1L8LA

Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-phosphoserine phosphatase
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8lA01
3U7FB 2R8ZA 3DNPA 2OYCA 4BNDA 1Z4JA 2WF5A 2JAOA 2ZBEA 1TJ4A 4Y3UA 1U02A 2AMYA 4Y2TA 3KZXA 3NUQA 2Q5EA 3B9RA 2R8YA 3M9LA 4L6AA 4F71A 5ALFA 2B82A 3EF0A 4G63A 3U19A 4XE5A 5ALKA 3QX7A 2I7DA 5AKKA 5AW1A 2ZBGA 1EK2A 4QJBA 5ALXA 5ALRA 5AVUA 1XPJA 5AKHA 4OCZA 4YGYA 1CR6A 4JB3A 1YV9A 2OA0A 2IYEA 3RFUA 2HO4A 2HDOA 3BWVA 3AR8A 4ZEVA 3HLTA 3FPSA 5FP0A 4EZEA 3U7EB 3E81A 2YJ3A 4UMFA 4F72A 4QQFA 1YS9A 3J7TA 4CE6A 2G80A 5AW9A 4KN8A 3L1UA 3AR2A 5AK3A 3WKEA 3KOOA 3I28A 4Y2YA 1LVHA 1Z88A 2P27A 3UMBA 2FPXA 3UM9A 4HGPA 2YMMA 1S2OA 4O8CA 3ZTWA 5ALUA 3E58A 3E8MA 4FFDA 4UU0A 2YJ4A 2I33A 3QXGA 3R4CA 1U2TA 1RPZA 1LTQA 5AVYA 4UMVA 1CQZA 4ZEWA 5AI6A 4UMEA 4Y2UA 4Y2QA 5E0OA 2C8LA 4NAVA 3KC2A 5AI5A 3N07A 3DAOA 3SKYA 5IT4A 1YNSA 1VJRA 3AR5A 2C88A 4PNHA 1ZJJA 2WF8A 2HOQA 2EAUA 2WF6A 3NRJA 2B8JA 5AKXA 2FPWA 5ALPA 1AQ6A 2I55A 3SLRA 3U7GA 3L0YA 3UMGA 1ZD4A 3WK7A 1Q92A 3QNMA 2G07A 3P96A 4DW8A 4DWOA 3AR7A 3N8GA 2I6XA 3L8HA 4AS2A 5ALYA 2HF7A 5ALTA 4GIBA 3NALA 2WF9A 4AS3A 3HYCA 3OCUA 4BKMA 2P9JA 3FGOA 3W5BA 2Q4TA 3L8GA 5JJBA 5AVVA 2W4MA 3F9RA 3DV9A 2QYHA 1VJ5A 3I1YA 2CFSA 3R09A 3U7HB 1N8NA 1ZS9A 4UATA 5ALHA 1L8LA 3ET5A 4EEKA 3FZQA 3L7YA 5ALNA 3ZVLA 4CF3A 3EWIA 4BEWA 3EPRA 4EELA 4UAVA 1ZOLA 3M1YA 4YH1A 1Z4OA 2FPSA 2GHTA 2NYVA 3CNHA 1RLOA 1Z4PX 2G06A 5AKEA 4IG4A 5AM3A 1L7PA 5ALIA 5AK5A 3B8EA 2GFHA 5ALWA 1Y8AA 5T41A 3ZX4A 4UU1A 2FDRA 1QH9A 5AI8A 2GMWA 2NO5A 4BYGA 3WKBA 2R8XA 4Y2JA 3ZU6A 1T5SA 4NWIA 3SMVA 3QUQA 3K1ZA 2G08A 3OCYA 4G9BA 3SHQA 4KNWA 1SU4A 4Y2SA 3OCXA 5ALJA 5AW2A 2IOFK 2OBBA 3A1EA 4EENA 2O9JA 4KX3A 4HGOA 4EX6A 2CFRA 2HEGA 1QYIA 4NABA 5IS2A 5AVQA 1Z4NA 5AICA 2MU1A 1L7MA 2W11A 3OCZA 1SWVA 2BDUA 4BX0A 4OFZA 5AK4A 2YJ6A 3OPXA 4UASA 1QQ5A 1ZD2P 2G09A 2YY6A 1RQLA 1X42A 1FEZA 2O2XA 3OCWA 2P69A 3TLMA 2ZBFA 3E84A 1RKQA 4CF5A 3OTQA 3NANA 4XOUA 1Z4KA 3W5CA 2FPUA 3N1UA 3AR9A 3VAYA 4AP9A 2C9MA 3QUTA 1ZD3A 1WVIA 3ZUPA 3QU7A 5AKGA 4J03A 2ODAA 2FPRA 1Z4LA 2D2VA 3RF6A 2GO7A 1RDFA 1VFPA 5AVZA 2YMQA 2HI0A 1L7NA 1F5SA 3PCTA 4HGNA 4KNVA 3FVVA 3MC1A 3D6JA 5ALQA 2B1RA 1IWOA 4L57A 4C4RA 4J2TA 5ALDA 1L8OA 3QUBA 5AW5A 2JARA 3L8EA 1O03A 2HX1A 2IOFA 4YCLA 4Y2XA 2VKQA 3MMZA 2FUCA 1U7OA 4OD0A 2CN1A 5AK6A 2PQ0A 5AM5A 1J97A 2I34A 4RESA 2X4DA 1TA0A 3WKCA 3R9KA 5AVXA 2PKEA 4GXTA 4NFLA 3EF1A 4I9FA 1NNLA 1Q91A 5AW4A 1RMTA 2RARA 2BY4A 4YIKA 5ALVA 4I9GA 3IRUA 3NIWA 3A3YA 4CF4A 1ZRMA 2G1AA 1RKVA 4HAIA 4XQ0A 5AW6A 4KYTA 3ZTYA 3ED5A 5ALMA 3WK5A 5AVSA 1YDFA 3WK9A 3ZX5A 4HGQA 2W43A 3N28A 3QUCA 3WK6A 2FI1A 3AR6A 5AM4A 2R8EA 3I6BA 2WF7A 5AVTA 1SWWA 1ZD5A 3SF0A 1S8OA 5A3QA 3L0CA 2JGAA 1XP5A 5ALGA 3WKDA 3WK8A 1NRWA 2FUEA 3PDWA 5AKJA 2YMPA 3AR3A 1TJ5A 4UMDA 3ONNA 2YBDA 2FEAA 4JDPA 4UW9A 3ZWDA 3IJ5A 4BNDB 2ZXEA 4UAUA 3B9BA 1Z5GA 4HYTA 4MWOA 2YN4A 4BX3A 1YMQA 5AM1A 2C4NA 1JUDA 2WFAA 3QLEA 2RBKA 3AR4A 3QU4A 3QU2A 1ZRNA 4UM7A 3SD7A 1L7OA 1EK1A 3FPBA 1QQ6A 4RETA 4C4SA 5AI0A 3NAMA 3GYGA 2B0CA 4UM5A 3ESQA 4YIHA 4BBJA 1RKUA 1Z4QA 3SKXA 4C4TA 1RC8A 3ZWKA 4E88A 1N9KA 1TJ3A 1T9ZA 3CZ4A 4FYPA 3MN1A 2HF2A 3FM9A 4HGRA 3QU5A 4UARA 4XPZA 3WKAA 2JAWA 3QU9A 4Y2RA 2B8EA 3WGUA 3L8FA 1PW5A 2CFTA 3KDPA 1WZCA 1MH9A 3L5KA 1O08A 3IB6A 5AKLA 3OCVA 5AW7A 2HCFA 2AGVA 2P11A 1WR8A 2AH5A 1L6RA 3U13A 2ZOSA 1Z5UA 4B6JA 5AKIA 2I54A 5IT0A 5AKZA 1RMYA 5AI9A 5AM0A 5AESA 4YCMA 4H1WA 4L6CA 1NF2A 2GHQA 1Z4MA 2PR7A 1QQ7A 4CNQA 3QYPA 4YCNA 3NASA 1K1EA 3ESRA 2HSZA 2ZG6A 2Q4RA 3PGLA 2B30A 2MSNA 5AW3A 2WM8A 5ALLA 3A1CA 3ZVNA 3L1VA 2YJ5A 2WHEA 1WPGA 3KD3A 4FE3A 2C8KA 3BA6A 5AW8A 3U26A 3ZI4A 3I76A 5ALOA 1J8DA 2B1QA 3PGVA 1RLMA 4Y2VA 5AIBA 4KX5A 5A3RA 3DDHA 1RQNA 3W5DA 1T5TA 3WGVA 1YJ5A 3A1DA 1TE2A 2G0AA 2YFYA 5AVRA 3ZVMA 4Y2PA 3ZW7A 2EATA 1U7PA 4IFTA 4NV0A 3MPOA 3UMCA 3L0BA 2BDEA 3N5KA 4BX2A 3W5AA 2RB5A 1Z4IA 3QGMA 3KBBA 1RRCA 3ET4A 5AW0A 5AHXA 4ZEXA 5AKYA 5AM2A 2IA5A 2AUTA 5AIAA 4DFDA 2YMLA 4MUMA 5ALEA 5AVWA 2JAUA 4OHFA 2IOHA 4EX7A 1U2SA 2NO4A 2EARA 4BEVA 5A3SA 2ZBDA 1KYTA 3WK4A 2HHLA 4DCCA 2OM6A 5AI4A 1RMQA 2DQSA 2QLTA 3S6JA 2RAVA 5ALSA 5ALZA 1XVIA 1RLTA
chains in the Genus database with same CATH superfamily
4XQEA 3U7FB 5DK6A 3D2NA 1IYZA 4A27A 2RD2A 1DAOA 2A92A 1NVMB 4EY4A 4C76A 1Y9EA 4FN4A 3C8DA 3D3EA 2JIPA 4CYMA 1A3CA 4CVNA 4G9GA 3CVXA 4IRUB 1SRRA 1XVVA 2ZVPX 3TZBA 5D6OA 1Q57A 4NRDA 4Q4HB 3T1YB 4BNZA 1C3OA 4TMYA 3OSNA 2FW8A 4GKBA 3P27A 5AJYA 3OHSX 3T7CA 5E8JA 5F51A 3Q40A 2JV3A 4OI4A 2ZYDA 5IP5A 1EDZA 3VOTA 2R6ZA 2WOOA 1Q1EA 3GLHA 1CUKA 2OGZA 3L0SA 3HH8A 3A06A 3P9YA 4U0KA 1PN3A 2ZIVA 3GNTA 5JMOA 2P66A 3N8GA 4PBSA 4CN9A 1W1UA 2BTQB 2JDIA 4ZARA 4IJQA 2X3FA 1PLLA 3IMGA 1G8KA 4MDYA 3PJRA 2YIVX 5KT3A 2NT4A 3ND5A 3V2UA 1ECPA 2X0IA 3EFEA 4BIIA 1T3QA 3KVYA 4YALA 1U80A 3V8QA 3KK0A 2FDRA 2FW1A 4BYGA 2V7VA 1JTEA 1ZFNA 4BO5A 1OLSB 4RFLA 3WJ2A 4S05A 4TTTS 3SHQA 2P2GA 3B82A 4OHXA 1UEXC 1G38A 2WFLA 2ID4A 1QU2A 4DADA 3S2IA 4O08A 4M8KA 2NZUG 2BKLA 2VDMB 1T4GA 4FBLA 