1QCKA

Solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure plus 20 individual simulated annealing structures
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
89
structure length
89
Chain Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR)
publication title IMPROVING THE PACKING AND ACCURACY OF NMR STRUCTURES WITH A PSEUDOPOTENTIAL FOR THE RADIUS OF GYRATION
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 89
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02961 BAF Barrier to autointegration factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.40 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Barrier-to-autointegration factor, BAF 1qckA00
2BZFA 1QCKA 2ODGA 1CI4A 2EZYA 2EZZA 2EZXA
chains in the Genus database with same CATH superfamily
1ZQTA 5ALDA 1X42A 4JV0A 3M7DA 4NLBA 4CCHA 8ICNA 2G08A 1SB3C 4DOCA 4IL6U 1KRPA 4ECZA 5KG4A 9ICQA 4QIWC 5H2FU 5J8YC 3QZ8A 8ICMA 2P35A 4O3MA 3ORYA 1KBUA 2JEJA 4KLTA 1ZQMA 4ZOHC 1C20A 1BVSA 5DQGA 1S76D 1TK5A 2AH5A 8ICHA 4IR9A 4Q44A 4CRXA 1SXDA 3JPNA 5AI0A 3Q8RB 2F8KA 3EW9A 3SR6A 3GV5B 4A8EA 5BPCA 2KIWA 2JGAA 3RB6A 5ALTA 4NL9C 5KFOA 5CJ7A 4DSIA 4NLNA 2WTFA 5AKLA 2GO7A 1OUQA 2Y9TA 3ZDAA 1SV0C 3L5KA 5AKKA 2W7PA 3V6KA 5AKGA 3SAHA 1CRXA 3T3FA 4XA5A 1Z3EB 1NK5A 2KMDA 2LYBA 2I5HA 4I2JA 5ALPA 4R8UB 1V97A 1PK3A 4EEYA 4NJ8A 4F71A 3DDHA 2P6UA 3UMCA 1FFVA 1YZ6A 5HHIA 3M9MB 9ICEA 2YB4A 3KOOA 5KG2A 3QU7A 1Z4OA 4ECVA 2L5YA 4C8KA 2WB1C 2E5SA 1ZQXA 2HCFA 1TFRA 1JMSA 4CNQA 2DFLA 2FMQA 1S97A 1ZETA 4BDPA 1S0MA 3QYPA 4EZ6A 3CP8A 2F3NA 1NJYA 3I28A 1ZQHA 3PW2A 4QZHA 1KFDA 3H4BA 3UQ2A 2A3VA 3WKEA 5EE3A 3OPXA 3KKAC 4BXOA 4YCXA 1ZQOA 1D9DA 1KEJA 2ZUDA 1BPEA 1D8BA 2RQ5A 3T5LA 1X9SA 3MGIA 2HHXA 5KG1A 3WK9A 3T5JA 2OM6A 3QEBZ 2F1IA 1X66A 2B0CA 2XC9A 1J2MA 4YR3A 4B9TA 4ECWA 3KZXA 3T5KA 1ZQKA 4YR2A 3B0XA 3THVA 1MQ3A 3TQ1A 2KFNA 3QUTA 3TARA 4LJXA 2WF5A 2ZJ8A 4PGXA 2BGWA 3SAFA 5J29A 3MC1A 2LBOA 1SL1A 3NVVA 1NK0A 2NV3A 4ED8A 2Y1JA 3NGDA 1CEZA 4EBCA 2RDIA 2I6XA 4DS4A 5KFKA 5AM5A 1X6JA 4BXOB 2JH1A 2DWQA 4ED1A 2F44A 3JPRA 4LZDA 1BPDA 4F4YA 4UATA 1ZD4A 2KE7A 4QZIA 4J03A 2DL0A 3GIIA 2PXIA 9ICAA 4GIBA 2JXJA 4I2EA 4UB1A 5J2BA 3WK4A 1IXRA 2R18A 4KLLA 2XGPA 1SZPA 5F9LA 4M47A 1P7DA 4GC6A 3M9NB 4M04A 4J9OA 4QJFB 2WAQF 4I2DA 3WK6A 2CN1A 1BPYA 3WK5A 1ZD3A 4YQWA 5KTQA 2WHEA 5ALKA 3TACB 2Z7JA 5AKYA 3AQFA 2VA8A 4NM2A 4PHAA 3ICXA 3HX0A 2DPJA 4NV0A 3K75D 4DS5A 2AXTU 3F53A 5ALHA 8ICRA 4F4KA 3EUB2 3GFKB 1ZQLA 3NVZA 5KG7A 4UBCA 1EXNA 4GLXA 1K1QA 5ALMA 4DFMA 5AM4A 2B21A 1LKYA 4FBUA 4I2AA 2K4EA 5KG3A 5CP2A 3GV8B 2K8CB 1A6SA 1S0OA 4BJQA 3PMLA 4RNMA 1XSNA 2XY5A 5D46A 4F50A 2D3DA 8ICOA 2BCVA 4DSLA 4DF4A 4F4XA 1D8YA 3NRZA 1NKBA 3PR5B 2M9NA 3PR4A 4GXKA 2DQNB 2VA3A 2HDOA 5ALSA 5AKEA 2BDPA 3FAHA 1L7NA 5AI5A 5HP4A 4O5KA 5TZVA 2JMGA 1NJXA 4EYIB 3SQIA 9ICJA 5DBCA 3PV8A 4P4PA 4QZFA 3QU5A 7ICLA 5AIBA 2ZUBA 9ICSA 5AKXA 1ZYQA 2ZJAA 3A0BU 4E0DA 2PFPA 4KLDA 5DB9A 1IM4A 1JUDA 3V72A 1S0VA 9ICRA 5KT2A 5KFTA 1MQ2A 3PX0A 4F3OA 9ICPA 4DSFA 1UPHA 3E2EA 4DSJA 5JU5A 5EWGA 3ALRA 4OD0A 1WCLA 5AK5A 5J2IA 1OW5A 3UXOA 4RQ5A 5KFHA 3BJYA 1Q3VA 1HIWA 4FZLA 5DKWA 5AM0A 4F5PA 1LV5A 2HVHA 2ZJ5A 4MHVA 4B6JA 4KLUA 8ICVA 2LM4A 3RTVA 4RQ4A 1X9MA 2BDUA 1OXJA 3JPTA 3LYSA 4FFDA 3BQTA 3U26A 3AU2A 2ZTEA 3TANA 1WWUA 3F5AA 3UXNA 4EX7A 5DQIA 4DOAA 1O08A 2BZFA 2PKEA 3UMGA 4QW9A 4QZ9A 4DSEA 2NO5A 4RT3A 4C8NA 1AROP 5AI6A 2FLPA 4ED3A 5AM3A 4RNOA 2A1JA 4K4HA 3C29A 5ALNA 3T79A 4ELVA 3PZPA 1T4GA 5KFAA 5CRXA 1XSLA 4NLKA 2FPKA 9ICMA 5KFRA 8ICSA 5KG0A 4TQRA 2H3FA 3PW4A 3Q8QB 3EYZA 5AKZA 1WYGA 1N5WA 4Q8EA 2YMPA 4Q43A 5CEHA 2KZZA 1ZQVA 5CB1A 4TUSA 3C21A 2LM1A 4PGQA 1KLNA 2MRLA 3WKAA 1JI7A 1X6IA 5TISU 1Y88A 