3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
b'RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
3WKEA 2JAUA 3KOOA 4IG4A 2HSZA 2AMYA 3FGOA 3M1YA 2G80A 4XPZA 2WF7A 3ZI4A 4AS3A 5AW6A 4MWOA 1RRCA 2FPWA 1O08A 4FYPA 1YNSA 2YN4A 1WPGA 2B8JA 5AVYA 1QH9A 3VAYA 4HGOA 3SMVA 2VKQA 2FPUA 2IOHA 3NALA 3ZTWA 2GHQA 3NASA 3WK7A 2YJ3A 3U7FB 4HGPA 3FZQA 2YMQA 1L7PA 3SHQA 1RLTA 3EWIA 2PR7A 4ZEXA 3ET5A 4Y3UA 3ZVNA 1XP5A 2HF2A 1NNLA 3N1UA 2YJ5A 1T9ZA 1MH9A 2QYHA 5AIBA 4HYTA 1YV9A 5AVSA 2ZBFA 1RPZA 4YGYA 4GIBA 3ZWDA 3ZWKA 4F72A 4C4TA 2NO5A 1K1EA 3UM9A 4CF4A 4G63A 1ZD3A 3P96A 3W5AA 5AK6A 4EENA 3BWVA 3OCWA 2GFHA 3M9LA 3WK6A 4J03A 2GO7A 1XVIA 2CFRA 4EELA 3ESQA 3NUQA 1RDFA 2FPXA 3U7HB 3I1YA 1SWWA 2PQ0A 1CR6A 2I55A 2I34A 4OFZA 2I33A 1RC8A 5AKGA 1YDFA 4KYTA 4HAIA 4NFLA 1QQ5A 3SKXA 2OYCA 2W4MA 4AS2A 5AM1A 4F71A 5AM2A 2B8EA 5AVQA 2C8KA 4EZEA 2BDEA 3AR9A 3DV9A 1TJ3A 3DNPA 3ZVMA 1RKVA 1Z4OA 3ONNA 1WR8A 4CNQA 3KDPA 2RB5A 5AM5A 1L6RA 2YJ4A 2WFAA 5AM0A 3FM9A 5AK3A 1ZOLA 5ALMA 1TJ5A 1VFPA 1FEZA 2WF8A 5AI5A 5AK4A 3SD7A 3ET4A 5AW5A 5ALKA 1L8LA 3QU4A 3AR8A 4DWOA 1JUDA 3UMBA 3AR4A 1RMTA 3B9RA 4CF3A 3B8EA 5ALIA 2YMLA 2C4NA 1VJRA 3QU9A 4OCZA 4BEVA 4UW9A 3D6JA 5E0OA 3RFUA 4Y2TA 4BBJA 5AW1A 3GYGA 3ZVLA 2OM6A 1TE2A 1SU4A 1ZD5A 3KD3A 4YH1A 3KC2A 5AKXA 2BY4A 2B1QA 3I28A 4NV0A 1L8OA 3KBBA 4NAVA 1RMQA 3WGVA 4UM7A 5AICA 3E84A 1L7MA 2OBBA 5IT4A 4ZEWA 2HDOA 3QUQA 4Y2YA 3L5KA 3QUTA 5AKZA 2JARA 4B6JA 1Z5UA 2WF5A 4G9BA 5AHXA 1X42A 2FPRA 3OCVA 3U26A 2G06A 4YIHA 2IOFA 2IA5A 3L1UA 1U2SA 5AVUA 4Y2JA 3ZU6A 4UMFA 1ZD4A 1IWOA 1Z4KA 3WK4A 3N28A 3WK5A 2YFYA 4BX3A 5IT0A 2B0CA 2YBDA 3QXGA 4UM5A 2P27A 4MUMA 2YMPA 4YCMA 5AW9A 1RQNA 4KX3A 4UAVA 3AR7A 1ZRNA 4KX5A 1QYIA 2HOQA 2G09A 3EF0A 4DCCA 1YJ5A 4QQFA 4YCNA 3PDWA 2G1AA 3PGVA 3R9KA 3NANA 3K1ZA 2R8ZA 3FVVA 5ALYA 1Z4MA 3J7TA 4CE6A 3WK8A 1U7OA 5JJBA 2IOFK 1RMYA 4ZEVA 5ALGA 4UATA 3ESRA 3U13A 3U7EB 4L57A 5ALVA 3ED5A 3QUBA 2CFTA 3FPSA 5AKIA 3L0YA 1N8NA 4YCLA 2WF6A 4BNDB 3B9BA 3OTQA 4RESA 2HI0A 1J8DA 4UMDA 5AESA 3IJ5A 5ALSA 4BX0A 3R4CA 3U19A 3KZXA 2O2XA 5A3RA 3L0BA 5AI6A 5AI8A 2QLTA 1WVIA 2X4DA 1U02A 2P9JA 3OCUA 5ALEA 1T5TA 3R09A 5AI9A 1LTQA 3AR3A 2IYEA 4UARA 1RKUA 1SWVA 1S2OA 5ALHA 2YMMA 3S6JA 2G08A 2FEAA 3UMCA 2Q5EA 2RBKA 3L0CA 2EAUA 2ZOSA 5AKLA 3A1CA 3E81A 4KN8A 3AR5A 2HO4A 3PGLA 4XOUA 1LVHA 1ZRMA 1Z88A 2ODAA 5AW7A 1U2TA 4UAUA 3L8EA 2HX1A 3WGUA 5ALQA 3QU5A 1RLMA 3CZ4A 3QU7A 2RAVA 4C4SA 2HEGA 4Y2SA 4OHFA 1QQ7A 2O9JA 3OCZA 2C8LA 5ALRA 1NF2A 5AW0A 1S8OA 4BYGA 4L6AA 4Y2VA 2AH5A 2P11A 2WHEA 1YS9A 4GXTA 1L7NA 5AW3A 5FP0A 5ALWA 3A1DA 4Y2UA 4AP9A 3W5DA 3OCXA 2DQSA 3L1VA 5AI4A 5AVWA 3OCYA 5ALXA 5AKEA 2C88A 2R8XA 1XPJA 1F5SA 5AM4A 1TJ4A 5ALNA 3BA6A 3E8MA 3U7GA 3L8GA 4QJBA 3WKBA 1RKQA 4DFDA 4YIKA 5AKHA 2B30A 5AVTA 3PCTA 2JAWA 3L7YA 4KNWA 4Y2RA 4Y2XA 4CF5A 3MPOA 1L7OA 4BX2A 3ZX4A 2FDRA 1CQZA 3QUCA 5AW8A 2OA0A 2MU2A 2W43A 5AW2A 3QNMA 4O8CA 5AVVA 3IRUA 2FI1A 2FUEA 2WM8A 1EK2A 1U7PA 2P69A 4XE5A 3OPXA 4BKMA 1ZS9A 2GHTA 2FPSA 4OD0A 4Y2QA 5AK5A 2I6XA 5T41A 5ALTA 4BNDA 5A3SA 3WK9A 1ZD2P 2W11A 1EK1A 5AIAA 4L6CA 5ALZA 2WF9A 1RLOA 2ZG6A 5ALJA 3EPRA 3TLMA 4DW8A 4EX7A 3I6BA 3ZUPA 2ZBGA 2R8EA 4NWIA 3F9RA 3I76A 3W5BA 4EX6A 3A3YA 1Z5GA 4JDPA 1TA0A 3SLRA 4UMEA 2BDUA 3CNHA 4H1WA 4HGNA 1QQ6A 3IB6A 3HLTA 4IFTA 3SKYA 5ALPA 2MSNA 3WKDA 2EARA 4HGRA 1PW5A 1Q92A 2NO4A 3W5CA 3QGMA 2G0AA 2I54A 3L8FA 3NIWA 4JB3A 2PKEA 5ALLA 2ZBDA 2NYVA 4FFDA 2GMWA 1Z4NA 2Q4RA 5A3QA 1Z4LA 3MN1A 2D2VA 4NABA 1Z4QA 1WZCA 2ZXEA 4PNHA 1ZJJA 5IS2A 1Z4IA 2JGAA 3HYCA 3AR6A 4XQ0A 3SF0A 3MMZA 2FUCA 2RARA 1N9KA 5ALUA 4UMVA 1NRWA 3NRJA 3RF6A 3UMGA 2Q4TA 5ALOA 2B1RA 5ALFA 4KNVA 3N5KA 3WKAA 3DDHA 3QYPA 3QX7A 2ZBEA 3N07A 1J97A 2I7DA 1RQLA 2AUTA 2G07A 1VJ5A 3DAOA 5AKKA 4FE3A 3ZW7A 3QU2A 2AGVA 5AW4A 5ALDA 5AVXA 2B82A 1T5SA 1Q91A 4J2TA 4I9GA 3L8HA 2HF7A 1AQ6A 4BEWA 5AVRA 2C9MA 4E88A 5AKJA 4UASA 1Z4PX 3QLEA 2CN1A 4UU0A 2MU1A 2HHLA 2EATA 2CFSA 1Y8AA 2HCFA 2JAOA 3MC1A 2YY6A 5AM3A 3A1EA 1YMQA 1O03A 3N8GA 3ZTYA 3E58A 2R8YA 4I9FA 4C4RA 1KYTA 5AKYA 4UU1A 3EF1A 4EEKA 3NAMA 3AR2A 3FPBA 4HGQA 5AI0A 4Y2PA 2YJ6A 3WKCA 4RETA 5AVZA 3ZX5A 1Z4JA
chains in the Genus database with same CATH superfamily
2IBKA 4Z9YA 2JGKA 1HO3A 1OLSA 4KH0A 3DLCA 1CUDA 4EKYA 1PGNA 4DUZB 1NXPA 2YZKA 4I3GA 3QV1A 4PSAA 2I03A 3RC1A 3SSNA 2JCSA 2X2PA 2H57A 2A9QA 1H94A 4C9BA 2P7IA 4XX1A 4YMSA 721PA 1ADBA 2NZJA 3I53A 2JFYA 1O96A 4CLHA 1ELOA 4F4UA 4YQFA 4KPEC 4UM9D 1XNQB 1YI8A 2AQ4A 3IX7A 3EXAA 3L1IA 4XYMA 4UAJA 3HFJA 1X86B 2W2PA 4MQ6A 4MKHA 2KYRA 4GSYA 4DQRA 1KI4A 1ACJA 1WUDA 4QX6A 2ZT8A 4OFBA 2IXFA 2Y0PA 5IIIA 4ZZ0A 4YMIA 3AHJA 4IRCA 5H3CA 1JDTA 3A6JA 1FPQA 1MIHA 4GR5A 3TOSA 1O6FA 3UZUA 4AX8A 4Q1BA 2CY0A 2QTFA 1AH2A 2Z5FA 1TK8A 4PC2A 2BTOA 3ETNA 2JFZA 4A0RA 1TYCA 1FSFA 3DEEA 1T1GA 4Y2YA 2FQWA 1QSSA 1HORA 3VZPA 2C8JA 4N41A 4P34A 3N0RA 3EPGA 1F8FA 4IIYA 3THWB 3DWFA 1LLQA 3MZ0A 2KD1A 4EYEA 1IWOA 3L8CA 4EAQA 1VTKA 1JMSA 3V7KA 4ZI7B 4Q47A 1ZRNA 4NFSA 4DIFA 4GNKA 4F1WA 4HSEA 3PUWA 1BGXT 4EKIA 3RKSA 