3N7SC

Crystal structure of the ectodomain complex of the cgrp receptor, a class-b gpcr, reveals the site of drug antagonism
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
ACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcitonin gene-related peptide type 1 receptor
publication title Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 27
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3n7sC00
3N7PD 3AQFA 2XVTA 3N7RC 3AQEA 3N7SC 2YX8A
chains in the Genus database with same CATH superfamily
1A77A 1FEZA 2R8IA 5KAIU 4ED3A 4X5VA 3RH4A 4PL1A 1L6NA 1PUZA 4J9PA 1F5SA 1SKWA 3MABA 3PNCA 1S9FA 4IR1A 3GZFA 9ICBA 5HP4A 4DOCA 3UMGA 4P0QB 4QNLA 4QW8A 1S97A 1RQLA 1PVRA 2OM6A 3QX7A 4B9NA 2Q0ZX 4O3SA 2W3SA 2DUYA 1ZQYA 5J0UA 2HCFA 3KZXA 1KW4A 1L7MA 4QZDA 5AM0A 3Q8QB 1BPZA 1ZQHA 4I2EA 1A6SA 2NRTA 3NVZA 2E1FA 7ICFA 8ICAA 3SYZA 3OSPA 2Y9UA 2H5XA 1N56A 4RQ0A 4KMOB 1ZQKA 4JMUA 3A0HU 3D6JA 2F44A 1ZQ1C 1X6JA 3RJGA 2K8BB 3MDCA 2AHOB 5H2FU 2YMPA 2ZIWB 3NVVA 2ZIXA 1RYUA 1D8LA 3BZKA 1JI7A 3BS7A 4GC7A 3NVYA 1SB3C 1RDFA 4LZGA 5AM5A 4Y2UA 3H0RB 1VJ5A 5ALHA 3WK9A 5AK3A 2KHQA 3N97B 3ZI4A 4DS4A 8ICEA 4UAZA 2JHDA 7ICSA 2H3IA 3ISBA 3SI8A 4UQGA 4RT2A 3GIKA 3UQ0A 1X9MA 5KFMA 3WK8A 2LKYA 2WF6A 1LB2B 1T4GA 3WK5A 1LKYB 1K1SA 4FFDA 2FE9A 1NOMA 2W8KA 7ICUA 2WB1C 5ALUA 3RB6A 3TFRA 3NASA 4EEYA 3AEVA 1QLNA 4R65A 5AI8A 3NTUA 4DL5A 1Z19A 1HEKA 3C21A 2HOIA 1PZNA 4DCCA 1JIHA 2I5HA 4PJ0U 3JPQA 4RQMA 1UQVA 4UAWA 4I2GA 3ISDA 3ZDAA 4J9KA 4ED8A 3KOOA 9ICNA 4KLEA 4PZOA 1WCLA 4PL2A 4O0IA 1BPYA 4RPYA 2KSOB 5J0TA 2PKEA 1BNPA 3OHBA 3SEIA 4DL4A 1QQ5A 3RBDA 9ICWA 2F77X 4EBDA 1ZQPA 4AYBF 1B43A 3G6VA 4RNOA 1ZQGA 4PZNA 1XO0A 5KFZA 1URJA 5BOMA 7ICTA 2KIVA 5KT6A 5JUMA 3HT3A 4Q8FA 1NKBA 4NLNA 4JV0A 2AGOA 3HW8A 2LPEA 1AQ6A 2Y9TA 2YN4A 5KFNA 4US9A 4JV2A 3ETRA 2XY7A 1KFTA 4FZLA 4A8EA 2FLNA 3HPOA 2IBKA 9ICMA 2IHNA 3ORYA 4DFMA 9ICRA 3D2SA 1XS9D 5HR6A 3OHAA 2UVWA 2XY6A 4I2DA 4Y2XA 3C5GA 1NK8A 1SZPA 3QU5A 5J0XA 3M1YA 2N1RA 9ICQA 3KD3A 3SD7A 5J8YC 4AP9A 4F2RA 5KT5A 5DDMA 3I28A 5AK6A 4F4ZA 2C2RA 3I1YA 5ALNA 4OD0A 2K8AA 2BPFA 2D6FC 2LBOA 2B21A 4UB8U 2DBYA 3GIJA 4J9RA 5AKLA 1M6YA 5J2DA 1ZQZA 9ICOA 2KOBA 4RNMA 2FJ6A 4B9MA 1C7YA 1PVPA 5DDYA 5KFGA 1XNSA 2KJ5A 2XCPA 5AKYA 1RXWA 1IM4A 5J2EA 4J9LA 4DOBA 3Q8MA 2J6TA 4NM1A 4QZFA 5KG1A 2V4QA 2DL0A 1RM6C 3M8RA 4NWIA 3T5KA 3BS5A 4G9BA 4ECRA 2HHVA 2LYAA 3PX0A 4DEZA 2E8NA 1S0MA 4F5PA 4P4OA 4OJOA 5L9XA 3NGDA 8ICVA 2FDRA 4KLLA 7ICGA 5DGBA 2FLLA 5AICA 8ICXA 5AKIA 2C22A 3UQ2A 2EQYA 5ALEA 4YXMA 4YR0A 3KHLA 4I2HA 4J03A 5KFHA 1Q3UA 5AI0A 5ALRA 3H0MB 2W43A 2I6XA 4ICAA 4ECTA 3L4PA 4DQSA 2FMPA 2B0CA 5K4LA 1UA0A 1NZPA 1LVHA 1L8OA 3KZIU 4ELTA 5EE3A 4M9HA 1OUQA 1UCVA 4MF8A 3PSFA 2HOQA 2K4EA 3ZDDA 5ALFA 1JUDA 2ASLA 4ECVA 3NVWA 1DOQA 3C1ZA 3RFAA 1ZETA 4IRKA 2IOHA 5L1MA 3GILA 4RQ4A 3U26A 2BCQA 4FBUA 2RQ5A 2KKPA 1N62A 2CPRA 1SIJA 2XI9A 5KFTA 3KFUF 1SL2A 4KLTA 2KP7A 8ICHA 4YR3A 3M6KA 4UBCA 1NI3A 5ALJA 3V6HA 5AKZA 4FS1A 3DDHA 2PI5A 3LWMA 5ALQA 5HMLA 1ZQCA 4BUGA 1ZXIA 3F5EA 5EE0A 3NUQA 1EXNA 4F2SA 3B0XA 4IQWA 9ICJA 8ICGA 3QUCA 2G06A 1OXJA 3RRHA 3M6ZA 4UATA 2ASDA 4P0PA 2HHWA 2AGPA 3BQ1A 2JZBA 1GO3F 3D2NA 4YMMA 5ALWA 4B6JA 3RF9A 2QB0A 4YD2A 4RUCA 5HR7A 4YR2A 4RQ6A 1Q3VA 1Z3EB 2ISPA 5AM4A 1ZQMA 5JTIA 3QUTA 3OTQA 1JN3A 2ZTEA 4I28A 1JROA 1ZD5A 3GIIA 3QYPA 5KG7A 4ED0A 2ZIUA 3QXGA 3RJKA 4NLGA 2BR0A 4EX7A 3TKAA 8ICPA 2O6KA 1N48A 3RR8A 2KVCA 3L5KA 4F5NA 4C4TA 1SWWA 3A0BU 2BKEA 4I27A 4KLJA 5IIMA 1RPLA 2FPMA 1ZQIA 2NV3A 2M0NA 4Y2YA 5KL1B 1COOA 2AH5A 3DV9A 4F72A 4ZOHC 2HVHA 4RNNA 2GLEA 5KFWA 5KL8B 3RJEA 5DKWA 4TUPA 2R8HA 2BPCA 4O3MA 3V7KA 4UAVA 4ECYA 2W7PA 4DFPA 4ECWA 1TAUA 5A0LA 5IIKA 4DS5A 4EYIB 2UVVA 5ALXA 3T5HA 3H8WA 3PY8A 1RYSA 4JWMA 5ALKA 1FO4A 4UB1A 1D8BA 2VIXA 4DQRA 5KFPA 4DL3A 2GO7A 1QSYA 4XUSA 8ICCA 4PHDA 3S6JA 7ICEA 4OJ5A 2W9CB 4KLDA 5IIOA 1Y88A 2DF4B 2V4RA 4C8KA 1T3NA 4FS2A 4M2YA 8ICMA 5J0PA 5CEHA 2A1JA 1U45A 2JEGA 1ZQWA 4GXKA 3C2KA 2XGPA 2G09A 5EOZA 2QB1A 4PPXA 4NY8A 4O9MA 4DOAA 2XICA 2PMZC 2K4HA 4TUQA 5E79U 5GTIU 3TADC 2VJ4A 3K75D 4DF4A 3RJHA 4BXOA 1CUKA 4JB3A 4QJFB 1FFVA 1WUDA 8ICSA 1X9XA 4J9MA 2NRXA 4YG2A 3AL0B 4CF5A 1NKCA 2W11A 3PSPA 5B5EU 4I29A 5J2JA 