3N7SC

Crystal structure of the ectodomain complex of the cgrp receptor, a class-b gpcr, reveals the site of drug antagonism
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
91
structure length
91
Chain Sequence
ACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcitonin gene-related peptide type 1 receptor
publication title Crystal Structure of the Ectodomain Complex of the CGRP Receptor, a Class-B GPCR, Reveals the Site of Drug Antagonism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 27
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3n7sC00
2XVTA 3AQFA 3N7SC 2YX8A 3AQEA 3N7RC 3N7PD
chains in the Genus database with same CATH superfamily
5KFGA 1NNLA 5EWEA 4DSKA 4CF4A 5AKHA 7ICQA 4Y2YA 2XY6A 8ICXA 4KN4A 2RHFA 3PMLA 4KLIA 3UMBA 1SL0A 5D49A 3HJEA 4Z6DA 4P0QA 2R8KA 8ICBA 5JTIA 5ALNA 5GTIU 1L3VA 2VA8A 2W9BA 5ALKA 3RBDA 4C8KA 4NXZA 2HI0A 4KLGA 2PFQA 4ED1A 4RNNA 3H4DA 3PY8A 3ORYA 5J8YC 3K1ZA 4G9BA 5KG0A 3IM1A 4J9SA 4BGDA 2OM6A 3RRGA 2B21A 3BS5A 4UBCA 2GLEA 4KLOA 3LWMA 4RNOA 3M9NB 2R18A 4BDPA 4F5NA 1WG8A 4I2JA 3DEEA 1KTQA 4I2DA 5KFTA 1X6IA 3C1ZA 5CHGA 4XA5A 4AYBC 1V38A 9ICWA 1BPEA 1ED1A 4RQ5A 3GU3A 1S10A 4PGXA 1ZQLA 2OHFA 5EE1A 4ZH4A 3HX0A 2ZIUB 4RQ6A 2KVSA 2W54A 3KHRA 4R8UB 2W7PA 3QU4A 5ALHA 5AM0A 4YVZA 4UB5A 2QLTA 1D8YA 2KKPA 5AI5A 2BCSA 4FS2A 5J0SA 3PR5B 1HEKA 1N48A 3B0XA 5IILA 5J0TA 1KRPA 2E1EA 2Y9UA 2DQNB 1Z4NA 9ICAA 2DF4B 4UQGA 2KN7A 1QSSA 2V4RA 2FDRA 3Q8MA 3QUQA 5ALRA 3HP6A 4F4WA 4QZ8A 8ICHA 1HJPA 1T4GA 2KIVA 2H3FA 3NVWA 3E58A 4Q43A 1TK0A 4Q45A 2MA1A 1KSPA 1T8EA 4EZ6A 4R65A 4M9JA 5JUMA 4B9LA 4EYHB 1BPDA 4P4OA 5H2FU 5KFUA 1OW5A 2W8LA 1ZQEA 1S0VA 4B6JA 7ICRA 1Z3EB 2A1JB 1B43A 1SGGA 1T3NA 4O5EA 1X9SA 1ZQTA 3RH4A 4ED0A 4B9TA 3FM9A 3UPQA 3C2MA 3RBEA 5F9LA 5J0QA 2CN1A 3RB0A 3UMCA 2WB1C 1HUOA 1XC9A 4RQ7A 5J0PA 5BOMA 1DK2A 3ZDBA 5AK3A 2KTQA 8ICYA 3KTQA 2G5HB 2KOBA 2JXJA 4OJLA 1A76A 2A1AA 4ECXA 4KMUA 2VA2A 3RJJA 2MSNA 4R63A 1Q8KA 4NJ8A 4KMOB 2V9WA 3HKZC 3ISBA 3MR2A 7ICVA 4F5OA 4BUGA 1SWVA 5KFEA 2NRZA 4I2EA 5J2DA 4M9LA 2H5XA 4DL5A 2JEJA 5ALEA 1Q46A 5J0RA 5L1MA 2YQEA 3QEBZ 4C0ZA 5IIJA 3RAQA 4TURA 4FZMA 1LVHA 4QW8A 4UB1A 1MA7A 1JIHA 3G6YA 8ICCA 4ECUA 3SI8A 4I2BA 1HUZA 2JH7A 5KAIU 1ECWA 1U4BA 3A0HU 1C20A 4B9VA 2R8HA 2OWOA 4IQWA 4EBEA 1KFSA 5KNIA 5AHXA 5AK4A 4KLSA 1COOA 4DF4A 3GFKB 4FS1A 4J03A 3RJGA 7ICFA 2G0AA 4DQQA 4KLMA 5DQGA 5ALPA 5B66U 2NRXA 5J0WA 2NO5A 3NS1A 4RQNA 4UB3A 3JPTA 2KK0A 5CB1A 1XSLA 4BJQA 5AKZA 3N7PD 4KITB 4MEXA 8ICRA 1GO3F 4Y2SA 1VLBA 4M6WB 4DSIA 2AHOB 2EAMA 3WU2U 3M6ZA 2QB1A 4UAYA 3B9JA 2OXOA 3HRDD 4RQ8A 4IR1A 1TFRA 5HMLA 3JPOA 3I76A 1X9WA 1ZQVA 1VDVA 2EZZA 4YG2A 2N1RA 3KKAC 4UB4A 5BOLA 4I2IA 3U26A 3THVA 1X2IA 4RQ2A 1PK3A 4QZBA 3WKEA 4ECQA 4J9NA 2GWSA 2YMLA 4DL3A 4CE6A 2KD1A 3WK4A 3RH6A 2G09A 5KG2A 2ES6A 4EX7A 2A1JA 3N97B 2YB1A 4ELUA 3SEIA 4KLDA 2K4HA 1TAUA 2JMGA 3N28A 3WK7A 2RLTA 2K8BB 1M6YA 2VJ4A 4NWIA 1KL9A 9ICGA 3RR8A 4RQMA 4PZNA 1NI3A 3QU2A 2K89A 3OJSA 3RB4A 5CR0A 4LZGA 4AP9A 3BQ1A 4CNQA 3DDHA 1XSPA 4F5QA 5AI9A 1X9MA 2OEHA 1NJZA 4HAIA 5ALGA 2BCQA 3GIJA 4FBUA 5KFYA 3TAQA 4RPZA 7ICGA 1UCVA 4F5RA 3LVVA 3NVVA 1Z00B 3OSPA 2PMZF 1SKSA 4RQ4A 4O3MA 3IP4B 1Z4OA 1PZNA 3Q8QB 4ECTA 3PX0A 2DWQA 9ICCA 4UBBA 5KG4A 4UATA 5KFFA 4J9PA 4DFJA 2KEYA 4RNMA 3IG5A 1KEJA 3WK8A 2IHMA 3S6JA 4U6PA 3C2KA 5BPCA 1N2XA 2KNJA 3F5AA 3VCBA 2KZZA 4JMUA 3SENA 2UVVA 1ZQPA 1RXVA 5HR7A 3NVYA 4GXKA 1FO4A 3LDAA 1QLNA 3V6HA 2E8PA 4IQTA 5CWRA 2W7OA 3PW5A 4TUPA 8ICNA 1L8LA 3BQ0A 2YY6A 5F9NA 1LKYB 1FEZA 4EBDA 3BDPA 3T3FA 5KG6A 2Y0SC 4DLEA 2G07A 3C5GA 2XO7A 2WHEA 2D8CA 1ZQNA 5J2CA 4ELTA 1XWLA 5DBAA 3AMZA 3M9MB 3RJEA 1SL2A 2PFNA 4E0DA 3Q8SB 4DO9A 5TISU 3ISDA 2LYBA 4PHAA 4C8LA 1T7PA 2DBYA 3BS5B 4PGQA 3MDCA 1O03A 3PMNA 1KKXA 2FMPA 2WF9A 3IRUA 2ISOA 3BZCA 1BGXT 5EOZA 1IXRA 3K1RB 4DOAA 1L3SA 3AL0B 1TKDA 1KLNA 4MF2A 8ICAA 4MFFA 4NLNA 2BCVA 3QZ8A 2LKYA 4FO6A 4F72A 4UASA 2GOLA 4I2CA 4XQ8A 2RDIA 1WCLA 1QQ7A 7ICOA 2KHQA 3PO4A 1BPYA 1K5OA 3ZDEA 1ZETA 5JRTA 2YMPA 3QUBA 2M9NA 5GTHU 3MR6A 2ZTDA 4IS7A 1X40A 1B22A 4RZRA 2PFOA 5DB7A 2AQ4A 1LB2B 2ZIVA 2ZTCA 5IIMA 3WKAA 1MQ3A 4O3OA 4F2RA 5KFPA 1KW4A 4HYKA 1C7YA 5J2AA 3D2QA 1JUDA 4WJ3B 3ONNA 3WK6A 2KE7A 3LK9A 4F4XA 