3QU4A

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13ala mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
223
structure length
223
Chain Sequence
RKKLKAVLFDMAGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 77
structure length 223
sequence length 223
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qu4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qu4A01
1K1EA 3W5AA 3WKDA 5ALQA 4Y2TA 5ALDA 1EK1A 1T5SA 5ALMA 4E88A 3OCVA 3WK4A 3AR3A 2DQSA 1N9KA 5ALTA 1U7PA 3I28A 3GYGA 2CFRA 3ET5A 5IS2A 2ZOSA 3ZX5A 3L8GA 3E8MA 4BNDA 3PCTA 4XOUA 3DAOA 1YS9A 3OCYA 1ZRMA 3QGMA 5AI9A 3R09A 1RQNA 3PGLA 3B9BA 3NAMA 1SWWA 2Q5EA 5AKJA 2IA5A 2GFHA 5IT4A 4J2TA 3CNHA 2P9JA 3EF0A 3KBBA 3UMBA 5AM5A 3NRJA 3MMZA 2JGAA 2C8LA 1Z5GA 1SU4A 4KX5A 3OCZA 2FPWA 4I9FA 1O03A 2FEAA 3L8HA 1EK2A 3CZ4A 5AVTA 5ALXA 3QU5A 2HF2A 4ZEWA 3WGUA 1L6RA 5ALPA 5AI8A 5AK3A 1YNSA 2C88A 3WKBA 4EX6A 1ZJJA 2G07A 5AKHA 1YV9A 3L8EA 3R9KA 2O9JA 4XQ0A 1RLMA 5AVRA 4UAVA 3E81A 3VAYA 4KNVA 2WF5A 5ALUA 5ALJA 3UMCA 4MWOA 3AR6A 4OD0A 4KN8A 4RETA 3L0BA 4AP9A 4DFDA 2B8EA 2CFTA 3J7TA 2G08A 3QUQA 2FPSA 4UMEA 3AR2A 1ZD5A 4C4SA 4KYTA 4BNDB 4Y2QA 4HGRA 1RPZA 3KD3A 3KOOA 4HGQA 4Y2PA 3FM9A 2YMLA 3TLMA 1O08A 1QH9A 1Z88A 2GO7A 5AW6A 1ZD2P 3KDPA 4KX3A 3SLRA 3N28A 1S8OA 2HO4A 2FDRA 2I34A 1RMTA 2HSZA 4EZEA 1WPGA 2RARA 3EF1A 5AVUA 1ZRNA 5ALOA 3AR7A 1U7OA 4BEVA 1N8NA 5AI4A 2PQ0A 2JAOA 2EAUA 4OHFA 5AW8A 3U26A 2HI0A 1VFPA 2HHLA 1SWVA 2IYEA 5AM0A 2I33A 2YBDA 3EWIA 5AKGA 2HCFA 3ONNA 2RB5A 1ZD3A 5AIBA 3L7YA 2AH5A 3HYCA 3PGVA 3N07A 4Y3UA 2G1AA 1T5TA 1QQ7A 3FPBA 4ZEXA 1Z4MA 5AVXA 2B8JA 2AMYA 2AGVA 3SF0A 1Z4PX 4OFZA 1Z4KA 2FPXA 1YMQA 3QX7A 4EX7A 2YMMA 5FP0A 4H1WA 1ZD4A 3EPRA 4UMDA 1VJRA 2GMWA 4BYGA 1Z5UA 4G9BA 4CF3A 4UU0A 2FUEA 3OCUA 3MC1A 2WFAA 5AW3A 1RDFA 3QU7A 5AVWA 3FZQA 4I9GA 1CR6A 4CF4A 4CF5A 4YGYA 5AM4A 3IB6A 3NANA 3WK5A 1L7MA 5AVQA 3N5KA 2C9MA 2YJ6A 3KZXA 3QLEA 5AW1A 3R4CA 4FFDA 4YIHA 1U2TA 5ALEA 3U7HB 2PKEA 5ALZA 2RAVA 5T41A 3UM9A 3ZUPA 1NNLA 3ZVMA 4CE6A 3I1YA 3L5KA 1RLTA 2B82A 1RC8A 3ZTYA 3QUCA 2IOFK 1Z4IA 3WK7A 1Z4LA 3MN1A 4O8CA 2B30A 4NABA 5AM3A 3ZWKA 2QLTA 4KNWA 3W5DA 2G0AA 2ZG6A 3D6JA 3DNPA 2I7DA 2YJ5A 1U2SA 3E58A 4YIKA 5AESA 2R8YA 5AICA 2W11A 4NAVA 3U7GA 3ESRA 3IJ5A 1RMYA 2BY4A 2OM6A 3OPXA 3WKAA 5ALLA 3KC2A 2Q4TA 4HGOA 3ZWDA 4BEWA 4BBJA 4RESA 1AQ6A 1RKQA 3ZU6A 4DCCA 3M1YA 3I6BA 3U7EB 5AVVA 5ALNA 4JB3A 1WZCA 4EENA 5AM2A 1Z4OA 2RBKA 4GIBA 5AKYA 1LTQA 4OCZA 2MU1A 3N8GA 4BX2A 5AKEA 4Y2RA 5AI0A 5AKZA 5ALIA 3P96A 2O2XA 2MU2A 1L7OA 1TJ5A 2R8ZA 5AKXA 1Y8AA 5ALGA 4EELA 1L8LA 5AI6A 2YFYA 3L0CA 2ZBFA 5AKKA 4BKMA 4L57A 3I76A 2NO5A 1Z4JA 1TA0A 2CFSA 3U7FB 2WF9A 2ODAA 3BA6A 2I6XA 5JJBA 2ZBEA 4PNHA 3W5BA 4Y2YA 4L6CA 3ZW7A 2JAUA 1RMQA 4HYTA 3SHQA 1LVHA 3FGOA 5AVZA 5AIAA 2G06A 3QXGA 4AS2A 1XP5A 4UW9A 4J03A 1MH9A 4DW8A 5E0OA 3QU2A 3QU4A 2R8XA 1FEZA 2HOQA 5AI5A 3QNMA 1J8DA 1NRWA 1RKVA 2I54A 3OCXA 4UU1A 4NFLA 2YJ3A 4UMFA 3M9LA 5ALKA 5ALRA 2FUCA 3B8EA 4YCLA 3ZX4A 5AW0A 2IOFA 2W4MA 5AKIA 3FVVA 2WF8A 2G80A 3ET4A 4YCMA 3RF6A 2Q4RA 3U13A 2CN1A 4UMVA 3L1VA 4HGNA 1XVIA 2B1QA 2OYCA 2P27A 1F5SA 4UM7A 4UM5A 3A1EA 2MSNA 2YMPA 5AW4A 3OCWA 4GXTA 1L7NA 3QYPA 3DDHA 2YN4A 2IOHA 2HF7A 4Y2XA 1QYIA 5ALWA 4Y2JA 3FPSA 2C4NA 3W5CA 3L0YA 2OA0A 4QQFA 2W43A 4L6AA 4UATA 2YY6A 2ZXEA 1TJ3A 3HLTA 3WKEA 5AM1A 1T9ZA 2G09A 2GHTA 4UASA 3SD7A 4FE3A 4F72A 3WK6A 1Z4QA 4NWIA 4BX0A 5IT0A 4QJBA 2GHQA 2EATA 4UAUA 5AW2A 4IG4A 5AKLA 3WKCA 2NYVA 1RRCA 3N1UA 1RLOA 2ZBGA 1VJ5A 4CNQA 3DV9A 4B6JA 4NV0A 3NALA 1U02A 4Y2VA 2FPUA 1XPJA 3AR8A 1ZS9A 5AW7A 2HX1A 1NF2A 5ALFA 1YJ5A 2JARA 4DWOA 2NO4A 5AHXA 2HEGA 2FPRA 5A3SA 1QQ6A 5AK4A 2WF7A 3ZVNA 2ZBDA 3PDWA 1S2OA 3QU9A 3SKXA 4Y2SA 4EEKA 1KYTA 1CQZA 2QYHA 3SMVA 1YDFA 4Y2UA 1IWOA 4C4TA 2B1RA 2BDUA 2HDOA 1L8OA 1RKUA 3IRUA 4YH1A 2VKQA 4C4RA 2PR7A 2C8KA 4IFTA 3ZVLA 3UMGA 4YCNA 3A3YA 3ED5A 3WK8A 1PW5A 2WF6A 3MPOA 5A3QA 2EARA 4BX3A 1WR8A 1Z4NA 3AR9A 1QQ5A 1JUDA 2YMQA 3F9RA 3BWVA 4HGPA 4AS3A 5ALSA 5ALYA 2AUTA 2B0CA 3E84A 4XPZA 1Q92A 3L1UA 3ESQA 2FI1A 4G63A 2X4DA 5ALVA 1WVIA 5AW5A 3ZTWA 4JDPA 3B9RA 3ZI4A 3S6JA 4F71A 4MUMA 1ZOLA 5AVYA 5AW9A 2YJ4A 3A1CA 3AR4A 2I55A 3L8FA 5AK6A 3U19A 5A3RA 3WGVA 5AVSA 1TJ4A 2D2VA 4HAIA 3RFUA 2WHEA 3NIWA 1X42A 3NASA 5ALHA 2JAWA 3QUTA 5AK5A 3OTQA 3A1DA 1L7PA 4UARA 3QUBA 4FYPA 2WM8A 3K1ZA 1TE2A 1Q91A 2P69A 3NUQA 3SKYA 4ZEVA 2R8EA 2P11A 2BDEA 2OBBA 1RQLA 1J97A 3WK9A 4XE5A 3AR5A
chains in the Genus database with same CATH superfamily
