5JU5A

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
b'NISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5ju5A00
2K4PA 1Z1VA 2KE7A 3BS5A 3BQ7A 2QB1A 1V38A 5J8YC 5L1MA 1PK3A 1X40A 2F3NA 2F8KA 1SXEA 5J8YA 2FE9A 5KNIA 4RQMA 2GLEA 2K60A 3KKAC 2E8OA 3TADA 3HILA 2DKXA 2EAPA 1SXDA 2KG5A 5JRTA 5JU5A 5F3XB 3KKAA 3BS5B 2E8MA 2E8NA 1SV0A 1SV4A 5JTIA 1DXSA 2DL0A 1COKA 1LKYB 2KIVA 3TADC 1LKYA 4MHVA 1X66A 2QKQA 4IS7A 2LPEA 3SENA 4PZNA 1B4FA 2KSOA 1OW5A 4NL9A 1SV0C 1WWUA 1WWVA 2LMRA 4PZOA 1KW4A 4NJ8A 2QB0A 1JI7A 2D8CA 1PK1A 2EANA 1X9XA 4NL9C 4RQNA 2KMDA 3IDWA 1B0XA 1UCVA 2DKZA 3K1RB 2KSOB 2D3DA 3SEIA 3H8MA 2F44A 2ESEA 2QARB 2QARA 3TACB 2E8PA 2EAOA 1SGGA 2JV3A 2YTUA 2L5YA 1F0MA 1RG6A 2EAMA 1V85A 2QB0B 2B6GA 2ES6A 2Y9TA 3BS7A 1PK1B 1UQVA 1OXJA 2Y9UA
chains in the Genus database with same CATH superfamily
2KE7A 2KK0A 2ASLA 1N63A 4NM1A 3SI8A 4DSFA 4RNNA 5EWFA 2DGZA 4DQQA 5J8YC 2VKQA 4X5VA 4RQ5A 2OWOA 5T14A 1DRGA 1QQ7A 2V4RA 5KNIA 4I2GA 1Q3UA 4ED3A 3GV5B 4OO1J 4YMNA 4RU9A 4U7CA 4FO6A 1CEZA 4LZDA 2FMQA 4XUSA 1RM6C 4OJPA 4DFMA 2NRZA 1ZD2P 1SL0A 2R18A 2W55A 3NRWA 1BPYA 4O3NA 4DFJA 4I2BA 8ICAA 4KLMA 2EZYA 5KFQA 3GV7B 8ICFA 4O3RA 4J9SA 2KFNA 3KD3A 1XSPA 1JXLA 1ZJNA 4ELVA 5KG3A 1FIQA 4KLDA 5KFVA 2DWQA 9ICNA 1SL1A 2E1FA 4O5KA 5AKXA 2XO7A 4P2HA 2B0CA 4EX7A 2QB0A 4Y2QA 1WUDA 4M6WB 2R8KA 2I6XA 3WKBA 3RJEA 1UCVA 4C7ZA 3NVVA 2LYBA 4YD2A 3H40A 3WU2U 4DQIA 3EPGA 3CRXA 1HJPA 3N28A 1ZQFA 4JV0A 1Y88A 2ZG6A 1NK5A 5G5HA 4NLGA 2AU0A 5J0WA 3QEBZ 2WF6A 3UM9A 1DGSA 4UB6U 1Z1VA 4UB2A 2JH7A 3CYMA 4B9TA 1VDVA 3CP8A 2HOFA 2R8JA 1JMSA 2G5HB 1NJWA 1QTMA 1MC8A 3CNHA 2WF5A 4Z6FA 1SKRA 4Y2JA 4R63A 2VJ5A 5ALNA 4ED8A 5J0YA 4QZHA 1N48A 3HW8A 5DG9A 9ICVA 2HHSA 1T3NA 5JUMA 1ZOLA 5BOLA 5KG0A 4FZMA 8ICSA 1S0OA 4DL5A 1SV0A 1SV4A 3HKZF 3OPXA 5TISU 4Y2PA 2DL0A 4KTQA 7ICNA 4MHVA 4XA5A 1IIPA 3SR6A 5DG8A 4J9OA 4F91B 3H7IA 1P7DA 4RUCA 4Q43A 1K5OA 1IV8A 3GZFA 3N7RC 7ICLA 4Y2UA 5KL8B 3PR4A 2HDOA 2ZIVB 2B21A 2WFAA 1XWLA 2KOBA 5KFWA 1XSNA 3GU3A 2D8CA 3RRGA 4BXOA 4NL9C 4M47A 2K89A 5J29A 3AU2A 4J03A 4UB5A 4I27A 4GLXA 4MFCA 5KFTA 2FLPA 4OJLA 5AKHA 4PGQA 4PPXA 8ICEA 4DL6A 3BQ2A 2E5SA 9ICFA 5DBCA 2ZTDA 2B6GA 4BXOB 2IHMA 4QWBA 2CRXA 3LK9A 4Q8FA 2HHTA 4JV2A 2F1IA 3PVXA 4ECQA 4ED6A 3N97B 2WTFA 3F2DA 3K75D 1SKWA 4RQ6A 2K4HA 2R8GA 3M8RA 5HR6A 3PSFA 3TFRA 3MC1A 1ZQNA 2HBMA 2G09A 4DSIA 3Q8SB 2GLEA 3T79A 3E2EA 2W8KA 1TE2A 3GIKA 3Q8PB 5KFNA 1SB3C 7ICPA 3N4MB 4C4RA 4OJOA 2BCRA 1VJ5A 2BPCA 1SWVA 4PL2A 4AYBC 1NJXA 2BQ3A 4IQTA 4M6WA 3C1YA 1S10A 2LYAA 2WAQC 3BZCA 4FE3A 1S77D 4R8UB 1VLBA 5DGBA 4IR9A 4LZGA 4M0AA 4E0DA 3PW4A 2OCEA 1AQ6A 3C2KA 2JEJA 2EH9A 2ZTEA 2O6KA 5ALMA 2KMDA 5DB7A 4DF8A 5ALZA 3BQ1A 3WKCA 4US9A 3QUBA 4EELA 5J2HA 2BPGA 2K4EA 2ALZA 4DSLA 1ZQVA 2PI4A 5DGAA 5KFZA 4NV0A 4RQ8A 2ODGA 2DFLA 3RJHA 1D8LA 5L9XA 1Z00B 2PFOA 1QSYA 2FJ6A 8ICRA 1CI4A 1ZQEA 3PW5A 2W7PA 5J2AA 1T3QA 3ISDA 2MA1A 4F8RA 3KBBA 2XY6A 1ECWA 5DB9A 2WF9A 4ECXA 2M9NA 2ASDA 2J6UA 4KLUA 4ACOA 4R66A 4GXKA 1KBUA 4G3IA 3AM9A 5ALOA 1JIHA 3IM1A 2XIDA 7ICGA 2JEIA 1ZQBA 2K8BB 5CA7A 1JRPA 4QIWC 2FDRA 7ICHA 8ICUA 1JUDA 2DQNB 3AQFA 4MF2A 4UB1A 5DG7A 1B43A 2IMWP 2P66A 3ZD8A 4DL2A 4J9RA 3PW0A 4B9NA 1S5LU 4JWMA 4RQ2A 1KRPA 4PZNA 2YMQA 4DSKA 4BX9C 3PO4A 2G08A 1QSSA 5KT4A 4NL9A 5KT3A 3VCBA 1Q8KA 1WWUA 4C80A 1JX4A 3H4BA 4JWNA 3TKAA 1RYSA 3G6VA 1N5XA 2AQ0A 4JUZA 2BCQA 3ALRA 1C20A 3OHAA 3PX6A 1T8EA 4QZ8A 4O3SA 1KN5A 2KHVA 1NK8A 3C5FA 1B0XA 4DOCA 2DKZA 4ZOHC 3K1RB 1O03A 3SEIA 3PMLA 1T7PA 1HUZA 5AKZA 2QARB 3RR7A 3RB3A 4B9VA 5K4LA 4EYHB 3WK6A 3KHRA 4B9MA 2MU2A 2HHWA 3C28A 1IG6A 4U6PA 3RF9A 1ZYQA 7ICFA 2AGQA 3M6ZA 1L3SA 4WJ3B 5IILA 3ZDBA 2Y9TA 2VA3A 2ZIUA 4YG2A 4NXZA 3M6KA 2QLTA 4RT2A 3UXOA 3V6HA 3DDHA 3GFKB 4HYKA 4PL1A 5ALDA 1TV9A 3H8SA 1N61A 2K8AA 4QW8A 1QQ6A 3OJUA 1LB2B 1T94A 2AGOA 5KFFA 2KVSA 4OJ6A 1ZQRA 2JEGA 1ZD5A 1AROP 4O5EA 4RQ7A 2K60A 4KLOA 3KKAC 2HHVA 3DEEA 3NVZA 2PXIA 5CJ7A 2MUTB 4J9KA 2EZXA 3V7JA 3ZI4A 1JROA 4DS4A 5JTIA 3GV8B 3SQIA 2XGPA 5GTIU 4UQGA 3JPPA 