2O6KA

Crystal structure of upf0346 from staphylococcus aureus. northeast structural genomics target zr218.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
72
structure length
72
Chain Sequence
YSFYQFVMTVRGRHDDKGRLAEEIFDDLAFPKHDDDFNILSDYIETHGDFTLPMSVFDDLYEEYTEWLKFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of UPF0346 from Staphylococcus aureus. Northeast Structural Genomics target ZR218.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
molecule keywords UPF0346 protein MW1311
total genus 24
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2o6kA00
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH superfamily
3PX6A 1AQ6A 2DGZA 2RDIA 3PW0A 4YVZA 8ICRA 7ICRA 1NKBA 1COOA 1BNPA 4DQRA 4E0DA 4GLXA 7ICEA 4BWMA 2NYVA 3H8JA 4UASA 4BGDA 4YN4A 4KMUA 2MUTB 4Y2SA 1OW5A 3KHHA 3PW2A 5AKGA 4UBBA 3OHBA 2Y9UA 1NNLA 4XRHA 2YMPA 3CP8A 3UMCA 4IRKA 4I2FA 5J0SA 4M9HA 3RTVA 3H8SA 4CF3A 3UQ2A 4QZEA 3CRXA 5KFMA 1ZQQA 2BQRA 4DFKA 4B9SA 5JTIA 2ZIVA 3F5EA 2R8HA 7ICIA 3TARA 2K4EA 4PGYA 2E1FA 2ZXHA 4DL4A 4MFAA 1LB2B 2KKVA 5DB7A 5J2IA 2HHSA 2VA8A 4NXZA 4O3NA 2KJ9A 3SMVA 4YR0A 7ICNA 3SAFA 1KTQA 1JALA 3AQEA 9ICUA 4ED0A 2GH1A 4MHVA 3PZPA 3RAXA 2KJ5A 1FEZA 2ES6A 1UHUA 2IOFK 2A1JB 3HKZF 4R64A 4KX5A 2ZUDA 4B9LA 4F8RA 4JMUA 4B9TA 4BX9C 2IHMA 4JUZA 5KFXA 3MR3A 5L1JA 4C8MA 2E1EA 4KLDA 2M0NA 3G6YA 1N5XA 4ED7A 2H3ZA 4YP3A 2AJQA 1ZQSA 2KHVA 1N63A 1ZQCA 2IA6A 2ZIUB 2AGPA 3EZ5A 2KOBA 2FMQA 2QB0A 4RQ7A 2QB0B 3Q8MA 2O6KA 4IQVA 1IV8A 4OJ6A 2HOIA 1C7YA 4QWBA 3V6HA 2WF9A 1WCLA 2F44A 2HHXA 4NY8A 3MGIA 2NRXA 4OJPA 3ISDA 2BKEA 5EE9A 3JPOA 3H0RB 1SXEA 4TUSA 2FLPA 1WWVA 4KMOB 1X66A 4UAYA 3SQIA 4C0ZA 3PO5A 3PVXA 5KFPA 4I2IA 5DG9A 1HUOA 3G6XA 1BPXA 4C8OA 1A76A 2UVWA 3ETLA 4IRDA 8ICJA 4Z6EA 4CCHA 3O0FA 4F4ZA 4DS5A 5AI4A 3QNMA 4Y2XA 4EBEA 4F72A 2KIVA 3LWMA 2E3TA 2BQ3A 5DG8A 3EWAA 3BZKA 4BDPA 2A3VA 2MAXA 3KZIU 5EE1A 2P6RA 2UVRA 4RUAA 3H8MA 1RDFA 1WWUA 5JRTA 1BPZA 2LM4A 2C2EA 3M9MB 1S0OA 1TAUA 4YD2A 5DBAA 4KLIA 3H40A 4GIBA 2W9BB 2W9BA 1SKWA 4O3SA 5KAIU 3WKEA 2JH7A 1RQLA 4Y2VA 2ZIVB 4QZHA 3OJSA 1TK8A 2BPFA 2KFZA 2HHTA 1Z19A 4PL2A 1Q3VA 1U4BA 1SL1A 5ALVA 8ICVA 2W43A 4OCZA 2UVVA 3OSPA 4O3OA 1D9FA 4QZ8A 1CUKA 2VKQA 2HHUA 3QXGA 1LKYA 4FZLA 8ICXA 4KN7A 2F3NA 2Y0SC 2F77X 3VC8A 4EX6A 2BCQA 1L3SA 1ZQEA 5KFNA 3FDSA 4GC6A 4G9BA 4F93B 2CRXA 3ISBA 4EBCA 4RQ0A 1FFUA 4DSEA 3D2NA 4CE6A 4QW9A 1S10A 4I2BA 4YMNA 2Y0SF 4F4XA 2JV3A 5J0TA 2ZXIA 4NM2A 5EWEA 1RM6C 2KG5A 1ZQPA 1ZQIA 8ICYA 2XI9A 3D2SA 3PSPA 4CF5A 2CN1A 4NLBA 3RR7A 2RHFA 4DSFA 5A0LA 2ZIUA 4YMOA 4UB6U 1TFRA 3C23A 4FBUA 9ICKA 5DQGA 2V4QA 8ICSA 5D46A 2ZJ5A 5J2GA 4O3PA 5IIOA 3TFRA 4KLGA 5AI9A 2QARB 3UPQA 2YX8A 3GIJA 3SD7A 2JEFA 3ZDAA 5AKKA 1ZQ1C 2BCSA 1ZXIA 2Y9TA 4J9KA 3M9NB 1N5WA 4DWIA 2MUTA 3QU5A 4JK1A 5KT7A 3ONNA 2VJ5A 4MEXA 4QZIA 1TKDA 2R8GA 3Q8PB 4K4HA 2JGAA 1Z3EB 2NRVA 1SWVA 3M9OB 3OTQA 3NTUA 4QZDA 1L3VA 2MRLA 5ALIA 5J2HA 3WK9A 1WYGA 1J97A 2RQ5A 5DDMA 3I28A 2RLTA 3OPXA 4ECVA 1A6SA 4M6WA 1XSNA 3UM9A 4NM1A 3JPTA 3FAHA 5BOLA 2BCRA 4M9GA 5AK5A 3ISCA 3TQ1A 2RDJA 2BCVA 2IHNA 7ICVA 5DGBA 3F2DA 4B9MA 2L5YA 5KFFA 3UMBA 2LHTA 4RPZA 4DL5A 4QWDA 3GDXA 7ICFA 2W9CA 1ZETA 4US8A 4UB8U 3AM9A 3M7DA 3WK5A 1VJ5A 1S97A 3C2MA 3PMNA 5KG0A 2E8NA 3V72A 3RB3A 5KG7A 1S5LU 1QCKA 2DF4B 2Y1JA 1WG8A 2HHQA 4I2DA 2EQYA 3Q8SB 2H3QA 5DBCA 4IRCA 2OXOA 3T5HA 1M6YA 2XGPA 3ZDCA 5J0PA 2HHWA 4PH5A 3MR5A 1ECWA 4O3MA 4HAIA 4YCXA 4J9QA 1PZNA 1NKEA 9ICJA 2XVTA 3TAQA 4F5QA 1V85A 4I2AA 1JROA 5K4LA 2R18A 2PMZF 1X2IA 4Y2TA 2W9MA 2AGOA 4RQ1A 5KFQA 1PK1B 2EDUA 5AK6A 2KVSA 2KIWA 3BQ1A 5DQIA 2RRDA 4TQRA 5ALTA 3RH5A 5KFSA 5L1LA 1XC9A 4NV0A 1KEJA 1CI4A 1OXJA 4O9MA 5ALOA 