1L8LA

Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
222
structure length
222
Chain Sequence
b'HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-phosphoserine phosphatase
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8lA01
3E58A 2B82A 2HHLA 2BY4A 2HDOA 4Y2JA 1WPGA 1RC8A 5AKJA 4Y2PA 3EF1A 1Z5GA 5AK6A 2NO5A 1U7PA 1N9KA 1YS9A 3B9BA 2JAUA 2B8JA 3ZI4A 2YJ4A 1Z4LA 2GFHA 4BKMA 3L8HA 2C88A 2X4DA 5ALKA 2AUTA 2O9JA 2EAUA 4BEVA 2GMWA 5AVTA 3M9LA 2YJ6A 3FVVA 3OCYA 2FEAA 3E81A 2PKEA 3U7GA 3ED5A 3L5KA 4UMDA 4UMFA 3DNPA 3L0BA 3L0YA 3QYPA 2JAOA 4EX6A 1S2OA 3HLTA 2G08A 3I28A 4YCMA 2I54A 2ZXEA 3QUTA 2D2VA 1QQ6A 4BX2A 1XP5A 5AIBA 1F5SA 1RKQA 2FPRA 3NALA 3VAYA 3SHQA 5AM3A 2CN1A 4GIBA 4UM7A 4KNVA 3QGMA 1L8OA 5T41A 1N8NA 5AKKA 2FPSA 1RMYA 4Y2XA 3ET5A 3ZU6A 3QX7A 4AS3A 1MH9A 3NANA 3KOOA 2DQSA 3F9RA 4HGPA 2EARA 1RLOA 1QYIA 2HCFA 4KN8A 4EZEA 5ALPA 3L1VA 4NAVA 3I1YA 1Z4PX 3WK4A 4EELA 5ALMA 2I33A 3N1UA 4KX5A 1U7OA 1RMQA 4UM5A 2WFAA 5E0OA 2OYCA 2ZOSA 2ZBFA 3AR3A 2Q4RA 3MN1A 3QU2A 3R4CA 2WF9A 2GHQA 4OD0A 4HGOA 4O8CA 1U2TA 1LTQA 5ALZA 5AVWA 3MPOA 3FPBA 3WK8A 5AVUA 4Y2VA 1WVIA 5ALHA 1TE2A 4J03A 5AW2A 5AKGA 2G0AA 2WHEA 2AH5A 3ZX4A 1VFPA 4PNHA 2B30A 1NRWA 5ALTA 5ALOA 3U26A 5AW8A 2GO7A 4Y2UA 4CE6A 2P11A 3ZVLA 4L57A 3CZ4A 1O03A 1Z4OA 4MUMA 1YV9A 1Z4QA 1PW5A 3OCWA 5AK4A 3ZWKA 2RARA 2PQ0A 2Q4TA 4BNDB 3OCZA 1XPJA 3B9RA 3SLRA 3KC2A 1VJRA 3QUQA 1X42A 3FZQA 3MMZA 1L6RA 5IT0A 4BBJA 4EEKA 2R8ZA 1JUDA 3K1ZA 4GXTA 3QU4A 4F72A 1ZJJA 4NFLA 3W5CA 1YNSA 2FDRA 3QUBA 3UMCA 4UMVA 5AIAA 1WR8A 2QLTA 1VJ5A 1L7PA 4HGQA 5ALWA 3MC1A 1T9ZA 1ZD4A 5AK5A 3WGVA 2ZBGA 1LVHA 3EWIA 5AVYA 1Z4NA 4UAVA 2GHTA 3W5AA 3A1DA 4HAIA 3ONNA 3CNHA 4Y2RA 5AKZA 4OHFA 3W5BA 5ALRA 1L8LA 2WF6A 3AR2A 5AKHA 3NIWA 5ALGA 4Y3UA 3DDHA 3IB6A 1Z4KA 5AESA 3L8EA 3AR5A 5FP0A 2P9JA 2FUCA 3U7HB 2G80A 5ALIA 4EX7A 2HF2A 1Z5UA 4BYGA 2I34A 4UU1A 4BEWA 3NAMA 4KNWA 2B1QA 5ALXA 3I6BA 3U13A 3SD7A 4BX3A 1XVIA 4IFTA 3U7EB 3OCUA 5AI9A 1ZD3A 4L6CA 4NWIA 2CFSA 4H1WA 2YMLA 3EF0A 4L6AA 2P69A 5AW6A 3WKDA 1J8DA 1QQ7A 2FPWA 4RESA 2NO4A 2YBDA 2C8KA 4G9BA 3ESRA 4C4RA 4NABA 2HSZA 3M1YA 3OCVA 2YFYA 1U2SA 4XOUA 3N07A 3KZXA 3L0CA 3EPRA 4CF3A 1T5TA 2RB5A 2G06A 4ZEXA 3ZWDA 4Y2TA 4FYPA 3RFUA 1TJ3A 5A3SA 1TJ4A 5ALUA 2ZG6A 1IWOA 2CFTA 5ALJA 2IOFA 4FFDA 3DAOA 2OBBA 1QQ5A 2P27A 3AR9A 3SKYA 4KYTA 3N8GA 5AKXA 3NASA 2YN4A 4DW8A 1QH9A 3R09A 3QU7A 4CF5A 1O08A 1L7OA 5AVXA 2IOHA 3ZVNA 3ZTWA 2QYHA 3WK5A 3UMBA 2NYVA 3TLMA 1SU4A 3AR8A 2RAVA 4OFZA 2IOFK 2B0CA 5AVQA 3NRJA 2ZBDA 5AICA 3S6JA 4ZEVA 1CR6A 3SKXA 2BDUA 3UMGA 5AW7A 1KYTA 1Q92A 1ZD2P 2C4NA 5ALEA 3WKBA 2OM6A 4XQ0A 4HGRA 3I76A 3IJ5A 4XE5A 2WF7A 3A1CA 4Y2QA 5AW9A 4JB3A 3P96A 5AM4A 5AW0A 2Q5EA 1AQ6A 2YMQA 2G09A 3FPSA 4YCNA 3SMVA 1Z4MA 3U7FB 5AHXA 2AGVA 4ZEWA 2I55A 3BWVA 5AVSA 1CQZA 2R8XA 3FGOA 3KDPA 4QQFA 3OTQA 3WKCA 3E8MA 4J2TA 3ZW7A 5ALVA 5ALNA 3J7TA 4JDPA 4UATA 3WKAA 4F71A 2YJ5A 1ZRNA 3ET4A 1ZS9A 3A1EA 1Z88A 2G07A 1Y8AA 3ZX5A 2MU1A 2HOQA 1EK2A 3AR7A 2JAWA 2W11A 1ZRMA 2FUEA 5AM5A 1FEZA 2AMYA 3SF0A 4CNQA 3N28A 1RMTA 1RLMA 5ALYA 4HYTA 4DFDA 2JGAA 2EATA 5ALQA 1Z4JA 4QJBA 5ALDA 5AKIA 4YCLA 4YGYA 3U19A 1U02A 5AW3A 1K1EA 2IYEA 5AKEA 5AI6A 2RBKA 3L8GA 5AM2A 2YMPA 4DWOA 5AVRA 4AP9A 3PGLA 4HGNA 3NUQA 3AR4A 3AR6A 1SWVA 1RRCA 2YY6A 3R9KA 2ODAA 3ESQA 5AW5A 4DCCA 4UU0A 2IA5A 3B8EA 1RDFA 4IG4A 3WGUA 4BX0A 3BA6A 3DV9A 4RETA 2OA0A 1RKUA 3ZUPA 3ZVMA 2FI1A 5AI4A 3QUCA 3ZTYA 4FE3A 2G1AA 3PDWA 4YIHA 3QXGA 4G63A 1NF2A 1J97A 5AK3A 1ZD5A 5IT4A 1Z4IA 1YJ5A 3W5DA 5AI5A 3L1UA 3QNMA 5AI8A 2W4MA 3HYCA 1RKVA 5AM1A 2C9MA 3UM9A 1L7MA 3QU5A 5IS2A 3QU9A 3OCXA 1TA0A 3D6JA 4UAUA 1RQLA 2HEGA 4CF4A 4C4TA 3E84A 5AKLA 3RF6A 2CFRA 4UASA 5AW1A 3PGVA 4EENA 5ALLA 1YDFA 4YH1A 3FM9A 3GYGA 2PR7A 3KBBA 4YIKA 2I6XA 4I9FA 4UW9A 2FPXA 4Y2YA 1NNLA 2C8LA 1TJ5A 4I9GA 4NV0A 1RPZA 2B1RA 2MSNA 3PCTA 1S8OA 4UARA 3A3YA 2YMMA 5ALFA 3KD3A 2I7DA 5AI0A 4E88A 2HX1A 4C4SA 5AW4A 4UMEA 1SWWA 5AKYA 2VKQA 3OPXA 1RLTA 3WKEA 2WF8A 5A3RA 1WZCA 4KX3A 4BNDA 5JJBA 1EK1A 3QLEA 1Q91A 2JARA 2WF5A 5AVVA 3WK6A 3L8FA 4OCZA 3WK7A 1ZOLA 1RQNA 2FPUA 2HI0A 5A3QA 2R8YA 2HO4A 4Y2SA 5AM0A 2R8EA 2BDEA 2B8EA 2O2XA 4AS2A 2ZBEA 4XPZA 4B6JA 1T5SA 5AVZA 3L7YA 2W43A 1L7NA 3IRUA 3N5KA 1YMQA 5ALSA 2HF7A 4MWOA 2YJ3A 2WM8A 3WK9A
chains in the Genus database with same CATH superfamily
