2WFAA

Structure of beta-phosphoglucomutase inhibited with beryllium trifluoride, in an open conformation.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wfaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wfaA01
3FPSA 1AQ6A 2P11A 3KDPA 4GIBA 4KNVA 1Z4OA 4UMDA 3FGOA 2B8EA 1Z5GA 1Z4QA 3FVVA 2FDRA 4OFZA 3ZX4A 1WR8A 2G1AA 2FPXA 2Q5EA 3SKYA 5AIBA 5AKXA 5ALXA 2GHQA 5A3RA 2IA5A 3ZI4A 5AVQA 3MC1A 1Z4NA 2R8XA 1TJ3A 4FYPA 5AVUA 2OBBA 1YV9A 1Z4IA 3EF1A 4YCLA 5ALJA 1CR6A 2MSNA 4F72A 1L7PA 3ONNA 3NANA 4BX0A 3AR9A 1Z88A 3E58A 4C4TA 2YMPA 1WPGA 1ZRNA 4IG4A 4UMVA 2CFTA 5AI4A 3NAMA 3ED5A 4FE3A 1QH9A 2WM8A 5ALGA 2JGAA 3B8EA 3NALA 4NFLA 2C8LA 1XP5A 5ALLA 3NASA 5IS2A 1RLTA 2X4DA 2MU1A 4AS3A 4UMFA 2HO4A 2EAUA 2HOQA 1T5TA 3PCTA 4EX7A 3ZTWA 4I9FA 1VFPA 5AW1A 1Z4JA 4OHFA 2ZXEA 5ALSA 3PDWA 3SD7A 3I1YA 4EEKA 3B9RA 1O03A 5ALPA 4EZEA 2WF9A 2CN1A 2JAOA 1RRCA 3QU5A 4J03A 4Y2VA 2B1QA 4Y2XA 2HF7A 3W5DA 5AKKA 3FZQA 3WKDA 2O9JA 2WF8A 3ZU6A 1J8DA 1RMYA 3SKXA 3I28A 3U13A 5AM2A 1U7PA 2PQ0A 2B1RA 4Y2RA 1K1EA 2NO4A 2EARA 5ALYA 4ZEVA 1LVHA 3QU4A 3L0CA 3DAOA 3WK7A 2HX1A 4C4RA 1YDFA 4L57A 3IRUA 1TA0A 1RMTA 5IT4A 3L7YA 2G06A 4CF4A 2FI1A 4DCCA 4YCNA 1S2OA 3AR2A 4G63A 1TJ5A 1WVIA 3QUTA 4JDPA 3AR4A 3L1VA 2Q4RA 1MH9A 2I33A 5ALZA 3OCUA 5AKEA 1N9KA 3ESRA 2B0CA 2GO7A 2ZBGA 2RB5A 5AI6A 3HYCA 3OCVA 3SHQA 5AI9A 2WF7A 3OCZA 1L6RA 4Y2UA 1Z5UA 5AM0A 4YCMA 4Y2TA 4YGYA 4Y2YA 3EPRA 4J2TA 1U7OA 2GHTA 2IOFK 1YJ5A 3ET5A 1ZOLA 2D2VA 2I54A 3A3YA 5ALIA 4B6JA 2FPRA 2R8EA 1L8LA 1T9ZA 3E8MA 3L1UA 2RAVA 2I34A 1QQ7A 3NRJA 2HHLA 3ZWKA 2ZOSA 3QUBA 3AR3A 3WK9A 4DFDA 2R8ZA 3DV9A 3ZVLA 3W5AA 3BWVA 5ALMA 1ZD3A 2NO5A 1RLOA 3N8GA 4CNQA 2QLTA 4E88A 5FP0A 2G09A 1RKUA 1RQNA 4UARA 3ZUPA 1RKVA 2CFRA 4FFDA 5AVYA 3WKCA 4UASA 5AM4A 2OM6A 3MMZA 2I55A 3ZVMA 1L7NA 4UW9A 2YJ6A 3QUQA 3BA6A 1TE2A 4UM5A 3OTQA 2JAWA 4KNWA 4BNDA 1Z4MA 2JARA 5AVTA 1VJ5A 3L8HA 3ZTYA 3OCWA 1RDFA 4HGRA 3S6JA 1NF2A 5AW4A 2NYVA 2IOHA 4Y2JA 2B8JA 1ZS9A 1QYIA 4KX3A 2G08A 1NNLA 4XPZA 3WGVA 3A1DA 3ET4A 3PGLA 1EK1A 2B82A 1QQ6A 3QUCA 2HF2A 3SLRA 4IFTA 1XPJA 1WZCA 5AW0A 2QYHA 2I6XA 1ZJJA 1YNSA 2FPSA 2IYEA 3B9BA 5A3SA 4HGQA 1S8OA 1U2SA 4MWOA 4Y2SA 4XOUA 5AK5A 4XE5A 5AVSA 4KX5A 4QJBA 3U7GA 5AKJA 5ALRA 3AR6A 3NUQA 2I7DA 3R09A 4KYTA 5ALVA 5AKYA 3P96A 4NABA 1PW5A 2YJ3A 3IB6A 5ALQA 5E0OA 4AP9A 2FUCA 4G9BA 2DQSA 3J7TA 3ZX5A 3ZVNA 2W43A 5A3QA 4HGOA 4EX6A 5T41A 3E81A 3I76A 4MUMA 5AW9A 2ZBDA 3UMCA 2R8YA 4BNDB 3U7EB 1SWVA 2WHEA 2ODAA 1EK2A 3L0BA 4O8CA 2P69A 3L0YA 4Y2QA 5AW6A 4CE6A 1RC8A 2HCFA 1X42A 5AW3A 3U7HB 1YS9A 3HLTA 4YIHA 4BX3A 2O2XA 3QU2A 1JUDA 4BYGA 1TJ4A 3MPOA 2IOFA 3UMGA 4UU0A 5AW5A 4UATA 3AR5A 3WKAA 1QQ5A 3W5BA 5ALDA 5ALOA 5AK4A 3N1UA 1YMQA 2HEGA 1XVIA 4CF5A 2AMYA 2G80A 4YIKA 2B30A 4F71A 3PGVA 3WKBA 4BBJA 4Y2PA 5AICA 5ALNA 3KC2A 4HGNA 4NAVA 3A1CA 5AVZA 4BX2A 4DWOA 1ZD2P 3SF0A 2Q4TA 3TLMA 4BEVA 3WKEA 2BY4A 2P9JA 4UAUA 4PNHA 4UU1A 2ZBEA 5AKLA 5ALHA 4BEWA 2AH5A 5AK3A 5AM1A 3UMBA 2YN4A 1CQZA 3IJ5A 4HAIA 3QNMA 5AIAA 5IT0A 4UM7A 2C9MA 2P27A 4L6AA 4OCZA 3ZW7A 2RARA 3EF0A 3M1YA 1RMQA 2GMWA 4HGPA 1J97A 1U02A 2FPUA 5AVXA 1RQLA 1N8NA 2G0AA 3L8GA 3ZWDA 3QU7A 3L8FA 4H1WA 4C4SA 4ZEXA 3SMVA 2W4MA 2BDUA 3N5KA 2PKEA 3W5CA 3D6JA 4Y3UA 1RKQA 2BDEA 5AKHA 5ALEA 2AGVA 3QLEA 3N07A 4NWIA 1Z4KA 4UAVA 5AW7A 3MN1A 1RLMA 3WGUA 5AKZA 2CFSA 3QYPA 5AKGA 3U26A 3F9RA 1FEZA 2GFHA 1ZD4A 4JB3A 1T5SA 3KZXA 4NV0A 1F5SA 2YJ5A 4EELA 5AK6A 1Q91A 3WK4A 2WF6A 4AS2A 4GXTA 1O08A 1Q92A 5ALTA 2G07A 2WFAA 1L8OA 5JJBA 4RETA 1VJRA 5AI0A 3I6BA 1U2TA 5ALKA 3E84A 3AR8A 3NIWA 2YJ4A 3L8EA 4UMEA 3RFUA 2MU2A 3CNHA 4DW8A 3VAYA 3OCYA 4EENA 2ZG6A 1Y8AA 1KYTA 1SU4A 1RPZA 4RESA 1NRWA 3QX7A 3U19A 5AI5A 1L7MA 2YMMA 5ALFA 5ALUA 3M9LA 2C88A 2C4NA 3UM9A 2ZBFA 5AI8A 3R4CA 1ZRMA 4BKMA 2YFYA 2PR7A 1LTQA 4KN8A 5AW8A 1IWOA 2VKQA 2YY6A 2W11A 3QXGA 3WK8A 3EWIA 5AKIA 1SWWA 4I9GA 2RBKA 3CZ4A 4OD0A 2FEAA 4CF3A 5AVWA 3WK6A 3DNPA 3RF6A 5AESA 3OPXA 4XQ0A 2EATA 2WF5A 3QU9A 1L7OA 2HI0A 2HDOA 3L5KA 3R9KA 5AW2A 4QQFA 2YBDA 3QGMA 2C8KA 3K1ZA 5AM3A 1Z4LA 4L6CA 2YMLA 3OCXA 2OYCA 5AVRA 2FUEA 3ESQA 3KOOA 3A1EA 3N28A 3FM9A 3WK5A 1ZD5A 3DDHA 5AHXA 2OA0A 1Z4PX 2HSZA 5AVVA 3AR7A 4ZEWA 5AM5A 2AUTA 4YH1A 3FPBA 3KD3A 2YMQA 3U7FB 3GYGA 2FPWA 2JAUA 3KBBA 4HYTA 5ALWA
chains in the Genus database with same CATH superfamily
