1WUDA

E. coli recq hrdc domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
NYDRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIRAHVDGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conferring Substrate Specificity to DNA Helicases: Role of the RecQ HRDC Domain
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords ATP-dependent DNA helicase recQ
total genus 19
structure length 77
sequence length 77
chains with identical sequence B, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1wudA00
4QJFB 2HBJA 4NLBA 3SAHA 3SAFA 4CDGA 2HBMA 5C0YA 2RRDA 2KV2A 2RHFA 3SAGA 2HBKA 2HBLA 1GO3F 2E1FA 4NLCA 3CYMA 1WUDA 4CGZA 4O3MA 1D8BA 2MA1A 4OO1J 1YT3A 2DGZA 2E1EA 4QIWF 2CPRA
chains in the Genus database with same CATH superfamily
4K4IA 3RJIA 1QQ7A 3A0BU 3RAQA 4US9A 5AIBA 2I6XA 4QZAA 4XA5A 2Q0ZX 4M9NA 2XC9A 2EQYA 5ALRA 2C2RA 1ZQLA 2IHMA 2KFNA 3V6HA 4B9MA 4UATA 3RRHA 2HVHA 4QWDA 5KT6A 2ASLA 3RJKA 3CRXA 3GIJA 4JWMA 5J2CA 3LK9A 2FMQA 2F1HA 5AM4A 4Q8EA 1Z00A 2M9NA 2DBYA 5ALVA 3JPOA 3I28A 3THVA 5KFWA 1ZQTA 1T8EA 2HVIA 2CRXA 4R8UA 1A0PA 3C2MA 4UASA 2VA8A 1N2XA 2BPFA 4F5NA 5AK3A 4A8EA 5AI0A 5L1IA 3K75D 3WKAA 4TURA 1F5SA 4YVZA 5L1LA 4DS4A 2AQ0A 4IS7A 1X66A 1PK1B 3PNCA 2G5HB 4ECYA 7ICKA 4GLXA 1XSPA 1D8YA 1HJPA 5C0YA 5J2FA 2BDUA 4C4RA 2H3FA 2F76X 3RR8A 1ZQVA 2RLTA 5AKIA 3PMLA 9ICCA 1PK1A 2R18A 3BQ2A 5B5EU 1TAUA 4ED6A 1Z19A 5ALZA 3Q8MA 3HJEA 2G06A 2VKQA 4GXIA 4DQRA 1U48A 5DB6A 5EE0A 3QZ8A 4DL4A 4RNNA 4F5OA 2HHUA 3BS5A 7ICUA 5DBCA 7ICRA 2XI9A 3K1ZA 4F91B 4Y2YA 8ICJA 1N63A 4OJLA 3JPRA 3NS1A 3NVVA 4NJ8A 1ZQBA 1QSYA 2YX8A 2EZXA 1S0NA 3QXGA 8ICSA 9ICKA 3NTUA 2ZIXB 5D46A 4ELUA 9ICTA 4RQ4A 1U4BA 5CB1A 2F1JA 5J0UA 9ICRA 4EBDA 1ZQSA 4P4OA 4C7ZA 4UAUA 5GTIU 8ICKA 3ICXA 4Z6CA 5KAFU 7ICHA 3ISDA 5B66U 4KLMA 4QNLA 2HOIA 4IQTA 1URJA 2MRLA 2WF7A 2W9BB 1FFVA 2ZIVB 1TAMA 2FMPA 5KG5A 4ED7A 2N1RA 3HRDD 4F4WA 2LBOA 1ZD2P 3S6JA 4M6WA 3SEIA 3Q8LA 4F5RA 3H8WA 4YXMA 4Y2QA 3IG5A 2HBJA 3ZI4A 1PK3A 3HX0A 4QZ9A 5KT2A 1NZBA 4B9VA 2F8LA 5DG9A 3ETLA 5CWRA 9ICBA 2J6SA 4NLCA 4YQWA 4I29A 3L5KA 4UAWA 1SZHA 1NK7A 1EXNA 1KN5A 3PW0A 1UT8A 4PGQA 4IL6U 4J9SA 3SENA 5AKLA 3L3FX 1T3NA 1SWVA 2XY7A 5EE9A 3ZD9A 3H4DA 2DL0A 4KLOA 1UQVA 2YN4A 3AQFA 3MDCA 1N5XA 1ZQAA 3DEEA 1TK8A 2HBLA 1XO1A 1CEZA 3ISCA 5DDMA 3M9NB 9ICHA 1QTMA 5ALWA 4YMOA 4UB6U 3M9MB 2E8PA 8ICRA 1L7MA 2JH7A 4U6PA 5ALGA 3Q8KA 3WU2U 2HBMA 2OHFA 3UQ2A 9ICQA 4I2EA 2NRTA 2VANA 1NK4A 4UB4A 5ALOA 5KFJA 4M9HA 1MN8A 4DEZA 3EYZA 4O0IA 2DKXA 1K1QA 2LYAA 2OXOA 5ALUA 2XCAA 2HCFA 3F53A 2P6RA 1X9XA 5KT4A 1X40A 4CF3A 3NRWA 3D2NA 3QE9Y 2ZTEA 3HILA 4RQ8A 5D4BA 2A1JA 4KLDA 4PH5A 2KSOB 3M6KA 1N60A 3M8RA 3MR5A 1QQ6A 4PHPA 3PX6A 2FMSA 2FJ6A 4J9NA 1SGGA 3A0HU 4ECSA 4KX5A 2W7OA 1S0VA 2WF5A 4MEYA 5HHHA 4UB5A 2A3VA 4FZMA 4NV0A 5KFLA 2QLTA 3RRGA 9ICUA 3PO5A 5G5GA 2JZBB 3RB3A 4NL9A 5AI6A 2ISPA 2ZIUB 7ICJA 1VJ5A 1FFUA 1U49A 2JEFA 4B9TA 2W9MA 3SQIA 1L7PA 3RB0A 1NK5A 4JK1A 2YMMA 3UPQA 4M6WB 4DFPA 2BQ3A 1HEKA 2RRDA 2H3ZA 1DK2A 2Q4TA 5IIOA 2ZTDA 4QZBA 4J9QA 4XUSA 2ESEA 1JALA 5ALSA 4US8A 2AGQA 2V4QA 3KD3A 4F4ZA 5EOZA 2EAOA 4RQ2A 1O08A 4QWEA 1ZQCA 4FE3A 4QZIA 3B0YA 4PHDA 4DOCA 8ICIA 3F5AA 1Z4OA 2KZZA 3EWAA 4F2SA 2BCSA 4O3SA 3IM1A 2XY5A 3KTQA 1Q8KA 2AXTU 3PR5B 3F2DA 1SL0A 4GIBA 3HKZC 2B0CA 5KG2A 1OXJA 5J2KA 1ZQYA 5J2GA 5K4LA 4RT3A 4KLGA 3WK6A 2LPEA 5KFKA 9ICIA 4QIWC 4OCZA 4USAA 2NO5A 1SXEA 4ECZA 1JIHA 2MSNA 1HUZA 3IN5A 1RDFA 1T3QA 5KFFA 3MR2A 5DDYA 1KKXA 3WKCA 4DL5A 5ALNA 2GH1A 4Y2JA 1T7PA 3MFHA 1S10A 2K89A 2K8AA 5BPCA 2IA6A 4P0QB 2H3VA 2XGQA 1RQLA 4DFKA 3HPOA 2HBKA 4IC9A 5KFHA 4NLKA 5CR0A 3N7SC 2H3QA 3UMBA 2BCVA 5TZVA 1RXVA 1KEJA 3FM9A 8ICUA 5KFRA 2F3NA 2LI6A 4PHAA 4O5CA 1ECWA 4JV2A 8ICXA 4CNQA 3AN1A 4J9LA 1JUDA 4F72A 3QUTA 1YZ7A 4Z6EA 1NKEA 2IMWP 3N7PD 3T5HA 4CGZA 8ICQA 2O6KA 4YMNA 3LVVA 2F1IA 2DGZA 4QZHA 3GV8B 7ICFA 4IRDA 2R8JA 3QX7A 3AQEA 2DWQA 4F2RA 4C4TA 2L5YA 1YZ6A 5ALXA 3TADC 4QWCA 2LMRA 3MGHA 3AM9A 1WWVA 1BPZA 5AK5A 4K4HA 1JXEA 1SKSA 2BQUA 5KFEA 3KBBA 2W3SA 3TI0A 1PVRA 4JUZA 1V9PA 3QUBA 2FPKA 4I2HA 5J8YC 4LZGA 2FPMA 4TUSA 2J6TA 5KFNA 4QZGA 2KKVA 3PSFA 3PW4A 1XS9D 3PX4A 2QKQA 2EZYA 3F2CA 3FAHA 5J8YA 1NJXA 1Q46A 2NRVA 2ODGA 3J81j 3OSNA 4I2AA 7ICTA 2NRWA 5KFOA 2BZFA 4I28A 4AYBF 