1L8LA

Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8lA01
3FGOA 5AI9A 4Y2YA 3UM9A 5AW4A 3L0CA 3I76A 2YMQA 3NASA 3PDWA 1J97A 4QJBA 3WGUA 2NO5A 4UU0A 2O2XA 4DFDA 5AM1A 5E0OA 3WK7A 4UW9A 2P9JA 4YIHA 5IT0A 3A1CA 2AUTA 2GO7A 3VAYA 1WPGA 4BNDA 1IWOA 1MH9A 2JGAA 5ALFA 3PCTA 3CZ4A 4E88A 3ESQA 2HI0A 2I33A 5ALZA 3SKXA 3SKYA 2CFRA 3DV9A 4F71A 5ALVA 3QXGA 4I9FA 2NYVA 3OCYA 3W5CA 5ALQA 2YMMA 3FM9A 2D2VA 4GXTA 5AI4A 3WK5A 4Y2TA 5FP0A 2WF6A 5AW2A 2FPUA 3UMCA 2ODAA 4I9GA 1K1EA 2G1AA 2FI1A 4Y2UA 3WK4A 4XQ0A 3ONNA 3KDPA 1XPJA 4RESA 2G08A 4Y2RA 1QQ5A 2BDEA 3B9BA 1EK1A 4FYPA 2PQ0A 3OCZA 3KZXA 5ALTA 1RPZA 3L0BA 3FPSA 1YV9A 4DW8A 1N9KA 5AM0A 2GFHA 2WHEA 5JJBA 4KNVA 2R8YA 3J7TA 5IS2A 4ZEWA 4CF4A 4BEWA 3PGVA 4UATA 4DWOA 4UASA 3DDHA 1RDFA 4BX2A 4YH1A 2W43A 4IG4A 2C4NA 3W5BA 3L7YA 2HF7A 4BKMA 3W5AA 2B8JA 4EEKA 2YMPA 4HAIA 1TE2A 2HHLA 3L8EA 2JAWA 3IB6A 3ESRA 4BEVA 3FPBA 3L0YA 1Z4IA 3D6JA 2ZG6A 2YY6A 1NF2A 3DNPA 5ALPA 3L8GA 2CN1A 3AR6A 5ALNA 2FEAA 4CF5A 4Y2PA 4CE6A 1WZCA 2I34A 2YN4A 1JUDA 3S6JA 2WFAA 3U19A 3U7FB 5AI5A 4UU1A 2R8XA 2FPXA 3IJ5A 3ET4A 3SD7A 1L7MA 2OM6A 2CFSA 2YFYA 3ZUPA 2P27A 4HGQA 2BDUA 5AK3A 2B0CA 3ZWDA 1LTQA 3E84A 2R8ZA 2IYEA 1Z4LA 3N5KA 1F5SA 4OD0A 4J03A 1VJ5A 1Z4KA 2FPWA 4Y3UA 2OA0A 4HGOA 1L7OA 2ZOSA 2G80A 5AKYA 2R8EA 3SMVA 5ALHA 3KOOA 4NABA 2HSZA 1CQZA 3QU7A 3RFUA 2G07A 1VFPA 4OFZA 4F72A 3NANA 3MC1A 4OHFA 1TA0A 3BWVA 1RMQA 4UMEA 3UMGA 4DCCA 3BA6A 2YMLA 4OCZA 4Y2VA 2IOHA 4YCLA 3U7EB 5ALGA 1ZRMA 2CFTA 3OCXA 3EF0A 1WR8A 1L7PA 2IOFK 2G06A 3KC2A 2B30A 3WKDA 1U02A 5AKHA 3QX7A 3R9KA 1ZD2P 2YBDA 2RB5A 3QU9A 2Q4TA 2FUEA 1J8DA 2BY4A 4YGYA 3WK6A 1VJRA 1ZD4A 4FE3A 5ALYA 1EK2A 2PKEA 3L8HA 3ZVLA 1S8OA 4PNHA 4ZEVA 2HO4A 2QLTA 1WVIA 1ZS9A 3A1EA 3QUCA 5ALOA 5AVUA 5AKZA 2P69A 3HYCA 4AS2A 3SLRA 2HCFA 3EWIA 3SHQA 3OCUA 4L57A 4EZEA 4JB3A 3QNMA 1O08A 3A1DA 3U7HB 5A3RA 1L8OA 4UMDA 3NRJA 1Z4OA 2YJ6A 3QYPA 5AVYA 1X42A 3UMBA 5ALUA 1ZOLA 3OCVA 5AKGA 2B82A 3WKBA 4QQFA 4L6AA 4YIKA 3TLMA 2P11A 2FPSA 4NWIA 3ZI4A 5AVZA 5AIBA 4UM5A 1RKUA 3R4CA 2JARA 3FZQA 2ZBGA 2ZBDA 5AVTA 5AK5A 3QUQA 3WK8A 3EPRA 2B8EA 5AKEA 3B9RA 5AW9A 2W11A 3B8EA 2IOFA 4G63A 4UM7A 5ALIA 1YJ5A 1TJ4A 3E81A 3QLEA 3NALA 5AW7A 5AKKA 1FEZA 5AKJA 3KBBA 5AVWA 4CNQA 4EX7A 5ALJA 3W5DA 3AR2A 2HEGA 1XP5A 2HDOA 4GIBA 3E58A 5AHXA 4BX0A 5A3SA 4O8CA 2ZBFA 5AVSA 1YMQA 2G09A 5AW0A 5ALEA 3I1YA 3ZU6A 1ZRNA 3ZX4A 5AM2A 2WF7A 1YS9A 3A3YA 2EAUA 2ZXEA 5IT4A 3WK9A 1AQ6A 1N8NA 2MU1A 1QH9A 3KD3A 3WKCA 1KYTA 1S2OA 4C4RA 1TJ3A 3AR3A 2C8LA 1RMYA 4FFDA 2GMWA 3RF6A 2I54A 3EF1A 4BYGA 1SWWA 4BX3A 3L1UA 2YJ3A 5ALWA 3OCWA 3WKEA 5AVQA 1RRCA 1Z5UA 2C9MA 5AK6A 4B6JA 4G9BA 4UMFA 1XVIA 4ZEXA 3N07A 5ALSA 4YCNA 1QYIA 2FPRA 4BNDB 3L1VA 1L6RA 1RLOA 3N1UA 2I7DA 3CNHA 4MWOA 4Y2XA 4H1WA 3GYGA 4XE5A 2W4MA 5T41A 5A3QA 2RAVA 3ZTYA 2B1QA 2WM8A 2VKQA 2DQSA 3OPXA 2O9JA 5AW3A 4L6CA 5AM4A 1RQNA 3AR8A 2Q5EA 5AKLA 4KNWA 4NFLA 2RARA 2RBKA 1LVHA 4XOUA 4MUMA 2GHTA 4AP9A 3QGMA 2C8KA 3ZWKA 3ZTWA 1Z4MA 2OYCA 1ZJJA 2NO4A 1PW5A 1O03A 4HGPA 3QU4A 3E8MA 3R09A 4C4TA 3WKAA 1ZD3A 5AVVA 2HF2A 3NAMA 4YCMA 1RLTA 3L5KA 1Q91A 2I55A 2FDRA 1NNLA 2AH5A 3U26A 3NIWA 1RKVA 4XPZA 1RLMA 3MN1A 5ALDA 5AVRA 1SWVA 3K1ZA 3WGVA 4KN8A 1RKQA 3U7GA 1T9ZA 3P96A 1U2SA 5AI0A 3ED5A 2EARA 2YJ4A 5AW1A 4EELA 4CF3A 2AMYA 1Z4PX 3M9LA 3SF0A 1U7PA 1Y8AA 3OTQA 4UAVA 1Z88A 3FVVA 5ALLA 1TJ5A 2OBBA 4JDPA 2FUCA 4Y2SA 1T5TA 5AKIA 3I28A 2PR7A 2IA5A 3QUBA 3N28A 1U2TA 3AR9A 1CR6A 4HYTA 2WF8A 1Q92A 2HX1A 3AR7A 3ET5A 3ZW7A 1RC8A 3NUQA 2QYHA 4KYTA 3M1YA 5ALKA 3L8FA 4UMVA 5AW6A 2ZBEA 4HGRA 3MMZA 5ALXA 3QUTA 2JAUA 3PGLA 2I6XA 4KX5A 1RQLA 2C88A 5ALMA 4IFTA 3AR5A 1SU4A 4NV0A 5AK4A 3I6BA 4J2TA 2AGVA 2Q4RA 1RMTA 5AI6A 1U7OA 4AS3A 5AW5A 1QQ7A 4UARA 4Y2QA 5ALRA 5AKXA 2HOQA 4BBJA 3F9RA 1YNSA 3N8GA 5AM5A 1Z4NA 3HLTA 2JAOA 2WF5A 4NAVA 4C4SA 2X4DA 1QQ6A 1Z4QA 1ZD5A 5AESA 2GHQA 3DAOA 1L7NA 5AM3A 3MPOA 3IRUA 3QU5A 2G0AA 4EENA 1Z5GA 5AW8A 5AICA 4KX3A 4EX6A 2B1RA 5AI8A 1L8LA 1NRWA 3QU2A 3ZVNA 4HGNA 4Y2JA 1YDFA 3ZX5A 4RETA 2WF9A 5AVXA 3ZVMA 1T5SA 2MSNA 2YJ5A 3U13A 2EATA 4UAUA 1Z4JA 3AR4A 5AIAA
chains in the Genus database with same CATH superfamily
3WL5A 4OGLA 2OPHA 4B8ZA 4NFHA 2EV9A 2HHTA 3OZRA 1PJ3A 5EFZA 3QSGA 4D9IA 4PZEA 1N33B 5FCDA 2HQBA 1NSYA 3LYHA 4YUVA 3SQNA 1P0PA 4QBHA 4BFWA 3KPJA 4PC1A 1CJUC 1UK6A 4KH0A 2FI1A 1IEWA 1AQIA 4CMGA 2YCBA 1F6WA 3NC1C 2AXQA 4F2GA 5BVGA 4E5YA 3RT1A 1SKRA 1RI3A 3N2KB 1ANKA 1E98A 2O8CA 2QMYA 4MMYB 3DQZA 1P0QA 1BVSA 3NHUA 2HLDA 3LO8A 3HEAA 5ADUS 4HQOA 4G3IA 1XTPA 4K46A 3KO8A 2JIOA 3EC7A 1FQWA 4FN4A 1Y6GA 2YUTA 1Y3CE 3NHAA 4LE2A 2P9ZA 3BF8A 2QUZA 3K73O 3NONA 4FWIB 5K9ZA 3B6KA 4CLXA 3SI8A 1OYWA 1DRGA 1KU6A 4XGIA 5E6RB 1JIIA 3QKRB 5AOCA 3VDRA 4CGYA 2WAXA 1KI6B 4B34A 2FPGB 5B1EA 4UUNA 3GLIE 1IN8A 3U2QA 3PYMA 1RWXA 1W1WA 3THWA 1OXSC 4XXHA 4UFNA 3D6UA 1QU3A 1QGZA 3QVGA 3EVZA 3HBMA 1DC5A 5HRUA 3DPUA 2ACEA 3IULA 3F71A 2K4EA 2I8AA 2OBYA 1Q77A 1C4WA 5EL0A 1KS2A 5ARCA 1ISHA 1SUDA 1NXXA 3EDRA 4L57A 1Z0SA 3N76A 3E27A 5KU1A 1Y89A 1RQRA 4ESOA 