2Y1EA 3CEJA 1RQ7A 3RYHB 3TQOA 3LC2O 2IU3A 4NC9A 2B34A 1K6XA 2IV3A 2IIPA 3WNZA 2OO5C 5AIBA 3AG5A 2E87A 1P2TA 5CGQB 4PXAA 3E4CA 4DG9A 1NATA 4LECA 1RXUA 5KG4A 3FAHA 5SY9A 1GEEA 4ME6A 2UYYA 4AZVA 5CDSA 4YAKA 4D8VA 1JROA 4KACA 4X65B 1XP5A 1W8IA 1DTWB 3OFNA 4LZAA 1Q0ZA 4BNJA 3VOBA 5B1HA 4ZYYA 4PZ9A 1PZMA 4LY9A 4XCVA 4X84A 2Z1DA 3SYRA 1E3JA 1G5FA 5FWDA 2XDWA 4RJJA 3KTQA 2EJUA 3AOEA 2VI5A 1KZ1A 4DMCA 1ZIYA 2ZIXA 1F4PA 5BMVA 3D2LA 1AV7A 3IJEB 1LSUA 3R8XA 5TY0A 2ZZKA 3D3KA 1B8UA 2HHHB 4DIMA 4EGSA 1AHHA 1OBCA 5FT9A 3U6KA 1X8KA 1LBHA 5GOZA 4PIPA 2I33A 3B1WA 2NPFA 4GLBA 4EA8A 2DR3A 4YWJA 2B99A 2I2XB 4LRYA 3BZBA 1US8A 4EA6A 3R7FA 3RVPA 1FNBA 1PWXA 3S3TA 3M2TA 2MCFA 1VYTA 5BWNA 4UTVA 4Z5XA 3HE3A 1YU6A 3GVIA 1RXWA 4MA5A 5DM0A 4QRHA 1BE6A 1KN5A 4RORA 3SX2A 4G0WA 3BA6A 3RK0A 1DUSA 1SOVA 3QTBA 2RE8A 3GGPA 1WHTB 1ZJYA 2Q0XA 3P8ZA 4INOA 4BNYA 3U1VA 2IIVA 1HBJA 521PA 1YU9A 4JR1A 5CIYA 3CVVA 1CI4A 1TKRA 2RHTA 1LPSA 2B82A 5IH3A 1D2CA 5A6SA 4JQCA 1IXRA 4X44A 1CFJA 4U7TB 1KP3A 4B81A 4GBJA 3KB6A 1GLGA 3QBDA 2NVBA 2FRXA 4UEQA 2FMPA 3RH4A 3IH5A 3BMOA 1T3SA 1Y5IA 3NBMA 4YAOA 1AJEA 5AXBA 2NZVG 1AKEA 4EY8A 4Z6CA 1Q84A 2XVZA 2JIBA 3MJFA 2XEDA 1WM1A 2ZBQA 1VMEA 3VI3B 3P9KA 2D4AA 1Y7PA 4WLUA 4JYPA 2AA3A 1JMYA 3QYFA 5K6AA 2BKEA 1ZD2P 5EI5A 1SUPA 3ZHOA 3BX1A 4NCHA 1KWKA 3HR8A 4CUJA 5HMLA 1XRMA 3QVUA 4OSEA 4MYHA 1C4XA 1YS1X 5DB6A 4RQAA 3GAZA 2GPNA 2CYCA 4U9HS 4WASA 2ZR8A 1X19A 1QCDA 1L7EA 2V7BA 2BSQA 3HPRA 4RHYA 2ZANA 3PWKA 2ID4A 5DSXA 2A30A 5B7NA 2PGJA 5HQJA 2DFLA 3NGDA 1GUBA 4CUZA 5HF9A 1QC5A 4PPYA 2P9EA 3THXA 2XXJA 4EFKA 3Q3HA 1P2DA 2AG1A 2QSUA 3FCCA 4GLJA 1M75A 2IEGA 3DXYA 4WK2B 3GAMA 1E6CA 5LYYA 3A6DA 2AFVA 1U2PA 2KV2A 1JLMA 4DNFA 3ND9A 2Z6VA 3EFHA 5L7YA 3V7WA 2K4IA 1HM5A 2FZGA 1ULAA 5GM2A 3ZEAA 1PCXA 2KIVA 1X9MA 1XZCA 4E51A 2VYFA 5ELXA 1SO8A 2HHSA 1O8BA 1ULSA 1AKVA 5T7BA 2QDKA 4ZAFA 3W2TA 2VH2A 2ZWVA 2AZMA 3HPOA 4QPDA 3VPAA 4WKCA 2RJ3A 4PAMA 2EFCB 1OZFA 4KE9A 1DADA 3C74A 1LSSA 4ZYXA 3VZRA 4BX9C 1HYEA 2Y9UA 3J81j 3HW8A 3FPSA 3RBVA 1JTFA 1Y1LA 4JVNA 3OY7A 2GYWA 3DPUA 5DP1A 4Z6EA 4V03A 4EKGA 1TEHA 4KLGA 1ID8A 2AC2A 1GTVA 4CLHA 2QRZA 1ZCJA 3GGDA 1VL6A 5C37A 3TD2A 1Z06A 1KAMA 1YH3A 4F5PA 3O38A 4E1VA 5CJ2A 1GTRA 2D5BA 1D1TA 3ZCQA 2OFOA 5BUZA 1GRRA 1Z6YA 4G4SO 1UPXA 2QROA 4WVLA 4AUEA 3W2IA 3R7WB 2QUKA 3FNQA 3WLMA 5KVAA 3D81A 2Q6LA 3A10A 1DAHA 4ZIRA 2OGWA 2VUSA 4KAAA 4XM1A 5EEHA 4HD8A 5F4ZA 1G16A 1NHGA 4TV8F 4LWQA 1I0ZA 2ZS9A 4MW7A 5IAJA 4OK6A 2NMVA 4C88A 1PK8A 4IQFA 3FTEA 5EIHA 1UR5A 5K8TA 3CWZA 4ZYTA 8ICIA 1UXGA 4ZVPA 4Q4AA 4ZEVA 2V54A 4KQ2A 4AT1A 1BPYA 3D6HA 1QRDA 4MKGA 4K46A 2AXQA 7ICVA 4AD8A 3UFXA 5LZ5A 1T8SA 2GBLA 3EZ7A 2O2DA 2A0WA 1N9KA 5COBA 2FPKA 2XCTB 2PKCA 3THSA 3OPQA 1JP7A 4IRKA 3VNBA 1C8BA 4REQB 3H2GA 4W5NA 4DARA 3L7AA 1T1EA 1J1IA 1UDBA 1L5GB 4FYJA 1ZLXA 4XVRA 1WCLA 5G0TA 5KG1A 2H31A 3M3HA 5HE9A 3WFIA 2ZJ2A 3ZVKA 4CKEB 4X24A 3OTQA 3I9LA 5CU7A 4K0RA 2NU7B 1R4MA 2Q2NA 2ZBVA 3PF9A 4LV6A 2W90A 1A8PA 4AO7A 1GYRA 3RADC 4YRBA 4LF7B 2FGJA 4AAYA 5LQNA 2NV0A 3G89A 3BGOS 5EXDA 4UHHA 1W34A 2LKDA 1X1DA 3RTBA 2OGTA 1DBWA 4UXIA 1YNSA 1UJ6A 4XIGS 4JB2A 4KO8A 3C5CA 4XWOA 3LT2A 3SC6A 3DOHA 1RPJA 2KZMA 2JRZA 3CNOA 1SM4A 2YASA 4TS9A 4ZO9A 2YIJA 2GRAA 1J8VA 3M8SA 1V9PA 3CLSD 4NEHB 3VH3A 2WG0A 4N7JA 3STHA 1K5HA 2QTFA 4MQ4A 1BDMA 4G89A 4ZK6A 4CF5A 1UOEA 3PLRA 3HUUA 1F6BA 2A33A 1PNRA 1OH8A 1CY1A 1TVKB 5F1PA 1YDGA 5LNK6 5AKLA 3DZIA 4W9NC 5JBIA 1XF9A 2DCMA 2WUWE 4HH1A 1HYQA 3IV6A 4NYJR 4EQZA 4DM4A 1EFKA 4N3GA 2RARA 4EPVA 3SVZA 4S1VA 2EJBA 3D7MA 1OAOA 3KHTA 1UJCA 5KNCD 1I4WA 1C3LA 1D2GA 5IBCA 3RANA 1R4AA 3RRFA 5CLFA 4TUSA 1EFAA 3HP6A 1PFQA 4EZBA 4LJYA 1EGQA 2CLKB 1IHXA 2PGLA 2VYQA 5HP4A 4HUTA 3WLOA 1Y42X 3ZDDA 2EFDB 3LNCA 4Q16A 3ORHA 3VC8A 4FNMA 1GR0A 3F98A 2WF6A 3JPWA 2P4QA 1UCVA 1KS2A 2B4YA 4LRQA 3FLBA 3VPXA 4U6NA 4LEIA 1VJRA 1AK1A 3AXSA 1G9SA 1I2MA 3SJAA 5EQTA 1UZAA 3X2FA 3RC3A 2CXYA 1P9NA 4WKOA 4RKQA 4DLYA 5CB8A 5KVSA 1L7MA 1B76A 1XZIA 1UBNA 4Q05A 4YRSA 3AV0B 4IIVA 1ODFA 1QUEA 3TZLA 1G3IA 3FTDA 4LPKA 3ZGOA 1CBUA 1JWAB 2UYOA 3PVZA 1FP2A 1GXSB 3N7AA 2ORYA 5LU8A 2JHDA 2ZE8A 1CJMA 1P60A 4E3WA 2BAGA 5CB4A 4P7FA 1FPMA 3FPLA 1I2BA 1NTOA 4G3XA 1U99A 2D6FA 5LA6F 1DKMA 3ZNPA 2C0QA 3ILSA 1Z82A 2V65A 4I46A 2ZS7A 2DWPA 4AX8A 5L9XA 3TEJA 3QZ7A 4ZP1A 1OU4A 2QSJA 2VYNA 1QLJA 4JI0B 3CLKA 1U48A 3EDYA 4M0PA 5I3ZA 4O4LB 1T0JB 1TLTA 2QB1A 1CJVC 1TM5E 3GILA 3QRWA 3DWGA 2KZ3A 1YULA 2V98A 1M67A 4DR6B 4EH1A 1NKSA 4EJ6A 1E7RA 3DTYA 4J4HA 3G0OA 3ZS9A 2YWBA 4ARBA 3JYLA 1XDSA 3B1VA 3OH8A 3CF6R 1NNUA 1W96A 1CLUA 3C39A 1UM9A 3OP4A 3ZHCA 2F17A 4PG4A 5SYAA 5LKRA 2KYRA 4ZDWA 3BCUA 3O3MB 4LN1A 1VLVA 4H0NA 4AJLA 1ECWA 2GSWA 2OK7A 2C3MA 3SZLA 2HO5A 2RH9B 4O3RA 1FYFA 2R6CA 3M1LA 1MXFA 3QVGB 5DLYA 3OZWA 4GDMA 3RVLA 5DHAA 4N48A 3K1JA 5CA1B 1GUFA 1SOMA 4BKOA 4O5OA 1G0NA 1R0RE 4IDNA 2QE7A 3AR4A 2W6ZA 1QORA 9LDBA 3DMTA 1I4DD 3CBGA 3EPGA 1KKUA 2C2WA 1FMFA 4BVFA 3OX2A 2CNKA 2Y0BA 3MWJA 3PCXA 1BCRA 5BWMA 3PE3A 5CH3A 3Q0IA 3WLIA 4Q3LA 1I6KA 1G41A 2Z7JA 3QKRB 3PXBA 3ER8A 4RSHA 1N2HA 2I8LA 4L0CA 1NVFA 4CQNA 3BWVA 3FHLA 4IFBA 4XQCA 1GYQA 2XNCA 2IYNA 5KIAA 2F43B 1OXJA 5CYFA 3QTTA 3PDHA 3PUZA 3K73O 5DE3A 3EXG2 4RCVA 3KR0A 3QFFA 2AS0A 2WJ3A 2G3YA 3NM5A 1XGKA 3ILVA 4X7PA 1KR2A 4ESOA 1XMPA 1W5TA 4EHDA 2EBUA 3R5JA 4UHBA 2XADA 5I4KA 4DQRA 1O5TA 1FRQA 1VLHA 1YT3A 5BWLA 1SXDA 1T8YA 4Z4QA 5EWLA 1GNSA 1SOWA 5ALQA 2QZJA 5JC8A 4WEOA 3QBTA 9ICNA 4B75A 1IQUA 1MABA 1YS9A 1ZICA 5K3OA 1KIAA 5CGZA 1AG9A 4HWSA 4YQWA 2ZIUA 4I4IA 3K8YA 1T9GR 5SV2A 3RYIA 4PTYA 4JFAA 1N2JA 3JPSA 2A0UA 1ZSVA 2QDXA 3IMCA 1GTSA 3PY8A 3VBCA 5IM4F 4O63O 1XTSA 1QP8A 3ST7A 2IGBA 2GN0A 2DM6A 4IMPA 3ND6A 2QMHA 4PZNA 3MCUA 1V8ZA 2ERXA 2GMWA 3JASA 4JB8A 2YZNA 1FUIA 1X7YB 3I4FA 3M4XA 3CXUA 4G0PA 4GRDA 5ALEA 