1PZMA 3K4PA 2PO7A 4HSGA 3EF1A 2JGFA 3GL9A 2GT1A 3X2SA 4CIDA 3ETCA 3H9JA 1EA7A 3W05A 1MT3A 8ICFA 4XUSA 4F4KA 2PUCA 1I4EB 1WZ2A 2M2IA 4D0NA 1N6OA 4Y6LA 2FY8A 4FR2A 4F45A 3VR3A 2YDYA 3A3KA 1UWVA 4KBFA 4BP9A 4A03A 5AQEA 3E2PA 5JSKA 3Q8LA 1HUZA 1H2FA 1OWOA 1T5DX 2FPRA 4GIBA 1UM8A 1L8OA 3JD4A 1WY7A 3EVNA 5FFFA 2DQSA 1ESZA 4FX5A 3KYBA 3JVEA 1N2OA 2O2YA 3SJAA 4AZ0B 3KO8A 1C2YA 5KBYA 4NYMR 4GSKA 3ICXA 1E9BA 1R3DA 5KQLA 4JK3A 1PWEA 3L8DA 4S0XA 3CN9A 1XRPA 1HT3A 1EHYA 3O8QB 3T52A 1AUQA 2IY9A 4IQ4A 2QORA 4P86A 1ADCA 1VGVA 2RGXA 3ANXA 3WDMA 4TS3A 3H18A 1Y3CE 3MXOA 4MI9A 4I1PA 5A0FA 1ZXBA 1IUPA 2Q6VA 5J2IA 2Z1DA 2M1ZA 1ZJ5A 4I1OA 3JPQA 4Z86A 4BHTA 4PC3A 4GDFA 4QRDA 2Y1FA 2XUPA 4J7UA 3ZK9A 3I8OA 2QZ4A 1E89A 1G7CA 3FSEA 2HJSA 1K86A 3QE9Y 3DC7A 4FGWA 2Z98A 1MFPA 3RSQA 1PL8A 2Q8PA 1WE2A 3ZHOA 4YT8A 1XEFA 5IK2A 2HSZA 3KFLA 3G8BA 3ED1A 1I36A 3KE8A 2QI9F 4YRPA 3TNDA 3O8RA 3CLHA 4DQ0A 4MI3A 3BRCA 3CNQS 1HG0A 3A2MA 1TCCA 2AWNA 2VTDA 1P73A 1OHHA 5KNCH 5I7RA 1HFEL 4YMOA 1XTSA 4GECA 4V1CA 4N7BA 4YMWA 5AVXA 2H92A 3LZ6A 5C3MA 2D7DA 3ZH9B 3T3FA 2H07A 1PR0A 5H02A 3GRZA 3DCNA 3OTIA 3HO8A 2D0DA 1KK0A 2H9YA 1KJIA 2Z6VA 3LQFA 3T5CA 1N3IA 1QVWA 3WBBA 1L5NA 3D5QA 4C6TB 3C7TA 3A36A 1X9GA 2OVFA 3LE8A 3LQRA 3PSFA 3LL7A 3Q9NA 2AI1A 3FF4A 1IOLA 4QATA 1P1RA 1ZLXA 1ZOPA 4AN0A 4RADA 4JQZA 3DBLB 3OSZA 3I2JA 3K05A 2EX0A 2W6PA 1FSZA 1QIHA 4DUYB 4TKMA 2CJWA 1KFSA 3B2QA 1X1BA 4RANA 2VDWB 2XE4A 4QX6A 2A9OA 3EEOA 1FLDA 1M7BA 4YI5A 3HEBA 1WXGA 4MR8B 1YT3A 2V4QA 4MQEA 4F9GA 4CM6A 1GSHA 2XKAA 2M9MA 2GZAA 2ZTDA 1CR2A 4H15A 1YRBA 3QUCA 3I32A 1XZQA 4DOCA 3H3JA 1Z06A 1YAHA 3G68A 4AWBA 3RRFA 3DB1A 1QHHA 3P97A 3LXXA 1NA5A 3QYJA 2IYTA 1ISPA 2C5LA 5B36A 4B4OA 3NTVA 3BZBA 1W6RA 4ITUA 1HEYA 2P7HA 3PCTA 1BXRB 5FQOA 4QYIA 4G4SO 4A0QA 4N7RA 4L9SA 4EG1A 4XA5A 4I50F 5B1YA 4YR3A 1HWYA 3H42B 2WFMA 1C3VA 1SQ6A 1DC6A 3FD8A 4Y1RB 3A4YA 4KMRA 3A2LA 3HYNA 2NUTB 1Z1VA 4B3XA 2CSXA 3SSMA 3DUFB 1PE0A 4PRYA 2WWIA 3O8OA 4QVKA 1FTWA 3NP9A 4EB6A 1FFXA 3DB2A 2W2PA 4ND5A 4EZIA 2PUDA 1OAAA 4REQA 1TJYA 2WLTA 4CQMA 1KYWA 4BNGA 5A9SA 3GN2A 3TLKA 5J5CA 1ACJA 2IIVA 1AVTA 4N03A 1NMXA 4DIUA 1H4VB 3FBGA 1U1DA 1AHPA 4EGCB 1GKLA 3HMKA 4Y1FA 3JPNA 2JXJA 1J7JA 1P0IA 2YN2A 4FOLA 7GPBA 1KWGA 2P79A 1Z5OA 3RFCA 3UATA 4ILKA 1E3DA 2I1QA 1XUOA 2XGGA 2P62A 4X1KA 5C31A 3V1LA 4Z2AA 1KDTA 3IAM6 5GJBA 4MV7A 3NONA 2NAFA 2ZUFA 3Q7EA 4Q19A 1CYDA 4US8A 1IZ8A 3AVXA 4F4ZA 5JFGA 2ZUBA 3GDHA 1A72A 2ZT6A 5I8ZA 2QLFA 2FV8A 1SBYA 3IYLW 1B43A 5H3CA 1ZI9A 1SU7A 3Q3HA 3G0BA 8ICTA 4OQFA 1NI5A 1QZ3A 4WLEA 4F4YA 3PYXA 3V6MA 4MQBA 4WK2B 3UWPA 3UJ6A 2PXXA 4PANA 4HK4A 2NUPA 2W4QA 4RZRA 2PUEA 1BSVA 1LDNA 9GPBA 3GRVA 2A2ZA 4RPGA 1E1NA 3L40A 5ESXA 4KLQA 4LJKA 3S1AB 1YF3A 2HIHA 1I1OA 3RABA 2VWQA 5FOUA 3OOYA 4ZI7F 5LMZA 4L78A 2XADA 2O20A 3F6PA 2CY0A 3L8MA 2ISCA 1H5QA 4YXFA 5LZ8A 1CUVA 1PW7A 4RTPA 5KC8A 4TKZA 5JS7A 3KB8A 4FYWA 3GNQA 1KF0A 5KG1A 2VNKA 1RJGA 2Z8ZA 4EHIA 1OLOA 5CIYA 2PUFA 5G1NA 4FLMA 3CRVA 3CLRC 3ZNQA 3OWOA 4ZODA 3M5CA 4J07A 1XYGA 3KJIA 2EV9A 1MLDA 5JHHB 1YVDA 4W63A 3Q41A 5T64A 1QQ5A 4BGDA 4HN2A 4MUXA 3TGLA 2W6JD 4BKOA 3Q8QB 4N9QA 4JITA 1JFFB 2SCUA 2H29A 3DE6X 4C7OA 3H2BA 2N1RA 3OZIA 4EZ6A 3PTAA 3UPUA 4FBTA 4WI1A 4MCAA 3KZCA 4KE7A 1IH8A 3NHMA 1W36B 4H3KB 3B6MA 2ACEA 1D1TA 5KSOA 4TVKA 1PLKA 3W5HA 2QB0B 4XM1A 2AF3C 4IQWA 4CKXA 3OZVA 1COZA 1NX6A 3ESYA 3QG1A 1ZS9A 1LXCA 2DECA 1VZ3A 4DPKA 5B3JA 3Q8RB 4OJQA 3VJLA 3FGZA 5E6UB 4G9GA 4ED8A 3KUXA 1BX0A 3HZHA 2A86A 4K28A 4ZVQA 3BFVA 3H4VA 3FPAA 4N6GA 1RG6A 1NYTA 4F4IA 3BHNA 4ZCIA 2C54A 1ZWLA 1T35A 4EAAA 4QBGB 4Q12A 3KUKA 4ZVVA 4MVJF 2XY6A 4IOLA 2W4MA 3BEOA 4JELA 4CT4B 2DGZA 3MS4A 3K2IA 3VO2A 3WAKA 4EW3A 3PHHA 2B6HA 3PNLA 4H6WA 2WTFA 5IKXA 3PYMA 4ZMBA 3TWOA 3AERA 1XPOA 3TOCA 1Z68A 4IIUA 1Z6GA 3OSNA 3UFBA 2ZEJA 4MYRA 2X9LA 1JQDA 1EVKA 3OZTA 4BNHA 4Z6CA 5JS6A 3GFQA 3NIDB 3H5AA 5JIBA 4OLFA 2GNAA 3L2OB 1EESA 1ADFA 2KX7A 5HMMA 2PMZF 4KG7A 4NV3A 1H5NA 5AOVA 3R0VA 4TURA 1E79D 4FYXA 1KBQA 1EDOA 1RPAA 1SVMA 4EKNB 4QXMA 1II8B 3PF8A 2ORYA 3TOXA 2Q50A 3I9V6 4YRGA 5BWMA 4H27A 2KJ8A 3OCYA 3B3AA 2XC9A 3VR4D 4YUVA 1RXVA 1P1JA 5CCBA 2WJYA 1VLLA 4D3YA 3NALA 2XD9A 3NDBB 5CD9A 5JS1A 4QDTA 1T8SA 2J31A 5EJGA 4JEIA 5JPIA 4WD3A 3E9QA 1Y3AA 1YR2A 3UJDA 3RFAA 1RAEA 4OU4A 1H2YA 3CY6A 2ZOSA 5HHHA 3FIUA 2XI9A 1VPLA 5F7ZA 2PD6A 2DJIA 5AKGA 3PSTA 4QASA 3T1TA 4OMCA 4REMA 1TPZA 3VHXB 4BNTA 3TUZC 4BXOB 2BLNA 3QIVA 1T0HB 4C76A 1GZ4A 3D0RA 4MIYA 4DCSA 2HUNA 2RG7A 3IMKA 5CVVA 4Q34A 1SK8A 3EFHA 3K1ZA 1WCXA 4ENVA 3O0FA 3VPSA 5IMSA 2AJTA 3THOA 4ELTA 1E58A 1ZD4A 3EXFB 3IOBA 4NJOA 3BQ1A 1NWCA 4MWEA 1RIFA 1UPCA 2ZULA 3HE3A 2GZMA 2WIFA 5ALGA 2PLWA 2Z2KA 3C8MA 4OOFA 5AR1A 5C4MA 1NMQA 2Z3ZA 3EC1A 1Z5UA 2ZIUA 1IAQA 3PA8A 5ICMA 4LYJA 1DBWA 4X9XA 4QPZA 2C3PA 1RWOA 4ELUA 1E1CB 3DKRA 3FG9A 4DEXA 2W6ID 1MTZA 4J9UE 4N0DA 1J8DA 2BUCA 1VMIA 5FWYA 4DL2A 2D1TA 4MROA 3C4VA 2BGJA 3AO0B 1H3FA 4DR4B 1LK0A 4RNDB 4KQ2A 2PDAA 5EIAA 2JFXA 2FVXA 3CVVA 4EUHA 3TECE 5DTEA 3O3CA 4C4XA 3L4BC 4IL5A 3W5VA 3WNQA 4RIIA 4CIWA 4U7CA 3BK2A 4OATA 1HE2A 3X0DA 1Z15A 1DQNA 2CE7A 1MDBA 3W8NA 1SELA 4X97A 4XE5A 5J0SA 4BE9A 5E9JA 4G0ZA 4NG5A 5EJ2A 4LJYA 1RLUA 2PGOA 2Y9PB 3WGIA 1CE8A 2BWJA 2DL0A 1HQDA 4R40A 3VYVA 1JG7A 3J7TA 2G9UA 2ECPA 3K7EA 3RV4A 3B36A 4FONA 3GNLA 1NFRA 1GQFA 1DADA 2Z6UA 3PEYA 4JBGA 1PS0A 1FW8A 5FLKA 4ABTA 1YAJA 1EDEA 2WJAA 1F0KA 4QUAA 2RAUA 2QL6A 3QP9A 3JCZA 4H1HA 4NMXB 4EY8A 1CBUA 2O3QA 3HILA 3DUWA 4FYIA 1PWZA 1PO7A 1OZ0A 1E6KA 2ZVQX 1N6NA 3K4GA 2OORA 4ZVSA 3RS4A 3N97B 3BTSA 3SNKA 3WSVA 1BCSB 5IBQA 4OBWA 2DM6A 1ZD5A 1IOWA 1U0OC 4WFJA 4EO7A 4C5BA 1QVZA 5DBFA 3S1LA 2OZEA 2GVNA 3D8SA 4H6XA 4JR1A 2BONA 3K0SA 1B2LA 5GIOE 2QMUA 3RVOA 2ORED 3ITDA 4CM7A 4MHVA 4NLBA 3KQUA 4NV0A 1UBGA 4HQLA 1HL7A 3WLEA 