3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
2YY6A 3QGMA 3S6JA 3L7YA 3IRUA 1T9ZA 4HGOA 5ALXA 2R8EA 2YJ4A 1RMYA 5AW7A 4GXTA 4UASA 3ZX4A 4AP9A 5AW4A 1L8LA 2X4DA 2GO7A 3KZXA 5AVWA 3B9RA 4L6AA 1EK1A 3ZVMA 4EELA 3TLMA 2GHTA 1T5TA 1QQ7A 2B1QA 2R8XA 2G07A 5ALYA 2CFTA 2W43A 2FPSA 3ZWKA 1ZRMA 3ZTWA 2R8ZA 4Y2YA 2ZXEA 5AK4A 2Q4TA 1ZD4A 1U02A 4UU1A 1SWVA 5ALLA 3U7FB 2YMLA 4J03A 3UMGA 1RKVA 4BX2A 4YCMA 1SU4A 2CN1A 4ZEWA 2WFAA 5E0OA 3WK9A 5AW8A 2G08A 2ODAA 4HGRA 1LTQA 5AKEA 1L7MA 3U7HB 5AKIA 3AR8A 2D2VA 2CFRA 3QUBA 3ESQA 4CF5A 5IS2A 3NASA 3R4CA 3ZVLA 3ZVNA 1ZD2P 1Z4JA 2C4NA 3MPOA 4AS3A 3N5KA 1L6RA 3IB6A 3QXGA 1QH9A 4G63A 1VJ5A 1YMQA 4IFTA 3NANA 4CE6A 5AW2A 2B8EA 3L1VA 1N8NA 1PW5A 3MN1A 4IG4A 1WVIA 1RMTA 4QQFA 4UM7A 3W5DA 4KNVA 3PDWA 3F9RA 3AR4A 3CZ4A 2B1RA 1ZD3A 2NO5A 1Q91A 3FGOA 3SLRA 5IT0A 5AI4A 2JAOA 1TE2A 3EPRA 4UMFA 5ALHA 4BNDA 4KN8A 4UMEA 3QLEA 1L7OA 3L8EA 3RF6A 2IOHA 4I9GA 3OCZA 1WZCA 3N07A 2OA0A 2I55A 1RPZA 5AICA 2W11A 3NUQA 3HLTA 3M1YA 3EWIA 2WF5A 4UAUA 3MMZA 5AKZA 5AM1A 1YNSA 2G1AA 4KX5A 4L6CA 5AVRA 4JB3A 1Z4KA 3WK7A 4CNQA 3AR2A 3PCTA 1KYTA 2HOQA 4EX7A 5IT4A 4FE3A 1EK2A 2IYEA 4NWIA 2MU2A 4L57A 4Y2SA 2YJ5A 3NRJA 4BBJA 4MWOA 3QU9A 1N9KA 2WF8A 1Z4LA 2NO4A 5AK5A 3SF0A 2QLTA 3L0BA 5AKKA 3WKCA 5AM3A 1RC8A 4EX6A 2Q5EA 3WK8A 4FYPA 2HSZA 3QX7A 3WK5A 2HF7A 2W4MA 1O03A 5ALNA 3U19A 3CNHA 3W5BA 5AW5A 1CR6A 4DFDA 2ZBDA 3U7EB 2MU1A 4ZEVA 3ZX5A 1MH9A 3WGVA 4F72A 3N1UA 3SKYA 4OCZA 2AMYA 4BEVA 2BDEA 5AESA 3J7TA 2NYVA 5ALFA 3ONNA 4UU0A 2FUCA 3SMVA 1XVIA 5ALPA 3L8GA 2VKQA 3BA6A 4BX3A 3QU2A 2YMPA 3A1EA 2WF6A 2EATA 1XPJA 3QU5A 2FEAA 1YV9A 5AI0A 3AR9A 1YDFA 4MUMA 1S2OA 2C88A 2JGAA 3PGVA 1Z4OA 5ALSA 3E81A 1IWOA 4Y2JA 5A3QA 2B0CA 5AVXA 3QUTA 2GMWA 4XPZA 5FP0A 2G0AA 5AI6A 2I34A 1XP5A 2HO4A 1Z5GA 2IA5A 1L8OA 3L5KA 5AW0A 4J2TA 5A3SA 4UMDA 3WK4A 5AKXA 5AVYA 4YIHA 5AM5A 3AR5A 4G9BA 4NABA 2B30A 4XE5A 4PNHA 3AR3A 4YGYA 1RLTA 4YH1A 3AR6A 3E8MA 4F71A 4E88A 5AM2A 2I54A 3ZW7A 5AW3A 2GHQA 1RKUA 2WHEA 3L8HA 4BX0A 4UW9A 4NAVA 1NF2A 1TA0A 1T5SA 2G06A 5ALDA 4EZEA 3ZWDA 1RQNA 3A3YA 3WGUA 1JUDA 2ZBGA 4QJBA 4YCNA 5ALGA 3KD3A 3AR7A 5ALWA 3I76A 1RDFA 5ALOA 4UM5A 2RB5A 3OTQA 2WF7A 3ET5A 5ALKA 2P9JA 1WR8A 3R9KA 3KDPA 4YIKA 4C4TA 3WKAA 2YN4A 1J97A 2OYCA 5AM0A 4UARA 4BKMA 4DCCA 4OFZA 2FI1A 3FM9A 1RQLA 2DQSA 3ED5A 3ET4A 3NALA 1WPGA 5AKGA 4Y3UA 4Y2UA 5AK6A 3OCYA 2I33A 1ZRNA 1VJRA 3E58A 5AVTA 2YFYA 3I1YA 2OM6A 3BWVA 4NFLA 1RRCA 5ALZA 1Z4NA 1YJ5A 1NNLA 5ALIA 2HHLA 1Z4QA 2C8LA 5AKYA 4BNDB 3UM9A 2AGVA 4CF4A 3E84A 2B8JA 1U2TA 4H1WA 3A1CA 3KOOA 1U7PA 1NRWA 2RAVA 5ALRA 3ZUPA 2P69A 2G80A 4UMVA 3L8FA 5ALMA 3UMCA 4Y2PA 5ALUA 4EEKA 2YJ6A 1U7OA 1ZJJA 1SWWA 3QUQA 4C4SA 3OCXA 3OPXA 2FPUA 2JARA 2WM8A 5AI9A 5AI5A 3DAOA 1QQ5A 4DWOA 5ALTA 4JDPA 1U2SA 1TJ5A 3EF1A 3DDHA 3U13A 1Z4PX 1S8OA 3ESRA 2IOFA 3KC2A 4O8CA 4HYTA 2R8YA 1FEZA 2OBBA 4BEWA 3WK6A 3OCWA 3PGLA 3OCVA 3A1DA 3R09A 5AIAA 3QYPA 3U7GA 1RLMA 5A3RA 5T41A 3ZI4A 4UATA 1AQ6A 5AKJA 1VFPA 1O08A 3N28A 3B8EA 3I6BA 3WKBA 3SHQA 2PKEA 1J8DA 1ZS9A 2C9MA 2RBKA 2FDRA 4KX3A 2MSNA 3EF0A 4HAIA 5ALEA 3WKEA 2WF9A 1QQ6A 5AKLA 3U26A 4Y2VA 2YMQA 1Z4IA 4Y2QA 2P27A 5AI8A 2PQ0A 3B9BA 2BDUA 3MC1A 1L7NA 1TJ4A 5ALQA 3HYCA 4CF3A 2B82A 1F5SA 3DV9A 2ZOSA 3KBBA 4HGNA 2O9JA 4RETA 2I6XA 3L0YA 4UAVA 2HEGA 1Z5UA 5AK3A 2ZG6A 3FZQA 2FUEA 5AW1A 3VAYA 3M9LA 4DW8A 1LVHA 5AVZA 5AVSA 2FPXA 2I7DA 3L1UA 2HX1A 2QYHA 3K1ZA 4XQ0A 2AUTA 3QU7A 2IOFK 2JAUA 5AW9A 3DNPA 3FPSA 2Q4RA 4I9FA 1L7PA 3FPBA 1X42A 2C8KA 3QU4A 4OD0A 3W5CA 2HCFA 1YS9A 2EARA 1RMQA 1Q92A 3SD7A 3NIWA 2FPRA 3W5AA 2CFSA 3QUCA 5AIBA 3GYGA 3NAMA 3OCUA 4YCLA 2JAWA 4OHFA 4KYTA 5AVUA 2YJ3A 5AVVA 4RESA 4GIBA 4ZEXA 2O2XA 5AKHA 2EAUA 4XOUA 2YBDA 4Y2XA 3WKDA 4BYGA 1RKQA 4EENA 3ZTYA 5ALJA 3L0CA 1CQZA 2HF2A 2HDOA 2FPWA 1Z4MA 2BY4A 3IJ5A 3ZU6A 3I28A 1ZOLA 4Y2TA 4HGQA 4NV0A 3SKXA 4AS2A 1RLOA 2GFHA 4B6JA 3P96A 5AHXA 5AM4A 4FFDA 2G09A 2ZBFA 2YMMA 3UMBA 3FVVA 2ZBEA 1K1EA 1QYIA 1ZD5A 5JJBA 1Z88A 2RARA 2HI0A 3N8GA 4HGPA 1TJ3A 2PR7A 3RFUA 5AVQA 4Y2RA 1Y8AA 2AH5A 5AW6A 2P11A 3D6JA 5ALVA 3QNMA 4KNWA 4C4RA
chains in the Genus database with same CATH superfamily
2JEJA 5IILA 4U8GA 3K4QA 2DUNA 2KD1A 1I36A 1QZTA 1UJBA 1P0CA 2WUDA 3T3GA 2DT5A 2JJYA 3MJVA 3KKLA 3VVLA 1K98A 1T24A 5A5FA 1T2UA 1SEVA 5T64A 2VHWA 2AXPA 5E8JA 2J3EA 1T8SA 4UOZA 4DV6B 1VHLA 2GTIA 1VSTA 3JQQA 1JI0A 1XZBA 4OJPA 1UZAA 1F8XA 3KUCA 3M3PA 2W2KA 3PFGA 5KHLB 2VSQA 2VAPA 1UJ4A 2NTYC 2OGWA 2C8JA 5TF0A 3BHMA 4MR7B 2QLBA 4PS1A 1JMYA 3HEAA 5K6TA 3L01A 3AJRA 1BJKA 2OC4A 3AO0B 3I6YA 4TXMA 5E2BA 2G1JA 4LVNA 4ZRMA 5IWAB 2XZLA 2ZYGA 4C7OB 3HJTA 1JSRA 3I12A 4I1YA 4E4RA 1ZGZA 3ECCA 5IYZB 1GQ2A 3QFTA 1SB8A 1AOXA 4FI3C 4XSVA 2A0WA 3D8SA 4CM9D 4HWGA 4AAYA 2GD1O 1RI1A 1T2AA 2BIFA 4MVJI 1P62B 2FW1A 3DHEA 4OXXA 4DLPA 1XVTA 4F4JA 3Q87B 1KXZA 5FI1B 1RZRA 2UXBB 1HPLA 1VG9B 5J0YA 3TW8B 3WIDA 1JSZA 3IO3A 3IELA 3OZBA 5F5LA 4HZIA 2K6GA 3F78A 3BMQA 2W2TA 3KAQA 1V43A 1SWVA 3Q3CA 3TK1A 3TPZA 1KW4A 2BPGA 2Q6OA 2EQAA 3UT5B 4DQDA 5HRUA 4M9HA 4MWCA 