1L8LA

Molecular basis for the local confomational rearrangement of human phosphoserine phosphatase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
222
structure length
222
Chain Sequence
HSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKFLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for the local conformational rearrangement of human phosphoserine phosphatase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords L-3-phosphoserine phosphatase
total genus 49
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 3.1.3.3: Phosphoserine phosphatase.
pdb deposition date 2002-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.210 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Phosphoserine phosphatase; domain 2 1l8lA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1l8lA01
5AKZA 4EELA 4J03A 4C4TA 4YGYA 5ALSA 1TJ3A 3CZ4A 4UAUA 3E8MA 1ZS9A 2FPRA 5AIBA 1Z4IA 5AKEA 1ZD5A 4KN8A 3W5BA 5AM2A 2EAUA 3W5AA 3NUQA 3B9RA 1N8NA 2C88A 4FYPA 2HDOA 3RF6A 4OFZA 5AI8A 2MU1A 3BA6A 2WF9A 4BKMA 3KDPA 4F72A 3WK7A 4YCLA 2YJ3A 2IOFK 5E0OA 1YMQA 3CNHA 4DWOA 5AVXA 5ALKA 2QYHA 5AM0A 3IJ5A 3ZWDA 3AR6A 4OHFA 2G0AA 3U13A 1VJ5A 5AK5A 3BWVA 1YDFA 3KOOA 2ZBEA 2R8EA 3P96A 4C4SA 3B8EA 3MMZA 4ZEXA 4BEWA 3FZQA 4BBJA 1YNSA 5AVWA 4UU1A 2HOQA 3KZXA 3L1VA 4BNDB 5ALDA 3QUQA 1KYTA 3AR2A 4XPZA 3WK8A 4UMFA 4NFLA 2I34A 4UM5A 3R9KA 2O9JA 3N5KA 5AM3A 2C8LA 2WHEA 3EF1A 5ALRA 2B82A 4AP9A 2VKQA 4KYTA 1Q92A 5AICA 2Q4RA 3IB6A 1RKUA 1RQLA 3U7EB 2Q5EA 2WF7A 2I55A 1CQZA 2NO4A 2G07A 3QYPA 1U2SA 1TJ5A 1F5SA 3ET4A 1RLMA 3I28A 3R09A 4UM7A 3ZVLA 3F9RA 1RLTA 1TJ4A 4Y2UA 5A3RA 2BDEA 1U02A 1NF2A 2OM6A 3I1YA 5ALYA 1X42A 4JDPA 3ZWKA 2I33A 1L7NA 5AW7A 5A3QA 1RMTA 2R8ZA 4DW8A 5IS2A 2HF7A 2OYCA 3NRJA 4UAVA 1O08A 4HGQA 1RQNA 3QU7A 4I9FA 2QLTA 5AW6A 2GFHA 2RB5A 1J97A 1Z4MA 2RARA 5AKYA 2HF2A 3MPOA 5AVQA 4ZEVA 1Z5GA 4Y2PA 2B1RA 2GHQA 3NAMA 3ZU6A 1L7OA 2AUTA 4YH1A 2Q4TA 3PDWA 2W4MA 1ZRNA 2FDRA 1Z4KA 3AR7A 5AESA 3HLTA 3WGVA 5ALTA 4EENA 4DCCA 1QYIA 3B9BA 5AKHA 3ZX4A 1J8DA 1EK2A 1QH9A 1L7PA 1Z4QA 4BX3A 2G06A 2YJ5A 4UASA 1FEZA 4BYGA 3FGOA 1L8LA 1Z5UA 4CF3A 2B30A 4GXTA 3U26A 4IG4A 3M1YA 4FE3A 4J2TA 3DDHA 2I54A 3PGLA 4QQFA 3UMCA 3I6BA 1YJ5A 1NNLA 1RLOA 3QXGA 5ALHA 3A3YA 4BEVA 1Z4NA 4G63A 1RKVA 2R8XA 2ZXEA 2CN1A 1EK1A 5AW2A 2ZOSA 3D6JA 2B0CA 3ET5A 3SLRA 2JAWA 5ALMA 4KNVA 5AK3A 1U7PA 2OBBA 5AM1A 1U2TA 5AVZA 1ZJJA 3IRUA 3SF0A 2GO7A 4UW9A 2AH5A 1RDFA 4KX3A 2BDUA 5AKGA 4MWOA 3ZVMA 1QQ7A 1S2OA 3W5DA 2D2VA 3KD3A 4HGPA 2IA5A 1L8OA 2C4NA 3KBBA 3ZVNA 4Y2SA 2G1AA 2PKEA 3QUTA 4Y2TA 3AR8A 4XOUA 1VFPA 3MC1A 2MSNA 4AS2A 2JAOA 1WZCA 5AKXA 1VJRA 3QUCA 3ZI4A 2FUCA 2JARA 3AR9A 5ALEA 4UU0A 2GHTA 4UMDA 1WVIA 3L7YA 2NYVA 3HYCA 1TE2A 5AVTA 3QU9A 3UMBA 3FPBA 3FVVA 3QU4A 3OCWA 4ZEWA 3EF0A 3WKCA 2I7DA 3VAYA 4I9GA 5ALWA 5AI9A 3I76A 5A3SA 3SKYA 1RPZA 4CF4A 1Z4PX 1T5SA 3ESRA 2AMYA 2FI1A 5AVVA 3SMVA 1RMQA 1YV9A 2ZG6A 4YCNA 2CFRA 5ALGA 5AM5A 1LVHA 4B6JA 1T5TA 4JB3A 3DAOA 2FPWA 2GMWA 4PNHA 5ALNA 3ZX5A 3ZUPA 1RRCA 1QQ6A 3R4CA 3WKEA 2IYEA 4YIHA 5AI5A 4AS3A 2PQ0A 2WFAA 4E88A 2EATA 3OCVA 2W11A 4KNWA 3GYGA 3E84A 2YJ6A 5ALVA 1XP5A 2C9MA 1PW5A 5ALIA 4Y2QA 1WPGA 3OPXA 3PCTA 3NIWA 1S8OA 4YCMA 5JJBA 3L0CA 3QX7A 4NV0A 3N07A 2YJ4A 5AW8A 5AKIA 2HI0A 4RESA 4NWIA 1RC8A 3SD7A 3DV9A 2BY4A 2PR7A 3EWIA 1CR6A 1ZRMA 1SU4A 2I6XA 1WR8A 3QUBA 3FPSA 4GIBA 2WF5A 4L57A 4XQ0A 1ZOLA 2HSZA 5AKKA 4Y2RA 2EARA 3U7FB 2P9JA 3NALA 2YMPA 3ZW7A 3A1EA 3L5KA 3WKBA 1SWWA 4Y2YA 4IFTA 4HGRA 2DQSA 2YMQA 3WK5A 3QNMA 2JGAA 2NO5A 3TLMA 4HGOA 3A1DA 3NANA 1RKQA 4C4RA 4EZEA 4Y3UA 5ALOA 1LTQA 1L7MA 1ZD2P 5AKJA 3FM9A 2R8YA 5AVRA 4G9BA 2HCFA 4BX0A 2P69A 2YN4A 2FPUA 3WK6A 1ZD3A 3QU2A 4NABA 5AKLA 3L8GA 4EX6A 5AM4A 5ALUA 3WK9A 2ZBGA 3M9LA 3OCZA 5AI4A 5AW5A 3S6JA 4EX7A 3QGMA 4L6CA 4F71A 3K1ZA 1XVIA 4CE6A 3U19A 1Z88A 4NAVA 1TA0A 2HX1A 3UM9A 4QJBA 5ALFA 3E58A 4DFDA 3N28A 2RAVA 1O03A 2G09A 2ZBFA 2JAUA 1XPJA 4UATA 5AW0A 3OCXA 4KX5A 4UMVA 1K1EA 5ALQA 5IT4A 1Y8AA 5ALJA 1SWVA 5AVSA 4EEKA 2FUEA 5FP0A 4HGNA 3L0BA 3SKXA 3EPRA 1AQ6A 5ALZA 5AIAA 3ZTYA 5AW4A 2WF6A 1N9KA 5AW3A 3QLEA 2YMLA 2B1QA 2YMMA 2WF8A 3PGVA 5ALPA 2W43A 3E81A 3RFUA 3J7TA 3N1UA 5AHXA 1Z4OA 2X4DA 3QU5A 3OCUA 2B8EA 5AW1A 5AW9A 4UMEA 4Y2VA 2HHLA 3AR4A 3N8GA 3WKAA 2ZBDA 2P11A 2IOHA 3AR3A 3AR5A 3L8HA 4Y2XA 2YFYA 3KC2A 1MH9A 1U7OA 4YIKA 2G80A 2YY6A 2FPXA 5AI6A 2C8KA 5AVYA 3UMGA 4UARA 3OTQA 2FPSA 3L1UA 2CFSA 1ZD4A 5AI0A 5ALLA 2FEAA 3DNPA 3W5CA 2CFTA 4XE5A 1NRWA 3ZTWA 5AK6A 2OA0A 5IT0A 2HEGA 4H1WA 5AK4A 3OCYA 2P27A 3L8EA 2HO4A 4CF5A 2WM8A 4Y2JA 3A1CA 5T41A 4BNDA 4O8CA 2B8JA 2YBDA 3SHQA 3L8FA 4CNQA 3MN1A 4HYTA 2RBKA 3L0YA 4FFDA 4RETA 3WGUA 1JUDA 3U7GA 4OD0A 1QQ5A 1IWOA 5AVUA 3WK4A 4L6AA 2G08A 1RMYA 3NASA 3ONNA 3U7HB 2AGVA 2IOFA 4BX2A 1Q91A 4OCZA 3ED5A 4HAIA 4MUMA 1Z4JA 1L6RA 2ODAA 5ALXA 1T9ZA 1Z4LA 3WKDA 3ESQA 1YS9A 2O2XA
chains in the Genus database with same CATH superfamily
