1WUDA

E. coli recq hrdc domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
NYDRKLFAKLRKLRKSIADESNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALIRAHVDGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ATP-dependent DNA helicase recQ
publication title Conferring Substrate Specificity to DNA Helicases: Role of the RecQ HRDC Domain
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 77
sequence length 77
chains with identical sequence B, D
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2004-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1wudA00
2E1FA 2HBJA 1YT3A 1WUDA 2E1EA 2MA1A 4CGZA 2HBMA 4NLCA 4QIWF 2CPRA 3SAFA 2KV2A 4NLBA 4QJFB 4O3MA 3SAGA 2HBKA 1GO3F 3CYMA 2DGZA 4CDGA 3SAHA 1D8BA 5C0YA 2RRDA 2RHFA 2HBLA 4OO1J
chains in the Genus database with same CATH superfamily
4Y2UA 3JPQA 8ICRA 2HW3A 1KKXA 4ECYA 2E8PA 3LYSA 3QU7A 4IQWA 2EAPA 1NJWA 3IDWA 3FC4A 5AICA 3ZD8A 1U4BA 1RYUA 4C80A 1NK7A 5CB1A 2PKEA 3PO5A 3H7IA 4DOCA 3BQTA 3TI0A 2EDUA 5IILA 4RQ8A 4O5CA 4O0IA 3IP4B 4JWNA 2CPRA 2V4QA 3N97B 1VJ5A 2MSNA 2WF8A 5IIKA 1NK5A 4J9KA 2UVUA 3AU2A 3PW2A 4B9NA 4ELVA 4NLNA 1WWUA 4GFJA 3CRXA 2WF9A 3SEIA 4P4MA 3KZIU 1ZD5A 1Q8KA 2BDUA 8ICAA 5KFTA 2W04A 3UMBA 1X9SA 4NLKA 3Q8QB 2BCSA 2PFOA 1MN8A 2WF7A 4DF8A 1YZ7A 3C5GA 1KDHA 1ZQCA 7ICNA 1QCKA 5ALSA 4QZ9A 1MC8A 1CRXA 1BPBA 2W8LA 4Z6EA 1S76D 1ZQZA 4O3OA 2DPJA 5EWFA 1S0MA 1ZQFA 5DDMA 4OJOA 2OCEA 4I2EA 4QWEA 2NV3A 3GQCA 3EYZA 2P6UA 4UQGA 4EX7A 5KFDA 3G6XA 4F5NA 3NVWA 3M6ZA 8ICWA 3MR2A 2E8NA 3GU3A 1PVQA 3QUBA 4C0ZA 1T3NA 1OUQA 1U9LA 3BJYA 4QWDA 4BWJA 1BVSA 4OJ5A 3HILA 1T4GA 1QSYA 5KFSA 1IIPA 4Z6FA 3OHAA 1BPZA 1FFVA 2ZJ5A 5KFIA 3QXGA 2W9MA 2F1HA 5KFEA 4EZ9A 3NS1A 4UB2A 2WAQF 5AI4A 5J2EA 2NRWA 3WKBA 3Q8LA 1L8LA 5KG6A 2AXTU 1UPHA 2OEHA 1WCNA 2OM6A 4IQVA 4CDGA 2YMLA 5CR0A 2RRDA 2FPLA 2GWSA 3PNCA 3MR3A 4PL1A 1RZTA 3LVWA 4DSLA 1PVPA 4RQMA 2MAXA 4ED2A 3I28A 4DQPA 4RUCA 4YR0A 3ICXA 4MFFA 3NASA 2F3NA 5ALLA 1Q3VA 2R18A 4FO6A 3PW7A 2FPKA 5H2FU 1TAUA 4KITB 2R8HA 5C0YA 1KL9A 4US9A 4YD1A 3MR5A 1SV4A 1ZQJA 1SWVA 4FZMA 5HNKA 5DB9A 4PZOA 1ZQ1C 3ZDCA 3IHQB 4YP3A 5AKJA 1ED1A 8ICNA 3EPIA 2I6XA 4M47A 5ALEA 3WKDA 1Z00B 4J9RA 4A8EA 2P66A 2K89A 3JPSA 1IM4A 2OWOA 1IG6A 2XI9A 3F2CA 8ICKA 3JPTA 4QW9A 3EUB2 1KLNA 3SD7A 7ICRA 4U6PA 5J0SA 4ICAA 2BQUA 1MQ3A 2IMWP 1N63A 2G5IB 4F8RA 3Q8MA 2EZZA 3AQEA 1X9MA 1D8LA 4B9UA 3N7SC 4FS1A 2RDJA 3KHGA 5CEHA 2BDPA 3WK9A 2PFPA 3D6JA 8ICSA 3TARA 2W9CB 9ICJA 2KJ5A 5AI5A 3KZXA 4I27A 4HAIA 5AKIA 4TQRA 4F5OA 3N7PD 4AP9A 2JV3A 7ICSA 5DLGA 4DFMA 5AKEA 2PFQA 3BQ1A 8ICIA 2ZIXA 2WFAA 1F5SA 4QZFA 4C8OA 2VA2A 3KHLA 4NWIA 3L5KA 1TVAA 4YXJA 1HJPA 2XY6A 2KSOA 2NRZA 5KL8B 4BJQA 5L1IA 3RAXA 3ISBA 4BX9C 2JZBA 1PK1B 8ICQA 5E79U 3QNMA 2RLTA 2F44A 9ICTA 5F3XB 2DBYA 1SKRA 5AIAA 3RJGA 4F5PA 1ZQNA 2W54A 3RH4A 4Y2PA 4TUSA 3HJEA 4JUZA 3RF9A 3AU6A 2A1JB 4QZCA 4UW9A 2BCUA 2D3DA 4QIWF 3V7KA 1CI4A 4PH5A 1ZQRA 3QX7A 5HR7A 1TKDA 4EELA 3QU2A 1JROA 2K4HA 1OXJA 4ED3A 2IOFK 3IG8A 4FE3A 4K4GA 3F5AA 1OW5A 1L3SA 2HI0A 5GTIU 2KV2A 2BQRA 2KHVA 4UAYA 2W9AA 5KFGA 5ALRA 1M6YA 2XO7A 5D4BA 3A0HU 1XWLA 2Y1JA 4P0QA 3Q8SB 1RPLA 4DS4A 1KQQA 2E8MA 5DB6A 4KLEA 1LKYB 1HUOA 2E5SA 3IRUA 3G6VA 1UHUA 2H3VA 2BCRA 3RR8A 2ZIVB 2N1RA 2LYHA 1O03A 4UAZA 3THVA 4O5EA 3KHHA 2K8AA 2NO5A 2AJQA 1PUZA 4IR1A 5ALVA 3M9OB 2F77X 1C20A 3NUQA 3NVVA 4RT3A 3T5LA 3RB0A 3SYZA 1PVRA 2KJ9A 1JALA 2OH2A 5DG9A 3S6JA 4B9LA 1JXLA 4I2FA 4YMNA 2K4PA 1WG8A 2K60A 3K1ZA 3JPOA 2MUTB 2KIVA 3HT3A 4ECSA 3RB3A 4ED8A 2IOFA 5EWGA 2KICA 1JRPA 3RH5A 2WB1F 4C8MA 3HX0A 3BS5B 2KMDA 5KFWA 2YX8A 3PR5B 5HP4A 4R8UB 3RBEA 3FAHA 1T3QA 1UT5A 5J2KA 4PL2A 2IA6A 1QSSA 3BS7A 4K4IA 3QUQA 5C5JA 2HBJA 3MFHA 2OYYA 2HHSA 2YB1A 5J29A 2NO4A 4ED0A 1L3VA 2KKPA 2HBKA 3KOOA 4US8A 4YMOA 2ZIUA 3V6JA 3GIMA 3QZ8A 1ZQPA 2BCQA 2KZMA 1N5XA 2RQ5A 4F50A 4EYHB 5ALPA 1N61A 4CGZA 2B0CA 1SZPA 5CA7A 4I2CA 5KFBA 1QQ7A 5AK6A 1P7DA 3H0LB 4Y2JA 3RFAA 5KFOA 4O5KA 4RQ0A 1DXSA 2PI5A 3RR7A 3AL0B 4I28A 4ECQA 5KT3A 3AQFA 4DFKA 2ASJA 1V97A 4RQ2A 4TURA 2GOLA 2LM1A 4YQWA 3NTUA 2ZTDA 2BPCA 3WK5A 1K1QA 2BQ3A 1YZ6A 3ZD9A 5DDYA 4M6WB 2QB0A 2PFNA 2JEGA 3NVYA 3MDCA 5KG5A 9ICRA 2HVIA 2YQEA 3GIKA 4MFCA 2ZUDA 1DGSA 3JPPA 5J0TA 3N28A 4QIWC 1NKCA 1KEJA 9ICIA 4YR3A 3PR4A 