4B3SB 3JQCA 4WHMA 2W3RA 2Q5HA 3ZXUB 2G1PA 3STTA 3IC5A 3ZCSA 3R5JA 5H02A 3T1TA 3K72B 4FFLA 4Z0PA 4I2JA 1MGOA 4JLDA 4DLLA 4H16A 2M1ZA 4O2BF 5LLTA 2WFZA 3ZU5A 3PUXA 4CKCB 4H6WA 2E82A 3NGLA 4ARCA 3KXKA 1MBZA 4JBWA 5BUSA 4Q34A 1ZJMA 3JD1A 2Q9BA 3EA4A 1YR3A 4KQHA 4QPCA 3IAM1 2JLXA 3HCEA 3L6CA 4IRMA 3AGPA 2GJ8A 5BR4A 3BIXA 2ACVA 2XTJA 4UPVA 3BF8A 4Z86A 4HNAB 4O0MA 2VHQA 4F5ZA 3FNFA 4PH5A 3U16A 3FOFC 5ALXA 4H6XA 4YUXA 1H9AA 5TT0A 3WLLA 1TJ4A 3E8MA 4FCWA 5HJEA 2QIOA 3HADA 1OV4A 2W7TA 4KQ9A 1QFYA 2BMDA 2G36A 3HDQA 2W6JA 3SBXA 3VZSA 3TFWA 3JWIA 1U2GC 2FSHA 1QFJA 4C7OA 2QROA 4ED8A 5JS1A 3CO5A 4K0RA 4DG5A 2A4KA 1ESCA 3CE6A 3Q2OA 4F9FA 4PLCA 4XI9A 1VPDA 1AS3A 2YVAA 3K4QA 5FTLA 3R3UA 1XU4A 2X86A 1CP2A 3ID6C 1DJNA 2IV3A 3T7JA 1VL1A 3A11A 2F3PA 2G70A 1MQ8B 4XA8A 3L8FA 1EUZA 4P3XA 2Q4RA 3RVJA 2I2BA 2ID4A 1OH7A 3HV2A 3L4EA 2Q5CA 1JQEA 5LBIA 1CEXA 4U0KA 3RBEA 4X00A 2ZETA 2IHMA 4ZJYA 2Q4TA 2XOEA 1TIPA 2PMWB 3Q7RA 3OM1A 2KN7A 1OIWA 3Q5EA 1B3RA 3EVAA 4DA9A 1PLLA 4Q4JB 3HBMA 5IBRA 5I45A 1JHMA 3OZSA 4UU0A 4JYZA 1KJ8A 9ICXA 4XB6B 4G85A 3W2TA 2VHYA 2KJ9A 5GAJA 1HLPA 4L9SA 2H16A 3TPCA 1CY4A 1SKQA 3T9EA 1NC1A 2QNRA 1AKTA 4NCHA 1HMPA 4DPLA 3DJYA 5B7GA 2H2WA 3W8RA 1CDOA 4PZ0A 4HAYA 3IP3A 4Y7DA 1QYRA 4B45A 6CHYA 4ZZ2A 1P4JA 4JJ8A 1A9YA 4BO4A 5TC4A 3BK1A 3H13A 1QGUB 2IH5A 4H7DA 4M37A 1CJCA 4FD3A 4P1ZA 9ICBA 1N60A 3QF4B 3CX3A 3BXEA 3I0NA 1LCIA 1QIIA 4OQXA 2YASA 4LQ4A 2W2MA 5IC5A 3GARA 2ZJOA 1BHQ1 4INZA 3HRHA 4AX4A 4PZYA 4YP0A 1T0UA 3EGCA 4AIRA 5IYZF 2R47A 1NOKA 2XW6A 4LSZA 4RMNA 2FFRA 1JIUA 4JJAA 4LZLA 3KLMX 4ZCIA 5IJXA 5D6OA 2OYRA 4R64A 3QWIA 3WLNA 4EKNB 3RR8A 5DXFA 2PX4A 2CEAA 3L43A 4UNQA 2IYRA 2FPIA 2IWHA 2JASA 1DQNA 5CA0B 4ZEWA 4EATA 4IKPA 1YB5A 4NQZA 1T3QA 4E5MA 5DFAA 4L4RA 1OXTA 4I5GA 1DU4A 4CCSA 1ZD4A 5IH7A 1U2PA 2ZXFA 1T8YA 4Q3DA 4HNQA 3DAYA 3OMXA 1OHHD 1P1KA 3ESCA 2QTVA 2JFOA 3H6KA 5GTHU 2C2YA 3G0DA 2PKQO 4Z4GA 3HEAA 2R6CA 4D9GA 2QNIA 2QR5A 3D0KA 2OFFA 3W1EA 1B3BA 2KM1A 4E31A 1FYXA 3BAFA 4BNDB 3SM3A 1I5RA 3JVVA 1L5WA 2PYIA 4MVXA 1ZXIA 2PV7A 3ZZTA 3U19A 4IIFA 4TPKA 4JEUA 4WKOA 1JDNA 3MT9A 1PJ3A 3BJRA 1J2MA 1L2TA 4KR7A 2ZRJA 3JVEA 2J3QA 1DJPA 4BO6A 3H8SA 4LFCB 5KNBH 2IZ7A 4P32A 2BW0A 2ZPAA 2IU3A 5ANRB 1H42A 2W0SA 3QVWA 5IVDA 1G8JA 4TGLA 3CJTA 1I2MA 3O8NA 1ATZA 1ZQBA 1W4ZA 4J9PA 5CDYA 2W9BB 1SN7A 3ZWOA 1PR6A 2WSMA 1ZH4A 1QH1A 3KAQA 5DGCA 4D74A 1AKQA 4XQCA 2ZVPX 3C74A 5HOQA 2OCIA 4DQPA 3KYCB 4KMOB 2DR2A 4I2EA 5IM5A 4I0WB 3DE3X 1JFVA 1J1ZA 1KKUA 2IEGA 4RFSA 2ZKIA 3L7YA 5KFSA 4Q3BA 2DFNA 5ELXA 4L16A 4DLAA 4A10A 3OOSA 3JATA 4IO0A 5TF4A 5LXTB 4YMMA 2Y0EA 1NK5A 1RSZA 2KIVA 5DWVA 1XKXA 5T41A 2XQGA 1DJQA 2PS0A 3C1UA 2XGGA 2RKWA 1KJQA 2IXAA 1X8LA 1O57A 4MQLA 2X22A 1SUSA 4PLPA 5FOSA 4UTVA 2BGUA 4DG8A 1DKUA 5KQSA 3I9FA 3DUWA 2EFGA 5MN5A 3PL5A 2ZXEA 3T1NA 3MINB 3VU8A 2KHZA 3CSUA 3N2EA 1RC1A 3CCBA 1WXEA 1ZI8A 4IXDA 4LC0A 2PKQP 5GGYA 1NIJA 4DQLA 1RHUA 2CRXA 4HDMB 4EUSA 4UCWA 1X7XA 2YVUA 3IM1A 1WMBA 2I7DA 1RQLA 2BMJA 3DAOA 2EHDA 3QU2A 3EMVA 3UW3A 2XLCA 5CLFA 3KWMA 2O06A 1IY2A 3URMA 1ADCA 3RV3A 1WWKA 1S7GA 2WK1A 1IXSB 4XLZA 1HZJA 2KSQA 3X43A 4DS3A 5KNCD 1WV1A 1YF3A 5G02A 4EZBA 4WJLA 2ZRPA 3F7MA 1T13A 3PSPA 2OHHA 3GJXC 4RZIA 2DAPA 2XQFA 3T5PA 2B1JA 4L0MA 5EIBD 3GVPA 1P9RA 4HAWA 3WE7A 5L7WA 3A9RA 2YWDA 3ZVNA 4H1VA 1KQGA 2QM0A 3CEHA 5CXXA 3ZDDA 4PHPA 4I2IA 3GLGB 2CE2X 3FUVA 5CBPB 3GEBA 1Z17A 3KO8A 3PC2A 2CMDA 2YUIA 5BOVA 2NV6A 2IU4A 5DKWA 3F4LA 3DW1X 4JV5B 1OI7A 1U8XX 4GR4A 4M0AA 3KYIB 4W6QA 1OH5A 1HSZA 1P4HA 4Z3DA 2WZQA 1CUVA 2BFOA 3VNVA 2WFAA 1GN9A 1AKMA 4LXUA 3UKDA 2EWVA 1L8LA 2V7QA 3I8XA 4TL8A 3FYSA 3PO5A 1XNJA 1WXDA 1FNSA 3RFUA 2KK0A 1ZRHA 4L4YA 4XIYA 2H4ZA 2K4PA 1DVRA 2OAGA 4CYMA 1RWPA 1WUIS 1N7HA 1H65A 4FYVA 1NDQA 4H27A 1P2UA 1RJDA 1SZCA 2PZAA 4GKAA 4DREA 1SK8A 5CU7A 1ICIA 4WKPA 5D3MA 4G5SA 5IT0A 4Q1AA 3RGGA 1SU7A 2BI4A 1QOPB 1JSLA 5BNFA 1ZQLA 2OECA 3DMTC 3FGPA 1FDSA 1STOA 2Q5JA 2Y76A 3TL3A 3V2IA 4JQYA 5EHZA 5CH8A 4AN4A 3ZQJA 1UWKA 4EBFA 3EUWA 1U8EA 1BCRA 1DSSG 2IPOA 4LF8B 1SB9A 4GFJA 4OBBA 4RV4A 2VP0A 2WT8A 3O2QB 1JQJC 1KHHA 4FZRA 1VYVA 2XE7A 2I8LA 2VC2B 1BRMA 1M67A 2WHPA 4CIYA 1HL3A 1TIBA 4OMFG 2DHRA 3EMKA 4C2TA 1EM8A 5JRTA 2JANA 1XA3A 4L15A 5JQGA 1CEYA 4I99A 4XDGA 2NT3A 1BA3A 3V7JA 4X1IA 4NKRA 4JCCA 3WYDA 4FYWA 1XCOA 1B0UA 3DGFC 4IIUA 2WM2A 4DV3B 3GNLA 1FFVA 5J0OA 4HDQB 4P80A 2DBZA 3OX1A 1UODA 2EKDA 5HF6A 3AI3A 2ET6A 4IF6A 1V8FA 3W5VA 2VTKA 1E9RA 1M1UA 1JFSA 3HLKA 1EH5A 3V2UA 3M5PA 4YO7A 5H82A 4FOTA 1E20A 1O94D 1VMDA 4DC1A 2O8DA 2GM3A 5FCDA 4LF9B 2Z57A 1Z5GA 3IQZA 2AOUA 1JDPA 4DC9A 3BGVA 4MHTA 2VTDA 2PKXA 5KAFU 3HLTA 2IIPA 2I3ZA 1SHJA 3X2EA 8ICCA 3D8RA 2A0XA 3RYFB 3DPUA 4R54A 1GZDA 2O2JA 3WXBA 3C7CB 5DNYB 2P66A 2LBPA 1ZN7A 3FNGA 1QJ4A 5CUQA 4X97A 1JTEA 4MHVA 3N0XA 1YQWA 2E0IA 3ABRB 5KSZA 3TIXB 1KRPA 1WDWB 3E9CA 3E7WA 1OU0A 4BO1A 2WVGA 1BDHA 4QQKA 5ED4A 3MMSA 1H1LB 3V55A 3SOZA 2X9VA 1QDLB 1JHZA 2F1HA 4OGFA 2ZS8A 1VB3A 1OASA 2PVCA 4B5KA 1FLAA 3JSXA 4O0LA 2AFHA 4P4PA 3ZLTA 2E48A 1W1UA 4LTNA 4Q0MA 1X1DA 4EY7A 