2WFAA

Structure of beta-phosphoglucomutase inhibited with beryllium trifluoride, in an open conformation.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wfaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wfaA01
1ZS9A 4EELA 4YCMA 4HGQA 3KDPA 3UMBA 2B82A 1K1EA 5AK3A 3MC1A 3DV9A 2RAVA 3F9RA 2G08A 1IWOA 2MSNA 3QX7A 1Q91A 4C4RA 1CQZA 1RKVA 2FUEA 3FPBA 3KBBA 3L1UA 4OFZA 3QU2A 1RDFA 5AICA 3SLRA 1T5SA 3N8GA 3QU9A 4MWOA 2YMPA 3L1VA 1XPJA 2ZG6A 1U2TA 4PNHA 3N1UA 2FEAA 4G63A 4Y3UA 2C4NA 2W11A 5ALDA 3QUTA 2G09A 3IJ5A 2FPWA 3PCTA 3WGUA 3DDHA 1RLOA 5AI5A 4HGRA 5AM4A 2FI1A 2QYHA 2B8JA 3L8HA 3QUBA 5ALGA 5AVZA 5A3RA 5ALQA 5AW9A 2C8LA 4HGNA 4IFTA 3OCYA 2WF5A 1TJ4A 2ZBFA 3OCUA 4BBJA 1Z4JA 5ALFA 3KOOA 4KX5A 2VKQA 1TE2A 3EPRA 4J2TA 2WF9A 2GMWA 4KYTA 1VFPA 1NNLA 3L0BA 5AW2A 3GYGA 3SF0A 3NASA 1PW5A 5FP0A 5AKGA 5ALIA 1VJRA 2IA5A 4J03A 3ZX5A 2EARA 5ALHA 2I55A 1ZD4A 5AW5A 2P11A 1WR8A 2FPSA 2GO7A 1AQ6A 1RMQA 3FPSA 3MN1A 1RPZA 5AKZA 3ESQA 1QQ6A 5AM5A 3A1CA 2GHQA 5AKIA 1U2SA 1S8OA 1O03A 2R8YA 3WKAA 2IOFA 5IT0A 2FDRA 3RF6A 1N8NA 4OCZA 3A3YA 4Y2YA 4DFDA 1Z88A 4RETA 1Z4LA 1TA0A 3SD7A 4FFDA 5ALKA 1WVIA 3I1YA 3L5KA 3D6JA 4L57A 4Y2XA 4XPZA 4BNDA 4XOUA 4UU0A 3L8EA 3U13A 5AVUA 1RMTA 3FZQA 3A1EA 4Y2QA 3WK7A 3SKYA 3BA6A 4EX7A 1Z5UA 5ALTA 2AMYA 2EAUA 4KN8A 5ALVA 1RQLA 2WM8A 4Y2VA 4NABA 2HF7A 4MUMA 3P96A 2G0AA 3J7TA 4QJBA 2YJ4A 3WK9A 5ALJA 1Y8AA 2HEGA 2YJ3A 4BX0A 2MU2A 3U7EB 3R4CA 4BYGA 3AR9A 1F5SA 1Z4OA 4Y2RA 5AVVA 1Z4KA 3QNMA 3PGLA 4CE6A 4NV0A 5AIBA 2B30A 4UMFA 3OTQA 4Y2PA 2QLTA 5AM0A 5IT4A 3AR7A 2OYCA 2NO4A 5ALLA 3DNPA 1TJ5A 1RLMA 2YMMA 3AR4A 2ZXEA 2G06A 2R8ZA 3M1YA 2I33A 1U7OA 2AH5A 4UMDA 5ALXA 2CFRA 4YH1A 5AKXA 4XE5A 3AR5A 2JAUA 3WKDA 3N5KA 5AI4A 3QXGA 3OPXA 3NUQA 3EWIA 3NAMA 4QQFA 2NYVA 1L6RA 2AUTA 3W5CA 1FEZA 3ZI4A 5AVTA 3ZW7A 4IG4A 1JUDA 2I34A 4YIKA 5AVWA 3ED5A 5AKYA 1L7NA 2BDEA 4BNDB 1L7PA 2B0CA 3K1ZA 2CFSA 3B9BA 1X42A 2O9JA 1S2OA 3AR8A 3WK4A 4UM5A 2WF8A 3U7HB 3CZ4A 3MMZA 2YY6A 1MH9A 5ALOA 4I9GA 1U7PA 1SWWA 2JARA 3S6JA 3WK5A 3FVVA 2OA0A 1L8LA 5ALSA 5AESA 3W5BA 4GXTA 5IS2A 2PKEA 3A1DA 4GIBA 4UW9A 2FPXA 2ZBGA 5AW4A 5AM2A 4B6JA 3WGVA 1L7MA 3ONNA 4H1WA 3E8MA 4UASA 3ZWKA 3PGVA 3ZVMA 4BX3A 3WK6A 1LVHA 2BY4A 1Z4PX 4JDPA 5ALRA 1SU4A 5E0OA 4BEVA 2B1RA 4DWOA 4Y2TA 3MPOA 1LTQA 3SMVA 3WKCA 2HSZA 2HF2A 2GFHA 3U19A 3DAOA 4UAUA 3AR6A 4CF4A 1YV9A 2X4DA 4BX2A 2C88A 2P9JA 3ZWDA 3KZXA 2HX1A 1J97A 4I9FA 2C8KA 5AW6A 1Z4MA 5A3QA 3TLMA 5ALMA 4YCLA 3R9KA 4ZEVA 3ET5A 4CNQA 2CN1A 4HGPA 1RLTA 1VJ5A 4NAVA 3I76A 2FPUA 5AW1A 3E81A 5AKHA 2D2VA 2YJ5A 5AI8A 3CNHA 4L6CA 3NANA 1NRWA 1TJ3A 5AI6A 2EATA 3UMGA 4EX6A 4O8CA 1L7OA 3I28A 3OCVA 4HGOA 3AR3A 5AM1A 4UARA 5AI0A 4XQ0A 2I7DA 1WPGA 4BKMA 5AKLA 5ALEA 2CFTA 2HDOA 2GHTA 3HLTA 5AVYA 5AW0A 2RB5A 1T9ZA 3HYCA 3WK8A 2OBBA 4C4SA 1O08A 2G07A 2ZBDA 4RESA 1T5TA 4DCCA 3FM9A 5AVQA 1KYTA 3KD3A 2JAOA 2P27A 3OCZA 2Q4RA 1EK1A 4UAVA 2P69A 2IOFK 3UMCA 3ZTYA 3ZVNA 3L7YA 2I54A 3OCXA 3EF1A 4Y2SA 5ALYA 3NALA 4EEKA 1YDFA 2FUCA 2ZOSA 5AW3A 2B8EA 2G80A 3OCWA 1L8OA 1SWVA 2HCFA 2NO5A 2G1AA 3QU5A 5AI9A 4L6AA 4ZEWA 1J8DA 3KC2A 3NIWA 1YJ5A 4Y2JA 3WKBA 3L0CA 3QUCA 4OHFA 1ZJJA 2MU1A 5ALUA 1U02A 2Q4TA 3L8FA 2IOHA 4UM7A 5AVSA 1NF2A 4UMVA 3N07A 4UATA 1ZD5A 1ZOLA 2OM6A 3B9RA 4KNWA 4EENA 3SHQA 2WFAA 2YFYA 4JB3A 4Y2UA 5AIAA 3WKEA 2HI0A 1Z5GA 2O2XA 1ZRNA 2ODAA 1RC8A 1ZD3A 2HHLA 2W4MA 1XVIA 3VAYA 4AS3A 1EK2A 3I6BA 5T41A 5AW8A 1RRCA 2FPRA 5AW7A 3L0YA 3FGOA 3E58A 5ALPA 2C9MA 5AK6A 1QQ5A 2W43A 4FYPA 4YIHA 3L8GA 2JAWA 4DW8A 3ET4A 5AKKA 2RARA 3QLEA 1ZD2P 3IRUA 1YNSA 1YMQA 2YBDA 3EF0A 3ZUPA 3W5DA 5AVRA 2ZBEA 3ZTWA 2YMQA 4AS2A 5AVXA 4CF5A 4ZEXA 3R09A 2YN4A 2IYEA 2PR7A 2BDUA 4YGYA 5JJBA 2I6XA 5AK4A 1QH9A 2YJ6A 4FE3A 3NRJA 4YCNA 3QUQA 3QU7A 1Z4QA 5ALNA 3ZVLA 4NWIA 3SKXA 5AK5A 1RKQA 3AR2A 4UMEA 2DQSA 3U26A 2R8EA 4C4TA 1CR6A 1RMYA 2WHEA 1ZRMA 3IB6A 4HYTA 4F71A 3W5AA 1WZCA 1N9KA 2HO4A 5A3SA 4OD0A 2PQ0A 1QQ7A 3UM9A 2R8XA 2AGVA 3ESRA 3PDWA 1Z4NA 2JGAA 4EZEA 2YMLA 2HOQA 1QYIA 3QGMA 4AP9A 4F72A 4HAIA 4G9BA 1RKUA 4CF3A 3U7GA 4UU1A 3RFUA 2B1QA 5AHXA 3M9LA 4BEWA 5ALZA 4E88A 2RBKA 3ZX4A 4KNVA 1XP5A 3B8EA 4KX3A 1YS9A 2WF7A 2WF6A 5AKJA 3E84A 1Z4IA 4NFLA 3U7FB 3QYPA 5AM3A 5AKEA 2Q5EA 1Q92A 3ZU6A 1RQNA 3QU4A 5ALWA 3BWVA 3N28A
chains in the Genus database with same CATH superfamily
