3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
3QX7A 5AK6A 5AKYA 3KC2A 4AS3A 1L7PA 4Y2VA 3QYPA 4OCZA 2GFHA 1XP5A 4Y2JA 5AW5A 2P27A 5AW4A 3OPXA 2HSZA 3AR6A 5AM4A 1Z4QA 3ZVMA 3DV9A 5ALHA 3CNHA 2WF9A 3HLTA 4OFZA 5AK3A 3RFUA 5AICA 4O8CA 2I6XA 3J7TA 4UAUA 2EATA 4Y2XA 5AM2A 1VFPA 1WZCA 2JAUA 1QQ5A 5AW2A 1RMQA 3VAYA 3AR3A 4C4TA 1F5SA 4QQFA 2NYVA 5AKHA 4XPZA 4EENA 3AR5A 3SMVA 4DWOA 1Z4KA 1S8OA 4EX7A 4Y2YA 1NRWA 2ZG6A 4F72A 1RRCA 2FUEA 4GXTA 3EF0A 1Z5UA 4FE3A 3QU9A 2C8LA 2YN4A 4E88A 1U7PA 3U13A 5AM5A 3FVVA 3SLRA 5AVTA 2ZXEA 2IYEA 3A3YA 3B9RA 5AVQA 2B1RA 5ALTA 3RF6A 1RPZA 2G1AA 2HF2A 5AVVA 5AW3A 1ZRNA 3L1UA 5AW1A 3ZW7A 2MSNA 3ED5A 5AW9A 4Y2QA 4KN8A 3KZXA 3N28A 5AKEA 2CFTA 1RMTA 1RC8A 4F71A 3B8EA 1RMYA 2WHEA 2P9JA 3WKCA 3L5KA 5AK4A 2C4NA 3E84A 4EEKA 3L1VA 4BX2A 1WVIA 2WF6A 1YV9A 1L6RA 2RAVA 3CZ4A 5ALZA 2GHTA 4UMFA 4BX3A 4UAVA 4I9FA 2EARA 1LTQA 1VJ5A 1N8NA 2YFYA 3M9LA 3QU7A 3KD3A 5E0OA 5AW8A 2QLTA 3WK4A 1SWWA 4UM7A 2FPWA 2JARA 3ZVNA 4OD0A 4EELA 2G08A 1LVHA 2OYCA 3L7YA 4Y2UA 2I55A 5FP0A 5ALDA 3ET4A 4UU0A 2NO5A 5AW0A 2MU1A 4HGOA 4UMEA 3AR7A 3WGUA 2I7DA 2RARA 5AESA 3SHQA 4IG4A 1S2OA 2YMPA 5ALFA 2HDOA 2O2XA 2O9JA 3NANA 3QUQA 1TJ3A 3F9RA 2B8JA 3N5KA 2WF8A 4Y2TA 3L0CA 4UARA 5ALMA 1Z5GA 2HEGA 2W43A 1SU4A 5AKGA 3NIWA 2AGVA 5A3SA 3QU5A 1Z4IA 3ESQA 3QLEA 1PW5A 1O08A 5AIBA 2R8ZA 2RBKA 4NWIA 2G80A 4XE5A 4BYGA 3IB6A 1U2TA 3EWIA 2OM6A 1CR6A 3MC1A 2B8EA 4BX0A 5AM0A 2OA0A 4BKMA 4NV0A 4YGYA 4CNQA 1J8DA 4C4SA 2WF7A 2JAOA 3IRUA 2GMWA 2IOHA 4L57A 2HCFA 4UW9A 3MPOA 3U7FB 3U19A 5AVWA 1XPJA 1TJ4A 2FEAA 2G0AA 3R09A 3U7HB 3TLMA 3D6JA 3KBBA 3L8GA 2I54A 4JB3A 4UMDA 5AHXA 5ALIA 3UMGA 1Z4LA 4XQ0A 3MMZA 5IT0A 4UM5A 5ALQA 4CF4A 4BNDB 1EK2A 1Z88A 2I34A 2YJ3A 2EAUA 3FZQA 4G63A 2FPXA 2VKQA 3MN1A 3I28A 1VJRA 2FUCA 3SKXA 4YIHA 1XVIA 2C88A 3UMBA 2PR7A 5AIAA 4NAVA 3GYGA 3OTQA 2Q5EA 3W5DA 2IA5A 4Y3UA 2YJ6A 3DAOA 3S6JA 2B30A 3A1DA 2YJ4A 3NAMA 1YMQA 3KOOA 4HGNA 2HF7A 3PGVA 3SKYA 4HYTA 1Z4MA 3ESRA 3BA6A 3DDHA 1AQ6A 4GIBA 5AM3A 4CF5A 3E58A 1WPGA 3ZX5A 5ALRA 1Q91A 2CFSA 4MUMA 5ALGA 2FPSA 3WGVA 3EPRA 4DW8A 3OCVA 1Y8AA 1Q92A 1QQ7A 3K1ZA 2PKEA 1U02A 2MU2A 1L7NA 3QGMA 1ZS9A 5AI0A 3IJ5A 4B6JA 3OCYA 5AVZA 3AR9A 5ALNA 1N9KA 3I76A 2YMQA 2BDUA 4BEVA 2B0CA 3QXGA 5ALWA 5A3RA 3PDWA 5A3QA 1ZD4A 1EK1A 4AP9A 3AR2A 3A1CA 4EZEA 3FPSA 3UM9A 3KDPA 2P69A 2G07A 2ZBFA 5AKLA 2CFRA 2OBBA 2HOQA 5ALSA 1T5SA 2BDEA 3N8GA 5AK5A 2R8XA 1ZOLA 4NFLA 3ZWKA 3W5BA 3ZX4A 2B82A 2GHQA 4HGRA 2ZBGA 4CE6A 1L8OA 2HX1A 3L0BA 4YH1A 2P11A 4MWOA 5AVSA 4FYPA 4J2TA 1TE2A 1ZJJA 4YCLA 4CF3A 2YMMA 3N1UA 5IS2A 2FPRA 1L8LA 4BEWA 1NF2A 2WFAA 4UMVA 3SF0A 2WM8A 3W5AA 2JAWA 5AI6A 3L8HA 1RQNA 3L8EA 5AI4A 1RKUA 4RESA 5ALEA 1YNSA 5AKJA 1CQZA 1X42A 3WKBA 1RLMA 1YS9A 5ALOA 4YIKA 2ODAA 2GO7A 3QU4A 1ZD2P 2Q4TA 1Z4NA 5ALXA 4NABA 4XOUA 2IOFK 4PNHA 2D2VA 1YJ5A 1RKQA 2AUTA 5ALYA 4AS2A 2IOFA 2PQ0A 4FFDA 3AR4A 2JGAA 3PCTA 3N07A 2G06A 3PGLA 3L8FA 1Z4JA 5AI5A 1Z4PX 2YMLA 2X4DA 1ZD3A 3ZTYA 3ZU6A 1KYTA 2HO4A 1NNLA 3ZUPA 4YCNA 5AW6A 4BNDA 2QYHA 4UU1A 2G09A 1L7OA 4BBJA 3OCXA 4IFTA 3ZWDA 4G9BA 2BY4A 3WKEA 4ZEVA 3ET5A 2W11A 3OCWA 2DQSA 1T9ZA 3DNPA 3NASA 1TA0A 2WF5A 1T5TA 4ZEWA 4Y2RA 3I6BA 2NO4A 3WKAA 2RB5A 1O03A 3WK8A 5AM1A 3NUQA 1L7MA 4Y2SA 5AKZA 3A1EA 1WR8A 1Z4OA 3ZI4A 3QUTA 3QNMA 3WK9A 1RLOA 3NRJA 3R9KA 3FM9A 2AH5A 4EX6A 3FPBA 2YBDA 4KYTA 5AVRA 3QU2A 2C8KA 5AVUA 5AVXA 2R8YA 3WK7A 3AR8A 2AMYA 4C4RA 1QQ6A 2CN1A 4DFDA 3W5CA 3B9BA 3E8MA 1U7OA 2I33A 2W4MA 3P96A 3UMCA 4L6CA 5ALUA 2FDRA 3M1YA 4KX5A 5ALJA 5AKKA 3QUBA 4L6AA 5ALLA 1FEZA 2ZBDA 2FPUA 4KNVA 5AVYA 2HI0A 4ZEXA 2HHLA 2YJ5A 5T41A 2C9MA 3U26A 3EF1A 4HAIA 4OHFA 1U2SA 3WK6A 5AW7A 1J97A 3FGOA 4HGPA 1YDFA 3NALA 2ZOSA 4RETA 1SWVA 4I9GA 3SD7A 1RLTA 3OCZA 4QJBA 5JJBA 1RDFA 3BWVA 5ALKA 3R4CA 5AKIA 3HYCA 3OCUA 4HGQA 4KNWA 1MH9A 3ONNA 2Q4RA 4KX3A 1QH9A 1ZRMA 4Y2PA 2B1QA 3WKDA 4J03A 1RKVA 4UASA 4H1WA 5IT4A 1RQLA 3I1YA 4UATA 1QYIA 1TJ5A 1JUDA 5ALVA 4JDPA 4YCMA 2R8EA 2YY6A 5AI9A 5AKXA 1K1EA 3E81A 3U7EB 3QUCA 5AI8A 2ZBEA 4DCCA 3ZTWA 2FI1A 1IWOA 1ZD5A 3U7GA 3WK5A 5ALPA 3L0YA 3ZVLA
chains in the Genus database with same CATH superfamily
1LDMA 3QQPA 1QHSA 5JJKA 4YCDA 3TZLA 1P3DA 4Q7JB 4QUAA 2H57A 3KXIA 2ZJAA 3IHKA 1PO7A 2HDHA 4D25A 3OSPA 4O3SA 4EJSA 3HJGA 5EE3A 5E8RA 2PN1A 1FLAA 2B3DA 3G5MA 4U6SA 3EZ6A 1OXUA 5KVSA 2NYVA 4HB3A 3KVVA 1IM5A 4EX7A 2PZ8A 3QITA 1N34B 5BSGA 4UHFA 2IYEA 4RHFA 2VH2A 3P52A 1JU3A 2F9LA 4A0HA 4F71A 3V8MA 4TYYA 3IVMA 3DE6X 4QDJA 4YV0A 3AERA 4IGEA 3SJZA 3VOSA 5IDQA 5L7WA 1XDUA 3QZUA 1C2TA 4LPKA 4I81A 2BV3A 1XZKA 2PDAA 3E05A 1G8YA 1WUYA 1ZOPA 2WU3A 4HDQB 3I9V1 1VSUA 4B9LA 3P19A 2A9PA 3IO3A 3FTEA 4YCAA 1ZQGA 2DE0X 5EGNA 4UB3A 3K6SB 3L2OB 4DNFA 3RBVA 2ZAYA 4PSUA 1ZVKA 2FLKA 3A4IA 4LOIA 2ZAOA 9ICFA 3P5BA 3FWPA 1WNTA 2YXBA 1LBHA 1SO8A 2ZRNA 2VUUA 4OGFA 1DUVG 1G59A 3J81A 3U40A 2MAXA 3WE7A 4UEKA 5A6SB 1X1AA 1GO3F 4U39A 2XNDA 5ELMA 3MN1A 1VJRA 3SKXA 5A5GA 1OXTA 2EJWA 2HQ1A 2ZI3A 4RSHA 2PU5A 4HH4A 3DAPA 4F3OA 1P7YA 2YY5A 1X3SA 1Z8FA 3DZKA 4R3WA 