3M7DA 3KZXA 3NRWA 2FLNA 2F1HA 3JPQA 3I28A 5CP2A 4KTQA 4O3RA 3OHBA 5DDYA 5HR6A 2EDUA 3M8RA 3AM9A 9ICLA 1N62A 5ALQA 4F3OA 4J9LA 4OJOA 5G5GA 5J0YA 2Y1IA 4C7YA 4EX6A 3KHLA 3EW9A 3D2NA 1N56A 1JMSA 4QWDA 1SV4A 1RXWA 3RJKA 5EWFA 4O9MA 2JHDA 4DFMA 2ZTEA 4I28A 2ZIWB 1WYGA 1L3UA 4LJXA 1LKYA 3AEVA 4FFDA 5DLFA 1FFUA 1RZTA 2YB4A 2Z7JA 4M9NA 5KFZA 4O5KA 4Y2PA 4M47A 2H3IA 1SZPA 5EE0A 4EELA 5A0LA 4FBTA 4I2AA 2HVHA 3EYZA 3IDWA 4K4HA 3Q8KA 4DSJA 4J9RA 3D6JA 3HT3A 4KX3A 5ALOA 2KFZA 1U47A 4RT2A 3GQCA 4DL2A 2KV2A 3H0MB 2KSOA 2ZIXB 5DBCA 3Q8RB 1XSNA 1N5WA 2DPIA 5E79U 2R8JA 1L8OA 5J2EA 5DGAA 2ALZA 4QZDA 5D4BA 4DWIA 4DSEA 1ZD4A 2EAOA 2LYHA 4RU9A 4B9MA 5KT6A 5KG3A 3PX4A 5DG9A 2Y1JA 4BXOB 9ICJA 4MEYA 9ICXA 1ZD2P 4DFPA 4KLLA 2HHUA 2HHWA 4YN4A 4XUSA 3BS7A 2AGOA 2YTUA 2XY5A 1N5XA 3AQFA 4OCZA 2HBLA 4IRKA 4QWAA 5T14A 2BPCA 3LWLA 2W8KA 5KFCA 4GIBA 2V4QA 2XI9A 2PXIA 5DGBA 3EPGA 2C28A 4PH5A 2DGZA 1JX4A 3GIMA 3NVZA 2F44A 2WF7A 2W04A 4IC9A 4MFAA 3NGDA 4ED3A 3AU2A 3H7IA 4CF5A 4DFDA 2KG5A 3RJIA 4IL6U 3EWAA 3QYPA 1L7NA 3PW2A 2H3VA 4K4GA 2XICA 3RB3A 4C4RA 3TADA 4NLZA 2G08A 4MHVA 2UVUA 1V85A 3N4MB 1NJYA 4GLXA 3EUB2 4ELVA 4EYIB 4O5CA 8ICLA 5AM2A 4J9OA 4B9SA 1S8OA 2BPGA 2YMMA 3AUOA 2K4EA 3V6JA 5KFWA 2J6SA 2W9CA 5AK6A 2XVTA 3QUCA 2UVRA 3M1YA 4YQWA 3E2EA 1D8BA 4AYBF 3BQTA 2XGQA 4UW9A 5KG7A 2W11A 1RQLA 2A19A 3WKBA 1H38A 3H8MA 3EZ5A 8ICTA 3PW4A 5KT7A 5HP4A 4NV0A 2AQ0A 8ICIA 9ICQA 4F4ZA 4GXIA 2ZIWA 1D9FA 2HVIA 5AM4A 5J2BA 7ICTA 1RYRA 4KLEA 3QNMA 5KFQA 2ATLA 2HOQA 1T3QA 4C8NA 5KG5A 1K1QA 1ZQGA 2JGAA 3T5JA 5KFMA 3J81j 2ZUBA 4F5PA 3HWTA 1XNSA 2F1JA 1NKEA 5DDMA 2BGWA 3KD3A 1ZQKA 2ZIXA 1ZQDA 1SKRA 3KZIU 1BNOA 4C8MA 1PK1A 4C7ZA 5ALIA 1S0NA 2DKXA 4KN7A 2AGPA 4F93B 2C2EA 3C23A 2W03A 4NLKA 3MBYA 4BXOA 1ZQHA 4F4KA 4Q8FA 1N60A 5ALFA 3HPOA 3OHAA 2OCEA 5KTQA 3SR6A 3H8WA 3IHQB 4U7CA 5K4LA 1X66A 3JPRA 4TQRA 1CI4A 3LYSA 4MF8A 5EE3A 4C4SA 4NY8A 2P6UA 5J29A 3F2CA 2XCAA 5EWGA 3TACB 4JB3A 9ICMA 2LMRA 4Z6FA 2C2DA 2RRDA 3DV9A 7ICHA 1IM4A 4B9UA 2HCFA 4KX5A 2AH5A 1JROA 2LM1A 3BJYA 2ASJA 4O0IA 4JV1A 1ZQMA 1JXLA 5J2IA 3LVWA 2XY7A 2EAPA 4FZLA 5ALXA 3ZDCA 3MGVA 1WWVA 2WAQF 9ICPA 1L6NA 4DQSA 1QSYA 1ZQUA 3KHHA 4B9NA 2IOFK 4QZCA 4QNLA 2K60A 5KFLA 1BVSA 2ODGA 2BDUA 2Q4TA 3OTQA 2IOHA 1K1SA 2FPKA 3QXGA 4UB6U 2ESEA 3SQIA 4DL7A 3FAHA 2WTFA 7ICPA 4DSFA 2I5HA 1U49A 9ICEA 2RDJA 2EZYA 5ALWA 3QE9Y 2GO7A 3TQ1A 4IR9A 3RRHA 3E0FA 2OYYA 1UA0A 2FI1A 4JK1A 3M8SA 5J2FA 2KHVA 3T79A 3MGIA 4DL4A 5CJ7A 3UMGA 1DOQA 5DB9A 4O3PA 2NRTA 1S76D 3ED5A 4CRXA 4YFKA 2LBOA 1OXJA 2P66A 1NJWA 3G6XA 5KFDA 2VANA 1ZQBA 2J6TA 1DRGA 4J9MA 4FZNA 1F0MA 1Z1VA 1NK0A 1ZQZA 4P4MA 2JEIA 3GV5B 3RAXA 5ALDA 2HBMA 4UAWA 2ZIVB 1D9DA 2LPEA 3MABA 5KFOA 5CRXA 8ICQA 3PW0A 4KLFA 3RFAA 4NLCA 4RUCA 9ICHA 1NOMA 2W55A 1S97A 2IA6A 3SAFA 1KBUA 1S0MA 3TARA 2KVCA 1KQQA 3RR7A 2JZBA 1L7MA 1WCNA 3H0LB 3OJUA 3H0RB 4GC6A 2XC9A 4OO1J 8ICSA 3JPPA 2JH1A 1TVAA 1SB3C 4CDGA 2NRVA 1ZYQA 3QX7A 3QZ7A 4QZGA 3I1YA 2I6XA 4PJ0U 2ZJ8A 2FLLA 4QIWC 4Y2VA 3R9KA 3QU5A 4QZEA 3V7LA 3EPIA 2KKVA 1S5LU 2KJ5A 1NJXA 2C2RA 5KL8B 1ZQIA 3QU9A 3MR3A 5CA7A 1A0PA 3MR5A 2CPRA 2F8LA 3BZKA 3PZPA 5J2KA 4QWCA 9ICBA 5DBBA 1BPXA 2MUTB 2LHTA 2W43A 4M04A 1L5UA 2F3NA 2CXYA 5AI0A 1KFDA 5IIOA 4F71A 7ICSA 4GC7A 2KICA 4TUQA 3Q8PB 1TK8A 4FE3A 4YMOA 4IQVA 5KT3A 3ZDDA 4QWBA 2KSOB 1AROP 1HIWA 4CCHA 5KT4A 3PSIA 4NLGA 4IQUA 2BZFA 2HW3A 2RQ5A 4NM2A 4O3QA 4GFJA 1PVPA 1SXDA 5AK5A 4Y2JA 3BQ2A 2BCUA 8ICKA 2KZMA 4IRDA 8ICEA 1NKCA 5G5HA 1RYSA 4KLUA 2ZJ5A 3L4PA 1QH9A 4Q8EA 5KFIA 2HHXA 4RQ3A 2G06A 3KFUF 1T94A 3NRZA 3JPNA 1N61A 2YN4A 3K75D 2HHSA 5KFHA 1KFTA 2KJ8A 5L1LA 3F2BA 5KFRA 1JN3A 5HHIA 4CF3A 4ECVA 2Y0SF 3NUQA 1P7DA 2MRLA 1UA1A 3WK5A 4LZDA 3GILA 1LV5A 2VIXA 4RQ0A 5AKKA 3UXPA 3PNCA 5L1JA 1TV9A 4P0PB 4QZHA 2WF8A 4DFKA 4RPXA 2AGQA 4UAUA 1MSWD 1MN8A 2HHTA 3B0YA 2E1FA 4UB8U 3PO5A 3M6KA 3TFRA 4DL6A 2D6FC 1COKA 5AI6A 3F5EA 1J2MA 5CEHA 1XO1A 5KAFU 3F53A 4UAZA 2KP7A 1YZ7A 3ALRA 1QQ5A 4UARA 3IV6A 1PVRA 9ICUA 3T5LA 2VKQA 3WKDA 2BPFA 4I2FA 1AQ6A 2W9CB 2DKZA 3RB6A 9ICSA 5DG8A 5DQIA 2UVWA 4OJPA 1JXEA 5ALYA 3C28A 1UQVA 1X9XA 5J2GA 5TZVA 5J2JA 1OUQA 2B0CA 1NK8A 3UM9A 4I27A 1Q3UA 2GH1A 4PPXA 4ACOA 5HHHA 4Y2XA 3ICXA 2HBJA 2BQ3A 2MUTA 2MAXA 1ZQXA 