1QCKA

Solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure plus 20 individual simulated annealing structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR)
publication title IMPROVING THE PACKING AND ACCURACY OF NMR STRUCTURES WITH A PSEUDOPOTENTIAL FOR THE RADIUS OF GYRATION
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1qckA00
2EZYA 2ODGA 2BZFA 2EZXA 2EZZA 1CI4A 1QCKA
chains in the Genus database with same CATH superfamily
4EZ9A 3QU5A 3UMCA 5AM4A 3C21A 1F5SA 2JZBB 3H8MA 3AMZA 1ZQHA 2F8KA 4QIWF 4YR3A 1L7OA 3ZD9A 1KFDA 1UA0A 3V6JA 1QSYA 4EBDA 1QSLA 1S0VA 2LPEA 2GOLA 3EPGA 2A19A 2W11A 3PX6A 1ZQUA 3KBBA 3PZPA 2Q0ZX 4BDPA 4F5NA 3QU4A 2XY5A 4JK1A 8ICNA 4KLLA 2HHUA 7ICJA 4I2GA 4ED8A 2PFQA 3TAPA 1L5UA 4M9GA 4IRCA 2BDUA 3FM9A 1IV8A 4QJFB 1ZQZA 2KJ8A 2KOBA 2LHTA 1KDHA 2W3RA 5J2JA 4RQ3A 3PW2A 2JZBA 3QU2A 1MA7A 3WK8A 3HKZC 2WF7A 2P6RA 4EEKA 4RQ8A 4RNNA 4O9MA 2GH1A 3AQEA 5J0YA 2BCSA 1BNPA 1ZQBA 4DL4A 2KZ3A 2EAPA 2ASLA 3RJJA 2ASDA 2PMZF 4O3OA 3NRZA 5KT7A 1UHUA 2KIVA 2F1IA 1TK5A 5DQGA 1N56A 1QQ5A 3EZ5A 3MR5A 1TVAA 1XU4A 4QNLA 4KLFA 5DQHA 2BPCA 3RFAA 3RAXA 3LYSA 1WCNA 4F3OA 5HP4A 1Z3EB 4Q44A 1ZJMA 2G09A 3GZFA 5JUMA 5DBBA 2JEFA 1V38A 4R8UA 2Y0SF 4M9LA 2ZIVA 4KITB 1NJWA 1KFTA 3D6JA 2LKYA 4Y2PA 4DF4A 4NY8A 3JPOA 2HBJA 5KFXA 2W43A 1RG6A 5DGAA 1UCVA 7ICUA 1X2IA 3E2EA 2ZXHA 3C2LA 2DFLA 5KT6A 8ICAA 3HRDD 5KFYA 3DEEA 1WG8A 4DOBA 1X9SA 4O5KA 4EYHB 4JV0A 5AKJA 1ZQKA 1KN5A 4RQMA 1UT5A 2HOQA 9ICPA 4K4GA 1URJA 2VJ5A 4ECYA 2BCQA 2OEHA 1T8EA 4M04A 1NZBA 2I6XA 1BPDA 3MR3A 4YD2A 5J0RA 3RR8A 3MGHA 1XS9D 1Y88A 5J29A 1QQ7A 1JUDA 4B9LA 5BPCA 8ICKA 1QLNA 1SGGA 2D8CA 3M6KA 5IIKA 2JRZA 5KFOA 5KFZA 2AGOA 4NXZA 4O3NA 1FO4A 4DL6A 3NVVA 1NNLA 1XSLA 3RB3A 1HIWA 5TISU 2FDRA 2RDIA 2NRTA 3QUQA 1NKEA 4DFDA 3WK6A 1U49A 4K4HA 4RNOA 5KFKA 2OYYA 3IG8A 2G0AA 4PJ0U 2JXJA 1O03A 2WF6A 5KAFU 5KL1B 5KG0A 3G6YA 2C28A 2ZIXA 2G5HB 2RP5A 1ZJNA 3H0LB 5J0UA 4MHVA 4O3MA 1Q46A 8ICGA 5AI6A 2ZUCA 2ZTEA 5J0QA 1Q3VA 2W8KA 2RHFA 5J0OA 4QWCA 4PL2A 7ICIA 4F4ZA 5AI8A 2IHNA 4Z6DA 4YR0A 2DUYA 1YZ7A 4C8LA 5FP0A 4OJ6A 2MUTA 1CUKA 2KIWA 1ZQRA 1KKXA 5KG5A 4F91B 2IOFK 1L3UA 2YMMA 4MFAA 2CPRA 1S9FA 7ICFA 2HBKA 5K4LA 4Y2RA 3ZD8A 3BZCA 2YQEA 3WK5A 3E58A 3SI8A 2R8KA 3N7RC 4EX7A 2XY7A 1XC9A 1S0MA 1QCKA 1ZQEA 3MGIA 4PGQA 4J9PA 4ECQA 2KZMA 5F9LA 4P2HA 5KT4A 4WJ3B 3JPSA 1NJXA 1X6IA 7ICKA 3WKBA 4RU9A 2D6FC 4EBCA 1N62A 3Q8PB 2FJ6A 3QZ8A 2A3VA 4PH5A 3OTQA 4J9RA 5ALUA 2K8AA 1N60A 2YMLA 4UATA 1L8LA 4ZOHC 5KFCA 3TANA 5J0WA 5CWRA 2AJQA 2BHNA 4M9HA 1ZD2P 2YMPA 4UAVA 7ICOA 8ICEA 3C2MA 3OSPA 2F8LA 4RQ7A 1IG6A 2KEYA 4Y2UA 5J2DA 1L3SA 1TFRA 3RTVA 4HAIA 5ALDA 1SV0C 2GLEA 1COOA 4BWJA 5DBCA 2LM1A 2NRWA 1T94A 3EYZA 2AQ0A 1Z00B 5AKZA 4TUPA 1X40A 1L8OA 5AKHA 4GXKA 2UVUA 4ICAA 4MEYA 1MC8A 2KNJA 2NO4A 1PVPA 3PSIA 3BJYA 3V6HA 2R8HA 1D9FA 2K4HA 2PI4A 1JRPA 5EWEA 1JXEA 1TK0A 2DPIA 1LKYB 1IIPA 4UB5A 3NUQA 1S97A 1KSPA 3LWMA 1A0PA 2FPLA 2VA8A 1S77D 4P0PB 5DB6A 4DSJA 4ED7A 3KHRA 3SR6A 2QARB 4NL9C 4C7ZA 4DSEA 5ALXA 3HILA 2J6SA 8ICRA 1RYUA 4IRDA 1NKCA 2Y9UA 3L5KA 3ISBA 2KE7A 4DSIA 4F5RA 1D8BA 5KG2A 4O0IA 1J2NA 4F8RA 3L3FX 2KJ5A 2LM4A 3FC4A 3WK9A 5J2EA 2OXOA 5BOLA 4NWIA 2G08A 4ECSA 5A0LA 3WKCA 4QZCA 4P4MA 5EWGA 4XUSA 4ECUA 2PFOA 4KN4A 1X6JA 4QW8A 5HR7A 1DGSA 2B6GA 1A77A 1BPXA 2LMRA 3BZKA 4M2YA 2MRLA 5DB7A 2HDOA 5EE3A 5AM1A 1L7MA 2VJ4A 4DQQA 4B9NA 4Y2XA 3IV6A 8ICXA 4DLGA 1AQ6A 2YB1A 2UVVA 3H8SA 3C5FA 3T5LA 5DLGA 2OCEA 4DCCA 3EPIA 1ZQGA 2ZJ8A 7ICPA 1Z19A 4GFJA 1L3TA 2MU2A 4KLIA 9ICVA 4EX6A 3BQ1A 3H7IA 5KNIA 2K4IA 2DL0A 3PR5B 5DG7A 1M6YA 4I2JA 3AN1A 3WK7A 4EENA 4ED1A 1L7PA 3ED5A 1NK4A 3E0FA 1VLBA 7ICEA 3SD7A 4QZGA 