1QQ7A 4B9NA 3IM1A 3BQ2A 3DV9A 2FE9A 1XO1A 5ALDA 4ELUA 1TK5A 2H3IA 3LVVA 2KNJA 4IQTA 2FPKA 2DBYA 3QYPA 2KTQA 1DGJA 4M9NA 2KP7A 2KJ8A 4QIWF 1Q3UA 3NVVA 5AIAA 4UBCA 1S77D 2HBLA 1DK2A 1ZQGA 2MA1A 2ZIXA 3I1YA 3QEAZ 7ICTA 3NVYA 1TVAA 4YD1A 5D4BA 5ALLA 5ALPA 3RJJA 4J9NA 4GXJA 3L3FX 1YZ6A 3MFIA 5KFWA 1QSLA 4C8NA 1HIWA 5DQHA 4F4KA 2HOQA 2HI0A 3N7SC 3UXNA 3N7PD 5ALSA 2W9CB 3NRZA 3D2QA 3AN1A 5KG3A 2OYYA 4CF4A 2ASJA 2CXYA 1DRGA 5J0XA 4J9OA 2BGWA 2AHOB 1TK0A 5T14A 1WUDA 4DL7A 4TUPA 3BZCA 1X40A 2WB1C 4F91B 2EAPA 2JZBB 3SR6A 2XO7A 3ORYA 1NKCA 5J2FA 2QARA 3JPSA 3IN5A 1N56A 3B9JA 4P2HA 1KN5A 1T3QA 3CYMA 5L1IA 4I2GA 4XA5A 2Q0ZX 4MF2A 4PL1A 3AU6A 1PVQA 3GV8B 1Z1VA 3SV3A 2BR0A 5ALRA 2VA3A 4OD0A 5AK3A 4C4TA 7ICQA 3M6ZA 3RR8A 5AI0A 3C21A 1F5SA 3NRWA 5G5GA 2K4IA 5KFYA 1B43A 8ICAA 3PSIA 3KKAA 3NGDA 1QTMA 3A0HU 5KG4A 4RT3A 3C28A 4UAVA 5AKZA 5BPCA 3SZ2A 3B0XA 4DOAA 4F4WA 2XY6A 2F8KA 1DGSA 1XSPA 5JU5A 9ICTA 1J2MA 3AUOA 3T79A 1RYSA 1B22A 4WJ3B 1S9FA 1XWLA 2WB1F 3ZDDA 3SYZA 2QLTA 5J8YA 3JPNA 5ALYA 2K4PA 3AU2A 3OJUA 1SXDA 3SV4A 4PHAA 3C1YA 4KLMA 9ICEA 1NZPA 5L1KA 4BJQA 3V7JA 4IQWA 5KFEA 1NZBA 3IG5A 3MDCA 2ZIWA 4ECXA 2VANA 1SV0A 2LYAA 1SGGA 1BPDA 3NVZA 2DPIA 2EZYA 5IILA 3KHGA 7ICGA 2C28A 9ICBA 4JV0A 5DDYA 5AM2A 1T7PA 3GQCA 4RQ6A 3UMGA 1QSYA 4EENA 2ZTCA 2HHVA 4UB2A 3M8RA 1N62A 1RYRA 2BPCA 1S8OA 5ALNA 2FDRA 2YN4A 5KFDA 5J8YC 3D6JA 4JV1A 1U9LA 4NLZA 5J2KA 5J2CA 5C0YA 2KEYA 3PSFA 1KFTA 1Z4NA 4C8LA 2H3VA 3MABA 2HMXA 4TURA 4J9LA 1JXLA 1J2NA 2ZTDA 3L4PA 1QLNA 3IDWA 4DSKA 4ECSA 1ZQLA 3ZDEA 3QUBA 4C4SA 2OEHA 3H4BA 3UXPA 3C29A 2OHFA 5IIIA 1X9MA 3HP6A 2FMPA 1P7DA 2IOHA 3QX7A 2WF6A 1ED1A 2HVHA 2WAQC 4USAA 3EPGA 4ACOA 4KTQA 4FS2A 3F53A 4DEZA 5KTQA 8ICNA 1KLNA 5KFAA 1ZYQA 5ALZA 1NJXA 3WKBA 4Z6DA 5KFKA 5FP0A 2XCPA 1B0XA 1ZQBA 3RRGA 5CR0A 1VDVA 3RJKA 2JEJA 2FPLA 4PZNA 7ICJA 3BS7A 4Y2YA 9ICQA 1Y88A 4FE3A 3JPQA 1ZQVA 5HR7A 1SL0A 3R9KA 4QIWC 4P0QB 2B0CA 3F5AA 2XICA 4CGZA 2EZZA 8ICZA 4KLUA 4JV2A 3M1YA 1CRXA 2WF8A 1ZQZA 4U7CA 3ETRA 4P0PA 5AIBA 4UARA 3MR6A 4J03A 1A0PA 1L7NA 4RNMA 5J2DA 2LI6A 4XUSA 2R8JA 5J0QA 2HDOA 5AKLA 3ED5A 5C5JA 5ALGA 2PMZC 1BPEA 5AI6A 3RBEA 2V9WA 3KOOA 3OSNA 3KBBA 4OJOA 5CWRA 4ECRA 1ZQMA 3N7RC 3C2LA 4NJ8A 4ICAA 5ALMA 5HHIA 4Q8FA 4DLGA 3RRHA 5J0OA 3WKCA 5CA7A 2F76X 2KD1A 2VJ4A 8ICOA 2ZUCA 2D3DA 2ISOA 2BDUA 4RZRA 4ED2A 1Z00B 2H5XA 3RB4A 5G5HA 4C7YA 3C1ZA 4DL2A 7ICLA 1IG6A 5DBBA 5AKXA 2BZFA 2WF5A 3QU9A 4UB1A 1U48A 4PGQA 3HILA 3K1RB 3MGVA 5KT6A 4YR3A 2HBKA 4BXOB 1T8EA 4QZGA 2K89A 2R8IA 5AKYA 1V97A 2MU2A 4DL3A 2ZJ8A 3HJEA 3RJFA 4AYBF 5AKEA 4EBDA 3GFKB 4BUGA 1KFDA 3E2EA 4FFDA 4Y2PA 2AQ4A 2DPJA 4ED3A 1SB3C 3L5KA 4RNNA 2JXJA 3IHQB 3FC4A 3PSTA 2NRWA 5AKJA 5J2EA 1N48A 1HUZA 3RH6A 4DFJA 4MEYA 1LV5A 3EUB2 3QE9Y 2HBMA 3GV7B 1ZRNA 3UQ0A 3RF9A 3TANA 4ECZA 2E8MA 2W7PA 3TKAA 2W03A 4GXIA 2IBKA 4QZBA 3SAHA 3C5GA 1MQ2A 1XNSA 5EE0A 3J81j 4O3QA 4EELA 4F2SA 4EX7A 2OH2A 4F3OA 2EAMA 1MN8A 1IIPA 3NVWA 3KTQA 4RQMA 8ICTA 1N2XA 2HW3A 5AI8A 1ZJMA 4KLJA 5KG5A 5J29A 1U47A 4ECYA 2D8CA 1NK4A 4PHEA 1RXVA 3MC1A 2BHNA 1KFSA 1ZQDA 2KKPA 3G6VA 1H38A 3LDAA 5AM4A 3U26A 5AHXA 4NLGA 5KG6A 1XS9D 2KE7A 3HWTA 5KG1A 1L7OA 4RQ3A 2KZZA 3WKDA 2F1HA 4Y2RA 1T94A 4XQ8A 3AQFA 3PX4A 5ALKA 1AROP 1BPYA 3SAGA 3THVA 3PW7A 4CRXA 5F9LA 2E8PA 1ZQHA 3HKZC 1K1QA 4U6PA 5ALQA 4ECUA 4UATA 2OCEA 4KLTA 2WTFA 2NRZA 4YG2A 2F1IA 4O5EA 1Q8KA 2DQNB 3UXOA 2ALZA 4OO1J 4K4GA 2HCFA 2DUYA 1QSSA 2XY5A 3GZFA 4DF8A 3HW8A 3AEVA 4P0QA 2A19A 2H3FA 1RG6A 4GXKA 4NL9A 5AM5A 1NI3A 4M9JA 4DOBA 2WF7A 2AGQA 4ELTA 3RB0A 1L8OA 1N61A 4Z6CA 4ECQA 2EAOA 1UA0A 3QU4A 5GTIU 4DQPA 4JB3A 2EZXA 4RPYA 8ICHA 2ZIWB 3TADC 3KHLA 8ICGA 3HPOA 4M2YA 1UT5A 3SENA 