2WFAA

Structure of beta-phosphoglucomutase inhibited with beryllium trifluoride, in an open conformation.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
molecule tags Isomerase
source organism Lactococcus lactis
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wfaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wfaA01
1YV9A 1IWOA 2IOFA 4RETA 4FE3A 1YJ5A 3SKXA 1Z4NA 3U13A 3NIWA 4Y2JA 5ALRA 2I54A 5JJBA 4HGQA 3OCYA 4GIBA 2W11A 3IJ5A 2I55A 3L0CA 1NRWA 1TJ4A 3N28A 5AI5A 5ALQA 1ZOLA 4O8CA 1JUDA 5AK5A 2RAVA 3DDHA 1ZS9A 2G09A 2B1RA 3L8HA 2B0CA 1Z88A 1J8DA 4UM5A 5AKEA 1Y8AA 4UARA 2PQ0A 3AR4A 2YFYA 1U02A 2YMPA 5AI8A 2FEAA 2G08A 5AVXA 4EX6A 1YS9A 1WPGA 5AVQA 4C4TA 3WK4A 3ZVNA 1FEZA 3OCXA 5ALLA 4EEKA 2JAOA 3B9RA 4Y2PA 1VJRA 2MU1A 4DW8A 2B1QA 4Y2SA 3BWVA 2C4NA 1RMYA 3MPOA 3F9RA 2JARA 1Z5UA 4KNVA 1RPZA 3WKEA 3L8GA 3EWIA 3L1VA 3ZTWA 4FYPA 1WZCA 3DAOA 2YN4A 4BNDB 3QUCA 4UU0A 4L6CA 4OD0A 3QU4A 1SWWA 3QUTA 2Q4RA 1XVIA 2YMLA 3QXGA 2P9JA 3QU2A 3ZVMA 1Z4QA 4BX0A 2HF2A 3KOOA 2AGVA 3KDPA 1ZRNA 1L7PA 2IYEA 4PNHA 1CR6A 5AM1A 3U7HB 4NWIA 2GHQA 5ALPA 5AIBA 3K1ZA 4AP9A 1QQ6A 2WFAA 3I6BA 3MN1A 2PR7A 2IOHA 2BDUA 3N5KA 5AICA 3FGOA 5AKZA 3WK5A 3A1EA 4KYTA 3AR7A 5AKLA 4QQFA 3ZI4A 4UASA 4FFDA 2RARA 2OA0A 4UMDA 2QLTA 4HGRA 4AS3A 3CNHA 2WF5A 5AM4A 5AVSA 3L0YA 2I34A 4Y2QA 2HX1A 4BBJA 1SU4A 3S6JA 3WK8A 1T5TA 4OFZA 2ZBFA 2HSZA 3QU9A 4QJBA 1Z4LA 1U2SA 1RDFA 3AR6A 2BY4A 1EK2A 2FPUA 4IFTA 3HLTA 1Q92A 5ALHA 1F5SA 2HEGA 2YBDA 4YCLA 1LTQA 3UMCA 4Y2XA 5AW8A 2ZBDA 2GFHA 4BX2A 5AW1A 5AKYA 3KBBA 4E88A 2C9MA 2OYCA 4Y2UA 1NF2A 2ZBEA 1TJ5A 3ZX5A 3MC1A 1SWVA 5AKJA 1L7NA 2CFRA 3AR8A 2R8XA 3ZU6A 3UMBA 3KD3A 2WF6A 1RMQA 3ZUPA 3I28A 3ZTYA 2FI1A 4UMVA 5ALUA 4L57A 2WF7A 2GHTA 3ESRA 4UAVA 3MMZA 2IA5A 3OCWA 1RRCA 5ALMA 4BEWA 1O03A 4CF5A 4DWOA 5ALKA 4L6AA 1QQ5A 4J03A 5ALIA 4KN8A 5AVUA 2YJ3A 3QUQA 2ZG6A 5FP0A 3E58A 3AR9A 3TLMA 4BKMA 1N9KA 1VFPA 1S2OA 3N8GA 4Y2TA 2HHLA 1T9ZA 2HI0A 4YIHA 4EZEA 3FM9A 4UM7A 2ODAA 4CF4A 4G63A 5AK4A 1EK1A 3OTQA 2HO4A 1L7MA 4XE5A 5AI0A 2P69A 1ZD4A 1XPJA 3ESQA 3N07A 2FPWA 4HAIA 1Q91A 4EELA 2RB5A 1ZRMA 5AW5A 5AKXA 3OCUA 3RFUA 5AIAA 4BEVA 3WGUA 3W5DA 5AKKA 5ALEA 2PKEA 5ALTA 3RF6A 5E0OA 3QGMA 4MUMA 1KYTA 2NYVA 2CN1A 2WF8A 4NFLA 2B82A 3IRUA 2HDOA 4XOUA 4HGOA 2AUTA 3W5AA 1VJ5A 5AVYA 3WK6A 2MU2A 5AVWA 2GO7A 5IS2A 5AVTA 4Y2RA 3U7GA 4I9GA 3A1DA 2O9JA 2EATA 3ED5A 2G06A 2I33A 2B30A 3NRJA 1CQZA 4YCMA 4BX3A 4YCNA 1TJ3A 2YMQA 2FPXA 1WR8A 3AR2A 2RBKA 3NASA 2B8JA 2YY6A 5ALVA 3I76A 1Z4PX 3PGVA 3DV9A 2HF7A 1Z4MA 3HYCA 3L1UA 4EENA 3EF0A 2AH5A 3ZW7A 1L6RA 2CFSA 3R4CA 3QNMA 1Z5GA 4OHFA 4BYGA 2C8LA 1RQNA 2FPSA 2FUCA 1Z4OA 5ALGA 3QX7A 4MWOA 3SKYA 2CFTA 3N1UA 5AW7A 1L8OA 4BNDA 4UATA 3AR3A 3EF1A 2R8YA 3L7YA 1RLTA 4J2TA 3WGVA 5AKIA 2OM6A 1QYIA 1U7OA 3R9KA 1RLOA 4EX7A 4UW9A 3ET5A 5AVRA 2WF9A 5A3QA 1LVHA 1MH9A 5ALZA 2MSNA 5AK6A 5ALWA 2P11A 3ET4A 4HGNA 3SF0A 3QUBA 3OCZA 3UM9A 3P96A 3FVVA 3NAMA 4YIKA 5ALXA 2QYHA 3NANA 5AW4A 2GMWA 5AW2A 4CE6A 4F72A 3WKBA 4JDPA 3IB6A 2DQSA 3WKAA 3CZ4A 3SHQA 4UMFA 4Y2YA 4NABA 1J97A 1L8LA 1XP5A 1YDFA 1N8NA 3B9BA 5AM2A 1S8OA 2JAUA 4F71A 1TA0A 3ZVLA 4CNQA 3QU7A 5AI6A 2Q4TA 4YH1A 3FZQA 1U2TA 5AVVA 2FDRA 2R8ZA 3QU5A 4I9FA 5ALDA 2IOFK 3ZWDA 3U7FB 4KX3A 1ZD5A 3OCVA 5AW3A 3GYGA 5AW6A 1QH9A 4C4SA 1WVIA 3M9LA 1ZD3A 3A1CA 2YJ4A 2AMYA 3AR5A 4UAUA 3NALA 3L0BA 1YNSA 2O2XA 3M1YA 2WM8A 1ZJJA 3W5CA 5AW0A 1T5SA 5AVZA 5AKHA 4B6JA 1RC8A 3I1YA 4DCCA 2G80A 3DNPA 5AHXA 5AM0A 5AK3A 5AKGA 2EAUA 5A3RA 1RKUA 4NAVA 5ALJA 3KC2A 1ZD2P 1QQ7A 3FPSA 2D2VA 2YJ5A 4UU1A 2X4DA 2G07A 5ALFA 2NO4A 1K1EA 5IT4A 3EPRA 3SLRA 4XQ0A 2YJ6A 5AI4A 3E8MA 3U26A 5T41A 5IT0A 3OPXA 1YMQA 4UMEA 1Z4IA 2JGAA 1TE2A 5ALNA 4Y3UA 3J7TA 3WKCA 1Z4KA 2B8EA 2Q5EA 2G1AA 2VKQA 3UMGA 2BDEA 2P27A 3U19A 1RMTA 2NO5A 3ZX4A 3VAYA 1RKQA 3L8EA 3WK7A 3BA6A 1Z4JA 3PGLA 3FPBA 3NUQA 1U7PA 3QLEA 2R8EA 1L7OA 4G9BA 2EARA 2ZBGA 4OCZA 2C8KA 3L8FA 5AM3A 3WK9A 2I7DA 4HGPA 1PW5A 2FPRA 2OBBA 5AW9A 3KZXA 3R09A 2WHEA 4ZEVA 3D6JA 1AQ6A 4KX5A 3SD7A 2HOQA 4KNWA 4HYTA 5ALOA 1X42A 1RQLA 2G0AA 4ZEWA 3W5BA 3B8EA 3ONNA 4IG4A 1RLMA 4AS2A 4JB3A 5ALYA 3E84A 3QYPA 3E81A 3PCTA 3A3YA 4RESA 5AESA 4CF3A 3SMVA 1O08A 4DFDA 2C88A 4XPZA 4ZEXA 2ZXEA 4Y2VA 3L5KA 4NV0A 2W4MA 4C4RA 2W43A 4GXTA 1NNLA 2JAWA 2ZOSA 2FUEA 3U7EB 4H1WA 5A3SA 3PDWA 4YGYA 5AI9A 3WKDA 1RKVA 3ZWKA 5AM5A 2HCFA 2I6XA 2YMMA 5ALSA
chains in the Genus database with same CATH superfamily
