3N7SC

Crystal structure of the ectodomain complex of the cgrp receptor, a class-b gpcr, reveals the site of drug antagonism
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
ACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Calcitonin gene-related peptide type 1 receptor
total genus 27
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3n7sC00
3N7PD 2XVTA 2YX8A 3N7RC 3AQEA 3AQFA 3N7SC
chains in the Genus database with same CATH superfamily
4KLLA 4P4PA 5KFWA 3C1YA 3M9OB 1XO0A 1Z1VA 3H8SA 3PR5B 8ICLA 1O08A 4M9HA 2VIXA 1X66A 2W54A 2HBJA 5DLGA 3QUTA 4EENA 3UQ2A 2KEYA 2UVWA 4US8A 3TADA 3QUCA 4DEZA 3ZDDA 1QLNA 1P7DA 3M6KA 1BNPA 3EUB2 3V7LA 3BZKA 1ZYQA 3SR6A 4KTQA 1GO3F 2HHQA 2QARA 4NM2A 3LVWA 4C4RA 5J0YA 4UB8U 3WK9A 1ZRNA 4O0IA 4P0PB 3PW0A 1N62A 1ZQKA 3RH6A 3UPQA 2WF8A 3ISCA 2G0AA 4IQUA 1SXDA 2YTUA 3BZCA 4MFFA 1ZQYA 4RQ3A 5KFZA 5KFBA 3M1YA 2YMMA 3NVWA 5AM5A 4ECTA 4JWMA 2XIDA 4Q43A 5KFTA 2OYYA 1N60A 2Y1JA 3WK5A 2KSOB 2LBOA 2NRVA 4DL5A 9ICTA 3RAXA 1RM6C 1FEZA 2AGQA 1RZTA 1Y88A 2BKEA 2LI6A 1PVRA 1QTMA 5L1IA 4J9SA 1RPLA 1NKBA 5CJ7A 2Y0SF 1TFRA 5D46A 3C2LA 1SV0A 2UVVA 2IOFK 4DFJA 2AQ4A 3FYHA 2W3RA 1SV0C 1MQ2A 2DGZA 5J0PA 3EZ5A 3SV4A 4KMUA 5G5GA 4C0ZA 3G6VA 8ICNA 2R8KA 2GWSA 3QUQA 5AI0A 4DSEA 1BPBA 2P35A 2DWQA 1U48A 1B4FA 4C8KA 4B9MA 2XY6A 4YR0A 2W7OA 1ZQUA 3T5LA 3I1YA 2K8CB 1S0MA 2LYBA 2NRWA 4EEYA 3QU4A 3PO4A 4M6WB 4F5RA 1JUDA 3CRXA 4DL3A 2D6FC 1KFTA 1B43A 4CCHA 2JR5A 2PFQA 4I27A 3RRGA 5AM4A 4CDGA 3F53A 5CHGA 4JWNA 2G07A 3RH5A 4F8RA 5BOMA 1JX4A 1OUQA 2VKQA 4MHVA 3RJGA 2B6GA 2JRZA 2KOBA 2XY7A 1L7NA 4I29A 1S5LU 4C8OA 4UBBA 3AM9A 2L5YA 2VANA 4RQNA 3T5HA 4K4HA 5ALUA 3RBDA 2Q0ZX 2G09A 2ZXHA 2DL0A 3I76A 1YZ6A 4J9LA 4J9RA 4KLJA 3B0YA 1IM4A 4C8NA 2E5SA 4RQ5A 2D3DA 1ZQMA 3PMNA 3KHRA 2KK0A 2NV3A 4PH5A 4EX7A 4ECWA 3TANA 5AKXA 1N56A 4YFKA 1PK3A 4GXJA 3ZDCA 4UARA 5ALNA 1PK1A 3H7IA 2QLTA 1KRPA 3AU6A 3RJFA 1JROA 2E8PA 4B9SA 3NS1A 2XGQA 5KTQA 4QZ8A 3PMLA 4B9LA 3PX4A 3OSPA 2C2EA 4KN7A 4DSJA 5GTIU 4M9GA 3WU2U 4UB1A 3M6ZA 3ETRA 7ICEA 1PK1B 5KFCA 1TVAA 2DBYA 4F71A 4C8MA 4MFCA 2UVUA 5ALOA 3RF9A 1ZQNA 4DF8A 3WKBA 2ZTDA 2FLPA 4QWEA 1MQ3A 3S6JA 2M0NA 1XC9A 2A1JB 4TUQA 1A6SA 5CRXA 4I2JA 1UA0A 1AROP 4YMMA 4HYKA 3HRDD 3NUQA 4B9TA 3TKAA 1T8EA 1JXLA 3SENA 3T5JA 4R63A 3HPOA 4EX6A 3KOOA 4DFKA 3HT3A 1ZQPA 3WK7A 5CWRA 4I2FA 4RQ6A 3ALRA 5ALVA 5ALGA 2NO5A 1FIQA 1S9FA 4LVSA 3J81j 4FS2A 2FLLA 2WTFA 4I2BA 1BVSA 4AYBF 3IG8A 5CR0A 1WG8A 4DSKA 4PZNA 2G08A 2WF5A 5DKWA 2LM4A 4IRKA 3MDCA 3PX0A 3TI0A 4J9MA 3WKAA 4KN4A 2K4EA 5EE1A 2IA6A 5DB9A 1V97A 1XS9D 4FBTA 4AYBC 3DDHA 4NV0A 1K1SA 3MR6A 1KKXA 3H8MA 1L8OA 4PHDA 2A3VA 4JV1A 2KZ3A 4KLGA 1O03A 2F44A 4C4SA 3PNCA 1U9LA 4J03A 4O3SA 1TK5A 2PFNA 3HW8A 1AQ6A 5AKLA 1H38A 2C22A 4NLBA 4RT2A 2JGAA 4QZCA 1SWWA 3ZD9A 4DSIA 1TK8A 5EWEA 4KLOA 8ICPA 5J8YA 4IL6U 2WF7A 4YD1A 3IRUA 4YCXA 1JI7A 1DK2A 3CP8A 3RH4A 3A0HU 3SAHA 1ZD5A 2ES6A 2ZUBA 3KZXA 2YMLA 2HBKA 4KLHA 2EAMA 4EBCA 3SEIA 1U49A 5EE0A 4I2AA 1X9WA 1NZBA 8ICCA 4UB3A 1WUDA 4MEYA 2E8NA 2YN4A 4KX5A 4KLUA 9ICJA 2F3NA 2Q4TA 3KKAC 3MR5A 2J6SA 1VLBA 5DB8A 5J2JA 2HVHA 2EANA 2ATLA 2PKEA 7ICRA 4NL9A 1MA7A 5HHIA 3LWMA 2LYHA 4DF4A 5EWFA 1DGJA 4DLEA 4EYHB 4RQ2A 3RJJA 3BS5B 1SL0A 1DGSA 2YMPA 2KZZA 1DXSA 2RDJA 4KLTA 1S8OA 5HHHA 2KFZA 2W55A 3C1ZA 2PFOA 2H3ZA 3MDAA 2KFNA 9ICCA 5DG7A 1HIWA 3T5KA 4WJ3B 3AQFA 5AICA 2JH1A 3M9MB 3UQ0A 1YZ7A 5TISU 2BCVA 1LKYA 2ZTCA 3WKDA 2HBLA 1ZOLA 3C5FA 4US9A 4P0PA 3ETLA 5JTIA 5DDYA 2BR0A 1C20A 2KJ5A 5ALJA 1Z3EB 2Y0SC 4RQ1A 1A76A 4I2HA 4DOBA 2XVTA 2E8MA 5J29A 4B9UA 4QNLA 3EPGA 5ALXA 8ICEA 4NJ8A 4GC6A 2DQNB 3QZ7A 3KTQA 3H8JA 2WF6A 2GOLA 1IXRA 2NO4A 4UAUA 1T3NA 3C28A 1BPEA 4P2HA 5KT4A 8ICYA 2AH5A 8ICVA 3OPXA 5KG2A 1COOA 5EWGA 2W9CB 1U45A 2E1FA 4O5KA 2JHDA 1BPZA 5DB6A 4F4ZA 2BCUA 3AN1A 3JPTA 2KSOA 2EDUA 1BPDA 1ZQLA 1ZQJA 2EZYA 1S0OA 2HMXA 2RRDA 5J2BA 1HJPA 1F44A 4PJ0U 1S77D 5TZVA 3RJKA 4ELTA 4KLMA 2EZZA 2XCPA 5KFAA 3AU2A 3ZDAA 5KFLA 3HX0A 5KT5A 3NVZA 7ICSA 1SGGA 3V6JA 9ICHA 2DUYA 2W7PA 4Y2TA 3UXOA 2PI5A 4PGXA 8ICWA 3H0LB 2H3VA 4K4IA 4M9NA 1CRXA 2GO7A 2AGPA 3QYPA 3SQIA 7ICHA 4RUCA 5ALWA 4J9KA 4QZEA 1ZJNA 9ICQA 4JUZA 2BCSA 1ZQWA 4IRDA 3TFRA 2ZUDA 2ODGA 