3QUTA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
b'HMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qutA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qutA01
3AR5A 3M1YA 4BBJA 2OA0A 1Q91A 1TJ4A 5ALGA 4EX6A 4F71A 2FUCA 3NAMA 4MWOA 5ALSA 2MU1A 2X4DA 5ALIA 3A3YA 3AR6A 4YCLA 2WFAA 3KD3A 4UARA 5AI8A 1RMYA 3B8EA 3I1YA 5ALOA 2FEAA 3FPSA 5ALFA 3UMCA 1Z5UA 4CNQA 3B9BA 4HGQA 5JJBA 1L7MA 3E81A 3CNHA 3VAYA 3ED5A 2QYHA 2P27A 4YH1A 1ZD5A 1U02A 3L1UA 2IA5A 5AKIA 3KC2A 1FEZA 3DAOA 3KOOA 2B30A 2ZOSA 2HX1A 3IRUA 1KYTA 4KNVA 3WK6A 3NANA 2WHEA 2FPWA 2RARA 4HGRA 4OCZA 2Q5EA 4O8CA 2GHQA 4Y2UA 1L8LA 3FGOA 5AI0A 1Z4KA 4BEVA 3ESRA 3W5DA 5AVXA 2G80A 1QQ5A 3I76A 3NALA 2WF5A 2CN1A 1RPZA 4F72A 5AW2A 3NRJA 4GXTA 3U26A 2G07A 2CFRA 2EATA 5ALQA 2R8ZA 4QJBA 4CE6A 5ALYA 2HO4A 2JAWA 1LTQA 1EK2A 2FPXA 2IYEA 4OD0A 4E88A 5AKHA 2JAUA 3L1VA 2AGVA 2C9MA 2P9JA 3A1CA 5AHXA 2ZBEA 3KBBA 1U7OA 4I9FA 4NAVA 3QUTA 3CZ4A 2PR7A 3E58A 1RKQA 1SWWA 5ALRA 4OFZA 1YJ5A 2HEGA 3N1UA 4UMEA 1U7PA 2P69A 1WR8A 2IOFA 4UU0A 3ZU6A 3ZW7A 1Z5GA 2YJ3A 3I28A 5AM2A 3QYPA 5ALEA 2MU2A 3D6JA 2B1QA 2YBDA 5AI4A 3SLRA 3U13A 3E8MA 1Z4JA 3OCWA 3L8FA 1LVHA 3L0BA 2Q4RA 4NWIA 3AR3A 2I55A 1NRWA 3QU9A 3ONNA 2WM8A 4H1WA 1RRCA 3F9RA 4C4RA 5ALWA 4YIHA 5AVRA 4CF4A 2AUTA 5AM4A 5AK5A 5AM3A 4Y2JA 3OCYA 3WKDA 4C4TA 3ZVMA 4XQ0A 3K1ZA 1ZD4A 2I6XA 1JUDA 4Y2TA 3MMZA 3OCVA 4I9GA 3ET5A 3TLMA 1NNLA 4NV0A 4KYTA 3U19A 3FM9A 3QU7A 5AKEA 2BY4A 3L0YA 1Z88A 4EEKA 3I6BA 1L7PA 3L7YA 1XPJA 1X42A 2PKEA 4EENA 4G9BA 3UM9A 5AESA 4HGNA 2YFYA 1U2TA 4DWOA 4BX3A 1YS9A 4MUMA 2G1AA 1Z4LA 2W11A 4AP9A 2R8YA 3M9LA 3W5CA 4UW9A 5FP0A 5ALZA 2YN4A 4BX2A 2FDRA 5AW6A 1TE2A 5AI9A 4Y2RA 4Y2SA 3KDPA 4BEWA 3DNPA 2NYVA 2PQ0A 3MPOA 5AK4A 1RKVA 2G06A 2CFSA 3NUQA 4HGPA 1L8OA 5AVWA 5A3QA 1ZD2P 2ZBGA 1QQ6A 2HF7A 1RMTA 1ZD3A 1N8NA 3A1DA 5ALTA 3QUQA 3OCUA 1T5TA 1YDFA 1Z4PX 2ZG6A 5AW8A 5AW5A 1PW5A 3QXGA 2HCFA 1VJRA 3AR2A 3WK5A 1Z4MA 1VJ5A 1Q92A 3PDWA 3ZX5A 4L6CA 4HYTA 3MN1A 3SD7A 4NABA 4BKMA 5AKGA 2R8XA 5AKKA 3L8HA 3WKAA 1J97A 1XP5A 3GYGA 1RLOA 3QUBA 3QU5A 4Y2QA 4KN8A 2B1RA 2C8LA 3WK7A 2G08A 5AM1A 2BDUA 4UM5A 5IT0A 5AICA 4ZEVA 2AMYA 3DV9A 2ZBDA 3R4CA 4HAIA 4AS3A 4J2TA 2G0AA 4PNHA 2JGAA 2FUEA 3EWIA 1L6RA 2O2XA 4ZEXA 2ZBFA 2I7DA 1QH9A 4IFTA 2B8EA 4XE5A 4BNDA 4JDPA 5AW4A 2HSZA 4UATA 2FI1A 1T9ZA 3OPXA 3RF6A 2NO5A 4DW8A 3S6JA 5ALLA 2IOHA 3UMGA 2GMWA 3L8GA 3QGMA 4GIBA 3FZQA 2YJ6A 1YV9A 2HI0A 5AK6A 3R9KA 5A3RA 4IG4A 1EK1A 2EAUA 3R09A 1AQ6A 2RB5A 3KZXA 4YIKA 4YCMA 4L57A 3FPBA 2OM6A 5AVSA 1Y8AA 3QX7A 3AR4A 2OBBA 3SF0A 1ZS9A 5AIAA 4QQFA 4UMFA 3W5BA 5AVQA 1ZOLA 2JAOA 5ALDA 3N8GA 2O9JA 1O08A 4G63A 4J03A 2VKQA 4HGOA 2YMPA 3ESQA 3BWVA 1RQLA 2CFTA 1SU4A 5AVUA 2P11A 2W4MA 3WK4A 1O03A 3QUCA 5ALKA 1VFPA 3ZTYA 1XVIA 3EPRA 1QYIA 1WVIA 4EX7A 3SKXA 5E0OA 3L0CA 1RDFA 1Z4OA 1U2SA 1T5SA 3ZWKA 2WF6A 1TA0A 2HOQA 3J7TA 3WKEA 2B8JA 1CR6A 2B82A 2ZXEA 2WF8A 3L8EA 2C4NA 2I34A 1S2OA 4ZEWA 2AH5A 4B6JA 5IT4A 3A1EA 3AR8A 4UMVA 5ALPA 2I33A 3NASA 2ODAA 4KNWA 1ZRMA 3ET4A 2IOFK 2BDEA 5T41A 3OCZA 5AKJA 5AIBA 3SMVA 1RC8A 1QQ7A 2EARA 1RMQA 3BA6A 4EELA 5AW1A 3EF0A 4KX3A 2D2VA 1WPGA 5AKZA 3P96A 5AW7A 3OCXA 3PCTA 1RLMA 2RBKA 5AI6A 3N07A 5ALXA 5AW9A 3AR9A 3ZVNA 5AK3A 1RLTA 4NFLA 1K1EA 4XPZA 2C8KA 3ZWDA 5ALVA 2WF9A 2FPSA 3QU4A 5AKXA 2I54A 5AW3A 5AW0A 2YMQA 2W43A 3UMBA 4FFDA 5AVVA 3QLEA 5ALHA 5AVYA 4UASA 1ZJJA 2GHTA 4AS2A 5AM5A 3WK8A 3E84A 3QU2A 4L6AA 3IB6A 1Z4IA 1Z4QA 1TJ5A 3WGVA 3ZTWA 3PGLA 5AVZA 4CF3A 5AKLA 1S8OA 2YMMA 5ALNA 2YY6A 2WF7A 2HDOA 4DCCA 3IJ5A 3N28A 2RAVA 3WGUA 4Y2XA 1IWOA 2HHLA 3U7HB 1RKUA 4UAVA 2NO4A 4RESA 3NIWA 2QLTA 1CQZA 3PGVA 4OHFA 4Y2PA 3ZX4A 2HF2A 2JARA 4BYGA 3B9RA 4UU1A 3N5KA 4YGYA 4RETA 4XOUA 1YNSA 3ZUPA 4Y3UA 2YJ5A 5A3SA 4Y2YA 3QNMA 2FPRA 4YCNA 3WKBA 3AR7A 3WKCA 3ZI4A 3SHQA 1Z4NA 1NF2A 1TJ3A 1RQNA 5AKYA 2R8EA 2YJ4A 5AM0A 4EZEA 1L7NA 3L5KA 1F5SA 5AI5A 4FYPA 3FVVA 2C88A 3OTQA 3SKYA 1N9KA 5ALUA 3EF1A 2OYCA 5ALJA 2MSNA 2GFHA 4DFDA 4C4SA 3DDHA 3U7EB 4Y2VA 1SWVA 3W5AA 4BNDB 4KX5A 2YMLA 2FPUA 2B0CA 5IS2A 4BX0A 4JB3A 1MH9A 3U7FB 1L7OA 3WK9A 3HYCA 2Q4TA 4UMDA 3ZVLA 4UM7A 5AVTA 3U7GA 4UAUA 2GO7A 5ALMA 1J8DA 4FE3A 2G09A 1ZRNA 3MC1A 3RFUA 1WZCA 1YMQA 3HLTA 2DQSA 4CF5A
chains in the Genus database with same CATH superfamily
3AR5A 1HZJA 2VPTA 4Q19A 3X1MA 4C6HA 3ABSB 4CHGA 2OL4A 3E81A 4JC0A 4Q37A 2H3FA 3RC7A 4YV7A 1KYTA 5KVSA 1R8XA 4WXHA 4LBWA 2ZTUA 3DW3X 3V2GA 1OXBB 2RFLA 1GLVA 1R6AA 1N2CE 1JEAA 4RA6B 3BS5B 4QZ8A 1QYXA 1IHOA 1E7YA 2BMAA 2YVQA 4KLUA 3GUVA 4EUEA 2Y9MB 4AROA 5KWSA 2JFOA 4CI0B 2VRCD 3SSAA 3JATB 1W6RA 3QUTA 4I55A 1NP3A 5L7TA 2J3LA 1CZHA 2J3JA 2P3SA 4G67A 2ZVQX 3FNFA 2FPMA 3FTFA 1Z07A 3AI2A 1OB2A 3GRUA 4LE2A 3QPBA 3O31A 3RS7A 1X2BA 1GL3A 1O97C 4F4JA 4BNTA 1SC1A 2B2CA 4DBVO 1NBME 3CUKA 1NUPA 5HIIA 1AQNA 4WHMA 4BTEA 4XEUA 1ZITA 1L5KA 2A1UA 1Z45A 1FSZA 3T4PA 2GAJA 3L18A 5BVGB 4M9CA 4KWCA 2Y1CA 5F1OA 1MO3A 2FZGA 4RPYA 2B5WA 3QF4B 4RQ2A 2C9CA 2ZP1A 3OAAD 1DX4A 1Q21A 1FP1D 3WI7A 3JPSA 4CTOA 1KS9A 2H1FA 4A8HA 5EIBC 2I9GA 3E7XA 3I04A 