2GWSA 2XY7A 5HR7A 8ICVA 5DQIA 5D4BA 4PH5A 2HVIA 5BOMA 4CF3A 4KLQA 2BDUA 5KTQA 4AP9A 2XVTA 1NNLA 4EENA 1ZD4A 4UAVA 2PKEA 5CWRA 5AM1A 3V7LA 2VA8A 7ICOA 2LYHA 3D6JA 3SAHA 1SZPA 4KN4A 1ZQSA 4EX6A 2W9CB 3TQ1A 2H3ZA 3IN5A 3QZ8A 1U9LA 5KFKA 2ZUCA 3F2CA 3B0XA 1D9DA 1K1SA 4I2DA 4Y2YA 4ED2A 4ELTA 4DOAA 3RAQA 1ZQXA 8ICNA 1KFDA 2BQRA 4YCXA 4DSJA 4EBDA 1PZNA 8ICWA 5ALKA 3D2SA 8ICYA 2CXYA 3OTQA 2P35A 1X9MA 1SGGA 7ICKA 2EQYA 1RDFA 5ALTA 1V85A 4I2HA 5D49A 4KLHA 3NS1A 1TK8A 1KEJA 5AK5A 1YZ7A 1S76D 2ZUDA 7ICMA 5ALSA 5HNKA 4QNLA 3PMNA 3I1YA 1V38A 1ZQQA 2I5HA 4DF4A 2W9BB 2VIXA 4NY8A 3GIJA 2HHQA 4MFFA 4R65A 3RB6A 3V6KA 3IRUA 1KTQA 2KG5A 3S6JA 5KFMA 5JU5A 4Q44A 5A0LA 3C2LA 4C8MA 4DLGA 3AQEA 2YMMA 3PSTA 1NZBA 1UT5A 1N62A 4BWMA 4IS7A 1ZJMA 2MSNA 4RPZA 4NLBA 3MABA 3KFUF 2BCUA 5ALLA 2DPIA 3AMZA 2JEFA 5ALIA 3HP6A 4KLIA 3A0HU 5ALEA 2C2EA 4F4XA 1HUOA 1DK3A 3THVA 2OHFA 8ICIA 4UASA 4QZIA 5AI0A 2PI5A 2FMSA 3WK8A 2RLTA 3K4GA 2LM4A 1X2IA 2F8LA 4BGDA 4QZBA 8ICJA 3HKZC 5J2IA 4KMOB 3EPIA 2Z7JA 4PGYA 4I2CA 4YVZA 3MR3A 5J2GA 5ALRA 2MUTA 4DWIA 4B6JA 5KFAA 5J2CA 3HJEA 3M1YA 5ALXA 3VC8A 4FFDA 4Q8EA 3WKDA 2G0AA 1Z4NA 5KFSA 2PFPA 1JN3A 5J0XA 5AK6A 5ALGA 3MDCA 3ONNA 4DFPA 2E8OA 5AKJA 9ICEA 4UATA 2ISOA 1XC9A 2PMZF 4US8A 2KVCA 2KTQA 1H38A 4JB3A 1PVQA 5L1KA 3OSNA 4LVSA 2W9CA 5AI4A 5ALJA 4UAYA 4O3QA 3MR6A 1U48A 1LKYA 1RQNA 9ICKA 1NJZA 4FZNA 1FEZA 1XU4A 2LPEA 5AM0A 4I2IA 2W54A 4OJ5A 4C8NA 2VA2A 4ELUA 5B5EU 3QE9Y 1S97A 2H5XA 5KG4A 1S8OA 7ICJA 2G5IB 4K4GA 4BJQA 3TANA 1JI7A 5KFLA 4QZDA 2F1JA 4UW9A 3GILA 2LM1A 1U45A 1X9XA 5KFPA 4CGZA 3UQ0A 3SAGA 2E3TA 3MBYA 1PVRA 8ICLA 3H4DA 4XQ8A 4F5PA 1BNPA 2LHTA 2W9BA 4UAZA 2KJ5A 3SAFA 4HAIA 2FPLA 2BCSA 2KP7A 4ED1A 3WK5A 3M9OB 1A0PA 4PHAA 3JPNA 4QJFB 3K1ZA 2XCAA 3GIIA 2VJ4A 1BNOA 4F71A 9ICXA 1PK3A 1L7OA 5KG5A 1SXEA 9ICSA 5J8YA 2W3SA 4O0IA 5AM2A 2C2RA 4ED0A 2RP5A 3G6XA 1ZQLA 3HILA 3CW2C 3SV4A 5C0YA 2KHQA 3BS5B 3KHHA 1ZQCA 5IIIA 2W8LA 1IXRA 3H0LB 1EXNA 2I1QA 5CR0A 2HCFA 3RB0A 1Z4OA 1V97A 5KAFU 4O3MA 4QW9A 5DDMA 5J2BA 1ZETA 2VANA 9ICBA 3HWTA 2J6SA 3RB4A 1RPLA 1SWWA 1D8YA 3QU9A 5EWGA 4IRCA 2HBJA 5AM4A 2H3FA 1ED1A 4J9MA 2RHFA 3D2NA 3IP4B 4DQRA 5C5JA 1X42A 1D9FA 2OH2A 3BDPA 1L7NA 1L5UA 2RDJA 3AUOA 4ECUA 3IDWA 4DFKA 1TVAA 2KSOB 1UA1A 3H8MA 5H2FU 1S0NA 5KFIA 2YY6A 4P0PB 2F1HA 4RQ4A 4DO9A 3RH5A 3PSPA 4IQWA 3F5AA 4C8OA 2KJ9A 4P0QB 5KT6A 4F4WA 4UBBA 8ICTA 7ICTA 5DDYA 3RH4A 2AGPA 2NRWA 1ZQIA 5D46A 3QEAZ 2YX8A 1XO1A 2ZJ5A 4Y2RA 3UMGA 5AM3A 5KFUA 2AQ4A 3ZDCA 2UVUA 2KD1A 3KHGA 7ICSA 3M8SA 4F93B 1RZTA 4BDPA 2AJQA 2F8KA 3BQ0A 2DKXA 3MFHA 2ZIXB 4YR2A 4KLGA 1MN8A 3OHBA 3EZ5A 3V7KA 2FLLA 3QNMA 4YQWA 2A3VA 2V4QA 2E8NA 4O9MA 4PJ0U 2MAXA 9ICGA 2LBOA 2P6UA 1F5SA 4Z6CA 4F72A 4EEYA 2IOFK 4F5NA 4ICAA 3LWLA 3UXNA 3EYZA 3H0RB 4QZEA 3GDXA 4TURA 3C29A 4DQSA 3MGHA 4NLCA 2OM6A 2IBKA 5J0TA 1FFUA 1RQLA 2M0NA 5ALQA 5AKEA 2NV3A 4GFJA 2ZIVA 4NJ8A 3LVWA 4CF4A 4GXJA 1ZQYA 5ALWA 4NM2A 5ALYA 1FFVA 3V6JA 2D3DA 2RQ5A 4RQ0A 5AKLA 2HHXA 2GOLA 3LWMA 4YMMA 5KFOA 2LI6A 2A19A 1F0MA 3U26A 2EAMA 3JPQA 1A77A 3UQ2A 4FBTA 5J0RA 7ICIA 3BS7A 1ZQPA 1ZRNA 1YZ6A 2Y1IA 1ZQZA 2W03A 1ZQTA 3BS5A 3BQ7A 2PFQA 4Y2VA 1CRXA 2UVWA 1TAUA 1ZQWA 4KLEA 7ICRA 4I29A 2KZ3A 3QU5A 1LV5A 4IRDA 1ZQ1C 1XSLA 3BJYA 4M04A 4FZLA 2WB1C 4A8EA 2HI0A 4JV1A 4I2EA 4F4KA 4EZ6A 1BGXT 3PO5A 2CN1A 3IV6A 3OJSA 4RPYA 4ECTA 1MQ2A 1DK2A 1SZHA 3NGDA 1GO3F 2AHOB 2H3QA 9ICRA 4R8UA 2FPMA 3NASA 4DL4A 2KSOA 3ICXA 3EW9A 5KFEA 4PHPA 5J0OA 4Y2XA 5KG2A 4ZH4A 4QWEA 4P0PA 2KEYA 5DB6A 4UB8U 2Q0ZX 1KW4A 2JHDA 3G6YA 1ZQOA 2PFNA 2Y0SF 4P4PA 3GQCA 4F92B 1KQQA 4C0ZA 2R8IA 3PSIA 2H3VA 2GH1A 3HPOA 2HOQA 5ALFA 1NOMA 4Y2TA 5J2JA 4Z6EA 5CEHA 3WKEA 1QSLA 1RG6A 4TUQA 8ICOA 5ALVA 2GO7A 1Z00A 3KTQA 1L3TA 9ICJA 3RJIA 3SZ2A 2YQEA 1Z1BA 9ICQA 1N56A 9ICAA 1QLNA 8ICMA 1ZQJA 1S0VA 1OUQA 2NO5A 4QZFA 3PV8A 3KOOA 4NLZA 5HMMA 3Q8MA 1BPBA 2F3NA 9ICTA 1KLNA 4CF5A 2FE9A 2JR5A 5L1IA 4F4ZA 5AKYA 3NTUA 4RNMA 5AKKA 9ICHA 4ECSA 2JH1A 1NK9A 5AM5A 5F3XB 1L3VA 4KX3A 5J0PA 2RRDA 4YMOA 4BUGA 1RXWA 2UVVA 2BGWA 