1TVAA 2IELA 4ZQFA 4FS1A 3EQ6A 4YRAA 8ICBA 3QQPA 3ZJTA 3DAHA 4AUMA 3K8YA 2J3LA 5HRAA 2J9FA 2Q4OA 4YAIA 1GNSA 2W9CB 4YA6A 5DF1A 4MHTA 1EBUA 1ETUA 1PT9A 1BCSB 1W4RA 3VYUB 3ZE2B 5SY9A 1Z6ZA 3FE2A 5JUWA 3LZDA 4Y2GA 1JJIA 2VIXA 5D46A 1VJGA 1ZMRA 1DHRA 4J29A 3HN6A 4KIWA 3S2ZA 5CXUA 2XCSB 4YJHB 4WLVA 2NU6B 1RNLA 1JN3A 2B1JA 3IBSA 5DCUA 2EGGA 5A71A 4W5TA 3A3PA 3QLJA 2VYVA 2VDQB 4UUQA 3FMOB 2O3TA 1J5EB 5EP4A 4J9RA 5GGXA 3U2QA 1ZRSA 2JAQA 2WSYB 4ARUA 4FMCB 3RVOA 2GCGA 1UBJS 5CP2A 3ONEA 5DHAA 4Q4AB 1VI6A 4DCMA 4ATNA 5HBGA 5EMLA 3V7JA 5DRYA 4E2WA 1USVA 3OJXA 121PA 3GOQA 3N8IA 1Z8HA 5HDQA 2Y0BA 5EXSA 3SAFA 4BDSA 1U80A 3HSYA 5TJ9A 1X13A 4KBGA 1K3UB 2H63A 5DZSA 2XKBA 5LZ8A 4ED6A 4A3SA 1P2SA 4GC6A 5GTIU 5J63A 3TKYA 1K2WA 3VX4A 2D3WA 3WBKA 3WAJA 4CEJA 1P9OA 1MBZA 2PR2A 2KIWA 2Q29A 3B8HA 3NCHA 4K6HA 3MCVA 1Z16A 4PANA 1VLLA 4CR8A 2YZGA 1PS8A 2V4UA 2JFWA 3EISA 2VJ5A 4FUTA 4HPXB 4FWBA 4CQLB 1A69A 2C8JA 5BRJA 2Z5FA 5F78A 5HMMA 2JF0A 4P4SB 4OAOA 3PCTA 4MTLA 3RF7A 1R8SA 4LE1A 3ZWVA 1JPVA 4QUAA 2NVUA 2VG8A 3ANNA 3JALB 4P4GA 4MYCA 5JAQA 5F64A 5DX0A 4FDAA 1VCOA 5J0TA 1GG5A 1KP9A 3PW4A 3OJUA 4J9LA 2GEDA 3TRFA 5C32A 4QDXA 5AVZA 1JLKA 3W0LB 1V5EA 5EJ5A 4ZOAA 4ZALA 4LXHA 1F8UA 1QDUA 1ORRA 3NTUA 4FFBB 1ZQHA 1PBTA 2ZKIA 4ETWA 1Z73A 5CB4B 1BOOA 3EK2A 4U7HA 3L0IB 3IVGA 4Q9DA 2WFZA 3CHYA 2FKNA 4C4OA 2R68A 3QUSA 1Z4JA 1S10A 2X19A 3GEDA 1MH1A 4G4JA 4Q16A 1DC4A 3MT7A 3U16A 3TD2A 3EC7A 1LWNA 4D97A 1JQBA 2B4QA 5F52A 2ANBA 3NATA 1Z6GA 2PD6A 5AW2A 4YRCA 4BFYA 5DB9A 4P4OA 1D9DA 3R76A 1UBEA 3LWLA 4G3IA 4B43A 4CV0A 5TPZD 9ICJA 1T9GR 1PVOA 3WGOA 1C9YA 4TKUA 2VH5R 4QQ8A 3C3JA 4LDRA 3HWTA 8ICJA 4L16A 4MOWA 4QPPA 4Q7KA 4YCJA 5DN6D 4MKXA 3MDAA 2LV8A 2ES6A 2Z8ZA 3IUYA 2YKGA 5J4KA 1KPGA 4TWIA 4L2IB 4CDMA 5CDFE 3ODGA 5LDHA 5F7ZA 3B6ZA 1L5GB 1YKSA 3QEMA 3U3DA 3DE3X 2IHNA 3RJGA 3PNVA 4Q9NA 4ZV4A 3SR6A 1M5UA 3VR6H 1QSLA 1LLQA 4E5YA 4ARZA 3W1EA 3PFNA 3FPCA 3H5RA 4M99A 5I51A 2P9QA 3WXMA 1C9JA 1KLNA 3GILA 3IP3A 1GTSA 5ESWA 2NU8A 2I2WA 3KSBC 5IAGA 2WIGA 2BZFA 1E4YA 1R3UA 4CLDA 3DMGA 3GRCA 2AYYA 3I9LA 2F9MA 2W83A 2XNJA 3ZOKA 1SCUB 4ECTA 1IMOA 2FZWA 2PLWA 1PKEA 2YFKA 5EEHA 3IAM1 1GPNA 3TLGA 1XNRB 1H6CA 1LSUA 3HSSA 2VXYA 3CWCA 2I76A 2IKSA 4JXKA 3DWFA 1RFGE 4L9SA 4PX3A 3HV2A 5AXDA 3LECA 1QZZA 3FG9A 2HJRA 3CJTA 4F4XA 4CMHA 3CTMA 4M83A 2REBA 3I4CA 2Q0XA 3PDUA 4HAOA 4Y2QA 4FO6A 1BKYA 4F7WA 1FDUA 4PQEA 3TSOA 2QOEA 4EIWA 3A11A 3RRYA 1YOBA 1JKJA 1MB3A 3C5EA 3QXJA 4KP7A 4O2BF 3UYLA 3RJKA 1P0PA 2IZ1A 5C81A 2C2GA 3RQIA 4P9NA 1HE3A 2FPPA 2R1UA 1Q1GA 1OLXA 4FT4A 5JXGA 1GUDA 2BRUA 1HOXA 3Q4GA 4X1IA 3EGDA 2ZP1A 2X77A 1HRDA 2BGRA 4NP6A 5D86A 5TC4A 3WBBA 1ESCA 1ADCA 4N5LA 1K86A 4RPIA 1IZ8A 2XQJA 1CZLA 1L7XA 1B1CA 1JU9A 2FEWB 5A0FA 4NR0A 4UUBA 2G4CA 3IS3A 5H68A 3IR6A 2R8GA 4YRNA 3GUHA 3QNMA 3PC8C 5EHXA 1ZQ1C 1JG1A 4HQ6A 4EHJA 5CEEA 5CVTA 3DXFA 5AIBA 1XRLA 3OTQA 2XTJA 1QLJA 2O1XA 4EAQA 1TM1E 1LBHA 3UGKA 4QZFA 3G5TA 4GKJB 3OTOB 2VHCA 4AX4A 3EA4A 3MINB 5DBOA 3QXHA 1ZSNA 1E3DA 1M3SA 3REQA 1IDOA 3M1YA 2PTHA 4GX0A 4ZMSA 2P8JA 7MDHA 2GK3A 2X2PA 1E6CA 2AG1A 3MWKA 1S02A 3QIAA 4KDFA 3WJ1A 2IWHA 2G4VA 4CCYB 1XCBA 2CFRA 1R9GA 1JTVA 4I5FA 3VNUA 4QIWF 1UCFA 4NJ8A 2JVKA 3AF6A 1FUYB 2BKLA 3X1JA 2HMUA 3ND9A 5BR7A 3B1ZA 4X61A 1DJQA 1EDZA 1X8XA 4IAOA 4LYJA 4R1SA 1E79D 3T7AA 1YZKA 1OZFA 2MYUA 1DCKA 3QPCA 1XF9A 4BFSA 1EKXA 3CLKA 4OFXA 5HF5A 5K03A 4F9GA 2EGUA 2UVUA 2O7RA 4GZLA 3P9SA 1ABBA 3H5AA 4CHGA 2C2EA 2CMGA 3QYFA 1PJ8A 2R7MA 4I8XA 4X8LA 2IDMA 4F45A 3PUWA 1E9FA 3GLUA 4D9HA 3HCPA 1KO7A 1U1EA 2F9FA 2BUBA 4RH0A 3DVLA 1FVFA 5DK4A 2V7QA 3UQ2A 4O3PA 4C20A 4TQSA 4X60A 4G89A 4ILEA 4AJ4A 1RC1A 3EZNA 4UQGA 2LPMA 1WWUA 3PMLA 2ZRFA 3F47A 3IAXA 2O9JA 1H2HA 1SUFA 2NVOA 4NEQA 1SVUA 5AJWA 3L0DA 2W5UA 3U7HB 3DXZA 3HI6A 1ZN9A 3I72A 4EHFA 1J9ZA 3R5XA 1M6YA 1V45E 5JPCA 2TYSB 1U7PA 1ZOOA 1GQYA 1T9CA 1SBZA 1U7TA 1SBIA 4HN4B 3JZMA 4IGEA 4Q37A 2QJFA 4FD3A 1L8LA 1PFGA 3KYCA 3L82B 1SC3A 3PX4A 1H5UA 1OH5A 4PHEA 3E22A 4GXTA 3VTFA 4G2TA 4FKMA 2HHXA 2PWYA 5LA6A 4LXTA 4B3FX 4Q34A 2O5CA 3ZLTA 1V7PC 3UCFA 4I50F 3FFAA 4OJ6A 2GKGA 3G0DA 4H17A 4DDWA 4EITA 4Q1EA 1JL3A 5ECYA 4ER7A 2QXTA 4HOYA 1L3TA 4UTZA 2DKZA 3ORSA 4OX9Y 4R5HA 3M4ZA 2B1RA 2CEAA 1JXAA 3ESXA 4KQIA 3T5CA 3RLIA 4B09A 1R64A 1UEJA 4ADSG 4F92B 1VP3A 1EWVA 2RGDA 3I2YX 1OILA 5IINA 1FP2A 4Y9SA 2UVRA 5JPIA 5KFLA 9ICQA 1JHYA 1XTJA 2JZBB 1LLDA 3NAGA 1ZA2A 5HJ5A 3U7JA 5FH9A 5L45A 4GI7A 4TTPA 1IQ0A 2ZAYA 1VGQA 4O0LA 4O1IA 2C88A 2YDYA 2JLCA 2WJWA 4A8PA 2HJHA 2N3ZA 1N2IA 4PPYA 4D9GA 5IN4A 3BHJA 1T5DX 3K1AB 1E63A 1LXCA 3V1UA 3ICWA 3BWMA 1SCJA 5HGJA 3WG9A 2VTBA 3N6RA 5KOIA 3HXMA 2J5XA 3IB3A 4FFSA 4WL0A 5CB4A 3UT6A 3K8ZA 2BGIA 3ET5A 1JEDA 5BV2P 4NMMA 1U65A 3DM9B 1VG8A 4GPAA 2OCXA 1W85B 4LUCA 1VCIA 3W8NA 4AO6A 1SC9A 4WN3A 3N05A 5C7LO 3CCCA 3E15A 1M0SA 1TAGA 2AMLA 3UT5B 1O96B 4M54A 4G97A 3RYHB 5JYEA 2OY0A 1GEGA 2CUTA 3FGZA 3P26A 4F93B 3BSFA 4G4SP 4J9VA 1TJ3A 4XTRA 4AWAA 1GY8A 4RVUA 2VJNA 4HFJA 3BMNB 4BQFA 1CUSA 3FCOA 1PJTA 1HI9A 1P3DA 4OQDA 4WXPA 1WD5A 4BLWA 8ICFA 2GVNA 4HP8A 2ERXA 4PICA 3OCVA 4K6GA 3WVNA 4JZKA 4HWPA 1AQYA 1XEFA 2NUTA 3DR5A 3JRXA 4XXHA 3EPHA 1SD1A 2ZGVA 3LCRA 4L4UA 3LUCA 4LDQA 1L5FA 1XX6A 1YNOA 1PUXA 2HA2A 2RB5A 4H27A 4BMSA 1J22A 2A59A 1OI4A 5EWMB 4B83A 2B3DA 2IPLA 3EDMA 4XB1A 1E3TA 3A0UA 3I8SA 3B89A 2JIDA 5HFJA 1CUDA 1U5BA 2X2EA 3MOIA 4KLTA 1XT6A 1V8OA 1L6NA 3IEMA 4BX8A 1G2PA 1TCVA 1TF7A 4YHBA 4EYGA 1LFAA 5ICMA 2IOFK 5A7FA 4GL2A 5CHGA 2H1VA 4LY9A 1DRKA 2C7PA 1NJ2A 1N7HA 5ALYA 4LSMA 4S1NA 3RSOA 2RSLA 1LJ8A 1E92A 1QG6A 4FYJA 5KSWB 5KQRA 1DBPA 4I8IA 4MVXA 4H35A 4UPEA 2Y2VA 1L8OA 4LY6A 4HYYA 1N2BA 4E3WA 2DQNB 2JAXA 4ZQIA 1OLUB 1P7CA 4HDOB 4QUEA 3OTHA 4KC0A 1YJXA 1ZO8A 2HPHA 4QZHA 1Z6TA 1Y1LA 4TLBA 1PBNA 2F43A 2VPXA 2SECE 1NI5A 1VKZA 