1L5GB 1PS0A 2X23A 4B40A 3U4QA 1RADA 4JZYA 2ZTSA 2YWGA 1ODSA 3BJEA 2F3SA 5EXSA 2CN1A 3WE7A 5GZ1A 4JLUA 1P17A 1N6NA 2A9JA 2V3WA 3C6ZA 5K0BA 4RQ1A 3SV3A 1XMIA 1U3UA 1Z83A 5TNXA 2AJLI 4WBNF 1M2WA 4LOJA 4EYHB 2YWJA 3F9IA 4BQIA 1CY1A 4ZHQB 4KGVA 3I62A 3W2HA 3FWKA 3WP1B 4OQFA 2JD1A 1ZMBA 1ZD1A 4IIBA 3QUBA 3G9QA 4XI9A 3KVOA 4IR9A 4MMZB 3TB6A 2AFIB 2Q3EA 2QIPA 3ESDA 4GGMX 4WPGA 5F2OA 4B3GA 1ZEMA 3OHSX 1GADO 1YQ9A 1GL9B 3OU7A 3UT5A 4CM9A 4TKZA 1KHTA 3IUBA 4F1WA 2XQIA 3VKWA 5DLYA 1P5RA 2X0IA 2ZRLA 2FH5B 4K6KA 2C4WA 2AOVA 1WVGA 1JYEA 4X95A 5E2AA 4Z53A 4KI0A 4UB8U 2VO1A 1ZH2A 5AT1A 3HZHA 1CZUA 2E2WA 2VCHA 1LQTA 1EDDA 4FHCA 3ABZA 3VR2D 3R44A 4IG4A 4Z4EA 4REQB 3W5DA 1MC1A 1X94A 2Q0QA 2OGZA 3KR1A 4L0MA 4ZQHA 1U2PA 2V4RA 3C6KA 3GVIA 3OAAA 4W5WA 3GEPA 3NOVA 4M55A 5ICGA 3NU1A 4EUHA 2LPMA 4RLQA 1TUIA 2Q9AA 1OBVA 4X9XA 1J8FA 4JCOA 2IHUA 3GN2A 2V7TA 4HX5A 4QXRA 5BRNA 2HYDA 3REQA 1RNLA 3Q8WA 4B71A 2R62A 5HF5A 5I7OA 4X7MA 4F21A 1DFIA 3K6RA 3KE8A 4YQZA 4YAEA 3CUEF 4Z0TA 3AONB 3BTSA 5J29A 2IOHA 1RSZA 3OTIA 4I9GA 3RV4A 3K0HA 5LZ2A 3MJFA 1ZWLA 2VT6A 3CLRD 4LJKA 2P5YA 1UEXC 4JB2A 1KYQA 2O14A 2Y1KA 2DCMA 4JOQA 3SLKA 4DLKA 5BR4A 3RK0A 2CWWA 5T7BA 2O1XA 3FNRA 1LJLA 5AICA 1A4RA 1Y4SA 3ELBA 1X9SA 3INGA 4JI1B 5D49A 3F6PA 4DC1A 3SS8A 1ODIA 4DV4B 3T95A 1ZJ6A 2WHYA 5DMXA 1WPRA 4CKWB 1ZQAA 1HRKA 2P4UA 2WYIA 3O73A 1EXWA 2RGAA 4K9MA 4KN9S 1N5JA 4EX7A 1JFSA 3IQZA 3MTQA 4Y1RA 2CL6X 1V1MA 1FLVA 1WDWB 1Y1PA 2Q8NA 3NUGA 1YUMA 2GEKA 4RBNA 4E5YA 3IT0A 4K0KB 2XX3A 2LYHA 4I2IA 2WM2A 5K3DA 5CDHA 4JJ4A 1EFCA 1XNJA 2O1SA 2HWXA 3ICPA 1FQKA 1GU7A 2QK4A 2VG8A 1WXEA 3OOHA 5L3SA 3EXIB 5C7OO 2O2HA 1N32B 5JCZA 1XI2A 1RRGA 5HZGA 4INPA 4K6GA 4KPYA 1CFZA 3SM3A 1EWRA 4INJA 2FP4A 2HSZA 4CKWA 1PVDA 1Z38A 1O03A 2QP3A 1NRJB 1BPDA 4HDNB 4WKPA 1GU1A 5AW5A 5K03A 1VBMA 5JZOA 4C2AA 3ZU5A 1G5IA 4CCYA 4MCHA 3NP7A 3DZ8A 1JBKA 3IS3A 5KYYB 4DBVO 3P26A 3RJFA 1YZFA 4ND5A 5JZSA 2I3BA 2A9PA 3GFPA 1XXLA 4KQGA 4RHYA 1N4AA 4AKSA 3SKYA 2DTEA 2ORWA 2HT6A 3DQPA 4LCBA 3DLCA 4OO3A 5F1KA 3WNVA 5IKXA 4JVOA 1C8LA 4IFEA 3BT7A 2EZXA 1Z28A 2P7IA 3EUEA 3DE7X 4RJJA 4MVJF 4G5HA 2OP0A 1CRWG 2YZ2A 5D01A 5KTPA 3PHLA 3G1UA 8ICAA 2EFCB 2HV9A 3LOUA 4MWEA 3V4FA 4RH0A 3JYHA 4TWAA 5BQ5A 4A0RA 3U39A 1GPH1 3GEBA 4GYWA 1F2UA 2ZREA 3ZGNA 1KFDA 1EIZA 1DXHA 2VHYA 4IIUA 5EWJA 1T43A 3T9FA 3QU2A 3DOFA 3L6EA 1PU2A 2R48A 2KMLA 2WWHA 3AY3A 4NMWA 4UC0A 4MYRA 2F1RA 4C7XA 5A0TA 5DTMA 2DPIA 2VJBA 1AGPA 1D4AA 1LBSA 2Y2VA 5K3EA 2O8FA 5L1KA 3FHJA 1AQYA 4QZEA 3CZAA 4RKQA 1OTXA 5DSXA 2OFFA 3HJEA 2C3PA 3AB3A 1TQ4A 2Y77A 4Y9SA 3EOZA 3PVXA 4ZOLB 5G2OA 5C34B 2BMFA 2B98A 3DL7A 3T5PA 4KQJA 4OGFA 2ORYA 2P0YA 1T36A 4ZDJA 5DM2A 3FPKA 1MJGA 3MRVA 2NAPA 1CVIA 1JDZA 3AT1A 3C85A 3MB8A 4IZIA 3F96A 2I34A 4XPZA 3ADBA 5D3KA 5FAXA 3BXPA 3CRQA 1T91A 5DHUA 5IAKA 1JR3E 1QANA 3DE3X 4XIJA 1ZU5A 1JZTA 2ROQA 2CSXA 1DRGA 1HETA 1MVLA 2P5SA 2WU3A 2G5GX 3FJ1A 5E7JA 2RJNA 2X0FA 2BL4A 3JD4A 1JLKA 3M1AA 4LJ8A 2JIRA 5HKLA 4E3WA 1DOZA 5C52B 4G9BA 2P6NA 2XZDA 3QVXA 1XK7A 4UQLA 3U44B 1M8FA 1RBQA 4UHEA 4DWIA 1G1AA 2ZW9A 3A2MA 3SBXA 1NI5A 4EY8A 3DP9A 4V1CA 5BSUA 1IAQA 1QFJA 1T10A 2VT7A 2W6OA 1ULBA 3F47A 3FKJA 3H11B 1MNQA 1OUQA 1KMMA 1NNI1 3TVDA 3UUWA 1U28C 2FUNB 4CKBB 3V7JA 4E08A 2BFMA 1E94E 1LF5A 2R6R1 3DBIA 3FPGA 4JYBA 1M6EX 2FP3A 1DO2A 2CNDA 3T1QA 4E2FA 2AW5A 4EPTA 3DJFA 4ECUA 8ICCA 2Y92A 1Y7IA 1Z9BA 3S2EA 3S2GA 3SJ7A 3TKAA 1KYYA 4Q1EA 3U3XA 4CV0A 1P2DA 3RAEC 2N1BA 4UW9A 4PL1A 2WPDA 1RYBA 3GCWA 3OLZA 2F3RA 3VNUA 3H16A 2I99A 3S7TA 2XQFA 5IK2D 3GLQA 3FKQA 1GWNA 3QLUC 1P75A 5ECDA 4D9MA 6NULA 3H84A 1ZMXA 5DCUA 1W88B 2Z1DA 3GHHA 4Y1RB 1RQNA 1LKZA 5F3XB 4AULA 4D44A 3WGUA 1JUDA 5JAMA 3CZQA 3RU7A 3IULA 5ALGA 2UAGA 3IAHA 4B3MB 2H1OA 3I76A 2JASA 1II8B 3PR3A 3HKZF 3COVA 1JQJC 1PL6A 1SCJA 4HH1A 4MV0A 4JLNA 4OHXA 2EZ9A 3X1JA 3V8RA 3IFSA 3WIOA 5GAJA 4ROSA 1KHHA 3FXAA 3V80A 4ZPJA 1MJGM 2BFBA 4EHAA 2WE8A 3AGPA 4RPGA 4JOBA 3R9KA 2W6CX 2HBKA 2XCPA 3GLRA 4LF6B 3HCWA 3O92A 5JXIA 2OHIA 4D0SA 4UUQA 1QGUB 4B9EA 2H3EA 2BTEA 3GGCA 4BFZA 2XNSA 5I7UA 2AOTA 4K6CA 3B1ZA 1FL9A 5C1PA 1RQLA 1IDN1 1EB9A 2Q29A 2ATLA 1NU6A 4L8VA 1I7PA 2ZP1A 3OCCA 3DOEA 3GFKB 4B85A 3BCHA 2CLOB 3SENA 1M2NA 2HQSA 3QA9A 3QFHA 1C4OA 1TFUA 4MIKA 1HYQA 4R2HA 3SYLA 1Q3KA 1V39A 2FG5A 2FFAA 4OUDB 1X9GA 4D43A 4HNTA 2P9HA 4JP3A 1VJRA 4PLVA 4ASUA 1DQPA 1XDUA 3VV3A 3V6JA 3FC4A 8ICBA 3C4QA 1YACA 7MDHA 1Z4NA 2Q1UA 2UU9B 3C3EA 2H1HA 2CGEA 2WINI 3QFCA 4CYMA 1R74A 2PK3A 5LZ9A 1PZEA 2GBIA 1FFYA 3SQLA 3HCDA 4MVJH 5DDIP 3A14A 1J9GA 3IHTA 1U0LA 1ZGJA 3IT3A 3UWOA 2G17A 4CMHA 2ZXFA 4E7OA 2MIIA 4KBYA 1RPTA 4C5BA 1NRWA 4DRXB 3DL4A 3IPLA 2G80A 5EZYF 3O6VA 3B2EA 4NCJA 3OIFA 4RHTA 2E8NA 3TLGA 5JWOA 3AEUB 4J76A 3WIUA 1CDEA 1D9DA 1OX4B 2P65A 1F9AA 2SKCA 1DQYA 4B48A 2C9CA 3RQIA 4OL9A 1C30B 4XFKA 2DY1A 2R5NA 1QGAA 3REOA 2O5EA 3BH0A 2PBLA 2ZS7A 5KWVA 4WD3A 3F5MA 4S1OA 3OZTA 2HF8A 3OCXA 1KOJA 3C3KA 3R0ZA 4KGZA 5JSKA 3VBEA 1MG0A 2FPUA 3ZHTA 4ECRA 1SVSA 1KAGA 1ZN7A 1GA6A 4S35A 3T5BA 3TRFA 4R8KA 4E33A 4PXYA 4IY1A 