1TPYA 2YMMA 4D46A 4MUJA 4OUKX 3DXZA 3RHTA 4DCGA 5BNIA 1CDZA 1GYQA 4PLTA 3R9IA 3G59A 4NHOA 1EB9A 3HYSA 1C8VB 1EP9A 2C2YA 4KFRA 1FMTA 1RHRA 2OAQ1 1QRTA 1QG2A 5HJ5A 5JASA 4DDKA 4I5EA 5HKBA 4MB0A 4POAA 5DU2A 2CXOA 2QIOA 5KNLA 3OIFA 1C8BA 2WICA 3PT5A 2ID9A 4ZI5A 1LDYA 2ATIA 5DGCA 1PJLA 2EAUA 1U7UA 3O84A 3VSCA 2PMEA 1TQ6A 1JROA 1HOXA 5LWQA 1XNRB 1HZJA 4C0LA 1SMKA 1Q7GA 1UKEA 2ZIVB 2H3VA 3L0SA 3MELA 4EI7A 3FB4A 1P1CA 2HO5A 4PZ0A 3U09A 5ICFA 5BOVA 1FNCA 1GZDA 2CJPA 1QFYA 1XLVA 3N4MB 3B0XA 3MGGA 1PK3A 3M81A 1YZUA 3WLFA 5H16A 5FL7D 5ALOA 1Z39A 1MNQA 3QEMA 1I2AA 3IAS6 3MAJA 4P4LA 2PL3A 5YASA 2OHFA 3GLKA 3KFUF 1VPTA 2PYZA 1FVXA 4GI5A 3K6SA 2ZYUX 4BJHB 4GMHA 4I5IA 1D9XA 1BWPA 4TQAA 3DWGA 2BTQA 3EZ6A 3G0HA 2JH8A 1DMRA 1PBNA 4MV4A 4K5QA 5D8DA 4BX9C 2HXYA 4QVIA 3MCWA 1NUQA 3C2MA 2X77A 1R5OA 3WO1A 3IAHA 4LY0A 3OQPA 3PQ3A 2DBQA 1J9GA 5F5LA 2ENWA 5KSWB 4E5MA 2QG4A 1XTIA 1SL2A 3MTDA 3AUFA 3FTQA 4GGOA 2P2SA 2OGTA 1UQUA 2H48A 5LFAA 2FUCA 4B2IA 3U4IA 1SKSA 1OFUX 2A1AA 3V1YA 4DV7B 2ORWA 3ISTA 2W2QA 3OE7D 1JQBA 3PSPA 2DB3A 2XMDA 4ZT3A 1Y88A 3QWBA 5KFUA 2D4HA 2K5UA 2QRJA 3NEJA 3I12A 1YFJA 4EIWA 1Z7BA 2XDAA 3BORA 2IYXA 5A7GA 1LQTA 2VXCA 4FFDA 3TTYA 5BOMA 2B7BA 2ETXA 3EDCA 3R7SA 2WSLA 2AEJA 2X7JA 2MAXA 3NT4A 4R1MA 4PYLA 3LBYA 1XO0A 2H5XA 4M86A 1TAGA 3TOVA 3EDMA 3Q8PB 4CKWB 5EZQA 1XNHA 1CJTC 2RH5A 4JGIA 3WOVA 2I1LA 2ZM5A 1VDVA 3T5HA 1I32A 1ANKA 1N2IA 3RUPA 3A25A 1BU8A 4RSMA 1Q1BA 4M88A 1G6HA 2A35A 3E4CA 2G4LA 1I9GA 3AP1A 1X1DA 1UK7A 4ZU1X 3KZ1E 1T1IA 1KKXA 3AF0A 4QZVA 1U1IA 1SXJE 5F1PA 2Q5EA 3FPSA 4B76A 1Y3DE 3O03A 1R0XA 1PYOA 3AM3A 2FQYA 1Z9BA 2GJSA 4QPNA 4F71A 2EJVA 2FSPA 5E3IA 2IH2A 4NHEA 1Q5PA 3WAJA 3E3MA 3PIIA 4FOOA 4N48A 1E9SA 4BFTA 4U7TB 2AF4C 5EMKA 3RYHA 4WBNA 4GLLA 3VPHA 4OIFA 1G7RA 1Y1SA 2B9VA 1D07A 2B4RO 3EZYA 3C3WA 3PR3A 2WAAA 4LMAA 2PZMA 1L4KA 5ESRA 3EWSA 2FG5A 4H7EA 1E0AA 4D92A 1OV6A 2RG1A 1SHKA 4V1CB 3G8DA 3LWBA 1OPXA 5K4LA 5EQJB 3AUXA 4FMBB 1ODFA 2GJKA 4R9UC 1T9AA 4YDSA 4BLWA 2VHWA 4U6PA 4UCXA 2RB4A 1ELOA 4NZPA 3U4GA 2HZ7A 1R27A 2FFHA 4MS4A 3MS2A 3A4TA 1XXHA 5DHFA 1JQAA 2PQ6A 3JSXA 2M6KA 4HRYA 4FQ8A 3CN7A 2QTBA 4KXXA 1SA0A 4EEZA 2WYOA 4BQNA 4DIOA 4KPUA 3PF9A 4JB2A 1Q91A 2ATEA 2HA0A 3I6YA 3ONDA 3CX4A 4MA5A 4ZN6A 2BFFB 2EQ5A 3P27A 5A3QA 3RVLA 4KLNA 1IQUA 3AW9A 5J0OA 4AZSA 2C2XA 4CEIB 2CJWB 1AUPA 4NXMB 3RW9A 4H60A 1G8GA 1YMQA 2IEIA 5ELXA 3IHWA 8ICSA 3EVZA 1UHUA 3BGWA 1ECGA 2C00A 4MRMA 4MQEB 1RYDA 2CCGA 1Z4LA 3BRWD 3QQPA 4C4ZA 3OJUA 4WLOA 2FEXA 3FVVA 4DUGA 1A1VA 2H18A 2REBA 2DQ4A 4ER0A 3ED5A 3C3CA 1A76A 3MR3A 5DB9A 3WMRA 3KV3O 3QK7A 1MQ9A 3ISDA 3VX4A 2QZJA 2VZ8A 3AP3A 4C0QC 2OAP1 1HRDA 4NCKA 3VRHA 3MTIA 4QTYA 1S0MA 1Z4PX 1PFWA 5ALMA 4G24A 3TDNA 5FTWA 2YFQA 4WKGA 4ZO8A 3AR3A 1NE2A 3ECAA 4EUNA 2YXNA 4UPDA 5DYGA 4G26A 2R1TA 4PNHA 4QYIB 1ORRA 5IDVA 3JVIA 3ZHXA 4QHTA 4P4GA 1N1GA 1KO4A 4NOKA 1OV4A 4WK0B 4EHAA 5GM2A 2PFNA 1BEEA 2O06A 3O8OB 2WG1A 4BFSA 4EB6B 1FFXB 1CUKA 4FBUA 1L7PA 1QHSA 1YZGA 4CQMB 5K0FA 1TM3E 4LHEA 1PK9A 4OK5A 1HE8B 2DUNA 5A9SB 4UAVA 4OQEA 2VAVA 1XG5A 3AR2A 4G37A 3ILSA 2F76X 4HDOB 2IZZA 2D1QA 1PJZA 1KGSA 2RCNA 4MV9A 4BECA 1E6CA 5J29A 4ARIA 3GAZA 4FKZA 4PLPA 2JGIA 2UZ3A 1RZVA 1KDZA 3PENA 2A1JA 2XQKA 3NGLA 1PJ2A 1FVOA 4KODA 4X1KB 4MQ4A 2H4JA 2E0IA 3IRVA 1E2FA 3RSFA 3L7CA 1Z6ZA 3JD0A 4Z7JA 1VG9B 1N1MA 3BPSA 4L8LA 2A9JA 3FPFA 3CE9A 5JISA 4TL7A 1FU4A 5BQFA 2Y0CA 1JVBA 4B7UA 4LDQA 5SICE 4K4HA 4CF5A 3WU2U 3CSSA 3IOMA 2F9MA 2IIQA 4QBFA 1O4VA 2NUPB 3HBAA 3WGLA 3AY0A 1OI7A 1RTKA 1NOIA 2XVYA 2H7XA 3OCCA 1UPAA 4FZ3A 2C2GA 4ZZIA 5K0NA 2VUHB 1EVYA 2Q6TA 1THGA 5ALVA 3EZXA 2PWAA 4TV9A 3D4LA 2CLEB 2JS7A 2P0YA 4A0RA 3LOUA 3AR7A 1LC3A 1E2DA 3LFUA 1K1EA 4M9NA 4P7FA 1J7KA 1N3LA 1NE7A 3L43A 1R5JA 1I7LA 3HBMA 3HZZA 4IRUB 4NDNE 3OU2A 1NQOA 3GV0A 1FQJA 4TLMB 3GPBA 2RKOA 1OFVA 1UINA 3MJHA 1GTL1 3GUVA 5ES3A 3REGA 1JAZA 4YIHA 5KFAA 4PHFA 4IIGA 5KB3A 1ZK3A 2SCUB 1XZKA 1RKVA 1W4LA 5DK6A 3RIYA 1OX4A 4RSRA 2G04A 4LYEA 5HA5A 4C7OB 3A32A 2WJWA 1CB7A 5K0ZA 1JZSA 1OJLA 1T6NA 2IYWA 2QPAA 4UASA 5KTRA 1BDHA 5IHPA 1YDFA 1YZFA 4X8LA 5CW2A 1AS3A 2PR7A 1E9EA 2IPLA 1F38A 2QNIA 1F6BA 4IJWA 4OU5A 2V4MA 8ICYA 4LOAA 3A6LA 4UPEA 5K6TA 3USES 4IH4A 3JTMA 3ZE1B 7ICGA 2R5WA 4FGKA 1PJAA 5DNAA 3AI7A 5DBBA 3KKOA 1WPQA 3T15A 4RZXA 4WMLA 3K35A 3S68A 1E92A 1EVEA 1GAWA 3VR4H 2XNKA 5DVZA 4BNXA 3CUVA 1N0VC 4N0PA 1W25A 3PD0A 4K9PA 4K26A 1Z5GA 4MI6A 1WRBA 4J16C 3ONFA 2I29A 2C78A 4O5KA 2PSSA 3C3XA 4CM9A 1GYRA 2ZRQA 3I6MA 3BWXA 1OVMA 1DWUA 2PBLA 3FR8A 2BJHA 1UP6A 1PX0A 1JJIA 2XNCA 1PJTA 1XKQA 5EWGA 1VYVA 1EWRA 2NIPA 4IHKA 1FMJA 1ULAA 3KM0A 2ZWAA 2HQBA 2AXNA 4DIMA 2X4LA 1KW4A 2BH2A 4H59A 1LVUA 4URXR 2WF9A 2Q4DA 3AERB 4EA6A 4GBJA 2WDZA 2QUBA 3OCWA 3THXA 2V7WA 3I5XA 4K8OA 3NM4A 2UZ0A 3ETHA 3BF8A 1VJRA 4NU6A 2WMYA 1Q46A 3CLUC 3DE4X 5D6NA 1YD7A 4EEKA 1XF9A 1DC7A 3VR5D 1RAAA 5KT7A 2Q62A 1JF8A 1XZBA 5FBVB 4NBKA 5EZ5A 4AJNA 3CLUD 5F3WB 2GARA 3EWIA 4DJEC 2O5CA 1Q0LA 4G85A 5JXGA 3M6FA 1QRRA 1CX9B 4I4TF 4KC0A 3Q5DA 3NH6A 1QANA 4PNZA 4S2UA 1MVNA 3V4ZA 1LJUA 2JFGA 2RJ3A 