4DOAA 3TFRA 4C8OA 4I2CA 2KKPA 3KTQA 2EH9A 3SZ2A 5AI5A 4QZDA 2W9CB 3N7PD 3IG5A 3AUOA 1P7DA 4YMOA 4IQVA 5AKEA 2KVCA 1TKDA 3KHLA 2WF5A 1LB2B 3M9OB 3RF9A 4QZEA 3GIKA 5AM5A 1F0MA 5AI4A 4CF4A 4Q8EA 1T3NA 4J9KA 4E0DA 3GU3A 3AEVA 4OJ5A 5HMMA 2ES6A 5KFWA 5KFEA 3PNCA 3HP6A 5DQIA 3WKDA 2XVTA 1ZQWA 5ALEA 4Z6CA 5AM3A 1LVHA 1SXDA 2W03A 1A76A 4XRHA 5GTHU 2H3VA 4ECWA 4UAZA 7ICGA 1J97A 4IRKA 3OJUA 4C8NA 3HPOA 5ALMA 4DS4A 1RXWA 4MF2A 1D8LA 8ICOA 4I29A 2Y9TA 4ZH4A 5AIBA 2JEGA 8ICFA 5KFVA 2V9WA 3S6JA 1ZQCA 3RH6A 1DXSA 4F4WA 9ICKA 3HKZF 4ECRA 3N97B 3OSNA 2W55A 3JPQA 2OHFA 1SL0A 4QZFA 3QEBZ 4CE6A 3UXOA 4QZ9A 4U6PA 4RQ6A 3EWAA 1NKBA 2HOFA 5IILA 3QZ7A 4PHAA 5AKGA 1S10A 2QB0B 5J2AA 4DQSA 2KSOA 5KG6A 2BCVA 2C2DA 2KP7A 2A1JB 4FZNA 4ECVA 4CNQA 2CN1A 4FFDA 2WB1C 5CB1A 3QUBA 4QZIA 3ORYA 3FYHA 8ICYA 3TQ1A 4PPXA 1ZQDA 1MQ3A 2FMQA 3QYPA 4NLCA 2KZZA 4JWMA 3SQIA 1N48A 3PW5A 1JX4A 1GO3F 2FPKA 3MBYA 7ICHA 4M6WB 2HBMA 8ICMA 3RH5A 1ZQPA 4UB4A 2WF8A 2LYBA 8ICTA 3TKAA 3A0BU 4KN7A 1RQNA 5ALJA 3MR6A 3M7DA 4YVZA 9ICUA 4LVSA 4DWIA 2EZZA 1ZOLA 5T14A 5L9XA 2MSNA 3NASA 2DKZA 4UB6U 5H2FU 3AU2A 1RYSA 3U26A 5ALHA 4NV0A 4NLBA 3ALRA 2W04A 2VA2A 2K4PA 2EDUA 2I1QA 4C4TA 5J2BA 8ICLA 1PVRA 4TUSA 4DSKA 3M8SA 1X42A 2FI1A 1PK1B 4GXIA 1DOQA 3JPRA 4RT3A 5J2FA 1ZQNA 4J03A 4NLKA 4LJXA 2MAXA 4F50A 2F1JA 2I9GA 2YTUA 2JMGA 3QXGA 2ZJAA 4F2SA 2E8PA 4YXMA 4I2IA 4Z6EA 5J8YA 1JROA 5KFGA 3LWLA 2OH2A 1NK6A 1QQ6A 3C1ZA 3T5HA 4US8A 3M9MB 2R8JA 3JPTA 3CNHA 1PK1A 4F71A 5EE9A 1RXVA 9ICSA 3WK4A 4NLGA 2DGZA 1NI3A 4I2DA 1JMSA 3SMVA 4O5CA 2Q4TA 3THVA 2HVIA 2N1RA 5ALPA 2IOHA 4YFKA 9ICWA 4RQ2A 1B4FA 2CXYA 2V4RA 4G3IA 4FS2A 5J2GA 2AGQA 4RPXA 1HEKA 4IQTA 4I28A 2E8OA 3K1ZA 4FBTA 2WF9A 8ICUA 1U48A 5DG9A 3MDAA 1S5LU 3M8RA 3MABA 4R65A 4F5PA 3NRWA 3DDHA 9ICMA 1J2MA 4M47A 3PSFA 3ETLA 3TADA 2WAQC 2EANA 1SZPA 3GQCA 2ESEA 4Y2JA 1SV0A 5J0TA 4KLEA 2ASJA 2H3IA 3RB6A 1BPEA 1ZQXA 5G5GA 1B43A 1NJYA 2RDJA 2EZXA 5AHXA 4LZDA 2BPGA 2DF4B 1XO1A 3TFSA 5EE0A 4CDGA 1C20A 2A1AA 2JR5A 5AM2A 4UARA 2RQ5A 2KG5A 3F5EA 5EWFA 2PFPA 5L1JA 5KG4A 1C7YA 5EOZA 3D2SA 3OHBA 2F2AB 2XCAA 3T5JA 2ZXIA 4UBBA 1ZQTA 4ECZA 2LI6A 2O6KA 3V72A 2BCRA 1ZD4A 2UVWA 5AI0A 3QUTA 2KK0A 3ZDBA 5KFMA 5IIIA 5KG1A 1KBUA 4NL9A 4RQ0A 2C2RA 4PZOA 3MFHA 4XQ8A 1WWUA 1WUDA 1V9PA 3IN5A 3TARA 2FMPA 1CEZA 1MN8A 4UQGA 2R18A 2P35A 2EAOA 4YP3A 3AL0B 2F3NA 2B0CA 3V7JA 5HHIA 2H3FA 5KFBA 2HHVA 4KLSA 4Y2SA 3MR2A 1RPLA 4X5VA 1XSNA 3B0XA 2WTFA 2XC9A 2KHQA 3ZDAA 4F93B 3WKAA 3MGVA 4Q43A 1RQLA 2WFAA 2OWOA 4J9MA 4IC9A 3LVWA 3ISDA 4R63A 3MDCA 2XY6A 1S0OA 4YCXA 5F9NA 2BPFA 5D4BA 2ZG6A 4Y2TA 2HHQA 2KD1A 1F44A 1S0NA 1TE2A 4C8KA 2NYVA 9ICTA 4IQWA 1QH9A 4Q8FA 8ICIA 1KEJA 2F77X 4MF8A 3Q8SB 4IR1A 1YZ6A 3M9NB 3SV3A 3UMGA 4USAA 5DDMA 1XSPA 1ZQQA 2ODGA 3Q8RB 5KFTA 4DFMA 5JTIA 5J2CA 5DLFA 1ZXIA 4JUZA 4ELVA 9ICQA 3PW7A 4YN4A 2FMSA 3KD3A 3B9JA 4BUGA 3IRUA 1RYRA 4KX5A 2H3ZA 1IM4A 4CF3A 3OPXA 3K75D 2FLLA 3WKEA 3VCBA 3BQTA 2H3QA 1Z00A 1MSWD 2L5YA 5AKYA 3H8JA 1SKWA 2NRVA 2YX8A 5IIJA 1TAMA 1OUQA 4A8EA 5ALTA 1ED1A 3AU6A 1U47A 1SWWA 5AK3A 1Z4NA 5IIOA 1N5XA 3C28A 3C1YA 1ZD3A 4J9NA 4AP9A 4EELA 4MFCA 2ZIWB 1LKYA 2ZJ5A 8ICCA 2HSZA 3RAQA 4RQ4A 1U9LA 4O3SA 9ICLA 1ZQMA 3JPPA 5ALWA 9ICIA 1VDVA 3PMLA 4P0PA 1PUZA 1ZQ1C 2QARA 4YMMA 4FBUA 2G5IB 4RPZA 5CRXA 3GIIA 1SIJA 3O0FA 2W9MA 1PVQA 3UPQA 5ALVA 1K1QA 1B22A 2G06A 5AKIA 1JIHA 3H0RB 3RJIA 2M9NA 3BS5B 2PFNA 3PW0A 3GV5B 2KV2A 4FE3A 5BOMA 3PO5A 1L6NA 5ALFA 2IA6A 5AIAA 9ICJA 9ICEA 2RLTA 2DKXA 3F2CA 3TI0A 2BR0A 1N61A 3QUCA 9ICNA 2FE9A 5DDYA 5ALRA 4AYBC 2HHSA 5J2KA 9ICCA 2YB4A 3NGDA 4Y2YA 4FZLA 7ICQA 3TACB 4I2HA 1Q3UA 4Y2QA 4JB3A 5AK6A 2KFNA 5ALKA 1SXEA 3KHGA 1TV9A 