4YMMA 5AM5A 4DF8A 1SWWA 5AKLA 2R8IA 4KLJA 4US8A 3NASA 4QW9A 2PI4A 5HNKA 4P2HA 5AI4A 1PK1B 3PR4A 1ZQCA 3K4GA 8ICZA 5J2HA 2QKQA 3CW2C 3MFIA 4OD0A 3M9OB 1NK7A 7ICLA 4YMNA 1ZQ1C 1EXNA 3BQ7A 3V6KA 3ETRA 2EH9A 5J0XA 2BKEA 4CGZA 3MGHA 3N7RC 1SXEA 2E8MA 2HDOA 2G5IB 2IOFA 2YMQA 2ASLA 2K8AA 2JRZA 3T5HA 4Z6CA 1XU4A 5L1KA 2MU2A 2E3TA 3CYMA 1SL1A 2F8KA 3AU6A 8ICMA 1SIJA 3HW8A 2K4PA 3OGUA 5IIKA 4NL9A 2DL0A 1ZQQA 4EEYA 4DS5A 2JEFA 5KG1A 2DUYA 2OH2A 4OJ6A 1ZQAA 1SV0A 4P0PA 4M9GA 5KFKA 1RQNA 4M0AA 1ZQJA 3D2SA 1U48A 2WFAA 2XCPA 5IIIA 4Y2RA 2DFLA 4DLGA 1TE2A 5AIBA 2BDPA 4ECWA 4DS4A 2E8OA 3H8SA 1U9LA 3TI0A 4F2SA 1KDHA 4ZOHC 5ALSA 2LM4A 5DB8A 2QB0B 5KT5A 2WF5A 3RTVA 1S77D 3F2DA 1NK5A 3CP8A 3KOOA 2EZXA 2EANA 3ZD8A 2VJ5A 3ZI4A 2JV3A 1X6JA 3CRXA 4BX9C 1V97A 2FPLA 2E8NA 4RUAA 5DQHA 1O08A 1ZJNA 3T5KA 4M9HA 1L3TA 2Y9TA 4M2YA 3ETLA 8ICUA 3MC1A 3ISCA 3A0BU 2F77X 4A8EA 2M0NA 4US9A 4UAVA 1J2NA 1DXSA 3PVXA 4JWNA 1Z1BA 2IMWP 4YR2A 5ALTA 1DGJA 2JR5A 4YP3A 3JPSA 2FMQA 2F76X 5DLGA 4YXJA 4YR3A 4I2GA 9ICIA 1B4FA 3GV7B 5EE9A 1RYUA 3CNHA 1QCKA 4QJFB 4QZFA 2ZXIA 5KT2A 4JV0A 2FE9A 4QZ9A 4DOCA 3G6VA 2CRXA 5KL1B 1JALA 4Y2QA 2HSZA 5FP0A 4DOBA 4PL1A 5AKEA 2IHNA 2JZBB 2W3SA 2NYVA 4F50A 2EQYA 1SZHA 2WAQC 3NTUA 4Q44A 4IRCA 5AM1A 3GDXA 9ICOA 5J0UA 4G3IA 8ICGA 9ICVA 4R64A 3SAGA 1B0XA 5AIAA 4P4PA 2DPJA 2KMDA 3TANA 2WB1F 3QU7A 2HHVA 3V7KA 1NK4A 5B5EU 2E5SA 2W3RA 1V9PA 4PHPA 3H4BA 1CRXA 3IN5A 1ZRNA 1UPHA 2H3ZA 4ECYA 2KIWA 2ZXHA 5AKGA 1S9FA 3RJFA 3UXNA 4ED7A 3C2LA 3O0FA 4TUSA 2ZIUA 2P35A 4PZOA 3TFSA 1URJA 3HKZF 4R8UA 4QZAA 2F2AB 5AICA 5L1IA 1RPLA 5J0OA 3RJHA 4ED6A 1ZRMA 2QB0A 1NZBA 1L7PA 1X42A 4RQ1A 5J8YA 2D3DA 5KFNA 4F4YA 1KN5A 1PUZA 4C80A 2R8GA 7ICMA 1JRPA 4ICAA 2I9GA 8ICVA 5ALVA 8ICJA 1NK9A 4PHEA 4YXMA 4R66A 4YD1A 3UQ2A 3QEAZ 9ICNA 3VC8A 3GZFA 4RPYA 2BR0A 3KBBA 1DK3A 4F91B 4Y2UA 4J9KA 2PMZC 5ALUA 3PX6A 4KLTA 2KZ3A 4J9QA 3TAPA 2AJQA 1ZOLA 1BPBA 1ZD5A 5JU5A 3L5KA 3WK9A 2A3VA 5D46A 1ZQRA 4PGYA 1QTMA 3PV8A 4F8RA 4ECZA 5C5JA 2ZG6A 5KFVA 4YCXA 3FDSA 2HOFA 2H3QA 3SYZA 3N7SC 3C5FA 1FFVA 3UXOA 3UQ0A 2XIDA 2K4IA 3WKCA 4XRHA 1F44A 3FC4A 3HILA 7ICEA 1A6SA 4NLBA 2PKEA 4BWJA 1Z19A 3TKAA 1NK6A 4MFCA 5AI8A 3AQEA 3RH5A 2PFPA 5AKIA 2QARB 1F5SA 3C1YA 3SZ2A 3MFHA 4RT3A 4JV2A 4ED8A 1IIPA 7ICJA 2ISPA 2VA3A 2AXTU 1ZQSA 4DSLA 4DQPA 1UT8A 4Z6EA 4X5VA 4O3SA 2HMXA 1FIQA 4F92B 1ZD3A 2BQRA 4DQRA 5HMMA 1D8LA 2L5YA 4USAA 5AKXA 3V72A 2BCRA 5L9XA 4KLQA 1UT5A 1NZPA 4C8OA 5F3XB 1YZ6A 2ZUCA 2C22A 4ECRA 1N63A 3C21A 4DEZA 4NL9C 4PHDA 2WF6A 3GV8B 1IG6A 2FLPA 3RF9A 4JUZA 2HHQA 1RDFA 3FYHA 3SD7A 3OPXA 1S0OA 2W9MA 5DB6A 1SV0C 7ICIA 2PI5A 2Q0ZX 4P0QB 5KFBA 2LYAA 8ICWA 7ICNA 1UHUA 3TADC 1J97A 4QZIA 8ICFA 1MC8A 1XO0A 2B6GA 4YR0A 3KHGA 5AKYA 3SAHA 2XGPA 1SKWA 1CUKA 1TAMA 3Q8LA 4M6WA 5ALJA 4DCCA 1MQ2A 2W9BB 2NO4A 4Y2TA 2FPMA 4C4TA 1RM6C 3L3FX 4ECSA 5IINA 9ICRA 4QIWF 2P6RA 2ASDA 5ALZA 1WUDA 3H40A 3SV4A 9ICFA 1RG6A 4O3NA 4BWMA 5DKWA 5KFJA 2KFNA 1WWUA 3H8JA 1ZQWA 3QUTA 2HBKA 1VJ5A 8ICOA 1YT3A 1BNPA 1NKBA 4K4IA 1IV8A 4UB2A 7ICKA 2IBKA 3GIIA 2F1IA 3PW7A 7ICUA 1ZQOA 1DGSA 1ZQYA 3OSNA 4EZ9A 4I2HA 2ZUDA 1XS9D 4ED2A 5ALLA 4EENA 1L7OA 3V7JA 5DG7A 1BPZA 1Y88A 3PSPA 1TK5A 4I29A 9ICKA 1U45A 4QWEA 3IG8A 3GIKA 2QARA 5KFSA 3PSTA 3C29A 4DQIA 4EEKA 5AKJA 8ICPA 4LVSA 1A77A 2O6KA 1ZXIA 2FJ6A 3ZDAA 2NV3A 3KKAA 5KFAA 1CEZA 1ZQFA 4PL2A 2NRWA 2JEGA 1QQ6A 5KFXA 2KJ9A 2FMSA 1Z00A 1TAQA 2LI6A 4YD2A 3AN1A 3MDAA 2J6UA 1PVQA 2W9AA 4EBCA 2ZJAA 5AM3A 1Q3VA 2AU0A 4TQSA 5C0YA 3SV3A 9ICTA 3ZD9A 3PSFA 2BQUA 5ALMA 1JI7A 4OJ5A 3SMVA 2RP5A 1ZJMA 2YX8A 2I1QA 2BHNA 1QSLA 4JWMA 2HOIA 4NM1A 4GXJA 4KLHA 2K8CB
chains in the Genus database with same CATH topology
