3QUTA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 82
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qutA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qutA01
4E88A 4KNVA 5ALSA 5ALKA 1Z4IA 3AR6A 3QXGA 1RC8A 5AVYA 4CF5A 1RMQA 1YMQA 2CFSA 1Q92A 3E81A 2P69A 2HEGA 2JAUA 1RQLA 1L8OA 3N8GA 3SKXA 1EK2A 3QU9A 2JGAA 1VJ5A 2B8EA 5ALDA 2B82A 2FEAA 3FGOA 1QH9A 2VKQA 4IFTA 2NO4A 3QU4A 1NNLA 1K1EA 5AW0A 3ZTYA 1LVHA 5AKZA 3SHQA 1L7NA 5ALWA 5E0OA 3L8GA 3N07A 5ALVA 1L7MA 5ALIA 4L57A 3A1DA 3R4CA 5AW7A 4G63A 4EELA 2CN1A 3DV9A 5AVWA 2IOFA 4Y2YA 3A3YA 3SF0A 1ZJJA 1N8NA 3E8MA 4KNWA 4CF3A 2EARA 2P11A 3L8HA 2G08A 3NAMA 5IT4A 5AICA 2O2XA 1Z5GA 3MPOA 1ZRNA 4YH1A 2W4MA 1Z4LA 2OBBA 2ODAA 5AI6A 1TE2A 3WK6A 3DNPA 2ZOSA 2GO7A 3L7YA 3CZ4A 5AI0A 1AQ6A 4O8CA 3WGUA 4QJBA 3IJ5A 1MH9A 2C8LA 3IB6A 1L7OA 4YCNA 3WKAA 2WF7A 1J8DA 3WK5A 4Y3UA 2RB5A 1TJ3A 1RKUA 3WK7A 1S8OA 2IOFK 3FZQA 2YN4A 4Y2UA 2YBDA 5ALJA 3MC1A 4CNQA 2YMPA 2R8ZA 4BBJA 2FUCA 2B8JA 3WK4A 5ALYA 5AI9A 2C88A 2EAUA 4F71A 3N5KA 1IWOA 4CF4A 1Z4KA 2HCFA 3QLEA 3OCWA 2MU2A 4UU0A 4OFZA 4UMDA 1Z88A 2PQ0A 2MSNA 3QU7A 1ZD2P 2YJ6A 2FUEA 1SWVA 5ALMA 3L8EA 4PNHA 4HGQA 4BKMA 2P27A 4NAVA 3QUCA 4DFDA 5AVQA 4NFLA 1Z4JA 5A3QA 1ZD4A 1U2SA 2B0CA 5AM2A 3EWIA 3N1UA 4NABA 3BA6A 1TJ5A 3L0BA 1O03A 2O9JA 2X4DA 1O08A 4Y2JA 2G06A 3AR2A 1Z4OA 2FDRA 2WFAA 5ALOA 2FPWA 4BNDB 3WK8A 4BEVA 4OHFA 2B30A 4KYTA 3QUTA 2G1AA 4MWOA 3KDPA 3ONNA 1XVIA 3AR7A 1ZD3A 2I6XA 2Q4RA 2AH5A 1SU4A 3ZVNA 3HYCA 2I33A 2YMQA 2AGVA 4UMEA 5ALFA 3QUBA 2HSZA 3U13A 4BNDA 4HYTA 3AR5A 5AIBA 1RDFA 4B6JA 3OCXA 1ZD5A 4CE6A 4C4SA 3NRJA 5AKGA 4ZEWA 5AI5A 2WF5A 5ALXA 1RMYA 3OCZA 3AR4A 5ALZA 4KX3A 3ZVMA 3SD7A 5ALRA 4FE3A 5AM0A 3KOOA 1KYTA 3WKBA 3IRUA 3ESRA 3W5BA 2RAVA 1J97A 3I28A 2B1RA 3QGMA 1F5SA 5AKHA 4YGYA 3ESQA 1LTQA 3KC2A 2AMYA 1NRWA 4HGNA 2WF6A 2GFHA 5AI8A 5AVSA 3BWVA 4FFDA 3UM9A 2DQSA 4EEKA 4Y2VA 1EK1A 4BYGA 4QQFA 2HF2A 3NASA 4DWOA 1SWWA 3DAOA 1N9KA 3SKYA 3K1ZA 3WK9A 1QYIA 2R8YA 3ZVLA 4L6CA 4NWIA 1Z5UA 3CNHA 3UMBA 3AR8A 3J7TA 2D2VA 1U2TA 5AVRA 3B9BA 1L6RA 3NUQA 3I76A 3D6JA 3OTQA 5AIAA 2HHLA 3PDWA 2GMWA 2PKEA 3QX7A 2CFTA 4HGPA 3RF6A 2HOQA 3MN1A 4GXTA 4UMFA 5JJBA 3W5CA 2WF8A 4KN8A 4UW9A 1PW5A 4ZEVA 3QYPA 1VJRA 3M9LA 3HLTA 3E58A 4L6AA 1WZCA 1FEZA 3AR9A 2WHEA 5FP0A 2I34A 4AS3A 4ZEXA 2NO5A 3R9KA 2I7DA 3I6BA 3A1CA 4XOUA 4BX3A 5AVUA 3WKDA 5AKXA 1RLMA 5ALTA 1NF2A 2GHQA 2G0AA 3TLMA 2G09A 3ZU6A 3FVVA 2ZG6A 3R09A 3FPBA 2WF9A 1Z4PX 4XPZA 2IA5A 4MUMA 2JARA 3EPRA 4YCLA 2OA0A 4BEWA 2G07A 3F9RA 5AW2A 3B8EA 1RKQA 3KD3A 5ALQA 4F72A 3NANA 4Y2PA 3QNMA 1T5SA 1YV9A 4AS2A 4Y2RA 3ZUPA 2NYVA 3L1VA 3P96A 5AVZA 3W5DA 4I9GA 1Y8AA 2C8KA 5AW5A 5AK4A 3RFUA 1RMTA 3U7FB 2R8XA 3A1EA 4UAUA 2R8EA 3SLRA 1TA0A 3ZI4A 4HAIA 1JUDA 2HI0A 3ZW7A 3I1YA 5A3SA 3QU5A 4C4TA 1RRCA 1WR8A 4UMVA 3U19A 4UM5A 1T5TA 3L8FA 5AW8A 1XPJA 4HGRA 5AKEA 4J2TA 3ZX5A 5AKLA 4IG4A 4G9BA 2P9JA 5ALNA 1WVIA 4UATA 2YFYA 1XP5A 3WKEA 1U7PA 1RPZA 4FYPA 5AM3A 1RLTA 4UARA 5AKJA 5T41A 5ALUA 3E84A 4I9FA 1RLOA 4Y2XA 1WPGA 4KX5A 2OYCA 2C9MA 5ALPA 3AR3A 1Z4NA 5AK5A 2IYEA 4J03A 5AVXA 2YMMA 1QQ7A 3U26A 1QQ5A 2HO4A 3L5KA 5AKIA 4UU1A 2FPSA 3U7HB 2JAWA 4Y2QA 1ZS9A 4EX6A 4BX0A 2BDEA 3SMVA 4XE5A 3S6JA 5ALLA 3PGLA 4EX7A 4RETA 3ZTWA 3L1UA 1YNSA 4YIHA 3NIWA 5AM4A 4GIBA 3L0CA 4DCCA 2FPUA 3UMCA 2ZBFA 4H1WA 4C4RA 4EZEA 3KBBA 2ZBEA 4JDPA 3ZWKA 1CQZA 1S2OA 2EATA 1ZRMA 1Q91A 3OCUA 5AW4A 3NALA 1TJ4A 5AW3A 5AM5A 2WM8A 2MU1A 3OPXA 2W43A 3M1YA 3ZWDA 5IS2A 3N28A 2BY4A 5AK3A 5AK6A 1L7PA 2Q5EA 2RBKA 2ZBGA 1U7OA 2ZXEA 3ET5A 2YMLA 5AM1A 4YCMA 1ZOLA 2ZBDA 3WKCA 3FM9A 4OCZA 2FPRA 4NV0A 4RESA 1T9ZA 4UAVA 1RKVA 4YIKA 2FI1A 1VFPA 4OD0A 2C4NA 1QQ6A 1L8LA 2FPXA 1X42A 5AESA 3GYGA 3EF1A 2CFRA 5ALEA 2Q4TA 2AUTA 2BDUA 4XQ0A 4HGOA 2QYHA 3QUQA 3B9RA 2GHTA 2JAOA 2YJ4A 5AVTA 2YJ3A 4Y2SA 2W11A 2G80A 3W5AA 5AW1A 1Z4QA 5AKKA 3FPSA 3DDHA 1U02A 5AW9A 5ALHA 2I54A 3KZXA 1Z4MA 3OCVA 3PGVA 3ET4A 2HDOA 5AI4A 2I55A 4UM7A 4UASA 5AW6A 5IT0A 5AHXA 1YS9A 1YJ5A 5A3RA 3ZX4A 3WGVA 3UMGA 2QLTA 4JB3A 3EF0A 3PCTA 3QU2A 5AVVA 1CR6A 2HF7A 3OCYA 3VAYA 3U7EB 2HX1A 2YY6A 3MMZA 4BX2A 5AKYA 4EENA 4AP9A 3U7GA 1YDFA 2OM6A 5ALGA 2RARA 3L0YA 1RQNA 2IOHA 3ED5A 2B1QA 2YJ5A 4DW8A 2PR7A 4Y2TA
chains in the Genus database with same CATH superfamily
3ZHOA 3FJ1A 1RC8A 1PNVA 1GZ5A 3HKCA 4F6CA 5CNMA 2AEJA 5G1OA 2P9TA 3KTOA 2TRSB 2TMDA 3PB3A 3SFVA 3Q3VA 4CMIA 4GI1A 1NDHA 1NYRA 4A73A 3SHOA 1LV5A 5ALIA 4L95C 2JIOA 2K6GA 4M04A 2P5YA 1SCNE 1XAJA 1XPOA 2OXTA 3A4IA 1ZMBA 3G8BA 4Q12A 3M6MD 5G4KB 5CU7A 4IFBA 3MPOA 2O8FA 5REQB 3AF0A 9ICNA 4CM4B 2GXUA 1X8JA 3USZA 5KINB 2N42A 2CXOA 3T52A 4G25A 5CX1B 1VSQA 2GN2A 3H75A 4IDPA 2IOFK 1BZYA 4QDUA 4DCSA 3DEKA 4RVUA 4QICA 5FLXA 4NYMR 2Y1OA 4AZSA 1OBVA 2DVMA 4L5IA 2WD8A 4IQ4A 1Z82A 2HH9A 2XRZA 4KBGA 4L4RA 5KIAA 3N7AA 3RVDA 4UOZA 4IILA 5IDVA 2ZAGA 3GGJA 1QH1A 2OO7A 5E4TA 1K3UB 1FS6A 3Q7TA 2XBLA 4ETIA 4FYMA 4OK6A 2MMGA 3U7JA 5D00A 4R65A 1BJTA 3C7DB 4IVNA 2RHLA 5LQCA 4JWNA 2GQ0A 4D4MA 2XVXA 2I6XA 2QU7A 4L3OA 4QL3A 2B98A 3NONA 2B7CA 4X3CA 