2R8JA 2IUTA 3R1IA 3JQGA 5LMZA 3G2QA 4C7BA 1JHVA 4BIMA 4ZVQA 1ZY2A 3LXMA 1G6OA 5K3DA 3BCUA 1BHO1 1LV8A 4S2EA 4CQMD 2EF0A 3KPYA 4GWGA 4X45A 1TUIA 2FR8C 4N0DA 4JT4A 1DQNA 4JLJA 3JQQA 4B34A 3TJRA 2J32A 3STXA 1O96B 3ZXXA 4AYXA 2XO7A 3KFLA 3GRRA 1BG6A 5LQMA 2C3PA 4PPYA 1AUOA 1L1EA 2IUSA 4MMZB 1KAMA 3VDNB 3B12A 3KZVA 2EEZA 4LXQA 3AH8A 5EHXA 3T5MA 2R1ZA 4HLCA 4LGMA 5JDIC 4QXPA 3RS4A 3A2NA 3IODA 3SLRA 4JUBA 3O03A 3K9CA 1JPJA 2AJBA 2B5OA 2Q62A 1EUCB 3MJCA 3ILVA 1ZRNA 1QS0B 1NBIA 3V72A 4NFHA 1I2AA 2XT9A 1DI0A 4G0XA 1EK5A 1NK4A 3ZK8A 5KNCD 4JNKA 4ZOBA 1TVKA 4BLWA 5F21A 4O2BF 2AOTB 2IC5A 4CTKA 3BQ1A 1VL5A 2CXSA 1O58A 1W30A 4OSPA 3KKQA 3H0RB 3UUFA 4YLYA 3SOPA 2Y4OA 2AQ4A 3PLNA 3L4KA 4BP1A 1J33A 3D0KA 1EA5A 3HGQA 1BXZA 4A8TA 1XSEA 3S70A 2PIDA 2YZMA 3Q8PB 1KE2A 1KC1A 3ORFA 4F2RA 1J5PA 2Q46A 3KKZA 4D56A 1O8CA 1ZLYA 1E2NA 2KWIA 2PU7A 4DSFA 3PX6A 2GDZA 3HTXA 3GJ5A 5HYVA 3MTAA 5ALNA 4U7JA 4EKEA 3ZWPA 4X61A 1DXSA 2ZBPA 1KDZA 2O2XA 4RK6A 1X1AA 2JLUA 3ANMA 1R8XA 1QZZA 1SXDA 1U1DA 3QHAA 4BFUA 2W98A 1C9KA 2ZJ4A 2JA2A 4GE3A 1XAHA 3W5BA 4LSMA 1FDRA 1MTZA 3QBEA 2V9ZA 3AVUA 5KINB 4HS9A 1UMCB 1G5HA 4DSJA 3GQBB 4GMDA 4QECA 2AHOA 1L5GB 3M6MD 1NU8A 3V2IA 2ORVA 3R44A 4CMIA 5KAIU 2ZW9A 5FH9A 2V9CA 4D8UA 3VZCA 1ZQZA 1GGVA 1GCOA 1YK1A 4Q9LA 4BJ3A 2BM0A 1JEYB 5A6VA 4Y9UA 1YQUA 5C3MA 3EAQA 5EZYF 2C9DA 1PV1A 3OZSA 5U4QA 3R0QA 1GUZA 3DZJA 4DSKA 5KWIA 2YH2A 4MPTA 4Z99A 3VKGA 3V1KA 5EJFA 2H3ZA 4PZ0A 1HDYA 4UAUA 3W6PA 3M34A 3IAS1 3OLCX 3WNZA 4TS9A 5CDHA 3GJZA 1UBJS 2RAFA 1V2GA 1AQUA 1F3LA 1KZ9A 3WU2U 2JW5A 4S1PA 4DUYB 2FPUA 2XV1A 5AHXA 4PXAA 3WXMA 5AK4A 2IPXA 3ZVNA 4A0HA 2XEDA 1M7BA 3F4KA 4EEKA 4B46A 3VKWA 2QYHA 3F2IA 3BD6A 2IHJA 1SCDA 4AAYA 2Q6KA 3REGA 1KU0A 5LQDA 1U47A 2RH8A 2BTQA 3ONDA 2O2DA 3TARA 2H2FA 4PL2A 4EGSA 2ZTEA 4DCGA 3IEUA 3CJQA 3VU3A 4GI2A 3D6HA 4EYOA 4I2CA 2WTFA 2FNAA 1K88A 2WJ6A 2YQ4A 3OTIA 2CCKA 4AQYB 1ISSA 1QSLA 4DDMA 4KJZA 4M53A 3UJ7A 4F5NA 5AUPB 3SX4A 3OE7A 1YI0A 1ODFA 5DRTA 4KLQA 2N75A 2XUQA 2NSJA 1KKXA 1C8VB 4WESA 3NONA 2JA1A 1ESEA 5IDQA 1X8LA 3E15A 3LNCA 2X0IA 4A6EA 4QQKA 2FZGA 3PR3A 3NM6B 4FX5A 1KTIA 3AHDA 3MWLA 1TU4A 5IEJA 4ZRDA 1DP4A 1GQYA 4O4LB 1BX0A 1UIRA 4MO2A 5ERGB 5E7IA 4HEJA 4KNYA 4I9FA 4PSVA 2P2ZA 2D1TA 5D5PA 1U9JA 3TUZC 2NQ8A 1I6KA 1M5TA 4JBIA 1PDVA 2VEOA 3OHBA 5I8ZA 2KP7A 2ADFA 3IQEA 4P81A 2DERA 1CI4A 2RBGA 3GV8B 4XSHA 4WK0B 4OHUA 2NTVA 3ZZTA 3T38A 4DDWA 2G9QA 2XI4A 4URVR 3I04A 1EAMA 3TIIA 3RAJA 1H0KA 4JJ7A 1FSGA 3ZE9A 4CMCA 2PUAA 4Y30A 4H60A 3B6EA 3V7UA 2POQX 3V7WA 1GQOA 4RLHA 3DC7A 5E0KB 3GP5A 3N75A 2VATA 4Q3DA 3WLHA 4O29A 2AJ8A 4CMBA 4EX7A 4ZT7A 5DHAA 4OYYA 2TYSB 3VCBA 1GTRA 4AN1A 5EJIA 1N33B 3WQBA 1YZQA 1G5TA 4NAUA 2UAGA 2GZSA 2R1VB 4A3SA 4Y1RB 4RLFA 1MAWA 2QG9A 1FSFA 1GPWB 3EVGA 3RYHA 3D2LA 1BVRA 5I9NA 1MABA 2IJGX 1GT91 3V4VB 5DX0A 1VYHA 1CCWA 1AB6A 2C2RA 3KAPA 4YMSA 4PYRA 3EVFA 2VXYA 4ZVOA 2R86A 4LF7B 1DT5A 3C5HA 1SXPA 1VA4A 3C39A 4FDTA 1LSSA 1NN1A 4LPKA 4BU1A 5ED0A 4CIXA 4HDNA 5SZIA 2EFJA 3DEZA 2HCJB 2GN4A 2X7JA 5DM1A 4XSVA 4NCJA 1JQLB 1TYBE 2IH5A 4RZSA 3SHQA 3E4DA 1XNGA 1UPCA 1GADO 2OAP1 4QYWA 2I2FA 4YRJA 4EA9A 4IUYA 1S1MA 16PKA 3NJRA 2IA6A 2C0CA 1V43A 4FZ3A 3PQ8A 1ADCA 5B6JA 1NP3A 4D4IA 3PW5A 1V5GA 3R6GA 5CA1B 4ZANA 3EQ7A 4NR0A 1XJWA 1QFSA 1AS2A 4ZI7A 3B9JA 3TLZA 5KSYA 4AY4A 4XWTA 3K70B 1EQUA 4K9PA 1G8YA 4DA9A 2B37A 3H04A 4C87A 4FZRA 2FW1A 2YVQA 3A2MA 3VAZA 5KVAA 2CXUA 3WKCA 4QOIA 4DR7B 3NBZC 1NR1A 3ZGOA 3WYCA 2ZE8A 1B2RA 3BMNB 4YJKA 4D81A 4UTXA 2QJOA 1W4CA 2PKQP 3EXEA 4B81A 1K5HA 5KHAA 5A4JA 1GVNB 1E9RA 1TW3A 3SHTA 1QO7A 1V7ZA 4M83A 5I48A 1T91A 1AE1A 4JV2A 3BG5A 1UXOA 3K0FB 2RGEA 1ZQKA 2O8FA 1OR8A 3UYLA 2WIKA 3VPHA 1U5BB 1C9YA 3K32A 5J0OA 4G5GA 4HRAA 3QV1A 3CVXA 3ZLTA 1W5FA 1E9SA 5KFOA 2ZDHA 4BOYA 5C1IA 5JXWA 2D0DA 1RHQA 3R8CA 4GHWA 3FYTA 1W48A 2ZTUA 1G8GA 5C8YF 3C4QA 3Q85A 3ADBA 3TQCA 2VXCA 5CTAA 4Z0NA 1QGAA 3MZ0A 2RJOA 2QG4A 4JQOA 1OYOA 3VR0A 2JH7A 1ADYA 3DO6A 3SS7X 5FOQA 4EB0A 3WKDA 2ZIXA 2CGEA 2B4KA 4LE2A 3UF0A 4H77A 1I9CA 4TQUS 4KQEA 5A1TA 3AILA 2FQYA 2E4AA 3CLSC 5JYCA 4LJRA 4RGYA 2WM3A 4P0PA 4EPVA 4O3PA 5A5VA 4TN1A 3CISA 3G5AA 4IXMA 5HTOA 3PHLA 4J91A 5EJEA 2I6UA 3ZHTA 3PIDA 1H8HA 1IXYA 4AWXA 4W9MC 1OHHD 1CUFA 1KMQA 3BFVA 4YAJA 2XZLA 3I58A 4DS3A 5DT9A 3EBPA 1EJ0A 1E4YA 1JDZA 1C0KA 4MV1A 4MQ6A 3WNVA 2V58A 3DP9A 5EG5A 4UD2A 4TWJA 4EB6B 3FJYA 2K2QB 3LUPA 4HGQA 5ICCA 3EGOA 4MJ3A 4OAOA 2GTPA 3NGMA 1T4DA 2VTDA 4C0KA 3O1IC 1Z17A 5J0UA 4B76A 3WRYC 4WZBA 3UAWA 5AW8A 3U26A 1L5VA 2GXAA 3IOMA 3TINA 2WAQC 3LH5A 3CX4A 2CKMA 4FP9A 3V8EA 1S76D 4I2JA 2CBXA 1BFKA 4WKNA 3GCXA 3V8RA 2DM6A 3TMYA 5KOIA 3JZAA 1L9XA 3IJRA 3T8YA 3KTAB 1LUAA 3JQRA 4Z9FA 1JHDA 4J0HA 5C53B 3I92A 3F6SA 2CMDA 3ZWBA 3ICVA 4ZHSA 1AO0A 1Z34A 3BEDA 2FSFA 2IMWP 2FF5A 1M6VA 4DNQA 3IR6A 1M2GA 4CEHB 1PJQA 1OLOA 2BI4A 1FUUA 4WDRA 4RCZA 2ZSHA 3GCDA 1JQEA 4HAOA 3V4LA 2BBWA 1RFGE 4LA4A 4YQEA 1ZP6A 1Z2EA 2R8YA 5AJWA 4NAVA 2O0JA 1QC5A 1YFKA 4NU6A 1QFXA 5PNTA 3TW4A 5JHHB 2QMYA 3CLRC 1VRVA 1QHHB 3DT9A 2O8BB 4NNOA 1SKSA 5ENZA 2DKXA 1QLHA 1MQ3A 1AA9A 4J9NA 1NHGA 3GDHA 4EQ6A 4D8YA 1F0PA 5LLSA 4CG3A 1P62B 2QUJA 1TNDA 2W83A 3MAGA 4DNPA 1G5IA 3SS8A 3QX8A 3V3TA 5AVZA 4R9RA 2C57A 3VGPA 1R0SA 4BGEA 1VQ1A 4F8JA 1ZMBA 1NU6A 5LKRA 2YXNA 1J8DA 2I7TA 3VTZA 4AT1A 3ABRB 3AKZA 4AJJA 4JSYA 2WABA 4G0ZA 5IVDA 1YRYE 2G80A 4CN9A 1O95C 1MEJA 1S3FA 3RJ9A 1NDUA 2X58A 3JPPA 4EGCB 4Q7MB 2XQGA 2Q4DA 2B1QA 5IRCD 2HK6A 3DB1A 2QW8A 1S89A 2NN3C 4LX8A 4AUMA 3E6AA 1S8NA 5C4GB 1YBVA 3UJHA 2HLHA 2HNBA 2ANCA 3BYZA 2FPOA 3SEFA 4V38A 1JNYA 4LMBA 1VOTA 4FR5A 1JBQA 1I10A 3IUSA 2HK9A 4EPTA 1D5WA 1Z16A 2HD4A 4LC0A 4YRLA 1ZC3A 3LXUX 