5JU5A

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tankyrase-1
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5ju5A00
4PZOA 2F3NA 5L1MA 1X9XA 2ESEA 1Z1VA 5JRTA 2DL0A 2F44A 3H8MA 1PK1B 1UQVA 1SV4A 4NL9A 3KKAC 1RG6A 2LMRA 2B6GA 3K1RB 4NJ8A 5JTIA 1LKYB 2EAOA 1B4FA 2FE9A 1OXJA 5KNIA 2Y9TA 4RQMA 2L5YA 3BS7A 2K4PA 2F8KA 5J8YA 1WWVA 2KG5A 1UCVA 2KE7A 1SV0C 1PK3A 3TADA 2QB1A 2K60A 1DXSA 2EAMA 2QB0B 3BQ7A 1PK1A 3BS5A 4MHVA 2LPEA 2D3DA 3IDWA 3TACB 1WWUA 2GLEA 1F0MA 1COKA 2QARB 2QKQA 5J8YC 2QB0A 1X66A 2EANA 5F3XB 1V38A 2E8PA 1SXEA 2D8CA 1V85A 1SGGA 3TADC 1KW4A 2DKZA 2QARA 2KSOB 2Y9UA 1JI7A 1SXDA 3SENA 1X40A 1SV0A 2ES6A 2DKXA 2E8MA 4NL9C 4PZNA 2JV3A 2KSOA 2YTUA 4RQNA 5JU5A 3BS5B 3SEIA 2E8NA 2E8OA 3KKAA 2KMDA 1B0XA 4IS7A 2EAPA 2KIVA 1OW5A 1LKYA 3HILA
chains in the Genus database with same CATH superfamily
5L1MA 3OJSA 5G5HA 4K4IA 4P0QA 5DLGA 4KLHA 3OJUA 1ZQGA 2LKYA 5KFMA 2PFNA 4I2HA 3KHGA 2F44A 1A6SA 2EDUA 3NVWA 1DK3A 2B6GA 4P2HA 1BPEA 1KL9A 2EAOA 3OTQA 4R8UA 1NKBA 1B4FA 3ED5A 1OXJA 5DQIA 2XC9A 1SWVA 5DDYA 4KLEA 3PSPA 1A77A 3GV5B 4UB3A 2VJ4A 3H8JA 3MGHA 2MU2A 1D8BA 2AHOB 3EYZA 8ICIA 2KG5A 3GV7B 4P4OA 2W9CA 2WB1F 2KE7A 2XY6A 2NRXA 4ELVA 1N62A 2XGQA 1HJPA 3SR6A 1ZQUA 4YR3A 2JGAA 4ECTA 1PK1A 3RJJA 3OPXA 5AKGA 4KN7A 1D9FA 3IDWA 5AI5A 4IRKA 2GLEA 5DBCA 2RLTA 1X66A 2P66A 1RYRA 3WKCA 3QU5A 5KFUA 2A3VA 4IR1A 5KG6A 4QJFB 1ZQTA 4X5VA 5ALVA 4M9NA 4BJQA 2Y9UA 1JI7A 2KJ9A 5CP2A 3QEBZ 1Z4OA 4F5PA 2RRDA 2ES6A 2ZXIA 4UB1A 1AROP 2YMLA 5KFCA 1RXVA 3SMVA 2W55A 2YB1A 1ZQOA 5DKWA 1U49A 1LKYA 3E2EA 2E3TA 5KFLA 2ZUBA 4G9BA 3GILA 1PVQA 4EX6A 4YN4A 1NKEA 5AK6A 1T94A 1N5XA 3MDCA 2Y1JA 3RJGA 2F77X 3PW2A 3N7PD 2F2AB 1S9FA 4HYKA 4ECRA 3K1ZA 3PSIA 5J0UA 5EWGA 5EWEA 1D8LA 5AIBA 3OGUA 2AH5A 2BGWA 4BXOA 3I76A 4NLZA 4TUPA 4DQRA 2Y9TA 3QUQA 4O3MA 5KFBA 2VJ5A 4I2DA 4EBCA 3BS7A 1BPXA 4U7CA 4C8LA 2BR0A 1HIWA 1S97A 4O3SA 3LDAA 3RB6A 3ISDA 3LWLA 1SZHA 5KFDA 5FP0A 4KITB 4PGYA 2PMZF 2QB0B 3IN5A 1S0OA 8ICVA 3SV4A 5CB1A 4DL5A 2JXJA 4KLJA 2H3FA 5J2HA 2D3DA 3F2CA 2MUTB 2KKPA 9ICVA 2ZG6A 3IP4B 2H3VA 3N4MB 2K4HA 3AMZA 3GV8B 1S5LU 4B9SA 4O5CA 5B66U 1ZRNA 4I2BA 5J2DA 5ALFA 3RB4A 5J2EA 3ISBA 5J2CA 5DB9A 2HHWA 3AQEA 1NK9A 7ICPA 2AGQA 3M9MB 4C4SA 1LVHA 3C1ZA 2E8OA 2NRWA 1B0XA 5BPCA 4C4TA 2XCPA 1J97A 3SQIA 4C8MA 2RHFA 4C8OA 4QNLA 1KSPA 2W9BA 3WK7A 3H0RB 2V9WA 5JRTA 2DBYA 4O5KA 3G6VA 2XIDA 5IIIA 4F72A 3TANA 4OO1J 3RH6A 2R18A 5KFNA 3IG5A 2DFLA 5CHGA 2W04A 2JHDA 4DFPA 5ALRA 4DOBA 4O0IA 3SYZA 4FS1A 4EX7A 2W9CB 2YMPA 2AQ4A 3PO4A 1FFVA 4YD2A 2Q0ZX 2WB1C 2IOHA 1QSLA 3NGDA 8ICXA 4Z6CA 4QZAA 2HOFA 1NK6A 4DF4A 2HHUA 1L8OA 4Y2SA 3F5EA 3L5KA 2J6SA 4C8KA 4TURA 2G5IB 2FI1A 2JH1A 4YFKA 5T14A 2ZJ5A 9ICPA 2ZJ8A 1C20A 1SKSA 2FMQA 4Y2YA 3AM9A 3B0YA 9ICXA 2V4RA 4FZMA 3QZ7A 2ZUCA 2W9BB 1CEZA 2PFOA 2KKVA 2PI4A 3TFRA 4XQ8A 4Q8EA 4F50A 1X9SA 1L3TA 5AM3A 3RTVA 1ZQQA 3V7KA 5J0PA 3CW2C 9ICMA 4QWCA 3T79A 1U47A 2DKZA 2ODGA 5KFIA 4LZDA 2LYHA 2J6TA 4Y2QA 1X40A 3GIKA 3H0LB 4RQ6A 3HPOA 3TAQA 2CPRA 3CRXA 1SZPA 1U4BA 4EYIB 4WJ3B 3RBDA 4B9LA 1ZQXA 4RQ7A 1JUDA 2LHTA 3MFIA 4FZLA 3FDSA 5AI6A 8ICOA 1K5OA 2K8BB 2KVSA 2KICA 1ZQSA 5KFKA 5L1KA 2NRVA 5EE1A 2WF8A 3H8SA 3RH5A 2HI0A 2D6FC 4ZOHC 1T4GA 3SAHA 4YP3A 1LKYB 5AK3A 1L7MA 3WK4A 5HMMA 3PY8A 3C23A 3ZDCA 2KV2A 3M8RA 2XO7A 1Z1BA 3PX4A 7ICIA 3IM1A 2NRTA 4O3RA 1TK8A 4DS4A 4KLTA 4RT3A 2NO5A 5KFRA 4J9KA 3V6HA 3BZKA 2G07A 1L8LA 4IQWA 4UARA 4KLOA 5J29A 2YY6A 3PV8A 3TKAA 4UASA 2K60A 4RPYA 1LV5A 1TFRA 1JALA 1GO3F 5C5JA 5KFQA 4JV2A 5AKZA 4Q44A 5TISU 4F5RA 4AYBF 2BKEA 3TFSA 1Q46A 2QKQA 2VIXA 3UQ2A 3N7RC 1FFUA 2EH9A 4P0PB 4F93B 4NLGA 3U26A 2JZBA 5KT6A 2VA3A 8ICNA 3GQCA 3OHAA 1B22A 1ECWA 4F5OA 1UA0A 5DDMA 4HAIA 2QLTA 3GDXA 5C0YA 1DRGA 4UBCA 2ZIVA 4ELUA 5D46A 2ZIWB 4PL2A 1N60A 2G06A 3RJHA 5HP4A 5J0YA 3ZD8A 2W8KA 4C7ZA 8ICJA 4PZOA 4J9LA 2LYAA 4I28A 2KHVA 2BHNA 1VLBA 2DL0A 4MFFA 1ZD5A 5KG3A 4B9MA 1X6JA 3NUQA 2FLPA 3T5JA 4YR0A 2LYBA 1ZRMA 4FE3A 2ZIUA 1NJXA 3ZDDA 3H0MB 3T3FA 3PX6A 4RUAA 3SAFA 3G6YA 5AI9A 