3N7SC

Crystal structure of the ectodomain complex of the cgrp receptor, a class-b gpcr, reveals the site of drug antagonism
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
ACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Calcitonin gene-related peptide type 1 receptor
publication title Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3n7sC00
3AQEA 3N7SC 3N7PD 3N7RC 2XVTA 3AQFA 2YX8A
chains in the Genus database with same CATH superfamily
2K60A 4DCCA 3BQ0A 1FEZA 2WF7A 3M6ZA 3NUQA 4OJLA 5EE3A 4DFMA 2H3ZA 3RH5A 1MQ2A 2QB1A 5HMLA 2UVUA 5J0SA 2ALZA 3V7KA 3UQ0A 5J2JA 3PMNA 5CJ7A 2KJ9A 4R63A 4IQVA 1J97A 4Y2PA 2HOIA 4EEKA 5ALHA 3Q8MA 3BZKA 3GIJA 8ICNA 2ODGA 2XY7A 3AU2A 3HX0A 4C7YA 1S0VA 3BQTA 4MEXA 3NRZA 2KMDA 1MQ3A 2XVTA 1NJWA 4YD2A 1WUDA 1QQ6A 1NZPA 2K8BB 1FIQA 2WF5A 2R8KA 4BJQA 4C4SA 4C8MA 2DKXA 2ZIVB 2W11A 5L1LA 3OSPA 5J2EA 1A76A 4KMOB 5AM4A 1TE2A 2MRLA 5AKEA 4QZDA 4NJ8A 3QE9Y 2B6GA 1DOQA 1S0OA 1SXDA 3HW8A 5KG4A 4RQMA 3MDAA 3OJUA 1LVHA 4O5KA 4DLEA 3TAQA 2LYBA 3UM9A 3UMBA 3SYZA 1Z19A 3OHAA 4C8OA 4Y2VA 5KT7A 3IP4B 4OO1J 2ZIXB 5T14A 1SWWA 3QEAZ 5L1JA 5AM2A 2GOLA 5AKYA 1T3NA 3Q8QB 2Y9UA 1XSLA 3TFSA 5ALJA 4I2DA 1TAQA 1ZQCA 1NK8A 1PK1A 3A0HU 2KJ8A 2G08A 2DPIA 4BXOA 5CWRA 2YQEA 4JWMA 2JEIA 4UASA 3E58A 3I1YA 3C5GA 4M9NA 2WB1F 5ALMA 2Y1JA 1L7PA 2RP5A 3G6YA 4ED6A 1URJA 4B9SA 1Z00B 3TADA 3SI8A 3ED5A 5J2KA 5DB9A 1LB2B 9ICNA 2AXTU 3RRGA 3ORYA 4RT2A 4RQ1A 4JMUA 3HT3A 3M1YA 3ISDA 4Z6EA 1V9PA 2K89A 3LYSA 4M0AA 9ICAA 2QARA 8ICLA 5L1MA 2PFQA 1NK4A 3BQ2A 5CRXA 3C2KA 5KFFA 5J2BA 2YMMA 2QB0B 5EE1A 4UBCA 1NJYA 5HHHA 4YR3A 4DL4A 1HUOA 2HSZA 2FMQA 2EQYA 1RZTA 4IRKA 4QZHA 2HHWA 2F44A 3DV9A 1PK1B 2MUTB 4Q8EA 3EWAA 2MU2A 1YZ7A 5KFIA 1RXWA 5KFSA 5HHIA 4ED1A 3UQ2A 5DQGA 8ICXA 2HBLA 1H38A 5ALIA 5DBCA 1XWLA 3FM9A 3C1ZA 4FO6A 1NJZA 1C20A 2ASDA 1HEKA 3ICXA 2WAQC 1VLBA 5JTIA 3IN5A 3PW0A 2IMWP 1BPDA 2Z7JA 2NRZA 2KKVA 2F1HA 1ZQQA 2A1JB 5F3XB 2KP7A 3HWTA 2FMPA 3KFUF 1RYRA 5J2FA 4MFAA 2RHFA 2PMZF 4ECWA 4UAUA 2DPJA 4QIWC 1N5WA 2D8CA 2RRDA 5ALLA 1BPXA 3I28A 4NY8A 2ZTEA 2FJ6A 3WKCA 4F8RA 2HHXA 4PGQA 5CEHA 4Q8FA 1JX4A 5CP2A 3EPIA 1SL0A 4JB3A 3AL0B 2NRXA 4I2JA 1KEJA 4IQUA 4I2CA 4QZCA 4ED8A 3ZDDA 2C22A 1O08A 2CRXA 1ZQKA 1TVAA 2ZTDA 4I2BA 4B9LA 3B0YA 5EWEA 5CHGA 2ZXHA 3QUBA 4PZOA 5JUMA 2W8KA 2EZYA 4AYBC 5KT2A 4QWBA 2GO7A 3MDCA 3FC4A 2DWQA 4O5CA 4CE6A 4RQ5A 4DOCA 1S77D 2G5IB 2W04A 4PGYA 1UT8A 4J9RA 2XY6A 2DUYA 4KLDA 2YN4A 3PVXA 1QLNA 4WJ3B 4UAWA 4GC6A 3KHHA 1TAMA 4DFPA 4ECQA 1XNSA 4DSKA 2ISPA 5K4LA 4CGZA 3H8WA 5D4BA 2KZMA 1SV0A 1NKCA 4KLHA 1X40A 3PSIA 5KG0A 3QU5A 2QKQA 8ICUA 3WK7A 1TK5A 8ICHA 3PY8A 3N4MB 4YP3A 2NRVA 1TK0A 4DFKA 3RRHA 5ALXA 3H4BA 2LI6A 5AI5A 2PI5A 4KN7A 2DQNB 2KSOA 4O0IA 2BPFA 4DSIA 4EYHB 1ZJMA 3K1ZA 3H4DA 2YMQA 3OGUA 1ZQUA 4RQ0A 2OWOA 1WWUA 2LM4A 2HDOA 2ATLA 1X2IA 4ED3A 4YG2A 4QZAA 3JPRA 2OCEA 3RBDA 5ALFA 4NLBA 2FI1A 4Y2SA 1L3TA 1BPZA 1CUKA 3KBBA 3QXGA 1Z4NA 4JWNA 3RH6A 5EWFA 1XSPA 1NNLA 1DRGA 5J0PA 2W43A 1Y88A 2VA2A 3C23A 1JIHA 1NJXA 1LV5A 2I6XA 2HHVA 3D2SA 5J2IA 2HHQA 2ZIUB 1SB3C 5KG1A 3GV5B 2NYVA 7ICUA 4BDPA 4LZGA 3V7LA 1BNOA 1QSLA 3KD3A 4TUPA 2XIDA 4XQ8A 4QJFB 3L5KA 3ZD9A 2IBKA 4ELTA 3LK9A 2ZUBA 2YMLA 2KSOB 4CRXA 2ZJ5A 2WF6A 3AU6A 3C21A 1OXJA 4MHVA 4RNMA 3RB0A 9ICEA 2VJ5A 3QUCA 4I29A 4O3SA 3RF9A 2HHTA 2PFNA 1ZQNA 4OJ5A 3IRUA 2UVWA 1ZD3A 4JV0A 3MR6A 3QU4A 5EE0A 2KV2A 4IRCA 3IG8A 1RXVA 4DQSA 2OXOA 5AM3A 2KVCA 2KNJA 3SR6A 4O3OA 4PL2A 1T8EA 5KG6A 3DEEA 1AROP 5KFVA 3LVWA 5AK4A 2IOFA 3RJKA 3SENA 1ZQFA 3KHRA 3HPOA 2WHEA 3RFAA 1DK2A 4QZGA 3JPQA 4KX3A 3MGIA 8ICZA 2IA6A 3TQ1A 1S9FA 1QQ7A 2IOHA 2JZBB 2R8IA 5J8YC 2V9WA 2ISOA 5KFCA 4ECZA 2AGQA 3QEBZ 2HMXA 1XS9D 1C7YA 3I76A 4ZOHC 2W9AA 9ICGA 4DFDA 4IS7A 4I2GA 4OD0A 1BPEA 1QH9A 9ICMA 4UQGA 1FFUA 2W9BB 7ICGA 3QZ8A 3T5LA 8ICBA 3KOOA 8ICVA 3QU9A 2KOBA 4U7CA 5DLGA 2B0CA 2RDIA 4US9A 4Y2XA 1ZQDA 4F4YA 1K1QA 3N7PD 3MC1A 1NK9A 3KZIU 2RDJA 5ALNA 5AK3A 5ALPA 4FZMA 2KVSA 7ICTA 4B9MA 4FZLA 3V7JA 9ICQA 2L5YA 4I28A 9ICOA 2FPMA 2AHOB 3SV3A 3UPQA 2BPCA 4J03A 2KHVA 5FP0A 5JRTA 8ICJA 8ICKA 1N5XA 5DQIA 5ALQA 4C8LA 2KICA 4OCZA 5KFJA 2ASJA 1JRPA 1SIJA 5AICA 5DBBA 4NL9C 2VANA 4ED2A 2KIWA 5AKZA 4RQ3A 2YY6A 