2O6KA

Crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
b'YSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0346 protein MW1311
publication title Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 24
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2o6kA00
2O6KA 2FJ6A 2KVSA
chains in the Genus database with same CATH superfamily
4LZGA 2R8GA 3TKAA 3RH5A 3KD3A 2G5IB 1T3NA 1Q8KA 2ZIUA 5ALXA 1SB3C 3NVVA 5KFCA 4RQ7A 5C0YA 9ICBA 3B9JA 3ISBA 3H8MA 1YZ6A 2YMQA 4ICAA 4F8RA 5ALQA 1ZQUA 3TI0A 4NLKA 5J0OA 4O3NA 4XQ8A 4UQGA 3SV3A 3MR3A 4M6WB 4PHEA 4C8MA 2R8IA 4M9HA 4C4TA 4US8A 4Y2VA 4ECQA 5AI4A 2ZTEA 5J0WA 4I2AA 8ICIA 2QARB 4RQ5A 2BCUA 3RJJA 2VA3A 2DQNB 4R64A 4ACOA 2RDJA 2V4QA 2F1IA 4KMUA 4M2YA 1UT8A 2IA6A 4FFDA 1HUOA 2E1EA 4QWEA 3IG5A 3OJUA 4IRCA 3BQ7A 5AI9A 5L1JA 3WK7A 4F4WA 5AKHA 1X6IA 2ZJ8A 4QW8A 4RT3A 2JRZA 4PHPA 5C5JA 3H0RB 4U6PA 4RPYA 3TARA 4O5EA 1J2MA 4X5VA 3PVXA 4FBTA 2E8MA 9ICMA 3KTQA 3G6VA 1A76A 4CE6A 4P4MA 5KG6A 3PSIA 4UB5A 3QUCA 4FS2A 3UMGA 2LM1A 1XNSA 2BQRA 1MN8A 3T5HA 4F2SA 4CGZA 4GIBA 2EAOA 2A1AA 2D6FC 3PR4A 2FE9A 3GIMA 1L3SA 3GZFA 4OJLA 2WF9A 5DQHA 3TADA 2KZMA 1X66A 4UAUA 1L3VA 5HHHA 4O9MA 4B9LA 4AP9A 4Y2YA 4I2IA 4O3MA 5KFIA 4NLGA 5HNKA 2G08A 4QZBA 4XUSA 2IOHA 2EANA 1FO4A 2LM4A 4TUSA 2UVUA 1XSNA 2F1HA 1U9LA 5AM5A 2ZIVA 2YMMA 1N63A 5KT5A 3HX0A 3ISCA 2XGQA 2A1JA 5KL8B 4KN7A 3QU5A 4B9UA 5CA7A 1Z1BA 3KKAC 2BZFA 2E3TA 4Y2TA 5KG7A 5J0YA 4QWBA 3HJEA 4ELUA 2O6KA 5KT7A 4M9JA 3Q8SB 2OH2A 4NL9A 3CNHA 3C23A 3Q8LA 2HHSA 1ZOLA 4ECVA 2VA2A 3FAHA 4QZHA 5J2BA 1Z00B 2KSOB 4JWNA 1YZ7A 1S0MA 2H3VA 2YMPA 4OCZA 1X9WA 2HBMA 5AM4A 3MDAA 4U7CA 3PV8A 4C7ZA 5HR6A 3H0LB 5KFYA 1A77A 1L7PA 5A0LA 3A0HU 2YTUA 3PW4A 4UBCA 4TUQA 4PGYA 8ICFA 3JPOA 5J0TA 2EZXA 4QIWF 3QUBA 4J9RA 4YR0A 5J8YC 4EYHB 2ODGA 3SD7A 5BPCA 1AQ6A 5EE3A 1KFTA 2HHTA 2WAQC 3B0XA 1SV0C 5KG2A 4YR2A 5AKYA 5DDMA 2ESEA 1ZJNA 4ED7A 4J9OA 1XU4A 3J81j 2EZYA 2ZG6A 1EXNA 4ECRA 2HSZA 4YCXA 5KG3A 3UXPA 7ICGA 1RYRA 5AKIA 2G09A 3C21A 2HBKA 2P6RA 5IIOA 4RPXA 4RQ6A 1TK0A 3OHAA 1TAUA 4P4OA 2HBLA 9ICOA 2KKPA 5KFDA 2CPRA 4UAVA 3RBEA 4RNMA 3MGHA 1N60A 5F9LA 3MFIA 2A3VA 2ATLA 4WJ3B 3GQCA 1RYSA 2HHWA 4PL1A 4B9VA 2HW3A 4OJOA 2CXYA 4EELA 4YMOA 2IMWP 1BNPA 1ZQMA 4YVZA 2ZJ5A 1SIJA 4DQSA 4GFJA 4ECZA 2W8KA 2KFNA 2XVTA 2KKVA 5KFBA 5IILA 3JPTA 4UB2A 5HR7A 1VLBA 3JPSA 3ZD9A 3UXOA 4Y2XA 2H3FA 4UATA 1WYGA 1IXRA 4J9KA 3T5JA 4I29A 3V7LA 2DKXA 1XSPA 8ICEA 4Z6DA 5KTQA 4RQ0A 3F5AA 1Z4OA 5EE1A 4KX3A 3MABA 1IG6A 3QX7A 4DFDA 2VIXA 1KDHA 1PK3A 5CR0A 3ZDCA 5KAFU 3BS5B 4QZ9A 3PW0A 4BXOB 5CP2A 2ZUCA 5ALUA 5AK3A 2JEIA 4DLEA 3MBYA 4GLXA 3RB0A 5ALJA 5AKJA 4UAYA 3CRXA 2DPIA 2PI5A 3CW2C 2R18A 1S8OA 4I2FA 2L5YA 7ICOA 4EBCA 2GOLA 1PVRA 3GU3A 2R8JA 3T5KA 5HMMA 4Q8FA 4YFKA 3OJSA 8ICLA 4F92B 8ICVA 1RQLA 2MAXA 2VJ5A 3TANA 2YB4A 1L5UA 4QZAA 1CUKA 1K1QA 3GFKB 2KIVA 1BVSA 2Y9TA 5ALVA 1SL2A 4PGQA 2FLPA 3LVVA 3VCBA 2KVCA 5KFAA 4YP3A 4RUCA 1X2IA 1KW4A 3ED5A 3M6ZA 2KD1A 3H8WA 5KFZA 2Y0SF 3NRZA 4RQ2A 3GIJA 2F77X 4PJ0U 5ALWA 9ICUA 1NK5A 5J2AA 4KMOB 1Z4NA 3MGVA 1SXDA 1BGXT 3KKAA 4RPZA 1U4BA 3HKZF 3B0YA 3WK4A 3MC1A 1NZBA 2LHTA 7ICLA 4P0PA 1S0OA 3ZDAA 3RBDA 4M6WA 2WTFA 4DS4A 2FLLA 4BX9C 4YN4A 4YQWA 1HIWA 2KJ8A 1LB2B 3T3FA 4NWIA 3V6KA 2EQYA 2J6UA 8ICUA 2B6GA 1NZPA 2QARA 1S0NA 1TAQA 2YMLA 3ICXA 3S6JA 3TFRA 3GDXA 1MC8A 4R63A 3WKDA 3ZI4A 5KAIU 4FBUA 1ZRNA 4UASA 4JWMA 1ZETA 3BQ0A 4GC7A 3EZ5A 2XY6A 2QB1A 3LWLA 1RQNA 5J8YA 5AKXA 1JMSA 1S0VA 3HPOA 2MA1A 3OGUA 5AIBA 4C8NA 5J2JA 1QLNA 5KFPA 1KFSA 1WCLA 2OYYA 4IS7A 4DLGA 1COKA 5D4BA 3RTVA 4FS1A 1ZXIA 4UAZA 4ECSA 2ISPA 2KNJA 1N5XA 1N5WA 1UQVA 4B9NA 1S76D 2RLTA 