8ICPA 2LM1A 2RQ5A 4BX9C 1JXLA 2K4EA 3IHQB 1JI7A 1NI3A 3H8MA 2G08A 4AP9A 3SI8A 4YR0A 5AHXA 3MBYA 1A77A 2FLPA 2WFAA 3OJSA 2MUTA 3N97B 4Y2TA 1ZETA 9ICFA 2HOQA 3M6ZA 1Z4NA 4BUGA 4R65A 5IILA 8ICOA 4EX7A 4J9PA 3V7JA 4M9LA 3H0MB 1X42A 5HP4A 4O3QA 4M47A 1U45A 8ICNA 3ALRA 4EBCA 4IQUA 3BJYA 5DG8A 7ICNA 3KHRA 3IDWA 4I2IA 3RJGA 5KTQA 2E1EA 1XU4A 2E8NA 2GOLA 2G5IB 7ICSA 1XC9A 8ICYA 2EZZA 8ICVA 5TISU 3SAHA 4HAIA 1QLNA 3ORYA 1VDVA 2GWSA 3HWTA 1BPEA 4EZ6A 2PKEA 1H38A 5CA7A 2H3IA 5AM3A 1WUDA 9ICOA 3PW7A 4J9OA 3OTQA 2PXIA 1Z1VA 5HHIA 1X6IA 4BWMA 4TQRA 4O9MA 5KFCA 2CPRA 4QW9A 3MGVA 2KG5A 4DSJA 1T4GA 3NVZA 4ED0A 4EYIB 3KZXA 3EPGA 3LVWA 3RH4A 1UT5A 2P6UA 3C2LA 5J2DA 4RQ3A 1KL9A 5KG4A 4JV1A 1ZQZA 1NKBA 1FEZA 4DSFA 3RTVA 8ICFA 1WG8A 1WYGA 1D9FA 2DFLA 1PZNA 1D8LA 4IR1A 5A0LA 2QB0A 1COKA 5T14A 4P2HA 5H2FU 1RM6C 4F5PA 9ICXA 2ASDA 2HI0A 4B9NA 2XO7A 5DQHA 4ELTA 5HNKA 3RH6A 2RHFA 8ICMA 2W8LA 3GFKB 8ICGA 1V97A 3MFIA 3BQTA 5KT3A 2J6UA 2QARA 3N28A 2WB1C 4ED2A 4UB8U 4ZOHC 1WWUA 1IM4A 1F44A 2W43A 3AL0B 2DF4B 4Z6FA 4R64A 5J0XA 3PZPA 4BGDA 5L1MA 2XY6A 4DQPA 1U47A 4KLTA 1KFDA 3PSIA 2B21A 4C8NA 5KFBA 1BPYA 4ECRA 2JGAA 1ZQHA 4F71A 4IR9A 2JXJA 5F3XB 3C29A 2E8MA 1NJZA 4CF5A 5DGAA 2F8KA 3V7KA 4I2GA 3LYSA 1MQ3A 2KNJA 4PZNA 4I2JA 1SWWA 2ZJ5A 5CHGA 1X9WA 2K8BB 4DWIA 4DQQA 1JMSA 3OJUA 4EZ9A 1IXRA 2R8IA 5DGBA 9ICMA 5F9LA 5D49A 1SV0C 2V4RA 1SXDA 2JV3A 5KFYA 4P0PA 4UAYA 4FZLA 4YXJA 4E0DA 3SV3A 1ZQKA 2JZBA 5J0OA 4UB2A 2AHOB 3KHLA 2DQNB 2KN7A 4DOAA 2LM4A 2YMLA 2WF6A 1PUZA 5CRXA 1GO3F 1ZQWA 3E58A 5KFUA 5AK4A 2K4HA 1N61A 4Q45A 3RJJA 2HHTA 4Q44A 4ICAA 2Z7JA 8ICEA 5ALKA 5CEHA 2PFPA 1Y88A 2OWOA 4Q8FA 2KZ3A 1RYRA 4MHVA 1KBUA 1UPHA 7ICPA 3QNMA 4OJOA 1NK8A 3BDPA 4O5EA 5KFGA 4UBBA 3U26A 3T5KA 4DLEA 2ZJAA 3C1ZA 4QWBA 4XRHA 3FDSA 3UM9A 3TANA 5ALYA 4UB3A 2D6FC 2ASJA 5EWGA 3JPQA 2KV2A 1LB2B 1V85A 2FLLA 2G09A 1RXWA 2ZIUA 4J03A 3NVYA 4M2YA 2GO7A 4IQVA 3GV5B 4GFJA 2K60A 2VIXA 2EAPA 4Y2VA 2W9CA 4PL1A 2JEJA 4QJFB 4ELVA 5DKWA 5J2JA 4Y2UA 1S97A 4KLHA 3I1YA 1XSNA 1OW5A 9ICLA 4ECQA 2EH9A 2ZIVA 3M1YA 3KHGA 4Y2RA 4P0QA 2FI1A 1CUKA 2Y0SC 1BPBA 4OJ5A 4R66A 4EEKA 1ZQ1C 4DL2A 4O3RA 4M0AA 3KKAA 1ZQEA 3EZ5A 4UAVA 4XQ8A 2LHTA 4B6JA 4NWIA 1CRXA 2MA1A 3FC4A 3BZKA 3V6JA 4I2FA 3QZ7A 2W11A 3ZDEA 3TFRA 3MR3A 2GLEA 2ZIWB 2BCQA 3JPSA 2AJQA 4R63A 3L4PA 2BHNA 2VJ4A 3K1RB 4RPXA 4GC6A 3N4MB 3IG8A 4LJXA 5DQGA 1JX4A 3KFUF 2NRXA 4OO1J 4PJ0U 9ICJA 1ZQDA 3DDHA 4ECVA 1N48A 1S77D 3M9OB 4ECTA 1D9DA 5IIKA 2KMDA 5EWEA 3I76A 1TAQA 4G3IA 4DFMA 5L1KA 3T3FA 1XSLA 5AI4A 4I2DA 1RYUA 5AKJA 8ICCA 2Y9TA 4UQGA 4DSEA 1WCNA 2KD1A 1KW4A 1ED1A 3UXPA 1ZD3A 4RNMA 2UVRA 2CN1A 3H4BA 4DFJA 4NLBA 2UVWA 4FBUA 2BR0A 4QZCA 1K5OA 4U7CA 1O03A 1S9FA 3R9KA 3H8SA 3RH5A 1FO4A 3G6XA 1ZOLA 2AH5A 1J2NA 2ZUCA 3GDXA 2YB1A 4Q43A 5KFTA 1L5UA 2E8OA 3BZCA 1ZQQA 5KG3A 2PMZF 2ZG6A 2K8CB 1SKRA 1WCLA 5C5JA 2RP5A 3PSPA 3NRZA 2ZIXA 3ONNA 5JRTA 5BOLA 2PMZC 2FE9A 1MQ2A 2KVSA 5KAIU 4NLNA 4AYBC 2WF9A 3Q8SB 4EENA 4JV0A 4EX6A 4K4GA 1ZQMA 4KLSA 1B43A 1FIQA 2ALZA 4PPXA 5KFDA 4JB3A 4R8UB 4C8KA 4MFFA 3KOOA 3EPIA 1SZPA 5IIJA 1NJYA 3PR4A 4DF4A 5KFMA 4JMUA 3H0LB 3WK7A 4F5QA 2JH1A 3SMVA 2OEHA 3GV7B 2D8CA 4KX3A 4P4PA 4YMMA 5EWFA 5KFQA 2EANA 2KVCA 3QU2A 4LZDA 4RNOA 2KP7A 3ZDAA 9ICSA 7ICGA 3GU3A 2PFOA 4NLZA 2KKPA 3VC8A 4YP3A 2UVUA 1N62A 2IOHA 4IQWA 3SYZA 1M6YA 4KITB 1TKDA 4F4KA 2MUTB 1A6SA 2IOFA 2KE7A 4M9JA 3KZIU 3QU4A 4UBCA 4C8LA 1B22A 2E5SA 2DPIA 4PGXA 4ECXA 5ALQA 1NJWA 1KFSA 3HT3A 1AROP 4PGYA 4KLLA 1S0MA 2HHQA 2VA2A 4RUCA 4GC7A 3QYPA 1AQ6A 3H40A 4RQ5A 2JMGA 4EBEA 4DQIA 2HW3A 5AKYA 3ZD8A 1HUOA 1MSWD 5ALPA 5AKKA 5KFSA 5DQIA 2WTFA 2YY6A 3Q8RB 5DBAA 4KLFA 3AUOA 3VCBA 2W9BA 2AGOA 2HHSA 4UAZA 3CP8A 4QZEA 1U9LA 1RZTA 2NYVA 1X2IA 2BCUA 3TACB 1ZRNA 4QWAA 2A1JB 4EELA 3T79A 1L3UA 2HSZA 2ZXIA 5ALLA 4C8MA 2Y1IA 4Y2PA 4OD0A 4KTQA 2R8HA 2FLNA 3IV6A 2W55A 1ZQJA 1RPLA 3CNHA 1ZRMA 2KIWA 2PFNA 2Y0SF 4CCHA 3EUB2 3RJHA 2F44A 2WAQC 2H5XA 5KL1B 5KNIA 5ALJA 1JROA 4ECUA 5ALMA 3BQ0A 3MC1A 2VJ5A 1SV4A 2Y9UA 4C4SA 1KSPA 4UW9A 9ICNA 3V7LA 1ZJMA 1D8BA 5L1JA 5DG7A 4YN4A 4ZH4A 3SV4A 1ZYQA 2ISOA 1V38A 1Z3EB 3RJEA 3HW8A 8ICLA 9ICVA 1VLBA 3PV8A 4FFDA 4RPYA 5J0WA 1JRPA 3GIMA 1N56A 2G0AA 3RJFA 1L7NA 2HDOA 3AEVA 3MDAA 3NASA 3OPXA 3IRUA 4DF8A 3O0FA 5J0PA 3BQ1A 