2WFAA

Structure of beta-phosphoglucomutase inhibited with beryllium trifluoride, in an open conformation.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wfaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wfaA01
3MC1A 1YNSA 3WK5A 2FUCA 3D6JA 3NASA 2P9JA 2PQ0A 4HGNA 4IFTA 5AW7A 1O08A 2YJ4A 3N28A 1VFPA 1FEZA 3NUQA 3QUTA 1PW5A 3FZQA 2YMPA 4KYTA 4DCCA 3I28A 3HLTA 5AW1A 1VJ5A 4UMVA 1ZD2P 2C4NA 3QNMA 5AKIA 4EENA 1F5SA 4CF3A 2CFTA 1S8OA 4GIBA 3WKAA 4MWOA 5ALYA 1Y8AA 3E8MA 5ALHA 3OCVA 2NO5A 4BX3A 2ODAA 2BY4A 3N5KA 5ALDA 3W5AA 3WK8A 1L7NA 2FI1A 5A3SA 4UARA 1L8OA 3ZW7A 1RMTA 4OHFA 2HI0A 1RMYA 1Z4OA 2JAOA 2VKQA 3IB6A 3L8FA 1QH9A 2WF7A 4L6CA 4G63A 3ZTWA 4UM5A 5AM1A 5AW2A 2RBKA 5ALVA 5ALGA 4KX3A 4BEVA 5AW0A 4UU0A 4JDPA 4XPZA 4AS3A 3I1YA 1WVIA 2YMQA 1XPJA 1QQ5A 5ALEA 4F72A 2I54A 2OYCA 2Q5EA 2WF9A 1Z5UA 2B30A 3ZWDA 3CZ4A 1WR8A 5AKKA 1YDFA 3OTQA 2O2XA 3W5DA 2B1QA 2GHTA 4EEKA 1RLOA 4YIHA 3P96A 3AR9A 4IG4A 3FPSA 3ZU6A 2FPRA 3QU5A 3WK9A 1Q91A 2G1AA 2ZBEA 2CFRA 3WKBA 5AI6A 4OD0A 3QU9A 3GYGA 1ZD5A 2ZBGA 3K1ZA 2WF8A 5AKLA 5AW8A 3DV9A 3WK6A 1TE2A 2P27A 3ONNA 2OA0A 2QLTA 4YCLA 4UAVA 2CN1A 4Y2TA 2HF2A 3NALA 3MPOA 2O9JA 2MSNA 3ESRA 5AW3A 4CE6A 5AKZA 2MU2A 3RFUA 3QU2A 2Q4TA 3IJ5A 1RPZA 1LVHA 4B6JA 3SD7A 3PGVA 3U7HB 1SWWA 3ESQA 5AKGA 5ALRA 4G9BA 2YJ3A 4H1WA 3PGLA 1MH9A 4AS2A 2R8ZA 2NYVA 4C4RA 4RESA 1ZJJA 3R4CA 5AKXA 5AIAA 4NAVA 1YJ5A 4GXTA 5AM5A 2GMWA 2HSZA 3A3YA 4BKMA 4I9FA 3L8GA 2YMMA 3NRJA 2B82A 5ALFA 4Y2JA 4XQ0A 5AK5A 1Z4MA 3QUBA 2ZBFA 3E58A 2QYHA 4RETA 3SKXA 4EELA 5ALNA 3AR3A 3E84A 3B9BA 1L7PA 5ALTA 2HX1A 3L7YA 1XVIA 1N9KA 3SKYA 4BX0A 4XOUA 2PR7A 4NWIA 2YJ5A 1ZOLA 3M1YA 3KD3A 2HCFA 4FYPA 5AVWA 3U7FB 1U2TA 2G0AA 4BNDA 4KNWA 2C88A 1XP5A 3KZXA 3A1DA 2HEGA 4C4SA 3HYCA 1WZCA 2RB5A 2YN4A 2GFHA 2IOHA 3FM9A 4EX6A 5AVXA 4NV0A 3QU7A 2IOFA 2GO7A 3DNPA 2RAVA 3QUQA 3KDPA 1X42A 3FGOA 3M9LA 3OCYA 3U26A 3J7TA 1YV9A 3BWVA 2HHLA 3SLRA 5A3RA 2I33A 3NANA 4ZEWA 3ZTYA 2FPSA 5ALOA 3QLEA 3AR7A 3VAYA 3I76A 4OFZA 1TJ3A 2YBDA 4J03A 5T41A 3U13A 2I55A 3WK7A 5AW5A 5AVSA 2BDUA 2JAWA 2WHEA 2WF5A 4PNHA 3EF0A 1Z4LA 4OCZA 3L8HA 3ZUPA 2C8LA 3QXGA 1RQNA 5AK4A 2D2VA 4F71A 4C4TA 3ZI4A 4FFDA 3WGUA 3OCUA 5AIBA 1RKUA 2AH5A 2G80A 4NFLA 2W4MA 2P69A 2I7DA 4UMEA 1RLTA 1T5SA 1YS9A 3QU4A 1Z4JA 1L7MA 4BEWA 2FPXA 2PKEA 2RARA 4YCMA 1RMQA 4UMFA 3N07A 5ALQA 1L6RA 4HGPA 5ALSA 1KYTA 4UW9A 1J97A 1J8DA 1Q92A 1T5TA 5ALPA 3ET4A 4YCNA 5AVTA 2MU1A 1Z88A 2EAUA 4BYGA 3AR2A 4Y2SA 3CNHA 3WK4A 1Z4KA 1Z4IA 3SHQA 2ZXEA 5ALWA 5JJBA 5AVVA 5AM4A 1ZD3A 5AM3A 2AGVA 3TLMA 3ED5A 2WFAA 3ZX4A 4Y2XA 1QQ7A 3AR4A 4UMDA 4QQFA 3N1UA 1NNLA 2IOFK 2OBBA 2BDEA 5ALKA 5AVQA 4YGYA 2FUEA 1CQZA 3L0YA 1EK2A 4BBJA 2R8YA 4BNDB 4E88A 5IT4A 2G06A 3EF1A 1L8LA 4J2TA 2HOQA 4YH1A 4HGOA 2B1RA 2IYEA 2W11A 3QUCA 3SF0A 1ZRMA 4Y2PA 1ZS9A 1RKQA 1U7PA 2IA5A 4UAUA 5AW9A 3ZVNA 1O03A 2FPWA 3W5BA 5AI8A 5AM2A 4JB3A 5AI4A 3KBBA 3AR6A 1IWOA 5E0OA 1RQLA 5ALLA 3L0BA 5AW4A 3BA6A 2C9MA 3DAOA 1T9ZA 2AUTA 2WF6A 5FP0A 4CNQA 4DFDA 3UM9A 2G09A 1ZRNA 2G07A 5IS2A 3UMBA 5ALMA 3U19A 5ALUA 3L8EA 5ALXA 4NABA 4HAIA 2JGAA 1LTQA 4BX2A 5AW6A 2YMLA 3OPXA 3U7EB 4KN8A 4QJBA 5AI5A 3OCWA 3QGMA 5AHXA 2EATA 1RDFA 3EPRA 2DQSA 3EWIA 4AP9A 1U2SA 3L5KA 1Z5GA 3FPBA 4L57A 2R8EA 3PCTA 4UATA 4XE5A 3ET5A 3OCZA 1RKVA 4Y2UA 5AKJA 5ALJA 3DDHA 5AI9A 4CF5A 1TJ5A 2FDRA 3OCXA 5A3QA 1U7OA 5AVUA 2FEAA 2I6XA 4Y2YA 3RF6A 2JARA 5ALIA 5IT0A 4ZEXA 4FE3A 3E81A 3U7GA 4ZEVA 5AICA 1JUDA 5AVYA 3QYPA 2AMYA 2ZG6A 2YFYA 1RC8A 1SU4A 2WM8A 2ZBDA 5AVZA 4MUMA 1YMQA 3KC2A 5ALZA 3R09A 1TA0A 3ZVLA 2C8KA 2P11A 3SMVA 4Y2QA 3WKDA 1VJRA 2GHQA 3NAMA 2B8EA 1Z4PX 4Y3UA 1NRWA 2JAUA 3MN1A 4KX5A 4UM7A 2ZOSA 3AR5A 3F9RA 4Y2RA 3ZX5A 4KNVA 3AR8A 2NO4A 3IRUA 1QYIA 3MMZA 3A1CA 1TJ4A 5AKEA 2OM6A 4HGRA 2HDOA 5AESA 5AVRA 1U02A 3L1VA 1Z4QA 3A1EA 2R8XA 3N8GA 4CF4A 3ZWKA 1CR6A 3R9KA 1S2OA 1NF2A 4YIKA 3B8EA 1L7OA 4O8CA 4EZEA 4UU1A 2G08A 3W5CA 1N8NA 3WKEA 2HF7A 1ZD4A 1Z4NA 3B9RA 3ZVMA 1RRCA 2Q4RA 4Y2VA 3L1UA 4HGQA 4HYTA 5AK6A 1AQ6A 2YJ6A 5AKHA 2HO4A 2YY6A 5AKYA 3UMGA 1SWVA 2CFSA 3L0CA 5AM0A 2I34A 5AI0A 2B0CA 3WKCA 3WGVA 4L6AA 2EARA 3S6JA 4DW8A 3QX7A 2X4DA 1RLMA 3PDWA 1K1EA 3NIWA 3KOOA 3I6BA 4UASA 4EX7A 4DWOA 5AK3A 1EK1A 3FVVA 2W43A 2B8JA 1WPGA 4I9GA 1QQ6A 2FPUA 3UMCA
chains in the Genus database with same CATH superfamily