4RUAA 1JALA 2BZFA 5KFCA 4USAA 1HEKA 4C4SA 4YR3A 2FPKA 3M7DA 8ICPA 4ECYA 3SENA 4MEYA 3B9JA 1OW5A 2W3RA 4KMUA 4RQ3A 4B9SA 1TAMA 3IG8A 2EDUA 2W43A 4J9QA 1U4BA 3C1ZA 1UA0A 5IINA 1KFSA 3RJJA 1KL9A 2G06A 9ICPA 4F5QA 1J97A 4QWDA 3OSPA 3TAQA 2HVHA 2PMZC 1L7PA 1MQ3A 5AK4A 2NRXA 2N1RA 1NJYA 2F44A 1X6IA 3I28A 2WHEA 2QARA 1T4GA 2JXJA 1L3UA 4DL3A 1K1QA 4DCCA 1KSPA 2JV3A 1ZXIA 3AU6A 5AKGA 1F44A 2HBLA 4TQSA 2H3IA 4UAUA 5KFGA 1B22A 5KFRA 2KICA 5KG6A 3UPQA 9ICCA 5DLGA 4C8KA 4C8LA 1UQVA 3M9NB 1Q3VA 2K4PA 1BPZA 3UMCA 2JZBB 4FBUA 4EBEA 2Q4TA 5HP4A 2DUYA 3SYZA 1UHUA 5L1JA 1UT8A 2W11A 3MDAA 1X40A 4DS5A 1Z19A 3RTVA 2ATLA 1A6SA 2EAPA 4JMUA 4XRHA 5JRTA 1ZQAA 2W9AA 3KKAA 1O08A 3HRDD 4GXIA 1RYUA 2KKPA 1COKA 3KZXA 4Y2SA 2KIVA 3TADC 4M9LA 8ICGA 3LYSA 1X66A 4UB4A 2YB4A 2YN4A 5DQHA 4TUPA 2C28A 4KX5A 7ICEA 1URJA 3HX0A 3B0YA 2ZTCA 2BDPA 1NK0A 3H8WA 1NK6A 2WF8A 2IHNA 1BPXA 4GC7A 2AH5A 3D2QA 4YP3A 5E79U 4J9PA 2BCVA 4PZOA 5AHXA 3MFIA 3LVVA 5KFJA 4DLEA 2G07A 2F2AB 4JK1A 3RAXA 4RQNA 1U47A 4KLTA 3FDSA 4GIBA 4K4HA 7ICVA 2BPFA 2FLNA 4F5RA 1TKDA 1TK5A 2LKYA 5AIBA 4TUSA 3WK4A 4O3OA 2E8PA 4PGXA 2EAOA 4F2SA 4DEZA 5KT5A 2KJ8A 2F76X 4EZ9A 1PK1B 5KFXA 3C5GA 1PUZA 3T5HA 1QH9A 3RFAA 3PR5B 3WK7A 4UAWA 2W04A 1YT3A 1TFRA 5F9LA 2A1JB 3WKAA 3QUTA 1N2XA 5AI5A 1NK4A 2XC9A 5AK3A 5EE0A 3QZ7A 4RQMA 5DLFA 4G9BA 4K4IA 1DGJA 3QU2A 5IIKA 4YXJA 3H8JA 1J2MA 1CUKA 2K4IA 4QZAA 4C7YA 1L8OA 3ETLA 4CNQA 4DSEA 5BPCA 2NRVA 5B66U 3NUQA 3FM9A 3J81j 5CB1A 1C7YA 4YD1A 1X6JA 2R8HA 4QWCA 9ICOA 2KIWA 4RQ1A 3L4PA 2HBKA 3QUQA 2XICA 2DPJA 2HSZA 4CRXA 3ZDEA 1ZQKA 2ZIWB 3NRZA 3SV3A 2YMLA 1TK0A 3T3FA 3R9KA 5KFDA 3ZD9A 1BPDA 1SKSA 2KZMA 3TI0A 2LMRA 4DL7A 1N60A 2YB1A 4KLJA 3E58A 4BWJA 5KFYA 1L7MA 4IRKA 1NKCA 3RH6A 4EBCA 1X9WA 5DKWA 4NWIA 3RBDA 1ZQDA 2JZBA 1NKBA 4UARA 4UB3A 2XGQA 2HW3A 3JPTA 3E0FA 1ZQUA 1Q46A 3FAHA 3TACB 8ICQA 4C4TA 5EOZA 9ICLA 1Z3EB 7ICQA 1M6YA 1S0MA 5AI8A 1MSWD 2ZIUB 4RZRA 4PHDA 1D8BA 3Q8RB 2WF7A 5CP2A 4GC6A 2Y9UA 5KG1A 2HMXA 4LJXA 1U49A 1QCKA 2QB1A 3F5EA 4QZCA 5AICA 5L1MA 5EE9A 4OCZA 4YR0A 9ICUA 2OXOA 4DOBA 5J0QA 1RXVA 5DBBA 4M9HA 3TADA 5KT2A 3TFSA 4KLFA 3QUCA 1N5WA 9ICMA 5G5GA 5KL1B 2KN7A 2E8MA 2NRTA 1BPEA 4Z6DA 3PX4A 1QQ5A 4I28A 4ECVA 3GIMA 1ZRMA 3N7PD 3ED5A 5AKIA 5KT7A 5AI6A 1ZQHA 3BQTA 1LVHA 3JPRA 4R64A 2OYYA 3T5LA 3C21A 2C2DA 3ETRA 1UPHA 5KG7A 2IA6A 1WWVA 3FYHA 3PX0A 2KKVA 1PVPA 2OEHA 5KFHA 4EYIB 3JPOA 3DV9A 2A1AA 3RJGA 1PK1A 1XS9D 3AN1A 5GTHU 4M9NA 3T5JA 8ICXA 3JPSA 4RT3A 4B9LA 2ESEA 4DQPA 2AXTU 5J2EA 1WYGA 2Y1JA 2W9MA 3A0BU 3RRHA 2A1JA 3AL0B 4O5CA 2YTUA 4KLSA 3PZPA 4AYBF 2P6RA 1J2NA 4KITB 3QYPA 2KV2A 3L5KA 3HT3A 4YN4A 4YFKA 4QZGA 2JGAA 5HMLA 2YMPA 2CPRA 2WAQF 2BQUA 2FMPA 1OXJA 5IIOA 5F9NA 3Q8KA 1NKEA 2BHNA 2UVRA 5J2FA 4ED7A 4MF8A 1IM4A 3PY8A 2K8CB 4QZ9A 3M9MB 1ZD3A 4CDGA 3LDAA 1BVSA 2Y0SC 2HOIA 4ECWA 2C22A 2RDIA 3IHQB 2XCPA 2ZJ8A 5EE1A 5IIMA 5KAIU 1X9SA 4P4OA 1KDHA 4M2YA 2ZIWA 4B9UA 2KNJA 5EWEA 1NK7A 3Q8QB 1L6NA 1L8LA 3RBEA 2NO4A 1XNSA 5HHIA 5EE3A 3ZDAA 2QKQA 4ECZA 8ICBA 4MEXA 3MR2A 3NVYA 1B4FA 4IR1A 2F77X 4NLKA 3PW7A 2JRZA 2NYVA 1JXEA 4J9NA 3UMBA 2KZZA 5AI9A 5HHHA 3RJKA 2ASJA 2V9WA 8ICKA 5ALHA 3H0MB 3C2MA 3I76A 4J9LA 3KHLA 2IOFA 9ICWA 5J0SA 1HIWA 2EANA 4I2JA 3IG5A 3Q8LA 5TZVA 4QIWF 3NVWA 5ALUA 3FC4A 4KN7A 5J2DA 3MGVA 1NI3A 4Q45A 2L5YA 2MRLA 2BR0A 4I2AA 4TQRA 1WCNA 2QB0B 2ES6A 3PNCA 4IQVA 2XY5A 5CRXA 4P0QA 1MA7A 1KFTA 3MGIA 3SD7A 2ZUBA 3ISCA 4PHEA 5FP0A 2E1EA 3TAPA 3RR8A 9ICIA 2DF4B 3MR5A 1SIJA 3C23A 3TARA 3EWAA 4FS1A 3AEVA 4I2FA 4F2RA 3F53A 4P4MA 3QXGA 4RNOA 5DBAA 5DQGA 3KZIU 5L1LA 3PW2A 1KKXA 2IOHA 3OGUA 4F5OA 3ISBA 2KFZA 1SXDA 3RJFA 5J2KA 2ZIXA 4F4YA 1S9FA 4NLNA 3ZDDA 2XI9A 1DOQA 1TAQA 2I9GA 1FO4A 4M9JA 4IQUA 3F2BA 5ALPA 1DXSA 2ZJAA 2ISPA 1LKYB 4KLLA 2DBYA 2W7OA 3UXPA 4M9GA 3L3FX 4ECRA 3N7SC 2WB1F 8ICCA 8ICHA 2HHUA 4F3OA 7ICUA 8ICZA 5IIJA 4O3PA 1SV0C 3WK9A 5DB8A 1ZQMA 1RYRA 5KFBA 3V72A 1V9PA 1ZQGA 1WCLA 3QX7A 4MFAA 3T5KA 4CCHA 5J0UA 2BKEA 3EUB2 4CE6A 5AIAA 4IL6U 1COOA 1SL2A 2ZXHA 3BZKA 4FS2A 3O0FA 5CHGA 4F50A 2FI1A 1WG8A 4OD0A 2D6FC 1A76A 3SMVA 4IC9A 4YXMA 4UBCA 4EEKA 4RPXA 1NZPA 4QWAA 2JMGA 3QU7A 3QU4A 2ZXIA 4DFDA 3ORYA 1XO0A 2EZZA 2J6TA