5AKZA 1XC7A 2X23A 5EE0A 4LHXA 4UHBA 3S2UA 1CK4A 3IR5A 2P4SA 1WZIA 1GFSA 1L9KA 1SPXA 3HRHA 3T9CA 1PUIA 1JZQA 4FW8A 3I04M 1U7ZA 2CZCA 1D09A 2HADA 1HDIA 1K5HA 4TYMA 3WYGA 3T7IA 1Q2XA 5LQJA 4QJFB 4I2GA 2QEQA 2HGSA 4ENQA 2AN3A 2QTWB 4ZVVA 1KC1A 3U3JA 1A0OA 3A1UA 1SOMA 3HKZC 3RVKA 2QUZA 4UUNA 2IU4A 3AZQA 2Q5LA 5E9AA 2YW9A 3VAAA 5AM2A 1RM3A 4ZXFA 3MWGA 1J49A 2SCUB 5KNCH 5L4LA 2MTBA 2ZTCA 4H15A 5K03A 5E6UA 2C0PA 1ZNXA 4UEWA 1OHHA 3OBBA 3OMLA 3D7LA 4JBNA 4F4UA 4QW8A 3BMNA 5LOVB 3ZD7A 4UQGA 1ECFA 4GXRA 1YKSA 3NOVA 3IP3A 1HKHA 4HP8A 4R8KA 4W1RA 5EZQA 4L75A 4AX8A 5C8XA 4Z7NB 1V7ZA 2RAFA 4ED8A 3PX2A 1G16A 1YZNA 5F98A 4O0LA 3L7KA 4LWPA 5DCYA 3DEKA 3KO8A 3OT4A 5E0OA 3SICE 4PGHA 2V7EA 1LC0A 5GWXA 5KU7A 2AI3A 2XH8A 1NF8A 3PNLA 1I8TA 4R5MA 1BJKA 7ICUA 5LZ8A 2GM5A 3CE9A 3Q1KA 5GTHU 3AR6A 1KFSA 3I9LA 4J9QA 4IDHA 1UDWA 2VH2A 5CMLA 2AQHA 2PT7A 2BL4A 4NCKA 4PZUA 4RVHA 4TV8B 3U80A 5CB4B 2XCTB 7ICRA 1WDWB 4J9NA 1YACA 3PZBA 1Z0DA 2Q27A 3H8SA 1RJEA 2JZNA 3FETA 3ORRA 3PRKE 3U40A 3QJYA 4BEWA 3MS4A 1CY7A 2FH5B 1NW8A 3GRAA 3LCJA 1WLYA 4I81A 4WDQA 1JEQB 3L43A 3UQ2A 3IIIA 4MDYA 3C87A 4ZZ3A 4KXMA 4F5YA 3GIMA 1X2IA 1OJ7A 4XDZA 4KQHA 3QEKA 4M49A 2KZMA 5G0TA 4CHTA 1A2KC 4W9NA 3JWHA 1Z19A 1YB4A 5ALDA 3UHFA 1XKQA 1KYTA 5CUQA 1FSZA 2HT6A 3PNKA 2H1LA 3INGA 4WSOA 4ZTZB 3M34A 2AOXA 3CSUA 3FLEA 1OFUX 4TN1A 3RHZA 5IMSA 4ROSA 5JO0A 2X9LA 2Y8EA 3VVBA 3K4HA 3T7RA 3N76A 5AM3A 4Q8EA 3B6MA 2C8LA 1JH8A 3UC9A 1O0CA 4F04A 2VXYA 1X74A 2E6KA 4RS3A 5T8KC 3NP7A 4EI8A 1II0A 1QDLB 3VCBA 2O2JA 2Q4RA 4E51A 2X58A 3ETLA 4JQSA 2QUKA 5JLJA 2WB1F 3KR9A 3DZDA 1ZJNA 4G07A 5D85A 1X86B 4Y6SA 1VIVA 2B4YA 1ORTA 2I55A 3G2OA 4FYYA 4JQYA 3JAKB 3HXPA 4GOND 4KPUA 4JENA 1LQ2A 3BA1A 4DMLA 4R71A 2WB2A 4CJXA 1KO8A 1A7UA 1T8YA 3ZE9A 2LD4A 5LQNA 5IHXA 1KMIY 1H6BA 4CYMA 2XT0A 3WWEA 1INLA 1FVHA 1DAOA 1KI9A 1KZYC 1L7NA 1MOZA 2R6AA 4I6GA 2I4LA 1EZ4A 2XTZA 1JB9A 3OZEA 2A86A 4G8JA 1TYEB 1EM8A 1NPYA 2J3MA 5AUPB 4ZFNA 4KG7A 5TSDA 5CT5A 2IITA 3K0KA 4QODA 1JIXA 3LZDA 1TZCA 4DV7B 2P2GA 2E1FA 3CINA 4GEKA 4ECQA 3FI9A 4BB6A 2JLWA 4I1YA 4BNGA 2DECA 4U7CA 2D00A 5A6SA 1MU0A 2A9OA 4G1BA 1QAQA 5ECDA 3SYKA 1W36B 3T3OA 3UAXA 2PMKA 5CRIA 3ZHQA 4YUAA 3ALRA 3HDJA 4QUIA 4QNMA 5K3OA 1KJ9A 1DWPA 5AKYA 4WVLA 2F2TA 2QRZA 4CNBA 1V47A 3KL2A 3WOHA 3L79A 4AZSA 2OCDA 2R86A 3LO8A 3Q7PA 4JN6B 2RB4A 2OWEA 1YVPA 3O8NA 2IEYA 2QZ4A 4LPKA 2QTRA 4GX1A 2DY0A 1Y42X 1LBTA 1CBUA 2H0QA 2OV3A 1NQVA 1NFQA 3I0MA 3IEKA 1WDMA 1VZ3A 4MMZB 4V02A 5LWHA 2BUBA 4A8JB 2B2NA 5C18A 3FWNA 3PQ6A 1VIYA 1X1RA 2QM7A 2TS1A 4YB8A 1NR7A 1DKLA 2PDAA 2YVQA 3D8SA 4Y0AA 4E2XA 5BWLA 1WMBA 4JWNA 1JDNA 1UBSB 1YS1X 4JBHA 4C0WA 1NBMA 3FRHA 4ZVQA 4ARZB 3QEMA 3JD1A 3PRYA 3DMDA 1U0OC 1LDGA 5C4IA 3FDSA 3IULA 4M46A 3O03A 5DNVA 3RRNA 1NJGA 3PD7A 1D8YA 1VMKA 3CNEA 4RHFA 4E15A 1PK9A 1JKFA 4HMOA 4I5FA 3BTVA 4PRZA 5DP2A 4ETNA 4ZCLA 3GJXC 2RJ3A 5DI3B 3OUZA 2KMLA 2GTHA 5C2JB 3TSCA 2W22A 5EYPA 4ME6A 4CV2A 3K6JA 4KE7A 3SJAA 3I6BA 1DFIA 3GT7A 3HKZF 2WYWA 3TRHA 1CZOA 1E1RA 2BR4A 3AWIA 1AY0A 2PNFA 2R6FA 4GYJA 4MROA 4KLZA 3RCBA 2XZPA 4OMUA 4F5QA 1T3SA 3JARB 3WIDA 4LTDA 4C3OB 3IEXA 2O5RA 3E03A 1RHMA 3IMGA 1C1DB 6ABPA 2B0CA 1HY3A 4B6GA 3VQTA 1RYMA 4BY9E 1LPAB 1XZIA 1YZQA 5JD6A 3J81A 1FJHA 3BRWA 1YJAA 3C8ZA 3WMFA 4PCLA 2X8LA 3I45A 1Z06A 3GUYA 3UB3A 2ALJA 1GKKA 1MTOA 4EABA 3KPUA 1YE8A 1H1TA 1WUTA 2F48A 3IB3A 4D44A 4MVJM 1V11A 4B35A 4HNVA 4L5JA 4Z1MD 3U6BA 4POOA 5KU1A 2DUUA 4NZZA 4XDGA 2OHIA 3HZRA 2HV8A 5TARA 4EI7A 5IM4A 3I53A 4TROA 1OQAA 3HY4A 4HRXA 3W4IA 4IYJA 3ZXYA 3WBJA 2F4NA 3WBFA 4RTKA 3VSBA 4G81A 1RYSA 2CUNA 2VCEA 3KVYA 4A73A 2BJHA 3VKGA 2BE7A 4K46A 1ECCA 3OAAA 4PHEA 3R0QA 5DBCA 1EVLA 3AHFA 3AZOA 1GTMA 2FR0A 1DG3A 3MJFA 4DVJA 5LB4A 5JCXA 2HFKA 2HMWA 1MCZA 1Z6PA 4B4OA 1L7BA 4BNTA 2W2TA 2ZRFA 1ED1A 3MBKA 5E7IA 1JROA 1KI8A 4UMDA 5ICMA 1WETA 2J3IA 2KFNA 1LJ8A 4OMDA 2Z43A 1DBSA 2D1FA 2QJFA 1GA6A 2YDXA 4R1LA 5E4TA 5GTDA 3CRRA 1XDUA 2JLSA 4GE3A 2DR2A 3FBTA 4NU8X 1SXJD 2I7DA 5JH7F 1DRVA 5EIBD 3FNHA 4WFQA 1PDWA 3DTVA 4EY5A 4JI3B 1WWKA 2VK8A 2AR0A 3B20A 3IO3A 1XN4A 4HDOB 4XLTA 3RK1A 4F85A 2IMWP 1NULA 1Z4PX 3PS9A 1RHKA 3ESRA 2VDRB 2EG5A 9ICQA 5NULA 4I1RA 1JSRA 2JBWA 1NXVA 4KXQA 3SBEA 2FI1A 2IY9A 4TSRA 3L8CA 4RIHA 3AY7A 3ILXA 1JDZA 4YPFA 4TYNA 2V6FA 1JHRA 1F2DA 2J5QA 2QV7A 1A8HA 1N6RA 1K89A 1W1UA 3G13A 5DYYA 2CLOB 2ZSIA 1Z6AA 5DTEA 3TSAA 1TM3E 4B7AA 3RB8A 5IKPA 1Z5NA 4UVDA 3MT7A 1GL6A 1N5KA 2ZR7A 1RRFA 2ZWAA 3H86A 3OF5A 3NS7A 3UUEA 1TAMA 4LXGA 1K8YB 4ECAA 2ZRJA 4K9PA 1AJEA 1NJZA 3CZMA 4FEEA 1WHSA 4GC6A 5AUQA 4D4HA 3GJ7A 4R8SA 1BKYA 5BW6B 1QK4A 3LLUA 3ONWA 2JL1A 4JGBA 1BPXA 2BCUA 4MFFA 1HQCA 1R3UA 1CUKA 3BHMA 3FXAA 2CVHA 3HYLA 3TPFA 3WMGA 5DSTA 8ATCA 5I3ZA 4BZZA 1TT5B 2PN1A 5ALIA 5AXAA 4NLBA 3L4PA 4BGDA 1CSEE 1UBKS 2QGNA 3EODA 1FFGA 1MX5A 4AM8A 5CCEA 5HM6A 1FNNA 2E7ZA 1A9RA 4D81A 4DDMA 1FS6A 1S8OA 5L9XA 1NV8A 2ZIWA 1OBFO 4WK4B 5CB0A 1QGDA 2YFKA 3PGXA 4UBNA 8ABPA 1C8KA 2GYUA 2FPMA 2E5WA 1ODLA 3DT8A 2YJ4A 4FS3A 5E2AA 4HZIA 2C2HA 1XKTA 1QU2A 1CRXA 2JCYA 1CF9A 2V45A 3GN2A 4DCVA 5JYEA 2VPWA 2CKDA 2WJZB 5D3ZA 2B1IA 1QO9A 3CNNA 1P5ZB 1ZQOA 4B79A 2NU9B 2XRZA 2W2LA 1F0KA 5LP1A 4D9JA 1CF2O 3I2KA 1V6CA 3U60B 2EJWA 1L4KA 5FIUA 1V4BA 1REQA 2I8AA 3QUAA 4MWTA 1IK4A 4BFLA 2HOIA 4K6HA 4XWOA 1Y3FE 1RQXA 1II9A 3AUKA 2WKQA 2ZR0A 4ITUA 