1L8LA

Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
total genus 49
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8lA01
2I54A 4F71A 5A3RA 3OCXA 3R4CA 5ALIA 2I33A 3L0YA 3PCTA 2CN1A 4PNHA 1L7OA 2BDEA 3N07A 3QYPA 2FUEA 3CNHA 2IOHA 3I6BA 1T5SA 5AVXA 4KNWA 2B8EA 2RAVA 3A1EA 3NANA 1Z4QA 1RLOA 4OCZA 2C4NA 1RQNA 5A3SA 2HCFA 2WF8A 4OD0A 1RPZA 3N28A 1RLMA 1IWOA 4O8CA 4CNQA 4YIHA 1S2OA 2BDUA 1Z5UA 3FPBA 3ZTWA 2C8LA 3IJ5A 3R9KA 3ZUPA 2Q5EA 4UW9A 2NO4A 5FP0A 3ZI4A 2FPXA 1YNSA 2PKEA 5AK6A 3EF0A 2CFRA 3WKEA 5AM4A 4UAVA 3L0BA 3QUQA 3RF6A 2G06A 2NO5A 4ZEWA 2IOFK 5AI8A 3ZWKA 2R8XA 5AESA 3L1VA 1LVHA 2GO7A 1O03A 5AHXA 4UMDA 5IT0A 3OCYA 1QQ5A 2IA5A 1Z4LA 2FUCA 2FPUA 2I55A 2OYCA 1RMYA 3L5KA 3OCVA 5AKZA 3W5DA 1VFPA 2WF5A 1NF2A 2OA0A 3HYCA 2O2XA 1ZOLA 3ESRA 2P11A 4XOUA 4DWOA 4CE6A 4Y2RA 3SLRA 5AVVA 5ALNA 3PGVA 3WKBA 3WK6A 1YDFA 1N8NA 5ALSA 4EENA 3DAOA 3L8FA 5AW5A 1L8OA 3M9LA 1XVIA 2DQSA 2YJ3A 4Y2SA 3PGLA 4Y3UA 2G80A 5IS2A 5AICA 2NYVA 2B30A 2HF7A 2ZXEA 5AW0A 5AVRA 3KD3A 2ZG6A 3KC2A 5AI0A 1WR8A 4RETA 1RLTA 5A3QA 2FPWA 3NUQA 3ZW7A 4H1WA 3FM9A 3L0CA 5AW9A 1ZS9A 2Q4RA 5ALYA 3ONNA 3QU5A 5ALFA 3UMCA 2B1QA 4EEKA 3U19A 2GFHA 1YV9A 3WK8A 2ZBFA 2ZOSA 2FI1A 2RB5A 4Y2VA 4HYTA 2CFSA 1ZD2P 5AIBA 3QU2A 3UM9A 1TJ3A 1RKQA 1RC8A 4AP9A 2PQ0A 4OHFA 2C88A 2C9MA 1Y8AA 5ALVA 2HI0A 3I76A 1L7PA 3BWVA 3B8EA 1YS9A 4B6JA 2X4DA 4YCMA 1L7MA 4UU1A 2WHEA 1RQLA 1NRWA 1RKUA 2ZBDA 1Z4MA 3WKAA 2JAWA 3BA6A 3WKDA 1ZD5A 3N1UA 1MH9A 3QLEA 2AUTA 3OPXA 3AR2A 5ALPA 2Q4TA 3WK5A 3SKYA 5ALHA 3OTQA 1X42A 3QU9A 5IT4A 4I9GA 5ALQA 3IB6A 4XPZA 3WK4A 1Z4JA 4JB3A 2OM6A 3ZWDA 4AS2A 4Y2JA 5JJBA 3E84A 5AM5A 5ALWA 1T5TA 3W5CA 3ZVNA 3E81A 3NIWA 3EPRA 4UU0A 4FFDA 4HAIA 4HGNA 4Y2PA 1FEZA 4MWOA 3WK9A 5ALMA 2I7DA 5ALJA 1QQ7A 4KX3A 2W4MA 4IFTA 2HOQA 3N8GA 2GMWA 4KYTA 1NNLA 3OCWA 4DCCA 4EX7A 4J03A 1RMQA 3AR5A 3L8HA 2FPSA 2AH5A 4UM7A 2B1RA 2YMPA 2BY4A 3ZX5A 4FE3A 1O08A 2WFAA 3EWIA 1L7NA 1CQZA 2MU1A 3AR4A 2JARA 4NWIA 1QYIA 1CR6A 2MSNA 4QQFA 4QJBA 3RFUA 2EAUA 3A1DA 2C8KA 2CFTA 4L57A 4F72A 5AK5A 4EX6A 1ZJJA 1YJ5A 1U2TA 3W5BA 3ZVMA 1KYTA 1LTQA 4L6CA 1AQ6A 1EK2A 3ET4A 5AKJA 1T9ZA 2G08A 3AR9A 3AR3A 3QUTA 2HDOA 1J97A 3D6JA 4BEVA 2AMYA 1QH9A 4NAVA 5ALTA 1RDFA 4GXTA 5AW2A 5AVWA 4BBJA 2HF2A 5AKXA 3ET5A 4DFDA 4RESA 1EK1A 1U02A 4C4TA 3PDWA 2YFYA 5AKYA 4YIKA 2B82A 4HGOA 4UMFA 1WPGA 2YJ5A 1F5SA 2R8EA 3DDHA 2YBDA 4NFLA 5AKEA 3E8MA 1VJRA 5ALUA 2JGAA 3U13A 1S8OA 5ALXA 4UMEA 1L6RA 3QXGA 4YCNA 4Y2QA 1TJ4A 5E0OA 4L6AA 4C4SA 3AR8A 5AVYA 3L7YA 2EATA 3P96A 1XP5A 4YGYA 2ZBGA 1U2SA 5ALOA 2EARA 3B9BA 3QUCA 5AI6A 1WVIA 4EELA 2D2VA 3A3YA 2B8JA 5ALEA 1ZD4A 2PR7A 3MC1A 2R8ZA 5AW4A 2OBBA 5AI4A 4BNDB 4HGPA 1Q92A 2VKQA 1Z5GA 2WM8A 3AR6A 3M1YA 3SD7A 2WF9A 3CZ4A 3FPSA 3FZQA 1PW5A 1WZCA 5ALZA 3ZU6A 3I28A 3FGOA 3U7FB 3F9RA 4G63A 3GYGA 4J2TA 1YMQA 2FPRA 1Z4OA 5AM2A 1RMTA 2GHTA 3KBBA 3QU4A 3VAYA 3SHQA 4DW8A 3ZVLA 3NRJA 5ALRA 3WGUA 5AM3A 5AK4A 1K1EA 4BX2A 2G09A 3NASA 4AS3A 3WKCA 5T41A 5AK3A 4CF5A 4XQ0A 1JUDA 3NALA 4C4RA 3U26A 1SWWA 5ALGA 2P69A 2IYEA 4YH1A 2P9JA 3NAMA 3OCZA 4G9BA 3UMBA 4BX3A 5AW3A 2R8YA 3KZXA 2I6XA 4JDPA 2HEGA 2G1AA 4UARA 5AI5A 4ZEVA 1SWVA 4BYGA 3QNMA 5AKHA 1J8DA 4I9FA 5AM1A 1ZRNA 4BKMA 2AGVA 1Z4IA 4Y2UA 2I34A 2W43A 3QGMA 4UM5A 3L8GA 5AVSA 3J7TA 2YMMA 1L8LA 1Z4PX 1U7OA 4CF3A 2FEAA 3L8EA 2W11A 4Y2XA 5ALLA 5AI9A 2GHQA 4KX5A 3S6JA 5AW8A 4BNDA 2JAOA 3R09A 4CF4A 2O9JA 3K1ZA 2YY6A 2ODAA 4HGQA 4KNVA 4ZEXA 4KN8A 3QUBA 3SKXA 3I1YA 4FYPA 1Q91A 1QQ6A 1XPJA 2G07A 3HLTA 3WGVA 1Z88A 3MPOA 2WF7A 4NV0A 5AIAA 4E88A 4YCLA 3IRUA 5ALKA 4OFZA 4MUMA 1Z4KA 2YMQA 1SU4A 4BEWA 4UMVA 3L1UA 4UASA 3SMVA 1ZRMA 2HSZA 2HO4A 4UAUA 5AKGA 3QX7A 3DV9A 2HX1A 3ED5A 3FVVA 2QLTA 2YN4A 2WF6A 5AM0A 3TLMA 3U7GA 2ZBEA 3U7EB 1RKVA 3WK7A 4Y2YA 2RARA 4HGRA 3EF1A 4IG4A 2YJ6A 3KOOA 1VJ5A 5AVUA 2JAUA 3MN1A 3ESQA 4EZEA 5AVQA 2P27A 3SF0A 2YMLA 3W5AA 3ZX4A 3MMZA 2YJ4A 3B9RA 1ZD3A 2FDRA 3U7HB 2IOFA 5AVZA 2RBKA 5AW1A 3KDPA 3DNPA 2G0AA 2B0CA 1N9KA 3QU7A 3A1CA 3ZTYA 2HHLA 2QYHA 5AW6A 3UMGA 4GIBA 5AKKA 1TA0A 5AKLA 5AW7A 3OCUA 1TJ5A 4Y2TA 5ALDA 4NABA 3E58A 1TE2A 5AKIA 1Z4NA 4XE5A 1RRCA 3N5KA 1U7PA 3AR7A 4UATA 5AVTA 4BX0A
chains in the Genus database with same CATH superfamily
4DQIA 4F71A 1P4JA 1IZ0A 5EQTA 4RZUA 5A3RA 1Z0SA 2VYVA 5KAFU 2CN1A 3O95A 3T41A 9ICIA 1GQFA 4EYOA 5K8LA 1E61A 5C3UA 1P1CA 3FG9A 1CY1A 4FYKA 5TQJA 4TKZA 1JSXA 2Q3EA 4ZALA 1JR6A 5ECYA 5FA6A 2J09A 2PX3A 5KFAA 4C0SA 4IRCA 4DG8A 4CHGA 4KSYA 3MWGA 1KTIA 3ZWYA 2OB2A 3R0JA 4FCVA 1JV2B 2J9FB 2XIQA 3WWCA 5C8VA 2J5XA 3I8OA 1WMEA 4RXTA 3GIMA 3JQAA 2Y1JA 2KP7A 2PGDA 1IY9A 2Z1MA 1L4NA 2XCQA 2ZYTX 4GXIA 1O0CA 4Z9AA 3PWZA 4X71A 3WMEA 3DV0A 3ELBA 1GNSA 3O6VA 2HJHA 1U0NA 4WXHA 3P32A 1RW4A 1ZM2A 3UMJA 3R9KA 5C7LO 2IMWP 4RF2A 4XEUA 1PDOA 3SE0A 3TO5A 3T7JA 1XCOA 2R11A 3HY3A 3TCNA 4GPAA 3M3DA 2YWRA 3T9BA 1BROA 1KY5A 1QFSA 1SUBA 3GAZA 3DVQX 5JVDA 3HKCB 5BW6B 3ZCSA 4PIMA 5FBWB 1X94A 1TK8A 4DL7A 1G8GA 1Z7BA 2AQIA 2H92A 5DOVA 3GLIB 3IEKA 3EPLA 2VT6A 2I6UA 3BSSA 2EBHX 4WT7A 1C0IA 5CBKA 