3QUTA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 82
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qutA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qutA01
2QYHA 4OD0A 1L7PA 5ALFA 3QNMA 3SKXA 3U7EB 4MWOA 1RMTA 4DWOA 4BNDA 3SD7A 3WKCA 2FI1A 2RARA 2NO5A 2RAVA 2HEGA 3WK8A 2YJ5A 2B0CA 1RQLA 4UU0A 2BDEA 2ZBFA 4O8CA 1Q91A 2PQ0A 2FPWA 3KDPA 3OCVA 5AVVA 3KD3A 3I76A 1ZD4A 4DCCA 3CZ4A 2YMMA 3AR5A 2I6XA 2P27A 4KYTA 5AM5A 4UMFA 5AK3A 3FPBA 2JAWA 3TLMA 3KC2A 4IFTA 1U2SA 5JJBA 3AR3A 2C4NA 5ALWA 5AVWA 3S6JA 3ONNA 1ZD5A 5A3SA 4CF5A 5ALMA 3K1ZA 2JGAA 5AW7A 2CFSA 3ET5A 2B1RA 5ALDA 4BEVA 1Z4OA 5AW1A 4EELA 5AKKA 4KX3A 1RLTA 3HLTA 3MPOA 2HDOA 4YCNA 2JAOA 1T5SA 2OBBA 1TJ3A 2MU1A 3WK9A 1VJRA 1S8OA 1YNSA 4Y2UA 4HGPA 1IWOA 1CQZA 3FGOA 5ALEA 2Q5EA 2RBKA 1Z4PX 3AR4A 4JDPA 1QQ6A 1RQNA 4Y2JA 5ALLA 5AW6A 4GXTA 5AW5A 3DDHA 2W4MA 2B8EA 3QGMA 1J8DA 5AW3A 1YJ5A 5ALQA 1PW5A 4IG4A 1WPGA 4YIKA 2WFAA 5AI0A 1L6RA 3AR6A 1RLOA 2AMYA 2R8XA 3IRUA 4UMDA 3B8EA 1RRCA 5AKYA 4XE5A 5ALKA 5AKZA 2YMQA 3DAOA 4AP9A 4YH1A 5AM2A 2I33A 3L0BA 2G08A 5AIBA 3QU9A 3AR7A 2D2VA 3CNHA 2AH5A 3HYCA 4L6AA 2HOQA 1NF2A 1TA0A 4F72A 4EZEA 4UMEA 4OCZA 5AM0A 2CN1A 3BA6A 4GIBA 1EK1A 4AS2A 2X4DA 3SF0A 5AM3A 1U7OA 3FZQA 4CF3A 4NWIA 3L8EA 4EX7A 2ZOSA 4MUMA 1L7OA 1Z4MA 3N8GA 2AUTA 4ZEVA 2FUEA 5E0OA 2YN4A 3AR9A 1Q92A 4I9FA 1NNLA 1VJ5A 5ALUA 2JAUA 3L8FA 1X42A 5AIAA 3ESQA 2C9MA 3L1UA 3ESRA 5AK6A 2WF5A 5ALXA 2G09A 1Z4JA 4H1WA 3FVVA 5AW4A 3PGLA 5A3RA 3ZTYA 1MH9A 2FPRA 2ZXEA 3WK7A 1QYIA 3E8MA 5AW0A 5ALNA 3NIWA 1SWVA 3OCZA 3WK5A 1ZRNA 3E84A 3NUQA 3R09A 3IB6A 4FFDA 5AESA 4J2TA 3W5DA 2WM8A 4UMVA 4XPZA 5AKXA 3E58A 2ZG6A 1O08A 4BKMA 5AW2A 2YJ4A 1ZD3A 1Z4KA 3QUQA 2OYCA 1NRWA 2HF2A 3BWVA 4KX5A 4J03A 4QJBA 1ZRMA 2PR7A 3NRJA 4E88A 3EPRA 1SWWA 3WK6A 2CFTA 5ALOA 3L8GA 3D6JA 2Q4RA 4BYGA 2IYEA 1Z88A 5AI4A 5ALJA 3I1YA 3QX7A 1YMQA 2GFHA 2HHLA 4YGYA 2YMPA 3QUTA 2WF9A 1O03A 3ZWDA 2FUCA 1RMQA 1Y8AA 2P69A 4Y2TA 3WKAA 4OFZA 5ALIA 3U7GA 1WVIA 1L7MA 2O2XA 4OHFA 4Y2SA 5AKHA 2R8EA 2NYVA 2B8JA 3AR8A 3F9RA 4UW9A 5AI6A 2CFRA 1XPJA 1QQ7A 4G9BA 2MSNA 4XQ0A 1RKUA 1Z5UA 3QLEA 4EX6A 3NAMA 3IJ5A 1AQ6A 2FEAA 3ZI4A 1KYTA 5ALZA 3ZUPA 3U7FB 1T5TA 1ZOLA 2YY6A 2G07A 3L8HA 1L7NA 4HGQA 2NO4A 5ALRA 1TJ4A 1U2TA 5AKJA 3U19A 4FE3A 5ALPA 4B6JA 4EEKA 1ZJJA 3FM9A 4UARA 2W11A 4YIHA 1N9KA 3UMGA 4Y2PA 1FEZA 5AI5A 1TE2A 3QXGA 1TJ5A 5T41A 5AVYA 2G1AA 4UAUA 5AKLA 4I9GA 3RFUA 2I54A 4HGNA 4Y2XA 3EF1A 3DV9A 3MC1A 1RKQA 3WKBA 2C8LA 3QYPA 3OCYA 2AGVA 2GHTA 1RDFA 1Z4IA 5AK4A 4Y2QA 3QUBA 4ZEXA 5AVXA 5FP0A 1T9ZA 1SU4A 