2VJQA 4AG3A 1SJ9A 3H9QA 1QKIA 3PEVA 1OC2A 1UQRA 1NX9A 3LPMA 4FLEA 5C8YF 1AK9A 1KP9A 2I2FA 4I5GA 3VUEA 1W0JA 2O7SA 2QARB 1TDJA 2MR5A 4E46A 4MUHA 4YRKA 4MRRA 5HRAA 3C1OA 4UFNA 3GLIE 1VYHA 1CEXA 2GPTA 1K6IA 3FHLA 3NC0C 2HRRA 4YV2A 1ZN7A 1YF3A 1HPLA 2OZVA 2FE9A 2J3LA 3KT6A 3LX8A 4B9TA 3RU2A 2J07A 3V3KA 4F60A 4FBGA 3ZNNA 4BWVA 5FNVB 4RULA 5K0TA 2FWPA 2RGNA 1EK0A 3B7PA 2UZ3A 3ZIAA 1UM9A 1HG0A 3T34A 3HVRA 4YN4A 2O7RA 4CKBB 4YCSA 4Q1CA 1RHRA 4F21A 2K8AA 4BBZA 1VLBA 3FX2A 1FJ2A 3F3KA 4B3RB 1KY4A 2CJXA 4BGIA 4I1SA 1QP8A 3GLFE 4EX6A 1GQ2A 1H5NA 3GG9A 1W5SA 4CLOA 1J22A 3I23A 2Q3FA 1ZUHA 4PZZA 4RGQA 4EKGA 2PCJA 3LA6A 1D8AA 3PWZA 2X5KO 4HB2A 5KMGB 1TK3A 2GYWA 1EA5A 3BOSA 4LJ4A 4QZGA 4YAGA 2G6TA 5KSWB 2ANCA 1MQSA 3LX4A 2CW5A 1HETA 3ZS8A 3K6KA 2NYUA 1QSSA 1ZW1A 5J0SA 2HHHB 4MDHA 4HEQA 1P2TA 3ISVA 3LLCA 4QYTA 3HK2A 3ORYA 2PV0A 5GZ3A 4EHKA 5FA5A 1XGKA 1Q11A 4DF3A 5CLFA 2JIZD 5IWCA 5JMOA 3QTLA 5HBGA 4RWEA 3D81A 4JMLA 3UB2A 1QHYA 3OCXA 4PZAA 1KP2A 2JJ1D 4TRMA 1J0EA 2MCFA 3T7TA 3WHIA 2BDPA 4ESHA 1V39A 5L4NA 3NETA 1OH5A 4O4IA 1B2LA 1X80A 3OTWA 5HTKA 4RJKA 3KQTA 1L4YA 3AONB 1JTFA 3UWMA 3L8MA 3A04A 5TC4A 4XARA 2UV8A 3KKPA 1XWIA 4LC1A 4IQUA 1WY7A 3A6FA 5F51A 4CM8A 3LA8A 2JZBA 3LP6A 2EJCA 4QGSA 3DZJA 4GICA 5AW3A 5DNUA 4ZICA 4DPMA 3O8OB 2H2HA 3EFEA 4JQZA 4K26A 5E6RA 3RFUA 1XO0A 2W2XA 3SK0A 1CVLA 4ZOBA 4DNPA 1OH7A 1NBOA 1X70A 4XJTA 2QW1A 1Y3CE 4UD2A 2ECOA 3RS9A 4AURA 2WAAA 3PW4A 1P6UA 3S81A 2QB0B 2G7ZA 2QVGA 3C6MA 3S2ZA 4OXRA 3REGA 1SU6A 2R8KA 3H04A 4ESEA 3FTPA 4GGMX 4W8HA 4Y8VA 2DT5A 2QMEA 1KVRA 2PZAA 4IXDA 1IBLB 1CEEA 1NJXA 4XSGA 4ZO4A 4FYHA 4CMKA 4OATA 4J7XA 2IJGX 1XU7A 3L8HA 3SQXA 2YFYA 3ITDA 1KARA 2JPDA 3KBOA 4ITRC 3WLPA 3NYWA 1YT3A 4YIKA 2B61A 5A4AA 1NVVR 5JRZA 1NONA 2GZRA 4MGYR 4KLOA 5K8CA 3M9WA 2A33A 2AGPA 5H83A 1KFEB 5JR3A 2AFIA 4FP9A 1CRLA 3R24A 1OGJA 2XMDA 3DO8A 4KFSA 3DQZA 5L7YA 3BXPA 1CTQA 4LV8B 4AUMA 2A59A 3L1HA 3OBIA 3BD6A 4D9IA 4DILA 2LYHA 1EX9A 2QQ0A 4X6XA 2XE4A 1O9HA 4KC0A 1R66A 2XNSA 3COVA 1B3BA 3KZNA 2OZEA 3PHJA 3V5NA 2KJ8A 1WVGA 2HBYA 4GGPA 3P0FA 4Q24A 1R6BX 3ELUA 4ZAZA 2ZATA 4KIUA 4FFWA 5IT0A 2WIKA 3N6VA 5IILA 3OZRA 4RZ2A 3D6VA 4B7ZA 1MRSA 3AVUA 2BELA 4TKMA 1CUEA 2A1TS 2CXHA 2JIQA 3F4KA 2A1TR 4GVLA 5BP7A 4ZZIA 1JP7A 1X9IA 3RO7A 1ZGGA 3JQCA 4X63A 1SHZA 3WGZA 4AZVA 4Q3NA 2ZTMA 1NXXA 1ZA2A 2D7DA 2VT6A 2ZM6B 1N2XA 4I36A 5DVZA 1PLKA 5KL8B 8ICMA 1QIDA 4QLBA 3M4JA 3P9QA 4FFDA 2QUBA 5JWRA 4NLNA 1N4AA 3F7TA 5A4MS 2PUGA 2PUAA 1NJ8A 2EGUA 2E37A 3NP9A 1C50A 1XEAA 5FH9A 3GJTA 5K6AA 2CLLB 3OMWA 3OX1A 1U7TA 3N7RC 2Z2XA 3C43A 3O1IC 1N4DA 2B99A 3PGJA 2WE8A 3KFUF 3L7IA 4IIGA 4V3BA 1RPLA 3PUIA 3V4FA 4BX2A 4XWWA 4JHLA 3IUEA 2JI8A 3HP1A 4MR8B 4RV4A 2AV6A 4CEJA 3ED5A 2JFNA 3QUSA 3BDIA 4AJKA 4RMHA 2J7PA 1GZ7A 1LFAA 1SC1A 5DX8A 4RYLA 2J3HA 3K53A 4XCQA 4Z2YA 3H6GA 4P4TA 3F98A 1I2CA 4R8VA 3JZIA 2AWOA 2FSPA 2JLZA 1YD7A 1M34A 1NJ6A 4YGYA 5EJGA 5FD8A 3GPIA 5KNCA 2DKOA 2H4JA 2YWCA 3TFRA 2YFQA 4ZAWA 1GM5A 3O0FA 2CHGA 1RZUA 3R6GA 1MC1A 2GI4A 2JHCA 4GP9A 1UDAA 4V0QA 3WZMA 4BRUA 4QZVA 1I80A 1CY8A 1XD8A 5TRTA 5J47A 3KB1A 1Z4IA 1SRQA 2RMKA 4J29A 1P8JA 2Z30A 1RQ2A 4UVHA 7ICOA 3MJEA 1XRJA 3IILA 3KT0A 4NS1A 5DOZA 2FJUA 4PR0A 2WD9A 1IVSA 2IXDA 1FNDA 1W5AA 1V8BA 4YWHA 4Z7OB 3U39A 2G25A 1N8NA 2M6RA 2FPIA 2PAFA 3I1JA 3RJMA 3AUUA 3NDRA 4A9AA 2YXLA 4IUDS 1V3VA 4Q9KA 5F73A 2VYVA 1ZHHA 2GJ8A 3FLBA 2XGJA 1YRWA 2ZDHA 3EBLA 3BA6A 3IQDB 5GZ1A 2R7KA 1JRLA 1NBMD 4E33A 4OLAA 1FYDA 1YFKA 1O96B 3TQFA 1DK2A 2AZTA 4AY2A 5LMZA 3CW8X 1CB0A 2O1EA 5CCBA 4O4JF 1E18A 1UFVA 1FDIA 1AUQA 2BM9A 2OHOA 4HAVA 4P4NA 4QO8A 4TTPA 1JKXA 1SUBA 5A02A 3T9FA 4R66A 1VPLA 1EUCA 4MH0R 3LQ4A 2WICA 4XTRA 1WHTA 2QL7A 3K5HA 3VYTB 1DUVG 3AF6A 5ISMA 1DL5A 2C2MA 4FS1A 2A94A 4BDPA 3JQGB 3MMZA 4R2MA 3ANXA 1CEZA 1Y6ZA 3IALA 1ZM9A 4W9MC 5I9MA 3ZHZA 3ZY5A 2D74A 2V58A 3JQAD 2EV9A 4IRDA 1ORRA 4MUKA 2B9EA 5B1SA 3TIGA 3ZHCA 2OECA 4G1UC 1F38A 1GADO 4I4TA 5KI6A 4HDKB 1MHPA 4P4GA 3RJFA 3TPZA 2OV1A 4QUAA 5FORA 4DWWA 4M83A 3SE7A 4M9SA 4C29A 5KG3A 3LD9A 1T2AA 4JSYA 1OXBB 3ZJTA 2ZB3A 1A9SA 1IZ0A 2C77A 3O4IA 3QYJA 4KVFA 1R0YA 5COQA 2FHSA 2QTZA 3ONDA 1KIMA 4DQUA 5ALRA 4IWNA 2AJ8A 1KY5A 2XDAA 2A7XA 3LUBA 3G0OA 4Q3AA 3IB6A 2VC2B 4BJ3A 3OIGA 4DYVA 1FRVA 4X3OA 1S3SA 2WF7A 1ADYA 2FR1A 5L95A 3NDIA 2PXAA 3DHEA 4YT5A 4B3MB 2ZUEA 2R65A 2G07A 5C1DA 4N1AA 5EJMA 2QRLA 5IW8A 3VVLA 3ZLTA 1TF7A 4P0QB 5BXQC 4XD2A 1X40A 4Y2UA 8ICJA 2PMWB 3O6VA 3O9ZA 3WR5A 3LRXA 4NE9A 2D3WA 2V54A 5IJ9B 5A1JA 3ZCPA 1IVYA 1E9RA 5ARCA 1U2QA 4QXOA 1RMTA 4BUJA 2GN0A 3RSQA 5L1KA 1CZNA 1V8PA 2IHJA 4FE7A 1MTZA 3HWX1 1Y8QA 1FB5A 2C42A 5KSYA 1ZMBA 2AHRA 3FUTA 2I99A 1S8AA 5CCDA 3WTBA 3ZZNA 4Q37A 1TO1E 1T1GA 5DBBA 2VP4A 2ID4A 3UKOA 2O3UA 4LOHA 5FNVF 3CEPB 2BQ3A 1AZWA 2P3LA 2RGUA 3IBGA 3MGBA 5IKOA 2WY2D 4HAZA 1YBFA 3WQRA 2K8BB 3KOYA 1UM9B 1R88A 1TLFA 2FLKA 3EYZA 5G4KA 4O4LF 1G2PA 3EWAA 2C7PA 5KQRA 3BH6A 4J8PA 1I94B 4MO2A 5IC6A 2O0HA 2Z9BA 4JLVA 4W9RA 1F0YA 1M34E 1MEOA 2XMZA 4RCVA 3U3OA 4Y2PA 2IHMA 3HMQA 5EZYA 1ISIA 3G82C 1JPJA 5A4JA 1E0SA 4D92A 1JYEA 4MVCA 1JJAA 5EKXA 3SU8A 3WSVA 4ETWA 1SQ5A 3B0YA 1EU1A 4FILA 1CUZA 