chains in the Genus database with same CATH topology
2K4PA 1Z1VA 2KE7A 3BS5A 3BQ7A 2QB1A 1V38A 5J8YC 5L1MA 1PK3A 1X40A 2F3NA 2F8KA 1SXEA 5J8YA 2FE9A 5KNIA 4RQMA 2GLEA 2K60A 3KKAC 2E8OA 3TADA 3HILA 2DKXA 2EAPA 1SXDA 2KG5A 5JRTA 5JU5A 5F3XB 3KKAA 3BS5B 2E8MA 2E8NA 1SV0A 1SV4A 5JTIA 1DXSA 2DL0A 1COKA 1LKYB 2KIVA 3TADC 1LKYA 4MHVA 1X66A 2QKQA 4IS7A 2LPEA 3SENA 4PZNA 1B4FA 2KSOA 1OW5A 4NL9A 1SV0C 1WWUA 1WWVA 2LMRA 4PZOA 1KW4A 4NJ8A 2QB0A 1JI7A 2D8CA 1PK1A 2EANA 1X9XA 4NL9C 4RQNA 2KMDA 3IDWA 1B0XA 1UCVA 2DKZA 3K1RB 2KSOB 2D3DA 3SEIA 3H8MA 2F44A 2ESEA 2QARB 2QARA 3TACB 2E8PA 2EAOA 1SGGA 2JV3A 2YTUA 2L5YA 1F0MA 1RG6A 2EAMA 1V85A 2QB0B 2B6GA 2ES6A 2Y9TA 3BS7A 1PK1B 1UQVA 1OXJA 2Y9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4P A;  1Z1V A;  2KE7 A;  3BS5 A;  3BQ7 A;  2QB1 A;  1V38 A;  5J8Y C;  5L1M A;  1PK3 A;  1X40 A;  2F3N A;  2F8K A;  1SXE A;  5J8Y A;  2FE9 A;  5KNI A;  4RQM A;  2GLE A;  2K60 A;  3KKA C;  2E8O A;  3TAD A;  3HIL A;  2DKX A;  2EAP A;  1SXD A;  2KG5 A;  5JRT A;  5JU5 A;  5F3X B;  3KKA A;  3BS5 B;  2E8M A;  2E8N A;  1SV0 A;  1SV4 A;  5JTI A;  1DXS A;  2DL0 A;  1COK A;  1LKY B;  2KIV A;  3TAD C;  1LKY A;  4MHV A;  1X66 A;  2QKQ A;  4IS7 A;  2LPE A;  3SEN A;  4PZN A;  1B4F A;  2KSO A;  1OW5 A;  4NL9 A;  1SV0 C;  1WWU A;  1WWV A;  2LMR A;  4PZO A;  1KW4 A;  4NJ8 A;  2QB0 A;  1JI7 A;  2D8C A;  1PK1 A;  2EAN A;  1X9X A;  4NL9 C;  4RQN A;  2KMD A;  3IDW A;  1B0X A;  1UCV A;  2DKZ A;  3K1R B;  2KSO B;  2D3D A;  3SEI A;  3H8M A;  2F44 A;  2ESE A;  2QAR B;  2QAR A;  3TAC B;  2E8P A;  2EAO A;  1SGG A;  2JV3 A;  2YTU A;  2L5Y A;  1F0M A;  1RG6 A;  2EAM A;  1V85 A;  2QB0 B;  2B6G A;  2ES6 A;  2Y9T A;  3BS7 A;  1PK1 B;  1UQV A;  1OXJ A;  2Y9U A; 
#chains in the Genus database with same CATH topology
 2KE7 A;  2KK0 A;  2ASL A;  1N63 A;  4NM1 A;  3SI8 A;  4DSF A;  4RNN A;  5EWF A;  2DGZ A;  4DQQ A;  5J8Y C;  2VKQ A;  4X5V A;  4RQ5 A;  2OWO A;  5T14 A;  1DRG A;  1QQ7 A;  2V4R A;  5KNI A;  4I2G A;  1Q3U A;  4ED3 A;  3GV5 B;  4OO1 J;  4YMN A;  4RU9 A;  4U7C A;  4FO6 A;  1CEZ A;  4LZD A;  2FMQ A;  4XUS A;  1RM6 C;  4OJP A;  4DFM A;  2NRZ A;  1ZD2 P;  1SL0 A;  2R18 A;  2W55 A;  3NRW A;  1BPY A;  4O3N A;  4DFJ A;  4I2B A;  8ICA A;  4KLM A;  2EZY A;  5KFQ A;  3GV7 B;  8ICF A;  4O3R A;  4J9S A;  2KFN A;  3KD3 A;  1XSP A;  1JXL A;  1ZJN A;  4ELV A;  5KG3 A;  1FIQ A;  4KLD A;  5KFV A;  2DWQ A;  9ICN A;  1SL1 A;  2E1F A;  4O5K A;  5AKX A;  2XO7 A;  4P2H A;  2B0C A;  4EX7 A;  2QB0 A;  4Y2Q A;  1WUD A;  4M6W B;  2R8K A;  2I6X A;  3WKB A;  3RJE A;  1UCV A;  4C7Z A;  3NVV A;  2LYB A;  4YD2 A;  3H40 A;  3WU2 U;  4DQI A;  3EPG A;  3CRX A;  1HJP A;  3N28 A;  1ZQF A;  4JV0 A;  1Y88 A;  2ZG6 A;  1NK5 A;  5G5H A;  4NLG A;  2AU0 A;  5J0W A;  3QEB Z;  2WF6 A;  3UM9 A;  1DGS A;  4UB6 U;  1Z1V A;  4UB2 A;  2JH7 A;  3CYM A;  4B9T A;  1VDV A;  3CP8 A;  2HOF A;  2R8J A;  1JMS A;  2G5H B;  1NJW A;  1QTM A;  1MC8 A;  3CNH A;  2WF5 A;  4Z6F A;  1SKR A;  4Y2J A;  4R63 A;  2VJ5 A;  5ALN A;  4ED8 A;  5J0Y A;  4QZH A;  1N48 A;  3HW8 A;  5DG9 A;  9ICV A;  2HHS A;  1T3N A;  5JUM A;  1ZOL A;  5BOL A;  5KG0 A;  4FZM A;  8ICS A;  1S0O A;  4DL5 A;  1SV0 A;  1SV4 A;  3HKZ F;  3OPX A;  5TIS U;  4Y2P A;  2DL0 A;  4KTQ A;  7ICN A;  4MHV A;  4XA5 A;  1IIP A;  3SR6 A;  5DG8 A;  4J9O A;  4F91 B;  3H7I A;  1P7D A;  4RUC A;  4Q43 A;  1K5O A;  1IV8 A;  3GZF A;  3N7R C;  7ICL A;  4Y2U A;  5KL8 B;  3PR4 A;  2HDO A;  2ZIV B;  2B21 A;  2WFA A;  1XWL A;  2KOB A;  5KFW A;  1XSN A;  3GU3 A;  2D8C A;  3RRG A;  4BXO A;  4NL9 C;  4M47 A;  2K89 A;  5J29 A;  3AU2 A;  4J03 A;  4UB5 A;  4I27 A;  4GLX A;  4MFC A;  5KFT A;  2FLP A;  4OJL A;  5AKH A;  4PGQ A;  4PPX A;  8ICE A;  4DL6 A;  3BQ2 A;  2E5S A;  9ICF A;  5DBC A;  2ZTD A;  2B6G A;  4BXO B;  2IHM A;  4QWB A;  2CRX A;  