3D31A 5IVKA 3H9BA 1HDYA 3EH1A 1XDWA 3M1LA 4GP9A 4W82A 1T5OA 3C1AA 4ZAVA 2YC4C 3G13A 5A9SB 3AL0C 3IDSA 1R0ZA 3RIGA 5IINA 3GEEA 5FOUA 4AIRA 1ZN9A 3MAAC 1ADFA 4CM3A 5IAOA 1IBKB 2PUAA 4M88A 2X5JO 3MGGA 2Y1GA 3AZPA 4ALMA 1N2HA 3DE2X 2AG1A 2X0RA 4JL6A 3FYUB 4Z2YA 3WJ1A 4MQ4A 4MVJA 4RWEA 2O3RA 3SZMA 1GRCA 1TJ4A 2R7MA 4X97A 1U9LA 1WZ2A 3E1SA 4FQ7A 2WVHA 1U0LA 4JLBA 4JI3B 2CMFA 4WL0A 3RSLA 1XTUA 3HB9A 1SXQA 2OEHA 2VTEA 4RQ7A 3WZMA 1KS2A 2BF7A 2PSFA 2OSBA 3OF3A 5JARA 4I5DA 1K5PA 4GPTA 2EG5A 4S04A 4F6LA 5DHQA 3T3GA 1I1HA 1PFGA 1RLJA 2PQ0A 1QH8B 2C9CA 3HMQA 3T5CA 4A0FA 1I5EA 3TJMA 4DLTA 2IPLA 2Q46A 4RMJA 4XVQA 4EITA 4BLOA 1U45A 1OLSA 4PS0A 2EFJA 5K0EA 4QZIA 1YS9A 3ZWMA 2YFHA 1KXJA 2JHCA 1HQCA 2OR3A 3DBVO 4UB5A 3F98A 3HSYA 1GPH1 3GV7B 4MYDA 3UQYS 4BRUA 4D79A 4RTPA 2R86A 1OHHD 2BCQA 4FX2A 4RLQA 4MEXA 4ZANA 4BKUA 2FDCA 4FFBB 3FH0A 2B6NA 5KFTA 1DK3A 3MFIA 1D8YA 3NAGA 5E6UA 1OPRA 2FSHA 4P4SA 2W3RA 1C3VA 2FVXA 4WINA 1TK2A 1ECPA 2AR9A 2V7QA 4O2BB 1C7YA 5REQA 2AZMA 3GUVA 3D7SA 2CLOB 3KWLA 4LBWA 1M2EA 3OHBA 1OD6A 7AT1A 1Z56C 2O0LA 3F6CA 3H18A 1KYXA 1HE4A 1X80B 4MEYA 2WDPA 3ILYA 9ICUA 1TM1E 3L1VA 3NDRA 4FFBA 5A6SB 2X0FA 4YXFA 5LDDC 1FFEA 4XQ8A 2F8LA 3BIXA 1MRSA 4MULA 4C7JA 4YIHA 1A88A 3W3AD 1FP6A 4H4DA 1PWXA 1YZGA 3DP9A 1EB9A 4UU0A 4NNPA 5A4DA 3SAGA 1IZZA 1E20A 4UDXX 1SQ6A 1GKIA 2A5YB 4DYVA 5FXMA 3TDMA 3WXMA 3QU2A 1KTVA 4R3NA 4DIBA 6Q21A 4JJGA 4WFQA 7YASA 5HRAA 4XFKA 4KREA 4DOCA 4RDXA 3VI3B 2O8EA 4JB0A 3LHFA 2JGEA 2XQKA 1XA0A 5CLGA 4IZHA 4C05A 4LDNA 2FEXA 2D74A 4YAOA 1D6NA 3V42A 4RPLA 3HB5X 4IDPA 2BMDA 2D5AA 5ALPA 1PR3A 1QP8A 2EFYA 5F2EA 5IAGA 5CYOA 1TYCA 3CLUD 2BM9A 2EFCB 1K75A 3L4BA 1K68A 4DV3B 1DBSA 1GFSA 1JXAA 1OXKB 2IQIA 4DA8A 4KHZA 2BR5A 5K3FA 3DV0A 3GDFA 3GRZA 2KVSA 3T5GA 2XJ4A 1I4WA 4ADSG 3N5KA 5D6OA 4O9MA 4J9UE 1PR5A 1QZZA 3VNSA 1GQOA 1NX9A 1JNXX 1Z37A 3H1TA 1K7SN 4V0OA 1RWOA 3VSBA 1KNXA 4JVLA 3AVOA 3DVAB 5FNVA 4ED1A 4EFMA 1ENOA 1W75A 1G20B 1FSFA 4B3RB 1QNLA 2C58A 1M1YA 1GCUA 1YSCA 3GOQA 1Q1AA 3IELA 1GKLA 4X7PA 2HPAA 3KQMA 3IV7A 1WS6A 1SV0A 5ICMA 3E22A 3ZLVA 5EZYF 3EG5A 3L7OA 4CHGA 1Z4LA 2CHGA 3BH6A 3RBZA 2PGDA 1EK2A 1L5ZA 3AXTA 4BLPA 3PDCA 2AQ0A 3BFXA 3IVMA 4OP1A 4G0QA 4MQLA 1EAMA 4M83A 4UXHA 4GLOA 4MF2A 4WACA 3RYFA 3T5DA 1HLFA 4C0KA 1AF4A 1U3CA 2RGBA 3WGZA 1NXWA 3D02A 1QM5A 3NHUA 4PU0A 4YCLA 3EOAI 4PLGA 2O8FA 3FBGA 5B6IA 2FP4A 3RRHA 2PSSA 2YW2A 3GLHA 4J91A 5AR1A 3O8RA 1XDUA 3GX1A 5AKYA 4LNUA 4N8EA 2P91A 1UBOS 2R4QA 2BR0A 5LXTF 4L8YA 1NBWB 2OO7A 1PKEA 4ETIA 1LV7A 4JS0A 3TZLA 4M47A 1FRFS 1Q7BA 4CN9A 4PGXA 6GPBA 1B73A 3DUWA 1B6TA 4KBFA 3AR8A 3UMBA 9ICIA 3L6EA 3KD3A 4EVSA 3AB8A 1XX6A 2E3TA 4F5RA 4XPIA 3BK1A 3KTDA 2OGUA 2QUIA 3JQPA 1R4ZA 4O3MA 1I3MA 1PEDA 1U1CA 3W78A 3V72A 1IHOA 1TVKB 4RM3A 1P0PA 1ZM4A 1IYZA 2VRWA 2UVQA 2ZYVX 4J6EA 1KQGA 1AKYA 4GX0A 3W6ZA 3B3JA 4W9MC 2Q4DA 3KOMA 4HDRA 1V26A 2CF6A 1EP2B 1A50B 3A4VA 5IJXA 8ICJA 4X3PA 4W5TA 4UJ3A 4B45A 3C8UA 3M33A 3NBXX 3QVVA 1IN8A 1KHHA 4AKGA 4NBUA 1E32A 5EP1A 2AX4A 3OP1A 1P1HA 1HIWA 3GUYA 3M8SA 3OA0A 4BKMA 3Q8WA 3GQBB 1SXGA 4FHZA 4NG5A 1JKXA 4QYTA 3ZJYA 5CVDA 2ATXA 4MKHA 4AY5A 2JCXA 2VJMA 1BH2A 1TU0A 2HZ7A 3NNNA 3LK9A 2VAMA 5FEUA 4JKIA 3UENA 2FLVA 1IHYA 4H7PA 3TEJA 1SUDA 3D2BA 3SS7X 3X1YA 2LDBA 3TTSA 5J2KA 1UEJA 1YR2A 4G4GA 2H3ZA 3G9UA 4H4EA 4XFDA 1VPWA 1ISRA 1UEXC 3CEJA 4O8ZA 3QMVA 3B3FA 5FV4A 3DA8A 4MHSA 3LTEA 2HADA 2WSMA 4G86A 5K3OA 3N07A 2HJSA 3TYXA 3IPLA 4LJLA 2OL4A 4BUZA 4DLWA 4L3WA 3BXFA 2YB1A 1NZDA 1XKQA 1ZSVA 2JW5A 4M1SA 3N74A 1Y82A 2WYUA 5F52A 1AMOA 1QIKA 2VA9A 1KI8A 4RPYA 2CXRA 3H5NA 3ON5A 1EGMB 3G7SA 4RIHA 5DNYB 5B55A 2QTFA 1LKYA 1NY5A 2VYNA 2NSHA 3MLBA 1WHSA 2F1IA 3AHGA 3MWLA 1GNPA 4LJ9A 1S9HA 2YL2A 5H68A 3RYCA 5ECDA 1F7VA 3RFVA 1OUQA 5BNZA 2VRCA 4TGLA 4ZA2A 3IRUA 1IG3A 2R4UA 4FFOA 4LISA 1JBKA 4TWZA 2CW5A 1Z62A 2FWJA 5HF6A 1O6GA 2LDXA 3M4ZA 4GXJA 4IJ6A 5CVCA 4ZI7A 3I9V1 3GMSA 1UBCA 4R51A 5JNRA 4PHPA 1ZEJA 4ZOAA 5HPYB 5B6JA 2Q5JA 3AO0B 3AJEA 2CMKA 1VP9A 2MSLA 2YRWA 3A0BU 3G7UA 3GK3A 4Q44A 3BORA 5G3ZA 1M8JA 3RYIA 4RZ2A 3UTDA 3ZZNA 1KZ7B 1UJCA 1J23A 2QRMA 3G7NA 3ZWBA 3CUEF 4BQRA 2YKGA 4UNPA 4NL9A 1PTJA 4U9HS 4MFFA 1U98A 1J21A 2ZE8A 4IH1A 4OHXA 4WE3A 4X91A 4N65A 4KLMA 4A8PA 2FPXA 3TLGB 4DJTA 3V6JA 2PH3A 5IH7A 1GUFA 3L6OO 5KX5B 3GLFA 1V4VA 3NXSA 4OI1A 3SQIA 4J0IA 4BEJA 4RULA 2FETA 4OJTA 3ZYCA 3BHNA 4C7KA 7MDHA 1TXGA 4CT4B 3MFHA 1C7JA 1T10A 3E48A 1D0VA 1A6SA 1EHCA 2D1QA 3L1UA 4YXMA 2E48A 2ZPTX 3L46A 3NC1C 3P4XA 4JLJA 2EKQA 4LZZA 4FOPA 3TLGA 8ICPA 4WKPA 1OHHA 1CYEA 4Y67A 5K4LA 2FFRA 8ICZA 4OA8A 1CZOA 3MB5A 1NV8A 4L4UA 3Q41A 4NZZA 5KG4A 4QPPA 3VPXA 3U1BA 2PUFA 2MSWA 1W1UA 4O5OA 1R5JA 3DEZA 3TSAA 3RB3A 2OPBA 4WOJA 3EISA 1IJFA 1GXSA 3I1IA 2IL1A 3I3SR 3WIBA 5H8WA 5KSPA 4XGNA 5AW7A 1YBMA 1T8SA 4WK2B 5E7IA 3VTZA 4P0QB 2ZXHA 3LF2A 3EF1A 1YZUA 3O8QB 1SKYB 4L8LA 2AOUA 4AQDA 4YBZA 2OM6A 1S5PA 3B12A 4YRCA 3UJAA 2QARB 1GV1A 4F3YA 4JOBA 3UMMA 5CHEA 4CMGA 4YRAA 2NU6B 5JR3A 3F2VA 3QKUA 3VKFA 9ICNA 2ZBVA 2COKA 2OFOA 3OO1A 4HDNA 2PO7A 1BAPA 4X7RA 2P7HA 5G41A 3W5UA 4F3NA 2XGSA 3PXGA 1DTWB 4ZQIA 3RABA 1G55A 3LC2O 3I9V6 4BMOB 1Q7EA 3HJEA 2PH7A 2MSNA 3CW8X 5CHYA 3G8AA 5EKUA 4G0YA 4M9QA 3AOGA 1R4AA 1W30A 3DKVA 3EBPA 3GH3A 4LVNA 3U0VA 4RTMA 1LPOA 1F06A 1RT9A 4CL8A 3VVLA 3WLJA 4YXJA 1PG5A 4V24A 4YR7A 1MUUA 5EZSA 3RTEA 3P96A 2WEKA 1KJZA 4RF2A 3EJ6A 5TF4A 4JI4B 5JATA 3THXA 1FFDA 2E6UX 4EG0A 3WKBA 3UFXA 5JEEA 3JALB 5FBKA 4FEEA 4YDHB 2DQSA 4NU8X 2CDAA 1ZQEA 1C3OA 4WXHA 2ADOA 2VJMB 3J81k 4G5YA 5HCNA 1H8EA 2OZVA 2R44A 1C3LA 1WKVA 3I5UA 3U56A 3ZH9B 5CX4A 1WB9A 3LCCA 3WV5A 1TA0A 2AOTA 2CCKA 3HUDA 3H5OA 3R7WB 1IEVA 1WSAA 2CL0X 1H85A 3GBSA 5B2ZA 4IR7A 3WGGA 2Q4TA 5G4KA 