1X2IA 4JB3A 2KK0A 1QLNA 1KW4A 2DKXA 4RPYA 9ICKA 4K4HA 1NOMA 3TADA 2C2EA 2HOQA 3CW2C 9ICCA 3Q8KA 2GH1A 1ZD3A 2DL0A 3MABA 1SXEA 1URJA 2YY6A 5GTHU 2XY5A 1UQVA 4Y2QA 2KZZA 4MF8A 1N62A 7ICTA 4DQSA 4I2DA 3H8SA 4M04A 5J2GA 1MA7A 2QLTA 4XRHA 2JXJA 4EBCA 3OSNA 4QZEA 2KTQA 1X66A 5JRTA 2W11A 2XIDA 1PZNA 4RT2A 3SV4A 2BCVA 7ICJA 1V38A 4DWIA 3ETRA 2H3QA 9ICOA 3TQ1A 4C4SA 1T94A 3FM9A 1QSLA 2KIWA 2Q0ZX 3UPQA 4DL6A 2ZJAA 3C2KA 5AM3A 4KLHA 2RP5A 8ICUA 2ISPA 2VA8A 5AIBA 2DWQA 3KD3A 4R64A 1S0NA 4J9SA 4QZAA 2DFLA 3VCBA 5AKZA 3EZ5A 2I9GA 4BDPA 2FJ6A 2K4IA 4E0DA 5ALGA 4ECRA 2V4RA 4KMOB 4KX3A 4RNMA 3GIJA 4M9LA 3WKCA 5KAFU 4C4TA 2VANA 4RQNA 3ALRA 5J2IA 3HRDD 3RH6A 4FZLA 3TKAA 4C7YA 1KN5A 3PX4A 2MU2A 5KNIA 5J0RA 1S0OA 4RQ1A 2WB1C 1COOA 2QARB 3C5FA 1D8YA 4Y2TA 4KLGA 2IHMA 3PSIA 5DB7A 2HHVA 3SV3A 8ICLA 1S10A 1NKBA 4ED1A 1X6JA 1ZQTA 1XO0A 4UARA 4DSJA 4P4OA 1L5UA 2PXIA 1NZBA 3QZ7A 1SKWA 2B21A 2ZIWB 2FMSA 3GV7B 1NNLA 1HIWA 4F3OA 2KOBA 5J0XA 1NK8A 5ALIA 3NGDA 1ZQIA 2BPGA 3AMZA 2JGAA 4RNOA 3PW4A 2DQNB 4MEYA 3BDPA 2C22A 1WYGA 4PJ0U 4M2YA 3GIIA 2AQ4A 5J0OA 1SL0A 4CF5A 4OO1J 1RQLA 3MBYA 2MA1A 1LVHA 4J9MA 1S97A 3Q8PB 3N4MB 1XU4A 4CF4A 5KFHA 2ASLA 3JPRA 3F2DA 4DSEA 3F5EA 4MFAA 4Y2YA 1FIQA 5BOLA 3ISDA 1Q3UA 4NLGA 5AKGA 4JV0A 1RYRA 3TANA 1U49A 1IXRA 5EE1A 2HBMA 2ALZA 2FMQA 4QWCA 1GO3F 1A76A 2IBKA 4QW8A 3ETLA 5AHXA 3MFIA 2HHTA 3RAQA 4QZDA 2DF4B 5KFCA 2W9BA 4JV2A 2K4EA 3EPGA 2G07A 1A77A 4LZDA 4Y2RA 1N56A 2J6SA 3A0BU 3BZKA 4DLEA 4QZ8A 3CP8A 8ICJA 4KX5A 4QZBA 2W9CA 2EAOA 1QH9A 3F2BA 3B9JA 1U45A 1HEKA 2HOFA 4O3QA 5JUMA 1NJZA 2LM4A 3KBBA 5ALYA 4YMMA 2H3IA 1BNOA 4F4WA 3OTQA 3T5HA 4Y2XA 2D6FC 4M9JA 4B6JA 1KFSA 4I2IA 4DQRA 4QWAA 4M9HA 2BZFA 8ICVA 2VIXA 4F5RA 9ICHA 3T3FA 3KTQA 3C23A 2K8CB 4F2RA 5HHIA 3C29A 1BNPA 2KN7A 4BXOA 1B4FA 3JPNA 2KD1A 2F8LA 1Z19A 4J03A 1RYSA 1L7PA 3M9NB 3U26A 4DL2A 5IIOA 2E3TA 4GXJA 1ZQBA 4OJLA 2M9NA 4FBTA 1JIHA 4DLGA 3F53A 1NK6A 4DL7A 1AROP 2YN4A 5L9XA 2ATLA 1UA1A 4OCZA 3E2EA 1ZQVA 1BPXA 3ED5A 5L1MA 4UB1A 1ZQKA 8ICPA 3KHRA 3M8RA 4R66A 3V72A 1L7NA 5CHGA 3GZFA 2ZTEA 2J6UA 4GXKA 3RRHA 3K1RB 2ESEA 4NJ8A 5DG7A 3UMGA 2W8KA 1Q46A 4DOBA 1EXNA 2E1FA 1N5WA 5ALFA 1L7OA 1L7MA 4PGQA 4YD2A 9ICFA 4Y2SA 4NLBA 1ZQXA 2ZIVA 3RJHA 1RM6C 2F1JA 2BKEA 5AKHA 4RPXA 4WJ3B 4M9GA 2FPMA 2EANA 2HBLA 1N2XA 2F76X 1B43A 2ZXHA 5DQIA 4FS2A 4UASA 4ELTA 5KFXA 2QKQA 4C4RA 4NY8A 5KG7A 3TFSA 4P0PB 4USAA 2JMGA 4O3SA 4JWMA 4PHDA 2FLLA 1MQ2A 7ICUA 7ICKA 1CEZA 2G0AA 1TK8A 2AH5A 5B66U 1RXWA 4UATA 4UB8U 1ZJMA 3C21A 3HWTA 4R8UA 2Y0SF 8ICXA 1TAMA 2EH9A 2ZUBA 3C1YA 1S8OA 1Z1VA 1J2NA 8ICMA 4CCHA 3PY8A 3I76A 5DQGA 5J2FA 2ZG6A 4NL9A 2IOHA 3B0XA 3PMLA 2HOIA 4XA5A 2W3RA 2WAQC 1NKEA 1UCVA 2DGZA 4KLSA 2ASDA 1N48A 2ZIXB 5JTIA 3H8JA 3AUOA 3O0FA 3WK6A 3TACB 4KLMA 3RJIA 1NZPA 2DUYA 3NRZA 1TV9A 4Z6CA 1ZQMA 1KTQA 4KLUA 7ICQA 3WK7A 2JZBB 4DFDA 4UAVA 2PMZF 3KKAA 5DB8A 2I5HA 5KT4A 5DGBA 3QU4A 9ICXA 4EBDA 3OGUA 2KG5A 5DKWA 4PHPA 4BUGA 2LPEA 4O3NA 4P2HA 5KFNA 3H0MB 2AGOA 5AKLA 9ICWA 5DLFA 4Q43A 3C1ZA 2BR0A 3LVVA 3QUTA 3M8SA 1ZQGA 3TADC 4F4KA 2J6TA 4QWBA 1VLBA 5ALNA 1SZHA 4CRXA 3D2NA 2MRLA 1KFTA 4NM1A 2G5HB 4RU9A 3PSPA 4RUAA 2XCAA 5HMMA 4M6WA 1X9WA 2FLNA 4NV0A 2G09A 1ZJNA 2KEYA 1FFUA 3RB6A 2H3ZA 9ICQA 1ECWA 4ACOA 5A0LA 1SGGA 5ALKA 3ORYA 7ICLA 2D8CA 1NI3A 5J2CA 2LI6A 1DGJA 4I29A 5J0QA 4TQSA 3PW0A 4GIBA 4BGDA 4P0QB 4NXZA 1BPYA 5KFZA 1ZXIA 3PX0A 4XQ8A 2M0NA 3B0YA 1LB2B 2KZ3A 1F44A 3LWLA 8ICOA 1XC9A 5AM1A 4F2SA 1SKSA 3OPXA 3PSFA 2G06A 5G5GA 9ICSA 3QEAZ 4IL6U 8ICGA 2VKQA 1PK3A 2WTFA 5AM5A 4P4PA 4QZIA 5KFQA 3CNHA 4EENA 3BQ0A 2XVTA 5KT5A 1XSNA 4J9QA 5DBCA 4JMUA 4F93B 1JMSA 2DPIA 4B9SA 1B0XA 1NJYA 4DFPA 4DQIA 2GLEA 4YCXA 3TAPA 1QQ6A 7ICPA 3OHBA 1RDFA 4B9MA 5AKKA 3M6KA 3T5KA 2VA3A 4IQTA 2KNJA 1U47A 4KLJA 3RTVA 4DSFA 1TK0A 2R8IA 3ZDBA 4RQ6A 3RJJA 4KLFA 4Q8EA 2ZJ8A 3H4DA 2F2AB 3SENA 4C7ZA 1ZQDA 1J2MA 2H5XA 2KHQA 2KVSA 3TAQA 1DOQA 3QU5A 3SR6A 3M9MB 4FBUA 4EX6A 4CNQA 4ECTA 1B22A 4LZGA 4KLDA 4MEXA 4KTQA 4C8KA 1SV0A 2DKZA 4RQ5A 3MGVA 8ICBA 4IQUA 4KLIA 4PPXA 5ALXA 4CE6A 4JK1A 1T8EA 7ICEA 2W55A 2BPFA 1RG6A 5BPCA 1U48A 3N7RC 5IINA 3RJKA 3HW8A 4YFKA 2QARA 3UQ2A 3T79A 2A1AA 5AI9A 4IC9A 2Y0SC 5ALJA 3OJSA 3SQIA 5ALOA 4I2AA 3ISCA 2PI4A 4M0AA 1WUDA 1XSPA 2ZIWA 1ZQWA 1NK0A 1KRPA 1SB3C 4DQQA 