2VJAA 1CY0A 1U2PA 4LWOA 1TF7A 4FS3A 3TAPA 2QZ9A 4ISCA 5I4KA 4KXUA 3EGWA 3IP8A 3ECSA 1QUEA 4ID3A 3I9MA 2BV3A 3O75A 1EX6A 2XCIA 3W5CA 3T1HB 4NG4A 4RK1A 1VXOA 5DGXA 2ONYA 2ODAA 4EEYA 1EDOA 1AUVA 4L85A 1FFYA 1K7YA 3O8CA 3N75A 4C4RA 4MLCA 1T4BA 2IXBA 1WXWA 3WGJA 4MDFA 4IQGA 3P0HA 2IOQA 5JPCA 3M9NB 3TLZA 3DCYA 2JLYA 2ZCUA 1D07A 1LPAB 1UH5A 5LP6C 2BEWA 2AOVA 5CA0A 2ZCJA 1DT5A 2VHZA 4F4DA 5ELXA 1BFKA 3A4MA 5JXWA 1J5PA 5K6AC 3FIJA 5JZVA 1M75A 4Q1EA 3D31A 1D8AA 3ZCUA 3DGEC 3U0BA 3U81A 3AFGA 4H2DA 5IVIA 2FUEA 2XI9A 1ULTA 4MJXA 5HZHA 1HYBA 4HSGA 2YXNA 4ADSG 3WFIA 2Y1EA 2H1VA 4DIKA 2WFAA 4M38A 5LQSA 1M5UA 2TS1A 3B3JA 1G0OA 4FMDB 3H3FA 3NHUA 1KZYC 4PRKA 4IS3A 4ZVQA 2WVJA 3MUEA 3OM1A 4KK3A 1NLFA 1QIGA 2XMCA 3HXQA 1WZIA 3S99A 1YQQA 3QFTA 3GDWA 2I3DA 1J42A 4XUSA 2EQBA 4Q9LA 2FSHA 5AESA 1YDGA 1EM8B 2WMNB 4NL9A 3B1YA 4CM7A 2GHRA 4R01A 5DX1A 4UTOA 3QYPA 4LYHA 4PLTA 2IBMA 1Q7EA 3B36A 5DT9A 2QVBA 1WDMA 5ICMA 2FNAA 1SKBA 2IEDA 3JR3A 2PGDA 1ORDA 3LQKA 4ZYTA 2CLFB 3JTMA 3I42A 2QN9A 2ZB7A 4F5QA 5FOVA 1N4AA 3GHHA 3K0AB 5LA6A 1T10A 5DTJA 1NXVA 5KFBA 3AZOA 2AUTA 2E5WA 4IIEA 2HC9A 4C3OB 2R8GA 1H5UA 4QFBA 4IEEA 4FI3C 3FLBA 1E6WA 4WKPA 1FYEA 2W22A 4DMHA 4LPSA 2JF0A 1YRBA 4I9HA 1OAOC 3S8MA 4FCTA 1MP0A 1ZUHA 2C2GA 1BWSA 4CI9A 2ZIXA 1XHLA 4UCFA 2KIVA 3K9LA 3NTQA 4OXQA 4G5RA 4KN6A 4RF4A 1K4KA 3HU2A 2QB1A 4TYPA 4KKVA 2XIJA 3ICCA 1FY2A 1U3UA 1M34B 5BQXA 3DDZX 4XIIA 5T4EA 3FNGA 3H18A 5DMXA 4DHWA 4DFMA 2YTUA 4F8JA 3GJ6A 5HJ7A 3EFOB 2XY7A 2WB4A 2KVSA 1OXKB 3PWZA 2DUYA 5DNCA 2D3DA 4NKRA 3IKMB 3KQLA 5DKFA 3UA4A 4Y0VA 3E2PA 3K75D 2JVJA 1NSYA 1FP1D 1PFQA 1QQAA 2XUQA 4QWCA 4L4ZA 4E4YA 2V9PA 1OFIA 2H57A 2FAXA 2ASEA 3IOCA 4RIGA 5KT7A 2W4QA 4FFVA 1Q7GA 4GEGA 1JHUA 1N6OA 5JSYA 1P7ZA 5B7QA 1PL0A 4DSOA 4ZXPA 3DMHA 1B93A 4XCVA 4Y0AA 4PRZA 1USKA 3SZUA 4OMUA 2QLFA 3O2QB 4FHGA 4HFRA 3EZXA 5JROA 1GGVA 4WNYA 4EY5A 3G5UA 5FH9A 3A1FA 1IPEA 2QL7A 3KSAC 1GUFA 1APBA 3OO0A 3SY8A 3COWA 3WLFA 5IVKA 1WW3A 4YT4A 1ZI8A 4DA6A 3WI7A 1M6EX 1S01A 5KFEA 1KOJA 1ZNYA 1UBCA 4W5JA 5AKGA 1XZBA 4LY6A 4WUTA 3AOEA 2VYVA 3L7CA 2Z1MA 3RF6A 1RDFA 5U4QA 3VXKA 1WBJB 2A1TS 1AHHA 3IKVA 3ORQA 3OZUA 2CNNA 1AXGA 5CX1B 1AUXA 3I6IA 3QSYA 5ALDA 1Q14A 4YV2A 3PFIA 1RQPA 2B36A 2O23A 3RB6A 4PINA 1YI8A 2UYQA 3EXIB 2ZRPA 3KQOA 1JDTA 3PE3A 3V7NA 3LSYA 5CCEA 4NMWA 1JLMA 1OFHA 4TV8A 5CLLA 3V9PA 1WWKA 2EG5A 2ZSKA 1X7XB 5EYPB 2QR2A 4WNCA 1Y4DE 4EW1A 3FYSA 3R7WB 7AT1A 2VF7A 4DT1B 2XZTA 3GH1A 4LJ9A 3A9RA 4X8OA 3MB8A 3KBOA 7ICFA 4UDOA 2NO7A 2BKAA 5MHTA 3EWAA 2BMVA 4FNAA 3UXHA 3VJLA 4XH9B 3AR4A 5TGTA 1DBSA 4O25A 5JI2E 1ZGGA 3SM9A 5JS2A 2X0RA 1TQ2A 3BJIC 3I61A 1WJGA 2KEYA 2F9FA 3I9V1 3LBAA 3QKSB 5AT1A 2HHJA 4JEIA 2HBQA 2WUVA 5SYMA 2LXNA 1NJWA 2QLLA 1K08A 5CNKA 4I5FA 1MJGA 2VPTA 3RHZA 2AN1A 1Z33A 2CHGA 5HCIA 2EAMA 4YUAA 1C8BA 5KFXA 5LKAA 4Q43A 3FYCA 4C6TB 2MUTB 4U6NA 4KZPA 3GJ3A 3LPMA 3L1VA 4NQRA 5G41A 2W0SA 2QG6A 2GXAA 5HOEA 2XR1A 4FMDF 3PY8A 5SZJA 4QELA 1J2TA 1NSTA 1CQIB 4PZZA 4X6YA 1O95A 3TE7A 4R9RA 2EZZA 3O1JC 1DP4A 4X60A 1P0IA 1I2MA 2DJ5A 3CWCA 1OROA 3QE2A 3EC1A 1Y9DA 1XALA 5EE3A 3MT0A 2J33A 2QQFA 2X0KA 3DWIA 4W9MC 3KHGA 1NQUA 4PR0A 4QRIA 2ZBVA 4L72A 2GAIA 1EFRD 2EHJA 4I2CA 2R8ZA 1DC5A 4F3KA 1SU8A 3RQIA 5C35A 2NVBA 3UG6A 2W2OA 2VNHA 2IZ5A 2OR3A 1ID1A 1TKAA 4NL9C 2WHQA 2WU1A 2BSXA 3QVKA 3BBLA 5CD1A 1BEUB 3ETJA 3V1MA 1N7IA 3AFHA 1ZOPA 1YZFA 4C08A 5KQGA 4IRKA 1XQXA 5JE8A 4KO3S 2HHUA 3HBMA 2ZVJA 4ZKEA 3G2JA 3R8XA 5CA1F 1I4DD 2WTXA 2FN4A 5L3SA 3B7GA 4N49A 2Q3LA 4L0DA 3HB5X 4W9NC 1FRFS 3KSDO 5KFDA 5E95A 1DPFA 4MKRA 1KOGA 5U1PA 3FGOA 1N6LA 1QSLA 1D7OA 3GVHA 1YUNA 3AF6A 5LDDC 3UZUA 3BGVA 1KHTA 2NRVA 3ET5A 3DEJA 4PN7A 2A1UB 4CF3A 2W3RA 3UPTA 3IMCA 5DX8A 1RI1A 1JZQA 3PXCX 1J9GA 3WAKA 3O4JA 3M0EA 3EF3A 3PDJA 4JYAB 1F8YA 4I1IA 4WK0B 2MIIA 4P93A 1X38A 3LXXA 5G02A 2ADFA 3BF7A 1GSHA 2WVGA 3T3NA 1V9PA 1PTKA 5LIPA 3I73A 5BRJA 4N5NA 1FEZA 3K8YA 4XSGA 1G42A 5CXUA 2W93A 1NC1A 5M7EA 1BVUA 1NU6A 3P9KA 3N6RA 5A5GA 4PHHA 5H70A 2CLLB 1CJBA 2NIPA 4CRWB 2F44A 4IDHA 3DZBA 4JROA 3QUBA 1XTUA 3L06A 2C29D 3R9WA 1VLZA 1Y6ZA 2I34A 2HZ7A 2WRZA 4U7PB 4Y1RB 4QYXA 9ICVA 5DLGA 1BOFA 1UMBB 3K4QA 3PUWA 1NZBA 4HAIA 1EZZA 2OP1A 1J2RA 3K9NA 4KKXB 1YJQA 5I4IA 2VS1A 1MQ9A 4ELUA 3ZDXB 4JB2A 5KL1B 1SB3C 2QVXX 2CJYA 4LHYA 4Y0NA 1LS6A 2Z4TA 3ZWDA 4JOQA 3AF3A 2EX1A 4C6RA 2LYHA 3RVOA 3SXUA 2R8RA 3GP5A 3AOEC 4X91A 3VVLA 2BBTA 1V0JA 4V38A 5I6DA 1SUIA 4LRWA 4M9UA 2KE5A 3TRHA 2I3ZA 4AXXA 4MIYA 4LIPD 5EWFA 4FJ2A 5JWOA 3X3HA 3WKAA 2R8HA 4RQTA 5JWHA 4WPGA 4ZYUA 4MINA 1YFJA 1OJLA 1E1KA 2HUPA 2JVKA 1WS6A 3VV2A 1L7QA 3T9FA 3D3QA 4O2RA 5C5EA 1J0DA 4ZN6A 1SBIA 5JAZA 2Q4DA 3HJAA 1GQOA 2FFHA 4KLAA 2CJWB 2ZVDA 3L82B 4ZI3A 3GZNB 3JVVA 3WGVA 4XYBA 2BCGY 2OHGA 8ICYA 3D3JA 3A6HA 1QYVA 1XWIA 4ZQFA 3UKOA 2VPPA 2BKXA 5D3MB 4Z4CA 3RC3A 5ITZA 3VPAA 3LVRE 5IFLA 3UEOA 3FVQA 1YZHA 4II2A 4C0QC 3OZEA 2B21A 2ONKA 4UULA 4K86A 1OAKA 3KSUA 3PQ6A 1QP7A 3QPWA 2PUWA 2ACEA 2ERCA 3COZA 1YFLA 4FOTA 1X7HA 3DEAA 2I3GA 2X8LA 3QIAA 4HDMA 1V5GA 1U0HC 4B76A 1GKLA 2OE2A 4OHRA 