3UM9A 2IOFA 2HO4A 3L7YA 4CF4A 4PNHA 3UMCA 4KN8A 3SLRA 3SKYA 2ODAA 1WR8A 2YBDA 2FPXA 5AVUA 2B1QA 2BY4A 5AW8A 3A1EA 3WGUA 2GMWA 3M1YA 3W5CA 3N5KA 2R8ZA 3ZVNA 5AI9A 1Z4QA 3SHQA 3OPXA 4HGRA 5AVTA 2G06A 1WZCA 2YFYA 2QLTA 4JB3A 4BEWA 3NANA 5ALGA 1L8LA 5AW9A 5AVSA 3ZWKA 1U7PA 2PKEA 1U02A 2YJ6A 3QU2A 4Y2YA 3KOOA 1JUDA 5ALTA 4BX3A 3EWIA 3QU7A 2C8KA 3DNPA 4KNWA 3UMBA 5ALVA 3A1DA 3WKDA 4RETA 1F5SA 4RESA 2HX1A 4BBJA 1YS9A 2IA5A 3R9KA 5ALYA 4Y2VA 1CR6A 2EATA 5IS2A 2GHQA 2WHEA 4CE6A 4UASA 4UATA 5AI8A 2FPSA 4FYPA 1RC8A 2ZBDA 3GYGA 2Q4TA 5AM4A 1XP5A 2WF6A 3OCUA 1RPZA 3PCTA 1J97A 3NALA 4KNVA 4QQFA 3W5AA 3PGVA 1XVIA 1LVHA 2JARA 3WKEA 3N07A 5AVQA 4UM7A 3ZX4A 3ZTWA 3QU5A 3L1VA 2FDRA 4AS3A 4DFDA 2HF7A 3R4CA 4F71A 3I6BA 1N8NA 1VFPA 2I34A 3EF0A 3L0YA 2OA0A 5AVRA 3WGVA 1RKVA 5AKIA 3ZW7A 4HAIA 2BDUA 2EARA 1ZD2P 2DQSA 3P96A 2B82A 3B9RA 3WK4A 2C88A 5IT4A 3ED5A 3ET4A 3E81A 2GO7A 3OCWA 4G63A 2W43A 3I28A 2B30A 4EENA 4BX2A 3RF6A 4C4SA 3L0CA 2I7DA 3MMZA 3N28A 2HSZA 1EK2A 2G80A 3NASA 4XOUA 2FPUA 2P9JA 3SMVA 1K1EA 2I55A 5AK5A 3U7HB 2HI0A 1LTQA 2YJ3A 1ZS9A 2HCFA 2R8YA 4Y3UA 2G0AA 1Z5GA 4NV0A 1Z4LA 3ZVMA 4L6CA 4BX0A 5AHXA 3U26A 5ALSA 4NABA 2O9JA 5AM1A 5AKEA 3QU4A 4UAVA 3OTQA 4NFLA 2RB5A 3L5KA 3PDWA 4Y2RA 5AKGA 3A3YA 3VAYA 4YCMA 3B9BA 3ZX5A 3OCXA 3J7TA 1QQ5A 2WF7A 1S2OA 4C4RA 1RMYA 1YV9A 4HYTA 3QUCA 3KBBA 5IT0A 2EAUA 3ZVLA 2YMLA 2ZBEA 2WF8A 4CNQA 5A3QA 4NAVA 2IOHA 2ZBGA 3KZXA 1L8OA 1Z4NA 3AR2A 4UM5A 3U13A 3A1CA 3M9LA 4UU1A 3ZU6A 4L57A 4YCLA 5ALHA 1YDFA 3MN1A 2IOFK 5AICA 2P11A 3N1UA 5AVZA 1QH9A 2MU2A 2VKQA 2OM6A 4DW8A 4HGOA 4BNDB 4ZEWA 4C4TA 1RLMA 3FPSA 3W5BA
chains in the Genus database with same CATH superfamily
2I6QA 5TB5A 5L95A 1T9GS 2H1HA 1ZWKA 1FDIA 3NBZC 3AUUA 3P19A 4F6RA 5BV2P 1RSZA 1E1QD 2R6JA 4LWQA 3WV5A 4DY6A 1WB9A 1V8FA 3G5MA 3M5CA 4RM3A 4DCVA 1AD2A 1KAQA 1XHFA 1E62A 4LWOA 5HUJA 1BXKA 1CFZA 1PJTA 4C4XA 2YB1A 1U81A 1VPTA 1O6CA 5K8UA 1EXDA 2OP1A 3QOXA 1GU1A 1A97A 1GG8A 3Q2KA 4H0FA 3DLPX 3OEYA 4ETWA 4UQOA 5C0YA 2O7SA 3T3PB 4DIEA 3TLGB 2H6EA 1D2EA 3FFBA 1HYEA 1EA5A 1V4BA 2M32A 3GJXC 4H1VA 4RD1A 5I8ZA 2FVYA 3AHCA 1LBHA 1E3SA 4KH0A 4OQXA 5D1HA 4OQEA 3D2SA 1C29B 1HG1A 3KOWA 3DE2X 2Z4TA 3S28A 4KXNA 4W1RA 1S2IA 1QBGA 2BFNA 2DR2A 2CKDA 3NHKA 4ZYTA 5UKDA 4DILA 3BWEA 5A4JA 4R3UC 1V97A 5CD9A 3BWCA 1IOZA 4LHWA 2PVSA 3H1FA 1KQNA 2P27A 4NU0A 4C7BA 1CY1A 3PX0A 4IR9A 1PQYA 3B89A 5GONA 4JWKA 1DBIA 1TK9A 5EA2A 5EPUA 1EVYA 3AR3A 3FVQA 3MTQA 5CEEA 2A67A 4UHKA 4DCMA 5KOIA 1OYYA 1CY2A 4E03A 1MO2A 4PG7A 4ZVRA 2QKYA 1GGHA 4MO9A 5K2OA 1YBVA 1AE1A 