4RD2A 4U2GA 3THYB 2HGSA 4RUAA 1U1GA 4LV6A 1TMGE 2ZJ2A 2ZCJA 3ZHVA 3TUZC 1Q7TA 4BFYA 1SV0C 3G1WA 3TRDA 2FY8A 1D7AA 4G24A 5ULLA 4ENRA 3G3EA 3AL2A 2EKLA 3HSYA 5FV4A 1JG1A 4L5CA 1KEZA 4OSPA 5C31A 3U4IA 3CGWA 3UWKA 1NVAA 4KFTA 3VH3A 2Y0DA 5FWYA 4MCIA 1LQUA 4C07A 4BLVA 4LK3A 5IIJA 4UCFA 4YUZA 5DYGA 1AC5A 1HQYE 4YMWA 5FPTA 1EESA 3PR5B 3MF4A 4MEYA 2BI7A 2JRCA 4CF3A 2YMLA 1EWRA 2JIMA 2WAYA 4I4TB 4R1LA 3WDKA 1SU4A 4GWGA 3TLKA 5CX1B 1ECJA 1VI6A 1O95C 4ARBA 1A8UA 1KAHA 4RNMA 4RXMA 4Y6RA 1GZHB 3AI1A 3E15A 2F2AB 2F17A 2HDOA 1PD1A 2GJAA 3JQBA 1VBFA 5IAJA 3OJOA 1SQFA 5CDSA 1K5OA 4CL8A 3TUIC 5KTOA 1R0LA 4ZIRB 3A0BU 4EP1A 1PFUA 1UMCA 1DTEA 4HH0A 3SR3A 1T9BA 3BDIA 4HQOA 4HS9A 4TV9F 3AO0B 3TF5A 5FPPA 1J8YF 2QMOA 2BKLA 3V4PB 2X0EA 4GF5A 3IDWA 4RPXA 1VZ3A 2W8LA 4I5IA 2BN4A 5IU6A 4BYMA 4AS1A 4Q4LA 3DTNA 2B78A 1HA3A 2PN1A 3WNCA 2VAWA 3OCJA 1GKLA 2DFDA 2HSJA 3S28A 1G8MA 2FSVC 2QHXA 3KQPA 2ZSJA 4TRRA 2FJ6A 5TGTA 3I9MA 5L7YA 1C9NA 3V9PA 1Y5MA 1UIRA 4B7CA 1Y1TA 3F5QA 2Q3EA 4RYDA 4E0DA 2YZ2A 4B75A 2Y99A 4R2IA 5E4TA 2FXVA 1PVDA 1XEAA 4LCBA 1ID1A 4YRJA 2XY6A 1MFZA 3W34A 3M6AA 4G26A 3HZRA 4ECWA 3V32A 2R8XA 1ONNA 3U4AA 3BSSA 3I04A 1NSTA 4OQZA 5BN1A 1BHJA 4QXPA 4IJUA 1M2NA 2DLNA 4K03A 2GZDA 1UA0A 1WBDA 4ZYUA 1AKUA 1PEAA 2QZZA 4B8ZA 4X44A 1N5WA 5JUWA 3PXUA 1XZHA 4EH1A 4HXYA 4EG5A 4D43A 1KEEB 3S2SA 3KYBA 2PD4A 5GONF 2CLFB 1H0RA 2AMJA 2GCIA 2REXB 5IF3A 3FPJA 2FJ0A 4CM1A 2AZ4A 2W00A 3DYBA 4NATA 4EYOA 2Q6OA 3TE7A 1N6PA 4Q3KA 3QUSA 4D92A 5WRFA 3NGDA 4NS4A 4Z0TA 2F3SA 1R12A 1AB6A 3OIGA 1G5FA 1OIXA 4XWAA 1MX9A 3BMCB 1GGKA 2XUDA 3F5DA 2ZUBA 4XQ0A 4YXFA 1N62A 1FQOA 4R1TA 2WP0A 3KZVA 5H16A 1FSZA 2QDXA 4N3NA 5JALA 2FK8A 4PSKA 2Q50A 3PTZA 1SURA 1KZHA 2V9ZA 4FHEA 2QP9X 4U9HS 2CXUA 3N74A 5FHRA 4ZOLA 1A96A 1F14A 4Q19A 3PQ2A 3W0LB 2C96A 4FZ3A 1CUKA 2Z6QA 4YJHB 1QVVA 2PG3A 5EZQA 4E6EA 3PGA1 3HFGA 5KYNA 1V7PC 1EFLA 3TCNA 5JPIA 3DNFA 2V1UA 3NVWA 3PLAE 5B36A 5JS8A 2E2WA 4J16C 4AS3A 1NP6A 1OROA 2A33A 2XY4A 5IFLA 1F4LA 5ILOA 2VJAA 4IRXA 2D4HA 3IT1A 2ZSFA 5LDDC 2JI8A 1SCNE 2ZSAA 3ZDAA 3ELDA 4KO2S 3STYA 4US1R 5ELMA 3IVAA 4X8MA 5DEIA 5F5LA 4AZTA 1IN5A 3W2IA 5TPZD 5IPFA 1VB5A 3W5JA 4E5VA 5H9VA 4XEHA 3CB2A 3OQNA 3EFHA 1C29B 2QK4A 3A28A 1SBIA 2OHJA 3AUXA 1RM5A 3OQVA 3AVWA 3UNXA 1PFQA 5A5DA 3FCAA 1MNQA 4JP3A 2IHVA 1WZEA 4OB6A 3K6SA 4F2GA 1W19A 4PY2A 1GL3A 4LEIA 3W8EA 2MDTA 5IDVA 1H2AS 1PK3A 1QO9A 3I1IA 3G88A 3KTAA 1X1TA 4L9RA 3C28A 4ZAWA 1VKRA 2H54A 3RTCA 4BU1A 4QLBA 2W6PA 3SC2B 8ICKA 1Y4DE 3T3PB 2W93A 3E05A 3TGPA 4IHQA 2UXBB 1A27A 4ZO4A 5JXIA 4YCMA 1OZ0A 1AM4D 1UM9A 8ICRA 5FWDA 2ZBRA 3BMNA 4IJVA 1TK5A 2LPEA 1YH3A 2J6HA 4JXJA 4OQMA 4RD4A 3JQRA 3IP1A 4KQ2A 1AE1A 4N48A 4IQTA 3G9QA 1VE1A 2Z98A 1XQ1A 1OFGA 2ENWA 3IXQA 2YOHA 2K87A 4DOCA 2VNIA 1OJLA 3H4VA 1C3OA 4PZNA 2X6RA 1B00A 2P9JA 5ALEA 3FUXA 5AI9A 3LWMA 4KN9S 4WWHA 3R7WB 3H86A 4B87A 4F21A 3RNLA 4A8PA 2SCUB 2AHOB 5EE9A 3BE5A 2CFIA 4YRBA 4R7ZA 4US9A 1KMCA 2HMXA 1WCYA 2VA2A 1A0PA 3VYUB 3KOMA 5J4YA 2XH8A 1P5JA 2H3IA 2PBZA 5IC6A 1S8OA 3KLPX 3MMNA 3O2NA 5DGBA 4XH9B 3AXSA 3A4IA 5DOZA 1NJWA 2C88A 3T15A 5I9LA 4J3NA 4K6GA 1R8XA 3L41A 2Q4BA 1AOXA 4DS4A 4I55F 4CF5A 3H4TA 1G2QA 2FR8C 9ICAA 3NR2A 5DP2A 5JSZB 5AJWA 3UQ2A 3GFQA 5EZYF 3HB1A 3O84A 4O3FA 4IHKA 3L3FX 3AILA 4L50A 2IYWA 1KOJA 3WK9A 3VYWA 3VKHA 4UTOA 2W2KA 4P58A 1KYWA 3IE0A 3TLBA 4LDRA 1YKGA 3L82B 1ZJZA 4IFTA 1JAHA 4WMLA 3SAFA 3IEIA 3AIOA 2KVSA 1N1EA 2IYYA 4Z9XA 1MTZA 3UQYS 4HO1X 2M6KA 4IIGA 1EE1A 1A8PA 4JLOA 5DM70 1J7JA 3A6HA 5NULA 4GW3A 4M83A 1QMPA 2Y67A 1ECFA 6ABPA 4F45A 2JLCA 4L0CA 5E1DA 2H1HA 2Y1XA 3AL3A 1RCFA 3WICA 2CEKA 3GROA 3FHOA 5AVRA 1E2IA 4IVRA 1NY5A 3BSYA 1L5GB 4ZCPA 1TFRA 1LKYB 1A2OA 2DH5A 3HSSA 3H11B 4M36A 1FNBA 1B0AA 3NAMA 3O9ZA 3GP3A 4ELTA 2F3QA 3JQDA 2G17A 1HEIA 3OM0A 3U4QB 2ZIXB 1D9FA 3PT5A 2YHIB 3MJHA 4WK4B 1DFHA 1EZZA 4A9AA 4CMCA 3MGGA 3OZVA 4Y9RA 3MLBA 4S1PA 4IZHA 4L0QA 4HNUA 4MS3A 1KHTA 2RHTA 4TQUS 3U39A 3OICA 5CB4B 3C6KA 3ALRA 5DM1A 2OOKA 9ICCA 1K6EA 4DLRA 1VHLA 5LDHA 4BVKA 4N7JA 3N70A 4TKZA 1T0IA 3VZBA 7MHTA 5I4KA 4YAFA 1N2SA 4F5QA 2RLTA 2I4RA 2RKBA 4C05A 4ZZ3A 3FR7A 1Z2EA 3QI2A 2WHYA 4RY8A 1JX6A 2GRUA 2R6HA 4FWIB 2UV8A 3NVKI 2WU1A 1SIJA 1TJ5A 2JMGA 2ZR0A 5HS4A 1O0BA 1QFXA 3KZKA 4IOMA 5TS3A 4FQ5A 3VH1A 5J2GA 4GXQA 4D56A 1ZJ6A 4NAHA 4WFJA 2I3GA 4HWSA 2VBGA 4NL9C 4JKOA 3DOCA 2XEXA 5LZ9A 1JMKC 1O3YA 5CFQA 1IAQA 5ECWA 4O5EA 4LXQA 5LOVF 4R4JA 3R0QA 1W2HA 5JV5A 3ONVA 5CYGA 1E5DA 3EGDB 4C0AC 5AVUA 5AJXA 4FMCB 4G5QA 5H1YA 5CPFA 4EQ6B 2DUYA 2XIJA 2BDPA 2HJ9A 3G2PA 5JT1A 2HMUA 5HIAA 2LCFA 5IXYA 4YCNA 2OQIA 2FFBA 1MV8A 4RU1A 1ZK1A 3DYIA 4ZEVA 2ZRAA 4FYKA 5DIFA 3UXYA 3CF0A 1EFHA 2DF8A 2RHDA 4NLLA 4QOEA 4RQNA 2GZAA 4HQFA 4PHEA 2I7TA 1J22A 3L7OA 4HJRA 3VU9A 5JCZA 4LJ6A 1UMDB 4JB8A 1OILA 3KQSA 1GNPA 4L1KA 4UXJA 4MFFA 3NWPA 1RTTA 2ZM6B 4X7RA 4HFJA 3RQIA 4DMRA 3PUIA 5KTRA 4U39A 1U2GA 4PZOA 3GLRA 4PRKA 1L1EA 1F51E 4Y2SA 2JFFA 13PKA 1HYGA 3S8MA 4US0R 4Q7LA 2RHJA 3W9SA 3EWAA 4D41A 2IY9A 1POWA 9ICOA 4G97A 4HF7A 3LQ1A 3HA5A 4AWXA 5BOLA 1CBUA 