2P35A 1JQKA 4A8JB 5TQVA 4G26A 5G1OA 1SUIA 2VQEB 2DGZA 3OIDA 1RPLA 1T36B 4KGDA 4M0UA 3NRCA 4QGSA 3ZC3A 3HRDD 1G5HA 4BKUA 2OO5A 3PQCA 4BFCA 3D4PA 2V4ZA 2QVXX 3NDBB 1EXNA 5TV2A 2MUTA 3GRYA 3GJQA 2ZYSA 4CTKA 3OZRA 2OCAA 1TT5B 3PX7A 2YHBA 4OHWA 3VMMA 3GMTA 2VKQA 3EWIA 1XDGA 4B79A 1YZYA 1XU4A 3EPIA 4G56A 4NESA 5KQLA 4CPDA 1RLJA 3ELYA 1XT6A 3GGJA 2IZ7A 3DBLB 3SSNA 3VSEA 3SOPA 4K88A 1AKUA 1D09A 3MK31 4KMOA 1WUYA 3FPEA 2ONYA 2VT2A 4I6EA 4MSUA 1I1QB 3P9YA 4QICA 2W98A 4DL6A 4P0PA 2R44A 3E5MA 5K45A 1DKLA 3S7ZA 5HFAA 3TB6A 1U0BB 3ZWVA 4UZEA 4KXYA 4KLSA 5KX5F 4GBGA 3ZGLA 1Z0JA 3VR4A 4KR2A 2DR2A 2I29A 4RMGA 3PCTA 1CUCA 2G9RA 2FN8A 2XODA 5ALPA 4FK8A 5A9SB 3UUFA 3W1EA 4M9SA 4BO5A 5F2EA 1WSDA 2NYRA 3H9UA 3WLLA 1JQ5A 3EAGA 2ZUSA 2YWHA 2ZCJA 2VHJA 5F2NA 2KWIA 2PS3A 2FE9A 1HTBA 3ONFA 1NBOA 3SE7A 2PL1A 3EDMA 4OXKA 3PNMA 3Q98A 4V1CI 4E11A 5HRUA 1C80A 1LBQA 1KJJA 1QV6A 3SXUB 2R68A 3VJRA 4XCXA 2NNWB 2KE7A 3GEEA 3SKVA 3LPNA 2OESA 2FEPA 2CCGA 3F5EA 2VF4X 2HFJA 3DFZA 1CEYA 3GFGA 3PDCA 3RQIA 1JPVA 2A1JA 1XZEA 5CT5A 2I3AA 4OJMX 2JJ1A 2R8ZA 3MJVA 2JZBA 5ILGA 1PZXA 1C2YA 5HG0A 3BRWA 4Q03A 4BMNA 4M53A 1ZQLA 1A8QA 2JHPA 1XAHA 1BIFA 3K4PA 4F2WA 1NQUA 1U2EA 1QTQA 1YQ9A 3JQDA 4XLZA 4ZYUA 1RAIA 4OV6B 3PX2A 4G07A 2O3JA 4JT4A 4G4IA 4US2R 2JH3A 5D51S 2BHLA 4WPGA 4ZV4A 4C6RA 3NH9A 1XBTA 5DJ5A 3I01M 4DR7B 3A26A 2PH3A 5J2JA 3SHWA 1YA4A 3RRGA 5WRFA 3DEAA 2WMOB 4MV4A 4DMLA 1TPZA 1KRWA 4KLAA 4RS3A 4AJPA 4NULA 2BBTA 1U7XA 1QTMA 1U3GA 1MPXA 1P5JA 5DVZA 1KGDA 1F0NA 4KLNA 3OZIA 5G0WA 4KN5A 5JAHA 4JSRA 3GLVA 1GD1O 2ZSUA 2WTMA 1T25A 5ALNA 3VZDA 1RKBA 4PFSA 1HDXA 4ABTA 3FG9A 2BY4A 5CT4A 2XQFA 2IWHA 4Q34A 3B7WA 4DPMA 4LOKA 2QBYA 1E2LA 2FPUA 4G5XA 2YHIA 3IRVA 2Q62A 4JH0A 4TM7A 3LCCA 4MDYA 3N7SC 1FNSA 4MQ5A 5FKJA 3ZU4A 4PO9A 4H6PA 3RVDA 1I3MA 1FEZA 4HNVA 4QEKA 3K9FC 5CT8A 3UK7A 4HDQB 2BCGY 2DPLA 2YJNA 1Z36A 2LKYA 3KOZA 2FEOA 3BM5A 4KR0A 3V8MA 2WVHA 5JAIA 5LBTA 1D4OA 1QIEA 2BKAA 4LSMA 2COUA 4LZZA 3R4CA 3INTA 3L01A 3P45A 1L5ZA 4FB5A 2NT3A 1OW5A 3WRYC 2HWWA 1JHXA 2PWYA 3E9MA 2FN3A 5K0BA 4BOYA 1IY2A 5AW2A 3SXJA 4B9UA 4R8UA 4JV5B 2OCDA 3C5FA 3OX4A 2XQGA 2FLLA 3AHCA 1P7CA 1X0VA 3OPYI 3GLIA 4B9MA 2PFKA 4DGQA 1ISSA 5BYBA 2JAUA 5JBQA 5IXYA 3KBBA 4QPZA 1VE3A 4OX9Y 3KOWA 5DGTA 3HL0A 4NXNB 1NE2A 4XWAA 3IA7A 1B6SA 3E0QA 4I3GA 2QM0A 4CKWA 4CCSA 2FLNA 4O4HA 2Y1GA 3V3TA 1PVRA 2ZXFA 5HM6A 4UUMA 1VMAA 5KEIA 2WSBA 3KJQA 3AOEC 1GA4A 3DHEA 4HFRA 1XEWY 1Q20A 1NW7A 3T15A 3I01A 3BB4A 1SKSA 1V3TA 4CHTA 3T5MA 5EWMB 5K8JB 1X7GA 4AI6A 1D8LA 3AEQB 1RRCA 3N8DA 1VIVA 3MBIA 3R2JA 2FLKA 4XJTA 4NBTA 2LYBA 4LOLA 4KFTA 1IOWA 3C3KA 2HIAA 4E46A 4B0OA 5AM2A 4GC6A 3FFTA 2R1ZA 4AJJA 1BGWA 2HX1A 4Q39A 1VDMA 3GX1A 1WV0A 1SCAA 4QBIA 2I2FA 1EYZA 3DPSA 3LIIA 3A2KA 1VHJA 2FSIA 5CFLA 1TM2A 4EW2A 5MN6A 3UENA 5LCXA 2MSWA 3EWNA 1DT5A 4LE2A 2JJ2A 4A91A 1RI1A 3PUVA 4JC5A 3DBRB 4B6JA 1L8LA 2BGGA 2XSZD 2HK7A 3JS5A 1N0HA 2XUKA 1I80A 5F2KA 3R3VA 3MGGA 3COWA 1RAAA 1WXEA 2X1LA 4RY9A 4EFDA 2F62A 1EGVB 3T9FA 1I4EB 4Y0VA 4B43A 4C03A 4DLUA 2IYRA 4OHKA 4TKZA 4PVCA 1LLDA 4UM5A 4GVPA 4DANA 2QE6A 1QVRA 4JHLA 3F4BA 4BNGA 5IKPA 1U2GC 3E5HA 3BFPA 3VZCA 3KETA 2ECQA 4W9NA 3TJMA 4BUZA 2WKSA 3O9MA 2NN3C 4I81A 1L5KA 4FPXA 2I6XA 1EIWA 3X1JA 1RYYA 4CMIA 2ACEA 2OCKA 2QUAA 5ALRA 4XGNA 3VJLA 4ZV7A 4BLWA 2HHCA 3L4KA 1ZGHA 4AFNA 1T9HA 3S2EA 1DS6A 1J90A 3H83A 4EJ2A 2IUYA 5TC4A 4GKBA 2W2QA 2FB9A 4GR9A 2HCFA 4N8DA 3EZNA 3ZOKA 4OJLA 3L0SA 3QKSA 3STYA 2GZDA 3TE7A 4J29A 3MPUA 3RTDA 3SI7A 3ILHA 3KJIA 1V11B 2BWJA 2VG8A 3Q15C 1WETA 1F8UA 1D4FA 3FDSA 1E69A 3CB4A 3U3JA 7ICTA 3QE4A 4ZJYA 4WA8A 3C21A 2XGOA 2SKEA 3ZXYA 5IAOA 3F6SA 2WAQC 2CHEA 3TDNA 1TU4A 1GUZA 1VYHA 5CD1A 1WMAA 4RK6A 4H6WA 4QZEA 3KYCB 5KVCA 3PPWA 4BMXA 3BJZA 4PBSA 5CAEA 4IR9A 2DPMA 4O8ZA 2XA2A 4BFUA 3D3JA 4L74A 2EW8A 1NKTA 5DN6A 5E3IA 1KIMA 2EDCA 1LPAB 1XRRA 1A7AA 4MV7A 3VKWA 4ESVA 4BBAA 4UB5A 4ZOHC 3Q3JB 2OEPA 4V0OA 2JIZA 3P0EA 3QLJA 2BVNA 1E4EB 2FN7A 3BE4A 1Q46A 2CBXA 2HLDA 4GVLA 1SUWA 2GN6A 1EUZA 1U8EA 2VJ4A 3V2IA 2AXNA 1P17A 4X5VA 3RF6A 3GT4A 1J4AA 1OB2A 2XCSB 1EVEA 3TARA 1Y3DE 5H8WA 1D0VA 4Y1GA 4TYPA 2FMIA 3V6JA 5IWCA 4HADA 2KKPA 2FZKA 2CCKA 1HA3A 2NG1A 5DM1A 4Q7EA 3U9SA 4PYQA 2DC1A 1R15A 1AGPA 1CUKA 2K8CB 1YZVA 3ZIAA 5JVDA 3GH1A 3NZEA 1R5OA 2GASA 3OSUA 3WGJA 4RTNA 4UTPA 4N8EA 1F0MA 5FPQA 1KW4A 4I2GA 2H1VA 4HLDA 1PNQA 5DEIA 1Y6FA 3NJRA 3OE4A 3GLSA 4HAWA 4P3KA 2NUTA 4D0SA 3TPFA 1PT9A 4L02A 4AYWA 3OJOA 2Q1XA 1ZQBA 4G5FA 2QRGA 3C0KA 4F3CA 3CVUA 1E66A 2BMDA 3I9MA 3ZTWA 2J9ZB 3O8DA 1BXKA 2R66A 4ES6A 5EVCA 1RYNA 4D4GA 4EFLA 1TECE 2NPOA 2Q8PA 2XITA 1BN7A 2E8PA 1BD4A 1V47A 2MTBA 3FLMA 1E3LA 2FWAA 4RSGA 4TXNA 3MQ2A 1IB0A 4ZK2A 1Q0SA 3E2EA 2X9GA 3PSAA 5BN4A 4KUGA 1I0LA 3G2HA 5CVUA 4RNDB 1OCEA 3TNLA 2G7MC 1XSNA 3DE0X 1ODIA 4EG7A 2BGNA 2PX6A 3INRA 5FTLA 1NXSA 4DMKA 1ZQHA 4O5AA 4X0EA 2RB5A 3G7SA 1HOTA 2XNDD 4IVQA 3ZZ1A 2PKWA 4G84A 3RYFA 1S6YA 2D2VA 4OKIA 2C1EA 4RCZA 2WJPA 4DMMA 2HHLA 3QXJA 3PXCX 2CHQA 3HWTA 1X7DA 4F2HA 3RV3A 2C5GA 4CNQA 1AXRA 2VL7A 1KE2A 2B7BA 1X9XA 5KFBA 1MQ8B 