2XIDA 1P60A 4MICA 3GJ0A 3E7WA 4CHGA 1XMSA 3GLRA 4LYEA 3ABOB 3FWYA 2EP8A 1ZISA 4U2CA 3JQGB 2RIRA 1SKUA 2C2HA 1PQ4A 3I23A 4BNIA 4EENA 2IYVA 3EDCA 8ICMA 4Q44A 1YUBA 4B3RB 4KGVA 4E4RA 5HMLA 3SZ3A 1PCXA 3LM8A 5LOVB 2AWNA 2IYNA 3UMRA 4CMBA 3EPGA 2OEPA 4NYJR 3QBTA 3IV7A 4QAQA 1DC8A 4A26A 1T1SA 5L7TA 1QQ5A 3SYTA 3N6VA 3FNIA 3WYEA 4BLWA 4ZU1X 8ABPA 2B30A 4BC0A 5FFFA 3E2IA 1E62A 2O1SA 3SS8A 3LWNA 3AUFA 3K1JA 1RLOA 2WMNB 2JH3A 4LXXA 3GJQA 2GZDA 1NKVA 4HD8A 3EY4A 4B4DA 1J99A 1WKCA 3PY8A 3KJIA 2OUKA 3JWHA 4JASB 4C0LA 4NYMQ 2XQJA 3WIUA 2VOEA 5IZ4A 3H87A 3C39A 3F5QA 4BAUA 5AJHA 2QMOA 3CRW1 4E2YA 2VDNB 1LKYB 5LUAA 1UZNA 3VPXA 3E7FA 4X8LA 1DBVO 2IYSA 5F1KA 3U1VA 1VZ2A 1JLRA 3EBLA 5FLEX 3HO8A 2C2EA 5M5BA 3I05A 1Y7HA 4PS0A 1NXOA 3I53A 4V3BA 4BNDA 1CBUA 4RKRA 5J4KA 2XGGA 2H1HA 4QZCA 1YI8A 1XRMA 4OTZA 4BJ1A 2G1UA 1R4NA 3NIFB 1UJNA 4QNLA 1USIA 1W8DA 5M2QA 5ALOA 1MW8X 2AFIA 2N75A 2QMYA 2R4TA 5J8YC 3IUJA 5EXPA 1GQSA 3P0IA 3UPQA 1NP6A 4A0GA 5BQXA 3JX9A 4NV3A 4RIIA 3ADKA 1H5UA 4D9NA 2OVFA 3V55A 3F0TA 3HBJA 3I0ZA 3VZPA 1RP1A 2QL6A 1MAHA 1E9AA 2DKZA 5AVTA 4Q1FA 4C78A 2GWHA 4NU5A 3K5IA 4BS9A 4UMDA 2WAOA 1LQTA 4ND2A 3ZW9A 2HK6A 3FPGA 1UEXC 4YMSA 5K0EA 3ABQB 2GN6A 4J2TA 5CYFA 3SF8B 3A9TA 5DLPA 5EY5B 3E18A 2X7XA 2B4YA 3D8HA 3S2UA 4QATA 2QG9A 2G07A 4UTXA 4PZEA 4R3UC 4RHXA 4JJ8A 4JLAA 1JZQA 2JK1A 4L0DA 4R81A 1O5TA 3WGHA 4PFQA 3ESXA 4U39A 1HC7A 1IM4A 3SQOA 4MUGA 1BWSA 3PX7A 3T3FA 3PFIA 2CNWA 1Y5MA 5KYUA 3A1VA 3DTVB 1OAOC 4CKEB 1HBJA 1QS0A 4QYXA 3LMKA 5JVDB 2O5VA 5DGTA 1FP2A 3E53A 4M9CA 3WQRA 1UPAA 1DRUA 3MZ0A 5FOWA 3AF3A 1HNNA 3WYAA 2H4FA 3CEPB 3Q6MA 4BJHB 2QU7A 3VYVA 1VP3A 5J2TB 3RI3A 5JAQA 2AN1A 2C2XA 4QZ9A 4RS4A 3PNBA 4JXZA 3TZQA 1Z74A 1Q77A 2JD0A 5JZSA 1GPDG 2EKZA 4DJJA 1CZLA 4BNGA 1A9XB 1Z9BA 2TECE 4F8JA 5KYWB 4HRAA 5K0NA 4WLFA 3C41J 4UAGA 4YJKA 2HO4A 3L84A 1YVRA 2CWWA 1T3TA 3OE4A 1GN9A 5JTUA 4DSOA 2BGLA 3GA7A 3TEJA 4U2GA 4QT0A 1NOMA 3FRJA 5DRYA 1DJMA 2AKYA 4NS1A 2OP0A 3ZS9A 1OGYA 2Y9MB 3IKTA 1F6WA 3URMA 3NGMA 3X0DA 2FPUA 2WJZB 3HXMA 1CVRA 3AEXA 1O08A 3ZKAA 3TZHA 4ED9A 4AD8A 2X2PA 1UKVY 1RS0A 3WE7A 5IKMA 1N5LA 4BZZA 5HUJA 4A10A 2ASVA 4CUKA 3THWB 3BVPA 2PV7A 2H48A 4GKVA 2YTUA 4CM9A 2A7QA 4S2UA 4F06A 5D51S 1XJ5A 4NRDA 2APJA 4NEHB 4XJTA 5BSEA 3GLFE 1HA3A 3ZWXA 1N4DA 4EECA 3TECE 3QFCA 4FZRA 1MJNA 2XAUA 2HC9A 3OIWA 2O2XA 2BW0A 2B1QA 5CT9A 4RUAA 3UYKA 1TX4B 2QW8A 2XUFA 4KAFA 1S02A 3TO5A 1VPTA 1CYEA 2NSLA 4BVEA 2FW6A 2NVOA 2SECE 2IE0A 2UYHA 2NT4A 1R9NA 3DVAA 4AUKA 4UAVA 2K89A 3KLPX 1XQ1A 2JI9A 4WN9B 3KHUA 4OMCA 3OZEA 2YJ3A 4MKGA 3CSUA 1P2GA 2BM9A 2OHFA 3G7NA 4DMMA 3ZWYA 3R4CA 2LYBA 1NMZA 3VVMA 4IC9A 3W5HA 4OQFA 1S9HA 2O4UX 3NRJA 4RPKA 4R2HA 1EAMA 2R97A 1AIPA 3M2PA 2A86A 1LLCA 4O0MA 3JAMA 4D0LB 1M67A 1H8HD 1R37A 2LHTA 5FFMA 5AJTA 1RE0A 4NWIA 1G7CA 1F9EA 2NX2A 5TNXA 2B21A 1F7VA 3KNZA 5CP8A 2ONCA 3HXKA 1QYWA 4X8HA 2E5SA 3H16A 4RJ2A 4YRKA 3I9FA 2C3MA 1H66A 1WZNA 4M0FA 5JT1A 4Q01A 1C30B 1T0IA 3VDRA 4P53A 5IDWA 2FSGA 3NGDA 4MYCA 2FRVA 4GPAA 2A1JA 4PHGA 2PUJA 3K4PA 3DLCA 4I5DA 2W37A 3E5NA 5CU7A 1B15A 3L8MA 3JPTA 1E5XA 3C23A 5KNDD 2VEOA 2XNDD 1JDSA 4P0QA 2VATA 4GXJA 2GAFA 2Q46A 2ZRNA 4D42A 1QIDA 4B79A 5JQGB 1TM2A 3K6JA 3K9NA 4A7PA 5DDMA 4HO1X 1LB1B 2DB3A 1XSEA 5IW8A 4C5CA 1G6OA 4J94A 1OH8A 3WNDA 3S44A 5B36A 1ODCA 2H92A 2QX4A 1H1LA 3PFGA 1U5BB 1V41E 3ZWPA 1T3SA 3JV7A 3FMOB 4R8VA 1QIHA 1QH8A 3T5MA 1QRDA 2PUHA 2B83A 4Q9JA 3KALA 4Q93A 4DM3A 3EGEA 4C6TA 2CHGA 3PGMA 1DC3A 2PMEA 3D3WB 1Z16A 2VSFA 4HLUA 4U7HA 5EZSA 3DWFA 4LYYA 1D8LA 4F5OA 4KUEA 4ZEXA 2OLJA 5IAGA 4RVSA 4QQNA 1PBNA 3U56A 4EUSA 3C6QA 2O3RA 4NESA 1WW2A 4ZYUA 1K86A 2I4OA 3JYOA 1KYYA 4JELA 4RY2A 4KRXA 2XZOA 3J81A 4PPGA 3ASVA 1OX6A 5CA7A 4ZCRA 3ICXA 4UAJA 2JIZA 3S5UA 1MC4A 2WB2A 3WRXC 3T6KA 2MAXA 3ISCA 4M0PA 5JMOA 2FB9A 1IQUA 2YKGA 3WLSA 3D6HA 3GEEA 5CJJA 3Q8RB 1AA6A 4KPUB 4KTTE 4LFBB 5K3SA 4OH1A 5KT4A 3IPLA 3H1FA 1JSXA 3GA0A 4ED3A 4MUEA 2XD4A 1XZHA 2ZKLA 4L3OA 3J81k 4CMEA 1NVDA 2YDYA 2QUBA 4YJDA 3RNLA 1WPGA 1RM6C 1GQYA 1Y88A 3PPVA 3CZRA 4LYDA 2BFMA 2YZMA 3ZG6A 1G4AE 1ZN8A 1ZQEA 5LFAA 2V9ZA 3RSLA 1QGUB 5HQ3A 3M2TA 5HBRA 2C3PA 3GNTA 4GWGA 4RV9A 3IQHX 5K4LA 1FFUA 3GCZA 1XDWA 3LWLA 4DIMA 3QE3A 3JQ8B 1UMDA 3DLBA 3KAJA 2LIPA 3Q3IA 4QXQA 4BWFB 2DLNA 1XHFA 3BS5A 3FZEA 4PS1A 1L3VA 5FYDA 4G0XA 4PLPA 4ECSA 2DQ4A 3UQYS 3ZBPA 3NETA 2Q07A 1IHOA 4Q9DA 4MUBA 3I5AA 4NBRA 1TLFA 3AL0C 4QARA 2IHKA 4L2IA 1KOFA 1Q91A 1U9CA 3EVGA 2QW0X 1FY2A 3ZH9B 1UQRA 1YTUA 5DHAA 2O9JA 3VYRB 3LDUA 3ICWA 4B3IA 2DTDA 4Q8FA 3PIDA 2BCEA 1W4BA 3L46A 3T79A 1SKAA 3SR6A 1MH9A 3C1TA 3OQBA 5C7OO 1E9VA 1ZJJA 1OLSB 5IDYA 5AIAA 4E08A 1Q6ZA 5BURA 4R3NA 1P9WA 2PLNA 5JMWA 4N39A 3W1WA 2JBAB 4ZIRB 1YDEA 4BQOA 4J3NA 2ZAMA 5EIXA 3AW9A 2QUHA 4XM0A 2JVKA 4MUXA 1G1MA 4J75A 3PUHA 2ZCVA 4LQCA 3SKYA 4PQFA 1MIOA 1MDBA 1AF4A 5DM4A 1BW9B 3LY5A 4ECEA 2C77A 4GXQA 4IGIA 3C45A 3OIFA 3I1JA 5LA6B 3ZCQA 1KO7A 3JARB 1LI4A 3ETCA 2H8GA 4YUAA 1YUNA 2DP4E 2V1XA 3KDAA 4U8HA 4NF2A 3JZMA 4JI4B 1GKUB 2AN3A 3KT6A 3KE9A 1Z1BA 3HYRA 2AH5A 4L8YA 4LXHA 4FDLA 4JC4A 3UWMA 4G5HA 3QG1A 2J7KA 1TDJA 3N0RA 3KEGA 1VCIA 4Z0NA 4KFUA 4ELVA 5DV9A 3GLHE 3OZUA 3IEPA 2XNJA 1T8RA 4YR2A 3W9YA 4IQWA 1XALA 5IAKA 1NAHA 1FP1D 4ZDJA 4FCTA 3WWYA 1SEVA 4EIWA 4ZT6A 4Y6QA 3T5HA 4A1OA 2Y99A 1ZM9A 2PX8A 1N7JA 1JILA 5KFPA 4BX9C 2EP5A 3WG9A 1PJRA 1N6OA 4ETNA 3FTFA 4ZVSA 3ZWBA 4YUVA 1G20A 3TI9A 4KDRA 3R0QA 3W7AA 5LQCA 4YJ2B 3UK2A 2FMSA 5AO9A 2JGAA 3OMXA 1AZWA 1KPIA 1K7CA 5DMHA 4DHWA 1T2FA 4L15A 3UFXB 5KFDA 1CD5A 3NFRA 1Z36A 3D2BA 1RKVA 1N5DA 2CWDA 5EZYB 3I64A 3QVOA 4HDKB 3JWGA 2MSWA 1B8VA 4OQ4A 3RFXA 1GADO 1ZM3A 2JJMA 1MV8A 4GWKA 2OCYC 3OI7A 3GD5A 7YASA 2IUYA 3VU3A 3V1UA 3IAAA 1GV1A 8ICZA 4FD2A 1WXWA 2ADMA 5DW3A 4LCJA 2Z9BA 4FLEA 4ZGGA 4GFJA 2QDXA 3I0MA 3M9MB 3TGPA 