1QIKA 5IUNC 1Y6QA 3EGOA 4PGMA 5H59A 1MORA 4TYWA 3GVCA 3RU3A 1KJIA 4AJ4A 4BLTA 1O95C 1P80A 1QBKC 4KMOB 3CCFA 3JQGA 3PXXA 4Z4IA 3SYTA 1PWEA 4LFAB 2AN3A 4D5GA 2BE9A 1HQYE 2HIGA 2C4WA 3VH1A 2JCXA 5CDGA 3W8DA 1ZM3A 5ERXA 5A0FA 4D9HA 3UJCA 1CRPA 4HR7A 2QB0B 2HY7A 4CTMA 5L1IA 4G8JA 1U8YA 2XVMA 5I7OA 1N2IA 4QBKA 3PITA 4N48A 2BGWA 3G9UA 3WNQA 4UNNA 1NI4B 3EGXB 1G18A 1PJ2A 3BD9A 9ICCA 2GRAA 4YJHA 1L8LA 3LLMA 5TPWB 1HT0A 2HBYA 2HRRA 3S68A 4UHFA 3A4IA 4R2KA 4MB6A 3GFVA 4CKBA 4JK3A 1GLGA 4XJSA 1BN6A 1MB9A 3KJEA 4PAGA 4ENRA 3EZLA 1W9MA 3PIIA 1HFWA 4PG7A 4PJ0U 4TROA 5JCJA 4O0MA 3TXYA 3O2JA 1TU0A 4BKUA 2X86A 1LTHR 5E6SA 4RT2A 3Q11A 3NATA 1WETA 2JA2A 1KL9A 2O2XA 1JN3A 3AESB 3NX4A 3GIKA 4KTVE 2PWPA 4UVEA 1UCVA 2CMGA 5IAJA 1PW7A 3MOGA 5FAKA 1B74A 4QDUA 4QZFA 3W9UA 1GNSA 1S3IA 4JX9A 2IHKA 4V39A 3O4RA 4F9EA 4LJ8A 4RFSA 1MW8X 2R44A 3KPJA 2PUAA 1OLUB 3W2FA 1FSFA 5K3SA 4TVBA 2VR1A 2WJYA 3UPDA 1FIUA 4CMKA 3GQVA 2X5NA 2PAFA 1EHCA 2PFKA 3LS2A 2V9ZA 2GPTA 3KYDA 4HNAA 3B9QA 5F1YA 3CGWA 1LZKA 4KYVA 1GCAA 4BNLA 4EK9A 4UHDA 2HBRA 3HCRA 4XIGS 1CRWG 5HKAA 3CIFA 4WUVA 2PGAA 2FI1A 5CNIA 4YCAA 1T4CB 1PK7A 1ZK1A 1YKGA 3KXIA 3VX4A 2ZUEA 5BVHA 4MMZB 2FQXA 1DC8A 3KDAA 4LHZA 3F7OA 1MV5A 1I1HA 2YN4A 5K0CA 1YMQA 5I7SA 1FZQA 4HEA1 3QU4A 2XECA 2FWNA 1RJDA 1T9DA 4M8SA 2ZWOA 1Z75A 4U0JA 4CCYB 3E9MA 1J21A 3X1KA 1AUPA 1HF3A 1N78A 1FFBA 1GL9B 3NYQA 3QIVA 2R6FA 2WJ4A 1QRDA 4AUMA 4EEXA 2JIMA 1M2FA 1L3SA 5CHYA 4UCXA 2X9VA 1K5OA 4CQJA 2I54A 4UUPA 3KKNA 2HDWA 2CF5A 1IZ9A 4Q7MB 4D4HA 5CA7A 4YMNA 3JQ7B 5EJ6A 1SXIA 2Z57A 3C70A 2AFIB 4N39A 4XUEA 4XPIA 2GVDC 2WM9B 1VCHA 1SHJA 1TLLA 4DV6B 5TF4A 3X1ZA 3WL6A 4F96A 1N9GB 1IXRA 3QBTA 5HF6A 4N65A 3OE7D 2WD7A 1QB7A 2WWIA 4R31A 4EITA 3OSZA 5EJ4A 3C3CA 4EOGA 2KMDA 3RB0A 4KV7A 3QPCA 4F2GA 1A9QA 2X13A 3SSMA 3B2NA 2XNSA 1U3CA 1PNVA 1D2GA 1CY6A 4LXYA 1VC2A 4FFMA 4AS1A 2CJPA 3FBGA 2QRHA 2WYOA 1S4QA 4I1SA 1GQQA 4IDNA 1A04A 1X1QA 1YO6A 2HMWA 1KDRA 4ZEVA 5ECGC 1UWVA 4E31A 1OI4A 4RTNA 3L0PA 1MEJA 3ZY6A 4DJFC 1M2GA 2O6HA 2J6SA 3BCUA 2Y0SC 4WESB 1RJEA 3QXGA 4QAQA 5DI3B 3C6QA 4LTNA 4Q1FA 3LVWA 2FW9A 4J1TA 2F1HA 1XA0A 4MV7A 3RTEA 1SXJD 2UZIR 3MRSA 1I14A 2V7EA 1PIWA 4C8KA 4US8A 2WWGA 2HW3A 1RYMA 3PX0A 1ZINA 4KQHA 4BQEA 3CVUA 4EA9A 1CEZA 3G2LA 5C80A 4BFUA 5G0TA 1FW6A 3KJIA 2HD4A 4KQFA 5HS6A 3U4MA 4K7JA 2WWRA 4C4OA 1FOEB 2ZSDA 1ZS9A 5BWOA 2VAXA 5GZ1A 5CYOA 4RVFA 3AV3A 3FX2A 3ZHVA 5F2NA 2X40A 4PX2A 3KB1A 4NV3A 1G17A 1NN1A 1IM2A 1ATIA 2Q2VA 1JDNA 4B32A 2ORVA 4M86A 3TIFA 3N7SC 1MA7A 2NUTB 4LA4A 1DKNA 3TTSA 4XZ3A 2HQBA 2JLRA 2Q62A 2CYAA 2C95A 1SC9A 1VMDA 1DTSA 1ZCJA 2PE5A 4TTJA 2IHVA 4NVRA 3QFHA 1YA8A 3IAM1 2CF6A 1HZJA 2Q45A 1NBWB 5JFTA 2IHZA 4I2BA 4UD2A 1LBSA 4U6SA 5L3QB 3VSBA 3G9TA 2J6CA 1JKJB 4S2EA 1HC7A 1GNQA 1VJGA 3EQZA 1LZLA 5I8WA 2FMQA 4X65B 2EW2A 3CCCA 2P2NA 4JQYA 2IYXA 5AJZA 1FB5A 5LQMA 2DKZA 3ICEA 2NSLA 2J3EA 3O2NA 2D1TA 4AYWA 1VGRA 3AUYA 3GFGA 1DKUA 3OJ0A 2JL1A 3SXPA 4I5DA 3U4QA 2JARA 1JHAA 4ZT5A 1GXSA 5LBIA 1VE6A 3CR3C 2IOFA 3BE4A 3UG7A 1YQ9A 4N5IX 4YMIA 1UBSB 3KB2A 1BVYF 2O2YA 1STOA 1TA0A 3TVDA 4ARIA 4FFSA 2AK3A 1XU9A 1ZQGA 4IH1A 1N3IA 2G4VA 3CVVA 1U4BA 2AI1A 1G2QA 1AGYA 3ROEA 1EK0A 3UC5A 1E2MA 3NNSA 2OO7A 1Q0ZA 4BYMA 1MB4A 4JR1A 4MUEA 4WKNA 3UV3A 4OG2A 1B73A 1SK9A 2FOIA 1EUQA 3USES 2D3TA 3QTTA 3FF4A 2HCJB 4HDRA 1LBEA 4RYDA 5KFFA 2HHTA 2ZR8A 4DDTA 3LUKA 1YZQA 4KFUA 1LX7A 2VUTA 3D3WB 3TOCA 3B1WA 2OAP1 4IMIB 3KV3O 1PNOA 2W90A 3OJOA 1MLDA 5CVJA 3O3CA 5FPYA 3GRYA 4DREA 1PBNA 3MN1A 3FM9A 1O4WA 1YJXA 2I62A 1VJ1A 2ODBA 2DFVA 3E5NA 3LWDA 4HAXA 1FDRA 1QX3A 2GASA 2YC4C 1FFAA 2G9QA 1LK0A 3DZKA 3O6VA 3EAFA 1JG6A 2ZWMA 1FQJA 4ECQA 1EUZA 4F38A 4W99A 4D5EA 4GNRA 2CXYA 4TPKA 2GM5A 3FBTA 4XTCS 3PT5A 3Q3VA 5H8WA 2QX8A 1CFJA 5CDTA 4UEJA 4N3GA 3H9GA 2DG2A 3WDMA 3LCJA 1ESDA 2P8JA 4GGOA 3V7WA 2VJLA 3IHTA 1V96A 4M76B 4B6QA 3C4VA 2VO1A 3MGCA 4B81A 3HB7A 2R47A 4DFDA 3RUIA 4OIMA 3RJHA 3KXPA 4YA6A 5J23A 4TKVA 3Q3CA 4JL8A 4YPOA 5HSGA 4IUDS 2YWBA 4KN5A 2H5LA 2I6GA 5EHIA 2DFNA 4F71A 5DT2A 4O29A 2R6CA 2CEKA 1DKLA 4D3ZA 5FV7A 5TRTA 3V1YA 2WTEA 4RMHA 2C7GA 3AJ9A 1HY3A 4FNOA 3D3KA 3GT3A 3AGPA 3L1UA 3NU1A 1GOTA 3UM9A 3V4FA 3ENZA 1YR7A 1C30B 3D1LA 3Q3HA 5CPFA 4OB8A 1IXRC 4NK4A 1ISIA 1JLHA 4F8RA 2ZJ4A 3KJHA 3K09A 2CLSA 4IXNA 1SK8A 2H1FA 3ABZA 3W3ZB 2V6FA 2XQGA 5KNBA 2F3UA 1OBHA 1U2DC 1LPOA 1CWUA 4DEZA 2WJAA 4UUMA 2I3AA 5I4CA 1ISJA 1TEXA 3MYYA 3V9AA 2E8PA 4RWEA 3JPYA 2A84A 2GERA 4WBXC 1XKXA 2WWVD 4K40A 5DHSA 3KEFA 1NN0A 1KY3A 1KK2A 5IJ9A 2CHFA 1CQJA 4OAOA 2YV5A 4NK5A 4EA8A 2HJGA 3BCSA 1MOQA 1YZGA 2AJLI 1UBJS 2D13A 1SQGA 1M2JA 4J1TC 1IN8A 1KO1A 2HSGA 2FK7A 3DPUA 3ZJ4A 3QPAA 2W11A 1NKTA 4GLBA 4LC9A 3IJPA 1NURA 3HG7A 3HADA 2BBSA 3VU0A 1JBEA 4MQUA 3H0CA 3K0CA 1F14A 4WY8A 5K8JB 2BJWA 1ND6A 5KU7A 4PONA 1VMEA 5FULA 1HSZA 1EVYA 1LDMA 4PLZA 3A6EA 2HI0A 4EY7A 1ZUNB 2QBYB 2D74A 4GXQA 1A97A 3W2GA 1JQKA 1P1KA 2J6BA 3TVTA 3ND8A 3AMVA 2I4LA 2PNJA 3DZIA 4FMPA 5J0SA 2OCPA 4Z6DA 4BNIA 4UOZA 2AI2A 4NSNA 1AS2A 4H77A 4KQJA 4YMOA 4CKCA 1NBMA 5GJCA 4R8MA 1Q1NA 