1NBMA 3TI7A 1E0SA 2XB8A 2QI9C 1DI0A 1WEHA 2UUOA 4ZYYA 4KYIB 2CF5A 2YIDA 2CLMB 1JN3A 5LCXA 5AW6A 1VHJA 5KMGB 3M6MD 4TVSA 4PW0A 1RS0A 2PMFA 4K9DA 2O2HA 4YRSA 1YDGA 1UDBA 3RRYA 3M6ZA 4CTKA 2G06A 2G8LA 2P6OA 4OHZA 4ARSA 3HN2A 4AX8A 1NLZA 4FDVA 4H1VA 4BZXA 3H2IA 5IRCD 1IRIA 3Q3GE 2MOKA 2QTZA 1KDPA 4DO9A 2XMSA 2EBUA 1ODLA 1OTHA 2UVRA 1KOJA 3HKBA 1NKCA 1WLSA 4WOCA 3IE0A 1DJMA 3RFVA 4K40A 4MYHA 5CDYA 3EIOA 1ZGHA 1IXKA 3IDQA 2KLBA 1KJ8A 4ZRNA 3R1IA 4MUBA 4J3NA 3UXYA 3IP9A 1Z4MA 3EIXA 3EVFA 3R40A 4TSRA 1TU4A 2KIWA 3FPKA 3ZN2A 3FOWA 2V7EA 2XGSA 1R0SA 2Y4OA 3PX2A 4HYTA 2O4UX 4J4TA 4HD8A 3JU3A 3O92A 4EG0A 4DAEA 3ZE6A 5FWYB 3ZWMA 3CUEF 1BWSA 4GKJB 1PEYA 3T7SA 4G0PA 3GFBA 1IMJA 1BDJA 4CL2A 4MIOA 4JP5A 1HDIA 5JSFA 1SNYA 4MUYA 2V4RA 5DT2A 5P21A 3QJGA 2EGGA 3ZV3A 2P2LA 2C4TA 2C4MA 3GEPA 1W52X 3ZCUA 5DYIA 3BL6A 3LRTA 5FFNA 5AVOA 4RVHA 5A4AA 1N5KA 1AA9A 1WPXA 5DASA 1E2EA 3GDGA 1SC9A 3MERA 3HCNA 4YI3A 5DYWA 4DNPA 2EFCB 2MR5A 4W7IA 1AZLA 3CISA 3TBKA 3H13A 3N53A 5CA0A 1N77A 2CL7X 1MEOA 3D7SA 1CE8B 5F78A 4JCCA 3TNFA 3OCJA 4H0CA 3CBQA 3MCTA 3ZV7A 1KVTA 2Q4OA 2W9BA 1U1FA 1BD3A 1OXKB 4JI0B 1M74A 3K6RA 5BV1A 2VBIA 4LHZA 3ZV5A 1QV9A 4DRXA 4GYJA 5BXYA 2VPWA 5HK8A 4HWRA 2XZDA 4NZYA 3O21A 4BFZA 4UFOA 4LWOA 3SJ7A 3NWBA 3HX0A 1WMAA 1RPTA 2GFQA 2HQSA 5D4BA 1DRJA 2EIHA 3W7BA 4YNBA 5L7WA 1FJHA 3FF1A 2X9NA 2CNWA 5HBGA 3LP5A 3IIJA 4HZUA 3U0BA 1O97C 3M2TA 2DWPA 3WK4A 1Z29A 1J39A 2PIAA 1LTKA 5EIOA 2VS1A 2D0IA 5EUBA 1HQYE 3ZQ4A 4FZNA 5DEIA 2XUHA 3VH4A 2TSYB 2E8PA 1O97D 3ZTTA 4RV4A 1YA4A 2WA1A 1U28A 3I8SA 2WFZA 1J24A 2Y0SF 2W8LA 4GQIA 1NVTA 2QY6A 1RHKA 2PCJA 2FOLA 2XV1A 3RLIA 4BLUA 5DF1A 2LZ0A 5K4AA 4YRBA 4I2GA 4OQPA 4ECEA 3B1VA 2A3VA 1WKCA 2INGX 1KTVA 2WIJA 1W75A 4N5HX 4HLNA 2Q9BA 4A23A 3H1BA 3LKVA 4IAOA 4C06A 4PZZA 4JJIA 1F8UA 5DXFA 3L0IB 4U7DA 3A2KA 3H6HA 2ZUTA 1EX1A 1P19A 1QCDA 1JX6A 1G6KA 3UJCA 2QV0A 4NH4A 2QN9A 2WJVA 4L0CA 4OHFA 5CPBA 1XLWA 5M7EA 1PT7A 3PQDA 3CVWA 1COOA 4ZDWA 2P9TA 4RLSA 2Z58A 1XEXA 1A9ZA 4CKEA 4G0VA 1J4AA 1UUFA 3JD3A 5HM8A 2GSWA 4WECA 1EFCA 1GCGA 2VP5A 3EPPA 4WDQA 4L6AA 4F21A 3OX1A 3TQTA 4JP1A 5G0TA 4F8EA 1VMKA 2HADA 5JYDA 1TAQA 1QFSA 3KIPA 4M2LA 2Q3CA 1KI8A 4RLQA 3H5WA 3DBHB 3QEMB 5KAMA 2QBYA 3GJTA 4FE7A 2YICA 1XCPA 4NIMA 3NP7A 4J90A 5IN4A 1XMOB 2P4EA 1Z75A 1JWLA 2X5NA 3FLEA 3WG9A 2P40A 1GRNA 4OFZA 5BW4A 3D8NA 3PC7A 4UZSA 3IH5A 2VRCD 5AHRA 1M1UA 1PJ3A 2BMJA 3GRFA 8ICMA 1QUFA 3QVSA 4JWTA 5H5JA 2EZTA 2C98A 3A1SA 3VKHA 4ETWA 2YZMA 1SOAA 3WAGA 5E1MA 1ZFNA 1PUXA 2GTHA 2F8KA 1NZPA 1UIRA 4GPAA 3RRGA 1GGEA 1H42A 4M55A 1K1SA 2J9ZB 1ZY2A 1BJRE 2WT9A 1KS9A 3IP6A 3GC6A 4RPZA 3I0NA 3U19A 5ERXA 2P4UA 1G8PA 4BQPA 1WCYA 5D3QA 4XPIB 2X3FA 2Q3HA 4OQMA 2J3HA 3OAAD 1P45A 4YO8A 4AYBF 3C5CA 3U9TA 1XZAA 2VT7A 4PSAA 5KT2A 2AXTU 3SQWA 1LPBB 4O59O 3M6LA 1PG2A 2YCBA 2UZAA 3SHWA 3H1PA 4G07A 2K8AA 4MVJD 3NUGA 3KAKA 2NTYC 4F6LA 4P08A 4H7JA 3AUAA 4MQUA 2R2AA 4MVWA 4KUGA 4HNAA 3AUYA 5JZSA 4OTZA 4P2BA 1XRNA 2CUTA 2CJYA 1PVVA 4QAQA 1NXXA 3VU9A 2EJWA 3ZEAA 4JMUA 4IVNA 5H59A 4IGAA 1ZK4A 2D5BA 2DFTA 2HRCA 1ZXXA 1K97A 4P4SA 1XWLA 1C0LA 4CKWA 5ELMA 1AU9A 3CWQA 4EM6A 2HI0A 1A04A 3KKKA 3ZQUA 1RYYA 2GD2A 1TYCA 3MHPA 2QR5A 2XZLA 3SPXA 3RYHB 1X2EA 4WBNB 3MT8A 3VSEA 2B82A 4LF9B 5JD5A 3TOZA 1Y82A 4DSJA 1X7DA 2C82A 4XA8A 4M76B 1XLTA 3MD9A 2IJGX 3U7RA 3QTTA 4WASA 4HO1X 3EIWA 4PFJA 4H3HB 1VHLA 2I3AA 4O4LF 2MU2A 2F2TA 3VC8A 3WRXC 2XQFA 3E9EA 4MITA 1H8HD 1N36B 4HXGA 4BNLA 3S8EA 5A4KA 3C6QA 2HMSA 3ZWOA 2C1XA 5H83A 4BVGA 1T9CA 4Y6QA 1YA8A 3G2QA 4JX8A 4AZVA 5J0TA 2HCFA 4E11A 1CQXA 1ZO8A 3DWEX 2DSNA 1NQTA 1U6JA 1PR5A 5HKKA 1Z25A 2P3QA 1MX5A 3P2OA 4Q3LA 4O8CA 2MJLA 4M49A 4MS4B 1XXHB 5DPMA 4DSKA 3KV1A 1XZMA 3O9ZA 2WVAA 5DM0A 2C7OA 4P8RA 3ES9A 1SA0B 5JW6A 1O6GA 4KPUB 3HU5A 1UMCA 3RB6A 3BILA 2NVUA 3ADDA 4LZWA 1KETA 1CR4A 1FL9A 3F5SA 1JJAA 4M7PA 2DE0X 3JZDA 2XGJA 1YQXA 2ASVA 2H2DA 3EDRA 3GFTA 4IEFB 5IVPA 4TXJA 3TG8A 4MRMB 1O6CA 2ZB8A 4HV4A 4DQXA 1WS6A 2QARB 1X8XA 1MA7A 4UAYA 3QWAA 1JKXA 4M9HA 3DD1A 1LV8A 4ALKA 3GEDA 1IM8A 3RC2A 2BFFA 2D1FA 3ZHVA 4CEIA 2C7GA 2EL7A 3HNOA 2Q0HA 1RYBA 4BLTA 4LOKA 1E59A 3KJNA 4EPYA 4Q4LA 1UJMA 2H9AA 4IYRA 3IMEA 4H08A 4L5CA 1FP1D 1NVFA 3DHEA 1QX3A 1XCBA 5J9FA 3SZ3A 4OHUA 3N07A 4JLBA 3NHFA 1L4GA 1ZVKA 4IV0A 4MKGA 2R1TB 3RFUA 3VSBA 2W37A 3GEGA 2CFTA 2XJ9A 5KYWA 1EUZA 2EANA 3D8TA 3JQPA 3F5QA 3OD5A 4DLBA 1YI8A 5CB4B 2VDNB 2AG0A 1L7DA 2UV8A 1F9EA 3N75A 3PW0A 1TFRA 3OQJA 3I4LA 4BCDA 2P4QA 1W1IA 4G5QA 5U4XA 3AB3A 2GN0A 4EY4A 2WYIA 5FA8A 1AJEA 3MGCA 4TL9A 3QVVA 4OI0A 5SYNA 1KGDA 1XDDA 2KN7A 3EXHC 1DRVA 3LT4A 5B1SA 4DLKA 3C0KA 3FOBA 1TM7E 2I2DA 4DREA 2DTXA 3Q7IA 1B26A 1Y42X 2WHRA 2G40A 2IV3A 3C1YA 1FY2A 5DTMA 4JA2A 1DCMA 2X4IA 3OZRA 2A1JB 5B7GA 3N58A 1JKFA 1L3IA 3IXQA 1DXYA 4F0JA 4KAXA 2P66A 3O90A 4Q1BA 1QTRA 4NK4A 3LD9A 3RB0A 4E5PA 4Z6EA 1WWVA 1A4IA 2JEOA 3RIXA 4L0DA 1GG2A 3QE4A 5GPBA 4QUDA 1JMSA 2E4ZA 4IGIA 3G7UA 4GYYA 3BS4A 2XVXA 5I01A 4RTJA 3SQOA 3CNBA 3W4KA 4P81A 4E22A 4CUZA 5A62A 2XCSB 5DM1A 3V9AA 4FSDA 5KG0A 3V4PB 1DHRA 5CB6A 3W5IA 1OXUA 