1ZD4A 4YFKA 1QQ5A 4RQ4A 3NASA 5KFGA 3TFSA 3PX0A 1XO0A 4PGXA 9ICAA 2DKZA 4BXOA 5IIKA 3RJIA 1C20A 2ASLA 3PY8A 2A1AA 4DFMA 5IIMA 1L5UA 4EEYA 3WK6A 1JUDA 4JWNA 3F2CA 3V6JA 3DEEA 4NL9C 7ICUA 4KLEA 1KDHA 2PKEA 5AM1A 1ZQYA 4FZNA 4J9PA 1ZQFA 3GV5B 7ICHA 2W11A 3RB6A 4I2CA 5KFZA 8ICFA 3QUQA 4JWMA 3KHRA 7ICOA 2I1QA 4UB5A 5KFBA 4IC9A 4DOCA 3RH4A 4HYKA 2KVCA 3BS5A 4I2JA 4MFFA 4OJ5A 4MFCA 1RYUA 3ICXA 2G09A 4RNOA 4ED8A 1RXWA 3JPPA 2LM1A 2WFAA 1K5OA 2HOFA 2A1JA 3RJGA 3KD3A 1D8LA 9ICLA 2KN7A 3N97B 5J0WA 2W3SA 4UW9A 4QWAA 5KG2A 3F2BA 4F50A 4US9A 2JHDA 3PR4A 1F0MA 2ZG6A 1KL9A 4OJLA 2PFOA 4Q45A 3RJHA 4G3IA 4FBTA 3H7IA 1K1SA 1FFVA 5AKHA 2AXTU 3IP4B 2HBJA 3E58A 5KFVA 1JX4A 1URJA 4NLCA 3C2KA 3K4GA 2IMWP 2FPMA 3MDAA 5KT3A 5ALXA 3T3FA 3RJEA 3LWLA 3S6JA 1MQ3A 2BPGA 1ZQWA 3N28A 1SKRA 1JMSA 1LKYB 4DFDA 1UA1A 4ED1A 3ZD9A 5ALWA 4DQIA 4O3RA 2W9AA 9ICCA 4QJFB 1TE2A 2HVIA 5H2FU 2PI5A 4KN4A 3MR2A 3PW4A 1X9SA 4B9UA 3WK7A 5CRXA 9ICFA 5F3XB 3AL0B 1OUQA 1PK3A 4EYHB 2PFPA 2K4HA 5KFTA 1EXNA 9ICIA 1D9DA 2LYBA 3C5FA 5KT2A 4UAUA 8ICUA 1NJZA 1ZQNA 1X42A 1SV0C 2E8OA 3CNHA 8ICLA 3H8WA 1ZOLA 2LYHA 5D49A 2GWSA 4PHPA 2ASDA 1N60A 4AYBC 4YXMA 2PFNA 1B4FA 4LZGA 8ICMA 4C7ZA 1NK0A 5J2JA 3AMZA 5DLGA 3BQ7A 4UB4A 5ALHA 3V7LA 1X9XA 2I5HA 4F5NA 4I28A 3MFHA 2F1JA 4QZCA 1PVRA 9ICHA 2BDPA 8ICBA 2ZUBA 2JEGA 1ZQOA 2AH5A 1DXSA 5KFOA 4M0AA 1ZQRA 8ICEA 1NJYA 1X6JA 1BNOA 2RP5A 1ZD3A 3V6KA 3BJYA 3Q8LA 7ICKA 5KFJA 5CHGA 5EWGA 4QW8A 3PMLA 3H0MB 4DFPA 5TISU 3WKAA 1NK5A 1LVHA 2WHEA 3IG8A 3E0FA 1T3NA 2D6FC 1KW4A 2J6SA 3GIMA 2P66A 1SWWA 4P4OA 1T4GA 4UB3A 1U45A 4KLHA 4DLEA 1NK6A 9ICOA 1L8LA 4QZAA 2K8CB 2KHQA 1ZD2P 5ALUA 2ISPA 1IXRA 1BGXT 1ZQUA 4UAWA 8ICKA 2ZJAA 2B6GA 1KBUA 2G5IB 5KFCA 4Y2JA 2UVUA 2I9GA 9ICVA 2W3RA 2YQEA 1JIHA 2P6UA 1BVSA 2VIXA 4M47A 4TUQA 5HR6A 2WAQF 1PUZA 2ODGA 1SV4A 3K1ZA 3TAPA 4KX3A 4B6JA 2VA2A 2JRZA 2B21A 2P35A 2C2DA 1KQQA 1KRPA 3GU3A 4R65A 5ALEA 3BQ0A 5BOMA 2KZ3A 1JXEA 1ZJNA 2R8KA 7ICMA 2YB1A 1NK7A 3HT3A 2Z7JA 4PZOA 2W04A 4KLOA 5DB9A 2EANA 5ALFA 3Q8QB 4J9SA 3HRDD 1FIQA 2ZIXB 3QUCA 3QZ7A 4M04A 4QZ9A 2ZTEA 3I76A 3Q8KA 2F8LA 3H0LB 5KFUA 2C22A 4P4PA 2KICA 2LMRA 3OHAA 2XGQA 4YR2A 3KZXA 1Z4OA 4DF4A 4DQQA 2KSOB 2FLNA 2KSOA 5KL1B 2XC9A 1SKSA 2F2AB 3PW5A 1F44A 1L3TA 4GC7A 1Z1BA 2GO7A 2YMLA 3ALRA 1O03A 5DB8A 3WU2U 1UQVA 4R63A 5AM0A 4PJ0U 4RU9A 4M9LA 4R66A 8ICCA 2J6UA 3B0YA 4QWEA 4J9RA 4O0IA 2KMDA 4KLFA 2G5HB 7ICPA 5L1MA 2XCAA 1KKXA 4KLQA 5EWFA 4PHDA 9ICGA 4YQWA 4NWIA 2EH9A 3LYSA 5CJ7A 3KFUF 2CPRA 3EW9A 2FLLA 3PV8A 1X6IA 4PPXA 4ZH4A 2GOLA 5AICA 5JUMA 4F71A 3EPIA 2NV3A 1Q46A 2FMSA 1PVPA 1ZD5A 3M6KA 2DFLA 2JR5A 3EYZA 4IS7A 4GFJA 5E79U 1MA7A 1UPHA 4ECTA 2W8LA 1HJPA 3HX0A 5HMLA 3RFAA 5CB1A 4DL6A 4RQ5A 5KFHA 4CNQA 4I27A 1CEZA 3T5KA 3NS1A 5EE3A 1PK1A 4QWCA 1MSWD 4Q8EA 4LVSA 2YMQA 4F5OA 4J9MA 4AP9A 5DLFA 5DG7A 2FJ6A 1L7PA 1Z00A 1FO4A 4M6WB 2W8KA 2KZMA 2DKXA 4LZDA 5KFLA 4FZMA 4DS4A 4FO6A 3QUTA 5B5EU 4UAZA 1A77A 2N1RA 2PXIA 3FM9A 1XSLA 4BWJA 4Y2UA 5DKWA 5KNIA 4DSLA 2G07A 4DQSA 8ICQA 4B9VA 1V9PA 1QH9A 2E5SA 1NJWA 1X9WA 1RQNA 4RQ2A 1ZRMA 5EOZA 2XIDA 1IM4A 3FYHA 3TACB 3SI8A 2LPEA 3SEIA 1S76D 9ICPA 4UQGA 2BQUA 4IL6U 4MF8A 3LVWA 5J0YA 4DSJA 1GO3F 4R8UA 5AM3A 1D8BA 3RAQA 1COKA 1TAMA 2GLEA 5F9NA 4ECWA 4I2HA 2PFQA 2BCUA 4P4MA 5B66U 2K60A 3PO4A 5HMMA 2DWQA 1O08A 5KT5A 4P0PB 4IR1A 4F2RA 2ESEA 2J6TA 3LK9A 3NUQA 4KITB 2I6XA 2G06A 3ZI4A 5HP4A 1L7MA 5AKIA 3A0BU 4Q44A 1YT3A 3RBDA 4F4YA 4CDGA 3ZDBA 5CP2A 2PI4A 1KSPA 3JPRA 1WCNA 4C80A 4X5VA 1ZQKA 2AU0A 4RT2A 5AK4A 1TAQA 1VLBA 1ZQXA 1JI7A 2QKQA 4ZOHC 1U49A 4Q43A 5KFRA 2K8AA 4C4RA 2JEIA 5J0RA 4I29A 5L9XA 1QQ6A 3QU2A 5J0UA 3H4DA 4DCCA 1L6NA 2HSZA 1UT8A 3WK4A 