2WFAA

Structure of beta-phosphoglucomutase inhibited with beryllium trifluoride, in an open conformation.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wfaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wfaA01
3WK6A 4HGNA 2WM8A 3ZX5A 2AH5A 1EK1A 2I33A 2HCFA 3PDWA 5AIBA 2B1QA 4MUMA 5AI4A 3PGVA 3OCXA 3HLTA 2ZBGA 1TJ3A 4UW9A 4YCNA 5ALVA 2FUCA 3QUBA 1TJ5A 3K1ZA 2OYCA 3IRUA 3N28A 4BX3A 5AM1A 4XQ0A 4Y2RA 3EWIA 3NALA 3KOOA 3WGUA 3QU7A 3A1DA 3L0CA 1L8LA 5ALLA 1L7PA 3E81A 2OM6A 3MC1A 1S2OA 2YJ4A 2ZBEA 5ALKA 4GXTA 1RKQA 3SKYA 4OCZA 5AVZA 4UU1A 2DQSA 5ALFA 2GFHA 4OD0A 1XVIA 1U7OA 5FP0A 2O2XA 3W5AA 2WF7A 5ALNA 2D2VA 5A3SA 1U7PA 5AKXA 3P96A 4Y2XA 1VFPA 4HAIA 1S8OA 2YMQA 4Y2YA 3NIWA 4BKMA 4XPZA 4YCLA 1WPGA 3AR8A 4Y2PA 2ZBDA 3HYCA 4DWOA 3ET4A 3U7EB 3BWVA 2G0AA 1XPJA 4XOUA 2GO7A 1XP5A 3ESQA 3WKCA 1Z88A 2R8EA 3PCTA 4GIBA 3AR4A 1F5SA 5AW0A 4RESA 5T41A 4DFDA 4EELA 1Z4JA 2IA5A 1Y8AA 2R8XA 2MU1A 4OFZA 3L8EA 4EEKA 2AGVA 2EAUA 3N8GA 4UM7A 3VAYA 2YJ6A 3UM9A 4FFDA 3WKDA 2JAUA 1K1EA 2C9MA 4UARA 4UMVA 1U02A 1L7NA 4CF3A 3ZVNA 3DV9A 3OTQA 4C4SA 3D6JA 3B8EA 2EARA 1RMQA 2FDRA 1NRWA 1Z4KA 3WK4A 1RRCA 3WKEA 5AM2A 5ALGA 1YNSA 2GMWA 2YMMA 3ZUPA 3U7GA 1Z4LA 4RETA 4L57A 4CF5A 1T5TA 1YDFA 2W43A 2GHQA 3AR5A 3DNPA 2WF5A 5AVSA 1VJ5A 3WK7A 3ZTWA 4C4RA 4MWOA 5AESA 3FZQA 5AW1A 4QJBA 3L8FA 2MU2A 3I1YA 5AKIA 5AKHA 3A1EA 2AUTA 3SMVA 4YCMA 4ZEXA 5AI5A 5AKYA 2RARA 5AW4A 3ZVMA 2YMLA 1RLOA 4I9GA 3M1YA 3ZW7A 3GYGA 3QU2A 3NANA 3R4CA 2HI0A 1VJRA 3WK9A 2YJ5A 5AK3A 3E84A 4I9FA 1SU4A 3TLMA 2ZBFA 5AW6A 1SWVA 5AKEA 3KDPA 2WF9A 1ZD3A 5AKZA 3A3YA 5AW2A 3ZVLA 4OHFA 3FM9A 4EX6A 2CN1A 4NAVA 1O03A 3AR2A 1L8OA 3ZWKA 4Y2QA 2FI1A 1QQ6A 1WVIA 5ALDA 3MPOA 4Y2JA 5ALQA 5JJBA 3NASA 1ZOLA 3WK5A 5ALHA 3ZU6A 5AW8A 4PNHA 3N1UA 4KX5A 4FYPA 3UMBA 2O9JA 3QGMA 5A3QA 3W5DA 2BDUA 3SF0A 3L8GA 5AKKA 3R09A 1RLTA 2QLTA 2OBBA 2ZG6A 4Y2SA 2YY6A 3QU4A 4O8CA 1KYTA 2P69A 5AM0A 3KBBA 5ALEA 1WR8A 2HDOA 1L6RA 3ESRA 2R8YA 4FE3A 5ALZA 5ALUA 2I54A 2FPUA 4KYTA 2YMPA 2W4MA 3OCUA 5AI9A 4CF4A 3ET5A 2HF2A 3KD3A 3DAOA 2G09A 2BY4A 5IT4A 5AI0A 5AKJA 2I6XA 1O08A 2PR7A 2JGAA 2IYEA 3L1VA 1L7MA 4L6CA 1Q92A 2P11A 2ZXEA 4H1WA 4G9BA 3U26A 1Z4QA 1RKUA 1X42A 3PGLA 3AR7A 4BBJA 1ZRMA 3R9KA 1CR6A 2FEAA 2FPXA 2W11A 3W5BA 3L1UA 3W5CA 5AICA 2B8EA 3QX7A 4UAUA 2Q4RA 1RC8A 2HSZA 4Y2TA 1SWWA 3KC2A 2B30A 3NUQA 2YN4A 2CFSA 1JUDA 4UAVA 1RMTA 2ODAA 4E88A 2G1AA 5AVRA 5A3RA 2G06A 3ZTYA 3OCZA 2G07A 3L7YA 3U13A 5AIAA 3QXGA 1N9KA 3MMZA 4IFTA 3BA6A 3I28A 1ZRNA 5AVQA 4BYGA 1YMQA 2VKQA 2C88A 2Q5EA 2I34A 1Z4MA 3QUCA 3FPSA 5AKLA 5AW3A 5E0OA 4NABA 2B82A 5AVXA 1MH9A 3U19A 4B6JA 2HO4A 1ZD5A 2B1RA 4AP9A 3SLRA 5AM4A 4BEWA 1J8DA 4DW8A 2HX1A 3L8HA 3FGOA 4CNQA 3QU9A 2IOFK 2NO5A 3WKAA 1QH9A 1Q91A 5AVTA 4BNDA 3QNMA 3IB6A 3SD7A 2JARA 2Q4TA 4YIKA 4EENA 1N8NA 2IOHA 4F71A 3EF1A 1RMYA 1TA0A 2RBKA 4KN8A 3WGVA 4HGOA 2FPRA 2ZOSA 4QQFA 4L6AA 5ALTA 1PW5A 5ALOA 4UMEA 3EPRA 1Z5UA 4AS3A 1WZCA 3U7HB 3F9RA 4HYTA 3QUTA 2OA0A 4EX7A 3AR3A 1T5SA 4HGQA 1IWOA 4DCCA 3B9RA 2HHLA 2FPSA 3OCWA 2YJ3A 4IG4A 3L0YA 2P27A 3I6BA 5ALXA 4BX0A 1NNLA 4BX2A 5AK5A 5AKGA 3SKXA 5ALSA 1NF2A 1RDFA 4Y2VA 1U2TA 3ZI4A 4ZEVA 1ZJJA 4C4TA 2YFYA 4Y3UA 4KNWA 2B0CA 2I7DA 5ALIA 2I55A 3IJ5A 3OPXA 1TE2A 2G80A 1Z4PX 3N07A 3E8MA 5AVUA 4Y2UA 3UMCA 3FVVA 2RB5A 4UU0A 2NO4A 4UMFA 2JAOA 4UASA 3OCYA 5AVWA 3NAMA 5ALJA 3QUQA 3ED5A 2HF7A 2WF6A 2G08A 5AW7A 4KNVA 3CZ4A 3L0BA 2GHTA 3UMGA 3M9LA 3MN1A 1J97A 1T9ZA 3AR6A 1AQ6A 1QQ5A 3ZX4A 1RLMA 4BNDB 1YS9A 2HOQA 5AM5A 4UM5A 1U2SA 1CQZA 3EF0A 5AVVA 1L7OA 2EATA 3QYPA 1ZD2P 2B8JA 4EZEA 5ALRA 3OCVA 1RPZA 2MSNA 4HGRA 5ALYA 2WHEA 2HEGA 4ZEWA 1QYIA 5AK6A 1Z4OA 2WFAA 5AK4A 3FPBA 2X4DA 5AW5A 3ZWDA 2BDEA 1Z4NA 5AVYA 3N5KA 1ZS9A 4BEVA 3RF6A 2FPWA 3WK8A 5IT0A 5ALMA 4J2TA 5IS2A 2WF8A 3I76A 2YBDA 2JAWA 4JDPA 4NFLA 3L5KA 2RAVA 3E58A 1RQNA 3QU5A 1YV9A 2C8KA 2P9JA 3DDHA 3RFUA 2C8LA 3SHQA 5AW9A 4UMDA 3J7TA 5ALPA 2IOFA 4F72A 5AM3A 1TJ4A 3A1CA 3QLEA 4AS2A 4HGPA 1RQLA 2FUEA 1Z5GA 5AI6A 4G63A 3S6JA 4KX3A 1QQ7A 3CNHA 4CE6A 2R8ZA 1RKVA 4YIHA 2NYVA 1EK2A 1FEZA 2QYHA 2CFTA 5AI8A 5ALWA 4J03A 3AR9A 4JB3A 3U7FB 3KZXA 2PQ0A 1LTQA 4YH1A 2C4NA 4XE5A 4NWIA 1ZD4A 3NRJA 1YJ5A 4UATA 3B9BA 4YGYA 1Z4IA 2PKEA 5AHXA 2AMYA 3ONNA 1LVHA 3WKBA 2CFRA 4NV0A
chains in the Genus database with same CATH superfamily
