2WFAA

Structure of beta-phosphoglucomutase inhibited with beryllium trifluoride, in an open conformation.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near Attack Conformers Dominate Beta-Phosphoglucomutase Complexes Where Geometry and Charge Distribution Reflect Those of Substrate.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 76
structure length 221
sequence length 221
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2wfaA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2wfaA01
4OHFA 4J2TA 1TJ5A 2YN4A 5AW5A 3NAMA 1RKVA 1XVIA 4ZEXA 1RMYA 2DQSA 2YBDA 1KYTA 3L8GA 1T9ZA 4BNDB 5AVRA 3WK9A 1ZD2P 2B8JA 2HO4A 1Z4QA 4EZEA 2MSNA 3A3YA 2RAVA 1LTQA 3GYGA 3L5KA 3MPOA 3KC2A 4Y2VA 2R8YA 4XE5A 1RC8A 5AVQA 5AW7A 1NF2A 5AIAA 3L1UA 5AKHA 4YH1A 3ET4A 5AKKA 4IG4A 1EK2A 1TJ4A 5AM0A 3R09A 4FFDA 2OM6A 5AM2A 3D6JA 4EELA 2C88A 2B82A 4UAUA 3VAYA 3OCXA 2IOFA 4J03A 5AESA 1TA0A 3FZQA 2EATA 4GIBA 4G9BA 5ALYA 2YJ5A 4NWIA 3IJ5A 1QYIA 3OPXA 5AW4A 3UM9A 4E88A 4HGPA 3WKBA 3I1YA 3OCVA 3U19A 2G80A 5ALIA 3L8EA 3W5AA 2CFSA 4L57A 2G08A 1RLMA 3ONNA 5A3RA 3SHQA 3DDHA 3L0YA 5ALOA 3MMZA 2WF7A 2WHEA 4EENA 4AS2A 2Q5EA 3OCUA 2HF2A 3PCTA 1Z5GA 2AH5A 4C4SA 1RKQA 1ZD3A 4KNVA 5AI5A 5AVWA 4XPZA 1L7NA 4DWOA 1K1EA 5ALGA 2OA0A 2PKEA 1Z4OA 1SU4A 2JAUA 1QQ6A 1RLTA 3ZW7A 1U2TA 4JDPA 5AVXA 4Y2TA 1EK1A 1RMTA 4UU1A 2ZG6A 1XPJA 3W5CA 3NRJA 3ZX4A 2MU1A 2P69A 3QU2A 3M9LA 2YY6A 4CF5A 4KN8A 2ZBFA 1WZCA 4CE6A 2G1AA 1ZJJA 1F5SA 3PGLA 1YS9A 3NIWA 3MN1A 1L7MA 1YJ5A 2FPXA 3SKXA 3A1DA 2R8EA 1Z4KA 3WKAA 4OD0A 2C9MA 4Y3UA 3SD7A 3F9RA 4EEKA 2JAWA 4MUMA 4OFZA 3FPBA 1JUDA 1Z4JA 5ALSA 4NV0A 2NO5A 5AKGA 3WK8A 4UMFA 2WFAA 1ZRMA 2WM8A 3EPRA 3IB6A 5AW6A 3QX7A 3L8FA 4KNWA 4FYPA 1QH9A 3U7EB 3QLEA 2W11A 3RFUA 3I28A 3ZX5A 4YIHA 3ESQA 1ZRNA 1LVHA 1N9KA 1FEZA 3DAOA 4HGOA 5ALFA 2HF7A 2P11A 2HHLA 3HLTA 2WF8A 3B9BA 2IYEA 2I33A 4KX3A 4YIKA 2ZXEA 2C8LA 4CF4A 1T5TA 2CFTA 4UARA 4O8CA 3PGVA 4CNQA 2GFHA 1RQNA 5ALKA 4UMDA 5AKYA 1RMQA 3ZWDA 2G07A 3OCZA 2IA5A 2QLTA 2WF9A 2NYVA 1RQLA 1MH9A 2AMYA 5ALTA 3S6JA 5ALWA 5AM1A 2EAUA 4UM7A 4XQ0A 2PR7A 1O08A 3QNMA 5AVVA 5AW8A 5AVSA 1RKUA 4DFDA 1Z4LA 5ALJA 4BEWA 1ZOLA 4BYGA 2GO7A 2JARA 3QU7A 1Z4NA 5ALNA 3WK4A 1YNSA 3AR6A 2W4MA 2G06A 3ZWKA 4EX7A 3NANA 3QUQA 2GHTA 2HX1A 5AW3A 3ZU6A 5JJBA 5T41A 2W43A 5AK6A 2GMWA 1SWWA 4HGRA 4C4RA 2I55A 2B1QA 1NNLA 4UMEA 1Z88A 3KZXA 2G09A 2HOQA 2G0AA 2YFYA 2B30A 5AM5A 5AVTA 3N28A 3NASA 5AKJA 3QXGA 2EARA 2MU2A 5ALUA 5AK3A 5AVZA 3WK5A 3WGVA 1TE2A 3E81A 3SLRA 2WF6A 2ZBEA 4G63A 3WKDA 4HGQA 4BBJA 3B9RA 2I54A 2RB5A 2B8EA 3A1CA 3BWVA 2ZBGA 3AR3A 1NRWA 2FUEA 5AI9A 5AK5A 4L6CA 2YJ6A 3AR7A 1VJRA 3HYCA 2IOFK 4Y2JA 3L0BA 4Y2XA 3OCYA 4HAIA 2FPSA 1AQ6A 5ALMA 2OBBA 4I9FA 4Y2RA 4PNHA 5AIBA 2IOHA 4BNDA 5ALPA 1PW5A 2I34A 3BA6A 2RBKA 5AI8A 3WKEA 2AGVA 3OTQA 5ALRA 2YMQA 1QQ7A 2C8KA 1X42A 3E8MA 4Y2SA 2AUTA 2O2XA 5AKEA 3EF1A 2JAOA 3KDPA 3W5BA 4Y2YA 4QQFA 3QYPA 4BEVA 3U7HB 2ZOSA 3U7FB 4QJBA 4AS3A 3SKYA 3U7GA 3U13A 3UMBA 5ALQA 2WF5A 2B1RA 1YDFA 2YJ3A 5AVUA 2NO4A 1Q92A 2X4DA 3OCWA 3L7YA 4OCZA 4B6JA 2Q4RA 4FE3A 2I6XA 2Q4TA 4F71A 2YMPA 2O9JA 3KOOA 5AW1A 1Z4IA 4KX5A 4UM5A 1L7OA 4AP9A 2QYHA 5AM3A 2CFRA 3L1VA 2PQ0A 4ZEVA 3CZ4A 4EX6A 3QUTA 1XP5A 1ZD4A 1SWVA 4MWOA 3K1ZA 3U26A 4UAVA 3QUBA 5IT4A 2D2VA 1WR8A 4KYTA 5IS2A 1L6RA 2R8ZA 2VKQA 2YJ4A 4I9GA 1U2SA 3ZI4A 4Y2UA 5ALDA 2HDOA 1J97A 4CF3A 3WKCA 3ZVNA 3UMGA 1QQ5A 2BDUA 3QU4A 5AKZA 3DNPA 4NABA 1VJ5A 1T5SA 1J8DA 1L8LA 3R4CA 1YV9A 2FPRA 5AICA 3ZUPA 5AHXA 3R9KA 4XOUA 3QU9A 2P9JA 3I6BA 1CQZA 2FUCA 3M1YA 2CN1A 4BKMA 2FPUA 5AI6A 3J7TA 2C4NA 5AW0A 3P96A 3N8GA 4RESA 4UU0A 4GXTA 1RRCA 1Y8AA 1YMQA 5ALVA 3FPSA 3AR4A 3FGOA 3N1UA 1U02A 3AR9A 5A3QA 2YMLA 3FVVA 4DCCA 4L6AA 1WPGA 4Y2PA 5FP0A 3QU5A 4UASA 5E0OA 4BX3A 1ZD5A 4BX2A 4HGNA 3AR5A 3AR8A 4UMVA 2HEGA 3WGUA 5AK4A 2BY4A 4YGYA 3SF0A 4YCLA 3ED5A 1O03A 3UMCA 4RETA 4BX0A 3IRUA 1U7OA 2ODAA 1RLOA 3CNHA 4NAVA 2FDRA 3SMVA 1L8OA 3MC1A 4C4TA 4IFTA 1VFPA 3ZVLA 5ALEA 5AI4A 3NALA 3ET5A 3EWIA 3WK7A 5ALXA 2R8XA 2HI0A 4H1WA 2BDEA 4NFLA 1IWOA 4ZEWA 3TLMA 5ALHA 5AI0A 2ZBDA 4UATA 4Y2QA 1WVIA 3FM9A 2B0CA 3KD3A 3N07A 3E84A 1S8OA 2FEAA 5AM4A 3DV9A 1N8NA 4UW9A 4HYTA 2I7DA 2RARA 3KBBA 2FI1A 3EF0A 3I76A 4F72A 3QUCA 3RF6A 3W5DA 1Q91A 5AVYA 5AKXA 1RDFA 1RPZA 5ALLA 3AR2A 2HSZA 5AW9A 2JGAA 3PDWA 3ZTYA 4YCMA 2OYCA 2HCFA 3ESRA 3WK6A 3QGMA 1CR6A 2YMMA 3NUQA 3E58A 3N5KA 4DW8A 2P27A 1L7PA 5AKIA 5A3SA 2GHQA 2FPWA 5AKLA 1S2OA 4YCNA 3ZVMA 5AW2A 1TJ3A 4JB3A 3A1EA 1ZS9A 1Z4PX 3ZTWA 5ALZA 1U7PA 3B8EA 3L0CA 1Z5UA 3L8HA 5IT0A 1Z4MA
chains in the Genus database with same CATH superfamily