3JPSA 3T79A 4NLNA 4R8UB 1ZQAA 3HKZF 5KFUA 3SD7A 1ZQHA 4RQ7A 4P4OA 3BQ1A 4Y2QA 5ALRA 5ALKA 4UATA 3UMCA 1Q3UA 4LZDA 5KFQA 3K4GA 5HNKA 3PO4A 3PSTA 1XO1A 4DSEA 1PVRA 5F9LA 4FS1A 8ICGA 2OM6A 1U45A 3V6HA 1L7OA 3NS1A 4QW8A 5IILA 4JUZA 2EAPA 3HILA 3V6JA 4YMMA 5C0YA 4P0QB 1A6SA 2LYAA 3AM9A 5EWGA 3DDHA 5D46A 4C80A 2ESEA 1RYUA 1JI7A 9ICUA 3RTVA 1L8OA 1UPHA 1N62A 1DXSA 3QUTA 4NV0A 3VC8A 3H40A 5KFHA 5KFWA 2H3IA 3OTQA 4ECTA 5L1KA 3MR5A 1ZD4A 3RJIA 5EE9A 4ELUA 3NTUA 4J9SA 1L3UA 2BDPA 3K1RB 4DL3A 2C2EA 2DBYA 1JUDA 2ZG6A 2D3DA 5KFYA 2RLTA 3TACB 4ECSA 2VJ4A 4TQSA 2HW3A 4GXJA 2G5HB 2LBOA 1GO3F 2EANA 1RYSA 4IL6U 5KFKA 5A0LA 2HOQA 5B66U 4KLGA 2A19A 2W54A 3ZDEA 4F5QA 1MSWD 4RPZA 1S10A 1IXRA 5J2DA 3GILA 4KLLA 4DL7A 3T5KA 2ZIWA 1ECWA 2KJ5A 9ICXA 1BVSA 2KHQA 1U9LA 8ICSA 1ZETA 4KLUA 4QWCA 1NK0A 3UMGA 4J9LA 3AQFA 4P4PA 4DQIA 1B4FA 3RJJA 5ALUA 4DS5A 4F93B 2BQRA 2V4RA 1SZHA 1KLNA 5AK6A 1SKWA 1XU4A 3N7SC 5DB8A 3LWMA 3V72A 1BPBA 4DSJA 2XO7A 1OW5A 2EZXA 2YTUA 1ZQEA 4IR9A 2H3VA 5AKJA 4F2SA 1PZNA 3GV8B 4YD1A 4R64A 4CF5A 3BQ7A 3IM1A 3TARA 5KFRA 4DQPA 5DG7A 3RB4A 2JR5A 5KG3A 3PX0A 3C2MA 3H8SA 1KN5A 4DL2A 4EX7A 1KSPA 4BXOB 3M8RA 1F0MA 4RZRA 4YMOA 2MAXA 5J0QA 4UB4A 3RB6A 1Z1BA 2E8MA 5KL8B 2G0AA 2HI0A 3J81j 3WU2U 4QZBA 4J9PA 4YR0A 4RPYA 2QLTA 3ZDBA 2KD1A 1N60A 2R8GA 4EZ6A 3B9JA 9ICRA 5E79U 4QW9A 1ZQVA 2LYHA 1WCNA 1L6NA 3RB3A 4F5OA 2JEFA 1PVQA 2QARB 4PGXA 2MA1A 4USAA 4P0PA 2WTFA 2P6RA 4QZEA 4NWIA 3RJFA 3KZXA 1PUZA 3JPPA 3HJEA 4G3IA 1N48A 3C5FA 2W03A 5J0WA 3AN1A 4MF8A 3ONNA 5J8YA 4TQRA 5KT6A 2EAOA 3PW7A 2KIVA 3N97B 2GH1A 4Y2TA 4PL1A 1B43A 5HR6A 1ZQRA 5KFAA 1UQVA 2H3QA 3QYPA 1ZJNA 2FLLA 4YXJA 2F76X 2JH1A 4EBCA 2PFPA 4CF4A 2A3VA 5DDMA 3FAHA 2FPKA 4RQ8A 4ICAA 3N28A 5IIIA 4EELA 2NO5A 2NRWA 3M9OB 3ZDCA 7ICEA 2PFOA 2RQ5A 2EAMA 2DF4B 2W8LA 9ICFA 3F2CA 1ZD5A 4F50A 3GQCA 1VJ5A 2W3RA 4Z6FA 5ALOA 3CP8A 4NL9A 2E8NA 4FBUA 3GIIA 2E8OA 3VCBA 2Y0SC 3GFKB 4F72A 1SV4A 3WK6A 1HIWA 1ZQSA 3RAXA 1SL2A 2JV3A 2BCVA 2BKEA 5KFGA 5DLFA 1RG6A 5HR7A 3G6XA 4EBEA 1X42A 3T3FA 1N61A 2YX8A 4O3PA 1WYGA 4M9JA 4FBTA 2Y9TA 4I2AA 1LKYA 3H7IA 1X66A 4UB3A 4MF2A 5L1IA 4PHDA 2B21A 5DB7A 4KLMA 3SMVA 1COKA 2YMPA 2WAQF 1NOMA 1P7DA 1D8LA 3PZPA 4DFJA 4ECRA 4O9MA 4F71A 3HP6A 3H8MA 2V4QA 4IQWA 8ICWA 2MSNA 3TKAA 4DSFA 5J0OA 3CYMA 5L9XA 1NK7A 4O3QA 2ES6A 1MN8A 4C8NA 2AQ0A 4QIWF 3PSPA 4DOBA 2FLNA 4O3MA 4CNQA 1D9FA 5JU5A 4DL5A 5EOZA 2G09A 3SAGA 5AKXA 3PX6A 3PR5B 1ZQBA 3C1YA 2H5XA 3KHLA 5KFDA 2GWSA 4C4RA 8ICEA 1IV8A 1O03A 3RH4A 2DGZA 4NLKA 5TZVA 5HP4A 2PKEA 2W7OA 3PW2A 1XC9A 3IDWA 2XGQA 4FS2A 3ETLA 4M9GA 9ICWA 8ICFA 4EENA 4DL6A 7ICQA 3PNCA 4KLEA 5BOLA 2AU0A 4YN4A 2I9GA 4J9QA 4Z6DA 1ZYQA 1L3SA 3ISCA 2C28A 5TISU 4CDGA 4KLOA 4F92B 3AUOA 2FMSA 1ZQPA 1LKYB 4DF4A 9ICTA 2BQUA 3OPXA 1T94A 5AI8A 5AKLA 2F3NA 3BS5A 2UVRA 1EXNA 4F5RA 4M9LA 4A8EA 4F2RA 1X6IA 4AYBF 3JPOA 4KN4A 1ZQXA 2IHNA 3F53A 1CRXA 1IIPA 2VA3A 2KFZA 2JHDA 3ISBA 2YB4A 8ICPA 5IIOA 4C7ZA 3WK5A 4PHEA 5BOMA 1ZQGA 4E0DA 2ZUDA 2XC9A 5AIAA 5AM1A 1L7NA 3ZDAA 3RJHA 3ALRA 2BZFA 1OUQA 5KTQA 4FE3A 3SAHA 2XCPA 2PXIA 1J2NA 1SZPA 5AI0A 1Z1VA 5B5EU 4RPXA 3L4PA 2HBKA 2Q0ZX 1JXLA 1T4GA 4KX5A 3KHGA 1N56A 2K8CB 1JROA 2M0NA 4GXKA 3ZI4A 4OJ6A 4R66A 4UAVA 1ED1A 1UHUA 2I5HA 3IV6A 5BPCA 2K4HA 3NGDA 1JALA 2ZUCA 4C0ZA 3MGHA 4F3OA 4IRDA 3PMLA 4TUSA 5KFZA 1SL1A 4K4HA 3QU2A 4LJXA 4GIBA 3M8SA 4B9UA 2KEYA 3BS5B 2BCQA 1V97A 4RNNA 3EZ5A 5AM5A 4GC7A 5KAFU 4NM2A 5KT3A 4TURA 1Q8KA 2KKPA 2NV3A 4UW9A 3GIKA 4DOAA 2O6KA 1TFRA 4XA5A 4LVSA 1DK3A 3PO5A 4QWEA 3O0FA 5DG9A 2WB1C 4QZIA 4QWDA 2W9MA 1A0PA 2JH7A 2JEJA 3NVWA 1ZQYA 4NLGA 4QNLA 2W9CA 3MR3A 4F4XA 1U48A 4J9KA 4KMUA 3CNHA 5HMMA 9ICSA 9ICCA 2P66A 2I1QA 1VDVA 2LHTA 5ALZA 5DBAA 2ZTCA 1U49A 3D2QA 3WKAA 1Z4OA 5IIMA 4UARA 1V38A 1S97A 2ZIVA 2ZXIA 4Y2RA 2BR0A 1X9SA 2C2DA 4RQ4A 5D49A 4JV1A 5J0UA 2FE9A 3BDPA 1IG6A 5KG7A 2KE7A 2KN7A 7ICLA 4K4GA 4RQ6A 1S5LU 1JMSA 3KKAC 4M2YA 4ECUA 3RAQA 4ELVA 2ZIXA 5KT4A 3NASA 4QZ8A 1ZXIA 8ICQA 4PHPA 1TV9A 2E5SA 2FPLA 2HHSA 3U26A 3TI0A 1L3VA 1ZOLA 2W3SA 5ALDA 2KK0A 4BX9C 2DL0A 1L5UA 4KLIA 2P35A 3MFIA 5ALGA 2W9CB 1NK6A 3NVZA 1T3QA 2BCRA 1ZQIA 5GTIU 3LDAA 4NM1A 2E8PA 1KBUA 3M7DA 3QNMA 7ICKA 4IQTA 3Q8SB 2PMZC 