3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
3J7TA 3AR9A 2G09A 5ALMA 1YJ5A 3WK5A 3I28A 1XVIA 2OBBA 1Y8AA 5AKGA 3W5CA 2CFSA 2ZBEA 4UARA 2WF8A 5ALOA 3U13A 1RKVA 1O08A 2P69A 3QYPA 4JB3A 3HLTA 2EARA 3QUBA 3N5KA 3EF1A 2IYEA 4Y2JA 4XE5A 4HAIA 5FP0A 3QU2A 4KNVA 5AHXA 4ZEXA 3E81A 4BX2A 3RFUA 2G08A 2B30A 3M1YA 4BYGA 4KN8A 4YGYA 4NFLA 2HEGA 3SKXA 3VAYA 2ZBFA 2YMMA 2MU2A 3E84A 2BY4A 4Y2UA 4QQFA 2YJ5A 2GMWA 3QU9A 5ALNA 4L57A 1QQ6A 2MSNA 3AR2A 3KOOA 4NWIA 1ZD3A 4NV0A 1NF2A 4PNHA 4KX5A 3AR8A 1JUDA 5AI0A 2P27A 1KYTA 2W4MA 3QU4A 2AGVA 4FE3A 4I9GA 3FPBA 3NIWA 4BEWA 2G06A 4Y3UA 4L6CA 2NYVA 2FPWA 2HO4A 1L7NA 5AW4A 1ZD5A 2CFTA 3L0BA 3SD7A 3SKYA 2WF9A 2JAUA 3OCXA 1RQNA 2B8JA 3U26A 3B9BA 5AVTA 1L7MA 1U02A 2P11A 4Y2SA 5ALXA 5AM0A 3ZTYA 1EK1A 1X42A 4J03A 1NRWA 4AP9A 1RQLA 1RMYA 3I1YA 3MN1A 4BNDB 3QUQA 1Q91A 2ODAA 1TA0A 4BEVA 1L8OA 5AW2A 2HCFA 3DV9A 3EWIA 4EZEA 2RB5A 3A1EA 1TE2A 2ZG6A 3KC2A 3L8FA 5AVQA 3BWVA 5T41A 2IOHA 5ALEA 2C8LA 5AVRA 4CF3A 2R8YA 2FPSA 4EEKA 4DCCA 4UM7A 4RETA 4UMDA 5ALJA 3E8MA 4YIKA 3ED5A 5AKHA 1Z4LA 1RPZA 4IG4A 5ALLA 5AIBA 4JDPA 1CR6A 3FPSA 3DDHA 3NRJA 4DFDA 2FUEA 1ZRMA 1Z4KA 3QLEA 4FYPA 1RRCA 2GHTA 4E88A 1MH9A 4HYTA 1L7PA 2OYCA 5ALKA 3A3YA 3B9RA 3ET5A 3U19A 4UAVA 4Y2PA 2EATA 2HHLA 5AW3A 1WR8A 1Q92A 3N8GA 3WKDA 2HX1A 5AESA 3WKAA 2I55A 1CQZA 5AKJA 4O8CA 3UM9A 2C8KA 2B0CA 2NO5A 4FFDA 2PQ0A 2FI1A 2G0AA 5ALHA 3R09A 3L1UA 2R8EA 5AM5A 4UAUA 1LTQA 4GXTA 1XPJA 2HI0A 3L5KA 4F72A 5ALGA 1S2OA 3IB6A 5A3RA 1S8OA 4UATA 2WFAA 2NO4A 4CF4A 1QQ7A 1TJ4A 4G63A 2G07A 4IFTA 3W5BA 2JAWA 1ZD2P 2HDOA 3FGOA 4UMEA 2W11A 3WKBA 1AQ6A 1F5SA 3QGMA 5AM4A 4BNDA 1Z5GA 2JAOA 3OTQA 2C4NA 3SMVA 2ZXEA 3ZUPA 4NABA 1QYIA 2EAUA 2AMYA 2G80A 1RKUA 3FVVA 4KYTA 3L0YA 3ZW7A 5AK5A 1L6RA 5JJBA 5ALWA 3R9KA 1WZCA 5ALZA 3AR4A 1YNSA 1IWOA 4C4TA 3BA6A 2FPUA 3QX7A 2P9JA 3QXGA 3UMCA 3WK6A 2FEAA 3HYCA 2JGAA 1RLTA 3OCZA 2I54A 3OCYA 4ZEWA 4GIBA 5IT4A 2YFYA 5AM3A 3QU7A 5ALFA 5AICA 3L8GA 1RC8A 3TLMA 3PGVA 1SWWA 1VJRA 1RKQA 2WF5A 2GHQA 4YCNA 3U7GA 1Z4IA 1O03A 2VKQA 1PW5A 1U7PA 3L7YA 2YMQA 3WKEA 2BDEA 2YMPA 1RLOA 2GFHA 4CF5A 1ZOLA 5AK4A 4OD0A 3KDPA 2I7DA 3SLRA 4CNQA 3QNMA 2ZBDA 1TJ5A 4C4SA 2I34A 3QU5A 3L8HA 5AW5A 4EENA 1NNLA 2DQSA 3ZI4A 2RAVA 3ZX5A 3NASA 4UM5A 3ZWKA 1U2SA 3GYGA 5AIAA 1Z4MA 3NANA 1T9ZA 2CN1A 5AKKA 3WK9A 4C4RA 2PKEA 5AKXA 3AR3A 3KZXA 3E58A 2HSZA 1FEZA 4DWOA 4BBJA 3D6JA 4UU0A 5AI8A 5ALUA 3RF6A 1WPGA 3OCVA 3ET4A 3SF0A 3WK7A 4DW8A 2D2VA 5ALYA 3L1VA 3I76A 5ALSA 1Z5UA 2R8XA 2B1QA 4AS3A 3S6JA 2IOFA 2X4DA 2O9JA 5ALRA 4EX6A 2G1AA 4EX7A 3R4CA 2B8EA 2IOFK 3AR6A 2HOQA 3N07A 1TJ3A 1L7OA 4EELA 4YIHA 3N1UA 3IRUA 5AI4A 2HF2A 3EF0A 4RESA 3CZ4A 2YN4A 2RARA 2O2XA 2HF7A 4KNWA 3EPRA 3MC1A 3DNPA 3B8EA 5AKLA 4F71A 4MWOA 4Y2QA 4AS2A 3W5DA 4XOUA 3PGLA 3NUQA 1N9KA 5AVSA 3QUTA 3I6BA 5AM2A 2FDRA 3A1DA 3SHQA 1K1EA 4HGQA 3ESRA 1U7OA 1LVHA 5E0OA 3ZU6A 4ZEVA 4OFZA 3FM9A 4B6JA 5ALTA 1ZRNA 1J8DA 1ZJJA 3CNHA 5AI5A 5AVYA 2C88A 4HGOA 2FUCA 2I33A 2YBDA 5AVXA 5A3SA 3ZTWA 3ONNA 1QQ5A 2Q4RA 3KBBA 3PCTA 1RMQA 2RBKA 4HGNA 2Q4TA 4G9BA 5IT0A 2CFRA 4HGRA 4NAVA 4BX0A 3IJ5A 5A3QA 2GO7A 1VJ5A 2C9MA 2WF6A 3WGUA 1T5TA 1U2TA 5AKIA 4YH1A 5ALVA 1N8NA 2R8ZA 1WVIA 3AR7A 5IS2A 4YCMA 5AVUA 5AI6A 3U7HB 2YJ4A 2OA0A 4OHFA 4KX3A 3ZVNA 5ALDA 3W5AA 5AW0A 3F9RA 4CE6A 1Z4JA 1L8LA 3A1CA 4YCLA 1YS9A 3ZWDA 2B1RA 4QJBA 4BX3A 4H1WA 2JARA 5AK6A 4Y2YA 4Y2XA 2PR7A 2YY6A 5AW9A 5ALQA 4OCZA 1RDFA 3OPXA 2OM6A 4XQ0A 4UMFA 3L0CA 4HGPA 3QUCA 3WK8A 1YMQA 3M9LA 3FZQA 5ALIA 1T5SA 4BKMA 3WK4A 4Y2TA 4Y2VA 3MMZA 2WM8A 5AW8A 2AH5A 1Z4NA 3UMGA 1Z4PX 2Q5EA 2WF7A 4UW9A 1SWVA 4L6AA 2YMLA 2W43A 4I9FA 3AR5A 3U7EB 3KD3A 5AVZA 5AW6A 4MUMA 2MU1A 5AI9A 3PDWA 4UASA 2FPRA 2QYHA 3OCUA 3NALA 4Y2RA 1EK2A 1YV9A 5AW1A 3N28A 1VFPA 2I6XA 3WKCA 1XP5A 3ESQA 5AVWA 3DAOA 1J97A 3ZX4A 5AK3A 5AKZA 1ZD4A 1YDFA 2YJ3A 2B82A 3UMBA 3OCWA 2YJ6A 5AKEA 3U7FB 2AUTA 2IA5A 2ZOSA 2QLTA 1RLMA 5AKYA 3ZVLA 3L8EA 1Z4OA 3P96A 5ALPA 1Z4QA 3K1ZA 1QH9A 4UU1A 2FPXA 5AM1A 4XPZA 1ZS9A 1SU4A 3WGVA 1Z88A 1RMTA 3MPOA 3ZVMA 2WHEA 2BDUA 3NAMA 5AVVA 4UMVA 4J2TA 2ZBGA 5AW7A
chains in the Genus database with same CATH superfamily
2UVQA 2HLHA 8ICZA 3JTMA 3MS2A 5C4IA 4XGKA 2OBBA 1X8KA 1JQBA 5A9SA 1JAHA 4JC0A 1RQGA 3E9DA 1XNHA 5BNTA 3T1QA 3WLTA 3Q8QB 1UKBA 3D1LA 4UQGA 1M8PA 1JEAA 5KOYA 3EGXA 4FGSA 5TPZD 4FQ5A 1L5YA 4G09A 2G5PA 5CVVA 1LK0A 1RKVA 5MF6A 2DEUA 3AWIA 2MR6A 4YR2A 1VECA 1PU2A 5KI6A 2J6TA 4ONEA 3ZK7A 1FZQA 3VZQA 3PDCA 2OG1A 3EZGA 4CKXA 4YCSA 5FP0A 1VHDA 5DQIA 1VI2A 2C82A 2KW5A 3AP1A 3DUWA 3AGPA 3GLHB 7MHTA 1K06A 1E2MA 1G64A 3WRXA 4X24A 4QGSA 5F23A 2YRFA 3WYCA 4LF6B 1MHTA 4V02A 1X8JA 3MOSA 1S1CA 4L3OA 2B35A 5EHZA 4MCAA 5CPBA 1RJWA 1HQYE 4HL6A 4IL5A 4INOA 4KPYA 3O03A 1I4TD 3RKSA 4P4GA 3RREA 4Y6GB 2CNWA 3VAYA 1CKEA 3KRTA 3EFOA 1QFJA 2KE5A 1C3OB 5FWYA 4I27A 3SDBA 3V2IA 4AY3A 2CDCA 4ZT7A 3S44A 2DBQA 1EVIA 3QU9A 1D6MA 1O57A 1PWHA 1TO1E 1YZ3A 7ICMA 2C59A 3QH4A 4L57A 2OCEA 2O52A 3HL0A 3OHSX 8ICUA 1IOWA 3C3AA 4WJ3B 3QVMA 2XYHA 4TZKA 5CVCA 4NWIA 2QZJA 