5DB8A 1WCLA 2FPLA 3WK8A 4Y2UA 4RQ0A 1SL0A 5KFPA 2A1AA 4RQMA 2ASJA 3SZ2A 5KFVA 4DQSA 4BWMA 4ECUA 4KLDA 4ED8A 5D49A 1ZETA 2KN7A 5ALLA 3PSTA 4G3IA 5AI4A 5KG4A 2WF5A 2W9MA 4YCXA 4Z6FA 5KFJA 1WWUA 1TK0A 4GC6A 5A0LA 1NK8A 4KLQA 5KT5A 1F0MA 7ICLA 5K4LA 2I6XA 2XY7A 3BZCA 3FYHA 3M6KA 3F2BA 1JN3A 3MR2A 4F8RA 3CYMA 1V85A 2B21A 1QQ6A 3RAQA 1XSLA 2HCFA 4NXZA 3WKDA 1TV9A 2BDUA 2DKXA 2W54A 5J0XA 2KD1A 5DGAA 3QEAZ 3QYPA 4JB3A 4YG2A 4J9RA 1IG6A 3WK6A 3SI8A 1Q3VA 4P4PA 4BDPA 3I1YA 2RDJA 2BQ3A 1Z00A 5IIKA 1FO4A 2WFAA 4UB6U 1VJ5A 2YMMA 3I28A 2A1JB 3N7SC 2UVWA 2HVHA 3M6ZA 4IRCA 2LMRA 2JEJA 1MN8A 4IR9A 3VC8A 2FE9A 4PHEA 2PI5A 2KFZA 3HKZF 4Y2XA 3LYSA 4J03A 3NRWA 4KLMA 2KJ8A 3V7LA 3QZ8A 1KBUA 2ZIXB 3PW5A 4GC7A 4CDGA 3RF9A 4RUCA 3EUB2 2ZIXA 5CA7A 7ICFA 8ICEA 4ECZA 1CUKA 2ZXHA 1C7YA 1DGJA 2KZZA 2P35A 3MDAA 4C0ZA 1JMSA 1TAQA 4PH5A 4MFAA 4AP9A 4TQSA 8ICWA 1L7NA 1A76A 3BS5A 5G5GA 9ICWA 5KL1B 5KTQA 3UQ0A 5AICA 2VKQA 3RJKA 4MFCA 4DQIA 2ATLA 4E0DA 1O08A 1U45A 4R65A 4RQ3A 4DL3A 3LWMA 2FPMA 5HHHA 3Q8RB 4O3PA 1N61A 3S6JA 2HW3A 4M9LA 1BPZA 1XO0A 1QH9A 5KT4A 8ICUA 2CN1A 1SV0A 3RRHA 2E8MA 1ZQMA 2JMGA 2PMZC 4EZ6A 2KMDA 3WU2U 2KZ3A 5EE9A 4YMOA 1XWLA 3IRUA 7ICUA 2K4EA 2YQEA 4QZ8A 4JV1A 4QIWF 5KFEA 3OSNA 3D2NA 3MFHA 1URJA 4O3QA 3PR5B 2JRZA 8ICSA 3QUBA 5E79U 2C22A 7ICNA 4IQUA 4IL6U 3JPNA 9ICBA 5GTIU 1BPBA 1X2IA 3JPPA 5AIAA 2Q4TA 2HSZA 9ICGA 8ICAA 2JZBB 3WKEA 4USAA 4R66A 3MR6A 3KHLA 2W43A 4IQTA 1RG6A 3SAGA 3K1RB 4DS5A 2BPCA 2DPIA 3RJFA 5AM4A 4B9UA 2Y0SF 5KNIA 4UB4A 1BNPA 1PZNA 3ETLA 3RR7A 4GXIA 1RPLA 9ICAA 4I2EA 2FPKA 1KQQA 3O0FA 5ALNA 5AKLA 5J8YA 4J9OA 4NV0A 5KAIU 2PFPA 4K4HA 3C1YA 5KFHA 2OEHA 2NO4A 3TADA 3MR5A 3SD7A 4RQ2A 5H2FU 3V6KA 9ICTA 3GZFA 1UT5A 5KFZA 4EELA 3T5KA 3BQ7A 2I9GA 2HBJA 4B9VA 2GH1A 4UW9A 7ICTA 7ICEA 4US8A 1JXEA 2W11A 3KZXA 2G08A 2HHVA 3QU2A 1ZQWA 3EWAA 3C2MA 4QWAA 2HHTA 3GIMA 2KP7A 2K89A 2D8CA 4BX9C 3C29A 5KFXA 1XS9D 4CF3A 1NK5A 1PUZA 4OJOA 9ICKA 4F92B 4RU9A 1NK7A 5IIOA 3EPGA 4CE6A 1DK2A 3DDHA 4YD1A 4LJXA 1TK5A 5D4BA 4J9PA 2HDOA 1ZQ1C 3IG8A 3N97B 2BPGA 4RNMA 1ZQAA 2E1EA 4Q43A 1J2MA 4MEXA 4M9JA 1N5WA 5AK5A 1S76D 3B0XA 3EW9A 2PFQA 4PHDA 7ICSA 2WAQC 2P6RA 4J9NA 4DOCA 4NL9A 2Z7JA 2YMQA 3KD3A 2DUYA 2F1JA 4FBUA 1NJWA 5AM0A 2JEIA 2BCQA 5KFWA 1AQ6A 5CRXA 2KZMA 2FJ6A 4QZBA 4ACOA 5KFOA 2DQNB 5ALEA 2L5YA 3OHBA 2W3SA 5L1JA 4ZH4A 3KZIU 2IBKA 1J2NA 2WHEA 1TVAA 2XVTA 1UPHA 5JUMA 7ICQA 4F2SA 1HUOA 2ASLA 4EZ9A 2KFNA 3UXPA 4KTQA 1IXRA 2LBOA 4IQVA 4PJ0U 2H5XA 1X42A 2IA6A 4US9A 1SXEA 4C4RA 5AI8A 2MAXA 4KLLA 1MQ2A 1LB2B 4DFMA 2H3ZA 2ISPA 4DFDA 3AUOA 1L7OA 4NM1A 5JU5A 1ZQCA 5CEHA 2GO7A 4DSJA 1FIQA 1ZQNA 2GWSA 5HNKA 5J0QA 3C2LA 2V4QA 3MGVA 1ZYQA 1ZQDA 1M6YA 2P6UA 3PO5A 1OW5A 5KFGA 3PMNA 4CF5A 3E0FA 4M2YA 4M04A 3BQ0A 2OWOA 2HOQA 4CGZA 2R8GA 1Z3EB 7ICRA 1RXWA 1XU4A 4ED1A 3H8MA 1UT8A 2F8LA 8ICGA 3KKAC 2KNJA 3WKBA 2YN4A 1NK4A 1MSWD 3NVZA 3A0HU 1BGXT 3QX7A 2EZYA 2EZZA 5IIMA 1ZQFA 4PPXA 2WF6A 4M9GA 4RQ4A 5F9LA 5ALGA 5J2KA 5ALKA 2E5SA 3QUCA 1Z19A 2IHMA 3HX0A 4NY8A 1RZTA 2GOLA 1SV0C 1TAUA 5BOLA 3FM9A 4ICAA 3R9KA 4ECWA 1YT3A 3ZD9A 3PW7A 2KHQA 2VA2A 4BGDA 8ICHA 3GU3A 1U9LA 4NM2A 7ICJA 1S0NA 2BQUA 3M7DA 2DPJA 2QARB 2QB0A 4IC9A 1BPYA 4EYHB 2K8AA 1COOA 4DL2A 2I1QA 3HKZC 9ICLA 2YX8A 5EE0A 1QCKA 5DQHA 1RQNA 3GFKB 1KW4A 3WK5A 5KG2A 2KSOB 4JUZA 3H8WA 1NJZA 4JV0A 4CF4A 1QTMA 3JPQA 2W3RA 4NLBA 3RH4A 1OUQA 4RT2A 2WF7A 2NYVA 4B6JA 3KHHA 9ICJA 2HMXA 1Q3UA 3HILA 2B0CA 2PKEA 2JH7A 4F4XA 3H4BA 2RP5A 4M6WB 1JXLA 5L1IA 3M9NB 2KIWA 3B9JA 4M6WA 3UMGA 3V6JA 2RDIA 3M9OB 3THVA 2F1HA 2NRZA 1T3NA 3JPTA 5JTIA 9ICSA 5ALTA 4DSIA 5EWFA 3PX0A 4JK1A 5GTHU 1X9WA 3RRGA 4OD0A 2OCEA 2J6UA 8ICBA 8ICZA 4ELTA 9ICHA 4YMNA 2PXIA 2F8KA 3SV3A 1CRXA 2ISOA 4OJ5A 3NVVA 4DSEA 1MC8A 4QZDA 3FAHA 1N63A 3RJEA 4LZGA 1SKWA 4F91B 4ECVA 1K1SA 1IV8A 9ICQA 2UVUA 4RZRA 2BCRA 2W03A 2MUTA 4FZNA 2LPEA 4KX3A 5ALUA 2C2EA 3CNHA 2R8HA 5ALXA 1H38A 2FDRA 2ZJAA 4F5NA 5TZVA 2R8JA 4DCCA 3V72A 4JWNA 5CR0A 3MBYA 3PW4A 3BQTA 1P7DA 5CWRA 1PVRA 2A19A 5AKXA 3QE9Y 3MR3A 1SL1A 