1VDVA 3F5SA 1X40A 2HU2A 1LWOA 2RDMA 1GZ6A 2GT1A 2CXPA 4BNLA 5C4IA 5CA1F 4OXXA 2FUEA 1F0KA 2EFYA 2Q5HA 2BE9A 3DQPA 1A3CA 3WGJA 1CUKA 4DJAA 4PQGA 2DERA 1P1RA 2I2AA 2E87A 4BMDA 2X3YA 1W47A 1T3NA 3PMLA 2GKGA 3S7ZA 1ETUA 4G6ZA 1RFGE 1XWIA 5FD8A 4MK4A 3BWVA 1L4FA 1IOLA 3QPVA 3CLKA 3ZTYA 3U3RA 3H6KA 1LSOA 4BNJA 1A4RA 5G3ZA 4G0UA 4HLNA 1OYOA 3ISDA 8ICPA 1CE8B 4F1WA 3PKZA 3I73A 4B79A 3I9MA 1MG5A 1IHUA 3L4KA 4L16A 3SIRA 3KEFA 2ANBA 1HQKA 1GYRA 1AKEA 5GMOA 3RU3A 1M1ZA 2QRKA 1JWLA 4FNAA 3UY4A 3ZV7A 5A1JA 4BO0A 4KX3A 3S2UA 2XTZA 5IVIA 3MMXA 3VTKA 3WP1B 1FZQA 2WIKA 3SP1A 3KXDA 1PJ3A 1ZQWA 5DM2A 4IKOA 2OAEA 2DEUA 4RIHA 4TV9B 4W4TA 5DBHX 5DISB 3MIZA 1QCZA 1RQGA 2QF7A 5GONA 4FI3C 4EHIA 2BFDB 5EIOA 2P9BA 3PNQA 1R15A 3AP1A 2GWHA 2E82A 5IYZF 4C76A 4PZPA 1BVRA 4WDQA 3TI7A 3EPKA 1POWA 4BWGA 5DNVA 4NCKA 3GMSA 2QVBA 1E7WA 2G3YA 3FPKA 2QTBA 2FMHA 3CTMA 1BD3A 1SXPA 3RSSA 1U31A 5E8JA 4F8JA 1XQ1A 2ZRMA 4NCBA 4C7VA 4D3SA 3KTQA 4C88A 4JI5B 4A91A 4KX5A 3PTAA 2PL9A 4YP5A 1NKEA 1C3LA 3IAXA 4ZOLA 5C5DA 2BTQA 3ILVA 1DC7A 2UVRA 4NAUA 1OWPA 3HXQA 1MD9A 2E8PA 5IEJA 3I52A 4L72A 1XRSB 1XTRA 1MVLA 3PPWA 2VANA 1S96A 1Q22A 4W6QA 4XSGA 1Z4KA 4J0EA 3GA7A 5FA8A 4G36A 3H8VA 2YCLA 3NHYA 1RPZA 3Q6IA 3LYUA 2BFCB 1IN5A 4RQ6A 2D0PB 4QUAA 4FGZA 1TK5A 3RTEA 3MLEA 3NFRA 4P36A 4JN6B 1JKIA 3I2JA 3MRSA 3O7MA 3LYLA 2BISA 3EGWA 4Z0PA 1E2MA 4W5NA 4LX0A 2AT1A 4IDHA 2EZ8A 3DEFA 1E7MA 1OFGA 1ZQ9A 3KQQA 4XQ8A 1NSYA 3IEVA 3NP9A 4TS4A 3GG9A 2BR3A 2JEGA 1RFLA 2DFNA 4EIWA 3G6KA 3OE7A 2VF7A 3VDRA 2QRGA 1YI1A 3Q3CA 1PV1A 5DLQC 1OGYA 1DADA 2KFNA 4HGNA 1HV8A 3P8ZA 2W6JA 4J43A 1OCEA 4TKVB 1HNXB 1EKXA 2Y67A 2J7PD 4RLFA 3EFBA 3DLBA 1UOPA 4R63A 1VQ1A 3LQ2A 3AC0A 1XRJA 2QZPA 3CVOA 4XX0A 2XTJA 1ZBDA 9ICPA 4OHPA 1N6LA 1AS3A 1YRBA 4QA9A 2WABA 3AOGA 4B87A 3EULA 5FUVA 1HDEA 2HCFA 4F6RA 4ZYXA 2NUPB 3ACBA 1RTKA 4RAOA 4DMLA 1JN0A 1H2RS 2O6KA 1OYWA 1S01A 3ZLVA 4UHHA 4OI4A 2G40A 4HQ6A 3ZHZA 2OORC 9ICSA 4MLZA 3IA2A 1WABA 4IJQA 2WKQA 4JJZA 4EBEA 5ARBA 4IV5A 4EKEA 4D8WA 5FO0A 4ILEA 5G02A 2VJNA 3ZE8A 3W90A 1R5NA 2GUGA 2IHUA 4H4DA 4R40A 1PLLA 1FSSA 3E9CA 4I19A 1N5XA 4R1OA 4TL6A 5K3FA 5CG1A 2QR3A 3IOCA 2OBBA 2O1WA 1COOA 3KQKA 1FFCA 3O1JC 4XCQA 5JZVA 4F3KA 3MJSA 3E23A 1KZ1A 3CLTD 3BN3A 4I46A 1FMFA 2QLJA 4NY8A 3GT4A 4R2WA 4O2AA 4AZ3A 4X95A 1E5LA 3FWPA 1MW8X 1P9RA 5C37A 1GJRA 4FD2A 1QIKA 5FBRB 3UAGA 4RVNA 3ONVA 3SAHA 1Q7TA 3KFVA 1IPHA 1SAYA 2UVWA 1CWUA 2ZDHA 3PJRA 2LNDA 3DZKA 5IZ4A 3LH5A 4GR5A 4WZAB 1XTQA 5SYMA 2Y1GA 3L7BA 3E7WA 1CRQA 5TMDA 1W9MA 5BQXA 4WCFA 2HA2A 4MJLA 1P1KA 2Z6AA 5J2HA 3HKDB 3BCHA 2ZAYA 5LA6A 4X66B 2WF7A 2WAYA 4B8ZA 3HPRA 2H1VA 2ZVJA 1C4XA 4Z9FA 4YUZA 3PJDA 2EJUA 2GK7A 4U8HA 2OHXA 3PGVA 1RPJA 4GHWA 3G0DA 5C32A 4DY6A 2H3QA 4KDCA 1II0A 2CZQA 1BHSA 2G0TA 2A0XA 1DBIA 4WCVA 3CVUA 2XF8A 2JAHA 3LUGA 4HX9A 3VTAA 2JLBA 1QNLA 3AEQB 4AAYA 1K2WA 2H7VA 3G8CA 3U4DA 2H9YA 4JNKA 2BEUB 2ZIWA 1ZI8A 1IL0A 4DFDA 4CCSA 3T1NA 4UUOA 2VUSA 2PUWA 4UULA 3V8EA 3JALB 5LLDA 1SCDA 3VUEA 2EBWA 1CJMA 2PUVA 1T0HB 4FWBA 1H94A 5FI3A 4J0DA 5KWVA 3BWEA 3D7NA 4AYBF 4IX1A 4TTRA 5KFXA 4C08A 4CMEC 5FAXA 1CEQA 4MV4A 4AG3A 2IPNA 4BMNA 4GZLA 1D6JA 2E5LB 1OAOC 1J1ZA 1JXOA 2EVWX 3WTCA 1C1XA 2BIFA 2OCLA 2ZI5A 2OZKA 2FE4A 3RYIB 1TB4A 2OESA 3SS8A 4XGRA 5ADUS 5G4KB 4FGJA 4D80A 5KAMA 2EERA 2XCAA 1X1QA 4W5TA 1ZQYA 1SQFA 4JUBA 4JFAA 4LDRA 4WESB 2YWRA 4ZA2A 3DBLA 4XTRA 4OQXA 5T4FA 4PBTA 1A9YA 3DEKA 4Q1DA 2YVLA 4YAWA 1C81A 1F6DA 3AJAA 4FEGA 1XEXA 2DGDA 2PSHA 3X1ZA 3UAYA 4Z0TA 1YD7A 2UVUA 2YBDA 3MWFA 2XUHA 5KQGA 5EZYF 4WGGA 2C9ZA 1SZJG 4QSMA 4OY3A 2WW8A 3P5BA 3H5RA 5SYAA 1CUYA 3GH3A 3FGNA 1IZYA 5IWAB 1DAEA 3EIQA 1KAGA 5EIFA 4C20A 3GIIA 3NAGA 4IWYA 2R8YA 4NS1A 1VM6A 5WRFA 1OX4A 1HLPA 3JQGB 4A73A 1KJZA 3ZU3A 2C2WA 4ZVLA 3L0IB 5A2QA 1CC1S 1JEOA 3RPEA 4N5DA 3PNMA 1NMZA 2QL5A 2BZFA 3H2GA 3EPIA 4ESEA 3U44A 4MDYA 6ADHA 3L4PA 7ICUA 4FX2A 1SJ9A 4YQFA 2IHTA 3WWPA 1J8MF 5DHQA 2UAGA 2QX6A 3AEKA 1BNOA 5CGZA 5D00A 4XR9A 2DVMA 3LPMA 3AHCA 2E5WA 4X91A 4L5CA 3USCS 4QG3A 3I5XA 8ICWA 2C2XA 1PV4A 1JA0A 5EESA 4OB8A 1ZMRA 2FMXA 1QSYA 2JXJA 5F2EA 5J2UA 2BGMA 4LF6B 2G70A 2UVVA 2LCIA 1X9XA 1NI4A 2RLTA 4XXHA 3DCYA 5J2FA 4JL5A 2PY6A 4O29A 2MSWA 1Y80A 3DE3X 1P2SA 2PJDA 1ZN8A 1VFPA 4LF5B 4WBNB 3KAPA 4KPUB 2C5LA 4AG5A 2VPWA 1KIAA 4DEVA 3M6LA 2VH2A 2ZRHA 3O9VA 1DTWA 5TX7A 1UIRA 4FYYA 4RMIA 1PGOA 3QYAA 3FSRA 1SXQA 3FIJA 2W90A 1YK1A 4IIXA 3TVYA 4CMBA 3IP9A 2HJHA 4P0PB 1M7HA 2ZZMA 1K5PA 4F7DA 4ERNA 4BO5A 5KKCA 3AB7A 4GH5A 4YJ2B 2ZIVB 3LHDA 3FNRA 4ACOA 3CN9A 4CKZA 2ANCA 4A8PA 8ICHA 2EJTA 2V9WA 1U3DA 3ILXA 3KUXA 2F6RA 3HJCA 1NNEA 1YOVB 3M5PA 1GA4A 4DN6A 3OX4A 1VA5A 9ICNA 4V0SA 3GRAA 2HU5A 5B7QA 3HB0A 1PL8A 4OXQA 3SIWA 3W0LB 4LJKA 2OUKA 3QA3E 2EKLA 3I45A 3IHTA 3S81A 3JQFC 1R3DA 2CHFA 4MGYR 2VT2A 8ICYA 2FPRA 4HQ0A 3ANSA 1HUOA 4DG8A 2O2IA 2I3ZA 5KFOA 4U5QA 2LKYA 2J3HA 1LV8A 2LPMA 2CMGA 1QV7A 1ZGBA 4E0DA 5EXXA 2YXLA 4UFPA 4J1SA 5D46A 3U7EB 3NAZA 1P91A 4ZAGA 1JHXA 5LWHA 2JFHA 2N46A 5DGCA 1HIWA 4Q02A 4MVJI 1UC5B 2R1VA 1YQWA 1R6TA 1KC1A 2IOQA 2MOKA 1OI7A 