3N6VA 4WFQA 2CVZA 2EVWX 3ADDA 2C61A 2IYFA 4D8VA 3KKKA 2R86A 4G0ZA 2F62A 3IUSA 3BAZA 5TDHA 3ZKAA 2CVHA 1LW7A 1DNPA 2NU6A 1RAIA 3R0IA 5AVVA 3OPNA 1T6ZA 7ICIA 1GEEA 3GLGE 3OPXA 3GOQA 1ISSA 3EPJA 4NY1A 2IHKA 3G2LA 4AUKA 2A88A 5ALZA 1RBYA 4YT4A 3T41A 3GRAA 4DFPA 1CETA 1U1CA 3VKVA 5DW0A 3SE0A 3WAGA 3TD9A 3K35A 1G55A 3RSCA 2I8AA 2YUTA 5C51B 3QE3A 4GC9A 2W4QA 3U7RA 3U4CA 1PW5A 3CUEF 1ZSNA 5C8YA 3NM6B 4ZMBA 4GT1A 3IUPA 4I3FA 3TSCA 4ATNA 1E0JA 4UVDA 3D0RA 1QYVA 2VK4A 2AQKA 1E5TA 1V9CA 4OHMA 5TVKA 4RD0A 4Y8VA 5T57A 4IDCA 2ZJ4A 2VQSA 1YRYE 4EKGA 2W42A 1TZ2A 3FDZA 2XNDD 3NFYA 4DBZA 3IELA 5KG2A 3L6EA 4O4IF 1EA7A 4BGEA 1UEXC 4R9RA 1P9WA 5L4SA 4GRIA 2JIRA 4CQMD 7GPBA 2WWXA 2WNHA 5FBQB 3RRXA 1UXKA 1YB1A 3MJEA 3UFBA 2MAXA 3E9RA 1M8GA 3FWPA 2WKSA 5KQMA 3DLAA 1GVNB 4XQEA 1AA6A 1ZQHA 5DHFA 2EJWA 3HQ4O 1S2DA 1PYDA 1WBBA 5GIPE 2O6HA 5AKYA 1ZQWA 1SEPA 1M2OB 2HO5A 4PXYA 3MJCA 1DLIA 1ZK4A 3R7AA 1W1WA 1KI6A 4DCTA 1YNSA 3FYCA 5GJBA 2C5HA 3TRKA 4CKWB 4EVIA 5CM8B 3A7DA 4JI5B 3GBSA 1XZKA 3QLTA 4QDOA 1MHPA 3BYZA 2QRKA 1RQXA 3TBHA 5IASA 1RKXA 1ZNXA 1CUFA 4P5PA 4QQ8A 2R7MA 5AK6A 1NW6A 1WXWA 1UZLA 1KSPA 3VGJA 1NXXA 3VNUA 5EYPB 1OBHA 4R6WA 1E9BA 4D8TA 4JLJA 2ZAYA 5CIQA 3ICVA 2HK8A 3W1VA 1VKHA 3NOVA 4C04A 1CQIB 3T9FA 3QI7A 5DM2A 4NCNA 2GYVA 4P8RA 1ZQYA 1NKSA 2PU5A 2XUQA 2JLWA 2K2WA 3GZJA 1SIBE 4RFLA 4DFMA 4DMLA 2ISOA 5L40A 1ESEA 3K2BA 3MFIA 4DFKA 1TE2A 4G1FA 5FFFA 5BMOA 3W04A 5BW8A 2C4UA 3F3MA 5GJWC 2DKNA 3OKAA 3PHJA 2JH9A 5KCMA 3JQ8B 5C5CA 2JARA 4MR8B 3IFSA 1GNRA 1F3LA 3SEZA 1JHAA 4MVJD 1SC6A 3EGWA 1TVEA 2OBYA 5LQDA 1DKLA 1UBFA 1WZ2A 1GARA 1ADGA 3Q88A 1NNSA 2FN7A 1L4EA 2VPPA 1XYGA 5DHRA 2FFQA 3VHXA 1NVEA 1KKMA 3HY6A 1FX0A 1KEUA 2HHSA 1E9EA 3Q6MA 3R41A 1SUFA 3CF2A 3SQWA 4B84A 5BPCA 1QOQB 2XOKA 2C78A 4P93A 3I45A 4TT3D 5IJZA 3C8ZA 2C94A 3BQ2A 2CNNA 4BMSA 1NF3A 2GF0A 1NMZA 1II0A 3N6XA 2OLJA 2ZTLA 1QHGA 4G0VA 3AYXB 3LLMA 4BMZA 3B8HA 3A9VA 4USAA 4AZ3A 4BB5A 2W9AA 1D2NA 4WOJA 2JEOA 4C89A 1VL6A 4NEQA 3AK4A 2IW3A 5INTA 3ZCVA 4ESVA 1XZ8A 1GA1A 2BM8A 4EFLA 4B31A 1FA9A 1LJ8A 1IN8A 4PVDA 2A1UB 4BXOB 4WBNB 1EKXA 4OU5A 3IMFA 2H00A 1BTOA 1XR3A 2VI5A 4ND1A 4IYRA 2P7HA 3Q85A 1JH8A 1V95A 3NHAA 4DVGA 2V6FA 3GT3A 4AULA 4DFDA 3EQ8A 4DC0A 3M1AA 4L7QA 2HZBA 3VJKA 4KVZA 1NVTA 4BDSA 3WYGA 4QHTA 4OUDA 1EHCA 1U0BB 3PC4A 2A1JA 2I71A 1BD3A 3MQ2A 2CLOB 4OJMX 4EW3A 3K96A 1M76A 4ESOA 2QPLA 4YDQA 4LOLA 4YT2A 3NWEA 2QARA 1TGYA 1TA0A 4U8HA 2GN0A 4QU5A 3SJBA 5AHOA 1CNEA 4IDOA 1U48A 1SVUA 1Z74A 1KI3A 1YA8A 1EHYA 1L5OA 1NV8A 1R18A 3IAM6 3WLAA 1GTJ1 4NRDA 4ZJUA 3HACA 2BBOA 5CWRA 1TPZA 1ORVA 4TV8F 4URVR 1I7NA 1PGOA 3NBAA 1ZMBA 5KAMA 4G1EB 2B5WA 1CZUA 1EFAA 3PW0A 4E07A 2K5UA 4QEDA 2LUOA 3VC3A 3U3KA 5JHHB 2XDQA 3FWNA 5BPHA 4UB3A 1CZRA 3GUVA 4RY0A 3GVCA 2EATA 4JXKA 3GGDA 4M9SA 3B0YA 1WXQA 4QYTA 5FPSA 1RWMA 1ULAA 1U0TA 5KKAA 3KOUA 1MQAA 2XUJA 1HNXB 3CGGA 1AKNA 1QTQA 5JBQA 2KP7A 2Z8ZA 1FU4A 4AB1A 2EGUA 3LY5A 2XECA 4QPDA 3J81j 4CM6A 3R5TA 3RVDA 1CUGA 1MXFA 2EV9A 1S1CA 4QUDA 4BLTA 3QZUA 4FZLA 5JAZA 1HG0A 3ZY3A 2XQVA 1V4VA 1IOLA 4TUPA 3BICA 1I33A 4DIUA 1MKYA 4UB2A 5THKA 4DV0B 5JG7A 1F6DA 3MWLA 5KFIA 1VCMA 3A58B 1L8AA 3HA3A 3ONNA 4TYWA 2P4EA 3FZYA 3JPPA 5C34B 4DV2B 1V85A 1GAWA 3N2YA 8ICHA 1HWYA 5BW4A 1E3SA 3DMTA 4Q4HB 3O8RA 3RS8A 3K8QA 3EEFA 3O4FA 2XCIA 1W47A 4CQNA 4N3GA 1N2JA 3K0HA 4BATA 1BKSB 4KDCA 3MUFA 4D98A 1WF3A 2Z4SA 5DB4A 1EDBA 1NJGA 4UPDA 3QUTA 4QWAA 4B6JA 3FJ1A 2O54A 1MJHA 5IABA 5FWNA 4FCCA 2YVLA 2R87A 2B1GA 1QZZA 2JGMA 1FB5A 3Q3EA 2REBA 3PC6A 3QEMB 1TUEA 5D46A 1C0EA 4WESB 3H65A 3IOMA 1T9DA 4AF8A 3A6LA 3RJKA 5AO9A 3PQ8A 2VDLB 4DA7A 3FDSA 1ZQAA 1SUIA 2E9SA 1NONA 1S2NA 4GECA 1A5ZA 4GVLA 2B25A 2Y2UA 2CLLB 1XO1A 5K45A 3ZDQA 1EWKA 4J29A 4BFCA 2WSIA 1HDRA 3HXOA 1W4BA 4L5IA 2YW9A 3BJMA 4H1HA 3DBHA 4TWIA 1P39A 5KAIU 2G08A 5HG0A 4AUNA 5I7RA 5ETJA 2KQUA 3R3ZA 2E6KA 2DPMA 1FBNA 4Q9DA 2QTMA 3O92A 1JEDA 4UCQA 2X9NA 3D59A 4GM4A 1JLKA 3PNMA 4C8NA 1GQYA 1DJMA 4GP6A 3IN5A 1CD5A 5AJHA 1L7AA 3MUNA 3QBTA 4R8UA 4QXAA 1V4BA 1Y3FE 4CM8B 1ZQIA 1DCKA 4DR6B 4M2LA 3UMFA 4F0JA 4FR5A 2H65A 2VSNA 1O6GA 4J7CA 1HGXA 4O25A 3X1MA 2VSXA 3BC1A 4U7HA 1UM8A 2EP8A 2N3ZA 3E9YA 3FNEA 4QNRA 3TYXA 5G2OA 1QAOA 3ETGA 4MQEA 5DB8A 2WOOA 4MO2A 1WDTA 1G6Q1 5HJ7A 2G4VA 4ND3A 1KGDA 3PK0A 2BGGA 3QWFA 3M33A 3G8BA 2LR0A 2JJ2A 4IDAA 1CRPA 1PUIA 3QVJA 4DBLE 1E9VA 4QD3A 3DMFA 1US8A 5DXJA 2Z2KA 4RMHA 3SFTA 1RPJA 3LC1O 3WMXA 4CIVA 2D3WA 1UXGA 2QE7A 3AF3A 1E32A 4H7EA 2PKWA 4F3YA 3AX6A 1JE0A 2NO0A 3OTWA 3PENA 2WDPA 2G07A 3IPXA 2F77X 4Z4QA 4EG8A 2FF5A 1GGHA 3KQLA 2LM4A 3TRIA 5CYOA 2F48A 1SV0A 3OO0A 2I91A 4AMUA 1KOGA 1FXWF 4PGXA 4OHWA 1TKAA 1BW9A 3QTBA 5KFDA 3K9BA 5LBUA 2QTNA 1VFNA 1O5TA 4KAJA 3AR2A 3B2EA 5AI0A 1CZKA 4BVGA 2TMDA 4R01A 3KOOA 3EXHB 3I2IA 4MWOA 1JB9A 4BJ6A 1T9GR 4DMMA 1BYUA 3P0HA 5KT2A 1KH2A 4AW9A 2BBSA 2UVRA 1TZMA 3DA8A 2DZDA 2VJMA 2ASVA 5GJCA 1TM4E 2AG8A 1MA3A 5K3AA 1JQBA 1PN3A 1GSAA 4C1NA 2VDQB 3DWGA 4KLIA 3ZK7A 3ZBUA 2CLSA 3WGZA 3ULKA 3OJEA 4NF2A 3TN7A 4CW7A 3TACB 4YFYA 2FK7A 3CUKA 2P9QA 