2HF7A 1HE5A 3FBGA 3H5OA 4BUGA 4HWRA 2NSJA 3UMRA 1KJJA 5GJBA 5E4FA 5EVCA 2DFVA 2VJNA 8ICHA 4IIJF 5HKLA 4QTZA 1DHTA 3QXCA 3IKJA 4G4JA 5JC8A 1YQWA 3OETA 4LCJA 1T4CB 2GNAA 1CJTC 4ZVVA 1W44A 5TQ2A 2B7LA 1QO9A 2BUAA 3LF2A 1G5HA 3LUGA 1OTHA 3C8HA 1HEYA 3DMNA 1EVQA 1JROA 4MEJA 2AOWA 3AM9A 4MITA 4GDMA 3K6KA 1VKRA 3LT4A 3K6SA 2AIRA 4IF6A 1T9AA 3SF0A 1CUSA 1NVVQ 2F1HA 3OFNA 3V48A 4IZIA 1RLMA 1CYEA 2Y0DA 2O1SA 3W79A 1LJLA 5K7SA 1QX4A 3URKA 3T34A 2OCDA 2PT9A 1JF8A 3QEBZ 1P19A 2JHAA 1QIDA 1OC2A 3CTMA 5A6SA 2QYHA 3IR7A 2W6IA 1XKQA 4PNPA 4WNYA 4YCXA 1VE9A 1R5OA 1T9ZA 3W3AD 3OF5A 2R751 4AU1A 4QQNA 2XVMA 4JMPA 2P6UA 1LEHA 3T94A 1UCFA 3UF0A 1WPRA 4NZOA 4MDHA 3FZGA 1YR3A 4I8IA 4O5OA 5LKAA 1CIJA 4YAKA 3QUBA 1I3LA 4G4GA 3OJLA 1T4CA 1NRJB 4RE6A 4Q1DA 2V7QA 2AJDA 1PKXA 4U7FA 1DIOB 2RHHA 3ZD8A 4DCPA 1SXIA 2OKCA 3GLKA 4FU0A 1GN9A 5F9MA 2RHJA 4MGYR 2PGOA 4QGAA 3O8BA 4RPJA 2QBYB 3L7CA 1W29A 5JYEA 3ZV3A 1BIFA 7ICJA 3OQ6A 1CHNA 4Q3CA 4FHEA 1KYIA 4TSFD 3MGIA 1SBTA 1XZBA 3WMGA 3G89A 2HCTA 5CT8A 1WCXA 1P9LA 3ETNA 1XZLA 3ANSA 3TFOA 2V65A 3FTQA 2IP2A 2M6KA 3QY9A 1UDRA 4WJ3B 1JDNA 1SC3A 2XZDA 1V5IA 2DCUA 1QU3A 1QAQA 3PUWA 4R3NA 3CF0A 3ZIDA 4I29A 3FFBA 3FMFA 1Z1BA 2C04A 1V5WA 3A0BU 2XUGA 3QE9Y 3TX6A 2ZT7A 4EO9A 4GLBA 3CX8A 5KEIA 4TZ0A 5GOZA 5KFMA 3CLRD 3M1AA 1MD9A 2NZ2A 2OVFA 4ZCSA 1I7LA 1CS0B 3F49S 5BQ5A 1DRUA 3JQQA 3HJFA 4N82A 2QNBA 4KR7A 4KPYA 4L76A 2OORA 4FHDA 2MOKA 4IINA 1XTKA 1LSOA 1Z5PA 1A5SB 3ZKWB 3OJEA 2PEZA 3IX7A 3LRTA 5AXBA 2ZIXB 4ACOA 4PBRA 1RXEA 4I66A 2PUGA 3G1WA 3C6ZA 2VZ9A 3P2JA 2QBYA 3S8MA 4KN9S 1KPHA 1BEZA 3EDYA 2N1RA 4RZ2A 3EPGA 3LDGA 2CEAA 2CNWA 2GO1A 1RAAA 1WETA 5DNWA 2FEPA 4DM7A 3IBCA 2SHKA 4AZ0B 4J2HA 3T3PB 3HWTA 4JROA 2HYIC 5G41A 4CM8B 4X84A 1E2JA 3ZBTA 4B8ZA 2P3OA 1FSGA 2Q9UA 4WOPA 2XIJA 2O2HA 4IICA 1ZQQA 3EZ7A 3A26A 3CLRC 4JKYA 4MPTA 1SXQA 2P9GA 4C7MA 8ICUA 1AN9A 5JD6A 1XCGB 2YJ6A 4MWEA 4ZJUA 2Z57A 4IFBA 1VQ1A 1Y3BE 2VZ0A 4R1OA 2EZXA 1N3LA 1X94A 4GC9A 2CVOA 2YWFA 2P2YA 1JR3A 3WL8A 2NWQA 2RE8A 3PGA1 5FPKA 1DV2A 1M75A 5LVAA 4A4DA 3DTVA 5C5DA 6Q21A 4J9PA 1NJGA 3FGPA 5F64A 1PJBA 2Z4SA 3LQYA 2QKQA 1GOTA 1EK1A 2H18A 3ZKWA 2A92A 3IPAA 4F3TA 8ICTA 4Z0NA 4X6XA 2LR0A 1M76A 4WLNA 5CLGA 4NK5A 2ZIXA 1OGIA 5A6VA 4F45A 3O47A 3CC8A 3JYOA 4B43A 3CB4A 1GUBA 5AVSA 1GPDG 4IQ8A 2XMQA 2MSCB 4EHNA 4KDCA 4ZCQA 1ATZA 1NF2A 4YBRA 2CZGA 1EUDA 3AF3A 2JAWA 1BX0A 3OU7A 4LC0A 4IGAA 1OFIA 3F46A 3DB1A 5B36A 2JLAA 2FN4A 4XWGA 1IHOA 2Q1XA 1AIPA 2YCBA 3TTSA 5ALYA 4YY3B 4AZ0A 4QDOA 1ZYUA 4RQAA 4CM8A 1D2GA 1SA0B 1UM9B 3AT1A 5IHXA 2J8ZA 3CUVA 1AHNA 3UJ7A 1M3SA 2B69A 5GTHU 1KIMA 3CEPB 1SD2A 2BCRA 3VISA 1PT7A 1I4EB 2Q49A 3DLTA 3NRJA 3AKYA 5EHGA 4KU4A 4JKIA 2B8WA 4DFDA 2IYUA 1FXWF 4C3ZA 4NCAA 2B5WA 4L4RA 5EE5B 4EOGA 3GAAA 4L0MA 2Y1EA 1UBJS 2P2LA 3JPNA 5M34A 3R0JA 1PE0A 4KLEA 2PMCA 3FMGA 4GX5A 4ZVSA 2CJYA 1X74A 3NIDB 1G2QA 2RKBA 4L02A 2QPTA 1B7GO 3K31A 4JEUA 4KFSA 1MAWA 1ZZEA 2IIPA 5C3UA 4CCAA 4FOSA 5ALPA 2Q9BA 2Q2VA 4CR8A 7ICHA 3V2UA 3KDAA 5LUBA 2GFHA 4QOSA 2OUIA 3DOHA 3ZKAA 4RQTA 2OLEA 1X19A 2EATA 1SA0A 4OUKX 4N8DA 1UM9A 2BTQB 1E64A 1JIQA 1DQZA 2X6QA 2XNHA 4C6RA 3L7OA 3Q87B 3L04A 5DCYA 4KXMA 2OXTA 2QLJA 2J5RA 3PKZA 4UEQA 4PG5A 4DLNA 4GF5A 4PY2A 3JD4A 4PO9A 2NSLA 2HF9A 2GA8A 4MW7A 4U9HS 1EUCB 3IMGA 2EFJA 3RJFA 4TM7A 4NM2A 5KYNA 3WMWA 2O8VA 5C8ZA 3DF9A 2HSJA 3VYUB 4HLNA 3CW8X 1FLNA 1RZ3A 4HGZA 3VFDA 1YZFA 1QHGA 4L0DA 1YHNA 3EDMA 5JU6A 2JARA 3I32A 4HCJA 3GLTA 3KZCA 5FP0A 2VTEA 2X0DA 4BE9A 4XTCS 2IPAB 4MUFA 2DT5A 3RTGA 1L3TA 4DMLA 3W8FA 2R2GA 2AOUA 1FY2A 3N74A 2HD4A 4FHGA 2Z83A 3HFSA 4I7EA 4BHTA 3PXBA 5CYGA 1GNTA 4JWTA 3DW3X 3PR1A 5LDHA 3RPEA 1E1YA 1P33A 2WTUA 4RV4A 1JMKC 4O2LA 1C1DA 4BYMA 4HWPA 3W77A 2HIMA 2VF4X 4F04A 4P83A 3R09A 1PS9A 1E9BA 5HHTA 4EPVA 2QTRA 5IM5A 2NV2B 4EDHA 4JLKA 4JI5B 2E1EA 3RS7A 1KO1A 2OWDA 4E3WA 4Z7NB 3C2MA 1S8NA 3F71A 1JQ5A 1QIJA 2BTQA 5DVZA 2ZIGA 2HJSA 3T61A 1LPSA 2ZWIA 1JIUA 4ADSG 3RTVA 3M3PA 1T9BA 4FK8A 2XAAA 1EUCA 3AFHA 2IIVA 5ALRA 3FKSD 4RYLA 1AQNA 4GGOA 1K98A 2FMSA 4MI1A 4OHYA 2XCTB 1R2QA 4B6JA 4F6LA 3FCSB 5ALNA 5EYPB 1M72A 3PDJA 4C80A 3VOAA 2WT9A 4D3XA 3ODPA 1E20A 2FZWA 4Q9KA 3SV4A 3SS8A 4Z99A 5EIHA 5EZ6B 2AN3A 4QREA 1LXCA 4P5EA 2ZTLA 5AK5A 3MRTA 5FPQA 2VT3A 4CIVA 3KL2A 5DT2A 3ZZUA 3NBZC 2P6PA 3NQ41 3Q5EA 4S12A 2B2XA 1SXJB 1PL8A 2ZCVA 1MW9X 3VHRA 3GFPA 4YXWA 5DHPA 3BWCA 4BWVA 4UUMA 4UBNA 1ZM3A 5EEHA 5DOVA 2FE1A 3MJDA 4PIPA 2IS6A 2GF0A 2QVXX 4D4HA 4YACA 5F7ZA 4H9GA 1ZD3A 3LQFA 1QV6A 2WUFA 3BE6A 3LPAA 4QNRA 3GQCA 3CP8A 4JD5A 2QDKA 3PL1A 1H3FA 2XTMA 5FNVB 5CFQA 2UUOA 3AN1A 1DJLA 1NN5A 4O0LA 4EHHA 5B4UA 3OTIA 4WZ6A 3ZWNA 2GBGA 3ND7A 2RHGB 1N0UA 5KOJB 4Q1AA 2WAQF 2QTCA 1JBQA 5LQUA 4W9NC 2ECKA 3OQVA 4V0MA 3MLBA 3ZGYA 4JV2A 3B6EA 5ALUA 1T8PA 4XM2A 5ALLA 2BMJA 5EYPA 1ZVMA 3TLEA 1U2SA 4C88A 2N46A 3I42A 3A9SA 2TRSB 1ODIA 3I5XA 4F5PA 3C8ZA 3KLNA 1WXEA 2XT0A 5KKCA 1SKMA 2X2OA 1K1SA 1BYUA 4Y2PA 4H7IA 4GRAA 4BNVA 1SZHA 5K0BA 2EFHB 3RKUA 4ZDKA 4WA8A 3K96A 1APBA 3O92A 3IODA 1W75A 1JUDA 2WK1A 2DKZA 3IP3A 