3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
4UMEA 3U13A 5AKIA 2OYCA 3MPOA 2EATA 4AP9A 2JAOA 2FPXA 1YDFA 5ALYA 2ODAA 3ET4A 3WK9A 1QH9A 5AKLA 3EF0A 5AVQA 3FPBA 1FEZA 5ALRA 1RMQA 3ZWDA 1O03A 5AIBA 1Z5UA 2GHQA 4NV0A 2FEAA 2IOFA 2YY6A 5ALVA 2WFAA 3QUQA 3AR3A 5AVRA 3KBBA 2IYEA 2Q4TA 4AS2A 5ALTA 5AI9A 5ALMA 3SD7A 2ZBEA 3U7FB 2OM6A 2B1QA 3L8GA 5ALPA 3TLMA 1ZRMA 3QU5A 5AKEA 4YIKA 4KNWA 1KYTA 3QLEA 4YCLA 5AM2A 1RKQA 3QNMA 4J03A 5AVZA 2I7DA 3BWVA 3PCTA 4CF4A 1RQLA 1L7PA 4KYTA 5AVUA 3UMCA 1J8DA 2RARA 4XE5A 3CNHA 5AM1A 3U7EB 5ALDA 3FPSA 3S6JA 4BNDB 3A1CA 2W11A 4XQ0A 3GYGA 1U7PA 4IFTA 4C4TA 2ZBDA 5A3QA 4JDPA 3SLRA 2HOQA 5ALFA 3ZUPA 1ZJJA 5AVWA 3QU4A 1T5TA 2GMWA 2VKQA 4BEWA 5JJBA 4IG4A 2G09A 2ZOSA 3ZVMA 4KX3A 3DV9A 4GXTA 3WKBA 5AKHA 4UATA 3ZX4A 4EEKA 3P96A 3UM9A 2X4DA 4Y2YA 3PGLA 2FPRA 3B8EA 3RF6A 5AW2A 5AW7A 3KD3A 2CN1A 3WGUA 4Y2VA 3VAYA 2G08A 3NIWA 2G80A 2FI1A 2FPWA 3M9LA 1NF2A 4EX7A 2C4NA 2I33A 2ZBFA 4I9GA 3ZTYA 1CR6A 2NYVA 3BA6A 4CNQA 5AVYA 4JB3A 4J2TA 2W4MA 5AVSA 4O8CA 3L8EA 3A3YA 1F5SA 2B30A 4UMDA 1Y8AA 1EK1A 3MMZA 3EWIA 3IB6A 5AW5A 3QGMA 1PW5A 2FPUA 3KZXA 2QLTA 2FPSA 2JAUA 5ALZA 3PDWA 4BX3A 2FDRA 5ALLA 4NFLA 5A3RA 3CZ4A 4Y2RA 1ZD4A 5AM0A 4YCNA 3A1EA 4E88A 1ZOLA 4UM7A 4XPZA 2C88A 2WM8A 1Z4MA 4UASA 3MN1A 4OFZA 4NABA 2IOHA 4HGRA 4QQFA 4FFDA 4OCZA 2G07A 2HF7A 5AI5A 5ALIA 4H1WA 2EARA 3AR5A 5AI4A 5AM3A 4Y3UA 5ALQA 2YMQA 4CF3A 2C8KA 5IT4A 3DDHA 2ZBGA 1WZCA 3FGOA 4L57A 2HDOA 1RLOA 3WGVA 5AW9A 4G9BA 4DFDA 1RKVA 4BX0A 2C9MA 3RFUA 2O9JA 4L6AA 1QQ5A 2GHTA 5AM4A 1N9KA 2YJ3A 2HSZA 2G06A 4NAVA 4YGYA 4YCMA 2HO4A 3FZQA 1U02A 3EPRA 4HGOA 3ZW7A 1RMYA 3OCYA 5IT0A 1NRWA 1QQ6A 1L7MA 2YMMA 1WVIA 2B8JA 3ET5A 3L0CA 1L7OA 1U2SA 3N07A 4F72A 2HI0A 1YV9A 5E0OA 1L8OA 2CFTA 3IJ5A 3L7YA 2ZXEA 4UMVA 3QX7A 4OD0A 1X42A 1ZD5A 4UAVA 3ZI4A 3OCVA 3QUCA 4HGPA 4DW8A 2C8LA 1RLTA 1U7OA 1Z4LA 2BY4A 5T41A 1VFPA 2HX1A 3SHQA 3E58A 1JUDA 2FUCA 3WK5A 1RDFA 4DCCA 1RLMA 3KC2A 2RAVA 5IS2A 3WK7A 3IRUA 5AKKA 1Q91A 3NASA 1Z4NA 3ZWKA 3PGVA 2I54A 4OHFA 4HAIA 1MH9A 2G0AA 2P11A 5AW0A 3N5KA 3ZVNA 1RQNA 1Z4QA 3U7HB 3E84A 1SWWA 1WR8A 2PKEA 4HYTA 4EENA 2NO5A 3L8HA 3QXGA 1L8LA 4Y2JA 2JGAA 2QYHA 5AI6A 2DQSA 2O2XA 3I6BA 1U2TA 2W43A 4Y2PA 5AKJA 2HF2A 3D6JA 3QUTA 1NNLA 2B8EA 4BBJA 4B6JA 3K1ZA 3DAOA 5AK5A 2IOFK 2GFHA 1ZD3A 3MC1A 5AK4A 3L0YA 5AESA 4C4RA 3U19A 1ZRNA 5ALXA 4HGNA 4QJBA 1TJ4A 5ALWA 4CF5A 4MWOA 4UU0A 1XPJA 2FUEA 5AHXA 4Y2TA 2YJ4A 3SKYA 3ZTWA 1RPZA 5AW3A 3AR2A 3I28A 3SKXA 5AK6A 4UM5A 4EX6A 2CFRA 4KX5A 3B9RA 1AQ6A 3R4CA 2R8ZA 3WKCA 3OCUA 3EF1A 3SF0A 2P9JA 4GIBA 3WKAA 4Y2UA 3QYPA 4YH1A 3QU9A 1Z4KA 1Z4PX 3M1YA 2WF6A 3N28A 5ALUA 1J97A 3AR7A 4PNHA 2AGVA 3W5AA 3F9RA 3OTQA 4UMFA 3WK8A 2ZG6A 3R9KA 4DWOA 3KDPA 5ALGA 2YBDA 3AR6A 5AW6A 1XVIA 5AVXA 5AW8A 1TE2A 4UAUA 2YMLA 5ALKA 3AR4A 4ZEWA 3W5DA 2HEGA 3ZX5A 2I34A 2WF7A 4Y2QA 3NAMA 2YFYA 3L8FA 4XOUA 1RRCA 5AW1A 3N8GA 2NO4A 2D2VA 3L1UA 3NUQA 4KN8A 2IA5A 1SU4A 2PQ0A 3E81A 4BNDA 3OCWA 1LVHA 5ALNA 2P27A 5AKZA 1LTQA 2I6XA 2YJ5A 4UU1A 1QYIA 4FYPA 2Q4RA 2HCFA 5AIAA 3ESRA 4UARA 4KNVA 1XP5A 1L6RA 4BEVA 1IWOA 2RBKA 2P69A 2OA0A 3FVVA 5AVVA 3QUBA 3B9BA 4NWIA 5A3SA 5AW4A 3KOOA 1O08A 2Q5EA 5ALOA 3FM9A 4ZEVA 4BX2A 2CFSA 2AUTA 4Y2XA 3WK4A 2HHLA 4CE6A 3R09A 4C4SA 4I9FA 1L7NA 1WPGA 5ALEA 2WHEA 3ESQA 2WF9A 1Z4IA 2WF5A 1RC8A 5ALJA 1VJRA 3ZVLA 3E8MA 3ZU6A 5AI0A 1RMTA 3HYCA 1ZD2P 2PR7A 1Z88A 5AVTA 3AR8A 3AR9A 3UMBA 1S8OA 5ALSA 1YMQA 1ZS9A 3ONNA 5FP0A 1S2OA 3WKEA 5AK3A 3OCZA 1N8NA 3U26A 3A1DA 3N1UA 4Y2SA 3NANA 1QQ7A 1YJ5A 2I55A 3I1YA 2B0CA 1Z4OA 3QU2A 2YN4A 3L0BA 5AICA 1VJ5A 1YNSA 2AH5A 2EAUA 2YJ6A 3OPXA 4ZEXA 3HLTA 1YS9A 2OBBA 2WF8A 3U7GA 5AKXA 2MU2A 4UW9A 5AKGA 4FE3A 3L5KA 5ALHA 4EELA 2B1RA 2BDUA 3NALA 4YIHA 2YMPA 4BYGA 2JARA 4MUMA 5AI8A 5AKYA 2JAWA 3I76A 2BDEA 1CQZA 1K1EA 2R8YA 3QU7A 4AS3A 3DNPA 3UMGA 3W5BA 1RKUA 4BKMA 4RESA 1SWVA 2G1AA 3WKDA 4RETA 2B82A 2GO7A 3L1VA 4F71A 2R8XA 3OCXA 1Z4JA 3ED5A 4G63A 1T5SA 4L6CA 3NRJA 2MU1A 1Z5GA 3SMVA 3W5CA 1TJ5A 1EK2A 1TJ3A 4EZEA 1TA0A 1T9ZA 2R8EA 2RB5A 2AMYA 1Q92A 4HGQA 2MSNA 3WK6A 5AM5A 3J7TA
chains in the Genus database with same CATH superfamily
2QN7A 4UDYX 4YACA 2C4UA 1A77A 3TL6A 2DWOA 3WGKA 4KWHA 3RK4A 4RJIA 5K45A 3DGFC 4G8BA 8ICMA 1ZQEA 1LZKA 4QZDA 5A1JA 4OHKA 5F21A 3O38A 3L7NA 3B1WA 1F0KA 3G6XA 2CFCA 3QUSA 5B6IA 1DB3A 2F8KA 1HUOA 3E03A 1HQDA 4BPBA 4JUZA 1ONOA 4LHVA 1DIRA 2QLMA 1QH1A 1T3GA 2QG6A 2VOJA 2P2DA 1DADA 4WZAE 5T4HA 3LUDA 5J4KA 1GSOA 5LXTB 4IG4A 4MKIA 1I4LD 3R7DA 3ZX4A 1MVNA 3JQDA 3NGLA 2R48A 4M21A 3N86A 3JVIA 2X0FA 1DBSA 4RC9A 1ZICA 3CH6A 5DDIP 1LKYA 1D9FA 4OMFG 1IATA 5IDVA 1Z00A 1WQ1R 2K8CB 4KBGA 5AJYA 2JI9A 2HLPA 2POCA 2JFVA 1I2CA 3I34X 4TMYA 5JZMA 4PHCA 4II3A 3IEVA 5IIKA 2Z1NA 2QMHA 2AQIA 3F5QA 5BSWA 2OMEA 5CLGA 1O58A 2O54A 3M6LA 4BMOB 2RCYA 2EF0A 4BXOB 3DQQA 4EPXA 5CG1A 5ALQA 1JB9A 2KWIA 4WWHA 1GCAA 4QUAA 3CMMA 3UXNA 1XRQA 3IQDB 4RH0A 3DXXA 3E82A 4G41A 1JLRA 4CT5A 4R84A 2YICA 2GD2A 4YAFA 1VZ3A 1ZGHA 4TSRA 1W96A 5EWLA 1KHTA 2N9UA 4QARA 2C2KA 2QTZA 