3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
2JAWA 5AVZA 5AI8A 1Z4QA 3U26A 1S2OA 1L8LA 2W11A 1RKVA 5AKLA 4Y2TA 3AR8A 5A3RA 3DNPA 3ZX5A 3DV9A 3HLTA 2B8JA 2FEAA 1Z4KA 2FPWA 1YJ5A 2YMLA 1Z4IA 2G08A 5ALDA 2R8EA 4CNQA 1U02A 3B9RA 5AK5A 4CF3A 5ALEA 2MU1A 3R09A 3ZX4A 3W5CA 4UMVA 4EELA 3WKAA 3AR3A 5ALGA 3WK4A 4AS3A 5AKIA 3FPSA 4OHFA 4YIHA 2YMPA 5FP0A 1ZRMA 4J03A 4UMEA 4OCZA 3R4CA 2ODAA 1T9ZA 2HX1A 4ZEVA 3WK7A 1Z4JA 3U19A 4EZEA 4L6AA 3SD7A 4BYGA 1Z5UA 3B8EA 5AVYA 2HHLA 1Z4NA 3WK8A 3QLEA 2B1QA 5AVVA 2FPRA 3ESQA 3KOOA 3L8FA 4IFTA 2B0CA 4XOUA 3QNMA 2Q5EA 4KNWA 4YH1A 3ESRA 4NFLA 1VJRA 2C88A 2WF5A 3WKEA 3W5DA 1T5TA 4HGRA 1WZCA 2YJ4A 4NWIA 3E8MA 2BDUA 2RARA 3PGLA 4UMDA 3KD3A 3OCWA 5AM3A 5IS2A 1RLTA 2JAUA 3QGMA 5AVWA 2EARA 3IJ5A 2IOFA 1YNSA 3HYCA 3OCUA 1CR6A 2ZOSA 3N28A 4MUMA 3DAOA 2C8LA 5IT0A 4UAUA 2YY6A 4UARA 2AMYA 5ALXA 1PW5A 1F5SA 3NRJA 3QUQA 3AR4A 1EK1A 4NABA 4F71A 1RLOA 4C4RA 4HGQA 4RESA 2R8XA 2JARA 2GMWA 1LVHA 2OA0A 2RAVA 4UM7A 5AK4A 3L0YA 5ALMA 3QUCA 2B82A 4UM5A 3RF6A 2C8KA 2OYCA 4H1WA 3UMCA 3ONNA 5AM5A 4XQ0A 3I1YA 2Q4TA 3PGVA 2FI1A 2ZG6A 4Y2UA 3EF0A 3L8EA 3OCZA 4L57A 1AQ6A 3QX7A 4Y2JA 3VAYA 2IA5A 2WF9A 3A1DA 3NAMA 4EX7A 4BBJA 5AW4A 3CNHA 3PDWA 1ZD3A 4YCMA 3NASA 3ZI4A 3A1CA 3QUBA 1TJ5A 3D6JA 2HF2A 2FPUA 3U7FB 1L7OA 3WGVA 2P9JA 5AI9A 2ZBEA 5AW9A 3OCVA 2AH5A 4F72A 1RMQA 1WPGA 3AR5A 4BX3A 5AICA 4YCLA 2YMQA 2CN1A 1XP5A 3ZU6A 5ALQA 3ZTYA 1JUDA 2CFTA 4FFDA 1ZD4A 2ZBFA 3SKXA 2WF6A 1MH9A 1YV9A 5T41A 3N1UA 2G07A 3FVVA 2X4DA 4GXTA 2G0AA 1TJ3A 3QXGA 3AR9A 5E0OA 3OCYA 5AI6A 4B6JA 3WKCA 4PNHA 3L0BA 3L8GA 4RETA 1QQ5A 3I6BA 1Z5GA 3W5AA 1TE2A 2R8YA 3L5KA 3L0CA 3FZQA 4UATA 2HI0A 2P27A 2I6XA 3NALA 1RKUA 4QJBA 3U7EB 3QYPA 5ALFA 2YFYA 3SKYA 1SWWA 4KX3A 2NYVA 3R9KA 5AW2A 3N07A 5AW5A 1K1EA 2MU2A 1RMYA 1T5SA 4HGPA 1Z88A 5ALIA 4J2TA 3WK6A 3M9LA 3NUQA 1ZD2P 2FPXA 5ALVA 2G80A 4UASA 4Y2YA 4Y2RA 4BX2A 2GHTA 2YMMA 3A3YA 2Q4RA 4Y2SA 2GHQA 2CFSA 2HF7A 2YJ5A 2B1RA 5ALRA 2PQ0A 3KC2A 3NIWA 1WVIA 5AW3A 3EPRA 2HSZA 3WK5A 3FPBA 3KDPA 4DW8A 1QQ6A 1S8OA 1RQLA 2R8ZA 2GO7A 1Z4LA 3QU7A 4BNDA 5AIBA 1YS9A 2I34A 4UMFA 2HCFA 4DFDA 3M1YA 1FEZA 5AVXA 1N9KA 4KNVA 4EX6A 2PKEA 4DCCA 2B8EA 1Q92A 4Y2VA 2FDRA 1RRCA 2W4MA 4UU1A 4ZEXA 2I7DA 1RLMA 3UMBA 3SF0A 4HYTA 4I9FA 5A3QA 2OBBA 4UW9A 5AKYA 1NNLA 1SU4A 5AM0A 4NAVA 1L6RA 3QU4A 4HAIA 1ZOLA 3U7GA 2YN4A 2OM6A 4L6CA 3I76A 2W43A 4UAVA 1NF2A 3WKBA 1YDFA 1U7OA 3BA6A 3P96A 5AW8A 1YMQA 3K1ZA 4C4TA 2NO4A 5AM1A 1SWVA 2B30A 4AP9A 3N5KA 3U13A 3U7HB 2I33A 1VFPA 3TLMA 1ZS9A 3ZW7A 2P69A 4KN8A 5AVQA 3L7YA 3ZWDA 5AKZA 3L8HA 2WHEA 4Y2PA 4I9GA 5ALZA 1ZJJA 1L7MA 5AW0A 5AKXA 2HO4A 3QU9A 4JDPA 5ALKA 2VKQA 3ZVLA 1ZD5A 4FE3A 4IG4A 2YJ3A 3N8GA 4E88A 5ALHA 1N8NA 1NRWA 2G1AA 4DWOA 5AKJA 5AW7A 3L1VA 1X42A 5AVUA 1Y8AA 1RQNA 1RKQA 3E81A 2YBDA 4MWOA 5AESA 1ZRNA 5AIAA 5A3SA 5AI5A 1Z4PX 2IOHA 4Y2QA 5ALSA 3ET4A 3OTQA 1J97A 5ALTA 4Y2XA 5AKKA 3SHQA 3E84A 1L7NA 2ZXEA 3MC1A 3WKDA 2I55A 1LTQA 2JGAA 3DDHA 1TJ4A 1Q91A 3ZVMA 1IWOA 2IYEA 3UMGA 1U2SA 2BY4A 1L8OA 3AR6A 5AI0A 1Z4MA 2WF8A 3MN1A 2G06A 3QU2A 2AGVA 2RB5A 2PR7A 1U2TA 4HGOA 2WFAA 2JAOA 3FM9A 3EWIA 2BDEA 1KYTA 4BKMA 1RDFA 3FGOA 2CFRA 3KBBA 5AM2A 3ZTWA 1Z4OA 3SLRA 1XPJA 4Y3UA 1J8DA 3RFUA 4ZEWA 2WF7A 5ALUA 3WGUA 3ET5A 4CE6A 1L7PA 4CF5A 5AK6A 1U7PA 3KZXA 3IRUA 1CQZA 3PCTA 4YGYA 1O08A 5ALLA 4G9BA 3ED5A 2FUCA 3B9BA 3AR2A 2GFHA 4FYPA 3J7TA 5AVTA 5AHXA 4BX0A 5IT4A 2HEGA 2MSNA 3E58A 1WR8A 2HDOA 3IB6A 3A1EA 5ALPA 1O03A 3NANA 4KX5A 3ZUPA 2IOFK 5AK3A 4G63A 4OFZA 1VJ5A 5AKHA 3EF1A 3QUTA 3CZ4A 2D2VA 2QLTA 4YIKA 1RMTA 5JJBA 4JB3A 4OD0A 1XVIA 2EAUA 3MPOA 5AKEA 4XE5A 4O8CA 4XPZA 4EEKA 3I28A 5AVRA 3WK9A 3BWVA 5AKGA 3W5BA 2YJ6A 4BNDB 3OCXA 5AM4A 2HOQA 3QU5A 2EATA 3SMVA 1RC8A 5ALJA 4NV0A 3OPXA 4BEVA 2O2XA 2FPSA 2RBKA 4GIBA 1QH9A 4KYTA 5AVSA 2WM8A 2G09A 3L1UA 2ZBGA 1TA0A 2AUTA 2DQSA 5ALNA 4HGNA 4C4SA 3ZWKA 2ZBDA 5AW6A 5ALWA 4QQFA 3ZVNA 2C9MA 2FUEA 5ALOA 2O9JA 1RPZA 1QYIA 3AR7A 3GYGA 3F9RA 2P11A 5AI4A 2NO5A 1EK2A 3MMZA 4AS2A 2QYHA 4UU0A 4BEWA 5AW1A 4EENA 3UM9A 2I54A 1QQ7A 4YCNA 5ALYA 2C4NA 3S6JA 4CF4A
chains in the Genus database with same CATH superfamily
3RR7A 1K8ZB 3CW2A 3MGCA 1HF3A 2BPFA 3TIVA 4C76A 2WAXA 4PN7A 1ZQZA 1REQA 3V5NA 6REQA 3FKQA 3HZRA 4R31A 1W4RA 2YRFA 3FTQA 5K0LA 3T3DA 2K6GA 3PX7A 3LRPA 1JYSA 1JQKA 3JTEA 2XUJA 1LK0A 1DO0A 4DOBA 3RJTA 2BFDA 2MYTA 3HLTA 4P92A 3PX0A 2QXUA 4QTUB 2QX6A 1P0CA 5IJ0A 3A6LA 5I5GA 1DS6A 5IBQA 1EFRD 2NYUA 2OGWA 4B32A 2VJCA 3TZKA 5AUOB 3F3YA 1KL9A 2RRDA 3EMBA 1MDFA 1VM6A 3MWDA 3EW9A 1KBOA 4DXHA 1E8NA 3MLAA 1L1FA 5EIAA 2DBRA 4MRAA 2X8JA 3O7MA 4EHNA 3ODGA 4IJUA 3FHTA 2IITA 1DINA 2W6IA 2A9RA 3MGAA 3I6MA 3NS7A 4LBYA 4LGVA 4OLJA 1X7YA 4QODA 2WKWA 3RUDA 3UA3A 3VGJA 2XB8A 4AY4A 5CXUA 4PZZA 4MI3A 1N2ZA 2CBZA 3CM0A 4QTZA 1QBGA 2GWSA 1RXEA 4BO8A 4Q34A 2F43A 4TQ9A 2PNJA 1LNQA 3CLSC 4I99A 5AJUA 1T8RA 1DKQA 3GVHA 3VOTA 2P4EA 3KUCA 1OWMA 3QM1A 1NXVA 4EG5A 4OA8A 3GQBB 4DOAA 4UVGA 2ZUDA 3GCXA 1OZ0A 4XUGB 2UXDB 5CRIA 2PSHA 3OMXA 1YR9A 4FR2A 1ZBDA 1HUZA 