4YXMA 4ED6A 1RYSA 1ZD2P 4CE6A 4C7YA 3QEAZ 3LVVA 2ODGA 3RJIA 3D2SA 1QLNA 3ETRA 4IRKA 2OEHA 3O0FA 5DGAA 4TUPA 1UA0A 2W7OA 2HHVA 2IMWP 2WF6A 1JXLA 5ALJA 4MEXA 4JB3A 4P0QA 4KLQA 3V7LA 2KHVA 3TI0A 3ISBA 2JV3A 1NJWA 1N63A 2KFZA 2FDRA 3F2DA 4PZNA 1FFUA 2E8OA 3OHAA 4O3SA 5ALEA 4EEKA 4RQMA 1S10A 2KKPA 1ZQYA 3RAQA 2KV2A 4PHEA 1YZ7A 5ALLA 3C1ZA 5IIIA 3D6JA 4RQ8A 2NYVA 2O6KA 4NLCA 4C80A 5KFPA 9ICXA 1S9FA 4DQRA 1A0PA 7ICQA 5AM2A 3BQ7A 4PHDA 4UAZA 3ONNA 2HHWA 5KNIA 5EE1A 3WKDA 2BQRA 2E1FA 9ICFA 2W55A 4P0QB 4R66A 2JHDA 3M6KA 1X9WA 2V4RA 4PH5A 1HUOA 8ICAA 7ICNA 1MN8A 2DKZA 1ZD5A 2YY6A 2LI6A 5J0RA 4QWAA 3OHBA 2RHFA 3ED5A 3QUBA 4PL1A 4YR0A 4K4GA 2H3VA 2E8NA 5DDMA 4IRCA 1L3TA 5HR7A 5G5GA 1XWLA 2Y9UA 3SMVA 3NUQA 4F8RA 5KFNA 3SI8A 7ICFA 3RRHA 1PVQA 3QU4A 4XUSA 3M8RA 1B43A 4I2FA 7ICRA 3MDAA 4US8A 3KHLA 2XVTA 5KFGA 2KN7A 1D9FA 5KFJA 2IA6A 4G3IA 4QZAA 2HW3A 5KT5A 2ATLA 3V7KA 2C28A 2IOFK 3H7IA 3C2LA 3TADC 2AQ4A 3V6JA 4DL2A 1L8OA 1S77D 1TVAA 1ZQ1C 5KFZA 4DL4A 2ES6A 1H38A 3G6XA 1D8LA 3HKZC 3KFUF 3PNCA 2HHUA 3LWLA 4J9LA 4DFDA 3BS7A 2EH9A 1RPLA 4FO6A 2HBKA 5GTIU 1ZQQA 4R8UA 4UB5A 1T3NA 2ZIUA 4C4SA 4XQ8A 1T7PA 2G06A 3ZDCA 4QWEA 3CYMA 4O3PA 5J0QA 1S8OA 5AHXA 4DSKA 5KFCA 2RP5A 4J9RA 1CI4A 2W9CA 1L3SA 2M0NA 5FP0A 4QZBA 2KJ5A 3H8MA 5J2JA 1S0NA 2YTUA 5DQHA 2KZMA 3IG5A 3RB3A 9ICVA 1NKEA 4JMUA 1QQ7A 1KFSA 4DOBA 1JRPA 1ECWA 4DL7A 3H0RB 4OO1J 4C4RA 8ICLA 3IV6A 1DK3A 5IILA 2AGOA 5DB8A 2ZIUB 5KFVA 4IRDA 1SZHA 1ZQUA 2F8LA 1U49A 1UT8A 4KLOA 4US9A 2RRDA 3Q8PB 3RRGA 2G5HB 2R8HA 4MF2A 4KLEA 2HOIA 1WWVA 4F72A 5KT6A 3EPGA 2W9CB 4DL6A 1ZQBA 2ZIVB 1UCVA 2E8MA 4CF5A 2MU2A 4IQTA 4UB3A 3EZ5A 1ZQCA 2WF7A 3T5HA 3N97B 2ISPA 7ICPA 3HP6A 4RQ7A 4YXJA 5BOLA 5DG9A 2CPRA 3I1YA 1B4FA 3E0FA 1ZQGA 3MR2A 5J8YA 1PVPA 3MR5A 3K4GA 4Y2XA 2V4QA 4F5RA 5DBAA 7ICKA 1IV8A 3MFHA 4DCCA 1Z19A 4I2HA 4EYHB 1K5OA 3QXGA 1SL2A 2GH1A 2F2AB 2BHNA 2KHQA 4I2BA 2KG5A 4KMUA 2ISOA 5T14A 5C5JA 4UQGA 1N61A 2AHOB 2NRXA 2W43A 4LZGA 3PW5A 3GDXA 1PZNA 1V85A 4AP9A 4NL9A 4JWNA 4RQ3A 4Y2RA 3PO5A 5J2HA 2KSOA 1SV0A 3L3FX 1RG6A 3RJFA 4QWDA 3QX7A 3JPSA 5DBBA 3RH4A 3CRXA 1RQNA 4ECYA 4C0ZA 1XSPA 1Q8KA 2R8JA 3BQ1A 3BQ0A 2BPCA 1SGGA 3PW0A 2XCPA 2YB1A 5AKIA 5L1IA 8ICZA 5KG6A 2LHTA 1FEZA 2HBJA 1KW4A 2H3QA 4ICAA 3HT3A 3N4MB 2KZ3A 2KSOB 3CW2C 2XY6A 4IC9A 1XO1A 3PVXA 5L1MA 4YG2A 1U4BA 5B5EU 1L8LA 9ICKA 5IIJA 4O5CA 3KKAA 5KFFA 4FE3A 2HBMA 1RYUA 2OCEA 3PSPA 3V7JA 2A1AA 4RU9A 1SWVA 3H8JA 4KLMA 2P66A 5KFYA 5J0YA 5J0SA 4UB4A 4J9MA 3UMBA 2F1JA 1KN5A 4DEZA 4RQ0A 3B0YA 4NLZA 4DQQA 2MUTB 1ZRNA 5K4LA 3RJJA 4ED2A 2EAMA 1Q46A 3H8WA 4EZ9A 2FLNA 4DWIA 5EWFA 1RZTA 1V9PA 4QZGA 2WAQC 1V38A 5AK4A 2MA1A 4CF3A 1COKA 1T8EA 2HOFA 1IG6A 3NASA 1CUKA 4M2YA 1MC8A 2C2EA 3AEVA 3HW8A 2UVUA 3BDPA 4ELTA 4EBEA 1XC9A 4BWMA 2FMSA 3PX4A 1DGJA 4ECXA 4P4MA 4KX5A 5IINA 4P4OA 2K4HA 1URJA 1Z1VA 4X5VA 3E58A 1NI3A 5J0TA 9ICUA 4EX6A 4XRHA 3GZFA 4R63A 4CDGA 1ED1A 2YMQA 3N7SC 9ICNA 4AYBF 2EAPA 1TE2A 4Z6DA 4ECQA 5ALQA 4P0PA 2W8LA 4F5NA 1SXEA 2EZYA 4PPXA 4O3OA 4M6WA 1NK4A 1COOA 4HAIA 2QB1A 2PFQA 1ZQPA 1NK8A 4Y2JA 2P6RA 2NRWA 2PI5A 2LYAA 2IHMA 4OCZA 3H0LB 1U47A 4KITB 1NK6A 3RJHA 4USAA 4QZEA 3GQCA 1N2XA 4BWJA 4J9SA 2FI1A 9ICBA 4DFKA 2R8IA 3AMZA 3I76A 5KFMA 8ICKA 4JV1A 1M6YA 1JX4A 4J9KA 3M1YA 3OTQA 4MF8A 4P0PB 2WF9A 4B9SA 4B9UA 5DLFA 1KFTA 4M6WB 4F5QA 2NO4A 1VLBA 7ICGA 3IP4B 2VJ5A 2LPEA 3PSIA 2WF8A 3EPIA 1NK7A 9ICLA 1ZOLA 3IG8A 2YX8A 3NVWA 3ZD9A 2E3TA 4QNLA 3BZCA 3K1ZA 1RDFA 4WJ3B 5DG7A 2KJ9A 2BKEA 2FJ6A 1T3QA 4QW8A 2JR5A 1Z4NA 3C23A 3OSPA 1ZQFA 9ICWA 2J6UA 3QUQA 2HSZA 1BNPA 3N28A 3F2CA 2W9AA 3D2NA 2I1QA 4RUCA 4MFFA 2BPFA 1AQ6A 4B9LA 4ECRA 3H0MB 4EBDA 4MFAA 4Q45A 3HILA 5L1KA 4F5OA 2FE9A 3GV7B 4I2GA 4B9MA 4DF8A 