5JU5A

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
60
structure length
60
Chain Sequence
NISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5ju5A00
1LKYB 3BS5A 2ES6A 2KMDA 4IS7A 3KKAA 1KW4A 4PZOA 1SV0A 5KNIA 5J8YA 2KIVA 3BS7A 1WWUA 3TADC 2YTUA 5F3XB 1SV4A 2DKXA 4NJ8A 3TADA 1PK1B 2QARA 1V38A 2E8NA 2L5YA 2E8PA 2QB1A 2E8MA 3BQ7A 1Z1VA 1B0XA 1V85A 3KKAC 1SV0C 1UCVA 2K60A 5J8YC 2QKQA 1SXEA 2EANA 2KSOA 5JRTA 1X9XA 2FE9A 1LKYA 1RG6A 1X40A 2B6GA 2Y9TA 4RQMA 3K1RB 1SXDA 2EAPA 1OW5A 1DXSA 2F44A 2KG5A 3SEIA 5JTIA 2ESEA 2D3DA 2F3NA 2K4PA 2QB0A 2EAMA 4NL9A 2EAOA 3BS5B 3TACB 3HILA 4RQNA 1PK3A 2LMRA 4MHVA 1F0MA 2JV3A 1COKA 1WWVA 2KE7A 1SGGA 5JU5A 2DL0A 1X66A 2F8KA 1UQVA 2Y9UA 2LPEA 3H8MA 1PK1A 1B4FA 1JI7A 2GLEA 3IDWA 4PZNA 2QARB 4NL9C 3SENA 2DKZA 2E8OA 1OXJA 5L1MA 2QB0B 2D8CA 2KSOB
chains in the Genus database with same CATH superfamily
4KX5A 1QH9A 5DB9A 2ES6A 2HHUA 3PVXA 1ZXIA 5ALVA 3THVA 2LHTA 4O3MA 3QUQA 2XGPA 2YTUA 2W9AA 4QWAA 5KL8B 3OGUA 2BCQA 4DOCA 5G5HA 1JROA 3NRZA 4R8UA 1XU4A 3F2CA 4KLDA 5KL1B 3LWMA 3UMGA 2OCEA 9ICAA 1YT3A 2FDRA 2K60A 5AM2A 2W7PA 3GZFA 2K4HA 3RJFA 2JGAA 3MGIA 3M8SA 5AI5A 5CP2A 2YB4A 2ASJA 2KNJA 5EE0A 3RJHA 2ZXIA 2ESEA 2DPIA 4EELA 2AJQA 9ICWA 2D3DA 1S0MA 3PZPA 5J0XA 4KLHA 4J9QA 2QB0A 5HMLA 4BWMA 2A3VA 1NK4A 8ICPA 3PW2A 3RB4A 9ICUA 2EAMA 2Q4TA 1S0OA 4NLGA 5AKIA 3TACB 1XO0A 2ZIVA 5KFCA 2PI5A 1F0MA 4I28A 5J2CA 2OH2A 5IINA 2ZJAA 4QZ9A 3GIKA 1C7YA 3V7JA 5ALLA 1MQ2A 2W9CB 3M9MB 1L7MA 5HP4A 4DLEA 2QARB 4KN4A 2AU0A 2ZJ8A 4BGDA 2EZYA 2E1FA 5KFSA 2ZIXA 1SL2A 1YZ7A 1SKRA 2MAXA 2YMQA 1QQ7A 2ZTCA 2PMZC 1Z4NA 4C8MA 2OHFA 4DWIA 3KHHA 3ISDA 5KG4A 3PY8A 2I6XA 4PGQA 1WWUA 4GFJA 5HMMA 1LB2B 3F53A 4TQRA 3EZ5A 2GWSA 1PVPA 1NJWA 3R9KA 3SMVA 2E8NA 4DLGA 8ICVA 2XY6A 1V85A 2P6RA 2NRZA 3RRGA 2KSOA 1NKCA 5K4LA 2E3TA 3E58A 1LKYA 3NUQA 5BPCA 2AGPA 3LVVA 2KFZA 1RM6C 4DQSA 2PFPA 1N61A 9ICEA 5ALIA 1NK6A 5ALKA 8ICIA 1GO3F 2KICA 2R8IA 5JTIA 2WFAA 2KK0A 2K4PA 3CW2C 3AEVA 2PFNA 1KN5A 3PSPA 1FO4A 1ZQDA 1K1SA 4US8A 9ICBA 4DSEA 3JPPA 2KHVA 1BPEA 3RBDA 5KFWA 1ZQCA 3D2SA 3WK8A 2F77X 3WK5A 4OO1J 1XSPA 4RPZA 4RQ0A 4NM1A 5AI0A 4MFCA 1SL0A 2WAQC 4U7CA 3AU6A 4J9PA 5ALXA 2NRWA 1KFDA 4DFDA 4KLTA 3PSFA 3C5GA 2B0CA 2B21A 4QZ8A 5ALJA 4B9SA 4ECWA 1D8LA 1JXEA 3NVWA 5KG2A 3GV7B 2FMQA 4Z6CA 3UM9A 2FLLA 3PR4A 4P4OA 1XSNA 2UVWA 4QWDA 3OJUA 5J2AA 4BJQA 4NJ8A 2BHNA 4NWIA 4KTQA 3HJEA 2RQ5A 2QB1A 2YX8A 4ECSA 1ZETA 3Q8PB 8ICUA 2LM1A 1MSWD 2UVVA 5J8YC 2QKQA 4QWBA 3NS1A 1X9XA 2LYHA 4YCXA 4QNLA 4DL5A 1VJ5A 3ETRA 1SXDA 2ZIUA 2F44A 3WK6A 2HHWA 3AU2A 4F3OA 2HOFA 5KFOA 4CE6A 1ZRNA 4OD0A 2Y0SF 2BQ3A 7ICMA 1KTQA 4R65A 4DF8A 5HHHA 3Q8MA 1XWLA 3BS5B 1KBUA 9ICOA 8ICKA 4QIWC 2YB1A 4UB2A 1V97A 2BCVA 2KKPA 3I1YA 7ICTA 1BPDA 2MUTB 3RAQA 2HMXA 3QNMA 4XUSA 3NVYA 2MA1A 3C28A 4UB8U 3IRUA 3WKCA 7ICJA 3UXOA 3M8RA 2BR0A 1L3UA 5L1MA 4C0ZA 2VANA 3PX6A 3C2LA 1TVAA 2VA2A 1ZYQA 1UT8A 5DG7A 5KFDA 4PZOA 1C20A 5KAFU 2MU2A 2A1AA 5AKYA 4F5OA 2CXYA 4NY8A 1JUDA 3OJSA 4QZAA 4MF2A 3TFSA 4E0DA 2W9MA 4IRCA 3HW8A 2DF4B 4UAVA 5J0RA 4KLOA 4NLNA 3OHAA 9ICPA 4NLZA 2FMPA 3C21A 4GC6A 2JH7A 4Y2TA 5J2GA 1PVQA 3KKAC 1N63A 5ALHA 2XVTA 3SI8A 1T3NA 4KLFA 4EBDA 2C2DA 4ACOA 4IC9A 3MR6A 4Y2QA 4RQMA 2KFNA 3L3FX 3RJGA 3JPTA 1L7OA 3L5KA 5J2JA 4OJ5A 1D8BA 1S9FA 4EZ6A 2XIDA 3HRDD 1U9LA 4ECYA 2KP7A 5DG8A 4YXMA 2BGWA 4I2CA 4QZEA 1NK8A 5CJ7A 9ICVA 2YMLA 3E0FA 1FEZA 4ED2A 4MHVA 3C2KA 1COKA 3QUTA 5C5JA 5IIOA 1X2IA 4EBCA 4QZGA 7ICSA 2W9BA 2ODGA 2KOBA 3PW7A 5J0PA 3JPQA 4J9LA 2XI9A 2NRTA 2WHEA 2RLTA 5AKHA 4RUCA 2JZBB 2WF6A 3IHQB 4ELTA 3G6XA 1BPYA 8ICGA 4BDPA 2XCAA 1NJXA 4UAUA 2LYAA 3GV8B 4JWMA 3KHGA 4M9HA 1RQNA 1SWWA 2AH5A 3H0MB 2HDOA 5AICA 4F4KA 5C0YA 4PGYA 4AP9A 4O5CA 5CRXA 2HVIA 2BQRA 1MN8A 2C22A 2A1JA 3UMCA 3RJKA 1H38A 2MRLA 2P35A 5J2HA 2JR5A 1J2MA 2JHDA 1QCKA 1ZD5A 3EW9A 2I5HA 3RTVA 2AGOA 4DL3A 2FLPA 3KZIU 4Y2XA 3QU4A 3PX0A 3NVVA 1UCVA 5ALEA 3QEBZ 1JIHA 2M9NA 3H8WA 5J2EA 4RQ3A 4O3QA 4BUGA 4QW9A 5ALPA 1OW5A 1DXSA 4FZNA 4C7YA 8ICRA 4I2GA 1NNLA 3Q8KA 