3ZHCA 3U7RA 2VO1A 1EK6A 1KEPA 4K03A 3E9YA 1KEJA 5JXIA 3O95A 4EFLA 3FPSA 3D5QA 1XZDA 5KFKA 4RQ7A 3CPJB 1I1OA 4DGSA 2CLLB 2C3YA 4IQ0A 3G6YA 3VNAA 3IGFA 1DXOA 3EOAI 4BLOA 3I76A 2WF5A 3QUAA 2H08A 3UVEA 3G0HA 4US2R 1JHOA 3H9QA 3FYCA 1X15A 2YBEA 4X3PA 3PEVA 2XLBA 1N56A 4TWBA 2XOXA 2D7CA 1H2WA 1XRMA 2VDWB 5I7WA 2W58A 1OFIA 3P5SA 4QVKA 4QWDA 1V85A 8ICZA 2QDKA 4PCVA 3N2IA 4YV0A 3BJRA 4B3MB 1EXVA 1NK4A 3SR4A 3GDFA 2Q6IA 3K0EA 3JVDA 2EQBA 3X0DA 2ACEA 1TT5A 3AT1A 3KQUA 5EP1A 2J31A 3I5YA 2GEVA 2XAUA 5F98A 2Q0HA 1NATA 2HJ9A 3OWHA 1NV8A 4M4SA 5HZMA 4MQFB 5JSQA 1M8JA 1PNOA 2KLHA 4CLOB 4RQ4A 1GLGA 1T5BA 1J0CA 4OLAA 2RGGA 5DASA 5J0WA 2MWMA 3LLCA 2NW6A 2OGZA 2NV3A 2R6DA 1KRWA 1IRIA 5DOVA 3TZ6A 5HKAA 4EMBA 2PJRA 3M3DA 1JKJA 4OJ6A 1S4MA 1LDNA 1G21B 4U00A 1LNQA 3GCXA 2A94A 2PU5A 2Q2OA 2ZSEA 1S0VA 5HM6A 4CWAA 4FYKA 2CDBA 3HADA 3L8YA 3HKCB 1IMJA 5K0SA 2ZFUA 4G3XA 1WXEA 4ZOAA 3GK3A 4GXQA 2ZI4A 1E1RA 1SXJE 2OH2A 1T36A 2AG0A 1SUIA 3GYGA 2Q4OA 3THWB 1OZAA 1SR8A 1UBMS 3B12A 3IEXA 3JZIA 3MT8A 1EJBA 3EDYA 1IULA 3BHJA 4YJFB 4Q44A 1T3HA 5GJBA 2B0JA 4KFUA 4NJEB 2VK4A 4UATA 3ZZ0A 4EYKA 3OY2A 5KG3A 2R65A 4L78A 3ICQB 1F0YA 4H4EA 3HY4A 1TEHA 2VEOA 4L3OA 1XRLA 1M7BA 1N4DA 1P0IA 4A5OA 2Q4EA 4WCFC 2VSQA 3I9V6 2OV2A 4NESA 5D6OA 3SS7X 2BFFB 1JR3A 3WKEA 2FHPA 3TNDA 3K1JA 1C4WA 5HF6A 4REQA 3TQRA 2HYIC 2XB4A 4K87A 2MSCB 3SEAA 1E2EA 4ZHQA 4Q3AA 5EERA 1PWZA 3MRXA 4LZDA 4LRUA 4DM4A 2GXUA 2C5BA 2BN4A 1VLJA 2I66A 2ZYHA 3THOA 3F71A 3D2SA 5FTNA 1T26A 4OJNA 2CJWA 1FUEA 3RSZA 3DKRA 2QAJA 2P90A 5DULA 3EH2A 3CZ9A 2VTKA 2W2XA 5DT2A 5AM5A 4YDRA 2I6UA 1PUIA 2GBCA 3ENVA 4WI1A 3EVEA 7GPBA 4BCCA 3LF1A 6AT1A 4I8XA 1J8FA 1XD2A 4GI7A 1D0SA 5CA0B 2OD2A 2ILVA 1QORA 1QX4A 4BO4A 2H65A 4RETA 4NK5A 3HFRA 1A9TA 2BMVA 4C3UA 3P0HA 5JZMA 3AEYA 2OK7A 4IEFB 3ROEA 3O3CA 3F46A 2A9JA 1LQTA 2K8BB 5GGXA 1CSEE 2WUVA 2C0CA 2QA5A 5AVTA 3RYCA 4KLCA 2DUYA 1BOFA 1RHRA 3AF5A 5JQGF 7ICMA 1N5MA 3P0JA 4AJ4A 4TTVA 3VR5D 1I6LA 1W7AA 3RGGA 5K3DA 3LY7A 1YR6A 4F4UA 1WXGA 3D81A 1P9LA 4HN2A 4E11A 4DQRA 1R0KA 2BFOA 2LE0A 1H1TA 1J8VA 2ZBRA 1Y9EA 3W5DA 1ZQ1A 2BMWA 2FW7A 4AICA 5L6MB 1XCPA 3VPHA 1M2GA 2QW8A 4XGNA 5KC8A 2CD9A 3CLRD 3L1VA 3M9WA 1QC5B 2FPGB 2BCSA 3ASUA 5DWDA 5EUQB 2GAFA 1F8XA 3STYA 5IVPA 2P62A 3CW9A 5FBLB 3WNZA 1KXZA 1L4YA 2HW8A 2J6TA 4M86A 4QRDA 1ZCZA 3AK4A 3CZMA 3DPUA 3K0SA 3TE7A 4ZI7F 4X85A 5KFNA 2VQ6A 3Q6NA 4IJ6A 1UK9A 3PV8A 2FQYA 1ZM2A 4CM9A 3WAKA 3I6BA 3N59A 4NE9A 2YFYA 3EB9A 4Y1RB 1T0UA 4P7GA 1PEDA 3GLGA 4ARZA 2NV0A 4MW7A 2Q8PA 3UYLA 1DRJA 4LPKA 5FCDA 4M1YA 3LYHA 2O5CA 2C22A 3OPYA 1H23A 5K03A 1W5SA 2BCEA 5B3LA 3M83A 1I4WA 4YN3A 5DT9A 2AXNA 1NR5A 4OVKA 4PH5A 4ZO8A 2Q99A 2L17A 3MBKA 2IYRA 4WSOA 3WK5A 1B93A 4RT3A 4V0LA 3TAHA 4LC0A 2JIQA 1M7GA 2EKBA 4OQMA 1UJBA 3LUPA 2YWFA 5HFNA 1HT2E 5B12A 1Q7RA 3DOHA 1C7RA 3WK7A 1I94B 3C6XA 1KMQA 5CB4F 1W93A 2ZBDA 1MPTA 3SIPA 3C39A 2IU3A 3SJAA 3U2QA 3TSZA 1O6FA 2AQKA 3UH1A 5EKXA 1D1QA 1VE6A 4KLLA 3CVJA 1DUSA 3FBGA 1ZQEA 2QQFA 1OC2A 4HJRA 3ZDXB 3QG5A 1GPUA 2YJ6A 4F8YA 3K7EA 4LWPA 4PTYA 5JD6A 1IRXA 3D6NB 1EFPA 5M7EA 3AF0A 3TQIA 2JI8A 1AUVA 2CV0A 2ZSBA 1ODCA 1U8CB 2G76A 2I4LA 2QRLA 2LP4Y 2O52A 2PPVA 2O0KA 4NHEA 1SCNE 5BXQC 1DJMA 3P2OA 4ZYUA 3J7TA 4WJLA 1WZNA 1WXXA 2N75A 4H59A 3KBOA 2R87A 4FJ1A 4I6JA 4MAMA 4EKDA 2JRZA 1QF7A 1BFUA 2OXRA 2FW6A 2C28A 5BMVB 1KI8A 1D1PA 1ZH2A 4B47A 4C4OA 1LKYA 3WGIA 1VB5A 4E2FA 2VTBB 3GAAA 2BCVA 1OE0A 1N5WA 2RBKA 2F9FA 2RRDA 3SX2A 3EDQA 4K9DA 1ORVA 1C7JA 3QSYA 2QD1A 4B4OA 4ED8A 2Y4OA 3BAFA 5KS2A 4ZJYA 2XI4A 2QUZA 1GTRA 1E63A 4L15A 3UHFA 5BNTA 3VH3A 2REXB 3PUJA 4NBRA 3FWHA 3MAGA 5LB2A 3ZIAD 4JAVC 1KDOA 4NF2A 5LU8A 1PT7A 2IT1A 1FTQA 3C21A 5H1YA 2VDOB 2O14A 2QVZX 5JDIA 1FYFA 5DTJA 4JIGA 5FTJA 1PJ8A 1X66A 4LMPA 3NCTA 2VNIA 5HP4A 4EUKA 4MW2A 1F2VA 3ULKA 5L1KA 1OWOA 2YHBA 4TURA 4B9TA 2PMZF 4D7AA 2O8DA 2QX4A 1XRPA 2VTEA 4PGMA 1NG1A 3IKLA 3PSHA 1XV5A 1SIWA 5JCJA 1NK6A 2H7XA 4HVCA 2B7CA 1RWKA 1Q91A 1QIEA 4Q9HA 4K46A 3OC0A 1RYRA 2O0HA 4JLVA 3HUTA 1PN3A 1GPDG 1KRHA 5J1TB 2BSXA 2WAXA 4JZKA 4J49A 3GFRA 3W3AD 1UC9A 3ZI0A 3QTLA 4ZICA 4KNVA 4JLOA 5E95A 1TMYA 2Q0ZX 4KBFA 2WU0A 1Y98A 5EC8A 2KIVA 1SXHA 1L5HB 3F7TA 3HP4A 3K31A 3VHXA 2WINI 1AZWA 3SQMA 1N5RA 1TAQA 4YJDA 3F3KA 3C85A 1PQYA 1NQOA 2W93A 3COZA 4J76A 2RJNA 4OYYA 4MAAA 3WNBA 2O7NA 2WE8A 4QOSA 2KMLA 3QXHA 3E8MA 2PQMA 2GEFA 2OAGA 3RFAA 1B22A 1B3RA 2NXJA 2DWCA 3BL6A 1SGGA 1NYTA 3MQ4A 2JI7A 4ZQGA 7ICGA 3OCVA 2OPHA 2Y6UA 1VKRA 3CX4A 2VSFA 5KYGA 3HUEA 4CEIB 1QRAA 5FV7A 4WN3A 1RYHA 5BUQA 2DBQA 3QKSB 1DIGA 1JU9A 3G85A 3DOIA 1A8IA 2X0JA 1RP7A 3LKZA 5D4BA 4OQDA 2W98A 3OPMA 1EWYA 4L8FA 5ITZA 1T2EA 4RMHA 4ZAXA 4M6WB 2XNKA 5K99A 5HS6A 1S02A 4DZTA 4G4IA 2A5DA 1FB5A 5AW5A 2FAXA 5DDIP 1CEXA 3F1KA 5H02A 3RC9A 1IJKA 4AY6A 2JNWA 2LM4A 3BE4A 3IP7A 3PDWA 2V98A 5KU1A 3FSEA 2GN4A 5AJVB 2IV3A 3S1AA 1D5WA 3ZLBA 3MOGA 5JEEA 2HPHA 4YNBA 4H18A 4BNXA 4LSWA 3U80A 3G5UA 4KH0A 1M1UA 4A1OA 1JEDA 1UBEA 5H0IA 4RACA 2VPYA 4EKNB 3EIHA 1KWKA 1GTL1 3LXMA 3B3AA 5KNDD 4M9NA 1JHRA 2NOAA 3EXG2 3VA7A 4NYJR 2XWQA 