5JU5A

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5ju5A00
2EAMA 2QKQA 5JTIA 1V38A 4NJ8A 2F44A 2QB0B 1OW5A 2EAPA 2FE9A 2Y9UA 3BS5A 1X40A 1JI7A 3H8MA 1DXSA 4PZOA 1X66A 2F3NA 2DL0A 1B0XA 2GLEA 1SXDA 3TADA 2ES6A 1UQVA 3BQ7A 2E8MA 2ESEA 1V85A 2YTUA 5JU5A 1B4FA 1LKYB 2E8OA 2Y9TA 1PK3A 1WWVA 1PK1A 2E8PA 3BS5B 2KG5A 1KW4A 5JRTA 1SV0C 3BS7A 2D8CA 2KMDA 5J8YC 2EANA 2JV3A 1OXJA 4PZNA 4RQMA 2F8KA 2QARA 1SGGA 2D3DA 4RQNA 5F3XB 4NL9C 3HILA 2KSOA 1UCVA 4IS7A 3KKAC 2KE7A 1RG6A 5KNIA 2E8NA 2DKZA 2LPEA 3K1RB 1PK1B 2L5YA 2KIVA 2QB0A 1LKYA 1COKA 1SV0A 5J8YA 1Z1VA 4MHVA 3SENA 2QARB 2QB1A 1SXEA 2DKXA 2LMRA 1X9XA 3TADC 1F0MA 3SEIA 2B6GA 4NL9A 1WWUA 2K4PA 2KSOB 2EAOA 5L1MA 2K60A 3TACB 3KKAA 3IDWA 1SV4A
chains in the Genus database with same CATH superfamily
5J2JA 4PHEA 4EELA 1L7NA 1V38A 4NLCA 4RPYA 4QZIA 1F5SA 1YZ6A 5KL8B 2UVRA 2W8KA 4DSJA 3BZCA 2ZIWA 1DXSA 2BHNA 4QZBA 3JPQA 2KEYA 4RUCA 2R8IA 2BPCA 1RYSA 2AH5A 2H3VA 4R63A 1LVHA 4I2GA 4NY8A 4XA5A 3AUOA 5KFIA 2K89A 2KD1A 3Q8RB 2CRXA 1NK8A 1A77A 5DB7A 2ZUBA 5G5HA 4JB3A 2Y9TA 4KLTA 2R8KA 2ZUCA 2P6UA 3EUB2 4FS2A 2AXTU 1NKCA 1KW4A 2KICA 5KFAA 4JV0A 4KLGA 4P0PB 2WB1F 4MF2A 3HX0A 4F5RA 3C1ZA 4F4KA 1ZD5A 2W9AA 4NL9C 4NLZA 4MEYA 9ICGA 3OHAA 3PV8A 2IOFA 5J2BA 2PXIA 1SL0A 1N5XA 2DKZA 3UXNA 4RNNA 2WF8A 3A0HU 2RHFA 3GFKB 2NRXA 1COKA 3ORYA 2Q0ZX 2B21A 3C2MA 3FAHA 5AIAA 3UXOA 2V9WA 4RUAA 4DFPA 1L3VA 1O08A 2Y0SC 2BCUA 2KTQA 4OJ6A 3WK6A 2XY5A 5D4BA 4Q44A 3WK7A 4DL4A 2BCSA 3PSIA 5AKZA 1RYRA 1BPDA 3HWTA 2F44A 5EOZA 3F2CA 3ICXA 1OW5A 1BPXA 1NK7A 2W9BB 2EAPA 4U7CA 1U9LA 4PH5A 1X9WA 5DQHA 2W9CB 2V4RA 4YP3A 1X9SA 4JV1A 4Y2XA 3AU2A 3N7PD 3PR5B 3CYMA 3RJHA 4RNOA 1KDHA 4O5KA 2ISPA 4OJPA 5KG0A 5KFBA 1UPHA 4F91B 4RU9A 2PFNA 2DGZA 4BWJA 1VLBA 4UAUA 3MBYA 2BCRA 4DFJA 1IIPA 4RQ8A 2HDOA 3QUTA 2IA6A 5J8YC 1OXJA 3KBBA 9ICTA 5KAFU 2WFAA 1NI3A 3M7DA 4YMNA 2MUTA 2UVVA 4BXOA 2WB1C 2RDIA 3M8SA 1U48A 2ZJAA 5JUMA 2W11A 3GZFA 3KOOA 3UQ2A 3GU3A 2NV3A 3T5JA 2HHUA 3B9JA 3F2BA 4QZCA 5ALXA 3V6HA 3M6ZA 2Y1IA 4GXJA 4EYIB 5AI6A 4F2SA 4UAYA 3M6KA 5KFJA 1F44A 4UATA 2XICA 2ZXIA 4GXKA 4OCZA 2WHEA 3L3FX 3QEBZ 3M9MB 3V72A 3QZ8A 2HHTA 3ISBA 2YB1A 4F71A 3D2QA 7ICOA 4NLNA 2FI1A 2HHWA 3AQFA 1T4GA 1S0MA 5AKIA 2J6UA 5J2CA 1IXRA 3WK5A 4MF8A 4PGYA 2VJ5A 1SXDA 3EPIA 5KT6A 2XY6A 1ZQKA 4GC7A 1MQ2A 4O3NA 1MC8A 4C8OA 4QZAA 4HYKA 2EDUA 4KN7A 4M0AA 2LM1A 3LYSA 5ALIA 3EYZA 1N63A 2AHOB 5KFNA 1KEJA 5DG8A 2JGAA 5EE3A 5AKLA 2IOHA 5J0UA 2D8CA 4M6WA 1D8BA 4FS1A 4DL3A 1L3TA 4ECWA 1U45A 4DSIA 3FC4A 1TK8A 3IG5A 1D9DA 2ZG6A 4ECYA 3BQ0A 5AKXA 2FMPA 3GIMA 3QUCA 2A1AA 2HW3A 1RG6A 2UVUA 4RQ5A 1JMSA 2JH7A 3RRHA 2VIXA 4M9GA 3GIIA 4J03A 4J9NA 2FLLA 1D9FA 2F77X 1SV0A 4GC6A 2P35A 4ECRA 3C28A 1Z00B 1ZQQA 1H38A 4R66A 2D6FC 3WU2U 3GV8B 2KKPA 1NJZA 8ICKA 3RR7A 2ZXHA 2UVWA 3MC1A 2AJQA 5KT4A 1S5LU 3PW7A 1TK0A 8ICRA 4RT2A 4ZOHC 2A1JA 4EEKA 3SYZA 2OXOA 5J2GA 1ZQGA 2RP5A 3LK9A 4B9LA 1KTQA 3RTVA 4DF8A 5AKEA 8ICMA 4DSEA 3G6XA 5CB1A 4B9TA 4BX9C 3MFIA 3BZKA 1ZQBA 2XC9A 1NK9A 5J2HA 2LI6A 7ICUA 2ZUDA 5ALWA 4YXMA 1NJXA 2K8BB 2I5HA 1QLNA 3C5FA 9ICNA 5KT7A 5C5JA 1DK3A 4YVZA 5K4LA 4DQIA 1BPEA 3SQIA 1VJ5A 3DV9A 4J9SA 3MABA 4C7ZA 1Z4NA 4QIWF 5AK6A 2ODGA 3RAXA 4Y2UA 5DG9A 3L4PA 5F3XB 4ACOA 7ICJA 9ICXA 1T94A 1QH9A 2FDRA 4OO1J 1MA7A 1YT3A 3PY8A 2BR0A 2KV2A 1MQ3A 3MR5A 4M2YA 3SMVA 2W7PA 5AI0A 4JWMA 4FE3A 1JIHA 4G9BA 3TKAA 4UB5A 3C1YA 2HVIA 1S10A 3GIKA 1D8LA 4DSKA 3U26A 1KLNA 4ELTA 1XWLA 3WK8A 4F92B 2P66A 3AM9A 2LMRA 2GH1A 4YN4A 2AGPA 2OEHA 1TVAA 4RZRA 4NM2A 9ICPA 5L1MA 5AICA 4IRKA 4DEZA 5KFHA 2NYVA 3JPTA 5G5GA 5AM5A 2EAMA 3HRDD 3PVXA 4CGZA 1JXEA 3GDXA 2W9MA 2AGOA 4P4PA 1ZQFA 3HT3A 1SKWA 5HHIA 3GILA 2K4IA 5ALDA 4WJ3B 3QUBA 1NKBA 3TFRA 5CJ7A 3M9OB 3F5EA 3ZDBA 2PMZF 8ICYA 3PW4A 1SKSA 1RM6C 3H8WA 5J2DA 4IR9A 4UB3A 1BNOA 1ZQWA 4J9RA 1PK1A 3PSTA 4FFDA 4GFJA 1SV0C 3EPGA 3RJGA 4QJFB 4IL6U 4KLLA 1TFRA 2ISOA 2MAXA 4IQUA 1XC9A 2NO5A 3QXGA 1VDVA 4I29A 4KLHA 1J2NA 4QIWC 8ICOA 2PKEA 5CR0A 3RJFA 3WK9A 2KZZA 3RRGA 3V6JA 4Z6EA 3M1YA 