5JU5A

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tankyrase-1
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5ju5A00
2F3NA 4IS7A 2E8PA 2DKZA 2YTUA 2ES6A 3K1RB 2F8KA 5F3XB 1SXDA 1B0XA 2ESEA 5KNIA 2GLEA 1LKYA 4PZNA 2F44A 2JV3A 2QB0A 2FE9A 3KKAA 2EAMA 2Y9UA 2DL0A 2LPEA 2K60A 3TADC 2EAPA 4NL9A 1UQVA 1X40A 2E8OA 1V85A 2K4PA 2DKXA 3BS5B 3TADA 2KG5A 1B4FA 1Z1VA 2EANA 5J8YA 3TACB 2D3DA 1V38A 2QARA 3BQ7A 2KSOA 1WWVA 1RG6A 4RQMA 1PK1A 2EAOA 2QB0B 2KE7A 1X66A 2QKQA 3IDWA 4MHVA 1OW5A 4RQNA 1WWUA 1PK3A 1SGGA 1SV0A 5JTIA 1KW4A 1UCVA 1JI7A 3BS7A 1COKA 5J8YC 2Y9TA 3SENA 2LMRA 4PZOA 1SV4A 2QB1A 3H8MA 1SXEA 1LKYB 3SEIA 2KMDA 3BS5A 3HILA 5L1MA 2KIVA 1DXSA 2E8NA 1F0MA 2D8CA 3KKAC 2B6GA 4NL9C 1SV0C 2QARB 5JRTA 2KSOB 4NJ8A 1X9XA 5JU5A 2L5YA 1OXJA 1PK1B 2E8MA
chains in the Genus database with same CATH superfamily
3ZDEA 3D2SA 2C2RA 3C2LA 4M9NA 9ICWA 4YQWA 3M9OB 2HBKA 4Q43A 4EEYA 2HOFA 1SB3C 5ALLA 4DFMA 4FE3A 7ICIA 3F53A 2HHSA 4DF4A 1Q8KA 1NK7A 4MF2A 1BNPA 8ICMA 2ZJ5A 2LBOA 7ICMA 2ZXIA 2AXTU 2V4RA 2XICA 3V6JA 4RUCA 3EWAA 2F2AB 1Z1VA 2MAXA 4DSKA 1RXWA 2JH7A 4GIBA 4I2AA 4YMNA 1TE2A 2EZYA 3D6JA 2BDUA 3UMCA 1AQ6A 1ZD2P 3TQ1A 3OPXA 1X66A 2ZJAA 3WU2U 5L1LA 3OSPA 8ICPA 2NRZA 5ALFA 1QSYA 4P2HA 2ZIUB 2WF8A 4CF3A 4QZIA 5F9NA 5KFRA 5AKXA 5AKKA 3C28A 1A77A 4F92B 3CP8A 2AU0A 5AM2A 2YN4A 4Z6FA 4JWMA 4QZ9A 3RJGA 3T79A 2BPCA 1ZQRA 1TVAA 3TAQA 5L1MA 4IQTA 1WCNA 5AM1A 5CB1A 3KFUF 5J2KA 4BDPA 4FS1A 4DWIA 4F4KA 4C7ZA 1SV0C 5G5HA 4ECYA 3GQCA 3SAHA 1CUKA 1JROA 4UB6U 3HX0A 5DQHA 3GV5B 4PHEA 3IN5A 5F9LA 8ICVA 5AKIA 3M8SA 7ICSA 2F8LA 2YQEA 4EBDA 5KFEA 3H0LB 2ES6A 3PO4A 4O3SA 3PSIA 4NLZA 1FEZA 4YCXA 1SL0A 5EWEA 2A1AA 1ZQTA 1RPLA 1ZQJA 3KTQA 3VC8A 1QCKA 7ICEA 5KG6A 2ZIUA 3H8SA 1IM4A 3OJSA 2BKEA 4PGYA 3GIKA 1DGJA 4CGZA 4CCHA 3QZ7A 5EE1A 3WK6A 2G09A 5ALKA 2DQNB 3NUQA 3GIMA 3GILA 5AK5A 3FC4A 2C22A 2K8AA 3RBDA 5J2BA 2HSZA 3PX4A 3QEAZ 2K8CB 1OW5A 2PKEA 1ZQZA 4IRDA 4B9UA 3S6JA 5KFJA 1S10A 2Y9TA 3B0XA 1Z19A 1X6IA 7ICJA 1IG6A 2H3QA 1XO1A 1Y88A 4KLIA 2WB1F 5DLGA 3ISBA 1QTMA 5EOZA 1NKBA 2KICA 2JEJA 2IOFA 4YG2A 1ZQWA 3N7SC 4RQ8A 5EWFA 4ECZA 1T8EA 4F4YA 2QLTA 1KTQA 2ZIWB 5DLFA 1L7NA 4KLLA 2KVCA 2KP7A 4DOAA 4ECWA 5CP2A 2BZFA 2KJ9A 3K1RB 3Q8SB 4EX6A 4EBCA 2ESEA 7ICQA 4DSJA 4YR2A 4DS5A 3HKZC 4DEZA 5DBBA 2OCEA 2R18A 4YFKA 2I5HA 9ICOA 5AK6A 3E0FA 2H3IA 3SMVA 2W7PA 4PGXA 4UAZA 2BCQA 4O9MA 5KFXA 3IP4B 3BS5B 1A76A 4JV2A 2F1HA 3NVVA 4FFDA 3N4MB 2LYHA 4ECUA 1ED1A 2H3FA 4MFAA 9ICUA 4GC6A 1ZQVA 1Q3VA 4HAIA 4R65A 5HR6A 4BX9C 4IQWA 3F2CA 4U6PA 4KLDA 2IBKA 2W8LA 2P6RA 4F71A 4B6JA 4DQQA 2JEGA 3MABA 4NLCA 3MR5A 2AGOA 5CA7A 8ICTA 2EZZA 4NLKA 2RP5A 2ZIWA 3QNMA 1D8YA 5L1IA 3ZDCA 3JPNA 1O08A 2VA2A 1IXRA 4I29A 2HW3A 4F5NA 2E1FA 4UAYA 4DS4A 2YMQA 2FI1A 2RQ5A 4I2JA 2WTFA 2BCUA 3E2EA 2KSOB 4Q8EA 4Y2JA 1X9XA 4Q44A 1KRPA 1L3UA 3T5HA 4UAUA 2LM1A 1LV5A 2DFLA 3C5FA 4MFFA 4R8UA 1O03A 5ALGA 5KFIA 5J2FA 4FZNA 3UMGA 3TAPA 1FO4A 3QZ8A 3DV9A 2W11A 8ICRA 2AH5A 3FAHA 4KITB 2F76X 3WKEA 2GLEA 4YXMA 4F50A 1ZQXA 3RB3A 1ZRMA 5D49A 4Y2YA 1NK0A 4C4TA 3LVWA 3WK7A 4DQRA 5KFPA 2Y1JA 1ZJNA 2EAPA 4ELUA 2GH1A 2HHVA 1WUDA 1XU4A 5KFGA 1MN8A 5KG0A 4IRKA 1L3VA 3OSNA 2W04A 2VJ5A 2D3DA 2BQ3A 3JPPA 1L7PA 5J2DA 2PMZF 2M9NA 2VA3A 4F2SA 2KZ3A 4RQ0A 4MF8A 2WFAA 7ICPA 3KD3A 4DQSA 5FP0A 4RPYA 4YMMA 2VA8A 3N7RC 4RPZA 4TUQA 2P35A 1ZQOA 5HHHA 3RJJA 4UARA 1A0PA 2FDRA 2A19A 2BCSA 3RJFA 2Y1IA 1WWUA 4NM1A 3LWLA 1UT5A 1SGGA 4RQ1A 2MSNA 4GLXA 4KMOB 3Q8MA 4JB3A 4PL2A 2KJ5A 3B9JA 2JZBB 1L7MA 1SXEA 1A6SA 2KZMA 4KLOA 3BS5A 2XCPA 2O6KA 4J9OA 4QZHA 4DL4A 5AM4A 2W55A 4AYBF 1IV8A 3QUBA 1JIHA 5ALDA 2KV2A 1S0VA 4RQ7A 4DLEA 4Y2SA 4KLJA 2HBJA 4KX5A 3CW2C 2DUYA 1DK2A 1PK1B 5J0YA 7ICGA 1UPHA 4IS7A 2V4QA 4Y2TA 4ECSA 1JXLA 4YP3A 4TQSA 2FPKA 2AJQA 4P4OA 5KG4A 5KFWA 2N1RA 5KG3A 4G9BA 3JPOA 3H40A 3UXNA 3T3FA 1KLNA 3CRXA 3WK4A 3PSPA 3PMNA 3MBYA 2K4HA 4QZBA 3TFRA 7ICKA 3KHGA 3ONNA 2JRZA 2NYVA 2LPEA 3QYPA 2OWOA 3SAFA 1L3SA 4O5KA 2W54A 2EDUA 4BJQA 3Q8LA 1RDFA 3WKBA 4IQUA 2NRWA 3QXGA 