1Y88A 2OM6A 2RDJA 4P2HA 4YVZA 3TI0A 4IRDA 1CEZA 2YY6A 5AK3A 2BKEA 7ICFA 3SAHA 2G5HB 2WF7A 4ICAA 8ICBA 1PK3A 3JPOA 5KFJA 3MR5A 2JV3A 1D8YA 3G6VA 4IQWA 2XGQA 4DQQA 2GOLA 3GFKB 5KFPA 2KE7A 2LBOA 2IOHA 1Q3VA 4PL1A 4RQ4A 4G3IA 5EWEA 1DGSA 3IDWA 5AM3A 4NLKA 1WYGA 3Q8QB 8ICNA 3V6JA 5AKKA 5AI8A 4O5KA 1NZPA 4B9VA 2HW3A 2W03A 1QLNA 4IQVA 4YFKA 4RQ2A 1AROP 2F8LA 4YP3A 4K4IA 3RB3A 4F5PA 4I27A 4IS7A 4US9A 5AM4A 5J0TA 1KW4A 1ZQ1C 5KFLA 5DQHA 2G07A 5KNIA 2IHNA 2RP5A 4TURA 2W9CA 3ZD9A 3F5AA 2EH9A 5AKZA 1IV8A 1PK1B 5J0UA 2F76X 2QARA 2VJ4A 2D6FC 1V38A 5J0QA 3EPIA 1A77A 4O5EA 3N7RC 3N97B 4M04A 1KQQA 4UW9A 5HHIA 3V6HA 4DFMA 1TKDA 2F1IA 4PHPA 5D46A 3QEAZ 3WK4A 4UBBA 1RQLA 4DSFA 2KVSA 2XC9A 2B6GA 1ZQAA 4UATA 1PUZA 1HJPA 8ICLA 3AN1A 3MDCA 2ISPA 3K1RB 2ZUDA 1BVSA 2JEGA 1NI3A 1ZQIA 3TANA 2W8LA 3HWTA 3L4PA 4DQPA 4M2YA 8ICFA 4EEYA 2H5XA 3PO5A 5F9LA 2ZXHA 4Q45A 4M47A 4FE3A 2Y0SC 4YMMA 3GILA 4ECXA 4NL9A 2BDPA 2KKVA 4KMOB 4I2HA 4J9KA 4QZFA 5CHGA 3NVZA 5IIKA 5AKXA 3MC1A 7ICLA 3KFUF 1S8OA 3GQCA 4QWEA 3S6JA 4J9RA 5E79U 1ZQNA 1ZQLA 2J6SA 4PGXA 3BQTA 4UAZA 9ICXA 1X9MA 1X6JA 3V6KA 3UQ0A 3AUOA 4EZ9A 2DFLA 1Z4OA 1KL9A 1Z19A 4YXJA 4DL2A 2H3ZA 3BJYA 5KFZA 3QZ7A 5AI6A 5KT4A 3ZDBA 4BWJA 4ED8A 2HHTA 1SV4A 3T5HA 4I2IA 4FZLA 4TUPA 1ZQZA 3M6ZA 1RPLA 1ZQHA 2ZUBA 3TAQA 1T7PA 2OWOA 4IL6U 1FFVA 1Z3EB 2HHVA 5KFKA 1BPBA 4DL4A 4C4TA 5DQGA 3HKZF 2JEJA 4PH5A 1SZHA 3SEIA 2VIXA 1U45A 4RPXA 4EENA 5HR6A 4KLSA 3MGVA 1T8EA 5AM5A 1UT5A 2N1RA 2ASDA 4J9SA 3I76A 1LVHA 2R18A 3B9JA 4RT3A 5KG6A 2O6KA 3RJJA 1ZQMA 4RT2A 1U4BA 1ZQQA 1KFTA 3ORYA 2C2EA 3AQEA 4F5RA 4O3NA 3LYSA 4DEZA 1U48A 3UXPA 1FIQA 4RQ6A 4I2EA 1ZD3A 1X66A 1N56A 1ZD2P 2XICA 3RRHA 2R8HA 1L7NA 5ALWA 4J9OA 2G08A 2KD1A 1SZPA 2Z7JA 3F2DA 4KX3A 3K75D 1RYRA 2BDUA 1DK3A 4EBEA 2QB0B 2F2AB 2HBMA 8ICXA 5T14A 2HBJA 3BS5A 4Q44A 2H3VA 5AHXA 2ZIVB 4EYIB 1XS9D 1BPXA 1VDVA 3MBYA 4IR1A 5DLGA 4R64A 3A0BU 4GXIA 2KJ5A 1NJYA 3VCBA 3ZI4A 3RR8A 9ICCA 2MUTA 4R63A 3PR5B 2ZTEA 1ZRMA 4QWCA 2KVCA 4DFKA 1BPZA 2NO5A 4FZMA 4QZDA 4XRHA 1NJZA 1NKEA 1WUDA 4Z6EA 2FLNA 3DV9A 3RH5A 8ICCA 3PW5A 4FBTA 3BQ1A 2XCPA 1HEKA 9ICQA 3PX4A 2IOFK 4KLQA 1QQ5A 2K8AA 3M9OB 3SQIA 1QSLA 2HCFA 1IM4A 3B0XA 7ICHA 5B5EU 4CF3A 3CNHA 3ZD8A 3TAPA 5AIAA 4USAA 4ECRA 1ZQOA 5ALUA 2P6UA 1BNPA 4BXOB 1CRXA 1KFSA 1HUOA 2HVHA 1KKXA 3H8MA 2HHSA 1TK0A 4M9JA 2KZZA 3LWLA 5DBCA 4Y2SA 8ICJA 2JH1A 2AGQA 4KLJA 2BQUA 2IBKA 2D8CA 4Q8EA 1D9FA 4JV2A 4G9BA 4DCCA 1URJA 1XC9A 2Y1JA 2E5SA 4LJXA 2C28A 2RDIA 4XQ8A 4JWNA 3RF9A 4C4SA 3GIJA 2KIVA 1L3TA 8ICSA 1F5SA 1ZQSA 4F8RA 4DS5A 4P0QB 2V4RA 5KFBA 1JRPA 4DO9A 3ALRA 3QZ8A 4DFJA 2CN1A 4F91B 2JZBA 7ICOA 4EX7A 4GXKA 5KFMA 4C80A 5KFFA 2W04A 1RDFA 1RG6A 5ALMA 3IM1A 5ALSA 7ICUA 4PHEA 3IN5A 5ALRA 4UAWA 2PI4A 8ICMA 4KLEA 2EZXA 1QSYA 8ICEA 3SV3A 3SV4A 4F50A 3A0HU 1AQ6A 1JXLA 3NTUA 4HYKA 2ALZA 4I2BA 3I28A 1J97A 2HHXA 4UB6U 4Y2UA 8ICTA 3Q8RB 4DL6A 4RQNA 5DG9A 5ALOA 4J9MA 1TK8A 7ICQA 4AYBF 5B66U 5AI9A 2AQ4A 4B9NA 4QZBA 4P0PB 4IQUA 3N28A 2LPEA 3H0LB 3WKAA 4DSIA 1B4FA 3DDHA 1RZTA 5DDYA 1ECWA 2NYVA 5J0SA 2YMMA 1ZQJA 4KITB 5KFGA 1OXJA 2KTQA 3PW0A 1U49A 3MABA 4TUSA 2ATLA 4X5VA 4B9LA 3C5FA 1S0NA 1EXNA 4K4GA 3RR7A 3AM9A 1ZJNA 1ZQBA 1L5UA 4DF4A 5J2BA 9ICMA 4KLMA 1SV0A 4TUQA 3Q8LA 3K1ZA 4QZIA 2R8KA 1DRGA 1WG8A 1L8LA 4YMOA 5IILA 3G6YA 4ELUA 3UMBA 1JN3A 3ZDCA 4YQWA 3TARA 3OTQA 3UQ2A 2E8MA 3ONNA 4DL7A 4I2JA 3U26A 2K8BB 4CCHA 2XY5A 5AK6A 1JALA 5KT3A 2WF8A 3QUCA 4Y2YA 4UB5A 4OJPA 4MFAA 2FE9A 5KFXA 7ICGA 2ZTDA 4F92B 3MFHA 2KZMA 1X6IA 1S76D 4KN7A 2OEHA 4YR3A 1A76A 4MF8A 3C2MA 3ICXA 5CEHA 3D2NA 3MGHA 5G5GA 4O3OA 3HKZC 4PPXA 2F3NA 3WU2U 3C1ZA 1QQ6A 2R8GA 3GV5B 3T5JA 2KV2A 4UARA 3ZDEA 1QTMA 5BOMA 1V9PA 9ICFA 4O3PA 1QSSA 4ED7A 4I29A 1WWVA 1NK0A 5J0OA 1O03A 5KT7A 1NZBA 4OCZA 3JPSA 4LZGA 4IR9A 4JK1A 2K8CB 5ALGA 2G09A 1YZ6A 2UVRA 2PFQA 3RB6A 2PFOA 4P4MA 4C7ZA 2W7OA 1XO1A 4FS1A 1N60A 1SL1A 4C8OA 4DSJA 3K4GA 2JXJA 4UAYA 1KDHA 4XA5A 4MEYA 1SKSA 3FYHA 7ICNA 3EWAA 2ZIWB 4LZDA 5J2DA 1ZQGA 2HSZA 2LI6A 1HIWA 1MC8A 3SR6A 4Q8FA 3JPRA 5KFAA 