5DSTA 2F7SA 2XUQA 3R3YA 1PDVA 5KDOA 2P77A 3W34A 1JUDA 2EEZA 4NYJQ 3D4NA 4I5FA 2EIHA 3AVOA 5CFPA 5MGNA 1ETHA 1ZCZA 4O25A 1A9XA 5ILOA 2ECFA 1M0SA 1GRNA 4HQRA 2VI5A 3K35A 2ZIWB 3A1FA 3AEUA 4I9GA 4PC2A 5DXFA 5K3BA 2YWGA 3CB2A 4I08A 1HR0B 2NYVA 2FPWA 1SH7A 2HO4A 2LV8A 2VJQA 1P61B 2JGJA 4OQPA 4BIIA 5A4JA 3GG9A 5KQPA 3LOUA 4ASUD 4J3FA 4MPDA 4XUSA 3KPUA 4I1VA 4OYLA 3N39C 1EXVA 4M0LA 4E2ZA 3N05A 4MVWA 4GPZA 5J0XA 1XCGB 2JEFA 4J9SA 1DKQA 1JIXA 1NZJA 2QRNA 4D8WA 4TXHA 1IUNA 1DUIA 1I0ZA 2GD2A 3BGDA 3U26A 3MGHA 3WFZA 4HV4A 4ZOHC 1PS9A 1RWNA 1JSCA 2ISSD 5DP1A 3L7KA 1ONPA 4DSLA 2A94A 3JSAA 3DKVA 1CE8A 1XT6A 1SUAA 2YTZA 3K6RA 4U02A 5KQMA 2CXUA 2ZTUA 1E6MA 1EK1A 1V1MB 3Q8XB 3U6BA 1RQLA 1FFCA 4RUCA 4B0OA 3KDAA 5I3CA 3F96A 1KC1A 2B94A 5GIOE 3JD2A 5K1ZA 3OECA 3F3KA 1G6KA 1YDHA 3H65A 5E0KB 3BILA 1V6CA 2ZBVA 3PNOA 1ZNXA 5CRXA 3HWWA 3RASA 1XKXA 3V4SA 3UKDA 4AF7A 2HHVA 7ICKA 2JGFA 1LK5A 2KJQA 2QX4A 4IDFA 4M76B 4LSWA 4KOEC 1GUBA 2A9KA 1EUQA 1JPJA 4KIWA 5EXEA 2VTEA 4GZLA 4CM6A 4FCCA 2YHSA 4DC9A 1W4BA 2I80A 3GNQA 4ZDKA 1CRQA 1JH9A 4LAFA 1O0BA 1V11B 5FBLB 4O1IA 3M8RA 2HW3A 1K75A 4D3DA 3IR6A 1GZ4A 1O5IA 2JHAA 2ZRIA 3AUSA 5GQSA 3E8MA 2YWJA 4BV8A 7ICJA 3VC2A 2IHMA 3I58A 1LI4A 4GWGA 4DARA 3FNFA 1B2RA 4TRRA 1E89A 2D5IA 2D00A 3E3AA 3LSYA 2JIDA 1L1FA 1RJDA 1SQ5A 4OXIA 1OX5A 1RPJA 3A9WA 4OTZA 3ZJYA 5H1YA 3TFWA 4EHHA 1LBQA 4JK1A 4F93B 5EWGA 3ZDDA 1VE1A 2ZTVA 3KJFA 1OGJA 3SM9A 1SXPA 3T5LA 1WUDA 4DFDA 3C45A 3JQDA 1P2SA 4D43A 1KEEA 1UF9A 4D0RA 1MB4A 5BR8B 3OZBA 3QLEA 4UFOA 2ABWA 2G7ZA 2GHTA 1U7DA 1M2EA 3EZXA 3OQVA 5KTOA 3GFOA 3T3OA 5G41A 3USCS 3B9RA 4QGBA 2XYVA 1HA3A 3I2GA 4FN5A 1QP8A 1CUWA 2FEKA 5EZQA 1K5HA 3D0QA 5AHRA 4XUCA 1RKBA 3DVQX 2XDYA 3EPJA 2E1FA 1R10A 2C77A 4GI2A 3FVRA 4R8RA 1BJTA 2AYXA 3PNVA 1PR3A 2C5AA 1ZQ9A 1ODFA 3WWPA 1ZMRA 5B3KA 2EKLA 5FQOA 1UKCA 5L3QB 1TCUA 3LM8A 4TMVA 3BSSA 4QDKA 4PWZA 2ZKIA 2JCYA 3O3MB 3RYFA 4E1BA 2FI1A 2ZIVB 3IEUA 1NC3A 1JLHA 3OFKA 3P2KA 2C97A 2VHQA 3QA9A 3F73A 3C2KA 1NK4A 3C2QA 3KHRA 4N8EA 4WK6A 1KJ8A 5D8DA 4CQMD 1NZPA 1UWKA 5LD2C 1G6OA 3VSBA 4IWXA 4G56A 1J1UA 1DKNA 1SOUA 1W0JD 4TLBA 1QVRA 2WTBA 4LHSA 4IUBS 4M6WA 4L3WA 4YRFA 1QRTA 1PJLA 2KS6A 2HNKA 2QD4A 4KXNA 5DDIP 3UB3A 1Z0DA 3W5BA 4RANA 3LWLA 3JYNA 2OORA 5EXTA 2EANA 1XIVA 2FRVA 2G88A 5FIUA 1GAJA 4LGYA 5FWXB 2WSLA 4BP9A 3IJPA 4B5KA 3CEJA 5ER9A 1N8KA 4Q1VA 4WA8A 5SV2A 2IX3A 3NP7A 2A8YA 1JJVA 2V3VA 1RU3A 3C2MA 3K4HA 4Y6OA 4RH1A 1P91A 1R6TA 5FWAA 4LA4A 7REQA 3M0EA 1TT7A 1C9MA 2JJMA 4GYWA 4C7OB 1Z12A 4X5VA 1DSSG 3E5HA 4JT4A 4UHEA 1Y3HA 3FVVA 4JSRA 2Q4EA 1V8OA 4OHPA 4RGVA 4S0XA 1Y7TA 1PJ8A 1EIZA 1X39A 2FFBA 4DQUA 2X8WA 3I4FA 1TM4E 2YUTA 3A4TA 3QVGB 4PO8A 3V4LA 5ALWA 3J80A 1PVRA 2JDIA 2PMBA 1SRRA 2ODGA 2AGQA 2HCRA 4W1QA 4XXHA 4AICA 1CV2A 3DW3X 4AO8A 4IJKA 1UBHS 4PVCA 1E1RA 5BQPA 3TCXB 3S2GA 1JHPA 1QGUA 2JH3A 1X6JA 1NPTO 1GAWA 2JL1A 4J3NA 1V85A 2AI3A 4EFKA 4JDUA 4GRDA 2R7MA 4IOLA 1LRKA 1U9LA 1NKBA 1P3Y1 2IY8A 3CTPA 2EFDB 3KUCA 1MF7A 4YAWA 1CVRA 1E2QA 1WMDA 4IOJA 1L3TA 4U7JA 4Q4HA 1BA3A 3GQBB 4ZICA 2OCIA 1PZNA 3HFJA 3ID6C 5JCJD 4TV8B 3K1RB 5KOHA 5HZHA 5MN5A 2PT9A 1SWWA 3QVLA 2VPPA 3S1AA 4UDXX 1RZUA 3ORSA 1QLJA 1Z83A 1HF3A 3C5WP 3EXHB 4QSHA 3KTAB 3UC9A 1GJRA 1X8LA 5K4LA 1JIVA 4ZGGA 2QK4A 1H0HA 2BOVA 3E8XA 4EMSA 5C1OA 5KVSA 1U8AA 3DTVD 3OFSA 2MAXA 2Y1WA 4TMWA 2JRCA 3ITEA 3LHSA 4QICA 1U31A 3TZBA 4HN9A 3ELDA 4LJYA 1RLOA 1TEVA 3VCBA 1Q6YA 2GFHA 2IP2A 1IPFA 1NR5A 1T0HB 4IG9A 2OEHA 1LLFA 3QHQA 4F5QA 2ROQA 2REQA 1ZUNB 2YJNA 4C0ZA 1XG5A 1UQVA 2VNJA 4CI9A 3PSAA 4XAQA 4J94A 4R8SA 4M1EA 3G13A 3C6ZA 2QRZA 2WSSA 2YRWA 2ZU6A 3ANLA 3L79A 3ONWA 4L5JA 4G0VA 2WTMA 1NM5C 2X2OA 3VDXA 3VNBA 3ZZMA 4F3KA 1NDUA 1ORRA 3AHFA 4O3QA 1NVXQ 2AXNA 3AXTA 3GYGA 3K8ZA 4YP1A 4FR2A 3GP3A 4BFTA 1M7HA 1YBMA 4RZQA 2EHJA 4HEHA 2EJBA 1I4LD 2WJIA 1R8XA 2X4GA 8ATCA 2ALZA 1R9GA 1XMVA 2AZMA 2GRJA 1X2IA 2Z3ZA 3BXXA 3KZXA 1TKDA 2P41A 4P86A 1KGDA 4ZU3A 2ZT6A 1Q7BA 1X1SA 4G65A 3SU8A 3NWEA 1W4RA 2Z8XA 4JT8A 5CB6A 2DQKA 1ZWLA 2QN1A 3EY9A 3KTOA 3HNRA 1R4AA 3KL4A 1BEEA 2WWRA 4Q05A 4V0MA 4CMBA 4WCFB 4PHAA 3QXHA 3LRPA 4YUZA 2C4TA 1NN3A 1LX7A 1XA0A 5DNYB 1RCTE 1SKYE 2AFHB 3IMFA 3CG0A 1PK7A 1RYMA 2GS9A 2CXSA 4FZ5A 4JA2A 4RT3A 3G0CA 3KTQA 3U0VA 3UHAA 1P7DA 2R8PA 3LZCA 2RG1A 4OLHA 5FI3A 3MWKA 3ZEAA 3KQOA 2ADMA 1SXDA 2FWNA 4PLHA 1JIKA 4JU8A 1KZ9A 2HBLA 4OMFG 4RL4A 5D00A 4I4CA 4WN9A 1WO8A 2PKCA 4FVTA 3ASVA 3JPRA 3DMHA 3G0GA 3ZU2A 3M6ZA 3I53A 4RKQA 1E9FA 1YBAA 3GDXA 4C2AA 1OLXB 2QN2A 1U0FA 3GRVA 2ID7A 1SVWA 3ADPA 4WFQA 3RVDA 3WNZA 4C14A 1Z45A 5ESWA 1THGA 5IF9A 3D2AA 3VOAA 3FVWA 4BLSA 2I03A 1GQRA 3DKRA 3EQ2A 3KG2A 1YOVB 4DNXA 4MDEA 1M2JA 1JT2A 4TTQA 1L7OA 3B20A 3ELUA 1UA0A 1ACJA 1O77A 3GV8B 1OFUX 1I2ZA 4INPA 1MD9A 4QPCA 3PGJA 4JWMA 1WHSB 4L08A 2BGGA 1E4YA 3OJOA 2PGJA 4NG4A 4OXRA 2W7TA 5IAEA 1OR8A 5EG5A 3VNAA 1JDNA 4C9BA 1YCHA 2GRUA 5KFBA 4Q8EA 3E7DA 3LDUA 1OI2A 2QRVA 7ICTA 2O2XA 4KE6A 1YF3A 3ZDCA 3U3RA 1LGYA 4KP7A 1VIDA 2VIXA 4WA7A 1EFVB 4OFBA 3TFOA 4D9FA 3L6BA 1X14A 4P98A 4LQ4A 1DMSA 