2W03A 4YFKA 1UHUA 3PSFA 5IIOA 2Q4TA 4M0AA 5ALFA 4F2SA 4Y2VA 1HUZA 4KLIA 1DRGA 2Q0ZX 1DOQA 2VANA 2DKXA 2ZXHA 4QZ8A 2QARA 1LVHA 4YMOA 3CNHA 4Y2YA 1FO4A 3AUOA 2VA2A 2KD1A 4UW9A 5D49A 1ZXIA 3IM1A 3IHQB 1JALA 5L1LA 3FDSA 2FLLA 2KNJA 2IOHA 1TAMA 3FM9A 4CF4A 4C4TA 4GXJA 4UASA 3IRUA 2YMMA 3AL0B 3HRDD 5L9XA 3KHGA 3KZIU 4RQ2A 1DGSA 4OJPA 4KLHA 5KT3A 5JUMA 4NM1A 4TQSA 3RJGA 1L7PA 1ZQZA 2W9BA 5D4BA 5ALUA 1TKDA 2QARB 2R8KA 2EZZA 4UAYA 2EZXA 3BS5A 2ASLA 4BUGA 4OJOA 2XGQA 1WUDA 2EQYA 1NKCA 2NRVA 1L6NA 1PK1B 5J2AA 1L3UA 4TURA 2I9GA 4JV2A 7ICEA 1FIQA 4PHPA 1QSLA 3Q8KA 3KHRA 4Y2SA 1RM6C 1SKSA 2W9MA 2KKVA 2RDJA 5L1JA 4LVSA 4Z6FA 2W9BB 4NWIA 2G5IB 4QIWF 8ICCA 3SZ2A 1X40A 4Y2TA 3LDAA 3N7RC 3JPOA 2W8KA 2OHFA 3BS5B 3QE9Y 4UAUA 4DLGA 3MBYA 5J0OA 2VIXA 2ASJA 2DBYA 5ALYA 4GC7A 4FBTA 5AKJA 2F76X 3PW7A 1KQQA 5KFLA 4OJ5A 3C2MA 1ZJNA 4RQ6A 4IQUA 2J6TA 1WCNA 9ICHA 4I28A 3ZI4A 3HWTA 3MGVA 1N5XA 2KTQA 4Y2UA 3H4DA 2DF4B 2EAOA 4GFJA 3GIJA 8ICEA 3WKBA 2BCRA 1JIHA 4J9QA 7ICHA 5ALRA 3WK7A 3SV3A 4O3NA 2MAXA 4O0IA 5AI8A 2ZIXA 4RZRA 2HBLA 2PFOA 2ALZA 3NTUA 4MFCA 3VCBA 3ISCA 4UAWA 2H3ZA 4IQWA 4F2RA 4O5EA 4QWCA 1Z1BA 5KL1B 3F2BA 1XS9D 1RXWA 2A19A 5F9NA 2BR0A 2G09A 7ICJA 3VC8A 4F93B 4FS1A 2K4PA 5J2DA 4ED7A 2K60A 2ZIVA 5HMLA 2BCSA 8ICTA 2F77X 2KVSA 4KLSA 2JRZA 1GO3F 1U48A 3M8SA 9ICTA 2ZTCA 2DPIA 2BCUA 7ICIA 5J0XA 4C7ZA 2KK0A 3K1RB 1O03A 4ECSA 2AGQA 4RUAA 3RJKA 2WB1F 3TAQA 4ELUA 4M9JA 4RQNA 2ZIXB 5E79U 3KBBA 2H3IA 2LMRA 4QZDA 3RR7A 4RQ1A 4DQIA 2HI0A 3BZKA 3R9KA 1KTQA 2KJ8A 4U6PA 5ALZA 4I2IA 3PMNA 1XNSA 3Q8MA 4NY8A 3TADA 4JUZA 5KFUA 4GXIA 1BPXA 4YD2A 4ZH4A 5BOMA 5CWRA 3DEEA 4M9NA 3KHHA 4F4ZA 2QB0A 2FPMA 3TFSA 2HVIA 3J81j 7ICOA 5AKHA 5A0LA 3F5EA 1SKRA 3AU6A 2ZTDA 1Z00A 3LVWA 5KT4A 2D8CA 4ECUA 1NNLA 4IS7A 5JTIA 2QLTA 2BQ3A 3HJEA 7ICUA 1UT5A 2K4IA 3OJUA 3RF9A 1KDHA 5ALVA 4HYKA 2HOQA 4Z6EA 3C1YA 4M9HA 1KKXA 2OWOA 3UXPA 2OH2A 2K89A 5GTHU 4JWMA 2DGZA 2QB0B 8ICGA 3C28A 4FZMA 3PO4A 3WU2U 2YN4A 4J9PA 4YD1A 5KFSA 1PUZA 1SL0A 3FYHA 4EENA 1VJ5A 4UB2A 2JEIA 5AK6A 1Z00B 2IOFA 4RNNA 3ETLA 3N7PD 4KTQA 1MA7A 2BCQA 4DFJA 3PY8A 8ICJA 3C5GA 1IIPA 5DDYA 1KL9A 1WG8A 8ICYA 2W54A 5EWEA 1SWWA 3WK8A 4MEYA 2MUTA 2K8BB 2ZUCA 1JROA 2E1EA 5ALIA 1KSPA 2B6GA 5J0UA 4M9LA 2VJ4A 3H8SA 2YMLA 4DL3A 3SD7A 2PMZF 1B0XA 2KIVA 1N48A 5KFIA 4ACOA 3PX6A 3FC4A 4I2CA 2WFAA 4YP3A 2AQ0A 1SIJA 3GILA 3B9JA 2GOLA 3KTQA 4B9VA 4PGYA 1ZQWA 4C8MA 1F5SA 2UVRA 1LB2B 2XICA 5JRTA 1BGXT 8ICUA 3NVYA 1TAUA 2NRTA 3L4PA 1L3VA 7ICVA 2XO7A 5IIKA 3OSNA 2G07A 1RYRA 1HJPA 4FS2A 1S5LU 5KFXA 3TAPA 1U9LA 2Y1IA 9ICOA 4KMOB 4ECTA 3RB0A 1ZQEA 2ZXIA 3QZ7A 5KFWA 1ZQDA 3QU2A 2BQUA 3ZD8A 5DLGA 4KN7A 2PMZC 3SAGA 3JPPA 5F3XB 3M9OB 3TFRA 4KLGA 1N62A 4QWBA 2MSNA 1ZQJA 4O3RA 1ZQIA 4J9NA 4C8LA 4JK1A 4B9NA 3RAXA 5AICA 3MABA 4O9MA 4KLJA 3BQ2A 5KAFU 2Y0SF 4C8OA 2JZBA 3SENA 3RB4A 2LYHA 1F44A 3AN1A 3QUCA 2JEFA 2HHQA 4RPYA 3G6VA 1TAQA 3MFIA 4F91B 5DB7A 1LKYB 2IBKA 5HMMA 1SKWA 4Y2QA 3Q8LA 4OJLA 3EWAA 4DFPA 4I27A 4Y2PA 3LWMA 5ALGA 3ZDDA 2W3RA 5AI9A 1N60A 2KICA 2IHNA 1QSYA 3NRWA 5KFEA 4UB6U 2UVVA 4UBBA 3PSTA 5EE9A 1RXVA 2YQEA 1DXSA 2CRXA 5IIMA 4YMNA 1NK9A 2JZBB 1N56A 4DO9A 3C2KA 2PFNA 5J2CA 8ICWA 4M9GA 4I29A 2Y0SC 1QTMA 4BX9C 3UQ0A 4KX3A 5CA7A 8ICFA 2C22A 2K8AA 4O3QA 1QQ5A 1XU4A 4BGDA 3H40A 3TKAA 2ZG6A 2XIDA 5J0WA 2AU0A 2FMPA 2QKQA 5KFQA 1X2IA 3D2QA 1BPBA 2UVWA 2F1HA 4AYBC 4YMMA 3SYZA 4PJ0U 5J2FA 1K1SA 5J0PA 2W3SA 3QNMA 2RLTA 5ALOA 3OGUA 3C5FA 2EDUA 1B22A 3GIKA 4QZCA 1ZQAA 3OJSA 1L7OA 1QQ6A 2CXYA 1T94A 3MR3A 5HHHA 1F0MA 1U45A 5ALWA 3WKCA 5J2KA 2PI4A 3KD3A 1JN3A 1J97A 5G5HA 3RBEA 5AI4A 5C0YA 4Q8FA 1TK0A 4EELA 2DUYA 3A0HU 1A77A 3SV4A 8ICPA 2V9WA 2FPLA 1ZQRA 3ZDEA 5HNKA 5AM1A 5KT7A 5KAIU 7ICMA 