2OGTA 3UJ3X 3O0DA 4OREX 3WRYA 2GBCA 4LZOA 4AK9A 2PA0A 4FFLA 4JBHA 2GILA 5E95A 1RWVA 1AF7A 2QT0A 1NU8A 3EEBA 2QR2A 1GAEO 1N25A 2XOEA 3GL9A 2CJFA 4P8RA 1FTSA 1HEYA 3TE7A 3B9QA 4JLAA 4AMGA 3JQ7A 1N36B 2NP6A 4GC6A 2WI8A 5K0TA 4EHJA 1P4SA 4DG5A 1JSRA 5EFOA 3GIMA 3D0OA 1VYHA 2PBLA 1RP7A 3MOIA 2ILTA 4L8WB 4A9AA 5DJ5A 1RZVA 3MJVA 4M60A 2FW9A 3VZBA 2VAMA 2C92A 4JOBA 1NOKA 5A9RA 4UUBA 1V26A 3TLGB 3QQ5A 3L6CA 3PV0A 1V3VA 4UD6A 4CF3A 3E1SA 2WB4A 3N2YA 2DUNA 5EP4A 2PUAA 1MVLA 2AZMA 2R3SA 5HCNA 4YNBA 1KH3A 2OQ2A 2JEIA 3THSA 3LQYA 4QT4A 4UQPA 4HS4A 2FR8C 2JCVA 3L8FA 5CA0F 1JLRA 3I92A 1G5RA 2EP8A 4HP8A 2VZ9A 3LL7A 1Z39A 5AW6A 3CX7A 1CNMA 1ZSNA 3NB0A 2I66A 3K9CA 3HPQA 4QU0A 3TQTA 1V37A 4CVNA 2QRVB 5LBTA 1NUAA 4QZHA 1AS3A 5ALQA 4GGOA 1YDWA 5FTWA 4CR7A 2GN9A 3FX2A 2XOKD 2PSEA 4LMRA 4O3SA 4ZO4A 1YMUA 4BNZA 4FGLA 5HJ5A 2C0QA 9MHTA 3QE2A 821PA 1E1LA 4W4TA 1K4MA 3MCVA 4YPVA 1II9A 1FUYB 4GVXA 3PR2B 3WWZA 3MELA 2FMPA 5SYMA 1XDGA 5A71A 1SPBS 2P90A 3IPRA 2WDPA 5LWHA 2H0RA 4YRLA 4CTMA 4YBZA 4JI3B 5L4SA 4ALKA 4FMPA 3U9SA 3E5MA 2B35A 3QIVA 5EWJB 1JWAB 2W71A 3VNQA 1A9ZA 4KNYA 4L5CA 3N2GA 2IU4A 7ICPA 4Q93A 3WL8A 3O8CA 2Z3WA 2A9FA 4PZZA 1W75A 4H7HA 5D1NA 3JATA 4G89A 4DQVA 3LGSA 1GU7A 5C0YA 3K75D 1DRWA 2V03A 4XQGA 1PW5A 5EGNA 1DJMA 5AQ1A 1CUKA 1KN5A 3CUEF 1O5IA 1BNCA 4EHAA 1O95A 3LHIA 1R18A 3M4JA 3JAKB 8ICIA 3MEQA 5AKGA 4P4GA 1Z08A 2BKUA 4F5ZA 4GX0A 2W2XA 2PXXA 4JWNA 1E79A 1MD9A 2ATVA 2PQ6A 1JLHA 3SS8A 5KFRA 1LU9A 1KQGA 3FVVA 2BZ0A 5FO0A 4RABA 1CI4A 1ZKMA 4MOWA 1J70A 3GLFA 1E3LA 2QVBA 4DABA 3M9LA 3LVWA 1FYFA 2YRFA 3P2JA 1PZMA 4Y6QA 3TCNA 3TM4A 5L6LB 1W19A 5JXIA 4ITUA 3H87A 3I0ZA 2PFQA 1E1MA 3OAAD 4MIEA 4RNCA 2QXTA 4HNAB 2WQ7A 4IF6A 4MW2A 1Q20A 1D6MA 1Y6GA 2JLAA 3E27A 1O4WA 3DFZA 4MARA 2GDZA 4EEXA 2ACKA 4I8XA 5EVJA 3B1YA 4CETA 4P4TA 3KT0A 1PSDA 4LOLA 2BGWA 3N7SC 2J4CA 3EGCA 1G8MA 1E0JA 3KTFA 3ER9A 5CFRA 1L5UA 5FIUA 5T8KA 3TNFA 2ZIUB 3F2CA 1TD9A 3ZXSA 4KXWA 4G0YA 2W03A 2BGUA 5IC4A 1YBFA 5D84A 4C3OB 3UT0A 4CFYA 2OECA 2DY1A 3I30X 3A6JA 4LE0A 3PVXA 3QRWA 3EPIA 1R5JA 2C4UA 1C8KA 4Q82A 2FJPA 4ED1A 3B85A 4Q48A 1IHPA 2R4UA 1IBLB 5DNCA 3TCXB 5CEHA 1B74A 2F1IA 3IRUA 2XGSA 1BS2A 3D8SA 2O07A 1MV5A 2ZJFA 3L0CA 5ALLA 1SHZA 2ZXUA 1XC9A 5HXAA 2WSIA 5JWHA 3PPIA 3D6NB 3OTGA 2C98A 2UYYA 3I9LA 1UPBA 4BFSA 3FYCA 4BVGA 4P54A 2HHJA 1N3LA 1JIXA 3MLBA 2GA9A 4FQ7A 5FOVA 2GO7A 4QWDA 5DB6A 4HX9A 3ZE2B 2A5GA 2Q3JA 3RIHA 1Z4JA 2IA5A 2JL1A 1Y8AA 1P8AA 5GZ1A 1H6DA 5D01A 1KMHA 2Q0SA 2QSYA 5BN4A 1LC0A 2C2OA 3WKDA 1R88A 2GPJA 2ORIA 4D4IA 3RB6A 5AXBA 3FAKA 1QLWA 2J31A 3NHYA 4EYEA 3Q8RB 4A1OA 1IG3A 4OGFA 1O57A 3SAGA 1HI9A 4PJ0U 1EUQA 2P40A 1OKKD 1L3SA 3D4PA 5G02A 2H2FA 4RPIA 3JRNA 5DVZA 3ZKWA 5CDFE 1YFZA 3OP1A 1Y4SA 4IJWA 2BISA 1D6SA 4AKTA 3PXBA 1DK3A 2C2WA 2XLCA 5HF5A 4M54A 1XRQA 3JWGA 1JAXA 4C6TA 4IXTA 3AO0B 2JK1A 3OZRA 3BSWA 1MOSA 5AKKA 1WLYA 4F8JA 5AMXA 5ER9A 4OYLA 1EP2B 1Z9BA 4WBNA 3Q7PA 1YF3A 4L8YA 4JJ6A 1A98A 4OQLA 2YYSA 2O23A 1FMCA 1Z0JA 2W6MA 4IIHA 4LVNA 8ICVA 3WQRA 4JITA 1JTVA 2VN8A 1VP9A 1KVUA 4R7TA 1JMVA 1Z47A 5JJLA 3VPXA 2VPXA 4BEBA 2JHDA 3FH0A 1A6SA 5HE8A 4KFCA 3PXDA 1ZRMA 2ZIWA 4PBTA 5EUQB 1CJUC 3KJZA 3IE0A 2ZSIA 2UYOA 4JV1A 4ZN6A 2QJTA 4FHFA 1LKYB 2XADA 1QTRA 3DKKA 2FN3A 3REQA 1U6KA 1DS6A 4DUGA 5GONB 1GILA 4LF5B 4M0CA 1OE0A 4ENSA 3CISA 1ZRNA 1B42A 2P2GA 4P9NA 4HWPA 1Z4MA 5LZ5A 4DN6A 3NORA 3TZBA 5FUBA 3GRZA 4MVCA 1AGYA 4TM7A 3LY7A 3O3OB 4MJXA 3ADPA 4UM9B 4HDNB 1U31A 4NXZA 3L49A 3NJ8A 3VPGA 4W5JA 1N5DA 1P5HA 2E8NA 3MDAA 4Q19A 1G2OA 3CLRC 4ZAFA 3SSOA 1WBBA 4QELA 3W77A 4RK7A 2JC3A 4WA7A 5ALXA 2XZTA 4QDJA 5A4AA 5JLJA 4KLHA 1REQB 2P0EA 1I3NA 3I9V1 3K70C 3FKQA 4WLUA 1AQLA 3E3LA 4LMBA 3E05A 3Q8SB 4DNQA 4Z6EA 1HY3A 4JJGA 4J7AA 1EWRA 3BFPA 1RLMA 3SHWA 3ZIDA 2JEFA 3QJGA 3OM9A 2NT3A 3GR6A 1CKEA 4QOHA 2JHPA 2ZUWA 1UFVA 3OLCX 4XLLA 3H4BA 2Q1SA 2ZT6A 1Q22A 1Z8NA 2VAVA 1J9EA 1GNLA 1FP7A 4R8LA 2H4HA 4KN5A 4PLYA 2V9PA 2RAVA 3FUUA 2C8LA 2XEDA 3ZGYA 3PJDA 4MYCA 4L9AA 4DMHA 2XNCA 1QG2A 4LYEA 2ZE6A 4IEFB 4J9KA 1IU9A 2YZKA 3L1KA 1RQLA 2Q46A 1RWXA 1ULSA 4H0CA 1UF9A 1E1RD 1R5NA 3KKZA 1JVSA 1YQ9A 3KT3A 2LP4Y 3CXRA 3MWLA 5C1PA 4BLQA 4PLZA 5F7ZA 4YGYA 3O90A 3DHYA 4IQGA 3WKBA 3IMKA 2Y0DA 1BNOA 5BQOA 1B14A 2B2XA 2CZQA 4RSMA 2WAAA 3BN3A 4QYSA 4MYSA 2GK3A 2N46A 5EKSA 4OJ6A 4PTYA 1XV5A 3TAXA 3QU7A 3FDFA 5J8YC 5D7BA 3I9KA 4C0SA 2VP0A 4QHYA 1OZHA 3OF5A 2OBNA 3KVOA 3FOEC 1G19A 1QIFA 3ZCTA 4L2IB 2QN9A 3OMWA 5BSVA 2YJZA 4P4UA 1D6NA 3HYCA 5IVHA 4BL5A 1T7PA 3P45A 1ORVA 1NW7A 3MR3A 3RRBA 3P32A 2ZBUA 3HL4A 3VOSA 4PN7A 3UYKA 2H29A 2IY8A 4IDPA 5CB8A 5JZ9A 2Y71A 1T2AA 2OV4A 3BWYA 1CHNA 5KMGB 4EY3A 4FFDA 4IGFA 3WYEA 1A9XB 1SOMA 3OEWA 1EM8B 4ZVSA 1XJCA 1RMQA 3FUWA 5EPOA 1DIGA 3C1AA 4LUCA 4LHZA 2JVIA 1NXOA 2IYQA 4RHEA 1Z0DA 5A7GA 1UBCA 4PHHA 3IOCA 4V3CA 2OCXA 4I1UA 1F6DA 5CVCA 2LPMA 5EQFA 3VNRA 3C29A 2ESEA 2ZBFA 5FI5A 5KBYA 3PW7A 5AKZA 4XQEA 5IM4F 4J90A 1TQ8A 1ZQTA 2VHEA 4OGLA 1WMDA 3CPSA 4PL1A 5BPFA 1FNBA 3LK6A 3CPJB 4DJAA 3IP6A 1D09A 5JROA 4K9MA 3X0DA 3FNRA 3L2OB 1M1XB 1ZXXA 4RO0A 2R6R1 4L8VA 1TAMA 3EQZA 4I9HA 1KEWA 2GPSA 1LLQA 4XCVA 2E0IA 4JQOA 2G09A 4CF6A 3V6HA 1QORA 3H1FA 4QBGB 1KI6B 3QE0A 2XMSA 3NU1A 4OFBA 2ZXEA 1FUIA 1EA5A 4WL0A 5IJ9B 1W87A 1UQVA 2LM4A 2W11A 2PRKA 3OZSA 2K8AA 5BR1A 2CKDA 1WO8A 5DB4A 2G5HB 4YJFA 3VKGA 3DXZA 5EUBA 1BA2A 5IC5A 4JDUA 3QEJA 2EH9A 5CYFA 4AKHA 1VGVA 3EXFB 2Q6TA 3DB1A 3R75A 5I9BA 4B6JA 2VPIA 1NF3A 4PU0A 4Y6RA 2AG5A 5TLSA 1TZBA 4YP0A 3SIPA 1UA1A 4HADA 1Z33A 5LZ7A 3PXUA 4K3VA 5AVKA 3DOEA 3FJYA 4UHCA 4K9LA 3EPRA 1LF0A 2ZJAA 1RQ2A 1FQKA 2DM6A 5EJGA 1HKHA 1U0HC 4B17A 2O8NA 3C7KA 2VF7A 1Z6QA 2OCEA 3RUPA 4JMUA 1AQIA 2KNJA 2QJFA 5CVUA 1Y6ZA 1JEQA 2JGDA 3U4QB 2HIHA 4R9VA 1QCCA 3UJPA 2OSBA 5KYYB 2EEZA 1RZUA 4DL4A 1RIIA 2GLUA 2BBSA 1L4MA 