3GIMA 4EZ9A 3ETRA 1Z00A 2K4EA 4F4ZA 7ICJA 4UB2A 3C28A 2IHMA 1U47A 1FO4A 5ALEA 2J6UA 4R65A 3OHBA 2K4PA 1WWVA 1HUZA 2R18A 2G06A 1D9DA 4Y2YA 4Z6CA 1SXEA 3M9MB 1DGSA 1RPLA 2FDRA 2QB0A 2F1JA 2PI4A 4M9HA 5J2AA 4YCXA 2CPRA 1L7MA 4DSLA 4UB6U 3PSFA 4IC9A 4ECVA 2WFAA 2DKZA 5DKWA 4B9TA 1ZRNA 2M9NA 5AHXA 3AEVA 3A0BU 3Q8LA 2MUTA 2Y1IA 4DQQA 5DG8A 4PZNA 3F5EA 2WF9A 3PR4A 1QTMA 4NLZA 3SZ2A 3JPNA 3C29A 2F8LA 3THVA 3NRWA 9ICVA 1K1SA 2XCAA 2KZ3A 3N7RC 3HRDD 1V85A 2W7PA 2A1JA 9ICJA 1X6JA 5F9NA 1KW4A 3FDSA 1YT3A 5CR0A 3UXNA 8ICCA 3BS7A 4Q43A 4DEZA 1Z3EB 4GLXA 1TK8A 4B9NA 2VIXA 1PVPA 5AKIA 5KFNA 3WKDA 1S8OA 3GU3A 4UB1A 5J29A 3IHQB 3LWLA 4RNOA 5J0TA 4M47A 4DLGA 2EH9A 4B9VA 2E1EA 3F5AA 3EUB2 1SKRA 3B0XA 3F2DA 4I2HA 2ZIWB 5AKKA 7ICIA 1XSNA 2JRZA 3EPGA 1S0MA 3QZ7A 4BGDA 2OH2A 4YR2A 1RQNA 5KAIU 4TUQA 5AK5A 1COOA 3JPTA 2A1AA 1F5SA 5KFBA 2KTQA 2UVVA 1B0XA 5ALYA 1KTQA 2N1RA 4JV2A 4PJ0U 3PX4A 4RQ2A 1QSSA 5KFEA 4RUCA 2XICA 3MGVA 4KLQA 4KTQA 2JMGA 5AKHA 1M6YA 3S6JA 4XUSA 3WKBA 2JGAA 4O5EA 2LM1A 9ICHA 3NVVA 2XI9A 1UT5A 2J6TA 4P2HA 1D8BA 5KG5A 7ICNA 4EEYA 2K4IA 3PW4A 9ICLA 1T7PA 3MR2A 3M9NB 1JN3A 2DFLA 5AI4A 2BHNA 7ICVA 1UA1A 1N63A 1ZQWA 2BCUA 8ICTA 3BZCA 4KLSA 4EYIB 3PV8A 4NXZA 1TKDA 5C5JA 4DQRA 3C2LA 5J2GA 1SKSA 5DGBA 5J0XA 1WG8A 4RT3A 2EDUA 2JXJA 4O3RA 4KITB 4YFKA 3H0MB 1QCKA 4Q45A 2LKYA 2ZJ8A 5KFTA 4YMNA 3SV4A 1D8YA 5KT5A 4BWMA 1BNPA 7ICOA 2HOFA 4B6JA 4UBBA 2LMRA 4PHAA 4Q44A 4P4MA 5ALVA 4CCHA 3FYHA 1ZRMA 3D6JA 4F4WA 4XRHA 4KLTA 1AQ6A 3RJGA 4P0PB 3WK8A 2FLPA 2F8KA 2HCFA 2HVIA 2BGWA 3MABA 4F5PA 3CRXA 5KL1B 4FFDA 2OHFA 8ICMA 1ZQTA 2KZZA 5CB1A 5DQHA 5ALWA 3Q8KA 3TFRA 2ZIUA 1WCLA 5ALTA 4QZ9A 4I2EA 5J2HA 1SWVA 1CEZA 1BGXT 3NVYA 1L8LA 5KFPA 1KQQA 2XGPA 4J9NA 1KFDA 2F2AB 2CXYA 1DGJA 4J9OA 3TAPA 4JK1A 5J0RA 2AH5A 3Q8PB 1MC8A 4ACOA 2BPGA 5J2CA 5IINA 4US8A 2F1IA 1CI4A 9ICKA 3GDXA 5GTHU 2IOFK 4Y2JA 5IIKA 5AIBA 4I2FA 2P6UA 2LPEA 4M04A 3QX7A 3KKAA 3TADC 4M6WA 3QU7A 4QZFA 4HAIA 3M6KA 3SEIA 3E0FA 5ALSA 4O3NA 8ICAA 1KDHA 1RQLA 2C2RA 2H3FA 3RBEA 4DF8A 1A77A 1JXEA 1KFTA 2OEHA 3UXPA 4BWJA 3BJYA 5DDYA 5KNIA 5AI6A 4ECXA 1F44A 4C4TA 9ICBA 3H0LB 3H0RB 1UA0A 2JEGA 8ICRA 3H8JA 3HKZC 4EX6A 1N2XA 4GXIA 4OJPA 1RM6C 3E2EA 2R8HA 4GFJA 1ZQMA 2G07A 4C8KA 3V6KA 5J0YA 2JZBA 4FZNA 3L3FX 3LVVA 5CA7A 2AGPA 2EZZA 3EYZA 3R9KA 2GLEA 2ASLA 4UB5A 1NKBA 5KFLA 4X5VA 2HVHA 7ICMA 1ZQOA 4KLJA 4KLFA 2HBMA 2W9BA 1UCVA 1XO0A 1KL9A 2F77X 3WK9A 1S76D 3RR8A 3F2BA 1SGGA 3EW9A 3GV7B 2E1FA 3PW5A 1KRPA 1KKXA 2E3TA 2VKQA 4BUGA 2YB1A 1K5OA 5AKGA 1KFSA 7ICHA 4M6WB 3RJEA 4PH5A 4K4IA 3D2NA 5KG2A 3SAFA 1ZQJA 4RUAA 9ICIA 5DB6A 3RR7A 3OJSA 1X9WA 2OYYA 4ECYA 3KTQA 3WK4A 2AQ4A 1Q46A 9ICPA 4NLCA 3MBYA 3CW2C 4F5NA 4UB8U 4OJOA 4Y2UA 4ED7A 2ZJAA 3T5HA 2NRTA 2KG5A 2BCSA 2CN1A 3AMZA 1QQ5A 1PK3A 1X9XA 5G5GA 4CF3A 1Q3VA 4R8UA 5KFXA 1IM4A 7ICRA 1TAUA 2Y0SF 4QWAA 4DO9A 2KFNA 1QSYA 2J6SA 5H2FU 2D6FC 1FFVA 3IG5A 3OSNA 5G5HA 1X9MA 2HHUA 4AP9A 7ICPA 3GZFA 4UAYA 3T5JA 3SQIA 2NO4A 2R8JA 4RU9A 8ICYA 5DGAA 3Q8RB 3G6VA 2VA8A 2AGOA 4DWIA 7ICSA 3UXOA 2HBJA 2WF8A 1RDFA 1YZ6A 2XY5A 1BPYA 1NKEA 1ZQ1C 4F4KA 1NK5A 4G9BA 4I27A 1NZBA 4EBDA 2K8AA 4MEYA 3ZD8A 1S0NA 3TANA 2W55A 4P0QA 1ZQLA 1SV0C 4MFCA 3QUQA 5AI9A 4YQWA 2AJQA 1ZD2P 5KFMA 4DS4A 3WKEA 4I2IA 4ZH4A 2Q4TA 5KFOA 8ICOA 1J2MA 4YXMA 5AM0A 1MA7A 4J9MA 4RQNA 3MFHA 4IR1A 1NI3A 4PPXA 4U6PA 1HJPA 4ED0A 3AQEA 2BDUA 1B22A 4MFFA 8ICIA 4YVZA 4HYKA 7ICFA 4F91B 4UAZA 2BQ3A 1U4BA 5IIJA 1ZQZA 3K75D
chains in the Genus database with same CATH topology
2PMZF 3IG8A 3M6KA 2OXOA 2CN1A 2KEYA 2KIWA 2VIXA 4QIWC 1PVPA 1Z1BA 2VJ4A 3E0FA 5KL8B 3T79A 2RRDA 2KVCA 2DGZA 2G0AA 2KNJA 2DQNB 3M6ZA 2G5HB 3NUQA 1GO3F 2DF4B 2LBOA 2WB1F 2W7OA 3F2CA 4PL2A 1Q3VA 2H3FA 3GU3A 4OJLA 2H3ZA 3DEEA 3HKZF 2Y0SF 5A0LA 2RP5A 3K1ZA 2KD1A 3LVWA 2HOQA 2KKPA 2NV3A 3M7DA 3H0MB 1KBUA 2PMZC 2LKYA 2D6FC 1URJA 3IG5A 2E1EA 3F5AA 1F44A 2K4EA 3CP8A 2HOFA 4CDGA 3GZFA 3H0LB 3RFAA 3F2DA 3O0FA 2KJ9A 3C28A 3SQIA 2WB1C 1Q3UA 2HOIA 3H0RB 4KX3A 1A0PA 2JH7A 2ZIWB 4JMUA 3HKZC 3VCBA 2Y0SC 1L6NA 2ZIWA 3AL0B 4OJPA 1ECWA 3OPXA 2K89A 1T94A 2KJ5A 3LYSA 4GFJA 1PVQA 4QNLA 2KHQA 3PSTA 1HIWA 2MA1A 2G07A 4P0PB 4NLBA 2R18A 4A8EA 2G06A 2OH2A 4P0PA 4FZNA 