2VIXA 4C0ZA 2G07A 2KIWA 4P0PB 1XNSA 2DGZA 2ZXHA 2KKVA 4FZMA 3SQIA 1ZQ1C 2KKPA 2K4HA 2ZIXA 1MA7A 3O0FA 2JMGA 2KJ5A 2ZIUA 1HEKA 2K8BB 2RHFA 2VJ4A 4NWIA 4CGZA 1IIPA 5HR6A 1URJA 2F77X 2HBKA 3HKZF 3N7RC 2W04A 2JH7A 4IC9A 4P0QA 5KL8B 2E1EA 2F2AB 2DQNB 2G5IB 1ECWA 1YT3A 2DF4B 2K89A 4A8EA 4OJOA 2M0NA 2K8AA 3E0FA 2E1FA 2OYYA 1A0PA 2W03A 3M6KA 2D6FC 2CPRA 2KHVA 2F8LA 3PZPA 3T79A 2HMXA 3F5EA 2LYBA 3D2NA 1NZBA 3CYMA 1Z1BA 2H3VA 3F53A 2LHTA 2XICA 4ICAA 2JHDA 3ALRA 2H3FA 2ZIWB 2G08A 4U7CA 2G0AA 2F76X 2MA1A 4CRXA 1PVRA 2KICA 2LBOA 2VKQA 3LYSA 4FE3A 3AL0B 3LVVA 3PSPA 2YB4A 2Z7JA 3K1ZA 3VC8A 3GZFA 1HIWA 4OJPA 3F2CA 3IG8A 4OJ6A 3C28A 2LKYA 4QJFB 2H3IA 2OH2A 5A0LA 2PMZF 2ZXIA 1DRGA 3PSIA 4P0PA 3PSTA 4FZNA 2OM6A 3C29A 2GOLA 4O3MA 3IP4B 2HBMA 2PMZC 1OUQA 4KX3A 4BJQA 3D2SA 2ZIVB 3N7PD 2K4EA 2R18A 3RF9A 4GFJA 2RRDA 1PVPA 1GO3F 5CRXA 2NV3A 2CRXA 2XVTA 2KHQA 2KV2A 3OPXA 3H0MB 4PL2A 5KL1B 2GH1A 1Q3UA 2ZIXB 2KEYA 3IG5A 4ACOA 2KJ9A 2CN1A 3M6ZA 3DEEA 4PL1A 3RFAA 4AYBF 1D8BA 4KX5A 2WB1C 4NLCA 2OXOA 3ICXA 2WAQC 1SZHA 4P0QB 4U6PA 2LYAA 2HBJA 4AYBC 2A3VA 1PVQA 4NV0A 2N1RA 2KNJA 1ED1A 3F5AA 2ZIVA 1XO0A 3SAHA 3VCBA 2G5HB 2ZIWA 4JMUA 1Q3VA 3SAFA 1TAMA 1KBUA 2KOBA 5HR7A 3SAGA 3GU3A 3LVWA 2KVCA 2ZG6A 2G06A 2HOFA 3KFUF 5C0YA 1T94A 4FZLA 4OJLA 3F2DA 2H3QA 3D2QA 3H0LB 3N7SC 3PSFA 2WB1F 3MGVA 3H0RB 2W7OA 4WJ3B 4OO1J 3CP8A 2XIDA 2WAQF 2K4IA 3ONNA 4OJ5A 2HOQA 2JH1A 3SMVA 1L6NA 3L3FX 2KJ8A 2KD1A 2RP5A 2E5SA 4CDGA 4KMOB 3F2BA 1F44A 2ZIUB 3AQFA 4QIWF 2HBLA 3HKZC 2YX8A 3M7DA 1WUDA 1A6SA 2G09A 5T14A 2Y0SF 4NLBA 1CRXA 2VJ5A 3IN5A 4BUGA 3NUQA 3KZXA 3NRWA 4QNLA 2MRLA 2W7PA 1P7DA 1UPHA 4BX9C 2XI9A 4QIWC 1Z19A 2HOIA 3CRXA 2H3ZA 2BDUA 2JGAA 2K8CB 2Q4TA 3AQEA 2Y0SC 2YB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVT A;  3AQF A;  3N7S C;  2YX8 A;  3AQE A;  3N7R C;  3N7P D; 
#chains in the Genus database with same CATH topology
 5KFG A;  1NNL A;  5EWE A;  4DSK A;  4CF4 A;  5AKH A;  7ICQ A;  4Y2Y A;  2XY6 A;  8ICX A;  4KN4 A;  2RHF A;  3PML A;  4KLI A;  3UMB A;  1SL0 A;  5D49 A;  3HJE A;  4Z6D A;  4P0Q A;  2R8K A;  8ICB A;  5JTI A;  5ALN A;  5GTI U;  1L3V A;  2VA8 A;  2W9B A;  5ALK A;  3RBD A;  4C8K A;  4NXZ A;  2HI0 A;  4KLG A;  2PFQ A;  4ED1 A;  4RNN A;  3H4D A;  3PY8 A;  3ORY A;  5J8Y C;  3K1Z A;  4G9B A;  5KG0 A;  3IM1 A;  4J9S A;  4BGD A;  2OM6 A;  3RRG A;  2B21 A;  3BS5 A;  4UBC A;  2GLE A;  4KLO A;  3LWM A;  4RNO A;  3M9N B;  2R18 A;  4BDP A;  4F5N A;  1WG8 A;  4I2J A;  3DEE A;  1KTQ A;  4I2D A;  5KFT A;  1X6I A;  3C1Z A;  5CHG A;  4XA5 A;  4AYB C;  1V38 A;  9ICW A;  1BPE A;  1ED1 A;  4RQ5 A;  3GU3 A;  1S10 A;  4PGX A;  1ZQL A;  2OHF A;  5EE1 A;  4ZH4 A;  3HX0 A;  2ZIU B;  4RQ6 A;  2KVS A;  2W54 A;  3KHR A;  4R8U B;  2W7P A;  3QU4 A;  5ALH A;  5AM0 A;  4YVZ A;  4UB5 A;  2QLT A;  1D8Y A;  2KKP A;  5AI5 A;  2BCS A;  4FS2 A;  5J0S A;  3PR5 B;  1HEK A;  1N48 A;  3B0X A;  5IIL A;  5J0T A;  1KRP A;  2E1E A;  2Y9U A;  2DQN B;  1Z4N A;  9ICA A;  2DF4 B;  4UQG A;  2KN7 A;  1QSS A;  2V4R A;  2FDR A;  3Q8M A;  3QUQ A;  5ALR A;  3HP6 A;  4F4W A;  4QZ8 A;  8ICH A;  1HJP A;  1T4G A;  2KIV A;  2H3F A;  3NVW A;  3E58 A;  4Q43 A;  1TK0 A;  4Q45 A;  2MA1 A;  1KSP A;  1T8E A;  4EZ6 A;  4R65 A;  4M9J A;  5JUM A;  4B9L A;  4EYH B;  1BPD A;  4P4O A;  5H2F U;  5KFU A;  1OW5 A;  2W8L A;  1ZQE A;  1S0V A;  4B6J A;  7ICR A;  1Z3E B;  2A1J B;  1B43 A;  1SGG A;  1T3N A;  4O5E A;  1X9S A;  1ZQT A;  3RH4 A;  4ED0 A;  4B9T A;  3FM9 A;  3UPQ A;  3C2M A;  3RBE A;  5F9L A;  5J0Q A;  2CN1 A;  3RB0 A;  3UMC A;  2WB1 C;  1HUO A;  1XC9 A;  4RQ7 A;  5J0P A;  5BOM A;  1DK2 A;  3ZDB A;  5AK3 A;  2KTQ A;  8ICY A;  3KTQ A;  2G5H B;  2KOB A;  2JXJ A;  4OJL A;  1A76 A;  2A1A A;  4ECX A;  4KMU A;  2VA2 A;  3RJJ A;  2MSN A;  4R63 A;  1Q8K A;  4NJ8 A;  4KMO B;  2V9W A;  3HKZ C;  3ISB A;  3MR2 A;  7ICV A;  4F5O A;  4BUG A;  1SWV A;  5KFE A;  2NRZ A;  4I2E A;  5J2D A;  4M9L A;  2H5X A;  4DL5 A;  2JEJ A;  5ALE A;  1Q46 A;  5J0R A;  5L1M A;  2YQE A;  3QEB Z;  4C0Z A;  5IIJ A;  3RAQ A;  4TUR A;  4FZM A;  1LVH A;  4QW8 A;  4UB1 A;  1MA7 A;  1JIH A;  3G6Y A;  8ICC A;  4ECU A;  3SI8 A;  4I2B A;  1HUZ A;  2JH7 A;  5KAI U;  1ECW A;  1U4B A;  3A0H U;  1C20 A;  4B9V A;  2R8H A;  2OWO A;  4IQW A;  4EBE A;  1KFS A;  5KNI A;  5AHX A;  5AK4 A;  4KLS A;  1COO A;  4DF4 A;  3GFK B;  4FS1 A;  4J03 A;  3RJG A;  7ICF A;  2G0A A;  4DQQ A;  4KLM A;  5DQG A;  5ALP A;  5B66 U;  2NRX A;  5J0W A;  2NO5 A;  3NS1 A;  4RQN A;  4UB3 A;  3JPT A;  2KK0 A;  5CB1 A;  1XSL A;  4BJQ A;  5AKZ A;  3N7P D;  4KIT B;  4MEX A;  8ICR A;  1GO3 F;  4Y2S A;  1VLB A;  4M6W B;  4DSI A;  2AHO B;  2EAM A;  3WU2 U;  3M6Z A;  2QB1 A;  4UAY A;  3B9J A;  2OXO A;  3HRD D;  4RQ8 A;  4IR1 