3H40A 8ICKA 2VJ5A 3HWTA 3QNMA 1SKRA 4EEKA 2RDIA 5AK4A 4QIWC 2LKYA 1D9DA 5J0UA 4QZBA 3Q8MA 4IRCA 2F2AB 3L4PA 3UXPA 4ECYA 4DOCA 2JEFA 2R8JA 1RYRA 4XRHA 3UMCA 2KN7A 1A0PA 2F1IA 1F0MA 2F1JA 1LKYB 4QWBA 2WAQC 4CRXA 4DWIA 3N7RC 5CB1A 2K4IA 2W11A 3ONNA 3FC4A 3BQ2A 4ED1A 2K8BB 1F5SA 1QSSA 2W9MA 2IBKA 1N2XA 4RPXA 5KFOA 2OCEA 1JIHA 5DQIA 1D8LA 3KD3A 4R8UA 4F91B 4B6JA 7ICIA 2WFAA 3OSNA 3OHAA 4ECSA 4IC9A 4IQVA 2PXIA 5KG7A 1NK6A 3JPSA 2HI0A 3QU9A 1ZD3A 1WWVA 5ALKA 5J0WA 4RNOA 1DRGA 2CN1A 3TAQA 1LB2B 5AK5A 4UAZA 1S76D 4XUSA 3CNHA 3FDSA 9ICAA 2XI9A 1RG6A 4DQSA 3RR7A 7ICMA 3KHLA 2HHTA 3VC8A 8ICSA 5KFSA 4FZMA 1SV4A 1BPXA 2FMPA 1NJXA 3IHQB 4UASA 3PW7A 2E3TA 2ISOA 2OHFA 3CW2C 2FPLA 2W9BA 3WKEA 5J0TA 1X9SA 4NLKA 2W43A 1ZQBA 3H0RB 3TACB 3GFKB 2A1AA 2A19A 1X9XA 1KDHA 2R8GA 3RJHA 4X5VA 3C5GA 3V6HA 2F8KA 4PPXA 9ICUA 1ZETA 2MA1A 4DL7A 3IM1A 4IR1A 1ZQRA 1A77A 3AMZA 1Q8KA 4P0QB 4TUSA 3LYSA 4QWDA 2ZIVB 1NZPA 1FFVA 5J0SA 2HOFA 5DB7A 5DLFA 8ICIA 2WB1C 2RP5A 5KFXA 1CUKA 1SZHA 4Y2YA 3O0FA 5C5JA 2J6TA 8ICTA 2ZIUA 4J9PA 2NRTA 4YR2A 3BQ0A 4OJLA 3QEAZ 2XO7A 3AUOA 4F93B 5BPCA 4KLQA 3PV8A 3VCBA 1PVQA 2HHVA 2MAXA 5A0LA 1ZQGA 3AL0B 1B22A 2JV3A 1HEKA 5B66U 5KFJA 2MRLA 2YMQA 1D9FA 7ICKA 1RXVA 2K8AA 4Y2UA 2BDUA 4UW9A 4PL2A 1JRPA 2DKXA 2KZMA 9ICLA 4I2GA 2JEJA 3DV9A 4BXOB 5HNKA 5J0RA 4FFDA 1ZQSA 1ZQAA 2PI4A 2B0CA 2PMZC 4OJ5A 1X42A 1SXEA 3N7SC 1S0NA 3GIIA 3H8WA 2KP7A 3OJSA 2FPKA 4R65A 4ZOHC 4F3OA 4F5NA 4KLFA 3QU2A 2OH2A 2E1EA 5AKKA 2DKZA 4QZGA 2VA8A 5IINA 1XNSA 2FMQA 4DFDA 3RRHA 3SZ2A 5J8YC 1LVHA 4DQQA 4ELVA 7ICUA 4OJPA 1ZQTA 3ZDEA 4RUAA 5AKHA 4EYIB 3PSIA 4YN4A 3PW5A 2OM6A 8ICOA 5T14A 1Z00A 1Z1BA 2YQEA 2VJ4A 4DFMA 1UT8A 4F5OA 1NJZA 2H3FA 2FMSA 9ICBA 3SV3A 9ICPA 4Q8EA 5DQHA 5HMMA 3IG5A 2KJ9A 3D2QA 4M04A 1NKEA 2HHSA 4Y2JA 2F77X 2CRXA 3C23A 1JMSA 5K4LA 2JEIA 3BS5A 4NLGA 3BQ1A 4QZDA 7ICPA 4ED6A 2ISPA 1SIJA 1T3QA 5D4BA 2M9NA 5EOZA 1S97A 4DQIA 1KBUA 1OW5A 1IIPA 5JUMA 5J2EA 5ALDA 2Y1IA 1ZQHA 2BPCA 2Z7JA 2MUTB 2HHUA 4DLGA 7ICGA 5KT6A 2W03A 4DFPA 4C4TA 3PY8A 1XSNA 3UM9A 3PVXA 3GZFA 4IQWA 5KFGA 3WK4A 4MEXA 2ZJ5A 4GXIA 9ICWA 2FJ6A 3V72A 2QARB 1V85A 2W3SA 3RJIA 3MR3A 9ICVA 1SKSA 5J2DA 4O9MA 1L3UA 8ICXA 5KFUA 3NGDA 4C7YA 8ICBA 3M9NB 1XWLA 4I28A 4DQRA 5J2FA 3RAQA 1XU4A 4EZ9A 1WWUA 2YX8A 4ECQA 2PMZF 4P0QA 2LM1A 4GLXA 4P4OA 3OJUA 2I6XA 2IHMA 4OJ6A 1SWVA 1KFDA 2KICA 4KLDA 5ALHA 5DGAA 5IIOA 2NRZA 3FAHA 3U26A 4Q45A 3D2NA 8ICHA 3NTUA 3B0XA 2JXJA 3QZ8A 3TARA 2MSNA 3MC1A 2EQYA 1N5WA 2OXOA 5DQGA 4Y2PA 4PZOA 1UT5A 3ZI4A 5AM1A 1N63A 4UQGA 4RQMA 2KMDA 4XQ8A 2KVCA 4QWCA 4IR9A 2V4QA 5KAFU 1EXNA 2QB0A 4LJXA 1VDVA 4DO9A 2FI1A 5CP2A 2ALZA 4IS7A 1HUZA 1X6IA 4F5QA 1LV5A 4CE6A 3PSFA 4RPZA 5DBBA 3HJEA 2JZBB 4YXMA 3V6KA 2MUTA 5J2GA 3OTQA 3TAPA 4TQSA 4PGYA 4ECUA 1BNOA 5EE9A 4BWJA 3T3FA 9ICIA 2NYVA 2H3IA 4M9JA 2HOQA 3WKCA 1ED1A 1XO1A 2RHFA 2KTQA 2KKVA 3GV8B 1N48A 4UATA 3TFSA 4ED2A 3GV7B 1S0VA 2KIVA 4TUPA 5DGBA 1ZQDA 1TK0A 4DCCA 1ZQVA 3GILA 5CA7A 2I9GA 4ICAA 1SZPA 5L1MA 2XGPA 3M7DA 4CF4A 1ZQFA 2JMGA 5J2IA 1SL2A 5KFRA 4UAWA 2J6UA 3F2DA 1WYGA 4BJQA 2EAPA 1HUOA 4ECZA 4ED8A 4JMUA 4EBDA 4TURA 2BCRA 3M8SA 5KFHA 2EH9A 2P66A 4GFJA 3GQCA 9ICFA 4RNNA 4KX3A 3B9JA 5KG0A 5G5HA 3H4BA 4ACOA 3Q8RB 1PVPA 3N97B 2KE7A 1FFUA 3AQEA 1KW4A 5ALZA 2K4HA 4J9NA 5L1KA 2FE9A 1V38A 4KITB 2DPJA 2AGOA 3QXGA 5E79U 2KD1A 3BQ7A 2DF4B 4DL6A 4BGDA 4Y2QA 4F4XA 4KMOB 3QE9Y 2G5HB 4B9NA 9ICRA 2KNJA 3L5KA 2WF9A 2BGWA 5ALYA 3GIJA 3QU5A 4PL1A 1RYUA 3UMBA 3K75D 1NJWA 1N5XA 2BDPA 4NLZA 2V4RA 4FE3A 1J2MA 2F76X 5L1JA 4NLCA 4IQTA 4MFAA 4LZGA 4M6WA 3V7JA 4F5PA 1QQ5A 1TE2A 1UPHA 1CEZA 5IIJA 5ALTA 3RFAA 5AM0A 2IMWP 5ALLA 2ZJ8A 4G9BA 4DS5A 4FS1A 1CI4A 4ECXA 1RQNA 3K1ZA 5ALMA 3UMGA 4U6PA 2AJQA 1KL9A 4G3IA 2WHEA 3NASA 2XY5A 5IIIA 5J0QA 3MGVA 1ZQQA 2RLTA 2ASJA 2OWOA 8ICRA 8ICUA 5AKEA 4I2IA 3MFHA 4KLSA 3ICXA 2MU2A 2GH1A 2H3QA 2HW3A 2H5XA 2ZIVA 3EW9A 3THVA 4C7ZA 5IIMA 5ALSA 5KT2A 2I5HA 7ICNA 4F4KA 3PX6A 3NVVA 3RB0A 3Q8QB 4Z6DA 2ZIXA 4RQ8A 3MR2A 4JK1A 5J2HA 3KFUF 4EBEA 5JU5A 2Y9TA 2EZXA 2K60A 5AK6A 7ICJA 5D49A 3JPNA 3G6XA 4DOAA 1T7PA 4RNMA 2LHTA 1U47A 1YT3A 3ED5A 2ZXIA 4Z6FA 4P4MA 5AKIA 3HKZC 4F4YA 4M47A 3Q8LA 4I2EA 4NY8A 1B0XA 4QZ9A 2ZG6A 3GU3A 