4ZTZB 1U0SY 3ZY6A 3HL4A 5CYOA 2KN7A 1M6VB 1P7WA 3ZHBA 5DBIA 2XTMA 5EJ2A 2NZWA 3I4LA 4P7JA 2XY4A 1Z4QA 3NOQA 3FOWA 3CEMA 3G8YA 2HCRA 3ZPXA 2DECA 3A9UA 5G0VA 3VKFA 4U2KA 1D6JA 1DC7A 3JAWB 4M3NA 1A82A 4U7HA 1X38A 3W9UA 4AG5A 2WFZA 4OSEA 4O4IF 3DBVO 3H83A 3C5VA 1L5UA 3ZI0A 5E4FA 2IOFK 1X1BA 3CX6A 4C4RA 5FX2A 4F3TA 1VL0A 2ES6A 1Y4DE 2EKPA 1IV8A 2CL0X 1L1RA 2WAQF 2OV8A 3K72B 1QRTA 3WDKA 1RW4A 1OHHA 3GDGA 3ICQB 1T9KA 4FIDA 1Q46A 3BZUA 3UK2A 3DVAB 1QU2A 2J9FA 1QTQA 2DOKA 2Z04A 1J2JA 2CK3A 3KB6A 3QIAA 5JXGA 3DWEX 3E4DA 5C46F 3DGEC 2WF7A 1I3NA 3O92A 2XCTB 3U17A 5JARA 3H87A 1FYWA 5C31A 1BHO1 3BMXA 4XM2A 1HDOA 4TV8F 1EFDN 4JVLA 2QD1A 5BN4B 4S2UA 1VBKA 3VISA 4YN4A 4O8ZA 1TEVA 5CAEA 1T2AA 4G2TA 1IMOA 3GHYA 4Q9LA 1BE0A 2CLOB 3V7YA 3D7MA 3OVMA 2EP8A 2FQWA 4HLUC 3CY6A 4JSTA 1QAQA 2CC2A 4WIAA 3ZVLA 4DBLE 3IOMA 1UZLA 4FSHA 2HY7A 5JZBA 1RWKA 1UKAA 4DLRA 3RADC 3NVZA 3P0HA 4NNOA 1LDBA 9ICPA 4MV7A 4WKNA 3WISA 2DLDA 4ZEXA 4BFTA 2VDWB 4M0DA 2DWUA 1C9DB 4B6RA 5KTNA 2D8AA 1EQ2A 4D3ZA 3PJDA 3UWOA 4JT2A 2JXJA 2CXRA 1FLNA 4DCOA 1EAYA 4LC1A 4CBVA 5FOTA 3AVUA 5D00A 3EULA 2O4CA 1T9BA 3PFIA 3U80A 1CUAA 1N78A 2RB5A 3D2CA 4RKEA 3VR4D 3ZE2B 2R751 4ZI3A 4KLRA 4YG2A 2SICE 3LQ1A 2EJTA 1WUTA 2J3MA 4C2UA 3J81A 3AESA 3Q7TA 2ENWA 4I5GA 3AVQA 5AH0A 4QASA 1YZTA 2ENUA 3QFSA 1BKYA 4MQ6A 5TQ2B 1NY5A 1KAQA 1SXEA 2B9VA 4KXNA 3N0XA 3N2GA 3T3IA 1RWMA 3EIQA 3RBXA 2ZBVA 1EZZA 1XXHB 1M1NB 2DTEA 1JLKA 1PJZA 5ERGB 1MO2A 2QTCA 2OZLB 1WZ2A 3MTIA 1KO4A 2VJNA 3BFPA 3RJGA 1XAGA 1VE7A 4QODA 2Y71A 5H7XA 4MJ7A 4DQLA 3WGLA 3W5UA 2GM9A 1NI4A 2H1WA 2V3CC 3FZYA 2QWXA 1WWUA 2IGTA 3B8EA 1VI2A 4LSWA 3M6UA 2BHTA 3DCNA 4G09A 4HNHA 3EGWA 4NENA 3CMCO 4TTRA 4CNQA 4UREA 4XWAA 2P8JA 2DUUA 1MVLA 4DY4A 1YIOA 1UPHA 1G6HA 5B58C 5MFZA 4IGAA 4IV0A 3WHIA 1H5NA 5BNTA 4C7BA 2X6TA 3ND5A 3HLYA 1N9GA 3C29A 3UJDA 4IHKA 4IMIB 5FHQA 1YZNA 3RU7A 4YP0A 1ECPA 3E5NA 3WGVA 1BH6A 2PD6A 2E18A 4XM1A 1GXSA 4DAOA 2WDPA 1DBVO 4OYYA 5EE0A 4BMSA 2Y1CA 2HO4A 4K40A 4MW7A 2AQ8A 1PV1A 4DV7B 3EHDA 4ZZ0A 1Z62A 2H0AA 4IXMA 4F4WA 4GR4A 3T12A 1Z2PX 2RD2A 2ABWA 3MQFA 3E8XA 4WJKB 5CIYA 1TT5B 2OLKA 4OHFA 1QFMA 2O3TA 4ABYA 2UYGA 1HLFA 3LSYA 3IBGA 1J8YF 1D4ZA 4BCCA 2I5HA 3TRHA 5HHIA 2Z2ZA 3E9QA 1ZONA 3GA0A 1MTOA 2RJNA 2VUSA 4XWTA 2REQA 3LX8A 1P0CA 3L3BA 4OBWA 5DP1A 2Q1SA 3H5TA 2F8TA 2IXGA 4LS3A 1COKA 3RV3A 5C34B 1M7BA 2NU6A 5KFQA 2ZQYA 5J2CA 1IZ9A 2VP9A 1EE2A 3TMKA 3JPPA 3T38A 1JDNA 2H17A 3SHVA 1NW5A 1C8VB 1W46A 3TSAA 3GT3A 1NKSA 1YVRA 4MK4A 4F8RA 5DLGA 1RRCA 3C23A 2FZWA 4ZFNA 5F7ZA 3MUNA 1S9HA 5BN5A 3CG4A 8ICBA 2Q1UA 2I66A 2VYCA 2QK4A 5A0TA 1U1EA 2DFKB 1Y6JA 2AQHA 4GX1A 4LJ9A 2WAYA 3DEHA 4W9RA 3QUBA 2VJAA 4O2RA 1TTTA 5AQEA 4KFSA 1U5BB 3I05A 5JRJA 4O5OA 4M9LA 1F8UA 1QSSA 4CQLA 4L07A 2YS6A 4H15A 1XDUA 4I1SA 4TS9A 5AVTA 1QBKC 2DCUA 3CUEF 3FTPA 1G17A 2A2ZA 3BFXA 4RMGA 4HY3A 3RYFA 3WL6A 1PBNA 1T2VA 4LJYA 4JQSA 4EKDA 3LW7A 5L9AA 1OW5A 4HDKA 5DM0A 2G4CA 3ISJA 1NBME 3KP1A 4E4TA 2NM0A 4E1BA 4MHOA 2BPFA 4R8MA 2Z5VA 1IAVA 4EY6A 4PFKA 1W85A 4R05A 5DE3A 3LVWA 4JDUA 4O9MA 1M3SA 5FULA 4PYOA 3GUVA 5CVCA 5KFXA 3PX6A 821PA 4P6VF 2RBGA 1X7ZB 2Y1JA 3KOUA 1ULUA 5HIJA 1KORA 1RZUA 9ICMA 1G8MA 4TZ0A 3PNYA 1FBNA 3GD7A 1VPEA 3G5MA 1Z8HA 5AVRA 1N2SA 2ZRDA 2P75A 3ZDAA 2GTIA 1YUMA 2ZT6A 2EW8A 1Q2XA 3SIXA 2XA1A 5DYTA 3R74A 4PC1A 1HDGO 4IUYA 3COWA 4NJMA 4ZHQF 1A0PA 3DAHA 3DMRA 9ICAA 5BWLA 3V3TA 3I6MA 5KTMA 3N8NA 2XGMA 1T3ZA 2FFQA 4Q7EA 4ZQHA 3GLFB 1SXPA 2GPWA 3Q0IA 1BEZA 2Q6KA 1QHXA 3TVDA 4O4JB 2BAGA 1K7EB 2FMHA 3CRNA 2H1LA 2OENG 2C7VA 2ZZKA 3VNVA 2FWMX 3RYHA 2O7NA 1I33A 2QMZA 4PIMA 3N3BC 1AKUA 3TJRA 5B3JC 1WP4A 3KKEA 1VPDA 5TB5A 1K6XA 1S2IA 4JSRA 3PLRA 1WM1A 2RLTA 3O6VA 4X1OA 1B6RA 4DTCA 3WLIA 4DV1B 3U7RA 4G24A 2FF5A 3MRVA 3TNDA 1R6AA 4HB0A 2LXNA 1I2DA 3RUPA 1VE9A 4M9JA 3HE3A 2EHDA 2K8AA 5IKEA 1L7BA 1KP3A 2WYWA 3HY3A 3KQTA 1JFFA 2OAGA 2ODPA 2IV3A 5JNTA 4R8RA 4O2BB 1YQTA 3NAGA 3EUWA 5DEOA 2ECFA 2Q28A 1OH8A 5EMHA 4H16A 1BFDA 3A6GA 5IABA 4RZ3A 5JCJD 3I64A 4MCIA 4YV2A 1N2BA 3EXFB 4PRLA 3AEQB 1M67A 3B9JA 3DVRX 1UDAA 1XNSA 5TQVA 3WV4A 1PWHA 3CZMA 4KMSA 4BQEA 4FP9A 4WXEA 3ONVA 4HGPA 3A06A 1CBUA 2ZJ5A 5C0YA 1GTZA 1N3IA 5GV8A 2AXPA 1MORA 3NVKI 1R0XA 2O8CA 2RGRA 4CEHA 2HA7A 3P9XA 2Y0PA 3EXEB 2R86A 1S4QA 4LF6B 5KKCA 4RADA 1PZGA 4F0JA 4BKUA 4OIFA 2RMKA 3OZEA 3C1OA 1KH2A 4DREA 4BO0A 2MMCA 3H5RA 5D87A 4B6QA 1Q7TA 1GPLA 4XRHA 3DBRA 5C4MA 1OF1A 3K1AB 3JQQA 1E4EA 3PKZA 2OGWA 1XSNA 2JFBA 3OX3A 2WJWA 1DAHA 1B0ZA 1OI2A 1JXMA 1AQ6A 1FP4A 4I2GA 1M76A 2EZXA 1SK8A 2H5LA 3PGXA 2IWRA 2O3UA 4QUDA 3QU9A 3H18A 3JQ8A 3UPDA 3X43A 2J9GA 1AK1A 4HMQA 3EPJA 4AMBA 4BFZA 3WP1B 2BOVA 2H0RA 2KV2A 2R11A 3QUAA 3F6SA 4BLPA 5B2EA 2OXOA 4UJ3A 3D4OA 4ERNA 1ADJA 4INPA 2G1KA 1I10A 4TLCA 3E48A 2WJ6A 4GLBA 4AT1A 3ZE1B 1R6VA 4IRMA 4TT3D 1ZKDA 5K01A 2NUAA 3R6WA 5JFOA 1KDOA 1E3DA 4PRKA 2P5TB 3DEJA 3QBJA 2FEPA 3ETDA 1USIA 3WJ1A 3PL1A 4HLDA 3TM4A 2OCDA 3DCIA 5LZ5A 4F45A 3UBMA 4V39A 4LZOA 5FPYA 3KXPA 3BN3A 3AQIA 4YUXA 4Z8XA 2OEPA 1JKJA 3A05A 3PUVA 1SN7A 3F5MA 1NSFA 