A;  1TFR A;  5HML A;  3JPO A;  3I76 A;  1X9W A;  1ZQV A;  1VDV A;  2EZZ A;  4YG2 A;  2N1R A;  3KKA C;  4UB4 A;  5BOL A;  4I2I A;  3U26 A;  3THV A;  1X2I A;  4RQ2 A;  1PK3 A;  4QZB A;  3WKE A;  4ECQ A;  4J9N A;  2GWS A;  2YML A;  4DL3 A;  4CE6 A;  2KD1 A;  3WK4 A;  3RH6 A;  2G09 A;  5KG2 A;  2ES6 A;  4EX7 A;  2A1J A;  3N97 B;  2YB1 A;  4ELU A;  3SEI A;  4KLD A;  2K4H A;  1TAU A;  2JMG A;  3N28 A;  3WK7 A;  2RLT A;  2K8B B;  1M6Y A;  2VJ4 A;  4NWI A;  1KL9 A;  9ICG A;  3RR8 A;  4RQM A;  4PZN A;  1NI3 A;  3QU2 A;  2K89 A;  3OJS A;  3RB4 A;  5CR0 A;  4LZG A;  4AP9 A;  3BQ1 A;  4CNQ A;  3DDH A;  1XSP A;  4F5Q A;  5AI9 A;  1X9M A;  2OEH A;  1NJZ A;  4HAI A;  5ALG A;  2BCQ A;  3GIJ A;  4FBU A;  5KFY A;  3TAQ A;  4RPZ A;  7ICG A;  1UCV A;  4F5R A;  3LVV A;  3NVV A;  1Z00 B;  3OSP A;  2PMZ F;  1SKS A;  4RQ4 A;  4O3M A;  3IP4 B;  1Z4O A;  1PZN A;  3Q8Q B;  4ECT A;  3PX0 A;  2DWQ A;  9ICC A;  4UBB A;  5KG4 A;  4UAT A;  5KFF A;  4J9P A;  4DFJ A;  2KEY A;  4RNM A;  3IG5 A;  1KEJ A;  3WK8 A;  2IHM A;  3S6J A;  4U6P A;  3C2K A;  5BPC A;  1N2X A;  2KNJ A;  3F5A A;  3VCB A;  2KZZ A;  4JMU A;  3SEN A;  2UVV A;  1ZQP A;  1RXV A;  5HR7 A;  3NVY A;  4GXK A;  1FO4 A;  3LDA A;  1QLN A;  3V6H A;  2E8P A;  4IQT A;  5CWR A;  2W7O A;  3PW5 A;  4TUP A;  8ICN A;  1L8L A;  3BQ0 A;  2YY6 A;  5F9N A;  1LKY B;  1FEZ A;  4EBD A;  3BDP A;  3T3F A;  5KG6 A;  2Y0S C;  4DLE A;  2G07 A;  3C5G A;  2XO7 A;  2WHE A;  2D8C A;  1ZQN A;  5J2C A;  4ELT A;  1XWL A;  5DBA A;  3AMZ A;  3M9M B;  3RJE A;  1SL2 A;  2PFN A;  4E0D A;  3Q8S B;  4DO9 A;  5TIS U;  3ISD A;  2LYB A;  4PHA A;  4C8L A;  1T7P A;  2DBY A;  3BS5 B;  4PGQ A;  3MDC A;  1O03 A;  3PMN A;  1KKX A;  2FMP A;  2WF9 A;  3IRU A;  2ISO A;  3BZC A;  1BGX T;  5EOZ A;  1IXR A;  3K1R B;  4DOA A;  1L3S A;  3AL0 B;  1TKD A;  1KLN A;  4MF2 A;  8ICA A;  4MFF A;  4NLN A;  2BCV A;  3QZ8 A;  2LKY A;  4FO6 A;  4F72 A;  4UAS A;  2GOL A;  4I2C A;  4XQ8 A;  2RDI A;  1WCL A;  1QQ7 A;  7ICO A;  2KHQ A;  3PO4 A;  1BPY A;  1K5O A;  3ZDE A;  1ZET A;  5JRT A;  2YMP A;  3QUB A;  2M9N A;  5GTH U;  3MR6 A;  2ZTD A;  4IS7 A;  1X40 A;  1B22 A;  4RZR A;  2PFO A;  5DB7 A;  2AQ4 A;  1LB2 B;  2ZIV A;  2ZTC A;  5IIM A;  3WKA A;  1MQ3 A;  4O3O A;  4F2R A;  5KFP A;  1KW4 A;  4HYK A;  1C7Y A;  5J2A A;  3D2Q A;  1JUD A;  4WJ3 B;  3ONN A;  3WK6 A;  2KE7 A;  3LK9 A;  4F4X A;  3M7D A;  3KZX A;  3NRW A;  2FLN A;  2F1H A;  3JPQ A;  3I28 A;  5CP2 A;  4KTQ A;  4O3R A;  3OHB A;  5DDY A;  5HR6 A;  2EDU A;  3M8R A;  3AM9 A;  9ICL A;  1N62 A;  5ALQ A;  4F3O A;  4J9L A;  4OJO A;  5G5G A;  5J0Y A;  2Y1I A;  4C7Y A;  4EX6 A;  3KHL A;  3EW9 A;  3D2N A;  1N56 A;  1JMS A;  4QWD A;  1SV4 A;  1RXW A;  3RJK A;  5EWF A;  4O9M A;  2JHD A;  4DFM A;  2ZTE A;  4I28 A;  2ZIW B;  1WYG A;  1L3U A;  4LJX A;  1LKY A;  3AEV A;  4FFD A;  5DLF A;  1FFU A;  1RZT A;  2YB4 A;  2Z7J A;  4M9N A;  5KFZ A;  4O5K A;  4Y2P A;  4M47 A;  2H3I A;  1SZP A;  5EE0 A;  4EEL A;  5A0L A;  4FBT A;  4I2A A;  2HVH A;  3EYZ A;  3IDW A;  4K4H A;  3Q8K A;  4DSJ A;  4J9R A;  3D6J A;  3HT3 A;  4KX3 A;  5ALO A;  2KFZ A;  1U47 A;  4RT2 A;  3GQC A;  4DL2 A;  2KV2 A;  3H0M B;  2KSO A;  2ZIX B;  5DBC A;  3Q8R B;  1XSN A;  1N5W A;  2DPI A;  5E79 U;  2R8J A;  1L8O A;  5J2E A;  5DGA A;  2ALZ A;  4QZD A;  5D4B A;  4DWI A;  4DSE A;  1ZD4 A;  2EAO A;  2LYH A;  4RU9 A;  4B9M A;  5KT6 A;  5KG3 A;  3PX4 A;  5DG9 A;  2Y1J A;  4BXO B;  9ICJ A;  4MEY A;  9ICX A;  1ZD2 P;  4DFP A;  4KLL A;  2HHU A;  2HHW A;  4YN4 A;  4XUS A;  3BS7 A;  2AGO A;  2YTU A;  2XY5 A;  1N5X A;  3AQF A;  4OCZ A;  2HBL A;  4IRK A;  4QWA A;  5T14 A;  2BPC A;  3LWL A;  2W8K A;  5KFC A;  4GIB A;  2V4Q A;  2XI9 A;  2PXI A;  5DGB A;  3EPG A;  2C28 A;  4PH5 A;  2DGZ A;  1JX4 A;  3GIM A;  3NVZ A;  2F44 A;  2WF7 A;  2W04 A;  4IC9 A;  4MFA A;  3NGD A;  4ED3 A;  3AU2 A;  3H7I A;  4CF5 A;  4DFD A;  2KG5 A;  3RJI A;  4IL6 U;  3EWA A;  3QYP A;  1L7N A;  3PW2 A;  2H3V A;  4K4G A;  2XIC A;  3RB3 A;  4C4R A;  3TAD A;  4NLZ A;  2G08 A;  4MHV A;  2UVU A;  1V85 A;  3N4M B;  1NJY A;  4GLX A;  3EUB 2;  4ELV A;  4EYI B;  4O5C A;  8ICL A;  5AM2 A;  4J9O A;  4B9S A;  1S8O A;  