4AY3A 3CGGA 2ZSUA 3NT2A 3QKWA 3M6WA 1O8BA 1OYYA 4ON9A 4JA2A 5F1OA 5EWLA 1V5WA 1G20E 5BOVA 3CV3A 3P52A 4G0ZA 4PLFA 1G6Q1 3LVBA 1HEYA 1HV8A 4OX9Y 1Z06A 2VN8A 1NJYA 2N9UA 4BRZA 3TLXA 4TM7A 2DWQA 1W5AA 4KJZA 3EGEA 1E89A 4OIFA 4D3XA 3ZQJA 5E7JA 1N2CE 1Z0ZA 1HFEL 3MTIA 4EYGA 4NYMR 4AD8A 2N3ZA 4KVZA 2AW5A 3UXMA 3TZEA 3A3PA 3DTVB 1HYQA 2ZI5A 3L8FA 3F4KA 1Q3TA 3E1KA 3EXEA 4U7HA 6REQB 4C22A 3JQAA 4YCMA 2XGQA 3E3LA 4JJ7A 1SA0B 2GCNA 2QMYA 5HIKA 3F1KA 4FFRA 1VKZA 4CDNA 1ODIA 1K3FA 1KYYA 1F0MA 4QEZA 4UAZA 4ZCMA 1QB8A 1LTKA 3FNIA 4H7KA 5F33A 3ZWBA 1BD4A 4UUNA 3PKZA 3WV4A 3MTAA 4IP0A 2HM7A 1U9CA 5CCBA 4QHSA 3ZVMA 2C0PA 3PCXA 3FOAA 4BQPA 2V6JA 2ZIUB 3L0BA 5HR7A 3QVLA 4CUZA 3RAQA 4WEOA 4YLYA 2WAMA 1CZUA 1BRTA 2QVYX 2I9PA 4M9SA 2LPMA 2QAGC 4RWZA 2EARA 1T1RA 4YQZA 4AKEA 3ZEAA 3CQ9A 1RJ9B 4KXVA 2YDXA 4YR7A 1F20A 4JELA 1QCYA 5FTJA 1J8MF 2FN8A 4L27A 4BFCA 2MRLA 1YS4A 1E7WA 4EHAA 1B1CA 3MFQA 3MWJA 3FI0A 3PNPA 1A5ZA 2V7UA 5L95A 2C1XA 3HLTA 1Y82A 2V4MA 3V7UA 2O0MA 3H11B 1K6JA 1OAAA 1JHQA 1XMVA 1Q1GA 4LQDA 1Z0KA 5L7WA 3PXAA 1I4OA 5DPMA 1EP2B 2A9VA 2WG0A 2IHTA 4W7SA 3NBKA 2I67A 4FB5A 3OQ6A 3DZJA 1KDVA 4UPEA 5IT4A 1K27A 4OFWA 4UHCA 1PLJA 1EVIA 1E99A 3VISA 3U3DA 3X2FA 1KIMA 5LQAA 3KNZA 4OYLA 1Y8CA 4NE7A 1WHSA 2QRJA 3O26A 4F3CA 3EULA 3I9V6 2AXTU 2QN1A 3TNLA 4U02A 3HCAA 4HVLA 1DMRA 5DE3A 4Z9AA 2JA1A 1X1DA 2F1JA 1R9NA 4UBCA 1UK6A 1PFVA 1HE3A 4UPDA 1GRCA 2Q4OA 3E9DA 2P3SA 2GBGA 1U6JA 5TR9A 4PIPA 4C0SA 2BMAA 4NECA 1CJUC 1R6DA 2IYZA 4DQRA 4JYBA 4J91A 2CLCX 3EJ6A 3RF9A 1SNYA 1L0BA 2QLJA 1NK9A 3ELUA 4F85A 1R6AA 2IOFK 4P84A 4G8DA 2HEGA 3QVGB 3KYCB 1D8TA 3C2LA 1RHKA 3WLHA 3K09C 1P2VA 3PDIA 1I3NA 1EK5A 3OT4A 2OSVA 2QD5A 4Q1BA 3TDMA 1A71A 1QGZA 1KDPA 1T3TA 1DE0A 3R7BA 1NF3A 3ZCXA 2YB4A 3L7NA 4YRFA 1ETUA 4FK8A 5FQNA 1OZ0A 4EVSA 3SZ2A 1TMYA 4RHCA 2O59A 4E70A 2WAAA 3PA6A 1IPFA 3PX3A 1O3YA 2B6GA 2FDXA 1RZUA 1G60A 3OZRA 1DWUA 4C5CA 3FMVA 4GXJA 3BRSA 1JFVA 3V80A 1Y7PA 1JJFA 2EQAA 2ETVA 5A2QA 2AMLA 4MICA 1GG2A 3ZH9B 3GCDA 1RMTA 2VVTA 3ELYA 2QRGA 1N25A 2HGSA 1ZHFA 3KR9A 1AS3A 1LV7A 3PW7A 4O4LB 4G23A 2ZAOA 4QUJA 3ILXA 4RNCA 3TW8A 1TOAA 1BA3A 4FZRA 4C1BA 3W6PA 4YDRA 3EGDB 4U5XA 4HDAA 2JEOA 5J3JA 3F67A 2GWHA 2WWTA 1E0DA 4PWYA 4TLAA 3HKDA 3UTCA 2DETA 1SPXA 3PYMA 3EY4A 2Q7DA 1XC7A 5AYVA 2GPBA 4ZAZA 5DGCA 4IGEA 5J0RA 1T9ZA 3CZ4A 4D0RA 5GTDA 3OJCA 3IT0A 2Y0EA 2DAPA 1H3NA 2WINI 3DAHA 1LDYA 4GYKA 4A4DA 1GO2A 4D96A 4MAMA 2AA3A 2FWMX 2R6DA 1WF6A 3HP7A 2QTFA 1ZYUA 3E9RA 1CY7A 4V0LA 7ICJA 4WLUA 1EGMB 2A9QA 4OGKA 4A73A 3TG8A 1WUYA 4WCFC 1AQJA 1RYEA 2BYTA 5LOVA 1VKJA 3RC9A 4HT3B 3O31A 1M7HA 3AC0A 3K0FA 2YFHA 4I8DA 3KTFA 4RELA 4CCSA 4GH5A 4CIBA 1MJNA 2BHRA 1JFFB 1ELOA 1HWYA 1X7YB 3FPHA 1QAOA 4A0SA 1UFKA 3T99A 3SX0A 3K0HA 2GZMA 3GGJA 4P5PA 1NYTA 4NNJA 4OHFA 2NXNA 1XNSA 4HRVA 3R6WA 3WJAA 5CPBA 3I04M 4OPMA 2Q28A 5EXSA 2XRFA 5K3FB 1QU3A 3I6MA 4DRXB 1W36D 1RBQA 1V11A 4MUAA 4CLOB 3Q9NA 4XX1A 1C14A 1E9CA 7ICIA 1QJCA 1G5QA 4V0NA 3WO1A 1Q17A 2QTVA 1J4AA 3LY8A 3OOEA 4DR6B 5CR0A 1IN6A 2QWXA 3AR2A 4E46A 2Q3MA 3N2EA 2PRIA 4BATA 3E8MA 1RIFA 4NZOA 5JY1A 2DR0A 2W7TA 4RJIA 5JAIA 2AFVA 2DQYA 1H2FA 4REQA 4Y2QA 3G9XA 4EBFA 4E5KA 3UY4A 4RUAA 2PX0A 2XQIA 1UAYA 4E14A 2F9LA 4TXNA 3QMWA 2V5AA 3G2NA 4G0YA 4QFCA 1EBUA 1CJTC 3HXTA 5A03A 4PSAA 4J9OA 1E6CA 2MCFA 1IE3A 4EHIA 5DEOA 2QA5A 3EUB2 4O5KA 2HA0A 2QMOA 3OUUA 5FEUA 2V59A 2G72A 3BREA 3T1VA 4TYNA 4QA9A 9ICKA 3RJJA 4K9DA 3TSAA 5EMHA 3KT3A 1W1WA 2PZAA 1SCQA 1W2WB 5ALWA 3V34A 5GINE 1Q5PA 2PX5A 2B8NA 4X62B 3ORHA 4C03A 1HM5A 1JFSA 1PJ3A 2PZKA 1B00A 4NLLA 2QOEA 1AKMA 4IEIA 4K9OA 4LJ4A 2RGYA 3FG9A 1KP3A 5EJ9A 4DPKA 1XAIA 3N2ZB 5JZ9A 3EVTA 1ZWKA 8OHMA 2XAAA 1CHNA 4CCHA 3MDAA 1GGJA 4RKEA 2AW3A 2G4CA 2GA9A 2WMYA 4D6XA 3HXLA 1H8HA 2ZXHA 5KFRA 3K3PA 1XX6A 4K87A 3GPLA 2A0UA 1D2CA 3C1YA 5DNYB 3N7RC 4DSEA 9ICJA 4PRYA 2P7IA 1URJA 3VR4H 7GPBA 3D54D 1Y89A 1XQ1A 2AR9A 4HQKA 2P68A 4MVYA 5CWRA 4C7VA 3DXZA 1J97A 2YWEA 3WGOA 3F3MA 3PPYA 2FHSA 1CIJA 4G5QA 2IXAA 2Q8NA 2GD2A 4WJKB 4M6WA 3AUSA 3GG2A 2JGDA 4DFJA 4DLLA 1US8B 4RZSA 2JEFA 4UEQA 4YT5A 4KQIA 3AIOA 4QTZA 4Y9SA 9ICRA 2OV1A 1R2QA 2J6IA 5J1TB 1NZDA 3EIQA 1NDHA 5CA1B 4AF6A 3GW8A 3AP3A 1NF9A 3HO8A 5IUJC 3CF4G 5AHWA 3TMYA 4BXOA 4C6SA 3GZJA 3WB9A 2GZDA 1BE6A 1DQRA 4L15A 4J9NA 4DSNA 2AOWA 4KPGA 4OU4A 2D5IA 1NP3A 4FYPA 3UQYS 5IBCA 3SWWA 3ZHTA 4P1ZA 4YR2A 2O3RA 1JECA 1P81A 3TE6A 4YWHA 3THVA 1XMOB 5DWDA 1WR8A 4O4LF 2VHWA 1DHRA 4UNQA 3F7TA 1EM6A 2P9HA 4OI2A 2IJGX 1CG6A 1GLVA 2E6UX 2KYRA 1RG6A 4OFBA 5JHHB 4Z1MA 4YRTA 1VFNA 5A9SB 1HQCA 3SNKA 4LNAA 4R8UB 1J00A 2QP3A 3I1IA 2Y1CA 1V9LA 9ICFA 3TTUA 4ILKA 4TQUS 3BXPA 3BWMA 3PG5A 5CIYA 3HR4A 3UXYA 4H60A 1TD9A 1Z7EA 3C43A 2GYWA 3BZWA 3VKVA 3KBBA 1UBTS 4YRDA 3CNNA 1WP4A 4H59A 1PNQA 1JROA 4ZO9A 3WWDA 5FTNA 1P2TA 4QUAA 1XMSA 4CN8A 1UEIA 1ZESA 5ALSA 2RAVA 1T9CA 4MGYR 4RQ3A 2OYCA 5BUQA 2W98A 4OXYA 4M9NA 2OCGA 1VOTA 3LPDA 1JH9A 5F3WB 5FBHA 4MV3A 2X8BA 4CLEA 4KVFA 1T1EA 2R1VB 2Z5GA 1WCYA 2W4IA 3SBDA 1SVNA 5EKDA 1ZN2A 2YZGA 4QD3A 1CZRA 1L4MA 3EN0A 4BNUA 4XYLA 