1EHIA 2OVFA 4G8BA 1Z07A 2FQQA 1WZNA 2IHZA 2Q8QA 1XKXA 1DDIA 4NLGA 3PFBA 5TXGA 3QU5A 2L17A 1GWNA 3C7DB 4JLMA 4E07A 4AZTA 4QYSA 3ONEA 5IDXA 3OQJA 2WU4A 2DUWA 3HB7A 4HDRB 4TYQA 5EJ4A 4B2LA 3R40A 3DJFA 3ISBA 3EGEA 3HJTA 5AW6A 2D2EA 3GYGA 3UYLA 5CITA 3DMGA 1NU6A 4ZCPA 3DHWC 1M75A 5B3LA 3DXFA 4QFDA 4WJKB 2SHKA 2CFCA 4CWAA 2E4ZA 3NLLA 1WDLA 3AM5A 1XMXA 3C3EA 1C0IA 4UAUA 1FP4B 3H5AA 2W55A 1X1BA 2ZJ6A 3DFMA 3Q9SA 2JFZA 3LYAA 4LJ7A 3BXGA 4RD3A 3WLRA 4AJNA 3BS5A 4DSJA 1D6SA 1KFJB 1G3IA 3PWSA 4HQFA 1X7XB 5IAJA 2P79A 4P6VF 721PA 3KVNA 3FR8A 3N0WA 4G1BA 1TAQA 3M2PA 1AKTA 1T5SA 4F4ZA 3ASVA 1VCNA 3OD1A 3BWMA 4EGCB 3OQIB 2JGKA 2VUUA 3KEMA 1CZLA 5AUOB 5HHTA 2G80A 3PJRA 2KE5A 3F1KA 2WZCA 5KWVA 1QTQA 2WJZB 3TSWA 3E7FA 1OW5A 3G82C 1TK5A 1XU9A 1W4LA 1UK6A 2HMSA 2M1XA 8ADHA 3KC2A 2Y71A 4PAOA 2JH3A 2D2VA 3CVVA 4BC1A 2X14A 1UKAA 4BE9A 3CF6R 2PGAA 4B6PA 1AZSC 1T5HX 2D1TA 4PN3A 3GFOA 5THQA 3NYWA 5AOBA 5KI6A 5IWAB 2ZVJA 1JWLA 7ICQA 3U16A 4DR7B 2DZDA 2I71A 1PSZA 2JGAA 4DMCA 1QKKA 2CXYA 4IRUB 4OXYA 2SBTA 4RYLA 1PT6A 4ZQHA 4O2LA 3ZGYA 3GLHE 1YT5A 1U5BA 1N9ZA 1PD1A 3I83A 3M6KA 4RNMA 1YRAA 2XUFA 2H1SA 3KV3O 3VPBA 3QFHA 3RRJA 1T6YA 2WJHA 3SOZA 5DE3A 3T7CA 3PHIA 2HXYA 2FGJA 3MTIA 5JD3A 2X19A 4PO8A 1GNQA 1XO0A 1THGA 4QE3A 4URVR 4MYTA 2VBCA 4HRXA 5LQDA 3GLIA 1NR7A 9ICWA 3RFFA 1FBNA 3FYUA 1QGOA 2Y66A 3FUCA 1T2AA 4RW0A 4LGYA 5C46F 5JJIA 2XXAA 5EVJA 2XMGA 1PHRA 3JQAB 4Z6DA 1WCXA 3NBQA 5DYNA 1D0IA 1IVSA 2ZBGA 3AGQA 4RKQA 7REQB 1U7HA 2V6IA 4BJ1A 1GFIA 2C8KA 4MWZA 4PIMA 4D3FA 4Q4DA 2Z0MA 2O3TA 2CNDA 3PQ4A 3WK9A 1NPYA 4KR7A 3WSTA 3QUAA 3LI2A 2A88A 3TTVA 5IVPA 1YL5A 1ZIYA 3JYHA 2VHZA 3R09A 5CTJA 5JMOA 4LXXA 4XM2A 3D6JA 4AICA 4ZICA 2IBMA 3FSJX 1HFWA 2QIPA 3MVEA 4XYLA 3D2AA 3ZXSA 1K5OA 3FA2A 4GDFA 2YJTD 2KYRA 3BEDA 2V7BA 3EDYA 1A4UA 4IMPA 1QO7A 2CK3A 2Z43A 4EYIB 2P9FA 3U3JA 4F8EA 4FLEA 3EWAA 4RESA 4GI1A 3WYCA 4YRNA 3OG9A 3WIOA 2YHIA 1LA2A 1CRWG 1GA6A 3CW2A 2G70A 4JOSA 5A06A 4Q3NA 2X6QA 5LQCA 1R8JA 3DEEA 4QWBA 4X8OA 4OX9B 2LYBA 2XI9A 1XMOB 3LA6A 3L5KA 1MV8A 3LP8A 1I9CA 3JYQA 1A9RA 1RM0A 3WQRA 4QARA 4P7JA 1NI4B 5I4KA 1T1RA 4NCNA 2W43A 2HSDA 4TMFA 3HYTA 3UH1A 4CM8B 5BWMA 1EX7A 1E2PA 1BA3A 1CIVA 1NDUA 4GUAA 4M0AA 4BNWA 2P8JA 2OB1A 1WLSA 5TQ0A 2B21A 1IAVA 3THRA 4YVFA 3SEZA 3BTUA 4V0ME 5I48A 2C0CA 4KXNA 3FLBA 1OFIA 5D3QA 1QF6A 4BQPA 3NGMA 2C9DA 3QWBA 1B0ZA 3RRGA 3DDOA 3PVXA 1ORRA 4XDHA 2Z5VA 1KRXA 1EG7A 5HWSA 3OFKA 4TUYA 3RIXA 4CMKA 3UG6A 4YPOA 2WHQA 3DLIA 2QAIA 1OUMA 2BMFA 3K5HA 4RF3A 5AVKA 4Z6CA 1T2EA 2DY1A 3AESA 1MNQA 4H7IA 3H8MA 4XDGA 3VKUA 4FIDA 1BGWA 1I1OA 4D6XA 3A6DA 1NFFA 1L3TA 1TCAA 1O6FA 3E27A 5ECWA 5B2FA 5I47A 3UXPA 3DBHA 3C7KA 3ADOA 4WKNA 2PX3A 3O8DA 3ZI7A 5HKAA 3HUEA 5J40A 3D7LA 5EJ2A 3M3PA 1KNQA 1Y63A 1QRSA 2Z8XA 1DCKA 1GZHB 3H99A 2G4CA 4JNCA 5I5GA 4L8FA 2FSVC 1EFKA 4UARA 1AU9A 1L5SA 1AKQA 1JWBB 2P0AA 2UZIR 2ZIAA 3QEBZ 3AR4A 4YMSA 1AUVA 5J29A 3ZDQA 3RYCB 1ZGCA 3D0OA 1FLNA 5JDIC 3HX0A 2F77X 1KI6B 1SVKA 2J8ZA 3K31A 4LUCA 1O6BA 4MI6A 1B6RA 4QHSA 5BSMA 5AVQA 1XJ0A 3EE6A 2FE1A 4IIBA 3F9CA 3GGJA 4HEA1 5H70A 3SJUA 2DGZA 3X1JA 4PGFA 3CNNA 3SFTA 7ICHA 1J5EB 1KVRA 3P32A 2WU8A 1GA1A 3SM3A 4CLXA 4EI7A 1R37A 4BB9A 3BN3A 1P74A 1PBTA 3OZ7A 1U9IC 1PUZA 3R6GA 4FR0A 5T4EA 1H2YA 1R6XA 2FKNA 1XXHB 4PYRA 4DT1A 3GPDG 3K8ZA 4HKTA 1QOPB 4JVOA 3MPOA 2IZ1A 1JTEA 3Q7EA 3RT7A 1U6IA 5IC6A 1R0XA 1HURA 2IKQA 5ILGA 1ZUWA 3MJRA 4H31A 1D2MA 3B7GA 3IHTA 5JH7A 2NVUA 2G1UA 1H4SA 2G0NA 4MCIA 4WCFA 3LVQE 5CB6A 1KDOA 4I1UA 3QUCA 3JARB 1JB1A 2XE6A 1QO0D 3G1WA 3GGCA 4WESB 3K0AB 4ZCSA 4HZUA 3LNTA 1YFJA 4LG1A 1R0BA 4ER6A 5LD2C 4ER5A 3D2LA 2CFOA 3ZOKA 2PZBA 3FPHA 4C0WA 3R5SA 4R41A 3BMCA 4FFLA 4AK9A 2HXSA 4DBLC 3WU2U 4YT8A 1WSBA 2GOLA 4ZWNA 4D0LB 3C1ZA 1PUXA 1E60A 3M6ZA 5JYBA 3NEJA 4MV8A 4M0FA 1QIJA 1DC8A 3DF9A 4BO1A 2IOHA 4TS9A 2BDUA 1HA3A 2XNDD 4Q7EA 3UXEA 4CR6A 2ABWA 1ODIA 2Q1TA 3GPIA 5DBIA 5I9BA 1OIXA 3HKEA 2JNWA 3QLVC 1E7YA 5F9MA 4D81A 3DLBA 4FGUA 1JFVA 5JRDS 1Y6GA 5AKLA 1Z7EA 1GNTA 1N3YA 1NVFA 2GF0A 3GJ3A 3HV2A 4I1VA 4AP5A 4LZWA 4AX4A 2W9CB 3B3QA 3K7EA 4KQEA 2P6MA 2VTVA 4URXR 3RK1A 4MAMA 2HK7A 2IITA 2O8NA 2Q4OA 1M1ZA 3LF1A 3T6KA 4AJ4A 4CIXA 5A3JA 1I6KA 1NMZA 1GVHA 2QL9A 2KEYA 1W52X 3JVEA 5E79U 1U7WA 2DHRA 4OA5A 1ZJMA 3B36A 5JNWA 3QU9A 1H5QA 1GL7A 2WJ3A 4KBGA 5ESWA 4XLZA 3FJYA 3P9SA 2ZB8A 5K3EA 4FS3A 3THOA 2WTAA 2X58A 4AJOA 1P45A 3DVSX 2FWNA 2XLCA 3MJFA 5AHRA 2GFIA 2IPMA 2OV4A 4HHEA 4EAQA 2N9UA 3R5XA 3L1KA 4HMQA 5E2BA 2HRRA 2BI8A 3ZBPA 3MMXA 2JIOA 1F5NA 4JLAA 4Y2XA 1KC1A 2GN1A 3IMEA 4YAUA 3MWYW 2Q0QA 3VR1A 2AMJA 5FYDA 3ZHTA 2JF0A 2AWOA 1O8BA 4F84A 3ZPXA 3AF6A 4IVNA 3PPXA 2Y77A 4DUGD 5KQRA 2QPAA 3RU9A 4PZ0A 1KZHA 3SF8B 1Y4ZA 3VYVA 3F5DA 4PG4A 3TD6A 3ZWNA 1BCRA 3N2EA 2CNWD 3AX6A 3PVCA 3H13A 1CD5A 1TJ5A 4HN4B 4EDHA 1SM4A 3EODA 3M70A 1POWA 3C2QA 3MOGA 3TQSA 4E5SA 5L3QB 5K4HA 2IUEA 1FU8A 2EAMA 1Z0KA 1SZHA 7ICMA 2COUA 3VUEA 1C9EA 4P0PB 3D4PA 1L5QA 4G0WA 9ICHA 3ELDA 4DL5A 4BVLA 1UC9A 1BHJA 1NLMA 4GNRA 3TW8B 3ZHYA 4I2JA 4FBUA 3UAGA 3UJCA 1E7MA 2PL9A 2ZVQX 4H35A 4MVJF 3WADA 1IN6A 4NATA 4BQNA 