2BPG A;  2YMM A;  3AUO A;  2K4E A;  3V6J A;  5KFW A;  2J6S A;  2W9C A;  5AK6 A;  2XVT A;  3QUC A;  2UVR A;  3M1Y A;  4YQW A;  3E2E A;  1D8B A;  4AYB F;  3BQT A;  2XGQ A;  4UW9 A;  5KG7 A;  2W11 A;  1RQL A;  2A19 A;  3WKB A;  1H38 A;  3H8M A;  3EZ5 A;  8ICT A;  3PW4 A;  5KT7 A;  5HP4 A;  4NV0 A;  2AQ0 A;  8ICI A;  9ICQ A;  4F4Z A;  4GXI A;  2ZIW A;  1D9F A;  2HVI A;  5AM4 A;  5J2B A;  7ICT A;  1RYR A;  4KLE A;  3QNM A;  5KFQ A;  2ATL A;  2HOQ A;  1T3Q A;  4C8N A;  5KG5 A;  1K1Q A;  1ZQG A;  2JGA A;  3T5J A;  5KFM A;  3J81 j;  2ZUB A;  4F5P A;  3HWT A;  1XNS A;  2F1J A;  1NKE A;  5DDM A;  2BGW A;  3KD3 A;  1ZQK A;  2ZIX A;  1ZQD A;  1SKR A;  3KZI U;  1BNO A;  4C8M A;  1PK1 A;  4C7Z A;  5ALI A;  1S0N A;  2DKX A;  4KN7 A;  2AGP A;  4F93 B;  2C2E A;  3C23 A;  2W03 A;  4NLK A;  3MBY A;  4BXO A;  1ZQH A;  4F4K A;  4Q8F A;  1N60 A;  5ALF A;  3HPO A;  3OHA A;  2OCE A;  5KTQ A;  3SR6 A;  3H8W A;  3IHQ B;  4U7C A;  5K4L A;  1X66 A;  3JPR A;  4TQR A;  1CI4 A;  3LYS A;  4MF8 A;  5EE3 A;  4C4S A;  4NY8 A;  2P6U A;  5J29 A;  3F2C A;  2XCA A;  5EWG A;  3TAC B;  4JB3 A;  9ICM A;  2LMR A;  4Z6F A;  2C2D A;  2RRD A;  3DV9 A;  7ICH A;  1IM4 A;  4B9U A;  2HCF A;  4KX5 A;  2AH5 A;  1JRO A;  2LM1 A;  3BJY A;  2ASJ A;  4O0I A;  4JV1 A;  1ZQM A;  1JXL A;  5J2I A;  3LVW A;  2XY7 A;  2EAP A;  4FZL A;  5ALX A;  3ZDC A;  3MGV A;  1WWV A;  2WAQ F;  9ICP A;  1L6N A;  4DQS A;  1QSY A;  1ZQU A;  3KHH A;  4B9N A;  2IOF K;  4QZC A;  4QNL A;  2K60 A;  5KFL A;  1BVS A;  2ODG A;  2BDU A;  2Q4T A;  3OTQ A;  2IOH A;  1K1S A;  2FPK A;  3QXG A;  4UB6 U;  2ESE A;  3SQI A;  4DL7 A;  3FAH A;  2WTF A;  7ICP A;  4DSF A;  2I5H A;  1U49 A;  9ICE A;  2RDJ A;  2EZY A;  5ALW A;  3QE9 Y;  2GO7 A;  3TQ1 A;  4IR9 A;  3RRH A;  3E0F A;  2OYY A;  1UA0 A;  2FI1 A;  4JK1 A;  3M8S A;  5J2F A;  2KHV A;  3T79 A;  3MGI A;  4DL4 A;  5CJ7 A;  3UMG A;  1DOQ A;  5DB9 A;  4O3P A;  2NRT A;  1S76 D;  3ED5 A;  4CRX A;  4YFK A;  2LBO A;  1OXJ A;  2P66 A;  1NJW A;  3G6X A;  5KFD A;  2VAN A;  1ZQB A;  2J6T A;  1DRG A;  4J9M A;  4FZN A;  1F0M A;  1Z1V A;  1NK0 A;  1ZQZ A;  4P4M A;  2JEI A;  3GV5 B;  3RAX A;  5ALD A;  2HBM A;  4UAW A;  2ZIV B;  1D9D A;  2LPE A;  3MAB A;  5KFO A;  5CRX A;  8ICQ A;  3PW0 A;  4KLF A;  3RFA A;  4NLC A;  4RUC A;  9ICH A;  1NOM A;  2W55 A;  1S97 A;  2IA6 A;  3SAF A;  1KBU A;  1S0M A;  3TAR A;  2KVC A;  1KQQ A;  3RR7 A;  2JZB A;  1L7M A;  1WCN A;  3H0L B;  3OJU A;  3H0R B;  4GC6 A;  2XC9 A;  4OO1 J;  8ICS A;  3JPP A;  2JH1 A;  1TVA A;  1SB3 C;  4CDG A;  2NRV A;  1ZYQ A;  3QX7 A;  3QZ7 A;  4QZG A;  3I1Y A;  2I6X A;  4PJ0 U;  2ZJ8 A;  2FLL A;  4QIW C;  4Y2V A;  3R9K A;  3QU5 A;  4QZE A;  3V7L A;  3EPI A;  2KKV A;  1S5L U;  2KJ5 A;  1NJX A;  2C2R A;  5KL8 B;  1ZQI A;  3QU9 A;  3MR3 A;  5CA7 A;  1A0P A;  3MR5 A;  2CPR A;  2F8L A;  3BZK A;  3PZP A;  5J2K A;  4QWC A;  9ICB A;  5DBB A;  1BPX A;  2MUT B;  2LHT A;  2W43 A;  4M04 A;  1L5U A;  2F3N A;  2CXY A;  5AI0 A;  1KFD A;  5IIO A;  4F71 A;  7ICS A;  4GC7 A;  2KIC A;  4TUQ A;  3Q8P B;  1TK8 A;  4FE3 A;  4YMO A;  4IQV A;  5KT3 A;  3ZDD A;  4QWB A;  2KSO B;  1ARO P;  1HIW A;  4CCH A;  5KT4 A;  3PSI A;  4NLG A;  4IQU A;  2BZF A;  2HW3 A;  2RQ5 A;  4NM2 A;  4O3Q A;  4GFJ A;  1PVP A;  1SXD A;  5AK5 A;  4Y2J A;  3BQ2 A;  2BCU A;  8ICK A;  2KZM A;  4IRD A;  8ICE A;  1NKC A;  5G5H A;  1RYS A;  4KLU A;  2ZJ5 A;  3L4P A;  1QH9 A;  4Q8E A;  5KFI A;  2HHX A;  4RQ3 A;  2G06 A;  3KFU F;  1T94 A;  3NRZ A;  3JPN A;  1N61 A;  2YN4 A;  3K75 D;  2HHS A;  5KFH A;  1KFT A;  2KJ8 A;  5L1L A;  3F2B A;  5KFR A;  1JN3 A;  5HHI A;  4CF3 A;  4ECV A;  2Y0S F;  3NUQ A;  1P7D A;  2MRL A;  1UA1 A;  3WK5 A;  4LZD A;  3GIL A;  1LV5 A;  2VIX A;  4RQ0 A;  5AKK A;  3UXP A;  3PNC A;  5L1J A;  1TV9 A;  4P0P B;  4QZH A;  2WF8 A;  4DFK A;  4RPX A;  2AGQ A;  4UAU A;  1MSW D;  1MN8 A;  2HHT A;  3B0Y A;  2E1F A;  4UB8 U;  3PO5 A;  3M6K A;  3TFR A;  4DL6 A;  2D6F C;  1COK A;  5AI6 A;  3F5E A;  1J2M A;  5CEH A;  1XO1 A;  5KAF U;  3F53 A;  4UAZ A;  2KP7 A;  1YZ7 A;  3ALR A;  1QQ5 A;  4UAR A;  3IV6 A;  1PVR A;  9ICU A;  3T5L A;  2VKQ A;  3WKD A;  2BPF A;  4I2F A;  1AQ6 A;  2W9C B;  