1OA0A 3AUJB 3BGIA 4WFJA 4R9VA 5BXQC 1QH1A 2ZVPX 3T61A 3OQ1A 3GNSA 4I1UA 4P7FA 3GDXA 2VG8A 2HW3A 5FO0A 3RAPR 1U7DA 3S29A 2YWGA 2W2VA 4A8JC 3DDCA 1ZQAA 1CZUA 3NIDB 4FYIA 1QB7A 2N9UA 1SXJA 4QWAA 1JWAB 3H5RA 1SKMA 1RM4A 3DR5A 3KUKA 2BJVA 2H4WA 1ZM4A 2Z9BA 3PDUA 1OOEA 4O08A 1SVOA 4TWIA 3L7DA 3U3RA 3W8RA 2WJHA 5JSKA 4HH0A 4NXMB 3OHAA 3AU9A 2BR0A 1FQOA 3RVJA 2IKSA 2WG0A 2IPXA 4UBBA 3N0WA 2ZRCA 4IVQA 4MB2A 3B36A 4UREA 4Q48A 3SP1A 2GBCA 1P7YA 3NKFA 3U0VA 5JCOC 2B6HA 3N2LA 5DK6A 3CG0A 1ITZA 5D3MB 3MGIA 1M7BA 1SIOA 2R1TB 3RRYA 3T35A 3UV6A 3KQNA 2OCGA 5JALA 5F7JA 4RQMA 4EHNA 3D0RA 1OKKD 2BMAA 4RDCA 2AZXA 1NSTA 4PVCA 3IBTA 4JKYA 3HVRA 2GEDA 2CHVA 4EKIA 3EXEB 1WSAA 1UDCA 2E4YA 1DNPA 1U0FA 2TSYB 3CF4A 3EGWA 2PL1A 1PGOA 3L40A 3KVVA 4NFSA 4PSAA 4QIHA 3L8FA 3UJAA 4DT1B 3AQ4A 1G291 4UM8B 5HCIA 3X43A 1VIAA 2YFKA 3LE8A 1Y0BA 5ELXA 2DQSA 3JASA 4KDFA 1FUKA 3JTEA 2C9DA 5D5HA 1EM6A 5C4IA 2ODGA 4A0FA 3OHMA 4Q7KA 1KHHA 2GASA 4XGQA 5CA1A 5EWMA 2IHZA 1Y4DE 4OX9Y 2ZLBA 1IQPA 3Q8PB 2ZSFA 3MXTA 2IV3A 2JZNA 4PICA 4QQ8A 3W6OA 4GD3Q 3T3EA 2IZZA 4MJ3A 5K4AA 4QZBA 2AFHE 2GBPA 4IFEA 3JYNA 2RE8A 3K2IA 3MR6A 1VL2A 1RLTA 1UANA 3LQYA 4D9GA 4X9XA 4IRMA 2UZ4A 3WAJA 3D3WA 3AF0A 4FFNA 3FNBA 4OY3A 4YR2A 2DOKA 2VZ8A 3DEKA 2WKRA 4IIXA 3LT4A 1VMAA 4QZDA 3LSTA 4OUKX 3UMCA 1Y8CA 3N8DA 3A4YA 1T3GA 3A8TA 4HLUA 1UPHA 1ISRA 1J9EA 3IJEB 1NPDA 3RHTA 2YHSA 3G2IA 5ITSA 2EKLA 1U2ZA 4FINA 1JQJC 3F6CA 4QT4A 1KC3A 2P6OA 4G07A 4CN9A 4ARCA 4JWMA 3LA8A 3MJDA 2J9GA 1N92A 1ADCA 3OF3A 4MUJA 3MW8A 4ZVUA 4KWCA 4NBVA 5E9QA 2J87A 4PHGA 4IEIA 2HV8A 4L0CA 4WOBA 4CL0A 5DGHA 3T5GA 3LWZA 3SYZA 4I2AA 2AFRA 1X15A 1NMQA 2AB0A 4IDFA 4KI0A 3UJ9A 2EX1A 5MF6A 3W2TA 1FVFA 1Z7GA 2Y66A 4JL5A 5LC1A 2WR8A 3RUIA 1K5GA 5J2UA 4XLLA 4DL4A 1LNQA 2X4DA 2PRYA 1WB9A 1TNDA 4EDHA 2AG6A 2XQVA 4BUJA 4PPFA 2V74B 3PNOA 4P5DA 5KQSA 1BXZA 1LLDA 5IMBA 1KFJB 4GR4A 4ARVA 4RL6A 1O96A 3IVMA 2WUVA 3E82A 3G8YA 3GN2A 3OIDA 1AUOA 2GZMA 4ON9A 4NIMA 1B14A 3EIFA 3TE7A 3WO0A 2ZZNA 1P7WA 1RFGE 3EY4A 4O4HF 2WG2A 3EULA 1F0KA 2DPIA 4RGYA 1DRGA 3FCEA 1ZYUA 3QU9A 1NBMD 3RUFA 2YJTD 4FZNA 2XUOA 2ZAMA 1VL0A 3OO0A 2BH9A 3I1FA 3WK4A 2V6JA 4Y18A 4ETMA 5BN4B 5JSZA 2OO7A 1PVRA 3LLSA 3G3EA 4NZOA 4ZVRA 2G9NA 4K6KA 3DWIA 1Y4ZA 3UJ7A 2QTFA 2H31A 1TIKA 4JELA 1BA2A 1MN6A 4OM7A 3V32A 2QX9A 3OA2A 1JXAA 1U2GC 2Y05A 3UOGA 1KJ9A 3P19A 1DIHA 4JZKA 4ALMA 4HEA6 5A6VA 1OYVA 5D6OA 2O2GA 2PM8A 4LF9B 3ZN2A 1GFSA 3C3XA 4ELTA 421PA 5LQUA 1K2WA 4ZC1A 3NVVA 8ICPA 1SCJA 2RKOA 4C88A 1IXRA 1YAHA 3VR2A 4IJVA 1Z2EA 1S76D 3ULKA 1J25A 3DZ8A 4NU0A 4AMBA 1G55A 1C3XA 2HU7A 5MGNA 4ID3A 2VN8A 1QCKA 1EWRA 2V3CC 1A2KC 2NG1A 4DCCA 4PPXA 1JAZA 4EX7A 2GZ1A 3PZRA 1U8YA 3PQ2A 3OFVA 4CV1A 1WPRA 4M1SA 4RLSA 1JTVA 3L8CA 2M2IA 1DAHA 5FORA 4CL2A 1VHWA 1CUDA 5JUMA 4KLJA 2IYWA 1MCZA 5JC1A 2A0YA 5KFGA 4CG0A 4QVKA 5KFYA 3ILHA 4J0GA 5B7NA 2FMHA 1Y6QA 2AEEA 1K8ZB 3NW9A 1N77A 4RH3A 3A9UA 2YX1A 4M0MA 2C94A 3O3OB 3GT4A 3BWCA 2AN9A 5FUYA 3WWPA 4LBVA 1UCFA 4F6RB 1HTBA 3B51X 3QJ5A 2OLKA 3AU2A 4QJBA 2P75A 2W6IA 1QVRA 1XXHE 2IP2A 1G20E 4DPKA 2CFTA 1RXVA 4QZHA 1A69A 2HV9A 1M6VB 2J4DA 1FNSA 2PR2A 2VYQA 1ZQKA 1CUEA 2ZJ0A 3ASUA 3DE6X 3HY4A 4WMLA 4GICA 2IBTA 4C8OA 3IESA 5LL6P 1ESZA 1T5LA 1Q12A 3LD9A 4LFCB 4ED9A 4F5EA 1BJTA 5H3HA 1YJCA 2CJXA 2JIPA 3KZKA 2EERA 4C7MA 3X1ZA 1IXKA 3AB3A 4J1TC 4U2CA 5LLTA 3G85A 5AQEA 3FUVA 5DBGA 3RFFA 4W82A 5TQ2A 2KZMA 4RMGA 2VRCA 2QD4A 2ZE7A 4KRGA 1JF8A 2AMYA 3GILA 1Z5VA 2VHWA 1JDNA 2A9KA 3WLSA 4DGQA 3KUUA 5KCZA 3TL6A 2EKBA 1G8MA 2GKSA 4P0TA 3SF8A 3EDYA 5C9ZA 2RHMA 3A37A 5CP2A 1OMOA 2XB6A 1F2UB 3CLSC 3CUWA 5IK2A 1VIMA 3WHKA 2QVXX 3AU6A 2C20A 1T2NA 4ND8A 4JIGA 2PZAA 2XUHA 2EEPA 4AMZA 4BZZA 4AI6A 1G8AA 1T2CA 2FP3A 2Y1KA 3KEOA 4M37A 4PYKA 2GZAA 3WL5A 2PL9A 5KCMA 1JPUA 1VL6A 4NZNA 3AFHA 1E3WB 3HRKA 3CLTD 3V8NA 3FWZA 3W1WA 5LVAA 3FPJA 2WIFA 1X1TA 2R68A 1C14A 2IZ0A 4P35A 2QY6A 3WYFA 1W36C 1A1VA 4K0RA 4R8MA 4TZ6A 2VNKA 5IAOA 3WQRA 1U9IC 3ZDFA 1DMSA 3CS3A 4C0JA 4IOKA 1GPUA 1XDUA 2D00A 1MMFB 2JLCA 4JP5A 5E0OA 1Z13A 1YCDA 1QK3A 3I0NA 3M1AA 3NWBA 6REQB 2Q9CA 4G5QA 4F8EA 4Y30A 1Z7EA 4IGKA 2F64A 2VPTA 4F21A 4L16A 2KK0A 4E2XA 4PO8A 5A03A 1E0SA 5EMHA 4YVFA 3OF2A 3QE9Y 4LQ4A 4ZZ0A 3PICA 1WBBA 2D2VA 1WD5A 1X1SA 3JR3A 4PG7A 2F43B 4D41A 5C5EA 3INTA 5I5EA 1X1DA 2Q27A 2V9PA 3M0EA 2PG3A 3D2BA 1XXHB 3BTOA 4RELA 4W6QA 3G2OA 4RMNA 2F8SA 2OCLA 3UXOA 5AI4A 2YDXA 4KRXA 3PKIA 5TPWA 4AG3A 3FTEA 5EUCA 2BCJQ 2KVCA 1BSVA 1NOIA 1Q3HA 2VCYA 3ELYA 3GEGA 4OK5A 4WRRA 3TZLA 3UWSA 4GL2A 3H0MB 2QMHA 3BK7A 2VK4A 4OUDB 4ZCPA 2QDXA 1K08A 1JEQB 1I80A 4F2GA 3UHJA 1UM9A 3NBFA 3Q0EA 3C5CA 3UUGA 4DRXB 4PINA 5CBPA 3QI2A 2IYPA 4RU1A 4XVQA 2UZAA 4OHYA 3TCXB 4YI3A 2JAXA 3R75A 3IHQB 4TRMA 2HUPA 2AR7A 2SCUA 2H7YA 1R0CA 2YXNA 2V7PA 3GCDA 4G4SO 5CYOA 4EPVA 2PXXA 8ATCA 2WB4A 2CV1A 2ZI4A 4XUEA 4C8NA 1E9BA 2DL0A 1JU3A 2QJWA 3L1JA 4XB1A 2IYVA 3HUEA 3K72B 3T95A 2ZS7A 3VYSB 4EW1A 1IHUA 2FQWA 4JR1A 1PT8A 3PEWA 2QBYA 4OKNA 4W5QA 4WN3A 5FWYB 5LZ7A 1NVWQ 2W2PA 3TRKA 3TTSA 4EZIA 3TAPA 4EBCA 2I2FA 3E7PA 3FUTA 