1Y8CA 5SY9A 1O4VA 2DUYA 4DRYA 2GEUA 3LWNA 2Q3CA 8ADHA 3C6MA 2G8LA 4BLQA 4U3JB 1N0WA 4TKUA 4NXZA 1DX9A 4Z7OB 3L1JA 1JLLB 4X45A 3O0DA 1M0EA 3R9XA 3IKVA 4N8DA 2IV2X 3OM9A 4O3SA 1J97A 5BYAA 1CI4A 2VYQA 3HN2A 4GYYA 3WIEA 3A58B 4D96A 3SLGA 2O1EA 3SOPA 1IXRC 4LG1A 2A78A 4I9UA 2AOUB 1SXJE 2P9BA 1M0WA 1ANKA 1Q1AA 2WNHA 3TI0A 2VQEB 3WDMA 4IZOA 2XKJE 2IUFA 2PV7A 3U16A 2YIDA 2KOBA 3JR3A 1EX6A 3QEMA 4ZODA 2EOAA 3WBFA 4MUNA 4Q47A 3GD5A 1YFJA 3ZGLA 2JG3A 2K7ZA 1RCUA 3OECA 2OUKA 2GTHA 4BX3A 5AVUA 1BFDA 2YHIB 2C2BA 3SQWA 1D0SA 2GK3A 3FR7A 4S35A 4MV0A 5BSHA 8ICXA 4WADA 3SDBA 3GDWA 5SY4A 3ZH2A 2X2FA 2GCOB 3R5HA 3NKLA 4LHSA 1DXOA 4D98A 4BVGA 4WNIA 3WL5A 3TR5A 2HJRA 3QLUA 2JNWA 1T1IA 3V00A 3EQ9A 3V4VB 1O6ZA 3L7IA 5JEEA 3DWIA 2YUTA 4UDOA 1G0OA 2FPSA 1GQSA 2HN9A 4J9KA 3GFFA 2HW3A 1E58A 4CDNA 3SJZA 2WHPA 2XE8A 1G17A 4I55F 2MU1A 3CSUA 1HLDA 4CL0A 1X40A 2D1RA 4BWYA 2NX2A 4Q7JB 3HJEA 3OE7A 4A7PA 3K72B 3JD1A 2Z5LA 5CTJA 2BCJQ 4PONA 1NK0A 4AD8A 2H4ZA 3B20A 5B58C 3UB2A 1QS0B 2H4JA 2QRPA 3A36A 2WLTA 4JI2B 2ZQYA 1AJEA 5DNEA 4ROSA 1SXGA 4D99A 1OSNA 4FT2A 4ALJA 2VH2A 2NGRA 4RQ7A 4M89A 4CLOA 3PCXA 3ZVKA 1D5CA 1V8FA 4B4VA 2ZI3A 1YB2A 3K71B 2EZZA 3BTUA 4BQPA 3GLHB 1IU9A 2AYZA 5JTUA 4BAGA 1KQQA 1V9CA 4I9HA 2KYRA 2GZHA 1Z8FA 4L5BA 1NI4B 1DO8A 3FD8A 1UK6A 4RLQA 1F48A 4UBKA 5DE3A 2CGEA 3RJFA 2POCA 3HXLA 2O1SA 4NE2A 5D7NA 3FYUA 1G3UA 4C2AA 3V55A 3WLLA 3GZJA 1JNXX 1L3VA 1DZ3A 3FDFA 1N3YA 1MT3A 2QXYA 1OT5A 1TEHA 5ITZA 1US8B 1Z4LA 1P91A 3QUSA 4MA5A 3V8RA 1E2EA 4OBXA 2E1FA 3GFSA 5BSFA 4I5GA 4IDGA 2Y1CA 4RD3A 2RB5A 2IXBA 4GO1A 3TFQA 4BMCA 2O52A 1L4YA 4QU0A 3T1VA 2IBMA 3ZGNA 4D5GA 3V1LA 4IQFA 2VPZA 2HXSA 4DADA 3WR5A 4ECRA 2WILA 5J2FA 3JQGB 3VH4A 1XU9A 4K1LA 1NJXA 4RMIA 1Y7PA 4KGZA 4KVAA 4QOIA 1QNFA 2BEUB 1DTEA 1PL8A 5MGNA 1OKKD 4Y6QA 2W2TA 1HI9A 4BNNA 3SC2B 2NRXA 1DDIA 3QFSA 3TQTA 1O6FA 5KFDA 4AP5A 5CLJA 1JHDA 3U49A 2ZJ0A 4ZJYA 1SHKA 2FP3A 1QK4A 2HHTA 1MB9A 1SY7A 1FTQA 4IF6A 2I80A 1XROA 1Y33E 4DLXA 3JZDA 4LIPD 1BX0A 2V03A 3C21A 2DZDA 2VEDA 3C16C 3VU0A 4J75A 5LZ9A 3ZJYA 2NU8A 2I29A 1X7XA 1SUFA 4DT1A 4JB0A 1W2WB 4HMQA 1OWLA 5J5AA 5CHEA 4QXAA 5BQ5A 2FV8A 1NFRA 4AUNA 3DBRB 1JHYA 1IEVA 5DDMA 1A5BB 3MTGA 3FETA 3T1QA 3QYPA 1S01A 1UZUA 1RAFA 1H9AA 2I1WA 1NMQA 3OC0A 4AS3A 4R2XA 1EEHA 3T7TA 4O2BB 2C5FA 2OK8A 2OFPA 3RJEA 4EYOA 1IXRA 2I7CA 3HE3A 3CF0A 1PHRA 4PO1A 3JVVA 3GJSA 1DIHA 2FOLA 2NYRA 3KZCA 3RFUA 3AEUA 4YP6A 3CX7A 3NJRA 3S8EA 4GBJA 1CZUA 4UAUA 5CWRA 1LY1A 4W5NA 1ADGA 2PMDA 3F96A 4XB1A 4J49A 2E8MA 2PIDA 5HVNA 2FSVC 1PKEA 3A3PA 3JASB 3RBDA 3VMFA 5DF1A 1FF9A 3PHIA 5LR6A 1SCIA 3NTUA 1R00A 1AD2A 1CQJB 3ON5A 3LNTA 3AVWA 1EFPB 1SG9A 2WG1A 3JQ8A 4HX2A 4ZREA 3GGGA 1GCOA 3OZWA 3CWQA 2JFBA 9ICEA 1CFJA 3EFOB 1PV1A 4K6FA 4JXZA 5JZMA 2LR0A 4TYYA 2DPHA 2X13A 1Y1RA 3PX0A 5ES3A 2BEVA 4Q7LA 2P2NA 1YKSA 2W04A 2W8LA 3OZSA 5CM9C 3NS7A 3GLFE 3TJZA 1VFPA 1TF5A 4UUMA 2V6BA 4YYZA 3LDAA 1U8TA 4LUCA 4RANA 1VBKA 1PL6A 4OHMA 1FMTA 1M72A 2LM4A 1EVQA 1EKXA 2B3DA 1TYBE 1T43A 3Q5EA 2XDQA 1NPYA 2QB0A 3KSAC 5DNCA 4EBFA 4V0MA 4HYYA 5GJBA 4CNBA 2NU6A 1RADA 5JWRA 4RZ2A 3KJNA 2G9VA 3KTFA 1OXVA 3A9TA 4QWAA 2DWUA 5G3ZA 3B7GA 3T7KA 4I0WB 5BR7A 2BSAA 3AR6A 1JALA 1JIKA 2F76X 1VSUA 1RWOA 1CVLA 3OSPA 2KJ5A 4IG9A 1Q1BA 3EIUA 4IEIA 4F6RA 3RH4A 3GQVA 1HPLA 4QZIA 3M8SA 3KX2A 2KHZA 4Q3KA 3TRJA 2QLLA 3EXEB 1N2GA 2O5CA 1DU4A 5GTIU 1TT7A 2WSSD 5D1NA 1JHZA 4JOBA 2JI6A 3FKQA 2PJRA 3QI7A 2XYQA 1YBVA 3V8NA 4F5ZA 4C88A 3CPHA 7ICGA 4OBEA 1M66A 5IN5A 5LM3A 4LE2A 3VR5A 3BIOA 4MQFB 4XYGA 4OJOA 4QECA 2KMDA 2CCKA 3ANSA 3AEVA 5DM70 4II2A 3RRGA 4B7XA 3T7SA 4FKZA 3NBZC 4Z6CA 1SU8A 3DBLA 1AGPA 1Q7TA 1VSBA 4HL6A 1HLPA 1SVIA 1M8KA 3QV2A 1AGXA 4J0FA 1ZRSA 2Y9PB 4JYAB 2R5NA 2MIIA 3BA6A 3SYNA 1QAQA 2H8GA 2EFDB 4GVPA 5KBYA 4ZWNA 3IXQA 1KJYA 1QRSA 2WM3A 4AJ4A 4NI5A 3LX6A 1A8QA 1E4EB 3E0FA 1UBEA 3KT3A 4HSEA 3N0XA 4F3CA 4M1MA 1A77A 2C1EA 4KFSA 1HXHA 1ZIYA 4B6PA 4BFZA 4C20A 4BC1A 1N0HA 2EERA 1WCXA 3RVKA 3WHPA 3JYHA 3A9UA 2W9BB 2ZYVX 4YGYA 1ZQAA 1CR1A 3KKAA 2GFHA 3IQFA 5JT1A 1MA3A 1IRIA 4E46A 2P1ZA 4RUCA 3S1SA 5EGSA 1SXJB 5L7WA 2CV1A 4GNKA 1ZUIA 8ICOA 2GF9A 4G0MA 4RFLA 1NZDA 1RC1A 5GGXA 4HGPA 5D01A 3BWMA 1FOEB 4BMYA 2YKGA 1JYEA 3GWZA 3IP7A 4F4HA 3PCRB 4JI3B 3DAPA 4PQRA 1HT0A 3MTIA 2OZEA 2HCBA 1PEYA 4HS4A 4KVFA 2G07A 4YP3A 3VU3A 5KYXB 5IUJC 2C42A 4H7DA 4MKIA 5L40A 1CR2A 5AW5A 1YZYA 5HGXA 5AWFC 4IQGA 4B80A 2UYCA 4I1OA 4JBWA 3MS4A 1U0RA 5J2EA 3LVFO 4UULA 2OESA 2NXNA 4Q44A 2GA8A 9GPBA 2MSKA 4TTAA 4IP0A 3RYHA 1NSFA 4UTZA 3FPFA 4X20A 4H4CA 4ZOCA 2FRXA 5AOAA 4MRPA 1LBSA 3PXBA 4F4KA 1PTJC 1ZK3A 4RCZA 2QIOA 3A4YA 1Y89A 1Y8ZA 3N76A 2FRDC 4PNZA 3F6BX 4LXUA 3UMYA 4UNPA 3OLWA 3ZDDA 5EIBC 5HZGA 4LFBB 2BFFB 2AT1A 3B3JA 2VDKB 2GBPA 2FSVA 5T4FA 1P7PA 4TVOA 3N8KA 3QVVA 4R51A 1ABBA 5BR8B 2CK3D 3ZWWA 1TAGA 4KLLA 1P61B 1U94A 3KQUA 1M6VA 2E6KA 1EBBA 5AW9A 5DM4A 3R7AA 4EEXA 4UUAA 2J85A 3SAGA 3RS8A 4JLUA 2DYKA 4MF2A 1GVNB 2HIAA 4PC2A 3PCTA 3FTNA 1QZUA 4X1IB 4BO8A 2NZUG 5TDHA 3RI3A 4JYZA 2H8KA 3AZPA 4AP9A 5JZSA 4N7BA 3F2CA 3VMMA 3CKLA 