5JS2A 2J5KA 4XVUA 2WYOA 2GBFA 2ZIWA 4KIGA 3M6KA 4TMKA 2FRVA 1KFBB 4BQOA 3H19A 1UH5A 1BVRA 1VECA 3SSOA 4E5DA 1A2QA 1F8XA 4UTRA 2XCLA 1VMKA 4IUYA 5T57A 4PQYA 5HIIA 5IVPA 2RJNA 2HPVA 3UPUA 4I2JA 5KMGB 4F4YA 2G77B 3OTWA 1G3UA 1EG2A 1YL7A 1QG2A 1JSZA 1NVKA 1H5UA 3KHLA 4NLGA 5KDDA 4MFCA 2OD7A 1O0BA 3KZKA 2FLWA 4ZOLB 2R84A 4J0JA 4DG8A 1AO0A 4RVCA 4HS4A 1OXBB 3C1ZA 3UMMA 3HO1A 2X5OA 1C4KA 2Y92A 3HCRA 3LP6A 2IH5A 1A5ZA 4JROA 3TLEA 2TS1A 3JQ6A 1DKOA 3V00A 1BEZA 3E61A 2QY6A 2ZTVA 4M7WA 2CHVA 4J49A 5EFOA 3A1WA 3DTVA 4C3UA 1TADA 3L8FA 2KM1A 3Q9NA 3TN7A 3WC4A 3PRJA 5L3QB 4PAWA 4LY3A 3UJ3X 4EJSA 3D6JA 2XF2A 4BMPB 1V26A 4BUGA 4Z7JA 1JTVA 1KMHA 3AJRA 1F4LA 4N54A 1D4ZA 8ABPA 2VC2B 3SZ3A 1Z5NA 1LVUA 3HCCA 5AK6A 3DAPA 3AEUA 4IHAA 5D85A 3OJEA 2EXXA 5D6OA 2CNWA 5HDQA 3VU8A 2PNJA 4RF2A 2JAQA 4PYKA 1RKXA 1SU4A 4M37A 1CYDA 2FSUA 3O91A 1X80A 4RKEA 1AXEA 3T1NA 5KQGA 5AJZA 1OTHA 5F76A 2YX1A 4O3PA 3W6UA 1IEQA 3KJGA 4RPHA 1VLQA 4R3UC 4FHFA 2Y4NA 1T1RA 3KVYA 3WK6A 1NBMD 2IDMA 4EZ6A 1YQGA 4J3JA 4O4IA 1IQ0A 4ZT7A 1Z5WA 5DCWA 4RTQA 2ZBUA 1XLUA 3UHJA 3B38A 4LF4B 3H2JA 1HQDA 4K86A 3WLFA 4XD7D 2VYND 2F9LA 2Y1CA 2QLLA 3QA9A 5EA2A 2ZYRA 2ZJ0A 3R5XA 4BXOB 4XR4A 5CCEA 2F9FA 3DULA 3HH8A 2XY6A 2FSSA 2ZJ8A 1IEXA 1JIXA 3OJSA 3BZCA 1U9YA 4XA8A 5DX1A 3WAKA 3AP1A 9ICAA 1ZVVA 4H4DA 2WT9A 1KL9A 4RF5A 1L7DA 4DR2B 3X44A 4PR0A 1BH6A 3NJ8A 1R8SA 1PI3A 3HV2A 2I4TA 4IQVA 4DBLE 3VHRA 2OXOA 1ML4A 4Q9HA 2Q07A 4UOEA 1U0TA 2ZK7A 3I6YA 5DBIA 3K9HA 3OX1A 3DE1X 2X2PA 2MSDB 2E1EA 4PWZA 1BDBA 3B3AA 4WY5A 4DC0A 3OBBA 4TT3A 1AQNA 5CX4A 3WBJA 3IRUA 1DQRA 2CXUA 3W6ZA 1XF1A 1L5QA 4HNQA 1YB5A 1KS9A 4KXMA 1V1RB 1T2AA 5FLEX 2WJAA 5KYWB 4BJHB 4JGGA 2CL6X 2PRYA 3O73A 1YR3A 1R6DA 3GA7A 4QXPA 1HYGA 1E58A 2X0DA 2C7QA 1ZQ1C 3H1EA 3OLCX 4YUXA 4X00A 4ZI7B 3MCVA 1J22A 3AHHA 2XT6A 1WCIA 5DYGA 3HHPA 2XW6A 3SMQA 2RSLA 3TCNA 4E31A 1N2EA 4JJGA 1O9HA 1RABA 2ZT8A 3V9AA 2BEWA 5G0SA 4HX5A 721PA 3BRSA 1T4CA 3OCWA 3L82B 3V1KA 4CHGA 2IOHA 1P1IA 2V9PA 2M9NA 2IPOA 4MVCA 2BISA 3TEFA 3UGTA 1Q95A 5LQAA 3X1XA 4BPBA 1POWA 3UXNA 3H16A 3GIJA 1B1AA 1KK3A 1UBKS 1U1IA 2GKSA 3IEIA 8ICKA 3IDQA 1U3DA 1XTQA 3ZG6A 1T6ZA 2W8BB 1Q50A 2F77X 1DDGA 4OUDA 1UK7A 2IF2A 4K6GA 3GUCA 3VHXB 2W3RA 3FCEA 2HMWA 4NTZA 3BQTA 4TLMB 2XA9A 3EQ9A 1ZUWA 5AK4A 1UC8A 2B1GA 2XVTA 4JCCA 5HSGA 2PWAA 1F2TB 2P90A 1PT7A 5AVZA 2P9FA 3U4CA 2X5JO 3RYCA 1CF4A 3P2IA 1YK0A 4FSHA 2RMKA 1P0QA 4YLGA 3FFAA 1ADGA 5F1YA 5KYKA 3TIVA 5BW4A 5H83A 3VJKA 4Y6SA 2LPMA 3ZDCA 1IUNA 1V4BA 4UTXA 5BSVA 3WRYA 2GD6A 2VJMB 4FX2A 1IK6A 2XBMA 1XPOA 2RKBA 3G49A 1YZLA 1E5XA 2VDPB 1DXQA 4NX2A 5LP6B 3R4VA 2L42A 3GJSA 2X3YA 2Q29A 2NXWA 9LDTA 3W6NA 1Z8DA 3SR3A 3BULA 3ORSA 3WO0A 2AGOA 1Q1QA 3BSFA 1K06A 5L7WA 1QAQA 1UP7A 3PD7A 2BYTA 1ZU5A 1F2DA 3FOCA 2A86A 4J43A 2R1TA 2WC1A 3TLJA 3T7KA 4EBFA 4J9PA 5J8YC 2P9YA 2P0AA 4ZT5A 3BHIA 1KO5A 2AW5A 1YRAA 1JEYA 1WKCA 1COZA 1SIWA 1MJFA 4MS1A 1W4AA 4PLTA 2BTQB 3CW9A 1A8HA 4KIFA 1ILEA 3UQ0A 3PSIA 5D49A 3HB7A 1SZHA 2HK8A 4C2AA 3LUDA 1Q3KA 2D3DA 1JQBA 1VHLA 5CM8B 4B46A 4ZOCA 2I5PO 4AJ9A 2C8KA 4HAZA 3PR3A 5CM9C 3N7RC 3IN5A 4MYSA 1PT8A 3N28A 2RGNA 2KJ5A 1W0JA 1WQ1R 4X63A 1S0VA 3AIMA 4MHOA 5DGDA 4UM9D 2OKGA 4X7BA 5CYGA 3MFYA 1MX1A 2GWSA 4ND3A 3ZLVA 5DM70 1Z19A 4IZ6A 5C5EA 3HJGA 4GOJA 1SJ9A 1I3KA 3F47A 2FPXA 1Y81A 4FN5A 1NVGA 2NP7A 3QFRA 5F9HA 2YXEA 1M2JA 4GLFA 1U1GA 2NX2A 2HZ7A 1U04A 1CB7A 5DOVA 1R0CA 4HBGA 3ADDA 3AR9A 1QIJA 4DKXA 1TCVA 5JT1A 3AF6A 1G7RA 3DM9B 1PP4A 4UMVA 3E2MA 4KG7A 3NASA 4QULA 1GAEO 1GDDA 2EAMA 3NFYA 1XSEA 1MB0A 3RYTC 4IDAA 4DCUA 1AU9A 1CVRA 4FD3A 3K9WA 1K1SA 1FYVA 4P53A 1M8KA 4LK3A 3C48A 4CMKA 4YTEA 4Q1EA 3V8PA 4AWBA 2O3RA 1GFZA 3G82C 4BN0A 3ZKWB 3D6AA 3PA8A 3DW1X 3HKZC 2PUJA 3ML1A 1IAVA 2F3RA 4LMBA 1DK2A 1EDOA 1XS9D 4RANA 1U2GA 4JP1A 5FNVA 3QWAA 1W88B 4IV5A 2DMRA 4GPAA 2HNKA 4FR5A 2PEYA 2HV8A 2OV6A 2EBWA 3QUTA 2AFIA 4JDPA 4EY5A 2O7QA 4JT8A 3I34X 2VHTA 3UAYA 2JJ1D 2RG1A 1PTKA 4E5VA 2EHJA 2AXEA 4DCNA 2NSLA 5IIMA 5EIWA 5I7UA 3JAKB 2QTMA 4O2BB 4ZFNA 3C3DA 3LKBA 1T9ZA 3WL7A 1EFVA 3B85A 2WFLB 4PLFA 3IDOA 3UJ6A 2WSSA 4LNUA 3GJTA 4RXUA 3ZWPA 1Q3HA 3JX9A 4L5AA 4DDTA 2NVUB 3M6XA 3LA6A 4NU0A 2POCA 1ZMTA 4LHYA 2VH1A 4P4PA 3TQ1A 3LBYA 4Q93A 3RIEA 1P33A 1DFHA 1T9CA 3G8DA 1ZMRA 2R18A 2LKCA 2PWBA 3B51X 3AFIA 3PGXA 4NQZA 2YIDA 3QUCA 2PT5A 4IICA 3ZWQA 3OFJA 1A69A 5K0ZA 4QOEA 2D8AA 2XZOA 3HHEA 4BKQA 3V1YA 3QW2A 5AVSA 1BJKA 4N47A 4TMWA 2CV0A 1I3LA 2LZ0A 2ZWPA 3UF0A 2F67A 4MITA 1UJ4A 1X8XA 3MYYA 2VSNA 1USGA 3KOUA 2H1CA 4RTJA 4YRNA 3G9ZA 3IB3A 4BKPA 2ARKA 2ZUVA 2OTCA 3IEPA 1E1RA 3BVPA 4ODIA 1NK0A 2V1XA 1GGMA 3IMFA 1CR4A 2IEYA 4OU5A 4F8EA 2ZLBA 3ETNA 1H9BA 5CXXA 5KNDD 5KFDA 2V0GA 3C6MA 2FE1A 2JG3A 4DHEA 2NZUG 1N63A 2HCJB 1SKYB 6AT1A 2CGEA 1AE1A 4AG5A 3ZVRA 2W2VA 2KOBA 3T9BA 2ZWMA 5EGSA 2JATA 5ITSA 2PVPA 3E5NA 1T5SA 1AN9A 2C2YA 1DHRA 5U4XA 3PFNA 1V7QA 1I30A 2ANBA 3MAAC 4EABA 1LGYA 4H3VA 5CLQA 1NJZA 1ZKDA 4AWAA 2V4MA 1P8JA 3ANMA 1V48A 1OFUX 3FMOB 1D8TA 1D9XA 5KU1A 1E6LA 3U44B 1TM7E 4GNKA 1HT2E 4M9CA 1TK2A 4UVIA 2OHVA 3I4LA 1EE1A 3A11A 