4Q3NA 5DCUA 5FFMA 4EFMA 4NCNA 3ZI0A 2IZ1A 2OCDA 2J3IA 2BISA 1KDPA 3CLSC 3K9CA 3E23A 4EATA 4IF6A 1DWQA 4P0QB 1T8TA 3RT7A 1WW2A 1BAPA 3CISA 3TRKA 1Z6QA 1D2HA 3R9XA 1L5LA 2XCQA 3FF1A 2JJ1A 5F9HA 3AV3A 1ZH2A 4DKXA 4DQXA 5JXHA 4BNYA 3A14A 2V7VA 1MIOB 4ZA2A 2OSVA 5K3EA 2JFWA 4H1UA 3CINA 3V1YA 4TM7A 2B4AA 4Y6OA 2D5LA 2RGUA 3IGFA 1I1NA 1P2TA 4MW0A 2UXBB 1A88A 3FDZB 3K72B 2ST1A 1RAHA 4MQEA 4TMZA 1KJNA 4BVLA 4ND8B 2O2IA 5F9MA 4YJ3B 5K45A 1Z33A 5IT9A 4NJMA 1I4TD 3ETLA 4TRJA 4NCIA 1YJQA 2NTEA 3W5SA 2R4UA 1JIQA 5GM1A 1GNSA 1X38A 4LXQA 3QU4A 2R2GA 3K0FA 2V4UA 3HFRA 3MQ4A 4BLRA 1RYEA 2OKGA 5CT5A 3A4MA 3FHCB 1Z45A 5LZ4A 4TSFA 5KJCA 1A5AB 3T9EA 1UWKA 3L46A 5ITVA 2XQKA 4IRXA 3WR5A 1QQAA 2Q4DA 4G25A 1DKQA 3THYA 3R0XA 3OJLA 4MO2A 2XB8A 2HHVA 4QVGA 1S3IA 1XZDA 2ZBPA 1YBAA 4QD3A 1AF4A 1XK6A 4OQEA 4KMOB 1MNAA 1T0BA 2ZXHA 4JWTA 4NYJQ 2VSOA 4MR9A 1CU1A 3OM8A 1IEXA 2B5WA 3EHDA 1FXUA 4YFYA 3UWDA 1N5RA 2FRVA 4YD2A 2EX0A 1YL6A 2A8YA 5AK4A 4CKEB 2YICA 2XRZA 1R6VA 5E3HA 3OWHA 2AZXA 2JEIA 1HEIA 4HWPA 1NSTA 3Q2IA 1ZD5A 1W4RA 3CH4B 3H1BA 1YFLA 2AF3C 4PC3A 3NNSA 2YZ2A 1G4UR 1DWUA 3TUJC 5IWCA 1S2DA 1KVRA 2OCPA 3ZHOA 3NASA 3ZDAA 1GQYA 1XTRA 3K5WA 3TBFA 5CDUA 1ZICA 2C2XA 2FQYA 3ESQA 5HCNA 5G0SA 4RDHA 1KP3A 4X7MA 5AQ1A 4YRNA 1T9KA 2I5PO 3ODGA 2D2VA 3HU5A 1XZIA 1RWOA 3LFUA 2HNKA 1G16A 2GPJA 3CM0A 3CW8X 2Z2KA 5CFOA 3GZNB 1X1QA 1XEXB 1Z06A 2AJCA 4N0DA 2FPIB 5TMBA 2EL9A 1VJGA 1L7DA 3FPAA 2GZMA 2Y2UA 5BN5A 2DFTA 1M1UA 3SC4A 1X2EA 4M46A 1Q5PA 1HUQA 4ZQHA 4WZAB 5EUMA 4Y8VA 3H5AA 1W85A 1ONPA 5E6UA 1VSUA 2FPXA 9ICCA 3Q9UA 3QWIA 1U7XA 4C3ZA 3NHZA 1DAGA 4IMJB 4JJIA 2DLNA 1C29B 4D2IA 1HDGO 4C03A 3MD0A 4KL8S 3PNYA 1K3UB 5F78A 3ZHBA 2H7VA 4K9SA 2FJ0A 3EWSA 4MWEA 3NANA 4F93B 4PG6A 5GONF 1FDTA 4ITVA 4U2GA 5FUBA 1QO9A 4I2EA 2KE5A 1ECLA 1L5OA 5K4LA 3O4VA 4MQUA 1JILA 4M9LA 4JBHA 1C3LA 4KMUA 1EK2A 3EXIB 3OMXA 1U3CA 4HTFA 3BCUA 5FNVF 2PXCA 4H7FA 3L9XA 1NMYA 3CZ9A 4L95C 3AJDA 1EUDA 3A1DA 3RBEA 1V85A 2Q9BA 1VJ1A 3UBTA 3IMCA 3F3MA 3ASZA 1RYFA 1FYDA 2IYRA 5HILA 3R0QA 3ESAA 2BI4A 1CIVA 1RKUA 1ZQLA 3UJ7A 2OUKA 4HEHA 4Q21A 1JIHA 2JHGA 4J9OA 1FP2A 3AILA 3E7DA 3GBVA 1ZWLA 1MR3F 1CP3A 2FJUA 1JLKA 1XFDA 2NU7A 3ZQJA 3K0HA 4BX0A 3Q8XB 2RHBA 3FKJA 4IGKA 3HCAA 5DLPA 3SPXA 1FBNA 3HBJA 4CCAA 2UYYA 2JK1A 5BT9A 3LQRA 2VH5R 3U81A 1GAXA 4GDFA 3VQTA 2AJBA 3BMOB 3GV0A 4F2HA 1W4CA 3CEHA 5M34A 1VI2A 4NATA 5FOTA 4HZGA 5DASA 3QEOA 2X8LA 2RIPA 5A9SA 4PCAA 1UAGA 5J2BA 1VBNA 1KH2A 4K6OA 5D84A 2QBYA 4TQRA 1JIJA 3OIWA 1IXRC 1KSFX 2R86A 5HF6A 2GSWA 3RUAA 4YUXA 3EEFA 3SAHA 4C0ZA 4LAFA 4RXMA 1JEAA 2P2ZA 2VT6A 4JXXA 4TSRA 3DBOB 5JS2A 2X2OA 1OI7A 3R6WA 3RAXA 3ZGXA 1SZCA 1QRSA 3OLXA 3QY9A 1RC1A 1CE8A 1E1DA 4QJ3A 4UHFA 5E6SB 5GZ6A 4GWKA 4QULA 4BLQA 4R6XA 4IZIA 5CA0A 2PY6A 1UAYA 3ZK8A 3S1LA 5DGDA 1CIPA 3OJCA 5BORA 4GBJA 2XLCA 4CKCB 3F9CA 4JHXA 4HX9A 3VKUA 2J5KA 1WZEA 4RNDB 2LYAA 1AZSC 1LFDB 3QEAZ 1TVCA 2BFNA 1VG9B 4HZIA 1D09A 1PQWA 4LZDA 3N2YA 4X6LA 3EXEA 2AOUA 1NBWB 4MRAA 4OJ6A 3IM1A 2FQWA 4PY2A 1TU0A 1R9JA 2IA6A 4ETNA 4IHJB 4MUAA 1J25A 4DSEA 2PSFA 3K2EA 2LCFA 5FPTA 4E5UA 3EN0A 5IKXA 2XYQA 4Q6WA 4TZKA 3K70D 1DAMA 3R3SA 1OJ7A 1X9IA 3TM5A 1BE6A 1DO0A 2WJ6A 1BWSA 3G1TA 2J5XA 8AT1A 1IL0A 1GPAA 3I1JA 1ZRHA 4BQRA 3BZWA 2WT8A 1PWHA 4J0CA 1TM4E 4ILKA 2YRXA 1EEXB 2HJGA 2W6IA 1XN4A 2OC9A 3EY4A 2AB0A 2IPLA 3G2NA 3KPVA 1OPRA 4OHRA 5I6DA 1P0CA 3AX6A 3I5UA 4US2R 1N4DA 4TUPA 1E3MA 2C0QA 3X1JA 4RU9A 5TEVA 2A9QA 2WWIA 2VHXA 2WICA 8ICZA 5IUKC 2EFGA 5F3WB 3GRRA 4WFJA 4M37A 1Z6AA 3NJ4A 3I9FA 3O8RA 5DM0A 1NJSA 1GZ3A 3AB8A 1F3OA 1CUAA 4IIYA 4IL5A 5LKAA 1L1FA 4F45A 4F46A 4R1QA 3N2KA 3ESDA 2Z9BA 2B5OA 4LDZA 4UM9D 4AY3A 4KN5A 5B7GA 3JW8A 3UB2A 2QN8A 1SUFA 4D8VA 5D5PA 3I04A 2AKYA 1BWPA 4YXMA 4Q9HA 1CS4C 4OCZA 3ZH2A 4LKOA 2J7KA 1U8XX 1ISMA 3DBHA 2WB1C 2Z6VA 1M1XB 1G19A 2BCVA 3DC7A 4F04A 1QFXA 2VRCA 1XZHA 5CK4A 3WQBA 2BGIA 3NVYA 3RJIA 4W5TA 2XCSB 4QXMA 4R1NA 3C48A 4LUCA 4DUGA 3R40A 1ZS9A 5E6RA 4V0RA 1R4MB 3QKRA 4XLTA 3RASA 2P2CA 3TNFA 3HYCA 4AG3A 1KI6A 3IHQB 1OA1A 4ZDJA 2FPGA 3I52A 1Q95A 3V1MA 3RTCA 3WMRA 3KG2A 4UNNA 3CB4A 1ZOLA 1QFSA 4GLFA 4L6AA 4B9AA 3RBVA 3JPQA 3C3CA 4MULA 2KBFA 3I2FA 4ME6A 4OLHA 1P7YA 5DHPA 2IEAA 3G8DA 1ZW6A 3DQPA 2MJLA 2XVXA 5ES4B 1CB7A 1AG9A 1VL6A 1X1BA 1OXBB 5AVWA 1XCOA 4FHGA 2XVAA 2FP3A 2WWRA 2PJZA 4CN9A 3JYLA 4M4SA 4MA5A 5HG0A 2YDXA 3GV5B 3P9QA 2W6OA 2Q28A 2AR0A 2AI2A 5JS7A 1CZNA 4N5HX 4QYMA 4P0QA 3PQ5A 3M9XA 2O5CA 4UUAA 2QN3A 1I8TA 4DQLA 3CRNA 2HHAA 3H6GA 4C21A 4MRNA 4H6WA 1QDEA 3FTCA 3CZPA 5CTAA 2EP7A 2GYVA 4KXXA 5IVDA 2PEZA 4DV5B 1MIOA 5D5HA 2CRXA 1PSWA 2LUOA 3CGGA 1G0OA 2GI4A 1LB2B 4YT4A 4TQUS 1QRTA 2F77X 3M82A 3U39A 4BBPA 1OAAA 5IHPA 5KJ1A 3FDZA 1LBTA 4F21A 3KZNA 3U17A 3F5SA 4JI3B 4YRSA 1TQ8A 4AZSA 4ND8A 4E2YA 3JWGA 3W8DA 3WWDA 4KN8A 3N8HA 4CG2A 5DM2A 4DQUA 1GPLA 4OP3A 4UUBA 5LP1A 2PGOA 5DSTA 4XR9A 3FSJX 4MUYA 2J3KA 2Z3ZA 2VSNA 4JYZA 5IT5A 2VIXA 3GJTA 4YP1A 3SSAA 5FOQA 3HRKA 2J09A 1PG5A 1SBIA 4L4SA 1U3TA 4HGZA 3MFQA 4DSFA 2TYSB 5HKKD 3AI2A 2E48A 4JUBA 3GQCA 