2VBCA 3RTBA 3ZHSA 4DR1B 1DBSA 2ZJ3A 3VVBA 1U3UA 5CRIA 4OJMX 4F3OA 3ST7A 1O95C 4RZIA 1WXWA 2DJ5A 4C0LA 3Q7RA 3NM6B 3ICCA 4DQXA 2C2OA 4E4RA 4I55B 2DHRA 4EHHA 2ASVA 4ALKA 2WVAA 3ILHA 2FWAA 3AEQB 3NU1A 2J33A 3QKRA 4JJGA 2ZIZA 4KNWA 1EFHA 2D74A 4FXPA 5L3QB 5HRUA 3KM0A 2R6R1 3AUUA 3IDQA 2C2MA 1NQVA 5FWNA 4F3YA 1E96A 3V33A 1W88B 4BB6A 1P0MA 2FWJA 5JSQA 4NLKA 3NWPA 5HYVA 1U11A 4ER3A 1W4BA 4R2LA 4QDJA 2A9PA 4BL5A 2C77A 5FL7D 3KQQA 1LKYB 1PU2A 4EQ6B 3TECE 1QB7A 3VA7A 5FXMA 2WINI 3C2MA 1YKFA 1JSXA 4R8SA 3P0HA 2J1LA 4RGQA 4FDAA 1XDDA 2E21A 1RWXA 4FZJA 2WTXA 3ANYB 4B47A 4ZALA 2XOKD 3M6WA 4NHEA 4E5KA 2ZE8A 3OIYA 2GI4A 3TNFA 2CNDA 1J8YF 5KDDA 1ECLA 5I7OA 1RVV1 3K1RB 7ICNA 1BPBA 3B1YA 3WK8A 3LHDA 1F7VA 3TW4A 4GICA 2FLVA 3IAS1 3EGVA 1VJGA 3JVUA 3S99A 2YWEA 3HRIA 4MGZR 3F2VA 5DO9A 1ZQEA 1ZXBA 4IFEA 4B6JA 4G8DA 1JE0A 2F1IA 1AK1A 3C8MA 5SZHB 2PWPA 3C3XA 1NY5A 1ZW6A 1D04A 2W7PA 4WY2A 1KDTA 2IIBA 2XJ4A 3DYVA 3IVRA 4NE9A 1JJVA 1R9NA 1O9GA 4MUYA 4EPXA 1D8TA 5DDIP 1X13A 2FZCA 4DXDA 2RBEA 2DGDA 4CKEB 2Z2KA 1JQJC 3QE4A 3HCCA 2HSWA 1A98A 4WOBA 4JSRA 1QP7A 4PG5A 4CKBA 4BV2A 5IC4A 5C5DA 1YQXA 3CNHA 1WW3A 3P2JA 1JH8A 1P1CA 2VJNA 3AY6A 1K3FA 2PPLA 5EJFA 5CIQA 3RHZA 2BRUC 1K2WA 1KU0A 2NW6A 1RABA 1OB5A 1D1SA 3I61A 1V8ZA 1PE0A 2HM7A 1Z56C 3DTVA 1NXTA 4M49A 3H0KA 3VPGA 3L7AA 2HWWA 3NT2A 3HA5A 5KG0A 2WUGA 4H60A 3EVZA 5BSUA 1ENPA 1OZAA 4CUJA 4I9GA 3X1YA 4TTRA 1NZBA 3IELA 1GUBA 2IEIA 8ICTA 4Q9AA 4LMBA 3BD7A 5J0YA 2DUWA 2BCEA 4DQKA 3A4TA 1DAEA 3DW1X 4MZXA 1X8LA 5CNKA 4R1MA 2FE4A 1QFSA 2JRZA 5F2OA 4G0XA 3EUAA 5BOMA 3CM0A 1KJJA 4CHGA 1ZJ5A 1U1IA 1RLOA 1FDOA 3V32A 1AO0A 4L85A 4KO8A 4N5NA 4CCHA 4DUGA 3ZDBA 2FCRA 2DT8A 2JI4A 1YT3A 2PZLA 2P3LA 4OFBA 1EJBA 1I7PA 3PF9A 4M55A 4PHPA 2IGBA 4ZCRA 4KK4A 4BJ6A 5G0VA 2QT9A 1FX1A 3JATA 3CX3A 4N3AA 4C5CA 3QVMA 3VHXB 3CHYA 3RC7A 2PT7A 1XVTA 3GLFB 1PO7A 3GA5A 3LA8A 2PKWA 5CCBA 2BMVA 4JCCA 9ICIA 3DE7X 2PSJA 3ETCA 5EJ6A 1ZUHA 4RPIA 4L9SA 3M9WA 1ORHA 2PKCA 3G8DA 3GEPA 3W5SA 3PKJA 1QOQB 1D1TA 1PTJA 4N6NA 1ZH4A 1FFAA 2PJUA 1DC3A 3CPJB 1Q11A 5PGMA 4ZJZA 6YASA 3QVSA 3R3VA 1OGIA 1R6DA 3W3AA 1FPMA 4EYKA 3MAAC 1ADCA 2JJMA 2HJHA 5HZMA 3FX2A 3TN7A 5DHFA 3KLNA 3A9VA 4Y2TA 9ICMA 3AF4A 1X74A 4EGSA 1BCRA 3HFJA 5IMBA 4MB2A 1RM3A 3QU9A 4IQ8A 3LHFA 5EJMA 1A7AA 1U8CB 3KUCA 5HFAA 3KZ1E 3E3AA 2SKEA 4ZT3A 5A6SA 3MWDB 3ZEIA 2HBZA 3VR3D 5G0UA 1YOVA 1O0BA 1SGWA 1XQWA 5FUYA 5DB6A 1V16A 3NM4A 2H2GA 2X86A 3UGKA 5LIPA 2Z30A 1VLJA 5P21A 4X1KB 3KHGA 2FN8A 2P8SA 3GF4A 1ZNQO 1YZHA 3UVEA 2DT5A 4ZCIA 1CVRA 1O95A 5J23A 1PJBA 2ZB8A 5HF8A 1WSBA 3OZAA 4TGLA 4O5KA 5CMLA 4TLBA 1H66A 1R0LA 2TYSB 1GCAA 4J1NA 1CX9B 5HRCA 2AGPA 4CW7A 2I8AA 4BBJA 2UVQA 2O6LA 3SNKA 2HHWA 4UJ5A 1EDOA 3Q12A 1H2AS 3K31A 2G5IB 1FP1D 1XAHA 3QLEA 2ZYGA 4ZOLF 2XSZA 4PPGA 3MPUA 2FFAA 4ZV4A 2NVBA 4KH1A 3G2QA 1IDOA 2J3IA 4GRIA 1LQUA 4XPIA 1XQ6A 9ICOA 3AL2A 2YZMA 4GYWA 1GSHA 2XMSA 3DW3X 1E2DA 2NAPA 3D5QA 4EHDA 1GL6A 1T6XA 2DPIA 3G0OA 3DO6A 1ISIA 4B5LA 4RVSA 3IPXA 3W6OA 4PLYA 1QIJA 1KEPA 5ALXA 5ER9A 1L5YA 3SD7A 1ZN8A 2VT6A 2FJ6A 3SOZA 3EOAI 5HF6A 3ROTA 2KSOA 1KARA 1N6IA 3LOQA 1KDHA 5EMHA 3MAJA 2LCQA 3VR6H 3G8YA 1B1AA 4DARA 4BYGA 2QM8A 1POXA 5KCMA 3FOFC 4MMZB 1Z16A 2CDCA 5D4BA 3AGPA 1AZTA 1SUSA 4HB3A 2D1QA 2ODEA 2DLDA 2UZ4A 1KZYC 3QX7A 1JIVA 3N8DA 4AF7A 1CVIA 4KR0A 4BLRA 3TLMA 1N5OX 1SV0C 2PYDA 3FSEA 3H4MA 2FXVA 4P7GA 4FW9A 3BMQA 1YZKA 3S2GA 1FTGA 3OOSA 4YAFA 5AK4A 4N0QA 5CLIA 5TZVA 2BRUA 4PLHA 1QIIA 3O31A 1TNDA 1GRRA 5CA1A 1U0JA 4HYQA 4E3ZA 3BQNB 3HDTA 4RF5A 2NPFA 2D13A 1KRHA 1FQKA 1RZRD 3BFJA 4DLWA 3QVGA 3R0QA 2YXPX 5BPFA 4MKHA 1WCNA 4ZVOA 1XLWA 3BRSA 3OZVA 3FPHA 4KSBA 3WHLA 2XCQA 7ICMA 3O8LA 1KNXA 1PL0A 3A1SA 3OTIA 5DXFA 3TIFA 4UTRA 5CB0A 1MAWA 3KV1A 5IJ9A 1IBLB 2A5JA 2YB1A 5IUKC 4Q9JA 1T1SA 2OHFA 5KFFA 4MUJA 2VXBA 4ZIRB 5DB9A 1QG6A 1ZBQA 4EW2A 3EF1A 1Z39A 1DMRA 5KFZA 2XXJA 1EUCA 3NMUF 3GDGA 1GZ3A 3OQIA 2QYHA 5IAGA 1W8DA 4YA6A 3OT1A 1K4MA 3RAFC 2K5UA 2ONJA 3IVAA 5G0SA 4NCJA 2H4HA 3EARA 4J2OA 1JMKC 1RIFA 3OKPA 2HDOA 1WBBA 1UBNA 2GN1A 5JQWA 1SIWA 2D1TA 1X1AA 1HRDA 3DFUA 3TOCA 1GFWA 2E4XA 3VAYA 3CRVA 3PX2A 2HLHA 4LHVA 4ARUA 5K4GA 2JCSA 3E22B 1KEJA 3JAWB 5ISMA 5ALSA 1IWBB 1E6LA 3QVTA 1H23A 4YNBA 3CV3A 5B4VA 2IHUA 2HMSA 3COWA 2GEFA 5CBPB 2K89A 4DTIA 3HL0A 4HY3A 5ENZA 4U6PA 3WRXC 3PHLA 2CDRA 3CX4A 4YUXA 3T4XA 4E5VA 4D3DA 2OGSA 2G17A 3QBJA 1SBTA 3COYA 1GUZA 3O95A 4O3PA 2BJWA 1MQAA 2OBBA 4OJYA 3C4QA 3UT5A 4CL8A 1E5LA 4QYSA 2IV3A 4HQNA 4RTLA 3N2YA 5EFZA 4XB6B 2AOXA 1V8PA 1C8KA 2AFIE 2VQFB 4OHWA 2Z08A 3FDSA 3JZAA 1S8OA 3UHFA 4UBNA 3PGKA 5C1DA 2FZGA 1ZN7A 4R41A 2HA6A 4R1OA 4P3OA 1WY7A 2DQYA 3OCWA 1P62B 3UB3A 3EVCA 1FU8A 3LDGA 4TXMA 1QYVA 4RYDA 3PX6A 5BURA 1G4AE 4KLIA 2ENUA 4RHXA 3TD6A 3CJQA 4B2LA 1WO8A 1WWKA 4NEGA 4FKBA 1UQTA 1WD5A 2GK6A 3BXZA 2V7WA 4OATA 1SELA 1D4OA 2XXBA 3IP9A 4W9NC 5IASA 3W2HA 3MR3A 3IHWA 1GYRA 1G9SA 2HSZA 4GDFA 3NVYA 1PAUA 4RJLA 4M36A 5G40A 3HDVA 1QH8A 1K2VN 2QMQA 1PZGA 4U6QA 3S8MA 3K9FC 4QQKA 2QGFA 1ZSVA 1T6BY 4NXMB 3ER9A 1JSLA 4NYIQ 2FN4A 1VDZA 1F06A 