5JU5A

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5ju5A00
2JV3A 2KSOB 2ESEA 2QARB 3KKAC 1SXEA 5JRTA 1OXJA 3SENA 3SEIA 2QB1A 2QB0B 1PK3A 2KG5A 2Y9TA 2KIVA 3H8MA 1V38A 3BQ7A 3IDWA 1LKYA 1SV4A 1KW4A 2E8NA 5JU5A 2L5YA 1X9XA 1DXSA 1SXDA 5L1MA 2EAMA 3KKAA 1WWVA 2DKXA 1RG6A 2YTUA 1LKYB 2F3NA 2DKZA 5JTIA 2F8KA 4PZNA 4IS7A 1UQVA 4RQNA 3TACB 5J8YC 1OW5A 3TADC 2GLEA 1PK1A 5F3XB 2K60A 1SGGA 1V85A 2EAOA 2LMRA 3K1RB 1X66A 4PZOA 1SV0C 4MHVA 5KNIA 1WWUA 2D8CA 5J8YA 1PK1B 3TADA 1Z1VA 2K4PA 1X40A 2KMDA 1UCVA 3BS5A 4NL9C 1B4FA 1F0MA 2E8MA 2DL0A 2E8OA 1SV0A 2Y9UA 3HILA 1JI7A 2D3DA 3BS5B 1COKA 2LPEA 1B0XA 4NL9A 3BS7A 2KE7A 2KSOA 2EAPA 2E8PA 2QARA 4RQMA 2B6GA 2F44A 4NJ8A 2QB0A 2EANA 2QKQA 2ES6A 2FE9A
chains in the Genus database with same CATH superfamily
2JV3A 3Q8KA 1A0PA 5KAIU 4RQ3A 1V9PA 9ICPA 1DRGA 4IRKA 2DBYA 5JRTA 4RUCA 3M6KA 5KT6A 2VA3A 2PI5A 3SAHA 3H8MA 3C29A 4KLMA 4XUSA 1TK5A 1ZD5A 1LKYA 5J2CA 4YD2A 3G6YA 3PW4A 1SV4A 3QE9Y 1XSPA 4EZ6A 2ISPA 4F2RA 3JPPA 3Q8LA 3SAFA 2PMZF 3MGVA 1NNLA 2KJ8A 1GO3F 2HVIA 4CRXA 2B21A 2ATLA 1X42A 3PR5B 2ZXHA 5EWGA 1Y88A 4EZ9A 1TE2A 4QZ8A 5KFNA 5KG7A 3PMLA 1C7YA 5ALTA 2RDJA 5AKKA 3UMGA 4J9LA 1RDFA 1A76A 3ZD9A 4PZOA 2KP7A 3FDSA 3QYPA 2NRXA 3C2KA 8ICTA 2BR0A 1BPYA 2ZJAA 5CB1A 2LHTA 5KG5A 4KLFA 4ECSA 2LKYA 1ZOLA 2KHVA 1X6IA 3KHLA 4I2EA 5AM3A 3F5EA 4RNMA 2PFPA 4DSIA 3M8RA 4Y2TA 4PHDA 3GDXA 2ZIWA 4ECUA 2FLLA 2P35A 1XO0A 4NL9A 3WK5A 5B66U 3MFIA 2B0CA 5IIOA 2AXTU 3AL0B 2QARA 3OTQA 3NS1A 3JPQA 1DGSA 4ED7A 3K4GA 3N7RC 2HVHA 4Y2SA 3LK9A 3SV3A 3PX6A 4DSFA 4TQRA 2C2DA 4M2YA 4O5CA 2F77X 4UAYA 4B9TA 2W3RA 1XNSA 3CNHA 4DFPA 4BWJA 1ZJMA 5AK5A 2WF7A 3ISDA 4CDGA 4ECRA 4C8MA 4MFAA 4EX6A 4R66A 5KFOA 4JUZA 3MFHA 4QJFB 3PY8A 4B9LA 1QH9A 3UMCA 1UQVA 4YMMA 2VANA 2MUTB 4R64A 4ED1A 2NO5A 3EYZA 4I28A 2GO7A 1BGXT 4C80A 1KFTA 8ICQA 4QNLA 2LYBA 4DS4A 2BQUA 5IIMA 4DEZA 1CRXA 1ZQZA 8ICPA 1PZNA 2KEYA 3C2MA 2W9BB 5GTIU 1ZQFA 4M9LA 2W8KA 4IQVA 3SYZA 4DSLA 3F2CA 3EPGA 1S5LU 3TFRA 1NK8A 1J2MA 2P6UA 4JV0A 1S9FA 3ISCA 1ZQVA 4JK1A 3H4BA 2AGQA 2LBOA 2KZ3A 2YMPA 4DF4A 3UMBA 1P7DA 2VA2A 2WB1C 3AEVA 5ALJA 4MFFA 1TFRA 5J0PA 2IA6A 3K75D 5DLGA 5IINA 2F8LA 3FYHA 3KKAC 4R8UB 1L7MA 1D8YA 3GV8B 4UB1A 4UATA 3ETRA 2BDUA 5CWRA 4IC9A 3Q8QB 3KHGA 3KD3A 1XSNA 5EOZA 5IILA 3V6JA 5KT3A 2XCPA 5J2AA 8ICUA 4QW9A 4B9MA 5KFIA 4P2HA 2NRWA 4RQ0A 2BKEA 3NTUA 2I9GA 3FAHA 4EEKA 5DQIA 1LKYB 1EXNA 2F3NA 4OJ6A 5ALIA 4YR3A 4DL5A 3V72A 2ZIUA 3OHBA 2PFOA 2M9NA 4M9HA 2R8IA 4YG2A 5KFVA 9ICAA 1QSYA 4LZGA 5ALXA 3C21A 2PFQA 4Y2VA 2AQ0A 3H40A 4M04A 1COOA 2WF5A 3QUTA 5TZVA 1ZQNA 5JUMA 4ELTA 4PHEA 3PSFA 2ZUBA 1JALA 2UVVA 2FJ6A 4UB5A 8ICHA 3NVVA 5J0UA 4QW8A 1SZPA 3MABA 5AKIA 3T5JA 4I2CA 4KLQA 2OWOA 8ICGA 1JI7A 1C20A 2KJ9A 4MEYA 3RB4A 1WUDA 4XRHA 1NK7A 2FMSA 1L7NA 3RB0A 4RQ7A 2KVSA 3ZDDA 2YB1A 2ZIWB 2P6RA 1A6SA 4EENA 1ZQWA 3F2DA 5DBAA 4RPYA 1T4GA 4IR9A 2NV3A 4ED0A 2WB1F 2BZFA 2QARB 2BCVA 4RU9A 3GZFA 1ZD3A 2IMWP 4G3IA 3PNCA 4Q44A 2K4HA 9ICLA 1D9DA 1X9XA 4QZCA 1JXLA 9ICEA 4UAVA 1M6YA 4B9UA 1PVRA 2W9CA 2KKPA 1X2IA 4FO6A 2EDUA 5EE3A 3SZ2A 5ALDA 4J9SA 1T3NA 3PSPA 3QEAZ 1ZQCA 1BVSA 2R8KA 3I76A 2XGPA 4I29A 2VIXA 4UBBA 4F50A 4DF8A 4KX5A 5IIIA 3UQ0A 2AJQA 3ICXA 1KSPA 4Z6FA 1XSLA 5KFKA 5ALSA 2H3ZA 3JPOA 2G0AA 4O3NA 4YP3A 3VC8A 2Y1JA 3QUBA 2K4PA 4O5EA 3HT3A 1ZRNA 3BS5A 3JPRA 7ICMA 3OJSA 2E8MA 2ASLA 4PGXA 3SAGA 2FDRA 5KG1A 2Y9UA 9ICIA 3WKCA 2R8GA 4IQUA 3JPSA 3BJYA 3RJHA 5CRXA 1WYGA 2CXYA 3AM9A 2F2AB 2KE7A 5C0YA 3GU3A 4BGDA 4Y2YA 2W43A 4OJLA 2ES6A 4M6WA 2A1JA 3BQ2A 1TV9A 2BCQA 5KG2A 4KLHA 4HAIA 3D6JA 5B5EU 1SB3C 3EUB2 4RNOA 2ESEA 3C5FA 4PL1A 5J2HA 5TISU 2XO7A 3TAQA 4O3OA 4MF2A 3RTVA 4QZIA 1WCNA 2BCRA 3JPTA 4UB2A 3PVXA 3ED5A 5KL8B 1S0OA 1ZQSA 2EAMA 2XC9A 4Y2UA 1DK3A 2QLTA 1L8LA 4R63A 1DOQA 4C8NA 1L7PA 2DKZA 2WF8A 3EW9A 4PL2A 4UAUA 3UXPA 1S0VA 2JGAA 5DDMA 3M9MB 2FLNA 9ICMA 5KFBA 2J6SA 7ICSA 5KFAA 2GLEA 5J2DA 2ZIUB 2EAOA 3KZIU 2W8LA 1B22A 1FIQA 4DL6A 5ALHA 1UA0A 1LB2B 4B9NA 3M1YA 2CRXA 5KAFU 1Z1VA 5AM1A 4DOCA 5J2JA 