4I4TB 2PWPA 2FSIA 2PKXA 2D8MA 1T91A 3IFSA 3BQ2A 5AI6A 5EZ5A 4YRJA 3FKSA 3WLOA 2DJIA 2IV3A 1KMIY 4I3GA 4EPRA 5C8YB 3FE2A 2P9HA 1H8EA 2DY0A 4C0KA 3LOPA 4I50F 4Y0AA 1C3OB 4U7CA 4MDEA 2ZJ3A 1O0SA 1V37A 1ZG3A 2B4YA 2IPXA 2WLTA 4L0DA 4KHZA 4G97A 4GPEA 5IXJA 2CJYA 3KB2A 4K6KA 5AIAA 4N3GA 3W2IA 3CX7A 5KHOC 3G0BA 1W44A 2BDTA 4U6QA 1E66A 1GLVA 2AUTA 5ALFA 5JTTA 3SQWA 1E6KA 4G0PA 5JLAA 5C35A 4RHCA 3TFOA 4TV9F 4LMAA 5D49A 4KQGA 4C6TA 2GLEA 2Q6TA 3AUXA 2WVAA 3IP8A 1HFWA 3WK5A 1TRHA 1ZD1A 2FPUA 1WDLA 1DRUA 3BPSA 4PYOA 2YH2A 5CVCA 2QUIA 4CN8A 1L4UA 1F8GA 4JUCA 1NWHA 4QDOA 2X7JA 3ZWBA 1Q0SA 4M8SA 1A4XA 5C3UA 1PEYA 6PFKA 9ICSA 1NQUA 1WPRA 5F21A 4L0CA 4DWOA 4UASA 3AWDA 3VO9A 2O05A 5CA1B 5J0RA 3I09A 4CMEC 4YC7A 4HAIA 5J4HA 3AM5A 2IH4A 1EGMB 3DAGA 1G6KA 1UT8A 1BDMA 1RIFA 4O29A 4BN0A 3GZNA 4NBLA 1CQJB 3C5FA 1KNQA 3A0UA 3RYHB 3UJ3X 1XEXA 1D0SA 1N5DA 3DAPA 1E18A 2QMOA 2YFYA 2ZRLA 2FPIA 3NDIA 3TM4A 2WNHA 1F5SA 1KDHA 3P9RA 4DL2A 4Z7OB 3T5DA 4DLTA 2F6RA 1HNZB 4ZOHC 5INTA 5IU6A 4RQUA 3U7EB 4WZAA 4AXXA 5LLTA 1BG6A 3WGGA 2W6MA 2YBDA 4ESEA 3GJ5A 1NR5A 3KAJA 5EWMB 3OX2A 3SFVA 1KFJB 1ADCA 2XNSA 4RC9A 1UJNA 2WPDA 3JWJA 1IG3A 1LDMA 5K0EA 1OGJA 5ILGA 2EZYA 4OXKA 1MMFB 3KZ1E 4HQRA 4TRRA 3BWXA 1RXYA 5EUBA 4HB0A 1QGDA 1CNMA 2IZ6A 3D2AA 2F3SA 1DADA 2K4HA 3G6XA 2XNKA 1U0FA 3EXIA 2BE7A 4V0MA 2ZSDA 4ZO4A 2ZBDA 4D80A 3N74A 5CA0F 2AKAB 1BOOA 1S97A 2QEQA 2ZRPA 4QWWA 3VR6D 3JR7A 2QP9X 1FEZA 5GJVC 4PR3A 4XWKA 1DC8A 1FJGB 1HG1A 4DV2B 2MMGA 3N70A 3AF3A 3N4MB 1E3TA 2C3OA 4NMXB 2MUTB 3RJTA 2PGXA 3RH4A 3L1UA 2G9VA 6GPBA 2JFHA 2IXDA 3VC1A 5SZJA 2NGRA 3QKSB 2DETA 3AGQA 3A6ZA 1MOSA 1S02A 4ZD6A 3T8YA 4ZOLA 1OFGA 1TMGE 2QGZA 2FYTA 4NFLA 1R5NA 1LK5A 2BCSA 1U0GA 3HKZC 5DCWA 4ZU3A 4XFDA 4N3CA 2F9FA 2KFZA 3GCDA 2UYHA 4BTEA 1Z6TA 4Y0VA 2OV8A 5JMWA 2E4WA 2A5LA 3UAVA 1A4IA 2V6IA 3MABA 4ZMBA 4NLLA 3DH0A 1KQPA 3Q41A 4ED7A 4GOLD 4UVIA 3FY4A 3C6ZA 3OQVA 2ZDGA 4Q3DA 3BZCA 2FSVA 2R7AA 1HE2A 1KJYA 3SAJA 1Z2AA 2PSHA 5HR6A 3JQAB 1FF9A 1G291 4TSKA 3UJNA 5GGXA 3EVAA 4UPVA 2O5EA 5FOVA 4ARBA 3DD5A 1JXEA 3CXUA 3HHPA 3U4HA 2G5GX 2PV0A 3RIMA 1AN9A 2BT4A 3HWSA 3S81A 1O95C 3TAPA 5HZHA 2DF8A 5IBPA 3FX2A 3GEGA 1BXRB 3KSUA 5E6SA 3WRWA 3PQDA 3I2IA 3OTIA 5JYBA 1QCKA 4ZANA 2YJGA 3IXLA 3QU5A 1KN5A 1JKFA 2PLAA 1KRWA 1CY0A 1FP7A 4CKCA 3NBMA 1IZ7A 1OIWA 4OXYA 4F2RA 1SGWA 1QGYA 3FAZA 1WTAA 3R7LA 1H4VB 5COAA 1TM2A 4G81A 4MYSA 3U13A 3WHKA 2H48A 4JLJA 5FTLA 5KG5A 4WECA 4MOWA 5HZGA 2NT3A 2Q7OE 1JTVA 1C9KA 1SUCA 4IHJA 2WPNA 3JYNA 2YRFA 3FR8A 1FP1D 3R7WB 3VISA 1JLSA 1DSSG 2EJWA 4DA6A 3WB1A 1K2VN 3H3XA 1M34E 2G08A 5KNBH 4XD7D 5K01A 2XA9A 3RB6A 3N0WA 5EHXA 3M6IA 4DSOA 2C3PA 2C2RA 2VXCA 1U0JA 1ZLXA 1IHYA 2WR8A 4YAOA 4KAAA 1F06A 4UNRA 4B82A 3F5DA 3AFIA 3E48A 2QUBA 5BXYA 1DBRA 5HZKA 1KY3A 3FRHA 5JU6A 1F38A 2Q3LA 4CHTA 2Z6QA 2XKKA 3V1KA 4LWOA 4WEQA 5KX5F 2O54A 2JGMA 1WJGA 1EUZA 4N5IX 2GA8A 3I01M 3L8GA 3V8BA 2Z1MA 1R9MA 4ECXA 2B1GA 2G40A 1T1IA 4MDHA 4X1IB 4F0JA 1PZGA 1DPGA 3PWTA 3UKOA 3ZUPA 3FDJA 1G6OA 2HNAA 2VHWA 1L1EA 3UG6A 1UA1A 2FWNA 3NVMB 1VG8A 3BWDD 3MF4A 2OA0A 1E9FA 2ZTUA 2RHMA 4F3OA 5LCXA 4A4DA 7ICFA 1N5IA 1XZJA 3BWVA 2PYDA 2PH1A 5K8IA 2B8WA 2HK6A 1EP3B 4RZ2A 4C2AA 1GZUA 5C5CA 5B2EA 3QU9A 1DC7A 1Z2EA 1N6KA 4R1TA 4ZK6A 4R6WA 3CMCO 2ATCA 1U2RA 3HSYA 1BEEA 1FUYB 3BTSA 4PV7A 5ALOA 3VR4H 1G4HA 2F7SA 2OXTA 2UVRA 1ULBA 4KQ6A 2NQTA 4YJ3F 1PHRA 3UANA 5JRTA 3BAFA 1Y5LA 1XQ9A 1B6TA 4ECZA 4PIPA 2VT7A 3PTZA 3VPBA 1UF9A 4C1BA 1KYWA 3T95A 1NW9B 3T3EA 2GCPA 6Q21A 3OSNA 4NHEA 1TU4A 4UVGA 2LMRA 2ISCA 4FM9A 4F2DA 4GIBA 2QUJA 1YMQA 1KW4A 1XTQA 2R1UA 5FBZA 1QOQB 4UE2A 3N6XA 5P21A 3PY8A 2DH6A 1U0HC 3Q11A 4JBNA 5DW3A 1R1DA 1CZOA 5IBRA 5LMNB 1D8LA 3TDKA 2QB5A 3MVEA 4P7GA 1Z29A 2HU8A 1IN1A 2BD0A 4AB1A 2I66A 2Q7XA 2WVJA 4LJ6A 2BKEA 1LSUA 1FY2A 2JLYA 1KPIA 2YN0A 4GKJB 2JI7A 4Q37A 1LLQA 1TK2A 3NRZA 4GR5A 5MGNA 9ICEA 3VDNB 1UBKS 1XAGA 2YQZA 1BFDA 1NVBA 2RJOA 5JYEA 4AM8A 7ABPA 4B1FA 1HGXA 4E22A 1ZD3A 3DLTA 4MCHA 4XIJA 1E61A 1XZNA 3FNRA 2Y1WA 1V1RA 1SBTA 2O8CB 5D86A 3RWBA 4Z9XA 4DJ5X 1M3SA 5C52B 3ISDA 2OORA 3GYBA 1AUOA 3AJEA 3JS5A 4CF3A 1EFPB 3HGQA 1IQ0A 3QENA 5FR1A 1XHEA 1A77A 5C0YA 1T5TA 4KWTA 2CLCX 5TS2A 3TLEA 1W0KA 4YCCA 1NBEA 2H5JA 2IEBA 3T0IA 4JLBA 1CUSA 2HRBA 3HR4A 3VYTB 3ZW8A 1PNQA 4P4PA 1G5RA 2O59A 3K9LA 4QAQA 4X6YA 2HOQA 4RTRA 4C4SA 3K8ZA 3B38A 1AX9A 3V1LA 5CYFA 2FETA 3F5MA 4K9KA 3JQRA 4GOJA 1ED1A 2J8ZA 3VU1A 1AK1A 1ZQKA 1PDOA 2K8AA 4I4TA 1D3AA 1PG0A 2XYVA 3Q7QA 4B9UA 1KL9A 2FCRA 5CVTA 1A1VA 5HF5A 4PWZA 2ZT6A 2VWQA 1IH8A 4D4MA 1M73E 5A3JA 1XXHB 3B20A 2XRYA 4L9SA 2H5XA 1C3OA 1FFDA 3G23A 1XLWA 3VC2A 1A7JA 4TOIA 5AJYA 4AG5A 1RAIA 1TF7A 1G4AE 3E2MA 4XB1A 9ICFA 3MTAA 5J2EA 4F4JA 4PBTA 3G85A 2BMFA 2VJCA 4F8JA 3TX2A 1XDUA 2M6KA 3AFOA 2C3UA 1CJKC 3R8XA 1TA9A 4BJ6A 2OZKA 4DRYA 4C4XA 3K4GA 3BWEA 1YZLA 3QPBA 5TF4A 4IVRA 3ID6C 1TNDA 1Y7LA 2XMRA 4UQLA 3BL6A 4USAA 4DDVA 4RQTA 4XVUA 1I10A 4B4VA 3IT0A 1U63A 2IU4A 1PJBA 5FUQA 2VTEA 5KFIA 2GF2A 1MAAA 2PL1A 4JC4A 4XCVA 3R7AA 5CA1A 4LE1A 2GOLA 3C85A 