1WUDA

E. coli recq hrdc domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
NYDRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIRAHVDGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ATP-dependent DNA helicase recQ
publication title Conferring Substrate Specificity to DNA Helicases: Role of the RecQ HRDC Domain
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 19
structure length 77
sequence length 77
chains with identical sequence B, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1wudA00
4QIWF 4QJFB 1WUDA 2RRDA 5C0YA 2MA1A 3SAHA 2HBLA 4CDGA 3CYMA 2CPRA 3SAGA 3SAFA 2RHFA 4NLCA 2E1FA 4OO1J 4CGZA 2HBMA 2KV2A 1GO3F 2HBKA 4NLBA 2E1EA 1YT3A 1D8BA 2DGZA 4O3MA 2HBJA
chains in the Genus database with same CATH superfamily
1TK0A 4FZMA 4PHPA 2R18A 5HHIA 9ICHA 2BDPA 7ICTA 2BZFA 5EE0A 2R8JA 4ACOA 4DQIA 8ICXA 3BS7A 5AK4A 3RB3A 1KFSA 5KFYA 3FAHA 4Y2UA 9ICEA 3TADA 4Z6CA 3B9JA 2KICA 5IIJA 2UVUA 3C1YA 4BJQA 5DBBA 1A0PA 1JXEA 2XI9A 2EAPA 4EBDA 1UHUA 3CNHA 2R8HA 2ZIWA 5ALUA 5EWGA 5D46A 1TAUA 2ODGA 5KNIA 4LZDA 4MF8A 4CF4A 2F2AB 3NASA 1UCVA 2V4RA 1YZ6A 1ZQCA 5KFPA 3MFIA 2QB0A 1ZQBA 3BS5A 3PV8A 4P4PA 2LYAA 1BPZA 4DFDA 2E1FA 4ED2A 4QWAA 1PZNA 1ZQTA 3BQ2A 3LVWA 5DDMA 2ZJ5A 4RQMA 1JALA 4O5KA 3I76A 1D9DA 1QSSA 5AI9A 3BQ1A 5KG1A 1L8LA 2WF7A 5T14A 2A1JB 4DOAA 4Z6FA 3RBEA 4RQ0A 4Z6DA 5KG7A 3M8SA 3QYPA 4MFCA 1TFRA 3V72A 1COKA 3IDWA 1X9SA 5K4LA 5BOLA 4I2HA 3MDCA 1WWUA 2DKZA 3M9MB 7ICLA 5L1IA 3BQ7A 3WKBA 5AKEA 1URJA 2YMQA 4QIWF 3T5HA 3Q8PB 2XCPA 5KT4A 3GILA 4EX7A 1FO4A 1NZPA 1J2NA 2H3ZA 3UMBA 2JZBB 2PFPA 4K4IA 3H8WA 3AEVA 5ALNA 9ICMA 3HRDD 2UVRA 4F5NA 2IHMA 3N28A 5L1JA 1GO3F 2KD1A 1ZRNA 5HMMA 2JEIA 2WAQF 9ICWA 2ZTDA 3RAQA 2C28A 4FBUA 4B9UA 3IN5A 3RJFA 3BQ0A 2IHNA 4FS2A 1WWVA 2VJ4A 5ALOA 5KFZA 7ICRA 4CDGA 8ICAA 5DQGA 3QZ7A 4QZHA 2Z7JA 3S6JA 2AQ4A 1NZBA 3HPOA 3Q8SB 4UB3A 7ICEA 1PVRA 1S0VA 5KG4A 2OH2A 2L5YA 4LVSA 4PGYA 3WKDA 2BCQA 4B9NA 1MA7A 1K1SA 3C5GA 3EPIA 1SKWA 2I1QA 3GIIA 3JPRA 5ALHA 3F2BA 3ETLA 3V6JA 1ZQSA 3T5KA 2G09A 2EH9A 7ICKA 1XSLA 4YFKA 4IR1A 2MRLA 1S0MA 5HHHA 4ECRA 4JV1A 4R8UB 5DQIA 3HP6A 2NO4A 5ALIA 3QZ8A 3SYZA 5IIMA 2A1JA 4DF8A 4JMUA 4Y2SA 4IR9A 2JGAA 1XNSA 2VANA 4FO6A 5AKYA 2KEYA 4NLCA 1KW4A 2QKQA 2E3TA 5KFIA 5J0WA 2DL0A 3RRGA 5J2KA 4PJ0U 2HHUA 5J0QA 3MFHA 2RQ5A 1JI7A 3ZDDA 4KTQA 2F1JA 1Q8KA 3GZFA 2JZBA 4I2DA 3TACB 8ICSA 3NVWA 5F3XB 2KJ8A 5KFQA 4DSEA 8ICOA 1UT8A 4GIBA 4Y2JA 4UQGA 4IRCA 2HCFA 1ZQUA 2DKXA 2FLNA 2FDRA 3MGVA 1KSPA 4USAA 4C0ZA 1A76A 3FYHA 2W54A 2K4EA 8ICCA 3UQ0A 1QLNA 3PW0A 2XVTA 2HHVA 2NRVA 3QUBA 1ZQAA 4O0IA 5J0XA 4U7CA 3H0RB 3T79A 4IQUA 2BPCA 4I2BA 2ZTEA 3C2KA 5J8YA 3PX6A 2MSNA 3KZIU 1DGJA 1N63A 3IHQB 1X9XA 4C8OA 3A0BU 2FJ6A 3RJKA 1S0NA 3C29A 5CJ7A 4KLJA 2GWSA 4QZBA 1RPLA 1D8BA 1UQVA 1KFDA 3UXPA 4KLFA 4NLKA 1B22A 4R8UA 4QZIA 4Y2VA 1J2MA 5HNKA 3PO5A 3GIJA 3NGDA 2YB4A 3MR5A 3AN1A 5DB8A 4TQRA 3Q8MA 4FZNA 1JX4A 2W3SA 5DB9A 4TUPA 3GQCA 3TFSA 1N5XA 1SL2A 5AKHA 1L3VA 2AGQA 2KHQA 3UXNA 4A8EA 3RH4A 1ZQKA 2PFOA 4QZAA 3PZPA 2NRXA 2W9AA 4F50A 3PVXA 3K4GA 4UB6U 3L5KA 2M0NA 3EPGA 4IQTA 3ZDEA 2JEGA 4JV0A 1DXSA 4NLNA 3EW9A 1RQLA 1Q3VA 2IA6A 8ICTA 4QIWC 2HHXA 2R8GA 2BCUA 3WU2U 1SV0A 1UT5A 1SXEA 3QU2A 3Q8RB 3SD7A 1L7OA 9ICSA 2Y0SC 3T3FA 5KFOA 1WYGA 4B9TA 1NKEA 4FZLA 7ICIA 3QXGA 1ZOLA 1N60A 2WAQC 4C8MA 4UBBA 5KFUA 2Y9UA 4KX5A 5DB7A 8ICJA 5ALJA 3WK6A 4CE6A 3J81j 2HBLA 2F76X 8ICYA 4GXKA 3N7RC 2ZXHA 4NM1A 3QX7A 4ECZA 2YX8A 4DQQA 2F77X 2WF5A 5J0TA 1MQ2A 2DQNB 4DFJA 4DOBA 3GDXA 1PK3A 1N48A 1KLNA 3UXOA 2XIDA 1TV9A 9ICVA 4QNLA 3OGUA 2IBKA 3KFUF 2K60A 1D8LA 1RYSA 9ICTA 4C7ZA 1L7MA 2EQYA 3V7KA 1ZQQA 4KLGA 3JPOA 9ICKA 4ECQA 3NS1A 4NV0A 4QW8A 8ICQA 1XSPA 3GIKA 1O08A 8ICRA 4KLLA 3RH6A 3RJJA 2EANA 2EAMA 3JPQA 2PI4A 2WTFA 1HIWA 7ICMA 3F53A 5E79U 3AQFA 4PHDA 3PX0A 3SV4A 2NRZA 3NUQA 3F2DA 2ZUBA 1XWLA 2G0AA 1L3TA 5J0YA 5KFJA 2LYBA 1YZ7A 3HX0A 4J9MA 4XA5A 3WKAA 3F5AA 4GLXA 2I5HA 2B6GA 5DBCA 2HOQA 4DL4A 3TI0A 1ZQEA 2DF4B 2FE9A 2H3IA 1ZJNA 4F5PA 4F2RA 3C1ZA 3CRXA 3G6YA 2AGOA 5AM3A 1UPHA 1HJPA 4Y2QA 2MAXA 2W8KA 3KHLA 2W7PA 3PW7A 1DGSA 3GV5B 5G5GA 3HW8A 1KQQA 3D6JA 4AYBF 4CNQA 4QZ9A 3T5LA 4I2IA 2FMPA 8ICHA 2QARB 4IS7A 4RQ7A 1RQNA 3QU5A 4F93B 1B4FA 4B9LA 3KOOA 4EX6A 4ED3A 4OJPA 1NKBA 