4BMPB 4TZ0A 1HRKA 1Z13A 3BMQA 5GP1A 5B58T 3V4FA 1WCIB 5HKLA 3QUCA 4MA4A 3ZHBA 3NVYA 4GRIA 1S7GA 4ZKDA 1ZJJA 1YQXA 4RMGA 5B3AA 1YVDA 4MA5A 5JLJA 3P9RA 1D4OA 3IEUA 2KP7A 4GWGA 1OGJA 5BOVA 5K2OA 2RKOA 4UMVA 2ASVA 4BGDA 4GLXA 1H5QA 2BONA 3FIJA 2IBMA 5CXSA 5CWRA 1CHDA 1QPBA 2XKAA 3SM3A 2XMPA 3VU0A 5U4QA 1WUYA 5TXGA 4ZVRA 3WAKA 5CT6A 2WFAA 3WP1B 2F1RA 4E5VA 4S1WA 1EVYA 1UL1X 2DJ5A 2FWJA 4HNTA 4BNWA 4XLLA 5AJHA 2AK2A 5LP6B 3CVUA 4AS3A 4M36A 5JLAA 2FSIA 2IOQA 3UZUA 4CIXA 1X1SA 1GQRA 2PRYA 3CRQA 3C6MA 4KWIA 4UHJA 4YLYA 5E6RB 2HRZA 1JBKA 5KFJA 2J08A 3IE2A 4KMOA 5CR9A 1RRCA 1KO1A 5DN6A 4ARAA 5ILGA 2WAYA 4EDHA 5ALPA 2C9MA 4BO6A 1QQ5A 3TGPA 2FFAA 2WR8A 2WVAA 4PFKA 1KI7A 2FE9A 9ICBA 4FX2A 4M9XA 2J3JA 1G7SA 1RJ9B 2JNWA 4E51A 4YDRA 4FXPA 2QTHA 1D2AA 1HV8A 1SQ5A 4CZ2A 4PNZA 1R8QA 4KCGA 4GYYA 4QDUA 3HW8A 1JN0A 2IHZA 3MF4A 3OU6A 2YBDA 3OKAA 3R5KA 4YFKA 2ZYDA 1VSBA 1Z45A 1NUTA 1XRRA 5DB6A 5D6OA 1JS1X 4G23A 5K3AA 3ZD9A 1H8HD 1N8KA 2X1VA 4V0NA 2LYAA 3C1AA 1Q7BA 2RI0A 3KJXA 5B7GA 1TKBA 1RI2A 2G9VA 3ROPA 4IXTA 5ECGC 1ULUA 1DBIA 2Q9CA 4FDMA 3WP0A 1ESMA 3G1TA 1DG1G 2REQB 5JJBA 1HMYA 4JT9A 2XJ9A 3GLIE 5AK4A 2M1XA 2BF7A 4DLUA 3NEYA 5DM1A 1WE2A 5H59A 4FE3A 3G2QA 3QE0A 1UMDA 2BGMA 1B1AA 2H85A 2E18A 3QI2A 4QWBA 1WPXA 3S2SA 4XRRA 3T7RA 2K4IA 1M6WA 2N42A 2OAGA 2A92A 1C30B 2QR3A 1EGMB 3EXIA 3GG2A 4LQDA 1G8KA 4R1UA 4W8HA 3UBMA 3B36A 3W5UA 4UHDA 5CB0A 2IEGA 3R7FA 3JPOA 2E4UA 2H6EA 1K8RA 4EW6A 1QTNA 1ZGJA 2ZFUA 4ZTBA 3VGPA 1H93A 2Q2NA 1HQCA 3KT8A 1A82A 1PV1A 1WZCA 1XNJA 2G17A 2O0LA 2QS9A 2ZVDA 5HIKA 4ZYLA 2JCYA 4ZIRB 4Z2YA 2GEVA 2IS6A 1ECWA 2O8DA 2RI6A 4R51A 1T9GS 4JYMA 4A8JC 1OH8A 2DUMA 2XLCA 3BD9A 2PNFA 1H2ZA 2UUPA 2PV0A 1MN6A 2G6TA 2ACKA 3AL2A 1KFSA 1XTQA 1ECLA 2IZOA 2LDBA 3NHUA 4IH1A 2C54A 4F72A 3SF8B 3TLKA 3IL2A 5CNIA 3TW8A 4O2BA 5J4HA 4B2IA 2IYAA 1U3TA 3H05A 1PWHA 1QGUA 2GDJA 4TWZA 1B3RA 4X8OA 2X9LA 4XGNA 4AZVA 1CJSA 4EUNA 4TYYA 2X23A 4DYHA 1U1IA 2WI8A 4AYXA 1U0JA 2ATEA 3DULA 3QKSB 4TXHA 3ZX4A 4TT3D 1CDEA 1OW5A 3URKA 4CMAA 2W6NA 1RC0A 1ST2A 4KX3A 1Z5WA 5KFQA 4JGBA 5J0WA 3LT2A 1U47A 3PUXA 3RARA 4BE7B 1WO8A 2XYHA 1C7IA 2XCIA 4R8RA 1YASA 2FETA 2OHXA 2VWGA 3M34A 5EGNA 4TUSA 2HIGA 5DBAA 3NRCA 3G9ZA 4IMIB 2CLIB 2DC1A 6GPBA 1KRPA 3CVOA 3H2GA 4G8BA 1RM5A 4LJ8A 5EZYA 1ECFA 1W36B 5EHGA 4U5QA 2OPHA 1FDIA 1OVGA 9ICRA 1KF0A 3DE7X 4JIMA 3V97A 1ZS9A 3QVGA 3AZQA 1SBNE 3LVRE 4FS2A 1VA5A 1SIJA 5AMXA 2ZTMA 1L0BA 4JSTA 3BK2A 4OK6A 4CUKA 5HS4A 1IEVA 3DQPA 1B16A 2A78A 5GZ6A 4BU0A 1UPAA 5KFFA 3O92A 4EJSB 2XE7A 5FEMA 4R1TA 4QIHA 4RSRA 3DT9A 3MXTA 1AF7A 1WW2A 2K2QB 1X7XB 1YRHA 4UOQA 3RSGA 3T94A 5CLJA 1DL5A 3JD0A 3F9RA 3IMKA 3GUVA 1NLYA 4TMYA 4QU0A 4MO9A 3NBFA 5F9MA 3RU3A 1ZR2A 3JRNA 4IRCA 1R6VA 2XXBA 1IHXA 2O1SA 5IAEA 4F3TA 4LXYA 5YASA 2AQ4A 1XI2A 2VN8A 4KQWA 1ZUNA 4UE3S 16PKA 2BMVA 9ICVA 1GUBA 2R11A 1RDFA 5AICA 3C3XA 3PSIA 3PEUA 4J43A 3WHIA 4DXDA 3NG1A 5IDXA 4UUNA 1JB9A 4WESB 2ZETA 5EY5B 2H1SA 4HSGA 4Y8VA 5ARDA 2W2OA 5KVQA 4ZOCA 1A7JA 4YCAA 4OGFA 4B6GA 3JQEA 5JW6A 3H83A 5D3ZA 5IXSA 1CSEE 3X1YA 2QG9A 2D1YA 4KSBA 2EKZA 1YRYE 2CJWB 4RK1A 5FBKA 2QRKA 3QF4A 3F9CA 5BMVA 1TF2A 2ZXFA 4LF4B 5ITZB 5KYXA 3PRHA 3ZY5A 1S5LU 3TNFA 2XXAB 2PSDA 3FCYA 4PGYA 3BRWD 4TOIA 3U7QB 1V6SA 4MRMB 1OXMA 9LDTA 2GBLA 4WADA 1B2RA 3IX7A 4DBVO 4Z6KA 3D2QA 1Q20A 1O9BA 5GJCA 2JGMA 2F4VB 1LRLA 2OYYA 1DQYA 1K2VN 3NBUA 3DOJA 2BFAA 1QG0A 3NW9A 1JMSA 1FUUA 4YASA 4MH0R 5IKOA 1AO0A 4QTXA 2OHVA 3FSJX 2FI1A 4H16A 4GEGA 5KJEA 4DIBA 4F6CA 5JASA 5DOVA 4JLBA 2HA7A 5DSZA 3PE4A 4UUMA 3E35A 3STHA 2B4KA 5JSFA 2MUTA 1UT5A 3HB5X 4P4MA 1WDLA 3V7YA 3CX6A 5SZKB 1T4GA 4X24A 5DU2A 1DAGA 3AFNA 4UJ3A 5DNUA 1XWIA 1YVEI 4IJVA 2YB1A 4LEIA 2A9QA 2PU5A 3JCZA 5KSOA 3FHLA 5A9TA 3CLSC 2RHRA 3D4PA 1RXWA 5HQTA 2JFNA 3P20A 4PU0A 3AUSA 2CDCA 3STYA 2W48A 3AKYA 3GYGA 1BRMA 2IXEA 5KG4A 4HNAB 1JJVA 4H18A 1O1YA 1D0IA 1PW5A 2BW0A 4G5QA 1YBMA 2OCAA 4CCSA 1UXHA 5K09A 2DHDA 4DIKA 5MGBA 1U9IC 3IMFA 1R4MA 1I51A 1WKVA 4G1CA 1CP2A 2EARA 2YN0A 4JBNA 2C1ZA 2QW1A 2QTZA 1G7TA 4B80A 4F6RA 3WU2U 5DP1A 4IOKA 4DOCA 2GO7A 1RMQA 3DFIA 2WE8A 3F74A 1YBAA 3MN1A 3TW6A 3GLFB 4LJRA 2HRDA 2H0AA 4M8NE 2IYYA 5EI5A 2ORIA 5E7IA 3WMWA 1FB5A 1Y6RA 3AM4A 5D2CA 4ZRDA 1L4BA 1KL7A 3QE9Y 3QRWA 3R5TA 2VSXA 4PZLA 3WLSA 4UB4A 3KJGA 4H7FA 4AZ0B 4DB2A 2ISOA 4O63O 1BQ4A 3ZW9A 1EJ0A 3KQOA 4ZREA 3CN7A 3GB9A 2XY7A 1GLVA 1NPYA 2VSYA 2ZIFA 4JBYA 4KWHA 2B7LA 2HBQA 3QBTA 4N8DA 3ZS8A 4MR7B 4MV6A 1ZQMA 1TZJA 4PLFA 5TRTA 4KN4A 1T35A 1NMZA 1SVMA 1PL8A 3BFPA 4JYAB 1J8QA 2H3FA 1G20A 3E18A 3QJGA 2XGPA 5DOZA 1K6MA 1I94B 5C0YA 3LH5A 5KB3A 1N34B 3MMXA 2YVLA 2Z5VA 4NBWA 2X3UA 3THSA 3RVJA 1C4WA 2WIJA 4H4DA 4CCHA 4J3FA 1WUIS 1VL2A 2A88A 2IXTA 3ONVA 2P2GA 5C8ZA 1HNNA 2EDCA 3H2IA 1ZH0A 1E8NA 2A0YA 2C5FA 2BI8A 1ISIA 2C2KA 5KC8A 3ADKA 3FOCA 2XIQA 1C30A 3TOZA 2WTEA 5ALVA 7ICIA 1Q83A 3IVMA 4KN8A 3VO1A 3IBYA 1Y3HA 3C16C 2HF7A 2JW5A 3OHPA 4G1MB 3U3JA 3R0IA 3JX9A 2I2XB 5AUQA 1A3CA 1T6ZA 2ZRBA 3WK9A 1IIRA 1SA0B 3CIFA 3D7NA 4FZJA 3DTTA 5EXDA 2UYOA 1ZYQA 2REXB 4NHEA 1N33B 4P36A 5JSHA 3VO2A 