1B4FA 4O3PA 1F0MA 4NLGA 4TQSA 2E5SA 1ED1A 1RYSA 4UB3A 1U9LA 4KLUA 3E58A 5ALRA 2V9WA 1MN8A 3DDHA 5AK6A 8ICMA 1Z4OA 1DGJA 4QZEA 3H8JA 5ALUA 3ALRA 1L3SA 1UHUA 1S0NA 3V7LA 4F91B 4P0PA 2P66A 4TUSA 5BPCA 1ZQRA 4EBEA 2LYHA 2XCAA 8ICEA 4I27A 2AQ4A 1TK8A 9ICHA 4DSEA 2HMXA 4K4GA 2VA8A 4I2JA 4JWMA 1N61A 2IOFK 4GLXA 3HP6A 5KFHA 4F72A 4AP9A 2MRLA 4QWCA 9ICCA 4M9JA 4KN7A 4NXZA 3SQIA 1Z1BA 4QZAA 5KFYA 1MA7A 4O3RA 5J0WA 2W04A 1T3QA 5IIKA 3LYSA 3QUCA 2JEFA 5J2EA 2W9CB 4M9NA 3C1ZA 7ICFA 4CF3A 1X9WA 4OJ5A 1KN5A 3WK9A 3ETLA 4M47A 1Q8KA 2H3VA 2Q0ZX 4FZMA 2NRTA 3TADA 2EH9A 4DFKA 3RR7A 1Z4NA 4KITB 1U49A 4TUQA 3AMZA 4A8EA 2FPMA 3RR8A 1CEZA 9ICFA 1LVHA 3HKZC 3QNMA 2E8OA 1SV0A 4F5NA 2DQNB 4UAZA 2V4RA 9ICUA 4F5QA 3BS5B 3V6HA 1COKA 4QZHA 3WK7A 3M9NB 5J2IA 3BS7A 3FC4A 3WK4A 3A0BU 3ORYA 4O5KA 5J0SA 2RP5A 4I2AA 1NZPA 5KG0A 2H3FA 2F44A 5AKYA 9ICTA 3PX0A 5AI6A 1ZQAA 5CA7A 5J0QA 3N4MB 3OSPA 4QZ9A 1KFDA 8ICZA 2LI6A 2UVRA 4F71A 1CI4A 2VKQA 2J6TA 1V38A 4M6WB 2A1JB 5HNKA 1KTQA 1SKWA 4OO1J 1NZBA 2HSZA 1SZHA 1S10A 5L1MA 1KFSA 4USAA 4QZBA 4YMOA 2DKXA 4I2HA 3H0MB 4IRCA 4YR2A 9ICWA 4KLEA 7ICOA 4UB8U 3KZXA 1J2NA 4UB6U 4RQNA 4C4TA 3BZCA 1Z19A 4J9KA 1RPLA 3THVA 5ALZA 5EE1A 3RJGA 4GIBA 1YZ6A 5KNIA 4KLTA 4YXJA 2DWQA 1DK2A 1N2XA 4RPXA 8ICIA 4EYIB 3EZ5A 2LYAA 1FEZA 2W9MA 1UCVA 4NL9C 1KBUA 2OEHA 1XC9A 3HJEA 1ZXIA 1VLBA 1RYRA 9ICRA 3HRDD 3D2NA 5C5JA 3HKZF 1NJXA 3E2EA 4Q43A 5J0YA 5CEHA 1RXVA 3QZ8A 8ICFA 4Y2PA 2EAPA 2Y0SC 3PW5A 3H7IA 3L3FX 4FS1A 4Y2QA 2R8HA 4US9A 2PXIA 1QCKA 2HDOA 2JZBA 1QSLA 1HJPA 1OXJA 4KN4A 4DL3A 3A0HU 4F93B 1NK0A 3OPXA 4P0PB 4GXKA 3IDWA 3ZDBA 2G06A 3AU2A 2E8NA 4IQWA 2I5HA 4ACOA 2FLPA 4J9PA 1N63A 4YFKA 3B0YA 2M0NA 2V4QA 2J6UA 1L5UA 2ODGA 3WKBA 5AIBA 2XY5A 4UASA 1SL2A 5J29A 9ICKA 2KNJA 4F92B 2XY7A 2XIDA 2I1QA 9ICNA 5D4BA 2C28A 4EBDA 3ZDCA 2KJ5A 2HCFA 5K4LA 5DDYA 1BPEA 2H3QA 2JH1A 3K1RB 3SV4A 4RNNA 3HW8A 4PGQA 4KLOA 8ICKA 8ICAA 2W7OA 2W11A 5AM5A 5J8YA 4EEYA 1U47A 5AKZA 1U4BA 1NJWA 4YXMA 1BPDA 5ALOA 5AM2A 1S0MA 1NKEA 4F5OA 8ICRA 1PUZA 3IM1A 4QIWC 1BPZA 3AQEA 5ALEA 2H5XA 2CPRA 3UQ2A 4F4KA 2GWSA 3I28A 2PI4A 3QU4A 1S97A 1XO1A 2WTFA 3PZPA 3NRWA 2LPEA 3C1YA 2BCUA 4I2FA 4NLCA 8ICYA 1ZQKA 2XI9A 4KLJA 1U48A 2Y0SF 3MR2A 1ZRMA 1B43A 3B0XA 1ZJNA 3MR5A 2HBJA 2YMMA 2KFNA 5L1LA 1TAUA 2ZUCA 4E0DA 5AM4A 3LWLA 4ECXA 4KTQA 7ICKA 1N60A 7ICGA 4UW9A 3MC1A 3FM9A 3QU2A 3CRXA 4RQ6A 4BX9C 4PPXA 1SXDA 1SWWA 1WWVA 5AI5A 3ZD8A 3DV9A 5E79U 4DQRA 5HP4A 2YTUA 5J2BA 2AH5A 4F8RA 4I2GA 4KLGA 4JWNA 2O6KA 4DL4A 5DQHA 4F4YA 3B9JA 5AI0A 5KFGA 4WJ3B 4YVZA 5ALWA 4ECVA 4C7YA 1SGGA 5DB9A 5DQGA 2YMQA 1NI3A 2PKEA 2VJ5A 5HMMA 5L1IA 2JXJA 5J2KA 3ZI4A 1ZQDA 9ICXA 2EZZA 4ELUA 5EE9A 4MHVA 1RXWA 3UXNA 7ICPA 4PGYA 3UM9A 4NY8A 2NRZA 3SR6A 1L8OA 4FZNA 5KFCA 5ALLA 2K4IA 2DL0A 2AU0A 4QIWF 2W54A 3T79A 1QTMA 5G5GA 1N62A 2WAQC 4Z6DA 4JMUA 3BZKA 2AHOB 1NKCA 2XGQA 4LZDA 1ZYQA 1D8BA 1RYUA 5AM0A 4RQMA 2DGZA 2QB0A 3QXGA 3AQFA 3RJJA 5DG8A 3Q8SB 5KT4A 1UT5A 3CP8A 5ALYA 2EZYA 5ALVA 3IG5A 2RLTA 4RQ2A 2KG5A 3LDAA 2ZTCA 2E1EA 2KIVA 5KFZA 2YY6A 8ICOA 2RDIA 3KHRA 4ECTA 1X9SA 2EQYA 1KKXA 2AGPA 5KFWA 5GTHU 2JZBB 3K1ZA 3BQ1A 2F1HA 4GXJA 3H0RB 3CYMA 5BOLA 1D9FA 4CF4A 3I1YA 4I2BA 4IL6U 3VCBA 2ZTEA 4HYKA 2IOFA 5J0TA 2FMQA 4B6JA 1AROP 3NVWA 5ALKA 1NJYA 1Z00A 5H2FU 3MDCA 4JB3A 4AYBC 3C5GA 3RJFA 3H8WA 2YMLA 1XWLA 3RH6A 4CGZA 3T5LA 4CCHA 2C2RA 8ICXA 1JMSA 4RT2A 5ALGA 2ISOA 1QSSA 3OHAA 3MGHA 3BQ0A 1X40A 2KMDA 1ZETA 3TARA 2ASJA 1MQ3A 2ZG6A 1FFUA 2OYYA 3IP4B 5KFXA 4YD1A 5T14A 5KFPA 3GV7B 3RF9A 1J97A 4KLLA 3SI8A 1KL9A 1FO4A 3WKAA 3KTQA 2HOQA 4J9MA 4P0QA 2W55A 2KIWA 2D3DA 3Q8RB 4EBCA 1NJZA 4QZFA 2WAQF 5KT7A 1B0XA 1NOMA 3AUOA 2IOHA 2XICA 1ZD2P 3GV5B 4DLGA 1SL1A 4DFMA 4O3QA 4FE3A 3G6XA 1N5WA 1YT3A 3WK6A 4YMNA 5DB6A 5KFFA 9ICVA 4UARA 3GQCA 4F4ZA 4M9GA 3SEIA 4DSKA 1NK9A 5AIAA 8ICWA 3N28A 1K1SA 1JN3A 4F3OA 4J9NA 4DFDA 1QQ7A 1L3UA 2BPCA 4CNQA 8ICLA 3E0FA 1ZQMA 2R8JA 4OD0A 2ZUDA 3J81j 3RH4A 4BDPA 4TUPA 4UQGA 4NM2A 3F5AA 5AHXA 3G6VA 3PMNA 3TKAA 2G08A 4J9RA 5J2GA 