4F2RA 5K4LA 4B9SA 5J0SA 2NRVA 2ATLA 5J8YA 3TACB 4QZEA 4XUSA 4EEKA 1RG6A 2FLNA 1L8LA 4PH5A 4I2IA 4QNLA 4RPXA 3L4PA 3SQIA 2LM4A 5DB6A 1ZQBA 4B9LA 5L9XA 3GIIA 1RZTA 3F5EA 1VJ5A 3JPTA 1KL9A 4KLTA 1SV0A 5J2HA 1B22A 4PL1A 2IHNA 7ICLA 2HOQA 4UAVA 2KNJA 3NVZA 1U47A 9ICIA 8ICHA 2ZTDA 3RB0A 1NK6A 3C5GA 4KLSA 5AIAA 3MR3A 4ED2A 3I1YA 3V7KA 5ALJA 1NJZA 2BGWA 1TK0A 3BQ0A 2D8CA 4KLFA 4OO1J 2B6GA 3LK9A 5KG1A 2B0CA 4DL6A 4C4SA 2KKVA 2L5YA 4P4MA 1NK9A 5J0RA 5KFAA 1T3QA 1JALA 3LDAA 4DQPA 8ICQA 1T4GA 1BPZA 3PW7A 3M7DA 2ZTEA 5IIIA 1PVRA 2YMPA 3V72A 2IMWP 1QH9A 3KKAA 3UQ0A 9ICEA 2K4IA 1YZ7A 5J2EA 2Y9UA 5DDMA 1U9LA 5T14A 3TADC 2BHNA 1XSPA 2LHTA 3RJEA 1S8OA 4QZ8A 4GFJA 2PI5A 3N28A 2GO7A 2WF9A 1NJXA 5KFQA 2NRTA 3BQ2A 3AN1A 5ALMA 4RNOA 3UPQA 4QZGA 2B21A 5CJ7A 2JMGA 2OM6A 4QWBA 1RYUA 3F5AA 2XCAA 5AM0A 2DPJA 1D9DA 3KBBA 5DB8A 3D2NA 3H4DA 5IIKA 4IL6U 3M6ZA 2JEFA 2VIXA 1ZYQA 1RM6C 3ZDBA 4ED0A 4EELA 5CHGA 4I2FA 2ZIVB 4RQ3A 4PHAA 1S0NA 7ICHA 1Q3UA 5KFKA 2ZTCA 4DLGA 5DQGA 9ICJA 4NLBA 5J29A 2ZIVA 1QQ6A 4I28A 2KMDA 3ED5A 3PR4A 1Q46A 3A0BU 5J0UA 3C1ZA 4UASA 5J0XA 5AI9A 4RZRA 1MSWD 5AI4A 1F0MA 3M9MB 4C8LA 3GIJA 1SKRA 3QU2A 1T7PA 4NL9C 3RRHA 4ACOA 2H3VA 4Z6EA 4M2YA 4Y2RA 8ICEA 4Z6DA 2Z7JA 8ICJA 2WF5A 2DKZA 1LB2B 1KN5A 4F4XA 3QU5A 2G08A 2F1JA 2MU2A 4J9KA 5TZVA 4ECVA 4F3OA 1LKYA 5GTIU 2QB0A 5AM3A 9ICBA 3PNCA 4TUSA 3EUB2 2XVTA 5KL1B 3DEEA 1ZQSA 5AKLA 3MDCA 1U48A 2JGAA 3I76A 3RRGA 4LZGA 1N48A 1ZD3A 3PV8A 4Z6CA 4RT2A 1S9FA 3HP6A 3RFAA 2GOLA 4EZ9A 4C7YA 5AKJA 3L5KA 2YMLA 3IHQB 4O5CA 5J0QA 2FPLA 1NOMA 2HHUA 4MEYA 1Z4OA 2H5XA 2XGQA 2BCVA 1QSLA 5KG7A 4DSLA 4J9RA 4NWIA 2HHXA 1JX4A 1JI7A 2WHEA 1FFUA 3PW5A 3BZKA 1FIQA 2M0NA 4CF4A 2ISPA 1ZOLA 1F5SA 4K4GA 4PPXA 2NO4A 9ICTA 5H2FU 5ALQA 3RH5A 2NRXA 5AIBA 5J2JA 1SL1A 2KOBA 3ORYA 1V9PA 1SKWA 2VJ4A 4BXOA 2HCFA 4FZMA 1OXJA 4B9MA 4IRCA 5ALZA 3K1ZA 4QZFA 2LKYA 2YB1A 2C2DA 2PFPA 3AU6A 2I6XA 3RH4A 3PY8A 2K89A 5ALWA 3GV7B 4ED3A 4G3IA 1SXDA 2W9BB 3N7PD 5KT6A 2NV3A 2HDOA 3RF9A 4PZNA 1BVSA 3H4BA 3OTQA 2PI4A 9ICAA 3EYZA 2W9BA 5KTQA 3IM1A 3LVVA 3ICXA 1KFDA 2I1QA 1N61A 4UB5A 3RBEA 4BGDA 4TURA 1S76D 4F91B 4I2DA 4C8NA 5CWRA 8ICWA 5KFTA 1L8OA 1WCLA 3BZCA 5AM5A 2FMQA 4US8A 1Z4NA 8ICSA 1ZQUA 3MFIA 3IDWA 2A1JA 4NXZA 5BOMA 4DF8A 9ICLA 4KLGA 3GFKB 5HMLA 4CE6A 1KBUA 2JR5A 1KW4A 3GZFA 2BDPA 4LZDA 3RB4A 2R8KA 2RDJA 1S77D 2ALZA 1TK8A 4FO6A 2F1IA 4YD2A 1JRPA 1HJPA 3SEIA 3IV6A 3ZD9A 2BPGA 8ICIA 2W9CA 4MEXA 1SZHA 3PR5B 4M9JA 5J0TA 3PW2A 5ALNA 5JRTA 2ISOA 3R9KA 2KTQA 1OUQA 1KFTA 4Y2UA 3HW8A 4KX3A 5EE9A 4M6WB 4OJLA 4ECQA 3BQTA 4B9TA 5KG2A 3WKCA 2FLPA 4YD1A 1L5UA 5ALOA 1N63A 2KHVA 3V7LA 7ICUA 1SZPA 3AQFA 3JPSA 4X5VA 4KLEA 4DFJA 2P6UA 3ETLA 4DCCA 4ED8A 5DBCA 4IR9A 4KN7A 1UQVA 4NL9A 2PMZC 3PO5A 2ZG6A 1X40A 2ZUCA 4FBTA 5HR7A 4RQ4A 1N5WA 2KEYA 2ZJ8A 3SD7A 2HHWA 1RXVA 4TUPA 5KFMA 2FPMA 4RQMA 4YXJA 9ICRA 5ALPA 3H0RB 1PZNA 4QJFB 1KEJA 4O0IA 5IIJA 3G6XA 4M04A 1C7YA 2KE7A 2XY7A 2QKQA 2IHMA 2BQUA 4KLMA 4KTQA 4EYHB 1ZQYA 1BPBA 8ICOA 4B9VA 7ICTA 2GWSA 1BPEA 1SKSA 4O3OA 1P7DA 2QB1A 1L6NA 9ICVA 3HILA 3T5KA 3AL0B 3KHRA 4PJ0U 4JMUA 1RYSA 3JPQA 1ZQHA 2QARB 5AK3A 4DOBA 1Z00B 5JU5A 1U4BA 1HUZA 3HPOA 4XRHA 1HUOA 1DGSA 3FDSA 5AKHA 4WJ3B 4KMUA 3E58A 5J0WA 2JZBA 7ICFA 4NV0A 4O3RA 1ZQKA 2XGPA 2JXJA 5AKGA 2XY6A 4NLNA 1S0OA 4RU9A 3Q8QB 3QU7A 4DFPA 4JV0A 2MA1A 4BXOB 2ZIXA 2DGZA 4DSEA 5IIOA 1S0MA 5ALTA 8ICBA 3KHLA 2HBMA 2KN7A 3WKDA 2W3RA 4F5RA 3ZDAA 3EZ5A 4R66A 2KHQA 3AQEA 3MFHA 5KT4A 1QSSA 4ZH4A 1ZXIA 1X2IA 1BPYA 4PHDA 3U26A 3C1YA 3H7IA 4GXKA 1KQQA 1L3TA 2ZUDA 2OHFA 3RTVA 3CNHA 5C5JA 5ALUA 5KL8B 4A8EA 3C2MA 4C0ZA 5AI5A 3RJHA 2W3SA 8ICKA 1TAUA 1L7OA 1MC8A 5KFCA 4J9LA 1ZQLA 4M47A 2WB1C 3IRUA 4F72A 3EPGA 5B66U 3KKAC 2A1JB 4LJXA 2W9AA 4NM2A 2YX8A 9ICGA 2XO7A 3NVYA 4LVSA 3UXPA 4QWCA 5EE3A 3G6YA 1NK4A 3SI8A 1T94A 4ECXA 4USAA 1JN3A 2HHQA 5DG9A 4PGQA 1YT3A 4ED7A 4EBEA 7ICNA 5AK4A 1C20A 4Y2XA 2F44A 3MR6A 2W9MA 4UQGA 2OXOA 4YR3A 3RR8A 4F5QA 2BR0A 2K60A 5KFOA 1N60A 1TAMA 4DL3A 4CDGA 5ALRA 5BOLA 1ZD4A 1LVHA 3QUQA 5AICA 