4W1QA 5DBHX 3QFFA 4LJ8A 1W93A 1NY5A 4ANFA 1MENA 5EXTA 3OT4A 1X1DA 3ZKAA 4GMDA 4GM1A 1Q95A 1NLUA 5KUTA 2F7SA 3MUOA 4Q4LA 3B1XA 1ORHA 3C48A 1FNNA 2OCPA 4UB1A 2HD4A 3ZDYB 2DKZA 4RPYA 3Q1LA 1ECBA 3HKEA 1QO0D 4G5OA 4JKOA 4NONA 3U7JA 1HQDA 2Q1XA 1YQXA 4WIAA 9ICWA 3E3OA 2NRVA 4AVYA 3T34A 2JAQA 5HKKA 2LCFA 3JPOA 3IVGA 1GTRA 5HCUA 3ZXIA 2JIBA 4TTAA 3H1EA 5LXTB 3ROKA 4NFLA 1M7BA 1Z15A 4MQEA 1QGZA 3N0VA 2LRHA 3GDWA 4RORA 2GA8A 3VC3A 1ODIA 3NXKA 4ECZA 1DADA 3WICA 1ZJMA 2NO1A 1WDTA 2GCNA 2R96A 4R5HA 3EW7A 1G7TA 1PX2A 5ALWA 2PQ0A 8ICEA 5GWXA 3NVAA 1ZQWA 4NICA 3HNRA 1LVHA 2JI7A 4AJ2A 1ZGBA 2CDAA 5KOJA 4GMHA 4DOBA 5AOBA 4KLCA 2P68A 1XLTA 2X4GA 2JAXA 1YIAA 4QIWC 3BDPA 4B9AA 2JEYA 5L1LA 1X2IA 4QIWF 2QAIA 4YECA 3RJZA 3BMQB 2PFNA 1GXSA 5ALNA 5K5EA 2JDIA 3HEBA 3RVJA 1V43A 3VPCA 5ERGB 1XHEA 3U3MA 3VKVA 3ZZ1A 3I73A 1V71A 5HHHA 4KPYA 1YS7A 4XUDA 1Q21A 4IS3A 1YOBA 3TB4A 3IEUA 1TLTA 3MT8A 4RCVA 1OA0A 1QHYA 2BFBA 1FZTA 1Q57A 5EWMB 1NK7A 1QB8A 3I8XA 3E8SA 2WB1C 1JXEA 4CG2A 1PV4A 4G8BA 5K0NA 1RHKA 2TYSB 2WB1F 3HZOA 1ZL0A 3A1UA 1K2WA 4IDFA 4P08A 3Q0TA 1Z2PX 1IUPA 3SI7A 2CV2A 1A2KC 2VZEA 4NIMA 1M0WA 2KWIA 2IPOA 4ERNA 3EGDA 3IIMA 3Q7RA 3HP1A 1YK0A 4BRZA 1H9BA 3ZK9A 3CGGA 1ZNYA 1PVVA 2Y6UA 3KSMA 3IDSA 1YQQA 1E3MA 2WAOA 3TW4A 2Z5FA 2C82A 4RF3A 3G1WA 5IZCA 4FEGA 2UUAB 4EG5A 3SI8A 4H27A 2QB1A 2XE8A 4LGVA 2JGKA 2J07A 1VZ2A 3GUYA 1KZHA 1ZG3A 3IE1A 1T9HA 3EYAA 1J2EA 1Q74A 4LJSA 2W6IA 3FCUB 4UHEA 2WMDA 4HB4A 4YRRA 1VP3A 3C3AA 3SEZA 4II7A 2J9XB 1XB2A 4EDFA 1MMFB 5HK8A 2RCYA 2XV1A 3N0XA 2XZLA 4OAOA 4AQ7A 1U8FO 4GOLD 3NWPA 4U7TB 2ZYHA 3OOYA 1MPXA 4I9NA 1CUUA 2C9DA 1R9GA 2I4NA 3DMFA 4P84A 3HI6A 4LDJA 5TF0A 2GRJA 2V6BA 4MIKA 2PT7A 2CJWB 1NR5A 4JBLA 1DKQA 4AJOA 1QSLA 1T3NA 1FIUA 4KO4S 2A5YB 1X86B 5EEHA 3PX4A 5AJVB 5K3AA 2ONZA 1UJBA 3A3PA 4CPDA 3TD9A 1WMFA 1QMGA 3P4UA 2IXDA 2QQEA 4RTRA 2VG8A 5KTKA 4N41A 2AW5A 4HGQA 3PYLA 2WFMA 4JP1A 2PDAA 2P27A 1XFDA 3NBXX 5ISMA 5JWOA 1ZQEA 3CRMA 1QIHA 3OX2A 2IYFA 4FCWA 1QYDA 1U7UA 4QZEA 3OEHA 5KG5A 1TI7A 4KV7A 3SIXA 1SG0A 3MR2A 2O2GA 4NYIQ 3V8QA 2I7XA 4ZK2A 1M6HA 2VH1A 1X3SA 4LCBA 3ND8A 1OOEA 3VU9B 4N6OA 4YLGA 4UBMA 1CV2A 1OYYA 4IEIA 5GM2A 4WXYB 4U0KA 2P66A 1QPGA 2ECPA 1VJGA 2PZJA 2NXNA 5JXHA 3T9FA 5BOVA 1JXMA 3DFKA 1P1JA 1CUGA 3G0HA 2Z09A 3WZLA 1MEEA 1CK4A 4IRUB 2XOKA 3U09A 3AY0A 4R2WA 4E46A 2OZEA 4C04A 3M1AA 4OG2A 4WCVA 5DN9A 1G8HA 1YUMA 4BOYA 2ZZMA 1IG0A 4CKZA 3NH9A 1NR7A 2VUUA 3KK0A 4MRVA 2VJNA 4TL8A 5EOZA 3ZHTA 4MS1B 2D5IA 4XZ3A 3HFSA 5D6OA 4DJEC 3AEVA 1IOZA 1IUNA 3FGNA 2CFRA 3MINA 1RE0A 3VVCA 4UTRA 4ESEA 4GXKA 2WOOA 4JX9A 5K3FA 4B47A 3RU3A 5KYXA 4OM8A 4F60A 1R9MA 2KZ3A 3DVRX 3I6IA 3MQ4A 3I3SR 2QNBA 4X93A 4UUQA 3J81k 1QIEA 3EE6A 5IW8A 5CAEB 3EA0A 3I3OA 3AP2A 1PDOA 1RKQA 4MQMA 4TT3D 1GAWA 1K08A 3LA6A 3PUIA 4F2RA 4DM3A 3AVVA 1NLZA 4HEHA 5HZHA 4Z7QB 4KR3A 4QDKA 2AFHA 1NY6A 1JIKA 2A6PA 4BGVA 2BVNA 1CSEE 1XZNA 2G0TA 3D1LA 4AYTA 3SAJA 3DE4X 4TTVA 4CKCB 3CBGA 1JIVA 1R9NA 2GLTA 3AQFA 3PC4A 3TJRA 5LYJB 3P0RA 5EJ6A 3ZGZA 4YUAA 2O6KA 5T14A 1QQBA 4JEUA 4FGUA 5DBOA 1S76D 1WABA 5BQ5A 1IN4A 4RETA 2QTWB 4GOKA 2KN7A 1Z19A 4DYVA 2WJZB 2K7ZA 4X24A 3RLFA 4DQKA 4GLOA 2FRXA 4E09A 2BUCA 1NJ2A 4UQLA 3M70A 5ULLA 2KHQA 4LW8A 1NIPA 4R8UB 5K0GA 1XVUA 4NFHA 4YRIA 5L3SB 3U3RA 4ZCTA 4BWJA 2D59A 5LQUA 5DOZA 4EX6A 4OEHA 1TF5A 3UOWA 1UZAA 1XKQA 3R3XA 4F56A 1V1MA 3OI7A 3L18A 4QBIA 1TAUA 3P0JA 1W5TA 3OKPA 2EW2A 3NDJA 4DSEA 3DCNA 3BXEA 3TL3A 1HUOA 1I5EA 2XX3A 1TIKA 3LYHA 1M2VA 4GD3Q 1I2DA 4TPKA 3VPBA 5M5BA 3IAM6 5AI9A 2HWWA 1T4GA 1KI9A 2JLXA 1Z2OX 4WEQA 2K4EA 4H4DA 3PZPA 1YE5A 3DC7A 3KQKA 3I9NA 4HXFB 4F3RA 4NE2A 4LV6A 1G6Q1 3HY6A 4CL3A 4CEIB 4LOKA 1EVEA 5KYNA 5J59A 1CF2O 3VUFA 3S81A 2O8FB 4MVJA 4YI3A 4B83A 2ZUSA 4C29A 4TUYF 3X43A 4NABA 5EJ8A 4DY6A 2AI2A 3IYLW 2UZ1B 1H9AA 3RB3A 1FXUA 2KICA 5CK5A 3EOBI 1IXRC 2EFHB 3G2QA 3WGVA 4NLLA 3EG9A 3IV6A 2Y0EA 2F3TA 3GLRA 5JISA 2WZDA 4QPPA 3PCXA 3PE4A 3AVOA 3P97A 4OQYA 4YDRA 2CNNA 1DIAA 2OCGA 4Z54A 5BV8A 2VSQA 4X20A 2NNLD 1U2GC 3R5JA 4WCFB 3RTGA 5CH8A 4YO8A 5HEKA 3OPXA 2G80A 1EXMA 1L4GA 5C0OE 4AN0A 5JAHA 2IHYA 2P0YA 5DX1A 1ND6A 3HCCA 3OWHA 2GLXA 4GPBA 4Q4HB 3GAFA 1R9JA 1D1SA 4R5MA 1I0ZA 3ZE7A 5GM1A 4TLLB 2FPPB 2XF2A 4JP3A 5I7RA 4M4SA 1W36D 3BH7A 1JR2A 1EQ2A 4UCXA 1WBJB 3TQCA 1ZD2P 2UYHA 4MA4A 5ALYA 2PFPA 1M74A 3T5HA 2IV7A 4HFNA 4CKXA 1SXIA 2RJNA 1FX0A 1GTG1 3TI0A 1M7HA 1OAAA 3GELA 3UJAA 1VPWA 1PQ4A 1R0KA 3RO7A 3RKSA 1TKRA 1U8TA 1KAOA 3FR8A 4MHOA 4IIGA 4OQMA 2XGQA 1JEYB 1GLGA 3UC5A 5K6TA 2QK4A 2L42A 4PLFA 1CQIA 1DINA 4M9LA 1V45E 2YB1A 3L7AA 3VR5H 1IOVA 1H5NA 4EGAA 2FFAA 1E0AA 3JQ9A 3LIPA 1ZU5A 4CLOA 1ZL2A 1YL5A 2OCKA 3N39C 1S2NA 4Q9HA 3C97A 2GGSA 3AFNA 1AXGA 4GOXA 4MKXA 1U94A 2YBEA 2I29A 2H5XA 5KT4A 3NHZA 5BNIA 1XQ6A 2QDXA 4F3TA 4B4WA 1DEXA 4B6OA 4EITA 2EZ4A 1YQDA 1M73E 3BQ7A 2I8AA 2HW8A 2RGXA 3UXNA 4N3GA 3BWVA 3X1JA 3GT7A 3GLIE 4XVHA 4Y9DA 4LQDA 3I1JA 1M34B 3NEJA 2XBUA 1GPAA 2A9OA 2O8EA 3EBOA 4UNRA 3JY6A 5IBRA 2FP3A 4WQMA 4QRDA 3MWJA 1CE8A 5EI5A 3DEYX 3TSCA 2AGQA 1A1SA 4Q18A 4IV8A 4DCPA 4BTEA 