4YD1A 5IIMA 2EDUA 4RQNA 3WK5A 3UQ0A 4KN4A 1ZQNA 1COOA 5DB8A 4RQ1A 4PZOA 4NM1A 3TAQA 2MAXA 1QH9A 4ED1A 4YD2A 2VA3A 1RQNA 2KK0A 1UHUA 1OUQA 2AGPA 3TARA 1SL2A 3PW5A 2OM6A 2ZUBA 2ZJ8A 5ALDA 5JUMA 4O5KA 5ALIA 4DL6A 4KMUA 4DFDA 5AM1A 1UCVA 3C2KA 1XWLA 5FP0A 1CI4A 4O3NA 2ZUDA 3C21A 3C5FA 4P4MA 2YQEA 3MR6A 3V72A 4NY8A 2XCPA 4RT2A 1SV0A 4KMOB 1BNPA 1DGJA 1DOQA 1ZD4A 1ZQPA 1L7OA 5DB7A 2DKZA 5JU5A 5KFZA 3TQ1A 1ZQGA 3QEAZ 2W9CB 1IG6A 3QU5A 2PFQA 3E0FA 4J9KA 7ICOA 5AM5A 5BOMA 2K4IA 3C1YA 5KFVA 2AU0A 4RQ6A 2B6GA 3SAFA 4FS2A 1QSLA 1KQQA 3OHBA 1PVPA 4B9SA 1KFTA 7ICLA 1XNSA 2W54A 3NGDA 1IIPA 3FYHA 4LVSA 1T94A 5KFAA 3T5JA 3C28A 2JHDA 2WF8A 5KFXA 4QW8A 7ICEA 2V9WA 5AK6A 1PVQA 1B0XA 5HMMA 2PI4A 4MF8A 3JPTA 2I9GA 4O3MA 2YB4A 4DOBA 2YTUA 5AKXA 2F2AB 2BDPA 1Q3UA 1IV8A 3WKEA 4J9MA 1KRPA 5F9NA 2IOFK 4F3OA 1S0OA 2NRZA 2R8KA 5KT5A 4BDPA 3QEBZ 1NKCA 3WK4A 2A1AA 1RYSA 5G5HA 1LVHA 2FPLA 1NK6A 2IBKA 5KFPA 2C2EA 4PL2A 2EAMA 2F77X 3ZDBA 4FBTA 4OJPA 2JEIA 9ICPA 7ICQA 4CE6A 4ECWA 2LYHA 1TV9A 5AICA 3RB4A 4DSLA 1ZXIA 4DSKA 1J97A 2KJ8A 1QQ5A 3OHAA 1C20A 3WKBA 3NVWA 4ED3A 1ZD5A 3AMZA 3AU2A 4F4YA 5ALEA 4NXZA 1C7YA 3HP6A 4B9UA 3PO4A 3B0XA 4UB1A 1J2MA 1KLNA 2ES6A 2KFZA 2P66A 4I2CA 1Z00B 3BS5B 4G9BA 2W04A 5AKZA 4RZRA 2BCRA 3RFAA 5KG1A 3KKAC 5AKGA 1TFRA 3PW2A 3ED5A 3PVXA 2RDIA 5J2AA 4CF4A 4KLEA 3PX0A 1ZQXA 2HHXA 3RBDA 2OCEA 4UARA 1NOMA 2A19A 4GXJA 2C28A 5IIIA 5J29A 1NK0A 5E79U 5J0TA 1BPDA 2E3TA 3MABA 1TK0A 1LKYB 1S8OA 1ZQFA 2OH2A 1BPXA 1DGSA 1ZQIA 4F8RA 3SAGA 2PI5A 2BPGA 7ICMA 1MC8A 3UMCA 4TQSA 4HYKA 4DCCA 2KOBA 2AQ4A 1LKYA 5CJ7A 3WK8A 3D2SA 4J9RA 3LWLA 1L6NA 1L3SA 2KSOA 4QZ8A 2I1QA 1UA0A 1TK5A 4RQ7A 4BJQA 4RUAA 2BQRA 2E1FA 2ZIWA 4Y2XA 3WK9A 4WJ3B 2LYBA 4MEXA 4Y2SA 1S5LU 3QU7A 3ZDCA 3H8JA 5DLGA 3QUCA 4YFKA 4NL9C 9ICEA 1SIJA 3M7DA 4DO9A 5AI8A 3ZDDA 2R8GA 1HIWA 5ALHA 2JRZA 5DB9A 4ED8A 4JWNA 4I27A 4CRXA 4DS5A 4O3OA 5L9XA 3GQCA 5J2EA 3PMNA 5J2HA 1P7DA 3D2QA 4BXOB 5HMLA 4O3PA 3TFSA 5J2BA 4M9GA 1BNOA 3QUQA 5J2IA 4QZFA 4C80A 1X9MA 4M04A 2KEYA 1SB3C 3B9JA 4TUPA 1ZQRA 2YMPA 1L8LA 2XVTA 2D3DA 2UVVA 3T5LA 1NK9A 3GIKA 1UA1A 1XO0A 3PY8A 1SKWA 2XIDA 3WKDA 3M8SA 1F0MA 3ISBA 2WB1F 3RF9A 3OSPA 2W03A 1NNLA 3H0RB 2HOFA 3G6YA 4KN7A 5J0YA 3BQ7A 3C23A 3ETRA 1RG6A 4KLUA 2C2DA 2FDRA 2K4PA 2XGPA 3GILA 3G6VA 4RQMA 8ICAA 2HMXA 8ICHA 1ZJNA 4CDGA 5J0RA 3RAXA 1NZPA 4RU9A 3RBEA 3EW9A 1B4FA 2KJ9A 4YG2A 5GTHU 4RQ0A 9ICWA 3AU6A 3SR6A 5KG7A 1Z1BA 2WAQF 4KLJA 5JTIA 4I2BA 2KHVA 1TE2A 3C5GA 3HKZF 3V6KA 2JEGA 2KICA 1L3TA 1L3VA 4C8OA 2KHQA 4GXKA 4F92B 5AKEA 1MA7A 4KLIA 8ICBA 2KTQA 3CYMA 1QSSA 4BWJA 3H7IA 2LKYA 5CP2A 4DQSA 2W8KA 3RB6A 8ICWA 5ALFA 2BGWA 2NO4A 4QIWF 3OGUA 1N5WA 5J0QA 2W9AA 3TAPA 1S76D 2XICA 3NUQA 3SZ2A 3SD7A 5DLFA 3PSTA 3D6JA 2CXYA 3KHHA 5KG0A 4YR2A 2W7PA 2BKEA 4MFAA 1DXSA 2RDJA 5KL8B 2ZXHA 3F5EA 1YT3A 2Y1JA 5EE3A 1ZQOA 3Q8QB 3MGIA 3UXOA 4YCXA 2JR5A 2KZMA 4ACOA 8ICZA 2HHWA 3UXNA 3GZFA 2ZTCA 5KFIA 3TADA 4BXOA 2G07A 1K1SA 2KIVA 5ALTA 4FS1A 3UMGA 4P0PB 1Q3VA 3IP4B 3CW2C 4F4XA 9ICAA 5KG6A 4YR3A 4NM2A 5DBBA 4RPZA 2HHVA 7ICVA 5J0SA 4DLGA 1DK3A 4MFCA 4EYHB 2BPCA 1TVAA 4FO6A 1L8OA 2YMQA 5AIAA 5HR7A 1DRGA 3DV9A 3F2BA 4QZDA 3LWMA 2KJ5A 7ICIA 4Z6DA 2QB1A 2I5HA 1JN3A 4FZNA 1KDHA 3JPPA 2OYYA 4F50A 4PHEA 2W3RA 2DUYA 5AM2A 3TKAA 1SL1A 2NV3A 5IINA 1A76A 4MF2A 4DL7A 5HR6A 5KT7A 3RR7A 2QB0B 2DPJA 1KTQA 3E2EA 5AKHA 4C7YA 9ICGA 1ZQUA 3Q8PB 2MU2A 4X5VA 3K4GA 5EE1A 2WHEA 2IHNA 4OJ6A 1X6JA 5AI5A 5AI9A 4NLGA 4DSIA 4B9LA 2QARB 4F93B 1X9SA 3GIIA 4DL3A 3LDAA 2C22A 4TUQA 1BVSA 4IRKA 4KLQA 2M0NA 1BGXT 3N7RC 1LV5A 1QCKA 3JPNA 3BS7A 3QU9A 4IRCA 5AM0A 2P35A 2ATLA 8ICTA 4EEYA 4C0ZA
chains in the Genus database with same CATH topology