5T8KA 1R6BX 2GLTA 4BFVA 3AM9A 4LOLA 3BK7A 3KXLA 2R60A 3WZLA 1PR3A 1T4BA 3H87A 1MC1A 1P1KA 5BV8A 1XCGB 2FPIB 4GX5A 5TDHA 3PR4A 1D9XA 3GY0A 4P3XA 1AZWA 1GYPA 3ZBTA 5B7QA 1IDOA 4QZEA 1MEOA 3QIAA 4HJXA 2WM9B 7MDHA 3ICXA 4YNBA 5HK8A 2EDUA 1CS0B 3IUNA 4OPMA 1O89A 4OHOA 1GEGA 1NW9B 3EEFA 1CQZA 1V7CA 3A25A 1F2UB 3QJYA 4J1TA 4ZALA 2ZE5A 1YL5A 3C0KA 4YRCA 3VVMA 3DW1X 3N76A 4XRRA 4EA6A 1Z4PX 4IIGA 1P62B 4LXHA 3A7EA 3IVGA 4L5BA 4M98A 3O26A 4CU5A 4B4UA 2VCEA 2GJKA 4GXTA 3K1AB 4MYDA 3G9TA 1CU1A 1OWPA 1VLBA 2X7JA 3HJCA 4W5JA 5KHAA 3T7TA 3VO1A 4BLWA 4IIEA 4CT4B 3TRJA 4AJLA 2O2CA 3I37X 4UHHA 4KPFC 4M6WA 2BFDA 2MYPA 3NU1A 1ZBDA 2DETA 4GDFA 4AMZA 3KVOA 4X91A 1KBUA 1BYUA 1COWA 3A9CA 3BXXA 3NHWA 1F6BA 4X60A 2FWRA 4ZO7A 4BU1A 1U7HA 1TD1A 2ZJOA 3E8SA 2HBLA 5E3HA 2Q5LA 3IRUA 2A6PA 1BQ4A 1X7HA 1ZXXA 3RVNA 1DTWB 4YH1A 5ETJA 2OCBA 5AM2A 1W0KA 2VK2A 1OU0A 3FUTA 2QN2A 1MVOA 4R63A 2CJYA 3PKZA 1OLSB 3N86A 5CGQB 2EL9A 2NZVG 3PJFA 5FTLA 2C4KA 4KL8S 2J32A 4MUJA 2Q5FA 3QX3A 4PJ0U 4UNQA 3E7WA 4B3BA 1ZY2A 4BAZA 2EFGA 1C50A 3HDYA 4CMIA 4ZVNA 3ZV6A 1H1LA 1PLKA 4UQGA 3GVCA 4AD8A 1H38A 1OCEA 3LYHA 4RIHA 3OIUA 4WOKA 4CKWA 1YF3A 4WNCA 4MW5A 1FVOA 5GGXA 3P1JA 3VO2A 3IHQB 5T3YA 2FRVA 5B3LA 4CV1A 1DDGA 3DMYA 2UZ4A 4KXYA 4CF3A 1Z8DA 4XJXA 1IH8A 1T9BA 3N05A 3PC7A 4V0LA 2R62A 2K2QB 2R4QA 4C7YA 3I3SR 4UUMA 2P8SA 2VHVA 2P0YA 1VZ3A 1Y81A 4UBIA 3P0HA 1GTRA 2H1OA 3GIMA 1LLCA 2XCQA 3UH0A 3OF3A 4F8YA 1Q92A 1L5MA 2NN3C 4I9FA 4MR9A 3TBKA 5KYGA 4GSYA 5ERYA 3GN2A 5BW6B 2GLEA 3IT2A 3LC0A 3NBAA 3ZY2A 3TLZA 2GJ4A 2FU5C 2HUPA 3B7WA 3L1UA 4QGGA 5DB8A 3ESRA 3IQIX 4REMA 1QFMA 4H27A 3MWEB 4ZOCA 2JK0A 1TZMA 3C70A 1TM3E 5TPZA 4G5GA 5IAKA 4PL2A 1CJVC 4HQLA 3PD1A 4UDOA 4M2LA 4DLEA 1T1JA 4MQ5A 4BDTA 3IL2A 2HBMA 2ASJA 1FFYA 1V3QE 4NAHA 4RTQA 3FMPB 4KIWA 1AQUA 2JAQA 5HKKD 4NLGA 2DUYA 4TLMB 1XO0A 1MA7A 1Z2EA 2WR8A 3GVPA 5KVSA 3I9LA 4S2UA 5HUHA 4KR3A 1CJCA 3JQAD 4NTZA 1CS0A 4UTPA 1L2TA 8ICLA 1WXWA 1UFOA 5E4FA 4AMUA 4JBYA 1F8XA 5GJBA 1ZSVA 2W93A 5E7QA 2XWQA 2O5RA 3ZNPA 3HZHA 5GM1A 1N9GA 4M0DA 2WM8A 2EF1A 1XSNA 3PDHA 4RV4A 3T3GA 3WWEA 4BVGA 5KREA 3D6FA 1HYHA 5KAFU 1E1RA 1GPWB 1P3JA 2VSYA 9ICJA 3G8BA 4PY2A 4QWBA 5ELMA 1MB4A 3CCBA 5BT9A 3R5HA 2XYRA 3GAZA 4J03A 1CBUA 4C4PA 5F7ZA 3I83A 5L3ZA 3GAMA 2P6RA 2OG2A 2PQ6A 4YMMA 4Z7NB 4OXRA 1YUMA 3WK6A 3T7JA 3Q11A 4I5EA 4X95A 1Q0SA 3OX1A 2XY6A 3AZQA 1N8TA 1ZH8A 4TKUB 3CCCA 2Y9PB 4ZKEA 4ALJA 3QXCA 2FFBA 2P35A 2FOLA 2HHLA 3DV0B 4KQMA 4HVCA 3O74A 3LDHA 3ICEA 3EJ6A 1L3UA 1TKBA 2REQB 2ZQ5A 2KFZA 3D3WB 3SSAA 1V37A 4ZEOA 1EVZA 3O8RA 3M1LA 2A19A 