2Y1IA 3T5HA 1K5OA 2BCSA 1D8LA 2JEJA 3NGDA 4F4WA 3QU5A 3MGIA 4Y2XA 1PK1A 5F3XB 1N56A 4DWIA 2K60A 5KFQA 4AYBF 4ED2A 1S8OA 2FPKA 2K8AA 4DCCA 1SL0A 3RJIA 3RAXA 2HHQA 1JROA 3ZDAA 2JHDA 2WHEA 1UPHA 4RPZA 5ALQA 2KVCA 1L3VA 2IBKA 4DS5A 3QEBZ 4RZRA 1HIWA 1RM6C 4GC6A 3GIKA 2PFNA 4ECZA 4LVSA 2BGWA 4R65A 5AI8A 5CP2A 2KOBA 1L6NA 5DG9A 1NKBA 4F2SA 5EWFA 5KFDA 3HX0A 2KSOA 4CF5A 1ECWA 7ICTA 2HHUA 4DFJA 4EYHB 4FZLA 1T7PA 4NJ8A 2F1IA 4RT3A 2KFZA 2K89A 5CR0A 8ICVA 5KFTA 4NLNA 5D49A 3O0FA 2HBKA 3QU7A 5DB7A 5DBBA 3ISBA 1SXEA 1KDHA 4DO9A 1URJA 2QB0B 1KEJA 9ICSA 1PK3A 2Y9TA 3M9OB 1N5XA 2XY6A 3D2SA 4YR0A 3F53A 1BNOA 2LM4A 2KICA 1TAMA 5A0LA 3PV8A 5JU5A 2L5YA 4Y2JA 3WKEA 2ZJ5A 1JXEA 4ELVA 2F1JA 2YN4A 5KFMA 4EELA 5KT5A 4ICAA 5F9LA 5AI9A 5HR6A 4RQ4A 1F5SA 1N48A 2HHTA 4GFJA 2BHNA 2HBLA 3GIMA 3TADC 5L1KA 3SMVA 2LM1A 4DOAA 4KLIA 2R18A 2FMPA 4O3MA 5AKEA 2A1AA 2BPFA 1Z00B 1TKDA 2LMRA 1TK0A 4FBTA 1XU4A 1IXRA 1HUZA 3NRZA 5KL1B 3JPNA 1SV0C 2KD1A 3PSIA 2K8BB 3AU6A 5HHHA 5F9NA 1NK5A 1L3TA 2FI1A 2KHQA 4UAWA 4BXOA 3DEEA 2XVTA 4C8KA 3PSTA 3NVYA 4YCXA 3QU9A 4G9BA 2OHFA 3H0LB 2DF4B 3H8SA 2KN7A 4YQWA 3RH5A 1IIPA 5AKXA 2A3VA 4P0QB 5EE0A 3C23A 5KG3A 5AI4A 2G5IB 5KTQA 1BNPA 1UA1A 1RQNA 3NVZA 4Q45A 4MFCA 3RB6A 4J03A 2G09A 4KMUA 2UVWA 4MEXA 8ICSA 1ZQPA 4XA5A 7ICEA 3ONNA 5J0RA 4FFDA 3M6ZA 5KFLA 1DXSA 2ZIXA 2OXOA 4UBCA 3KKAA 1QLNA 1F44A 7ICLA 2GOLA 3KOOA 1T8EA 4I2IA 4DQQA 4K4IA 1FFVA 3EWAA 2KTQA 2G07A 3TANA 5HHIA 2JMGA 4UB4A 4IS7A 5ALFA 4C8OA 4RQ5A 3MR3A 4ECYA 2C2EA 2VJ4A 2GH1A 2Q4TA 2WFAA 4XQ8A 2ALZA 1PVQA 3KBBA 2ZIVA 3IV6A 3UPQA 2HHVA 3Q8MA 4Y2RA 4J9OA 2BQ3A 1ZQ1C 1V85A 4BJQA 4X5VA 2JEGA 1X66A 1IV8A 4ED8A 2HOIA 2HW3A 4FS2A 1S77D 1PK1B 4DL7A 3BQTA 1WCLA 4NLBA 1NK6A 1LV5A 4KLSA 3RB3A 1Q3VA 3IRUA 4KX3A 1VDVA 5CJ7A 5ALNA 4DQSA 2HHXA 2KZZA 9ICOA 2OM6A 3R9KA 4F4XA 3HILA 2YX8A 2HHSA 1MQ2A 4O9MA 2UVUA 1SIJA 1NK4A 1WG8A 2ASDA 2OH2A 5KFRA 3IN5A 5J0OA 2W03A 3IHQB 4ECWA 3LVVA 5DB8A 3C2LA 3WKDA 4TURA 2DPIA 2KSOB 4IR1A 3KFUF 2I6XA 3BDPA 3SENA 3HPOA 3QX7A 4Z6EA 3WK8A 3C28A 1SKRA 2DFLA 3OGUA 4DLEA 3AN1A 1PVPA 3RRHA 3S6JA 2MU2A 3N7SC 3MBYA 4KLDA 7ICUA 2WF6A 3N97B 5HMLA 2BPGA 7ICHA 2EZXA 4LJXA 1YZ7A 3D2QA 4GC7A 3M8SA 2MSNA 5KFSA 1K1QA 1JIHA 5J8YC 1CUKA 4NM1A 2KV2A 2ZXIA 2HI0A 3LVWA 4IRDA 5DLFA 2OCEA 4JV1A 7ICNA 3LWMA 3PW0A 2IHNA 4PJ0U 3T3FA 5DKWA 1RZTA 2W7PA 4FBUA 2DUYA 7ICJA 1WWUA 2RQ5A 3QZ7A 4QWAA 1UT8A 3MDAA 5FP0A 8ICNA 4JV2A 2BDPA 1ZQHA 4ZH4A 3SD7A 2DPJA 1L7OA 1MC8A 4DSJA 4Q8FA 4IQTA 4QZDA 5CHGA 3TQ1A 5KG6A 8ICJA 2NYVA 4NLZA 3MR6A 2BQRA 1ZQBA 4C7ZA 2JR5A 5AKGA 3HWTA 5AKLA 4BXOB 2C22A 4O3SA 2W9AA 5J2FA 3U26A 1X9MA 2E8PA 5AK4A 1ZQOA 4US8A 4QZGA 3RBEA 4PH5A 4P4PA 3KHHA 1KLNA 3T5KA 4C4SA 1H38A 1QQ6A 4OJPA 1ZQLA 2K4EA 4PHAA 5HR7A 1IM4A 3RJKA 3TAPA 1ZQQA 4C4RA 1KW4A 1BPXA 4OJOA 8ICCA 2W3SA 3V7KA 4KMOB 1JUDA 4RQ1A 1RG6A 2MA1A 7ICQA 4DQPA 5KFJA 4P4OA 4ED6A 2HBMA 4DOBA 1ZQEA 1O08A 5JTIA 4B9SA 2F8KA 4OCZA 2ZIXB 3TACB 1OW5A 2E1FA 2YB4A 3OJUA 1JRPA 3V7JA 1ZQXA 5KFUA 4BWMA 1JX4A 3V6KA 5AK3A 9ICBA 4Z6CA 2Z7JA 4YN4A 5G5HA 5ALMA 1ZQIA 4J9QA 2N1RA 2E3TA 4B9VA 3RFAA 4NLKA 2ZIVB 1KQQA 4BUGA 2A19A 2HOFA 2WF9A 3GIIA 5DGBA 4MF8A 4CE6A 2KKVA 3M7DA 5BOMA 2JRZA 5DGAA 4F5RA 9ICJA 1ZQGA 3PW2A 3PW7A 2F76X 1RQLA 2KZMA 9ICQA 2NRVA 4RUAA 4NV0A 4I2DA 3NUQA 1IG6A 5AICA 9ICGA 4P4MA 4K4HA 7ICIA 3F2BA 3RAQA 1SWVA 2D6FC 3PX4A 1ZQJA 4QWBA 3TFSA 1ZQUA 1SKSA 3UXOA 1A77A 5ALPA 1ZD4A 4F5PA 2JEIA 2FE9A 2AGOA 2CN1A 2H3IA 1XS9D 3GIJA 3H4DA 5AKJA 2RHFA 1X6JA 3Q8PB 2QB1A 3CW2C 5KG4A 3RBDA 5IIJA 3EPIA 1Q3UA 1HEKA 3BQ7A 4RQ8A 1Z3EB 5DBCA 3PO4A 5KFEA 5L1JA 1V97A 1U45A 7ICVA 1MSWD 1AQ6A 2NO4A 4U7CA 5EWEA 2PMZC 2MUTA 3GILA 2MAXA 4PZNA 3OSNA 4PHPA 1O03A 4ZOHC 1OUQA 3WU2U 1ZQYA 2ZTDA 5AKHA 5KT2A 4Q8EA 4ED3A 1TAQA 2JH7A 5D46A 3RJEA 3IG8A 3L5KA 2K8CB 2IHMA 4NWIA 3L4PA 4ECQA 1BPBA 2D8CA 3RRGA 2W9BA 4GXIA 3ZDEA 1TVAA 2HHWA 3QUQA 4QWEA 4QWDA 3PO5A 4EX7A 4DL2A 1T94A 3GFKB 1S76D 2KK0A 5L9XA 3PR4A 4C8LA 5DG7A 4O0IA 3N7PD 5J0XA 1HUOA 1KRPA 3TI0A 3NASA 2YQEA 7ICRA 1VJ5A 1Q46A 4C0ZA 1QQ5A 2RRDA 2ZJ8A 1ZQTA 2G5HB 4R8UA 2B6GA 8ICBA 2EANA 2QKQA 4DQIA 4U6PA 2FPLA 4M0AA