2Y0SF 2KVCA 2WAQC 2HMXA 3SAHA 4U6PA 4CDGA 4BJQA 4FE3A 2HBMA 5KL1B 3GU3A 2ZIXB 3C29A 2D6FC 2KV2A 2VJ5A 2KKPA 3VC8A 3F5AA 2G09A 2E1FA 2H3IA 2KJ9A 1WUDA 2G5IB 2ZIUA 2ZIWA 5HR7A 4WJ3B 2LYBA 1DRGA 1D8BA 2KJ8A 3LYSA 2LYAA 2OXOA 3E0FA 3F2BA 2KD1A 2WAQF 2KNJA 3F2DA 1Z1BA 1ED1A 3HKZC 1PVRA 2KHVA 2K4IA 3ICXA 4GFJA 2KJ5A 3F53A 3CRXA 1A6SA 2VIXA 3HKZF 2CPRA 2K8BB 3MGVA 4FZNA 2KICA 4PL1A 2CN1A 4QJFB 2KHQA 2G0AA 4NLBA 3NRWA 3D2NA 4QNLA 3SAFA 2HOIA 3M7DA 1URJA 2OYYA 2MRLA 4U7CA 2KKVA 3KZXA 3PSFA 1HIWA 4KMOB 1MA7A 2ZIVB 3LVWA 4QIWC 1TAMA 1PVPA 1XNSA 2CRXA 3OPXA 1A0PA 2ZIVA 3M6KA 3F2CA 1IIPA 2E5SA 3O0FA 2N1RA 3CYMA 2NV3A 4P0QA 2YB1A 2LBOA 2LKYA 3IN5A 2Y0SC 4A8EA 4CRXA 4OJ5A 1T94A 4P0PA 5HR6A 5A0LA 1ZQ1C 2W04A 4FZLA 3C28A 4KX5A 4QIWF 5T14A 2W7OA 2PMZF 2JHDA 2ZG6A 2GH1A 3RFAA 1P7DA 2K8CB 3D2QA 4AYBF 3IG5A 2K89A 2HBJA 2K8AA 2XICA 2G5HB 1PVQA 3NUQA 2DQNB 2H3VA 2JMGA 2A3VA 4P0QB 2LHTA 2RP5A 4FZMA 1NZBA 4NV0A 3PSTA 4NWIA 3PSPA 2F8LA 1CRXA 5C0YA 2BDUA 2H3FA 2RHFA 4BX9C 2ZIXA 2K4EA 2F76X 2HBKA 4IC9A 1OUQA 5CRXA 2KEYA 3ONNA 1GO3F 2W7PA 4NLCA 3N7SC 4OJ6A 4O3MA 2PMZC 2H3QA 5KL8B 2YB4A 2G08A 2OM6A 2ZIUB 2MA1A 2ZXHA 3F5EA 4AYBC 2F2AB 1YT3A 2K4HA 2R18A 1SZHA 1Q3UA 1Z19A 2WB1C 2XVTA 3SQIA 1ECWA 2HOQA 4ICAA 3L3FX 2Z7JA 3M6ZA 3VCBA 4BUGA 2ZIWB 2G06A 3CP8A 1XO0A 1F44A 2VKQA 3H0MB 1KBUA 3AL0B 2DF4B 1UPHA 4ACOA 2OH2A 3AQFA 3PZPA 4OJOA 1HEKA 2RRDA 3GZFA 2XIDA 3SAGA 2M0NA 3ALRA 3DEEA 3N7PD 2VJ4A 2H3ZA 3T79A 2HBLA 2G07A 2WB1F 3N7RC 3RF9A 4CGZA 2W03A 2ZXIA 3IG8A 3PSIA 4P0PB 2Q4TA 3H0RB 3LVVA 2KOBA 3KFUF 1Q3VA 2XI9A 4OO1J 2HOFA 4JMUA 3H0LB 2DGZA 2JH1A 3K1ZA 4PL2A 3SMVA 2F77X 3IP4B 4OJLA 4KX3A 3D2SA 2E1EA 2JGAA 1L6NA 3AQEA 2YX8A 4OJPA 2GOLA 4C0ZA 2JH7A 2KIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJF B;  2HBJ A;  4NLB A;  3SAH A;  3SAF A;  4CDG A;  2HBM A;  5C0Y A;  2RRD A;  2KV2 A;  2RHF A;  3SAG A;  2HBK A;  2HBL A;  1GO3 F;  2E1F A;  4NLC A;  3CYM A;  1WUD A;  4CGZ A;  4O3M A;  1D8B A;  2MA1 A;  4OO1 J;  1YT3 A;  2DGZ A;  2E1E A;  4QIW F;  2CPR A; 
#chains in the Genus database with same CATH topology
 4K4I A;  3RJI A;  1QQ7 A;  3A0B U;  3RAQ A;  4US9 A;  5AIB A;  2I6X A;  4QZA A;  4XA5 A;  2Q0Z X;  4M9N A;  2XC9 A;  2EQY A;  5ALR A;  2C2R A;  1ZQL A;  2IHM A;  2KFN A;  3V6H A;  4B9M A;  4UAT A;  3RRH A;  2HVH A;  4QWD A;  5KT6 A;  2ASL A;  3RJK A;  3CRX A;  3GIJ A;  4JWM A;  5J2C A;  3LK9 A;  2FMQ A;  2F1H A;  5AM4 A;  4Q8E A;  1Z00 A;  2M9N A;  2DBY A;  5ALV A;  3JPO A;  3I28 A;  3THV A;  5KFW A;  1ZQT A;  1T8E A;  2HVI A;  2CRX A;  4R8U A;  1A0P A;  3C2M A;  4UAS A;  2VA8 A;  1N2X A;  2BPF A;  4F5N A;  5AK3 A;  4A8E A;  5AI0 A;  5L1I A;  3K75 D;  3WKA A;  4TUR A;  1F5S A;  4YVZ A;  5L1L A;  4DS4 A;  2AQ0 A;  4IS7 A;  1X66 A;  1PK1 B;  3PNC A;  2G5H B;  4ECY A;  7ICK A;  4GLX A;  1XSP A;  1D8Y A;  1HJP A;  5C0Y A;  5J2F A;  2BDU A;  4C4R A;  2H3F A;  2F76 X;  3RR8 A;  1ZQV A;  2RLT A;  5AKI A;  3PML A;  9ICC A;  1PK1 A;  2R18 A;  3BQ2 A;  5B5E U;  1TAU A;  4ED6 A;  1Z19 A;  5ALZ A;  3Q8M A;  3HJE A;  2G06 A;  2VKQ A;  4GXI A;  4DQR A;  1U48 A;  5DB6 A;  5EE0 A;  3QZ8 A;  4DL4 A;  4RNN A;  4F5O A;  2HHU A;  3BS5 A;  7ICU A;  5DBC A;  7ICR A;  2XI9 A;  3K1Z A;  4F91 B;  4Y2Y A;  8ICJ A;  1N63 A;  4OJL A;  3JPR A;  3NS1 A;  3NVV A;  4NJ8 A;  1ZQB A;  1QSY A;  2YX8 A;  2EZX A;  1S0N A;  3QXG A;  8ICS A;  9ICK A;  3NTU A;  2ZIX B;  5D46 A;  4ELU A;  9ICT A;  4RQ4 A;  1U4B A;  5CB1 A;  2F1J A;  5J0U A;  9ICR A;  4EBD A;  1ZQS A;  4P4O A;  4C7Z A;  4UAU A;  5GTI U;  8ICK A;  3ICX A;  4Z6C A;  5KAF U;  7ICH A;  3ISD A;  5B66 U;  4KLM A;  4QNL A;  2HOI A;  4IQT A;  1URJ A;  2MRL A;  2WF7 A;  2W9B B;  1FFV A;  2ZIV B;  1TAM A;  2FMP A;  5KG5 A;  4ED7 A;  2N1R A;  3HRD D;  4F4W A;  2LBO A;  1ZD2 P;  3S6J A;  4M6W A;  3SEI A;  3Q8L A;  4F5R A;  3H8W A;  4YXM A;  4Y2Q A;  3IG5 A;  2HBJ A;  3ZI4 A;  1PK3 A;  3HX0 A;  4QZ9 A;  5KT2 A;  1NZB A;  4B9V A;  2F8L A;  5DG9 A;  3ETL A;  5CWR A;  9ICB A;  2J6S A;  4NLC A;  4YQW A;  4I29 A;  3L5K A;  4UAW A;  1SZH A;  1NK7 A;  1EXN A;  1KN5 A;  3PW0 A;  1UT8 A;  4PGQ A;  4IL6 U;  4J9S A;  3SEN A;  5AKL A;  3L3F X;  1T3N A;  1SWV A;  2XY7 A;  5EE9 A;  3ZD9 A;  3H4D A;  2DL0 A;  4KLO A;  1UQV A;  2YN4 A;  3AQF A;  3MDC A;  1N5X A;  1ZQA A;  3DEE A;  1TK8 A;  2HBL A;  1XO1 A;  1CEZ A;  3ISC A;  5DDM A;  3M9N B;  9ICH A;  1QTM A;  5ALW A;  4YMO A;  4UB6 U;  3M9M B;  2E8P A;  8ICR A;  1L7M A;  2JH7 A;  4U6P A;  5ALG A;  3Q8K A;  3WU2 U;  2HBM A;  2OHF A;  3UQ2 A;  9ICQ A;  4I2E A;  2NRT A;  2VAN A;  1NK4 A;  4UB4 A;  5ALO A;  5KFJ A;  4M9H A;  1MN8 A;  4DEZ A;  3EYZ A;  4O0I A;  2DKX A;  1K1Q A;  2LYA A;  2OXO A;  5ALU A;  2XCA A;  2HCF A;  3F53 A;  2P6R A;  1X9X A;  5KT4 A;  1X40 A;  4CF3 A;  3NRW A;  