4NU0A 1SXJA 5KFDA 4KAAA 4ZVKA 2H8KA 5LQRA 1BROA 1D2NA 3SZMA 5KNCH 1NVXQ 3CCBA 4TWRA 4AUNA 2AX4A 4UOZA 3OPXA 1NN3A 2AS0A 2JB9A 2IITA 1LDGA 2M6SA 3L4KA 1U4OA 3ADKA 4KLDA 2YWXA 4HSGA 3ZGOA 2BGGA 3QXXA 4PO1A 5LP1A 1GKIA 5BPHA 2N9UA 3LPCA 4M0LA 5FNVA 1NT2A 4OLAA 1E0DA 2VHVA 2E4XA 4X8MA 3CF6R 1JZTA 5JXIA 5KYGA 1EMDA 2VHUA 3PQ8A 5KOJA 3T3NA 2VTVA 1NRIA 3RRZA 1DXSA 2KK0A 1BMDA 3CVYA 4N76A 3SXUB 2GJSA 1V39A 1K4YA 4P82A 4EKIA 3CS3A 3SQXA 1BGXT 4DIUA 2HC9A 5JECA 2KIWA 4B32A 3OX1A 2VA9A 1KC1A 3VMFA 5AW0A 5LP6B 1LV5A 5EKUA 4PZYA 3WRWA 1QHIA 2Q5QA 4OJTA 4QQKA 1ESMA 2QMQA 1V1JA 5DQGA 4DQLA 3PUJA 4E5VA 3KEFA 4J3JA 4A0QA 1GT6A 5BNZA 3K5HA 2OA0A 2H07A 3CZ5A 1ZLYA 2HH9A 1YT3A 3E7PA 3QZ7A 3N5CA 2ZR9A 3I72A 5LZ2A 1UWKA 1LDNA 4MIOA 3PENA 1UDXA 1QG4A 1RHKA 4GR4A 2EERA 2OKGA 1ABFA 3KLOA 1BEEA 1FYXA 3GCZA 2F17A 4IC9A 4CL2A 3OQMA 2K4PA 3QMMA 1LPOA 4CV1A 2V4QA 1YU9A 2PT6A 1FFBA 1JL3A 2NO9A 4QULA 1A9OA 3NEPX 3H42B 1F9EA 5BV8A 1XD2B 1B14A 2VBCA 3NAMA 1PWXA 1S2MA 5F35A 3A4NA 2OYRA 4MPPA 2X9GA 3KPYA 5DK6A 3KQUA 2IFTA 4I2DA 2HK9A 3SXUA 1AVTA 4ZP1A 1HUOA 3VZQA 4RQ6A 1E2IA 5JAQA 5TJ9A 4KFCA 2IU0A 1RI5A 4TRJA 1OWLA 2B0CA 3OJWA 3RH6A 2WD9A 4H7HA 4DOAA 4IJUA 5AJVB 3FPSA 5IN5A 1YOVA 1XCOA 3MT8A 2FPOA 4Q01A 5JNUA 4EI9A 1VLZA 2HX1A 5T4EA 2YQ4A 5KWIA 3ZVRA 4BC1A 2OLKA 4E5SA 3CBQA 4H6PA 4OQPA 4Z4HA 2IX3A 3K71B 1K7CA 3CM0A 4ECSA 1ZQAA 1HT2E 1CUCA 4G84A 2GN6A 2HREA 1RYBA 1A5AB 5C3MA 1LDYA 3I6QA 1WUTA 5AOVA 1GLNA 1GQSA 2VXYA 4E08A 4F21A 4OB7A 1Q3KA 1UPBA 3KWFA 3VR3A 4RUCA 2ZJ6A 2RGNC 4W63A 5SY4A 1E63A 1RPJA 3M7IA 3UB2A 1UK8A 3LH5A 2WB2A 1XD2A 3K8YA 1BVUA 3K0HA 1JG4A 5LBIA 3HNPA 3KQTA 1V9PA 2FGKA 2AH5A 4D8VA 4J94A 1YACA 4MJ3A 4DGSA 3MFHA 2HSDA 3GIIA 5FBRB 4MUKA 2BGRA 2CZCA 4E2YA 4Q0MA 2GZDA 1VL2A 3SF8B 5TT0A 2HU8A 4LZZA 3WLRA 4LF4B 4J9NA 1NPDA 1DUIA 1HLFA 4KI7A 2K2WA 1JX6A 4FYXA 3TQCA 3VPXA 2E1PA 1P8AA 1N7GA 1M2HA 2HUPA 3PDUA 5JJIA 4AS3A 2BFNA 5FJJA 4O4IF 1U8YA 1T0JB 2Z2XA 1EIWA 3NRWA 5I9NA 1MJGM 1WZCA 2E9SA 4Z4FA 4KN4A 1F5SA 5AKHA 4EENA 4TLLB 1JG1A 1JB1A 2QVZX 4JJGA 2F8SA 4DS4A 5CJJA 3RSSA 3TL3A 1W4CA 2W93A 5DN9A 4Q9JA 1Z7YA 5E9AA 2O1WA 3PUYA 3OTGA 1HOTA 2CSUA 1IRXA 1RJFA 4IYJA 1GQFA 1FXUA 4YR9A 3UFXB 1D8AA 5HK8A 3Q11A 1QUEA 2VVTA 3IJRA 2CBZA 1HNWB 7ICPA 3GEIA 1SWWA 3SF8A 3PFWO 4BN0A 2QAJA 2QSJA 5G0VA 3OIDA 2Q7OE 2DPHA 1CP3A 4RVNA 1CY6A 3I04M 4YEDA 5K5EA 2CMDA 1USKA 4KXFB 1ORDA 4RZUA 3N53A 1T13A 4WXYB 3WDKA 4YD1A 1RM5A 3CNOA 3E1KA 3CU5A 4A5OA 1OAKA 3WA6A 3GIJA 1I32A 1MA3A 3F6SA 4YTEA 3JQAD 3WIBA 1T8UA 1U2TA 1Y3FE 3V1TC 1PDOA 4KSCA 5BSMA 5LZ4A 3DL2A 1ZXXA 3TUIC 4Q4DA 1C9MA 1OA0A 1KK0A 4GVXA 1C2YA 1X13A 4FD3A 4YI5A 3KQYA 4O5CA 2C5LA 1Q1EA 1LSJA 4ENUA 3VKWA 3ZLTA 1GZHB 4IDPA 4P38A 4R1QA 3B2EA 4G63A 1WMBA 3FSRA 1I5RA 5IARA 1U5CA 3PB3A 2K4MA 3W9BA 4BBZA 2ZBRA 1S10A 3RIHA 2F3RA 5LA6B 4JLAA 2XZLA 2ZTHA 1EB8A 4EYOA 4YRIA 5JRDS 5FR1A 3H5IA 1T43A 1TYCA 2H3HA 4X66B 2I3BA 2GA9A 2IL1A 1Z0JA 4HVAA 2VXOA 1ELOA 5ICSA 4D99A 3P5SA 1U2PA 3PQ5A 3BMXA 5IEBA 1MO5A 1AHPA 4JLJA 2BBTA 3TRDA 2W70A 4ANFA 4DVGA 4WY2A 3U1TA 2AMJA 3FD8A 1C50A 3IP5A 1XPRA 5E7QA 3O4JA 5CNJA 3N7TA 3R5XA 3OFJA 4KQKA 1L8OA 1EFHA 4DC9A 4M38A 2CHFA 5KZMB 2AJCA 4MROA 1CUUA 4MRMB 1KL7A 4JLBA 3HWSA 1PV1A 2FUKA 4ALIA 5DGHA 5U4XA 2DOKA 1PSDA 4XGKA 1PZMA 4TTVA 3HL0A 4UB1A 4J76A 4F4DA 3EQ7A 4MVJH 4JP2A 5NLLA 2RGDA 3V4SA 3KELA 1Q77A 4ZRDA 1JFLA 3KAQA 5LA6A 3A0RB 2JFQA 1HY3A 4LZGA 4LVCA 1YR1A 4TWBA 1BE8A 4J9LA 2XICA 2FF7A 3LUPA 3EMVA 2HLDD 3RO7A 1Y88A 2QAIA 2VPYA 2F77X 3K70D 1NF8A 4TQSA 3EJWA 2IF2A 4F9FA 3G2HA 3WK6A 4O3FA 1X9MA 1IJFA 3M2PA 3GN2A 4HNSA 4P3NA 2XCQA 3NOXA 2YTZA 4XD7D 4Q1FA 5IKPA 3THRA 5E7JA 5SYAA 3B52X 3I9KA 3V00A 1WE2A 4UASA 2IP1A 4BAUA 5SZIA 1QYIA 1TJ5A 1ZSNA 3E70C 2JLBA 1IWPB 1W88B 4J0DA 4HQRA 3RTDA 3ECCA 3DC7A 4ID3A 4MRMA 2O4CA 1P74A 2ECPA 1KMHB 1Z2NX 1V45E 4EA7A 3QE2A 2H4HA 1MX5A 4YVFA 2L69A 4H2DA 5IJ0A 3R5TA 3SZ2A 2Y0CA 1LLDA 2LCQA 4JQCA 4M0CA 4OHUA 4AY3A 4HKTA 2IUYA 1YA4A 3IPCA 4LSGA 3V8PA 4NECA 4FCVA 1WDKA 5ALTA 1XKTA 4QDUA 3RVNA 3M5CA 4YV7A 4N8EA 1Y8CA 1L5HB 5AR1A 1Y5NA 2VN8A 4LVOA 3DUFB 1L4UA 5BURA 2PKYX 4KXNA 1NU6A 3IC5A 5EIFA 1COWA 1L4HA 4J3FA 4EL5A 4H60A 4TYNA 4F4WA 4H3VA 1SH7A 1NE2A 1XSNA 2M2IA 4EGCB 1JI0A 3HEMA 3GUVA 3AI1A 4RCZA 2HFKA 4MW1A 5MHTA 1N2OA 4YR2A 5IJZA 1WABA 1T6ZA 2C2OA 3EB9A 1NY6A 1U9JA 2VDVE 2HIAA 1E1QA 3C5VA 2WFZA 2AGVA 2PGLA 5AIBA 5E3IA 1W88A 1KR5A 1U4NA 1RXWA 2VRWA 5CXXA 1KMHA 1J8DA 4IS7A 4Z8XA 3HFGA 3A9VA 2ZI7A 5EIBD 2OO3A 4IAOA 5ERGB 4PQFA 2OV2A 3U19A 1RI3A 5J5AA 5KQSA 3T99A 4M1SA 1UKVY 4BOYA 4B8YA 2JD0A 1YK1A 2AK3A 2E4AA 4FDAA 3PLNA 5B7PA 1E2LA 2IY8A 3MWLA 4AYXA 5H80A 1K06A 1I13A 4MF2A 1PN3A 1KQNA 2ZUDA 3RYHB 2WB1C 4QZGA 4KR0A 2H1VA 1P29A 4U0JA 1IYZA 1JX4A 1L5HA 4XWKA 7ICQA 3DUFA 1U0GA 4S1OA 4X3OA 2RGCA 2NRZA 4LN1A 3UZUA 5FL3A 3VYSB 4P3YA 4IUBS 5FAKA 3GU3A 5AVZA 3JWEA 4KQ1A 5KT5A 1Y6RA 2G4CA 4E94A 3PDWA 1L6IA 1NNI1 2QPAA 1B3RA 1KR2A 5JQWA 2B5OA 2V4MA 3CKKA 3GLUA 4PAGA 1M0EA 1SRRA 3F5SA 1SD1A 5C31A 1NW3A 2BCGY 5EIBC 1RZUA 