4GM1A 3PFWO 4M8IA 3OWXA 4OU4A 2C4HA 4P32A 2QLBA 4QBHA 1FX0B 1T0JB 4CV0A 4EZEA 4UUPA 3ZQ4A 1U9IA 2AJQA 5FADA 4UOQA 1QFXA 1A76A 2BVNA 3ND8A 4X1YA 4ZC1A 1DKNA 3U3KA 3K6SA 3HVKA 1J8MF 5K99A 5MGBA 3LOPA 5EJMA 3V6JA 1KXZA 1O2DA 2ADMA 2ZR9A 3K1AA 3PFIA 4OUDA 3VXKA 2LP4Y 3HRDD 5LDDC 1EQ2A 5CCBA 1E79D 2WIGA 5MFPA 5D7BA 2QB0A 3R5JA 5FCDA 2DB3A 1H9BA 1II8A 2Y2VA 3PB3A 1QIIA 4XWYA 3QVTA 3H5RA 2BDUA 2YOHA 3NIBA 3KPJA 2QQ0A 4M3NA 2XI4A 5KNDD 3H19A 5BYBA 3B5EA 5J4HA 2A86A 3AK4A 4M1EA 3T1YB 1JXMA 1ZM2A 1OLUB 2NU6A 3QPUA 2CUKA 5L8VA 4JODA 4PBTA 3JPOA 2ZRAA 2HD4A 2Q9AA 2R6ZA 2JAUA 4B87A 1KKMA 2QEQA 1O6FA 1VECA 1L4EA 4RQ4A 1PTKA 2W8KA 2XNSA 4TWJA 2B8WA 2EARA 1EX6A 1YNSA 2REOA 2V5UA 4CMGA 2UYHA 1GVHA 1JKXA 3ZV6A 2OXTA 1OAKA 5LFAA 5ECGC 2G83A 2ZOSA 2WE8A 3OLXA 2EJVA 3W5VA 1ZNXA 1N0UA 3HKDA 4FFRA 3CZCA 3OQJA 2CXXA 4I55B 3WLPA 5BW5A 1HETA 2NG1A 4BV9A 3LY7A 3R0XA 4EHDA 4I28A 5EJFA 4X1IB 5L1KA 3S44A 3UJAA 3WGLA 3Q7SA 4ZI7B 5C2JB 3C5FA 2BMVA 2OG1A 4ZT2A 4AYWA 2PX8A 3K0FB 1AUXA 2R8XA 2BUCA 2VR1A 1GQFA 3EX7C 1CY0A 3NHSA 2EG5A 4I2FA 4Z9YA 2PUFA 5E3IA 3EE6A 3BHIA 5JUMA 2G4CA 4N3GA 3WGZA 2LD4A 2M2IA 3ZHYA 1EINA 2VHEA 3MS2A 1MC8A 1OASA 2ZS9A 2GK6A 3HJUA 4M54A 4UM5A 2A9PA 4X90A 5TQJA 3RVNA 3H2GA 2P3QA 3NGLA 2D5AA 1H93A 4BO1A 4QUGA 2WD7A 4AJKA 1G18A 2RH9B 1WW2A 1USUA 2PZ8A 3KK0A 1NV8A 1ORIA 2CB0A 4J2OA 3NX4A 3TQFA 2PYZA 3AIOA 4HAXA 1UPTA 3IEUA 5TT1A 2B7LA 3VZPA 5A5GA 2IYLD 4XJSA 2FFRA 1BRMA 1XALA 5E4FA 3ZHRA 2O0HA 5TIIA 3AETA 3KNZA 4MDEA 4MFCA 3SXUB 3PKJA 4IRCA 1OKKA 3W8DA 1UK9A 2XAAA 4IINA 5BN5B 3WG9A 1QLJA 3OOSA 1K08A 4HFMA 1NYRA 2R6CA 5FAKA 2KIWA 5EIBC 4TYYA 2HJHA 3GDXA 1P17A 3O83A 1CYDA 3P2EA 1SOWA 2AQHA 2ZCUA 4OQYA 5TF4A 1F12A 2Y1EA 3N0RA 2X5OA 2IF2A 5ERYA 3LC2O 3EG5A 3FBWA 5ALQA 4F11A 2LKDA 3BKWA 3EC1A 5FNVB 4KPYA 1QF7A 1RWNA 1SUDA 3EQ6A 4FFDA 5JH7A 5FHQA 1C20A 2VUIB 2W03A 1VYTA 1UBFA 5FA6A 5DNYB 1RD4A 1NONA 1TTPB 2I62A 3JAKB 3ZH9B 4AWXA 3NWJA 4QG3A 5J4LA 1GFWA 2QN1A 4H2DA 1RPNA 5M7EA 2VZEA 3OEEA 1JE1A 4PFQA 4DCSA 2ATLA 4OX9B 2VK1A 3W4KA 3TADC 2FW0A 1EK5A 1UFRA 3U3ZA 1WVMA 1BRTA 2R5NA 1SUIA 1T3ZA 2PZLA 3FMGA 3NKLA 4PVCA 4ZVRA 3VU9A 5AOCA 3PJDA 3I0ZA 2ZK7A 1V8ZA 2GRUA 3M70A 3RG2A 4BNXA 2XYRA 1JIVA 3U7JA 3BGOS 1REQB 3S55A 3TDNA 4BRUA 5I01A 1FTWA 3K9HA 1JWAB 5EMLA 3LWLA 2XKJE 3X3HA 2F3PA 1KTQA 4L9SA 3T6KA 2B1IA 2ZPTX 4DMLA 2VQSA 4BUCA 5C37A 1B8VA 3W7AA 4D25A 3LW7A 4ZA2A 4AMVA 1FZTA 4R63A 1NRJB 3UOAB 4DVGA 3M6AA 3QFRA 4AFNA 3SKYA 1GZ5A 4KX3A 4CFSA 1G7SA 3T0FA 2A1IA 4BV2A 5GZ1A 3R9KA 3PLNA 5CCDA 3JQPA 3MJFA 1K1EA 1JT9A 1T5SA 2FQQA 3FVRA 1PEDA 3U3XA 4BRWA 2FSVC 9LDTA 1NVEA 2VPWA 3ZXUB 3F71A 5EIEA 3RSOA 3K9CA 2G0TA 3R6GA 3NTVA 3DOIA 3P5SA 4QDXA 3IP4B 1KQFA 3QY9A 1N2HA 2A3RA 1IIPA 3EUFA 4Q3DA 3L43A 3M9LA 4FYKA 1XNQB 2C92A 4XIYA 3E5HA 4RTNA 4W5NA 4KO3S 3TG2A 1W4LA 4J94A 4Z7NB 2HYIC 5TQVA 4BX2A 1BH6A 2GHTA 3KKQA 1W47A 1R0KA 1EDEA 1YQQA 1E1RA 3S5UA 4OO1J 1YKGA 1XYVA 5LB4A 2E3TA 4MEBA 5DM60 2FMFA 1K97A 3QWHA 5FFNA 3NCTA 1ITZA 4BX8A 2WBLC 3BK1A 4C7MA 1GPBA 1QG4A 3Q88A 1R50A 1K2WA 3KDPA 1BPBA 3FPGA 4GU5A 2J4CA 3QVGA 4OJYA 3LT5A 3NHZA 4OYYA 1I1HA 4YMWA 2DPHA 4DV6B 2R8ZA 3V6KA 2PL9A 1T4CB 3ISTA 5KSOA 2RK3A 4LYDA 3IQHX 3AHJA 4BVFA 1VRVA 2WJIA 2R5FA 1EZZA 5KNBA 2HU5A 2V0CA 2DQNB 3WADA 4KPEC 1JPNA 1TM7E 3K6SB 5LKAA 3A7EA 1NXTA 1U7UA 4FX2A 4C4AA 3CLTD 1JAYA 3KTOA 3OTGA 4EB8A 3A7DA 1CJUC 1ZUIA 3L4KA 4F6LA 5FPSA 5DLFA 1M0EA 2PL3A 4X1KB 3IDFA 3RGWS 1P81A 3NJ4A 1E5TA 3VDMA 2DR3A 3AESB 3FG9A 1OPXA 2FRDC 4BE4A 3TZQA 3V2UA 4R8LA 3QOXA 1RPTA 2ZI9A 2HSJA 4RUKA 4J3NA 2XGMA 4HV4A 2NV3A 5G1PA 4XAQA 2IU0A 1I3OA 3AM3A 3C3YA 2FUG1 4HYEA 3REFA 4NBNA 4CM9A 1ZQVA 3KSMA 3GRPA 4BX9C 2WC1A 4O6VA 1YU6A 3SGLA 4ABTA 2P3OA 3B13B 2H2AA 1YJQA 3MQ4A 1YZYA 2POQX 3I76A 3LKZA 3OY7A 3P5BA 3QUSA 3IOCA 4ZVOA 3RS0A 4CMEA 1TADA 1BPDA 1GU0A 4FCVA 2OCXA 1AKWA 4WXMA 1HPLA 3FC4A 4MQLA 3MWDB 4BX9A 2FLLA 4RSMA 2XWQA 2G17A 2GN4A 1MQAA 5HMLA 4N0QA 4AYBF 2PD6A 1TYZA 4X0EA 3UMVA 5LZ9A 3GJTA 5G53C 5E6UA 1UMDB 2VCEA 3AUSA 3EJWA 2B37A 1I4OA 1N2CA 4AY5A 1LPOA 2I4RA 3H1TA 4OQPA 3T79A 1Z73A 2X5NA 4KFCA 3RTEA 4I2AA 1OFGA 3JCZA 1KXJA 3N7PD 5IIMA 1YO6A 3C85A 3D9QX 3C1UA 4BNFA 3CPHA 2HQSA 2DT8A 1CD5A 4J29A 5GQSA 5THXA 4W9MC 2P7IA 5CWRA 2VSOA 2Y1FA 1N0WA 3DB2A 3G9UA 4KFUA 4O8ZA 5HJEA 2Z2XA 2ZZMA 4E88A 1PV4A 5ALHA 4QSHA 3BCUA 5AOVA 8AT1A 2RMKA 4IYJA 2BFBB 1KO1A 4HVTA 3IGFA 3T38A 5AKJA 4NH4A 1R12A 5LIPA 5LQRA 3KYJB 1XNJA 1J06A 3KKNA 4XB1A 4AS1A 1L5FA 3FYCA 1VG0B 1W0JA 2I1LA 4M36A 4QASA 4YC7A 5FBLB 3UC9A 3WSVA 4JI8B 4MGEA 1RIIA 1XCPA 1VHWA 3OP1A 3A3OA 1HLGA 2FVXA 2GHRA 2QGNA 4WXEA 4KYUA 3RVOA 3JD2A 4RIGA 1NKEA 1N5MA 3AVOA 1Y4ZA 1RC0A 1J2YA 1OUMA 3GFRA 3KOMA 5ALSA 3H42B 4HEA6 4GDMA 2GN6A 4X95A 4WY5A 1MX5A 4Z4CA 3LTEA 4PLZA 1C7RA 1QO0D 2GA9A 4E6EA 2MWMA 3M3HA 4YMMA 3IR7A 4OK5A 1LBEA 2Q3HA 3QYFA 2NN3C 2LDBA 1I0IA 1K86A 2IY8A 1WXXA 3MJTA 3RIGA 3TQSA 3SJAA 3EPJA 5DN6A 4RSRA 3S70A 3C4JA 1K63A 2RH5A 4M21A 3DDOA 1LJ8A 4DYHA 1L1QA 3KTQA 1ABFA 1FSFA 1TECE 1T6NA 1KI8A 2Q0QA 2YY7A 