 3NVZA 4Y2QA 2C2RA 2A1AA 3D2SA 1VJ5A 3K75D 3RF9A 4M9GA 1NK5A 8ICSA 2VKQA 1T3QA 3TI0A 4MF2A 2ZJAA 3HRDD 4DOBA 1KFSA 2KVSA 2JZBA 4XUSA 4IC9A 4YD2A 2FLLA 5KFVA 1PVRA 3QU4A 2NRWA 5AI5A 2XI9A 1ZJNA 1CI4A 4M9LA 4ECSA 1JIHA 2LHTA 2G5IB 3TACB 1MC8A 4NLBA 9ICOA 4RU9A 2R8IA 3PY8A 1KQQA 3RH5A 3KOOA 4RQ4A 3EPGA 4F5QA 1ZQXA 1L8LA 4Y2XA 3NGDA 3ZI4A 2KP7A 1NJWA 2H3QA 3RB4A 1RQNA 1ZQBA 5KAFU 1ZQEA 3B0YA 2WB1C 1T7PA 5KFYA 5J2FA 5KT5A 4O3OA 2BCUA 1S0MA 1YZ6A 2Z7JA 4PGXA 3HKZC 3Q8LA 4UB2A 4CF3A 2W9CA 7ICQA 4EX6A 1NOMA 3H40A 4B6JA 1KN5A 3A0BU 1ZOLA 1ZQAA 4I2FA 1NK9A 4PL2A 4NY8A 4O3NA 2BCSA 2PMZC 1ZQIA 5ALEA 4QWAA 1P7DA 3QUTA 5CEHA 4F71A 4DEZA 4JV1A 3RJGA 1ZQ1C 9ICTA 4MFAA 1JROA 1DRGA 4O5EA 3RB6A 1FFUA 4EYHB 1ZQSA 4I2EA 1TK5A 4RQNA 2UVVA 1WG8A 2DPIA 4M6WB 4O0IA 9ICRA 4B9VA 2YN4A 3HT3A 3MC1A 2Q4TA 4QIWC 2FMPA 3GIMA 4P0PB 1EXNA 4CCHA 2F3NA 2E8PA 1Z00A 2EZYA 2P6RA 3TAQA 3IHQB 8ICGA 5KG5A 3DEEA 1RG6A 2Y0SC 4DFPA 5L1IA 4IQVA 3HW8A 3NS1A 4QZEA 2PXIA 3V7JA 4ECYA 4Y2PA 3HPOA 4RPXA 1ZXIA 4RQ1A 1TK0A 2W55A 3JPPA 4KN7A 2E1EA 1ZD4A 4UAZA 1IM4A 2H3IA 1S10A 1WCLA 1QQ5A 3T3FA 3HWTA 2M0NA 5DB9A 3ETLA 1BPYA 2W9BB 2FMQA 4F92B 5AIBA 2IOFK 1ZQLA 3NRWA 4ECWA 4ECTA 3SV4A 4I28A 4FS2A 5DBBA 3WKBA 4DSJA 2P35A 1SXEA 1QH9A 1MQ2A 2KICA 4JMUA 1X40A 2ZIXA 3GU3A 5DG8A 2BR0A 5D46A 3TARA 2NRXA 3T5KA 5J0UA 3KHRA 3PO4A 8ICCA 2QKQA 3SI8A 4YQWA 4TQSA 1KW4A 2QLTA 1U47A 1CRXA 4KTQA 1PK1A 1TK8A 3F2CA 4NLZA 2ATLA 5AICA 2P6UA 4P0QA 4XQ8A 4DSIA 1PVQA 2XY7A 9ICUA 2A1JA 4MFFA 2KFZA 3ZDBA 1BNPA 3R9KA 3GIJA 2I6XA 3C29A 1OW5A 2BGWA 2HVHA 4B9SA 1UT8A 2KJ9A 1BPXA 4F2SA 4JWNA 2HBJA 2G06A 3KZIU 3SV3A 1ZQOA 5DLGA 4EELA 1L5UA 1L3TA 2H3VA 2PFOA 1TE2A
chains in the Genus database with same CATH topology
2O6KA 2FJ6A 2KVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6K A;  2FJ6 A;  2KVS A; 
#chains in the Genus database with same CATH topology
 1XSN A;  1ZYQ A;  3I28 A;  2KSO B;  4F4W A;  4PZO A;  2ZUC A;  1Z1B A;  5KT3 A;  4BWJ A;  1L3S A;  8ICZ A;  1NJZ A;  1SB3 C;  1LV5 A;  2JEJ A;  4OCZ A;  4F50 A;  5ALJ A;  5KFN A;  4DL6 A;  1ZQJ A;  1Q8K A;  1V97 A;  3H0R B;  4K4I A;  1ZQQ A;  3IRU A;  2ISO A;  4ED8 A;  5ALS A;  3T5H A;  2KZM A;  3WK9 A;  4YR2 A;  3EYZ A;  1O03 A;  1KDH A;  5J2E A;  3H8S A;  7ICE A;  1D8B A;  1F44 A;  8ICU A;  3Q8P B;  1Z1V A;  4UB8 U;  1ZQC A;  9ICB A;  1BPE A;  1CUK A;  