2CFRA 4RF3A 2MHCA 4D2IA 1P9WA 4Z99A 3SYTA 4FW8A 2PXIA 5AD1A 1GN9A 2YWFA 4PZPA 1Q0ZA 1RPZA 4LZLA 2P2ZA 3GARA 5KFEA 2P75A 3NDPA 1OH7A 1M1NA 4KLOA 3LS2A 4Q7LA 3R7WA 4TV9B 3HA2A 3BUSA 4BFVA 4NQRA 1WBBA 1NBEA 2B69A 3PFWO 2JAHA 2RAPA 1T0PA 3OT4A 2ZUVA 9ICGA 1RWPA 3N5KA 1C9JA 1D4FA 1DAPA 1R6TA 4Y2JA 2O57A 1YB6A 5BT9A 2PXHA 3I04M 3GEEA 5MGBA 3LC2O 4LJ4A 1XRJA 1WZUA 2VJDA 2O9JA 5EHXA 2HSDA 4PZDA 2F1KA 2C2KA 2WA2A 1ZH6A 4TWIA 2FCRA 2RD2A 2LKCA 1S2OA 2FUG6 4E03A 1CW2B 1DAKA 2ODEA 1ZOSA 2OOSA 1RKQA 5FBWB 5LPNA 5KFSA 1NUAA 2CFOA 2CUZA 1TNDA 2A9QA 5JCZA 1OX4B 3EVTA 1M7GA 1TD1A 1NRIA 3ORRA 4S12A 4OJPA 3QEOA 4EBCA 3QMWA 4RCYA 1VMDA 1I14A 2HAEA 3NG1A 3QU2A 2ZROA 4UNNA 2ZU0C 5AVWA 3LUKA 3CLRD 4CM8A 4U7FA 1TE2A 1TYDE 2GPAA 1KKMA 5LD2B 1R18A 5C4IA 3MJRA 3I2KA 1X0VA 1OZFA 4X62B 1TZCA 4M0CA 4DA4A 4ZCTA 3VR5H 5DM4A 3NWEA 4PO8A 2RP5A 4KFTA 1XMVA 4LE1A 3WGNA 4TN1A 3IV6A 2JIZA 3QX9A 1QTQA 3WWCA 2PKQO 2KQUA 2XVTA 4P0QB 2IGTA 3PZPA 2NRWA 5L3RA 3Q40A 2P9HA 3HP4A 1K8RA 2AW3A 3IKTA 2J09A 1YTLA 3BGIA 5AKZA 1XZGA 1YKGA 3GJXC 4R2MA 4R83A 1CEYA 4MKHA 5C53B 1UZAA 4GL2A 5DYYA 4WOPA 3KXPA 1L4BA 5HFJA 2ZANA 3A6ZA 4AN4A 4NZ9A 4UM9D 2AFIA 5KFFA 3AJRA 2W54A 2OV4A 2V8BA 4EWLA 4ODIA 2GNPA 3BGDA 4TXNA 4DV2B 1QO7A 1QO9A 4D56A 4G41A 2CLCX 3QA3E 3ZW9A 2RAFA 4QU9A 5JO9A 2AZTA 1FJGB 2H5EA 2X0RA 9ICJA 4F11A 3M4ZA 1XLUA 2GEFA 4ZANA 3U62A 3LW8A 4L7QA 5CUQA 3HYRA 3HJNA 3WLKX 3RUFA 2VDJA 3OJ0A 4OGGA 1FRQA 1Y1QA 3IP3A 4V3BA 5EYPA 3THXB 4QTUB 2P6NA 1LJLA 5GWXA 1LI4A 3RQSA 1FFHA 3MBYA 1SU4A 5GV8A 4DB4A 3FMVA 4II7A 4CTNA 1CR6A 5AJUA 5CX1B 4D8TA 5FT9A 5HSGA 5ADHA 4M8IA 4BO8A 4JB3A 2XB9A 1I7QB 4KLSA 1DAGA 3UXNA 2O7QA 4NX2A 3V8QA 4KK4A 3DEIA 2C22A 1IXRC 5E2BA 3HWSA 3EPGA 2GGSA 1ESEA 3R0ZA 3SF0A 3S2EA 2QJOA 3L02A 3SDSA 3K9FC 1FYWA 1PJ8A 3EQ6A 3H6GA 3GGPA 3H97A 5AI6A 2QN8A 5G1PA 4MF8A 5CJ2A 4URZR 4WFQA 3E3OA 3TADA 1E1YA 3IR7A 1RKBA 1BG6A 2BH9A 4MQMA 4DTIA 1CQPA 4B6PA 5K0LA 4X24A 4BTLA 2NTVA 4ZDIA 1C9MA 1HDGO 3A1UA 1ARZA 2B0JA 4ZRMA 2CUKA 1ABFA 2P91A 3TRKA 5KMGA 5K6AA 3FPLA 4R2KA 5I4CA 9ICKA 4OG2A 3HKBB 3AF5A 1RSZA 2LYAA 5DO9A 4LOIA 2ZJ4A 3GFKB 2YIVX 1DC5A 4JLAA 2R8RA 1Q1NA 1N6IA 3T34A 4C01A 1HK7A 1VMAA 1J8YF 3JPWA 5CH5A 2RFLA 4ZHQF 1SUSA 1DX4A 2I7DA 4OYHA 1R3UA 2RLTA 2PT6A 5FAKA 2SHKA 3GQBA 3K4QA 4Q48A 2ZGVA 1G8HA 3KK0A 1LS6A 1OFIA 1RXEA 3AVYA 2G1JA 3RJEA 1Q7RA 2CKDA 3SX2A 4FO6A 2W43A 2Q3JA 2IHBA 2HF7A 1NV8A 1H93A 4Q05A 2BR4A 1DU4A 3OT1A 2J5XA 3A05A 4L02A 1BJTA 2WAYA 5KDOA 5CA7A 4OPMA 1Q7EA 4C2AA 4UMDA 1V47A 3L0BA 5CGQB 2IXAA 1T5LA 3O3MB 2ZXEA 4D3DA 3F8SA 3ICVA 1E2PA 2B34A 4RJJA 4U2KA 4NY8A 4DC1A 3ROQA 1WUKS 1NJSA 3QX7A 2FTKE 4MLPA 4Y18A 2HBJA 4CV2A 2I03A 4CF6A 2GTIA 5IJ0A 1SPXA 1JWBB 2H2IA 4C7MA 2TMYA 3V8VA 1HNNA 1IU9A 1P5ZB 3HA5A 3LHIA 3ZOKA 1AB6A 3UK7A 4PYOA 3MIZA 5CA0B 2YXBA 5HKOA 3U4AA 3NTLA 2JLWA 4PS0A 1NPYA 1EDBA 4AECA 2M6RA 2W9BB 3P2EA 3SR4A 1BZYA 1N56A 2VP3A 4LVUA 1XPUA 4FWBA 4JASB 3G8YA 2AA3A 1OU0A 1R1DA 1CZOA 4G6ZA 1ZVQA 4NFLA 2Z5LA 5JBNA 1O5TA 5CVTA 3TDKA 4C6SA 4RDIA 1G4AE 5AK5A 5DDYA 1SVWA 2XNDA 4DRXB 1JALA 3NHLA 2QF7A 4WZBE 1GU0A 3T7TA 2J3QA 2ZCVA 3T9EA 4DV3B 2PUGA 1ZKDA 1GT91 4RXMA 2KZZA 3VPBA 3IIMA 3TLEA 2GERA 2IDJA 3O4HA 4Z1MA 2ZRDA 2ZTCA 1QB8A 3FYTA 1D0SA 2XO7A 3WQRA 3JZIA 5EE0A 3DMTA 5ER9A 4MQ5A 1L5OA 4EG8A 2FJUA 4Z4QA 2DKFA 4HZUB 4HQFA 1EK0A 1ACMA 2IF0A 1QIDA 3GLRA 1FXWF 2VYQA 4L50A 3R4VA 1WX1A 2W2NA 3UXEA 3JWPA 5IVHA 1ZSVA 3DONA 1MENA 3TJRA 3R0XA 3LTNC 3I0ZA 3ZZ0A 1KL9A 3DEFA 4MFCA 3KG2A 3AU8A 4M6WB 2YN4A 4YB8A 5FEUA 1YACA 5WRFA 3D8UA 5REQA 2VJLA 4JV0A 3C48A 4P3PA 1K92A 4FDMA 1U2QA 4US0R 2BMDA 2YS7A 3VKWA 4CIXA 4DMFA 2HBMA 2VXYA 1QK4A 3T7CA 1JG1A 1GQOA 4G0MA 3BZUA 2R8IA 3ZDZB 2AFRA 1QCYA 1JEAA 5JZVA 3RB4A 1XEXB 4CKEB 2IYNA 2J85A 4KI0A 2HW3A 1PVRA 4PFQA 4B6EA 4ED9A 2RI0A 3EDOA 1LWNA 1Z2PX 3HGTA 5K0CA 4UUMA 4JI6B 3ZDYB 3VO9A 1SO8A 4B75A 3NUQA 1N1DA 4U02A 2VJPA 4MVJH 2IX3A 3BM5A 2V5VA 3LP6A 1DGJA 9ICOA 4BMZA 2XTAA 1HDEA 1CYEA 3LYHA 4FS8A 4DR2B 2QBYB 1OBOA 5CPFA 2I2BA 1SUFA 3VZSA 3HCEA 3HDQA 2HBKA 1YE8A 2NU6A 2W6QA 2FR8A 3STXA 5KTNA 2XT9A 1UEJA 2J0EA 4UHJA 5IZ4A 2WPDD 3MB5A 4K05A 4KRFA 1OY1A 4QRIA 1X94A 3H0LB 1SCKA 3EZFA 2QRKA 1RXCA 1IN5A 3P9CA 4I5GA 4YN3A 4WE3A 3T7DA 3DBHA 5LKAA 4B7CA 5IDWA 1G16A 1B76A 4QBHA 3H40A 4MB6A 4IIDA 4ZAZA 3LKZA 1AZWA 2OK8A 2E1EA 4RHCA 3SX4A 1Z33A 1JHAA 3MFHA 2AJLI 2R6JA 3G5MA 4X45A 3IX7A 4OYLA 4BKQA 4EKDA 4OJYA 621PA 2JDID 4B4WA 2R6HA 1BQ4A 1SUDA 1WCWA 1K75A 1BMFA 2VEDA 3IL2A 2DYKA 2ZJ3A 3GCGA 2Q29A 5AK6A 1ISMA 2HK9A 1UC5B 1ULHA 4V0LA 2X4DA 5H9WA 2AUTA 3RSOA 1LPAB 3I23A 4R9NA 3VNVA 2IXEA 4YAKA 3DW3X 2IBSA 8ABPA 1PZGA 1DKUA 1B3RA 3U5TA 4DYHA 4UXJA 5JCOA 2ALJA 4L6IA 2VNAA 4K9RA 4DJ5X 3WHIA 5F7OA 4XPIA 1LB2B 2EARA 1PDWA 4WIAA 1WB4A 4HNAB 4F4DA 2JHCA 5C1BA 5KYYA 1KERA 3OLQA 4NSNA 2IXGA 2I8CA 3MQ2A 2OPBA 3ZHZA 4OD0A 5C1OA 3ORYA 3VU9B 1QE0A 3TSWA 2WEKA 4AJEA 1PX2A 4QA9A 3HUDA 4P4SB 4JUBA 3ELDA 1KJZA 2C3MA 2J7PA 2OFOA 2I4MA 4DVGA 3E0QA 8OHMA 5LBIA 4J9RA 3EEFA 3O2NA 5KT6A 1X42A 4MAFA 1U99A 1C1XA 5B2FA 2GBFA 3ASZA 