4GXKA 4G8CA 3BIFA 1IJFA 3NRWA 3LK9A 2JI7A 2N42A 4E13A 2W7TA 3DV2A 1EWKA 1DUVG 4H77A 4TSKA 2BFCB 3FF1A 1P7DA 4WZBB 2DUNA 1KW4A 3KQNA 3RROA 3CN9A 3ZY2A 4DW8A 1CUAA 3QX7A 3IT2A 2F77X 4AIIA 5KHAA 2O0MA 1IXRA 3OJSA 3RDPA 2C3OA 2WWFA 1S8AA 2XMPA 2JBWA 4TQSA 1GO2A 3FCCA 1KJQA 1SM4A 3EVFA 1FTNA 1ZNQO 4ZAFA 3NG1A 1Y34E 5FWXB 4QFDA 3QX9A 4D8WA 1MGOA 2C4NA 3C6KA 3VJLA 5LC1A 4KL8S 1LXCA 3KFVA 3ONWA 1BPBA 4Z1MA 3RVQA 4B46A 4M3NA 2A5JA 2XBLA 3T15A 1QCCA 3VJRA 1ZQ1A 1YZQA 3TQSA 1XDUA 1CVLA 1TYAE 1ECBA 2K4IA 4MGHA 2PS9A 1K6JA 1H3NA 1RJ9B 1QM5A 3VYTB 1IEWA 2OHHA 3TL6A 3ROXA 1WEHA 4YIHA 1ES9A 1Z22A 4EG1A 2FPRA 2AHOA 2I1LA 5BUZA 2CXQA 4N0QA 3LC1O 4TM7A 2Q6KA 3RS0A 1RYDA 1MO5A 1QVRA 5A1TA 2X0JA 3ROGA 1I2DA 4QUJA 3C7CB 4N0DA 2VDVE 1QGDA 2QTHA 2J9GA 4YA6A 1NJ8A 3N2KB 1V7CA 3KX2A 4EYEA 4DMFA 2AJDA 4GUAA 2E4XA 1SCBA 1J9EA 2X19A 1Q7BA 2RDJA 4AKTA 3AVPA 5DBAA 3VXKA 4BB5A 3D4IA 2C3UA 1T9CA 5BN5B 2OESA 1TAHA 2Y6UA 1YCGA 1FYDA 3JS5A 2ZYRA 5HDBB 5KOIA 3CW9A 3AR3A 5JRTA 3DV0B 2WYVA 3C74A 4OSPA 5LDDC 4GLLA 3L4KA 2GEFA 5I47A 1DX4A 3VH2A 2GBPA 5K03A 2PWPA 5EQJB 2QTNA 2AFHA 1ZM4A 2PFNA 3DFZA 3EEQA 2I7XA 5J2KA 4LY9A 4TGLA 5A3RA 2I33A 2R66A 3HUEA 3PFKA 3S81A 4J0IA 2Z4TA 1GR0A 4RV5A 1QVWA 5GJCA 4FW9A 5FUXA 5EKTA 2A19A 4CLHA 1EU1A 2C0CA 1N33B 4JUCA 4TRNA 4TMTA 2OEHA 2REQA 1NMXA 2EWWA 3CNHA 4JNCA 5HCNA 1GZ4A 1ZD3A 1ACMA 1B4FA 2OBYA 2CLHB 4HX9A 4AXXA 1VBMA 5CR0A 4EYIB 1TUEA 4QWDA 3WHIA 1KDZA 1QYCA 1CUCA 3O8BA 2AN5A 1VKRA 4FC6A 3IUPA 2D2EA 3KL4A 1JPNA 5DGIA 2IA5A 1YJ8A 2V7UA 4NLZA 2FG7C 1U7DA 4EY5A 4PZPA 1U8TA 4MVCA 3X1MA 2ZYDA 1TV9A 1T9GS 4Q9KA 3OIDA 3ADBA 3GRUA 3GGJA 1SQFA 4ZDIA 4RJKA 5J4YA 3L5KA 3SBDA 1Y1PA 4J0KA 3TBHA 2R5FA 3A3KA 2J4DA 3I32A 4QJ3A 4I2FA 2NNWB 4RZ2A 4D9KA 3A70A 5T3YA 4QSHA 2OWDA 1I4WA 3ZE8A 4K6GA 1V8OA 1Y9EA 3L7JA 3G2IA 1XTIA 4EO4A 2PGXA 2LCQA 2HA2A 2Y77A 3L5OA 1U1IA 2B98A 1KH2A 4V2IA 3WV5A 1Z2OX 3VUEA 3KAKA 4LOLA 4ZVTA 3SAJA 4LJ8A 1CNFA 1LNSA 1IOVA 3NHKA 1YZGA 1WB4A 1CUKA 1WMSA 1V37A 3VC1A 3AUOA 5BR1A 1WUIS 3TOVA 4A5OA 1KBZA 3VNRA 4B6OA 3FFTA 1W1WA 4BFYA 4C08A 2BM0A 2PN1A 3T9BA 4YV0A 1CS4C 3D2NA 3BZBA 3H84A 4PWZA 3QEKA 3PEWA 4AJKA 4LPKA 4NBLA 3L2OB 1J42A 2W6ZA 2OY0A 3AIMA 1H69A 1HDIA 1UXGA 1ORIA 4RKWA 1J70A 5L3QA 4ZMSA 2J9XB 3L0OA 3V9AA 2HH9A 4B9EA 1VLBA 3FOWA 4OOFA 5E6SA 3E3AA 2XVTA 2JG3A 5G3ZA 3PWKA 2PUCA 4MF2A 4X20B 4II2A 4O4HA 1XQ6A 2KB0A 4MW1A 3A6PC 2E3JA 4JR2A 3DEKA 2QUIA 5J1TB 4BMCA 4QODA 3EZ9A 1NLUA 4NTZA 2GARA 1NC1A 4WE3A 4MVJD 4R8RA 3TIXB 3HKDA 2CSUA 3M9XA 4FNAA 2BOVA 3KOUA 4HMPA 1RJFA 5JZMA 3GVCA 4F72A 2J31A 2C9CA 1X7ZA 2HJGA 4BO3A 2P4QA 4OXXA 3V8EA 1E3LA 2E85A 3MR5A 2BCVA 3F46A 2F8TA 4LXQA 3IPYA 1UZUA 2J3MA 3DP7A 3GC6A 4XLZA 1T4BA 1ZUNA 2ZS8A 5MN4A 2GTPA 4KQ9A 1N63A 2O8VA 3WZLA 4NJEB 4P7KA 5FADA 1S0UA 2Q50A 4EZ6A 5L1JA 1XZNA 1RTKA 3WLPA 2HA5A 5KFFA 4V24A 2Q21A 4Y2JA 5LD2B 2YXBA 4HQOA 3FFXA 1P44A 4ECWA 1CE8B 3QVWA 5K9ZA 1TQ4A 3Q12A 1UCFA 3A1DA 7ICTA 2D00A 2IOHA 1I32A 1KETA 3T06B 1ECPA 4MCJA 2XOXA 5I8ZA 2J3LA 2CLMB 2CEAA 1A8SA 3HB7A 3HPOA 4JOSA 5JAHA 2PFKA 2X3YA 4Q02A 3KDSE 1KS9A 1R0KA 4LXYA 2TMKA 5TS2A 3QZ8A 3MTQA 5FHRA 2FW1A 3ZI4A 3VSEA 4D3FA 3F3YA 1J1ZA 3LQ2A 1GDHA 4RYLA 3Q8MA 1PEDA 2P62A 4YMMA 1EMDA 1IHPA 5JADA 2NQ2C 1WBDA 1IK4A 3L0ZA 4YV2A 1MOZA 2P66A 1OWOA 5K0LA 1UM9B 3WQSB 2ZYAA 2QARB 1I6KA 3ZDQA 3O0TA 2ESRA 3KD2A 9ICIA 2B6NA 2EWMA 1OWMA 3L6BA 3ZKWA 2C83A 4OO3A 1GQ2A 2D6FA 3ODPA 1FU4A 3PWSA 3W5BA 1J2UA 5K2MA 3GPDG 1WHSB 3L01A 1Q7GA 1E59A 4C0BA 1EHCA 2PVSA 3EQ9A 2QRNA 2OTCA 4UFPA 2FYTA 3C5HA 1QCZA 1N1EA 1OZAA 4P93A 2UUBB 4KLHA 3KWMA 3JZFA 2QHXA 1Q0ZA 3ZWVA 5FORA 2VXOA 1VL6A 3QXHA 4A0SA 5BN3B 2C2RA 4L9RA 9ICVA 2NO0A 3S99A 2PX6A 2ZBDA 3R7WB 4R2IA 1M0EA 1X1AA 3C6XA 4HWOA 4DDKA 2D2IA 4R2JA 1O0BA 2RH5A 5DBGA 1O95D 4IZIA 3I58A 1N7IA 1GPUA 4R2LA 2OKGA 2CMFA 1G0OA 3G89A 4BNLA 1V35A 3HBLA 2H2AA 4KZKA 4NFYA 2X8WA 1DCFA 2V6BA 4M54A 3OQJA 3OURA 1V96A 4P0PB 1KIFA 1Y4SA 4OLAA 3K1RB 2V3CC 3MSXA 1PYGA 3BWXA 1A4XA 2PXAA 1M8KA 2I2DA 4F12A 5GOZA 3W79A 2ODTX 3C3BA 1U1EA 4IKOA 1WD5A 1CY1A 1RVDA 1AKTA 5AXCA 4IRMA 1HMPA 1MPXA 1E2DA 1UC4B 1EAYA 3UBMA 2PZLA 5BSWA 2QY6A 4ZAXA 5JECA 1H93A 1IH8A 1QFZA 2AHRA 2WU8A 1KH1A 2DWQA 3I28A 3JYNA 4CDRA 3GRVA 4GIBA 4LYAA 4MWOA 2X41A 5AR1A 1DL5A 4OI1A 2BY4A 5KKAA 2PU5A 3I01A 3ELYA 5JSZA 4D9MA 3PSIA 4L0QA 1TQDA 2HW3A 4YRRA 3UW3A 3GLSA 1X9SA 1IEVA 3O8QB 1ZRHA 4C8OA 4HDRB 4BQEA 4XSVA 3B0YA 1A4UA 2N1MA 1EFLA 3TL3A 2BI8A 4AKSA 3BMOB 2Z56A 4QYTA 4QRIA 2JGLA 3ZNOA 2AGQA 3X44A 4EKYA 2ZI6A 2ZSEA 1UF9A 2GZRA 2RHFA 2HADA 3FI0A 5K0GA 3GW8A 2EU8A 5JG7A 2L18A 1QF6A 2C2KA 4MA5A 2C2GA 1U49A 5CURA 3ELWA 1SKMA 5TMPA 3ICEA 4P4MA 2HLDA 3ZJYA 1UBJS 4AJOA 3OZGA 3KSRA 1A8PA 3NVWA 1TW3A 2ZWOA 4RDCA 3EHDA 5CFRA 4G4IA 4MR7B 3NPMA 2XCQA 1CY7A 4D56A 5JIBA 5E4JA 1D9XA 4FUTA 4N5HX 5P21A 3CVVA 1THMA 3U1TA 3W5JA 3RJGA 3GNQA 1K7SN 3R0VA 2SKDA 2XSZD 1Y98A 4H17A 3PVCA 2GESA 3VR6D 4F86A 5JI3E 3CUEF 3MCZA 1ZD8A 1THGA 3Q0IA 5DB6A 3X1XA 5B58C 1KPGA 4MW6A 3L7MA 1Y9DA 3H2SA 4IR1A 4LRTB 4I2GA 4NE9A 4C8LA 3S55A 5DRTA 4TQGA 