3LK9 A;  4Q8F A;  2HHT A;  4JV2 A;  2F1I A;  3PVX A;  4ECQ A;  4ED6 A;  3N97 B;  2WTF A;  3F2D A;  3K75 D;  1SKW A;  4RQ6 A;  2K4H A;  2R8G A;  3M8R A;  5HR6 A;  3PSF A;  3TFR A;  3MC1 A;  1ZQN A;  2HBM A;  2G09 A;  4DSI A;  3Q8S B;  2GLE A;  3T79 A;  3E2E A;  2W8K A;  1TE2 A;  3GIK A;  3Q8P B;  5KFN A;  1SB3 C;  7ICP A;  3N4M B;  4C4R A;  4OJO A;  2BCR A;  1VJ5 A;  2BPC A;  1SWV A;  4PL2 A;  4AYB C;  1NJX A;  2BQ3 A;  4IQT A;  4M6W A;  3C1Y A;  1S10 A;  2LYA A;  2WAQ C;  3BZC A;  4FE3 A;  1S77 D;  4R8U B;  1VLB A;  5DGB A;  4IR9 A;  4LZG A;  4M0A A;  4E0D A;  3PW4 A;  2OCE A;  1AQ6 A;  3C2K A;  2JEJ A;  2EH9 A;  2ZTE A;  2O6K A;  5ALM A;  2KMD A;  5DB7 A;  4DF8 A;  5ALZ A;  3BQ1 A;  3WKC A;  4US9 A;  3QUB A;  4EEL A;  5J2H A;  2BPG A;  2K4E A;  2ALZ A;  4DSL A;  1ZQV A;  2PI4 A;  5DGA A;  5KFZ A;  4NV0 A;  4RQ8 A;  2ODG A;  2DFL A;  3RJH A;  1D8L A;  5L9X A;  1Z00 B;  2PFO A;  1QSY A;  2FJ6 A;  8ICR A;  1CI4 A;  1ZQE A;  3PW5 A;  2W7P A;  5J2A A;  1T3Q A;  3ISD A;  2MA1 A;  4F8R A;  3KBB A;  2XY6 A;  1ECW A;  5DB9 A;  2WF9 A;  4ECX A;  2M9N A;  2ASD A;  2J6U A;  4KLU A;  4ACO A;  4R66 A;  4GXK A;  1KBU A;  4G3I A;  3AM9 A;  5ALO A;  1JIH A;  3IM1 A;  2XID A;  7ICG A;  2JEI A;  1ZQB A;  2K8B B;  5CA7 A;  1JRP A;  4QIW C;  2FDR A;  7ICH A;  8ICU A;  1JUD A;  2DQN B;  3AQF A;  4MF2 A;  4UB1 A;  5DG7 A;  1B43 A;  2IMW P;  2P66 A;  3ZD8 A;  4DL2 A;  4J9R A;  3PW0 A;  4B9N A;  1S5L U;  4JWM A;  4RQ2 A;  1KRP A;  4PZN A;  2YMQ A;  4DSK A;  4BX9 C;  3PO4 A;  2G08 A;  1QSS A;  5KT4 A;  4NL9 A;  5KT3 A;  3VCB A;  1Q8K A;  1WWU A;  4C80 A;  1JX4 A;  3H4B A;  4JWN A;  3TKA A;  1RYS A;  3G6V A;  1N5X A;  2AQ0 A;  4JUZ A;  2BCQ A;  3ALR A;  1C20 A;  3OHA A;  3PX6 A;  1T8E A;  4QZ8 A;  4O3S A;  1KN5 A;  2KHV A;  1NK8 A;  3C5F A;  1B0X A;  4DOC A;  2DKZ A;  4ZOH C;  3K1R B;  1O03 A;  3SEI A;  3PML A;  1T7P A;  1HUZ A;  5AKZ A;  2QAR B;  3RR7 A;  3RB3 A;  4B9V A;  5K4L A;  4EYH B;  3WK6 A;  3KHR A;  4B9M A;  2MU2 A;  2HHW A;  3C28 A;  1IG6 A;  4U6P A;  3RF9 A;  1ZYQ A;  7ICF A;  2AGQ A;  3M6Z A;  1L3S A;  4WJ3 B;  5IIL A;  3ZDB A;  2Y9T A;  2VA3 A;  2ZIU A;  4YG2 A;  4NXZ A;  3M6K A;  2QLT A;  4RT2 A;  3UXO A;  3V6H A;  3DDH A;  3GFK B;  4HYK A;  4PL1 A;  5ALD A;  1TV9 A;  3H8S A;  1N61 A;  2K8A A;  4QW8 A;  1QQ6 A;  3OJU A;  1LB2 B;  1T94 A;  2AGO A;  5KFF A;  2KVS A;  4OJ6 A;  1ZQR A;  2JEG A;  1ZD5 A;  1ARO P;  4O5E A;  4RQ7 A;  2K60 A;  4KLO A;  3KKA C;  2HHV A;  3DEE A;  3NVZ A;  2PXI A;  5CJ7 A;  2MUT B;  4J9K A;  2EZX A;  3V7J A;  3ZI4 A;  1JRO A;  4DS4 A;  5JTI A;  3GV8 B;  3SQI A;  2XGP A;  5GTI U;  4UQG A;  3JPP A;  2GWS A;  2XY7 A;  5HR7 A;  8ICV A;  5DQI A;  5D4B A;  4PH5 A;  2HVI A;  5BOM A;  4CF3 A;  4KLQ A;  2BDU A;  5KTQ A;  4AP9 A;  2XVT A;  1NNL A;  4EEN A;  1ZD4 A;  4UAV A;  2PKE A;  5CWR A;  5AM1 A;  3V7L A;  2VA8 A;  7ICO A;  2LYH A;  3D6J A;  3SAH A;  1SZP A;  4KN4 A;  1ZQS A;  4EX6 A;  2W9C B;  3TQ1 A;  2H3Z A;  3IN5 A;  3QZ8 A;  1U9L A;  5KFK A;  2ZUC A;  3F2C A;  3B0X A;  1D9D A;  1K1S A;  4I2D A;  4Y2Y A;  4ED2 A;  4ELT A;  4DOA A;  3RAQ A;  1ZQX A;  8ICN A;  1KFD A;  2BQR A;  4YCX A;  4DSJ A;  4EBD A;  1PZN A;  8ICW A;  5ALK A;  3D2S A;  8ICY A;  2CXY A;  3OTQ A;  2P35 A;  1X9M A;  1SGG A;  7ICK A;  2EQY A;  1RDF A;  5ALT A;  1V85 A;  4I2H A;  5D49 A;  4KLH A;  3NS1 A;  1TK8 A;  1KEJ A;  5AK5 A;  1YZ7 A;  1S76 D;  2ZUD A;  7ICM A;  5ALS A;  5HNK A;  4QNL A;  3PMN A;  3I1Y A;  1V38 A;  1ZQQ A;  2I5H A;  4DF4 A;  2W9B B;  2VIX A;  4NY8 A;  3GIJ A;  2HHQ A;  4MFF A;  4R65 A;  3RB6 A;  3V6K A;  3IRU A;  1KTQ A;  2KG5 A;  3S6J A;  5KFM A;  5JU5 A;  4Q44 A;  5A0L A;  3C2L A;  4C8M A;  4DLG A;  3AQE A;  2YMM A;  3PST A;  1NZB A;  1UT5 A;  1N62 A;  4BWM A;  4IS7 A;  1ZJM A;  2MSN A;  4RPZ A;  4NLB A;  3MAB A;  3KFU F;  2BCU A;  5ALL A;  2DPI A;  3AMZ A;  2JEF A;  5ALI A;  3HP6 A;  4KLI A;  3A0H U;  5ALE A;  2C2E A;  4F4X A;  1HUO A;  1DK3 A;  