2DKZ A;  3RB6 A;  9ICS A;  5DG8 A;  5DQI A;  2UVW A;  4OJP A;  1JXE A;  5ALY A;  3C28 A;  1UQV A;  1X9X A;  5J2G A;  5TZV A;  5J2J A;  1OUQ A;  2B0C A;  1NK8 A;  3UM9 A;  4I27 A;  1Q3U A;  2GH1 A;  4PPX A;  4ACO A;  5HHH A;  4Y2X A;  3ICX A;  2HBJ A;  2BQ3 A;  2MUT A;  2MAX A;  1ZQX A;  4YMM A;  5AM5 A;  4DF8 A;  1SWW A;  5AKL A;  2R8I A;  4KLJ A;  4US8 A;  3NAS A;  4QW9 A;  2PI4 A;  5HNK A;  4P2H A;  5AI4 A;  1PK1 B;  3PR4 A;  1ZQC A;  3K4G A;  8ICZ A;  5J2H A;  2QKQ A;  3CW2 C;  3MFI A;  4OD0 A;  3M9O B;  1NK7 A;  7ICL A;  4YMN A;  1ZQ1 C;  1EXN A;  3BQ7 A;  3V6K A;  3ETR A;  2EH9 A;  5J0X A;  2BKE A;  4CGZ A;  3MGH A;  3N7R C;  1SXE A;  2E8M A;  2HDO A;  2G5I B;  2IOF A;  2YMQ A;  2ASL A;  2K8A A;  2JRZ A;  3T5H A;  4Z6C A;  1XU4 A;  5L1K A;  2MU2 A;  2E3T A;  3CYM A;  1SL1 A;  2F8K A;  3AU6 A;  8ICM A;  1SIJ A;  3HW8 A;  2K4P A;  3OGU A;  5IIK A;  4NL9 A;  2DL0 A;  1ZQQ A;  4EEY A;  4DS5 A;  2JEF A;  5KG1 A;  2DUY A;  2OH2 A;  4OJ6 A;  1ZQA A;  1SV0 A;  4P0P A;  4M9G A;  5KFK A;  1RQN A;  4M0A A;  1ZQJ A;  3D2S A;  1U48 A;  2WFA A;  2XCP A;  5III A;  4Y2R A;  2DFL A;  4DLG A;  1TE2 A;  5AIB A;  2BDP A;  4ECW A;  4DS4 A;  2E8O A;  3H8S A;  1U9L A;  3TI0 A;  4F2S A;  1KDH A;  4ZOH C;  5ALS A;  2LM4 A;  5DB8 A;  2QB0 B;  5KT5 A;  2WF5 A;  3RTV A;  1S77 D;  3F2D A;  1NK5 A;  3CP8 A;  3KOO A;  2EZX A;  2EAN A;  3ZD8 A;  2VJ5 A;  3ZI4 A;  2JV3 A;  1X6J A;  3CRX A;  4BX9 C;  1V97 A;  2FPL A;  2E8N A;  4RUA A;  5DQH A;  1O08 A;  1ZJN A;  3T5K A;  4M9H A;  1L3T A;  2Y9T A;  4M2Y A;  3ETL A;  8ICU A;  3MC1 A;  3ISC A;  3A0B U;  2F77 X;  4A8E A;  2M0N A;  4US9 A;  4UAV A;  1J2N A;  1DXS A;  3PVX A;  4JWN A;  1Z1B A;  2IMW P;  4YR2 A;  5ALT A;  1DGJ A;  2JR5 A;  4YP3 A;  3JPS A;  2FMQ A;  2F76 X;  5DLG A;  4YXJ A;  4YR3 A;  4I2G A;  9ICI A;  1B4F A;  3GV7 B;  5EE9 A;  1RYU A;  3CNH A;  1QCK A;  4QJF B;  4QZF A;  2ZXI A;  5KT2 A;  4JV0 A;  2FE9 A;  4QZ9 A;  4DOC A;  3G6V A;  2CRX A;  5KL1 B;  1JAL A;  4Y2Q A;  2HSZ A;  5FP0 A;  4DOB A;  4PL1 A;  5AKE A;  2IHN A;  2JZB B;  2W3S A;  2NYV A;  4F50 A;  2EQY A;  1SZH A;  2WAQ C;  3NTU A;  4Q44 A;  4IRC A;  5AM1 A;  3GDX A;  9ICO A;  5J0U A;  4G3I A;  8ICG A;  9ICV A;  4R64 A;  3SAG A;  1B0X A;  5AIA A;  4P4P A;  2DPJ A;  2KMD A;  3TAN A;  2WB1 F;  3QU7 A;  2HHV A;  3V7K A;  1NK4 A;  5B5E U;  2E5S A;  2W3R A;  1V9P A;  4PHP A;  3H4B A;  1CRX A;  3IN5 A;  1ZRN A;  1UPH A;  2H3Z A;  4ECY A;  2KIW A;  2ZXH A;  5AKG A;  1S9F A;  3RJF A;  3UXN A;  4ED7 A;  3C2L A;  3O0F A;  4TUS A;  2ZIU A;  2P35 A;  4PZO A;  3TFS A;  1URJ A;  3HKZ F;  4R8U A;  4QZA A;  2F2A B;  5AIC A;  5L1I A;  1RPL A;  5J0O A;  3RJH A;  4ED6 A;  1ZRM A;  2QB0 A;  1NZB A;  1L7P A;  1X42 A;  4RQ1 A;  5J8Y A;  2D3D A;  5KFN A;  4F4Y A;  1KN5 A;  1PUZ A;  4C80 A;  2R8G A;  7ICM A;  1JRP A;  4ICA A;  2I9G A;  8ICV A;  5ALV A;  8ICJ A;  1NK9 A;  4PHE A;  4YXM A;  4R66 A;  4YD1 A;  3UQ2 A;  3QEA Z;  9ICN A;  3VC8 A;  3GZF A;  4RPY A;  2BR0 A;  3KBB A;  1DK3 A;  4F91 B;  4Y2U A;  4J9K A;  2PMZ C;  5ALU A;  3PX6 A;  4KLT A;  2KZ3 A;  4J9Q A;  3TAP A;  2AJQ A;  1ZOL A;  1BPB A;  1ZD5 A;  5JU5 A;  3L5K A;  3WK9 A;  2A3V A;  5D46 A;  1ZQR A;  4PGY A;  1QTM A;  3PV8 A;  4F8R A;  4ECZ A;  5C5J A;  2ZG6 A;  5KFV A;  4YCX A;  3FDS A;  2HOF A;  2H3Q A;  3SYZ A;  3N7S C;  3C5F A;  1FFV A;  3UXO A;  3UQ0 A;  2XID A;  2K4I A;  3WKC A;  4XRH A;  1F44 A;  3FC4 A;  3HIL A;  7ICE A;  1A6S A;  4NLB A;  2PKE A;  4BWJ A;  1Z19 A;  3TKA A;  1NK6 A;  4MFC A;  5AI8 A;  3AQE A;  3RH5 A;  2PFP A;  5AKI A;  2QAR B;  1F5S A;  3C1Y A;  3SZ2 A;  3MFH A;  4RT3 A;  4JV2 A;  4ED8 A;  1IIP A;  7ICJ A;  2ISP A;  2VA3 A;  2AXT U;  1ZQS A;  4DSL A;  4DQP A;  1UT8 A;  4Z6E A;  4X5V A;  4O3S A;  2HMX A;  1FIQ A;  4F92 B;  1ZD3 A;  2BQR A;  4DQR A;  5HMM A;  1D8L A;  2L5Y A;  4USA A;  5AKX A;  3V72 A;  2BCR A;  5L9X A;  4KLQ A;  1UT5 A;  1NZP A;  4C8O A;  5F3X B;  1YZ6 A;  2ZUC A;  2C22 A;  4ECR A;  1N63 A;  3C21 A;  4DEZ A;  4NL9 C;  4PHD A;  2WF6 A;  3GV8 B;  1IG6 A;  2FLP A;  3RF9 A;  4JUZ A;  2HHQ A;  1RDF A;  3FYH A;  3SD7 A;  3OPX A;  1S0O A;  2W9M A;  5DB6 A;  1SV0 C;  