3Q8SB 5KFBA 2C2RA 2GLEA 2JH7A 3RH6A 5DB6A 1NJZA 3RR8A 3M6ZA 5DGBA 5KFDA 3G6YA 4DQPA 4KN4A 2J6SA 2AJQA 2OXOA 2XY7A 1NZBA 3MDCA 3ISDA 2W11A 2ASDA 4DL5A 2C2DA 3UM9A 1UA1A 2BPGA 5EOZA 2KVCA 3AQEA 3S6JA 2HMXA 2HHSA 2N1RA 2A1JB 3MGHA 5EE0A 3RH5A 4K4IA 5ALXA 9ICIA 1C7YA 5DG8A 1TV9A 5AK3A 2W04A 5KL8B 4IQVA 7ICSA 1MSWD 2G0AA 2GWSA 1PK1A 4IR1A 3NS1A 1ZQNA 2KEYA 4FZNA 4RPXA 2VKQA 1ZRMA 2OYYA 1ZJMA 4P2HA 1X9XA 3IN5A 2R8GA 4R65A 1RQLA 4F4WA 4UB8U 3RFAA 1Q3UA 1QH9A 9ICCA 1QCKA 1XO0A 1SV4A 4Z6CA 4CGZA 3RBDA 4YVZA 1JXEA 4OJ6A 4KLFA 3UPQA 5AIAA 5B66U 2NRZA 4RPZA 3LK9A 3AM9A 2XCAA 2ESEA 2E8PA 4U7CA 1L7MA 3SEIA 5HR6A 2LKYA 2XI9A 2ZIWA 1L5UA 1NZPA 1YT3A 5CHGA 1QSSA 3ZDBA 1ZQSA 4UARA 1J2NA 2KP7A 4NXZA 4G9BA 3IDWA 2JEGA 4NLGA 3HKZF 3QU9A 3DV9A 3JPQA 1HEKA 2D6FC 4UAVA 4PZOA 4TUQA 3GU3A 3V6HA 8ICXA 3RJEA 1UQVA 3MR6A 4ED0A 4YN4A 5KG5A 5CR0A 8ICBA 1BNOA 7ICTA 2AGPA 1TK8A 1BPZA 1NOMA 2HHTA 3HPOA 2ZIWB 5J2GA 1PVRA 2KOBA 3GIMA 8ICQA 4F92B 2EANA 2H5XA 4R64A 4DQSA 5J2EA 4DLEA 4PL2A 8ICIA 1VDVA 1A76A 1DK2A 9ICGA 4RT2A
chains in the Genus database with same CATH topology
2BZFA 1QCKA 2ODGA 1CI4A 2EZYA 2EZZA 2EZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZF A;  1QCK A;  2ODG A;  1CI4 A;  2EZY A;  2EZZ A;  2EZX A; 
#chains in the Genus database with same CATH topology
 1ZQT A;  5ALD A;  1X42 A;  4JV0 A;  3M7D A;  4NLB A;  4CCH A;  8ICN A;  2G08 A;  1SB3 C;  4DOC A;  4IL6 U;  1KRP A;  4ECZ A;  5KG4 A;  9ICQ A;  4QIW C;  5H2F U;  5J8Y C;  3QZ8 A;  8ICM A;  2P35 A;  4O3M A;  3ORY A;  1KBU A;  2JEJ A;  4KLT A;  1ZQM A;  4ZOH C;  1C20 A;  1BVS A;  5DQG A;  1S76 D;  1TK5 A;  2AH5 A;  8ICH A;  4IR9 A;  4Q44 A;  4CRX A;  1SXD A;  3JPN A;  5AI0 A;  3Q8R B;  2F8K A;  3EW9 A;  3SR6 A;  3GV5 B;  4A8E A;  5BPC A;  2KIW A;  2JGA A;  3RB6 A;  5ALT A;  4NL9 C;  5KFO A;  5CJ7 A;  4DSI A;  4NLN A;  2WTF A;  5AKL A;  2GO7 A;  1OUQ A;  2Y9T A;  3ZDA A;  1SV0 C;  3L5K A;  5AKK A;  2W7P A;  3V6K A;  5AKG A;  3SAH A;  1CRX A;  3T3F A;  4XA5 A;  1Z3E B;  1NK5 A;  2KMD A;  2LYB A;  2I5H A;  4I2J A;  5ALP A;  4R8U B;  1V97 A;  1PK3 A;  4EEY A;  4NJ8 A;  4F71 A;  3DDH A;  2P6U A;  3UMC A;  1FFV A;  1YZ6 A;  5HHI A;  3M9M B;  9ICE A;  2YB4 A;  3KOO A;  5KG2 A;  3QU7 A;  1Z4O A;  4ECV A;  2L5Y A;  4C8K A;  2WB1 C;  2E5S A;  1ZQX A;  2HCF A;  1TFR A;  1JMS A;  4CNQ A;  2DFL A;  2FMQ A;  1S97 A;  1ZET A;  4BDP A;  1S0M A;  3QYP A;  4EZ6 A;  3CP8 A;  2F3N A;  1NJY A;  3I28 A;  1ZQH A;  3PW2 A;  4QZH A;  1KFD A;  3H4B A;  3UQ2 A;  2A3V A;  3WKE A;  5EE3 A;  3OPX A;  3KKA C;  4BXO A;  4YCX A;  1ZQO A;  1D9D A;  1KEJ A;  2ZUD A;  1BPE A;  1D8B A;  2RQ5 A;  3T5L A;  1X9S A;  3MGI A;  2HHX A;  5KG1 A;  3WK9 A;  3T5J A;  2OM6 A;  3QEB Z;  2F1I A;  1X66 A;  2B0C A;  2XC9 A;  1J2M A;  4YR3 A;  4B9T A;  4ECW A;  3KZX A;  3T5K A;  1ZQK A;  4YR2 A;  3B0X A;  3THV A;  1MQ3 A;  3TQ1 A;  2KFN A;  3QUT A;  3TAR A;  4LJX A;  2WF5 A;  2ZJ8 A;  4PGX A;  2BGW A;  3SAF A;  5J29 A;  3MC1 A;  2LBO A;  1SL1 A;  3NVV A;  1NK0 A;  2NV3 A;  4ED8 A;  2Y1J A;  3NGD A;  1CEZ A;  4EBC A;  2RDI A;  2I6X A;  4DS4 A;  5KFK A;  5AM5 A;  1X6J A;  4BXO B;  2JH1 A;  2DWQ A;  4ED1 A;  2F44 A;  3JPR A;  4LZD A;  1BPD A;  4F4Y A;  4UAT A;  1ZD4 A;  2KE7 A;  4QZI A;  4J03 A;  2DL0 A;  3GII A;  2PXI A;  9ICA A;  4GIB A;  2JXJ A;  4I2E A;  4UB1 A;  5J2B A;  3WK4 A;  1IXR A;  2R18 A;  4KLL A;  2XGP A;  1SZP A;  5F9L A;  4M47 A;  1P7D A;  4GC6 A;  3M9N B;  4M04 A;  4J9O A;  4QJF B;  2WAQ F;  4I2D A;  3WK6 A;  2CN1 A;  1BPY A;  3WK5 A;  1ZD3 A;  4YQW A;  5KTQ A;  2WHE A;  5ALK A;  3TAC B;  2Z7J A;  5AKY A;  3AQF A;  2VA8 A;  4NM2 A;  4PHA A;  3ICX A;  3HX0 