3THV A;  2OHF A;  8ICI A;  4UAS A;  4QZI A;  5AI0 A;  2PI5 A;  2FMS A;  3WK8 A;  2RLT A;  3K4G A;  2LM4 A;  1X2I A;  2F8L A;  4BGD A;  4QZB A;  8ICJ A;  3HKZ C;  5J2I A;  4KMO B;  3EPI A;  2Z7J A;  4PGY A;  4I2C A;  4YVZ A;  3MR3 A;  5J2G A;  5ALR A;  2MUT A;  4DWI A;  4B6J A;  5KFA A;  5J2C A;  3HJE A;  3M1Y A;  5ALX A;  3VC8 A;  4FFD A;  4Q8E A;  3WKD A;  2G0A A;  1Z4N A;  5KFS A;  2PFP A;  1JN3 A;  5J0X A;  5AK6 A;  5ALG A;  3MDC A;  3ONN A;  4DFP A;  2E8O A;  5AKJ A;  9ICE A;  4UAT A;  2ISO A;  1XC9 A;  2PMZ F;  4US8 A;  2KVC A;  2KTQ A;  1H38 A;  4JB3 A;  1PVQ A;  5L1K A;  3OSN A;  4LVS A;  2W9C A;  5AI4 A;  5ALJ A;  4UAY A;  4O3Q A;  3MR6 A;  1U48 A;  1LKY A;  1RQN A;  9ICK A;  1NJZ A;  4FZN A;  1FEZ A;  1XU4 A;  2LPE A;  5AM0 A;  4I2I A;  2W54 A;  4OJ5 A;  4C8N A;  2VA2 A;  4ELU A;  5B5E U;  3QE9 Y;  1S97 A;  2H5X A;  5KG4 A;  1S8O A;  7ICJ A;  2G5I B;  4K4G A;  4BJQ A;  3TAN A;  1JI7 A;  5KFL A;  4QZD A;  2F1J A;  4UW9 A;  3GIL A;  2LM1 A;  1U45 A;  1X9X A;  5KFP A;  4CGZ A;  3UQ0 A;  3SAG A;  2E3T A;  3MBY A;  1PVR A;  8ICL A;  3H4D A;  4XQ8 A;  4F5P A;  1BNP A;  2LHT A;  2W9B A;  4UAZ A;  2KJ5 A;  3SAF A;  4HAI A;  2FPL A;  2BCS A;  2KP7 A;  4ED1 A;  3WK5 A;  3M9O B;  1A0P A;  4PHA A;  3JPN A;  4QJF B;  3K1Z A;  2XCA A;  3GII A;  2VJ4 A;  1BNO A;  4F71 A;  9ICX A;  1PK3 A;  1L7O A;  5KG5 A;  1SXE A;  9ICS A;  5J8Y A;  2W3S A;  4O0I A;  5AM2 A;  2C2R A;  4ED0 A;  2RP5 A;  3G6X A;  1ZQL A;  3HIL A;  3CW2 C;  3SV4 A;  5C0Y A;  2KHQ A;  3BS5 B;  3KHH A;  1ZQC A;  5III A;  2W8L A;  1IXR A;  3H0L B;  1EXN A;  2I1Q A;  5CR0 A;  2HCF A;  3RB0 A;  1Z4O A;  1V97 A;  5KAF U;  4O3M A;  4QW9 A;  5DDM A;  5J2B A;  1ZET A;  2VAN A;  9ICB A;  3HWT A;  2J6S A;  3RB4 A;  1RPL A;  1SWW A;  1D8Y A;  3QU9 A;  5EWG A;  4IRC A;  2HBJ A;  5AM4 A;  2H3F A;  1ED1 A;  4J9M A;  2RHF A;  3D2N A;  3IP4 B;  4DQR A;  5C5J A;  1X42 A;  1D9F A;  2OH2 A;  3BDP A;  1L7N A;  1L5U A;  2RDJ A;  3AUO A;  4ECU A;  3IDW A;  4DFK A;  1TVA A;  2KSO B;  1UA1 A;  3H8M A;  5H2F U;  1S0N A;  5KFI A;  2YY6 A;  4P0P B;  2F1H A;  4RQ4 A;  4DO9 A;  3RH5 A;  3PSP A;  4IQW A;  3F5A A;  4C8O A;  2KJ9 A;  4P0Q B;  5KT6 A;  4F4W A;  4UBB A;  8ICT A;  7ICT A;  5DDY A;  3RH4 A;  2AGP A;  2NRW A;  1ZQI A;  5D46 A;  3QEA Z;  2YX8 A;  1XO1 A;  2ZJ5 A;  4Y2R A;  3UMG A;  5AM3 A;  5KFU A;  2AQ4 A;  3ZDC A;  2UVU A;  2KD1 A;  3KHG A;  7ICS A;  3M8S A;  4F93 B;  1RZT A;  4BDP A;  2AJQ A;  2F8K A;  3BQ0 A;  2DKX A;  3MFH A;  2ZIX B;  4YR2 A;  4KLG A;  1MN8 A;  3OHB A;  3EZ5 A;  3V7K A;  2FLL A;  3QNM A;  4YQW A;  2A3V A;  2V4Q A;  2E8N A;  4O9M A;  4PJ0 U;  2MAX A;  9ICG A;  2LBO A;  2P6U A;  1F5S A;  4Z6C A;  4F72 A;  4EEY A;  2IOF K;  4F5N A;  4ICA A;  3LWL A;  3UXN A;  3EYZ A;  3H0R B;  4QZE A;  3GDX A;  4TUR A;  3C29 A;  4DQS A;  3MGH A;  4NLC A;  2OM6 A;  2IBK A;  5J0T A;  1FFU A;  1RQL A;  2M0N A;  5ALQ A;  5AKE A;  2NV3 A;  4GFJ A;  2ZIV A;  4NJ8 A;  3LVW A;  4CF4 A;  4GXJ A;  1ZQY A;  5ALW A;  4NM2 A;  5ALY A;  1FFV A;  3V6J A;  2D3D A;  2RQ5 A;  4RQ0 A;  5AKL A;  2HHX A;  2GOL A;  3LWM A;  4YMM A;  5KFO A;  2LI6 A;  2A19 A;  1F0M A;  3U26 A;  2EAM A;  3JPQ A;  1A77 A;  3UQ2 A;  4FBT A;  5J0R A;  7ICI A;  3BS7 A;  1ZQP A;  1ZRN A;  1YZ6 A;  2Y1I A;  1ZQZ A;  2W03 A;  1ZQT A;  3BS5 A;  3BQ7 A;  2PFQ A;  4Y2V A;  1CRX A;  2UVW A;  1TAU A;  1ZQW A;  4KLE A;  7ICR A;  4I29 A;  2KZ3 A;  3QU5 A;  1LV5 A;  4IRD A;  1ZQ1 C;  1XSL A;  3BJY A;  4M04 A;  4FZL A;  2WB1 C;  4A8E A;  2HI0 A;  4JV1 A;  4I2E A;  4F4K A;  4EZ6 A;  1BGX T;  3PO5 A;  2CN1 A;  3IV6 A;  3OJS A;  4RPY A;  4ECT A;  1MQ2 A;  1DK2 A;  1SZH A;  3NGD A;  1GO3 F;  2AHO B;  2H3Q A;  9ICR A;  4R8U A;  2FPM A;  3NAS A;  4DL4 A;  2KSO A;  3ICX A;  3EW9 A;  5KFE A;  4PHP A;  5J0O A;  4Y2X A;  5KG2 A;  4ZH4 A;  4QWE A;  4P0P A;  2KEY A;  5DB6 A;  4UB8 U;  2Q0Z X;  1KW4 A;  2JHD A;  3G6Y A;  1ZQO A;  2PFN A;  2Y0S F;  4P4P A;  3GQC A;  4F92 B;  