2VQDA 4L73A 1D03A 1RXWA 4NCJA 3TQOA 4YUZA 4G23A 1YWGO 1GSAA 2CZGA 3HKDB 5K0LA 1JHYA 4WA8A 5HCUA 4J3NA 2JHPA 1Q14A 2NG1A 1UBRS 4UBCA 2Q1SA 1PP4A 3I4CA 4TS4A 1PJLA 2ZUUA 3B60A 4F91B 4EA9A 1VC2A 4CMGA 1IDOA 1XB2A 1A77A 4RTNA 3B9BA 3QPDA 5DLPA 3ZQKA 4E14A 3I73A 1YO6A 3HKDA 3K35A 1A8SA 4ZRNA 3TANA 4I27A 4YRTA 4ZQIA 1KSGA 3S99A 4FDLA 3EZ5A 1JFFB 1ICEA 1PNRA 2YQZA 3JVEA 4YS6A 3VPAA 3DLTA 2XPCA 3V32A 4WGFA 1U9JA 3BGVA 3NAZA 1BZYA 4WNIA 2HQOA 2QRUA 3FFXA 1W34A 4BTVA 1QTIA 5IINA 4L2IA 4E5DA 2DM6A 3U4HA 3TSZA 1EFVA 3JD4A 2O48X 1AH2A 3HSYA 1GZ5A 4KLNA 4NJOA 3GV7B 1U7HA 3QXGA 2FZKA 2MYNA 1N1GA 3HVUA 1U2GA 3OZTA 2LGJA 3SBDA 4N18A 4NATA 4B8ZA 3OT5A 2G72A 2QN2A 1GRNA 4AMGA 4QYWA 1QHXA 4C03A 3SHWA 4GYWA 3ILHA 3HWTA 2VJOA 1TKRA 4C04A 3NOXA 1QIFA 1O3YA 2PLNA 2WSLA 3FUXA 4G4JA 4IOKA 4P3PA 3MTJA 1CZRA 2FZWA 2I03A 4J9PA 3D5EA 4NU5A 5CVCA 1G20E 5GV7A 3S40A 1NKVA 1V6AA 2AE1A 4XVCA 2GYYA 4HX9A 2FQWA 4Q3BA 1JALA 2OBBA 3GQVA 3TUZC 5AM1A 2QVBA 1YDMA 4AG6A 2GRAA 1YRQA 5EWLB 2VQSA 4DL6A 3G7SA 3SFTA 3BJYA 3D0QA 2RBGA 4KHZA 1J0AA 2LP4Y 1MO5A 5ED4A 3IQHX 4LF4B 1W1WA 2OD7A 3FDZB 2Z09A 4QIWF 5L3RA 2R8IA 1CE8B 1V2GA 4MWOA 4P0QA 3P0RA 3OZDA 2A1UA 2AZMA 3DMNA 3ETEA 1CUJA 5TT1A 3QENA 1WBJB 2XJ9A 5JH7A 5K20A 5BV1A 2EDAA 2OFOA 3IV7A 3MQ4A 2PKEA 5KFBA 1QAOA 3PZRA 2IVFA 1E20A 4TTJA 4TT8A 5KHAA 3VA7A 2NPFA 4OX9Y 2WIAA 3EGDB 3ZZ0A 1XV5A 1OXUA 2Q0SA 3EIEA 5KKNB 3MC1A 3GQCA 2WWYA 2W2MA 1B00A 3BEOA 1WV1A 1E5LA 1ZG3A 1Z6QA 2GCNA 2J9ZB 3RG2A 4EO4A 1I4OA 2GD0A 4QSMA 3TZKA 3GEPA 2OXCA 4BDTA 3W77A 1Y1KE 5KIAA 5KJ6A 4AO8A 1G42A 4KQ6A 5F7ZA 1FPMA 2XNCA 2R68A 4UEKA 1FJXA 5KYNA 2NYVA 4YRSA 1ZQQA 2GSWA 4N03A 2HW8A 4PZOA 4BQQA 6AT1A 3C98A 1JXQA 2UYQA 4FHFA 3QU9A 3CRW1 3PSAA 4HH3C 1Q1AA 3ZHYA 1PJZA 4YV7A 1JEQA 5BPFA 5TJ9A 3MMNA 4DJEC 3HUEA 2NT4A 2X5JO 1ZUIA 2RHCA 1YJCA 2JC3A 3DXFA 3R5XA 4N8DA 4CKEB 5INTA 4FC7A 1FYWA 3R7FA 4KR6A 4JVSB 3ZBUA 3K8QA 2Z98A 1NJ5A 1T3HA 2XMGA 2Y1FA 3B7GA 2ICAA 3F96A 3RUPA 5J2TA 4DV4B 3W7AA 1CYDA 2DEUA 4QWAA 2NP6A 4YLYA 4MQUA 4A3SA 1D2HA 4GRDA 2FSVC 3PLNA 5ALGA 2W48A 2NU8A 5KTOA 5EP3A 1TK2A 4PWYA 1JXOA 3GGCA 4MGEA 3SS7X 1T0IA 3IVRA 7ICVA 3S2FA 2BMAA 1Z0JA 4F06A 5C0OE 2IZ1A 1WL8A 2YYYA 1DBIA 4NMLA 4NPAA 2Y2UA 2E85A 1OYVA 3FCOA 1H94A 3DV0B 4KQ9A 2BFEB 2BM8A 2GGSA 1YVRA 2YJNA 1Q1EA 5LJIA 1UBFA 5KFTA 1GCOA 3NUZA 4OEHA 3D3WB 4ECYA 5JNLA 1EIWA 3SVTA 4Q7KA 2CXTA 2PZKA 1Q22A 4Z7QB 5FO0A 4Z6KA 2GCOA 1QQAA 4XOIA 1Z56C 4DM7A 4ZYLA 1QHFA 1U49A 4BXOB 1EX1A 2HRCA 4OGWA 1E69A 4RHEA 4CKWB 3OKCA 1EGMB 3HL4A 1WPXA 2IC5A 1QGUA 3AHIA 4HNHA 3VZDA 2GKOA 4TQAA 2VTBA 3IP1A 2ZRPA 4NV0A 5EXSA 2C03A 3R8XA 3HGQA 1JEJA 1OV6A 2KP7A 2Z1NA 3IE2A 5ECYA 3R6WA 5CX1B 4Y6GB 2A0UA 4H0NA 3SENA 3JQ7B 5JQGB 3JYQA 4ECXA 1IQUA 3AI7A 3D6TB 4P3KA 1F20A 3C4VA 3SD7A 3HJAA 5HMMA 3PRJA 1FVXA 4WERA 5ED0A 4BC0A 3WAJA 3QH4A 3TD2A 2J46A 1ENPA 3OFNA 3GEGA 4EB8A 5BOMA 3NONA 4R6WA 3JASA 1H5QA 4HPWA 4ARAA 1U80A 3U09A 1M8GA 1QIKA 5G2OA 3D8HA 3RC2A 5JHHB 1HORA 2ZXHA 4MAAA 3KUUA 5HMLA 1YULA 1ZKDA 1TPYA 4RZRA 2JJMA 4TM7A 5IEBA 3UJ7A 1JEAA 3A14A 1NR5A 4WZBB 3RV4A 3RUHA 3ZW7A 4KOAA 2GASA 4NJEB 4GPAA 2NRVA 1MSWD 3I6YA 4F2PA 3ZNPA 4BP3A 3GT3A 5HWSA 3AJRA 2H3EA 3F9IA 3LT2A 4HN9A 4M0EA 1Z2CA 4EBEA 1PK8A 3TRKA 2J67A 3R6TA 2I3ZA 3H9CA 5J2UF 5CEJA 3F3YA 2D7CA 3OJEA 3ZE6A 4M1TA 1YFLA 3GJRA 3ON5A 3T0GA 3RWBA 1U47A 1KERA 1L3IA 1ZUNA 3AZPA 1KK1A 5ALOA 1Q6ZA 1XCBA 2KHVA 2QY6A 3OZIA 1JILA 4Q82A 1DWQA 3SC2B 5C5IA 5K0GA 4A1OA 2VT7A 4TWIA 1SKYE 2I6UA 4KLTA 1EAYA 3L4BC 2YZMA 3L4SO 2GAJA 4O4JB 4TSFD 1S7CA 1GYRA 4AJJA 1CRZA 1X7ZB 5JLAA 2QP4A 3CN9A 1KPGA 1NG1A 1JLKA 1F2UB 3P2MA 1WKVA 2FRDA 3MWJA 3PC6A 2EW8A 2GVNA 1M83A 2KPOA 3RWOA 5ITZB 1G4AE 1DGJA 4R5HA 3NBFA 4UUPA 5CB4F 1MFPA 5JSHA 1C3OB 2GRJA 4JX8A 1IHOA 2H18A 3QPWA 2ZLBA 4P0PA 1NATA 3WK9A 3FFTA 4G0PA 1P61B 4QDKA 5IHPA 5JADA 2JJ2A 2H16A 3S6JA 2KLBA 3I5UA 4L4UA 5B58T 2VJBA 3R9XA 1UP6A 1QMGA 4BNUA 1O8BA 3NWJA 1G9TA 4BAZA 2XADA 1XU4A 1DZ3A 2PH7A 3QZUA 2DHQA 3Q3VA 4NBTA 4KSCA 2H3VA 2QR2A 3GHHA 1SK8A 2JEJA 3GDWA 3W2IA 1Y8ZA 3FDIA 4GPTA 3MR2A 4M0UA 4PY2A 1A8IA 1W47A 6LDHA 2UXDB 1DDGA 4KE6A 2H4HA 4JUZA 2OWOA 2ZJ7A 4TXLA 1CY1A 2H07A 4FYXA 1PWHA 4YONB 1JZTA 2IUYA 2LIPA 3OWHA 1N2HA 5LNK1 4C4YA 5EJ6A 4IRKA 3ER6A 1GRVA 2Y1OA 3ZV6A 4Q3DA 1UPBA 3PHHA 4OHMA 1C9MA 3F47A 5DW3A 3O90A 1OFHA 1SOUA 1U0HC 4QWMA 4HNGA 3ZZMA 1EUYA 4CTMA 1SELA 2Z6QA 4D9HA 2PS1A 3LK9A 2NUTB 4MCIA 4OFBA 1NNI1 4LOAA 5HF8A 2R18A 1G6KA 1ZCZA 2VPYA 5KFNA 4V1CI 3E23A 3FCUB 5LZ4A 5F9FA 3PFBA 3O8OA 4MHOA 3MSXA 1FPQA 4C88A 4IQ4A 5GPBA 2X8JA 4DZRA 4M87A 1EAMA 4UVEA 5I9TA 4PLHA 2QJTA 2Q6LA 2QAGC 3PNYA 4ZQFA 1Z4OA 1PI3A 3K0CC 3K72B 1CS0A 1E59A 2B8EA 2GO1A 4U6PA 2VIXA 3G5UA 1WUHS 2W6ID 3M6XA 5I8PA 3LT0A 4F3TA 4OY3A 3WNZA 3JQBA 3MZ0A 1NXWA 2I91A 2XC9A 4X41A 3RUDA 3FPKA 3FOFC 1TCUA 4W5RA 2IYNA 2FUKA 4H7HA 4I28A 2AJCA 1ECBA 1E2GA 2EEPA 4K87A 4P86A 4YLGA 1O5TA 5U1PA 4H7PA 2RHMA 3Q8PB 1B1CA 3QWHA 3ZY4A 4FINA 5IH3A 3IUBA 4U7HA 1T9KA 3WYAA 2Q29A 3K9GA 2WB4A 3AHHA 3MLEA 4HK4A 4DDKA 1AHPA 3KC2A 2REOA 2ZJ4A 3IQZA 3KLBA 1I6KA 4N54A 3VH1A 1BHO1 4D45A 4DYHA 4F6RB 1QHSA 2O5EA 1BHJA 1I5RA 