4M0AA 1B22A 2W11A 4CDGA 4JV0A 3BS7A 7ICPA 3TADC 2AXTU 5F3XB 3TADA 5CA7A 4B9TA 3JPNA 3LDAA 1WCNA 1S0VA 5ALFA 3SZ2A 4EEKA 5L1IA 4KLLA 5IIIA 3DEEA 2YMPA 3WK7A 4KMUA 4UB1A 2ZUCA 3OSPA 3M9NB 2HOIA 2Y9TA 2H3FA 1PVRA 3E2EA 5AM1A 5GTHU 4RNMA 3PSTA 1ZQTA 1P7DA 2HHQA 3QU2A 2F1JA 2MSNA 2XY7A 8ICOA 5KFYA 4TQSA 1DK2A 4F5QA 4GLXA 4O3RA 4F4YA 3HPOA 1L8OA 2C2RA 2I1QA 3T5KA 3C1YA 4DOAA 2BCRA 4I2FA 1L7PA 3PSIA 1ZQPA 1SIJA 3KOOA 3RFAA 3VC8A 1TK5A 3RJEA 2M0NA 3KZXA 5J2IA 2Y9UA 5KFQA 4F93B 7ICRA 4NL9C 2ZG6A 4YMNA 4RNNA 2YQEA 1N62A 5HR7A 5ALDA 4I2AA 9ICSA 4JUZA 2LKYA 3OPXA 3TQ1A 3F5EA 4CRXA 5DGAA 5H2FU 4QJFB 2FI1A 5KAIU 3N7PD 3ZDDA 1Z00B 2GH1A 4F4XA 2Y1IA 5EE1A 3OSNA 4QZCA 1OUQA 9ICKA 2VA8A 5KFEA 2WTFA 1ZJMA 4Y2PA 1N5WA 1ZQUA 3D6JA 3LVWA 4U6PA 5L1JA 1ZQVA 5D4BA 2PKEA 2E8PA 1KEJA 9ICTA 4CF5A 3N7SC 4Z6FA 5EE9A 5DDMA 2WB1F 4WJ3B 3M1YA 1T3QA 2KHQA 3H40A 4UASA 5KFTA 1NKBA 5J2FA 1F44A 3V72A 3QUBA 4RPYA 4ZOHC 8ICAA 3M6KA 2EAPA 4ED1A 1TE2A 4C4RA 2IMWP 2V4QA 1NK5A 2K4EA 2HI0A 3T5LA 3ISBA 4JV1A 1ZQEA 4YR0A 4BX9C 4M6WB 4FS2A 9ICHA 4PHDA 2PXIA 3RBEA 2H3QA 4DSKA 2KJ8A 2EDUA 5DQIA 2GO7A 2HBLA 2DGZA 4FFDA 3T3FA 2G0AA 4AYBC 5AKGA 3FAHA 3SAGA 5EOZA 4EYHB 3ISCA 2NV3A 3NASA 2E1EA 3WK9A 3BQ2A 3SENA 2JMGA 4Y2RA 4R8UB 4RZRA 9ICJA 4ELVA 4DFPA 3EPGA 3GU3A 1VLBA 3V7KA 3CYMA 2HOQA 4ZH4A 2RRDA 3QU9A 3D2QA 4NV0A 2KMDA 1NOMA 2NO4A 2VKQA 1ZQXA 5KFVA 4BXOA 2DKXA 4J9NA 1ZQRA 2K89A 4R66A 3AL0B 1UHUA 1B0XA 3WKDA 3ED5A 3QE9Y 5L1KA 3HT3A 4YN4A 2JEFA 3IV6A 1K5OA 2EANA 4IRKA 3H0RB 3IG8A 2KIWA 1X40A 4CNQA 4B9UA 4J03A 1S97A 1J2NA 2LM4A 5D49A 1JX4A 5L9XA 1Q3UA 2W8KA 4RUAA 2KG5A 3H7IA 5KFNA 4DOBA 2W43A 2G5IB 4P0QA 3F2BA 2QLTA 2ZIXB 1X9WA 2FPMA 2IOFA 4IQTA 1TAMA 3SAFA 4FO6A 4ECUA 3QYPA 1ZQKA 3HILA 1Q46A 5KG3A 3GIMA 7ICVA 1ED1A 4M9GA 2RHFA 4F71A 1SKWA 1KSPA 3MDAA 2LYBA 1Z1BA 4C8LA 4ECVA 5AM0A 3NGDA 3ETLA 5AKLA 2BCSA 4MEXA 5KG0A 3H4DA 3TKAA 1KRPA 2F8KA 4M9NA 2HBKA 1L3VA 8ICZA 3PMNA 3TFRA 1Q8KA 4PZNA 2A19A 1TFRA 5KG7A 1X9SA 5DB6A 5CB1A 4RQ7A 3EYZA 5DBAA 4ED3A 4RNOA 2KZ3A 5KG5A 3BQ0A 2KSOB 4EX6A 5IIMA 5KTQA 4RU9A 1FFUA 4Z6DA 1LKYB 2FPKA 2ISOA 3IG5A 2BPFA 3UPQA 8ICYA 5DBBA 5KFIA 3KTQA 1N5XA 5J8YA 3WKEA 4ECQA 2W3SA 2ASLA 2W54A 4P0PA 1ZQWA 2BCUA 3V7LA 3PV8A 4UQGA 2L5YA 5DLFA 1Z1VA 3Q8SB 4F4ZA 2G06A 8ICWA 3CP8A 1SXEA 4QZHA 5JRTA 3QU5A 4B6JA 2BPGA 3MFIA 1TAQA 2V9WA 9ICIA 5ALTA 4RQ1A 2Q0ZX 4Q43A 4PL2A 4YR2A 2I9GA 4DQRA 4ED6A 3UXNA 2UVUA 7ICEA 2CPRA 3PNCA 3C29A 3SYZA 4DQIA 8ICQA 1RYSA 3QXGA 1UPHA 1SB3C 2EAOA 5DB7A 3CRXA 1B43A 8ICHA 3OHBA 1CUKA 2OYYA 3BZCA 4NXZA 2FMSA 3RH4A 2IHMA 1SGGA 4GXJA 2WF5A 2DL0A 2BPCA 1UQVA 2WF9A 2DWQA 5AKJA 3H4BA 4LVSA 1JI7A 9ICLA 4JMUA 5CWRA 1A0PA 3T79A 1XNSA 1KLNA 4I2DA 3FDSA 5J2KA 2EZZA 3J81j 4C8KA 5GTIU 4O9MA 3BDPA 2PMZF 4Y2JA 3M7DA 5BOLA 4FBUA 1IIPA 2EQYA 1ZD4A 3KKAA 1JMSA 1TV9A 3LK9A 2ZIUB 3B0YA 5JUMA 5TISU 1A6SA 1PZNA 2ZJ5A 3H8SA 1L3SA 4O3SA 1MA7A 1S77D 1NK9A 4F5NA 5KG1A 5FP0A 1UA1A 5DKWA 5ALNA 2VA3A 4YD2A 1T4GA 2BZFA 1SV0C 3KD3A 5KFUA 9ICRA 4O0IA 5L1LA 4MFFA 3QX7A 5ALYA 3KHRA 3HX0A 2WB1C 3FM9A 2ZIWA 2YN4A 5J0WA 3PW4A 4KLUA 4RQ5A 4Y2VA 2DUYA 3H8JA 4NLBA 3PMLA 4PJ0U 2J6TA 3GIIA 2R8JA 7ICIA 5AI4A 1X42A 5J29A 2CRXA 1WCLA 3FC4A 3AQFA 5AKEA 9ICGA 1LV5A 3SD7A 1U47A 5AK5A 1ZQFA 1HUZA 2P66A 2FJ6A 2LMRA 5DGBA 2H3IA 4P4PA 5EWGA 4PHAA 5IIJA 1DOQA 4GIBA 3RH6A 3RB0A 5CR0A 4NLCA 5KT6A 1BNOA 1D9DA 2WAQF 1PK1A 7ICKA 2FPLA 3AMZA 5AIBA 1MQ3A 5ALZA 4F4WA 2DKZA 4YD1A 3GDXA 4F2RA 4YG2A 1RXWA 4DS4A 4ED0A 3QU7A 2OXOA 5HNKA 4KLGA 3C23A 1T94A 3O0FA 1XSLA 3KHLA 5F9NA 5TZVA 4UBCA 4UB4A 1DGJA 3N4MB 2KJ9A 2JRZA 3PO4A 3RAXA 1M6YA 2DQNB 2NRVA 4RQ8A 2W3RA 4DSLA 2KEYA 4JB3A 3MR2A 2DBYA 1COOA 4NM2A 4C8NA 3IP4B 3KBBA 1IXRA 4OJOA 3BQ7A 1S10A 2W55A 2IA6A 3ZDAA 5KFHA 4A8EA 5A0LA 2NRXA 4CGZA 3HP6A 1RYUA 1N2XA 3RJIA 4F72A 2KN7A 2W9BB 4UB3A 1CI4A 4QW8A 2AQ0A 1Z00A 9ICNA 5KT5A 4K4HA 5DB8A 2F1HA 5EWFA 1ZQYA 5ALQA 4ECTA 2K4IA 5AK4A 3WKBA 1IG6A 2J6UA 4OJ6A 2AHOB 4QIWF 4ECZA 3NRWA 2VJ5A 5EE3A 1K1QA 1SWVA 3MR3A 4KLIA 2A1JB 1UA0A 4OJLA 5JU5A 1S5LU 1O08A 4HAIA 5J0YA 2DPJA 3EUB2 4GC7A 2GLEA 1ZOLA 3BZKA 5KFRA 4F2SA 1L6NA 1BGXT 1N48A 1RXVA 4B9MA 2JEIA 4M9LA 1NK7A 2E8OA 2XO7A 5KT2A 1TAUA 4CF4A 4M6WA