3Q8R B;  2B0C A;  2ZIU B;  1QTM A;  4B9T A;  2ZTE A;  4Y2J A;  4UAU A;  1ARO P;  4M9N A;  4BXO B;  3GFK B;  4DQS A;  9ICP A;  4ACO A;  2R8K A;  2EAP A;  1JXE A;  2R8G A;  4E0D A;  3H4B A;  4EBC A;  3O0F A;  2HHT A;  1MSW D;  3BQ2 A;  4RQ7 A;  2W9A A;  1NKB A;  3GV7 B;  3H7I A;  3C2M A;  5III A;  5J0R A;  2YMP A;  2RDJ A;  1QSS A;  1ZRN A;  4DLG A;  1X42 A;  1WWU A;  3UXN A;  2WB1 F;  2G07 A;  4RNN A;  1X66 A;  2XY5 A;  1X9S A;  5KFQ A;  3MGV A;  4KMU A;  1SV0 C;  4F8R A;  2KG5 A;  3HKZ F;  1SV0 A;  1SKS A;  1PZN A;  3RRH A;  1JMS A;  4UB5 A;  8ICQ A;  2V4R A;  1SL0 A;  1T94 A;  1RPL A;  2O6K A;  4ELT A;  2F76 X;  2W9M A;  4QW8 A;  4JK1 A;  4Z6E A;  3SAF A;  9ICL A;  1L7P A;  4YP3 A;  3BS7 A;  5AI4 A;  2PMZ F;  3B9J A;  3C23 A;  4KLM A;  5DQH A;  1WWV A;  1V9P A;  5J2B A;  1QLN A;  1JAL A;  3BS5 B;  2IHN A;  2F1I A;  1DGJ A;  2QB0 B;  3KHH A;  4C8M A;  2GLE A;  4KMO B;  1T8E A;  3V7K A;  4I2A A;  2JEF A;  4DL3 A;  3CRX A;  2K8C B;  4UAV A;  1YZ7 A;  5AHX A;  3WKC A;  1S0O A;  4OJL A;  1NNL A;  4QIW F;  5CJ7 A;  3RR8 A;  3BJY A;  5DQG A;  3PMN A;  3QZ8 A;  5DBC A;  1KSP A;  4PPX A;  4DL7 A;  3ZD8 A;  3OJU A;  2Y0S F;  4QZ8 A;  4Z6C A;  5DB7 A;  4RQ6 A;  5HR6 A;  2KKP A;  2E8O A;  5J2I A;  3BDP A;  5BOL A;  5L1M A;  2GO7 A;  2AQ0 A;  4DCC A;  4U6P A;  4KLQ A;  1ZQU A;  3H4D A;  5CR0 A;  4F5N A;  3LYS A;  1HIW A;  3VC8 A;  4GFJ A;  3NUQ A;  5DLF A;  2FPL A;  7ICP A;  4DS5 A;  3PR4 A;  2MUT B;  1D8L A;  2L5Y A;  4M0A A;  4YXJ A;  1JN3 A;  4C0Z A;  3PZP A;  1C20 A;  1N2X A;  5KFU A;  3MDC A;  4M2Y A;  3Q8Q B;  5KG7 A;  4DSF A;  2BQR A;  4O3S A;  2HHW A;  5JRT A;  4X5V A;  8ICP A;  5EWE A;  2IOH A;  7ICU A;  5HML A;  5DB6 A;  5CA7 A;  1L3U A;  4KLD A;  1RM6 C;  1ZQP A;  4I27 A;  4Y2U A;  3HIL A;  5ALD A;  5KG2 A;  5KG1 A;  5J0Q A;  2V9W A;  2NO4 A;  3C1Y A;  5EE9 A;  1V85 A;  3DV9 A;  1RYU A;  4B9L A;  4DL2 A;  1PUZ A;  1XSP A;  2IHM A;  4PH5 A;  4QJF B;  9ICM A;  1KKX A;  3AN1 A;  2A19 A;  4U7C A;  3E2E A;  2EAM A;  4KLE A;  2JXJ A;  2W04 A;  3TAP A;  1LKY A;  2AHO B;  4QW9 A;  3AQF A;  1BPZ A;  4IR1 A;  4FFD A;  3SR6 A;  4DQP A;  9ICW A;  2GH1 A;  4BWM A;  2J6S A;  5J8Y C;  5FP0 A;  5AK3 A;  3SMV A;  4F93 B;  2ZIV B;  5DGA A;  4QWE A;  3C5G A;  1XS9 D;  5KFD A;  3C21 A;  1SWV A;  1A77 A;  4YMN A;  3TKA A;  2NO5 A;  4R66 A;  