4FZNA 1XOIA 5C4MA 5JCJA 4S1OA 3REOA 2VUSA 3EARA 3SZGA 1X9GA 2XTNA 4YYZA 3K32A 1XZGA 5AVVA 3EGWA 4WZAB 3ZK8A 4D82A 3QELA 4J9SA 4QTYA 3EUAA 1EAMA 4QLOA 4J3NA 2CKDA 3IGFA 4DSUA 3E70C 3UA3A 1N2EA 2ZVPX 4FUQA 1R5JA 3M3PA 3ZJ5A 1GRRA 2XA1A 1TJ5A 3ZK7A 3T4PA 2RHLA 3P94A 3Q7TA 1FNMA 2YHAA 4RQ0A 1IHYA 1USWA 2OGUA 2R8ZA 2ZVQX 5T67A 3C48A 4GPZA 1G38A 4NYIQ 3GZJA 4MWGA 4UMDA 4BY9E 4Z9XA 3IV9A 1QO9A 3GAAA 1IOZA 3SZUA 3TMKA 4ENPA 5CA1A 1NYTA 2CLOB 3KKKA 2YL2A 1MNAA 4DFMA 4RWZA 5DLGA 4BB5A 1E4VA 5ERXA 1VKRA 2Z95A 3V6KA 2X0KA 3AV3A 4AQDA 3DL7A 2CXHA 4XM1A 4JC4A 1IBMB 5DPMA 2FLNA 2OXOA 4LVNA 2UZ4A 1PGPA 1Y4DE 3RTCA 3THWA 4PZYA 1X1EA 2HZBA 3EVFA 3VJMA 2HFKA 3CRVA 2NTVA 2OFPA 5DBGA 4BNKA 4DY4A 9GPBA 3B13B 5FQNA 2WJYA 3TSCA 2VI5A 3HKZC 3PF9A 5J3JA 2ZANA 1Z00A 3ADBA 3HCOA 2ZI6A 3AUYA 1NQUA 1QO0D 1V71A 1SZDA 2B0CA 2HNAA 3EDCA 3D3KA 4MWTA 4XIFA 5I8ZA 1E5XA 4D9NA 1X7ZA 4F8EA 5CTAA 4ZI7A 4I7EA 1IBCA 5D6NA 3PLNA 3DWEX 1TL7C 2AZXA 4L6IA 1SOMA 1PFKA 3PYXA 3AERA 4CQMA 1IQRA 1UOOA 3OJEA 2PUTA 1LKYA 3HBMA 3JZIA 3NHFA 2WV7A 3KUKA 2ZBVA 2P2CA 1QGOA 3PJRA 2R5FA 5JVDF 3MTIA 3ZXXA 4CR7A 1GXSB 1OX6A 3LV8A 4RVSA 3BS4A 2FUNB 4I2CA 3IP6A 1DI0A 1SQSA 2WUDA 3JVEA 3OIFA 3ZBPA 3BE4A 4DZZA 1YQGA 4NNOA 4D9BA 4GXKA 5AM2A 1ZQRA 2C58A 3HJBA 5L4LA 3DDSA 1EK6A 3RJIA 2CJWA 4X7RA 1AVTA 3HXLA 4H3KB 3O38A 2O8FB 2A1TS 4DZRA 2DLNA 4D0NA 4O59O 4ECEA 4J9UE 2IQ5A 3PR4A 1JSLA 3O7WA 3ZVKA 4QLBA 4J0KA 4YV1A 4QOIA 1SKWA 1OXBB 3SZMA 4C0SA 1MD9A 4BJHB 5I01A 2AOTB 3MGIA 5ED4A 2AYXA 3JQ9A 1E3WB 3NETA 2Y9UA 1U8ZA 4RSGA 3TX2A 1ADJA 4J3JA 2IHBA 3NHMA 4PVDA 5C8DA 3VPBA 3UVEA 4C6TB 2VDRB 2XZTA 1SG0A 1DC8A 3LHDA 5FCDA 3R3SA 4ITUA 3UJHA 5JD5A 3VXKA 3CUYA 1B43A 3WR5A 3L6BA 1IVSA 2Z2YA 3AEQA 1A4UA 4ISCA 4A2QA 3KR1A 1QZXA 2X2OA 1EVKA 3AF2A 3HPQA 3ZWXA 4RIIA 2YQ5A 2IV7A 3PUZA 1Z06A 2YB4A 5JXJA 1RTKA 3BMNA 3HVIA 4GMHA 4M98A 2DR2A 4AS1A 4DMLA 4QUDA 4RTJA 1Y1PA 1B6RA 1TQ2A 4QWAA 5LD2B 1YRWA 5FBVB 3LVFO 2P1DA 2B0JA 1AQLA 2XUKA 4G8CA 4R31A 2WUGA 3GCDA 5TMBA 3D2LA 2AKYA 4PRZA 4IHKA 2E9SA 2MYNA 5J0OA 4YR7A 3M6KA 4FR5A 7ICPA 3AXSA 2XYPA 4LHSA 4KRGA 2ZRDA 1YS2X 3B78A 2BMDA 1K8QA 4NCJA 3O0FA 1C3OB 1BGXT 3KJFA 1AXEA 1QAMA 2V0CA 3C8DA 2DBYA 1UOEA 3FYDA 2VJPA 2CNDA 3G68A 3HY6A 2OFFA 3UKOA 1JR3D 1AZWA 3AI3A 4U2DA 1MT3A 2H54A 2ZSJA 4HV4A 1E3MA 4OSOA 5BXQC 1R66A 1AQUA 1UKEA 2DHRA 4D42A 4PO3X 4KLMA 1WM1A 3PDHA 1M8JA 1SQ0A 2IF0A 3VTKA 5SZIA 1B0PA 4W7IA 1HDIA 2XHEA 2VFAA 3QQ5A 3B48A 1LFDB 4Q43A 3RUAA 1VPEA 2VOJA 3JPWA 3CP8A 5JHGB 4AJ2A 1GRQA 2NAFA 4OM7A 4D79A 2WEKA 1RQ7A 2BEVB 5GIPE 2VOEA 2HHVA 2O2SA 3DL0A 5K3FB 3Q98A 5KYWB 2GYWA 2UVDA 4R7TA 4NCBA 2NTJA 3NYRA 4UVIA 1WBDA 4ED3A 1EK1A 1OR8A 3CO0S 5G0TA 1K98A 5D00A 5HDBB 1K6JA 2NM0A 5IUNC 4XWWA 1NRXA 1O9HA 3PPYA 1LV8A 2HWWA 2VK1A 2X7HA 1CC1S 1RQGA 2V7VA 2VAWA 2C7BA 3OCXA 5B2ZA 2PA0A 6AT1A 5JYDA 4O4IB 3GEBA 3NTQA 1AK9A 4JS0A 4U7GA 2PD3A 4JA0A 4HK4A 1NBWB 1Z6XA 1JGTA 1RADA 4LYAA 3VYVA 1RBZA 5HR6A 2OV1A 4I14A 1SUPA 2B8EA 4QFBA 3SGLA 2NNWB 4RANA 3M6AA 2OCLA 1G9XA 1EK5A 3RUPA 3FKSA 1P1RA 1ZXLA 4O5CA 3K20A 1PG0A 3WZ2A 4CIDA 1J90A 3RIHA 1IIPA 3F78A 4BV3A 1DC6A 1T4CA 1P5FA 2XEDA 2Q5JA 4QZGA 4Y2JA 2WWHA 1FX0B 3IIIA 3N0VA 3R7BA 4B34A 2VA3A 5ESRA 4EG6A 5IKXA 3UWKA 5FO0A 1AA6A 1E59A 1A9XA 2FF5A 3NLLA 2I03A 3AJ8A 4UCFA 2FVYA 2V4MA 1KXZA 1VGVA 2QLNA 3OAAA 1N9GB 2JFHA 4I2GA 3AFGA 3F3YA 4MVCA 3RI3A 4ENQA 3MD0A 3DZDA 5FWNA 4DR6B 1JW9B 1ICIA 1JR2A 2O2YA 3NONA 4IZHA 4US1R 2DFPA 4OJPA 2MSCB 2YV3A 3C8ZA 4LW8A 2LI6A 4X8HA 4RVNA 5DWDA 2G3YA 4PLWA 4UVGA 4BO3A 2GQ0A 4M4SA 4WERA 3UMJA 1PV4A 4RV5A 2D3DA 1BU8A 2QLMA 2TS1A 5I5EA 3LPCA 1N6KA 4FMPA 4R8KA 2BHRA 2Q4DA 2WAAA 3JYLA 4REQB 1G20E 1RI3A 2H48A 3P9CA 4HJRA 1GU7A 1SELA 1U3GA 3CLRC 4XIGS 4EYSA 3WXBA 4URWR 4YMLA 1Q8KA 3INGA 2D4AA 2VUUA 2YC2C 3A05A 4ZANA 5A9RA 1ZQYA 2NPOA 3K9FC 4MV8A 1G8JA 3H3JA 1V16B 3H87A 3IQHX 1BRTA 1MB4A 1NZFA 4JYPA 3ES9A 2YHSA 4NG5A 1J6UA 1XD9A 2QQFA 2JL1A 3S55A 1A1VA 3GDXA 3E53A 2XLBA 4L28A 2W43A 4OO3A 4EW2A 1FFXA 1W34A 1WMDA 5BYAA 4X63A 5IBPA 3QNUA 4HAVA 1SUEA 2CHGA 2K4EA 3DF9A 4QC2A 5DQGA 2A5DA 3LO5A 1JIVA 1UC4B 1EJ6A 4BNXA 4TRRA 3SQIA 3EFEA 2RH9B 1J00A 3C6BA 5AT1A 2BSXA 3GNLA 3ZDRA 1A6SA 1GPYA 3NVWA 2OESA 1VHQA 2GBPA 4G1EB 3N2KA 3VR4D 1KYZA 3C29A 3H19A 1VIYA 4OLAA 1ZWKA 2CVPA 4OHOA 3TW4A 2YMQA 3NHJA 2ID9A 3LWZA 4HQOA 1KAGA 3HYSA 4UNNA 4JMPA 4L75A 1FUKA 1GGNA 3O7MA 3EPJA 5KT5A 1PCXA 3DAPA 5CGZA 2Q41A 4YRQA 5KTNA 3ABOB 1NNEA 2GKSA 3D6TB 4U39A 5FBQB 5L40A 1I32A 1KVRA 3W2FA 4UAYA 4F06A 5ALNA 1JEQB 2GN9A 3A3OA 3W77A 4DQDA 1MMFB 4MV7A 4YMTA 1NBHA 1KTIA 1P6XA 1B23P 4DIMA 4EEXA 1NFRA 3HX0A 2JCXA 4ZQGA 3KNZA 2IPAB 4HUQB 4OQNA 1JSRA 4C4PA 2V3VA 3BQ2A 1CU1A 3IB6A 2ZJ5A 4JKYA 4QXAA 3W5AA 3D6AA 5DBBA 2NXJA 1NWHA 1W9MA 4MYTA 2XC9A 1TJYA 4RH1A 1TUIA 5B6JA 5C8YB 5B3JA 4IDHA 4URUR 2ZIWB 3KUXA 4O3MA 5K0NA 1G5RA 1N6PA 1P31A 1QKKA 3RGWS 3DTYA 4PHCA 2ZBRA 2QLBA 1YS7A 1O4VA 2J1LA 3GFRA 4XYGA 5H02A 3KJZA 4AYBF 4AK9A 4EHIA 1JDJA 3GBSA 1NJFA 1BD3A 4D9EA 3RJZA 2AHOB 3HVJA 1KEUA 1QHGA 1P4AA 1XU9A 2M0NA 4UU1A 1R0XA 