2DUYA 2ZUCA 9ICQA 5TISU 3H4DA 1X66A 3MR3A 2NO5A 4P4MA 4QW9A 1DOQA 2KZ3A 3QEAZ 5G5HA 2HBKA 4KLSA 8ICPA 4F4WA 1FFVA 2DGZA 4NXZA 2EZZA 4Y2XA 4B9MA 1ZQ1C 1BPXA 2CPRA 5KT2A 2KZZA 4O9MA 1L5UA 5ALWA 5AKKA 3F5EA 8ICNA 4ZOHC 5FP0A 8ICGA 1N62A 2E8OA 1Z19A 1X9WA 2HHWA 1SB3C 3MGHA 3SZ2A 1QQ7A 3SAHA 4KX3A 1CRXA 4QWDA 4F2SA 4XQ8A 4J9KA 1U4BA 4F4YA 1X40A 5AKLA 4KN7A 3AU6A 4PHEA 1NNLA 4MFAA 1AQ6A 1WUDA 1RXWA 3ONNA 2KIVA 2F1HA 4OCZA 5J2FA 2HOIA 2K8BB 3QUTA 2F1IA 2ISOA 1VJ5A 2OCEA 5AK3A 4JV2A 2ZIVB 3RR7A 3PR5B 2H3VA 4EBEA 4C8KA 2HBJA 9ICAA 4FS1A 3C2MA 4JB3A 1BGXT 1L7NA 3KKAA 1LKYB 3H40A 4TUQA 1IIPA 4PGXA 1T3QA 5L1KA 4EZ6A 1XO0A 2RDIA 3PSPA 4C4SA 5KFAA 2DPJA 2KTQA 5J0RA 2XO7A 2XY5A 1T8EA 1ZQNA 1OXJA 4YQWA 4KN4A 5KFHA 4KLMA 4J03A 5AK5A 5KFEA 1PVQA 4Q44A 3QU9A 1SL0A 1N5WA 4UAUA 2LHTA 5AM2A 9ICNA 4KLQA 3MC1A 3FM9A 2HW3A 3H8JA 4NLBA 2K8CB 2KE7A 2P35A 4QZDA 2WF9A 1BNOA 1ZD4A 4NL9A 1NJWA 2RRDA 5ALLA 2HVIA 1NK0A 3IG8A 2PI5A 1HEKA 2E8PA 2KHVA 1ZQRA 1SXDA 4CGZA 4BWMA 3UMCA 2ZJ8A 5AI8A 5EWEA 1J97A 5KG3A 3H0LB 4YXMA 4J9RA 2WF6A 4DL3A 5ALPA 2ASDA 1U49A 4QZEA 4FE3A 5D4BA 1NK8A 9ICLA 5B5EU 5KTQA 5KFNA 4DS4A 1ZQPA 1LV5A 1V85A 1Z4OA 5KFCA 1ZD2P 3HT3A 2UVVA 3H8MA 1SKRA 2ZUDA 2V9WA 1Y88A 4EELA 2ZIVA 5H2FU 4P0PB 5ALZA 4AYBC 9ICRA 1QSYA 1NK9A 1L3UA 3ICXA 1ZD3A 4PHAA 2M9NA 3QNMA 4NWIA 4ELTA 2NRWA 4O3PA 1NK7A 5AI6A 1LKYA 5KFKA 1LB2B 3TARA 1QQ5A 4BDPA 4TQSA 3EZ5A 3G6VA 4I2JA 3PSFA 1OUQA 5KFRA 4F5QA 4KMOB 3AL0B 4U6PA 2KG5A 4X5VA 3KTQA 1KKXA 3SV3A 1QSLA 4DFPA 5JTIA 3WK9A 5J2IA 2I6XA 4ICAA 4LZGA 4Q43A 4C4TA 2HMXA 3KHHA 2RLTA 5KFSA 3SAFA 3MR2A 1ZQOA 2CXYA 1ZJMA 3DV9A 3PSTA 2G5HB 3IRUA 4O5EA 4I2FA 3ZDAA 5DGAA 1KTQA 1MSWD 1IM4A 8ICIA 5KAFU 4BX9C 3MBYA 1OW5A 2XY6A 1ZQXA 3WK8A 2FPMA 7ICPA 1SKSA 4ED6A 3SMVA 2N1RA 5IINA 2D3DA 2VKQA 8ICMA 2A19A 4O3RA 4Q8FA 1Z3EB 3LWLA 1ZETA 2PFNA 1S9FA 2ZTCA 2G07A 1QCKA 4DQRA 5CP2A 5HR6A 4ED0A 3B0XA 2KNJA 4DS5A 2BGWA 5CWRA 5DDYA 3QU7A 4F91B 1JROA 4DLGA 4P0PA 2HHQA 4GC6A 1D9FA 4UB4A 3BJYA 4PL1A 2FMQA 1IG6A 4US9A 3TAQA 3LWMA 7ICFA 4F5OA 5ALRA 2DBYA 4OD0A 4OO1J 3LVVA 1ZQFA 2GH1A 4RU9A 2KIWA 5KT7A 2BCSA 4NLZA 4DWIA 2BKEA 1ZQZA 5AKJA 2C2DA 4UAWA 2J6SA 5AM5A 3V7JA 2CRXA 4UATA 2NYVA 4QJFB 3RTVA 3FDSA 5HR7A 2LMRA 4I2AA 2OEHA 2A3VA 4RQ2A 4GXJA 3SI8A 2BHNA 1ZQWA 3IM1A 4EYHB 5KG6A 4O3OA 1U48A 1SWWA 2B0CA 4PH5A 5DGBA 5J29A 3CW2C 2EZYA 4BXOB 4M2YA 5BOMA 3HKZF 2ALZA 4GFJA 2A1AA 4DSJA 4M0AA 2HHTA 4Y2TA 5DLGA 1RZTA 3OSNA 5EOZA 2KV2A 4UB2A 8ICVA 4P4OA 1FIQA 4Y2YA 1S5LU 2LYHA 3RRHA 4DFKA 4Z6EA 1WCLA 1C20A 3UQ2A 3OJUA 5KT6A 1TK5A 5CEHA 5EE1A 1XSNA 2W55A 5CB1A 5DKWA 5AI5A 3TADC 1BNPA 3EYZA 1V38A 4DL2A 2W9BB 1MQ3A 5KFTA 1XU4A 4F71A 5J2CA 2AH5A 4I27A 1D8YA 2FPLA 3AUOA 2J6UA 5EE3A 1SGGA 2NRTA 4RNNA 5J2EA 5TZVA 1TK8A 1T3NA 4B6JA 2BQRA 2HVHA 1Z00B 5DLFA 5D49A 4QZ8A 3UMGA 4YD2A 2BCVA 2MU2A 4EEKA 2YY6A 3PW5A 2AQ0A 2E1EA 3EUB2 2D6FC 3I1YA 9ICCA 4I28A 3OSPA 1JN3A 8ICKA 4YMNA 1X9MA 4WJ3B 1UA1A 5ALEA 2KKPA 9ICOA 2W9MA 4QZGA 5AIAA 4BWJA 5IIKA 3JPNA 4DQPA 2RDJA 3BDPA 1JXLA 3I28A 4DCCA 4UBCA 1ZD5A 3HILA 2W8LA 9ICBA 3ZDBA 4YG2A 7ICQA 4BXOA 4C8LA 3M9NB 2LM1A 4ECSA 4R64A 4B9SA 5JRTA 3N7PD 2JH7A 5B66U 2C22A 5AM1A 5KG5A 4YD1A 2KJ5A 2KFZA 3PX4A 3D2NA 1F0MA 2ISPA 4FBTA 2K8AA 2IMWP 4ECVA 3AQEA 7ICVA 5EWFA 4C4RA 3C28A 4YCXA 2AXTU 3MR6A 2IOHA 2HHSA 3M6KA 9ICUA 4LJXA 4RUAA 1ZQVA 4IL6U 3R9KA 1ZQMA 3OPXA 3QUQA 4O3NA 4KLEA 5DBAA 4NY8A 1S8OA 4CF5A 3PR4A 4IC9A 4NM2A 4CCHA 1F5SA 2W9BA 5AKXA 5KL8B 1ZQJA 3KBBA 1TAQA 1SL1A 1XC9A 4OJOA 1XS9D 4ECXA 4F72A 3KHGA 5BPCA 1ECWA 4M47A 2ATLA 1NI3A 4R65A 1Z00A 3BQTA 1VDVA 2E8NA 4R63A 2C2RA 4F5RA 3MDAA 3K1ZA 3RF9A 1BPDA 4RQ1A 2DPIA 3E58A 3RJGA 5IIOA 2VJ5A 3TAPA 4RQ5A 4TURA 1O03A 1B43A 3RB6A 4DF4A 1K1QA 1PUZA 3K1RB 1X6IA 2F3NA 3ISDA 2KSOB 2EDUA 1TE2A 5ALKA 5ALYA 5KG0A 4M9HA 5KT5A 4J9OA 4ED7A 3IV6A 2KKVA 4DSLA 4ED1A 3FC4A 3ETRA 5KAIU 1Q46A 2QLTA 5AI4A 3OJSA 1ZQHA 5J2JA 2G06A 2JEJA 3D2QA 4F4XA 1A77A 3V7LA 4KLIA 3RR8A 3SQIA 4RQ3A 4RPXA 3PW2A 2LM4A 1NOMA 4YR3A 5AHXA 1IV8A 2EZXA 4KLOA 3C23A 4DSIA 1BVSA 4RQ4A 1KEJA 3HKZC 4F4KA 3SENA 2GLEA 4O3SA 3JPSA 1S76D 3KHRA 4JUZA 4RT3A 3DDHA 3TFRA 3AM9A 2Y1IA 2OM6A 3UM9A 2JR5A 3U26A 5IILA 2J6TA 4XRHA 5DQHA 3ALRA 4UW9A 4EYIB 4O5CA 3E0FA 4K4GA 5GTHU 5J0SA 2GOLA 1KRPA 