3CQ9A 3QYAA 4I1OA 1WYGA 2DT5A 4LRQA 4NJ8A 4WLNA 4DQKA 5BN1A 3MF4A 1JAXA 3T7DA 3FR7A 1A7AA 3KB6A 4YMHA 1XSEA 2GN2A 2OLEA 4I7EA 2C3PA 2UXCB 3D1VA 2X5KO 4FDVA 5EN4A 4OYLA 5HFAA 3SC2A 4AKIA 4MPJA 4TS4A 3EPPA 3EWIA 3RS3A 3M4ZA 3HPOA 2HU2A 4F5YA 1V5FA 2F77X 1VGVA 1FQOA 3FBGA 1Q1NA 1TU3A 3KXPA 1FS4A 4LV8B 5HBRA 2CFRA 5BW8A 1GUFA 4P0PA 1YTUA 4I6JA 1JSCA 3L8MA 3A3NA 2Y05A 4EHJA 4KQFA 2ZYTX 2G1JA 3CYFA 1QHEA 5FA5A 3A6HA 2BCGY 3EDYA 4ZEWA 1E5QA 1XKXA 1NSFA 2ATCA 2I2WA 1FRVA 1NU6A 2X5JO 3ILVA 3TIXB 4ZPXA 3IP6A 5JAOA 2XEDA 5IIKA 1UDBA 3ZJVA 5AK6A 5AXCA 3VPBA 4HN4B 5E3HA 5I7WA 1D09A 3GIKA 2PKQO 1FXSA 4ARZB 5AYVA 4DBLC 1CVRA 5B7QA 1G6Q1 3GJ7A 4U7HA 4K6KA 4L3WA 2GZHA 2PAFA 5TJ9A 4MKHA 1D8YA 1IHOA 2P30A 3DEYX 3JPYA 2X0FA 4WESA 2QAGC 2B7BA 3PQFA 1K8RA 4BQOA 1OVGA 3ABQB 4RA6A 4GP9A 1GQYA 3OSPA 1RRFA 2PWBA 4H7DA 2X19A 1C1DB 3IAEA 3AX6A 3L1HA 2C0QA 1X6IA 5CP8A 3GMTA 4WTOA 5D7NA 2JEZA 3DYVA 1FY2A 1ULSA 2J7KA 3VHRA 4JI5B 4A2PA 3D7NA 3IB6A 1BXKA 2Q4OA 2ZQYA 1L4BA 4FBMA 4JBXA 4P7JA 4ZOLB 1ZRSA 4RPHA 1KIAA 4G3XA 2QRJA 1B76A 2X15A 3E15A 3QUTA 1NYQA 2BE7A 3KLBA 3T3OA 2R7KA 1NK8A 4OD0A 1JBQA 5TPZD 4EJFA 4OMCA 1KYIA 3H1AA 1ZN9A 3HR4A 1LDEA 5GGYA 2P5YA 1GUYA 3UC5A 4B4VA 3DC2A 1V1RB 5NLLA 1I13A 4TMVA 4W7SA 3C87A 2VZ0A 3PGJA 2NUBA 3I1FA 1DLJA 1M6WA 3QW4B 4IS2A 5KEIA 1NN1A 2RI0A 3LLCA 1GHTA 3LUFA 2V7PA 2C42A 4L15A 4URXR 5KFOA 4WZAE 3V6LA 2RDIA 3EARA 3H0EA 4Q3NA 1XTSA 4UQGA 3ZLBA 2OZKA 2K4MA 3DL2A 3DTVA 3AOGA 1HUQA 1JBKA 5AM4A 1ICIA 1QHIA 3QU5A 4Q43A 4RLSA 5JCOA 4G89A 3I6ZA 4IGKA 4II7A 2AJBA 2W9MA 2JXJA 4CI0B 2DUMA 5KOJA 3WHPA 1TK9A 3FSEA 1N3YA 1NDQA 3AESA 2RBKA 3T5CA 4KWCA 2Y1LA 3V2HA 3VZQA 3GEMA 2IZ7A 3MDCA 5CBPB 2VSNA 1YKFA 3RJEA 2ZBGA 4C0KA 3CH5A 3R5TA 3ROKA 3NDBB 2QZPA 4B80A 4FNMA 4HGNA 4GMKA 3TL2A 3UWSA 1TUGA 8ICOA 2E5SA 1XS9D 4KQJA 4O5AA 4ON9A 3EDRA 3EW7A 3N58A 4DA9A 3LK6A 3OQIB 4IO1A 3MIIA 4O2BF 4WCDA 1E9RA 2I7XA 5L7TA 4KLSA 2PBRA 4ARCA 4K87A 4TT8A 1UIRA 1KFTA 2DX7A 1XQ6A 3HCDA 1Z35A 4EYQA 3DT9A 3R3HA 2I6GA 4YV1A 1NW7A 4YJ2A 4LZWA 2LKCA 1IK6A 1VIMA 3KPUA 4ODIA 3A0HU 2FG6C 5B5SA 3L0OA 5CCEA 3SQLA 5JLJA 1E1CA 2A1AA 4EWLA 4XARA 2KHZA 2ZJ0A 3FN4A 1SXIA 2XIDA 2E5WA 4LOLA 1QQ7A 4KOAA 2CL6X 2IYZA 2OXRA 1KQQA 2FRVA 4FW9A 3STTA 5TC4A 5IJ0B 1JH9A 3GAMA 5JMTA 5KT4A 1R10A 1VKJA 3G2HA 4NH0A 1Q14A 3VNSA 4YONB 2YXEA 1CVLA 1RKVA 3M3PA 3MRTA 1BMTA 2GEKA 3PNVA 2R9VA 1C81A 3NMUF 4RW0A 1APBA 2HMWA 3PXGA 4M0CA 3F6PA 3D5TA 1CUDA 4DGSA 2FPWA 2EFDB 1L0BA 4IIJB 4RD0A 5TJHA 2LBPA 3CVOA 4IIDA 1LPPA 1TQDA 2MA1A 1V45E 3QVMA 4GX5A 4PF1A 3TRDA 4MLDA 4HAVA 4E1AA 4QM6A 1H2FA 3I3SR 1M74A 4ECZA 4AN4A 3BD8A 2NGRA 5JG7A 2UVQA 2VPTA 1IATA 4QSMA 1UFQA 3AJDA 4FMCB 3PFGA 2QRVB 1JT2A 2C2EA 2F4NA 3DAHA 3DD5A 3FCUB 4QA9A 1ZMXA 3GQBA 1ZM9A 1Q21A 4X7BA 4BJ3A 8MHTA 3IUMA 4NJEB 2X14A 1M2KA 2QUHA 3KBOA 5I48A 2YINC 3CZMA 1VRCA 2OUIA 2WABA 4TWAA 4U0KA 1LVUA 4DQXA 2WICA 3RSFA 3F73A 2K60A 1ZITA 4B7XA 1GKKA 2BYTA 5J2IA 2P91A 5CP2A 1V1JA 2GYYA 1R0CA 2QMQA 1CLEA 2HSDA 2JH3A 2ZI4A 4OJQA 1E1LA 1TC2A 3ODPA 2VXCA 2ODAA 4PU0A 2IV2X 4K2AA 5ICEA 3V80A 2RGWA 4MP6A 1T1IA 4IGFA 4P31A 1XC9A 3MBYA 2QB0B 1GR1A 2OILA 2GKSA 4XEHA 2D7CA 3RSQA 4MUBA 3ZBUA 2CXQA 5JZSA 3IX7A 4G1UC 2Y0CA 1H1TA 2H54A 4HN2A 2WVAA 1SKRA 2LIPA 4Z1MD 1VIDA 1CI4A 4RZQA 1J8VA 5EWLB 5DT2A 1HMPA 2CLHB 3R1IA 2AEJA 3ESRA 4P5PA 1RYZA 4U5XA 4LFBB 3S2EA 4RPZA 1SL0A 3BXFA 3AG6A 1K7XB 4FOLA 4J9RA 1YR1A 2G9ZA 4U63A 5CR9A 5JSYA 3VC2A 5KQLA 2ZSAA 4K6FA 2OXIA 4LXHA 2XVXA 3AIIA 1NLZA 4MUXA 2AOVA 2GVDC 1L3TA 3PGLA 3V1KA 2AZTA 1G55A 2V1XA 2D06A 4O4IB 1ZL0A 4OL0A 2EF1A 3WLOA 1YRAA 5HCIA 4Z1MA 1IOZA 4YXWA 5EKSA 2H0RA 4B7AA 5EJEA 2ZT6A 2PXHA 2I4IA 2G5CA 3AERB 4RV9A 4ZOQI 3HEAA 1ISPA 3H4BA 1PNTA 3IP1A 1FO4A 1II9A 1NVDA 4LX0A 4OXXA 4PLWA 4PTLA 1H1LA 2IYOA 4QELA 5I7SA 4Q03A 1KWKA 3O73A 1OXMA 4QE3A 3RBVA 1HWYA 3G79A 3LGSA 2O4CA 1P0PA 1ISIA 2ZUVA 3F6BX 2EGUA 2VT2A 4N4AA 4NMMA 2D2XA 3R75A 2I7VA 3G23A 1T25A 4B3FX 4NNOA 1JKJA 1JLLA 1TCUA 4IGAA 1CEYA 4B4UA 3TMKA 4JJ4A 2OLJA 4CV2A 3O47A 4NEGA 4NYJR 5FQNA 2BRUA 4QZIA 3SBXA 3DMRA 4YYEA 3HMKA 3AR4A 1BOFA 2PYDA 4C4RA 2ATEA 5KFJA 3OX4A 2OK7A 4GZ3A 4IRXA 1M75A 3BN3A 5HOQA 1NW8A 1RYYA 3Q8XB 1VSBA 1BDJA 4GSYA 4UFPA 3L4JA 1SC6A 2AF3C 5KC8A 1V8PA 3NEJA 3LPAA 4IUCS 1MGPA 1HDXA 2VYCA 5A4FS 2W2MA 4YCMA 1IPEA 2A35A 3ONNA 3GUYA 3TBFA 1ODSA 2RG7A 2FOIA 3IDOA 1DIGA 4IH4A 3RS8A 5KAFU 1JX6A 3H65A 3OWOA 3LO5A 3G3EA 4NM1A 3PNKA 3L8EA 4LY3A 1AGYA 4JVNA 1VJTA 2J5XA 4MXDA 4MUIA 3N59A 3EMKA 4RDXA 4CFYA 1IEQA 1W5TA 3GP5A 1BXRA 3K0BA 4BWGA 1XXLA 1JEDA 3E9NA 4M1MA 1Z39A 2QTFA 1GIAA 2H4XA 2P9ZA 2DUJA 3B9PA 3DE6X 3JVUA 4EHFA 2RGBA 4MRRA 4ZZ3A 3R5FA 4HEA1 4NZNA 2FLVA 3TADA 3P97A 4LJKA 3I8OA 4H6XA 2WVHA 1YE5A 1U0FA 5IK2A 1UPCA 4EP1A 3ANMA 4YRMA 2HIAA 2NV2B 3AR5A 2P9TA 3PQCA 2GZDA 2WD9A 4I81A 4R1OA 4BX3A 4YRRA 5JRZA 4FPXA 4ZQGA 4F1KA 2AZDA 2ZRJA 4DV4B 1YJBA 4LXIA 3L7CA 3V7NA 2A2ZA 3LHFA 5DLQC 4KRXA 2IHNA 721PA 1S0OA 5KTKA 2REQB 2YVAA 1Y88A 1BE1A 3I9MA 1YV9A 2FN4A 4TMZA 1DC3A 4YJ2B 4JYBA 3UJCA 1YE8A 