1LV8A 4OL0A 3ETJA 3S2FA 1XLVA 3L6DA 4KN6A 4B81A 4K4HA 1YUBA 3I6BA 4FYMA 4OIFA 5FD8A 2HF8A 5LWQA 3FHTA 1W44A 2JCBA 2Q3BA 3CCFA 4MB0A 1RTTA 3IAFA 4J0GA 3UUEA 1KL9A 1CZRA 2P5TB 2OB1A 3MVEA 4E12A 1PHRA 2C0QA 3SP1A 2D2EA 3C24A 3UGKA 2ATEA 2CXTA 4TMZA 3PF9A 3PNQA 3OIWA 4YCDA 1CSEE 1KDRA 3KQPA 3PHIA 5LQCA 4JOCA 2XWPA 5LUAA 1D4OA 3B12A 1ZEJA 2R6CA 1TLFA 4L22A 2CD9A 1N5RA 3EVZA 2FUCA 1QZ3A 1JRLA 5JC8A 1K08A 2ORVA 1J9GA 5EPOA 2X9QA 5D3QA 1QKJA 1O94C 1YS2X 1DBRA 2OP0A 3NTOA 1JXLA 1QQ5A 3AG6A 4B9UA 4QUJA 3TJZA 4RJTA 5KCZA 2XNHA 5EAIA 3U4DA 3UAZA 1A50B 2IEDA 2QRPA 3A6LA 2W03A 1WULS 2I8AA 2PVPA 3NHRA 4LC1A 2A1IA 1XZBA 3WZ2A 3X2FA 2VF4X 4OLJA 4EAAA 5IRCD 1T3TA 3MABA 3AO0B 4NVRA 4BX0A 2LTAA 3BJZA 4CEHB 1QHYA 3NRWA 1G3MA 4IGKA 5E1MA 4QYTA 3WB9A 1NV8A 4IJUA 1FJGB 2QVYX 5FEMA 3I6MA 4GC5A 4NAHA 5CCDA 3MCZA 3KYJB 3VC8A 3PNBA 3ISBA 1KZ6A 4YS6A 5EWLB 1N3BA 1KY5A 1U4SA 2FW8A 3BEOA 3HWRA 4UHDA 4BNZA 3MJTA 4MW2A 1UEXC 1WVIA 4PEVA 3IAEA 1XD8A 2HFKA 1OZGA 5BSHA 3C23A 3O8CA 4CQNA 5B12A 2JGLA 2VTVA 2OHHA 4IIUA 4S1OA 3RR2A 3BWEA 1XXHE 2PQMA 4DPLA 4HS9A 2ID8A 1UA1A 3G02A 4CR7A 1GILA 3DDOA 4LDNA 2QT9A 4HLUC 4OUDA 2XVMA 2QUBA 3VYSB 1O96B 1XMXA 2MSDB 2O2GA 4A2PA 4ZJUA 3Q8PB 4GS5A 4QQRA 4TRMA 2GEVA 4NNOA 4BMVA 4LZWA 1EXMA 2PMKA 3T54A 3BMNB 3H8WA 2W8KA 1LPOA 5FYQA 2BHLA 2IZ7A 4BN4A 3T4XA 4R7GA 2AW5A 3AU9A 4NF2A 4PZAA 4XQ0A 5TX7A 2BFFA 2WUGA 3G2JA 2R79A 1R50A 3QUCA 2TMDA 3NKVA 4FEEA 4G1FA 3PEWA 4RSRA 4BZWA 4HHEA 3DDCA 3AIIA 3IILA 4ZMSA 4ZT6A 2ZUVA 1DIHA 2YZGA 1TFRA 3GAZA 4IHAA 3T99A 5L4SA 2J31A 1N2XA 1RACA 2FVXA 2XRFA 2WM8A 2WYWA 1W35A 3AOEA 3CZCA 3FJ1A 3GAFA 4ALMA 2YW2A 2OHXA 1X1BA 3PC8C 3CF0A 5EJ5A 2P4QA 4KN5A 4OK3A 4EHBA 1QB7A 3EZ6A 4AAYA 7MDHA 4TVOA 4PG8A 5KFEA 4JLNA 5J8YC 3R44A 1Z0ZA 4PLVA 4L78A 3C4JA 4K40A 3E9RA 2JCXA 3EGWA 1XXHB 1ZBDA 4GX1A 4E7PA 2Y1GA 4P4MA 2AUNA 2D0PB 3DYIA 5DBGA 2BR4A 3NALA 3NONA 4M1ZA 3ZDYB 1LCIA 1TM2A 3GVCA 2CLEB 9ICNA 4WESA 2GYVA 3EXIB 5TF4A 1QGED 1CR4A 5K3EA 5EEGA 4AJEA 2BHRA 5C46F 2JAQA 1UJMA 2B3DA 2JKZA 5AK3A 1NFFA 4NLNA 2HUNA 2VUIB 4B73A 4MV5A 4O4JA 3JQQA 1DIGA 3KFLA 3RT7A 1MG5A 4QEZA 2YJ6A 5KFTA 3RVMA 4P8RA 5JYBA 1JXOA 4OGKA 4DPMA 1IG0A 4MS3B 2M1ZA 1DWUA 3H8SA 3OQJA 5K0EA 4J1TA 1J2MA 1U3VA 4MQMA 4B0PA 2OORC 1GPKA 5DLPA 1VGVA 1OAAA 4IP0A 1ML4A 4U6PA 1TLLA 4F2DA 2RBGA 1P72A 2WAMA 3HRHA 3K9FC 1AE1A 3I8XA 5IF3A 2B69A 4UU1A 3KL2A 3NG1A 2BMDA 4IV5A 3C43A 5CLIA 4GYYA 3MWLA 1F17A 2ZIUA 4ZT2A 5H70A 1PBNA 3F46A 1QLWA 1VPTA 3LGSA 1L5FA 4JUBA 4ZCSA 1BPYA 3RQSA 3OX4A 2Q46A 2EKZA 1FTYA 4EB8A 3CZMA 2K4EA 4XM2A 4WRRA 3VHQA 4ZZ0A 2GJ8A 5J58A 2E55A 3IKTA 1KIMA 8ICLA 5CT9A 3UAWA 4AX8A 1GZ7A 3QKSB 4G01B 4BLVA 5BW5A 1TOAA 5IYZA 3NDBB 2QP4A 3CU5A 4KR0A 1EE9A 2WU8A 1G7CA 4Y2GA 4CQMB 2ZSFA 3U13A 3E3MA 4K9DA 3C41J 1QZTA 3CO5A 1CNFA 4JHLA 5EQDA 4OA5A 3QVOA 3CKYA 3EXIA 3EXHC 1QX4A 3HLTA 1UMDB 2EARA 4YO7A 2MUTA 2Z1DA 5FF9A 4S24A 2PG3A 3C5FA 4FBGA 5EYPA 4DR1B 1SHJA 1PR9A 4RU9A 1Z0JA 4J0HA 1C9DB 2X8JB 2QW8A 5BN5A 4WFKA 5C5IA 4Z6CA 4ZAXA 5JCXA 1OREA 1Q77A 4PLPA 4AO7A 5L7YA 2VUUA 4BUZA 2OSBA 4RPYA 1YIDA 2QORA 1SQGA 2WPDD 4U7WA 5I9BA 3TVDA 4E6PA 1NMYA 5B66U 9ICUA 4RQNA 1UBSB 3ZWQA 4AY5A 3SMQA 4B34A 2YDYA 3FZNA 2NU9B 3QLTA 4OATA 1UZAA 4POAA 3BJEA 1POWA 3ESBA 4GR5A 3SXJA 1VMKA 2FHPA 2HEIA 1II9A 3Q8MA 2SCUB 3KVVA 4IHQA 4OMCA 4NU8X 5CEHA 4PICA 3RVSA 4BLRA 1QQ6A 4DEXA 2W54A 1SC4A 1DKLA 4YR0A 2MSNA 2EDAA 1XC9A 1EG7A 1TUBB 2DBYA 2E5WA 2YOFA 3DMYA 5J5CA 4HDQB 1NDHA 3IODA 4MMYB 4PNHA 2AQHA 2C8JA 3A9UA 3VKHA 3DVLA 4NBWA 2X0RA 3COWA 3I2JA 4WCDA 1ZQFA 1OZHA 4FEGA 3TX6A 3BMXA 3D31A 3F53A 3QU4A 1TEHA 1I9GA 3WJAA 4EVIA 4PC3A 2L19A 3HP6A 2BC9A 4N8SA 1I7LA 4OUDB 4Z8XA 5JASA 4BEWA 5IJWA 4KLAA 2ACVA 4JX8A 3C1ZA 2CGEA 3HYNA 1J5XA 1RPNA 4B80A 1J0DA 5IXYA 1V9PA 3BBLA 1UMDA 4DT1B 1Q0RA 1SBTA 1VM6A 1L7QA 4F45A 1SQ0A 2E49A 1C5KA 4QXOA 3NVMB 2E8NA 1RAGA 1RAEA 5CLFA 2I1LA 3DMGA 1NJFA 1R4MA 1XXLA 3HB1A 5CNMA 3TVTA 3INNA 3TE7A 5HTOA 1ZGJA 3V1TC 1E8NA 2FW0A 1RBZA 5DSZA 1D2EA 4AP9A 4LWPA 4WFJA 1BS2A 2IHVA 3G2HA 4QWMA 1M1YB 2QRJA 2PTHA 3S27A 4KI0A 1USUA 3IFSA 3O1LA 1J0BA 1DAMA 4X1YB 3PK0A 5FYDA 2BHNA 1BSVA 2I2FA 1Z6AA 2CUTA 2NLOA 2XDQA 3DE2X 3O4HA 4FU0A 4V0ME 1EDDA 4L9RA 3WIVA 1EB9A 3DV9A 1PF7E 1MQSA 4H7JA 3FWNA 2JHCA 2IOYA 3LHIA 2MDTA 1ZOOA 1DDIA 4M60A 2WWIA 4X7BA 3RTEA 2C99A 3RYHA 2C2GA 2DUUA 3O8QA 1KI9A 4UE6A 1PFUA 3W5HA 4RBNA 2OFPA 4U7PB 1LWNA 4XYMA 3GAMA 3ILHA 4UOEA 2B5WA 4EG7A 3ZBUA 1QWSA 1DGSA 4AYBF 1EE1A 1OIXA 2VXCA 2ZJOA 4JQZA 1O0SA 2FSFA 3C6QA 4ZAZA 3RBZA 2MINB 2B7CA 3U2QA 2AUMA 4DMMA 4KLQA 3CZ9A 5HGJA 4Y8VA 1Z47A 3RIGA 4CFSA 3ZYCA 4GM1A 1RXCA 5G1NA 4D4GA 5LYJB 3U81A 2QM0A 3IXQA 3ROGA 4DCJA 5C3MA 3SR4A 1CR6A 1QGDA 3NRJA 1UK8A 5KFNA 2EGHA 3ONFA 4MJ7A 3JVDA 4S2UA 4QUBA 4WESB 3AHEA 1I4EB 4LF9B 1Z4KA 4YLEA 3V2HA 5B2FA 3ADOA 3KXLA 3LPMA 4JEIA 2YINC 3C5EA 1S9FA 1VIAA 1SZDA 4Z7OB 4WBNA 4ECRA 1ZMBA 4ERNA 5CLGA 1CNMA 1AN0A 1UXGA 4KPGA 5IKXA 4OEHA 4A73A 1RXYA 3QXCA 4A9AA 4BKOA 1AUXA 1XSLA 2Q0QA 3H99A 4MRNA 5JQGB 4K4GA 2IYUA 3HXOA 