1NHGA 3DG9A 1UQUA 1M2NA 3MR3A 1G66A 2D5IA 3DC7A 1WDLA 5SYNA 3JATA 4BNIA 1Y9JA 2FPSA 1OFIA 2P9EA 2QTFA 3QFSA 5A9RA 5HE8A 2DLNA 1VIDA 5DYTA 2OV2A 3EFBA 5J59A 4RJTA 2GZSA 3MCWA 1I7QB 5CRXA 4I2FA 1DS6A 1E62A 2W6CX 3E3OA 3Q6MA 1FL9A 5ES3A 3R9IA 3BSWA 3W1VA 1Z08A 3FPAA 1T6YA 3FSJX 3GCWA 5EJ2A 4E09A 3DAFA 3WL6A 1ISHA 2FR8C 2SNIE 1NRWA 4FSXA 3ZTWA 5AK6A 1G64A 4UCWA 4Y6QA 9ICVA 2FN7A 5DLYA 1Y33E 3TLGB 2VA3A 4L7VA 5D2CA 4BE7B 1HE3A 3ZE2B 2Q0QA 2GJ9A 2HHAA 1S10A 2XA9A 5E9JA 3SYRA 5KAPA 3W8FA 2CJYA 3ZD8A 5LMCA 1BFKA 5T7BA 1E5QA 3I6ZA 3O94A 4I3GA 5JZOA 1N2CE 3L9XA 1T25A 3FFBA 4WN3A 4PPFA 2CMKA 4Q7QA 2Z8YM 3AT1A 1JHXA 2Y0EA 1JSXA 3FWKA 3EHEA 3DDNA 4NYIQ 4PIMA 3E7PA 3ZV3A 1YVEI 5E9QA 3WGUA 4CV1A 2B35A 5C7YA 5ES4B 3GLFA 2R60A 1CJUC 2JBHA 1MQ3A 1GUYA 4CM7A 3PMNA 5KYYB 5AVUA 1OFGA 1ST3A 1U98A 1W19A 1UPXA 1TZMA 3I92A 3LLMA 3NRBA 2M9NA 1HYQA 3KYDB 3OG9A 3JVUA 1RVDA 1XMVA 2XY4A 4U2FA 1W4RA 1HOXA 2DPLA 4M55A 4UUOA 4C80A 1JX6A 2FFHA 3FD8A 4R0MA 4JBXA 3TB6A 2GERA 2YFHA 3BFJA 1YFJA 1E3DA 3FR8A 3Q12A 1P4HA 2QQGA 3ENKA 4OXXA 4C07A 1JB1A 3DL7A 3IX7A 1MAAA 5LU9A 1J2YA 4HB4A 3MRXA 2PZBA 4IH1A 2ZSAA 4P7KA 3VH4A 2QNRA 1XZNA 1R0ZA 3PL1A 1FP6A 1YB1A 3I9MA 3UAVA 4MKZA 421PA 3ZWPA 4F5NA 4GPEA 2Z2KA 1M7BA 3IE1A 3V46A 2O8DB 2ODBA 1I4WA 2OYSA 4DR7B 3GYBA 2YQEA 4UAUA 3KVOA 2PT5A 2PYDA 4X62B 3FOZA 2BMDA 2LKYA 4GOKA 2G4VA 4A4DA 1C9YA 1Z00B 3GEHA 6Q21A 7ICPA 1C30B 2JRCA 5DWDA 3RNLA 4OQMA 4OXKA 3HUDA 3I9V6 5GIOE 4KFCA 4WOBA 4Z9FA 4OI1A 1ZD5A 4HXFB 5JYCA 3AEQA 8ICKA 1A9XA 3QPBA 3T4EA 2ZE5A 4OJOA 2YHIA 3I2YX 3E48A 1KZ1A 1Z0ZA 4ZVTA 3G9QA 3IPCA 1SM4A 3OZWA 4RK0A 4WOPA 3BRQA 3RYIB 4BJ5A 4QU5A 1L3SA 4NE7A 1EUZA 2VHVA 2C97A 2LCFA 5JC1A 1YB2A 3WNDA 4OX9B 1BC5A 5E7MA 5EEHA 3WOVA 1FS4A 2XRMA 4K88A 3NTRA 4BWGA 3MW8A 4CODB 5KNBH 5DHQA 4WBXC 4AZ3B 5EWGA 4E5NA 5BN3A 3H2ZA 2ZM5A 1XXHB 4OJ5A 1YQGA 4O4IF 5CD9A 2NM0A 2V7QD 3KJQA 3GHYA 3OGUA 1QO0D 1KVSA 1YBAA 3HZOA 4J0CA 4LY3A 2Y6VA 4FE4A 4BX8A 2X6TA 3KAQA 3MBIA 3B1XA 4AIIA 2DWCA 3EQZA 4ZT7A 3ZWDA 2NMVA 2NRTA 4MI9A 4R6XA 1UXGA 2REBA 3DGFC 5KG4A 3L0OA 4TWJA 2OFXA 2QTGA 3BWVA 1HXHA 3O3OB 5KVQA 3OE7D 3F49S 3B9QA 4IXNA 1PFVA 1VSQA 1PKXA 4NBUA 4O3FA 1EE9A 2FN8A 3K5PA 3A9SA 4RA9B 4BRZA 4C7YA 1MG0A 1UF9A 1YDGA 3A06A 3CR3C 4DMKA 4PPQA 5CIYA 3L3FX 1WDTA 3WXBA 1E2NA 1QRAA 2G7MC 4LHYA 2H3QA 3UJBA 3LFUA 2ZI9A 4HN2A 1B76A 1TVKA 5JAPA 4U6NA 2LI6A 3A37A 4BB5A 1PFGA 2WM9B 2WZBA 1R12A 3AR2A 3P32A 3OIWA 1I2BA 1QRRA 1RW4A 3VPBA 5JEDA 1WQ4A 2I34A 1PQ4A 3CZQA 4YUXA 1OB2A 3KOXA 1K6MA 3SAFA 2JFYA 4FR2A 4FXPA 3WB1A 4RD6A 1RYRA 3TMAA 5IVPA 3QW2A 2FLPA 2JCSA 1J9EA 3A27A 3IR6A 4J49A 1T4MA 5COBA 2QTBA 4AP9A 1JJIA 1M9NA 4GM0A 4RV9A 1MJNA 3LXUX 1HMPA 4K4GA 1ZI6A 3L49A 3ZU2A 4JLDA 4IZIA 2FMIA 4AJ9A 3CVXA 4DOCA 4JUIA 4KAXA 3ITKA 4XYLA 1E9CA 1HNWB 3DNMA 1D6JA 3C24A 2B4AA 1TM5E 1QPBA 4KLDA 1UZAA 2E5FA 2EQYA 5FWNA 4DUZB 2WWTA 2A92A 2JLXA 1D7OA 4DMRA 2QTLA 1N5LA 5G5GA 2O6KA 3GY0A 1LDMA 3QVJA 4FYIA 4NSNA 9ICWA 3H0MB 3QKTA 1T8UA 1ZH8A 3DEIA 2RK6A 4KYVA 1NMSA 1UMKA 2CCJA 3GRVA 3KAPA 4FTWA 3M4NA 4ZIRB 1YAJA 4ZMBA 2PSSA 3K09A 2QE7D 4KGVA 2AFIB 3ETRA 2YY5A 3NATA 2GN9A 3SYMA 3OKPA 4C5CA 2BJVA 1IAVA 2A6PA 2LR0A 3FMGA 1TEXA 4Z3DA 1ENOA 1VJ1A 3QW4B 1SKYB 4PINA 4E2YA 3PPYA 3AM3A 4D99A 4KLSA 1FTYA 1RQRA 1P7CA 3JYNA 1OW3B 1Z8FA 3PDCA 2RKWA 4W7IA 4AMVA 4CWAA 5EQFA 4AO7A 2BKLA 2OBFA 3CBGA 5DHRA 3EGIA 4JLOA 3RFFA 2RB5A 3WHLA 5B55A 1E5XA 2W6PA 1O4VA 1VKZA 3OECA 4MKHA 3PY8A 3GJYA 1NZJA 3NEAA 3STTA 1J2NA 4BQIA 2BGRA 1UBMS 2B1RA 2I4MA 2IW1A 3FDFA 4JH0A 5CB6A 2Q5IA 5GADl 1P1RA 2V7WA 1XCPA 3R0XA 2QZJA 3QVXA 5HQJA 4JUFA 1TIBA 1QH8A 2C0QA 2WJ6A 3D5TA 2Q4OA 2YJZA 4JJEA 1Q0PA 4QAJA 4B71A 5B6PA 5FUXA 3TLCA 1TQ4A 3N05A 3OZBA 5IANA 4QU0A 3IT2A 2ECFA 3I0ZA 3L1JA 5KZMB 4DCCA 4B8YA 1R0SA 4FFBA 2X1VA 1VKRA 1V5GA 2FTKE 3BZUA 3EIOA 1U99A 5BNTA 3Q0TA 3KT3A 3AVTA 3PSIA 9ICRA 1X77A 4A8JA 2HA7A 5CLHA 5IDXA 2G5HB 3GRUA 1DKUA 3X1XA 2AB0A 3AG6A 1TGVA 1MB4A 3AFNA 4R1NA 3TAQA 2IOYA 3UFXB 1FUYB 2V4ZA 2SKCA 3AF5A 3EH2A 1U8ZA 3HB9A 1WZUA 4I9UA 1UBJS 4NENB 1YJXA 3VXKA 4JUDX 5DGIA 1TRKA 4RLHA 1W4LA 3DDHA 1TD1A 3AU8A 2AOUB 3UMCA 4IUBS 4JVOA 5DG7A 1R5OA 4UZFA 1M7HA 4F12A 5ALHA 1EJBA 1XYYA 3DYVA 3LPAA 4CM8B 4DCNA 1FFHA 1L5HB 3NX4A 1ISSA 4L4RA 3VC8A 5DQGA 2ZOSA 4M76B 5K8UA 4DMGA 1LV5A 4MQ4A 1C80A 3TECE 4YJ2A 4CIAA 4O3MA 3SF8A 3CH7A 2XUIA 1PDVA 1B0AA 3WLAA 3QMVA 4NCHA 2XEDA 3DOCA 5D49A 1UK7A 1ZI8A 1ZN9A 4M38A 5G53C 4JHXA 1BE1A 2DKNA 1G3MA 1UP4A 3ISBA 1OT3A 1X15A 5ECWA 5AXCA 4ZZ2A 4ZREA 3A10A 2ZSBA 3RKRA 4D8UA 4G0NA 4AKEA 1NKBA 5E2BA 3WIVA 2HNAA 1PEAA 5A05A 1MT0A 2Q21A 4WZBE 1C2TA 3PX6A 2BDUA 3L8DA 2BE9A 5AKGA 4I14A 3ND7A 2IHBA 5HQTA 4NC9A 5KWIA 2QLBA 1HC7A 3FAHA 5ITVA 2D2VA 4HGPA 4KN4A 3OOSA 2PL1A 4KPUB 5E79U 1X3SA 1ZGJA 1NN0A 4GRAA 3ZNOA 4AF8A 4DIFA 1FIQA 2GKSA 2H7XA 2JS7A 2WSYB 4X91A 2FQXA 3H42B 4ZVLA 3LYHA 4UPEA 4I50A 5A4IS 1IVNA 2A5DA 4OI2A 5EYPB 2NVUB 4CT0A 2PUCA 4GAEA 2OGZA 5IJAA 2WOJA 1K2WA 2YBEA 1Z8HA 1XSNA 2AGOA 3COYA 1C9KA 3H7AA 4MPJA 2FUCA 3HJNA 1WS6A 2EFGA 4IG9A 3WMXA 4GOMD 2WFZA 2FZLA 3K1JA 4FCTA 3QZ8A 4NOJA 4CCYB 5CT8A 1BGXT 2P1ZA 1GTZA 2R6GA 