2P4HX 3G1UA 1BNCA 4KAJA 4OKNA 2F3TA 3FPEA 4DV1B 1BN7A 3H97A 5EN4A 2BYTA 4MVJH 3HDJA 2DUYA 1GG2A 3ZNPA 5C1DA 3WOHA 5IMSA 3SJCA 1P7DA 4LOIA 4TYYA 3QKSA 1GQYA 4ZO6A 5FWNA 2I6SA 2H11A 1Z0JA 1PO7A 3F74A 3HA7A 1B8NA 2GPAA 3AJRA 3VYWA 4DANA 2GF2A 1O89A 2WWRA 2K5UA 4P54A 4BLUA 1SN7A 1G6HA 3QUQA 3O92A 4QELA 2JGIA 1Y1PA 1N9KA 1FNNA 1LTKA 3B13B 5CHGA 1U0GA 1NVWQ 5EESA 4D8TA 2G9NA 1ACJA 2CK3D 4TTSA 1RHRA 2XDQB 2P2CA 3EQ2A 4BLQA 5J2IA 5TQVA 4F97A 3EPIA 1TVKA 4HQOA 4ZT6A 3AP1A 3ROFA 2HA4A 1Y81A 2IV7A 1CEZA 3MJCA 1N2CA 2VH1A 4L75A 1IVYA 1VG0B 5IHXA 2XO7A 2IE0A 2YXDA 3U7QA 2AI2A 3Q7RA 1NG1A 4H08A 1A8UA 1YHNA 4YFVA 1EIZA 4CM8A 1ZGHA 5D49A 3GCGA 5C5IA 1ZD4A 1L1EA 1JSZA 1LKZA 2HSWA 2VDMB 1K3FA 1KEVA 1YVDA 4PVDA 5F2KA 1SBNE 1IQUA 2LMRA 3C98A 1OW3B 2JIRA 3K0EA 2O06A 2X2FA 1X2IA 4CGYA 4C7VA 3N2KB 5DLFA 4I7EA 1I4EB 5P8WA 3LDGA 2RIRA 1OX4B 4R1NA 4BEVA 1ISMA 2LYAA 3ELBA 4EGAA 5KOJB 2I1QA 1Q17A 2QTAA 1DCTA 9ICEA 1K5HA 2RB4A 1E1KA 4RVNA 3IAUA 2VFAA 3RUFA 3E5MA 4JI7B 5BV0A 2GXAA 1M10A 1S8FA 4ECQA 1MIHA 3JYPA 3GA0A 3MUEA 4DJEC 5CX1A 4B2IA 5FD8A 1XE3A 1G3QA 3KQYA 2Y9MB 5DKFA 3UAWA 3SYTA 3ZY5A 2X22A 3ICCA 1RYZA 1BS2A 3A7DA 3MFQA 4EOGA 5B12A 5KNCD 3U17A 4BBZA 5CCDA 4Y2RA 4TTVA 1D8LA 1YIOA 4OMFG 3IIKA 4FW9A 2ATCA 4N5HX 1SKSA 3O26A 3CRRA 4L0DA 2JLYA 3KOXA 1LQ2A 3ROZA 2B30A 4DSIA 2QIOA 3BWDD 3DCJA 3LVWA 4P98A 2F8MA 4JBGA 4N8DA 5FWXA 4B6SA 3R0ZA 3PUYA 2RK3A 3RADC 3STUA 5EP2A 4BX3A 2OQIA 2XXAB 1QBGA 3TFOA 3HJUA 3H9UA 3V2HA 3NW9A 4IQUA 2Z30A 4TKVB 5IJAA 3OZGA 2APJA 2PUTA 4IVRA 3BL6A 2IYLD 1TVAA 2Y68A 3FYCA 2Z2IA 3NHJA 4UCFA 4K0KB 1VCOA 4R68A 3VPAA 4QOHA 3LTNC 5LQNA 1N62A 1NYLA 2P90A 2E5LB 2GPSA 4L5BA 1CY7A 2VZEA 4QSMA 5AJTA 1JQAA 4CCHA 2FUG6 5JZ9A 5LLDA 1G59A 1UR5A 1AHNA 1DVRA 2JEYA 2VPPA 2FQ1A 4OJQA 4DUPA 1OI4A 5KFVA 3FJ1A 1JSXA 1Q6YA 3PXXA 3GUHA 4ZVOA 1E99A 4P33A 2W90A 3ENZA 4D9JA 4PSDA 1TT7A 2X3FA 1J2UA 2CLEB 3A05A 1Z4OA 1DOQA 3PRHA 4MVXA 3UO8B 3JPYA 5GINE 1SUBA 4EI8A 3H2IA 3BFPA 2VDPB 3FVRA 2XRFA 4WZAA 4C3UA 4O4LB 4Z86A 3E3LA 1O95C 1YCHA 1E1LA 3C3KA 1HDOA 3ILHA 3TLKA 4X6YA 3NVWA 2NPIA 1RM3A 4YRGA 2VPWA 2ZYAA 4NBTA 3GVHA 2G72A 3RAJA 5ITWA 3ZH2A 3VU3A 3LJKA 3A7EA 1P7PA 2ZSKA 2OZPA 3KWJA 3OTHA 4RHEA 1RACA 1B93A 3GUZA 1J0CA 4MIEA 2BMAA 1N8KA 1BVYF 4IQGA 4YR2A 2W6OA 2IU6A 2A59A 2IY8A 1G3UA 1YI1A 2CDBA 3ZEAA 5TRTA 2OY0A 3QNUA 5DX0A 2J7KA 4KN5A 1YKGA 5J2BA 2BBTA 1HSOA 3DTTA 3HB4X 4HTFA 1LBTA 1HYHA 5DCYA 2PMFA 2V0CA 4C7YA 1TB4A 1LFAA 2O48X 1R5OA 3OPYB 5KVSA 5KYXA 4NNOA 2JLBA 3TTYA 4EBEA 1R4MA 5JZSA 4MINA 1XZCA 3KT3A 9ICQA 4CE6A 8ICWA 1G5QA 5CCXA 5JQGA 3RC8A 1Z12A 3CX7A 3PENA 2AMFA 2WFMA 3L84A 3DR5A 3M4XA 1B8UA 1QHHA 4HFRA 4IZOA 1RPTA 4WXMA 1ZCZA 5AXBA 3UXHA 5HM6A 1TKDA 5CVEA 1LLDA 2DL0A 2JH1A 1TD9A 1T5BA 1UDRA 3IOBA 4E4YA 2KZ3A 5AM2A 4WKCA 1HE2A 1BXZA 1XLTC 4P82A 4YJGB 3RAFC 1HWYA 1W4CA 3MUOA 2AOTB 4U6NA 2I6GA 2MYPA 3HFSA 4RPHA 3B5EA 2DWUA 3TEMA 4BFZA 4YLYA 4DB4A 3B0XA 1T9HA 2EJCA 3I2YX 3KHGA 1BFKA 1BIFA 2H2DA 4YI3A 4F5WA 5B3JC 4DL2A 3PW2A 2D8CA 3QUSA 4WJLA 1RC1A 1GPJA 1W94A 5KHAA 3LE8A 5KJ6A 2OHIA 3IV9A 5C5EA 1IOWA 1XNRB 2NYAA 4FB4A 2XOKA 3UANA 4KX3A 1J8YF 4NDNE 2IDZA 4MUBA 3ZIDA 2GDZA 3SZLA 2WT8A 3GLGB 1A0PA 1DG1G 4RH0A 4WUTA 4B6FA 5CLFA 3NEAA 1TECE 2CL6X 4KLUA 1EFRA 1QTNA 2H3QA 2MDTA 2QTHA 4Q1AA 4ZDKA 4O4LA 1KN5A 4KZPA 3ORYA 2PT9A 1SEVA 1X6VA 3SQXA 2QZZA 5IBRA 4LXIA 3NHPA 2ZRKA 3FWYA 4YMLA 3MBYA 2ZJOA 3W5CA 3C0KA 1Z6ZA 5FOVA 4KTVE 1EG2A 3CKLA 1WMFA 2NVOA 3B1FA 3DC2A 1E4OA 1QAOA 5FAXA 4HWKA 2G7MC 3PD0A 1VKNA 2DPLA 2PKQO 3PHHA 4HNRA 3D8HA 5BQ3A 2W6ID 2QARA 1G3MA 4HP8A 4CUKA 1M76A 3P9NA 4RQ8A 4GPBA 5D4BA 1O95A 2QX8A 1L9KA 1ORIA 2H52A 2G6BA 4EB3A 5HVNA 3SEFA 3AM9A 3EW7A 5IT4A 1S97A 4ED0A 1R0KA 1RXWA 3BTVA 3VYSB 5AI4A 5L3VA 1LF0A 1X7YB 1ADYA 4BO7A 1TK8A 4UAYA 2XE4A 3H1BA 3BSFA 3MERA 1WMSA 3RH5A 1CZRA 2EW1A 3JPRA 5ETJA 3O4HA 3WOVA 4UAZA 4P83A 3TFRA 1QGDA 1I7QB 4LSWA 4XARA 4DBLE 4MF8A 2HU8A 3GAAA 3GRYA 3PE6A 4OQXA 5EOVA 4ZMSA 2PKWA 1W1IA 2Y1IA 4U2FA 4BB0A 2A1TS 4Q9HA 4OJPA 5ITZB 4J4HA 1JQ5A 3QJGA 1NNEA 4ED7A 2BFOA 5K3BA 3WK7A 1H5NA 1UDCA 3PZRA 3QG5A 4TLBA 2J3EA 1DC3A 4P3NA 2XX3A 3KYJB 2GSDA 3G0DA 3IHLA 3P0IA 2X3UA 3X1DA 1N7HA 1E6MA 2Z2ZA 3AKEA 5I3CA 3RSSA 2ID4A 3QVKA 1ORHA 3ENNA 3GMTA 1ZY2A 3ONFA 1GYRA 3ESZA 4GEGA 4EJ0A 4UAJA 2IZOA 1WP9A 2VNAA 4IIDA 3DD1A 1DC5A 1G8JA 1DX6A 3H11B 3KPYA 4B74A 1J8VA 1NK8A 1Z5NA 5LMNB 1CB7A 1EINA 4DS4A 2EDCA 5K0SA 1BU8A 4KITB 4MJXA 1LZKA 1BJRE 3ABQB 3RVJA 4HGPA 4FN5A 4N0EA 5BORA 4WLOA 4RCZA 3ZCQA 3FDXA 2O2EA 3K9BA 2ESEA 3KZXA 3N2KA 2GYYA 1I2ZA 3V6MA 1F2UB 2F9LA 4DARA 1CE8B 4KGDA 4GL2A 2B2NA 2O4CA 3AY7A 4AJIA 1EUQA 1GEGA 3ZCTA 3LYSA 3DFUA 5KMGB 1HPLA 1ZQLA 1EFDN 1E1RD 1P0MA 4KK4A 5TQ2A 4CTNA 3H16A 4I2DA 1A2QA 1BHO1 2EKZA 3HDYA 5DNEA 4PLTA 2HA0A 4L4YA 5GJWC 3LD9A 2H2IA 5FBWB 1IDN1 3TNFA 3W90A 2VYFA 4IDEA 3KVYA 5A4KA 2OESA 1N3IA 1V85A 4Y9DA 1RBYA 2JCYA 5LYJB 2HB6A 1N34B 2VEOA 4JX9A 4DPMA 5LWHA 4PAQA 1E62A 1RWXA 2KD1A 1O08A 5J2DA 2XDQA 3IAFA 4K5QA 5I9NA 2QT9A 3DR3A 5JUMA 2HMXA 1ONOA 3CMCO 1IHPA 2JAXA 3BF7A 2X15A 4RAQA 