4M9J A;  5CHG A;  2QAR A;  1MQ3 A;  1B22 A;  1SGG A;  5AM5 A;  4UAY A;  1B0X A;  3F2B A;  4DOA A;  3T5J A;  3OHA A;  3HP6 A;  5EE3 A;  2XIC A;  4YVZ A;  8ICL A;  2C28 A;  2VAN A;  1XC9 A;  3G6X A;  4NLC A;  8ICX A;  2ZXI A;  5L1L A;  4IQU A;  1XO1 A;  3PO5 A;  1U49 A;  2ASD A;  5DG7 A;  3M9M B;  4PGQ A;  3Q8M A;  4RQM A;  8ICO A;  4ECX A;  9ICV A;  3DDH A;  3T79 A;  4O3Q A;  1N5X A;  5KFW A;  1KBU A;  4QZD A;  3RAX A;  5KTQ A;  5J2D A;  4Q44 A;  1L7M A;  3NTU A;  5EOZ A;  2W43 A;  5F9N A;  5DB8 A;  2E3T A;  3D2Q A;  3KHL A;  3SZ2 A;  4GXK A;  3ISC A;  2DF4 B;  5ALK A;  1S0N A;  1UHU A;  3N4M B;  1XU4 A;  7ICO A;  2MAX A;  4R63 A;  4F4X A;  3RJH A;  5IIJ A;  1TFR A;  2HBM A;  5CB1 A;  1BVS A;  3V6J A;  4YMO A;  3M8S A;  3MFH A;  5ALM A;  2R8H A;  4KN4 A;  2OYY A;  3JPN A;  5KFX A;  2B21 A;  3PSP A;  3SEI A;  1N62 A;  5J0X A;  1XWL A;  4Y2Y A;  3PNC A;  4TUP A;  1OXJ A;  3AU6 A;  1DK3 A;  4P4M A;  4B9M A;  3NVY A;  3PW0 A;  1KFT A;  3GDX A;  2K8B B;  3QNM A;  5J2K A;  2W8K A;  3ZDA A;  3NVW A;  4GC7 A;  2EDU A;  4QZA A;  2JGA A;  1F5S A;  1SZH A;  5ALX A;  3OHB A;  9ICG A;  1ED1 A;  3K1R B;  3QX7 A;  4OJP A;  2JR5 A;  4BUG A;  1N60 A;  4XA5 A;  5F9L A;  4C8K A;  4Y2T A;  5KG6 A;  2HMX A;  2HHU A;  2MSN A;  4ECR A;  2MA1 A;  4K4G A;  5KFL A;  4GC6 A;  4O5K A;  4I2I A;  4M6W A;  4UAT A;  1L8O A;  2W9C B;  4RQ8 A;  2EZX A;  4P0P A;  3HX0 A;  1KLN A;  2KHQ A;  4KLG A;  3V6H A;  4YR3 A;  3JPT A;  3PW5 A;  3QUQ A;  4RQ0 A;  4RZR A;  2W8L A;  4I2H A;  4IL6 U;  4R8U B;  3GV5 B;  3WK4 A;  7ICN A;  3PSF A;  4PHE A;  2DBY A;  4PJ0 U;  5ALT A;  4J9N A;  5J2J A;  3S6J A;  3OPX A;  4PZN A;  3NVV A;  2XCA A;  3EW9 A;  2NYV A;  2AGP A;  2PI5 A;  5J2H A;  2ALZ A;  5AKE A;  4IR9 A;  1WYG A;  2F1J A;  5JUM A;  3ONN A;  4CE6 A;  3EZ5 A;  3OJS A;  2HVI A;  7ICR A;  4Y2R A;  2W9B A;  3J81 j;  2B6G A;  2RRD A;  4QZB A;  2DKX A;  7ICG A;  3ED5 A;  2E5S A;  4YD1 A;  2EH9 A;  5ALW A;  4KX3 A;  2G09 A;  2HI0 A;  3PR5 B;  4O3R A;  5IIM A;  2KZZ A;  4I2B A;  4J9M A;  2W3S A;  4C4R A;  4ECQ A;  3ZDE A;  4DF4 A;  4O5C A;  3E0F A;  3PW2 A;  1NK4 A;  3RH4 A;  3RBE A;  3RBD A;  4BJQ A;  2R8J A;  1IXR A;  5HMM A;  3F5A A;  1SKR A;  1NZB A;  7ICI A;  4YMM A;  3IM1 A;  4J9L A;  4KX5 A;  2KIW A;  5EE1 A;  1ZQR A;  3M6K A;  3UM9 A;  3MR3 A;  1ZQG A;  1ZD3 A;  3C28 