4J43A 4NXZA 3I0ZA 4I2EA 2UVQA 1SC9A 4Q19A 2VZLA 3TB4A 2XB2A 1NOMA 3HXTA 4EPXA 4C89A 3D5EA 3BM5A 2V58A 2G9NA 5KC8A 1L1FA 1GUZA 2GK7A 2JGKA 3TGPA 3WK6A 2CT8A 9LDBA 5B1HA 2IGTA 1JN0A 4JJGA 3A1DA 3ZXYA 2ZS8A 4KMSA 5KJ6A 1UOPA 5TIIA 4U39A 3UBMA 1PFVA 4CDRA 1V4VA 4ZEMA 4B4WA 4PLYA 3WA7A 3RUAA 3I6BA 4KO3S 1ZS9A 5FFMA 1DRJA 4OYRA 1T0IA 4LPSA 2D1YA 3UKOA 2FDRA 2GF9A 4B2IA 4JITA 4RZ2A 4YUXA 2IXEA 5JS7A 4HUJA 3UUGA 4B2LA 3BVPA 3NCHA 4CTJA 1KNXA 1OAKA 4RZUA 4YRTA 2IYPA 2ZIUA 1CHNA 3IESA 4DQXA 1KK1A 3LC0A 1M6YA 2GJKA 3CH5A 8ICWA 2BFAA 4DWWA 2IWHA 1UAGA 4EMBA 1N9GA 5BY2A 1L3TA 1RLIA 2JLSA 4Q66C 1E2LA 2JA2A 2P27A 4O1IA 4RKWA 4RIFA 4ACOA 3MC1A 2WJPA 3WDSA 3HYCA 2CDAA 3IOYA 2PUBA 3TOSA 1AXEA 1IRXA 1VHQA 2EYUA 3ICOA 2HIHA 3JD3A 1BNPA 2G82A 5FA5A 1LJ8A 4XGNA 1JXMA 2JKZA 3A27A 5B7NA 3HYNA 5IW8A 2F8MA 4PZUA 1KVUA 2XTZA 3RC2A 4UBIA 1U2EA 1WOYA 2GHIA 4F9EA 5DM70 3H86A 3RFAA 5IASA 4O3FA 5IXJA 4OHUA 1WMFA 4YI3A 2I91A 3T3OA 1I7NA 5K4LA 3FY4A 3K9LA 1PF7E 3M3HA 1NNSA 3B13B 4GQAA 2K4EA 2I7DA 8ICUA 4RJ2A 2OXFA 1XZAA 2Q2NA 4Z9BA 5TV2A 3SNKA 3G2JA 4DCJA 4ZCIA 3CVUA 3SE0A 1O5OA 4L5JA 3QU7A 1VMEA 3RM3A 4CXMA 5KYXB 3TOXA 4URUR 3ZXUB 3VDMA 4EJSA 3RVSA 3QEAZ 2PT6A 2Q4RA 4QZHA 3N86A 1RAHA 3FPBA 1L5RA 1NN5A 3UATA 1R7RA 2C8KA 4KIUA 3F67A 4R83A 2CLIB 2PL1A 1DC5A 3FRJA 3AI1A 5L4LA 5JAPA 1VL8A 3NIWA 2IIBA 1JHRA 3IEPA 4MVJP 4D25A 2K4HA 4U7PB 3GQCA 3MGHA 4H9GA 3IPXA 4KLCA 4DR3B 4J9SA 2JAWA 3JZIA 3OZFA 5AVUA 2YJ3A 3NH6A 4ZRNA 5F4BA 3OIUA 4IMPA 1HMYA 5AVVA 2VPTA 3J81k 2ZUFA 2D6FA 1LFDB 5JRTA 4RD0A 3ILYA 2AOXA 4ZK2A 1U7ZA 2D1FA 4TSKA 4B47A 4LYDA 3S8YA 5DP2A 4EPVA 4HMPA 1GPUA 2W6NA 1VMIA 1U7HA 1VCMA 2JJ1A 5D3QA 3UPDA 3RAXA 1QO0D 1JALA 1EYZA 1W5FA 2G4VA 3ZTYA 1YBHA 1WCXA 4I1IA 1GEGA 2WWWA 4UAZA 3DC7A 3RYFA 3VFDA 5HK9A 1R8SA 1ZBQA 2O07A 3WRXA 5JBQA 2YRXA 1WETA 4DMMA 1MTZA 1UOQA 1GYPA 2G1KA 4MLZA 3V2HA 5HR5A 1W5TA 1J20A 2GJ9A 3OA0A 4RPJA 3VPFA 3LPCA 4DG9A 5D51S 4KWEA 3VKVA 4CWAA 4D2IA 5B3JC 3PEEA 4PSVA 1E5VA 2CCKA 3RARA 2Z6QA 3ZVRA 4BKOA 3K32A 1M2KA 1FXWA 1KVQA 4G9GA 5KOHB 2I80A 3BQ2A 2DHQA 1U7WA 2ZBFA 3CWZA 4Q3KA 5J2UB 1NY6A 5T4BA 2GWSA 3ROTA 4O08A 4P3YA 3UG7A 1XXHE 4N76A 4AJOA 1T8YA 1GSHA 3UC9A 5CJ7A 2H5XA 4V03A 3R1IA 4GOJA 5E6UB 1SXJE 3N8GA 1JR3A 1SOMA 5HSGA 7ICGA 1WDKA 4HTFA 1F0MA 4BWJA 3K73O 3G0HA 1K4MA 1OW5A 2JFVA 4L4RA 3WWZA 4FZ5A 1Z5WA 4HLDA 4JKIA 5IDVA 3SC2B 2O54A 3BSFA 3T38A 2CV1A 3MR2A 2CVZA 1KQFA 2Q2VA 2XIJA 1HYBA 3WGNA 1B8OA 1RRMA 2QRQA 3DVRX 5DHTA 3C98A 1BX1A 4QRDA 2FMKA 3NC4A 2H9IA 1N7GA 3EYAA 2O3JA 4K4HA 4Q3LA 1EVEA 1W4LA 3PLNA 1GSOA 2H29A 3LL7A 5LQJA 2Q3LA 5DN9A 3RD5A 2A58A 4XWYA 2VTBB 4IMJB 1DTEA 2FPOA 1F6BA 2OZVA 3I2IA 3O9VA 4RFSA 5F52A 3ZHQA 5HX7A 1F4PA 4BVGA 5AVWA 3TIVA 5CDUA 4RF5A 5AJYA 5B7QA 3GC6A 4P0TA 5BR8B 1T1JA 2HK8A 3MFQA 4MDYA 4GXNA 1E1CB 3MCUA 2ECQA 1P19A 4W7HA 1RJEA 2WM3A 2DX7A 1F2DA 4E11A 1QCCA 1B7GO 1Z5VA 2COUA 2FVXA 2P8SA 1PLLA 1LH0A 4UUAA 4DIFA 1XN4A 2AUNA 2RFLA 3RUDA 1Q0PA 2QQFA 2ZT5A 3G0DA 2FPSA 1HTWA 4KR7A 4BWMA 3ORFA 3MWGA 3C5GA 4N1AA 3UB4A 2FZKA 1QC5B 3JAWA 3WYDA 1U8TA 1T4MA 1U0OC 2AZ4A 5HYVA 2WDZA 3KLOA 2FSVC 3O4FA 4H7KA 3TRJA 7ICSA 2G5IB 3EZ7A 3U9TA 3Q8RB 4U63A 4RQ0A 4QWCA 1F1BA 2C9ZA 2ZXEA 3NNNA 5HFAA 3KKQA 1W4AA 2BFEA 1GIAA 5T5QA 1J2NA 3EQ7A 2GD2A 4OU5A 1W4BA 1YRBA 4GM1A 3NG1A 4Q7EA 3RIYA 4NM2A 1QGOA 3LBIA 4L28A 4MW0A 3HNOA 1W1IA 4FINA 3JYPA 4JGIA 4LHEA 4U7JA 4WX2B 1P5JA 2BJVA 3INYA 5ENVA 4RANA 4DIOA 3JPWA 2OXEA 1EWVA 5TVKA 2C20A 3DZBA 2BM1A 1ESEA 5H81A 4KK3A 3EGXA 1T25A 5AW8A 3T99A 3CRW1 4X1YB 5DK4A 1A9RA 1C8BA 1N5LA 2I2FA 3GQBA 3FFXA 5CNMA 5D00A 3RSLA 3ZE9A 4BU0A 1KK3A 2R97A 4HB0A 4BO5A 2WT9A 3Q15C 3ZWYA 4RZSA 3GF4A 3JYQA 5LP6C 3PFNA 1QNFA 3VHLB 3GEEA 1V8OA 9ICBA 4HTAA 5B12A 2XNDD 4G89A 1ZQLA 1PI3A 2YOHA 2P62A 4P4GA 4WNAB 2C4NA 2UXCB 1TK8A 2QNIA 3VPHA 4KIWA 1BG6A 1UK8A 3IV7A 1L6RA 4MV9A 5D2CA 4DL6A 2UVWA 1C41A 2C4UA 3A3NA 1XQVA 3X1YA 1VLQA 4IL6U 2R6HA 4R68A 2AF3C 1ZOSA 3LBHA 4YACA 1G8HA 2FRXA 1YJ8A 3RBDA 4RPZA 4GPEA 4Q1DA 4UM7A 2NZUG 2M0NA 3O91A 3QBJA 1ORIA 3F9RA 2O23A 1ZD3A 1Q91A 4A8JC 1DDOA 1YIDA 2XRMA 3SAFA 1TK9A 2WMDA 3COYA 3N8NA 3IHWA 3W3AA 4J7XA 1DKNA 2GERA 3AWDA 4PRKA 4WNAA 4BO2A 1A4IA 4DUGA 1CQPA 4ARZB 4J9MA 1P7ZA 2WSSD 2XB8A 4XUEA 2IHJA 1QLNA 3D7SA 3A32A 1TJPB 1GV1A 2FZGA 3IV9A 4HN9A 4OLAA 1OV4A 1CUGA 1U0SY 2X9VA 3RTBA 3OH8A 3WGTA 2WJWA 5DBOA 2A9OA 4P4LA 2NV2B 4KXUA 4YT4A 3IIEA 1J90A 2B6HA 4EB3A 2JLWA 3R4VA 1YS1X 3OCZA 2VRNA 1RYFA 2GO1A 3ZD7A 2H5EA 1C3VA 2H4FA 1DJOA 1X7WA 2J5RA 4EQZA 1XG5A 2LZ0A 1BKSB 5EWGA 1G4HA 1IG0A 1COZA 1NI4A 2O2DA 3B6MA 3LT0A 2BGUA 3JASA 1QIHA 3G68A 4B32A 4YAWA 3ZWQA 2W11A 4GE0A 2XGGA 4YYEA 4JSTA 4Z5XA 4Y7DA 4BNZA 3OUTA 4LYAA 5KFWA 2UUPA 3CX3A 3LA8A 3GRRA 3NBUA 2I4IA 5FUBA 3UOAB 1K5OA 1UWLA 4A2CA 3BHNA 4NICA 4WXHA 1ZD9A 1SOAA 3K2BA 1UPAA 3PCTA 1CUDA 1ZCJA 3NHPA 3MXOA 4XW2A 3PR4A 1MQ2A 3QLJA 3LLSA 3W3AD 1N2CB 4M9GA 4OHRA 1ZC3A 2JGLA 2YJ5A 2Z3VA 3RVNA 5IVHA 1YR6A 1JHDA 1XJ5A 2OGTA 4QBHA 4IZOA 1QGYA 2OMKA 2D0IA 1RYRA 1ATIA 3NKVA 4U6SA 4LJLA 