4CRXA 2R18A 3JPNA 3RB3A 1URJA 2JH1A 1S97A 2L5YA 4I2AA 3IP4B 2QB0A 1N56A 4JWNA 2AGQA 3TAQA 3O0FA 5KFLA 1YZ7A 1TV9A 2F1HA 3H0LB 2JXJA 1QQ5A 1Z4OA 4I2IA 1ZETA 4XUSA 4EYHB 4DFKA 2W8LA 4JMUA 4KLDA 5AIBA 3NVWA 1NK0A 2AQ0A 4NJ8A 4R8UA 2DPIA 4A8EA 5KT5A 1RPLA 3T3FA 2GWSA 8ICGA 1NZBA 2JEGA 3E58A 1JI7A 2W3RA 4RNMA 4QWDA 9ICQA 3PO5A 5ALHA 4O3MA 2VA3A 4YMMA 2DL0A 2G06A 1T3QA 2JR5A 2GOLA 4M47A 2GO7A 2KNJA 4RQ6A 4CE6A 5FP0A 1ZQJA 5HP4A 4EBCA 1V85A 2NRTA 1DGSA 8ICNA 5HNKA 3AEVA 1V9PA 3THVA 1ZQLA 2PMZC 9ICFA 2XCAA 3V6KA 3BS5B 2KG5A 1BPYA 3SZ2A 4F4YA 3UM9A 4YR0A 2KKVA 1ZQRA 4Y2PA 5D49A 4F5OA 9ICWA 1ECWA 1KFSA 5BOMA 1B22A 3QNMA 2YQEA 2F1IA 4ED2A 3KHLA 2W43A 3NRZA 1K1SA 1Z19A 5J0OA 3F5AA 3F53A 4P0QA 4ECSA 3PO4A 4Q8EA 4GLXA 4I28A 5DQIA 1K5OA 3KFUF 3QU7A 3K1RB 1NKEA 3HW8A 1O03A 2MU2A 3C23A 1S0NA 3TARA 1XO1A 2AU0A 2ZIUA 4DQQA 2ZIXB 5F9LA 2MSNA 5KFPA 2QARB 3IV6A 1NZPA 1X9XA 4Y2VA 4XRHA 2ZTDA 2R8HA 1WWUA 3HP6A 5TISU 5KFZA 2PFPA 2CXYA 9ICRA 3KKAA 1N2XA 4C8LA 4KLQA 3IDWA 1L8LA 1FFVA 4PHAA 4TUQA 5HR7A 3RJEA 8ICXA 1ZXIA 1L6NA 2V4QA 3GV7B 4UAWA 3NVYA 4QNLA 1ZD4A 3CW2C 5L1LA 3I76A 1J2MA 3S6JA 2GLEA 7ICKA 3RH5A 4KLJA 4HAIA 4UQGA 4NLGA 5ALYA 3ZDEA 3OHBA 2R8GA 2ASDA 7ICFA 1JRPA 3ALRA 3ETLA 4NXZA 2J6SA 1QSSA 4USAA 4DS4A 2KP7A 4RT3A 1BVSA 1ZQSA 2PFOA 5AM3A 4I2HA 1RDFA 3BS7A 4EBDA 3MGVA 4EX7A 1Q46A 5AI8A 2G5IB 1ZD2P 1SGGA 3RH4A 4I2EA 1ZD3A 4R65A 1CUKA 4IS7A 2HVHA 3EW9A 4UB8U 3TFSA 3PW2A 2KHVA 1KKXA 4GIBA 1S9FA 1NK6A 3PX4A 5B5EU 2KOBA 3AQEA 2YMMA 1XS9D 2OM6A 3FDSA 2ZTEA 1Z1VA 3UQ0A 3CNHA 4FZLA 4QW9A 4UBCA 4ED7A 4UARA 1IV8A 2KZMA 3H0RB 1F0MA 3SEIA 1PVPA 2FLPA 3SAFA 3JPPA 4ECXA 1HEKA 4F5QA 4CDGA 4EZ6A 2DQNB 1KBUA 1Q3UA 9ICVA 2BGWA 4I2FA 5A0LA 1BGXT 2LYAA 1BPBA 4O3OA 9ICIA 4KITB 5IIJA 4PJ0U 5J0QA 1K1QA 2Y9UA 2G08A 1FEZA 1RQLA 7ICTA 4PZOA 3EWAA 1ZQMA 2I9GA 2CN1A 8ICBA 3ZI4A 5J2EA 2WF6A 4ICAA 4YR2A 5KFTA 4B9UA 1A76A 5HHHA 1UQVA 3NVVA 5AKKA 4DL7A 8ICUA 5AKYA 4F50A 2E8MA 2A3VA 4O3PA 3PW5A 4IRDA 2YTUA 4LJXA 3QZ7A 5ALMA 4M04A 3JPRA 4Q43A 3ISDA 2ZIWB 2OWOA 2W3SA 4F8RA 3AL0B 2WF7A 5KT3A 4NV0A 5KFYA 1SKRA 3MDCA 4JV2A 4DO9A 2HHVA 2DBYA 2KSOA 2G09A 1BNPA 3KKAC 8ICQA 1S0VA 2H3ZA 2ZIVA 4KN4A 3D2SA 2XGPA 1T7PA 2JZBA 3H4BA 4B9VA 4C8KA 9ICLA 3BQ2A 4BWMA 4ED0A 2EH9A 3H8SA 5IIKA 9ICKA 4DQRA 3ONNA 3NASA 1C20A 1X42A 2KZ3A 1N48A 3B0YA 1U4BA 2IHMA 3N28A 2K60A 5ALKA 5DGBA 1CI4A 1ZQUA 2NRZA 1QSYA 1KRPA 3MDAA 2IMWP 3QU9A 4DF4A 1PUZA 3T5LA 4QZDA 1U49A 4IR1A 3RJJA 4O9MA 8ICLA 4RQ1A 4J9KA 1WYGA 1NJWA 3A0BU 1GO3F 5DB9A 3IRUA 3N7SC 1FO4A 3IN5A 3H8JA 1B0XA 2BQRA 3E2EA 4UASA 2ES6A 2K8CB 3F2DA 8ICHA 3WKCA 4DWIA 4RPXA 4DLEA 2H3IA 2EQYA 4K4GA 5KFWA 2ZJ5A 5AM2A 8ICSA 1ZQZA 5DDMA 3KD3A 4K4HA 5KFKA 1NOMA 2HI0A 3BDPA 5DBAA 3ZD9A 2AQ4A 5CEHA 1RZTA 3MGIA 5KFFA 5J0SA 3D2NA 3GQCA 4DOAA 2NRVA 3RJKA 1QCKA 1JN3A 8ICIA 4DCCA 1KFDA 8ICVA 3MR3A 4UB2A 2EZXA 3RR8A 1DRGA 3K75D 3KZXA 4ED1A 5KG3A 2MA1A 4OJ5A 4NLKA 5J0YA 3T5KA 4UB6U 4KMUA 1Q8KA 4DLGA 2E1EA 4DSFA 3NGDA 5ALPA 2IHNA 5J0PA 4K4IA 4LVSA 2VA2A 8ICPA 1N60A 1TKDA 3SV3A 5GTIU 2F2AB 4NWIA 2MRLA 2B6GA 5AKGA 2MUTB 3PNCA 1IG6A 2DF4B 2F8LA 3PMNA 2EAOA 4BXOB 4QZGA 8ICFA 4Y2QA 3HPOA 3NS1A 4MEXA 4J9MA 4P4OA 7ICMA 4QZ8A 2EZYA 3WKAA 2JEJA 4F2RA 3IG8A 3LWLA 3QYPA 3RJIA 4O3SA 4ED6A 4M9JA 1RXWA 2HBKA 5KG6A 3RBDA 1CRXA 5L1JA 4O5EA 2Z7JA 2F3NA 4DL5A 4DL6A 4P0PA 4Y2YA 3QX7A 3KHHA 4O3QA 4IQTA 2XI9A 4IQWA 4KX5A 1L7PA 3Q8KA 3RB6A 4PPXA 4RQ3A 2ASJA 2FPKA 2O6KA 2KJ9A 3SAGA 4I2JA 4QZHA 2HSZA 4CF3A 1NNLA 1UT5A 2WAQF 4ZH4A 3H7IA 2FPLA 3MGHA 2C28A 3AU6A 4CF5A 4MFCA 5AHXA 4US8A 5BPCA 4LZGA 3V7LA 3UPQA 1OUQA 5EE1A 5HMLA 2P6RA 2HHSA 7ICLA 2ASLA 2HOFA 8ICEA 1ZRMA 2HBLA 2LBOA 2NRWA 1HIWA 3CP8A 3FYHA 3Q8PB 4EBEA 4UAZA 4XQ8A 1X6JA 1ZJNA 1HUOA 2BQUA 4C8MA 4F72A 1ZQCA 1UA1A 2G0AA 2W9BA 2KK0A 3HJEA 9ICSA 3QU5A 3QU4A 3ZD8A 4M6WB 1Q3VA 2W9CA 5CWRA 1SL1A 3QU2A 5AM0A 1KN5A 2QB1A 1SXEA 8ICAA 5KFUA 4Y2JA 3AMZA 3R9KA 4JK1A 3I1YA 1FFUA 1XSPA 3LDAA 3JPOA 1KSPA 2PI4A 1V97A 2OCEA 5AM4A 3OTQA 4ECTA 4QWAA 4ECQA 4GXIA 