3QU4A 8ICFA 2IOFK 5KAFU 2ZXHA 1ECWA 4F8RA 2E3TA 2R8HA 5CRXA 2FLLA 1WWVA 3BQ1A 4GXJA 4QWAA 4R64A 4UATA 2EAOA 2EZXA 2DF4B 3AM9A 4OJ6A 9ICMA 5J2IA 1ZQEA 1N56A 2V9WA 2JHDA 5KG5A 2EQYA 5D46A 1M6YA 3PSFA 2W43A 4J9PA 4GXIA 3Q8RB 5KFZA 3RAQA 4FS2A 1XC9A 5AHXA 3CYMA 2LMRA 4PZOA 1MA7A 3QX7A 1J97A 5HP4A 3C29A 2PFNA 4UAWA 5A0LA 2RDIA 4CRXA 2LI6A 1Z1BA 2E8NA 4BWJA 9ICFA 4KN4A 4ICAA 5KFNA 2OH2A 2HOIA 5J2GA 5L1KA 2BCRA 1K1SA 1J2NA 5J0PA 4O5EA 3HT3A 1H38A 2RRDA 3GV8B 3PW4A 2KJ8A 3MC1A 3IG5A 3PX0A 4K4IA 3NRWA 1B0XA 4UB2A 4RNMA 4C8KA 3WK5A 4UBBA 3K4GA 2HVIA 3M8RA 4IC9A 2DBYA 3ALRA 3RR7A 1J2MA 4FBUA 1AROP 7ICVA 2DKXA 1X9WA 5KFDA 1D8BA 5CEHA 2EANA 4OJ5A 4ED6A 2OEHA 2R8GA 3Q8KA 1XNSA 1V38A 1N62A 3MGHA 1X6JA 4I2EA 2YY6A 3SV4A 4UB8U 1PK1A 2A3VA 2CN1A 4DO9A 5KFLA 3G6VA 4RNNA 4GC7A 4DQIA 1NI3A 5KFFA 2YB4A 5BPCA 2YMMA 1TFRA 1IIPA 4RUAA 1KSPA 1PK3A 4UB3A 5J2CA 4O3MA 3A0HU 3MDAA 4O3NA 3M1YA 4DL7A 3KOOA 1EXNA 2UVWA 3H8MA 4E0DA 3JPRA 2ZUBA 2BQRA 8ICCA 4KLUA 2VKQA 4DL5A 1CI4A 4AYBC 2C28A 1U49A 1DXSA 4K4HA 3HWTA 3C2KA 1T3NA 5KT3A 4M6WA 5DGAA 8ICXA 1QQ5A 1ZQNA 3WKAA 5DGBA 2DWQA 1TK5A 4QZAA 8ICUA 4YMOA 2F3NA 2WF7A 2E8PA 2YTUA 4XA5A 5F3XB 2Q0ZX 3QU9A 2ASJA 1KKXA 3SV3A 5KNIA 3ETRA 3MGIA 3TFSA 3SR6A 4UBCA 1CEZA 1XSLA 1UA0A 1NZPA 2E5SA 4HYKA 1RQNA 4P4PA 4J9NA 3THVA 2EAMA 4ECRA 4J9QA 2DL0A 5JUMA 3NS1A 5DQIA 1S97A 3V6HA 1RYRA 5AKZA 4O3QA 2Y0SF 4AP9A 2E8OA 1V85A 5KT5A 3GDXA 3NRZA 5ALHA 2PXIA 1HEKA 3FM9A 1QLNA 3QUCA 3ISDA 4YR0A 4BWMA 2WAQC 3VCBA 2AHOB 1CRXA 2C2EA 2KVSA 2CPRA 5J2AA 5G5GA 4P0PB 3RH6A 5KFBA 1RQLA 1ZJMA 4I2GA 1NJWA 4I27A 3PMLA 2HVHA 2ASLA 1FFVA 1XSNA 4B9NA 4RQNA 5D4BA 4EZ6A 4QW8A 4RQ5A 3BS7A 4EYIB 3I28A 3PW0A 3TARA 4OJOA 5J8YC 1SL2A 3FYHA 5ALEA 4Y2QA 5CR0A 4QIWC 1X9MA 9ICPA 5KT2A 3KZIU 1B43A 2VANA 3KZXA 2IA6A 5KFSA 3OHBA 3QE9Y 3OHAA 4I2BA 2I9GA 1Z00A 3BJYA 4KLHA 3QUTA 4RQ2A 3ISCA 1VLBA 4EENA 9ICSA 2RLTA 4R8UB 1S5LU 2UVRA 8ICAA 1DK3A 9ICCA 1TAQA 2MUTB 4J9MA 3C23A 3UQ2A 3TANA 2WF6A 4UB1A 4ED1A 5KT7A 1GO3F 4QW9A 4IR1A 4C4RA 3NASA 1NK5A 1D9FA 1ZQ1C 4MFCA 1ZRNA 2K4PA 4DSFA 5DDYA 5ALYA 5IIMA 3ZD8A 9ICKA 2QARA 1TKDA 2KSOA 3PSTA 4XQ8A 3H8WA 3LYSA 5ALIA 1Z3EB 7ICRA 3OGUA 1JXEA 4Y2PA 2P66A 4DFKA 3EW9A 3PZPA 1URJA 4M9LA 3PVXA 2UVUA 3QEBZ 5KAIU 1BGXT 5IILA 5ALXA 2XI9A 2R8JA 1COKA 5AI6A 3TKAA 2W9CB 4C80A 3T5LA 4BUGA 1NNLA 1K1QA 2HBLA 1D8LA 2JEIA 4R63A 2IOHA 1MQ3A 1QQ7A 2ZIXB 4OCZA 3RJIA 1MQ2A 1LKYB 5HNKA 5IINA 3DDHA 5B5EU 1PVQA 1X9SA 3BDPA 4P0QA 4PHPA 1PVPA 3WK8A 4P0PA 4UB4A 2XC9A 4NJ8A 1HIWA 2KKPA 3K75D 2Q4TA 2E8MA 1DOQA 2AQ0A 9ICQA 3AEVA 5ALSA 4DFDA 5KFHA 3O0FA 4CF5A 3B0YA 5EE0A 4TQRA 4QZCA 2F8KA 5HMMA 1K5OA 2R8IA 1ZQCA 3ZI4A 1XS9D 1F44A 3M6KA 4US9A 3EPIA 4Y2VA 4Q45A 2D6FC 8ICYA 3HKZF 1JMSA 3SZ2A 2F77X 2NO5A 2CXYA 4F5OA 4J03A 1X42A 1WYGA 2EH9A 5ALVA 1ZQAA 1ZQDA 4F5PA 1NK8A 5HHIA 1KDHA 2W7OA 4M0AA 4QIWF 4ZOHC 8ICGA 4JWNA 2OYYA 2JH1A 2DPIA 1UA1A 4F4WA 4DSIA 1BPXA 3L3FX 2AQ4A 2FMPA 4F4ZA 2KZZA 2QB0B 5AI0A 2MUTA 8ICZA 2AGQA 3UMBA 2W8KA 2RHFA 3NTUA 4OJPA 1XO0A 2LYAA 3AU2A 5KFYA 4I2HA 2HHTA 4P0QB 4Q8FA 5L1JA 4ECTA 4MHVA 5TISU 5DB9A 4FZLA 5DG7A 4RQ6A 2KD1A 1COOA 3NVWA 4DL2A 3F2BA 1UCVA 2XY5A 1ZQIA 7ICOA 1BPDA 2G06A 2AGPA 3SENA 2WAQF 5KFVA 3J81j 3D2QA 1V97A 4QZDA 3AUOA 1SV4A 1NZBA 4C8MA 5GTHU 8ICNA 1U45A 4QWDA 2CRXA 2G5IB 5DBAA 2KK0A 4IQVA 5DG8A 4J9SA 2UVVA 2E1EA 2KIWA 5AI8A 4OD0A 3RJKA 2FMSA 2J6UA 3M9NB 9ICNA 3H0MB 3KHHA 3RB6A 1PUZA 2K4EA 4NLGA 1SIJA 5C0YA 4O3PA 1N5XA 2G5HB 5AKYA 3C21A 2XIDA 3HJEA 3SAGA 2PFQA 9ICXA 3H8JA 3V6KA 5KFUA 3T5JA 2JV3A 1WG8A 1XWLA 2FE9A 3MR2A 3LWMA 4M9HA 4KLQA 2KFZA 4RT3A 1ZQGA 1SWWA 1NKEA 4F93B 1NJYA 3TADA 2KG5A 1B4FA 5E79U 2W03A 2Y0SC 3BQ7A 2BPFA 8ICLA 4U7CA 5J0OA 1ZD5A 3OJUA 4I2CA 4ELVA 3SYZA 3WK9A 1UHUA 3NGDA 4C8OA 1BNOA 3V7JA 3Q8PB 1KFSA 5EWGA 3UM9A 2K8BB 4QWEA 2ODGA 1DRGA 3GU3A 2J6SA 4JK1A 1ZQQA 4ELTA 1VDVA 3ZDDA 5JTIA 3IG8A 1NKCA 1ZETA 2KFNA 2HI0A 3MGVA 4DOCA 9ICHA 5DB7A 5DKWA 1JUDA 5AKEA 3F2DA 2G07A 4CNQA 1SWVA 2G0AA 1TV9A 2MRLA 1N2XA 1ZQPA 4M9GA 2LYBA 4UW9A 4YVZA 1YZ6A 3N97B 2ASDA 2FJ6A 2KIVA 4YN4A 1ZQFA 4JV1A 1ZQMA 3HRDD 3AMZA 4JUZA 2PFOA 4EX7A 3PX6A 2H3ZA 2HMXA 3UXOA 3RAXA 4NY8A 3TI0A 2J6TA 1UT8A