6ABPA 1XZIA 1HQYE 2C5GA 2VTDA 2W48A 1M0EA 1WY5A 4GQIA 1TIPA 3P9IA 4WNIA 1VPLA 3HWX1 3URKA 1D6MA 3OF5A 3H5RA 3LKVA 4UAYA 4HUTA 5P8WA 2FCAA 2HF7A 3X1DA 4G0NA 4GKKB 1TQ2A 2XE7A 4YRCA 3D8NA 4DABA 5CA0B 3Q9SA 4JYZA 5BUQA 4H77A 4N48A 2EAMA 1MH9A 1JFRA 3PQ7A 4EO4A 3N2LA 2AXNA 2W6QA 3VJLA 1ZLXA 1EZZA 3BB4A 1E0AA 4ZRDA 1VHDA 4F50A 2UYQA 4I55F 2CXHA 5KG3A 2EFDB 2UZIR 4HXEB 1F4VA 3KFXA 1C0PA 5CBPB 421PA 4H35A 1NF9A 2D54A 2NYVA 3QX3A 3AOEC 4E5DA 4DZRA 3NEPX 3MELA 4CIYA 4E2XA 4FYYA 4KRXA 4M7WA 1X1CA 1WSDA 2N42A 2WIKA 1D5WA 1C7QA 1E7WA 4QGHA 5BOMA 2Y1FA 2CBXA 3AWIA 2WJAA 2HQRA 1JQLB 4PLHA 1G5RA 4GICA 4RCVA 3TG8A 3KQHA 4WKGA 4JT9A 2RHDA 3KWMA 5H59A 1LFAA 3GR6A 2VPIA 3L0OA 4W5TA 4JEUA 2GEFA 1Y3BE 2C00A 1WEKA 4NPAA 4EHDA 2VPWA 1C0KA 2PH1A 2Y1EA 1KI9A 1S2OA 1O96A 4HLUC 2LP4Y 4Q00A 1ZR4A 3WMEA 1EI9A 1IWOA 3DCYA 1E1KA 1Z26A 4O3MA 4DQPA 3F6YA 3F7MA 3I45A 4X41A 1LV7A 3FOBA 1VIVA 3BFKA 2MTBA 2QMZA 3QUTA 5EWFA 2FN8A 2GSWA 2JFYA 3IIIA 4LDZA 4M0CA 4N0PA 3CRMA 1V5GA 3GBPA 4WLUA 1L8XA 2D0PB 2E82A 1D8YA 3TWOA 1XELA 1D1SA 5KYKA 5IJZA 4J2TA 4KLLA 3HV0A 2E48A 3IPYA 4JLJA 3HDHA 1B8VA 2JJ1D 1PVQA 3DMFA 1U47A 4X66B 5KJEA 5KNCA 3GGJA 3NZEA 3O84A 3OFNA 3ONWA 4MWZA 4ZVUA 5CG1A 1MFPA 4XE5A 4I19A 4A1FA 2DQZA 2E4YA 4OK3A 1MN8A 1I1QB 1N48A 2C4HA 3IMEA 4LXGA 4PO8A 5GVRA 3TQIA 3U62A 5FWXA 1IEVA 1XTSA 5JMWA 5L3RA 1K7FB 2OV3A 3BIJA 2KFNA 2JI8A 1OD6A 4FKBA 4R3NA 3IKVA 3IKLA 1J2JA 3JW8A 1ZQNA 1NK5A 3NC1C 3O1HB 3V32A 3GU3A 1P74A 1PR3A 3HT3A 1IJKA 1G17A 1GPBA 2QXYA 4RZRA 2VAMA 1FU7A 2XADA 4BBAA 5BWBA 3FCYA 3M6FA 5HJ5A 3ZHVA 4GEKA 4BXOA 2YV1A 4LJAA 4ZOCA 3UJPA 1ZQXA 1XZKA 4URVR 2OPHA 1C1DA 9ICEA 2ZJ0A 1TA0A 1BFUA 3QG5A 2X6QA 2EZYA 2B5WA 3GLIA 4BDTA 4NH4A 3A4NA 3M34A 4I27A 4I46A 3DL0A 2PTGA 3GFQA 2FPMA 2F44A 1T3HA 4BWFB 1T1GA 2H85A 2W90A 4TXHA 3ZCVA 4JLSA 4KR9A 4JELA 3H0EA 3Q8XB 4LDNA 5FJJA 5JNWA 3T4UA 2XVYA 3QX8A 4RPHA 3TMKA 3JTEA 1RDFA 1B3RA 2J9XB 2WOOA 4HJRA 1LPSA 5KT6A 1UFKA 3F5SA 5M7EA 3LW7A 4PFSA 1S9HA 5EUQB 3SIRA 1EFRD 3L05A 3I05A 4UFOA 3ZC3A 4URXR 3GGSA 3H5NA 3KB8A 5CMLA 2VNKA 2LIVA 3BXZA 3C39A 4KDFA 1JU4A 1T2FA 5IBQA 3THWA 2W9CB 2N3ZA 3IXLA 4Z1MA 2ZWAA 1X7DA 3NHKA 3F73A 4RNCA 3LQ4A 1Q50A 4XKJA 5B30A 1IEQA 1MGOA 4G23A 4N3CA 1QORA 3P5BA 4PFQA 1QSGA 2R2AA 1ZK0A 1PJ3A 3EE6A 3G2IA 4DJAA 5ITZB 4YUYA 2XC9A 3K5HA 3KELA 1Y8QA 3L77A 3KETA 3V1UA 1D9XA 1KKUA 3B3QA 2B9EA 3KJGA 1OWMA 3R3UA 1R15A 5GGYA 5KDLA 1RR6A 3WTCA 2QRJA 3IP7A 5DNVA 2HWUA 1SZPA 3FDZB 2GBGA 1RFGE 2JRCA 4BMDA 1XTRA 4M88A 2EKQA 2JBAA 4Q15A 1NNLA 3RH6A 1EFTA 1ZN9A 4Q9NA 3PX0A 1N2HA 1VL6A 4PZ0A 4RFVA 3QTLA 4CLDA 3V6KA 4PLPA 3TW0A 1HI9A 3GX1A 4DV0B 2E1EA 1VCIA 1T4BA 1XGKA 2PO5A 2XMPA 3PNVA 1EFRA 4L4UA 4NBVA 3M49A 1CUHA 1CE8A 7ICUA 1NJ1A 2B8JA 3WA6A 4DDHA 2PI4A 1WA5A 1SU6A 1BDJA 2F43A 4KTVE 1KZ4A 4QRIA 3RQSA 4F2PA 5DG9A 4M0EA 2IBTA 1VGQA 4U8HA 1TTQB 2ETVA 3BB3A 4WKOA 1DC3A 3HXPA 4UQOA 3CIFA 3H5IA 4NJ8A 1IYZA 2FPPA 3Q6NA 1KR5A 3GUVA 1SGWA 3ZY4A 1KDOA 5GOZA 3LQYA 3BX1A 2C7GA 3V9AA 1TK0A 4QOIA 5J5VA 2H1FA 1MQ8B 1UBGA 1VOTA 3B48A 3IP3A 3RT7A 2MR5A 4JV2A 2JARA 4Z86A 3NWOA 3ITKA 4U5XA 1KC1A 3G13A 3ONEA 5B6PA 4P4MA 5LWHA 1ULHA 2QUHA 1UIRA 4UHBA 1XL0A 1TJ5A 2G8NA 4HEA6 3KYCA 5A4MS 1RM6C 2GBFA 2PSEA 4FMDF 1VECA 2NU8A 2J8ZA 3NATA 3IOCA 1M34B 4YX9A 3EEQA 2ZIVA 4J1TA 1RW4A 4B7UA 3HP6A 1DE0A 4CRWB 4AL4A 1FEZA 1UDAA 2C92A 4MKRA 3BE4A 1YCHA 1RAFA 4NE7A 1DMSA 1NK8A 3E2EA 1K2VN 3GIJA 3DYBA 1QX3A 5C7YA 2V45A 1E6WA 5DXAA 1RS0A 1PT7A 5AIAA 2I9PA 2ECFA 2P67A 4OJQA 2RBEA 3R7DA 2ZSIA 2VUSA 4B81A 5DB7A 2WIJA 2EDCA 4EJFA 5AKJA 4KI7A 3CUUA 3B8EA 1URJA 2FZEA 3D3KA 3NHRA 4QQRA 3CWQA 1X13A 5DXFA 3S2SA 1U4BA 4RZHA 1N5IA 4FYWA 1GCIA 1CIVA 5EQDA 4F9GA 1DS6A 4EYKA 1ZGHA 1G8SA 1QB8A 4OJTA 1S5PA 2VI5A 1HK7A 1MX9A 3TH5A 1C4XA 1F3LA 4QJ5A 1OQAA 2FWPA 5LB4A 5FB3A 4C7KA 2B21A 3EZ2A 3IP4B 1X14A 2XRFA 4PN3A 4YMVA 3HYRA 2BELA 4KV9A 4W5QA 2B2XA 4YD1A 1XRMA 5KOHA 1CY4A 1XOIA 3ETEA 3FOWA 2RBGA 3RTCA 1B26A 3LT4A 2TMYA 1JA9A 1YKFA 2GZ3A 2XXBA 1VCHA 2RGDA 4B9SA 3FBWA 5TPWB 4IHJF 16PKA 1A96A 3RUEA 4D45A 4KKXB 2UUBB 3D2CA 4C03A 1A72A 2QG4A 1B0XA 4L72A 4RXMA 4W9NA 5J43A 2VJMB 1OKKA 4ZO6A 3IUYA 4V0KA 2HLNA 4WCVA 4JSYA 4A92A 3C7DB 3TTTA 4AN1A 4HLCA 3TM5A 1I9CA 5TPZD 2IZ6A 3AHEA 2ZG6A 3ACBA 3FAKA 4QU5A 2BKAA 2GOYA 1TYCA 3HJUA 1LVHA 3UMYA 4WK6A 3LU1A 3CUTA 3OIVA 5JXJA 5K0ZA 1HURA 2E8PA 1Y4ZA 4HD8A 5IU6A 5F12A 4PQRA 4RE5A 5EZYB 3CCCA 3I2HA 4DXAA 5KQPA 1AZLA 3W5SA 5L3VA 2QDKA 4QPPA 2W7PA 3ADPA 5KFUA 1OXSC 1H2XA 3W4IA 3D59A 1J0CA 4RFSB 2HCRA 3AVUA 1YS9A 4RPIA 5DVZA 4JLVA 1Z2NX 4LEIA 3BKWA 1KP3A 4M9XA 5GP1A 1E8NA 2LKCA 1YRLA 4G1MB 4B3CA 4JI2B 4CLOB 4ZZIA 4OYYA 1SVMA 1LS6A 1S1MA 2RHCA 2PV0A 4W6ZA 1RHMA 4YXMA 1J42A 1NW7A 4LOAA 4B5LA 4OHFA 4EG8A 1L8AA 1X80A 1X2IA 3I5MA 2K8BB 2IVZA 2JZCA 1JFVA 5CH3A 3ZCUA 3VR6A 1VE1A 2QR3A 4ZEXA 5LP1A 4G0VA 1XMVA 1V5IA 3L40A 3Q2OA 1AG9A 3LWLA 2WJ6A 4Q3NA 1ZNWA 1HGXA 3CU5A 4AQDA 2RC5A 1UPTA 5M3BA 2NRVA 3OLYA 1SKYB 3TJMA 1FIUA 5J0OA 3E3NA 2YX8A 3M7DA 2KIWA 8ICSA 1MF7A 2Z5FA 4ZQFA 3T7DA 