3PI6A 3Q9UA 4UUPA 5ALRA 2Q8PA 1EGVB 5D2CA 1D8LA 2PMKA 4LXXA 4TL6A 3TLXA 4DUGA 4BX2A 1D03A 4PS1A 1A4IA 7ICTA 1KDPA 1UWCA 1ZISA 3G8CA 5DNUA 1NJXA 3FXAA 3WGMA 4BVHA 5DRTA 1VIYA 1FTSA 2BKLA 4ARIA 3JD3A 3WYDA 2IY7A 3HXMA 2KNJA 3BSYA 4LY3A 3UUFA 4CU2A 4DNOA 4EQ6A 2VT3A 3G02A 2Y0PA 3BH7A 1O5TA 4C7OA 1UKEA 4KV9A 2KLHA 4YMWA 1CBUA 5LOVF 4M89A 2FE9A 1FLVA 2QN7A 1QHSA 2ABWA 2AT1A 2KJ5A 1VHDA 4KZPA 2I8LA 4P34A 1IM8A 1JVBA 1U9ZA 1E5QA 1P7ZA 1XZHA 4URZR 1YR1A 1L5SA 3ETNA 3FKJA 3AFNA 3IPCA 5BVHA 4EWLA 2GN9A 1BDIA 1MB0A 1YVPA 5KNDD 5F9FA 3UH0A 4UNNA 4J16C 1PIWA 5E1OA 3R7AA 2DYKA 3H6KA 1ML3A 4LJYA 3D64A 2KV2A 3X0DA 2GJ9A 4QOSA 5IU6A 2R6CA 2YWCA 5CM9C 2AJTA 3ETCA 4GWLA 2P9CA 4EH1A 1IZ7A 2V5UA 1RBYA 1IK6A 3DV0B 3DVSX 3LI2A 4BNNA 2ZT6A 2V03A 4KWHA 4IJKA 3A25A 4KX5A 2XF2A 3W5HA 5KSZA 1D8YA 1XUOA 2JGDB 2DUYA 3EAGA 3PYLA 1JEYA 1QTNA 1VE7A 3VU3A 3I4CA 4PSVA 1GQSA 4YMIA 3J81A 2OD2A 2OEPA 4FCTA 2ODAA 2GD0A 3FY4A 2COEA 3QVWA 4L8LA 3D2NA 1ZXBA 2W8LA 3HRHA 3G6YA 1ADBA 4MLZA 1EJ2A 1PG2A 1KMCA 3HDTA 4BKOA 1PS0A 1IH8A 4C3UA 1K06A 2RI0A 1VP9A 2ZYUX 3FPLA 3HA3A 3KKOA 4MGYR 1W85A 5J40A 4EYHB 1DXHA 1JVNA 3WGVA 1LBSA 5KJ6A 3HJGA 1IOZA 3NIGB 3TOSA 1U81A 3WWEA 4Y9SA 1XB2A 4FMDB 4P0QB 3WAGA 3K4GA 3SAHA 1XO0A 1KIFA 1ZQ9A 1GGMA 3MA0A 3NAZA 1UP4A 4LWOA 4MUIA 3AQEA 5KG2A 5FI3A 3C23A 3F5SA 9ABPA 2AXQA 3JZFA 2XI9A 5IN5A 4RKEA 1EE9A 4Q93A 4WBNA 5FUXA 4Q34A 4DR6B 1OVGA 4E30A 3QX7A 3PR5B 4KTQA 4QO7A 3UBTA 4US9A 1ZXXA 2JAQA 3DWGA 3R5XA 3ED5A 2CXUA 3N9IA 3DM9B 4QC2A 5EIBC 5FNZA 3WC4A 4QKQA 2WF6A 1JQKA 2A0KA 3KLNA 3U7GA 1QFYA 5CJPA 3AI1A 3PNYA 3HDYA 2WYVA 1YT3A 4J1QA 4ENTA 5I4BA 2V58A 3IOBA 5A5FA 3KD2A 3HEMA 1VOTA 3V1UA 3ZGXA 4EGSA 4KLQA 3RS0A 2CNLA 1UA1A 3O91A 1N60A 1OHHD 1UQVA 1NP3A 2A7QA 1AMNA 1F17A 1N5IA 1WMFA 3NEJA 4BRZA 1TMOA 3AETA 4O2BF 3RKRA 1T43A 3E35A 4HDMA 4XYGA 5DWVA 2P2NA 4ZT5A 4D02A 5A4FS 1AO0A 4KLZA 5B58C 1SIWA 3R3SA 1D2GA 4L5JA 3SZUA 2CVFA 4ZK2A 4U2EA 3C1AA 2CF6A 3H5IA 3JASB 5AOBA 1PDWA 1N9KA 4H6VA 5E9WA 2FV8A 3SR6A 2IIVA 2PBFA 1EK6A 2QYHA 1NBOA 2PMCA 3NHAA 5AKKA 3OZUA 3PS9A 4G65A 3IKVA 3BM5A 4CF6A 7MDHA 5AW7A 4WFIA 3EEBA 4KLRA 5IK2D 4YCBA 4NLBA 1LI5A 2JGEA 4INOA 5GONA 3NYRA 4HRAA 3U56A 3URMA 1J2JA 4I2BA 3AESB 4COKA 4BIMA 4E07A 5KNCD 2JFFA 2OBMA 4B81A 3OUTA 1E9CA 1OLUA 2EBUA 2F9MA 4LZZA 4PYOA 5HS6A 1SVIA 2HBQA 1CR2A 2G5TA 1JR3A 4V39A 3SJZA 1H0KA 5L7YA 4BX0A 3L4KA 4MVXA 5JRJA 4PH5A 4TN1A 2O1SA 4M38A 1DTEA 3V2IA 5KTNA 1J6UA 5FWXA 5BOVA 3E4CA 3IE2A 2X5NA 5C51B 2HWUA 4OQMA 2QL6A 5K0SA 1E1YA 3UXMA 5LKRA 2PIDA 5BMOA 5M04A 4KFRA 3CNHA 4II7A 3J81j 4KUHA 3KSBC 5EZ5A 4RTRA 3O31A 5JR3A 3LBAA 3N2KA 3PTLA 4KLAA 1YQXA 5G0SA 3NI2A 3EODA 2BJWA 4UAZA 1Y6ZA 2V6IA 4OCZA 3B1JA 4J6EA 3ANTA 4R54A 1F38A 4XA5A 3RASA 4EJ0A 3OLXA 1GPYA 1NI5A 2C0PA 2GPNA 1UC4B 4Q9LA 3LDFA 3LQRA 4J9KA 1YFZA 1R3UA 2C5FA 4R9RA 4ZOCA 4GC9A 2QWXA 3VYRB 2QRVB 2YNMD 4YR9A 5T57A 3L0PA 4DKXA 4I4TA 4QU8A 2IW1A 3IDAA 1I5OA 2P2GA 3EZ2A 3E0FA 2JEIA 3H4MA 5ICCA 1UMDB 1YWGO 2J6HA 4OYHA 1XJ0A 2ATEA 4UDNA 1C4KA 1V25A 4EB6B 4J1NA 1OLXB 1YRLA 3IAXA 5AJTA 3ZLVA 4JGGA 3N8IA 2PS3A 4JNCA 1P73A 3AJDA 2H4FA 3K73O 2D0IA 4FLMA 3MS4A 2IU0A 2AQ8A 3KLMX 2VDNB 2PT6A 3V4SA 3HO8A 3CWQA 3ND6A 4X0EA 3RJEA 4LK3A 1CY4A 2C2ZA 4R69A 2JGKA 3RF6A 3WQBA 3PHJA 2NO5A 3ROMA 3WNVA 1KGSA 5ITZA 2UUBB 4ALIA 4DM4A 4LDZA 1R8XA 1ZWKA 4TMXA 2DXIA 3DFMA 3HBFA 4GFDA 4B6RA 4RS4A 2V6BA 5AESA 2LCFA 3L1VA 1CFZA 2YJNA 3QPBA 2JJQA 4LXYA 3SC4A 5KQRA 4TT3D 4IG9A 2IA5A 2Y6UA 2J0EA 4XSVA 4B82A 2B3TA 1K3TA 1HE2A 1QKIA 2IE0A 1ZUHA 2VJCA 2X41A 3ASYA 1WB4A 1EVJA 2PZGA 3B6MA 3LLUA 3JWJA 4LYHA 4RD2A 4RVGA 4BWFB 3QBEA 1Y1QA 3JQDA 5CHGA 1IEXA 3EVTA 5LOVA 2C61A 4E32A 3F7MA 3HYCA 1FL9A 3Q9LA 1WHSB 2Z09A 2POCA 2DB3A 3TI0A 4FHZA 3DE0X 4MV7A 3T4UA 2H8KA 3WMRA 4DWOA 5KINB 4LF5B 5HQTA 4CIWA 4GBJA 3B0YA 3ZCTA 2GCOA 1TM4E 4TWZA 5KAIU 4KLFA 3TXXA 5D7NA 2BTEA 1FRQA 2NV3A 1DDIA 5BQPA 3W4IA 5ALSA 4KGDA 2V0NA 3K9QO 1IZYA 3ZDXB 3WLQA 1IB6A 2BDTA 3T7DA 4EA8A 4C21A 3LZ6A 2P3OA 3IVGA 5CTJA 3UXHA 5C35A 3RBAA 3QA9A 2F3UA 3ZYCA 3PVXA 3W8DA 4ROSA 2WWFA 1DADA 2P5SA 1NLZA 1ZI9A 2JFOA 1BPEA 4Y2SA 3HWSA 3IT2A 3MAJA 2WDZA 1QFMA 3AM5A 1E94E 2QS9A 4YG2A 5J2CA 2OCYC 1Q7BA 4E94A 1MQ3A 1L8AA 3COVA 3LO5A 3LP6A 4PG8A 2I7CA 2ZRQA 3RDPA 5KFZA 1C3JA 1RZRD 5CDFA 1NDUA 4YASA 2HUNA 2JKVA 2X5KO 2YHUA 2A84A 2ZJ3A 4IDAA 1XZBA 2DBVO 2W4IA 3MOIA 4JXJA 3UW3A 5A2GA 2WWGA 1KE1A 2XVMA 5EKDA 3GRPA 1CIPA 2RHGB 2DFPA 1NNUA 2IRWA 3AO0B 4UJ3A 2QP3A 3L0CA 3NT2A 5CRXA 1K7EB 4E21A 4RHFA 4MYHA 4F92B 1V47A 3I73A 3NC0C 5TGDA 4OOEA 2K4EA 4H6WA 4Q1BA 2NUTA 2CB0A 3SVTA 2EF0A 3TADC 4EEKA 4ID9A 4JA0A 1A8PA 4D7AA 4G97A 3DF9A 2HM7A 3DOUA 1L7AA 5E7QA 2H85A 4ZI5A 2NXNA 4QXQA 3B38A 4DQSA 1S3SA 4HYTA 4D43A 4H1UA 1B1AA 1QOQB 4MMXB 2CFCA 3ZXXA 2VH1A 3STTA 1MDFA 4HL6A 1SB9A 3SHOA 5ADUS 5FI1B 1VMDA 3DAPA 3MT7A 5J2AA 3ZY6A 1C50A 2DLNA 1IK4A 2PJUA 3B5IA 1KMIY 1WHSA 2BI8A 1L7PA 2CZCA 4DCJA 5JZVA 2VSOA 3GU3A 3GV8B 1GSIA 1IHXA 1VLVA 2EKQA 2K7ZA 1ISMA 1EQ2A 1LBIA 2AS0A 4E12A 4GUAA 4YJHA 4RQNA 1GFZA 