5CLJA 4GW3A 4JQZA 1CTQA 3AHJA 2MINB 2FPIA 1YCDA 2Q1UA 3ZGOA 2BDUA 1JHZA 3GBSA 5CT4A 5EWGA 3HEBA 4KLIA 4DWJA 1LWNA 4WINA 3GP8A 4RW0A 4IJUA 4W6QA 1L4BA 1JAXA 1OY1A 2IXTA 3NHZA 1J00A 4F60A 1UUFA 2AXEA 2PSJA 2CL6X 2ZE8A 3MLAA 1PLJA 1E5DA 5E2IA 2WQ7A 1BZYA 9ABPA 2AG6A 4WXEA 4BNKA 1B6RA 1MJFA 4UHCA 1GNLA 3DQZA 4OM8A 4BGIA 3MABA 5HKOA 4M9ZA 3R5TA 1AC5A 2X5NA 1N5MA 2JJ2A 3MEQA 3GFSA 2HOQA 4MLZA 5DYIA 2VUSA 1U8CB 4IQVA 4ZZIA 3RYIB 4Q7KA 5ER6A 2OFOA 3S7TA 1PT7A 3OPVA 3CVYA 2MYPA 1XAJA 3DOIA 3PVZA 4CMJA 3F1KA 1DBRA 3LY8A 4A92A 4PYRA 3B6ZA 3LOUA 5CVUA 2QE7A 5JNUA 2Y8EA 5CEFA 1EDBA 1V5GA 2PU7A 4U7CA 1HORA 3OKPA 4Y6PA 4BU0A 1OC4A 4GS5A 5A3QA 5EUBA 4WBNA 2AV6A 5TISU 4TS4A 5LXTF 4Z49A 3PTLA 3F8SA 1WMFA 3GZJA 3HACA 4D2IA 1AG9A 1ENYA 3BREA 4LZDA 3RW9A 1E9DA 1U9IC 3QNWA 3V7NA 5EZ6B 4QXPA 3ZCXA 1ZETA 2ZSAA 4FXOA 4BMYA 2UYYA 2ZGVA 4KU4A 4YROA 1BDBA 1R74A 5A0VA 4HGRA 4YT4A 4QJFB 5AESA 4YMVA 4EGAA 3SI7A 1MNQA 1TU4A 1B0AA 1WYGA 1M2HA 4C29A 2DC1A 3N8NA 2WNSA 3K09A 1E3MA 1XD8A 5CLQA 4PN7A 2H7VA 3I6IA 3ACCA 3GIJA 1GA4A 1FDVA 4C01A 5EL0A 1YFKA 1VL0A 4BZXA 2VK1A 1Q1AA 4X54A 3BSYA 4IFIA 4XB6B 2RHTA 2C31A 3RK1A 1ZSYA 3IHLA 3G2LA 1RC0A 3NDBB 4Z3KA 3UPUA 1ZMRA 2ST1A 2LZ0A 3NP9A 1KOJA 1K2WA 3N7AA 3VX3A 4Z3OA 3H5LA 3JPRA 4G67A 4LJXA 3UWDA 4YJFB 4XJVA 4AS1A 5TQVA 3MVEA 3I04M 1KL7A 2XB2A 1KZ4A 2NPIA 3E8MA 4A27A 2QR5A 2XLBA 1VE1A 5H4HA 2GLEA 1O6FA 1R8XA 1JFLA 2D8AA 3H0RB 1X1EA 5ED0A 1D4OA 1OT3A 3L06A 1CQIB 5J2EA 1UK8A 2H1IA 4HGYA 3K30A 2HV9A 4DV4B 1X3LA 4JP8A 2GCIA 4B8WA 3DFMA 2ZI5A 3FVQA 5CGQB 4LV8B 5EMMA 1IBLB 3CJQA 4QOJA 1HQKA 4FZMA 1KARA 3A9VA 4D5GA 2E82A 1RXYA 1N60A 2WJAA 4YUYA 2RI1A 1R8SA 5JRJA 3I12A 1OPXA 3I52A 3TD2A 1CETA 2YHUA 4HX5A 4DFMA 2WMOB 3IJ5A 3DOEA 3V6KA 5BN1A 3RT9A 1NLFA 3CUSA 1E79A 3UOAB 4L27A 2Q3DA 3ABZA 3BTSA 4EUEA 1ZUHA 2JDID 2FJ0A 4V0MA 1YB5A 3QVGA 4TZKA 5AUNB 3E4DA 4J07A 1P0QA 1JU9A 1U9YA 5EP3A 3F5MA 4M6WB 1WMEA 3T9FA 2Y67A 2PO7A 1FW6A 2X40A 2VPXA 3ZLVA 5FD8A 4HFJA 3NOOA 3G0HA 1UCVA 1KZ6A 3QNUA 3K70D 1W4CA 4DOCA 3EXEA 2PZFA 3V1KA 4UHHA 3JAKB 1Z5VA 1I13A 4AURA 5HR5A 1RP7A 1NU6A 2A5GA 4Q9HA 4LJKA 3SY8A 4EHBA 4CMGA 1TJYA 3OOYA 3L18A 3OY2A 3KHRA 4XD2A 4HDNA 4O1IA 2LW7A 3OP1A 3DM9B 4AL4A 3N86A 4H2DA 3UHOA 4RENA 3CLTD 1XMPA 3GNLA 3R9WA 1I2BA 2XKBA 4O08A 1N2OA 1TXGA 4D82A 2A59A 3OESA 3AL0B 1O7JA 1ESEA 2R8IA 5COBA 2F4NA 1XN1A 1WNTA 1T5TA 1OJ7A 2V98A 1U65A 3RWMB 1S3SA 1XRLA 4HQRA 4GGPA 4RUCA 4WXMA 1ZJNA 1ZQWA 4ZU3A 1RACA 5A4KA 1WXQA 3LRXA 4F9EA 1V11A 2LUOA 3KQYA 4C6HA 1Y5RA 3NONA 3KQWA 1X1CA 2CCJA 3DT8A 1CS0A 3PGKA 3IM1A 2WF6A 1E1RA 2FFQA 1EFAA 1SXIA 3Q4GA 4TTVA 1V3QE 3RRGA 2G8NA 1Q7TA 5EQTA 4BVLA 3GGSA 5IRCD 4MW0A 3G5AA 1ZU4A 1J07A 3QGMA 5U1PA 1D6SA 1M6HA 5F73A 1U2GC 7MDHA 3EH1A 2BR4A 3LV8A 1XRJA 2IH5A 1AGPA 3EQ6A 3NS7A 4OI0A 1A9OA 1DIHA 5DHSA 3G0OA 1VLMA 4GKAA 1HKHA 4EBEA 3IBGA 3C6MA 1EUCB 1G7SA 3R0IA 3UMJA 1W2HA 1G7RA 3T3PB 3SS9X 1DHTA 3P9YA 1VDZA 1CZKA 4CT4B 3HGQA 4CKCA 3WKDA 3HSYA 3FPEA 1RAFA 4JBYA 1R5JA 5LQAA 2FGKA 2OSBA 4MVJE 4DB2A 4AJEA 2GERA 3HDVA 4WBXC 1KI7A 4FD3A 3GAMA 1NZBA 1SXEA 2GXUA 3VC8A 2ZUFA 2GRUA 4C0WA 4PG5A 1KI3A 4TXLA 5IBCA 1CIJA 3ISJA 3KXDA 3OX3A 1ZBDA 1QCDA 3ICPA 1TUBB 4JI7B 3UATA 1OYVA 3BAFA 4HYYA 2N1RA 1X9GA 1HYGA 3W34A 4DUZB 1QONA 1V3UA 2A0XA 3MW8A 1KAEA 1XVAA 3U3RA 1YNSA 3MXOA 4ISCA 3NYIA 1PSDA 2YFHA 3PFBA 4KXYA 1A0PA 4RDHA 4M83A 2EZZA 1ZXIA 1FK8A 4DDHA 1RJEA 1N5KA 4DLAA 4E22A 3OF5A 4C0ZA 1SH7A 4ZO8A 1P5RA 1KLNA 4RJIA 4HNTA 3AHHA 4FZNA 3PQEA 4G5OA 3ALRA 5B4UA 4C2BA 3FYSA 1E3QA 4DWWA 1T15A 5KG2A 3R4VA 3FIJA 2A33A 1SD5A 2NXEA 4UNRA 1HQCA 1UFKA 1FVHA 1V2HE 1DK3A 4OQZA 3TYXA 2YBEA 4IG4A 3DF7A 1XP8A 3CTPA 3FVTA 1TGYA 3WNCA 3R7AA 5EHQA 3OQIA 2IV7A 1T2AA 2XCPA 2HHJA 1DG3A 4NNPA 5DXJA 3EMKA 3PCRB 4G4SO 4ZAZA 3PGVA 1P4JA 5ALRA 3DONA 5GAJA 2W2NA 3A1FA 4A8TA 3TAUA 2HBMA 1QR2A 3K4QA 3L4JA 2VDLB 5IC5A 3ZZTA 2NM0A 3GJ7A 3W6PA 1W5FA 5IVPA 1P7PA 5ALFA 2YZGA 1RYNA 1T1EA 4G0OA 1YQUA 4MWDA 4MI9A 3SLKA 4QT4A 3P19A 5LMCA 1SVNA 1BA3A 1NI5A 4N03A 4KR3A 3T1QA 4YAEA 3IAS6 3L7AA 3QKRA 3M9WA 1KE2A 3GNSA 5EWFA 2XCAA 1BCSB 1RWQA 5ERXA 4GPTA 3IV6A 4LKRA 3LUJA 3WNBA 3LTEA 4GGOA 4MPTA 2IC5A 4PBTA 3B12A 3SBXA 2JLQA 4N18A 2YDXA 1N6RA 2Q0ZX 3QG5A 1R00A 1COKA 1E9SA 1VMEA 5KVAA 4FYVA 3AL2A 3BSFA 3F2IA 1JSZA 3FPFA 3KYDB 2PMKA 3U3MA 4K1XA 4RBNA 2IU3A 5BOSA 3PQFA 1VBNA 3RH0A 4V39A 3RASA 1CUUA 4KMMA 4D6YA 4X65B 1GUYA 1NUPA 3ND5A 4NBVA 4M1WA 1EX9A 4UKDA 4G1MB 5DTEA 4QLOA 4HMOA 4ALLA 3KKOA 4TQ9A 3MRTA 3NWEA 5DHUA 2H54A 4KR0A 5ENDA 3L1HA 2B35A 1I4DD 1XF9A 1LF5A 4IG9A 3HHEA 1X7XB 4C76A 2O14A 1V5EA 4EB6A 4YPVA 2OD7A 3UVEA 5E7QA 4ND7A 2O6KA 5C8XA 1UPBA 1Z28A 4Z4CA 1BMQA 4OEHA 4RLSA 2A0FA 5AHXA 4LE0A 4AY3A 3EWIA 2I4TA 2OBMA 1OILA 2BCJQ 3HV0A 4DIBA 3IBSA 1CY4A 4G0VA 4O4LB 4D4LA 3V6MA 4YD2A 1YZTA 3MMPA 3WA6A 3N2ZB 1VSQA 4S1OA 4AJ1A 4E14A 3P2JA 3U7GA 5TMEA 4F4FA 2EFHB 1B43A 3PEUA 2DH6A 1BWPA 1XK7A 3ZUGA 2W8LA 4BO7A 3WY9A 1FNNA 4FOOA 1CEYA 1ZG3A 3HRDD 1DV2A 4X3PA 4OHBA 1DTEA 3V48A 4QVKA 1M74A 3CH7A 1L5WA 4D9HA 4JP5A 4WMLA 1AQJA 1R6BX 