1D9DA 2XO7A 4F4KA 2KZZA 2A1AA 1SV0C 2W7OA 1KEJA 2E8PA 2UVUA 2CN1A 3RBEA 4XQ8A 2WF8A 3IM1A 4J9OA 4Y2QA 2IA6A 1ZQDA 1ZQOA 4YCXA 3SQIA 4NL9A 1OW5A 5KFUA 1SXEA 2FPLA 2BZFA 3WU2U 2WB1F 1QQ7A 3PR4A 2AQ0A 2JMGA 3JPRA 1XWLA 1V85A 5KFKA 1ZD3A 1T94A 4UW9A 5CRXA 2XGQA 1L3VA 3FDSA 3TACB 3V7LA 2ZJ8A 4BDPA 3V6KA 1NJZA 5EE1A 3PMLA 1KSPA 1Z4NA 1PK3A 4M6WB 4Q8EA 3AQEA 5DG7A 4IR9A 2KG5A 3WKCA 5EWEA 2WF5A 2FMQA 2GOLA 4MEXA 4IL6U 4PHEA 2R8JA 1RXVA 1ZQBA 5DBAA 4QZAA 3ISCA 1XO1A 5KNIA 3MC1A 2Y1JA 2NYVA 2KHVA 4NV0A 4F8RA 3BQ2A 2KVSA 1NK7A 9ICKA 2JXJA 1NZBA 8ICKA 3E0FA 4RT3A 2AXTU 4DSKA 8ICOA 3Q8PB 3M9NB 2EANA 3MGIA 1HUZA 4JUZA 5BOLA 4EEKA 4DSLA 3PMNA 4DL7A 2ZIVB 2F76X 4RQ2A 1Q8KA 2ZXIA 2EH9A 3IN5A 3BQ0A 1Z1VA 4QZGA 3FAHA 5J29A 2KEYA 5CA7A 4F71A 4F5QA 2XC9A 5F3XB 5IIJA 4QWAA 4QZ9A 5ALVA 1SWVA 4LJXA 3WKDA 4IS7A 2H3VA 3QZ7A 2MAXA 5AI9A 3IRUA 3QU2A 4CF4A 2VA2A 3L3FX 5ALMA 2F1IA 5ALDA 1N63A 4R63A 1ZYQA 3BDPA 5J2BA 4KLHA 1P7DA 1BPBA 5KFIA 1TAQA 3ZD9A 3QE9Y 4MHVA 4UBBA 2MUTB 9ICUA 2ISOA 5KFYA 1DGSA 3EZ5A 8ICUA 1X66A 2AU0A 1JXLA 5JRTA 4Z6EA 3B9JA 1ZQJA 4J9QA 1CRXA 3AU2A 2ZUCA 4Y2JA 4PGXA 2F2AB 2KIWA 2KFZA 4ELUA 3PW2A 4I2CA 4F91B 4C8MA 4PHAA 1DGJA 1YZ6A 3SMVA 5IIIA 3EWAA 3PW4A 3PV8A 2LYHA 3AUOA 2OWOA 3M9OB 4TUSA 3MR3A 9ICCA 1NK9A 5AM1A 3SZ2A 4M9GA 1ZOLA 4P0PB 2EAPA 2JH1A 2BQ3A 1BPEA 5DBCA 2QKQA 1JX4A 3C1YA 2QB0B 4EYHB 1UT8A 1T8EA 2BCRA 8ICQA 2KMDA 2YMLA 4KLFA 4J9NA 2M9NA 4Y2PA 1XSPA 3FYHA 3JPNA 4GFJA 3MDAA 5KG4A 1JALA 4O3RA 1MSWD 2ZIUB 3PZPA 4TQRA 2EAMA 4YP3A 3PW7A 5G5GA 2LM1A 3F53A 1V38A 5ALGA 5DGAA 2ZUDA 8ICNA 5AKEA 3J81j 4DLEA 4IC9A 1NK5A 4QWCA 1B22A 4K4GA 2I1QA 1D9FA 2HBKA 3RRGA 5ALTA 1MQ2A 2WHEA 4I2FA 3GV5B 2MSNA 3TARA 2YB1A 2G5HB 4C7YA 4R66A 2LM4A 2BDPA 2G07A 4OCZA 4EBEA 1DK3A 4WJ3B 1QTMA 2F1JA 5KFXA 3QEAZ 1F0MA 2YQEA 9ICXA 3ONNA 4YXJA 1KN5A 1NJYA 5AKGA 5EWFA 3KKAC 4C80A 4ED7A 1Z00A 2XIDA 2NRWA 2JRZA 3WKAA 4UARA 3PO5A 1PK1B 1D8YA 1T7PA 5ALYA 3N7RC 4DFJA 4IRCA 3HP6A 4EELA 2QARB 4CDGA 5J8YA 3M9MB 3N28A 3UXNA 1ZRMA 1S77D 2LHTA 2YTUA 4P0QA 4KLSA 8ICTA 5AKKA 2XCAA 2KZ3A 4B9VA 5CP2A 8ICFA 1RYRA 2Q4TA 5CHGA 3MGVA 2Y1IA 2K4IA 4F93B 4MFCA 4UB2A 3ZDBA 9ICVA 3LK9A 2Y0SC 4KX5A 2RLTA 2F8LA 3OJSA 2BDUA 5J0WA 9ICTA 2BHNA 2EAOA 4F3OA 4FZMA 5KFJA 5L1JA 2W55A 3MFHA 3C5FA 1S76D 4UB6U 4GC6A 3QNMA 4YMOA 2L5YA 4C8NA 5J2GA 1KTQA 4M9JA 4R8UA 4P4MA 2YX8A 4MFFA 2AGQA 3QZ8A 4GLXA 4EENA 2ZIWA 5AK5A 2OXOA 3LVVA 2E5SA 2ATLA 2IOFA 1WWVA 5IINA 2DKXA 3JPTA 3SAHA 1COKA 3UXOA 1ZJMA 4UB5A 4DSFA 4ECSA 1RQNA 2YY6A 1T3QA 1NNLA 2C2DA 1BNOA 2PMZF 3ZDEA 3OPXA 4OJPA 1N5XA 3MFIA 4BWJA 3AM9A 5L1LA 5J2KA 2ZG6A 1JXEA 3OGUA 3C29A 5CR0A 2HVIA 5AM2A 5HHHA 2R8KA 3CYMA 5DLGA 4Y2VA 2WF9A 4YVZA 4GXIA 4EBCA 5CJ7A 1ZQXA 4KITB 4C4SA 3IG8A 2H3ZA 2QLTA 2OEHA 2P66A 2DKZA 4K4HA 4U6PA 2W8LA 2FI1A 2WF7A 1L5UA 4RQ1A 4P4PA 8ICJA 4MFAA 3H7IA 5DG9A 3EYZA 1IXRA 3K1ZA 3SV4A 5J0RA 4GIBA 5KFDA 3HX0A 1A0PA 1JMSA 2EZZA 1TKDA 2ZUBA 2KSOA 1WYGA 3QU9A 1SGGA 3GV7B 4TQSA 5TZVA 2GH1A 1L3TA 2PFPA 1S5LU 2W9MA 4UASA 5KFSA 2ZIXB 4DO9A 4IRDA 4I2BA 8ICWA 4OJ6A 3SAGA 5KFAA 9ICEA 3KHRA 5BPCA 3VCBA 3PVXA 3E58A 3LYSA 1SKSA 5F9LA 3K1RB 1L7OA 2CRXA 2KZMA 4QZ8A 1ZQLA 5KT4A 2AQ4A 2BQUA 2RRDA 5DBBA 3C28A 2RP5A 4KLOA 3WKBA 3WK7A 1XC9A 1YT3A 4QWBA 2JH7A 2R8GA 1KL9A 4C4RA 4Z6DA 2D8CA 3NRZA 4O5KA 5DB9A 1U47A 2NO5A 1WG8A 7ICLA 4ECZA 4IQVA 1X40A 4LVSA 4C7ZA 4LZDA 3JPOA 5L1KA 2JEIA 1TV9A 4FZNA 3GQCA 5KFOA 5AIBA 2F8KA 1HJPA 4UB3A 4E0DA 5FP0A 2W03A 1NK6A 1L7PA 4CF3A 2MU2A 2A19A 2DPJA 1ED1A 3BQ7A 3AN1A 3WK6A 3IHQB 3RJIA 1J2NA 3ZDCA 3SENA 2W9BA 4DFKA 1NJWA 4C8LA 4Y2RA 4DSJA 2VKQA 4O3OA 9ICLA 4Q43A 4USAA 1DK2A 4G3IA 3R9KA 3Q8SB 1LV5A 3RR7A 3UMCA 5DB6A 2BPGA 2WFAA 5J2CA 1KFDA 2YB4A 1VDVA 5KFVA 4K4IA 2VA3A 5EE9A 1BPDA 3BJYA 2ODGA 4UAUA 3Q8KA 1X9WA 5CWRA 3TADA 2MA1A 4NL9C 5C0YA 5KG3A 4ACOA 3PR5B 1V9PA 4ZH4A 2HHUA 4O5EA 1ZJNA 2JGAA 5ALSA 5JU5A 3I76A 1J2MA 2G5IB 3MR6A 4YD1A 2BCUA 3RAQA 1SV0A 1ZQFA 1QH9A 3PSTA 4C0ZA 4RQ7A 3AQFA 5AKJA 5HMMA 4DFDA 3JPPA 4I2IA 2HMXA 2W04A 1MC8A 2PFQA 3MGHA 2ASJA 7ICMA 3D2QA 2HW3A 3H4BA 8ICZA 3T3FA 3N4MB 5ALPA 1AROP 2E8OA 1K5OA 1KRPA 4ECUA 8ICYA 5J0SA 3GFKB 4YMNA 1BPXA 4RU9A 1CEZA 1QQ6A 4DQQA 3RAXA 1L7NA 4NLBA 1NK0A 