3KB2A 2R85A 3I9MA 1JKIA 3TR0A 1GKKA 3K0BA 1BAPA 2IYPA 2F3SA 4WKPA 1PJRA 2Z9BA 5EN4A 1L0BA 1N5RA 2HLPA 3RREA 3SKYA 3PI6A 1UOEA 2PGOA 4B4DA 2KVCA 1NJWA 2BHSA 4JVLA 1NVDA 1G66A 1JLKA 4HNGA 1W59A 3PDWA 2B25A 3CVOA 1Y80A 4DMKA 5JU5A 3FMFA 1UBOS 3BSWA 4WAUA 3I6BA 3GUYA 5IBRA 4UXIA 1KTIA 1OHHA 1KOGA 3IV9A 3G89A 3ITDA 4CKWA 1MTZA 1RKQA 2Y0CA 1S7CA 2XNSA 1ODJA 4LS3A 3HRDD 3T0GA 1MKYA 2OUIA 4S0XA 1Q77A 3BD8A 4INPA 1WV1A 1FNBA 2E82A 2FUG1 3EMKA 2LWIA 2BYTA 1KZ9A 2GS9A 4AJOA 3BCRA 4E51A 1DUIA 3WG9A 4CV1A 3PZRA 3DAGA 2YW9A 3MTQA 3FFWA 1X3SA 2EYQA 5FBRB 4U4AA 2DC1A 4GOOD 1LSSA 5A4KA 4C76A 4D4IA 3TACB 4ACAA 3KBBA 1M8GA 1HSZA 1OLUB 1XZ8A 4QYTA 2PU7A 1TW2A 3D7LA 2FXIA 4KLNA 4JWKA 3MR5A 3UPUA 3PD1A 2DY0A 1LH0A 2UU9B 5CK4A 2O57A 1UMDB 2G72A 3WNQA 1Q20A 4Y9TA 4I50A 2W70A 3DZFA 5F78A 1FCJA 1BXGB 4KGXA 2PY6A 1D4ZA 1RJGA 3ESCA 1NONA 2EFCB 2E18A 4QPDA 3EC1A 4QAJA 4DB2A 4XM2A 3OZEA 3HDQA 5C1BA 4MW1A 4RK1A 4UNRA 4ZTUB 3OX2A 5M34A 4H27A 4EHLA 3IUJA 3ESYA 4GF5A 3JQ7A 5CDHA 2AK2A 1U3TA 4MFFA 2WAYA 3ELUA 5E7QA 4O1IA 3HJGA 2HX1A 3FPKA 2C59A 5TPWB 4POAA 5KOIA 4DABA 1L1RA 2PR7A 4WBXC 1GTL1 4RFSB 4X63A 5K0NA 3ZBUA 3EVBA 3V8VA 2HBMA 2Y76A 4QUAA 5J43A 3Q0IA 4NS4A 2ZTMA 4I6GA 4GMHA 1G42A 1N2CA 3BK7A 2XD4A 4G5FA 3F3KA 1E1LA 4BDTA 3PSTA 2CLMB 4OA5A 3RSZA 2FEOA 4G0VA 3ECAA 1GL9B 1JDTA 4PGYA 4MYRA 4IJMA 3DM9B 1U90A 4HS9A 2A92A 5E6UA 2QLNA 2FOIA 2B7BA 1J8DA 1NRXA 2F9MA 1KFTA 3C23A 1C7IA 4YJKA 1H6DA 4DV5B 1OW3B 4WOCA 1ZHFA 4G5RA 2BDTA 2B94A 2V97A 3FF4A 3RBXA 4DLRA 2J9XB 3DZCA 1D2EA 4XOIA 3L6BA 2YR0A 3KV3O 1HETA 1X6IA 1L4GA 3MGGA 3N2IA 3QLUC 3HO1A 4HDAA 4NAVA 2R00A 4IKEA 3LLUA 3ICQB 3SV4A 4I2BA 3CX6A 1YMVA 3VYUB 3N1UA 3ONDA 1WCV1 2IELA 1Q1GA 2Q1WA 1NXOA 3W6PA 1R9MA 1PI3A 1ESZA 2VLIA 1IJFA 3TFOA 4PXAA 1Q3TA 2ONZA 1XTRA 2XNKA 2NZVG 2XKKA 3IP8A 1QPBA 1QFMA 1UPCA 1HOXA 2RAFA 4IH1A 4ZGWA 3K70B 5DBEX 4CM9A 3B9PA 4GC6A 3TL6A 4M9ZA 3ESAA 2ZE5A 3GFGA 4WZBE 1BNCA 2FHPA 1USVA 3G5LA 3HNRA 1NKSA 4ICIA 4NR0A 2VANA 4N9WA 4EF4A 4PWYA 1FUUA 3RK1A 1P17A 1U2GA 5BN3A 2ID4A 4W9NA 1SG6A 3STTA 1X3LA 2ORWA 3LFTA 1ZUD1 2IXEA 4Q93A 4ZOLB 3WLHA 2HYIC 4GBMA 1XFAA 3GQBB 4F2WA 2IZ0A 2Z56A 1IC6A 4V1CA 3KHKA 4JR0A 1WZCA 4AY6A 3P5SA 1KMIY 2QTRA 3AWDA 4M0MA 3FVVA 4WV3A 4CTKA 4DPLA 2N75A 1KFBB 2YRWA 3LXXA 5LN1A 1E18A 2MDTA 2JAHA 2NYVA 2BP7A 1CIVA 4G2TA 5EYPA 3MK31 1KZHA 4WVLA 2R6AA 3ABRB 3WB9A 1RLIA 4A5OA 1Q83A 3L8FA 4C14A 1YUBA 2UVDA 5LKRA 4L73A 2VWGA 5LP6C 5LQJA 4ZYXA 2PRSA 4KO3S 3R3WA 5FCDA 2YS6A 1XFDA 1ZIPA 3QWAA 5HUJA 2K8AA 2I91A 1PGOA 1YL6A 1SIUA 4EX6A 3RW9A 2ZIXB 2XY4A 4XGNA 2J9FB 4WXPA 2NSLA 1JQBA 4DR2B 4WPGA 4H1WA 1QQBA 4JV5B 2HWYA 3GUUA 1T9GS 3IFSA 1UK8A 1NVAA 2IWRA 4G0YA 3TCNA 5IBCA 4WIAA 1OI2A 2RGNA 2JVIA 4YBRA 2ZRAA 3DLBA 3OE7D 3GEHA 1TT5B 4JLAA 8OHMA 1UCVA 1NKEA 5KFCA 2XQGA 3CURA 4RESA 1RJFA 4GYJA 4ROTA 2KE5A 2A35A 3ELBA 2QR2A 3DAYA 3IVCA 3AV0B 3ZZMA 3OJOA 4B87A 3QLJA 1CRPA 9ICLA 1W46A 4RIFA 1F2UB 1J09A 1JKJB 4S2EA 4Z86A 1XMQB 1ADBA 1XZDA 2CBXA 1QO0A 1XTQA 4NCKA 2B5OA 4KI0A 3HXKA 4QU8A 5CRXA 1RAAA 1BNPA 1UBFA 1UC5B 3O83A 2ZATA 1UM9A 1NJ1A 5ALGA 3T9DA 1TPZA 3FOWA 3GVCA 2NQ8A 5J2UF 1H2YA 1V25A 2QWXA 1VE7A 2LMRA 1EZ4A 1GNVA 2W2KA 4Y9DA 4HDQB 4UM8B 2BPOA 1B4FA 3O8OA 3KKKA 3OA0A 4L57A 3M6IA 1KS9A 1DKPA 4J07A 3E53A 2CN1A 4C0AC 1BW9B 4Q03A 3S2EA 2YW2A 4ND5A 3RGGA 3OZIA 2QGNA 3JQQA 1D9XA 3AH8A 1VDVA 3WAGA 4IHAA 1SZJG 3BMCA 3BB4A 2AQIA 2GN8A 5CLGA 4UVDA 4JEHA 3WKAA 4FOPA 2AFIB 4G4SO 4BPRA 2DH6A 5DSZA 2KZ3A 1UKBA 3PW2A 4Q1FA 1ISFA 2YMPA 1H9BA 2EF0A 1IBMB 3U1BA 3D4IA 3RTGA 1XJWA 1IJEA 4AECA 4UU0A 3T3EA 4AFNA 4LDNA 2K4MA 4JUFA 4B9EA 2AFHA 4JA2A 2DBVO 5DLYA 1JF8A 4C0BA 3K0FA 2C2DA 1VE3A 4DLGA 5CVEA 1OYVA 4P4UA 1T3LA 1CJBA 2GKOA 4ALIA 4EHKA 3QF4B 1F0MA 3W1WA 1IV8A 1GQRA 1Q44A 4HEA1 1W87A 1QP0A 3E9EA 1MVNA 3KQOA 3K1TA 1JDBB 4KMOB 1ISRA 1DXQA 4QOFA 2IA6A 4E70A 4FFMA 5IZCA 4P3NA 1CQIA 3INGA 5GV7A 5JNVA 3IRUA 3CRRA 2AHOB 3TAQA 3GZNB 2H07A 2PKRA 5DIZA 1I4LD 2VTKA 4R1TA 2ODNA 4D8XA 4BFUA 1WBDA 1DGSA 1XC7A 1GQQA 4JI8B 4CYMA 2X1LA 2W2VA 1PJQA 1YQWA 4RAOA 4RQBA 3UMBA 5A04A 1QV6A 2V3VA 4I8DA 2CFTA 1ZU4A 4ZRNA 3VO1A 2JRCA 3BGIA 1ACMA 4ZEVA 2I3BA 1PUJA 1DNPA 3K7EA 3DGFC 1GKLA 4EUNA 4LV6A 2NO5A 4HJRA 1NF2A 3DF9A 4BBAA 2RAUA 5D3KA 1MN8A 2EP5A 3NTOA 3I6ZA 1ZNYA 1TEVA 2BONA 2QN9A 2VP4A 2QEQA 2CZGA 5CIYA 4JBXA 3TLZA 1QHHB 4PSUA 3EBOA 4BVLA 4M7RA 5IVDA 3EJWA 1KKXA 5A3SA 2DKZA 1KAOA 4EG0A 3A9CA 1WB4A 4WKCA 1WF6A 2NIPA 3DFZA 3M2TA 4DJ5X 3E84A 1VBFA 4LDRA 4IS7A 2QK4A 2J08A 2WU1A 3Q7EA 3IUBA 4DYVA 4LQLA 3L0ZA 3WO0A 5DMHA 3O74A 3TVDA 5FQOA 4Q4AA 1TTPB 4OY3A 5CX4A 7ICFA 3HGMA 3F7OA 3PDIB 2VUTA 3FNRA 5LP6A 1E62A 3AM3A 4JB2A 1XLVA 5B5EU 5FI0B 1Y9ZA 2IC5A 4YIKA 4OD0A 1L4LA 1YRYE 4DLUA 2CUTA 2QUZA 3D3KA 4CCYA 4KLCA 2F6RA 4NU6A 5F33A 1XNRB 4WXYB 2OBXA 9ICGA 3PYLA 4BMZA 4QZAA 4EP1A 4DOBA 2EEPA 3H84A 3A10A 4D8VA 1PIWA 2WU4A 3TCXB 1W49A 4DL7A 3UFXA 3ZX4A 1T0PA 5A4IS 3AN1A 3RR8A 4URWR 2FPPB 1TFUA 2ZYDA 3N2KA 4YRCA 3KKAC 3G8AA 1G9TA 1DIOB 1JAHA 3ZUGA 3KPWA 1I7DA 1WLYA 5HKBA 3GPDG 4JUDX 1HE5A 