4B34A 1KDHA 3JQ7A 5I4KA 4CM3A 3SM3A 1MO6A 1XLTA 3K09C 3PC4A 1MF7A 4LJKA 3E0FA 4WXRA 4HAUA 1E69A 3AF0A 2LPMA 2C7GA 2EWVA 1SGGA 1KYYA 2C3MA 3D6UA 2AD1A 3MCAA 4OHFA 4EL5A 2B6NA 3LL4A 5KEIA 3VXKA 1C14A 1M5RA 3TQFA 4U2FA 4WK4B 4CV2A 3KR9A 2ZR9A 4PHGA 3TX2A 3RJMA 5FUMA 2WYVA 5M7EA 4L4SA 1PX0A 1WNTA 2GN8A 4C8KA 1ZCZA 3KUDA 4I6JA 3KVNA 4UHFA 2EZZA 1BXRB 1DNPA 1TZBA 3R44A 3RRGA 3DEZA 3R9XA 3G2JA 1CZLA 3C29A 3V1KA 1SKUA 1P1CA 4B2LA 1TPYA 3R5SA 4B35A 4EVIA 2QLFA 3C3JA 4ZCPA 4EHDA 3VKGA 1K5PA 3R8CA 3WLLA 2X19A 3HKEB 4C0SA 2MYTA 3B6KA 4MS3B 5C18A 2R1TB 3GRFA 4O25A 1J1UA 1C2YA 1K4YA 2ZTDA 3EWSA 2JGDB 3GDFA 2NO4A 4MVCA 4YONB 3EVEA 1DTSA 4IR7A 1U2TA 2RH8A 1AMUA 3EZ7A 4Q3OA 1E3MA 4NZYA 2QD2A 2GWSA 1EX1A 1XMSA 4WE3A 4Y98A 2EYQA 3D5EA 1GPYA 2Z6AA 4DSJA 3C8DA 2DWQA 3VPAA 5J0TA 2AN3A 2VRCA 2NO7A 1IQ0A 1BXRA 1QYCA 2V7TA 4R41A 3N8HA 3ZW8A 1W5BA 1UZUA 5I9BA 4QGFA 4DSZA 2DWUA 4IX1A 1I7QB 2GN4A 4UNPA 4WKGA 5BOSA 5K6AA 3A9VA 1K9SA 3B3AA 4OMCA 5FQNA 1SUWA 4AZ0A 4HWPA 1YVUA 2PGDA 2UYQA 3SEIA 1GGJA 4RAQA 3D31A 2OV3A 4MLDA 3TW6A 1VOTA 3EQ7A 4DSUA 2GHIA 3DV9A 2P9QA 4J0KA 3T3HA 3DAPA 3Q98A 2HBQA 1OZGA 3WKBA 2C8LA 3GNLA 1YR7A 3G2IA 3L7MA 3HP4A 4FGUA 4F5WA 4BJHB 1F7UA 3MRVA 1O0BA 1KL9A 4F2RA 1NVDA 1TM4E 4K86A 4MDFA 4TRRA 4YR7A 3TADC 2O0KA 1S8FA 2XW6A 1LPOA 5JZ9A 2ACEA 1C0KA 1LV7A 5H4GA 5IJ0B 5ICSA 2I76A 2PDAA 3LXMA 1ZQ9A 4G4IA 4MWDA 8ABPA 5I8WA 3I01M 4G4SP 1PDWA 3QKRA 1DV1A 1P0PA 1M2HA 4FLFA 5J9FA 4B4KA 1O58A 2GESA 2Y68A 4OQQA 4YT2A 4CF4A 1KFKB 2I4RA 4PC1A 2BE7A 4JJFA 4EJMA 5B2EA 4LJ8A 5EZYB 1O6BA 1FDUA 4BUJA 3SJ7A 2B1QA 2IOYA 2BCGY 1R1DA 3EVCA 2P91A 4I2NA 4YGXB 2ZRCA 1MQAA 5CXXA 4W6ZA 1K1QA 2D6FC 5BUZA 4ZGWA 1FVHA 3O95A 4JKOA 4RL6A 4DJEC 1CQXA 2I2BA 3H9EO 3LMKA 4PONA 4XX0B 3IKLA 4D4GA 2RLTA 4CIBA 3V2UA 2WV9A 3WRYA 2ZUCA 1TK5A 3FNFA 3P9CA 5DNYB 2PZLA 1BC5A 2XUQA 1IXSB 3K0CC 1E7WA 4V1CA 2OKGA 4Q3EA 1UJCA 1CJMA 3L7AA 4C0HA 1A9SA 5GONF 1CUYA 2NSYA 3UJBA 1OBFO 2VTDA 3K2EA 3LDAA 2HCBA 5CH5A 3R7NA 2W98A 3WIUA 4X8OA 4ZP1A 1OI2A 1VFNA 5F9FA 4QXRA 3WR5A 4DFMA 2J30A 1XLTC 3S0JA 2V6MA 4LYJA 2XCSB 1O97C 2I9PA 2GEUA 3SEFA 5EJMA 1Z6ZA 3HFRA 3CYMA 3PI7A 3C1AA 1PJ8A 1E6KA 4GD3Q 4G8DA 3LVWA 4U3JB 3TW8B 5C35A 3HL0A 2BLLA 2W4QA 4CWAA 4EPVA 2K8BB 3D02A 4B1FA 2J9GA 1NI4B 2YWBA 4DLNA 4FOOA 2YN2A 5IEBA 3ADBA 3DOJA 4C0ZA 1FFCA 4KO1S 4FGWA 3A0UA 4N76A 4BEBA 3PR1A 5DXFA 3SSMA 4EG7A 2F8LA 2PX0A 2OHXA 3VU3A 1OWOA 4KFUA 4OYRA 1NZPA 1EP3B 1BPDA 3ONWA 3TZKA 4GMKA 4ODIA 4BNNA 3S8EA 3PNYA 5B1IA 3VYWA 3H86A 3RFXA 4X97A 2C9ZA 2XYGA 1U2DA 2C4WA 1AKNA 1RU3A 4U7WA 1T0PA 