2ZIUB 1CRXA 2W9AA 5ALGA 7ICNA 5AK5A 5KAIU 5KFQA 2YN4A 2K89A 4QZ8A 1ZQLA 1FEZA 4GIBA 4JWNA 5AI9A 4OD0A 2XIDA 1EXNA 4DEZA 4IR9A 4P4OA 3Q8LA 5DKWA 1OW5A 1KL9A 1A6SA 7ICRA 8ICHA 2PKEA 2KMDA 4ECXA 3TAQA 2BGWA 5G5HA 2VANA 3OJSA 4YR2A 4OJPA 1KQQA 1SL2A 1UQVA 3CRXA 4YQWA 3GDXA 3H0MB 4DQIA 2LYHA 3HX0A 3RRHA 4DL3A 2JEJA 4OCZA 3BQ7A 3D2NA 5KT2A 2W9CA 3RH4A 1ZQOA 3UM9A 4PGXA 5L1IA 2GO7A 2WB1F 3ZI4A 2HOIA 1ZQSA 1JALA 3Q8QB 5CA7A 1N5WA 2KHVA 3SAHA 3F2BA 3CW2C 5KFSA 9ICHA 4GLXA 2EQYA 1U4BA 4NM1A 2IMWP 5TZVA 4B9TA 4MFFA 9ICXA 2DQNB 4NM2A 3RB0A 4PL1A 3BQ0A 4TQRA 4M9JA 1OXJA 1X9XA 2F44A 3I76A 2ATLA 4I2BA 4UAWA 4KMUA 2NRZA 5KL8B 4DFKA 1VJ5A 1JN3A 2NRXA 5D49A 4DSFA 5HMLA 2HW3A 4KX3A 2VIXA 3GIJA 2ZTCA 4BXOB 2AU0A 3N28A 5L1KA 3KKAC 2AH5A 5KFPA 3IHQB 3DV9A 4QWAA 5HNKA 4P4PA 2MA1A 4NLNA 4P0QB 3V7KA 2K4EA 1BPYA 5KTQA 5KFHA 4ELUA 2XGQA 1NZPA 2QB0A 5ALQA 4C7YA 1X9WA 4Y2VA 1RM6C 4CGZA 4Z6FA 5L1MA 2RRDA 1KTQA 3PMNA 4R8UB 2E3TA 2JGAA 2A1JA 4RZRA 1ZQJA 1NJZA 2ZIVB 8ICJA 5JRTA 3C5GA 1ZQFA 4YG2A 3WU2U 5ALYA 3NVZA 4QIWC 4I2FA 4QZBA 3A0HU 4B9UA 4BXOA 4I2EA 9ICOA 2W7PA 1N63A 4TQSA 2HMXA 1AROP 3F53A 1S8OA 4KLTA 5ALNA 4BGDA 2QB1A 4M6WA 3KHHA 5KT3A 3HJEA 4P0QA 1SB3C 2W7OA 1D9DA 1UA1A 2C2EA 3H40A 1HUOA 4OJLA 2EZYA 3C23A 4RNMA 3ZDDA 4FS1A 1T7PA 4EZ6A 5KFLA 3F5AA 4J9OA 4RUAA 1FIQA 5KFFA 4J9QA 1TK8A 3GILA 3H4DA 4QWBA 3OHAA 3I1YA 4KLGA 4ED0A 5J2HA 2GWSA 9ICRA 2DWQA 4EEYA 4GC7A 3UXNA 2ISOA 2I5HA 3R9KA 2W8LA 4KLOA 4M0AA 2QLTA 5HR6A 4ED2A 2WAQF 2JHDA 4ED3A 4B9MA 5ALOA 5KFJA 5DGBA 2PMZC 4JV2A 3KFUF 2J6TA 1Z1VA 3QU7A 4RQ5A 3PW4A 2KKVA 4TURA 4ACOA 3IDWA 3LDAA 2XI9A 2UVRA 3SAFA 3UMBA 2B21A 4R66A 2KFZA 2BKEA 4YXJA 3ZDCA 2K8CB 1QTMA 2PI5A 2CRXA 2ZIXB 4DQRA 3SENA 5KG7A 4DFJA 1XWLA 2E5SA 3G6VA 2Y0SC 4F5QA 4HYKA 4YD1A 8ICSA 4PGYA 3J81j 4F72A 8ICPA 8ICWA 2AXTU 2JH7A 4QW9A 5C0YA 1UT8A 4RQNA 5C5JA 4DS5A 3Q8MA 2ZUDA 4J9LA 2E8MA 4GC6A 3IM1A 2MUTB 1ZRNA 3N4MB 3ONNA 7ICTA 4RPYA 2HI0A 1L3VA 3PX0A 4US9A 3PVXA 4QWEA 3CYMA 2BQRA 1FFUA 4LZGA 4O5EA 4ELTA 2HVHA 3FDSA 5KFNA 4DL7A 1BVSA 2R8IA 2NO5A 2HHTA 1DK3A 5B66U 3V6KA 4I2AA 4FO6A 2ALZA 3H8WA 4MEXA 2LBOA 2KVSA 4O3PA 4O3QA 3HW8A 1UPHA 5AICA 1NK5A 1ZQYA 2ISPA 3SEIA 2PXIA 5HHHA 7ICVA 2YMQA 3KZIU 2P6UA 2BCUA 5EE1A 4BWMA 2AHOB 1PK3A 1LV5A 3SV4A 5DBAA 2W3SA 1DRGA 4ECTA 5DB8A 3RBDA 4R64A 2V4QA 1SKRA 4F5OA 4RT2A 4BJQA 5IINA 1SL1A 9ICFA 5AK4A 7ICMA 1IXRA 3F2DA 4C80A 3PSTA 1ZETA 1BPBA 4UASA 3V7LA 2E1FA 2LYAA 5J8YC 3T5KA 8ICVA 1COKA 3MFIA 4F4KA 3I28A 2NV3A 3G6XA 4KLMA 5CP2A 5KT5A 3PR4A 5ALIA 2HHXA 5KFAA 3GFKB 2W9BB 2YY6A 4UB1A 3KZXA 4DFPA 1V85A 3NTUA 1K1SA 4O3RA 4G9BA 5CHGA 4C0ZA 3K1RB 4NJ8A 1BGXT 3SYZA 1ZQAA 4QWDA 4TUQA 1PZNA 2Y1JA 3B0YA 3RJEA 5AKLA 1SZHA 5CJ7A 3AM9A 7ICSA 3JPNA 1O08A 4KLUA 3ETRA 3HWTA 5L1LA 2BDPA 1Z4OA 3ZDEA 3QX7A 5AKKA 1SV4A 3UQ2A 1X66A 1KRPA 2VA3A 4RUCA 1ZD5A 3RRGA 4F4XA 1NK7A 2W9BA 3TADC 4IS7A 4OO1J 9ICBA 3ICXA 1S76D 2JV3A 4XA5A 3RJKA 3PO4A 3GV7B 4B6JA 3LK9A 4IL6U 1WCLA 1N2XA 1U45A 1X9MA 2XO7A 2JEIA 2HCFA 3Q8KA 4JMUA 1YT3A 4C8MA 2C22A 8ICZA 1H38A 1KLNA 1V97A 4UAYA 5J0XA 4PHEA 3PV8A 8ICBA 3QU9A 4IQUA 3C2KA 2HHWA 4UBCA 4KTQA 3C29A 2E1EA 4GXJA 2K60A 4KLHA 4UAUA 2E8NA 4PZNA 5GTIU 1L7NA 2G07A 1RZTA 4C4SA 4PHDA 4DOCA 2F1HA 2DBYA 1DGJA 5DG8A 3QNMA 4EYIB 3UQ0A 4YMNA 5AKXA 4DO9A 3M1YA 4KLJA 1QSSA 1XO0A 3MC1A 2H5XA 2Z7JA 1ZQVA 3K4GA 1ZQIA 3AQFA 2D3DA 4AYBF 3RJHA 3QE9Y 4KMOB 2XGPA 2P66A 7ICLA 5CEHA 5ALLA 3IP4B 1WYGA 2DPJA 1NOMA 4UB2A 4F2RA 2HBLA 1MQ2A 4I27A 4UW9A 1ZRMA 4UB8U 2ZTDA 2BQUA 3OGUA 3RJFA 5JU5A 3PY8A 4PHPA 2FLNA 1NK0A 4DL2A 4FZMA 3T79A 4M9NA 5CR0A 2J6UA 2JH1A 1KW4A 5KFIA 4F4YA 4ED6A 2WHEA 4Q45A 4J9SA 3QEAZ 5B5EU 2KICA 