4RQ8A 5KAFU 5IINA 3Q8RB 3ZD8A 4RQNA 2LKYA 2ATLA 5DB6A 3QZ8A 4RPXA 1UCVA 4EYIB 3MGHA 5TZVA 2MSNA 4IR9A 9ICRA 2NRTA 4R8UB 3PNCA 1NOMA 2KK0A 3GIIA 5J2BA 1JN3A 4K4IA 3DDHA 2JH1A 1NK8A 3IRUA 4Z6FA 1DOQA 4F5RA 5KFIA 4QNLA 4NLNA 1SZHA 2YY6A 3N4MB 5DGAA 4IQUA 9ICWA 1BPBA 4A8EA 1ZQJA 4RUCA 3BDPA 2LBOA 1SZPA 3BS5B 5IIJA 1SL2A 1L3UA 5HNKA 2Q4TA 4C8KA 4LJXA 5KT4A 1DK3A 1D8YA 4O5KA 2XY7A 4O5CA 2NO5A 4EEKA 2Y1IA 2M9NA 3PR5B 2KFNA 3GILA 3T5LA 4YMMA 2OWOA 3VCBA 1V38A 9ICMA 3WK8A 8ICPA 2JMGA 5J2AA 9ICSA 2K8BB 4NLKA 2G08A 8ICWA 5HHHA 4ELVA 4FS1A 3TADA 3KKAC 3MBYA 3BQTA 1RZTA 3M8SA 3QU7A 1JRPA 3T5JA 4EZ9A 2C2RA 1NK9A 4KLLA 4F92B 2FI1A 4ED6A 1ZQAA 4YXJA 4KLSA 4F5PA 1HEKA 5AI5A 2W7OA 4DO9A 2AQ0A 2NO4A 5KL8B 2DL0A 8ICIA 1SIJA 1S0NA 4Y2QA 3V7KA 2V4RA 9ICNA 1MC8A 2QB1A 4I2EA 2OM6A 4EZ6A 9ICXA 4TQSA 1S0MA 4QZFA 2YB4A 3CW2C 3QEBZ 2JZBA 3GIKA 4DSIA 2W54A 1TV9A 3K75D 7ICSA 5ALJA 3OGUA 1ZQTA 5CEHA 2W55A 1RPLA 2G0AA 2YMMA 3IV6A 3TI0A 5GTHU 2IOFA 1S0VA 2YTUA 1YZ7A 1XU4A 2KV2A
chains in the Genus database with same CATH topology
2O6KA 2KVSA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6K A;  2KVS A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 3PX6 A;  1AQ6 A;  2DGZ A;  2RDI A;  3PW0 A;  4YVZ A;  8ICR A;  7ICR A;  1NKB A;  1COO A;  1BNP A;  4DQR A;  4E0D A;  4GLX A;  7ICE A;  4BWM A;  2NYV A;  3H8J A;  4UAS A;  4BGD A;  4YN4 A;  4KMU A;  2MUT B;  4Y2S A;  1OW5 A;  3KHH A;  3PW2 A;  5AKG A;  4UBB A;  3OHB A;  2Y9U A;  1NNL A;  4XRH A;  2YMP A;  3CP8 A;  3UMC A;  4IRK A;  4I2F A;  5J0S A;  4M9H A;  3RTV A;  3H8S A;  4CF3 A;  3UQ2 A;  4QZE A;  3CRX A;  5KFM A;  1ZQQ A;  2BQR A;  4DFK A;  4B9S A;  5JTI A;  2ZIV A;  3F5E A;  2R8H A;  7ICI A;  3TAR A;  2K4E A;  4PGY A;  2E1F A;  2ZXH A;  4DL4 A;  4MFA A;  1LB2 B;  2KKV A;  5DB7 A;  5J2I A;  2HHS A;  2VA8 A;  4NXZ A;  4O3N A;  2KJ9 A;  3SMV A;  4YR0 A;  7ICN A;  3SAF A;  1KTQ A;  1JAL A;  3AQE A;  9ICU A;  4ED0 A;  2GH1 A;  4MHV A;  3PZP A;  3RAX A;  2KJ5 A;  1FEZ A;  2ES6 A;  1UHU A;  2IOF K;  2A1J B;  3HKZ F;  4R64 A;  4KX5 A;  2ZUD A;  4B9L A;  4F8R A;  4JMU A;  4B9T A;  4BX9 C;  2IHM A;  4JUZ A;  5KFX A;  3MR3 A;  5L1J A;  4C8M A;  2E1E A;  4KLD A;  2M0N A;  3G6Y A;  1N5X A;  4ED7 A;  2H3Z A;  4YP3 A;  2AJQ A;  1ZQS A;  2KHV A;  1N63 A;  1ZQC A;  2IA6 A;  2ZIU B;  2AGP A;  3EZ5 A;  2KOB A;  2FMQ A;  2QB0 A;  4RQ7 A;  2QB0 B;  3Q8M A;  2O6K A;  4IQV A;  1IV8 A;  4OJ6 A;  2HOI A;  1C7Y A;  4QWB A;  3V6H A;  2WF9 A;  1WCL A;  2F44 A;  2HHX A;  4NY8 A;  3MGI A;  2NRX A;  4OJP A;  3ISD A;  2BKE A;  5EE9 A;  3JPO A;  3H0R B;  1SXE A;  4TUS A;  2FLP A;  1WWV A;  4KMO B;  1X66 A;  4UAY A;  3SQI A;  4C0Z A;  3PO5 A;  3PVX A;  5KFP A;  4I2I A;  5DG9 A;  1HUO A;  3G6X A;  1BPX A;  4C8O A;  1A76 A;  2UVW A;  3ETL A;  4IRD A;  8ICJ A;  4Z6E A;  4CCH A;  3O0F A;  4F4Z A;  4DS5 A;  5AI4 A;  3QNM A;  4Y2X A;  4EBE A;  4F72 A;  2KIV A;  3LWM A;  2E3T A;  2BQ3 A;  5DG8 A;  3EWA A;  3BZK A;  4BDP A;  2A3V A;  2MAX A;  3KZI U;  5EE1 A;  2P6R A;  2UVR A;  4RUA A;  3H8M A;  1RDF A;  1WWU A;  5JRT A;  1BPZ A;  2LM4 A;  2C2E A;  3M9M B;  1S0O A;  1TAU A;  4YD2 A;  5DBA A;  4KLI A;  3H40 A;  4GIB A;  2W9B B;  2W9B A;  1SKW A;  4O3S A;  5KAI U;  3WKE A;  2JH7 A;  1RQL A;  4Y2V A;  2ZIV B;  4QZH A;  3OJS A;  1TK8 A;  2BPF A;  2KFZ A;  2HHT A;  1Z19 A;  4PL2 A;  1Q3V A;  1U4B A;  1SL1 A;  5ALV A;  8ICV A;  2W43 A;  4OCZ A;  2UVV A;  3OSP A;  4O3O A;  1D9F A;  4QZ8 A;  1CUK A;  2VKQ A;  2HHU A;  3QXG A;  1LKY A;  4FZL A;  8ICX A;  4KN7 A;  2F3N A;  2Y0S C;  2F77 X;  3VC8 A;  4EX6 A;  2BCQ A;  1L3S A;  1ZQE A;  5KFN A;  