4FX2A 4X92A 1QLJA 3AU6A 4PPGA 4S05A 1WG8A 4GOKA 3LHDA 4PX9A 2FDRA 1IZ9A 1BMQA 5BMVF 4MPDA 1OZHA 3TMAA 1O4WA 2GN2A 3R7DA 1CULC 3A1DA 2DR2A 3P9NA 1F44A 4XFJA 2WZBA 3WFIA 5FXMA 3ZPXA 2V58A 5B4TA 4MVXA 6PFKA 2GXUA 5K7SA 3DKIA 1TQ8A 1MAUA 3TPCA 1A5AB 5C7OO 2EDAA 3WKDA 4KACA 4ER5A 2CD7A 5DGAA 4RFSA 4LGMA 3L0CA 5JDCC 4OL0A 3HN6A 5FHQA 1JDTA 1W9HA 5A3SA 3O9VA 1F8XA 1SCAA 1KI2A 4TMFA 1DEHA 2OR3A 5T4HA 1XTRA 4FT4A 4B6QA 2IHJA 4QNNA 5EJAA 3RSLA 5IZCC 2QK4A 1UMCB 4D1YA 2MDTA 1DDIA 1UBLS 2NVUB 5FTLA 3BS5A 2H63A 2IS4A 2E2WA 4MO9A 1KDHA 2YXEA 4DSEA 5H8WA 1T3TA 5D84A 3DF7A 1OZAA 4A26A 2HSJA 5LDGA 4RS4A 2CXQA 3LP8A 2NZYA 4D5EA 2FGJA 1ADGA 5KFBA 3MWDA 3W1VA 1R66A 1CLEA 1EM8A 3SV4A 4KLRA 4I2AA 2HRBA 3NM6B 1JEOA 2ZYWX 1U31A 4Z4HA 3W2FA 2J6UA 1WHSB 1LPOA 3HWX1 2QARA 3WMWA 2WG2A 3F73A 4Z2YA 1RRCA 2ILVA 4JR0A 2X0DA 3ENKA 2XYGA 4ZOLF 5DQHA 2LCQA 2C4HA 3JWJA 5KYWB 2MR6A 4D9IA 3KLBA 3TBFA 3D1JA 2C2DA 4R05A 4RQNA 2J9RA 3O26A 5CEHA 3GN1A 3NXKA 4P2GA 4RVGA 3ZWNA 2V1UA 2DSTA 4LZNA 4ACAA 4TYQA 1URJA 4KWCA 4F60A 3I6ZA 1MX3A 2AX4A 3ZWPA 3M6WA 3CO0S 4ISCA 3KHKA 4QSHA 4V02A 2RC6A 3ZGXA 3DE2X 4QWBA 3RU9A 4TQSA 2WU1A 4F96A 3K09C 3CRXA 4RLFA 4G81A 4LMPA 3FZEA 4NNPA 3LF1A 5CB4A 2I2XB 4DMRA 2IQIA 3L18A 2JJ8A 2WMOB 4Q4DA 3EW9A 3NBAA 4GR4A 3KZVA 4GI1A 4W5JA 3RFTA 1CP3A 3EMKA 1R00A 2JFUA 1KKLA 1PF7E 3K70C 3NB0A 1HDZA 3ONWA 2ZJ1A 3RH4A 5J0QA 2Q0XA 5FV7A 3KPYA 1Q0QA 5JSZA 4Y2PA 1GNSA 3ACBA 1QMGA 3TVYA 4CQNA 1J0DA 3K70D 5C8DA 1H1TA 2P6UA 4PAMA 4G09A 2ZQZA 3P5BA 1A4RA 1K7EB 3TJMA 4E5VA 5I3CA 3OHBA 4KDRA 4PAWA 4HMQA 1KEEA 2YJGA 4RIEA 4B33A 2CBXA 3F3MA 2DPXA 2WSSA 4NPAA 4DS3A 2A5FA 1QFZA 2ECQA 3PQ5A 3I1JA 2WJHA 4UDXX 1TU3A 2C9OA 2VSXA 1LK5A 2Y0SC 2QRLA 3BE6A 2AQHA 3C6BA 3HXQA 4B71A 4C5AA 1FS5A 3B1JA 2O2GA 3D31A 2ADFA 3E1SA 2GF2A 2Z4RA 4X7RA 1O03A 5CFRA 1M1NB 4PYKA 3R7WB 2RI6A 1G9XA 4G0OA 3ZWKA 5EA2A 2RHDA 2H65A 1JHQA 2AZDA 3NZEA 1R6VA 3BD7A 3KC2A 3W8DA 2X0FA 2D7CA 2ZI4A 4AY4A 5JVDF 2VPIA 5FBRB 5MGNA 2JIQA 4FFPA 2R00A 1IM5A 2W55A 3ICCA 3R9WA 1IXYA 2GETA 4MAAA 3IBYA 4WEOA 3LPNA 1TZBA 4GG1A 3K31A 4AKSA 1OAOA 1V7QA 4V0NA 3PITA 1KP9A 2IH4A 3SYRA 1X2BA 4IHJA 2AGQA 1ZD3A 3W6NA 3LY9A 2N75A 4UNQA 4LSMA 2QJWA 2YZ2A 4N7JA 1K5GA 1POXA 3AJ9A 1M8PA 4D4GA 4KMSA 1NK0A 3WIBA 2W2KA 1Q19A 2HNBA 1JNXX 3VHLB 5ESDA 2D59A 4MICA 2P30A 4AIIA 4CM8B 2Y1XA 3RBEA 5ALUA 1DBVO 3SBDA 2F9LA 1X3SA 4KXFB 5L7YA 1YI0A 3EWAA 3ZHCA 1J90A 1E6MA 3R09A 2ES4A 3PNCA 1II0A 2I5PO 3V7FA 3V5NA 3HEAA 1T3NA 1RWNA 3W4JA 1KSFX 2LBOA 4B74A 2DQYA 3NPMA 3OZDA 4E7OA 2V65A 4G5GA 3BX1A 1U6KA 3KZNA 2JH1A 2FJPA 4TRRA 5HE9A 4HG2A 3KVNA 3QMVA 5JMPA 2W22A 2CMHA 2FWBA 3TMKA 2PZBA 1KH3A 4B4DA 3QX8A 5AM4A 3CT6A 1L7AA 4UDNA 1S2IA 4GYKA 1QLNA 4D41A 3UQ2A 2X40A 4IG9A 3CH6A 2ZYAA 1TADA 1GAQA 5J0YA 4P0QA 4L95C 4NZNA 3L8CA 1FEZA 2AFIB 4NRDA 5J2TF 4CNQA 4LYYA 1JYEA 4GP6A 3HDVA 3CYFA 3U4MA 2B1JA 1EXNA 3RS2A 4DQDA 3MJTA 3RCBA 2XAAA 4EUSA 4WZAA 3GA7A 3BIJA 4P5PA 5AW5A 2JEIA 1G4HA 1YASA 4YJ3A 1GR0A 5L6MB 5C9ZA 4QT0A 4XDZA 5K8JB 3ZE9A 2Y76A 4C88A 1GIAA 3PRKE 4ZYWA 2XMCA 4JXJA 4D4KA 2AYXA 3ZLUA 5DX0A 4AKIA 1J33A 4Q1VA 3BFJA 3MWYW 5AK3A 2O14A 8ICKA 3W2HA 5EYPB 4ADSG 2RGDA 4B6OA 4PLYA 1AKWA 4ARVA 3OEEA 4BQQA 1C7EA 4JIMA 3DMHA 3AVPA 3W6OA 2F67A 2OXIA 4GLOA 3E5RA 5JCJD 4UCWA 1TJ5A 1GNTA 4KPGA 1AK2A 5CNKA 4QYXA 3W6ZA 9ICTA 3BQ0A 2KSOA 1BQ3A 3EPIA 4YYEA 4Z0NA 5CX1A 4C1NA 1TVKB 3EZLA 1TXGA 2JF0A 2FUNB 3E9MA 3SEFA 4ZCRA 4KXWA 3GLFA 5FHRA 2GCNA 2NO5A 4EYHB 2JIPA 3BCRA 1C14A 3B9BA 2BN4A 4TL6A 2GFHA 3BQTA 2OGSA 2ANCA 1FYVA 2AYZA 2GB4A 4P7BA 4OSOA 1KLNA 4HZGA 5AWFC 2ZRBA 3IPCA 1DTEA 4G0UA 1UP4A 3K0FA 4YASA 3PMLA 1MGOA 4NXZA 1XP5A 4Q18A 3VAYA 4N76A 3GGJA 2QN6A 1ORIA 4PX5A 2ERYA 5HGJA 1MXFA 2DKZA 4F38A 4QELA 1VA4A 4RFLA 2J45A 5FYQA 1L4LA 3BKWA 1YFKA 3OEHD 5IANA 4LI3X 3C74A 3O73A 1JFSA 3LIIA 3O1IC 5DOZA 2WB4A 4LQ4A 5ERGB 2JFYA 3NC1C 1AQNA 3DMFA 2DWQA 5B3AA 1MJHA 2A78A 1XV5A 2WE8A 3ND7A 4ZRDA 5DIZA 4BEJA 1FW6A 3FWKA 1EUQA 3GQBB 1ZU5A 1TECE 3KE9A 5KFKA 3NHJA 1Q3KA 3FW1A 5E8RA 5I6DA 2X1MA 5E38A 3LA6A 4WOKA 2D00A 3CPJB 5KKNB 5KNBA 4PLCA 1HNWB 1KXJA 5DG9A 1GTG1 2VZ0A 2XRYA 2ZJOA 1TM5E 4BGEA 3E7XA 4I8IA 4HQKA 3KSDO 3OT1B 4GX5A 2CNKA 2W2XA 1CTQA 2AJBA 1G291 4X1IA 3HA3A 3IC5A 5AKHA 3K9CA 421PA 1DCTA 2FSUA 4D98A 5JPDA 4B79A 3A4VA 2VJMA 3L07A 1LNSA 4QJ3A 1LQ2A 4FYMA 3OZGA 3PG5A 4H1WA 3DLHA 4DSUA 1Q0UA 4UB6U 5IJ0B 3PI6A 1U65A 5F33A 1Z7GA 2HYIC 3FHLA 3KWJA 4UD2A 4RT2A 5BSGA 2VT2A 5GJCA 4B6GA 1YRLA 3GVPA 4PGFA 1XRRA 1P7CA 2E4UA 4EFKA 2JD0A 5AJXA 3CRNA 1PR1A 2WBLC 4TSFA 4C0HA 3R3UA 4P82A 4DJAA 4XUGB 3FYSA 3OSPA 5BO5A 4FD2A 1VFNA 1JR3D 4KLGA 2PUBA 3F98A 5TMDA 2GEKA 2HLHA 5ENVA 4MARA 1Q3VA 5I7FA 5ED0A 3RUDA 3FFAA 2O2JA 6NULA 2PX2A 4CFYA 4AJJA 1O77A 3NWPA 3OI7A 1O3YA 2DT8A 3SE0A 4RD0A 4RHFA 3L0DA 1JAXA 4MJLA 3WLQA 3WYAA 2G83A 2HA6A 5IJAA 1OILA 2BZ0A 3DEHA 4K9NA 2JHDA 3HXKA 1GZ7A 2OAEA 3PNMA 2QQEA 1Q22A 2HA2A 5EMJA 4QOEA 4C3OB 5EHGA 2QAJA 5LZ4A 2VHVA 4HS9A 4Q03A 2ODAA 1EGAA 1G9TA 4B85A 3SSAA 3U17A 3S29A 1H8EA 2FI1A 1JKJA 4RJLA 3ZWCA 3V9PA 2XUKA 