3GIDA 3MJEA 9ICJA 3Q15C 4J2TA 1TJ5A 4FDLA 2R8JA 1CRLA 2WUFA 3M0EA 5BV1A 2VATA 3KCQA 1SELA 3ZDEA 2R96A 1ZL0A 1ZQZA 1Q14A 3GGOA 2BQRA 5GOZA 3H4VA 1NXVA 2JAHA 2CPRA 2C28A 4DCPA 1GEGA 2V45A 1WB6A 2I2FA 2NAFA 2ZIAA 3IUYA 3IR5A 4EP1A 3ER8A 4QFDA 1NDHA 5CB4B 3CRW1 3T9FA 4EG8A 4RLSA 3KLPX 3F5AA 3EXEA 4QUEA 4IQUA 4R2IA 1O6GA 3RS7A 4ASUD 4CL8A 4EW1A 2NU7A 3LBNA 4AYTA 1G1AA 4I4TF 4EYEA 2QTTA 1GKYA 1CIVA 1Z2EA 2I29A 2R8YA 2RGEA 4YI5A 1N5XA 2LYAA 3Q8KA 3L7BA 4XEHA 5D1HA 4YP7A 2IV3A 3A1NA 2GPAA 5C5EA 5HX7A 5L6MB 1WY7A 2XDAA 3K8QA 3SAHA 1VMKA 4FDUA 3GJ6A 3CRVA 3OX4A 3QVXA 4AX4A 2D54A 1BGXT 3W9SA 4HBGA 3I45A 4AURA 5KC9A 2Y6VA 1HQYE 2HJGA 3OLXA 3ELWA 2YZMA 2IYRA 4RULA 1TLTA 2FDXA 3DG9A 1O97C 2Q6VA 4MH0R 4B44A 2MR5A 2V0GA 3WB0A 4QFCA 1E3LA 3ASVA 4IUYA 1WBDA 8ICOA 2DUYA 4G3IA 5LMNB 4UAUA 4DEXA 2OZLA 5F7ZA 3BE4A 3MIIA 1PYDA 5IAJA 5IYZB 2P67A 3MGCA 1UJ2A 1Y5NA 3C3KA 1ABFA 1ZVQA 3N0XA 4EA6A 2YZ2A 5J3JA 1AUPA 1QHXA 3AKEA 3OJEA 3TM4A 1AKMA 4G9BA 2JGDB 2ZR7A 3L6UA 1QYIA 1FPQA 2HQRA 4HD8A 3I5UA 1CRXA 1OASA 1PG5A 5IBRA 3G2LA 3ZY6A 2GILA 3RNLA 3OFNA 1HQKA 2DERA 1Z2DA 1G38A 1EJ2A 1M34B 4QZAA 2QARA 1ZH4A 2ZIXB 3ZYCA 1V35A 3LHDA 5DSXA 4RPGA 4HDKB 3E3NA 4ER3A 3PDIA 1UKAA 2CHFA 2CEKA 3HCRA 3TRJA 1D7OA 2C2XA 2GEUA 2OBXA 4LZJA 1P72A 2QL9A 4BMXA 3A9RA 2RSLA 2EFHB 2WSYB 3GV0A 3B1ZA 1D9FA 2Y93A 2CGEA 1NVWQ 2BCJQ 4RHFA 3BAZA 4I81A 2HWWA 2CHEA 2CJPA 2TMGA 1FMJA 3EZ9A 2P8JA 1RKQA 3TTXA 1E77A 1CPYA 3QJYA 4KNVA 4NCNA 3UJPA 4YMLA 2X4LA 1NIPA 1T4CA 1TL7C 3UJHA 2BQ3A 2A0WA 2X2FA 1QTNA 1ZQVA 4DL4A 2IPOA 3O3MB 1XK6A 4HQOA 4Q16A 5GGXA 2B6HA 4B7XA 3TB6A 2C5LA 2D4AA 3OFSA 4UFNA 3WXMA 1TFRA 3KQLA 3IR7A 4MI9A 1JXLA 4RFLA 3PSPA 1DQSA 2A1TR 2Y67A 3E5RA 2JIZD 1Y33E 2CXRA 2D00A 5AYVA 3HTXA 5IANA 3T1YB 3HVIA 1X7WA 2JBAB 4QJFB 121PA 4OXRA 3HDHA 3K20A 1SRQA 3JWGA 1XQXA 2OBLA 9ICCA 3NBZC 2P69A 2ZPUA 1D03A 1UBEA 2IQIA 2V74B 5KNDA 5EWMB 5K3BA 2F3UA 1YBFA 2AQ8A 2P8SA 3B3QA 1KEPA 1JKIA 2NOAA 2YCBA 4BP1A 3L1JA 4GO1A 1Y9EA 2JRCA 521PA 5KOHB 3O03A 4DIUA 5DGAA 4NZNA 1E1CB 3IIKA 5A6SA 3PT9A 2E5SA 2SCUB 3PHHA 4HI0E 3PJDA 4LDZA 3SKXA 5I7OA 2UYYA 1UAYA 2WFZA 2A78A 2KN7A 2PBFA 4JHXA 1ISRA 1R37A 1J25A 1P2VA 2Q99A 2QMZA 2WEKA 2WNHA 3EB9A 2QVZX 3ECSA 2VWGA 3PCRB 4K5QA 5IAGA 3N2NA 3EZFA 9LDTA 2AZXA 3SX0A 1VHTA 4JI0B 3W6UA 3GRRA 3UUWA 1JUDA 5BOSB 4LIPD 3QNUA 4NATA 3FUWA 4CM1A 2PANA 1N4DA 1R4ZA 1XHEA 1QX4A 3OKFA 2GXQA 4I2VA 3EMVA 2Y1LA 5MF6A 2OO5A 4ZT3A 1FP2A 4IEFB 3U6BA 3FOCA 4KFCA 3R0IA 5DRTA 2NUTB 3ORRA 4WLEA 4DKJA 5BRJA 3OD5A 3TW6A 5KNCH 1KRPA 5KG5A 4M9SA 2OUKA 1E8MA 2W2PA 2OCEA 4PC2A 2LI6A 1OGJA 3H1AA 3ZX5A 1RBZA 3ESQA 1E0AA 4Z54A 1N9KA 4H1VA 5FBWB 4NF2A 3KTAB 3ZE1B 4G23A 4LZDA 3LM8A 4OB6A 2P11A 4S2UA 3TQSA 4FTWA 4BP9A 4B7UA 1H0SA 4I3FA 2KS6A 3NVKI 4G9GA 2PQMA 5ESWA 1H2XA 2HU5A 4WVFA 1A5ZA 2IDJA 2HUPA 2QENA 4PO9A 3QWIA 2BD0A 5CXUA 4ZAXA 4UARA 3YASA 5HKAA 5JWOA 1U2RA 4RQ6A 3U3JA 5P21A 2W8BA 3VPAA 2LKYA 3LECA 2KFNA 2Q7OE 2W2VA 1CCWA 4PPFA 2ZT5A 2WF9A 1GR1A 1RQLA 1L4HA 1BVYF 1O6CA 2R87A 4R2KA 1XTUA 4RMNA 3RLFA 1KRWA 5LOVA 1MIHA 4OSEA 1NQ5A 1T1SA 2DF4B 2HQBA 3PSAA 1OJ7A 1OF1A 3FROA 4G86A 3S8YA 4UHKA 4R0MA 4RTRA 2Y0EA 3D4IA 4ZJZA 5ALJA 5GZ1A 1KBZA 2XUKA 4O5KA 2CMFA 4D3YA 5F1YA 4DA0A 1Y37A 3OUUA 4ZYTA 1JWBB 4TV9B 1AQYA 2P2SA 2DVMA 2JARA 1HF3A 1QB7A 3K4PA 2A84A 5BOLA 3J7AC 2ADOA 3RYIA 4UDXX 2QTZA 2ASLA 2BFOA 3PFBA 1B0UA 4FK8A 5LP6C 4BNWA 4BDSA 2C00A 2HIMA 4UB8U 3HR8A 5I4BA 1XDZA 2FJPA 2OGSA 3BHJA 3CM0A 1ZG3A 3NANA 4QA9A 5F73A 4C0HA 5JXJA 1U2PA 4R3UC 3C1ZA 3IV7A 1I4WA 1T1GA 5T41A 1J5EB 1FW8A 3V6HA 3CR7A 3IODA 3IALA 2O5CA 3GJRA 1Z8HA 1KI3A 5A5GA 2B1QA 3T1VA 3K09C 2IPNA 3GA0A 5E6RB 1H2ZA 2RHHA 4DPKA 1L7XA 2X58A 2J0QA 5A0LA 5I7HA 2VZEA 5KFNA 2QORA 4MVJA 3Q8QB 2CNLA 1RYDA 4G8DA 4TPKA 3TMKA 3QNWA 4RPKA 2DECA 1S1CA 1PK1B 3OTIA 1MQAA 4H18A 4TKZA 5AVTA 4OMFG 4MYRA 5GJBA 3GRUA 4L8YA 2OC4A 4I27A 5DN6D 4FLFA 5ALUA 3AI1A 5H81A 5AK3A 4IUBS 2GRJA 1GGVA 3D59A 3E35A 4I5FA 5K0NA 4G97A 4QFMA 4EJ0A 1RHJA 3DHNA 3G89A 2J9YB 2LMRA 4JV1A 1VQ1A 4F3CA 2Y1CA 4II2A 1AK9A 1ONOA 3PNPA 1JIIA 3KHGA 3OWHA 5ELMA 3KQUA 1B93A 1UOPA 3IKLA 5AXCA 1FXWA 3D2QA 3AL2A 3ZHSA 4Y2XA 4INAA 5EA2A 4LF6B 1XEWX 4GDFA 1ZH2A 2QN3A 5LVAA 1VYVA 3EA4A 4M9NA 3IAEA 1LF5A 3A0RB 3ENQA 3ZV6A 5I48A 3ITNA 3WJAA 4A10A 1E2JA 2R79A 4E5NA 1AU9A 5D6OA 4M6WB 1C81A 3AW9A 5FTLA 1QQ7A 1WYGA 1VYTA 3BMCB 3N58A 1GPAA 2NWQA 2XB4A 2DH6A 3PKZA 4UBJA 2Q7XA 1P5JA 1P4JA 1UBFA 1TC1A 2I2BA 3AJEA 1PT7A 1DOHA 2JJ8A 2NUPA 1W9HA 1T6YA 4O4LA 1PWYE 1XZDA 3K3PA 4N5DA 1FSSA 3RVPA 2C61A 4B3CA 1CQJB 3PNVA 4RAOA 5GTHU 4GKAA 3A05A 3X2EA 1AQJA 2PFPA 3GT4A 3K73O 5BYBA 1BPEA 4S3MA 2A1JA 4MEYA 4WVLA 4ABTA 4IHJB 1M83A 5C8YF 4LF5B 1FFVA 2HBKA 3IYLW 4WW0A 2PGAA 2GEBA 2QPTA 3AJAA 3FR8A 5DI9A 2H7VA 1YB4A 1G63A 3C3DA 3HCDA 1LKZA 2WJPA 1RAGA 3D9QX 5EJ5A 1QONA 4IGFA 4TQUS 2I6XA 1U3TA 1UBLS 4XCVA 2XVZA 5T4HA 1ZBDA 2JFVA 2BFDA 3R5JA 2IOQA 4NJOA 3A1VA 3NR2A 4ZANA 4DHWA 1A9SA 2OZLB 4Z4QA 4KQWA 5K3AA 1JYFA 4O4IF 2C8VA 4XVRA 1KZHA 4UM5A 3W2TA 4ZGWA 1LLQA 1RRMA 2X7HA 1PF7E 2QB5A 3CLTC 2XQVA 4RBNA 4RVNA 2CDAA 1G98A 3P2MA 3CB4A 3HHPA 3Q2KA 2Q1SA 2R751 5KFTA 1SKQA 5EWEA 3TLZA 1PL7A 5DYIA 3HU3A 4EBCA 3LSTA 2C99A 4TQRA 2RLTA 1PL0A 3DE1X 3VYSB 4Y1FA 4EUNA 2YWFA 3C1AA 4UAVA 1CETA 2FP4B 1T26A 2XQGA 1S4MA 3CT6A 3ORFA 5IT4A 4E46A 4QO7A 1N5RA 1PP4A 3G9ZA 3RSOA 2FMUA 3ESYA 3KKLA 1DKRA 3O91A 4W9NA 4N49A 2OXRA 1HEUA 3IVRA 4DL9A 4DRXB 4P81A 3ZGXA 1MHTA 3WOVA 5DBFA 2QS9A 4DXHA 2HLNA 3CEAA 2PEYA 1SIOA 3NFRA 5EIOA 5ADVA 2BDUA 4YMWA 3BIXA 4JLMA 2XCIA 1A9QA 4JI3B 