3ABRB 3UJ6A 1KQPA 2X0RA 1HE1C 3W78A 3SSNA 1CV2A 3ML1A 1O0SA 2WF6A 4RVGA 1J0DA 1J22A 4ZH4A 3DVAB 1CJUC 2MSDB 4L0QA 4FX5A 3O3OB 3GV0A 3ZZMA 1Z0SA 3VOTA 5DIFA 1X6VA 5JJIA 1YB4A 4CFSA 3FG9A 1S2NA 3RUDA 1M6VB 2CB0A 5A62A 1BGVA 3O5AA 3CRZA 1EP9A 1PK7A 1RI2A 1EX9A 5EWMA 2WB1C 3R1IA 3TOXA 1GPWB 4HWPA 4TWAA 4BZWA 3GJ4A 1E2PA 4GXJA 5HUJA 2PVSA 3IG5A 4B7CA 3IJ5A 1S0NA 5EXDA 3FHOA 1JFSA 1U8FO 1UP4A 2VJQA 2PRYA 1FCJA 4HDCA 4BAGA 4OHFA 3NHKA 2G4VA 1CR1A 1QHSA 4NBKA 4UOZA 2I4RA 4BBZA 4KJZA 3GVPA 1T2VA 3GARA 2NRTA 4DQXA 3CISA 3Q4GA 2QD3A 4OMUA 3PD0A 4CQMA 4FW9A 3WSVA 4REOA 5JAPA 4PE5B 3D6HA 2Z1DA 2IEZA 3C3YA 1QYWA 1UPFA 2P1DA 1G8KA 4FR5A 2BCGY 1C8LA 3QW4B 2G7ZA 4RL6A 4D9KA 4XFDA 3ZHOA 2W2LA 2ZU0C 1TADA 4FS1A 1DUIA 1GQRA 2QVGA 5F78A 3QZ7A 2JGDA 1MZVA 2ZETA 3IVGA 3HZRA 5C5CA 4DXHA 3LWNA 4MEBA 4UVGA 2IELA 4QFBA 1I3KA 4WZZA 1INLA 1U4OA 3UPUA 4RY2A 1H65A 2JBAB 5DJ5A 1P5ZB 2HQRA 3DB2A 2XDWA 4OHBA 1SCAA 1KQNA 1NV9A 2EF0A 3GJ8A 3PK0A 1QHXA 1YKGA 1R8QA 1U7OA 1BYUA 3D3JA 2HCJB 5IU6A 4R2HA 3SEQA 1QVRA 5ALRA 3W6NA 2IWRA 3CNLA 4EWLA 5ADWA 3KE9A 2OFFA 1S1CA 2QD5A 4TROA 2IHNA 1UKEA 4RO0A 3WOHA 2Z2KA 3AQFA 2WP8J 5TIIA 1V8DA 3RSFA 4G0VA 1PD0A 1P4JA 5DTMA 4YIHA 3QKRB 2NGRA 4S3MA 3S3TA 1XYGA 2FVYA 1DU4A 1F8GA 5J23A 2RHBA 3HBLA 4L4SA 4LSMA 3KUDA 2C78A 2GWRA 5H2FU 1T1RA 2W11A 2UUPA 1C7IA 5KWIA 2VNHA 3BJYA 3URMA 2MMGA 2OORA 1DAGA 3QP9A 5J5VA 5THKA 2FE1A 2F1OA 3K9HA 1H1LB 4R7GA 3QZUA 3SXUB 1CIJA 3K70B 4C4PA 4KV9A 2P2NA 4YMLA 3L7DA 3D4NA 1TO1E 5C4GB 2WK1A 4UB1A 3GLFA 3R0ZA 3VOSA 1C9EA 2B4YA 3ZDYB 1SU8A 4EJ0A 3OMLA 1ULBA 4XAQA 4A15A 5AKKA 4MO9A 1KJJA 1COZA 5JRTA 5B30A 1XNSA 1SZCA 3K09C 4IQGA 1PJTA 3OFSA 4QLBA 1TYAE 4BE7B 5KTSA 2QZ9A 4BQQA 2H9AA 3G0IA 3WYDA 1U8ZA 1ORRA 4PSKA 3TJRA 2Z2IA 1Y7TA 3O91A 2OV4A 1VC2A 1B0ZA 3FZQA 3CY6A 1DIRA 3DT9A 5JDCC 4C21A 1OLSB 2RGWA 3IUNA 3LWZA 4HK4A 5IZCC 1V5WA 1V41E 3VAZA 1PNRA 1HLGA 3T5PA 1BJKA 3AFGA 1DKMA 5J3JA 4OJLA 5KTQA 5BR4A 2CNKA 4I2IA 3EYZA 2I03A 1QTRA 3HA5A 2HFJA 4GMHA 3WB2A 3IKVA 1YR2A 3GA5A 3JZFA 4AZVA 1F2TA 2XUQA 1Q16A 3NBZC 3UK0A 3HGTA 5T64A 3WHPA 2Q1WA 3DVRX 5HKOA 3OHAA 3C3MA 5F3WB 1SV0C 1HQYE 3P2EA 3NO4A 3V1UA 1A7AA 4KFRA 3ZQ4A 1O57A 2NVUA 4BB0A 2VOEA 1K6EA 3P0FA 2GERA 5HGJA 1T8YA 5LQKA 3NM5A 1G3MA 1OILA 2ZGVA 4YLGA 4PLWA 3K71B 1ZUHA 3R3UA 3PHGA 3T9CA 3WGVA 4PCLA 4F60A 4FNOA 5AXBA 3E61A 2YFKA 4I4TA 4BKUA 3HVRA 1YQTA 3BSSA 1B2LA 2FQWA 4YAOA 4FUTA 3CPHA 3EA4A 2YJZA 3NOOA 4D8YA 1ATIA 1W96A 1WZUA 5AJTA 5A6SA 1ADJA 3CX3A 3ADPA 4CMEA 5LPNA 4QC2A 5LYJF 4KIJA 1OAOA 4N7BA 3R5TA 3K8ZA 1M1YB 2OFXA 5JVDA 4FZNA 3B13B 3LHSA 3CE9A 3ND7A 4M76B 5EL0A 3M7IA 2HBLA 4CL2A 2Q3LA 1MQ8B 1PT5A 2DBZA 2JFXA 4NK4A 3T6KA 4JB3A 4B3SB 5UKDA 3EEYA 3BGIA 1TUIA 2NSJA 1Y8ZA 1QWSA 1U11A 4ZALA 4JSTA 2WTBA 1V0JA 3IAM6 2BWJA 4B3CA 4JLKA 1E4EB 4GM4A 4ZAVA 2RGCA 3WDLA 4L4UA 3ED5A 4I08A 5K51A 1Y1PA 2QRVB 4CEJB 4GP6A 1L3UA 3WHLA 4RTJA 3A04A 4X94A 1H0KA 2VDLB 4RTOA 5G2OA 3HRHA 2OCEA 3GDWA 4OFXA 2OZLB 3NHRA 2B34A 3PEFA 3PI7A 1WU7A 4RTKA 4IMPA 2N0SA 3IDOA 4B46A 4PPGA 3HEMA 4EPYA 2NU6A 4DL3A 2A0UA 2VDQB 3CXUA 3TRKA 2HIMA 1RZVA 3MHPA 1ZW6A 2OLKA 5B3JC 4YRZA 3MR6A 2D06A 3V2HA 4J0GA 5DM60 4QJ5A 5T67A 2GKOA 4YB8A 4HO1X 1R0XA 5KTTA 1CULC 4LOIA 4TSFD 4Q1AA 9ICRA 3ZWNA 4AJ2A 2F8SA 2B1IA 4F2WA 2EP8A 2RK6A 3NHAA 3OICA 1ZWKA 4PZDA 4CKEA 2XIQA 4JJGA 1XHLA 1O58A 4N3NA 4LZWA 2ZQZA 3FI9A 3LRPA 5H16A 3O83A 3QUQA 2Q3FA 4F4KA 1E8DA 4GQIA 2O06A 3TUZC 3IQDB 3U37A 1JH9A 3TW6A 4G89A 4KLAA 1OF1A 4BV8A 2LYBA 2WNIA 1XA0A 3SR3A 1C1DA 4YCXA 2GZAA 3EC1A 4B9LA 5CG2A 3OX3A 1RR6A 2PX8A 2YWBA 1JROA 4IOMA 3OPXA 1DEHA 1J21A 1RTTA 1H22A 1U7ZA 2GXAA 4XYGA 2OM6A 1DNPA 3GFFA 1E77A 1Y37A 4A2CA 1NJ1A 3PVCA 2QRMA 1QLWA 2AKEA 3OBBA 3CHYA 3UJDA 1OI2A 4IMRA 4Y1FA 3AIIA 4X1YA 1YVRA 2EJWA 3NNSA 2YJTD 3U3JA 4DOCA 2PT6A 3V7YA 3HBJA 4X41A 4L8GA 4UMVA 1U94A 3UMSA 4TLMB 3PUZA 2ET6A 3ZJ5A 4UTNA 1B42A 2IQIA 4GMKA 4WW0A 2F4VB 1U2DC 1X3SA 1SPXA 1UR5A 4B6PA 2VRBA 3OIFA 1TTPB 1J20A 4GOKA 4P4NA 4P5DA 4B40A 4Z8XA 1WY7A 2FSPA 3JQFA 4WNIA 3G79A 4N48A 3H0CA 2E4WA 3AM5A 2HR1A 1PHPA 3VJLA 1E2QA 5AVYA 2A7QA 3TFRA 3NHJA 3E84A 4XSHA 2GAOA 3BOSA 2ZPTX 2FSUA 1FX1A 4HDKA 4M9SA 2AEFA 1YQ9A 1NQXA 1WSBA 3TSOA 4N7RA 3LCVB 2ZQYA 2H1CA 3NJRA 4NM2A 3SC2B 4P86A 5LOVA 3URKA 1V6AA 4LYGA 4RABA 3DE4X 3TM5A 5CEJA 1EA7A 5JPCA 4BNUA 1A5ZA 4N0QA 4LHXA 2GXSA 2YJ4A 1W5TA 1Z1BA 1SBZA 1ZJYA 3SAGA 1VCIA 3E7DA 5FNVA 4Q7QA 4C4SA 4GEKA 3WYBA 2H5LA 4EYEA 5GINE 3F7OA 2C61A 4FWTA 3C1YA 2VG8A 1WBJB 4CKBA 2RMKA 1DBSA 3ZVLA 3V6KA 4QYSA 3KQLA 4OKNA 4QASA 5TB5A 5E6SB 1GRRA 1G60A 1XMXA 2YH2A 1CB0A 4HAVA 4BO3A 2GEBA 1CZRA 3T7KA 3O4RA 2O0LA 2Y8EA 1HDRA 3VZSA 1XCOA 2ZPUA 4G0ZA 2HX1A 3EF3A 1F9AA 3IMEA 2Q5CA 3UENA 5HYVA 4CFZA 3NDPA 2OKCA 1L4KA 1MO2A 2GZRA 3O3MB 2WTUA 1PR2A 4GWGA 3AKEA 3RWOA 1O54A 4HTFB 1T3TA 3U39A 1JFVA 1SXGA 5T3YA 2CZGA 2WKRA 3LY5A 8AT1A 4NDZA 1YZNA 4YRKA 2ZTLA 5JAUA 2WSIA 4D4HA 2FY8A 3MK31 3QELA 2J9XB 1RM6C 4QEKA 4B3XA 1NJ8A 4WY2A 2AFHB 1OV6A 1M3SA 1GUZA 4AJHA 3GGJA 4UHEA 4C78A 4ZOEA 3DMHA 1L3VA 2RDIA 4M1KA 