4Y2RA 4DS5A 1JROA 4C8OA 1NK6A 4CNQA 3M9NB 1K5OA 5ALYA 3SAHA 1D9FA 5KFXA 3BS7A 5HP4A 7ICRA 2XO7A 3H4DA 3H8SA 1ZQDA 3RJKA 3SYZA 2PI4A 2ZJAA 3PNCA 4F2RA 2IHNA 1JXEA 3D6JA 4DL7A 3N97B 3PSTA 1OW5A 1JRPA 5KFUA 4RNOA 3PX6A 2XI9A 2BPCA 2PFOA 2ZTCA 2BCSA 2XY7A 2EH9A 2W3RA 5DGAA 2HHVA 3AQFA 1JX4A 4EZ6A 3JPRA 2G0AA 2QLTA 1ZQWA 3PW2A 2C2DA 1ZYQA 4Z6CA 1QQ5A 3QUQA 4IL6U 5AKEA 3Q8MA 4F5QA 4M47A 9ICWA 1C20A 2BKEA 4Y2QA 5G5GA 2WB1C 1ZQJA 4I2GA 4K4GA 4JUZA 4J9NA 7ICHA 1VDVA 1PZNA 2W54A 4YG2A 4RQ1A 5AK5A 3SEIA 1TE2A 2F3NA 4G9BA 5J2KA 1TK8A 3NUQA 8ICRA 1O08A 1ZQRA 7ICMA 1Z00A 4Q8EA 2FPLA 2KSOA 3F53A 4KLHA 5ALRA 1QH9A 2DBYA 4NM1A 2FPKA 2WF6A 3K1RB 3ZD8A 1X9MA 8ICCA 3SMVA 1MQ2A 1Y88A 4QZEA 2F44A 2BCVA 1ZD5A 3C2KA 1BPYA 1ZQCA 5ALFA 5J29A 5KT3A 4F4KA 2KHQA 5AK6A 5J0UA 2W55A 3KOOA 1ZQSA 5ALSA 2LYAA 2FMSA 8ICGA 3UPQA 3ZDBA 1SZHA 1N61A 5KFFA 1F0MA 2NO5A 5BOMA 4DSFA 4XRHA 3GV8B 3ONNA 3MR5A 1O03A 2RHFA 3NVZA 1URJA 2AGQA 2K8CB 4TQSA 3JPPA 3QZ7A 5AI6A 2XGPA 2W7OA 2LBOA 4ECYA 1KL9A 3CP8A 4QNLA 5KFVA 3QZ8A 1BPXA 1L7MA 2JH1A 4EEYA 1N48A 3NRWA 4CDGA 4LJXA 2IBKA 2DFLA 7ICEA 4ZH4A 2GO7A 2YN4A 3THVA 3MDCA 4PGXA 1S5LU 2W11A 2ZIXB 2HHQA 4K4HA 5J0SA 2NYVA 2KHVA 5AICA 4BUGA 2KN7A 4KLTA 3PSFA 1PK1B 2HOFA 7ICSA 2JXJA 5J0RA 3HP6A 1UA1A 4J9LA 1PVPA 4I2HA 1JIHA 4J9QA 1SWVA 4F50A 2HOIA 3F5EA 1ZQFA 4F72A 2V4RA 3I1YA 4BWMA 2BCQA 3NTUA 1MA7A 3BS5A 3EWAA 3RAXA 2HOQA 4BXOA 5DDYA 1ZQVA 1NI3A 1UHUA 3TAQA 3IN5A 3EW9A 3TQ1A 3WK5A 9ICIA 1SXEA 4RQNA 4Y2SA 1IV8A 4IQWA 3E2EA 2WF7A 2BDPA 4LZDA 4DSKA 5J2HA 4KLFA 1TVAA 5DQGA 3PZPA 4FO6A 2K4EA 5DLFA 2W7PA 2FJ6A 4BDPA 3PMLA 3PMNA 2W3SA 8ICPA 1L7OA 5KFLA 3Q8RB 1VJ5A 1NJYA 3GV7B 4KLUA 2AU0A 5ALGA 5AKKA 4KLJA 2NRXA 4F5PA 1CRXA 2JHDA 1CEZA 2HCFA 2KE7A 4B6JA 3IP4B 5EWFA 4RQ4A 2BGWA 5J2CA 1FFUA 4Q44A 1U47A 5DB6A 2JZBB 3WK6A 2XY5A 4QZCA 9ICCA 2WF5A 2AJQA 1JI7A 4OJ5A 1N56A 1X42A 4C4SA 4DL2A 4O3PA 3QEAZ 1F5SA 2C28A 5IIKA 2ASDA 3ETRA 1RXWA 3HRDD 1ZQBA 4G3IA 4JK1A 1N2XA 2NRTA 5E79U 1YT3A 4KLQA 5DB7A 2HDOA 4DQQA 1Q46A 2NO4A 8ICNA 1KFDA 1PUZA 3F2CA 1NK0A 3SQIA 2Z7JA 4IQUA 2PMZC 5J2IA 5DBCA 1L6NA 3T79A 5JUMA 2PFQA 2MUTB 5L1LA 5KNIA 5DG8A 4DL3A 4Q43A 4QWCA 9ICXA 2KV2A 3VC8A 4F4YA 3N7RC 2K4PA 3RRGA 5DB9A 1ZQLA 2XCPA 4Z6FA 3NVYA 4NM2A 2ZUBA 1SZPA 3BZKA 3V6JA 4M9LA 3RJGA 3G6YA 1B43A 3TFSA 1D8LA 2C2RA 2HHXA 1UT5A 4O3OA 3N28A 1BPEA 1KQQA 2XC9A 2Q4TA 4DSJA 2RP5A 4DO9A 1RXVA 2E8OA 5IINA 1D9DA 1D8YA 4O5CA 2KZ3A 4NLCA 1XWLA 5F9NA 3PO4A 2XCAA 5KFTA 1GO3F 2H5XA 2W43A 1RG6A 3KZIU 3U26A 2F1JA 9ICEA 4UW9A 1NOMA 4LVSA 5KFGA 1BPBA 2JH7A 1V38A 4F5NA 4UB3A 3BZCA 4B9SA 1KLNA 2JEJA 5EE0A 1T3QA 2BDUA 1JXLA 4ED0A 4CF5A 3C5GA 2FLNA 4YMNA 4C7YA 2KICA 3Q8KA 2W9AA 3EPGA 5KFOA 2H3QA 4OO1J 7ICTA 3RJIA 2XIDA 1QSSA 8ICHA 3N7SC 5KG1A 3C1YA 5KT2A 1L8LA 5L1MA 2LYBA 4I2EA 2ASJA 3H40A 5JU5A 3E0FA 8ICAA 3SI8A 4DFKA 2R8HA 1KKXA 3PW5A 4O3QA 2ZXHA 4NY8A 1M6YA 2FI1A 2BQUA 2AQ4A 9ICQA 4RT2A 8ICTA 1S9FA 3KBBA 3D2NA 5ALTA 5K4LA 4DFPA 4QZFA 4HAIA 2YB1A 1TAMA 2AXTU 3V72A 3QYPA 1UPHA 5KL1B 4ED2A 5DG7A 5J0XA 7ICFA 4J03A 5GTHU 4RUAA 5KG0A 7ICVA 3O0FA 3MFHA 2JMGA 3FM9A 1FFVA 3BQ2A 3DDHA 3I76A 2K4IA 1KRPA 2OWOA 5ALEA 3QU9A 1NJXA 3RB3A 1ZQZA 2QB0B 2RRDA 2H3ZA 3JPQA 3C2LA 2WFAA 5AHXA 5KFQA 9ICKA 4Z6EA 1NK7A 3PY8A 2M9NA 3RH4A 1QQ7A 5CEHA 4JV2A 2HVHA 2MU2A 2NRZA 5BOLA 5ALNA 2FMQA 3D2SA 3QNMA 7ICPA 7ICJA 3ZDDA 2NV3A 2W9BB 2KJ9A 1NJZA 1RDFA 5DG9A 1B22A 5CJ7A 2CRXA 2F76X 4F5RA 3AU6A 5ALIA 5F3XB 5AK4A 1V85A 4P0QB 1TV9A 4BWJA 1HUZA 2UVRA 1ECWA 8ICSA 4OJ6A 2DGZA 3BQTA 1WWVA 4NLBA 3HILA 1LV5A 3UMBA 5J2EA 1ZRMA 5KFWA 2KIWA 2W9MA 4DEZA 5D46A 5KG5A 4DOBA 2GH1A 4IR1A 2JV3A 2Y1IA 