5J0OA 4KLFA 5KFTA 4P0QB 3KKAA 4RQ1A 4ECXA 3RB0A 3UMBA 2DF4B 2KIVA 5DGBA 2IHNA 4R8UB 3TAPA 4QWBA 4I2GA 4C7YA 1BVSA 4PGXA 1RQLA 5ALSA 2AQ0A 8ICPA 4M47A 2EZXA 5ALMA 5HR6A 4UAYA 3PNCA 2OYYA 2G0AA 3CP8A 2KK0A 4BXOB 3RR8A 1PK1B 3LVVA 1UQVA 1S77D 1F44A 4RPXA 4OJPA 4NJ8A 3LVWA 4BUGA 2WAQF 3KTQA 4JWMA 5DLFA 2BCSA 5ALHA 1ZQYA 3BQ1A 2OHFA 4ED6A 9ICRA 1L3UA 4NWIA 2IOFK 3AL0B 3E58A 3ALRA 4F4KA 2G5HB 5ALZA 4FS2A 4KLIA 3UPQA 3AU6A 4DLGA 1ZJMA 4CNQA 5DBAA 5KG1A 9ICFA 2OH2A 4UBBA 2IMWP 7ICHA 2K8CB 2BQRA 1ZQEA 2FMPA 2ZUDA 5DG8A 4DSLA 3AQFA 4DWIA 5KFYA 2CXYA 3D6JA 5AKYA 1L3VA 2XI9A 3NS1A 4O9MA 2W8LA 1L5UA 2QARA 7ICGA 2LM1A 1WG8A 2AU0A 1X9MA 3SENA 4F2RA 1KDHA 4QZ9A 2C28A 2E8NA 1KFSA 3DEEA 4IS7A 3UM9A 2EAPA 4DEZA 1BNOA 2BZFA 2H3QA 2ESEA 1JX4A 4KX5A 2R8IA 4NLCA 1Z1VA 4YXJA 1PVPA 1N2XA 2C2RA 4QZCA 5KFSA 5AI0A 9ICEA 3H7IA 5KG5A 5ALYA 1ED1A 1SB3C 3J81j 3MABA 1SV4A 1TAMA 5KFFA 1XC9A 1V97A 4EEYA 2KOBA 5AM1A 4KLUA 4UB2A 3C21A 2BCUA 2UVRA 5J2FA 5IINA 5J0SA 2RQ5A 2VA8A 5DBBA 3QU9A 1S8OA 1ZD4A 4MF2A 3K4GA 4I2FA 1SKRA 1WWVA 1JRPA 4M0AA 2NV3A 2BDPA 2HHQA 3JPSA 3PW0A 1PK3A 1KFTA 1ZQKA 4CRXA 2AGPA 3M8SA 4R63A 4EEKA 4UATA 4QZHA 2EAMA 4NLNA 1S0MA 5DB6A 4Y2RA 3IV6A 2HVIA 4Q45A 2XY5A 1NK0A 1JROA 5AK4A 3H4DA 2AGOA 3HW8A 4ECSA 5DG9A 4Y2VA 2OM6A 2WF9A 4I2IA 2HOIA 2DGZA 3Q8QB 1ZQLA 9ICCA 3QU7A 1WYGA 4I27A 2VANA 3TI0A 1SXDA 5J2GA 3N28A 2YTUA 2KSOA 4RQNA 4UB8U 4DOAA 9ICOA 4I2JA 2FLLA 5KT7A 4KMUA 2MRLA 1Z4NA 4BWJA 4KLSA 4YVZA 1VDVA 2FMSA 1X9XA 1KRPA 1KLNA 4MF8A 1XNSA 1K1QA 3ISCA 3PR4A 8ICMA 2H3IA 3Q8KA 5AKIA 3H40A 3EZ5A 5ALDA 3PZPA 2BPFA 4QZIA 4GXKA 4J9SA 5KG0A 4JMUA 1T8EA 2ZTDA 3ORYA 4EBDA 1SL2A 4DSFA 1HUZA 3NTUA 4QWDA 4O5EA 5L9XA 1YZ7A 2MSNA 1XSPA 8ICYA 9ICUA 4I2CA 4FFDA 4YMMA 1ZQJA 5AKEA 3LK9A 1NOMA 4UAUA 2Y1IA 4DQQA 5J2IA 1ZQBA 5AM2A 2JR5A 3Q8PB 5HMLA 4F5QA 1NKCA 4UAWA 4I29A 4QW9A 3KOOA 4AYBC 2HBKA 4K4GA 4R64A 4RQ5A 4OCZA 1ZQVA 9ICIA 1DOQA 2W7OA 2HHXA 4TQRA 1QLNA 8ICQA 4EENA 1WCNA 1IIPA 4C8NA 1RDFA 8ICFA 3HWTA 4YQWA 2F76X 3ZDBA 4DLEA 5F3XB 5J0WA 5J2JA 2W9AA 3TADC 1SGGA 3AEVA 1T7PA 1QQ7A 4UB5A 1V9PA 1EXNA 4NL9C 3UXOA 4F3OA 3AN1A 2JEGA 5HHIA 4GLXA 3NASA 2ZTEA 5DQGA 5ALOA 4FO6A 4O3OA 1RYUA 2IOFA 8ICLA 2F3NA 2ZIUB 2K4IA 4KLGA 4ED0A 4DQPA 1ZQZA 2XICA 5KT3A 5ALIA 4F71A 5EOZA 1O03A 4KMOB 4OJLA 2Y0SC 2KEYA 3C2KA 3BQ2A 1ZXIA 1NJYA 5EE3A 2JEFA 3C28A 5AHXA 4Y2JA 5ALQA 1RM6C 4GIBA 1IM4A 1BPDA 4ED2A 1NZPA 3BDPA 2HBMA 2O6KA 4YR2A 1KTQA 3DV9A 2QB1A 3M1YA 3EPIA 1DXSA 4F4YA 2LI6A 3AU2A 4MHVA 5KAFU 5KT2A 5BOMA 1NNLA 2KJ5A 3TACB 2E1FA 1RYSA 4QZEA 1B43A 2AXTU 5J8YC 3F5AA 3ETRA 4UQGA 4Q8FA 1KEJA 3G6XA 3Q8MA 2DWQA 3ZDEA 4FBTA 3QU4A 2E8PA 3UXNA 4O3NA 2LM4A 5J2AA 5J2BA 1Y88A 4DL4A 5KG7A 4QZGA 2XCAA 3BS5B 4UAVA 4QZFA 4PHPA 4QWEA 1L6NA 1ZQPA 2F1IA 4ED7A 2HBLA 4PZNA 4Z6DA 3ONNA 4DF8A 5J0TA 7ICMA 2ZIVB 3A0BU 1KFDA 1D9DA 1T3QA 4PGQA 3D2SA 3ZI4A 4P4MA 4Z6EA 3VCBA 4DFKA 5ALPA 4DL7A 2FLNA 4ECYA 1CI4A 3HRDD 3K75D 8ICKA 3IHQB 5ALJA 3JPRA 4DL6A 1Z00B 3RB3A 2MA1A 2ASDA 4QIWC 4MEYA 5IILA 3OSPA 5KFAA 3UMCA 2HHSA 1MQ3A 3KHRA 4C80A 5CJ7A 2M9NA 3RAXA 1UCVA 1ZD3A 4NLKA 3PMLA 1ZJNA 1DGSA 4DO9A 2ALZA 1ZQRA 1S0VA 3F2DA 4PL1A 2WTFA 2KTQA 1XSNA 1UHUA 3KBBA 3L4PA 3HP6A 1COKA 3TQ1A 4RPZA 5IIJA 5KL8B 2C2DA 4PHAA 4RNNA 4YXMA 3L3FX 2A1JA 1V38A 2M0NA 1F5SA 3RBEA 3D2QA 1FEZA 4ECQA 1NI3A 4DFJA 1L3SA 8ICTA 3T5LA 7ICVA 3NVYA 5AM5A 3SEIA 1JIHA 2ZTCA 1NZBA 3Q8SB 3PVXA 3QNMA 4J9MA 5F9NA 3WK9A 1Q8KA 1ZOLA 3C5GA 4P0PA 3JPOA 2OXOA 4DSKA 4OJ6A 1XO1A 4RNOA 4F4WA 1QQ5A 2KVCA 1QSYA 4I2AA 5ALWA 1HEKA 4TUSA 5L1LA 1N56A 3ZDAA 1TE2A 4M9HA 3QXGA 3TARA 2AJQA 3V7JA 1A0PA 1YZ6A 4J9QA 1QSSA 4B9NA 5DG7A 2G09A 3WKAA 2CRXA 3F53A 3C5FA 4B9TA 7ICOA 5HR7A 3ICXA 2UVVA 1KN5A 4KN4A 3T5HA 4IRDA 4XA5A 4TUQA 2K4PA 1N48A 3PSFA 3MGIA 3MC1A 1D8YA 1S10A 8ICCA 2BCVA 1X6IA 4F4ZA 5J0RA 7ICKA 1KKXA 1ZD2P 4LVSA 2ZIWA 5AKHA 1L7PA 4GXJA 1SIJA 3FC4A 2YB4A 2R8KA 3HJEA 4CCHA 3QUTA 1SWWA 3NRZA 5AKKA 3GIIA 2N1RA 1MA7A 1TKDA 4XRHA 5DB7A 2EQYA 1WUDA 2EANA 4UAZA 2XGPA 1UA1A 4QW8A 9ICNA 4EBEA 4Y2TA 8ICRA 1ZQIA 3Q8LA 5B5EU 1ZQHA 4ED3A 4U6PA 2W7PA 2JV3A 3BJYA 3RFAA 4A8EA 3RJIA 2I5HA 3HT3A 4GFJA 3KFUF 4RQ8A 4XUSA 3GIJA 5AKJA 4Y2PA 1U48A