4D41A 4PCUA 4WUTA 5EIFA 5DISB 3SJUA 1ZHOA 2NOAA 2FN3A 1CVRA 2QLJA 1OBFO 2BFEB 1O58A 2ZI5A 3L6BA 3NAGA 3P1JA 3OECA 4C6HA 5KDDA 2W42A 1NG1A 4LOIA 3N05A 5JY1A 1LBEA 2C4VA 4GR5A 1H9BA 3IUPA 4MP3A 5FPTA 1P77A 2R8RA 3KT3A 3UGQA 3CB4A 4PSCA 2V3VA 3VR1A 4DL7A 1YZ7A 3ZD8A 3EGWA 1F2TA 3T9AA 4NV0A 2X1VA 3VH2A 4L6IA 5ABPA 1AMOA 4O33A 2ALZA 4L02A 4MGEA 4BKUA 5E1BA 3B9JA 3W06A 2XGQA 3GLUA 3B5IA 4MS4B 1Z47A 1IONA 8LDHA 2PZEA 4HYYA 5KQGA 3WJ2A 1SUSA 2JIOA 2BH9A 1B2RA 4JL8A 3B89A 1H4TA 1MEOA 3LWNA 4I9UA 4IM7A 3RHFA 3W5HA 1E2UA 2WILA 4RNMA 4INAA 4EW2A 2V7GA 4M53A 5FQOA 4EJ0A 1MENA 1Y8AA 3H5VA 1SHUX 4TTJA 3W8NA 3IEVA 1QBKC 3CKKA 2O8BB 4EGFA 3VISA 2ZI7A 1X6IA 1N2BA 3D0KA 5B6IA 1WTCA 1VYHA 3WNCA 1PK1B 1W8IA 3EXEB 5EMLA 3O90A 3U7JA 1A98A 1CD5A 1E2JA 3KZNA 1U6KA 2GXAA 3Q5EA 5KTQA 3C3MA 1JFFA 1J2MA 1XDBA 4EKGA 3ZIAA 1O6ZA 2B4KA 4FUQA 1TQDA 3KQYA 4YAUA 1KMNA 2KVCA 2AKYA 1ZK2A 5HIIA 2R00C 3FSEA 2D8CA 4JR1A 2GO7A 4H4CA 4NSNA 3MTDA 3IVMA 1U8YA 3A6LA 4M8KA 4NCIA 1PFYA 2Q45A 5FUWA 3CPEA 4B6PA 4CMIA 4BN4A 2HK6A 1D1TA 3JQAD 5COAA 4RJLA 3PSTA 1ZGBA 4WINA 1YQWA 2VSNA 3VSBA 2IK8A 2WFLB 3AV0B 1Z34A 4EELA 5CW1A 2B8WA 2BCQA 1CY2A 5J4HA 1D4OA 4OQPA 1PK1A 1K6EA 1YBMA 1QHFA 2ACWA 1UAYA 2I3ZA 3DMDA 3RIGA 4YP7A 4QSMA 4XRGA 1W9MA 1Y7TA 1R3UA 2KV2A 2HU5A 1OI7A 2CFTA 2OOKA 3RT9A 5JADA 5CT4A 2Q1SA 1KQNA 5CLLA 3RUIA 4Y0AA 4PWZA 3U3OA 1P1JA 4N03A 5EERA 5GTDA 1WDMA 2HNBA 2FZ4A 2YRFA 4UEQA 2WHXA 4YEDA 9ICXA 1SUFA 1Q44A 1SUDA 4CQMA 3HDJA 1RQXA 2SECE 2XY4A 2R8ZA 4OH1A 5KFQA 2QE7A 3LKBA 4UTPA 1JDTA 1HR0B 3VYWA 2Q4TA 1ZD4A 1IOLA 1U02A 1XPUA 2M1XA 4BRZA 2Y1JA 4EY3A 1U2DC 5A5DA 1XKTA 2YMLA 1YK1A 3LK6A 3QV2A 4LRXA 3SCZA 3ZDQA 4W5RA 4TTSA 4CLOA 3HY6A 4FSXA 1XZFA 3DV2A 2H0QA 3PITA 2ZSKA 1J2YA 1WXFA 3MDAA 4Q1AA 4UE2A 2OQRA 5AKEA 5KG0A 2AX4A 4ZZ1A 2FMPA 1HBJA 2FEXA 4RYDA 1JR2A 4TUQA 5G53C 1VIAA 5IXYA 3QENA 1H1TA 1P7YA 3M4ZA 2AR0A 4TKMA 4KLAA 3ESQA 1K7EB 4DG8A 5IABA 3HB9A 2A14A 3NWBA 4RM2A 3MMNA 2W9AA 2OQVA 1B1CA 3WGQA 2IDJA 2A7QA 1J9ZA 1IZ8A 2D8MA 2QGZA 4BNUA 3R9XA 2AC2A 3QPWA 2WTUA 4U6QA 3ZV5A 3GJ8A 3CQ9A 4QJ3A 2PLFA 4MINA 1ZXXA 2XSZD 4O0LA 3LDHA 5EOVA 4DCPA 3NAQA 2HOFA 3ZLTA 2B8EA 2BR5A 3ZH2A 1EUDB 4QOGA 1UMKA 1VE6A 3MN1A 4WZAB 1YF3A 2WB2A 2CPRA 1I13A 4LCEA 4HNUA 3H1AA 3ALRA 3D3EA 3GNQA 3AU6A 4TSRA 1B22A 5MFPA 4TKUB 5E9WA 4NOKA 4QXMA 5FUYA 4FCVA 4HFNA 4MW1A 1TZ2A 1ZD8A 4TGLA 1M2VB 5IULC 3CR8A 4XLLA 1S8FA 2FMUA 3RU2A 3KAKA 1ZCAA 2GWHA 3KT6A 3L49A 1TK2A 2QNRA 2R7KA 4IZHA 4RQBA 4CLEA 3UA3A 2KFZA 3EIOA 5KFCA 5EHXA 1V41E 3L7MA 1EGMB 4IKPA 1NLUA 1LDBA 2VJDA 2FRDC 1J07A 1FYEA 3CUYA 1QJCA 2B61A 1RC0A 3EQZA 3DTVA 3LGSA 4GZ6A 4BGVA 4RDIA 4BP1A 1N63A 2FJ0A 4JLPA 4WVFA 3PFWO 4D9NA 5ITVA 4RDHA 1P9LA 3HJFA 5LU9A 4EF4A 4OAOA 3RIMA 1AQLA 1X15A 3OIYA 3P45A 2A1TR 1TA9A 3CEMA 1QCYA 2XHZA 2YB1A 4B73A 4LOKA 7REQB 3NGDA 3KSRA 5DPMA 2WKPA 1UKZA 5JSUA 3OI7A 4YRMA 2G4CA 2QSZA 3V34A 5FOQA 1X1AA 1FJ2A 2HIAA 3F7TA 3HNPA 1D1QA 4EI9A 5HM8A 4ZT2A 2BR4A 4OXIA 2B8TA 3RYHB 2I2AA 1Y7HA 1AQUA 4KSCA 1RWOA 3OMLA 2R79A 4RLSA 4D3YA 1B1AA 2Q8PA 1Z6XA 2YW2A 2H1VA 1YR8A 4FDMA 4S1TA 3K0KA 4YDRA 2VZEA 3KQOA 4OI2A 3VR5D 3QU9A 4OO1J 5FR2A 5FBWB 4PY2A 3D8UA 4DMKA 2HJVA 2R7NA 1GRVA 4JLMA 1SL0A 2HLDA 3HP1A 1PDVA 1UT5A 1QWSA 3SF0A 3UH0A 1P5ZB 4QPCA 4C76A 4UTRA 3UYKA 4WXYB 1TADA 4M8IA 4J90A 7ICJA 3K20A 1IVNA 1XV5A 2EZ8A 4A82A 5BP7A 2W4MA 5KG4A 3FVRA 4ZVQA 4B6SA 2CNLA 1GNTA 4Q0MA 1QYDA 4GC5A 4DFDA 1G7SA 5BUZA 5DLFA 3WL6A 4TURA 3G2LA 1GPWB 3RJHA 2QD2A 2L0XA 3DOOA 4ELTA 4HAOA 4N3NA 4EVIA 4OLJA 5LIPA 4GSKA 2HU2A 5KFNA 2JJMA 4NBRA 5K09A 3UK6A 4HDSA 4BEVA 3FMPB 4E15A 2B7LA 1GNPA 1QCDA 2GN0A 1K06A 4GI7A 3G85A 2QPLA 2H2WA 4I1OA 2BKEA 3ELYA 1V8BA 3L6UA 3SMVA 4UREA 3O8CA 2YKGA 1ZXIA 4MMYB 3HRKA 3MFYA 2WD8A 1ZYUA 2PJZA 4Z4HA 5LKAA 1IMJA 2DBZA 3AI7A 4MUKA 5EVJA 5ADWA 1XAHA 3CUSA 4XVQA 4QWEA 1D8BA 2X19A 3FWZA 1XNSA 2QJWA 3VYUB 2ZYRA 2OCKA 5KC9A 5KTKA 2W7TA 4XSHA 3C2MA 1SHTX 1XPJA 3NFYA 1OYWA 4LVOA 1NASA 2Z9DA 3C4VA 5KMGB 2H51A 2HW8A 2H4XA 1ZICA 3LCVB 1I7SB 1N5RA 1AKUA 1MW9X 2CHVA 3NRBA 1RC1A 1MO4A 1PYOA 4ED1A 2WTEA 1Z06A 3H17A 8OHMA 4I1RA 3T7KA 4DV5B 4WZAA 1N3BA 3HUFA 4GS5A 1QHIA 1NW4A 3EG9A 4QLOA 1FRZA 4NJMB 4I2DA 2JBAB 3PQ8A 2VLBA 2IA5A 3K6SA 1L8OA 4GR4A 4PGFA 2DSNA 4IS2A 1RAEA 3QVOA 4M9JA 2W2KB 4B4DA 1JR3D 1A9XB 4NLGA 1DIAA 1TF7A 5AM5A 1DG9A 3EXHC 3UOGA 1GM5A 4MA4A 4ODIA 2WU0A 3FCAA 3GDFA 8ICEA 4NABA 1W2WB 3QKRB 2ZWPA 2OO7A 3IQGX 2FSHA 1MX1A 1O87A 2HRRA 2YYZA 3SF8B 1TUEA 2IH2A 2C3OA 2MSWA 2E8OA 1JYFA 1RZVA 3EJ6A 3MRSA 3TFOA 4QUBA 1MEJA 3LYUA 4U2CA 4QDTA 1NSYA 3F3YA 4D9FA 4EJ6A 3I6QA 3SI8A 3C6MA 4U6PA 4OJMX 3F3KA 1CYDA 1B00A 5C7IO 2NRZA 1COKA 4GOXA 3EHEA 1WOMA 3F49S 3PE4A 1KZ7B 1PW7A 4OBEA 4W9NC 1NF2A 3JVEA 5B3KA 5LDDC 1OT5A 2FLWA 4IHQA 2H3IA 4F97A 5B57C 3ZCXA 3ROZA 1I2BA 2ZRMA 3FFBA 2JFNA 3WAJA 3DKRA 3AVYA 3GAMA 1NK9A 2HHAA 2Q3JA 1GDHA 4EPYA 1JAHA 2IW3A 3KD3A 1RI5A 3NVMB 5AP9A 2XMCA 1W35A 3GJ0A 1FA9A 1PS8A 5LDHA 2HR1A 3S8EA 4Z6DA 1H9AA 4GZ3A 1VBNA 3O83A 3M6MD 2H08A 4G5OA 3WGZA 2WF7A 