3AYXB 2XUAA 1IM5A 4G86A 5ALZA 5I7FA 1V2HE 2IYPA 2JRCA 1QV7A 1VLJA 1QIKA 3KLBA 4QU8A 2O2JA 3G5UA 1OV6A 1PJLA 2DT8A 3A2NA 4MQMA 4WK6A 1ZU4A 4G1UC 2IEIA 1TLFA 2O6HA 3NAQA 2ZI9A 2WF6A 3E84A 3P32A 2K89A 4RPKA 4RX1A 5EXPA 5AVKA 2YQZA 4U00A 2A9JA 2KJ9A 2HO5A 4NJMA 5C1IA 4P7KA 1PR9A 4QGAA 5K3FA 3QPVA 4C03A 2HB6A 2W93A 1RBQA 3PSTA 2QP3A 4HQNA 1RQNA 3H0EA 3PYLA 3TZKA 1UZLA 1RRVA 2GZDA 1HC7A 3ALRA 1ORTA 2G7ZA 1CJBA 1MC1A 4BX2A 4F3KA 1GJRA 1JILA 3RBEA 1FDVA 2J6SA 3KVYA 4EELA 3F3SA 4N01A 1BMDA 1JEOA 1N9GA 2X5XA 1XL0A 1LNSA 4O4IA 5BMVB 2E4WA 1QLWA 1NVUQ 1FRVA 2FNAA 1Z2CA 5REQB 2G1KA 2L2QA 3QVUA 5FI1B 1ID8A 3I8OA 4IMPA 1PNRA 3MC1A 3DV9A 1TD9A 2KHZA 4RQ2A 4LCBA 5HPYB 3E0FA 4XYEA 5IC4A 1DELA 2EEZA 2PVPA 1O3YA 2GZSA 4HWKA 5F3RA 1U7WA 5FR2A 2BCRA 1TVEA 1OI7A 3BQTA 1MJNA 1OIVA 1VJ0A 5E1OA 3RUCA 2EEPA 2QB0B 1T5IA 2H52A 2NO9A 3EVBA 2I8CA 3OUZA 3Q3EA 2JH7A 1SUIA 1TEXA 4R9NA 5HUJA 5IJ9B 5KG0A 1QHEA 4ZK2A 2JZBA 5C37A 2AFVA 5DHSA 1YBVA 4YD1A 4ECZA 1ZQFA 3D2SA 2KQUA 3NDJA 3PHGA 4OFZA 4RDCA 3ZLJA 2PWPA 1NQAO 1DC5A 2K4MA 1R2QA 1A9QA 5BORA 1MJGA 1G20B 3P0FA 4QPZA 1JV2B 2F6RA 2IMWP 4JWNA 2P5SA 3DL4A 3LHIA 3M9XA 1APBA 2ZTHA 1N5WA 1PSDA 2HHAA 1L3UA 2QYOA 4Y3UA 1FFDA 4JJZA 4LXXA 3TOCA 4M9CA 2BCSA 5IT9A 4IEFB 4P33A 5EIAA 1N2XA 4RNOA 1X8KA 2CNWA 4IMRA 2UXBB 1O8BA 1RI1A 2PS3A 1E2LA 3L18A 1DUVG 3FTFA 13PKA 1SXJC 1FYXA 5JDCA 5JS7A 3FY4A 4G0NA 1GPLA 2X6RA 2CLKB 2CCKA 5A5EA 2V9PA 3PVZA 1XNHA 4RTKA 4GNKA 3C5CA 3T8YA 3DP7A 4EATA 2ZWOA 4WNAB 4YBZA 3TG2A 2ZJ6A 1O97D 4KGVA 2VVTA 4LYYA 5D3KA 3UXPA 3I64A 3GLFA 1O8CA 1POXA 3GBVA 2J0SA 1A9PA 2G8LA 2FG5A 4L4ZA 5HJ7A 4XQCA 3WL4A 1XTRA 4GAEA 2QN3A 4ZVSA 3W4JA 4EY8A 1R15A 1UZMA 3N2KB 2D1SA 4ROTA 3V8EA 4UQLA 3ZGZA 2LYBA 1YONA 4AW9A 5EJ9A 1TJ4A 2IVZA 1CUFA 3PZBA 2QTNA 1NFQA 3IQXA 3NS1A 4PWYA 1UZAA 4BBJA 4FX5A 4LTNA 4LGVA 3CY6A 1BJTA 4C43A 2HSGA 5E7QA 1H1LB 2RHFA 3Q8MA 2WF9A 1J99A 1FTGA 2YOFA 2NYAA 4I55F 1L1FA 4ZYXA 4ZAWA 3ACDA 3H2JA 3RS4A 4EZ6A 4HUJA 3ZBUA 1FUIA 2AGQA 1KFDA 2ZUSA 2HHJA 3KPWA 2QRZA 2PUCA 1U98A 3PPWA 1E4EB 1MQ8B 2ONZA 2O4CA 4C6HA 5JIBA 1WV1A 4TUYA 3N3AC 4QBKA 4AUEA 5JNWA 5ALHA 5JS8A 2C57A 3SC2B 2XDWA 3LW7A 1NKCA 1NX6A 2IIQA 3FDZA 4G01B 3D6NB 3TXXA 2DETA 4QZAA 3K6SB 2H59A 1WU8A 3B5EA 3LM8A 1E4OA 2C22A 4HZUA 4A0QA 2AS0A 4ECVA 5KFVA 4YRIA 3QSYA 4HLUC 5FHQA 2ZJOA 1NUUA 2Z8XA 1W19A 4OP3A 1QQ6A 3DW3X 3I45A 2ZBQA 2D2EA 2ZU0C 2FXVA 2J31A 5J2UB 5AKIA 3C23A 1GNPA 1ML3A 3M3HA 2J67A 4TT3A 4UXHA 4LXIA 2GLEA 5J1TB 3CSDA 4KXVA 4HYEA 8ABPA 3ZJVA 1JLLB 3F96A 1L3VA 3G5AA 2FDRA 4POAA 1GV1A 3DBLB 2AR0A 2GR9A 4LDZA 5C3UA 1NXWA 3V32A 5K0ZA 4J2OA 3S99A 2BBWA 1XTVA 1XD2A 3S1AA 4R2IA 4EY6A 1VRWA 1KYVA 1Z0AA 2LDXA 3CS3A 4ARZB 5KOHB 4FFDA 3RH6A 1YDGA 3KQUA 4FFOA 4TLAA 3ZE7A 3G6XA 4CM3A 2VPYA 5BSFA 4RJLA 1QOZA 2JIOA 4ZA2A 3RV3A 1UPHA 1CIVA 1RWWA 1W0CA 2PX2A 1LKYB 1Z2AA 2OGZA 3GFOA 4TM7A 2VCYA 2FAXA 5M04A 4X95A 1TTTA 1P9LA 1CXZA 2Y77A 4XOUA 1GKYA 2B20A 1KZHA 5I45A 4ZOHC 1S2NA 4RT2A 2RFLA 3M8KA 1WP9A 3SI7A 4QXQA 3WIUA 1NKEA 4DLNA 1B2LA 1VC2A 2EFGA 1EHCA 3OFNA 2E1PA 4CXMA 1K7FB 4JP3A 1YZ7A 4C0WA 5E4JA 4DJ5X 4OJMX 1KJYA 2AMYA 3K8QA 4XR4A 1Z5PA 3BCSA 3DTVB 1SEVA 3IAAA 1X1AA 2IHYA 1NF3A 2ZSAA 4YRKA 3CZ9A 2UVVA 3AQ4A 1SG9A 4YJ2B 1A2BA 1C1XA 1H0RA 4H0CA 4C89A 2RIRA 4MZDA 2RGWA 4PLCA 4D9FA 2YJ4A 3CH5A 1QNFA 1KVUA 221PA 2XCQA 4D99A 2X9NA 3G9XA 1LV7A 3KT3A 4RKRA 1YUNA 2LD4A 2HEGA 3P9ZA 2NPIA 4ITRC 2PANA 4BECA 5IABA 4X85A 1TMKA 3U5ZB 1NF8A 1AQIA 1MB2A 4KIJA 3C4QA 4YT8A 3M8SA 2EJCA 4F84A 1XLWA 4PW0A 5GONB 1NUHA 3D6UA 4F12A 1D8AA 2OHHA 2ALJA 3HCRA 2B69A 4C7ZA 1LU9A 4HAYA 5J5VA 4RA9B 3ZWMA 5K05A 3IQGX 3C3EA 2ZUTA 3VH4A 7ICOA 1UDAA 2W4QA 5BV8A 1O9GA 2OBNA 3B5JA 3PUIA 3RRBA 5KKNB 2NAPA 3SVLA 1V7QA 4DADA 1JLHA 4DUGD 1QMPA 2H2WA 3MFQA 1O4WA 3O8OB 4MGHA 5CYPA 1U1DA 2FSFA 4NY1A 3TK1A 6CHYA 2Y9TA 4Z6CA 1XQYA 3LC1O 1MDFA 4I2DA 4IRUB 2NPFA 2AJTA 2CB0A 3BS5B 2FE4A 2HU2A 2ZI5A 4P4NA 1I24A 1Q6YA 1U7OA 4GEKA 5GJVC 3X2EA 1VLZA 1W96A 4JEMA 1JU4A 4MV3A 5IEJA 1F6BA 5LP1A 3SDZA 2A84A 1F2UA 3GGSA 4RD6A 5K4HA 4BQSA 3UJAA 5AKXA 5DHTA 2PYIA 3GRUA 4EWLA 3RJTA 2Y4NA 4UVEA 1GZ4A 2P0AA 3UMRA 5KYUB 3MCAA 5ELMA 1CFZA 1UBLS 4HDMA 3LBNA 3IOMA 2R5WA 3RB3A 1NQTA 2WT9A 4H08A 2PZFA 4DBLE 4IRMA 4BKOA 1AGYA 1W1IA 2IYSA 1SBCA 1EEXB 1LA2A 4U7DA 1ZQZA 1NHGA 3NZEA 3QVKA 3UCEA 3OA0A 4EK9A 1NMYA 2WU3A 2HA5A 1WDMA 4P34A 4P31A 3ZW7A 4QYXA 2HD4A 4M88A 3ZWBA 4I4TA 4BMDA 4EB0A 5IYZA 1PEDA 1VLQA 4R2WA 5KFSA 3Q5DA 4QHSA 4N1AA 2CE2X 3N87A 4WY8A 5AQEA 4AU1A 4B87A 4DWVA 1YE8A 3GJ0A 3QWIA 4RQ4A 1I2DA 4JP1A 3C0KA 1X6VA 3MA0A 3UB3A 3BHMA 2OCGA 3GV0A 1TC1A 3EFHA 4XASA 3OI7A 1QRAA 2H17A 2XWSA 1FP4B 1UOPA 3ZIUA 1Z7BA 1I7NA 1X40A 1XMXA 3E3NA 3F2VA 4URVR 1QHSA 1N5JA 1MH9A 5EOZA 1JEJA 4KLIA 2E4VA 4U6NA 5CPFA 2O07A 1TAHA 5ITZA 5KYXB 2OQIA 2B4AA 4F4IA 1CBUA 4U5XA 3ITDA 4ECQA 1CUVA 3JQBC 2KEYA 4MW0A 3RBAA 2X13A 2PKEA 3A1DA 3B1XA 2G83A 4EFKA 4UW9A 2C5GA 1VXRA 3FAZA 5J5AA 2RCNA 3FNIA 4MGKR 3PE3A 4UM8B 1DGQA 1TMYA 2V9ZA 3E8MA 5FPSA 4TVKA 4UNRA 3WK6A 1LVHA 1II9A 1NONA 4MB0A 3TB6A 4D9JA 