3ZD9A 2R62A 5BN3A 3O75A 5A3VA 1XZGA 3PICA 1O95A 5J40A 4V38A 2PTHA 2OAP1 1EAMA 3EQZA 1JFTA 4I8IA 3UICA 5JAOA 3B1XA 4ZKEA 4KC0A 3L7JA 3K09C 3ITKA 4DXDA 2GXSA 1UFQA 4FQ8A 4ENUA 2NTJA 5JADA 2EYQA 1DC7A 1M6WA 1S0OA 4M0CA 2HB6A 3B8EA 3JWGA 1QOZA 2HBRA 2A9VA 1HTBA 5JLJA 4I66A 4EHJA 3PXEA 3KQKA 2SECE 3TNJA 3RJHA 4O2LA 3CIOA 4LHZA 2PGOA 5AVOA 1ZP6A 1F0MA 1GXSA 3C41J 5I7FA 2PRIA 2AZXA 5L3QA 4TTAA 4QZBA 2JLVA 4GGOA 1V4NA 1BCSB 4CCWA 4UU7A 3C6XA 1ZYQA 4MIOA 2G82A 4RPIA 2FX3A 2O7VA 1BVHA 4KDRA 4KXYA 2C4WA 1ZJYA 3ZE1B 4EOGA 4DIOA 3TAUA 5CFOA 1MV5A 2UVQA 4B71A 2C29D 2QYOA 1W36D 4RJTA 3P9XA 1ZQRA 2C04A 3GZTB 5AKIA 1EGHA 2WPNA 4XRHA 1XHLA 2W2QA 3GUCA 3B7WA 4RPLA 1EFVA 2XY5A 3TBKA 1SGGA 1IWPB 1YL6A 2A0YA 5A5FA 2PUGA 1GTZA 2V4RA 3O2SB 3KJHA 3ND9A 3TCXB 4REQA 2IYEA 3T1VA 3DF7A 4K6MA 1XI2A 3V48A 4YN3A 5KFZA 2B37A 3HXTA 4QJIA 2ZBVA 1D8TA 1DAEA 1NBWB 3EUAA 1Z6TA 1OZAA 4E13A 1NF2A 2OXFA 4HFNA 3MD9A 1G5QA 3AZPA 4N3BA 3CYMA 4LZPA 4Q9AA 5EIXA 1KYIA 4BDTA 3ROKA 5ADHA 1MX1A 3MTJA 3RJJA 1N2EA 1NFQA 5TMEA 1B42A 4R8SA 4DRXB 2DHEA 1ARZA 1CFJA 2Z2JA 1NATA 3VR6A 3AVOA 1YJCA 3OECA 1ZQZA 1IFXA 1VDVA 1RRKA 4HRYA 4E4TA 4B4DA 5IZ4A 2NUAA 3ZV7A 1AVTA 1UPCA 4QZAA 4QZDA 2K4IA 1I1QB 5EJ8A 2P2GA 3GCXA 1O97D 3TZQA 1D1QA 1PJZA 1SXGA 4LVOA 1NULA 4EKEA 2H3HA 2JLQA 1E1RA 3WLPA 4QGGA 3REOA 4LK2A 4BMNA 1U0SY 3D3WB 4YMOA 3OC6A 1WTAA 2JGAA 4CEJA 1YS1X 1Z68A 2FWJA 2JAXA 4RIEA 2HJWA 2OORC 4RQ6A 1ZI9A 5IULC 2B1RA 2R7LA 3JWEA 4YUYA 1D8LA 2WE7A 1KDTA 4XGNA 3MXOA 2A5YB 2ORIA 3M5CA 3OZBA 3HU1A 4NBRA 3KTFA 1ZGHA 4ZVVA 2J45A 4TLCA 3BMQB 1W0KD 3UYKA 1X7ZA 4KN6A 3T4XA 3U9LA 4G5GA 3BHNA 3UT5B 4LMAA 4QU8A 2R8YA 1HE5A 1NAHA 3W5SA 2HBZA 5KG5A 1VMEA 3QFSA 2E55A 1V37A 5I4BA 2YIJA 7REQB 1DK2A 1A1SA 4FLEA 5BSWA 2QRPA 2C5AA 4NPCA 3S99A 4D82A 2QAGB 2BGMA 5AVYA 2VKQA 1M0SA 1SKWA 1G2IA 1QSLA 1VG1A 3AM5A 4TQ9A 4UBMA 2PLNA 3A25A 1AHPA 1KDRA 2Q8QA 4MKZA 4BO5A 4PCVA 1LY1A 5LZ4A 3L4PA 4G65A 5A6SB 4D25A 4BZZA 1CY8A 2FPXA 4IEEA 1WS6A 5DV9A 5FUBA 1FNDA 1QG6A 4IXMA 1DC6A 2EJBA 2DPHA 1TF5A 5SICE 3ABQB 1WQ4A 3CFYA 1YR8A 1N5KA 3UWDA 1IVSA 4NHEA 4ARVA 4W5JA 1JIQA 4PR3A 4KMOA 2ZYAA 4P0PA 4RGVA 5I7EA 2D8CA 1F9EA 3KHGA 1H0HA 1YAJA 1GFWA 2X0JA 4MJLA 2L5YA 1TNDA 2EW1A 2VK1A 2JAHA 1P44A 2O48X 3FFWA 4UE6A 2G9UA 2TMYA 3GGCA 4HADA 5EINA 4NCJA 2C5GA 5AHKA 1H2ZA 2PHZA 3AKDA 5JNWA 2AI2A 4TQGA 5JW6A 3KDSE 4ZMRA 4BWJA 3UGTA 4ZGBA 1XAGA 1R5NA 4QUAA 4Y2JA 4URUR 1E6EA 5KFHA 2PYZA 5FAKA 1U94A 2ZXHA 4BX3A 3DDUA 3T54A 1ZRSA 1KJWA 1M6NA 2JFUA 1ZIOA 4HDCA 2VYVA 7ICRA 1EFDN 4GOND 4CE6A 2I4TA 1A5AB 4D9HA 4DA8A 3MIIA 2YIMA 1LPSA 2XUZA 3FPAA 1EWQA 4JR0A 4OOEA 4K9MA 5CW2A 2RGUA 2FWMX 1RZ3A 1OB2A 3MT7A 1M75A 5HIJA 1N1DA 3O4VA 4JUFA 4BZWA 3GCZA 3LBNA 5K01A 3ZDXB 4EYKA 5CNJA 4EJSB 3QNUA 5FOVA 2FR8A 2H0QA 1GLVA 4M1MA 3NMUF 3N0WA 2UYYA 3OT1B 2XKBA 3U3DA 3WYFA 1TM3E 5AW0A 1QLJA 1T2DA 1WL8A 1SBTA 1E79D 2Z83A 4J75A 2VDWA 3JRNA 1G0NA 2IDMA 3UWPA 2G71A 1U31A 3M4XA 5KJCA 1J24A 3EZ9A 3CT4A 3B6EA 4K4HA 2XZLA 5ELLA 2Q5OA 2J7PA 2J5KA 3AQIA 1UK6A 2Q46A 4RTOA 1MABB 3TARA 1ZNZA 5DX0A 1QNLA 2ABWA 2QW1A 3GLGA 1J23A 3ISVA 4GVXA 1BD4A 3WL4A 5KT5A 4DADA 2ZIWB 2JLSA 4BUZA 4URXR 1HXHA 2IOYA 1Y6QA 3TJZA 1GNTA 5KIAA 5IDXA 5CT5A 3V4VB 3ILYA 1HLFA 1FFDA 3KQUA 3AHGA 3KZIU 5ITZB 4ZPXA 3WO1A 2ZDHA 1KAEA 3NHYA 4P5EA 3AEUB 4F6RA 1GSIA 4FWBA 1W5SA 2VDPB 4K05A 4B47A 4FOPA 4BE9A 3O3MB 5EWMB 4F86A 4N3CA 4OJLA 3DTVB 1XXHA 2JLYA 5KINB 2WTAA 4HWTA 3NETA 3V4SA 5CGZA 5SYMA 4BIIA 3X1JA 4UULA 5E2BA 4YCAA 5BYJA 1IZZA 1L4GA 1NYLA 5LP6B 4K88A 4C0LA 2UVUA 2PMFA 4FJ2A 2Q3DA 3H1EA 1LF0A 2RHHA 4X91A 1PDWA 4Q3EA 3NVZA 2QG9A 1GQFA 3D6HA 1EE2A 1ZL0A 3JZDA 3KQNA 1O1YA 5EUCA 3KZNA 4P0QB 1DXSA 3O5AA 4K4GA 5KWSA 2C5LA 4WUTA 1D4FA 1KSJA 5A5EA 1I14A 1GRQA 1FTNA 4MR7A 5J0SA 2PJDA 2VHCA 1WU7A 5J0QA 1K8ZB 4Y1RA 2GN9A 5B7NA 4Z49A 4QYXA 1ES9A 2AOXA 3ROZA 3ASZA 4AKHA 2FNAA 3G0CA 1TVKA 4TZKA 3VZCA 4PBSA 1YDMA 2FMTA 4IIVA 3HJEA 3G2OA 1NQOA 4CCYA 1T0BA 4ISBA 4PSDA 3IR7A 3REQA 4LYAA 3AU9A 1Q2XA 3P27A 4E94A 2JIQA 3ZE7A 1SIWA 4NL9A 1R27A 3NHLA 2E49A 1F2UA 1VOTA 4RZSA 1QIHA 3VVCA 4UFPA 3B9QA 4CTNA 4QREA 1SUCA 5LQKA 3T4UA 2W6IA 5A6VA 4GOXA 3SZRA 1JEAA 3PJRA 4FGLA 2QXUA 1F0YA 3ZOKA 4DOAA 1L6RA 3W8DA 3QVLA 4YX9A 1QHFA 4NL4H 3ZH9B 3J81A 4K6KA 4ZVSA 4K9PA 1NX6A 3TOCA 3L7CA 4U7WA 3I37X 2I2WA 1O9GA 4IQFA 1XTBA 1X2BA 3PIIA 3W77A 1TJNA 1Z7YA 3H84A 1QTMA 2YCBA 5A04A 1MIOB 3F2DA 4S24A 2I9PA 1NUPA 5MGBA 4OK6A 2OBMA 4PO9A 4HNVA 1EBBA 4BX8A 1EUCB 2ASEA 2Z3VA 4IHJB 4RGQA 3H9QA 2ZREA 2VA9A 2ZPTX 4Z0HO 2XODA 3RC9A 5SZJA 5LKRA 5LIPA 4ITUA 2AUMA 1MEOA 5IJ0A 3MGHA 4H1UA 2CLCX 5FBWB 4YP9A 1HIWA 2QBYB 4YAUA 1WEKA 1NW9B 4OY3A 2XGMA 5DGIA 1WB9A 3AERB 3AIMA 4M1QA 3ZI7A 3EIQA 5C5EA 4CT4B 3O83A 4ZYWA 1W34A 2O3TA 2O23A 3H1PA 3PQCA 1URPA 1ECLA 3KD2A 4J1SA 3W3AH 3TFQA 1PZHA 5BSHA 5L3RA 3PSFA 3PEVA 4PYLA 4GDFA 1T5TA 2XWJI 1O89A 3WZ2A 4FYHA 5BV8A 2Z58A 2P3OA 3FNRA 5C81A 2RBKA 3IVXA 4QIWF 2IHJA 1ADFA 3A1CA 4BLQA 1H2WA 2L69A 5KQLA 4TLMB 1USIA 2DVMA 2V97A 1G2OA 2HFJA 4CN8A 3L8YA 2DQKA 2WIDA 