1NK9A 1ZQXA 4QIWF 1ZXIA 3QU7A 7ICOA 4R8UB 3HILA 5ALIA 8ICGA 2O6KA 4RU9A 4UB4A 5AKJA 4YMNA 3IN5A 5IILA 3GIKA 3K4GA 5AI4A 5L9XA 2XICA 3LK9A 1L5UA 1ZQEA 5DDMA 1QQ7A 2ZIXB 5KFYA 7ICTA 2AHOB 1QQ6A 2C2RA 9ICGA 3FM9A 4DSFA 2BCQA 4NXZA 4UB5A 3GDXA 4F92B 4J9OA 1TAUA 1NK5A 5AI9A 4DL4A 5HP4A 3KKAA 2P6UA 4JB3A 4B9VA 4DL2A 2F1HA 2UVRA 5CEHA 4KLEA 3E58A 2JZBA 5KG4A 3GIMA 3K1RB 5KFMA 3RB3A 1ECWA 4NL9C 5DBCA 1MSWD 1MC8A 3BS7A 1V9PA 2LPEA 5GTHU 1PZNA 4GXKA 1FO4A 5L1LA 5HR6A 2KHQA 3EPIA 5AIAA 4GC7A 4Z6EA 3N28A 1RDFA 4MF2A 1DK3A 1SL1A 4U7CA 2KG5A 2W9AA 3JPQA 2C2DA 5J2CA 1T4GA 4NM1A 2OEHA 1QH9A 2W8LA 4ECVA 2BPFA 4USAA 5AI5A 3BQTA 4RPYA 2D8CA 3RR8A 3GV5B 2CPRA 1Z4OA 4EELA 1D8BA 4JV2A 2VA2A 4Y2SA 3OGUA 1KEJA 2F8LA 4C8LA 3MGIA 3SI8A 2VA3A 3WK8A 3KBBA 4FBUA 2A1JA 3R9KA 3JPOA 3SYZA 1SKWA 3RB6A 1X2IA 2I1QA 4PHAA 2R18A 1L7MA 4O3NA 2ZIUB 1RXWA 9ICSA 1BGXT 2ASDA 1URJA 2AXTU 1KLNA 8ICJA 2YY6A 4QZIA 8ICMA 4CGZA 4BWMA 2ESEA 4QZHA 1KN5A 4LZDA 4A8EA 7ICQA 1NK0A 3C2MA 3HP6A 2BZFA 2YB1A 5KG1A 3KZIU 1S10A 3ORYA 2YB4A 2V9WA 1D8YA 4UB2A 5KT7A 3KHHA 3F2CA 3QEBZ 1UQVA 4I2DA 1ZJMA 4YD2A 7ICFA 5HMLA 3UXNA 5F9NA 2QKQA 3JPRA 2AQ0A 2Y9UA 1Q3VA 2P6RA 4OO1J 2KVSA 2LMRA 5AIBA 2QB1A 4O5EA 4BX9C 3SAGA 3JPPA 3Q8KA 1COKA 3RJEA 5KL1B 2C28A 1BPYA 1NK8A 1QSLA 3MBYA 5AK3A 2CXYA 3MGHA 2XC9A 3PSTA 1ZD2P 3LDAA 4ZH4A 1RYSA 3TQ1A 5KFEA 5H2FU 4YR3A 1JXEA 4QZAA 1L6NA 1NOMA 9ICKA 2HOIA 4RT3A 1ZRMA 5KT3A 4F2SA 4Q8FA 5EE3A 3LWLA 3NRWA 1NNLA 1QCKA 5JRTA 5KG6A 1MN8A 2QB0B 4CF5A 5KFFA 1L8LA 4DS4A 3IDWA 4CNQA 3RBEA 2HBMA 4BUGA 2B21A 1XSLA 1QSYA 3F5AA 1Q46A 2FLNA 3A0BU 3H4DA 3ISBA 4ELUA 4R64A 1XSPA 4QW9A 3CYMA 4YG2A 3MFIA 3SAFA 2R8IA 2NRXA 1JN3A 5KFPA 8ICQA 1VJ5A 2ASLA 3NVYA 3LVVA 2KKPA 2ZIWB 1ZD4A 1TAQA 4O3PA 3BDPA 1L7PA 3PW4A 3L3FX 4BDPA 5ALRA 5ALFA 3ISDA 4YP3A 1K5OA 1C7YA 4RQ0A 4ECRA 4O3RA 3SMVA 3T79A 4F50A 4FO6A 3C21A 4K4GA 4JV0A 5J0XA 4RQ4A 3PO5A 1DOQA 4QWAA 5KL8B 3MABA 1UA1A 3SD7A 1L7OA 5DBAA 4QJFB 5AKZA 2GLEA 4BXOA 1U4BA 4QW8A 8ICZA 5KFNA 9ICNA 2BPGA 2WB1F 4Y2RA 1Z00B 3D6JA 3I28A 3PW2A 4XA5A 4PGQA 4GIBA 3E2EA 1X40A 4O3MA 1ZQ1C 2LYAA 5DG9A 2FPMA 3EYZA 4YVZA 1KFSA 3G6YA 9ICEA 2E8OA 2RQ5A 3HKZF 5F9LA 5BOLA 3F5EA 5ALQA 5AKYA 5KG5A 2ZTEA 1L3TA 3D2SA 1J2NA 1L3SA 3C29A 4YMOA 4O3QA 3Q8PB 1ZQIA 3BJYA 1SB3C 4Y2VA 3EWAA 2K89A 5ALEA 2IHNA 3AEVA 1NI3A 9ICXA 1KQQA 5J0OA 2KJ8A 4UBCA 5KG3A 1ZQCA 5AM3A 1N61A 3WK6A 3DEEA 1ZQZA 1UCVA 2G5IB 3ZDBA 2DFLA 2R8HA 5KFKA 1TKDA 2PFPA 2HCFA 5ALPA 2HSZA 4F72A 2KIWA 4OJOA 1ZQOA 4C80A 2ZUCA 4F4WA 2IOHA 2W9BB 4HAIA 5KAIU 4ED3A 7ICLA 5FP0A 2XCAA 2HHWA 2BQRA 2G06A 2HHXA 2DPIA 1WCLA 4O3OA 2W04A 3N4MB 4R66A 1OXJA 1T94A 4NWIA 2JEGA 4J9QA 1X9MA 1X6JA 5C0YA 3ZD8A 4M2YA 1NK4A 2KV2A 3QUBA 8ICFA 5KFDA 2HDOA 2N1RA 3PSPA 5IIKA 4AP9A 1RQLA 3TADC 4OCZA 4M9LA 9ICOA 2BQ3A 9ICMA 4RZRA 1KTQA 1Q3UA 5AHXA 2EAOA 3PR4A 4KLIA 5KFIA 5HR7A 1UHUA 5J2AA 4EZ6A 1WCNA 4O5CA 4F2RA 1NKCA 3IV6A 4Z6CA 5AI8A 4UAVA 2AU0A 3Q8SB 4YQWA 1NK7A 3H0MB 4M0AA 2WAQF 1M6YA 4OD0A 4DQPA 1PUZA 2ZIWA 1Z4NA 4YXJA 4FZLA 4ED7A 3M8RA 5B5EU 3OHBA 3F2BA 3RTVA 7ICVA 3RB4A 3QX7A 5F3XB 1JALA 4UB6U 1NJYA 2K4PA 2BHNA 4UAYA 5KFQA 2BQUA 4NLNA 4TQRA 1K1QA 4Y2XA 2KHVA 4Q44A 5AKGA 1Z19A 3PZPA 1KSPA 4E0DA 3C2KA 4I2CA 3N7PD 2W8KA 8ICAA 5KFVA 1TV9A 4PHPA 1IG6A 2HVIA 1IV8A 4ED0A 2FDRA 3IP4B 2IOFA 1TAMA 3NRZA 5DG8A 5AM2A 2W9CA 5AI6A 5KNIA 4DSLA 2ZJAA 5J2KA 1J97A 3E0FA 1L3VA 4MF8A 4QZFA 4CF3A 4RQ7A 4PHEA 3V7KA 3KHGA 2JH7A 4FZNA
chains in the Genus database with same CATH topology
4NV0A 4BX9C 2JH1A 3IG5A 3SAGA 1CRXA 2WB1F 5KL1B 2KJ9A 3D2QA 2A3VA 3AQEA 3VCBA 1PVQA 2K4HA 2ZIXA 2DGZA 3SQIA 3VC8A 1XO0A 2OXOA 1Q3UA 5A0LA 4FZMA 2HBLA 3KFUF 3PSTA 3AL0B 4O3MA 4C0ZA 1ZQ1C 5HR7A 2F77X 2CRXA 4P0PA 2KD1A 2LYAA 1HEKA 2DF4B 2VIXA 2KVCA 2HBJA 4KMOB 2LHTA 2MRLA 1YT3A 2CPRA 2ZXIA 2G5HB 3HKZF 1L6NA 2KJ5A 3HKZC 2HOIA 2KEYA 1D8BA 3F5EA 4NLBA 2Y0SC 2VJ5A 2JGAA 3PSFA 2K8AA 2F8LA 2ZG6A 2BDUA 2KNJA 3GU3A 3D2SA 4QIWF 4PL2A 2XVTA 3NRWA 1P7DA 3C29A 2W7OA 3H0MB 3M6KA 4QIWC 2WAQF 1KBUA 2LKYA 2K8CB 1IIPA 3M6ZA 4U7CA 4PL1A 2LYBA 4QNLA 3IN5A 2ZIWA 3H0RB 4FZLA 2Z7JA 2K89A 3CP8A 2F2AB 2W03A 2DQNB 1GO3F 3SAHA 2PMZC 2KJ8A 2GOLA 4FE3A 4OJ5A 2HBMA 2F76X 4BUGA 