4NJ8A 1ZEMA 2BFBB 4GRDA 2C59A 3M1IA 3EH2A 4JELA 4NYIQ 2IOQA 4UE2A 4MA5A 3I9NA 1QCZA 3QU2A 3QFCA 3ZWAA 4JKOA 1UKEA 3BGVA 1OAKA 3Q7QA 1SL1A 1QIHA 4RU9A 2CLCX 1O94C 1DKQA 1UM9B 1E79D 1OLXA 5TPZA 1UBLS 3ZE8A 1ESZA 3ULKA 3B5EA 4LHSA 1QC5B 5HF8A 2YRWA 4AS3A 2IUYA 1FLVA 2OAEA 3UJPA 3KVYA 1R9MA 1EDBA 4ZVUA 1Z7EA 2VJYA 2WG0A 3G7UA 2V4ZA 3KOWA 4HFJA 3TAHA 3CX7A 5DXJA 4C7OB 3P8ZA 4Q24A 3OQJA 9ICHA 3T9CA 5JBQA 3CS3A 4DBVO 4B9VA 5KNBA 1LC0A 5JC1A 3C45A 1Y98A 4WN9A 3BXHA 3FF1A 1IN1A 2BMVA 4MKHA 3V8MA 3WK9A 4LZPA 1MC4A 3DBLB 5J0WA 5HE9A 1NK9A 5EUQB 5JFGA 5KMGB 2V6BA 5AKEA 2QD2A 3F6RA 2P2GA 2H07A 1HH4A 4IJUA 4IOJA 4RIGA 1BMFD 5J2GA 1T8UA 3MJSA 4YWJA 4FX5A 3V5NA 4TQGA 2HQBA 3WE7A 3NDRA 1NKTA 3O4IA 3LNCA 1FIUA 5TJ9A 3C1YA 3IV9A 4WZ6A 3DVQX 1K2VN 3INGA 2HOQA 4MVXA 1NW7A 1OUMA 4G0VA 4CL2A 1AKEA 3AY3A 5ED4A 1LD3A 4Q9HA 4D8XA 4F2RA 5AW7A 1CZKA 1AC5A 1VXRA 2FLKA 8OHMA 4AJ1A 1O6ZA 3WYNA 3PENA 4QZCA 1DKLA 4MDHA 5BURA 2EW1A 1UHUA 3PCRB 4REMA 1C80A 2ZI4A 4YRIA 1YBFA 2PBZA 2YYYA 5TE9A 4KQJA 4KLEA 4UVHA 2E8PA 5IN5A 1JEDA 4IL5A 1CUVA 3EIEA 2ZB8A 2I80A 3R5FA 3JD2A 4EGFA 1QV9A 1TYEB 4D2IA 1VFNA 1AUOA 2RH4A 1KPGA 3NRZA 1MMFB 1YI1A 1XRNA 2R6JA 3AR5A 2DPIA 1UWKA 3DTVA 4EDHA 1XL1A 4O5KA 4U7GA 1MPXA 1BDMA 4Y30A 1OA1A 1QDLB 2OBLA 3OEHA 2EX4A 1ZQRA 1SVIA 1IB6A 5A4MS 3D59A 4FQ7A 4Q9DA 2DKZA 2UVWA 1UBMS 2GJKA 1QGAA 3GRPA 4N49A 5CP2A 4AYBF 4M47A 4LW8A 2JEFA 5JDCA 2WE8A 4QVGA 3OY2A 3FSEA 1MLDA 2PLNA 3RTVA 2JL1A 2Z9CA 1F8YA 4M8NE 3PQ7A 3QKUA 2EHJA 2C8LA 3DW1X 1XU9A 3TKYA 4W8HA 2FPMA 2BHNA 3W34A 1XHEA 3L04A 3AZOA 1CDZA 4PAGA 5TT0A 1HKHA 5JFTA 1X9GA 5DI3A 3TIFA 3OP1A 3ZD9A 4O25A 2ZT5A 3OTHA 3VA7A 4C3ZA 5ED0A 2J0UB 4M0MA 4L75A 2ZYHA 1Q3UA 1JLLB 2HRZA 3R7WA 1TL7C 4JN6B 2ZJ3A 4RPKA 3OHBA 5DEIA 1T4CA 1E2HA 3ZGLA 4BTLA 4BNUA 3JQRA 3HPOA 1HA3A 1XNQB 2Y1GA 2R6FA 5JECA 2B61A 2YS7A 4Y2TA 1AKMA 1NBIA 3BEDA 5BOSA 5EZYA 2V7VA 3A9TA 3UUGA 2WMDA 4WV3A 1ESMA 1MAHA 4ZREA 1MHPA 3SENA 4E2YA 3AHGA 1VA4A 4CLXA 4K0RA 1J2YA 3BE6A 2V7UA 7AT1A 1J20A 5F1YA 1NZJA 2FW7A 1I7DA 2CBGA 5ELMA 2GBPA 2EX0A 3PUJA 4PG8A 3CZ5A 1O6BA 4JI3B 3NM6B 4UC0A 4R4JA 1K66A 2X58A 2A9VA 4QJIA 1MW8X 1QYVA 1AH2A 2VYVA 4O0MA 4TRMA 1GNLA 3C3XA 1TMKA 2P7HA 5ILQA 4EF4A 2NZVG 4JCOA 2KHZA 1VJRA 3OM1A 2PWAA 2G0TA 4JI8B 1GN9A 4E5VA 2F8SA 1KIMA 2GCEA 4DYHA 1TW3A 2RIPA 2C1XA 4R2JA 4X1YA 1VGQA 4IH4A 2PSSA 3D3JA 1H2ZA 4DWVA 4ED7A 2FDXA 4DLLA 2DR2A 2OCLA 1X1RA 2ZYWX 3TZLA 4EELA 3MFYA 4QPPA 5K3FA 2HXYA 1K0FA 3GQCA 4G1BA 5HE8A 2BP7A 3OIFA 2EEPA 3ON5A 1J25A 1NN3A 2CHFA 3NMUF 4L0MA 4X3OA 1NF9A 3HJCA 2E6KA 2AG1A 2HZBA 1OYYA 1IXYA 2ZJBA 2WFMA 4GFDA 2Q3EA 2O1EA 5JXIA 1GAWA 3OQBA 4M8KA 3CYMA 1Z6GA 3GRFA 3MPOA 3IIMA 9ICGA 4M55A 4GECA 1R3UA 3TB4A 4C4PA 4EB8A 4JKIA 2WC1A 4NBSA 2FZVA 4AJ4A 3DEFA 2YJZA 3LFHA 3JY6A 2IC5A 4A6EA 3MZ0A 2FWRA 1AIPA 3CKMA 1ICIA 2HBYA 5FUQA 2H1SA 3L0DA 1VL8A 4XE5A 4CF6A 4GKKB 1MKYA 3RTGA 3GYGA 4DQVA 4W7HA 3C6ZA 1RAAA 3IUSA 1L8AA 3OHAA 2V0NA 3UC5A 1MA7A 1SUPA 3F3SA 4DDKA 5COAA 1FPMA 4NIMA 3LJKA 5KFOA 4E94A 6YASA 3HGMA 2QOEA 3F7MA 4JI1B 4DF4A 1GAQA 2BEWB 4CV1A 4D81A 3KTQA 4UMDA 3RYIB 5TY0A 1MEEA 3DFUA 1PW5A 3DHVA 3LF2A 3KCNA 3L40A 4IWNA 4CZ2A 1NC1A 5H9VA 4ROTA 1IIBA 1T0IA 1FYXA 4PZCA 3NTRA 1PVQA 4E1VA 1CRLA 1SBCA 1M2EA 2HLDA 1ECWA 5IAAA 3WU2U 5IJ0B 4Y6GB 2IW1A 1UADA 3UJ3X 5LQKA 3H4MA 1R8XA 4BRWA 3N0TA 2ZRJA 2A0YA 3X1JA 7ICTA 3DT9A 3KPWA 3JARA 4CM3A 3LG2A 4L0DA 4E30A 4EARA 2GBLC 3KQOA 5K8LA 3EIUA 3KSAC 4EG8A 1AN0A 3H2KA 3R0IA 5M5BA 2EAOA 1H66A 1QP0A 3P5BA 1K0UA 1KK2A 1Y80A 3T3MB 4E13A 1E1DA 3SHOA 1BGXT 4D4IA 3G1WA 4RZQA 4WY8A 3G3EA 2IEZA 3IAXA 1U0HC 8ICSA 1Y48E 3OLZA 2C1EA 4A8JA 3NT2A 3ND7A 1UINA 3Q41A 2J0QA 3MRTA 1J99A 5CW1A 5AK5A 4F5RA 4G0UA 3MC1A 4IZIA 4KK4A 4UE3S 1XDDA 4CKEA 5TZVA 2IUFA 3G17A 5CW2A 1H9CA 4GDMA 1UBRS 1E6LA 2H92A 2PUVA 4DCMA 3PFWO 3C21A 4G5SA 4MUHA 3LT1A 3RB0A 2WU8A 5D3ZA 5KYYA 1X6VA 4AYTA 2PSFA 1ZP6A 3PUWA 1QYRA 3SLKA 3VH2A 3PFBA 4L95C 3R4VA 3QMVA 4M76B 3E81A 2AOTB 4ZQEA 2F1HA 4NLKA 4JBHA 4XIGS 2CF5A 1TQ2A 2QL7A 5JS2A 3W90A 3GRRA 1E59A 3H2YA 5C8YB 1SKBA 2EKZA 3FM9A 2IFTA 1Z22A 4W5WA 2GO1A 1JR4A 4J49A 1XCBA 5C1PA 4WKBA 1LDYA 3LWNA 1WCNA 2ZYIA 1EDEA 1KSGA 4KK3A 1UEXC 1Y6FA 3GCZA 3F8WA 5LZ4A 4QM7A 4D4MA 4RF3A 4BLWA 4FMPA 2HBZA 2H59A 1X1CA 1J2RA 2EAUA 2XB9A 1GDHA 4EMSA 3H5AA 1MEJA 4YK7A 4YP6A 2OL4A 4NMMA 2B78A 4NLZA 3U4QA 4IHJF 1K92A 3SZRA 1K86A 1J9GA 3HZRA 3VR1A 3LYSA 4CLRA 4NV1A 3WO1A 1R50A 4Q4AA 1K75A 1HO3A 4EATA 3RIHA 1OMOA 1DWOA 4MHTA 3ASVA 4EVSA 5FTKA 4ECWA 2LYAA 3DWFA 1TJPB 2WKPA 1GKYA 1XZCA 4TRRA 4COKA 2JJ1A 5CDFE 2QARA 1XN4A 4KODA 1RMQA 4D46A 2VJ4A 1ADYA 1UBHS 5HXAA 1CHDA 3LKZA 3JALB 2B1QA 3LOPA 4PYMA 1VKJA 1KU0A 2X22A 2WJPA 1N48A 4RHXA 3THOA 3H6KA 5CH3A 3BS5B 3EZFA 1Q0LA 3G2JA 3ZJ4A 3NCTA 3FOAA 1X9SA 3NYWA 3ND9A 1NRXA 3BREA 3GPIA 4NFSA 1RXVA 4YMUA 3OFSA 3Q7RA 3SF8A 3N2ZB 3P9RA 3CLRC 2Z56A 2XYHA 3RF6A 4F3NA 1MDFA 1C3LA 3BUSA 2Q2OA 5EP3A 5B1SA 3WGQA 1YVDA 2XVXA 5BXQC 1H5QA 2C5HA 3E35A 3TIVA 4TQRA 1GFZA 3NBMA 3FFWA 1VSBA 4MW2A 4NY8A 4DLGA 