2IPAB 5C5DA 1GL6A 1R2QA 2E89A 2HSDA 3MOGA 1SY7A 2AMLA 5D3MB 3TDKA 3I62A 1M8GA 3T5BA 3TKLA 2NU9A 1Z0JA 1QYVA 2ANBA 2ODBA 2YV5A 3GRAA 2GRAA 1K8QA 2Q6KA 3DULA 5BNZA 2PMCA 1QBKC 3NHFA 3R5XA 5JBNA 4JI5B 5J8YC 1P91A 3UNXA 2O0JA 1E2KA 3M1AA 4ENQA 4KMRA 1E7QA 3NTRA 1VE9A 4MA5A 4CTJA 4OXYA 1GGNA 2JJ2D 3A10A 1C7IA 4ZWNA 3IN5A 2CE7A 4XGRA 5IAOA 2GF0A 2PWPA 2OCAA 3LGSA 2DFDA 2QMOA 4QDTA 3HNRA 2XXJA 3N8GA 4E4YA 5EWFA 5B37A 2HZ7A 3OX1A 5ETJA 4RIGA 2JAQA 5JEDA 3COJA 1KSPA 1F1JA 2FMKA 3W6ZA 1DBQA 4B3TB 2YX1A 2Q4OA 1R88A 2OD9A 3IV9A 4B2PA 1KK3A 1U2GC 4OQNA 3ZKWA 2FJUA 1XBTA 3C1YA 3S2SA 4ZZ3A 1EP9A 4MYDA 3N1UA 3QEMA 2E3TA 1ZMTA 3AR9A 3ONDA 3SZRA 4I2GA 1SRRA 1I2DA 2YMLA 1YBHA 2XX3A 3NXKA 4ZAGA 1XZMA 3OEHA 3X43A 4EMUA 4IR1A 1JFVA 1PNOA 3CF6R 4RCVA 4XM2A 2FWRA 8AT1A 3DFMA 2A86A 3D0KA 4PNPA 3ZTTA 2XWBF 3IUPA 4KKXB 3UOGA 3UH1A 2A30A 1NR5A 3K1RB 1EQAA 1V9CA 1WPGA 1WDKA 2JCBA 3NS7A 4NE2A 4YD1A 5KYUB 2ZB8A 2YYZA 2WKPA 1DIGA 1W87A 3NWPA 2E87A 2RI6A 4FSDA 1XRJA 2PUVA 4KLFA 2GDJA 2BY4A 2GM9A 4JODA 2CXYA 1VJGA 2XEDA 3VKWA 1SD2A 5CG1A 7ICSA 2BGLA 4W82A 3AEVA 5L3RA 4EJ2A 3N5CA 4NCIA 3IKTA 1E5QA 2UYHA 1FP1D 3EXIA 4RJLA 5JBQA 4KLCA 5KL8B 3ZU3A 5F51A 2CXUA 3RVJA 1WCYA 4RCYA 3SF8B 4UVHA 3SIWA 4CI0B 1ZP6A 2NACA 1GZ7A 1ZQDA 1ZQKA 2ATIA 3G1UA 4UKDA 3ZVLA 4C7OA 4LY3A 1KEZA 3K2BA 5DGBA 3IDQA 1MZPA 5HNKA 4EMBA 4MS3B 4H1WA 2IX3A 4EI7A 1WW8A 3C15C 4EB6B 2JZBB 2YY5A 3HGMA 5CBPB 5KOJB 1OPRA 1IN4A 1KZ4A 1G20A 5EZYF 4RD6A 2HSWA 4AKTA 3IPLA 2J7PD 5KQMA 3IVCA 3IBSA 2PRSA 2AZTA 4A3SA 5B7NA 2VCEA 5B1YA 4YP1A 5KWEA 4XWAA 3JRXA 4CM3A 4NYJQ 1ZQCA 4JY7A 1QO0A 5BV2P 3AOEA 1TK3A 2HNAA 1KKMA 3REFA 2ASJA 3SK0A 3E4DA 5AM4A 1YD7A 1DAIA 2XE4A 1H1TA 1XTQA 2KTQA 3A6KA 3CUEF 4MJ3A 4RSHA 1M34A 1WBJB 2QIPA 3ESZA 5T4FA 3VPSA 4AN4A 3PTLA 3E9CA 4CV3A 2O6LA 2X4IA 2R86A 1REQA 3OEEA 2WHYA 4RDCA 3FFAA 8ICVA 2FPOA 3O0TA 5TPWB 4RZ2A 4B3HA 1VKZA 4XW2A 4EL0A 4LG1A 3O2NA 4NL9A 1VSTA 3BWEA 1T0JB 2YHIA 4HLDA 3BK1A 4PO3X 1I1HA 1N60A 5C5JA 3RRHA 1P2SA 1ATZA 1Z75A 1OBOA 2QL6A 2CWDA 4MAAA 2G04A 3UATA 3AQFA 4G0UA 3P32A 4GBMA 2YMMA 1GO2A 4X94A 1ZM7A 3HSYA 2YVLA 4LN1A 5IUKC 5BSEA 5L4SA 2H1RA 1MCZA 5C7IO 4N5NA 1H2BA 3HB7A 4AJ2A 4C78A 4LMAA 5FAXA 3MMSA 3MPUA 4MUXA 1ZQOA 3RK4A 5AP9A 1DRUA 2F62A 2Z3VA 1PZEA 3GNSA 4DS4A 2QX4A 3R7BA 2ZTSA 1EIZA 1YTLA 2E85A 3BD8A 1F38A 1PG2A 2OPHA 1TXGA 4DVJA 4ETWA 1OBHA 1P73A 3BA1A 5CXQA 3FYSA 4KPUB 1FVOA 4PFSA 3QEAZ 4S0ZA 2W54A 3SYTA 4OLFA 4MVWA 5HQTA 2VP0A 4J0DA 3ZI7A 4ER5A 3P0EA 4OI2A 4IRKA 1VMEA 2QW1A 1JDVA 2WTUA 2NTVA 3GVPA 2KJQA 3KQYA 5DN9A 4FVTA 4N76A 2EZXA 1THMA 3NRBA 3MCUA 4N6OA 1V8PA 3KJXA 3DAYA 3K6RA 3OZCA 4LZZA 3VR2D 2RC5A 4IBOA 4N65A 4ZCTA 4B4VA 1JMSA 3OCCA 4BRWA 3PDCA 3ILSA 5DISB 2Q49A 2PL9A 4K6CA 4C6RA 2DFLA 1JDJA 3I1FA 4DWWA 3HDYA 2W2LD 4LSZA 2RBGA 1YAJA 3LE8A 4NBWA 5T14A 1KKUA 4PZDA 2DQZA 2QDXA 3SEZA 3U7IA 5BORA 3QKTA 4JI4B 2MSNA 2I7CA 1G0NA 3K92A 2IV2X 1EU1A 1SXJC 1S7GA 2NXCA 4ZOLA 2C29D 1GRQA 5DM4A 1Q7CA 4EGJA 2QXYA 4Y2VA 2IHYA 3UK1A 3VPCA 4PGYA 1G9XA 4OQMA 1G4AE 2DULA 5EIHA 1YZ6A 1AHIA 5TARA 4G36A 4WSOA 2C7BA 3HS3A 3QMMA 1KMMA 2VA3A 4MJXA 2YQZA 3ZNNA 3M8KA 3J81k 2VCHA 2QRNA 1HT2E 3EDMA 4A7PA 4UULA 4L5YA 5J2KA 1MEEA 4IRMA 5EMMA 4V1CI 3PIIA 3AEKA 2VP4A 2I2AA 1SC4A 1MRZA 2WIGA 2K4EA 3AF6A 4F6CA 3OOSA 1TVKB 4J03A 5L8VA 3BMNB 2ZSKA 4QX6A 1JDBC 3FZQA 2CFCA 3LX5A 2PI5A 2QJTA 4OQLA 5CTAA 4DXDA 4FMPA 1MXHA 2XSZA 3ITDA 1TPYA 2ORIA 2P7IA 3OZFA 4GQBA 4LDRA 3T54A 4DJAA 3F74A 2QMQA 3NX4A 1YL5A 1QFXA 3EXFA 4NFSA 4MQLA 3GXBA 4BLVA 2DL0A 5CR0A 2V54A 3UT5B 1X2IA 5ICEA 2VAVA 1XEFA 3HKBB 1I3LA 9ICXA 3GP5A 2H4JA 3O1IC 5ADWA 3GXOA 1K86A 1Q1QA 1SD5A 3C4JA 4RY8A 4CUJA 4C7YA 1T8PA 1UPAA 1WUHS 2PWZA 2RHGB 3K6JA 6ABPA 4B9LA 5K9ZA 4Z3DA 1SL2A 1J9EA 1E3QA 3IQDB 4TLAA 2F2AB 2UXBB 4X1KB 4GFJA 5ENZA 4IQTA 4RQMA 3V7WA 2WHEA 1B00A 3LQYA 4QGBA 4Z0HO 1FNSA 2Y76A 3REQA 2JCGA 1RU3A 1B41A 4MS3A 2UVUA 1RE0A 3T5HA 1P2UA 4GMXA 4C4SA 1JQJC 3KKMA 4CLRB 1XRMA 1GRRA 4W8HA 4WWHA 3QW4B 2HCRA 3OF2A 1ZCFA 3MCVA 1HDYA 1NNI1 4IG9A 3GJ7A 3HJTA 3UZUA 4J9KA 1UQRA 3I6ZA 2OA0A 2XE8A 4X1OA 2Y0CA 2RCNA 1OBCA 4KB5A 2J3LA 3RAJA 2I2DA 3FUVA 5YASA 4BLOA 1JKJB 1W4ZA 3D4LA 3QI7A 3BHNA 3D2SA 4MDYA 2V6BA 1DJNA 3FFBA 2I4OA 3V7KA 4N7BA 4B9SA 4XYLA 5FYDA 1L3UA 1EK1A 1Z34A 2FFHA 3UT6A 4UU1A 2PK3A 2OYRA 3WZLA 2EX4A 1LUAA 3C97A 1C0KA 3JYQA 2VP3A 4MGKR 5H70A 3ZX4A 4G0YA 2ZUTA 1RAAA 3UXHA 3QU2A 1ZH0A 1W0KA 1ZI8A 2JLBA 3HADA 4CF5A 5J2CA 1ZAKA 3PL5A 4TXHA 2XVTA 5CITA 2AFIB 4KLSA 1GQ2A 3MRSA 4MLPA 3PU6A 2IFTA 5FA8A 3W9UA 4RCZA 5JAIA 1GITA 1QO0D 3X2SA 2CJWB 1E9CA 4ML3A 3WOHA 3RVOA 5KT3A 3H75A 3OC6A 5TGZA 5TRTA 3UKJA 2G67A 4PX9A 4Z4EA 4M0AA 1O97D 1A9ZA 3K9BA 3WKAA 2Q0XA 2EAMA 3SI8A 3GFRA 5FL7A 1QGOA 3G8CA 2QPLA 3CCCA 3F9RA 3LUPA 3DHWC 4YAEA 5EN4A 4EO9A 5JSFA 5H80A 5FOTA 2GXSA 5BY2A 2F8MA 3TQ1A 1PQWA 2VJBA 2XUFA 3UKOA 3A3KA 3QG5A 3LC0A 2HYIC 5H5JA 1ZIDA 4MGEA 5TQ0B 2WFAA 2YVUA 5K01A 1EHYA 2WY2D 2O8VA 2WM8A 2QMYA 4W1PA 2XUPA 1Z00A 4V0SA 3U37A 4A0SA 5LQSA 4IIUA 1JSXA 1A2KC 1U94A 1CRWG 5EJ4A 4QWDA 5K7SA 5KX5F 3OQIA 3QKRA 5FBVB 3UN1A 1PCXA 1O3YA 