3Q2IA 3EXIA 3O93A 3IBTA 2FSSA 4J90A 4AYBF 3PMNA 4MQEA 2GXAA 4H1TA 5IUJC 4EFDA 5ENZA 4YRCA 1M7BA 5C5EA 1COOA 5J0QA 4NS4A 3HK2A 1A5AB 4Q12A 2I5HA 1G21B 1BA2A 2BFWA 4OHPA 4B4VA 3DEZA 3LDHA 2Z5GA 4OGFA 2VHQA 1K1EA 3KOOA 5KG1A 1XTPA 2ZUUA 2Q5HA 5DI3A 2ZIXA 2IUEA 5MFPA 3KOXA 1JG4A 2CXHA 2FGJA 1D8TA 2ZE5A 5EI5A 3CX6A 2WV7A 2ZT8A 3BJMA 3FLAA 3C3AA 2AKAB 3ER8A 1O94D 3G7UA 2JEOA 4ZOQI 2HA6A 3A9UA 2DBRA 2Y2UA 5C8VA 1AD2A 3BT7A 3EC1A 2I6QA 3BJRA 2EF0A 4D97A 4QBIA 1BMTA 4ZCLA 1KI9A 2W4IA 1E9EA 5DK4A 2YV2A 3CNLA 4GZMA 4CYMA 5EP2A 4KHPB 3UT0A 2RBKA 4C8KA 1R50A 4KDFA 4BNWA 3AQFA 2FW9A 4RKFA 2CJWB 2Z6UA 4BRWA 3RC9A 4PX3A 1RRPA 1EVLA 3ZU6A 3MAGA 2Z2KA 1U7WA 2KE5A 4RIGA 3CF4G 4BDTA 1T9KA 4D3SA 4IHJB 3A9SA 3CBQA 5IF9A 3GRRA 1W88A 1ZY2A 2QWXA 1EVKA 2GFQA 3RG8A 3WZMA 3BA1A 1UL1X 3HFSA 3IQDB 1EFHA 4Y0NA 1U81A 1ZU5A 2DVMA 4LJYA 5LXTA 3AKZA 3E15A 3OIGA 2HSZA 2E37A 1BXRB 4AN1A 1NQAO 2IYUA 3DH0A 2P91A 5ESRA 4NEQA 1VI2A 3I1FA 3ONFA 1U8XX 5LQNA 2CBZA 1MV5A 4LTMA 3DL0A 2QTGA 4YAFA 3TMAA 1SV0A 4IIXA 1SGWA 2W8ZA 3FM9A 5JCZA 2AOUB 4RVNA 1PF7E 1X42A 3WTCA 5I7HA 4HH1A 4PGXA 1GPWB 3AJDA 4Q9AA 2ZRQA 3VAYA 1E7MA 3LX4A 3UWPA 4K9SA 4OATA 2VTVA 2V3VA 3R8FA 3AUTA 2RGXA 2A84A 1UFOA 1VE7A 2Y92A 1WCYA 5U9CA 2GOLA 2KHZA 3ST7A 4D4JA 4KLSA 1KWGA 3RFVA 1VE9A 2M6SA 3CNNA 4BFXA 2WKPA 2CXNA 2C99A 1HTBA 3GJ6A 2QN3A 1N3BA 4BN0A 4NLBA 2BMVA 1KI6A 3LCUA 3KPVA 8ICRA 4UD2A 1RADA 2VFAA 3WLKX 3A2MA 4RNOA 1ADJA 1V9PA 4ZI2A 4CIXA 1N5XA 1W36D 1YK0A 4ZGBA 4HEJA 5FLXA 5T64A 2G5TA 3PC6A 3RUFA 4ZV7A 3DKRA 4M60A 2OAEA 1XDSA 1DTSA 4Y6GB 4XI9A 2FLNA 3IDWA 2BGKA 4YLGA 2D06A 1RQGA 4X0EA 1OD6A 1NW8A 3FF4A 4V0RA 4EG5A 2XY7A 5KL1B 1L4NA 3GPIA 2CUZA 4F4JA 2A9VA 4YFVA 1VGRA 1K89A 1P1BA 4EY4A 3U37A 1M5RA 3NDPA 2EOAA 1O4VA 1W4ZA 2ZVQX 4ARIA 1J6UA 4MHTA 1FUUA 3DZIA 3OKAA 4O29A 1YMQA 3QOWA 2G82A 4MKIA 5HKAA 1YGPA 4C7KA 4X1IA 1T4CB 2DPHA 5KPJA 4S12A 4XB1A 2Z58A 1FRNA 4EG3A 2Z09A 1QHNA 6NULA 4QUEA 3L9XA 3FTDA 4J16A 1QDLB 4U2FA 2VR1A 1A95A 2VPYA 3WKEA 5BUQA 4DF3A 4F2SA 2F55A 4MX8A 4GDFA 2PHZA 3AK4A 4QE3A 2R1TA 4KI0A 2VP6A 5ARCA 1RLMA 3LX6A 2I66A 1JT2A 4QHSA 3PE3A 3KUDA 2O2ZA 1RG6A 3HRKA 1T10A 3EX7C 4CG1A 1JBQA 2H1RA 5K3DA 3VZQA 3C16C 2ZIZA 1Q14A 3KFXA 2BEWA 4H60A 1Y4ZA 4ASUA 4ESOA 2H2DA 3R7LA 1ZN2A 4MRMB 3T3DA 3WGMA 4NM1A 1JG2A 4RUKA 1JEYA 1PJ3A 3CHYA 5KOHB 3JQDA 4B8ZA 5H3HA 1L5KA 4XWGA 1J2RA 1RZ3A 5BSMA 2QLMA 1I0ZA 5JNVA 4DMKA 2VZ8A 5CNKA 4U3JA 1IB0A 4DEVA 1UA0A 2FUG1 1YE8A 1UMKA 2H08A 4YR0A 4AO8A 4MFCA 3W8FA 3JQPA 4UBJA 5K2OA 1XZEA 3C3DA 1WV1A 6ADHA 1NSYA 3VOSA 4RJLA 5FUWA 1WRBA 3IOYA 1AHNA 1NUHA 4RA6A 2ZM5A 3HU3A 4TQRA 4FZ3A 5IJ9A 1DRKA 2J3IA 1ZJ4A 4R8UA 4ECTA 2X0DA 3NNSA 3KCQA 2VZEA 1XRQA 1A8QA 1SZHA 1A8HA 1DJLA 4B3GA 4ECAA 3MFHA 4UB5A 1A04A 1XAHA 4CE6A 1PV4A 4DO9A 1S5LU 2VUIB 2M9NA 2MR6A 1XL0A 2GO1A 4LHXA 3SBOA 1QS0B 2GSDA 3PS9A 4DIOA 4B44A 1JECA 3AVWA 2XUOA 3T5JA 4F3TA 3EZ7A 3PITA 1OROA 7REQA 5A04A 1VLJA 3NIBA 3H2YA 2WZCA 1JIIA 1AUQA 1P45A 4Q4AB 2YS6A 3H5OA 1NYRA 1BTOA 3OEED 3DHWC 1ACLA 2QVYX 4ENPA 1YFJA 1L9KA 4BXOA 1A7KA 3BE5A 3OQ1A 1XDDA 4NYMR 1ORWA 3KB1A 3AXTA 5KJ6A 1SK9A 1FCJA 9ICOA 1GSIA 3DB1A 3PYLA 1H8ED 1H9BA 1YSCA 3HDJA 1TU0A 2JEJA 5DM1A 4NXZA 2W04A 1M5UA 3ZN2A 4KVFA 4JYCA 4B3BA 5JZVA 1B2RA 1BXGB 4UUOA 3TR6A 4U6SA 1UC9A 2OXFA 3SYMA 1J2TA 2D54A 2NSHA 2HSJA 3EBPA 2ZJZA 1LRLA 4HJRA 3QI7A 2QZZA 1IUNA 4Y2XA 1IY0A 3TUJC 2VF2A 3AFMA 1HT1E 1I14A 3AZQA 2E21A 1JEQA 4BECA 4C4XA 3EEYA 4MHOA 2PKRA 4QTXA 3VAZA 2YS7A 2E9SA 2YXEA 2FPWA 2ZS9A 5BT8A 3MB8A 1I9GA 3GLIB 4CLEA 5LLDA 1SQ0A 4KDEA 4QA9A 4CIDA 1XVUA 4LFAB 5IZCA 2PUGA 1NQOA 4B47A 4PSCA 2OV6A 1QOPB 3D54D 2DCUA 4E32A 2I2WA 1DADA 3ULKA 2AU0A 1COWD 4INOA 4PBRA 5ALJA 1LUAA 2WHRA 2WTAA 4OHOA 4MRPA 5I5GA 1DO2A 3GF4A 2DU8A 2PFQA 3DVAB 4XGKA 1JU4A 3E9EA 3IEXA 4LS3A 2LP4Y 1D1PA 4JV1A 1IBKB 2OV2A 1NXXA 1T43A 1Q83A 4LDQA 3G13A 3OWHA 4F5EA 1PU2A 1H2ZA 5FO1A 3TLXA 2F64A 2ESEA 4I2IA 2OCIA 4GH5A 2Z9CA 1D0VA 1JMVA 1QX3A 1BPYA 3WYCA 1XS9D 2ZVDA 3I8SA 4IFBA 4BGDA 5ES4B 1OI3A 4FFPA 3L7KA 1MABA 4LF6B 3VDMA 4JA0A 2H6EA 1NPYA 4FYJA 2PSDA 1N8NA 2KPOA 2ATVA 2BWJA 1Q0QA 1Y7IA 1E1LA 4UBLA 4D96A 4UTOA 2NVBA 4FQ7A 4UQLA 1XEXA 4UOQA 1OC2A 1Q3KA 1N36B 1Z2CA 1ORDA 3ORYA 1QRUA 2YVLA 5AOAA 4ZAWA 4P31A 2QM7A 2AE1A 1SZPA 2GDZA 2WVAA 3PZPA 4IQ0A 2YJ4A 3E03A 4X7PA 5DB4A 1PW5A 1SCKA 2JCXA 1SD1A 5DSXA 4PSVA 5K6AC 4S0ZA 3HTXA 1XHLA 4HDMA 2V1UA 4YCBA 1Y8AA 4ZOBA 2JVJA 3QVKA 4P0QB 1V4VA 4OQLA 2HR1A 3IUEA 4DLGA 4ENVA 2ZUVA 2P1RA 3JTMA 3V3TA 3UUFA 4Q00A 2GZHA 3WA7A 1FDOA 4J1SA 4DL9A 3HA5A 1HRKA 3PK0A 3ESAA 3VYUB 3TX2A 3Q7EA 4WCFA 2YMQA 1R0LA 5EVJA 1M0SA 4LF9B 3B3AA 5C8DA 5T4HA 1H1LB 1OYWA 4H59A 3EGDA 1ABBA 3I2YX 2Y68A 3SBEA 3KYCA 2WSLA 2PGJA 4KXNA 4RMHA 1ZK3A 1QH8B 1SOMA 4F8YA 3GBVA 5K4HA 4YBZA 4YMNA 3P2IA 4C6TB 1IAQA 4M7WA 1TGVA 5DT9A 2Q4TA 3QPBA 3STHA 4AS2A 3FKSD 4CU2A 2XE8A 1EG2A 3QPCA 1L4LA 3E3OA 5FOUA 5C18A 1QOQB 4KFRA 2D1SA 3EMVA 5JR3A 3TAHA 3C5VA 4Z9BA 2YUIA 3NBXX 4XGRA 3ER6A 3GDFA 5FBRB 4IO1A 5HX7A 3FWKA 2HJRA 3AM5A 3G0DA 1S4MA 3A14A 5T6MA 5KTKA 1B0ZA 