1A0PA 1TFRA 2XGQA 3PSTA 4YXMA 5J8YA 3GILA 5DBBA 5CJ7A 4GC7A 4ECZA 3SAHA 2VJ5A 5ALUA 1TAQA 5KL1B 3WK8A 8ICHA 3WU2U 2AHOB 3BQ2A 3GV8B 2HHUA 5KT2A 2E8OA 2WF5A 7ICHA 1C7YA 3RJFA 1ZQOA 1ZETA 3ZI4A 4YVZA 3MGIA 2PMZC 3L4PA 8ICZA 3IG5A 2JHDA 3J81j 2NRTA 2LYBA 3LWMA 2QB0B 2HHQA 4KN4A 4PGXA 4F5QA 3PO4A 4R65A 1YT3A 3IM1A 5KT6A 5CP2A 3RBDA 3G6YA 4F4YA 2EZXA 2WF6A 3PVXA 1L6NA 4ED6A 7ICGA 1S77D 1NK4A 3UQ0A 4DL3A 1LV5A 2P6RA 5AM2A 3HPOA 1ZQYA 3MR6A 2W03A 5J0WA 1JUDA 2GO7A 5KTQA 2HHWA 4GC6A 5J0UA 4I2HA 1FO4A 3RB4A 3NVZA 2Y9UA 1ZQQA 3HP6A 2YMPA 3FYHA 2HSZA 1JI7A 5HR6A 2R8GA 4PHAA 3CYMA 1RQNA 1COKA 1X40A 2WHEA 3K4GA 1L3UA 1K1SA 3QUCA 3QU9A 4FZNA 1X6IA 1ZQUA 5KFUA 2Z7JA 1N60A 4F92B 5AI6A 2LYAA 2Q4TA 3H8WA 4YR2A 9ICPA 4UB6U 1QTMA 4F4ZA 4UB4A 1KSPA 2FE9A 2C2RA 1Z00A 3GFKB 3MGHA 4DS5A 2B6GA 9ICUA 4ZH4A 2CXYA 5HHHA 4NLCA 3DV9A 4GLXA 2UVWA 1UT8A 4MHVA 5HMLA 4KLOA 2R8KA 3TFRA 2XICA 4DEZA 2LKYA 1ZD4A 1D8BA 5EE0A 2EZYA 2YMMA 2HDOA 5AM4A 3AN1A 7ICMA 4EZ6A 2E1EA 3RRGA 1K5OA 5AKXA 4DOAA 1L8OA 1Z4OA 2R8JA 3KFUF 1HUZA 2KE7A 2A19A 4UBBA 1S9FA 2L5YA 9ICGA 1SWWA 3AEVA 4ECWA 2K8BB 3H4BA 4JV1A 1BGXT 2XGPA 5CRXA 3QEBZ 9ICLA 9ICBA 1D9DA 1X9XA 2ODGA 4KLQA 1XSLA 4KLTA 5CWRA 4MF2A 5L1JA 5K4LA 1PK1A 5J2DA 4RQ3A 4KN7A 2KKVA 2P35A 4ED7A 3OSPA 2C2DA 1V9PA 1ZQLA 5KG3A 1Z4NA 3HKZF 3V7LA 3MDAA 9ICAA 3IN5A 3ZDAA 2V9WA 5DG8A 2F8KA 2UVVA 2A1JA 3T5JA 4P0PA 2LMRA 5AK4A 4B9VA 4DSIA 1X42A 4NL9C 5ALZA 4DL5A 1L3TA 4O9MA 3PZPA 3ONNA 2G08A 5KG4A 5KFPA 2Y1IA 2CRXA 4M9NA 5EWEA 5F9LA 3PX6A 4OD0A 3WKEA 5AK5A 5IIMA 4X5VA 1ZRNA 2NRVA 5KG2A 3GV5B 2A3VA 4RZRA 1D9FA 3ZDDA 2XY7A 4HYKA 2IHNA 4ZOHC 4EEKA 2W7OA 9ICMA 2LHTA 3C2MA 3UM9A 5J2HA 2ZUCA 2RDIA 8ICCA 3FDSA 3KKAC 2W43A 3LDAA 2W9BB 4TUPA 5KAIU 4Z6DA 2I1QA 1LKYA 4F91B 4EBEA 3D2SA 3QYPA 2ISOA 5TISU 2KFZA 5IIJA 5T14A 2FLPA 4QZGA 4QZHA 4UAWA 4I2JA 4F72A 2ZXIA 3OJUA 2AGQA 5ALDA 5J0PA 4J9NA 4RNNA 2QB1A 1XO1A 2W3SA 1SL1A 3RJEA 4DSKA 4C8NA 4XUSA 2VJ4A 4IRKA 4C8LA 5EE3A 4BXOB 3DEEA 4ECUA 2EQYA 4AYBF 2AGPA 1T7PA 1TE2A 2MUTA 8ICFA 1ZD2P 1JN3A 1S0VA 1ZYQA 5D46A 1DK2A 3WK4A 4J9OA 5DGAA 2EAMA 4YG2A 3R9KA 3BS5A 1V85A 1S5LU 3SMVA 1TK5A 5AK3A 1Z3EB 3V7JA 5J2JA 1SL2A 1O08A 5KFFA 5AI8A 4DO9A 5AI0A 2YMQA 3M7DA 3SI8A 8ICEA 2JEJA 1AQ6A 2F1IA 2KJ8A 1KFDA 5AKYA 5EOZA 1A6SA 1J97A 3C28A 4QJFB 3UXNA 3PV8A 4LJXA 2XCPA 5KFYA 4DF4A 4DFJA 4IRCA 4F71A 4QNLA 4IR9A 4I2BA 2Y9TA 2JRZA 3UMCA 5BOMA 2JH1A 2KSOB 3EW9A 3E58A 4UB5A 2FI1A 2OXOA 3SAFA 7ICIA 2H3FA 2W7PA 3K75D 4EEYA 3UXOA 4RQ7A 2HCFA 2BGWA 5KFRA 9ICEA 4UBCA 4UB3A 4NLZA 1DRGA 8ICTA 1SV0C 4KLLA 3PMNA 1SIJA 2JEIA 5ALHA 4J9PA 4FFDA 2HVHA 4R63A 2JH7A 3M1YA 5KG1A 4O3MA 4Y2VA 2JEFA 5KFVA 5ALMA 1ZQSA 2YB4A 3C2LA 4BWMA 4G3IA 4EYIB 2KFNA 5J2AA 4ECVA 5G5HA 5ALWA 5D49A 4IS7A 4UAUA 2UVRA 3H40A 3HKZC 4PZNA 5ALQA 5KFMA 3Q8RB 4O3RA 3H0RB 3SAGA 3I1YA 4B9TA 5J8YC 4U7CA 3V6HA 1KBUA 4OJPA 5EE9A 5KFJA 1CUKA 5DQHA 4TUQA 4LVSA 1RXVA 3AM9A 3D2QA 1WCLA 2KP7A 1JX4A 2AU0A 1Y88A 9ICVA 3PW5A 2FMPA 4Q8FA 3MC1A 2FDRA 1BPEA 1UA0A 5KT7A 5F9NA 5L1KA 7ICOA 4CF3A 2NYVA 4NM2A 2ZTCA 4GXIA 5B5EU 4PGYA 2O6KA 1XS9D 2LBOA 3BZCA 5TZVA 1H38A 9ICNA 4RPZA 4PHEA 5JU5A 1ZQHA 3QE9Y 1NJXA 3E0FA 1QQ5A 2JR5A 1NK9A 1WWVA 4OJ6A 2YTUA 3GDXA 1MSWD 3EWAA 4DCCA 1F0MA 1Z1BA 2C28A 4Q45A 3L3FX 5AM0A 1SXDA 3ZDEA 2OHFA 4ECXA 1XNSA 8ICYA 4J9LA 4I2GA 4DL4A 1ZQEA 3DDHA 4ELUA 3UXPA 4G9BA 4AYBC 3VC8A 3LK9A 1DK3A 3NRWA 2HMXA 4Q44A 5L1LA 5KG0A 4F4XA 1VDVA 5IIIA 2ZIUB 3BQ7A 3V6KA 1JXEA 5KFKA 1ZQAA 2KVCA 3H8MA 5J0YA 2RHFA 5ALTA 7ICFA 5KFLA 5FP0A 5KFAA 2CN1A 2AQ0A 3WKAA 1BPDA 2ES6A 2BHNA 7ICVA 2NRXA 3IV6A 1ZRMA 5J2BA 4IRDA 2HHXA 1IV8A 1FEZA 1ZOLA 4KMUA 2XC9A 4O3PA 4RQ4A 5DBAA 3SZ2A 4YN4A
chains in the Genus database with same CATH topology