2XDWA 1EJBA 4B6FA 1EE9A 2V7WA 1QK3A 1SUPA 5BW4A 5CBKA 4LXXA 4DLWA 2GLUA 1PZFA 2CLKB 2Y92A 2BCUA 4TSKA 3DBLB 2H92A 4DREA 4KQIA 3IOBA 1RABA 4HBGA 2BRUA 5E1MA 2XJ9A 5A3JA 1ZQSA 3OZFA 4UCXA 1NJFA 3V7YA 3B9RA 3OZAA 3D31A 2WYWA 1P2TA 2PX8A 3HBJA 1ABFA 2ZIWB 4ZDIA 1CSEE 7ICKA 1TF7A 2K8AA 3BRWA 4P4OA 2C9CA 2OQVA 3PFBA 3ND8A 4RJIA 4P38A 2AJDA 1DEKA 3EARA 2QZ9A 4PZDA 2PBFA 1C7RA 3W5VA 3LTNC 4HOYA 2PUWA 3GIDA 1SKUA 2CXOA 1Z74A 3BAFA 5H1YA 2OLKA 2VZEA 3I5AA 3WYEA 3DTVA 3GW8A 1MJHA 3E3LA 2ZS7A 4X64B 3OQIB 4EYHB 1RHMA 2WWHA 5KKNB 2V0CA 2X77A 1XPRA 1U6JA 4RT2A 4MRVA 3CUEF 2VP0A 2WAQF 1NK9A 2AOTA 3H6KA 2FZ4A 5CDUA 2Y1WA 2GQ0A 3RVBA 4QJ3A 4Q05A 4ZCLA 3AUXA 5K03A 2ZXUA 4GWLA 2O3RA 2QXYA 4JYZA 3LRXA 1VPVA 2C29D 1XSPA 4B6GA 3GPDG 1EESA 2AG6A 5TR9A 4FFVA 1DIGA 2QAJA 1P7WA 3FDFA 4F3TA 4D25A 3SZRA 4B82A 1TO2E 4KQJA 1SQ6A 1IM8A 4ZREA 1Z4PX 2CNWD 2Q9CA 4R68A 3C5GA 2VK8A 2JD2A 3LBFA 3O4FA 4N3BA 4WCVA 3IFSA 1EMDA 4GDMA 4FFRA 2R6DA 3ZHQA 3FCCA 4YR9A 4E5DA 4DIEA 3O3CA 2IZ6A 4PM4A 3BX1A 3KZXA 1VLLA 2VUSA 4PQRA 2P66A 1NVVQ 5DO9A 1ULUA 3G79A 3R7AA 1T10A 1CDEA 4N5MA 1P5ZB 1SQFA 1DRVA 4YRNA 4GZMA 4HAWA 4MVJD 4CCWA 1UMCA 3GQBA 2BJWA 1DAIA 1CNMA 1FFXA 1YDMA 2LBOA 3ORRA 1XE3A 3B70A 3WJ1A 1KI8A 1HEYA 4EENA 5B1EA 2EQ5A 1Y5LA 1D0IA 1R8YA 4FN5A 2GWSA 2QM7A 2IF2A 2R2AA 5CFPA 1JEYA 4KQGA 5IBCA 4YLGA 4RZHA 3EPKA 4XUCA 5I9BA 2K6GA 1IRXA 4DWWA 2Q4EA 1RYEA 3WLFA 4ZVKA 1DJNA 1VE6A 6YASA 1HYBA 1W44A 5EJ5A 2IYYA 2VEDA 1OB5A 3NGLA 1VPDA 3AC0A 3IDOA 2O5CA 4PLYA 5CT8A 4WZZA 1YVDA 4S12A 3U3OA 4AY5A 4ED3A 2C8JA 3UMFA 3W9SA 4QD3A 3TTTA 5FNVB 2GXSA 1SXQA 3WGLA 5KPJA 5CCDA 1PBNA 4N5DA 2C04A 4MWZA 4Z9XA 4COKA 3NKLA 1TCAA 4JB8A 3AINA 2P3SA 2H8KA 4QJBA 3HDQA 2A6PA 4JB0A 4GYYA 4YP9A 3FSGD 3I4CA 4DEZA 4CL0A 3OH8A 2WDPA 5DYNA 1BDHA 3I6QA 3WRWA 1FQKA 4B1FA 3I32A 4HD8A 2WD9A 2JI9A 4DPKA 3QX9A 1H6CA 4PCUA 3PDWA 4Y2UA 3NM5A 3HU1A 3WWZA 4CCYB 3SI8A 1PV4A 4WK2B 4MXDA 1MNAA 2VRBA 4X85A 1NYQA 2EFCB 4QJ4A 4PTZA 1SIWA 5FR1A 1QGUA 1XWWA 4Q8EA 4M9SA 5ALYA 3D4LA 1P31A 5BQ5A 1JAZA 1KDYA 4EHIA 5CNJA 1C7IA 1ECJA 4DYHA 4O4LA 3ELYA 3MGBA 3DKVA 3NASA 4M1QA 1P73A 2JAWA 1A5ZA 3LOPA 3QTLA 1CR1A 5DBGA 5HQTA 4YXFA 1RIIA 2RDMA 3DL0A 3W5AA 3P4UA 4WCFB 2WI8A 1UPAA 1SVMA 1QRAA 4M7PA 3OSZA 4JC5A 5HWSA 4EBDA 1O9BA 3HXLA 1EM6A 1VG1A 4A03A 4Z6FA 4C4OA 3AN1A 4PRLA 4OXRA 1P7PA 4L0DA 3HCPA 4JJEA 1WSAA 5CAEB 5E38A 3CBQA 1S9HA 1M8JA 3IELA 3EDCA 4MNTA 3AVPA 2PWPA 3I05A 1BVHA 4LYJA 3KFVA 5J2UF 5CCBA 1GEGA 5DTQA 2GK7A 4GKVA 3JQ8A 2V65A 1KQ3A 4MWOA 2WHPB 1J2MA 4R65A 5D51S 5HMMA 3A9UA 2IPNA 3KHHA 3OOHA 5CLLA 3LQQA 4OXKA 2JFXA 3Q8RB 5KIAA 1B3BA 2JI4A 1POXA 4TSRA 1BH6A 3ESBA 1PWEA 2X15A 4EO7A 1UH5A 1VE1A 3T7CA 2DLNA 2R1VA 3CZPA 4CGZA 4FONA 4P54A 2ZSAA 3OY2A 4QTYA 1GSAA 4P98A 3IVCA 3ZXYA 5TF0A 3HYCA 1LK0A 3PD0A 3SBDA 1TXGA 4OUKX 4YJ2F 3QLJA 2YYAA 1U2EA 1ED1A 4YK7A 3NP7A 3CB4A 2ZUDA 3EVDA 4F4XA 3MTJA 4J3JA 4MCHA 1A4UA 1KO4A 2BGKA 2SNIE 5TMEA 3D5QA 2WJHA 4QZEA 2PRYA 2PI5A 3CU5A 4DQXA 1ODSA 4F11A 3OA2A 4RZXA 4ZQEA 3ASVA 1KZ7B 1B4FA 4O2RA 4ZZIA 1NNEA 1XD9A 3B3QA 1DJMA 5MF6A 1N2SA 3FSJX 4HT3B 4ENUA 4K9RA 4A15A 3O9ZA 4D99A 2KQUA 1K8YB 3A4TA 5EXXA 2QKQA 2AX3A 2I67A 5FOWA 3A6PC 1QJ4A 1AH2A 2XMGA 3FMVA 4CT5A 4IL6U 1KNQA 3S1LA 2NU9B 2FFRA 4X65B 3O1HB 4X54A 1TLLA 5CA1A 3ELDA 3ZV5A 5H4GA 2ZJ5A 3KUXA 4DILA 1DV1A 2R8ZA 5HIAA 3SZ3A 5BSFA 1P3Y1 9ICJA 1E1RD 5HA5A 3PKIA 4DIBA 2VJDA 2FFJA 4XTCS 3JRXA 1E3IA 4C14A 1IY1A 4IF4A 4KK3A 2NUPB 2Q0QA 1FNNA 1DARA 5ENVA 4YDRA 1H1LA 3KJHA 1U31A 5KNDH 1UXJA 1Z6AA 1NYLA 3L0OA 1TUEA 3RM3A 2F1OA 3JVEA 3ET4A 2ZJ7A 3BMNA 1R4AA 2F90A 2BZGA 3FFWA 3BWMA 4BIIA 3QYPA 1VCHA 4PL1A 3VR4D 3SBEA 4C7ZA 2DSNA 2O14A 5EE3A 2P5UA 1BJKA 3I1JA 3K0FA 2QV0A 2EJTA 2JZCA 4Y1EA 3S7TA 1U5BA 4IRDA 4LXIA 2F1RA 2VP4A 2C98A 5DSZA 3ABQB 4PFKA 1DO0A 5BV0A 2XF2A 3W5JA 1LV7A 5ALFA 3B9QA 4K6OA 4WINA 1DZ3A 1J42A 3KVVA 4QO7A 4DWJA 1XHFA 2EGHA 4MHSA 5BV2P 2YJTD 4XSGA 2DWQA 1Q7EA 2O2HA 2BEUB 5KHOC 2XITA 1E7WA 3FDZB 3MRTA 4J2HA 3BBLA 5LXTB 1RHUA 3E22A 1A5BB 1JA1A 2P5TB 3ORYA 1P0CA 2IH4A 3RFTA 2H5EA 4CMEC 4FXOA 1F0YA 5CJ7A 1W73A 4FMPA 2VHVA 1KEEB 2BI7A 4I5EA 1P2DA 2JIZD 5CHYA 4R2XA 5CEJA 1BA3A 4OXXA 1T5SA 1YIOA 5EXDA 3PQ6A 1FFHA 1CDDA 5JOQA 1WUIS 2VK4A 4QQRA 4EB6A 2EDUA 3AYZB 3D1JA 2O2YA 1YR9A 3UKOA 4DJ5X 4KN9S 5T14A 1QG4A 2ZRPA 2FSVA 2IYLD 2PEZA 1ZD8A 3OUTA 3QZUA 1QYCA 3FJ1A 1TKDA 5GJBA 1LCIA 4M8KA 3PI7A 1WY7A 4W9RA 5FWXA 4CDMA 1SZDA 3KR9A 3HBNA 4R8UB 4ECZA 3DF7A 4F06A 4GICA 4FBLA 1RXIA 4AZ0A 3UW1A 3IKJA 5INTA 3VA7A 2DGZA 3LLSA 2R6JA 4G5XA 1YE8A 1ACJA 2X6QA 2C2DA 3UMCA 2A9JA 5ENDA 3HR8A 1NIJA 4TWZA 2VQFB 4GZ5A 1NXTA 9ICKA 3TW0A 3KTAA 2H4XA 1SUSA 1AQYA 4E09A 1DEXA 1PFGA 3ETEA 3TGPA 1T9CA 2JXJA 1Q0QA 1JQBA 2CJYA 2OV6A 3AM1A 3W3AA 4KLUA 1D1TA 5TQ2A 3E1KA 2WAMA 1UR5A 5IN4A 5JRZA 4D0LB 4J9UE 5K0LA 4BFWA 5AUNB 4KODA 1KO8A 4NM1A 3C16C 3UWMA 1QHHA 2O8BA 1Y3DE 2PK3A 2C82A 3HILA 1XZAA 3TEMA 2NW6A 3TRFA 1CC1S 4TTIA 1AY0A 2OVBA 1L4GA 3IB6A 3DFUA 3AFGA 4QATA 4EPWA 3RU3A 3Q9UA 5IJ0B 2HR1A 4IINA 2NVUA 4AY6A 2VDMB 1IJFA 3CE6A 1MZPA 4PSAA 1H8EA 1PHRA 