chains in the Genus database with same CATH topology
4PZOA 2F3NA 5L1MA 1X9XA 2ESEA 1Z1VA 5JRTA 2DL0A 2F44A 3H8MA 1PK1B 1UQVA 1SV4A 4NL9A 3KKAC 1RG6A 2LMRA 2B6GA 3K1RB 4NJ8A 5JTIA 1LKYB 2EAOA 1B4FA 2FE9A 1OXJA 5KNIA 2Y9TA 4RQMA 2L5YA 3BS7A 2K4PA 2F8KA 5J8YA 1WWVA 2KG5A 1UCVA 2KE7A 1SV0C 1PK3A 3TADA 2QB1A 2K60A 1DXSA 2EAMA 2QB0B 3BQ7A 1PK1A 3BS5A 4MHVA 2LPEA 2D3DA 3IDWA 3TACB 1WWUA 2GLEA 1F0MA 1COKA 2QARB 2QKQA 5J8YC 2QB0A 1X66A 2EANA 5F3XB 1V38A 2E8PA 1SXEA 2D8CA 1V85A 1SGGA 3TADC 1KW4A 2DKZA 2QARA 2KSOB 2Y9UA 1JI7A 1SXDA 3SENA 1X40A 1SV0A 2ES6A 2DKXA 2E8MA 4NL9C 4PZNA 2JV3A 2KSOA 2YTUA 4RQNA 5JU5A 3BS5B 3SEIA 2E8NA 2E8OA 3KKAA 2KMDA 1B0XA 4IS7A 2EAPA 2KIVA 1OW5A 1LKYA 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PZO A;  2F3N A;  5L1M A;  1X9X A;  2ESE A;  1Z1V A;  5JRT A;  2DL0 A;  2F44 A;  3H8M A;  1PK1 B;  1UQV A;  1SV4 A;  4NL9 A;  3KKA C;  1RG6 A;  2LMR A;  2B6G A;  3K1R B;  4NJ8 A;  5JTI A;  1LKY B;  2EAO A;  1B4F A;  2FE9 A;  1OXJ A;  5KNI A;  2Y9T A;  4RQM A;  2L5Y A;  3BS7 A;  2K4P A;  2F8K A;  5J8Y A;  1WWV A;  2KG5 A;  1UCV A;  2KE7 A;  1SV0 C;  1PK3 A;  3TAD A;  2QB1 A;  2K60 A;  1DXS A;  2EAM A;  2QB0 B;  3BQ7 A;  1PK1 A;  3BS5 A;  4MHV A;  2LPE A;  2D3D A;  3IDW A;  3TAC B;  1WWU A;  2GLE A;  1F0M A;  1COK A;  2QAR B;  2QKQ A;  5J8Y C;  2QB0 A;  1X66 A;  2EAN A;  5F3X B;  1V38 A;  2E8P A;  1SXE A;  2D8C A;  1V85 A;  1SGG A;  3TAD C;  1KW4 A;  2DKZ A;  2QAR A;  2KSO B;  2Y9U A;  1JI7 A;  1SXD A;  3SEN A;  1X40 A;  1SV0 A;  2ES6 A;  2DKX A;  2E8M A;  4NL9 C;  4PZN A;  2JV3 A;  2KSO A;  2YTU A;  4RQN A;  5JU5 A;  3BS5 B;  3SEI A;  2E8N A;  2E8O A;  3KKA A;  2KMD A;  1B0X A;  4IS7 A;  2EAP A;  2KIV A;  1OW5 A;  1LKY A;  3HIL A; 
#chains in the Genus database with same CATH topology
 5L1M A;  3OJS A;  5G5H A;  4K4I A;  4P0Q A;  5DLG A;  4KLH A;  3OJU A;  1ZQG A;  2LKY A;  5KFM A;  2PFN A;  4I2H A;  3KHG A;  2F44 A;  1A6S A;  2EDU A;  3NVW A;  1DK3 A;  2B6G A;  4P2H A;  1BPE A;  1KL9 A;  2EAO A;  3OTQ A;  4R8U A;  1NKB A;  1B4F A;  3ED5 A;  1OXJ A;  5DQI A;  2XC9 A;  1SWV A;  5DDY A;  4KLE A;  3PSP A;  1A77 A;  3GV5 B;  4UB3 A;  2VJ4 A;  3H8J A;  3MGH A;  2MU2 A;  1D8B A;  2AHO B;  3EYZ A;  8ICI A;  2KG5 A;  3GV7 B;  4P4O A;  2W9C A;  2WB1 F;  2KE7 A;  2XY6 A;  2NRX A;  4ELV A;  1N62 A;  2XGQ A;  1HJP A;  3SR6 A;  1ZQU A;  4YR3 A;  2JGA A;  4ECT A;  1PK1 A;  3RJJ A;  3OPX A;  5AKG A;  4KN7 A;  1D9F A;  3IDW A;  5AI5 A;  4IRK A;  2GLE A;  5DBC A;  2RLT A;  1X66 A;  2P66 A;  1RYR A;  3WKC A;  3QU5 A;  5KFU A;  2A3V A;  4IR1 A;  5KG6 A;  4QJF B;  1ZQT A;  4X5V A;  5ALV A;  4M9N A;  4BJQ A;  2Y9U A;  1JI7 A;  2KJ9 A;  5CP2 A;  3QEB Z;  1Z4O A;  4F5P A;  2RRD A;  2ES6 A;  2ZXI A;  4UB1 A;  1ARO P;  2YML A;  5KFC A;  1RXV A;  3SMV A;  2W55 A;  2YB1 A;  1ZQO A;  5DKW A;  1U49 A;  1LKY A;  3E2E A;  2E3T A;  5KFL A;  2ZUB A;  4G9B A;  3GIL A;  1PVQ A;  4EX6 A;  4YN4 A;  1NKE A;  5AK6 A;  1T94 A;  1N5X A;  3MDC A;  2Y1J A;  3RJG A;  2F77 X;  3PW2 A;  3N7P D;  2F2A B;  1S9F A;  4HYK A;  4ECR A;  3K1Z A;  3PSI A;  5J0U A;  5EWG A;  5EWE A;  1D8L A;  5AIB A;  3OGU A;  2AH5 A;  2BGW A;  4BXO A;  3I76 A;  4NLZ A;  4TUP A;  4DQR A;  2Y9T A;  3QUQ A;  4O3M A;  5KFB A;  2VJ5 A;  4I2D A;  4EBC A;  3BS7 A;  1BPX A;  4U7C A;  4C8L A;  2BR0 A;  1HIW A;  1S97 A;  4O3S A;  3LDA A;  3RB6 A;  3ISD A;  3LWL A;  1SZH A;  5KFD A;  5FP0 A;  4KIT B;  4PGY A;  2PMZ F;  2QB0 B;  3IN5 A;  1S0O A;  8ICV A;  3SV4 A;  5CB1 A;  4DL5 A;  2JXJ A;  4KLJ A;  2H3F A;  5J2H A;  2D3D A;  3F2C A;  2MUT B;  2KKP A;  9ICV A;  2ZG6 A;  3IP4 B;  2H3V A;  3N4M B;  2K4H A;  3AMZ A;  3GV8 B;  1S5L U;  4B9S A;  4O5C A;  5B66 U;  1ZRN A;  4I2B A;  5J2D A;  5ALF A;  3RB4 A;  5J2E A;  3ISB A;  5J2C A;  5DB9 A;  2HHW A;  3AQE A;  1NK9 A;  7ICP