4UB8U 2D3DA 2I6XA 5ALZA 1SKSA 4FZMA 4UAWA 3UQ0A 1HJPA 2VJ4A 2W03A 3NGDA 3GIKA 2E8PA 3I28A 4YR3A 4QZDA 4R8UB 3QU2A 1T7PA 1NKBA 1ZQOA 4C0ZA 5AM3A 1OUQA 1AROP 2ZIXA 1NKEA 9ICLA 3QU4A 4QIWC 2WAQF 3WU2U 3FC4A 1UA0A 4CCHA 2CN1A 3H4BA 4KLDA 3PW7A 3DV9A 1PK1A 3IHQB 9ICAA 4QWAA 3NS1A 1JN3A 5DKWA 3V6HA 4EX6A 1X6JA 1BPDA 5J2DA 2KVSA 3G6XA 4DSLA 2MSNA 2FMPA 2B21A 4NLZA 4ECWA 3SR6A 2HHUA 5G5HA 1KEJA 4NLNA 2DL0A 9ICPA 3ZDEA 2DUYA 3LYSA 4OD0A 4US9A 3RRHA 5KFKA 4I2BA 4DSIA 4ED6A 4RNNA 3OSPA 2R8KA 2XICA 5DBBA 3WKCA 4UB1A 1U48A 2C2EA 1NK8A 4DQPA 4KTQA 2KP7A 4CF4A 1SGGA 8ICJA 3L4PA 5AM1A 5AKGA 2KTQA 3SZ2A 1X9SA 3ISDA 1SKRA 3EUB2 1RYUA 5IIIA 4B9TA 5KFSA 5DLGA 4I27A 3K4GA 3AM9A 3FDSA 2P66A 5AM0A 4DFMA 5J2GA 3AEVA 3AL0B 3H7IA 3AUOA 4EZ9A 5AI5A 4F5OA 4M0AA 3KFUF 4DQIA 2BHNA 4DL4A 2M0NA 9ICFA 4F4XA 1NK4A 5L1KA 2JZBA 4P0PB 1F44A 2BQ3A 2YQEA 3N7PD 3RB4A 3C28A 3IV6A 3AMZA 3TAPA 5DB8A 4E0DA 2Y1JA 4QZGA 3PSPA 5EWEA 3RFAA 8ICWA 4ECXA 2J6SA 1L3TA 3GIIA 4KLGA 2WF8A 4ECTA 1A0PA 2RDIA 2JGAA 4CF3A 5KFRA 3GV5B 4CRXA 2EZZA 2UVVA 2G5HB 5KFEA 2MUTA 1ZD3A 1UCVA 1H38A 1ZD2P 2NRVA 5AKZA 4KLOA 1ZQ1C 1DRGA 4MFFA 2I1QA 4DL6A 2KZZA 2F8LA 2IHMA 2LI6A 3MGIA 4ED1A 2W9CB 2N1RA 3QUTA 4R65A 9ICRA 1KTQA 4B9MA 2Y0SC 2AHOB 2A19A 3WK8A 4DF8A 1MQ3A 5HMLA 2ALZA 2KMDA 2P6UA 4UARA 4DOAA 1ED1A 3N4MB 1XO1A 2KFZA 5ALPA 2ZXIA 1ZQNA 3IG8A 5ALMA 3SAGA 2QKQA 2ZIWB 3HKZC 4ELTA 2OCEA 3UM9A 3IM1A 1KN5A 2FPMA 9ICSA 1Z19A 3LVWA 2KJ5A 4DF4A 4JB3A 3Q8QB 4ED3A 1L3UA 1S10A 4GC6A 3C2MA 5AKLA 4GXKA 2OEHA 4ECUA 2OM6A 2VKQA 8ICQA 4TURA 4IQTA 1LKYB 4YD1A 4DL5A 4JV1A 1BNOA 9ICTA 4EX7A 4IRDA 3RR7A 1ZQEA 4PPXA 3M6KA 2BR0A 4QWDA 1QSLA 3KZXA 1TFRA 3OSNA 1T94A 2HMXA 1FEZA 4KN4A 7ICNA 9ICGA 3OPXA 4UB4A 4IC9A 3HW8A 1V97A 2ZIUB 4MEYA 1COOA 2E8NA 4DOCA 3WK9A 3M9OB 2ZUDA 3D2QA 4AYBC 3MR6A 5CRXA 5KT6A 3WKEA 4C80A 5TZVA 3IRUA 5DGBA 4JV0A 1U45A 1J97A 2IOFA 2YX8A 4HYKA 1ZQXA 4NJ8A 1ZJMA 4Y2PA 4KLMA 1NJWA 3KHHA 4EBEA 2AH5A 2DPJA 3TACB 1NKCA 1N62A 3NVWA 2AGOA 3IDWA 4EBDA 1ZQTA 4C4RA 3C1ZA 3V7JA 3WKAA 1NNLA 1T8EA 1DGJA 3AN1A 1ZQPA 1B4FA 3Q8PB 2WHEA 1XS9D 5TISU 3KHLA 1SL1A 4UBBA 4Y2UA 2KK0A 2LMRA 2QB0A 9ICJA 1Z1VA 2Y9UA 4QZ8A 3HWTA 3C29A 3RB6A 4O5KA 1ZQQA 4IR9A 4EEKA 2I9GA 1RPLA 2EAPA 2EDUA 4O3RA 3M8RA 5ALDA 1Q3UA 5JTIA 2G06A 2E5SA 3A0BU 3KHRA 1IIPA 3H0MB 2DF4B 5L9XA 2LKYA 3JPNA 2K60A 2W9BA 3MR2A 4YXMA 3C5FA 2WB1F 1KSPA 4PH5A 2J6TA 2LPEA 3QE9Y 2MRLA 3RF9A 2DKZA 1CI4A 8ICOA 4P0QA 4NXZA 2F8KA 2NRWA 2VANA 3CYMA 2Q0ZX 5D49A 2HVIA 4KITB 4F71A 4YMMA 3RJEA 1C7YA 4I28A 1SKWA 2OHFA 1ZQYA 3FYHA 5B5EU 4I2DA 2HBJA 1K1SA 3HT3A 3QXGA 3ORYA 3H8JA 1Z3EB 4YXJA 4MEXA 5AM2A 4M9NA 4F93B 4QJFB 4ELVA 5KFNA 1T4GA 5H2FU 5DBAA 3R9KA 2JR5A 4IQVA 3EYZA 5J0PA 2DWQA 5KFMA 1WCNA 1QTMA 2K8AA 1L8OA 8ICZA 5CB1A 3KHGA 4R8UA 4RQ3A 4C8LA 4RU9A 2E1FA 3UXNA 2JEGA 2ZTDA 2KG5A 4PHDA 4TUPA 3DEEA 4UB6U 1KBUA 1RM6C 4O3SA 5CWRA 1MSWD 2ZIVB 4BGDA 1D8BA 2ASLA 1ZQIA 1IM4A 2A1JB 4MF2A 5KFHA 2JEFA 5IIMA 4IRKA 2D8CA 3ETLA 1WUDA 1Q3VA 4K4IA 4KLIA 1S97A 1U49A 5JRTA 1TKDA 1SL0A 7ICUA 3ALRA 2B0CA 2GWSA 2RQ5A 3GILA 2BPGA 3V7KA 2W8LA 3BJYA 2K4HA 1QCKA 3LWMA 4NV0A 1SWWA 3M8SA 3BQ1A 4P4PA 4JMUA 7ICKA 3PX0A 4DCCA 4PZNA 1DOQA 9ICNA 2ISOA 2OXOA 4A8EA 2EAMA 3RH6A 4RQMA 5ALLA 3F2BA 4R66A 3E58A 8ICKA 7ICQA 4PHAA 4P2HA 4PL2A 3BDPA 4M04A 4KLLA 8ICYA 3OHBA 1TK5A 9ICHA 3M1YA 2K89A 5KFJA 4DWIA 5ALKA 5GTIU 5J2FA 4OJPA 5L1IA 1WWUA 1S77D 4KLSA 8ICMA 1J2NA 4QW9A 3UMCA 4EYIB 4MF8A 1B0XA 3SV4A 5ALOA 2F2AB 5DQIA 1DGSA 4J9PA 1RZTA 1L7NA 4M9GA 3RR8A 4GXIA 2FDRA 5AIAA 2KOBA 1ZQHA 1ZD4A 5EWGA 3QEBZ 2IOFK 2AQ0A 5AI0A 1DK3A 2KEYA 4YD2A 3TADC 2PKEA 4DQRA 4F4ZA 1A6SA 