2HT1A 3UV7A 5CA7A 1QC5A 4KR0A 5JWRA 2JKZA 1TJ3A 2NAFA 3OTIA 4K3UA 5E0OA 1I32A 2XZPA 3HI4A 1ZQKA 2HFJA 4DKJA 4MS4A 2DUYA 3WKCA 4YCCA 3NHWA 5H3CA 3EMVA 3GMSA 1QSSA 3OT5A 5B6PA 2UKDA 3D2AA 3E22A 5EIFA 4X85A 3TPFA 1KDTA 3PRKE 2W7OA 1YZVA 4B7UA 1WXQA 2H2DA 2ZTHA 2F3SA 1RP1A 3QPWA 1M34B 2X8JB 3L0CA 4KB5A 3LHKA 3VNVA 5EJGA 1HLFA 1GPKA 4DB2A 3DTVD 4KV7A 4D0RA 2CDRA 4DLPA 1AS3A 1TUIA 1S0NA 2O0JA 4XA8A 1IZ8A 3K09C 4WRRA 2O8DB 4J9NA 4J1NA 2R7NA 3F5QA 2F8TA 1JIQA 3IFSA 4W1SA 4O1IA 3KWFA 2PMDA 4MYSA 5TPZA 1CZRA 3QVKA 1HQYE 2NO6A 3DTVB 4GECA 5KYGA 3PY8A 4LF6B 4PG8A 2DPGA 3L7MA 3A10A 3QVOA 4ZO4A 5MN4A 3H5LA 4AULA 5F23A 3RYTC 4CEIA 3E23A 1NOJA 2Z58A 4GUAA 4D0LB 4W9NC 3U81A 5AT1A 5BY2A 1LLUA 2NADA 4DMMA 3Q8MA 1D9FA 4YRIA 5C3MA 1OLXA 2ODQA 4R9VA 2MJLA 4UNSA 4ZEOA 4MITA 1ZMTA 4Z0TA 4CTJA 1C2YA 1GNVA 4EYGA 3L6RA 3HGMA 1IM8A 3ZR4B 3DKPA 3FBTA 3M6UA 3K09A 4H3HB 4N8SA 4Q39A 3CE9A 2WPNA 5FPHA 3JQ9A 4TL7A 1UDWA 2YJ5A 5ALRA 3C1ZA 3AJRA 3O3NB 1WVIA 2Q5CA 3DBHB 3ETCA 3BGSA 3ZWMA 1EAYA 3UKDA 2VPZA 4LXGA 1SUAA 2XSZD 2FEMA 2EBFX 3UGJA 2BMFA 2IELA 2HR1A 4I8IA 5K8IA 4REQA 4K05A 4LDRA 4GOXA 1ZHHA 2ZIUA 1G17A 1G5FA 2RK6A 1AO3A 2WWFA 2EYQA 4NFYA 3RKSA 4A5OA 2HCFA 4B76A 5JDIA 2N3ZA 4HVCA 5DBOA 3JPRA 2DHQA 2O7NA 3A1NA 5LJLA 3HJRA 1EA7A 3R6WA 4DLAA 1QU2A 1P74A 1BE0A 1VMAA 3I04A 1Q92A 4H18A 3CKYA 1ZU4A 1D8BA 2VDNB 3D0RA 4Q01A 3RABA 3X0DA 1KQNA 2O8EB 5JO0A 5KFAA 4OHWA 1N34B 2KK0A 1QRSA 3FMFA 2XMGA 4DIBA 1PL8A 5FWDA 2HVHA 2C2KA 3K5WA 4FMDF 1JG4A 4ND2A 5HCUA 4DIFA 3DZBA 2EJBA 3JD1A 4TKMA 3UMYA 1ZOLA 3E82A 2BGGA 3SEAA 1J7KA 4J9MA 1U1DA 3D6VA 2YVUA 3BFPA 1C3XA 3WZ2A 4AT1A 4CKEA 1N2CB 4PFJA 2LV8A 2OENG 3WO0A 5CDSA 2IPLA 1J0DA 4AP9A 1YRLA 3AEZA 2YWFA 3B3GA 4MULA 4ZZ2A 3RVBA 2N75A 2AZXA 3R9XB 1LS6A 5EJAA 2WU0A 3WBFA 2KMDA 1NJ8A 3TNLA 1WQ1R 2O2EA 4RQ2A 1JEJA 1ISHA 2MHCA 3DBLA 1N78A 1EXWA 3WYEA 1A9TA 1HV8A 2GLTA 2QTAA 1F2UA 5LLSA 2JLUA 3IKLA 2F62A 3QXSA 4KREA 2AHOA 3MOSA 1OXSC 1MVOA 2FFBA 1TCCA 2RD2A 4MTCA 1WUDA 1CB0A 2AWOA 2FZWA 2JLYA 3NORA 5EHQA 5CFLA 5JQGB 2PMCA 4GWLA 3QENA 2IDKA 3CBQA 2GLUA 1XD8A 4DSJA 1A69A 3D7KA 3QE4A 1TZCA 2JH8A 1XV5A 1QH8B 5EUQB 3TYXA 3ZI0A 1Q19A 2DGDA 3FI0A 3K2EA 4OHXA 5KVVA 1X3LA 2B36A 3HE3A 4E12A 2FMXA 3O3OB 2KP7A 2QRMA 4O2AF 4P6VF 2OZPA 1L7RA 4QIHA 4BEBA 3KZCA 5C53B 2MMGA 3MR5A 2JC3A 1DC6A 4TM8A 5A4KA 1WU8A 1PJAA 1ZVJA 1HLPA 2A6PA 2NSDA 1MJGM 1FMCA 3GHYA 2WVJA 5H8WA 1WV0A 3Q7TA 4ZVTA 4GW3A 3GZ4A 4DPKA 2PM8A 1A2OA 2Y0DA 1LX7A 4ZCTA 1FJXA 3J81k 4N0DA 8ICSA 2VG8A 2AOUB 1PU2A 3HYTA 3F90A 3W6NA 3UJ9A 2I3DA 1HTTA 2Y66A 4E4YA 4F86A 1YRBA 4BDTA 3AHDA 3E2PA 1QS0B 1HFEL 1IM4A 1QAQA 1Y3BE 3IS3A 4DVJA 4KXMA 2XJ4A 2ODTX 3KKAC 1Z0KA 2VDOB 3PI7A 4GP6A 4NDAA 4R8MA 3HA7A 4G56A 1RYRA 3EOAI 4OQDA 4PRLA 4TWRA 2Z2YA 1C9KA 1U2DC 3PVZA 4EGSA 2O0MA 4M7RA 2GBGA 4C2BA 2J1LA 2JGAA 3DDHA 1DO2A 1NTRA 1XZ8A 2WFZA 4OU5A 5F1KA 1TC1A 3OA2A 5F5XA 4ZVMA 1U7ZA 1W5BA 5A5VA 2QX9A 2X76A 2ZTMA 1H2WA 1X13A 2JEIA 3THYB 3QZ8A 4N76A 2JVIA 1BJKA 4EHBA 5JALA 4I5EA 2RP5A 3AM9A 4O4JF 2F1KA 2DF8A 2GJSA 1F60A 3PUWA 4PBSA 4EZ9A 4BZPA 4LJXA 2VBFA 4HGOA 4HNAA 1NIJA 2E1RA 3IM1A 2P5SA 4J0HA 2EANA 3IKMB 1W0KA 4P4SB 3TQIA 4EKDA 5C7OO 1NL3A 4LNHA 5GINE 1JHOA 1UAAA 1EWQA 3K5PA 3HWSA 1RDFA 4JKOA 3M1IA 4MZXA 5NULA 3FOEC 4HLNA 4AY3A 4JX9A 4LZNA 3CLHA 3T5LA 1NVXQ 2BF4A 4KVZA 3DONA 3EQZA 4MWEA 1Z08A 3NTOA 2DFVA 2PYIA 3PX3A 2ZJ7A 2C9DA 3IT0A 4V0LA 2FFHA 1RXUA 4FR5A 4MHSA 2QTLA 1ZBQA 4IZOA 3R41A 4M4SA 4TMFA 3ET5A 5BSHA 1F3OA 4X63A 3ZIDA 3BQ2A 3D2CA 1L5RA 1TM1E 1KFBB 2VF8A 3GEIA 1LKYB 3OICA 4HNRA 3IJPA 3SV4A 3KU4A 4S1OA 1VLBA 3S99A 3WE7A 1Z1VA 1GTVA 1A1SA 4XVRA 1ZLYA 1FBTA 3IA7A 2P9EA 2WJ3A 2DH6A 3RR2A 4ASUA 1CP2A 1P2VA 1KEKA 4XGRA 4KR6A 2IVFA 1H4SA 1YA8A 5F51A 3UQYS 2XQFA 1Z1BA 1E1RD 1ZYUA 1ZQHA 4HAZA 3QFTA 1GZUA 1NQOA 2QL9A 3BRQA 3DV0A 3AR2A 1TNDA 5G0SA 5KWEA 3GV8B 1DHTA 1UJ5A 2O3UA 1GCGA 3JQRA 2J3EA 3B5IA 4B9VA 5T67A 3AB7A 4QWCA 3ILYA 2YYAA 5TF0A 3UW3A 1GUDA 4QOFA 3E58A 1DWOA 3F67A 3BXXA 3R74A 5JC8A 1ODTC 3GZNA 1X1BA 2JHDA 4DSUA 4YQWA 3RUCA 4US2R 2XUPA 5AK3A 2HSGA 2ASLA 3PV0A 5KYUA 4OFZA 1KOGA 3D8NA 3JYQA 1W94A 2ZIZA 4KVFA 1ZCAA 1SQFA 7ICLA 4FFLA 4PX9A 3VR0A 1YK1A 2SNIE 5IVDA 3VH4A 3DMHA 3KFVA 4M53A 3VKUA 3AVTA 1A7JA 4LTDA 5LXTA 3NR2A 4Z7QB 2R87A 1H9CA 1EK6A 2PQ6A 4L2IA 2NRXA 2OAQ1 8ICVA 2G4VA 3R7DA 3QY0A 3EWNA 3AW8A 2HRRA 2GNAA 2OZLB 4LJAA 1HQDA 5BQ5A 3F7NA 5JW6A 4DLUA 4CNBA 2ZYWX 3DOFA 2VDKB 4LYYA 4TVKA 3PJEA 3QPDA 2QM7A 3ZWOA 2UVVA 4D5GA 1RYMA 2BHTA 1WLYA 2JMGA 4RL4A 4B9AA 2SBTA 3GLUA 3R3VA 2CBXA 5ERGB 1X0VA 5REQA 4A8JC 1IY1A 3SP1A 5HP4A 3V34A 1TVKA 3FHCB 3AY7A 5ICMA 2O23A 5F52A 5IVHA 2HA3A 4EB6B 3HUFA 5AUPB 4B9SA 5EWJB 1HYEA 3PDUA 9ICEA 2C7VA 5IEBA 1BPYA 2FAXA 1E2DA 2ERYA 1KETA 3RLFA 2JR5A 4WZAA 3IEMA 3K2BA 5ALNA 2O3TA 3TLEA 1MCZA 1RYFA 2IXEA 3GF4A 4FTWA 4WK2B 2BR4A 4MB0A 1PJ2A 3K70C 3ZWKA 2YB4A 3VNRA 4IV8A 5AW6A 2AFHB 2DU8A 3U4AA 1VHJA 2O8FA 2YV5A 3ZHXA 3EYZA 5LZ7A 1G8PA 4X92A 4QICA 4YMTA 3IERA 1NN5A 5K0NA 3SX0A 5A4IS 5KCZA 4GPBA 1EK2A 3IMGA 4BWYA 4DV1B 1P4JA 1RXVA 4J0QA 5E4TA 1OR8A 5P21A 5DCLA 2H4YA 3AJ9A 1I2MA 1A4RA 3KL4A 1DRUA 2O50A 2HQBA 2W37A 2ZS7A 3I01M 1P6UA 4HL6A 4XVCA 1PUIA 3NVKI 3MVEA 4TSRA 3O0FA 2C7QA 3S6JA 5JZ9A 2CDAA 1HEKA 3RH5A 4BASA 5ESDA 1IK4A 4OIMA 2VBCA 1I2ZA 4TXLA 4ED3A 1RHQA 5IU6A 1T2VA 1TCVA 2EHDA 5C8ZA 1K7EB 1WXEA 2F3TA 3KJZA 3NNNA 1RM6C 4JBWA 4PWZA 2PGDA 3WZMA 4C14A 2FSGA 4QM7A 1MPTA 1T0IA 2CGEA 2FEAA 1I6WA 9ICFA 4NYMR 2I1QA 4QUJA 2NWQA 3PUHA 4ID9A 4M89A 2YMLA 4YUYA 1KR2A 1T3LA 3RANA 2IHMA 5IILA 1AHHA 4CIXA 2WJJA 1TD1A 4F7WA 4UXIA 1R0BA 2P35A 4GKAA 2PTHA 4X1YB 3NHAA 3VNBA 3K9BA 4UTZA 2R751 4UAZA 1MA0A 2A5YB 4EA6A 1JLHA 4XRRA 4OJLA 2BL4A 2DAPA 2I9PA 3B7WA 3I12A 3L9WA 4Y1RB 4RCVA 1KH2A 4FHGA 1X9XA 3EZYA 1LI5A 4A8JA 3ROMA 4Y98A 1R0RE 2EJCA 3MJHA 4R0NA 1XSLA 4NS4A 4UB5A 1YQDA 5ANRB 5E6RB 2B83A 1YZLA 1QKKA 3NHFA 1XU9A 4YWJA 4RIIA 1T4MA 3OP4A 2H5XA 1ZA1A 2WAOA 3PO4A 4HADA 1MHPA 2Y67A 1E1CB 3BIFA 1SVOA 4O3FA 4ZAVA 2EWVA 2AFIE 1JALA 1W34A 5EIWA 2JF0A 4MR9B 5K4GA 3U7RA 3LE8A 1I7PA 1N6LA 4D57A 5KOIA 2GYUA 3D3NA 4LEIA 3SFVA 3R9XA 1T1GA 2WA1A 4M37A 4Z7OB 1R5JA 1MC4A 3R3ZA 3VPCA 4ZYLA 5LUAA 1GZDA 2JGMA 3DE3X 3OQOA 2G04A 2I4OA 5JTTA 4PEVA 2ZRQA 4NBRA 3EZFA 3CVWA 2CD7A 5SZHB 4ZOAA 1K27A 1H8ED 4FFOA 4YR3A 1AGPA 4IIBA 4YMOA 1KI9A 3AEQB 3G6WA 5EZ5A 4FFSA 1ZM3A 2Z08A 4RY8A 1M0SA 3B7GA 1NKCA 1OJLA 4B2PA 2DKZA 4IS3A 5GVRA 1N48A 4BQEA 2ZJ1A 4KDCA 4DLKA 5IC4A 2XVMA 5EP4A 2X42A 2WOJA 1PWEA 1XP8A 1YCDA 5CX1A 2YIDA 3N6RA 1TF5A 5GWXA 4E21A 3RSHA 4B8YA 5KZMB 3PUJA 3TIFA 1UKZA 3QGMA 4JP8A 3CYMA 1N75A 3BFJA 4NSNA 2C5LA 4ECUA 5C7IO 5ITZB 2H48A 2SHKA 3GMDA 2VPQA 3DEIA 3DWGA 4K8RB 3W5HA 1XU4A 1FRFS 3PWSA 4LV5B 2IHYA 3GP3A 3L77A 2FNAA 5CR0A 2MIIA 3N28A 5DHAA 2FH5B 1R6AA 2BDTA 4Z3OA 3HXLA 4CVNA 2CJPA 3O2JA 3FF4A 3Q9UA 5HPYB 2ZIVA 2GSDA 3TZHA 1H2EA 1XMXA 5HGXA 3ND5A 1PW5A 4W9RA 1I4EB 1TQ6A 2G72A 1EP9A 4NZPA 2IBTA 3OT4A 4QECA 3DNMA 4NABA 4RZ3A 1HE5A 1FP6A 1RLOA 2B2CA 3TEJA 2JD0A 1RZRD 1YT5A 3TD2A 1EWTA 1UJ4A 2JARA 2ZIEA 1T8YA 2DTXA 2ANBA 3QBDA 4LXXA 3NTQA 1JXLA 1KAOA 4CLOB 1W73A 5ALMA 3C2MA 3QUCA 2Q2QA 3JPTA 2V7QD 3UT6A 4CQJA 2V7WA 4WZBA 1Z83A 2WUDA 4RYLA 3PUYA 3WRXC 4F5EA 3PQ8A 3UMCA 2G5PA 3RUFA 4XQ0A 1NMSA 3DGFC 2PCJA 3HNRA 1KC3A 3CX4A 3PGVA 2YHIA 4BMSA 4IOJA 2H7XA 5CFQA 1K66A 1B0XA 4HDQB 4IIJF 4RGQA 4RVSA 1U49A 1UJCA 4TTIA 2Z4TA 4UM9D 3RQIA 1EBBA 2ZSDA 4Y2JA 1GUBA 4S35A 4DLWA 3D2LA 3QJYA 2A1JB 3QVSA 1KRPA 1LSOA 3A9TA 1M1YE 4NK4A 2C61A 3ZKAA 2VRBA 4E32A 1ONSA 3NBMA 4ED6A 3E2MA 4GVXA 1SBYA 4ZAFA 2VDRB 1JTVA 3OIFA 1Z6XA 4V38A 4DG8A 4LWOA 3WYCA 4DV0B 4DNFA 5K8CA 3OTWA 2J6UA 4RHXA 3WL3A 5AJHA 3GWZA 3H4TA 4TLCA 2AFRA 3QIAA 1KFKB 3L46A 4WNYA 2M6LA 3UHFA 5C51B 1SRRA 3D2QA 2A4KA 2JK0A 3PC8A 5C8YB 3VBEA 4QU9A 3VQTA 4IOMA 2CN1A 1QVVA 4LK3A 1T9HA 4A03A 2AI2A 1KY3A 4DIOA 1YDGA 3EPHA 1E2PA 1Q12A 1XTVA 2REBA 4PFKA 3V8NA 4G0OA 2X22A 4X8HA 1QF9A 4EJ0A 1YIDA 3CGWA 4DN6A 4YXJA 3WLTA 1FFHA 2HLNA 1P0QA 5HSGA 5GV8A 2R5WA 4JT8A 2G0AA 1KI6A 4DR1B 1O0CA 3WYGA 3AKCA 4ED1A 3AR9A 2WU1A 4D44A 2QBYA 2E1EA 3SK0A 1GZ6A 3RS2A 1HXHA 5IDYA 4N41A 1D2HA 3X2EA 3BJYA 1DZIA 2P2LA 4MV5A 2FEWB 1LBSA 3UZUA 1V5IA 4CM4A 4BMOB 1KORA 4JC8A 3MTQA 3ZOKA 3SQWA 5CHEA 1X3SA 2Z04A 1ZD1A 1PGQA 2AMJA 2R8YA 3LM8A 1Z0UA 2FZKA 3G2PA 3T52A 5LNK1 1NG1A 2H3HA 3P9ZA 4CM6A 1BIFA 1R74A 4O4IF 4DABA 2P90A 2GZRA 3ZHOA 2DKXA 1PYDA 2SKCA 3GB9A 2E6UX 1UQVA 3MTBA 1G8AA 3NALA 1Y1LA 1S7GA 3X1XA 2ES4A 3AM5A 1R16A 3IPAA 4DBVO 2X58A 4CMAA 3MXOA 4D4LA 3DE7X 3L7NA 2X13A 1THMA 3KB2A 1T4CA 3ETHA 3VA7A 5HR7A 4ITVA 2FQ1A 2JCBA 3PF8A 3B51X 2D1FA 2NSHA 5DHQA 4NVRA 1LLQA 4OMUA 3GOHA 1HT0A 3KFLA 3N76A 4WKGA 2KE5A 1HZZA 3LUDA 3MJCA 4HB0A 1YH3A 3DBOB 4QLAA 2YASA 3CRXA 4AJOA 3VYRB 4Y2RA 4XQ8A 4GXIA 4ED2A 1TIKA 1NBEA 1YHNA 3BVPA 4MAAA 5ER9A 2CNWA 1NK0A 1F9EA 2ZAMA 3AY3A 2AUMA 2PEYA 3AIKA 3IMCA 4GR4A 4QZDA 2GHQA 1A96A 2JEYA 3FLMA 4KGXA 4FNGA 4R2XA 4XFDA 2FEOA 2B1RA 2PQ0A 2JRCA 1NP3A 5JCZA 3BE5A 4JXZA 1QHSA 4G5SA 2HJ9A 3N8KA 3A04A 4DA4A 4FR0A 3II6X 1MBZA 1G9XA 4QFDA 4G6ZA 2D4HA 5JAQA 5H0IA 2N1MA 4YPOA 9ICNA 2ZSJA 2BEKA 2ZYSA 3T54A 2J87A 1T8SA 3Q8RB 1V16B 1GTJ1 2J9FB 2HTFA 1GP2A 4U2CA 1MTZA 4XPIA 5BT8A 4FOPA 3O21A 1LX6A 3AI3A 3OD5A 2XUHA 4MIKA 4QBTA 5IKOA 5AVXA 5IDQA 4M1YA 4PPGA 3EIOA 2AC2A 3UAXA 5FBZA 3V33A 4P8RA 2Z6UA 1RQRA 1II0A 4GQIA 1SBNE 1GAJA 1RLMA 3OETA 3KHRA 1VL6A 1KS2A 3GK3A 3OBBA 3PIRA 3V7UA 2OV8A 2W2XA 3VX4A 1OIWA 2VTVA 4S1VA 1XEXB 2ODNA 1DG3A 1QG2A 2NYAA 2CXUA 2D0OB 2J9ZB 2YN4A 2DKOA 4GR9A 1MAHA 5BN3B 3CVJA 1C80A 4UTXA 5DSXA 2DKFA 1IWBB 1QKIA 3TQHA 1O94D 3WVNA 1VI2A 4JAVC 1OKKD 1FYFA 1TK3A 3FCAA 3QF4A 5A5FA 1L4KA 1RZ3A 2XZTA 3G59A 5BT9A 4Z5XA 1E2HA 2BJHA 2PX3A 3BWEA 5EMKA 5J8YA 1FPMA 2P8SA 3ZV5A 1NP7A 1T1JA 3FNBA 5ADWA 1F17A 1NFFA 1QGUA 3BGIA 3E9CA 3ESCA 3NRBA 4WDRA 4Y1FA 1YVPA 2JAPA 3AUUA 4EFNA 3A6ZA 1QCCA 1HRDA 1HR0B 1ZJJA 2ES6A 4XUDA 1H4VB 3ITEA 1K5DA 1PK9A 4I08A 2RG1A 2PNFA 1JFVA 1Z82A 4H6VA 4WBNA 4D9HA 4REOA 4MQ4A 4Q16A 3OD1A 5J0SA 4GZ6A 2CPRA 3REQB 1ZQXA 1PJ8A 1UC5B 4CL0A 2GAFA 4X6XA 