5DN9A 5BOSB 3W3AH 1XBTA 1RC8A 1W0CA 4NVRA 1I7NA 3AUYA 5CUQA 3UJ8A 3NORA 4UFPA 4R1NA 4IIYA 3GDXA 1JSZA 1ZH4A 5K0JA 3RRBA 4H7FA 4QICA 5JNRA 1THZA 4RADA 4F60A 2VXOA 3PGVA 5IDXA 1KU6A 2J0UA 2O0HA 3D6AA 4HWTA 4L5YA 4D80A 1OC2A 4HL6A 4QXOA 4FHDA 2QRMA 5C7OO 3HXOA 4AUEA 2BKAA 3C8UA 3FOCA 2QARA 2YV1A 2ZKLA 5B6JA 1A9RA 2H0AA 3M6FA 2HA3A 2Z8YA 5CVVA 1GY8A 4HAXA 3VNRA 4CW7A 3HBFA 3WLIA 4X20B 3C14C 1R9MA 1T8PA 4ED0A 1LBIA 2W2PA 3V6HA 1V41E 2XODA 1WSBA 4DXHA 4ZIRA 3TAHA 3PE4A 4DQPA 2W3SA 1CUDA 2CXUA 1TIBA 4RX1A 3CF4G 1U0FA 2VC2B 2B9VA 2V03A 3KV3O 4NARA 2J6UA 3ADCA 1QOPB 3ROXA 3ZEIA 1KO4A 4LZDA 2QL7A 3MUEA 3B9RA 2LP4Y 3ONFA 1Y5RA 5CHEA 1DK3A 1CG6A 1FNMA 2H2GA 3WZ2A 1QZZA 2BC9A 2C5FA 3PTZA 4TOIA 4B4DA 4UB5A 1LX6A 3VAAA 4G63A 3MBKA 1YWGO 3O75A 3JQRA 3KYIB 1RM5A 1D9FA 2I7DA 5A4AA 3MMZA 3PQ8A 1ZNWA 1KEVA 1Z36A 2Q3HA 2CDRA 3HZRA 2XV1A 3L7NA 3W5VA 5M5BA 3RIYA 2MAXA 1USIA 2FMSA 3B6MA 1W46A 2EDAA 3EBOA 2ID9A 2JH8A 4CTNA 1RG6A 1Z6XA 4JP8A 3R9IA 5TJ9A 1N34B 3HK2A 5J59A 3WWYA 1L4KA 1IVYA 5DSTA 4B8WA 3DDSA 1VPWA 2Z8XA 1L4FA 4MJ3A 5I7FA 3Q9LA 2HCFA 3H2YA 3HKCB 4PLWA 4BE4A 1C8KA 2O3RA 3HJNA 3VC2A 4OLJA 3LDGA 3JPRA 3P52A 4GZLA 3WHPA 1DBRA 1TVCA 3KWLA 4EYKA 3ACDA 1JSLA 3HKDB 4QUDA 4KQFA 1UC5B 3G5LA 2PT7A 1XQYA 1YRYE 1SKAA 5GV8A 1N6LA 3C5CA 4LHSA 4NENB 4Z9YA 1XDWA 2AEEA 3TOVA 4YYEA 3H4IA 4EYOA 4AVYA 2GN9A 2Q49A 3FD8A 2H3HA 1HNNA 4WXHA 1AKRA 1GJRA 2MYUA 4DWIA 4CN8A 4ND3A 4BV8A 1S7CA 5GY7A 3TH5A 1FS5A 4OJLA 2GJ9A 3R6LA 5M3BA 3ZX5A 4IH4A 1N56A 2IPMA 5CFLA 3OD5A 2JKYA 3PWSA 1IHPA 1UXHA 1KP2A 3PO5A 3LCRA 3FPJA 3FCCA 3SZOA 4EF5A 3DT8A 4OK6A 1NTOA 4Q47A 2CNBA 2AX3A 3WADA 6LDHA 4KUGA 5GONB 3Q72A 1ZI9A 3F74A 4EQZA 1GGFA 1P1FA 2YZNA 1E1QA 2ZUFA 5AHWA 3V72A 5HE8A 3OFKA 4U2CA 3L6CA 1JR6A 1GQSA 1D6SA 3TNYA 3LYAA 5IC5A 4H7EA 2VUTA 1G41A 3CEPB 3FOWA 2DR3A 1E5QA 1H9BA 2JFVA 2IFTA 4R2IA 4BP3A 4I1PA 9ICFA 4HC4A 3T7EA 2HBYA 4L0CA 1AHIA 3PS9A 3U3KA 1UT8A 2OXFA 2B4YA 3BC1A 4YJFB 1QPBA 1I2AA 2EBWA 4X8LA 4ZYYA 5B3JC 1UKEA 2Y1WA 4LDNA 2G9NA 2EQYA 1UADA 3D4NA 3LVVA 4MQ6A 2TMGA 4KBFA 3NHLA 4RO0A 4UCWA 5B7NA 5JSHA 8ICQA 4GOXA 4MP3A 3FKSD 3ZQ4A 3IO5A 3UOGA 1T6BY 1N8SA 4AT1A 3LHIA 1L7AA 4X3CA 1FUYB 2HADA 3OIGA 3CH5A 3VQTA 2B78A 3CGWA 4PYLA 4YXMA 2UZ1B 5EPOA 3FUXA 4EKNB 3HWX1 4KAFA 1X7WB 4L74A 1SHTX 1PJLA 2VP6A 1G21E 1FU8A 3ILYA 3WK8A 2QTMA 3BN3A 1Q8KA 1Q1ZA 3BICA 3EVFA 5L1LA 4TTIA 1FMCA 1H4QA 4MI1A 2JJMA 3L0DA 5LA6A 4HWSA 2BFOA 4FYYA 2FJ0A 5EJ2A 5FTMA 2Y0CA 1AT1A 4N9WA 4F50A 3COZA 1CHNA 4JX9A 2O2GA 3I76A 2W2VA 1D2HA 3MTDA 3ZCRA 1IUPA 2VDOB 4RXUA 4MRMA 2GFIA 