4BFCA 1VJ5A 3A6KA 1DEXA 2ALJA 5KDOA 3JAKA 4YDHB 1M2VB 1Z6TA 2J3EA 4RQ3A 4OEHA 1X80B 2PS0A 1OYOA 2UYQA 2AUMA 4I2NA 5CR9A 3U4HA 5HQ3A 2OC9A 1GXSB 3JD3A 2RG1A 4ZQIA 2ECKA 4FJ0A 5EC8A 3MEQA 3PD7A 1R9JA 4ED3A 5L9XA 3Q7QA 1IG3A 4LSMA 3KOZA 4MI3A 2OSBA 1M1ZA 3O90A 2P35A 4Q7QA 3QSGA 3MJCA 1FSZA 4AB1A 4PLPA 4MR7A 1HZZA 4Y2UA 4KLFA 5A9SA 2V7UA 2BHNA 2NVWA 4LZPA 4O02B 4DLAA 2R6ZA 4H1TA 2APJA 2GYUA 1X2IA 1T2AA 2YOFA 3SYKA 3HV0A 3K16A 3PQ7A 2MSNA 3QEAZ 1SIOA 1H4SA 1JWLA 3D3JA 3R2JA 2QBYA 1S77D 3NDJA 3Q41A 3UK7A 4LRQA 2VVTA 5KTOA 2GJSA 2PSSA 4TS1A 2Q6OA 3R3XA 3SYRA 2PRJA 2HHSA 1GKIA 2FEWB 3WGIA 1IHDA 1O6CA 1IIBA 4Z4IA 3OZFA 2OO3A 4EBEA 3REFA 3B1VA 4HDSA 1CV2A 4QFDA 2O1XA 5K01A 3W8RA 1IJKA 1N4AA 2VHYA 1BFUA 4QDOA 4C7OB 1DFGA 3ZVMA 5LDGA 4JUCA 5JJ5A 1CJKC 4GYKA 3OJXA 5TJHA 2PZAA 2VZ9A 3TW8B 3W5BA 3X2EA 2J4DA 4WEQA 2WUWE 4WZBB 2YXEA 4KOAA 3NOXA 4TWJA 4FHCA 2W42A 4AN4A 1NP7A 2P2DA 4WOPA 1EQ2A 1UXOA 1QUEA 4G56A 1T3NA 1MB2A 1ZVKA 6PFKA 4TMWA 3HXOA 1LQ2A 3W4IA 4AC9A 1BYUA 1N4DA 2VP6A 1P73A 1U0NA 4YT2A 1KMCA 3RF6A 4WLVA 3LO5A 1L5HA 1N34B 4K6KA 5K8UA 5A4FS 3WBJA 2IIPA 5ALTA 4RSHA 1QGZA 1TZJA 4ECWA 4AZVA 1IMOA 2OCPA 3B5JA 1T9BA 4XEHA 4AS2A 3MA0A 5FYQA 1ZN9A 3TD9A 3AUXA 3DB2A 2XT6A 1I9GA 5FUBA 2GZDA 2CNKA 1A8HA 2X9VA 3U44A 2ZI9A 4RVOA 2QM3A 1JV2B 3H3JA 5AFSA 2ES4A 2BR3A 1T8WA 3PLAE 3WKEA 1T35A 4U00A 4YN3A 4Z6KA 4HVCA 3PO4A 4QGAA 2C5BA 2F1JA 3QOWA 3TZCA 4AWAA 2QVBA 3QXXA 4KODA 4AT1A 3D3WA 1JEDA 4ND1A 5CVVA 1K7FB 2OPBA 5J9FA 1FDVA 4EZEA 4GXJA 4OX9Y 3KLBA 3UJ6A 4EHFA 4L7VA 4D4KA 1BN6A 4QT0A 3W1VA 2HB6A 4L74A 1TLFA 3K2BA 3HO8A 4KQWA 4XX0B 1NJGA 3OQMA 4PHGA 3JR7A 3ME5A 1RTKA 1ZQMA 1RE1A 2Y77A 4IBOA 2Z04A 1MJHA 3OKFA 2D5IA 1JA9A 4BMXA 3TNYA 1F4LA 5BNIA 2WJVA 5AKKA 1OFUX 4MUBA 1D8AA 3FCSB 4ES6A 1W73A 3V8PA 5J0TA 4L50A 3ADOA 3TLGB 2I4NA 4OJQA 4NG5A 2DUNA 5KNDD 4Y1RA 4MUKA 2C7RA 1J56A 1E6WA 4KRXA 5JO9A 3GFOA 1RMQA 2H18A 4EJ0A 4Z9AA 1NKCA 4DFKA 4HAWA 3IO3A 4M0KA 1BS1A 3DMTA 4HHEA 4EITA 4MKXA 3OJLA 5GOZA 1D5WA 4DCMA 1SVUA 3PG5A 4MQ5A 3SF8A 4U2KA 1N6OA 4B3MB 5T7BA 3VOBA 1SOVA 1ULTA 3GWGA 1EFVB 2VQ6A 3THSA 1E3MA 2VJOA 1RQ7A 4ZDIA 3BXXA 1ZL0A 4MEYA 3L0IB 3OBIA 4N5MA 2R8IA 1IRXA 2NTVA 4JZYA 1FXWA 5F9HA 2B4TO 4FCCA 4QHSA 5DHUA 1WW8A 3N53A 1E1DA 3M5CA 2WJZB 2ZQ5A 2Y8EA 5CDGA 2WAQF 1B6GA 2NO0A 4XWKA 5HIAA 2OLKA 4TL7A 1PWEA 1E6CA 4LWOA 4B82A 3E7XA 2WA2A 1YC5A 4OFZA 3WB0A 4UM9B 3U3JA 5JPIA 2Z4SA 3AHHA 3QI2A 3RS2A 1S7GA 2C9CA 3PENA 3ZI7A 5CP2A 3EXFA 5J2UB 1V43A 3GHHA 5JSYA 4KXWA 1CRLA 2Q4EA 4L5YA 1LX6A 1XVIA 3O0TA 2AG6A 2B2CA 3KKNA 1GDHA 3USCS 2DSTA 2Y6VA 2XE6A 1XKTA 2HNAA 1XHFA 3FUTA 1WMSA 3NRJA 5AI5A 1OLSA 4RPHA 4US2R 1G6HA 1AMNA 3ZWXA 2CLLB 4GPAA 4D79A 4MKFA 1Z33A 2FSSA 3IHQB 4JL6A 5C7YA 5DG9A 1V1MA 2ZSDA 1R4NA 5EJGA 2I4LA 2AOWA 4Z2AA 3BWVA 2WVGA 2LCFA 4YQZA 3K1ZA 4WKOA 3EEQA 4RA9A 2R8PA 4ZQEA 3NUQA 1UFOA 1OFIA 4LYJA 1DTWA 1W52X 4PZEA 5LB4A 2RKOA 2V7TA 4KZPA 5KTSA 1GOTA 1TUEA 2QZZA 3PY8A 2KN7A 1PGQA 4AURA 1S3IA 4ZEXA 3M89A 3QLVA 3FRHA 4KHPB 3I72A 4RQTA 3RKUA 4Y0AA 1FP6A 3EPRA 3SZGA 5EIEA 5HW0A 2EZYA 1ZMRA 2ZGVA 4FFNA 3I53A 4G3XA 1KS2A 3RHFA 4LC9A 3W5DA 5CB8A 3D2QA 3RPEA 2Q2VA 2NPOA 2WWIA 2HI0A 1N3IA 3MDCA 3D1JA 4C4TA 5H16A 5LQSA 3A0BU 1F8YA 4W9MC 4Q7EA 1MOQA 4PF1A 4NLZA 4KBFA 1WD7A 5D5HA 4EUSA 1HUZA 3P9RA 4ZDKA 3OQ6A 3ZX5A 1SXPA 5FFNA 1HDZA 3VSDA 1BD3A 1XVUA 3WA6A 3K35A 1Q6YA 3I5AA 4HMPA 4N76A 4W82A 4ED1A 3EQ8A 4DBZA 4P31A 2HWUA 1RBQA 3IOBA 1U0OC 4K4IA 2W2XA 3HEAA 2HTEA 5JSUA 3WMWA 3K05A 5MN4A 2TMKA 3D02A 5LPNA 3R40A 1KEZA 1QYWA 1EXVA 2R7AA 3IIIA 4TUYA 4R7GA 4B74A 2QE6A 2KM1A 3IODA 1PT7A 3FZYA 4JV0A 2QZJA 4KXXA 3R7SA 3GDFA 1D2CA 4TSFA 2GOLA 2ZT7A 2JHAA 3GZ4A 2Q29A 2R1TA 5K5EA 4EYQA 3SBXA 5TRTA 3UUGA 3H87A 3P26A 4LCEA 1EE9A 2HUNA 1E7SA 2HZBA 2X0EA 2W71A 1PK9A 1A95A 3ZWBA 2CFRA 1KZ1A 1I2CA 1M8PA 1ODKA 1MRSA 2AFVA 4A26A 2FN3A 1NW5A 1U4SA 5AJUA 3AOEC 2QUAA 1UBRS 3T5LA 3K0SA 3ZWMA 3GLUA 3U3KA 4WBNA 3K96A 3SEQA 4EL0A 1SKAA 1E3IA 4KIUA 3WTBA 1IM5A 5EIBD 2QLTA 5LWQA 4CUKA 1V4NA 1ZCFA 4IMJB 2QVXX 3EGDA 3R9WA 4GPBA 1ML3A 2A2ZA 1NK9A 4NARA 1ZINA 2WU0A 5DASA 3DOUA 2D3WA 4CEJB 4UBMA 2UVRA 4IFTA 4MDYA 3AHIA 4YCCA 1JB1A 1CEYA 2NTYC 1E3TA 3DT9A 3VHLB 3N07A 5BWBA 2QX6A 2HA2A 3UK6A 4B76A 4Q6BA 4GMXA 1PS9A 3W6NA 4UHFA 1JL3A 1Z22A 3MSXA 1E1CB 8ICPA 4W5OA 2H63A 5EKDA 1UEIA 3CT6A 2V8BA 4B9VA 3LT4A 2O7SA 2BUAA 1SKRA 1ZIDA 1O95D 4EZ9A 4GGOA 1K8YB 1HQDA 1MEEA 3Q8SB 3NGXA 1I6WA 2F4NA 1Z5WA 5KU7A 3ER8A 1LWOA 4GWGA 3EPHA 3DQQA 1Q21A 1P2DA 3VGPA 4ZCTA 2XSZD 3BK2A 4YDQA 5C5IA 4IL5A 4WERA 1UBCA 4XUGB 1O58A 1RWKA 3VKWA 3BL8A 2Q21A 2CXNA 5A2QA 4JJKA 3ENVA 4RKWA 3DZJA 5L1LA 2WFAA 2FZEA 3HA7A 1YS7A 4E32A 2F67A 3QMVA 4Z4HA 3R0XA 5I9MA 2LZ0A 3L8ZA 3OKAA 1E9FA 1E9DA 2QTFA 2QTAA 1NC3A 1EX1A 1EM8A 1GAWA 3WIUA 4EPVA 3HBFA 3IPRA 2OAP1 1KJQA 2BFWA 1G5QA 3ZDZB 4Q00A 2AWNA 3E9DA 2H1IA 3KALA 3ZD7A 3KJQA 4V0OA 4QFBA 2QR5A 4MHOA 1Z35A 3FPLA 5C31A 5C51B 3KQLA 4NMXB 4AU1A 1HYGA 3BJYA 3B6IA 1VIAA 4DLYA 1M2FA 3KYDB 2ZWVA 5G4KA 2QVCA 1GP2A 4NOJA 4R6XA 1F2TB 4CM4A 1QVVA 3BXPA 