2VJPA 2ZFUA 3EVGA 3ZIUA 4DDWA 3VNAA 1PUXA 4KO2S 2B4RO 1GL7A 2RGUA 1ORHA 3VMMA 4ADSG 2X9GA 2YL2A 3DL0A 3ZZ1A 3N0WA 4RYDA 4DLBA 3ONWA 4RWEA 3RUEA 4FYKA 1Z5OA 1SUCA 3P97A 4DADA 4E21A 5TC4A 3NHBA 1LDGA 4BB0A 2WB2A 1SQSA 4EUKA 3L40A 4TL7A 2PKYX 3FSEA 4MP8A 4Q93A 1TT5B 3A1TA 3C70A 4QUJA 2YCLA 4O8CA 3UH0A 2JI6A 3VYRB 4D8WA 3IDOA 4U9HS 2WM3A 2XAUA 3T5AA 1V16A 1OWNA 1Q16A 5DE3A 1R4MB 1H9BA 1PVPA 2WHPB 2JEFA 1RI1A 2PV7A 2VF5X 4GEGA 1P7VA 4GRDA 3FPLA 3P2YA 4GQAA 3M1IA 1F8GA 4MK4A 3ZE6A 2ZTDA 5JPCA 5E7JA 2W42A 1FS6A 2GN2A 1DWPA 2X42A 4PNEA 2JLSA 1A71A 1ACMA 1IDN1 1WD7A 5AM1A 2EFDB 5EI5A 1E92A 2CBGA 3H3XA 4X95A 5DBIA 2LHTA 5AW8A 4G9EA 4W5HA 4WZAE 5THXA 1NV9A 1SO8A 2BEUA 3AMZA 1KBUA 2DM6A 4BCBA 4RMHA 4JX8A 5BP7A 2ZIGA 5CR9A 4QOHA 4OPMA 4BE4A 1IOLA 5IIOA 4UREA 4G1FA 4CFZA 5MN5A 1W7AA 2P4HX 3JALA 3HVRA 4R7ZA 4ZEMA 1EFHA 3WK4A 4B82A 5E6UB 4JT4A 3TDMA 2VUUA 3M4ZA 1Z82A 3TQFA 4YAGA 3B6IA 4QDXA 4BO8A 2B78A 3HKDA 4DA9A 3NYQA 3BE8A 1EGMB 4KO1S 1BMQA 1ZINA 4P7FA 1UZUA 1E79A 4I2HA 5KTOA 1DOAA 2I4NA 3F6EX 3CCBA 2LE0A 4KXYA 2I55A 5K6AA 3DXZA 3CQ9A 3CONA 3MTIA 4IZIA 1JXOA 4LHXA 3M3DA 4RMIA 4AG5A 1RZUA 4UMEA 2J6UA 1M5UA 2ZTVA 3PEFA 5AJUA 1PFYA 5TMEA 3RUHA 1SKYE 1II8A 1UKBA 1IEWA 2IUFA 2GHRA 4J9UE 1BDBA 1W5FA 4EM6A 3PW2A 5AD1A 3HB4X 2HA3A 4IJKA 4P53A 1PHRA 1XKQA 2ZKLA 3DPSA 2OMKA 5AVOA 4EVIA 5KFHA 1R9MA 2CLHB 1L0BA 2BEWA 3BL5A 4HJXA 4BNTA 3E3MA 2IP1A 2HWKA 2JFXA 2UUOA 4MVJP 3TNJA 3OMXA 4HGQA 1L4NA 1IPEA 1S0NA 1UBHS 1V3TA 2FEPA 4UAGA 1M1YE 3RKUA 4ESEA 1LS6A 2QLFA 5BSRA 1KJNA 1XIVA 1U7UA 4LCEA 4BWFB 4JWMA 2PGJA 4UUNA 1QH8A 3I92A 5HQ3B 2EBFX 5TGDA 1L5RA 3LL7A 4KHZA 4H3HB 4JLPA 1EIWA 1VTKA 3KKQA 3OE7D 4PY2A 1SD1A 5HF5A 1E5VA 4X92A 4F21A 4R71A 3L0BA 3ICXA 1K98A 4F4DA 5K8IA 3O9MA 5I4CA 5ES4B 4ZT2A 3ZGVA 4EHFA 4WN3A 4LYGA 3ZK7A 1C8LA 2IWHA 3R7WA 4TRJA 1SVMA 4RSGA 2GN4A 1DAFA 2QX6A 2GA9A 4WN9B 1Y9JA 4LJXA 4BX9A 3U60B 5B2ZA 4AIRA 2H5JA 3C4VA 1CKEA 5BR4A 3G9TA 3OJFA 1UFRA 3EIEA 3U7HB 1Q1BA 4EJSB 1RYBA 3CSSA 5A3VA 2WSBA 5ARDA 3U7GA 1YULA 1QV6A 2CNDA 1TTQB 3JPRA 2WF5A 1AN9A 1ZU5A 2FQ1A 1LPPA 2O50A 2XUAA 3GWZA 4MWCA 3IHWA 4LXYA 1ZMRA 3KQMA 3SVLA 1E2MA 2NUAB 5C8DA 1V5IA 4KQMA 3OZGA 3TRKA 4AUEA 1EESA 4OCZA 3TL2A 4CLHA 4I50F 2IBTA 2H18A 4N18A 1I3CA 1YJQA 1PLKA 2KK0A 5FA5A 2R44A 2H4WA 4P8RA 1TQ8A 4RF3A 4DOCA 1Z1VA 3I9V6 5A1TA 5HQJA 5IWCA 2AFIE 3ECAA 3KJGA 1LDMA 1PK3A 1YASA 2RC6A 3R3XA 3HWTA 5ER6A 4NOMA 2WICA 2Z9DA 3KAQA 3OIUA 3P9KA 2FLNA 2H3ZA 4LYFA 1K5OA 4MGHA 4CI9A 4R7TA 1S3SA 4I1IA 2IGTA 3AF5A 4HKTA 3GOQA 1SIWA 1YJ8A 4MLDA 3SM3A 4CT5A 4ZVOA 1SWVA 2R85A 1NX6A 1DNPA 2C07A 3EXIB 4MRVA 5CDYA 4W7IA 4BO7A 5DNYB 3DM9B 2QGFA 5CVEA 4Y6GB 2JJQA 3ZJVA 5G40A 5MFZA 1NN1A 2REOA 3FOZA 1KQPA 1M72A 2R6GA 3HJUA 3S44A 1MFZA 1XB2A 2MIIA 2WA2A 3GCXA 4R0VA 2WNIA 2I1VB 2FETA 1MJNA 4ZOEA 5KTTA 1QU2A 4QWMA 1N6OA 1XCMA 3HHEA 1OIVA 1CBUA 2YHBA 3FSJX 3FNGA 3HWRA 1YUMA 3HBNA 3QU4A 2H3FA 1JI3A 2C2ZA 1WOMA 3MJVA 4HDMB 1LTHR 5PNTA 5CEEA 3EARA 2JLWA 1B7GO 2O05A 3AEXA 4B9VA 1J8DA 3OZBA 3URMA 2BGMA 4MEBA 3JW8A 4NBLA 4RD2A 1X9SA 2ZB2A 5FWYA 3OLQA 2C57A 3T94A 1QHHA 2FCRA 4P3XA 3EODA 3U49A 4DPMA 5AHXA 2I99A 4NJEB 2P0AA 1NKCA 4LGVA 4QZVA 4RZRA 4JOBA 5FWAA 1YS6A 3PQCA 5LP6B 1V39A 2AHOA 1QHIA 1A7KA 3A6FA 4E1VA 1WCNA 2O6HA 4I19A 2GAAA 2LWIA 3BORA 3IUSA 3DYIA 3LT0A 2QUKA 3LYLA 1G9TA 4ED1A 3I9OA 3NVAA 2HA5A 1ETHA 4G0PA 2IEIA 5CGQB 5FEMA 2ZYDA 4KAJA 4KYIB 4PTLA 3P94A 3TSCA 4D3ZA 2BHLA 5LXTB 4GRAA 4JQSA 3UWDA 4BIIA 2VP5A 4HXGA 1WCLA 3SPXA 1DXSA 1S4QA 4WT7A 1O9BA 5DHTA 4G3XA 3SYLA 4YCSA 3VUEA 3B3FA 5EOZA 3DE2X 4DLYA 1Z25A 421PA 1YU9A 2JZOA 2Q6LA 5EHNA 4F8YA 1QHFA 2FW7A 1LPBB 2LCFA 1AQUA 3FYUA 5BNFA 4D7AA 4CEJA 2XUJA 3NRZA 1XA4A 3EJWA 3H0KA 3KZKA 4RKRA 5KKNB 3D31A 3WLKX 1XU7A 4YRAA 4PGXA 2IZOA 4E94A 5IKXA 1FFYA 1U1FA 3GAFA 4A5OA 1MNQA 1ZUNA 2P6PA 2RONA 2VSXA 3JD2A 3BT7A 2QPAA 1TCVA 2AGOA 3KL2A 3SYNA 2G5CA 2NQTA 1WU7A 4FI3F 3EPIA 1E4EA 4TSFD 4BQSA 2JJYA 1WSDA 4GYWA 4RKFA 2ODEA 5EQDA 3DKRA 4Y9RA 4ER0A 4TQAA 4HTFA 3WGUA 2GM3A 3AETA 1YSCA 3NYIA 3GCZA 2JLAA 2A9VA 1GU0A 3EDRA 5CH5A 5EVCA 1QLHA 4GRIA 4L73A 3FGPA 4RETA 3K0CC 4C6TB 4QGHA 4C29A 2FEOA 4CIVA 2DKNA 4D6YA 2RGCA 5T57A 2PL5A 3MWLA 4HWPA 2QTHA 2FDRA 3PX4A 4KWEA 4UHFA 3P20A 3ROPA 2VRCD 1W4BA 4BWYA 1DADA 1VC2A 2ZATA 2BCRA 3KHKA 4QU5A 2B92A 1HBJA 1U3VA 4GLJA 1WP4A 3MUEA 3ET5A 3P9IA 4YAUA 1RXWA 2XDYA 4JJGA 5BWNA 1W6UA 1KI9A 2VNHA 4DILA 2EZZA 1IM4A 4PZ0A 5I9SA 2NMVA 1RJFA 1LVUA 1KWKA 4L74A 2X1VA 4DR4B 1T9BA 4RKWA 3EE6A 2WC1A 1TLFA 4DEVA 2BEVA 1F4VA 4Q05A 2UVRA 4F5RA 4TV8F 2R1ZA 4M3NA 1FU8A 5DLPA 4F38A 4ZRMA 5I3CA 3HP7A 5ITVA 4BMCA 1FS5A 3VNVA 4JUZA 2XCQA 5JANA 2KICA 3EXG2 3ZWCA 3H4BA 5I7RA 4QZ8A 5EJ2A 5B1SA 3ROFA 4FYHA 5J47A 2GJAA 3ORHA 1LWOA 5DASA 1Y4UA 5BWCA 2WUEA 2P5SA 1CDEA 1BS2A 2PLNA 1FVXA 1N5JA 2NV6A 4ALIA 1B26A 4R84A 4UW9A 5F21A 2O2SA 4V3BA 3S28A 3KT3A 1SBYA 3A9UA 3KBBA 5HJ2A 3SAFA 1E6LA 1RM4A 4EUHA 2MYTA 1GN9A 2FUG6 1F2DA 2V6FA 3OEHD 3JQEA 2R6ZA 4O2BB 1WXIA 1Z3EB 2JMGA 5CLLA 4Q02A 3RO7A 3UJ7A 5AVYA 3JPOA 1AD2A 3SS8A 4OQDA 4FZLA 4HZIA 3SICE 5E1BA 1Y7IA 