1Z00B 4O3NA 4NJ8A 3FC4A 3T79A 3HRDD 4B9SA 5ALZA 2W54A 4CCHA 1MA7A 3BZCA 2Z7JA 2LMRA 7ICRA 4IQUA 2C28A 3K4GA 1IV8A 1SL1A 8ICLA 2KJ9A 3CNHA 2DWQA 4UAYA 1UA1A 2P6UA 2LI6A 1SV4A 3CW2C 5DB8A 3BS5B 4NM2A 2BGWA 3GIMA 3GDXA 2ZJ5A 4B9UA 2HI0A 3G6XA 1S0OA 3EUB2 3NS1A 4F50A 5AK4A 3UMBA 2HHTA 1MQ3A 2DGZA 5AI5A 2PI4A 2YMQA 3M7DA 5HHIA 3CRXA 5J2FA 3TI0A 2OYYA 2HBLA 4ELVA 3TANA 4YN4A 1S8OA 1X6IA 1S10A 2IOFK 4DSEA 3O0FA 4RQ5A 1X42A 1CI4A 4FE3A 1U49A 3ETLA 5DB7A 2HHXA 5DQGA 5L1IA 3LDAA 2IMWP 4R8UB 4B9LA 3H8JA 3C2MA 2G0AA 3V7JA 1C20A 2YMMA 4QIWC 4M47A 5J0QA 5DLFA 3H40A 1ZD2P 2WAQC 3LVWA 4ECXA 5ALIA 1KKXA 5KFEA 1ZQVA 1FIQA 3UPQA 4QZBA 4M9LA 1ZQNA 1MN8A 1X2IA 4C8OA 4RQ3A 5B66U 5TISU 5J0YA 2XVTA 1ZD4A 2ZTDA 7ICHA 5KTQA 4NLKA 4KMUA 4ECQA 5IILA 5EWGA 4R64A 2KD1A 5J0OA 2KNJA 5ALOA 3QU7A 2W9CA 1RG6A 2Y0SF 1K1QA 2H3FA 4ED1A 2BQRA 3F2DA 3OJUA 4Q45A 3HKZC 3KHHA 5D46A 3TAPA 2JZBB 1FFUA 3KHGA 4DQIA 4I2AA 1ZQUA 3LWLA 1TAMA 4Q44A 1L8LA 5D4BA 3T5JA 4MEYA 4GXJA 4QWDA 4KLUA 3IV6A 4RQ8A 1KFSA 3N7SC 4QZCA 3RB4A 5KT7A 3H8SA 2E1EA 3GV8B 1Z1BA 1QSSA 1PVQA 3AU6A 1TK5A 2PFNA 2HHQA 2JEJA 2W3RA 4DWIA 1ZQSA 2W9AA 1ZQTA 1TE2A 4KLQA 3SV3A 1SZHA 3V6JA 5KFLA 2RHFA 3EPIA 3RH5A 2P35A 4M0AA 3PW0A 1HUOA 3TFSA 3C2LA 1KDHA 4RUAA 3HJEA 4ED6A 7ICQA 3Q8LA 5AKXA 9ICAA 4QWEA 8ICRA 2NRVA 2JR5A 2BCSA 3TAQA 4PHPA 4DL2A 4KLIA 4Z6FA 4NLZA 4M9NA 5KG5A 5J2AA 1TFRA 3H4DA 1S0VA 2GWSA 1QSLA 2EZXA 4P2HA 8ICIA 4FO6A 2E8MA 2UVRA 4JK1A 1KQQA 2K4PA 2A1JB 4M6WA 2EDUA 3E2EA 2DQNB 4FBTA 2PXIA 1ZQQA 2W9BB 2KTQA 9ICFA 4F4WA 3MBYA 1SXDA 2CXYA 4TURA 5DQHA 5G5HA 1HIWA 2R18A 3KKAA 4BXOB 1VLBA 4RPXA 2EZYA 2D3DA 1XU4A 4CGZA 1F44A 3F5AA 7ICIA 2BCVA 2ZJAA 3RB3A 2ZIVA 4KX3A 3ED5A 5KFCA 3PW5A 3CP8A 5AI6A 2H3QA 1IIPA 3F2CA 5J2HA 5AKHA 4KLMA 3MR5A 7ICJA 4QZIA 9ICPA 1XSNA 5KAFU 4PGYA 1IG6A 4F5RA 4PGQA 3B0YA 3PX4A 3BQTA 3EW9A 2ZTCA 2FLPA 2LYBA 3AMZA 4Y2SA 3HILA 5F9NA 7ICPA 2JV3A 4HAIA 9ICIA 2KKVA 2VANA 2J6UA 5ALLA 4AYBC 3QU4A 3PX6A 4KLGA 2VJ5A 2MUTA 2JEFA 2ZXHA 3RJJA 3TQ1A 4JV1A 7ICKA 3QUBA 4KTQA 1KBUA 2FMSA 1Q46A 7ICOA 2V9WA 3NRWA 2PFOA 4QW9A 2A3VA 1LKYA 9ICHA 3THVA 4NXZA 3UM9A 4QZHA 2KN7A 1YZ7A 1JRPA 4I2JA 3RB0A 4BJQA 1ZQEA 1B4FA 1SL0A 3Q8RB 3DEEA 1N61A 1ZQRA 2I9GA 3UXPA 2ES6A 3QUQA 1U4BA 1WWUA 2ALZA 3WKEA 3GU3A 3F2BA 3RH6A 4EZ9A 1DRGA 4Y2TA 5AM3A 2OH2A 4Z6CA 3IP4B 3N7PD 2K89A 4F92B 1O08A 4OJLA 7ICNA 1A76A 1V97A 1U48A 2B6GA 3SAFA 2J6SA 3KBBA 2ESEA 4O3QA 5AHXA 1TK0A 1TK8A 2HBMA 4CRXA 5HNKA 5KG0A 3G6YA 1XSLA 4YFKA 2HSZA 5AI4A 3MR2A 1UT5A 1BVSA 1U9LA 4F5OA 1TVAA 5T14A 3QEBZ 2HDOA 1N5WA 4JWNA 4CE6A 3IG5A 4DL6A 1ZRNA 5KT3A 1NKEA 1Z4OA 4IQTA 3IDWA 4CNQA 2FPKA 4O3PA 2F3NA 3RTVA 2XY5A 5KFQA 3HWTA 3M8SA 3OSNA 2F1HA 5DQIA 5GTHU 1L3SA 4F4XA 5KFFA 3RJFA 4BGDA 3ZD8A 1DXSA 5KFRA 4ED2A 2HBJA 2OHFA 2K8CB 4DF8A 5CB1A 3FM9A 2AJQA 2VA8A 1O03A 1S0NA 2RDJA 4M04A 1RZTA 4MF2A 1PK1A 4XA5A 9ICSA 4RPZA 4DQPA 2G08A 3EPGA 4RZRA 4HYKA 4XRHA 2QARA 4PH5A 4NLCA 1J97A 4DLGA 2P6RA 1ECWA 2KICA 1WCNA 1B0XA 2OCEA 4QIWF 2DPIA 2HOFA 4U7CA 3C23A 2NO4A 4BWMA 1NJXA 9ICGA 4O5CA 1UPHA 4DSIA 1H38A 2WAQF 3WK4A 4UB4A 5KG6A 3H8MA 1QCKA 1N2XA 4F4YA 4US8A 2KK0A 2KJ8A 4BX9C 5KT2A 7ICVA 1BGXT 1L3UA 1ZQAA 2KE7A 5AIAA 1NK4A 8ICBA 3KTQA 1X9SA 3PSIA 2K60A 4RQNA 3VC8A 1N60A 3ALRA 2WTFA 4EZ6A 4QZEA 2KV2A 4OO1J 4YQWA 2DFLA 5C5JA 3T5LA 2MRLA 4EX6A 4J9SA 1UHUA 3PO4A 5KFBA 2RDIA 2KFNA 2NRZA 3V72A 3ICXA 1SKRA 3JPSA 4KN4A 5DG8A 2C2EA 4B9TA 5KG2A 4KN7A 1KLNA 3HKZF 3SR6A 5J2IA 2IHMA 2HHSA 5D49A 2E3TA 3H0LB
chains in the Genus database with same CATH topology
3SQIA 2Y0SC 2YB4A 4KX5A 2ZIUB 3DEEA 3PZPA 2F8LA 3RFAA 2HBJA 2NV3A 2LKYA 2M0NA 5KL1B 2DGZA 2BDUA 2GH1A 2K8CB 2WB1F 3F53A 2N1RA 1TAMA 1HIWA 3M7DA 3CRXA 1P7DA 2R18A 4FZMA 4PL1A 1L6NA 5KL8B 2KKPA 2JMGA 2OYYA 2CPRA 2XI9A 2WB1C 2MA1A 4IC9A 2HBLA 4CGZA 1T94A 3N7SC 2ZIXB 3GZFA 1F44A 4O3MA 3KFUF 4OJ6A 3GU3A 2W7PA 3F5AA 5A0LA 3F2BA 3SAGA 5CRXA 1DRGA 4P0QB 2G08A 5C0YA 4ACOA 4QNLA 1Z19A 3M6KA 3VCBA 2OH2A 3LYSA 1HEKA 2HBKA 2E1EA 2ZIVA 4KX3A 2K8AA 2YX8A 4NLCA 1Z1BA 2LBOA 3CP8A 3IP4B 1PVQA 3N7PD 2K89A 2D6FC 2H3QA 1PVRA 2OM6A 3O0FA 2CRXA 1IIPA 2ZIWA 3F2CA 1D8BA 4OJLA 2VIXA 2OXOA 1ECWA 4FE3A 2KICA 2KOBA 3LVVA 2E5SA 2RRDA 3C28A 