chains in the Genus database with same CATH topology
1LKYB 3BS5A 2ES6A 2KMDA 4IS7A 3KKAA 1KW4A 4PZOA 1SV0A 5KNIA 5J8YA 2KIVA 3BS7A 1WWUA 3TADC 2YTUA 5F3XB 1SV4A 2DKXA 4NJ8A 3TADA 1PK1B 2QARA 1V38A 2E8NA 2L5YA 2E8PA 2QB1A 2E8MA 3BQ7A 1Z1VA 1B0XA 1V85A 3KKAC 1SV0C 1UCVA 2K60A 5J8YC 2QKQA 1SXEA 2EANA 2KSOA 5JRTA 1X9XA 2FE9A 1LKYA 1RG6A 1X40A 2B6GA 2Y9TA 4RQMA 3K1RB 1SXDA 2EAPA 1OW5A 1DXSA 2F44A 2KG5A 3SEIA 5JTIA 2ESEA 2D3DA 2F3NA 2K4PA 2QB0A 2EAMA 4NL9A 2EAOA 3BS5B 3TACB 3HILA 4RQNA 1PK3A 2LMRA 4MHVA 1F0MA 2JV3A 1COKA 1WWVA 2KE7A 1SGGA 5JU5A 2DL0A 1X66A 2F8KA 1UQVA 2Y9UA 2LPEA 3H8MA 1PK1A 1B4FA 1JI7A 2GLEA 3IDWA 4PZNA 2QARB 4NL9C 3SENA 2DKZA 2E8OA 1OXJA 5L1MA 2QB0B 2D8CA 2KSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY B;  3BS5 A;  2ES6 A;  2KMD A;  4IS7 A;  3KKA A;  1KW4 A;  4PZO A;  1SV0 A;  5KNI A;  5J8Y A;  2KIV A;  3BS7 A;  1WWU A;  3TAD C;  2YTU A;  5F3X B;  1SV4 A;  2DKX A;  4NJ8 A;  3TAD A;  1PK1 B;  2QAR A;  1V38 A;  2E8N A;  2L5Y A;  2E8P A;  2QB1 A;  2E8M A;  3BQ7 A;  1Z1V A;  1B0X A;  1V85 A;  3KKA C;  1SV0 C;  1UCV A;  2K60 A;  5J8Y C;  2QKQ A;  1SXE A;  2EAN A;  2KSO A;  5JRT A;  1X9X A;  2FE9 A;  1LKY A;  1RG6 A;  1X40 A;  2B6G A;  2Y9T A;  4RQM A;  3K1R B;  1SXD A;  2EAP A;  1OW5 A;  1DXS A;  2F44 A;  2KG5 A;  3SEI A;  5JTI A;  2ESE A;  2D3D A;  2F3N A;  2K4P A;  2QB0 A;  2EAM A;  4NL9 A;  2EAO A;  3BS5 B;  3TAC B;  3HIL A;  4RQN A;  1PK3 A;  2LMR A;  4MHV A;  1F0M A;  2JV3 A;  1COK A;  1WWV A;  2KE7 A;  1SGG A;  5JU5 A;  2DL0 A;  1X66 A;  2F8K A;  1UQV A;  2Y9U A;  2LPE A;  3H8M A;  1PK1 A;  1B4F A;  1JI7 A;  2GLE A;  3IDW A;  4PZN A;  2QAR B;  4NL9 C;  3SEN A;  2DKZ A;  2E8O A;  1OXJ A;  5L1M A;  2QB0 B;  2D8C A;  2KSO B; 
#chains in the Genus database with same CATH topology
 4KX5 A;  1QH9 A;  5DB9 A;  2ES6 A;  2HHU A;  3PVX A;  1ZXI A;  5ALV A;  3THV A;  2LHT A;  4O3M A;  3QUQ A;  2XGP A;  2YTU A;  2W9A A;  4QWA A;  5KL8 B;  3OGU A;  2BCQ A;  4DOC A;  5G5H A;  1JRO A;  3NRZ A;  4R8U A;  1XU4 A;  3F2C A;  4KLD A;  5KL1 B;  3LWM A;  3UMG A;  2OCE A;  9ICA A;  1YT3 A;  2FDR A;  2K60 A;  5AM2 A;  2W7P A;  3GZF A;  2K4H A;  3RJF A;  2JGA A;  3MGI A;  3M8S A;  5AI5 A;  5CP2 A;  2YB4 A;  2ASJ A;  2KNJ A;  5EE0 A;  3RJH A;  2ZXI A;  2ESE A;  2DPI A;  4EEL A;  2AJQ A;  9ICW A;  2D3D A;  1S0M A;  3PZP A;  5J0X A;  4KLH A;  4J9Q A;  2QB0 A;  5HML A;  4BWM A;  2A3V A;  1NK4 A;  8ICP A;  3PW2 A;  3RB4 A;  9ICU A;  2EAM A;  2Q4T A;  1S0O A;  4NLG A;  5AKI A;  3TAC B;  1XO0 A;  2ZIV A;  5KFC A;  2PI5 A;  1F0M A;  4I28 A;  5J2C A;  2OH2 A;  5IIN A;  2ZJA A;  4QZ9 A;  3GIK A;  1C7Y A;  3V7J A;  5ALL A;  1MQ2 A;  2W9C B;  3M9M B;  1L7M A;  5HP4 A;  4DLE A;  2QAR B;  4KN4 A;  2AU0 A;  2ZJ8 A;  4BGD A;  2EZY A;  2E1F A;  5KFS A;  2ZIX A;  1SL2 A;  1YZ7 A;  1SKR A;  2MAX A;  2YMQ A;  1QQ7 A;  2ZTC A;  2PMZ C;  1Z4N A;  4C8M A;  2OHF A;  4DWI A;  3KHH A;  3ISD A;  5KG4 A;  3PY8 A;  2I6X A;  4PGQ A;  1WWU A;  4GFJ A;  5HMM A;  1LB2 B;  3F53 A;  4TQR A;  3EZ5 A;  2GWS A;  1PVP A;  1NJW A;  3R9K A;  3SMV A;  2E8N A;  4DLG A;  8ICV A;  2XY6 A;  1V85 A;  2P6R A;  2NRZ A;  3RRG A;  2KSO A;  1NKC A;  5K4L A;  2E3T A;  3E58 A;  1LKY A;  3NUQ A;  5BPC A;  2AGP A;  3LVV A;  2KFZ A;  1RM6 C;  4DQS A;  2PFP A;  1N61 A;  9ICE A;  5ALI A;  1NK6 A;  5ALK A;  8ICI A;  1GO3 F;  2KIC A;  2R8I A;  5JTI A;  2WFA A;  2KK0 A;  2K4P A;  3CW2 C;  3AEV A;  2PFN A;  1KN5 A;  3PSP A;  1FO4 A;  1ZQD A;  1K1S A;  4US8 A;  9ICB A;  4DSE A;  3JPP A;  2KHV A;  1BPE A;  3RBD A;  5KFW A;  1ZQC A;  3D2S A;  3WK8 A;  2F77 X;  3WK5 A;  4OO1 J;  1XSP A;  4RPZ A;  4RQ0 A;  4NM1 A;  5AI0 A;  4MFC A;  1SL0 A;  2WAQ C;  4U7C A;  3AU6 A;  4J9P A;  5ALX A;  2NRW A;  1KFD A;  4DFD A;  4KLT A;  3PSF A;  3C5G A;  2B0C A;  2B21 A;  