1PZMA 3AFOA 1ZRSA 2ZUBA 1KDTA 3JQ6A 4MX8A 3ZTYA 4DCOA 1XCOA 1POXA 2F3TA 3V72A 5KFGA 3QGMA 4AZSA 1CR6A 2YHUA 4I2EA 2VJDA 4XDZA 3HWX1 3SEFA 3N5KA 4P4MA 3IS3A 1SZCA 5BURA 1YF3A 4MPRA 3NEJA 5DBAA 5DVZA 2F64A 2W8LA 5A9SA 1N2CE 3IIJA 3TN7A 4GM1A 4B8WA 2AOTA 2ZXFA 2YFQA 1JJFA 1FU4A 3LBYA 3R8FA 2V0NA 2WIJA 3HFSA 1CHNA 1IY9A 3CMMA 4LWOA 4NKRA 1Z13A 2AQHA 3B8EA 1JVNA 3DXFA 3OECA 3TE6A 1RZTA 1ZETA 9ICHA 1MV8A 1XELA 4C0JA 5DHAA 4KFSA 2E21A 4DUPA 1N1MA 3H2YA 9ICOA 2IZ1A 3O94A 3OU7A 4UB6U 1ND5A 4D9IA 4MR7A 2J7KA 1C7ZA 3CZAA 4XYEA 2DQSA 2VBFA 4MI6A 3AF0A 2ZR0A 2QY6A 3ND8A 3H7IA 4V38A 3RGWS 3V4OA 4DKXA 5HRAA 1CJMA 4S05A 1XV5A 1JF8A 2BFNA 1KVTA 1JHXA 4LEIA 1KU0A 1RR6A 2YY7A 4QPPA 1WPRA 3VPFA 5LA6A 4JIGA 1W73A 2J3EA 3VYVA 1SC9A 3LQRA 2Z2XA 2C2DA 4LBVA 4FFNA 3TZKA 2AS0A 1NKVA 1XSPA 2AT1A 4TMVA 3G2NA 2PD4A 3H9QA 4ZA2A 2LVBA 3O4VA 4NMXB 1GZ6A 3NJ4A 4XXHA 5AVQA 4JC5A 4I9UA 5LOVB 3BVPA 3ZDBA 5EMNA 1V8BA 1X2BA 4X20A 5BO5A 3LLSA 2RGNC 1JAXA 5NULA 2SKDA 4OJYA 1D3AA 4H17A 3CW2A 5AK0A 4FR2A 3UVEA 1GUBA 4X97A 5AH0A 1Z19A 3EASA 1JG1A 1SVLA 2JI4A 3BXZA 1C1XB 2H5IA 1MBZA 1XJ5A 2EBHX 2B1GA 2LCIA 4PFKA 4R8VA 4A91A 3K94A 4YJDA 2D6FC 3D6JA 4WRRA 4FIDA 3TADA 1PD0A 4M9GA 2VJ5A 1Q74A 5KT2A 3HN6A 4S04A 3IUNA 5CT8A 1B1AA 2NSJA 2F2TA 1RRKA 1YVDA 2GTIA 2Z98A 1TT7A 2OP0A 1S8NA 2BF7A 2ZJOA 2ZYVX 1NT4A 3EAFA 3I42A 4HSGA 2FKAA 3DVRX 4LHVA 4QOSA 2HDNB 4WBNB 3UG7A 5BN3B 3B9PA 1HNNA 5IPFA 3DZCA 1C3EA 3RS2A 2E4WA 2NX2A 4HJRA 1TTTA 2IS6A 1SXJB 1L4YA 3OPXA 1SQFA 5DEOA 1JTEA 1M66A 3GLIA 5FWXB 1TX4B 1VJDA 3HXTA 3OE5A 4RGQA 4BQEA 1DMRA 1BVUA 3OCVA 1JYSA 4M89A 1SVKA 1V7PC 2L69A 2V7XA 4REQA 5DBHX 3SBDA 1LK0A 4L57A 4B3JA 2VL7A 1P5FA 4TLCA 4C6HA 4F4IA 2KVCA 1PK1A 2F59A 2OO7A 5FJJA 5C0YA 1Z45A 2QTMA 2GZ1A 1UJ4A 3RROA 2IS1A 3F6YA 1ZQYA 2CDRA 4GX2A 4YRCA 5J2UB 2AW3A 3CINA 4HLUA 2C9DA 2QE7A 3Q8RB 4S1VA 1N2ZA 4WQMA 2VWQA 4EIWA 1TKAA 5DB7A 3AF2A 2QVXX 4AQDA 2XNDA 4H0CA 4N9QA 3BQ7A 1Z5GA 3G49A 3QZUA 1H85A 1KS9A 5JDCA 3PUKA 3V8QA 3GZFA 1GQRA 2A8YA 1V5FA 3BZBA 3F49S 4DS5A 4XPZA 5AVWA 3FPEA 4IQVA 3R7DA 5C81A 3K8OE 5CTJA 4BNFA 1B22A 3RF7A 3F5FA 3L0PA 5F5LA 3PFNA 4YPOA 3ORQA 1Z4OA 2YB1A 1ZN8A 3VGJA 3JAMA 3G7UA 3MABA 2JAUA 3I37X 4Q9DA 1JSCA 4G0NA 5TE9A 1AQIA 1BEZA 1Y5RA 3OZIA 4NH0A 3CTMA 3AEUB 3LPNA 2AG1A 4BZWA 5IJZA 2C7VA 4OHCA 3C3YA 2PZGA 3GRPA 3FE2A 3E9ZA 4AU1A 2WMYA 3BJIC 2ZRGA 2QD5A 4DL7A 3C45A 3CHYA 1OAOC 1K88A 3JZFA 3LQ2A 3T0GA 4CEIA 3PYLA 4EHJA 3AETB 2OBMA 3HNPA 4FT4A 4BE7B 1C3LA 1KKXA 4B9NA 1M6HA 1IQRA 1ES9A 3S1SA 2O6KA 3KOWA 2ZRQA 1XMVA 3BRWD 1A8UA 1ZJJA 5E4YA 4RJTA 5FOQA 4RJKA 3W5VA 3ABQB 1I6KA 1TKCA 3KVRA 4CEIB 1WM1A 1T2FA 3KDAA 2JIDA 1W0CA 3M70A 4R2MA 5H7XA 1ZVJA 4W7SA 1NK4A 4OUDA 4TUYB 2OAGA 2W8KA 1IQ0A 3F1LA 4NU5A 1ZUIA 4QQRA 1RRFA 1NVEA 2QYOA 3VNSA 3OT1B 2DY0A 1ZNZA 3I73A 1S1MA 1MUUA 3FYUB 1OT3A 1J1IA 5ALSA 1SJ9A 4RXTA 3ZDCA 4RYLA 4KFUA 4E7OA 3GCDA 2HLDA 5CB8A 2J48A 5JU6A 1BQ3A 4HWOA 2CKMA 1Z5WA 4RD0A 3VV3A 2Q2OA 2P4SA 7ICMA 5T3YA 3LF2A 5JZBA 4UOEA 1G5IA 4Y7DA 1ZQRA 1Q84A 4AZ0A 4I8XA 4RQ4A 4L4UA 2YXEA 2P35A 4KXNA 3A6PC 3PE3A 2H1SA 3EZLA 4JS0A 1GZ3A 3OEYA 3H3JA 4KXLA 3BJRA 3GRZA 4NI5A 4Q3KA 1DV1A 4DLSA 1BH6A 3CU5A 3P1JA 4WNCA 5ALFA 2XTNA 4EO7A 1TAQA 9ICRA 4OHKA 2WF8A 1EFDN 2FV8A 1EVIA 3PW0A 4I4TA 4KR0A 2IYAA 5K3CA 3ROKA 3A6HA 4F3KA 1ECBA 5L53A 2XNJA 2QPOA 2B98A 2D6FA 1H3FA 4XWWA 5E3JA 1O6BA 4YN3A 5JISA 2PQ2A 3KYCA 4I08A 3NBQA 4HUQB 1HK7A 1H42A 1KJWA 1NUPA 1XLTA 2VQ6A 3CW2C 3HVHA 4B80A 2P77A 4B3IA 2HBYA 2RGNA 5EINA 2P66A 1CLEA 1W581 1LB2B 1CVRA 2QLTA 1L7EA 1IMJA 2Y0DA 3AG5A 4LWPA 3T5MA 4AJOA 3IE0A 4ZMRA 4D99A 2AMYA 4XX0B 3S6JA 3AH8A 4HFJA 3X1ZA 2EERA 4TYPA 2G83A 2JFPA 1PS0A 5A9SB 3F71A 2YOFA 1B0PA 3PMLA 1C0LA 4UQOA 5AJZA 2OD2A 4DSNA 5TDHA 4Z7OB 2QX7A 4DL3A 2HM7A 2F17A 4EPYA 4OGWA 4I1RA 3GZNA 4JT8A 4RIIA 2QL7A 3SYKA 4YMHA 2E1FA 1PT9A 2BZ1A 8LDHA 3D64A 4NMLA 1COWA 1W4AA 5PGMA 5UKDA 1E18A 2ZTMA 1YIOA 2Z8ZA 1JSRA 1UBKS 2EV9A 4JENA 4QNRA 1YNSA 1EFAA 3NCHA 1DJPA 2J3HA 3I8SA 3I9MA 4JC4A 3ICCA 2P9QA 2W48A 2DR0A 3MDAA 3C6MA 3P9RA 3EBPA 4LMRA 3ZU6A 3PQ8A 5E8RA 3QF4A 4RM2A 5JXGA 3AY7A 3C6YA 2VUHB 3NBKA 3L4BC 1P4AA 1XQ1A 1ZMBA 2C9ZA 3GLTA 3FTNA 4L75A 4NSNA 4F4KA 2GXUA 1CERA 3BGWA 3L8CA 1CUHA 4HMQA 4C5BA 3PJEA 3K2EA 2JW5A 4IHJF 2JRZA 4YQFA 5C8YB 7REQA 5CJJA 3TDNA 2WIDA 1JKMA 1NK6A 1R6TA 2RDIA 5G2OA 1EFPA 3ZHOA 3D4NA 4GR5A 4LYJA 2JA2A 3VYTB 1NTOA 2WPDA 3GA5A 3MLEA 5B57C 3NASA 2YS7A 1CXZA 3G5UA 3WMWA 4WXRA 3VC2A 2VUSA 1RAFA 4OBBA 5JALA 3I4LA 2WZCA 1DEHA 1XA0A 4RE6A 2GWHA 2NUPB 2PA0A 3S81A 4O02B 1UPTA 3OOHA 1KFJB 1TZKA 2R6AA 2I54A 2PR2A 3NUGA 5EYPA 3QKUA 2W6ID 3IKVA 4HUTA 1FPMA 1PT5A 1NLZA 1PEKE 1WSAA 3OLWA 5DIFA 5KTNA 4C4OA 2DSTA 1I7DA 3IIMA 2RG7A 3ZHBA 2YX8A 2XR1A 3ETGA 5G0VA 1BVRA 3VJRA 3V8MA 3FOAA 4E14A 1G64A 2FWIA 1P1RA 3C5GA 1U0NA 3RRYA 2JH3A 3KXPA 3DZGA 4JJ6A 5JFTA 1GNTA 1H0HA 4W99A 4HTFB 4AZTA 1Z7WA 2OV1A 3W77A 2QW0X 5MGBA 3K0HA 2YN2A 2P6UA 1KO4A 4R1OA 4WTOA 5J0SA 1SU7A 1P0PA 1DJMA 3A06A 1GY8A 1KL7A 2LGJA 2ZUSA 3WZMA 3R20A 4GICA 4DLZA 3Q2OA 3M9MB 1R5JA 2HIAA 4C4XA 3TI9A 4AQYB 1FDIA 3NAQA 