5EIXA 2R2AA 2XH8A 2XF2A 4JI3B 4E94A 1AZTA 4EH1A 4QZVA 2OD9A 4CMHA 4J90A 3UVEA 5KYVA 2RKOA 5DEOA 4YXWD 2AF4C 3CWCA 3Q87B 4CKWB 3HB9A 4BP8A 5B1SA 3TFSA 4PSUA 3SC2B 1V3TA 5BUCA 4NC9A 3EK2A 3DZGA 1Q95A 4H7EA 2BKAA 1CULC 1WKVA 5AI5A 1V9SA 3IAM1 4BC1A 2QUZA 3MAAC 4HXYA 1ZETA 4YI5A 5JANA 4OLBA 1X70A 3K4QA 1MDBA 1LI7A 3WL6A 2AKEA 4P0PB 2PI5A 2O1SA 4PBRA 3SYMA 1DRVA 4OH1A 2Q2WA 3EXIA 1N1EA 1PR1A 1U0RA 2C9CA 4W6QA 4JITA 3RTCA 3Q2OA 1H8EA 1CQWA 1WSDA 2W8BB 5P8WA 4E5PA 3ZZTA 1SBQA 2HPVA 3H9QA 1G0OA 4MHTA 1JFFB 3UMGA 1OV4A 2J08A 5CFMA 3O1IC 4BGUA 5CHGA 3AYZB 4RZ2A 4GGOA 1U3CA 3UXPA 4Y2GA 3ULKA 2EZZA 1PVOA 3QU2A 4CKBB 1K68A 5C9ZA 2ZJ5A 2BFEB 3GT3A 3L0IB 2AZMA 4C0QC 1MW8X 1IOLA 3NAQA 3VI3B 1CWUA 4CZ2A 3N9IA 4HRAA 1I6KA 4XUSA 2AQKA 1SVSA 1E9VA 1RKXA 3CSDA 1H4TA 3FFAA 4QW9A 1P2GA 2PJZA 1W7AA 2PSJA 1Z45A 2Q50A 3FGOA 4JI6B 5HKAA 2PT9A 5L3RA 3N05A 1V6AA 1W93A 2J85A 2XECA 5DULA 4DPLA 2WVGA 4OGWA 5ILQA 1J8DA 4ZI5A 1SM4A 5TT0A 2OHVA 3DMYA 1DAEA 3T06B 1MOSA 1NKSA 1PHRA 2ONKA 3BREA 1L7PA 1IG3A 9ICCA 2GD1O 2R00C 4TRRA 4NCJA 1XA0A 3RHTA 3EGIA 3GY0A 2FSIA 3ENWA 3OOWA 3VKVA 4LFCB 3S1SA 1VPEA 5K5EA 1B22A 4B3BA 5ICCA 3IAFA 5DIFA 2Z6QA 4C80A 3GARA 1RT9A 4C7XA 2O2DA 4UPVA 4MGIR 1UK6A 1JH8A 4XA5A 1PKXA 4NBUA 4CG3A 1I0ZA 4AX8A 3DVLA 3Q6IA 4BNJA 3B9BA 3DAPA 4W82A 2VOJA 5M29A 4KLEA 3TB4A 1IBRA 4K6CA 4YYZA 4FYPA 5J0XA 2B6GA 1S0VA 1K2VN 1ZOOA 4TL9A 4BX0A 5IYZA 4YRKA 2QHXA 3SZ3A 3TXAA 3AT1A 4D9GA 5HRCA 5ADUS 3OH8A 5B1EA 2H11A 2XT9A 2ANCA 3Q1LA 4PNEA 4BJ5A 3R5KA 4L7QA 3C15C 3DLPX 4KR2A 5KDDA 4MAMA 5AD1A 4AXXA 1DELA 1A5TA 1MB3A 3RSGA 1I2CA 1Q77A 2PU5A 3RHFA 4B9MA 2FF7A 2QR5A 1RMTA 2OV2A 2PRJA 3PL1A 5ADVA 5LYYA 1RAHA 1QZZA 4NOJA 4WAUA 1WS6A 4HTFB 2PS1A 4CXMA 3PBKA 2KW5A 3DPIA 4EB0A 4JLPA 1MNAA 2XJ9A 2WTXA 1G42A 4X94A 4RTKA 2BIFA 9ICGA 4BVEA 2FFQA 2FGJA 3FNHA 1QRDA 5JC1A 3NFRA 1VL1A 3UUGA 1OH7A 3FCEA 2KD1A 3O1JC 4KGZA 3FYUB 4BDPA 1N5OX 1NVBA 3GZFA 3V8PA 2YZKA 1LSSA 3HUEA 4L78A 4U2GA 2EATA 2GN1A 3AXTA 3G8AA 4IUYA 4W99A 3KQMA 5CIQA 5CAEA 5JARA 2HW8A 1VI6A 1XTZA 3HG7A 3V1TC 3OPXA 1LDMA 4PPYA 4POAA 3U4IA 3HP4A 5GOZA 3GLGA 1MAWA 1DGQA 2BD0A 4CIVA 3RRXA 1NQTA 1SXDA 2TMKA 4O29A 2DQSA 1KA9H 4LYEA 4C89A 4ECEA 1J99A 2WQZA 1D4AA 3JAMA 2O7QA 1SCAA 1YB2A 2YJNA 2MSKA 3NBAA 2QIOA 1Z63A 2Q4BA 3FYTA 1DOHA 2YOGA 1SXGA 1JDTA 4KLMA 3GFGA 5TQ0B 3L4PA 1F1JA 3LD9A 3I9OA 5ALWA 5B58C 4HH3C 4NDZA 4OV6B 2KVSA 1KK3A 4PS0A 4BO3A 4RFSB 3ADPA 2BGUA 3QF4B 1AKEA 3FVQA 4YJHA 4L5BA 4CIYA 3TLJA 4D26A 3D7SA 4C3UA 1KQ3A 1JTEA 3UK0A 4UBBA 4QZFA 2QAJA 3CWQA 1IE3A 3V97A 3P4YA 3EULA 1SHUX 1Z15A 2BZ1A 3GDFA 3HN7A 4K46A 3GXBA 1KAHA 4OP1A 3DOCA 1L5GB 1L3IA 1FL9A 5DHRA 3K31A 3RTAA 5FQOA 5IZ4A 3A2NA 1P2DA 4NU8X 3LWNA 3LY9A 1IM5A 3OHBA 4ZQBA 4I1SA 5EE0A 5CLQA 5G0VA 1OLUA 3BCRA 2GXSA 2WR8A 2Y6VA 4I2GA 3BRCA 4PG4A 4RJKA 5TGTA 2GT1A 3RVQA 2V8OA 3QMWA 5FYDA 1AB5A 4GO1A 1XRNA 1TM3E 1OT5A 4MV1A 1WZNA 1ESDA 1K8XB 4C7JA 3V8VA 4N3CA 1A4UA 2V9ZA 2JEGA 3ZX5A 5BPFA 4QGFA 4R98A 5MDHA 2NSLA 4UCQA 1MJFA 3IO5A 4O3OA 5C1BA 4ED7A 3TLBA 4TSFA 1WXIA 4YPFA 1AKQA 1HDOA 1Y5IA 1PT6A 4PZEA 4JV2A 1IBMB 1QYRA 3RV4A 1T36B 4BTLA 3MABA 2KQUA 2FU5C 3FYHA 4W1PA 5LQSA 3GAAA 4BNTA 4MKXA 2YJGA 1GQSA 2I65A 4CF3A 3CTMA 2C4MA 2J3MA 3KTDA 3R3SA 3A1VA 2K4HA 4QJFB 4F4ZA 4F4KA 1XQXA 2DWOA 2UZ3A 2VNAA 3DJYA 2QJOA 3DFMA 3JASA 3N39C 4DNQA 4UOZA 4ENRA 4BGIA 3D2SA 5J23A 2HPHA 1PQPA 2Z8XA 3G8CA 3R0VA 2Y99A 2RHFA 4HEHA 4YRFA 1VKRA 3ZDQA 1TZ2A 4FLFA 4HFJA 4JJZA 4GMHA 3KLOA 1L5KA 4JLMA 2WFMA 4K0RA 5D84A 4EABA 5FULA 5HJ5A 1CRPA 4NAHA 1ZRMA 3RAQA 8ICQA 3FTNA 4NCKA 3LQYA 1L8QA 3U4GA 3WGNA 2XW6A 4W5HA 5FKJA 2HX1A 2BUBA 3PRJA 3WSTA 3AEQA 2HHJA 4F5DA 3M8SA 2GETA 4HB4A 4LRSB 4B6PA 3A3PA 5I7HA 3ZVKA 4JEUA 2OCDA 2I1WA 5FD8A 4Q9AA 3EXHC 4OYRA 1MPXA 5JHGB 5AVVA 1XVAA 1WMEA 2BH2A 4NNJA 2Z5GA 2AVDA 4YD1A 5DH9A 1FDTA 2EFCB 7ICIA 1QNLA 4RHFA 1XN1A 3QNMA 4MPTA 4KPGA 3HZOA 1EA5A 4PSDA 4AO6A 4OBEA 1L1EA 2AD1A 4ARSA 2VATA 2GJ9A 3V48A 2HO5A 4PX3A 4BRSA 3G5TA 2Q8QA 1SBCA 3FDFA 2AJCA 1IY0A 2C78A 5DXFA 5HR5A 1IEWA 2O6HA 2UUPA 2GK3A 4TRNA 3JYNA 4IQTA 4JC5A 1D5CA 4ALMA 2JEJA 3NBUA 1UK7A 2FVYA 4G5QA 1XF1A 1ZJ4A 2DSNA 3WIUA 4Z3KA 5JQGF 1ULBA 4LOHA 1QOPB 3INTA 3LK9A 5LOVF 1P2UA 3QX3A 1Z3IX 4WK0B 2C5FA 4RVOA 2YCBA 4V0SA 1UZLA 1Z68A 2I78A 2WTBA 4IDBA 3B89A 4PHDA 1V5GA 3IP8A 3KZKA 1P7CA 1E2FA 1WMDA 3IKTA 1P1RA 3K4GA 4P38A 4P4LA 1OROA 2Y1JA 2QNBA 4IXMA 2PGJA 3GBVA 4PLFA 1FTQA 1YDMA 4L0CA 3B0XA 4OHBA 1F5SA 4K4IA 2RHTA 1OBHA 4IO0A 4JSTA 4R41A 4X61A 5M34A 1WUKS 1RADA 3FNRA 1AKTA 5BRAA 3MGBA 5DO9A 3WQHA 1EK1A 1ZQEA 1K7CA 3CLVA 4M99A 3KQNA 4L50A 1CRWG 3HZZA 2I80A 4OHUA 4AIRA 4BBAA 4CG1A 1VL0A 1R00A 4RA9A 3HM9A 1JXAA 3UWPA 3VNAA 2DVMA 1BU5A 1PZFA 4LWQA 4XVHA 3GUVA 3ADCA 4A4DA 2ODGA 3KE8A 3ETGA 2XA2A 2AT1A 3E1GA 4Q45A 2X9NA 1Y34E 4K4HA 3ZG6A 5J2DA 2X5XA 4XM1A 3FUWA 4YPVA 4LC0A 5DGIA 3NUZA 5GM2A 5TVKA 2KJ5A 4HRXA 1GG2A 1NUUA 1M1UA 3I45A 4MA4A 4R9UC 1BQ3A 1A8IA 3OZSA 2JCSA 4UAYA 1NM5C 1ESZA 1KVTA 4LZOA 2FI1A 1WW3A 1YB7A 1D6SA 6ADHA 4CCYA 1NJ2A 