4BJHB 3KKAA 4EHHA 5KWSA 4KZPA 1LEHA 2FQXA 1BCSB 2JEOA 2XV1A 4QQNA 4RDXA 4NM1A 4N3AA 3F6SA 4LMBA 5EIXA 5SZHB 2D0OB 3LUFA 1MX3A 2SICE 2XMDA 3L4PA 3F9CA 2CKMA 4PHGA 2AEEA 3CEAA 3LCCA 4DG5A 4TLLB 3OTOB 3PA8A 2HSWA 3RR8A 1E61A 5IJ0A 2ASVA 3KEMA 1L5MA 4FR2A 1YHZA 3BD6A 3PA6A 1L4LA 4C0WA 2FGKA 1LWOA 4WVLA 4BGDA 5AKGA 3HU3A 4R5MA 5AOCA 4EP1A 4Y2UA 2ZTVA 3SXUB 3D6AA 2C42A 3OCYA 1WAMA 1PV4A 1T3QA 2XYHA 2AS0A 2J09A 2Y2UA 1ZRNA 1KEEB 1KJ8A 3UFXB 4M47A 3VMFA 1CEYA 3UJCA 4Z9YA 2OM6A 1J0EA 5E4FA 4BV9A 3ZDEA 1MC4A 2RG7A 1BA3A 3JAKB 4WZ6A 4HGZA 3PD0A 3CVJA 3FETA 2RK6A 3G2OA 5ADHA 4BNDB 3REQB 3QE0A 1MO5A 5K3AA 3SC2A 1PFUA 2OB1A 4MEYA 1KY4A 4D46A 4DVGA 3GEHA 4B8ZA 1TM4E 5KL8B 3EDQA 1ONOA 2VPZA 1N5OX 3R77A 4F0JA 3CBGA 1K92A 3ZUPA 3EGDB 3FCCA 1NURA 4ED7A 2CXRA 1P1IA 3AGQA 3OE7D 5DI3A 2JGNA 2NGRA 3UMCA 2DPXA 1LVUA 1JZSA 3LCRA 2AJCA 4E0BA 5K9ZA 1YWGO 5L8VA 1NMXA 3FIUA 4G4SP 1OGJA 3TF5A 3TINA 4XTCS 4CL2A 1KVRA 1SV0A 1ZQYA 1ZVKA 1AK2A 3I73A 1GN9A 3LO5A 3H3JA 4YFYA 3PS9A 3N3BC 5CPBA 1UPCA 5CFRA 4LQDA 3G6KA 5BWCA 1V8DA 2VBGA 3UJAA 2KN7A 4A23A 2FV8A 4CEJB 3NVDA 5CCBA 1BOFA 1Z4PX 4G5FA 4EZ6A 4QC2A 3IE0A 5DU2A 3EGDA 3VZPA 1CIJA 1W0JD 4HUQA 1Q1BA 4G6ZA 4L15A 1MDBA 5TMBA 4F8EA 3N7SC 3KSUA 3Q7SA 3VPSA 2WD9A 1ZKDA 1IHYA 4CMGA 4DJJA 3DAYA 3G2MA 5EPUA 2HL6A 3WZMA 3C24A 2EG9A 3K9WA 3P9CA 5BURA 1PK8A 4EBDA 4FEAA 2C2ZA 2IITA 4MB6A 2ASJA 9ICUA 1PWHA 1UJNA 2PGDA 1Q0UA 5CDFA 2ZBUA 2C1ZA 1RPLA 4JT4A 3VU9B 2BN4A 3LSYA 2PXAA 1E0KA 5F3RA 3JS5A 1R16A 3SHQA 4QLAA 5FOUA 2KW5A 3CX4A 4UUNA 5K51A 2PKEA 5KFAA 2I5HA 2ZU6A 4LHZA 3B7GA 3KWJA 1TW2A 1MB9A 3B6IA 3JPQA 1DIHA 5BN5B 1RFLA 2F8KA 4HAIA 3GGGA 5LQAA 1E6MA 1JKIA 4UDNA 1GG9A 2VHXA 3KO8A 2VWQA 1Q74A 4NI5A 3JQ8A 5HBRA 5KNCD 4JX8A 1R6AA 2OWOA 3TGLA 2W2VA 2ZTUA 5EESA 4ENQA 3ER9A 4Y2VA 3DZFA 4IIEA 2PX0A 3N2NA 1KRWA 4TL7A 3PDJA 2PQ0A 2ZTHA 4JNKA 4RACA 4YONB 5U4QA 3WLRA 3IA2A 4DQLA 2J1LA 2W00A 3F2VA 2GN2A 5EEHA 1VG0B 3EXG2 3LQKA 5KYWB 4DAOA 2AFHE 4MVXA 1OVMA 1C9EA 2IUEA 4YCDA 1Z12A 1MOZA 2VUHB 3HJHA 4B6QA 3TSOA 5BN3A 1KK2A 2E6KA 3ZD6A 5I7HA 3I9KA 4DQRA 3ESXA 1U2RA 2AF4C 2BKUA 3BL8A 3HEMA 4L2IB 4AMUA 5J2DA 3PSIA 1YBAA 3EOAI 2GRUA 1X74A 5CA1A 4UBOA 3NBQA 1CJCA 1T36B 4GX5A 3J81A 1Z5UA 4A26A 1Z7EA 2HU7A 3O4GA 2DGDA 4G5QA 3S68A 2IYRA 2C2HA 3M9LA 3PW5A 4DXHA 2EP8A 1JQKA 1MORA 4QBGB 4Z0HO 2G3YA 3LWBA 2CFIA 3GB9A 2ID9A 4TL9A 3RC9A 2JGMA 2HA7A 2PJRA 4LDRA 3H0KA 4ZAZA 2NRWA 4EI7A 3RANA 1GAWA 4KCGA 2XH8A 3FFWA 1L7PA 4PYNA 1SQ6A 3VHXA 1CUYA 4OD0A 5CD9A 3TNLA 4DEVA 2E5LB 1VP9A 2QSJA 1E4EB 2IDMA 3LPMA 2HJWA 1Q92A 2PX4A 3F8TA 1ORTA 2CXSA 4DSKA 1DX4A 1US8A 1Q3TA 3GDXA 4EW6A 4IJUA 3O31A 2NWQA 4YCLA 5KNDA 1B6SA 1DJNA 2YXNA 3DM9B 1ZFNA 5LMCA 2C2KA 2IYYA 5DQHA 4GYKA 1XIVA 2HCBA 2ZQ5A 1DBWA 2XJ9A 1S5LU 2FEPA 4GIBA 4AQYB 3RJ5A 3HNRA 4ZAYA 4EEYA 4F4ZA 2EV9A 1PEDA 4C8LA 2L17A 3CVOA 1PDOA 1DWOA 1STOA 2XXJA 4XIFA 3QH4A 4UB5A 3WKDA 4DSLA 2P4EA 2HBZA 5CK5A 4DDKA 4E31A 1XVUA 2JHAA 4JI0B 3TAPA 1PKXA 1A2BA 5ALJA 2BW0A 2K8AA 2PXHA 2P91A 3DNFA 1RKXA 5A05A 4MWTA 4JXZA 2Q6TA 2QX9A 4KLMA 4DV2B 3LUGA 3OFVA 4Y6LA 5FI0B 1EGQA 1ZNZA 3PJDA 4NS1A 1PG2A 4PCAA 1H6BA 4PGQA 4N4AA 3QYAA 2Z9CA 2MMCA 1XC7A 1ZOLA 4NIMA 3N7PD 2XQGA 2HQBA 221PA 4Y1FA 2GLEA 5DBHX 5AHXA 4AWXA 4CM8B 1V0JA 2NXCA 1A5TA 1EEXB 3FTDA 2OYYA 121PA 1X92A 1XD9A 2BEVB 4TQSA 2WWFA 3QF4B 5CB1A 2Q28A 3IEXA 4RLHA 5GZ6A 4O1MA 4RY2A 2ZBEA 1RWVA 3ZV7A 5KTYA 2KIVA 3OM9A 1LSUA 5A7HA 2JDID 3SSNA 3ZJVA 1H8HA 2X5NA 1HO3A 1V1JA 4TV8B 1XCPA 1E1LA 2OFWA 3NRZA 1USUA 2W6ID 4WXMA 1V3UA 4X8MA 4AF6A 2LM4A 2W8ZA 2CXOA 1UP6A 1FPMA 1ECFA 1NKTA 1NW6A 3TZQA 3X1KA 4LSWA 2RC6A 2NN3C 4AP5A 2NRTA 1N5MA 2VRWA 3RNOA 3RR7A 3SJAA 3SHFA 2ZS9A 1MJ5A 2CY0A 2ZSBA 2O3UA 2ZK7A 5F9LA 1G20A 4WZBE 5DBIA 4HGOA 5ALXA 4NTZA 3NIDB 4GKBA 4O4JA 3TW4A 1L4BA 5DGIA 3U4CA 4D8WA 3BH7A 5K05A 2BFCB 3TL2A 2KE5A 2P77A 3E3AA 4IGIA 2FPIA 3BAZA 4CW7A 1M1XB 2YW9A 3O8OB 4WA8A 3WYGA 3V7KA 3KPUA 3D6FA 2P9BA 3VR6D 2GPTA 3PFFA 5AJXA 1KDRA 5KEIA 3C1TA 1QUFA 2ZQZA 3QMPA 1ZQHA 5DBFA 3II6X 2DLDA 3NTXA 4IIXA 5DYGA 2QMHA 4XUGB 2CDBA 1L3IA 1R5JA 2GTHA 3KOYA 1K6JA 3FOCA 4HH4A 2B1QA 4BJ1A 1Z2AA 1B14A 4BNYA 1BX3A 3CHYA 1FJHA 1R0KA 4H1UA 2OGUA 3WGIA 1POWA 2ZITA 3O2JA 3VZSA 1LTHR 1EIWA 3ZDAA 4K6OA 1P3DA 2ZRAA 2RI0A 3R5TA 4X1KB 2TYSB 3ZXIA 4ENUA 3ANSA 4Z3OA 1O3YA 1TC1A 3QX9A 4FSHA 4BQFA 2IHBA 3SYNA 4DC9A 3HM2A 4JXXA 2QORA 1CS0A 4C3VA 3S81A 2OBMA 2Y1WA 3UN1A 2UYCA 3RB8A 2ZSDA 2MHCA 1FTYA 3HE3A 4L8LA 4BNHA 4I1SA 4X45A 3RJIA 1XHLA 2V6JA 3JTMA 3DS8A 4N40A 4Z6CA 1AC5A 1R9JA 2HTFA 5ES4B 4UE6A 4MR8A 3HBLA 1LX6A 2G08A 1DJPA 2AB0A 4QX6A 4X1KA 1C9DB 3U7HB 3KOUA 2JCGA 2R1TA 4NMLA 4EMSA 3L9WA 2JI7A 1FFEA 1NIJA 1ZGAA 2V9CA 3AR8A 2FR8A 3FOZA 3WL4A 3N39C 3MAAC 2UYHA 4RTOA 1F51E 4V0LA 4AUNA 1ZD2P 3IXMA 3U1TA 1FOEB 4XQEA 4D3XA 2C3YA 3O8BA 2ZM6B 3A04A 3QXGA 2NSHA 3CURA 5C1DA 2CC2A 5IXSA 1INLA 1MA3A 1RRVA 1JJ7A 4BUJA 4P86A 2E55A 2GK3A 4QEDA 1UFRA 3L1VA 2EDAA 3PZBA 2B92A 5H02A 5MF6A 3FAZA 4FC7A 4Y0VA 3HU1A 2GZHA 1D7AA 1P4JA 4J0HA 3GIKA 4AJ2A 5JTUA 