3AESB 2ATEA 3TW6A 4OHUA 5KNCA 2C2BA 2XYVA 2XNSA 4MEXA 3I39X 1MFZA 4JBNA 4RU9A 3ISDA 1XKTA 2CB9A 1U4SA 3E8XA 4OSOA 2L82A 4UDOA 4UHBA 4YRDA 1NC3A 2VP0A 1MQ9A 4K7JA 4P3KA 3GROA 4AZWA 1Q5PA 3KYBA 1XYYA 3TWOA 3A0BU 3Q0EA 5B2EA 2P9QA 3IAEA 1HUOA 1HDXA 4GQIA 1NZFA 9ICPA 4E5UA 1EVJA 2ISQA 1WUKS 4MR9A 5DM0A 4ZK6A 1GQQA 3C14C 4EHLA 1DAKA 1PNQA 4WZ6A 1U98A 2QF7A 3UJNA 2ZYUX 1U1GA 1W5BA 4C06A 2FHSA 4X71A 3DFFA 4L8FA 4F9GA 5AVVA 1SO8A 5HQ3B 2GYUA 4L9WA 5IAOA 3PXUA 5MN6A 4HWTA 1PWXA 3B2EA 4ZCQA 1J23A 1JBKA 1UMDB 4N4AA 1ZX1A 3OZVA 1Z2PX 1II9A 3C29A 1K4MA 2I3BA 3WS7A 4K4GA 4QNMA 3TIVA 1PZNA 3KHLA 4IIUA 1NU8A 3K8OE 5I4BA 1UWVA 1PUZA 4AZ0A 4DS5A 4KR2A 3DMFA 1IJKA 3LF2A 4ARZB 3NJ8A 1YQGA 3U7EB 2FLWA 1N2GA 3EZ5A 4I99A 3H1PA 4HQ6A 1NR7A 1H2EA 5AJWA 4P2GA 1OFUX 4TM8A 3QSYA 3TS1A 2UVWA 4G9GA 1I94B 1RYRA 3SG0A 1YVEI 4IIEA 1R0SA 4QDOA 4J9SA 4AVYA 3MJCA 2P30A 4N65A 5KJCA 1FFBA 2OO3A 3RS5A 5FB3A 4XD7D 1EWRA 4RTKA 2I2XB 1PDVA 1IK6A 2ZITA 3AEYA 4O02B 3A1NA 3T5PA 3V80A 1X8KA 3IDZA 4BV3A 4UZSA 5FPSA 5J2CA 1I7PA 2H51A 5TLSA 1ECCA 3F47A 2VQSA 1BPZA 2JZCA 5FULA 4NBWA 2VK2A 3B52X 1S89A 4RVCA 3MUOA 2WIDA 1MIOB 3N5CA 4W5OA 5GINE 3ZU5A 3GV8B 4YG2A 3M4XA 5BSTA 3S6JA 4TMWA 3PDWA 4ZU6X 3QUAA 3ZDRA 1K9VF 1KVSA 3BEDA 2ERXA 4DJFC 1TEHA 2QTBA 4BKOA 1JB1A 3UAWA 1E2PA 3DXFA 1HT2E 4TQUS 1JAIA 2FKNA 3NUQA 1NUAA 1YOVA 1UAAA 2OAP1 4MRVA 4ZFNA 3AFNA 1YDHA 3OSUA 5KAMA 4ESVA 2QU8A 4G0PA 2ZJ3A 3X1KA 5JO0A 1V6AA 1ZN7A 3SS7X 4REQB 2Z2JA 1YT5A 2F1IA 4DC9A 1HNXB 4DQPA 1CNMA 3CW2A 2YWBA 3VZDA 1H3EA 3A6KA 1I33A 1FDUA 4DFPA 3LX5A 3RSCA 2PS1A 4QZDA 2D7JA 2QM3A 3V8RA 4JV5B 4UBOA 3QKWA 4L08A 1G20B 1AU9A 2X9LA 3H2JA 2V7BA 3B1ZA 3D6NB 2BF4A 4X61A 4H6VA 4FWBA 3H1EA 3DTYA 4RQBA 3LZCA 1E77A 1W5TA 2R1VA 3OF2A 3VR5A 4DL5A 1KWKA 1AKNA 1KHHA 2DUWA 4MQBA 2J48A 4RQ4A 1C3XA 1CT9A 4ZCPA 1QZUA 1Q3TA 5CEHA 5FQOA 2VXBA 3CG0A 1Z8FA 1DMSA 4RZQA 1OI2A 2GCEA 2DUMA 2EX4A 1FLNA 1DP4A 3PX2A 4IV8A 3B6EA 2H0RA 4DIFA 4K0RA 3OLXA 4Z9XA 1P8JA 3RRHA 4PTZA 2DY1A 1JW9B 2O20A 1RXSA 4NLCA 5AVXA 5K5EA 1LSJA 4F3OA 3DKVA 1NXQA 5G0TA 1EUQA 2XNCA 1KOGA 2WMDA 1DAMA 2QLNA 4PXAA 5LWQA 2WFLB 1SY7A 5K4GA 1KKUA 3BM5A 3ESBA 2CZQA 5B7PA 1KQPA 4KE7A 1S2IA 3B70A 1GPMA 3B5JA 4S35A 3N2NA 5A4JA 4XUCA 2A3VA 3RE1A 4DABA 2V9CA 1FDIA 3OWOA 5TV2A 1POWA 1Z88A 2G4VA 3LWMA 4I5EA 1E1CB 1FFSA 3OWXA 4D9FA 3T1OA 5F5LA 2BCQA 3JPWA 3ME5A 2VAWA 4DLYA 3GUVA 4UEKA 1W0JD 2VL7A 4C6SA 3B38A 1PFGA 4DRYA 4EI8A 2CB0A 3ZY4A 3HYLA 4EG0A 3CX3A 4O63O 3SR3A 4L8VA 4LJLA 2C57A 2NYAA 1M72A 2OMEA 3L8EA 1QMGA 3Q9LA 2EFCB 4CN9A 3P45A 2Z7JA 2PH5A 3T3HA 4BDSA 2Y1DA 1YB4A 4E5NA 2QUAA 2AHOB 4XE5A 3JPNA 1LA2A 2OD9A 4YAUA 3T5LA 2DR0A 5HXAA 4LSMA 3B8HA 2WIFA 5EFZA 2ZSDA 4OYYA 4Q1VA 4G81A 1VCHA 4TTQA 1DC6A 1TT5A 2W54A 4CV2A 2OXRA 2ILTA 1NF9A 3OOJA 1XZFA 5KC9A 2ZBQA 1CQPA 4C20A 3PGA1 2F00A 2QR3A 1NR1A 5F7XA 1JLMA 3B5IA 3D4BA 1FP6A 1JR3A 2BPGA 3C28A 4J4TA 3L1VA 4EEXA 4D9GA 1A0OA 2OV1A 4X95A 1S2OA 3BDPA 2BKVA 3UF0A 1LPBB 3X1WA 1Z1VA 2P2GA 3LPAA 5KB3A 2VCYA 3NORA 4TUPA 1YZFA 2H3IA 1L5UA 4WI1A 2AFHB 1TD9A 2OZVA 2IZ7A 2V7TA 2QN1A 2VP2A 4KMUA 2AT1A 4UASA 5GZ3A 3MAAC 1X7WA 4PAQA 5EE1A 5HWSA 3VUFA 3QTBA 1YRBA 4MKHA 2ZRAA 4EJ6A 3QUTA 3IBCA 4OHMA 1BGVA 3RV3A 3CZPA 4DT1A 1VLQA 4NOKA 3SX2A 5ARBA 4Q5IA 3RANA 3V4PB 4ZOHC 4FFWA 5H80A 1O9BA 2VJDA 3BE6A 2O23A 2REQB 2WHQA 1SKRA 1UXJA 3ETGA 4FS3A 1QQBA 2CVZA 1QKKA 4UPVA 4GX2A 3JASA 4EG6A 1WCNA 1I7QB 1ORHA 1KK3A 5CX4A 3RO7A 1SHTX 4OLFA 1YDGA 5EZ5A 4K0KB 1R2QA 3TOXA 4PPQA 3QFFA 3C3CA 4PSAA 2JLWA 3TF5A 2WQZA 3EWNA 4FM9A 2Q5JA 5AKLA 3IUNA 2O1XA 1ENZA 3OA0A 3EVZA 5JNTA 3R5SA 1PUIA 1LBIA 1F51E 2J6SA 4PRLA 3AF2A 4OQPA 1R9MA 1SKYE 3EOBI 4BCDA 1ISRA 5FI1B 1QP0A 1OFUA 3WGJA 3NVZA 1PBTA 5KYXB 2QW1A 4ALNA 1FC0A 3MGBA 1QH1A 4TTPA 3CW8X 5AKXA 4TUYF 3I4FA 3JVDA 5J43A 1D03A 4QUIA 1FRVA 3RSSA 5HIMA 1TZMA 1NUSA 2QNRA 3D6UA 1ZJ5A 2ZIAA 3CLSC 2JW5A 4HUQB 3F5FA 1FDTA 3FGPA 2DM6A 4JUBA 5DDIP 5B6PA 4URVR 1CCWA 2Z8ZA 4IDBA 5E2AA 4IEEA 1W6UA 1XTKA 2O8DA 4BKPA 4RZSA 3THSA 2E8NA 4OSEA 2ZXUA 3DNPA 3P9PA 1FDRA 1ZQQA 3WYDA 5DEIA 2IHNA 3GFPA 4FGKA 1G60A 3MBOA 4JJFA 5G4LA 3ITKA 1FQKA 4G4JA 2CL5A 1SL1A 1ZPDA 3IAM1 2UVQA 4YEDA 1XWIA 3OUZA 5L3QB 3IR6A 3K9GA 5YASA 2V54A 3B89A 4CU5A 2C8VA 5E6SB 1K5GA 1XI2A 5IK2D 1P0PA 5ELMA 1X6VA 4HYKA 1IE3A 2AIRA 4F5QA 4B3MB 3RKRA 3B6IA 4PCVA 4O4HB 1J22A 2EJCA 3GMDA 4R0NA 1QYRA 1XNGA 1JS1X 4KLDA 2IEZA 4HLUC 2NRVA 4US9A 4KXXA 3LDGA 1XTTA 1IWOA 2QTCA 3M70A 2P8SA 2QSYA 5HA5A 3HKDB 4TN1A 4BN5A 3NGLA 3M49A 4TT3A 3KJFA 5REQB 4DLBA 4CIAA 1Z45A 2XH8A 5ALXA 3OJFA 3AFOA 5TPZD 1U0BB 3A3PA 5DKFA 1CJBA 1N2CE 3GRYA 1GPAA 3RCBA 3DDCA 2UVRA 1A9PA 1T4MA 1PVQA 3AERA 1QZXA 2YVAA 2FEAA 3BFXA 1ED1A 1N6KA 1W5AA 3Q8SB 1AV6A 5T14A 4Y9SA 1PDOA 1N3YA 5FR1A 6PFKA 4GMHA 3O3OB 2BCSA 3LQ1A 3W77A 1R5BA 3LIIA 5KQSA 2D4HA 3RYCA 4M0KA 1M1YA 1NA5A 5JCOA 3O4IA 4KNVA 4NLKA 4CMEC 1UADA 1PX2A 2JVIA 4QPJC 2G1PA 5KUTA 2CCGA 5JJCA 1E6WA 1Y3AA 2HNKA 5EHGA 3V00A 4LTDA 2F8SA 4E7PA 2V65A 1FB5A 3SI8A 3B8EA 4R71A 2WT8A 3DO5A 4JH0A 2IEYA 3V3KA 3L4EA 3BB3A 5KFUA 