3TBHA 5BMVF 4D9IA 4X61A 1KZGB 1QUFA 4WKPA 1ZUIA 5H8WA 3FTFA 4K6HA 4N0MA 1YD7A 5MFPA 2B6NA 3MGHA 2HK7A 4AF6A 2O0LA 3V8RA 2OHOA 1NP7A 1QH1B 2DL0A 3CW2C 2IPXA 1JI7A 3G0CA 3E7WA 2R96A 3KB2A 3ORRA 2GYVA 3I5MA 1CY4A 3O2SB 1P4RA 2C3UA 2KD1A 1JPJA 1JRLA 1GA4A 2R66A 1MJ5A 2J87A 4GT1A 3MTEA 4PHHA 4OQFA 4RD4A 5KSOA 1TRHA 1LS6A 2YV5A 3KK0A 2W11A 3A7EA 3KO8A 4RZSA 4OHZA 4QUBA 3D4LA 3STTA 4KK4A 1UCVA 4PSAA 3RYHA 5I7EA 3PLRA 3TSYA 5AVXA 1C14A 2A3VA 5DM60 1N63A 4JASB 4EPYA 4ENRA 3HGQA 3BB4A 4S1VA 4I99A 3N4MB 2JHDA 3VYRB 1RHUA 1MO6A 2FFQA 1IHPA 2OWEA 2PX2A 2PJZA 2MYNA 4RHYA 2XF2A 2MINB 3NBQA 4DMKA 2I2CA 4CM6A 1HQDA 2ZCJA 3TD2A 3EYZA 1MW8X 2JKYA 3G7SA 4LE1A 1BX3A 1MH9A 4NZMA 3G6KA 2PXAA 4DLPA 1UWLA 1R6VA 3L07A 3R3HA 3O8NA 3TRFA 3MVEA 1G6Q1 3N97B 5F5XA 3I9V6 4DZRA 2G5CA 4B80A 3N2KB 3RUDA 1QFYA 4TUQA 1EFVB 4JC5A 4X00A 1ISHA 4BEJA 1DIGA 1QH1A 1Y9DA 3PNSA 4P3PA 1LB1B 1NHWA 3DXZA 3W5UA 4DCMA 1EKXA 1Z6TA 3BEOA 2FZGA 1XT6A 1O8BA 5F1OA 3VOBA 1QNLA 2OD9A 1ZQVA 2HNKA 4M47A 2ZUWA 5C4MA 1RWQA 3ZI7A 4OXQA 1L4EA 1P2FA 4RHUA 5FI5A 1JT2A 4YUZA 2IZZA 2WPNA 2B1RA 3FVQA 3JQFA 1U7DA 1OLXB 3GVXA 2BEUB 4KZPA 1SK9A 1XMSA 5HNKA 1Z6YA 1QK5A 3GR6A 4C8LA 3BD9A 4BGIA 2FPIB 2GZ3A 4XYEA 2MINA 1C7FA 1ZGJA 3C2LA 3GJRA 3TEJA 4D82A 2ATVA 1R16A 2I55A 3L5OA 4M2LA 2JI4A 3IESA 4KGZA 5JZVA 2R48A 2X0JA 2QNIA 4RDIA 4R84A 3NTVA 2C7VA 5IJAA 5JQGB 3EHDA 4EBFA 2IHYA 3PJEA 1D2EA 1P91A 1OQAA 2GEFA 3K9HA 4YRDA 5JD3A 2YXPX 3UAGA 3JQ7B 3N75A 3N2KA 2O6KA 4DQKA 4C4SA 4K88A 3NLLA 1EFVA 1GGNA 3SE0A 1M73E 2QT0A 4H1HA 4GFJA 2AV6A 1OBHA 3JQ8B 3WZMA 1GUAA 2NQ8A 3QYFA 2GS9A 3FPCA 1GTVA 5J2UF 8LDHA 4L8GA 5J0WA 2FLWA 3FF4A 1VBKA 2Y9TA 5H0IA 1E59A 1I7PA 4MIYA 1I0ZA 2C2RA 1ZXBA 1HT3A 3I2KA 3ONEA 4Y1FA 5K05A 3O4HA 1JG6A 4RTLA 4DL5A 2NZYA 2QD1A 3ZIAA 2RDIA 3O3MB 1KAQA 3EXEB 3OD5A 1OLXA 2IDZA 5G40A 2BEUA 3BA6A 4EA6A 2A0YA 1IY0A 4GIBA 3EBOA 2C8JA 1QZZA 2QTTA 1K2VN 4MQFB 3ZDEA 4JJ8A 5CLFA 1OC4A 4WCFB 4RQ1A 1RHQA 2BEJA 1Y8AA 3L6CA 3RAPR 4DJDC 2FPIA 4I5DA 3DCIA 1KS9A 2VYFA 1KKMA 4UE3S 2BZFA 1GAQA 1P4HA 2YMQA 4E4YA 4WSOA 4ZCTA 2NSHA 1NBMA 3MHPA 2D2IA 3NR2A 4OAOA 1KRWA 5IVIA 3K0FB 2IYVA 2V59A 2EHDA 3FPFA 2G07A 1WRBA 3P2YA 3NHRA 4Y67A 3PG5A 2QDXA 2W98A 3ZG6A 2R44A 3U61B 2H52A 1D0VA 5JQGA 4D26A 2ZJFA 3ZE2B 3LKVA 4OXRA 3A3KA 4LBZA 5KNLA 1ZRHA 4NAUA 4WZBE 1OLSB 3AHGA 3JQ7A 2IVFA 1RJEA 5DEIA 1NJ5A 2J4DA 1U0JA 1XQXA 3TI9A 1XU9A 4NE7A 5KTSA 2FSSA 4JYZA 1NZDA 2PJUA 3P9RA 3JQ8A 5J59A 2ZWAA 3W0LB 1UBHS 2WT4A 2I2DA 3VI3B 1UBNA 1RCFA 5KTNA 4YWHA 1C0IA 3GDHA 3DWIA 1B1CA 2AJTA 3TXAA 1FC0A 4IR1A 3X2EA 2ERCA 2OFFA 4Y6PA 4DM3A 2MSWA 3JQ9C 2ZB8A 1LB2B 2FW7A 1AKMA 5FOTA 4V24A 3PPXA 1CLUA 3WK8A 4Y2SA 4QOFA 3G3EA 3EXEA 2D5CA 1U0TA 1EFDN 1KYQA 2L42A 1PK3A 3ZOKA 3SE7A 2ID9A 2DKFA 4MQFA 5KFHA 3Q8XB 3W2FA 4AYWA 4WCFA 1Q1NA 3R0XA 4DOMA 2EOAA 2YIDA 3OHPA 4D1YA 4TM8A 4ED3A 1OVGA 5KIAA 2O5VA 3AC0A 3KZKA 4YRAA 1IXYA 3F6BX 1LWNA 4XVQA 1ZJYA 1RCUA 4I9GA 3K0FA 5J5VA 4BMCA 5LU8A 3NRBA 2X7HA 3DC2A 2XB9A 4EYHB 2ATIA 2R8KA 1DXYA 2BZ1A 2JS7A 4IKPA 3C6YA 4Z7QB 1YJ8A 3TM5A 1T3TA 1MSWD 5IFKA 5HFNA 4EAAA 1OLSA 4A36A 4YMHA 1LBQA 1RYHA 1R4NB 3N2YA 3C43A 4FGJA 4D56A 4MS4B 2PL5A 1NKBA 3RR8A 4ZVQA 2H1SA 2ZTMA 2QG6A 2YUTA 2HUNA 1SV4A 1DB3A 1Q7CA 3RAXA 1ZM4A 1Q95A 2JAUA 4PU0A 1PLKA 3KHUA 2GRUA 3G8AA 5I47A 1FNBA 3MS7A 1UPUA 3SP1A 1OXBB 5FADA 1PJLA 3BIJA 3MGCA 3SLRA 3EXHB 2QGZA 4IX9A 3PX0A 4NK4A 1KI8A 3F7MA 2HTEA 3PWKA 1RM3A 5KT7A 1RMYA 8ICLA 1U7ZA 1UC9A 5AK4A 3AUTA 2YX8A 2D00A 3CKMA 2WSBA 3S81A 4XLTA 5JANA 2C9DA 3DOUA 4C5CA 4OBXA 4BLQA 3X3HA 3QVOA 4DY4A 721PA 4MNTA 2FPWA 2WICA 1EDZA 5I4KA 1SUWA 4FGSA 1PNOA 1GEGA 5REQB 3U37A 2BOVA 4F7DA 2L18A 4KDFA 7ICTA 4YRLA 4W8HA 4R01A 3PVZA 2RQ5A 4EG3A 5B5EU 3GLRA 4FZJA 1E96A 2NIPA 1VSBA 5DW3A 4DCJA 4PZ9A 2RGGA 5A3SA 2J0UB 2XGOA 3VJLA 2R4QA 1FFEA 4WPGA 4OSPA 4BP8A 4PVDA 1AHHA 1R4NA 5CX1B 4FIZA 4MS4A 3ETEA 6PFKA 3T12A 1SQ6A 1QO0A 3EVEA 2V7GA 1C0PA 2CLFB 3TBFA 4B9NA 2O19A 4DOBA 2HQBA 2XDAA 3GJ3A 2P91A 3VZBA 4J0QA 4LHZA 2ON6A 2LYBA 4ZVOA 2FWBA 1H8ED 4HNRA 4BPRA 1ULAA 3KFVA 5FBHA 4ZDJA 1HGXA 4QOIA 3SSOA 1D6JA 3ADDA 1EGHA 2JFGA 4MMZB 3EXHA 1BFKA 2JCYA 3FDSA 4M9JA 1HFKA 2YOFA 1AQ6A 2C5GA 5FLYA 1C9YA 2IUUA 3OHBA 2AFHE 4CKXA 1QH0A 2XVXA 7ICNA 1XZQA 1P7ZA 2EG9A 3PE4A 3NTUA 4PLHA 4NBSA 1PVPA 4PGQA 5REQA 3VR4H 3TIVA 1A77A 2LBPA 4BX8A 4E13A 3VO2A 3ZWKA 4AX4A 4CE6A 3EX7C 2UZ4A 2NZJA 4II7A 2J0UA 2BMAA 4J0EA 4EEZA 3K0SA 3MMNA 5IMBA 1A8PA 5CX1A 3L8CA 1RKUA 1U8AA 2IW1A 3UMFA 4LEIA 3TTUA 1FYEA 3PGJA 4OGGA 2BONA 4MUEA 3KQPA 4KLMA 3GGOA 4K1XA 2F3TA 1ILWA 3E0QA 2HLNA 4UBLA 2C4TA 1J23A 4Q1EA 4Q9IA 4N6OA 4OJQA 1U0BB 1KU0A 4F97A 3WP1B 4G1EB 3WKAA 5F33A 4HDRB 4LF7B 3D0OA 4O6VA 4AAYA 5FDFA 5AJWA 4KQIA 1A9XB 4UHEA 1A4IA 4W8GA 5LC1A 1R4AA 2DWCA 3F6EX 4AUMA 1Y3IA 4D8YA 1E6LA 4YQEA 2O2CA 5E4JA 2NOAA 3AFGA 2Z09A 1DBPA 4GXQA 3K75D 4IEFB 3WGIA 4YRPA 1FS4A 1HKHA 3P9ZA 2IEYA 4EQ6B 2JIZA 4K9OA 2ETVA 4PJ0U 1R0LA 5LYJF 2GUWA 1GSAA 1ZJNA 2LNDA 2NXNA 1H42A 5JJBA 4BATA 5AKIA 2QENA 1SKBA 1A9SA 2XYQA 4R1UA 