chains in the Genus database with same CATH topology
2JV3A 2KSOB 2ESEA 2QARB 3KKAC 1SXEA 5JRTA 1OXJA 3SENA 3SEIA 2QB1A 2QB0B 1PK3A 2KG5A 2Y9TA 2KIVA 3H8MA 1V38A 3BQ7A 3IDWA 1LKYA 1SV4A 1KW4A 2E8NA 5JU5A 2L5YA 1X9XA 1DXSA 1SXDA 5L1MA 2EAMA 3KKAA 1WWVA 2DKXA 1RG6A 2YTUA 1LKYB 2F3NA 2DKZA 5JTIA 2F8KA 4PZNA 4IS7A 1UQVA 4RQNA 3TACB 5J8YC 1OW5A 3TADC 2GLEA 1PK1A 5F3XB 2K60A 1SGGA 1V85A 2EAOA 2LMRA 3K1RB 1X66A 4PZOA 1SV0C 4MHVA 5KNIA 1WWUA 2D8CA 5J8YA 1PK1B 3TADA 1Z1VA 2K4PA 1X40A 2KMDA 1UCVA 3BS5A 4NL9C 1B4FA 1F0MA 2E8MA 2DL0A 2E8OA 1SV0A 2Y9UA 3HILA 1JI7A 2D3DA 3BS5B 1COKA 2LPEA 1B0XA 4NL9A 3BS7A 2KE7A 2KSOA 2EAPA 2E8PA 2QARA 4RQMA 2B6GA 2F44A 4NJ8A 2QB0A 2EANA 2QKQA 2ES6A 2FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV3 A;  2KSO B;  2ESE A;  2QAR B;  3KKA C;  1SXE A;  5JRT A;  1OXJ A;  3SEN A;  3SEI A;  2QB1 A;  2QB0 B;  1PK3 A;  2KG5 A;  2Y9T A;  2KIV A;  3H8M A;  1V38 A;  3BQ7 A;  3IDW A;  1LKY A;  1SV4 A;  1KW4 A;  2E8N A;  5JU5 A;  2L5Y A;  1X9X A;  1DXS A;  1SXD A;  5L1M A;  2EAM A;  3KKA A;  1WWV A;  2DKX A;  1RG6 A;  2YTU A;  1LKY B;  2F3N A;  2DKZ A;  5JTI A;  2F8K A;  4PZN A;  4IS7 A;  1UQV A;  4RQN A;  3TAC B;  5J8Y C;  1OW5 A;  3TAD C;  2GLE A;  1PK1 A;  5F3X B;  2K60 A;  1SGG A;  1V85 A;  2EAO A;  2LMR A;  3K1R B;  1X66 A;  4PZO A;  1SV0 C;  4MHV A;  5KNI A;  1WWU A;  2D8C A;  5J8Y A;  1PK1 B;  3TAD A;  1Z1V A;  2K4P A;  1X40 A;  2KMD A;  1UCV A;  3BS5 A;  4NL9 C;  1B4F A;  1F0M A;  2E8M A;  2DL0 A;  2E8O A;  1SV0 A;  2Y9U A;  3HIL A;  1JI7 A;  2D3D A;  3BS5 B;  1COK A;  2LPE A;  1B0X A;  4NL9 A;  3BS7 A;  2KE7 A;  2KSO A;  2EAP A;  2E8P A;  2QAR A;  4RQM A;  2B6G A;  2F44 A;  4NJ8 A;  2QB0 A;  2EAN A;  2QKQ A;  2ES6 A;  2FE9 A; 
#chains in the Genus database with same CATH topology
 2JV3 A;  3Q8K A;  1A0P A;  5KAI U;  4RQ3 A;  1V9P A;  9ICP A;  1DRG A;  4IRK A;  2DBY A;  5JRT A;  4RUC A;  3M6K A;  5KT6 A;  2VA3 A;  2PI5 A;  3SAH A;  3H8M A;  3C29 A;  4KLM A;  4XUS A;  1TK5 A;  1ZD5 A;  1LKY A;  5J2C A;  4YD2 A;  3G6Y A;  3PW4 A;  1SV4 A;  3QE9 Y;  1XSP A;  4EZ6 A;  2ISP A;  4F2R A;  3JPP A;  3Q8L A;  3SAF A;  2PMZ F;  3MGV A;  1NNL A;  2KJ8 A;  1GO3 F;  2HVI A;  4CRX A;  2B21 A;  2ATL A;  1X42 A;  3PR5 B;  2ZXH A;  5EWG A;  1Y88 A;  4EZ9 A;  1TE2 A;  4QZ8 A;  5KFN A;  5KG7 A;  3PML A;  1C7Y A;  5ALT A;  2RDJ A;  5AKK A;  3UMG A;  4J9L A;  1RDF A;  1A76 A;  3ZD9 A;  4PZO A;  2KP7 A;  3FDS A;  3QYP A;  2NRX A;  3C2K A;  8ICT A;  2BR0 A;  1BPY A;  2ZJA A;  5CB1 A;  2LHT A;  5KG5 A;  4KLF A;  4ECS A;  2LKY A;  1ZOL A;  2KHV A;  1X6I A;  3KHL A;  4I2E A;  5AM3 A;  3F5E A;  4RNM A;  2PFP A;  4DSI A;  3M8R A;  4Y2T A;  4PHD A;  3GDX A;  2ZIW A;  4ECU A;  2FLL A;  2P35 A;  1XO0 A;  4NL9 A;  3WK5 A;  5B66 U;  3MFI A;  2B0C A;  5IIO A;  2AXT U;  3AL0 B;  2QAR A;  3OTQ A;  3NS1 A;  3JPQ A;  1DGS A;  4ED7 A;  3K4G A;  3N7R C;  2HVH A;  4Y2S A;  3LK9 A;  3SV3 A;  3PX6 A;  4DSF A;  4TQR A;  2C2D A;  4M2Y A;  4O5C A;  2F77 X;  4UAY A;  4B9T A;  2W3R A;  1XNS A;  3CNH A;  4DFP A;  4BWJ A;  1ZJM A;  5AK5 A;  2WF7 A;  3ISD A;  4CDG A;  4ECR A;  4C8M A;  4MFA A;  4EX6 A;  4R66 A;  5KFO A;  4JUZ A;  3MFH A;  4QJF B;  3PY8 A;  4B9L A;  1QH9 A;  3UMC A;  1UQV A;  4YMM A;  2VAN A;  2MUT B;  4R64 A;  4ED1 A;  2NO5 A;  3EYZ A;  4I28 A;  2GO7 A;  1BGX T;  4C80 A;  1KFT A;  8ICQ A;  4QNL A;  2LYB A;  4DS4 A;  2BQU A;  5IIM A;  4DEZ A;  1CRX A;  1ZQZ A;  8ICP A;  1PZN A;  2KEY A;  3C2M A;  2W9B B;  5GTI U;  1ZQF A;  4M9L A;  2W8K A;  4IQV A;  3SYZ A;  4DSL A;  3F2C A;  3EPG A;  1S5L U;  3TFR A;  1NK8 A;  1J2M A;  2P6U A;  4JV0 A;  1S9F A;  3ISC A;  1ZQV A;  4JK1 A;  3H4B A;  2AGQ A;  2LBO A;  2KZ3 A;  2YMP A;  4DF4 A;  3UMB A;  1P7D A;  2VA2 A;  2WB1 C;  3AEV A;  5ALJ A;  4MFF A;  1TFR A;  5J0P A;  2IA6 A;  3K75 D;  5DLG A;  5IIN A;  2F8L A;  3FYH