1P1IA 4O63O 4BNLA 5LKAA 3HVUA 3O8QA 1A2QA 3OD1A 3WGGA 4IWXA 4PO1A 4BQIA 3AW9A 4RVUA 5KINB 3BTSA 4V0ME 1NN5A 2AJLI 3S2YA 4UBKA 3VH3A 2EF0A 2FMXA 3CF4A 5LLTA 1GTVA 5KFZA 1BEUB 3NRCA 1ZNZA 4IIJA 4MS1B 4NATA 4QRIA 2FPOA 1Z0FA 1YI0A 4MUNA 2YDYA 2BDPA 4A8JC 1IRXA 1U7DA 2NPFA 4B75A 2WYIA 3SQOA 5D5PA 2GETA 1MHPA 4MHOA 5LUAA 1U6KA 1CE8B 1CR4A 4XD7A 2G6BA 4I5IA 4JWMA 5A9SA 1O87A 1XTZA 5DSXA 4JXZA 5K3SA 3KYJB 2CUTA 2EAMA 1E5LA 2HHAA 2GLXA 3F2VA 4MHSA 4Y2UA 3QG5A 4DSOA 4HGPA 1IWOA 1DT3A 1SIOA 1TU0A 2Z6VA 2BFWA 3FCSB 4IJ5A 4M55A 4CHTA 2HRCA 3T6KA 1TUGA 3UJHA 5F9HA 2CL6X 1KS9A 3V42A 2JJ1A 4WN9A 5KZMB 2QMUA 4U7GA 3TVYA 5T4BA 2NOAA 3KE9A 1T6ZA 3HNPA 1P75A 2XT6A 1RVDA 4K9MA 4CLDA 1WCLA 4LC1A 3RTAA 4BQSA 4DLZA 2HN9A 4MQ4A 4LRUA 2P6UA 3TQ1A 2DXIA 2NM0A 8ICFA 5DNVA 1BEEA 2Z9BA 3JQGB 1RE1A 2GRAA 3M6XA 4X1KA 5B37A 3V1NA 1U99A 4H9GA 4HDSB 3PLAE 5P8WA 1T36A 1WSAA 2AMYA 3JVEA 1RBQA 4UMDA 2ZI4A 5JS1A 4GKJB 3DQQA 1YVEI 4RZQA 3N8NA 1E7RA 2AFIE 2YMQA 4YRBA 2FUG1 5JADA 5A7HA 4GX1A 4Z0PA 2ZIEA 1Z6AA 4NQZA 3HADA 3WOHA 4D0NA 2KP7A 2EFYA 4ZXPA 5DG7A 4RNDB 3RI3A 4D56A 4UVDA 2XKJE 2XIQA 1CZOA 1QSSA 1I1QB 3VU0A 3KZ1E 1BE6A 3LUCA 4MAFA 1O9GA 2BLNA 2XQVA 3PIIA 4YREA 2NRXA 3SR3A 2QSZA 3T34A 1W6UA 4KMUA 3B52X 3EGXB 5TEVA 2LBOA 3HO6A 3BE6A 3K0AA 3QVSA 3ZBPA 1UPTA 4I2AA 1NMXA 2H51A 2VQDA 2ECFA 1OYVA 3DBOB 5B2ZA 4J8PA 1G8JA 3WYEA 1SKBA 1VSVA 4N5LA 4NBTA 4NKRA 4EVSA 1DUVG 1OFUA 1SXDA 3GU3A 2V74B 1PZNA 2JD2A 2BT4A 3LIIA 4F9FA 5BYKA 4R8UB 2DC1A 4MUMA 4RDIA 2WVGA 1IE3A 4ZCIA 1K0UA 2ZJFA 3GX1A 2AKEA 4OHYA 1G20B 2ZUWA 4DL9A 4QGSA 4RORA 5AVJA 2YNMD 3RAJA 1VECA 4EGFA 2VQFB 2FX3A 2RRDA 5HFAA 2HLDA 2I4TA 2W6ID 1VJ5A 1WEKA 3AU8A 3T1QA 2JAUA 5H83A 1IQPA 4M3NA 1DAKA 2YHBA 3H4TA 2YHUA 3CMCO 1Y8RA 5IFKA 2RHWA 2PUDA 2YHAA 4GMXA 4LDPA 4JJ6A 5DB4A 4B6EA 3GARA 3FMFA 2CXPA 2V0GA 1Z22A 4X8HA 2A0XA 2Q1SA 5TQ2B 3FVVA 4RNOA 5BPCA 2WZBA 4PGQA 1UK7A 3RH4A 2Q9UA 4RDHA 5DYGA 3STTA 1PWHA 3E1KA 2QTWB 3KJXA 3F4BA 1ZAYA 2JJ8A 2XITA 2XWJI 4ME6A 4BV9A 4HR7A 4CL3A 5DTQA 2YIDA 3R09A 1TK3A 1G6OA 2IYRA 3JRWA 1NZBA 2GJ8A 3WIEA 3SX4A 4RZUA 1DC6A 4L1KA 4R0MA 5CB0A 4J2TA 1SXQA 1PR4A 2DPMA 2IYOA 4HEA1 2UXCB 1AS0A 1NW8A 2XUAA 4C7ZA 3B1ZA 3LNCA 1B0ZA 1DELA 2ZG6A 4UMVA 1N2BA 2BSAA 3B2EA 4KLOA 3KPUA 3OESA 1BXGA 4WGFA 1LJUA 1M8KA 3T06B 1YA4A 3KRTA 3W9BA 4CV3A 2C7QA 4ZVOA 4NLLA 4NHEA 3GUYA 3VM6A 4DVJA 4J9PA 3SQWA 4NNJA 1V8PA 2Q0QA 1EGMB 3EPRA 4ED8A 3WLRA 1W85A 4BLQA 4BRUA 4XWOA 3EGDA 3JQGA 4IFEA 4X1KB 2QG9A 1YIAA 2AYYA 3AESA 3Q3VA 4CKEA 4EHIA 1CQIA 4FYHA 3L4KA 3DVAB 1K2WA 1PQWA 1QDEA 4FFLA 