1U4BA 2WIGA 3KO8A 5DB4A 4N5NA 1BVUA 1SVKA 2YRWA 5KL1B 3A26A 1C1XB 1US8A 5CDSA 2BM1A 4PCVA 1AMOA 4MDEA 1E6WA 4I1OA 2R65A 1ICEA 4KO8A 2O5RA 2WQ6A 3KWFA 3SJ7A 1JEJA 1ZJYA 5DG7A 3MNFA 1COWA 1K4MA 3FNQA 4ESOA 3LL7A 4GPIB 1K8XB 2O8FB 3TVDA 5B2FA 4J9MA 4MLCA 5K4GA 3ZOZA 4DMHA 3RH6A 5I9SA 1DRJA 5JZMA 3PQ6A 2X22A 3IOMA 1WUYA 2HXSA 4KE6A 1Y9DA 3QEBZ 1Z4JA 2XUPA 2YINC 4MQUA 2UYYA 3TOXA 5A4DA 2GBLC 4K0KB 3ACBA 2DF8A 3D8RA 1KEVA 3F96A 3FVQA 3P2MA 4JBYA 1DUSA 4NR0A 1VDZA 4YP3A 5EHNA 4TMZA 5J4YA 4DCPA 1UK6A 4NCKA 2DJ5A 1VQ1A 4I4IA 2F2AB 3S81A 3I92A 3K6SA 3ZVNA 2O8FA 3KL2A 2IHMA 2Z6QA 1NLYA 1S2NA 5FUVA 1KRXA 3WQHA 3AKEA 3C2LA 1KYVA 3B2QA 1DKUA 4IKEA 1F06A 4UTOA 1Y1LA 3FZGA 3L6BA 2XRYA 1V3TA 3AI2A 5E1BA 5SYNA 5LR6A 1H2FA 1PLKA 2ZR9A 4FPXA 4FS3A 4BC1A 4ZGBA 3WK9A 2K4MA 1V1MB 2Y71A 4IQTA 2X76A 2D3TA 8ICKA 2KHVA 3I83A 4HV4A 1R0YA 3GA0A 3N8GA 1KO8A 1VECA 1X66A 4DL9A 5F23A 2JKYA 2JGFA 2J3JA 3DL4A 3C43A 3ZQUA 1DIRA 1V35A 1FLAA 4EPXA 2B98A 3U3KA 5KNDA 1V1RA 4WCFB 5GOZA 1ZQHA 4B74A 2QSZA 4G3XA 1YUBA 5FUMA 1E7MA 2O05A 1G6KA 5EZ6B 1RRPA 5HR6A 4PGXA 1F1JA 2QQGA 4B9VA 4AJLA 4PYIA 3REOA 2QRKA 1QFZA 5JBQA 3KSZO 1G21E 3HJAA 1SQ5A 4IJWA 4RZQA 4NWIA 5DHFA 2ZUFA 2O2IA 3PWTA 1TK2A 3QNWA 1BHJA 3KXDA 4FONA 3KCNA 1YB6A 2Z9DA 2D6FA 2O8BB 4BVAA 3OQOA 3C74A 3H5OA 3D1LA 1IBLB 2XY7A 3EXIA 1DZIA 4UB3A 4HYYA 1MP0A 1LSOA 3FHJA 4CM9A 4OQZA 1FP2A 3R5KA 4LVCA 1UBFA 1AQ6A 4J0CA 5CW1A 3RB0A 1NGSA 1PK8A 2CL5A 1VI6A 1AQLA 1I4EB 1LDGA 4HDOB 3AEQB 3HCOA 4UNIA 2H2IA 2R7AA 2FGKA 1X8XA 3UHFA 4V0OA 2I3BA 2JIZD 3F5AA 1P77A 4QOJA 3T3DA 2UAGA 2FW6A 4FHCA 1E0KA 3Q5EA 1U4SA 2AFHB 4O2BB 3RGGA 3GLRA 1K9SA 4BP1A 1UPUA 3S99A 2E1RA 3D4OA 5CEFA 3H0LB 1UT5A 1M6YA 2QPAA 4PZAA 1N25A 1DCMA 1LX6A 1MQ8B 1Q57A 1NJ6A 2OV2A 2DLDA 2ZT7A 4I5IA 1BVRA 4C4TA 2H1WA 3D3EA 1F4LA 1K5HA 2PUTA 3ZPXA 4CQMD 2NVOA 4PZNA 4QNRA 4ZPXA 4D9EA 3A4NA 1XRJA 2P2LA 3MTIA 4RTQA 4LZNA 1F5SA 3X3HA 2EJWA 3GC6A 1QTQA 4O9MA 5IKMA 4ARSA 1R4NA 2YBDA 5IZCA 3O8CA 3BJIC 4I27A 4DTCA 5IM4F 4UB6U 2I2XB 4ZYTA 2XB8A 3FJOA 3WGNA 1WUTA 1X19A 1GGKA 3A3KA 4GW3A 1J23A 1KYZA 3P0JA 3T54A 3IMCA 4RA9A 5G4KA 5JD3A 2V1XA 3LS2A 1TVMA 1UBHS 1UBSB 4GX0A 4QWMA 3Q7IA 2PL3A 3H4DA 4ME6A 3F0TA 5CT4A 3TQOA 2X40A 1IZZA 1S2DA 4BV2A 4U7DA 4FMDF 3DLHA 2FPGB 1ZP6A 3VH4A 1KK1A 3VR4D 3RBXA 1Z5NA 1I7SB 4L9SA 3SNHA 3VDRA 1EHCA 1G21B 2ODQA 3K7EA 3LUJA 3RPEA 1JEDA 1JKJA 3W5JA 1NT2A 2GTIA 2H9YA 4W7IA 2QJOA 4UE6A 4KLHA 5A7HA 5IASA 5JMTA 8ICZA 2R7KA 4AB1A 3MC1A 4CG2A 4GVLA 2W93A 1YRYE 2A58A 4BO7A 2XITA 3H11B 4CM8A 1ID1A 2JHGA 2QUBA 1BVHA 4J3NA 5JS1A 1AKUA 4O6VA 3JQ8B 1I6WA 1XWLA 5JZSA 3UJCA 1LSJA 3PA8A 1GAXA 1MEEA 2GYYA 1E1MA 3AR6A 5CNJA 5JYEA 1Q0HA 3Q5DA 4PYNA 1JJFA 3BXGA 1W5BA 2GA8A 1II9A 3A1FA 3FPHA 1GVNB 3DOHA 1PUXA 2MMCA 4AF8A 1MA0A 2FK8A 4GXNA 4E4TA 3CIFA 3AKDA 3NUZA 5JJCA 1AQYA 4OHZA 3DZCA 1Z63A 4B6PA 3KQMA 5CITA 3C87A 3FMPB 3H7AA 1JP7A 3L6OO 1BC5A 1K5PA 1CRXA 2P9FA 1YE5A 4YEDA 4YP6A 4ZD6A 1CNMA 3LPNA 4RACA 3RS3A 3U3ZA 3UGJA 3A9WA 1EJ0A 1SQ6A 2A57A 4OF4A 4BNHA 3RBEA 4KBFA 1T4CB 3PPXA 2A9QA 3BWXA 2K2QB 1QTRA 3F7TA 1IBCA 4LY0A 3LCRA 4GI7A 5L7WA 1R2QA 2GHTA 2XEDA 3B6EA 4NBLA 2A1JB 2QRQA 1OW3B 5AM3A 1JLSA 1XZQA 1K6JA 1R5NA 1X14A 1PEKE 3R8XA 3DBLA 3DUFA 3IMFA 4PG6A 3TNJA 4QU0A 2GGSA 1P17A 3AM4A 3GNTA 4N03A 5COBA 3X1JA 1T36A 2JBAB 1R6TA 4MQBA 4WUVA 3L9WA 3P0EA 2OO3A 2Q3DA 4I81A 5HIKA 4FHGA 4MS3B 4HEQA 4ZAZA 5L6MB 1AY0A 3GP8A 5IJ9B 3WGJA 3M6VA 2X1HA 4W5WA 1IDOA 1CJKC 1IN4A 1BJKA 5ITWA 5JLJA 2A1TS 3ITEA 2XOEA 3A36A 1JHOA 2NTVA 2ZJ2A 3KXIA 4LQLA 1UXKA 2ICAA 3ZQ6A 5BYAA 4G26A 2DPLA 1EGAA 3F7OA 4K8RB 1KFBB 5IUNC 2PMFA 4UQPA 2A4KA 4UTRA 4YRSA 4ZEVA 5HFJA 3GZTB 5DTQA 1U2PA 4D8UA 3VSDA 3K31A 3VZDA 1K6IA 1TLFA 1ZN7A 2XODA 2FP4B 1H3FA 1NAIA 4EFNA 3GFRA 1L7QA 3OUZA 4UU7A 2YIVX 3OQBA 5LB4A 2Q3CA 1SV4A 2DQNB 2C3PA 2DR2A 3KJHA 1F6WA 1SKYE 5D51S 3J7TA 5DXAA 2YMMA 1L8LA 2H3HA 1GTL1 2XHZA 5BMVF 1G8JA 1SOAA 1W93A 1EIWA 2YWHA 4WLNA 4U7GA 3LCMA 4G5OA 4JJKA 3A6ZA 4DLGA 1I0ZA 1OI4A 1Z8DA 2VBIA 3EGEA 3KT8A 4QAQA 4TRJA 3DQQA 4MQEB 1O94A 3UICA 2EZUA 4HFNA 3H8WA 3H7IA 2B5OA 3EOZA 4QHYA 4RM3A 4YUYA 4Q18A 1B74A 4UEJA 2YN0A 3KS9A 4BNKA 1FFXA 2YY6A 3HWRA 4ZEXA 2WMYA 1ZMOA 1BW9B 4QO8A 4EKGA 1GP2A 3TFRA 4KMUA 1KP2A 3SKXA 3M6UA 3N2NA 4PM4A 2W9AA 2A1AA 2FMXA 2HA3A 4FYJA 4G86A 2W90A 1RRFA 2QGFA 3CTMA 4CL8A 5GVSA 3VNVA 1N2EA 2IITA 1ZBDA 1VE1A 2BFFA 4DHEA 2C0QA 3UH1A 1HUQA 4DXHA 1Z35A 4KQMA 1Q8KA 3OHBA 1RCFA 2C3YA 3IHLA 1PEAA 3WY9A 1V43A 4F7WA 2HU5A 4QOFA 1GTG1 2W54A 2JIMA 5U4QA 1ZKMA 4QUAA 1DHRA 4CG1A 4JJ7A 2HA7A 1H1LB 3LPLA 4HFJA 4QPPA 3KXLA 3WG9A 4C3OB 3SMVA 2VA3A 3EVCA 3RK1A 2JLRA 2KMLA 5DGXA 2Y0CA 1EDZA 2Z8XA 2QYTA 2JJMA 3BHJA 3RG8A 1C30A 4D8VA 3H5NA 1C3LA 1RZVA 2YIJA 1CUVA 5KWIA 4WZAE 2EFDB 3B20A 3T9EA 2C5HA 3EEIA 2AUMA 3GPCA 5B1IA 4X6LA 3HCWA 5IAKA 2ACVA 1ID8A 2ASDA 4CCSA 2AFVA 4Y2YA 1IHYA 1Y5IA 2ID8A 4O2RA 3ZU4A 5HSGA 1DXYA 5JD6A 3C6XA 5JLAA 1SHLA 1X74A 1ECGA 2HBYA 5FTKA 1VBKA 4RYLA 4CIAA 5D8DA 3H0EA 5J63A 2DHQA 2SECE 2EL7A 2JCGA 4JUZA 1OI7A 4QPZA 3P9ZA 