4NLCA 3RF9A 2XICA 1A0PA 3KZXA 2H3IA 3F2BA 3LVWA 3N7SC 3C28A 3F5AA 3CRXA 2HBKA 2D6FC 2HOQA 2M0NA 2R18A 1ED1A 2ZIXB 3GZFA 3OPXA 2RHFA 4P0PB 2KKVA 1A6SA 5CRXA 2WAQC 4CRXA 2E1FA 3DEEA 1UPHA 2ZIUB 3F53A 4CDGA 1NZBA 3N7RC 2JHDA 3CYMA 2G07A 3RFAA 1WUDA 2E1EA 2G5IB 2K4IA 3SAFA 2OH2A 3NUQA 2MA1A 1URJA 3ONNA 1XNSA 2G0AA 1OUQA 4CGZA 2K8BB 2VKQA 4KX5A 2KHVA 3K1ZA 2KIWA 3H0LB 1Z19A 4OJOA 3PZPA 4U6PA 4ICAA 4A8EA 2Q4TA 2KOBA 3M7DA 4P0QB 3LVVA 2KKPA 2ZIWB 4OJPA 2JMGA 3ALRA 3N7PD 2HMXA 2XIDA 3L3FX 2RRDA 1ECWA 3MGVA 3LYSA 2YB1A 2OYYA 2ZIVB 2G06A 3F2DA 4BJQA 1MA7A 2G09A 2ZXHA 1F44A 2HOFA 3SMVA 2W04A 2YB4A 2LBOA 2YX8A 2WB1C 2RP5A 1SZHA 3PSIA 1T94A 2PMZF 4AYBF 3IG8A 4JMUA 3IP4B 4P0QA 4IC9A 3T79A 3F2CA 2OM6A 4NWIA 5HR6A 2G08A 2KHQA 3O0FA 1TAMA 3ICXA 4GFJA 2GH1A 2E5SA 2H3QA 4OJ6A 5T14A 5C0YA 1Z1BA 2KICA 2VJ4A 5KL8B 2KV2A 1PVRA 4KX3A 2ZIVA 3D2NA 2H3ZA 2H3FA 2K4EA 1DRGA 2NV3A 2ZIUA 3E0FA 2CN1A 4QJFB 2Y0SF 4ACOA 2N1RA 2W7PA 1Q3VA 3PSPA 1PVPA 1HIWA 4FZNA 4OO1J 4OJLA 4WJ3B 3AQFA 2JH7A 4AYBC 2XI9A 2H3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7P D;  2XVT A;  2YX8 A;  3N7R C;  3AQE A;  3AQF A;  3N7S C; 
#chains in the Genus database with same CATH topology
 4KLL A;  4P4P A;  5KFW A;  3C1Y A;  3M9O B;  1XO0 A;  1Z1V A;  3H8S A;  3PR5 B;  8ICL A;  1O08 A;  4M9H A;  2VIX A;  1X66 A;  2W54 A;  2HBJ A;  5DLG A;  3QUT A;  4EEN A;  3UQ2 A;  2KEY A;  2UVW A;  4US8 A;  3TAD A;  3QUC A;  4DEZ A;  3ZDD A;  1QLN A;  1P7D A;  3M6K A;  1BNP A;  3EUB 2;  3V7L A;  3BZK A;  1ZYQ A;  3SR6 A;  4KTQ A;  1GO3 F;  2HHQ A;  2QAR A;  4NM2 A;  3LVW A;  4C4R A;  5J0Y A;  4UB8 U;  3WK9 A;  1ZRN A;  4O0I A;  4P0P B;  3PW0 A;  1N62 A;  1ZQK A;  3RH6 A;  3UPQ A;  2WF8 A;  3ISC A;  2G0A A;  4IQU A;  1SXD A;  2YTU A;  3BZC A;  4MFF A;  1ZQY A;  4RQ3 A;  5KFZ A;  5KFB A;  3M1Y A;  2YMM A;  3NVW A;  5AM5 A;  4ECT A;  4JWM A;  2XID A;  4Q43 A;  5KFT A;  2OYY A;  1N60 A;  2Y1J A;  3WK5 A;  2KSO B;  2LBO A;  2NRV A;  4DL5 A;  9ICT A;  3RAX A;  1RM6 C;  1FEZ A;  2AGQ A;  1RZT A;  1Y88 A;  2BKE A;  2LI6 A;  1PVR A;  1QTM A;  5L1I A;  4J9S A;  1RPL A;  1NKB A;  5CJ7 A;  2Y0S F;  1TFR A;  5D46 A;  3C2L A;  1SV0 A;  2UVV A;  2IOF K;  4DFJ A;  2AQ4 A;  3FYH A;  2W3R A;  1SV0 C;  1MQ2 A;  2DGZ A;  5J0P A;  3EZ5 A;  3SV4 A;  4KMU A;  5G5G A;  4C0Z A;  3G6V A;  8ICN A;  2R8K A;  2GWS A;  3QUQ A;  5AI0 A;  4DSE A;  1BPB A;  2P35 A;  2DWQ A;  1U48 A;  1B4F A;  4C8K A;  4B9M A;  2XY6 A;  4YR0 A;  2W7O A;  1ZQU A;  3T5L A;  3I1Y A;  2K8C B;  1S0M A;  2LYB A;  2NRW A;  4EEY A;  3QU4 A;  3PO4 A;  4M6W B;  4F5R A;  1JUD A;  3CRX A;  4DL3 A;  2D6F C;  1KFT A;  1B43 A;  4CCH A;  2JR5 A;  2PFQ A;  4I27 A;  3RRG A;  5AM4 A;  4CDG A;  3F53 A;  5CHG A;  4JWN A;  2G07 A;  3RH5 A;  4F8R A;  5BOM A;  1JX4 A;  1OUQ A;  2VKQ A;  4MHV A;  3RJG A;  2B6G A;  2JRZ A;  2KOB A;  2XY7 A;  1L7N A;  4I29 A;  1S5L U;  4C8O A;  4UBB A;  3AM9 A;  2L5Y A;  2VAN A;  4RQN A;  3T5H A;  4K4H A;  5ALU A;  3RBD A;  2Q0Z X;  2G09 A;  2ZXH A;  2DL0 A;  3I76 A;  1YZ6 A;  4J9L A;  4J9R A;  4KLJ A;  3B0Y A;  1IM4 A;  4C8N A;  2E5S A;  4RQ5 A;  2D3D A;  1ZQM A;  3PMN A;  3KHR A;  2KK0 A;  2NV3 A;  4PH5 A;  4EX7 A;  4ECW A;  3TAN A;  5AKX A;  1N56 A;  4YFK A;  1PK3 A;  4GXJ A;  3ZDC A;  4UAR A;  5ALN A;  1PK1 A;  3H7I A;  2QLT A;  1KRP A;  3AU6 A;  3RJF A;  1JRO A;  2E8P A;  4B9S A;  3NS1 A;  2XGQ A;  5KTQ A;  4QZ8 A;  3PML A;  4B9L A;  3PX4 A;  3OSP A;  2C2E A;  4KN7 A;  4DSJ A;  5GTI U;  4M9G A;  3WU2 U;  4UB1 A;  3M6Z A;  3ETR A;  7ICE A;  1PK1 B;  5KFC A;  1TVA A;  2DBY A;  4F71 A;  4C8M A;  4MFC A;  2UVU A;  5ALO A;  3RF9 A;  1ZQN A;  4DF8 A;  3WKB A;  2ZTD A;  2FLP A;  4QWE A;  1MQ3 A;  3S6J A;  2M0N A;  1XC9 A;  2A1J B;  4TUQ A;  1A6S A;  5CRX A;  4I2J A;  1UA0 A;  1ARO P;  4YMM A;  4HYK A;  3HRD D;  3NUQ A;  4B9T A;  3TKA A;  1T8E A;  1JXL A;  3SEN A;  3T5J A;  4R63 A;  3HPO A;  4EX6 A;  3KOO A;  4DFK A;  3HT3 A;  1ZQP A;  3WK7 A;  5CWR A;  4I2F A;  4RQ6 A;  3ALR A;  5ALV A;  5ALG A;  2NO5 A;  1FIQ A;  1S9F A;  4LVS A;  3J81 j;  4FS2 A;  2FLL A;  2WTF A;  4I2B A;  1BVS A;  4AYB F;  3IG8 A;  5CR0 A;  