2QARA 4YR0A 3G6XA 3WKEA 1COOA 5KG2A 4YP3A 1N56A 5J8YC 2ZJAA 5AICA 3PY8A 4PZNA 4YXJA 2KMDA 4OJLA 5KFBA 3JPPA 1N61A 2FMSA 2DFLA 2XY7A 1KDHA 4HYKA 9ICXA 4Y2PA 1X42A 1NK5A 2FPKA 4CF3A 1ZQDA 4QWEA 3EWAA 1BPYA 2KSOA 4TUSA 2R8IA 1QQ6A 2HSZA 2WB1F 1TKDA 2VA2A 2BQUA 2ASLA 2YB1A 1V97A 4J9PA 3GV7B 1L8OA 5J0UA 4ELVA 4DL5A 1KBUA 4IQVA 2YTUA 1KL9A 2W9CB 9ICIA 1N2XA 3H0MB 4J9QA 3PW4A 3TKAA 1U45A 4ED8A 2C2EA 3AMZA 4ELUA 2AJQA 3NTUA 4NLGA 2GO7A 3PMNA 1MN8A 2JEFA 5DG7A 2HOFA 3PO4A 2Q4TA 1M6YA 3VC8A 2MA1A 2DWQA 2JV3A 2CN1A 1F44A 4F8RA 3SR6A 2IOFA 5L1MA 1XO1A 3BZKA 2AGPA 4I2EA 3ZDCA 5J2AA 1NK6A 3O0FA 4P2HA 3RFAA 1SV0C 4F3OA 4DLEA 4AP9A 4ECUA 1S77D 3NVYA 1S97A 2ZXIA 1ZYQA 2Y0SF 4MFFA 4GXIA 2XGQA 3TANA 2RHFA 1RM6C 5KFMA 4YMOA 2WHEA 5F9NA 4PZOA 4RNOA 3N7SC 2P66A 2YMLA 5DG8A 1V9PA 4IRDA 3C5FA 1WG8A 4BUGA 4MHVA 2JRZA 4C80A 2FI1A 2I9GA 4M6WB 4RNMA 3L4PA 2F8KA 1KFTA 2W3RA 3QUCA 2PMZF 4PGQA 4DO9A 5AM4A 3GIMA 2KVCA 4RQNA 4M9NA 5KFDA 2F8LA 2O6KA 5J0OA 3ISCA 2VA3A 5EE9A 2KJ9A 5AKGA 4OJ5A 4GC7A 2W9CA 1HUZA 4ECWA 3OHBA 4DOCA 3GFKB 5GTIU 3NVZA 3L3FX 1SZPA 2JMGA 1IXRA 2KP7A 3PSIA 2E5SA 4RPYA 1ZQGA 2G5IB 2MUTB 4IRKA 1ZQYA 3VCBA 1ZXIA 4P0QB 1RG6A 9ICGA 3BZCA 3PMLA 2BPGA 5KT3A 4YVZA 1HUOA 8ICLA 2HDOA 4I29A 2JH1A 4Y2RA 3RJEA 3M7DA 2W03A 4KITB 3N97B 1NJYA 3HJEA 5J2GA 4RPZA 1NK4A 3N4MB 5L9XA 3M1YA 4EEYA 1C7YA 3T5JA 4UAZA 4UB1A 3HWTA 3H8SA 1ZQLA 3B0YA 1JMSA 1NJXA 5ALSA 1B0XA 4NJ8A 3WK5A 1CI4A 4C8NA 1AROP 5KFLA 2K4PA 4QZCA 8ICFA 4M6WA 2HBMA 2AHOB 3OHAA 8ICEA 1U9LA 3GU3A 4K4HA 2ZIUB 2P6RA 5ALVA 7ICSA 2RP5A 1Q3UA 3DEEA 5C5JA 1L3SA 4Q45A 5JUMA 4M9LA 2XC9A 4I2GA 1K5OA 5ALDA 3MGIA 1Z1BA 4KLDA 2EAOA 4R66A 8ICWA 2YQEA 5CRXA 1S10A 3TQ1A 4E0DA 4M9JA 3RH5A 2WB1C 4I2CA 3Q8LA 2D8CA 3RJHA 2B21A 1DK2A 3JPTA 3Q8QB 5CHGA 4US8A 2MUTA 1NKCA 1ZQIA 4P0QA 5ALQA 3C21A 5J2BA 1S0OA 4DL7A 3LDAA 3RB0A 3ZD9A 7ICUA 2JHDA 3M8RA 1DRGA 3LK9A 2KK0A 1NJZA 8ICUA 3Q8KA 5J2DA 2Y9TA 4F92B 1PK1B 4QZFA 3NVVA 4RUCA 4RQ8A 2V4QA 3ZI4A 2W7OA 2XGPA 1T7PA 5DG9A 3QE9Y 5KFGA 4QWBA 1FEZA 2KZMA 5KFXA 3M9OB 1BPBA 1SWVA 2K4HA 1P7DA 4KLUA 5L1LA 1SV4A 1KN5A 3ZD8A 9ICJA 2G08A 4UAVA 2PFQA 4M9GA 1A6SA 4QWCA 3RBDA 5F9LA 3SEIA 3SAGA 3MABA 7ICOA 5AKIA 1BPEA 1CUKA 5ALMA 4CRXA 1Z1VA 3IG5A 3KD3A 3KKAC 3QU4A 4O3MA 2ZIUA 3NRWA 1L7PA 3H7IA 3K75D 4DFMA 4M04A 2QB1A 3A0HU 4XUSA 2W11A 2LKYA 3V6KA 2ES6A 5KL1B 4MEYA 2FLPA 2P6UA 3V6HA 5KFVA 1RYUA 4G9BA 3RJIA 3IP4B 3QEBZ 3AU2A 4YMMA 1MC8A 2PMZC 2BPFA 2WFAA 5AM0A 2IOFK 3M6ZA 4RZRA 4KLHA 3GV8B 4DSKA 3D2SA 2OHFA 8ICBA 3OTQA 2H5XA 2LBOA 1RXVA 1T4GA 4O3QA 2YMMA 4J9NA 4UASA 4ECTA 2UVWA 4NL9C 2ZIXB 1RYRA 4UARA 2XCAA 2VA8A 4DQSA 5DB6A 4MEXA 1Z4NA 2OXOA 2KFNA 4DEZA 4OJ6A 2OWOA 4DSFA 3PNCA 3KZXA 1PK1A 1UA0A 3E2EA 4EENA 5KFWA 1ED1A 1X6JA 2ASJA 5JU5A 1ZRMA 4ZH4A 4YR2A 4YN4A 1JIHA 3NRZA 3LYSA 2W43A 2JXJA 5AKZA 2NV3A 2ZG6A 3RAXA 9ICFA 5J2HA 2H3QA 2KOBA 2HI0A 3CYMA 3ED5A 3WKCA 3H4BA 2K89A 3CP8A 2YN4A 2BR0A 3RB4A 2LPEA 3ISBA 7ICNA 2F44A 1PVPA 1YT3A 7ICHA 5HMLA 3ORYA 2Q0ZX 4UB5A 4J9LA 4RT2A 4EZ9A 7ICJA 2WF8A 5ALGA 4J9SA 2PKEA 1QTMA 7ICGA 5HP4A 2BDUA 4UB8U 2ZIWB 4BGDA 1EXNA 1VLBA 1H38A 2FLLA 3F2CA 1X2IA 3WK4A 8ICZA 1RDFA 4B9VA 1LVHA 5AK6A 2K4IA 5KFFA 2BQ3A 1L6NA 4Q8EA 4UAYA 5AI0A 2QB0B 4FFDA 3UPQA 5ALFA 4RQ6A 3BS5B 4KLTA 4DL6A 4ECYA 2AU0A 1U47A 4JWMA 5ALTA 4HAIA 1WCNA 1JRPA 2LI6A 2KN7A 3WK7A 4KMUA 5IIIA 4PL2A 2BCRA 9ICPA 2Y1JA 2KVSA 1T94A 2ZIXA 1QH9A 4C7YA 5ALXA 4MF2A 5J0PA 1TVAA 2R8KA 4EBCA 2YMPA 5CR0A 2OYYA 2W04A 5C0YA 4G3IA 1FFUA 1SIJA 1SZHA 4JK1A 4F4ZA 1CEZA 2PXIA 4JWNA 2VIXA 2E8MA 5CA7A 5AIBA 2ESEA 1TAMA 4PPXA 1DK3A 2H3FA 2XICA 3C2LA 1JUDA 5A0LA 4IQWA 3THVA
chains in the Genus database with same CATH topology