4QZ8 A;  5ALJ A;  4B9S A;  4ECW A;  1D8L A;  1JXE A;  3NVW A;  5KG2 A;  3GV7 B;  2FMQ A;  4Z6C A;  3UM9 A;  2FLL A;  3PR4 A;  4P4O A;  1XSN A;  2UVW A;  4QWD A;  3OJU A;  5J2A A;  4BJQ A;  4NJ8 A;  2BHN A;  4NWI A;  4KTQ A;  3HJE A;  2RQ5 A;  2QB1 A;  2YX8 A;  4ECS A;  1ZET A;  3Q8P B;  8ICU A;  2LM1 A;  1MSW D;  2UVV A;  5J8Y C;  2QKQ A;  4QWB A;  3NS1 A;  1X9X A;  2LYH A;  4YCX A;  4QNL A;  4DL5 A;  1VJ5 A;  3ETR A;  1SXD A;  2ZIU A;  2F44 A;  3WK6 A;  2HHW A;  3AU2 A;  4F3O A;  2HOF A;  5KFO A;  4CE6 A;  1ZRN A;  4OD0 A;  2Y0S F;  2BQ3 A;  7ICM A;  1KTQ A;  4R65 A;  4DF8 A;  5HHH A;  3Q8M A;  1XWL A;  3BS5 B;  1KBU A;  9ICO A;  8ICK A;  4QIW C;  2YB1 A;  4UB2 A;  1V97 A;  2BCV A;  2KKP A;  3I1Y A;  7ICT A;  1BPD A;  2MUT B;  3RAQ A;  2HMX A;  3QNM A;  4XUS A;  3NVY A;  2MA1 A;  3C28 A;  4UB8 U;  3IRU A;  3WKC A;  7ICJ A;  3UXO A;  3M8R A;  2BR0 A;  1L3U A;  5L1M A;  4C0Z A;  2VAN A;  3PX6 A;  3C2L A;  1TVA A;  2VA2 A;  1ZYQ A;  1UT8 A;  5DG7 A;  5KFD A;  4PZO A;  1C20 A;  5KAF U;  2MU2 A;  2A1A A;  5AKY A;  4F5O A;  2CXY A;  4NY8 A;  1JUD A;  3OJS A;  4QZA A;  4MF2 A;  3TFS A;  4E0D A;  2W9M A;  4IRC A;  3HW8 A;  2DF4 B;  4UAV A;  5J0R A;  4KLO A;  4NLN A;  3OHA A;  9ICP A;  4NLZ A;  2FMP A;  3C21 A;  4GC6 A;  2JH7 A;  4Y2T A;  5J2G A;  1PVQ A;  3KKA C;  1N63 A;  5ALH A;  2XVT A;  3SI8 A;  1T3N A;  4KLF A;  4EBD A;  2C2D A;  4ACO A;  4IC9 A;  3MR6 A;  4Y2Q A;  4RQM A;  2KFN A;  3L3F X;  3RJG A;  3JPT A;  1L7O A;  3L5K A;  5J2J A;  4OJ5 A;  1D8B A;  1S9F A;  4EZ6 A;  2XID A;  3HRD D;  1U9L A;  4ECY A;  2KP7 A;  5DG8 A;  4YXM A;  2BGW A;  4I2C A;  4QZE A;  1NK8 A;  5CJ7 A;  9ICV A;  2YML A;  3E0F A;  1FEZ A;  4ED2 A;  4MHV A;  3C2K A;  1COK A;  3QUT A;  5C5J A;  5IIO A;  1X2I A;  4EBC A;  4QZG A;  7ICS A;  2W9B A;  2ODG A;  2KOB A;  3PW7 A;  5J0P A;  3JPQ A;  4J9L A;  2XI9 A;  2NRT A;  2WHE A;  2RLT A;  5AKH A;  4RUC A;  2JZB B;  2WF6 A;  3IHQ B;  4ELT A;  3G6X A;  1BPY A;  8ICG A;  4BDP A;  2XCA A;  1NJX A;  4UAU A;  2LYA A;  3GV8 B;  4JWM A;  3KHG A;  4M9H A;  1RQN A;  1SWW A;  2AH5 A;  3H0M B;  2HDO A;  5AIC A;  4F4K A;  5C0Y A;  4PGY A;  4AP9 A;  4O5C A;  5CRX A;  2HVI A;  2BQR A;  1MN8 A;  2C22 A;  2A1J A;  3UMC A;  3RJK A;  1H38 A;  2MRL A;  2P35 A;  5J2H A;  2JR5 A;  1J2M A;  2JHD A;  1QCK A;  1ZD5 A;  3EW9 A;  2I5H A;  3RTV A;  2AGO A;  4DL3 A;  2FLP A;  3KZI U;  4Y2X A;  3QU4 A;  3PX0 A;  3NVV A;  1UCV A;  5ALE A;  3QEB Z;  1JIH A;  2M9N A;  3H8W A;  5J2E A;  4RQ3 A;  4O3Q A;  4BUG A;  4QW9 A;  5ALP A;  1OW5 A;  1DXS A;  4FZN A;  4C7Y A;  8ICR A;  4I2G A;  1NNL A;  3Q8K A;  1Y88 A;  2OM6 A;  2RDJ A;  4P2H A;  4YVZ A;  3TI0 A;  4IRD A;  1CEZ A;  2YY6 A;  5AK3 A;  2BKE A;  7ICF A;  3SAH A;  2G5H B;  2WF7 A;  4ICA A;  8ICB A;  1PK3 A;  3JPO A;  5KFJ A;  3MR5 A;  2JV3 A;  1D8Y A;  3G6V A;  4IQW A;  2XGQ A;  4DQQ A;  2GOL A;  3GFK B;  5KFP A;  2KE7 A;  2LBO A;  2IOH A;  1Q3V A;  4PL1 A;  4RQ4 A;  4G3I A;  5EWE A;  1DGS A;  3IDW A;  5AM3 A;  4NLK A;  1WYG A;  3Q8Q B;  8ICN A;  3V6J A;  5AKK A;  5AI8 A;  4O5K A;  1NZP A;  4B9V A;  2HW3 A;  2W03 A;  1QLN A;  4IQV A;  4YFK A;  4RQ2 A;  1ARO P;  2F8L A;  4YP3 A;  4K4I A;  3RB3 A;  4F5P A;  4I27 A;  4IS7 A;  4US9 A;  5AM4 A;  5J0T A;  1KW4 A;  1ZQ1 C;  5KFL A;  5DQH A;  2G07 A;  5KNI A;  2IHN A;  2RP5 A;  4TUR A;  2W9C A;  3ZD9 A;  3F5A A;  2EH9 A;  5AKZ A;  1IV8 A;  1PK1 B;  5J0U A;  2F76 X;  2QAR A;  2VJ4 A;  2D6F C;  1V38 A;  5J0Q A;  3EPI A;  1A77 A;  4O5E A;  3N7R C;  3N97 B;  4M04 A;  1KQQ A;  4UW9 A;  5HHI A;  3V6H A;  4DFM A;  1TKD A;  2F1I A;  4PHP A;  5D46 A;  3QEA Z;  3WK4 A;  4UBB A;  1RQL A;  4DSF A;  2KVS A;  2XC9 A;  2B6G A;  1ZQA A;  4UAT A;  1PUZ A;  1HJP A;  8ICL A;  3AN1 A;  3MDC A;  2ISP A;  3K1R B;  2ZUD A;  1BVS A;  2JEG A;  1NI3 A;  1ZQI A;  3TAN A;  2W8L A;  3HWT A;  3L4P A;  4DQP A;  4M2Y A;  8ICF A;  4EEY A;  2H5X A;  3PO5 A;  5F9L A;  2ZXH A;  4Q45 A;  4M47 A;  4FE3 A;  2Y0S