3SAFA 2JGAA 2RP5A 3AQEA 1PVPA 1CRXA 2YB1A 2G5HB 4OJ5A 1XNSA 2KJ5A 1SZHA 1YT3A 3KZXA 2G5IB 2DF4B 2G07A 4QIWF 4BUGA 3SAHA 4U7CA 2HOFA 2JH7A 2RHFA 1A6SA 3F5EA 4PL2A 2F2AB 4WJ3B 2GOLA 2HBMA 2KIWA 2E1FA 2G0AA 3PSTA 4C0ZA 4CRXA 3AQFA 1UPHA 3NUQA 4QIWC 3ONNA 2WAQF 4NWIA 2G06A 2PMZF 2HMXA 2G09A 2W04A 2LYAA 3M6ZA 2KHVA 2LYBA 3OPXA 4NV0A 4OJPA 4P0PA 3SMVA 2F77X 1NZBA 2XICA 2KJ8A 2WAQC 3E0FA 3LVWA 2PMZC 2K4HA 2XIDA 3D2QA 4OJOA 5T14A 4BX9C 2ZG6A 4AYBF 3C29A 4KMOB 1GO3F 3D2NA 2KKVA 4JMUA 3CYMA 3IG5A 3RF9A 1ZQ1C 3N7RC 1XO0A 2VJ4A 4AYBC 4FZNA 5HR7A 1URJA 2ZIVB 3PSIA 3VC8A 4CDGA 2K8BB 2F76X 4QJFB 3ALRA 2W03A 1Q3VA 1WUDA 2HOIA 2ZXIA 3IG8A 3IN5A 2H3ZA 4P0PB 2JH1A 2KV2A 1Q3UA 2LHTA 2VJ5A 2ZIWB 4NLBA 4OO1J 3AL0B 2ZIXA 2ZXHA 1ED1A 3PSPA 3T79A 2XVTA 3H0MB 4ICAA 4P0QA 4U6PA 2MRLA 1KBUA 1MA7A 3NRWA 2Z7JA 2KEYA 3H0RB 2ZIUA 4FZLA 4A8EA 3ICXA 2W7OA 2KJ9A 3K1ZA 1OUQA 2VKQA 2KHQA 2KD1A 2A3VA 2CN1A 2H3VA 2KNJA 2HOQA 2Q4TA 3PSFA 2KVCA 3HKZF 2K4EA 3MGVA 3D2SA 2K4IA 1A0PA 2DQNB 2Y0SF 4GFJA 2H3FA 2JHDA 5HR6A 3F2DA 3H0LB 4BJQA 3HKZC 2H3IA 3L3FX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7P D;  3AQF A;  2XVT A;  3N7R C;  3AQE A;  3N7S C;  2YX8 A; 
#chains in the Genus database with same CATH topology
 1A77 A;  1FEZ A;  2R8I A;  5KAI U;  4ED3 A;  4X5V A;  3RH4 A;  4PL1 A;  1L6N A;  1PUZ A;  4J9P A;  1F5S A;  1SKW A;  3MAB A;  3PNC A;  1S9F A;  4IR1 A;  3GZF A;  9ICB A;  5HP4 A;  4DOC A;  3UMG A;  4P0Q B;  4QNL A;  4QW8 A;  1S97 A;  1RQL A;  1PVR A;  2OM6 A;  3QX7 A;  4B9N A;  2Q0Z X;  4O3S A;  2W3S A;  2DUY A;  1ZQY A;  5J0U A;  2HCF A;  3KZX A;  1KW4 A;  1L7M A;  4QZD A;  5AM0 A;  3Q8Q B;  1BPZ A;  1ZQH A;  4I2E A;  1A6S A;  2NRT A;  3NVZ A;  2E1F A;  7ICF A;  8ICA A;  3SYZ A;  3OSP A;  2Y9U A;  2H5X A;  1N56 A;  4RQ0 A;  4KMO B;  1ZQK A;  4JMU A;  3A0H U;  3D6J A;  2F44 A;  1ZQ1 C;  1X6J A;  3RJG A;  2K8B B;  3MDC A;  2AHO B;  5H2F U;  2YMP A;  2ZIW B;  3NVV A;  2ZIX A;  1RYU A;  1D8L A;  3BZK A;  1JI7 A;  3BS7 A;  4GC7 A;  3NVY A;  1SB3 C;  1RDF A;  4LZG A;  5AM5 A;  4Y2U A;  3H0R B;  1VJ5 A;  5ALH A;  3WK9 A;  5AK3 A;  2KHQ A;  3N97 B;  3ZI4 A;  4DS4 A;  8ICE A;  4UAZ A;  2JHD A;  7ICS A;  2H3I A;  3ISB A;  3SI8 A;  4UQG A;  4RT2 A;  3GIK A;  3UQ0 A;  1X9M A;  5KFM A;  3WK8 A;  2LKY A;  2WF6 A;  1LB2 B;  1T4G A;  3WK5 A;  1LKY B;  1K1S A;  4FFD A;  2FE9 A;  1NOM A;  2W8K A;  7ICU A;  2WB1 C;  5ALU A;  3RB6 A;  3TFR A;  3NAS A;  4EEY A;  3AEV A;  1QLN A;  4R65 A;  5AI8 A;  3NTU A;  4DL5 A;  1Z19 A;  1HEK A;  3C21 A;  2HOI A;  1PZN A;  4DCC A;  1JIH A;  2I5H A;  4PJ0 U;  3JPQ A;  4RQM A;  1UQV A;  4UAW A;  4I2G A;  3ISD A;  3ZDA A;  4J9K A;  4ED8 A;  3KOO A;  9ICN A;  4KLE A;  4PZO A;  1WCL A;  4PL2 A;  4O0I A;  1BPY A;  4RPY A;  2KSO B;  5J0T A;  2PKE A;  1BNP A;  3OHB A;  3SEI A;  4DL4 A;  1QQ5 A;  3RBD A;  9ICW A;  2F77 X;  4EBD A;  1ZQP A;  4AYB F;  1B43 A;  3G6V A;  4RNO A;  1ZQG A;  4PZN A;  1XO0 A;  5KFZ A;  1URJ A;  5BOM A;  7ICT A;  2KIV A;  5KT6 A;  5JUM A;  3HT3 A;  4Q8F A;  1NKB A;  4NLN A;  4JV0 A;  2AGO A;  3HW8 A;  2LPE A;  1AQ6 A;  2Y9T A;  2YN4 A;  5KFN A;  4US9 A;  4JV2 A;  3ETR A;  2XY7 A;  1KFT A;  4FZL A;  4A8E A;  2FLN A;  3HPO A;  2IBK A;  9ICM A;  2IHN A;  3ORY A;  4DFM A;  9ICR A;  3D2S A;  1XS9 D;  5HR6 A;  3OHA A;  2UVW A;  2XY6 A;  4I2D A;  4Y2X A;  3C5G A;  1NK8 A;  1SZP A;  3QU5 A;  5J0X A;  3M1Y A;  2N1R A;  9ICQ A;  3KD3 A;  3SD7 A;  5J8Y C;  4AP9 A;  4F2R A;  5KT5 A;  5DDM A;  3I28 A;  5AK6 A;  4F4Z A;  2C2R A;  3I1Y A;  5ALN A;  4OD0 A;  2K8A A;  2BPF A;  2D6F C;  2LBO A;  2B21 A;  4UB8 U;  2DBY A;  3GIJ A;  4J9R A;  5AKL A;  1M6Y A;  5J2D A;  1ZQZ A;  9ICO A;  2KOB A;  4RNM A;  2FJ6 A;  4B9M A;  1C7Y A;  1PVP A;  5DDY A;  5KFG A;  1XNS A;  2KJ5 A;  2XCP A;  5AKY A;  1RXW A;  1IM4 A;  5J2E A;  4J9L A;  4DOB A;  3Q8M A;  2J6T A;  4NM1 A;  4QZF A;  5KG1 A;  2V4Q A;  2DL0 A;  1RM6 C;  3M8R A;  4NWI A;  3T5K A;  3BS5 A;  4G9B A;  4ECR A;  2HHV A;  2LYA A;  3PX0 A;  4DEZ A;  2E8N A;  1S0M A;  4F5P A;  4P4O A;  4OJO A;  5L9X A;  3NGD A;  8ICV A;  2FDR A;  4KLL A;  7ICG A;  5DGB A;  2FLL A;  5AIC A;  8ICX A;  