4QIWF 4KMOB 2G08A 3AL0B 2NV3A 1ZQ1C 2ZG6A 4FZMA 4QJFB 4U6PA 3PZPA 1A6SA 2H3QA 1HIWA 2KOBA 2R18A 2VJ5A 1PVQA 4WJ3B 5HR7A 3F53A 2H3ZA 3CYMA 4BUGA 2CPRA 2KKPA 3GZFA 4ICAA 2HMXA 2LHTA 2M0NA 3AQFA 3SAGA 2K89A 2A3VA 3CP8A 3SAFA 2KJ8A 4ACOA 3NUQA 3PSTA 3F2DA 2G5HB 2HBMA 3F5EA 1GO3F 4CRXA 2KD1A 2G0AA 2K8CB 4NLBA 3IG5A 2CRXA 1PVPA 2WAQF 1YT3A 2WB1F 2LYBA 3GU3A 2KKVA 2ZIUB 2PMZF 2KICA 4O3MA 2ZIUA 3NRWA 3IN5A 1Z19A 1Q3VA 2KVCA 3F5AA 4QIWC 2YB1A 2RRDA 2F8LA 2HOQA 3MGVA 3N7PD 4BX9C 2JH7A 4BJQA 2VJ4A 2RP5A 2DF4B 3SAHA 1Q3UA 3DEEA 3HKZF 4KX3A 4GFJA 2H3IA 4C0ZA 4CDGA 1CRXA 1A0PA 2KJ5A 2KJ9A 2LKYA 3IG8A 2XI9A 1HEKA 5KL1B 2K4EA 1KBUA 2BDUA 2KHVA 2Y0SC 3D2NA 3CRXA 2Z7JA 2ZIWB 2K8AA 1UPHA 2G06A 2ZIWA 4OJ5A 3H0MB 1NZBA 3D2QA 4CGZA 3AQEA 2XVTA 3F2CA 1Z1BA 1PVRA 2KV2A 4FZLA 2OH2A 2W7PA 3SMVA 2N1RA 3C28A 5CRXA 2VKQA 3SQIA 2K4IA 2WAQC 3IP4B 3H0LB 3L3FX 4U7CA 4AYBF 2F2AB 2WB1C 3H0RB 3T79A 1L6NA 3M6KA 2JMGA 1MA7A 2PMZC 3PSIA 4KX5A 2E5SA 1WUDA 2G5IB 3M6ZA 4FE3A 2HOFA 3D2SA 2Q4TA 3VC8A 3ONNA 2MA1A 3OPXA 2HBLA 3VCBA 2F76X 3F2BA 4P0QB 3HKZC 2HOIA 2K8BB 2CN1A 2LYAA 3N7RC 2ZXHA 4P0QA 2G07A 2LBOA 1F44A 5HR6A 2G09A 2YX8A 2KNJA 2E1FA 2F77X 4IC9A 4PL2A 2DQNB 3C29A 2ZIXB 3LVWA 1T94A 2OM6A 2ZIXA 4OJPA 2MRLA 2JHDA 3O0FA 2ZIVB 3RFAA 2ZIVA 5KL8B 1D8BA 4P0PB 2OXOA 2H3VA 4P0PA 4AYBC 2JH1A 2HBJA 2XIDA 1DRGA 3M7DA 2W03A 3ALRA 4OJ6A 2OYYA 5T14A 3ICXA 2W04A 4QNLA 5C0YA 4OJOA 3KFUF 2YB4A 3E0FA 3KZXA 4NWIA 4OJLA 2ZXIA 1SZHA 4PL1A 2Y0SF 4JMUA 2W7OA 2GOLA 1ECWA 2VIXA 2JGAA 1XNSA 4FZNA 2RHFA 2KEYA 4NLCA 1ED1A 3LVVA 4OO1J 1IIPA 2GH1A 1TAMA 4NV0A 1XO0A 2KIWA 2HBKA 2H3FA 2XICA 3PSPA 2E1EA 2K4HA 1P7DA 2KHQA 4A8EA 2D6FC 5A0LA 3K1ZA 3RF9A 3N7SC 1OUQA 3PSFA 2DGZA 3LYSA 1URJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW F;  4QJF B;  1WUD A;  2RRD A;  5C0Y A;  2MA1 A;  3SAH A;  2HBL A;  4CDG A;  3CYM A;  2CPR A;  3SAG A;  3SAF A;  2RHF A;  4NLC A;  2E1F A;  4OO1 J;  4CGZ A;  2HBM A;  2KV2 A;  1GO3 F;  2HBK A;  4NLB A;  2E1E A;  1YT3 A;  1D8B A;  2DGZ A;  4O3M A;  2HBJ A; 
#chains in the Genus database with same CATH topology
 1TK0 A;  4FZM A;  4PHP A;  2R18 A;  5HHI A;  9ICH A;  2BDP A;  7ICT A;  2BZF A;  5EE0 A;  2R8J A;  4ACO A;  4DQI A;  8ICX A;  3BS7 A;  5AK4 A;  3RB3 A;  1KFS A;  5KFY A;  3FAH A;  4Y2U A;  9ICE A;  3TAD A;  4Z6C A;  3B9J A;  2KIC A;  5IIJ A;  2UVU A;  3C1Y A;  4BJQ A;  5DBB A;  1A0P A;  1JXE A;  2XI9 A;  2EAP A;  4EBD A;  1UHU A;  3CNH A;  2R8H A;  2ZIW A;  5ALU A;  5EWG A;  5D46 A;  1TAU A;  2ODG A;  5KNI A;  4LZD A;  4MF8 A;  4CF4 A;  2F2A B;  3NAS A;  1UCV A;  2V4R A;  1YZ6 A;  1ZQC A;  5KFP A;  3MFI A;  2QB0 A;  1ZQB A;  3BS5 A;  3PV8 A;  4P4P A;  2LYA A;  1BPZ A;  4DFD A;  2E1F A;  4ED2 A;  4QWA A;  1PZN A;  1ZQT A;  3BQ2 A;  3LVW A;  5DDM A;  2ZJ5 A;  4RQM A;  1JAL A;  4O5K A;  3I76 A;  1D9D A;  1QSS A;  5AI9 A;  3BQ1 A;  5KG1 A;  1L8L A;  2WF7 A;  5T14 A;  2A1J B;  4DOA A;  4Z6F A;  3RBE A;  4RQ0 A;  4Z6D A;  5KG7 A;  3M8S A;  3QYP A;  4MFC A;  1TFR A;  3V72 A;  1COK A;  3IDW A;  1X9S A;  5K4L A;  5BOL A;  4I2H A;  3MDC A;  1WWU A;  2DKZ A;  3M9M B;  7ICL A;  5L1I A;  3BQ7 A;  3WKB A;  5AKE A;  1URJ A;  2YMQ A;  4QIW F;  3T5H A;  3Q8P B;  2XCP A;  5KT4 A;  3GIL A;  4EX7 A;  1FO4 A;  1NZP A;  1J2N A;  2H3Z A;  3UMB A;  2JZB B;  2PFP A;  4K4I A;  3H8W A;  3AEV A;  5ALN A;  9ICM A;  3HRD D;  2UVR A;  4F5N A;  2IHM A;  3N28 A;  5L1J A;  1GO3 F;  2KD1 A;  1ZRN A;  5HMM A;  2JEI A;  2WAQ F;  9ICW A;  2ZTD A;  3RAQ A;  2C28 A;  4FBU A;  4B9U A;  3IN5 A;  3RJF A;  3BQ0 A;  2IHN A;  4FS2 A;  1WWV A;  2VJ4 A;  5ALO A;  5KFZ A;  7ICR A;  4CDG A;  8ICA A;  5DQG A;  3QZ7 A;  4QZH A;  2Z7J A;  3S6J A;  2AQ4 A;  1NZB A;  3HPO A;  3Q8S B;  4UB3 A;  7ICE A;  1PVR A;  1S0V A;  5KG4 A;  2OH2 A;  2L5Y A;  4LVS A;  4PGY A;  3WKD A;  2BCQ A;  4B9N A;  1MA7 A;  1K1S A;  3C5G A;  3EPI A;  1SKW A;  2I1Q A;  3GII A;  3JPR A;  5ALH A;  3F2B A;  3ETL A;  3V6J A;  1ZQS A;  3T5K A;  2G09 A;  2EH9 A;  7ICK A;  1XSL A;  4YFK A;  4IR1 A;  2MRL A;  1S0M A;  5HHH A;  4ECR A;  4JV1 A;  4R8U B;  5DQI A;  3HP6 A;  2NO4 A;  5ALI A;  3QZ8 A;  3SYZ A;  5IIM A;  2A1J A;  4DF8 A;  4JMU A;  4Y2S A;  4IR9 A;  2JGA A;  1XNS A;  2VAN A;  4FO6 A;  5AKY A;  2KEY A;  4NLC A;  1KW4 A;  2QKQ A;  2E3T A;  5KFI A;  5J0W A;  2DL0 A;  3RRG A;  5J2K A;  4PJ0 U;  2HHU A;  5J0Q A;  3MFH A;  2RQ5 A;  1JI7 A;  3ZDD A;  4KTQ A;  2F1J A;  1Q8K A;  3GZF A;  2JZB A;  4I2D A;  3TAC B;  8ICS A;  3NVW A;  5F3X B;  2KJ8 A;  5KFQ A;  4DSE A;  8ICO A;  1UT8 A;  4GIB A;  4Y2J A;  4UQG A;  4IRC A;  2HCF A;  1ZQU A;  2DKX A;  2FLN A;  2FDR A;  3MGV A;  1KSP A;  4USA A;  4C0Z A;  1A76 A;  3FYH A;  2W54 A;  2K4E A;  8ICC A;  3UQ0 A;  1QLN A;  3PW0 A;  2XVT A;  2HHV A;  2NRV A;  3QUB A;  1ZQA A;  