2NW6A 2W4MA 4DA7A 3DEFA 3FBWA 4HDSA 5FLYA 2OV8A 3VA7A 1XTTA 2H5EA 1DSSG 1EVLA 3DZIA 4GP7A 3G6VA 3R20A 2Q2WA 1P0CA 3QYFA 4H1WA 4F8JA 5F1KA 1TVCA 2BKVA 2PAFA 3A3PA 4FJ1A 1ONSA 2PWZA 1QYWA 2VTDA 4H17A 5E1BA 4LPSA 3S68A 4JB2A 3VVMA 2W03A 2IZZA 1TC1A 3RJ9A 5ALSA 1L3VA 1AV7A 3T5PA 1RWKA 3GLGA 1KMMA 2IOFA 4KLNA 3RT1A 2V4QA 4YV1A 3QXSA 5LMZA 5T8KC 1DWOA 4L16A 2BFBA 1G21B 4CM1A 1HDEA 2QAGB 2Q5QA 4KQXA 3W5IA 5JJBA 2NV0A 1K9SA 1BDHA 1SVIA 2QNIA 3FTNA 3KJIA 1RWBA 2CXTA 2PZAA 4HCJA 2I55A 4J0HA 2C29D 1XSNA 3BJYA 4DQRA 1E2QA 2BJHA 2X8AA 3RH4A 5GONB 4F7WA 1XGKA 2P0EA 3C5WP 1PT5A 3EY4A 3LBAA 1XXHE 4ECSA 3A04A 4QOEA 1GHTA 3NZEA 4DL4A 3NB0A 5ENZA 3DLHA 2ZAMA 1D03A 4WERA 4E22A 1HTBA 4UBIA 4U8GA 5BYAA 1UK8A 4QG3A 5GJCA 4D9BA 4AKEA 3ZDRA 1J8DA 3UWPA 3WWEA 5DCUA 5JANA 4YECA 2JHAA 2J4FA 4DLYA 2YWCA 2FSSA 2OV1A 3PHCA 4ZIRA 2OB2A 4D8UA 1AZWA 5JISA 2VP4A 5KYUA 2C1EA 3PWKA 1RPAA 4O4JA 5BR7A 1CUSA 1JSCA 3BG5A 4G56A 4M1KA 3BB1A 4RK0A 5B37A 4F3KA 3TQHA 3O0FA 1IB0A 1YMVA 4LYDA 3PQCA 2G08A 2OWEA 1T1SA 3NIFB 4CKWA 3RGGA 4CJXA 3OM8A 4XA5A 5KFQA 5IVHA 1E9RA 4NX2A 3OCXA 4RK4A 2QYSA 4EW1A 3N2IA 4I55A 5DHFA 3WLSA 1VHWA 4PFKA 5BV2P 9ICPA 2OK7A 2W2PA 2J9ZB 1GRRA 2XIQA 3A27A 3EXHB 3NVZA 4ND3A 3F7OA 3NORA 1L7EA 1A9YA 5AHWA 4RA6B 4B7ZA 1HC7A 1DBQA 4N8SA 1ZQKA 2BGIA 2PXAA 1E0JA 3QPVA 4TXJA 4ARBA 5FA5A 1G5HA 5L40A 1IM8A 2NMVA 4NLCA 3BWVA 3COWA 1CXZA 1E59A 3D3NA 2V7TA 4WKGA 2EW8A 4KQHA 3T1OA 1Z5UA 1JIKA 1MFPA 1HLGA 1O6CA 2ASJA 3KPUA 5CGZA 5AMXA 4EUNA 4EYKA 1Z45A 4IDAA 1RHJA 1SKRA 4C0BA 3QY9A 4J76A 3F5QA 3KFVA 4DNPA 3V7KA 3AM1A 2A3NA 4EF5A 1VRCA 4CRWB 4NK5A 4E13A 2WTFA 2QJRA 4HX9A 2GAJA 1YK0A 4F9GA 1FXWF 1X87A 2ZRBA 4EHHA 2GBPA 2X3YA 4EHFA 3ZDYB 4Z7OB 4F11A 5JUWA 1IG0A 2Q9CA 2XDAA 2BCUA 2GYWA 1BGXT 4DDKA 1YZ7A 1A9TA 2Q3DA 1YRBA 4HH3C 1ZRNA 4RVHA 3FNGA 3Q15C 2Y1EA 1RJ9B 1GUAA 1MMFB 1CY6A 1SCUB 3NJRA 4L0MA 1TEHA 4ZMRA 3LU1A 2C84A 2ZIVA 1L7DA 1ML4A 1OTXA 3P1JA 5F9LA 3VPCA 3IXMA 5KNDD 3IQHX 2P67A 4TKUA 2UVWA 1E0DA 5J2HA 2CWDA 3LRPA 3OOYA 4DJFC 1ZINA 4J49A 5LXTA 3N0XA 2K7FA 4FEYA 3TRFA 2X8JB 3GDOA 3H65A 1ORVA 2H1HA 2DR2A 2PX4A 2D2IA 3A1EA 4YMOA 4AZWA 4LF5B 3SAJA 2QT0A 8ICTA 1M8KA 4QQFA 1SKYE 3RBDA 3MLEA 3JPNA 1HYEA 2RARA 3JAKA 3CNHA 4DT1B 4UU7A 4M9HA 2Q8NA 3M9MB 3FCSB 2A78A 2YYAA 2ZS8A 3O8NA 4JJKA 1R2QA 1RJGA 2FSIA 1E3EA 3A2MA 3T1VA 4E31A 1T8YA 3DZKA 2EU8A 3TAXA 3SX4A 4JZYA 4EEXA 1G9XA 3HPQA 3TCXB 3NONA 4RD1A 1O97C 3T1NA 2HHQA 2BY4A 4NULA 3CLSC 1QIMA 2Y99A 2GJKA 1QSSA 1KI6A 1S89A 3CIOA 1Q92A 4N7JA 1BXKA 1KMNA 3AB7A 3I4LA 4LRWA 4F2DA 1ULSA 1K63A 4RFSA 3BDIA 3BQ0A 1EWVA 4XUEA 3M8KA 3DOJA 3PNCA 8ICFA 5D5PA 3E7PA 2R18A 5I7EA 5E4TA 4JXJA 4PF1A 3K0FA 5KTTA 4Z53A 5G0VA 5B1SA 3R3WA 1XEXB 2AQHA 4I9HA 5FBRB 3PYLA 4Z0HO 1D8BA 2F3RA 2H1OA 4GC9A 4UQGA 1MO4A 1Z9BA 4QVGA 4G23A 4S1PA 1IZ7A 4UHHA 4BFXA 3TBKA 3TXXA 2UZ4A 4RPIA 3QF4A 4Q9LA 4DLBA 2PUVA 1Q6ZA 2C0QA 3ZZTA 1KKMA 5A71A 5B7PA 3ZK7A 2XMZA 5DSXA 1KFDA 2DR0A 2JXJA 2H9AA 1FYVA 2FU5C 2MSEB 3NCTA 3ZXUB 1P9NA 1ZX1A 5EJ9A 1HE8B 1U0NA 3IDWA 4ZU1X 1BX0A 3HI6A 2FX5A 2ZTUA 1PQ4A 1UT8A 1NJ1A 1F4VA 3SPXA 3EVEA 4XX0B 1UP7A 4B46A 3DPSA 5BRAA 1P72A 4XX1A 5HF5A 4RT3A 1SBTA 4EZ6A 1IULA 3QVGA 3OY2A 2HU5A 5JAHA 1F51E 3ER8A 4LVUA 1ZI8A 4FP9A 4BDPA 1J0DA 5CFMA 3LYUA 4IXTA 4TSFD 4D9IA 1FYFA 1TYAE 3PXUA 3I04M 4H7HA 1RWPA 1RAHA 2XZTA 4HRVA 4QQNA 1DTSA 2F62A 2VQ3A 2HBKA 1RYDA 1XZJA 2QXUA 1NI4A 3K4QA 2ZG6A 3KUUA 3AR9A 3DDZX 3DCNA 4UZFA 3OZCA 2VJKA 2C9YA 4IW3B 4YO7A 2GILA 1AGRA 2W83A 4JUCA 1QYXA 1II8A 1V1MA 5F12A 3VOAA 2YZNA 2ZUDA 3CN9A 1OXVA 2HHLA 3JYLA 4FFNA 2CVHA 2OQRA 4MKGA 1TM7E 4JA2A 4H6VA 4PZUA 2A1JB 1OREA 2QZJA 4PPQA 5DBEX 4CLEA 3TXAA 4EHBA 1ECCA 5KYNA 4B5LA 2CLKB 4Z9AA 1TFRA 2FP3A 4B80A 5F3DA 1A2BA 4J7AA 3ZWOA 1PEAA 4BO5A 4F6RA 3IBSA 4JV2A 1WZEA 3FMVA 5AI0A 4PPYA 4RTKA 4DQIA 4F45A 5AUPB 2BC9A 3E5NA 3EMKA 4I4TA 5GVSA 2A0KA 2WZQA 3NGLA 3AN1A 4MUXA 5D3ZA 2POCA 1A97A 1NSFA 1ZQYA 1X8JA 3STXA 2JFOA 1KXZA 121PA 3OCUA 1Z0SA 5HRCA 1O9GA 5JH7F 1LRLA 1YHZA 3WWPA 3W5DA 5C1OA 1R7RA 2GLXA 1VBNA 1M74A 4QZHA 4FYMA 4LJKA 1KJIA 3O7MA 1KYTA 1YBFA 4OBXA 3W34A 3BFVA 3QG1A 3ROQA 2WF8A 4ECXA 3CYFA 1AC5A 5K7SA 2MA1A 1Q15A 4AX8A 3PFIA 4IEFB 3A4MA 4IOMA 5CK4A 1MRZA 3NPMA 4JVMA 5LXTB 5PGMA 4WY8A 1VJ5A 5FULA 4BZZA 4F60A 3CY6A 5AVYA 1SL2A 4NCJA 2CPRA 2VHUA 3DLPX 1MSWD 1N7IA 2A1UB 4O0MA 1JLHA 1P5RA 3ZZ1A 2DJIA 1NK7A 2FPIA 5AQ1A 1PGOA 2E3JA 3QIAA 1XD9A 1YO6A 3WMRA 5EIBC 3U3KA 1TKAA 2WINI 3C4QA 4B4OA 1C2YA 5F3WB 2RBEA 2B3DA 3VU9A 4FS1A 4Q4JA 4HNVA 2D7CA 3Q72A 2WB1C 5B66U 4BNMA 5BPFA 2QB1A 5JPCA 4KCGA 5KT6A 5K0JA 3S8YA 1OKKD 3KR2A 4C4ZA 1W0KD 1VL0A 1U8CB 1IHDA 5ECGC 1Z75A 2RBKA 3IJEB 4QZ9A 3M89A 3SZOA 5K9ZA 3CZQA 4I2FA 5KDOA 5JZVA 2ZDQA 1I32A 3Q7SA 1ID1A 4J7XA 4FFWA 3JCZA 4AFNA 5DTJA 2Y1WA 2HF7A 2O5RA 4O59O 2HA2A 4ENVA 3HYCA 4C7XA 2QBYA 2D7JA 3DHEA 5G5HA 3SFVA 1YJ8A 5IKXA 3QPDA 4OI0A 2QLJA 3K0SA 2MIIA 4A0HA 2CXPA 1UJ4A 1OV6A 4QRHA 2X5XA 4GH5A 3V00A 1ZNWA 3JSXA 5C7OO 3R4CA 4O2AF 2P2YA 3RS9A 3UFXB 3RUDA 1GM5A 3LECA 5KSZA 1CHNA 2VO1A 2JAPA 5ALGA 1NMYA 3ZQ4A 1V4BA 