9ICBA 5ALVA 2LKYA 1WCNA 4P2HA 2KVSA 2E5SA 3H8MA 1JXLA 2XVTA 1X66A 1AQ6A 1L3UA 1COOA 2NO4A 3SD7A 3M9NB 3RFAA 1ZQVA 4O5CA 5DG7A 3RB0A 5AI9A 3BQ7A 1JROA 1B43A 4C4TA 2A1JB 2ESEA 1M6YA 3GIJA 1B4FA 1LKYB 4P4MA 4C4SA 4BDPA 2E8OA 4UB1A 4QWEA 3GV5B 1L3SA 3RH6A 5JRTA 1N62A 3N4MB 1NK4A 2Y1JA 4EZ9A 4DQPA 5KFSA 4MFAA 3OJSA 2RQ5A 2WAQC 4RQNA 4DOCA 3ZDDA 1ZJMA 3E0FA 1L8OA 4QW8A 3RAQA 4OD0A 1ZRNA 5KFOA 8ICCA 3SI8A 1ZQYA 5ALFA 2KE7A 5ALSA 2EZZA 1LV5A 1XSLA 1IM4A 4AYBF 1ZOLA 4ED8A 3UMCA 1A6SA 5J0RA 5HR6A 5ALEA 2G5HB 4J9QA 4J9LA 4F3OA 2KFZA 1X9MA 4U6PA 2KJ5A 4I27A 1LB2B 4ELUA 4TUSA 2RRDA 3TACB 2HOQA 2F1JA 5EE9A 1TAUA 1DGJA 3L5KA 4RQ7A 2XIDA 5KFXA 2FE9A 1ZQEA 3BQTA 5DDYA 4YCXA 5GTHU 3T79A 5ALGA 3C2LA 5AK4A 1JX4A 2CPRA 3TANA 4UW9A 3TADA 1UT8A 4ECUA 3M8RA 2E1FA 4PGQA 1ZQHA 4FBTA 5KFDA 3QUQA 5KFGA 4C7YA 2BZFA 4QWBA 4IC9A 2E8PA 2W03A 5KG2A 4EENA 3K1ZA 4YD2A 4G3IA 1Y88A 2PI5A 3NUQA 5E79U 3D6JA 1Z00A 5J29A 2QLTA 2HBMA 2IBKA 4M9HA 2C2DA 1X6IA 2Q4TA 1SWWA 3PZPA 3QEAZ 1HUZA 1SZHA 4Q45A 3G6VA 2C2EA 4IQVA 4DFMA 3Q8QB 1PK1B 5CP2A 3WKBA 1TE2A 2YX8A 2JHDA 2B0CA 2HCFA 4AYBC 3RB4A 1KL9A 5CRXA 4EX6A 2XO7A 2HHXA 5IINA 4KLSA 3SR6A 1ZQPA 5ALNA 1S77D 3I28A 3KTQA 4RPZA 5KG1A 3KHGA 1UA0A 1JUDA 2VJ4A 1ZQXA 4NM1A 9ICJA 1S8OA 3TQ1A 1AROP 5JTIA 2QKQA 5ALQA 3H4DA 3T5HA 5KFRA 2BCVA 5C0YA 4F5NA 4F5PA 2QB0B 1S76D 1X40A 5EWFA 4BGDA 2JEFA 3MR2A 2ATLA 5KTQA 2IOFK 3SV4A 5B66U 2VKQA 4IRCA 1ZQ1C 3FM9A 1TK5A 5AKHA 3KHRA 4DQSA 9ICCA 3VCBA 7ICQA 2F76X 4O0IA 5CA7A 4C4RA 2LYHA 1WCLA 2JMGA 3PSFA 4KLMA 3ED5A 4EEYA 4R8UB 5AI5A 4YR3A 2RLTA 3H40A 8ICZA 1P7DA 1EXNA 4ECVA 9ICOA 2FMQA 4PHDA 3B0XA 2FLNA 4Y2SA 4YFKA 3JPSA 3TI0A 2BDUA 2VANA 5ALJA 4RQMA 2F8KA 3DDHA 8ICJA 1KFTA 5IILA 4UBBA 2BPFA 4KLFA 5D46A 4ED3A 7ICRA 5T14A 4PHPA 2BCQA 2YB4A 3TAPA 2W54A 3K4GA 5KNIA 1C7YA 4O3RA 2LPEA 5KG5A 1RYUA 2YMPA 1XNSA 5DQGA 4DS5A 4TQRA 2DPJA 3BQ1A 5DBBA 2I6XA 9ICAA 1D8YA 3KZIU 2FMSA 2HOIA 3N97B 1ZQIA 2DKXA 1J97A 2G07A 3TADC 2HHQA 2C22A 5F9NA 7ICSA 4RQ4A 2HMXA 1L7OA 3SAHA 4P0QB 4KLEA 4DFDA 5ALLA 3V7JA 5EWEA 5EE0A 2KJ8A 2OYYA 3WK4A 3C29A 2LHTA 4C8NA 4UB4A 3NVZA 1XO0A 5DLGA 2ZIUB 3WKEA 2K4EA 2OH2A 2DUYA 4ECZA 5AK5A 3OSPA 5KG7A 4B9MA 1FIQA 4TQSA 2WTFA 2KVCA 3RF9A 5DKWA 2N1RA 4PL1A 1L7MA 1SIJA 1PVQA 4F4WA 2YMQA 3OSNA 4M9LA 3CRXA 8ICTA 3LWMA 4DSLA 1XU4A 3BJYA 1TAQA 7ICPA 5AK3A 2EANA 2H5XA 4KLUA 5ALTA 5KFVA 1WUDA 4YG2A 1A0PA 5L1KA 4Y2RA 3PX6A 4Z6CA 5DGAA 4C0ZA 5KFQA 3HILA 5J2IA 1UCVA 3PSPA 3OPXA 4B6JA 2E3TA 9ICUA 2YMLA 4M9NA 3H0MB 4YXJA 2VA8A 1SL2A 2BPGA 1SZPA 1RQNA 1LKYA 4MHVA 9ICEA 1N61A 3SENA 5ALUA 3C2KA 3J81j 4RQ0A 1T8EA 4Q8FA 2KHQA 3IM1A 4X5VA 2XGQA 3QE9Y 7ICGA 5KG4A 2LYBA 1QSLA 5DB8A 4FBUA 4C80A 1SV4A 2KN7A 3PX0A 2M0NA 5J2FA 5L9XA 2BDPA 4TUPA 3BS5A 1N5WA 5CHGA 3Q8MA 4CF4A 1KQQA 4DOBA 2ZJ8A 5IIIA 1ED1A 3PR4A 3NRWA 1ZQTA 3IHQB 4B9NA 1HJPA 4YQWA 2YN4A 5DB6A 4QWCA 4PGXA 1Z3EB 4PL2A 3UMGA 5IIOA 1U47A 4J9PA 1MSWD 3ETRA 4YMOA 5BOLA 4J9OA 5KFCA 4CCHA 5J0WA 2XCPA 2KFNA 5JU5A 3MR6A 5IIMA 4JUZA 1PK3A 1WWVA 3Q8LA 1JALA 2RDJA 1XSNA 3OGUA 4FZNA 9ICHA 5ALRA 2W55A 1Z1BA 1NK5A 3HKZF 2ZIXA 4KLIA 4E0DA 3NTUA 4QZ9A 2QARA 2D3DA 4F4XA 2JRZA 2ZTCA 3EZ5A 3LVVA 5ALOA 3RBEA 7ICNA 5AM1A 4B9SA 5KL1B 5TZVA 4KLOA 2BKEA 4BUGA 1QQ6A 2E8NA 2DWQA 3Q8SB 1S0OA 5KFEA 2K8AA 4KMOB 5H2FU 1ZQNA 2A19A 2KIVA 2JEIA 4I2DA 4AP9A 3C5GA 3PW0A 2H3FA 3MFHA 5J2KA 4F93B 5J0TA 3PMLA 3LVWA 2OHFA 2W04A 1MN8A 3OJUA 1L5UA 1PZNA 3UXPA 4NL9A 2K4PA 2KSOB 7ICHA 5L1IA 9ICMA 5EWGA 5DBCA 4KTQA 2ZIVB 2JZBB 4Z6FA 4QZEA 4F4ZA 4NLBA 4BJQA 7ICIA 4UAVA 2YY6A 1X2IA 1ZQDA 1WG8A 1BPZA 4QZFA 5ALZA 3UMBA 1SB3C 3DEEA 3C21A 2FJ6A 2BQ3A 4ELVA 4MFFA 2PFQA 4DL2A 1T3NA 1CEZA 5AKJA 4US9A 4YD1A 1TAMA 4OJLA 3ZDAA 8ICWA 4KX3A 1NJYA 2W7OA 2M9NA 1QQ7A 5HMMA 3V7KA 3ISCA 2KMDA 4CNQA 2WF9A 2JV3A 4PZNA 2XY7A 2I1QA 4LZDA 4RQ2A 2ALZA 2KIWA 3G6YA 2LM4A 2DFLA 4R64A 4Z6DA 1ZQAA 3HKZC 1SWVA 5J0XA 5KFMA 2WF5A 1DOQA 5AI4A 3ZDCA 7ICEA 2C2RA 2FPMA 1RXVA 1QTMA 2K4HA 4I2CA 5DLFA 2Y0SF 4FZMA 5J8YA 4Y2TA 1PVRA 2J6TA 4FO6A 2R8JA 3WKDA 5KAIU 3N7RC 3VC8A 5KT2A 4OJOA 5J2AA 1ZQOA 4TURA 4I2BA 1UHUA 2H3QA 2HBJA 1ZYQA 3AN1A 1DK2A 7ICVA