2HBJA 2ZXHA 1YT3A 2OYYA 1NZBA 2LBOA 3M6ZA 2ZIWB 3IG8A 2E1EA 2HOQA 4FE3A 2XI9A 2YB1A 3F2CA 2GH1A 2JH1A 3GU3A 3LYSA 3F5AA 2KHQA 1HIWA 3LVVA 2VIXA 2JMGA 4C0ZA 1PVQA 4P0PB 3D2SA 3E0FA 2OXOA 1URJA 2KOBA 3SAFA 2KV2A 5T14A 1OUQA 2H3FA 2W7PA 2KKPA 1SZHA 1L6NA 2K8CB 2KHVA 4U6PA 4ICAA 3D2NA 2HBKA 2MRLA 4CRXA 3KFUF 4OJ6A 2JGAA 2ZIUA 2ZXIA 3C29A 4OJ5A 2DQNB 1Z1BA 2G5HB 3PSPA 2G5IB 4P0QA 2KD1A 3MGVA 3L3FX 3AQEA 1IIPA 1MA7A 2F8LA 1Z19A 2G0AA 2W03A 3N7SC 1DRGA 2K8BB 4OO1J 4NV0A 2G09A 2KEYA 4P0PA 2H3ZA 5CRXA 2XIDA 2E5SA 1XNSA 1ECWA 4ACOA 5A0LA 2MA1A 3IP4B 2VJ4A 4CGZA 2CPRA 2H3VA 3N7RC 2JH7A 2ZIVB 2WAQF 2H3QA 5HR6A 2KJ5A 2N1RA 4O3MA 1P7DA 3T79A 3KZXA 4OJLA 3H0LB 3RFAA 3DEEA 4AYBF 2K8AA 2Y0SF 1T94A 2YB4A 1TAMA 3CYMA 3N7PD 1UPHA 4P0QB 2KIWA 3F53A 4IC9A 3F2DA 4AYBC 2KKVA 3F5EA 3VC8A 2OM6A 2Y0SC 4CDGA 2RP5A 3SQIA 3AL0B 4GFJA 3CRXA 2RRDA 2F77X 2ZIXA 1Q3UA 2M0NA 3HKZF 3AQFA 3NUQA 4NWIA 1WUDA 2BDUA 3IN5A 2ZIWA 1F44A 4FZNA 3HKZC 4PL1A 3LVWA 2W04A 2GOLA 3NRWA 2HBMA 5KL8B 3VCBA 2Z7JA 4BJQA 2KJ9A 1A0PA 2HMXA 2ZG6A 3H0RB 3OPXA 3PSFA 1PVPA 2K4IA 3PSTA 2HOIA 2G06A 4BX9C 3SAGA 3GZFA 2LYAA 3SMVA 1GO3F 2Q4TA 2VKQA 4KMOB 2ZIUB 3ICXA 4KX3A 2OH2A 2WAQC 4U7CA 1Q3VA 1KBUA 2R18A 4OJPA 3ONNA 2DGZA 2G08A 2KVCA 3PZPA 3K1ZA 2CRXA 3ALRA 2ZIXB 2XVTA 3SAHA 2DF4B 2F76X 2VJ5A 5C0YA 3D2QA 3O0FA 2RHFA 5KL1B 2K4EA 4FZLA 1CRXA 4JMUA 2E1FA 2CN1A 2KICA 2A3VA 2G07A 3RF9A 3M7DA 2WB1F 2KJ8A 4NLCA 4QIWF 1A6SA 2WB1C 3CP8A 2W7OA 4FZMA 4NLBA 2PMZF 2LHTA 4KX5A 4QJFB 2YX8A 2ZIVA 3C28A 4QIWC 3M6KA 4OJOA 3F2BA 1ZQ1C 3PSIA 2PMZC 3IG5A 2JHDA 1HEKA 2KNJA 2XICA 2HOFA 4WJ3B 5HR7A 1ED1A 2NV3A 4QNLA 2LKYA 2LYBA 4PL2A 2H3IA 1PVRA 4BUGA 1D8BA 2K4HA 1XO0A 2HBLA 4A8EA 2F2AB 2K89A 2D6FC 3H0MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1F A;  2HBJ A;  1YT3 A;  1WUD A;  2E1E A;  2MA1 A;  4CGZ A;  2HBM A;  4NLC A;  4QIW F;  2CPR A;  3SAF A;  2KV2 A;  4NLB A;  4QJF B;  4O3M A;  3SAG A;  2HBK A;  1GO3 F;  3CYM A;  2DGZ A;  4CDG A;  3SAH A;  1D8B A;  5C0Y A;  2RRD A;  2RHF A;  2HBL A;  4OO1 J; 
#chains in the Genus database with same CATH topology
 4Y2U A;  3JPQ A;  8ICR A;  2HW3 A;  1KKX A;  4ECY A;  2E8P A;  3LYS A;  3QU7 A;  4IQW A;  2EAP A;  1NJW A;  3IDW A;  3FC4 A;  5AIC A;  3ZD8 A;  1U4B A;  1RYU A;  4C80 A;  1NK7 A;  5CB1 A;  2PKE A;  3PO5 A;  3H7I A;  4DOC A;  3BQT A;  3TI0 A;  2EDU A;  5IIL A;  4RQ8 A;  4O5C A;  4O0I A;  3IP4 B;  4JWN A;  2CPR A;  2V4Q A;  3N97 B;  1VJ5 A;  2MSN A;  2WF8 A;  5IIK A;  1NK5 A;  4J9K A;  2UVU A;  3AU2 A;  3PW2 A;  4B9N A;  4ELV A;  4NLN A;  1WWU A;  4GFJ A;  3CRX A;  2WF9 A;  3SEI A;  4P4M A;  3KZI U;  1ZD5 A;  1Q8K A;  2BDU A;  8ICA A;  5KFT A;  2W04 A;  3UMB A;  1X9S A;  4NLK A;  3Q8Q B;  2BCS A;  2PFO A;  1MN8 A;  2WF7 A;  4DF8 A;  1YZ7 A;  3C5G A;  1KDH A;  1ZQC A;  7ICN A;  1QCK A;  5ALS A;  4QZ9 A;  1MC8 A;  1CRX A;  1BPB A;  2W8L A;  4Z6E A;  1S76 D;  1ZQZ A;  4O3O A;  2DPJ A;  5EWF A;  1S0M A;  1ZQF A;  5DDM A;  4OJO A;  2OCE A;  4I2E A;  4QWE A;  2NV3 A;  3GQC A;  3EYZ A;  2P6U A;  4UQG A;  4EX7 A;  5KFD A;  3G6X A;  4F5N A;  3NVW A;  3M6Z A;  8ICW A;  3MR2 A;  2E8N A;  3GU3 A;  1PVQ A;  3QUB A;  4C0Z A;  1T3N A;  1OUQ A;  1U9L A;  3BJY A;  4QWD A;  4BWJ A;  1BVS A;  4OJ5 A;  3HIL A;  1T4G A;  1QSY A;  5KFS A;  1IIP A;  4Z6F A;  3OHA A;  1BPZ A;  1FFV A;  2ZJ5 A;  5KFI A;  3QXG A;  2W9M A;  2F1H A;  5KFE A;  4EZ9 A;  3NS1 A;  4UB2 A;  2WAQ F;  5AI4 A;  5J2E A;  2NRW A;  3WKB A;  3Q8L A;  1L8L A;  5KG6 A;  2AXT U;  1UPH A;  2OEH A;  1WCN A;  2OM6 A;  4IQV A;  4CDG A;  2YML A;  5CR0 A;  2RRD A;  2FPL A;  2GWS A;  3PNC A;  3MR3 A;  4PL1 A;  1RZT A;  3LVW A;  4DSL A;  1PVP A;  4RQM A;  2MAX A;  4ED2 A;  3I28 A;  4DQP A;  4RUC A;  4YR0 A;  3ICX A;  4MFF A;  3NAS A;  2F3N A;  5ALL A;  1Q3V A;  2R18 A;  4FO6 A;  3PW7 A;  2FPK A;  5H2F U;  1TAU A;  4KIT B;  2R8H A;  5C0Y A;  1KL9 A;  4US9 A;  4YD1 A;  3MR5 A;  1SV4 A;  1ZQJ A;  1SWV A;  4FZM A;  5HNK A;  5DB9 A;  4PZO A;  1ZQ1 C;  3ZDC A;  3IHQ B;  4YP3 A;  5AKJ A;  1ED1 A;  8ICN A;  3EPI A;  2I6X A;  4M47 A;  5ALE A;  3WKD A;  1Z00 B;  4J9R A;  4A8E A;  2P66 A;  2K89 A;  3JPS A;  1IM4 A;  2OWO A;  1IG6 A;  2XI9 A;  3F2C A;  8ICK A;  3JPT A;  4QW9 A;  3EUB 2;  1KLN A;  3SD7 A;  7ICR A;  4U6P A;  5J0S A;  4ICA A;  2BQU A;  1MQ3 A;  2IMW P;  1N63 A;  2G5I B;  4F8R A;  3Q8M A;  2EZZ A;  3AQE A;  1X9M A;  1D8L A;  4B9U A;  3N7S C;  4FS1 A;  2RDJ A;  3KHG A;  5CEH A;  2BDP A;  3WK9 A;  2PFP A;  3D6J A;  8ICS A;  3TAR A;  2W9C B;  9ICJ A;  2KJ5 A;  5AI5 A;  3KZX A;  4I27 A;  4HAI A;  5AKI A;  4TQR A;  4F5O A;  3N7P D;  4AP9 A;  2JV3 A;  7ICS A;  5DLG A;  4DFM A;  5AKE A;  2PFQ A;  3BQ1 A;  8ICI A;  2ZIX A;  2WFA A;  1F5S A;  4QZF A;  4C8O A;  2VA2 A;  3KHL