1WG8 A;  4DSK A;  4PZN A;  2G08 A;  2WF5 A;  5DKW A;  2LM4 A;  4IRK A;  3MDC A;  3PX0 A;  3TI0 A;  4J9M A;  3WKA A;  4KN4 A;  2K4E A;  5EE1 A;  2IA6 A;  5DB9 A;  1V97 A;  1XS9 D;  4FBT A;  4AYB C;  3DDH A;  4NV0 A;  1K1S A;  3MR6 A;  1KKX A;  3H8M A;  1L8O A;  4PHD A;  2A3V A;  4JV1 A;  2KZ3 A;  4KLG A;  1O03 A;  2F44 A;  4C4S A;  3PNC A;  1U9L A;  4J03 A;  4O3S A;  1TK5 A;  2PFN A;  3HW8 A;  1AQ6 A;  5AKL A;  1H38 A;  2C22 A;  4NLB A;  4RT2 A;  2JGA A;  4QZC A;  1SWW A;  3ZD9 A;  4DSI A;  1TK8 A;  5EWE A;  4KLO A;  8ICP A;  5J8Y A;  4IL6 U;  2WF7 A;  4YD1 A;  3IRU A;  4YCX A;  1JI7 A;  1DK2 A;  3CP8 A;  3RH4 A;  3A0H U;  3SAH A;  1ZD5 A;  2ES6 A;  2ZUB A;  3KZX A;  2YML A;  2HBK A;  4KLH A;  2EAM A;  4EBC A;  3SEI A;  1U49 A;  5EE0 A;  4I2A A;  1X9W A;  1NZB A;  8ICC A;  4UB3 A;  1WUD A;  4MEY A;  2E8N A;  2YN4 A;  4KX5 A;  4KLU A;  9ICJ A;  2F3N A;  2Q4T A;  3KKA C;  3MR5 A;  2J6S A;  1VLB A;  5DB8 A;  5J2J A;  2HVH A;  2EAN A;  2ATL A;  2PKE A;  7ICR A;  4NL9 A;  1MA7 A;  5HHI A;  3LWM A;  2LYH A;  4DF4 A;  5EWF A;  1DGJ A;  4DLE A;  4EYH B;  4RQ2 A;  3RJJ A;  3BS5 B;  1SL0 A;  1DGS A;  2YMP A;  2KZZ A;  1DXS A;  2RDJ A;  4KLT A;  1S8O A;  5HHH A;  2KFZ A;  2W55 A;  3C1Z A;  2PFO A;  2H3Z A;  3MDA A;  2KFN A;  9ICC A;  5DG7 A;  1HIW A;  3T5K A;  4WJ3 B;  3AQF A;  5AIC A;  2JH1 A;  3M9M B;  3UQ0 A;  1YZ7 A;  5TIS U;  2BCV A;  1LKY A;  2ZTC A;  3WKD A;  2HBL A;  1ZOL A;  3C5F A;  4US9 A;  4P0P A;  3ETL A;  5JTI A;  5DDY A;  2BR0 A;  1C20 A;  2KJ5 A;  5ALJ A;  1Z3E B;  2Y0S C;  4RQ1 A;  1A76 A;  4I2H A;  4DOB A;  2XVT A;  2E8M A;  5J29 A;  4B9U A;  4QNL A;  3EPG A;  5ALX A;  8ICE A;  4NJ8 A;  4GC6 A;  2DQN B;  3QZ7 A;  3KTQ A;  3H8J A;  2WF6 A;  2GOL A;  1IXR A;  2NO4 A;  4UAU A;  1T3N A;  3C28 A;  1BPE A;  4P2H A;  5KT4 A;  8ICY A;  2AH5 A;  8ICV A;  3OPX A;  5KG2 A;  1COO A;  5EWG A;  2W9C B;  1U45 A;  2E1F A;  4O5K A;  2JHD A;  1BPZ A;  5DB6 A;  4F4Z A;  2BCU A;  3AN1 A;  3JPT A;  2KSO A;  2EDU A;  1BPD A;  1ZQL A;  1ZQJ A;  2EZY A;  1S0O A;  2HMX A;  2RRD A;  5J2B A;  1HJP A;  1F44 A;  4PJ0 U;  1S77 D;  5TZV A;  3RJK A;  4ELT A;  4KLM A;  2EZZ A;  2XCP A;  5KFA A;  3AU2 A;  3ZDA A;  5KFL A;  3HX0 A;  5KT5 A;  3NVZ A;  7ICS A;  1SGG A;  3V6J A;  9ICH A;  2DUY A;  2W7P A;  4Y2T A;  3UXO A;  2PI5 A;  4PGX A;  8ICW A;  3H0L B;  2H3V A;  4K4I A;  4M9N A;  1CRX A;  2GO7 A;  2AGP A;  3QYP A;  3SQI A;  7ICH A;  4RUC A;  5ALW A;  4J9K A;  4QZE A;  1ZJN A;  9ICQ A;  4JUZ A;  2BCS A;  1ZQW A;  4IRD A;  3TFR A;  2ZUD A;  2ODG A;  3H40 A;  8ICK A;  2VJ5 A;  3HWT A;  3QNM A;  1SKR A;  4EEK A;  2RDI A;  5AK4 A;  4QIW C;  2LKY A;  1D9D A;  5J0U A;  4QZB A;  3Q8M A;  4IRC A;  2F2A B;  3L4P A;  3UXP A;  4ECY A;  4DOC A;  2JEF A;  2R8J A;  1RYR A;  4XRH A;  3UMC A;  2KN7 A;  1A0P A;  2F1I A;  1F0M A;  2F1J A;  1LKY B;  4QWB A;  2WAQ C;  4CRX A;  4DWI A;  3N7R C;  5CB1 A;  2K4I A;  2W11 A;  3ONN A;  3FC4 A;  3BQ2 A;  4ED1 A;  2K8B B;  1F5S A;  1QSS A;  2W9M A;  2IBK A;  1N2X A;  4RPX A;  5KFO A;  2OCE A;  1JIH A;  5DQI A;  1D8L A;  3KD3 A;  4R8U A;  4F91 B;  4B6J A;  7ICI A;  2WFA A;  3OSN A;  3OHA A;  4ECS A;  4IC9 A;  4IQV A;  2PXI A;  5KG7 A;  1NK6 A;  3JPS A;  2HI0 A;  3QU9 A;  1ZD3 A;  1WWV A;  5ALK A;  5J0W A;  4RNO A;  1DRG A;  2CN1 A;  3TAQ A;  1LB2 B;  5AK5 A;  4UAZ A;  1S76 D;  4XUS A;  3CNH A;  3FDS A;  9ICA A;  2XI9 A;  1RG6 A;  4DQS A;  3RR7 A;  7ICM A;  3KHL A;  2HHT A;  3VC8 A;  8ICS A;  5KFS A;  4FZM A;  1SV4 A;  1BPX A;  2FMP A;  1NJX A;  3IHQ B;  4UAS A;  3PW7 A;  2E3T A;  2ISO A;  2OHF A;  3CW2 C;  2FPL A;  2W9B A;  3WKE A;  5J0T A;  1X9S A;  4NLK A;  2W43 A;  1ZQB A;  3H0R B;  3TAC B;  3GFK B;  2A1A A;  2A19 A;  1X9X A;  1KDH A;  2R8G A;  3RJH A;  4X5V A;  3C5G A;  3V6H A;  2F8K A;  4PPX A;  9ICU A;  1ZET A;  2MA1 A;  4DL7 A;  3IM1 A;  4IR1 A;  1ZQR A;  1A77 A;  3AMZ A;  1Q8K A;  4P0Q B;  4TUS A;  3LYS A;  4QWD A;  2ZIV B;  1NZP A;  1FFV A;  5J0S A;  2HOF A;  5DB7 A;  5DLF A;  8ICI A;  2WB1 C;  2RP5 A;  5KFX A;  1CUK A;  1SZH A;  4Y2Y A;  3O0F A;  5C5J A;  2J6T A;  8ICT A;  2ZIU A;  4J9P A;  2NRT A;  