A;  5BPC A;  5KT4 A;  5BOM A;  3G6Y A;  1RXV A;  2ES6 A;  4RPY A;  3ORY A;  3CP8 A;  2OWO A;  4Q43 A;  4GXI A;  1Z3E B;  5C0Y A;  4FZL A;  5JU5 A;  4JV0 A;  4Q8F A;  2HCF A;  3IN5 A;  3LVV A;  1Z4O A;  3QZ7 A;  3RB0 A;  5KFJ A;  2XY6 A;  4C4T A;  3FM9 A;  2LBO A;  4QWB A;  1AQ6 A;  5HP4 A;  1A76 A;  5KFR A;  3UPQ A;  2KSO A;  2E8N A;  2KEY A;  2OHF A;  2F2A B;  4NLG A;  1QSL A;  3H0M B;  2EAN A;  3PST A;  8ICI A;  2NRZ A;  3LWL A;  4UQG A;  1LB2 B;  2FPM A;  2A1J B;  2K4E A;  3JPS A;  3AL0 B;  4AP9 A;  1XNS A;  3MR6 A;  1B43 A;  4R64 A;  5AKI A;  3ISB A;  2KZ3 A;  1VDV A;  1D8Y A;  2K8A A;  1K1Q A;  4RNO A;  1Q3U A;  3PW4 A;  5ALL A;  5B66 U;  3PX0 A;  4JV2 A;  1OUQ A;  3WK5 A;  4ED7 A;  2XGP A;  5DDY A;  2ZIU A;  2YY6 A;  2IBK A;  2EZZ A;  4UB4 A;  2HHV A;  2HOQ A;  2Y1I A;  1TAM A;  4JUZ A;  4F4Z A;  4BXO A;  2AJQ A;  5J0S A;  2OXO A;  4R65 A;  5HNK A;  4UW9 A;  3PSI A;  3GV8 B;  3A0H U;  5AKX A;  2JEI A;  3BQ7 A;  4M9H A;  4UBB A;  3U26 A;  3OSN A;  2HW3 A;  3GZF A;  5K4L A;  5T14 A;  5KL8 B;  4KLU A;  2KTQ A;  5D49 A;  2RP5 A;  5ALH A;  4RUA A;  1NK7 A;  3RJE A;  3MR2 A;  1LVH A;  2FPK A;  2CN1 A;  2XO7 A;  2ZUB A;  1SKW A;  9ICQ A;  2E8M A;  5ALQ A;  1HUO A;  1T3N A;  4ICA A;  2PI4 A;  5E79 U;  2RQ5 A;  4IRC A;  4KLH A;  3UQ0 A;  4YG2 A;  4ECV A;  2BCQ A;  5A0L A;  4F5R A;  4RQ5 A;  1DGS A;  3QE9 Y;  3RJI A;  1ZD2 P;  5TZV A;  2JMG A;  8ICT A;  5G5H A;  3Q8S B;  3PV8 A;  4IQW A;  3LVW A;  2CRX A;  4F91 B;  2EQY A;  3AUO A;  5D4B A;  2W54 A;  1RZT A;  3BS5 A;  2HHX A;  1XO0 A;  1H38 A;  2F8K A;  2NV3 A;  2QB0 A;  2WAQ C;  8ICF A;  1U9L A;  5KG0 A;  3EPI A;  4CF4 A;  3UMC A;  9ICF A;  4ED1 A;  3RR7 A;  2WHE A;  2F44 A;  1L7O A;  1HJP A;  1NKE A;  4CF5 A;  3L3F X;  3JPQ A;  4JWM A;  4C7Y A;  2UVR A;  4J9R A;  4M47 A;  5J2C A;  4HYK A;  4RQ3 A;  3PW7 A;  5KFK A;  3H8W A;  5KG3 A;  3BQ0 A;  2LYH A;  4C8O A;  5CRX A;  2KHV A;  1KRP A;  4WJ3 B;  4EX7 A;  3B0X A;  1NJX A;  1BPD A;  1Z19 A;  3C2K A;  1TAU A;  3JPR A;  3V6K A;  2VA8 A;  2YML A;  4RNM A;  5GTH U;  5CWR A;  5TIS U;  5AI0 A;  5AM1 A;  2KN7 A;  3BQT A;  4YXM A;  4Y2S A;  2W3R A;  1ZQK A;  4LJX A;  1SL1 A;  2JEG A;  2HDO A;  4NL9 C;  4NL9 A;  2F77 X;  2J6T A;  2KD1 A;  1S97 A;  3C2L A;  2MUT A;  4TUR A;  4MEX A;  2VA3 A;  3IG8 A;  4O9M A;  5AKL A;  3SQI A;  4QWC