A;  4NWI A;  3L5K A;  1TVA A;  4YXJ A;  1HJP A;  2XY6 A;  2KSO A;  2NRZ A;  5KL8 B;  4BJQ A;  5L1I A;  3RAX A;  3ISB A;  4BX9 C;  2JZB A;  1PK1 B;  8ICQ A;  5E79 U;  3QNM A;  2RLT A;  2F44 A;  9ICT A;  5F3X B;  2DBY A;  1SKR A;  5AIA A;  3RJG A;  4F5P A;  1ZQN A;  2W54 A;  3RH4 A;  4Y2P A;  4TUS A;  3HJE A;  4JUZ A;  3RF9 A;  3AU6 A;  2A1J B;  4QZC A;  4UW9 A;  2BCU A;  2D3D A;  4QIW F;  3V7K A;  1CI4 A;  4PH5 A;  1ZQR A;  3QX7 A;  5HR7 A;  1TKD A;  4EEL A;  3QU2 A;  1JRO A;  2K4H A;  1OXJ A;  4ED3 A;  2IOF K;  3IG8 A;  4FE3 A;  4K4G A;  3F5A A;  1OW5 A;  1L3S A;  2HI0 A;  5GTI U;  2KV2 A;  2BQR A;  2KHV A;  4UAY A;  2W9A A;  5KFG A;  5ALR A;  1M6Y A;  2XO7 A;  5D4B A;  3A0H U;  1XWL A;  2Y1J A;  4P0Q A;  3Q8S B;  1RPL A;  4DS4 A;  1KQQ A;  2E8M A;  5DB6 A;  4KLE A;  1LKY B;  1HUO A;  2E5S A;  3IRU A;  3G6V A;  1UHU A;  2H3V A;  2BCR A;  3RR8 A;  2ZIV B;  2N1R A;  2LYH A;  1O03 A;  4UAZ A;  3THV A;  4O5E A;  3KHH A;  2K8A A;  2NO5 A;  2AJQ A;  1PUZ A;  4IR1 A;  5ALV A;  3M9O B;  2F77 X;  1C20 A;  3NUQ A;  3NVV A;  4RT3 A;  3T5L A;  3RB0 A;  3SYZ A;  1PVR A;  2KJ9 A;  1JAL A;  2OH2 A;  5DG9 A;  3S6J A;  4B9L A;  1JXL A;  4I2F A;  4YMN A;  2K4P A;  1WG8 A;  2K60 A;  3K1Z A;  3JPO A;  2MUT B;  2KIV A;  3HT3 A;  4ECS A;  3RB3 A;  4ED8 A;  2IOF A;  5EWG A;  2KIC A;  1JRP A;  3RH5 A;  2WB1 F;  4C8M A;  3HX0 A;  3BS5 B;  2KMD A;  5KFW A;  2YX8 A;  3PR5 B;  5HP4 A;  4R8U B;  3RBE A;  3FAH A;  1T3Q A;  1UT5 A;  5J2K A;  4PL2 A;  2IA6 A;  1QSS A;  3BS7 A;  4K4I A;  3QUQ A;  5C5J A;  2HBJ A;  3MFH A;  2OYY A;  2HHS A;  2YB1 A;  5J29 A;  2NO4 A;  4ED0 A;  1L3V A;  2KKP A;  2HBK A;  3KOO A;  4US8 A;  4YMO A;  2ZIU A;  3V6J A;  3GIM A;  3QZ8 A;  1ZQP A;  2BCQ A;  2KZM A;  1N5X A;  2RQ5 A;  4F50 A;  4EYH B;  5ALP A;  1N61 A;  4CGZ A;  2B0C A;  1SZP A;  5CA7 A;  4I2C A;  5KFB A;  1QQ7 A;  5AK6 A;  1P7D A;  3H0L B;  4Y2J A;  3RFA A;  5KFO A;  4O5K A;  4RQ0 A;  1DXS A;  2PI5 A;  3RR7 A;  3AL0 B;  4I28 A;  4ECQ A;  5KT3 A;  3AQF A;  4DFK A;  2ASJ A;  1V97 A;  4RQ2 A;  4TUR A;  2GOL A;  2LM1 A;  4YQW A;  3NTU A;  2ZTD A;  2BPC A;  3WK5 A;  1K1Q A;  2BQ3 A;  1YZ6 A;  3ZD9 A;  5DDY A;  4M6W B;  2QB0 A;  2PFN A;  2JEG A;  3NVY A;  3MDC A;  5KG5 A;  9ICR A;  2HVI A;  2YQE A;  3GIK A;  4MFC A;  2ZUD A;  1DGS A;  3JPP A;  5J0T A;  3N28 A;  4QIW C;  1NKC A;  1KEJ A;  9ICI A;  4YR3 A;  3PR4 A;  1X2I A;  4JB3 A;  2KK0 A;  1QLN A;  1KW4 A;  2DKX A;  4RPY A;  9ICK A;  4K4H A;  1NOM A;  3TAD A;  2C2E A;  2HOQ A;  3CW2 C;  9ICC A;  3Q8K A;  2GH1 A;  1ZD3 A;  2DL0 A;  3MAB A;  1SXE A;  1URJ A;  2YY6 A;  5GTH U;  2XY5 A;  1UQV A;  4Y2Q A;  2KZZ A;  4MF8 A;  1N62 A;  7ICT A;  4DQS A;  4I2D A;  3H8S A;  4M04 A;  5J2G A;  1MA7 A;  2QLT A;  4XRH A;  2JXJ A;  4EBC A;  3OSN A;  4QZE A;  2KTQ A;  1X66 A;  5JRT A;  2W11 A;  2XID A;  1PZN A;  4RT2 A;  3SV4 A;  2BCV A;  7ICJ A;  1V38 A;  4DWI A;  3ETR A;  2H3Q A;  9ICO A;  3TQ1 A;  4C4S A;  1T94 A;  3FM9 A;  1QSL A;  2KIW A;  2Q0Z X;  3UPQ A;  4DL6 A;  2ZJA A;  3C2K A;  5AM3 A;  4KLH A;  2RP5 A;  8ICU A;  2ISP A;  2VA8 A;  5AIB A;  2DWQ A;  3KD3 A;  4R64 A;  1S0N A;  4J9S A;  4QZA A;  2DFL A;  3VCB A;  5AKZ A;  3EZ5 A;  2I9G A;  4BDP A;  2FJ6 A;  2K4I A;  4E0D A;  5ALG A;  4ECR A;  2V4R A;  4KMO B;  4KX3 A;  4RNM A;  3GIJ A;  4M9L A;  3WKC A;  5KAF U;  4C4T A;  2VAN A;  4RQN A;  3ALR A;  5J2I A;  3HRD D;  3RH6 A;  4FZL A;  3TKA A;  4C7Y A;  1KN5 A;  3PX4 A;  2MU2 A;  5KNI A;  5J0R A;  1S0O A;  4RQ1 A;  2WB1 C;  1COO A;  2QAR B;  3C5F A;  1D8Y A;  4Y2T A;  4KLG A;  2IHM A;  3PSI A;  5DB7 A;  2HHV A;  3SV3 A;  8ICL A;  1S10 A;  1NKB A;  4ED1 A;  1X6J A;  1ZQT A;  1XO0 A;  4UAR A;  4DSJ A;  4P4O A;  1L5U A;  2PXI A;  1NZB A;  3QZ7 A;  1SKW A;  2B21 A;  2ZIW B;  2FMS A;  3GV7 B;  1NNL A;  1HIW A;  4F3O A;  2KOB A;  5J0X A;  1NK8 A;  5ALI A;  3NGD A;  1ZQI A;  2BPG A;  3AMZ A;  2JGA A;  4RNO A;  3PW4 A;  2DQN B;  4MEY A;  3BDP A;  2C22 A;  1WYG A;  4PJ0 U;  4M2Y A;  3GII A;  2AQ4 A;  5J0O A;  1SL0 A;  4CF5 A;  4OO1 J;  1RQL A;  3MBY A;  2MA1 A;  1LVH A;  4J9M A;  1S97 A;  3Q8P B;  3N4M B;  1XU4 A;  4CF4 A;  5KFH A;  2ASL A;  3JPR A;  3F2D A;  4DSE A;  3F5E A;  4MFA A;  