C;  4YMM A;  3GIL A;  4ECX A;  4NL9 A;  2BDP A;  2KKV A;  4KMO B;  4I2H A;  4J9K A;  4QZF A;  5CHG A;  3NVZ A;  5IIK A;  5AKX A;  3MC1 A;  7ICL A;  3KFU F;  1S8O A;  3GQC A;  4QWE A;  3S6J A;  4J9R A;  5E79 U;  1ZQN A;  1ZQL A;  2J6S A;  4PGX A;  3BQT A;  4UAZ A;  9ICX A;  1X9M A;  1X6J A;  3V6K A;  3UQ0 A;  3AUO A;  4EZ9 A;  2DFL A;  1Z4O A;  1KL9 A;  1Z19 A;  4YXJ A;  4DL2 A;  2H3Z A;  3BJY A;  5KFZ A;  3QZ7 A;  5AI6 A;  5KT4 A;  3ZDB A;  4BWJ A;  4ED8 A;  2HHT A;  1SV4 A;  3T5H A;  4I2I A;  4FZL A;  4TUP A;  1ZQZ A;  3M6Z A;  1RPL A;  1ZQH A;  2ZUB A;  3TAQ A;  1T7P A;  2OWO A;  4IL6 U;  1FFV A;  1Z3E B;  2HHV A;  5KFK A;  1BPB A;  4DL4 A;  4C4T A;  5DQG A;  3HKZ F;  2JEJ A;  4PH5 A;  1SZH A;  3SEI A;  2VIX A;  1U45 A;  4RPX A;  4EEN A;  5HR6 A;  4KLS A;  3MGV A;  1T8E A;  5AM5 A;  1UT5 A;  2N1R A;  2ASD A;  4J9S A;  3I76 A;  1LVH A;  2R18 A;  3B9J A;  4RT3 A;  5KG6 A;  2O6K A;  3RJJ A;  1ZQM A;  4RT2 A;  1U4B A;  1ZQQ A;  1KFT A;  3ORY A;  2C2E A;  3AQE A;  4F5R A;  4O3N A;  3LYS A;  4DEZ A;  1U48 A;  3UXP A;  1FIQ A;  4RQ6 A;  4I2E A;  1ZD3 A;  1X66 A;  1N56 A;  1ZD2 P;  2XIC A;  3RRH A;  2R8H A;  1L7N A;  5ALW A;  4J9O A;  2G08 A;  2KD1 A;  1SZP A;  2Z7J A;  3F2D A;  4KX3 A;  3K75 D;  1RYR A;  2BDU A;  1DK3 A;  4EBE A;  2QB0 B;  2F2A B;  2HBM A;  8ICX A;  5T14 A;  2HBJ A;  3BS5 A;  4Q44 A;  2H3V A;  5AHX A;  2ZIV B;  4EYI B;  1XS9 D;  1BPX A;  1VDV A;  3MBY A;  4IR1 A;  5DLG A;  4R64 A;  3A0B U;  4GXI A;  2KJ5 A;  1NJY A;  3VCB A;  3ZI4 A;  3RR8 A;  9ICC A;  2MUT A;  4R63 A;  3PR5 B;  2ZTE A;  1ZRM A;  4QWC A;  2KVC A;  4DFK A;  1BPZ A;  2NO5 A;  4FZM A;  4QZD A;  4XRH A;  1NJZ A;  1NKE A;  1WUD A;  4Z6E A;  2FLN A;  3DV9 A;  3RH5 A;  8ICC A;  3PW5 A;  4FBT A;  3BQ1 A;  2XCP A;  1HEK A;  9ICQ A;  3PX4 A;  2IOF K;  4KLQ A;  1QQ5 A;  2K8A A;  3M9O B;  3SQI A;  1QSL A;  2HCF A;  1IM4 A;  3B0X A;  7ICH A;  5B5E U;  4CF3 A;  3CNH A;  3ZD8 A;  3TAP A;  5AIA A;  4USA A;  4ECR A;  1ZQO A;  5ALU A;  2P6U A;  1BNP A;  4BXO B;  1CRX A;  1KFS A;  1HUO A;  2HVH A;  1KKX A;  3H8M A;  2HHS A;  1TK0 A;  4M9J A;  2KZZ A;  3LWL A;  5DBC A;  4Y2S A;  8ICJ A;  2JH1 A;  2AGQ A;  4KLJ A;  2BQU A;  2IBK A;  2D8C A;  4Q8E A;  1D9F A;  4JV2 A;  4G9B A;  4DCC A;  1URJ A;  1XC9 A;  2Y1J A;  2E5S A;  4LJX A;  2C28 A;  2RDI A;  4XQ8 A;  4JWN A;  3RF9 A;  4C4S A;  3GIJ A;  2KIV A;  1L3T A;  8ICS A;  1F5S A;  1ZQS A;  4F8R A;  4DS5 A;  4P0Q B;  2V4R A;  5KFB A;  1JRP A;  4DO9 A;  3ALR A;  3QZ8 A;  4DFJ A;  2CN1 A;  4F91 B;  2JZB A;  7ICO A;  4EX7 A;  4GXK A;  5KFM A;  4C80 A;  5KFF A;  2W04 A;  1RDF A;  1RG6 A;  5ALM A;  3IM1 A;  5ALS A;  7ICU A;  4PHE A;  3IN5 A;  5ALR A;  4UAW A;  2PI4 A;  8ICM A;  4KLE A;  2EZX A;  1QSY A;  8ICE A;  3SV3 A;  3SV4 A;  4F50 A;  3A0H U;  1AQ6 A;  1JXL A;  3NTU A;  4HYK A;  2ALZ A;  4I2B A;  3I28 A;  1J97 A;  2HHX A;  4UB6 U;  4Y2U A;  8ICT A;  3Q8R B;  4DL6 A;  4RQN A;  5DG9 A;  5ALO A;  4J9M A;  1TK8 A;  7ICQ A;  4AYB F;  5B66 U;  5AI9 A;  2AQ4 A;  4B9N A;  4QZB A;  4P0P B;  4IQU A;  3N28 A;  2LPE A;  3H0L B;  3WKA A;  4DSI A;  1B4F A;  3DDH A;  1RZT A;  5DDY A;  1ECW A;  2NYV A;  5J0S A;  2YMM A;  1ZQJ A;  4KIT B;  5KFG A;  1OXJ A;  2KTQ A;  3PW0 A;  1U49 A;  3MAB A;  4TUS A;  2ATL A;  4X5V A;  4B9L A;  3C5F A;  1S0N A;  1EXN A;  4K4G A;  3RR7 A;  3AM9 A;  1ZJN A;  1ZQB A;  1L5U A;  4DF4 A;  5J2B A;  9ICM A;  4KLM A;  1SV0 A;  4TUQ A;  3Q8L A;  3K1Z A;  4QZI A;  2R8K A;  1DRG A;  1WG8 A;  1L8L A;  4YMO A;  5IIL A;  3G6Y A;  4ELU A;  3UMB A;  1JN3 A;  3ZDC A;  4YQW A;  3TAR A;  3OTQ A;  3UQ2 A;  2E8M A;  3ONN A;  4DL7 A;  4I2J A;  3U26 A;  2K8B B;  4CCH A;  2XY5 A;  5AK6 A;  1JAL A;  5KT3 A;  2WF8 A;  3QUC A;  4Y2Y A;  4UB5 A;  4OJP A;  4MFA A;  2FE9 A;  5KFX A;  7ICG A;  2ZTD A;  4F92 B;  3MFH A;  2KZM A;  1X6I A;  1S76 D;  4KN7 A;  2OEH A;  4YR3 A;  1A76 A;  4MF8 A;  3C2M A;  3ICX A;  5CEH A;  3D2N A;  3MGH A;  5G5G A;  4O3O A;  3HKZ C;  