A;  2AGQ A;  3M9M B;  4C4S A;  1LVH A;  3C1Z A;  2E8O A;  2NRW A;  1B0X A;  5BPC A;  4C4T A;  2XCP A;  1J97 A;  3SQI A;  4C8M A;  2RHF A;  4C8O A;  4QNL A;  1KSP A;  2W9B A;  3WK7 A;  3H0R B;  2V9W A;  5JRT A;  2DBY A;  4O5K A;  3G6V A;  2XID A;  5III A;  4F72 A;  3TAN A;  4OO1 J;  3RH6 A;  2R18 A;  5KFN A;  3IG5 A;  2DFL A;  5CHG A;  2W04 A;  2JHD A;  4DFP A;  5ALR A;  4DOB A;  4O0I A;  3SYZ A;  4FS1 A;  4EX7 A;  2W9C B;  2YMP A;  2AQ4 A;  3PO4 A;  1FFV A;  4YD2 A;  2Q0Z X;  2WB1 C;  2IOH A;  1QSL A;  3NGD A;  8ICX A;  4Z6C A;  4QZA A;  2HOF A;  1NK6 A;  4DF4 A;  2HHU A;  1L8O A;  4Y2S A;  3F5E A;  3L5K A;  2J6S A;  4C8K A;  4TUR A;  2G5I B;  2FI1 A;  2JH1 A;  4YFK A;  5T14 A;  2ZJ5 A;  9ICP A;  2ZJ8 A;  1C20 A;  1SKS A;  2FMQ A;  4Y2Y A;  3AM9 A;  3B0Y A;  9ICX A;  2V4R A;  4FZM A;  3QZ7 A;  2ZUC A;  2W9B B;  1CEZ A;  2PFO A;  2KKV A;  2PI4 A;  3TFR A;  4XQ8 A;  4Q8E A;  4F50 A;  1X9S A;  1L3T A;  5AM3 A;  3RTV A;  1ZQQ A;  3V7K A;  5J0P A;  3CW2 C;  9ICM A;  4QWC A;  3T79 A;  1U47 A;  2DKZ A;  2ODG A;  5KFI A;  4LZD A;  2LYH A;  2J6T A;  4Y2Q A;  1X40 A;  3GIK A;  3H0L B;  4RQ6 A;  3HPO A;  3TAQ A;  2CPR A;  3CRX A;  1SZP A;  1U4B A;  4EYI B;  4WJ3 B;  3RBD A;  4B9L A;  1ZQX A;  4RQ7 A;  1JUD A;  2LHT A;  3MFI A;  4FZL A;  3FDS A;  5AI6 A;  8ICO A;  1K5O A;  2K8B B;  2KVS A;  2KIC A;  1ZQS A;  5KFK A;  5L1K A;  2NRV A;  5EE1 A;  2WF8 A;  3H8S A;  3RH5 A;  2HI0 A;  2D6F C;  4ZOH C;  1T4G A;  3SAH A;  4YP3 A;  1LKY B;  5AK3 A;  1L7M A;  3WK4 A;  5HMM A;  3PY8 A;  3C23 A;  3ZDC A;  2KV2 A;  3M8R A;  2XO7 A;  1Z1B A;  3PX4 A;  7ICI A;  3IM1 A;  2NRT A;  4O3R A;  1TK8 A;  4DS4 A;  4KLT A;  4RT3 A;  2NO5 A;  5KFR A;  4J9K A;  3V6H A;  3BZK A;  2G07 A;  1L8L A;  4IQW A;  4UAR A;  4KLO A;  5J29 A;  2YY6 A;  3PV8 A;  3TKA A;  4UAS A;  2K60 A;  4RPY A;  1LV5 A;  1TFR A;  1JAL A;  1GO3 F;  5C5J A;  5KFQ A;  4JV2 A;  5AKZ A;  4Q44 A;  5TIS U;  4F5R A;  4AYB F;  2BKE A;  3TFS A;  1Q46 A;  2QKQ A;  2VIX A;  3UQ2 A;  3N7R C;  1FFU A;  2EH9 A;  4P0P B;  4F93 B;  4NLG A;  3U26 A;  2JZB A;  5KT6 A;  2VA3 A;  8ICN A;  3GQC A;  3OHA A;  1B22 A;  1ECW A;  4F5O A;  1UA0 A;  5DDM A;  4HAI A;  2QLT A;  3GDX A;  5C0Y A;  1DRG A;  4UBC A;  2ZIV A;  4ELU A;  5D46 A;  2ZIW B;  4PL2 A;  1N60 A;  2G06 A;  3RJH A;  5HP4 A;  5J0Y A;  3ZD8 A;  2W8K A;  4C7Z A;  8ICJ A;  4PZO A;  4J9L A;  2LYA A;  4I28 A;  2KHV A;  2BHN A;  1VLB A;  2DL0 A;  4MFF A;  1ZD5 A;  5KG3 A;  4B9M A;  1X6J A;  3NUQ A;  2FLP A;  3T5J A;  4YR0 A;  2LYB A;  1ZRM A;  4FE3 A;  2ZIU A;  1NJX A;  3ZDD A;  3H0M B;  3T3F A;  3PX6 A;  4RUA A;  3SAF A;  3G6Y A;  5AI9 A;  5DB8 A;  1WCL A;  2FPL A;  3WK8 A;  4Y2U A;  4RQ0 A;  1SL0 A;  5KFP A;  2A1A A;  4RQM A;  2ASJ A;  3SZ2 A;  5KFV A;  4DQS A;  4BWM A;  4ECU A;  4KLD A;  4ED8 A;  5D49 A;  1ZET A;  2KN7 A;  5ALL A;  3PST A;  4G3I A;  5AI4 A;  5KG4 A;  2WF5 A;  2W9M A;  4YCX A;  4Z6F A;  5KFJ A;  1WWU A;  1TK0 A;  4GC6 A;  5A0L A;  1NK8 A;  4KLQ A;  5KT5 A;  1F0M A;  7ICL A;  5K4L A;  2I6X A;  2XY7 A;  3BZC A;  3FYH A;  3M6K A;  3F2B A;  1JN3 A;  3MR2 A;  4F8R A;  3CYM A;  1V85 A;  2B21 A;  1QQ6 A;  3RAQ A;  1XSL A;  2HCF A;  4NXZ A;  3WKD A;  1TV9 A;  2BDU A;  2DKX A;  2W54 A;  5J0X A;  2KD1 A;  5DGA A;  3QEA Z;  3QYP A;  4JB3 A;  4YG2 A;  4J9R A;  1IG6 A;  3WK6 A;  3SI8 A;  1Q3V A;  4P4P A;  4BDP A;  3I1Y A;  2RDJ A;  2BQ3 A;  1Z00 A;  5IIK A;  1FO4 A;  2WFA A;  4UB6 U;  1VJ5 A;  2YMM A;  3I28 A;  2A1J B;  3N7S C;  2UVW A;  2HVH A;  3M6Z A;  4IRC A;  2LMR A;  2JEJ A;  1MN8 A;  4IR9 A;  3VC8 A;  2FE9 A;  4PHE A;  2PI5 A;  2KFZ A;  3HKZ F;  4Y2X A;  3LYS A;  4J03 A;  3NRW A;  4KLM A;  2KJ8 A;  3V7L A;  3QZ8 A;  1KBU A;  2ZIX B;  3PW5 A;  4GC7 A;  4CDG A;  3RF9 A;  4RUC A;  3EUB 2;  2ZIX A;  5CA7 A;  7ICF A;  8ICE A;  4ECZ A;  1CUK A;  2ZXH A;  1C7Y A;  1DGJ A;  2KZZ A;  2P35 A;  3MDA A;  4C0Z A;  1JMS A;  1TAQ A;  4PH5 A;  4MFA A;  4AP9 A;  4TQS A;  8ICW A;  1L7N