4Y2Y A;  1FIQ A;  5BOL A;  3ISD A;  1Q3U A;  4NLG A;  5AKG A;  4JV0 A;  1RYR A;  3TAN A;  1U49 A;  1IXR A;  5EE1 A;  2HBM A;  2ALZ A;  2FMQ A;  4QWC A;  1GO3 F;  1A76 A;  2IBK A;  4QW8 A;  3ETL A;  5AHX A;  3MFI A;  2HHT A;  3RAQ A;  4QZD A;  2DF4 B;  5KFC A;  2W9B A;  4JV2 A;  2K4E A;  3EPG A;  2G07 A;  1A77 A;  4LZD A;  4Y2R A;  1N56 A;  2J6S A;  3A0B U;  3BZK A;  4DLE A;  4QZ8 A;  3CP8 A;  8ICJ A;  4KX5 A;  4QZB A;  2W9C A;  2EAO A;  1QH9 A;  3F2B A;  3B9J A;  1U45 A;  1HEK A;  2HOF A;  4O3Q A;  5JUM A;  1NJZ A;  2LM4 A;  3KBB A;  5ALY A;  4YMM A;  2H3I A;  1BNO A;  4F4W A;  3OTQ A;  3T5H A;  4Y2X A;  2D6F C;  4M9J A;  4B6J A;  1KFS A;  4I2I A;  4DQR A;  4QWA A;  4M9H A;  2BZF A;  8ICV A;  2VIX A;  4F5R A;  9ICH A;  3T3F A;  3KTQ A;  3C23 A;  2K8C B;  4F2R A;  5HHI A;  3C29 A;  1BNP A;  2KN7 A;  4BXO A;  1B4F A;  3JPN A;  2KD1 A;  2F8L A;  1Z19 A;  4J03 A;  1RYS A;  1L7P A;  3M9N B;  3U26 A;  4DL2 A;  5IIO A;  2E3T A;  4GXJ A;  1ZQB A;  4OJL A;  2M9N A;  4FBT A;  1JIH A;  4DLG A;  3F53 A;  1NK6 A;  4DL7 A;  1ARO P;  2YN4 A;  5L9X A;  2ATL A;  1UA1 A;  4OCZ A;  3E2E A;  1ZQV A;  1BPX A;  3ED5 A;  5L1M A;  4UB1 A;  1ZQK A;  8ICP A;  3KHR A;  3M8R A;  4R66 A;  3V72 A;  1L7N A;  5CHG A;  3GZF A;  2ZTE A;  2J6U A;  4GXK A;  3RRH A;  3K1R B;  2ESE A;  4NJ8 A;  5DG7 A;  3UMG A;  2W8K A;  1Q46 A;  4DOB A;  1EXN A;  2E1F A;  1N5W A;  5ALF A;  1L7O A;  1L7M A;  4PGQ A;  4YD2 A;  9ICF A;  4Y2S A;  4NLB A;  1ZQX A;  2ZIV A;  3RJH A;  1RM6 C;  2F1J A;  2BKE A;  5AKH A;  4RPX A;  4WJ3 B;  4M9G A;  2FPM A;  2EAN A;  2HBL A;  1N2X A;  2F76 X;  1B43 A;  2ZXH A;  5DQI A;  4FS2 A;  4UAS A;  4ELT A;  5KFX A;  2QKQ A;  4C4R A;  4NY8 A;  5KG7 A;  3TFS A;  4P0P B;  4USA A;  2JMG A;  4O3S A;  4JWM A;  4PHD A;  2FLL A;  1MQ2 A;  7ICU A;  7ICK A;  1CEZ A;  2G0A A;  1TK8 A;  2AH5 A;  5B66 U;  1RXW A;  4UAT A;  4UB8 U;  1ZJM A;  3C21 A;  3HWT A;  4R8U A;  2Y0S F;  8ICX A;  1TAM A;  2EH9 A;  2ZUB A;  3C1Y A;  1S8O A;  1Z1V A;  1J2N A;  8ICM A;  4CCH A;  3PY8 A;  3I76 A;  5DQG A;  5J2F A;  2ZG6 A;  4NL9 A;  2IOH A;  3B0X A;  3PML A;  2HOI A;  4XA5 A;  2W3R A;  2WAQ C;  1NKE A;  1UCV A;  2DGZ A;  4KLS A;  2ASD A;  1N48 A;  2ZIX B;  5JTI A;  3H8J A;  3AUO A;  3O0F A;  3WK6 A;  3TAC B;  4KLM A;  3RJI A;  1NZP A;  2DUY A;  3NRZ A;  1TV9 A;  4Z6C A;  1ZQM A;  1KTQ A;  4KLU A;  7ICQ A;  3WK7 A;  2JZB B;  4DFD A;  4UAV A;  2PMZ F;  3KKA A;  5DB8 A;  2I5H A;  5KT4 A;  5DGB A;  3QU4 A;  9ICX A;  4EBD A;  3OGU A;  2KG5 A;  5DKW A;  4PHP A;  4BUG A;  2LPE A;  4O3N A;  4P2H A;  5KFN A;  3H0M B;  2AGO A;  5AKL A;  9ICW A;  5DLF A;  4Q43 A;  3C1Z A;  2BR0 A;  3LVV A;  3QUT A;  3M8S A;  1ZQG A;  3TAD C;  4F4K A;  2J6T A;  4QWB A;  1VLB A;  5ALN A;  1SZH A;  4CRX A;  3D2N A;  2MRL A;  1KFT A;  4NM1 A;  2G5H B;  4RU9 A;  3PSP A;  4RUA A;  2XCA A;  5HMM A;  4M6W A;  1X9W A;  2FLN A;  4NV0 A;  2G09 A;  1ZJN A;  2KEY A;  1FFU A;  3RB6 A;  2H3Z A;  9ICQ A;  1ECW A;  4ACO A;  5A0L A;  1SGG A;  5ALK A;  3ORY A;  7ICL A;  2D8C A;  1NI3 A;  5J2C A;  2LI6 A;  1DGJ A;  4I29 A;  5J0Q A;  4TQS A;  3PW0 A;  4GIB A;  4BGD A;  4P0Q B;  4NXZ A;  1BPY A;  5KFZ A;  1ZXI A;  3PX0 A;  4XQ8 A;  2M0N A;  3B0Y A;  1LB2 B;  2KZ3 A;  1F44 A;  3LWL A;  8ICO A;  1XC9 A;  5AM1 A;  4F2S A;  1SKS A;  3OPX A;  3PSF A;  2G06 A;  5G5G A;  9ICS A;  3QEA Z;  4IL6 U;  8ICG A;  2VKQ A;  1PK3 A;  2WTF A;  5AM5 A;  4P4P A;  4QZI A;  5KFQ A;  3CNH A;  4EEN A;  3BQ0 A;  2XVT A;  5KT5 A;  1XSN A;  4J9Q A;  5DBC A;  4JMU A;  4F93 B;  1JMS A;  2DPI A;  4B9S A;  1B0X A;  1NJY A;  4DFP A;  4DQI A;  2GLE A;  4YCX A;  3TAP A;  1QQ6 A;  7ICP A;  3OHB A;  1RDF A;  4B9M A;  5AKK A;  3M6K A;  3T5K A;  2VA3 A;  4IQT A;  2KNJ A;  1U47 A;  4KLJ A;  3RTV A;  4DSF A;  1TK0 A;  2R8I A;  3ZDB A;  4RQ6 A;  3RJJ A;  4KLF A;  4Q8E A;  2ZJ8 A;  3H4D A;  2F2A B;  3SEN A;  4C7Z A;  1ZQD A;  1J2M A;  2H5X A;  2KHQ A;  2KVS A;  3TAQ A;  1DOQ A;  3QU5 A;  3SR6 A;  3M9M B;  4FBU A;  4EX6 A;  4CNQ A;  4ECT A;  1B22 A;  4LZG A;  4KLD A;  4MEX A;  4KTQ A;  4C8K A;  1SV0 A;  2DKZ A;  4RQ5 A;  3MGV A;  8ICB A;  4IQU A;  4KLI A;  4PPX A;  5ALX A;  4CE6 A;  4JK1 A;  1T8E A;  7ICE A;  2W55 