2Z6UA 2K4EA 3HABA 2XNHA 2GZHA 1BJRE 1UMCA 3ZQKA 4E5KA 3B1YA 4NCHA 4YROA 4CL3A 3E9EA 2ATXA 2P0YA 1A0PA 2C57A 3F8TA 3DXXA 1G8HA 4PPQA 1L5FA 2CJFA 1ECJA 1O95D 1A9XB 1BMFD 2YN4A 1CUWA 3ZJTA 2YW2A 2CLIB 3GV5B 3WWCA 4B73A 2P4SA 3F96A 3DV2A 3DAPA 3S2YA 2AN5A 4X44A 2MHCA 3HLKA 5JMPA 5CLGA 2JS7A 1UUFA 4MDEA 3LT0A 1K8ZB 4HDNA 3FNIA 3IRVA 1ZQXA 1K98A 3V4FA 1JPJA 4AO8A 4P82A 4WXMA 1NZDA 3ESCA 1H4TA 1R00A 5DGIA 4IINA 2N47A 3QBJA 4S1OA 2I99A 4F2HA 3AF1A 2FOLA 2QP4A 5CRXA 1LDYA 2TYSB 1QH9A 4G84A 3B8HA 4BWFB 4F4WA 3STTA 3QGMA 1Z16A 4RSGA 5BQOA 2R18A 5KT7A 3QEOA 4DOAA 3FPBA 5KTPA 1NVUQ 2QMHA 1CCWA 2JC3A 3N6XA 4IAOA 7ICLA 2YV3A 4J03A 2YMPA 1K6IA 3EEOA 3UGJA 1JDVA 4QU0A 4O4IF 1KAMA 4GBJA 2LM1A 3F6EX 4B6GA 4GRDA 3EN0A 4UNNA 3TIXB 3U3KA 4L9RA 5K0TA 1IZ8A 2HV9A 4PR3A 2ORWA 3VZBA 2EJVA 2A19A 1T9AA 2B6GA 4DCGA 4UZSA 2LWIA 4BIIA 4KXYA 3GX1A 1CERA 3D2BA 4CEHB 5EP2A 1RVDA 1PR1A 3CSSA 4F56A 1FVFA 5HK8A 4U7WA 4O3OA 2WP0A 3MFQA 3G0GA 3GFBA 1KYVA 5DW0A 4IIDA 3NRWA 4O3SA 5TGDA 3WZMA 1BA3A 4MFFA 2XMPA 2ID9A 2AF4C 3E2MA 1BCSA 4RV9A 1BHQ1 4RIEA 1UA0A 3Q10A 1P7VA 2ORVA 3GLRA 1BJTA 3WNDA 4PBSA 5FBHA 5FI0B 2IX9A 3TL3A 2ZCJA 1ADFA 2XKKA 4D8XA 2LBOA 3B3QA 4G5GA 3VU0A 3SG0A 4PC7A 5KVQA 1N0HA 2DMRA 2VRCA 2BQ3A 4NLLA 2UYOA 4K2AA 3V8RA 3DE0X 5DEOA 2GVZC 4ER6A 2BKVA 2ZDGA 3TLGB 3LT5A 5HQ3A 2WHPA 3NHMA 2KM1A 3OIYA 1PDVA 3W2EA 2CXRA 5JFTA 3IT1A 2P65A 3X1YA 2WQ6A 3OU7A 4LJ5A 5IXJA 3ZIUA 3AH8A 4ZVMA 1D7OA 1E3TA 5ICCA 4D92A 1NW9B 5J0TA 1P5RA 5HE9A 4KFSA 4JI7B 4RD4A 3T61A 2JCXA 3CNHA 4YH1A 3L1UA 3DDWA 3VR0A 1TJNA 3ZCPA 3NIFB 5JSZA 3WK6A 2NO1A 4U1RA 4DSKA 3WQBA 1CF2O 4IRUB 4OGWA 4JENA 1EZ1A 4XUCA 2OHFA 3VDNB 3OAAA 3OZRA 4YJGA 3JVEA 1NMSA 1T5DX 2PXAA 1LB2B 1HNNA 4CE6A 1C1YA 4FLEA 3UKJA 3KBBA 1WVMA 2DTXA 1V39A 2FB9A 3LV8A 4JMUA 2W0SA 4P93A 2AX4A 2VH1A 5ES4B 4X97A 3Q8LA 1T1GA 1RJ9B 2NO7A 5A4KA 1L7XA 4UBMA 3PXGA 3KKPA 3VC7A 4N9QA 2JHFA 5AI4A 1YUMA 2BRUC 4IH1A 1CF9A 4OQLA 3I6YA 4QDZA 3VO9A 3FNBA 4ZANA 1KVQA 1WP9A 4IQUA 4I50A 4H7JA 3FWYA 3OP4A 2AOTB 3QEJA 1APBA 5DM70 3FTDA 3W2HA 1XD8A 3MHTA 1N2BA 2PGIA 2XXJA 4BLSA 3JVIA 1B43A 3V7WA 3T3MB 4F3YA 3N3BC 3RTDA 2QENA 3C3PA 1NX6A 3ZOKA 4RJ2A 4B2YA 1QQ6A 1GU1A 4F3RA 3WRWA 4CM4A 5IM4A 5HF8A 3B1JA 4IS3A 1N8NA 2GPAA 4KLQA 1OH5A 2R84A 3T0GA 3QY0A 1HEUA 3ZW9A 1X7YB 2C82A 3ZDCA 1TCCA 4YI3A 1AQLA 2H1RA 5CWRA 2WMOB 2PU7A 3MS4A 2QXTA 2V97A 5F33A 4IHQA 4KW7A 2GHRA 3LIIA 3OZCA 2B36A 3TKLA 4DT1B 2C3OA 4L0CA 4XM0A 4HP8A 3AUUA 4R98A 1QHFA 2ZT5A 2P9TA 3ZHYA 4EOGA 3EUEA 1EINA 5G1PA 3OSPA 2E4XA 4KDFA 3R76A 1BAPA 5KVAA 4NP6A 1ZGZA 4MIKA 1RW4A 4L07A 4QLAA 1JDPA 5CDFE 5C7YA 1C2YA 1UJ4A 1Z5WA 3U3XA 1QSGA 4OH7A 3NHBA 5A71A 4KGVA 4MR9B 1O2DA 4MEJA 3SOZA 4A23A 2H1IA 3L79A 3O75A 3TK1A 1TCBA 3UK2A 1GZ5A 4QECA 3AKDA 4YP1A 4DUPA 2A5LA 4M8NE 3PZPA 1THZA 5FYDA 1BXGA 4S2EA 1XPUA 2Z04A 1VLQA 2XSZD 1QHIA 7ICVA 3PXCX 1ECFA 1LVUA 1XMQB 4C1BA 2ALZA 2DHEA 10MHA 3K8QA 5EVCA 5T6BA 1IHPA 2D8AA 1XMVA 4Q3NA 4TN5A 4C6TA 1UMDB 1S0OA 3WL3A 4W8GA 1XB2A 5AJWA 3TJMA 1ZZGA 2WJAA 1CY6A 3CEJA 3RE1A 4I4IA 4DCPA 2DJ5A 3OEWA 1CHNA 1J9ZA 1W0KD 3KU1A 2LCFA 5TQJA 2HA3A 4TMZA 1PL7A 2QGNA 1X1CA 1DDOA 1KTIA 1A96A 1PQWA 4U2EA 2X7JA 3DS8A 1J4AA 4JSYA 1RQNA 5ESXA 4BNWA 2J6BA 1E62A 5IUNC 1SA0A 1Z2EA 1JILA 1R6DA 2QG9A 3H65A 1PJAA 4QBFA 3USZA 2QM7A 1E79D 1YB6A 4MHVA 2E4ZA 2OBXA 1YZVA 2OWDA 1W6UA 3GRRA 2GD6A 2GCOB 4LY9A 1W5BA 1TC1A 4CGYA 2QY6A 1Z5NA 2WM3A 3SKVA 4ZZ1A 2PRSA 3SJ7A 2RGDA 1JX6A 2F3TA 1IZ0A 2Z57A 4RXUA 4B4UA 4RQ0A 1E5VA 1GKKA 2RARA 1NK0A 3QVOA 4Q3DA 4BZZA 3DTVD 5M2QA 1FLVA 2QK4A 4AWAA 5JHGB 3JCZA 4FLMA 3L2OB 2QIPA 5LC1A 3VNBA 3MBOA 3IDAA 3JWIA 2HXYA 3LHIA 4J9LA 2CL7X 1V1RB 2D59A 4IS2A 4HQOA 1EWKA 4OMCA 3ZQ6A 1QOPB 3VR5H 3HDQA 4UU0A 3DW1X 3T7RA 2TMGA 5IN5A 3HVJA 4X60A 1GZHB 2QJFA 4CGZA 2XBLA 2VYND 4PLFA 4BJ1A 3CG0A 2EC5A 4NNOA 1G9XA 1JRPA 4JZYA 3I0ZA 2WFZA 4ER5A 2P6MA 2R8PA 1GUDA 5EJIA 3FNQA 1YB7A 4MTCA 2CRXA 3JWGA 1EB8A 1SU7A 4IWNA 2ERCA 3HW8A 4BL5A 2BLNA 4PGQA 4RVHA 1O6BA 2QTNA 3CW2C 1W1WA 3OQVA 3IUQA 4M47A 3K2QA 3ST7A 4ZT7A 5G0SA 4CV0A 4MB6A 4ZO6A 4AJPA 1P6QA 4TX1A 1EG2A 1SURA 3KZIU 1KIFA 4JBYA 1GCIA 4ZJZA 3R9XB 2NUBA 4TVBA 5KVVA 3OCUA 5DQIA 5DH9A 2GILA 3D6UA 1D2NA 1E60A 2FF7A 4PBRA 4CKWB 4X93A 3QFTA 3LQKA 2XXAA 5CEFA 4FSDA 2HU8A 2NRZA 1CPYA 3AB3A 4G5HA 3LLVA 1IG3A 5HKLA 4Q5IA 2VXOA 2RDJA 5GJVC 2Q28A 3AL2A 3LGXA 3TE6A 4QDKA 3TGPA 1WZEA 1X7XA 1QOQB 3KTOA 4C80A 3V4OA 1TJYA 4XTCS 3GAZA 4TV8F 4OO1J 3BIWA 2DM6A 3H1FA 4QAQA 1HMYA 1U5BB 4RH1A 4JMPA 2Z6QA 4GGOA 2R00C 3ABQB 2XODA 1PR6A 1WB9A 4TM7A 3K5WA 2UUOA 3CBGA 1L4MA 1M8KA 5EIXA 3A1SA 2VCHA 4XFJA 5JALA 2PBFA 3K15A 2HSWA 3ZCTA 2W7TA 2PX0A 4BAZA 1NY6A 3M4YA 3GFTA 2BFEA 1PG0A 2PD3A 1TGVA 1RXWA 5I8WA 2V7WA 1I5EA 1ESCA 5H80A 1RC8A 3BL8A 5FOSA 3C41J 4A8JC 1TW3A 3GEPA 1QSLA 3OQBA 3JYHA 1B26A 1AOXA 1I0IA 1CEEA 5IH7A 1LB1B 1SKBA 3R8XA 3KQWA 1RE0A 5AW3A 1E6EA 4QYIA 4CJXA 3JPRA 1OGIA 3CO0S 4FKZA 4DIOA 3CJTA 1ZNWA 3DNFA 3H84A 1OIXA 3D3WB 4MLCA 3AHHA 1N2CB 1JDBB 1Z2CA 3CZAA 3C48A 3VPCA 2KVSA 3UPDA 4GM0A 2ZVDA 4QBIA 