4K1XA 3Q8MA 1MD9A 2P7IA 1U6IA 3EXG2 4TGLA 2NYAA 2V7XA 3EPLA 4L4ZA 1ZCBA 1NUQA 3NJ4A 3OO0A 3EF0A 4BLPA 4RQ6A 3FE2A 1DKPA 2VA2A 2JI7A 3ZE1B 1C0KA 4OFXA 4F8YA 1OR8A 4JXXA 2QLFA 4EQ6A 2ODQA 2RJOA 2BEWB 1K1QA 4CF4A 2GBGA 2VK4A 5GAJA 5KYKA 1P9NA 4E30A 2CLEB 4D6PA 1AO3A 1SB8A 4KWHA 1VE6A 1KMNA 1FLNA 3LL7A 7ICGA 2PFQA 3TSOA 3EPJA 3JSAA 3QOWA 4K28A 5I8ZA 1L7XA 1PR3A 1SCJA 1PYDA 5G4KB 3AV0B 3VM6A 3BULA 4CG0A 3PYLA 4EY3A 4M89A 9ICHA 2WTMA 3UWDA 5KFSA 1C9NA 3CS3A 2IV7A 4U2CA 3VTZA 3ZX5A 2ECPA 2BVNA 2GMWA 3JR3A 3ZWYA 3H8JA 1PBTA 4FSHA 4I6JA 3ZUPA 5KYGA 2O2DA 1SY7A 1Z1BA 3RT9A 3EG9A 3AUSA 3ICPA 4Q1DA 4O6VA 4ZQHA 3W4KA 5FWYA 1LBEA 2BFEA 2Q5HA 3PITA 5ERXA 4U9HS 1ZQGA 1ODTC 9ICLA 1KYIA 2V7UA 1GILA 2W11A 2W54A 4QYXA 2RGDA 3H11B 3QVGA 5HK9A 1TJYA 3C39A 4OHRA 3QTTA 2YS6A 3OHAA 1MIOA 4HNAB 4QDTA 3MBYA 1PW5A 1Z1VA 2WWGA 4HRVA 1ZQIA 1WHSB 4G8CA 5HK8A 4F38A 4IRXA 3T1TA 4IV5A 4ODIA 2XKJE 5KFJA 2VHTA 3AJ8A 4IP0A 3VPDA 3MSCA 3GFRA 3WWYA 1ETHA 3WWCA 2D8CA 2NQ8A 4B4DA 4BO7A 1U9ZA 3H5NA 2DETA 2R8JA 3ZGXA 4WLFA 3QX7A 1ISFA 3JZMA 5HRUA 3FNIA 1N8SA 2OL4A 1CJVC 3VDXA 3A28A 3ZEIA 1P7WA 5H02A 3RE1A 4HXGA 3SZ3A 2WG1A 4HVCA 1EVQA 1ZVKA 3MWYW 3NGXA 2R8GA 1I14A 4FZNA 1HEKA 2IDJA 1SBYA 4B9EA 3DULA 2D5CA 3L3BA 3V00A 1M1YE 2HV9A 3VJMA 2BP7B 2P9QA 4KN7A 2ASLA 4GR9A 3KSAC 4RY8A 1MO3A 3VR3A 2ZYUX 4WKBA 1L5UA 3W6OA 1SKRA 1JNYA 1L7EA 4WJ3B 3E9ZA 4V0LA 1VYTA 4PO3X 3RSZA 3I5XA 2GXAA 5TQ2A 1QWOA 1ZSYA 2ZU0C 2N1MA 3D4LA 4MS1A 5FBWB 3IAHA 4CIVA 3ID6C 2VRNA 3WHKA 3FYSA 1HNXB 4JP5A 1JFTA 2O19A 2JVJA 4MV6A 3KQYA 1C3LA 2ID9A 3CPSA 4IGEA 3ST7A 1XCMA 1OXXK 4NL9A 1XMIA 1R9MA 4O08A 4X24A 3RVLA 3EEBA 1Z07A 2HB6A 3R40A 1F0MA 1FQOA 3HBJA 5REQA 5DT2A 2I0FA 5KDOA 1F06A 1T0PA 3C4QA 1QTQA 3N87A 3IUYA 1LTQA 1MIOB 5IARA 3FPJA 1K6XA 1OZ0A 2FG5A 3FM9A 2FW6A 2JJ8A 1QB8A 2D7JA 2P6NA 1RRKA 3ND5A 3K9CA 3G1TA 3MIZA 1GHTA 2X1LA 4FEYA 4NV3A 4PLZA 1CY4A 3QWIA 2P68A 4RDCA 4J0GA 3F6PA 2DGZA 8ICZA 3BB4A 3F5FA 2M32A 4Q6WA 5J2EA 3UQZA 2UYHA 4AWXA 1CQPA 1IB6A 3EDMA 4D6YA 1QRSA 3D8RA 3H9BA 3BREA 1DXYA 1QGZA 1QIGA 3B2QA 3MCAA 4Q3LA 2CHVA 3FJOA 4DC1A 2CY0A 2RI1A 3KFLA 1TXGA 4DCJA 4MQLA 4DTIA 2YKGA 4QYIA 5KYVA 1T24A 2XUGA 1I0LA 1M76A 3KUDA 2KHQA 4DRYA 3R9XB 3QOFA 2O8FA 4GXJA 4BO5A 3GVHA 3U19A 1PNQA 2GN1A 2BGJA 3E7FA 3K1YA 3VOTA 1Z36A 4YAIA 3A3NA 2BEWA 3PCXA 4IO1A 3R41A 1K7FB 1V48A 8ICBA 1K27A 2UVPA 4WXEA 4HPXB 3V1KA 4DV1B 3QPVA 4XASA 3R8FA 3IKLA 2FJ6A 1XL1A 1GIAA 3UHAA 1IAQA 2PZGA 1JU9A 1L5SA 1F14A 2VZLA 1TJPB 1HSOA 1PN3A 2ZBFA 4YAUA 3FVRA 1NVTA 1H0KA 2ISCA 3N0WA 3PC3A 1F5NA 1AVTA 1B41A 3DEYX 3QKSA 4ZDJA 4LA4A 4YAOA 1XLTA 3ZGYA 1O8CA 1EGAA 1DKMA 1QE0A 2X0RA 4YR9A 3FAKA 4KLFA 3OPQA 4B9UA 1O94D 5JJLA 3SWWA 3UGQA 3QVVA 1T2VA 1U81A 3E15A 3KJEA 4JT2A 4TM8A 2IUUA 4ACAA 1P9OA 4K6CA 3LHIA 3KTDA 4EBFA 5EZYB 1UFRA 1XDGA 4JNCA 2WF8A 1YDHA 4RL4A 3DMFA 2C2OA 1LSJA 5JRDS 2OBXA 5EPEA 5T3YA 2E1RA 5DNCA 3NGLA 1EDOA 1Q0SA 5P21A 2BZSA 2E1PA 3OQNA 1YZKA 2VVTA 2JV3A 3CSSA 2W9MA 1MPTA 1ESCA 1S3IA 2R1TA 2BISA 1NBME 2K4MA 4V1CA 1Z6ZA 1NW4A 1U9CA 1CEYA 4G0MA 1OBCA 1LY1A 3IUSA 4F5DA 2QTAA 3FNBA 1A9TA 3B3GA 3QY9A 3CUYA 3DL2A 1WXDA 5G0WA 2JIRA 2ZYWX 3ZGLA 1R4MB 1SIWA 3EXHC 3LAWA 4CDMA 2RGYA 3V8VA 4EVSA 1ZCJA 1PFQA 2PR2A 3K4PA 2X0EA 4ECTA 4PGXA 1UODA 3HRKA 2JDID 4IPTA 3G9TA 4JC4A 2O7VA 4DA6A 5A04A 5HOEA 2BLLA 2EBWA 3GROA 3ZDFA 4FVTA 5TB5A 2JCBA 1YR3A 2AQKA 1DINA 1PFWA 2JF0A 4I29A 2EVWX 3A70A 1M8FA 4NHOA 4YK7A 5DHPA 1UEXC 3DLHA 3RTAA 1Y8QB 2PQ6A 4IDAA 3H0EA 1ZD4A 2G4CA 5FDFA 1SCIA 4KTQA 1GLVA 1ZESA 4ON9A 1VBKA 2NU7A 4DL5A 1ZK1A 4UUMA 5FWDA 5B6JA 3UMSA 2KQUA 4NENA 2EHJA 5F9MA 2XXBA 1KR2A 3HXTA 4YRCA 4OIMA 5DB8A 1EVJA 4GD3Q 3DB1A 3IQEA 4JA0A 2XDWA 1GXSB 2JATA 5HR7A 3CONA 3ETCA 2YWEA 1Z29A 2RGNC 5AK4A 3FKQA 1T6BY 4TKUB 3TR5A 3E2PA 3G6VA 4FHZA 4N7BA 4BNNA 4CLDA 1IJEA 3DWEX 1QYCA 4G56A 1Y63A 1A96A 3ISCA 1J2RA 1NYTA 3ISTA 4U4AA 2ECKA 3CT4A 5C5CA 4N49A 4PYIA 1IG6A 3VNSA 1YC2A 1U2DA 1ZKMA 5FL7D 3OE5A 2YB4A 1SUWA 3ZDXB 5GMOA 1G20B 1UIRA 1I7DA 5IVDA 4QG3A 3ESYA 1AQYA 1WXFA 2F17A 2Y0BA 3A0RB 3CC8A 3ORSA 1CCWA 3KALA 1TTPB 3P1JA 1NJWA 1GPBA 1IWOA 4YXJA 2O4CA 2E3TA 3U3DA 3UH1A 2J0SA 2FOXA 3R0VA 1PR5A 3EXIB 5EUQB 1G8FA 5HZMA 1YR8A 2EWMA 1KYYA 1WOMA 2XUFA 3DBHB 3HDTA 1RYBA 3JVIA 5CVTA 1CUVA 1NDUA 4M1EA 5AVOA 1H1DA 3OICA 1XEWX 4I4NA 4CM9A 3A11A 3KZVA 5DM70 3TR6A 1ZQDA 3F5SA 2D2EA 4R2KA 2XB6A 4EHDA 4N65A 3Q3GE 7GPBA 1A2OA 3O8QB 3V55A 3X1MA 1DCKA 4J4BA 4EELA 1T3LA 3TO5A 2PHZA 5EIOA 1E0AA 3Q9NA 4FT2A 2F3UA 4NF2A 4PV7A 4RZQA 1E7WA 4UE2A 3DTVB 1VPVA 2RGGA 4PG7A 1OBOA 1NI5A 4LQCA 3QFFA 3OKFA 1KOLA 4F92B 2I3DA 4QREA 3ZJ4A 3QFRA 2FPRA 4BIMA 1QBGA 4BGUA 2QLMA 1BWPA 3EXEA 1IXSB 1BPEA 3KVNA 4KVAA 2JFXA 5CGZA 3ML1A 4QOJA 5BSHA 2XIDA 4LXHA 5EKDA 4N3AA 4KN8A 1IMJA 3ASZA 1BO6A 2XBLA 5DGXA 4ZAVA 3U62A 4GZLA 3UWPA 1Y6FA 3RVRA 1KHTA 3H2GA 3UANA 1Y5RA 3EXG1 4DLUA 3ZJ5A 3NHJA 3M6VA 1XDZA 3MTGA 4FYPA 4QTYA 1Z5PA 2VZ0A 2CF6A 4ZVMA 5CM9C 5F3WB 1RPJA 3TTXA 1W4CA 3NTQA 3KDPA 2W98A 3ROZA 3ZV5A 4RU9A 3EAFA 2ZRAA 1QJ4A 2ZBRA 2ZITA 3K9HA 1WSBA 1YMQA 2VDVE 3JQFA 4RK6A 1TVKB 5E4FA 4DR3B 4EBDA 1FYFA 4QWCA 5ALKA 1R6VA 