A;  3KKA C;  4R8U B;  1L7M A;  1D8Y A;  3GV8 B;  4UB1 A;  4UAT A;  3ETR A;  2BDU A;  5CWR A;  4IC9 A;  3Q8Q B;  3KHG A;  3KD3 A;  1XSN A;  5EOZ A;  5IIL A;  3V6J A;  5KT3 A;  2XCP A;  5J2A A;  8ICU A;  4QW9 A;  4B9M A;  5KFI A;  4P2H A;  2NRW A;  4RQ0 A;  2BKE A;  3NTU A;  2I9G A;  3FAH A;  4EEK A;  5DQI A;  1LKY B;  1EXN A;  2F3N A;  4OJ6 A;  5ALI A;  4YR3 A;  4DL5 A;  3V72 A;  2ZIU A;  3OHB A;  2PFO A;  2M9N A;  4M9H A;  2R8I A;  4YG2 A;  5KFV A;  9ICA A;  1QSY A;  4LZG A;  5ALX A;  3C21 A;  2PFQ A;  4Y2V A;  2AQ0 A;  3H40 A;  4M04 A;  1COO A;  2WF5 A;  3QUT A;  5TZV A;  1ZQN A;  5JUM A;  4ELT A;  4PHE A;  3PSF A;  2ZUB A;  1JAL A;  2UVV A;  2FJ6 A;  4UB5 A;  8ICH A;  3NVV A;  5J0U A;  4QW8 A;  1SZP A;  3MAB A;  5AKI A;  3T5J A;  4I2C A;  4KLQ A;  2OWO A;  8ICG A;  1JI7 A;  1C20 A;  2KJ9 A;  4MEY A;  3RB4 A;  1WUD A;  4XRH A;  1NK7 A;  2FMS A;  1L7N A;  3RB0 A;  4RQ7 A;  2KVS A;  3ZDD A;  2YB1 A;  2ZIW B;  2P6R A;  1A6S A;  4EEN A;  1ZQW A;  3F2D A;  5DBA A;  4RPY A;  1T4G A;  4IR9 A;  2NV3 A;  4ED0 A;  2WB1 F;  2BZF A;  2QAR B;  2BCV A;  4RU9 A;  3GZF A;  1ZD3 A;  2IMW P;  4G3I A;  3PNC A;  4Q44 A;  2K4H A;  9ICL A;  1D9D A;  1X9X A;  4QZC A;  1JXL A;  9ICE A;  4UAV A;  1M6Y A;  4B9U A;  1PVR A;  2W9C A;  2KKP A;  1X2I A;  4FO6 A;  2EDU A;  5EE3 A;  3SZ2 A;  5ALD A;  4J9S A;  1T3N A;  3PSP A;  3QEA Z;  1ZQC A;  1BVS A;  2R8K A;  3I76 A;  2XGP A;  4I29 A;  2VIX A;  4UBB A;  4F50 A;  4DF8 A;  4KX5 A;  5III A;  3UQ0 A;  2AJQ A;  3ICX A;  1KSP A;  4Z6F A;  1XSL A;  5KFK A;  5ALS A;  2H3Z A;  3JPO A;  2G0A A;  4O3N A;  4YP3 A;  3VC8 A;  2Y1J A;  3QUB A;  2K4P A;  4O5E A;  3HT3 A;  1ZRN A;  3BS5 A;  3JPR A;  7ICM A;  3OJS A;  2E8M A;  2ASL A;  4PGX A;  3SAG A;  2FDR A;  5KG1 A;  2Y9U A;  9ICI A;  3WKC A;  2R8G A;  4IQU A;  3JPS A;  3BJY A;  3RJH A;  5CRX A;  1WYG A;  2CXY A;  3AM9 A;  2F2A B;  2KE7 A;  5C0Y A;  3GU3 A;  4BGD A;  4Y2Y A;  2W43 A;  4OJL A;  2ES6 A;  4M6W A;  2A1J A;  3BQ2 A;  1TV9 A;  2BCQ A;  5KG2 A;  4KLH A;  4HAI A;  3D6J A;  5B5E U;  1SB3 C;  3EUB 2;  4RNO A;  2ESE A;  3C5F A;  4PL1 A;  5J2H A;  5TIS U;  2XO7 A;  3TAQ A;  4O3O A;  4MF2 A;  3RTV A;  4QZI A;  1WCN A;  2BCR A;  3JPT A;  4UB2 A;  3PVX A;  3ED5 A;  5KL8 B;  1S0O A;  1ZQS A;  2EAM A;  2XC9 A;  4Y2U A;  1DK3 A;  2QLT A;  1L8L A;  4R63 A;  1DOQ A;  4C8N A;  1L7P A;  2DKZ A;  2WF8 A;  3EW9 A;  4PL2 A;  4UAU A;  3UXP A;  1S0V A;  2JGA A;  5DDM A;  3M9M B;  2FLN A;  9ICM A;  5KFB A;  2J6S A;  7ICS A;  5KFA A;  2GLE A;  5J2D A;  2ZIU B;  2EAO A;  3KZI U;  2W8L A;  1B22 A;  1FIQ A;  4DL6 A;  5ALH A;  1UA0 A;  1LB2 B;  4B9N A;  3M1Y A;  2CRX A;  5KAF U;  1Z1V A;  5AM1 A;  4DOC A;  5J2J A;  1B4F A;  4O3P A;  1F0M A;  4NLG A;  4TQS A;  2E5S A;  1ED1 A;  1RYS A;  4UB3 A;  1U9L A;  4KLU A;  3E58 A;  5ALR A;  2V9W A;  1MN8 A;  3DDH A;  5AK6 A;  8ICM A;  1Z4O A;  1DGJ A;  4QZE A;  3H8J A;  5ALU A;  3ALR A;  1L3S A;  1UHU A;  1S0N A;  3V7L A;  4F91 B;  4P0P A;  2P66 A;  4TUS A;  5BPC A;  1ZQR A;  4EBE A;  2LYH A;  2XCA A;  8ICE A;  4I27 A;  2AQ4 A;  1TK8 A;  9ICH A;  4DSE A;  2HMX A;  4K4G A;  2VA8 A;  4I2J A;  4JWM A;  1N61 A;  2IOF K;  4GLX A;  3HP6 A;  5KFH A;  4F72 A;  4AP9 A;  2MRL A;  4QWC A;  9ICC A;  4M9J A;  4KN7 A;  4NXZ A;  3SQI A;  1Z1B A;  4QZA A;  5KFY A;  1MA7 A;  4O3R A;  5J0W A;  2W04 A;  1T3Q A;  5IIK A;  3LYS A;  3QUC A;  2JEF A;  5J2E A;  2W9C B;  4M9N A;  3C1Z A;  7ICF A;  4CF3 A;  1X9W A;  4OJ5 A;  1KN5 A;  3WK9 A;  3ETL A;  4M47 A;  1Q8K A;  2H3V A;  2Q0Z X;  4FZM A;  2NRT A;  3TAD A;  2EH9 A;  4DFK A;  3RR7 A;  1Z4N A;  4KIT B;  1U49 A;  4TUQ A;  3AMZ A;  4A8E A;  2FPM A;  3RR8 A;  1CEZ A;  9ICF A;  1LVH A;  3HKZ C;  3QNM A;  2E8O A;  1SV0 A;  4F5N A;  2DQN B;  4UAZ A;  2V4R A;  9ICU A;  4F5Q A;  3BS5 B;  3V6H A;  1COK A;  4QZH A;  3WK7 A;  3M9N B;  5J2I A;  3BS7 A;  3FC4 A;  3WK4 A;  3A0B U;  3ORY A;  4O5K A;  5J0S A;  2RP5 A;  4I2A A;  1NZP A;  5KG0 