5AKI A;  2C22 A;  3UQ2 A;  2EQY A;  5ALE A;  4YXM A;  4YR0 A;  3KHL A;  4I2H A;  4J03 A;  5KFH A;  1Q3U A;  5AI0 A;  5ALR A;  3H0M B;  2W43 A;  2I6X A;  4ICA A;  4ECT A;  3L4P A;  4DQS A;  2FMP A;  2B0C A;  5K4L A;  1UA0 A;  1NZP A;  1LVH A;  1L8O A;  3KZI U;  4ELT A;  5EE3 A;  4M9H A;  1OUQ A;  1UCV A;  4MF8 A;  3PSF A;  2HOQ A;  2K4E A;  3ZDD A;  5ALF A;  1JUD A;  2ASL A;  4ECV A;  3NVW A;  1DOQ A;  3C1Z A;  3RFA A;  1ZET A;  4IRK A;  2IOH A;  5L1M A;  3GIL A;  4RQ4 A;  3U26 A;  2BCQ A;  4FBU A;  2RQ5 A;  2KKP A;  1N62 A;  2CPR A;  1SIJ A;  2XI9 A;  5KFT A;  3KFU F;  1SL2 A;  4KLT A;  2KP7 A;  8ICH A;  4YR3 A;  3M6K A;  4UBC A;  1NI3 A;  5ALJ A;  3V6H A;  5AKZ A;  4FS1 A;  3DDH A;  2PI5 A;  3LWM A;  5ALQ A;  5HML A;  1ZQC A;  4BUG A;  1ZXI A;  3F5E A;  5EE0 A;  3NUQ A;  1EXN A;  4F2S A;  3B0X A;  4IQW A;  9ICJ A;  8ICG A;  3QUC A;  2G06 A;  1OXJ A;  3RRH A;  3M6Z A;  4UAT A;  2ASD A;  4P0P A;  2HHW A;  2AGP A;  3BQ1 A;  2JZB A;  1GO3 F;  3D2N A;  4YMM A;  5ALW A;  4B6J A;  3RF9 A;  2QB0 A;  4YD2 A;  4RUC A;  5HR7 A;  4YR2 A;  4RQ6 A;  1Q3V A;  1Z3E B;  2ISP A;  5AM4 A;  1ZQM A;  5JTI A;  3QUT A;  3OTQ A;  1JN3 A;  2ZTE A;  4I28 A;  1JRO A;  1ZD5 A;  3GII A;  3QYP A;  5KG7 A;  4ED0 A;  2ZIU A;  3QXG A;  3RJK A;  4NLG A;  2BR0 A;  4EX7 A;  3TKA A;  8ICP A;  2O6K A;  1N48 A;  3RR8 A;  2KVC A;  3L5K A;  4F5N A;  4C4T A;  1SWW A;  3A0B U;  2BKE A;  4I27 A;  4KLJ A;  5IIM A;  1RPL A;  2FPM A;  1ZQI A;  2NV3 A;  2M0N A;  4Y2Y A;  5KL1 B;  1COO A;  2AH5 A;  3DV9 A;  4F72 A;  4ZOH C;  2HVH A;  4RNN A;  2GLE A;  5KFW A;  5KL8 B;  3RJE A;  5DKW A;  4TUP A;  2R8H A;  2BPC A;  4O3M A;  3V7K A;  4UAV A;  4ECY A;  2W7P A;  4DFP A;  4ECW A;  1TAU A;  5A0L A;  5IIK A;  4DS5 A;  4EYI B;  2UVV A;  5ALX A;  3T5H A;  3H8W A;  3PY8 A;  1RYS A;  4JWM A;  5ALK A;  1FO4 A;  4UB1 A;  1D8B A;  2VIX A;  4DQR A;  5KFP A;  4DL3 A;  2GO7 A;  1QSY A;  4XUS A;  8ICC A;  4PHD A;  3S6J A;  7ICE A;  4OJ5 A;  2W9C B;  4KLD A;  5IIO A;  1Y88 A;  2DF4 B;  2V4R A;  4C8K A;  1T3N A;  4FS2 A;  4M2Y A;  8ICM A;  5J0P A;  5CEH A;  2A1J A;  1U45 A;  2JEG A;  1ZQW A;  4GXK A;  3C2K A;  2XGP A;  2G09 A;  5EOZ A;  2QB1 A;  4PPX A;  4NY8 A;  4O9M A;  4DOA A;  2XIC A;  2PMZ C;  2K4H A;  4TUQ A;  5E79 U;  5GTI U;  3TAD C;  2VJ4 A;  3K75 D;  4DF4 A;  3RJH A;  4BXO A;  1CUK A;  4JB3 A;  4QJF B;  1FFV A;  1WUD A;  8ICS A;  1X9X A;  4J9M A;  2NRX A;  4YG2 A;  3AL0 B;  4CF5 A;  1NKC A;  2W11 A;  3PSP A;  5B5E U;  4I29 A;  5J2J A;  1D9D A;  2XO7 A;  4F4K A;  2KZZ A;  2A1A A;  1SV0 C;  2W7O A;  1KEJ A;  2E8P A;  2UVU A;  2CN1 A;  3RBE A;  4XQ8 A;  2WF8 A;  3IM1 A;  4J9O A;  4Y2Q A;  2IA6 A;  1ZQD A;  1ZQO A;  4YCX A;  3SQI A;  4NL9 A;  1OW5 A;  5KFU A;  1SXE A;  2FPL A;  2BZF A;  3WU2 U;  2WB1 F;  1QQ7 A;  3PR4 A;  2AQ0 A;  2JMG A;  3JPR A;  1XWL A;  1V85 A;  5KFK A;  1ZD3 A;  1T94 A;  4UW9 A;  5CRX A;  2XGQ A;  1L3V A;  3FDS A;  3TAC B;  3V7L A;  2ZJ8 A;  4BDP A;  3V6K A;  1NJZ A;  5EE1 A;  3PML A;  1KSP A;  1Z4N A;  1PK3 A;  4M6W B;  4Q8E A;  3AQE A;  5DG7 A;  4IR9 A;  2KG5 A;  3WKC A;  5EWE A;  2WF5 A;  2FMQ A;  2GOL A;  4MEX A;  4IL6 U;  4PHE A;  2R8J A;  1RXV A;  1ZQB A;  5DBA A;  4QZA A;  3ISC A;  1XO1 A;  5KNI A;  3MC1 A;  2Y1J A;  2NYV A;  2KHV A;  4NV0 A;  4F8R A;  3BQ2 A;  2KVS A;  1NK7 A;  9ICK A;  2JXJ A;  1NZB A;  8ICK A;  3E0F A;  4RT3 A;  2AXT U;  4DSK A;  8ICO A;  3Q8P B;  3M9N B;  2EAN A;  3MGI A;  1HUZ A;  4JUZ A;  5BOL A;  4EEK A;  4DSL A;  3PMN A;  4DL7 A;  2ZIV B;  2F76 X;  4RQ2 A;  1Q8K A;  2ZXI A;  2EH9 A;  3IN5 A;  3BQ0 A;  1Z1V A;  4QZG A;  3FAH A;  5J29 A;  2KEY A;  5CA7 A;  4F71 A;  4F5Q A;  2XC9 A;  5F3X B;  5IIJ A;  4QWA A;  4QZ9 A;  5ALV A;  1SWV A;  4LJX A;  3WKD A;  4IS7 A;  2H3V A;  3QZ7 A;  2MAX A;  5AI9 A;  3IRU A;  3QU2 A;  4CF4 A;  2VA2 A;  3L3F X;  5ALM A;  2F1I A;  5ALD A;  1N63 A;  4R63 A;  1ZYQ A;  3BDP A;  5J2B A;  4KLH A;  1P7D A;  1BPB A;  5KFI A;  1TAQ A;  3ZD9 A;  3QE9 Y;  4MHV A;  4UBB A;  2MUT B;  9ICU A;  2ISO A;  5KFY A;  1DGS A;  3EZ5 A;  8ICU A;  1X66 A;  2AU0 A;  1JXL A;  5JRT A;  4Z6E A;  3B9J A;  1ZQJ A;  4J9Q A;  