A;  2DPJ A;  4NV0 A;  3K75 D;  4DS5 A;  2AXT U;  3F53 A;  5ALH A;  8ICR A;  4F4K A;  3EUB 2;  3GFK B;  1ZQL A;  3NVZ A;  5KG7 A;  4UBC A;  1EXN A;  4GLX A;  1K1Q A;  5ALM A;  4DFM A;  5AM4 A;  2B21 A;  1LKY A;  4FBU A;  4I2A A;  2K4E A;  5KG3 A;  5CP2 A;  3GV8 B;  2K8C B;  1A6S A;  1S0O A;  4BJQ A;  3PML A;  4RNM A;  1XSN A;  2XY5 A;  5D46 A;  4F50 A;  2D3D A;  8ICO A;  2BCV A;  4DSL A;  4DF4 A;  4F4X A;  1D8Y A;  3NRZ A;  1NKB A;  3PR5 B;  2M9N A;  3PR4 A;  4GXK A;  2DQN B;  2VA3 A;  2HDO A;  5ALS A;  5AKE A;  2BDP A;  3FAH A;  1L7N A;  5AI5 A;  5HP4 A;  4O5K A;  5TZV A;  2JMG A;  1NJX A;  4EYI B;  3SQI A;  9ICJ A;  5DBC A;  3PV8 A;  4P4P A;  4QZF A;  3QU5 A;  7ICL A;  5AIB A;  2ZUB A;  9ICS A;  5AKX A;  1ZYQ A;  2ZJA A;  3A0B U;  4E0D A;  2PFP A;  4KLD A;  5DB9 A;  1IM4 A;  1JUD A;  3V72 A;  1S0V A;  9ICR A;  5KT2 A;  5KFT A;  1MQ2 A;  3PX0 A;  4F3O A;  9ICP A;  4DSF A;  1UPH A;  3E2E A;  4DSJ A;  5JU5 A;  5EWG A;  3ALR A;  4OD0 A;  1WCL A;  5AK5 A;  5J2I A;  1OW5 A;  3UXO A;  4RQ5 A;  5KFH A;  3BJY A;  1Q3V A;  1HIW A;  4FZL A;  5DKW A;  5AM0 A;  4F5P A;  1LV5 A;  2HVH A;  2ZJ5 A;  4MHV A;  4B6J A;  4KLU A;  8ICV A;  2LM4 A;  3RTV A;  4RQ4 A;  1X9M A;  2BDU A;  1OXJ A;  3JPT A;  3LYS A;  4FFD A;  3BQT A;  3U26 A;  3AU2 A;  2ZTE A;  3TAN A;  1WWU A;  3F5A A;  3UXN A;  4EX7 A;  5DQI A;  4DOA A;  1O08 A;  2BZF A;  2PKE A;  3UMG A;  4QW9 A;  4QZ9 A;  4DSE A;  2NO5 A;  4RT3 A;  4C8N A;  1ARO P;  5AI6 A;  2FLP A;  4ED3 A;  5AM3 A;  4RNO A;  2A1J A;  4K4H A;  3C29 A;  5ALN A;  3T79 A;  4ELV A;  3PZP A;  1T4G A;  5KFA A;  5CRX A;  1XSL A;  4NLK A;  2FPK A;  9ICM A;  5KFR A;  8ICS A;  5KG0 A;  4TQR A;  2H3F A;  3PW4 A;  3Q8Q B;  3EYZ A;  5AKZ A;  1WYG A;  1N5W A;  4Q8E A;  2YMP A;  4Q43 A;  5CEH A;  2KZZ A;  1ZQV A;  5CB1 A;  4TUS A;  3C21 A;  2LM1 A;  4PGQ A;  1KLN A;  2MRL A;  3WKA A;  1JI7 A;  1X6I A;  5TIS U;  1Y88 A;  4YXM A;  4ED6 A;  1RYS A;  1ZD2 P;  4CE6 A;  4C7Y A;  3QEA Z;  3LVV A;  2ODG A;  3RJI A;  3D2S A;  1QLN A;  3ETR A;  4IRK A;  2OEH A;  3O0F A;  5DGA A;  4TUP A;  1UA0 A;  2W7O A;  2HHV A;  2IMW P;  2WF6 A;  1JXL A;  5ALJ A;  4MEX A;  4JB3 A;  4P0Q A;  4KLQ A;  3V7L A;  2KHV A;  3TI0 A;  3ISB A;  2JV3 A;  1NJW A;  1N63 A;  2KFZ A;  2FDR A;  3F2D A;  4PZN A;  1FFU A;  2E8O A;  3OHA A;  4O3S A;  5ALE A;  4EEK A;  4RQM A;  1S10 A;  2KKP A;  1ZQY A;  3RAQ A;  2KV2 A;  4PHE A;  1YZ7 A;  5ALL A;  3C1Z A;  5III A;  3D6J A;  4RQ8 A;  2NYV A;  2O6K A;  4NLC A;  4C80 A;  5KFP A;  9ICX A;  1S9F A;  4DQR A;  1A0P A;  7ICQ A;  5AM2 A;  3BQ7 A;  4PHD A;  4UAZ A;  3ONN A;  2HHW A;  5KNI A;  5EE1 A;  3WKD A;  2BQR A;  2E1F A;  9ICF A;  2W55 A;  4P0Q B;  4R66 A;  2JHD A;  3M6K A;  1X9W A;  2V4R A;  4PH5 A;  1HUO A;  8ICA A;  7ICN A;  1MN8 A;  2DKZ A;  1ZD5 A;  2YY6 A;  2LI6 A;  5J0R A;  4QWA A;  3OHB A;  2RHF A;  3ED5 A;  3QUB A;  4PL1 A;  4YR0 A;  4K4G A;  2H3V A;  2E8N A;  5DDM A;  4IRC A;  1L3T A;  5HR7 A;  5G5G A;  1XWL A;  2Y9U A;  3SMV A;  3NUQ A;  4F8R A;  5KFN A;  3SI8 A;  7ICF A;  3RRH A;  1PVQ A;  3QU4 A;  4XUS A;  3M8R A;  1B43 A;  4I2F A;  7ICR A;  3MDA A;  4US8 A;  3KHL A;  2XVT A;  5KFG A;  2KN7 A;  1D9F A;  5KFJ A;  2IA6 A;  4G3I A;  4QZA A;  2HW3 A;  5KT5 A;  2ATL A;  3V7K A;  2C28 A;  2IOF K;  3H7I A;  3C2L A;  3TAD C;  2AQ4 A;  3V6J A;  4DL2 A;  1L8O A;  1S77 D;  1TVA A;  1ZQ1 C;  5KFZ A;  4DL4 A;  2ES6 A;  1H38 A;  3G6X A;  1D8L A;  3HKZ C;  3KFU F;  3PNC A;  2HHU A;  3LWL A;  4J9L A;  4DFD A;  3BS7 A;  2EH9 A;  1RPL A;  4FO6 A;  2HBK A;  5GTI U;  1ZQQ A;  4R8U A;  4UB5 A;  1T3N A;  2ZIU A;  4C4S A;  4XQ8 A;  1T7P A;  2G06 A;  3ZDC A;  4QWE