3D2N A;  3QE9 Y;  2ZTE A;  3HIL A;  4RQ8 A;  5D4B A;  2A1J A;  4KLD A;  4PH5 A;  2KSO B;  3M6K A;  1N60 A;  3M8R A;  3MR5 A;  1QQ6 A;  4PHP A;  3PX6 A;  2FMS A;  2FJ6 A;  4J9N A;  1SGG A;  3A0H U;  4ECS A;  4KX5 A;  2W7O A;  1S0V A;  2WF5 A;  4MEY A;  5HHH A;  4UB5 A;  2A3V A;  4FZM A;  4NV0 A;  5KFL A;  2QLT A;  3RRG A;  9ICU A;  3PO5 A;  5G5G A;  2JZB B;  3RB3 A;  4NL9 A;  5AI6 A;  2ISP A;  2ZIU B;  7ICJ A;  1VJ5 A;  1FFU A;  1U49 A;  2JEF A;  4B9T A;  2W9M A;  3SQI A;  1L7P A;  3RB0 A;  1NK5 A;  4JK1 A;  2YMM A;  3UPQ A;  4M6W B;  4DFP A;  2BQ3 A;  1HEK A;  2RRD A;  2H3Z A;  1DK2 A;  2Q4T A;  5IIO A;  2ZTD A;  4QZB A;  4J9Q A;  4XUS A;  2ESE A;  1JAL A;  5ALS A;  4US8 A;  2AGQ A;  2V4Q A;  3KD3 A;  4F4Z A;  5EOZ A;  2EAO A;  4RQ2 A;  1O08 A;  4QWE A;  1ZQC A;  4FE3 A;  4QZI A;  3B0Y A;  4PHD A;  4DOC A;  8ICI A;  3F5A A;  1Z4O A;  2KZZ A;  3EWA A;  4F2S A;  2BCS A;  4O3S A;  3IM1 A;  2XY5 A;  3KTQ A;  1Q8K A;  2AXT U;  3PR5 B;  3F2D A;  1SL0 A;  4GIB A;  3HKZ C;  2B0C A;  5KG2 A;  1OXJ A;  5J2K A;  1ZQY A;  5J2G A;  5K4L A;  4RT3 A;  4KLG A;  3WK6 A;  2LPE A;  5KFK A;  9ICI A;  4QIW C;  4OCZ A;  4USA A;  2NO5 A;  1SXE A;  4ECZ A;  1JIH A;  2MSN A;  1HUZ A;  3IN5 A;  1RDF A;  1T3Q A;  5KFF A;  3MR2 A;  5DDY A;  1KKX A;  3WKC A;  4DL5 A;  5ALN A;  2GH1 A;  4Y2J A;  1T7P A;  3MFH A;  1S10 A;  2K89 A;  2K8A A;  5BPC A;  2IA6 A;  4P0Q B;  2H3V A;  2XGQ A;  1RQL A;  4DFK A;  3HPO A;  2HBK A;  4IC9 A;  5KFH A;  4NLK A;  5CR0 A;  3N7S C;  2H3Q A;  3UMB A;  2BCV A;  5TZV A;  1RXV A;  1KEJ A;  3FM9 A;  8ICU A;  5KFR A;  2F3N A;  2LI6 A;  4PHA A;  4O5C A;  1ECW A;  4JV2 A;  8ICX A;  4CNQ A;  3AN1 A;  4J9L A;  1JUD A;  4F72 A;  3QUT A;  1YZ7 A;  4Z6E A;  1NKE A;  2IMW P;  3N7P D;  3T5H A;  4CGZ A;  8ICQ A;  2O6K A;  4YMN A;  3LVV A;  2F1I A;  2DGZ A;  4QZH A;  3GV8 B;  7ICF A;  4IRD A;  2R8J A;  3QX7 A;  3AQE A;  2DWQ A;  4F2R A;  4C4T A;  2L5Y A;  1YZ6 A;  5ALX A;  3TAD C;  4QWC A;  2LMR A;  3MGH A;  3AM9 A;  1WWV A;  1BPZ A;  5AK5 A;  4K4H A;  1JXE A;  1SKS A;  2BQU A;  5KFE A;  3KBB A;  2W3S A;  3TI0 A;  1PVR A;  4JUZ A;  1V9P A;  3QUB A;  2FPK A;  4I2H A;  5J8Y C;  4LZG A;  2FPM A;  4TUS A;  2J6T A;  5KFN A;  4QZG A;  2KKV A;  3PSF A;  3PW4 A;  1XS9 D;  3PX4 A;  2QKQ A;  2EZY A;  3F2C A;  3FAH A;  5J8Y A;  1NJX A;  1Q46 A;  2NRV A;  2ODG A;  3J81 j;  3OSN A;  4I2A A;  7ICT A;  2NRW A;  5KFO A;  2BZF A;  4I28 A;  4AYB F;  8ICP A;  2LM1 A;  2RQ5 A;  4BX9 C;  1JXL A;  2K4E A;  3IHQ B;  1JI7 A;  1NI3 A;  3H8M A;  2G08 A;  4AP9 A;  3SI8 A;  4YR0 A;  5AHX A;  3MBY A;  1A77 A;  2FLP A;  2WFA A;  3OJS A;  2MUT A;  3N97 B;  4Y2T A;  1ZET A;  9ICF A;  2HOQ A;  3M6Z A;  1Z4N A;  4BUG A;  4R65 A;  5IIL A;  8ICO A;  4EX7 A;  4J9P A;  3V7J A;  4M9L A;  3H0M B;  1X42 A;  5HP4 A;  4O3Q A;  4M47 A;  1U45 A;  8ICN A;  3ALR A;  4EBC A;  4IQU A;  3BJY A;  5DG8 A;  7ICN A;  3KHR A;  3IDW A;  4I2I A;  3RJG A;  5KTQ A;  2E1E A;  1XU4 A;  2E8N A;  2GOL A;  2G5I B;  7ICS A;  1XC9 A;  8ICY A;  2EZZ A;  8ICV A;  5TIS U;  3SAH A;  4HAI A;  1QLN A;  3ORY A;  1VDV A;  2GWS A;  3HWT A;  1BPE A;  4EZ6 A;  2PKE A;  1H38 A;  5CA7 A;  2H3I A;  5AM3 A;  1WUD A;  9ICO A;  3PW7 A;  4J9O A;  3OTQ A;  2PXI A;  1Z1V A;  5HHI A;  1X6I A;  4BWM A;  4TQR A;  4O9M A;  5KFC A;  2CPR A;  4QW9 A;  3MGV A;  2KG5 A;  4DSJ A;  1T4G A;  3NVZ A;  4ED0 A;  4EYI B;  3KZX A;  3EPG A;  3LVW A;  3RH4 A;  1UT5 A;  2P6U A;  3C2L A;  5J2D A;  4RQ3 A;  1KL9 A;  5KG4 A;  4JV1 A;  1ZQZ A;  1NKB A;  1FEZ A;  4DSF A;  3RTV A;  8ICF A;  1WG8 A;  1WYG A;  1D9F A;  2DFL A;  1PZN A;  1D8L A;  4IR1 A;  5A0L A;  2QB0 A;  1COK A;  5T14 A;  4P2H A;  5H2F U;  1RM6 C;  4F5P A;  9ICX A;  2ASD A;  2HI0 A;  4B9N A;  2XO7 A;  5DQH A;  4ELT A;  5HNK A;  3RH6 A;  2RHF A;  8ICM A;  2W8L A;  3GFK B;  8ICG A;  1V97 A;  3MFI A;  3BQT A;  5KT3 A;  2J6U A;  2QAR A;  3N28 A;  2WB1 C;  4ED2 A;  4UB8 U;  4ZOH C;  1WWU A;  1IM4 A;  1F44 A;  2W43 A;  3AL0 B;  2DF4 B;  4Z6F A;  4R64 A;  5J0X A;  3PZP A;  4BGD A;  5L1M A;  2XY6 A;  4DQP A;  1U47 A;  4KLT A;  1KFD A;  3PSI A;  2B21 A;  4C8N A;  5KFB A;  1BPY A;  4ECR A;  2JGA A;  1ZQH A;  4F71 A;  4IR9 A;  2JXJ A;  5F3X B;  3C29 A;  2E8M A;  1NJZ A;  4CF5 A;  5DGA A;  2F8K A;  3V7K A;  4I2G A;  3LYS A;  1MQ3 A;  2KNJ A;  4PZN A;  4I2J A;  1SWW A;  2ZJ5 A;  5CHG A;  1X9W A;  2K8B B;  4DWI A;  4DQQ A;  1JMS A;  3OJU A;  4EZ9 A;  1IXR A;  2R8I A;  5DGB A;  9ICM A;  5F9L A;  5D49 A;  1SV0 C;  2V4R A;  1SXD A;  2JV3 A;  5KFY A;  4P0P A;  4UAY A;  4FZL A;  4YXJ A;  4E0D A;  3SV3 A;  1ZQK A;  2JZB A;  5J0O A;  4UB2 A;  2AHO B;  3KHL A;  2DQN B;  2KN7 A;  4DOA A;  2LM4 A;  2YML A;  2WF6 A;  1PUZ A;  5CRX A;  1GO3 F;  1ZQW A;  3E58 A;  5KFU A;  5AK4 A;  2K4H A;  1N61 A;  4Q45 A;  3RJJ A;  2HHT A;  4Q44 A;  4ICA A;  2Z7J A;  8ICE A;  5ALK A;  5CEH A;  2PFP A;  1Y88 A;  2OWO A;  4Q8F A;  2KZ3 A;  1RYR A;  4MHV A;  1KBU A;  1UPH A;  7ICP A;  3QNM A;  4OJO A;  1NK8 A;  3BDP A;  4O5E A;  5KFG A;  4UBB A;  3U26 A;  3T5K A;  4DLE A;  2ZJA A;  3C1Z A;  4QWB A;  4XRH A;  3FDS A;  3UM9 A;  3TAN A;  5ALY A;  4UB3 A;  2D6F C;  2ASJ A;  5EWG A;  3JPQ A;  2KV2 A;  1LB2 B;  1V85 A;  2FLL A;  2G09 A;  1RXW A;  2ZIU A;  4J03 A;  3NVY A;  4M2Y A;  2GO7 A;  4IQV A;  3GV5 B;  4GFJ A;  2K60 A;  2VIX A;  2EAP A;  4Y2V A;  2W9C A;  4PL1 A;  2JEJ A;  4QJF B;  4ELV A;  5DKW A;  5J2J A;  4Y2U A;  1S97 A;  4KLH A;  3I1Y A;  1XSN A;  1OW5 A;  9ICL A;  4ECQ A;  2EH9 A;  2ZIV A;  3M1Y A;  3KHG A;  4Y2R A;  4P0Q A;  2FI1 A;  1CUK A;  2Y0S C;  1BPB A;  4OJ5 A;  4R66 A;  4EEK A;  1ZQ1 C;  4DL2 A;  4O3R A;  4M0A A;  3KKA A;  1ZQE A;  3EZ5 A;  4UAV A;  4XQ8 A;  2LHT A;  4B6J A;  4NWI A;  1CRX A;  2MA1 A;  3FC4 A;  3BZK A;  3V6J A;  4I2F A;  3QZ7 A;  2W11 A;  3ZDE A;  3TFR A;  3MR3 A;  2GLE A;  2ZIW B;  2BCQ A;  3JPS A;  2AJQ A;  4R63 A;  3L4P A;  2BHN A;  2VJ4 A;  3K1R B;  4RPX A;  4GC6 A;  3N4M B;  3IG8 A;  4LJX A;  5DQG A;  1JX4 A;  3KFU F;  2NRX A;  4OO1 J;  4PJ0 U;  9ICJ A;  1ZQD A;  3DDH A;  4ECV A;  1N48 A;  1S77 D;  3M9O B;  4ECT A;  1D9D A;  5IIK A;  2KMD A;  5EWE A;  3I76 A;  1TAQ A;  4G3I A;  4DFM A;  5L1K A;  3T3F A;  1XSL A;  5AI4 A;  4I2D A;  1RYU A;  5AKJ A;  8ICC A;  2Y9T A;  4UQG A;  4DSE A;  1WCN A;  2KD1 A;  1KW4 A;  1ED1 A;  3UXP A;  1ZD3 A;  4RNM A;  2UVR A;  2CN1 A;  3H4B A;  4DFJ A;  4NLB A;  2UVW A;  4FBU A;  2BR0 A;  4QZC A;  1K5O A;  4U7C A;  1O03 A;  1S9F A;  3R9K A;  3H8S A;  3RH5 A;  1FO4 A;  3G6X A;  1ZOL A;  2AH5 A;  1J2N A;  2ZUC A;  3GDX A;  2YB1 A;  4Q43 A;  5KFT A;  1L5U A;  2E8O A;  3BZC A;  1ZQQ A;  5KG3 A;  2PMZ F;  2ZG6 A;  2K8C B;  1SKR A;  1WCL A;  5C5J A;  2RP5 A;  3PSP A;  3NRZ A;  2ZIX A;  3ONN A;  5JRT A;  5BOL A;  2PMZ C;  2FE9 A;  1MQ2 A;  2KVS A;  5KAI U;  4NLN A;  4AYB C;  2WF9 A;  3Q8S B;  4EEN A;  4JV0 A;  4EX6 A;  4K4G A;  1ZQM A;  4KLS A;  1B43 A;  1FIQ A;  2ALZ A;  4PPX A;  5KFD A;  4JB3 A;  4R8U B;  4C8K A;  4MFF A;  3KOO A;  3EPI A;  1SZP A;  5IIJ A;  1NJY A;  3PR4 A;  4DF4 A;  5KFM A;  4JMU A;  3H0L B;  3WK7 A;  4F5Q A;  2JH1 A;  3SMV A;  2OEH A;  3GV7 B;  2D8C A;  4KX3 A;  4P4P A;  4YMM A;  5EWF A;  5KFQ A;  2EAN A;  2KVC A;  3QU2 A;  4LZD A;  4RNO A;  2KP7 A;  3ZDA A;  9ICS A;  7ICG A;  3GU3 A;  2PFO A;  4NLZ A;  2KKP A;  3VC8 A;  4YP3 A;  2UVU A;  1N62 A;  2IOH A;  4IQW A;  3SYZ A;  1M6Y A;  4KIT B;  1TKD A;  4F4K A;  2MUT B;  1A6S A;  2IOF A;  2KE7 A;  4M9J A;  3KZI U;  3QU4 A;  4UBC A;  4C8L A;  1B22 A;  2E5S A;  2DPI A;  4PGX A;  4ECX A;  5ALQ A;  1NJW A;  1KFS A;  3HT3 A;  1ARO P;  4PGY A;  4KLL A;  1S0M A;  2HHQ A;  2VA2 A;  4RUC A;  4GC7 A;  3QYP A;  1AQ6 A;  3H40 A;  4RQ5 A;  2JMG A;  4EBE A;  4DQI A;  2HW3 A;  5AKY A;  3ZD8 A;  1HUO A;  1MSW D;  5ALP A;  5AKK A;  5KFS A;  5DQI A;  2WTF A;  2YY6 A;  3Q8R B;  5DBA A;  4KLF A;  3AUO A;  3VCB A;  2W9B A;  2AGO A;  2HHS A;  4UAZ A;  3CP8 A;  4QZE A;  1U9L A;  1RZT A;  2NYV A;  1X2I A;  2BCU A;  3TAC B;  1ZRN A;  4QWA A;  2A1J B;  4EEL A;  3T79 A;  1L3U A;  2HSZ A;  2ZXI A;  5ALL A;  4C8M A;  2Y1I A;  4Y2P A;  4OD0 A;  4KTQ A;  2R8H A;  2FLN A;  3IV6 A;  2W55 A;  1ZQJ A;  1RPL A;  3CNH A;  1ZRM A;  2KIW A;  2PFN A;  2Y0S F;  4CCH A;  3EUB 2;  3RJH A;  2F44 A;  2WAQ C;  2H5X A;  5KL1 B;  5KNI A;  5ALJ A;  1JRO A;  4ECU A;  5ALM A;  3BQ0 A;  3MC1 A;  2VJ5 A;  1SV4 A;  2Y9U A;  4C4S A;  1KSP A;  4UW9 A;  9ICN