1C3OA 2ATIA 1DFIA 1J39A 2D5LA 5EP1A 4GL2A 2OBFA 4YMOA 4IIFA 2MINA 4JYBA 3SQNA 1FFAA 1X7ZB 5BNZA 1JKJB 1VOTA 4J0GA 3I3OA 3LDFA 5C3MA 3QGMA 3EGDA 1B3BA 3A6PC 3FKSA 1GVHA 3HXPA 4JQSA 4C2BA 4UU8A 2CT8A 5BR7A 1KMNA 1WZIA 4MW0A 1SXJC 4N0QA 5KYUB 9MHTA 4M7RA 2HMSA 3BS5A 3ZD7A 1PJAA 2P11A 3S29A 5CPFA 5DHUA 4F38A 1GHTA 2VAMA 1XD8A 2HW8A 5KINB 2BFCB 4D25A 2IA5A 3QOYA 1E9FA 3LLUA 3SV3A 3I32A 1HEYA 2P1DA 3D3QA 1UZMA 1VMIA 1DKUA 1N0WA 1PQUA 1UWLA 3ETGA 2H17A 3NAMA 3DOJA 2FW1A 2J1LA 2Q45A 5B6JA 2OYYA 4MPDA 1JGTA 1M34B 2QQ0A 2WFMA 4DR3B 1HNNA 3KZIU 1X2EA 3UJPA 2GEDA 2GZ1A 3RAQA 4JWKA 5FLYA 3HFSA 2B4TO 3ONWA 1BXGA 3BBPA 4ECEA 2V6JA 2YRWA 1MORA 2DERA 1L1EA 4JL6A 1OJ7A 3A1VA 1ZSNA 4JLJA 3PIDA 3GR6A 2W8LA 1NW8A 4HNSA 2D54A 1OV6A 5HCUA 3RT7A 2I1VB 3JXEA 3LWZA 3ZDAA 2ESEA 3KFUF 4DCSA 3MABA 1N5LA 1KFEB 5JPCA 1J42A 4NE2A 4OQYA 5BWOA 3IEKA 4Q4JB 3RB3A 1NBME 4MUFA 1EZ1A 5GVRA 3I30X 2GPAA 2Q3MA 4MW6A 2G7ZA 3UAVA 1YO6A 4Q3BA 4XUCA 1NASA 1U1EA 4TRMA 1QRTA 3CWQA 1OJLA 1X2BA 3H2KA 1WV1A 5DBCA 1J1ZA 3ZVMA 3QUQA 2W70A 3HBFA 3T0FA 3L92A 3H5AA 3GW8A 4P93A 2HKIA 4A03A 3VNAA 3RS4A 3IHQB 4UNSA 4G4SP 4LXGA 4QBHA 1PFYA 3PX0A 3HJTA 1C4WA 1W36B 1VSUA 2EIHA 2C7PA 5JSQA 3TPCA 3DMYA 1Z37A 1HORA 1SUEA 3EPHA 5KG0A 4D3SA 3ZJVA 2H4JA 1GGFA 3W04A 4X45A 4MUAA 4QWAA 2H7XA 3OCCA 1DC6A 4YC7A 3SAJA 4BNXA 4LJ6A 3ZXSA 2FEXA 5KT3A 2ZE6A 4F84A 2I4OA 2H18A 1FF9A 2CZCA 2W0SA 2H1SA 1OVGA 5AW3A 4PG8A 3U4QA 1ACLA 2KD1A 3N05A 2DQZA 3HK2A 1V25A 4YP5A 5AW5A 5HQTA 5ALOA 2H63A 2WA2A 4YJ2F 1EP3B 3H97A 3KDSE 3KV3O 1T9DA 4GNRA 1Z07A 4Y2PA 4JYAB 1IVSA 2K2QB 4AMBA 3G6KA 2UZ0A 1GZ6A 3O82A 4XRHA 3IKTA 4C08A 3MB8A 2W55A 5IILA 3BDPA 3M4NA 5BP7A 2CK3D 4HWPA 4EQ6B 2X5XA 3HNOA 5ED0A 3KLMX 3AHEA 4MWDA 5TF0A 3E05A 2BEVA 1RM0A 4WBNB 3SAHA 4IF4A 9ICLA 4OLJA 4EECA 2R751 4EEYA 4HYYA 3AX6A 4EI2A 1F5SA 3CUYA 4IJUA 5JS7A 2Q28A 4AS2A 4CMGA 2XUPA 5FFNA 2QVZX 4XYBA 5JUWA 5DLQC 1FMCA 3RFUA 1UBHS 5L95A 4HRVA 2HLDD 3IAHA 4EWLA 4YV0A 3LYLA 4AQ7A 1TCAA 1WSBA 4C43A 3NC1C 5FYQA 3WIUA 1D9ZA 4RJLA 4Z1MD 4L3WA 3NHLA 4FC7A 1IWOA 2P91A 2JGKA 4Z4IA 5BV8A 1YBVA 1A96A 2V7EA 3WLHA 4ALMA 2WF5A 2G9UA 2XTAA 2HDOA 4UBOA 3AVQA 2CF6A 3ZIAD 2YBDA 3ZDYB 3QF7A 2BFDA 3UWSA 4ZZIA 3WR5A 3IAS6 4MEBA 4DV7B 3TRDA 1NJWA 2MOKA 4DIBA 1Z18A 2II6A 1YTLA 1MAHA 1SA0B 4MINA 3ENZA 2JGLA 4RLHA 1SUSA 1JVNA 1NLYA 1RQ2A 1LZKA 1G8HA 5EHQA 3BE6A 3PWZA 4DF4A 4WHMA 1SC6A 3F3MA 5J2TF 5AKXA 3UOWA 2PQMA 2ISSD 3OLZA 4IQWA 3KVNA 3GWZA 7ADHA 4KO4S 1WB6A 3MTEA 2J3EA 2A5JA 1G4HA 2PKQO 3BGWA 1SBQA 3H11A 3O8QB 1BVYF 1ZQ1A 5A7GA 2CFIA 1ZQZA 1D0SA 2JFYA 2BC9A 2CLEB 5DHQA 5TB5A 3MWEB 1XZ8A 3N6XA 1VJ0A 3NIGB 2W9MA 3R6GA 2VK1A 3JQFC 2O9JA 4URFA 3VR5H 3GEGA 4II7A 4WINA 3QXCA 3VPBA 2YZMA 3E9ZA 8ICFA 1L3CA 1TAMA 3P19A 2O8EB 1XZLA 1APBA 4QC2A 4A3SA 2FVYA 2KVSA 3OU6A 3R0QA 3RG2A 5I9LA 2WD7B 3R7SA 1DJOA 3IAFA 2H4ZA 3X1KA 2YYZA 4G63A 1Y1PA 3GRVA 3AM5A 3TR6A 3DE5X 2ZIGA 3SAGA 2IUUA 1T5HX 2EQYA 1XJ0A 3MRXA 4P2GA 4ZO8A 3T3MB 1G98A 1E32A 3H9EO 2Q9CA 3PNBA 3AQ4A 3S5JA 2R8EA 1YXMA 4BQIA 1IK4A 4GQIA 2XUGA 1ZXIA 5CJJA 3EOBI 3O2NA 2QARB 5EL0A 4IO0A 3AF4A 4M9JA 1BHJA 2X7HA 3HVIA 1HL7A 1NURA 1Z0IA 3ROQA 1OH5A 4H0CA 2BFEB 3E2PA 5DB7A 5DX8A 5JARA 1QR2A 2OMEA 3TSOA 1ZZEA 2EDAA 1N2CE 4JWMA 4IRDA 1KQOA 4F56A 1XK6A 2ZCVA 4XUEA 3U17A 1Z45A 2QRQA 4YXFA 5LNK1 2ZIEA 1M6WA 1PJ4A 3QPCA 2XYQA 4F5DA 5DBEX 2GJKA 1T4MA 1Y8CA 4DDMA 3ZBUA 5EJ7A 1OFTA 1CUXA 2IQ5A 1VLJA 4HWRA 1PF7E 4HB2A 1U4NA 3C4JA 1FFDA 1Y8QA 1E8DA 1ECJA 4BVLA 1JALA 2RFLA 5BOSA 1VKZA 3NHJA 3DKIA 3KXLA 4FHEA 3P26A 3L6UA 4CM9A 2BI8A 1VIDA 1NVUQ 2G9QA 1UFOA 5I7OA 2NAPA 4EJSC 1Z0SA 3A1CA 2P2CA 5J8YA 3OJWA 1IL0A 4B9LA 1NT2A 2I0FA 1XXHB 3DTVD 4IHQA 2MWMA 1TMGE 1A27A 2YWCA 1NVXQ 1NTRA 5GJCA 1MTZA 4QM6A 2YV5A 2OYSA 2A9QA 1ZGJA 1LBEA 4EHJA 3QIVA 5J58A 3VV3A 3OKAA 1IWBB 5KYYA 4L08A 2Y77A 4RXMA 4YMMA 3RKSA 1U31A 3M0EA 2DT8A 1W6UA 2BHTA 1FDTA 1RRKA 3VA7A 2W7OA 1L9XA 3AUOA 1JR6A 4L16A 2PMDA 5CXQA 1KI6B 1F48A 4MWTA 4JX9A 1GL9B 2VEOA 5KWJA 3H04A 1M2VA 4PZCA 1J2JA 2M6LA 1SB3C 4ELUA 4Y0AA 4BZZA 1NRWA 3CONA 1WKBA 2L19A 1FO4A 3CU5A 5JDIC 3UN1A 3U4GA 3HYNA 4M8KA 1P1CA 4P81A 1Y9JA 1E9BA 3M5WA 4DMUB 2Q0HA 4LTNA 4WKPA 1Q12A 3HP1A 3WK8A 2NSJA 2VTBB 1EGHA 3W06A 3WZ2A 3EYWA 4MUIA 2BI4A 2JEYA 2NRWA 2PMFA 5BT8A 1BVHA 2ZI7A 1BE0A 4NENA 1N25A 4V1CB 2XQJA 1ZD5A 3BJIC 4BS9A 3W3AD 4BEBA 3Q7QA 4GP9A 2WG1A 1ORIA 2VBFA 4Q47A 2AXTU 1C9JA 2DETA 3CUWA 2J6CA 4MRRA 2PMKA 3KPVA 3QW4B 4I5EA 2G5GX 4TWIA 2OENG 4GUAA 4WZBE 2HCTA 3UXPA 1TJ3A 4AJHA 2WWYA 3F73A 2IPXA 4CM7A 4Y1RB 3NANA 2QXTA 2QTBA 5LQDA 4YUAA 3C87A 3S2UA 2A19A 4DEZA 3IAS1 4PRYA 4HXFB 2ZYTX 2Z9BA 5BSGA 3DVQX 4D1YA 1GSIA 1QHGA 1DJQA 5A0FA 3D0QA 4ZXPA 1ZI6A 2C8VA 3NS1A 1S0UA 2QUBA 2QAIA 3K6JA 5C4MA 2ZXIA 2B1RA 4KR3A 1URPA 2P2ZA 3BEOA 3F2CA 1HY3A 1KVSA 1LI5A 4RZXA 2VP9A 2VIIA 1XMIA 2JA2A 4WNCA 1ELOA 4MEXA 3UKOA 1Z6ZA 1E1DA 4B17A 5BSKA 3RHTA 2UUCB 2F3NA 3RJMA 4OM7A 2WLTA 4A0HA 3KQNA 4QWBA 3LBIA 1KP2A 4Q82A 1CE8B 1ZUNB 2Q7XA 3MLAA 4ZCPA 2EZYA 1RI4A 2V03A 4IJQA 4XGRA 6GPBA 1LSOA 1PSDA 1JFFB 2B0JA 