4PPX A;  2F3N A;  3WU2 U;  3C1Z A;  1QQ6 A;  2R8G A;  3GV5 B;  3T5J A;  2KV2 A;  4UAR A;  3ZDE A;  1QTM A;  5BOM A;  1V9P A;  9ICF A;  4O3P A;  1QSS A;  4ED7 A;  4I29 A;  1WWV A;  1NK0 A;  5J0O A;  1O03 A;  5KT7 A;  1NZB A;  4OCZ A;  3JPS A;  4LZG A;  4IR9 A;  4JK1 A;  2K8C B;  5ALG A;  2G09 A;  1YZ6 A;  2UVR A;  2PFQ A;  3RB6 A;  2PFO A;  4P4M A;  4C7Z A;  2W7O A;  1XO1 A;  4FS1 A;  1N60 A;  1SL1 A;  4C8O A;  4DSJ A;  3K4G A;  2JXJ A;  4UAY A;  1KDH A;  4XA5 A;  4MEY A;  1SKS A;  3FYH A;  7ICN A;  3EWA A;  2ZIW B;  4LZD A;  5J2D A;  1ZQG A;  2HSZ A;  2LI6 A;  1HIW A;  1MC8 A;  3SR6 A;  4Q8F A;  3JPR A;  5KFA A;  4M0A A;  1B22 A;  2W11 A;  4CDG A;  4JV0 A;  3BS7 A;  7ICP A;  3TAD C;  2AXT U;  5F3X B;  3TAD A;  5CA7 A;  4B9T A;  3JPN A;  3LDA A;  1WCN A;  1S0V A;  5ALF A;  3SZ2 A;  4EEK A;  5L1I A;  4KLL A;  5III A;  3DEE A;  2YMP A;  3WK7 A;  4KMU A;  4UB1 A;  2ZUC A;  3OSP A;  3M9N B;  2HOI A;  2Y9T A;  2H3F A;  1PVR A;  3E2E A;  5AM1 A;  5GTH U;  4RNM A;  3PST A;  1ZQT A;  1P7D A;  2HHQ A;  3QU2 A;  2F1J A;  2MSN A;  2XY7 A;  8ICO A;  5KFY A;  4TQS A;  1DK2 A;  4F5Q A;  4GLX A;  4O3R A;  4F4Y A;  3HPO A;  1L8O A;  2C2R A;  2I1Q A;  3T5K A;  3C1Y A;  4DOA A;  2BCR A;  4I2F A;  1L7P A;  3PSI A;  1ZQP A;  1SIJ A;  3KOO A;  3RFA A;  3VC8 A;  1TK5 A;  3RJE A;  2M0N A;  3KZX A;  5J2I A;  2Y9U A;  5KFQ A;  4F93 B;  7ICR A;  4NL9 C;  2ZG6 A;  4YMN A;  4RNN A;  2YQE A;  1N62 A;  5HR7 A;  5ALD A;  4I2A A;  9ICS A;  4JUZ A;  2LKY A;  3OPX A;  3TQ1 A;  3F5E A;  4CRX A;  5DGA A;  5H2F U;  4QJF B;  2FI1 A;  5KAI U;  3N7P D;  3ZDD A;  1Z00 B;  2GH1 A;  4F4X A;  2Y1I A;  5EE1 A;  3OSN A;  4QZC A;  1OUQ A;  9ICK A;  2VA8 A;  5KFE A;  2WTF A;  1ZJM A;  4Y2P A;  1N5W A;  1ZQU A;  3D6J A;  3LVW A;  4U6P A;  5L1J A;  1ZQV A;  5D4B A;  2PKE A;  2E8P A;  1KEJ A;  9ICT A;  4CF5 A;  3N7S C;  4Z6F A;  5EE9 A;  5DDM A;  2WB1 F;  4WJ3 B;  3M1Y A;  1T3Q A;  2KHQ A;  3H40 A;  4UAS A;  5KFT A;  1NKB A;  5J2F A;  1F44 A;  3V72 A;  3QUB A;  4RPY A;  4ZOH C;  8ICA A;  3M6K A;  2EAP A;  4ED1 A;  1TE2 A;  4C4R A;  2IMW P;  2V4Q A;  1NK5 A;  2K4E A;  2HI0 A;  3T5L A;  3ISB A;  4JV1 A;  1ZQE A;  4YR0 A;  4BX9 C;  4M6W B;  4FS2 A;  9ICH A;  4PHD A;  2PXI A;  3RBE A;  2H3Q A;  4DSK A;  2KJ8 A;  2EDU A;  5DQI A;  2GO7 A;  2HBL A;  2DGZ A;  4FFD A;  3T3F A;  2G0A A;  4AYB C;  5AKG A;  3FAH A;  3SAG A;  5EOZ A;  4EYH B;  3ISC A;  2NV3 A;  3NAS A;  2E1E A;  3WK9 A;  3BQ2 A;  3SEN A;  2JMG A;  4Y2R A;  4R8U B;  4RZR A;  9ICJ A;  4ELV A;  4DFP A;  3EPG A;  3GU3 A;  1VLB A;  3V7K A;  3CYM A;  2HOQ A;  4ZH4 A;  2RRD A;  3QU9 A;  3D2Q A;  4NV0 A;  2KMD A;  1NOM A;  2NO4 A;  2VKQ A;  1ZQX A;  5KFV A;  4BXO A;  2DKX A;  4J9N A;  1ZQR A;  2K89 A;  4R66 A;  3AL0 B;  1UHU A;  1B0X A;  3WKD A;  3ED5 A;  3QE9 Y;  5L1K A;  3HT3 A;  4YN4 A;  2JEF A;  3IV6 A;  1K5O A;  2EAN A;  4IRK A;  3H0R B;  3IG8 A;  2KIW A;  1X40 A;  4CNQ A;  4B9U A;  4J03 A;  1S97 A;  1J2N A;  2LM4 A;  5D49 A;  1JX4 A;  5L9X A;  1Q3U A;  2W8K A;  4RUA A;  2KG5 A;  3H7I A;  5KFN A;  4DOB A;  2W43 A;  2G5I B;  4P0Q A;  3F2B A;  2QLT A;  2ZIX B;  1X9W A;  2FPM A;  2IOF A;  4IQT A;  1TAM A;  3SAF A;  4FO6 A;  4ECU A;  3QYP A;  1ZQK A;  3HIL A;  1Q46 A;  5KG3 A;  3GIM A;  7ICV A;  1ED1 A;  4M9G A;  2RHF A;  4F71 A;  1SKW A;  1KSP A;  3MDA A;  2LYB A;  1Z1B A;  4C8L A;  4ECV A;  5AM0 A;  3NGD A;  3ETL A;  5AKL A;  2BCS A;  4MEX A;  5KG0 A;  3H4D A;  3TKA A;  1KRP A;  2F8K A;  4M9N A;  2HBK A;  1L3V A;  8ICZ A;  3PMN A;  3TFR A;  1Q8K A;  4PZN A;  2A19 A;  1TFR A;  5KG7 A;  1X9S A;  5DB6 A;  5CB1 A;  4RQ7 A;  3EYZ A;  5DBA A;  4ED3 A;  4RNO A;  2KZ3 A;  5KG5 A;  3BQ0 A;  2KSO B;  4EX6 A;  5IIM A;  5KTQ A;  4RU9 A;  1FFU A;  4Z6D A;  1LKY B;  2FPK A;  2ISO A;  3IG5 A;  2BPF A;  3UPQ A;  8ICY A;  5DBB A;  5KFI A;  3KTQ A;  1N5X A;  5J8Y A;  3WKE A;  4ECQ A;  2W3S A;  2ASL A;  2W54 A;  4P0P A;  1ZQW A;  2BCU A;  3V7L A;  3PV8 A;  4UQG A;  2L5Y