A;  3EUB 2;  1V38 A;  4UAS A;  9ICJ A;  4YR0 A;  8ICA A;  2JV3 A;  4DQR A;  2VJ4 A;  5DKW A;  2KKV A;  5EE0 A;  1ZJM A;  5KT2 A;  1UCV A;  4C4S A;  5L9X A;  3UXP A;  3AEV A;  4NLK A;  1S8O A;  5KAI U;  2FLP A;  8ICH A;  4KLT A;  2EAO A;  8ICE A;  2AH5 A;  1PVP A;  1L3V A;  1VLB A;  3N28 A;  5L1K A;  2J6U A;  5AM4 A;  2WF7 A;  3OSP A;  3ZDD A;  1YT3 A;  3F5E A;  1TAQ A;  3G6V A;  4MF8 A;  4YFK A;  4UAW A;  9ICS A;  5JTI A;  5AK5 A;  5AI8 A;  2H3F A;  4GIB A;  1S0V A;  3L5K A;  4MHV A;  2YB1 A;  2ZTC A;  4P2H A;  5KFI A;  1U45 A;  1O08 A;  5AKG A;  2BZF A;  4IQT A;  1X6J A;  2G0A A;  2C2E A;  2WF5 A;  2BCR A;  2KOB A;  2KE7 A;  2LYB A;  5KFC A;  3AM9 A;  4RUC A;  3C1Z A;  3CW2 C;  3H8J A;  2ZIV A;  7ICM A;  1A0P A;  4KLL A;  4AYB C;  5KNI A;  4J9K A;  2QB1 A;  2A3V A;  4KLO A;  4ED0 A;  3MFI A;  3BZK A;  3QU7 A;  2LM1 A;  5J8Y A;  5KT6 A;  3N7S C;  5ALR A;  3F53 A;  3ETR A;  3OGU A;  2FLN A;  7ICJ A;  4G9B A;  1ZQZ A;  2YB4 A;  1UPH A;  2DQN B;  3GIK A;  3K4G A;  4PHA A;  2C2D A;  2R18 A;  5KG4 A;  4EZ9 A;  5J0O A;  3CYM A;  4I2J A;  2DKZ A;  3QYP A;  4NV0 A;  5ALF A;  3FDS A;  7ICL A;  2G08 A;  2ZJ8 A;  3TQ1 A;  3UXO A;  2BDP A;  2ASJ A;  1HEK A;  3IP4 B;  2KNJ A;  2VJ5 A;  2E1F A;  4I29 A;  3D6J A;  2ZUD A;  1ZRM A;  4LZD A;  4TUS A;  5EWF A;  1ZQV A;  3Q8K A;  1FFV A;  4FBU A;  4J03 A;  2DPJ A;  2XGQ A;  2PFQ A;  4QZG A;  2ZIW B;  2DUY A;  4DS4 A;  4EBD A;  4HAI A;  8ICJ A;  2FJ6 A;  2HBL A;  2BQ3 A;  1Q46 A;  1QCK A;  1S77 D;  1U4B A;  3F2D A;  5AI6 A;  3NRZ A;  1N48 A;  4EZ6 A;  2KK0 A;  2WF8 A;  4NM1 A;  4EEY A;  2K89 A;  1ZQM A;  1ZQF A;  1NK6 A;  4KIT B;  5DDM A;  4UB1 A;  2W7P A;  5DBA A;  2NRV A;  4ED3 A;  4FS1 A;  2JRZ A;  5J0T A;  4BGD A;  2BPC A;  2ZJ5 A;  2W03 A;  3OTQ A;  2JZB B;  4K4H A;  4Q45 A;  3QEB Z;  3RB3 A;  5J0W A;  1HUZ A;  4B9N A;  2VA2 A;  3PVX A;  1ZQN A;  2WF6 A;  1WCN A;  4US8 A;  4OO1 J;  4UAR A;  1L7N A;  4QZI A;  3UMB A;  4G3I A;  1TV9 A;  4F2R A;  5KFT A;  2IMW P;  5AM0 A;  2WAQ F;  1XSL A;  4QWD A;  2FE9 A;  4EBE A;  2ESE A;  9ICN A;  3H8M A;  1IV8 A;  4TUQ A;  2WF9 A;  4P4O A;  2LKY A;  2K4H A;  3V72 A;  1FIQ A;  2C22 A;  2W11 A;  4Q8E A;  2BPF A;  1SL2 A;  1COO A;  4OD0 A;  5IIL A;  4R8U A;  3E58 A;  4ED2 A;  5AKY A;  4OJ6 A;  2W7O A;  3ICX A;  5AKZ A;  5AI9 A;  1RXW A;  3KD3 A;  2F8L A;  