4D74A 3NDIA 2DG2A 4YAOA 4O9MA 2BSXA 4JSYA 4D0NA 1OUMA 3KT0A 3QIAA 4D9KA 1NF8A 1Y1RA 4WASA 2DR3A 2XUGA 2WOJA 3PRKE 3DLTA 3QUAA 1P75A 3N0TA 4DMFA 2XD4A 1EVLA 1PFQA 2H4FA 5KEIA 2B5VA 1P1KA 2MTBA 4CLOA 4KLIA 3GYBA 4ENWA 4PQGA 1XRLA 1WHTB 2ZIUA 1Y8QA 2HJWA 4TLEA 2ZK7A 5IJXA 3L7YA 1FYVA 1V6SA 2R6FA 4U7CA 2R4TA 4ZU3A 3SC2B 4M55A 1P39A 3IVMA 3VYUB 3H4TA 3BSFA 3ILYA 3WGMA 3OP1A 1IBLB 1E79D 2ON6A 1AS0A 2C03A 5HILA 4RU1A 3DOJA 1DIRA 3QH4A 4RA6B 3HDQA 2MSWA 3H83A 3SZMA 1AB5A 3EMKA 4OXQA 1DUVG 3TJMA 4JKIA 2QW8A 1JDPA 5KFJA 3LBHA 2C4HA 1KE2A 4DJTA 5IF9A 2M1XA 3DHVA 2BN4A 4IV8A 3QVOA 4KN5A 4B6EA 1PGOA 4TS9A 5H8WA 4RSMA 5KNBH 3GD5A 2Q62A 4XDHA 3RVKA 3WXBA 1OHHD 3KELA 1EJ6A 4GG1A 4XGKA 4Y6LA 3SKVA 4MW0A 5K8VA 1RBYA 3I3OA 4MLCA 5I9BA 3V34A 4JN6B 3H6KA 4KFRA 4NAHA 1NLMA 4F2DA 5DM0A 3RVLA 3RBXA 4KYTA 3UMJA 2B20A 2IKSA 3AX6A 4G4SO 4L8GA 1KIMA 3Q3IA 3WLFA 1PFKA 2H92A 3DZFA 3OOYA 2W8ZA 1OTXA 3TD9A 1AKWA 1NBOA 2AG5A 2D0DA 2HDOA 5CVDA 1MGPA 9MHTA 3PHGA 3L3BA 4HRXA 5EZ6B 3PWSA 4RVDA 3UV7A 3HLYA 1QQ5A 3DNPA 3I0NA 1YGYA 3RVRA 4L08A 2W2QA 4NL4H 2MR6A 3VMFA 1B6GA 3QEMB 3P0RA 1WCIA 1IUOA 1S2IA 1IXRA 5B6JA 5EERA 4QIWC 1BC5A 1GTSA 2X23A 5AJXA 1RM3A 5LKAA 4MUKA 2LD4A 3LFHA 4NYMQ 3WIVA 3WNDA 3RAQA 4DA7A 3K5HA 2CYCA 5F1KA 2ERCA 5LQCA 1ZSNA 1VGVA 2JD2A 1N3YA 3M6ZA 3HBMA 2XGQA 4PC3A 1W5BA 5KC8A 1OVMA 2FPUA 3CW9A 1EUQA 3P8ZA 4K1LA 4MR7B 3DGEC 3OIVA 4DLUA 4KVZA 2ZSAA 4QPNA 3DVLA 4Z53A 1O54A 2DUJA 1P4RA 1JLKA 4RV9A 1C9EA 4G0XA 1K68A 4EJSA 4K9NA 1K0UA 3RE1A 2X5NA 4QQNA 1RRCA 3CXRA 4Q6BA 4EJMA 1P81A 2RHTA 2IU4A 4B7ZA 4D3XA 3I2IA 1V85A 2O2DA 4PFQA 3H4IA 3QLUC 5EJAA 4GMDA 1BO6A 4I5EA 2BMFA 3AFIA 5JAPA 5K03A 3HN7A 5F33A 2KIWA 1EUZA 1ZQGA 3BDAA 3L7DA 5FUWA 4PYNA 3M8RA 2F7SA 2WJIA 1G0OA 3JQ9A 1ECLA 4UBCA 2BKVA 1KYXA 4G81A 5DNUA 5B7GA 5DZSA 1IPFA 1JIHA 3IMEA 5E0OA 4ZCLA 4GWGA 2WWGA 1L4FA 1GTJ1 1I51A 4ED2A 2YTUA 2JFHA 1XCBA 2VDUE 2ALZA 2ZJZA 4AZ3A 2X76A 4RMJA 1D07A 2VHEA 2W2NA 4UMVA 4W9NC 4YX9A 4P4PA 3OQPA 4YGYA 2QN6A 1XDSA 3UMCA 3A36A 2JA1A 2J9ZB 3M2TA 4DA6A 3SMQA 1DP4A 3MRXA 1FFXA 3FTDA 4GZ5A 2BYTA 4WESB 3THYA 3SQXA 3QXJA 4PWZA 3KPWA 2EAOA 3M3PA 1ODKA 2V58A 4EPRA 3ILXA 2X8LA 4B8YA 2PH1A 3FMFA 3RIXA 4W5JA 1RQGA 2KNJA 3RS4A 5C4GB 4XD7D 3PQ3A 2BZFA 5T67A 5ALEA 3M33A 4LV8B 1FRFS 1GYPA 3NALA 3EWIA 3PYXA 4MP6A 2OFPA 1YRWA 1TW2A 3RVMA 1U5AA 3O8CA 3CRRA 2HI0A 2X6TA 4FFVA 3QI2A 4G5RA 4NFLA 3H8WA 2HBJA 4NY8A 3I2GA 2C78A 4ACBA 3PFCA 4CLRA 9ICQA 4TSRA 3TLMA 4W5OA 3LK7A 3VDRA 3OX3A 3WLTA 3F97A 1COOA 5J2AA 1TAMA 4ILEA 1EZ1A 3DPIA 4ZTBA 5DDYA 2PTHA 3E22A 3TNLA 4KE8A 1XDDA 1DVRA 3TRHA 2FVYA 2LDXA 5EP2A 1YZGA 1T5BA 3ZNQA 2CXXA 4ZU1X 1OKKD 4DSAA 5HR6A 2BM1A 4KLGA 1U3CA 2Q1XA 3EZ2A 4GOJA 4JP5A 2J41A 5FNZA 3VKFA 4K6GA 3K6SB 3V3KA 2BP7B 1GZDA 3GDFA 2FYTA 2BEJA 1P61B 2YZKA 3MS7A 4J1NA 4BMNA 2PS1A 4X1YB 1XMXA 4I4NA 3RH4A 2REQA 4O5AA 1DC4A 1JG6A 5AOCA 4CG1A 1UAGA 2ZIEA 4C1NA 3E7WA 3KZOA 5ULLA 2ZVPX 5IILA 2GAIA 2NU6A 5BN3A 2DXIA 4C8MA 3NT2A 3TF5A 4HB3A 4AUNA 2C2WA 1DPGA 2ZJBA 4CLEA 3IMCA 4FNOA 1R12A 4WKGA 1JIJA 3OTHA 1YQGA 2QU7A 2GPNA 3W0LB 4ENVA 1KQGA 2BPGA 4CIDA 3E58A 3QBDA 1V37A 3G8BA 4O2RA 4JR0A 1NM5A 3ZK8A 3T6KA 4MQMA 4CCWA 3GEDA 1G19A 4CKWA 3KQHA 4QGSA 3ZI0A 1SEPA 4WZBA 3OE4A 3WG9A 1KIFA 2WRZA 4MIYA 2H16A 2SICE 3JWEA 3QPWA 1TNDA 3RR8A 1NRXA 2A9OA 4EJ6A 2WIKA 4GX0A 2JF0A 3L0CA 5EUCA 2O8DA 4YFYA 4C89A 4H7KA 2EZTA 4OHMA 4X6UA 1SL0A 4CDGA 3TTVA 4MYTA 4GXKA 1XLWA 4OHFA 5FFMA 3UWKA 1IHDA 1LC0A 1TTHA 3JQRA 5H16A 3VYWA 5H3LA 5D4BA 4MSUA 4RTNA 1MJGM 2IEZA 2EGHA 3LBAA 3HXQA 3A4VA 4WOKA 4M0DA 1ZAYA 2ZBQA 1FYFA 3EG9A 4ZEXA 2XXBA 1C7YA 5TQ2A 4FBMA 1J0EA 4GHWA 5I8PA 2HVIA 3A2MA 1IZ7A 2O0KA 4MFCA 5JPDA 3USZA 1W85B 5DHFA 4CNBA 1GPLA 4ZCRA 4Z9BA 1IB0A 3KAKA 1S8FA 3OAAD 4X00A 2FSPA 3A3YA 3TBKA 5A5VA 3KLNA 1WTCA 4WCVA 4OTZA 3ZHRA 4LYHA 4WLNA 4IGIA 5IK2A 4C03A 1E0KA 3W7VA 1UH5A 2GVDC 4YJHA 4C4ZA 2QT9A 3VJLA 4BJ1A 2IBSA 4RLFA 3GZJA 1Z38A 4QRIA 5E9QA 1OFUX 2J3KA 1BS9A 5THKA 2YRXA 3LRTA 3O4JA 3VZPA 2H17A 1CS0A 3BGVA 3ZGYA 1ZJ6A 4CXMA 5T6MA 5LLDA 1F4PA 3T3HA 3RBEA 1T5DX 3H0MB 1C2YA 4TKMA 2JVJA 3F4LA 1WSWA 8ATCA 2EF1A 1PZNA 2AEMA 5IEBA 3E2EA 2O3QA 3S1LA 4IIEA 2JEIA 4QZEA 1B6RA 3ZQ6A 4OHPA 2W22A 4NCBA 1G6OA 5L95A 4B6QA 4HGZA 1IXSB 2FU5C 1E2FA 4GOKA 4MHOA 3MT9A 1PFWA 1TA0A 1JX6A 3ZCQA 4GIBA 3JD3A 2QVCA 5TVKA 2Q9BA 5TS3A 1N2HA 2C0PA 3DUFB 1P7PA 1WHSB 1NVTA 2AIRA 5IINA 2JFQA 3KB1A 3TLJA 3UUFA 1N2CB 5C8XA 1V3QE 3WKBA 2XIJA 4OI4A 3L8EA 4DC1A 3AM1A 2D13A 2HT6A 3TOXA 4O2BF 3OF3A 3N2LA 1S97A 4O4HF 2QQEA 2X7JA 4DLRA 5J0RA 2Q4BA 4AKSA 1K9VF 1BW9A 1O0SA 2HNKA 4PINA 3VKVA 5J5VA 3NYWA 1PFGA 3NHRA 4NENB 1X8JA 2ILVA 4X1IB 1WNFA 3VOAA 4BVEA 4F2RA 1OA1A 3L8ZA 4POAA 4YO7A 3UJBA 3N7RC 3ND6A 1URPA 3VH3A 4I46A 1BXGA 2W37A 3ZDZB 4AS2A 2VDMB 4IIXA 1USVA 2WP0A 3OA0A 1ZQHA 2JBWA 3OZTA 4DR2B 3H42B 4DV6B 2C31A 1RLUA 2IJGX 3GJZA 4ZV4A 1I7QB 3RDPA 1TYEB 3QELA 1N5LA 1KEJA 5K1ZA 2NRWA 4IJWA 4V24A 1VG8A 1YQUA 2ODTX 1QQAA 1HKHA 1AC5A 2CUKA 3GT0A 3T3GA 3UT5A 3FCUB 3R3WA 2ZJYA 5FT9A 4EEZA 1KKLA 2IYWA 1QK4A 1DBIA 1XEXA 3FLEA 1WMSA 2HHQA 3EQ9A 3HBLA 