chains in the Genus database with same CATH topology
2F3NA 4IS7A 2E8PA 2DKZA 2YTUA 2ES6A 3K1RB 2F8KA 5F3XB 1SXDA 1B0XA 2ESEA 5KNIA 2GLEA 1LKYA 4PZNA 2F44A 2JV3A 2QB0A 2FE9A 3KKAA 2EAMA 2Y9UA 2DL0A 2LPEA 2K60A 3TADC 2EAPA 4NL9A 1UQVA 1X40A 2E8OA 1V85A 2K4PA 2DKXA 3BS5B 3TADA 2KG5A 1B4FA 1Z1VA 2EANA 5J8YA 3TACB 2D3DA 1V38A 2QARA 3BQ7A 2KSOA 1WWVA 1RG6A 4RQMA 1PK1A 2EAOA 2QB0B 2KE7A 1X66A 2QKQA 3IDWA 4MHVA 1OW5A 4RQNA 1WWUA 1PK3A 1SGGA 1SV0A 5JTIA 1KW4A 1UCVA 1JI7A 3BS7A 1COKA 5J8YC 2Y9TA 3SENA 2LMRA 4PZOA 1SV4A 2QB1A 3H8MA 1SXEA 1LKYB 3SEIA 2KMDA 3BS5A 3HILA 5L1MA 2KIVA 1DXSA 2E8NA 1F0MA 2D8CA 3KKAC 2B6GA 4NL9C 1SV0C 2QARB 5JRTA 2KSOB 4NJ8A 1X9XA 5JU5A 2L5YA 1OXJA 1PK1B 2E8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3N A;  4IS7 A;  2E8P A;  2DKZ A;  2YTU A;  2ES6 A;  3K1R B;  2F8K A;  5F3X B;  1SXD A;  1B0X A;  2ESE A;  5KNI A;  2GLE A;  1LKY A;  4PZN A;  2F44 A;  2JV3 A;  2QB0 A;  2FE9 A;  3KKA A;  2EAM A;  2Y9U A;  2DL0 A;  2LPE A;  2K60 A;  3TAD C;  2EAP A;  4NL9 A;  1UQV A;  1X40 A;  2E8O A;  1V85 A;  2K4P A;  2DKX A;  3BS5 B;  3TAD A;  2KG5 A;  1B4F A;  1Z1V A;  2EAN A;  5J8Y A;  3TAC B;  2D3D A;  1V38 A;  2QAR A;  3BQ7 A;  2KSO A;  1WWV A;  1RG6 A;  4RQM A;  1PK1 A;  2EAO A;  2QB0 B;  2KE7 A;  1X66 A;  2QKQ A;  3IDW A;  4MHV A;  1OW5 A;  4RQN A;  1WWU A;  1PK3 A;  1SGG A;  1SV0 A;  5JTI A;  1KW4 A;  1UCV A;  1JI7 A;  3BS7 A;  1COK A;  5J8Y C;  2Y9T A;  3SEN A;  2LMR A;  4PZO A;  1SV4 A;  2QB1 A;  3H8M A;  1SXE A;  1LKY B;  3SEI A;  2KMD A;  3BS5 A;  3HIL A;  5L1M A;  2KIV A;  1DXS A;  2E8N A;  1F0M A;  2D8C A;  3KKA C;  2B6G A;  4NL9 C;  1SV0 C;  2QAR B;  5JRT A;  2KSO B;  4NJ8 A;  1X9X A;  5JU5 A;  2L5Y A;  1OXJ A;  1PK1 B;  2E8M A; 
#chains in the Genus database with same CATH topology
 3ZDE A;  3D2S A;  2C2R A;  3C2L A;  4M9N A;  9ICW A;  4YQW A;  3M9O B;  2HBK A;  4Q43 A;  4EEY A;  2HOF A;  1SB3 C;  5ALL A;  4DFM A;  4FE3 A;  7ICI A;  3F53 A;  2HHS A;  4DF4 A;  1Q8K A;  1NK7 A;  4MF2 A;  1BNP A;  8ICM A;  2ZJ5 A;  2LBO A;  7ICM A;  2ZXI A;  2AXT U;  2V4R A;  2XIC A;  3V6J A;  4RUC A;  3EWA A;  2F2A B;  1Z1V A;  2MAX A;  4DSK A;  1RXW A;  2JH7 A;  4GIB A;  4I2A A;  4YMN A;  1TE2 A;  2EZY A;  3D6J A;  2BDU A;  3UMC A;  1AQ6 A;  1ZD2 P;  3TQ1 A;  3OPX A;  1X66 A;  2ZJA A;  3WU2 U;  5L1L A;  3OSP A;  8ICP A;  2NRZ A;  5ALF A;  1QSY A;  4P2H A;  2ZIU B;  2WF8 A;  4CF3 A;  4QZI A;  5F9N A;  5KFR A;  5AKX A;  5AKK A;  3C28 A;  1A77 A;  4F92 B;  3CP8 A;  2AU0 A;  5AM2 A;  2YN4 A;  4Z6F A;  4JWM A;  4QZ9 A;  3RJG A;  3T79 A;  2BPC A;  1ZQR A;  1TVA A;  3TAQ A;  5L1M A;  4IQT A;  1WCN A;  5AM1 A;  5CB1 A;  3KFU F;  5J2K A;  4BDP A;  4FS1 A;  4DWI A;  4F4K A;  4C7Z A;  1SV0 C;  5G5H A;  4ECY A;  3GQC A;  3SAH A;  1CUK A;  1JRO A;  4UB6 U;  3HX0 A;  5DQH A;  3GV5 B;  4PHE A;  3IN5 A;  5F9L A;  8ICV A;  5AKI A;  3M8S A;  7ICS A;  2F8L A;  2YQE A;  4EBD A;  5KFE A;  3H0L B;  2ES6 A;  3PO4 A;  4O3S A;  3PSI A;  4NLZ A;  1FEZ A;  4YCX A;  1SL0 A;  5EWE A;  2A1A A;  1ZQT A;  1RPL A;  1ZQJ A;  3KTQ A;  3VC8 A;  1QCK A;  7ICE A;  5KG6 A;  2ZIU A;  3H8S A;  1IM4 A;  3OJS A;  2BKE A;  4PGY A;  3GIK A;  1DGJ A;  4CGZ A;  4CCH A;  3QZ7 A;  5EE1 A;  3WK6 A;  2G09 A;  5ALK A;  2DQN B;  3NUQ A;  3GIM A;  3GIL A;  5AK5 A;  3FC4 A;  2C22 A;  2K8A A;  3RBD A;  5J2B A;  2HSZ A;  3PX4 A;  3QEA Z;  2K8C B;  1OW5 A;  2PKE A;  1ZQZ A;  4IRD A;  4B9U A;  3S6J A;  5KFJ A;  1S10 A;  2Y9T A;  3B0X A;  1Z19 A;  1X6I A;  7ICJ A;  1IG6 A;  2H3Q A;  1XO1 A;  1Y88 A;  4KLI A;  2WB1 F;  5DLG A;  3ISB A;  1QTM A;  5EOZ A;  1NKB A;  2KIC A;  2JEJ A;  2IOF A;  4YG2 A;  1ZQW A;  3N7S C;  4RQ8 A;  5EWF A;  4ECZ A;  1T8E A;  4F4Y A;  2QLT A;  1KTQ A;  2ZIW B;  5DLF A;  1L7N A;  4KLL A;  2KVC A;  2KP7 A;  4DOA A;  4ECW A;  5CP2 A;  2BZF A;  