4LTNA 1NRXA 4B3RB 4L85A 4DB2A 1I6KA 1TA0A 3GVPA 4YAWA 3MERA 3B5IA 5EZ6B 1CQJA 4AMBA 2CUTA 3RYHA 3ILXA 4RKRA 3ENWA 5J59A 5DGTA 4EBEA 1H3NA 1UODA 4RHFA 2YNMA 3PRYA 3V8VA 3THYB 2PX2A 1V9SA 1S5PA 1RRKA 3RSOA 2KIVA 4RH3A 1DJNA 3TLZA 1WB4A 4NE2A 2DTXA 1N2ZA 1VPLA 3I23A 2YHUA 1U90A 3KQMA 4MR9B 4G0XA 2V7PA 4M9ZA 1ECGA 4IF4A 2MYNA 5D3MB 1DEKA 3IYLW 1ZM7A 4JMUA 4HG2A 4MV7A 2GXUA 3A36A 5EWMA 3K75D 4XLZA 3DL2A 5FV7A 1IWPB 4TS9A 5SY9A 4YYZA 4YFKA 3D2CA 1GRCA 1CPYA 1SJ9A 4Q1EA 1W0CA 3B8EA 3NOOA 4Q5IA 3K6JA 4FIDA 3OE7D 4K81B 3DEYX 4N5NA 3V46A 4YHBA 5BO5A 4Q7QA 4ZCLA 3K0AB 4D9KA 5AJXA 4I27A 5KINB 3Q3JB 1ACJA 4R40A 5KJFA 5GTDA 4GL4A 3NWOA 2DPHA 5BRAA 1Z47A 1N6HA 2CNDA 4YRIA 4EAAA 2RGDA 3VTFA 1DELA 1BVRA 3AIMA 1T6XA 2NU8B 3GYGA 1KZYC 1X6JA 5AOVA 5K03A 1GTZA 4CQNA 1YZHA 3RVMA 4QWCA 4M9QA 9ABPA 1KO5A 4RY2A 1FMJA 2MUTA 5GV7A 5J3JA 3W5VA 3JQGB 3IMGA 3X43A 2X2FA 1DHRA 4EL0A 2VZ8A 2NO4A 3P0EA 4BO5A 5C7OO 4BNMA 4B6OA 3QKSA 1ISGA 1IN4A 4OXNA 4I99A 5REQB 1UBRS 4ZJYA 1W4LA 2HMWA 4GZ3A 3BHNA 3SX0A 2O2GA 2FP4A 3P4UA 4PHCA 1JJAA 5EHGA 4QWBA 3OC0A 1OX6A 2E9SA 3QM1A 4PYIA 2YOGA 4UCWA 5E6UB 2YY7A 5TISU 3MHPA 5JAMA 1SV0C 1JLLB 3ZZTA 2E8OA 2JCBA 1SXHA 2OV6A 1TO2E 3UK2A 1Q92A 4RJJA 3ZHVA 3SR0A 3DEHA 4UTNA 4FCTA 1MF7A 1SBCA 4F5ZA 3OOHA 4HNHA 4G5HA 1SG9A 2YXDA 3C2QA 2A9KA 4WLUA 3JQAA 3OUTA 1O77A 1GXSB 3VGPA 1W35A 2DT8A 4JITA 2Q3EA 3NBQA 2NG1A 4JSYA 4PS1A 4NLBA 1TCAA 3OOWA 3UOGA 5CK5A 4P3OA 4BO1A 5TT1A 3R7DA 3CSDA 2VBIA 4F60A 3NHJA 3ZZUA 1T1JA 2WF9A 1DT5A 5GPBA 2FFBA 2ZSAA 3ZKAA 4MK4A 4W5NA 1A8HA 3AUKA 1BXRA 1EUDB 1A8IA 5I9MA 3BM5A 4CT5A 3HXKA 1E5LA 3G0GA 3P9SA 3VAYA 4ZREA 3SZLA 1Z6YA 4LRYA 3TECE 1HJPA 1P7ZA 2I33A 3TQ1A 1GA4A 4OPMA 3II6X 4NU8X 4PYRA 1AHIA 1RWWA 2W04A 1TEVA 4NPAA 3WDMA 4MWZA 3GWGA 5JBQA 3VR2A 1SQFA 1GCAA 1YTUA 3UWPA 2DL0A 7ADHA 2YQEA 4AC9A 1WYGA 4FFPA 2QMQA 1BW9B 1PNVA 2AR9A 1YU9A 1NK6A 4WN9B 3EVGA 5MFZA 1VHQA 4D46A 3R7WA 4IP0A 4EEKA 2CD7A 1Z7GA 1A2OA 2D0DA 2CN1A 2F4VB 5IYZB 3GIJA 4KQXA 1XRJA 3HUEA 4MQBA 3AJ9A 2M1XA 2A2ZA 2DHDA 5DM60 4Z4QA 3LLCA 3DKKA 1DJPA 4L78A 1L7OA 1JF8A 2B7BA 2ZT8A 2Q4OA 2KLBA 4UMEA 4XEUA 4FOSA 4TYPA 3OJSA 3EXHA 1Y4UA 1IUOA 4KUHA 5J8YA 4FEAA 3KHLA 3MLEA 4IV0A 3AINA 2E4VA 4RLHA 3TOXA 3L7DA 4O59O 1QHNA 2ZTEA 3BMCA 4GX0A 4ZCRA 2GAAA 2I9GA 1WVIA 3HM2A 3B9JA 1H69A 1T0IA 2C07A 2C61A 5AUQA 4GYYA 1FK8A 2X9QA 1ZGJA 2Y9TA 4P92A 2ZE7A 1MQSA 2Z5FA 4J9UE 3OQHA 1N77A 2WUDA 3WFIA 1WLYA 5CG1A 4V0NA 4NDAA 2IVZA 5I7VA 3C4QA 1DK2A 1NOJA 4CYMA 3HWX1 3MJHA 4FEEA 1TCUA 5AHWA 2AFIA 2WFZA 3AUOA 4ML3A 2D1QA 2BUCA 5KOYA 3FROA 2J33A 3ZU6A 3V8MA 2ASJA 5LBUA 2WD8A 5EJ7A 1YR9A 3WKCA 3C7AA 3GLSA 1WXDA 5A4DA 2O2ZA 1MFPA 5ER9A 5L95A 4LYYA 4URFA 2C9MA 1GQSA 1DXQA 1K7FB 2OFWA 1U80A 2O50A 3NEPX 2VAWA 2UVUA 3V8RA 5A3QA 2YXNA 2ZPUA 1ZGBA 4PTZA 2YQ4A 2A30A 3M6WA 2FKAA 4RZIA 3OJ0A 4YR2A 2GHTA 3ZK9A 2G4CA 4IJVA 1N2JA 5IC6A 4AZTA 3MGVA 3LZ6A 5C8YF 1RAEA 4JR0A 4MVJH 4DJEC 5KO2A 3G2LA 3DD1A 3RKRA 1JIKA 4M89A 3DMRA 4QUJA 5COQA 2BGLA 3KQTA 3MGGA 4BEJA 5JDIA 2RC6A 1CCWA 1D8TA 3CKLA 3AL0B 2J9YB 1JJ7A 3KKKA 1TZCA 3FTEA 4EUSA 4FN5A 3E4DA 4X54A 2ZYIA 1MCZA 1H42A 2IEGA 1XEWX 3WLHA 3SF0A 1IDOA 3LW7A 4PNPA 4NCKA 3N39C 4A26A 4R3NA 2YZKA 2OYSA 4KRGA 3O8OB 4KLJA 2DTEA 4K5QA 2QT9A 4IZHA 4TQGA 1JKJA 5FL3A 2BHRA 2DLCX 1CFJA 4Q00A 4QWEA 4EYOA 1EFPA 4FYWA 3LC2O 3DBHB 3KQNA 3U62A 4A0QA 2KBEA 3KOWA 1RJDA 1IE3A 4IOKA 3NBKA 2AJDA 4I4NA 4YCJA 4A8TA 3IV9A 3REFA 5AICA 2P6UA 4KB5A 1YQTA 3NGMA 3IVXA 2G67A 4FJ0A 3A6DA 2MSNA 2EATA 2XY5A 2XSZD 4GI7A 4YJDA 4UHBA 3HVHA 2XF8A 3LLSA 4P6VF 2GBCA 4P36A 4UUMA 3C8DA 1BCSB 5AM1A 1JHOA 3PR5B 2Q2VA 4UW9A 2FAXA 2PH5A 5EQTA 1OTYA 1QGUB 1ZBDA 3OCYA 1P1FA 4PHHA 9ICBA 3PC8A 4M0EA 4XQ0A 1NR1A 1JQEA 4DCGA 3CT4A 4IRDA 3ICCA 3PITA 1EVZA 2OFOA 3K4HA 3GFGA 2QIOA 1XXHA 1JU9A 2H17A 3IS3A 2I4TA 1AKRA 1D07A 9ICAA 2YFQA 2D06A 5LDDC 1ZU4A 4CIVA 4PZPA 4EHDA 4F84A 4LECA 4JV0A 2E2WA 4KMMA 3E2EA 2FE9A 4IJQA 4L51A 1WZCA 3SXJA 1NBIA 2IP2A 3HP6A 4E2WA 4YRPA 5D1NA 3I9JA 5K3BA 1ZBQA 1K89A 2BL4A 3FCEA 3WGKA 1SKUA 2D7JA 4JX9A 3MT0A 3NFRA 2OB2A 1M2NA 2IZZA 1KK3A 4DMMA 1BPEA 2IIQA 2Q2NA 1AO3A 2O6HA 1NI4B 3R3VA 4CCYA 2I6UA 3ZGYA 3ANTA 1PZEA 1Z5VA 5IC4A 4RPKA 1VC2A 4EKEA 3FVQA 2EYQA 5KPJA 5J2GA 4DYDA 4I66A 1RPJA 1XZ8A 1FFWA 1QR2A 1VL2A 1GNVA 3KEGA 1KHTA 4J9LA 4GWLA 3M3DA 1WBJB 2CFCA 2QW8A 2X0NA 1J2NA 3UOAB 2JI4A 1XEAA 4HFMA 2PVPA 2VZEA 4M9XA 2HRRA 3DJYA 2C4UA 4V38A 3MW8A 4R31A 2P67A 3ZDFA 4FGLA 3QYFA 2AOXA 4EG4A 2C7BA 1EFRA 2GS9A 4ERXA 3CN9A 4JYPA 3NORA 3OU7A 3FOAA 3DBIA 4QOGA 4LOKA 5KTNA 3ECAA 2ZRAA 2GN4A 4CRXA 2WIAA 1Q15A 1MPXA 5D3MA 2QS9A 4B73A 5C5DA 3E5HA 1H0KA 3Q8RB 4H3KB 3Q5EA 2HMTA 3SHVA 1RRVA 1TI7A 3W8EA 4DLRA 2MRLA 3JQBC 5JW6A 4EO4A 1B8VA 4UC0A 1GZVA 1BPYA 2GD0A 5EP4A 2ADOA 4OMDA 4BAGA 3ROPA 1M6NA 2PS9A 4PINA 1G3QA 4H15A 3K0AA 2D13A 5KEIA 4F4WA 4KN6A 3ZN2A 4IOMA 2GO1A 4C6TB 4X3CA 5JHGB 1V48A 3C23A 1DV2A 3ZLTA 3PNCA 4KKVA 3GFQA 3M81A 2GBPA 2VNAA 5KNCD 1RWNA 4TTTS 2G9UA 1RWBA 4M7RA 4H1VA 1N7HA 4BU1A 2EQBA 2NU8A 1FDIA 4RD0A 2KPOA 