4UPEA 5C4MA 1Z12A 4UTZA 4QXQA 1EQUA 2HDWA 2BZ0A 3AI2A 3NIFB 5CA0B 2E5FA 1RIFA 1C9KA 1JE1A 2FFAA 5JUMA 1Q0RA 1U6JA 2ONZA 5CYOA 2V4RA 1ZQ1A 1FDUA 2ZUVA 5EKTA 4CBVA 5I7SA 1YT3A 4JXZA 1K6MA 5KAFU 4ECQA 4EHBA 2PT6A 1P9RA 2QR5A 5H83A 4ASUA 1KQNA 3PSIA 2VJMB 4OP3A 2PZJA 2Q8PA 3COPA 3RR2A 2G77B 5KT5A 2QD3A 4PPNA 3L8MA 3NBXX 3QK7A 3LTEA 3UQ2A 1K06A 2D7DA 2LW7A 1B3RA 1I1OA 3V5NA 1WXEA 2PH3A 3I23A 1BU8A 5LCXA 3R7NA 3VU9B 1XSEA 4MPDA 4DPLA 4KLHA 3PXXA 4XKJA 4ZVQA 2CDBA 5JAUA 2YYYA 1XO1A 1C30A 2P3SA 4UNNA 2MINB 1XWIA 1X39A 4N9WA 3EOAI 4G1CA 2Y8EA 1HOTA 2CMHA 2XD9A 2XCUA 1N63A 4GLXA 1V5GA 4ZOQI 3KKEA 2GPTA 2KFZA 1SCNE 1ZRMA 4OK5A 4UFOA 1WW3A 4XJSA 4HQLA 4MUFA 3EHEA 3NAGA 3ZHCA 1T35A 2ILTA 3EG5A 4PX3A 4BMYA 5K5EA 2RGRA 1KYVA 4PLTA 4KRYA 2WUGA 2HMYB 2M9MA 3GBPA 4JVOA 5CURA 4AP5A 1JAYA 4NFHA 5EPUA 3I28A 1O58A 2ZIXA 3N86A 1P1CA 2CVPA 4DL6A 3DBHA 3PC2A 1P31A 2QL5A 2EG5A 1I2MA 4UM9D 2VDQB 4J91A 3TIIA 1HLDA 1JEQA 2G9ZA 4K28A 1X1SA 3ZE0B 5L7WA 4QZBA 1KQOA 3D1VA 3S8EA 3FPHA 4X7RA 3FHTA 3H99A 3QY9A 1YC5A 5DJ5A 4UD2A 2O1SA 3TR5A 1ORVA 2H8KA 4RTJA 3S55A 3QOWA 5LZ4A 2WZBA 5IDWA 3BTSA 2VYQA 4R83A 3G85A 3ROTA 5F2EA 3WBBA 1QZXA 1FUIA 2WLSA 1G2QA 1XTTA 2XITA 3NKFA 1HQCA 1UL1X 1V11A 3AXTA 3QBTA 4FIZA 4WERA 3VH2A 4ER7A 4GL2A 2GYYA 3WMEA 3AYZB 2QGNA 2F3QA 4L3VA 2UZIR 3IT1A 5EZYB 4DIFA 6REQB 4QW9A 4ZREA 3T4UA 5KAIU 5U9CA 2GUGA 4M38A 3GC6A 5DT2A 2XADA 4DV0B 3ICPA 3HN2A 2J4DA 3ZZUA 4F5PA 4CKWB 4WZAA 2PMBA 2Q7DA 4YV1A 2VBCA 4J9LA 4HOYA 3QVSA 4S1OA 1SC6A 4FGWA 1HT0A 3LH5A 5CVUA 4QTYA 1U1DA 1FK8A 4I9NA 1PT8A 2HLHA 2Z30A 5J9FA 4UQGA 3WGQA 3RJKA 1UFQA 2P2LA 4IF6A 4WBSA 4A8JA 3EXHA 4N8DA 4G5YA 2ZSUA 1K2VN 1KFKB 2XWPA 1GNQA 3OFKA 1QHYA 4IFIA 1NVXQ 5HS4A 5CCBA 4ZJPA 1TT5A 3DSRA 4K9QA 5KTYA 2R11A 4TTJA 4WOBA 4KODA 2B2CA 5EFZA 3VRHA 2BFDB 3MTBA 4GXIA 4KK4A 4OAOA 4RABA 5DNAA 2PXCA 3SBXA 2HVHA 4YR9A 3EW7A 3AEUA 2RGYA 3R3UA 4Q3AA 4XIGS 5K0SA 4LF9B 4C0WA 4HAWA 3WLOA 3PTAA 3EZXA 2D5BA 1U80A 4LZNA 1OX5A 2V9ZA 1T9GS 5AOBA 4ZQBA 1CY4A 4WFQA 5HM8A 1IN6A 1OSNA 2IU3A 1CI4A 3IPXA 5HA5A 2HA6A 3T5GA 2JLVA 1WOYA 2YFYA 3E7XA 1GUAA 3F90A 4IV0A 3OPNA 3QVVA 3PR5B 3GGDA 3GRVA 3GUVA 3AQ4A 1YS1X 4LJYA 5JZMA 1DBRA 1XJCA 2UUAB 5AJHA 4LKOA 4XTRA 1KGDA 4D96A 1UOOA 2R48A 2ODWA 5FWXA 2IIVA 4OAPA 1KF0A 3OQOA 4JITA 2AWOA 5JI2E 4U3JB 3IOBA 5BRAA 2H0QA 1AZTA 2GCOB 3ETEA 4UBIA 4TYWA 1QF9A 1BNOA 4PGGA 1W88B 3DZJA 4IL5A 4JBHA 4KPUA 1P0IA 2BKXA 3ZUGA 2AC7A 4P98A 1A1SA 1UZAA 3C6XA 3W3AH 4MQFA 2Z1NA 2FY8A 3CJQA 3REGA 1P2BA 1UDWA 4LK2A 2J85A 3IC5A 5B4UA 2FMPA 2ATEA 3BFKA 1NR1A 4K40A 4L8LA 1KAGA 4ED9A 4OATA 2ZJ2A 1WG8A 4KGVA 5KINB 2B3DA 1PQYA 3WYCA 2KZZA 4HAIA 4YMNA 3BMNA 3QE2A 2C84A 5ALMA 1HE4A 2ZIWB 3ILVA 4KACA 3BHIA 5B53A 4NMWA 1QFYA 2N46A 5JSZA 1KP2A 4PL1A 2W8BB 4B4UA 5JXWA 3DT9A 5FV4A 3AO0B 1TCUA 2MSDB 3BCHA 5ALRA 2EKLA 4HB4A 4DDMA 1E9FA 1PUJA 3FVWA 3UJ6A 1Z0AA 2TS1A 1RWQA 4LW8A 4PYOA 1FRVA 1ZYUA 5CVJA 2F4NA 4DQXA 1Z2OX 1NZFA 4DMCA 4CEHA 5U4QA 3UV6A 3H04A 1Q7TA 4UTNA 3W5BA 1BIFA 2GX6A 5JNWA 3QYPA 4Q03A 4BEVA 13PKA 4H1HA 1NKTA 2YIJA 4P08A 3IG5A 1PQ4A 4C7VA 3CF4G 5JVDF 2K5UA 4NP6A 1O2DA 3EQ8A 2NO4A 2XMZA 2CLIB 4TRRA 4CUKA 3QBJA 5BN4B 4O3QA 1Y3CE 4U6QA 4XSGA 4JA2A 4Q7KA 3E6AA 3NWBA 2QLLA 5HG0A 3FPJA 4RO0A 4BMZA 1YOVB 3R0VA 4FB4A 3DL4A 5ITZA 3KSBC 2VH5R 2OFWA 2FZ4A 1H6BA 3F7NA 4MV3A 3OZAA 1SU6A 4Y9SA 2CF6A 2OL4A 1NU8A 1T3HA 3RODA 1DKLA 2DTEA 4QDUA 1P7YA 3K0SA 1H2RS 1MAUA 3WP0A 2AD1A 5HWSA 5E6RA 1NY5A 4RQ2A 3FKSA 4ZAFA 3V1NA 2J4FA 3FI9A 3NVMB 4TV9A 4KSCA 5H68A 1MX3A 3MUFA 1IY0A 1ZD4A 5GGYA 2OG2A 2BW0A 3NU1A 3LA8A 3EIQA 3IEVA 2WZQA 4KUHA 3SF8A 2JASA 1P2TA 1U0TA 4P3OA 1QR2A 1QSGA 2C3PA 3T7SA 1JPUA 3PNKA 1ULAA 2PRIA 2COUA 3CTPA 2YJ4A 2DB3A 2W70A 3ESXA 2H0AA 3REOA 2OHFA 2WMOB 3V7LA 4ZVNA 2LYBA 4K3UA 3P9ZA 3H2IA 4HNAB 3RV4A 4HAOA 2GJKA 2VLIA 4TVOA 4YYEA 4EHAA 4NICA 2E8OA 1GYRA 1QFZA 4KQHA 4ZTZB 4FLMA 5CM8B 2F43B 5D8DA 4TXMA 3DDUA 1MJ5A 3MXTA 2W2TA 1X92A 2BCQA 4RKYA 2VH1A 4F3RA 3R6GA 4FSXA 2XMQA 5FBRB 5FPKA 4ETNA 2ZP1A 3PXAA 5I7FA 1UJNA 3HJEA 4PAOA 2F48A 4UVGA 3JD1A 2B8TA 5G0SA 5T4BA 4A0RA 4ARAA 5KYXA 3ZVKA 4EABA 2O8FA 4NEHB 3FN4A 3K32A 4PC1A 5IVIA 4G8CA 4BNJA 3VXKA 1EE9A 1QPZA 2YWEA 3WL5A 3ZIAA 1U3GA 3KB8A 5A4FS 4Q9IA 1NX9A 5FPQA 3I6IA 1LV5A 2DYKA 3D5TA 2HWUA 3DPUA 4X1YA 3S40A 2BR3A 4GOLD 5HGXA 3SYZA 1WUTA 1XF1A 2CHQA 1EAMA 1SOMA 4KI0A 4DT1A 3B1VA 4J9NA 1KQQA 1RWNA 2J5RA 2QTVA 3ZXXA 4IIHA 4K9KA 2W3SA 4JNKA 1GM5A 3WRXC 4BXOB 1DJLA 2E4UA 3IKMB 2WABA 3PNQA 1Z8DA 3U4IA 5K8TA 5HCNA 4J76A 3AJ9A 5D49A 4XQEA 2Y9PB 3H5NA 2CLOB 3AONB 4FGZA 4IIGA 1T43A 1RXVA 5HUJA 4JWKA 3RYCB 1VCNA 1XTJA 3GEMA 3IAXA 4IVRA 4NYIR 3T1TA 1C8KA 4MVJG 5EQTA 3TKAA 3IA7A 4ZEOA 4D42A 1T2VA 3HSKA 3Q4GA 5DMXA 3IQWA 3P0JA 3RTBA 3W2IA 4GZ6A 4B0PA 4ZYWA 1W30A 3RGGA 1U65A 3AUOA 4G1UC 2QYTA 2DY1A 2JCSA 3QYAA 2W71A 4XWKA 4QBHA 4D4GA 2D1FA 2FEXA 3KIPA 2CK3A 4O08A 5IJ9A 4PHCA 3WGZA 4JBWA 3GLGB 4BO5A 1QTMA 2WPDD 4WKBA 3GDOA 3IHQB 1BVHA 1YE5A 2NO7A 4F4YA 1EI9A 3LCRA 1UT8A 1N9GA 1WCV1 4DREA 2HCJB 2FGKA 3VKGA 1XMQB 2C3MA 4NLBA 5BOMA 1WB5A 3HMQA 4I6JA 2DPYA 4P6VF 