4AYBF 2CRXA 2HBJA 3L3FX 3LVVA 1PVRA 2XVTA 3AQFA 2LHTA 4NWIA 5CRXA 3F53A 2HMXA 2OM6A 3CRXA 1WUDA 5KL1B 1CRXA 3KZXA 5HR7A 1IIPA 1DRGA 1ZQ1C 2K8BB 3D2QA 2JHDA 4BJQA 1SZHA 2YB4A 2ZXHA 2YX8A 2ZIVB 2HBMA 1NZBA 3N7SC 2ZIVA 2ZXIA 3D2SA 2K8AA 4AYBC 2N1RA 1XO0A 4KMOB 2F77X 2ZIUB 2W03A 2CPRA 3ONNA 2ZIUA 2KOBA 5C0YA 4U7CA 4P0QB 2MRLA 2LYAA 3PSFA 2XICA 4IC9A 3MGVA 3F2BA 1A6SA 2G5IB 3ALRA 2JMGA 2W04A 2E1FA 4P0QA 1OUQA 4FE3A 3SAHA 3N7PD 2JGAA 3SMVA 2VKQA 2H3VA 4BUGA 2YB1A 2WAQF 1UPHA 1P7DA 4WJ3B 4FZMA 2HBLA 3PZPA 2LYBA 4NV0A 3VC8A 2XIDA 4QJFB 2XI9A 1Z19A 2F2AB 3F5EA 3D2NA 2GH1A 3IP4B 4PL1A 1D8BA 4OO1J 2HBKA 2ZIXB 3SAFA 4ACOA 5HR6A 5T14A 2Q4TA 1TAMA 4FZLA 2H3QA 2ZIXA 4KX5A 2OYYA 4CRXA 2H3IA 1XNSA 2K8CB 2GOLA 2K4IA 2M0NA 1MA7A 1HEKA 3ICXA 3CYMA 2F76X 2F8LA 2WAQC 3C29A 4CGZA 2JH1A 3NRWA 4OJ6A 2E5SA 3IN5A 4U6PA 4NLCA 3PSIA 2VJ5A 1ED1A 4QIWF 2KHVA 3AQEA 2BDUA 2Z7JA 3N7RC 3PSPA 2KKVA 4O3MA 3RF9A 2A3VA 4OJOA 2K4HA 3KFUF 2W7PA 2G09A 4BX9C 3SAGA 4OJ5A 4C0ZA 2KJ8A 2G08A 1YT3A 2KICA 4ICAA 2ZG6A 2KV2A 2RHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQE A;  3N7S C;  3N7P D;  3N7R C;  2XVT A;  3AQF A;  2YX8 A; 
#chains in the Genus database with same CATH topology
 2K60 A;  4DCC A;  3BQ0 A;  1FEZ A;  2WF7 A;  3M6Z A;  3NUQ A;  4OJL A;  5EE3 A;  4DFM A;  2H3Z A;  3RH5 A;  1MQ2 A;  2QB1 A;  5HML A;  2UVU A;  5J0S A;  2ALZ A;  3V7K A;  3UQ0 A;  5J2J A;  3PMN A;  5CJ7 A;  2KJ9 A;  4R63 A;  4IQV A;  1J97 A;  4Y2P A;  2HOI A;  4EEK A;  5ALH A;  3Q8M A;  3BZK A;  3GIJ A;  8ICN A;  2ODG A;  2XY7 A;  3AU2 A;  3HX0 A;  4C7Y A;  1S0V A;  3BQT A;  4MEX A;  3NRZ A;  2KMD A;  1MQ3 A;  2XVT A;  1NJW A;  4YD2 A;  1WUD A;  1QQ6 A;  1NZP A;  2K8B B;  1FIQ A;  2WF5 A;  2R8K A;  4BJQ A;  4C4S A;  4C8M A;  2DKX A;  2ZIV B;  2W11 A;  5L1L A;  3OSP A;  5J2E A;  1A76 A;  4KMO B;  5AM4 A;  1TE2 A;  2MRL A;  5AKE A;  4QZD A;  4NJ8 A;  3QE9 Y;  2B6G A;  1DOQ A;  1S0O A;  1SXD A;  3HW8 A;  5KG4 A;  4RQM A;  3MDA A;  3OJU A;  1LVH A;  4O5K A;  4DLE A;  3TAQ A;  2LYB A;  3UM9 A;  3UMB A;  3SYZ A;  1Z19 A;  3OHA A;  4C8O A;  4Y2V A;  5KT7 A;  3IP4 B;  4OO1 J;  2ZIX B;  5T14 A;  1SWW A;  3QEA Z;  5L1J A;  5AM2 A;  2GOL A;  5AKY A;  1T3N A;  3Q8Q B;  2Y9U A;  1XSL A;  3TFS A;  5ALJ A;  4I2D A;  1TAQ A;  1ZQC A;  1NK8 A;  1PK1 A;  3A0H U;  2KJ8 A;  2G08 A;  2DPI A;  4BXO A;  5CWR A;  2YQE A;  4JWM A;  2JEI A;  4UAS A;  3E58 A;  3I1Y A;  3C5G A;  4M9N A;  2WB1 F;  5ALM A;  2Y1J A;  1L7P A;  2RP5 A;  3G6Y A;  4ED6 A;  1URJ A;  4B9S A;  1Z00 B;  3TAD A;  3SI8 A;  3ED5 A;  5J2K A;  5DB9 A;  1LB2 B;  9ICN A;  2AXT U;  3RRG A;  3ORY A;  4RT2 A;  4RQ1 A;  4JMU A;  3HT3 A;  3M1Y A;  3ISD A;  4Z6E A;  1V9P A;  2K89 A;  3LYS A;  4M0A A;  9ICA A;  2QAR A;  8ICL A;  5L1M A;  2PFQ A;  1NK4 A;  3BQ2 A;  5CRX A;  3C2K A;  5KFF A;  5J2B A;  2YMM A;  2QB0 B;  5EE1 A;  4UBC A;  1NJY A;  5HHH A;  4YR3 A;  4DL4 A;  1HUO A;  2HSZ A;  2FMQ A;  2EQY A;  1RZT A;  4IRK A;  4QZH A;  2HHW A;  2F44 A;  3DV9 A;  1PK1 B;  2MUT B;  4Q8E A;  3EWA A;  2MU2 A;  1YZ7 A;  5KFI A;  1RXW A;  5KFS A;  5HHI A;  4ED1 A;  3UQ2 A;  5DQG A;  8ICX A;  2HBL A;  1H38 A;  5ALI A;  5DBC A;  1XWL A;  3FM9 A;  3C1Z A;  4FO6 A;  1NJZ A;  1C20 A;  2ASD A;  1HEK A;  3ICX A;  2WAQ C;  1VLB A;  5JTI A;  3IN5 A;  3PW0 A;  2IMW P;  1BPD A;  2Z7J A;  2NRZ A;  2KKV A;  2F1H A;  1ZQQ A;  2A1J B;  5F3X B;  2KP7 A;  3HWT A;  2FMP A;  3KFU F;  1RYR A;  5J2F A;  4MFA A;  2RHF A;  2PMZ F;  4ECW A;  4UAU A;  2DPJ A;  4QIW C;  1N5W A;  2D8C A;  2RRD A;  5ALL A;  1BPX A;  3I28 A;  4NY8 A;  2ZTE A;  2FJ6 A;  3WKC A;  4F8R A;  2HHX A;  4PGQ A;  5CEH A;  4Q8F A;  1JX4 A;  5CP2 A;  3EPI A;  1SL0 A;  4JB3 A;  3AL0 B;  2NRX A;  4I2J A;  1KEJ A;  4IQU A;  4I2C A;  4QZC A;  4ED8 A;  3ZDD A;  2C22 A;  1O08 A;  2CRX A;  1ZQK A;  1TVA A;  2ZTD A;  4I2B A;  4B9L A;  3B0Y A;  5EWE A;  5CHG A;  2ZXH A;  3QUB A;  4PZO A;  5JUM A;  2W8K A;  2EZY A;  4AYB C;  5KT2 A;  4QWB A;  2GO7 A;  3MDC A;  3FC4 A;  2DWQ A;  4O5C A;  4CE6 A;  4RQ5 A;  4DOC A;  1S77 D;  2G5I B;  2W04 A;  4PGY A;  1UT8 A;  4J9R A;  2XY6 A;  2DUY A;  4KLD A;  2YN4 A;  3PVX A;  