A;  2H3F A;  2F44 A;  5AKY A;  9ICT A;  3PX0 A;  5AI6 A;  1ZQA A;  5CA7 A;  5J0Q A;  3N4M B;  3OSP A;  4QZ9 A;  1KFD A;  8ICZ A;  2LI6 A;  2UVR A;  4F71 A;  1CI4 A;  2VKQ A;  2J6T A;  1V38 A;  4M6W B;  2A1J B;  5HNK A;  1KTQ A;  1SKW A;  4OO1 J;  1NZB A;  2HSZ A;  1SZH A;  1S10 A;  5L1M A;  1KFS A;  4USA A;  4QZB A;  4YMO A;  2DKX A;  4I2H A;  3H0M B;  4IRC A;  4YR2 A;  9ICW A;  4KLE A;  7ICO A;  4UB8 U;  3KZX A;  1J2N A;  4UB6 U;  4RQN A;  4C4T A;  3BZC A;  1Z19 A;  4J9K A;  1RPL A;  3THV A;  5ALZ A;  5EE1 A;  3RJG A;  4GIB A;  1YZ6 A;  5KNI A;  4KLT A;  4YXJ A;  2DWQ A;  1DK2 A;  1N2X A;  4RPX A;  8ICI A;  4EYI B;  3EZ5 A;  2LYA A;  1FEZ A;  2W9M A;  1UCV A;  4NL9 C;  1KBU A;  2OEH A;  1XC9 A;  3HJE A;  1ZXI A;  1VLB A;  1RYR A;  9ICR A;  3HRD D;  3D2N A;  5C5J A;  3HKZ F;  1NJX A;  3E2E A;  4Q43 A;  5J0Y A;  5CEH A;  1RXV A;  3QZ8 A;  8ICF A;  4Y2P A;  2EAP A;  2Y0S C;  3PW5 A;  3H7I A;  3L3F X;  4FS1 A;  4Y2Q A;  2R8H A;  4US9 A;  2PXI A;  1QCK A;  2HDO A;  2JZB A;  1QSL A;  1HJP A;  1OXJ A;  4KN4 A;  4DL3 A;  3A0H U;  4F93 B;  1NK0 A;  3OPX A;  4P0P B;  4GXK A;  3IDW A;  3ZDB A;  2G06 A;  3AU2 A;  2E8N A;  4IQW A;  2I5H A;  4ACO A;  2FLP A;  4J9P A;  1N63 A;  4YFK A;  3B0Y A;  2M0N A;  2V4Q A;  2J6U A;  1L5U A;  2ODG A;  3WKB A;  5AIB A;  2XY5 A;  4UAS A;  1SL2 A;  5J29 A;  9ICK A;  2KNJ A;  4F92 B;  2XY7 A;  2XID A;  2I1Q A;  9ICN A;  5D4B A;  2C28 A;  4EBD A;  3ZDC A;  2KJ5 A;  2HCF A;  5K4L A;  5DDY A;  1BPE A;  2H3Q A;  2JH1 A;  3K1R B;  3SV4 A;  4RNN A;  3HW8 A;  4PGQ A;  4KLO A;  8ICK A;  8ICA A;  2W7O A;  2W11 A;  5AM5 A;  5J8Y A;  4EEY A;  1U47 A;  5AKZ A;  1U4B A;  1NJW A;  4YXM A;  1BPD A;  5ALO A;  5AM2 A;  1S0M A;  1NKE A;  4F5O A;  8ICR A;  1PUZ A;  3IM1 A;  4QIW C;  1BPZ A;  3AQE A;  5ALE A;  2H5X A;  2CPR A;  3UQ2 A;  4F4K A;  2GWS A;  3I28 A;  2PI4 A;  3QU4 A;  1S97 A;  1XO1 A;  2WTF A;  3PZP A;  3NRW A;  2LPE A;  3C1Y A;  2BCU A;  4I2F A;  4NLC A;  8ICY A;  1ZQK A;  2XI9 A;  4KLJ A;  1U48 A;  2Y0S F;  3MR2 A;  1ZRM A;  1B43 A;  3B0X A;  1ZJN A;  3MR5 A;  2HBJ A;  2YMM A;  2KFN A;  5L1L A;  1TAU A;  2ZUC A;  4E0D A;  5AM4 A;  3LWL A;  4ECX A;  4KTQ A;  7ICK A;  1N60 A;  7ICG A;  4UW9 A;  3MC1 A;  3FM9 A;  3QU2 A;  3CRX A;  4RQ6 A;  4BX9 C;  4PPX A;  1SXD A;  1SWW A;  1WWV A;  5AI5 A;  3ZD8 A;  3DV9 A;  5E79 U;  4DQR A;  5HP4 A;  2YTU A;  5J2B A;  2AH5 A;  4F8R A;  4I2G A;  4KLG A;  4JWN A;  2O6K A;  4DL4 A;  5DQH A;  4F4Y A;  3B9J A;  5AI0 A;  5KFG A;  4WJ3 B;  4YVZ A;  5ALW A;  4ECV A;  4C7Y A;  1SGG A;  5DB9 A;  5DQG A;  2YMQ A;  1NI3 A;  2PKE A;  2VJ5 A;  5HMM A;  5L1I A;  2JXJ A;  5J2K A;  3ZI4 A;  1ZQD A;  9ICX A;  2EZZ A;  4ELU A;  5EE9 A;  4MHV A;  1RXW A;  3UXN A;  7ICP A;  4PGY A;  3UM9 A;  4NY8 A;  2NRZ A;  3SR6 A;  1L8O A;  4FZN A;  5KFC A;  5ALL A;  2K4I A;  2DL0 A;  2AU0 A;  4QIW F;  2W54 A;  3T79 A;  1QTM A;  5G5G A;  1N62 A;  2WAQ C;  4Z6D A;  4JMU A;  3BZK A;  2AHO B;  1NKC A;  2XGQ A;  4LZD A;  1ZYQ A;  1D8B A;  1RYU A;  5AM0 A;  4RQM A;  2DGZ A;  2QB0 A;  3QXG A;  3AQF A;  3RJJ A;  5DG8 A;  3Q8S B;  5KT4 A;  1UT5 A;  3CP8 A;  5ALY A;  2EZY A;  5ALV A;  3IG5 A;  2RLT A;  4RQ2 A;  2KG5 A;  3LDA A;  2ZTC A;  2E1E A;  2KIV A;  5KFZ A;  2YY6 A;  8ICO A;  2RDI A;  3KHR A;  4ECT A;  1X9S A;  2EQY A;  1KKX A;  2AGP A;  5KFW A;  5GTH U;  2JZB B;  3K1Z A;  3BQ1 A;  2F1H A;  4GXJ A;  3H0R B;  3CYM A;  5BOL A;  1D9F A;  4CF4 A;  3I1Y A;  4I2B A;  4IL6 U;  3VCB A;  2ZTE A;  4HYK A;  2IOF A;  5J0T A;  2FMQ A;  4B6J A;  1ARO P;  3NVW A;  5ALK A;  1NJY A;  1Z00 A;  5H2F U;  3MDC A;  4JB3 A;  4AYB C;  3C5G A;  3RJF A;  3H8W A;  2YML A;  1XWL A;  3RH6 A;  4CGZ A;  3T5L A;  4CCH A;  2C2R A;  8ICX A;  1JMS A;  4RT2 A;  5ALG A;  2ISO A;  1QSS A;  3OHA A;  3MGH A;  3BQ0 A;  1X40 A;  2KMD A;  1ZET A;  3TAR A;  2ASJ A;  1MQ3 A;  2ZG6 A;  1FFU A;  2OYY A;  3IP4 B;  5KFX A;  4YD1 A;  5T14 A;  5KFP A;  3GV7 B;  3RF9 A;  1J97 