2QIPA 4E7PA 2BFFB 2JMGA 1WUKS 4P2HA 1YF3A 3GRPA 3KSBC 5DNAA 3R0XA 1K8XB 4FE4A 4ZGGA 7ICNA 4Z6DA 2RBEA 1DGQA 1H6AA 4G41A 1GRNA 3TRKA 1DQSA 4B0PA 4MGIR 3KR2A 1E2KA 2O8BA 1OWOA 2NQ2C 4TMTA 5AVTA 3GZNA 1DELA 5JNSA 5A71A 1L5VA 1ULBA 1HLFA 1YONA 2WJYA 1OPRA 4C14A 3KQKA 4KL8S 4QGBA 4IIXA 3FI9A 4KQMA 4MS3A 2YV3A 3OCJA 4F85A 3ZDRA 3PVSA 2FMKA 4C7ZA 4FMCB 5E0KB 1I5RA 4XX1A 4KWEA 2YINC 4ZVVA 4R51A 4DDKA 1J8FA 3PUKA 2CJYA 3L0BA 4TL8A 4DQPA 4FFNA 4YRKA 2EX1A 3TFRA 2OWDA 2QS9A 1NUQA 3L7JA 4RNCA 3RE1A 1G8GA 3DR5A 2AFRA 2EKDA 3ETJA 3PQ8A 16PKA 4M76B 5JCJA 3WRVA 3QBEA 3PHBE 4DOCA 5FO1A 4YMUA 3WX0A 3FZGA 1UMBA 1KZYC 5I7VA 1YNOA 3R0VA 3VHLB 2IEBA 3C8DA 2ZRBA 5K8CA 2VAXA 2NU6B 3RWBA 1ZI9A 2LIVA 2F3TA 3OPYB 4UVHA 4GC7A 1XROA 2L18A 3TACB 1FFHA 2GZAA 1KVRA 1N34B 4DL5A 4FMDB 4DDHA 3OFND 1WNFA 4LQLA 2AWNA 2WW8A 3GMDA 2JZNA 3ANSA 1CQPA 1XNHA 3T8YA 4ECQA 4M9ZA 2RQ5A 5KL8B 3DVAB 1SXJA 2IZOA 4PCUA 1D04A 2ZU0C 3RSCA 2JAPA 5HIJA 2MJLA 3HJNA 2VYVA 5JV5A 4QUBA 3SQIA 4EPTA 4C6TB 3S8MA 2AMFA 2ZI3A 3W78A 2EC5A 1X7XB 4WNYA 3CW2C 3HNRA 1HEIA 1ZIXA 2IYFA 2RGNC 3KQHA 1NIPA 1JPJA 1ZNWA 1QIKA 3K0FB 1PJLA 1EH5A 3GK3A 1MEJA 3BILA 4N5LA 4KQIA 3FPFA 3Q72A 4Z0PA 4KTTE 3WLEA 1UZLA 2O1XA 2PI5A 3SYTA 4ZOEA 2G9NA 4A10A 5FJJA 5C18A 5AM3A 3OEWA 1KLNA 2ZREA 1K3UB 3WA6A 5FO0A 3C3MA 4DFMA 2WYIA 5C7YA 5F7XA 4UULA 3EBOA 5G41A 1IBRA 4K3UA 3VPGA 4OQEA 3P9IA 4PZAA 1KF0A 1CV2A 1IWPB 1JFTA 2IZZA 4A8HA 1B22A 1S8FA 4XXHA 1Z12A 3NT2A 5K0CA 1STOA 2ZTSA 5AVUA 1T3TA 2HU2A 5K0EA 3VKUA 3UMSA 3B48A 4OYHA 4PYIA 1U0HC 1SXQA 1SGGA 4CTJA 2XKJE 3NAGA 2ZT7A 2J0QA 4P0QA 3L6OO 2ALJA 4XTCS 3S55A 5JEEA 1BD3A 2CRXA 2HMUA 5BN3B 1NC1A 2EU8A 3GD7A 4EB3A 3H7AA 5IEBA 4JLOA 2N42A 4JP5A 1RG6A 3IVGA 4C4OA 1EG7A 4ECVA 1IG0A 4FS8A 3TTXA 5C8DA 4O0LA 4QXAA 5ITZA 3R3JA 1MJNA 2RK6A 4YCAA 1KAHA 3OECA 1S01A 5K3CA 4KDCA 1QBKC 3U09A 5MDHA 2G0NA 3Q2KA 3WIEA 4MQEA 1IHYA 1QIDA 3T5BA 3J80A 3NCHA 3IHWA 3UTCA 3ROEA 4HH3C 3PMLA 1BFUA 4UPDA 2IPNA 3R0IA 4YMHA 3LYSA 4GOKA 2XT9A 3GP8A 2V7QA 1MVLA 1N1GA 4QOSA 2E8OA 4JOQA 4ND1A 4GOOD 4WK6A 3A9UA 4ICIA 1EXWA 3BD8A 3QY9A 4K8RB 4UW9A 5KYNA 4BO3A 1C0KA 3WWPA 1SUCA 2IXEA 4Y2GA 3ZTYA 1GCUA 3COPA 3CF0A 1NWHA 3K0AA 1KMMA 3ENNA 5F73A 3TGPA 2OG2A 5K0NA 1P7WA 1QRRA 3WZMA 3TLAA 5D8DA 4FP9A 4LDZA 2WM9B 2WWRA 2PIAA 2W2TA 2C9ZA 4KRFA 1FFVA 4KVGA 1CY2A 1X1QA 2I7DA 3KYJB 4D9HA 2RHDA 1NW9B 3L8ZA 1T3HA 4W9RA 1P6UA 1L3SA 3MA0A 4NAHA 3LD9A 2VDWA 4EY3A 1VBMA 3WMGA 1SQSA 3QU2A 4NBWA 4QQRA 4CCAA 8ICZA 3G0IA 3AVUA 5H0IA 5DLGA 3A06A 2HEGA 1E59A 4KQHA 1E1CA 4J0DA 2X0IA 3SX0A 2FJUA 1OIWA 3LUGA 3P20A 1MRNA 5ARBA 3CUEF 4RDHA 4P7JA 2WIBA 1IY8A 1CLEA 1XRSB 3LCUA 3P0RA 3WIDA 2IBKA 4LKOA 4LTDA 1RYFA 2VATA 5D3MA 3KXIA 1UIMA 3FD8A 2ZJYA 3TBKA 1E94E 2W4MA 3TW8A 3PR1A 1RQGA 5IJAA 1X1BA 4TX1A 1HRDA 1DP4A 1MMFB 3QFCA 4OXIA 1KDRA 1Z4KA 1RPNA 4URZR 2CXRA 1J20A 4GPTA 3F9RA 1R00A 3HUFA 2NO6A 2Z95A 2JGEA 1JVBA 4IGFA 3TLZA 3U3XA 4OQMA 2GF2A 4HQLA 4R7TA 4ZZ1A 2G4VA 4QYIB 3NIWA 4KLCA 4I2BA 1QFJA 1WXHA 5HF8A 3VV2A 3HXTA 2B1JA 4BMYA 3TVTA 5CEJA 2D1TA 4A27A 5K01A 1S9HA 2GK4A 2VNKA 4C0QC 3EZLA 2WPDA 4LOHA 2OBYA 2HDHA 4ED7A 5C7OO 1QLNA 3C8UA 4RQ1A 3U48A 1JVSA 3LQYA 3ELDA 4LTMA 5AVWA 2UXDB 1HTWA 1BYUA 3X0DA 3Q6MA 3O4JA 3UV3A 3MRVA 4BNIA 2DWQA 3JQFA 1HT3A 1EAYA 1B7GO 1F9EA 2IC5A 1KJYA 4OQQA 5E6SB 3K15A 2DWUA 1REQB 4AMZA 1T0IA 2AE2A 3DSRA 2Z5FA 2ECKA 2FZ5A 4O4LF 4H16A 3T99A 1MA0A 1AM4D 3PI7A 3ZY5A 2Q0SA 4KHZA 4I1SA 2VUTA 5CHGA 1L4BA 2HRRA 4TURA 3CVYA 2IZ1A 3UXOA 1TVEA 1F8FA 5DSTA 1A1VA 2DY0A 2HIGA 3RF7A 4TYMA 4BJQA 3MOIA 4GMDA 3BORA 5B6IA 2H1LA 5G4KA 4PQRA 3EISA 5D00A 2J9FA 3IOYA 3A1SA 4RK1A 4JVOA 1WCV1 2NLOA 3EW9A 1E2MA 3D64A 4IZHA 3Q12A 2EBFX 4FCWA 1VIYA 4B80A 3CLVA 5CA1F 1JF8A 1BMFA 1D8YA 2H4XA 1G8YA 3PDJA 4QZGA 4CFZA 2PX2A 4BTLA 5EJAA 3EXIB 2JZCA 3TLBA 4ARAA 4ZQHA 5DW0A 2P9HA 4IUCS 3PUWA 2AHRA 3MFIA 2G06A 1PO7A 3EE6A 3JZAA 3B3GA 2BZGA 1U9IC 1AZWA 4DCCA 1P7VA 5L40A 4R84A 5EKDA 1RLIA 2AJLI 4E5MA 5F9MA 5ECYA 3AILA 4P7GA 1W1IA 3VVBA 3OZ7A 4B9EA 1XZHA 1TVAA 4QDKA 5BNWA 4GX0A 1GNVA 2XQKA 3ZGNA 1UA1A 1F6DA 1XPUA 3LZDA 3KSDO 1Q2UA 1Y82A 5JASA 2PGNA 2WJ4A 4D2IA 2B92A 4UBCA 2D3WA 1UPFA 2QR2A 1I6WA 1L7AA 1FC0A 4D9FA 3GRCA 3GFQA 2YCBA 2V7WA 2XGJA 1XELA 1KY2A 1T6BY 3BMCA 3ZGZA 1NKEA 621PA 4GI1A 3JWJA 1WBJB 3GHYA 1V1JA 4QJFB 1AKQA 1GTG1 1VZ3A 3GFPA 1UKEA 4S3MA 5EZSA 1EX7A 4NZYA 3UJBA 1B93A 1XCOA 4I5GA 5JQGA 2BPGA 3HGQA 3N2LA 1YS4A 1TK0A 4H7FA 3H9CA 1RHKA 3P27A 4FIDA 3PC8A 2F00A 3U3RA 5LMUB 1T1SA 5KB3A 1Y8RA 4LIPD 3GAFA 4YCXA 2WP8J 2Q0QA 4UPEA 1QG0A 4GC9A 3UPTA 5J2IA 3GIIA 1ZQPA 3T79A 3W77A 5J2CA 4PRLA 3BQ9A 1LDBA 1U8FO 5JLJA 5JMOA 4R69A 3IDZA 5B30A 1FTYA 3ECCA 3MLEA 1U0JA 2BLLA 5IC6A 4HQ6A 2WUEA 4L0DA 5ILOA 1F5NA 1NOMA 2AW3A 3R24A 1EWYA 4GX1A 1TUGA 3UG6A 3KPUA 5JDIA 4U3JA 4FXPA 4YROA 7ICFA 3HYTA 5AP9A 1QH0A 5KTPA 1OXXK 1KEVA 1G21A 3UB2A 2PRJA 4UB3A 3DO6A 4YRAA 1AZSC 3MTJA 4L6AA 4EMTA 3V55A 4OL9A 1ONPA 1JIHA 3NR2A 1F14A 1FSSA 1K86A 1PNOA 1N1MA 4C4SA 1UBLS 4WZAA 2O48X 1UMDA 2E8MA 2B5OA 1HEKA 3N70A 4R2XA 5DOZA 3IAAA 