4UKDA 1XSPA 1D2GA 2PZFA 4QUJA 1TIPA 1DRKA 4FMDF 4EGQA 1V7CA 3OU6A 2X4IA 3H99A 4U7CA 4YMNA 4GSLA 1DKRA 4H3HB 4ZTZB 2P40A 4DLPA 4IVRA 2ZJZA 5AI5A 4KLEA 4WCDA 5EWLA 2CLDX 3K0HA 4IDDA 4J0FA 3CLSD 5I4BA 4DLLA 4L75A 4LQDA 4KWTA 3T1HB 4EQ6A 2ZIUA 3KR9A 1ZH8A 3MT7A 1P73A 3ZE0B 5ELMA 1HTWA 1YDEA 8ICKA 1CUDA 2B5OA 1HSZA 5JQWA 4QU8A 3PEEA 1GN8A 4Y30A 3VSAA 3U7QB 2REQB 4AJJA 1MB3A 4BB5A 3KQTA 5A4DA 3B9BA 1AVTA 4E32A 1BW9B 1SGWA 1TXGA 4LTDA 3KALA 3TPCA 2W6MA 1IVNA 3V5NA 4EVQA 3GR6A 1MIOA 3LX5A 4RQAA 2IIBA 5DZSA 3CRMA 3Q40A 3GJ6A 5LLTA 3BB4A 3EUFA 3SAJA 4LOKA 4R2MA 3PKJA 5IFKA 5TT1A 1UKBA 4KUEA 3QEMB 4JDUA 2NVBA 4IQWA 5H5JA 1LTQA 1EK2A 2I78A 4RGBA 1XP8A 1P4HA 2C59A 5D87A 1SZDA 4TZ6A 2FPLA 2HQBA 1YB1A 5JATA 3ZJYA 1B16A 4ONEA 1F6BA 4MWBA 3ICWA 3W3AH 2HQOA 4ZMSA 3MNFA 1CY1A 4EGSA 5GADl 4NWIA 3D0QA 5H7XA 2ZRAA 2R7KA 1KMHB 4FEAA 3IEMA 2Q3EA 1G5IA 2HGSA 1R88A 1GKUB 3ZBTA 3C3WA 3T15A 3U19A 3O90A 5I8ZA 4ED7A 4KGDA 2Z98A 3BHNA 4QXOA 3STHA 1L5SA 3D5TA 1WW2A 5P21A 2VTDA 1CLUA 1T6BY 1HL7A 5AHOA 4X00A 4ZCQA 1SB9A 2CPRA 5EWGA 2EANA 3K09A 3Q8KA 4MINA 4OIMA 2XZOA 3QFSA 1DCFA 3ZN2A 3VSDA 3GFQA 1Z18A 2Z08A 3KZNA 3PHHA 5CD1A 4UB4A 1YZQA 2OTCA 3S70A 3MAAC 1QUFA 2D5BA 1USWA 3RRXA 5JDCA 1Q8KA 3C0KA 5LXTA 2IDZA 5IZCA 4DIFA 4K9QA 4UVDA 4Q1CA 1EUDB 1VHQA 1V3QE 3K2EA 2IYPA 3TNYA 1LDGA 1FMCA 5IH3A 5HM8A 2X14A 4ZVVA 2QSYA 1MB0A 1X8LA 1U4SA 4AJNA 5EXEA 3H1TA 2BGTA 1GSAA 4PANA 3JWPA 1EK1A 1IH8A 2XKBA 1BD4A 5TQ0B 3MT9A 1SV0A 1W30A 2UZAA 1HFWA 3CJQA 4MUEA 4ZT6A 1PFWA 2G88A 4V2UA 1DTSA 1OXVA 1L7RA 1Y5NA 4CTMA 4BNZA 9ICGA 5DX0A 3ZK9A 4NVRA 2GOYA 1CZNA 1W8DA 1KO4A 3UHOA 4AXBA 1Z4OA 4IDPA 4FIDA 4JSRA 2ZJBA 1O1YA 1L5UA 1CT9A 4IHJB 4JBHA 4QZDA 3FMIA 5BRNA 3OEYA 1E3WA 4ZO9A 2J3EA 3RJJA 1ACMA 3BA6A 5F9LA 1WTAA 1I2CA 4QLOA 5AW1A 5EJ8A 1RJGA 5KNDH 2PZEA 2X5XA 4HZIA 5BP7A 2QJRA 5NLLA 4JV1A 1Z33A 1TUBA 3L1HA 3RB6A 5JH7B 1O96A 1LWNA 1N2HA 2BOVA 3O47A 2PGDA 3D6VA 3L5OA 1G3RA 3M4NA 5CBKA 3SC6A 1B8OA 4LJ9A 2PRKA 1VMIA 4B3IA 2GHTA 3L7CA 1RXSA 1VJ1A 4EHLA 3TH5A 4PZOA 1V1MB 3PC7A 4LISA 2EW1A 5KX5F 3QWHA 1QVVA 1OX5A 2WY2D 3QKIA 4JWTA 3K6KA 4TM8A 4ZIRA 3CF4G 2HA5A 1RS0A 5K0CA 3W1WA 1OTXA 4BC1A 2A14A 1O8CA 2G9UA 4W5QA 4WJ3B 1GRVA 2L5YA 2ON6A 1WF3A 5CYPA 3MTIA 4LDAA 1OREA 1GG9A 1YRLA 1YBFA 4M3NA 2HBZA 2YZGA 2X8JA 5KQSA 3OX2A 3SKYA 3H1PA 4J6EA 4GOMD 1ZQGA 2CLCX 3C2MA 2VL7A 5KAFU 3W5AA 3NRCA 3NS1A 2WAQF 2YZKA 2ZKIA 2ZB8A 1E4OA 3EZXA 2RKOA 1Q12A 4BO2A 2OCBA 2RGNC 1U6KA 3HQ4O 1A4IA 1G3QA 5JCPA 1OT3A 4Y6OA 4ALMA 4DFKA 1IXRC 1MVNA 1KR2A 3T3OA 3JAKB 5IINA 8ICMA 1WLSA 4BJQA 5GVSA 4B7XA 2I9PA 2QN3A 3R7LA 3MUFA 4KKXB 3PNYA 3A0BU 3IIEA 1YQQA 2GNAA 2PUAA 5B6IA 3K92A 1JEQB 4N6GA 4ZQEA 3RV3A 3B6IA 2CF5A 3HGMA 4IGAA 1SPBS 4TXHA 1ZQBA 4M0CA 3KYJB 4ZI2A 3ZJUA 2WSYB 5B3JA 4UBCA 4YWHA 4DUZB 1KQGA 2FEWB 2JW5A 3WBJA 3EHDA 2HBMA 4LWQA 4ZEMA 5FTKA 2D1YA 3CLTC 1AZSC 3UQ0A 1XZ8A 6CHYA 1U1CA 1RXVA 6GPBA 1O95C 5C4MA 2FVXA 5KOJA 3AFNA 3EFEA 3FBWA 1I9CA 4F45A 3NTXA 3B0XA 4X6UA 3CUUA 4RV5A 1ZN7A 2XMGA 1XDSA 2HXSA 1SC6A 1DOHA 3DCJA 2XQFA 2Y1XA 4JXKA 4R3WA 5FTLA 1CJCA 1KI6B 5DHFA 3T34A 2CDCA 1VP3A 2FMKA 4LXYA 1LK7A 1E9EA 3GJ5A 5KWJA 4UW9A 1LVGA 2BGKA 3QEAZ 4BX2A 2FMIA 1KQQA 1XE3A 4O4HB 1UAAA 2PL5A 4HGZA 3P20A 3C14C 5SICE 3DR3A 5J2DA 3E9DA 5KREA 1NXOA 4LWOA 4PHGA 3G68A 3V3TA 1H2XA 5FJJA 2NXCA 1MRSA 1GP2A 2BW0A 4G1EB 2R60A 1RPAA 3S55A 3WP0A 5AJYA 3MR3A 1T13A 4KTVE 1FNSA 2BZSA 4M8SA 3DWEX 1J2RA 3W8NA 1HORA 4R83A 2W03A 2Q1TA 5HIMA 5B3KA 3QLTA 1W4LA 3H1GA 4LTNA 8ICOA 2CSUA 4PYLA 1ES9A 2PLRA 4EBDA 2IHYA 4RCYA 3RJIA 5J58A 3IIMA 4ZHSA 5JO9A 1EA5A 3RIYA 4DLSA 4HB2A 4ELVA 2R8IA 5BN4B 4KU4A 3TZEA 1B23P 3LOPA 7ICRA 5EXPA 1S9DA 1U2DA 4H9GA 4KR9A 2X0DA 4E5DA 3RVOA 2VQSA 4EI7A 3G2PA 4U2GA 3DO8A 4EPXA 1Z7GA 1G5RA 3WLMA 1QBGA 3G2MA 2X9NA 4Q8FA 1NKCA 3ONWA 5CT9A 1EM8B 2ASDA 2W2KA 3EVFA 1CHDA 2VAPA 4Q93A 4UU7A 1E18A 3RU7A 4D9IA 3MWKA 2WM9B 2C7GA 2Q0QA 5AOCA 2JASA 1MTZA 5CUQA 3EZGA 3DONA 1LLFA 1G7TA 3CR8A 3UZUA 1Z3CA 4QGBA 4DSEA 2GH1A 3KVNA 2HK8A 1HYEA 4PO1A 3COWA 4CLXA 1Y82A 3GXBA 1Y34E 2J9GA 4KRYA 4QOFA 2YVKA 3VR5A 3KJZA 2MYTA 3GLIE 4JWNA 1N6PA 1X77A 3PUKA 5BMOA 5LIRA 2HU7A 2IIQA 1UPUA 1XYYA 2WKPA 3W5SA 1LSJA 4MV5A 2AJQA 1EJ2A 1UANA 3WGUA 1CEYA 1P6UA 2Z5GA 4FO6A 4MIYA 4EPRA 2EZTA 3NIWA 1EPUA 3PUWA 1JNYA 4OJ5A 1UDRA 4AIIA 3G7UA 4KMOA 1KDYA 4YO7A 3VJRA 1JFFB 1IJBA 4QJIA 3AF2A 2Q3HA 4URXR 1GNTA 1WEHA 5BOSB 2AHRA 4MLDA 2ZTVA 1FTGA 4RTSA 2AUMA 3L7MA 4EK9A 2BEVA 1C29B 3CS3A 4DRXB 5MGNA 3EEIA 3SHFA 2XRMA 4QWEA 1D2MA 4KXNA 3GZNB 1CIPA 2R66A 4EG8A 5JUMA 1JXAA 3CXRA 2J09A 3JAMA 1UBGA 4I7EA 1BH2A 3ME5A 2IU0A 1FX0B 1ZOOA 5AD1A 2WJIA 4BU0A 4F5WA 3V34A 5KG6A 4NJOA 4G9GA 1H8ED 3L41A 3T5MA 1P0FA 2K4MA 1X7ZB 2OPBA 2C7PA 1XVVA 1KI7A 4IRXA 2B7LA 3PLAE 1GGKA 4G4SP 3P2IA 3E5HA 1SBCA 2ZSFA 3EC7A 2PLWA 1XQXA 4ND7A 2JD2A 4NV1A 4F8EA 2IQ5A 5AHKA 3T1VA 3W6ZA 2EWVA 3V7JA 1CDZA 1RJWA 1DO2A 1MDFA 2R8KA 4DCVA 2XY7A 1RAIA 4QZFA 1QZXA 2WJYA 3KJNA 3NBUA 3IDQA 1TAMA 4B5LA 3T4EA 1L6IA 4MVJD 2NZ8A 5BSHA 1N4AA 4QIWF 4EHBA 3V1YA 2Q49A 