A;  2BPF A;  1RG6 A;  5BPC A;  1U48 A;  3N7R C;  5IIN A;  3RJK A;  3HW8 A;  4YFK A;  2QAR A;  3UQ2 A;  3T79 A;  2A1A A;  5AI9 A;  4IC9 A;  2Y0S C;  5ALJ A;  3OJS A;  3SQI A;  5ALO A;  4I2A A;  3ISC A;  2PI4 A;  4M0A A;  1WUD A;  1XSP A;  2ZIW A;  1ZQW A;  1NK0 A;  1KRP A;  1SB3 C;  4DQQ A;  1A0P A;  1TFR A;  2XGQ A;  3PST A;  4YXM A;  5J8Y A;  3GIL A;  5DBB A;  5CJ7 A;  4GC7 A;  4ECZ A;  3SAH A;  2VJ5 A;  5ALU A;  1TAQ A;  5KL1 B;  3WK8 A;  8ICH A;  3WU2 U;  2AHO B;  3BQ2 A;  3GV8 B;  2HHU A;  5KT2 A;  2E8O A;  2WF5 A;  7ICH A;  1C7Y A;  3RJF A;  1ZQO A;  1ZET A;  3ZI4 A;  4YVZ A;  3MGI A;  2PMZ C;  3L4P A;  8ICZ A;  3IG5 A;  2JHD A;  3J81 j;  2NRT A;  2LYB A;  3LWM A;  2QB0 B;  2HHQ A;  4KN4 A;  4PGX A;  4F5Q A;  3PO4 A;  4R65 A;  1YT3 A;  3IM1 A;  5KT6 A;  5CP2 A;  3RBD A;  3G6Y A;  4F4Y A;  2EZX A;  2WF6 A;  3PVX A;  1L6N A;  4ED6 A;  7ICG A;  1S77 D;  1NK4 A;  3UQ0 A;  4DL3 A;  1LV5 A;  2P6R A;  5AM2 A;  3HPO A;  1ZQY A;  3MR6 A;  2W03 A;  5J0W A;  1JUD A;  2GO7 A;  5KTQ A;  2HHW A;  4GC6 A;  5J0U A;  4I2H A;  1FO4 A;  3RB4 A;  3NVZ A;  2Y9U A;  1ZQQ A;  3HP6 A;  2YMP A;  3FYH A;  2HSZ A;  1JI7 A;  5HR6 A;  2R8G A;  4PHA A;  3CYM A;  1RQN A;  1COK A;  1X40 A;  2WHE A;  3K4G A;  1L3U A;  1K1S A;  3QUC A;  3QU9 A;  4FZN A;  1X6I A;  1ZQU A;  5KFU A;  2Z7J A;  1N60 A;  4F92 B;  5AI6 A;  2LYA A;  2Q4T A;  3H8W A;  4YR2 A;  9ICP A;  4UB6 U;  1QTM A;  4F4Z A;  4UB4 A;  1KSP A;  2FE9 A;  2C2R A;  1Z00 A;  3GFK B;  3MGH A;  4DS5 A;  2B6G A;  9ICU A;  4ZH4 A;  2CXY A;  5HHH A;  4NLC A;  3DV9 A;  4GLX A;  2UVW A;  1UT8 A;  4MHV A;  5HML A;  4KLO A;  2R8K A;  3TFR A;  2XIC A;  4DEZ A;  2LKY A;  1ZD4 A;  1D8B A;  5EE0 A;  2EZY A;  2YMM A;  2HDO A;  5AM4 A;  3AN1 A;  7ICM A;  4EZ6 A;  2E1E A;  3RRG A;  1K5O A;  5AKX A;  4DOA A;  1L8O A;  1Z4O A;  2R8J A;  3KFU F;  1HUZ A;  2KE7 A;  2A19 A;  4UBB A;  1S9F A;  2L5Y A;  9ICG A;  1SWW A;  3AEV A;  4ECW A;  2K8B B;  3H4B A;  4JV1 A;  1BGX T;  2XGP A;  5CRX A;  3QEB Z;  9ICL A;  9ICB A;  1D9D A;  1X9X A;  2ODG A;  4KLQ A;  1XSL A;  4KLT A;  5CWR A;  4MF2 A;  5L1J A;  5K4L A;  1PK1 A;  5J2D A;  4RQ3 A;  4KN7 A;  2KKV A;  2P35 A;  4ED7 A;  3OSP A;  2C2D A;  1V9P A;  1ZQL A;  5KG3 A;  1Z4N A;  3HKZ F;  3V7L A;  3MDA A;  9ICA A;  3IN5 A;  3ZDA A;  2V9W A;  5DG8 A;  2F8K A;  2UVV A;  2A1J A;  3T5J A;  4P0P A;  2LMR A;  5AK4 A;  4B9V A;  4DSI A;  1X42 A;  4NL9 C;  5ALZ A;  4DL5 A;  1L3T A;  4O9M A;  3PZP A;  3ONN A;  2G08 A;  5KG4 A;  5KFP A;  2Y1I A;  2CRX A;  4M9N A;  5EWE A;  5F9L A;  3PX6 A;  4OD0 A;  3WKE A;  5AK5 A;  5IIM A;  4X5V A;  1ZRN A;  2NRV A;  5KG2 A;  3GV5 B;  2A3V A;  4RZR A;  1D9F A;  3ZDD A;  2XY7 A;  4HYK A;  2IHN A;  4ZOH C;  4EEK A;  2W7O A;  9ICM A;  2LHT A;  3C2M A;  3UM9 A;  5J2H A;  2ZUC A;  2RDI A;  8ICC A;  3FDS A;  3KKA C;  2W43 A;  3LDA A;  2W9B B;  4TUP A;  5KAI U;  4Z6D A;  2I1Q A;  1LKY A;  4F91 B;  4EBE A;  3D2S A;  3QYP A;  2ISO A;  5TIS U;  2KFZ A;  5IIJ A;  5T14 A;  2FLP A;  4QZG A;  4QZH A;  4UAW A;  4I2J A;  4F72 A;  2ZXI A;  3OJU A;  2AGQ A;  5ALD A;  5J0P A;  4J9N A;  4RNN A;  2QB1 A;  1XO1 A;  2W3S A;  1SL1 A;  3RJE A;  4DSK A;  4C8N A;  4XUS A;  2VJ4 A;  4IRK A;  4C8L A;  5EE3 A;  4BXO B;  3DEE A;  4ECU A;  2EQY A;  4AYB F;  2AGP A;  1T7P A;  1TE2 A;  2MUT A;  8ICF A;  1ZD2 P;  1JN3 A;  1S0V A;  1ZYQ A;  5D46 A;  1DK2 A;  3WK4 A;  4J9O A;  5DGA A;  2EAM A;  4YG2 A;  3R9K A;  3BS5 A;  1V85 A;  1S5L U;  3SMV A;  1TK5 A;  5AK3 A;  1Z3E B;  3V7J A;  5J2J A;  1SL2 A;  1O08 A;  5KFF A;  5AI8 A;  4DO9 A;  5AI0 A;  2YMQ A;  3M7D A;  3SI8 A;  8ICE A;  2JEJ A;  1AQ6 A;  2F1I A;  2KJ8 A;  1KFD A;  5AKY A;  5EOZ A;  1A6S A;  1J97 A;  3C28 A;  4QJF B;  3UXN A;  3PV8 A;  4LJX A;  2XCP A;  5KFY A;  4DF4 A;  4DFJ A;  4IRC A;  4F71 A;  4QNL A;  4IR9 A;  4I2B A;  2Y9T A;  2JRZ A;  3UMC A;  5BOM A;  2JH1 A;  2KSO B;  3EW9 A;  3E58 A;  4UB5 A;  2FI1 A;  2OXO A;  3SAF A;  7ICI A;  2H3F A;  2W7P A;  3K75 D;  4EEY A;  3UXO A;  4RQ7 A;  2HCF A;  2BGW A;  5KFR A;  9ICE A;  4UBC A;  4UB3 A;  4NLZ A;  1DRG A;  8ICT A;  1SV0 C;  4KLL A;  3PMN A;  1SIJ A;  2JEI A;  5ALH A;  4J9P A;  4FFD A;  2HVH A;  4R63 A;  2JH7 A;  3M1Y A;  