3FHLA 3C45A 4JUCA 4UB2A 3A26A 1QC5B 2MYTA 4QHTA 1JRPA 1DEHA 1YDEA 2AC2A 4PCLA 1G5FA 1HORA 4Q15A 3ETLA 5KT6A 2K87A 3BZUA 2A30A 3OU2A 3KL2A 3HACA 3JVEA 5BORA 2CEAA 3QKTA 4QUKA 1PGJA 3QWAA 2H0AA 4HEA6 1B8OA 2UAGA 5I9IA 1BDHA 4MEYA 4Q0MA 4ZCQA 3GZ4A 2ZJ3A 1QLJA 3IEKA 2JI4A 5KPJA 4PZOA 1SD5A 3F9RA 3KAPA 2BPFA 1C1XB 2HNBA 1U1EA 4OJQA 4DOCA 2I4IA 2PMZF 1EP3B 1U0OC 1MX9A 4R65A 1KQQA 1F2TA 1B0PA 5D85A 5D8DA 4P81A 3KR2A 3JQRA 1WUTA 4DPLA 2ZSHA 3U1BA 1XCPA 1BH6A 1KZ1A 1MCZA 4X3CA 1QYIA 2GAAA 3VU9A 3SHFA 2W37A 1XZIA 2QTGA 4G09A 1J20A 3RODA 3TL3A 5KYYB 1G6KA 3NHBA 4RQ1A 4L3WA 3QZ8A 3MTEA 4F2PA 2YQEA 4KQ6A 1L1EA 3V46A 3JYHA 1QKKA 3H04A 3QHQA 3P26A 5LFAA 1ZD3A 1TAUA 3TQOA 2VJKA 4G1FA 3BTSA 2KPOA 2CNLA 4LC1A 4N76A 3CYMA 3USZA 3EQ8A 2YWDA 2CNBA 3WLTA 3Q8LA 2CWDA 1SKUA 5H3CA 5KQMA 2R4UA 1XMJA 1RI5A 4KXYA 1E1LA 2GCGA 1A5SB 3NNDA 1GILA 4MW4A 2D5LA 2RK4A 2VP5A 3S44A 1SUPA 3RHTA 4I9GA 4PHGA 3CFYA 1QG6A 3CZQA 4TV9F 4DV7B 2CXSA 2W6JD 3CM0A 4BEJA 4G5SA 3EPJA 3NDIA 2VHQA 1AURA 3I2IA 2X4GA 3QXJA 4ALNA 2BDTA 1GLNA 4EL5A 2ENUA 1J2EA 1KXZA 2XF8A 1ESZA 5AXDA 4Q02A 1XC9A 4MS3B 2QKQA 3UENA 2NW6A 1SIWA 3GHYA 3C5FA 4RETA 3QLUA 3M8SA 3QWFA 3MJDA 4OJLA 3MMXA 4JAVC 3AW8A 4F06A 2HSJA 3F9CA 2ONCA 1VYHA 5IKXA 4RK5A 4LNHA 3GFBA 3IB3A 4DCVA 3F2IA 2EJCA 1SM4A 2FFQA 3RYIB 4KUHA 2VSXA 3D4BA 2JI6A 1K66A 2PKCA 3GXBA 4EHHA 1SPBS 3DMPA 4MWBA 1OFUA 1RWPA 3MAJA 2W5UA 4R1LA 2BJVA 5PGMA 4ZI7B 2P90A 1NWCA 3MHTA 3B2QA 4LE0A 1TFRA 2HB6A 3ZWNA 3D7RA 4NE9A 1H1LA 1RWNA 2D54A 5DM0A 2CUNA 4ARCA 3DD1A 3UHFA 3DE1X 4BAGA 4GD3Q 4R63A 4IHKA 1U1IA 5IW8A 4BMSA 2I6UA 4PX3A 4PNPA 3B78A 1KLNA 2O0JA 2XBUA 1EH5A 1RRCA 5KIAA 1D0IA 5DN6A 1EJ0A 3MWEB 4FZ5A 4U63A 5FL7A 4MV4A 5IULC 1EWVA 1JQEA 1XS9D 2HYIC 1SCBA 3QKRA 4GRIA 5IXYA 2O7RA 2Q2NA 5EE5B 4XVHA 3N74A 1B0ZA 2VJQA 5JTTA 4DVJA 3ZGOA 2EP8A 1TMGE 1I5EA 3KXKA 2HHSA 2WPDA 4FHFA 3A37A 4TYYA 1H0KA 4UXJA 5ARCA 5BOSB 2CDBA 2OO5A 5F2KA 2H3IA 1O87A 4PBTA 4XGRA 5DBOA 3EUAA 2Y05A 2O07A 2CCKA 2J3QA 2FYTA 1MN6A 2PTGA 3JQCA 1MAHA 4PNEA 1GP2A 9ICQA 2O06A 3UB4A 3HKBB 1W52X 1X7ZA 1UWKA 1NG1A 4URUR 1I2BA 1YKFA 1JYSA 3F6BX 1UPBA 1QSSA 2WMDA 3J81k 4UEKA 1GPYA 1XSNA 1UIMA 5CEHA 1TUGA 1WXFA 1U8TA 1AK1A 1TVEA 3NAGA 1OKKD 4BKMA 4BDTA 2DPGA 4X0EA 1VG8A 1DSSG 3A28A 4JOSA 4QZGA 1IOWA 3N58A 3OJEA 5K3EA 3PMLA 3NTUA 2G7MC 4JHLA 2GK3A 1ZXLA 1ZQJA 3LUJA 5A4IS 3FPEA 4JQZA 5T64A 2PUVA 4JUZA 2B1GA 4ZCPA 3ZTTA 5C81A 3EFHA 1FMTA 2FWAA 5F7ZA 3WMRA 2PS3A 5JU5A 3LTEA 1DX9A 1DBIA 5B2EA 4AQDA 1RABA 3QV2A 3OCXA 4C8NA 3OWXA 5BQ5A 4PZNA 4HK4A 7ICNA 4H31A 4UAWA 3FLAA 5C53B 3GLKA 2ZI6A 4QU5A 4NHEA 4YV0A 2GLUA 1QSGA 4XWWA 3OJLA 3OHPA 4B9UA 1SUFA 2QZPA 4F9FA 3HJTA 1PDVA 2ZAIA 3N2KA 4WK6A 1HG0A 4HWPA 1ATZA 4O3OA 3PENA 1RRGA 2X5OA 4N3CA 3S28A 1K75A 2VCHA 3LMKA 3IUPA 4IICA 1XWFA 5TQJA 2ZU6A 2XB9A 4MW7A 1IWOA 1UQTA 3QMPA 3EQ7A 4JA0A 4F4FA 4YCLA 2V4ZA 4MR8B 4H6XA 2JEGA 5JSQA 1PGPA 4F45A 2C61A 5NLLA 5GP1A 1ODSA 3QELB 3C1UA 1U7ZA 5JD3A 3O8DA 1OXBB 2HJHA 5AHKA 3RC8A 1L3BA 4QZ9A 1COWD 2EWVA 2POCA 4FR0A 4JI6B 4X41A 1A9OA 3CF2A 1ICEA 4BO1A 1KJNA 2EWWA 4HV4A 4YRJA 2C5SA 4UW9A 1DQSA 1FF9A 4R7TA 1R9GA 1THZA 1M5RA 1X1CA 1PT7A 3EVDA 3FMPB 3HN7A 2QM0A 1XNHA 2K8BB 3ZHYA 2QR5A 3JQ8B 5AXBA 4BJ3A 2VWGA 2R8JA 3HBFA 4WOBA 2IQIA 4FS2A 1EFPB 2JBAB 3JASA 1KI3A 1DINA 1T8RA 3SE7A 1PW5A 2COEA 3P2IA 4M89A 4G0PA 2FMHA 4ISBA 4NFYA 3A3NA 1U2GA 4LGVA 4NE2A 3FAKA 1WKBA 3L8CA 2W2TA 8ICKA 5JJLA 2DECA 4RNOA 4R1OA 1IY8A 4H7JA 2E4YA 3AEQA 3GMIA 3GG9A 1AKWA 1SKWA 1YC2A 3LCRA 2C8KA 3EZYA 3ABIA 5DGDA 2ZJOA 3ZLTA 2YVLA 2FA9A 2JK1A 4UHBA 3LQ1A 3QLUC 1KU0A 1GTJ1 1KGSA 1TT5A 3CZMA 4YAWA 4P0QB 1KDHA 2XXBA 3RUCA 1O96A 2XDQA 1OLSA 2A57A 3E9EA 1YBAA 3WBBA 1V1RB 4B3IA 4DCCA 3AM4A 3OUZA 2H00A 2BCSA 2YN0A 1SUAA 4JH0A 4J0KA 1U2QA 3D7MA 4XFDA 1Q95A 4P5EA 1SVLA 1JH8A 2XCQA 4CU2A 2EHDA 4ZI7F 4X95A 1XQWA 5BSKA 4IV0A 5CB4B 2AZTA 4FLFA 4QW9A 1HUOA 5B7PA 3NIFB 5IDVA 3HYRA 3R6TA 4WKCA 4C29A 5KQLA 3EIXA 1RACA 2IEGA 3GLGA 3LUCA 3D8RA 3O83A 4DAOA 1X1SA 4PHAA 3E5MA 2YUTA 3NXSA 5LP1A 5HJ2A 4I2EA 1AVTA 5IIKA 3ZWXA 4LYYA 1QLWA 3H9BA 1ENOA 2MDTA 2X22A 2MHCA 3H86A 4TKLA 1IULA 3MT8A 5IK2D 3GGPA 1GGHA 2ZITA 4PLYA 1UDXA 3T4UA 2AQ8A 4GBMA 1KZ7B 2VDJA 1BROA 4E4TA 1QRAA 2WU4A 3OQPA 3HJHA 1T5LA 4FX5A 3BGOS 1AO3A 4EYHB 3UAYA 2OZVA 3LFTA 3EDRA 1N8NA 1KAGA 5GONA 3FNRA 2GNAA 4BCBA 5H16A 2XGOA 2XX3A 4N4AA 3D5QA 2OO5C 1ESNA 3U31A 3QXCA 2IU3A 3IE2A 4JB8A 1LJLA 1QIFA 3ZU5A 3EXG1 3VC2A 3BB4A 4TOIA 4CTNA 3KUKA 1DQPA 1YBMA 1E4VA 1FLDA 2BMFA 1LCIA 4KE8A 4N8EA 2DPIA 2H4FA 3NGMA 2WB1C 1E61A 2VPXA 4BZQA 3BDPA 5HRCA 3DZGA 3GRCA 3K71B 4Y7CA 2X8JA 5HYVA 1PYDA 4FYKA 4YXMA 4ZVSA 3BJEA 3DBHB 3OVMA 4OP1A 1NJ8A 1IEWA 4BTLA 1AKTA 4FUTA 3DO8A 1I0ZA 2FFAA 2QY9A 1EMDA 3H99A 4BBAA 3R9XB 5HUJA 3EIWA 4L8GA 1S6YA 4ATNA 3K70C 4ZH4A 3DNFA 2PSDA 1AGRA 9ICHA 4EMTA 2DF8A 1NA5A 1XNRB 2VH1A 5TXGA 2OO3A 2RGDA 1K98A 1FYVA 1OOEA 5KG7A 3AUAA 4QYIB 4F04A 2YXDA 1Z26A 2PJRA 4QIHA 2SKEA 1TLTA 5C31A 1Z8DA 3IRUA 2ZTEA 1JT9A 1P3JA 4YP0A 3IDFA 4IVPA 2EX4A 3PWTA 8ICBA 1U2ZA 