3RVRA 3IAM1 3R6LA 3VYUB 2EZTA 3SYTA 2MRLA 4V0LA 1R64A 5IKXA 4TTSA 4H35A 1LPAB 1G6HA 1MTZA 4A6PA 4KG7A 4NPCA 4JP8A 1H69A 1QFSA 1UBGA 1GKKA 2AXNA 4X1IA 1J1ZA 1TVEA 1ZAKA 4FCVA 3W5JA 2C94A 1YZ3A 1U1GA 1A9PA 4GUAA 3WXBA 3WLPA 3JPWA 3OKCA 1KKXA 1SCDA 3JTMA 4LYJA 1B6TA 2PXIA 4QNLA 4OI4A 2EQAA 3AOEC 4V02A 4KN7A 3GF4A 2L18A 2E1FA 3PR4A 4LAFA 4ENRA 2BMFA 3QELB 4CIBA 3K72B 5EGSA 2J0UB 4NMXB 4JBIA 1FB5A 2H1VA 2JATA 4RXTA 2FPUA 4UD2A 2HW3A 1XQVA 5EQDA 3CF4G 3STWA 4M1OA 4P38A 4EMTA 4F2PA 2Z98A 1T9BA 4C1BA 2OB2A 4MCIA 3L8DA 3TRDA 2ETVA 2E6UX 4FXOA 2XUDA 2OAGA 3PKZA 5ITZB 5HOEA 4EPXA 3AWIA 2X5NA 5E8RA 5BQ3A 1AKYA 5IVIA 1M2WA 2Z2ZA 2BLNA 3DWIA 2XB6A 2Q4OA 4ZJPA 1U2DC 1Y4DE 3Q3VA 4FR2A 3N6XA 4H18A 4RD2A 2YWFA 2IEZA 1P44A 2PHZA 3FMOB 3KTQA 1HF3A 3GARA 4YBRA 1XALA 1DX9A 4M0FA 3RK0A 2Q4TA 1HC7A 4CTOA 2VRCA 1YRLA 2LMRA 3HXOA 1SV0C 1TEHA 2Q6LA 4YRGA 2YRXA 1ST3A 5H8WA 5HWSA 2HOIA 2BEUA 4QZAA 2ZJZA 4OH7A 4BP9A 4DLZA 4D1YA 3FFAA 4FT2A 5ENVA 1NF2A 3H8JA 3UMMA 1CY6A 4TV9A 3D1VA 4PYOA 5JPCA 5AVUA 4N1AA 5CG2A 1D0SA 4TL7A 1AMOA 4UMFA 3R6DA 4N7RA 2V0NA 5AOCA 3BMOA 3C3BA 2B4YA 1XVAA 4PG8A 2KKPA 1GNPA 2Y1FA 1FP2A 2RGNC 5AWFC 3FWZA 1TM5E 4MWCA 3JQQA 1JLMA 2NZYA 3KQTA 2ZR0A 3O1HB 4BO8A 1RI4A 4NQRA 3OU7A 3B0XA 4LXGA 2EV9A 3F3MA 3GK3A 3DBLB 4DSUA 2PL9A 3OICA 6YASA 5F2EA 1U8AA 3DYVA 1VCMA 4MV6A 1YR7A 7YASA 4I50F 2JNWA 3PO5A 4AQYB 1QRSA 1HYGA 2XCLA 5A4MS 4TVSA 3MHTA 4KO2S 2PMWB 2ASDA 2JLZA 1R4NA 2OG1A 3GXOA 4QYMA 1XZIA 1XA4A 2Y1EA 2VK8A 1ZMBA 5AI8A 1WHSB 1N0VC 4BP8A 3RI3A 4L1KA 3B6JA 3F4KA 3LPAA 2JF0A 4AROA 4EB8A 2LWIA 3GRKA 3NLLA 2OEPA 1NE2A 4BMNA 3IQEA 3SZ3A 5HFJA 3CZRA 5E9QA 3U44A 4JT9A 1P2TA 1ETUA 4KXXA 2VNSA 3M4NA 3LCMA 3T3GA 1C3EA 3EYZA 4LWZA 1CY4A 4BE7B 1OFIA 2BUBA 3PR3A 4N3CA 3RRZA 4DRXA 4HQKA 4G24A 1FZQA 8ICNA 5EMMA 4MV9A 4FNAA 2OK7A 2XUOA 1QYXA 3LFTA 2FRVA 4IF4A 3IAUA 2EGGA 4NS4A 4CLDA 4ZGGA 3OE4A 5KNCA 5WRFA 4EELA 4JHLA 1PF7E 1TVCA 3SXUA 4XX0A 3LX4A 2D5BA 4WZAB 4C2BA 3TAQA 3IDFA 3W5UA 1KU0A 3OO0A 4X61A 3LC2O 4C03A 4B4DA 1KJ8A 3RTDA 3Q0EA 4BHTA 4OHPA 2ECFA 4GMKA 3W9SA 1YL7A 1E9CA 4RF4A 3GT3A 2ORED 4OUDB 5D87A 1G8PA 4FZJA 4J1NA 4J3FA 3GYGA 4USAA 4A7PA 1BCRB 2JBAA 3KOMA 1WKVA 4U6NA 1W4CA 3B3FA 1BMQA 2Z9DA 4E51A 2EZ8A 5LDHA 4L0CA 2ZB2A 5C5IA 1UFOA 4PNHA 3QXCA 1QFMA 2GZMA 1VHTA 5IAOA 2SCUA 1P4AA 3IQXA 3GFGA 1VE3A 3JWHA 3ZLVA 2RK3A 2OUKA 1BD3A 4WESA 4BKRA 3OE1A 1TLLA 2XITA 1BHQ1 2JLVA 3P9IA 4OXNA 4TMKA 4ER7A 4YO7A 3IMCA 4GKJB 4I9UA 2D54A 4ZO9A 3EPJA 2H5JA 3QBDA 4Z4HA 2H1WA 1X42A 2SKCA 1R4MB 2UUBB 5F7JA 4BUGA 1A71A 4COKA 1QYRA 5I7HA 1W47A 1JG7A 3KZMA 4PLTA 1LUAA 1ZUWA 1VIVA 4EUFA 1L5LA 2NO5A 5B1HA 1GAQA 4H59A 5CB4A 3RLIA 2X1VA 8AT1A 3G49A 4YWJA 3KXLA 3BHMA 4CG0A 5TSDA 3AHGA 1EUCB 1RQ7A 2FMQA 1DARA 2ZIXB 3MCUA 3I01M 4PEVA 1COWA 1QC5B 2IS4A 4HTFA 2X42A 1E2IA 1WKCA 3N59A 4WSOA 4FBUA 3QPBA 3ZS8A 3VV3A 4YN3A 4F7WA 3ND6A 1Q7RA 1UR5A 5J2TB 2DQYA 3WQBA 5KOIA 4FEYA 1KPIA 4OA8A 4FMDF 2EG9A 3MBOA 3OZAA 3KT6A 5CB1A 3ZCRA 4M49A 2CV1A 3T0IA 4JJKA 1BDMA 3GZNB 3FA2A 4A6XA 2VDWA 1MBZA 4PYRA 3C2QA 1MO3A 3T7EA 3OLVA 1UL1X 2DB3A 5BOSB 1XC7A 3FBWA 1T1JA 4X65B 2FSVC 3BICA 1Q16A 1KYYA 2FKAA 5CLQA 3I52A 4S0XA 3KL4A 5HQ3A 4QODA 4XYBA 1SKRA 3DZCA 1T1EA 3NEAA 1SKWA 3T1HB 2OENG 3EH2A 2A59A 1I2ZA 4BGUA 3I4LA 3JYNA 2KBFA 2ZYUX 7MHTA 3LX6A 3BMNB 1HETA 3E9CA 3HUFA 2IW3A 3AB8A 2X15A 4MMYB 3GIKA 1MJGM 3CUYA 4B2YA 4RPJA 3TR5A 3ZG6A 1P39A 4NU5A 5A4KA 3CEJA 2VWHA 2Z2YA 3IUEA 1GKIA 3AHIA 2BEJA 5K3OA 4PZYA 3IB3A 2FUCA 1FLNA 4GDFA 4DAOA 4I4CA 3SEFA 5TEWA 1P33A 2VDNB 5H2FU 2VF4X 2NQ8A 2YJNA 1LK5A 5I5EA 5C5EA 5ECDA 2ZULA 4DB2A 3UHJA 2NZ8A 3GIWA 3GGOA 3W3AA 5A1JA 1SC1A 1ZEJA 4D74A 5FPYA 1B4FA 3NBMA 3R2JA 4AYXA 1E3WB 1TK9A 3GPIA 4HMPA 4XPIB 1LPNA 5DIFA 4MS3B 2QP9X 5KFWA 1LBEA 4UB5A 4QOJA 4DWOA 1CDOA 4HWOA 1THMA 1DXYA 4PHGA 3WO0A 2EX4A 4R6WA 3D6VA 1L5RA 2XQVA 5L3QB 3HXTA 3MMXA 4N3BA 1IQPA 1MPTA 5BV2P 2ESRA 4ECTA 3ZGXA 3S8MA 3PNYA 3N7TA 2PFSA 2A19A 3WHIA 3V00A 4HX5A 5JH7B 3F4BA 4I2NA 5I48A 2IBMA 2YMMA 5FKJA 1PVQA 5CP2A 4EQ6B 1YBMA 3EC1A 4MZDA 3UGTA 1VHQA 4B2PA 5BUSA 5CLJA 1CRPA 4F2WA 2PH1A 1O87A 4F6LA 1QAQA 5TX7A 3WSTA 2YJ5A 3GJYA 3WHPA 2FPKA 4FSDA 4UPVA 5SZKB 4C30A 4R51A 1T9KA 4WINA 3IPCA 1KHHA 5CTAA 2M98A 1O94A 3T7DA 5FWXB 1K92A 1MQSA 4A8JC 3QP9A 2O9JA 1QU2A 1XVTA 1PJZA 2C3MA 3IBGA 4MQFB 1J7KA 5LQRA 1EBBA 4KOEC 1HL7A 2RAPA 3WYGA 3LW7A 1KC3A 2QPTA 4AY2A 3ZZNA 1RACA 3WIEA 5ILGA 1S0VA 2V3WA 4ZYTA 4DLWA 4I66A 3JAMA 2IE0A 3B6IA 1C3XA 2KW5A 1BVSA 1J2UA 3OIYA 3VYRB 4MHVA 5IH7A 1FX1A 3RARA 4JUBA 5C1OA 1P7WA 1QFYA 3UGKA 3UWPA 1DC6A 2ZKIA 3KHLA 1V8OA 4F85A 4OXIA 3DQQA 3AUTA 3O82A 2XCRB 2MJLA 1PS8A 2VLIA 5IK2A 2PAAA 3O4GA 4DQIA 1J7JA 3OJSA 1ZD1A 2NU6A 2YTUA 4MKFA 2VIXA 4EJ2A 4WK2B 5EXDA 1FVXA 4M0AA 2PT5A 2RGYA 2VYNA 3PI7A 4A0HA 4G4SO 4MRPA 3I9V6 4MRSA 4K6FA 4M0KA 1DEKA 1K5PA 1LBSA 4HDRA 2R68A 4Z9BA 4TTRA 4C0KA 3WGGA 5H68A 2VC2B 3G7SA 1UDXA 1WNFA 3Q40A 1VG0B 4WLNA 2KKVA 2VQFB 9ICCA 2JAPA 2DPHA 2GN2A 3HYNA 3ZZTA 1GAXA 4ZEVA 5J2KA 3A2KA 5C35A 1TYCA 1TK8A 4G36A 3WLFA 1B8VA 1SC9A 