A;  3V7L A;  1ZJM A;  1D8B A;  5L1J A;  5DG7 A;  4YN4 A;  4ZH4 A;  3SV4 A;  1ZYQ A;  2ISO A;  1V38 A;  1Z3E B;  3RJE A;  3HW8 A;  8ICL A;  9ICV A;  1VLB A;  3PV8 A;  4FFD A;  4RPY A;  5J0W A;  1JRP A;  3GIM A;  1N56 A;  2G0A A;  3RJF A;  1L7N A;  2HDO A;  3AEV A;  3MDA A;  3NAS A;  3OPX A;  3IRU A;  4DF8 A;  3O0F A;  5J0P A;  3BQ1 A;  4YD1 A;  5IIM A;  2EDU A;  4RQN A;  3WK5 A;  3UQ0 A;  4KN4 A;  1ZQN A;  1COO A;  5DB8 A;  4RQ1 A;  4PZO A;  4NM1 A;  3TAQ A;  2MAX A;  1QH9 A;  4ED1 A;  4YD2 A;  2VA3 A;  1RQN A;  2KK0 A;  1UHU A;  1OUQ A;  2AGP A;  3TAR A;  1SL2 A;  3PW5 A;  2OM6 A;  2ZUB A;  2ZJ8 A;  5ALD A;  5JUM A;  4O5K A;  5ALI A;  4DL6 A;  4KMU A;  4DFD A;  5AM1 A;  1UCV A;  3C2K A;  1XWL A;  5FP0 A;  1CI4 A;  4O3N A;  2ZUD A;  3C21 A;  3C5F A;  4P4M A;  2YQE A;  3MR6 A;  3V72 A;  4NY8 A;  2XCP A;  4RT2 A;  1SV0 A;  4KMO B;  1BNP A;  1DGJ A;  1DOQ A;  1ZD4 A;  1ZQP A;  1L7O A;  5DB7 A;  2DKZ A;  5JU5 A;  5KFZ A;  3TQ1 A;  1ZQG A;  3QEA Z;  2W9C B;  1IG6 A;  3QU5 A;  2PFQ A;  3E0F A;  4J9K A;  7ICO A;  5AM5 A;  5BOM A;  2K4I A;  3C1Y A;  5KFV A;  2AU0 A;  4RQ6 A;  2B6G A;  3SAF A;  4FS2 A;  1QSL A;  1KQQ A;  3OHB A;  1PVP A;  4B9S A;  1KFT A;  7ICL A;  1XNS A;  2W54 A;  3NGD A;  1IIP A;  3FYH A;  4LVS A;  1T94 A;  5KFA A;  3T5J A;  3C28 A;  2JHD A;  2WF8 A;  5KFX A;  4QW8 A;  7ICE A;  2V9W A;  5AK6 A;  1PVQ A;  1B0X A;  5HMM A;  2PI4 A;  4MF8 A;  3JPT A;  2I9G A;  4O3M A;  2YB4 A;  4DOB A;  2YTU A;  5AKX A;  2F2A B;  2BDP A;  1Q3U A;  1IV8 A;  3WKE A;  4J9M A;  1KRP A;  5F9N A;  2IOF K;  4F3O A;  1S0O A;  2NRZ A;  2R8K A;  5KT5 A;  4BDP A;  3QEB Z;  1NKC A;  3WK4 A;  2A1A A;  1RYS A;  5G5H A;  1LVH A;  2FPL A;  1NK6 A;  2IBK A;  5KFP A;  2C2E A;  4PL2 A;  2EAM A;  2F77 X;  3ZDB A;  4FBT A;  4OJP A;  2JEI A;  9ICP A;  7ICQ A;  4CE6 A;  4ECW A;  2LYH A;  1TV9 A;  5AIC A;  3RB4 A;  4DSL A;  1ZXI A;  4DSK A;  1J97 A;  2KJ8 A;  1QQ5 A;  3OHA A;  1C20 A;  3WKB A;  3NVW A;  4ED3 A;  1ZD5 A;  3AMZ A;  3AU2 A;  4F4Y A;  5ALE A;  4NXZ A;  1C7Y A;  3HP6 A;  4B9U A;  3PO4 A;  3B0X A;  4UB1 A;  1J2M A;  1KLN A;  2ES6 A;  2KFZ A;  2P66 A;  4I2C A;  1Z00 B;  3BS5 B;  4G9B A;  2W04 A;  5AKZ A;  4RZR A;  2BCR A;  3RFA A;  5KG1 A;  3KKA C;  5AKG A;  1TFR A;  3PW2 A;  3ED5 A;  3PVX A;  2RDI A;  5J2A A;  4CF4 A;  4KLE A;  3PX0 A;  1ZQX A;  2HHX A;  3RBD A;  2OCE A;  4UAR A;  1NOM A;  2A19 A;  4GXJ A;  2C28 A;  5III A;  5J29 A;  1NK0 A;  5E79 U;  5J0T A;  1BPD A;  2E3T A;  3MAB A;  1TK0 A;  1LKY B;  1S8O A;  1ZQF A;  2OH2 A;  1BPX A;  1DGS A;  1ZQI A;  4F8R A;  3SAG A;  2PI5 A;  2BPG A;  7ICM A;  1MC8 A;  3UMC A;  4TQS A;  4HYK A;  4DCC A;  2KOB A;  2AQ4 A;  1LKY A;  5CJ7 A;  3WK8 A;  3D2S A;  4J9R A;  3LWL A;  1L6N A;  1L3S A;  2KSO A;  4QZ8 A;  2I1Q A;  1UA0 A;  1TK5 A;  4RQ7 A;  4BJQ A;  4RUA A;  2BQR A;  2E1F A;  2ZIW A;  4Y2X A;  3WK9 A;  4WJ3 B;  2LYB A;  4MEX A;  4Y2S A;  1S5L U;  3QU7 A;  3ZDC A;  3H8J A;  5DLG A;  3QUC A;  4YFK A;  4NL9 C;  9ICE A;  1SIJ A;  3M7D A;  4DO9 A;  5AI8 A;  3ZDD A;  2R8G A;  1HIW A;  5ALH A;  2JRZ A;  5DB9 A;  4ED8 A;  4JWN A;  4I27 A;  4CRX A;  4DS5 A;  4O3O A;  5L9X A;  3GQC A;  5J2E A;  3PMN A;  5J2H A;  1P7D A;  3D2Q A;  4BXO B;  5HML A;  4O3P A;  3TFS A;  5J2B A;  4M9G A;  1BNO A;  3QUQ A;  5J2I A;  4QZF A;  4C80 A;  1X9M A;  4M04 A;  2KEY A;  1SB3 C;  3B9J A;  4TUP A;  1ZQR A;  2YMP A;  1L8L A;  2XVT A;  2D3D A;  2UVV A;  3T5L A;  1NK9 A;  3GIK A;  1UA1 A;  1XO0 A;  3PY8 A;  1SKW A;  2XID A;  3WKD A;  3M8S A;  1F0M A;  3ISB A;  2WB1 F;  3RF9 A;  3OSP A;  2W03 A;  1NNL A;  3H0R B;  2HOF A;  3G6Y A;  4KN7 A;  5J0Y A;  3BQ7 A;  3C23 A;  3ETR A;  1RG6 A;  4KLU A;  2C2D A;  2FDR A;  2K4P A;  2XGP A;  3GIL A;  3G6V A;  4RQM A;  8ICA A;  2HMX A;  8ICH A;  1ZJN A;  4CDG A;  5J0R A;  3RAX A;  1NZP A;  4RU9 A;  3RBE A;  3EW9 A;  1B4F A;  2KJ9 A;  4YG2 A;  5GTH U;  4RQ0 A;  9ICW A;  3AU6 A;  3SR6 A;  5KG7 A;  1Z1B A;  2WAQ F;  4KLJ A;  5JTI A;  4I2B A;  2KHV A;  1TE2 A;  3C5G A;  3HKZ F;  3V6K A;  2JEG A;  2KIC A;  1L3T A;  1L3V A;  4C8O A;  2KHQ A;  4GXK A;  4F92 B;  5AKE A;  1MA7 A;  4KLI A;  8ICB A;  2KTQ A;  3CYM A;  1QSS A;  4BWJ A;  3H7I A;  