3N7SC 3SAGA 5J2IA 3UXPA 3RBEA 2QKQA 3D2QA 8ICQA 3RB4A 2ZIWA 2BQ3A 4CCHA 2Y1IA 4CRXA 1WWVA 1ZYQA 1D8YA 9ICAA 3CP8A 5DB9A 3RJGA 2OM6A 5KFDA 5KFRA 2R8GA 4U7CA 2VKQA 2IHMA 3EW9A 3FAHA 3GV8B 4QZAA 3ISCA 4JV1A 4BX9C 2IOFA 1ECWA 2F76X 2KN7A 4NLZA 4KLQA 3BS5A 4B9VA 5AM0A 2AGPA 3HT3A 2KTQA 4EBEA 4DQPA 1FFVA 4QZHA 2FPMA 4C4RA 3M6ZA 1NK8A 1SKSA 1XNSA 4K4IA 3KKAA 4RQ1A 4KLDA 5J0SA 5E79U 4F92B 1HJPA 5D46A 2XCPA 3PSPA 5IIMA 9ICGA 1JI7A 1NK9A 1SWVA 2AQ4A 5ALZA 1Q8KA 3EUB2 1KFSA 1JXLA 3RR7A 5KFUA 2ZIUA 3BDPA 2W54A 3H4BA 3BQ2A 3GIMA 2BZFA 1T3QA 4UB3A 4DLEA 1TAQA 3BS7A 3NS1A 3LVVA 4DL5A 2K8BB 3T3FA 1K5OA 2EAMA 1T4GA 2KJ9A 1BPZA 2FLPA 4OJOA 4CF5A 4B9SA 1BNOA 3VC8A 5F3XB 1CI4A 3L4PA 4DF8A 3NVWA 3NVYA 1Z1BA 5J0PA 2KSOB 5KG3A 1TAUA 1DK2A 2M0NA 2XICA 4DSLA 2IBKA 1RDFA 3KOOA 5ALSA 2ZUBA 3PX4A 1HUZA 1B0XA
chains in the Genus database with same CATH topology
2EZYA 2ODGA 2BZFA 2EZXA 2EZZA 1CI4A 1QCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZY A;  2ODG A;  2BZF A;  2EZX A;  2EZZ A;  1CI4 A;  1QCK A; 
#chains in the Genus database with same CATH topology
 4EZ9 A;  3QU5 A;  3UMC A;  5AM4 A;  3C21 A;  1F5S A;  2JZB B;  3H8M A;  3AMZ A;  1ZQH A;  2F8K A;  4QIW F;  4YR3 A;  1L7O A;  3ZD9 A;  1KFD A;  1UA0 A;  3V6J A;  1QSY A;  4EBD A;  1QSL A;  1S0V A;  2LPE A;  2GOL A;  3EPG A;  2A19 A;  2W11 A;  3PX6 A;  1ZQU A;  3KBB A;  3PZP A;  2Q0Z X;  4BDP A;  4F5N A;  3QU4 A;  2XY5 A;  4JK1 A;  8ICN A;  4KLL A;  2HHU A;  7ICJ A;  4I2G A;  4ED8 A;  2PFQ A;  3TAP A;  1L5U A;  4M9G A;  4IRC A;  2BDU A;  3FM9 A;  1IV8 A;  4QJF B;  1ZQZ A;  2KJ8 A;  2KOB A;  2LHT A;  1KDH A;  2W3R A;  5J2J A;  4RQ3 A;  3PW2 A;  2JZB A;  3QU2 A;  1MA7 A;  3WK8 A;  3HKZ C;  2WF7 A;  2P6R A;  4EEK A;  4RQ8 A;  4RNN A;  4O9M A;  2GH1 A;  3AQE A;  5J0Y A;  2BCS A;  1BNP A;  1ZQB A;  4DL4 A;  2KZ3 A;  2EAP A;  2ASL A;  3RJJ A;  2ASD A;  2PMZ F;  4O3O A;  3NRZ A;  5KT7 A;  1UHU A;  2KIV A;  2F1I A;  1TK5 A;  5DQG A;  1N56 A;  1QQ5 A;  3EZ5 A;  3MR5 A;  1TVA A;  1XU4 A;  4QNL A;  4KLF A;  5DQH A;  2BPC A;  3RFA A;  3RAX A;  3LYS A;  1WCN A;  4F3O A;  5HP4 A;  1Z3E B;  4Q44 A;  1ZJM A;  2G09 A;  3GZF A;  5JUM A;  5DBB A;  2JEF A;  1V38 A;  4R8U A;  2Y0S F;  4M9L A;  2ZIV A;  4KIT B;  1NJW A;  1KFT A;  3D6J A;  2LKY A;  4Y2P A;  4DF4 A;  4NY8 A;  3JPO A;  2HBJ A;  5KFX A;  2W43 A;  1RG6 A;  5DGA A;  1UCV A;  7ICU A;  1X2I A;  3E2E A;  2ZXH A;  3C2L A;  2DFL A;  5KT6 A;  8ICA A;  3HRD D;  5KFY A;  3DEE A;  1WG8 A;  4DOB A;  1X9S A;  4O5K A;  4EYH B;  4JV0 A;  5AKJ A;  1ZQK A;  1KN5 A;  4RQM A;  1UT5 A;  2HOQ A;  9ICP A;  4K4G A;  1URJ A;  2VJ5 A;  4ECY A;  2BCQ A;  2OEH A;  1T8E A;  4M04 A;  1NZB A;  2I6X A;  1BPD A;  3MR3 A;  4YD2 A;  5J0R A;  3RR8 A;  3MGH A;  1XS9 D;  1Y88 A;  5J29 A;  1QQ7 A;  1JUD A;  4B9L A;  5BPC A;  8ICK A;  1QLN A;  1SGG A;  2D8C A;  3M6K A;  5IIK A;  2JRZ A;  5KFO A;  5KFZ A;  2AGO A;  4NXZ A;  4O3N A;  1FO4 A;  4DL6 A;  3NVV A;  1NNL A;  1XSL A;  3RB3 A;  1HIW A;  5TIS U;  2FDR A;  2RDI A;  2NRT A;  3QUQ A;  1NKE A;  4DFD A;  3WK6 A;  1U49 A;  4K4H A;  4RNO A;  5KFK A;  2OYY A;  3IG8 A;  2G0A A;  4PJ0 U;  2JXJ A;  1O03 A;  2WF6 A;  5KAF U;  5KL1 B;  5KG0 A;  3G6Y A;  2C28 A;  2ZIX A;  2G5H B;  2RP5 A;  1ZJN A;  3H0L B;  5J0U A;  4MHV A;  4O3M A;  1Q46 A;  8ICG A;  5AI6 A;  2ZUC A;  2ZTE A;  5J0Q A;  1Q3V A;  2W8K A;  2RHF A;  5J0O A;  4QWC A;  4PL2 A;  7ICI A;  4F4Z A;  5AI8 A;  2IHN A;  4Z6D A;  4YR0 A;  2DUY A;  1YZ7 A;  4C8L A;  5FP0 A;  4OJ6 A;  2MUT A;  1CUK A;  2KIW A;  1ZQR A;  1KKX A;  5KG5 A;  4F91 B;  2IOF K;  1L3U A;  2YMM A;  4MFA A;  