4LIPD 1NWHA 1W44A 3CZ4A 1RYMA 3ZHSA 4BN5A 4EHJA 1CJMA 3TECE 2ZRIA 1MV8A 3DUFB 4EM6A 1SKYE 4J7UA 3ZGLA 1NNEA 1VLLA 2QVLA 3O2QB 1DU4A 3TSZA 1JN3A 1N4DA 1XSLA 2M6SA 4R81A 5IC4A 3CUWA 4BWGA 4QZIA 5IBCA 4NLLA 3JYLA 2IYOA 4QUGA 2Q2WA 1K63A 1SCIA 2W9XA 1KFSA 1N2ZA 3ROGA 4Z4CA 5CVJA 2ZT8A 1X9HA 4ZI7B 4ECAA 2I4OA 3IBYA 2GAJA 2IE0A 2ISSD 1P0QA 2A7XA 4G8DA 3WNQA 2CLKB 4H7DA 4OJ5A 4JHXA 2H3QA 2PUWA 5AHWA 3R3JA 1CV2A 1S76D 1U7XA 2JLCA 3TNFA 1WUIS 3M6WA 5A03A 4LC9A 3E8XA 1FS6A 3LM8A 2B0JA 5EG5A 4UAUA 1QVZA 4CN9A 5AKZA 4QUKA 2G9VA 5JXWA 3QMVA 2ZE7A 3FNHA 3WL7A 2PN1A 4Q8FA 1ZQEA 4N39A 4RK7A 4BMVA 1C7FA 1N3IA 4D8XA 4CNQA 3O8OA 1TAUA 2ZR0A 3PIDA 1J8QA 3AL2A 2C5HA 3E9NA 2FPPB 2DM6A 3JZDA 4FGUA 4PR3A 3SEIA 4L78A 1Q3UA 1ZOIA 3AESA 1W581 2YXDA 2PGJA 3IP1A 1ITZA 1UEJA 4DDTA 5JROA 3CKLA 5CLFA 2GGSA 3B6EA 3MMXA 2XT0A 3Q85A 4F6RA 4KITB 3DVAB 4E6EA 4O5CA 2FSSA 2GPAA 3H9BA 4JP2A 1BDMA 5KYVA 1WWVA 4HV4A 3A1WA 3QEMB 4NG4A 4UOQA 5LFAA 2R3SA 1QTIA 3KUKA 1MB3A 1E2GA 4P58A 1IMOA 2WVGA 1YZ6A 5JAOA 1IOWA 4LX8A 3MJRA 1KZYC 1EAMA 5ALNA 4B9NA 1X7YB 1XZLA 2FHPA 1A27A 4GRDA 4GWGA 4TLAA 1EE2A 1RJ9B 3U60B 4UBJA 4LJ6A 1JQ5A 1JH8A 3ASVA 1XQ1A 5D6OA 4M9LA 1P1CA 3UC5A 1TMKA 3V5NA 3DJYA 3WNBA 1Z73A 3JRXA 4UHDA 1EFVB 3R8CA 1E9BA 3N1UA 1K5PA 4P80A 5G4KA 4QDJA 1GCGA 1OTHA 1PJTA 3JQ7A 1XDWA 5JNVA 3FSGD 4RY0A 4HAWA 3HP4A 2IYVA 1VSVA 4LE2A 1YDWA 3GRPA 2WT8A 4OU4A 2H65A 4YPFA 5B5EU 5L1LA 1JEDA 2RAUA 4UU0A 5GPBA 5JZ9A 5KFVA 2P6MA 1PNVA 3L8GA 4PZDA 4NPCA 4KXYA 2WZBA 4CJXA 1BYUA 5LBTA 4XA5A 4EY6A 4LRWA 3L0IB 1S2LA 1G7TA 4TSFA 1JDPA 3T3FA 1MV5A 4E32A 1PX2A 2ZAIA 2GJSA 1K3UB 1YZLA 5CH5A 1HNZB 2PWPA 5AI0A 3MJHA 2ZJ2A 3OT1A 1C4WA 3EQ2A 2ACEA 4CV1A 3CVVA 1AKQA 2ZUSA 3HH8A 3NMUF 3MSXA 2AR9A 3O4VA 3GDGA 4L7QA 5F21A 2VJCA 1R00A 4Y2JA 1QRAA 4JOSA 1GTL1 1DMRA 2XTMA 3KXLA 2Y99A 5AVXA 1HT3A 3LLCA 1IZZA 2AHOA 4X97A 5UKDA 3ICEA 3CSSA 2ODBA 2ATXA 4IDDA 3AY7A 5FWYA 2C5FA 4GT1A 3U44A 2F55A 3ZZ0A 3BMNA 4OI0A 1NPTO 2WW8A 5E1OA 1H2YA 2Y0EA 2WKSA 2XDAA 3B20A 4JYCA 1GA1A 2OM2A 3QPAA 4OGGA 1TZBA 3WHPA 3IT1A 1G9SA 2HPZA 3CW8X 3DEZA 3ZY2A 2ADOA 5HIMA 5FDFA 2QVBA 5K8JB 2FQYA 4UCQA 3WYEA 3E61A 3HCAA 1IQRA 3PB3A 5FYQA 3VO9A 4HXGA 5IPFA 2VJ4A 4F4IA 1AM4D 1XCMA 2M98A 2MAXA 1LSOA 2Q1YA 3GVCA 3LAWA 3AB7A 4KE9A 5A0VA 2XSZA 3WADA 2UKDA 4E88A 1ZU4A 2LXNA 1LF0A 1Y5NA 2WR8A 1JJBA 2X1MA 3B9PA 4XXHA 1FP1D 3LX8A 1ILWA 3W2EA 1SVNA 2FEOA 2NAFA 5U4XA 5K01A 3HLYA 3WFZA 2VBIA 2VP4A 1U0NA 1A88A 1SHZA 2QJTA 5CCDA 3RC8A 3EVCA 3ORYA 2X0JA 4TX1A 1UZMA 5TXGA 1RM4A 4Q37A 3RFVA 4DQQA 4R2JA 5AJWA 4CQLB 4DLNA 3ADCA 2QTVB 1U04A 3NKFA 4YYZA 3CH4B 3DMTC 2QTAA 3MEQA 3UF0A 4JXJA 1G5FA 2C5BA 5J8YA 4Y0NA 2X8JA 3A2KA 1TQ6A 5J0XA 1EK0A 2DOKA 2QD1A 1ST2A 4K6MA 3WTBA 4H3HB 4RV4A 2OYRA 1V6CA 1V2HE 1IULA 5KAIU 5ALWA 1QSYA 3F97A 1QR6A 1DTWB 1MXFA 3R0VA 1RAAA 1QB7A 4U7GA 5EP1A 4JEHA 2NU6A 3TLKA 2CXPA 1YZGA 1YL7A 5FRDA 2WAQF 5JU6A 4J7AA 5ALKA 2QN3A 5BW4A 5EIBD 4ZVVA 1ECBA 4UEWA 4F86A 4KE7A 3KDPA 4RA6A 2BP7A 2KJ8A 2EEPA 3H0RB 4KDEA 3UXEA 4AUEA 4PN7A 2QPAA 4QDXA 1B0AA 4R2WA 5FFFA 2CB0A 5HILA 3GJ5A 4OFZA 4PICA 1YL6A 5D4BA 4L4YA 3ZCQA 1KBOA 4PG8A 2J0EA 3PMNA 4D0GA 2VBCA 3KFUF 2YNMC 4BCCA 1M73E 3F98A 4CEHA 2ESEA 3HI4A 5F7JA 2W03A 2XEDA 1MZVA 4RIEA 3MT8A 3T7CA 3YASA 1I2AA 3GEIA 1QG2A 4ZT5A 3ZQKA 4BECA 1K7YA 1EH5A 3UTDA 2AKEA 1JTVA 3K1AB 3BWVA 3L02A 4YECA 1FVXA 4Q01A 4QW9A 1L5LA 3UTCA 5DB8A 1HY3A 5CEEA 4BQPA 5JC1A 2A94A 4CIAA 3FHCB 4F4FA 4LHYA 4YR2A 3ZK8A 1GARA 3L0ZA 4UHKA 3C1OA 1F8YA 1LGYA 2GDJA 3K2IA 5LN1A 3A1CA 1O94C 2VPPA 7GPBA 4KR0A 4CKEB 5C0YA 1RWNA 1CJUC 3MGKA 3ETLA 1BWSA 3OT1B 4YASA 3WWYA 5CA1B 3VR2A 4PWYA 1RBMA 2XD4A 1NWCA 3BZCA 2W8LA 1FP7A 3VPCA 2Y71A 1W2HA 1YJQA 3HZOA 2BMWA 4KUGA 3V8QA 1MRZA 3K1AA 4GPZA 1QGZA 4A2QA 5H8WA 4KMMA 3KHUA 2F1IA 2BGMA 2QMEA 1VM6A 3K4GA 2VK2A 4FW9A 1GZ4A 3DO8A 5DV9A 5FULA 1BPEA 2PEZA 2VA9A 3OPXA 4L5IA 1A5AB 4B6FA 1E2QA 2WT4A 1XF9A 3DAOA 5KBYA 3BZBA 2ODPA 2Z04A 2ZYDA 1QWOA 3DA8A 4BNWA 5J47A 4F4XA 3EFEA 2RHLA 5JYEA 2VCEA 2FWJA 5G0WA 3DDHA 4ZVOA 2E4XA 5PNTA 3KEGA 1GITA 3S3TA 2GN8A 2OV2A 1UXHA 3OQVA 2FMFA 2CDRA 4DJEC 3AH8A 5DNEA 4ZAXA 2WV9A 2LYBA 1HV8A 4OFBA 5E3IA 4ZQBA 8ATCA 3RVBA 3WIEA 4EG1A 4YMGA 4ZHSA 1IY9A 2I1VB 4JQYA 4R69A 1NBHA 4KVZA 3IO5A 9ICRA 3BQTA 3DTVD 4DF8A 2QTLA 2Y1XA 4FFBB 4HB4A 3PW2A 1IV8A 3OZGA 3I1IA 1KPIA 1EP2B 4R8UA 3PGLA 4J91A 4KYUA 2XUFA 3SYKA 2HMTA 4OA8A 1KO8A 3PT5A 1UANA 2WWXA 3N0WA 4QASA 3SDZA 1QG6A 3HB7A 5CT9A 2CMGA 5PGMA 3ISBA 2NX2A 3PVSA 1O08A 1CEQA 4MKIA 3WQBA 3TADC 2C9MA 1JE1A 2FYTA 3AYZB 1GKIA 3P71T 3PGKA 4NFYA 7ICOA 4P2GA 4YP5A 1KF0A 1OZFA 2AIRA 3G5AA 3LT2A 5FBZA 3GIWA 4LJ5A 1UKYA 2FTKE 4Q3BA 4GMKA 3UWKA 4V0NA 2XUQA 4YK7A 1MPTA 5ALEA 1W94A 3K1TA 3PR2B 2ISPA 3UXOA 1ISPA 3N8IA 2YQ4A 3DZKA 3TM4A 1XQXA 1UQUA 4WFIA 4LAFA 3BREA 3PX3A 4JJEA 2MYNA 3GW8A 2ETXA 5SY6A 3QE4A 4LI0A 3THWB 3PQ5A 1QE3A 1I2ZA 1M0SA 2G04A 2H57A 1I2DA 2WIBA 2ZT6A 1XEXB 2D2EA 1DWQA 2H6EA 3I04M 3NS7A 4JQCA 4PLTA 5CEHA 2G25A 5DP1A 5SV2A 1W36C 2JIZA 2FMSA 1IXKA 3ON5A 1OXKB 