2J6UA 5DM0A 5ALRA 5DHQA 2BCVA 3CVVA 2WD9A 1GKYA 3Q2IA 3NG1A 2W8BB 4RMIA 4Z1MD 5J0TA 4KGZA 3DEJA 2VHXA 2IS4A 4C5BA 1JLSA 1PFYA 2KJQA 1S02A 4TLLB 3OQIB 3QKUA 5AVTA 1I7PA 1SUDA 1XSPA 1U0OC 5EEHA 2DT5A 1NYQA 4YEDA 5TE9A 3G89A 2C4VA 4JHLA 4WLUA 1FFYA 1XVTA 4RORA 2CNBA 2VJPA 3TD2A 1RVV1 3QMMA 1ZSYA 2I65A 2P4QA 1PJSA 3WBKA 2QF7A 3N5CA 2J87A 4BTEA 2ODWA 1NMEA 3FHTA 5U9CA 3EXHC 1EFRA 3CRNA 4YAKA 1QVAA 1G4AE 2PFOA 1XZIA 3CLTC 5GTIU 3DHNA 1W29A 1NKCA 4LCJA 3AJAA 1D6NA 3DAHA 4IDHA 1UOQA 4M8SA 3RYIA 1NXVA 1JLMA 4E5UA 5AUOB 4DWJA 2FKAA 4TSRA 5KFQA 5JJ5A 3ZKWB 4LBWA 3W4JA 2ECPA 1UOEA 5JSUA 5IK2D 1L8QA 4QUHA 1QAQA 1W85B 4ZH4A 1XTPA 1ZN2A 4AJHA 3WKAA 2P2CA 3PFHA 2G4LA 2O3SA 2I5PO 3IOBA 5G3ZA 5JMTA 5LFAA 3OQ6A 2ATEA 2PV0A 3D2SA 1UEIA 1F7VA 3BXGA 3PVXA 3LY7A 3OX3A 4I9GA 3L8HA 3CG0A 5HMMA 1U47A 4IMPA 1ZH0A 4MQBA 1Z00B 1DTWB 4DWVA 2BVNA 4NH0A 4M7RA 4B3FX 1WSDA 1KPHA 3P9SA 4LSWA 2A5GA 1OE0A 3SP1A 1N5JA 1UXHA 1IG3A 4MVJH 4X1KA 3GAZA 2GYUA 1MT0A 4B4WA 3HJAA 1M10A 2ZI6A 5DG7A 3V8VA 2JR5A 2YTZA 2QSZA 1M34B 2VYQA 2Y6VA 4U2FA 4F5WA 1JIXA 3PW2A 1G3UA 4HLUC 1V1JA 3UAOA 1RJEA 1JXAA 4WTOA 1P7PA 1OAAA 3INYA 5JSKA 4F2DA 4MWBA 1Q0TA 5FTJA 4ZJZA 4ARAA 3SEIA 3EAGA 5A1JA 3RK0A 1NQXA 4MS1A 3M8RA 1LRLA 3JU3A 3H42B 2BDEA 1HT3A 4D4JA 2ZXIA 1GUFA 2BTQA 4GMDA 2A94A 3NIFB 2FF7A 2O8VA 5L4LA 4DA4A 5AI5A 4E33A 1RQPA 3BIJA 1U7WA 5DJ5A 1QQTA 4MWZA 4B6SA 2EDCA 1LK0A 3T79A 5B4UA 1UANA 1YK1A 8ICZA 5KKCA 4YP5A 3KV3O 3SV4A 4WVLA 2PH5A 1NDHA 1XTQA 1E0SA 3DJFA 2X5XA 4OUKX 5EJMA 4XYEA 2PUFA 3ILXA 1BPXA 4G9BA 1XUOA 1HTTA 3KT8A 1CZLA 4ETWA 2FPRA 1J6UA 1ZQSA 2PWPA 1QNFA 2GS9A 3JWPA 1OZGA 4F8JA 2PD6A 5AOAA 4MRVA 2CLHB 4BN4A 4BMPB 3AEZA 3LA8A 2GUGA 3K0EA 1CJBA 2Q6VA 1X7GA 1GCOA 4EA7A 3Q3HA 2V59A 1O58A 5B58T 4O4LB 3FVVA 1CIPA 4QFDA 1E6LA 3RB0A 4S1WA 4UVHA 1DOHA 3Q3IA 3BMCA 1YVEI 3T5MA 2GESA 2HAEA 1ZGZA 5CFZA 3JVDA 3C24A 4I50A 5JBNA 3CHYA 4MW9A 4LRSB 3ETLA 2ERXA 2RAFA 5K2MA 2QEQA 3O9VA 4C2AA 2CXSA 2WKRA 4PLTA 3EGVA 4P2GA 4YJFB 1U28C 1ZRMA 3QRWA 3RAEC 4GX2A 1CLUA 3NYWA 5JVDB 3PFFA 3MGKA 4BFTA 3IKVA 2OCEA 4ZEOA 3U37A 3AVUA 2J07A 2R60A 1XNRB 4ENPA 4WXEA 2AKEA 4JY7A 4FUQA 3BDVA 4CDNA 3FMVA 1LPOA 3FTPA 2J6CA 4BX2A 1PR3A 1Q1QA 5EN4A 2C1XA 1R9JA 2R44A 3SHVA 5LQSA 3AY7A 4UVEA 2XUGA 3H2GA 5EI5A 2ZJ7A 1L6IA 5AIAA 1AZWA 4L3VA 4A8JB 4MAFA 4DLXA 1MB0A 4R83A 2O59A 4UQGA 5IT9A 3I32A 1RRVA 2HSWA 2NX2A 1O6BA 1ZAYA 1U04A 3N2IA 3SEQA 2GD1O 2E21A 5IG2A 3LT0A 3I30X 4RQ5A 2VJBA 3ADCA 3R3WA 1KETA 2NUBA 2V55B 4NBLA 4W6ZA 3PJFA 3MFYA 4OJYA 4JP1A 3HB4X 5I8ZA 5M2QA 1EFKA 4JGIA 4LX8A 2BSAA 2PAAA 2V7PA 2JCBA 3ERCA 4KE9A 4OSEA 4UM8B 1MORA 4HXFB 3HCBA 4PSCA 3UN1A 1C1XA 4RH3A 2X8JB 4XWGA 1GQ2A 1UXOA 5JI2E 2FWNA 4YBZA 3NHUA 4KBYA 4KSBA 4KLRA 1P0FA 4YPOA 3CR7A 1KYTA 3CW8X 1VSQA 2QI9C 1RXCA 1X14A 4M2YA 5MN6A 3BHIA 3UO8B 1Y48E 4CEHA 4GHWA 1JEQA 2K2QB 3EDQA 1YJAA 2Z8XA 4Q8EA 4R84A 3PO4A 2LKCA 4BN0A 1AA9A 9ATCA 2MSWA 4BRUA 2FPUA 4C7KA 4XEUA 4ER3A 2YMQA 2HOFA 1BMTA 1MQ9A 3R5SA 4P4MA 4NCBA 4QUBA 4IXTA 3B6MA 1N8KA 2BWJA 1DXHA 3DTTA 4YB8A 4X60A 1LDEA 1TT5A 1KA9H 2OWEA 4J03A 1N6RA 1V5EA 3GLIB 3PNSA 3FLBA 1ECCA 3M6FA 1J8FA 1V9PA 3I0ZA 2PSJA 3EC7A 1M7HA 3FMOB 3BHJA 2V7GA 3I34X 4II3A 5AM0A 5EIHA 1IQUA 3O1HB 1I6WA 1WHTB 4AJKA 1QHNA 3MJDA 3UMSA 3DV2A 3MTBA 1EYZA 4TN1A 2VWGA 2GCGA 4EJSC 4ESEA 2C4NA 3JYOA 1G41A 4XUCA 4DJJA 3VAAA 4UTZA 3CW2C 3QE0A 3SLGA 1BEEA 2GSWA 3IQWA 3ZJVA 3EWNA 3HTXA 4YACA 3ILHA 5DBCA 1XRSB 1F1BA 3O74A 5BWMA 3G7SA 5GADl 4R2KA 1NLZA 3HZOA 2OAEA 3I04M 1ZQKA 1PP4A 4EG3A 2YMPA 1IQPA 3KZMA 1N7JA 2JS7A 4QXOA 2XQKA 1TLTA 3GZ4A 1L4LA 5KFBA 2NVOA 3LW7A 4M1OA 4HGZA 5BYAA 4JN6B 2P79A 1KORA 3CPJB 4IGAA 4UATA 3PVCA 4JZYA 1MVOA 3UHPA 2F8KA 2KV2A 1VG0B 2C00A 3IO5A 3BIWA 5IDYA 4AJPA 5EP4A 3R44A 5I7HA 4PC1A 3D2QA 1NHWA 4HTFA 4ONEA 1I7DA 4EFMA 5EWLB 1UWCA 1E66A 1BRTA 1CDDA 4DBVO 4LXXA 4CG2A 2QL5A 3LECA 2VATA 1SWVA 4QATA 3LTNC 1IHOA 2BKVA 1GPAA 3IXLA 1XDBA 4AECA 2Q5IA 5HIIA 5TMBA 5HF9A 1LKYA 4FE7A 2GAJA 3H11A 4HDRB 3X1KA 3AXTA 1TKDA 4KXUA 4RWEA 3GJ5A 3GMIA 1RRMA 4L6AA 4HGYA 5KQRA 2QM8A 3D3QA 3AJ9A 2ACWA 3OCXA 3JQ6A 4BVHA 5J2TF 4YQZA 3R0JA 4EPXA 5LMZA 4UAZA 2FE1A 2Q3FA 4E15A 5LQCA 2PUEA 4RF2A 821PA 1G2PA 3E9NA 1PRYA 2X42A 4F4YA 1MO5A 4ZHQB 1VRVA 4ESHA 2CNWD 4AYBF 4NM2A 1NQVA 1JBKA 3JARB 1A5BB 1UJNA 2GDZA 4L5JA 1TAQA 7ICPA 1ZPDA 4MV8A 2ZZNA 1HZZC 4HGNA 2NUPA 4X84A 4MV9A 2ORWA 4L22A 3GQVA 1J21A 3IIJA 4HZIA 3LLUA 2PUJA 3SHTA 2GCPA 1LI7A 4RQ3A 4J90A 5HUJA 2Z1NA 5G0VA 2QMUA 3HDTA 3AR6A 4E09A 4QDUA 3S55A 1MDBA 1K66A 5KU1A 2K4EA 4UD2A 1ZA1A 4EPVA 4MVJF 3WL7A 4G0PA 1TMKA 1B23P 3WGIA 1ENPA 2G1UA 4AKSA 1VLLA 2KHQA 3ESYA 5CDHA 5AVXA 3EGDA 4LJAA 3IUMA 4CTOA 2QP3A 4HOYA 4DB2A 2DPJA 1DARA 4HSGA 1QP0A 1Z4PX 4GI2A 3B20A 2IUEA 2MCFA 4N5IX 4LHEA 4RLSA 1MSWD 2C57A 3LPDA 2HRCA 4FBGA 5G4KA 2VAXA 4ZGGA 4KBGA 3LUPA 3ZV3A 1JG3A 3IIIA 1DTSA 2I1LA 4ZDWA 4EHFA 5TQ2A 4EO4A 5CJPA 4N7RA 4XWYA 3SCZA 5A9SA 3K09A 1GZ5A 1WXFA 5BR1A 3UAZA 3TXXA 2LRHA 4M9ZA 3Q1KA 1XP5A 2P5SA 3LDHA 1MH9A 2QYHA 5THXA 4BFLA 4Q93A 4RABA 