4UW9A 2XGSA 5JR3A 2QW8A 2F9LA 5BQPA 3LDHA 2HBKA 4LE1A 5CX1A 3C1OA 1VG1A 2DKNA 3ZV4A 1W4ZA 4MXDA 4CTOA 1XPUA 3B6JA 4DQSA 2X7XA 3EXG1 3I2KA 2HXGA 1SVSA 3NAZA 1MC8A 5TPZA 4HVLA 2V4MA 4RXTA 4P2GA 2IEGA 4WH0A 3UO8B 3KHLA 1TAQA 4X8LA 4EG7A 5JFTA 3NHUA 2K4EA 1N2BA 2CXXA 4ZO6A 5AM3A 1DLJA 1VG8A 1QR6A 4Q4DA 3N2EA 3HABA 1O4WA 4N47A 4F0JA 2P0AA 1ZAYA 1MSWD 2YVAA 1NOJA 1BMTA 2XVYA 1M6YA 3DDCA 4URHA 4F2DA 4U3JA 2RJNA 1W7AA 1JLLA 2IUUA 3X1WA 1QTNA 3VYTB 1DG9A 3UMCA 1THZA 5BN5A 4LXIA 4JDPA 4DL3A 1R5BA 3ZE0B 2C2EA 1CY2A 2IHTA 3LSYA 1LDGA 1PFVA 2OHJA 3PUWA 1L7PA 2AOUA 3FYCA 1IY8A 2ECFA 3PFGA 1B2RA 4BO7A 3UWSA 4EB3A 4MVJM 4RDIA 1RPJA 4F5YA 2YQ4A 2QARB 3RK0A 2PH3A 4OQNA 4XDYA 3MFQA 4BNUA 1JP7A 3SEIA 4ITRC 1VL2A 4O33A 5CVUA 3MCUA 2PD4A 2EZTA 3D31A 3TS1A 4JP1A 3VTAA 2YHIA 2PGJA 3NYWA 4JLJA 3SMQA 3DMRA 3DVAB 4MUGA 1SUPA 3TAHA 3K9CA 2YQ5A 4LBWA 3DKPA 3L7BA 1NUHA 5BSGA 3SZLA 3ZJ5A 1I80A 1KO5A 2GCOA 2XUQA 1YMQA 2NTEA 4AM8A 5EA2A 3GA0A 2GSDA 2E4VA 1N1EA 3AOEA 2IYVA 4TYQA 3S27A 4F5NA 3FYDA 4LWZA 4IIXA 4ZU1X 3A32A 3GFQA 3ZGVA 2J9GA 3F8WA 4DZRA 4JC4A 9ICSA 4TYMA 1XBTA 1Z47A 3A25A 4S1WA 1XMXA 4D8TA 1UMBB 2HQOA 3DQPA 3P32A 1ZGGA 4DHWA 2YY7A 4F8EA 3MTAA 2MYNA 1PKXA 2RI6A 4R31A 3PNCA 1P18A 4ND4A 1L5ZA 1V39A 5KYWB 5K3AA 5I7FA 1Q7GA 4B6GA 3SWWA 1EDBA 5D84A 1QS0A 4BKMA 1R5NA 1GZHB 1ZA1A 3SAHA 4C0ZA 4AK9A 2HHCA 5EY5B 4I2JA 2PX8A 4I08A 4Q1AA 1XWLA 2HLDA 4HSGA 3PIIA 4N01A 4EA7A 2Q50A 4NBSA 3RRNA 5CT4A 4URYR 1Q57A 5BWNA 2VT7A 4O2RA 3TINA 3TZKA 2ZROA 3IS3A 4U7TB 3C48A 5IXYA 4M38A 1K97A 2QKQA 2CHGA 1NI4A 2HF8A 2L19A 2ZSBA 5JYDA 1Q5PA 1EK6A 1YGPA 2CJYA 2QR3A 5GADl 4GR4A 4YUAA 1FMCA 4BEBA 1CKEA 1G3QA 3Q0TA 3TBFA 3EW7A 1O6GA 2V8OA 2XYRA 421PA 3M1IA 4HWKA 1NK5A 5EIWA 2EZUA 4C7JA 3NAQA 1UJ2A 3NASA 3LC2O 2QYOA 1VJ1A 1SXHA 3ZVLA 4ME6A 1US8A 1FMFA 4RJTA 1LPPA 1EFRA 2IE0A 3AYZB 4IWNA 2J3LA 3BORA 4MI9A 3H5IA 3HM2A 2A3NA 1PJ8A 1J06A 3EIFA 2CBZA 1ZEMA 4QPCA 5FP0A 1JXEA 5L3RA 3MCZA 1P9OA 4C3UA 3MGAA 1S0NA 1IBSA 1JEJA 4HZGA 5J8YA 2QP9X 4UKDA 1OHHD 2IA5A 4MUMA 2ZSKA 5CFLA 3RRBA 3RYCB 4OX9B 4MMXB 4GC5A 4C4PA 4FBMA 4TQUS 3KAJA 1LRJA 3JQGA 1U2ZA 5FWXB 4ZVRA 3F6RA 1QCDA 1Q16A 4HNTA 4MVJA 1DCMA 1T4DA 2HQSA 1SO8A 3VX4A 4JT4A 4F3RA 3F5FA 1VPTA 1Z8NA 2BEUA 5IEBA 1EFCA 3ANNA 1M10A 3EE6A 2WM2A 3ZHTA 4J0EA 1EG7A 3RVOA 1JXAA 1XP5A 3SC2A 3M70A 4V38A 5P8WA 2VI5A 2PUTA 2A8YA 3FE2A 2FP4B 1ZGHA 5LQMA 4MYTA 4YUZA 4AJPA 4CQMD 1JXMA 1ZKDA 3M6VA 1OIXA 4U7CA 3IUQA 2B1JA 4WVFA 3JAMA 5L3SB 1ONBA 4CDGA 1IPEA 4BB0A 1K7EB 2GKGA 2R00C 3UV6A 4LZZA 3M81A 4IKPA 4KLZA 4WASA 1IIRA 2BY4A 2HLNA 4PTYA 4DIUA 1B6SA 1SBYA 5I6DA 4GKVA 3AUTA 1ULSA 3JWIA 5TARA 1P1RA 3B3GA 4HZUB 4KLJA 2A33A 2GNOA 1J8VA 2EZ4A 3CEJA 5IKOA 3A2KA 3DBRA 3F90A 2WJAA 2PKQO 1X9GA 4ENQA 4PYOA 2Q4TA 2IYLD 1QTIA 3KOYA 1JJIA 3INNA 2O3RA 3DE2X 4LYDA 4FK8A 2C2GA 3DMDA 1NZJA 5BQOA 3UOAB 1F20A 1OI7A 4O2BA 4KGDA 2GERA 3SSOA 3OFVA 4KXMA 5DBBA 4LVOA 1RKXA 2K4HA 4PIPA 1NR1A 5TIIA 3F71A 3P9XA 2RARA 2IOHA 1YUMA 3FHOA 2IY9A 1U2GC 1VKHA 5K6TA 4JJ4A 1RJ9A 3SKXA 1NLUA 4L4ZA 3CUWA 5AW0A 1S2IA 3H8MA 1HDCA 3OPNA 3VVLA 1ML4A 1A9ZA 3DMNA 4WINA 4YRTA 4A0SA 3OQ1A 3JASA 1OAAA 3GNLA 4DF8A 2JLZA 5H81A 2DUMA 1BHJA 4KJZA 5KFAA 3MR2A 1WQ3A 1CQJA 3UJ8A 3FCEA 2D59A 2C83A 3AEKB 1EFPA 3UAZA 2PEZA 2L18A 3EFOA 3A3OA 3R77A 2CLHB 3OT4A 4XWTA 4CFSA 2FJ0A 2B6GA 3EZ7A 2R0QC 2PHZA 3NV7A 4K8OA 1YHNA 1PYGA 3K9LA 4MV3A 3QSYA 2ZULA 4XIJA 4NYJR 5IHPA 2H17A 4YGXB 2QX8A 4XQGA 4ZZ2A 1R6AA 4YV7A 3B2EA 4HX9A 5TQVA 4QWMA 5K4HA 1GWNA 2WIGA 2B0CA 2OYSA 5HKOA 3OF3A 3N7TA 4HDMA 3P71T 4HADA 2DP4E 3H1AA 3CSDA 2YCBA 3B52X 3TRKA 1ENOA 5LZ5A 5LMZA 3IBCA 3TXXA 2OQRA 2HOFA 4D8YA 2RGNC 4D56A 5FPYA 1FVOA 3H11B 1GCGA 7MDHA 2PRKA 5JS8A 1PW7A 2V7QA 4CM9D 1JEYA 2VPTA 1KMHA 3EUFA 3LAWA 4IO1A 1ORDA 1G18A 3TLXA 4UAGA 4F50A 3DCJA 5DGXA 5JD5A 1EP1B 3KC2A 2WSBA 2OXRA 1XRSB 1DRVA 3QE3A 1NG1A 5KTMA 3PW4A 3HYRA 3NHZA 3L41A 3JS5A 3ZCRA 4MPJA 3P2YA 3H13A 2WUVA 2BI4A 5B7GA 9ICBA 3MGKA 3SIRA 1UFQA 2BD0A 2AEMA 4MQFA 4GBGA 1N62A 4GHWA 5KFUA 1RACA 2IOYA 4EZIA 4ENSA 3C3PA 4U5QA 3NTVA 1EE1A 5TB5A 3CMCO 4QUBA 7ICRA 1T0JB 4L72A 2C5GA 1TTTA 1IOWA 3E82A 1AHIA 1EYZA 1XYYA 4F72A 3KUKA 3BE6A 3NIFB 1MD9A 3HPRA 4XB2A 8ICMA 1KORA 4EYIB 1DWPA 4M2LA 4Q02A 4BDSA 3K9WA 3SU8A 3U9SA 1OV6A 1Y3FE 3WYEA 1DOHA 3QM1A 1TO6A 4CTJA 4A0QA 4TLLB 4KDFA 1KN5A 2QAJA 3ICOA 2B9EA 4YBZA 4QUKA 2ZT5A 3D7KA 5BNTA 2RHMA 4OLFA 1ZI6A 1KSJA 2GUGA 3BAFA 2JD2A 3U40A 3OOWA 3O1JC 4KLEA 2IPOA 1A04A 3DEJA 3P9YA 3SMVA 4XE5A 2IX3A 4BGDA 1YNSA 5G02A 2GUWA 4DGSA 3ELWA 1KOJA 2EATA 3VNUA 4W5TA 4UU8A 2W9BA 4PGMA 2ZM6B 2CF5A 4ZAXA 4KPUB 5B57C 3B1ZA 5F5XA 2W22A 4TTJA 1ATIA 3FZNA 4YPFA 1T9CA 5GQSA 1SXJA 1L5LA 1P5FA 1Y48E 4FSDA 4I99A 3EMDA 2X76A 3RRJA 4F3NA 2HO5A 3ZHXA 1A1SA 3K20A 3WYAA 1MDBA 1IOLA 3R3UA 5JC1A 1JIQA 1J42A 4Y1GA 2AQKA 4OJNA 2QLJA 5IZCC 1CS0A 4EYSA 1LCIA 2IU3A 3L6CA 2GRUA 2HF7A 1QBGA 3EDQA 4D9GA 4KVZA 2W9AA 2KP7A 3EFBA 5KYXA 2PI4A 4QDKA 1ZQYA 1BEZA 7ICSA 3D2AA 4R68A 3P2KA 3X1MA 2WVHA 3SYLA 2JIPA 1DFHA 3P0RA 3SQLA 3QUAA 1J2YA 2WYHA 