5EFOA 1L7RA 2NV2B 1XTSA 5CH5A 2H2GA 2DSNA 4DIUA 3VKFA 3N0XA 3PQ3A 4IJMA 2IVFA 1ESDA 4CM8A 1J09A 3MTBA 1GPBA 3KKKA 2NYRA 3RS3A 3Q9UA 3KUXA 5IIMA 2Z5FA 2IV2X 3BXGA 4HEHA 1FVFA 2BF7A 3RUPA 3LZ6A 3OJWA 3BQ2A 1DC7A 1CUJA 5BSKA 1NJGA 4KQHA 1M2OB 5MN5A 1WY5A 1G8PA 4XW2A 4NCAA 2JI4A 4BX3A 1RM3A 3ZHBA 1NJ5A 4DYDA 2W2XA 4GLJA 1N0VC 2X5OA 4RHEA 2CYBA 3NIDB 1TKDA 4TX1A 3ZDFA 4UHKA 1QO0A 2DFPA 3F8TA 1HE4A 1A7AA 3L0SA 2BMWA 5DYGA 4F4ZA 2DKXA 3ELDA 1KFCB 2P6OA 1UODA 1JG7A 1BYUA 2J5BA 3FI9A 4YR3A 3FVWA 1J20A 3LK6A 1W581 4ECQA 4WAUA 3Q0TA 1Y82A 2ZTEA 3U9LA 2A78A 1PR6A 2HNAA 3VDQA 5ENVA 5I48A 1KJZA 2C4TA 3RHSA 4HN4B 3DTVD 4GL2A 5I45A 4U2DA 3NPAA 4BKMA 3RJ9A 3E22A 1XC9A 3ROZA 4XDZA 2XQGA 1NOKA 3EULA 3UT5A 4TV9F 5JRZA 2VWHA 1LJUA 1P6UA 2O0HA 1E2BA 4BUGA 1P2FA 1IATA 1JDZA 5HZGA 3F5AA 3WWCA 1KJYA 1M8PA 3B1XA 4N47A 4XWYA 3G2JA 2QKQA 5CMLA 2KJ5A 5EPEA 1GWNA 3AVOA 1Y8RA 2SCUA 3VR3A 1XKQA 2QT0A 3M9LA 4TKMA 2O0JA 4YR9A 5LIPA 3U26A 2JS7A 4U02A 4ZD6A 3QZ7A 1ONSA 3DJYA 2NV6A 4S0XA 2BFFA 1PK1B 2OFXA 5SZHB 4H7DA 1F4VA 2F1RA 5JYDA 1YS9A 4C2TA 4E07A 3A36A 3WIVA 4PZ0A 4QNNA 1GFIA 1W48A 3WGTA 1F9AA 4EW1A 2PZMA 2ZSBA 3SHQA 1KP3A 3O7WA 1DCMA 4ETWA 2VVTA 5DO9A 1R15A 3BQMB 3Q9SA 4K4HA 4BBJA 4GI5A 1V97A 4B7CA 4E88A 4EI2A 4WDRA 1CP3A 5JSZB 1PR9A 1RXVA 1F38A 3AV3A 5CB4F 1RQ2A 3U7IA 4R65A 4MDFA 2E6UX 2Z2XA 1JH8A 1Q19A 2HPHA 3EG5A 4NCNA 1JAZA 3RARA 4E2FA 2Y0SF 2EJWA 4JI3B 1XXLA 3JZIA 3WIEA 2AXQA 4KSCA 4R51A 4TOIA 2FEMA 1BSVA 4BVBA 4AP9A 3F9CA 4WERA 4JDUA 3GFFA 1MHPA 4YJ3F 5L9AA 2P67A 1E1NA 1LV8A 1KJWA 4NBSA 8ICKA 3HNOA 4PLYA 1NKBA 3PW5A 1U0FA 2Q2NA 1PK8A 1SCUB 4CMCA 1X6JA 4B31A 1D1TA 3TLGB 3BPSA 1NMYA 1NKCA 2GOYA 1BOOA 1DIGA 4FT4A 1Z5OA 3HBFA 3RGWS 3U9SA 1QZTA 2W6MA 5CT5A 1XWFA 2D5CA 4CM4B 4FN4A 1PZGA 5B6IA 2J45A 1FUEA 5KJFA 3GAFA 1NBAA 3UB4A 1IXRC 2I87A 3IURA 5F2NA 4OH7A 1UXIA 5IIKA 2ZATA 4ARCA 4EF5A 2VHXA 3ZE6A 5CDHA 4E6EA 1DXQA 3WNQA 4WXHA 1O4WA 1ZGAA 4D45A 5KG0A 1BEEA 3PR2B 1CUEA 3UMVA 1SCIA 5E9AA 4ZVVA 3PPIA 4WD3A 4E12A 4OREX 2WPNA 4IIGA 1NK4A 1DARA 5KCMA 3AF1A 2IA6A 1NVTA 4L07A 4NOJA 4O8ZA 1SBZA 2I6SA 1H0RA 2E55A 2WUWE 1PS9A 4H7KA 4D80A 1QQ6A 4D4GA 2C00A 4QPZA 4TKVB 1ZQ1C 3WJ2A 3DL4A 1NSTA 3OQPA 2P35A 2WYOA 1EIZA 3I5XA 5I9TA 4HNUA 2AGPA 1M6WA 3CRQA 5CFOA 3D3EA 3TUZC 3MBKA 1C9DB 2WP8J 4U9IS 2NU6A 3IH5A 2RGGA 1CUDA 3FYCA 1FPQA 4RVUA 3FCUB 4LXIA 4RF2A 16PKA 3U3OA 1ML3A 2KIVA 4JBXA 3QVSA 3H2IA 3DR3A 1AK1A 5HOEA 3KKEA 4QZEA 1NOJA 5GONB 2CXSA 4Q05A 1Z3CA 1R6XA 3OEHD 4J0GA 1K4KA 2O7SA 4W7HA 2OV3A 1E8MA 4LG1A 3EEIA 2A9JA 2H4WA 2GAOA 4X63A 3FZYA 5ITSA 4RIFA 1JZSA 4YRMA 2Q3JA 2W6IA 2FF5A 3KE8A 4JLJA 3UQ0A 3HRIA 2J0UA 3L92A 2CLSA 5HILA 4NZZA 1KDOA 4MB2A 4RIEA 2IYZA 3EIQA 4HFRA 2WHPA 4WBNB 2X4IA 3INGA 2WA2A 1VKHA 4FMBB 221PA 3N39C 4G6ZA 4P98A 5JROA 4AF6A 4H4EA 4OGKA 3IJRA 4FXPA 3CRXA 4RF3A 1I30A 3ETJA 5KJ1A 1ZQZA 3H1AA 1AMUA 1T8UA 1YZ3A 3H8WA 1SXJA 2C95A 3TEFA 2OGZA 1NN1A 5E6UA 1YI1A 1T3LA 3T1TA 5KQGA 5DK6A 5GTDA 1NSFA 1W30A 3CTMA 1N8TA 3F6RA 1N2ZA 1GPJA 4FHDA 3UXOA 4M9JA 2VRNA 5GV8A 4FWTA 3QUQA 4RZUA 5J9FA 4LJ4A 2I9GA 2GD6A 4CFZA 1XWWA 3COWA 3GFOA 4IUDS 1H4QA 1B6TA 4I50F 3SSAA 3KZNA 3U61B 5F1OA 1WKVA 4GE3A 4P35A 3ISVA 2WVHA 3V1TC 3K9BA 2YY7A 2XHZA 4BO8A 1RPNA 3AFIA 4TL9A 3N07A 3A05A 1SIOA 4JHLA 1L5QA 4CGZA 1R64A 4RORA 3UYLA 1D1QA 2VZLA 3M6WA 2WFAA 5KFNA 4JAVC 1O58A 1OLXA 1SU8A 4EB8A 4UM8B 2RGWA 3V7UA 2XY4A 3HB5X 4ZRMA 1MA7A 3M6AA 1Z0FA 2GYWA 1A76A 1YK1A 1KJ8A 3I2KA 5ICSA 2O7QA 5KTOA 1WD7A 2WD7B 3QPAA 2J8ZA 4R4JA 5KU1A 4IWXA 4JWTA 5L1LA 1E2FA 4M2YA 4QFBA 2W3RA 5HEKA 1DUIA 1DXYA 3ZHQA 1U9JA 2FZ5A 4XJSA 4M47A 2JEZA 1W1UA 3HRHA 4HLNA 3I4CA 3CUVA 3ZWCA 5IHPA 5HF5A 5DBOA 4UFNA 1EZZA 3EQ2A 3RF6A 4B6SA 5I7AA 3QEAZ 4ZEVA 1P0CA 4NMHA 4CDGA 4J29A 1D7AA 1S3GA 5F9FA 4BLRA 4LN1A 1OR8A 1ZZEA 3QVGB 2NAPA 1JJ7A 2EL7A 3AHGA 3TDKA 4KLJA 3SC3A 4DKJA 4UEJA 1JXLA 1YJXA 2C9ZA 3Q6IA 4DREA 2FSFA 5JH7F 1U02A 4CT5A 2B8NA 2I6FA 2V6JA 2GLTA 4EATA 2R86A 4D79A 4B71A 2R8KA 4AY4A 4H15A 4PYQA 3EXEB 1Q50A 4DNOA 1PVDA 4AWBA 1DAGA 3TINA 4HPWA 5JXJA 3A26A 5JJ5A 3D8UA 3PD0A 4CMAA 4IYRA 1HNWB 5ILOA 1EVEA 4MYUA 1GG5A 3ORSA 1J2EA 4DL4A 5BYJA 1RQPA 2OENG 3V1MA 3GIWA 3COSA 1BE6A 2IGBA 3ND9A 1EDEA 2PFSA 3IBYA 4QXOA 1K0UA 4AJJA 3W5SA 2YJTD 3D6TB 2ACEA 5JSHA 5KHOC 4JWKA 4UNSA 1E7WA 1K88A 4J0FA 4K8OA 4KZPA 3OFNA 1SA0A 3RSFA 4BMXA 2CLKB 4OLHA 4UVEA 1HEYA 2ZJ7A 5AVOA 2O1EA 5K09A 3FCEA 4QZVA 1JIUA 3FFAA 5AW2A 4RPXA 3MUEA 1JHMA 3L8ZA 2W93A 3LT0A 3I45A 5KTPA 3NHAA 4V0NA 2RAFA 1GYQA 1VBKA 1G5PA 3ZJTA 5EG5A 4BB9A 2O5CA 1HTWA 3TM4A 1RHRA 1L7BA 4BWYA 5DYWA 2ZT6A 4DR1B 5AJXA 2IK8A 1CS0B 2G5CA 5JMPA 3G2HA 3TOCA 3TRKA 3QP9A 2XGSA 5CCXA 1MO2A 2WM2A 3K53A 1QAMA 1ZC4A 4ZWNA 4IZ6A 1BQ3A 4WLUA 1OOEA 2BQ3A 3HBAA 1M6VA 3O91A 3TSOA 1FO4A 4DOAA 5AMXA 1M1UA 2D1RA 4KVAA 2GN2A 3D5QA 1I5RA 3R7NA 2F1HA 1YB2A 3ZQJA 3CF4A 1K8XB 3OUTA 3UQZA 3U4HA 2ZULA 3JALA 3SHOA 5HK9A 4OP3A 1OZ0A 4RQUA 4I7EA 4CKCB 4LMBA 4U0JA 3RADC 4OVKA 4EY6A 4ELUA 3AN1A 5FT9A 2ORED 5LUBA 5HYVA 5IARA 4FYPA 1V85A 1GKYA 3R3XA 3V8PA 4P83A 4UHFA 