1A9OA 1SK8A 1Y33E 3H2ZA 4ED0A 3JPPA 1ZITA 1U9LA 2PXHA 2YJ4A 4NLNA 4A8EA 2EV9A 3CG4A 3UHOA 3V48A 1XD9A 2J85A 3OE1A 4Z51A 2DUUA 1VHQA 4OJLA 2IOFA 1R0XA 3O8NA 3KXPA 1D2CA 3AIKA 1OBVA 3F78A 5E7MA 5FPSA 4EHHA 1ULAA 3BHIA 2XEXA 1AD2A 4I2IA 1W0KA 2C5SA 3Q5GA 1Z8NA 4N54A 7ICVA 2JFWA 5IBCA 1G8HA 3ER9A 1I8TA 3NH6A 4K4HA 5GM2A 4EKYA 1RLIA 2E1EA 2RGRA 4Q43A 3R0XA 4RLHA 5JAMA 4U63A 4YALA 5B64A 1KRWA 5JDCA 2R8BA 4DVJA 2WMNB 4RORA 4EAAA 1M5UA 3B13B 4GT1A 1HY3A 3TDKA 1W30A 2D5AA 2IE8A 1NXTA 1ZSVA 4DEZA 2JDID 5HEKA 2BFAA 4OB8A 2UVQA 2FFJA 1S0OA 3VKUA 1XRLA 4CM6A 2E55A 1SBYA 3GMIA 2ZIWA 4IMIB 1UXOA 1D0SA 4BU1A 2ZWPA 4G4IA 4J9UE 5GOTA 4PE5B 1PFUA 4MJ7A 4ZEMA 2C2WA 3L7JA 2HL6A 3PJFA 5HM8A 2QUKA 4REMA 3UAVA 3AK4A 3M82A 3QKUA 4BEJA 1Z19A 2ID7A 5EMMA 1AUPA 3IP7A 2W70A 3CP8A 4B2IA 4K4IA 1T2VA 3BIJA 4WBSA 4WN9A 2JK1A 2REXB 3U7JA 1NW4A 4RIIA 1IM2A 2XXAA 3TD9A 5C1PA 1P8AA 3QVKA 2A33A 5LUBA 3ICEA 1NXXA 1LFAA 2IUSA 2PWPA 2ZJAA 4LPSA 1KIAA 2C2YA 4EZBA 3BDPA 4F5RA 3WL6A 3BEOA 3V1TC 3BHMA 3QP9A 4GWGA 2I78A 1RLMA 3EWAA 1GNQA 4RQ8A 1SA0A 2NM0A 1AROP 1Z3EB 1MO2A 3BZUA 3NVMB 4G0QA 4O8CA 4QJ4A 3AQFA 1RWVA 1TVCA 3BXXA 1AT1A 8ICLA 1QK5A 2XUJA 4I1RA 1W34A 3RVRA 1C8BA 5FFFA 4FZLA 1T1GA 1Z0DA 3OC0A 4YRFA 5BO5A 5HIAA 3KZNA 3T5PA 4B9UA 3ZR4B 3J7AC 3SX2A 2ZI5A 1V37A 1E58A 1TYDE 1YB4A 4L0QA 4FDUA 4OQXA 4P53A 1SVUA 4WOJA 1I33A 5KBYA 3CVYA 4BAGA 3G1TA 4E5PA 4F4YA 1YGYA 8ICCA 2HGSA 4ZV4A 5IYZA 2FWJA 2GBGA 2ERXA 3KOUA 3O2JA 3LT0A 4PHPA 3ID6C 3WJ2A 2BGRA 2L42A 2JI8A 2VFAA 3TG2A 4IIJF 3JPWA 4YAUA 3C3BA 3TW4A 3FCYA 9ICVA 1PRYA 2ODTX 1YQGA 1V6SA 3SZ3A 3ZNQA 3C3DA 1FP1D 2ZEJA 1GG9A 2BF7A 3FHOA 5I7OA 1WMSA 3HC7A 2DFTA 4WACA 1DXQA 2VP4A 4IZOA 1Z5ZA 4HKTA 2R5FA 3OPYI 3UJ6A 2ZUBA 3VKVA 1Q1EA 3F53A 1JGTA 1H6AA 1C1XA 1X1AA 1F2VA 3L5KA 1PZGA 2PNFA 1IQ0A 2WJ3A 2ZRLA 3PIRA 4RZHA 3X1WA 5TZVA 4O3SA 5A02A 7ICLA 5J2EA 4REOA 3VNRA 3QZ8A 1J4AA 3QVUA 4TV8F 5AT1A 1ULTA 1L5NA 1FUEA 2WJZB 3B9QA 3RU9A 3ZK8A 4UPEA 2VTKA 1PQUA 4PFKA 2OG2A 2G9ZA 3GG9A 4GC5A 4JX8A 4KK4A 4CE6A 4NOMA 1J2RA 5CB6A 4FOSA 3MBKA 2IYFA 5GGYA 1P9RA 1WKCA 2OFXA 5CLLA 3SJAA 2WPNA 2FSVC 3GRUA 1G38A 2H11A 3M2PA 3WKBA 5J3JA 1G41A 2WYIA 4GQAA 4BLOA 1CU1A 1ZN9A 1AC5A 2YQ5A 4DWVA 4URYR 2SKCA 3UAGA 3VX3A 3DJYA 1UDWA 4CKZA 1M0EA 3CRVA 3SQOA 3M6ZA 4FZ5A 4NE7A 4ENSA 5ULLA 1YDGA 2YX8A 3PJGA 2B4TO 2XT6A 3K0CC 2N47A 4IBOA 3T6KA 4N5IX 3AINA 1Q3VA 2HNAA 1PWZA 1WYGA 5SZHB 1CY0A 3CNLA 2HTEA 2J08A 2P79A 1O57A 2GPSA 2WTXA 3AY0A 4Q0MA 2AC4A 4TVOA 5G41A 4EHDA 1LV8A 2OK8A 3MQFA 3F74A 1BO6A 4X93A 4NNOA 3WLRA 3FMVA 1Z12A 1OXBB 4Z5XA 3CXUA 1SQGA 2VZ9A 3A2LA 2NUAA 1G0OA 3KEGA 1HURA 4G41A 4BMXA 2VDOB 1W88A 5DNWA 4E1VA 1DWPA 2OGTA 2QVLA 2PH3A 2F67A 1RADA 5EKXA 2QN9A 1XMQB 1TEZA 2W8BA 4M1EA 3WK8A 1M54A 2O3JA 1ZEJA 4N7BA 4B31A 1RAIA 4RQ4A 4EY4A 1WAMA 5H8WA 1B00A 2HFJA 4XW2A 2R18A 3JTMA 3P9RA 2UVPA 2ZSDA 1A8HA 1USWA 5DHUA 3WOVA 4KBYA 4B80A 2C88A 1N5KA 4GX1A 1PJTA 4PHFA 2ZUSA 5JPIA 4K8OA 2HK8A 4FS1A 2J3IA 4X54A 3ZS8A 1YS9A 2DECA 2QW0X 2WLSA 2ZYIA 3BERA 3V46A 5LU8A 4QTYA 4YR7A 1L7MA 4JZYA 1IXYA 5CR0A 1Q0SA 2FAXA 2WUFA 1P2UA 2FK7A 3Q3EA 4KMSA 1A9QA 3UMFA 1TEVA 4D4GA 1L7RA 4DLXA 3TUZC 4XWAA 1BS1A 3O94A 4DRYA 4FB4A 1QQAA 3HLYA 1EWKA 1DT5A 2GPTA 3BA6A 1Q7CA 3I32A 5ERXA 3KALA 3SYLA 3WB2A 4JV0A 2WW8A 4B0OA 5BNTA 2REQA 4BUGA 4HWPA 4XX1A 1K5OA 1JEQA 2G9UA 2ZREA 1YB1A 3IOEA 4DADA 1ZQGA 2P9BA 3IP9A 1X39A 3OJWA 3V7WA 3C6ZA 3W2IA 5ALHA 4EBBA 3B5JA 1EBFA 3B1WA 4MUYA 2XI4A 3CQ9A 4ASUD 2MA1A 1RXUA 3DTVB 3LXUX 5ALQA 4JK1A 3G5TA 3QYJA 4NTZA 4RXUA 1M10A 2ECOA 4CM8B 5KYXB 4N47A 5F98A 1X92A 4RQTA 2PS1A 5KNLA 3TBHA 1Z6TA 2HCRA 5EI5A 3NMUF 2ZKLA 3HCCA 3BJZA 1NLMA 3DFFA 3KPVA 3OE4A 4CM9D 2H54A 1PL6A 2FMIA 4HXYA 1QIIA 4QEZA 5E2IA 5KPDA 4RH1A 2HR1A 2PY6A 4DXAA 5LM3A 3QWHA 4ZTZB 4ECSA 4RCVA 2XLBA 4KFCA 2G76A 1PFQA 2GCIA 1J56A 4GOND 4LBYA 5H4GA 4MKFA 2VLIA 5IC4A 3K30A 2DTDA 3MINA 1CI4A 3W8EA 1RAFA 4MEYA 4MKIA 5BUZA 3GLFA 1M2EA 3DZIA 3HWTA 2A14A 5ALJA 5EE3A 1RIIA 3ZYZA 5A4AA 3ROQA 1XDSA 3WDLA 3GLIE 4HQKA 2AJCA 1VL5A 3PDIB 3ZDCA 3AB7A 1M1ZA 1SNYA 4TXNA 1R50A 2VR1A 2C1ZA 1EFUA 3L8HA 1I9CA 5G4LA 4HNVA 4DCVA 3LRPA 3T5AA 4HWRA 3QKIA 3AG5A 1O77A 3VDNB 1FW8A 3MRXA 4L74A 4X1YA 2B1RA 3W4JA 2AHOA 2D7CA 1N2JA 2P3QA 5ENVA 4MI6A 1LSUA 1DQNA 2E7ZA 5F2OA 3FE2A 1G42A 2WFAA 3VU9A 1MQ2A 2XWJI 3LBIA 4IJQA 4Q03A 2W9BB 4B83A 3I34X 1IJFA 1OC4A 2IEZA 3IERA 4P5EA 4RHCA 4O3NA 1UFOA 2MSCB 1WWKA 3ESAA 3IVXA 5GY7A 1CPYA 4JUBA 3M7IA 4IP0A 3PNPA 2WM2A 4B32A 3KWMA 1ENYA 2IS1A 4TL7A 1QQTA 2J48A 4YQYA 2BMVA 4DV7B 2LXNA 1G20A 3EDRA 2K60A 2XGSA 2FGJA 4FHDA 4LHWA 3UAXA 3SOZA 5CLHA 4L6IA 1CLUA 4UHHA 1BS9A 1JIVA 1KAGA 1KMHA 1Z6XA 3VBEA 2FSFA 5FHRA 3RYCA 4QDOA 4G5SA 2GBIA 4MW7A 2C59A 3GZJA 3HYNA 1JZSA 9ICUA 4GWKA 4WQMA 5ELLA 2YH2A 4PLHA 1H4QA 2VAWA 3KBOA 3UGQA 5AJHA 2CB9A 4EFMA 4IGFA 1XAGA 1U7TA 3WWOA 2PI5A 3DMRA 5DLPA 2OUIA 3T12A 2PAAA 2V55B 4GXTA 2KICA 1P33A 3H99A 3QLTA 2VWGA 1KYQA 4H08A 5DCYA 2HF2A 3T9FA 3U60B 4DFPA 5CCDA 1H2WA 3EXHB 2VQ3A 3ENKA 3WQQA 2VWPA 1T6ZA 1H1TA 3RSFA 