2D59A 2E4ZA 2V58A 2VHCA 3FYUA 5DNEA 2AYZA 3ZYCA 5ES4B 1OXUA 4IF4A 4L74A 1TYCA 4YACA 3VAYA 2WTUA 1Z33A 4EI9A 5E9JA 1XKTA 3BX1A 3PPXA 3F4KA 5EZSA 1EFKA 1BNOA 4AMBA 1JA0A 1DV1A 2XB2A 2H4JA 4KL8S 3E9YA 2OV4A 4CEHA 1E64A 2MYUA 3QUBA 2ORYA 3MCZA 4JHLA 8ICAA 4MW7A 4TN5A 2FPUA 1TJYA 4ZOBA 3VV3A 1UH5A 2QPLA 3ANNA 5DI9A 4USAA 2XQKA 3T12A 2HXYA 4C30A 3AO0B 3R44A 4S12A 5IASA 4GVPA 3R7LA 3WGMA 4XASA 4EYEA 3NWOA 5DBBA 1N5XA 1DBVO 1VL5A 4F12A 2D5LA 2WPDD 4KPFC 5IUKC 2ISPA 1IBSA 4NK5A 3ZTYA 2XQIA 4RDHA 5GV7A 1N9GB 1PGOA 1EMDA 2B92A 2EW1A 3OM0A 3ORSA 2IRWA 4JB0A 1BDMA 2FQYA 3FRHA 7ICJA 1PYGA 2GH1A 1CRZA 2V8BA 2WTAA 3CX8A 4FOOA 4J0CA 1SGWA 4FJ0A 3TAXA 2BEUB 3FLBA 4QXMA 5BOSA 4Q6WA 4DLEA 2EFYA 2NQ8A 1AB6A 1NQAO 2W6JD 1FDIA 2I6FA 4UBKA 3L6OO 4HS4A 4XX0B 5AQ1A 4Q21A 2CBGA 2WP8J 3V1NA 3SAJA 4AJIA 1EP1B 4TTPA 4U7TB 2V54A 1KGDA 1SR8A 1KE1A 3SC3A 3MD9A 2AN1A 4PLHA 1DCKA 4DIUA 4EG3A 2IXTA 3C1TA 3HRIA 2J46A 4IVNA 1OYOA 3B7PA 3DCIA 3PPWA 5COBA 2UYCA 3NGMA 5JFGA 1XZGA 4HTFA 4OQEA 4B0OA 1OX6A 1DKMA 1X80B 1XHEA 1F0KA 3ASVA 1MOZA 4IXNA 3Q0TA 3ZGXA 2A1JA 1XTUA 1ODLA 2ZIWA 1X7HA 4MFFA 1PR0A 1P44A 1E66A 2Q07A 5IT5A 1HNNA 1S2DA 3AV0B 3UIEA 1AIPA 5DGHA 1UEJA 2VHZA 4UHKA 3V2IA 2W9BA 1M6EX 3MAJA 1ZQRA 2NYVA 1ZMOA 2VI5A 3T3PB 4C5AA 3EVDA 5K4LA 4LXUA 4PPNA 5FWXB 3OE5A 2VIIA 3WRVA 1GRNA 1ATIA 1Y5RA 1A8SA 1G6OA 2LNDA 4RQ7A 2X7HA 1R8YA 2YICA 2LDXA 3ASZA 3C8MA 4LG1A 4PC2A 3PTAA 1M7HA 1WCV1 4D79A 5JTIA 2Q41A 2R25B 3C3CA 3O0DA 4CLEA 2YV1A 2YXBA 4G0UA 5UKDA 1FRZA 4M8KA 4DXDA 3JVIA 4A10A 3LX6A 2QU8A 4KXQA 5C4IA 5C1OA 5JI2E 3EUB2 4GG1A 3OEWA 2CHQA 1ULUA 4N9WA 1OH6A 1GA1A 3AUTA 1ZNZA 3HDJA 4WACA 3KZIU 2O8EA 2H8KA 5BWNA 3IRVA 4KTQA 1YONA 3DTTA 3NBZC 4JBNA 4LUCA 2M6KA 2ISOA 4XRGA 3Q7RA 1RI2A 2Y1XA 3SR4A 1SQ6A 1Z2CA 3WB1A 4RLHA 1VKNA 4JI1B 4YT8A 4B75A 4WKBA 3AIMA 3IDQA 3H0RB 2D3WA 3UHJA 3WWOA 3ZYZA 5C5DA 2GASA 3DVSX 4QZHA 1OREA 1R0YA 2IS6A 2D1TA 3RO7A 1S5PA 3H4MA 3P9IA 3MTDA 3CRRA 2I6TA 4ND6A 4QOHA 3QF7A 4CKEB 4ECTA 4YJGA 4PYIA 1A9ZA 1JHPA 1CS0A 5HA5A 2QQEA 3E9QA 3R7WA 5AJYA 3CB4A 3A06A 4TS9A 4E22A 5JH7F 1N3LA 4JNCA 4YRAA 4BNDA 2PFQA 1MG5A 2RLTA 3SIXA 4ZHQA 1UF9A 4RXMA 4LDNA 1ZQWA 2DFPA 4LRXA 1FEZA 2Q3JA 1PT5A 1CU1A 3MNFA 4NU5A 2X0IA 2HZ7A 4KNVA 1WB5A 2VC2B 5EPOA 4NZZA 3FDZA 3G2OA 4I9UA 5BN4A 2B8EA 2K2WA 1XKLA 4KGVA 4NHEA 3BDAA 3OZDA 5DLPA 2PRYA 4L5IA 4KUGA 4MI9A 4YJ3A 2IDMA 1RQ2A 1X66A 3HO8A 2HLDD 4RKFA 4PTZA 4HQRA 4B4KA 3LA6A 1ID8A 1O87A 1WHSB 5KG5A 2GWHA 2WB4A 2ORED 2A8YA 2W6JA 3HCCA 3JWEA 3KOZA 3PEVA 4LJ8A 5TEWA 2WQ7A 1J2MA 4D5EA 3Q15C 3D6NB 1NWCA 3IV9A 5T6MA 2ZRPA 2W2LD 4R83A 5JPCA 4LY0A 5CA0F 1QGUB 3CR3C 2QKQA 3QW2A 1G4AE 2PX2A 1CEEA 2BZGA 3LZDA 1C1YA 2COKA 3CJRA 4MCIA 2LUOA 1IBCA 1Z7WA 2ZR0A 3CPSA 5FFFA 5B37A 5FOSA 3RC2A 2QZJA 2WU3A 3WBJA 2AXEA 5CFPA 1D03A 1VL8A 3GA5A 1ZKMA 3IP3A 3KYCA 3H2YA 4B2YA 5FLKA 3CR8A 1J0AA 1XEWX 4MV6A 3TLMA 3VPDA 5D3KA 1YDHA 3NLLA 4JUIA 3TR6A 2QPAA 3ZVRA 5KOHA 2GERA 3N6XA 5IK2D 4BLQA 3I8SA 5BW6B 1BPXA 1L4FA 1UZNA 3RW9A 1KTIA 3RFCA 4Y2PA 3D2NA 4I9GA 4UM9B 4ENUA 3A31A 3A0RB 4U00A 2QUAA 1JHDA 4FYVA 4TMYA 2HMVA 3WO1A 9LDBA 3CUVA 4BZZA 2SKEA 3C6QA 4LPSA 4GH5A 3HDGA 2OEPA 4PC6A 4DY6A 5PNTA 3OOJA 3L6EA 4CIWA 5JNSA 3JR7A 5SY9A 1TM2A 3BTOA 2BZSA 2H1IA 1D07A 3AU9A 1Z22A 3HGTA 3SLKA 3T5JA 1BD3A 1LEHA 1EE2A 1HGXA 1I2BA 1OGYA 2WEKA 3LHIA 1LCIA 4RXUA 13PKA 2KKVA 1DC4A 1M1YB 2JHGA 2VSQA 4MTLA 3VTZA 3D64A 4MWSA 4U0JA 2Q9UA 5EE9A 3VHQA 2YWXA 4F9EA 3E3AA 3KHKA 4K3VA 4K88A 3CNOA 1JNXX 1E1NA 3ZWPA 3H86A 1NQWA 3EFOA 2CJXA 3RYFA 2FUKA 2SICE 3LC0A 4YHHB 2YRWA 1A9SA 2VL7A 1GKIA 1S9DA 1ENOA 4XWGA 3MUOA 4K5QA 1XZCA 3FETA 1R0XA 3GRKA 2XCLA 3JQBC 4N49A 1FP7A 4B47A 2PS3A 2Y8EA 4YRBA 4AYXA 3SAFA 1UK8A 3W8EA 3K5IA 2CXPA 3CNEA 1CUYA 4ISCA 1GKUB 5IBRA 4RNDB 2XWPA 2GQ0A 4D0NA 4W5QA 5GZ6A 1SZDA 1FQWA 1GSIA 3GEEA 3WLSA 2H1HA 1A8HA 3SIRA 2JAHA 4R1PA 1H2HA 2B1JA 4RSHA 2ZANA 1D1PA 2FHSA 2VAXA 3PXAA 4JQCA 1NY6A 4IFEA 4WLUA 4KFSA 3GRAA 5FRDA 3ZHTA 1TAGA 1T13A 4K1XA 3D8TA 1VE5A 2O2HA 2CD9A 2B94A 2Z43A 4E1BA 4TLMB 2J6BA 4MW2A 1J9GA 1V7QA 2ZYHA 1I9CA 2ZYGA 2A0YA 1O94A 5CYFA 1JR3D 1JXEA 1I6LA 3O4IA 5F35A 1MSWD 3JD3A 3V8EA 3RF9A 2PANA 4RU9A 4U2DA 1CY1A 2CNLA 5EMNA 3T7IA 3C3WA 3Q9NA 1MFPA 4QULA 3JU3A 3WGUA 2KTQA 1ZAYA 1EJBA 5KAPA 2Q46A 3CX7A 3GLFB 1ZJ5A 2ACEA 4RF4A 1JR3A 3VU9B 5KUTA 3PCTA 3OTHA 4F3TA 4ZAGA 1JA9A 5GJCA 5GP1A 2HBZA 3D8HA 3EZ9A 1MVLA 4JV0A 1GY8A 1E77A 5G40A 2XZLA 1E92A 1PGNA 2CJWA 1OU4A 1R15A 4QGBA 2A9OA 2WLTA 2KHVA 4QHTA 1F6WA 5IXYA 1G8YA 2R6JA 2LVBA 3H4IA 4P3XA 4DSNA 3FTFA 5EWFA 3NHMA 4ZI3A 5JS8A 1DTWB 2ZVJA 1HT2E 1N3IA 1KMQA 4JR2A 4D45A 3WOHA 1O03A 1N4DA 1OE0A 4DDWA 1GUAA 4U8GA 3EEIA 3NIGB 1U6KA 2RCNA 2ZUEA 1N6IA 2WJYA 3BCSA 4AROA 1RHJA 2QLTA 3LCMA 2JL1A 4ECSA 3GYBA 4I27A 3Q40A 1KBQA 1RQPA 1XVIA 3X1WA 4YHBA 3IDAA 5HQTA 3MPOA 4QRDA 1H5UA 1E6KA 2DPXA 2Q28A 1YA4A 5FWAA 4M46A 2EHJA 5JJCA 1TQ4A 1NHWA 1WO8A 3FCYA 3HSSA 3LYAA 1YZ3A 1RE1A 4H17A 4X1KA 4Z2YA 3OQMA 5L3SA 2XYQA 4RF2A 3TFRA 1Y0BA 2GB4A 3Q3JB 4ENVA 2HPAA 2R1UA 