1NK8A 1E1RA 2E1FA 1IY9A 4WHMA 4YV2A 1IFXA 1KO4A 5K6AC 2G67A 1MIOB 3PEWA 10MHA 1J42A 3AF1A 4CTOA 3FX2A 4E21A 1KBQA 1XR3A 1Q7RA 1SKSA 1YT5A 3AV0B 4NCXA 1AKQA 3WL3A 3L8YA 3WKCA 3D4LA 1KYYA 1SOVA 3OIUA 4CFZA 2J3EA 1A9ZA 2D8AA 3K70C 2H4WA 1EFTA 2LMRA 1K92A 3BTOA 2C07A 4WACA 5JS1A 3FTQA 3MB8A 3O2QB 3FNGA 1KFCB 3F9IA 1EVQA 2HX1A 1WCV1 3GZFA 4JOSA 2JLWA 4HNRA 3QPUA 3KTQA 1VCMA 3EAQA 4JI8B 1E2BA 2KKPA 4BDTA 1B73A 4E3ZA 2OAP1 5JAOA 4KLLA 4Q00A 4HGPA 1C50A 3TSAA 2IT1A 3UV7A 1J23A 4MJ7A 4LVUA 3L93A 1LK0A 4QELA 5IDWA 3HJUA 3ORQA 3RIXA 5C5JA 3H1PA 1XJCA 2D2FA 1EFPB 2FPUA 1XWWA 1Z8NA 1PE0A 1PLJA 5AKHA 2AG8A 2Q6KA 3OQHA 4MIOA 3F6BX 3ZHTA 5A4DA 4TKMA 5FLYA 3D0OA 1NSTA 2J59A 3G7UA 1WJGA 5J2AA 2IW1A 2QZPA 2JLBA 4X5OA 4RTRA 1NRWA 4EBFA 3FSGD 1S0MA 2VP9A 2XPCA 3BIJA 3OPQA 4NYJQ 3AL0B 2H3EA 1UKBA 1ZIOA 3F6EX 3I37X 2D5BA 1PEAA 4R2HA 4YP0A 1YL5A 2E4YA 3RYIB 1T1SA 1Q2UA 3A9UA 4PPFA 2PRSA 2GN4A 5IU6A 3X1MA 5JAHA 4R6WA 2AB0A 2DUWA 1PP4A 2XUFA 4A92A 4YACA 1PVPA 5LN1A 4P2BA 2HW8A 3KJEA 2PI5A 4DSIA 1ZH6A 2A5JA 3W79A 2O0HA 1QHHA 1VG1A 2VAVA 1HT1E 3LOQA 3L1HA 3Q8QB 3CC8A 3URMA 3V48A 2BCGY 4BX9C 3OIVA 4KQ2A 2FP4A 3FNHA 5EJGA 4HYKA 5DLFA 1HFJA 1XTPA 5T8KA 2P69A 4XX1A 1Z9BA 2BFMA 2VH1A 4OEHA 4OQQA 1B74A 4ZO9A 3VVLA 3ZVNA 1LS1A 2V4RA 4DCGA 2DPMA 4L4SA 4CRWB 1ZVJA 1RPTA 2G40A 3HDGA 3R6LA 2DERA 5JV5A 5IT5A 3OOJA 1X9HA 2V7BA 2JFPA 3EEQA 3LZ6A 3H9EO 3OJSA 2FUCA 2VNSA 2XDAA 4BVGA 5JAIA 4GKBA 3OEEA 4YJ3B 4OOEA 1MTOA 4WQMA 4TVSA 4J90A 2H9AA 1NT4A 4YJGA 5DP2A 4ACOA 3TSYA 3UPTA 1JBEA 5IAAA 4WLUA 1ZCBA 2XY4A 3F49S 3AX6A 3GEMA 4OU4A 5GWXA 1X74A 4H0FA 1QAQA 5DX8A 3DGFC 3HI4A 4FKBA 4US0R 3ZE8A 4XRGA 5AOCA 1XGKA 3O1IC 2V7QD 3L9WA 4Z3KA 1Q22A 1RQXA 1K5PA 3ZGNA 5IDQA 3RAXA 1U11A 4LJ9A 2R8JA 1FRNA 4O4LF 4ODIA 3IV6A 1OXSC 1P60A 4Q7QA 4Z0NA 3UJ6A 2W3RA 4TS9A 4XWOA 2OLJA 2PLAA 4ZT2A 4HAWA 5IJZA 3TWOA 3WLTA 1KKUA 5KPJA 4QM7A 4DPLA 2AEJA 3DO8A 2ZIUA 3EYAA 1I4WA 3LDUA 1OQAA 2GWRA 4JODA 1Z5GA 3O47A 3OOYA 4X1OA 4B75A 2VT2A 1ZD3A 1OIWA 2SNIE 4Q4HB 4Y7DA 2F7SA 1RYFA 1JHUA 3ZDCA 5HCUA 5I9TA 4F3CA 1N5OX 3ETEA 3VAYA 4WN9A 4AIIA 1RG6A 1MIHA 3QBVA 4BRUA 2VS1A 3JYPA 2QVXX 2HVHA 4G5RA 3JYOA 1C8VB 1IJKA 4FINA 2XCPA 3ZEIA 1ZVVA 4ACAA 5DFAA 2OFOA 4QJ5A 5LP6A 1RABA 4YCDA 4OAQA 3NJ4A 3RU2A 2HNKA 5AK6A 1XSPA 3KZNA 3LD9A 2NG1A 3S0JA 4EKEA 3T7DA 3N2GB 4I2EA 3GXOA 1NT2A 2WD7A 5J0PA 2N1BA 2QYTA 1LX6A 2RGXA 2XKJE 3B2EA 3E23A 1GUAA 5F3XB 2QMYA 3G0IA 4O4JF 4YC7A 4MHVA 4N03A 1DJPA 8GPBA 1Y37A 2I91A 2VDPB 5T3UA 1M8GA 4LHEA 1SCUA 4MRAA 1DGJA 4RD0A 2FSSA 2FZKA 2R3SA 1MN8A 4JGIA 4R1QA 1SBTA 1Y89A 5JMOA 4HADA 4CG0A 4LTDA 4EPYA 5BRAA 1GZ3A 3NFYA 1KSFX 5IASA 3VI4B 3SXPA 2EDUA 5CDHA 3WE7A 1IN7A 3L1JA 4Q1AA 4TQRA 2XQKA 1W9HA 1PNOA 3ANSA 4DAEA 2X41A 4DJFC 4JI2B 4YALA 3DC7A 2FOXA 4DVGA 4DEXA 2OG1A 1UKVY 1USIA 3SIXA 3MAJA 3ZDEA 3OVMA 1JQ5A 3LL7A 5H3LA 5I7UA 4J6EA 3QLVA 4MUIA 2IP2A 1KTVA 2BELA 3DWIA 2Q50A 3PC7A 5CYFA 3T4UA 1OBFO 4NWIA 3BJZA 3QKWA 5AK5A 4UDNA 1A4IA 3AR2A 3F2IA 2CCGA 1EBBA 3G02A 4EG1A 3Q8RB 2J3HA 4W63A 4DR3B 4NZMA 3KQYA 2IP1A 1ECPA 1J0DA 2HY7A 4JI1B 4DQIA 3GP8A 1B6SA 3PO4A 1TZKA 2W6JD 1ZQAA 5DTJA 1PNTA 1YL7A 3QFFA 4H4EA 3QH4A 3WL8A 3THYB 3M5WA 1Z15A 4C76A 2GB4A 2KI5A 4MUHA 3RSSA 4AJ1A 1M75A 1XSLA 3AEVA 1DTWA 2D2XA 1DBQA 2BEWB 3JY6A 1XTKA 3MCWA 4HWTA 3BD6A 4DDUA 5JH7B 1K0UA 2Q3BA 1N7GA 3M4YA 3D8BA 2QTWB 2M98A 3UV6A 1E9AA 3HR7A 2KJ8A 3BCHA 3WNDA 1UODA 2WG1A 5BSWA 1QVRA 1DAKA 2JD2A 2YOHA 3KCQA 3PUJA 5EFZA 1RPJA 3WIEA 4BZZA 4PG5A 3RNOA 1W0JA 1ZZEA 3K5HA 5E3IA 2KTQA 3CH6A 4MIEA 1F4VA 3CLTC 3RFUA 3UOGA 5F7XA 5JO0A 1XO1A 3TD6A 2H07A 4WLEA 4HB4A 2BMFA 1XHLA 2DLCX 1M34A 4KMRA 5LQSA 4FOTA 2JFQA 5DEOA 1Y42X 1V4NA 3T0GA 4OQZA 1T13A 4BQNA 4CIAA 2Q28A 4U7FA 5A9SB 4H3HB 3B8EA 3A26A 4ETNA 1H1LA 1B3BA 1CT9A 2DMRA 1VYHA 1SBYA 3CX3A 3PW7A 2A1TR 3E27A 3MRTA 4LYHA 5TQVA 3HRDD 2OXIA 4A5SA 5BNTA 2BEUA 2E21A 2PWZA 1XCLA 3MJSA 2MT9A 5AKEA 1JA1A 4IR7A 4Q01A 3B38A 1CY8A 2CBZA 5FV7A 1GNQA 4B85A 2E4AA 3KJNA 3KPJA 4IZ6A 3QU4A 1OFUX 4DA6A 2HNBA 3BWVA 4F4DA 1RXUA 1L5LA 4XQGA 3R6TA 1W7AA 4IO0A 3ZU3A 3ZD8A 3ZDAA 3LRXA 4RMNA 3VC3A 1QYWA 4G41A 4TLEA 3T5HA 3MUNA 5HR7A 1YJCA 2YOGA 1Q44A 3IURA 4OUDB 3IBGA 1K1EA 3AK4A 2YN2A 5A4AA 2QBYA 1D8BA 3L3FX 1C1YA 1Z37A 3WV5A 3FFXA 1QH8B 3NOXA 4RPYA 4QBGB 3VKVA 4IFEA 1TK0A 3T9EA 1IEXA 1JEAA 2IUTA 2MINA 2QLFA 3F7OA 1JKJB 1T5OA 2ERCA 3CPEA 3HCDA 4UBIA 2FSGA 1QP8A 4RABA 4K6FA 1L5QA 2XUHA 3O8DA 4JI5B 4AMYA 1KEEA 3C3BA 3RIGA 1V0JA 1KAEA 3KTAB 1RKVA 2GZ1A 3LMKA 3BWCA 4UB5A 4ND1A 2O2HA 2WJJA 2PFQA 2VSOA 4PYRA 5J2EA 3DD5A 3EY4A 2RGNC 3SYRA 4PZNA 1B8VA 1DRUA 1DINA 4NQZA 1NP6A 2PFNA 4M76B 5F21A 2YMPA 4RD2A 4Y1FA 1KDVA 2WWYA 1PFYA 2JJ1A 4B74A 3WWZA 4DJDC 2HU5A 1ZAKA 4UZEA 2HCRA 2EAMA 1HIWA 3TUZC 1GSHA 1E9RA 4IL5A 2CPRA 1C7YA 2FP4B 1QCYA 2VHZA 4FHEA 4G0QA 2VZ8A 5KYNA 2NU9A 2OCEA 3S1SA 4UTVA 5C5EA 1AUOA 3V46A 4O2AA 1GAQA 2RONA 4QUBA 2BN4A 5T4HA 4BE9A 5BV7A 4FP9A 1XKQA 1PVRA 2GHRA 3FZGA 1QDLB 2ILTA 3LYUA 4IWYA 4KE6A 1KP2A 2NP6A 1TU4A 1Y8CA 3FHTA 1UMDB 2QDKA 9ICNA 1HKUA 5E6SA 3TR5A 