5CXQA 3BT7A 1MIOA 1YQDA 3OKAA 5DNAA 5E6UA 2XB2A 3KETA 2HWXA 5EQJB 1SU6A 5KG3A 1ORIA 3TZHA 5DT2A 2VHXA 3OJUA 4KXMA 5LQMA 3C6MA 1XZCA 4UJ5A 4RQ6A 3DHVA 2QV0A 4MIKA 3FPFA 3RRBA 2ZAOA 1QAQA 1QYRA 1TCAA 4HG2A 5KFOA 1VXOA 3EIUA 4LEIA 1MORA 1NKEA 1GZSA 3NWOA 3V6HA 4JROA 1UKYA 4QUDA 1Z2NX 3GVCA 3QQPA 4BQSA 5JTTA 2Z5GA 2ONJA 1D6SA 4W5NA 1XP8A 3KKPA 1DIGA 1LKYA 1QFXA 1H8EA 4UBMA 4BJ3A 4KITB 3ROTA 5IVKA 5EVJA 1BW9A 3G23A 4HDNB 2CNNA 2ST1A 5CW2A 4YGYA 2GM3A 5JU5A 4CKCA 4E5KA 5C8YF 5A5EA 2AD5A 3B9BA 2PMZF 4P0PA 2RGEA 3OI7A 4KTVE 3JPYA 1OKKA 2Q9BA 1ZH8A 3NBQA 4KDRA 1EKXA 5KTQA 4LTMA 5FTNA 1MOZA 1ORDA 3G2QA 3IQXA 2L69A 3LQQA 4YWJA 5KTKA 1O8CA 5C37A 5CLQA 4GI5A 4DR2B 2RGXA 3LQ1A 4KOAA 2E89A 3C5EA 1XMSA 4RUKA 3CUTA 3NDRA 1TI7A 2XZTA 2BVNA 5KVQA 4X66B 3P0IA 2J07A 1KDHA 3VUEA 1X9GA 4ZYVA 2A6PA 4Q9JA 3GIWA 2LVBA 1M8KA 3DZGA 3FPEA 5GJWC 4MF8A 1X7HA 2B5WA 3QFTA 5LDGA 5ALZA 2W6QA 2ZI6A 4O4HA 4C0LA 2Q45A 3E6AA 2ATVA 2OH2A 4HYKA 2YUTA 3EGCA 3NR2A 4H0NA 2O3RA 2XR1A 1ZUIA 2AOTA 3DUWA 1ZQ1A 2DPMA 4BWYA 2ZBPA 4DC0A 2VJMA 1QGOA 5D5PA 8ICQA 2WTFA 1F2TB 4BVEA 3ZWOA 1UPTA 4LF8B 5FWXB 4UVEA 4IKPA 1BCRB 1T3HA 2P5UA 2X7XA 4BV3A 1LLCA 3KYCA 4IHQA 3EX7C 2Q2WA 5EZSA 1HV8A 2NZXA 4J9VA 3DR3A 4R64A 4M8SA 5C5DA 1X7WA 3JQGA 4ZOLA 4CETA 2ILVA 1MKYA 4ZU6X 3K0EA 4RVOA 4HAUA 4EL5A 5HMLA 1C1DA 4CQJA 1XQYA 1EXNA 4YDRA 2QXUA 1HFEL 1UOPA 3LC0A 4GKBA 3DWEX 4X7BA 2EKPA 3GDHA 4LNAA 4W63A 1U9YA 2OY0A 1LPOA 2ZJBA 4EY3A 4CKEB 4O4JA 1YJXA 5IJ0A 1WPXA 4Z7QB 2RH9B 3A1VA 4ZQEA 1LBTA 2QNRA 1EUZA 3FNGA 4C78A 4E70A 3OCZA 1CRQA 4UB1A 4RSHA 4Z9XA 4ZZ3A 5L4LA 1K3FA 1PG5A 3F3YA 3HH8A 3QE0A 2VJKA 3E7FA 1XVTA 4A5OA 2C95A 4NXNB 1P0QA 4IIFA 1OWMA 3HILA 4FDMA 4EI7A 3TF5A 1Y7IA 5AI5A 4NMHA 1LLQA 2VDVE 5C80A 5TIIA 4OA8A 1CTQA 2O1XA 1DRWA 4J1TA 3ZCQA 1XPOA 2X8WA 1A04A 4V0ME 2VDUE 2Y0SC 2EDAA 4LE0A 5D3MA 5EEGA 4WOPA 3SBEA 1H22A 4Y9UA 3JVUA 4DSEA 2J8ZA 2J9RA 4FZJA 1PAUA 1X40A 1Z73A 3C6YA 4KSCA 4AJ9A 2BGNA 5AVSA 9GPBA 2ZYVX 4U9IS 3NWJA 2QM8A 1CUSA 5BR7A 4B6OA 3OT1B 2R2GA 1KOLA 3V8PA 1ELOA 2VJDA 3RARA 1PU2A 5JYDA 2BGMA 4OMFG 3H8MA 1PK7A 2BI7A 3DZHA 3I2IA 4I46A 3S6JA 4U6NA 4QPDA 2G3YA 1L4FA 1EFTA 5LCXA 1SCIA 1MO3A 1SY7A 4KQWA 2ASJA 4L0DA 4MPDA 2C7QA 4BTEA 3RNOA 2O8BA 2X14A 1II8A 1TYAE 3EW9A 3R24A 4M99A 3EXHC 1MZVA 3SK0A 5DGDA 3E4DA 2EHJA 5C53B 2HRDA 5JJLA 1H2ZA 3I5XA 5SZJA 1U4NA 4P7JA 3A6EA 1HGXA 1V16B 4KN7A 2QTZA 4POAA 5DN9A 4P8RA 3VR6D 1VRVA 2R8IA 4ERNA 1D8AA 4IHAA 2FN4A 4YUZA 3H1TA 3C4JA 1QIKA 3GGSA 1QZZA 2FW0A 2R85A 3GX1A 2W7OA 4I1SA 1FYVA 4MUMA 4DEYA 2Y0DA 3RVBA 3QFHA 5LMUB 3ZD9A 5DCWA 3TW0A 5LOVB 3TQ1A 2C2HA 3AHDA 1X80B 1KI9A 4KFTA 4B8ZA 1QIJA 5L1IA 1N5RA 1TXGA 3DMTA 4D4MA 4ESHA 4WXRA 3I8SA 5F35A 1EXDA 2C2KA 3ETRA 2PJZA 2ZSKA 1EXMA 4KQ6A 4A10A 3ORSA 4JKOA 3V00A 1MZPA 3LLCA 2RARA 3I2FA 3PFIA 1CVLA 2OZEA 1AUVA 3RTAA 3VZCA 2ZVQX 5JJIA 1WRBA 4JT4A 3UOWA 1G98A 1JZTA 5KTPA 1CUZA 2VXCA 3FVWA 1J0XO 3JD2A 1WCIB 2VYNA 1JDTA 2QTNA 3OWOA 2G4VA 3SF0A 3K5WA 2XLCA 1V8PA 1EX1A 1CUKA 2HBMA 2OXRA 2FCRA 2FWAA 2ONCA 4Q37A 4QG7A 5AHRA 2FSVA 3OLQA 1NNSA 4US2R 4CG3A 2Z4SA 3AETB 2FG5A 1XJCA 2O3QA 4G25A 5AW1A 1CDDA 1DKPA 4LYGA 4RK5A 5A6SA 3T5LA 1W7AA 3QBTA 3P20A 3PW0A 1WOYA 2R4UA 2REOA 4YLGA 5FOSA 3LXXA 2JAHA 4LZWA 4XYEA 3ZTYA 3FTQA 4L72A 2JEJA 1RCTE 3TQCA 3HO1A 1FVHA 2HRRA 4RWZA 1LU9A 1UIMA 5HOEA 3Q2IA 1F51E 3ABZA 3JVDA 4N12A 1F4VA 3JPNA 1K89A 2FLVA 5F76A 3PD1A 4PX3A 4HNUA 1RKBA 4UAYA 1OWLA 4QW8A 1W0KD 3G88A 3KFLA 1E2PA 4CM4A 1IN7A 1KH2A 4EZ6A 1U7PA 1EP1B 3ITNA 5CHYA 5JU6A 2GI4A 4JB0A 5J0OA 3G5MA 1AG9A 4KDEA 3KTFA 3WZMA 3EVBA 4E2FA 2NU9B 3D2CA 2MYUA 5DBAA 1GCUA 2Q6VA 4GDMA 1EE2A 3T7KA 3DE2X 1YJAA 3GNLA 4IDQA 4I1PA 3KQTA 3EZFA 1PR9A 3L0YA 4C04A 5HFAA 2OBLA 3BTUA 4PNHA 7ICEA 1YNOA 1COKA 1SC6A 2QN6A 3QOWA 4XDGA 3UYLA 3L7IA 3LBYA 3HA5A 2W58A 3DBHB 3MJHA 2FUEA 4Q4HB 3VI4B 2AXEA 2G77B 2IOHA 4MR9A 2OGUA 1HSOA 3D1JA 3QG1A 4IXMA 4D44A 4HX2A 2ZUUA 3GF4A 1HEIA 1ATZA 1XD8A 1KFCB 2Q46A 2B8EA 4QUBA 3HVIA 1HTTA 1E2LA 2DUJA 4JD5A 4U7HA 2GM9A 1RRKA 2XNKA 4DSJA 2C4NA 2V96A 2BGLA 3AILA 2E4ZA 3P9CA 4Q8FA 1Z0IA 1CUAA 4TN5A 2I9KA 3AHGA 2I03A 3OE7D 2MJLA 1JLLA 3HJCA 5E9JA 3VV2A 3ZBTA 3AH8A 5KT2A 4JS0A 1ADFA 4NCNA 2EOAA 1L5YA 4RJJA 2OUKA 4E7PA 5KEIA 2C4TA 3DEYX 2ZXFA 3OZWA 4YMNA 2HHXA 1FMTA 8MHTA 3ZTWA 1OBCA 3RJHA 2AMJA 1ST2A 3K0AB 5F51A 4XUDA 1NBIA 3PFWO 2GXUA 2NO4A 7ICSA 5ICMA 1NKCA 1JBKA 2H9AA 3KYDB 3O73A 1A9SA 2AZDA 3QF4B 4AO7A 4ZYZA 1EFVA 4P36A 2KMDA 4UXJA 3OMWA 5DNDA 3PQ8A 5JAOA 3N5CA 5F73A 1R0KA 1YQQA 2C3UA 2SNIE 5EIEA 4F4UA 1P4RA 3V7FA 4ND5A 1DS6A 1HO3A 3VR0A 1UM8A 2OVFA 2PKYX 1RHMA 1GPLA 1USUA 3L7NA 2XWBF 3V34A 4JI7B 1R8QA 3R76A 2QJRA 1TB4A 1SIUA 3QEAZ 3ZV5A 3BQ2A 2PGOA 4N8DA 1MDBA 3D6MA 3GJ6A 5JAIA 1YHNA 1ONNA 2I1QA 1AF7A 3FI0A 3CEAA 3R3YA 4MDYA 2XTMA 3UVEA 4BB5A 4DSAA 3ZZ0A 1PNTA 1FTGA 1X3LA 1ZICA 3OCVA 3U4QB 1QHEA 1DG1G 1S89A 3GEEA 5KFBA 2C29D 4ZV9A 2A35A 1PFVA 2GZHA 1YR7A 1H0RA 1CY8A 2ZP1A 3COZA 3HBLA 3MZ0A 4MNTA 2CV2A 4Y6RA 1M66A 3ZW7A 5C7YA 1OW5A 1XTTA 5IJ9A 1XL0A 2NW6A 3PC7A 4HLCA 