A;  3CYM A;  4O3P A;  5J0Q A;  1S8O A;  5AHX A;  4DSK A;  5KFC A;  2RP5 A;  4J9R A;  1CI4 A;  2W9C A;  1L3S A;  2M0N A;  5FP0 A;  4QZB A;  2KJ5 A;  3H8M A;  5J2J A;  1S0N A;  2YTU A;  5DQH A;  2KZM A;  3IG5 A;  3RB3 A;  9ICV A;  1NKE A;  4JMU A;  1QQ7 A;  1KFS A;  4DOB A;  1JRP A;  1ECW A;  4DL7 A;  3H0R B;  4OO1 J;  4C4R A;  8ICL A;  3IV6 A;  1DK3 A;  5IIL A;  2AGO A;  5DB8 A;  2ZIU B;  5KFV A;  4IRD A;  1SZH A;  1ZQU A;  2F8L A;  1U49 A;  1UT8 A;  4KLO A;  4US9 A;  2RRD A;  3Q8P B;  3RRG A;  2G5H B;  2R8H A;  4MF2 A;  4KLE A;  2HOI A;  1WWV A;  4F72 A;  5KT6 A;  3EPG A;  2W9C B;  4DL6 A;  1ZQB A;  2ZIV B;  1UCV A;  2E8M A;  4CF5 A;  2MU2 A;  4IQT A;  4UB3 A;  3EZ5 A;  1ZQC A;  2WF7 A;  3T5H A;  3N97 B;  2ISP A;  7ICP A;  3HP6 A;  4RQ7 A;  4YXJ A;  5BOL A;  5DG9 A;  2CPR A;  3I1Y A;  1B4F A;  3E0F A;  1ZQG A;  3MR2 A;  5J8Y A;  1PVP A;  3MR5 A;  3K4G A;  4Y2X A;  2V4Q A;  4F5R A;  5DBA A;  7ICK A;  1IV8 A;  3MFH A;  4DCC A;  1Z19 A;  4I2H A;  4EYH B;  1K5O A;  3QXG A;  1SL2 A;  2GH1 A;  2F2A B;  2BHN A;  2KHQ A;  4I2B A;  2KG5 A;  4KMU A;  2ISO A;  5T14 A;  5C5J A;  4UQG A;  1N61 A;  2AHO B;  2NRX A;  2W43 A;  4LZG A;  3PW5 A;  3GDX A;  1PZN A;  1V85 A;  4AP9 A;  4NL9 A;  4JWN A;  4RQ3 A;  4Y2R A;  3PO5 A;  5J2H A;  2KSO A;  1SV0 A;  3L3F X;  1RG6 A;  3RJF A;  4QWD A;  3QX7 A;  3JPS A;  5DBB A;  3RH4 A;  3CRX A;  1RQN A;  4ECY A;  4C0Z A;  1XSP A;  1Q8K A;  2R8J A;  3BQ1 A;  3BQ0 A;  2BPC A;  1SGG A;  3PW0 A;  2XCP A;  2YB1 A;  5AKI A;  5L1I A;  8ICZ A;  5KG6 A;  2LHT A;  1FEZ A;  2HBJ A;  1KW4 A;  2H3Q A;  4ICA A;  3HT3 A;  3N4M B;  2KZ3 A;  2KSO B;  3CW2 C;  2XY6 A;  4IC9 A;  1XO1 A;  3PVX A;  5L1M A;  4YG2 A;  1U4B A;  5B5E U;  1L8L A;  9ICK A;  5IIJ A;  4O5C A;  3KKA A;  5KFF A;  4FE3 A;  2HBM A;  1RYU A;  2OCE A;  3PSP A;  3V7J A;  2A1A A;  4RU9 A;  1SWV A;  3H8J A;  4KLM A;  2P66 A;  5KFY A;  5J0Y A;  5J0S A;  4UB4 A;  4J9M A;  3UMB A;  2F1J A;  1KN5 A;  4DEZ A;  4RQ0 A;  3B0Y A;  4NLZ A;  4DQQ A;  2MUT B;  1ZRN A;  5K4L A;  3RJJ A;  4ED2 A;  2EAM A;  1Q46 A;  3H8W A;  4EZ9 A;  2FLN A;  4DWI A;  5EWF A;  1RZT A;  1V9P A;  4QZG A;  2WAQ C;  1V38 A;  5AK4 A;  2MA1 A;  4CF3 A;  1COK A;  1T8E A;  2HOF A;  1IG6 A;  3NAS A;  1CUK A;  4M2Y A;  1MC8 A;  2C2E A;  3AEV A;  3HW8 A;  2UVU A;  3BDP A;  4ELT A;  4EBE A;  1XC9 A;  4BWM A;  2FMS A;  3PX4 A;  1DGJ A;  4ECX A;  4P4M A;  4KX5 A;  5IIN A;  4P4O A;  2K4H A;  1URJ A;  1Z1V A;  4X5V A;  3E58 A;  1NI3 A;  5J0T A;  9ICU A;  4EX6 A;  4XRH A;  3GZF A;  4R63 A;  4CDG A;  1ED1 A;  2YMQ A;  3N7S C;  9ICN A;  4AYB F;  2EAP A;  1TE2 A;  4Z6D A;  4ECQ A;  5ALQ A;  4P0P A;  2W8L A;  4F5N A;  1SXE A;  2EZY A;  4PPX A;  4O3O A;  4M6W A;  1NK4 A;  1COO A;  4HAI A;  2QB1 A;  2PFQ A;  1ZQP A;  1NK8 A;  4Y2J A;  2P6R A;  2NRW A;  2PI5 A;  2LYA A;  2IHM A;  4OCZ A;  3H0L B;  1U47 A;  4KIT B;  1NK6 A;  3RJH A;  4USA A;  4QZE A;  3GQC A;  1N2X A;  4BWJ A;  4J9S A;  2FI1 A;  9ICB A;  4DFK A;  2R8I A;  3AMZ A;  3I76 A;  5KFM A;  8ICK A;  4JV1 A;  1M6Y A;  1JX4 A;  4J9K A;  3M1Y A;  3OTQ A;  4MF8 A;  4P0P B;  2WF9 A;  4B9S A;  4B9U A;  5DLF A;  1KFT A;  4M6W B;  4F5Q A;  2NO4 A;  1VLB A;  7ICG A;  3IP4 B;  2VJ5 A;  2LPE A;  3PSI A;  2WF8 A;  3EPI A;  1NK7 A;  9ICL A;  1ZOL A;  3IG8 A;  2YX8 A;  3NVW A;  3ZD9 A;  2E3T A;  4QNL A;  3BZC A;  3K1Z A;  1RDF A;  4WJ3 B;  5DG7 A;  2KJ9 A;  2BKE A;  2FJ6 A;  1T3Q A;  4QW8 A;  2JR5 A;  1Z4N A;  3C23 A;  3OSP A;  1ZQF A;  9ICW A;  2J6U A;  3QUQ A;  2HSZ A;  1BNP A;  3N28 A;  3F2C A;  2W9A A;  3D2N A;  2I1Q A;  4RUC A;  4MFF A;  2BPF A;  1AQ6 A;  4B9L A;  4ECR A;  3H0M B;  4EBD A;  