5FYDA 4KQHA 3HI6A 3U39A 4L8YA 3MCAA 5ARBA 5K8IA 2C2GA 2C4MA 4CHGA 2XB2A 4EI7A 4UBKA 3BGIA 4RNMA 1ZZGA 1XN1A 4N9WA 3IELA 4F8YA 1L9XA 3G2PA 1D9DA 1XKXA 4P80A 3I30X 1A2OA 3ENKA 2J5XA 4DEZA 3EVCA 3SS7X 5H4GA 3AEXA 3AQ4A 4JZKA 1EFUA 4C5AA 3VU9B 2O2EA 5ERYA 1YK0A 4PX2A 4JX8A 2D5IA 3NVYA 3RS2A 2FUEA 4PG7A 4PQYA 2D3DA 1Q0SA 4EYEA 4M54A 1IQUA 3IVRA 4HDRA 1WV0A 1JA1A 3PQ2A 1A9XA 4NL9C 5EJ5A 2H7VA 1AUVA 4ALKA 5KQPA 4Z54A 4MW0A 3T0GA 3T5KA 3BRSA 4DL4A 3IVGA 4C6SA 2GOYA 1JJ7A 4MQ6A 4CTNA 3ZD9A 3Q10A 1SRQA 4EQ6A 2B2CA 1NUQA 2VYNA 4H27A 1CS0A 3D43A 3M3DA 4RJTA 2WIBA 2WNIA 4ZV7A 3F5MA 5BRJA 1FVXA 3WLHA 1R0WA 3L7YA 1ZR4A 2RJ3A 4XCVA 3GUYA 1LDBA 5JJ5A 1Z39A 5FPHA 5C1BA 2HDOA 4O4HF 5AVKA 3K9WA 1J20A 2PI4A 2PD6A 4WLUA 3EPKA 4YBZA 3R0QA 2YNMA 2ADFA 4BVAA 2IX9A 1W52X 3OM1A 2FZ5A 3PW0A 2YV4A 2QR2A 5L1LA 2Z6AA 4LDQA 2RHDA 3W1EA 2HQOA 2R7MA 3PC8A 3DT6A 4HG2A 1TQHA 4D02A 3A1NA 3QG1A 5IIJA 5FJIA 4HPXB 4RVUA 1J24A 2PWPA 1SG6A 3KR9A 3RKSA 4L7VA 4AB1A 3WZ2A 3OE5A 3VU9A 1TAQA 2HT1A 2AMFA 1N92A 4L50A 5IP5A 1Q19A 1QGED 2B3TA 3EUWA 1QHFA 3CSSA 3E48A 3SQOA 3GYGA 2Q5EA 4ALLA 3IQIX 1S3SA 3K0BA 4PAWA 1N2JA 3E9NA 4I2CA 2BFWA 3PNQA 1RI1A 1ISSA 1IU9A 2WIAA 5TF0A 2YX1A 1Q92A 3QOWA 3O4RA 3PT5A 2IUTA 4E14A 4UULA 4MRPA 1MVLA 4D9BA 2YV2A 3IHWA 4JI3B 4NZYA 3WZLA 5IK2A 2W71A 5KAPA 5BXYA 1NXSA 2D7DA 3EVBA 4LXXA 1BAPA 4P58A 4ONEA 3KOXA 5BPFA 4P9NA 5FTMA 1NDQA 3AJAA 1OXMA 2E2WA 3HO1A 2E6UX 3BD7A 1E2DA 4A0RA 2KMLA 1M10A 2CKDA 1FXSA 1USUA 3IAM1 4DNPA 1B42A 2UUPA 4DLKA 2A5LA 3L6OO 2O2IA 2SICE 4ZMSA 4LJ6A 4NU5A 2IMWP 3QOXA 2G06A 2DWPA 3SIXA 2PA0A 4KRYA 2V7UA 1VHJA 3UUFA 1KZ4A 3PQDA 2WMYA 3FFWA 4GWGA 4NPCA 3SV3A 3EQZA 3WYDA 5KG0A 2Y3IA 2RI6A 4CI0B 2JK0A 1K1QA 4P0PB 3G82C 5NULA 2YYSA 1F0PA 5C32A 2WTAA 2ZRFA 2PBFA 3QU2A 2ZPAA 1MOPA 3C6KA 3WRYC 4RHCA 2BKVA 2XXBA 1G8JA 2G9NA 3UMYA 3GI1A 1G1AA 5CM2Z 4FHZA 3PRHA 2F3UA 3PXEA 5KU1A 3QLVC 3AHCA 1EFRA 1G20E 2A7XA 4GICA 4QICA 1GQQA 4WL0A 1EI9A 1R1DA 4BQFA 2GYWA 3HYCA 2C5BA 5IUJC 5A2QA 9ICWA 1U28C 3BGWA 3H8MA 4PBTA 3ESZA 2NXJA 1D9FA 4A27A 3V7KA 1ZYQA 4DWVA 3HFRA 2NU7B 4OQEA 2MHCA 4GC6A 4E5YA 4P0QB 4JDPA 4MQLA 3GEPA 2OSBA 4EGJA 1CUHA 4M9SA 4BN5A 1GTJ1 2JD1A 5K0NA 3UJNA 4F4JA 3DONA 5IJWA 3RNOA 1X2IA 2NO7A 4YS6A 2HY7A 1IEQA 3R6GA 3ETHA 2PIAA 1I7DA 2PMDA 3RRJA 3U3XA 1H2WA 5E2AA 3DBRB 3JD2A 3PW5A 4L1KA 4LUCA 4P0PA 2QX9A 4OY3A 5CEEA 4B87A 2C8LA 2EX0A 1GVHA 2QN2A 5GZ3A 2ORYA 3RF6A 3RVDA 1J2MA 3FYCA 2Q1WA 4FNOA 4N01A 2Z9DA 1ST2A 1XZDA 4NBNA 2FZCA 1XELA 1VJTA 1CV2A 1FNDA 3I9OA 3RS4A 1Z5VA 4BLPA 2TSYB 4ROSA 1WHTB 2BKXA 1SUIA 2FP4B 2M9NA 1G1MA 1E94E 4G5HA 3TS1A 2AG1A 4AY5A 2GDJA 4G56A 4DQUA 3U0VA 5MN5A 2NU7A 2HHHB 3L9WA 4P0QA 2C4HA 3OURA 2DEUA 4HQ6A 9ICLA 4DTCA 2H4WA 1Z2EA 4ZQIA 3ICWA 1PGNA 4JLMA 3S99A 5J0PA 1W47A 2I1LA 2YDYA 2VDNB 2H0QA 1NYTA 2VSFA 4TS3A 2XEDA 3UPQA 1O87A 2ETXA 4ZU3A 2J3LA 3T3DA 3UAWA 3VNBA 2JZOA 4UTNA 1EXMA 1K5DA 3KSDO 4DSTA 2HHVA 2XGGA 4K40A 5ER6A 5L4LA 1Z6GA 2WMNB 4HQ0A 4CF4A 1JZQA 2NQ2C 3R5HA 3DBRA 3LWLA 5CVCA 4YJKA 1GA6A 2SCUB 1BA2A 4IHKA 5KJCA 4IDCA 5CITA 3TLZA 3W5DA 4KSBA 4IJVA 4KAJA 1GA1A 1K7XB 1RYZA 1KI2A 2Q99A 4HXFB 4OJYA 1GSHA 2CMGA 1DAHA 4PC2A 3DZFA 4JP8A 2HPAA 1W0CA 3L7JA 4L8LA 1UPTA 3GGSA 1DDIA 1E1KA 2CDCA 1RJGA 4OHXA 3JD1A 1WHTA 1Z3EB 2FP4A 1E58A 2WBLC 5CLHA 4ND6A 3LAWA 3RS5A 1FDTA 3AKEA 2XY7A 1T8YA 1XZNA 4X97A 4D4JA 2OOSA 5LQJA 4QYMA 4DT1B 2CJPA 3M3HA 2A5JA 3UPUA 5ENDA 4O9MA 3QA3E 4R6XA 4DMHA 4BQNA 4CCSA 2X77A 1ZC3A 3PV0A 5L3SB 3BN3A 3WLLA 2ZM6B 1XDGA 1LQTA 1UKEA 1KK2A 3F4BA 2IOFK 3USZA 1ZNYA 5EP2A 4DO9A 1TK9A 3IQFA 4UUQA 3FOCA 4ZD6A 2G36A 2PS9A 5IKMA 3IDOA 2OCGA 4QSMA 3GP5A 4R6WA 4LHXA 4FEAA 3UJ8A 2J7PA 3C1OA 3IE2A 3K30A 1C7ZA 1YI8A 2QD2A 2V1UA 3OBBA 1M6VB 4XQCA 1TCAA 5FCDA 4Q34A 2QW1A 3GT4A 1QVRA 1NFFA 4GZMA 3NHLA 2F3PA 3V8VA 1EAYA 3NZEA 2V74B 2WWGA 4FS2A 3TH5A 1U7TA 4MWDA 4X3PA 1Z45A 4RJLA 3FNBA 3D31A 2Q7DA 2Z43A 1XDZA 4DMRA 4MH0R 1Y7IA 4FKBA 4Q44A 2H1WA 1W6RA 4ZRMA 2FSPA 3ZDDA 2CCJA 2P68A 4EB8A 4KX3A 4FE7A 4LJ4A 4DT1A 2ZWMA 4QEZA 2DZDA 9MHTA 5L3SA 3AV0B 3ZTWA 3BZUA 4B3MB 4B3IA 3DOFA 1DJOA 1L1RA 1TQ2A 3DZIA 4Q7LA 1I80A 3A36A 3PNCA 1MMFB 3WR5A 1AKEA 1K27A 3DV2A 2IEGA 2VATA 1X3LA 3NKFA 4RZHA 1GTMA 3U4QB 1HUZA 4E5UA 1CKEA 4B33A 1RMQA 3NHAA 5DNEA 2ST1A 3I37X 4C4TA 3TW6A 1OT3A 1L8XA 1TLLA 2XUIA 1PDWA 3BGOS 5DG9A 1KXJA 2BCUA 1Z0AA 2CT8A 1M6VA 3QXSA 2W6JD 2X9NA 2FXVA 4B74A 1RVV1 5G5GA 1KIFA 5BOLA 2QAGC 4C43A 5DTQA 3GLHE 2W2QA 3WLTA 4U7TB 4KQCA 2W4QA 1DIRA 5EHIA 5JWOA 5WRFA 1EE2A 4N7JA 1N2BA 3BWXA 3ET4A 2WSIA 4HUJA 3WSTA 1EH5A 2AR7A 2VHWA 4GPD1 2Q3BA 5IF9A 3KJZA 4URUR 5LP6A 5JFGA 1CETA 2JKVA 3A70A 4WNAB 4HXGA 1U04A 4C6HA 1CUEA 4X6YA 3ZW9A 2XJ4A 4H7PA 2HL6A 4X41A 3B85A 4LFCB 3MTJA 1WXXA 1OZAA 5AVJA 1XPJA 4B5LA 2YOHA 3FAHA 1NDUA 1Z0UA 3U4QA 3RBEA 4KTQA 4EZIA 2C2EA 2XGSA 3I28A 2JAPA 1AH2A 3EGEA 2ONJA 3NH6A 2EAPA 3GJQA 4DDMA 2YH2A 2P3QA 3KAPA 2CCGA 3SKYA 3HQ4O 3UXYA 2J6HA 2JEGA 1XRPA 3CJRA 4LOHA 3C3BA 5JS2A 3FPLA 3ZNQA 1QCKA 5COQA 2GK4A 3OIWA 1SHKA 4RS4A 2E3TA 1QTMA 