1CZOA 1X1SA 2BEKA 4WK4B 2VF4X 4HGNA 3UENA 1GY8A 2BP7B 2YTZA 2J6HA 3KOXA 1EUDA 4BRSA 2PM8A 1LNQA 2YJTD 1JIVA 1I01A 1NVUQ 1U4NA 3DQQA 3TKLA 4CMEA 3L6OO 6GPBA 3L0YA 2HJGA 2KZ3A 1HDIA 1DPFA 2Z1MA 4MQFA 3TNYA 4RSHA 4UAVA 1NXWA 2IEZA 2HEGA 1A7JA 1KBZA 2DWCA 3FZQA 3IVRA 4EF6A 5BT8A 1ABBA 2VAVA 3PQFA 1TECE 2CLSA 3UWPA 3WLOA 5JALA 2VA2A 2YWFA 1CFJA 3L8DA 1SXPA 4M9SA 3EA5A 1RYEA 4XJTA 1S0NA 4QUIA 5C8DA 5MGNA 2WJHA 3VUEA 4ZJZA 5MN5A 4O4JB 5EWMA 1UXJA 1Z39A 1LNZA 4ZJYA 1NQXA 3HDYA 2OWEA 4J0GA 3CG0A 4LF4B 3D3JA 4DNPA 3H2BA 1SUAA 1PIWA 3AY6A 3MVEA 1T1SA 2PX2A 5ENDA 1PQUA 1LPOA 2REXB 3HVJA 3WGOA 1QRUA 4QYXA 5FWXB 3SD7A 3AUAA 1HFWA 2RHFA 1CNFA 3S5JA 3MJ4A 5I48A 4H4DA 4XOIA 5ICFA 5KVQA 1WVMA 4ZGWA 4ICAA 4FFOA 2Y93A 1KGDA 1N1DA 2BC9A 1M2HA 4V24A 2F17A 4D81A 3MR3A 1EB8A 1Z68A 4HL6A 4XQ8A 3W7VA 4DXDA 1ZI8A 2OV8A 3BCRA 3RTEA 2P9GA 2UYOA 2REOA 5DHSA 3WYBA 4KVAA 2FPLA 2GN6A 2R8OA 3E6AA 3VVMA 5KFPA 4ZIRB 3WDLA 4LZZA 4OKSA 4AB1A 4BNGA 2JI4A 3IKTA 3LLUA 1N1GA 4A3SA 2GLXA 1G2OA 3G82C 4R2LA 2PWYA 4YUAA 2VJYA 1BWQA 3HDVA 4OP3A 4AICA 3WLNA 4AG3A 5FLEX 2A33A 3P9RA 2JLRA 2JLVA 1SXJC 1WTAA 2DFPA 3BD9A 5BORA 2HDOA 2HQ1A 1HC7A 1Q12A 1WSAA 3MILA 3IG8A 2C99A 1NXSA 2I4NA 1Z6GA 4YWJA 4MV5A 5IDQA 5HF8A 1RP1A 3V2UA 2FE4A 3O26A 5JVDF 4AJJA 1BXZA 1ZQVA 5F9NA 2QZSA 3V7NA 3ACCA 3T3PB 5JZBA 2QDXA 2BGJA 1OWLA 1JEOA 2ATCA 2HLHA 3BL6A 4IDEA 3TFQA 2K87A 3LIPA 3FB1A 3NWEA 4ETMA 3OZUA 5K0JA 1BW9B 3UMBA 4JBWA 1MXHA 2M1ZA 4J8PA 2VS1A 1WF3A 4EHLA 5J2HA 5BV0A 1FUUA 3BORA 4UPEA 5JNTA 5IIIA 5JR3A 5KX5B 1WV1A 2WTNA 1I0LA 4H18A 3MQFA 5BOVA 5AESA 2W54A 5CX1B 3UJBA 4MQBA 3Q3GE 1MJFA 2EJBA 4U0KA 3R3YA 2OY0A 5JJCA 4FYHA 3DFMA 4C0KA 3VDRA 3DV0B 3RT1A 3CR7A 1M75A 1R8JA 4YXJA 3AIIA 4UU8A 4ZVMA 1PTJC 1T0UA 4FGLA 1EQUA 2JRLA 4GHWA 1ELOA 2EW8A 3V33A 4EW3A 5E8RA 4ZD6A 1TD9A 2VOJA 5EIWA 4RWZA 2XBLA 2V8BA 1UBEA 4QYSA 1RHRA 3BS4A 4KLNA 5HHHA 4QGFA 3ZE8A 3ZX4A 4DQKA 2YDXA 3ONFA 4PANA 4ZN6A 4DOCA 1M8KA 2PS9A 1Q11A 3MGVA 3P97A 2IUTA 2NTNA 4MYTA 1GYRA 3UB3A 4KGDA 4AJLA 1V85A 3PWTA 4NBUA 1GA4A 3MD0A 1I6LA 3R5KA 4KZKA 2ASDA 4NBWA 1QGDA 2GCOB 1ZQKA 1K9VF 4LZLA 4G0PA 3TLMA 2NYAA 4OX9Y 4B43A 1G3IA 1K86A 1UKCA 2GHTA 3GDHA 4MEAA 4OQDA 4W7IA 4AYXA 1A5BB 3DXXA 3EG9B 1QM5A 3ZZNA 4K4IA 1JKFA 1NVVR 3FDXA 4B09A 3H7IA 2BJWA 3JQ9A 5GWXA 4YJ2A 5KNLA 1N36B 1FMFA 3Q4GA 3WVNA 4A10A 4OJOA 2ZVQX 4RQ5A 1DXYA 3R20A 2FQQA 3FNGA 4P8RA 1ECJA 4RIGA 3FWPA 1QAMA 3OJLA 4UUBA 4XGIA 5DZSA 5C7LO 5CP2A 3CKMA 2ZGVA 1XNGA 1KFKB 7ICRA 3A8TA 3GCGA 5KOYA 1P0FA 3EG5A 2P2YA 4ZDWA 4LF7B 1QVVA 4P33A 3NBYC 5EE5B 5HCIA 3VZBA 5I4KA 3U0VA 1IBCA 1GFZA 5KFRA 2PFSA 1XN1A 5BNFA 1Z0KA 2OR3A 2FP4B 5ALLA 2EX1A 4Q6WA 3VZCA 1JWAB 4UB1A 1ISGA 3P9PA 1WXXA 3UMGA 4R1MA 3LVFO 2PUVA 4MEBA 4JK3A 2WFAA 2PZGA 3IHKA 3RS0A 3RBZA 1E3DA 1P9NA 2BFNA 1Y5IA 1LK5A 4MW4A 5C46F 1T5DX 4DSEA 1K4YA 3P5SA 1WMBA 3WZLA 5LJIA 2AFIE 5EZ6B 1AY0A 4PPGA 4EQ6B 3HPQA 4KRFA 1BWPA 4RKFA 4BFTA 2IS4A 3L2OB 3GXBA 2ZJ8A 1KYIA 3LT5A 2GCEA 2WVJA 1XTJA 2J6TA 2E18A 4R6XA 5DWDA 5EJAA 3TSWA 4C0SA 1T13A 1N9ZA 2CJYA 3LHDA 1JIJA 4G63A 4TLCA 2GRAA 4IFTA 1SKMA 3MWDA 2ZAMA 3OJOA 1DQNA 3VSDA 4AQ7A 4KWHA 4MS4A 2MA1A 1P9OA 5G40A 3WP0A 1POXA 3PJFA 2KHQA 4E22A 2MT9A 3RAFC 1E2IA 2BZSA 1YFZA 3HB0A 4H3SA 5IUJC 3A70A 4LI3X 4MKHA 1TLFA 3SOPA 4BFLA 4LMRA 3QIVA 4RPYA 2GESA 3FGOA 2C2DA 1XWWA 5AI4A 2RIRA 3OQNA 1RABA 1RXUA 4NCAA 5E3HA 1V7CA 4EL0A 1YA6A 2Z58A 3UKDA 2QXTA 4ARSA 1BVSA 1IIRA 1S2MA 3W79A 3HU5A 4UMFA 2A0YA 5ECGC 3FHTA 3ID6C 1YC2A 3BUSA 1HFJA 4FW8A 4HNRA 5GGXA 3ZWDA 5ADUS 5K2OA 2A3RA 1X40A 4L85A 3F6CA 4FK8A 2ZR8A 1H9CA 3LVWA 1KI8A 1CUJA 3HGTA 3NEJA 1BKDR 2GA9A 4BP9A 4A2PA 2E1PA 1F14A 2CXQA 1L5KA 8ICMA 1GZDA 1EX9A 2R68A 2UVDA 4ZCMA 2WA2A 2BGGA 3PRJA 3UMVA 2CV2A 1XT6A 2BSQA 4U2EA 1RPZA 2AHOB 5KFFA 4P7GA 1R88A 4Z9FA 3RSGA 1FQJA 5AVRA 3QUSA 2IS1A 4Z7OB 4ESEA 5IVKA 2H18A 1F6WA 3PUVA 3Q1KA 5EGSA 3H87A 4NFHA 5ELLA 2QHXA 2QSYA 2ZE8A 3IP8A 3UQZA 4CFYA 1JH9A 5K8IA 3ETRA 3PFKA 2UVRA 3TJZA 4EK9A 5KNIA 3GLSA 1XU7A 1R18A 3CJQA 2P4SA 4FE3A 5E7QA 3UAXA 4ETIA 1ZA2A 5BV2P 3LF2A 4WWHA 4A0GA 5FTLA 3C5FA 3VPXA 1FNMA 1C20A 1SGGA 2OV6A 1U0BB 1P4GA 2XUZA 4ND7A 4BRUA 5IFKA 5JASA 4R66A 3B0YA 4FZMA 1NVWQ 2R8PA 4RZQA 2FPGA 2VP0A 1EVZA 3D5QA 2WF8A 1N2CE 2YWCA 2OECA 4Y2GA 4TYMA 4JXKA 3ROMA 2ZULA 3F5DA 1XRJA 3L1JA 5JE8A 2W0SA 3AKZA 2GVZC 1OYVA 1ZKMA 1Q3VA 2WZQA 1N0VC 2XODA 4LRUA 4PRLA 3UW3A 4CL0A 3AW8A 2MYTA 3A3OA 2EEZA 3RRMA 4D74A 4ZYUA 1R0CA 2YIDA 5DYWA 4CVNA 4RMNA 2M6KA 1OPXA 5JCOC 1CR6A 4CQLA 4ARVA 4ZWNA 5C8YF 2XTJA 2VWGA 4BLQA 3VYRB 3CX6A 3MUNA 1ED1A 3JD0A 4XARA 4YBRA 2TS1A 3GFFA 3QKIA 1AHPA 2X9GA 1UJCA 1WZ2A 1ZQBA 2OLEA 4Q24A 5A4JA 2HOIA 1Y5MA 4AECA 1Y9JA 4UB2A 2Q0ZX 1VSUA 3I42A 3PFCA 3RAPR 1QG4A 3THOA 5JYCA 3CLVA 3QKTA 1KQPA 1FTGA 2MMGA 4HN4B 2C04A 4L5BA 4LXUA 3W8FA 3MBIA 3K9BA 3GNLA 3GOHA 3W77A 4I8IA 3TL6A 2RQ5A 3TTVA 5C18A 2OEHA 3RJ9A 2VSXA 3WOHA 4EMTA 1XVIA 2UZ3A 5KVAA 4DKXA 3O8RA 5BVGB 4QWDA 1SFRA 1XZEA 2XOKA 4BO4A 2BF4A 1JPVA 2QTWB 3ZQUA 1LSSA 1MB2A 1GFSA 1KZGB 3P0EA