A;  1A76 A;  3BS5 A;  5G5G A;  9ICW A;  5KL1 B;  5KTQ A;  3UQ0 A;  5AIC A;  2VKQ A;  3RJK A;  4MFC A;  4DQI A;  2ATL A;  4E0D A;  1O08 A;  1U45 A;  4R65 A;  4RQ3 A;  4DL3 A;  3LWM A;  2FPM A;  5HHH A;  3Q8R B;  4O3P A;  1N61 A;  3S6J A;  2HW3 A;  4M9L A;  1BPZ A;  1XO0 A;  1QH9 A;  5KT4 A;  8ICU A;  2CN1 A;  1SV0 A;  3RRH A;  2E8M A;  1ZQM A;  2JMG A;  2PMZ C;  4EZ6 A;  2KMD A;  3WU2 U;  2KZ3 A;  5EE9 A;  4YMO A;  1XWL A;  3IRU A;  7ICU A;  2K4E A;  2YQE A;  4QZ8 A;  4JV1 A;  4QIW F;  5KFE A;  3OSN A;  3D2N A;  3MFH A;  1URJ A;  4O3Q A;  3PR5 B;  2JRZ A;  8ICS A;  3QUB A;  5E79 U;  2C22 A;  7ICN A;  4IQU A;  4IL6 U;  3JPN A;  9ICB A;  5GTI U;  1BPB A;  1X2I A;  3JPP A;  5AIA A;  2Q4T A;  2HSZ A;  9ICG A;  8ICA A;  2JZB B;  3WKE A;  4USA A;  4R66 A;  3MR6 A;  3KHL A;  2W43 A;  4IQT A;  1RG6 A;  3SAG A;  3K1R B;  4DS5 A;  2BPC A;  2DPI A;  3RJF A;  5AM4 A;  4B9U A;  2Y0S F;  5KNI A;  4UB4 A;  1BNP A;  1PZN A;  3ETL A;  3RR7 A;  4GXI A;  1RPL A;  9ICA A;  4I2E A;  2FPK A;  1KQQ A;  3O0F A;  5ALN A;  5AKL A;  5J8Y A;  4J9O A;  4NV0 A;  5KAI U;  2PFP A;  4K4H A;  3C1Y A;  5KFH A;  2OEH A;  2NO4 A;  3TAD A;  3MR5 A;  3SD7 A;  4RQ2 A;  5H2F U;  3V6K A;  9ICT A;  3GZF A;  1UT5 A;  5KFZ A;  4EEL A;  3T5K A;  3BQ7 A;  2I9G A;  2HBJ A;  4B9V A;  2GH1 A;  4UW9 A;  7ICT A;  7ICE A;  4US8 A;  1JXE A;  2W11 A;  3KZX A;  2G08 A;  2HHV A;  3QU2 A;  1ZQW A;  3EWA A;  3C2M A;  4QWA A;  2HHT A;  3GIM A;  2KP7 A;  2K89 A;  2D8C A;  4BX9 C;  3C29 A;  5KFX A;  1XS9 D;  4CF3 A;  1NK5 A;  1PUZ A;  4OJO A;  9ICK A;  4F92 B;  4RU9 A;  1NK7 A;  5IIO A;  3EPG A;  4CE6 A;  1DK2 A;  3DDH A;  4YD1 A;  4LJX A;  1TK5 A;  5D4B A;  4J9P A;  2HDO A;  1ZQ1 C;  3IG8 A;  3N97 B;  2BPG A;  4RNM A;  1ZQA A;  2E1E A;  4Q43 A;  1J2M A;  4MEX A;  4M9J A;  1N5W A;  5AK5 A;  1S76 D;  3B0X A;  3EW9 A;  2PFQ A;  4PHD A;  7ICS A;  2WAQ C;  2P6R A;  4J9N A;  4DOC A;  4NL9 A;  2Z7J A;  2YMQ A;  3KD3 A;  2DUY A;  2F1J A;  4FBU A;  1NJW A;  5AM0 A;  2JEI A;  2BCQ A;  5KFW A;  1AQ6 A;  5CRX A;  2KZM A;  2FJ6 A;  4QZB A;  4ACO A;  5KFO A;  2DQN B;  5ALE A;  2L5Y A;  3OHB A;  2W3S A;  5L1J A;  4ZH4 A;  3KZI U;  2IBK A;  1J2N A;  2WHE A;  1TVA A;  2XVT A;  1UPH A;  5JUM A;  7ICQ A;  4F2S A;  1HUO A;  2ASL A;  4EZ9 A;  2KFN A;  3UXP A;  4KTQ A;  1IXR A;  2LBO A;  4IQV A;  4PJ0 U;  2H5X A;  1X42 A;  2IA6 A;  4US9 A;  1SXE A;  4C4R A;  5AI8 A;  2MAX A;  4KLL A;  1MQ2 A;  1LB2 B;  4DFM A;  2H3Z A;  2ISP A;  4DFD A;  3AUO A;  1L7O A;  4NM1 A;  5JU5 A;  1ZQC A;  5CEH A;  2GO7 A;  4DSJ A;  1FIQ A;  1ZQN A;  2GWS A;  5HNK A;  5J0Q A;  3C2L A;  2V4Q A;  3MGV A;  1ZYQ A;  1ZQD A;  1M6Y A;  2P6U A;  3PO5 A;  1OW5 A;  5KFG A;  3PMN A;  4CF5 A;  3E0F A;  4M2Y A;  4M04 A;  3BQ0 A;  2OWO A;  2HOQ A;  4CGZ A;  2R8G A;  1Z3E B;  7ICR A;  1RXW A;  1XU4 A;  4ED1 A;  3H8M A;  1UT8 A;  2F8L A;  8ICG A;  3KKA C;  2KNJ A;  3WKB A;  2YN4 A;  1NK4 A;  1MSW D;  3NVZ A;  3A0H U;  1BGX T;  3QX7 A;  2EZY A;  2EZZ A;  5IIM A;  1ZQF A;  4PPX A;  2WF6 A;  4M9G A;  4RQ4 A;  5F9L A;  5ALG A;  5J2K A;  5ALK A;  2E5S A;  3QUC A;  1Z19 A;  2IHM A;  3HX0 A;  4NY8 A;  1RZT A;  2GOL A;  1SV0 C;  1TAU A;  5BOL A;  3FM9 A;  4ICA A;  3R9K A;  4ECW A;  1YT3 A;  3ZD9 A;  3PW7 A;  2KHQ A;  2VA2 A;  4BGD A;  8ICH A;  3GU3 A;  1U9L A;  4NM2 A;  7ICJ A;  1S0N A;  2BQU A;  3M7D A;  2DPJ A;  2QAR B;  2QB0 A;  4IC9 A;  1BPY A;  4EYH B;  2K8A A;  1COO A;  4DL2 A;  2I1Q A;  3HKZ C;  9ICL A;  2YX8 A;  5EE0 A;  1QCK A;  5DQH A;  1RQN A;  3GFK B;  1KW4 A;  3WK5 A;  5KG2 A;  2KSO B;  4JUZ A;  3H8W A;  1NJZ A;  4JV0 A;  4CF4 A;  1QTM A;  3JPQ A;  2W3R A;  4NLB A;  3RH4 A;  1OUQ A;  4RT2 A;  2WF7 A;  2NYV A;  4B6J A;  3KHH A;  9ICJ A;  2HMX A;  1Q3U A;  3HIL A;  2B0C A;  2PKE A;  2JH7 A;  4F4X A;  3H4B A;  2RP5 A;  4M6W B;  1JXL A;  5L1I A;  3M9N B;  2KIW A;  3B9J A;  4M6W A;  3UMG A;  3V6J A;  2RDI A;  3M9O B;  3THV A;  2F1H A;  2NRZ A;  1T3N A;  3JPT A;  5JTI