4LVNA 1PVPA 2E18A 3MJDA 2XE4A 2W0MA 3SC2B 1CRPA 4RTRA 4NFSA 3RH0A 2CK3A 2E4AA 3WNDA 4R9VA 4DSIA 1Q0HA 5BNIA 1F8GA 4HUJA 4PFJA 1YULA 5AKJA 1FVOA 3FIUA 5ICCA 4QFDA 5DK6A 5ULLA 2EF0A 4LXUA 1YRWA 3L0IB 2UUPA 4OQYA 3E3OA 4C0XA 3AF4A 3LX4A 2PXHA 2ZIEA 5CVEA 1UDCA 4A0SA 5B4TA 1G4HA 1GT6A 3Q12A 2WV7A 2W6PA 2VLBA 5HKBA 5KB3A 1WLYA 1S8OA 3GLIB 3CH4B 2IWRA 4KMRA 2G17A 4CKCA 1PVQA 4TV9B 1OYOA 5L40A 4V0RA 4W9RA 1R1DA 2EQ5A 3C1UA 9ICIA 4G1CA 1OYWA 4OBEA 3P5SA 3N7TA 2Q2WA 3KX2A 2JJ1A 4E33A 1Y3DE 1OYYA 3EMKA 1KHHA 5A03A 3ANNA 2HR1A 2JIPA 2DUWA 2ZDGA 1SIBE 3ETCA 4WOCA 4DBLC 2YFKA 4ER7A 1L4MA 2OZLB 4O0MA 1K8QA 2L82A 1U9YA 2P6RA 2C7BA 1G8MA 2QD5A 1C14A 5DM4A 2KOBA 1D09A 1LU9A 3LWBA 2Z98A 8ICQA 4GGPA 5CAEB 4DS3A 4KFCA 5H82A 3ZCQA 2FDCA 2XVXA 1PJAA 1VHJA 1G55A 3BEDA 2G5IB 3HJGA 3JAWA 1X7XA 3RT1A 1MQ8B 4GEKA 3VBEA 2QYSA 3RK4A 4PRKA 3MG9A 1T8RA 5IZCA 2NTNA 1G3UA 2O7NA 1IV8A 1AXGA 4GLJA 1WXGA 7ICNA 3QYAA 2BDPA 3D4OA 2B92A 4MW4A 4B7XA 1IAQA 1KEJA 1ZUNA 5JR3A 4FXOA 5KWSA 4H4DA 2I54A 1J33A 4N6GA 4M9ZA 1DCMA 1X38A 2C2HA 2I2CA 5JW6A 5CM2Z 4HLNA 3VR3A 4EM6A 3E15A 2ONYA 2RB4A 4IHJA 1P9NA 5L6LB 2NZ8A 4YRSA 4O3SA 3UKOA 1QK4A 1B8UA 2XCAA 1TUBA 2K6GA 2V7EA 3EVGA 4OI2A 5I5GA 4MS1A 5IXSA 1ISHA 1H38A 3OWOA 1Q0LA 3D2CA 4MVYA 1P7VA 5CB1A 3AHHA 4ETMA 2QARA 4DR3B 3KLNA 3WYEA 5IWAB 2O8CB 2A1JB 3I9V1 3PSPA 3BCUA 3OSUA 4F3NA 2KZ3A 2WYOA 3GWGA 1MHPA 4WOJA 3A28A 4JI1B 3ABQB 4G5GA 3ISCA 4B74A 2CK3D 3AEQA 4LC0A 5KVQA 2EIXA 2I34A 3PPXA 3L8HA 3H6GA 4UNSA 3KYBA 1K3UB 1BROA 2ZUTA 4Z4GA 1E0KA 4YXMA 1F3LA 2NU6B 3KHHA 2EH9A 5EERA 3UN1A 5J4LA 1XD2A 2GZDA 5F76A 5GOZA 5BVHB 4H7KA 1P1JA 1DEKA 5GY7A 1W25A 1ZMXA 1P0PA 5K8UA 2A9JA 2X6QA 4DCTA 2AK3A 2OCPA 3SAJA 4KQ2A 3ESYA 2WFLA 4ECXA 2Y92A 1QPBA 3IJRA 4R1SA 4XH9B 4Y6LA 2ZI4A 3E58A 4KQCA 3TZ6A 4DM3A 1RQ2A 2FRDC 4EH1A 4ZTUB 1JA1A 1TCBA 4DC1A 3JZMA 2VJBA 1E9VA 2O8DB 4LCEA 2X3UA 4ZAGA 4C05A 3M6WA 1NL3A 1UKVY 3IYLW 1MA0A 4IXDA 4RY2A 4A8HA 5LNK1 5TE9A 4B3HA 1FDWA 4N7RA 3FYDA 4IX9A 1YVPA 8ICFA 1Q0SA 4G0OA 2X15A 3ZD9A 4BMOB 3CFYA 5DLEA 1KL7A 2WW8A 1FXWF 2WJ6A 2J87A 1YFKA 4O6VA 4WBXC 4QHYA 2NW6A 1GV1A 1RYZA 1H6AA 1ZUIA 1XNRB 3I2YX 3ZHCA 4DT1A 1XRSB 3PU6A 4R9NA 3BTVA 1NT2A 4KGDA 3KVOA 5DM2A 4A6PA 2HU5A 2XT6A 2W7PA 1ADBA 3Q1LA 3LKDA 2E2WA 1ZIYA 3E4CA 5B5EU 3QMMA 4QBKA 3ND8A 2NU7A 4XIFA 1GZHB 2AFIA 4LK2A 5GMOA 2BQUA 1M6HA 3R4CA 4AK9A 5LXTB 4R2KA 1IDOA 1QIJA 3C98A 3AIMA 2DLCX 2GCGA 2OPBA 2PMDA 1NU8A 3JVEA 2C5SA 3K8YA 4DVGA 2F4NA 1FNMA 4K88A 4YPFA 4B9VA 3U1TA 3F5MA 1QYCA 1Q84A 3RS3A 1WBJB 5JD3A 3VR6D 3ZU3A 3VOSA 2F8SA 2ZAMA 2P91A 1BIFA 3HVHA 4R7TA 3TQOA 4REQA 1GPH1 4UM9B 4UB2A 4WAUA 3SQDA 2ZRHA 5SZHB 1ZSNA 1RWOA 5IDYA 2AIRA 3MR5A 4J2HA 1A5TA 1GTJ1 3HKEA 5CFQA 1JDZA 5A04A 4TQAA 2GPAA 4ZDIA 1Q0PA 2CCJA 4MRMA 2DH5A 5IC4A 2JEYA 5JSUA 2OD7A 1B00A 4F9GA 5AT1A 5HR5A 1PGJA 1JLLA 2XOEA 4LK3A 4RVCA 3VYVA 5BSKA 1DBSA 4I2FA 2REXB 3P2IA 3OJ0A 2PVCA 2DWUA 1UCVA 2P9YA 3GUYA 3UTDA 1GT91 3KZ1E 2BCVA 2PX0A 3GEIA 3KE9A 1E7MA 1JHVA 1O97D 2DPHA 3JQEA 4Q9LA 4JI0B 2WIDA 3NAZA 1B74A 1UR5A 3RIXA 3W4IA 4BEJA 3S4YA 3TRKA 4ZCRA 3N3BC 5LPNA 2R8IA 2XHEA 3I8SA 1S3SA 4RKWA 4CQMA 3N87A 1L5HA 2HC9A 3JQ9C 1OVMA 5DBAA 1Y4UA 2I7VA 2A2ZA 3HXPA 3KUKA 3PCTA 4FW8A 3M6XA 4KRXA 3DCJA 3KFUF 3BXHA 2ZTCA 1S4QA 3ECSA 5KSPA 2XCPA 3FZYA 3I04A 4M89A 4YCBA 5JXGA 1TK2A 4RIHA 5CJJA 4NAVA 1KH2A 2CDNA 4P5DA 4DYHA 1YHZA 1K63A 1A3CA 3NIFB 1VJ5A 5A3QA 1A1VA 1UXHA 4M2YA 1EGAA 2VATA 3FZGA 3FY4A 3ZIAD 1JQKA 1I8TA 2FJPA 4P31A 2BFEA 2J6HA 4W1SA 1V48A 2JLBA 2XRMA 4KJZA 5IMBA 5C31A 4F4UA 3U60B 5HJ5A 5K8IA 2R6FA 4Y1RA 1MQ2A 1S77D 1WP9A 2PX2A 1I7QB 1N8NA 1FP6A 1QCZA 1T9AA 4Y1RB 2H4WA 3CMCO 4P7BA 5EJ2A 1UBCA 1V47A 3W1EA 4DSKA 3BX1A 9ICHA 2JHPA 2QTTA 1TRKA 4ZIRB 1M83A 2OA0A 3D64A 1SURA 1DHRA 3ES9A 3GVIA 4G81A 4WY5A 5HCUA 3ZU4A 1JEOA 2EJVA 1VPEA 2YY5A 3NTRA 5CX4A 1GCUA 1JAIA 1S0VA 1Z4JA 3RVBA 4E22A 3X1JA 3K73O 3WAGA 4P0PA 2G77B 1ZQSA 2VJYA 3PXAA 1Q1BA 1I3KA 3ASUA 3E22B 3MTBA 4XJXA 3SC2A 3V7UA 1T8YA 3TW8B 3ZWDA 4FFRA 3NIDB 3G8YA 3PL5A 4QRHA 1BHO1 1FS4A 2C07A 3BTOA 3OTIA 1PL8A 4KWCA 2LD4A 4F2GA 3JQ9A 3ZD7A 1P5JA 1T43A 4ZRDA 2HPVA 3D3EA 4FZRA 2EZTA 3QW4B 4HEA6 3VVMA 3PX4A 2UVUA 3T7KA 5ITVA 1EWQA 4YYEA 1MNAA 1XYYA 3EA5A 4HTFA 3ZWOA 4ZCPA 1R7RA 3LUAA 2RGNA 1SXHA 2ATCA 4KITB 1VJ1A 4JLVA 1B4DA 4WXPA 3VGJA 5KNCD 4BVEA 4AMUA 3H4VA 3I1IA 1Y3BE 3NH9A 4RV4A 3VZCA 1KFEB 1ZQWA 4ZQEA 3WMRA 1XRQA 1L4LA 3NATA 4QIWC 4ED1A 2WUDA 4N0DA 4BFSA 4EKYA 3K9NA 3QVKA 2BEJA 1JIQA 5CJ7A 2H2DA 3ENKA 3M6VA 2VWPA 3TAUA 1NJWA 5DNEA 2HFJA 3C7AA 3Q72A 4L6AA 1SKMA 4BTVA 5FFNA 4I4IA 1UPHA 1V1RB 3P9KA 1ZGHA 5G02A 4I9FA 3WLEA 4JXXA 2HVIA 3U4HA 3KD3A 2Y0SC 1EA7A 1TNDA 2O2CA 3KEMA 4XWAA 2VJPA 2O54A 2EC5A 5CA0A 1QO0A 4OJOA 2OGZA 2D1SA 4B82A 3AVPA 5DGTA 3AXSA 3L93A 3LKZA 4PN3A 3IM1A 3TL2A 3UMMA 5TQ0A 2VVTA 2XYQA 2I1QA 1D5CA 3HB4X 1KSPA 4Q34A 2QLBA 2XB4A 2G76A 4TVBA 2PKQO 1UJ2A 4IHJB 3QXJA 8ICCA 4O3FA 1ZK2A 2DULA 3GNSA 3JYOA 4IJVA 5A7FA 5JAOA 3HPRA 3W4JA 3U7IA 2VXOA 4V0LA 4YRQA 3RSSA 4ZHQB 1SNYA 2EAPA 