4YR2 A;  3BQ0 A;  4OJL A;  3QEA Z;  2XO7 A;  3AUO A;  4F93 B;  5BPC A;  4KLQ A;  3PV8 A;  3VCB A;  1PVQ A;  2HHV A;  2MAX A;  5A0L A;  1ZQG A;  3AL0 B;  1B22 A;  2JV3 A;  1HEK A;  5B66 U;  5KFJ A;  2MRL A;  2YMQ A;  1D9F A;  7ICK A;  1RXV A;  2K8A A;  4Y2U A;  2BDU A;  4UW9 A;  4PL2 A;  1JRP A;  2DKX A;  2KZM A;  9ICL A;  4I2G A;  2JEJ A;  3DV9 A;  4BXO B;  5HNK A;  5J0R A;  4FFD A;  1ZQS A;  1ZQA A;  2PI4 A;  2B0C A;  2PMZ C;  4OJ5 A;  1X42 A;  1SXE A;  3N7S C;  1S0N A;  3GII A;  3H8W A;  2KP7 A;  3OJS A;  2FPK A;  4R65 A;  4ZOH C;  4F3O A;  4F5N A;  4KLF A;  3QU2 A;  2OH2 A;  2E1E A;  5AKK A;  2DKZ A;  4QZG A;  2VA8 A;  5IIN A;  1XNS A;  2FMQ A;  4DFD A;  3RRH A;  3SZ2 A;  5J8Y C;  1LVH A;  4DQQ A;  4ELV A;  7ICU A;  4OJP A;  1ZQT A;  3ZDE A;  4RUA A;  5AKH A;  4EYI B;  3PSI A;  4YN4 A;  3PW5 A;  2OM6 A;  8ICO A;  5T14 A;  1Z00 A;  1Z1B A;  2YQE A;  2VJ4 A;  4DFM A;  1UT8 A;  4F5O A;  1NJZ A;  2H3F A;  2FMS A;  9ICB A;  3SV3 A;  9ICP A;  4Q8E A;  5DQH A;  5HMM A;  3IG5 A;  2KJ9 A;  3D2Q A;  4M04 A;  1NKE A;  2HHS A;  4Y2J A;  2F77 X;  2CRX A;  3C23 A;  1JMS A;  5K4L A;  2JEI A;  3BS5 A;  4NLG A;  3BQ1 A;  4QZD A;  7ICP A;  4ED6 A;  2ISP A;  1SIJ A;  1T3Q A;  5D4B A;  2M9N A;  5EOZ A;  1S97 A;  4DQI A;  1KBU A;  1OW5 A;  1IIP A;  5JUM A;  5J2E A;  5ALD A;  2Y1I A;  1ZQH A;  2BPC A;  2Z7J A;  2MUT B;  2HHU A;  4DLG A;  7ICG A;  5KT6 A;  2W03 A;  4DFP A;  4C4T A;  3PY8 A;  1XSN A;  3UM9 A;  3PVX A;  3GZF A;  4IQW A;  5KFG A;  3WK4 A;  4MEX A;  2ZJ5 A;  4GXI A;  9ICW A;  2FJ6 A;  3V72 A;  2QAR B;  1V85 A;  2W3S A;  3RJI A;  3MR3 A;  9ICV A;  1SKS A;  5J2D A;  4O9M A;  1L3U A;  8ICX A;  5KFU A;  3NGD A;  4C7Y A;  8ICB A;  3M9N B;  1XWL A;  4I28 A;  4DQR A;  5J2F A;  3RAQ A;  1XU4 A;  4EZ9 A;  1WWU A;  2YX8 A;  4ECQ A;  2PMZ F;  4P0Q A;  2LM1 A;  4GLX A;  4P4O A;  3OJU A;  2I6X A;  2IHM A;  4OJ6 A;  1SWV A;  1KFD A;  2KIC A;  4KLD A;  5ALH A;  5DGA A;  5IIO A;  2NRZ A;  3FAH A;  3U26 A;  4Q45 A;  3D2N A;  8ICH A;  3NTU A;  3B0X A;  2JXJ A;  3QZ8 A;  3TAR A;  2MSN A;  3MC1 A;  2EQY A;  1N5W A;  2OXO A;  5DQG A;  4Y2P A;  4PZO A;  1UT5 A;  3ZI4 A;  5AM1 A;  1N63 A;  4UQG A;  4RQM A;  2KMD A;  4XQ8 A;  2KVC A;  4QWC A;  4IR9 A;  2V4Q A;  5KAF U;  1EXN A;  2QB0 A;  4LJX A;  1VDV A;  4DO9 A;  2FI1 A;  5CP2 A;  2ALZ A;  4IS7 A;  1HUZ A;  1X6I A;  4F5Q A;  1LV5 A;  4CE6 A;  3PSF A;  4RPZ A;  5DBB A;  3HJE A;  2JZB B;  4YXM A;  3V6K A;  2MUT A;  5J2G A;  3OTQ A;  3TAP A;  4TQS A;  4PGY A;  4ECU A;  1BNO A;  5EE9 A;  4BWJ A;  3T3F A;  9ICI A;  2NYV A;  2H3I A;  4M9J A;  2HOQ A;  3WKC A;  1ED1 A;  1XO1 A;  2RHF A;  2KTQ A;  2KKV A;  3GV8 B;  1N48 A;  4UAT A;  3TFS A;  4ED2 A;  3GV7 B;  1S0V A;  2KIV A;  4TUP A;  5DGB A;  1ZQD A;  1TK0 A;  4DCC A;  1ZQV A;  3GIL A;  5CA7 A;  2I9G A;  4ICA A;  1SZP A;  5L1M A;  2XGP A;  3M7D A;  4CF4 A;  1ZQF A;  2JMG A;  5J2I A;  1SL2 A;  5KFR A;  4UAW A;  2J6U A;  3F2D A;  1WYG A;  4BJQ A;  2EAP A;  1HUO A;  4ECZ A;  4ED8 A;  4JMU A;  4EBD A;  4TUR A;  2BCR A;  3M8S A;  5KFH A;  2EH9 A;  2P66 A;  4GFJ A;  3GQC A;  9ICF A;  4RNN A;  4KX3 A;  3B9J A;  5KG0 A;  5G5H A;  3H4B A;  4ACO A;  3Q8R B;  1PVP A;  3N97 B;  2KE7 A;  1FFU A;  3AQE A;  1KW4 A;  5ALZ A;  2K4H A;  4J9N A;  5L1K A;  2FE9 A;  1V38 A;  4KIT B;  2DPJ A;  2AGO A;  3QXG A;  5E79 U;  2KD1 A;  3BQ7 A;  2DF4 B;  4DL6 A;  4BGD A;  4Y2Q A;  4F4X A;  4KMO B;  3QE9 Y;  2G5H B;  4B9N A;  9ICR A;  2KNJ A;  3L5K A;  2WF9 A;  2BGW A;  5ALY A;  3GIJ A;  3QU5 A;  4PL1 A;  1RYU A;  3UMB A;  3K75 D;  1NJW A;  1N5X A;  2BDP A;  4NLZ A;  2V4R A;  4FE3 A;  1J2M A;  2F76 X;  5L1J A;  4NLC A;  4IQT A;  4MFA A;  4LZG A;  4M6W A;  3V7J A;  4F5P A;  1QQ5 A;  1TE2 A;  1UPH A;  1CEZ A;  5IIJ A;  5ALT A;  3RFA A;  5AM0 A;  2IMW P;  5ALL A;  2ZJ8 A;  4G9B A;  4DS5 A;  4FS1 A;  1CI4 A;  4ECX A;  1RQN A;  3K1Z A;  5ALM A;  3UMG A;  4U6P A;  2AJQ A;  1KL9 A;  4G3I A;  2WHE A;  3NAS A;  2XY5 A;  5III A;  5J0Q A;  3MGV A;  1ZQQ A;  2RLT A;  2ASJ A;  2OWO A;  8ICR A;  8ICU A;  5AKE A;  4I2I A;  3MFH A;  4KLS A;  3ICX A;  2MU2 A;  2GH1 A;  2H3Q A;  2HW3 A;  