A;  9ICS A;  5ALT A;  4DSI A;  5EWF A;  3PX0 A;  4JK1 A;  5GTH U;  1X9W A;  3RRG A;  4OD0 A;  2OCE A;  2J6U A;  8ICB A;  8ICZ A;  4ELT A;  9ICH A;  4YMN A;  2PXI A;  2F8K A;  3SV3 A;  1CRX A;  2ISO A;  4OJ5 A;  3NVV A;  4DSE A;  1MC8 A;  4QZD A;  3FAH A;  1N63 A;  3RJE A;  4LZG A;  1SKW A;  4F91 B;  4ECV A;  1K1S A;  1IV8 A;  9ICQ A;  2UVU A;  4RZR A;  2BCR A;  2W03 A;  2MUT A;  4FZN A;  2LPE A;  4KX3 A;  5ALU A;  2C2E A;  3CNH A;  2R8H A;  5ALX A;  1H38 A;  2FDR A;  2ZJA A;  4F5N A;  5TZV A;  2R8J A;  4DCC A;  3V72 A;  4JWN A;  5CR0 A;  3MBY A;  3PW4 A;  3BQT A;  1P7D A;  5CWR A;  1PVR A;  2A19 A;  5AKX A;  3QE9 Y;  3MR3 A;  1SL1 A;  5J0O A;  4KLF A;  5KFT A;  4P0Q B;  3KKA A;  4RQ1 A;  4ECX A;  3RB0 A;  3UMB A;  2DF4 B;  2KIV A;  5DGB A;  2IHN A;  4R8U B;  3TAP A;  4QWB A;  4I2G A;  4C7Y A;  1BVS A;  4PGX A;  1RQL A;  5ALS A;  2AQ0 A;  8ICP A;  4M47 A;  2EZX A;  5ALM A;  5HR6 A;  4UAY A;  3PNC A;  2OYY A;  2G0A A;  3CP8 A;  2KK0 A;  4BXO B;  3RR8 A;  1PK1 B;  3LVV A;  1UQV A;  1S77 D;  1F44 A;  4RPX A;  4OJP A;  4NJ8 A;  3LVW A;  4BUG A;  2WAQ F;  3KTQ A;  4JWM A;  5DLF A;  2BCS A;  5ALH A;  1ZQY A;  3BQ1 A;  2OHF A;  4ED6 A;  9ICR A;  1L3U A;  4NWI A;  2IOF K;  3AL0 B;  3E58 A;  3ALR A;  4F4K A;  2G5H B;  5ALZ A;  4FS2 A;  4KLI A;  3UPQ A;  3AU6 A;  4DLG A;  1ZJM A;  4CNQ A;  5DBA A;  5KG1 A;  9ICF A;  2OH2 A;  4UBB A;  2IMW P;  7ICH A;  2K8C B;  2BQR A;  1ZQE A;  2FMP A;  2ZUD A;  5DG8 A;  4DSL A;  3AQF A;  4DWI A;  5KFY A;  2CXY A;  3D6J A;  5AKY A;  1L3V A;  2XI9 A;  3NS1 A;  4O9M A;  2W8L A;  1L5U A;  2QAR A;  7ICG A;  2LM1 A;  1WG8 A;  2AU0 A;  1X9M A;  3SEN A;  4F2R A;  1KDH A;  4QZ9 A;  2C28 A;  2E8N A;  1KFS A;  3DEE A;  4IS7 A;  3UM9 A;  2EAP A;  4DEZ A;  1BNO A;  2BZF A;  2H3Q A;  2ESE A;  1JX4 A;  4KX5 A;  2R8I A;  4NLC A;  1Z1V A;  4YXJ A;  1PVP A;  1N2X A;  2C2R A;  4QZC A;  5KFS A;  5AI0 A;  9ICE A;  3H7I A;  5KG5 A;  5ALY A;  1ED1 A;  1SB3 C;  3J81 j;  3MAB A;  1SV4 A;  1TAM A;  5KFF A;  1XC9 A;  1V97 A;  4EEY A;  2KOB A;  5AM1 A;  4KLU A;  4UB2 A;  3C21 A;  2BCU A;  2UVR A;  5J2F A;  5IIN A;  5J0S A;  2RQ5 A;  2VA8 A;  5DBB A;  3QU9 A;  1S8O A;  1ZD4 A;  4MF2 A;  3K4G A;  4I2F A;  1SKR A;  1WWV A;  1JRP A;  4M0A A;  2NV3 A;  2BDP A;  2HHQ A;  3JPS A;  3PW0 A;  1PK3 A;  1KFT A;  1ZQK A;  4CRX A;  2AGP A;  3M8S A;  4R63 A;  4EEK A;  4UAT A;  4QZH A;  2EAM A;  4NLN A;  1S0M A;  5DB6 A;  4Y2R A;  3IV6 A;  2HVI A;  4Q45 A;  2XY5 A;  1NK0 A;  1JRO A;  5AK4 A;  3H4D A;  2AGO A;  3HW8 A;  4ECS A;  5DG9 A;  4Y2V A;  2OM6 A;  2WF9 A;  4I2I A;  2HOI A;  2DGZ A;  3Q8Q B;  1ZQL A;  9ICC A;  3QU7 A;  1WYG A;  4I27 A;  2VAN A;  3TI0 A;  1SXD A;  5J2G A;  3N28 A;  2YTU A;  2KSO A;  4RQN A;  4UB8 U;  4DOA A;  9ICO A;  4I2J A;  2FLL A;  5KT7 A;  4KMU A;  2MRL A;  1Z4N A;  4BWJ A;  4KLS A;  4YVZ A;  1VDV A;  2FMS A;  1X9X A;  1KRP A;  1KLN A;  4MF8 A;  1XNS A;  1K1Q A;  3ISC A;  3PR4 A;  8ICM A;  2H3I A;  3Q8K A;  5AKI A;  3H40 A;  3EZ5 A;  5ALD A;  3PZP A;  2BPF A;  4QZI A;  4GXK A;  4J9S A;  5KG0 A;  4JMU A;  1T8E A;  2ZTD A;  3ORY A;  4EBD A;  1SL2 A;  4DSF A;  1HUZ A;  3NTU A;  4QWD A;  4O5E A;  5L9X A;  1YZ7 A;  2MSN A;  1XSP A;  8ICY A;  9ICU A;  4I2C A;  4FFD A;  4YMM A;  1ZQJ A;  5AKE A;  3LK9 A;  1NOM A;  4UAU A;  2Y1I A;  4DQQ A;  5J2I A;  1ZQB A;  5AM2 A;  2JR5 A;  3Q8P B;  5HML A;  4F5Q A;  1NKC A;  4UAW A;  4I29 A;  4QW9 A;  3KOO A;  4AYB C;  2HBK A;  4K4G A;  4R64 A;  4RQ5 A;  4OCZ A;  1ZQV A;  9ICI A;  1DOQ A;  2W7O A;  2HHX A;  4TQR A;  1QLN A;  8ICQ A;  4EEN A;  1WCN A;  1IIP A;  4C8N A;  1RDF A;  8ICF A;  3HWT A;  4YQW A;  2F76 X;  3ZDB A;  4DLE A;  5F3X B;  5J0W A;  5J2J A;  2W9A A;  3TAD C;  1SGG A;  3AEV A;  1T7P A;  1QQ7 A;  4UB5 A;  1V9P A;  1EXN A;  4NL9 C;  3UXO A;  4F3O A;  3AN1 A;  2JEG A;  5HHI A;  4GLX A;  3NAS A;  2ZTE A;  5DQG A;  5ALO A;  4FO6 A;  4O3O A;  1RYU A;  2IOF A;  8ICL A;  2F3N A;  2ZIU B;  2K4I A;  