2EEZA 2Q3JA 5L3QB 3U4GA 4XYEA 4CLRB 3T95A 3D9QX 3X43A 5AK5A 3S2GA 5KFSA 4FMCF 3UUFA 5CXXA 2AN4A 2J6SA 2BY4A 3K0AB 3KHGA 3HDGA 4MCHA 1F9EA 4OMFG 4E70A 1FYDA 5DKFA 1O0BA 4IVNA 2R6JA 5KJEA 3H4TA 1XQVA 3H7AA 1Q1BA 2O57A 1JIHA 3IEIA 1V2GA 3KX2A 4GI3A 5IDVA 1VXOA 1KYWA 1WHTB 1EJ6A 4KR0A 1DIOB 1I7PA 2ESRA 4HGPA 5IX8A 5JV5A 4E4RA 4DCMA 2GFIA 3HY3A 1MQAA 5FNZA 4C04A 4HLDA 4D0NA 1GARA 3T7SA 3DPSA 2WR8A 3T54A 2XMDA 5K8CA 1F0MA 3GWGA 4KLGA 4HD8A 3LM8A 3C2KA 3SCZA 1ZUIA 2DU8A 3V6JA 2BLLA 3A1WA 4AZSA 3DVLA 3UHJA 3VSCA 7ICNA 1Z15A 4NOLA 4JGGA 4O2AF 4E0BA 2JGAA 5JOQA 4Q4DA 1QVZA 4JOCA 1AGNA 2EQ5A 4JDPA 5CTAA 4E15A 1T9ZA 2DCMA 1VMEA 1RCFA 4OK3A 3FRJA 1LV7A 4FDUA 3ZIAA 2OT3B 2YZ7A 1RXCA 2B4QA 2YWXA 1FXWA 2GBLC 4XPIB 4GU5A 4NBVA 2QRNA 1LLDA 4EI8A 2R3SA 2GA9A 1KEZA 3VU1A 3DKKA 3II6X 3R24A 4LZGA 2YVAA 4KFCA 4KUGA 2WWHA 1VIAA 1AH2A 3CNBA 2P3OA 4WKGA 2QWXA 5CCBA 5LA6F 3AI7A 1R0ZA 2QP3A 1V9SA 4HMOA 3OTWA 4RQTA 3P9CA 1E20A 1YBVA 1R9GA 4K2HA 5EJGA 2ODTX 1GGNA 9LDTA 3DUFB 3IJRA 2V3CC 4H7DA 4KLTA 5JIBA 1TLFA 1X7WB 1U28A 1VCOA 2D1FA 2Q5OA 1WPGA 5IK2D 5E1DA 3WRXC 4CM1A 4PC2A 4CKCA 4LA4A 4D3DA 2FSVC 1PX0A 1HKHA 4M0PA 3G1UA 1WWUA 2FPSA 1MGPA 1BPBA 1OY1A 1RM0A 2OHIA 4ZXFA 3HA3A 1VMDA 5BSKA 2VJ4A 2X76A 5CFPA 3W3AA 4LRSB 3T1TA 2OVFA 4WJKB 3GU3A 2PKWA 1IPEA 4CG3A 1RRMA 1NJ2A 4UCWA 5EXSA 2ZRIA 4AN1A 5TVKA 1VE9A 2Q0XA 5DHTA 3E1SA 2F8TA 2CLHB 3V1NA 1JEYB 5HE8A 1EEHA 3WGZA 4DABA 5DLFA 1FDUA 4G26A 1XZJA 3U61B 1WA5A 4BLTA 1TU0A 2OP0A 3M2TA 4CVNA 3BKXA 5J2TF 3ZPXA 3HT3A 1X1TA 3AMZA 2QL7A 1TZJA 3G7SA 3MRTA 3PUXA 4X3OA 4UVEA 3BQMB 1OA1A 3QNUA 1NVWQ 4MB0A 1Z56C 3F6YA 3K9LA 1Z34A 3L7IA 2P8JA 2B0CA 5IS2A 2GKSA 1VP9A 3N75A 5ICEA 3K0BA 1BVUA 1JHUA 2VJMA 3GLVA 3IBTA 2G09A 2XVMA 2B4TO 3DFFA 1TKRA 3GNSA 2QSUA 3CB2A 3OJCA 4BDPA 4P81A 4AUNA 4B6SA 4CLDA 5JZ9A 5ABPA 4OOFA 5DHUA 2P77A 1YWGO 2ARKA 4IXTA 4F3NA 2IPLA 2W8BA 2BRUA 4B9MA 5BN5A 4MARA 4NH0A 3MINA 5KKAA 1H2ZA 2H5IA 3R8CA 4MWCA 5D5QA 4LRXA 3QFFA 1SXJB 3AHEA 3ICXA 1Q6YA 2W9BB 3H5OA 1OA0A 5IDXA 2VYFA 2ZE8A 1G1AA 2Y77A 7ICPA 3LZCA 2HEGA 4N5NA 4P5PA 4UNRA 3AVPA 4C30A 5LQMA 4LCEA 4G8BA 2XNCA 2F76X 3EX7C 4BFVA 1QIMA 5FAKA 4J29A 5G0WA 3V7KA 1BPZA 3FCYA 1VJCA 3MERA 1FE8A 3RNOA 4MP8A 4DL5A 4OTZA 1IIRA 1VFNA 4ZO4A 2XWPA 1PSDA 2H2IA 3P4YA 4EENA 1CTQA 1H6AA 5A0FA 3KOZA 4YY3B 5CGQB 3RT9A 4O3PA 1ZAYA 1Z4LA 1KFEB 2HHHB 3PPXA 2N1BA 2FUNB 1D5CA 3K1RB 2BKLA 4FT2A 5B1EA 2EDUA 2MTBA 3VZDA 4RW0A 1QS0B 2J45A 3F74A 5J2UF 2VAVA 3BCSA 3LHKA 5EIWA 4CIBA 4IMJB 4AWXA 4RHCA 4G56A 5I4IA 1Q0TA 3CGGA 4CQLA 1H2HA 4C06A 3F2VA 5BSUA 2NO0A 7ICTA 4HYTA 1YE3A 3DDCA 1UBNA 4EHDA 2C7BA 3K96A 4MKRA 1JLHA 4BXOA 4KACA 5K45A 3OHPA 4K81B 2DBYA 5LFAA 3RYFA 4OQQA 3LLUA 3EAQA 3OKCA 1KNQA 3GOQA 1A95A 3ANTA 3ZKAA 2XDQB 1TO2E 1SBYA 3AUSA 4BB9A 2IF2A 3ZIDA 4R8KA 4WGFA 1XCMA 3FOEC 2VP4A 1DE0A 2OCIA 5TF0A 4G0MA 4RNOA 3HDTA 3M34A 3QVKA 2OB1A 4OF4A 3TOZA 1PJQA 2O6HA 4RWZA 3CH5A 3FSGD 3DZIA 2H2FA 2I3GA 4FZLA 1MN8A 1HFEL 3OM9A 4PW0A 4WWHA 3Q3HA 4DO9A 1KOGA 4NARA 2IUSA 5FPKA 3DTYA 2O2SA 2PYIA 1CZOA 2ODAA 3WSTA 2IOFK 1WUTA 4K9SA 4PGXA 2VDRB 4Z9YA 1AKWA 1A8SA 2NU7B 2M6SA 3CLRC 4MAFA 1SUBA 2FU5C 2Q1SA 2DUWA 1RYYA 3HJHA 4CF6A 3PW2A 1KEEB 1M72A 4FHZA 4A0FA 1PVDA 1TF5A 3JQ7A 1UXJA 5G1NA 1W2GA 3W9BA 4ARIA 4FFDA 2X86A 3Q5GA 5L7YA 2AJLI 4HYKA 2DQ4A 4EECA 1ZG3A 4MYCA 4R41A 2GVNA 1VDMA 3CLSC 3FLBA 4Q12A 4Q48A 3PHBE 1I7LA 3N0RA 4JGBA 3FAKA 4B7ZA 1FC0A 2SKDA 4YRCA 2JEIA 1S6YA 4M0EA 3VHRA 3VYTB 2R6GA 1WHSB 1U47A 4IH4A 3IXQA 1M2JA 3NMUF 4CHTA 2CYAA 4GXRA 2R8EA 1V9PA 3B6KA 4KTQA 1AMOA 1GITA 3CUTA 3TARA 2OYCA 3UOWA 3PD7A 4RFSA 4QXRA 5KYWB 1J2EA 1MQSA 3KEOA 3BFKA 4IXMA 4R01A 1GQFA 2YTUA 3HWRA 3KSRA 2ZSAA 3TLCA 1SKAA 2JLCA 2Y0BA 3MFIA 4AQDA 4JXJA 1F48A 3ICEA 2OXTA 3LCJA 4LMBA 1II8B 1TJ4A 1ZN2A 1F60A 4ZJUA 1W87A 3M49A 1PSZA 1A71A 2BMDA 4GC9A 2XMCA 1OU0A 4DADA 5FWAA 1E1KA 1KYIA 3GCWA 1YULA 4H0FA 3HYSA 4BZQA 1MB4A 3KC2A 3IQWA 1CW2B 1M2OA 3GCDA 5IMBA 1GYPA 4MA5A 2E1PA 5F2OA 3IPLA 4OUDA 1XZCA 5E4TA 1ZOIA 2G5CA 1OC4A 1YA6A 1XR3A 2RHJA 3NWBA 4JLWA 4TXJA 2Z09A 2WICA 3CW2A 4DB2A 4I9FA 2HHWA 4PZZA 1H5NA 1R4ZA 5HR5A 3INRA 4G2TA 2Q7DA 4AY2A 4MW0A 3BTVA 4CUJA 4JWMA 4D26A 2CNWD 1Z0IA 4D44A 4M9UA 2FW9A 4LHSA 4PHAA 4PX5A 1SVSA 3REQB 1TGYA 5AHWA 2FSGA 1D4OA 2PT9A 3A58B 2QTLA 2QS9A 3GJXC 2QQGA 5K3AA 3K1YA 3MTEA 2FGJA 4AXXA 2W0MA 3GLHE 3Q6MA 3EUAA 3FM9A 3ENWA 2J1LA 1KMCA 2PIAA 4UDYX 2A6PA 3T3FA 4LW8A 3FSJX 5E79U 4KN6A 2AYZA 3RJTA 3A6ZA 4ZWNA 2O8CB 1KYZA 2QNRA 4W7SA 2E3JA 3JQBC 3BXOA 3L3FX 3IXMA 2ZSUA 1KZ4A 2CMHA 2ZBGA 1TVCA 2C5SA 1CLEA 4HX5A 5AOAA 5B2ZA 1DOZA 1ZD3A 4JVOA 2G82A 3FB4A 4CM3A 1MX9A 5BPCA 5IAJA 1RKBA 3IIKA 2J3QA 5EI5A 1Z4MA 4LC9A 4X7PA 5F5NA 3ISJA 4GVXA 2XDAA 2R00A 4M0LA 2ZIAA 5B1YA 3UFXB 1WBBA 5M5BA 3TIGA 3ETNA 4F1JA 1FQJA 3ZGZA 4KK4A 2BJVA 3BILA 4L8LA 2B1RA 3KWLA 1CVRA 3TW4A 1S76D 1X1AA 3TBHA 1QHGA 5GTDA 2Q1YA 3DULA 4LNUA 2V4UA 3CRNA 3N58A 3WMGA 3E22B 3K9CA 2JFVA 1DLIA 1MAAA 1U28C 3OOJA 3U5ZB 1AV7A 3WA7A 1AO3A 1ZDMA 2JAXA 4YIKA 4A8JA 2W00A 4LPSA 1EHYA 2JJ1D 3MS2A 