2AQ0A 4I1SA 3G49A 1KRXA 2MSWA 1E0JA 4ZFNA 2IH2A 2QVLA 4URUR 3M3PA 4DOAA 1XXLA 2YZNA 1RTTA 2X9GA 1XD2B 5EJ7A 1CP3A 4FIDA 4QVIA 1NJ2A 4O0IA 3JQ9A 3W9YA 2MR6A 4GE3A 4KAAA 4BB9A 3AEYA 4MO9A 1BPZA 4A6DA 4OHBA 5LZ8A 4CV2A 1MH9A 5IT9A 3HTXA 4GKBA 1S2DA 2C2KA 2HT1A 1G59A 4W1PA 2DTEA 1UPBA 4DQ0A 5DNYB 2BFFA 1PV4A 2BDPA 4M46A 3PGXA 5K8TA 3BXFA 1CIJA 3PGMA 1E5DA 1W6UA 3A1UA 5J5CA 4M3NA 4Y6GB 3SP1A 2YJ6A 3AUYA 3HWSA 3OQHA 3L79A 4X90A 3E4CA 3UANA 3UATA 3VKHA 3VUFA 5ESXA 3RH0A 1N5LA 3N7UA 5HMLA 5ITSA 4LHWA 5FHQA 4PRZA 4MKZA 1UQRA 1WE2A 4H7IA 3SQNA 3A3NA 1BC5A 2P9HA 3VR4H 2FEPA 2YCLA 2AH5A 2FWIA 1MQ9A 4ZCQA 4OFWA 4X1IA 4H1HA 1EUDA 3AFNA 7ICTA 2OZLB 5G1NA 5CCEA 4O1HA 3WL7A 3IIJA 3DZKA 1YACA 4OI0A 3EEOA 2XUZA 3OZXA 4EBDA 2W2NA 2JVJA 5MDHA 4BLTA 3IEKA 4I55A 1UAAA 1JG3A 4J7CA 2Q8NA 3UH1A 1NP3A 2M6KA 3AEQA 4DMFA 5L3QA 4DNXA 3HCPA 5L6LB 1C1DB 1A4UA 5J0PA 3S8YA 2Z3ZA 4N5LA 1N7JA 3IEVA 1TKAA 5F9MA 2JBWA 3IDSA 1W88A 2A6PA 4NDAA 1ZJ6A 3RVRA 1CUXA 4M6WB 4HAXA 4TL6A 4XM0A 2GZMA 3AR9A 3PSIA 3AX6A 1NJ5A 4EQ6A 1Y4UA 1YR2A 4U6NA 3LC7O 1QGYA 3HBLA 1YR9A 3B8EA 4K86A 4XWWA 2QTVB 4WDQA 3EIEA 4P9NA 1IH8A 4PZYA 2WSYB 2IZZA 1GHTA 2XADA 4DVGA 4A1FA 3WLKX 3PEWA 4K88A 4MW7A 3KQVA 4CIAA 1W35A 4BMVA 2GXSA 2WE8A 5EUCA 4CR7A 5JFOA 2FMHA 2H1RA 4GLLA 1P7VA 1H2BA 3TO5A 1HUQA 2YVKA 4WY5A 5ILQA 4F46A 1C5KA 4P0QB 1IULA 2Q27A 4TRMA 5A0FA 5MN5A 4FHEA 1TMYA 2VDWB 1ZQXA 2OLJA 3EGIA 1HZZC 4LE0A 2O8BB 4L4SA 4MYDA 2VJBA 1LK5A 3L0CA 1J5EB 4I2AA 3PC7A 3Q7PA 2MUTA 1B7GO 3S1LA 3LHIA 2CNOA 1ISPA 3CF4G 3SCZA 2Z43A 1YE5A 4CKEA 1NXXA 2ILTA 3ZE2B 2D0IA 2DKFA 4BFXA 3AXSA 1FDTA 2ZJ4A 4TVBA 2BE7A 3V6HA 4Q7MB 4QRDA 4C5BA 4R98A 4HJXA 1KSHA 8ATCA 4C4AA 1FYVA 3VNSA 1D7OA 4K9NA 4IXTA 1SXIA 2XHZA 1KSGA 1L7VC 3D7RA 3PXCX 3DZDA 3O4JA 1B22A 5I7EA 3G0HA 3SE7A 4J0IA 1SV4A 2MSCB 2B4RO 8ICCA 1I13A 4UTNA 1TECE 4WJKB 4DIDA 1SUBA 1PJLA 1QLHA 5C1IA 1ULBA 5E2IA 1Q46A 2F77X 1Y4ZA 4UB5A 4RIEA 2QI9F 1FZTA 3O9ZA 3BWYA 4EA8A 1PUIA 3LCRA 4PPNA 1MENA 4RF2A 5LD2B 2XWBF 4CF3A 1MIOB 1DMSA 4K81B 1FFWA 3WLSA 2WA1A 1LSUA 3CEPB 2CKMA 1XSEA 5EXXA 1WMDA 2BZSA 4PCLA 1XGKA 1P33A 2FSHA 2VDQB 1T1GA 2LHTA 1BCSB 1ZU5A 2BFMA 3BFKA 4D92A 3VHXA 3F5DA 4H16A 5CW1A 1XA4A 1NIJA 1NOKA 2BFNA 1JT2A 2P4HX 4HNRA 3AERB 3CLKA 2YJNA 3AFMA 1XQYA 3S81A 3GLFA 1AU9A 4GP9A 4YROA 2VNIA 3G5TA 2QD3A 3ICWA 5TVGA 3PNPA 2QB5A 3O4RA 4N7RA 1FJGB 2XJ9A 4AXXA 1LBTA 5KFRA 4RS3A 1R16A 2IHZA 3CFYA 1AHPA 3LHSA 2DJIA 4KLSA 2CZQA 4OQQA 1NYLA 5KTTA 5TS3A 5FOTA 4A0FA 1HTBA 3PNMA 3DL4A 2G1AA 2WJ6A 1SU4A 1VSVA 3TQSA 1E5XA 1VHDA 2SNIE 3GAZA 4UMEA 5HR7A 3NBAA 5D49A 2G1UA 1N36B 3UZUA 3WOHA 4TXHA 3STHA 3IMGA 4W6ZA 3PUVA 1M7GA 3OCXA 2ODBA 5FTMA 5BSKA 3VUEA 4YMWA 4M1SA 1FFUA 1U0FA 3U4MA 5LP1A 4DDHA 4HVAA 5JY6A 2C7BA 1SK9A 2E4WA 1W36C 3MT9A 3DC2A 2PMZF 1EGMB 4QLAA 4FCWA 2RHFA 4BMNA 3MWDA 5DH9A 1GR1A 4G8JA 2A0YA 1R7RA 5ECWA 3AI2A 2G9QA 2IGTA 4G5SA 3ODGA 5JRJA 4QYIA 3KOMA 3QVUA 4ZRMA 5EWLB 5LU9A 3NIGB 1APBA 1UXGA 3FNFA 4GXTA 1L8XA 5I9LA 4N0EA 4BV8A 3V4SA 1D6NA 4NZPA 3NVKI 1JA1A 1M2WA 4L9WA 3VJRA 2BJVA 5EJIA 1R6TA 5C37A 4DAOA 1KK3A 3DMTC 2J3DA 4PZOA 3IQIX 1P6UA 3VDXA 2IFTA 4ZAFA 2Q49A 2CYCA 1JDZA 3HB7A 4II7A 4KNYA 4IGAA 2PUWA 3TMYA 1A5TA 2C99A 1NM5A 3GRUA 3I92A 2VHZA 1N9ZA 4IX1A 3DD1A 3QWFA 1KI1A 1FFYA 1VI6A 1FFVA 1L3TA 3BS7A 5ESWA 3W2IA 1PFGA 4LJYA 5JLJA 3TCKA 2XF8A 1NV8A 2IHMA 4DQDA 2H7YA 3B60A 3ZH9B 3HCAA 5EZ5A 3IKTA 2JIRA 3SZUA 4EPTA 4PC6A 3RF7A 1GZUA 4DVJA 4X7PA 4OG2A 3PGLA 4HRAA 1SHTX 1DV1A 2O2DA 4MX8A 4PLZA 1SVLA 2LV8A 1NBME 2GAOA 1YT5A 4RT3A 1BKDR 2ZP1A 1F17A 3D4PA 4FU0A 3VR5D 3VPFA 2OGUA 2MA1A 5HDBB 5DBIA 3I34X 3EQ7A 4BNWA 2B83A 1PUZA 4B84A 4P98A 4Q15A 3AM9A 3T7RA 2LKDA 2WV7A 1BOOA 3VNVA 4G23A 1WDMA 2FK7A 4GLFA 3RJKA 3NKVA 2P9GA 4KFCA 3LKBA 3ANLA 1TIKA 2HBJA 4RVHA 3QU2A 2Q3HA 4RYLA 4EWLA 3H9JA 1Y8RB 5IRCD 4QNNA 4HLUA 4Q4JB 3AQ4A 2KV2A 4BV9A 4KXYA 3LYAA 5KX5F 2F64A 7REQB 5DEOA 4TXNA 1MOSA 2GARA 4EVSA 1NW6A 4EJ2A 4FYWA 3JPRA 1P4AA 2J5BA 1MPXA 5HHHA 3L6EA 1YK1A 2ZM5A 2ZREA 3O8QB 4ED2A 5L1MA 3TF5A 5CT6A 3DVRX 4EO4A 1A5ZA 2V4RA 1CUDA 1KBOA 1MBZA 1VLMA 5DJ5A 1G8HA 3P0JA 2RD2A 3QLVC 1S76D 3WL6A 1NF9A 2D62A 2GD2A 4G0OA 1VMIA 4XM1A 3TMAA 3CVVA 1PK3A 2O3JA 4R7TA 4YCBA 3MT7A 1JWAB 1AQ6A 2BN4A 1XEAA 3AVQA 4W5JA 3MLAA 4Y3UA 2XAUA 1SC3A 3OT5A 3HYNA 2RMKA 3RJZA 2OT3B 1C0KA 5KNCH 3P9QA 4MHVA 3VX3A 1JU3A 2YBDA 1K8XB 4LJLA 4HVTA 1B2LA 1J20A 1XU4A 3B2QA 5C53B 2W2LA 3DOJA 4CMJA 2VC2B 5FYDA 2V6MA 1XMOB 2P27A 5F64A 4PQYA 2PMWB 4MICA 5F3RA 2HIHA 2HXYA 2G06A 3MLBA 3GROA 2H5LA 4M0CA 4BMDA 2YVLA 1AOXA 4B71A 4G1FA 1U0BB 4ZEOA 5K0JA 4KKVA 2BEJA 4LGCA 5KOHB 5HF5A 3PLRA 1ZH8A 3IN5A 3FGNA 3E22A 2Q1UA 5KWSA 4HYTA 3JAWA 1TF7A 2VA9A 1C80A 4H77A 4KLDA 4JXXA 3TLJA 1WUJS 1J24A 2DFLA 3THYB 5L51A 3GILA 5B1DA 3V4FA 2YVQA 3DHYA 3MWGA 5EINA 4M47A 4PGAA 3K6SB 1WF3A 1SOMA 2NXWA 5AUNB 2GBFA 2E1EA 3SE0A 2I3AA 1GEEA 3V6KA 4XA8A 3TX2A 1U47A 3CZ5A 3GFTA 1LLDA 1PHPA 4DNFA 4OLAA 3H2BA 1QYIA 5DNDA 3BBLA 1QK3A 3G88A 1YULA 4NBLA 1JHUA 3CPEA 4NLNA 1ZVMA 3UHOA 2ZPUA 3RARA 3MGBA 2ZRNA 