1U2RA 1SKRA 1ZM9A 2EXXA 2VSXA 3Q8XB 3UAYA 1FVOA 3DKVA 2B99A 3ZXUB 4EMUA 1VDVA 2A67A 1N4DA 3OCJA 3W5IA 3CNOA 5JSFA 7ICFA 1WU7A 3GLFB 4HZIA 4LE1A 2AXTU 1E2NA 3IURA 4P81A 5FLYA 1QZ3A 1JXEA 4MHTA 1Q46A 2K87A 4ICIA 4IDOA 2KQUA 1YCGA 3CSUA 1M8JA 2SBTA 3R5SA 3U9SA 1W36D 1J24A 1XRQA 3EUAA 4LJ5A 1UF9A 1L8OA 3O21A 1P1JA 1I3OA 5J2JA 4MEBA 4GI3A 1THTA 4M36A 4AYBF 1COOA 2B69A 2VJNA 3L7CA 3IRVA 4PX2A 2AZTA 4WLOA 5H68A 3RYTC 3SC6A 4KQKA 1AN9A 3O2NA 3SEZA 3STHA 5L53A 2ZXEA 1NF3A 1TYEB 1DC3A 3VR3A 3DVAA 2X58A 3LHDA 1YZYA 1MV5A 4KIJA 4Y1RA 1N78A 1XFDA 4WJLA 4L5YA 4RETA 4D3DA 3WE7A 5B6JA 4NYMR 3VJKA 2KYRA 2HT6A 3NXSA 1KEUA 4IH4A 2OPBA 3S1LA 3NUQA 5DT9A 4AO6A 4HQ6A 5D3QA 3ZE0B 2JFVA 2PT7A 2CBZA 3O8QB 4WW0A 1U31A 3V7JA 3ONNA 4ELVA 1QG6A 4U00A 5K6RA 3RK0A 1XEWX 4QVGA 1Q77A 3RYCB 3UJHA 2HWKA 5TQ0A 2AJBA 5EJ5A 1NVGA 1SUCA 1YS7A 2ZOSA 3U4MA 3P1JA 2FPPA 5BVGB 3GP5A 4ARBA 1IG6A 1QRDA 1A9ZA 3K70B 2VBFA 1Z6QA 5AIBA 3QE4A 1SXQA 4YRJA 1NVTA 1RHQA 3KAKA 2O54A 2XNDA 3T38A 4Z9BA 3ZE2B 3DCNA 4F5ZA 3LY8A 4OHFA 4BLTA 3ISDA 2C9MA 3QW2A 1NXOA 3HPOA 4LRSB 5BSGA 1XWFA 5GJVC 3J80A 3CLUC 5HZMA 3IHTA 2F3PA 5HMMA 4N8EA 4ZCTA 1KERA 1SO8A 5TGTA 5BR4A 4MW9A 3U80A 5LJLA 3GLFE 4R5MA 3TR5A 4OQDA 4N9WA 4I2JA 1H23A 1EWVA 1NU8A 2ZRMA 1XK6A 1NBAA 1YZKA 2CYBA 2EQBA 3U4IA 4MKGA 1XOIA 4OIFA 5EZYB 1G7RA 4DMRA 1O94C 1JALA 4WXEA 1VMEA 4XIGS 3BZWA 3PCRB 1U6IA 2EWMA 1UAGA 1DBWA 1YBAA 4RNDB 5FHQA 3G59A 3AFMA 1TM7E 3WHIA 4FNMA 3EH2A 1T9GR 1DFHA 2A4MA 3GEBA 4R63A 5A1TA 3GQBA 4ZQFA 2JCYA 1KAQA 2X5XA 1UXHA 2QTTA 2PLRA 3UWMA 1E7YA 1ZNYA 2I1LA 2Y1IA 2VJQA 3GLGA 2AVNA 2DQ4A 3HI6A 3I2GA 2LMRA 3HG7A 4GM1A 4OJPA 4KMRA 1PT6A 4MVJH 4QUGA 4FN4A 4FWBA 4Y1RB 2QL7A 4BFYA 2Q1TA 4BRSA 1EG7A 2HBZA 3I2KA 2OGSA 3PDHA 1YTLA 1PL8A 3QMWA 3OTWA 5TR9A 3C3CA 1W4CA 4HN4B 1EPUA 1Q14A 4LQCA 2L5YA 1J39A 3FD8A 3MTQA 4P84A 5DBFA 3RH5A 4JI1B 2J6SA 3BS5A 4LYJA 3G0HA 3GUCA 1ZJMA 2XCLA 4Y6LA 3W0LB 5IJXA 7ABPA 3DQZA 1FDSA 4B9EA 3CX4A 1NW3A 3NTUA 4OJTA 1LW6E 2WZBA 5DDIP 4ZRMA 4OIMA 2IDJA 1QV9A 2AOTB 4FHEA 3UMSA 4PQGA 2GRJA 3FBGA 3SR3A 5C4MA 1ZJWA 3S7ZA 4A9AA 3T9CA 5HZHA 1L5UA 1NBEA 2I5PO 2VSNA 3L6RA 2VJAA 2OFOA 1NQUA 5EPOA 3AXSA 4IFTA 4WPGA 4KYTA 4PQRA 2OQIA 2WZQA 3ZWQA 2MDTA 1FNCA 4AG5A 3HE3A 1ZI6A 1O3YA 3E3MA 4TUYF 4XM0A 5JZ9A 1KDTA 4O02B 4R83A 1IAQA 3O0FA 3HU2A 2HH9A 4IDPA 4WN9B 3H9GA 1R8JA 3VPAA 5KFRA 4F8RA 2HREA 2GJ4A 3QXXA 4P4GA 1FTNA 1E7QA 3A7DA 4HTFB 4Y6QA 5I9MA 2F4VB 3BGWA 2BY4A 4N01A 2VP6A 2JLBA 1VKRA 3CNBA 2ZTUA 2R4QA 4OLHA 2A2ZA 1RBZA 3HGQA 3TIGA 3WGTA 2FTKE 3NBKA 4UM9B 1HNZB 1LRJA 3CRQA 3TTWA 1MJFA 1ZJ6A 4QW9A 1ZQNA 2E4UA 2JARA 2B6NA 3HDGA 3L4BA 3N76A 5EERA 5BQFA 8OHMA 3A6PC 2IU6A 4GYWA 5HBRA 5C8YB 4R2MA 2GVDC 2X1MA 2R4TA 2ZI3A 4XFDA 2QQFA 3CZQA 3ISTA 4X20B 2BISA 5AK5A 1QHXA 1VCHA 3MWJA 2DBZA 2YXEA 1UC9A 2NU8A 4A0QA 3C5HA 4PWZA 1TVKA 3CY6A 3KAJA 1O8BA 3OQVA 1SFRA 4H16A 2QPOA 4ZZIA 1N9ZA 4KLEA 3DXYA 3JD1A 3RM3A 3OP1A 3BXFA 3SENA 1FRNA 3L4SO 1P18A 3FDXA 3WB0A 4D3FA 5FBHA 1T8UA 2FEXA 4RH0A 4C0BA 1WF3A 1N2IA 7GPBA 3G8BA 1N6IA 1PN3A 1KZ4A 2DSTA 1MT3A 3M6KA 1EUYA 2EJUA 2ZJFA 1EUDB 4WESA 3RC7A 2NO7A 2H3EA 1EINA 1DINA 2P30A 3SXUA 3BQ7A 4BUZA 3FFXA 1QNFA 3I9V6 2JLSA 2AMVA 4J76A 3KSRA 1XDZA 3LA6A 1HYGA 2X9QA 4Q66C 1F8FA 4X64B 5IZCC 3RSQA 3IUSA 1GZ7A 1VJTA 2PK3A 1YBFA 2PX5A 2CNBA 2HO5A 3C8UA 1NK4A 1OVMA 1PNOA 3DDHA 2XXBA 4LRWA 4MVCA 4D96A 4EGQA 3DD1A 1VGRA 4UTNA 1KRHA 3DKIA 3E8MA 3KE8A 1VHLA 3LV8A 5DLQC 3GZNB 5CYFA 5CJ7A 5J2KA 3OLCX 4GXQA 1ZJZA 3LQ2A 4MV3A 4Q6BA 3T3PB 3W7AA 3TEJA 2HCBA 4F5PA 1J0BA 1KJYA 1JA9A 1KY2A 4N49A 1MOQA 4B2LA 1LC0A 1AA9A 2BGIA 3T7AA 2EATA 1ZKDA 5K51A 5IFKA 2GPJA 1ZMXA 3LLMA 4LXIA 4CMCA 4H7PA 5TARA 1NX9A 4X94A 5T5QA 4PC1A 1OJ7A 4ZDIA 2P4QA 1Y3DE 1ZX1A 5BPCA 3QWIA 4HQFA 3F2IA 2K4IA 1ESEA 4FTWA 3ZU3A 1I32A 1ZD4A 2ZTMA 3K8OE 4JBGA 4ND6A 2BDPA 1Y8ZA 4I8IA 4HZUB 3ZJUA 1TO1E 3HKDB 3WWZA 5JROA 4KAFA 2OV6A 4XR9A 3U3XA 4D2IA 2UYHA 1Y6GA 3GLVA 2KX7A 4ZCMA 2F3SA 1ZA2A 3IHKA 3L0DA 5JTUA 4G9GA 3RK4A 3U6BA 1ZZGA 3OFSA 3OMXA 4BS9A 5DHPA 5B6IA 1CY2A 1FNNA 3A9CA 3AJ9A 4YAEA 4LCJA 2FSHA 4UCQA 5CU7A 2OHIA 1FUYB 1KDYA 3WBFA 4BL5A 4XLTA 4CUJA 5KO2A 1GPJA 3CKYA 2W22A 4AZWA 2KB0A 4R84A 1E64A 5B58T 1G60A 4UHDA 4DR4B 1NXQA 3V1MA 4B09A 3UAOA 1Q21A 3OCCA 8ICMA 1UP6A 2WYHA 3BRCA 4MRNA 4BCDA 2BCQA 2W0MA 4ZQIA 1Z9BA 3AEVA 3JQRA 2ALJA 2FMTA 4KXYA 1QSSA 4DRZA 4Y67A 2D2XA 1BGVA 2QR3A 2YNMC 4BE9A 5JC8A 5AM2A 1RLJA 3OLZA 5KOHB 1KJIA 1TV9A 2PZEA 2PA0A 1NXVA 2YYYA 5EKSA 3HX0A 4XWOA 3IAEA 3SHQA 3ZLUA 2WD8A 2YV4A 2TMYA 3EMDA 1SBHA 2PGXA 3ME5A 4NV3A 3NRJA 4OBWA 4JMUA 4DFMA 1R6AA 2WV9A 4PZDA 5CGQB 5NLLA 5CFQA 1IEWA 2XCOA 3DLPX 3FGNA 3O93A 2E5LB 1YA8A 2F62A 3FHLA 1NJ8A 2FUKA 2V45A 1K75A 3CB4A 4FQ7A 4NE9A 3IIMA 3GZNA 1LTKA 3OM0A 4MICA 4I3HA 2VYVD 2JJYA 4MJLA 2IDZA 3MD0A 5F5XA 2FX5A 5EFZA 4P2HA 1G66A 3PUVA 3G2NA 3V2UA 3TMKA 4K88A 2AW5A 1KK2A 1XHFA 3OQNA 2I4NA 1M5TA 3UMBA 3FN4A 1SAYA 3F2BA 4ZJYA 2C5BA 5AW3A 4Z4EA 1X86B 2Q3BA 3EA5A 1JDBB 1UBEA 4QLOA 1ZO8A 1AQUA 2OBFA 4RSRA 4YT2A 3AUAA 3IBFA 