1KMQA 1RD4A 1K6EA 3MGHA 1VSBA 1QTMA 2XBMA 4C4PA 2VCEA 1BH2A 1PJCA 1NPTO 1SL0A 2R8BA 3V6KA 3JQGA 1SXIA 3USCS 2NV6A 3AIIA 3F8SA 1FTGA 3SYTA 1U8UA 3CO0S 4QGSA 5FEMA 2JZOA 1OBOA 3HABA 5DIFA 2FXIA 4GRAA 3QPWA 5REQA 1GQFA 1MUUA 2NX2A 3ZY3A 1KYZA 2NAPA 4NAHA 1ZJ5A 4OI2A 3WDSA 3FRIA 1JEJA 1PR2A 3WFJA 3ZCQA 2LP4Y 1SC1A 4JQSA 5HUJA 2EU8A 4LWZA 3RF7A 4M2LA 3A37A 1MC4A 1HSOA 3LQKA 1HTWA 1D2CA 1JLLA 1CUIA 4MAMA 3STXA 1PFWA 1JN3A 2Q7DA 3SYRA 5CDTA 1XMQB 4DCVA 2Z08A 5EWFA 1NQXA 1ZNZA 4ECSA 3MJ4A 4GSLA 1IHDA 3ZHXA 3I64A 3DKVA 4JZKA 2EERA 1R6TA 1R0KA 1XSEA 1GXSA 2EEPA 1P73A 2YIVX 3H1AA 4A2WA 3PDCA 2ZYGA 3ZY2A 3OIFA 1NJXA 5DN6D 1PR9A 1PS0A 4PZOA 4Q1FA 7ICNA 4GPD1 3IAUA 1BXGB 2BGJA 3RH0A 4CM9D 1KKUA 4FO6A 1Q3HA 2BFEB 5F3DA 4QBIA 1X66A 3VVLA 1XZEA 1T15A 4JS0A 2Q5OA 4OVKA 1G3MA 2W6JA 4LPSA 4YG2A 3EA5A 4XOIA 3QW4B 3K9NA 3TQCA 4RLFA 3QITA 2PKCA 3ZZ0A 4FS3A 3OF2A 1C9EA 3UKDA 4FMCB 1PJLA 2JIPA 5GGYA 2ECOA 1XLVA 1YE5A 3KOXA 1U0TA 1M2KA 3EPJA 2EJBA 4L07A 3QFTA 4EY7A 3U7FB 2JDIA 4LVCA 4ZOLB 4HEA6 1BW9A 4TXJA 3U0VA 3ROZA 2IY8A 4QIWC 4B3BA 1G8FA 4DLPA 3D4PA 4R2LA 3DAFA 4WN9A 3OFKA 3WI7A 1VJ5A 3QRWA 1IOLA 1JZQA 2KWIA 2Y4NA 1HZZC 4H1HA 5DX8A 3TGWA 2A4KA 2L0XA 2HIAA 2VDVE 4CIYA 4BC0A 3U37A 2JD2A 3H4IA 3MFHA 5IYZA 3UUEA 3HWWA 2DBYA 4NARA 1ZH0A 1N6RA 4A8PA 2VJOA 2HMYB 5IILA 4A8EA 3FLBA 3I6ZA 2QTGA 3U16A 4D4IA 4KHPB 2IBSA 1ID8A 3SDBA 5JTIA 1NLMA 4K9NA 4D3YA 4JLAA 5E7JA 1P5RA 3H2YA 1YR6A 2V97A 3D3WB 4EBCA 4I08A 3QPDA 4B9NA 4OK3A 3CRRA 1RACA 3HWTA 1I2ZA 4F50A 2D62A 2QW1A 2Q6IA 3JPOA 1QVZA 1XRRA 4BVJA 2H8GA 1XDBA 4P80A 3ROFA 4G2NA 3DE1X 2VJ4A 4PO1A 2WAMA 4ZYVA 3EIUA 4MKHA 5AHXA 3DW1X 2YWFA 4YHHB 2HR1A 2X1MA 2XADA 1YQUA 3WSTA 2EC5A 3KUCA 1X39A 4UOZA 4NU5A 3X3HA 1ZISA 1GAEO 1SRQA 1H22A 1XOIA 4ACOA 2DR0A 2Q3MA 4CKXA 2CXYA 1UINA 2WJGA 5EA2A 1GGJA 2R60A 3K32A 3RB3A 1Q3UA 2VWHA 5JATA 4JBWA 5E9QA 3RQSA 3CR8A 1ZR4A 3RS9A 2BRUC 1VP3A 4ZYYA 3GWZA 1U9LA 3A9RA 2AYZA 4Q1AA 1M2JA 1FP4B 2XKBA 1G8KA 1CXZA 1PW5A 1VL0A 4EKYA 4HNTA 4ECTA 3FF4A 1B22A 2BEJA 4KITB 4EZ9A 3K0KA 4GXRA 4YBZA 4J9MA 2UZ0A 4OMFG 3LK9A 1Z15A 3WHPA 3PA6A 5KFGA 3HKCB 1SCUB 2BMEA 3GT4A 3EH1A 2XTNA 1YQQA 1SCKA 2AEFA 2CPRA 2D6FC 3KKLA 4K0KB 4EGJA 4NDZA 1D7AA 1ZYUA 1UMDA 3E9NA 4LYAA 3EG9B 4CEJA 4ZRDA 2PR7A 1IDN1 3WLSA 4H7JA 1RHKA 4Y6QA 1OUQA 4Q4AB 3AEZA 1X19A 4OSOA 1L5GB 2JLAA 4R71A 3OZGA 3RLFA 1EVLA 3WLIA 5IDQA 4D4GA 2GBLC 4XJVA 1EGAA 1VI6A 3I6BA 4IIBA 4MGIR 4WLNA 2ZYDA 4G0NA 1YRQA 3ZNNA 5JISA 3ORQA 5ELMA 4QA9A 3IXMA 2R6DA 4YAKA 1LBEA 4XKJA 1A5TA 2J7PD 1EFLA 4HAYA 2BM0A 3NG1A 121PA 1XWLA 3PTAA 3O8OA 3UW3A 1BOFA 1TPYA 4DIKA 4M0CA 1WDMA 5AHOA 5CNKA 4CM5A 3F6EX 2H18A 3UGJA 1YB7A 3BJYA 4BFVA 1JU3A 1PJTA 1UQVA 1JT9A 3AP2A 3LKZA 1H2BA 1Y3AA 3QWAA 5ITWA 5JARA 4B45A 2HHXA 4OQPA 3KLPX 4HNSA 5JRJA 4FK8A 4REQB 1RXWA 5LB2A 4C4AA 4L3OA 3RUIA 2PS0A 1JPNA 1AUQA 3RCBA 4ARIA 5B37A 4RD6A 4B3CA 3C29A 3VVBA 2TMDA 5K4HA 2JLBA 3ZE1B 1BPXA 5LU8A 2QRQA 3C3JA 4M0MA 3QE2A 2UZ3A 1PQYA 4F3TA 4JQCA 4BQIA 1G3RA 4FZNA 3KBOA 1BCSA 4IDEA 3KKAC 2V74B 3ZWQA 4WWHA 1ESEA 1P5HA 2VIIA 4M0AA 4AF6A 1QGUA 3N87A 2J08A 3SQOA 2O2CA 4PHDA 2UKDA 2IU0A 1GKLA 3UCFA 4E21A 1K2WA 1G9SA 3T35A 1ZQCA 2ZEJA 1P9WA 1CVLA 4H77A 5A3VA 4QPZA 3MG9A 4M8IA 1Q57A 1SCIA 3ECSA 3N75A 1SD2A 3RS7A 4DL3A 3GLQA 3PNVA 1AXRA 3GHHA 1CIJA 2YB1A 1WWKA 2A7XA 2P27A 4LJLA 5AP9A 4KQHA 3LZDA 2OYRA 4MR8A 3TF5A 1C7EA 5H16A 4UDOA 2NO9A 4BQPA 2X9LA 5ESDA 3ZJ5A 4M9JA 5CVUA 4ITRC 4FT4A 4XWOA 4OATA 2XAUA 3ISTA 3ETRA 2N3ZA 1V1RB 1BSVA 3TPZA 3V9PA 3KC2A 5IAOA 1FFYA 1SUBA 2VHZA 5GP1A 4P3YA 1EHIA 2PSSA 2C95A 2OO3A 1C3JA 3KVRA 2DTDA 2PXXA 3QUCA 1HETA 3A3OA 3TRJA 1BNOA 1WY5A 1F0NA 1NI4A 4QIHA 1VBFA 4QU0A 3QNMA 5DULA 3E4CA 1HT3A 3MJVA 5KAMA 4JNKA 2NO6A 3S5JA 3QLVA 1OLUB 2BMJA 5M04A 3FOBA 1NW8A 2ASDA 3CWCA 3EJ6A 5F5XA 3ZHTA 3CCFA 5DYTA 4RQAA 1KU0A 1T8SA 3UUGA 1WL8A 4RX1A 5SZKB 1USUA 4IS7A 4RLSA 2H1CA 3RWOA 1DKMA 4TN5A 4P7JA 1JHVA 5CFZA 4KLAA 5ALEA 1OTXA 4HH3C 4TZ6A 4JUAA 1P39A 5A2GA 2DHRA 2XUQA 4NCBA 5CB0A 2P6PA 5JD4A 3VO2A 2YWJA 2WINI 4PYNA 3VSAA 4AW9A 2EG9A 3N1UA 3QEBZ 2VPZA 4J90A 4ZFNA 4BIMA 2YWDA 1U1CA 5IIOA 2JGDB 4FR0A 5JWOA 4HFNA 1T94A 1L5VA 2V6BA 4M1EA 1Q2UA 4TRMA 3O4GA 2VCHA 3KHUA 1OFUA 1N0WA 1KAQA 3B2NA 1PI3A 2F1JA 4AQYB 4J9QA 1IXYA 4YAGA 6LDHA 2PUDA 3EDMA 2GEFA 5E7QA 2JLCA 3GIDA 2XYGA 4UEQA 4R65A 4DCJA 1VJ0A 1PWXA 3IEIA 3RARA 3H9BA 2H07A 4E7PA 5IKOA 3HCCA 2QM3A 1LCIA 3T1OA 621PA 1Y1RA 3DEKA 1BE1A 2P1RA 1UKZA 3MMZA 5C8ZA 3ZLBA 4F4UA 4CM3A 1KK1A 1C7IA 1Y8CA 1AH2A 2HREA 4LZZA 2GM5A 3LPAA 2GYYA 3LA6A 4NAVA 2V7QA 1LPBB 2QQ5A 3H5OA 2G5HB 3Q0TA 3PE6A 4YPFA 1Z7WA 5KQLA 3PJEA 3WU2U 1JR3E 2D59A 1XK7A 5KSPA 4MEXA 4UDYX 1RYHA 2ZM5A 4MAAA 4MQLA 5BWOA 1YFKA 3ND6A 3T4UA 1RZUA 2WAAA 3FYCA 4FD3A 5EZQA 4G5SA 4QJBA 2AEEA 2X0KA 5I7EA 4YQZA 1WZ2A 3CRQA 3CS3A 3A32A 3UMFA 3OJUA 1MDFA 4YTEA 4YREA 4RK0A 5ADVA 1YVEI 3LJKA 4DZZA 4MINA 1HMPA 4AMYA 2WJJA 1KL7A 2NNLD 4B3MB 4FD2A 3QVLA 2H2AA 3RUDA 2CEAA 1W36D 3T6KA 1Q0QA 1EJ0A 2AF4C 1TC1A 4R84A 4UE6A 5C37A 3EZ6A 1BXGA 