1QQ7A 4J9MA 2X13A 2Z6QA 4M53A 3FAKA 1ZKMA 2QK4A 1CK4A 3U7RA 1NOJA 3WGLA 3OCYA 3ER9A 1FJ2A 2PCJA 1W7AA 2FOLA 2ORVA 1XLTC 4Y2HA 1RRVA 5B4TA 3CB2A 4IOLA 3GLIE 2VA8A 2I3ZA 3ZYZA 4BL5A 3L6UA 3L01A 3OQOA 1FUIA 1H9CA 3DWEX 4IDQA 2EBUA 3W9YA 4MR9B 4WNAA 1ID1A 3PXAA 1KOJA 5D84A 4EUEA 4CF3A 3AHIA 4RC9A 1JHAA 5EINA 4RLHA 5JAIA 2Q2OA 3CRRA 1WSBA 3KQOA 5DJ5A 4HGYA 5AKJA 4KQGA 2J0SA 4ZZ1A 4TYWA 3LGSA 3DO5A 5L1MA 2I6QA 3ZHOA 1FSSA 1VKHA 1QIHA 1N1MA 2YMLA 1S8AA 3TFSA 2YHSA 1AMOA 1R66A 1P5JA 3KOWA 3OF3A 4AG3A 3DNPA 3UT6A 2C59A 4EG4A 1E6WA 4QARA 5EHZA 3OZTA 3R3WA 2PUBA 1QDUA 2DULA 5CD1A 3UAXA 3C3YA 1HE3A 2PTHA 4BNXA 1LLQA 1UDBA 1DG3A 1FTSA 1MC1A 4FBLA 2I33A 4B7AA 2GTPA 1KSFX 3EJ6A 1CZKA 5CYFA 1TL7C 1VG8A 2DPJA 3B3GA 1RXIA 1B41A 2YZNA 4OU4A 3M8KA 1MEJA 4I3FA 2HXSA 3C23A 3GH3A 1GGKA 2ADMA 3DOCA 2P75A 1LV7A 2Y1IA 2ASDA 2R7KA 3M9OB 4MR9A 1UXKA 5FULA 1GVNB 5KNBD 4H7KA 1H66A 5TPWB 4LY9A 4U2CA 1HI9A 2REXB 5FXMA 1X6IA 2P6NA 4LXHA 1USVA 2HLHA 3Q3IA 1C0KA 5FF9A 3TNLA 4RD0A 3WLJA 1OIXA 4Q3EA 2G1PA 3L77A 4LBWA 3QMVA 4OG2A 2RHLA 2O6HA 1FB5A 3BHJA 4URXR 3SFZA 1Q0PA 1T3ZA 3P2MA 4EHJA 1B74A 3AF0A 4GXTA 2E5WA 1OXJA 1FS6A 4ZHQB 2CB9A 2C4KA 4H3SA 2X9LA 2GN9A 3M4NA 3HBFA 2OZEA 5EJ6A 1VSTA 1SG9A 2JJ1D 2RG1A 5C37A 1NXXA 3UFXA 2GR9A 4UMFA 3UWPA 2NP7A 4PZEA 1R15A 1XN4A 4DL9A 2EIHA 1V95A 2D1SA 2IXTA 4OO3A 4RMIA 1RE1A 3NTOA 2Q2WA 3CNNA 4X6LA 3HB0A 2WF8A 2YWJA 3L7IA 1YBMA 3KXDA 5TPWA 5JMOA 4C8OA 3AYZB 4QHSA 2ODBA 1PFWA 1NXOA 4BYGA 3RASA 2XQKA 3PEWA 1CWUA 2Z8YM 1A8HA 3F8TA 3G79A 1D07A 1MHTA 2VXCA 3TX2A 1U0SY 1KVQA 3UKJA 1URPA 5IAEA 3KXLA 4JT9A 5EMKA 4ZOHC 4IDFA 4JA2A 4J07A 1NXVA 1KOFA 1RW4A 1Z88A 4QDKA 3HWWA 1ECJA 3L7NA 3MTIA 5E6RB 1VHDA 2YV3A 1EHIA 5C52B 4DV3B 4NAVA 2AQ0A 1OAOA 4ZHQA 4LJRA 3GT0A 4IY1A 1TKDA 3IUMA 3YASA 4B75A 4PN7A 4O63O 3ZV6A 3AJDA 2ZITA 5IC4A 1GY8A 2PA3A 4O3MA 1NKEA 1M7HA 4EJFA 2DFPA 1TTHA 1HMYA 9ICIA 1NLFA 4EKYA 1N6HA 2JLRA 1SOAA 4F7WA 3CG0A 3H0RB 1B2RA 2D0PB 4PQRA 3SCZA 4B1FA 3OEYA 4JZYA 4MYCA 1A71A 3PUXA 3M4XA 3HKBB 5TGZA 3K32A 4FEYA 2HIGA 2HOQA 1Z38A 2W9BB 4R7ZA 1ZCZA 3IP8A 3RJIA 1LZKA 4LYYA 5CFLA 1QONA 2GHIA 3NVWA 3ADCA 1KSJA 2Q0XA 5BNTA 4UB8U 521PA 5B1IA 4ER6A 4MK4A 5C5JA 2WW8A 1YWGO 4NCNA 3T0IA 3CWZA 3NXKA 1XTIA 3IV6A 1XYYA 3ZWOA 1OIWA 1QZUA 1BMTA 3SQMA 3IMEA 1ORRA 5E6RA 3NASA 1EM8B 3V6JA 4MB0A 1SCJA 3K9FC 4KLNA 2PRKA 1SD5A 3KWMA 2HK6A 1E77A 3S27A 2XCSB 4BX9C 3K70C 4EKDA 1ZQMA 4W5RA 4RE5A 1K8RA 4AJ2A 4QQRA 4WI1A 4YT2A 1GG2A 5KYYB 3H4DA 2ZT6A 2H2GA 4OUDB 4W7IA 2G1KA 3KTQA 1RM0A 2G5PA 4I8XA 1KGSA 1NVFA 2HU2A 2GNPA 3K53A 5GIOE 1D9ZA 4HN4B 2V9PA 2TS1A 1ZEJA 1X1QA 3WB9A 5HA5A 3HKBA 3HA7A 3RAJA 1TW2A 1JA0A 3KE9A 2W9BA 5DRTA 1Z0KA 1T4BA 1Q3TA 4JXJA 3DD5A 2H08A 2QZZA 5G0UA 3CH6A 2KJQA 3U09A 1VB3A 3ZJVA 4XIYA 3H2YA 3H5AA 4YRZA 4H1TA 1C0LA 3ISJA 3TD9A 4IO0A 3T1YB 1QFXA 4X6UA 4Q6BA 4IRUB 1DTWB 1YZGA 1LJUA 3GLQA 4MKGA 5DKFA 2ZU0C 2O8BB 2YVLA 3R3VA 2QX8A 1X8KA 3W5VA 1L8QA 2F00A 1KOGA 3LT1A 1YZ7A 2N75A 2FPLA 2C5AA 1V96A 3PGMA 1WB4A 5SZJA 1KRPA 1S7GA 3DEJA 4ZCRA 4B5KA 4QQFA 4M7RA 4URYR 4JWKA 4M86A 4HQOA 4YGXB 3ABSB 1EM8A 1CERA 3UBMA 4HBZA 1IJKA 1K8QA 1K7FB 3OZRA 4V0RA 5BUSA 2HDWA 1UOEA 3GGPA 3I9FA 3WYGA 3IUSA 4MCJA 4D8WA 3PNMA 3ZPXA 1KQOA 1NVAA 3BKWA 3U44B 3ZH2A 3ZV5A 3V6LA 5KYYA 2W8ZA 4OUDA 4RUKA 4BX2A 2BI4A 4TS9A 3BJMA 2BM1A 1DAGA 1MO4A 4XWAA 3GV0A 3BQ0A 3SC2B 5FYQA 1VJ5A 1A4RA 1IXRC 3RR2A 1GUYA 1JG7A 3VDXA 1WJGA 4HB4A 3JX9A 4P7KA 4EY3A 1T2EA 3FFXA 1YBAA 2AZ4A 1JKXA 3W6NA 4E33A 1PBTA 1HSOA 4Z0TA 1P4AA 3I9MA 4BQIA 5KFGA 5FT9A 2F7SA 2JIDA 4XGQA 2FEXA 3C97A 1M6HA 5HSGA 3UMSA 5HX7A 4DDKA 3FY4A 2VK4A 2V7VA 1COKA 3B1XA 1D8LA 1HE4A 1WIWA 1DTWA 1M5RA 4KE6A 2O8BA 5KOYA 1A3CA 1E6MA 3JVIA 5J1TB 3AHEA 1GCAA 4YYZA 2HMAA 3AUSA 3KU4A 4MINA 4RT2A 1MC5A 3CUSA 1H5UA 1AOXA 3VHQA 4UM5A 1M7GA 5K2OA 3T1VA 4YT5A 4D9FA 3I58A 2E7ZA 1TLTA 2GZMA 2O2SA 5J0TA 4AL4A 4AFNA 2I0FA 4QBFA 5AMXA 2J7KA 2VOEA 4EWLA 3WGOA 3MTGA 3TADC 4HTAA 3C87A 1B0PA 3EGVA 4IVQA 4J6EA 9ICJA 4UC0A 4FBTA 2WM9B 3U17A 3AEZA 3FNIA 3WSVA 2KN7A 3U44A 2OAGA 3ZZTA 5M2QA 1NRXA 1VKNA 2D54A 1E7SA 4PIVA 2ZE7A 3SC2A 3QGMA 5JMTA 1V4NA 821PA 3I05A 2W2MA 3CE6A 4R31A 2AC7A 3HM2A 1EBBA 3EBPA 1YUNA 5KNIA 3NPMA 3UT5B 4DA9A 1IOWA 2KIVA 3BD8A 2QRNA 5JDCA 3TDKA 5B3KA 1PZFA 2B34A 2HYDA 4BASA 4UU7A 4Y6LA 5HHIA 2IYQA 3OPYB 4R8SA 2FPRA 5DKWA 2TECE 5EJIA 1U2ZA 3QPBA 5BN1A 2G9QA 2NW6A 1CXZA 4RQ0A 3OQHA 4QNMA 2WA1A 2HDNB 5BVGB 4ZOCA 4GP6A 2BE7A 3G0OA 2LGJA 4JOSA 5LD2B 2PLWA 4JWMA 5B6JA 5C0OE 2RGAA 1BSVA 2X23A 1DAEA 3GC6A 1L4KA 4DIOA 2FSGA 1CSEE 4GVPA 5TVKA 1VE7A 2BYTA 4AQYB 3CO5A 3K72B 1ZQ1C 5AM1A 5AKZA 2Z8ZA 4DZZA 2LV8A 3LNTA 3RGWS 1M67A 1TUBB 1I7QB 3WBBA 3KQKA 1NJ6A 4QUIA 1IB6A 2PSHA 3AJ8A 1A96A 1BS1A 4JI1B 3OOEA 5KG4A 1AN0A 1W4AA 2OHVA 3CR3C 4IQWA 2HI0A 3WHLA 4ZEXA 3JR7A 2XHEA 5C53B 3ZVKA 2LYAA 4WASA 1BDMA 1DKRA 1R5JA 4GYKA 2UVWA 3HYNA 2ISPA 8ATCA 1LSSA 3WICA 1RWPA 3UT5A 2ZW9A 5E3JA 1O77A 2B1QA 2A5FA 2PX8A 4PWYA 2FZEA 4J4TA 4AP6A 2WV7A 4DILA 5BW8A 2UUAB 3OPYA 2PRZA 2RGWA 4RW0A 