3OY7A 2HWKA 3PDWA 3ICWA 2AN5A 2QZ4A 2QW8A 2VT7A 4HFMA 3K1YA 2H9YA 2NX2A 3N76A 2WZDA 1ZK2A 4R84A 9ICTA 4N3BA 4KWEA 1MQ2A 2EU8A 3AFIA 3AJAA 2CVOA 1E2LA 4A6PA 1ZVVA 1I6KA 3IBSA 1IUKA 3HRHA 1K9VF 3K94A 1UOOA 5TC4A 4J9LA 3S2ZA 1ZH4A 4WXMA 3RV3A 1IZYA 4DQIA 1WZCA 4CM4B 1CK4A 2ANBA 3V72A 4H4CA 1LBQA 4ILEA 3OJUA 4P92A 4PYOA 1F0PA 5DXAA 4LHSA 3DXYA 5AR1A 5EE0A 4JQSA 5DIZA 4MA0A 4L73A 2GN0A 5TS3A 1C7QA 1KR5A 4QBGB 3C16C 3DOHA 4OHKA 3VMMA 3X1MA 1F51E 4A8EA 1XZJA 2NV3A 5CM9C 1KH3A 1W0JD 4AJJA 4D56A 2B61A 1T4DA 1KEJA 4U39A 3SU8A 4AYBC 4ZWNA 1PI3A 1ML3A 2VEDA 1T34A 4HAUA 3ET4A 4ZAXA 1M54A 5FOQA 3T9DA 4X7PA 4KSYA 1DTWB 3GPCA 1ZG3A 1JWBB 4FD3A 5JUWA 1CERA 4L4XA 1OXVA 4XB1A 3U4GA 1DJPA 3HSYA 5HQ3A 2DPYA 1QFSA 2FMIA 4QOIA 1T25A 2GS9A 6GPBA 4LY3A 4DVGA 1P9RA 4AK9A 1E0JA 1U2GC 2ID8A 2JFPA 1UL1X 5K6TA 4B0OA 4BN0A 1NLYA 1B3BA 2QUIA 2NNWB 1J90A 3D4LA 3S2UA 3KOOA 4ZO8A 3WGQA 3OZCA 3WIVA 2ECFA 4L8YA 1F2VA 1WXEA 2JH3A 1NVFA 5CLJA 3SZ3A 4CIWA 4GO1A 1NYRA 1Y6JA 1Y7TA 4U7TB 5E6RB 4TGLA 4O2BF 2ZTLA 2XEXA 4QFMA 3I52A 5HKLA 3MMSA 3JRWA 3LQRA 1V7QA 3G2KA 2WLTA 2GFQA 4KQGA 3TTTA 2G07A 3PEYA 1EJ2A 4ER3A 5CB4F 3OQMA 4RBNA 3EG9B 4ETIA 1J7KA 1OYVA 3VI4B 3NYRA 4M21A 1U7DA 3KV1A 3F5SA 3ACBA 4RPYA 3PSIA 2ODWA 3ZDEA 1PJRA 4PGHA 2IY7A 4AFNA 3CLHA 3TZLA 4R64A 3PL1A 5H4HA 2FWIA 3R7FA 1B8UA 3I58A 2VL7A 3DP9A 5EUCA 2C9ZA 1X66A 3FUCA 4G37A 4ZPXA 4EG7A 2HFKA 2PMDA 4TN5A 1M6HA 1Z0AA 3I9LA 3MWFA 1P7WA 2D6FA 3IEPA 3GLHE 1EFCA 4EHKA 5B4TA 5MGNA 1FU4A 1AX9A 4EJSB 5FWYA 2FEKA 2RJNA 2FN9A 1AMUA 2XZPA 3SM3A 5KOJA 2D1RA 5EKXA 1NVKA 4V1CB 5E7QA 3OUTA 1EB8A 1CUAA 3DB2A 4ER7A 1NN3A 1ENYA 3UMFA 1E77A 3GDOA 3KSMA 1B6TA 5CXSA 5AJXA 3PC7A 4LRXA 2J1LA 3FSJX 3GGOA 5JJCA 4PS1A 2BOVA 2AWOA 1V48A 1G3UA 1YR2A 2HX1A 2C58A 2CXNA 4LQ4A 1Z7BA 5CT9A 5A4AA 3VR2D 4C20A 2YQ5A 1EG7A 3RS0A 3X2EA 2CE2X 1Z8FA 4NJ8A 4QZAA 3W9YA 1MT0A 1XZPA 3VKFA 2XQFA 4OMFG 3GELA 2WYWA 1GPNA 2VWPA 4DOAA 3KZCA 2P4SA 2NVUB 3PNBA 4DLXA 5ALGA 3V1LA 1KIAA 1TCVA 1U90A 1E5QA 4O4IF 1QHGA 4QOFA 2K4HA 2B2NA 4N0QA 3D64A 2WJIA 3RU7A 5C3UA 5DULA 2E5FA 1IJEA 3RVMA 1UM9A 3HE3A 4MPPA 3AZQA 5K2MA 2XVAA 4PYNA 4PS0A 4MSUA 1XL0A 4RVOA 3JARA 1I1NA 3JQFA 4I7EA 1MU0A 4Q05A 3VGPA 3CH6A 4GQAA 4B3DA 1CD5A 2IL1A 3SR4A 4NBTA 2HMYB 3NUZA 3RC1A 5FNZA 2Q5IA 1UZNA 4MKIA 2Y68A 2FE9A 1C4XA 1TAMA 3HYSA 2A3NA 1V7ZA 3PSTA 1KIFA 5GMOA 4RS3A 4DR4B 2NP7A 3U26A 4A2WA 2Q6TA 1OCEA 4DUZB 1JG7A 1OUQA 4BMDA 5JFGA 4EL0A 2ZAYA 2KI5A 5LJLA 4MNTA 2Z56A 3TQQA 3HMKA 4RSRA 3M6AA 5DI9A 4D98A 3OZ7A 5F64A 4NDAA 2BFBB 2XY6A 4E7OA 3FKSD 5AVWA 4HEJA 5C8YF 1GEEA 2KTQA 3KOMA 3B1FA 2IXGA 5JLJA 4J2OA 1P9LA 1XEXB 4AI6A 3RAGA 3OETA 4I55F 3GLFA 1GZUA 1TU4A 3DDWA 5SY6A 4AY5A 2HA3A 4HWTA 5JQGA 4R6WA 4S35A 3OEED 2O8FB 4GC7A 4UQGA 5DB8A 2Q0SA 2TMDA 3AJEA 1P72A 2W9AA 3GPDG 3VR4D 2QUZA 4ZJZA 1DXOA 2FZWA 2QAJA 3RR2A 3ZGXA 2DBYA 4RK4A 2NSYA 1UBEA 1GRRA 2DSNA 5DRTA 2JLSA 1C8VB 2F90A 5EQJB 2RP5A 4AO7A 3K9CA 1YHNA 1C7FA 5C52B 4RZXA 1JX4A 4TL9A 1FVXA 3D02A 3L4PA 4YVZA 4INAA 4R1PA 2PZEA 3PR1A 4MV1A 1H6DA 3FR7A 1TZKA 1TCAA 5DLQC 2J5QA 4I4CA 5ALTA 1FRQA 2AJQA 3SXJA 1BXGA 5KFAA 4Y1RA 3UMMA 4K5QA 2G9RA 3PF9A 2DL0A 1P7VA 1S97A 1DBQA 3HFSA 4XI9A 3DLHA 1Q3UA 4EZIA 4KXNA 1PHRA 4BV8A 4LZJA 3G6WA 4NESA 3M82A 4AWBA 3GYBA 2CXXA 2IYOA 2VNIA 1LDEA 3WBJA 4RGQA 2VDVE 4DYVA 1UPFA 4WQMA 2ZRFA 4Z8YA 4OQZA 4GUAA 3BS5B 3VPCA 4AIIA 3HCFA 2ZBQA 2PSEA 4O5EA 1DG3A 1J39A 1X86B 3TUZC 3CLTD 2PZGA 1Z3EB 3JAKB 2XE6A 3HT3A 3FKQA 4UDNA 3FC4A 1XYGA 4B9NA 3QI2A 5DW0A 1JI0A 2WE8A 3ENWA 2JGMA 4LCJA 4E5DA 1YQDA 3C2KA 2CCGA 3GFKB 3E84A 1RKQA 2JHPA 3NANA 2Z2KA 2ZM5A 4FZNA 2LMRA 3OLYA 4YCDA 1BXRB 3CRMA 1MVNA 3P9SA 4YDSA 5ILOA 3LT4A 2C1ZA 1QP8A 4IXMA 2AQHA 5JBNA 1S1MA 5DBFA 4BVKA 1S2IA 3R6LA 4R1MA 3GZNA 1Z5WA 5T4FA 4IKOA 2JHDA 5EKTA 3PW0A 4H6VA 2LD4A 5D3MA 1Q21A 4NX2A 4GMKA 2AL7A 5E3HA 4P4NA 4JV5B 3C1OA 2D6FC 1M1XB 1E1QD 2C9DA 1W5EA 1K7EB 3OKFA 3IR6A 5BMVA 3VH3A 2CD9A 5HTOA 3WK8A 2IYVA 2YMPA 1KFBB 2WTMA 3PLNA 1XRLA 3ZZNA 4MKGA 2QQEA 2PBZA 2DOKA 2J31A 4O3NA 2WU8A 1R37A 3FPBA 5BO5A 4BTVA 2ZT7A 2PU5A 4CTJA 1JDBB 5CYPA 4D4GA 3RFVA 2SKCA 3GA7A 3FUTA 3ESYA 3LX6A 4WXRA 3SJUA 1A7KA 1N63A 1O8CA 1HOTA 1BZYA 4RHXA 5FUWA 1LF5A 3VSDA 2FVXA 1D8BA 3CRXA 3RTGA 1I36A 5AI9A 4BFVA 1DLIA 1QWSA 1SZHA 5K03A 2Q5LA 3FZEA 1XQYA 4AN1A 1H2AS 4M88A 3FCEA 2QP4A 3QTBA 2F3SA 3KEMA 1NI4A 3EGXA 4I1UA 5CB0A 4ZIRB 2Y0DA 4HLCA 2A8YA 4CIAA 2VRCD 1TE2A 1N0WA 1Y4UA 2RHRA 2AG6A 3G13A 1NQTA 3R1IA 3GFPA 1XQ6A 3ICXA 5CG1A 1U99A 1W6UA 3COPA 3H1TA 5L1LA 3DMYA 3ENQA 5LQNA 3TF5A 4JMPA 3JQPA 5EXDA 4JLJA 3HLYA 3JQFC 1VYUA 3DOOA 4U6QA 2PA0A 3WMEA 1DPGA 1AM4D 2FJUA 4WV3A 5ICFA 4LXQA 4TS3A 1V45E 3KZXA 1QCDA 2OILA 1U1CA 1Q12A 3HXPA 3SLKA 4GGMX 1CR1A 4ZXFA 2XYRA 4GL2A 4JCCA 1OFUX 4C0KA 2CMFA 4AJ1A 4I8IA 1ECWA 1XXHB 3K8OE 1TW2A 4LWZA 4AG6A 1D6MA 4L95C 4D42A 4RQAA 4J1QA 3M4NA 4FVTA 2DZDA 4EI7A 2QSJA 1BDIA 5IZCA 3CURA 3PVXA 1GNVA 2ECPA 4A9AA 1HDYA 3C8HA 3R6DA 4UMVA 1HLDA 2P2DA 3TFOA 4PO8A 3MTQA 3PVCA 5IN4A 3H2JA 4R1UA 1R3UA 5DU2A 4NU8X 2JFBA 4OXIA 