chains in the Genus database with same CATH topology
2EAMA 2QKQA 5JTIA 1V38A 4NJ8A 2F44A 2QB0B 1OW5A 2EAPA 2FE9A 2Y9UA 3BS5A 1X40A 1JI7A 3H8MA 1DXSA 4PZOA 1X66A 2F3NA 2DL0A 1B0XA 2GLEA 1SXDA 3TADA 2ES6A 1UQVA 3BQ7A 2E8MA 2ESEA 1V85A 2YTUA 5JU5A 1B4FA 1LKYB 2E8OA 2Y9TA 1PK3A 1WWVA 1PK1A 2E8PA 3BS5B 2KG5A 1KW4A 5JRTA 1SV0C 3BS7A 2D8CA 2KMDA 5J8YC 2EANA 2JV3A 1OXJA 4PZNA 4RQMA 2F8KA 2QARA 1SGGA 2D3DA 4RQNA 5F3XB 4NL9C 3HILA 2KSOA 1UCVA 4IS7A 3KKAC 2KE7A 1RG6A 5KNIA 2E8NA 2DKZA 2LPEA 3K1RB 1PK1B 2L5YA 2KIVA 2QB0A 1LKYA 1COKA 1SV0A 5J8YA 1Z1VA 4MHVA 3SENA 2QARB 2QB1A 1SXEA 2DKXA 2LMRA 1X9XA 3TADC 1F0MA 3SEIA 2B6GA 4NL9A 1WWUA 2K4PA 2KSOB 2EAOA 5L1MA 2K60A 3TACB 3KKAA 3IDWA 1SV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAM A;  2QKQ A;  5JTI A;  1V38 A;  4NJ8 A;  2F44 A;  2QB0 B;  1OW5 A;  2EAP A;  2FE9 A;  2Y9U A;  3BS5 A;  1X40 A;  1JI7 A;  3H8M A;  1DXS A;  4PZO A;  1X66 A;  2F3N A;  2DL0 A;  1B0X A;  2GLE A;  1SXD A;  3TAD A;  2ES6 A;  1UQV A;  3BQ7 A;  2E8M A;  2ESE A;  1V85 A;  2YTU A;  5JU5 A;  1B4F A;  1LKY B;  2E8O A;  2Y9T A;  1PK3 A;  1WWV A;  1PK1 A;  2E8P A;  3BS5 B;  2KG5 A;  1KW4 A;  5JRT A;  1SV0 C;  3BS7 A;  2D8C A;  2KMD A;  5J8Y C;  2EAN A;  2JV3 A;  1OXJ A;  4PZN A;  4RQM A;  2F8K A;  2QAR A;  1SGG A;  2D3D A;  4RQN A;  5F3X B;  4NL9 C;  3HIL A;  2KSO A;  1UCV A;  4IS7 A;  3KKA C;  2KE7 A;  1RG6 A;  5KNI A;  2E8N A;  2DKZ A;  2LPE A;  3K1R B;  1PK1 B;  2L5Y A;  2KIV A;  2QB0 A;  1LKY A;  1COK A;  1SV0 A;  5J8Y A;  1Z1V A;  4MHV A;  3SEN A;  2QAR B;  2QB1 A;  1SXE A;  2DKX A;  2LMR A;  1X9X A;  3TAD C;  1F0M A;  3SEI A;  2B6G A;  4NL9 A;  1WWU A;  2K4P A;  2KSO B;  2EAO A;  5L1M A;  2K60 A;  3TAC B;  3KKA A;  3IDW A;  1SV4 A; 
#chains in the Genus database with same CATH topology
 5J2J A;  4PHE A;  4EEL A;  1L7N A;  1V38 A;  4NLC A;  4RPY A;  4QZI A;  1F5S A;  1YZ6 A;  5KL8 B;  2UVR A;  2W8K A;  4DSJ A;  3BZC A;  2ZIW A;  1DXS A;  2BHN A;  4QZB A;  3JPQ A;  2KEY A;  4RUC A;  2R8I A;  2BPC A;  1RYS A;  2AH5 A;  2H3V A;  4R63 A;  1LVH A;  4I2G A;  4NY8 A;  4XA5 A;  3AUO A;  5KFI A;  2K89 A;  2KD1 A;  3Q8R B;  2CRX A;  1NK8 A;  1A77 A;  5DB7 A;  2ZUB A;  5G5H A;  4JB3 A;  2Y9T A;  4KLT A;  2R8K A;  2ZUC A;  2P6U A;  3EUB 2;  4FS2 A;  2AXT U;  1NKC A;  1KW4 A;  2KIC A;  5KFA A;  4JV0 A;  4KLG A;  4P0P B;  2WB1 F;  4MF2 A;  3HX0 A;  4F5R A;  3C1Z A;  4F4K A;  1ZD5 A;  2W9A A;  4NL9 C;  4NLZ A;  4MEY A;  9ICG A;  3OHA A;  3PV8 A;  2IOF A;  5J2B A;  2PXI A;  1SL0 A;  1N5X A;  2DKZ A;  3UXN A;  4RNN A;  2WF8 A;  3A0H U;  2RHF A;  3GFK B;  2NRX A;  1COK A;  3ORY A;  2Q0Z X;  2B21 A;  3C2M A;  3FAH A;  5AIA A;  3UXO A;  2V9W A;  4RUA A;  4DFP A;  1L3V A;  1O08 A;  2Y0S C;  2BCU A;  2KTQ A;  4OJ6 A;  3WK6 A;  2XY5 A;  5D4B A;  4Q44 A;  3WK7 A;  4DL4 A;  2BCS A;  3PSI A;  5AKZ A;  1RYR A;  1BPD A;  3HWT A;  2F44 A;  5EOZ A;  3F2C A;  3ICX A;  1OW5 A;  1BPX A;  1NK7 A;  2W9B B;  2EAP A;  4U7C A;  1U9L A;  4PH5 A;  1X9W A;  5DQH A;  2W9C B;  2V4R A;  4YP3 A;  1X9S A;  4JV1 A;  4Y2X A;  3AU2 A;  3N7P D;  3PR5 B;  3CYM A;  3RJH A;  4RNO A;  1KDH A;  4O5K A;  2ISP A;  4OJP A;  5KG0 A;  5KFB A;  1UPH A;  4F91 B;  4RU9 A;  2PFN A;  2DGZ A;  4BWJ A;  1VLB A;  4UAU A;  3MBY A;  2BCR A;  4DFJ A;  1IIP A;  4RQ8 A;  2HDO A;  3QUT A;  2IA6 A;  5J8Y C;  1OXJ A;  3KBB A;  9ICT A;  5KAF U;  2WFA A;  1NI3 A;  3M7D A;  4YMN A;  2MUT A;  2UVV A;  4BXO A;  2WB1 C;  2RDI A;  3M8S A;  1U48 A;  2ZJA A;  5JUM A;  2W11 A;  3GZF A;  3KOO A;  3UQ2 A;  3GU3 A;  2NV3 A;  3T5J A;  2HHU A;  3B9J A;  3F2B A;  4QZC A;  5ALX A;  3V6H A;  3M6Z A;  2Y1I A;  4GXJ A;  4EYI B;  5AI6 A;  4F2S A;  4UAY A;  3M6K A;  5KFJ A;  1F44 A;  4UAT A;  2XIC A;  2ZXI A;  4GXK A;  4OCZ A;  2WHE A;  3L3F X;  3QEB Z;  3M9M B;  3V72 A;  3QZ8 A;  2HHT A;  3ISB A;  2YB1 A;  4F71 A;  3D2Q