3PDJA 3MHPA 2RC5A 4HCJA 2JAOA 2FDXA 3ZDCA 2GHTA 2Q28A 5A5FA 1GG9A 1WD7A 3UNXA 2R6DA 4HPXB 1X2EA 1YOVA 1XHFA 1DFIA 2CLKB 3C2MA 4GR5A 4ED8A 7ICMA 1FFXA 3EZNA 2VXOA 1K06A 4HYKA 2R8PA 2R62A 1M5RA 1RKXA 4MVJG 4LY0A 1SHLA 1IK6A 4Q3NA 3T38A 1KYIA 4C7OA 4LZLA 5J2UB 3Q8WA 4IGEA 2JJMA 4C88A 3JV7A 2DUYA 4RSHA 2IVFA 1QIJA 1VIDA 4MHTA 3ZDDA 4ZOEA 4B0PA 4URUR 5JAUA 4I8DA 4XWOA 3KHUA 2YDYA 3MWEA 4O2AA 4GC5A 1BWSA 2NU9B 2VJQA 4M87A 4INJA 1HOXA 4OI2A 2PGLA 3U4DA 3ZWAA 3U48A 3JQDA 2WINI 4FFWA 3TI7A 16PKA 2Y6VA 1BS1A 4OP2A 4GF5A 1JPNA 4Q7KA 4KDCA 1QF9A 2ECOA 4YGXB 2X0RA 3N74A 3SS9X 5DNYB 1SM4A 1JPVA 5COBA 2GFHA 2VI5A 4HMOA 2W2VA 4D4MA 5HJ7A 2ZI7A 2ROQA 3IBTA 4FZ3A 2GEBA 3FCCA 1KPHA 1KDVA 1C14A 2HKIA 1TM2A 2W98A 1XP5A 1B0PA 5JJKA 3A9VA 1EUZA 4M6WB 3EY9A 3WNCA 2IYZA 4HNGA 4RM2A 1GJRA 4G01B 1ED1A 4B3BA 1Y5LA 4YA6A 2F3SA 3X3HA 1K3TA 1X80B 1PYDA 2PXCA 2OSVA 2EIHA 5L95A 4E5DA 3KT8A 3TINA 4K28A 4RMHA 3GPLA 4LJ5A 3PHHA 5DTIA 7ABPA 1E5DA 3FMIA 4LY6A 4RS4A 1B8UA 1KDZA 2BMVA 2HSWA 3FYUB 3VR6H 2CW5A 5HM8A 2GHQA 1Z5ZA 4BC0A 2X9LA 3EY4A 4G23A 1Z3IX 3WLEA 2PUFA 4YVZA 4B9VA 2E9SA 3FG9A 1R8JA 1G8SA 3DFFA 5JSUA 4CFZA 3C1OA 1G66A 1MC1A 3O21A 3UATA 3ZVLA 2FW7A 2GESA 4Q9LA 3K6RA 4GWKA 4I14A 3N1UA 2XZDA 1XRSB 4CDRA 3ZDZB 1SBNE 2DPLA 2MR5A 2JFYA 2QW8A 1E2GA 5JADA 1K98A 2FZKA 3B1ZA 3V7WA 2W6PA 2GAOA 3L3FX 3GJTA 3UK1A 3IOYA 5CXXA 3AL0C 1QJCA 3PSIA 3BXOA 4OSEA 4YDHB 1C4KA 4LN1A 2GOLA 4RHCA 4S1VA 3AJDA 2RE8A 3ITNA 3V1MA 3LL4A 2Y4OA 4R69A 2QARA 1LB2B 1S2LA 3U31A 3PEUA 2JEOA 3II6X 2QUZA 5E1DA 3ZH2A 4W99A 4OHKA 1UJMA 3VR0A 1EFPA 3AF2A 3Q2OA 4N5NA 2WTNA 1WVGA 3ZLBA 2QTBA 4DQLA 4DMGA 1ULZA 3J81j 1LEHA 2HBYA 2ZEJA 2ZYTX 4CQMD 2PT9A 2OD2A 4EYIB 3ZDFA 1OJ7A 2FSIA 4RLQA 2FUG1 5BW4A 3WKAA 5FA8A 2PUCA 5KFHA 1XZQA 4UNPA 2XYHA 5BSGA 2PX6A 1JFLA 2LYBA 2JI8A 1ZVJA 4ZZ2A 2E85A 3NV7A 4QZDA 2WJHA 1ZXBA 1XMIA 3DS8A 4ZI7B 5BSMA 1T6ZA 4GLFA 1OIXA 1VLZA 4CCWA 4ID9A 4AL4A 2IS1A 1ZLXA 3IDAA 3Q9LA 3K73O 3Q3HA 1X19A 3K0KA 3VX3A 4G1FA 3LUCA 3GLGA 3FNEA 1KEUA 4RQ2A 4Q3AA 2YXEA 2QD3A 2R2AA 1X7HA 3JQ6A 1L5GB 4BNTA 3KTAA 2VHXA 3LUJA 1TEXA 2AJQA 3TYXA 3T7KA 4Q1FA 2DP4E 2X6TA 3E23A 4ZREA 1NYRA 1XK7A 1QB7A 1ZR4A 4LK3A 3VMMA 3PF9A 4ZEWA 3QUSA 5ECYA 3LYUA 3G2HA 1PGNA 4EFDA 1VG1A 1PJ2A 1G59A 4IIUA 1DEHA 3L79A 4KXMA 2Z6VA 3ZWYA 1VXOA 2I3BA 8ICXA 5IIMA 4HRYA 2V9ZA 3ADBA 4OV6B 4CM8B 3CZMA 5LQNA 1ZBDA 3G2KA 2IT1A 4MYDA 1QBGA 3H75A 4ENVA 3RSQA 3PSTA 2C3OA 2O59A 1UWCA 4FXPA 1CUZA 5C1BA 1VQ1A 2ZIFA 1N61A 1B26A 1SPXA 4B1FA 2LVBA 3KZXA 3F2DA 1K9VF 2J5QA 1R00A 3M1LA 4XOIA 2X8BA 5EZ6B 2ZGVA 4KP7A 4NAHA 3ML1A 2ZI9A 1GPKA 3HLTA 5JI3E 1CT9A 2I2AA 2RI0A 4F3OA 2R6AA 4XA5A 4MYHA 2CY0A 4KQFA 1H1LA 4BAZA 4XGRA 1JBQA 3GFSA 3WYNA 1NSTA 2AC7A 4J2HA 2RRDA 1FNDA 1KIFA 1IM4A 3OLQA 1N0IA 1BFKA 4FO6A 3LU1A 3HU3A 2J5BA 3E0XA 4Y2YA 3C28A 1DCMA 2QW1A 4DADA 3EXG1 5FNVA 3U6KA 1SUSA 4KLAA 5BVGA 4K6MA 4D7AA 4OHVA 2MUTA 4IVNA 5JD6A 1T9AA 1QG6A 2P67A 1AUQA 4QTZA 4ZHQA 1CUBA 1NRWA 1T6BY 1DKOA 3PCRB 1VCNA 3H05A 5G41A 2C97A 4H15A 3U1BA 1WZNA 3DL0A 3NEPX 3EZ5A 1DWUA 4RZ3A 3FZQA 1S10A 1X87A 2ATIA 3H9GA 1F2UA 3M8KA 5ARDA 3ANMA 3D6FA 1XXLA 4OUKX 3UAGA 3TSOA 1IG6A 5KOYA 3PPYA 3GFBA 2BE9A 4I28A 1UFRA 3NO4A 4ZIRA 3CRXA 5K8VA 3HJRA 3LM8A 2RK4A 4KGXA 1RC0A 2JLWA 4ESVA 2VCEA 4EHHA 3N8KA 1G20A 1WWUA 3FDSA 1C8LA 5LQSA 4RK6A 1IWPB 1B43A 4KAAA 4D43A 4AG6A 1QX4A 2PBZA 3ZGOA 2AKEA 3DOUA 3B12A 4X94A 2D3DA 4OJNA 2OV8A 2YMPA 1SD5A 2PUVA 3QVLA 1M1YA 2ODTX 4EO9A 1OVMA 4UBOA 1ZISA 5HIMA 5LOVB 2C0PA 1H8ED 4ZCMA 1E6EA 4J16C 1EGMB 4Q9JA 2O8CA 4RTOA 4KPUA 1LV5A 3QEMA 1OFHA 4DDUA 4EBDA 2I8CA 5KFJA 4O9MA 4A16A 2NSJA 5K0CA 5KTSA 4DL2A 1UDBA 3T1YB 2VDMB 1CERA 2PX4A 3MMSA 1U0EA 4GI2A 3H04A 2IOQA 3IHQB 3H8WA 3FDJA 9ICTA 3P7MA 3K6SB 2AF3C 3TRJA 3U5ZB 4KTQA 2O0HA 3LBFA 4F04A 5EWGA 1BVRA 1Z5WA 2I3AA 3SPXA 1WCIA 1EE1A 4CZ2A 2EFCB 3LYLA 5I9SA 1LH0A 4KMOA 2IOHA 1M1ZA 3G13A 3SQLA 4EW2A 3IQZA 4QQFA 3K0CA 4EJ0A 1TCUA 3PDUA 1RAFA 3EF3A 2W6JD 1ISSA 2FPIB 3EGIA 1I7DA 1GCUA 1EI9A 3CNQS 4MQLA 2HSGA 4N48A 2J9ZB 2AEJA 1TXGA 1TYAE 2YC2C 3QZUA 5DGCA 1ZJYA 3PE6A 2G5PA 1DAEA 4CL0A 1E3IA 2BTQB 5JSKA 3CLTC 2HBZA 3MJHA 2PBFA 1NLYA 2VP2A 2PX8A 3M34A 4IXDA 3KBOA 4DF3A 3DLHA 5C3MA 3HVUA 3RTEA 1KA9H 4ETWA 1AN0A 1ZX1A 4RTJA 1LPPA 3VR4H 3IAS6 2MR6A 2P5TB 4EUHA 3NVWA 5EIOA 2B8JA 3OCVA 1EBFA 2CSXA 4ZTUB 8ABPA 1UMKA 3ZY6A 2MYUA 5C8YB 1GQRA 2XVAA 4U3JA 4X85A 5DIZA 4CKBA 3IVMA 5ERYA 2ZUUA 3IE2A 2GK7A 3LT4A 1ZM4A 4IV0A 4ZRDA 2GN8A 2QMQA 3EXHB 1HNXB 1V4NA 3B89A 5BR7A 2GK6A 1IY9A 4U1RA 3TTUA 2EBUA 3PS9A 3WL7A 4OHXA 1QWOA 4W5WA 3NHLA 2A1JB 1SVWA 3OVMA 2DEUA 4NTZA 4RULA 2ID8A 1A88A 3PPWA 1F6BA 3AH8A 3WNZA 1E9BA 3LWNA 5AHXA 3EUEA 3FSEA 1GUFA 1T10A 3HCWA 2OCLA 1XE3A 3OSZA 3Q8LA 1NP7A 2GJAA 1Z73A 4PLCA 4JNKA 2FZCA 3WIBA 4E5PA 4KE8A 3F7MA 1N2GA 4IIXA 2FN9A 4NVRA 5JSYA 2BFOA 3DAFA 3EFBA 3RSHA 4D25A 4J0DA 3HQ4O 3N7RC 5EZQA 4AZ0B 4KR9A 3GQBA 3WKCA 4HN4B 2IPNA 1QRUA 1O6BA 3M6WA 2QTVB 4XLTA 4LECA 1SXJE 1HTWA 1ORTA 2M6RA 3HA2A 1OV6A 1YWGO 3KFXA 3H2BA 2HNAA 2OVFA 1SXPA 2OT3B 2OQRA 5DGXA 