1CRX A;  3AU2 A;  2ZUC A;  4Y2J A;  4PGX A;  2F2A B;  2KIW A;  2KFZ A;  4ELU A;  3PW2 A;  4I2C A;  4F91 B;  4C8M A;  4PHA A;  1DGJ A;  1YZ6 A;  3SMV A;  5III A;  3EWA A;  3PW4 A;  3PV8 A;  2LYH A;  3AUO A;  2OWO A;  3M9O B;  4TUS A;  3MR3 A;  9ICC A;  1NK9 A;  5AM1 A;  3SZ2 A;  4M9G A;  1ZOL A;  4P0P B;  2EAP A;  2JH1 A;  2BQ3 A;  1BPE A;  5DBC A;  2QKQ A;  1JX4 A;  3C1Y A;  2QB0 B;  4EYH B;  1UT8 A;  1T8E A;  2BCR A;  8ICQ A;  2KMD A;  2YML A;  4KLF A;  4J9N A;  2M9N A;  4Y2P A;  1XSP A;  3FYH A;  3JPN A;  4GFJ A;  3MDA A;  5KG4 A;  1JAL A;  4O3R A;  1MSW D;  2ZIU B;  3PZP A;  4TQR A;  2EAM A;  4YP3 A;  3PW7 A;  5G5G A;  2LM1 A;  3F53 A;  1V38 A;  5ALG A;  5DGA A;  2ZUD A;  8ICN A;  5AKE A;  3J81 j;  4DLE A;  4IC9 A;  1NK5 A;  4QWC A;  1B22 A;  4K4G A;  2I1Q A;  1D9F A;  2HBK A;  3RRG A;  5ALT A;  1MQ2 A;  2WHE A;  4I2F A;  3GV5 B;  2MSN A;  3TAR A;  2YB1 A;  2G5H B;  4C7Y A;  4R66 A;  2LM4 A;  2BDP A;  2G07 A;  4OCZ A;  4EBE A;  1DK3 A;  4WJ3 B;  1QTM A;  2F1J A;  5KFX A;  3QEA Z;  1F0M A;  2YQE A;  9ICX A;  3ONN A;  4YXJ A;  1KN5 A;  1NJY A;  5AKG A;  5EWF A;  3KKA C;  4C80 A;  4ED7 A;  1Z00 A;  2XID A;  2NRW A;  2JRZ A;  3WKA A;  4UAR A;  3PO5 A;  1PK1 B;  1D8Y A;  1T7P A;  5ALY A;  3N7R C;  4DFJ A;  4IRC A;  3HP6 A;  4EEL A;  2QAR B;  4CDG A;  5J8Y A;  3M9M B;  3N28 A;  3UXN A;  1ZRM A;  1S77 D;  2LHT A;  2YTU A;  4P0Q A;  4KLS A;  8ICT A;  5AKK A;  2XCA A;  2KZ3 A;  4B9V A;  5CP2 A;  8ICF A;  1RYR A;  2Q4T A;  5CHG A;  3MGV A;  2Y1I A;  2K4I A;  4F93 B;  4MFC A;  4UB2 A;  3ZDB A;  9ICV A;  3LK9 A;  2Y0S C;  4KX5 A;  2RLT A;  2F8L A;  3OJS A;  2BDU A;  5J0W A;  9ICT A;  2BHN A;  2EAO A;  4F3O A;  4FZM A;  5KFJ A;  5L1J A;  2W55 A;  3MFH A;  3C5F A;  1S76 D;  4UB6 U;  4GC6 A;  3QNM A;  4YMO A;  2L5Y A;  4C8N A;  5J2G A;  1KTQ A;  4M9J A;  4R8U A;  4P4M A;  2YX8 A;  4MFF A;  2AGQ A;  3QZ8 A;  4GLX A;  4EEN A;  2ZIW A;  5AK5 A;  2OXO A;  3LVV A;  2E5S A;  2ATL A;  2IOF A;  1WWV A;  5IIN A;  2DKX A;  3JPT A;  3SAH A;  1COK A;  3UXO A;  1ZJM A;  4UB5 A;  4DSF A;  4ECS A;  1RQN A;  2YY6 A;  1T3Q A;  1NNL A;  2C2D A;  1BNO A;  2PMZ F;  3ZDE A;  3OPX A;  4OJP A;  1N5X A;  3MFI A;  4BWJ A;  3AM9 A;  5L1L A;  5J2K A;  2ZG6 A;  1JXE A;  3OGU A;  3C29 A;  5CR0 A;  2HVI A;  5AM2 A;  5HHH A;  2R8K A;  3CYM A;  5DLG A;  4Y2V A;  2WF9 A;  4YVZ A;  4GXI A;  4EBC A;  5CJ7 A;  1ZQX A;  4KIT B;  4C4S A;  3IG8 A;  2H3Z A;  2QLT A;  2OEH A;  2P66 A;  2DKZ A;  4K4H A;  4U6P A;  2W8L A;  2FI1 A;  2WF7 A;  1L5U A;  4RQ1 A;  4P4P A;  8ICJ A;  4MFA A;  3H7I A;  5DG9 A;  3EYZ A;  1IXR A;  3K1Z A;  3SV4 A;  5J0R A;  4GIB A;  5KFD A;  3HX0 A;  1A0P A;  1JMS A;  2EZZ A;  1TKD A;  2ZUB A;  2KSO A;  1WYG A;  3QU9 A;  1SGG A;  3GV7 B;  4TQS A;  5TZV A;  2GH1 A;  1L3T A;  2PFP A;  1S5L U;  2W9M A;  4UAS A;  5KFS A;  2ZIX B;  4DO9 A;  4IRD A;  4I2B A;  8ICW A;  4OJ6 A;  3SAG A;  5KFA A;  9ICE A;  3KHR A;  5BPC A;  3VCB A;  3PVX A;  3E58 A;  3LYS A;  1SKS A;  5F9L A;  3K1R B;  1L7O A;  2CRX A;  2KZM A;  4QZ8 A;  1ZQL A;  5KT4 A;  2AQ4 A;  2BQU A;  2RRD A;  5DBB A;  3C28 A;  2RP5 A;  4KLO A;  3WKB A;  3WK7 A;  1XC9 A;  1YT3 A;  4QWB A;  2JH7 A;  2R8G A;  1KL9 A;  4C4R A;  4Z6D A;  2D8C A;  3NRZ A;  4O5K A;  5DB9 A;  1U47 A;  2NO5 A;  1WG8 A;  7ICL A;  4ECZ A;  4IQV A;  1X40 A;  4LVS A;  4C7Z A;  4LZD A;  3JPO A;  5L1K A;  2JEI A;  1TV9 A;  4FZN A;  3GQC A;  5KFO A;  5AIB A;  2F8K A;  1HJP A;  4UB3 A;  4E0D A;  5FP0 A;  2W03 A;  1NK6 A;  1L7P A;  4CF3 A;  2MU2 A;  2A19 A;  2DPJ A;  1ED1 A;  3BQ7 A;  3AN1 A;  3WK6 A;  3IHQ B;  3RJI A;  1J2N A;  3ZDC A;  3SEN A;  2W9B A;  4DFK A;  1NJW A;  4C8L A;  4Y2R A;  4DSJ A;  2VKQ A;  4O3O A;  9ICL A;  4Q43 A;  4USA A;  1DK2 A;  4G3I A;  3R9K A;  3Q8S B;  1LV5 A;  3RR7 A;  3UMC A;  5DB6 A;  2BPG A;  2WFA A;  5J2C A;  1KFD A;  2YB4 A;  1VDV A;  5KFV A;  4K4I A;  2VA3 A;  5EE9 A;  1BPD A;  3BJY A;  2ODG A;  4UAU A;  3Q8K A;  1X9W A;  5CWR A;  3TAD A;  2MA1 A;  4NL9 C;  5C0Y A;  5KG3 A;  4ACO A;  3PR5 B;  1V9P A;  4ZH4 A;  2HHU A;  4O5E A;  1ZJN A;  2JGA A;  5ALS A;  5JU5 A;  3I76 A;  1J2M A;  2G5I B;  3MR6 