4GNRA 1ECWA 1G6Q1 3EOAI 4UB3A 5FOVA 1ZK1A 3JASA 1V1RA 5REQB 1K4YA 5I7AA 1AMUA 4X66B 2SECE 1F3OA 2IEGA 4HGZA 2I8LA 4HQOA 4COOA 2A88A 5CTAA 3JZMA 4I81A 5ALLA 4IHAA 2CV1A 3AQFA 3AI2A 4PZOA 3A3YA 4UTPA 4LQLA 4M6WA 1SRRA 5AI0A 1VKJA 4BO5A 5JJKA 2WILA 2KE5A 5D51S 4RYLA 1T9KA 7YASA 5J0PA 1AV6A 4GLXA 4UHCA 3Q3JB 1FFUA 2LYBA 3URMA 1WPGA 4IDCA 3K5WA 5BV7A 1R9MA 2GNOA 5ILGA 1Z5ZA 3L1KA 4JLWA 2Q2VA 3U39A 4BJ6A 1F2VA 4TTQA 4IVQA 2PRJA 3TZCA 2XVAA 4Y7CA 4MEJA 2D1SA 4BDTA 2EFHB 2ZPUA 1J8VA 2NU6B 2BLLA 2OM2A 2WSMA 3ZU6A 4KN8A 5FI3A 2P9FA 4URYR 4LK2A 5J2HA 1PR9A 1CUJA 3M49A 4RVUA 4RMGA 3HCPA 4RNCA 5BQ3A 5FPTA 5H9VA 1S0NA 4Q9AA 1M6VA 1ZITA 3J7AC 2VCEA 2QE7D 1YV9A 2NPOA 3C6XA 4DOAA 4GP9A 4IUBS 2OHGA 2J41A 5KINB 4LBYA 3A6PC 3HO1A 5JSUA 3V2HA 4MVJP 1RYNA 2IXDA 1I6LA 4M0PA 4TT8A 3AMZA 4DA6A 2OYRA 1L6IA 3ZIUA 3SDBA 4R9RA 3GFPA 1UPFA 3WGJA 2IHNA 4IDNA 4K3VA 1KAOA 3VZQA 1IY8A 2OKCA 2I1WA 3QXXA 3LK7A 3NMUF 2QT0A 4OK3A 4JP8A 2FLNA 2IZ5A 3U49A 2ID4A 4OJTA 1YQTA 4RIFA 1CY0A 3FTNA 4YMGA 4G5RA 1GPJA 5AI9A 1XDZA 2OC9A 2ERCA 2AC4A 2VPQA 1TIKA 4C87A 1MO5A 1P72A 2NZVG 2E82A 4JI5B 5KYYB 5KFTA 1TM2A 4CI9A 3IAM1 3OSUA 4UOQA 2PD4A 1OWLA 1OLSB 1NUUA 4E5DA 1C4XA 3P45A 1Q6ZA 3R76A 1QSGA 2B8NA 1T43A 1VCMA 4CKCA 1AX9A 1GVHA 4BIMA 3JYHA 9ICEA 1N75A 4X61A 5FNVF 1FB5A 2JGLA 1FQWA 2O2DA 4TKUA 3TW8A 4Y2GA 5EXXA 2F8LA 4MTLA 1Y3IA 3G2MA 1C1XB 1TT7A 5SV2A 1J1IA 3OQIB 1OI2A 3I2HA 1PZFA 5AICA 3J80A 4KR6A 5EKTA 3TL3A 1DQRA 1DOAA 1V4VA 2M6LA 2PMZC 2OO5C 4MIKA 1KFCB 4QNRA 2G25A 3ORHA 1SBHA 3RTEA 2OCBA 1F0YA 3S70A 4OYRA 3F5EA 2Y1KA 1GITA 2I55A 1US8A 2QVGA 5ALNA 2IWHA 4MUAA 5ARCA 1EI9A 3V48A 3WBJA 3PRYA 3QEKA 4I8XA 1G9SA 5LOVF 3BD8A 3A0RB 4OB6A 4MMXB 4L8YA 3A9WA 1I2CA 4NE7A 5G0SA 2XBMA 3ZU2A 2Z95A 5T4FA 2Q2NA 4ZU6X 3VKVA 2VSOA 5AT1A 1Z3IX 3BXFA 4FIDA 4RFSB 3UJAA 4RZUA 3QY9A 4NCXA 5IBCA 2X0JA 4L08A 2AJCA 4JHXA 3HC7A 2CHVA 3Q7TA 4OBBA 2EDCA 3R7LA 3PDUA 3BSWA 4ZVMA 4ZT6A 3HDYA 4NF2A 3BS5B 1QHXA 1LBEA 4UNSA 4P0TA 4EBFA 3WVNA 4FYJA 2N3ZA 1SCUA 1VPEA 2AZMA 2FPXA 1A9XA 1U3WA 1YB5A 6ADHA 5FEMA 3F1LA 2HOIA 4W82A 2R4UA 4GR9A 2HYDA 1CI4A 4LZGA 1OE0A 1W8IA 4TLAA 3BS7A 1WY5A 3MWDB 4XTRA 4NEHB 1EM8B 2P1DA 1U3CA 2FQXA 1VKHA 2Y92A 3OA2A 1O8CA 3VGJA 4AUMA 2QYSA 5ITVA 1KFEB 4EPTA 2IWRA 5L4NA 2ODNA 1VL5A 5FJIA 2B6NA 2XSZA 4AG6A 2ZQ5A 4NJEA 2F3SA 1WWUA 4JJ6A 2CMKA 3M6VA 3IUEA 3O4FA 3Q0IA 1ZG3A 3T4EA 3OFSA 3NAZA 5KYXA 4YMHA 3GJ6A 4WJLA 1EFDN 4FCCA 2VF8A 3KYJB 7ADHA 2JRLA 1D03A 2CVPA 4WCDA 1NUTA 2PS3A 3MWLA 3QF4A 1WOYA 3AM9A 4BU1A 3BE5A 3DO8A 1WHSA 4PO1A 3ET5A 4BU0A 4MEBA 5B6JA 4QE3A 3T06B 4RU1A 2PR2A 5E2AA 5HCIA 1GTRA 4A6PA 3VNUA 1GDTA 5IIMA 3N2YA 1TK0A 9ICQA 5EERA 1CUIA 2GZ3A 1UKVY 3EVAA 4ITVA 4HNGA 5BRNA 5KNCA 4QUJA 5J3JA 2O2EA 4C7KA 2F3PA 3W2IA 2Z04A 4D96A 3NBMA 5A04A 1N7HA 3PVZA 3FAHA 5F52A 2G88A 3K2BA 5F3RA 4XIJA 3RUCA 3G0IA 4UMVA 1PFQA 4FT2A 5JSZB 1NKBA 1YFLA 2JFVA 5F7XA 1Q17A 4ENPA 5GINE 4P31A 2HLDA 4K88A 3CF2A 2C2OA 3HL4A 2G5PA 2FFAA 2OWOA 2HPAA 1JSLA 1K5PA 1KEEB 3QEJA 5U1PA 2QVYX 4GLBA 1BFDA 4FGLA 4PLGA 5DBGA 3JPSA 2E6KA 4HPXB 4B09A 1WABA 1L4HA 1AMOA 2FZCA 1ZVMA 4IFTA 1VE1A 4RQ1A 1CY1A 1NOJA 3PD7A 2A1UA 9ABPA 2PUVA 2VZ9A 1EKXA 2P90A 5IF9A 4Q01A 3D7MA 1SY7A 4J1NA 2ZZNA 2QXYA 5G5HA 1X6JA 4EMUA 2BZSA 4QKQA 2CSUA 4UVIA 4OFWA 2W4IA 1PWHA 3JAWA 1BE0A 2ZRMA 2VIIA 7ICJA 1NIPA 4WX2B 2IL1A 2GVZC 5HWSA 2IF2A 4I5FA 3K8ZA 5K0GA 3CEHA 3C7AA 2YWEA 4L51A 4HX9A 4PZAA 2YBEA 1WP4A 3ROFA 2VP6A 3WIUA 1H2EA 3IGFA 4IVPA 3KS9A 3NR2A 2V97A 3BMNA 4XIFA 4L8FA 1SRQA 3EGOA 5H80A 1Y3HA 1KP2A 3OICA 3SMVA 3F4KA 5CB1A 3QOWA 4JQYA 4KQEA 3T7RA 1ZGAA 1U2RA 5MFPA 4OHYA 3B7GA 4IHJB 2QRVA 2ZTSA 2CL5A 3V2GA 4L73A 1AN0A 3N8KA 4UUNA 2XUFA 4LVSA 2RBKA 1OREA 4E32A 3P1JA 1SWVA 2W2KB 3CQ9A 5B12A 5A02A 4LHWA 3PEUA 1P6QA 2H1HA 4OGFA 4P9NA 4JJ7A 4B4KA 1NXQA 1YS7A 3LOPA 2DLCX 3GUYA 3UJ9A 2W6ZA 4Q1FA 1AKTA 3BD6A 4LE2A 2ORIA 4XI9A 3RAEC 3RTBA 3TIIA 4MKZA 3AY6A 3RAGA 4LIPD 3EGXA 4XFKA 1Y7IA 3H0MB 3QU9A 4ATNA 5B58C 4IO0A 4JBXA 1AF4A 2GBLC 4ZA2A 2WHYA 1F12A 4LRQA 4YH1A 4I9FA 4LDJA 1R0ZA 2UVUA 3LDAA 3V2UA 3CA8A 4KQFA 4PWYA 4YXWA 4CIVA 4RH0A 3NAQA 1FYFA 1T2CA 4CEHB 3WYBA 2MUTA 1E5TA 1M8GA 5KVSA 2RHTA 3HCOA 2LMRA 2DBVO 2P1ZA 1H2RS 1FS4A 5G3YA 2XYRA 1M72A 4GO1A 4OM7A 3GRYA 5AJVB 4MVJG 2OSBA 2BP7A 3MBOA 3EH2A 1TT5A 1WKVA 1EJ0A 4WZAB 4CDRA 5IVKA 3V4RA 4YJ3B 1M83A 5G41A 4WINA 3LX8A 3QHPA 1Z19A 9ICNA 3VR2D 7MDHA 3WQBA 4LXUA 4LECA 1A2BA 1V43A 4ML3A 3ZBTA 1T9BA 5DRYA 3GBSA 5IM4A 2V6GA 4PN3A 4YONB 1XWFA 4UB2A 3R0QA 5DGTA 4IUCS 1RYHA 3EH1A 1XNSA 1RLOA 1DARA 3WLAA 2BF4A 1OOEA 4JKIA 4DLLA 1U7OA 2BSAA 2CYCA 2NUBA 1YVPA 2HWUA 2X58A 2O0HA 2ERXA 1MV8A 5FA5A 2I6FA 4A7PA 4INJA 4LJ7A 5BY2A 2KSOB 2PTGA 3Q8MA 3RIEA 5DT9A 4KLDA 4ECQA 2V6MA 5F76A 5ADVA 3N6VA 4S1WA 2G5GX 3P0FA 2R8KA 3DFZA 3QVUA 4J1SA 3WDSA 1E62A 3C6MA 2GFIA 3GLFB 4JLUA 1TZ2A 4DABA 4BMVA 1R88A 2LIVA 3A11A 2GPJA 4R81A 3S7ZA 4CI0B 3E9YA 3VXKA 1EX9A 2JBHA 4IWYA 4B8ZA 2G1PA 4EFLA 2VJCA 3H3XA 2GPTA 2FEPA 4UD6A 4CV1A 1TVKA 3LSYA 3K0FB 1HH4A 4QDZA 3EQ8A 2HDNB 3GELA 3M1LA 2P69A 