5L40A 4DG8A 3K9LA 1E1CB 3I5YA 3O38A 3T52A 5JYBA 1U9IC 2JR5A 1RYEA 3DPUA 3PGXA 2RARA 2Q21A 1FRVA 5DLYA 1BU8A 5AK3A 1EVQA 3RT7A 3S70A 4YYZA 1OU4A 2VJKA 2B1JA 5KFSA 2VSXA 3BTOA 4G09A 4JYZA 2G4VA 5DNEA 1NSYA 2F55A 3FXAA 1NKSA 3WB1A 1G0NA 1TMKA 3JQRA 1EE9A 4QZFA 3O1LA 1I1HA 5CP8A 3UMVA 3ZLJA 3NGDA 1FFWA 1DIBA 4WX2B 3GMIA 2R00C 4JGIA 1Z7YA 2W83A 3CPEA 5JSZB 3OCUA 3G5UA 5IHXA 2FU5C 5C18A 1R5OA 1GZDA 3DAOA 5GADl 3QMVA 3P2YA 3KX2A 3GEDA 5I47A 1M8PA 4ZYLA 2XE4A 1UCVA 1CR6A 3E5HA 4LTDA 4WBSA 3U62A 4Q3OA 1D8LA 2LD4A 4II3A 3BB4A 2X5OA 1VMIA 4KI0A 9ICMA 2OYYA 1T5LA 1ZHFA 4JK1A 2P2YA 4DXAA 5D86A 5FFFA 3LZDA 4BFTA 4G0NA 4IY1A 3PMNA 4C5AA 3W6OA 5KI6A 3IAS1 4NZOA 1BXGA 4Y67A 3IKTA 4MO9A 4KMUA 1MN6A 4Q4DA 2NXCA 2UVUA 4BZXA 2PX5A 1W4LA 2QQGA 2BL4A 1PCXA 3R0IA 2PGNA 2YIDA 1DBPA 3EF1A 3QYJA 1V41E 1KEVA 2EGHA 3AW9A 3CH5A 2CWWA 3VGPA 5KWVA 4QYIB 2H1HA 5IZ4A 4IDCA 4XWYA 1HYEA 4JENA 4O33A 4Y9SA 4DCMA 3HFRA 3TNDA 1Y48E 3HP7A 1R1DA 4Y1FA 2NVBA 2RH8A 3PY8A 4FYIA 4EM6A 2ZT7A 1T8YA 1C3LA 4DNOA 3C8MA 4R9UC 1TE2A 3N07A 3SM9A 7ICTA 3DZFA 3GY0A 4H77A 3PKIA 2XNSA 5K45A 4E4RA 3NPMA 3NGLA 3W34A 3WDKA 4PG5A 2J32A 4MFCA 3AR6A 4CLRA 5KFGA 1K8ZB 4BX9C 3VDMA 3JVUA 1B0XA 1C1DB 4ED2A 4JZYA 3WGKA 4FDLA 4LGYA 1XT6A 3A9TA 3TAHA 5FWAA 2PBRA 2BFEB 1XG5A 3DEAA 5ALRA 2GYUA 1ZQYA 3T79A 2ZJBA 1TUBB 4ARBA 5AVYA 2C28A 1J21A 1QXSA 1QG0A 1U2QA 4DR4B 3EODA 4PE5B 2ZT8A 4K05A 1UFQA 3DTYA 2ZR8A 4EFLA 3EFEA 4KDFA 2IUUA 3WJ7A 3T3HA 1JIIA 1OWNA 1DDIA 1EUDA 3OLXA 2H3EA 1UP4A 3HACA 1S5PA 3VNVA 4CKWB 3K9FC 1II0A 2GBLC 3A9CA 3QVUA 2GSDA 2J1LA 4DE5A 5PGMA 3B3JA 3TKAA 3UK7A 3BQ0A 2NZVG 4RPGA 5KG6A 2SHKA 1UXKA 3BXXA 1JTFA 3I1FA 2WMOB 2AKAB 1JA1A 4YH1A 4MDYA 3EIWA 4OJYA 2IEBA 5FWYB 3OAAA 2WWRA 2DX7A 1W25A 3K9GA 4TQGA 4XYMA 2XRMA 1Z2CA 3OFVA 3KQHA 2Q2OA 1TRHA 1G2QA 9ICVA 2NOAA 3Q3EA 1I8TA 2CVZA 4IJ5A 2IBTA 5JJIA 1SBZA 5GGXA 5FH9A 3ZU4A 4N49A 3ZY5A 5JO9A 2GD6A 3H0RB 5FP0A 4NM2A 3ZJYA 2GX6A 4PQEA 4F86A 3TQHA 4J43A 4ED7A 4MV8A 3D64A 4QARA 3BL6A 4JC8A 1AH2A 3CMMA 4ILKA 3DV0B 3FTCA 3PSFA 1VYVA 3LXUX 5FPKA 3SC3A 3AM5A 4WXPA 3SQNA 2R79A 1Z0AA 2WJPA 4YMOA 2E4AA 4D9GA 2XJ9A 1TK3A 4B9NA 1TO2E 4BB0A 1OLSB 4LPSA 1THGA 2DFVA 4ZI5A 3UJNA 3COZA 1WEKA 4E1VA 4YEDA 1T1GA 5H3LA 3R20A 4MWOA 3FIUA 1ZJNA 3BL5A 1RVDA 2RIPA 1JR4A 1XLVA 2DUMA 1LNZA 3BZUA 3LKBA 3TSWA 1ZQ1C 3VKUA 5EHXA 1L4LA 4M9RA 1C7EA 3F97A 2P35A 4NJEA 3AKZA 4RIFA 1EJ0A 4K03A 1SCUB 2HU5A 2FWIA 4DPLA 2V4ZA 1WUHS 2EYUA 3IQWA 1FDSA 2NV3A 2YZ7A 1HBJA 2V7XA 3V3TA 1JZTA 1DOZA 1HLPA 4NENA 2ZI6A 4HEA6 1H05A 2NO9A 4BAGA 2O5RA 1OKKA 3QK7A 3ACCA 1WV1A 4UKDA 4HKTA 3C3XA 1DBQA 2AXQA 3VSCA 3LBYA 2PLNA 3FTEA 1YCGA 4JI0B 3OOWA 1IJEA 3DWEX 4ME6A 2AC4A 1YFKA 4YAIA 4JH0A 4AKSA 3QX9A 3OU6A 2FQWA 2ACVA 5G0WA 3ZHQA 1U9JA 1UBHS 3PQ6A 5HFNA 5HX7A 2YOHA 4R1PA 2BJVA 2XUAA 5KFYA 1YJ8A 3RJFA 2QU7A 5TS3A 5KFDA 4UUAA 4UHHA 1ZCFA 3NHSA 1JTEA 3KQLA 3L8CA 3SF8A 2QVCA 4RY9A 3A14A 5IP5A 4PFSA 1UDWA 4DNFA 5B7GA 2FLKA 3ZHXA 4ZEMA 5GV7A 2IV2X 4NY8A 5JEEA 2YWEA 3RV4A 3UJ6A 1Q8KA 2GAIA 1EFAA 5ICMA 3JD1A 5IAKA 1V3TA 2MYTA 4PAQA 2BF7A 5DU2A 1GGHA 4RENA 4JZKA 5FTNA 3KQQA 4Q5IA 1WPQA 3RSSA 2H5LA 5E7JA 1ODJA 3WAKA 1N5JA 3C7CB 4Y0VA 1GARA 1MP0A 4E4TA 3RVPA 4ROSA 1SA0A 3HJEA 3SC2B 1RAEA 4PR3A 3T5BA 2GPBA 1E9RA 1D3AA 1N1EA 4RPKA 4AUNA 3O8BA 4DSTA 3NIGB 1PEDA 1E6UA 5JUWA 3AL2A 3TLZA 2I5HA 4V1CB 1V6AA 2C5HA 3RC2A 1AY0A 1PK1B 3HVRA 4J0HA 3KG2A 4ZYVA 1QYIA 2VEOA 1ODTC 4LZGA 2VTBB 4JY7A 4IKPA 2AE1A 5REQB 2P6NA 4KWEA 5IM5A 5HHTA 3RJ5A 3UHFA 4NC9A 1RZRD 2CE2X 3H5TA 3V42A 3ILHA 1E60A 4F1WA 5LMCA 4J75A 2KE7A 1YR1A 5BVHA 2IDMA 4MQ4A 5KFQA 3P94A 3DL4A 3ZHCA 3T06B 2LE0A 3IAEA 5K20A 3DEHA 4YCCA 4CUZA 2BH9A 2DG2A 4HL6A 2HJWA 3T3NA 1XCOA 4JROA 4P58A 2P1DA 3G2JA 2OYSA 3W9YA 2WM8A 1JZSA 4MEXA 3RS0A 4E08A 3EX7C 3AFHA 3Q8XB 4DDMA 5FOWA 2AHRA 5SY9A 1RLUA 3VOAA 2WM2A 2VCYA 4NBNA 3AVYA 4CQMA 5L4NA 3VBCA 2ZU6A 2B4QA 3HFJA 5AKXA 1T3QA 1XCPA 5LNK6 3RS9A 1E1RA 4KB5A 3ET4A 3M83A 3FC4A 3KJGA 3R7LA 5KX5B 3AR4A 1F5SA 2OMEA 2OLEA 3QKRA 4O0MA 1NK5A 2GQ0A 4IM7A 4RDXA 3ECAA 4Q7LA 4RFLA 1U45A 5ICEA 4HEA1 4JA0A 2QN6A 1BQ4A 1ECPA 3O8RA 1R4AA 3L4EA 1YBHA 4EL5A 4GX1A 4MKZA 3I83A 4WXMA 4AW9A 3A6KA 2X5XA 4ZI3A 3PGA1 3W79A 2NSDA 3VH2A 1V16B 1UUFA 1D07A 4G5XA 3EARA 1SKBA 3WMXA 2V74B 1AS0A 3D8RA 5EEGA 4FKZA 4KLLA 4A36A 1H0HA 3HPRA 4G0PA 3KEOA 3MJEA 1W96A 3MGGA 2M9NA 2RGGA 5JJBA 4U5QA 4OPMA 3MUNA 1ZQJA 2HQSA 3TR0A 5HFAA 4TLEA 4FBGA 5DXAA 1LC3A 1MC4A 2V7BA 1CR1A 1GFZA 3QXHA 2H2WA 3LDHA 1Q2XA 1PTJA 2PRYA 3AVWA 5ICSA 2QR5A 1E4EA 3H0LB 1E64A 2FMXA 2Y1GA 2DHCA 1SQ5A 3U26A 2DTDA 3RADC 4B3FX 2BR3A 2PL5A 1SBCA 4RZHA 1YGYA 3THYB 5KFCA 4LISA 5FUXA 1E0KA 3KEFA 4P4LA 2D4HA 2ZE7A 1D2EA 1ZH6A 4J9VA 3I45A 3BA6A 1ZMOA 4JSYA 5EXSA 3VTKA 5IDWA 3PIIA 1UC8A 2YICA 1YS6A 3IMFA 5ER6A 3T4EA 3Q3JB 1D9FA 4D9EA 1P9WA 4LZDA 2QQFA 2IPLA 2FW8A 5BV1A 2JARA 4TS1A 1V6SA 2X1HA 2H2GA 5HRAA 3C14C 3ZZMA 2V7GA 1GN9A 1YZNA 4HDMB 1XEFA 4K1LA 5K0ZA 3AW8A 3LVQE 4M83A 1WZCA 2BFCA 2ZBVA 1LSJA 2ZIEA 2UUPA 5GZ3A 1DJLA 4I2BA 4RF5A 4TS4A 3KLOA 3T7JA 4NLBA 