2YY6A 1P7DA 1OXJA 3K1ZA 4J9MA 4F3OA 1ZQKA 5J0QA 5HHIA 4RQ8A 3L3FX 2AGPA 5KG4A 4XA5A 3RJFA 4RZRA 1XSLA 3AQEA 2LYHA 4Y2JA 1DXSA 1SV0A 2PXIA 4J9SA 1XO0A 3AU2A 3K75D 4AYBF 4F91B 1HEKA 3PX4A 1ZQAA 5IIJA 3M7DA 3M9MB 5ALHA 1NK9A 5FP0A 1QSYA 4FZLA 1JUDA 3NASA 5EE9A 1DK2A 4DSEA 2W9CA 1PVQA 2H3IA 2I5HA 3SAFA 4Q45A 4KLEA 4BJQA 4FZNA 3EPIA 1JALA 2BCRA 4MHVA 4NL9C 4DFJA 3RJHA 4EENA 2ES6A 4QZIA 7ICIA 3SENA 3WKBA 5EOZA 1FIQA 5T14A 2VA8A 1BPZA 3LK9A 2ZIWA 1ZQGA 3L5KA 8ICBA 4C8KA 1WG8A 2G07A 3PR5B 1SV4A 4O0IA 1LVHA 3LDAA 2BPFA 3UQ2A 3QU7A 4I2JA 2W04A 4PZOA 4TQRA 2P35A 3RAQA 5B66U 4USAA 2PFPA 2PMZF 4ZOHC 3F2DA 8ICXA 5KT4A 2GLEA 3T5LA 1X9XA 2C22A 2UVWA 1V9PA 9ICVA 4GXJA 1QQ6A 1LKYA 4I2CA 4FE3A 3PO5A 2HI0A 2PFNA 4MFCA 4ED8A 3OTQA 1XC9A 4MFAA 5CHGA 4KX5A 2K8BB 1X40A 5AI8A 2V9WA
chains in the Genus database with same CATH topology
2O6KA 2FJ6A 2KVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6K A;  2FJ6 A;  2KVS A; 
#chains in the Genus database with same CATH topology
 4LZG A;  2R8G A;  3TKA A;  3RH5 A;  3KD3 A;  2G5I B;  1T3N A;  1Q8K A;  2ZIU A;  5ALX A;  1SB3 C;  3NVV A;  5KFC A;  4RQ7 A;  5C0Y A;  9ICB A;  3B9J A;  3ISB A;  3H8M A;  1YZ6 A;  2YMQ A;  4ICA A;  4F8R A;  5ALQ A;  1ZQU A;  3TI0 A;  4NLK A;  5J0O A;  4O3N A;  4XQ8 A;  4UQG A;  3SV3 A;  3MR3 A;  4M6W B;  4PHE A;  4C8M A;  2R8I A;  4M9H A;  4C4T A;  4US8 A;  4Y2V A;  4ECQ A;  5AI4 A;  2ZTE A;  5J0W A;  4I2A A;  8ICI A;  2QAR B;  4RQ5 A;  2BCU A;  3RJJ A;  2VA3 A;  2DQN B;  4R64 A;  4ACO A;  2RDJ A;  2V4Q A;  2F1I A;  4KMU A;  4M2Y A;  1UT8 A;  2IA6 A;  4FFD A;  1HUO A;  2E1E A;  4QWE A;  3IG5 A;  3OJU A;  4IRC A;  3BQ7 A;  5AI9 A;  5L1J A;  3WK7 A;  4F4W A;  5AKH A;  1X6I A;  2ZJ8 A;  4QW8 A;  4RT3 A;  2JRZ A;  4PHP A;  5C5J A;  3H0R B;  4U6P A;  4RPY A;  3TAR A;  4O5E A;  1J2M A;  4X5V A;  3PVX A;  4FBT A;  2E8M A;  9ICM A;  3KTQ A;  3G6V A;  1A76 A;  4CE6 A;  4P4M A;  5KG6 A;  3PSI A;  4UB5 A;  3QUC A;  4FS2 A;  3UMG A;  2LM1 A;  1XNS A;  2BQR A;  1MN8 A;  3T5H A;  4F2S A;  4CGZ A;  4GIB A;  2EAO A;  2A1A A;  2D6F C;  3PR4 A;  2FE9 A;  3GIM A;  1L3S A;  3GZF A;  4OJL A;  2WF9 A;  5DQH A;  3TAD A;  2KZM A;  1X66 A;  4UAU A;  1L3V A;  5HHH A;  4O9M A;  4B9L A;  4AP9 A;  4Y2Y A;  4I2I A;  4O3M A;  5KFI A;  4NLG A;  5HNK A;  2G08 A;  4QZB A;  4XUS A;  2IOH A;  2EAN A;  1FO4 A;  2LM4 A;  4TUS A;  2UVU A;  1XSN A;  2F1H A;  1U9L A;  5AM5 A;  2ZIV A;  2YMM A;  1N63 A;  5KT5 A;  3HX0 A;  3ISC A;  2XGQ A;  2A1J A;  5KL8 B;  4KN7 A;  3QU5 A;  4B9U A;  5CA7 A;  1Z1B A;  3KKA C;  2BZF A;  2E3T A;  4Y2T A;  5KG7 A;  5J0Y A;  4QWB A;  3HJE A;  4ELU A;  2O6K A;  5KT7 A;  4M9J A;  3Q8S B;  2OH2 A;  4NL9 A;  3CNH A;  3C23 A;  3Q8L A;  2HHS A;  1ZOL A;  4ECV A;  2VA2 A;  3FAH A;  4QZH A;  5J2B A;  1Z00 B;  2KSO B;  4JWN A;  1YZ7 A;  1S0M A;  2H3V A;  2YMP A;  4OCZ A;  1X9W A;  2HBM A;  5AM4 A;  3MDA A;  4U7C A;  3PV8 A;  4C7Z A;  5HR6 A;  3H0L B;  5KFY A;  1A77 A;  1L7P A;  5A0L A;  3A0H U;  2YTU A;  3PW4 A;  4UBC A;  4TUQ A;  4PGY A;  8ICF A;  3JPO A;  5J0T A;  2EZX A;  4QIW F;  3QUB A;  4J9R A;  4YR0 A;  5J8Y C;  4EYH B;  2ODG A;  3SD7 A;  5BPC A;  1AQ6 A;  5EE3 A;  1KFT A;  2HHT A;  2WAQ C;  3B0X A;  1SV0 C;  5KG2 A;  4YR2 A;  5AKY A;  5DDM A;  2ESE A;  1ZJN A;  4ED7 A;  4J9O A;  1XU4 A;  3J81 j;  2EZY A;  2ZG6 A;  1EXN A;  4ECR A;  2HSZ A;  4YCX A;  5KG3 A;  3UXP A;  7ICG A;  1RYR A;  5AKI A;  2G09 A;  3C21 A;  2HBK A;  2P6R A;  5IIO A;  4RPX A;  4RQ6 A;  1TK0 A;  3OHA A;  1TAU A;  4P4O A;  2HBL A;  9ICO A;  2KKP A;  5KFD A;  2CPR A;  4UAV A;  3RBE A;  