3FDS A;  4GC6 A;  4G9B A;  4F93 B;  2CRX A;  3ISB A;  4EBC A;  4RQ0 A;  1FFU A;  4DSE A;  3D2N A;  4CE6 A;  4QW9 A;  1S10 A;  4I2B A;  4YMN A;  2Y0S F;  4F4X A;  2JV3 A;  5J0T A;  2ZXI A;  4NM2 A;  5EWE A;  1RM6 C;  2KG5 A;  1ZQP A;  1ZQI A;  8ICY A;  2XI9 A;  3D2S A;  3PSP A;  4CF5 A;  2CN1 A;  4NLB A;  3RR7 A;  2RHF A;  4DSF A;  5A0L A;  2ZIU A;  4YMO A;  4UB6 U;  1TFR A;  3C23 A;  4FBU A;  9ICK A;  5DQG A;  2V4Q A;  8ICS A;  5D46 A;  2ZJ5 A;  5J2G A;  4O3P A;  5IIO A;  3TFR A;  4KLG A;  5AI9 A;  2QAR B;  3UPQ A;  2YX8 A;  3GIJ A;  3SD7 A;  2JEF A;  3ZDA A;  5AKK A;  1ZQ1 C;  2BCS A;  1ZXI A;  2Y9T A;  4J9K A;  3M9N B;  1N5W A;  4DWI A;  2MUT A;  3QU5 A;  4JK1 A;  5KT7 A;  3ONN A;  2VJ5 A;  4MEX A;  4QZI A;  1TKD A;  2R8G A;  3Q8P B;  4K4H A;  2JGA A;  1Z3E B;  2NRV A;  1SWV A;  3M9O B;  3OTQ A;  3NTU A;  4QZD A;  1L3V A;  2MRL A;  5ALI A;  5J2H A;  3WK9 A;  1WYG A;  1J97 A;  2RQ5 A;  5DDM A;  3I28 A;  2RLT A;  3OPX A;  4ECV A;  1A6S A;  4M6W A;  1XSN A;  3UM9 A;  4NM1 A;  3JPT A;  3FAH A;  5BOL A;  2BCR A;  4M9G A;  5AK5 A;  3ISC A;  3TQ1 A;  2RDJ A;  2BCV A;  2IHN A;  7ICV A;  5DGB A;  3F2D A;  4B9M A;  2L5Y A;  5KFF A;  3UMB A;  2LHT A;  4RPZ A;  4DL5 A;  4QWD A;  3GDX A;  7ICF A;  2W9C A;  1ZET A;  4US8 A;  4UB8 U;  3AM9 A;  3M7D A;  3WK5 A;  1VJ5 A;  1S97 A;  3C2M A;  3PMN A;  5KG0 A;  2E8N A;  3V72 A;  3RB3 A;  5KG7 A;  1S5L U;  1QCK A;  2DF4 B;  2Y1J A;  1WG8 A;  2HHQ A;  4I2D A;  2EQY A;  3Q8S B;  2H3Q A;  5DBC A;  4IRC A;  2OXO A;  3T5H A;  1M6Y A;  2XGP A;  3ZDC A;  5J0P A;  2HHW A;  4PH5 A;  3MR5 A;  1ECW A;  4O3M A;  4HAI A;  4YCX A;  4J9Q A;  1PZN A;  1NKE A;  9ICJ A;  2XVT A;  3TAQ A;  4F5Q A;  1V85 A;  4I2A A;  1JRO A;  5K4L A;  2R18 A;  2PMZ F;  1X2I A;  4Y2T A;  2W9M A;  2AGO A;  4RQ1 A;  5KFQ A;  1PK1 B;  2EDU A;  5AK6 A;  2KVS A;  2KIW A;  3BQ1 A;  5DQI A;  2RRD A;  4TQR A;  5ALT A;  3RH5 A;  5KFS A;  5L1L A;  1XC9 A;  4NV0 A;  1KEJ A;  1CI4 A;  1OXJ A;  4O9M A;  5ALO A;  1QQ7 A;  4B9N A;  3IM1 A;  3BQ2 A;  3DV9 A;  2FE9 A;  1XO1 A;  5ALD A;  4ELU A;  1TK5 A;  2H3I A;  3LVV A;  2KNJ A;  4IQT A;  2FPK A;  2DBY A;  3QYP A;  2KTQ A;  1DGJ A;  4M9N A;  2KP7 A;  2KJ8 A;  4QIW F;  1Q3U A;  3NVV A;  5AIA A;  4UBC A;  1S77 D;  2HBL A;  1DK2 A;  1ZQG A;  2MA1 A;  2ZIX A;  3I1Y A;  3QEA Z;  7ICT A;  3NVY A;  1TVA A;  4YD1 A;  5D4B A;  5ALL A;  5ALP A;  3RJJ A;  4J9N A;  4GXJ A;  3L3F X;  1YZ6 A;  3MFI A;  5KFW A;  1QSL A;  4C8N A;  1HIW A;  5DQH A;  4F4K A;  2HOQ A;  2HI0 A;  3N7S C;  3UXN A;  3N7P D;  5ALS A;  2W9C B;  3NRZ A;  3D2Q A;  3AN1 A;  5KG3 A;  2OYY A;  4CF4 A;  2ASJ A;  2CXY A;  1DRG A;  5J0X A;  4J9O A;  2BGW A;  2AHO B;  1TK0 A;  5T14 A;  1WUD A;  4DL7 A;  4TUP A;  3BZC A;  1X40 A;  2WB1 C;  4F91 B;  2EAP A;  2JZB B;  3SR6 A;  2XO7 A;  3ORY A;  1NKC A;  5J2F A;  2QAR A;  3JPS A;  3IN5 A;  1N56 A;  3B9J A;  4P2H A;  1KN5 A;  1T3Q A;  3CYM A;  5L1I A;  4I2G A;  4XA5 A;  2Q0Z X;  4MF2 A;  4PL1 A;  3AU6 A;  1PVQ A;  3GV8 B;  1Z1V A;  3SV3 A;  2BR0 A;  5ALR A;  2VA3 A;  4OD0 A;  5AK3 A;  4C4T A;  7ICQ A;  3M6Z A;  3RR8 A;  5AI0 A;  3C21 A;  1F5S A;  3NRW A;  5G5G A;  2K4I A;  5KFY A;  1B43 A;  8ICA A;  3PSI A;  3KKA A;  3NGD A;  1QTM A;  3A0H U;  5KG4 A;  4RT3 A;  3C28 A;  4UAV A;  5AKZ A;  5BPC A;  3SZ2 A;  3B0X A;  4DOA A;  4F4W A;  2XY6 A;  2F8K A;  1DGS A;  1XSP A;  5JU5 A;  9ICT A;  1J2M A;  3AUO A;  3T79 A;  1RYS A;  1B22 A;  4WJ3 B;  1S9F A;  1XWL A;  2WB1 F;  3ZDD A;  3SYZ A;  2QLT A;  5J8Y A;  3JPN A;  5ALY A;  2K4P A;  3AU2 A;  3OJU A;  1SXD A;  3SV4 A;  4PHA A;  3C1Y A;  4KLM A;  9ICE A;  1NZP