A;  7ICO A;  4NLN A;  2FI1 A;  2HHW A;  3AQF A;  1T4G A;  1S0M A;  5AKI A;  2J6U A;  5J2C A;  1IXR A;  3WK5 A;  4MF8 A;  4PGY A;  2VJ5 A;  1SXD A;  3EPI A;  5KT6 A;  2XY6 A;  1ZQK A;  4GC7 A;  1MQ2 A;  4O3N A;  1MC8 A;  4C8O A;  4QZA A;  4HYK A;  2EDU A;  4KN7 A;  4M0A A;  2LM1 A;  3LYS A;  5ALI A;  3EYZ A;  1N63 A;  2AHO B;  5KFN A;  1KEJ A;  5DG8 A;  2JGA A;  5EE3 A;  5AKL A;  2IOH A;  5J0U A;  2D8C A;  4M6W A;  1D8B A;  4FS1 A;  4DL3 A;  1L3T A;  4ECW A;  1U45 A;  4DSI A;  3FC4 A;  1TK8 A;  3IG5 A;  1D9D A;  2ZG6 A;  4ECY A;  3BQ0 A;  5AKX A;  2FMP A;  3GIM A;  3QUC A;  2A1A A;  2HW3 A;  1RG6 A;  2UVU A;  4RQ5 A;  1JMS A;  2JH7 A;  3RRH A;  2VIX A;  4M9G A;  3GII A;  4J03 A;  4J9N A;  2FLL A;  1D9F A;  2F77 X;  1SV0 A;  4GC6 A;  2P35 A;  4ECR A;  3C28 A;  1Z00 B;  1ZQQ A;  1H38 A;  4R66 A;  2D6F C;  3WU2 U;  3GV8 B;  2KKP A;  1NJZ A;  8ICK A;  3RR7 A;  2ZXH A;  2UVW A;  3MC1 A;  2AJQ A;  5KT4 A;  1S5L U;  3PW7 A;  1TK0 A;  8ICR A;  4RT2 A;  4ZOH C;  2A1J A;  4EEK A;  3SYZ A;  2OXO A;  5J2G A;  1ZQG A;  2RP5 A;  3LK9 A;  4B9L A;  1KTQ A;  3RTV A;  4DF8 A;  5AKE A;  8ICM A;  4DSE A;  3G6X A;  5CB1 A;  4B9T A;  4BX9 C;  3MFI A;  3BZK A;  1ZQB A;  2XC9 A;  1NK9 A;  5J2H A;  2LI6 A;  7ICU A;  2ZUD A;  5ALW A;  4YXM A;  1NJX A;  2K8B B;  2I5H A;  1QLN A;  3C5F A;  9ICN A;  5KT7 A;  5C5J A;  1DK3 A;  4YVZ A;  5K4L A;  4DQI A;  1BPE A;  3SQI A;  1VJ5 A;  3DV9 A;  4J9S A;  3MAB A;  4C7Z A;  1Z4N A;  4QIW F;  5AK6 A;  2ODG A;  3RAX A;  4Y2U A;  5DG9 A;  3L4P A;  5F3X B;  4ACO A;  7ICJ A;  9ICX A;  1T94 A;  1QH9 A;  2FDR A;  4OO1 J;  1MA7 A;  1YT3 A;  3PY8 A;  2BR0 A;  2KV2 A;  1MQ3 A;  3MR5 A;  4M2Y A;  3SMV A;  2W7P A;  5AI0 A;  4JWM A;  4FE3 A;  1JIH A;  4G9B A;  3TKA A;  4UB5 A;  3C1Y A;  2HVI A;  1S10 A;  3GIK A;  1D8L A;  4DSK A;  3U26 A;  1KLN A;  4ELT A;  1XWL A;  3WK8 A;  4F92 B;  2P66 A;  3AM9 A;  2LMR A;  2GH1 A;  4YN4 A;  2AGP A;  2OEH A;  1TVA A;  4RZR A;  4NM2 A;  9ICP A;  5L1M A;  5AIC A;  4IRK A;  4DEZ A;  5KFH A;  2NYV A;  3JPT A;  5G5G A;  5AM5 A;  2EAM A;  3HRD D;  3PVX A;  4CGZ A;  1JXE A;  3GDX A;  2W9M A;  2AGO A;  4P4P A;  1ZQF A;  3HT3 A;  1SKW A;  5HHI A;  3GIL A;  2K4I A;  5ALD A;  4WJ3 B;  3QUB A;  1NKB A;  3TFR A;  5CJ7 A;  3M9O B;  3F5E A;  3ZDB A;  2PMZ F;  8ICY A;  3PW4 A;  1SKS A;  1RM6 C;  3H8W A;  5J2D A;  4IR9 A;  4UB3 A;  1BNO A;  1ZQW A;  4J9R A;  1PK1 A;  3PST A;  4FFD A;  4GFJ A;  1SV0 C;  3EPG A;  3RJG A;  4QJF B;  4IL6 U;  4KLL A;  1TFR A;  2ISO A;  2MAX A;  4IQU A;  1XC9 A;  2NO5 A;  3QXG A;  1VDV A;  4I29 A;  4KLH A;  1J2N A;  4QIW C;  8ICO A;  2PKE A;  5CR0 A;  3RJF A;  3WK9 A;  2KZZ A;  3RRG A;  3V6J A;  4Z6E A;  3M1Y A;  4CRX A;  2R18 A;  3JPN A;  3RB3 A;  1URJ A;  2JH1 A;  1S97 A;  2L5Y A;  4I2A A;  3IP4 B;  2QB0 A;  1N56 A;  4JWN A;  2AGQ A;  3TAQ A;  3O0F A;  5KFL A;  1YZ7 A;  1TV9 A;  2F1H A;  3H0L B;  2JXJ A;  1QQ5 A;  1Z4O A;  4I2I A;  1ZET A;  4XUS A;  4EYH B;  4DFK A;  2W8L A;  4JMU A;  4KLD A;  5AIB A;  3NVW A;  1NK0 A;  2AQ0 A;  4NJ8 A;  4R8U A;  2DPI A;  4A8E A;  5KT5 A;  1RPL A;  3T3F A;  2GWS A;  8ICG A;  1NZB A;  2JEG A;  3E58 A;  1JI7 A;  2W3R A;  4RNM A;  4QWD A;  9ICQ A;  3PO5 A;  5ALH A;  4O3M A;  2VA3 A;  4YMM A;  2DL0 A;  2G06 A;  1T3Q A;  2JR5 A;  2GOL A;  4M47 A;  2GO7 A;  2KNJ A;  4RQ6 A;  4CE6 A;  5FP0 A;  1ZQJ A;  5HP4 A;  4EBC A;  1V85 A;  2NRT A;  1DGS A;  8ICN A;  5HNK A;  3AEV A;  1V9P A;  3THV A;  1ZQL A;  2PMZ C;  9ICF A;  2XCA A;  3V6K A;  3BS5 B;  2KG5 A;  1BPY A;  3SZ2 A;  4F4Y A;  3UM9 A;  4YR0 A;  2KKV A;  1ZQR A;  4Y2P A;  5D49 A;  4F5O A;  9ICW A;  1ECW A;  1KFS A;  5BOM A;  1B22 A;  3QNM A;  2YQE A;  2F1I A;  4ED2 A;  3KHL A;  2W43 A;  3NRZ A;  1K1S A;  1Z19 A;  5J0O A;  3F5A A;  3F53 A;  4P0Q A;  4ECS A;  3PO4 A;  4Q8E A;  4GLX A;  4I28 A;  5DQI A;  1K5O A;  3KFU F;  3QU7 A;  3K1R B;  1NKE A;  3HW8 A;  1O03 A;  2MU2 A;  3C23 A;  1S0N A;  3TAR A;  1XO1 A;  2AU0 