3WGIA 3AF3A 4F92B 1JROA 1TAUA 3EY9A 2RHJA 3E23A 4I0WB 4QJIA 1MIOB 5HM6A 2E85A 3NM5A 1C7IA 3BCSA 3HKDA 1MX3A 1V6SA 3OKAA 1ZVQA 4HEA6 3RFAA 2V7QA 1PGOA 2HVHA 3ZVKA 2HVIA 1VIMA 4D5EA 1FVXA 3AYXB 3C3YA 1WMFA 3NNDA 3U0VA 2O7QA 1LLUA 1D09A 1UXKA 1QNFA 2HTEA 3DYBA 2Q7OE 1G8SA 1Y7HA 2YX1A 4M9GA 1CJBA 1JJ7A 5TZVA 3ZLUA 1UPXA 4DCSA 2R8EA 4DE5A 3ORHA 3V2IA 3CNQS 1WZEA 1L7VC 3DL4A 3RBAA 1CUFA 3BRWA 4Y18A 4KXQA 4MIEA 4PPQA 1XPJA 1SC9A 3F78A 1SVLA 3F7TA 3FPEA 4HQRA 4L8WB 1QQ7A 3AB3A 4FGLA 5HF5A 3TAXA 1NF9A 1W96A 4XQ0A 4LGCA 2X77A 1R64A 3KR2A 5IJ9B 4GI3A 4B6PA 3RAQA 4NR0A 3VR4A 4R83A 3QVWA 1A72A 4Q05A 2F8SA 2O1WA 4QIWF 1K75A 3OQ6A 4IVPA 3ZJTA 3F5QA 3R3ZA 4Q9JA 1ZUD1 2NAFA 2D0DA 5EWJA 5LQNA 1LWNA 3DGFC 4B40A 2Y0SF 3KVVA 5D5HA 4YXJA 1P0MA 2FCAA 1RCUA 2X0DA 3RUHA 1X9SA 3QFSA 4E09A 2MTBA 4RQ8A 2YWXA 3HCPA 4HGQA 4Q37A 5BR1A 3E61A 1P2BA 5CG1A 4HUJA 2P3SA 5TQ2A 4EEKA 3EA4A 4DAEA 3OIVA 3DOFA 1F8YA 2Z8ZA 4UARA 1UMBA 4LAFA 4KACA 1AV6A 3TSZA 3Q6MA 5EFOA 4C7OB 1N0HA 1JLKA 2DGDA 1U0OC 3KKKA 4MW6A 4AF8A 3MAJA 4EJSA 4TUSA 1DKPA 3EDMA 3M9MB 1M1YB 1PR9A 3DZ8A 4O2RA 5DHUA 2FLVA 3TZLA 5HCUA 4BLPA 4YCAA 5AVYA 1Q0TA 1D8BA 1A9QA 5E0KB 2WFLA 5KYUA 4X1YB 1RM6C 4DA9A 2PAAA 1R8JA 3VC3A 1YQDA 4IV5A 2ZP1A 1UEIA 3ZUGA 3D2QA 4GR5A 3JW8A 1KMNA 1GRQA 4GL4A 5EXEA 3QX9A 2AK2A 1D7AA 2CUZA 2FFHA 2RCYA 3U60B 3PXXA 3DF7A 2XMCA 1L5NA 3F5FA 3EXEB 3QUBA 1RYZA 1W5EA 3I5MA 1G18A 3QLVA 1MOZA 1UDCA 4J0JA 1XTUA 4X9XA 4CIVA 2AJDA 1YHNA 1G5IA 3VYSB 4WXEA 3L0IB 3OOWA 4ARZB 5C5EA 2WSLA 3ETEA 4GNKA 5DF1A 5TNXA 1URPA 1ORTA 4W5RA 5BN1A 1TMYA 2JS7A 4FUQA 5EJ7A 5C5JA 3ZHCA 3QOWA 4B4VA 4D96A 4ECAA 2CVZA 1ZQOA 3BRCA 4ICAA 2J48A 2GMWA 3PFNA 4F2WA 3GMSA 4B71A 2IX9A 4KWIA 2WVAA 3OWHA 4BNJA 3EUEA 2BGLA 1DFGA 3IURA 4D8TA 5CFNA 3VYRB 2GI4A 3E2IA 4K8RB 4C0BA 1NSYA 2YFYA 2IH4A 3OZGA 1C1XB 2PIDA 2QDXA 4NBSA 4XA8A 4Z54A 3ZV7A 1J39A 3WLTA 4HV4A 3UJAA 4OJQA 1JNXX 1XRPA 4O5KA 2H3FA 1DWOA 5A02A 2RGNA 5EXTA 5F12A 1I4DD 2MDTA 4XB1A 3S5UA 2V1UA 4CQNA 1IU9A 1XNGA 3HACA 1I1HA 3SDBA 2OCLA 1US8B 3K9GA 4N3GA 4WY8A 3DBRA 5CP8A 5I9TA 4BFLA 2JCBA 4ZT7A 1I5OA 2OV2A 1ORHA 2AV6A 4TMKA 3CH6A 3DEFA 2G40A 3D6NB 2EW8A 2FP3A 1V1RB 4A1FA 4IS7A 3IE2A 3OCCA 2O6HA 2V6FA 3AFMA 4HBZA 4M21A 1U4OA 2EBUA 1FRQA 2VDMB 4ENSA 3LQFA 1RKXA 3RSSA 2HDWA 3ZXXA 1HDYA 4UXIA 4FCWA 5T4FA 2J46A 1M6WA 4AAYA 1M33A 3L3BA 4C78A 2JCVA 2FFAA 2FRXA 3F3MA 3KDAA 3P9IA 4DL2A 3WMRA 1ADFA 1FMTA 3I04A 3WXBA 3E1SA 8ICCA 3GEBA 3B9QA 3JR7A 3FLMA 3E7PA 4PSCA 1ID1A 3A06A 1HDXA 2WTBA 4TKMA 2QIPA 3E9RA 4X85A 4PFJA 1HLDA 1S3SA 1P8JA 1N2JA 3D2BA 