3N87A 2YKGA 4TTIA 1IHUA 1VXOA 4EELA 2QX9A 2FVYA 2F8MA 5FTKA 4BJ1A 4FILA 4DJEC 3TNDA 1UMBA 1AKYA 1RHKA 2CDNA 3RM3A 3RVSA 5DSTA 1QRSA 2WC1A 3KB1A 3P19A 1JIIA 5L53A 4I1UA 1Q44A 2PMKA 3DG9A 2O0MA 4GQAA 4D5EA 4RFVA 2RCYA 3ME5A 1YQDA 1HSOA 4PHHA 3IPLA 8ICLA 4Q66C 3UPDA 3EIXA 4W5QA 1Y33E 4MUYA 3NC1C 2XMBA 3L01A 1FLVA 1L5ZA 4IXNA 5ADVA 3U7QA 1R6XA 5E9QA 4UW9A 4O3PA 1Z47A 4MRSA 1DMRA 1MO3A 5HKAA 2R6DA 5IC4A 3VR5D 7ICFA 1E89A 1L3SA 4GPD1 1D2AA 4O4HB 1MGPA 3TM4A 1H22A 1YFZA 2HRZA 3QIAA 3ED1A 1XA4A 3RJTA 1SG9A 3EGIA 3CVWA 8ICUA 4LOJA 4CVNA 3VQTA 5J1TB 2IDJA 5JTUA 2DQ4A 3I42A 5DQGA 3GT7A 3T3GA 2CXXA 5KNCH 3VJLA 2WUDA 4IJKA 1K0UA 4R9NA 1GPKA 3ETHA 1HE2A 4X0EA 4J0KA 4QHSA 2WU0A 5H5JA 3KXDA 1WB6A 4KMRA 4JUDX 2R25B 4TVSA 1RC0A 4OJ5A 5L3ZA 3BMXA 4AO8A 2H4XA 3M4NA 2J5BA 4DOMA 4D79A 1UADA 3SEFA 3JPRA 3PT9A 2PUBA 5ICSA 2H3EA 4PZZA 4KREA 1A9OA 4QM6A 4D9IA 4K9DA 5FT9A 4J4HA 4R1NA 1CYDA 1MOZA 3AZOA 4L73A 1P6XA 4K8OA 2QXYA 1NZFA 2A1AA 2NO6A 3ER9A 5L9XA 5LZ5A 3IUYA 2ODAA 5B4TA 1E4OA 2BUAA 4J6EA 4MUAA 2WAAA 2D0DA 5K6AC 2QPOA 2R85A 2EJCA 4KN5A 1V39A 2IZOA 1BDBA 4C8OA 4WZBB 1JTFA 1ZG3A 221PA 1FFAA 4DSKA 4GXTA 2ECFA 4D80A 2WJGA 4TX1A 4CZ2A 2KZZA 3TTXA 5HZMA 3A1TA 2BGRA 3BA6A 4I27A 3FYDA 4DBLC 1C7FA 4I1RA 5I9TA 4NHOA 3RYTC 4RANA 1TXGA 1P3JA 4AWBA 5KX5F 3AVXA 2FDRA 3SYNA 3T8YA 3B7GA 2E6UX 3B1YA 3OETA 4MYDA 3G82C 4NG5A 2QLJA 4J2HA 2X9QA 3EC2A 1X2IA 2RIRA 4U7GA 2ZE5A 1R6TA 2A9PA 2HH9A 1BX1A 2OORA 2P41A 3UKJA 3IR6A 3PDUA 1P0MA 2E4UA 1U5AA 1FLNA 4C0WA 1EQAA 4Q4CA 2ZRNA 4D5GA 4UQLA 2HM7A 4MVJP 5DP1A 1GA4A 4Q02A 4F5NA 1HEKA 5LYJB 5I9SA 4PHFA 3W5CA 1F0NA 1W8IA 3NIWA 4MA0A 3SWWA 1GP2A 2V4MA 2ACEA 2RRDA 3TIGA 3ZK8A 1U3CA 3THXA 3M1LA 1GGMA 1VP9A 3F8TA 2DHCA 2AQ0A 5J0XA 2V98A 3VZRA 2A9FA 4HH4A 3OE7A 2AVNA 4NAUA 3RJZA 1FP7A 3MVEA 2FWPA 2AEJA 4INPA 4RTLA 4KLNA 5F7JA 1X13A 5HBGA 3OMWA 3ZE6A 1GOTA 2G5TA 2ZIZA 3NBFA 1NHGA 2AN4A 3WFJA 3WZLA 4YR7A 3MA0A 3A4TA 4D3ZA 3PFIA 1SC4A 4V3CA 4JLNA 4CKEB 3ZHCA 2HSGA 2R5FA 1ZM2A 2DBVO 3AFIA 3U60B 4UUNA 3GUZA 3EXEA 1JZTA 1YVDA 4XPIA 2IKSA 4K46A 2ZJ0A 3IUNA 3QHPA 4DL5A 2V3CC 5BN5A 3F0TA 1O08A 4DWIA 5EJ7A 5IH3A 1SM4A 4KLDA 1BWRA 1PWXA 5E9WA 3AW8A 1TK2A 4M21A 1CNFA 4CV1A 2O8EB 2QA5A 1P7CA 3NFRA 1L5MA 5KFUA 5AIBA 1P9OA 3GEPA 4POAA 5CD9A 3LUGA 2FJPA 3O2JA 3K9CA 5JECA 2CFRA 4J94A 5GPBA 4PRLA 2P3SA 4FKZA 1U6IA 3WFZA 4NENA 4PPGA 4QGAA 1F8YA 1Z35A 2CMGA 3B1JA 1L3IA 1NXTA 1HLGA 5E6RA 1LS1A 2PCLA 1T6NA 1BO6A 4EUFA 1KAOA 3PKJA 4I4NA 5HXAA 5HS6A 1SL2A 1OT5A 4HUQB 4JBLA 3G49A 2G5PA 3ET4A 1NM5C 5C9ZA 2VSOA 5TPWB 3UMBA 3WV5A 2DY1A 4HLNA 3DL4A 4QOGA 4HEA1 1ZQCA 1E2UA 1VJRA 3QY0A 3EH2A 4WGFA 2HV9A 1C1DB 2VJ4A 4WOBA 3ZJYA 4EW6A 2YRWA 2B1QA 5BYKA 5F23A 3HKZC 1WWVA 4GI7A 3E5RA 3QKRB 4ROTA 4MR9B 1B74A 4M60A 1MJNA 4AIIA 4W5TA 4X9XA 1Y4ZA 3C5VA 2ZCUA 2QRZA 5IAGA 4P4GA 2YQZA 5J9FA 3K5WA 1RFLA 3ORYA 1P0IA 3H2HA 1KEWA 4MP6A 2HOQA 4W1SA 1MG0A 1JHOA 3HRDD 2MSKA 5T67A 1ZD8A 2IYZA 1Z0AA 2CL5A 4R3WA 4J9KA 4RQ2A 3WV4A 4K9NA 1MENA 2AFIB 1J8DA 1RWOA 4BB9A 4AD8A 2B6HA 2E5WA 1TK3A 1E3WB 3WX0A 4HV4A 2DFVA 3NBZC 4YJDA 1FC0A 4IBOA 4JL8A 4PLGA 1BS1A 1PUZA 3OIFA 4TLBA 1GTL1 4TYMA 4TM8A 1T35A 1YL7A 2QZ4A 1GVHA 1TV9A 4D42A 3NS1A 2VYCA 1JQDA 3PC7A 2GVDC 5KVVA 1J4AA 1FDOA 3FA2A 1ISRA 1T3SA 2QW0X 4JQZA 3THWA 4ASUD 1E99A 4DOBA 3OFJA 3Q9LA 3A3PA 4MGKR 4DMKA 1M34E 6GPBA 1TD1A 4BASA 4YVFA 4QDKA 4ZI7A 1IQRA 3NHJA 3O8OB 5LKAA 3UC5A 2IW1A 3THRA 3EE6A 5IEJA 2NN3C 4EB3A 1XD2B 1K7CA 4XM2A 4XCQA 1AXEA 3AWIA 1KFDA 4XA5A 5EMJA 2DFPA 5K99A 1JI7A 1A9XB 1BFDA 1PTJC 3SZ2A 4PSVA 3WGLA 5LPNA 4JVLA 3MRSA 4DKJA 1OYOA 2RMKA 3CZ5A 4H1WA 1OFUA 1QQ6A 3SF8B 4LZAA 3TZLA 4BFZA 1C4XA 5EESA 4CKCA 3BRSA 5ICGA 5KBYA 4GMFA 1BEZA 3H5IA 1DKRA 3HABA 2D2IA 3DBLB 3C5WP 4GXIA 2EJVA 4RCZA 2BI8A 2IWRA 2D1SA 5FLXA 4UBKA 2H85A 1ISMA 3AKCA 4AFNA 4PYKA 1X92A 1GNVA 2P4SA 2PX6A 5IKOA 4ZFNA 5AK0A 1NRWA 1G8SA 2ZRDA 2GOYA 2VZLA 2OHXA 4HNAA 4Q05A 4YRRA 2V4UA 2F8LA 1H4QA 3IH5A 2PH1A 4JQSA 1XSLA 2PWZA 3UYLA 4BLUA 2BQ3A 3DZ8A 1O2DA 1Z6PA 3ZWYA 4Q37A 3QEMA 1WKVA 2VH1A 1U6JA 2VF2A 3SMQA 1FDVA 3T94A 3ZTTA 3FKSD 1U49A 3ZDRA 4RQTA 2E37A 5C7YA 2IS6A 3ZXXA 4Z4EA 4KAFA 4S05A 4EJFA 1ZGBA 2FGKA 5FA6A 2YXBA 1L5FA 2HC9A 3O4JA 4BMOB 4LHXA 2FSVA 2A4MA 3DCYA 4XD7D 4P7JA 3WQRA 1SY7A 3ZGLA 4UB1A 1CJUC 4QNNA 3ITEA 2ZBUA 3GGSA 1TM5E 1KVQA 5J2UB 4E70A 2QLNA 3LQRA 3TFSA 3RNOA 4JMUA 3AJEA 2O1WA 2OHOA 3BZUA 3P96A 4MQUA 1Q84A 4Q24A 2QLBA 1SXJD 3I61A 1E7QA 3VVMA 2FPGB 2JJQA 3DOJA 3RKRA 1B8NA 3RBAA 3WB1A 1INLA 4IRKA 4RT2A 1ZQPA 4C7ZA 3UPTA 4ECZA 3LRPA 3FCEA 3L9WA 1J56A 2CFCA 4CXMA 5B4VA 2C9CA 2IU6A 1LF5A 3TE6A 2EW2A 4Q4JA 2C4KA 1GRRA 2C2MA 3GRFA 1BPBA 2HWUA 3IG8A 1HEYA 4ETNA 4MV4A 2IY7A 4MEJA 1YQQA 4KSYA 4BBJA 2B4YA 2OM6A 3HM9A 4WUVA 2WW8A 7ABPA 5AKXA 4D9CA 1BXZA 1TLLA 3UT6A 1SVKA 4JYMA 1QF6A 2BDTA 4YJ3B 1VG9B 4I2CA 3RWOA 2JH8A 2EDAA 1SVMA 3CVJA 2MUTB 4A73A 1HE8B 2QGFA 1NQWA 2RGGA 1U0FA 1QGUA 4DILA 1G17A 2AKAB 1LNZA 4F3NA 2I2FA 1T3LA 4YWHA 4U9UA 5FI1B 5M5BA 4E1BA 3TDNA 2GD6A 3QF4A 3CPEA 3V3KA 4N9QA 4BO3A 5H80A 