5DIZA 5FPPA 3GFRA 4AJEA 4Q9LA 1Q6YA 4M1MA 1V47A 3UWMA 4WNIA 2OSBA 1CEQA 2PMEA 2BFEA 1UJ2A 2ODWA 2UXDB 2PFSA 3TGLA 1EP1B 3UHAA 1T1EA 1JBQA 4DIMA 1EDZA 4FYXA 1L5HB 5FIUA 2EP8A 1RYUA 4EYEA 2WWXA 3QYJA 1A3CA 3LVQE 2WHXA 2Q9CA 2Y1LA 3NETA 3ONEA 4ARUA 2ZTLA 4RK7A 3AF5A 5EKSA 4LFCB 3KXLA 4JEUA 4COKA 1HG0A 4RE6A 4BV3A 1RYBA 2A7QA 5K0TA 3LVWA 2CLDX 1SPXA 2II6A 2RH9B 4EVIA 1BHO1 1EFDN 1HDXA 2ZS7A 3JARA 1HE5A 1XWIA 1UBNA 3BA6A 4BPRA 1O8CA 1UEXC 2HMVA 3NRBA 3ES9A 3CRZA 2ZBRA 1R3DA 2PD4A 3WKDA 2FP4B 3OOEA 1HLPA 4AFNA 4B2YA 2KYRA 1JVBA 3K20A 3I01A 4YR9A 3KQPA 4OXRA 2DVMA 4QZCA 2VP2A 4LDNA 1XRLA 1G1AA 1YSCA 4PSAA 3B3JA 4RU1A 2V9WA 4D3FA 3MRVA 2Q29A 4NYMR 5DG9A 4JJGA 4F8YA 3PZRA 5CFPA 1Q8KA 4QDXA 4HFJA 4JGIA 5EWGA 2IDMA 4UQOA 1UAAA 3WK8A 2JFUA 5J5VA 4ECQA 2IHKA 4HNQA 2OZPA 1N4AA 1QH8B 2E3TA 1XNHA 1R5BA 4LF4B 4N03A 1F2DA 5ALJA 3IG5A 4B44A 1K7XB 2ZBFA 3D3WA 4HK4A 1AMUA 2FU5C 4PZ9A 5LMZA 3ZEIA 1ZZGA 1SU6A 3GLGB 1U9IC 2A14A 4TYWA 2J45A 3GK3A 1W1UA 3EF1A 1RHMA 3LWMA 2AXNA 4OM7A 3C2KA 4EW3A 2JEJA 4AY6A 2QUKA 3W8FA 2R85A 3H3JA 1KPHA 3GFOA 3LQYA 2AEMA 3BRQA 5BQ5A 3L7CA 7ICHA 4MCAA 1Z56C 3I5XA 5TPZA 2IYTA 4RORA 1MB0A 3ROEA 1JEEA 1YRHA 4JC8A 1PJSA 1X2BA 2DF4B 3VH1A 3H4BA 5GVRA 1AQUA 3ICVA 2IXTA 2M0NA 1ZQUA 3KFUF 1J7KA 4MTLA 4A5OA 1BNPA 4RKWA 4N54A 5FUWA 4H7IA 4J3NA 1PLKA 3RS8A 1G6Q1 1IY9A 2ZR7A 1TA4A 2WAQF 1NOIA 5F2NA 4LC1A 2D7CA 3OZWA 3I5AA 4RYLA 1FP4A 2PAFA 3LP5A 1TKAA 4GF5A 4XZ3A 1TT5B 1YFZA 2R1TB 4ALKA 1AU9A 4IIFA 1AY0A 4GR9A 1U28A 1UFQA 2ECFA 4B2IA 1Y9ZA 3MR3A 4QDZA 1IHPA 2HSEA 3AQ4A 5HF9A 1XMIA 2FEOA 3EYZA 3HKCA 1VPDA 1KEZA 1DU4A 1SCUA 4ER6A 4XWGA 4E3ZA 6ABPA 3DLBA 1PGNA 4P22A 1ML3A 3DL4A 4C05A 2PRJA 5JZSA 1NRIA 2PZAA 4BNKA 4FHFA 5K6RA 3EXHB 4UARA 2XLBA 1GCGA 3EG9A 2E49A 3HY6A 1XVAA 3UB4A 2J1LA 4R54A 2XGQA 4N01A 2MAXA 4Q4AA 2HMUA 5B7QA 3BMCB 4LQDA 1Q1QA 2WM3A 4YMWA 2FDCA 3D4IA 5EIXA 1JR3D 1U9YA 4RZXA 4WKCA 3GY0A 4JL6A 3TDMA 2QVLA 2Y1GA 2WWHA 4XYGA 4QPDA 2D5AA 4YQFA 4LWQA 3IVRA 2HA6A 2Q4EA 2WHRA 3IALA 2JLXA 4YT8A 5LJLA 4BNVA 1A8QA 5J4KA 2IQIA 3WOHA 2ZCVA 2AFIB 1J0CA 3U7QA 1T2AA 4ZHSA 2GX6A 3IBGA 3PSIA 5DM4A 5CMLA 3FOCA 4JI7B 1DQRA 3IC5A 1UEJA 2Q3DA 2IS4A 4U9UA 3T3HA 5KDLA 4PPNA 4EYIB 3G2PA 2O7RA 3TCKA 4I2FA 4B5LA 4REQA 1H2EA 3HYNA 1ZI6A 1U7ZA 1M54A 2WLSA 2G6TA 3LUBA 5BOMA 1A50B 1ZH6A 3D6JA 2P3SA 4JFAA 3AEKB 3UXOA 1UIMA 3ZGLA 2BDPA 1B1AA 4EG0A 4MVWA 5ELXA 2P8JA 3U56A 1Z22A 2RP5A 2XKJE 5LU9A 2QAJA 3QPVA 3OX3A 3RTVA 3FNEA 5ER6A 2Z4TA 2PUTA 2VDOB 1JHMA 5IH3A 2A3NA 5J4VA 5BV7A 4MP6A 4Y30A 1QS0B 2UUAB 4QRIA 3NHPA 4IKEA 2P68A 1TM7E 4XARA 4R2WA 3JQEA 2TS1A 2F55A 3PWKA 1GZHB 4LDRA 2KOBA 1HT2E 1M75A 3ADCA 3EXG1 1IJFA 1WP9A 4AZ3B 2HK7A 5JO0A 1NVUQ 1B6RA 2ID7A 1JKJB 2VA2A 3MJEA 1X14A 3ZI4A 4MRMB 3U7RA 5NULA 3RVPA 1AGRA 4TVKA 1KKLA 1HXHA 3CG0A 1DG9A 4U39A 2H7YA 5K3DA 2P9GA 2R96A 1BJRE 1UBCA 2O1XA 3LY8A 3PIRA 3LKBA 2COUA 5JROA 3PSTA 2RH8A 4BNGA 1KXJA 4HDKA 1ZRNA 1OLUA 2XMGA 4EB0A 4ENPA 1XDSA 3A3PA 4AKGA 3IDFA 4R8SA 3OKAA 3BSFA 3KCNA 4TS3A 5COBA 1WO8A 5BY2A 3WKEA 4EGFA 4DL5A 5FD8A 3COWA 3F6RA 2CCGA 2PI4A 4P08A 4FYKA 2AFHE 1HPLA 5KFXA 2O19A 2JAHA 1E3JA 1M2HA 1Z6GA 3DVQX 3VRHA 4DJJA 3BZBA 1LBHA 1D8AA 3Q72A 1FX1A 1G8AA 2FE4A 1NUUA 1QKJA 3EIWA 2KICA 3S44A 4RSRA 2V54A 1KAOA 1S1MA 3PYXA 1K8YB 5CBPA 3JD3A 3WL6A 3BORA 2CLKB 4ZALA 2R8HA 1V35A 3W9UA 3LQ2A 4IIDA 2FWPA 1QHFA 3PWZA 1TIBA 1VLHA 3JSAA 3AF2A 3C41J 2ZRHA 1L7XA 4I1RA 3FFTA 4EG1A 4EHHA 4UVDA 3WRXA 2JGDA 4JK1A 3K6SA 4DB4A 5FFFA 2DPMA 2DBVO 4BCBA 4RPLA 3UXNA 4PYLA 4ALIA 2H4ZA 4Z53A 5GTIU 3PO5A 3UK1A 2Z3VA 1LY1A 3H0MB 3OY2A 3T3OA 1AXEA 3TINA 3H7AA 2C88A 3KHHA 4J75A 3IAS6 4ZVLA 3SYNA 4CCYB 3QELB 2Y0PA 5E38A 4JR1A 4RMGA 4CV2A 5G41A 4JCCA 2QTNA 1A98A 5AM5A 3V3KA 1YMVA 1UIRA 5KHAA 1ESMA 4H6PA 3AY7A 1JTEA 1Q2XA 2QZJA 2QV0A 3EQ7A 2YZ7A 4FMCF 3PNKA 5CRXA 2GN2A 2C28A 3AMVA 2ONYA 4ZGWA 4BUZA 2YHAA 2EIHA 3I9LA 3HVJA 4Y2YA 4ZV7A 2ZSFA 1GDDA 1O6CA 2MSEB 2FEPA 3DV2A 4ZOLF 3NBUA 1J9EA 5D5QA 2GO7A 4AD8A 1YWGO 5EAIA 3VDQA 4QICA 4H17A 1SKMA 4DR5B 4IMIB 1OI3A 3K1RB 2BIFA 4WIAA 4C0AC 1C7FA 4IDPA 3H4MA 1LF0A 2HYIC 3G2OA 1QB8A 1M33A 1F3LA 3D4OA 3ZV7A 1UUFA 3CE6A 2Q46A 4FONA 1JXAA 5B5SA 4EMBA 2EBFX 4L76A 3ZQ4A 1JNYA 2WB4A 3DKPA 4EM6A 1OU4A 1J0AA 1X3LA 3SWWA 2O2DA 4NZZA 1ONNA 3EPLA 4GDMA 1K68A 4ZO9A 2OK8A 4J7XA 3EDQA 1WW8A 3VKVA 3BD7A 2G80A 3RYFB 4ZJPA 1VRWA 1H4QA 1FU4A 5DWQA 1P77A 4OHBA 4I2JA 2GZ3A 5DGHA 2QIPA 3E7WA 2J0SA 2WU8A 3JZFA 1L5HA 2LYBA 3VJRA 2TECE 2HXGA 3HP4A 2VK4A 5CLFA 1JIUA 4E14A 2ID9A 3V2UA 4Q3BA 1F8FA 3Q10A 2MMCA 1E7YA 1EWTA 2PKEA 1NJ8A 3SEFA 1IHUA 4A8JC 2A58A 3PVXA 4AS2A 2L2QA 3AEUA 3OCUA 4IHJF 3PGA1 4KWEA 4NIMA 3OO0A 2ZU0C 4NI5A 2FLVA 2Y71A 2J46A 3IOCA 2BPGA 5DGBA 3IUEA 1JDZA 4RL6A 4H59A 7ICKA 5JI3E 1V71A 3C3XA 2FMXA 1PTJC 1EMDA 3WRYA 1NN3A 2ZXFA 3V72A 3AUUA 5DGAA 2XYPA 4G5GA 5EMLA 3NV9A 2I3GA 3ESYA 4G0WA 4IDHA 4M2YA 3N2NA 3DMPA 3ACBA 1YMUA 3DDSA 1Z1BA 3CLRD 3AVQA 4NG4A 1CDZA 5A1TA 5FI5A 1TK3A 2RKWA 2PE5A 3O4HA 1Z2DA 3ZQUA 4UD6A 3PKJA 1NNEA 3R8FA 1C0LA 4NJOA 