4CI9A 4JUFA 3KR1A 1B0PA 2YR0A 4NLBA 4LOAA 4L5YA 5DV9A 1SMKA 3BOSA 4Q1CA 3UHJA 4M89A 3ZCQA 1SZDA 4HYYA 1AUPA 4DLXA 2C7QA 2GHTA 3RH0A 1L5MA 5BYKA 3GLGB 3QJ5A 1UPFA 2I03A 3DXYA 2IIVA 3LU1A 5G0WA 1D0VA 1DJPA 3VO8A 1KEEA 4LK3A 5JSFA 2X8WA 4ACAA 1P62B 1MOZA 5FYDA 2P9GA 5LQUA 1ZHHA 4UAVA 5FR2A 2VR1A 3IXLA 1C81A 2C3OA 4M2LA 4C05A 3FWNA 5J5AA 4AXBA 3D9QX 1ECCA 3PIIA 2BTOA 2R1UA 4UNIA 4JJZA 4IKOA 2YQEA 2IZ7A 4D0SA 1YS7A 2JB9A 4MXDA 5DX8A 2VJMA 9ICOA 2VZ0A 4BBJA 2WD7A 1OBOA 5FBWB 1D04A 2I4MA 4YYZA 5J4VA 3EPLA 1K88A 4JB0A 4ADSG 3IKLA 2E4ZA 1JTVA 4GMFA 1I4DD 5AHXA 4YMGA 4LRSB 1G4UR 5CEJA 3WRYC 2P9JA 1KY5A 3TLCA 4WNIA 1KI6A 1EWKA 3ZHXA 4DM3A 2EG5A 2A4KA 4K9OA 1W29A 3MGBA 1X9HA 2BFCB 3TQ1A 1F4PA 5KEIA 3ZQUA 4OLJA 3WB2A 3I72A 5AW8A 2E5SA 2XQKA 3RHFA 2JIZD 2I34A 3CZ9A 2EYUA 1U0FA 1VDVA 3ZH9B 2Y9UA 4M1KA 2I4IA 1B43A 5KFUA 4E21A 4W5NA 1E69A 4Q66C 3CLKA 7ICGA 3B0XA 3HVJA 5GZ6A 2YB1A 3ECSA 4RL6A 5ICCA 1VL2A 2PYIA 3PJFA 2XMSA 3QG5A 9ICTA 4P0PB 1ZQTA 3DJFA 5JS8A 4JX8A 1N77A 2EZ4A 4BQRA 1HE2A 3ROMA 2QPAA 1KDYA 3HP1A 3ESYA 2B37A 1NGSA 3A37A 1L5SA 3QLTA 1E94E 4G8CA 1HEIA 1AUXA 4I46A 3IPCA 2RDJA 1VDMA 5REQB 2FG6C 4C07A 3HO8A 3KQPA 4PICA 5HG0A 3R0XA 2KNJA 4YEDA 4JSYA 4LXGA 1OBFO 3D0QA 4HEQA 2W7OA 5IINA 1N63A 2B5OA 2Q9CA 5DYIA 2MU1A 2HHXA 2XF2A 2QX4A 1YZ3A 2K60A 2X3YA 2J6HA 5ARBA 5CA1B 5HQ3A 3W3ZB 2YZ7A 2JAOA 1ZH4A 1QH9A 4ZYLA 3UZUA 4LHZA 3QF4B 3AM9A 1GITA 3RANA 3ZCTA 3JQBA 5ALVA 4DIBA 4AS2A 5IG2A 1E3JA 1V8PA 3W3AD 4Z9AA 1GPBA 3FR7A 4KLNA 1AD2A 3ZVRA 5DN9A 4RELA 1RJ9B 2E1PA 4TROA 2XE8A 3BMCA 2VLBA 4MGKR 1C7RA 2O7VA 4HYKA 4CMBA 3P9KA 1AKQA 5K0LA 3IILA 2R7LA 5I9MA 1T2NA 2RAPA 5J29A 4YPFA 4E70A 1T1JA 1UMKA 3AZQA 5ADUS 5DGBA 4R0MA 3EZ9A 3ISVA 3KYJB 3NIDB 3BC1A 4I36A 3I6QA 1P2GA 1Y1KE 3T7EA 3C6YA 2F17A 1U98A 4KLHA 5KAFU 4AMZA 3AX6A 1EWVA 2CKDA 4AWAA 3MILA 3ASZA 4MR7A 3FYCA 5ICGA 3N05A 3M7IA 1ZOLA 1JIJA 3NNNA 1NRIA 1QAOA 2JFUA 1Q74A 4UBIA 2D5BA 4FQ8A 2R2GA 4QPDA 5EKTA 4CTOA 3IEXA 4OI4A 3BMNB 3IDOA 2GK6A 5F9NA 3HSKA 4TKZA 3TXYA 3ABQB 2DX7A 2ZSFA 1U0OC 4UAWA 3HCDA 1Q0ZA 2YW9A 1HOTA 3G85A 4A8TA 5KYGA 3ET5A 5IZCC 2ZLBA 3FI0A 3EDYA 2UVRA 2AJCA 4UBMA 1N0HA 1T5OA 1L0BA 3VPBA 3VU9A 4GZMA 2B25A 2VSOA 4ECXA 2XKJE 5A03A 1W2GA 1P8AA 4RV9A 1A4XA 1XALA 2AT1A 4C76A 4MYSA 4X1KA 4Z0TA 3DB1A 1UDXA 3IMKA 4LJ4A 1IBKB 1Q1NA 4LQDA 1C7EA 5E38A 4AY5A 2VO1A 3WL7A 1WLYA 5L4NA 4AY3A 2IZOA 5TS3A 2W6JA 4NOKA 3CF2A 4WCFA 4B8WA 2OO5C 4ND8A 2PUEA 1GRCA 3LPCA 4FLMA 4F7DA 1RWXA 1G8SA 3RC9A 4AJ2A 3KHLA 1NAIA 4YAOA 2BEUA 3NU1A 1ZR4A 1UPUA 4FZJA 2QQFA 3O91A 5H5JA 5HQTA 3IFSA 3JYHA 3VUEA 4IFBA 4GPIB 1PT9A 3W9BA 2BGWA 4E2WA 7ICSA 1DC4A 4TVSA 2OWEA 2YJ5A 2CCJA 1CEQA 2KFNA 3KXKA 5I4CA 5IBRA 3NHFA 1B93A 2BI7A 5I9SA 1ENZA 1DLJA 1F8XA 3OZBA 1XTVA 3EFEA 5FUWA 4YMLA 3F1KA 1U4NA 3QXHA 1JX4A 3Q3EA 5IIOA 4L78A 4XI9A 2GILA 2J32A 3FKQA 4LV5B 2MUTA 4BNHA 2J4CA 4JI4B 2JIPA 1TIKA 2D13A 3AFHA 1LBQA 3R3VA 3C24A 1JB1A 3HP4A 2KKVA 3UC9A 8ATCA 2I7CA 2PJRA 2AZXA 3C8MA 3AMZA 3HXPA 3EX7C 4XYMA 4IJWA 3LX5A 2DEUA 1U1IA 1Z3EB 4L7VA 3E05A 2R8OA 2W98A 3PS9A 5JTTA 1W8IA 2V7TA 3E7WA 4Q44A 4KJXA 4BDTA 4LZDA 2JAWA 1GLVA 1UA0A 4LF5B 3BQ2A 2QTNA 1DRVA 4ZA2A 5K51A 4V0ME 1PHRA 1ADCA 4G0YA 2AGQA 3WJ7A 4DCJA 3GGOA 4ELVA 2JI6A 3FLAA 1U8YA 4OBXA 1A1VA 3I42A 4OU4A 2R1VB 2K4PA 1RI3A 4HAYA 2IS4A 1V1MB 4GKBA 1NBMD 2C9DA 2DBZA 3OHMA 1KKMA 3QLUC 2BHSA 4CKBA 2C5BA 5JBIA 3PSPA 4BZZA 4OAPA 4LSMA 1RAGA 3HJGA 3GAAA 4TRNA 1E60A 1FNBA 5DIFA 3BT7A 3KSUA 2XMBA 4YMVA 2OM6A 1TQ6A 1DPFA 1J8QA 2I87A 4KVGA 3ICCA 4AP6A 4JQZA 1FTNA 1UAAA 3E23A 1RKQA 4ZAZA 1FQKA 3VC7A 3ETNA 2CXQA 1MEOA 3REOA 3WSTA 2JLBA 1YVEI 2ZS9A 5DP2A 4LDJA 4FMDB 4QXRA 3SJAA 2V55B 1EVIA 4GSYA 1DQYA 3E9CA 3OWOA 2ILVA 4HWRA 1MOSA 4M1ZA 5HCIA 3OEED 2B2CA 4QGGA 5BO5A 5K3BA 3VCBA 1TU0A 1X3SA 1A4RA 4R2KA 4GXTA 2E8MA 1KC1A 4YVZA 3QHQA 1DIBA 4GSKA 2ONKA 5KNCA 2K8BB 4TL6A 5J2DA 2G8LA 2OCGA 3P97A 4R9VA 4ZARA 2FWAA 1OREA 1XTTA 2QVLA 3NDIA 3PC8C 4S1TA 2W90A 3AERA 1NU8A 5FNZA 3MLBA 4TMTA 1U3GA 3MMZA 3N97B 2CD9A 3KZXA 3MAJA 4DFKA 3SQDA 5KYKA 1L3SA 5HFAA 3PHGA 2H1RA 1X74A 3BQ1A 5ER6A 2BV3A 1R1DA 1XTKA 1X1TA 1G3IA 1FFCA 1G2PA 2VAWA 1JQBA 3TSZA 4WLOA 1SD5A 1WY7A 3I2FA 2RHFA 4J9VA 2NSLA 5KFEA 4O0LA 4A8PA 3OGUA 3F67A 4OKNA 4YCMA 1ZN7A 2FPOA 1NF3A 5T4BA 2LGJA 1T8YA 1L7MA 3KKMA 4NICA 1O97D 3UY4A 1ZK2A 2OESA 1RC0A 1J1UA 1SHLA 3ONFA 3WMEA 1U8UA 1H2XA 4MRPA 4HATA 1DEKA 3LV8A 2CE2X 3Q85A 5DULA 3D5TA 5CVTA 3QENA 3CVVA 4R8SA 1L4LA 2XX3A 4AZVA 3ZCVA 4ZYUA 5K6TA 4YHBA 1G5HA 3PTLA 1Y7TA 3QYFA 2H4ZA 1PJRA 1SKYB 3JW8A 2XWBF 4UU7A 4JLWA 5I7OA 1H9AA 3E0XA 3KEMA 1QJ4A 1RLJA 2FUEA 1AKNA 2FWNA 3SKXA 3OFND 3EPHA 3NGXA 2EIXA 3MCUA 3QNUA 2K2QB 1C9MA 3RABA 1ODKA 4F4XA 3OBIA 3LD9A 2QTRA 3PD0A 2PK3A 2W83A 2RI0A 3IUYA 2OO3A 3W0LB 1IVNA 3E9YA 4N65A 1MJGM 4QZAA 1BH2A 2WNIA 5K9ZA 3TVYA 3FTDA 1SQFA 4MWSA 1QGED 5A9TA 3DKIA 3DE5X 1Q0SA 3LKDA 3OLWA 1H2FA 3JPWA 2ECPA 4RPXA 3DUFB 3L6EA 4CG1A 1GZUA 1QVZA 3E1GA 2QQGA 2QRVA 4LYEA 1E2JA 5JR3A 2C58A 2R1ZA 4KMUA 4I4TB 5IEBA 5HKAA 1LW7A 