4YCX A;  8ICK A;  4I2G A;  4MFC A;  3M7D A;  8ICB A;  2BCV A;  4C7Z A;  5AKH A;  3RH6 A;  1JXL A;  2AXT U;  2HSZ A;  3ISD A;  4FO6 A;  1DK2 A;  1UT5 A;  4DSL A;  1ZQT A;  4GLX A;  2D3D A;  1U48 A;  1N56 A;  4ZH4 A;  2Y1J A;  4ED6 A;  2MRL A;  4QZC A;  2K4P A;  4EEN A;  1DXS A;  4TQR A;  3MAB A;  3WU2 U;  7ICK A;  2K60 A;  1Z00 B;  2I1Q A;  4BDP A;  5HHH A;  2YTU A;  3M9O B;  2CXY A;  4C8L A;  4ECU A;  5DG9 A;  4EYI B;  5KFE A;  4DFJ A;  1J2N A;  3QU9 A;  1QQ6 A;  2XC9 A;  3D2N A;  4O3M A;  4NLN A;  1MA7 A;  2ZXH A;  2K4I A;  4ECZ A;  1MN8 A;  1Y88 A;  2Q0Z X;  5G5G A;  2V4Q A;  3RJJ A;  2LMR A;  8ICN A;  4DSE A;  2AGO A;  1X9W A;  5KFP A;  3FC4 A;  4YN4 A;  2WFA A;  3AU2 A;  1B4F A;  4DFM A;  1NJY A;  3IDW A;  4OJ5 A;  2PFN A;  2DGZ A;  2DWQ A;  4F3O A;  2H3Z A;  3PX6 A;  2RDI A;  5KFM A;  2XVT A;  2KVC A;  1NZP A;  3I76 A;  1SIJ A;  3FAH A;  7ICS A;  2RLT A;  1N61 A;  1TKD A;  1L6N A;  3TAD C;  5IIO A;  3MBY A;  1FEZ A;  3TAD A;  2ZIX B;  4AYB F;  1GO3 F;  5KFA A;  4QZ9 A;  1IIP A;  2KMD A;  4EEK A;  3MGI A;  4KLS A;  1K1S A;  4DL5 A;  3THV A;  1PK1 B;  5J2G A;  2OEH A;  4ELU A;  3KFU F;  3BZC A;  3CNH A;  3M9N B;  4XRH A;  4PL1 A;  3PX4 A;  4P0Q B;  7ICT A;  4IRK A;  3GQC A;  1ZET A;  1ZQD A;  4CRX A;  4F5O A;  5KT7 A;  1JRP A;  4UB6 U;  2PFP A;  1IG6 A;  4RQ2 A;  2BQU A;  4PHD A;  3IG5 A;  3LDA A;  1NK8 A;  3M1Y A;  3TAN A;  2DL0 A;  2FMS A;  4PHP A;  7ICF A;  5ALN A;  3RFA A;  4QNL A;  4J9S A;  3AMZ A;  3QUC A;  4CGZ A;  3NAS A;  5C5J A;  2Y9U A;  1BPB A;  4US9 A;  4NXZ A;  1J2M A;  1WUD A;  1X2I A;  1RYS A;  2JH1 A;  2D6F C;  2Y9T A;  4DF8 A;  3N7R C;  4JB3 A;  1SWW A;  1NK0 A;  2G5H B;  2LM4 A;  3RAQ A;  3I1Y A;  1N63 A;  1SZP A;  5KFH A;  3TFR A;  2BKE A;  1BNO A;  3MR5 A;  2NRT A;  2JH7 A;  9ICH A;  1X9X A;  5KFB A;  2DFL A;  4DLE A;  4UB3 A;  4MEY A;  1QQ7 A;  1D9D A;  4NWI A;  4FE3 A;  4F72 A;  4CNQ A;  4P4P A;  4IS7 A;  2YMQ A;  8ICW A;  5AK4 A;  5L1J A;  3MDA A;  4FZM A;  4KLJ A;  3V7L A;  4F4Y A;  3SYZ A;  2AU0 A;  3N97 B;  4RT3 A;  4PGY A;  2WTF A;  3RJF A;  3GII A;  3QUB A;  1ECW A;  5KFF A;  5EWG A;  4J9P A;  2VIX A;  8ICV A;  2ZTD A;  3SEN A;  2I5H A;  4NM2 A;  1SXD A;  1RQL A;  3AQE A;  2FDR A;  2OH2 A;  2GOL A;  2BDU A;  2PKE A;  5ALZ A;  2XID A;  1X9M A;  1K5O A;  4RT2 A;  1F0M A;  2GWS A;  3RJK A;  