4BMNA 4LV5B 5KNDH 3OT1B 1L8XA 2GEJA 1P1RA 1C0PA 3D4NA 1CEYA 4ID9A 1QH8A 2VQ3A 3PE3A 1ZVQA 2WRZA 3UJBA 3KV3O 4YO8A 1QM5A 4IWYA 2QX4A 4LHVA 2E37A 2DSNA 1G2PA 5DRTA 3T54A 3GLGA 7ICJA 5KQMA 1YF3A 2HADA 1SBZA 1AMOA 3SDSA 3DAYA 1T3GA 1ZK1A 1D6JA 2ZZNA 5L3QB 1KAGA 3OT5A 3S1AB 5LOVB 1Y8RA 3D7RA 1K86A 3DTTA 4JSTA 1C30A 1LSOA 3RAPR 3G2MA 2PD3A 3NNNA 1MSWD 3NS7A 1GUZA 1PYGA 1OILA 1ODSA 3A3NA 1UPFA 1YCGA 2XITA 5F9NA 3FMPB 1XF9A 2B3TA 3DLHA 3GCXA 7AT1A 3L8CA 5CR0A 3UMMA 2BCGY 1MRZA 2WF8A 1KNXA 3IE0A 4G0QA 2JGFA 1NPDA 4R2MA 4MH0R 3HP7A 2C00A 4O25A 3GCGA 2QRHA 2X7HA 2A9FA 1KI4A 1IIBA 4J2TA 1YAHA 4YMGA 3GIMA 1PYOA 1TT5A 4WCDA 1ZSNA 3P4XA 2R1TA 5C3MA 2NZ8A 3I2JA 1YASA 1V7CA 1R50A 4UTPA 1ZGHA 4MMZB 3DEZA 3N53A 4C87A 4U7HA 3EOZA 1JZSA 1G9XA 4EMSA 4JC5A 3AU2A 4JIGA 1KDOA 3ECCA 4F2PA 3AP1A 2XI4A 1JFRA 3ILVA 3HJFA 4IINA 2ZUEA 3RAFC 1A7AA 1EHCA 1X1RA 2JK0A 2CXNA 2VHUA 1QTQA 5DDMA 4RVNA 3TZCA 2XZOA 5BUSA 8ICEA 2I3BA 2WU0A 5FL7A 1K8XB 4G41A 4R1UA 2BI8A 4WKNA 2ZRKA 3CX8A 1QLJA 4X90A 1F0PA 1PZFA 1ZA2A 3HKDA 3RKSA 5A0VA 1HMYA 4L0MA 2GDZA 3R5JA 1N34B 4DW8A 1LFAA 1QLWA 1U1GA 3H2SA 1MB4A 2W2LD 1AQJA 3DT6A 4ASUA 2OBMA 2IPMA 2BJHA 2I6GA 4RFSB 4NLNA 3EVCA 4XX0B 2ECPA 4YDHB 4UHJA 2JANA 4P33A 5ALPA 1RZRA 4TTSA 4NYIQ 3I72A 2I62A 3Q98A 1DVRA 2KB0A 2VA9A 4ZKDA 5TPWB 4IPTA 1COKA 1MB9A 3DUWA 3B2QA 4GE3A 2IYNA 2B0CA 2F44A 3NM6B 3RC2A 2WQZA 2ZOSA 2ZI4A 4DR7B 2VRWA 2B6HA 1R88A 5LZ5A 1DEHA 4RIFA 1GRRA 3RF9A 3AEKA 3WLFA 1TL7C 1H0RA 3BT7A 2Y67A 1XNJA 4BX9A 1P2UA 2ZSKA 2XZTA 4EJ0A 4NJ8A 1QMGA 1UFVA 4I4TF 1NW3A 1XTKA 4B40A 3L0SA 3U9TA 4F96A 3IRVA 4XUSA 5EWEA 4HQ6A 3U5ZB 8ICNA 3MOIA 4HATA 2ZVJA 1U47A 4D9GA 4FVTA 1UMDB 3A2KA 4HR7A 2CDCA 1PAUA 4CEJB 2ZWAA 4JB3A 3NAZA 1K0UA 4L72A 1L5UA 4KXQA 1QS0A 4C3OB 1BMTA 3CWZA 2EX1A 5K3AA 2JCVA 1CK4A 2XOKD 2GA9A 1ML4A 4DVGA 1RHQA 3PW2A 5EKUA 1JQJC 1URPA 4JP2A 3P52A 3GRPA 2GOYA 1KAHA 2AI3A 2ZB2A 1OHHD 4GOXA 3O75A 3W5IA 4AN1A 3H0RB 4JJ8A 4RVUA 2VBGA 2ZS8A 3PRHA 3AHJA 4MCIA 4C5AA 1GGKA 2GNOA 5DQIA 5I8WA 3ZGOA 4AZ3A 4GD3Q 3NT5A 3TB4A 1YDMA 2QE6A 1K75A 2ODPA 3GA7A 1XWWA 3UFBA 4PL2A 4RVSA 2R00A 2JFBA 4MRMA 4U8GA 4GRIA 4GX2A 4QQKA 4D9JA 2QU8A 3DBRB 3FVRA 4QJFB 4QODA 5LQDA 4CTNA 1I9CA 3KX2A 2E1PA 3PNMA 4L4YA 2QN2A 2QP4A 3BULA 3EMVA 2J6SA 4OO1J 3BJIC 2EQAA 1OIVA 3Q3CA 5CA1F 1ZFNA 2WHYA 4WK0B 4QDKA 4DDMA 3RRYA 2H3FA 4OA8A 3HVRA 1M6VB 3C15C 2VHTA 4BDSA 2PGNA 3ENVA 2O8VA 1NKSA 3BIFA 2MSLA 1A96A 3AXTA 2F3PA 4KI0A 1WS6A 4EUNA 1F4PA 4DNPA 5G0WA 4ELTA 3ZD8A 4DDHA 2Q8QA 3HJAA 3C2LA 3D0KA 3STTA 3ZDCA 1U0LA 1LPPA 2FZWA 2X1VA 3RSLA 4RAQA 1GR0A 1GT91 3T5BA 1YVUA 4WK2B 4FZ5A 2IP1A 1C1YA 2YVUA 3ZU2A 2NPIA 2WUEA 1SULA 3A6FA 3PSAA 5AUPB 2OV1A 2KVCA 2GWRA 4C6RA 4YN4A 5HHTA 5JD5A 4MR8B 1OH5A 4XGQA 1A9SA 2G8NA 4KQCA 1AHHA 1LDBA 3IP1A 2XXAA 1FO4A 1FJHA 1NULA 4NTZA 1Z34A 1NUQA 3PICA 4HLUC 1Z4QA 1JR2A 1FTQA 3K1JA 2AXTU 2DGZA 1N2OA 2ZS9A 3AH8A 4R7TA 1X1SA 3CBQA 3BQ0A 3WJ1A 4OJ5A 1TDJA 4LSGA 1RSZA 3QUSA 3QELA 2IUFA 1KI7A 3LYLA 3AFHA 2ZTSA 1TIPA 3DL0A 2ZSIA 5IIIA 1QQTA 1T9GR 5E7IA 4AP6A 4EFNA 2JJ1D 2XT6A 2MYPA 9ICIA 5KYGA 4Z7NB 2WTUA 3LQQA 1NFFA 2EBHX 3H04A 3IHWA 2QJTA 4MF2A 5A71A 3RJMA 2VDLB 3ETDA 3PDUA 2EW8A 1L3IA 5GZ1A 3CVXA 2PJDA 4HTAA 5I45A 4KIJA 3MAJA 2DLDA 4DA9A 2PKWA 3PQ7A 3A1SA 5LD2C 1S8FA 2FLNA 2WZQA 3L06A 3SJBA 1WMDA 2LVBA 2WM2A 3GD7A 4UHEA 5DBAA 1R37A 2C04A 5HGJA 3L7YA 5BQ3A 3LSYA 2BSXA 4WXPA 4OBBA 1SEVA 1P6UA 2KMLA 2RHWA 1CNEA 3N2EA 4C6SA 4HVLA 4R16A 4F1JA 2XR1A 2Q1YA 5B6IA 2LRHA 3U19A 2AMVA 3V9AA 3SS8A 4YLEA 1JH9A 1NUHA 1IM2A 2BV3A 4TSFD 3RTGA 1EZ1A 2ID8A 3DR3A 2BZFA 3DEIA 3GH1A 4YBRA 1MKYA 3ABSB 1ECWA 3I1FA 1FA9A 4DV3B 1NKEA 4MWGA 2WHPB 5IZCC 4EEYA 3GGSA 2A1TS 2RMKA 3TTUA 4KLIA 2Q4TA 3LF2A 4F5DA 4KO8A 4PAGA 2XOEA 2VOJA 4Y9SA 2CF6A 1X1EA 3RYFA 1IOZA 2NUAA 4NRDA 4GMXA 2IXGA 4RHXA 3I9MA 4F38A 2I4IA 2H4WA 5GIPE 3Q7RA 4B75A 4DSNA 2R8GA 1E6LA 5ERXA 5TGTA 4RVHA 4Z6FA 1J8QA 4LYEA 1MX5A 3BA1A 5J2FA 3FDFA 2VXYA 4F5QA 1FDSA 2Y1XA 3P9CA 3CRXA 5AKKA 3GZJA 4NBWA 3GBPA 1PFGA 3EBLA 4GR4A 1G7TA 3R5XA 3K70C 4OAOA 2VT3A 4D0SA 3LWBA 1RPLA 3JPRA 2NN3C 4Z4HA 4NOMA 1C1XB 1DX9A 3DOFA 3KQYA 3MMPA 5JFTA 1SWWA 4W6ZA 1O5TA 3GDHA 4ZTZB 1SZHA 2H5LA 1IPEA 2YIDA 3LMKA 1VTKA 1IBLB 3ANXA 2QRVA 4DZTA 1NGSA 5KJ6A 5T8KC 2X3FA 3BD8A 3EQ2A 1J9ZA 2FMIA 3GGPA 1RXIA 2V03A 3I9KA 4FWTA 1LPMA 3EIXA 3OFJA 5IAJA 3GRCA 1TTHA 2GCEA 4MGHA 1KLNA 3KQWA 5DBGA 1GAJA 4ABYA 5FI1B 1QG0A 4EJSA 3TARA 4YX9A 3OT1A 2RAUA 3GJ0A 3OE5A 3IXQA 3EGCA 1V6CA 3QLTA 2K60A 1SCDA 4ZYUA 5EP3A 1N6PA 3FH0A 5KWJA 2A9JA 1GU7A 3WFZA 3LE8A 3P2KA 3R9IA 4YRKA 1Q3TA 3GP5A 1RYMA 4FBUA 3R6DA 1Z88A 5CFNA 1TJNA 4RTLA 4CMAA 5BSUA 4Z7QB 5L3QA 1Y8ZA 2Q1TA 4NY1A 3S1AA 5LOVA 4OU4A 1Z0KA 3QPAA 3ICOA 1RC8A 4JZYA 4BRSA 1YJ8A 1I0IA 5EQDA 4KRFA 3CVOA 4IFTA 1W5EA 3JARB 2R8RA 1J8MF 2ALJA 1CQWA 3GAAA 5KVSA 2WIBA 2PS3A 3UJDA 1QOPB 3ZJVA 1XEWY 1OV6A 3L6BA 4INPA 2UVDA 4JT4A 4F4YA 1L5NA 4DCMA 4HYEA 4HEQA 5EZSA 1EFKA 2QX8A 1CUCA 3DDOA 4WGGA 3AHGA 3GLRA 1PQ4A 4QM7A 1QYDA 4UAUA 1WRBA 3U48A 3WLQA 2PZ8A 5IT0A 