2KJ9 A;  3K1R B;  3Q8S B;  4EX6 A;  4EBC A;  2ESE A;  7ICQ A;  4DSJ A;  4YR2 A;  4DS5 A;  3HKZ C;  4DEZ A;  5DBB A;  2OCE A;  2R18 A;  4YFK A;  2I5H A;  9ICO A;  5AK6 A;  3E0F A;  2H3I A;  3SMV A;  2W7P A;  4PGX A;  4UAZ A;  2BCQ A;  4O9M A;  5KFX A;  3IP4 B;  3BS5 B;  1A76 A;  4JV2 A;  2F1H A;  3NVV A;  4FFD A;  3N4M B;  2LYH A;  4ECU A;  1ED1 A;  2H3F A;  4MFA A;  9ICU A;  4GC6 A;  1ZQV A;  1Q3V A;  4HAI A;  4R65 A;  5HR6 A;  4BX9 C;  4IQW A;  3F2C A;  4U6P A;  4KLD A;  2IBK A;  2W8L A;  2P6R A;  4F71 A;  4B6J A;  4DQQ A;  2JEG A;  3MAB A;  4NLC A;  3MR5 A;  2AGO A;  5CA7 A;  8ICT A;  2EZZ A;  4NLK A;  2RP5 A;  2ZIW A;  3QNM A;  1D8Y A;  5L1I A;  3ZDC A;  3JPN A;  1O08 A;  2VA2 A;  1IXR A;  4I29 A;  2HW3 A;  4F5N A;  2E1F A;  4UAY A;  4DS4 A;  2YMQ A;  2FI1 A;  2RQ5 A;  4I2J A;  2WTF A;  2BCU A;  3E2E A;  2KSO B;  4Q8E A;  4Y2J A;  1X9X A;  4Q44 A;  1KRP A;  1L3U A;  3T5H A;  4UAU A;  2LM1 A;  1LV5 A;  2DFL A;  3C5F A;  4MFF A;  4R8U A;  1O03 A;  5ALG A;  5KFI A;  5J2F A;  4FZN A;  3UMG A;  3TAP A;  1FO4 A;  3QZ8 A;  3DV9 A;  2W11 A;  8ICR A;  2AH5 A;  3FAH A;  4KIT B;  2F76 X;  3WKE A;  2GLE A;  4YXM A;  4F50 A;  1ZQX A;  3RB3 A;  1ZRM A;  5D49 A;  4Y2Y A;  1NK0 A;  4C4T A;  3LVW A;  3WK7 A;  4DQR A;  5KFP A;  2Y1J A;  1ZJN A;  2EAP A;  4ELU A;  2GH1 A;  2HHV A;  1WUD A;  1XU4 A;  5KFG A;  1MN8 A;  5KG0 A;  4IRK A;  1L3V A;  3OSN A;  2W04 A;  2VJ5 A;  2D3D A;  2BQ3 A;  3JPP A;  1L7P A;  5J2D A;  2PMZ F;  2M9N A;  2VA3 A;  4F2S A;  2KZ3 A;  4RQ0 A;  4MF8 A;  2WFA A;  7ICP A;  3KD3 A;  4DQS A;  5FP0 A;  4RPY A;  4YMM A;  2VA8 A;  3N7R C;  4RPZ A;  4TUQ A;  2P35 A;  1ZQO A;  5HHH A;  3RJJ A;  4UAR A;  1A0P A;  2FDR A;  2A19 A;  2BCS A;  3RJF A;  2Y1I A;  1WWU A;  4NM1 A;  3LWL A;  1UT5 A;  1SGG A;  4RQ1 A;  2MSN A;  4GLX A;  4KMO B;  3Q8M A;  4JB3 A;  4PL2 A;  2KJ5 A;  3B9J A;  2JZB B;  1L7M A;  1SXE A;  1A6S A;  2KZM A;  4KLO A;  3BS5 A;  2XCP A;  2O6K A;  4J9O A;  4QZH A;  4DL4 A;  5AM4 A;  2W55 A;  4AYB F;  1IV8 A;  3QUB A;  1JIH A;  5ALD A;  2KV2 A;  1S0V A;  4RQ7 A;  4DLE A;  4Y2S A;  4KLJ A;  2HBJ A;  4KX5 A;  3CW2 C;  2DUY A;  1DK2 A;  1PK1 B;  5J0Y A;  7ICG A;  1UPH A;  4IS7 A;  2V4Q A;  4Y2T A;  4ECS A;  1JXL A;  4YP3 A;  4TQS A;  2FPK A;  2AJQ A;  4P4O A;  5KG4 A;  5KFW A;  2N1R A;  5KG3 A;  4G9B A;  3JPO A;  3H40 A;  3UXN A;  3T3F A;  1KLN A;  3CRX A;  3WK4 A;  3PSP A;  3PMN A;  3MBY A;  2K4H A;  4QZB A;  3TFR A;  7ICK A;  3KHG A;  3ONN A;  2JRZ A;  2NYV A;  2LPE A;  3QYP A;  2OWO A;  3SAF A;  1L3S A;  4O5K A;  2W54 A;  2EDU A;  4BJQ A;  3Q8L A;  1RDF A;  3WKB A;  4IQU A;  2NRW A;  3QXG A;  4F2R A;  5K4L A;  4B9S A;  5J0S A;  2NRV A;  2ATL A;  5J8Y A;  3TAC B;  4QZE A;  4XUS A;  4EEK A;  1RG6 A;  2FLN A;  1L8L A;  4PH5 A;  4I2I A;  4QNL A;  4RPX A;  3L4P A;  3SQI A;  2LM4 A;  5DB6 A;  1ZQB A;  4B9L A;  5L9X A;  3GII A;  1RZT A;  3F5E A;  1VJ5 A;  3JPT A;  1KL9 A;  4KLT A;  1SV0 A;  5J2H A;  1B22 A;  4PL1 A;  2IHN A;  7ICL A;  2HOQ A;  4UAV A;  2KNJ A;  3NVZ A;  1U47 A;  9ICI A;  8ICH A;  2ZTD A;  3RB0 A;  1NK6 A;  3C5G A;  4KLS A;  5AIA A;  3MR3 A;  4ED2 A;  3I1Y A;  3V7K A;  5ALJ A;  1NJZ A;  2BGW A;  1TK0 A;  3BQ0 A;  2D8C A;  4KLF A;  4OO1 J;  2B6G A;  3LK9 A;  5KG1 A;  2B0C A;  4DL6 A;  4C4S A;  2KKV A;  2L5Y A;  4P4M A;  1NK9 A;  5J0R A;  5KFA A;  1T3Q A;  1JAL A;  3LDA A;  4DQP A;  8ICQ A;  1T4G A;  1BPZ A;  3PW7 A;  3M7D A;  2ZTE A;  5III A;  1PVR A;  2YMP A;  3V72 A;  2IMW P;  1QH9 A;  3KKA A;  3UQ0 A;  9ICE A;  2K4I A;  1YZ7 A;  5J2E A;  2Y9U A;  5DDM A;  1U9L A;  5T14 A;  3TAD C;  2BHN A;  1XSP A;  2LHT A;  3RJE A;  1S8O A;  4QZ8 A;  4GFJ A;  2PI5 A;  3N28 A;  2GO7 A;  2WF9 A;  1NJX A;  5KFQ A;  2NRT A;  3BQ2 A;  3AN1 A;  5ALM A;  4RNO A;  3UPQ A;  4QZG A;  2B21 A;  5CJ7 A;  2JMG A;  2OM6 A;  4QWB A;  1RYU A;  3F5A A;  2XCA A;  5AM0 A;  2DPJ A;  1D9D A;  3KBB A;  5DB8 A;  3D2N A;  3H4D A;  5IIK A;  4IL6 U;  3M6Z A;  2JEF A;  