4RNM A;  3MGH A;  1N60 A;  5F9L A;  3MFI A;  2A3V A;  2ATL A;  4WJ3 B;  3GQC A;  1RYS A;  2HHW A;  4PL1 A;  4B9V A;  2HW3 A;  4OJO A;  2CXY A;  4EEL A;  4YMO A;  2IMW P;  1BNP A;  1ZQM A;  4YVZ A;  2ZJ5 A;  1SIJ A;  4DQS A;  4GFJ A;  4ECZ A;  2W8K A;  2KFN A;  2XVT A;  2KKV A;  5KFB A;  5IIL A;  3JPT A;  4UB2 A;  5HR7 A;  1VLB A;  3JPS A;  3ZD9 A;  3UXO A;  4Y2X A;  2H3F A;  4UAT A;  1WYG A;  1IXR A;  4J9K A;  3T5J A;  4I29 A;  3V7L A;  2DKX A;  1XSP A;  8ICE A;  4Z6D A;  5KTQ A;  4RQ0 A;  3F5A A;  1Z4O A;  5EE1 A;  4KX3 A;  3MAB A;  1IG6 A;  3QX7 A;  4DFD A;  2VIX A;  1KDH A;  1PK3 A;  5CR0 A;  3ZDC A;  5KAF U;  3BS5 B;  4QZ9 A;  3PW0 A;  4BXO B;  5CP2 A;  2ZUC A;  5ALU A;  5AK3 A;  2JEI A;  4DLE A;  3MBY A;  4GLX A;  3RB0 A;  5ALJ A;  5AKJ A;  4UAY A;  3CRX A;  2DPI A;  2PI5 A;  3CW2 C;  2R18 A;  1S8O A;  4I2F A;  2L5Y A;  7ICO A;  4EBC A;  2GOL A;  1PVR A;  3GU3 A;  2R8J A;  3T5K A;  5HMM A;  4Q8F A;  4YFK A;  3OJS A;  8ICL A;  4F92 B;  8ICV A;  1RQL A;  2MAX A;  2VJ5 A;  3TAN A;  2YB4 A;  1L5U A;  4QZA A;  1CUK A;  1K1Q A;  3GFK B;  2KIV A;  1BVS A;  2Y9T A;  5ALV A;  1SL2 A;  4PGQ A;  2FLP A;  3LVV A;  3VCB A;  2KVC A;  5KFA A;  4YP3 A;  4RUC A;  1X2I A;  1KW4 A;  3ED5 A;  3M6Z A;  2KD1 A;  3H8W A;  5KFZ A;  2Y0S F;  3NRZ A;  4RQ2 A;  3GIJ A;  2F77 X;  4PJ0 U;  5ALW A;  9ICU A;  1NK5 A;  5J2A A;  4KMO B;  1Z4N A;  3MGV A;  1SXD A;  1BGX T;  3KKA A;  4RPZ A;  1U4B A;  3HKZ F;  3B0Y A;  3WK4 A;  3MC1 A;  1NZB A;  2LHT A;  7ICL A;  4P0P A;  1S0O A;  3ZDA A;  3RBD A;  4M6W A;  2WTF A;  4DS4 A;  2FLL A;  4BX9 C;  4YN4 A;  4YQW A;  1HIW A;  2KJ8 A;  1LB2 B;  3T3F A;  4NWI A;  3V6K A;  2EQY A;  2J6U A;  8ICU A;  2B6G A;  1NZP A;  2QAR A;  1S0N A;  1TAQ A;  2YML A;  3ICX A;  3S6J A;  3TFR A;  3GDX A;  1MC8 A;  4R63 A;  3WKD A;  3ZI4 A;  5KAI U;  4FBU A;  1ZRN A;  4UAS A;  4JWM A;  1ZET A;  3BQ0 A;  4GC7 A;  3EZ5 A;  2XY6 A;  2QB1 A;  3LWL A;  1RQN A;  5J8Y A;  5AKX A;  1JMS A;  1S0V A;  3HPO A;  2MA1 A;  3OGU A;  5AIB A;  4C8N A;  5J2J A;  1QLN A;  5KFP A;  1KFS A;  1WCL A;  2OYY A;  4IS7 A;  4DLG A;  1COK A;  5D4B A;  3RTV A;  4FS1 A;  1ZXI A;  4UAZ A;  4ECS A;  2ISP A;  2KNJ A;  1N5X A;  1N5W A;  1UQV A;  4B9N A;  1S76 D;  2RLT A;  4Y2R A;  4DS5 A;  1JRO A;  4C8O A;  1NK6 A;  4CNQ A;  3M9N B;  1K5O A;  5ALY A;  3SAH A;  1D9F A;  5KFX A;  3BS7 A;  5HP4 A;  7ICR A;  2XO7 A;  3H4D A;  3H8S A;  1ZQD A;  3RJK A;  3SYZ A;  2PI4 A;  2ZJA A;  3PNC A;  4F2R A;  2IHN A;  1JXE A;  3D6J A;  4DL7 A;  3N97 B;  3PST A;  1OW5 A;  1JRP A;  5KFU A;  4RNO A;  3PX6 A;  2XI9 A;  2BPC A;  2PFO A;  2ZTC A;  2BCS A;  2XY7 A;  2EH9 A;  2W3R A;  5DGA A;  2HHV A;  3AQF A;  1JX4 A;  4EZ6 A;  3JPR A;  2G0A A;  2QLT A;  1ZQW A;  3PW2 A;  2C2D A;  1ZYQ A;  4Z6C A;  1QQ5 A;  3QUQ A;  4IL6 U;  5AKE A;  3Q8M A;  4F5Q A;  4M47 A;  9ICW A;  1C20 A;  2BKE A;  4Y2Q A;  5G5G A;  2WB1 C;  1ZQJ A;  4I2G A;  4K4G A;  4JUZ A;  4J9N A;  7ICH A;  1VDV A;  1PZN A;  2W54 A;  4YG2 A;  4RQ1 A;  5AK5 A;  3SEI A;  1TE2 A;  2F3N A;  4G9B A;  5J2K A;  1TK8 A;  3NUQ A;  8ICR A;  1O08 A;  1ZQR A;  7ICM A;  1Z00 A;  4Q8E A;  2FPL A;  2KSO A;  3F53 A;  4KLH A;  5ALR A;  1QH9 A;  2DBY A;  4NM1 A;  2FPK A;  2WF6 A;  3K1R B;  3ZD8 A;  1X9M A;  8ICC A;  3SMV A;  1MQ2 A;  1Y88 A;  4QZE A;  2F44 A;  2BCV A;  1ZD5 A;  3C2K A;  1BPY A;  1ZQC A;  5ALF A;  5J29 A;  5KT3 A;  4F4K A;  2KHQ A;  5AK6 A;  5J0U A;  2W55 A;  3KOO A;  1ZQS A;  5ALS A;  2LYA A;  2FMS A;  8ICG A;  3UPQ A;  3ZDB A;  1SZH A;  1N61 A;  5KFF A;  1F0M A;  2NO5 A;  5BOM A;  4DSF A;  4XRH