2FUG1 2XT6A 3VZQA 3RSFA 1SXJA 5IBQA 2W3SA 4MWDA 2QJRA 5JZ9A 4HV4A 2AL7A 4JR0A 4ZVOA 5I9IA 1E96A 1IEQA 2PVSA 3BHJA 4L5IA 2VJ5A 4NRDA 1LK7A 2V1UA 1JQKA 2I6QA 3M7IA 4NL4H 3N2GA 5SZIA 2GPAA 5JCOA 1XU9A 3P96A 4KODA 7ICNA 3BXEA 2C29D 3FCAA 1ZVQA 2FYTA 3I09A 3QPCA 4EVQA 4FNMA 1BXGB 1YNSA 1HL3A 1GL7A 1PF7E 2WYHA 4D0SA 4BQFA 3UWOA 2IP1A 4ZO9A 3VNUA 4ZYUA 2IA6A 1LH0A 3GH1A 3EEFA 3MAGA 1RLUA 3N7PD 1P39A 1TYZA 3QXCA 4FOTA 4JIGA 4M1ZA 5DHFA 5FR2A 1Z5VA 2P77A 3V72A 2QYOA 3RG8A 3GA7A 2PUEA 5GGXA 2W9CB 1WB5A 4RJ2A 4YROA 1WXWA 1SHKA 4LMAA 4EYGA 5H82A 1NKCA 4DJAA 3E82A 5I5GA 1XMXA 4KGXA 3RASA 4MTLA 3U3XA 4PXYA 1DC5A 1RYYA 4DA7A 2GR9A 2QU7A 2OYYA 5BPHA 5BMOA 1UBOS 3KYBA 3X2FA 3ZYCA 1NRIA 5AUOB 4ENVA 2QRVB 1OAOA 5JQWA 1S0UA 1CJKC 1FXWF 2UDPA 1W9HA 1IM2A 1MJGM 1D8LA 2DX7A 2OZLB 4R51A 5L3QA 3F9CA 3NORA 3RADC 1JDPA 1Q3KA 3QYPA 1KJIA 1PEYA 3UOAB 1TJ5A 1B4DA 2PWYA 4DMMA 2O8CA 5FF9A 4C8KA 2GQ0A 3HN6A 3HPQA 5LUBA 2W7OA 1XXLA 5H2FU 5FUWA 1NUUA 2E18A 2GF2A 4MLPA 4TWBA 1EDDA 2W6JD 4IKOA 5LSAA 5AW7A 3DFKA 2WNIA 4WW0A 1OXTA 2OXRA 4XM2A 3IUNA 3NTVA 3E2EA 3AOEC 1NJ1A 3TL6A 4K4IA 2R8ZA 2Y67A 4MMXB 2DQNB 3QZ7A 2NTJA 2PTGA 5IS2A 1YQXA 1K7YA 3CA8A 3VVMA 4EJSB 1C8VB 5I8WA 1ZD9A 3E9DA 4EHIA 4OKNA 2N0SA 5FXMA 3D31A 4NLLA 4WXRA 1N56A 2NTEA 5LKAA 5LPNA 2E4WA 3EARA 1N6NA 1GPNA 5IT9A 2Q7OE 1QPZA 1OU0A 1ARZA 4BRSA 3IO5A 4PNPA 3OJXA 3PE6A 5LP6C 4QASA 2YASA 3PDHA 3IP4B 5L3SB 4F4JA 4RBNA 4JI6B 3E61A 2W7PA 1JKJA 1KA9H 5CDSA 3I2JA 3K6RA 3ZU6A 3VMFA 1V9CA 1NZDA 1IJKA 4BN5A 2BSQA 5HX7A 1G6HA 2I2CA 1M67A 1R15A 1TNDA 2R47A 3A6EA 3E53A 1Z9BA 4TMYA 2DH6A 2FFBA 4OO3A 2KHZA 2PT9A 4ZC1A 5IBRA 4DS5A 1ZXLA 2YNMD 2AMLA 4IOJA 5AESA 5DDMA 1ZQHA 2X0JA 5KFFA 3AUTA 3WGVA 4S2EA 4UHHA 4FOLA 4C0SA 4RTOA 4DV6B 1O0BA 1KTQA 2I9KA 1SC9A 1DGSA 1GRQA 1VSTA 1ZGCA 3DZ8A 3ETDA 3H75A 4K6GA 4RGYA 4TTTS 5G1NA 3ZX4A 3CW2A 2YICA 3RS5A 4MB6A 4D74A 2Q07A 5CA1B 3NWOA 2BMWA 4DZTA 2YJ5A 5FI1B 1E63A 2G0NA 1MQ9A 3BAFA 1KJNA 4UBBA 2HMAA 2INGX 2LDBA 4RABA 1NVDA 2CXSA 4I2DA 1B42A 2LRHA 1X1EA 2NVBA 1HLGA 3B2EA 1WPQA 3KPJA 3MBOA 1QH8B 3OE7A 4JJGA 1RXVA 1JR3E 3SAHA 3F1LA 4ZYVA 2HPAA 1FLVA 1H1LB 2B34A 2B8WA 3MOGA 1O5IA 1WUIS 2DWUA 1S9FA 1AKNA 1DC6A 1DT5A 3DONA 5GVRA 3CKLA 1TMYA 2X4GA 3LECA 4RE5A 4S1VA 4JP2A 1RKVA 3D2QA 1XIVA 3CWZA 3WLIA 1UKAA 2C94A 3D3JA 4LJSA 4EEYA 1AKTA 2EQBA 3ICVA 4ZGWA 1W5FA 4PC2A 2ZREA 3DZFA 5L3QB 2OH2A 4FXOA 4WV3A 3VU9B 4MEXA 1X0VA 5CA7A 2JEIA 1N5IA 2B98A 4N3NA 4RELA 3AX6A 1XZKA 1V2HE 1MX1A 1XRSB 2FX3A 2R4TA 4C0ZA 1Z47A 1Y34E 3BE4A 3ILYA 3OHBA 3DNFA 3EHDA 3FRIA 3N8IA 4NM1A 1I2MA 2TMDA 3QBJA 4FT4A 3CRNA 3IOEA 4QEDA 4QRHA 1PK3A 1WSAA 4WOJA 3G9ZA 3G85A 3ZUGA 1XVTA 4NMMA 3BXGA 4N12A 4ANFA 3LIIA 2VHZA 3D3NA 3ZJYA 3K4GA 4Y6PA 4F45A 3PICA 1PLLA 2H9YA 4DPLA 1X9GA 4KXLA 1BPDA 3TAHA 3DBRA 1NJSA 4YCBA 3H9JA 1ADGA 2D5BA 4GI5A 2QL9A 4RH0A 2Z8ZA 2C4NA 2E21A 1RRMA 4Y2SA 1ZU4A 2LBPA 3KELA 4O0MA 4Y2TA 4CCHA 2W7TA 1J8QA 5KEIA 1SXJE 1UK8A 3ENNA 3HUTA 4GOOD 1LEHA 4LW8A 3G1WA 1NPTO 1ZIXA 3R5SA 2JEOA 2F3SA 3OUUA 3E0FA 5BMVF 2BPFA 4UREA 4AKHA 1SUFA 5F5LA 3KQUA 1NBWB 4QRIA 4UOEA 4CIBA 2VTDA 4X20A 3KR0A 1ML3A 1TFRA 1EJ2A 1P1FA 4DWVA 4DDWA 5DDYA 1N0IA 5A7FA 4ND2A 3V4VB 5I7HA 2FU5C 5HCNA 5B66U 3G79A 3TL3A 5BV0A 5EE5B 1DG9A 2OILA 2AI2A 3H13A 3VISA 4TTRA 1ZD8A 3DE4X 3K9WA 3I8XA 4IFIA 4XIFA 3X2SA 1ODJA 1L4FA 4D98A 2ST1A 1Q8KA 3DHYA 4ICIA 4J0FA 1ZVJA 3NTOA 3W2HA 3MGHA 4ED3A 4CIWA 4BX9C 4HS4A 5G0VA 1LB1B 1NRXA 3OZGA 3RS2A 5CA0B 2AMYA 1D0IA 1ZHFA 1LA2A 3K9LA 2W4IA 3HKBA 9ICBA 3P27A 2X8AA 4FM9A 2IQIA 4AXBA 4NZPA 1VMEA 1BDIA 3QE4A 4YCNA 1P4JA 5K4HA 4LXIA 1ENZA 2FK8A 4G84A 1SVIA 1GNPA 2FPWA 3KEQA 4IYRA 1DMSA 5FKJA 4QBIA 2PKRA 3S44A 5L40A 2F44A 5I3CA 1XR3A 3PYMA 4AICA 1FSGA 4Q3EA 4INOA 2DFKB 2NZ8A 5C3MA 4YIHA 4X7BA 2PQ0A 2XKKA 3GUHA 3KKEA 1T15A 4TV8F 3D6AA 1G4HA 4I2BA 1GO2A 4LOLA 4KNWA 5HQ3B 4Z53A 4GQAA 1PV1A 2NU8B 5BWMA 3JALA 4E5YA 1T13A 1ZK3A 1VCNA 3KTQA 2KSOB 5EVJA 2J6BA 2ENUA 3F3SA 3IBSA 2DSTA 2QB5A 3TRDA 2QT9A 3OM1A 5REQB 4KR3A 5FLYA 3ICXA 3NIWA 4B1FA 4V2IA 5J8YC 1MABA 3DHVA 5EJ4A 2IS2A 4E0DA 1P1IA 1G8SA 3HCDA 2JFQA 3I01A 5TQ2B 3TI9A 4EZ9A 3N07A 3UATA 1JBKA 3AKEA 2IHUA 4MCHA 1XTVA 4BAUA 3EZ6A 3FTCA 1DEHA 3CLTC 3QSGA 7MHTA 2QGZA 1M66A 3NT4A 1QCCA 1S5PA 1DQYA 1TJNA 3GOQA 3O91A 2DSNA 3UXNA 3L7OA 1RC8A 1QR2A 4L8VA 4G3IA 1ZK2A 4EYEA 1ULZA 3R20A 2A9VA 4NZYA 2Z5LA 3WL7A 4JC8A 2CNOA 2C7QA 3QBEA 3VDQA 1TF5A 4ZMRA 2VJPA 3JASB 4EGSA 1HH4A 1ORVA 4X65B 3PFFA 3RKUA 1QRTA 2W9CA 3HWRA 2JRZA 2WHXA 2IS4A 3DZCA 1E61A 4JWKA 1VCMA 4NQRA 4AN4A 1KIFA 2RI0A 3URMA 3QVWA 4MGKR 1X9HA 2Q4BA 5DN6D 1J1IA 2ZDGA 3WKBA 1CFJA 3HXLA 4KTTE 1TECE 2PVPA 8ICOA 1U1FA 2MMGA 4FZJA 4IJWA 1NOJA 4IDEA 4XB2A 3GLRA 4NFYA 1B74A 3OWXA 3DD5A 4RZSA 3PR3A 4PLCA 3VHXA 5KB3A 1YZYA 5JNUA 3JPYA 1XYGA 4MKGA 7MDHA 1SQ0A 1DNPA 2G1UA 3LT5A 1GCIA 2ZWOA 2ZBVA 3BZCA 1RYNA 3GLTA 4N47A 2JMGA 1DQPA 2HSDA 2EIHA 3PDUA 4U9IS 2GYVA 9ICTA 2VSQA 1BD3A 2ON6A 3E9YA 4UNPA 3C2QA 2GILA 1SIOA 1EXWA 4R63A 3AEKA 3HW8A 1Z0KA 2Q6TA 1KJ8A 2R751 2HC9A 3FRJA 2YWBA 4MVYA 4ZT2A 1ZGBA 4BU0A 1EEHA 5E7JA 1ZZGA 4OK3A 4BX0A 2C00A 1C4KA 2NADA 3LNCA 4DA4A 