2VIX A;  1ZYQ A;  1RM6 C;  3ZDB A;  4ED0 A;  4EEL A;  5CHG A;  4I2F A;  2ZIV B;  4RQ3 A;  4PHA A;  1S0N A;  7ICH A;  1Q3U A;  5KFK A;  2ZTC A;  4DLG A;  5DQG A;  9ICJ A;  4NLB A;  5J29 A;  2ZIV A;  1QQ6 A;  4I28 A;  2KMD A;  3ED5 A;  3PR4 A;  1Q46 A;  3A0B U;  5J0U A;  3C1Z A;  4UAS A;  5J0X A;  5AI9 A;  4RZR A;  1MSW D;  5AI4 A;  1F0M A;  3M9M B;  4C8L A;  3GIJ A;  1SKR A;  3QU2 A;  1T7P A;  4NL9 C;  3RRH A;  4ACO A;  2H3V A;  4Z6E A;  4M2Y A;  4Y2R A;  8ICE A;  4Z6D A;  2Z7J A;  8ICJ A;  2WF5 A;  2DKZ A;  1LB2 B;  1KN5 A;  4F4X A;  3QU5 A;  2G08 A;  2F1J A;  2MU2 A;  4J9K A;  5TZV A;  4ECV A;  4F3O A;  1LKY A;  5GTI U;  2QB0 A;  5AM3 A;  9ICB A;  3PNC A;  4TUS A;  3EUB 2;  2XVT A;  5KL1 B;  3DEE A;  1ZQS A;  5AKL A;  3MDC A;  1U48 A;  2JGA A;  3I76 A;  3RRG A;  4LZG A;  1N48 A;  1ZD3 A;  3PV8 A;  4Z6C A;  4RT2 A;  1S9F A;  3HP6 A;  3RFA A;  2GOL A;  4EZ9 A;  4C7Y A;  5AKJ A;  3L5K A;  2YML A;  3IHQ B;  4O5C A;  5J0Q A;  2FPL A;  1NOM A;  2HHU A;  4MEY A;  1Z4O A;  2H5X A;  2XGQ A;  2BCV A;  1QSL A;  5KG7 A;  4DSL A;  4J9R A;  4NWI A;  2HHX A;  1JX4 A;  1JI7 A;  2WHE A;  1FFU A;  3PW5 A;  3BZK A;  1FIQ A;  2M0N A;  4CF4 A;  2ISP A;  1ZOL A;  1F5S A;  4K4G A;  4PPX A;  2NO4 A;  9ICT A;  5H2F U;  5ALQ A;  3RH5 A;  2NRX A;  5AIB A;  5J2J A;  1SL1 A;  2KOB A;  3ORY A;  1V9P A;  1SKW A;  2VJ4 A;  4BXO A;  2HCF A;  4FZM A;  1OXJ A;  4B9M A;  4IRC A;  5ALZ A;  3K1Z A;  4QZF A;  2LKY A;  2YB1 A;  2C2D A;  2PFP A;  3AU6 A;  2I6X A;  3RH4 A;  3PY8 A;  2K89 A;  5ALW A;  3GV7 B;  4ED3 A;  4G3I A;  1SXD A;  2W9B B;  3N7P D;  5KT6 A;  2NV3 A;  2HDO A;  3RF9 A;  4PZN A;  1BVS A;  3H4B A;  3OTQ A;  2PI4 A;  9ICA A;  3EYZ A;  2W9B A;  5KTQ A;  3IM1 A;  3LVV A;  3ICX A;  1KFD A;  2I1Q A;  1N61 A;  4UB5 A;  3RBE A;  4BGD A;  4TUR A;  1S76 D;  4F91 B;  4I2D A;  4C8N A;  5CWR A;  8ICW A;  5KFT A;  1L8O A;  1WCL A;  3BZC A;  5AM5 A;  2FMQ A;  4US8 A;  1Z4N A;  8ICS A;  1ZQU A;  3MFI A;  3IDW A;  2A1J A;  4NXZ A;  5BOM A;  4DF8 A;  9ICL A;  4KLG A;  3GFK B;  5HML A;  4CE6 A;  1KBU A;  2JR5 A;  1KW4 A;  3GZF A;  2BDP A;  4LZD A;  3RB4 A;  2R8K A;  2RDJ A;  1S77 D;  2ALZ A;  1TK8 A;  4FO6 A;  2F1I A;  4YD2 A;  1JRP A;  1HJP A;  3SEI A;  3IV6 A;  3ZD9 A;  2BPG A;  8ICI A;  2W9C A;  4MEX A;  1SZH A;  3PR5 B;  4M9J A;  5J0T A;  3PW2 A;  5ALN A;  5JRT A;  2ISO A;  3R9K A;  2KTQ A;  1OUQ A;  1KFT A;  4Y2U A;  3HW8 A;  4KX3 A;  5EE9 A;  4M6W B;  4OJL A;  4ECQ A;  3BQT A;  4B9T A;  5KG2 A;  3WKC A;  2FLP A;  4YD1 A;  1L5U A;  5ALO A;  1N63 A;  2KHV A;  3V7L A;  7ICU A;  1SZP A;  3AQF A;  3JPS A;  4X5V A;  4KLE A;  4DFJ A;  2P6U A;  3ETL A;  4DCC A;  4ED8 A;  5DBC A;  4IR9 A;  4KN7 A;  1UQV A;  4NL9 A;  2PMZ C;  3PO5 A;  2ZG6 A;  1X40 A;  2ZUC A;  4FBT A;  5HR7 A;  4RQ4 A;  1N5W A;  2KEY A;  2ZJ8 A;  3SD7 A;  2HHW A;  1RXV A;  4TUP A;  5KFM A;  2FPM A;  4RQM A;  4YXJ A;  9ICR A;  5ALP A;  3H0R B;  1PZN A;  4QJF B;  1KEJ A;  4O0I A;  5IIJ A;  3G6X A;  4M04 A;  1C7Y A;  2KE7 A;  2XY7 A;  2QKQ A;  2IHM A;  2BQU A;  4KLM A;  4KTQ A;  4EYH B;  1ZQY A;  1BPB A;  8ICO A;  4B9V A;  7ICT A;  2GWS A;  1BPE A;  1SKS A;  4O3O A;  1P7D A;  2QB1 A;  1L6N A;  9ICV A;  3HIL A;  3T5K A;  3AL0 B;  3KHR A;  4PJ0 U;  4JMU A;  1RYS A;  3JPQ A;  1ZQH A;  2QAR B;  5AK3 A;  4DOB A;  1Z00 B;  5JU5 A;  1U4B A;  1HUZ A;  3HPO A;  4XRH A;  1HUO A;  1DGS A;  3FDS A;  5AKH A;  4WJ3 B;  4KMU A;  3E58 A;  5J0W A;  2JZB A;  7ICF A;  4NV0 A;  4O3R A;  1ZQK A;  2XGP A;  2JXJ A;  5AKG A;  2XY6 A;  4NLN A;  1S0O A;  4RU9 A;  3Q8Q B;  3QU7 A;  4DFP A;  4JV0 A;  2MA1 A;  4BXO B;  2ZIX A;  2DGZ A;  4DSE A;  5IIO A;  1S0M A;  5ALT A;  8ICB A;  3KHL A;  2HBM A;  2KN7 A;  3WKD A;  2W3R A;  4F5R A;  3ZDA A;  3EZ5 A;  4R66 A;  2KHQ A;  3AQE A;  3MFH A;  5KT4 A;  1QSS A;  4ZH4 A;  1ZXI A;  1X2I A;  1BPY A;  4PHD A;  3U26 A;  3C1Y A;  3H7I A;  4GXK A;  1KQQ A;  1L3T A;  2ZUD A;  2OHF A;  3RTV A;  3CNH A;  5C5J A;  5ALU