A;  3GV8 B;  3ONN A;  3MR5 A;  1O03 A;  2RHF A;  3NVZ A;  1URJ A;  2AGQ A;  2K8C B;  4TQS A;  3JPP A;  3QZ7 A;  5AI6 A;  2XGP A;  2W7O A;  2LBO A;  4ECY A;  1KL9 A;  3CP8 A;  4QNL A;  5KFV A;  3QZ8 A;  1BPX A;  1L7M A;  2JH1 A;  4EEY A;  1N48 A;  3NRW A;  4CDG A;  4LJX A;  2IBK A;  2DFL A;  7ICE A;  4ZH4 A;  2GO7 A;  2YN4 A;  3THV A;  3MDC A;  4PGX A;  1S5L U;  2W11 A;  2ZIX B;  2HHQ A;  4K4H A;  5J0S A;  2NYV A;  2KHV A;  5AIC A;  4BUG A;  2KN7 A;  4KLT A;  3PSF A;  1PK1 B;  2HOF A;  7ICS A;  2JXJ A;  5J0R A;  3HP6 A;  1UA1 A;  4J9L A;  1PVP A;  4I2H A;  1JIH A;  4J9Q A;  1SWV A;  4F50 A;  2HOI A;  3F5E A;  1ZQF A;  4F72 A;  2V4R A;  3I1Y A;  4BWM A;  2BCQ A;  3NTU A;  1MA7 A;  3BS5 A;  3EWA A;  3RAX A;  2HOQ A;  4BXO A;  5DDY A;  1ZQV A;  1NI3 A;  1UHU A;  3TAQ A;  3IN5 A;  3EW9 A;  3TQ1 A;  3WK5 A;  9ICI A;  1SXE A;  4RQN A;  4Y2S A;  1IV8 A;  4IQW A;  3E2E A;  2WF7 A;  2BDP A;  4LZD A;  4DSK A;  5J2H A;  4KLF A;  1TVA A;  5DQG A;  3PZP A;  4FO6 A;  2K4E A;  5DLF A;  2W7P A;  2FJ6 A;  4BDP A;  3PML A;  3PMN A;  2W3S A;  8ICP A;  1L7O A;  5KFL A;  3Q8R B;  1VJ5 A;  1NJY A;  3GV7 B;  4KLU A;  2AU0 A;  5ALG A;  5AKK A;  4KLJ A;  2NRX A;  4F5P A;  1CRX A;  2JHD A;  1CEZ A;  2HCF A;  2KE7 A;  4B6J A;  3IP4 B;  5EWF A;  4RQ4 A;  2BGW A;  5J2C A;  1FFU A;  4Q44 A;  1U47 A;  5DB6 A;  2JZB B;  3WK6 A;  2XY5 A;  4QZC A;  9ICC A;  2WF5 A;  2AJQ A;  1JI7 A;  4OJ5 A;  1N56 A;  1X42 A;  4C4S A;  4DL2 A;  4O3P A;  3QEA Z;  1F5S A;  2C28 A;  5IIK A;  2ASD A;  3ETR A;  1RXW A;  3HRD D;  1ZQB A;  4G3I A;  4JK1 A;  1N2X A;  2NRT A;  5E79 U;  1YT3 A;  4KLQ A;  5DB7 A;  2HDO A;  4DQQ A;  1Q46 A;  2NO4 A;  8ICN A;  1KFD A;  1PUZ A;  3F2C A;  1NK0 A;  3SQI A;  2Z7J A;  4IQU A;  2PMZ C;  5J2I A;  5DBC A;  1L6N A;  3T79 A;  5JUM A;  2PFQ A;  2MUT B;  5L1L A;  5KNI A;  5DG8 A;  4DL3 A;  4Q43 A;  4QWC A;  9ICX A;  2KV2 A;  3VC8 A;  4F4Y A;  3N7R C;  2K4P A;  3RRG A;  5DB9 A;  1ZQL A;  2XCP A;  4Z6F A;  3NVY A;  4NM2 A;  2ZUB A;  1SZP A;  3BZK A;  3V6J A;  4M9L A;  3RJG A;  3G6Y A;  1B43 A;  3TFS A;  1D8L A;  2C2R A;  2HHX A;  1UT5 A;  4O3O A;  3N28 A;  1BPE A;  1KQQ A;  2XC9 A;  2Q4T A;  4DSJ A;  2RP5 A;  4DO9 A;  1RXV A;  2E8O A;  5IIN A;  1D9D A;  1D8Y A;  4O5C A;  2KZ3 A;  4NLC A;  1XWL A;  5F9N A;  3PO4 A;  2XCA A;  5KFT A;  1GO3 F;  2H5X A;  2W43 A;  1RG6 A;  3KZI U;  3U26 A;  2F1J A;  9ICE A;  4UW9 A;  1NOM A;  4LVS A;  5KFG A;  1BPB A;  2JH7 A;  1V38 A;  4F5N A;  4UB3 A;  3BZC A;  4B9S A;  1KLN A;  2JEJ A;  5EE0 A;  1T3Q A;  2BDU A;  1JXL A;  4ED0 A;  4CF5 A;  3C5G A;  2FLN A;  4YMN A;  4C7Y A;  2KIC A;  3Q8K A;  2W9A A;  3EPG A;  5KFO A;  2H3Q A;  4OO1 J;  7ICT A;  3RJI A;  2XID A;  1QSS A;  8ICH A;  3N7S C;  5KG1 A;  3C1Y A;  5KT2 A;  1L8L A;  5L1M A;  2LYB A;  4I2E A;  2ASJ A;  3H40 A;  5JU5 A;  3E0F A;  8ICA A;  3SI8 A;  4DFK A;  2R8H A;  1KKX A;  3PW5 A;  4O3Q A;  2ZXH A;  4NY8 A;  1M6Y A;  2FI1 A;  2BQU A;  2AQ4 A;  9ICQ A;  4RT2 A;  8ICT A;  1S9F A;  3KBB A;  3D2N A;  5ALT A;  5K4L A;  4DFP A;  4QZF A;  4HAI A;  2YB1 A;  1TAM A;  2AXT U;  3V72 A;  3QYP A;  1UPH A;  5KL1 B;  4ED2 A;  5DG7 A;  5J0X A;  7ICF A;  4J03 A;  5GTH U;  4RUA A;  5KG0 A;  7ICV A;  3O0F A;  3MFH A;  2JMG A;  3FM9 A;  1FFV A;  3BQ2 A;  3DDH A;  3I76 A;  2K4I A;  1KRP A;  2OWO A;  5ALE A;  3QU9 A;  1NJX A;  3RB3 A;  1ZQZ A;  2QB0 B;  2RRD A;  2H3Z A;  3JPQ A;  3C2L A;  2WFA A;  5AHX A;  5KFQ A;  9ICK A;  4Z6E A;  1NK7 A;  3PY8 A;  2M9N A;  3RH4 A;  1QQ7 A;  5CEH A;  4JV2 A;  2HVH A;  2MU2 A;  2NRZ A;  5BOL A;  5ALN A;  2FMQ A;  