5FPTA 2YOFA 1BPBA 3R3JA 2N1MA 5LVAA 2X5JO 3VKWA 2CYCA 4RKYA 2QEQA 1GFWA 2KJ8A 1LQTA 4F4FA 3EVBA 3GOHA 1AHIA 5JBIA 3KP1A 4L95C 2Z1NA 1A5BB 2F77X 7MDHA 3JQEA 4QUGA 5T5QA 2ZI5A 4C0ZA 3ICOA 2ZSDA 3T54A 2V4MA 3OA2A 4UPDA 2XRZA 4TZTA 1QK5A 5GTHU 1DZIA 1QCZA 4O25A 2DBVO 4Z6FA 2YFQA 2VDPB 1U3VA 5HVNA 5LNK1 3G8YA 1HRKA 3PFKA 3WBFA 4PFQA 3LNCA 3VU1A 4CLXA 4YJHA 1EZ1A 3UH1A 2QNRA 4DCOA 4CEHA 2XNHA 2BW0A 4KH1A 4MRRA 1YUNA 3ZS9A 4ZO6A 4RV5A 1K7CA 5E6SB 4ZPXA 1GV0A 4QGSA 4RQ5A 1CX9B 1PBNA 2GTIA 4DUPA 3BILA 3RUDA 1QVAA 4JASB 2EJTA 4NCXA 2D0PB 3HTXA 3WK6A 2FWJA 1QO0A 2BJHA 1Y42X 5B12A 5EUCA 1ZCAA 2EDAA 4BDSA 1PTKA 2A5JA 4ER0A 2OAP1 5EYPB 1KSPA 1C9YA 2V5AA 5J0XA 3EZYA 4RTPA 3H5LA 3X1WA 4EJSA 3DA8A 2W6ZA 1ZK1A 1E2JA 3N0TA 3KQYA 4IL5A 5JRZA 1MJ5A 1T3TA 1TJNA 2PKRA 1F8YA 3MTGA 1XEXB 4EB3A 1U3UA 4B6EA 4IUYA 3EISA 2X40A 3HKCB 4QVIA 1GPMA 1OXXK 1S2IA 1I6KA 3E5NA 4C8OA 3EIQA 4RHTA 4YV0A 5DGBA 2YJ6A 1SNYA 2H00A 2B6NA 1QP8A 4FE7A 2JGLA 3V8EA 1DIHA 3NYQA 5D6NA 5J2DA 2I7CA 3AQ4A 4MGZR 3HU1A 2CMKA 2WU1A 4RQ3A 3GV0A 3EQ7A 1SVMA 1D4ZA 4RUKA 5D3ZA 3TWOA 3GA0A 5BSUA 4R4JA 4ZT5A 4PLHA 1G63A 1ZOIA 5CYGA 4GBGA 2OXTA 2MTBA 3M1YA 4LJ6A 1XXHE 3I9MA 1LRLA 1KQPA 1XZEA 3Q2IA 2GXQA 2FN7A 2GJ8A 4D9FA 1SQGA 2HCRA 1BFDA 5EZYA 1UP7A 3W9BA 4IDHA 3F73A 5KNDH 4HJRA 5JAIA 2C7PA 4WMLA 3MPOA 4KRXA 3AI1A 5COAA 3NASA 3PLNA 1ZOLA 3HCNA 4J9PA 1V96A 3G5TA 3DNFA 3G5AA 2HHVA 4LNAA 4F9TA 2M0NA 3ABQB 1ID8A 4Y2SA 2RKBA 4OJ5A 3K1TA 4UEJA 2P77A 1GGJA 5IFKA 3F5AA 4B7CA 3RG2A 3W04A 3V6KA 4C76A 4HDSA 5JCOC 4UUMA 1KZ7B 1YKFA 1AHHA 3RREA 1KY4A 3N7UA 4MF8A 2BMJA 2BZSA 1KK1A 3UXPA 2GTHA 1X9XA 4A0FA 2IUSA 2P11A 4LV5B 4G9BA 1RWKA 4UM8B 9ICXA 3JAWB 1W94A 4AJ1A 1XELA 1CRLA 2PLWA 5F3RA 2OXCA 3RSOA 3PUHA 1PVDA 3WOHA 4YR9A 3EDMA 1U4SA 2HJGA 4PLGA 4JUAA 3I64A 3AUOA 1JUDA 2RAUA 1ZK3A 1XPRA 3BXGA 2CDNA 1DBVO 3AP3A 2ID7A 4F96A 4IEEA 2PT6A 3WGZA 1WUIS 2H6EA 2CCJA 3D9QX 1L8QA 5KSYA 3H1PA 2QMOA 2X13A 3ISBA 1KFJB 2G6TA 3O2JA 2GWHA 3L7LA 5HR6A 1OYVA 4TQAA 3KSUA 4CNQA 5DT2A 4JI7B 3B1VA 4KO3S 3MSCA 3C5WP 1Y7TA 1JW9B 3DEJA 3R0ZA 5E79U 2AD1A 3R6WA 1HMPA 4UMEA 1NUQA 2WKQA 4WV3A 2O0JA 4YQYA 2WUGA 2TECE 3CRZA 3S29A 1I4WA 3DDSA 4KLRA 3KYDB 2WKPA 4EVSA 1DJNA 2B1GA 4CR8A 1OXKB 2C58A 1WRBA 1NN1A 5IILA 4ED3A 2X9GA 4P83A 1OREA 3DPSA 4UJ5A 4FOLA 1MRSA 1QFJA 3N2KA 3BCUA 4TM8A 4YDSA 1D4AA 2RHCA 4I7EA 5LXTF 2XQJA 2XHEA 3PR1A 4HGZA 4N54A 3PIDA 1W0CA 3DP7A 2OQVA 3SJZA 1AQ6A 4H6VA 4K4GA 2ZIGA 4KI7A 4HGYA 3BJMA 1SRQA 1L7BA 1NV9A 2G7ZA 4AJEA 2QAJA 2CHVA 3NYRA 1RWNA 4WNYA 1TCVA 1X7YA 1YB5A 4PZDA 5D3QA 3PSAA 5AHOA 1JPUA 2FE4A 4HEJA 4QNNA 2JIPA 4J2TA 4DR7B 1FXSA 2I1VB 1BPYA 1WXEA 4RQTA 4TQSA 5KFAA 1QTNA 2JGJA 3MTEA 3M4XA 3RJ9A 2ZT5A 4C0XA 5M7EA 2COKA 1JJIA 5KCMA 4D0GA 1E58A 2IP2A 1I3LA 1XKXA 4FINA 3L6BA 4TUSA 2E4VA 5LFAA 1ZGCA 1JVBA 3TFRA 5FL7D 1A5ZA 1UMBB 3JVVA 3AMZA 5THKA 2BCEA 3AI3A 4I3HA 3E03A 4KODA 4PG4A 3H5VA 3M7IA 5JDIC 1TU4A 1LTHR 4OHUA 3V48A 5H4GA 2XE7A 3USCS 4J4TA 1A50B 4OBWA 1PEAA 3V7NA 1UM9A 4JUIA 1M6YA 5B1IA 3RVDA 1Z2NX 5IKMA 3LVBA 4MYTA 3TZQA 5A4IS 4FEAA 5HGJA 1D2NA 4PSVA 4G0WA 1ZM7A 1LI7A 4L3WA 2RGCA 1GRVA 2YDXA 2ZFUA 2QG9A 5HTKA 3O8QA 3AETB 4O4IB 3B13B 4C5CA 1T0PA 2HMXA 3GV8B 3SXJA 2R1TB 1BDBA 3ROGA 3T7IA 4PZUA 2WAQC 2W43A 1PBTA 4TT3A 1DXSA 4UHDA 1KAGA 3W05A 2XC9A 4CKEA 2WAQF 2XJ4A 3JASA 3RPEA 4ASUD 2HOFA 4PQFA 1LDMA 1ATIA 2NU7B 3CNOA 3DTVD 1L4EA 4DRYA 2EKPA 2CWDA 1ODLA 1I4EB 5H1YA 3MTAA 1C41A 2H7XA 1AXRA 1WB5A 3IPAA 4KSCA 2JIDA 1GTMA 3HJCA 4X5OA 3DCYA 1GPLA 2EBHX 4RVNA 2YY6A 2DQ4A 4YS6A 1Z07A 1U28A 1JHPA 4HUJA 3H16A 2HDOA 2D0DA 13PKA 5SICE 2RHRA 4MPPA 5SZIA 3MJTA 1KL7A 2H8GA 1UKYA 1ZI8A 4WVFA 3RFXA 1UZNA 1JKIA 1WB4A 5A02A 2B4TO 3RK4A 4UTOA 1RWOA 3TW0A 4KGDA 5FBRB 2FUG6 4H1VA 3RC7A 4P7KA 5C8XA 2QMZA 5T4BA 1BPXA 4INPA 4KKXB 3NIFB 3BK7A 3FI0A 1CR4A 1XS9D 5FJJA 3ZU3A 4J0EA 2AOTB 4DQSA 1OH5A 1RJWA 4RE5A 2GTPA 3MK31 4MULA 1GZ6A 2GD2A 1EZZA 1X38A 2GB4A 4KIFA 4KV9A 4RY0A 1ZN9A 3QZ8A 4CMEC 5F23A 2ZITA 1BTOA 3JQAB 2JG3A 3FRIA 4HBGA 1CDDA 1TM4E 5JU5A 1C3VA 1XTBA 2VKTA 3L7DA 4DOAA 4F2DA 2CFIA 1KRXA 5E7QA 3CKKA 4ES6A 4LG1A 2OGZA 4YG2A 5J58A 4B3RB 3B2EA 1NZFA 2K4PA 4CN8A 2ZIVB 5BN5A 3B82A 3HJAA 1HE2A 1KWGA 4OQQA 3V55A 5IJWA 4YRZA 1L7AA 3VNUA 3M6UA 3HP4A 5LKAA 4PRZA 1M72A 5B3JC 3K4GA 5CX1A 3QVGB 3VPAA 3DLAA 1Z68A 4BNDB 5DDMA 5SY6A 2VXCA 2EKDA 1USGA 2YQ5A 3GJZA 3R0XA 3EJ6A 1Z6GA 2F8MA 3TO5A 3MWFA 3KTOA 2YW9A 4BKOA 3L7OA 2I4RA 4MB6A 4BEVA 5I9LA 3AU2A 2C78A 1MSWD 4F0JA 3T9CA 4Q47A 1R0XA 4R68A 4A27A 3DMHA 2GEDA 1KJWA 5A9TA 2J45A 2H52A 2QUIA 5G3YA 2P6PA 4EYGA 3T7RA 3PFFA 2B37A 4AIIA 1QLJA 4K40A 1E2HA 4A8EA 1VGRA 3RSFA 4LIPD 2A9KA 3NATA 3EH1A 3QW4B 4O2BB 4BIMA 3KSAC 4PX9A 4DLYA 4B7UA 2JGRA 3D0RA 3CNBA 4RZQA 1NTRA 3OKFA 2RH9B 4B5KA 1RBQA 4ARUA 5LYJF 5TQ0B 3GHHA 4G65A 5I7FA 3L04A 3B51X 1EVJA 2O8BA 4J9NA 1VLBA 4ISBA 4WW0A 4QVKA 5U9CA 3WYDA 4XVUA 1M2KA 5K7SA 2Y92A 4L02A 4TVOA 1ONBA 3VI3B 4NU0A 2PMDA 3T61A 3V2GA 1PUJA 3V46A 4EEZA 2ZRGA 3W2HA 2HQOA 3CZPA 4UM7A 3ORQA 1Z25A 5KU1A 3GNLA 2FX5A 4KVFA 1JKMA 5DGDA 