A;  5KL8 B;  4A8E A;  3C2M A;  4C0Z A;  5AI5 A;  3RJH A;  2W3S A;  8ICK A;  1TAU A;  1L7O A;  1MC8 A;  5KFC A;  4J9L A;  1ZQL A;  4M47 A;  2WB1 C;  3IRU A;  4F72 A;  3EPG A;  5B66 U;  3KKA C;  2A1J B;  4LJX A;  2W9A A;  4NM2 A;  2YX8 A;  9ICG A;  2XO7 A;  3NVY A;  4LVS A;  3UXP A;  4QWC A;  5EE3 A;  3G6Y A;  1NK4 A;  3SI8 A;  1T94 A;  4ECX A;  4USA A;  1JN3 A;  2HHQ A;  5DG9 A;  4PGQ A;  1YT3 A;  4ED7 A;  4EBE A;  7ICN A;  5AK4 A;  1C20 A;  4Y2X A;  2F44 A;  3MR6 A;  2W9M A;  4UQG A;  2OXO A;  4YR3 A;  3RR8 A;  4F5Q A;  2BR0 A;  2K60 A;  5KFO A;  1N60 A;  1TAM A;  4DL3 A;  4CDG A;  5ALR A;  5BOL A;  1ZD4 A;  1LVH A;  3QUQ A;  5AIC A;  3QU4 A;  8ICF A;  2IOF K;  5KAF U;  2ZXH A;  1ECW A;  4F8R A;  2E3T A;  2R8H A;  5CRX A;  2FLL A;  1WWV A;  3BQ1 A;  4GXJ A;  4QWA A;  4R64 A;  4UAT A;  2EAO A;  2EZX A;  2DF4 B;  3AM9 A;  4OJ6 A;  9ICM A;  5J2I A;  1ZQE A;  1N56 A;  2V9W A;  2JHD A;  5KG5 A;  2EQY A;  5D46 A;  1M6Y A;  3PSF A;  2W43 A;  4J9P A;  4GXI A;  3Q8R B;  5KFZ A;  3RAQ A;  4FS2 A;  1XC9 A;  5AHX A;  3CYM A;  2LMR A;  4PZO A;  1MA7 A;  3QX7 A;  1J97 A;  5HP4 A;  3C29 A;  2PFN A;  4UAW A;  5A0L A;  2RDI A;  4CRX A;  2LI6 A;  1Z1B A;  2E8N A;  4BWJ A;  9ICF A;  4KN4 A;  4ICA A;  5KFN A;  2OH2 A;  2HOI A;  5J2G A;  5L1K A;  2BCR A;  1K1S A;  1J2N A;  5J0P A;  4O5E A;  3HT3 A;  1H38 A;  2RRD A;  3GV8 B;  3PW4 A;  2KJ8 A;  3MC1 A;  3IG5 A;  3PX0 A;  4K4I A;  3NRW A;  1B0X A;  4UB2 A;  4RNM A;  4C8K A;  3WK5 A;  4UBB A;  3K4G A;  2HVI A;  3M8R A;  4IC9 A;  2DBY A;  3ALR A;  3RR7 A;  1J2M A;  4FBU A;  1ARO P;  7ICV A;  2DKX A;  1X9W A;  5KFD A;  1D8B A;  5CEH A;  2EAN A;  4OJ5 A;  4ED6 A;  2OEH A;  2R8G A;  3Q8K A;  1XNS A;  1V38 A;  1N62 A;  3MGH A;  1X6J A;  4I2E A;  2YY6 A;  3SV4 A;  4UB8 U;  1PK1 A;  2A3V A;  2CN1 A;  4DO9 A;  5KFL A;  3G6V A;  4RNN A;  4GC7 A;  4DQI A;  1NI3 A;  5KFF A;  2YB4 A;  5BPC A;  2YMM A;  1TFR A;  1IIP A;  4RUA A;  1KSP A;  1PK3 A;  4UB3 A;  5J2C A;  4O3M A;  3A0H U;  3MDA A;  4O3N A;  3M1Y A;  4DL7 A;  3KOO A;  1EXN A;  2UVW A;  3H8M A;  4E0D A;  3JPR A;  2ZUB A;  2BQR A;  8ICC A;  4KLU A;  2VKQ A;  4DL5 A;  1CI4 A;  4AYB C;  2C28 A;  1U49 A;  1DXS A;  4K4H A;  3HWT A;  3C2K A;  1T3N A;  5KT3 A;  4M6W A;  5DGA A;  8ICX A;  1QQ5 A;  1ZQN A;  3WKA A;  5DGB A;  2DWQ A;  1TK5 A;  4QZA A;  8ICU A;  4YMO A;  2F3N A;  2WF7 A;  2E8P A;  2YTU A;  4XA5 A;  5F3X B;  2Q0Z X;  3QU9 A;  2ASJ A;  1KKX A;  3SV3 A;  5KNI A;  3ETR A;  3MGI A;  3TFS A;  3SR6 A;  4UBC A;  1CEZ A;  1XSL A;  1UA0 A;  1NZP A;  2E5S A;  4HYK A;  1RQN A;  4P4P A;  4J9N A;  3THV A;  2EAM A;  4ECR A;  4J9Q A;  2DL0 A;  5JUM A;  3NS1 A;  5DQI A;  1S97 A;  3V6H A;  1RYR A;  5AKZ A;  4O3Q A;  2Y0S F;  4AP9 A;  2E8O A;  1V85 A;  5KT5 A;  3GDX A;  3NRZ A;  5ALH A;  2PXI A;  1HEK A;  3FM9 A;  1QLN A;  3QUC A;  3ISD A;  4YR0 A;  4BWM A;  2WAQ C;  3VCB A;  2AHO B;  1CRX A;  2C2E A;  2KVS A;  2CPR A;  5J2A A;  5G5G A;  4P0P B;  3RH6 A;  5KFB A;  1RQL A;  1ZJM A;  4I2G A;  1NJW A;  4I27 A;  3PML A;  2HVH A;  2ASL A;  1FFV A;  1XSN A;  4B9N A;  4RQN A;  5D4B A;  4EZ6 A;  4QW8 A;  4RQ5 A;  3BS7 A;  4EYI B;  3I28 A;  3PW0 A;  3TAR A;  4OJO A;  5J8Y C;  1SL2 A;  3FYH A;  5ALE A;  4Y2Q A;  5CR0 A;  4QIW C;  1X9M A;  9ICP A;  5KT2 A;  3KZI U;  1B43 A;  2VAN A;  3KZX A;  2IA6 A;  5KFS A;  3OHB A;  3QE9 Y;  3OHA A;  4I2B A;  2I9G A;  1Z00 A;  3BJY A;  4KLH A;  3QUT A;  4RQ2 A;  3ISC A;  1VLB A;  4EEN A;  9ICS A;  2RLT A;  4R8U B;  1S5L U;  2UVR A;  8ICA A;  1DK3 A;  9ICC A;  1TAQ A;  2MUT B;  4J9M A;  3C23 A;  3UQ2 A;  3TAN A;  2WF6 A;  4UB1 A;  4ED1 A;  5KT7 A;  1GO3 F;  4QW9 A;  4IR1 A;  4C4R A;  3NAS A;  1NK5 A;  1D9F A;  1ZQ1 C;  4MFC A;  1ZRN A;  2K4P A;  4DSF A;  5DDY A;  5ALY A;  5IIM A;  3ZD8 A;  9ICK A;  2QAR A;  1TKD A;  2KSO A;  3PST A;  4XQ8 A;  3H8W A;  3LYS A;  5ALI A;  1Z3E B;  7ICR A;  3OGU A;  1JXE A;  4Y2P A;  2P66 A;  4DFK A;  3EW9 A;  3PZP A;  1URJ A;  4M9L