4O0I A;  5J0X A;  4U7C A;  3H0R B;  3T79 A;  4IQU A;  2BPC A;  4I2B A;  2ZTE A;  3C2K A;  5J8Y A;  3PX6 A;  2MSN A;  3KZI U;  1DGJ A;  1N63 A;  3IHQ B;  1X9X A;  4C8O A;  3A0B U;  2FJ6 A;  3RJK A;  1S0N A;  3C29 A;  5CJ7 A;  4KLJ A;  2GWS A;  4QZB A;  1RPL A;  1D8B A;  1UQV A;  1KFD A;  3UXP A;  4KLF A;  4NLK A;  1B22 A;  4R8U A;  4QZI A;  4Y2V A;  1J2M A;  5HNK A;  3PO5 A;  3GIJ A;  3NGD A;  2YB4 A;  3MR5 A;  3AN1 A;  5DB8 A;  4TQR A;  3Q8M A;  4FZN A;  1JX4 A;  2W3S A;  5DB9 A;  4TUP A;  3GQC A;  3TFS A;  1N5X A;  1SL2 A;  5AKH A;  1L3V A;  2AGQ A;  2KHQ A;  3UXN A;  4A8E A;  3RH4 A;  1ZQK A;  2PFO A;  4QZA A;  3PZP A;  2NRX A;  2W9A A;  4F50 A;  3PVX A;  3K4G A;  4UB6 U;  3L5K A;  2M0N A;  3EPG A;  4IQT A;  3ZDE A;  2JEG A;  4JV0 A;  1DXS A;  4NLN A;  3EW9 A;  1RQL A;  1Q3V A;  2IA6 A;  8ICT A;  4QIW C;  2HHX A;  2R8G A;  2BCU A;  3WU2 U;  1SV0 A;  1UT5 A;  1SXE A;  3QU2 A;  3Q8R B;  3SD7 A;  1L7O A;  9ICS A;  2Y0S C;  3T3F A;  5KFO A;  1WYG A;  4B9T A;  1NKE A;  4FZL A;  7ICI A;  3QXG A;  1ZOL A;  1N60 A;  2WAQ C;  4C8M A;  4UBB A;  5KFU A;  2Y9U A;  4KX5 A;  5DB7 A;  8ICJ A;  5ALJ A;  3WK6 A;  4CE6 A;  3J81 j;  2HBL A;  2F76 X;  8ICY A;  4GXK A;  3N7R C;  2ZXH A;  4NM1 A;  3QX7 A;  4ECZ A;  2YX8 A;  4DQQ A;  2F77 X;  2WF5 A;  5J0T A;  1MQ2 A;  2DQN B;  4DFJ A;  4DOB A;  3GDX A;  1PK3 A;  1N48 A;  1KLN A;  3UXO A;  2XID A;  1TV9 A;  9ICV A;  4QNL A;  3OGU A;  2IBK A;  3KFU F;  2K60 A;  1D8L A;  1RYS A;  9ICT A;  4C7Z A;  1L7M A;  2EQY A;  3V7K A;  1ZQQ A;  4KLG A;  3JPO A;  9ICK A;  4ECQ A;  3NS1 A;  4NV0 A;  4QW8 A;  8ICQ A;  1XSP A;  3GIK A;  1O08 A;  8ICR A;  4KLL A;  3RH6 A;  3RJJ A;  2EAN A;  2EAM A;  3JPQ A;  2PI4 A;  2WTF A;  1HIW A;  7ICM A;  3F53 A;  5E79 U;  3AQF A;  4PHD A;  3PX0 A;  3SV4 A;  2NRZ A;  3NUQ A;  3F2D A;  2ZUB A;  1XWL A;  2G0A A;  1L3T A;  5J0Y A;  5KFJ A;  2LYB A;  1YZ7 A;  3HX0 A;  4J9M A;  4XA5 A;  3WKA A;  3F5A A;  4GLX A;  2I5H A;  2B6G A;  5DBC A;  2HOQ A;  4DL4 A;  3TI0 A;  1ZQE A;  2DF4 B;  2FE9 A;  2H3I A;  1ZJN A;  4F5P A;  4F2R A;  3C1Z A;  3CRX A;  3G6Y A;  2AGO A;  5AM3 A;  1UPH A;  1HJP A;  4Y2Q A;  2MAX A;  2W8K A;  3KHL A;  2W7P A;  3PW7 A;  1DGS A;  3GV5 B;  5G5G A;  3HW8 A;  1KQQ A;  3D6J A;  4AYB F;  4CNQ A;  4QZ9 A;  3T5L A;  4I2I A;  2FMP A;  8ICH A;  2QAR B;  4IS7 A;  4RQ7 A;  1RQN A;  3QU5 A;  4F93 B;  1B4F A;  4B9L A;  3KOO A;  4EX6 A;  4ED3 A;  4OJP A;  1NKB A;  2DUY A;  2ZUC A;  9ICQ A;  5TIS U;  3H4D A;  1X66 A;  3MR3 A;  2NO5 A;  4P4M A;  4QW9 A;  1DOQ A;  2KZ3 A;  3QEA Z;  5G5H A;  2HBK A;  4KLS A;  8ICP A;  4F4W A;  1FFV A;  2DGZ A;  4NXZ A;  2EZZ A;  4Y2X A;  4B9M A;  1ZQ1 C;  1BPX A;  2CPR A;  5KT2 A;  2KZZ A;  4O9M A;  1L5U A;  5ALW A;  5AKK A;  3F5E A;  8ICN A;  4ZOH C;  5FP0 A;  8ICG A;  1N62 A;  2E8O A;  1Z19 A;  1X9W A;  2HHW A;  1SB3 C;  3MGH A;  3SZ2 A;  1QQ7 A;  3SAH A;  4KX3 A;  1CRX A;  4QWD A;  4F2S A;  4XQ8 A;  4J9K A;  1U4B A;  4F4Y A;  1X40 A;  5AKL A;  4KN7 A;  3AU6 A;  4PHE A;  1NNL A;  4MFA A;  1AQ6 A;  1WUD A;  1RXW A;  3ONN A;  2KIV A;  2F1H A;  4OCZ A;  5J2F A;  2HOI A;  2K8B B;  3QUT A;  2F1I A;  2ISO A;  1VJ5 A;  2OCE A;  5AK3 A;  4JV2 A;  2ZIV B;  3RR7 A;  3PR5 B;  2H3V A;  4EBE A;  4C8K A;  2HBJ A;  9ICA A;  4FS1 A;  3C2M A;  4JB3 A;  1BGX T;  1L7N A;  3KKA A;  1LKY B;  3H40 A;  4TUQ A;  1IIP A;  4PGX A;  1T3Q A;  5L1K A;  4EZ6 A;  1XO0 A;  2RDI A;  3PSP A;  4C4S A;  5KFA A;  2DPJ A;  2KTQ A;  5J0R A;  2XO7 A;  2XY5 A;  1T8E A;  1ZQN A;  1OXJ A;  4YQW A;  4KN4 A;  5KFH A;  4KLM A;  4J03 A;  5AK5 A;  5KFE A;  1PVQ A;  4Q44 A;  3QU9 A;  1SL0 A;  1N5W A;  4UAU A;  2LHT A;  5AM2 A;  9ICN A;  4KLQ A;  3MC1 A;  3FM9 A;  2HW3 A;  3H8J A;  4NLB A;  2K8C B;  2KE7 A;  2P35 A;  4QZD A;  2WF9 A;  1BNO A;  1ZD4 A;  4NL9 A;  1NJW A;  2RRD A;  5ALL A;  2HVI A;  1NK0 A;  3IG8 A;  2PI5 A;  1HEK A;  2E8P A;  2KHV A;  1ZQR A;  1SXD A;  4CGZ A;  4BWM A;  3UMC A;  2ZJ8 A;  5AI8 A;  5EWE A;  1J97 A;  5KG3 A;  3H0L B;  4YXM A;  4J9R A;  2WF6 A;  4DL3 A;  5ALP A;  2ASD A;  1U49 A;  4QZE A;  4FE3 A;  5D4B A;  1NK8 A;  9ICL A;  5B5E U;  5KTQ A;  5KFN A;  4DS4 A;  1ZQP A;  1LV5 A;  1V85 A;  1Z4O A;  5KFC