2H5X A;  2ZIV A;  3EW9 A;  3THV A;  4C7Z A;  5IIM A;  5ALS A;  5KT2 A;  2I5H A;  7ICN A;  4F4K A;  3PX6 A;  3NVV A;  3RB0 A;  3Q8Q B;  4Z6D A;  2ZIX A;  4RQ8 A;  3MR2 A;  4JK1 A;  5J2H A;  3KFU F;  4EBE A;  5JU5 A;  2Y9T A;  2EZX A;  2K60 A;  5AK6 A;  7ICJ A;  5D49 A;  3JPN A;  3G6X A;  4DOA A;  1T7P A;  4RNM A;  2LHT A;  1U47 A;  1YT3 A;  3ED5 A;  2ZXI A;  4Z6F A;  4P4M A;  5AKI A;  3HKZ C;  4F4Y A;  4M47 A;  3Q8L A;  4I2E A;  4NY8 A;  1B0X A;  4QZ9 A;  2ZG6 A;  3GU3 A;  1NK9 A;  1ZQX A;  4QIW F;  1ZXI A;  3QU7 A;  7ICO A;  4R8U B;  3HIL A;  5ALI A;  8ICG A;  2O6K A;  4RU9 A;  4UB4 A;  5AKJ A;  4YMN A;  3IN5 A;  5IIL A;  3GIK A;  3K4G A;  5AI4 A;  5L9X A;  2XIC A;  3LK9 A;  1L5U A;  1ZQE A;  5DDM A;  1QQ7 A;  2ZIX B;  5KFY A;  7ICT A;  2AHO B;  1QQ6 A;  2C2R A;  9ICG A;  3FM9 A;  4DSF A;  2BCQ A;  4NXZ A;  4UB5 A;  3GDX A;  4F92 B;  4J9O A;  1TAU A;  1NK5 A;  5AI9 A;  4DL4 A;  5HP4 A;  3KKA A;  2P6U A;  4JB3 A;  4B9V A;  4DL2 A;  2F1H A;  2UVR A;  5CEH A;  4KLE A;  3E58 A;  2JZB A;  5KG4 A;  3GIM A;  3K1R B;  5KFM A;  3RB3 A;  1ECW A;  4NL9 C;  5DBC A;  1MSW D;  1MC8 A;  3BS7 A;  1V9P A;  2LPE A;  5GTH U;  1PZN A;  4GXK A;  1FO4 A;  5L1L A;  5HR6 A;  2KHQ A;  3EPI A;  5AIA A;  4GC7 A;  4Z6E A;  3N28 A;  1RDF A;  4MF2 A;  1DK3 A;  1SL1 A;  4U7C A;  2KG5 A;  2W9A A;  3JPQ A;  2C2D A;  5J2C A;  1T4G A;  4NM1 A;  2OEH A;  1QH9 A;  2W8L A;  4ECV A;  2BPF A;  4USA A;  5AI5 A;  3BQT A;  4RPY A;  2D8C A;  3RR8 A;  3GV5 B;  2CPR A;  1Z4O A;  4EEL A;  1D8B A;  4JV2 A;  2VA2 A;  4Y2S A;  3OGU A;  1KEJ A;  2F8L A;  4C8L A;  3MGI A;  3SI8 A;  2VA3 A;  3WK8 A;  3KBB A;  4FBU A;  2A1J A;  3R9K A;  3JPO A;  3SYZ A;  1SKW A;  3RB6 A;  1X2I A;  2I1Q A;  4PHA A;  2R18 A;  1L7M A;  4O3N A;  2ZIU B;  1RXW A;  9ICS A;  1BGX T;  2ASD A;  1URJ A;  2AXT U;  1KLN A;  8ICJ A;  2YY6 A;  4QZI A;  8ICM A;  4CGZ A;  4BWM A;  2ESE A;  4QZH A;  1KN5 A;  4LZD A;  4A8E A;  7ICQ A;  1NK0 A;  3C2M A;  3HP6 A;  2BZF A;  2YB1 A;  5KG1 A;  3KZI U;  1S10 A;  3ORY A;  2YB4 A;  2V9W A;  1D8Y A;  4UB2 A;  5KT7 A;  3KHH A;  3F2C A;  3QEB Z;  1UQV A;  4I2D A;  1ZJM A;  4YD2 A;  7ICF A;  5HML A;  3UXN A;  5F9N A;  2QKQ A;  3JPR A;  2AQ0 A;  2Y9U A;  1Q3V A;  2P6R A;  4OO1 J;  2KVS A;  2LMR A;  5AIB A;  2QB1 A;  4O5E A;  4BX9 C;  3SAG A;  3JPP A;  3Q8K A;  1COK A;  3RJE A;  5KL1 B;  2C28 A;  1BPY A;  1NK8 A;  1QSL A;  3MBY A;  5AK3 A;  2CXY A;  3MGH A;  2XC9 A;  3PST A;  1ZD2 P;  3LDA A;  4ZH4 A;  1RYS A;  3TQ1 A;  5KFE A;  5H2F U;  4YR3 A;  1JXE A;  4QZA A;  1L6N A;  1NOM A;  9ICK A;  2HOI A;  4RT3 A;  1ZRM A;  5KT3 A;  4F2S A;  4Q8F A;  5EE3 A;  3LWL A;  3NRW A;  1NNL A;  1QCK A;  5JRT A;  5KG6 A;  1MN8 A;  2QB0 B;  4CF5 A;  5KFF A;  1L8L A;  4DS4 A;  3IDW A;  4CNQ A;  3RBE A;  2HBM A;  4BUG A;  2B21 A;  1XSL A;  1QSY A;  3F5A A;  1Q46 A;  2FLN A;  3A0B U;  3H4D A;  3ISB A;  4ELU A;  4R64 A;  1XSP A;  4QW9 A;  3CYM A;  4YG2 A;  3MFI A;  3SAF A;  2R8I A;  2NRX A;  1JN3 A;  5KFP A;  8ICQ A;  1VJ5 A;  2ASL A;  3NVY A;  3LVV A;  2KKP A;  2ZIW B;  1ZD4 A;  1TAQ A;  4O3P A;  3BDP A;  1L7P A;  3PW4 A;  3L3F X;  4BDP A;  5ALR A;  5ALF A;  3ISD A;  4YP3 A;  1K5O A;  1C7Y A;  4RQ0 A;  4ECR A;  4O3R A;  3SMV A;  3T79 A;  4F50 A;  4FO6 A;  3C21 A;  4K4G A;  4JV0 A;  5J0X A;  4RQ4 A;  3PO5 A;  1DOQ A;  4QWA A;  5KL8 B;  3MAB A;  1UA1 A;  3SD7 A;  1L7O A;  5DBA A;  4QJF B;  5AKZ A;  2GLE A;  4BXO A;  1U4B A;  4QW8 A;  8ICZ A;  5KFN A;  9ICN A;  2BPG A;  2WB1 F;  4Y2R A;  1Z00 B;  3D6J A;  3I28 A;  3PW2 A;  4XA5 A;  4PGQ A;  4GIB A;  3E2E A;  1X40 A;  4O3M A;  1ZQ1 C;  2LYA A;  5DG9 A;  2FPM A;  3EYZ A;  4YVZ A;  1KFS A;  3G6Y A;  9ICE A;  2E8O A;  2RQ5 A;  3HKZ F;  5F9L A;  5BOL A;  3F5E A;  5ALQ A;  5AKY A;  5KG5 A;  2ZTE A;  1L3T A;  3D2S A;  1J2N A;  1L3S A;  3C29 A;  4YMO A;  4O3Q A;  3Q8P B;  1ZQI A;  3BJY A;  1SB3 C;  4Y2V A;  3EWA A;  2K89 A;  5ALE A;  2IHN A;  3AEV A;  1NI3 A;  9ICX A;  1KQQ A;  5J0O A;  2KJ8 A;  4UBC A;  5KG3 A;  1ZQC A;  5AM3 A;  1N61 A;  3WK6 A;  3DEE A;  1ZQZ A;  1UCV A;  2G5I B;  3ZDB A;  2DFL A;  2R8H A;  5KFK A;  1TKD A;  2PFP A;  