1QLN A;  4WJ3 B;  4UAW A;  4GC6 A;  3KHH A;  1TAM A;  4DFP A;  4ECQ A;  1XNS A;  4DSK A;  2ISP A;  5K4L A;  4CGZ A;  3H8W A;  5D4B A;  2KZM A;  1SV0 A;  1NKC A;  4KLH A;  1X40 A;  3PSI A;  5KG0 A;  3QU5 A;  2QKQ A;  8ICU A;  3WK7 A;  1TK5 A;  8ICH A;  3PY8 A;  3N4M B;  4YP3 A;  2NRV A;  1TK0 A;  4DFK A;  3RRH A;  5ALX A;  3H4B A;  2LI6 A;  5AI5 A;  2PI5 A;  4KN7 A;  2DQN B;  2KSO A;  4O0I A;  2BPF A;  4DSI A;  4EYH B;  1ZJM A;  3K1Z A;  3H4D A;  2YMQ A;  3OGU A;  1ZQU A;  4RQ0 A;  2OWO A;  1WWU A;  2LM4 A;  2HDO A;  2ATL A;  1X2I A;  4ED3 A;  4YG2 A;  4QZA A;  3JPR A;  2OCE A;  3RBD A;  5ALF A;  4NLB A;  2FI1 A;  4Y2S A;  1L3T A;  1BPZ A;  1CUK A;  3KBB A;  3QXG A;  1Z4N A;  4JWN A;  3RH6 A;  5EWF A;  1XSP A;  1NNL A;  1DRG A;  5J0P A;  2W43 A;  1Y88 A;  2VA2 A;  3C23 A;  1JIH A;  1NJX A;  1LV5 A;  2I6X A;  2HHV A;  3D2S A;  5J2I A;  2HHQ A;  2ZIU B;  1SB3 C;  5KG1 A;  3GV5 B;  2NYV A;  7ICU A;  4BDP A;  4LZG A;  3V7L A;  1BNO A;  1QSL A;  3KD3 A;  4TUP A;  2XID A;  4XQ8 A;  4QJF B;  3L5K A;  3ZD9 A;  2IBK A;  4ELT A;  3LK9 A;  2ZUB A;  2YML A;  2KSO B;  4CRX A;  2ZJ5 A;  2WF6 A;  3AU6 A;  3C21 A;  1OXJ A;  4MHV A;  4RNM A;  3RB0 A;  9ICE A;  2VJ5 A;  3QUC A;  4I29 A;  4O3S A;  3RF9 A;  2HHT A;  2PFN A;  1ZQN A;  4OJ5 A;  3IRU A;  2UVW A;  1ZD3 A;  4JV0 A;  3MR6 A;  3QU4 A;  5EE0 A;  2KV2 A;  4IRC A;  3IG8 A;  1RXV A;  4DQS A;  2OXO A;  5AM3 A;  2KVC A;  2KNJ A;  3SR6 A;  4O3O A;  4PL2 A;  1T8E A;  5KG6 A;  3DEE A;  1ARO P;  5KFV A;  3LVW A;  5AK4 A;  2IOF A;  3RJK A;  3SEN A;  1ZQF A;  3KHR A;  3HPO A;  2WHE A;  3RFA A;  1DK2 A;  4QZG A;  3JPQ A;  4KX3 A;  3MGI A;  8ICZ A;  2IA6 A;  3TQ1 A;  1S9F A;  1QQ7 A;  2IOH A;  2JZB B;  2R8I A;  5J8Y C;  2V9W A;  2ISO A;  5KFC A;  4ECZ A;  2AGQ A;  3QEB Z;  2HMX A;  1XS9 D;  1C7Y A;  3I76 A;  4ZOH C;  2W9A A;  9ICG A;  4DFD A;  4IS7 A;  4I2G A;  4OD0 A;  1BPE A;  1QH9 A;  9ICM A;  4UQG A;  1FFU A;  2W9B B;  7ICG A;  3QZ8 A;  3T5L A;  8ICB A;  3KOO A;  8ICV A;  3QU9 A;  2KOB A;  4U7C A;  5DLG A;  2B0C A;  2RDI A;  4US9 A;  4Y2X A;  1ZQD A;  4F4Y A;  1K1Q A;  3N7P D;  3MC1 A;  1NK9 A;  3KZI U;  2RDJ A;  5ALN A;  5AK3 A;  5ALP A;  4FZM A;  2KVS A;  7ICT A;  4B9M A;  4FZL A;  3V7J A;  9ICQ A;  2L5Y A;  4I28 A;  9ICO A;  2FPM A;  2AHO B;  3SV3 A;  3UPQ A;  2BPC A;  4J03 A;  2KHV A;  5FP0 A;  5JRT A;  8ICJ A;  8ICK A;  1N5X A;  5DQI A;  5ALQ A;  4C8L A;  2KIC A;  4OCZ A;  5KFJ A;  2ASJ A;  1JRP A;  1SIJ A;  5AIC A;  5DBB A;  4NL9 C;  2VAN A;  4ED2 A;  2KIW A;  5AKZ A;  4RQ3 A;  2YY6 A;  3JPS A;  3T79 A;  4NLN A;  4R8U B;  1ZQA A;  3HKZ F;  5KFU A;  3SD7 A;  1ZQH A;  4RQ7 A;  4P4O A;  3BQ1 A;  4Y2Q A;  5ALR A;  5ALK A;  4UAT A;  3UMC A;  1Q3U A;  4LZD A;  5KFQ A;  3K4G A;  5HNK A;  3PO4 A;  3PST A;  1XO1 A;  4DSE A;  1PVR A;  5F9L A;  4FS1 A;  8ICG A;  2OM6 A;  1U45 A;  3V6H A;  1L7O A;  3NS1 A;  4QW8 A;  5IIL A;  4JUZ A;  2EAP A;  3HIL A;  3V6J A;  4YMM A;  5C0Y A;  4P0Q B;  1A6S A;  2LYA A;  3AM9 A;  5EWG A;  3DDH A;  5D46 A;  4C80 A;  2ESE A;  1RYU A;  1JI7 A;  9ICU A;  3RTV A;  1L8O A;  1UPH A;  1N62 A;  1DXS A;  3QUT A;  4NV0 A;  3VC8 A;  3H40 A;  5KFH A;  5KFW A;  2H3I A;  3OTQ A;  4ECT A;  5L1K A;  3MR5 A;  1ZD4 A;  3RJI A;  5EE9 A;  4ELU A;  3NTU A;  4J9S A;  1L3U A;  2BDP A;  3K1R B;  4DL3 A;  2C2E A;  2DBY A;  1JUD A;  2ZG6 A;  2D3D A;  5KFY A;  2RLT A;  3TAC B;  4ECS A;  2VJ4 A;  4TQS A;  2HW3 A;  4GXJ A;  2G5H B;  2LBO A;  1GO3 F;  2EAN A;  1RYS A;  4IL6 U;  5KFK A;  5A0L A;  2HOQ A;  5B66 U;  4KLG A;  2A19 A;  2W54 A;  3ZDE A;  4F5Q A;  1MSW D;  4RPZ A;  1S10 A;  1IXR A;  5J2D A;  3GIL A;  4KLL A;  4DL7 A;  3T5K A;  2ZIW A;  1ECW A;  2KJ5 A;  9ICX A;  1BVS A;  2KHQ A;  1U9L A;  8ICS A;  1ZET A;  4KLU A;  4QWC A;  1NK0 A;  3UMG A;  4J9L A;  3AQF A;  4P4P A;  4DQI A;  1B4F A;  3RJJ A;  5ALU A;  4DS5 A;  4F93 B;  2BQR A;  2V4R A;  1SZH A;  1KLN A;  5AK6 A;  1SKW A;  1XU4 A;  3N7S C;  5DB8 A;  3LWM A;  3V72 A;  1BPB A;  4DSJ A;  2XO7 A;  1OW5 A;  2EZX A;  2YTU A;  1ZQE A;  4IR9 A;  2H3V A;  5AKJ A;  4F2S A;  1PZN A;  3GV8 B;  4YD1 A;  4R64 A;  4CF5 A;  3BQ7 A;  