A;  5DLF A;  1Z1V A;  3Q8S B;  4F4Z A;  2G06 A;  8ICW A;  3CP8 A;  1SXE A;  4QZH A;  5JRT A;  3QU5 A;  4B6J A;  2BPG A;  3MFI A;  1TAQ A;  2V9W A;  9ICI A;  5ALT A;  4RQ1 A;  2Q0Z X;  4Q43 A;  4PL2 A;  4YR2 A;  2I9G A;  4DQR A;  4ED6 A;  3UXN A;  2UVU A;  7ICE A;  2CPR A;  3PNC A;  3C29 A;  3SYZ A;  4DQI A;  8ICQ A;  1RYS A;  3QXG A;  1UPH A;  1SB3 C;  2EAO A;  5DB7 A;  3CRX A;  1B43 A;  8ICH A;  3OHB A;  1CUK A;  2OYY A;  3BZC A;  4NXZ A;  2FMS A;  3RH4 A;  2IHM A;  1SGG A;  4GXJ A;  2WF5 A;  2DL0 A;  2BPC A;  1UQV A;  2WF9 A;  2DWQ A;  5AKJ A;  3H4B A;  4LVS A;  1JI7 A;  9ICL A;  4JMU A;  5CWR A;  1A0P A;  3T79 A;  1XNS A;  1KLN A;  4I2D A;  3FDS A;  5J2K A;  2EZZ A;  3J81 j;  4C8K A;  5GTI U;  4O9M A;  3BDP A;  2PMZ F;  4Y2J A;  3M7D A;  5BOL A;  4FBU A;  1IIP A;  2EQY A;  1ZD4 A;  3KKA A;  1JMS A;  1TV9 A;  3LK9 A;  2ZIU B;  3B0Y A;  5JUM A;  5TIS U;  1A6S A;  1PZN A;  2ZJ5 A;  3H8S A;  1L3S A;  4O3S A;  1MA7 A;  1S77 D;  1NK9 A;  4F5N A;  5KG1 A;  5FP0 A;  1UA1 A;  5DKW A;  5ALN A;  2VA3 A;  4YD2 A;  1T4G A;  2BZF A;  1SV0 C;  3KD3 A;  5KFU A;  9ICR A;  4O0I A;  5L1L A;  4MFF A;  3QX7 A;  5ALY A;  3KHR A;  3HX0 A;  2WB1 C;  3FM9 A;  2ZIW A;  2YN4 A;  5J0W A;  3PW4 A;  4KLU A;  4RQ5 A;  4Y2V A;  2DUY A;  3H8J A;  4NLB A;  3PML A;  4PJ0 U;  2J6T A;  3GII A;  2R8J A;  7ICI A;  5AI4 A;  1X42 A;  5J29 A;  2CRX A;  1WCL A;  3FC4 A;  3AQF A;  5AKE A;  9ICG A;  1LV5 A;  3SD7 A;  1U47 A;  5AK5 A;  1ZQF A;  1HUZ A;  2P66 A;  2FJ6 A;  2LMR A;  5DGB A;  2H3I A;  4P4P A;  5EWG A;  4PHA A;  5IIJ A;  1DOQ A;  4GIB A;  3RH6 A;  3RB0 A;  5CR0 A;  4NLC A;  5KT6 A;  1BNO A;  1D9D A;  2WAQ F;  1PK1 A;  7ICK A;  2FPL A;  3AMZ A;  5AIB A;  1MQ3 A;  5ALZ A;  4F4W A;  2DKZ A;  4YD1 A;  3GDX A;  4F2R A;  4YG2 A;  1RXW A;  4DS4 A;  4ED0 A;  3QU7 A;  2OXO A;  5HNK A;  4KLG A;  3C23 A;  1T94 A;  3O0F A;  1XSL A;  3KHL A;  5F9N A;  5TZV A;  4UBC A;  4UB4 A;  1DGJ A;  3N4M B;  2KJ9 A;  2JRZ A;  3PO4 A;  3RAX A;  1M6Y A;  2DQN B;  2NRV A;  4RQ8 A;  2W3R A;  4DSL A;  2KEY A;  4JB3 A;  3MR2 A;  2DBY A;  1COO A;  4NM2 A;  4C8N A;  3IP4 B;  3KBB A;  1IXR A;  4OJO A;  3BQ7 A;  1S10 A;  2W55 A;  2IA6 A;  3ZDA A;  5KFH A;  4A8E A;  5A0L A;  2NRX A;  4CGZ A;  3HP6 A;  1RYU A;  1N2X A;  3RJI A;  4F72 A;  2KN7 A;  2W9B B;  4UB3 A;  1CI4 A;  4QW8 A;  2AQ0 A;  1Z00 A;  9ICN A;  5KT5 A;  4K4H A;  5DB8 A;  2F1H A;  5EWF A;  1ZQY A;  5ALQ A;  4ECT A;  2K4I A;  5AK4 A;  3WKB A;  1IG6 A;  2J6U A;  4OJ6 A;  2AHO B;  4QIW F;  4ECZ A;  3NRW A;  2VJ5 A;  5EE3 A;  1K1Q A;  1SWV A;  3MR3 A;  4KLI A;  2A1J B;  1UA0 A;  4OJL A;  5JU5 A;  1S5L U;  1O08 A;  4HAI A;  5J0Y A;  2DPJ A;  3EUB 2;  4GC7 A;  2GLE A;  1ZOL A;  3BZK A;  5KFR A;  4F2S A;  1L6N A;  1BGX T;  1N48 A;  1RXV A;  4B9M A;  2JEI A;  4M9L A;  1NK7 A;  2E8O A;  2XO7 A;  5KT2 A;  1TAU A;  4CF4 A;  4M6W A; 
#chains in the Genus database with same CATH homology
 1LKY B;  3BS5 A;  2ES6 A;  2KMD A;  4IS7 A;  3KKA A;  1KW4 A;  4PZO A;  1SV0 A;  5KNI A;  5J8Y A;  2KIV A;  3BS7 A;  1WWU A;  3TAD C;  2YTU A;  5F3X B;  1SV4 A;  2DKX A;  4NJ8 A;  3TAD A;  1PK1 B;  2QAR A;  1V38 A;  2E8N A;  2L5Y A;  2E8P A;  2QB1 A;  2E8M A;  3BQ7 A;  1Z1V A;  1B0X A;  1V85 A;  3KKA C;  1SV0 C;  1UCV A;  2K60 A;  5J8Y C;  2QKQ A;  1SXE A;  2EAN A;  2KSO A;  5JRT A;  1X9X A;  2FE9 A;  1LKY A;  1RG6 A;  1X40 A;  2B6G A;  2Y9T A;  4RQM A;  3K1R B;  1SXD A;  2EAP A;  1OW5 A;  1DXS A;  2F44 A;  2KG5 A;  3SEI A;  5JTI A;  2ESE A;  2D3D A;  2F3N A;  2K4P A;  2QB0 A;  2EAM A;  4NL9 A;  2EAO A;  3BS5 B;  3TAC B;  3HIL A;  4RQN A;  1PK3 A;  2LMR A;  4MHV A;  1F0M A;  2JV3 A;  1COK A;  1WWV A;  2KE7 A;  1SGG A;  5JU5 A;  2DL0 A;  1X66 A;  2F8K A;  1UQV A;  2Y9U A;  2LPE A;  3H8M A;  1PK1 A;  1B4F A;  1JI7 A;  2GLE A;  3IDW A;  4PZN A;  2QAR B;  4NL9 C;  3SEN A;  2DKZ A;  2E8O A;  1OXJ A;  5L1M A;  2QB0 B;  2D8C A;  2KSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...