A;  4YD1 A;  2BCU A;  3RAQ A;  1SV0 A;  1ZQF A;  1QH9 A;  3PST A;  4C0Z A;  4RQ7 A;  3AQF A;  5AKJ A;  5HMM A;  4DFD A;  3JPP A;  4I2I A;  2HMX A;  2W04 A;  1MC8 A;  2PFQ A;  3MGH A;  2ASJ A;  7ICM A;  3D2Q A;  2HW3 A;  3H4B A;  8ICZ A;  3T3F A;  3N4M B;  5ALP A;  1ARO P;  2E8O A;  1K5O A;  1KRP A;  4ECU A;  8ICY A;  5J0S A;  3GFK B;  4YMN A;  1BPX A;  4RU9 A;  1CEZ A;  1QQ6 A;  4DQQ A;  3RAX A;  1L7N A;  4NLB A;  1NK0 A;  1Z00 B;  4O3N A;  4NJ8 A;  3FC4 A;  3T79 A;  3HRD D;  4B9S A;  5ALZ A;  2W54 A;  4CCH A;  1MA7 A;  3BZC A;  2Z7J A;  2LMR A;  7ICR A;  4IQU A;  2C28 A;  3K4G A;  1IV8 A;  1SL1 A;  8ICL A;  2KJ9 A;  3CNH A;  2DWQ A;  4UAY A;  1UA1 A;  2P6U A;  2LI6 A;  1SV4 A;  3CW2 C;  5DB8 A;  3BS5 B;  4NM2 A;  2BGW A;  3GIM A;  3GDX A;  2ZJ5 A;  4B9U A;  2HI0 A;  3G6X A;  1S0O A;  3EUB 2;  3NS1 A;  4F50 A;  5AK4 A;  3UMB A;  2HHT A;  1MQ3 A;  2DGZ A;  5AI5 A;  2PI4 A;  2YMQ A;  3M7D A;  5HHI A;  3CRX A;  5J2F A;  3TI0 A;  2OYY A;  2HBL A;  4ELV A;  3TAN A;  4YN4 A;  1S8O A;  1X6I A;  1S10 A;  2IOF K;  4DSE A;  3O0F A;  4RQ5 A;  1X42 A;  1CI4 A;  4FE3 A;  1U49 A;  3ETL A;  5DB7 A;  2HHX A;  5DQG A;  5L1I A;  3LDA A;  2IMW P;  4R8U B;  4B9L A;  3H8J A;  3C2M A;  2G0A A;  3V7J A;  1C20 A;  2YMM A;  4QIW C;  4M47 A;  5J0Q A;  5DLF A;  3H40 A;  1ZD2 P;  2WAQ C;  3LVW A;  4ECX A;  5ALI A;  1KKX A;  5KFE A;  1ZQV A;  1FIQ A;  3UPQ A;  4QZB A;  4M9L A;  1ZQN A;  1MN8 A;  1X2I A;  4C8O A;  4RQ3 A;  5B66 U;  5TIS U;  5J0Y A;  2XVT A;  1ZD4 A;  2ZTD A;  7ICH A;  5KTQ A;  4NLK A;  4KMU A;  4ECQ A;  5IIL A;  5EWG A;  4R64 A;  2KD1 A;  5J0O A;  2KNJ A;  5ALO A;  3QU7 A;  2W9C A;  1RG6 A;  2Y0S F;  1K1Q A;  2H3F A;  4ED1 A;  2BQR A;  3F2D A;  3OJU A;  4Q45 A;  3HKZ C;  3KHH A;  5D46 A;  3TAP A;  2JZB B;  1FFU A;  3KHG A;  4DQI A;  4I2A A;  1ZQU A;  3LWL A;  1TAM A;  4Q44 A;  1L8L A;  5D4B A;  3T5J A;  4MEY A;  4GXJ A;  4QWD A;  4KLU A;  3IV6 A;  4RQ8 A;  1KFS A;  3N7S C;  4QZC A;  3RB4 A;  5KT7 A;  3H8S A;  2E1E A;  3GV8 B;  1Z1B A;  1QSS A;  1PVQ A;  3AU6 A;  1TK5 A;  2PFN A;  2HHQ A;  2JEJ A;  2W3R A;  4DWI A;  1ZQS A;  2W9A A;  1ZQT A;  1TE2 A;  4KLQ A;  3SV3 A;  1SZH A;  3V6J A;  5KFL A;  2RHF A;  3EPI A;  3RH5 A;  2P35 A;  4M0A A;  3PW0 A;  1HUO A;  3TFS A;  3C2L A;  1KDH A;  4RUA A;  3HJE A;  4ED6 A;  7ICQ A;  3Q8L A;  5AKX A;  9ICA A;  4QWE A;  8ICR A;  2NRV A;  2JR5 A;  2BCS A;  3TAQ A;  4PHP A;  4DL2 A;  4KLI A;  4Z6F A;  4NLZ A;  4M9N A;  5KG5 A;  5J2A A;  1TFR A;  3H4D A;  1S0V A;  2GWS A;  1QSL A;  2EZX A;  4P2H A;  8ICI A;  4FO6 A;  2E8M A;  2UVR A;  4JK1 A;  1KQQ A;  2K4P A;  2A1J B;  4M6W A;  2EDU A;  3E2E A;  2DQN B;  4FBT A;  2PXI A;  1ZQQ A;  2W9B B;  2KTQ A;  9ICF A;  4F4W A;  3MBY A;  1SXD A;  2CXY A;  4TUR A;  5DQH A;  5G5H A;  1HIW A;  2R18 A;  3KKA A;  4BXO B;  1VLB A;  4RPX A;  2EZY A;  2D3D A;  1XU4 A;  4CGZ A;  1F44 A;  3F5A A;  7ICI A;  2BCV A;  2ZJA A;  3RB3 A;  2ZIV A;  4KX3 A;  3ED5 A;  5KFC A;  3PW5 A;  3CP8 A;  5AI6 A;  2H3Q A;  1IIP A;  3F2C A;  5J2H A;  5AKH A;  4KLM A;  3MR5 A;  7ICJ A;  4QZI A;  9ICP A;  1XSN A;  5KAF U;  4PGY A;  1IG6 A;  4F5R A;  4PGQ A;  3B0Y A;  3PX4 A;  3BQT A;  3EW9 A;  2ZTC A;  2FLP A;  2LYB A;  3AMZ A;  4Y2S A;  3HIL A;  5F9N A;  7ICP A;  2JV3 A;  4HAI A;  9ICI A;  2KKV A;  2VAN A;  2J6U A;  5ALL A;  4AYB C;  3QU4 A;  3PX6 A;  4KLG A;  2VJ5 A;  2MUT A;  2JEF A;  2ZXH A;  3RJJ A;  3TQ1 A;  4JV1 A;  7ICK A;  3QUB A;  4KTQ A;  1KBU A;  2FMS A;  1Q46 A;  7ICO A;  2V9W A;  3NRW A;  2PFO A;  4QW9 A;  2A3V A;  1LKY A;  9ICH A;  3THV A;  4NXZ A;  3UM9 A;  4QZH A;  2KN7 A;  1YZ7 A;  1JRP A;  4I2J A;  3RB0 A;  4BJQ A;  1ZQE A;  1B4F A;  1SL0 A;  3Q8R B;  3DEE A;  1N61 A;  1ZQR A;  2I9G A;  3UXP A;  2ES6 A;  3QUQ A;  1U4B A;  1WWU A;  2ALZ A;  3WKE A;  3GU3 A;  3F2B A;  3RH6 A;  4EZ9 A;  1DRG A;  4Y2T A;  5AM3 A;  2OH2 A;  4Z6C A;  3IP4 B;  3N7P D;  2K89 A;  4F92 B;  1O08 A;  4OJL A;  7ICN A;  1A76 A;  1V97 A;  1U48 A;  2B6G A;  3SAF A;  2J6S A;  3KBB A;  2ESE A;  4O3Q A;  5AHX A;  1TK0 A;  1TK8 A;  2HBM A;  4CRX A;  5HNK A;  5KG0 A;  3G6Y A;  1XSL A;  4YFK A;  2HSZ A;  