4RDIA 5BSTA 1YMVA 3L6EA 3VR5H 4JYMA 1L1EA 4R98A 3K9CA 2JI8A 3V7NA 3F7MA 2XUJA 3LWMA 2IZZA 3K0HA 2H3ZA 2ZR0A 1U04A 3T1NA 2QZ9A 3ZPXA 3ZK9A 1NGSA 1YASA 2G82A 3FGPA 3JQ6A 3Q0EA 5F5NA 4GMXA 1R4MB 1D07A 4GLLA 1L2TA 2QR2A 5ALPA 2A7QA 3KKNA 1JX4A 4P58A 3SLGA 1VIYA 3WE7A 3K1ZA 4I2AA 2JLAA 2GNOA 2SICE 1Q46A 3HACA 5T6MA 5JBQA 5AM1A 2VYNA 1A6SA 1M1YE 3COSA 4IJMA 4AXBA 1TCVA 1SU4A 3MMPA 4KZPA 2P67A 4EYQA 3W5SA 4ZYLA 2CLOB 4GC7A 3HA5A 5D3ZA 4QM7A 1M2NA 3GNLA 5E9JA 3HJCA 1KLNA 2QZPA 2LBOA 2ZT8A 4PHTA 3ZCRA 5CG2A 1N62A 3EZ5A 1A2QA 1X3SA 5E3JA 4HAZA 4D4JA 2Z30A 1T2EA 1XLTC 2OLEA 4R3NA 2A4MA 2FE4A 1QH8B 2CFSA 3IQGX 3S7ZA 2ISCA 2QLNA 2W2MA 4XJTA 3ONVA 1ESCA 1H2YA 1KMMA 3PFWO 5KFVA 4W7IA 2R1ZA 4DUPA 4HGZA 3D0OA 3PDHA 2ZRQA 3PFKA 3WGKA 2YQEA 2V4UA 1NBEA 4D8XA 3O8OB 5BV8A 1XTRA 4EFDA 1N2CE 3VPDA 1LBEA 4PZDA 4Y9RA 3EF1A 2IYEA 3HL4A 1LPPA 2GK3A 1W59A 4AP5A 1YR2A 2W37A 4JNCA 4OHYA 3CZQA 3IHLA 3QU2A 3QVJA 4CMIB 1XCLA 2FXVA 2GK6A 3WY9A 4CDMA 2P7IA 3D6HA 3F2VA 3CPHA 4MOWA 5FQNA 3V1KA 4JOBA 3J81A 1OI4A 5AXCA 1REQA 2BIFA 1HYBA 4QA9A 5L95A 1XDDA 1EK0A 1YRHA 4D92A 3V7JA 3EQ6A 3ADBA 3MWYW 3EEOA 1JFTA 3CWCA 1RRFA 3K9HA 4RJJA 5KVAA 1IVSA 4TZTA 4EHFA 2G9RA 3I5AA 5EQFA 1UDRA 3RRXA 1GDTA 1Z6TA 2FMKA 2ZROA 4WBNB 1Z22A 2B98A 2IF0A 4WY8A 4PCUA 2VT3A 1OQAA 4LJ6A 5F33A 3N8IA 1XWWA 3T5KA 4LE0A 1J49A 1NJ5A 2YJ5A 4L0DA 3KPVA 3EA4A 4M9UA 5KJ1A 2XZTA 5DB9A 3O7MA 2VTBB 2FGJA 1H05A 4P7FA 4Q24A 4JOQA 4QATA 4W1RA 1M8GA 2IBSA 1WHSA 1DV2A 4BRWA 4JLWA 3AY3A 3M4XA 2P9FA 5SZIA 1D4ZA 5BRJA 1VHQA 5JZBA 2HXGA 1TYAE 1YGYA 2BZ0A 1EGVB 3P9PA 4JJGA 3A3OA 2DQ4A 4L8WB 3HBNA 4QECA 2P90A 3SYRA 3GUVA 3THWA 3D2LA 4DOAA 1GFZA 2A1TR 4CTOA 4C01A 4WDQA 2Q6KA 3DFUA 4YTEA 2ZYIA 3H2HA 1WMFA 9ICKA 3B7PA 4UTXA 4LJKA 4X6XA 4X93A 3TZQA 3E9YA 3EGOA 3SD7A 4MYDA 3O90A 3CKLA 1VPDA 4WD3A 1XOIA 2J85A 4N4AA 4BO1A 2ARKA 3IP5A 4TKMA 4UVHA 5DKFA 4BB9A 3FCYA 4KXLA 4EKEA 3OQPA 2JLWA 3DEEA 2GEKA 5DM60 4BVBA 1NRWA 1OX6A 3FYUB 3GJQA 3RF9A 2AVDA 5HILA 4BBZA 1J5PA 3TZKA 5KX5F 5K3SA 3PW7A 1A71A 1U3UA 4PPNA 4BEVA 1XZFA 4HK4A 4JODA 1ZX1A 1IM4A 3OUTA 7ICGA 1YIAA 4UTOA 3KSAC 2NYUA 1QIDA 2ZI9A 4CW7A 2HHAA 3KC2A 3IOYA 3PWKA 4A36A 1T9KA 5AVQA 4OB8A 1U5BB 5TQVA 1VRVA 2R8HA 4ODIA 3OHMA 4BP8A 2XXAB 3VR6A 4GICA 1VP9A 2X0EA 2VA3A 1M1UA 4CF3A 1WZNA 1X0VA 1U0NA 2ZSKA 2ZXFA 3DDUA 3D02A 2NZWA 4UMDA 3O75A 2EJWA 3HKBA 2NO1A 3PVZA 3R4VA 4ILEA 1WUJS 5F7ZA 5SY6A 4V24A 4N9WA 5FUWA 4JUAA 4W8GA 4FEAA 5CITA 1UC9A 3SZRA 5AKHA 1GQSA 3E2IA 3ZOZA 2I4MA 2HV9A 1PZHA 2GB4A 1JG7A 1XYVA 1GNLA 1NVVR 1W87A 1M2VB 3N8KA 2NV3A 1IM8A 2JMGA 1D0SA 2JDID 2P9GA 1ZCBA 4C89A 3N0VA 5BSWA 4YQZA 3RAJA 3DLIA 3I45A 5C9ZA 4YD1A 1GPAA 2G9ZA 1OXXK 3CVWA 3PLAE 4ALIA 3PW2A 3WSTA 5EHXA 3JV7A 1QMPA 3T79A 5LSAA 3V72A 1E9CA 3PC4A 4DHEA 2XITA 5KKNB 2NO0A 2EATA 3FWHA 2OZKA 1JHUA 1Z5PA 2HQOA 1RJEA 4KH1A 5DCWA 5IP5A 4DMUB 5A0LA 2QTLA 3QTLA 1JXQA 1YFZA 2NOAA 2JH9A 3MWGA 4HXFB 1IUOA 2XX3A 4D46A 3EQ9A 4QODA 3NI2A 2LXNA 1KQFA 3LI2A 4LRTB 2K8BB 1G20E 3L41A 2PI5A 1FYXA 3FETA 3JZFA 3EUWA 5EQTA 4WJLA 4YRBA 2F76X 3O8BA 2B0CA 3Q5DA 3V3TA 1PDWA 5BOSA 1P2VA 3SDSA 2ZUDA 3R09A 2D0IA 3JQGB 2BCEA 1XE3A 1D0IA 1EE2A 3ICCA 2J5BA 4L4UA 5CH8A 4UEKA 4IZHA 3GEPA 1UT6A 4D99A 2YQZA 2UXBB 2IE0A 2PJUA 3H7AA 1LI7A 2Q0SA 1ARZA 2JANA 2IDZA 1EQAA 3IB6A 1E1YA 4E09A 1U8YA 3Q9NA 5JOQA 4IFTA 3ZE0B 1U3GA 2CUNA 4IH9A 5ISMA 4NBNA 2Q07A 2H5JA 4J1NA 5C1DA 1T9GR 2R1VB 3NGLA 3FGOA 5L9XA 1PTJA 1T9BA 2WYIA 3OIFA 1LRJA 4RWEA 4RK1A 3IAS6 1LY1A 4LBWA 4UEJA 3OTQA 4OBWA 3HO1A 3GLVA 4OJLA 4XCXA 4B3BA 1Z2EA 2P2LA 2Y05A 5DDYA 2VJDA 3JZAA 4OQEA 1I30A 3E53A 2JEGA 2CHFA 1E1RD 2RH8A 2ZZKA 4ND5A 4IX1A 2OQVA 5CA1B 4LY0A 4XJSA 2G1PA 4MRAA 4EG3A 5JJBA 1B41A 2OXEA 3DJYA 3NGXA 2O2ZA 3FWKA 2WAYA 5IKOA 1IK6A 2AW3A 3R3WA 1ECCA 3OO0A 3A26A 2BCRA 2WTAA 3JAKA 2O0LA 4TTSA 3ZW8A 3P9XA 1CVIA 3OT4A 2J3MA 3ESDA 1DG3A 3AEUB 1Y7LA 1QE5A 3U4GA 4HVCA 3MRSA 2IYQA 3OCYA 1T3GA 4WNYA 4Y9SA 1Q11A 4O2RA 3RRHA 4DCOA 5IT4A 2VA9A 2AT1A 3LDAA 5ALFA 1SY7A 1V5IA 1V8BA 2ZSIA 3AJ8A 3K09C 3TW0A 5E38A 2V6JA 3LP8A 4I1IA 2FZCA 5LMNB 2H5EA 1ZGCA 4QZIA 1G41A 2HHTA 2NO6A 4Q5IA 4RA6A 4B3DA 1DAOA 3BJIC 1WSDA 1CRLA 2COEA 2X9NA 4DXAA 3MSXA 5IDQA 1PFQA 1XFAA 3EYZA 1T2FA 5LDDC 1UMCA 3JRWA 2NT3A 4Z9FA 4DMGA 4GKKB 4DJJA 3LECA 1Q83A 2XY6A 5A0FA 3EW7A 1IUKA 3OA0A 4NQRA 4DR7B 3QVUA 3SI7A 3PHJA 3G6YA 4XQ8A 2I7DA 2OOKA 1HZZC 2Q3CA 1PZMA 1PI3A 1FRFS 1MQAA 1YKGA 1IZ8A 4RZSA 2ZB4A 1TA9A 5DBBA 1TTPB 3EXAA 2X8JA 3O1HB 5K3CA 3OQIA 3NASA 2V9ZA 1X7YA 3RABA 5KTPA 4YMMA 1YZ6A 4J0QA 3SJCA 4JJEA 3DE4X 3OE4A 4R83A 5J4YA 2VF7A 1X80B 1IXZA 3BDIA 3KXIA 5DG9A 5LZ4A 2QG6A 3CNLA 1SAYA 2A14A 3R6LA 4H27A 4R9RA 4GLXA 3BXFA 3L49A 1ABFA 4WN9B 4XIJA 4WZAB 1JKJB 5DHSA 3PITA 1XA3A 2RHRA 1TJYA 2DUNA 4MHOA 2BMJA 3B1WA 1E6CA 3IAXA 4QUAA 1POXA 4FE7A 2X0FA 3QIAA 1QRSA 3ZHOA 3WWEA 2XMGA 3FTPA 3RVOA 3U48A 4BNTA 5ALUA 4NU5A 2FFRA 4ND1A 4J9QA 4AIIA 1SIWA 3OCVA 5KYKA 4C07A 4ISCA 3KKLA 5LMCA 3FLMA 4TX1A 1GG2A 3FLBA 5H2FU 4R1NA 2W8LA 4M53A 5IAJA 3WQQA 4J9MA 5BYJA 4RQ0A 