5KG1 A;  4O3M A;  4Y2V A;  2JEF A;  5KFV A;  5ALM A;  1ZQS A;  2YB4 A;  3C2L A;  4BWM A;  4G3I A;  4EYI B;  2KFN A;  5J2A A;  4ECV A;  5G5H A;  5ALW A;  5D49 A;  4IS7 A;  4UAU A;  2UVR A;  3H40 A;  3HKZ C;  4PZN A;  5ALQ A;  5KFM A;  3Q8R B;  4O3R A;  3H0R B;  3SAG A;  3I1Y A;  4B9T A;  5J8Y C;  4U7C A;  3V6H A;  1KBU A;  4OJP A;  5EE9 A;  5KFJ A;  1CUK A;  5DQH A;  4TUQ A;  4LVS A;  1RXV A;  3AM9 A;  3D2Q A;  1WCL A;  2KP7 A;  1JX4 A;  2AU0 A;  1Y88 A;  9ICV A;  3PW5 A;  2FMP A;  4Q8F A;  3MC1 A;  2FDR A;  1BPE A;  1UA0 A;  5KT7 A;  5F9N A;  5L1K A;  7ICO A;  4CF3 A;  2NYV A;  4NM2 A;  2ZTC A;  4GXI A;  5B5E U;  4PGY A;  2O6K A;  1XS9 D;  2LBO A;  3BZC A;  5TZV A;  1H38 A;  9ICN A;  4RPZ A;  4PHE A;  5JU5 A;  1ZQH A;  3QE9 Y;  1NJX A;  3E0F A;  1QQ5 A;  2JR5 A;  1NK9 A;  1WWV A;  4OJ6 A;  2YTU A;  3GDX A;  1MSW D;  3EWA A;  4DCC A;  1F0M A;  1Z1B A;  2C28 A;  4Q45 A;  3L3F X;  5AM0 A;  1SXD A;  3ZDE A;  2OHF A;  4ECX A;  1XNS A;  8ICY A;  4J9L A;  4I2G A;  4DL4 A;  1ZQE A;  3DDH A;  4ELU A;  3UXP A;  4G9B A;  4AYB C;  3VC8 A;  3LK9 A;  1DK3 A;  3NRW A;  2HMX A;  4Q44 A;  5L1L A;  5KG0 A;  4F4X A;  1VDV A;  5III A;  2ZIU B;  3BQ7 A;  3V6K A;  1JXE A;  5KFK A;  1ZQA A;  2KVC A;  3H8M A;  5J0Y A;  2RHF A;  5ALT A;  7ICF A;  5KFL A;  5FP0 A;  5KFA A;  2CN1 A;  2AQ0 A;  3WKA A;  1BPD A;  2ES6 A;  2BHN A;  7ICV A;  2NRX A;  3IV6 A;  1ZRM A;  5J2B A;  4IRD A;  2HHX A;  1IV8 A;  1FEZ A;  1ZOL A;  4KMU A;  2XC9 A;  4O3P A;  4RQ4 A;  5DBA A;  3SZ2 A;  4YN4 A; 
#chains in the Genus database with same CATH homology
 2HBJ A;  2ZXH A;  1YT3 A;  2OYY A;  1NZB A;  2LBO A;  3M6Z A;  2ZIW B;  3IG8 A;  2E1E A;  2HOQ A;  4FE3 A;  2XI9 A;  2YB1 A;  3F2C A;  2GH1 A;  2JH1 A;  3GU3 A;  3LYS A;  3F5A A;  2KHQ A;  1HIW A;  3LVV A;  2VIX A;  2JMG A;  4C0Z A;  1PVQ A;  4P0P B;  3D2S A;  3E0F A;  2OXO A;  1URJ A;  2KOB A;  3SAF A;  2KV2 A;  5T14 A;  1OUQ A;  2H3F A;  2W7P A;  2KKP A;  1SZH A;  1L6N A;  2K8C B;  2KHV A;  4U6P A;  4ICA A;  3D2N A;  2HBK A;  2MRL A;  4CRX A;  3KFU F;  4OJ6 A;  2JGA A;  2ZIU A;  2ZXI A;  3C29 A;  4OJ5 A;  2DQN B;  1Z1B A;  2G5H B;  3PSP A;  2G5I B;  4P0Q A;  2KD1 A;  3MGV A;  3L3F X;  3AQE A;  1IIP A;  1MA7 A;  2F8L A;  1Z19 A;  2G0A A;  2W03 A;  3N7S C;  1DRG A;  2K8B B;  4OO1 J;  4NV0 A;  2G09 A;  2KEY A;  4P0P A;  2H3Z A;  5CRX A;  2XID A;  2E5S A;  1XNS A;  1ECW A;  4ACO A;  5A0L A;  2MA1 A;  3IP4 B;  2VJ4 A;  4CGZ A;  2CPR A;  2H3V A;  3N7R C;  2JH7 A;  2ZIV B;  2WAQ F;  2H3Q A;  5HR6 A;  2KJ5 A;  2N1R A;  4O3M A;  1P7D A;  3T79 A;  3KZX A;  4OJL A;  3H0L B;  3RFA A;  3DEE A;  4AYB F;  2K8A A;  2Y0S F;  1T94 A;  2YB4 A;  1TAM A;  3CYM A;  3N7P D;  1UPH A;  4P0Q B;  2KIW A;  3F53 A;  4IC9 A;  3F2D A;  4AYB C;  2KKV A;  3F5E A;  3VC8 A;  2OM6 A;  2Y0S C;  4CDG A;  2RP5 A;  3SQI A;  3AL0 B;  4GFJ A;  3CRX A;  2RRD A;  2F77 X;  2ZIX A;  1Q3U A;  2M0N A;  3HKZ F;  3AQF A;  3NUQ A;  4NWI A;  1WUD A;  2BDU A;  3IN5 A;  2ZIW A;  1F44 A;  4FZN A;  3HKZ C;  4PL1 A;  3LVW A;  2W04 A;  2GOL A;  3NRW A;  2HBM A;  5KL8 B;  3VCB A;  2Z7J A;  4BJQ A;  2KJ9 A;  1A0P A;  2HMX A;  2ZG6 A;  3H0R B;  3OPX A;  3PSF A;  1PVP A;  2K4I A;  3PST A;  2HOI A;  2G06 A;  4BX9 C;  3SAG A;  3GZF A;  2LYA A;  3SMV A;  1GO3 F;  2Q4T A;  2VKQ A;  4KMO B;  2ZIU B;  3ICX A;  4KX3 A;  2OH2 A;  2WAQ C;  4U7C A;  1Q3V A;  1KBU A;  2R18 A;  4OJP A;  3ONN A;  2DGZ A;  2G08 A;  2KVC A;  3PZP A;  3K1Z A;  2CRX A;  3ALR A;  2ZIX B;  2XVT A;  3SAH A;  2DF4 B;  2F76 X;  2VJ5 A;  5C0Y A;  3D2Q A;  3O0F A;  2RHF A;  5KL1 B;  2K4E A;  4FZL A;  1CRX A;  4JMU A;  2E1F A;  2CN1 A;  2KIC A;  2A3V A;  2G07 A;  3RF9 A;  3M7D A;  2WB1 F;  2KJ8 A;  4NLC A;  4QIW F;  1A6S A;  2WB1 C;  3CP8 A;  2W7O A;  4FZM A;  4NLB A;  2PMZ F;  2LHT A;  4KX5 A;  4QJF B;  2YX8 A;  2ZIV A;  3C28 A;  4QIW C;  3M6K A;  4OJO A;  3F2B A;  1ZQ1 C;  3PSI A;  2PMZ C;  3IG5 A;  2JHD A;  1HEK A;  2KNJ A;  2XIC A;  2HOF A;  4WJ3 B;  5HR7 A;  1ED1 A;  2NV3 A;  4QNL A;  2LKY A;  2LYB A;  4PL2 A;  2H3I A;  1PVR A;  4BUG A;  1D8B A;  2K4H A;  1XO0 A;  2HBL A;  4A8E A;  2F2A B;  2K89 A;  2D6F C;  3H0M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...