1W1WA 4X1IA 1JDBC 1DAEA 3N7SC 2BDTA 2OWEA 4IXDA 1KP9A 2ZQ5A 4U7GA 2OZEA 4HNRA 2X5JO 5JBQA 4EW6A 3JV7A 4PHDA 4D7AA 3SF8B 3GGJA 2Y1GA 3W8EA 3DGFC 5DTEA 2H2GA 2ZCVA 4BV3A 3HBMA 3T5CA 4PC7A 3V8BA 2IDMA 7ICGA 4LJ7A 4GEKA 1Z15A 4Q00A 4QGGA 1KRXA 4BASA 2CVHA 3DOUA 3F98A 3ZN2A 1MN8A 4I2VA 4RF2A 2E6UX 1IVNA 4DO9A 3U62A 4CWAA 4BE7B 1EGMB 2BCRA 4I5GA 1SOWA 3EOZA 5TDHA 4Q4LA 2OZPA 2E6KA 4IR7A 1DAGA 2CE2X 3IUMA 4G8DA 1YA6A 4FKMA 1MX5A 3KB1A 4DLYA 5K01A 4RM2A 3DBLA 3C23A 2BCJQ 3QIVA 2NU8A 1TZKA 2GVDC 3A3OA 1D0SA 4S1TA 3HA2A 3RI3A 1EFRD 7YASA 4G25A 3R0IA 4J7CA 2WB2A 1H3NA 5HQJA 3AKCA 3C8DA 2OHXA 2BISA 5J40A 3L93A 4FHFA 3ICWA 4P5EA 1BCRB 1SVUA 5F1PA 2F00A 2GESA 4RS4A 1VCMA 1YJBA 4B9UA 1X9WA 5CA0B 3U3XA 5KQPA 2Y0BA 2Q5IA 5JEEA 3IL2A 4C07A 4EKIA 2X2FA 621PA 1OV4A 4OA8A 3VBCA 4MFFA 3B20A 1LBTA 4P7FA 5LMNB 5HIIA 3U48A 1QQ5A 2YMQA 3F9RA 1EUYA 1U4BA 1U8FO 1R0CA 1BKYA 2DCMA 4O3NA 5THKA 3DJYA 3RVSA 3PMNA 5IJXA 4FZMA 2QMHA 4KIJA 2AOWA 5IKEA 2FTKE 3OQIA 4B7AA 2BPGA 4ZAYA 1W0CA 3HCFA 1RWMA 2ZK7A 2ILTA 4WADA 4B48A 1H65A 2B6GA 4UFNA 2W93A 2P69A 5KL1B 4YJGB 4HXEB 4ND4A 3PGKA 5CWRA 1T2FA 5EKUA 5ALQA 3B52X 1X6JA 2EU8A 5EUBA 1PT7A 2CEAA 4MF2A 1WB9A 1SA0A 1PJSA 3B1YA 4GMXA 3R76A 3AEQB 1YS9A 1SUWA 3AM5A 1UBCA 4RE6A 1W5SA 3ZCSA 4OBWA 1MC1A 3AM4A 3DZGA 4RZUA 1DJQA 1NJ6A 2R7LA 1SXJD 3SYZA 3PW7A 2OXTA 5HUQA 1JXAA 2FU5C 1TLFA 1KEPA 1QFMA 4DL9A 3EZ5A 1II9A 1WUKS 2Q5QA 3S0JA 2DR2A 4AG6A 2A1AA 3EVTA 5JFTA 4XCVA 5KOJB 4ED9A 2YFQA 3AQ4A 3QWFA 3DSRA 1DOQA 5K4LA 4C8OA 3UV6A 1W1UA 4OD0A 1NK6A 3N59A 1XQXA 3DPSA 4U8GA 8ICSA 1ZQ1C 1C0LA 3L82B 3O83A 1UQUA 3DZHA 3TLMA 1QP0A 3VNUA 2I2DA 1WX1A 3QXSA 1OX6A 5GTHU 1TF5A 1I4LD 1JAXA 1Y8RB 4QJ5A 4UHHA 3IP6A 2D3WA 3B53X 4UEJA 3VZBA 1F1JA 2WMNB 1AUXA 1NUHA 3SZMA 1ZNZA 4OHWA 4LRUA 2C07A 2ZT7A 3QFHA 3OZCA 3EIEA 5JXHA 5DN6A 3H8WA 1FSZA 2GM5A 1PNVA 2C3YA 4AG5A 2NLOA 2OD2A 4IWXA 4C7XA 4J0FA 3NQ41 3ZI7A 4BDTA 2BMEA 3V32A 4YGYA 5J29A 1CQXA 3V6HA 4IIVA 3N5KA 5KQMA 1SELA 4GNRA 2VJAA 2VZLA 5FBKA 1NPYA 1L5NA 3EULA 2VS1A 2QL7A 4EGFA 4QU0A 5C8ZA 2I8LA 2I7DA 1RYYA 1RJWA 5H02A 1HEUA 5GV8A 2WU3A 2ONYA 1FS5A 1UAGA 3RBVA 2OV1A 4J4TA 4I36A 5KSOA 1FTQA 4B3CA 3N8GA 1IULA 4ZU6X 1KK3A 2IDKA 4LOIA 5EWLB 3RBZA 3E2EA 5EAIA 4EGJA 4OA5A 3E9EA 2EIHA 4I2NA 4L6CA 1RM0A 1DRKA 1JIKA 3GEDA 2OORA 3C4JA 1UC4B 1WHTA 3WAKA 3RC7A 1I13A 1LF5A 4OQNA 3BS5B 2L2QA 3RVQA 5CFNA 1J8VA 4NBVA 2ZTSA 3ZY6A 1GEEA 2HLNA 3G6WA 5HKOA 3VNRA 5BSTA 1Z00B 3CV3A 3QI7A 4B43A 3TZBA 1PJ2A 4GXTA 3RJJA 5A5DA 3TI9A 4CCYA 1E5DA 1D9ZA 4TKVB 4RPJA 4I6JA 4RQ6A 2VJLA 3K9BA 1AKNA 2YXBA 4G5FA 3DD5A 5ELXA 3VU1A 4I08A 3PUKA 1SXHA 4DDTA 1LPMA 4QICA 1CUJA 2REQA 5KYWA 2QTFA 4Z0TA 3ZWQA 2V7GA 4WXHA 3MGIA 3SQMA 3B6MA 5A3SA 4EHNA 3DVAA 5KWSA 2NMVA 1UKCA 3PX2A 3G5UA 5IVPA 3B0XA 4EZ9A 2FK8A 4Q19A 2H18A 3VV2A 4F9EA 1JIUA 1OWOA 2CB9A 1TQ4A 1NUQA 3TL3A 3G0CA 4XIYA 2NO6A 1TM2A 3K6SB 4CKEB 5KS2A 4BLTA 1NI3A 2F7SA 2K2WA 2QRLA 2Z1NA 3PC8C 4WCFA 3BD8A 2Z2ZA 3ETLA 3JD2A 5EJ7A 4EA8A 2P68A 4GG1A 5CRXA 3PV8A 2A84A 3WWYA 3D54D 3OQNA 5HGJA 4IX9A 3VDXA 4Z3KA 4HAIA 5CAEA 5BYKA 2JLSA 2VJYA 3HY4A 3COWA 1PTKA 3TE7A 4ZJUA 3CLUD 1THGA 2IYWA 4TYQA 3FCOA 1L6NA 2G40A 3EMKA 2BKAA 3OTGA 4MYDA 3COVA 3OP4A 2J09A 3TZLA 3U2QA 4M99A 3K0AA 3IP9A 2EAOA 4M36A 1BRMA 1YFJA 4RXMA 2WHPA 3W1VA 3F4LA 1EXDA 3TBKA 3GPLA 4QHYA 2X42A 5EOZA 3P9ZA 2PZMA 1Q1GA 2R7AA 2JCBA 1E98A 4POAA 1C3JA 1M1YA 3VR5H 3W3ZB 3EF0A 3OLVA 5I45A 3PC2A 1FXUA 1N9GB 4BJ6A 1W0KA 3AX6A 2QW0X 2Q6LA 4I14A 5CBPB 4B83A 1D9XA 4KR2A 4M7RA 5TS3A 1Q15A 2O06A 4BO8A 3SVTA 1PN3A 1OILA 1R15A 3KPUA 3GLGB 1CRLA 2G08A 3I23A 1R0ZA 1RPZA 4X6UA 4RKFA 2GI4A 2W42A 3CNOA 1GKIA 4DLSA 2GN9A 4WXPA 3GLTA 3GXBA 4M1EA 1MTOA 4TS1A 3VUEA 3AP1A 2ZKIA 3CNBA 3WBKA 1WCLA 1T0HB 1M67A 4DSEA 1CUWA 1FRQA 1NSYA 3K1AB 5KFXA 4HV4A 5C7OO 5BV7A 1DUIA 1E1YA 2GZHA 1PX2A 3PGVA 3CW2A 2Z9BA 1R88A 3LVBA 1C7YA 2FMIA 2HA4A 5WRFA 3JR3A 4LY9A 3H9BA 4UMDA 5ESRA 5K3OA 1C4KA 4REMA 2A5DA 3IH5A 1N0VC 2NU9A 4B3XA 5J4VA 5IJ9A 1RRPA 2OEPA 2RKBA 2I03A 4D96A 4RJTA 5ITWA 2WFLB 4MVJP 3QUCA 2J1LA 2D5AA 3C3MA 3ED1A 2DTDA 1GN9A 2JFZA 1V97A 2YIVX 2NUPA 1U80A 4NLKA 3FCEA 5HF6A 3ZU6A 3PP8A 2WSMA 2J8ZA 3O5AA 4GKJB 1WDMA 4DC9A 5EE5B 3BKXA 4RMGA 2BUAA 2ONJA 5HFNA 1E5VA 3D4NA 1SK9A 3ZU2A 2PT6A 3LY8A 1S6YA 1BS9A 4E5PA 3OZ7A 4BJHB 3I1IA 3URMA 1F3OA 3QJGA 5JD5A 1RTTA 3RC3A 5D3KA 2R4QA 1NMXA 2R7KA 4AIIA 3MW8A 3I39X 1M8KA 3ZHVA 1D5CA 4GXNA 5JXGA 3T3GA 4RH0A 3THOA 5DHTA 1P5HA 4E11A 3UJNA 2UZ0A 1VZ2A 2CK3A 3Q7IA 4FNMA 5DWVA 1IEQA 4OB7A 3EIXA 5JADA 1NRIA 4Q18A 3RUAA 5BMOA 3WP0A 1QWOA 4EW2A 4F4DA 3NI2A 3D6UA 2QX6A 3IAXA 1KNXA 4U63A 4IG9A 2RHCA 2MINB 1ZQDA 1P6QA 2QY9A 3OQPA 1URJA 4RZRA 3RDPA 1NVBA 4ED7A 5JS7A 2XY5A 4PSDA 4F9TA 3FKSA 3B3FA 2BEUA 4QXAA 2WKRA 3IG8A 3FDZA 3OZTA 1R6AA 2XGJA 2BFAA 5LXTA 1BYIA 3ANYB 1RZUA 5FUQA 4OTZA 1PWZA 3GJ0A 3A9SA 3N2EA 4LXGA 4DY6A 4IAOA 1HF3A 2HW8A 1GUYA 3JAMA 1P4JA 4C0SA 3I9OA 3ADPA 2CV1A 4IRCA 3GC6A 3LVVA 4JQYA 3CVOA 4NNPA 5JCJD 3C3XA 1XKQA 5HGXA 1OVGA 1B0XA 1Z68A 3PQDA 1PX0A 3I5XA 1KEEA 4RSHA 3H4MA 4JITA 1E7RA 1IMJA 