1GWNA 2WILA 2YHAA 4LX8A 3RGWS 1YZFA 2OAQ1 5DRYA 4RA6B 4CLHA 2FKAA 1J8DA 3DYBA 3G2PA 1USVA 1PYOA 5DZSA 1W59A 1J0EA 2C22A 4JODA 5FOUA 3VGJA 5F1YA 1VA4A 2I4IA 4RTMA 1K1QA 4YAFA 5KYXA 4Z4HA 2PGAA 4UM9D 2JLQA 1RQXA 3TQQA 4CUKA 3KKQA 4CPDA 1ZMTA 2H8GA 1T3LA 1CR4A 1UZUA 1AGYA 4IIBA 1RHUA 4LISA 2ZSJA 4DJTA 3DL7A 2OMEA 4CGZA 2OZPA 2H3VA 1HETA 3BFVA 4HS9A 3WAKA 1FB5A 3DMGA 4BGUA 4C6RA 4EFLA 1VKZA 1RKXA 4CV3A 3E9DA 4NYIQ 4F3CA 2G70A 1N1GA 1DARA 1CJUC 1DMRA 1JHVA 1G19A 3GGCA 5TMBA 3OTOB 2G25A 5IKXA 3DAHA 1KS9A 3R09A 1KI7A 4C22A 3ETHA 4AD8A 3BMCB 1WSWA 3KPJA 2C84A 3LRXA 2IYRA 3OX2A 1ABFA 4KN8A 4IIJB 2KSQA 5I8WA 3K4PA 2NO1A 5CFNA 2LKCA 2JEZA 4ZPJA 1NPYA 3RUAA 3WLJA 3TW8A 3ZNNA 2BMDA 1YF3A 2X2OA 1ST3A 1NLFA 2PZLA 1VMIA 5FULA 3BQ1A 2H1RA 4BWJA 1FMLA 3PNSA 2Q0ZX 3HLKA 3BPSA 1GKIA 4G5FA 4UTPA 5L1KA 1BMFD 3C8HA 3DYIA 3KVOA 2A9RA 3LUFA 5TS2A 4Z3KA 5JG7A 4Z0HO 3DONA 5J23A 4MIYA 1N6PA 2XJ4A 3D6UA 3NTRA 3EZ7A 1LWOA 5D5QA 3HXOA 2PH1A 3RC1A 1N1DA 3N7SC 5CAEB 1XTRA 1NP6A 2QLTA 2O3SA 4QXAA 3G5AA 3H13A 4FKZA 1AZLA 1Z5PA 1YR8A 3PI7A 4WNIA 3GN1A 2RGGA 4XOIA 4DLYA 4EVIA 1VG8A 3UMMA 5BOSB 1CE8A 2AGPA 1W8IA 2X23A 5CM8B 2TMDA 2I6TA 4PHHA 4B5LA 2QG6A 1L1EA 4TVBA 2J6UA 1GHTA 3MCUA 3HM2A 4I3FA 1YCHA 5EMLA 3WADA 4NQRA 3PA6A 3AUKA 3GLTA 3IAS6 5LMNB 4WK4B 5DW0A 3TJZA 3A6JA 4RMJA 5L8VA 1YQUA 2Q2OA 1JILA 5L6LB 1UADA 1XJQA 2QRGA 5EWJA 2NSDA 3AU8A 7ICIA 3OQHA 4DIMA 4D8XA 1W9HA 1KAMA 3GGJA 2IV2X 4ER3A 1C9MA 5IJZA 2I7XA 4C0XA 4D3ZA 2A5FA 4MDFA 2EDCA 4XR4A 4F12A 4KPUA 3E9CA 4BQOA 4KLGA 4CZ2A 4LCBA 1KARA 2WZCA 2XQFA 2JEFA 3KR2A 3OZEA 4NABA 1YZLA 3KB8A 1JIJA 1QH8B 2FEWB 3IBYA 3K6RA 4GYKA 4MW4A 4R2JA 4V3CA 5K0NA 1Z4NA 4GI2A 3TMYA 3KKAA 2XVYA 1HZJA 2Q0XA 2I4RA 1NM5A 1MVNA 1SKQA 4X1KB 3RB4A 1AH2A 4UATA 5AVTA 4BJQA 3DTYA 3OY7A 3C3YA 1Z6AA 3H5LA 4FFOA 3JVIA 4C4AA 1TT5A 1B6RA 3BMOA 4R81A 1KXJA 1OTYA 3C48A 3D43A 4Q44A 1Q1NA 5ALIA 2HPVA 3ICXA 5LZ5A 5C1BA 5EXDA 1VKHA 4NZZA 3ROPA 1Q15A 4H17A 3SN6A 4D74A 5KFWA 1QS0B 1G8YA 1T2FA 2CCKA 2YXBA 3TB6A 3DLAA 5TJ9A 5JCJA 4GKAA 4H7FA 2GPBA 2BDEA 1PVPA 3Q8MA 1M83A 2FH5B 1GU1A 3VH1A 4NICA 3VVLA 3W9YA 3WJ1A 1JEYB 3QX8A 5BWMA 1RYFA 4QBTA 4DS3A 2GZDA 4IEEA 4W5RA 2W7PA 1OR8A 2CWWA 3DMPA 3NANA 3VR6A 1MX9A 2R5WA 5CX1B 2ZS9A 5KJEA 2XRZA 1MEJA 3MTDA 4O0MA 1ETHA 1IN8A 3KEMA 3OC6A 2HCFA 4D6PA 2D59A 5EZYF 3RROA 5CAEA 2BP7B 4V2IA 2CDNA 2CJFA 2R1TA 4FR0A 1KZ7B 1CULC 4EDFA 1C3VA 2AVDA 1AUQA 1EFDN 4MARA 2QP4A 3A04A 2O4UX 1M74A 3Q0TA 3IJ5A 1T1IA 4NK4A 5EJ9A 2WJJA 4HJRA 4NMXB 2HIHA 2PV7A 3GVIA 1T9HA 2DAPA 1N7IA 1P0FA 5JANA 1IJEA 1AQNA 2WHXA 2Z5VA 3WNDA 1LLUA 4J8PA 4XCVA 2FR0A 4XWYA 1W49A 4K9SA 1KFDA 4PC3A 1F9EA 4TTAA 3F1KA 1VSBA 3U4CA 3V6JA 2NVWA 4ED2A 4FFBB 1DJLA 3R6GA 1P7VA 1TZBA 5DMHA 1RC0A 4F4ZA 1EA5A 4ZVOA 3VKFA 3T15A 4F5YA 1CUCA 2Z43A 5FPQA 7YASA 4ECYA 1XT6A 2HLNA 3HJEA 2O7SA 2VLBA 4RQ1A 3PRHA 1DJOA 2WJPA 3PQDA 4HUQB 3ZWKA 1XRMA 3ZQJA 2I9GA 3LF1A 4LECA 2VZLA 4RQ2A 2HHTA 1KNQA 4BIIA 2CW5A 4NZ9A 2F43A 1AE1A 3PNQA 3QLUA 2WTAA 3D0KA 3M9XA 1X7WB 4WVLA 1AIPA 3G9ZA 1DFGA 4PZUA 1S97A 5DWQA 3PG5A 3ZDYB 5AKZA 1JT2A 1L5HB 4KLSA 2HBRA 3NAGA 4FD2A 5TPWB 1BX0A 4AWBA 4B40A 2ZJ5A 3WU2U 2Z2IA 4O5CA 9ICTA 1BXGB 3IEIA 2BI4A 4G1CA 1ADJA 3TLCA 4LJ9A 2CXTA 4BY9E 3I5AA 1WCXA 2IWHA 2WY2D 4BWGA 2DWQA 3X2EA 3CEPB 5LN1A 3IMKA 4FS8A 5DQHA 4A7PA 5TB5A 3B1ZA 2LPMA 3FGPA 4XSGA 3ZZMA 3SLRA 4YV1A 5P21A 4GH5A 3UK1A 1D1TA 4B9SA 1AV7A 3TI7A 4CLEA 3SQXA 4C07A 4RNMA 1LRKA 4ZOLF 5CB8A 1DKRA 5EQFA 2HQOA 3TUJC 4YRBA 3BJMA 5I6DA 4IDDA 1J22A 3MRVA 2NRWA 2G9VA 4DIFA 1E9RA 1OREA 2BHRA 4HQOA 2Q62A 1P4GA 2OAGA 2W2KA 3DAOA 4JLJA 2D06A 4PAWA 4RCYA 2NSJA 3QW4B 4J4HA 1NI4B 4UKDA 3RT9A 4IIVA 1SXPA 3H4BA 4YROA 2PZJA 4UCFA 2VXOA 4IIHA 1FSFA 2QTLA 3Q3JB 4ZO4A 2ODEA 4F5OA 2O8DA 3RUPA 2D6FC 5AUNB 2HVIA 4TKUB 4ZYUA 5CEHA 2GK7A 4J7XA 1Q5PA 5F52A 3B7PA 2LD4A 3CWCA 4NECA 4DV2B 1PZMA 3WGIA 1CIJA 1NW5A 1YA6A 4GQBA 3L6UA 3V7NA 2IBKA 1I24A 9ICKA 1EVIA 3KX2A 5CIWA 4G0WA 1BX3A 3FA2A 4G6ZA 4UB8U 4AX4A 1IRIA 5ANRB 1ZW6A 4IUCS 4H1WA 2XZPA 5KSWB 3E8SA 4A8PA 3PUHA 3GQCA 1ZQPA 3S27A 1QTMA 2I4LA 1ONBA 3SJUA 5DTMA 2A8YA 5EKTA 3TFQA 4A8HA 3EVFA 1JSLA 5K2MA 4CDNA 4ND4A 1W88B 3FZYA 1EFLA 3O4HA 2MRLA 1DQRA 3KR1A 4JJ8A 1R6XA 4OFXA 5FEMA 1FFDA 3LKBA 4G56A 9ICRA 1SQ0A 2BBSA 1Z5WA 2PVPA 1KQQA 4L4SA 5KFJA 4FIDA 5C8DA 5CEEA 4HWSA 3N2KB 3D9QX 1TJ3A 1AQJA 3FUCA 3S5UA 1RC8A 1P45A 4DAOA 1NUQA 4J9QA 3CE9A 3HU5A 1K27A 3QLJA 3WFIA 8ICRA 2HLDA 2HI0A 1A4XA 1W29A 4LOKA 1BRMA 4TM7A 1IZ8A 2CMKA 5HUHA 4QUHA 3B8EA 4MUEA 4PLTA 4CLXA 4JENA 4UVGA 2IDMA 3LQ4A 4E6PA 2J6CA 1PFKA 2FMPA 2PT5A 3WKAA 1SR8A 3BB1A 4FCCA 4OB7A 3CUVA 3SBDA 5LDHA 4DDKA 1UDXA 3K5HA 1N5WA 4OGKA 5FBQB 2NWQA 1TUEA 1MG0A 1ICIA 2O06A 2ROQA 5BR8B 1E1QD 1ZD5A 2O2DA 5AUQA 3OZVA 2ID4A 3QLEA 3NM6B 2QGZA 1S8NA 3MCWA 5K3EA 5LWQA 1TOAA 1K88A 7ICGA 1EEXB 1P19A 1PUIA 2NIPA 3E9EA 3KEFA 3P52A 3GFSA 2YY5A 8ICYA 4UUMA 5LBTA 4C6SA 1R4MA 4I4CA 2UDPA 2H5IA 2ZI7A 4HZGA 3IB6A 2LKDA 9ICAA 4R71A 1MNAA 2QMEA 3HEBA 4H7HA 1KDVA 1WUHS 1N2OA 4DWJA 1JIHA 1M9NA 2QN8A <