A;  1ZD2 P;  3HT3 A;  2UVV A;  3H8M A;  1SKR A;  2ZUD A;  2V9W A;  1Y88 A;  4EEL A;  2ZIV A;  5H2F U;  4P0P B;  5ALZ A;  4AYB C;  9ICR A;  1QSY A;  1NK9 A;  1L3U A;  3ICX A;  1ZD3 A;  4PHA A;  2M9N A;  3QNM A;  4NWI A;  4ELT A;  2NRW A;  4O3P A;  1NK7 A;  5AI6 A;  1LKY A;  5KFK A;  1LB2 B;  3TAR A;  1QQ5 A;  4BDP A;  4TQS A;  3EZ5 A;  3G6V A;  4I2J A;  3PSF A;  1OUQ A;  5KFR A;  4F5Q A;  4KMO B;  3AL0 B;  4U6P A;  2KG5 A;  4X5V A;  3KTQ A;  1KKX A;  3SV3 A;  1QSL A;  4DFP A;  5JTI A;  3WK9 A;  5J2I A;  2I6X A;  4ICA A;  4LZG A;  4Q43 A;  4C4T A;  2HMX A;  3KHH A;  2RLT A;  5KFS A;  3SAF A;  3MR2 A;  1ZQO A;  2CXY A;  1ZJM A;  3DV9 A;  3PST A;  2G5H B;  3IRU A;  4O5E A;  4I2F A;  3ZDA A;  5DGA A;  1KTQ A;  1MSW D;  1IM4 A;  8ICI A;  5KAF U;  4BX9 C;  3MBY A;  1OW5 A;  2XY6 A;  1ZQX A;  3WK8 A;  2FPM A;  7ICP A;  1SKS A;  4ED6 A;  3SMV A;  2N1R A;  5IIN A;  2D3D A;  2VKQ A;  8ICM A;  2A19 A;  4O3R A;  4Q8F A;  1Z3E B;  3LWL A;  1ZET A;  2PFN A;  1S9F A;  2ZTC A;  2G07 A;  1QCK A;  4DQR A;  5CP2 A;  5HR6 A;  4ED0 A;  3B0X A;  2KNJ A;  4DS5 A;  2BGW A;  5CWR A;  5DDY A;  3QU7 A;  4F91 B;  1JRO A;  4DLG A;  4P0P A;  2HHQ A;  4GC6 A;  1D9F A;  4UB4 A;  3BJY A;  4PL1 A;  2FMQ A;  1IG6 A;  4US9 A;  3TAQ A;  3LWM A;  7ICF A;  4F5O A;  5ALR A;  2DBY A;  4OD0 A;  4OO1 J;  3LVV A;  1ZQF A;  2GH1 A;  4RU9 A;  2KIW A;  5KT7 A;  2BCS A;  4NLZ A;  4DWI A;  2BKE A;  1ZQZ A;  5AKJ A;  2C2D A;  4UAW A;  2J6S A;  5AM5 A;  3V7J A;  2CRX A;  4UAT A;  2NYV A;  4QJF B;  3RTV A;  3FDS A;  5HR7 A;  2LMR A;  4I2A A;  2OEH A;  2A3V A;  4RQ2 A;  4GXJ A;  3SI8 A;  2BHN A;  1ZQW A;  3IM1 A;  4EYH B;  5KG6 A;  4O3O A;  1U48 A;  1SWW A;  2B0C A;  4PH5 A;  5DGB A;  5J29 A;  3CW2 C;  2EZY A;  4BXO B;  4M2Y A;  5BOM A;  3HKZ F;  2ALZ A;  4GFJ A;  2A1A A;  4DSJ A;  4M0A A;  2HHT A;  4Y2T A;  5DLG A;  1RZT A;  3OSN A;  5EOZ A;  2KV2 A;  4UB2 A;  8ICV A;  4P4O A;  1FIQ A;  4Y2Y A;  1S5L U;  2LYH A;  3RRH A;  4DFK A;  4Z6E A;  1WCL A;  1C20 A;  3UQ2 A;  3OJU A;  5KT6 A;  1TK5 A;  5CEH A;  5EE1 A;  1XSN A;  2W55 A;  5CB1 A;  5DKW A;  5AI5 A;  3TAD C;  1BNP A;  3EYZ A;  1V38 A;  4DL2 A;  2W9B B;  1MQ3 A;  5KFT A;  1XU4 A;  4F71 A;  5J2C A;  2AH5 A;  4I27 A;  1D8Y A;  2FPL A;  3AUO A;  2J6U A;  5EE3 A;  1SGG A;  2NRT A;  4RNN A;  5J2E A;  5TZV A;  1TK8 A;  1T3N A;  4B6J A;  2BQR A;  2HVH A;  1Z00 B;  5DLF A;  5D49 A;  4QZ8 A;  3UMG A;  4YD2 A;  2BCV A;  2MU2 A;  4EEK A;  2YY6 A;  3PW5 A;  2AQ0 A;  2E1E A;  3EUB 2;  2D6F C;  3I1Y A;  9ICC A;  4I28 A;  3OSP A;  1JN3 A;  8ICK A;  4YMN A;  1X9M A;  4WJ3 B;  1UA1 A;  5ALE A;  2KKP A;  9ICO A;  2W9M A;  4QZG A;  5AIA A;  4BWJ A;  5IIK A;  3JPN A;  4DQP A;  2RDJ A;  3BDP A;  1JXL A;  3I28 A;  4DCC A;  4UBC A;  1ZD5 A;  3HIL A;  2W8L A;  9ICB A;  3ZDB A;  4YG2 A;  7ICQ A;  4BXO A;  4C8L A;  3M9N B;  2LM1 A;  4ECS A;  4R64 A;  4B9S A;  5JRT A;  3N7P D;  2JH7 A;  5B66 U;  2C22 A;  5AM1 A;  5KG5 A;  4YD1 A;  2KJ5 A;  2KFZ A;  3PX4 A;  3D2N A;  1F0M A;  2ISP A;  4FBT A;  2K8A A;  2IMW P;  4ECV A;  3AQE A;  7ICV A;  5EWF A;  4C4R A;  3C28 A;  4YCX A;  2AXT U;  3MR6 A;  2IOH A;  2HHS A;  3M6K A;  9ICU A;  4LJX A;  4RUA A;  1ZQV A;  4IL6 U;  3R9K A;  1ZQM A;  3OPX A;  3QUQ A;  4O3N A;  4KLE A;  5DBA A;  4NY8 A;  1S8O A;  4CF5 A;  3PR4 A;  4IC9 A;  4NM2 A;  4CCH A;  1F5S A;  2W9B A;  5AKX A;  5KL8 B;  1ZQJ A;  3KBB A;  1TAQ A;  1SL1 A;  1XC9 A;  4OJO A;  1XS9 D;  4ECX A;  4F72 A;  3KHG A;  5BPC A;  1ECW A;  4M47 A;  2ATL A;  1NI3 A;  4R65 A;  1Z00 A;  3BQT A;  1VDV A;  2E8N A;  4R63 A;  2C2R A;  4F5R A;  3MDA A;  3K1Z A;  3RF9 A;  1BPD A;  4RQ1 A;  2DPI A;  3E58 A;  3RJG A;  5IIO A;  2VJ5 A;  3TAP A;  4RQ5 A;  4TUR A;  1O03 A;  1B43 A;  3RB6 A;  4DF4 A;  1K1Q A;  1PUZ A;  3K1R B;  1X6I A;  2F3N A;  3ISD A;  2KSO B;  2EDU A;  1TE2 A;  5ALK A;  5ALY A;  5KG0 A;  4M9H A;  5KT5 A;  4J9O A;  4ED7 A;  3IV6 A;  2KKV A;  4DSL A;  4ED1 A;  3FC4 A;  3ETR A;  5KAI U;  1Q46 A;  2QLT A;  5AI4 A;  3OJS A;  1ZQH A;  5J2J A;  2G06 A;  2JEJ A;  3D2Q A;  4F4X A;  1A77 A;  3V7L A;  4KLI A;  3RR8 A;  3SQI A;  4RQ3 A;  4RPX A;  3PW2 A;  2LM4 A;  1NOM A;  4YR3 A;  5AHX A;  1IV8 A;  2EZX A;  4KLO