3IM1 A;  3TAR A;  5KFR A;  4DQP A;  5DG7 A;  3RB4 A;  2JR5 A;  5KG3 A;  3PX0 A;  3C2M A;  3H8S A;  1KN5 A;  4DL2 A;  4EX7 A;  1KSP A;  4BXO B;  3M8R A;  1F0M A;  4RZR A;  4YMO A;  2MAX A;  5J0Q A;  4UB4 A;  3RB6 A;  1Z1B A;  2E8M A;  5KL8 B;  2G0A A;  2HI0 A;  3J81 j;  3WU2 U;  4QZB A;  4J9P A;  4YR0 A;  4RPY A;  2QLT A;  3ZDB A;  2KD1 A;  1N60 A;  2R8G A;  4EZ6 A;  3B9J A;  9ICR A;  5E79 U;  4QW9 A;  1ZQV A;  2LYH A;  1WCN A;  1L6N A;  3RB3 A;  4F5O A;  2JEF A;  1PVQ A;  2QAR B;  4PGX A;  2MA1 A;  4USA A;  4P0P A;  2WTF A;  2P6R A;  4QZE A;  4NWI A;  3RJF A;  3KZX A;  1PUZ A;  3JPP A;  3HJE A;  4G3I A;  1N48 A;  3C5F A;  2W03 A;  5J0W A;  3AN1 A;  4MF8 A;  3ONN A;  5J8Y A;  4TQR A;  5KT6 A;  2EAO A;  3PW7 A;  2KIV A;  3N97 B;  2GH1 A;  4Y2T A;  4PL1 A;  1B43 A;  5HR6 A;  1ZQR A;  5KFA A;  1UQV A;  2H3Q A;  3QYP A;  1ZJN A;  2FLL A;  4YXJ A;  2F76 X;  2JH1 A;  4EBC A;  2PFP A;  4CF4 A;  2A3V A;  5DDM A;  3FAH A;  2FPK A;  4RQ8 A;  4ICA A;  3N28 A;  5III A;  4EEL A;  2NO5 A;  2NRW A;  3M9O B;  3ZDC A;  7ICE A;  2PFO A;  2RQ5 A;  2EAM A;  2DF4 B;  2W8L A;  9ICF A;  3F2C A;  1ZD5 A;  4F50 A;  3GQC A;  1VJ5 A;  2W3R A;  4Z6F A;  5ALO A;  3CP8 A;  4NL9 A;  2E8N A;  4FBU A;  3GII A;  2E8O A;  3VCB A;  2Y0S C;  3GFK B;  4F72 A;  1SV4 A;  3WK6 A;  1HIW A;  1ZQS A;  3RAX A;  1SL2 A;  2JV3 A;  2BCV A;  2BKE A;  5KFG A;  5DLF A;  1RG6 A;  5HR7 A;  3G6X A;  4EBE A;  1X42 A;  3T3F A;  1N61 A;  2YX8 A;  4O3P A;  1WYG A;  4M9J A;  4FBT A;  2Y9T A;  4I2A A;  1LKY A;  3H7I A;  1X66 A;  4UB3 A;  4MF2 A;  5L1I A;  4PHD A;  2B21 A;  5DB7 A;  4KLM A;  3SMV A;  1COK A;  2YMP A;  2WAQ F;  1NOM A;  1P7D A;  1D8L A;  3PZP A;  4DFJ A;  4ECR A;  4O9M A;  4F71 A;  3HP6 A;  3H8M A;  2V4Q A;  4IQW A;  8ICW A;  2MSN A;  3TKA A;  4DSF A;  5J0O A;  3CYM A;  5L9X A;  1NK7 A;  4O3Q A;  2ES6 A;  1MN8 A;  4C8N A;  2AQ0 A;  4QIW F;  3PSP A;  4DOB A;  2FLN A;  4O3M A;  4CNQ A;  1D9F A;  5JU5 A;  4DL5 A;  5EOZ A;  2G09 A;  3SAG A;  5AKX A;  3PX6 A;  3PR5 B;  1ZQB A;  3C1Y A;  2H5X A;  3KHL A;  5KFD A;  2GWS A;  4C4R A;  8ICE A;  1IV8 A;  1O03 A;  3RH4 A;  2DGZ A;  4NLK A;  5TZV A;  5HP4 A;  2PKE A;  2W7O A;  3PW2 A;  1XC9 A;  3IDW A;  2XGQ A;  4FS2 A;  3ETL A;  4M9G A;  9ICW A;  8ICF A;  4EEN A;  4DL6 A;  7ICQ A;  3PNC A;  4KLE A;  5BOL A;  2AU0 A;  4YN4 A;  2I9G A;  4J9Q A;  4Z6D A;  1ZYQ A;  1L3S A;  3ISC A;  2C28 A;  5TIS U;  4CDG A;  4KLO A;  4F92 B;  3AUO A;  2FMS A;  1ZQP A;  1LKY B;  4DF4 A;  9ICT A;  2BQU A;  3OPX A;  1T94 A;  5AI8 A;  5AKL A;  2F3N A;  3BS5 A;  2UVR A;  1EXN A;  4F5R A;  4M9L A;  4A8E A;  4F2R A;  1X6I A;  4AYB F;  3JPO A;  4KN4 A;  1ZQX A;  2IHN A;  3F53 A;  1CRX A;  1IIP A;  2VA3 A;  2KFZ A;  2JHD A;  3ISB A;  2YB4 A;  8ICP A;  5IIO A;  4C7Z A;  3WK5 A;  4PHE A;  5BOM A;  1ZQG A;  4E0D A;  2ZUD A;  2XC9 A;  5AIA A;  5AM1 A;  1L7N A;  3ZDA A;  3RJH A;  3ALR A;  2BZF A;  1OUQ A;  5KTQ A;  4FE3 A;  3SAH A;  2XCP A;  2PXI A;  1J2N A;  1SZP A;  5AI0 A;  1Z1V A;  5B5E U;  4RPX A;  3L4P A;  2HBK A;  2Q0Z X;  1JXL A;  1T4G A;  4KX5 A;  3KHG A;  1N56 A;  2K8C B;  1JRO A;  2M0N A;  4GXK A;  3ZI4 A;  4OJ6 A;  4R66 A;  4UAV A;  1ED1 A;  1UHU A;  2I5H A;  3IV6 A;  5BPC A;  2K4H A;  3NGD A;  1JAL A;  2ZUC A;  4C0Z A;  3MGH A;  4F3O A;  4IRD A;  3PML A;  4TUS A;  5KFZ A;  1SL1 A;  4K4H A;  3QU2 A;  4LJX A;  4GIB A;  3M8S A;  4B9U A;  2KEY A;  3BS5 B;  2BCQ A;  1V97 A;  4RNN A;  3EZ5 A;  5AM5 A;  4GC7 A;  5KAF U;  4NM2 A;  5KT3 A;  4TUR A;  1Q8K A;  2KKP A;  2NV3 A;  4UW9 A;  3GIK A;  4DOA A;  2O6K A;  1TFR A;  4XA5 A;  4LVS A;  1DK3 A;  3PO5 A;  4QWE A;  3O0F A;  5DG9 A;  2WB1 C;  4QZI A;  4QWD A;  2W9M A;  1A0P A;  2JH7 A;  2JEJ A;  3NVW A;  1ZQY A;  4NLG A;  4QNL A;  2W9C A;  3MR3 A;  4F4X A;  1U48 A;  4J9K A;  4KMU A;  3CNH A;  5HMM A;  9ICS A;  9ICC A;  2P66 A;  2I1Q A;  1VDV A;  2LHT A;  5ALZ A;  5DBA A;  2ZTC A;  1U49 A;  3D2Q A;  3WKA A;  1Z4O A;  5IIM A;  4UAR A;  1V38 A;  1S97 A;  2ZIV A;  2ZXI A;  4Y2R A;  2BR0 A;  1X9S A;  2C2D A;  4RQ4 A;  5D49 A;  4JV1 A;  5J0U A;  2FE9 A;  3BDP A;  1IG6 A;  5KG7 A;  2KE7 A;  2KN7 A;  