2UVU A;  1KTQ A;  1JX4 A;  5ALV A;  1UQV A;  2BHN A;  3PML A;  1RDF A;  4F5P A;  3QXG A;  2FI1 A;  1S9F A;  4Z6F A;  1SV4 A;  3SAG A;  3VCB A;  3T5L A;  4FZN A;  7ICH A;  9ICE A;  8ICM A;  1NKC A;  9ICA A;  2HOI A;  4LZG A;  4DQQ A;  7ICV A;  1UA0 A;  1UA1 A;  4ELV A;  1CEZ A;  2P66 A;  4B9U A;  1M6Y A;  2LYA A;  2F1H A;  1D9F A;  3KKA C;  2JHD A;  5ALI A;  4QZH A;  3KKA A;  2KV2 A;  3QU5 A;  3LWM A;  8ICR A;  1BGX T;  5KFS A;  9ICX A;  2MU2 A;  4FBT A;  4I2D A;  1ZQW A;  3TFS A;  5ALY A;  5AKK A;  5J29 A;  3EWA A;  1ZD5 A;  3LK9 A;  1KEJ A;  2D8C A;  4O3P A;  1RYR A;  1Q3V A;  3SD7 A;  1JUD A;  2HHS A;  2YQE A;  3HJE A;  3QU2 A;  4DQI A;  1URJ A;  2KJ5 A;  2H5X A;  5IIK A;  3MGH A;  3WK8 A;  4DO9 A;  4KLF A;  1COK A;  1J97 A;  1NI3 A;  5CP2 A;  1A6S A;  4CDG A;  1ZQY A;  1N5W A;  2I9G A;  5H2F U;  8ICY A;  2KJ8 A;  4A8E A;  2OCE A;  3RTV A;  4J9Q A;  3WKD A;  4RPZ A;  4DOC A;  5KFZ A;  1T4G A;  5F3X B;  5J2A A;  3N7P D;  3SAH A;  4F4K A;  4BX9 C;  5KFG A;  4Z6D A;  1TVA A;  5AM3 A;  4OJO A;  2HHQ A;  4DFD A;  3ALR A;  3IV6 A;  3KHG A;  3WK7 A;  1Z4N A;  5DGB A;  3C5F A;  9ICK A;  1QSY A;  3UQ2 A;  2RHF A;  3JPO A;  2N1R A;  4LVS A;  2OM6 A;  5GTI U;  3KBB A;  9ICC A;  2ODG A;  2LPE A;  5HR7 A;  3RRG A;  9ICI A;  5AKJ A;  3UMG A;  2ASL A;  4I2C A;  1DOQ A;  2BPG A;  1ZQH A;  5AIA A;  3ZDC A;  5ALP A;  2LI6 A;  1FO4 A;  5HHI A;  5DQI A;  4DSK A;  5IIN A;  4ZOH C;  4J9O A;  1S76 D;  4UBC A;  5ALG A;  4NJ8 A;  4GXJ A;  4C8N A;  2YMM A;  2KFN A;  5ALU A;  5AK6 A;  4C80 A;  4DWI A;  1LKY B;  4QZF A;  2YX8 A;  4IRD A;  2XCP A;  2IA6 A;  4DL4 A;  3KTQ A;  2IOF A;  3BQ1 A;  5J0Y A;  2AQ4 A;  3M8R A;  4Y2V A;  2M9N A;  2AGQ A;  3QEA Z;  2HBK A;  2UVW A;  3GIL A;  3L4P A;  5KL1 B;  2KIV A;  3FYH A;  4USA A;  2ZIW A;  4M04 A;  2QAR B;  5J0P A;  3M6Z A;  3K1Z A;  2HOF A;  1KL9 A;  4DFK A;  1JI7 A;  1S5L U;  1C7Y A;  1X6I A;  4KLI A;  3ZD9 A;  1KFD A;  3WK6 A;  3WKA A;  3KZX A;  5AM2 A;  3WKE A;  3H0L B;  2CPR A;  5ALO A;  2ZG6 A;  5KFO A;  2ISP A;  1PK3 A;  5B5E U;  3NVZ A;  4Y2Q A;  2C2R A;  2A1A A;  3D2S A;  1VJ5 A;  3K75 D;  3RF9 A;  4M9G A;  1NK5 A;  8ICS A;  2VKQ A;  1T3Q A;  3TI0 A;  4MF2 A;  2ZJA A;  3HRD D;  4DOB A;  1KFS A;  2KVS A;  2JZB A;  4XUS A;  4IC9 A;  4YD2 A;  2FLL A;  5KFV A;  1PVR A;  3QU4 A;  2NRW A;  5AI5 A;  2XI9 