2ZRAA 3I62A 1R6AA 1DIRA 2W5UA 2CFIA 2FX5A 2WP0A 4ZYVA 2OUKA 3IT0A 5EHNA 2F3RA 1P0FA 2QL9A 4OJNA 1NRXA 5C3UA 1F1BA 3UAWA 1MJGA 3DP9A 3UMJA 1JTFA 4QJIA 3I6IA 1EE2A 3CS3A 2IUEA 3IAS1 4HBGA 1C8KA 1BDBA 4GZ3A 4QJFB 1T6XA 2NAPA 1VOTA 3DKPA 2X14A 3EIQA 3HRIA 1TZJA 4NECA 4WFKA 1U9IA 5E4FA 1DX6A 3WBKA 1OW3B 2FYTA 3PGJA 1NT2A 1GPBA 1TGVA 1AD2A 4KH0A 4MGYR 5AJWA 4PZYA 4BNJA 3LY5A 3QW4B 2JJYA 5HUQA 4QW8A 3CX3A 4QDUA 4JI8B 1LF5A 4UB8U 4EHJA 2QUJA 3I76A 2VWPA 4WSOA 2WJPA 1FUUA 3LUPA 2M9NA 5ARBA 3ML1A 5B55A 4X1IB 1S7GA 3F5MA 3RJZA 3HJBA 3V80A 4J2TA 2TYSB 4GEGA 4R54A 4KLUA 4D9HA 5FH9A 3UB2A 1DAMA 4EJ6A 3BF7A 2VJMB 3E3NA 3GVHA 3TQOA 3STVA 1SCBA 2C7VA 2XJ4A 1A2KC 5F73A 3AESA 5E7JA 1GWNA 3TACB 2AE1A 1B4DA 2OO3A 2IELA 2JBAB 3KSUA 4M38A 4TTRA 2UUAB 2F4VB 5G0WA 1ZGZA 5A03A 8AT1A 2Q2QA 1Q14A 3KVRA 3LK9A 2FMSA 2NO9A 5KTSA 1ZQZA 2R5NA 4C43A 3PSIA 3I9JA 4E0DA 2AOXA 1F48A 1J97A 2CVZA 4BB6A 5JXHA 3A4IA 4OXKA 4O2AA 2W70A 2LM1A 3KJXA 4RQTA 3IDWA 3BREA 2CNOA 4XSGA 1GAXA 3T54A 1HYQA 2DFVA 5CAEB 2W9MA 1DQZA 4MYTA 1TRKA 2EBHX 1T2VA 5DTJA 4EFDA 1E2MA 2ONZA 2VKQA 4AI6A 2V45A 2YNMA 4G8CA 1VKZA 2EIXA 4ARZA 2PK3A 2AQ4A 1KDOA 4U2CA 3GRUA 2MMGA 2I9KA 1EXWA 5JNLA 4FZMA 4ES6A 1Y7LA 1NPTO 4QEKA 1H4SA 2Z2YA 3UMYA 3D3WA 5A0VA 3D3NA 3LO5A 4BWVA 5AVTA 5COBA 1WO8A 4KAFA 1N0WA 3ELBA 1X2IA 4IF6A 2OCGA 1JKJB 3CF0A 3Q87B 4W6ZA 4TTTS 3TOSA 3NM5A 4CMEC 2Y1OA 4FGZA 3JASB 1V1RB 4M89A 1EEXB 1S8FA 1LPPA 1TJNA 4RABA 2QMOA 4Q9JA 3WL6A 3C45A 5LN1A 1XU9A 4V0KA 3FWYA 2XY5A 3GBPA 5JI3E 4OH7A 4M7RA 3W8RA 2EZYA 3EW7A 2GHQA 1E2JA 5ALZA 1H94A 1OMOA 4AD8A 4J03A 4EHDA 2PVSA 4QFDA 2OILA 1R10A 3HDGA 2WVJA 5FJJA 4CMJA 1VPWA 3T3DA 1M10A 4O4IB 4Y1GA 1EVZA 1E7MA 5HR7A 3LWLA 1STOA 1NP6A 5ERYA 1IVYA 1GGJA 1SXGA 3H87A 1IZ7A 4B9VA 1GPH1 2RK3A 1KVUA 3DG9A 3I58A 2R6R1 4EKEA 5BN3A 3R7BA 2XXAA 2H1OA 1PJBA 5DN6A 1P9LA 1SHZA 2HREA 4XWYA 4QC2A 3RF7A 4Q9LA 2Z9DA 2A9KA 1UQVA 3C21A 5TE9A 4ZYUA 3IQHX 3JPTA 3SK0A 3B2NA 4DZZA 5ES4B 1EVQA 4RD2A 4NM1A 4GX1A 1I8TA 4CTJA 4AXBA 2GPSA 4Q7JB 1YK1A 1FRZA 3M8KA 1UA0A 3KOMA 2F1JA 1FSGA 2JRCA 1VE6A 1VPVA 3FE2A 1M9NA 1JMVA 4OHWA 1PU2A 2C28A 3ITEA 1FLAA 5ALJA 1P1KA 2OBBA 1M6VB 1JBKA 3HR4A 4E70A 3S2GA 4QNLA 3GFRA 1IY0A 5DYNA 5CFMA 1C3OA 3TM4A 1ZQYA 1XC7A 3AYXB 1QPBA 3W34A 4KI7A 3NVDA 4I4CA 1ZZEA 2NVOA 4B44A 3K8YA 3EGWA 2W2MA 3H9QA 1VMEA 3OLCX 4I55F 5IFKA 4O5EA 121PA 1T6BY 3PFIA 4URVR 2ZSAA 3H6KA 4RQ7A 3FYUA 1WXDA 1XQ1A 2P9GA 1A88A 1JIQA 2JZOA 2XICA 2FF7A 3SAHA 4NICA 1KFDA 2PX8A 3GJ5A 2ZDGA 2KG5A 3VVMA 5KYKA 3IQGX 4LRYA 3JQ6A 4WEQA 1D3AA 1DL5A 4KTVE 4DLYA 4EO4A 4KFSA 3MGAA 4N49A 4FWIB 2C04A 2JHPA 4IOJA 5JYCA 2WJZB 4QWMA 1VXOA 1N78A 2G9RA 5ALDA 5KFGA 1IY1A 1UDAA 2PKRA 4YGYA 3C2QA 4N8DA 4BO1A 1T29A 1UK6A 1YDHA 4GL4A 3T5MA 5BOSA 2FXIA 3HS3A 4YN4A 4RL6A 1IONA 1JJ7A 3E35A 1V26A 3PC2A 3Q7SA 1KJQA 4D9FA 2ZB4A 1NLFA 1XQ9A 4CKCB 4ZYXA 3PFKA 4F8JA 2NO6A 4TKUB 3TW8B 4PC7A 3WA7A 4YJFB 2ZIAA 1N5LA 4A27A 1OLSA 3ZXYA 3VM6A 4LCEA 3IQZA 4P4UA 1MAAA 2B4QA 2O6LA 4FYHA 4JD5A 3PXDA 2AR9A 1U7HA 1MQ2A 3M5PA 4ZAXA 1US8B 4Z7QB 1CJBA 2PV7A 4X7BA 4IM7A 2CHEA 4KR2A 4ZT5A 3OQIA 4EZBA 3K96A 1XK6A 2R8YA 3S3TA 1RABA 2Z8XA 2ZBEA 1SBTA 3ZXIA 2GBPA 4B9UA 4V0SA 5AOAA 4QZIA 2L82A 2DFPA 3RG8A 1ZAYA 1OFTA 4BP1A 3RVQA 4N01A 1XA0A 4YJ2F 2Y1JA 1FTNA 4IGFA 4E5UA 1SK9A 3RJGA 3ACDA 3D3KA 3HWWA 3JQBA 2HU5A 1HA3A 8ICXA 2D0OB 2I6QA 2OEHA 3C3EA 1P7VA 2CDRA 4R8RA 3BCHA 2LRHA 2COEA 1MEEA 4R1LA 3JQFC 3RUIA 2FSHA 4TV8A 5FTJA 1VXRA 1W0CA 3KPUA 3O1LA 1OJ7A 4Z8XA 1P7DA 3ZZTA 3EAGA 2CJXA 3H0KA 5DB4A 1TYEB 1XCJA 4D4HA 3FVRA 3LT1A 1SCUB 1P0MA 2IMWP 1KY3A 2YOHA 1A9XB 1FPQA 5CBPA 1IC6A 4ZT2A 2VDPB 1QB7A 3BYZA 1XEAA 1ORVA 3AY7A 1ZUNA 2H4FA 3PVSA 1ORTA 2C94A 3DTVD 4C7ZA 4F3YA 5CHYA 5JQGF 4WV3A 1AV7A 1YCGA 4YQEA 2X2EA 2ROQA 3A58B 4G8BA 4RTNA 1SQSA 4RMNA 4OL9A 4KIUA 1RAHA 3GQVA 5JNSA 4RQ2A 5DRTA 4NJEB 3HU2A 4NARA 5LP6F 3HWTA 3DTNA 4FS3A 4NQZA 5KYXB 3T3MB 2WUEA 2ASEA 4A8PA 4Q8FA 4BVAA 2B9EA 2C5EA 5KJFA 4YCCA 3VC1A 4BLSA 2G80A 5HRCA 1J0BA 1MAVA 2ZSHA 4WGFA 1M0EA 1MG5A 1ZN2A 2O3UA 3QF4B 3U13A 4FZLA 1CEZA 1JG3A 3N86A 3Q6MA 4X60A 2DKXA 2BKXA 2R1VA 4KHPB 3BFXA 1VJDA 2ZSEA 3EZ5A 1X7ZB 1L4UA 3LXRA 4LZDA 3WDLA 2NU8A 1UP7A 2JL1A 4C4RA 4ZK6A 3OCVA 2HV8A 2COKA 1GV1A 3QG5A 3W78A 2I8AA 3AEUB 5EQTA 4Q3DA 3NETA 5BYAA 4BJ1A 1WCIA 3ZS8A 2GK4A 3FKQA 3F4BA 3GW8A 1I4LD 4YFYA 4GKBA 4EW2A 1SU8A 4DA8A 3QOXA 3LQ1A 3N6XA 1EFKA 2BFAA 2YWBA 1SG0A 5H70A 3GRPA 3NHPA 1VKNA 2H11A 4F5PA 3EMBA 2AQKA 3ZG6A 2RAVA 1M8FA 3AJ8A 1U2EA 3G9TA 3S27A 1SQGA 2GOLA 2IUFA 3JYPA 3IEMA 5K8CA 3L6DA 1OYOA 3GK3A 2IC5A 2ZAIA 1M2KA 3NW9A 1Q1ZA 3AM5A 4C3ZA 1CEEA 3IO3A 1ZM4A 3RARA 4RGQA 3T5LA 4L8VA 4UATA 1ZN8A 4US1R 4JGGA 1YZ6A 2E85A 4TUYA 3VC7A 1LBQA 3DOEA 1RMTA 4J0EA 4LQDA 1YU6A 2EATA 2EERA 3IUNA 5LNK1 3OEWA 2A1UB 5IWCA 2E4YA 4HAYA 1B1AA 1E0DA 3W4IA 3EGIA 2K4IA 1YU9A 2W7TA 1Z8DA 3D43A 3G0OA 5JH7A 4GOLD 2C5AA 4RV5A 2JI9A 4YBZA 4YRJA 4Q45A 1H6DA 3IVXA 3JAWB 2UXCB 4X1OA 3ZHQA 4D9BA 3BEDA 3NHBA 5DOVA 2GEJA 3IXMA 4EDFA 3W2EA 4RK7A 4DLRA 4P98A 3G17A 4GBED 4MRVA 3JARB