2VAVA 3U9TA 5T8KA 1KXJA 4OQEA 2H2IA 2CJXA 3DPUA 4MK4A 1XJ0A 5K0BA 3DOHA 1KSPA 1MSWD 3B1YA 2FZEA 3L0IB 4FGZA 4XEUA 3MS2A 1A7UA 3T9AA 3GCWA 5BW4A 5TX7A 5DCYA 2QAJA 3LLVA 5JUMA 4TWJA 3NVDA 4MIEA 4FW8A 5LVAA 2D6FC 1CUFA 1P31A 1USVA 3T5AA 2RARA 1RE1A 3DXXA 3AMZA 2CUTA 4QO8A 3AI3A 1PTKA 3FHJA 2ANBA 2E48A 1KO1A 1G5FA 3WO1A 2BH2A 5F2OA 2CBXA 4DZRA 1I24A 1YJBA 2DWCA 4FMPA 4JC5A 3KEFA 3OTIA 2WIBA 5IM5A 2ODNA 4Y6RA 1YNOA 1Q0SA 1WP9A 3RAXA 1QLHA 4BNDB 4FOPA 4J0JA 3AFHA 2XXAA 3WAKA 2IYLD 8MHTA 3FDSA 4CR6A 4WACA 4QULA 2ZT7A 1NNUA 2OB2A 2AW5A 5IMSA 1R4NB 3B2QA 3AH8A 3FYDA 9ICFA 2FN7A 4KH1A 3L7NA 1E6KA 3IIEA 3COVA 2AFIB 5HGXA 3NKFA 4HDSA 8ICIA 4HXYA 3TLEA 2WWHA 1W85A 2MYUA 1EP9A 5EERA 5EIOA 1PT6A 1S0OA 2XYRA 4F56A 2AEFA 4JY7A 1GGEA 4Y2UA 3QMWA 5A62A 3ICCA 2UDPA 2QJTA 3R5FA 4FFLA 4Q21A 3OQIB 4TMXA 1LDBA 2YWRA 5AJVB 3BSWA 4B9TA 1J4AA 4AKGA 4CIWA 1ZSVA 2H1SA 2O2CA 3MOSA 3WLEA 4CLRA 2GT1A 4P1ZA 2VQDA 1IPHA 5GV7A 1T5HX 4F11A 2R47A 4PG6A 3M6LA 1MAWA 1C7FA 3D8NA 4KCGA 2XGQA 3KU4A 4PFKA 3G49A 1ONOA 2N9UA 4KMSA 3UMSA 4TV9A 7ICEA 2C1EA 2ZFUA 1G8YA 2FV8A 2WG0A 3L1UA 3DOJA 4URXR 3AU2A 2AG0A 2CFSA 4NCIA 4ECVA 1UT6A 2JNWA 4NFHA 2H9YA 3CPSA 3P9SA 3IDOA 1WW8A 4DA9A 4MYDA 1A72A 4TN5A 2COUA 5KYUB 1IMJA 4C80A 2PEZA 4LY0A 3S2SA 5EE9A 1A9QA 4XRHA 1P1IA 3V1NA 2ECPA 4KIFA 5CHEA 3VZSA 2WSSA 3A37A 3ADPA 3UAOA 3HVRA 5LQMA 1BJKA 3VHRA 4LHSA 2YQ4A 5AUQA 3M1LA 4G01B 9ICKA 4UNIA 2D2XA 3DVRX 3FUXA 3AM1A 5BOSB 3NHLA 1LC3A 1GU0A 5EMHA 1MEJA 4JBLA 4D8TA 2XVXA 5LZ5A 4R8SA 1U80A 4ND1A 8ICPA 3PX3A 2H59A 1F48A 3RBAA 3LYSA 1DAOA 1OKKA 2F8LA 3RF7A 2ZRCA 4Q1AA 2ORYA 5EWLA 4ECRA 4Z8XA 1HYHA 1BXKA 4QOGA 1IL0A 3A6LA 2RC5A 4L3VA 5HKKA 4EUFA 3IIIA 4BNFA 5C7YA 3IVMA 1XL1A 4QDKA 2LE0A 3HI4A 1WV0A 5LPNA 1PT5A 2I8AA 1N9ZA 3LWZA 4EB6B 1MT3A 4I2JA 3MYYA 3WK6A 1E3WA 3PQCA 5BP7A 3EA0A 1BHSA 3JQAA 4YJ3A 2I5PO 3IFSA 1MO3A 4B6JA 1EX6A 3RD5A 3OM1A 1M54A 5KVQA 4B82A 1O0SA 5LJLA 1Q6YA 1D2MA 3HB1A 1KS2A 4LBWA 4K05A 1EFKA 4Z86A 5JJIA 4Z2YA 5B2FA 4HL6A 3SKXA 3QLUA 4BGUA 4LY3A 1XE3A 3NAZA 2XWPA 3NFYA 5A0FA 3GILA 1E9FA 2ZJ4A 2JGEA 2OOKA 1CY2A 4QECA 1T4GA 1U2TA 3NV9A 3EXIB 4ZK2A 1AUOA 3LQ4A 4JLDA 4EKDA 1X14A 1PHRA 4KGZA 2J6HA 4ZI5A 4MP3A 4QYSA 2LCFA 3L93A 3MUFA 2IPOA 2PX3A 4K2HA 4N6NA 1WBJB 3DMTA 1EH5A 2YV3A 4ESEA 1F60A 1NKTA 3V2IA 2JAWA 2R2AA 4D25A 4N8SA 5DI3B 3PCXA 2ZIXB 4KNYA 3BHMA 3LKVA 1WDMA 2DFVA 4IKPA 1U2RA 5GVRA 5D01A 4GNKA 5TJHA 2O7RA 3DLHA 2D1QA 3S7ZA 3CEHA 621PA 1WF3A 3D2SA 1Z7YA 5HDQA 2G63A 3DE5X 1T6YA 3NO4A 1OBCA 1VIMA 4TZ0A 1EK2A 1BC5A 3F2VA 1B74A 1HDEA 4RTRA 3TIFA 1PT9A 5L4SA 3R2JA 3KSUA 3AL3A 4MH0R 5KNLA 3O3CA 4KIUA 2MT9A 2D5IA 1QR6A 2CMKA 3OTOB 4CNQA 4YT5A 4KAJA 1IHDA 2NU8A 5KQPA 3TKAA 3GGOA 5LQJA 3GMTA 3R6DA 3UXPA 4B9AA 2NZ8A 4MV7A 3GN2A 3OZWA 4YN3A 3TSWA 1X74A 1NM5A 2NO6A 2A1JB 3QE2A 3FPBA 5B3LA 3C5GA 5EJEA 2IW1A 3OCZA 4KKXB 2YASA 1DBPA 1Y8QA 1GFZA 3C4QA 4BTLA 3K09C 4GYKA 1W88B 1THTA 4PGGA 4B4WA 2C2OA 2XMRA 4OFWA 2C61A 5DLQC 2AJ8A 1ZH8A 2QN9A 4TLMB 1RU3A 5LXTB 2LR0A 2FP3A 3H86A 2EBHX 2O05A 3BXZA 4DLPA 1F4LA 1MF7A 1P9NA 2Z5VA 3TKYA 3P9KA 3REOA 1Z4QA 1NT4A 2F76X 2I62A 521PA 7GPBA 3K9WA 2PX4A 3GI1A 4WXYB 4BCCA 2OBFA 5AKYA 2J4FA 1ECLA 1OI7A 1UKCA 2Y0PA 3Q5DA 3WGVA 5B3KA 2FMHA 2Y0CA 2H5EA 3G6KA 3QBVA 4XYMA 3PQ4A 5E1OA 3PHIA 2ETXA 2QZJA 3OU6A 3G0CA 1R0YA 1TA9A 1PV1A 3GDOA 4ME6A 2W9CA 3L82B 4NK4A 2CJFA 4FFSA 4MNTA 4FS1A 3C3WA 2X8BA 1VHWA 3JQQA 1L4YA 3P9NA 3EPHA 2SKCA 4D9CA 1Y4AE 5ESWA 5ALDA 4YHHB 2FUG6 1RSZA 1L8OA 4LV5B 3AW8A 3WLFA 2KBFA 3T5KA 1A82A 4PYLA 4D57A 2OECA 1C2TA 1ACJA 2C82A 3ROEA 3JRXA 4IV0A 4LC1A 1XSNA 5AYVA 2B6HA 4YRZA 2KV2A 5A4DA 2MYNA 1UR5A 2JLXA 4IRCA 3JVEA 2EJVA 4BFZA 2X1VA 2UYGA 4DA6A 4ZCSA 5E2BA 1M83A 2ZYVX 2GSWA 1K06A 3LGAA 1P5FA 5F2KA 3PUZA 3EE6A 1RRFA 3M83A 3AEQA 3O9MA 1EG7A 5K8LA 1OMOA 4RGBA 2ONYA 4WLVA 4IEFB 1J0BA 3SHFA 4G9BA 3HABA 1XC7A 1EE9A 4L95C 5K8VA 4R9NA 2X1LA 4WLOA 3QBJA 4FX5A 3ZDBA 3BS5B 4NPAA 3U0VA 2YQ5A 4BFTA 2C54A 3TTSA 4X1IB 1ULZA 4RPJA 8ATCA 2V8BA 1DK2A 2NACA 3P2KA 4BTVA 3LQKA 2Q5FA 3DCIA 2AEMA 4JSYA 2ZQYA 2VPWA 5LQKA 2Y6VA 3A4LA 2GDJA 3KZXA 4L2IB 3WQQA 2C9BA 4L16A 3CZQA 4DLTA 2KMDA 2OHVA 2BFOA 1TVKA 3KDPA 1UT8A 4AMYA 3KHHA 2EW2A 1E9CA 3DWGA 2VA2A 2UXCB 3NVVA 5JS1A 4ZDWA 3F8WA 3KKAA 3MCTA 4Q9NA 2W9AA 5FOXA 4OFXA 1MUUA 2FJUA 4NATA 1DBWA 2B0JA 3ZDCA 3BCUA 2W8BA 2EBWA 3HDYA 3DOFA 1NFRA 2A5LA 3F3SA 2BMEA 2C78A 2IDZA 1WXHA 3X1JA 2VT7A 4KMRA 1NJZA 3FHOA 3TW0A 2CL0X 1RMQA 2BEWB 1D6MA 4K9RA 2JXJA 3ZBUA 5ICGA 5CXUA 1DQZA 2ORVA 2ID4A 1JEYB 3Q11A 2QIOA 3U81A 3OLCX 4NPCA 2Q1XA 2JFHA 4N01A 3C0KA 5DYNA 1QYVA 5B7GA 2ZYWX 3RB3A 2F67A 2WTEA 3GP5A 3AHEA 1H2RS 3CURA 4DSZA 4Z6DA 4U3JB 4B3HA 4K86A 3VTAA 3L07A 2PWZA 2C9YA 4K6FA 3B82A 2JH8A 3TDNA 4OOEA 3M8KA 3S68A 1LK5A 3DJFA 1N2SA 5H81A 2LPMA 4WVLA 1FP4A 2X8LA 4RA6B 4PONA 4EGSA 1UZAA 4QTYA 3PZRA 2RKOA 5IJ9B 1OYOA 3QIVA 2QRQA 2JKVA 3H4MA 1E2MA 1JG3A 2D8CA 3WJ7A 3MMNA 2ZTUA 5FRDA 2GEJA 3HYNA 5BR4A 7ICOA 5JLJA 4IIDA 4KXFB 3COPA 4XQEA 2NUBA 2PRJA 1JIVA 2RGDA 4N82A 4OGWA 4B48A 2AX4A 5EE5B 1MC8A