A;  3C23 A;  4DSI A;  1BVS A;  4RQ4 A;  1KEJ A;  3HKZ C;  4F4K A;  3SEN A;  2GLE A;  4O3S A;  3JPS A;  1S76 D;  3KHR A;  4JUZ A;  4RT3 A;  3DDH A;  3TFR A;  3AM9 A;  2Y1I A;  2OM6 A;  3UM9 A;  2JR5 A;  3U26 A;  5IIL A;  2J6T A;  4XRH A;  5DQH A;  3ALR A;  4UW9 A;  4EYI B;  4O5C A;  3E0F A;  4K4G A;  5GTH U;  5J0S A;  2GOL A;  1KRP A;  2QAR A;  4YR0 A;  3G6X A;  3WKE A;  1COO A;  5KG2 A;  4YP3 A;  1N56 A;  5J8Y C;  2ZJA A;  5AIC A;  3PY8 A;  4PZN A;  4YXJ A;  2KMD A;  4OJL A;  5KFB A;  3JPP A;  1N61 A;  2FMS A;  2DFL A;  2XY7 A;  1KDH A;  4HYK A;  9ICX A;  4Y2P A;  1X42 A;  1NK5 A;  2FPK A;  4CF3 A;  1ZQD A;  4QWE A;  3EWA A;  1BPY A;  2KSO A;  4TUS A;  2R8I A;  1QQ6 A;  2HSZ A;  2WB1 F;  1TKD A;  2VA2 A;  2BQU A;  2ASL A;  2YB1 A;  1V97 A;  4J9P A;  3GV7 B;  1L8O A;  5J0U A;  4ELV A;  4DL5 A;  1KBU A;  4IQV A;  2YTU A;  1KL9 A;  2W9C B;  9ICI A;  1N2X A;  3H0M B;  4J9Q A;  3PW4 A;  3TKA A;  1U45 A;  4ED8 A;  2C2E A;  3AMZ A;  4ELU A;  2AJQ A;  3NTU A;  4NLG A;  2GO7 A;  3PMN A;  1MN8 A;  2JEF A;  5DG7 A;  2HOF A;  3PO4 A;  2Q4T A;  1M6Y A;  3VC8 A;  2MA1 A;  2DWQ A;  2JV3 A;  2CN1 A;  1F44 A;  4F8R A;  3SR6 A;  2IOF A;  5L1M A;  1XO1 A;  3BZK A;  2AGP A;  4I2E A;  3ZDC A;  5J2A A;  1NK6 A;  3O0F A;  4P2H A;  3RFA A;  1SV0 C;  4F3O A;  4DLE A;  4AP9 A;  4ECU A;  1S77 D;  3NVY A;  1S97 A;  2ZXI A;  1ZYQ A;  2Y0S F;  4MFF A;  4GXI A;  2XGQ A;  3TAN A;  2RHF A;  1RM6 C;  5KFM A;  4YMO A;  2WHE A;  5F9N A;  4PZO A;  4RNO A;  3N7S C;  2P66 A;  2YML A;  5DG8 A;  1V9P A;  4IRD A;  3C5F A;  1WG8 A;  4BUG A;  4MHV A;  2JRZ A;  4C80 A;  2FI1 A;  2I9G A;  4M6W B;  4RNM A;  3L4P A;  2F8K A;  1KFT A;  2W3R A;  3QUC A;  2PMZ F;  4PGQ A;  4DO9 A;  5AM4 A;  3GIM A;  2KVC A;  4RQN A;  4M9N A;  5KFD A;  2F8L A;  2O6K A;  5J0O A;  3ISC A;  2VA3 A;  5EE9 A;  2KJ9 A;  5AKG A;  4OJ5 A;  4GC7 A;  2W9C A;  1HUZ A;  4ECW A;  3OHB A;  4DOC A;  3GFK B;  5GTI U;  3NVZ A;  3L3F X;  1SZP A;  2JMG A;  1IXR A;  2KP7 A;  3PSI A;  2E5S A;  4RPY A;  1ZQG A;  2G5I B;  2MUT B;  4IRK A;  1ZQY A;  3VCB A;  1ZXI A;  4P0Q B;  1RG6 A;  9ICG A;  3BZC A;  3PML A;  2BPG A;  5KT3 A;  4YVZ A;  1HUO A;  8ICL A;  2HDO A;  4I29 A;  2JH1 A;  4Y2R A;  3RJE A;  3M7D A;  2W03 A;  4KIT B;  3N97 B;  1NJY A;  3HJE A;  5J2G A;  4RPZ A;  1NK4 A;  3N4M B;  5L9X A;  3M1Y A;  4EEY A;  1C7Y A;  3T5J A;  4UAZ A;  4UB1 A;  3HWT A;  3H8S A;  1ZQL A;  3B0Y A;  1JMS A;  1NJX A;  5ALS A;  1B0X A;  4NJ8 A;  3WK5 A;  1CI4 A;  4C8N A;  1ARO P;  5KFL A;  2K4P A;  4QZC A;  8ICF A;  4M6W A;  2HBM A;  2AHO B;  3OHA A;  8ICE A;  1U9L A;  3GU3 A;  4K4H A;  2ZIU B;  2P6R A;  5ALV A;  7ICS A;  2RP5 A;  1Q3U A;  3DEE A;  5C5J A;  1L3S A;  4Q45 A;  5JUM A;  4M9L A;  2XC9 A;  4I2G A;  1K5O A;  5ALD A;  3MGI A;  1Z1B A;  4KLD A;  2EAO A;  4R66 A;  8ICW A;  2YQE A;  5CRX A;  1S10 A;  3TQ1 A;  4E0D A;  4M9J A;  3RH5 A;  2WB1 C;  4I2C A;  3Q8L A;  2D8C A;  3RJH A;  2B21 A;  1DK2 A;  3JPT A;  3Q8Q B;  5CHG A;  4US8 A;  2MUT A;  1NKC A;  1ZQI A;  4P0Q A;  5ALQ A;  3C21 A;  5J2B A;  1S0O A;  4DL7 A;  3LDA A;  3RB0 A;  3ZD9 A;  7ICU A;  2JHD A;  3M8R A;  1DRG A;  3LK9 A;  2KK0 A;  1NJZ A;  8ICU A;  3Q8K A;  5J2D A;  2Y9T A;  4F92 B;  1PK1 B;  4QZF A;  3NVV A;  4RUC A;  4RQ8 A;  2V4Q A;  3ZI4 A;  2W7O A;  2XGP A;  1T7P A;  5DG9 A;  3QE9 Y;  5KFG A;  4QWB A;  1FEZ A;  2KZM A;  5KFX A;  3M9O B;  1BPB A;  1SWV A;  2K4H A;  1P7D A;  4KLU A;  5L1L A;  1SV4 A;  1KN5 A;  3ZD8 A;  9ICJ A;  2G08 A;  4UAV A;  2PFQ A;  4M9G A;  1A6S A;  4QWC A;  3RBD A;  5F9L A;  3SEI A;  3SAG A;  3MAB A;  7ICO A;  5AKI A;  1BPE A;  1CUK A;  5ALM A;  4CRX A;  1Z1V A;  3IG5 A;  3KD3 A;  3KKA C;  3QU4 A;  4O3M A;  2ZIU A;  3NRW A;  1L7P A;  3H7I A;  3K75 D;  4DFM A;  4M04 A;  2QB1 A;  3A0H U;  4XUS A;  2W11 A;  2LKY A;  3V6K A;  2ES6 A;  5KL1 B;  4MEY A;  2FLP A;  2P6U A;  3V6H A;  5KFV A;  1RYU A;  4G9B A;  3RJI A;  3IP4 B;  3QEB Z;  3AU2 A;  4YMM A;  1MC8 A;  2PMZ C;  2BPF A;  2WFA A;  5AM0 A;  2IOF K;  3M6Z A;  4RZR A;  4KLH A;  3GV8 B;  4DSK A;  3D2S A;  2OHF A;  8ICB A;  3OTQ A;  2H5X A;  2LBO A;  1RXV A;  1T4G A;  4O3Q A;  2YMM A;  4J9N A;  4UAS A;  4ECT A;  2UVW A;  4NL9 C;  