4IXWA 3V4PB 5DGIA 2LBPA 3CNEA 4UOZA 3ZUPA 2IXEA 2XA2A 4F4ZA 1U3FA 3I09A 2BUAA 3AESA 4X1KA 1MRNA 4B85A 3IKMB 5KAPA 5B3AA 3V8PA 4JLMA 1UQTA 1F48A 3PTZA 1OZAA 1X1SA 4OKIA 4C2TA 1CQPA 8ICRA 5IDYA 4FFRA 3IT0A 1P5JA 3PUKA 4U00A 1PD1A 5G1OA 1QR2A 4P3KA 1WV0A 1DAPA 4GXNA 3KXPA 1X8KA 1DCFA 3DOIA 4JLPA 1T8WA 1GSIA 2NUTA 2AOUA 3L8GA 5IJ0B 1JEEA 2I80A 4QC2A 2FSHA 4LQLA 3BRWD 5E4TA 5B57C 4O8CA 3LC7O 2WA1A 1SOUA 5C7YA 3GRPA 4L4RA 3M6VA 3P8ZA 5TMBA 1FFUA 5BUCA 3GAAA 4FYXA 2LGJA 3GJ7A 1DRUA 4ZJZA 2JGAA 5B4VA 4I1OA 2QBYA 1L7MA 3CW2C 3WMRA 3E9MA 3FIJA 1QCYA 3ALRA 3NIDB 1YZLA 4XTRA 2O3TA 3DXXA 2IHJA 3R8XA 4XARA 1QONA 1KDOA 4YTEA 5JZOA 1V47A 1QFXA 3UUWA 4B8ZA 1U7ZA 3C8DA 4AXXA 5LQCA 1SHKA 1GYPA 2OEHA 5A9SB 2AI3A 3U4CA 1AKVA 2YZ2A 4I4NA 1JMYA 1GR1A 3MMZA 2E48A 4O4JA 1XZGA 4WCFC 4RMGA 6REQA 3CCFA 2UVPB 1JNYA 1ZH0A 5CT9A 4EGSA 5IDVA 4BEWA 1SL2A 1YT5A 1E8NA 1K7FB 2ZKLA 1DMRA 2E18A 4ZAGA 4MV1A 5EMNA 3LGXA 4ZRMA 5KTPA 2J3KA 3B3GA 4KPFC 2GRUA 3CYFA 3HZZA 3GLHE 3CSSA 3ZV3A 3P52A 1JIJA 3RS3A 5B37A 4A2CA 3ISTA 1V7PC 3OT1A 1GEGA 3L0YA 2EVWX 4EVRA 3N4MB 3D7MA 2EGUA 5A7FA 4WN9A 1CG6A 4I2DA 4NZPA 2D1TA 3R9IA 4PHAA 2P1ZA 4YJ3A 9ICNA 2QU8A 1NM5C 3DLTA 4GUDA 4FDAA 1C1XA 1LRKA 1J97A 4MKIA 1IPEA 5L1KA 3JZMA 4RQ4A 1CF4A 3FMPB 5LBIA 4PFKA 2YIVX 4ZOLA 1F2TA 1RXWA 1MT0A 1SY7A 3C3PA 4O3NA 2L5YA 1ZOSA 2NV6A 3W5IA 4ALLA 3I76A 5K8LA 1FDIA 3BFJA 5I9IA 1QGYA 2R8BA 3EVTA 3EFOB 2AA3A 3NHJA 4Y6OA 4MUYA 1GPH1 3KV3O 4NK4A 2N0SA 4ZDKA 2KE5A 4TMZA 3G9TA 3H2KA 4ZU6X 4O5CA 4TKUB 3ACBA 2D5AA 2VS1A 3ZGNA 2GN6A 2DERA 4NOMA 1Y4AE 4LXTA 4ZK6A 4BNIA 2FP4B 4RADA 5L8VA 4BEJA 1W5SA 3EMDA 1IBMB 2YXPX 3A05A 4FDMA 4Y1RB 2GJ4A 4I4LA 1ONPA 2AT1A 1W5BA 4KLMA 2IHNA 2EL7A 2AGOA 1C8BA 5KJEA 2IIPA 2D2VA 2I6QA 3TTXA 3CC8A 3WLIA 1S8OA 4KQ1A 1NK9A 2P8SA 1XF9A 3BK2A 4YMGA 2G0AA 3DE2X 4L8GA 4J9OA 3WGIA 2QAGA 2VNIA 1XEAA 4MGYR 3ZHOA 1NPDA 2PUWA 4M0DA 3G5LA 4A6EA 4DLSA 4FR5A 1W2WB 5JRTA 4F6RB 3WFJA 3JQFA 4HO1X 2ODNA 4RTNA 1XDZA 3OZFA 1NMSA 2ISCA 3EGOA 1KK3A 4DSOA 2WW8A 1U1EA 1DP4A 1FYXA 2WF5A 1FPMA 4FFBA 1JQ3A 1C7ZA 3BWCA 4R1MA 4HWTA 3MUEA 1GKYA 4IC9A 3LT1A 2GCPA 4BP3A 1KR5A 1BPDA 3EVFA 2AR7A 1Y4ZA 4O4LA 2O2ZA 3E84A 1XTSA 1PK8A 4BIIA 1WU8A 5KHAA 4MWTA 3PKJA 1D8TA 1V8BA 3CLUC 2CN1A 4OLHA 5CT8A 1O97C 1RCFA 3G1UA 2ERXA 1WVIA 1PT8A 2Z6AA 1EFRD 2RGDA 2IZZA 1JDNA 1CY1A 2KBEA 1SK9A 5IAAA 1IN7A 3AY7A 3DYIA 1CY2A 2P69A 2YVKA 3D43A 2IMWP 2VYFA 1C9DB 2IVZA 2AQ4A 2AQ0A 5IIJA 1KDTA 2I9GA 1A8PA 1KAMA 3U17A 5JUMA 1ZH2A 4POAA 5C37A 4HRAA 2CNOA 4MUEA 2IHMA 1HT3A 3THXB 3MWGA 3WO1A 1QAMA 3DZ8A 1QZ3A 5F1KA 2WABA 3CZQA 1BG6A 2XY5A 4WNAA 2GBGA 3VTAA 5J0PA 1E3EA 4N7BA 2PD6A 1IZ0A 1RMTA 4MUAA 3VDRA 3K1AB 2Y9PB 4MV0A 1IJBA 3TOZA 1N9KA 4K0KB 4KJXA 1N6HA 3TOXA 1ZITA 1NVWQ 4BZPA 2YV4A 5DMXA 1QP7A 3MSXA 2GVZC 1VMDA 3DF7A 3NV9A 4ALMA 3GLFE 2JXJA 1ZUD1 2EWWA 4IZ6A 1KBZA 2RGBA 4IGKA 4FGSA 3PGKA 1W4BA 3W6UA 1UZMA 2ZCJA 1EVIA 2Z7JA 1YXMA 5DTMA 4DCJA 4BX2A 4Y2VA 5AJYA 3AEKA 1X1BA 1ZJJA 3KHTA 2OHGA 1O0BA 4QG3A 3GP8A 2FR0A 4RXMA 1EX1A 2C5BA 4YJ2A 3EGVA 4OXQA 1HYBA 4BV2A 1RPNA 4FVTA 1K1SA 1P72A 2MSKA 3QUQA 4QUKA 4MPTA 4JJFA 2PZAA 5EE3A 1P6XA 5LA6B 2Y1WA 3I6ZA 3R5FA 3RFCA 4Z4GA 4O3OA 1MZPA 2O3SA 4DJ5X 2HSEA 4B8YA 1X7XA 1GQSA 3ZEAA 1V0JA 2I76A 1Z0KA 4IINA 4JYMA 3WQHA 3ROZA 2DHRA 4P2HA 1V5EA 4NBTA 3QYPA 1EFCA 2YVQA 2XXJA 3V7LA 5HSGA 1RQPA 3QXJA 3RRNA 1WPRA 3DH0A 3MBYA 1T4CB 4PWYA 1U48A 1IV8A 4QLAA 3HA3A 3FYSA 1TCBA 3RBDA 5K3CA 3BEDA 1U0BB 1TUIA 5AUOB 1ZW6A 1XCBA 2NUAA 2NRXA 3T94A 3GGCA 4EYHB 1NP3A 2ZM5A 3RC1A 4JR1A 2DPJA 4WRRA 2DQZA 5IYZB 1UMDA 1J8QA 3QLTA 4AUEA 5JSHA 2FLVA 1WXHA 3GGGA 1LI4A 1E9FA 4UATA 3B9BA 5C4MA 3P2IA 1KJYA 8ICFA 3R7NA 5DI9A 3FE2A 1O6FA 4KPEC 2BTEA 4JB8A 2FJUA 2CDBA 4R8RA 3HHEA 2XQKA 1A77A 4YMTA 4RGBA 3WGUA 4NPHA 1TMGE 3OIWA 4NNJA 2ZJ0A 1YHZA 3L8ZA 2GT1A 3GEPA 1K0FA 1NBMD 4JSRA 4CM5A 3CVWA 4DG9A 3WLQA 3KUKA 4ZU1X 4MIOA 2E8PA 1JSZA 4D3FA 1DXQA 2H63A 3UYLA 4BATA 2G9NA 3I1IA 4U2BA 4PRKA 3OJOA 4B9TA 1DKPA 4ZV9A 1V25A 2J3JA 3HWWA 4BQPA 2R8XA 1JDZA 4LY3A 5FWNA 4XM1A 4WZBA 4FLFA 3KUCA 4PGGA 1U8CB 4YRJA 2P2DA 3OM0A 3WBBA 1HNZB 4GZ3A 3WDLA 3F74A 2IS2A 1OD6A 4I4TB 2Y8EA 4YRPA 4F4IA 4RA6A 1JILA 3JQPA 2RKWA 1WW3A 4EB6B 2EW8A 4F06A 5D5PA 4F5EA 2UV8A 1LJ8A 5B66U 1GFSA 9ICUA 3R4CA 3VO2A 4Y7DA 1L1EA 1NMQA 1X1AA 5HZGA 2N75A 3SJAA 5IU6A 3GVCA 4Z9AA 1ONNA 4BQNA 2DH5A 4YAEA 4ECQA 1UMCB 4L08A 4TQRA 2GETA 2A5LA 4BO5A 5IJZA 4YB8A 4RQ1A 5BN3B 4PRYA 4TLMB 4DNPA 2QVYX 2V98A 3W5DA 2O2HA 1R0SA 2XD4A 1KTIA 5K0JA 1YZVA 3JZFA 3P0HA 1BKDR 2JANA 3KYBA 1R0ZA 1FP1D 2MMGA 1IHOA 4IDNA 1OH6A 3S7TA 2W90A 4C78A 4ZCRA 1UKVY 2CXUA 2FPOA 1VMKA 2HK6A 1Z29A 2ZIAA 4LJLA 2REBA 2PWPA 5EHNA 1O08A 2ZVJA 2DHDA 4XEHA 1OTHA 1TJPB 1GRQA 4L6CA 1JR3D 1WUJS 2D3TA 4OKSA 5FL7A 1Q3TA 2VXBA 5KNBH 5DM1A 3VVMA 1XAJA 1TAQA 3QBTA 3CCCA 1OFUX 2A9PA 4RELA 3TRIA 1J42A 5DSTA 3HBNA 3STYA 5JAPA 3RNOA 4EGFA 1KBQA 3LK7A 1P7YA 1XZPA 2X14A 4R9SA 5K3BA 2A94A 4QUBA 2MINB 1BQEA 5J2TF 4PH5A 1CUFA 1LB1B 4HAWA 4M89A 3K0FB 2XUQA 2QUJA 1KFCB 3RU9A 2OV1A 4PY2A 4OBXA 4EA9A