A;  5L1K A;  4BJQ A;  3V7J A;  4IQW A;  5KFE A;  1NZB A;  3IG5 A;  3MDC A;  2ZIW A;  4ECX A;  2VAN A;  1SV0 A;  2LYA A;  1SGG A;  1BPD A;  3NVZ A;  2DPI A;  2EZY A;  5IIL A;  3KHG A;  7ICG A;  2C28 A;  9ICB A;  4JV0 A;  5DDY A;  5AM2 A;  1T7P A;  3GQC A;  4RQ6 A;  3UMG A;  1QSY A;  4EEN A;  2ZTC A;  2HHV A;  4UB2 A;  3M8R A;  1N62 A;  1RYR A;  2BPC A;  1S8O A;  5ALN A;  2FDR A;  2YN4 A;  5KFD A;  5J8Y C;  3D6J A;  4JV1 A;  1U9L A;  4NLZ A;  5J2K A;  5J2C A;  5C0Y A;  2KEY A;  3PSF A;  1KFT A;  1Z4N A;  4C8L A;  2H3V A;  3MAB A;  2HMX A;  4TUR A;  4J9L A;  1JXL A;  1J2N A;  2ZTD A;  3L4P A;  1QLN A;  3IDW A;  4DSK A;  4ECS A;  1ZQL A;  3ZDE A;  3QUB A;  4C4S A;  2OEH A;  3H4B A;  3UXP A;  3C29 A;  2OHF A;  5III A;  1X9M A;  3HP6 A;  2FMP A;  1P7D A;  2IOH A;  3QX7 A;  2WF6 A;  1ED1 A;  2HVH A;  2WAQ C;  4USA A;  3EPG A;  4ACO A;  4KTQ A;  4FS2 A;  3F53 A;  4DEZ A;  5KTQ A;  8ICN A;  1KLN A;  5KFA A;  1ZYQ A;  5ALZ A;  1NJX A;  3WKB A;  4Z6D A;  5KFK A;  5FP0 A;  2XCP A;  1B0X A;  1ZQB A;  3RRG A;  5CR0 A;  1VDV A;  3RJK A;  2JEJ A;  2FPL A;  4PZN A;  7ICJ A;  3BS7 A;  4Y2Y A;  9ICQ A;  1Y88 A;  4FE3 A;  3JPQ A;  1ZQV A;  5HR7 A;  1SL0 A;  3R9K A;  4QIW C;  4P0Q B;  2B0C A;  3F5A A;  2XIC A;  4CGZ A;  2EZZ A;  8ICZ A;  4KLU A;  4JV2 A;  3M1Y A;  1CRX A;  2WF8 A;  1ZQZ A;  4U7C A;  3ETR A;  4P0P A;  5AIB A;  4UAR A;  3MR6 A;  4J03 A;  1A0P A;  1L7N A;  4RNM A;  5J2D A;  2LI6 A;  4XUS A;  2R8J A;  5J0Q A;  2HDO A;  5AKL A;  3ED5 A;  5C5J A;  5ALG A;  2PMZ C;  1BPE A;  5AI6 A;  3RBE A;  2V9W A;  3KOO A;  3OSN A;  3KBB A;  4OJO A;  5CWR A;  4ECR A;  1ZQM A;  3N7R C;  3C2L A;  4NJ8 A;  4ICA A;  5ALM A;  5HHI A;  4Q8F A;  4DLG A;  3RRH A;  5J0O A;  3WKC A;  5CA7 A;  2F76 X;  2KD1 A;  2VJ4 A;  8ICO A;  2ZUC A;  2D3D A;  2ISO A;  2BDU A;  4RZR A;  4ED2 A;  1Z00 B;  2H5X A;  3RB4 A;  5G5H A;  4C7Y A;  3C1Z A;  4DL2 A;  7ICL A;  1IG6 A;  5DBB A;  5AKX A;  2BZF A;  2WF5 A;  3QU9 A;  4UB1 A;  1U48 A;  4PGQ A;  3HIL A;  3K1R B;  3MGV A;  5KT6 A;  4YR3 A;  2HBK A;  4BXO B;  1T8E A;  4QZG A;  2K89 A;  2R8I A;  5AKY A;  1V97 A;  2MU2 A;  4DL3 A;  2ZJ8 A;  3HJE A;  3RJF A;  4AYB F;  5AKE A;  4EBD A;  3GFK B;  4BUG A;  1KFD A;  3E2E A;  4FFD A;  4Y2P A;  2AQ4 A;  2DPJ A;  4ED3 A;  1SB3 C;  3L5K A;  4RNN A;  2JXJ A;  3IHQ B;  3FC4 A;  3PST A;  2NRW A;  5AKJ A;  5J2E A;  1N48 A;  1HUZ A;  3RH6 A;  4DFJ A;  4MEY A;  1LV5 A;  3EUB 2;  3QE9 Y;  2HBM A;  3GV7 B;  1ZRN A;  3UQ0 A;  3RF9 A;  3TAN A;  4ECZ A;  2E8M A;  2W7P A;  3TKA A;  2W03 A;  4GXI A;  2IBK A;  4QZB A;  3SAH A;  3C5G A;  1MQ2 A;  1XNS A;  5EE0 A;  3J81 j;  4O3Q A;  4EEL A;  4F2S A;  4EX7 A;  2OH2 A;  4F3O A;  2EAM A;  1MN8 A;  1IIP A;  3NVW A;  3KTQ A;  4RQM A;  8ICT A;  1N2X A;  2HW3 A;  5AI8 A;  1ZJM A;  4KLJ A;  5KG5 A;  5J29 A;  1U47 A;  4ECY A;  2D8C A;  1NK4 A;  4PHE A;  1RXV A;  3MC1 A;  2BHN A;  1KFS A;  1ZQD A;  2KKP A;  3G6V A;  1H38 A;  3LDA A;  5AM4 A;  3U26 A;  5AHX A;  4NLG A;  5KG6 A;  1XS9 D;  2KE7 A;  3HWT A;  5KG1 A;  1L7O A;  4RQ3 A;  2KZZ A;  3WKD A;  2F1H A;  4Y2R A;  1T94 A;  4XQ8 A;  3AQF A;  3PX4 A;  5ALK A;  1ARO P;  1BPY A;  3SAG A;  3THV A;  3PW7 A;  4CRX A;  5F9L A;  2E8P A;  1ZQH A;  3HKZ C;  1K1Q A;  4U6P A;  5ALQ A;  4ECU A;  4UAT A;  2OCE A;  4KLT A;  2WTF A;  2NRZ A;  4YG2 A;  2F1I A;  4O5E A;  1Q8K A;  2DQN B;  3UXO A;  2ALZ A;  4OO1 J;  4K4G A;  2HCF A;  2DUY A;  1QSS A;  2XY5 A;  3GZF A;  4DF8 A;  3HW8 A;  3AEV A;  4P0Q A;  2A19 A;  2H3F A;  1RG6 A;  4GXK A;  4NL9 A;  5AM5 A;  1NI3 A;  4M9J A;  4DOB A;  2WF7 A;  2AGQ A;  4ELT A;  3RB0 A;  1L8O