A;  2ZIU A;  4DQQ A;  2ZIX B;  5F9L A;  2MSN A;  5KFP A;  2QAR B;  3IV6 A;  1NZP A;  1X9X A;  4Y2V A;  4XRH A;  2ZTD A;  2R8H A;  1WWU A;  3HP6 A;  5TIS U;  5KFZ A;  2PFP A;  2CXY A;  9ICR A;  3KKA A;  1N2X A;  4C8L A;  4KLQ A;  3IDW A;  1L8L A;  1FFV A;  4PHA A;  4TUQ A;  5HR7 A;  3RJE A;  8ICX A;  1ZXI A;  1L6N A;  2V4Q A;  3GV7 B;  4UAW A;  3NVY A;  4QNL A;  1ZD4 A;  3CW2 C;  5L1L A;  3I76 A;  1J2M A;  3S6J A;  2GLE A;  7ICK A;  3RH5 A;  4KLJ A;  4HAI A;  4UQG A;  4NLG A;  5ALY A;  3ZDE A;  3OHB A;  2R8G A;  2ASD A;  7ICF A;  1JRP A;  3ALR A;  3ETL A;  4NXZ A;  2J6S A;  1QSS A;  4USA A;  4DS4 A;  2KP7 A;  4RT3 A;  1BVS A;  1ZQS A;  2PFO A;  5AM3 A;  4I2H A;  1RDF A;  3BS7 A;  4EBD A;  3MGV A;  4EX7 A;  1Q46 A;  5AI8 A;  2G5I B;  1ZD2 P;  1SGG A;  3RH4 A;  4I2E A;  1ZD3 A;  4R65 A;  1CUK A;  4IS7 A;  2HVH A;  3EW9 A;  4UB8 U;  3TFS A;  3PW2 A;  2KHV A;  1KKX A;  4GIB A;  1S9F A;  1NK6 A;  3PX4 A;  5B5E U;  2KOB A;  3AQE A;  2YMM A;  1XS9 D;  2OM6 A;  3FDS A;  2ZTE A;  1Z1V A;  3UQ0 A;  3CNH A;  4FZL A;  4QW9 A;  4UBC A;  4ED7 A;  4UAR A;  1IV8 A;  2KZM A;  3H0R B;  1F0M A;  3SEI A;  1PVP A;  2FLP A;  3SAF A;  3JPP A;  4ECX A;  1HEK A;  4F5Q A;  4CDG A;  4EZ6 A;  2DQN B;  1KBU A;  1Q3U A;  9ICV A;  2BGW A;  4I2F A;  5A0L A;  1BGX T;  2LYA A;  1BPB A;  4O3O A;  9ICI A;  4KIT B;  5IIJ A;  4PJ0 U;  5J0Q A;  1K1Q A;  2Y9U A;  2G08 A;  1FEZ A;  1RQL A;  7ICT A;  4PZO A;  3EWA A;  1ZQM A;  2I9G A;  2CN1 A;  8ICB A;  3ZI4 A;  5J2E A;  2WF6 A;  4ICA A;  4YR2 A;  5KFT A;  4B9U A;  1A76 A;  5HHH A;  1UQV A;  3NVV A;  5AKK A;  4DL7 A;  8ICU A;  5AKY A;  4F50 A;  2E8M A;  2A3V A;  4O3P A;  3PW5 A;  4IRD A;  2YTU A;  4LJX A;  3QZ7 A;  5ALM A;  4M04 A;  3JPR A;  4Q43 A;  3ISD A;  2ZIW B;  2OWO A;  2W3S A;  4F8R A;  3AL0 B;  2WF7 A;  5KT3 A;  4NV0 A;  5KFY A;  1SKR A;  3MDC A;  4JV2 A;  4DO9 A;  2HHV A;  2DBY A;  2KSO A;  2G09 A;  1BNP A;  3KKA C;  8ICQ A;  1S0V A;  2H3Z A;  2ZIV A;  4KN4 A;  3D2S A;  2XGP A;  1T7P A;  2JZB A;  3H4B A;  4B9V A;  4C8K A;  9ICL A;  3BQ2 A;  4BWM A;  4ED0 A;  2EH9 A;  3H8S A;  5IIK A;  9ICK A;  4DQR A;  3ONN A;  3NAS A;  1C20 A;  1X42 A;  2KZ3 A;  1N48 A;  3B0Y A;  1U4B A;  2IHM A;  3N28 A;  2K60 A;  5ALK A;  5DGB A;  1CI4 A;  1ZQU A;  2NRZ A;  1QSY A;  1KRP A;  3MDA A;  2IMW P;  3QU9 A;  4DF4 A;  1PUZ A;  3T5L A;  4QZD A;  1U49 A;  4IR1 A;  3RJJ A;  4O9M A;  8ICL A;  4RQ1 A;  4J9K A;  1WYG A;  1NJW A;  3A0B U;  1GO3 F;  5DB9 A;  3IRU A;  3N7S C;  1FO4 A;  3IN5 A;  3H8J A;  1B0X A;  2BQR A;  3E2E A;  4UAS A;  2ES6 A;  2K8C B;  3F2D A;  8ICH A;  3WKC A;  4DWI A;  4RPX A;  4DLE A;  2H3I A;  2EQY A;  4K4G A;  5KFW A;  2ZJ5 A;  5AM2 A;  8ICS A;  1ZQZ A;  5DDM A;  3KD3 A;  4K4H A;  5KFK A;  1NOM A;  2HI0 A;  3BDP A;  5DBA A;  3ZD9 A;  2AQ4 A;  5CEH A;  1RZT A;  3MGI A;  5KFF A;  5J0S A;  3D2N A;  3GQC A;  4DOA A;  2NRV A;  3RJK A;  1QCK A;  1JN3 A;  8ICI A;  4DCC A;  1KFD A;  8ICV A;  3MR3 A;  4UB2 A;  2EZX A;  3RR8 A;  1DRG A;  3K75 D;  3KZX A;  4ED1 A;  5KG3 A;  2MA1 A;  4OJ5 A;  4NLK A;  5J0Y A;  3T5K A;  4UB6 U;  4KMU A;  1Q8K A;  4DLG A;  2E1E A;  4DSF A;  3NGD A;  5ALP A;  2IHN A;  5J0P A;  4K4I A;  4LVS A;  2VA2 A;  8ICP A;  1N60 A;  1TKD A;  3SV3 A;  5GTI U;  2F2A B;  4NWI A;  2MRL A;  2B6G A;  5AKG A;  2MUT B;  3PNC A;  1IG6 A;  2DF4 B;  2F8L A;  3PMN A;  2EAO A;  4BXO B;  4QZG A;  8ICF A;  4Y2Q A;  3HPO A;  3NS1 A;  4MEX A;  4J9M A;  4P4O A;  7ICM A;  4QZ8 A;  2EZY A;  3WKA A;  2JEJ A;  4F2R A;  3IG8 A;  3LWL A;  3QYP A;  3RJI A;  4O3S A;  4ED6 A;  4M9J A;  1RXW A;  2HBK A;  5KG6 A;  3RBD A;  1CRX A;  5L1J A;  4O5E A;  2Z7J A;  2F3N A;  4DL5 A;  4DL6 A;  4P0P A;  4Y2Y A;  3QX7 A;  3KHH A;  4O3Q A;  4IQT A;  2XI9 A;  4IQW A;  4KX5 A;  1L7P A;  3Q8K A;  3RB6 A;  4PPX A;  4RQ3 A;  2ASJ A;  2FPK A;  2O6K A;  2KJ9 A;  3SAG A;  4I2J A;  4QZH A;  2HSZ A;  4CF3 A;  1NNL A;  1UT5 A;  2WAQ F;  4ZH4 A;  3H7I A;  2FPL A;  3MGH