2JATA 3OLQA 2QVGA 2PXAA 3BHJA 5KFUA 4YY3B 4C03A 2C2RA 1K6EA 3LHSA 4LZPA 3ML1A 4D9CA 5K0SA 2PUDA 2CCGA 4CR8A 4Q66C 4E1VA 3P4XA 4V2UA 1IH8A 3ZIUA 2IWRA 3QVGB 5CLIA 2P6MA 4WD3A 3ONDA 4U6NA 3DO5A 3UGTA 5IAAA 5E9QA 3JWHA 4I29A 3P9XA 1X1TA 4GMFA 3M6KA 5G41A 1Q7BA 5HOEA 1WUTA 4RD1A 1MKYA 4UBJA 1X9GA 5TS3A 1J1ZA 1AE1A 3GJZA 1KARA 4NXMB 4N48A 5JFTA 1NPTO 1R8XA 1PEKE 1UMKA 3PC8C 4I4CA 5E6UB 3W06A 3GH1A 3PZBA 4IIGA 1QU3A 1XZIA 3AF5A 1CJCA 8ICIA 4FGWA 2JA1A 3P9PA 1AGRA 2F8LA 1M1NA 3Q10A 4GM4A 4M2YA 3VDNB 5I7AA 5M04A 1T2NA 3V1MA 4TVBA 4K2HA 2CUTA 5A3JA 3ZIAD 2QARB 1J2JA 1HDIA 2ZI3A 4KQ1A 2EW2A 3F9RA 3PNYA 3T3EA 5BQXA 1RWMA 2HBLA 1CP3A 4ECWA 2JASA 3N2KB 3VU3A 3D3KA 1EKXA 2WMOB 2IU3A 4UDXX 3JQQA 3ZWXA 4J43A 2V0NA 2HA5A 4RELA 4BEWA 2ORIA 3F2VA 1W6RA 5A06A 5A2GA 4FGSA 1Z7BA 3L7BA 2YOFA 4O4JB 3KQYA 3WNDA 1JR4A 4A8JB 3ZZ0A 3CJQA 3TW8B 2HCJB 4KXYA 1OU0A 1B1AA 4IL5A 5K8LA 4BQSA 1Q7GA 4OKNA 3TE6A 5A4JA 4KLGA 1JU9A 5IHPA 3WGIA 2EAMA 1DGSA 1ILWA 5A2QA 4L4XA 4RS4A 4ZWNA 4BP3A 4DZTA 1T5DX 3CBGA 3PMNA 5AKLA 1WCWA 3G0CA 2K4IA 4MICA 3PG5A 4P36A 3TNDA 4EVIA 1K89A 3A1WA 3SDBA 1W8IA 2ODEA 1SJ9A 2FMHA 2QN8A 3LRXA 4XX1A 5FL7A 3VSDA 3KR1A 2NRTA 1QONA 2V9CA 9ICLA 2VAVA 5CNMA 1W59A 4M9ZA 1IG0A 3BK7A 2IIPA 4P4PA 1OFVA 3IUYA 1DHRA 1IIRA 3GFFA 4EW1A 1AUQA 5JLAA 1KBZA 2NZ8A 3OIYA 3OZCA 5TQ0A 3JWGA 2F1OA 5KBYA 3PEFA 2FV8A 3N0VA 1CJKC 2APJA 1EVZA 1WU7A 3FPLA 3KOXA 5FWNA 3TOXA 1H0RA 1SCDA 1U0LA 3QYJA 4NP6A 4QZGA 5ALGA 1PW7A 3ANYB 3MWFA 4B40A 4QVIA 3AYXB 3IKJA 1YI1A 3VKHA 3A6JA 4JX8A 1USWA 2AB0A 1EUDA 4H7JA 5A0TA 3A9UA 4RV4A 4P4UA 3TVTA 3ISCA 2OKGA 4NE2A 4YP1A 5HXAA 2YVLA 3MOIA 2D54A 4YQZA 1LA2A 3D8BA 4DUGA 2VKTA 1T9ZA 1XFDA 5DCWA 1M2EA 2BT4A 4NATA 2ID8A 1WPQA 1AU9A 3LQ1A 4R71A 1ZL2A 2YDYA 3B6ZA 3B8EA 3ISDA 2FR1A 4KSBA 4FZJA 1Z4NA 4X97A 2PUWA 1CHNA 2P0YA 2ON6A 3KOOA 1PFWA 4PRYA 4LRTB 4BQNA 4QW8A 3CSUA 1STOA 4YDHB 3AY6A 5HQ3A 3OE7A 1SY7A 2C88A 3I9V6 3MCTA 3U31A 4JA0A 4IXTA 3ICEA 1V25A 3M8RA 1G5RA 4GMXA 3A4NA 1ZSVA 1PK1B 3H2IA 2B0JA 2YJ4A 4E31A 1X9MA 1KSHA 1U4BA 2XUGA 2AUNA 1GLGA 1YHYA 4JROA 4XB2A 5BURA 5C8XA 1WZUA 5TISU 1J6UA 3TW6A 1MH1A 1JN0A 1EHCA 2WTMA 1PUXA 4A2WA 1QDLB 1PR3A 1GDTA 2PLFA 2QLFA 3K96A 3MJVA 5KL1B 4CQMB 1G7TA 1YBHA 4KACA 3A6GA 2CVOA 4GKKB 3B1WA 3WAJA 1S2LA 1Z26A 3SVTA 1UZMA 3ABRB 3V32A 1IY2A 1UC4B 2GCOB 1CSEE 1NOKA 3PC4A 3GJRA 3RVPA 5LQJA 4QDUA 4GKBA 1Z74A 2VDMB 5FTJA 5B7NA 1KI3A 1A4IA 3CC8A 2PZMA 2WWHA 4KFTA 4ARZA 5A5EA 5BQPA 4BFVA 1RIFA 2JS7A 2AE2A 1Y63A 2KI5A 1E5XA 2FYTA 2QYTA 4S2EA 4EZBA 4TL6A 2O2CA 1XZLA 4FWIB 5B3JC 1KDRA 4MVJM 3OZWA 5A02A 4NONA 5KFGA 3VR4A 3A4TA 1Q17A 2X40A 1N5DA 2B82A 3EIEA 2R6HA 2RC5A 3RF6A 1QIGA 4NBVA 2QUBA 5L95A 4EPRA 3GLGB 2O3JA 3H9GA 1YBFA 2MSWA 4HG2A 2DWQA 4KJXA 4A3SA 5KNBH 5JJ5A 4P83A 5KOJB 2PRIA 3KXLA 2EQYA 3ZHZA 5HUQA 2Q4TA 4OGLA 3PICA 1DZ3A 2CNNA 4EY8A 4FDLA 1W19A 1L5HB 1VMIA 1T8UA 1JSXA 1ZI6A 2BKLA 2CMFA 1OWLA 1CVIA 4Q9JA 4CLRA 1T9AA 1QTRA 1JFSA 4Z6DA 1CK4A 3QX7A 4I0WB 3VDRA 1A0OA 2DTEA 4ZT7A 3BTSA 5EJ5A 4GLBA 1ZQAA 1RR6A 1VDVA 4F50A 3HVJA 2CK3D 2YX8A 3EUWA 3NXSA 5TNXA 4D99A 3UAOA 3SM3A 4EVSA 5EZYF 2WB1F 4NQRA 4X44A 1SXJD 2OOKA 5ICFA 1QRTA 1JWLA 2IYUA 2JFQA 1TZBA 2NU8A 5EGNA 2YFHA 2C04A 4RJIA 2A0XA 4HYQA 1K0UA 3WQSB 2JCVA 3WISA 4PV7A 1WBBA 1U5AA 2IL1A 3CRQA 1PS9A 1HFJA 4M83A 3WP1B 4D8YA 4EL5A 5GZ3A 1QQBA 2RGGA 4YCLA 2DLDA 1CUJA 1EFPA 3QHQA 4OI2A 4J9SA 2BMWA 2MR5A 4QXPA 5DI3A 3ZU6A 1MUUA 5HK9A 4JOBA 2XTNA 3ADBA 1SCJA 2HKIA 1COOA 2I8LA 2CFTA 2CWDA 2ZIAA 3QXJA 4FEEA 4PAWA 3IT2A 4YNBA 1RAGA 3SU8A 4C4ZA 1ZQIA 2O8VA 1EWRA 4PZLA 5T41A 4NMWA 1R0SA 1N2BA 4Z54A 5HFNA 1A1VA 1DTSA 1X40A 5J2JA 1T5IA 1Z12A 4FE7A 5DNDA 4BMYA 1FXWF 5FV4A 1Y9ZA 2WDZA 4I50B 1TOAA 3SJ7A 2XIJA 1XSNA 5KNCD 2IP2A 3B1ZA 3QBJA 4D4GA 4JL6A 5BXYA 5I9IA 2X6TA 3FNGA 3I53A 1HDRA 3VPSA 4DEZA 4DR7B 3THOA 5KG1A 4QWEA 3VPGA 3AL0B 3GT0A 4P08A 1DARA 2Q5QA 5EJ4A 1W36C 3C23A 1D6MA 5TMDA 4AO7A 1HIWA 3I61A 3W5AA 1DAIA 1MOPA 1U2GC 2ABWA 3ANLA 3KALA 4DCGA 2OK8A 4POOA 1QIFA 1VQ1A 3DE1X 4J9LA 2BFCB 2VP5A 4DWWA 5LDHA 5GTIU 1JHVA 1WCIB 3U48A 4DOCA 4ME6A 3L1JA 2Z57A 3IELA 2R7MA 4QJBA 4BJHB 2B1GA 3OZRA 1PFVA 1RWVA 1U8ZA 3NJRA 3RTDA 5JCPA 1QRRA 1ND6A 4Z9FA 2CHFA 2XMRA 1CIPA 1Z7GA 3GC6A 3QEKA 1XTTA 2TMGA 3OZAA 3C3AA 3GZTB 4C07A 3LNCA 3ER8A 2DSTA 1N2IA 1CHDA 4KLOA 1F2UB 1VSQA 1OTYA 3TM4A 3DOHA 4Q3OA 3JWJA 1GGEA 3ENKA 3V4FA 4DS3A 3CUKA 2X0NA 4ENPA 2UVPB 2ZPAA 5EP1A 1RHUA 5H5JA 2YXPX 2WWTA 1GGNA 3AEUA 2C7RA 5JAZA 4O1HA 3CVUA 5JQGA 4FINA 4A36A 5KFZA 1V9LA 4WVFA 2E89A 2Z3ZA 1DXQA 5JCJA 4EUFA 1LQUA 3AP3A 4I5FA 1VXOA 1GL6A 1LTHR 4LQCA 5J58A 2EP8A 3IV7A 4JI7B 4RH0A 4C6TB 4IC9A 2VHUA 3IBTA 1Y48E 4EZ6A 4MYCA 2G25A 2IXGA 4JZYA 5JECA 2Q6KA 3N2EA 3KOWA 2ZBQA 4D9EA 2O2JA 3H9JA 1UFOA 3MDAA 2WIDA 4G09A 4LKRA 4ZOCA 1T3TA 3PD1A 3E53A 1KVSA 3LUCA 5A5DA 1NMQA 1E0AA 5KG7A 4GE0A 1QK4A 5FEMA 1RAFA 3VDXA 4LYHA 1GUZA 3NBYC 4IDDA 2P79A 4UTNA 2HZBA 1NK9A 5LA6F 3KXIA 4N65A 4RXTA 4MPRA 2WWGA 3QTTA 4P3KA 1QGDA 2JB9A 2P77A 3PEYA 1WHSA 3K4HA 1ZIOA 3CONA