2BGNA 4PLHA 3SEIA 4OLFA 2GH1A 4KE7A 4P34A 3U44A 1UBMS 2AE2A 2R8YA 1KOJA 1RLTA 3G02A 3L7YA 4QT0A 5M5BA 1II9A 2V1UA 2NZUG 3GLSA 4BAGA 2AN9A 4PR3A 4J9PA 4TLMB 3LUDA 4F4XA 1A5SB 4NOJA 1PR0A 1GPMA 2ODGA 1YBAA 4MFCA 2BV3A 2OCIA 2W71A 3MCVA 4HVAA 2AFHA 4L5CA 3R76A 3LSTA 4PG5A 3SKVA 2F90A 3W6PA 4C06A 4BIMA 4DCGA 4UCQA 3RODA 1Y8RA 4Q5IA 3FRHA 4ZCTA 4KRGA 5F64A 3H2HA 3U4GA 3KHSA 1GYQA 2X1HA 2DYKA 4JWTA 4PPXA 2OO5C 3L7AA 4KW7A 5ALZA 3RJHA 1G16A 1S7CA 4HWGA 5CFZA 2C7QA 3GQCA 3AXSA 1Q0ZA 1YC2A 1GTZA 3F8SA 2P11A 3HJBA 4ASUD 2ZATA 2LBPA 2B2CA 2XJ9A 3ZD7A 2YDXA 3BX1A 3BJEA 2FJ6A 4I2VA 3EVTA 4L0QA 5LN1A 2A0XA 2ZK7A 3RJJA 4CV0A 2VK1A 4PEVA 3TNDA 4F72A 3H9JA 2G9ZA 4FJ2A 4I1SA 4JDPA 1EFLA 3IB6A 5CB1A 4KQWA 3RVMA 3T9CA 5KFOA 2X4GA 3SR6A 2CB0A 4P35A 4A73A 2KJ8A 3URKA 2ZTCA 4L76A 4W5JA 5BVGB 5FUYA 1YQXA 4JIGA 4NABA 5IC5A 3TZ6A 2ZZNA 2VQEB 1OVMA 1YR7A 4GFJA 4JH0A 1N8NA 1ZRHA 4I3GA 4OHRA 1S8OA 2BFEB 2WIJA 3GZJA 4QLAA 5LCXA 3T9FA 2W70A 4ER3A 3HM9A 1PQUA 4WBXC 5GIPE 4DF8A 4M60A 3G6XA 4PONA 3R6WA 4ZT4A 5AVVA 2LP4Y 4DCMA 3GZTB 3O90A 2PXXA 5BWBA 1A95A 1JQEA 3Q8PB 2EGHA 2RH9B 3AUSA 3EA0A 4UQPA 5U4QA 2QR3A 5J4LA 1E1QD 1JLMA 3BSSA 3G3EA 1E6UA 3KFXA 2X2EA 5CM8B 2BAGA 3RREA 3C15C 3A9UA 2H08A 4J07A 2IIBA 2ORYA 3F53A 1QH9A 2V5AA 3U39A 3ZCVA 4EVIA 2I3BA 5F4ZA 4FE7A 1ZJ6A 1OE0A 3S7TA 1Q2UA 1LBEA 2VP2A 3W1VA 1Z3EB 2WFZA 1A04A 3PDIB 5L51A 2I5PO 4DHEA 4YCDA 5KJCA 2NO9A 3ZQKA 3L0BA 4C0ZA 4W1QA 2CYAA 3MABA 1UZNA 2FJPA 3C5HA 4QU5A 2OHHA 4AYBC 2QTWB 3G2MA 3QBEA 3CXRA 4MV7A 3UVEA 4NJ8A 2CCJA 7ICIA 5A4AA 2RC5A 4V3CA 2EZUA 1HK7A 2VZ0A 2AG8A 3JQ6A 4GECA 2NU8A 4EPYA 1G5RA 4R8LA 2P9QA 2Q2OA 3IDZA 1Y5IA 1J8FA 2FK7A 3LIIA 2QPLA 4TTTS 4UHCA 1GGNA 4C9BA 4CKEB 1P1RA 1PVOA 4ILKA 2ZRLA 5AK3A 3RS7A 4OGKA 2R25B 3A4LA 1WTCA 3EG9A 4NJMB 5HRUA 3HTXA 3SE0A 4FYJA 3DGFC 1M6HA 3PNVA 5FLKA 4LY3A 1EE2A 4AG3A 1ZD2P 1W46A 7ICRA 1L5NA 2R48A 5H9WA 1Q1QA 2OBLA 4DRXB 1QLJA 4IILA 5ALFA 3KJGA 3SHFA 3BZKA 4UHFA 1KO1A 3PS9A 3CEAA 1LXCA 1TZCA 3IERA 4DL3A 3LT0A 3Q3VA 2YS7A 4A8JC 4EJMA 5T41A 4F0JA 5IT0A 2PUEA 5TPZA 1W93A 3WLEA 3L1HA 1VSVA 4Y0NA 4RQ5A 1RQ7A 2V7VA 3D4LA 4QX6A 5EIHA 3CLTD 5ERYA 5HBGA 5J2TF 3VR4H 3OLQA 3BFKA 4E32A 2GERA 4BX9C 1XWLA 3SAHA 1HORA 1R0RE 4NJOA 3WV4A 3AY3A 2AJQA 2YXEA 4OV6B 2OPHA 2O8DB 1BMQA 3U19A 3GQBA 3AEUA 3LWDA 4PM4A 4EI9A 2ZUVA 1Z2DA 1XAJA 4BNLA 4YMGA 5AFSA 2VJQA 2AE1A 3QRWA 4X95A 4LMAA 3MXTA 5GONF 5SY6A 3NUQA 5CVUA 1LPNA 1MOQA 1T5DX 1U7PA 2ASVA 2FFJA 2F3UA 3C5EA 2I2WA 3M1IA 4NTZA 3OE5A 4TUYB 3W04A 3U5TA 3F78A 1G4HA 1LB1B 1CJMA 3PKIA 4CTMA 2R8EA 5BR1A 5L45A 4YS6A 1W0JD 1MDBA 3BS4A 3OFSA 1L7OA 2XWJI 3HN7A 2JI7A 2PVPA 4JYZA 3UQ2A 8ICGA 2XCSB 1FIQA 4DF4A 1Z82A 2JANA 2VI5A 2ZYIA 3CISA 4MO9A 2R6CA 2I8AA 1WHSB 4J6FA 2GKSA 3PO4A 4JQCA 5K4AA 1YTUA 4F4HA 4X92A 5TQ0B 4LWOA 3QELA 4YR0A 5JAMA 4GOND 1Z1VA 4N39A 2WSSA 2X2OA 1TZBA 1E0KA 1NKCA 1MPTA 1R5BA 3LDFA 4FGLA 4MCAA 1NK4A 1PWHA 2P3SA 2YV3A 4TLEA 3MT9A 4XASA 1JW9B 1EZ4A 2PQ2A 2XUJA 3BQ9A 2GX6A 3PV0A 3UJ8A 1BD3A 5KMGA 1QSGA 1CJVC 2V4MA 2BI7A 4JJ6A 5KFUA 5CVJA 3ZIAD 2P2NA 3EIXA 5TNXA 5JSZA 3N70A 4AQYB 1M66A 1U3WA 4PYKA 2OHXA 3UYKA 3DTVA 4LNUB 4EFLA 3E81A 1XA3A 1IEXA 3DO8A 2VUTA 4FOLA 5AESA 5F77A 4EI2A 3L8DA 1U0BB 2A5GA 2D6FC 4PG8A 1W76A 3PC6A 3DEJA 4F4DA 5SZIA 3TGLA 5CPBA 3RBEA 4R2KA 3AMVA 3MGAA 4FPXA 4UE6A 1SC3A 3K8QA 5JRJA 1ZD1A 3HDVA 2PGIA 5BN4B 3EGOA 4BE7B 4NCAA 1Y1LA 3KB6A 4RA9B 2JBAB 2ZT6A 1KI2A 4Q4HA 2BEWB 2FUEA 1PHPA 4RZSA 3UK0A 3MCWA 1XYVA 1M0TA 1ZXIA 3BQ2A 4UNQA 1FF9A 2YY7A 3R0QA 4ED6A 3RAPR 4DWWA 3OTOB 1IE3A 4C8MA 2Z57A 4OHMA 1UJ5A 3RJFA 3UXOA 1IJKA 2JA2A 2YWDA 3EOBI 4R2MA 5AM5A 4KDFA 4RNCA 2LGJA 2YMMA 1MVLA 2HDNB 3PA8A 5A7FA 3AF5A 1I4DD 2JGJA 3RIYA 1CEXA 3H2ZA 5E3IA 4Q7KA 1W29A 2VDWB 2WSBA 1YV9A 2F17A 3TZHA 4M9GA 1YB5A 1DEKA 4RGVA 4FE3A 2YIVX 4X1KA 1BD4A 1TLTA 5BW4A 1WY5A 3GV0A 1XZ8A 1IG6A 2I54A 4N9QA 3TK1A 3WWCA 3KYCB 4ZVKA 4KO1S 2ORVA 5JSQA 3EGVA 3HZHA 3IJ5A 1MC4A 4MP6A 4MRPA 4TS3A 3RT9A 4D4JA 4DZTA 5CA1B 1C5KA 3I1FA 1ZOLA 3QNWA 5EIWA 5DTIA 3I0MA 3RU3A 1E6WA 3BKXA 5L1MA 4QBGB 3TPCA 1A4IA 3U1TA 2VJBA 3DZGA 1NNI1 3HADA 1EX6A 3IPAA 5H82A 1HETA 3X3HA 1N63A 2Q0SA 5DG8A 1IIBA 3R9XA 1Z88A 1MZVA 1HE1C 1XQYA 1U5BB 5DV9A 2QPOA 3ECSA 4MDFA 1WIWA 4J16A 3SQNA 3H4DA 1D4ZA 1GA4A 3GLHB 2IU4A 1B6GA 4PG6A 5K51A 4NLZA 3V6HA 5A02A 1US8B 1XRNA 3DZCA 4Q43A 3K05A 5BVHB 5HCIA 1N5LA 2VAVA 1GZ5A 1NP6A 2OCAA 2WC1A 2JB9A 5FOXA 3OM0A 4I4TB 1ZW6A 4TLAA 1PZGA 1CJSA 4HXGA 3D4OA 3IQEA 4PBSA 4DSZA 4J94A 4ZI5A 4RAOA 1C8LA 3Q0IA 1H1LB 2EQAA 3BIFA 4B3DA 3C5CA 3KZ1E 2MSDB 1XVTA 3WL4A 5C3UA 1XEXA 3HZRA 4D02A 4ZYUA 4F86A 2HQ1A 4A10A 4EWLA 1DJPA 4UBKA 1KKLA 3NTRA 1EBUA 3O73A 3P7MA 3AJAA 2RIPA 3OMXA 1DBPA 4OFXA 5EWJA 1X7ZA 4AUEA 4GRIA 1YOVA 1VSTA 1HYBA 4FB5A 1VCHA 2I2FA 3HKZF 3Q6MA 3QVOA 4JSYA 4L8WB 4E2YA 1TZKA 4L0CA 1HH4A 2AUNA 4WJZA 3PR4A 3ZBQA 4FYPA 4ECYA 5DWQA 2W5UA 4MTCA 4YJ2F 4CTKA 3GJ4A 3M7IA 4AZ3B 1EH5A 5BSGA 1TPZA 1ZOPA 2VJYA 1J9EA 1JG1A 2ZWOA 3TCKA 1DS6A 1ZVQA 1AIPA 3W9SA 1N60A 3V3KA 4S05A 3QVGB 5DEOA 2YYYA 2C78A 3PFNA 1VMIA 5JS6A 