A;  1N61 A;  4Z6C A;  4ECQ A;  2EAO A;  1UA0 A;  3QU4 A;  5GTI U;  4DQP A;  4JB3 A;  2EZX A;  4RPY A;  8ICH A;  2ZIW B;  3TAD C;  3KHL A;  8ICG A;  3HPO A;  4M2Y A;  1UT5 A;  3SEN A;  1ZD4 A;  4YFK A;  1QQ5 A;  4RQ4 A;  3NAS A;  5KFG A;  3TFS A;  3PX0 A;  1XO0 A;  4PGX A;  9ICA A;  2DKZ A;  4BXO A;  5IIK A;  3RJI A;  1C20 A;  2ASL A;  3PY8 A;  2A1A A;  4DFM A;  5IIM A;  1L5U A;  4EEY A;  3WK6 A;  1JUD A;  4JWN A;  3F2C A;  3V6J A;  3DEE A;  4NL9 C;  7ICU A;  4KLE A;  1KDH A;  2PKE A;  5AM1 A;  1ZQY A;  4FZN A;  4J9P A;  1ZQF A;  3GV5 B;  7ICH A;  2W11 A;  3RB6 A;  4I2C A;  5KFZ A;  8ICF A;  3QUQ A;  4JWM A;  3KHR A;  7ICO A;  2I1Q A;  4UB5 A;  5KFB A;  4IC9 A;  4DOC A;  3RH4 A;  4HYK A;  2KVC A;  3BS5 A;  4I2J A;  4MFF A;  4OJ5 A;  4MFC A;  1RYU A;  3ICX A;  2G09 A;  4RNO A;  4ED8 A;  1RXW A;  3JPP A;  2LM1 A;  2WFA A;  1K5O A;  2HOF A;  2A1J A;  3RJG A;  3KD3 A;  1D8L A;  9ICL A;  2KN7 A;  3N97 B;  5J0W A;  2W3S A;  4UW9 A;  4QWA A;  5KG2 A;  3F2B A;  4F50 A;  4US9 A;  2JHD A;  3PR4 A;  1F0M A;  2ZG6 A;  1KL9 A;  4OJL A;  2PFO A;  4Q45 A;  3RJH A;  4G3I A;  4FBT A;  3H7I A;  1K1S A;  1FFV A;  5AKH A;  2AXT U;  3IP4 B;  2HBJ A;  3E58 A;  5KFV A;  1JX4 A;  1URJ A;  4NLC A;  3C2K A;  3K4G A;  2IMW P;  2FPM A;  3MDA A;  5KT3 A;  5ALX A;  3T3F A;  3RJE A;  3LWL A;  3S6J A;  1MQ3 A;  2BPG A;  1ZQW A;  3N28 A;  1SKR A;  1JMS A;  1LKY B;  4DFD A;  1UA1 A;  4ED1 A;  3ZD9 A;  5ALW A;  4DQI A;  4O3R A;  2W9A A;  9ICC A;  4QJF B;  1TE2 A;  2HVI A;  5H2F U;  2PI5 A;  4KN4 A;  3MR2 A;  3PW4 A;  1X9S A;  4B9U A;  3WK7 A;  5CRX A;  9ICF A;  5F3X B;  3AL0 B;  1OUQ A;  1PK3 A;  4EYH B;  2PFP A;  2K4H A;  5KFT A;  1EXN A;  9ICI A;  1D9D A;  2LYB A;  3C5F A;  5KT2 A;  4UAU A;  8ICU A;  1NJZ A;  1ZQN A;  1X42 A;  1SV0 C;  2E8O A;  3CNH A;  8ICL A;  3H8W A;  1ZOL A;  2LYH A;  5D49 A;  2GWS A;  4PHP A;  2ASD A;  1N60 A;  4AYB C;  4YXM A;  2PFN A;  1B4F A;  4LZG A;  8ICM A;  4C7Z A;  1NK0 A;  5J2J A;  3AMZ A;  5DLG A;  3BQ7 A;  4UB4 A;  5ALH A;  3V7L A;  1X9X A;  2I5H A;  4F5N A;  4I28 A;  3MFH A;  2F1J A;  4QZC A;  1PVR A;  9ICH A;  2BDP A;  8ICB A;  2ZUB A;  2JEG A;  1ZQO A;  2AH5 A;  1DXS A;  5KFO A;  4M0A A;  1ZQR A;  8ICE A;  1NJY A;  1X6J A;  1BNO A;  2RP5 A;  1ZD3 A;  3V6K A;  3BJY A;  3Q8L A;  7ICK A;  5KFJ A;  5CHG A;  5EWG A;  4QW8 A;  3PML A;  3H0M B;  4DFP A;  5TIS U;  3WKA A;  1NK5 A;  1LVH A;  2WHE A;  3IG8 A;  3E0F A;  1T3N A;  2D6F C;  1KW4 A;  2J6S A;  3GIM A;  2P66 A;  1SWW A;  4P4O A;  1T4G A;  4UB3 A;  1U45 A;  4KLH A;  4DLE A;  1NK6 A;  9ICO A;  1L8L A;  4QZA A;  2K8C B;  2KHQ A;  1ZD2 P;  5ALU A;  2ISP A;  1IXR A;  1BGX T;  1ZQU A;  4UAW A;  8ICK A;  2ZJA A;  2B6G A;  1KBU A;  2G5I B;  5KFC A;  4Y2J A;  2UVU A;  2I9G A;  9ICV A;  2W3R A;  2YQE A;  1JIH A;  2P6U A;  1BVS A;  2VIX A;  4M47 A;  4TUQ A;  5HR6 A;  2WAQ F;  1PUZ A;  2ODG A;  1SV4 A;  3K1Z A;  3TAP A;  4KX3 A;  4B6J A;  2VA2 A;  2JRZ A;  2B21 A;  2P35 A;  2C2D A;  1KQQ A;  1KRP A;  3GU3 A;  4R65 A;  5ALE A;  3BQ0 A;  5BOM A;  2KZ3 A;  1JXE A;  1ZJN A;  2R8K A;  7ICM A;  2YB1 A;  1NK7 A;  3HT3 A;  2Z7J A;  4PZO A;  2W04 A;  4KLO A;  5DB9 A;  2EAN A;  5ALF A;  3Q8Q B;  4J9S A;  3HRD D;  1FIQ A;  2ZIX B;  3QUC A;  3QZ7 A;  4M04 A;  4QZ9 A;  2ZTE A;  3I76 A;  3Q8K A;  2F8L A;  3H0L B;  5KFU A;  2C22 A;  4P4P A;  2KIC A;  2LMR A;  3OHA A;  2XGQ A;  4YR2 A;  3KZX A;  1Z4O A;  4DF4 A;  4DQQ A;  2KSO B;  2FLN A;  2KSO A;  5KL1 B;  2XC9 A;  1SKS A;  2F2A B;  3PW5 A;  1F44 A;  1L3T A;  4GC7 A;  1Z1B A;  2GO7 A;  2YML A;  3ALR A;  1O03 A;  5DB8 A;  3WU2 U;  1UQV A;  4R63 A;  