4G5FA 2J5KA 1TK5A 2LE0A 2Y68A 3FGZA 2WZQA 3FPLA 4RTMA 5JS8A 1B26A 3DXXA 3VYVA 2Q8PA 3AEZA 1T10A 1P2VA 2ZJOA 3RUFA 3NB0A 3PF8A 4Q7JB 1OJLA 3FCEA 5CHEA 4PS0A 1ZQJA 2CSUA 4EX7A 4F71A 2ZBGA 3MCUA 3PR2B 4IX9A 1H2YA 4L6CA 5FTJA 3ZI0A 1U3TA 4UQOA 4JYAB 4E12A 5J1SB 3TOSA 1VG8A 2R1TB 3TXXA 1QQBA 5A03A 1NLZA 4NAHA 2AK2A 2OBLA 3NQ41 4GI2A 3TKLA 2ZUSA 5E0KB 5ALFA 3KQKA 1HEUA 4P4SA 4YJ3F 1IM8A 1PD0A 2RAVA 1TQ2A 4MR9A 2ZP1A 1ZNQO 3GI1A 1CWUA 2WU1A 1R4MA 3X3HA 5K0ZA 5HDQA 4ENUA 5IAAA 1K7CA 2E9SA 2VUSA 3BHNA 3MB5A 3QX8A 3AW8A 3GVXA 4CTNA 3GNQA 1ZAYA 3EC1A 1XNQB 2HXGA 2XRYA 2J4FA 2EP5A 4I8IA 4UHDA 2KE5A 5TR9A 5EIEA 5BUSA 3ENQA 1S2LA 1FFXA 2J3KA 2JH8A 3E22B 3HKEA 3W7BA 4PFQA 4EGFA 1QP0A 3UQ0A 4RUCA 5JYDA 1I1HA 1KEKA 1VBMA 2HLDD 4R8UA 4WL0A 1JX4A 4NY8A 2Y2VA 3KVRA 4RJIA 4X85A 4PG8A 3OLQA 4E5KA 5C37A 4CR7A 1D4AA 1B8PA 1YRAA 2I8CA 2WU0A 1O2DA 2YR0A 1A0PA 2YMMA 3ESAA 3H1BA 3SEFA 1RI5A 4HY3A 4QUEA 1QFSA 1T4CA 3JVDA 2JA1A 2CEKA 3N1UA 1XDDA 4QPPA 4TKUA 3TW8A 3WXMA 2IQ5A 3UXMA 1ZMOA 4OP2A 4LWOA 3VHQA 4BQOA 5AW1A 4L50A 4QRDA 5TV2A 1NK5A 4NFHA 1E60A 2B8TA 3SOPA 3QVOA 3G49A 2JIZA 3GZJA 3MCTA 1XEXB 4LCEA 4MK4A 4MZDA 2OPHA 3T95A 4JCCA 2E8OA 1Y3AA 1JIUA 2WHRA 3KKLA 3AUFA 3BWXA 3CW9A 3O0TA 5D5PA 3OUTA 3G2IA 5G1PA 4A7PA 3MJSA 3TTYA 3QWBA 1NOKA 2R11A 1QR6A 4QPNA 4HVLA 3G7UA 4Y2XA 1W30A 2VDLB 3I2GA 4F4KA 3QFHA 2FWMX 4MAMA 5MN4A 4KPYA 3CGWA 5JAOA 1O9GA 1K7XB 5BWBA 4W1PA 4OA8A 2BUCA 3NNNA 5LBUA 3T1QA 3U4AA 2I4IA 5AVYA 4QOIA 4YT2A 3ADOA 2Y0CA 3R3VA 1U28C 4XJSA 4CL0A 3NT5A 4LRUA 3OTQA 3IDOA 1QZXA 1LRLA 3GUVA 4JX9A 3U1VA 4AKTA 5JAQA 2CV2A 3NBZC 4PX5A 4D8TA 1NKTA 1TA4A 4F5PA 3D8UA 4ZP1A 2ZAGA 5MDHA 1L4EA 1SAYA 3PNSA 1QFZA 4JXKA 3U7QA 2VBFA 5THKA 1GNTA 5J2UB 3HA7A 4N82A 1X19A 1N63A 3G5MA 2BPGA 1RQ7A 4C7OA 3HPRA 1U31A 3RJ5A 2BFPA 1G8HA 5KQGA 3JQ9C 2HU5A 1ORDA 2BHRA 2VDWA 4PC7A 4P33A 1HIWA 4LQLA 4WASA 1SD1A 4F4YA 2WJVA 3FVWA 3O82A 1RSZA 4R1MA 2C9CA 4QU9A 4RD3A 1QYDA 4KXFB 4CG1A 1IY9A 4R9SA 1ZQUA 2DFTA 2YBDA 1ATZA 4GEGA 5CEEA 4ECRA 5KTYA 5TISU 4GNRA 1V8DA 3MN1A 4PQGA 1N5WA 2ET6A 3MK31 2OB2A 4KL8S 5KT3A 3FWYA 1SV0A 4LDZA 4WNAA 5FAXA 3GFOA 2NXNA 3UHPA 2PCLA 1KYQA 4FHEA 3VUFA 3ZV7A 2XW6A 4EUNA 1PFUA 4NMXB 1QQ5A 4B84A 2YL2A 5IEJA 4Q19A 3ZWNA 2CV0A 1FU4A 4R1PA 1E3WA 4HYKA 1PS9A 2HLHA 3ABQB 3CF6R 3DBRB 3JAWB 4FNGA 3ELBA 4HDQB 4CQLB 4WLUA 4X3CA 1XJ5A 1DRGA 1O6BA 2W6JA 4NDAA 3ZHVA 3BJIC 1E2DA 1QFXA 3LG2A 4RSMA 3WGOA 4ECZA 1U0LA 5K1ZA 4NZNA 1BXGA 5DW0A 4ZCQA 3MLBA 4YXFA 3KWLA 5LFAA 1C0IA 3QVSA 4QA9A 2HDHA 5IC4A 3HI6A 3KQHA 4ZOEA 3G7NA 1VBNA 3QLJA 3PZPA 2Q28A 4C6TA 2Q4DA 1GUAA 1O6GA 4KR9A 1NP6A 3E8MA 3TCKA 1V4VA 3DXYA 2PRYA 4FMPA 1R6UA 1Y88A 1TA9A 1TQDA 3C3WA 1OFVA 1F1BA 4DLNA 3GJ5A 4RM3A 3JWJA 1MUUA 3SZLA 3WYCA 2AIRA 2FPGB 2FLLA 1AURA 1TVAA 2RHGB 3EFOB 3HFJA 1TC1A 1PWEA 3L7DA 4MUBA 4RFSA 2AQ8A 3KHHA 4YBZA 3RH5A 4AX4A 2PZ8A 1TQ6A 3COSA 1DXHA 3NVKI 1IRXA 2IDMA 3D3EA 3CUVA 4S3MA 4XIGS 2VI5A 3KYJB 4Y6OA 1NTOA 4OU5A 4BFXA 5F9HA 1ESDA 2PKWA 5ER6A 3TZQA 4BFSA 4E3ZA 2XOKA 3D3WA 5SY9A 3WQSB 1G38A 4HJRA 1FLDA 4RAQA 1Q21A 4OMCA 5AVXA 4IXMA 3F6CA 4YDRA 4R68A 1NYQA 3VR3D 2N42A 2QN7A 5TMBA 3I9FA 3IJ5A 3M2TA 4EYKA 2QX8A 2G1JA 2PKQO 1W7AA 3UQYS 4DMHA 7ICMA 1JHMA 1YDFA 4LXUA 3HJRA 3KOOA 4IQTA 1C1XB 2I6FA 3IEPA 4I8XA 3SVZA 1GPKA 4JLMA 4M9LA 4UTZA 5EINA 4PL1A 1Q7CA 3H0CA 2D0OB 4ND5A 4F4XA 2B3TA 3R5TA 3ZKWB 4KLAA 5KJEA 3FZQA 5C4MA 3SJ7A 2QX7A 4DCOA 1PS0A 2NVUA 5EPOA 4FZVA 2B0JA 4OHUA 4N41A 3PW5A 3GLGA 1NQAO 4W5WA 5J2HA 4HRAA 4QLOA 1MABB 3NTXA 4NBKA 1KEZA 2FX5A 2FPKA 3M1LA 3ZDDA 2OFPA 2OTCA 1GA1A 5DBHX 4EZ6A 1ZY2A 3UKDA 1C0PA 2MYPA 2C4TA 4GBJA 2F43B 2FSUA 3NHRA 4M1KA 5TJHA 1PK1B 1XNHA 2GHRA 5JBNA 1RPNA 4KU4A 1N57A 3WV4A 3TOZA 3B9JA 3PX3A 4H6XA 8MHTA 2PUVA 4LZLA 4M9HA 4C20A 1BDBA 4RSHA 1XROA 3HN7A 2OCLA 2VL7A 1RKUA 4I50B 3TOXA 4EHBA 3FN4A 2ATCA 2HK9A 2NZVG 2HM7A 2CLFB 3LY5A 4KFRA 4RDHA 5TGDA 3H16A 1EPUA 4WZZA 4TL8A 2CFIA 4AMYA 4X94A 4D0RA 1EIZA 4FYJA 2JI9A 2Q1UA 1PUXA 1YH3A 1XJQA 2BRUA 1WVMA 2VA9A 3BAZA 3IHKA 1ZJ4A 2FOLA 5G02A 5M2QA 5EWLA 1E9DA 2O7NA 4BTLA 4OI4A 5LJLA 1ABBA 1PJCA 4EM6A 5A3QA 3NLLA 2O2GA 1M34B 2RHDA 1WCNA 4RAOA 4RLFA 1I2ZA 4RZHA 3RB0A 1QB7A 3QIVA 3BK7A 3FF1A 3GJ3A 4QULA 2OYRA 1R10A 1ZQMA 1M1UA 2VF4X 2ONKA 5JJIA 1Q5PA 3BTUA 4I2VA 4RD0A 3UF0A 4QZEA 2HIMA 2R8OA 3KEOA 1OW5A 3NVVA 4BYMA 1H6CA 2OGWA 3HJBA 3QRWA 1KWGA 3KUKA 1UPCA 4YAJA 3IP5A 4CFSA 1XX6A 4G5HA 4IRMA 4LJRA 2JAXA 2RARA 3PXUA 3LYAA 4Q1FA 5CITA 1LWNA 3GUCA 1FU7A 4WK2B 1Q0HA 2NUPB 3RRXA 1ZYQA 2Q5FA 5KFYA 2Z08A 2BKEA 2Q0XA 4DUGD 1E98A 1L7OA 1PJ8A 3NPMA 2Q4TA 5KVVA 4RTSA 1ZLYA 2IGBA 3QYFA 1EZ1A 1N3BA 1ZRNA 2ADOA 3R77A 3ROEA 4DLTA 3ZCTA 1Z2AA 2OORC 1KZGB 3K5WA 2AA3A 3OPMA 4QGBA 2P79A 1EBFA 4IS3A 2XICA 4JLJA 3AETA 4E70A 1GRRA 2JJ1A 2HIHA 5J0QA 3VR5H 1DCTA 4RDIA 4V03A 1A71A 1T91A 1QO0A 3FZYA 1EK2A 4LNUA 4MV0A 2KG5A 4R16A 5GM2A 2NAFA 4CUKA 1T2NA 3DZIA 2QS9A 1LW7A 4G97A 1Y1SA 1FDOA 1FEZA 4DFMA 5HXAA 4MRPA 4K9DA 4XQCA 4L5YA 5EIXA 2B25A 1N6PA 3W2EA 1XLVA 2OEPA 1DC3A 2FSVA 3GJZA 1Q20A 4O2BF 1T35A 1G7RA 1C3JA 5BSUA 1P33A 2IYUA 4QQFA 3VU3A 4P5DA 2OCGA 1JGTA 4GBMA 3KSRA 4LJ5A <