4KLG A;  4ED0 A;  4DQP A;  1ZQZ A;  2XIC A;  5KT3 A;  5ALI A;  4F71 A;  5EOZ A;  1O03 A;  4KMO B;  4OJL A;  2Y0S C;  2KEY A;  3C2K A;  3BQ2 A;  1ZXI A;  1NJY A;  5EE3 A;  2JEF A;  3C28 A;  5AHX A;  4Y2J A;  5ALQ A;  1RM6 C;  4GIB A;  1IM4 A;  1BPD A;  4ED2 A;  1NZP A;  3BDP A;  2HBM A;  2O6K A;  4YR2 A;  1KTQ A;  3DV9 A;  2QB1 A;  3M1Y A;  3EPI A;  1DXS A;  4F4Y A;  2LI6 A;  3AU2 A;  4MHV A;  5KAF U;  5KT2 A;  5BOM A;  1NNL A;  2KJ5 A;  3TAC B;  2E1F A;  1RYS A;  4QZE A;  1B43 A;  2AXT U;  5J8Y C;  3F5A A;  3ETR A;  4UQG A;  4Q8F A;  1KEJ A;  3G6X A;  3Q8M A;  2DWQ A;  3ZDE A;  4FBT A;  3QU4 A;  2E8P A;  3UXN A;  4O3N A;  2LM4 A;  5J2A A;  5J2B A;  1Y88 A;  4DL4 A;  5KG7 A;  4QZG A;  2XCA A;  3BS5 B;  4UAV A;  4QZF A;  4PHP A;  4QWE A;  1L6N A;  1ZQP A;  2F1I A;  4ED7 A;  2HBL A;  4PZN A;  4Z6D A;  3ONN A;  4DF8 A;  5J0T A;  7ICM A;  2ZIV B;  3A0B U;  1KFD A;  1D9D A;  1T3Q A;  4PGQ A;  3D2S A;  3ZI4 A;  4P4M A;  4Z6E A;  3VCB A;  4DFK A;  5ALP A;  4DL7 A;  2FLN A;  4ECY A;  1CI4 A;  3HRD D;  3K75 D;  8ICK A;  3IHQ B;  5ALJ A;  3JPR A;  4DL6 A;  1Z00 B;  3RB3 A;  2MA1 A;  2ASD A;  4QIW C;  4MEY A;  5IIL A;  3OSP A;  5KFA A;  3UMC A;  2HHS A;  1MQ3 A;  3KHR A;  4C80 A;  5CJ7 A;  2M9N A;  3RAX A;  1UCV A;  1ZD3 A;  4NLK A;  3PML A;  1ZJN A;  1DGS A;  4DO9 A;  2ALZ A;  1ZQR A;  1S0V A;  3F2D A;  4PL1 A;  2WTF A;  2KTQ A;  1XSN A;  1UHU A;  3KBB A;  3L4P A;  3HP6 A;  1COK A;  3TQ1 A;  4RPZ A;  5IIJ A;  5KL8 B;  2C2D A;  4PHA A;  4RNN A;  4YXM A;  3L3F X;  2A1J A;  1V38 A;  2M0N A;  1F5S A;  3RBE A;  3D2Q A;  1FEZ A;  4ECQ A;  1NI3 A;  4DFJ A;  1L3S A;  8ICT A;  3T5L A;  7ICV A;  3NVY A;  5AM5 A;  3SEI A;  1JIH A;  2ZTC A;  1NZB A;  3Q8S B;  3PVX A;  3QNM A;  4J9M A;  5F9N A;  3WK9 A;  1Q8K A;  1ZOL A;  3C5G A;  4P0P A;  3JPO A;  2OXO A;  4DSK A;  4OJ6 A;  1XO1 A;  4RNO A;  4F4W A;  1QQ5 A;  2KVC A;  1QSY A;  4I2A A;  5ALW A;  1HEK A;  4TUS A;  5L1L A;  1N56 A;  3ZDA A;  1TE2 A;  4M9H A;  3QXG A;  3TAR A;  2AJQ A;  3V7J A;  1A0P A;  1YZ6 A;  4J9Q A;  1QSS A;  4B9N A;  5DG7 A;  2G09 A;  3WKA A;  2CRX A;  3F53 A;  3C5F A;  4B9T A;  7ICO A;  5HR7 A;  3ICX A;  2UVV A;  1KN5 A;  4KN4 A;  3T5H A;  4IRD A;  4XA5 A;  4TUQ A;  2K4P A;  1N48 A;  3PSF A;  3MGI A;  3MC1 A;  1D8Y A;  1S10 A;  8ICC A;  2BCV A;  1X6I A;  4F4Z A;  5J0R A;  7ICK A;  1KKX A;  1ZD2 P;  4LVS A;  2ZIW A;  5AKH A;  1L7P A;  4GXJ A;  1SIJ A;  3FC4 A;  2YB4 A;  2R8K A;  3HJE A;  4CCH A;  3QUT A;  1SWW A;  3NRZ A;  5AKK A;  3GII A;  2N1R A;  1MA7 A;  1TKD A;  4XRH A;  5DB7 A;  2EQY A;  1WUD A;  2EAN A;  4UAZ A;  2XGP A;  1UA1 A;  4QW8 A;  9ICN A;  4EBE A;  4Y2T A;  8ICR A;  1ZQI A;  3Q8L A;  5B5E U;  1ZQH A;  4ED3 A;  4U6P A;  2W7P A;  2JV3 A;  3BJY A;  3RFA A;  4A8E A;  3RJI A;  2I5H A;  3HT3 A;  4GFJ A;  3KFU F;  4RQ8 A;  4XUS A;  3GIJ A;  5AKJ A;  4Y2P A;  1U48 A; 
#chains in the Genus database with same CATH homology
 4PZO A;  2F3N A;  5L1M A;  1X9X A;  2ESE A;  1Z1V A;  5JRT A;  2DL0 A;  2F44 A;  3H8M A;  1PK1 B;  1UQV A;  1SV4 A;  4NL9 A;  3KKA C;  1RG6 A;  2LMR A;  2B6G A;  3K1R B;  4NJ8 A;  5JTI A;  1LKY B;  2EAO A;  1B4F A;  2FE9 A;  1OXJ A;  5KNI A;  2Y9T A;  4RQM A;  2L5Y A;  3BS7 A;  2K4P A;  2F8K A;  5J8Y A;  1WWV A;  2KG5 A;  1UCV A;  2KE7 A;  1SV0 C;  1PK3 A;  3TAD A;  2QB1 A;  2K60 A;  1DXS A;  2EAM A;  2QB0 B;  3BQ7 A;  1PK1 A;  3BS5 A;  4MHV A;  2LPE A;  2D3D A;  3IDW A;  3TAC B;  1WWU A;  2GLE A;  1F0M A;  1COK A;  2QAR B;  2QKQ A;  5J8Y C;  2QB0 A;  1X66 A;  2EAN A;  5F3X B;  1V38 A;  2E8P A;  1SXE A;  2D8C A;  1V85 A;  1SGG A;  3TAD C;  1KW4 A;  2DKZ A;  2QAR A;  2KSO B;  2Y9U A;  1JI7 A;  1SXD A;  3SEN A;  1X40 A;  1SV0 A;  2ES6 A;  2DKX A;  2E8M A;  4NL9 C;  4PZN A;  2JV3 A;  2KSO A;  2YTU A;  4RQN A;  5JU5 A;  3BS5 B;  3SEI A;  2E8N A;  2E8O A;  3KKA A;  2KMD A;  1B0X A;  4IS7 A;  2EAP A;  2KIV A;  1OW5 A;  1LKY A;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...