A;  4KLL A;  3SI8 A;  1KL9 A;  1FO4 A;  3WKA A;  3KTQ A;  2HOQ A;  4J9M A;  4P0Q A;  2W55 A;  2KIW A;  2D3D A;  3Q8R B;  4EBC A;  1NJZ A;  4QZF A;  2WAQ F;  5KT7 A;  1B0X A;  1NOM A;  3AUO A;  2IOH A;  2XIC A;  1ZD2 P;  3GV5 B;  4DLG A;  1SL1 A;  4DFM A;  4O3Q A;  4FE3 A;  3G6X A;  1N5W A;  1YT3 A;  3WK6 A;  4YMN A;  5DB6 A;  5KFF A;  9ICV A;  4UAR A;  3GQC A;  4F4Z A;  4M9G A;  3SEI A;  4DSK A;  1NK9 A;  5AIA A;  8ICW A;  3N28 A;  1K1S A;  1JN3 A;  4F3O A;  4J9N A;  4DFD A;  1QQ7 A;  1L3U A;  2BPC A;  4CNQ A;  8ICL A;  3E0F A;  1ZQM A;  2R8J A;  4OD0 A;  2ZUD A;  3J81 j;  3RH4 A;  4BDP A;  4TUP A;  4UQG A;  4NM2 A;  3F5A A;  5AHX A;  3G6V A;  3PMN A;  3TKA A;  2G08 A;  4J9R A;  5J2G A;  2Y1I A;  3T5H A;  1K5O A;  2BCS A;  1D8L A;  2JEJ A;  3NGD A;  4F4W A;  3QU5 A;  3MGI A;  4Y2X A;  1PK1 A;  5F3X B;  1N56 A;  4DWI A;  2K60 A;  5KFQ A;  4AYB F;  4ED2 A;  1S8O A;  2FPK A;  2K8A A;  4DCC A;  1SL0 A;  3RJI A;  3RAX A;  2HHQ A;  1JRO A;  3ZDA A;  2JHD A;  2WHE A;  1UPH A;  4RPZ A;  5ALQ A;  2KVC A;  1L3V A;  2IBK A;  4DS5 A;  3QEB Z;  4RZR A;  1HIW A;  1RM6 C;  4GC6 A;  3GIK A;  2PFN A;  4ECZ A;  4LVS A;  2BGW A;  4R65 A;  5AI8 A;  5CP2 A;  2KOB A;  1L6N A;  5DG9 A;  1NKB A;  4F2S A;  5EWF A;  5KFD A;  3HX0 A;  2KSO A;  4CF5 A;  1ECW A;  7ICT A;  2HHU A;  4DFJ A;  4EYH B;  4FZL A;  1T7P A;  4NJ8 A;  2F1I A;  4RT3 A;  2KFZ A;  2K89 A;  5CR0 A;  8ICV A;  5KFT A;  4NLN A;  5D49 A;  3O0F A;  2HBK A;  3QU7 A;  5DB7 A;  5DBB A;  3ISB A;  1SXE A;  1KDH A;  4DO9 A;  1URJ A;  2QB0 B;  1KEJ A;  9ICS A;  1PK3 A;  2Y9T A;  3M9O B;  1N5X A;  2XY6 A;  3D2S A;  4YR0 A;  3F53 A;  1BNO A;  2LM4 A;  2KIC A;  1TAM A;  5A0L A;  3PV8 A;  5JU5 A;  2L5Y A;  4Y2J A;  3WKE A;  2ZJ5 A;  1JXE A;  4ELV A;  2F1J A;  2YN4 A;  5KFM A;  4EEL A;  5KT5 A;  4ICA A;  5F9L A;  5AI9 A;  5HR6 A;  4RQ4 A;  1F5S A;  1N48 A;  2HHT A;  4GFJ A;  2BHN A;  2HBL A;  3GIM A;  3TAD C;  5L1K A;  3SMV A;  2LM1 A;  4DOA A;  4KLI A;  2R18 A;  2FMP A;  4O3M A;  5AKE A;  2A1A A;  2BPF A;  1Z00 B;  1TKD A;  2LMR A;  1TK0 A;  4FBT A;  1XU4 A;  1IXR A;  1HUZ A;  3NRZ A;  5KL1 B;  3JPN A;  1SV0 C;  2KD1 A;  3PSI A;  2K8B B;  3AU6 A;  5HHH A;  5F9N A;  1NK5 A;  1L3T A;  2FI1 A;  2KHQ A;  4UAW A;  4BXO A;  3DEE A;  2XVT A;  4C8K A;  3PST A;  3NVY A;  4YCX A;  3QU9 A;  4G9B A;  2OHF A;  3H0L B;  2DF4 B;  3H8S A;  2KN7 A;  4YQW A;  3RH5 A;  1IIP A;  5AKX A;  2A3V A;  4P0Q B;  5EE0 A;  3C23 A;  5KG3 A;  5AI4 A;  2G5I B;  5KTQ A;  1BNP A;  1UA1 A;  1RQN A;  3NVZ A;  4Q45 A;  4MFC A;  3RB6 A;  4J03 A;  2G09 A;  4KMU A;  2UVW A;  4MEX A;  8ICS A;  1ZQP A;  4XA5 A;  7ICE A;  3ONN A;  5J0R A;  4FFD A;  3M6Z A;  5KFL A;  1DXS A;  2ZIX A;  2OXO A;  4UBC A;  3KKA A;  1QLN A;  1F44 A;  7ICL A;  2GOL A;  3KOO A;  1T8E A;  4I2I A;  4DQQ A;  4K4I A;  1FFV A;  3EWA A;  2KTQ A;  2G07 A;  3TAN A;  5HHI A;  2JMG A;  4UB4 A;  4IS7 A;  5ALF A;  4C8O A;  4RQ5 A;  3MR3 A;  4ECY A;  2C2E A;  2VJ4 A;  2GH1 A;  2Q4T A;  2WFA A;  4XQ8 A;  2ALZ A;  1PVQ A;  3KBB A;  2ZIV A;  3IV6 A;  3UPQ A;  2HHV A;  3Q8M A;  4Y2R A;  4J9O A;  2BQ3 A;  1ZQ1 C;  1V85 A;  4BJQ A;  4X5V A;  2JEG A;  1X66 A;  1IV8 A;  4ED8 A;  2HOI A;  2HW3 A;  4FS2 A;  1S77 D;  1PK1 B;  4DL7 A;  3BQT A;  1WCL A;  4NLB A;  1NK6 A;  1LV5 A;  4KLS A;  3RB3 A;  1Q3V A;  3IRU A;  4KX3 A;  1VDV A;  5CJ7 A;  5ALN A;  4DQS A;  2HHX A;  2KZZ A;  9ICO A;  2OM6 A;  3R9K A;  4F4X A;  3HIL A;  2YX8 A;  2HHS A;  1MQ2 A;  4O9M A;  2UVU A;  1SIJ A;  1NK4 A;  1WG8 A;  2ASD A;  2OH2 A;  5KFR A;  3IN5 A;  5J0O A;  2W03 A;  3IHQ B;  4ECW A;  3LVV A;  5DB8 A;  3C2L A;  3WKD A;  4TUR A;  2DPI A;  2KSO B;  4IR1 A;  3KFU F;  2I6X A;  3BDP A;  3SEN A;  3HPO A;  3QX7 A;  4Z6E A;  3WK8 A;  3C28 A;  1SKR A;  2DFL A;  3OGU A;  4DLE A;  3AN1 A;  1PVP A;  3RRH A;  3S6J A;  2MU2 A;  3N7S C;  3MBY A;  4KLD A;  7ICU A;  2WF6 A;  3N97 B;  5HML A;  2BPG A;  7ICH A;  2EZX A;  4LJX A;  1YZ7 A;  3D2Q