4KZKA 2QAGB 1L5NA 2EFCB 2G4CA 3F47A 3M82A 2Q5LA 4KLIA 1O03A 4OO3A 3IAUA 2WJZB 2RH9B 3TG2A 4KN5A 3DE1X 3KVOA 1JG1A 4LYDA 3ADOA 1CK4A 2LYAA 1CDDA 1DHRA 2NRXA 1FU8A 3FNGA 3PUVA 2WJHA 2YICA 4IQTA 4ZCTA 4FMPA 3RUCA 3DOCA 1ONOA 3OCXA 4XGQA 4KYUA 2GPWA 5BOLA 3KKAC 3H05A 5HTKA 3WLFA 3EIUA 3PTLA 4N39A 2I2WA 3ZWDA 4F50A 2XH8A 3IESA 2QZ4A 4CMIA 4LJ8A 3W2TA 2X8WA 1OFVA 3TUJC 2DWUA 4QUGA 2IS1A 1JQBA 5KFWA 4BOYA 1GXSB 5JARA 2JV3A 2Q8NA 1D8AA 2P6PA 1Q1GA 1E7QA 5K20A 1S10A 3Q12A 2GI4A 4AKTA 3C87A 1G0NA 2RB4A 1SVMA 3W4KA 3RQSA 3RYHB 4X6LA 1TEVA 8ICTA 4QW9A 1DBVO 5AK0A 4TUYA 3KTAB 4UHKA 5A0LA 3DOFA 1Y6QA 3NC0C 1NTOA 3TKYA 4DV5B 2N1RA 1OPXA 2TECE 4WZBE 3RHZA 3JAWB 2ZRLA 3M6MD 2JJYA 4GVLA 3EXIB 3IVMA 3PQ3A 3IAEA 3EQ8A 4PZAA 4QWMA 1K5DA 2WJ3A 3WJAA 4FMBB 3W77A 3UTDA 2ZKLA 3VCBA 3K9NA 4YLEA 1W88B 1MP0A 4CLEA 1DQPA 4EARA 1D0IA 1ZESA 2GDZA 2NU8B 3PRYA 4LK3A 2CWWA 1DINA 3N2ZB 3HR4A 3BF8A 1G9TA 1JIKA 4EYIB 1OXUA 3DHVA 4TSFA 3TADA 1XG5A 2ZI6A 4FKMA 4DLBA 5LZ5A 3B6EA 5U4XA 1U8EA 3MJVA 4YACA 5F77A 1P31A 4RQUA 8ABPA 3E3AA 3UJ9A 4WVFA 4BDSA 2AE1A 1NXVA 4FGWA 2FP4B 2JGIA 4P83A 1QH8A 4GZ3A 2ZZNA 3PICA 2EF1A 3BHIA 2PA3A 2CLOB 1AQUA 2AGVA 2FNAA 1ZQLA 2W6QA 3NWOA 3OUUA 4BNGA 4HATA 5SY6A 2QP9X 2GEKA 2OBMA 4UMEA 4U9UA 1NR1A 4PLHA 1U3GA 4BY9E 3P97A 1ITZA 2YQZA 4E2YA 1YMVA 5E3JA 1W49A 2TMKA 4CFYA 2H6EA 4OQEA 3ELYA 1Z8FA 3LDHA 4I1YA 2QY9A 1N36B 4RUKA 4DR7B 2NT4A 4WOCA 4DARA 1Q77A 4CXMA 3WKDA 3S44A 2ZTDA 1NUSA 4Q9NA 4BFLA 1PG2A 2TMYA 4MWZA 4YJ3F 3EXFA 3WBBA 1MHPA 4ALIA 2P2YA 4HNVA 1EE9A 3LKDA 3N0WA 3VDMA 1EVZA 2IP1A 1RVV1 2ZJFA 4KO4S 4UHBA 4PGYA 2WSMA 3EDOA 4DJDC 3GUYA 5BR8B 4NSNA 2APJA 5DCUA 2Z30A 4NLZA 1XJ0A 3OIUA 4S05A 2RG1A 8GPBA 4QXAA 2OB2A 2RG7A 4XD7D 2O3TA 3OT5A 4XIIA 1D07A 1FDRA 3GYBA 3INNA 3NIDB 2PAAA 2WWVD 2P6OA 2WJVA 3LGSA 1H0RA 2G67A 2QTFA 4GEGA 1J9EA 5CB6A 2K8AA 1ABBA 4OJPA 5DYYA 1JMVA 3RYTC 4TL9A 4HLUA 1VBMA 2DUMA 3CRRA 1GZSA 3HEBA 2I65A 2AMYA 4HAIA 2YDXA 5DG8A 3ZE2B 1UZMA 3QENA 3U4AA 2XUDA 2YFQA 1I4TD 1P77A 2FXIA 4ECWA 3R7DA 2B8TA 3CX7A 4O3NA 1FXUA 2CCKA 1F0NA 2EZ4A 5HFJA 2Q9UA 3GDHA 2OKGA 3QX7A 1P1FA 3GEEA 1XLUA 1IY1A 5A05A 1RQ2A 3OJ0A 3H8MA 4I4CA 1ORHA 3TI0A 3LX6A 2AQ8A 3WMRA 5FV4A 3L0CA 1KI9A 5KTRA 3GROA 4YJHB 2DX7A 2QYSA 4ABTA 7ICEA 1S2OA 4B4VA 3I9NA 3NBAA 4ENRA 3TTXA 2ZUFA 1G63A 5AIBA 1P74A 4PYNA 1ZR4A 4DIKA 4RVFA 4BLUA 3ZXXA 2H59A 2VSYA 4OL9A 2OQ2A 3GEGA 5LZ4A 4IIBA 3X1JA 2B8NA 4JYCA 4YAIA 1IFXA 2J7PA 3HJFA 4V0MA 2YS7A 1FP4A 3UJBA 1W85A 2CLSA 4EG3A 1U3VA 4WKCA 3BULA 1Y88A 3F1LA 4W5WA 5FBKA 4R1SA 1R6XA 3WLPA 3IB6A 2Y3IA 5C8YB 4OBEA 3RC8A 3PGLA 5TNXA 1U0FA 4YRBA 2R8HA 4AMUA 3EE6A 1YL7A 2G72A 1JFTA 2RGNA 5FWYB 2QLTA 4RPZA 4TQSA 3BTOA 2XB2A 2RGXA 2JCSA 1URJA 1IXRA 1T2AA 1EM6A 4Y2YA 3G6XA 4E5YA 3QIVA 2AR7A 3N0TA 3PI6A 4WOJA 4P4SA 3MGCA 2JKZA 2F43B 3R3XA 2GJ8A 4PG4A 4IIJF 1X1EA 3LT1A 1KI4A 1FRZA 2R79A 4LYHA 1PJ4A 3UMYA 5HS4A 4YRLA 6REQA 4GBMA 4BHTA 2JKYA 3F98A 4P2HA 4I14A 1UBLS 1T2DA 2F00A 1BOOA 1YS6A 2VF2A 3P9PA 2CHUA 2A8YA 1L5LA 5LP6C 4DCTA 16PKA 5JNVA 3ZK8A 1BDJA 3V1TC 3LRXA 1GPYA 1CUGA 4L8VA 1TQ4A 4UBKA 5FOUA 3AM9A 1TZKA 4KQ2A 1O95A 1BMFA 1G64A 1JG3A 1GSOA 4C0ZA 4B09A 4CIWA 3S1SA 3WBKA 3TACB 1NJSA 1CR4A 3WYFA 4GS5A 1L9KA 2NZVG 1WSDA 3CW8X 1I1NA 1J2TA 1ADCA 3KB2A 2AGPA 4JV5B 4DYHA 1DRUA 1GD1O 1P6XA 1T5OA 1UBOS 4DBLE 1U7PA 5JMTA 3C1ZA 1ZXBA 2AUNA 4HH1A 3K70D 3VZQA 4DDVA 4E3ZA 1FSPA 2JLYA 1M5UA 1DMSA 2FRDC 2DT5A 3QF7A 5PNTA 3QU9A 1G3UA 1CP3A 3NHPA 3T5BA 4H7IA 4IRKA 4XQ0A 3K1ZA 1ZD4A 1OT5A 1OMOA 3BSYA 2C04A 4I5GA 1Y63A 4EZBA 4N01A 4TQAA 1U4NA 1QKJA 3PNVA 3UM9A 4U7DA 1LFAA 4QOIA 3VYRB 2GZSA 1JT2A 4NCJA 4M1SA 2VLBA 3E15A 5AUQA 2Y99A 3CWCA 4Q4AB 3VO8A 2P9YA 2WYOA 5GV8A 2C1ZA 5AVWA 5EKTA 1UDAA 4E22A 5HKKD 1NK9A 2X0NA 2WJWA 4FOSA 1FFUA 4U2CA 3ZR4B 5DK4A 1IBCA 2OG2A 2QUKA 2JIDA 2Z58A 4ZK2A 3DAFA 4RKWA 3CF2A 1VBKA 5J29A 2I22A 3OIVA 4C7OB 1R0LA 3LK6A 1IBRA 3GZ4A 4BEJA 5AM1A 1PFUA 3V7NA 3RJGA 1P2UA 4BCDA 4PAOA 5LZ2A 4I5DA 4WN9B 4FI3F 1K86A 1U48A 1WXHA 4FYMA 3OTIA 4LDQA 2VYCA 2WAOA 3RJHA 4OFWA 1EFHA 1M1NA 3P1JA 2JMGA 2NZUG 2VBCA 1R0RE 2PE5A 5TV2A 4ABYA 5B36A 5ALDA 3MJRA 3N8GA 2BAGA 4RJJA 4C2TA 4D4KA 3FFAA 4HNGA 1GGVA 5JS6A 3P9RA 4TKZA 1FFBA 2Q1XA 4YUVA 3WK4A 1J06A 3E0XA 3M9XA 3EISA 1XDWA 5A2GA 2QTWB 5K6RA 1EHIA 4Q4JB 2DG2A 5T8KC 1ECPA 4RULA 4OLFA 4JJ4A 4CCWA 4EG1A 4UDXX 2WG1A 4DS5A 1EUCB 1AV6A 1MXHA 1YGPA 4HEA6 5CU7A 2A9FA 2XI9A 3TRIA 4HDAA 2LW7A 1C8KA 4XB2A 3QLJA 1PL0A 3NONA 3O4JA 5A7GA 3IVRA 1L7DA 1K1EA 3STWA 2E8MA 1XYVA 1SCIA 5CX1A 3TEFA 1U2QA 2AOUB 1JLLA 3GEBA 1Y33E 1WLYA 3GP5A 4EY8A 2FWIA 2C97A 2NQTA 4B9NA 3FGPA 5FBQB 1LK5A 3A6LA 1Q3TA 3RR8A 1DLJA 3ND6A 4HB0A 3CG4A 3LRTA 2V1UA 5CYOA 1JB9A 2AXEA 4UBJA 3MJFA 2E4YA 2DPJA 2AQ0A 4M87A 5EKUA 3IQGX 3TADC 3IQIX 5BN3A 1RJEA 3PJFA 4YCNA 3E9ZA 4OAOA 1TM4E 2J5RA 3BWYA 3IQHX 1KSJA 1JN3A 2XNSA 1KKXA 3RTBA 2QI9C 4U2KA 2HBYA 5JE8A 3QVXA 4EPVA 2DHRA 5SYNA 2C84A 1W9HA 4DJEC 2XGMA 1P8AA 3BORA 1WZCA 3T3EA 1IVYA 2DQSA 1V6SA 4JC4A 4R2XA 3EQ9A 4W8OA 3H9EO 4YHBA 2OLJA 4H31A 3KT0A 4FBUA</