2PDAA 3CF6R 1SKYB 3KOYA 5I7RA 5H8WA 1G3IA 1DQNA 3GD5A 4O5OA 1WX1A 5FOVA 1HQDA 2PH3A 2QRLA 1TK2A 2HJGA 3WMXA 2P6RA 3L4JA 3LC0A 1MC5A 3HU5A 1FNCA 2MYPA 1RAEA 4MEXA 3AEYA 4M3NA 3GPDG 3BSYA 4CDRA 3GH1A 1JROA 3VZDA 2BCJQ 3OSNA 2I6QA 2CDBA 4IXDA 3I9V6 4Q4LA 4OK5A 4TLDA 2NACA 1D1TA 3BMOA 3CBQA 4GOXA 3UK7A 1IBLB 3VJLA 5H5JA 3EZ2A 2O0KA 3D8SA 3TI9A 3UPUA 4G5OA 3MCZA 4XB2A 5F12A 1YK0A 2LWIA 3HJFA 1D8TA 1Y81A 2OQVA 4PXSA 4AZTA 4KYTA 4YYEA 4CCYA 1AMNA 2ZUWA 5C1PA 2WAOA 4IIJA 4F2SA 4O3RA 4MR8A 1SEPA 1FQWA 4KMOB 3LKVA 1GGVA 1U4OA 3NASA 4NEGA 1Z2EA 5EIBD 4F04A 5B12A 7AT1A 4MKHA 1YFLA 4L95C 1W29A 1K4MA 1KR5A 2AWNA 2JK1A 1QK4A 4J03A 2YNMA 2CE7A 3TARA 4OHXA 5EUBA 2X2FA 4C07A 1X2IA 4DIFA 2C96A 1I4LD 1ZD4A 1XRPA 5AW5A 3ZG6A 1XS9D 2P11A 3I58A 1J0EA 1VKHA 1NJ5A 4YCBA 2XAUA 4FEAA 5DO9A 5KFGA 1AV6A 1E61A 1GLGA 1MR3F 2QQGA 3DL2A 3KL4A 3NTRA 3U6BA 1HLFA 2WWFA 1RYBA 3MQFA 3BH6A 2NXNA 2DWCA 2P3LA 3AM9A 2ZSUA 1RCUA 1GG8A 4JL6A 5CG1A 5B5SA 1XEWX 1GD1O 4JR1A 1UP4A 4YQWA 1LB1B 3CCBA 1QONA 5C7OO 3WKAA 5HKOA 2G9RA 2HWKA 4P2GA 3IP4B 3GLHE 4ID9A 4CODB 4W1QA 1JH9A 5FAKA 1ND5A 1QAOA 5KVAA 1MABB 1VRVA 3CSSA 3EQZA 2EFHB 3D2AA 1XK7A 4MKRA 4DHEA 5KFRA 1NOJA 2P35A 2A1IA 4PR3A 4ED9A 1JEQA 1YI0A 2B35A 4D98A 1PW7A 5K51A 3TRHA 3TZ6A 1WVIA 1J21A 1XMVA 4BO4A 3NNNA 1RYRA 1ZSVA 3ISJA 3Q8SB 1T2DA 2VSNA 1OX5A 4OLFA 2DY1A 3PA6A 1PL0A 4I36A 3GFBA 4UU0A 2B36A 2H57A 3OF3A 1QS0B 4MTCA 1U45A 5K8UA 3LYHA 4EABA 1R6XA 4ZMBA 2FDXA 3WK7A 1X15A 2DQZA 2Q8PA 4JJAA 2OO5A 2B78A 2KYRA 1VOTA 2JGKA 2RG1A 3E4CA 2EZ9A 3KYIB 3PKJA 4JCOA 4K9KA 4TV8B 1ZQLA 4J16C 3HFRA 3L05A 4U8HA 1M7BA 2EKBA 3GCZA 4TSFA 4C3UA 4MCJA 1P2FA 4IVNA 4BKRA 3AZPA 3C7TA 1J9EA 1XNGA 1AN0A 4HG2A 3CUTA 1GZ7A 4OMCA 3W8FA 3H2SA 1R0BA 1FJGB 3NBZC 1CUEA 5JRTA 3J7TA 1FX1A 1YFZA 2WSSA 4KN6A 4M0UA 1SVSA 1Y8AA 2IYTA 1FY2A 2P41A 3ANXA 3G8DA 5FD8A 3RAGA 3GN2A 2YJ3A 3C15C 1PUJA 1F1JA 1KMIY 4MVWA 3BSWA 2F77X 1C0EA 2JGNA 3ZHOA 4HY3A 1Y6FA 1N8TA 1PFUA 4WINA 2PUBA 1P75A 2RGNA 3J81j 3BBPA 1K89A 3CB4A 5CUQA 3P2KA 2VATA 4PLGA 1IPEA 2OV2A 3H0KA 5KNCD 1SZCA 3N2IA 2X1MA 2PI4A 2OSVA 3FA2A 1Z4KA 3OT1A 3PGLA 3DMTC 4Z9BA 5F1PA 5CD1A 2BDTA 1JLMA 4PO8A 1TB4A 3HKBA 1I0IA 3FVTA 4JBGA 1DIRA 1O95D 3THOA 2KJ5A 1BPXA 1CJCA 1BXKA 1JHZA 4LHVA 2DFLA 4X3PA 4YJ2F 4CIWA 4PZPA 1X7YB 5LKAA 5H4GA 3ND5A 3CW2A 3V4VB 2W90A 3P0RA 1Z7GA 3C8UA 4YAOA 4HDRB 3LT1A 1FE8A 3D3WA 2HMSA 4FMDB 2P9GA 2W7PA 3HDYA 1N92A 4FIZA 4J1SA 4MPJA 4P5EA 4QTZA 1PD1A 2OBYA 2R1TA 1RI4A 3GFQA 1PGNA 5LOVB 5E4FA 4TZ6A 4Y2HA 1CY6A 2CW5A 2QLJA 1UJBA 3THWB 4KACA 4BBZA 4B33A 1XTIA 1ESEA 1NXQA 1XCGB 3DONA 1UBSB 2FUG1 3STUA 3ZDFA 3QXGA 3I32A 3NUQA 1XWLA 3W5CA 3LXUX 4FLEA 3INRA 4PG6A 1XZNA 4CM1A 5A4KA 1MP0A 1UXKA 4AQYB 1MEEA 5KFMA 1UQUA 4M53A 4YP6A 5NULA 2LCQA 1ZNQO 4Q93A 5HIAA 1BHSA 3M1LA 5C35A 1U63A 4X1KB 5DDYA 3S2UA 4JBWA 3CPJB 3BZCA 2XTZA 4U3JB 1B0AA 3VZPA 1JQDA 2CFSA 3THVA 3IUMA 4EBDA 4M9SA 6ABPA 4C6RA 3I9NA 1DTSA 3O8NA 3VFDA 4WJ3B 1D2GA 2XMDA 3DCYA 2WNHA 2FLWA 1DU4A 2P6MA 2AF4C 4GUDA 1CJTC 3V55A 2AXTU 2I7CA 2V9CA 4HLQB 3MWJA 1BEUB 5LA6B 4AB1A 3WYNA 1ZGGA 3CLUD 1ATZA 3KHHA 4HO1X 4B0PA 1N62A 3UOAB 2Z6UA 2V5VA 3EHDA 3QKUA 2AX3A 5KFOA 3TUIC 5J4YA 4JQOA 4E0BA 3FTNA 2C00A 4RY8A 4XUGB 1NA5A 2RC6A 1Q1QA 5JNSA 1JQEA 3VC8A 3ABZA 3EULA 3HUTA 1DAFA 1DNPA 3MGKA 2Z8YM 4JGGA 5P21A 4OKSA 4YMGA 1KMHB 4YO8A 3JW8A 1ZWLA 3OHAA 4O4HB 1W30A 4F4UA 4INOA 4K9LA 3DVRX 4DF4A 1HLGA 2WZDA 2RJ3A 1MJHA 3FBWA 1WLYA 2WUVA 3ZV6A 3JQAD 2PXHA 1T5BA 1HT3A 2JA1A 2KWIA 4AP5A 4WZBE 1H69A 3PSHA 5BSHA 2HSZA 1C1DB 1GTL1 4V24A 2I0FA 4FK8A 4TLCA 5CB6A 3PPXA 4DL9A 3C3AA 3CX8A 1RXVA 4GMFA 3LUJA 5IIIA 1QFJA 2QQEA 4G3XA 1A0PA 4FN4A 3MTBA 4NXMB 1QC5B 2GN6A 2XGQA 1XG5A 3H4DA 3NJRA 4UAWA 2GEUA 4UTXA 4ZAYA 3RM3A 2C8KA 5IJWA 2HMVA 2Y3IA 1OAKA 2AU0A 1ORWA 2D5AA 4YCLA 4XEHA 5FWAA 1TUBB 5HHIA 3II6X 3U4DA 2PO5A 4RGVA 4E11A 2ZZMA 3R8CA 1UBGA 1F44A 2AMVA 1IOLA 8ICRA 4N65A 2XF2A 3VR3A 4J1TC 2VTEA 3AT1A 4FZRA 2WD9A 5FOQA 4NCHA 3WYAA 3CNHA 3TFRA 2CCJA 2QLLA 3KU4A 2EATA 2Y0PA 3I34X 5B6IA 5I7HA 2O57A 4IDBA 3N75A 4B4DA 3ZHQA 4FFRA 1V5GA 2ZJAA 3F5EA 3C5GA 1WABA 3H6GA 1KFJB 4F21A 2XUGA 3AR3A 5K8JB 5AI0A 3EPGA 3WLQA 2NRVA 5EUMA 4ZVOA 1I36A 4N5HX 3NBAA 3KQLA 5CEHA 4FEEA 4D74A 5AW0A 4ZARA 1XU7A 2O50A 3HYCA 5JAPA 4G1FA 1ESDA 4ZO8A 4XDGA 3PS9A 5DYWA 3NRBA 1SD5A 3ROTA 1JHMA 4JLOA 3E2PA 3JQCA 3NDIA 2G07A 1UWCA 2WMNB 4UB3A 2FLKA 3QMVA 4IS3A 3RVKA 3SS9X 2ZRLA 4EHLA 3I39X 3PWSA 3PQ8A 3SBEA 1EFAA 3I2FA 4XPIA 2CXPA 3SYTA 1G21E 3KQKA 3ZI7A 5FUQA 3H5NA 4Z1MD 5LP6F 4LF8B 1RKBA 3PXCX 4D3FA 1PO7A 3C1ZA 1QOPB 2SKEA 3LSTA 3OOSA 5DKFA 4IGKA 1DKQA 1PYGA 2JGRA 1EQUA 1LZKA 2AEFA 4PCAA 2HRQA 3CW9A 1LEHA 1RIFA 2OQ2A 2Q3JA 1L5NA 3R8XA 1KR2A 5A6SB 4QJIA 5LOVA 1T5LA 2OOSA 3EMVA 8ICNA 2C42A 1MHPA 4P3KA 4WTOA 2AN9A 3U31A 3RIMA 4FBUA 1E9CA 3M33A 3PGA1 5DNVA 3L7DA 5EWEA 3SICE 5KQSA 2PL5A 1B6TA 3AVVA 1Q14A 3GZ4A 3UXNA 4AO8A 1VYTA 1XP8A 4HS9A 1U3VA 3HRHA 3IYLW 2Q6OA 3TLGB 1XC7A 1H0SA 2I87A 2HSJA 3AJAA 3OX4A 4NS1A 3RH5A 2BSAA 4P35A 1GL6A 3AJRA 1JQLB 1G18A 3AO0B 1PGQA 