2BEJA 4DOMA 2RI1A 1R0BA 3D5TA 4OGWA 3EX7C 3KUXA 4RENA 4YFYA 3F74A 4R16A 1BQ4A 3D8HA 3GY0A 4MP3A 5EJ5A 3BHMA 3HDQA 2JV3A 1H0HA 4D02A 1YVRA 7REQB 5B66U 1PQWA 4C80A 4MKXA 3RWMB 4JJZA 4D6PA 4H4EA 3WWOA 2G72A 7ICRA 1ZDMA 4GF5A 5BR8B 4QTXA 1COWA 2D1QA 4BYMA 5HS4A 1DCTA 3INYA 1FNCA 1SIBE 1MG0A 5J4HA 1XALA 1N2SA 1SG6A 4N49A 1NP7A 1IQPA 2QE7D 2ORIA 3PYXA 3E4DA 4JDUA 5CFZA 2KN7A 5LOVA 1XAJA 2FEAA 4NU8X 3DNPA 4WXEA 4G3IA 2EATA 4ACBA 3RFVA 2E4ZA 3R7NA 2VOJA 4AW9A 5KJCA 1E2IA 5CA7A 2F3UA 4O3QA 4TTVA 3QE9Y 1QNLA 5AH0A 3T7DA 4I2FA 4WN9B 4K9MA 3CGWA 1XQ1A 1XU9A 4QNRA 2R7MA 4W6QA 1SBNE 2ZJ7A 3KZOA 2XI4A 4YMTA 1J0XO 3N0VA 4TT8A 4MJXA 4C7OB 1N6RA 4CV0A 1H4VB 1W76A 3AL0B 3DMFA 2GHQA 1NW6A 2OHJA 4ZOQI 4N18A 4ZCIA 4YCLA 4ZYLA 3P97A 2OBMA 4MARA 3W8NA 3B8EA 5J0PA 1EVIA 4RY2A 1HV8A 2JA1A 4HDNB 5AWFC 2C03A 3QEBZ 2PGDA 2H4FA 5AJTA 4J03A 3SY8A 1KH3A 1AB6A 3NTLA 4EUFA 1TFUA 3N53A 5BSFA 5DM2A 3V46A 3I28A 2RK4A 2R8PA 2PSEA 3H40A 2H16A 1KAQA 1VMDA 1ZQRA 4PGMA 1SVUA 4RLQA 2PMWB 1S77D 1ZETA 4HQNA 4R66A 2IH2A 2TMKA 4HNTA 2PKRA 4KXLA 4OXQA 4YR3A 3KLNA 3FKQA 2XTNA 4B4KA 4YR9A 1ZX1A 1LQUA 1ZQOA 3EHDA 5IULC 4GZMA 1O6GA 2DFNA 5FUXA 4G0UA 1ZHHA 5D46A 1ZOLA 4MGHA 3DE2X 2ROQA 2LIPA 3ER9A 4UB1A 4AIRA 4DGSA 1XFAA 3OZEA 1RKUA 3NGLA 1WP4A 5AVYA 3WKCA 3V7JA 1RRGA 3IUBA 3E9CA 1OPXA 2XD4A 1C7JA 1BYIA 2E4UA 2BPOA 1C2TA 3RS5A 3ZD6A 7ICQA 5CMLA 4M04A 3FMIA 4G5YA 4IY1A 1WZNA 4GX2A 1D7OA 2QQGA 3MQFA 3AMVA 2PX3A 4BATA 4EG4A 1SC3A 2J0UB 9ICHA 4J6EA 4F4XA 1Q11A 2JR5A 4WJKB 4YMLA 4MJ7A 4ZYVA 1M0TA 5JAMA 1SXPA 2JFUA 3LRTA 4BNDB 2PK3A 3KQYA 2WHEA 2IIBA 1CUUA 2ZDHA 2VDVE 1JI3A 4CMEC 2IK8A 2FF5A 4YYZA 4IWYA 1JUDA 4QFMA 3R8CA 3KQWA 2PXHA 3QEMA 3JARA 1G20B 4G1BA 3V1LA 3IOBA 1LFDB 1NZPA 5FWYA 4OJKA 3GJ0A 1ZA2A 2C4KA 4CEJB 1Y4DE 1NULA 3RH5A 3TLMA 2ZGVA 3CW2A 2O19A 3VKGA 2QT9A 1X7WA 2YN4A 4UVGA 5LQRA 1AN0A 1HUOA 2QENA 3C29A 1BJRE 3K72B 1IUPA 5KHOC 4S1PA 4OCZA 3TXXA 5AUOB 2ZRNA 1HDZA 3PGKA 5A4KA 1Z8NA 2UZ1B 5AQ1A 3MUEA 3VR4D 4D5GA 3DVSX 5COAA 4BL5A 3F6EX 1AMOA 4INPA 3NHKA 1ESEA 5JLAA 2NV6A 2XRMA 3U26A 1KOJA 2WMDA 3TG2A 3F1LA 5E4FA 3VR2A 1XA0A 3MMSA 4E7OA 2XOXA 3KUUA 5K0GA 3FPGA 4QUIA 5K5EA 3ABSB 5AI0A 4TXLA 1PNVA 4MWBA 1OZGA 3DZJA 1O1YA 5K6RA 4BECA 4NBVA 1SL1A 4CU2A 4ZV9A 4UNIA 3D0RA 1DX4A 1KR5A 1Q6YA 4KC0A 3QHQA 4DE5A 3JPYA 2GBPA 2TMGA 4DLAA 2VRBA 1J9ZA 3LV8A 3TLCA 4E07A 3HR4A 3C7TA 2NO0A 4TL6A 1J9EA 1M5UA 5H82A 4N3NA 4PC3A 4MVJP 1S4QA 1NI4B 3KOOA 4GZ3A 2C4VA 2LI6A 4U2CA 3FCOA 2F1JA 2JIMA 3H1GA 3BRWD 4KQ9A 4RT3A 4YJ3B 1WOYA 2X8BA 3U61B 1TCCA 2VAPA 1AVTA 3I52A 4D0GA 1JU9A 2GX6A 2H5EA 2BV3A 3G7NA 2ZP1A 1YQUA 2HM7A 4QIWC 1CB0A 5GQSA 4K81B 1XV5A 4F93B 2VDRB 4U6SA 4E30A 3KT8A 2AQ8A 5KOHA 4QUGA 1CR6A 3INGA 1JEDA 4KK3A 1RTTA 2D59A 1DOHA 4LZDA 2UYCA 5JHGB 1X40A 2ZWOA 2RCNA 1QH9A 1AK2A 5JPDA 4Q9JA 2ZRAA 2B6GA 3R9XB 4LX8A 4C7BA 2ZTDA 3KE9A 4OYRA 2QW0X 1M83A 1XVLA 4DLTA 3SXPA 1ZQKA 2R6JA 2OC9A 1VKJA 5CNMA 2CD7A 4MRAA 3EXG1 1ONOA 4GOXA 4NBRA 2B1QA 3HB0A 4WNAA 4C4XA 1UBTS 4KDEA 4MWCA 4QLAA 4X9XA 3ESCA 4DS5A 2XMQA 2XO7A 3V4RA 5EKUA 2JGDB 4L57A 1CIPA 3T41A 3A1UA 2Z43A 4LXXA 1YMUA 1QMGA 2QHXA 3G88A 5HYVA 3FOBA 2ZTUA 2JHGA 5K6TA 3R41A 2R8JA 2XIQA 4K9LA 2H0QA 3ZE8A 3R7BA 1TZ2A 3TGLA 1QKJA 4Q6WA 1RBQA 1RTKA 5EUCA 3H0CA 1QCYA 3NXKA 3ET5A 3L06A 3IJPA 5JWOA 2GZMA 4KRYA 3K7EA 4RMHA 2ZOSA 3NLLA 4IDPA 3DV9A 1DEAA 3T5CA 1XE3A 4RA6B 1M66A 2WNSA 5G3YA 2QX8A 1PK7A 2CFRA 4OQ4A 1QHFA 4RCYA 1E3EA 2P9ZA 1ZQTA 3UA3A 1J8MF 2X6TA 1L4GA 3JWIA 5CBPA 4HEQA 4QYTA 4I1VA 1P2BA 5HJ2A 1FQOA 3LHIA 3ICPA 3ET4A 3WXMA 3BWYA 3R76A 3GELA 1WPQA 5BPCA 3GZJA 3CX7A 1QSGA 3W0LB 3PW2A 4EW6A 1A9XA 3DAYA 1D3AA 2V7UA 3ZBTA 4RTSA 3RJHA 2OSBA 2QJOA 4G9BA 1KOFA 2DE0X 1DUVG 3A7DA 1WHSA 2IYVA 2RDJA 5JCJD 3DCJA 3SZRA 2HVIA 1E5VA 3FN4A 2PD4A 3QLTA 4FM9A 1EM6A 3LT0A 1OMOA 3MJDA 3CN7A 1V2GA 3ZK7A 5DI3B 3PXUA 4TV9A 1TAHA 2J3IA 2R97A 1ONSA 3SDZA 1E99A 2VXOA 1N61A 2KW5A 2OZLB 4N6GA 3H0MB 2OQVA 4GMFA 3LQ2A 4Z7QB 3N3AC 3ESDA 1MOPA 5CJ7A 3LBFA 1T1JA 1XXLA 4Z8YA 1H66A 8ICEA 4NCBA 4KQ1A 3V2GA 4FMBB 5C31A 2LM4A 1VCNA 5BVHB 3GQVA 3RUCA 3TW4A 3O95A 4EP1A 2AVNA 1TJNA 4HN2A 4PRKA 3I12A 4GXIA 1CJUC 4TS3A 4FO6A 1Y48E 1AA6A 4CL0A 5A4FS 4RESA 2A92A 4JB0A 5JSZA 1U5BB 4QJ3A 5C52B 3DMNA 1BS1A 2Y1FA 3K5HA 2VQSA 5DCUA 2Q4DA 4KN9S 2Q3BA 3GVXA 5GY7A 1GV0A 5U9CA 5CVEA 4DIKA 1ESZA 4DSKA 1B8NA 4ASUA 3I05A 3DLIA 2P0EA 5F78A 4CTNA 2JJ2D 4CF3A 5IFKA 2HN9A 4LWPA 5ERXA 1TEZA 1OLSA 4CLOA 2PCLA 5EHNA 2C2HA 2JJYA 4O3FA 2JLSA 3N2YA 1NXPA 2X0NA 1DBIA 1GZDA 1L7BA 1UDRA 4HYTA 3Q8LA 3CVOA 3GVHA 2UUAB 1VI5A 3LO8A 3TQFA 1U9IA 3COJA 2QJRA 3OFVA 3LVFO 4OFXA 2XF8A 3CS3A 2F3SA 3H5NA 1GKIA 5CX1B 3ACCA 3MR5A 2DECA 4UAZA 2I7VA 1IN4A 4RVSA 1W1WA 3W4KA 3RDPA 3QV1A 5ALLA 4PAQA 4YQEA 2K6GA 4Q00A 3KT0A 3BHNA 3WE7A 1I6LA 1JRPA 3LDAA 3CKKA 3OO0A 3BF8A 2CN1A 2ZJOA 3AB8A 4QZ9A 3IAEA 3W6OA 1P4RA 4FKBA 4RFSB 2K89A 1FUEA 4HN9A 3D7RA 2WTFA 1Z2CA 5EIXA 3C6KA 1QK3A 3IEXA 1R88A 3EFOB 2WHYA 2LGJA 1THZA 4JYCA 3V33A 1TJ5A 2OZKA 2R6R1 5DT2A 2HVHA 4D3XA 2FDXA 1Y63A 5EJGA 1JEQB 1BNOA 4AK9A 