4MFA A;  4Q45 A;  3HIL A;  5L1K A;  4F5O A;  2FE9 A;  3GV7 B;  4I2G A;  4B9M A;  4DF8 A;  2W03 A;  4YFK A;  1UHU A;  3PSF A;  5IIO A;  2Q4T A;  4M0A A;  5ALF A;  4F2S A;  4Y2V A;  1HUZ A;  4KLI A;  1DRG A;  2Q0Z X;  1DOQ A;  2VAN A;  2DKX A;  2ZXH A;  4QZ8 A;  2QAR A;  1LVH A;  4YMO A;  3CNH A;  4Y2Y A;  1FO4 A;  3AUO A;  2VA2 A;  2KD1 A;  4UW9 A;  5D49 A;  1ZXI A;  3IM1 A;  3IHQ B;  1JAL A;  5L1L A;  3FDS A;  2FLL A;  2KNJ A;  2IOH A;  1TAM A;  3FM9 A;  4CF4 A;  4C4T A;  4GXJ A;  4UAS A;  3IRU A;  2YMM A;  3AL0 B;  3HRD D;  5L9X A;  3KHG A;  3KZI U;  4RQ2 A;  1DGS A;  4OJP A;  4KLH A;  5KT3 A;  5JUM A;  4NM1 A;  4TQS A;  3RJG A;  1L7P A;  1ZQZ A;  2W9B A;  5D4B A;  5ALU A;  1TKD A;  2QAR B;  2R8K A;  2EZZ A;  4UAY A;  2EZX A;  3BS5 A;  2ASL A;  4BUG A;  4OJO A;  2XGQ A;  1WUD A;  2EQY A;  1NKC A;  2NRV A;  1L6N A;  1PK1 B;  5J2A A;  1L3U A;  4TUR A;  2I9G A;  4JV2 A;  7ICE A;  1FIQ A;  4PHP A;  1QSL A;  3Q8K A;  3KHR A;  4Y2S A;  1RM6 C;  1SKS A;  2W9M A;  2KKV A;  2RDJ A;  5L1J A;  4LVS A;  4Z6F A;  2W9B B;  4NWI A;  2G5I B;  4QIW F;  8ICC A;  3SZ2 A;  1X40 A;  4Y2T A;  3LDA A;  3N7R C;  3JPO A;  2W8K A;  2OHF A;  3BS5 B;  3QE9 Y;  4UAU A;  4DLG A;  3MBY A;  5J0O A;  2VIX A;  2ASJ A;  2DBY A;  5ALY A;  4GC7 A;  4FBT A;  5AKJ A;  2F76 X;  3PW7 A;  1KQQ A;  5KFL A;  4OJ5 A;  3C2M A;  1ZJN A;  4RQ6 A;  4IQU A;  2J6T A;  1WCN A;  9ICH A;  4I28 A;  3ZI4 A;  3HWT A;  3MGV A;  1N5X A;  2KTQ A;  4Y2U A;  3H4D A;  2DF4 B;  2EAO A;  4GFJ A;  3GIJ A;  8ICE A;  3WKB A;  2BCR A;  1JIH A;  4J9Q A;  7ICH A;  5ALR A;  3WK7 A;  3SV3 A;  4O3N A;  2MAX A;  4O0I A;  5AI8 A;  2ZIX A;  4RZR A;  2HBL A;  2PFO A;  2ALZ A;  3NTU A;  4MFC A;  3VCB A;  3ISC A;  4UAW A;  2H3Z A;  4IQW A;  4F2R A;  4O5E A;  4QWC A;  1Z1B A;  5KL1 B;  3F2B A;  1XS9 D;  1RXW A;  2A19 A;  5F9N A;  2BR0 A;  2G09 A;  7ICJ A;  3VC8 A;  4F93 B;  4FS1 A;  2K4P A;  5J2D A;  4ED7 A;  2K60 A;  2ZIV A;  5HML A;  2BCS A;  8ICT A;  2F77 X;  2KVS A;  4KLS A;  2JRZ A;  1GO3 F;  1U48 A;  3M8S A;  9ICT A;  2ZTC A;  2DPI A;  2BCU A;  7ICI A;  5J0X A;  4C7Z A;  2KK0 A;  3K1R B;  1O03 A;  4ECS A;  2AGQ A;  4RUA A;  3RJK A;  2WB1 F;  3TAQ A;  4ELU A;  4M9J A;  4RQN A;  2ZIX B;  5E79 U;  3KBB A;  2H3I A;  2LMR A;  4QZD A;  3RR7 A;  4RQ1 A;  4DQI A;  2HI0 A;  3BZK A;  3R9K A;  1KTQ A;  2KJ8 A;  4U6P A;  5ALZ A;  4I2I A;  3PMN A;  1XNS A;  3Q8M A;  4NY8 A;  3TAD A;  4JUZ A;  5KFU A;  4GXI A;  1BPX A;  4YD2 A;  4ZH4 A;  5BOM A;  5CWR A;  3DEE A;  4M9N A;  3KHH A;  4F4Z A;  2QB0 A;  2FPM A;  3TFS A;  2HVI A;  3J81 j;  7ICO A;  5AKH A;  5A0L A;  3F5E A;  1SKR A;  3AU6 A;  2ZTD A;  1Z00 A;  3LVW A;  5KT4 A;  2D8C A;  4ECU A;  1NNL A;  4IS7 A;  5JTI A;  2QLT A;  2BQ3 A;  3HJE A;  7ICU A;  1UT5 A;  2K4I A;  3OJU A;  3RF9 A;  1KDH A;  5ALV A;  4HYK A;  2HOQ A;  4Z6E A;  3C1Y A;  4M9H A;  1KKX A;  2OWO A;  3UXP A;  2OH2 A;  2K89 A;  5GTH U;  4JWM A;  2DGZ A;  2QB0 B;  8ICG A;  3C28 A;  4FZM A;  3PO4 A;  3WU2 U;  2YN4 A;  4J9P A;  4YD1 A;  5KFS A;  1PUZ A;  1SL0 A;  3FYH A;  4EEN A;  1VJ5 A;  4UB2 A;  2JEI A;  5AK6 A;  1Z00 B;  2IOF A;  4RNN A;  3ETL A;  3N7P D;  4KTQ A;  1MA7 A;  2BCQ A;  4DFJ A;  3PY8 A;  8ICJ A;  3C5G A;  1IIP A;  5DDY A;  1KL9 A;  1WG8 A;  8ICY A;  2W54 A;  5EWE A;  1SWW A;  3WK8 A;  4MEY A;  2MUT A;  2K8B B;  2ZUC A;  1JRO A;  2E1E A;  5ALI A;  1KSP A;  2B6G A;  5J0U A;  4M9L A;  2VJ4 A;  3H8S A;  2YML A;  4DL3 A;  3SD7 A;  2PMZ F;  1B0X A;  2KIV A;  1N48 A;  5KFI A;  4ACO A;  3PX6 A;  3FC4 A;  4I2C A;  2WFA A;  4YP3 A;  2AQ0 A;  1SIJ A;  3GIL A;  3B9J A;  2GOL A;  3KTQ A;  4B9V A;  4PGY A;  1ZQW A;  4C8M A;  