3D2S A;  3QNM A;  7ICP A;  7ICJ A;  3ZDD A;  2NV3 A;  2W9B B;  2KJ9 A;  1NJZ A;  1RDF A;  5DG9 A;  1B22 A;  5CJ7 A;  2CRX A;  2F76 X;  4F5R A;  3AU6 A;  5ALI A;  5F3X B;  5AK4 A;  1V85 A;  4P0Q B;  1TV9 A;  4BWJ A;  1HUZ A;  2UVR A;  1ECW A;  8ICS A;  4OJ6 A;  2DGZ A;  3BQT A;  1WWV A;  4NLB A;  3HIL A;  1LV5 A;  3UMB A;  5J2E A;  1ZRM A;  5KFW A;  2KIW A;  2W9M A;  4DEZ A;  5D46 A;  5KG5 A;  4DOB A;  2GH1 A;  4IR1 A;  2JV3 A;  2Y1I A;  4UB8 U;  2D3D A;  2I6X A;  5ALZ A;  1SKS A;  4FZM A;  4UAW A;  3UQ0 A;  1HJP A;  2VJ4 A;  2W03 A;  3NGD A;  3GIK A;  2E8P A;  3I28 A;  4YR3 A;  4QZD A;  4R8U B;  3QU2 A;  1T7P A;  1NKB A;  1ZQO A;  4C0Z A;  5AM3 A;  1OUQ A;  1ARO P;  2ZIX A;  1NKE A;  9ICL A;  3QU4 A;  4QIW C;  2WAQ F;  3WU2 U;  3FC4 A;  1UA0 A;  4CCH A;  2CN1 A;  3H4B A;  4KLD A;  3PW7 A;  3DV9 A;  1PK1 A;  3IHQ B;  9ICA A;  4QWA A;  3NS1 A;  1JN3 A;  5DKW A;  3V6H A;  4EX6 A;  1X6J A;  1BPD A;  5J2D A;  2KVS A;  3G6X A;  4DSL A;  2MSN A;  2FMP A;  2B21 A;  4NLZ A;  4ECW A;  3SR6 A;  2HHU A;  5G5H A;  1KEJ A;  4NLN A;  2DL0 A;  9ICP A;  3ZDE A;  2DUY A;  3LYS A;  4OD0 A;  4US9 A;  3RRH A;  5KFK A;  4I2B A;  4DSI A;  4ED6 A;  4RNN A;  3OSP A;  2R8K A;  2XIC A;  5DBB A;  3WKC A;  4UB1 A;  1U48 A;  2C2E A;  1NK8 A;  4DQP A;  4KTQ A;  2KP7 A;  4CF4 A;  1SGG A;  8ICJ A;  3L4P A;  5AM1 A;  5AKG A;  2KTQ A;  3SZ2 A;  1X9S A;  3ISD A;  1SKR A;  3EUB 2;  1RYU A;  5III A;  4B9T A;  5KFS A;  5DLG A;  4I27 A;  3K4G A;  3AM9 A;  3FDS A;  2P66 A;  5AM0 A;  4DFM A;  5J2G A;  3AEV A;  3AL0 B;  3H7I A;  3AUO A;  4EZ9 A;  5AI5 A;  4F5O A;  4M0A A;  3KFU F;  4DQI A;  2BHN A;  4DL4 A;  2M0N A;  9ICF A;  4F4X A;  1NK4 A;  5L1K A;  2JZB A;  4P0P B;  1F44 A;  2BQ3 A;  2YQE A;  3N7P D;  3RB4 A;  3C28 A;  3IV6 A;  3AMZ A;  3TAP A;  5DB8 A;  4E0D A;  2Y1J A;  4QZG A;  3PSP A;  5EWE A;  3RFA A;  8ICW A;  4ECX A;  2J6S A;  1L3T A;  3GII A;  4KLG A;  2WF8 A;  4ECT A;  1A0P A;  2RDI A;  2JGA A;  4CF3 A;  5KFR A;  3GV5 B;  4CRX A;  2EZZ A;  2UVV A;  2G5H B;  5KFE A;  2MUT A;  1ZD3 A;  1UCV A;  1H38 A;  1ZD2 P;  2NRV A;  5AKZ A;  4KLO A;  1ZQ1 C;  1DRG A;  4MFF A;  2I1Q A;  4DL6 A;  2KZZ A;  2F8L A;  2IHM A;  2LI6 A;  3MGI A;  4ED1 A;  2W9C B;  2N1R A;  3QUT A;  4R65 A;  9ICR A;  1KTQ A;  4B9M A;  2Y0S C;  2AHO B;  2A19 A;  3WK8 A;  4DF8 A;  1MQ3 A;  5HML A;  2ALZ A;  2KMD A;  2P6U A;  4UAR A;  4DOA A;  1ED1 A;  3N4M B;  1XO1 A;  2KFZ A;  5ALP A;  2ZXI A;  1ZQN A;  3IG8 A;  5ALM A;  3SAG A;  2QKQ A;  2ZIW B;  3HKZ C;  4ELT A;  2OCE A;  3UM9 A;  3IM1 A;  1KN5 A;  2FPM A;  9ICS A;  1Z19 A;  3LVW A;  2KJ5 A;  4DF4 A;  4JB3 A;  3Q8Q B;  4ED3 A;  1L3U A;  1S10 A;  4GC6 A;  3C2M A;  5AKL A;  4GXK A;  2OEH A;  4ECU A;  2OM6 A;  2VKQ A;  8ICQ A;  4TUR A;  4IQT A;  1LKY B;  4YD1 A;  4DL5 A;  4JV1 A;  1BNO A;  9ICT A;  4EX7 A;  4IRD A;  3RR7 A;  1ZQE A;  4PPX A;  3M6K A;  2BR0 A;  4QWD A;  1QSL A;  3KZX A;  1TFR A;  3OSN A;  1T94 A;  2HMX A;  1FEZ A;  4KN4 A;  7ICN A;  9ICG A;  3OPX A;  4UB4 A;  4IC9 A;  3HW8 A;  1V97 A;  2ZIU B;  4MEY A;  1COO A;  2E8N A;  4DOC A;  3WK9 A;  3M9O B;  2ZUD A;  3D2Q A;  4AYB C;  3MR6 A;  5CRX A;  5KT6 A;  3WKE A;  4C80 A;  5TZV A;  3IRU A;  5DGB A;  4JV0 A;  1U45 A;  1J97 A;  2IOF A;  2YX8 A;  4HYK A;  1ZQX A;  4NJ8 A;  1ZJM A;  4Y2P A;  4KLM A;  1NJW A;  3KHH A;  4EBE A;  2AH5 A;  2DPJ A;  3TAC B;  1NKC A;  1N62 A;  3NVW A;  2AGO A;  3IDW A;  4EBD A;  1ZQT A;  4C4R A;  3C1Z A;  3V7J A;  3WKA A;  1NNL A;  1T8E A;  1DGJ A;  3AN1 A;  1ZQP A;  1B4F A;  3Q8P B;  2WHE A;  1XS9 D;  5TIS U;  3KHL A;  