5AM0 A;  4PJ0 U;  4RU9 A;  4M9L A;  4R66 A;  8ICC A;  2J6U A;  3B0Y A;  4QWE A;  4J9R A;  4O0I A;  2KMD A;  4KLF A;  2G5H B;  7ICP A;  5L1M A;  2XCA A;  1KKX A;  4KLQ A;  5EWF A;  4PHD A;  9ICG A;  4YQW A;  4NWI A;  2EH9 A;  3LYS A;  5CJ7 A;  3KFU F;  2CPR A;  3EW9 A;  2FLL A;  3PV8 A;  1X6I A;  4PPX A;  4ZH4 A;  2GOL A;  5AIC A;  5JUM A;  4F71 A;  3EPI A;  2NV3 A;  1Q46 A;  2FMS A;  1PVP A;  1ZD5 A;  3M6K A;  2DFL A;  2JR5 A;  3EYZ A;  4IS7 A;  4GFJ A;  5E79 U;  1MA7 A;  1UPH A;  4ECT A;  2W8L A;  1HJP A;  3HX0 A;  5HML A;  3RFA A;  5CB1 A;  4DL6 A;  4RQ5 A;  5KFH A;  4CNQ A;  4I27 A;  1CEZ A;  3T5K A;  3NS1 A;  5EE3 A;  1PK1 A;  4QWC A;  1MSW D;  4Q8E A;  4LVS A;  2YMQ A;  4F5O A;  4J9M A;  4AP9 A;  5DLF A;  5DG7 A;  2FJ6 A;  1L7P A;  1Z00 A;  1FO4 A;  4M6W B;  2W8K A;  2KZM A;  2DKX A;  4LZD A;  5KFL A;  4FZM A;  4DS4 A;  4FO6 A;  3QUT A;  5B5E U;  4UAZ A;  1A77 A;  2N1R A;  2PXI A;  3FM9 A;  1XSL A;  4BWJ A;  4Y2U A;  5DKW A;  5KNI A;  4DSL A;  2G07 A;  4DQS A;  8ICQ A;  4B9V A;  1V9P A;  1QH9 A;  2E5S A;  1NJW A;  1X9W A;  1RQN A;  4RQ2 A;  1ZRM A;  5EOZ A;  2XID A;  1IM4 A;  3FYH A;  3TAC B;  3SI8 A;  2LPE A;  3SEI A;  1S76 D;  9ICP A;  4UQG A;  2BQU A;  4IL6 U;  4MF8 A;  3LVW A;  5J0Y A;  4DSJ A;  1GO3 F;  4R8U A;  5AM3 A;  1D8B A;  3RAQ A;  1COK A;  1TAM A;  2GLE A;  5F9N A;  4ECW A;  4I2H A;  2PFQ A;  2BCU A;  4P4M A;  5B66 U;  2K60 A;  3PO4 A;  5HMM A;  2DWQ A;  1O08 A;  5KT5 A;  4P0P B;  4IR1 A;  4F2R A;  2ESE A;  2J6T A;  3LK9 A;  3NUQ A;  4KIT B;  2I6X A;  2G06 A;  3ZI4 A;  5HP4 A;  1L7M A;  5AKI A;  3A0B U;  4Q44 A;  1YT3 A;  3RBD A;  4F4Y A;  4CDG A;  3ZDB A;  5CP2 A;  2PI4 A;  1KSP A;  3JPR A;  1WCN A;  4C80 A;  4X5V A;  1ZQK A;  2AU0 A;  4RT2 A;  5AK4 A;  1TAQ A;  1VLB A;  1ZQX A;  1JI7 A;  2QKQ A;  4ZOH C;  1U49 A;  4Q43 A;  5KFR A;  2K8A A;  4C4R A;  2JEI A;  5J0R A;  4I29 A;  5L9X A;  1QQ6 A;  3QU2 A;  5J0U A;  3H4D A;  4DCC A;  1L6N A;  2HSZ A;  1UT8 A;  3WK4 A;  4RQ8 A;  5KAF U;  5IIN A;  3Q8R B;  3ZD8 A;  4RQN A;  2LKY A;  2ATL A;  5DB6 A;  3QZ8 A;  4RPX A;  1UCV A;  4EYI B;  3MGH A;  5TZV A;  2MSN A;  4IR9 A;  9ICR A;  2NRT A;  4R8U B;  3PNC A;  1NOM A;  2KK0 A;  3GII A;  5J2B A;  1JN3 A;  4K4I A;  3DDH A;  2JH1 A;  1NK8 A;  3IRU A;  4Z6F A;  1DOQ A;  4F5R A;  5KFI A;  4QNL A;  4NLN A;  1SZH A;  2YY6 A;  3N4M B;  5DGA A;  4IQU A;  9ICW A;  1BPB A;  4A8E A;  1ZQJ A;  4RUC A;  3BDP A;  2LBO A;  1SZP A;  3BS5 B;  5IIJ A;  1SL2 A;  1L3U A;  5HNK A;  2Q4T A;  4C8K A;  4LJX A;  5KT4 A;  1DK3 A;  1D8Y A;  4O5K A;  2XY7 A;  4O5C A;  2NO5 A;  4EEK A;  2Y1I A;  2M9N A;  3PR5 B;  2KFN A;  3GIL A;  3T5L A;  4YMM A;  2OWO A;  3VCB A;  1V38 A;  9ICM A;  3WK8 A;  8ICP A;  2JMG A;  5J2A A;  9ICS A;  2K8B B;  4NLK A;  2G08 A;  8ICW A;  5HHH A;  4ELV A;  4FS1 A;  3TAD A;  3KKA C;  3MBY A;  3BQT A;  1RZT A;  3M8S A;  3QU7 A;  1JRP A;  3T5J A;  4EZ9 A;  2C2R A;  1NK9 A;  4KLL A;  4F92 B;  2FI1 A;  4ED6 A;  1ZQA A;  4YXJ A;  4KLS A;  4F5P A;  1HEK A;  5AI5 A;  2W7O A;  4DO9 A;  2AQ0 A;  2NO4 A;  5KL8 B;  2DL0 A;  8ICI A;  1SIJ A;  1S0N A;  4Y2Q A;  3V7K A;  2V4R A;  9ICN A;  1MC8 A;  2QB1 A;  4I2E A;  2OM6 A;  4EZ6 A;  9ICX A;  4TQS A;  1S0M A;  4QZF A;  2YB4 A;  3CW2 C;  3QEB Z;  2JZB A;  3GIK A;  4DSI A;  2W54 A;  1TV9 A;  3K75 D;  7ICS A;  5ALJ A;  3OGU A;  1ZQT A;  5CEH A;  2W55 A;  1RPL A;  2G0A A;  2YMM A;  3IV6 A;  3TI0 A;  5GTH U;  2IOF A;  1S0V A;  2YTU A;  1YZ7 A;  1XU4 A;  2KV2 A; 
#chains in the Genus database with same CATH homology
 2O6K A;  2KVS A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...