4B7CA 4GNRA 3RVKA 2A3RA 3PL5A 1BWRA 1R4MB 3L77A 2J5KA 4LWPA 4Y2XA 3P32A 7ICOA 4G5FA 4RH1A 4YQFA 1L1QA 1BW9B 4I4NA 3GY0A 1U2GC 1OZHA 4LYYA 1Q7GA 5BR1A 1EPUA 2PRSA 4QXPA 2AHRA 4B9SA 1T5BA 1Z34A 3TBHA 3LXUX 3EIXA 3I61A 2HU5A 4GGPA 4DJDC 1G7SA 1UF9A 4G4SO 1RYFA 4AICA 5TS2A 1JKIA 3LWLA 1WP9A 2WHYA 5CFMA 3GEHA 4KI0A 4WECA 4CHGA 3L7AA 1CY0A 1D2HA 4Z4QA 2ZAYA 3W9SA 3L06A 1HQKA 4GC7A 3UAGA 1WF6A 4KPGA 4L6IA 1BWPA 3AETB 2BZSA 1G4HA 5DHRA 3NS7A 3EIHA 4UOZA 2XOKD 2RHBA 2YUIA 4L8FA 1KZYC 3O95A 2NZ8A 1P7ZA 1NT4A 3IAUA 4GPAA 1KI8A 2Y1EA 3TS1A 2J3DA 3HKCA 2JCGA 1Y3BE 3OZCA 1B26A 4OLAA 1Z7BA 5HGJA 2ECKA 1JR3A 2E4UA 3CLVA 4KGVA 5LQAA 3BKWA 3IJEB 4TSFA 2GYUA 4B6SA 3KL4A 1PR3A 2LWIA 3EAGA 4TL9A 1LZLA 2GI4A 2HIHA 3Q8LA 4C8LA 1PG0A 1VSVA 3A6LA 3MWYW 2J7PA 2HOIA 4S24A 1Q3HA 4HI0E 2F1OA 4RHTA 1B6SA 4Y2YA 4JOCA 1HJPA 2OCPA 3KKZA 2JFZA 3ZS9A 4JT9A 5BV8A 5G02A 4FFBA 3STYA 1QANA 1RAEA 2JCBA 3I01A 4FOOA 1OAOC 5JANA 4ALKA 3DEZA 1STOA 4DA4A 4RTQA 1ST3A 1DMSA 4FR2A 2H08A 4UNQA 1I3LA 1ILWA 1SCJA 3A2KA 2L17A 1V16B 4QXQA 1DSSG 5LZ8A 4AULA 4FFVA 1OYVA 3ZHQA 3GGSA 4CM7A 2WM8A 1CPYA 4F5QA 1XR3A 4CM6A 1TEHA 3ZU4A 4J9QA 2VCYA 1SJ9A 1D1SA 1ZMXA 5T6MA 1R8JA 4JXKA 2Q1WA 1ZOOA 4UCFA 4AD8A 2Q21A 2INGX 1FMTA 2VJDA 4KQIA 2Q0HA 5DGDA 4B6EA 2UXBB 2XCUA 3JQGA 1UKYA 4KXMA 1A5SB 2YZNA 1QV7A 1QLWA 2MOKA 4V3CA 2KVCA 2CBZA 2EAPA 4I50F 4O5AA 4RKRA 2WHPB 3H13A 3O8QB 3WK7A 3TQCA 1MT3A 1J56A 4R8UA 1GNTA 1BDJA 2LRHA 4QPZA 5KG7A 4BKQA 3AUTA 4WN3A 3JRNA 5HDQA 2QV0A 2F3SA 1X8LA 3K9GA 1VB5A 2ZJ8A 2NOAA 1KYQA 4EG3A 3AV0B 4D9KA 2JJ2A 3G2IA 2Z08A 3TKLA 4JKYA 3SJBA 3QELB 2A6PA 2OK8A 1TJ4A 4OXIA 3L0ZA 2X6QA 2QRPA 2YXBA 4ZU3A 1Q15A 2MCFA 3N2YA 3HNRA 1QFJA 4LJ8A 3T35A 3OCUA 4F6RA 2OP0A 1ODFA 5KZMB 4Y2UA 1CNFA 3RVDA 1DARA 4P7FA 3N28A 1HC7A 2L42A 3IERA 1PZMA 3A4LA 4CFSA 4X41A 2ECOA 4PLYA 4BL5A 2YBDA 4K2HA 1WS6A 3FOZA 3VO9A 4HN9A 5J2TB 3AKEA 4FGLA 5FAKA 2QXTA 3K8OE 1YL5A 5LA6A 1EFCA 5EFZA 1Z0KA 4MUXA 4D6XA 2OKCA 4ZI7A 2PV7A 3UAWA 3UW1A 1J0DA 2EKDA 5BVHB 5HOEA 3OJCA 3VOAA 2ZJ0A 1R10A 5CLLA 6REQA 1ZQVA 3FCOA 5ALEA 2D6FA 3LRTA 3IQGX 1EFRA 4EG0A 4RMJA 4IILA 2PSJA 3GAMA 2FQYA 3SBOA 4P82A 4P0TA 1XLTA 5BN3B 2W42A 5IFKA 1O7JA 4ER5A 3OETA 3ABIA 2H4HA 3T9AA 3B5JA 2I55A 1PN3A 2JFYA 5F9HA 1B41A 3PI6A 4O08A 3U7GA 4E3WA 1QH8A 3ZV7A 3UWPA 1O95D 3A1WA 4ZRMA 2NRXA 1QX3A 4BVJA 4XX1A 4ETNA 2OEHA 3WFIA 1CUEA 4URXR 5HMLA 1T1SA 4IDDA 3CPJB 3NM4A 1ULSA 2ADMA 1OB2A 4X64B 4XWKA 1E3EA 3ENZA 3DZKA 3AIIA 4G56A 1JILA 3DFZA 5U4XA 1U9IA 3NRCA 1U8EA 2IIQA 4CU2A 4BMYA 3CRRA 5FAXA 5JSZA 3FPBA 4QQNA 4UFPA 1T4GA 3RHZA 1PUIA 1GNRA 1BKDR 2Q4TA 3LRXA 1KRXA 2A88A 4J9OA 3TSCA 1KP2A 3GCXA 4E5YA 1NT2A 3TFQA 1YZQA 1P91A 3C7AA 3L7JA 4XDZA 1JSLA 1TUBB 2V7GA 5DM70 5EWEA 2XCIA 3LBYA 3V8QA 3TQTA 1B00A 2AHOA 4WBSA 4LNHA 5LMUB 5KVSA 1HMYA 1ZBDA 1N8SA 1Z9BA 2MJLA 5DT9A 2JJYA 3BDIA 4MYCA 3DO8A 1BN7A 5ECGC 1L8XA 3OSNA 4F1WA 4RT2A 3U9LA 4QVIA 4BCBA 5F4ZA 1B14A 4OJOA 4ZVKA 2XMZA 2YWJA 3UQZA 1YR3A 5JW6A 2VDNB 3ML1A 5AJXA 5FL7D 3T7AA 3VVMA 5JWRA 2OVBA 1R6UA 2R7NA 1AXGA 3WX0A 3KLOA 3VU3A 5SY9A 3MS2A 2MR6A 3NWPA 4E08A 3WGZA 3V72A 3KLBA 3KQYA 2XSZD 2HRRA 3BG5A 2GF2A 5EXDA 4IQTA 3ECAA 1PK7A 2V7PA 5B12A 5BV0A 2Q3CA 1F51E 4RQMA 2GLEA 1S0MA 3VR4H 3SYLA 1L4BA 5IT0A 4CLOB 1QRDA 1G66A 1VSTA 3M6AA 4BLVA 1C0EA 5K5EA 1ZQWA 1YUBA 3WL8A 1YJQA 2E5FA 1QNLA 1RYNA 2UZ0A 1EP9A 4DCGA 3IP7A 3CSSA 3T5GA 4H6PA 1IXRC 4QSHA 5COQA 1G5RA 3RJTA 5AKKA 4RE6A 5F3DA 3UJ6A 4HYTA 3EVCA 3PIDA 1NBOA 3HKDB 5CJPA 2XGQA 2H29A 4DS3A 3TYXA 1GQSA 2J0VA 2XVMA 4OQNA 5JVDB 1C9YA 3JX9A 3PIRA 4DLZA 2A9KA 2GRAA 4XJTA 4G25A 5KWVA 2F43B 1A96A 4DUGD 1P45A 4I2HA 2OHHA 1U8XX 1GYPA 1REQB 4WK0B 4GBJA 4NZYA 4UBCA 5F7JA 1QIKA 2COUA 2ZJ2A 2YWEA 4TMXA 1L5KA 5BPFA 1ORVA 5LKRA 3DHYA 1JFVA 2ZR8A 2H4WA 4PTLA 3BJYA 4O2AB 3JAKA 2PA0A 3PMLA 1E1CA 1MRSA 3RI3A 1C9EA 3SR4A 2XT9A 1SU4A 4P5EA 1NE2A 5KFDA 2HRDA 1RBZA 1UBOS 3DMHA 3OOEA 2PVSA 1XQ1A 2A1TR 3BBLA 5LB2A 3VNRA 3D7NA 2IXBA 4WLVA 1A2BA 1M10A 2YOHA 4R5MA 3SIRA 5JH7F 4YP7A 1X40A 3KEGA 2W9CA 3C3JA 3U7QB 1XXLA 2WJHA 3O8OA 4ER7A 2X7JA 4EHHA 4G5QA 3UMRA 4OQMA 4UDXX 4F3YA 1W52X 2C83A 4MJ3A 1XNJA 8ICGA 3KTAB 1FIQA 2W7TA 5FEMA 3QBEA 4FM9A 4JUIA 4KLLA 1C7IA 2AKAB 4U2DA 4BC1A 5KOHA 2X9NA 1N8NA 3WWYA 3GJQA 1CX9B 1OIWA 1VL5A 4P4MA 4GO1A 4TWRA 1E6MA 2N0SA 1Q17A 2WFLB 2NVUA 1A2OA 4GI7A 4N0PA 3GFGA 3PW4A 1A8UA 1C7JA 2VG8A 2PMDA 3UQYS 3FOFC 1AV6A 121PA 1BU5A 3BTSA 1PLKA 1S96A 3ZZMA 4QZGA 5JNVA 1XVUA 4A0FA 4EGJA 1GZ6A 1NONA 3H0EA 1EUDA 8ICRA 2C2OA 4DC0A 5A9SB 2BUAA 1A2QA 3PKIA 4Q8FA 2UYCA 1S3GA 2OO7A 3FPGA 4X8MA 5T5QA 3M1LA 2BR0A 1L4KA 3LK6A 5KOIA 1XS9D 1LRLA 1XRSB 1BXGA 3EZ6A 4IDBA 1H4QA 1NLMA 3G9XA 4EW3A 3WWCA 5E2AA 3TLMA 4G5OA 4ZO6A 4R8LA 3SC2A 2KZ3A 3QWHA 4E5UA 1FF9A 3CG0A 5AVJA 3KOZA 3DMYA 4ECZA 4OHMA 4BFLA 3H8MA 1J23A 4M87A 4FGUA 4HCJA 5C32A 1FFXB 4TMVA 3RSLA 3RQIA 3B78A 3MMXA 4C2TA 1LF0A 3LIIA 4KR3A 4HVTA 4JLOA 2WPDA 1R0YA 4O2LA 3LECA 5LKAA 4P3NA 2VP2A 5J4LA 1N7HA 4B34A 1P5JA 2XA9A 2QZSA 4JITA 1CJTC 2QX9A 3H11A 3V48A 