3FNHA 3LSTA 1RJFA 5T3YA 1RYEA 2CXNA 3L0BA 2GUWA 5CGQB 4P4SB 4ZK2A 1A50B 1ZISA 1E2LA 4I2FA 3FY4A 3ADBA 5ICCA 4KPFC 2PPVA 5KFXA 5FPQA 3AV0B 3B85A 4MCJA 4K87A 3TX2A 2DPLA 2PX8A 1HLDA 5TARA 1KZYC 1S6YA 3L3BA 2IPLA 1XL0A 4J16A 9GPBA 4G07A 3CX7A 2FAXA 4L4XA 5CA0A 4K81B 5JNVA 3WLEA 1Q22A 3PW5A 3V2HA 4A2WA 3OC0A 3G5MA 3GIJA 3D8NA 4XVCA 1FDUA 3E1KA 3HRKA 2GM5A 1QFMA 2C5BA 3WP0A 4CKZA 1TQ8A 1V11B 4KOEC 4FI3C 4KMUA 3VISA 5IJAA 3DF9A 3CG4A 4HWPA 3X1YA 3LTEA 1JHPA 4RSGA 4C0JA 4KUHA 5KVCA 4BNDA 2XZTA 2HBLA 5E6UB 3GLIE 4LRXA 2FZGA 4BC0A 1LB2B 2H2DA 4ZCSA 4AKIA 3RR7A 4UNIA 3I5MA 2BFWA 1OFUX 4GMGA 5DDMA 4RKRA 1E3LA 1U9YA 1YJBA 2CDCA 3RVQA 2YFHA 5LMUB 4PAOA 3EBLA 3C43A 2I54A 3L2OB 5FEUA 3BDAA 4QJ3A 1N6IA 3C5EA 5I51A 4OJ6A 2EFJA 5CURA 2A84A 1I9GA 4QJ5A 4EG1A 2HV8A 5F1OA 2KFNA 2W9BA 1AMNA 2W6JD 2X8BA 4F6CA 4GMHA 2VPXA 3R9IA 4JJZA 4QGSA 1GLGA 3KYCA 3QYPA 4URZR 4KU4A 1PSWA 4PPNA 3STWA 3TQHA 3ABOB 3CNEA 5B3AA 4R41A 4DLKA 4HLUA 3OQBA 5DQHA 3LPCA 1Z07A 1J07A 3AEQB 3BWEA 3D31A 2ES6A 3G5LA 4PX2A 5LXTA 1EK5A 1DOAA 3FVRA 3EW7A 4P3YA 5CCDA 2RDJA 3ZHTA 2X8WA 4G84A 5P8WA 2LYAA 2GZMA 4IS2A 1NU6A 4N9WA 4RJJA 3FDJA 1FPMA 1WIWA 4NMXB 3PNQA 5HHHA 2FVXA 2XNCA 3I92A 1LDNA 3OQHA 3J81k 2XI4A 2MSCB 3C3DA 3NM4A 2BFFB 3KM0A 3WNDA 4FC6A 1W46A 2BRUC 4Q7JB 2BFEB 3WOHA 2I3BA 4C4TA 1KNXA 3MINA 1T24A 3INRA 2C2WA 4V0KA 5C7OO 5U4QA 1JDBB 4HDMA 4KLTA 3FWYA 3ASYA 2BLNA 5DKFA 1SHTX 5DNWA 1N5MA 1KERA 4X93A 1Y9ZA 4LGVA 3QFRA 1Y4UA 5B1IA 3N6RA 3HW8A 3IBYA 2OXRA 1Q0RA 3REFA 4K28A 1QHIA 2X3UA 3KWFA 3B9RA 3WHKA 4DT1B 3D6JA 2HNAA 3U7IA 3IOEA 3STUA 5KG7A 1NV9A 4EGFA 1B8VA 1WZNA 3D1JA 3T3EA 1NUHA 4E22A 3K75D 2Q7DA 4PYNA 1NVFA 2WIKA 2WA2A 3E84A 4MULA 2RHWA 3C3XA 2DFLA 2OBXA 4BBAA 2WF5A 1QZTA 1Q57A 1A88A 2QMZA 1D4ZA 3GIKA 2IEIA 2Y9TA 5C53B 5JJLA 2LIVA 1TMOA 3I6ZA 4OQLA 2RGNC 2WSSA 1XN4A 8ICQA 4M1EA 2R00C 3ZBPA 1DT5A 2UUOA 1VSTA 3ISBA 2CE7A 1BMFA 3AJRA 4CMBA 5K6RA 4MVWA 3PDCA 5CBPA 3O0TA 2YVKA 3QXJA 4MI9A 4JWNA 3F6EX 3HNOA 3QG5A 2HXGA 1CNMA 3TG8A 5C2JB 2HEIA 4UBCA 4JT4A 2BR3A 3OGUA 2VJNA 3U5ZB 1J1IA 3BTUA 5JS7A 4DIBA 1VPEA 3IKLA 3OH8A 4KLZA 1IZ0A 4QWWA 1HYHA 2YJZA 2BH2A 1XKLA 1JKFA 1AUVA 2OEHA 3ZGXA 4KLLA 2J0EA 1HBJA 1BA2A 3CNQS 3K9GA 4LA4A 4CWAA 3EC1A 3AG6A 3LV8A 2GAAA 4FB4A 1USUA 4EPRA 3QU7A 1H2RS 4HRVA 2H1SA 2HEGA 3EY9A 1KF0A 2BMVA 4NJMB 3TTSA 1SXIA 4XFJA 3K0FB 4CT5A 8ICTA 2C8LA 2NQTA 2HHUA 4DQXA 3DD1A 2BL4A 1T6BY 2V7EA 4I8DA 3A1FA 3U1BA 4XR4A 4Q82A 5BO5A 1A95A 4PX9A 4MPPA 1NK6A 1X15A 4PINA 1LPBB 4PYIA 4ICIA 1XK6A 4LG1A 1WU8A 2XCRB 1J99A 1TAGA 5A0FA 1BNCA 1K1SA 1MB2A 2K7FA 5DWQA 1ZIPA 3HR7A 2QQ0A 5BSTA 3PIDA 1KBOA 3LYSA 1N0UA 3D5TA 3F1LA 2KKVA 4QRIA 3CU5A 2ODQA 3TS1A 4O3SA 3NC4A 4OL0A 1GDDA 5EVCA 4XXHA 5KOJB 3NV7A 5E4YA 121PA 2EJTA 3PSIA 3LF2A 1MW9X 1S3SA 3QWHA 8ADHA 3T4EA 3OEYA 1C8LA 4R8VA 2FG5A 4ID9A 3PWZA 4GDMA 2M0NA 4D3YA 4QOJA 1DWQA 3QKIA 2V7UA 5CAEB 4REOA 4M3NA 2NSLA 2R7NA 3MT0A 2QL7A 3R3JA 4LJ5A 3PFKA 1V97A 4RJKA 5M04A 2WAMA 5KMGB 1NJZA 5ALOA 4RHCA 5FRDA 5ALFA 1QYDA 3TL2A 4PTZA 1IU9A 2NMVA 3I5XA 3CKKA 5FJIA 4Q01A 1KZ4A 3S7ZA 3K20A 1RRFA 1T4DA 5KHOC 3HXLA 3WC4A 3W6NA 4HVAA 3U3MA 1OYYA 3T1OA 1T9HA 1QRAA 1MAAA 3OZGA 4OHOA 4HYYA 3NVDA 3QF7A 5SY9A 2QNBA 2GFIA 3DBRB 4B9SA 3ODGA 4KJZA 2OWDA 5AW6A 2COKA 4G0NA 2FN9A 4QFCA 3HYTA 5KTKA 4LJ7A 3SZGA 3VR3D 2CNOA 2XWPA 1VJDA 3H1FA 4OQ4A 4AROA 3RYFA 1U9CA 2AG1A 4GYWA 3TMYA 1BG6A 4NVRA 1QKKA 4NBTA 2IELA 4NG4A 3FPFA 1SXHA 2UU9B 4EJSA 4IV5A 3BWVA 3CLUD 1UINA 2INGX 4J9SA 3BFXA 4PO8A 1XVVA 3R77A 1N3BA 3CW2A 3WIUA 4WZBE 4OQEA 3SNHA 2E4YA 3JWJA 3OSNA 1TFUA 2I3DA 1S2GA 3ZNPA 1TZJA 1WDLA 1UBSB 1H1LA 4BNHA 4TZTA 4TQSA 1L5QA 1RLUA 1PE0A 4CRXA 3UF0A 5JNUA 4B9TA 1H23A 3T7RA 4Q39A 2Q49A 3KPJA 3K5PA 2E8MA 5G1NA 1KJYA 5CG2A 3W5HA 4JLMA 1Z0FA 4OYYA 4Y2TA 3BQNB 3T3HA 2ZJ6A 2BZGA 4PNZA 4RS4A 4JOCA 4Y6PA 3F73A 5DMXA 1YMUA 2AMFA 3TAPA 4WAUA 2C5SA 3VNSA 2EHJA 4OREX 3F7TA 5FF9A 5AKZA 5JFGA 3HBNA 4Z8XA 3THYA 1XZCA 3MFQA 3ZI0A 2WILA 4UMFA 3HK2A 2C7BA 4BCBA 4R8MA 5BSEA 2Z6AA 2AFVA 2KJ5A 4J0JA 2ZJZA 3WLFA 1T1RA 5EWMA 2AQ8A 4YXMA 3OPVA 2JFVA 4CM3A 2OV2A 1JEOA 4DM3A 5B1EA 3VH4A 2OFXA 4ECSA 3TXAA 4K1LA 5H70A 1J90A 3WWZA 3HKEB 2NXEA 2XMCA 4N65A 3JVUA 2XRMA 1LX6A 1G1MA 3SYRA 3ZHRA 2JZBB 2DTDA 2VNHA 5CHEA 5JZMA 3D0QA 5DEOA 2C2KA 4PGQA 4A4DA 2GPTA 4ILEA 3LW8A 3OTIA 2YMMA 1QTIA 2OCDA 4I4TA 2R5NA 3HYNA 1NY6A 5CX1A 3BF7A 2KG5A 3H4IA 3FN4A 4L8GA 2WUWE 3G68A 4JEIA 3D6UA 1QQ7A 9ICVA 2C2GA 3CSDA 4PAGA 1Q3UA 5JRJA 4X1YB 4MZDA 1HZZA 4ZIRA 1EVQA 1QCYA 4GBGA 5YASA 4YDRA 4PSUA 1VYUA 5EOVA 4QYSA 5LA6B 3WYCA 1SBYA 5J23A 1NJFA 4U02A 4N82A 3ZX4A 2P5TB 3HY3A 3RHSA 1A72A 2Q6LA 4FMBB 1K3TA 2ZRCA 1QK3A 4BEJA 1IL0A 1NKEA 4EGAA 4Y2QA 3OE5A 1S0NA 1XQ6A 1CP3A 2A7QA 5IXJA 3LD9A 4ZD6A 3CC8A 4G4IA 3I76A 3SLRA 3AOEC 4F4WA 1N61A 4LNUB 3F4KA 4ZKDA 2H4HA 1K27A 2FR0A 3ANYB 4PF1A 5DG8A 2AC2A 1BX3A 1RBMA 3TTVA 1P0PA 4JU9A 3A9WA 1ESMA 4RULA 2ZIVB 3U80A 4IHAA 4YMGA 4UQOA 3H5OA 1ZJNA 3G7NA 1PWEA 2JKVA 3M83A 1XTSA 3NRJA 4LXTA 3EHEA 3SI7A 5GVRA 1KO1A 3N5KA 1ABEA