4TLMB 1N57A 1FEZA 1W44A 2PD3A 1N61A 2G09A 3A1TA 5EXTA 1QTQA 3T3NA 3FBGA 4IOJA 3A37A 1SCDA 3GUZA 1JPVA 4NNJA 1QWSA 4PYJA 4NLLA 2FU5C 3Q2OA 1V47A 4Q3BA 3PFHA 1UDCA 3Q1KA 4MVYA 2EH9A 3RC2A 1MAUA 3PW0A 1A8SA 4LXQA 3KBOA 1Y0BA 1TB4A 3M6ZA 3N3BC 2OQ2A 3ZD6A 2NV0A 1NI3A 2JIDA 1UR5A 3TVTA 2ZWAA 3U5TA 1UBTS 1WPXA 3VBCA 1ZVQA 4PYMA 1BGWA 1FMLA 1QR2A 2C3YA 4JJ6A 4O2AF 3TNDA 3U3OA 1OPXA 1RRFA 2JCBA 2WEKA 3H2YA 3M4YA 2GFQA 1IQRA 1N3BA 4AG6A 2PO5A 4NLGA 2QN7A 5DM2A 4ZOHC 1RRKA 1GPJA 3NBUA 2AZDA 1E9SA 3G6VA 1COWA 1VGRA 4AMUA 4DR5B 2F55A 1U3DA 2PWAA 4R8LA 1TJ4A 3G68A 4BAZA 1E2NA 3U39A 2HC9A 2B5WA 3LQ1A 1VXRA 2K60A 4IGEA 2K2WA 4TSFD 2YX8A 4JQOA 4KO4S 3BRWA 4ZQCB 2COEA 4GGMX 4CKXA 1JEOA 1FVFA 2XT9A 4J90A 3AQFA 2AKYA 3L6DA 1XAGA 1N0VC 1PEKE 2PRYA 1CEQA 1M2KA 4FLEA 1ZWKA 3OLYA 5HFNA 4FFBB 1MB0A 1PZEA 2GLTA 3N7PD 1ZWLA 4FN5A 4MS3B 2KG5A 4KIWA 1Z6YA 5EP2A 1X8XA 4JBNA 5H7XA 4LJRA 3O2JA 2OHXA 3MINB 1P3Y1 1RXEA 2A9OA 1J2EA 4QWCA 4CUZA 1L4HA 2NM0A 1QZZA 1W5FA 3UMSA 2J4CA 4QEZA 2Y2VA 4PSVA 4K6MA 1EINA 3LS2A 4MIYA 3W6ZA 1L8OA 5BVHB 1GGEA 1O0SA 3CEHA 3IJPA 4JYPA 3W79A 1XN4A 2HR1A 4PZZA 2PXAA 3EUWA 1CJUC 1SD2A 3QXHA 4TYWA 4Z9FA 2Y0BA 1MXHA 5B1HA 4BBPA 2HQ1A 1E9AA 3CCBA 3TADA 5IG2A 4DY4A 3E8MA 3QTTA 4LF7B 3OQVA 4ZDJA 3VDNB 2HRZA 3J7AC 1DRJA 1ECGA 4MHSA 2WMYA 1AKWA 3UJNA 1GNQA 1OJLA 4RHUA 3DJYA 1OLUA 2Q8PA 3E8SA 4JN6B 2BUCA 3DL0A 3F6SA 1L5MA 4MDEA 3AI1A 4OYLA 1XJ5A 3UHAA 1UMDA 3TW6A 5AI9A 2PCLA 2ZDHA 1C50A 1L6NA 4BCDA 3CZQA 3NG1A 1J9ZA 1ED1A 5GPBA 1U7WA 3DTVD 4IIJB 1MW9X 1U2SA 3N2GA 1EVZA 3VC2A 1Y6QA 2P2GA 4Y2JA 1J99A 1FYWA 2RC5A 4RMGA 3D7NA 1LLUA 4UB2A 3O3NB 1KDRA 4EYEA 3NHAA 1H8EA 4GX2A 3LPLA 3ZV5A 4JYBA 2JGMA 3A4LA 5FBWB 3C5FA 4E5NA 2HT6A 2R7LA 5TPWA 1KH2A 4RKRA 3FI0A 3F6EX 4L0MA 1M2OB 1LVUA 5LA6F 4CTMA 4ZH4A 4D57A 3A14A 3C3WA 4Q3OA 2W9CB 1ORRA 3JYPA 2W3RA 4AMVA 4RFSA 2NN3C 4OB6A 4BCCA 4TT3A 4Q9NA 4ZO9A 3ADKA 5G41A 4B45A 3KKEA 4YP7A 1XA3A 1ZY2A 2VF7A 1DHTA 4DUGD 3MB5A 4K3VA 1OH6A 1OE0A 2H16A 3V6LA 2ZFUA 1Z6AA 3QEOA 4ZA2A 2WYVA 5DLQC 7ICJA 5DXAA 4NDNE 1PEDA 5JYCA 3PVZA 1P39A 3VZPA 1G7SA 2C94A 2HHLA 3T5JA 1UT5A 3WLMA 1B8UA 3VCBA 3PMNA 1JE1A 3DFMA 1SUIA 5HK8A 2JLAA 5IZ4A 3U3DA 4O3RA 4IGIA 2I34A 3L3BA 4IMPA 1L4FA 4XRGA 2PG3A 1Y5RA 4QM6A 4Q21A 4LRUA 4MLDA 1U9IC 2V58A 4P38A 2WBLC 5A0VA 1CZHA 1KI8A 3WGOA 1GM5A 3MOIA 3THWA 4HPWA 4ZXPA 2TMYA 1JEAA 4NCIA 2W6ZA 3AF5A 1ZETA 3HP7A 1QSYA 3W3AD 2ZUDA 3TI9A 4MQLA 3SLRA 1TA0A 5TPZD 1XMPA 4XGQA 1MV8A 3K5HA 1RRCA 1CZRA 2F62A 3ZDXB 1PWYE 1MHTA 3AUAA 3TSWA 2VAPA 2VJQA 6Q21A 1UXJA 1M2JA 1PK8A 3FTCA 4FOSA 4RK6A 1G20E 1YO6A 2IHJA 3NP7A 1W96A 4B6SA 3MXTA 1LBHA 2Y05A 2ISCA 4HH3C 3OPYI 1CUYA 3GLSA 3L4SO 3S4YA 2AC2A 1S6YA 1WX1A 2JAWA 3DF7A 4C7XA 4M2YA 1D8LA 2Y93A 4DCCA 2CXHA 1E3EA 5B37A 2OOSA 1VB5A 2FAXA 5KSOA 3KOWA 4OOFA 2VYFA 3FG9A 1TCBA 1QGOA 3F7MA 1YCFA 2GLUA 5JCOC 4B9SA 1NDUA 5DULA 4H4DA 1KERA 2AUNA 3WFZA 4OREX 2CLSA 1XA0A 2I99A 1MA7A 1NMXA 3BIFA 1J0DA 4ZOLA 1TCCA 1SHUX 2PE5A 1VZ2A 4YQWA 1NN1A 4QWWA 1RYRA 5EKTA 3FJOA 1UJMA 3NPMA 2IPLA 1TQ8A 2Z4TA 3I3SR 1NA5A 5CH3A 4ICAA 3PGVA 5I9SA 3E5MA 3F4LA 1R10A 3CB2A 1UPFA 4H7HA 4Q8FA 3TZLA 2GRAA 5GOTA 4UU7A 4WZZA 2EJUA 5HG0A 3O8BA 4V03A 3AGQA 3D1LA 4KNVA 3RRYA 1P9RA 4LY9A 3HJTA 4Z1OA 4R8MA 3C3MA 5IIJA 3BZBA 1MP0A 3WGJA 2JBAA 4PYLA 3C29A 3PKIA 5FUQA 5LJIA 3ZE1B 4JVOA 1Z07A 1EFAA 3K4GA 5AJTA 1AV7A 4XIIA 4IJWA 2P0EA 2W00A 2HKIA 5ULLA 2P9ZA 4CF6A 1HDOA 1L7XA 4JI6B 2GWRA 4RQ4A 2AZMA 4LF4B 4CM1A 3LZ6A 4GC7A 4F8YA 1NRIA 3S55A 2DXIA 1ZQVA 2ATLA 5J8YC 1UDWA 2ODAA 2EJWA 1O8CA 2ZIXA 3SJAA 3C6XA 2X4IA 1X0VA 4RJJA 4UDNA 1S0UA 2XMCA 3H4TA 5DGAA 4BO3A 3VJKA 4ESOA 2ZJZA 2QL6A 2H9AA 5REQA 1N75A 1KEEB 1IVSA 5JNUA 4J9NA 3DT8A 4ED0A 4ED9A 1TT5A 3PWTA 2OVFA 3G5UA 3MJSA 3O4HA 2UZAA 3KKPA 4MZDA 4NEQA 5YASA 1M5UA 3MM4A 4Y7CA 5CPBA 5FPHA 2QY6A 1C8BA 4PFKA 4RNNA 1NY6A 3LYUA 2Y9MB 3N7SC 4UQGA 1SCKA 2ZAMA 5KX5B 3H2HA 1Z28A 1F2UA 1JKJA 1FW6A 1FA9A 2MTBA 2R2GA 2HLDD 4NONA 4KQEA 1ZSYA 4J9LA 1VPLA 2VZ8A 4KR9A 2NUBA 2YTUA 3STVA 1REQB 1WVMA 2BWJA 1GPAA 4C6HA 1ZN2A 2X3YA 5A6VA 1SCBA 2RHBA 2XUPA 2GAJA 3Q9NA 3WY9A 1Y81A 4XFDA 5E9QA 1G4HA 2PGLA 2V98A 3NX4A 1QVAA 3IEIA 5FIUA 1GDDA 1YQ9A 4U02A 3MQ4A 3I0ZA 1MJNA 2NV3A 4RKFA 3CISA 2QL5A 4V0LA 1N60A 2GGSA 2EX1A 1NWCA 1N6NA 2YIMA 5EHXA 1ZQJA 1WEKA 4DMUB 2B7LA 4UFOA 4MW2A 5BUSA 1BW9A 4I2IA 1U0HC 4YAJA 4BO6A 5BNFA 1J0BA 2FPLA 3QK7A 4CG3A 6AT1A 5F35A 3GPIA 4HGZA 2D2XA 3DO5A 1BPEA 1UOQA 4JQYA 1PW5A 4FFRA 2OM2A 5F4ZA 4A2CA 2O0LA 1NQTA 1NJSA 2OG1A 2I6UA 3LUHA 3RUPA 1T3HA 4QO8A 4KIFA 4LHZA 1KYVA 4DJTA 1L8QA 1Q0SA 1PRYA 4F11A 2X2EA 2J87A 2AKEA 4OJKA 3AL0B 3O4IA 4ZMSA 5CB6A 2WDZA 4RM3A 5DGHA 5AVZA 4K9RA 4IZ6A 1DGQA 5GMOA 2GHIA 1A9PA 5F12A 3PE3A 4MVJD 3KD2A 2BM1A 4C0QC 7ICKA 2IDJA 2ZSHA 1GR0A 1K92A 4O4JF 4MITA 5ALNA 1F2VA 1U9IA 5T41A 3WZ2A 4AWXA 2EG9A 3G2JA 4I9FA 1EHYA 3ZJVA 3SHTA 3LCMA 1NMSA 2ZSAA 4ZT5A 1JHOA 1Y4SA 3N0TA 1OUQA 4HDRB 2PCJA 1ULAA 3Q11A 4GP6A 5CDFA 4RTMA 1CCWA 1OWMA 1AB6A 1BWSA 3SKVA 3HU1A 4LBVA 4GIBA 2AG0A 1H2EA 3VTFA 4EK9A 2L0XA <