1P18A 1GGMA 4RY2A 1RWWA 4XWKA 4MA4A 2KWIA 3L49A 1DEKA 3D6NB 3PQEA 4RAQA 4IFBA 2QSZA 3S1LA 3FAZA 3C28A 2VHCA 1N6KA 3Q6IA 1ZH2A 1JIJA 2VDQB 2ACKA 3TIIA 1NUSA 1DIHA 2FW7A 4LV8B 3ZCQA 2HA7A 4P9NA 5SZIA 1IL0A 1MDBA 5A7GA 1UKBA 3T3EA 6LDHA 2L18A 4MRMB 5BN3A 2JGKA 1AGPA 2GMWA 1M6YA 3CA8A 5C5CA 2DY1A 1Z13A 3UHAA 3OIUA 5K0LA 3K0CC 2G1KA 2QD4A 4OBBA 2A86A 3L6EA 1VBFA 4DF8A 3OHAA 4JXXA 2EFDB 1J0AA 3CW9A 1S2GA 4BNKA 5ICSA 1RZRD 1BQEA 3OAAD 4DY4A 1IATA 2IT1A 4P0TA 3CU5A 1TF2A 2OBYA 1D6JA 2XYVA 3V8BA 2O57A 4CLRA 1N0HA 1WQ4A 1TA9A 4CETA 4N1AA 4WFQA 4Q5IA 2FPUA 3PFBA 2Q9BA 1EDDA 1Y8QB 4XLTA 3QUTA 4QRHA 5IJWA 4IVQA 4GW3A 3V33A 4ZQCB 2FLWA 5JCXA 2PEZA 1T2EA 1H05A 3R6GA 4DLVA 1DG9A 3VSCA 1MTOA 5HR6A 3IVCA 3QNWA 1HT2E 3KJFA 2VA3A 2IUSA 4FYMA 3G5TA 3B1XA 2J0UB 3OPMA 4FYHA 1N9GA 3U5TA 3FNBA 4WADA 4HAYA 2J3MA 3FGZA 3GQBB 1I01A 1ABFA 3M1IA 1NC3A 2WSSA 4BB6A 4D4LA 1GSIA 1N2BA 1VG0B 2HIMA 3M5WA 5ALVA 1I2DA 1Z83A 2YXEA 3DUFA 4F8EA 4D02A 3S3TA 1PS8A 2BFWA 1DCMA 4AKGA 4DILA 2Q1UA 2ZRIA 3WP1B 3Q7QA 5AVKA 1C0EA 3RS2A 1EVLA 3SN6A 3LX8A 3CO5A 3BZBA 3F2DA 3O9ZA 2XYGA 5DLPA 5DSTA 1V5FA 1G4HA 3H6KA 1WX1A 3C39A 3QE9Y 4PC1A 4UE3S 5LL6P 1GZ6A 3T54A 1G2OA 3GYGA 3RK0A 3A4VA 3MHPA 1CNEA 3W79A 4DWVA 3S2FA 2AU0A 3QVVA 3O47A 1UINA 3ZW8A 3AVQA 3TB6A 5FUVA 1EFVB 3W8RA 4DOBA 1S10A 5H3HA 1DAEA 1Q84A 1IBRA 2WAOA 3IB6A 2P5TB 3EIFA 4X1IA 3AQ4A 1L5VA 3SBOA 2PKRA 4BX8A 4F5NA 2UXDB 2R62A 2AQ4A 5AJUA 9ICOA 2D4HA 3FCYA 2AD1A 3K6JA 4I2GA 4FZLA 2HSWA 2OQ2A 5JI3E 3BFPA 2YJ5A 5KFCA 2O8CB 1G5RA 1CDEA 2UDPA 4YP3A 5A4MS 3A9VA 3LDUA 3R0XA 3OMWA 1J8DA 4GFDA 3VGJA 4WXHA 3KX2A 2VYQA 1JG1A 3CISA 3NGDA 2AZXA 1YZYA 4NV0A 5IIMA 3OC6A 3KPYA 2LVBA 2ALZA 2RB5A 1E20A 4FCVA 4C9BA 1ZOSA 3EZ7A 5TQ0B 1M6VB 5IM4A 1JR3A 3OIWA 1OWNA 3K8QA 2AMYA 2VBFA 4M7OA 4NBSA 3HVUA 4ARZB 3YASA 3F4BA 4KGZA 3ROMA 1IJBA 4FBMA 4FR2A 1JFRA 4JB3A 3ASZA 1XG5A 3LXMA 3PJFA 1NXTA 4WJZA 3U39A 2P27A 4BKQA 3BUSA 2IDKA 2PUGA 4BRWA 1L4HA 1O6GA 2FLVA 2DGDA 1HQKA 3EC2A 5LQKA 1T2UA 3KC2A 4LMBA 4TV9B 2AKYA 1MJFA 3AZPA 5BPFA 1NGSA 3NBMA 1C80A 1CUYA 2BBWA 3SC2B 3NRJA 2GXSA 1V4VA 4FSHA 1XF1A 1HXHA 2HXSA 5AQ1A 4AS3A 1OLXB 4LJKA 5L3VA 1DGJA 1GCGA 1GNTA 5T4HA 4IILA 3HWTA 2C84A 5BP7A 1P5JA 1SG6A 2CLOB 5DLDA 4BEWA 1U0BB 2IC5A 1ZOLA 2HWYA 3WE7A 1QS0B 1CPYA 1ZQSA 1ZUWA 2WKWA 1MO5A 5J0YA 4DYHA 4D3SA 2QVLA 3R0ZA 2FPOA 3AB7A 1XRJA 2OC9A 1JAHA 3D2SA 3TRFA 2RGRA 1C4OA 2MINA 3I4LA 1IN5A 3HJRA 1RNLA 3SZGA 3EDYA 1AKEA 1B6SA 1H6CA 3LKBA 5K0GA 2ZJ1A 1TUBB 2CW5A 4BNJA 1C0LA 4RD4A 2EKBA 2V8OA 2DJIA 1V3QE 2IBKA 3PSFA 3G9QA 3GCXA 4GVPA 3GVPA 4H6PA 4QNMA 4UBNA 3AOGA 3FYHA 4ZK6A 3IIKA 3S40A 1KA9H 4CI0B 3PCRB 2OFXA 2VYFA 3CG0A 3RSLA 1CHDA 4QBFA 4ZQHA 3ZGLA 1QBGA 2CCJA 2EYUA 3HCPA 1SXQA 5KMGA 3PMNA 4C0WA 1ZQKA 2JAXA 5K8CA 4Z6EA 4KHPB 1NHGA 3FCUB 1E98A 2XOKA 3WV5A 2DU8A 2DLDA 2P6RA 1GA4A 3EGIA 2ET6A 4IRXA 3MVEA 4Q4AB 5FTMA 4WZBA 3TSCA 4AJHA 4BNNA 1XWLA 3GPBA 5K0FA 4NDNE 2AOTB 3I30X 4ZVLA 2ROQA 4ZT4A 1I6LA 3K5WA 2V5VA 8ICAA 2H1RA 1QTIA 5G3ZA 3H40A 3AINA 3D7KA 4TLLB 2BC9A 2D1QA 3Q2IA 1V1MA 3T3FA 4W6ZA 2HBMA 1P7YA 1C20A 5ICGA 1IUPA 3ECCA 1GFIA 1YZUA 3W9BA 3DHVA 4V0RA 1V39A 2CC2A 3G88A 2V7XA 3EC7A 3HYLA 4UUAA 3SPXA 2OXIA 1JLSA 4AJ9A 4ZOLA 4DOMA 1A77A 2JGLA 3NKVA 1SIBE 2E1RA 3LY9A 4YAJA 3SD7A 5T57A 3DZDA 1EFLA 2OBFA 4YECA 4H7IA 3SKXA 2W6IA 4MR7A 3WOHA 4BE9A 1W25A 4OLHA 3W1EA 3QOWA 1NJSA 5CVDA 1XSLA 5D00A 1OH5A 2CXHA 4MZXA 3L5KA 4GPIB 3FRIA 3BN3A 5IIJA 1PK8A 2J45A 2KICA 5KT4A 1J0EA 2WHYA 2ZYVX 4EA6A 3PPIA 3SQDA 1SMKA 3MTDA 1XZAA 3EXAA 4W82A 1JSLA 5L45A 1UHUA 3RIYA 4BVEA 1A5BB 4LSZA 4FKZA 1NJFA 4LKRA 4W1PA 4EDFA 4D4MA 1HGXA 3NWBA 1JT2A 4KRYA 1YULA 4HB0A 1X8LA 5BRAA 2ZIAA 1NG9A 4RHTA 3W6ZA 3Q7RA 1N5DA 3AEKB 1MEEA 2DH6A 3T9EA 3D8SA 3PNMA 4HYQA 3AHJA 1DEAA 5JRTA 5EIBC 1I9GA 5JYCA 2UUAB 2IW3A 3ILHA 4BNHA 4BFTA 4GQBA 4P5DA 1XVIA 5EJ5A 4BRUA 2ZYTX 5KFQA 2GYVA 5DCWA 1KEZA 1ML4A 1X39A 5TMBA 1VP3A 4KITB 3I09A 4TQ9A 5LYJF 3BQ1A 2PWBA 1UJMA 2WJZB 3UH0A 3BJRA 5L4LA 5AW9A 1PL7A 4Q66C 1SULA 3H2HA 1NJ2A 3ZWAA 2JZCA 1JR6A 5ALUA 2Y92A 3DHNA 1KMQA 1D1QA 5BNWA 1FMCA 4YP6A 1L3VA 7REQB 4Y67A 4CQLB 1OX6A 1XZDA 4J9VA 4XA8A 4E6EA 4HL6A 1OIWA 4ZOAA 2CB0A 1SCJA 4XQ8A 1IY0A 2OZEA 5LQDA 1MOSA 5F3XB 3LKVA 4R3UC 3EEYA 3NBYC 2V0CA 3ZZ0A 1CUHA 3GXOA 4G81A 4LSMA 1XZNA 4GMHA 4GPD1 1U0SY 1X9MA 1VCIA 4DKXA 2W4MA 1GUYA 2V1XA 3OCCA 2CFSA 3PVZA 3LWLA 4RLSA 5JS1A 5ALNA 1QO9A 1N8TA 1PK1A 3W0LB 1BPDA 1PJLA 4F97A 2NVWA 3GV8B 1JDPA 3SBXA 3MCAA 3RVNA 5AK5A 4K9PA 5BSFA 1S4MA 2RAPA 4QTTB 3ZEIA 5INTA 3E7FA 3R7AA 1Z74A 1J70A 3ELBA 2CYBA 4TXLA 2FMSA 4LVSA 4E12A 5AXCA 1E7QA 2G5HB 3HHEA 3UWDA 3PF8A 1MNQA 1Y4ZA 2O9JA 4ALLA 4ESVA 1XDDA 1ICIA 2BQUA 3IPAA 9LDTA 1H9CA 1I4LD 3O4GA 3SE0A 4BLOA 3F7MA 4DQUA 5H81A 3DLCA 2P69A 3QMVA 1NW5A 5T5QA 1Y3AA 2OHOA 3AN1A 3K5HA 1TKBA 4PGQA 3H4BA 1VL2A 3GLRA 3NKLA 1HZZA 2XSZD 3QSGA 4ZMSA 1W30A 1K8YB 2QG9A 2CDRA 1TV9A 2ZPAA 5D01A 3DHWC 3FYUB 3P1JA 4TRNA 1L8OA 1P5RA 3PHCA 4LI0A 1IM5A 2JNWA 4RIEA 3WP0A 3P4YA 1KO5A 3RRFA 3M6LA 3KLNA 1DOQA 2Z83A 2CBZA 