2NYRA 1GLVA 4B7UA 2F3SA 2QD1A 4URWR 2IBSA 1PE0A 3EYAA 1TLTA 4Q34A 3TTXA 5D86A 2P90A 2X0KA 3KSDO 2HHVA 3T4PA 1WEKA 5ADWA 2EDAA 4EMUA 2O7RA 3RS8A 1BNPA 4ISBA 2CNDA 3FKQA 1BDIA 3ADKA 3B2EA 3UJ6A 2RGCA 8ICYA 1VDVA 2VHEA 5C81A 2ZWAA 2FZ5A 5IF9A 4ZVLA 1Y98A 4DR3B 3PW0A 2BLNA 4R8UA 4YQWA 1W9HA 4JR0A 3KXKA 5EERA 4G85A 2H0RA 4NPCA 2R8PA 1N57A 3E0QA 2PYDA 4BMXA 3TI7A 1XAGA 3RB6A 2ECOA 4Q4AB 1JWAB 3BFJA 3DLCA 4TROA 2IPMA 3STTA 2WMOB 3ZV3A 2YIJA 1KDPA 3HVUA 3OWHA 4L7QA 4JJ6A 1CERA 3D7RA 1E8DA 2BM8A 1VLMA 4YV7A 2YVAA 5LP6B 1CQIB 4TT3A 2JLYA 2O4CA 2HREA 1WS6A 1VYVA 1F9AA 4ITUA 4DFDA 4RTPA 5I7FA 4UMEA 1DFHA 3VOAA 3F78A 4DSNA 3UO8B 3VJLA 2PZJA 1UP7A 2HO4A 3LOUA 5GTDA 2JEGA 5KZMB 3QFTA 1XJ0A 4W5OA 1I30A 2F64A 2OQ2A 4P4SB 5CB4F 5IJ0A 3IC5A 5F7XA 1F60A 4DL3A 2D00A 5HM8A 4LV6A 4K6CA 4DWIA 4D9MA 3PQ5A 3CXRA 4QGHA 2AMYA 3O2SB 3O0TA 1PO7A 1WUHS 1XTPA 5JMPA 1UBKS 1VJRA 1JB9A 4KH1A 4GD3Q 3SI7A 2OCKA 3VQTA 2IBTA 5JISA 1DWPA 4HH3C 1SR8A 1E20A 1WUYA 3CLTD 1W581 2VOEA 3N05A 2MTBA 2QB1A 3F4BA 3A32A 3SF8A 1GU1A 4I28A 1QH8B 2COKA 3TCKA 4LHSA 3CTMA 3FJOA 1PG2A 3WK7A 4PZAA 1XTRA 2ZYDA 3ETCA 4DMLA 3FUVA 4BNUA 3QVJA 4KPFC 4RKWA 4AS1A 4RNNA 2HBYA 3OX3A 1NY6A 3CKKA 1XCBA 3BK2A 1X9IA 3GRFA 3ITKA 4FHEA 4KL8S 1CZKA 4AMUA 3OEHD 1W4LA 5EWFA 4UM8B 3JPTA 4L5AA 4AG3A 4KQWA 4MOWA 4LF8B 1J23A 3OICA 3G0HA 4S0XA 3E5NA 1Q1QA 1EWRA 4B3DA 1R0XA 2KZ3A 1PF7E 1E66A 3ICOA 4DS5A 5KYVA 2I54A 2QN9A 4S0ZA 3NZEA 1MX1A 1V5IA 3L6OO 1XDUA 4R2LA 4KLAA 2NQ2C 3R40A 4LV8B 5IWAB 5D00A 3MBOA 3DAFA 3ZGVA 4EYKA 3A11A 2WKPA 1M2NA 4CN8A 4RJ2A 4ID9A 4KR3A 3JTEA 2X0EA 2VXBA 3OTHA 4GM0A 2EYUA 2ZETA 3L1JA 3PF9A 1ZNWA 5E7QA 2J6HA 4KAXA 1Q0TA 1OIVA 1WMBA 1V9PA 1OMOA 1PJ3A 4I1RA 4DL7A 1D2NA 4MGKR 4L5YA 1HM5A 1O5TA 4RL4A 4IGIA 2PMCA 4C0BA 1E2DA 4CDGA 5EZSA 2ZI3A 1O0CA 1LLFA 2PJDA 1AHHA 3DMGA 5A9SB 1XVLA 4EG0A 4M9GA 3ZJYA 5FL7A 2G9NA 2HHHB 5CYOA 1A76A 2GTHA 4YJGA 2VCHA 3MPOA 3FHTA 3AFIA 2JDID 3KDSE 4TMVA 4Q1AA 3VVMA 4X6LA 1J22A 3H2KA 4GI1A 1CUIA 1QO0A 3OZBA 1Q0RA 2RHHA 3AEQA 2WU8A 3E9MA 4Q4HB 1XZ8A 4PSCA 5A0VA 4WOJA 4ZALA 3NYQA 3AJ8A 1JLRA 4HKTA 2GOLA 2D62A 2W6QA 1E1NA 1J0XO 4LVSA 2QTRA 3LKZA 4MWDA 5CFOA 1K5PA 1NW9B 5JCPA 1HNNA 3EG5A 2Q6OA 3KTDA 1GDTA 4J9QA 1EP2B 2IPOA 1NJ5A 2VLIA 3VHQA 5KOJA 1TI7A 4M04A 3GT7A 1E3WA 3UTDA 5ALDA 3DE3X 3D59A 2VA2A 4IC9A 1Y81A 2P8SA 3U3KA 4JEMA 3QF4B 3OHPA 4DOMA 4HLNA 1E89A 5EIFA 4HATA 3BGIA 3ANNA 2C2EA 3RC8A 1Y8RA 4GP9A 3ZLVA 5EKXA 5JAIA 2RK4A 4HGYA 3ETRA 3KZMA 2B1JA 3W6UA 3H5IA 2QMUA 3T1VA 1QGDA 2VL7A 4J16A 3DBRA 5ALJA 1X9MA 3IKLA 4WPGA 1H9BA 3KQMA 4V39A 2PI4A 3A3KA 4TV9F 2XRFA 1RCUA 3OMXA 4TXLA 2GXQA 1F12A 3L5OA 3VI4B 3L8DA 3LDUA 2PXAA 3X1DA 2MSEB 3ZQKA 1UQTA 5EKSA 1W85A 4AKGA 4FJ2A 3I12A 5H2FU 2C7QA 1XZIA 4BQSA 1Q17A 2PSSA 3VU9B 2YBDA 1J9ZA 4F2PA 5TT1A 2XKKA 1BKDR 5IKPA 1ISGA 1I5RA 1E2MA 2XGSA 2LPEA 3QX7A 3GYBA 1A7KA 4G4SP 3QH4A 1SOMA 4LZDA 4TV8B 3IJEB 2AQKA 5EWJB 2VHCA 4EARA 1C50A 1HSOA 5EWLA 1ICIA 2Z98A 3U7HB 3AU9A 4ZV9A 4L27A 2PGOA 3FF4A 3R3YA 3LK6A 4PN7A 2HTEA 4QXQA 1V4VA 5J1TB 3ZV6A 1DMSA 4TMWA 4ETNA 1B00A 1UWLA 2OUKA 3T4XA 3W2EA 4I2EA 2GUGA 1U7TA 4UZSA 1XEAA 3HV0A 5C4IA 5F1OA 5H80A 2ZUCA 1K3FA 2ZROA 4HNSA 1N7GA 5J2KA 2H4HA 4EG4A 1CQWA 2CFSA 2ATLA 1OBCA 5JMOA 4TKVA 1RAAA 2MRLA 5CM9C 1JEOA 1DTSA 1V9CA 3GFTA 4IICA 2BGNA 4XX0B 1M34E 5HJ2A 4EDHA 2OGZA 1EK6A 3JARB 1YFZA 4NXZA 2DUYA 4UBMA 1FUYB 5KJ1A 4YAKA 3FE2A 1KYZA 1A9QA 2GYWA 1TU0A 2G25A 1RZRD 4UM5A 1O96A 3CVYA 2CL5A 1CZRA 5GJCA 3OQ1A 3A1SA 3QVVA 2R44A 3S2ZA 4X90A 4D9JA 1KJJA 2LCQA 2VPZA 1NW5A 4FEYA 1J8YF 3T52A 4CKEA 2ZRDA 2EATA 1NKBA 3MA0A 4Q21A 3ZY4A 3RU2A 1EUCA 4UVGA 2P30A 1EZZA 4BCCA 2VPPA 3JWHA 4H4EA 1QS0A 2RKWA 3ZGZA 4F9FA 1LI7A 1N5RA 3SIRA 3WIEA 1PYGA 2EHDA 5GM2A 5HE8A 4D4KA 3ZDXB 3HJRA 4KO4S 2QD4A 4NAHA 3SJAA 1E3MA 3ECAA 4P35A 1NC1A 5DFAA 2ZWPA 3CMMA 1RXVA 4OAQA 2YX8A 3ZJUA 2IGBA 3UK1A 4KTVE 1MJGA 4TL7A 2GBFA 5EVCA 2ZIEA 1WXIA 3F9CA 2CHVA 1QR6A 4M21A 1JDVA 3VR2A 1FFAA 3T61A 5A0LA 3PITA 2Q7DA 4YYEA 3C5FA 1N9GA 3PWSA 5IDXA 2WM8A 5EC8A 2P9QA 1YCHA 4YXMA 5CBPA 2VQSA 3GQVA 1Y8QB 3DKRA 4O2AF 2RH5A 2BCEA 5HJEA 4C05A 3OKFA 5FR2A 1C1DB 2J9RA 3QPVA 3GLGA 5KG0A 1CG6A 5BW5A 2BBOA 3ET5A 3OCYA 4LHWA 2JGNA 3S29A 2C2WA 5J0PA 3QEAZ 4Q6WA 2JIOA 1B73A 2H4FA 3GY0A 1ATZA 4EA6A 2VDJA 3RE1A 1V3VA 5MN5A 4PC2A 4D8VA 2YYZA 3OFND 4HVCA 3K1AA 3UQZA 1QHYA 2XCSB 1J0EA 1FVHA 3FVRA 3PD1A 1BDBA 4R2HA 4V0KA 3N7UA 4L3OA 3ZKAA 1YRBA 4IKOA 2E8MA 2CFTA 4U39A 3NTOA 1LB1B 3T9EA 5BOSB 4ZC1A 2VHXA 3AEYA 4B2YA 4BO5A 2F3RA 5J0TA 3E9NA 2WM2A 3C98A 1FRNA 2I34A 4OQZA 5DBBA 1FX0B 2ID9A 5E2AA 1UA1A 4IQUA 2HEIA 1OUQA 2XSZA 1JU3A 2JZNA 3TZHA 1PRYA 2H4YA 3JQBC 1M6WA 4R4JA 1ZYQA 5BSVA 1KEKA 1LPPA 2HUPA 2PBLA 1PS8A 3TBFA 4KBYA 5CCEA 2NV6A 4XCQA 4BYGA 3FPHA 4QWCA 3A10A 1B8UA 1VJCA 3RUDA 3HW8A 3O4RA 3OZDA 1PWHA 2IHYA 3PJFA 4HB4A 4F97A 5KUTA 1DTWB 1EHCA 3GP8A 4H3SA 2D6FA 4ZIRB 4K03A 3HVHA 1M2HA 2GF2A 4CU2A 2WJPA 4UDYX 4NL4H 1PJZA 2J5BA 2DECA 1RCFA 1M1ZA 3TW8B 3T1TA 4GOND 2W7OA 4DJFC 4N12A 4TVKA 5HR7A 1XTQA 7ICRA 1DQRA 2HQSA 3TZCA 1LX7A 4PCVA 4MV5A 