2HCF A;  5ALP A;  2HSZ A;  4F72 A;  2KIW A;  4OJO A;  1ZQO A;  4C80 A;  2ZUC A;  4F4W A;  2IOH A;  2W9B B;  4HAI A;  5KAI U;  4ED3 A;  7ICL A;  5FP0 A;  2XCA A;  2HHW A;  2BQR A;  2G06 A;  2HHX A;  2DPI A;  1WCL A;  4O3O A;  2W04 A;  3N4M B;  4R66 A;  1OXJ A;  1T94 A;  4NWI A;  2JEG A;  4J9Q A;  1X9M A;  1X6J A;  5C0Y A;  3ZD8 A;  4M2Y A;  1NK4 A;  2KV2 A;  3QUB A;  8ICF A;  5KFD A;  2HDO A;  2N1R A;  3PSP A;  5IIK A;  4AP9 A;  1RQL A;  3TAD C;  4OCZ A;  4M9L A;  9ICO A;  2BQ3 A;  9ICM A;  4RZR A;  1KTQ A;  1Q3U A;  5AHX A;  2EAO A;  3PR4 A;  4KLI A;  5KFI A;  5HR7 A;  1UHU A;  5J2A A;  4EZ6 A;  1WCN A;  4O5C A;  4F2R A;  1NKC A;  3IV6 A;  4Z6C A;  5AI8 A;  4UAV A;  2AU0 A;  3Q8S B;  4YQW A;  1NK7 A;  3H0M B;  4M0A A;  2WAQ F;  1M6Y A;  4OD0 A;  4DQP A;  1PUZ A;  2ZIW A;  1Z4N A;  4YXJ A;  4FZL A;  4ED7 A;  3M8R A;  5B5E U;  3OHB A;  3F2B A;  3RTV A;  7ICV A;  3RB4 A;  3QX7 A;  5F3X B;  1JAL A;  4UB6 U;  1NJY A;  2K4P A;  2BHN A;  4UAY A;  5KFQ A;  2BQU A;  4NLN A;  4TQR A;  1K1Q A;  4Y2X A;  2KHV A;  4Q44 A;  5AKG A;  1Z19 A;  3PZP A;  1KSP A;  4E0D A;  3C2K A;  4I2C A;  3N7P D;  2W8K A;  8ICA A;  5KFV A;  1TV9 A;  4PHP A;  1IG6 A;  2HVI A;  1IV8 A;  4ED0 A;  2FDR A;  3IP4 B;  2IOF A;  1TAM A;  3NRZ A;  5DG8 A;  5AM2 A;  2W9C A;  5AI6 A;  5KNI A;  4DSL A;  2ZJA A;  5J2K A;  1J97 A;  3E0F A;  1L3V A;  4MF8 A;  4QZF A;  4CF3 A;  4RQ7 A;  4PHE A;  3V7K A;  3KHG A;  2JH7 A;  4FZN A; 
#chains in the Genus database with same CATH homology
 4NV0 A;  4BX9 C;  2JH1 A;  3IG5 A;  3SAG A;  1CRX A;  2WB1 F;  5KL1 B;  2KJ9 A;  3D2Q A;  2A3V A;  3AQE A;  3VCB A;  1PVQ A;  2K4H A;  2ZIX A;  2DGZ A;  3SQI A;  3VC8 A;  1XO0 A;  2OXO A;  1Q3U A;  5A0L A;  4FZM A;  2HBL A;  3KFU F;  3PST A;  3AL0 B;  4O3M A;  4C0Z A;  1ZQ1 C;  5HR7 A;  2F77 X;  2CRX A;  4P0P A;  2KD1 A;  2LYA A;  1HEK A;  2DF4 B;  2VIX A;  2KVC A;  2HBJ A;  4KMO B;  2LHT A;  2MRL A;  1YT3 A;  2CPR A;  2ZXI A;  2G5H B;  3HKZ F;  1L6N A;  2KJ5 A;  3HKZ C;  2HOI A;  2KEY A;  1D8B A;  3F5E A;  4NLB A;  2Y0S C;  2VJ5 A;  2JGA A;  3PSF A;  2K8A A;  2F8L A;  2ZG6 A;  2BDU A;  2KNJ A;  3GU3 A;  3D2S A;  4QIW F;  4PL2 A;  2XVT A;  3NRW A;  1P7D A;  3C29 A;  2W7O A;  3H0M B;  3M6K A;  4QIW C;  2WAQ F;  1KBU A;  2LKY A;  2K8C B;  1IIP A;  3M6Z A;  4U7C A;  4PL1 A;  2LYB A;  4QNL A;  3IN5 A;  2ZIW A;  3H0R B;  4FZL A;  2Z7J A;  2K89 A;  3CP8 A;  2F2A B;  2W03 A;  2DQN B;  1GO3 F;  3SAH A;  2PMZ C;  2KJ8 A;  2GOL A;  4FE3 A;  4OJ5 A;  2HBM A;  2F76 X;  4BUG A;  4NLC A;  3RF9 A;  2XIC A;  1A0P A;  3KZX A;  2H3I A;  3F2B A;  3LVW A;  3N7S C;  3C28 A;  3F5A A;  3CRX A;  2HBK A;  2D6F C;  2HOQ A;  2M0N A;  2R18 A;  1ED1 A;  2ZIX B;  3GZF A;  3OPX A;  2RHF A;  4P0P B;  2KKV A;  1A6S A;  5CRX A;  2WAQ C;  4CRX A;  2E1F A;  3DEE A;  1UPH A;  2ZIU B;  3F53 A;  4CDG A;  1NZB A;  3N7R C;  2JHD A;  3CYM A;  2G07 A;  3RFA A;  1WUD A;  2E1E A;  2G5I B;  2K4I A;  3SAF A;  2OH2 A;  3NUQ A;  2MA1 A;  1URJ A;  3ONN A;  1XNS A;  2G0A A;  1OUQ A;  4CGZ A;  2K8B B;  2VKQ A;  4KX5 A;  2KHV A;  3K1Z A;  2KIW A;  3H0L B;  1Z19 A;  4OJO A;  3PZP A;  4U6P A;  4ICA A;  4A8E A;  2Q4T A;  2KOB A;  3M7D A;  4P0Q B;  3LVV A;  2KKP A;  2ZIW B;  4OJP A;  2JMG A;  3ALR A;  3N7P D;  2HMX A;  2XID A;  3L3F X;  2RRD A;  1ECW A;  3MGV A;  3LYS A;  2YB1 A;  2OYY A;  2ZIV B;  2G06 A;  3F2D A;  4BJQ A;  1MA7 A;  2G09 A;  2ZXH A;  1F44 A;  2HOF A;  3SMV A;  2W04 A;  2YB4 A;  2LBO A;  2YX8 A;  2WB1 C;  2RP5 A;  1SZH A;  3PSI A;  1T94 A;  2PMZ F;  4AYB F;  3IG8 A;  4JMU A;  3IP4 B;  4P0Q A;  4IC9 A;  3T79 A;  3F2C A;  2OM6 A;  4NWI A;  5HR6 A;  2G08 A;  2KHQ A;  3O0F A;  1TAM A;  3ICX A;  4GFJ A;  2GH1 A;  2E5S A;  2H3Q A;  4OJ6 A;  5T14 A;  5C0Y A;  1Z1B A;  2KIC A;  2VJ4 A;  5KL8 B;  2KV2 A;  1PVR A;  4KX3 A;  2ZIV A;  3D2N A;  2H3Z A;  2H3F A;  2K4E A;  1DRG A;  2NV3 A;  2ZIU A;  3E0F A;  2CN1 A;  4QJF B;  2Y0S F;  4ACO A;  2N1R A;  2W7P A;  1Q3V A;  3PSP A;  1PVP A;  1HIW A;  4FZN A;  4OO1 J;  4OJL A;  4WJ3 B;  3AQF A;  2JH7 A;  4AYB C;  2XI9 A;  2H3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...