2CPR A;  1S9F A;  7ICF A;  2HBK A;  5K4L A;  4Y2R A;  3ZD8 A;  3BZC A;  2YQE A;  3WK5 A;  3E58 A;  3SI8 A;  2R8K A;  3N7R C;  4EX7 A;  2XY7 A;  1XC9 A;  1S0M A;  1QCK A;  1ZQE A;  3MGI A;  4PGQ A;  4J9P A;  4ECQ A;  2KZM A;  5F9L A;  4P2H A;  5KT4 A;  4WJ3 B;  3JPS A;  1NJX A;  1X6I A;  7ICK A;  3WKB A;  4RU9 A;  2D6F C;  4EBC A;  1N62 A;  3Q8P B;  2FJ6 A;  3QZ8 A;  2A3V A;  4PH5 A;  3OTQ A;  4J9R A;  5ALU A;  2K8A A;  1N60 A;  2YML A;  4UAT A;  1L8L A;  4ZOH C;  5KFC A;  3TAN A;  5J0W A;  5CWR A;  2AJQ A;  2BHN A;  4M9H A;  1ZD2 P;  2YMP A;  4UAV A;  7ICO A;  8ICE A;  3C2M A;  3OSP A;  2F8L A;  4RQ7 A;  1IG6 A;  2KEY A;  4Y2U A;  5J2D A;  1L3S A;  1TFR A;  3RTV A;  4HAI A;  5ALD A;  1SV0 C;  2GLE A;  1COO A;  4BWJ A;  5DBC A;  2LM1 A;  2NRW A;  1T94 A;  3EYZ A;  2AQ0 A;  1Z00 B;  5AKZ A;  4TUP A;  1X40 A;  1L8O A;  5AKH A;  4GXK A;  2UVU A;  4ICA A;  4MEY A;  1MC8 A;  2KNJ A;  2NO4 A;  1PVP A;  3PSI A;  3BJY A;  3V6H A;  2R8H A;  1D9F A;  2K4H A;  2PI4 A;  1JRP A;  5EWE A;  1JXE A;  1TK0 A;  2DPI A;  1LKY B;  1IIP A;  4UB5 A;  3NUQ A;  1S97 A;  1KSP A;  3LWM A;  1A0P A;  2FPL A;  2VA8 A;  1S77 D;  4P0P B;  5DB6 A;  4DSJ A;  4ED7 A;  3KHR A;  3SR6 A;  2QAR B;  4NL9 C;  4C7Z A;  4DSE A;  5ALX A;  3HIL A;  2J6S A;  8ICR A;  1RYU A;  4IRD A;  1NKC A;  2Y9U A;  3L5K A;  3ISB A;  2KE7 A;  4DSI A;  4F5R A;  1D8B A;  5KG2 A;  4O0I A;  1J2N A;  4F8R A;  3L3F X;  2KJ5 A;  2LM4 A;  3FC4 A;  3WK9 A;  5J2E A;  2OXO A;  5BOL A;  4NWI A;  2G08 A;  4ECS A;  5A0L A;  3WKC A;  4QZC A;  4P4M A;  5EWG A;  4XUS A;  4ECU A;  2PFO A;  4KN4 A;  1X6J A;  4QW8 A;  5HR7 A;  1DGS A;  2B6G A;  1A77 A;  1BPX A;  2LMR A;  3BZK A;  4M2Y A;  2MRL A;  5DB7 A;  2HDO A;  5EE3 A;  5AM1 A;  1L7M A;  2VJ4 A;  4DQQ A;  4B9N A;  4Y2X A;  3IV6 A;  8ICX A;  4DLG A;  1AQ6 A;  2YB1 A;  2UVV A;  3H8S A;  3C5F A;  3T5L A;  5DLG A;  2OCE A;  4DCC A;  3EPI A;  1ZQG A;  2ZJ8 A;  7ICP A;  1Z19 A;  4GFJ A;  1L3T A;  2MU2 A;  4KLI A;  9ICV A;  4EX6 A;  3BQ1 A;  3H7I A;  5KNI A;  2K4I A;  2DL0 A;  3PR5 B;  5DG7 A;  1M6Y A;  4I2J A;  3AN1 A;  3WK7 A;  4EEN A;  4ED1 A;  1L7P A;  3ED5 A;  1NK4 A;  3E0F A;  1VLB A;  7ICE A;  3SD7 A;  4QZG A;  4DOA A;  3TFR A;  4C8O A;  4I2C A;  2KKP A;  3KTQ A;  2EH9 A;  3SZ2 A;  5AI5 A;  4QZD A;  2W9C B;  3N7P D;  3IG5 A;  3AUO A;  1P7D A;  4YMO A;  4IQV A;  5AKE A;  2KVC A;  1TKD A;  3KHL A;  2WF5 A;  1LB2 B;  3M9O B;  3RF9 A;  4QZE A;  3GIK A;  5AM5 A;  1F0M A;  5AI4 A;  4CF4 A;  4Q8E A;  1T3N A;  4J9K A;  4E0D A;  3GU3 A;  3AEV A;  4OJ5 A;  5HMM A;  2ES6 A;  5KFW A;  5KFE A;  3PNC A;  3HP6 A;  5DQI A;  3WKD A;  2XVT A;  1ZQW A;  5ALE A;  4Z6C A;  5AM3 A;  1LVH A;  1SXD A;  2W03 A;  1A76 A;  4XRH A;  5GTH U;  2H3V A;  4ECW A;  4UAZ A;  7ICG A;  1J97 A;  4IRK A;  3OJU A;  4C8N A;  3HPO A;  5ALM A;  4DS4 A;  1RXW A;  4MF2 A;  1D8L A;  8ICO A;  4I29 A;  2Y9T A;  4ZH4 A;  5AIB A;  2JEG A;  8ICF A;  5KFV A;  2V9W A;  3S6J A;  1ZQC A;  3RH6 A;  1DXS A;  4F4W A;  9ICK A;  3HKZ F;  4ECR A;  3N97 B;  3OSN A;  2W55 A;  3JPQ A;  2OHF A;  1SL0 A;  4QZF A;  3QEB Z;  4CE6 A;  3UXO A;  4QZ9 A;  4U6P A;  4RQ6 A;  3EWA A;  1NKB A;  2HOF A;  5IIL A;  3QZ7 A;  4PHA A;  5AKG A;  1S10 A;  2QB0 B;  5J2A A;  4DQS A;  2KSO A;  5KG6 A;  2BCV A;  2C2D A;  2KP7 A;  2A1J B;  4FZN A;  4ECV A;  4CNQ A;  2CN1 A;  4FFD A;  2WB1 C;  5CB1 A;  3QUB A;  4QZI A;  3ORY A;  3FYH A;  8ICY A;  3TQ1 A;  4PPX A;  1ZQD A;  1MQ3 A;  2FMQ A;  3QYP A;  4NLC A;  2KZZ A;  4JWM A;  3SQI A;  1N48 A;  3PW5 A;  1JX4 A;  1GO3 F;  2FPK A;  3MBY A;  7ICH A;  4M6W B;  2HBM A;  8ICM A;  