2AFRA 3E8SA 3UNXA 1VHTA 2CLMB 5K8CA 2QMOA 3FDXA 2WD7B 1SKYE 4OJ5A 2MINA 1YZNA 3T5BA 3RFVA 4WVFA 4R3NA 1SQGA 2R79A 2WTNA 3DLHA 4ZU3A 1W36B 4R83A 1J7JA 4GI3A 1XP5A 3INNA 2K4EA 2J4FA 4QPPA 1GNQA 3AK4A 3DEAA 1OI3A 4I1IA 1C41A 2RGWA 4G5HA 3KVYA 2H5LA 3ETJA 3PENA 4K4HA 5KTOA 1FYXA 3M7IA 4MIOA 3LUGA 4MUFA 2OQRA 3JPQA 4KMOB 2XAUA 2LYBA 1TD9A 1Q7RA 3IR5A 3AERB 4N7BA 4QDJA 3PR4A 4RSMA 1H1TA 5A7GA 5LLTA 4AF8A 3DDUA 4L9RA 3WLLA 1K1QA 1QU3A 3O75A 4R40A 4KGZA 2G36A 4JJGA 1EGVB 2J45A 4NBLA 1T6BY 4Y9DA 3CN7A 4HPJB 4JAVC 4BC1A 1ZQOA 1PD1A 2C9YA 5B2ZA 3CTPA 1OFVA 2CJPA 3V5NA 3HGMA 4KDFA 3AB3A 1PT6A 1CJCA 3RKUA 1YOBA 1R0RE 5KFMA 4IIEA 4URZR 3IEMA 4M46A 1U1FA 2WZBA 3ZE1B 3LPLA 4QWEA 4WKPA 1AA6A 5H70A 3WVNA 4J9PA 5E7MA 2XNSA 1T1EA 4RNCA 1HC7A 1TEXA 3LS2A 1Y37A 2A78A 2X4DA 2ORWA 4YFKA 3H86A 1VE5A 4Y1RA 4Q4AA 2K60A 2PDAA 2ZXFA 4FMCB 1ECGA 3O90A 4J29A 1O1YA 4DXDA 3C3YA 1JZTA 3SZ2A 1EUZA 1GL9B 4IDOA 3OFSA 2A33A 1GZVA 4MFAA 3AVXA 2IP1A 5LC1A 3QVMA 3KOXA 5LP6A 1CQIA 4PN3A 4L51A 1AKEA 2WIAA 2YW2A 4YGXB 1RAEA 1C29B 1D4ZA 4NZMA 5C1BA 1Q8KA 3R5JA 4FCTA 2XHEA 3TCNA 4EHFA 1ZQAA 4OMDA 4MDHA 2CYBA 4D0SA 1VA5A 1GRVA 3U5TA 5LZ4A 3CNHA 4L74A 2DR3A 1EB8A 3C15C 5ELLA 1UINA 4MARA 2PX2A 4J1QA 1MBZA 4C80A 4NBTA 5JG7A 4J2OA 4IDCA 1PJBA 8ICEA 2C28A 2VP5A 4BFZA 4D80A 4I19A 1U63A 2WFMA 1C9NA 1N5OX 3CEPB 2BGWA 3GEIA 3L7NA 2ENUA 3Q3IA 5ARDA 1OXVA 1REQB 2WKQA 1CD5A 1T4BA 4HQOA 1DELA 4IEFB 4A8PA 3MJDA 3RAEC 3OOSA 1WPGA 1M33A 3PQFA 1QH8A 4QDUA 4ZAZA 1IUKA 4OK5A 1MN6A 3B3JA 1Z9BA 4H3VA 7ICSA 2FUNB 3LT1A 2MMGA 5GONB 3G85A 3ES9A 4E7OA 2R4TA 1W2GA 1JBEA 5FO0A 3SQNA 3SJ7A 4LRXA 3CF4A 3IEPA 1VBNA 3MOGA 3GN2A 1ZMRA 2J6BA 2NTEA 2C1EA 2BM1A 4F86A 2OBYA 1PWYE 4Y98A 1K66A 3LAWA 3KALA 1E9BA 3LHSA 5FV7A 2UUCB 5ALEA 5ALZA 2CRXA 2PG3A 4QSMA 4AURA 4GOXA 2ZI5A 3CY6A 4RK4A 4CQNA 1I6MA 5DLDA 5D46A 4BNZA 1RWOA 4RD4A 2SKEA 3V34A 4CV0A 3SKVA 1QGED 3A4YA 3NPMA 3OO0A 2XZOA 2YWDA 4CM9A 2GNPA 1OLSB 1TF2A 1AN9A 1WVMA 1JLKA 3STVA 1EFKA 2PAAA 3G6KA 2FPPB 4YRIA 5KB3A 2QTAA 1O7JA 4AJEA 2O1XA 1WNFA 1FYWA 2PS9A 3FWPA 1E5XA 1YBAA 1FUEA 3KVOA 1XPUA 2Z6UA 1NJGA 1UBHS 1UJBA 2YJNA 4C2BA 5C5DA 2EFDB 1LX6A 3IPCA 4KR0A 1UBRS 1TUBB 1EGQA 1P4SA 4DB4A 1Y42X 5BSUA 3FXAA 3PVSA 4EUEA 1Y7LA 4J49A 3TNLA 1JXQA 4IF6A 1RWVA 3O1JC 4F04A 2XRMA 4MW2A 1J0DA 3CZQA 1YQGA 3SPXA 2HFJA 2IOYA 4MEAA 2XGMA 3E03A 1WY5A 2MHCA 1R00A 4BQIA 1ESZA 3KQVA 3KXLA 5AKIA 2QTHA 3KJFA 2H06A 5JSYA 3PNVA 4KZKA 2V7EA 4C8LA 1WTCA 4MUHA 2BMWA 3R0XA 4Q3CA 1U4SA 5EQFA 4X1YB 1SV4A 4FKBA 4I4CA 4NEQA 5KQGA 4K28A 5A9SA 4FE7A 1NMSA 4BKUA 4UOZA 1F6WA 3NHZA 2IT1A 2RH4A 4DQLA 4JLPA 4X0EA 4CUKA 3SC4A 3DQPA 1U8YA 1CR4A 2ZRCA 4TVOA 5BMVB 4B47A 1JAHA 4PC1A 3TLAA 4Q4HA 2HXSA 1JFVA 1KFJB 5JLJA 2Z43A 4UNQA 3CR3C 4HHEA 3MJVA 3TR5A 2NTYC 4HMQA 4QPNA 2WWTA 3QLUC 4KLIA 1TVCA 3FH0A 1X9HA 2IW3A 2H5XA 4LRYA 2K4MA 4LJLA 4MV7A 3E27A 4UAWA 2G4VA 2DPYA 2GKGA 4YAUA 2GEBA 4LGCA 3PLRA 3FUCA 1KH2A 3KXDA 3QFFA 3QF4A 4PC6A 4ZDWA 3WZ2A 4BKOA 3E3MA 3FVTA 4W5NA 4G1EB 1H2XA 2WVGA 4CEHA 3T15A 3BIJA 5DBEX 3PY8A 3H9QA 4G97A 3HABA 2FH5B 1NF3A 1A0PA 1V4NA 3SKYA 2P4QA 4X60A 2F1IA 2YICA 4R63A 4GMFA 3ICCA 4ER5A 4G37A 2HWKA 3UT0A 4S3MA 2VN8A 1OAKA 3OP1A 2PMFA 9GPBA 1TAQA 5DM0A 4QBFA 1UBTS 1WKVA 3RG2A 4G84A 2E37A 4W9NA 2M0NA 2FRXA 1ZXIA 3TD6A 4ZYLA 3QGMA 1G5PA 3U31A 5E6UB 1JE1A 3HJHA 4IOKA 3CEAA 3NHJA 5BWNA 2RIPA 3GLQA 4X8HA 3QSYA 2BKLA 4QUHA 2RRDA 2ZM5A 1K92A 3VU9A 2PR2A 4JL8A 3T34A 5JQGB 4FYXA 1OB2A 1VPTA 4NIMA 1MDFA 1QB8A 1T2NA 2D1SA 3PWTA 1P77A 1OI7A 2OK8A 1X7GA 3SQLA 5KDOA 3L05A 4Q15A 1KMIY 4DSIA 2W8BB 5SZJA 1CUEA 4MA4A 2HSJA 2DQ4A 4KX3A 1EFCA 5DNYB 4YP5A 2P8JA 5EWJA 4L50A 3PEFA 3SJZA 3HFJA 3NBYC 1AK1A 2WSYB 3PSIA 3R3SA 5K0EA 2UYOA 4M2LA 5HKKD 4EIWA 1MO3A 1RXYA 5JNTA 3V8QA 4OI0A 4N3NA 1MH1A 1KWGA 1G9XA 3RUEA 2KZMA 4BQFA 4ER3A 1ILEA 2WFZA 4BX9A 2E4ZA 2EBWA 4MLCA 4XIJA 2E5FA 1SKAA 2O05A 2FV8A 2JBAB 3KD2A 1OQAA 2B0JA 1E0DA 1GTZA 2AHRA 4KI0A 3QLEA 2JGLA 2AEFA 4KE6A 3RJFA 2Q9BA 2JFQA 1KRPA 1NNLA 3H9CA 1TOAA 2B83A 1F8GA 3GEGA 2GRUA 3AO0B 4I1SA 1R4NB 1UBOS 2IU0A 5I7SA 1XK7A 5L7YA 1FO4A 3EZLA 5G53C 5H8WA 3MQ2A 4B87A 1G19A 4Q47A 1YJXA 2GD2A 1Z37A 4XX0A 4ZFNA 1CUBA 2ZIWA 3JARA 2J7PA 1GL3A 4OJTA 4OXYA 5CVCA 4QA9A 4PBRA 5HFAA 2YIMA 3Q6NA 3LUKA 4QRDA 1WL8A 4F85A 3LWDA 3MUFA 3GJ8A 4DDUA 5GQSA 3E9ZA 2JFUA 1P1RA 4F60A 2ZB8A 3PHIA 3W1WA 2AZTA 1FFYA 2JEIA 4DQDA 3ZDZB 2XT6A 4DMGA 1W4RA 4LDQA 2IIBA 4HSGA 2DX7A 3AVYA 3T54A 4IS2A 1S0NA 1ZJ4A 2ZJOA 1TTQB 1JG2A 3FWYA 4HAYA 1RJDA 2DHCA 1YOVB 4R0MA 2DQNB 2QDKA 3CWCA 2OILA 1QYDA 1KY5A 4KDRA 4HNUA 3CNNA 4PLZA 4NL9C 1FMJA 4MKIA 4W1QA 1ZVVA 1Q3HA 4BZXA 1D8TA 2ZRLA 1WMSA 5DP1A 2PZFA 5AK0A 3AF0A 5HCIA 4ZAXA 2VWQA 1TRHA 5DGDA 3WJAA 3NH6A 3KTQA 1EU1A 3KKEA 3WTCA 1XZKA 4GVPA 2UXBB 1ENOA 1EVIA 5TT0A 2W2TA 4O5OA 1NSTA 3EPJA 2FQQA 2RI1A 1YCDA 4EK9A 2K7ZA 2YHAA 5LNK6 2B1GA 1E2FA 1ZCFA 4BN5A 2G5CA 4R2JA 3LWZA 3UW3A 1B74A 1DG3A 1IUNA 4ZRNA 5KNBA 3RARA 4IHKA 3RK4A 3IA2A 3LT4A 4YH1A 1E6MA 4BFYA 3L3BA 2A86A 5EI5A 3SYRA 1I01A 2BQ3A 2UZ3A 1MKYA 1Y8QA 1X8KA 2J6TA 4NQRA 2WIDA 