5M7EA 3MWLA 3RRJA 4ED1A 3RVBA 1ZPDA 9GPBA 4E88A 1IFXA 4RTPA 3SKYA 4EKDA 3PUIA 3LYUA 2HUPA 3AZPA 2Y0SC 1V4VA 3FAKA 1W7AA 1T3TA 2WSMA 2XJ9A 4AS1A 5JQWA 3GP8A 4KLOA 4EQZA 9ICPA 3IEMA 2PQ0A 5AH0A 1Z2NX 5KT4A 3ZHZA 4JLOA 3PHJA 221PA 4OJQA 3OZFA 4HMOA 4FDVA 1NONA 3PD1A 2A5FA 4BLOA 2X4IA 1XO1A 4BEVA 1GKIA 4BGIA 3C3PA 4A15A 3DNPA 2HQSA 1AB6A 3A1VA 3OSZA 4B4UA 4X24A 3HYLA 2KVSA 5IDWA 1YHYA 1NK9A 1I2MA 5LA6B 2DERA 3HUDA 4EW6A 4UB2A 2EZTA 1JKIA 4RFSA 2QLJA 4M49A 4O9MA 4XX0A 1H8HA 4LCBA 3D4LA 4R81A 4X61A 1FW8A 3K9FC 3B51X 3LPCA 1P9RA 1KKXA 4ALLA 3ELUA 4MARA 1X3SA 2BGMA 2KSQA 2IOHA 1OU0A 5KYYB 1U2ZA 5TPWA 4DABA 3TACB 4JBLA 2I3AA 4P4MA 5ANRB 3C24A 3SZ3A 1OXTA 3H4TA 4RWZA 1S8OA 4AYBF 1SQ5A 1J1ZA 3I8OA 3TD6A 2DUJA 4CV0A 2MA1A 3FIUA 4F3CA 3NVVA 2QRLA 1NN1A 2JZNA 1E3LA 3EAGA 3LSTA 4UZEA 4F86A 1BKDR 3M9NB 3RABA 1DZIA 4S0ZA 4BVAA 3ANMA 2CL0X 3ND8A 1R0ZA 4MJ7A 1KQFA 2AYXA 3GH3A 3BGVA 5C4GB 3MGBA 4DOMA 2JEOA 5HR5A 4JENA 1WUDA 2Q4BA 4TXLA 1DJOA 2QARB 1YVRA 4PRYA 3H65A 3VDMA 3QE0A 4BKUA 4QZIA 1P0IA 3EEIA 3RVJA 5JU5A 3TQOA 4QL3A 2GZ1A 3CKYA 3BRCA 1C0KA 2QG4A 1PGJA 1NZPA 4HPWA 2J5QA 3FWZA 2R6R1 5KSYA 3M89A 5H8WA 5HCUA 5U4XA 3O7WA 4PSUA 2W6ID 4LYHA 5JNLA 2DFPA 2XT0A 4KLGA 2EBWA 4U7WA 3FPJA 1NK0A 2WSSD 4GXNA 3JPNA 2BLNA 2OHHA 2P1DA 5DGXA 4ENQA 3K15A 3U7QB 1V9PA 2FWRA 3GLFB 2K8BB 3NGLA 3DBRA 2HBMA 1SZJG 5DBOA 3QGMA 4ZT4A 1U94A 1ZUWA 1RYDA 2PTGA 3I9V6 3NW9A 2XCPA 4MFAA 5K0JA 4OV6B 1MZVA 2GT1A 5E1BA 2GK6A 3DMTC 4JEMA 1M6VA 4EAQA 2C59A 1AQYA 4DIUA 1E79D 4DXHA 4UBLA 5LJIA 1V7ZA 2KX7A 3Q6IA 4C0XA 2GEKA 3H84A 2UV8A 3WMEA 2J3QA 4WLEA 2AFVA 4HYTA 3M5WA 3AR7A 1FMTA 2H4JA 1Y7PA 5JUMA 4MVXA 1E2MA 4MV4A 3VFDA 4I5EA 3RUFA 5ALMA 3ZBTA 2H1OA 4C6HA 4G4SO 1C8VB 4DUGD 3U4QB 3GGDA 3HMQA 4MW9A 1B41A 2G72A 1JA9A 1T3QA 2HJSA 3TJMA 4FNGA 3SYMA 1KZ4A 1N9ZA 3JD4A 3OZTA 3GU3A 5AI8A 3AW8A 2IX9A 5T64A 1W36C 2C2DA 2H11A 1GTJ1 1ZQ1C 2OQ2A 5JPCA 5E1MA 1XU4A 2WEKA 5C5JA 5HJEA 1TEXA 3UAWA 1SVIA 1AB5A 3ZGVA 3OLVA 1EFVB 2PM8A 4J4TA 4MDFA 1ZC3A 4RQ1A 1ZL0A 1U99A 5HDBB 4K9DA 4MO9A 3QK7A 4WUVA 1RHJA 2OHGA 3FGZA 4RENA 2CMGA 2ESEA 1NQTA 5JYDA 2DB3A 4WRRA 3B9BA 3GRAA 2ZI5A 2ERCA 4NXNB 4CMIB 3M3HA 4HDKB 4S1PA 4EW1A 5AM0A 2GM9A 1Y1PA 2LGJA 2WIJA 4D8UA 1P7DA 4ZC1A 4UATA 4PWYA 5CM9C 4Q18A 1KYIA 3KLBA 4GZ5A 4UZSA 3WO1A 1V3TA 1NLFA 1ST3A 4A2CA 4L1KA 2RGEA 3C39A 4DHEA 4PXSA 1ZINA 2Q45A 3EZ9A 4IEEA 1DBIA 2RGNC 4XASA 4AJIA 2QV7A 3AVVA 4GPBA 4J6FA 2JRZA 1G20E 2YX1A 5DTQA 3YASA 4PAQA 5CBPB 1T2VA 4BV8A 1XNRB 3FNIA 1VP9A 4BZXA 1PV2A 1EWRA 1FFCA 2J3DA 4QUDA 4ZO6A 4BNXA 2XMDA 1TF5A 4ENWA 2JVJA 1P4SA 3I39X 3LCVB 5KYVA 1QTIA 1YZGA 2JJ2D 3K6SB 5KOJB 2XPCA 5JWHA 2QTLA 1O9BA 1WV1A 4GMFA 3SEAA 5F5LA 1UADA 1OQAA 5CP8A 3SP1A 2F3NA 2JGIA 2M32A 4LF5B 4RQNA 2WHPA 1BX1A 2HFKA 3FKSD 1V8ZA 1DFHA 1N57A 3MT8A 5JZ9A 2PRSA 4X3OA 1WF3A 5JAIA 4HVCA 1POWA 1XRPA 1LX7A 4IQ4A 3FHLA 1FVOA 2WTEA 1B0UA 4M99A 3O74A 4BFUA 4X5VA 1N9GB 1LNZA 1EJ6A 2EJUA 5HE9A 2C4MA 4QTTB 5EERA 3T1NA 2PFOA 1I3KA 4PM4A 5C1PA 4TYYA 4Z8XA 3PQ2A 2OV3A 3LA8A 3A6PC 3NDBB 4L27A 2DGDA 1KSGA 1MXFA 4IIEA 1ODJA 2QVCA 3GRUA 3P9ZA 1V5FA 2Q99A 4X7RA 5IUNC 4B6JA 4IDNA 3QJYA 4FDAA 5BR8B 4YDRA 1KFDA 3WBBA 4FEGA 4D9BA 1F60A 3P8ZA 2JHAA 4MGZR 2W2QA 4H08A 3OEED 3WLNA 4QNRA 5FOUA 1MVLA 3UGKA 1C1XA 1FFXA 3JPYA 5LQMA 2O23A 2CB9A 5IYZF 3B13B 3PFBA 3DMHA 1JSLA 4JDUA 3ZDZB 2CBXA 3BDPA 1D9ZA 3KQSA 4ZMRA 4KDRA 4C4TA 3INYA 1PG2A 3TFQA 4GLJA 1IK4A 4XQ8A 4JLVA 5CX4A 4ZAZA 1PR5A 4BL5A 3MB5A 4ZCMA 3KVOA 1L2TA 3DFZA 3IQIX 3UHJA 3UZUA 2QSJA 4XRGA 2IHUA 2EARA 1DKPA 4AJPA 4XAQA 5MN6A 3LK6A 3CX3A 3RR8A 4JDPA 1L4YA 3QIVA 3SIRA 2VG8A 4RIGA 1DIOB 3JQ9A 4ENTA 3UBMA 3ISVA 3Q3EA 3VSBA 3KE9A 4RD4A 2JAUA 4RK1A 1OE0A 3VV2A 3O8CA 4Q4DA 3QVJA 1JPUA 4KP7A 1QOZA 2ZYSA 3I9OA 2ZTDA 2IPOA 4PHTA 4EGCB 2ZQYA 4TTAA 2IXAA 1ZCFA 1P1KA 4L28A 2VHJA 5JZVA 1E92A 1QF9A 4JC0A 4OEHA 2J31A 2PVCA 1VOTA 3AEUB 1SN7A 3SLKA 2O2JA 3CV3A 3G17A 4V0SA 1PDWA 3PRJA 3W05A 4MI9A 3WGUA 3D6VA 5BPCA 1KTQA 3HK2A 3T0GA 3GT7A 3FZEA 3KZMA 1N48A 3GEHA 2VDUE 1XKQA 3RJGA 4POOA 1BO6A 3AB7A 3FM9A 1OGIA 4GO1A 3MGAA 2PZMA 3DS8A 1ZGZA 1GGMA 4IX1A 1NV9A 5KI6A 1VBKA 4WL0A 2UZIR 3O38A 1KI9A 2PX4A 4KLEA 2NAFA 3O2QB 2W4IA 3Q2KA 2WW8A 3VKHA 3BMNA 3FB4A 2YXEA 5AOBA 4X94A 2HSGA 4J2OA 3Q5DA 3GI1A 4JLSA 4CMKA 1XEFA 3B1VA 2GESA 4WW0A 3X2FA 3JYHA 1ODKA 4JI5B 4LJXA 2QROA 3RWMB 4KGXA 5I9IA 5AJUA 1TTPB 3EBOA 2C82A 1GNTA 2ZYWX 4DCOA 5AKYA 1M1ZA 2V0CA 3EWAA 1KQNA 4LBZA 3RFTA 2Z58A 4EY4A 5EJMA 4JWKA 1Y4DE 1IULA 4MV0A 1SOWA 5JNUA 4NL9A 1Y8RB 1Y4AE 1RIIA 2VDRB 1AZLA 1C30B 2LPMA 3EH2A 5LA6A 1P1CA 4INAA 1DTWA 2IP4A 2R7NA 4PX9A 4D5EA 4AMUA 5KG3A 7YASA 5G53C 3H1PA 4ENSA 3C14C 2X5NA 3S3TA 2BKXA 5EIBD 2GZSA 3TAHA 2OV4A 2K89A 2JD0A 3FWPA 2AVNA 1E89A 2HCTA 4QEZA 5HKAA 2IK8A 2GZRA 5KYYA 3MRXA 1JAXA 3IOBA 3UMBA 5AKGA 4B3SB 1ISJA 2Q0ZX 4BCDA 3SQXA 4Q4JB 1RBYA 1TD9A 3F5QA 3PW5A 3RV4A 1RP1A 3DTNA 4M7OA 5JZBA 2JEZA 3KZCA 3OLWA 3PX4A 1DC4A 2FKNA 1T25A 1L3CA 3V2GA 4EZIA 3HZRA 3GJRA 2GEVA 1VLLA 4OQ4A 1U2DC 2EGUA 3QBVA 4BNHA