7ICI A;  2PI5 A;  2Q0Z X;  4P0Q B;  5KFB A;  2LYA A;  8ICW A;  7ICN A;  1UHU A;  3TAD C;  1J97 A;  4QZI A;  8ICF A;  1MC8 A;  1XO0 A;  2B6G A;  4YR0 A;  3KHG A;  5AKY A;  3SAH A;  2XGP A;  1SKW A;  1CUK A;  1TAM A;  3Q8L A;  4M6W A;  5ALJ A;  4DCC A;  1MQ2 A;  2W9B B;  2NO4 A;  4Y2T A;  2FPM A;  4C4T A;  1RM6 C;  3L3F X;  4ECS A;  5IIN A;  9ICR A;  4QIW F;  2P6R A;  2ASD A;  5ALZ A;  1WUD A;  3H40 A;  3SV4 A;  9ICF A;  1RG6 A;  4O3N A;  4BWM A;  5DKW A;  5KFJ A;  2KFN A;  1WWU A;  3H8J A;  1ZQW A;  3QUT A;  2HBK A;  1VJ5 A;  8ICO A;  1YT3 A;  1BNP A;  1NKB A;  4K4I A;  1IV8 A;  4UB2 A;  7ICK A;  2IBK A;  3GII A;  2F1I A;  3PW7 A;  7ICU A;  1ZQO A;  1DGS A;  1ZQY A;  3OSN A;  4EZ9 A;  4I2H A;  2ZUD A;  1XS9 D;  4ED2 A;  5ALL A;  4EEN A;  1L7O A;  3V7J A;  5DG7 A;  1BPZ A;  1Y88 A;  3PSP A;  1TK5 A;  4I29 A;  9ICK A;  1U45 A;  4QWE A;  3IG8 A;  3GIK A;  2QAR A;  5KFS A;  3PST A;  3C29 A;  4DQI A;  4EEK A;  5AKJ A;  8ICP A;  4LVS A;  1A77 A;  2O6K A;  1ZXI A;  2FJ6 A;  3ZDA A;  2NV3 A;  3KKA A;  5KFA A;  1CEZ A;  1ZQF A;  4PL2 A;  2NRW A;  2JEG A;  1QQ6 A;  5KFX A;  2KJ9 A;  2FMS A;  1Z00 A;  1TAQ A;  2LI6 A;  4YD2 A;  3AN1 A;  3MDA A;  2J6U A;  1PVQ A;  2W9A A;  4EBC A;  2ZJA A;  5AM3 A;  1Q3V A;  2AU0 A;  4TQS A;  5C0Y A;  3SV3 A;  9ICT A;  3ZD9 A;  3PSF A;  2BQU A;  5ALM A;  1JI7 A;  4OJ5 A;  3SMV A;  2RP5 A;  1ZJM A;  2YX8 A;  2I1Q A;  2BHN A;  1QSL A;  4JWM A;  2HOI A;  4NM1 A;  4GXJ A;  4KLH A;  2K8C B; 
#chains in the Genus database with same CATH homology
 2VIX A;  4C0Z A;  2G07 A;  2KIW A;  4P0P B;  1XNS A;  2DGZ A;  2ZXH A;  2KKV A;  4FZM A;  3SQI A;  1ZQ1 C;  2KKP A;  2K4H A;  2ZIX A;  1MA7 A;  3O0F A;  2JMG A;  2KJ5 A;  2ZIU A;  1HEK A;  2K8B B;  2RHF A;  2VJ4 A;  4NWI A;  4CGZ A;  1IIP A;  5HR6 A;  1URJ A;  2F77 X;  2HBK A;  3HKZ F;  3N7R C;  2W04 A;  2JH7 A;  4IC9 A;  4P0Q A;  5KL8 B;  2E1E A;  2F2A B;  2DQN B;  2G5I B;  1ECW A;  1YT3 A;  2DF4 B;  2K89 A;  4A8E A;  4OJO A;  2M0N A;  2K8A A;  3E0F A;  2E1F A;  2OYY A;  1A0P A;  2W03 A;  3M6K A;  2D6F C;  2CPR A;  2KHV A;  2F8L A;  3PZP A;  3T79 A;  2HMX A;  3F5E A;  2LYB A;  3D2N A;  1NZB A;  3CYM A;  1Z1B A;  2H3V A;  3F53 A;  2LHT A;  2XIC A;  4ICA A;  2JHD A;  3ALR A;  2H3F A;  2ZIW B;  2G08 A;  4U7C A;  2G0A A;  2F76 X;  2MA1 A;  4CRX A;  1PVR A;  2KIC A;  2LBO A;  2VKQ A;  3LYS A;  4FE3 A;  3AL0 B;  3LVV A;  3PSP A;  2YB4 A;  2Z7J A;  3K1Z A;  3VC8 A;  3GZF A;  1HIW A;  4OJP A;  3F2C A;  3IG8 A;  4OJ6 A;  3C28 A;  2LKY A;  4QJF B;  2H3I A;  2OH2 A;  5A0L A;  2PMZ F;  2ZXI A;  1DRG A;  3PSI A;  4P0P A;  3PST A;  4FZN A;  2OM6 A;  3C29 A;  2GOL A;  4O3M A;  3IP4 B;  2HBM A;  2PMZ C;  1OUQ A;  4KX3 A;  4BJQ A;  3D2S A;  2ZIV B;  3N7P D;  2K4E A;  2R18 A;  3RF9 A;  4GFJ A;  2RRD A;  1PVP A;  1GO3 F;  5CRX A;  2NV3 A;  2CRX A;  2XVT A;  2KHQ A;  2KV2 A;  3OPX A;  3H0M B;  4PL2 A;  5KL1 B;  2GH1 A;  1Q3U A;  2ZIX B;  2KEY A;  3IG5 A;  4ACO A;  2KJ9 A;  2CN1 A;  3M6Z A;  3DEE A;  4PL1 A;  3RFA A;  4AYB F;  1D8B A;  4KX5 A;  2WB1 C;  4NLC A;  2OXO A;  3ICX A;  2WAQ C;  1SZH A;  4P0Q B;  4U6P A;  2LYA A;  2HBJ A;  4AYB C;  2A3V A;  1PVQ A;  4NV0 A;  2N1R A;  2KNJ A;  1ED1 A;  3F5A A;  2ZIV A;  1XO0 A;  3SAH A;  3VCB A;  2G5H B;  2ZIW A;  4JMU A;  1Q3V A;  3SAF A;  1TAM A;  1KBU A;  2KOB A;  5HR7 A;  3SAG A;  3GU3 A;  3LVW A;  2KVC A;  2ZG6 A;  2G06 A;  2HOF A;  3KFU F;  5C0Y A;  1T94 A;  4FZL A;  4OJL A;  3F2D A;  2H3Q A;  3D2Q A;  3H0L B;  3N7S C;  3PSF A;  2WB1 F;  3MGV A;  3H0R B;  2W7O A;  4WJ3 B;  4OO1 J;  3CP8 A;  2XID A;  2WAQ F;  2K4I A;  3ONN A;  4OJ5 A;  2HOQ A;  2JH1 A;  3SMV A;  1L6N A;  3L3F X;  2KJ8 A;  2KD1 A;  2RP5 A;  2E5S A;  4CDG A;  4KMO B;  3F2B A;  1F44 A;  2ZIU B;  3AQF A;  4QIW F;  2HBL A;  3HKZ C;  2YX8 A;  3M7D A;  1WUD A;  1A6S A;  2G09 A;  5T14 A;  2Y0S F;  4NLB A;  1CRX A;  2VJ5 A;  3IN5 A;  4BUG A;  3NUQ A;  3KZX A;  3NRW A;  4QNL A;  2MRL A;  2W7P A;  1P7D A;  1UPH A;  4BX9 C;  2XI9 A;  4QIW C;  1Z19 A;  2HOI A;  3CRX A;  2H3Z A;  2BDU A;  2JGA A;  2K8C B;  2Q4T A;  3AQE A;  2Y0S C;  2YB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...