3RH5 A;  1ZQP A;  4UB4 A;  2WF8 A;  2LYB A;  8ICT A;  3TKA A;  3A0B U;  4KN7 A;  1RQN A;  5ALJ A;  3MR6 A;  3M7D A;  4YVZ A;  9ICU A;  4LVS A;  4DWI A;  2EZZ A;  1ZOL A;  5T14 A;  5L9X A;  2MSN A;  3NAS A;  2DKZ A;  4UB6 U;  5H2F U;  3AU2 A;  1RYS A;  3U26 A;  5ALH A;  4NV0 A;  4NLB A;  3ALR A;  2W04 A;  2VA2 A;  2K4P A;  2EDU A;  2I1Q A;  4C4T A;  5J2B A;  8ICL A;  1PVR A;  4TUS A;  4DSK A;  3M8S A;  1X42 A;  2FI1 A;  1PK1 B;  4GXI A;  1DOQ A;  3JPR A;  4RT3 A;  5J2F A;  1ZQN A;  4J03 A;  4NLK A;  4LJX A;  2MAX A;  4F50 A;  2F1J A;  2I9G A;  2YTU A;  2JMG A;  3QXG A;  2ZJA A;  4F2S A;  2E8P A;  4YXM A;  4I2I A;  4Z6E A;  5J8Y A;  1JRO A;  5KFG A;  3LWL A;  2OH2 A;  1NK6 A;  1QQ6 A;  3C1Z A;  3T5H A;  4US8 A;  3M9M B;  2R8J A;  3JPT A;  3CNH A;  1PK1 A;  4F71 A;  5EE9 A;  1RXV A;  9ICS A;  3WK4 A;  4NLG A;  2DGZ A;  1NI3 A;  4I2D A;  1JMS A;  3SMV A;  4O5C A;  2Q4T A;  3THV A;  2HVI A;  2N1R A;  5ALP A;  2IOH A;  4YFK A;  9ICW A;  4RQ2 A;  1B4F A;  2CXY A;  2V4R A;  4G3I A;  4FS2 A;  5J2G A;  2AGQ A;  4RPX A;  1HEK A;  4IQT A;  4I28 A;  2E8O A;  3K1Z A;  4FBT A;  2WF9 A;  8ICU A;  1U48 A;  5DG9 A;  3MDA A;  1S5L U;  3M8R A;  3MAB A;  4R65 A;  4F5P A;  3NRW A;  3DDH A;  9ICM A;  1J2M A;  4M47 A;  3PSF A;  3ETL A;  3TAD A;  2WAQ C;  2EAN A;  1SZP A;  3GQC A;  2ESE A;  4Y2J A;  1SV0 A;  5J0T A;  4KLE A;  2ASJ A;  2H3I A;  3RB6 A;  1BPE A;  1ZQX A;  5G5G A;  1B43 A;  1NJY A;  2RDJ A;  2EZX A;  5AHX A;  4LZD A;  2BPG A;  2DF4 B;  1XO1 A;  3TFS A;  5EE0 A;  4CDG A;  1C20 A;  2A1A A;  2JR5 A;  5AM2 A;  4UAR A;  2RQ5 A;  2KG5 A;  3F5E A;  5EWF A;  2PFP A;  5L1J A;  5KG4 A;  1C7Y A;  5EOZ A;  3D2S A;  3OHB A;  2F2A B;  2XCA A;  3T5J A;  2ZXI A;  4UBB A;  1ZQT A;  4ECZ A;  2LI6 A;  2O6K A;  3V72 A;  2BCR A;  1ZD4 A;  2UVW A;  5AI0 A;  3QUT A;  2KK0 A;  3ZDB A;  5KFM A;  5III A;  5KG1 A;  1KBU A;  4NL9 A;  4RQ0 A;  2C2R A;  4PZO A;  3MFH A;  4XQ8 A;  1WWU A;  1WUD A;  1V9P A;  3IN5 A;  3TAR A;  2FMP A;  1CEZ A;  1MN8 A;  4UQG A;  2R18 A;  2P35 A;  2EAO A;  4YP3 A;  3AL0 B;  2F3N A;  2B0C A;  3V7J A;  5HHI A;  2H3F A;  5KFB A;  2HHV A;  4KLS A;  4Y2S A;  3MR2 A;  1RPL A;  4X5V A;  1XSN A;  3B0X A;  2WTF A;  2XC9 A;  2KHQ A;  3ZDA A;  4F93 B;  3WKA A;  3MGV A;  4Q43 A;  1RQL A;  2WFA A;  2OWO A;  4J9M A;  4IC9 A;  3LVW A;  3ISD A;  4R63 A;  3MDC A;  2XY6 A;  1S0O A;  4YCX A;  5F9N A;  2BPF A;  5D4B A;  2ZG6 A;  4Y2T A;  2HHQ A;  2KD1 A;  1F44 A;  1S0N A;  1TE2 A;  4C8K A;  2NYV A;  9ICT A;  4IQW A;  1QH9 A;  4Q8F A;  8ICI A;  1KEJ A;  2F77 X;  4MF8 A;  3Q8S B;  4IR1 A;  1YZ6 A;  3M9N B;  3SV3 A;  3UMG A;  4USA A;  5DDM A;  1XSP A;  1ZQQ A;  2ODG A;  3Q8R B;  5KFT A;  4DFM A;  5JTI A;  5J2C A;  5DLF A;  1ZXI A;  4JUZ A;  4ELV A;  9ICQ A;  3PW7 A;  4YN4 A;  2FMS A;  3KD3 A;  3B9J A;  4BUG A;  3IRU A;  1RYR A;  4KX5 A;  2H3Z A;  1IM4 A;  4CF3 A;  3OPX A;  3K75 D;  2FLL A;  3WKE A;  3VCB A;  3BQT A;  2H3Q A;  1Z00 A;  1MSW D;  2L5Y A;  5AKY A;  3H8J A;  1SKW A;  2NRV A;  2YX8 A;  5IIJ A;  1TAM A;  1OUQ A;  4A8E A;  5ALT A;  1ED1 A;  3AU6 A;  1U47 A;  1SWW A;  5AK3 A;  1Z4N A;  5IIO A;  1N5X A;  3C28 A;  3C1Y A;  1ZD3 A;  4J9N A;  4AP9 A;  4EEL A;  4MFC A;  2ZIW B;  1LKY A;  2ZJ5 A;  8ICC A;  2HSZ A;  3RAQ A;  4RQ4 A;  1U9L A;  4O3S A;  9ICL A;  1ZQM A;  3JPP A;  5ALW A;  9ICI A;  1VDV A;  3PML A;  4P0P A;  1PUZ A;  1ZQ1 C;  2QAR A;  4YMM A;  4FBU A;  2G5I B;  4RPZ A;  5CRX A;  3GII A;  1SIJ A;  3O0F A;  2W9M A;  1PVQ A;  3UPQ A;  5ALV A;  1K1Q A;  1B22 A;  2G06 A;  5AKI A;  1JIH A;  3H0R B;  3RJI A;  2M9N A;  3BS5 B;  2PFN A;  3PW0 