1N1GA 4UDXX 2IV2X 1LPAB 7ICPA 4QZ8A 4RSGA 4O1MA 2R8RA 1JS1X 2H48A 3M4JA 1UK9A 1DKLA 5SY4A 1MCZA 3EPHA 1TJ4A 3KQUA 4JWTA 5M34A 4EO4A 4EJ2A 4GL4A 1ZQNA 5DOVA 1SCBA 1XRLA 3B51X 4JT8A 4EGQA 3OY7A 1FU7A 1GPMA 4Z4GA 5IC4A 3GLSA 2H5JA 3C8HA 1JQDA 4JP2A 4C22A 2PJRA 3WK4A 3FGNA 2O8EB 2FX2A 1G9SA 2BRUC 1E2JA 3L0DA 3KLBA 1K86A 4O8ZA 4TUQA 1T3NA 1NVVR 4G8BA 2BSQA 3VKFA 1ZHOA 1NV8A 5G3YA 4KIGA 1IHYA 3BEOA 5DBCA 3QE4A 1IM4A 5JATA 2CHGA 3PYXA 3HXQA 3KB2A 5EOVA 2F4NA 3N2NA 2E0IA 1U7UA 2VUIB 1U1CA 5KYGA 3ABZA 4Z4IA 3TNDA 3DBHB 4I55B 1RBMA 2O48X 2X14A 3O8OB 4YACA 5BW6B 4N7RA 1UOQA 4Z9YA 4M60A 4BTEA 4F5YA 1ESMA 4M9ZA 5J8YA 2WJ4A 3R6LA 4HYKA 4P7BA 1COWA 5FNVA 1IXSB 3BJEA 2ESRA 1KMNA 5IDYA 2BPFA 1P9RA 1DTWA 4P0QB 4L5BA 3HU3A 4ZIRA 5K3AA 5AM0A 3ONNA 4JOQA 1ID1A 3IQIX 5ESDA 2FCAA 5KJCA 1QHSA 1L3IA 3AXSA 1OIWA 1WAMA 3RH0A 2W2LD 4G9GA 1VJDA 1UJ2A 3TW8A 5BYAA 2O50A 4JROA 3R8FA 5LP1A 2FEXA 4TUYB 3G7NA 1GWNA 5CB1A 3KV1A 2XF8A 4MCIA 4LGVA 4BO7A 4NV1A 4CPDA 2H52A 2I9KA 4JEHA 1KBOA 2H1IA 2WD7A 1VIMA 2GEVA 1XLTA 4GLJA 1MXHA 1Z1BA 2V45A 2HFKA 1KORA 1ID8A 4ZU1X 2BKXA 4X3PA 1PFVA 4MA5A 2IOFK 1XTKA 5ILQA 2XC9A 3DUFB 4IV8A 1XTBA 1XVUA 2A5FA 2GB4A 1VBKA 3QG5A 4WBSA 5D6OA 4IDDA 1SCKA 1XRJA 2H8GA 3OPXA 2I76A 2Q5JA 3F3SA 4ZC8A 4YJHB 3HRKA 3FZYA 2JCVA 3MYYA 4MX8A 3WL3A 3LP8A 1ZH6A 4RMHA 5I7RA 3DOEA 5J2EA 3O1LA 4Y2RA 4PNEA 3IBFA 3B7GA 2VAPA 4NBKA 1J8FA 2DZDA 3L0CA 1E79D 3AERA 2AD1A 1PUXA 3TDMA 1KL7A 1NA5A 3M6WA 4KFRA 2QMQA 4FGLA 1BMTA 2FSGA 3G68A 4PR0A 1G41A 5YASA 3UJDA 2Y9PB 3U3RA 4DR6B 5I9MA 2W9BB 5L7TA 3QLVA 3UAZA 4X8OA 2IBKA 2V7PA 5DM60 3O38A 2M9NA 1OBHA 1VKRA 4FU0A 1HKHA 5L1LA 4RPGA 3ROZA 3OA0A 1G1MA 5C2JB 3K15A 1CRWG 3DBIA 2ZWVA 1QYIA 3L0YA 2EP5A 1H2EA 1DNPA 4Z9BA 4EI2A 4HLQB 2Q1XA 5LPNA 2GHTA 3GXOA 3QYJA 2CE7A 3VI3B 3QEOA 5L3ZA 4I4NA 4AC9A 2P75A 2WP8J 2HK8A 3B0YA 1Z08A 4K9NA 5IZ4A 3RK0A 4JMUA 3GH3A 2VDVE 1KH1A 4MPDA 5CT4A 2WZQA 1ZQMA 3EBOA 1VTKA 4ZMRA 2OGSA 1N1DA 4OHZA 3NBKA 3PFHA 2LPMA 4N3AA 4AKTA 4EEZA 3NAQA 4QOHA 1RYSA 4X84A 4A2QA 2CBGA 3WYGA 2OESA 5J2IA 4UTNA 1DAKA 4MQEB 1WW3A 2NP7A 2VDKB 3ROGA 4JN6B 4L07A 5IYZB 4YAWA 2EKPA 1ZOLA 1PFKA 1TYZA 3UAYA 2V6IA 4OGLA 4RVFA 1IIRA 4ZO8A 4Z49A 1WU7A 4ZYZA 3ZNQA 1LKZA 3IG5A 3FSRA 4BRZA 2UUAB 2QP3A 4XXHA 5HK9A 3P9CA 4D4HA 4LFCB 5JDCA 5ILOA 1K4KA 1USIA 2AN4A 3H2YA 2AI3A 5JNRA 4E1VA 4HSEA 3H3XA 2XE7A 3RS0A 4C43A 2VCEA 3ICEA 1REQA 1DPFA 1BJTA 1KY3A 4D4LA 2V6MA 1ZQBA 4BAGA 5FA8A 4N1AA 2H6EA 3ZCUA 1ZHHA 2E85A 2DBRA 2JPDA 4UPDA 3WADA 4AMBA 1Z2OX 4M0PA 4F3RA 1VHLA 3W2TA 2C88A 1MB4A 2D1QA 5T3YA 4WFKA 3SQIA 4WCDA 2XY6A 5CLQA 3H4IA 1M1XB 2DKOA 3AONB 3DW1X 2TS1A 2OCLA 2Z2JA 3P2YA 3V4FA 5B1IA 1U49A 1G59A 5K4HA 3H1BA 3KHKA 1NDHA 4MV0A 1KGDA 1D2RA 3SOZA 2GILA 3BUSA 4KYIB 2HHLA 3BD7A 4B74A 6GPBA 4ZQCB 3FLMA 4UOEA 1L5OA 4U2KA 2FPPA 5KDLA 5BSHA 1KQFA 3OHSX 1QXSA 4MTLA 1JHMA 4NYJQ 4QZFA 1NUUA 3RR2A 1KL9A 2VUUA 3DHVA 5IAJA 2EZ9A 5EWEA 7ICLA 4BNVA 5CIWA 4MH0R 4DQSA 1VIVA 2IRWA 4KVZA 3OIGA 3OQVA 2WILA 3BRCA 4NX2A 2I4MA 4MQ4A 1WG8A 1UKEA 1MC5A 3LI2A 4HR7A 1FNSA 3OJCA 5IXJA 1Z2NX 5J2JA 2ZG6A 1E3QA 1DRGA 2AC4A 1SVWA 5JC8A 4XH9B 4ZZ1A 3WKAA 3RJTA 4QEZA 2J3QA 3TSAA 3QKRB 2WINI 3NXKA 1E2EA 4M9NA 2GD1O 3KQKA 2HBLA 1NYTA 1QTMA 2PXHA 4G1MB 4Z86A 1QHIA 2GEDA 4H17A 1K75A 1NXOA 4JMPA 2P5SA 1Y1LA 5F7JA 2JLZA 3GUVA 3SSAA 4M86A 3OETA 5C52B 3MBIA 3CUUA 4YONB 4WLFA 4C4AA 4CV1A 1US8B 1EDBA 2JAUA 3UXNA 3NDPA 1OREA 7ADHA 4QU8A 1ZUHA 2V5AA 2C95A 4XJSA 4KWCA 1NMEA 4QTUB 1EUQA 3U7QB 2H7VA 1CUGA 4TTPA 5HILA 2PRIA 4XA5A 4MO9A 1PZHA 3RIMA 3AQEA 2MYUA 3L77A 5EP2A 1WCNA 4G67A 1V25A 1T3SA 4CKZA 3ZQ6A 3I61A 1UM8A 3AM9A 5LQJA 5HZMA 3A1NA 3VYRB 2UDPA 4IKEA 1QQTA 3JS5A 1K8QA 2IGTA 2B61A 1P2FA 2J9XB 4C4XA 2HA2A 3BCHA 1NBMD 1E9EA 2R5FA 3D3NA 3V2GA 1EZ4A 1KARA 4NSNA 2I4TA 4B3TB 4NWIA 4PONA 1YA4A 4U4AA 3MQFA 2HRQA 2BI8A 3TOCA 1KS9A 4L0MA 3ZXSA 2DFNA 2OCXA 1TZJA 4Z4FA 4ZT2A 2GAOA 4J3FA 3PDUA 3S8EA 3KTOA 2FKNA 2WHQA 2JL1A 2CHFA 4ATNA 4IDNA 2E1PA 5KFKA 2VF8A 3PKZA 1CY7A 2HN9A 5GJVC 1YB6A 1EJ6A 1CUKA 2JEYA 1QZUA 1E9DA 1I2CA 1OXXK 5DLGA 2FPKA 5KTMA 2C94A 3VPGA 3TQQA 1P3DA 2Y76A 3H0CA 2EKQA 2ZE5A 3UB4A 1HDEA 2Y0DA 1N5KA 1LWNA 3B5IA 2FW7A 5ALVA 3A0BU 4U6NA 2ZXIA 2J0VA 2YV5A 1X66A 3Q3EA 2FY8A 3MXTA 4RIFA 2FVXA 3A1CA 5E6UA 3QPDA 1YBFA 1T5OA 1P0QA 1UEJA 5DW3A 4DFMA 4OUDB 1P9OA 3IILA 2CDCA 2FUG1 2Y0EA 3GI1A 5JQGA 1FFVA 1FLDA 2HA7A 2QUZA 3NTXA 4MKRA 4O4LF 4EB3A 4KR9A 3CFYA 3T3DA 5G0TA 1OH5A 4CDRA 2A0KA 3NC0C 1P7DA 2BFWA 5EKDA 3I28A 1L4MA 2GPNA 1VGQA 4NYIQ 2D3DA 2LUOA 1NT2A 3K2BA 1RQNA 1ZK4A 3PG5A 4O3FA 1CRPA 5A9TA 2X6RA 3LC2O 3M1IA 1QE5A 5AM5A 4YQZA 3HXOA 4JELA 1XRQA 4LXTA 5DHUA 4LHZA 4JC4A 5KFQA 4TZ0A 1BMFD 3PGA1 4C1NA 1LI4A 3MGAA 1QSGA 2A9OA 2YWRA 3KHTA 3WO0A 4MVJM 1LNSA 3RUHA 4TMXA 1Y6RA 2XMDA 2VNAA 2YZGA 3HN2A 2HCTA 2A0FA 1R7RA 3URKA 4Y1GA 4N7JA 2Q50A 1L7QA 1Z35A 4HN4B 1O08A 2JBAA 3HDHA 2RAPA 2P0EA 3RSSA 4HX9A 1FW6A 4MUGA 1M2OB 2RARA 4QT0A 5EIXA 3FRIA 4L9AA 1E1MA 3DEIA 2FSVC 4ZT6A 4X5OA 4YRTA 3QYFA 4KLFA 3GGPA 4ZCMA 3OAAA 5JH7B 3IVAA 2A8YA 1FDWA 4L85A 4DMFA 4LZGA 