A;  2C28 A;  3AU6 A;  4CF5 A;  4MFC A;  5AHX A;  4US8 A;  5BPC A;  4LZG A;  3V7L A;  3UPQ A;  1OUQ A;  5EE1 A;  5HML A;  2P6R A;  2HHS A;  7ICL A;  2ASL A;  2HOF A;  8ICE A;  1ZRM A;  2HBL A;  2LBO A;  2NRW A;  1HIW A;  3CP8 A;  3FYH A;  3Q8P B;  4EBE A;  4UAZ A;  4XQ8 A;  1X6J A;  1ZJN A;  1HUO A;  2BQU A;  4C8M A;  4F72 A;  1ZQC A;  1UA1 A;  2G0A A;  2W9B A;  2KK0 A;  3HJE A;  9ICS A;  3QU5 A;  3QU4 A;  3ZD8 A;  4M6W B;  1Q3V A;  2W9C A;  5CWR A;  1SL1 A;  3QU2 A;  5AM0 A;  1KN5 A;  2QB1 A;  1SXE A;  8ICA A;  5KFU A;  4Y2J A;  3AMZ A;  3R9K A;  4JK1 A;  3I1Y A;  1FFU A;  1XSP A;  3LDA A;  3JPO A;  1KSP A;  2PI4 A;  1V97 A;  2OCE A;  5AM4 A;  3OTQ A;  4ECT A;  4QWA A;  4ECQ A;  4GXI A;  9ICB A;  5ALV A;  2LKY A;  1WCN A;  4P2H A;  2KVS A;  2E5S A;  3H8M A;  1JXL A;  2XVT A;  1X66 A;  1AQ6 A;  1L3U A;  1COO A;  2NO4 A;  3SD7 A;  3M9N B;  3RFA A;  1ZQV A;  4O5C A;  5DG7 A;  3RB0 A;  5AI9 A;  3BQ7 A;  1JRO A;  1B43 A;  4C4T A;  2A1J B;  2ESE A;  1M6Y A;  3GIJ A;  1B4F A;  1LKY B;  4P4M A;  4C4S A;  4BDP A;  2E8O A;  4UB1 A;  4QWE A;  3GV5 B;  1L3S A;  3RH6 A;  5JRT A;  1N62 A;  3N4M B;  1NK4 A;  2Y1J A;  4EZ9 A;  4DQP A;  5KFS A;  4MFA A;  3OJS A;  2RQ5 A;  2WAQ C;  4RQN A;  4DOC A;  3ZDD A;  1ZJM A;  3E0F A;  1L8O A;  4QW8 A;  3RAQ A;  4OD0 A;  1ZRN A;  5KFO A;  8ICC A;  3SI8 A;  1ZQY A;  5ALF A;  2KE7 A;  5ALS A;  2EZZ A;  1LV5 A;  1XSL A;  1IM4 A;  4AYB F;  1ZOL A;  4ED8 A;  3UMC A;  1A6S A;  5J0R A;  5HR6 A;  5ALE A;  2G5H B;  4J9Q A;  4J9L A;  4F3O A;  2KFZ A;  1X9M A;  4U6P A;  2KJ5 A;  4I27 A;  1LB2 B;  4ELU A;  4TUS A;  2RRD A;  3TAC B;  2HOQ A;  2F1J A;  5EE9 A;  1TAU A;  1DGJ A;  3L5K A;  4RQ7 A;  2XID A;  5KFX A;  2FE9 A;  1ZQE A;  3BQT A;  5DDY A;  4YCX A;  5GTH U;  3T79 A;  5ALG A;  3C2L A;  5AK4 A;  1JX4 A;  2CPR A;  3TAN A;  4UW9 A;  3TAD A;  1UT8 A;  4ECU A;  3M8R A;  2E1F A;  4PGQ A;  1ZQH A;  4FBT A;  5KFD A;  3QUQ A;  5KFG A;  4C7Y A;  2BZF A;  4QWB A;  4IC9 A;  2E8P A;  2W03 A;  5KG2 A;  4EEN A;  3K1Z A;  4YD2 A;  4G3I A;  1Y88 A;  2PI5 A;  3NUQ A;  5E79 U;  3D6J A;  1Z00 A;  5J29 A;  2QLT A;  2HBM A;  2IBK A;  4M9H A;  2C2D A;  1X6I A;  2Q4T A;  1SWW A;  3PZP A;  3QEA Z;  1HUZ A;  1SZH A;  4Q45 A;  3G6V A;  2C2E A;  4IQV A;  4DFM A;  3Q8Q B;  1PK1 B;  5CP2 A;  3WKB A;  1TE2 A;  2YX8 A;  2JHD A;  2B0C A;  2HCF A;  4AYB C;  3RB4 A;  1KL9 A;  5CRX A;  4EX6 A;  2XO7 A;  2HHX A;  5IIN A;  4KLS A;  3SR6 A;  1ZQP A;  5ALN A;  1S77 D;  3I28 A;  3KTQ A;  4RPZ A;  5KG1 A;  3KHG A;  1UA0 A;  1JUD A;  2VJ4 A;  1ZQX A;  4NM1 A;  9ICJ A;  1S8O A;  3TQ1 A;  1ARO P;  5JTI A;  2QKQ A;  5ALQ A;  3H4D A;  3T5H A;  5KFR A;  2BCV A;  5C0Y A;  4F5N A;  4F5P A;  2QB0 B;  1S76 D;  1X40 A;  5EWF A;  4BGD A;  2JEF A;  3MR2 A;  2ATL A;  5KTQ A;  2IOF K;  3SV4 A;  5B66 U;  2VKQ A;  4IRC A;  1ZQ1 C;  3FM9 A;  1TK5 A;  5AKH A;  3KHR A;  4DQS A;  9ICC A;  3VCB A;  7ICQ A;  2F76 X;  4O0I A;  5CA7 A;  4C4R A;  2LYH A;  1WCL A;  2JMG A;  3PSF A;  4KLM A;  3ED5 A;  4EEY A;  4R8U B;  5AI5 A;  4YR3 A;  2RLT A;  3H40 A;  8ICZ A;  1P7D A;  1EXN A;  4ECV A;  9ICO A;  2FMQ A;  4PHD A;  3B0X A;  2FLN A;  4Y2S A;  4YFK A;  3JPS A;  3TI0 A;  2BDU A;  2VAN A;  5ALJ A;  4RQM A;  2F8K A;  3DDH A;  8ICJ A;  1KFT A;  5IIL A;  4UBB A;  2BPF A;  4KLF A;  5D46 A;  4ED3 A;  7ICR A;  5T14 A;  4PHP A;  2BCQ A;  2YB4 A;  3TAP A;  2W54 A;  3K4G A;  5KNI A;  1C7Y A;  4O3R A;  2LPE A;  5KG5 A;  1RYU A;  2YMP A;  1XNS A;  5DQG A;  4DS5 A;  4TQR A;  2DPJ A;  3BQ1 A;  5DBB A;  2I6X A;  9ICA A;  1D8Y A;  3KZI U;  2FMS A;  2HOI A;  3N97 B;  1ZQI A;  2DKX A;  1J97 A;  2G07 A;  3TAD C;  2HHQ A;  2C22 A;  5F9N A;  7ICS A;  4RQ4 A;  2HMX A;  1L7O A;  3SAH A;  4P0Q B;  4KLE A;  4DFD A;  5ALL A;  3V7J A;  5EWE A;  5EE0 A;  2KJ8 A;  2OYY A;  3WK4 A;  3C29 A;  2LHT A;  4C8N A;  4UB4 A;  3NVZ A;  1XO0 A;  5DLG A;  2ZIU B;  3WKE A;  2K4E A;  2OH2 A;  2DUY A;  4ECZ A;  5AK5 A;  3OSP A;  5KG7 