A;  3GV5 B;  2KV2 A;  4FE3 A;  5BOM A;  3PO5 A;  1L6N A;  5ALF A;  2IA6 A;  5AIA A;  9ICJ A;  9ICE A;  2RLT A;  2DKX A;  3F2C A;  3TI0 A;  2BR0 A;  1N61 A;  3QUC A;  9ICN A;  2FE9 A;  5DDY A;  5ALR A;  4AYB C;  2HHS A;  5J2K A;  9ICC A;  2YB4 A;  3NGD A;  4Y2Y A;  4FZL A;  7ICQ A;  3TAC B;  4I2H A;  1Q3U A;  4Y2Q A;  4JB3 A;  5AK6 A;  2KFN A;  5ALK A;  1SXE A;  3KHG A;  1TV9 A;  2ZIU B;  1CRX A;  2W9A A;  5ALG A;  7ICN A;  5AK5 A;  5KAI U;  5KFQ A;  2YN4 A;  2K89 A;  4QZ8 A;  1ZQL A;  1FEZ A;  4GIB A;  4JWN A;  5AI9 A;  4OD0 A;  2XID A;  1EXN A;  4DEZ A;  4IR9 A;  4P4O A;  3Q8L A;  5DKW A;  1OW5 A;  1KL9 A;  1A6S A;  7ICR A;  8ICH A;  2PKE A;  2KMD A;  4ECX A;  3TAQ A;  2BGW A;  5G5H A;  2VAN A;  3OJS A;  4YR2 A;  4OJP A;  1KQQ A;  1SL2 A;  1UQV A;  3CRX A;  4YQW A;  3GDX A;  3H0M B;  4DQI A;  2LYH A;  3HX0 A;  3RRH A;  4DL3 A;  2JEJ A;  4OCZ A;  3BQ7 A;  3D2N A;  5KT2 A;  2W9C A;  3RH4 A;  1ZQO A;  3UM9 A;  4PGX A;  5L1I A;  2GO7 A;  2WB1 F;  3ZI4 A;  2HOI A;  1ZQS A;  1JAL A;  3Q8Q B;  5CA7 A;  1N5W A;  2KHV A;  3SAH A;  3F2B A;  3CW2 C;  5KFS A;  9ICH A;  4GLX A;  2EQY A;  1U4B A;  4NM1 A;  2IMW P;  5TZV A;  4B9T A;  4MFF A;  9ICX A;  2DQN B;  4NM2 A;  3RB0 A;  4PL1 A;  3BQ0 A;  4TQR A;  4M9J A;  1OXJ A;  1X9X A;  2F44 A;  3I76 A;  2ATL A;  4I2B A;  4UAW A;  4KMU A;  2NRZ A;  5KL8 B;  4DFK A;  1VJ5 A;  1JN3 A;  2NRX A;  5D49 A;  4DSF A;  5HML A;  2HW3 A;  4KX3 A;  2VIX A;  3GIJ A;  2ZTC A;  4BXO B;  2AU0 A;  3N28 A;  5L1K A;  3KKA C;  2AH5 A;  5KFP A;  3IHQ B;  3DV9 A;  4QWA A;  5HNK A;  4P4P A;  2MA1 A;  4NLN A;  4P0Q B;  3V7K A;  2K4E A;  1BPY A;  5KTQ A;  5KFH A;  4ELU A;  2XGQ A;  1NZP A;  2QB0 A;  5ALQ A;  4C7Y A;  1X9W A;  4Y2V A;  1RM6 C;  4CGZ A;  4Z6F A;  5L1M A;  2RRD A;  1KTQ A;  3PMN A;  4R8U B;  2E3T A;  2JGA A;  2A1J A;  4RZR A;  1ZQJ A;  1NJZ A;  2ZIV B;  8ICJ A;  5JRT A;  3C5G A;  1ZQF A;  4YG2 A;  3WU2 U;  5ALY A;  3NVZ A;  4QIW C;  4I2F A;  4QZB A;  3A0H U;  4B9U A;  4BXO A;  4I2E A;  9ICO A;  2W7P A;  1N63 A;  4TQS A;  2HMX A;  1ARO P;  3F53 A;  1S8O A;  4KLT A;  5ALN A;  4BGD A;  2QB1 A;  4M6W A;  3KHH A;  5KT3 A;  3HJE A;  4P0Q A;  1SB3 C;  2W7O A;  1D9D A;  1UA1 A;  2C2E A;  3H40 A;  1HUO A;  4OJL A;  2EZY A;  3C23 A;  4RNM A;  3ZDD A;  4FS1 A;  1T7P A;  4EZ6 A;  5KFL A;  3F5A A;  4J9O A;  4RUA A;  1FIQ A;  5KFF A;  4J9Q A;  1TK8 A;  3GIL A;  3H4D A;  4QWB A;  3OHA A;  3I1Y A;  4KLG A;  4ED0 A;  5J2H A;  2GWS A;  9ICR A;  2DWQ A;  4EEY A;  4GC7 A;  3UXN A;  2ISO A;  2I5H A;  3R9K A;  2W8L A;  4KLO A;  4M0A A;  2QLT A;  5HR6 A;  4ED2 A;  2WAQ F;  2JHD A;  4ED3 A;  4B9M A;  5ALO A;  5KFJ A;  5DGB A;  2PMZ C;  4JV2 A;  3KFU F;  2J6T A;  1Z1V A;  3QU7 A;  4RQ5 A;  3PW4 A;  2KKV A;  4TUR A;  4ACO A;  3IDW A;  3LDA A;  2XI9 A;  2UVR A;  3SAF A;  3UMB A;  2B21 A;  4R66 A;  2KFZ A;  2BKE A;  4YXJ A;  3ZDC A;  2K8C B;  1QTM A;  2PI5 A;  2CRX A;  2ZIX B;  4DQR A;  3SEN A;  5KG7 A;  4DFJ A;  1XWL A;  2E5S A;  3G6V A;  2Y0S C;  4F5Q A;  4HYK A;  4YD1 A;  8ICS A;  4PGY A;  3J81 j;  4F72 A;  8ICP A;  8ICW A;  2AXT U;  2JH7 A;  4QW9 A;  5C0Y A;  1UT8 A;  4RQN A;  5C5J A;  4DS5 A;  3Q8M A;  2ZUD A;  4J9L A;  2E8M A;  4GC6 A;  3IM1 A;  2MUT B;  1ZRN A;  3N4M B;  3ONN A;  7ICT A;  4RPY A;  2HI0 A;  1L3V A;  3PX0 A;  4US9 A;  3PVX A;  4QWE A;  3CYM A;  2BQR A;  1FFU A;  4LZG A;  4O5E A;  4ELT A;  2HVH A;  3FDS A;  5KFN A;  4DL7 A;  1BVS A;  2R8I A;  2NO5 A;  2HHT A;  1DK3 A;  5B66 U;  3V6K A;  4I2A A;  4FO6 A;  2ALZ A;  3H8W A;  4MEX A;  2LBO A;  2KVS A;  4O3P A;  4O3Q A;  3HW8 A;  1UPH A;  5AIC A;  1NK5 