2ZIX B;  1RYR A;  4UAR A;  2XCA A;  2VA8 A;  4DQS A;  5DB6 A;  4MEX A;  1Z4N A;  2OXO A;  2KFN A;  4DEZ A;  4OJ6 A;  2OWO A;  4DSF A;  3PNC A;  3KZX A;  1PK1 A;  1UA0 A;  3E2E A;  4EEN A;  5KFW A;  1ED1 A;  1X6J A;  2ASJ A;  5JU5 A;  1ZRM A;  4ZH4 A;  4YR2 A;  4YN4 A;  1JIH A;  3NRZ A;  3LYS A;  2W43 A;  2JXJ A;  5AKZ A;  2NV3 A;  2ZG6 A;  3RAX A;  9ICF A;  5J2H A;  2H3Q A;  2KOB A;  2HI0 A;  3CYM A;  3ED5 A;  3WKC A;  3H4B A;  2K89 A;  3CP8 A;  2YN4 A;  2BR0 A;  3RB4 A;  2LPE A;  3ISB A;  7ICN A;  2F44 A;  1PVP A;  1YT3 A;  7ICH A;  5HML A;  3ORY A;  2Q0Z X;  4UB5 A;  4J9L A;  4RT2 A;  4EZ9 A;  7ICJ A;  2WF8 A;  5ALG A;  4J9S A;  2PKE A;  1QTM A;  7ICG A;  5HP4 A;  2BDU A;  4UB8 U;  2ZIW B;  4BGD A;  1EXN A;  1VLB A;  1H38 A;  2FLL A;  3F2C A;  1X2I A;  3WK4 A;  8ICZ A;  1RDF A;  4B9V A;  1LVH A;  5AK6 A;  2K4I A;  5KFF A;  2BQ3 A;  1L6N A;  4Q8E A;  4UAY A;  5AI0 A;  2QB0 B;  4FFD A;  3UPQ A;  5ALF A;  4RQ6 A;  3BS5 B;  4KLT A;  4DL6 A;  4ECY A;  2AU0 A;  1U47 A;  4JWM A;  5ALT A;  4HAI A;  1WCN A;  1JRP A;  2LI6 A;  2KN7 A;  3WK7 A;  4KMU A;  5III A;  4PL2 A;  2BCR A;  9ICP A;  2Y1J A;  2KVS A;  1T94 A;  2ZIX A;  1QH9 A;  4C7Y A;  5ALX A;  4MF2 A;  5J0P A;  1TVA A;  2R8K A;  4EBC A;  2YMP A;  5CR0 A;  2OYY A;  2W04 A;  5C0Y A;  4G3I A;  1FFU A;  1SIJ A;  1SZH A;  4JK1 A;  4F4Z A;  1CEZ A;  2PXI A;  4JWN A;  2VIX A;  2E8M A;  5CA7 A;  5AIB A;  2ESE A;  1TAM A;  4PPX A;  1DK3 A;  2H3F A;  2XIC A;  3C2L A;  1JUD A;  5A0L A;  4IQW A;  3THV A; 
#chains in the Genus database with same CATH homology
 4QIW F;  4KMO B;  2G08 A;  3AL0 B;  2NV3 A;  1ZQ1 C;  2ZG6 A;  4FZM A;  4QJF B;  4U6P A;  3PZP A;  1A6S A;  2H3Q A;  1HIW A;  2KOB A;  2R18 A;  2VJ5 A;  1PVQ A;  4WJ3 B;  5HR7 A;  3F53 A;  2H3Z A;  3CYM A;  4BUG A;  2CPR A;  2KKP A;  3GZF A;  4ICA A;  2HMX A;  2LHT A;  2M0N A;  3AQF A;  3SAG A;  2K89 A;  2A3V A;  3CP8 A;  3SAF A;  2KJ8 A;  4ACO A;  3NUQ A;  3PST A;  3F2D A;  2G5H B;  2HBM A;  3F5E A;  1GO3 F;  4CRX A;  2KD1 A;  2G0A A;  2K8C B;  4NLB A;  3IG5 A;  2CRX A;  1PVP A;  2WAQ F;  1YT3 A;  2WB1 F;  2LYB A;  3GU3 A;  2KKV A;  2ZIU B;  2PMZ F;  2KIC A;  4O3M A;  2ZIU A;  3NRW A;  3IN5 A;  1Z19 A;  1Q3V A;  2KVC A;  3F5A A;  4QIW C;  2YB1 A;  2RRD A;  2F8L A;  2HOQ A;  3MGV A;  3N7P D;  4BX9 C;  2JH7 A;  4BJQ A;  2VJ4 A;  2RP5 A;  2DF4 B;  3SAH A;  1Q3U A;  3DEE A;  3HKZ F;  4KX3 A;  4GFJ A;  2H3I A;  4C0Z A;  4CDG A;  1CRX A;  1A0P A;  2KJ5 A;  2KJ9 A;  2LKY A;  3IG8 A;  2XI9 A;  1HEK A;  5KL1 B;  2K4E A;  1KBU A;  2BDU A;  2KHV A;  2Y0S C;  3D2N A;  3CRX A;  2Z7J A;  2ZIW B;  2K8A A;  1UPH A;  2G06 A;  2ZIW A;  4OJ5 A;  3H0M B;  1NZB A;  3D2Q A;  4CGZ A;  3AQE A;  2XVT A;  3F2C A;  1Z1B A;  1PVR A;  2KV2 A;  4FZL A;  2OH2 A;  2W7P A;  3SMV A;  2N1R A;  3C28 A;  5CRX A;  2VKQ A;  3SQI A;  2K4I A;  2WAQ C;  3IP4 B;  3H0L B;  3L3F X;  4U7C A;  4AYB F;  2F2A B;  2WB1 C;  3H0R B;  3T79 A;  1L6N A;  3M6K A;  2JMG A;  1MA7 A;  2PMZ C;  3PSI A;  4KX5 A;  2E5S A;  1WUD A;  2G5I B;  3M6Z A;  4FE3 A;  2HOF A;  3D2S A;  2Q4T A;  3VC8 A;  3ONN A;  2MA1 A;  3OPX A;  2HBL A;  3VCB A;  2F76 X;  3F2B A;  4P0Q B;  3HKZ C;  2HOI A;  2K8B B;  2CN1 A;  2LYA A;  3N7R C;  2ZXH A;  4P0Q A;  2G07 A;  2LBO A;  1F44 A;  5HR6 A;  2G09 A;  2YX8 A;  2KNJ A;  2E1F A;  2F77 X;  4IC9 A;  4PL2 A;  2DQN B;  3C29 A;  2ZIX B;  3LVW A;  1T94 A;  2OM6 A;  2ZIX A;  4OJP A;  2MRL A;  2JHD A;  3O0F A;  2ZIV B;  3RFA A;  2ZIV A;  5KL8 B;  1D8B A;  4P0P B;  2OXO A;  2H3V A;  4P0P A;  4AYB C;  2JH1 A;  2HBJ A;  2XID A;  1DRG A;  3M7D A;  2W03 A;  3ALR A;  4OJ6 A;  2OYY A;  5T14 A;  3ICX A;  2W04 A;  4QNL A;  5C0Y A;  4OJO A;  3KFU F;  2YB4 A;  3E0F A;  3KZX A;  4NWI A;  4OJL A;  2ZXI A;  1SZH A;  4PL1 A;  2Y0S F;  4JMU A;  2W7O A;  2GOL A;  1ECW A;  2VIX A;  2JGA A;  1XNS A;  4FZN A;  2RHF A;  2KEY A;  4NLC A;  1ED1 A;  3LVV A;  4OO1 J;  1IIP A;  2GH1 A;  1TAM A;  4NV0 A;  1XO0 A;  2KIW A;  2HBK A;  2H3F A;  2XIC A;  3PSP A;  2E1E A;  2K4H A;  1P7D A;  2KHQ A;  4A8E A;  2D6F C;  5A0L A;  3K1Z A;  3RF9 A;  3N7S C;  1OUQ A;  3PSF A;  2DGZ A;  3LYS A;  1URJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...