3ZVMA 4PQRA 1DAOA 1BROA 3RVOA 4O3FA 1OVGA 4BX0A 2FRDC 4ZRNA 1EFTA 1VE6A 1QAMA 3IJRA 3Q12A 4J0KA 4OY3A 4P3PA 5HG0A 2O2HA 4U2KA 5BSRA 3MMSA 1E7SA 1V1JA 2IYEA 2CD9A 1MA7A 2P9ZA 1JLLB 3KZOA 3OIWA 4TYMA 5H3CA 3I5MA 4NWIA 4LRUA 1D09A 2ODEA 3EGDA 4U7TB 1YUNA 1MORA 1KP9A 3C1OA 3R7WA 1RLIA 1GTJ1 3U9LA 3HXLA 3KQOA 4G5GA 4E1BA 4MR8B 3PD1A 5BUQA 2GM3A 3OEEA 2ZE6A 5CRXA 2BE9A 5F1PA 3MR6A 3Q5DA 3WMGA 5DTEA 3GFTA 1RKXA 4M0KA 1MW8X 5CXSA 5I45A 3I0ZA 9ICTA 1AQUA 1CP3A 2FRXA 4R4JA 4I8DA 3RW9A 3T3PB 3TBFA 3IAAA 5AO9A 4KLTA 5B5SA 2HY7A 5BNIA 5F5XA 4CU5A 4YAGA 1C9NA 1W6UA 5KNLA 1CLUA 2AF3C 5KSWB 2I1VB 2BHLA 4MLZA 5J2AA 3C6MA 4OTZA 1YQTA 2J3KA 1W48A 2AC4A 4IWYA 6REQA 4F1WA 4XQCA 2AEMA 4PZLA 4OAOA 2AKEA 2VPYA 2GI4A 5KJ1A 2V0GA 5EWFA 1PJQA 5EP3A 4EBCA 4LZDA 4DQQA 5EKSA 2HHUA 1FNCA 4YPFA 4JY7A 4G2NA 4QNNA 5EZYA 1HUOA 1W85A 1KI1A 3CH4B 4LQCA 1U6KA 1ESEA 3R3HA 3B89A 3GLQA 3N58A 4CT0A 3HB0A 3JQ9A 2VSQA 2WZBA 3EUAA 1UT5A 1KYIA 2J87A 3MWDA 1QBKC 4N5DA 2BFWA 4CV2A 1B4FA 4GEKA 4E51A 4R1PA 2JH7A 1OXXK 1FZTA 1NBEA 3VNVA 1WPXA 3LAWA 3B6ZA 4INZA 2XB4A 3P9CA 2FXIA 4ISBA 1O5TA 3CMMA 1QH0A 1XD2A 2R68A 3A11A 3GN1A 3E1KA 3BH7A 4XJVA 2ZRQA 4CKWB 3EEIA 1MQ2A 2GJ8A 3C87A 2WTMA 1AS2A 4BN0A 3EZGA 1GPAA 4FGJA 2KTQA 2CFRA 2CF5A 2Q2VA 3KB1A 4JCOA 3EVDA 3OMLA 5JD6A 2UUOA 1C1DB 1FX0A 1NR5A 6NULA 4G5OA 2QRZA 2I99A 5JWHA 1UXKA 1N78A 3ZUPA 3L0DA 1YRHA 3GAZA 4P4NA 1T3GA 3RSGA 1NJ2A 3AF3A 1R6UA 4OXQA 7ICJA 4L57A 3SY8A 1DO8A 1LBQA 4Z9XA 1PNQA 3VGPA 1U0JA 4DAOA 3N86A 4QTXA 1NU8A 4LHXA 2DFLA 3GPLA 2Q29A 2CL5A 2EGUA 3EXIB 4E5MA 1F2TA 4LHZA 1XDDA 2B25A 5CP2A 1T2VA 2CLMB 2W98A 4FHFA 4BLSA 3U3MA 1KO4A 1AKRA 1SHZA 1XA4A 2B7BA 3LUFA 3PVSA 3ZV3A 2XAUA 1QFYA 2NLOA 1NLFA 3AONB 4ECTA 3IKJA 1DNPA 4JP2A 3V7FA 4C01A 5HE9A 2J4DA 1ULTA 1KRPA 2HJ9A 3JVVA 4NC9A 4UVEA 5D51S 1VFPA 2VR1A 3RASA 3BGOS 4A0QA 1WV1A 3HQ4O 4BVEA 1JRLA 3CVWA 1W4ZA 4JLKA 3WB2A 2XMRA 1OXJA 3FWZA 5U1PA 3WMWA 1HQDA 1KAOA 1MX3A 2IKSA 4IJVA 4YC7A 4EG3A 4EZEA 4HTAA 4CF4A 1ECBA 1JQLB 4FNAA 4QBKA 1PTKA 1UMCB 2GXUA 1UJ2A 3HRHA 1YTLA 3WIVA 3JSAA 1CR4A 1RBZA 2AZ4A 3OHAA 2ZT7A 3S1SA 1AGNA 5BN5B 2HCTA 1X0XA 2JI6A 4HWRA 4N3AA 3M4JA 1GGHA 5JO9A 1QV7A 4C88A 1SVOA 1R66A 3A6HA 2R6R1 5EVCA 4CEHB 1PR6A 1DAIA 2CMGA 2B7CA 1NM5C 1LW6E 2AXNA 1PKXA 1T24A 3H2GA 3KB2A 5L3SB 4RTJA 4IIFA 3VMMA 2YN2A 2Y3IA 3R8FA 2HJGA 4Z7JA 2ZAGA 5E0OA 5KYVA 5JECA 1DEXA 4MUMA 4FFPA 3D6UA 1SVNA 4YCSA 2FJ0A 1YZHA 2UYGA 2P5UA 4V2IA 3IPYA 3PEEA 4P7KA 1ZH8A 2L42A 3BK7A 2AN5A 3R3YA 3HJCA 1OZFA 2EJVA 1AKVA 1JECA 1OASA 3GBPA 1WHTA 1SK9A 1NNUA 4LKOA 5EWMB 3WLTA 3ZQUA 4FU0A 2I4MA 4N0QA 1E0AA 2XODA 1R74A 1W19A 2MT9A 3PSFA 3LS2A 4O4HF 1UBFA 2WY2D 5DGHA 3NDJA 1P1IA 4LCEA 4TQRA 1SD5A 3JR3A 4UU8A 2AB0A 3D6HA 1GJRA 4XDYA 3G59A 1PIWA 4OHKA 3ZY6A 5F5LA 1J0BA 4MS1B 2PA0A 2X0EA 1PNRA 4YFYA 3BAFA 2FMKA 2WKPA 3QVLA 1QYVA 4LJSA 5LLTA 1K5GA 3KEOA 4P58A 2AJBA 2YJNA 5IPFA 4HWPA 5DM60 2Z4RA 2W04A 3O4IA 5E4FA 4BKRA 4K9LA 1XJWA 2WMNB 1RSZA 3WZLA 2JCSA 4CG0A 4DC9A 5F2OA 1OJ7A 1OYVA 1QE0A 1MU0A 1J7KA 1SC6A 4H1TA 3PW0A 2DBYA 1BO6A 5C37A 3PUIA 5I51A 4BC0A 3K6SB 1ES9A 1E9EA 4KLIA 1C14A 1OKKA 1YS7A 3GGSA 3G5MA 5DBAA 4D3XA 2H3HA 4H7FA 2KQUA 3HXTA 3TFQA 3V46A 1VCIA 4BYGA 4QBFA 1SY7A 2NU8B 1DXQA 5LQJA 2C5BA 2HMUA 4KPUA 3RUCA 4AJKA 1UWCA 4KLZA 1HRKA 1WUKS 4BNDA 4M0DA 5LOVF 2HR1A 2OVBA 3JQFC 2EKLA 1F2UA 4M1YA 4Q3OA 5JHGB 2W22A 1IM4A 3ALRA 4CDRA 4CV3A 2B7LA 2BGGA 1U7OA 3LHIA 5GGXA 3BJZA 3TSYA 2VT6A 5D8DA 1Q1EA 5JSYA 4W4TA 3WHIA 5DOVA 1R1DA 2O1SA 1E3WA 1V41E 4TV9A 3IE0A 1I80A 4B9UA 4QNMA 1KWKA 2ZJ5A 2GLUA 2WJ6A 3QMMA 2YOHA 4DUYB 2Q3MA 4R1MA 1WUYA 4EHKA 1D8TA 1U7XA 4D9CA 1E58A 3BZWA 2Y9TA 3WQBA 3DZDA 3HWWA 3EZ9A 2J0EA 5EFOA 5BSTA 2X0DA 1FFXA 3KLBA 3RBXA 3QUBA 2OHFA 2PS9A 1QRUA 2Y0PA 3ODGA 1CQWA 3PFWO 3PIRA 3TQOA 1TIKA 3DE7X 4RD4A 3VSCA 2JATA 3S1LA 3H4MA 1QKIA 4XIGS 3T7EA 1BTOA 1D9ZA 1EX1A 4MZXA 4OGWA 4RELA 1SOVA 5DGIA 4J0EA 3DVAA 1KEUA 2D5LA 3WL5A 1Z19A 3UG7A 3D7KA 3MCUA 3W2TA 4B44A 1CUUA 3BD7A 2BIFA 3INRA 1RYFA 2AF4C 2O23A 3L7IA 4RIEA 1JIVA 4XUDA 4Y2YA 3W2FA 1JSRA 1XZAA 3PCRB 4UXIA 4ZC1A 3MEQA 4R54A 3UT0A 4Z6FA 3FMOB 1ZQ1A 4DFMA 2BF4A 2WUFA 3MT0A 3O2QB 3KYDA 4ACAA 5AJUA 3T38A 2DUUA 3EZFA 5MFZA 1MZPA 5A0FA 1WL8A 4UB6U 1CHDA 2GCOB 2WQ7A 3ZWXA 2VA8A 2VK4A 1AV6A 1MC5A 1OROA 2ZRGA 4XH9B 3VM6A 1ZGAA 4LDAA 1I7DA 3GT7A 3H1EA 4RVOA 3HYNA 1VKZA 2Y1XA 3OEHA 1TU4A 5KWIA 4KLQA 3BMQB 4DLSA 2BR3A 1XU4A 2G9QA 3U7FB 1VMAA 1C8VB 1F1JA 3TQ1A 3PQ3A 1ZD5A 1E2NA 2PTGA 3RWBA 4M0LA 3WNBA 4LXHA 2RD2A 3HJFA 3AF1A 1NLYA 3FSGD 3MOSA 3O83A 1Z00B 4PIVA 2OCBA 4OLAA 2HFJA 1S1CA 4N0MA 2PCJA 4UBCA 4RHTA 1EFRD 2F64A 3PCXA 2P75A 4HDCA 4K6HA 4M37A 4NBWA 3STYA 8ICXA 1FNMA 1W0CA 1Y6QA 2AD1A 3HCRA 4HDOB 3W8EA 4ZK6A 4LJRA 9ICXA 3EARA 5G0UA 1K7EB 3UA3A 2SKCA 2O3JA 2O2XA 2AFIA 5TMDA 5L95A 3ZVKA 3EQ7A 3DWFA 1TU3A 5AW0A 1CQIB 1T6XA 4LYJA 5IHPA 1KQ3A 3HYLA 4NP6A 3VZSA 3RUPA 2HVIA 4RTOA 1RHKA 4BQOA 5JCPA 1EXVA 2QRLA 4D9HA 2GS9A 1M6VA 4WY5A 4DPKA 2ZE7A 3WVNA 3OJEA 8ICSA 1ISSA 5EE5B 1BJTA 1W4AA 2GPYA 2H85A 3AMZA 2HJRA 5JAPA 5HQTA 3FPSA 2Q4BA 