4L8VA 1EVLA 2J30A 2HUPA 2YHBA 3TLXA 2J0EA 2I3AA 3JALA 1ONSA 2HJSA 4AS3A 3LNCA 4CMEC 2OCGA 3U1BA 2VJMB 1X9MA 1IJKA 1ICIA 2H51A 3G8AA 2O9JA 5ALRA 1SPBS 1QF6A 1THTA 4IM7A 5EESA 2JAPA 4WK0B 4EX6A 1G2IA 3QKWA 5KKCA 3OZEA 3IQZA 1F12A 1QQTA 3R0IA 5HOEA 5F9FA 4GXQA 1ODLA 1ADCA 4G2NA 5LXTF 4DSTA 3HP7A 2A0KA 2PD4A 3D81A 2L42A 3S7TA 4B47A 2PGLA 4EELA 1C1HA 1LZLA 4I2IA 5K0CA 3BWCA 2ZTHA 2G25A 4G8JA 4WLUA 4ER0A 2RHCA 3SBXA 2AXEA 3DMTC 5F21A 5G40A 3BZKA 1X40A 1G18A 1XN1A 3AJ9A 1SUIA 2HSEA 4RESA 5TS3A 3QSYA 2YZMA 3HV2A 1XTQA 3RPEA 1WHTA 1S01A 4BNGA 1BXGB 1XJQA 4FS2A 1CQIA 1XZAA 3AIKA 3B7WA 4NBUA 4HR7A 1Z8NA 2YZKA 5AQEA 4RQMA 4N0EA 1XQ6A 2IGBA 4F84A 1SV0A 1E2IA 1R74A 1U8ZA 4Z86A 5KNIA 4DA7A 5CDUA 2X1LA 2W6ID 3D6UA 2AN1A 4R1TA 3VZSA 3H17A 1ZQXA 2QX9A 1KMHA 3ZDXB 3TTVA 1SC3A 3A31A 4DREA 2GYUA 1XRLA 4X95A 3THRA 4FI3F 1ZNYA 3TTSA 3ZKWA 4D97A 2XE6A 3K75D 4IR1A 3FTCA 4OFZA 4JFAA 4YXWA 4E6EA 2R25B 3R6TA 2F90A 1DOAA 3IO3A 4MDYA 3U3DA 2XAUA 5HZMA 5KNDA 4UBJA 3H2BA 1RFLA 4YMOA 2CFCA 2CWWA 1RBQA 2UZ1A 2BI4A 3HG7A 1BFDA 4JP5A 4XYGA 3NOOA 2IEAA 5EJGA 5AVJA 5FI1B 4HVLA 3FOEC 1EFCA 4UD2A 4FHZA 5AJTA 3VAZA 2P0EA 1GA4A 3CNBA 3AVUA 3H04A 3SEIA 1IY1A 1G5FA 4RY8A 1RC0A 3B2NA 4J16A 3AJEA 4M21A 5TS2A 3ANXA 1V16B 5JLAA 3AMZA 3UG7A 1ZCAA 3KQMA 1IM5A 5AFSA 3G0BA 2CFRA 3M1IA 4K1LA 1K86A 1R18A 1DX4A 2GRAA 1LC3A 5FBRB 2WF6A 3CN7A 3ZCUA 5K3FB 3HCNA 2NSLA 4RTQA 1X7WA 4WN3A 4EJMA 2H3FA 4D9IA 4F56A 3EULA 2EAOA 1R0YA 9ICWA 4XI9A 4KXVA 4X54A 3KJXA 3GPIA 1P17A 1CEYA 2ONKA 1TZCA 3AR7A 4QGHA 4WKCA 1QG0A 2N42A 3RJ5A 3HX0A 3U3ZA 2G4LA 3KYDA 4MUEA 4YCCA 3U4QA 4K3VA 3OPMA 4LJ9A 1NVAA 2FQ1A 3HEMA 2PKWA 1KJNA 1LD3A 4LI0A 1A7AA 4CR6A 4EITA 4KLTA 1I1HA 3QSGA 5K0FA 1H2BA 1LDYA 1U28C 1XVLA 1B1AA 2R5FA 3JQ7A 2F17A 3A1CA 2HSGA 3KR9A 1A98A 4JC5A 4R4JA 1YI8A 4MUYA 5K2OA 3QX8A 5DIZA 1L5SA 1SXJA 4PYMA 5BQ3A 3BFKA 4R0NA 1N32B 3ISDA 2AEEA 1KJZA 3DEJA 3BA1A 3DVAB 1MX9A 3PUWA 421PA 5IASA 4QNLA 2HNAA 3FTQA 2ZS9A 1J0AA 2XNJA 1WAMA 1QG4A 2V5AA 3WGQA 2RDIA 1KRHA 4RQ4A 1RE1A 3T7TA 4R68A 4MRRA 3KHLA 4H77A 1DBVO 3EGIA 3IE0A 2XCIA 4L7QA 4PIMA 5AOAA 1UIRA 4IDDA 4NEQA 2O19A 2CVPA 1W49A 3DNMA 3S5UA 4BQNA 4IRDA 2C9CA 2DWCA 1G8JA 3JYLA 3Q2KA 2JK0A 4B4OA 3SR3A 4EI9A 1GZUA 1XTJA 3D7RA 1T0UA 4YDRA 2O5CA 4N5NA 1P9LA 1KTQA 1N6IA 2FEWB 4OPMA 4W5HA 4MCJA 1N75A 4HB4A 3PG5A 3IDWA 1D8TA 5J2AA 2DCMA 3P9YA 1T7PA 4FT2A 4GH5A 3UAGA 2R7LA 2J3KA 1UXOA 2Q6TA 4P33A 3WXMA 1EJ0A 1S8AA 2PMFA 3WX0A 2MRLA 1I7PA 3R9IA 3FPEA 3ZJ5A 1EUDB 1TUGA 3DXYA 3EG9B 4EVQA 2W48A 4DTIA 1HRKA 4BFWA 1FPMA 1TF2A 2Q3EA 2BCQA 2Y6UA 2QM7A 2Z4RA 2LYHA 5EOZA 1ZL2A 2J7PA 2RAPA 4XGRA 2QS9A 2OYSA 4Y9UA 1SA0B 1A69A 2QSZA 2XMPA 4HQFA 3VO1A 3LUFA 3A6HA 4WKPA 5AKZA 3NHJA 4B3CA 2XZOA 1JDSA 4PLGA 3PBKA 5C8YB 4Q3NA 5FPKA 1KZYC 2RHGB 4PN7A 1A27A 3N9IA 1K1QA 5D4BA 3NDJA 3HEBA 4RIEA 3S81A 1YOVA 5CDGA 1P1KA 4H59A 4ALNA 4Q45A 2IIPA 3GW8A 5CJ2A 2A86A 4LTDA 5IAKA 3SBEA 1XCBA 3QZUA 3M83A 3FPKA 2WUFA 1N63A 2RC6A 3IIIA 4MUGA 3H0CA 5AYVA 5GPBA 4ER6A 5FV7A 2XD4A 3KAQA 2XCOA 1BAPA 4E4TA 2FMHA 3DEIA 5IJXA 5JO9A 4OB7A 3K1AB 1YE5A 5F12A 1G3QA 4AI6A 3KZMA 2HA6A 4RQUA 2HHSA 1U2QA 3MPOA 3NH6A 4J0FA 2VPZA 3TMKA 1CY2A 4IR9A 4RZIA 6YASA 1HFEL 5CLHA 2CNKA 3B0YA 2GBFA 2VHWA 3BIFA 4CMCA 1U1EA 3KIPA 5A7HA 2O8EA 2KHVA 1EFPB 1RPLA 4UHKA 1K5OA 2BFNA 1BTOA 5EUBA 4Q3EA 4CG0A 5DGAA 3ZBPA 4AWXA 2LPEA 1KH3A 2ZB8A 4E94A 1SHKA 3CEMA 1XDZA 1NXOA 2F00A 4WZBB 3L4BC 5JAQA 2B2XA 4ZN6A 4TTTS 3DCYA 1V4BA 3R7NA 4R66A 2ODQA 3BRWA 3OE7A 2H0QA 2XY5A 1XD2B 3T12A 1J20A 2NV2B 4Z54A 4JUZA 1AQYA 4EI8A 3EFOB 3WADA 1WMEA 4NL4H 4H18A 1R4ZA 2C9YA 2C2OA 2GZ3A 4M0FA 3E81A 2VPWA 1ZAKA 1WBBA 1SM4A 1A9SA 1AVTA 3LL4A 4C7XA 1YXMA 3PHBE 1UWCA 1YR1A 4CEIA 3NJRA 4KN8A 3N76A 3IIJA 1A97A 2M6KA 2BQ3A 2BKXA 2YZNA 5BOLA 3QBTA 5CYGA 1DLIA 1JJIA 2Q8NA 1DRJA 4BWMA 1MU0A 1YAHA 1M34B 4CTJA 1OU4A 4BLTA 5KYGA 2H63A 3PIIA 4RZ3A 2VZ8A 4LF5B 1FS6A 4TUSA 2R4UA 3ZZ0A 2CXNA 4MUKA 3GIDA 4PS0A 3TCNA 3P0EA 4KX5A 5J2GA 3K20A 1E2HA 2H54A 2EV9A 1JNXX 2J07A 2X0NA 3D8UA 3IQDB 3K7EA 5EIWA 5FPSA 1IZ0A 2W4MA 5B1SA 5J1SB 4RM3A 3VNVA 2RJNA 5B58T 4IUDS 1P0QA 4BLPA 4C0AC 2G06A 2I6TA 4EGJA 3LC7O 1UPTA 3VYRB 1NVKA 4Q66C 5F1YA 5BRAA 4P83A 4QPZA 3JPNA 3BXZA 4MUNA 4KAFA 3L0BA 5KPJA 1KKUA 3ZIAA 2HBQA 1N2IA 3K8QA 1SUFA 2Z8YM 3A3KA 4XR9A 2WWVD 5IJ0A 3SEAA 4IZOA 2HA5A 2ZRJA 4B79A 4Q43A 1ZKDA 2VP5A 2YWXA 3CYFA 4MV4A 4TTIA 4RH3A 5IAGA 3REQB 3EPKA 1U02A 1E96A 3AFNA 5DG7A 2R5WA 4TTJA 5ALXA 3NBAA 3TAQA 1NI5A 2FWBA 3FB4A 4LISA 2ORYA 3HABA 4FZMA 4XSGA 2YXBA 4GNRA 4FGZA 2GPWA 2P2DA 4I19A 5K0BA 1CETA 2Z08A 3PJDA 5DNUA 3LPDA 3QUQA 2FKAA 4V1CI 5KTKA 1VE5A 2Z9CA 4YJDA 2XIDA 2B34A 3BE4A 2L2QA 1G7SA 3ICOA 4X1OA 3R7LA 4ABYA 3UENA 1YQ9A 3B0XA 4MQ4A 3BERA 4FXPA 2ZG6A 4LHEA 1H5QA 2XBUA 2LYBA 4HNQA 2V6BA 3BWVA 3MZ0A 5KUTA 3MQ2A 1UMBB 3RYFB 5I8WA 1XSEA 5J0OA 5LMZA 4LNUB 4Y6SA 5CFZA 1WY5A 4F5OA 2BMEA 4RETA 3R7DA 1J0EA 2AOVA 3MGGA 4K9RA 4OFXA 3K1TA 2LIVA 3BULA 3LX5A 5CTJA 1BPZA 1FQJA 1MGPA 4IXWA 5JISA 1KYZA 3HUDA 1P3JA 5DRYA 1HV8A 