1KQQ A;  4C0Z A;  2R8I A;  3PSI A;  2H3V A;  2GH1 A;  3HPO A;  2HOQ A;  5ALF A;  1NOM A;  4Y2T A;  5J2J A;  4Z6E A;  5CEH A;  3WKE A;  1QSL A;  1RG6 A;  4TUQ A;  8ICO A;  5ALV A;  2GO7 A;  1Z00 A;  3KTQ A;  1L3T A;  9ICJ A;  3RJI A;  3SZ2 A;  2YQE A;  1Z1B A;  9ICQ A;  1N56 A;  9ICA A;  1QLN A;  8ICM A;  1ZQJ A;  1S0V A;  1OUQ A;  2NO5 A;  4QZF A;  3PV8 A;  3KOO A;  4NLZ A;  5HMM A;  3Q8M A;  1BPB A;  2F3N A;  9ICT A;  1KLN A;  4CF5 A;  2FE9 A;  2JR5 A;  5L1I A;  4F4Z A;  5AKY A;  3NTU A;  4RNM A;  5AKK A;  9ICH A;  4ECS A;  2JH1 A;  1NK9 A;  5AM5 A;  5F3X B;  1L3V A;  4KX3 A;  5J0P A;  2RRD A;  4YMO A;  4BUG A;  1RXW A;  2UVV A;  2BGW A;  4RUA A;  1JAL A;  2BZF A;  5KFC A;  4USA A;  1HEK A;  4C4S A;  4YR3 A;  2FPK A;  3M7D A;  8ICP A;  4ECY A;  3SEN A;  4MEY A;  3B9J A;  1OW5 A;  2W3R A;  4KMU A;  4RQ3 A;  4B9S A;  1TAM A;  3IG8 A;  2EDU A;  2W43 A;  4J9Q A;  1U4B A;  3C1Z A;  1UA0 A;  5IIN A;  1KFS A;  3RJJ A;  1KL9 A;  2G06 A;  9ICP A;  4F5Q A;  1J97 A;  4QWD A;  3OSP A;  3TAQ A;  2HVH A;  2PMZ C;  1L7P A;  1MQ3 A;  5AK4 A;  2NRX A;  2N1R A;  1NJY A;  2F44 A;  1X6I A;  3I28 A;  2WHE A;  2QAR A;  1T4G A;  2JXJ A;  1L3U A;  4DL3 A;  1K1Q A;  4DCC A;  1KSP A;  2JV3 A;  1ZXI A;  3AU6 A;  5AKG A;  1F44 A;  2HBL A;  4TQS A;  2H3I A;  4UAU A;  5KFG A;  1B22 A;  5KFR A;  2KIC A;  5KG6 A;  3UPQ A;  9ICC A;  5DLG A;  4C8K A;  4C8L A;  1UQV A;  3M9N B;  1Q3V A;  2K4P A;  1BPZ A;  3UMC A;  2JZB B;  4FBU A;  4EBE A;  2Q4T A;  5HP4 A;  2DUY A;  3SYZ A;  1UHU A;  5L1J A;  1UT8 A;  2W11 A;  3MDA A;  1X40 A;  4DS5 A;  1Z19 A;  3RTV A;  2ATL A;  1A6S A;  2EAP A;  4JMU A;  4XRH A;  5JRT A;  1ZQA A;  2W9A A;  3KKA A;  1O08 A;  3HRD D;  4GXI A;  1RYU A;  2KKP A;  1COK A;  3KZX A;  4Y2S A;  2KIV A;  3TAD C;  4M9L A;  8ICG A;  3LYS A;  1X66 A;  4UB4 A;  2YB4 A;  2YN4 A;  5DQH A;  4TUP A;  2C28 A;  4KX5 A;  7ICE A;  1URJ A;  3HX0 A;  3B0Y A;  2ZTC A;  2BDP A;  1NK0 A;  3H8W A;  1NK6 A;  2WF8 A;  2IHN A;  1BPX A;  4GC7 A;  2AH5 A;  3D2Q A;  4YP3 A;  5E79 U;  4J9P A;  2BCV A;  4PZO A;  5AHX A;  3MFI A;  3LVV A;  5KFJ A;  4DLE A;  2G07 A;  2F2A B;  4JK1 A;  3RAX A;  4RQN A;  1U47 A;  4KLT A;  3FDS A;  4GIB A;  4K4H A;  7ICV A;  2BPF A;  2FLN A;  4F5R A;  1TKD A;  1TK5 A;  2LKY A;  5AIB A;  4TUS A;  3WK4 A;  4O3O A;  2E8P A;  4PGX A;  2EAO A;  4F2S A;  4DEZ A;  5KT5 A;  2KJ8 A;  2F76 X;  4EZ9 A;  1PK1 B;  5KFX A;  3C5G A;  1PUZ A;  3T5H A;  1QH9 A;  3RFA A;  3PR5 B;  3WK7 A;  4UAW A;  2W04 A;  1YT3 A;  1TFR A;  5F9L A;  2A1J B;  3WKA A;  3QUT A;  1N2X A;  5AI5 A;  1NK4 A;  2XC9 A;  5AK3 A;  5EE0 A;  3QZ7 A;  4RQM A;  5DLF A;  4G9B A;  4K4I A;  1DGJ A;  3QU2 A;  5IIK A;  4YXJ A;  3H8J A;  1J2M A;  1CUK A;  2K4I A;  4QZA A;  4C7Y A;  1L8O A;  3ETL A;  4CNQ A;  4DSE A;  5BPC A;  2NRV A;  5B66 U;  3NUQ A;  3FM9 A;  3J81 j;  5CB1 A;  1C7Y A;  4YD1 A;  1X6J A;  2R8H A;  4QWC A;  9ICO A;  2KIW A;  4RQ1 A;  3L4P A;  2HBK A;  3QUQ A;  2XIC A;  2DPJ A;  2HSZ A;  4CRX A;  3ZDE A;  1ZQK A;  2ZIW B;  3NRZ A;  3SV3 A;  2YML A;  1TK0 A;  3T3F A;  3R9K A;  5KFD A;  3ZD9 A;  1BPD A;  1SKS A;  2KZM A;  3TI0 A;  2LMR A;  4DL7 A;  1N60 A;  2YB1 A;  4KLJ A;  3E58 A;  4BWJ A;  5KFY A;  1L7M A;  4IRK A;  1NKC A;  3RH6 A;  4EBC A;  1X9W A;  5DKW A;  4NWI A;  3RBD A;  1ZQD A;  2JZB A;  1NKB A;  4UAR A;  4UB3 A;  2XGQ A;  2HW3 A;  3JPT A;  3E0F A;  1ZQU A;  1Q46 A;  3FAH A;  3TAC B;  8ICQ A;  4C4T A;  5EOZ A;  9ICL A;  1Z3E B;  7ICQ A;  1M6Y A;  1S0M A;  5AI8 A;  1MSW D;  2ZIU B;  4RZR A;  4PHD A;  1D8B A;  3Q8R B;  2WF7 A;  5CP2 A;  4GC6 A;  2Y9U A;  5KG1 A;  2HMX A;  4LJX A;  1U49 A;  1QCK A;  2QB1 A;  3F5E A;  4QZC A;  5AIC A;  5L1M A;  5EE9 A;  4OCZ A;  4YR0 A;  9ICU A;  2OXO A;  4DOB A;  5J0Q A;  1RXV A;  5DBB A;  4M9H A;  3TAD A;  5KT2 A;  3TFS A;  4KLF A;  3QUC A;  1N5W A;  9ICM A;  5G5G A;  5KL1 B;  2KN7 A;  2E8M A;  2NRT A;  1BPE A;  4Z6D A;  3PX4 A;  1QQ5 A;  4I28 A;  4ECV A;  3GIM A;  