A;  1ZQY A;  2ISP A;  3SEI A;  2PXI A;  5HHH A;  7ICV A;  2YMQ A;  3KZI U;  2P6U A;  2BCU A;  5EE1 A;  4BWM A;  2AHO B;  1PK3 A;  1LV5 A;  3SV4 A;  5DBA A;  2W3S A;  1DRG A;  4ECT A;  5DB8 A;  3RBD A;  4R64 A;  2V4Q A;  1SKR A;  4F5O A;  4RT2 A;  4BJQ A;  5IIN A;  1SL1 A;  9ICF A;  5AK4 A;  7ICM A;  1IXR A;  3F2D A;  4C80 A;  3PST A;  1ZET A;  1BPB A;  4UAS A;  3V7L A;  2E1F A;  2LYA A;  5J8Y C;  3T5K A;  8ICV A;  1COK A;  3MFI A;  4F4K A;  3I28 A;  2NV3 A;  3G6X A;  4KLM A;  5CP2 A;  5KT5 A;  3PR4 A;  5ALI A;  2HHX A;  5KFA A;  3GFK B;  2W9B B;  2YY6 A;  4UB1 A;  3KZX A;  4DFP A;  1V85 A;  3NTU A;  1K1S A;  4O3R A;  4G9B A;  5CHG A;  4C0Z A;  3K1R B;  4NJ8 A;  1BGX T;  3SYZ A;  1ZQA A;  4QWD A;  4TUQ A;  1PZN A;  2Y1J A;  3B0Y A;  3RJE A;  5AKL A;  1SZH A;  5CJ7 A;  3AM9 A;  7ICS A;  3JPN A;  1O08 A;  4KLU A;  3ETR A;  3HWT A;  5L1L A;  2BDP A;  1Z4O A;  3ZDE A;  3QX7 A;  5AKK A;  1SV4 A;  3UQ2 A;  1X66 A;  1KRP A;  2VA3 A;  4RUC A;  1ZD5 A;  3RRG A;  4F4X A;  1NK7 A;  2W9B A;  3TAD C;  4IS7 A;  4OO1 J;  9ICB A;  3ICX A;  1S76 D;  2JV3 A;  4XA5 A;  3RJK A;  3PO4 A;  3GV7 B;  4B6J A;  3LK9 A;  4IL6 U;  1WCL A;  1N2X A;  1U45 A;  1X9M A;  2XO7 A;  2JEI A;  2HCF A;  3Q8K A;  4JMU A;  1YT3 A;  4C8M A;  2C22 A;  8ICZ A;  1H38 A;  1KLN A;  1V97 A;  4UAY A;  5J0X A;  4PHE A;  3PV8 A;  8ICB A;  3QU9 A;  4IQU A;  3C2K A;  2HHW A;  4UBC A;  4KTQ A;  3C29 A;  2E1E A;  4GXJ A;  2K60 A;  4KLH A;  4UAU A;  2E8N A;  4PZN A;  5GTI U;  1L7N A;  2G07 A;  1RZT A;  4C4S A;  4PHD A;  4DOC A;  2F1H A;  2DBY A;  1DGJ A;  5DG8 A;  3QNM A;  4EYI B;  3UQ0 A;  4YMN A;  5AKX A;  4DO9 A;  3M1Y A;  4KLJ A;  1QSS A;  1XO0 A;  3MC1 A;  2H5X A;  2Z7J A;  1ZQV A;  3K4G A;  1ZQI A;  3AQF A;  2D3D A;  4AYB F;  3RJH A;  3QE9 Y;  4KMO B;  2XGP A;  2P66 A;  7ICL A;  5CEH A;  5ALL A;  3IP4 B;  1WYG A;  2DPJ A;  1NOM A;  4UB2 A;  4F2R A;  2HBL A;  1MQ2 A;  4I27 A;  4UW9 A;  1ZRM A;  4UB8 U;  2ZTD A;  2BQU A;  3OGU A;  3RJF A;  5JU5 A;  3PY8 A;  4PHP A;  2FLN A;  1NK0 A;  4DL2 A;  4FZM A;  3T79 A;  4M9N A;  5CR0 A;  2J6U A;  2JH1 A;  1KW4 A;  5KFI A;  4F4Y A;  4ED6 A;  2WHE A;  4Q45 A;  4J9S A;  3QEA Z;  5B5E U;  2KIC A;  3N7S C;  3SAG A;  5J2I A;  3UXP A;  3RBE A;  2QKQ A;  3D2Q A;  8ICQ A;  3RB4 A;  2ZIW A;  2BQ3 A;  4CCH A;  2Y1I A;  4CRX A;  1WWV A;  1ZYQ A;  1D8Y A;  9ICA A;  3CP8 A;  5DB9 A;  3RJG A;  2OM6 A;  5KFD A;  5KFR A;  2R8G A;  4U7C A;  2VKQ A;  2IHM A;  3EW9 A;  3FAH A;  3GV8 B;  4QZA A;  3ISC A;  4JV1 A;  4BX9 C;  2IOF A;  1ECW A;  2F76 X;  2KN7 A;  4NLZ A;  4KLQ A;  3BS5 A;  4B9V A;  5AM0 A;  2AGP A;  3HT3 A;  2KTQ A;  4EBE A;  4DQP A;  1FFV A;  4QZH A;  2FPM A;  4C4R A;  3M6Z A;  1NK8 A;  1SKS A;  1XNS A;  4K4I A;  3KKA A;  4RQ1 A;  4KLD A;  5J0S A;  5E79 U;  4F92 B;  1HJP A;  5D46 A;  2XCP A;  3PSP A;  5IIM A;  9ICG A;  1JI7 A;  1NK9 A;  1SWV A;  2AQ4 A;  5ALZ A;  1Q8K A;  3EUB 2;  1KFS A;  1JXL A;  3RR7 A;  5KFU A;  2ZIU A;  3BDP A;  2W54 A;  3H4B A;  3BQ2 A;  3GIM A;  2BZF A;  1T3Q A;  4UB3 A;  4DLE A;  1TAQ A;  3BS7 A;  3NS1 A;  3LVV A;  4DL5 A;  2K8B B;  3T3F A;  1K5O A;  2EAM A;  1T4G A;  2KJ9 A;  1BPZ A;  2FLP A;  4OJO A;  4CF5 A;  4B9S A;  1BNO A;  3VC8 A;  5F3X B;  1CI4 A;  3L4P A;  4DF8 A;  3NVW A;  3NVY A;  1Z1B A;  5J0P A;  2KSO B;  5KG3 A;  1TAU A;  1DK2 A;  2M0N A;  2XIC A;  4DSL A;  2IBK A;  1RDF A;  3KOO A;  5ALS A;  2ZUB A;  3PX4 A;  1HUZ A;  1B0X A; 
#chains in the Genus database with same CATH homology
 2EZY A;  2ODG A;  2BZF A;  2EZX A;  2EZZ A;  1CI4 A;  1QCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...