2OUIA 4UBJA 3BRQA 1F5SA 4GPBA 2NSHA 4KQGA 1B0AA 4MS1A 1FJHA 2FZCA 3OZXA 5C53B 3ITEA 4R0VA 3KEFA 1H0KA 3GARA 4U6PA 5CCXA 5AXCA 3JQPA 2GK4A 2VJKA 4JJKA 1HWYA 4LOLA 2W6NA 3RW9A 3SR6A 3Q88A 4LYFA 4IYRA 3HLKA 4MVJD 4NX2A 5FLXA 2HMYB 3WLHA 3FDSA 4HX5A 4L4SA 5L6LB 3AL2A 4C0QC 4OGLA 2R62A 2ASDA 1QKJA 2FMIA 4JC8A 3K94A 3TJMA 5FV4A 4BN0A 1XTBA 4IDPA 1QMGA 4TOIA 3QTLA 1DELA 3UT0A 1NW9B 4ARBA 3IVRA 2I4RA 1QXSA 3HMQA 2HA6A 4RTKA 1SXHA 3ZD6A 3R1IA 2FWBA 4CKCA 4ND4A 1LXCA 4XRRA 1V9CA 2RHHA 1RLMA 3KB1A 1LLUA 1GKUB 5KYWA 1ZM7A 2H3HA 3E84A 4U63A 1IB0A 3UTDA 3AJDA 4RF4A 3DOOA 5B1DA 4KC0A 4M6WA 2V0GA 4KH0A 4R40A 2O3QA 3TFWA 2FQQA 4P7KA 5F5LA 3SX2A 5KG4A 2YV3A 1RKBA 3FHOA 4D8YA 4J4TA 2F00A 1OBVA 5I8WA 2JGFA 4A8HA 3G68A 1JVNA 4BE4A 1ZRNA 2A9JA 2ZIGA 1HE5A 1ZRHA 4YBRA 2P30A 5L3ZA 4GI1A 3RBDA 1M1UA 1QIGA 4RHUA 13PKA 4EVQA 4EOGA 1M2JA 2QJOA 1Y1RA 2VYNA 3KIPA 4WNAA 1D2EA 3FFBA 5E6UA 3V7JA 2AGVA 2ZR7A 1T3LA 1H2HA 5C1IA 3I2IA 5EJ5A 2GESA 4ZODA 4JCCA 1YQXA 3RVLA 5DOZA 3P2JA 1UEJA 3VAAA 4EL0A 2P9EA 3JVUA 3K70C 2UZ1A 3R23A 1H2RS 1ZMRA 3OPVA 1KQOA 1SIBE 2FTKE 3SIWA 1SB8A 5EG5A 3KEQA 4D8TA 3EYZA 1U1DA 1PTJC 4BO8A 3CVYA 4B40A 1LSSA 1G2IA 3M3HA 4MCAA 1SUBA 4IS7A 2CDCA 2DL0A 2VJOA 3C7KA 1P7YA 1JKFA 1VKZA 1HDRA 1XLVA 2ZAOA 1N3LA 4R68A 4ZT4A 1SC4A 1LDGA 2XUOA 3DC7A 4H3KB 4UBOA 3OLVA 4X7MA 2QKYA 1PSWA 2VNAA 1HRDA 1ZQPA 1JAZA 1FNDA 3K1JA 3MJRA 1NU6A 2I91A 3BB4A 3TLAA 2ZB3A 3RGWS 1FTYA 3DP9A 2RGNA 2YXNA 4QDXA 4C0AC 2OC9A 1ZCFA 3ZD8A 4BFXA 1UJMA 2QAIA 1RVV1 3RRMA 1F5NA 4RAOA 4GW3A 5HKKD 4M1MA 1RM6C 2PYZA 5HP4A 1U8FO 5EUMA 5B58T 1PFKA 1OBHA 5ESDA 1P4SA 5FNVB 4JT4A 2GCIA 2ODAA 1SVOA 4YUWA 3P2YA 2O8VA 4YAWA 4QW8A 5KPDA 1XO1A 5AJHA 4L28A 3SD7A 2FLLA 3KPJA 1F3LA 2CNLA 3EEFA 2I7XA 1X3LA 3B2NA 1IOLA 1A72A 4RE5A 1QLNA 4B3IA 1JDTA 2IS2A 1N2CA 5IKXA 3M81A 2E5WA 2GEFA 1SQSA 5JHHB 2GB4A 4DSJA 3T7DA 4DLAA 3ZZUA 4KFUA 5C9ZA 3TL3A 1GPJA 4FW8A 4EH1A 2DPGA 4KRXA 4NECA 2EBWA 5ITWA 5TLSA 3IP1A 4RZHA 4C4YA 1F4LA 4YQZA 3OSUA 4O3QA 2XZOA 2QB0A 1EGVB 1V47A 4V1CA 4N0DA 1KZ6A 1SBHA 2O8EA 5FUMA 4MGZR 1S97A 4PJ0U 5I5EA 4OX9Y 5BSUA 1WUIS 4J43A 3SZ2A 1GEGA 3TW4A 4PR3A 2IEDA 1HNNA 1G21A 1AHNA 5GPBA 3IPYA 1E9BA 2FDRA 3H5OA 5J0XA 3P0IA 4V0OA 3BGSA 5CIWA 1Q84A 2VP6A 1Z4MA 4CLHA 2H00A 1U8CB 3WAKA 1VLZA 3PQ4A 2X19A 4ZJUA 2DRIA 4HDNB 4L57A 3TSOA 4WZBA 4EFKA 1WXDA 1Z25A 1A71A 2NMVA 3D8NA 4PYIA 2EVWX 3ZDDA 4TKVA 4XYLA 3WRXC 1I0ZA 4N54A 3KLPX 1TK0A 1GGFA 1T36A 2VDJA 1FY2A 4BBAA 4K46A 4US0R 1XZJA 3NKVA 4OF4A 3G2QA 1SGGA 1AKWA 4TTSA 1U4SA 1Z33A 2HKIA 3BWBA 5DLYA 5F12A 2HI0A 1L5FA 4K88A 1PE0A 1FS4A 2GK3A 2PT5A 2ZRKA 2W2KB 2J9RA 5AUNB 1TAMA 2XDQA 3ED1A 8ICLA 2FUCA 5BOMA 5TGTA 2JFOA 4NDZA 2NXNA 1C2YA 3PGVA 4I1UA 3HA7A 4TRJA 3QG1A 3ZVNA 4EYEA 2D1TA 1JEYA 2VZLA 1NJWA 2HF9A 3IEPA 4J1NA 2QYHA 1ZKMA 1FTWA 1M2KA 3K0SA 4IQFA 1JIUA 1A50B 1P0MA 4QYSA 3DJYA 3DHNA 2XGOA 1ZD3A 1T8PA 1K7YA 2RH8A 2GETA 2RG1A 5ALWA 4DG8A 1ECFA 1YQUA 4OKIA 1L9KA 3IQEA 3AY0A 1ZOIA 3AR2A 4EVIA 4TS3A 5B66U 3AYXB 3QMWA 1VA5A 4Y18A 2FLWA 4PLPA 3AP2A 1G59A 3WYDA 4NOLA 4NH0A 1T2DA 3AR7A 1KEWA 2Z3ZA 2IHKA 2KQUA 4FLFA 3GRZA 2C3PA 4YUZA 4RPGA 2BDPA 4WACA 2HBLA 3TRFA 5AW1A 2ZW9A 3M49A 2EZTA 3SNKA 5EN4A 1S4MA 1EMDA 1ENYA 4E11A 4NCAA 1Z28A 5DX0A 1S02A 1RLIA 3GVXA 1GCUA 1V5GA 3OM0A 4U9UA 1IN4A 2HV8A 4FB5A 3H6HA 3OZDA 4W5JA 4P38A 3BCRA 3U0BA 1O5OA 3N7RC 5LP6A 3FWYA 3F6YA 2P68A 1QO0D 3NETA 4ZCMA 3L8MA 3WLOA 4YQYA 2OG2A 5JUMA 3TADC 2W2VA 4Y9SA 4AMUA 1E3SA 3C3AA 3P5SA 3FKSD 4EMTA 2WT8A 1BC5A 4TN5A 4HLUA 4MR9A 2AFHA 2MR5A 3ANSA 1ZYQA 7ICRA 5U9CA 4A73A 1M66A 3UMGA 3EZ2A 4MVJE 2DR0A 1Z36A 1NMQA 1JJFA 1O5IA 3KOMA 4C4OA 2D3DA 4IFIA 3DYIA 2H7VA 1KVRA 6LDHA 5I9LA 4IMPA 2Y9MB 1Z8FA 1NIPA 1OX5A 2CY0A 421PA 1Q1QA 2WU1A 4B75A 4BGDA 4RTLA 5FPQA 4B9TA 4YRFA 1JJIA 1UZAA 3A9CA 4CMKA 2C04A 2AFRA 1T3TA 2X0RA 1GYRA 4Q7MB 2Q2VA 1QONA 2X76A 5KO2A 3LXRA 1BNCA 2Q4DA 2ZIVA 2VHUA 1NLZA 3PMNA 2R6CA 2XI4A 5AVZA 4L4UA 1KEPA 3L6OO 4FFOA 2QI9C 5EC8A 1T9GR 3KOYA 4DMGA 4X0EA 4CKYA 1IONA 4TS1A 4FE7A 3KDAA 5HIMA 4KPFC 1ND5A 2BUBA 4KQXA 1TFUA 3C41J 1YBMA 5J0RA 4HJRA 5IVIA 2Z5LA 1NK0A 2FETA 3M2PA 3HUEA 3MT0A 1D7OA 1WPQA 3DLHA 4OFWA 2KMDA 3EC7A 3IEMA 4OFBA 3I62A 4BXOA 3PEFA 1JZTA 3T15A 5CM8B 1QLHA 1IMJA 4F4FA 2CL5A 3QGMA 2BKUA 5AW5A 4G85A 1NOMA 4R3UC 4CU5A 5ALLA 2NYAA 2G7MC 3URMA 1L1EA 2L19A 4UQLA 2D74A 2PJUA 1UXKA 3FPEA 4DDMA 1C8BA 4ECEA 3NWOA 1AN9A 2EJVA 3R9WA 4CM1A 1ZQDA 1N0VC 5LP1A 4IICA 5I45A 3AI2A 4MLZA 2EARA 3GELA 2LKYA 4HFMA 2ZYGA 4QYWA 5JD5A 4M98A 3K15A 2W54A 4HZGA 2FSVC 2IE8A 1QQBA 3FWZA 3JSAA 2Y0DA 1ZEJA 2QV7A 1ED1A 4ASUA 2FW1A 4QYMA 1ZJMA 4Q7QA 4TL7A 5GP1A 4UCWA 3ZV6A 3JAWA 3TLKA 3SC3A 1F2DA 4HAUA 4W8GA 1NZFA 2DBQA 2AXNA 2JIDA 4MEBA 3OZSA 4KAAA 4BO7A 2WRZA 2ZS8A 1N6PA 2BRUC 3O21A 4N0QA 3ACCA 1X2EA 4XDGA 1XE3A 5KNDD 1S0VA 3DVAA 1TAQA 5CT6A 4ABTA 4AKSA 2KX7A 3LWMA 4HZUA 3WZMA 4LVSA 3STUA 3GJTA 3M70A 1PQ4A 4KQKA 2D2EA 4ZV4A 5AUPB 3SF0A 4OJ6A 3U7JA 1B8OA 3M1YA 4OUKX 1HNXB 5BN4A 1SXGA 4HXEB 3K20A 2KE5A 5KCZA 3KDPA 1Z8DA 2YX1A 