1KSFX 2KHZA 4P1ZA 2ZRMA 5FUXA 5CCBA 3B38A 1BNCA 3THYA 1DO0A 1FX1A 4Q9NA 1QCKA 1SULA 4FCWA 1ZQZA 2E1PA 4GBED 3HCCA 1T34A 5BVGA 2Q5LA 3OEHD 3R76A 4WECA 4QBHA 5J2CA 2EDCA 2B4TO 3LHFA 2KK0A 1QO7A 4D1YA 1C1XA 1L9KA 2ZK7A 1C20A 1C1XB 3ZWXA 1HDGO 1CVLA 5ER6A 2O3RA 1SBQA 5IIKA 3A3YA 4CV3A 3T9CA 2IXEA 5ADWA 5G3ZA 3UJBA 4WOPA 1RNLA 4F5EA 4F96A 4LF7B 1NJZA 1WR8A 4RXTA 5BWMA 2QJTA 3ESZA 3NUGA 4Q3CA 1L5OA 2FNAA 2H31A 3IT3A 5FWDA 1S0OA 3CJTA 2PFKA 2D13A 4R63A 1B16A 2G28A 1E2LA 3C5HA 3GCWA 5LA6A 4DXHA 4W99A 2EFYA 2ODBA 2I1WA 2QSYA 1Z3EB 1NK6A 2O7QA 2IITA 3JQ7B 3OPNA 3O9MA 3SOZA 3SAGA 2B99A 3DT9A 4ZV4A 3UM9A 1ULUA 3S2SA 3W8DA 1W19A 1OLUB 3L1UA 2XB8A 2F6RA 3DLHA 1GQYA 3G23A 1B0UA 2PX3A 2WFZA 4NZMA 4NCHA 3BJMA 4HB3A 2CHQA 3L5KA 2V58A 1VLBA 2RRDA 1T91A 1KAQA 1R64A 2G07A 2OCKA 3DHWC 4MXDA 5TV2A 1V8DA 3G2LA 4IZIA 2ACWA 3CHYA 1W7AA 1KZ4A 5JD4A 1G9SA 2CMHA 4Q1BA 1E94E 4DA9A 1N5LA 1WWVA 3A14A 4HWRA 4B76A 4JP8A 2HJGA 4G1UC 4FFBB 2XKBA 3F47A 1E5QA 2VPIA 1QSYA 3FZEA 4IEFB 4AG3A 2WZQA 4BCCA 5KNBA 1ZJ4A 3O31A 1NMEA 1S2LA 2XODA 3BZUA 4JBLA 1U0JA 1F2UA 3L0YA 4TROA 1IZYA 5FFMA 5TXGA 3T9BA 5BQXA 1P7PA 4FNAA 3MCVA 1WWUA 2AWNA 3U4AA 1QBGA 2FLPA 2YV4A 3CJQA 4Y2HA 4BV9A 5JCOC 2EP8A 4BVGA 1XROA 4F4FA 3DC7A 3A0BU 3TACB 4UPVA 5BUQA 4HNAB 3CLVA 3ZUGA 1CJTC 1PHPA 2YWEA 3GUHA 4KFRA 4ZOCA 1U11A 5FO0A 1F4PA 3EE6A 4DLXA 4I4TB 5T41A 2JGAA 1GUZA 4P4NA 2ZSAA 5DZSA 5FBQB 4ZHQA 4FDTA 3PC8A 4WXEA 1L5MA 3DE0X 2WP0A 1GADO 3E0FA 1JFSA 5HQ3B 4Q00A 4WV3A 4MQFA 4AT1A 3HE3A 4ZZIA 4PLWA 2A1JA 4NMMA 2OFXA 2AYYA 4HMOA 3A2KA 1U1FA 2FSHA 4GSLA 4KYIB 1VJDA 4LWZA 4PHCA 2P9EA 3WMEA 4KN7A 4P6VF 1E1QD 1EMDA 4OY3A 1P1IA 2G8NA 2O2HA 4RPJA 5J0WA 1WHTB 4LV5B 4P54A 2HBRA 1PZXA 1Z5OA 2VDWB 5AVKA 3OY7A 3C3WA 4Q9JA 5JS6A 2D62A 4IGFA 4DBZA 4MWGA 1H4QA 1CIVA 1TEXA 1SXJE 2WJGA 1M2FA 4GE0A 3R7FA 5IWCA 1EYZA 3WAJA 1H0SA 2IS1A 5FLKA 1NUUA 4LYAA 1NQWA 2YYAA 4FYXA 2XXJA 4C4SA 1Q12A 2A0UA 3UXMA 1M33A 3DB2A 1LWOA 1BD4A 2XCLA 3Q40A 1XNGA 4JI5B 5CU7A 4DJDC 4UNNA 1BE6A 2OAEA 3H1FA 3LBYA 1J2YA 1EVKA 5A02A 3FSGD 3IIMA 1PUXA 2B25A 2BGTA 5A7GA 5LUBA 4K0RA 4MVJM 3NNDA 2RHTA 2ATXA 3OH8A 1IE3A 3I01A 2KX7A 3HZOA 1Y63A 4M8LA 4MWSA 3ZWPA 4ARSA 5A1TA 3COJA 5IILA 1HE3A 1RBYA 3AYZB 3BMQB 3PT9A 4HZIA 3OWXA 3V1YA 4OYYA 2YYYA 2IMWP 1DQPA 2Y1EA 1ETUA 4K2AA 3DFFA 4AZWA 1ILEA 4BBJA 1P1FA 1OE0A 4MLDA 2BEKA 4FCVA 4BVLA 4CT5A 2HZ7A 1Z0FA 1MX3A 2O8DA 2Y9MB 4S12A 2ZJ8A 3R3SA 3TL6A 1Z8FA 1SVNA 5DBEX 2NACA 3AESB 4ECZA 5DT2A 3EG5A 5EIOA 3VJMA 2D5CA 1W2GA 2VK2A 1KQNA 1UKZA 1VIVA 2QAGC 4S1WA 2O3QA 4MF8A 2R8XA 4YJHA 1A82A 1ZC4A 1ZVMA 1LEHA 1UC5B 1U8TA 3CX4A 4JQCA 3OZTA 5IJ0B 3GC6A 3ND7A 5FR1A 3PX7A 1O8BA 5LP6F 1LKZA 1LX6A 2YQ4A 4O2LA 3M6IA 4QYIA 3PNCA 1RXVA 1PD1A 1U0SY 1GFWA 4MW5A 1ESDA 1U9JA 1M6NA 2BUCA 3B5JA 5DHUA 1Y8RB 3P2EA 2CPRA 1BH6A 9ICQA 3TFSA 4XRRA 5CBKA 3K0AB 2J6BA 3NT4A 5JH7B 1KETA 1MC5A 1T2UA 4O3OA 2JBAB 3I05A 3MXTA 1PTKA 2V59A 4WPGA 5H59A 2CNBA 2PL5A 4HP8A 2DY0A 3EIQA 5JG7A 3VTKA 2I8LA 4WOKA 2WFLB 4DIBA 3N1UA 2X19A 3VXKA 5KHLB 1GGMA 2JASA 1KO8A 2VT7A 5AI4A 1F6BA 4YMSA 3V1LA 1NBMD 1XK6A 4LX8A 1DI0A 1GZDA 1QFZA 1H22A 2H7VA 3EZFA 4UB4A 3R41A 4ARBA 4YMVA 2B1IA 2KN7A 2GZAA 6CHYA 2EBHX 2BM9A 2WINI 5KJFA 5IC5A 2AR0A 3LXMA 2V9CA 4WX2B 3U80A 3FFWA 4PAOA 2LRHA 2NQ8A 1L7XA 1OBVA 5TR9A 2UUCB 4RHCA 1JS1X 4QZHA 5JFGA 3QPDA 4YAFA 4QWCA 2GVNA 2HMAA 1YL7A 4MCIA 4OQLA 3T7SA 4IXTA 1FX0A 3N0TA 3DOEA 3KYCA 3A1DA 5FEUA 3GDOA 3I6ZA 3VR4A 3UOGA 3IMKA 1SEVA 1DTSA 2F9FA 2HM7A 4CKEB 2AZXA 1LC0A 2DFPA 4HB0A 1H2ZA 1GEEA 3OD1A 4PLZA 3IBSA 4L1KA 4CLRB 5H7XA 1E9EA 1MIOB 3A05A 5CFMA 2WD7B 1QAQA 3COZA 5HE8A 5DB7A 1TA4A 1ZINA 3FLAA 2AZDA 1ZJZA 5CAEA 1T15A 2ZRDA 2IPNA 4I1RA 4XZ3A 3GRFA 5AVXA 5F9LA 3OIYA 1P62B 3VR5A 2HTEA 1KK2A 1R0SA 2CXHA 4KL8S 4QUKA 5D51S 5BWNA 3M4YA 3HDTA 3CUUA 2F48A 2IZ6A 1S0NA 3KU1A 4MWBA 1AN9A 4DIOA 4RPLA 1WD7A 5CGZA 1XVTA 5G4KA 1NVUQ 4IRKA 2IXAA 2Y0BA 3IJ5A 3EH1A 4OHCA 4M4SA 2ZTDA 3IBCA 3PEVA 5H83A 3RFVA 2AKEA 2IXTA 3GJZA 4U8HA 3ZWAA 1QAMA 2B83A 1PJBA 4NOKA 4M22A 3WTCA 1V9SA 3R74A 2C7PA 3CRW1 1Z5NA 3N86A 2V9WA 1U0RA 2I9PA 5CXSA 4B6FA 4EBBA 3L7NA 2EX0A 4H1HA 1NBOA 5E9AA 5B3JA 4GQBA 2J3EA 1LFDB 3OUUA 3IALA 4JH0A 5AI6A 3F6EX 2FW6A 4OHOA 3LA8A 2KJ5A 2OL4A 3RU7A 4J75A 5HM6A 1LPNA 5ANRB 3RM3A 2NZXA 3QITA 2CUZA 4F5NA 1NK5A 5E4FA 1YL5A 2FCRA 5BOSB 4D6XA 2QN6A 4BNKA 4FOLA 1ZMOA 3LWDA 1W1WA 4P7JA 4TS9A 3W7AA 2BUAA 3T7CA 2QT1A 3QZ7A 3LJKA 4EQZA 2B1RA 3PT5A 5KG3A 4CPDA 3AINA 3C3XA 2RHMA 3L0ZA 2WSBA 2VH1A 1XP8A 2B20A 2M98A 2PR7A 3SICE 4A8TA 3FNBA 1O89A 2R86A 1UKEA 1P1BA 2VDVE 3TOVA 4NM1A 1F38A 3VO9A 2ZI3A 1GD1O 1QNFA 1UPAA 2VYND 3C3MA 4ZTBA 4K3UA 3T5CA 2Z1MA 1YMQA 3CTMA 3QPCA 4M1TA 4WKNA 5FTJA 3T8YA 4N3CA 4BHTA 4NBSA 2F3UA 5IIJA 4OOEA 4B2YA 4EYKA 3HJFA 4ECEA 1IU9A 1N1GA 5DEOA 3WK4A 3G2PA 5BSVA 3SYLA 4Y2TA 1YRLA 3KHKA 3W06A 2UYQA 3MMZA 4RGQA 1UM9B 3BIJA 1HLPA 3PFHA 3QWAA 2AH5A 1C7EA 2WAXA 2GK7A 1DUVG 3GRUA 3VZPA 3JXEA 3LQRA 3THXA 1I9CA 3QY9A 1GARA 3CZRA 4WBSA 5F2KA 5H3LA 4E46A 2HQSA 1DQNA 2YMLA 