5CA1A 1LWNA 2RGWA 2XMSA 4FGZA 1GPKA 1VQ1A 2BCJQ 3L02A 3K9WA 3MS4A 2QYOA 1XF9A 3EK2A 4F46A 1UMKA 2G9RA 4AJJA 1A3CA 1V9CA 1VJTA 2H51A 2QMOA 4J3FA 3MA0A 4BMDA 4XWYA 5KNBD 1KARA 1H2XA 2ERYA 2YRFA 3WGJA 3ZW9A 3NIGB 1FBTA 3T3EA 3ZD9A 4YHHB 3JRNA 3JAMA 2JDIA 3WKCA 3THWA 1RS0A 1QFMA 1Z4KA 3WBKA 1G4UR 1ORWA 3M6IA 4XCVA 4QO8A 3CJQA 4TMKA 2C5FA 1H1DA 2QY6A 4G85A 4WZAE 2R96A 3C8MA 5DN6D 1EBBA 3KD2A 2VK8A 1ZK1A 1I2CA 3PITA 3QKTA 4WTOA 5I9TA 1ZYQA 3F6BX 4ZOCA 3M6LA 4QZCA 4HTFB 2QL6A 1VZ3A 2E49A 5BR4A 5L4SA 3L0PA 4DEZA 4QJ3A 1DIOB 2GZ1A 1S2NA 1K9VF 3P2IA 4BKOA 5EMNA 2AN1A 3PC8C 3SYMA 1SXJD 4KR6A 3HDGA 3N2LA 5KQSA 1G8YA 1QFZA 4CEJB 1ESMA 1JDJA 1UKVY 2OBFA 2M6SA 3IVXA 4ND8B 2PSEA 3IV6A 1PW5A 2O52A 1U7DA 5ICCA 2WHEA 1LK5A 1MXFA 1VC2A 2IHVA 2Z9DA 1RJWA 2UU9B 3N8HA 3AVYA 4O4JF 1G6OA 4H0FA 1ZK0A 3K5PA 1CJTC 1TADA 3L1JA 4HYTA 1N33B 4R1UA 1MOSA 4JU9A 4M76B 3W5BA 2NUTB 4IX1A 3SNHA 3X43A 1NOKA 3P4UA 3U6KA 5CNIA 4GOLD 2W7PA 4Z3OA 3TLJA 4Q16A 3EZ7A 1ECWA 3A3YA 4KU4A 1QGUA 1HTTA 1CEQA 1CZUA 1E4EA 3K4HA 4ES6A 5GWXA 1IJEA 4JJ4A 2BM8A 3AP3A 3AFNA 1KLNA 2FHPA 2Y2UA 2XRZA 2C88A 1BNPA 2YJGA 5BR8B 1S5LU 1K89A 3F2CA 1M34E 3F46A 3A70A 2OXTA 4ZAGA 3LWZA 1I1NA 3D1JA 3L04A 3TQCA 2MOKA 2MYUA 4JWMA 4KLDA 1EGHA 1VLJA 4J9LA 2XRYA 4KC0A 4QQ8A 1MHPA 2OXIA 4A27A 3R7LA 1DU4A 2VZ9A 2V58A 2PSDA 3TKAA 4YAJA 3PDWA 1FYXA 3GLIB 4Z4QA 3LT5A 3W8FA 3WGIA 4LVCA 5HQ3A 2IHJA 1PX2A 3JPOA 2J09A 4B9VA 3CEMA 3LXUX 4YA6A 2V4RA 1L4FA 4IGKA 3FTCA 2XXBA 4HSGA 2PSJA 1IWOA 2C5EA 1CJCA 3MTBA 3OZRA 4E0DA 5DGTA 2PJDA 4RKEA 2XYHA 5DNVA 2PWPA 4F92B 1MO3A 4BTLA 5KU7A 1EWYA 2NRVA 4D3SA 1V71A 1XC9A 3GU3A 4O4IF 5CPFA 5JS1A 1RRKA 3GL9A 4WY2A 5DI3A 3ZDCA 1YAHA 3T5BA 4QDXA 1KH1A 4MUIA 1SOMA 3R0IA 2B1RA 3SZ2A 2CD7A 4Y2GA 4ZN6A 2VJNA 3L8HA 4D4HA 3E2IA 5C4IA 4DR4B 4KLRA 4QDUA 1ZOIA 4R1TA 5LPNA 1N5OX 3I9KA 1RHQA 3WISA 2B1GA 3AUTA 2QMUA 1UOPA 2VJ4A 2Y6UA 3UJNA 2ZWIA 3W2EA 4DSEA 3K2EA 4V0SA 1C4XA 4D8XA 1C1XB 2O7NA 1J0EA 4J9OA 4UNNA 2OQ2A 1IUNA 5HJEA 3QWFA 4I55F 4S1NA 5AXAA 4NY1A 4MKXA 4S1VA 5EHGA 5LZ9A 5IH3A 1JILA 2ZSAA 3ZVNA 2BFFB 3G68A 3ODPA 3H0MB 5T3UA 3NFYA 4JYMA 3EPHA 3H9EO 3IAS1 1Z33A 2UKDA 3FOBA 3KE8A 1NQXA 4PZPA 1GPDG 4UM9D 3WB0A 1MJGM 4ZZ2A 2V6JA 3FD8A 4MGYR 2W0MA 4ZYWA 4KXQA 1Z00A 3HDTA 2IIPA 3FDSA 5K03A 2VJAA 2YYZA 3IO5A 4K9SA 4BFCA 4DLZA 3F9RA 2ZUSA 2JPDA 3BMQA 3DM5A 4MKFA 2DUMA 1KSGA 2KE7A 3WKEA 3W7AA 4DQVA 4H6PA 2IY9A 1N5MA 5EKXA 5KT5A 4NXZA 1EP9A 1RQ2A 1TM4E 4UZSA 1VLMA 4MVYA 1WJGA 2UAGA 1SXPA 4IKPA 3RSHA 1CZKA 1GTVA 1WETA 5IP5A 3DAOA 4PSCA 5CNJA 5U4XA 1QH1B 2KJQA 5KTNA 3D0QA 3LK6A 3C6XA 3OOEA 1QMPA 4DCTA 4G4SO 3TG8A 3SDBA 4I5GA 1T4CA 3L18A 4PX9A 2JLVA 5M2QA 2LNDA 3KOOA 2IP1A 1FP1D 2YS6A 4B3TB 3K0KA 3KDPA 3MTEA 3ZE9A 4BQSA 3I09A 3RNOA 1BS1A 1T6BY 2C20A 3QOWA 1H8ED 2SCUA 1MC8A 4K9PA 3ZBUA 5AM1A 4ZOBA 3RTCA 1PQWA 2VRNA 1E3SA 4LZGA 3THXB 3HCEA 3EAQA 3AIOA 3CN7A 3PL5A 3ABRB 4X64B 2FZLA 1EYZA 4M2YA 1KJ8A 2BI4A 5KVAA 1G4AE 2ISQA 3FDFA 2QRGA 2EJWA 2ODTX 1NONA 4FYKA 2R6ZA 3R6LA 5C34B 3DZJA 3NVDA 4UVHA 1JKJA 1MN6A 5BOMA 1RI5A 4CKCA 9ABPA 3EVCA 3CZRA 1EXDA 3AVTA 4RCYA 5AICA 3UHOA 3LUCA 3PDUA 3LWBA 4UOZA 5JFGA 4UB1A 1VL8A 2DCMA 4JMPA 3JVIA 2DBVO 5IAAA 5K8IA 3AWDA 5DLPA 4Z51A 3GYBA 4KLFA 4HI0E 4HGRA 4OLHA 2VK2A 1AKUA 2I80A 3WBJA 2PZLA 4F38A 3LL4A 2BM0A 2Y1FA 1P1CA 1UBJS 1E2LA 3B2NA 2GJ4A 4A03A 3HW8A 3NOOA 1JYFA 1BXRA 4KI7A 4BBJA 3KSRA 3WDSA 2EWVA 2G5GX 2KSQA 1KFSA 3CWCA 5EERA 2HSZA 4C7MA 2F1JA 1IXRC 1P91A 1PJ3A 2JK0A 3ID6C 2SICE 4RD6A 3K94A 4P08A 2FPUA 4F85A 2O7VA 3HLTA 1SZPA 1F17A 2A0YA 5I7UA 1DGJA 2EKPA 4Y9UA 4GPIB 9ICFA 5EZQA 2BZ1A 5KDLA 1NL3A 2QPTA 2W6CX 3W6OA 4KQKA 1R16A 4BJ6A 1YB7A 3SLKA 3NHAA 5IDVA 2RHDA 1KDVA 3OECA 4G8DA 4CM9D 1Y5MA 4ZIRB 3LQKA 1P2TA 3MDCA 1RXCA 3LFUA 2YQZA 1GU0A 3RS5A 4ZQFA 4C22A 4FYWA 5HJ2A 1Y9EA 4FDTA 4JC5A 1XEAA 2FKAA 3GXBA 3IT3A 2IXTA 5HIIA 4ZOEA 4PQGA 1NTRA 2HA3A 4CFZA 1A0OA 1Y37A 2IEIA 3K9QO 2WIBA 1FOEB 3FNIA 5DN6A 2WAMA 3KKPA 3ANLA 4GC5A 5B58C 1SWVA 3IILA 5TT0A 3GDXA 2I4RA 4N3NA 3SEAA 2QTMA 3RRXA 1WABA 5GONA 1GARA 2IZ0A 2R8XA 4F5NA 4M1EA 4P3XA 4MX8A 1I33A 3F96A 3V7YA 4BMPB 3ZHRA 4YXWD 3K53A 1RE1A 1XMSA 3K8OE 1OSNA 2ZR8A 3RR2A 2BFBB 3C70A 2RJNA 2VZ8A 3UAYA 2FMHA 2H0QA 1T2CA 3GWZA 3JPTA 2BPFA 2QUBA 3QV1A 5I7HA 2XA1A 2JK1A 5KFWA 3B1VA 2D1RA 1PS8A 2MR6A 3DJYA 3RYIB 1E79A 2WMDA 3K0AA 4HDMB 4W9NA 1GUBA 4FKZA 4BP1A 4MW5A 4JYBA 3FLAA 5ALMA 3X44A 1J1UA 4YFKA 3KCNA 4DA9A 1N8SA 1SUPA 4HXFB 2YV4A 2Y4OA 1CG6A 4QG7A 4UB8U 1I4LD 4FNMA 5ARDA 3T99A 3CWQA 5KHLB 4D44A 4ENSA 2O5EA 5JAUA 4NR0A 1UH5A 4YRTA 1KR2A 1NI5A 4INJA 1YZ6A 1LRKA 3GT4A 3VFDA 5IAKA 2YXLA 4YP7A 3UJ6A 5L4LA 3LX6A 5JVDB 2WA2A 1X94A 2CJYA 2MRLA 3VZQA 3FTQA 2R6JA 2C98A 4LSZA 2IPOA 4AJEA 4XVCA 2OHVA 4XGKA 2P1DA 1X6IA 2FOXA 2N47A 3CWZA 5DF1A 3EA5A 1L5RA 1ISHA 4J90A 4UBJA 2DFVA 2SNIE 2ECQA 2VLBA 2AFHB 3MW8A 3U0BA 2QDKA 2RHLA 4BGEA 1U0HC 2H54A 2WOJA 4P84A 3EDOA 2CLLB 4R1OA 4B7CA 2XICA 1AKWA 4OQPA 2VTBB 4ECUA 1D1PA 3BGSA 2ODAA 1HG1A 2PYIA 3OF2A 4GDMA 1PJ4A 4CLOB 1R0WA 3I9JA 3I9MA 3OJLA 4NICA 2ZTEA 4V02A 4BLTA