1YTUA 5JAPA 1JXQA 1G0OA 3GEDA 3TOVA 4ZCQA 1DXSA 3FUXA 1XKLA 2DJ5A 4PNEA 3SVZA 1JDSA 4M7PA 4A6XA 2VRNA 2BGMA 1IJBA 2NU7B 1GZ4A 3OH8A 3G8CA 1T2EA 3R6TA 4NCHA 4FOLA 2QKQA 4NWIA 3EGDB 3L02A 3NTXA 2VDWA 2FUKA 3PD1A 2EL7A 4HAZA 4QZEA 4BLTA 1W0JA 3JQAD 1EBUA 1USVA 4YRMA 2SBTA 2WF5A 5F35A 2VHEA 2GM5A 2H52A 4EAQA 5J2EA 4D3SA 5E2BA 3V42A 2QF7A 4ZEMA 4MP3A 2WA2A 3PR1A 5KKAA 3WP0A 3BZKA 1PBTA 2BGIA 4BNNA 4PVDA 2XZPA 3NEYA 3ZWQA 5JYDA 2FGJA 4MQLA 4E07A 3RWOA 4D97A 4UNRA 3H9EO 2BONA 1X7XA 3TTUA 4EG1A 1EIWA 1K4MA 2H4JA 3MOSA 4JASB 1WF3A 1Q14A 4DDUA 2REXB 2QLBA 4P34A 5TQ2A 3OCXA 1KRWA 4A10A 3VJRA 5K4AA 3L0IB 2IJGX 1A7UA 2YWFA 1M1NA 4D57A 3OZWA 4RTMA 1Z6PA 1P1FA 3OI7A 5CVDA 4ESEA 1W4ZA 5G0UA 4RKFA 2OZLA 3ETGA 3CURA 4HRXA 3H1FA 2A1AA 3DOHA 4QIHA 4KIFA 1CG6A 3EMBA 1YQ9A 2FLNA 4ME6A 1IG6A 1P4AA 5TT1A 2AZMA 2XB4A 2VNSA 3OMLA 1MD9A 4N7JA 1H2EA 5KDDA 1PI3A 2SECE 1NHWA 4COOA 3A25A 1E2IA 1U2ZA 1XYYA 2FU5C 5FTJA 5JY6A 2V58A 2N1BA 2O8BB 4LBVA 1PEYA 1CCWA 2Z58A 4AJHA 4O29A 2X8JA 3L01A 3D54D 2FR8C 4J0DA 4HDOB 4L51A 1DKMA 1S1MA 2ID9A 3CT4A 3Q2OA 4DSLA 4XD7A 1VOTA 1XTZA 4DFPA 3C6MA 1RXCA 4GBMA 4Z3KA 4CCYB 3AUXA 2C4NA 4K05A 3PPWA 2I2CA 1ZN2A 5J8YC 3CO5A 2UUOA 2FOXA 3HYNA 4LXHA 4W5TA 1P0IA 2QGZA 1RWPA 2IU3A 3GJ6A 4AJJA 2HDHA 2QGNA 3IUMA 4TQSA 1FVHA 4I7EA 4DLBA 4JHXA 3KZIU 2CJWA 4JMPA 3O31A 2ZBUA 3EMKA 2QX7A 4RGBA 2KZZA 5DYWA 1Y5LA 3K09C 5F2NA 2WOJA 4YMWA 4ED0A 3CXRA 3AKDA 5IDXA 3S99A 3OU7A 4QBTA 2PX6A 1TT5A 2XHZA 4RK4A 2GPTA 2ZSUA 4DMRA 1H3NA 1U1GA 2IUSA 2JFNA 4Y1EA 4J9RA 4O4LA 3HDYA 2J6TA 3ZXIA 2C9CA 1S89A 3O75A 3O8BA 4EJ2A 4RLQA 7ICFA 2EFHB 1E0SA 4DW8A 4BJHB 2WJYA 3FHTA 1WZIA 1MOQA 3CUUA 5FWYB 4PRZA 2IPOA 2Y3IA 5GADl 3GLIE 1U1CA 1XDGA 2WJIA 3ZJYA 3EZGA 3PLAE 4XXHA 4TTVA 4U8GA 1SKUA 1L5VA 4BO4A 3PUZA 2I4NA 3NBQA 1THGA 1YQWA 3UKOA 3QKIA 3RS8A 4M0CA 3QZ8A 5IWCA 5B6JA 2ZGVA 1VE1A 4UM5A 4JBYA 2WWFA 3ZKWB 4KYUA 2DETA 1LV7A 3S8MA 3CR3C 4ZCTA 3UA3A 2FP4B 4IRUB 4HADA 4LX0A 1CIVA 2VF4X 1YRWA 1GT91 4OIMA 4KLOA 1NJZA 3MINA 4IF6A 4DHEA 3C8UA 1XVLA 1VYTA 2AN1A 3L6UA 4IIFA 3EPIA 1QZZA 5KCMA 4BFCA 1LTQA 1EJ6A 4IOMA 3KT6A 3DF9A 5AIAA 4NTZA 1XP5A 3JYLA 4L8WB 4BN4A 3KKQA 2IDJA 5B53A 5JROA 1DRJA 1SV0A 4QWAA 3Q5EA 4LE2A 4DMHA 4JI0B 3QEMB 3AVVA 1J42A 4MPPA 2XGGA 1M0SA 1U28C 1OQAA 1LLCA 2V7WA 3LHFA 3B3QA 4JL5A 1O3YA 3U37A 1M1YB 4L74A 3PNLA 1WOMA 4JLVA 2ZEJA 2R65A 1NIJA 2PGIA 2NZXA 4H59A 4ECTA 4G9GA 1FBTA 2C4KA 4Z4IA 1OLUB 2WPNA 1GNSA 3WWZA 3LP6A 1F14A 1QV6A 1MV8A 1ZH6A 6PFKA 2FCRA 3Q15C 3F71A 5D49A 2G5IB 4OK3A 4KR0A 2X5JO 1IG0A 1V7QA 2WJ3A 3EXHB 5CFPA 1MJNA 2B69A 2XUHA 3EYAA 1GTVA 3TLBA 4Y9UA 3HDHA 2KJQA 4PX3A 3DAPA 1NVFA 1QFXA 5BOLA 2B34A 3SICE 4QPJC 1VMIA 4BMDA 4F21A 2JA2A 3B3AA 2WMNB 4TV9B 4RX1A 4DFJA 4LDAA 3OFKA 3LBIA 2IH2A 4EHFA 4K4HA 1FTQA 2P2SA 3GFOA 1YASA 1SB3C 3MR2A 2OCYC 1Z29A 3JWPA 2E87A 2XF8A 4UQGA 2XT6A 1V95A 4O4JA 5E9AA 4B76A 3KKKA 3ZZTA 2ZRLA 3IP9A 3EXG2 1EVQA 5CX1B 3PC4A 4YRKA 1E66A 3HS3A 2W2OA 3ZOZA 4BAUA 1ONBA 2EW2A 4F91B 4KTQA 5E0KB 5A4IS 4XJVA 1GPUA 1NN5A 5FJIA 4HH4A 1P31A 4BV3A 3NVAA 4KMRA 3QTBA 3MR6A 1W94A 1U7XA 1MC5A 4JBNA 5KQGA 4LI0A 3IBFA 4MDFA 1JIQA 3SXUB 2RHTA 4FFSA 1XQXA 3TLGA 2WVGA 2VRCA 4GLXA 5EZYF 1IK6A 3ALRA 3T94A 1PX0A 2XMQA 5HIIA 4I27A 1G3QA 1ZA2A 2L18A 3Q4GA 4OCZA 5ABPA 3OD1A 3V1YA 3C14C 1ANKA 3M9XA 3WGJA 4AYWA 4P31A 2N75A 1TKCA 2JRLA 2V4MA 5KOJB 1RAFA 1NW6A 5H0IA 5A6SB 4LTDA 4R65A 1PWYE 4GOND 2FG5A 1F4VA 4LECA 2PUTA 5K03A 3EXEA 5KINB 2PH3A 1ZQ9A 3QPVA 3ZW7A 3S40A 2VTDA 2AEJA 1J8MF 3AVTA 1F8FA 9ICVA 4W1QA 2QNIA 3L0CA 2V4QA 3IKJA 1TCBA 2RSLA 1TC2A 3U4MA 3FHCB 3GQVA 2OFPA 2PMKA 2ESRA 3ONEA 1MB2A 3PITA 2CUTA 5JLAA 1E0KA 3DKRA 1L5OA 3W3AH 4G97A 4LWOA 4KN5A 4GP6A 3AEKA 3D4BA 5AI6A 5J43A 2V7BA 3E61A 4JV2A 5KQMA 3GV0A 4EJSC 3JD3A 3V6KA 4PPQA 3SEAA 4B35A 3FSGD 4QWWA 4RH3A 4MEAA 4KQ1A 5M2QA 2PUGA 4BO2A 1SAYA 4Y67A 2PD4A 4YN3A 3W6NA 2F90A 1GTL1 2BCJQ 2IIBA 1IM5A 2AR9A 2UVDA 3EXAA 5EHNA 3QE3A 4XDYA 1J8VA 1T26A 1TQHA 2XUGA 3O82A 4PBSA 3J7AC 4QNRA 3KZNA 2OCIA 2B2XA 5JHGB 3THWB 1HX7A 1EZ1A 4G84A 2JBAB 3O5AA 2QR3A 4I1IA 3TBKA 3ITKA 4DCVA 2VK2A 3NVMB 2UV8A 2HNAA 2V8OA 4Q3DA 4RQ3A 2CXYA 5K8TA 1W19A 2H18A 2BFBA 3KL2A 2FMTA 3EXHC 3AM1A 1LB1B 3OJSA 3OX1A 4J0IA 1N9ZA 3I6IA 4HXGA 4Z6CA 3TE6A 3WFZA 1UM9A 4XM0A 4XLTA 3RLIA 3FNEA 4UQOA 5KFTA 4W9NC 1W5BA 4NYMQ 1M1XB 1RIIA 3EPGA 1QC5A 4XIFA 5IZ4A 1XCGB 1K5DA 4NBLA 2W93A 3FVRA 4CIAA 3UN1A 3AUUA 3S3TA 1LS1A 2P6MA 2QDKA 1XG5A 4C7OA 2XUKA 1VMKA 4BECA 5IJ9B 4F4CA 2W2TA 2M6KA 4NEGA 5C3UA 4QT4A 2GAOA 3UG6A 4MQMA 1AURA 2A0XA 1JAYA 2OZEA 2B1RA 4KQ6A 1VYVA 3TZKA 4JYAB 3OD5A 2NPIA 2O52A 1K6IA 2DMRA 2FR0A 2JKZA 1NXSA 5L3RA 2KJ5A 3PU6A 2IF0A 1CQJB 1T6BY 2QM7A 3T4PA 5BOVA 3KKOA 4JYPA 1R3DA 4R9SA 3MAGA 2ZT8A 1CZLA 3W1EA 3R5KA 4HGQA 4ZD6A 4IVNA 4N4AA 3FMFA 2HU2A 2W2QA 3FI9A 2Q1YA 3H0MB 4EW2A 1L5ZA 4D43A 1U6JA 4NESA 1KXJA 2ZUSA 1CY8A 3TNYA 2GZHA 1E1QD 5AOCA 5CXUA 3SGLA 1Z18A 4DJ5X 1RD4A 3QOYA 1VG9B 1BHQ1 5GOTA 3A2NA 4MEXA 1MXHA 2PEZA 1YJCA 1AE1A 2J9XB 1YI0A 4O3MA 4V0QA 1IPHA 