1SL1 A;  4UBB A;  4Y2U A;  2KK0 A;  2LMR A;  2QB0 A;  9ICJ A;  1Z1V A;  2Y9U A;  4QZ8 A;  3HWT A;  3C29 A;  3RB6 A;  4O5K A;  1ZQQ A;  4IR9 A;  4EEK A;  2I9G A;  1RPL A;  2EAP A;  2EDU A;  4O3R A;  3M8R A;  5ALD A;  1Q3U A;  5JTI A;  2G06 A;  2E5S A;  3A0B U;  3KHR A;  1IIP A;  3H0M B;  2DF4 B;  5L9X A;  2LKY A;  3JPN A;  2K60 A;  2W9B A;  3MR2 A;  4YXM A;  3C5F A;  2WB1 F;  1KSP A;  4PH5 A;  2J6T A;  2LPE A;  3QE9 Y;  2MRL A;  3RF9 A;  2DKZ A;  1CI4 A;  8ICO A;  4P0Q A;  4NXZ A;  2F8K A;  2NRW A;  2VAN A;  3CYM A;  2Q0Z X;  5D49 A;  2HVI A;  4KIT B;  4F71 A;  4YMM A;  3RJE A;  1C7Y A;  4I28 A;  1SKW A;  2OHF A;  1ZQY A;  3FYH A;  5B5E U;  4I2D A;  2HBJ A;  1K1S A;  3HT3 A;  3QXG A;  3ORY A;  3H8J A;  1Z3E B;  4YXJ A;  4MEX A;  5AM2 A;  4M9N A;  4F93 B;  4QJF B;  4ELV A;  5KFN A;  1T4G A;  5H2F U;  5DBA A;  3R9K A;  2JR5 A;  4IQV A;  3EYZ A;  5J0P A;  2DWQ A;  5KFM A;  1WCN A;  1QTM A;  2K8A A;  1L8O A;  8ICZ A;  5CB1 A;  3KHG A;  4R8U A;  4RQ3 A;  4C8L A;  4RU9 A;  2E1F A;  3UXN A;  2JEG A;  2ZTD A;  2KG5 A;  4PHD A;  4TUP A;  3DEE A;  4UB6 U;  1KBU A;  1RM6 C;  4O3S A;  5CWR A;  1MSW D;  2ZIV B;  4BGD A;  1D8B A;  2ASL A;  1ZQI A;  1IM4 A;  2A1J B;  4MF2 A;  5KFH A;  2JEF A;  5IIM A;  4IRK A;  2D8C A;  3ETL A;  1WUD A;  1Q3V A;  4K4I A;  4KLI A;  1S97 A;  1U49 A;  5JRT A;  1TKD A;  1SL0 A;  7ICU A;  3ALR A;  2B0C A;  2GWS A;  2RQ5 A;  3GIL A;  2BPG A;  3V7K A;  2W8L A;  3BJY A;  2K4H A;  1QCK A;  3LWM A;  4NV0 A;  1SWW A;  3M8S A;  3BQ1 A;  4P4P A;  4JMU A;  7ICK A;  3PX0 A;  4DCC A;  4PZN A;  1DOQ A;  9ICN A;  2ISO A;  2OXO A;  4A8E A;  2EAM A;  3RH6 A;  4RQM A;  5ALL A;  3F2B A;  4R66 A;  3E58 A;  8ICK A;  7ICQ A;  4PHA A;  4P2H A;  4PL2 A;  3BDP A;  4M04 A;  4KLL A;  8ICY A;  3OHB A;  1TK5 A;  9ICH A;  3M1Y A;  2K89 A;  5KFJ A;  4DWI A;  5ALK A;  5GTI U;  5J2F A;  4OJP A;  5L1I A;  1WWU A;  1S77 D;  4KLS A;  8ICM A;  1J2N A;  4QW9 A;  3UMC A;  4EYI B;  4MF8 A;  1B0X A;  3SV4 A;  5ALO A;  2F2A B;  5DQI A;  1DGS A;  4J9P A;  1RZT A;  1L7N A;  4M9G A;  3RR8 A;  4GXI A;  2FDR A;  5AIA A;  2KOB A;  1ZQH A;  1ZD4 A;  5EWG A;  3QEB Z;  2IOF K;  2AQ0 A;  5AI0 A;  1DK3 A;  2KEY A;  4YD2 A;  3TAD C;  2PKE A;  4DQR A;  4F4Z A;  1A6S A;  2YY6 A;  1P7D A;  1OXJ A;  3K1Z A;  4J9M A;  4F3O A;  1ZQK A;  5J0Q A;  5HHI A;  4RQ8 A;  3L3F X;  2AGP A;  5KG4 A;  4XA5 A;  3RJF A;  4RZR A;  1XSL A;  3AQE A;  2LYH A;  4Y2J A;  1DXS A;  1SV0 A;  2PXI A;  4J9S A;  1XO0 A;  3AU2 A;  3K75 D;  4AYB F;  4F91 B;  1HEK A;  3PX4 A;  1ZQA A;  5IIJ A;  3M7D A;  3M9M B;  5ALH A;  1NK9 A;  5FP0 A;  1QSY A;  4FZL A;  1JUD A;  3NAS A;  5EE9 A;  1DK2 A;  4DSE A;  2W9C A;  1PVQ A;  2H3I A;  2I5H A;  3SAF A;  4Q45 A;  4KLE A;  4BJQ A;  4FZN A;  3EPI A;  1JAL A;  2BCR A;  4MHV A;  4NL9 C;  4DFJ A;  3RJH A;  4EEN A;  2ES6 A;  4QZI A;  7ICI A;  3SEN A;  3WKB A;  5EOZ A;  1FIQ A;  5T14 A;  2VA8 A;  1BPZ A;  3LK9 A;  2ZIW A;  1ZQG A;  3L5K A;  8ICB A;  4C8K A;  1WG8 A;  2G07 A;  3PR5 B;  1SV4 A;  4O0I A;  1LVH A;  3LDA A;  2BPF A;  3UQ2 A;  3QU7 A;  4I2J A;  2W04 A;  4PZO A;  4TQR A;  2P35 A;  3RAQ A;  5B66 U;  4USA A;  2PFP A;  2PMZ F;  4ZOH C;  3F2D A;  8ICX A;  5KT4 A;  2GLE A;  3T5L A;  1X9X A;  2C22 A;  2UVW A;  1V9P A;  9ICV A;  4GXJ A;  1QQ6 A;  1LKY A;  4I2C A;  4FE3 A;  3PO5 A;  2HI0 A;  2PFN A;  4MFC A;  4ED8 A;  3OTQ A;  1XC9 A;  4MFA A;  5CHG A;  4KX5 A;  2K8B B;  1X40 A;  5AI8 A;  2V9W A; 
#chains in the Genus database with same CATH homology
 2O6K A;  2FJ6 A;  2KVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...