A;  4B9M A;  1FIQ A;  4TQS A;  2WTF A;  2KVC A;  3RF9 A;  5DKW A;  2N1R A;  4PL1 A;  1L7M A;  1SIJ A;  1PVQ A;  4F4W A;  2YMQ A;  3OSN A;  4M9L A;  3CRX A;  8ICT A;  3LWM A;  4DSL A;  1XU4 A;  3BJY A;  1TAQ A;  7ICP A;  5AK3 A;  2EAN A;  2H5X A;  4KLU A;  5ALT A;  5KFV A;  1WUD A;  4YG2 A;  1A0P A;  5L1K A;  4Y2R A;  3PX6 A;  4Z6C A;  5DGA A;  4C0Z A;  5KFQ A;  3HIL A;  5J2I A;  1UCV A;  3PSP A;  3OPX A;  4B6J A;  2E3T A;  9ICU A;  2YML A;  4M9N A;  3H0M B;  4YXJ A;  2VA8 A;  1SL2 A;  2BPG A;  1SZP A;  1RQN A;  1LKY A;  4MHV A;  9ICE A;  1N61 A;  3SEN A;  5ALU A;  3C2K A;  3J81 j;  4RQ0 A;  1T8E A;  4Q8F A;  2KHQ A;  3IM1 A;  4X5V A;  2XGQ A;  3QE9 Y;  7ICG A;  5KG4 A;  2LYB A;  1QSL A;  5DB8 A;  4FBU A;  4C80 A;  1SV4 A;  2KN7 A;  3PX0 A;  2M0N A;  5J2F A;  5L9X A;  2BDP A;  4TUP A;  3BS5 A;  1N5W A;  5CHG A;  3Q8M A;  4CF4 A;  1KQQ A;  4DOB A;  2ZJ8 A;  5III A;  1ED1 A;  3PR4 A;  3NRW A;  1ZQT A;  3IHQ B;  4B9N A;  1HJP A;  4YQW A;  2YN4 A;  5DB6 A;  4QWC A;  4PGX A;  1Z3E B;  4PL2 A;  3UMG A;  5IIO A;  1U47 A;  4J9P A;  1MSW D;  3ETR A;  4YMO A;  5BOL A;  4J9O A;  5KFC A;  4CCH A;  5J0W A;  2XCP A;  2KFN A;  5JU5 A;  3MR6 A;  5IIM A;  4JUZ A;  1PK3 A;  1WWV A;  3Q8L A;  1JAL A;  2RDJ A;  1XSN A;  3OGU A;  4FZN A;  9ICH A;  5ALR A;  2W55 A;  1Z1B A;  1NK5 A;  3HKZ F;  2ZIX A;  4KLI A;  4E0D A;  3NTU A;  4QZ9 A;  2QAR A;  2D3D A;  4F4X A;  2JRZ A;  2ZTC A;  3EZ5 A;  3LVV A;  5ALO A;  3RBE A;  7ICN A;  5AM1 A;  4B9S A;  5KL1 B;  5TZV A;  4KLO A;  2BKE A;  4BUG A;  1QQ6 A;  2E8N A;  2DWQ A;  3Q8S B;  1S0O A;  5KFE A;  2K8A A;  4KMO B;  5H2F U;  1ZQN A;  2A19 A;  2KIV A;  2JEI A;  4I2D A;  4AP9 A;  3C5G A;  3PW0 A;  2H3F A;  3MFH A;  5J2K A;  4F93 B;  5J0T A;  3PML A;  3LVW A;  2OHF A;  2W04 A;  1MN8 A;  3OJU A;  1L5U A;  1PZN A;  3UXP A;  4NL9 A;  2K4P A;  2KSO B;  7ICH A;  5L1I A;  9ICM A;  5EWG A;  5DBC A;  4KTQ A;  2ZIV B;  2JZB B;  4Z6F A;  4QZE A;  4F4Z A;  4NLB A;  4BJQ A;  7ICI A;  4UAV A;  2YY6 A;  1X2I A;  1ZQD A;  1WG8 A;  1BPZ A;  4QZF A;  5ALZ A;  3UMB A;  1SB3 C;  3DEE A;  3C21 A;  2FJ6 A;  2BQ3 A;  4ELV A;  4MFF A;  2PFQ A;  4DL2 A;  1T3N A;  1CEZ A;  5AKJ A;  4US9 A;  4YD1 A;  1TAM A;  4OJL A;  3ZDA A;  8ICW A;  4KX3 A;  1NJY A;  2W7O A;  2M9N A;  1QQ7 A;  5HMM A;  3V7K A;  3ISC A;  2KMD A;  4CNQ A;  2WF9 A;  2JV3 A;  4PZN A;  2XY7 A;  2I1Q A;  4LZD A;  4RQ2 A;  2ALZ A;  2KIW A;  3G6Y A;  2LM4 A;  2DFL A;  4R64 A;  4Z6D A;  1ZQA A;  3HKZ C;  1SWV A;  5J0X A;  5KFM A;  2WF5 A;  1DOQ A;  5AI4 A;  3ZDC A;  7ICE A;  2C2R A;  2FPM A;  1RXV A;  1QTM A;  2K4H A;  4I2C A;  5DLF A;  2Y0S F;  4FZM A;  5J8Y A;  4Y2T A;  1PVR A;  2J6T A;  4FO6 A;  2R8J A;  3WKD A;  5KAI U;  3N7R C;  3VC8 A;  5KT2 A;  4OJO A;  5J2A A;  1ZQO A;  4TUR A;  4I2B A;  1UHU A;  2H3Q A;  2HBJ A;  1ZYQ A;  3AN1 A;  1DK2 A;  7ICV A; 
#chains in the Genus database with same CATH homology
 2EAM A;  2QKQ A;  5JTI A;  1V38 A;  4NJ8 A;  2F44 A;  2QB0 B;  1OW5 A;  2EAP A;  2FE9 A;  2Y9U A;  3BS5 A;  1X40 A;  1JI7 A;  3H8M A;  1DXS A;  4PZO A;  1X66 A;  2F3N A;  2DL0 A;  1B0X A;  2GLE A;  1SXD A;  3TAD A;  2ES6 A;  1UQV A;  3BQ7 A;  2E8M A;  2ESE A;  1V85 A;  2YTU A;  5JU5 A;  1B4F A;  1LKY B;  2E8O A;  2Y9T A;  1PK3 A;  1WWV A;  1PK1 A;  2E8P A;  3BS5 B;  2KG5 A;  1KW4 A;  5JRT A;  1SV0 C;  3BS7 A;  2D8C A;  2KMD A;  5J8Y C;  2EAN A;  2JV3 A;  1OXJ A;  4PZN A;  4RQM A;  2F8K A;  2QAR A;  1SGG A;  2D3D A;  4RQN A;  5F3X B;  4NL9 C;  3HIL A;  2KSO A;  1UCV A;  4IS7 A;  3KKA C;  2KE7 A;  1RG6 A;  5KNI A;  2E8N A;  2DKZ A;  2LPE A;  3K1R B;  1PK1 B;  2L5Y A;  2KIV A;  2QB0 A;  1LKY A;  1COK A;  1SV0 A;  5J8Y A;  1Z1V A;  4MHV A;  3SEN A;  2QAR B;  2QB1 A;  1SXE A;  2DKX A;  2LMR A;  1X9X A;  3TAD C;  1F0M A;  3SEI A;  2B6G A;  4NL9 A;  1WWU A;  2K4P A;  2KSO B;  2EAO A;  5L1M A;  2K60 A;  3TAC B;  3KKA A;  3IDW A;  1SV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...