5AI4 A;  3MR2 A;  1UT5 A;  1BVS A;  1U9L A;  4F5O A;  1TVA A;  5T14 A;  3QEB Z;  2HDO A;  1N5W A;  4JWN A;  4CE6 A;  3IG5 A;  4DL6 A;  1ZRN A;  5KT3 A;  1NKE A;  1Z4O A;  4IQT A;  3IDW A;  4CNQ A;  2FPK A;  4O3P A;  2F3N A;  3RTV A;  2XY5 A;  5KFQ A;  3HWT A;  3M8S A;  3OSN A;  2F1H A;  5DQI A;  5GTH U;  1L3S A;  4F4X A;  5KFF A;  3RJF A;  4BGD A;  3ZD8 A;  1DXS A;  5KFR A;  4ED2 A;  2HBJ A;  2OHF A;  2K8C B;  4DF8 A;  5CB1 A;  3FM9 A;  2AJQ A;  2VA8 A;  1O03 A;  1S0N A;  2RDJ A;  4M04 A;  1RZT A;  4MF2 A;  1PK1 A;  4XA5 A;  9ICS A;  4RPZ A;  4DQP A;  2G08 A;  3EPG A;  4RZR A;  4HYK A;  4XRH A;  2QAR A;  4PH5 A;  4NLC A;  1J97 A;  4DLG A;  2P6R A;  1ECW A;  2KIC A;  1WCN A;  1B0X A;  2OCE A;  4QIW F;  2DPI A;  2HOF A;  4U7C A;  3C23 A;  2NO4 A;  4BWM A;  1NJX A;  9ICG A;  4O5C A;  1UPH A;  4DSI A;  1H38 A;  2WAQ F;  3WK4 A;  4UB4 A;  5KG6 A;  3H8M A;  1QCK A;  1N2X A;  4F4Y A;  4US8 A;  2KK0 A;  2KJ8 A;  4BX9 C;  5KT2 A;  7ICV A;  1BGX T;  1L3U A;  1ZQA A;  2KE7 A;  5AIA A;  1NK4 A;  8ICB A;  3KTQ A;  1X9S A;  3PSI A;  2K60 A;  4RQN A;  3VC8 A;  1N60 A;  3ALR A;  2WTF A;  4EZ6 A;  4QZE A;  2KV2 A;  4OO1 J;  4YQW A;  2DFL A;  5C5J A;  3T5L A;  2MRL A;  4EX6 A;  4J9S A;  1UHU A;  3PO4 A;  5KFB A;  2RDI A;  2KFN A;  2NRZ A;  3V72 A;  3ICX A;  1SKR A;  3JPS A;  4KN4 A;  5DG8 A;  2C2E A;  4B9T A;  5KG2 A;  4KN7 A;  1KLN A;  3HKZ F;  3SR6 A;  5J2I A;  2IHM A;  2HHS A;  5D49 A;  2E3T A;  3H0L B; 
#chains in the Genus database with same CATH homology
 3SQI A;  2Y0S C;  2YB4 A;  4KX5 A;  2ZIU B;  3DEE A;  3PZP A;  2F8L A;  3RFA A;  2HBJ A;  2NV3 A;  2LKY A;  2M0N A;  5KL1 B;  2DGZ A;  2BDU A;  2GH1 A;  2K8C B;  2WB1 F;  3F53 A;  2N1R A;  1TAM A;  1HIW A;  3M7D A;  3CRX A;  1P7D A;  2R18 A;  4FZM A;  4PL1 A;  1L6N A;  5KL8 B;  2KKP A;  2JMG A;  2OYY A;  2CPR A;  2XI9 A;  2WB1 C;  2MA1 A;  4IC9 A;  2HBL A;  4CGZ A;  1T94 A;  3N7S C;  2ZIX B;  3GZF A;  1F44 A;  4O3M A;  3KFU F;  4OJ6 A;  3GU3 A;  2W7P A;  3F5A A;  5A0L A;  3F2B A;  3SAG A;  5CRX A;  1DRG A;  4P0Q B;  2G08 A;  5C0Y A;  4ACO A;  4QNL A;  1Z19 A;  3M6K A;  3VCB A;  2OH2 A;  3LYS A;  1HEK A;  2HBK A;  2E1E A;  2ZIV A;  4KX3 A;  2K8A A;  2YX8 A;  4NLC A;  1Z1B A;  2LBO A;  3CP8 A;  3IP4 B;  1PVQ A;  3N7P D;  2K89 A;  2D6F C;  2H3Q A;  1PVR A;  2OM6 A;  3O0F A;  2CRX A;  1IIP A;  2ZIW A;  3F2C A;  1D8B A;  4OJL A;  2VIX A;  2OXO A;  1ECW A;  4FE3 A;  2KIC A;  2KOB A;  3LVV A;  2E5S A;  2RRD A;  3C28 A;  3SAF A;  2JGA A;  2RP5 A;  3AQE A;  1PVP A;  1CRX A;  2YB1 A;  2G5H B;  4OJ5 A;  1XNS A;  2KJ5 A;  1SZH A;  1YT3 A;  3KZX A;  2G5I B;  2DF4 B;  2G07 A;  4QIW F;  4BUG A;  3SAH A;  4U7C A;  2HOF A;  2JH7 A;  2RHF A;  1A6S A;  3F5E A;  4PL2 A;  2F2A B;  4WJ3 B;  2GOL A;  2HBM A;  2KIW A;  2E1F A;  2G0A A;  3PST A;  4C0Z A;  4CRX A;  3AQF A;  1UPH A;  3NUQ A;  4QIW C;  3ONN A;  2WAQ F;  4NWI A;  2G06 A;  2PMZ F;  2HMX A;  2G09 A;  2W04 A;  2LYA A;  3M6Z A;  2KHV A;  2LYB A;  3OPX A;  4NV0 A;  4OJP A;  4P0P A;  3SMV A;  2F77 X;  1NZB A;  2XIC A;  2KJ8 A;  2WAQ C;  3E0F A;  3LVW A;  2PMZ C;  2K4H A;  2XID A;  3D2Q A;  4OJO A;  5T14 A;  4BX9 C;  2ZG6 A;  4AYB F;  3C29 A;  4KMO B;  1GO3 F;  3D2N A;  2KKV A;  4JMU A;  3CYM A;  3IG5 A;  3RF9 A;  1ZQ1 C;  3N7R C;  1XO0 A;  2VJ4 A;  4AYB C;  4FZN A;  5HR7 A;  1URJ A;  2ZIV B;  3PSI A;  3VC8 A;  4CDG A;  2K8B B;  2F76 X;  4QJF B;  3ALR A;  2W03 A;  1Q3V A;  1WUD A;  2HOI A;  2ZXI A;  3IG8 A;  3IN5 A;  2H3Z A;  4P0P B;  2JH1 A;  2KV2 A;  1Q3U A;  2LHT A;  2VJ5 A;  2ZIW B;  4NLB A;  4OO1 J;  3AL0 B;  2ZIX A;  2ZXH A;  1ED1 A;  3PSP A;  3T79 A;  2XVT A;  3H0M B;  4ICA A;  4P0Q A;  4U6P A;  2MRL A;  1KBU A;  1MA7 A;  3NRW A;  2Z7J A;  2KEY A;  3H0R B;  2ZIU A;  4FZL A;  4A8E A;  3ICX A;  2W7O A;  2KJ9 A;  3K1Z A;  1OUQ A;  2VKQ A;  2KHQ A;  2KD1 A;  2A3V A;  2CN1 A;  2H3V A;  2KNJ A;  2HOQ A;  2Q4T A;  3PSF A;  2KVC A;  3HKZ F;  2K4E A;  3MGV A;  3D2S A;  2K4I A;  1A0P A;  2DQN B;  2Y0S F;  4GFJ A;  2H3F A;  2JHD A;  5HR6 A;  3F2D A;  3H0L B;  4BJQ A;  3HKZ C;  2H3I A;  3L3F X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...