1F5S A;  2UVR A;  1LB2 B;  2XIC A;  5JRT A;  1BGX T;  8ICU A;  3NVY A;  1TAU A;  2NRT A;  3L4P A;  1L3V A;  7ICV A;  2XO7 A;  5IIK A;  3OSN A;  2G07 A;  1RYR A;  1HJP A;  4FS2 A;  1S5L U;  5KFX A;  3TAP A;  1U9L A;  2Y1I A;  9ICO A;  4KMO B;  4ECT A;  3RB0 A;  1ZQE A;  2ZXI A;  3QZ7 A;  5KFW A;  1ZQD A;  3QU2 A;  2BQU A;  3ZD8 A;  5DLG A;  4KN7 A;  2PMZ C;  3SAG A;  3JPP A;  5F3X B;  3M9O B;  3TFR A;  4KLG A;  1N62 A;  4QWB A;  2MSN A;  1ZQJ A;  4O3R A;  1ZQI A;  4J9N A;  4C8L A;  4JK1 A;  4B9N A;  3RAX A;  5AIC A;  3MAB A;  4O9M A;  4KLJ A;  3BQ2 A;  5KAF U;  2Y0S F;  4C8O A;  2JZB A;  3SEN A;  3RB4 A;  2LYH A;  1F44 A;  3AN1 A;  3QUC A;  2JEF A;  2HHQ A;  4RPY A;  3G6V A;  1TAQ A;  3MFI A;  4F91 B;  5DB7 A;  1LKY B;  2IBK A;  5HMM A;  1SKW A;  4Y2Q A;  3Q8L A;  4OJL A;  3EWA A;  4DFP A;  4I27 A;  4Y2P A;  3LWM A;  5ALG A;  3ZDD A;  2W3R A;  5AI9 A;  1N60 A;  2KIC A;  2IHN A;  1QSY A;  3NRW A;  5KFE A;  4UB6 U;  2UVV A;  4UBB A;  3PST A;  5EE9 A;  1RXV A;  2YQE A;  1DXS A;  2CRX A;  5IIM A;  4YMN A;  1NK9 A;  2JZB B;  1N56 A;  4DO9 A;  3C2K A;  2PFN A;  5J2C A;  8ICW A;  4M9G A;  4I29 A;  2Y0S C;  1QTM A;  4BX9 C;  3UQ0 A;  4KX3 A;  5CA7 A;  8ICF A;  2C22 A;  2K8A A;  4O3Q A;  1QQ5 A;  1XU4 A;  4BGD A;  3H40 A;  3TKA A;  2ZG6 A;  2XID A;  5J0W A;  2AU0 A;  2FMP A;  2QKQ A;  5KFQ A;  1X2I A;  3D2Q A;  1BPB A;  2UVW A;  2F1H A;  4AYB C;  4YMM A;  3SYZ A;  4PJ0 U;  5J2F A;  1K1S A;  5J0P A;  2W3S A;  3QNM A;  2RLT A;  5ALO A;  3OGU A;  3C5F A;  2EDU A;  1B22 A;  3GIK A;  4QZC A;  1ZQA A;  3OJS A;  1L7O A;  1QQ6 A;  2CXY A;  1T94 A;  3MR3 A;  5HHH A;  1F0M A;  1U45 A;  5ALW A;  3WKC A;  5J2K A;  2PI4 A;  3KD3 A;  1JN3 A;  1J97 A;  5G5H A;  3RBE A;  5AI4 A;  5C0Y A;  4Q8F A;  1TK0 A;  4EEL A;  2DUY A;  3A0H U;  1A77 A;  3SV4 A;  8ICP A;  2V9W A;  2FPL A;  1ZQR A;  3ZDE A;  5HNK A;  5AM1 A;  5KT7 A;  5KAI U;  7ICM A;  3Q8S B;  5KFB A;  2C2R A;  2GLE A;  2JH7 A;  3RH6 A;  5DB6 A;  1NJZ A;  3RR8 A;  3M6Z A;  5DGB A;  5KFD A;  3G6Y A;  4DQP A;  4KN4 A;  2J6S A;  2AJQ A;  2OXO A;  2XY7 A;  1NZB A;  3MDC A;  3ISD A;  2W11 A;  2ASD A;  4DL5 A;  2C2D A;  3UM9 A;  1UA1 A;  2BPG A;  5EOZ A;  2KVC A;  3AQE A;  3S6J A;  2HMX A;  2HHS A;  2N1R A;  2A1J B;  3MGH A;  5EE0 A;  3RH5 A;  4K4I A;  5ALX A;  9ICI A;  1C7Y A;  5DG8 A;  1TV9 A;  5AK3 A;  2W04 A;  5KL8 B;  4IQV A;  7ICS A;  1MSW D;  2G0A A;  2GWS A;  1PK1 A;  4IR1 A;  3NS1 A;  1ZQN A;  2KEY A;  4FZN A;  4RPX A;  2VKQ A;  1ZRM A;  2OYY A;  1ZJM A;  4P2H A;  1X9X A;  3IN5 A;  2R8G A;  4R65 A;  1RQL A;  4F4W A;  4UB8 U;  3RFA A;  1Q3U A;  1QH9 A;  9ICC A;  1QCK A;  1XO0 A;  1SV4 A;  4Z6C A;  4CGZ A;  3RBD A;  4YVZ A;  1JXE A;  4OJ6 A;  4KLF A;  3UPQ A;  5AIA A;  5B66 U;  2NRZ A;  4RPZ A;  3LK9 A;  3AM9 A;  2XCA A;  2ESE A;  2E8P A;  4U7C A;  1L7M A;  3SEI A;  5HR6 A;  2LKY A;  2XI9 A;  2ZIW A;  1L5U A;  1NZP A;  1YT3 A;  5CHG A;  1QSS A;  3ZDB A;  1ZQS A;  4UAR A;  1J2N A;  2KP7 A;  4NXZ A;  4G9B A;  3IDW A;  2JEG A;  4NLG A;  3HKZ F;  3QU9 A;  3DV9 A;  3JPQ A;  1HEK A;  2D6F C;  4UAV A;  4PZO A;  4TUQ A;  3GU3 A;  3V6H A;  8ICX A;  3RJE A;  1UQV A;  3MR6 A;  4ED0 A;  4YN4 A;  5KG5 A;  5CR0 A;  8ICB A;  1BNO A;  7ICT A;  2AGP A;  1TK8 A;  1BPZ A;  1NOM A;  2HHT A;  3HPO A;  2ZIW B;  5J2G A;  1PVR A;  2KOB A;  3GIM A;  8ICQ A;  4F92 B;  2EAN A;  2H5X A;  4R64 A;  4DQS A;  5J2E A;  4DLE A;  4PL2 A;  8ICI A;  1VDV A;  1A76 A;  1DK2 A;  9ICG A;  4RT2 A; 
#chains in the Genus database with same CATH homology
 2BZF A;  1QCK A;  2ODG A;  1CI4 A;  2EZY A;  2EZZ A;  2EZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...