4XPIB 1R4NA 1GTG1 4RHUA 4KACA 4CI0B 3K4PA 3LP5A 2FN9A 3G0BA 4Y6LA 2DG2A 5COBA 5KFZA 3IAFA 2F9MA 1J70A 4I4LA 3RROA 1BCRA 5FTKA 4YQYA 2PZAA 4I1YA 3WZMA 2E7ZA 1C9EA 2QN1A 1OLXB 4QLBA 5EMKA 4MHTA 1YQ9A 5CA0A 4WNIA 2C7BA 3GIJA 3HMQA 3CINA 4X7MA 3UQYS 1TV9A 5HHTA 3AV3A 4HEA6 4RZ2A 1M34B 3Q8XB 4KNWA 2O0MA 2JFWA 1DHTA 5KNDD 3L4BA 4CKYA 4HQKA 1D2MA 3DM5A 1C3XA 4XARA 5JCXA 2L42A 2BTEA 4F93B 1YMUA 3A14A 3IR7A 1YOVA 1XDWA 2DPHA 2FMQA 4IQWA 4ZAGA 1WCWA 2YHIB 3U44B 3CKYA 4JSTA 4NYMR 4OMUA 2YQ5A 2QQ0A 2JJMA 2H3EA 5CA1F 4DNOA 3TB4A 3M8KA 3N74A 1ZQUA 1ZNQO 4H35A 1WHSB 1LPOA 1V5FA 5B7NA 2RI0A 2EYQA 3HDTA 2R8XA 4CL3A 1ISRA 3CLVA 3AY3A 1KMCA 3PC3A 4UEQA 3M6VA 1CB7A 1UL1X 2JKZA 4B6OA 2AZ4A 2FG7C 1D1SA 3RF6A 1N5XA 4IIXA 3KWJA 3VSBA 4ETIA 3NVWA 1YACA 5AW4A 4J90A 3U3ZA 2RB4A 2ZRKA 2JH8A 2BGIA 2DCUA 5LQSA 4BMOB 1T9ZA 3JZDA 3A6GA 2R8GA 3MLEA 3JAWB 1KSGA 2M6KA 1WDTA 5DJ5A 3RRBA 4B2IA 2QR5A 1UT8A 3HY3A 4G6ZA 5E6SB 1RLOA 3UANA 2K4PA 5KTPA 1VJ5A 2EX1A 3ID6C 3KHSA 5F73A 1CZNA 3SHFA 4F9GA 5K2OA 4YO7A 4BQRA 1V8BA 1S02A 5SYNA 3ZBUA 2I1VB 1RBYA 3K9NA 2P0AA 3TPFA 5LQNA 3WA6A 1WF3A 4EUFA 1EYZA 3VPBA 4EBBA 3RTAA 3O9MA 4GL2A 2Y2UA 3ZU3A 2ETXA 2J5RA 1NQOA 2Q2VA 4IO1A 1X9GA 3O7WA 4OHMA 4PYQA 2HKIA 5JYDA 3I83A 3L6DA 2O8EA 3DLPX 2GYUA 2FI1A 2WOJA 3OOYA 3BK1A 5E2BA 5BW8A 5K7SA 2JATA 3K30A 3N7RC 4ZJYA 4YMIA 1WMFA 4LBZA 5FF9A 1YS2X 4GR4A 4US1R 2BMDA 1Y3FE 3UMVA 1N7JA 4POOA 1G8FA 4RTOA 1P7YA 2WC1A 2Z8YM 3LLUA 5TQJA 2ZP1A 3GVXA 3TTWA 2QRNA 3AR5A 2VC2B 1KFDA 1RI3A 1ZQXA 1WU8A 1UMBB 2YB4A 3FR7A 1IV8A 2OPHA 2KLHA 3ZV7A 1HE8B 4I55A 2J07A 1EVYA 3C3PA 3O8OA 3H8SA 4GDFA 2JKVA 5DU2A 5IT4A 2DPJA 2W6JA 4FR0A 2PFQA 1NVDA 3BQ2A 1DG9A 4P22A 4D98A 2PD3A 4LOHA 4RZIA 4ETMA 5B53A 4FYJA 3UN1A 1IOLA 2D4HA 3C48A 3WWCA 2CD7A 1SUDA 3STHA 1TYDE 2VDRB 3TJMA 3BS5A 3T4EA 3TJZA 1ORVA 2KBEA 3PE6A 3DMTA 4LCEA 4EG3A 4ENPA 1XTVA 4FNAA 4X71A 3K16A 1I1HA 2VDLB 3A1FA 2DGDA 2WT8A 4EEYA 4JWNA 1FX1A 1GGKA 1ODLA 2F3TA 3COYA 1Z00A 3IQDB 1C30B 4GQBA 3RSZA 2PCJA 4W5HA 4DCNA 3GA0A 3UMYA 3VAAA 4BWMA 4JV0A 3UJAA 1E2LA 1DUSA 4GZ3A 3PF8A 5KAMA 3DUFA 3DEYX 1J1UA 4HMPA 1PZMA 2JHAA 3SF0A 4BO9A 4NJOA 5D2CA 1JA9A 9ICVA 1BDJA 5AD1A 2NIPA 1S5PA 4ZA2A 2PU5A 3QOXA 3VVCA 4YJHA 2GZMA 3GG2A 1QIKA 2NSLA 3OCUA 3V33A 3HKCB 1Y3AA 1JG7A 2P7IA 4QNNA 3R9IA 3BE4A 5MN4A 3NWEA 3TW6A 3DV0B 1X1SA 2ODQA 3HWWA 1XZHA 3OM1A 2CNKA 3KSRA 3I5MA 5J43A 1GQ2A 1GTVA 2QLTA 3P0HA 3K6SA 3S99A 1E77A 3RD5A 5MHTA 1M76A 5HHHA 5KWVA 1DAHA 4OP1A 3I8XA 3BWBA 4ZCTA 3NLLA 2Q8PA 4MGZR 4RESA 2CUTA 3RVJA 5CIYA 3T99A 2W9BA 3RBAA 1KYXA 1A5SB 4Z4QA 2QQGA 1IFXA 5AKYA 1OI4A 4BHTA 2VSXA 4WNAB 2B6HA 2I2CA 5JZOA 3ETGA 2PCLA 1L3CA 4KAAA 3UAOA 3WIVA 1T8WA 4E5YA 2YZ7A 2ASJA 3H5TA 5CLFA 1N0IA 5C9ZA 5GIOE 2WAAA 3BA6A 1U5AA 4ESOA 4CQLB 1MC8A 4PNHA 3EWAA 5DBHX 2X2EA 2E5LB 4HGZA 2G6TA 1HT1E 3N6RA 3WSWA 2OQIA 2H9AA 1V7QA 4DW8A 5KVCA 2FSIA 1JTEA 1ZXBA 3BC1A 3M6KA 3RF9A 3C3AA 3VYWA 2BGUA 3L43A 1QRTA 3RAGA 4WJLA 4IJ5A 4N4AA 1JWLA 3CUTA 3WGOA 1U0JA 4RVUA 4KWEA 1AV6A 3ESXA 1XOIA 3SZGA 4EG6A 3I45A 5JD4A 2Y1KA 1SKWA 3QOWA 2VP6A 3L8YA 5F5NA 4XLTA 2APJA 2AE1A 5E3IA 4C7MA 1WW2A 1S9FA 1LTKA 3C3JA 2PV0A 5EKTA 3WL5A 4UZEA 3MBYA 1LW7A 3EFHA 3QKTA 4M1WA 5LOVF 3E4CA 2F76X 1L3BA 5DG8A 4KREA 1W46A 1FVFA 2OORC 4YC7A 3VC3A 2ESEA 1ST2A 5IYZA 4Q7EA 1BYUA 2A3RA 2PYZA 4U7DA 2EZYA 1ZH4A 3I8OA 3MJEA 2VPYA 2ZWMA 1IN6A 4Q3BA 1XK6A 1Z56C 5IBPA 2CNLA 5EHIA 1E3DA 2VRNA 2X9LA 1L8QA 3EIUA 3O3NB 4ENQA 1DG1G 4IVRA 1XEWX 4D9IA 3OHMA 2P1RA 3L1UA 3S7ZA 3HN7A 2FHPA 1T2EA 1HDZA 3OUUA 3UJ9A 1ZM9A 3WYFA 1C1YA 3OOEA 2OSVA 1V95A 3F8SA 2WFLA 2YWGA 3C1OA 4JY7A 3BIXA 3S8MA 2QL6A 3SXUB 4XEUA 3GRKA 1A0OA 4DV6B 5IDVA 3CX3A 1D1PA 5TZVA 4W5TA 4IXWA 3OCVA 3F6RA 3RRYA 2G1PA 1V71A 2V98A 5E3HA 5IVKA 4GU5A 2NO1A 3PCRB 4FQ5A 2FMSA 3AZPA 4CLHA 2D1FA 1JDTA 4O5EA 3DXXA 4BNKA 4CDNA 4AJLA 3M6FA 4DEXA 1R6UA 1F8XA 3LBYA 3MDAA 5AWFC 2ZYTX 2YWXA 3CKLA 4PAGA 3VPXA 4OHCA 3VX3A 2BPCA 5E9WA 2XCRB 2MSCB 3KUDA 4ZYVA 4HFRA 2FR0A 1FNBA 2OOSA 1GNTA 5KKCA 3GA5A 3SICE 2C59A 2H29A 4P1ZA 1KK1A 2NNWB 3OF2A 2I71A 3TOVA 4KLLA 3F8WA 5BQOA 4IJWA 4HGRA 1DBQA 2PQ2A 4L9WA 5KYYB 5G0WA 3IDAA 2B35A 1A71A 4XB6B 4UVEA 1K6MA 3WLRA 1K68A 5FB3A 3I1FA 5C37A 4U3JB 2Q3EA 2XMQA 3FTCA 1JVBA 1NJ1A 4GOJA 4P3XA 2H59A 1EP1B 3TNFA 2ZANA 5EUCA 3RTDA 3EXHB 1KJ9A 3LX4A 1HTWA 9ICAA 3TNJA 3TMAA 4O33A 2MJLA 1ZX1A 2YXEA 3QKRA 2R87A 3RTEA 4D43A 4KRXA 3KZ1E 5THQA 1AGPA 3FZQA 4CF4A 1UFQA 2HT6A 1SC9A 3HA7A 4X3CA 3PI6A 4YV1A 4JLBA 3F49S 1CZUA 4YRBA 4O5KA 4WWHA 4H16A 4LVCA 2VJ4A 4PNZA 5K8VA 3DR3A 2Z3ZA 4TPKA 3U7QA 1P2GA 4LYDA 4X5VA 3CW2C 3GEBA 3WMRA 2Q2WA 1SJ9A 3GUZA 2J3IA 2MOKA 2GCGA 5FWDA 5EMNA 4EY8A 1IK4A 2RBKA 1UQVA 4GIBA 3ZGXA 2C2MA 4DUGD 1KN5A 2VYCA 4URHA 1ES9A 3QI2A 4BKMA 3EZNA 2OHVA 3H0KA 2I29A 2A1UB 4IXNA 3B1XA 2ONKA 4ZHQB 3MS7A 4F46A 4QL3A 1A2BA 3LLVA 4PHAA 3OSNA 4RVOA 3GDOA 5E7JA 1KGSA 4FGWA 4M7OA 4UAZA 4GOLD 1NK7A 1DK2A 3V55A 5M5BA 1CUAA 1AKYA 1GT6A 1EH5A 2AA3A 5C80A 2X23A 2QSZA 2WAOA 3L1VA 1VJGA 2OK7A 4UTZA 2VPWA 2RJNA 3KPJA 5D4BA 1U1GA 1PGPA 3RG8A 3DDSA 3K92A 1UBEA