2LKY A;  5CP2 A;  4DQS A;  2W8K A;  3RB6 A;  8ICW A;  5ALF A;  2BGW A;  2NO4 A;  4QIW F;  3OGU A;  1N5W A;  5J0Q A;  2W9A A;  3TAP A;  1S76 D;  2XIC A;  3NUQ A;  3SZ2 A;  3SD7 A;  5DLF A;  3PST A;  3D6J A;  2CXY A;  3KHH A;  5KG0 A;  4YR2 A;  2W7P A;  2BKE A;  4MFA A;  1DXS A;  2RDJ A;  5KL8 B;  2ZXH A;  3F5E A;  1YT3 A;  2Y1J A;  5EE3 A;  1ZQO A;  3Q8Q B;  3MGI A;  3UXO A;  4YCX A;  2JR5 A;  2KZM A;  4ACO A;  8ICZ A;  2HHW A;  3UXN A;  3GZF A;  2ZTC A;  5KFI A;  3TAD A;  4BXO A;  2G07 A;  1K1S A;  2KIV A;  5ALT A;  4FS1 A;  3UMG A;  4P0P B;  1Q3V A;  3IP4 B;  3CW2 C;  4F4X A;  9ICA A;  5KG6 A;  4YR3 A;  4NM2 A;  5DBB A;  4RPZ A;  2HHV A;  7ICV A;  5J0S A;  4DLG A;  1DK3 A;  4MFC A;  4EYH B;  2BPC A;  1TVA A;  4FO6 A;  1L8O A;  2YMQ A;  5AIA A;  5HR7 A;  1DRG A;  3DV9 A;  3F2B A;  4QZD A;  3LWM A;  2KJ5 A;  7ICI A;  4Z6D A;  2QB1 A;  2I5H A;  1JN3 A;  4FZN A;  1KDH A;  3JPP A;  2OYY A;  4F50 A;  4PHE A;  2W3R A;  2DUY A;  5AM2 A;  3TKA A;  1SL1 A;  2NV3 A;  5IIN A;  1A76 A;  4MF2 A;  4DL7 A;  5HR6 A;  5KT7 A;  3RR7 A;  2QB0 B;  2DPJ A;  1KTQ A;  3E2E A;  5AKH A;  4C7Y A;  9ICG A;  1ZQU A;  3Q8P B;  2MU2 A;  4X5V A;  3K4G A;  5EE1 A;  2WHE A;  2IHN A;  4OJ6 A;  1X6J A;  5AI5 A;  5AI9 A;  4NLG A;  4DSI A;  4B9L A;  2QAR B;  4F93 B;  1X9S A;  3GII A;  4DL3 A;  3LDA A;  2C22 A;  4TUQ A;  1BVS A;  4IRK A;  4KLQ A;  2M0N A;  1BGX T;  3N7R C;  1LV5 A;  1QCK A;  3JPN A;  3BS7 A;  3QU9 A;  4IRC A;  5AM0 A;  2P35 A;  2ATL A;  8ICT A;  4EEY A;  4C0Z A; 
#chains in the Genus database with same CATH homology
 2Y0S F;  2KVC A;  2WAQ C;  2HMX A;  3SAH A;  4U6P A;  4CDG A;  4BJQ A;  4FE3 A;  2HBM A;  5KL1 B;  3GU3 A;  2ZIX B;  3C29 A;  2D6F C;  2KV2 A;  2VJ5 A;  2KKP A;  3VC8 A;  3F5A A;  2G09 A;  2E1F A;  2H3I A;  2KJ9 A;  1WUD A;  2G5I B;  2ZIU A;  2ZIW A;  5HR7 A;  4WJ3 B;  2LYB A;  1DRG A;  1D8B A;  2KJ8 A;  3LYS A;  2LYA A;  2OXO A;  3E0F A;  3F2B A;  2KD1 A;  2WAQ F;  2KNJ A;  3F2D A;  1Z1B A;  1ED1 A;  3HKZ C;  1PVR A;  2KHV A;  2K4I A;  3ICX A;  4GFJ A;  2KJ5 A;  3F53 A;  3CRX A;  1A6S A;  2VIX A;  3HKZ F;  2CPR A;  2K8B B;  3MGV A;  4FZN A;  2KIC A;  4PL1 A;  2CN1 A;  4QJF B;  2KHQ A;  2G0A A;  4NLB A;  3NRW A;  3D2N A;  4QNL A;  3SAF A;  2HOI A;  3M7D A;  1URJ A;  2OYY A;  2MRL A;  4U7C A;  2KKV A;  3KZX A;  3PSF A;  1HIW A;  4KMO B;  1MA7 A;  2ZIV B;  3LVW A;  4QIW C;  1TAM A;  1PVP A;  1XNS A;  2CRX A;  3OPX A;  1A0P A;  2ZIV A;  3M6K A;  3F2C A;  1IIP A;  2E5S A;  3O0F A;  2N1R A;  3CYM A;  2NV3 A;  4P0Q A;  2YB1 A;  2LBO A;  2LKY A;  3IN5 A;  2Y0S C;  4A8E A;  4CRX A;  4OJ5 A;  1T94 A;  4P0P A;  5HR6 A;  5A0L A;  1ZQ1 C;  2W04 A;  4FZL A;  3C28 A;  4KX5 A;  4QIW F;  5T14 A;  2W7O A;  2PMZ F;  2JHD A;  2ZG6 A;  2GH1 A;  3RFA A;  1P7D A;  2K8C B;  3D2Q A;  4AYB F;  3IG5 A;  2K89 A;  2HBJ A;  2K8A A;  2XIC A;  2G5H B;  1PVQ A;  3NUQ A;  2DQN B;  2H3V A;  2JMG A;  2A3V A;  4P0Q B;  2LHT A;  2RP5 A;  4FZM A;  1NZB A;  4NV0 A;  3PST A;  4NWI A;  3PSP A;  2F8L A;  1CRX A;  5C0Y A;  2BDU A;  2H3F A;  2RHF A;  4BX9 C;  2ZIX A;  2K4E A;  2F76 X;  2HBK A;  4IC9 A;  1OUQ A;  5CRX A;  2KEY A;  3ONN A;  1GO3 F;  2W7P A;  4NLC A;  3N7S C;  4OJ6 A;  4O3M A;  2PMZ C;  2H3Q A;  5KL8 B;  2YB4 A;  2G08 A;  2OM6 A;  2ZIU B;  2MA1 A;  2ZXH A;  3F5E A;  4AYB C;  2F2A B;  1YT3 A;  2K4H A;  2R18 A;  1SZH A;  1Q3U A;  1Z19 A;  2WB1 C;  2XVT A;  3SQI A;  1ECW A;  2HOQ A;  4ICA A;  3L3F X;  2Z7J A;  3M6Z A;  3VCB A;  4BUG A;  2ZIW B;  2G06 A;  3CP8 A;  1XO0 A;  1F44 A;  2VKQ A;  3H0M B;  1KBU A;  3AL0 B;  2DF4 B;  1UPH A;  4ACO A;  2OH2 A;  3AQF A;  3PZP A;  4OJO A;  1HEK A;  2RRD A;  3GZF A;  2XID A;  3SAG A;  2M0N A;  3ALR A;  3DEE A;  3N7P D;  2VJ4 A;  2H3Z A;  3T79 A;  2HBL A;  2G07 A;  2WB1 F;  3N7R C;  3RF9 A;  4CGZ A;  2W03 A;  2ZXI A;  3IG8 A;  3PSI A;  4P0P B;  2Q4T A;  3H0R B;  3LVV A;  2KOB A;  3KFU F;  1Q3V A;  2XI9 A;  4OO1 J;  2HOF A;  4JMU A;  3H0L B;  2DGZ A;  2JH1 A;  3K1Z A;  4PL2 A;  3SMV A;  2F77 X;  3IP4 B;  4OJL A;  4KX3 A;  3D2S A;  2E1E A;  2JGA A;  1L6N A;  3AQE A;  2YX8 A;  4OJP A;  2GOL A;  4C0Z A;  2JH7 A;  2KIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...