A;  4GC7 A;  3M8S A;  2MSN A;  5KFS A;  1K1Q A;  1JIH A;  5J8Y C;  1CUK A;  4NM1 A;  2KV2 A;  2ZXI A;  2HI0 A;  3LVW A;  4IRD A;  5DLF A;  2OCE A;  4JV1 A;  7ICN A;  3LWM A;  3PW0 A;  2IHN A;  4PJ0 U;  3T3F A;  5DKW A;  1RZT A;  2W7P A;  4FBU A;  2DUY A;  7ICJ A;  1WWU A;  2RQ5 A;  3QZ7 A;  4QWA A;  1UT8 A;  3MDA A;  5FP0 A;  8ICN A;  4JV2 A;  2BDP A;  1ZQH A;  4ZH4 A;  3SD7 A;  2DPJ A;  1L7O A;  1MC8 A;  4DSJ A;  4Q8F A;  4IQT A;  4QZD A;  5CHG A;  3TQ1 A;  5KG6 A;  8ICJ A;  2NYV A;  4NLZ A;  3MR6 A;  2BQR A;  1ZQB A;  4C7Z A;  2JR5 A;  5AKG A;  3HWT A;  5AKL A;  4BXO B;  2C22 A;  4O3S A;  2W9A A;  5J2F A;  3U26 A;  1X9M A;  2E8P A;  5AK4 A;  1ZQO A;  4US8 A;  4QZG A;  3RBE A;  4PH5 A;  4P4P A;  3KHH A;  1KLN A;  3T5K A;  4C4S A;  1H38 A;  1QQ6 A;  4OJP A;  1ZQL A;  2K4E A;  4PHA A;  5HR7 A;  1IM4 A;  3RJK A;  3TAP A;  1ZQQ A;  4C4R A;  1KW4 A;  1BPX A;  4OJO A;  8ICC A;  2W3S A;  3V7K A;  4KMO B;  1JUD A;  4RQ1 A;  1RG6 A;  2MA1 A;  7ICQ A;  4DQP A;  5KFJ A;  4P4O A;  4ED6 A;  2HBM A;  4DOB A;  1ZQE A;  1O08 A;  5JTI A;  4B9S A;  2F8K A;  4OCZ A;  2ZIX B;  3TAC B;  1OW5 A;  2E1F A;  2YB4 A;  3OJU A;  1JRP A;  3V7J A;  1ZQX A;  5KFU A;  4BWM A;  1JX4 A;  3V6K A;  5AK3 A;  9ICB A;  4Z6C A;  2Z7J A;  4YN4 A;  5G5H A;  5ALM A;  1ZQI A;  4J9Q A;  2N1R A;  2E3T A;  4B9V A;  3RFA A;  4NLK A;  2ZIV B;  1KQQ A;  4BUG A;  2A19 A;  2HOF A;  2WF9 A;  3GII A;  5DGB A;  4MF8 A;  4CE6 A;  2KKV A;  3M7D A;  5BOM A;  2JRZ A;  5DGA A;  4F5R A;  9ICJ A;  1ZQG A;  3PW2 A;  3PW7 A;  2F76 X;  1RQL A;  2KZM A;  9ICQ A;  2NRV A;  4RUA A;  4NV0 A;  4I2D A;  3NUQ A;  1IG6 A;  5AIC A;  9ICG A;  4P4M A;  4K4H A;  7ICI A;  3F2B A;  3RAQ A;  1SWV A;  2D6F C;  3PX4 A;  1ZQJ A;  4QWB A;  3TFS A;  1ZQU A;  1SKS A;  3UXO A;  1A77 A;  5ALP A;  1ZD4 A;  4F5P A;  2JEI A;  2FE9 A;  2AGO A;  2CN1 A;  2H3I A;  1XS9 D;  3GIJ A;  3H4D A;  5AKJ A;  2RHF A;  1X6J A;  3Q8P B;  2QB1 A;  3CW2 C;  5KG4 A;  3RBD A;  5IIJ A;  3EPI A;  1Q3U A;  1HEK A;  3BQ7 A;  4RQ8 A;  1Z3E B;  5DBC A;  3PO4 A;  5KFE A;  5L1J A;  1V97 A;  1U45 A;  7ICV A;  1MSW D;  1AQ6 A;  2NO4 A;  4U7C A;  5EWE A;  2PMZ C;  2MUT A;  3GIL A;  2MAX A;  4PZN A;  3OSN A;  4PHP A;  1O03 A;  4ZOH C;  1OUQ A;  3WU2 U;  1ZQY A;  2ZTD A;  5AKH A;  5KT2 A;  4Q8E A;  4ED3 A;  1TAQ A;  2JH7 A;  5D46 A;  3RJE A;  3IG8 A;  3L5K A;  2K8C B;  2IHM A;  4NWI A;  3L4P A;  4ECQ A;  1BPB A;  2D8C A;  3RRG A;  2W9B A;  4GXI A;  3ZDE A;  1TVA A;  2HHW A;  3QUQ A;  4QWE A;  4QWD A;  3PO5 A;  4EX7 A;  4DL2 A;  1T94 A;  3GFK B;  1S76 D;  2KK0 A;  5L9X A;  3PR4 A;  4C8L A;  5DG7 A;  4O0I A;  3N7P D;  5J0X A;  1HUO A;  1KRP A;  3TI0 A;  3NAS A;  2YQE A;  7ICR A;  1VJ5 A;  1Q46 A;  4C0Z A;  1QQ5 A;  2RRD A;  2ZJ8 A;  1ZQT A;  2G5H B;  4R8U A;  2B6G A;  8ICB A;  2EAN A;  2QKQ A;  4DQI A;  4U6P A;  2FPL A;  4M0A A; 
#chains in the Genus database with same CATH homology
 2JV3 A;  2KSO B;  2ESE A;  2QAR B;  3KKA C;  1SXE A;  5JRT A;  1OXJ A;  3SEN A;  3SEI A;  2QB1 A;  2QB0 B;  1PK3 A;  2KG5 A;  2Y9T A;  2KIV A;  3H8M A;  1V38 A;  3BQ7 A;  3IDW A;  1LKY A;  1SV4 A;  1KW4 A;  2E8N A;  5JU5 A;  2L5Y A;  1X9X A;  1DXS A;  1SXD A;  5L1M A;  2EAM A;  3KKA A;  1WWV A;  2DKX A;  1RG6 A;  2YTU A;  1LKY B;  2F3N A;  2DKZ A;  5JTI A;  2F8K A;  4PZN A;  4IS7 A;  1UQV A;  4RQN A;  3TAC B;  5J8Y C;  1OW5 A;  3TAD C;  2GLE A;  1PK1 A;  5F3X B;  2K60 A;  1SGG A;  1V85 A;  2EAO A;  2LMR A;  3K1R B;  1X66 A;  4PZO A;  1SV0 C;  4MHV A;  5KNI A;  1WWU A;  2D8C A;  5J8Y A;  1PK1 B;  3TAD A;  1Z1V A;  2K4P A;  1X40 A;  2KMD A;  1UCV A;  3BS5 A;  4NL9 C;  1B4F A;  1F0M A;  2E8M A;  2DL0 A;  2E8O A;  1SV0 A;  2Y9U A;  3HIL A;  1JI7 A;  2D3D A;  3BS5 B;  1COK A;  2LPE A;  1B0X A;  4NL9 A;  3BS7 A;  2KE7 A;  2KSO A;  2EAP A;  2E8P A;  2QAR A;  4RQM A;  2B6G A;  2F44 A;  4NJ8 A;  2QB0 A;  2EAN A;  2QKQ A;  2ES6 A;  2FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...