3HMQA 2P9TA 4C3VA 2J3QA 4C29A 4YLYA 4UJ3A 3L02A 3TGWA 3E9QA 3K0SA 3DV0B 3UWKA 4ZAVA 6YASA 1ZCAA 2M1ZA 1MD9A 3DEKA 2PMBA 4RO0A 2B8WA 2C99A 4B82A 3LPLA 1GKYA 5DN6D 1RAFA 2VSYA 4F45A 1VE1A 2JARA 3U7JA 2IZ5A 3EVTA 3BMQB 3PQEA 3A9VA 4E2FA 4DLVA 2FW0A 8ICWA 4JBNA 5IJXA 3AUFA 1MPTA 4LJSA 2JIZD 3FVWA 1OOEA 4PX2A 1QH8B 3HKEA 1JB9A 1VXOA 5AVOA 1Z7EA 4RNMA 4CIDA 3IIJA 3N0WA 2Q4EA 1ZQEA 4ZOLF 1EFHA 1FFWA 3LL4A 2PANA 1EEHA 2NZJA 4C76A 3ZOZA 1CY8A 4XYEA 1XRQA 2OPHA 5J0SA 4JEHA 4O4JB 3FBWA 2BMFA 1A8SA 5I3CA 1ZRHA 3GUHA 4LSWA 4XB2A 1SIOA 2FR8A 3IFSA 4ZQEA 4FWIB 4O2AB 3THYA 4M0DA 5JJIA 1OXSC 1YVDA 2I2WA 1TZBA 1KSPA 1RYHA 2B3DA 4FEAA 2WB2A 4OMCA 1VIMA 4W7IA 1U28C 4DADA 3OGUA 5DCYA 5DGIA 3GLHA 2P77A 3DMPA 5BW5A 5CDYA 3O7WA 2BM8A 1O89A 2GPBA 5HS6A 3JD0A 4BU1A 9ICEA 3QWHA 4K9RA 4H60A 3L18A 4CLEA 1OXMA 1CQIB 3TZ6A 1SD2A 1CZLA 4BIIA 1FMLA 2Q5IA 4Z9XA 3W3ZB 1Z68A 1N6LA 1Z13A 1M5RA 3HZHA 3A0BU 3SYMA 2JLZA 2H2GA 3OUUA 4C6HA 5DBBA 3OJFA 3GLFB 2OV4A 3DMRA 5E7JA 4R7ZA 2J6UA 1N36B 4TQGA 2HBLA 5ELLA 4B9VA 2VNAA 3P2JA 3BN3A 1W25A 4Q4DA 2WIJA 3BL8A 1QFMA 3OF5A 4S35A 5DU2A 2DBQA 1GO2A 5KREA 4TTQA 4OQXA 3D43A 5MF6A 4BQQA 5EWJA 3K1AA 5HILA 1Y4ZA 4ED6A 1DEKA 3HA3A 1WDMA 2I8AA 1TQ6A 3L1IA 1Y6ZA 2J6BA 2QORA 3MTQA 3D54D 5B5EU 4BQEA 4JAVC 3FMGA 3ZWWA 5CP2A 4J94A 3LVWA 3G5LA 2WTXA 4DV2B 1P1RA 2RONA 5KFNA 1IZYA 2Z2IA 1QGYA 4NYMQ 4DCPA 3ITDA 5A5EA 1P1KA 3CRRA 1SXEA 4WKBA 1PYGA 2FG6C 4N82A 3AESA 1CUGA 2JH7A 4P3XA 5I7SA 4MZDA 2DPGA 1Q1AA 2C8JA 1Q8KA 3RIHA 3HU3A 3SZGA 1IN5A 3C24A 4E94A 4GIBA 2XICA 2QP3A 4X64B 1FW8A 1SBIA 1JIKA 2Q5EA 1R0XA 3PJGA 4US9A 2VT7A 3ZD9A 1MNAA 2P66A 1ZRNA 2DEUA 1FXUA 3NP7A 1V8PA 1JLLB 2A1IA 3VR0A 4N12A 1T5TA 2AG6A 2QRMA 3IE0A 3UQ2A 4X90A 1P31A 3A0UA 1CT9A 1FIUA 3OOJA 3OMXA 3MINA 5EZ5A 3FROA 1IXYA 1GRVA 2G5TA 4P98A 4PM4A 1EPUA 2FX5A 3N39C 1SV0C 1NVAA 1LDYA 3SKXA 3CEAA 4LRTB 2UAGA 4GDFA 1Y3IA 3DJYA 3OI7A 2CZGA 2NO4A 2AHOA 4PSDA 1RM6C 1ETUA 4UOZA 4D99A 2M9MA 4ARIA 5C5CA 1XVTA 4HDSA 4ZI7F 2X0RA 1H5NA 2Q0ZX 5AKEA 2FSHA 4XWYA 2B6HA 4PO8A 5AI6A 4QPCA 2WF7A 4JWNA 2WINI 2MYPA 3T3GA 3IVXA 1N5MA 2V96A 2JLUA 1AIPA 1VPWA 4RHTA 5CDFA 2HUNA 1RHRA 3KYDB 4CMEA 4F9FA 1NR1A 1XL1A 4ZVMA 2P1RA 1KY4A 3EMKA 2DPHA 1DAGA 2BHSA 2OCEA 1RBMA 4E22A 2X9QA 4UFPA 1VG9B 1YDMA 2JZOA 3DUFA 1PR4A 1Q57A 3RU9A 5IJZA 4J3NA 3PC8C 2PKQP 3ETEA 3F4LA 2H3EA 2CNWD 2GD0A 2W2KB 1ZGGA 1QGUB 1N3IA 1B73A 5E9WA 2CDNA 1U0RA 1YOVA 1ODLA 2I3BA 2M32A 1R6UA 2OY0A 3ECSA 4WOPA 4WGGA 5KG3A 2G8LA 5K7SA 1N5XA 3N7PD 4PO3X 3ANLA 3Q1LA 2WRZA 1YVPA 3FYUC 3W79A 4WXYB 4DUPA 3ESZA 4B6GA 2PUGA 4I5FA 3QMWA 1UEXC 3FSGA 4OH7A 4DS4A 2OQ2A 5K3BA 1QH1B 3EZ6A 4YAFA 3KWFA 3E1GA 8OHMA 3ESBA 2WTEA 4WOCA 1S96A 1Y3HA 2RGBA 2XCIA 4ZHQB 1U94A 2P2GA 2GEKA 2XEXA 2GBCA 5K3EA 5I9MA 4CYMA 4YRGA 1NQTA 4P33A 1GCOA 1P6QA 1AF7A 3AEZA 4C6SA 3K32A 2CDCA 3PUJA 5LP6F 1P9OA 1OX6A 5FJIA 3QNMA 1UMCB 3MJCA 1O5IA 4DYHA 2YXLA 5JMTA 4DXHA 2ZBPA 1JXQA 1Z33A 2NO1A 1OX4A 3L8GA 3THWB 2J32A 1JEEA 5J23A 3GOQA 4NCAA 3KPJA 4OK3A 4EHAA 1XJQA 4EZIA 4IDHA 3SFZA 4UHEA 1N6NA 5L3SB 1AGNA 2AZDA 3I72A 3H4BA 1Y9ZA 4KPUB 5JZMA 3L0ZA 1VYVA 3FPHA 3HCBA 3NG1A 4ZEOA 1U2TA 3VVCA 2HEIA 3HRHA 2IBTA 1HQCA 3OPMA 3RRZA 2A6PA 4TT3D 3CY6A 4MVXA 2OUKA 2WP0A 1E77A 4JU8A 3WYGA 5KPDA 2HK9A 3MW8A 2OHGA 1TFRA 2C88A 3EZ9A 5IJ0A 1ZM4A 4M7OA 2BDPA 2GOLA 4DZZA 2Z56A 3EUB2 1MJHA 1TKBA 1G4UR 2GR9A 1DC7A 4S1WA 3RUPA 4M0CA 1VSTA 4O2RA 1LRJA 4KB5A 3O8OB 1UKYA 1QIFA 1AO3A 3FUWA 2QXUA 3LY5A 5TVKA 4PLCA 3GLIE 4PHPA 3OICA 1QFZA 1N2XA 4QWCA 2YWXA 1CXZA 3IX7A 3V4ZA 2BFBB 1JKXA 4C0AC 5F9FA 2R7LA 3GNQA 1P75A 1FS6A 3C15C 4TTPA 1GNLA 2W03A 2XDYA 2YV2A 4AZTA 4UBMA 4AYBF 2VDQB 5LWHA 3NFRA 4GGPA 1CY7A 3WL3A 3NUZA 5FI5A 4O6VA 3E0FA 4LJLA 1EQUA 3T4UA 4UEKA 4D56A 2WAAA 4BFZA 4WFKA 2BKXA 3BRCA 3PQ4A 4DR5B 3RJTA 2YOHA 4I4TB 3LUJA 2WU4A 1RJWA 3QVLA 4XZ3A 5L51A 1CW2B 1QV7A 2Y1JA 2BBWA 3GFSA 1ZQFA 3B2EA 3S2ZA 2BMWA 1SFRA 1TK8A 4YJFB 1DWQA 3GJ3A 2PLNA 5KT5A 3K0HA 2OFFA 2OV1A 4OLAA 3JD3A 1UXHA 4GPD1 3FNIA 1NRIA 2BHNA 4XVCA 1HOXA 1D4AA 4IXWA 4NG5A 1V3UA 4YALA 3HCAA 5HM8A 2LMRA 5FORA 1X9IA 1LVHA 3L3BA 3MZ0A 3BD7A 4W7HA 5IT4A 2O0HA 3B2QA 2KSQA 1GSHA 1GL3A 1I2ZA 4O2BF 5DGXA 4E70A 5EJ4A 1E6KA 5TNXA 1PEYA 4XR9A 5C8VA 1U8ZA 4OSOA 3Q0EA 1DC3A 1RPAA 3CE9A 3NHMA 1ATZA 3AO0B 4EKEA 5BSWA 3C23A 2JHCA 3KOMA 1E2BA 3VAAA 4K2HA 3H9BA 4YAIA 1JXMA 2I6FA 1FFXB 2VLBA 4C5BA 1QYXA 2JI6A 3HCOA 4CLDA 2G25A 1P29A 3WNCA 4Q3DA 1CU1A 2R1VB 2H3FA 4EDFA 4M22A 5EZYB 4N9WA 1UBRS 2BGLA 5KNBA 3P9SA 3UMVA 3TM4A 2B5VA 2GARA 3HA2A 4UE2A 1NBEA 3OJ0A 4XW2A 1FOEB 2HA6A 4XFDA 5AM4A 3W8FA 1BZYA 1PS0A 1P8AA 3T1QA 2JNWA 3N2GB 4HAYA 2GN1A 1QFYA 3ETHA 3N7UA 1SBHA 4MTLA 3KHKA 4TYYA 4ZCTA 4OP2A 3R75A 4I5DA 4WY8A 1NJ2A 2GRJA 4L2IB 1QP4A 2QYHA 3CJQA 1SKWA 2O1WA 3ZWYA 5CFNA 3ZYCA 1U2SA 4JJAA 3H87A 1XVVA 3T7IA 5LVAA 4EPRA 5KDOA 1GNTA 4DIUA 1KZ6A 1A7KA 3C41J 4CODB 2CYBA 2HW3A 3TQQA 4F6RB 4B7ZA 2VT3A 3ZV5A 2OBLA 4Y8VA 1J0DA 3KEMA 2ALZA 4I50A 3SC4A 2P9GA 5KJEA 5EPOA 3L6CA 4ZI5A 1DC8A 4DRXA 1W0JD 2CVPA 3LQRA 2J85A 4DJDC 4KVFA 5KNCH