7ICL A;  4K4G A;  4RQ6 A;  1S5L U;  1JMS A;  3KKA C;  4M2Y A;  4ECU A;  3RAQ A;  4ELV A;  2ZIX A;  5KT4 A;  3NAS A;  4QZ8 A;  1ZXI A;  8ICQ A;  4PHP A;  1TV9 A;  2E5S A;  2FPL A;  2HHS A;  3U26 A;  3TI0 A;  1L3V A;  1ZOL A;  2W3S A;  5ALD A;  2KK0 A;  4BX9 C;  2DL0 A;  1L5U A;  4KLI A;  2P35 A;  3MFI A;  5ALG A;  2W9C B;  1NK6 A;  3NVZ A;  1T3Q A;  2BCR A;  1ZQI A;  5GTI U;  3LDA A;  4NM1 A;  2E8P A;  1KBU A;  3M7D A;  3QNM A;  7ICK A;  4IQT A;  3Q8S B;  2PMZ C;  3GIM A;  4EZ9 A;  3ETR A;  1Z00 A;  2K4E A;  4F4Z A;  7ICJ A;  4UB2 A;  3C28 A;  2IHM A;  1U47 A;  1FO4 A;  5ALE A;  2J6U A;  4R65 A;  3OHB A;  2K4P A;  1WWV A;  1HUZ A;  2R18 A;  2G06 A;  1D9D A;  4Y2Y A;  4Z6C A;  1SXE A;  3M9M B;  1DGS A;  1RPL A;  2FDR A;  2QB0 A;  2F1J A;  2PI4 A;  4M9H A;  5J2A A;  4YCX A;  2CPR A;  1L7M A;  4DSL A;  4UB6 U;  3PSF A;  4IC9 A;  4ECV A;  2WFA A;  2DKZ A;  5DKW A;  4B9T A;  1ZRN A;  2M9N A;  5AHX A;  3AEV A;  3A0B U;  3Q8L A;  2MUT A;  2Y1I A;  4DQQ A;  5DG8 A;  4PZN A;  3F5E A;  2WF9 A;  3PR4 A;  1QTM A;  4NLZ A;  3SZ2 A;  3JPN A;  3C29 A;  2F8L A;  3THV A;  3NRW A;  9ICV A;  1K1S A;  2XCA A;  2KZ3 A;  3N7R C;  3HRD D;  1V85 A;  2W7P A;  2A1J A;  9ICJ A;  1X6J A;  5F9N A;  1KW4 A;  3FDS A;  1YT3 A;  5CR0 A;  3UXN A;  8ICC A;  3BS7 A;  4Q43 A;  4DEZ A;  1Z3E B;  4GLX A;  1TK8 A;  4B9N A;  2VIX A;  1PVP A;  5AKI A;  5KFN A;  3WKD A;  1S8O A;  3GU3 A;  4UB1 A;  5J29 A;  3IHQ B;  3LWL A;  4RNO A;  5J0T A;  4M47 A;  4DLG A;  2EH9 A;  4B9V A;  2E1E A;  3F5A A;  3EUB 2;  1SKR A;  3B0X A;  3F2D A;  4I2H A;  2ZIW B;  5AKK A;  7ICI A;  1XSN A;  2JRZ A;  3EPG A;  1S0M A;  3QZ7 A;  4BGD A;  2OH2 A;  4YR2 A;  1RQN A;  5KAI U;  4TUQ A;  5AK5 A;  1COO A;  3JPT A;  2A1A A;  1F5S A;  5KFB A;  2KTQ A;  2UVV A;  1B0X A;  5ALY A;  1KTQ A;  2N1R A;  4JV2 A;  4PJ0 U;  3PX4 A;  4RQ2 A;  1QSS A;  5KFE A;  4RUC A;  2XIC A;  3MGV A;  4KLQ A;  4KTQ A;  2JMG A;  5AKH A;  1M6Y A;  3S6J A;  4XUS A;  3WKB A;  2JGA A;  4O5E A;  2LM1 A;  9ICH A;  3NVV A;  2XI9 A;  1UT5 A;  2J6T A;  4P2H A;  1D8B A;  5KG5 A;  7ICN A;  4EEY A;  2K4I A;  3PW4 A;  9ICL A;  1T7P A;  3MR2 A;  3M9N B;  1JN3 A;  2DFL A;  5AI4 A;  2BHN A;  7ICV A;  1UA1 A;  1N63 A;  1ZQW A;  2BCU A;  8ICT A;  3BZC A;  4KLS A;  4EYI B;  3PV8 A;  4NXZ A;  1TKD A;  5C5J A;  4DQR A;  3C2L A;  5J2G A;  1SKS A;  5DGB A;  5J0X A;  1WG8 A;  4RT3 A;  2EDU A;  2JXJ A;  4O3R A;  4KIT B;  4YFK A;  3H0M B;  1QCK A;  4Q45 A;  2LKY A;  2ZJ8 A;  5KFT A;  4YMN A;  3SV4 A;  1D8Y A;  5KT5 A;  4BWM A;  1BNP A;  7ICO A;  2HOF A;  4B6J A;  4UBB A;  2LMR A;  4PHA A;  4Q44 A;  4P4M A;  5ALV A;  4CCH A;  3FYH A;  1ZRM A;  3D6J A;  4F4W A;  4XRH A;  4KLT A;  1AQ6 A;  3RJG A;  4P0P B;  3WK8 A;  2FLP A;  2F8K A;  2HCF A;  2HVI A;  2BGW A;  3MAB A;  4F5P A;  3CRX A;  5KL1 B;  4FFD A;  2OHF A;  8ICM A;  1ZQT A;  2KZZ A;  5CB1 A;  5DQH A;  5ALW A;  3Q8K A;  3TFR A;  2ZIU A;  1WCL A;  5ALT A;  4QZ9 A;  4I2E A;  5J2H A;  1SWV A;  1CEZ A;  1BGX T;  3NVY A;  1L8L A;  5KFP A;  1KQQ A;  2XGP A;  4J9N A;  1KFD A;  2F2A B;  2CXY A;  1DGJ A;  4J9O A;  3TAP A;  4JK1 A;  5J0R A;  2AH5 A;  3Q8P B;  1MC8 A;  4ACO A;  2BPG A;  5J2C A;  5IIN A;  4US8 A;  2F1I A;  1CI4 A;  9ICK A;  3GDX A;  5GTH U;  2IOF K;  4Y2J A;  5IIK A;  5AIB A;  4I2F A;  2P6U A;  2LPE A;  4M04 A;  3QX7 A;  3KKA A;  3TAD C;  4M6W A;  3QU7 A;  4QZF A;  4HAI A;  3M6K A;  3SEI A;  3E0F A;  5ALS A;  4O3N A;  8ICA A;  1KDH A;  1RQL A;  2C2R A;  2H3F A;  3RBE A;  4DF8 A;  1A77 A;  1JXE A;  1KFT A;  2OEH A;  3UXP A;  4BWJ A;  3BJY A;  5DDY A;  5KNI A;  5AI6 A;  4ECX A;  1F44 A;  4C4T A;  9ICB A;  3H0L B;  3H0R B;  1UA0 A;  2JEG A;  8ICR A;  3H8J A;  3HKZ C;  4EX6 A;  1N2X A;  4GXI A;  4OJP A;  1RM6 C;  3E2E A;  2R8H A;  4GFJ A;  1ZQM A;  2G07 A;  4C8K A;  3V6K A;  5J0Y A;  2JZB A;  4FZN A;  3L3F X;  3LVV A;  5CA7 A;  2AGP A;  2EZZ A;  3EYZ A;  3R9K A;  2GLE A;  2ASL A;  4UB5 A;  1NKB A;  5KFL A;  4X5V A;  2HVH A;  7ICM A;  1ZQO A;  4KLJ A;  4KLF A;  2HBM A;  2W9B A;  1UCV A;  1XO0 A;  1KL9 A;  2F77 X;  3WK9 A;  1S76 D;  3RR8 A;  3F2B A;  1SGG A;  3EW9 A;  3GV7 