1ISIA 3EULA 3NAZA 4YRPA 2H2GA 1Y1SA 3STHA 1N56A 2B36A 4YQYA 2PKQP 1CFJA 4TM7A 5EXSA 1N5IA 4NAVA 1FDRA 4CTMA 3HPQA 3GLGA 1Z74A 2RDJA 3N76A 4D4KA 3VTZA 3G6WA 1TECE 2ZYWX 1JHYA 1TZMA 2YYAA 1IJBA 3KKAA 1C9NA 2NIPA 3ABOB 3CLVA 4O4LF 1MOSA 2ICAA 5GMOA 3ZXUB 4OQ4A 4AS1A 4YFKA 1Z6ZA 3PO4A 2FKNA 2WAXA 5L1LA 3IESA 1NBHA 3ER6A 1BXRB 1JT2A 4H60A 3WDKA 2QQ5A 3FB1A 4RQBA 5DSZA 3LK9A 1CW2B 2YV4A 3ZE8A 1CY8A 2QZSA 2PZEA 1QZ3A 2NZ2A 3EA0A 5LZ2A 2WMNB 4M04A 1OI4A 3GMDA 5I5EA 4BMDA 3EK2A 3FX2A 4OOEA 2AVNA 5FOVA 2HL6A 1GFSA 1OWLA 4YJFB 4EHKA 2IXBA 3HXOA 9ICEA 2B0CA 3Q12A 2OECA 2VLBA 5MGNA 3MIZA 3STTA 5L51A 3AFGA 4K9SA 4E5MA 3DZ8A 4ZO9A 2HIGA 2O0HA 5DCLA 4J7AA 3ZHUA 2ZU0C 1QIFA 4BBAA 1NBMA 2AMJA 2G9RA 4IIJB 4TTRA 3ZY5A 4DY6A 3UMMA 2N0SA 1J8QA 2ZXIA 1T8WA 2Q5HA 4Z1OA 1B23P 1VHJA 3LG2A 3Q7SA 1GTMA 4FKZA 3VNBA 2O7NA 2FP3A 2Z5GA 4WAUA 3S29A 4U2DA 3G6KA 2I67A 5AKXA 2BTQA 3AM3A 1JJ7A 2P2DA 2YXDA 3AIIA 3SEAA 2WU0A 3JYPA 4I4LA 3TFRA 5IN5A 4JA0A 2A67A 2D3WA 10MHA 1T10A 3AU9A 4LF4B 5I9NA 2P5TB 2R1VB 2JVIA 2Q07A 2P30A 2GZRA 1V8FA 1QGUB 3CNNA 1DE0A 4HXFB 4KMMA 3RFFA 2B5WA 2GNPA 1NE7A 2F8KA 2APJA 2G5IB 4QELA 3WQQA 3LL4A 5BQXA 1GKKA 2YWDA 3NEPX 4JLUA 4OL0A 2GHQA 3CLRD 1PAUA 5AKLA 5BW4A 1AUVA 3ZVMA 4IF4A 2AE1A 2L0XA 1WLYA 2YR0A 4NNOA 1RXIA 3WLMA 4B46A 1Z4PX 3KSAC 1V1RB 5DBGA 4ZKEA 1EXVA 4ZTUB 4P2GA 5EHZA 1JYEA 5A1JA 2DFTA 4MP3A 2G36A 2N1BA 4B2IA 3PVXA 1GADO 1Z5UA 2BI8A 4R6WA 3V4ZA 5CA1B 4I0WB 4G89A 2O2CA 2DHQA 1ADJA 3I04M 5AW5A 4QRDA 1RKVA 5C1DA 5DTMA 4KIFA 5CHGA 3I2KA 1C0EA 4UFPA 1R8XA 3EEIA 1RMYA 1CDDA 2C9BA 1TEXA 4GBJA 2BVNA 5ECDA 5IZCA 5HFAA 4ED8A 1RYMA 3TD6A 3EPLA 1DCTA 3ALRA 1RCTE 1T1JA 2CLLB 2E7ZA 3OOWA 4NZMA 5D85A 4OGLA 1NZDA 6PFKA 2BRUC 1V9PA 2DUUA 4HADA 4O1HA 1D9ZA 2C8JA 2WHRA 3KEMA 4B5LA 4BMOB 4F5EA 4HVLA 4WK0B 2PKRA 3H16A 4K8RB 1U2DC 3SR6A 1YHYA 4F9GA 1TUBA 3FKQA 1YR6A 3ACDA 3JATA 5BRNA 4BQPA 4DL2A 2OXEA 4E7PA 2OGWA 3SXUB 3PEUA 3ZHYA 2PBZA 2D5IA 3A1FA 4HEA1 1MC5A 1XZ8A 4HH1A 2BFCB 5AIAA 1NVKA 2HRBA 2VYNA 1JXQA 4PS0A 3D2LA 1HTBA 7ICKA 4HFMA 1GOTA 4CF6A 4IG4A 4RIFA 3HXKA 2JDIA 4JGGA 2R6DA 5DOZA 1DAHA 3WAKA 1P0QA 2FK8A 1MRNA 4BFYA 3PXEA 2X9VA 4FCCA 3OQVA 4M36A 1DLIA 3T1NA 2M0NA 4ZHQB 3KEGA 3ZWOA 1U0LA 3EUWA 1UPXA 2G5GX 3TMAA 4EL5A 4E13A 1CNFA 2PD3A 1NULA 4GDMA 1G41A 1NJ2A 4IICA 5SZIA 4Z6DA 4N3GA 3SSNA 1XPUA 1IY8A 4KQKA 2K4PA 1Q77A 2ZIVA 1ABEA 2PLAA 3T79A 2AJLI 3MBIA 3DNFA 3V7JA 2XA9A 4R1PA 5EKXA 4B5KA 4EG5A 1H4QA 4JJFA 2GASA 1P60A 4PLCA 4CIYA 4ZT4A 4PAQA 1NW4A 2J9FB 2Z57A 1WQ3A 4ZOBA 1SCDA 4L28A 1IZZA 1BWRA 4OHYA 2B5OA 3RAEC 1A77A 3MOIA 3O3CA 1FQOA 3QWHA 2ZUEA 2G9VA 2W9MA 4F06A 1ORTA 1JT9A 3FBWA 2ZUCA 4PLWA 2A9JA 2FG6C 3UJDA 3W4KA 1LRLA 4S12A 2CC2A 1V25A 1MH1A 2WJVA 3CSUA 2J87A 3RTEA 4F5DA 3EPKA 3RYHA 1B42A 1QANA 3NVYA 3CYMA 2EFYA 3LT1A 1D6SA 5ABPA 2CK3D 3B2QA 3CNLA 4ALMA 2H00A 2O23A 1K08A 3I09A 2ZQZA 3OBBA 1U3FA 1M2OA 4TUQA 3A14A 3DQZA 2RBEA 4Q9LA 1OV4A 3OCUA 3S8MA 1QK3A 1X80B 3CC8A 1LWNA 3MBYA 1JQDA 2A5JA 1QC5B 3PP8A 2KYRA 2G4LA 1PV2A 4UCWA 4UOZA 2EL7A 1N61A 1LDYA 4YP9A 4N0QA 3O92A 4QYTA 1OFIA 4D4MA 4CIAA 4DB2A 4ARUA 4ECVA 1L7NA 2XTJA 4EGSA 5DQHA 2EP8A 4B3GA 3X1KA 1X7ZA 3BWBA 3CPHA 4HWGA 2X0FA 1M8JA 4F6RB 2QR2A 2HJVA 4TMXA 4YT8A 3R9IA 2JIZA 4ZCMA 4EGFA 5HOQA 2IEGA 3E03A 2UUBB 4XIFA 2IXEA 2JGRA 1LBSA 2Y9MB 4R5MA 4WZ6A 5J0YA 1XXHA 1X13A 2EWWA 4AJPA 5KMGB 3I2JA 4I2AA 4XZ3A 2F1HA 3EQZA 2IUTA 4IOKA 4LNUB 3RK1A 3Q6NA 5J5AA 2JK1A 3SJZA 5AJTA 5FI3A 1GAQA 4KV9A 2GKOA 3MR6A 1LRKA 4IRXA 1J06A 3SR0A 1KO5A 2PUCA 3CZCA 3PF9A 1IXZA 1RVDA 3OPVA 3SLGA 4TVSA 1KTIA 1HDGO 4B4DA 4DR7B 4CMBA 3LPLA 3SS7X 2QP4A 9ICFA 3R5KA 2XXAA 2JKYA 3R6TA 2NP7A 1SG9A 2BV3A 2NNWB 5CXXA 3B3AA 4UUOA 4UZEA 4GXQA 5A4DA 4EUFA 3OOJA 2D06A 5JNRA 4YT4A 3A1SA 5GV7A 2FG7C 3MS4A 2ZYAA 1NGSA 3K9CA 4FDAA 3TSZA 4BZPA 4G1MB 2X8AA 3MUNA 4K03A 2C9MA 5DX0A 4V1CB 5HDQA 1NJ6A 2D1QA 5JR3A 5KU1A 1DAPA 1F8FA 4V0ME 4AJHA 4M7RA 4HVAA 4GW3A 3AHHA 1ECCA 4RPXA 1TF2A 1P2GA 2W2XA 2WI8A 3K31A 3MS2A 4WLOA 3S0JA 3UC5A 1SKYB 1V47A 1S77D 1GSOA 4LXIA 4P58A 4YRFA 3EPRA 1C3OB 3IB6A 1RJWA 4RVFA 3W1EA 4K2HA 2XICA 3SDSA 1DK2A 1HM5A 1CUUA 1T13A 2ZRJA 3ADKA 3KUUA 4I4TB 4OHWA 4B48A 4JYZA 5F2OA 5JS2A 3TCKA 1LPNA 4Z6FA 1WXXA 1H23A 2YJGA 3FSGA 1N1GA 3ND5A 2XZPA 4DCGA 4UM7A 5JS6A 3GEBA 2H4HA 2XSZD 4DSLA 1EXMA 3IV6A 1RXYA 1VFNA 3DMGA 1VLHA 5B58T 1S7CA 1EM8A 2IV7A 5ITWA 3GLGE 4Y6RA 4FEEA 2JFGA 2W6QA 4LX8A 2JI8A 1XCPA 3VHXB 1JB1A 4UB3A 1A04A 3U3OA 1ZOSA 4B3FX 3RSCA 5JARA 5LIRA 2NV2B 3HY6A 1AX9A 4IH4A 1RYYA 2IXFA 3JWPA 5KAPA 1SHKA 4J94A 4QC2A 3B36A 1NVMB 3GQVA 3VR5H 5ERXA 2Y0SC 4KQXA 4Q9AA 4CNQA 1AKQA 1H2YA 2DBYA 1WLSA 4DYHA 1T94A 1RQNA 3OC0A 3TWOA 2VJLA 3PMNA 1TYAE 4BFVA 5HIMA 2DU8A 3NONA 4I99A 1GNRA 3NLLA 1MT3A 4EQZA 5KNDH 4UDOA 5CT9A 2DSNA 2HV8A 3VBEA 4M8IA 5IIKA 4ZT5A 1U2ZA 5H3CA 3ZU4A 1CU1A 3PRYA 2PR7A 3DOHA 4P36A 2F3NA 2Y9TA 4XQ0A 5JRDS 2VXCA 4HZUB 2WSLA 1RKUA 3OLYA 3PE4A 3U6KA 1Q1EA 4DSIA 3B3GA 3I8XA 4ZPXA 1NZBA 4EDFA 4FYVA 1YCHA 2V3WA 4D41A 3CURA 4J8PA 1EB8A 1OILA 1J5PA 1UBTS 3T7IA 3QA3E 1Z4NA 4HBZA 1MQ8B 2Q8NA 3FWYA 1H5UA 4LZOA