1Z0AA 4M9QA 3BCUA 4URWR 5EXXA 5K8VA 4MJXA 3EIWA 3GZFA 4JBIA 5AO9A 3KD3A 4LJAA 1RWQA 2YKGA 1NOKA 5KFAA 3U31A 5FCDA 2C77A 3M4NA 3GLKA 5IKOA 1S2DA 3FMPB 3V4OA 5JBNA 4KKXB 5IKPA 4R2LA 2FHSA 3OICA 3AGQA 3DNFA 3NHLA 3VVBA 1XA3A 1Z3IX 1W34A 1Z68A 2F2AB 3P26A 1UBFA 2WE7A 1WXHA 4LMAA 1WY5A 3H04A 1XDWA 2OWDA 5TSDA 2Q7OE 1V7ZA 3AUAA 1Q3VA 2ZUBA 4F6LA 1F44A 1WMAA 2QUKA 4FDMA 4PG6A 1PR0A 4FZMA 4E46A 5IK2D 1Y9JA 1AOXA 1RM4A 4Q12A 4IC9A 4J16A 1T6XA 2HNBA 4IIVA 1SPXA 1MJ5A 1PG5A 3TNJA 2J0UA 4LF8B 3EWAA 1V4BA 3IALA 3WI7A 2BMFA 2V97A 2ZT7A 3B60A 1GQQA 1JLLA 4C0JA 5CM9C 4RY2A 4BC0A 3IJ5A 1SG6A 2VBIA 4MZDA 4XB2A 1N6HA 4RLSA 5K0BA 1PZNA 3RS0A 4MGHA 1WTCA 1TVEA 3NBKA 1QPZA 2JEOA 2A5FA 5ECWA 2GBLA 3RCBA 2IYSA 4DQSA 1Q3TA 4J9SA 2VDKB 5GJWC 4DIMA 2FOIA 4Y9RA 2PH5A 4YO7A 5K3OA 2WWRA 4RQ8A 1BXKA 1RWBA 3KXLA 3WFJA 3ZBTA 5EIBC 3HC7A 1HM5A 3GIIA 1HFEL 3DVSX 4N0MA 4UAGA 5KT3A 3F0TA 3SOZA 5JO9A 4DNPA 1VL1A 3A11A 5DB9A 3SFZA 3OOYA 4QU0A 1W93A 1QTIA 1ISRA 3R20A 4EY5A 1K3TA 3ENWA 2J08A 1WUKS 4R63A 1Z74A 4DV5B 1I4EB 5EE9A 1XVIA 4TLLB 3UGJA 1FRQA 4W5HA 3RUAA 4IEEA 2ID4A 1QRAA 3RROA 3GXBA 1GILA 1FSPA 4O63O 1Z7GA 2SKCA 1NKVA 3K4PA 4DNFA 3MELA 3F4LA 3G6WA 1V11A 5IARA 3F74A 1JXLA 4OXQA 2JLWA 3NHPA 3KO8A 5GWXA 4BBPA 3IOCA 2LKDA 2FSIA 3N0RA 5ALOA 4CMCA 3E9RA 2HDWA 2ZTCA 3ZDXB 1VKOA 4CL8A 2GK7A 1ZSNA 3M6VA 1ZM3A 5CA0A 7ICNA 1ISIA 4BU0A 1D4OA 1Q95A 2JGMA 5F64A 4N9QA 1B3BA 5EMKA 5DW0A 4KNYA 1N4AA 1N33B 2OCXA 1WCIA 4WFIA 2FMXA 1SG0A 3FRHA 1HE1C 3V8EA 1L5HA 4A15A 3MJDA 2NUTB 2XUFA 4Y6SA 1ISHA 3CVJA 3DXFA 5CDYA 3MTBA 2CLFB 3TCNA 1YB2A 4XYEA 3ZQJA 5SV2A 3AXTA 3QU7A 1FXUA 2DZDA 4WGGA 4RESA 9ATCA 1HY3A 4XLLA 3MWDB 3E3AA 3HN7A 3L7CA 2Z7JA 3L1VA 1M2HA 1K7XB 3W5CA 1DP4A 3SEFA 1QR6A 3AJRA 3U3DA 1NVAA 2Z2KA 4ENSA 3P2OA 1DLIA 3N2EA 4X65B 5I7SA 5BT9A 3TLZA 3GROA 1X1QA 3R8CA 3VDMA 3JD4A 3ZNOA 2X4LA 5IBPA 2IYEA 4KW7A 1YDEA 1NN0A 4TWJA 4TXLA 1ID1A 1Z2EA 4MV1A 1CDDA 4OAQA 5KBYA 3A2MA 3LOUA 5HDBB 3NEJA 3DWIA 5IMSA 2W11A 4D25A 2R6GA 2BEWA 3RYIA 9ICWA 1QJCA 3SZOA 1M1ZA 4OO1J 3NV9A 4WJZA 4C5AA 3QVKA 3JR3A 3C4QA 2GN4A 2Y4OA 1KRPA 1RPJA 3TVTA 1SBZA 1FE8A 1MQ8B 3OO0A 1KJ8A 2I71A 2M9NA 1RZRA 3OQHA 1VHDA 3PUYA 5IJ0A 2F59A 1WWVA 5EIAA 5D6NA 3NRWA 5AM0A 2QRLA 2AFIB 1ULBA 4XPZA 2HXGA 4JP2A 3FROA 4LIPD 1M2OA 5J0PA 1PWEA 3F53A 2WB1F 4D8VA 1VHWA 3I0MA 3I04M 2BFAA 5AK0A 3B6EA 5IULC 2BGRA 3DYBA 1AKRA 3PT5A 1X80B 4O3PA 2CHEA 1EHCA 1RYSA 1VLHA 2Q6LA 3VR5D 2A57A 1RXWA 4DGSA 4FS8A 2ISOA 3BIOA 3OKFA 3AVXA 1PR2A 1P1HA 1R9GA 2X6RA 4TUPA 4J29A 1HFWA 3T5JA 2VT6A 4B3FX 4DQ0A 2X8BA 3QVWA 4L08A 1IZ7A 1XJQA 4Q1AA 1CJSA 3EQ6A 4D4LA 1VFPA 3SQXA 3QVUA 1NYRA 5KNIA 2P6RA 3EQ7A 4H35A 1M8KA 2H5IA 3IPRA 3D0KA 1SWWA 1WR8A 5CXQA 2EFEB 4DV6B 1C9JA 4B7ZA 1XMXA 1HGXA 5DW3A 1J39A 4MB0A 2FR1A 4YCCA 1FU8A 1PR5A 3RVJA 2W3SA 2OV2A 1GG5A 3RVSA 4BZPA 2OILA 2JNWA 5DNUA 3O84A 2H2HA 5FI0B 4A7PA 1DAFA 1LGYA 3K70B 2WAOA 2FMKA 2QW1A 1SRRA 2AOTA 2WZQA 1E3IA 5JAZA 2OCBA 2AKYA 2PTHA 1ACMA 4H3HB 3RAPR 3RM3A 2K5UA 1Z07A 1XNHA 5C8YA 2NRWA 4TSKA 1AY0A 3G0HA 4DM4A 2VSFA 2Y1XA 2PRJA 1C1YA 4RKYA 3ZGYA 1QYIA 2P2NA 2YWCA 2KP7A 1Y8CA 1ZGAA 2BDTA 2Z2YA 5KYVA 1UBKS 3CT6A 4P3OA 2FLVA 4OQZA 1NXTA 1UOEA 1NUAA 1SCUB 3BE5A 5KFIA 2FPGA 1RTTA 2YV1A 1JH8A 1FFUA 3PWTA 2O8DB 2DHCA 1U9LA 2RH5A 4N5HX 4JYCA 5DHAA 4DC1A 2ZUEA 3I8SA 1FO4A 3LT5A 3L0BA 3COZA 3QI2A 4NMHA 2Y2VA 2YVUA 2CYBA 3KZMA 4BQFA 5C7OO 4QICA 2O2HA 3JZIA 5AVOA 3K35A 6CHYA 1O96B 1ITZA 1E9FA 4BRSA 3LZCA 3B13B 2ZRPA 1IQPA 4LPKA 4OJ5A 5JDIC 1P19A 1JG6A 4WFKA 4JD5A 2DTXA 1GCOA 4OK6A 4L85A 3NRJA 4KR9A 1AROP 1LBEA 1MIOB 2Q07A 1VECA 3DYVA 2Q45A 4PZEA 2PZAA 5KG1A 4C0SA 4B3SB 4B4DA 1CVLA 1IRIA 2Y93A 3AEXA 4UUBA 2OVFA 1QIJA 1T3HA 3C70A 1K1SA 1MRNA 3PFCA 5I47A 4RANA 4IUCS 1E0DA 4ND5A 3IAFA 2HIAA 1Y1QA 1LNQA 3MGHA 3IAM1 4QFDA 3ILSA 2WNHA 3VYSB 3O4HA 4N7BA 5F52A 1RBQA 4P3YA 3S70A 4P93A 3BVPA 4C3UA 4U6NA 3BS7A 3EXIB 1UBUS 4G0OA 1XMQB 1KJYA 1KJNA 2ATLA 1RFGE 5CB4B 1U7UA 5FOVA 1COWD 2QJRA 3W6PA 4MVJM 5LMZA 3AL0B 4BV2A 2ZROA 4MUBA 3M8RA 2CGEA 2XXBA 2PUFA 1UQTA 1M34A 4DJEC 3TTSA 1E7QA 3E7FA 4MFCA 2O1XA 3H1GA 1AZWA 4PQFA 4QUKA 2ZRQA 3I73A 2X3UA 3GLGA 2PGDA 4MQFA 5HTKA 2FZ5A 3MCAA 2VHQA 4QQFA 1TM7E 4C80A 3C16C 2G70A 3GDHA 3HVHA 3EUFA 4IGFA 3MRSA 1P9NA 2CYCA 4DA9A 3FDJA 5LLSA 3KEOA 4WLFA 2P66A 3U5TA 3N2LA 5JU6A 3H8SA 1QQ5A 3OWXA 2WTXA 3H6GA 1I1OA 3WLEA 2V96A 1PJBA 3Q3VA 3ZG6A 2AUMA 1U02A 3LFUA 4DWIA 3A10A 2Z6AA 5IASA 2IBMA 4NMLA 4O4LF 1U8AA 2G04A 3RRFA 2B4TO 3K5PA 4JLBA 1ELOA 1QIEA 3HCEA 1J0EA 1SKQA 3HACA 5I51A 1SXJA 2O2GA 3IAM6 2AJBA 2QJFA 3ZI4A 5LR6A 2Q46A 5D7NA 2A1TS 1N5RA 3AHFA 4YJFA 1JROA 2J48A 2X0EA 4P7BA 2I54A 1RXYA 3ZNNA 5AW0A 4H9GA 4PY2A 1OFUX 4P3PA 1R6TA 4X63A 1CS0B 5K7SA 2IYPA 3IP3A 2JZOA 7MDHA 2YYAA 2B8TA 3GEPA 5FKJA 5IZCA 2Y4NA 4Z9BA 3UWKA 2BFCA 1E2MA 3NT5A 3W05A 4QJBA 4FFWA 4ZQBA 4QXOA 1B8VA 2VP5A 3NATA 3JZMA 3IHLA 3K9WA 1X8JA 2IDZA 5DBEX 5CFLA 1X9XA 3QV2A 2IYVA 3KXDA 1GG9A 4MQ5A 4CIYA 2JLAA 2ORED 1NYTA 3C85A 2JI8A 1SGWA 2FPPB 3SE7A 5LZ2A 1KU6A 2H3EA