B;  2E1F A;  3PW5 A;  1KRP A;  1KKX A;  2E3T A;  2VKQ A;  4BUG A;  2YB1 A;  1K5O A;  5AKG A;  1KFS A;  7ICH A;  4M6W B;  3RJE A;  4PH5 A;  4K4I A;  3D2N A;  5KG2 A;  3SAF A;  1ZQJ A;  4RUA A;  9ICI A;  5DB6 A;  3RR7 A;  3OJS A;  1X9W A;  2OYY A;  4ECY A;  3KTQ A;  3WK4 A;  2AQ4 A;  1Q46 A;  9ICP A;  4NLC A;  3MBY A;  3CW2 C;  4F5N A;  4UB8 U;  4OJO A;  4Y2U A;  4ED7 A;  2ZJA A;  3T5H A;  2NRT A;  2KG5 A;  2BCS A;  2CN1 A;  3AMZ A;  1QQ5 A;  1PK3 A;  1X9X A;  5G5G A;  4CF3 A;  1Q3V A;  4R8U A;  5KFX A;  1IM4 A;  7ICR A;  1TAU A;  2Y0S F;  4QWA A;  4DO9 A;  2KFN A;  1QSY A;  2J6S A;  5H2F U;  2D6F C;  1FFV A;  3IG5 A;  3OSN A;  5G5H A;  1X9M A;  2HHU A;  4AP9 A;  7ICP A;  3GZF A;  4UAY A;  3T5J A;  3SQI A;  2NO4 A;  2R8J A;  4RU9 A;  8ICY A;  5DGA A;  3Q8R B;  3G6V A;  2VA8 A;  2AGO A;  4DWI A;  7ICS A;  3UXO A;  2HBJ A;  2WF8 A;  1RDF A;  1YZ6 A;  2XY5 A;  1BPY A;  1NKE A;  1ZQ1 C;  4F4K A;  1NK5 A;  4G9B A;  4I27 A;  1NZB A;  4EBD A;  2K8A A;  4MEY A;  3ZD8 A;  1S0N A;  3TAN A;  2W55 A;  4P0Q A;  1ZQL A;  1SV0 C;  4MFC A;  3QUQ A;  5AI9 A;  4YQW A;  2AJQ A;  1ZD2 P;  5KFM A;  4DS4 A;  3WKE A;  4I2I A;  4ZH4 A;  2Q4T A;  5KFO A;  8ICO A;  1J2M A;  4YXM A;  5AM0 A;  1MA7 A;  4J9M A;  4RQN A;  3MFH A;  4IR1 A;  1NI3 A;  4PPX A;  4U6P A;  1HJP A;  4ED0 A;  3AQE A;  2BDU A;  1B22 A;  4MFF A;  8ICI A;  4YVZ A;  4HYK A;  7ICF A;  4F91 B;  4UAZ A;  2BQ3 A;  1U4B A;  5IIJ A;  1ZQZ A;  3K75 D; 
#chains in the Genus database with same CATH homology
 2PMZ F;  3IG8 A;  3M6K A;  2OXO A;  2CN1 A;  2KEY A;  2KIW A;  2VIX A;  4QIW C;  1PVP A;  1Z1B A;  2VJ4 A;  3E0F A;  5KL8 B;  3T79 A;  2RRD A;  2KVC A;  2DGZ A;  2G0A A;  2KNJ A;  2DQN B;  3M6Z A;  2G5H B;  3NUQ A;  1GO3 F;  2DF4 B;  2LBO A;  2WB1 F;  2W7O A;  3F2C A;  4PL2 A;  1Q3V A;  2H3F A;  3GU3 A;  4OJL A;  2H3Z A;  3DEE A;  3HKZ F;  2Y0S F;  5A0L A;  2RP5 A;  3K1Z A;  2KD1 A;  3LVW A;  2HOQ A;  2KKP A;  2NV3 A;  3M7D A;  3H0M B;  1KBU A;  2PMZ C;  2LKY A;  2D6F C;  1URJ A;  3IG5 A;  2E1E A;  3F5A A;  1F44 A;  2K4E A;  3CP8 A;  2HOF A;  4CDG A;  3GZF A;  3H0L B;  3RFA A;  3F2D A;  3O0F A;  2KJ9 A;  3C28 A;  3SQI A;  2WB1 C;  1Q3U A;  2HOI A;  3H0R B;  4KX3 A;  1A0P A;  2JH7 A;  2ZIW B;  4JMU A;  3HKZ C;  3VCB A;  2Y0S C;  1L6N A;  2ZIW A;  3AL0 B;  4OJP A;  1ECW A;  3OPX A;  2K89 A;  1T94 A;  2KJ5 A;  3LYS A;  4GFJ A;  1PVQ A;  4QNL A;  2KHQ A;  3PST A;  1HIW A;  2MA1 A;  2G07 A;  4P0P B;  4NLB A;  2R18 A;  4A8E A;  2G06 A;  2OH2 A;  4P0P A;  4FZN A;  4AYB F;  2CRX A;  2HBJ A;  3L3F X;  3LVV A;  1PVR A;  2XVT A;  3AQF A;  2LHT A;  4NWI A;  5CRX A;  3F53 A;  2HMX A;  2OM6 A;  3CRX A;  1WUD A;  5KL1 B;  1CRX A;  3KZX A;  5HR7 A;  1IIP A;  1DRG A;  1ZQ1 C;  2K8B B;  3D2Q A;  2JHD A;  4BJQ A;  1SZH A;  2YB4 A;  2ZXH A;  2YX8 A;  2ZIV B;  2HBM A;  1NZB A;  3N7S C;  2ZIV A;  2ZXI A;  3D2S A;  2K8A A;  4AYB C;  2N1R A;  1XO0 A;  4KMO B;  2F77 X;  2ZIU B;  2W03 A;  2CPR A;  3ONN A;  2ZIU A;  2KOB A;  5C0Y A;  4U7C A;  4P0Q B;  2MRL A;  2LYA A;  3PSF A;  2XIC A;  4IC9 A;  3MGV A;  3F2B A;  1A6S A;  2G5I B;  3ALR A;  2JMG A;  2W04 A;  2E1F A;  4P0Q A;  1OUQ A;  4FE3 A;  3SAH A;  3N7P D;  2JGA A;  3SMV A;  2VKQ A;  2H3V A;  4BUG A;  2YB1 A;  2WAQ F;  1UPH A;  1P7D A;  4WJ3 B;  4FZM A;  2HBL A;  3PZP A;  2LYB A;  4NV0 A;  3VC8 A;  2XID A;  4QJF B;  2XI9 A;  1Z19 A;  2F2A B;  3F5E A;  3D2N A;  2GH1 A;  3IP4 B;  4PL1 A;  1D8B A;  4OO1 J;  2HBK A;  2ZIX B;  3SAF A;  4ACO A;  5HR6 A;  5T14 A;  2Q4T A;  1TAM A;  4FZL A;  2H3Q A;  2ZIX A;  4KX5 A;  2OYY A;  4CRX A;  2H3I A;  1XNS A;  2K8C B;  2GOL A;  2K4I A;  2M0N A;  1MA7 A;  1HEK A;  3ICX A;  3CYM A;  2F76 X;  2F8L A;  2WAQ C;  3C29 A;  4CGZ A;  2JH1 A;  3NRW A;  4OJ6 A;  2E5S A;  3IN5 A;  4U6P A;  4NLC A;  3PSI A;  2VJ5 A;  1ED1 A;  4QIW F;  2KHV A;  3AQE A;  2BDU A;  2Z7J A;  3N7R C;  3PSP A;  2KKV A;  4O3M A;  3RF9 A;  2A3V A;  4OJO A;  2K4H A;  3KFU F;  2W7P A;  2G09 A;  4BX9 C;  3SAG A;  4OJ5 A;  4C0Z A;  2KJ8 A;  2G08 A;  1YT3 A;  2KIC A;  4ICA A;  2ZG6 A;  2KV2 A;  2RHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...