A;  3PVX A;  2UVU A;  3QEB Z;  5KAI U;  1BGX T;  5IIL A;  5ALX A;  2XI9 A;  2R8J A;  1COK A;  5AI6 A;  3TKA A;  2W9C B;  4C80 A;  3T5L A;  4BUG A;  1NNL A;  1K1Q A;  2HBL A;  1D8L A;  2JEI A;  4R63 A;  2IOH A;  1MQ3 A;  1QQ7 A;  2ZIX B;  4OCZ A;  3RJI A;  1MQ2 A;  1LKY B;  5HNK A;  5IIN A;  3DDH A;  5B5E U;  1PVQ A;  1X9S A;  3BDP A;  4P0Q A;  4PHP A;  1PVP A;  3WK8 A;  4P0P A;  4UB4 A;  2XC9 A;  4NJ8 A;  1HIW A;  2KKP A;  3K75 D;  2Q4T A;  2E8M A;  1DOQ A;  2AQ0 A;  9ICQ A;  3AEV A;  5ALS A;  4DFD A;  5KFH A;  3O0F A;  4CF5 A;  3B0Y A;  5EE0 A;  4TQR A;  4QZC A;  2F8K A;  5HMM A;  1K5O A;  2R8I A;  1ZQC A;  3ZI4 A;  1XS9 D;  1F44 A;  3M6K A;  4US9 A;  3EPI A;  4Y2V A;  4Q45 A;  2D6F C;  8ICY A;  3HKZ F;  1JMS A;  3SZ2 A;  2F77 X;  2NO5 A;  2CXY A;  4F5O A;  4J03 A;  1X42 A;  1WYG A;  2EH9 A;  5ALV A;  1ZQA A;  1ZQD A;  4F5P A;  1NK8 A;  5HHI A;  1KDH A;  2W7O A;  4M0A A;  4QIW F;  4ZOH C;  8ICG A;  4JWN A;  2OYY A;  2JH1 A;  2DPI A;  1UA1 A;  4F4W A;  4DSI A;  1BPX A;  3L3F X;  2AQ4 A;  2FMP A;  4F4Z A;  2KZZ A;  2QB0 B;  5AI0 A;  2MUT A;  8ICZ A;  2AGQ A;  3UMB A;  2W8K A;  2RHF A;  3NTU A;  4OJP A;  1XO0 A;  2LYA A;  3AU2 A;  5KFY A;  4I2H A;  2HHT A;  4P0Q B;  4Q8F A;  5L1J A;  4ECT A;  4MHV A;  5TIS U;  5DB9 A;  4FZL A;  5DG7 A;  4RQ6 A;  2KD1 A;  1COO A;  3NVW A;  4DL2 A;  3F2B A;  1UCV A;  2XY5 A;  1ZQI A;  7ICO A;  1BPD A;  2G06 A;  2AGP A;  3SEN A;  2WAQ F;  5KFV A;  3J81 j;  3D2Q A;  1V97 A;  4QZD A;  3AUO A;  1SV4 A;  1NZB A;  4C8M A;  5GTH U;  8ICN A;  1U45 A;  4QWD A;  2CRX A;  2G5I B;  5DBA A;  2KK0 A;  4IQV A;  5DG8 A;  4J9S A;  2UVV A;  2E1E A;  2KIW A;  5AI8 A;  4OD0 A;  3RJK A;  2FMS A;  2J6U A;  3M9N B;  9ICN A;  3H0M B;  3KHH A;  3RB6 A;  1PUZ A;  2K4E A;  4NLG A;  1SIJ A;  5C0Y A;  4O3P A;  1N5X A;  2G5H B;  5AKY A;  3C21 A;  2XID A;  3HJE A;  3SAG A;  2PFQ A;  9ICX A;  3H8J A;  3V6K A;  5KFU A;  3T5J A;  2JV3 A;  1WG8 A;  1XWL A;  2FE9 A;  3MR2 A;  3LWM A;  4M9H A;  4KLQ A;  2KFZ A;  4RT3 A;  1ZQG A;  1SWW A;  1NKE A;  4F93 B;  1NJY A;  3TAD A;  2KG5 A;  1B4F A;  5E79 U;  2W03 A;  2Y0S C;  3BQ7 A;  2BPF A;  8ICL A;  4U7C A;  5J0O A;  1ZD5 A;  3OJU A;  4I2C A;  4ELV A;  3SYZ A;  3WK9 A;  1UHU A;  3NGD A;  4C8O A;  1BNO A;  3V7J A;  3Q8P B;  1KFS A;  5EWG A;  3UM9 A;  2K8B B;  4QWE A;  2ODG A;  1DRG A;  3GU3 A;  2J6S A;  4JK1 A;  1ZQQ A;  4ELT A;  1VDV A;  3ZDD A;  5JTI A;  3IG8 A;  1NKC A;  1ZET A;  2KFN A;  2HI0 A;  3MGV A;  4DOC A;  9ICH A;  5DB7 A;  5DKW A;  1JUD A;  5AKE A;  3F2D A;  2G07 A;  4CNQ A;  1SWV A;  2G0A A;  1TV9 A;  2MRL A;  1N2X A;  1ZQP A;  4M9G A;  2LYB A;  4UW9 A;  4YVZ A;  1YZ6 A;  3N97 B;  2ASD A;  2FJ6 A;  2KIV A;  4YN4 A;  1ZQF A;  4JV1 A;  1ZQM A;  3HRD D;  3AMZ A;  4JUZ A;  2PFO A;  4EX7 A;  3PX6 A;  2H3Z A;  2HMX A;  3UXO A;  3RAX A;  4NY8 A;  3TI0 A;  2J6T A;  1UT8 A; 
#chains in the Genus database with same CATH homology
 2F3N A;  4IS7 A;  2E8P A;  2DKZ A;  2YTU A;  2ES6 A;  3K1R B;  2F8K A;  5F3X B;  1SXD A;  1B0X A;  2ESE A;  5KNI A;  2GLE A;  1LKY A;  4PZN A;  2F44 A;  2JV3 A;  2QB0 A;  2FE9 A;  3KKA A;  2EAM A;  2Y9U A;  2DL0 A;  2LPE A;  2K60 A;  3TAD C;  2EAP A;  4NL9 A;  1UQV A;  1X40 A;  2E8O A;  1V85 A;  2K4P A;  2DKX A;  3BS5 B;  3TAD A;  2KG5 A;  1B4F A;  1Z1V A;  2EAN A;  5J8Y A;  3TAC B;  2D3D A;  1V38 A;  2QAR A;  3BQ7 A;  2KSO A;  1WWV A;  1RG6 A;  4RQM A;  1PK1 A;  2EAO A;  2QB0 B;  2KE7 A;  1X66 A;  2QKQ A;  3IDW A;  4MHV A;  1OW5 A;  4RQN A;  1WWU A;  1PK3 A;  1SGG A;  1SV0 A;  5JTI A;  1KW4 A;  1UCV A;  1JI7 A;  3BS7 A;  1COK A;  5J8Y C;  2Y9T A;  3SEN A;  2LMR A;  4PZO A;  1SV4 A;  2QB1 A;  3H8M A;  1SXE A;  1LKY B;  3SEI A;  2KMD A;  3BS5 A;  3HIL A;  5L1M A;  2KIV A;  1DXS A;  2E8N A;  1F0M A;  2D8C A;  3KKA C;  2B6G A;  4NL9 C;  1SV0 C;  2QAR B;  5JRT A;  2KSO B;  4NJ8 A;  1X9X A;  5JU5 A;  2L5Y A;  1OXJ A;  1PK1 B;  2E8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...