2WSSD 4R40A 2CWDA 1UXJA 2BR0A 1HFJA 3PHGA 5E0KB 1YZVA 4CM1A 2ACWA 2JW5A 3IQHX 4S05A 5BVGA 2P27A 3FOFC 3U9SA 3KZ1E 2WEKA 5I48A 1UFKA 1S7CA 3TZCA 1K86A 4AZSA 3IIJA 5GADl 3FMOB 4PO3X 4DF8A 2WUVA 2WJ6A 5HBRA 4US0R 4ED2A 1QPGA 4NYIQ 4OB6A 2NZUG 4WLVA 1H2XA 3IP4B 3FSEA 2JH3A 3JVVA 4PFKA 1ST3A 1TUBA 2YCLA 4HYQA 1EVKA 1VE1A 1XJ0A 1K6EA 2R79A 5EUCA 2RHMA 4KUHA 1FBTA 4IF4A 1XTVA 1QF9A 4WTOA 4JWNA 4DIMA 3MJHA 2ZSJA 4D6YA 5L4NA 1LLCA 5TPZD 3MGKA 3U6BA 3SYLA 4H18A 2XOKA 2YWGA 3H83A 2WI8A 1SVWA 4FYJA 4OD0A 2QLMA 4DLSA 4UMEA 4J3NA 1M0SA 5DBEX 4ALNA 1GNLA 1L5NA 2RARA 1KAGA 3SM9A 4WJZA 5EOZA 3JS5A 2AN5A 4UARA 3KT0A 3VR6H 4W9MC 2N1MA 4DR3B 3A1VA 1KU6A 2W00A 4DBLC 3OAAA 2IRWA 1ZKDA 3KCQA 3RIEA 1D1PA 1KERA 1M6WA 4GBJA 4N7BA 3IXQA 3KSRA 3EOBI 1ONOA 3B5IA 4L4XA 3T6KA 1YS7A 3ZCPA 2OYYA 4II3A 4NBKA 1TTPB 2QW8A 1MVNA 4ALMA 4PQEA 5I7OA 1SKQA 1WMEA 3SU8A 1AKTA 3MT0A 3E3AA 4BNDB 4OOEA 2XF8A 2OV8A 2P9YA 3REQB 2AKYA 2D1YA 2XTZA 4HAUA 4ZI5A 2A84A 2FW0A 2QTGA 2W3SA 3PHCA 3TBKA 3UEOA 3OKPA 4XQ9A 1F2UB 3VI4B 1X86B 5KVAA 2WWFA 4HGNA 3MHTA 1Z8HA 5EJ7A 1QSGA 4AIIA 1ZP6A 2BGMA 1AKQA 4KBGA 4O4JB 4D46A 1ZM2A 5J2KA 2P6MA 1IHXA 3GQVA 2NNWB 1WPGA 1PK8A 3QYJA 2P2ZA 2X19A 1FYVA 1X38A 1KO4A 1YL7A 2G83A 1A72A 4M1KA 2XUQA 2BGWA 5DTRA 5LOVB 1N2XA 1TGVA 1WUKS 3ADBA 4EHIA 5LQNA 4GM0A 1GQ2A 2XY5A 1E7YA 1H1LB 2ZYRA 2QSZA 5D49A 3EC1A 1J2YA 1T10A 4RVSA 3O8RA 4MWOA 4RAOA 4IILA 5K03A 1ZJJA 2Y9PB 4FFVA 3HMQA 2OECA 2X0IA 3U81A 3R24A 3KUCA 3RKRA 2WIKA 1R8XA 2DF4B 2I67A 4QG7A 1DARA 2BQ3A 1EYZA 5ALXA 2ZJBA 2LKCA 2ZROA 4J9OA 5K0JA 3MQ2A 2P7IA 4BLOA 4BNDA 2O8DB 1C1YA 1KMMA 3REQA 1QLHA 2J3KA 2KTQA 3NBFA 1ZGGA 1CQXA 2NO0A 5CHGA 4D9EA 4JLPA 2WJVA 2NO4A 1U1EA 1F2UA 2C1ZA 1YBVA 1P2SA 1W85B 2Y66A 5HUJA 3C4QA 2BHNA 4O4JA 2Q41A 1Z13A 3B9BA 1BNPA 4RJ2A 4U6PA 1MLDA 3LFUA 5J2FA 1JVBA 1AK2A 4DR4B 2IJGX 5BV7A 2VQSA 1FDOA 2HHLA 3L7AA 4ZCLA 3HDQA 5A5DA 1KEKA 3VNRA 3CRXA 1DIAA 1KHHA 5CU7A 4Q9AA 1E2QA 2J32A 1VDMA 1IY9A 4DJFC 4RHEA 4ZI7B 4LFBB 3KTDA 3AILA 2GK7A 2JVJA 4BE7B 4D43A 4NZNA 1U3CA 4A92A 3WIEA 5JTIA 3MS2A 2YQEA 2O23A 4D9JA 1DPFA 3LUJA 4UE6A 2BWJA 2ODWA 4BMSA 3UAZA 3QFFA 4MUYA 4M9XA 1Z18A 1SKUA 3RSGA 1Z6AA 4KO2S 2Y92A 4CLOB 5TX7A 5CNMA 2O8DA 3OE7A 3DE3X 4C89A 1G3UA 3D3JA 4TYPA 4EZ9A 3A37A 1R5BA 4UZEA 4MRNA 2VDWB 4U9UA 2WAQC 4F11A 4BIMA 4OM8A 2ZXEA 4DIKA 1MPTA 5E6SB 1W1WA 4IIXA 3JPPA 5DLGA 4MUJA 4Q6WA 1Y4AE 4A8TA 1IJEA 4RGYA 3AGQA 2DG2A 4UAYA 3F74A 1E9SA 1PR2A 2VF2A 2RAVA 2W3RA 1UL1X 4UAVA 4R3UC 2BRUA 3TTYA 2F8MA 5IDVA 1JQEA 4HAYA 5JHGB 2FMUA 4ZI7A 1ZK3A 1PVRA 1VYTA 3PW2A 2DLDA 3A9CA 4PL1A 2OMKA 1C9DB 3PR2B 3T0FA 4GI7A 3U3DA 4HQNA 3IVXA 5FOQA 4ECZA 2IEBA 3D0QA 1DJQA 3NNDA 4GWLA 5IVHA 4UUOA 2BCVA 5EZYF 1H85A 3DKPA 4S2UA 1JAYA 2O07A 2ZSIA 3I01M 1EXWA 1BDJA 2FP3A 2JFOA 2H63A 4MWCA 3P1JA 5KAIU 2A1JB 4PE5B 4ASUD 4RPCA 2HKIA 3ROPA 3D4IA 3TQ1A 3IAM6 4QGHA 3PW4A 4CLOA 3WRXC 4RV9A 3A10A 2VDQB 3BH0A 3SIPA 2H85A 2OD2A 5TB5A 3MJCA 5LXTB 5B1YA 4ISBA 3TZKA 2BELA 2INGX 3K94A 2VDWA 4PPYA 1FFSA 3QIAA 4PZLA 2JGDB 1H3NA 5CHYA 1JV2B 5E6SA 4XTRA 2IV7A 1JIXA 4RZIA 3LUBA 2JH9A 2OXRA 2IVZA 1WW2A 3CH7A 2OC9A 6NULA 3GJYA 4D98A 1NAIA 1O7JA 3E0XA 3QVKA 3RS3A 3R5SA 4FSXA 3EULA 4F5WA 3DDNA 3HYLA 2NSYA 1YA6A 4LDAA 1UOQA 4IIUA 1Q3VA 4B3JA 2K6GA 4YYEA 3EZGA 1KEZA 2P2GA 4JP3A 2NZXA 1T5SA 3X43A 3L1JA 5J9FA 4UUNA 2JD2A 2B1JA 1EVLA 4GSLA 4LRSB 1T5LA 2CXUA 2V5UA 3IQWA 2WFAA 1JLKA 2CVPA 4RJIA 3MD0A 4HQFA 4BS9A 5BYKA 4QZDA 1NVWQ 3BQ7A 1DLJA 1WWUA 3CRVA 3VKVA 5G3ZA 3KPVA 1Z4NA 1VP9A 2A1JA 4BO2A 4AS2A 2Q5OA 2Y1OA 1ONPA 3PGLA 1P9WA 4KTVE 1C7JA 3VAAA 2J3HA 1GILA 1H93A 3DBIA 3ETRA 4OBEA 4OOFA 2G9VA 1F14A 3KUKA 5LXTA 1T2FA 3E9YA 3WKEA 3ROEA 4UXIA 5F9HA 4NSNA 2DQSA 4QYWA 2JGDA 4Q45A 1MCZA 5DDYA 3RYTC 4F4ZA 1B8NA 3PF8A 1J8VA 1JEJA 2BGIA 4DQ0A 3UPTA 3FB1A 3U4CA 5J0UA 1C9KA 4UBJA 1WU7A 5H3HA 4RLQA 3MUFA 1KO8A 4AVYA 4KXYA 1ZQCA 1YAJA 3VVBA 2CWWA 3VO1A 3HBMA 2VG8A 2Q5LA 2XKAA 1EK5A 3EF1A 2XKBA 1AKYA 3X0DA 4QW9A 1XZMA 1A9PA 1N25A 2VNSA 1TKRA 1BFDA 5CVJA 1PR0A 1CQWA 4DE5A 4RVGA 3EXG2 1N2GA 3KJFA 3BQNB 1PTJC 2VNAA 4EFDA 1O0BA 2VH5R 4BGEA 2B98A 1E7RA 5K6AA 1QIMA 2WP0A 4UM9D 2WE7A 2ZJ1A 4JBYA 5HS6A 4QJIA 3L0YA 3RWBA 2JFXA 1FU7A 2J9FB 4L3WA 3LW8A 4E5KA 4A2CA 4CUJA 3W6PA 3PUZA 4NOMA 5SZKB 4YHHB 3CVWA 1I6WA 2I6XA 4MA5A 2EZ8A 1IG3A 4IL6U 1KGDA 1ZRSA 5DGCA 1JDZA 3SMVA 4Z1MA 1N6OA 2CDRA 4CR7A 2OZLB 4A9AA 3ZZNA 1FL9A 4KLQA 3THOA 1TFUA 4NCJA 3LHFA 2C00A 4TKMA 2BFDB 2GAIA 1N2CE 4WKBA 2PHZA 4QIHA 2R7LA 2WY2D 5T3UA 2PBLA 4BJ3A 4E5DA 1GPUA 1EWTA 3HKDB 3BG5A 3VPBA 1RWMA 3H0LB 3LBAA 2Q6IA 4JJIA 4TQUS 1T24A 4RL4A 2O1EA 4LXIA 4ZQFA 4RF5A 3OZEA 3SHQA 4MEXA 1OZFA 3B20A 4HH1A 3ZE6A 1VHQA 3AUKA 1B0UA 5A4AA 4BLRA 4H4CA 2HEGA 3KWJA 3OHAA 1UZUA 5TT1A 5BP7A 2W2XA 5HR6A 3TQRA 3M6UA 5BNFA 1JT9A 5FTLA 4IDAA 5LQSA 3WLSA 3Q7RA 3M83A 3AFOA 4KHZA 4U7GA 3D8HA 3T4XA 3EAFA 2VJ5A 3O8CA 5JYCA 1CU1A 2J9FA 2LP4Y 5JWRA 2J1LA 2DH6A 3E03A 4ACAA 1X8XA 4MEBA 1J21A 2UYOA 4EFMA 2HRCA 3MXOA 4PCAA 3CHYA 1VIMA 5I3ZA 4KFTA 4CEJB 4RBNA 4YQZA 