4YMHA 3ADDA 4FZVA 3DXFA 2PFQA 1PYOA 2QRGA 4YR9A 4YCXA 4OJMX 1P81A 1X2BA 4URXR 1KPIA 2ZJ3A 5TMEA 4RQ2A 2CVQA 5EWMA 1ECGA 2BEUA 2WV9A 4Q4JA 2F55A 1KBUA 1M76A 1BXRB 3PWSA 2I6XA 1OXMA 1X6VA 1AKQA 4GSKA 1RWVA 4R8MA 1U2ZA 3P9IA 3ZR4B 5K0LA 1HDIA 2JEIA 2J8ZA 2PZBA 3RYCA 4F5RA 4JOSA 4V2UA 4X1KA 2YJ3A 1YRBA 1GGVA 1RR6A 3EEBA 1JTVA 1EINA 3OJFA 3PTZA 5JS7A 2PUTA 1EFPA 2W7OA 4IRXA 1DC4A 4FKZA 3TQQA 5C51B 3C3BA 3GLRA 4F06A 1YZQA 4MULA 5K8CA 4DUZB 1N33B 1U6JA 5CP8A 1E1MA 3BORA 3O7WA 2JZBB 4CIAA 3PC3A 1V97A 5KFIA 2NTYC 1RSZA 1FYFA 1IB0A 1Z4OA 1GO3F 2DPLA 3K1AA 3P96A 4MAFA 2H4ZA 3SHOA 3W2HA 4ANFA 4KDCA 1P5FA 3IUEA 4OQQA 3D6AA 2EERA 2QJFA 3PDJA 2PV7A 4F7WA 4O4HB 3FMGA 4O5KA 1RVDA 2Y99A 3UUGA 4C08A 2WZCA 4ZPJA 2MMGA 4F5YA 1DEXA 3EYAA 3I32A 3O95A 4J90A 2OQRA 1O9GA 1B2LA 1TK0A 2A0WA 3EUEA 3P27A 4CI0B 1Z56C 2BONA 4JWNA 1KVTA 3CKMA 4FEYA 3BFXA 2QVXX 4K03A 2WU4A 1W0KD 3AI1A 3O84A 3PB3A 3OAAA 1LSSA 1NYRA 4IAOA 4NMWA 5I01A 3NHPA 3F2DA 2LDXA 1WB6A 4DG9A 4IMIB 5KFSA 3QLJA 3NCHA 4M46A 2JAXA 1NK8A 2C83A 1H8HD 1RCFA 1Q95A 1O08A 3KQTA 1G9TA 1FP2A 1UC8A 1QV6A 1Y7HA 4OU5A 3NOQA 5G0VA 4FGLA 1QUEA 1ZNWA 2XKAA 3WZLA 3BGVA 2JLXA 2J6CA 2ZJYA 1HEKA 3BS7A 4NPAA 2DGZA 1M2OA 2CLIB 2GEFA 2R4TA 9ICVA 2WOOA 3HKDA 2JFOA 3L9XA 3G5LA 3ILVA 4YCJA 2E5FA 2VDOB 3KQWA 3MGCA 4UEWA 4AN0A 3W5JA 4BWYA 4POOA 2QBYB 2VQ6A 4RNMA 2A92A 3RH4A 1WF3A 1F2TA 2WD9A 3OZRA 3RTDA 3E48A 4D79A 3VU1A 2RJ3A 1TM1E 2CKDA 3IVRA 4KACA 1D2AA 4MRPA 3ZDFA 1NAIA 3SAHA 3RFUA 1TUIA 2B30A 1IRIA 4BWVA 1QHNA 4NFLA 3FFXA 2FPIA 4F4JA 1WTAA 4HVAA 1L5UA 4BLQA 5IEBA 3IBGA 2ZBFA 3N2LA 2VL7A 4BO4A 4XJVA 1BNPA 1AZSC 3K0BA 4TXMA 1HDRA 4ND2A 4UAJA 3U31A 4DLYA 3EPGA 1GZVA 3C21A 4MQEB 4MF2A 4RUKA 2PUFA 4BC0A 1S3FA 5F7JA 5C53B 2CFIA 4UDYX 4PZOA 1IYZA 2PPLA 1Z2DA 4CF6A 5THKA 1UKAA 1ICEA 2HWKA 4RPZA 5H0IA 5I9MA 1BH2A 1OGYA 3NAGA 2Q49A 3RTVA 5F7XA 1Y8RA 1ZXLA 4FE3A 3HA2A 2QB0B 1E4OA 5BR7A 1MORA 3VC1A 1P6XA 3IUYA 4KPFC 2BFWA 4C3UA 1HTTA 2Q9CA 4L6CA 4V1CA 1N6OA 5GVSA 3OQOA 2YXNA 3DP9A 3GG2A 3TD6A 3HCOA 1IBKB 1Y1SA 1I32A 2E87A 1T2VA 3NETA 3V8PA 2XPCA 5K9ZA 4JU9A 3BE8A 3OT1A 1OBHA 4FGJA 4KV7A 4CR8A 4CWAA 3CLTD 3K1JA 4JJFA 1N6KA 3A11A 4QXQA 4YJHB 4J0IA 4O4LF 2CVHA 1XRJA 1JDTA 1JHRA 2OYYA 1Q50A 2G9QA 2Z4TA 2BP7A 1L7MA 3R3UA 5KZMB 1AHIA 2AOUA 3TQRA 4JUFA 1U2GA 5AM0A 2P5SA 4FFWA 3TJRA 1AXEA 3ZTYA 5TLSA 1I2CA 2ILVA 2X7HA 4YPVA 1AO3A 1B4FA 1X1DA 2I4NA 3RD5A 4OU4A 3TBKA 2FOXA 5ED0A 3VHRA 1FLVA 2JBHA 3VR3D 4E2FA 3ZD8A 1E6KA 1ILWA 4TMKA 3ZZNA 2P5YA 2C98A 2AHRA 3ZNOA 4YRRA 1CR2A 4F1KA 1LW6E 2BP7B 3RSGA 3PUXA 5DHAA 2ZB2A 2JI9A 4JBHA 1EH5A 3HVUA 2KBEA 2ZAYA 1KP9A 4MVJD 4X8MA 4CKCB 2YHUA 1UJ4A 2HLPA 3PEFA 5JHGB 1HORA 2P9CA 3H7IA 3A1EA 1TE2A 4GOXA 3MILA 4X20A 4LXTA 1R9MA 2DKXA 5EHQA 4ZVKA 3QWIA 2IOHA 1JR6A 2C28A 5ALEA 3W90A 2O1XA 3Q11A 2BKAA 2PSHA 3TLJA 4CDRA 4EEKA 3HY6A 5A5FA 2ZVJA 3I6QA 1HUOA 3PUVA 5CW1A 2ZJ4A 1SFRA 4XWTA 1D8BA 5DP2A 3RFXA 3QOXA 3HB9A 4WJZA 4D44A 1OI3A 4ZVRA 4F85A 3MWEA 4FJ0A 1HY3A 1E3WB 3AUUA 2NV0A 4DLAA 2Z6VA 3IG8A 3BYZA 4GVPA 4HBZA 1E3MA 1MAHA 1TKRA 2COKA 2X5OA 3KT3A 1CF2O 3OZXA 4X7RA 5F4BA 5JDCA 3H1PA 3FNRA 4J0EA 3AUTA 3HLKA 3G6KA 2QTNA 3GJSA 4JP2A 3AVTA 1IG3A 5H81A 3QNUA 5ALKA 4I2CA 1NP6A 1IOZA 2FY8A 1D7AA 3UWSA 1PSDA 2QRVB 4K81B 4AUEA 3BH0A 5C80A 2X6TA 1QH1A 1E1DA 4CM9D 5T4EA 4BLUA 1EP1B 1YR3A 2DHDA 4JP3A 3N8GA 3JQAB 2GZHA 1LPBB 3ZIDA 4QZDA 1ADYA 4XWWA 1U5CA 1EBBA 5CYPA 3Q8RB 1UM9A 2FW9A 3G6XA 4L2IB 2QMEA 4ENVA 4HRAA 1NXXA 1A96A 1YCGA 3FSEA 1ZM9A 3K4PA 2IU3A 2W9CA 1HXHA 3HU1A 3TX2A 5ITSA 3VSAA 2G0AA 1PCXA 2GM4A 3HKZC 3QENA 5SICE 3W9BA 3A6EA 5J0PA 1GWNA 1N92A 3T3PB 1VA5A 4C8MA 3JPQA 3EVNA 2DC1A 3CMMA 1NF3A 5BYBA 3GH3A 1K6IA 1MOSA 4PWYA 2BLLA 4M9GA 1P73A 1OH5A 3AF5A 3TOCA 2WFAA 2GAJA 4CF4A 4IIVA 3A04A 2F1HA 3DYVA 4HS4A 1X13A 4RPCA 4KAAA 1GA6A 4KLNA 4EA9A 2PBLA 2YCLA 4AF6A 2W11A 4DNOA 3NHMA 1VLVA 5EQJB 1D6SA 1Z5GA 4EO7A 1VKNA 3DEAA 2YVKA 3EWSA 1KIAA 4HRVA 2JHDA 4N7JA 4OIMA 4Z3DA 2PRYA 4AD8A 4B6OA 5JANA 1QGAA 3CT4A 4JP1A 2DFNA 1VJTA 5HA5A 2NPFA 4G4SP 1WZEA 2C5GA 1IBRA 2EWMA 2O23A 3BTUA 3IS3A 3QUSA 5IKEA 4B33A 4Q9AA 1JKJA 1RHRA 5EE0A 4R2HA 5DMHA 5LKRA 2GM9A 3Q7QA 1GM5A 2G5GX 3R9KA 5G4LA 2FP3A 4O5CA 4EPYA 3PL1A 4Q0MA 4UVEA 4DS5A 1L8QA 1I3LA 4OV6B 3KKAA 1VKHA 1Z5WA 2OUKA 3OZGA 3I2IA 1Z35A 3R0ZA 2O2IA 2DKFA 3AB7A 3U9TA 2XH8A 4IICA 1YBHA 3U61B 1KK3A 4NENA 1SOAA 2W2VA 1Z15A 3ANYB 4MYHA 5J40A 1KPHA 3HXMA 3RJIA 1VSUA 2IYNA 4X44A 5FUBA 4Q1CA 3JWJA 4MV8A 3H2GA 4D02A 2VJ5A 1DQRA 3QU7A 1L3BA 5AO9A 5KAIU 2A3VA 2EL7A 5TF0A 4MI6A 3TLMA 2IH5A 4DRXA 2OWEA 4ENQA 1I2BA 1PNTA 1S2NA 3WQRA 2WF5A 4BAUA 1Z37A 1KMCA 1QRAA 1XAHA 4FR0A 1QOQB 2HY7A 4QOIA 4ED0A 4CM9A 2ZRLA 4A03A 5G0SA 1CU1A 1ZOSA 1BO6A 2ZWPA 1MV5A 1ULZA 1DBIA 2Z56A 2PZ8A 1V3UA 2ZYRA 3M6MD 3NNNA 2P9TA 4TYQA 2ALJA 3UICA 4DCUA 1TEZA 1UBGA 1J0XO 1YDMA 1T36A 4JBYA 3KLOA 1NN0A 4OSEA 3RVNA 2BFPA 2X0DA 1W85B 3TLYA 4PYOA 1OA1A 1IN4A 2P30A 1MOQA 3OF5A 4BFXA 1F2TB 5LXTA 1WYGA 1MBZA 2RAVA 4OHMA 2GLXA 1C81A 3IV6A 5HM8A 1N6LA 1Z4MA 1S5LU