1ZRM A;  3N7P D;  3ED5 A;  5AKI A;  5KT7 A;  5AI6 A;  1ZQH A;  3BQT A;  1LVH A;  3JPR A;  4R64 A;  2OYY A;  3T5L A;  3C21 A;  2C2D A;  3ETR A;  1UPH A;  5KG7 A;  2IA6 A;  1WWV A;  3FYH A;  3PX0 A;  2KKV A;  1PVP A;  2OEH A;  5KFH A;  4EYI B;  3JPO A;  3DV9 A;  2A1A A;  3RJG A;  1PK1 A;  1XS9 D;  3AN1 A;  5GTH U;  4M9N A;  3T5J A;  8ICX A;  3JPS A;  4RT3 A;  4B9L A;  2ESE A;  4DQP A;  2AXT U;  5J2E A;  1WYG A;  2Y1J A;  2W9M A;  3A0B U;  3RRH A;  2A1J A;  3AL0 B;  4O5C A;  2YTU A;  4KLS A;  3PZP A;  4AYB F;  2P6R A;  1J2N A;  4KIT B;  3QYP A;  2KV2 A;  3L5K A;  3HT3 A;  4YN4 A;  4YFK A;  4QZG A;  2JGA A;  5HML A;  2YMP A;  2CPR A;  2WAQ F;  2BQU A;  2FMP A;  1OXJ A;  5IIO A;  5F9N A;  3Q8K A;  1NKE A;  2BHN A;  2UVR A;  5J2F A;  4ED7 A;  4MF8 A;  1IM4 A;  3PY8 A;  2K8C B;  4QZ9 A;  3M9M B;  1ZD3 A;  4CDG A;  3LDA A;  1BVS A;  2Y0S C;  2HOI A;  4ECW A;  2C22 A;  2RDI A;  3IHQ B;  2XCP A;  2ZJ8 A;  5EE1 A;  5IIM A;  5KAI U;  1X9S A;  4P4O A;  1KDH A;  4M2Y A;  2ZIW A;  4B9U A;  2KNJ A;  5EWE A;  1NK7 A;  3Q8Q B;  1L6N A;  1L8L A;  3RBE A;  2NO4 A;  1XNS A;  5HHI A;  5EE3 A;  3ZDA A;  2QKQ A;  4ECZ A;  8ICB A;  4MEX A;  3MR2 A;  3NVY A;  1B4F A;  4IR1 A;  2F77 X;  4NLK A;  3PW7 A;  2JRZ A;  2NYV A;  1JXE A;  4J9N A;  3UMB A;  2KZZ A;  5AI9 A;  5HHH A;  3RJK A;  2ASJ A;  2V9W A;  8ICK A;  5ALH A;  3H0M B;  3C2M A;  3I76 A;  4J9L A;  3KHL A;  2IOF A;  9ICW A;  5J0S A;  1HIW A;  2EAN A;  4I2J A;  3IG5 A;  3Q8L A;  5TZV A;  4QIW F;  3NVW A;  5ALU A;  3FC4 A;  4KN7 A;  5J2D A;  3MGV A;  1NI3 A;  4Q45 A;  2L5Y A;  2MRL A;  2BR0 A;  4I2A A;  4TQR A;  1WCN A;  2QB0 B;  2ES6 A;  3PNC A;  4IQV A;  2XY5 A;  5CRX A;  4P0Q A;  1MA7 A;  1KFT A;  3MGI A;  3SD7 A;  2ZUB A;  3ISC A;  4PHE A;  5FP0 A;  2E1E A;  3TAP A;  3RR8 A;  9ICI A;  2DF4 B;  3MR5 A;  1SIJ A;  3C23 A;  3TAR A;  3EWA A;  4FS1 A;  3AEV A;  4I2F A;  4F2R A;  3F53 A;  4P4M A;  3QXG A;  4RNO A;  5DBA A;  5DQG A;  3KZI U;  5L1L A;  3PW2 A;  1KKX A;  2IOH A;  3OGU A;  4F5O A;  3ISB A;  2KFZ A;  1SXD A;  3RJF A;  5J2K A;  2ZIX A;  4F4Y A;  1S9F A;  4NLN A;  3ZDD A;  2XI9 A;  1DOQ A;  1TAQ A;  2I9G A;  1FO4 A;  4M9J A;  4IQU A;  3F2B A;  5ALP A;  1DXS A;  2ZJA A;  2ISP A;  1LKY B;  4KLL A;  2DBY A;  2W7O A;  3UXP A;  4M9G A;  3L3F X;  4ECR A;  3N7S C;  2WB1 F;  8ICC A;  8ICH A;  2HHU A;  4F3O A;  7ICU A;  8ICZ A;  5IIJ A;  4O3P A;  1SV0 C;  3WK9 A;  5DB8 A;  1ZQM A;  1RYR A;  5KFB A;  3V72 A;  1V9P A;  1ZQG A;  1WCL A;  3QX7 A;  4MFA A;  3T5K A;  4CCH A;  5J0U A;  2BKE A;  3EUB 2;  4CE6 A;  5AIA A;  4IL6 U;  1COO A;  1SL2 A;  2ZXH A;  3BZK A;  4FS2 A;  3O0F A;  5CHG A;  4F50 A;  2FI1 A;  1WG8 A;  4OD0 A;  2D6F C;  1A76 A;  3SMV A;  4IC9 A;  4YXM A;  4UBC A;  4EEK A;  4RPX A;  1NZP A;  4QWA A;  2JMG A;  3QU7 A;  3QU4 A;  2ZXI A;  4DFD A;  3ORY A;  1XO0 A;  2EZZ A;  2J6T A; 
#chains in the Genus database with same CATH homology
 2K4P A;  1Z1V A;  2KE7 A;  3BS5 A;  3BQ7 A;  2QB1 A;  1V38 A;  5J8Y C;  5L1M A;  1PK3 A;  1X40 A;  2F3N A;  2F8K A;  1SXE A;  5J8Y A;  2FE9 A;  5KNI A;  4RQM A;  2GLE A;  2K60 A;  3KKA C;  2E8O A;  3TAD A;  3HIL A;  2DKX A;  2EAP A;  1SXD A;  2KG5 A;  5JRT A;  5JU5 A;  5F3X B;  3KKA A;  3BS5 B;  2E8M A;  2E8N A;  1SV0 A;  1SV4 A;  5JTI A;  1DXS A;  2DL0 A;  1COK A;  1LKY B;  2KIV A;  3TAD C;  1LKY A;  4MHV A;  1X66 A;  2QKQ A;  4IS7 A;  2LPE A;  3SEN A;  4PZN A;  1B4F A;  2KSO A;  1OW5 A;  4NL9 A;  1SV0 C;  1WWU A;  1WWV A;  2LMR A;  4PZO A;  1KW4 A;  4NJ8 A;  2QB0 A;  1JI7 A;  2D8C A;  1PK1 A;  2EAN A;  1X9X A;  4NL9 C;  4RQN A;  2KMD A;  3IDW A;  1B0X A;  1UCV A;  2DKZ A;  3K1R B;  2KSO B;  2D3D A;  3SEI A;  3H8M A;  2F44 A;  2ESE A;  2QAR B;  2QAR A;  3TAC B;  2E8P A;  2EAO A;  1SGG A;  2JV3 A;  2YTU A;  2L5Y A;  1F0M A;  1RG6 A;  2EAM A;  1V85 A;  2QB0 B;  2B6G A;  2ES6 A;  2Y9T A;  3BS7 A;  1PK1 B;  1UQV A;  1OXJ A;  2Y9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...