4BO0A 1U02A 2E5FA 2VAXA 4TV9A 3V2IA 4GMDA 1E0DA 1SB9A 3IPAA 1U0TA 2I62A 3C3CA 2B7BA 3OIGA 5DI3A 4WCDA 1ULTA 4MVJF 4P82A 4B32A 5A3VA 4ZDIA 2YNMC 3B9RA 1NZJA 1JFFB 2VWHA 1DXYA 2HMXA 1E9EA 3T5BA 1V3TA 3IAFA 5F1OA 1NNUA 5KQMA 1G8AA 1KEPA 2OKGA 5JJCA 1SKRA 3I2GA 2FHPA 1M2OA 2IHUA 3ASUA 1QHNA 2BAGA 2FP3A 4WK4B 3VO9A 1COOA 5EKSA 5E3HA 1V8FA 3OZTA 4HGZA 3H8JA 1CLEA 3OF2A 5DXAA 4D3YA 4DV5B 1H4QA 2WB1F 4IOLA 4B8ZA 2W04A 1ICEA 1YB7A 1DBRA 3FFTA 3GA7A 3IE0A 5T41A 4MF8A 3ZYZA 3ZD6A 4LV6A 2R85A 4IH9A 1Z0KA 1X3LA 1S9FA 1CZHA 2C2OA 2IUSA 4QVGA 2E4ZA 3PTZA 2PSEA 1QP7A 2WG2A 2I9KA 4YCCA 1JMVA 8OHMA 1N7JA 5H0IA 2WTBA 2QAJA 4A5OA 2Q62A 2VDKB 3HACA 2K8CB 3RW9A 1L5HA 1YB2A 4FYPA 1OB2A 1FNNA 5CT4A 4M0FA 5KYUA 2Z1NA 3LKBA 4F4HA 3OM1A 3BXXA 5DJ5A 4AI6A 3WL6A 4S1TA 3JASB 5HSGA 4UE2A 3KIPA 3D5TA 2P9BA 5A7GA 5CFZA 4FLMA 3GGPA 1SV0A 4JL5A 3BREA 4ZEOA 5JBIA 3FJYA 4KQFA 2C99A 2Q2WA 2RJOA 4PLPA 2D1QA 4R8MA 5CMLA 1PTKA 2UYGA 2PTGA 4Y67A 4FOLA 3UAWA 1E1LA 2WLTA 4Q1FA 1EX6A 4OL9A 4BXOB 5EUCA 4L8GA 5FUVA 2JEIA 3QXCA 3WSVA 5LQDA 2BDUA 2CXSA 4YGYA 4AVYA 3BTUA 5IPFA 5KT4A 4PG8A 3MAAC 1L7EA 1W5TA 2KG5A 4UTRA 1Z7EA 3NTOA 4GMKA 5FBWB 2KZ3A 3IXLA 4NX2A 3T06B 3QU7A 2QM8A 4FM9A 1P0MA 4G1VA 4F85A 2HHSA 3NHYA 4WJKB 3SXJA 5GONA 2O8BA 1UJ5A 4BO7A 3IKLA 1M8PA 1Z47A 1RHKA 2JI9A 1RZVA 4UZSA 4FOPA 3TXAA 3ER8A 1IEQA 3DV2A 3KQVA 2JFZA 4DLXA 1M2VA 1O97C 2P1ZA 4MYSA 1LBQA 5FQOA 3KUDA 5IF9A 4F3RA 2A67A 1U3FA 3I5YA 3ZE6A 3C3KA 2BFBB 3L49A 3SOZA 1GKLA 4YXWA 4XDYA 2WYVA 3G82C 3EIFA 2BCUA 3GP5A 2GO1A 1GQQA 5C4GB 5ERGB 1TKDA 1AHNA 2AZ4A 3W9BA 4QGHA 2Y99A 4WBSA 3V4PB 4K3UA 3ZLBA 4BN0A 5KI6A 3EJ6A 1XIVA 3PNBA 2BPOA 3B1JA 4LF5B 4FU0A 4FXOA 3OIYA 2GJ4A 4HAIA 2H1LA 1Z62A 3BD7A 4R40A 3U9SA 3V6LA 4AMVA 8AT1A 5K0TA 2EWMA 4Q4DA 3RADC 5MF6A 5FAXA 2I2AA 3COVA 2B1QA 1HF3A 1PT5A 4M9NA 2XTAA 5G4KB 1T0JB 5EOVA 1SZHA 4G25A 2HF9A 4XWKA 5JVDB 4EI2A 1O94D 3DEFA 4N6GA 1GTZA 2GPAA 1MAUA 4YT4A 2J9RA 5T57A 2BBSA 3EDQA 3R40A 3IH5A 4LC9A 2QX9A 1BW9A 2WF7A 4BLSA 1EWQA 1TKRA 3PXDA 1ODIA 3UB4A 5EMNA 1FXWA 5C8YF 1KERA 2KMLA 4FWTA 3FKSD 3GPIA 5EPOA 3PA8A 3WIVA 3S8EA 1BVHA 1E2EA 5DQIA 1O6ZA 2I1LA 2RKBA 2VTKA 3OCJA 4ZOLF 5J5CA 3ZCXA 1I7SB 4P0QB 4DOAA 1L4FA 3UQ0A 3SEQA 1KFKB 2CXUA 5TR9A 3LOUA 1E0AA 4IQ0A 1N77A 3LY8A 1CUZA 2HK9A 1EFLA 2QTVB 1J1ZA 2NU9B 1EESA 4YCMA 2V3WA 3LP6A 1MX1A 2V96A 2ZAOA 3FDXA 4O4IF 1V9PA 3L4SO 2ZBPA 3EXEA 3A6KA 4EKNB 3J80A 4JI6B 1X8JA 3VR2A 4AQ7A 1R0RE 3LG2A 3T95A 1GTJ1 4PYJA 1J8YF 2P78A 3CGWA 1CUKA 2EKDA 4DKXA 4JNCA 2VAPA 3UXYA 1T6XA 2MSNA 5AD1A 1W2WB 3ZHRA 2ZJ4A 3NHAA 3K0AB 5PGMA 2QT9A 2VPPA 4URXR 4PZOA 3I01A 2AOUB 4EKIA 3T7EA 1VKNA 2EC5A 2JD0A 3D8RA 2W2TA 5ANRB 1SVNA 1FFAA 4IIFA 4HT3B 4IJKA 2AQ0A 3LVQE 5JFGA 3N8GA 1DQRA 4MUBA 2V5AA 2YDXA 3QU9A 2R4QA 3OQJA 3EIQA 9ICMA 1SVWA 2I9GA 4FR2A 3HLKA 3CMCO 3N1UA 2FEAA 4LQLA 5F23A 1DFHA 4EHBA 1GZUA 3D31A 3AKDA 4MPTA 4CM4A 3KWFA 5IVDA 4ARCA 1DJOA 3EBOA 1JJAA 3G8AA 3VOTA 5ADWA 4S24A 1WSAA 1UEXC 1U28A 2NUTB 1XD8A 2IXAA 1ISPA 3GG9A 1DC7A 4NNJA 2W6IA 4R7ZA 2Y1JA 3JQAA 2OD9A 2BH2A 3ZXIA 4I6EA 1J24A 1AN9A 2YWEA 4X93A 5D5HA 3TMAA 1ZGAA 1WYGA 2ZTEA 1JRPA 4ECSA 1KOJA 1R0LA 3CE6A 4G09A 1V47A 3WLFA 2V6BA 1BGWA 1WW3A 3FMGA 4Q3DA 4RPCA 4CM7A 4P3OA 1G5TA 1G0OA 1BO6A 4UDXX 3T3IA 3WOHA 5B58C 5JSUA 3DVAB 2BGLA 3HFGA 1TEZA 2P65A 3Q0IA 1NW6A 1NN3A 4C4AA 2HMWA 1OA1A 5ALQA 3MUEA 4TRJA 2HBZA 4NZZA 4G84A 1ZG3A 2DH6A 3MIIA 3RWOA 1LC0A 1GPKA 1U04A 5J2TF 3SJCA 2C4WA 3NI2A 2QP9X 3LVBA 5FNVB 1T4MA 1F0MA 4W8OA 1J09A 4NDAA 5H70A 4Z4GA 1IK4A 4B0OA 5HQ3A 4KTTE 1Z1BA 2VQSA 1NN1A 4TZTA 1KWKA 5JYBA 5KFZA 5FA8A 3WYEA 4EPVA 1VFPA 1LTHR 4CWAA 4YTEA 4N3NA 2P75A 3JWHA 4L4XA 3E48A 3L0OA 4JLVA 3UPDA 2AR9A 3VVBA 2WM3A 4BQQA 4HDRA 4FYVA 2CWWA 3C21A 1KRXA 5TE9A 1NVVQ 1FLVA 4PG4A 2FMUA 4A2WA 5EJ8A 5L6LB 4BPBA 5FPQA 1E7SA 5B66U 4LWOA 4WZBB 1U1CA 4KO4S 2VQEB 2G7MC 1RJFA 4C7BA 2DBVO 3ZVRA 4BLOA 4TKVB 2ECOA 1XZMA 3GT7A 4IICA 3L7MA 1PK3A 3ZXYA 4HN2A 1AQ6A 3FPSA 5ADVA 1YDEA 4F4KA 1SHJA 2W6ID 1AKUA 3CO5A 4BFTA 1M1YE 3FCCA 5CR0A 5B30A 5G0SA 3ZYCA 2H9IA 1ZHOA 2GCNA 3ASVA 4IPTA 4C7KA 2Y0EA 1PJQA 1XDSA 3GV8B 1DFIA 1YK1A 2HM7A 3D0QA 4K1LA 4OUKX 5WRFA 1R27A 3RODA 1A1SA 4KSCA 5I3CA 4W7HA 2IYVA 1M9NA 3DA8A 4IIUA 5DTQA 4TMZA 5AOVA 4AY5A 2Z7JA 1V26A 3A4LA 3IVAA 1UZNA 3TCXB 4C0QC 3O2SB 1R6AA 3EEFA 2IC5A 3VAZA 2YTZA 3KHGA 1BS1A 3L7LA 5M5BA 4GT1A 1O95A 2AQHA 2B2CA 3PQEA 3ZQ4A 4E5PA 1NZBA 2WVJA 3L5KA 4BVFA 3WNVA 2B9VA 3KFVA 3DDOA 4WK2B 2EKLA 4RK5A 2CYAA 2VEOA 5TX7A 4QSMA 4I2IA 3V1TC 4CKWA 2BFCB 3TJRA 4NH0A 4ZI7B 4P4LA 4ZQCB 4RD4A 3VH2A 2FSVC 2I6TA 2BT4A 5EE5B 5TQ0A 1FRZA 2IYXA 3AY7A 4MQLA 3ZKWA 2QPOA 2C84A 1EB8A 3GDGA 2UZIR 4J9OA 2DWQA 3HG7A 4FGKA 4QTUB 5CT9A 1B8UA 1PDOA 1UXIA 4EHHA 2WSSD 3CUKA 4L74A 4FJ2A 4M22A 3U4HA 5JRZA 5EWGA 1G3RA 1K1SA 5CJ7A 4HS4A 5HS6A 5LLSA 3T9FA 5C18A 3GZNB 3OTWA 2PKWA 3Q8WA 4FYKA 3BGDA 4K0RA 1X2BA 1CV2A 4J94A 3OIDA 2GM3A 4RDHA 5CVCA 2G0AA 4RHFA 1CQIB 1HURA 3GN1A 2VPQA 4HX9A 4ML3A 1JSCA 2BR4A 4FGJA 2WUWE 4QWMA 1NW9B 3REGA 1BZYA 2VXOA 4QNNA 2W55A 4Y9RA 5G3ZA