3L01A 2VDRB 3IAM6 3HGQA 4NPHA 5J1SB 2W0MA 5MN5A 2Z08A 5GM2A 2BLNA 3REQB 3ZGVA 4OJNA 3DG9A 2W43A 2JAQA 4FYXA 3WGLA 4EG3A 3RVLA 1N8KA 3BSSA 4BWMA 2I6FA 2XRMA 2AYYA 2Q5JA 4N0DA 4DBLC 2R1UA 3M70A 5EE1A 3UATA 4YCXA 2PVCA 4RMNA 5L9AA 1L5KA 3KZOA 4JBGA 1TVKA 3WS7A 2O05A 1K86A 4MCIA 1PO7A 4OATA 3HRKA 1Y8RA 3GJ7A 4L7QA 4BB9A 4K3UA 1U4SA 3ZE9A 4O6VA 2NZWA 2ZT5A 1DX4A 3SP1A 5JC1A 1NNUA 2HADA 2PQ6A 3TRIA 1FLVA 1RI3A 3M3PA 4QDZA 4EKDA 1DBVO 1RHUA 4KXLA 2RGGA 5CNJA 3GNSA 2ZW9A 5EN4A 1KS9A 3NM5A 1Y8ZA 1JZTA 4GM1A 1S5LU 9ICIA 1I1OA 4UDXX 1I9CA 4DN6A 2GBLA 1JMVA 1VBMA 3KJNA 1YB7A 2IYPA 1LVGA 2GNPA 3FOFC 4ECUA 3PQ3A 3I2JA 1PVRA 3QA9A 3ADCA 2WG2A 3DLTA 5KG1A 5LKRA 2KZMA 3GFSA 5IXJA 4GX1A 2FXIA 4IAOA 2ZRHA 1QHNA 2Y2UA 3WYDA 3SIWA 4Q00A 5FPHA 2GM4A 1GTRA 4EFMA 4B7CA 1CRLA 2JZNA 4AZ0B 4WERA 4EGCB 3GRAA 5ALZA 4AKSA 3PL5A 2GTPA 4NYIQ 3TOVA 4Y2TA 3S1AB 4J0QA 2RGBA 3CZ9A 4RF2A 4E03A 4FXPA 4E15A 2KBFA 1TO2E 2HMAA 4BS9A 4PM4A 3ED1A 1NY6A 3IA7A 2J07A 4LJXA 3MR2A 4UMFA 4F72A 1ZPDA 1SURA 2LUOA 1NZFA 4LDRA 3JYLA 5EPUA 1NXXA 4AMUA 1B7GO 1U11A 1S7GA 2ZYSA 1T24A 1YVRA 3HEAA 3NBFA 1JFTA 2KKVA 2XXJA 2IFTA 1YS2X 2DY0A 2VWQA 4JFAA 4LXTA 4OK3A 3T7AA 1AY0A 1NU8A 3U7GA 2ILTA 3Q12A 1E1DA 3FSGA 3QE3A 2C7QA 3WLIA 3I72A 3LYAA 3RJTA 5M34A 1SJ9A 2J9FB 3V00A 3V8VA 3DEKA 2QIPA 3DMFA 4GP7A 1P4RA 2KSOA 4X3PA 4H9GA 4OKIA 3CZCA 4KSCA 1RT9A 1G3IA 1FFXA 4IZHA 4R8VA 1L8AA 3ASUA 1I7QB 4DSAA 2FX3A 4ZCSA 3LPNA 4OTZA 4F2SA 1TM2A 4QASA 1U2RA 1P62B 3L6CA 4TKUB 4C6HA 5PNTA 1GUZA 3K20A 3PNQA 3RRGA 2AFHB 2H59A 2DPMA 4BUCA 2DFDA 1O5OA 1XVUA 4QQKA 3GAZA 1X1AA 2EFCB 5ERYA 1WMBA 3IMKA 5C32A 4Q4HA 5GGYA 2C7BA 3T79A 5HP4A 3KZMA 3LXUX 3NVDA 1SY7A 5CBPB 3FYTA 1USIA 1GYPA 1QIHA 4RQNA 3JS5A 4ZANA 2F64A 3O95A 2RHOA 2AMVA 1GN8A 2KE7A 1DIAA 3CR7A 3FF1A 3R5FA 4KLDA 2BM9A 1F8UA 4Q39A 5JRDS 1NM5A 2RG7A 4F1JA 3C3EA 4QYTA 2PL9A 3F8WA 2BTQA 4R9NA 1FL9A 4BMCA 4NLZA 3LWZA 1V2GA 1E8NA 4R81A 1X7YA 4IS7A 1YQXA 3Q88A 1AC5A 3M5DA 3LFHA 3IUJA 3V7KA 3A3YA 4OHCA 4RQ8A 3RRNA 4NF2A 5LVAA 2QTZA 1NP6A 4R41A 5KDOA 1ZIOA 3FPLA 5FBWB 621PA 4HOYA 3RAEC 1EGHA 4LDZA 1ZU5A 3Q9UA 4Q3AA 2LIPA 4G0NA 4BMVA 3PNKA 1BEZA 1UBHS 3BF8A 3C2MA 4O2BB 1M3SA 1RYUA 3BXHA 3VBCA 3VJRA 1WXHA 4EHFA 2GK7A 2PX6A 1JUDA 2MSEB 3HP1A 4J0JA 5K4HA 1BGVA 2EZ8A 3L07A 5KC8A 3KVVA 3ME5A 3TZKA 3MJRA 1BN7A 3GA5A 5CEFA 4B3GA 3E35A 1J8QA 3GAAA 3ROKA 3SR3A 4NMLA 2ODQA 4KAJA 3FFWA 1NBME 2R8OA 5EESA 4P82A 2WSIA 3QH4A 3KKAA 4MWZA 2PY6A 3VZRA 1NMQA 4YMSA 1K9SA 1X14A 4Q1AA 2B4RO 5A04A 1T1IA 4YAOA 2AB0A 4O1MA 5K3CA 2PCJA 4J0GA 4JI3B 4ODIA 3A6PC 5EP1A 1RD4A 4X5OA 3MNFA 3KZ1E 4R2MA 2DP4E 2BFCB 3OD5A 5JPIA 3F9IA 4YR0A 4MGKR 3UCXA 3KEGA 4C0AC 1H2BA 4DSUA 2RJ3A 3DFZA 5F4BA 3IURA 3MPOA 3E18A 4PIVA 1JMYA 3VA7A 1HNWB 7ICGA 2X9NA 3MPUA 5IF3A 2P77A 2ZETA 1YS7A 3VZBA 2CGEA 4MVWA 2F7SA 1BYIA 1TZJA 3OLZA 5L4SA 2VHEA 4D8VA 2CK3D 4BUGA 4P3YA 1XZFA 4CGYA 3NVKI 2FZCA 2H3EA 5DJ5A 1KVUA 3VUFA 4L0MA 4F5OA 4R2XA 1S3SA 1WZUA 3EOZA 5AVUA 2CLMB 2B78A 3OFSA 2OQIA 1PUZA 4AY6A 1GNRA 4C89A 4ZOQI 3DE4X 1G9SA 4G1UC 4MWTA 1Q0HA 2FPXA 2UYGA 4IEFB 4QULA 2GBLC 5KNDA 4OP2A 1Q8KA 1EM8A 1XCJA 1GKKA 2DKOA 1GEGA 3CIOA 1BPYA 1IZ8A 4MW9A 5F5XA 4BFLA 5ALPA 3C3WA 3VNQA 4BQRA 3MJHA 4O4IB 3BE8A 3M4ZA 3NHYA 1KI2A 1YTLA 1X7WB 2PMWB 1EB9A 3DV9A 2IPOA 1UKCA 3CJRA 1IPHA 3GUCA 3DMRA 3K0AA 1M72A 4F1KA 3T3GA 4DYDA 3KT6A 3QHPA 3K16A 1AXEA 1VTKA 3KQYA 3AHIA 2D2IA 3GY0A 2C5BA 4PGAA 2WB2A 3SYNA 1X0XA 5DHQA 5CA1A 3H13A 1CZLA 3FMOB 3ZPXA 5EUBA 1MO4A 2GJSA 3ZU6A 3AHEA 1Y33E 3R7SA 1Y5IA 1XOIA 3VTAA 2OBXA 5ER9A 5M3BA 5I9MA 1M10A 2PT6A 1HLPA 1H4QA 4TZ0A 4Q16A 1Z4NA 2WT9A 2XMRA 4F4JA 1M0TA 2F00A 2OZPA 2PN1A 2A5DA 1V71A 1YOBA 4RD0A 1NAHA 4DY6A 4UASA 2XNDD 2F55A 5G1PA 2D59A 4RD6A 4K28A 1WE2A 1ZYQA 2R00A 2ZBFA 2WT4A 4B4KA 1H22A 1MNAA 1M34A 2BISA 4DL5A 3A2MA 1V95A 2TRSB 1L4YA 1R18A 4M8NE 4JEUA 4S1TA 4DV3B 4JWTA 3ZWMA 1L5YA 3BH0A 4AWAA 3LL7A 4YUXA 2Q8PA 4N7BA 5C8YB 1T8PA 4J6FA 4Y6GB 4R8UA 3EFOA 3NRCA 4MS4B 2HIAA 3DGFC 3UB3A 1NL3A 4I1YA 3DV2A 3UK0A 3LM8A 4I55B 3K30A 2GD1O 2AG5A 1X8XA 1X13A 2X14A 4AC9A 2O5CA 3H2IA 4WBSA 1I2ZA 2X5JO 4L75A 4NH4A 1JJBA 3CCBA 5JS7A 3ODGA 2QE7A 2DKNA 5EHZA 2VDOB 1HNNA 4H0NA 2Z98A 2P78A 4LDNA 1E2PA 5HHHA 1FFWA 2PIDA 4PPYA 1A8UA 2ZJFA 4MVJA 4NLBA 4ZMBA 3LF2A 3RSGA 4Q1CA 5FR1A 2R6GA 2XLBA 3PTLA 3HW8A 4C4XA 2WJJA 4OY3A 4RL4A 3IDAA 2EX0A 3QU2A 2XAUA 5FFNA 1EINA 3UYLA 4CEHB 4EFKA 1JDSA 2NUAB 3TTYA 2PGIA 3DEYX 1KERA 2A5LA 1LLDA 4JP3A 1NM5C 4WSOA 1GAWA 5H80A 4JUDX 1NVTA 4RANA 4AULA 4TLBA 3DKVA 4TTQA 4WW0A 3ROPA 1ISHA 3U13A 1KSHA 1DWQA 3PNLA 3RT1A 3CNQS 2Q21A 1N1GA 5LZ2A 3TJZA 5EVJA 4JP8A 3WYBA 3O82A 1G8PA 4ETNA 2H7XA 1EFTA 5CX1A 2B6NA 2QL9A 4LG1A 2EZXA 5A3VA 4E09A 3T5JA 1JEQB 2JIQA 2AHOB 1R10A 3EXIA 2O2SA 1GFSA 5CEJA 1A1SA 4ARAA 5JRJA 2GLXA 3WLOA 1X7XA 4QU9A 4UJ3A 3NVZA 2VEOA 5EYPA 2FZVA 3RVPA 1HMPA 2BDEA 2EFEB 1SOAA 1E3LA 4Q7JB 4U8HA 3R7WA 2R68A 4DXDA 5TNXA 4DT1A 3TIGA 1ZR2A 3Q0TA 5B64A 3NS7A 3TAXA 2VNAA 3LDHA 2FG7C 1PZMA 4ROTA 4QG3A 1UMCB 4E2FA 4UPVA 1ANKA 1Z4JA 2YHBA