A;  1ZJN A;  1CI4 A;  4M9L A;  4ECS A;  1JIH A;  2LHT A;  2G5I B;  3TAC B;  1MC8 A;  4NLB A;  9ICO A;  4RU9 A;  2R8I A;  3PY8 A;  1KQQ A;  3RH5 A;  3KOO A;  4RQ4 A;  3EPG A;  4F5Q A;  1ZQX A;  1L8L A;  4Y2X A;  3NGD A;  3ZI4 A;  2KP7 A;  1NJW A;  2H3Q A;  3RB4 A;  1RQN A;  1ZQB A;  5KAF U;  1ZQE A;  3B0Y A;  2WB1 C;  1T7P A;  5KFY A;  5J2F A;  5KT5 A;  4O3O A;  2BCU A;  1S0M A;  1YZ6 A;  2Z7J A;  4PGX A;  3HKZ C;  3Q8L A;  4UB2 A;  4CF3 A;  2W9C A;  7ICQ A;  4EX6 A;  1NOM A;  3H40 A;  4B6J A;  1KN5 A;  3A0B U;  1ZOL A;  1ZQA A;  4I2F A;  1NK9 A;  4PL2 A;  4NY8 A;  4O3N A;  2BCS A;  2PMZ C;  1ZQI A;  5ALE A;  4QWA A;  1P7D A;  3QUT A;  5CEH A;  4F71 A;  4DEZ A;  4JV1 A;  3RJG A;  1ZQ1 C;  9ICT A;  4MFA A;  1JRO A;  1DRG A;  4O5E A;  3RB6 A;  1FFU A;  4EYH B;  1ZQS A;  4I2E A;  1TK5 A;  4RQN A;  2UVV A;  1WG8 A;  2DPI A;  4M6W B;  4O0I A;  9ICR A;  4B9V A;  2YN4 A;  3HT3 A;  3MC1 A;  2Q4T A;  4QIW C;  2FMP A;  3GIM A;  4P0P B;  1EXN A;  4CCH A;  2F3N A;  2E8P A;  1Z00 A;  2EZY A;  2P6R A;  3TAQ A;  3IHQ B;  8ICG A;  5KG5 A;  3DEE A;  1RG6 A;  2Y0S C;  4DFP A;  5L1I A;  4IQV A;  3HW8 A;  3NS1 A;  4QZE A;  2PXI A;  3V7J A;  4ECY A;  4Y2P A;  3HPO A;  4RPX A;  1ZXI A;  4RQ1 A;  1TK0 A;  2W55 A;  3JPP A;  4KN7 A;  2E1E A;  1ZD4 A;  4UAZ A;  1IM4 A;  2H3I A;  1S10 A;  1WCL A;  1QQ5 A;  3T3F A;  3HWT A;  2M0N A;  5DB9 A;  3ETL A;  1BPY A;  2W9B B;  2FMQ A;  4F92 B;  5AIB A;  2IOF K;  1ZQL A;  3NRW A;  4ECW A;  4ECT A;  3SV4 A;  4I28 A;  4FS2 A;  5DBB A;  3WKB A;  4DSJ A;  2P35 A;  1SXE A;  1QH9 A;  1MQ2 A;  2KIC A;  4JMU A;  1X40 A;  2ZIX A;  3GU3 A;  5DG8 A;  2BR0 A;  5D46 A;  3TAR A;  2NRX A;  3T5K A;  5J0U A;  3KHR A;  3PO4 A;  8ICC A;  2QKQ A;  3SI8 A;  4YQW A;  4TQS A;  1KW4 A;  2QLT A;  1U47 A;  1CRX A;  4KTQ A;  1PK1 A;  1TK8 A;  3F2C A;  4NLZ A;  2ATL A;  5AIC A;  2P6U A;  4P0Q A;  4XQ8 A;  4DSI A;  1PVQ A;  2XY7 A;  9ICU A;  2A1J A;  4MFF A;  2KFZ A;  3ZDB A;  1BNP A;  3R9K A;  3GIJ A;  2I6X A;  3C29 A;  1OW5 A;  2BGW A;  2HVH A;  4B9S A;  1UT8 A;  2KJ9 A;  1BPX A;  4F2S A;  4JWN A;  2HBJ A;  2G06 A;  3KZI U;  3SV3 A;  1ZQO A;  5DLG A;  4EEL A;  1L5U A;  1L3T A;  2H3V A;  2PFO A;  1TE2 A; 
#chains in the Genus database with same CATH homology
 2O6K A;  2FJ6 A;  2KVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...