3ZD7A 3FRHA 3IG8A 1ZQ9A 3MCVA 2CY0A 2OZLA 3EE6A 2IELA 4TTTS 4CG0A 4YALA 1VMKA 4GO1A 3EVFA 3EA0A 2EKDA 4TLDA 6ADHA 2BFDA 4ZYTA 2JI9A 3KUUA 3AUYA 2CYCA 2WWIA 5DTJA 3PK0A 3FAZA 1LRLA 2OCLA 2UZIR 2CC2A 2CXRA 3EPRA 1W9MA 1ZOOA 1CR0A 4K9PA 3HKZF 4CL8A 1TPZA 1BO6A 4F5RA 1XG5A 1DXOA 3PFIA 5BWNA 2X5NA 3BILA 4B47A 5CDYA 1DJPA 1XJWA 3DDCA 2X1LA 5AVOA 4AP9A 1E3SA 3MSCA 4EYSA 3KKAC 4RDCA 2CXHA 2A58A 1EGVB 4ZODA 1Z0ZA 5E8JA 2HMWA 5C9ZA 2IV3A 1UMDB 4KR3A 4H4EA 3KQSA 2NSDA 2F3NA 1K8XB 3H6HA 1BC5A 5EZQA 4OXYA 2QLLA 2E8NA 3AUFA 3IAS1 4JC4A 1GYPA 3U7IA 3INRA 1GNPA 1ACJA 4KR2A 3GMIA 1EU1A 4CMBA 2GXSA 3FI0A 1U3VA 2CLCX 1E61A 2A88A 4HNQA 4IV0A 1D04A 5KFUA 1SV0A 3ZWCA 1RRPA 4CEJA 9ABPA 2IWRA 4ZALA 4TVKA 4JOCA 1BE1A 2FAXA 3UICA 3O83A 4YCCA 3FYUC 3PYMA 1SC9A 1T2NA 2PRSA 2X8LA 3KT3A 4B6EA 4C2TA 1EDDA 4Z2YA 5TDHA 1OWPA 4IW3B 1DOZA 2RHOA 4PX9A 5CIWA 3F8SA 4KW7A 2NV3A 1EINA 3GELA 3COSA 3RYCB 1YOBA 4HC4A 3M7DA 2WJJA 1U2EA 3KKPA 4Z6KA 3QI7A 4JLVA 2C84A 2F62A 3P71T 2QSYA 1WPQA 4B09A 1Q0UA 2IZOA 1B8OA 4Z9XA 5HZHA 1FFWA 3H17A 4EITA 2GCEA 5P8WA 1MX9A 3LGAA 4PHPA 2PWBA 4G8DA 4PSCA 1O54A 4YMMA 3QXHA 1UMDA 3T7TA 2OR3A 3QKRB 1WHSB 3OMWA 2JBAB 3KQMA 3AI2A 3GH1A 3JPSA 3VCBA 1G4HA 1O9GA 1RQGA 3MILA 4EP1A 2HAEA 2O14A 3LECA 4DF3A 1NWCA 1DC6A 4AD8A 1IEWA 3VAYA 1VLMA 4PLWA 4U0KA 4PANA 3UV6A 2JLSA 3A25A 4I1PA 2Q2QA 3LWDA 2X4LA 1O1YA 1OJ7A 2HF2A 2Y1JA 3X1JA 3PEUA 3ZJ4A 3E4CA 5J29A 3RYCA 1GGJA 1HETA 5JPDA 4UCXA 4OHMA 4ZH4A 4INJA 4W82A 1ZQHA 1XVUA 3EH1A 1QP4A 5G0TA 4U7DA 2ZJ2A 4OQLA 4JSYA 5BSTA 8ICSA 5JAUA 5ILOA 1E5QA 2XB8A 3RFXA 3PNPA 4PFJA 4X94A 2X7JA 3G17A 3G2KA 5EZ5A 4RQ3A 1TCUA 2EAOA 4AURA 3W4KA 3OSNA 2DPLA 2ZYTX 1HNXB 2DY0A 3AOEC 4ZYWA 4PCLA 3ACDA 1MAVA 2P67A 3AFNA 2XT9A 3OZCA 2WNSA 3LPMA 3QKRA 4DIEA 1WHSA 2VFAA 2XI9A 4MJLA 2JBAA 4B6QA 4AJNA 4MVJM 3T7KA 4RNOA 3AFIA 3BUSA 3P45A 3D4NA 3QM1A 2NLOA 3U7FB 3M6XA 2O5EA 4PPXA 4EKNB 2ZETA 1E8NA 3HWX1 1GNQA 1D0IA 2PGNA 3W7BA 4UHKA 2Y0SF 1JXMA 3JAWB 4GP7A 5TLSA 2Y6VA 2Z3WA 3L7DA 2MIIA 1FTNA 3GK3A 5J0OA 4M99A 3TNYA 2VJDA 3U2QA 4RFLA 3EVZA 2H3QA 3ROMA 4P8RA 5FI1B 3DLCA 1ZNZA 1NBWB 1XU4A 3JPOA 4TXNA 2SCUA 2BGNA 3ZWQA 3ZEIA 2H3IA 4NG4A 1PL7A 2J48A 5AUQA 1JLLB 4Q3KA 2QW0X 2Y2VA 4F84A 2P2CA 3OEEA 1SB9A 3VR5A 4L5CA 4WXHA 3OC6A 2EVWX 2O0JA 3AUAA 3HVIA 3O93A 3QYAA 1Q0RA 3DAYA 3RFFA 2I29A 4HVTA 5H02A 3ANNA 1K88A 5IVDA 1ZN9A 2ZYVX 3BXZA 2I3AA 1KTVA 4Y6SA 3IH5A 5JAMA 3LXMA 3DPIA 2QRHA 2Y9MB 2FVYA 2BMWA 3LUCA 5GY7A 3ZCVA 4LTDA 4BCCA 4GMKA 4X24A 5ERXA 4GC5A 4Z0HO 4C4ZA 4IWXA 1QJCA 3HX0A 2X1HA 1I2AA 2VUHB 4B7UA 2WZBA 4KL8S 3U60B 2V7WA 3ZJTA 2A67A 4KSYA 2C58A 4IQFA 4NV1A 2AF4C 2HZ7A 1T26A 3GUCA 2ZZMA 2ZJ8A 5AYVA 1ZJ4A 4TWAA 4DABA 4R7GA 3JAWA 4MLCA 3P9PA 3U4AA 4EY4A 2O57A 4RENA 3VPHA 3OJCA 3QOYA 4DREA 3BDPA 3GLGE 3L3BA 2YL2A 5KAFU 1I1QB 2ENWA 2A6PA 1IN4A 2RHCA 2KI5A 1O03A 2BBOA 4Z4CA 4CUZA 3ML1A 1RLOA 1JLLA 1JGTA 2KSQA 4OLFA 4AMYA 2I76A 1NF9A 1W46A 3TQOA 5F9NA 2VO1A 4CM9D 1KBUA 3R7FA 3BJZA 3ZQKA 1ORWA 5TJHA 1W4LA 2O2ZA 4E0BA 4B0OA 3L8ZA 1WB6A 4P53A 3FWHA 3SX0A 4YV1A 5LL6P 3L0DA 3IQEA 1NQXA 3Q8MA 2WV9A 4KE7A 1OA1A 4BKPA 4W1PA 4IIHA 7ICSA 4J1TC 3RK0A 1L3CA 1BH2A 5JI2E 4N4AA 2FH5B 4ZC1A 1CR1A 1KRHA 1R50A 4CMKA 3K1RB 4N5NA 2CNDA 2VIIA 5A7GA 5BSKA 3DFUA 1IULA 1XTUA 4QBKA 4FLMA 4MGHA 1B15A 3RIMA 4ICIA 5LWHA 3EPJA 4FI3C 4KIGA 2A9VA 4DMFA 4KZKA 3EPPA 2HPVA 3CGWA 3BJYA 1U6KA 1BYIA 5U4QA 2COEA 1XRQA 4DEVA 1HG0A 3CUTA 5H81A 1A50B 3NGDA 5AW2A 3H97A 2DPXA 4IGFA 2QRZA 3HXMA 2JCGA 4LGYA 1YKFA 1IZ7A 5HM6A 3SR3A 1HTBA 2QB1A 3QVXA 4IXMA 1TZJA 3OZXA 5I51A 4OV6B 1ZQWA 2YN4A 2AI2A 3R0ZA 1HTTA 4MVJF 4N65A 1YDWA 3WHIA 1WZUA 1CT9A 1N6NA 4OXKA 5KNDH 1O95A 3MR2A 2GD0A 4FGUA 1UINA 1G38A 4PSVA 1SL1A 5IILA 1C7YA 1IL0A 3ZDAA 1T3SA 7GPBA 2XGPA 1E3MA 4ILEA 2QLTA 4YV2A 3ROGA 2YYAA 3MIZA 3COWA 4CQNA 1Z75A 2ZS9A 4IQ4A 3NBXX 3L82B 4RPGA 1ECLA 1UPHA 1OSNA 2DHCA 2Z5FA 4G5OA 1J09A 1QNFA 4E1BA 2KHQA 3FPAA 4YJHB 1U1GA 2GK3A 1Z3IX 4UNPA 3HUDA 4YGYA 2G71A 2RK3A 3ZK7A 2H4JA 2H00A 7ICKA 3HVKA 4GKKB 3X44A 3TANA 5THQA 4WV3A 1PVVA 3IT3A 2LIPA 3K0EA 3RVLA 3CFYA 1I7NA 1ZIPA 3B70A 3D8NA 1P6UA 4FFBB 2A5GA 2Z6UA 3BH7A 3Q3GE 3MMZA 3AL0B 2GN8A 1L3SA 5J2JA 3BMCB 2GJ8A 1TUGA 2H5LA 3W9SA 2FPXA 4RMGA 4K6OA 4KWHA 4UEJA 3ZU5A 3I6MA 1K92A 3IEVA 3AEVA 2I78A 3UN1A 2ZBUA 5CFMA 1E8DA 1PJZA 2H48A 5LZ9A 4IDEA 3E35A 3EQ8A 3UHPA 4NLZA 4MIEA 3KV1A 4I55F 1SEVA 3LHSA 5KYTA 1XTRA 1CR2A 3KB8A 1T35A 1YJAA 1N9KA 2DUWA 2CK3D 1U4BA 3KTAB 4Q02A 4FILA 4TT8A 1XQYA 5KFNA 3STXA 5JDIA 2QXUA 1A6SA 4ZYUA 5JRJA 2CL6X 3NM5A 4J4BA 3S4YA 1Y3HA 4YJHA 1KI9A 4K86A 4LRYA 1AA6A 1FFVA 1V4BA 2FPGB 3MZ0A 2DPGA 4NHOA 4F2HA 1VKOA 2A86A 3AU2A 3EIHA 3L02A 1ZCAA 4XX0B 4R2KA 1P5FA 2XKKA 2H16A 3GVIA 3PHBE 1MB3A 4PNEA 4ER0A 1UKZA 1G60A 4JXKA 2CV2A 1OWOA 1ETHA 4FFBA 4IH4A 4HRVA 3OTOB 3FJYA 4COOA 3BMCA 2P65A 4PZCA 2ZE5A 2Q1TA 3RSOA 3L6BA 3G9QA 1N5RA 2LZ0A 1JA9A 4NL4H 2M32A 5D4BA 4OK6A 3GRKA 3ZCRA 3TZ6A 2Y05A 1J90A 4ND8B 1W8IA 4UOQA 3FB4A 4AJJA 2LDBA 3WK7A 1FDWA 2HT6A 2HBZA 2VJMB 1ZETA 5T8KC