5FO1A 3PHLA 1E9SA 3WGMA 1OXJA 3DE6X 4EW6A 2FSVA 2K4PA 4DN6A 2Y9TA 4ZCTA 4GRDA 2HIMA 1T8UA 2NADA 4BVLA 3GFSA 1DIBA 2ZBDA 1U9ZA 1ELOA 1QAOA 1P45A 2ASLA 2YZMA 1SBTA 1PR1A 1XP5A 4N7BA 3ZGZA 2NPIA 5FEMA 4C7MA 2J5RA 5DT2A 5L3QA 1ES9A 2PZKA 3ISTA 2G8NA 4N03A 2Y67A 2XOKA 2G88A 1CKEA 2G25A 3CKMA 2BEWA 3IRVA 2FN8A 4XJTA 1U2GC 3T3DA 4YRAA 4ZCMA 3WKEA 2E1EA 3THOA 1BX0A 2H9AA 4NQRA 3UKJA 1IVNA 3PE3A 3LQ1A 1AUQA 2CMFA 3RC3A 1K3UB 2PS0A 3TD6A 3GXBA 3ZCSA 4DG9A 4DDVA 5A2GA 1MNAA 4I14A 3AQIA 3I6BA 4TUYF 1VFPA 1TCBA 6YASA 3LFUA 3LSYA 3C24A 4HB0A 5GPBA 3WGVA 1W88A 3KOYA 3DR3A 1PFQA 1YMUA 2BFPA 3GLVA 3PUHA 3CM0A 4JL8A 4V0OA 1Y7TA 3EFOA 3RNLA 1DPGA 4KTQA 5DBCA 1XMVA 1U98A 2GN6A 2I0FA 2VJKA 4RK5A 2XZOA 3AVTA 2B82A 2JIZD 2REOA 4I9NA 1PG5A 3JQQA 4FR2A 3WC4A 1QOZA 2JVIA 4WCFB 4TXJA 1QGUB 4MPPA 2WQ6A 4MPJA 1FOEB 3TBHA 2OWEA 1T3LA 1R8YA 1QNLA 5GP1A 2W6MA 3OQOA 1GSAA 2Q9BA 1E1DA 2B30A 3U40A 3M8RA 2HXYA 2QN1A 3H2BA 3VU1A 2ZR8A 4L0DA 4PZDA 2WKWA 1NT2A 1XHEA 3D4LA 4HO1X 4EATA 4J3NA 3ASUA 2KV2A 1EGHA 2PXAA 3DO6A 3JQ9C 3KJQA 4MDYA 5LU9A 3T52A 3PZPA 5C81A 2HI0A 4N6OA 1F48A 3QSGA 1ZS9A 3D4PA 1TVMA 1X39A 3DO8A 3I9OA 1UQRA 4O4HF 3X2EA 3F5AA 5I5GA 5DB6A 3BB1A 3OTWA 4FPXA 1QCYA 3IAXA 3QKSA 3U26A 2RHMA 4ZQIA 4E46A 4S04A 1KDRA 4FMPA 4GKVA 4JOQA 5DM60 4M0LA 2OOSA 1PLLA 3BJYA 1LWOA 1FSZA 1ZM7A 3QU4A 1I51A 1WU8A 2OD2A 2REXB 2LTAA 4JUCA 4BTEA 3OBIA 4OLBA 4ARCA 2B4RO 1QYXA 3OEEA 4L51A 4LTDA 5CLIA 1QFXA 1DS6A 1WB5A 2BWJA 1E4YA 4KUEA 4LVSA 3JRXA 3CW2C 1KNXA 5T6BA 3SZLA 2AIRA 1V5GA 5C4GB 4CPDA 5HTOA 2OPBA 3PTLA 4LKOA 5BO5A 2QYTA 1L4YA 3S2FA 5KWJA 1SVKA 4ZHSA 3GC6A 9ICBA 1Q1EA 2WD7B 3I52A 3BS7A 3FROA 4BWVA 3L9WA 4XGQA 5I6DA 2KSOA 4F5QA 1DUIA 3E18A 3JYHA 3N8IA 3WIOA 2XXBA 1OW5A 4CG1A 1E60A 5JSQA 2OXIA 1AN0A 2O5EA 5DTMA 3M6MD 4EGSA 1NWCA 3QWAA 1ZQJA 3F97A 8ICGA 5D00A 4J9MA 4KWTA 4Z86A 2X8JA 3VSDA 2WM3A 2A9RA 1Q0HA 2Y99A 3O03A 3ST7A 3WLNA 3ZE7A 3H2ZA 3L1HA 2YTZA 4MJLA 4F4JA 4IOLA 1M2KA 1HK7A 2C2MA 4BUGA 4PG8A 2IUSA 4Y0VA 3DYVA 4DW8A 3GWZA 2OQIA 1WHSA 3L79A 3U4IA 4YUWA 4C4TA 1XA0A 4OQZA 4W6QA 1G4AE 2K2WA 2RFLA 3AB7A 4NPCA 4XD7D 5U4XA 1LRKA 3DT6A 3C1ZA 2OUKA 3AJ9A 4I4TB 5SZJA 1SU8A 1B6TA 1YE5A 4GYWA 3UATA 2ZUTA 1FP7A 3IUSA 2BHLA 3VHLB 2QU7A 4B7CA 3KXKA 2HEGA 5HWSA 4BS9A 3WSVA 1NFFA 4JC4A 5THQA 1OBCA 2F67A 1T0JB 5CW1A 2P68A 2O3QA 3AKCA 3W04A 2C42A 7ABPA 1Q20A 2FEMA 1HDOA 2R5NA 3IN5A 1O1YA 1G8MA 2FPWA 1KBZA 3EGCA 3K20A 4IMJB 4FYWA 5H3CA 3ANMA 3LDUA 4AWBA 4D02A 3M5PA 3FPLA 3BBPA 4LWPA 3IXQA 4F12A 4OI4A 3L92A 4PYJA 4J0QA 1UBCA 1CD5A 2LD4A 2OHGA 3H9QA 3UYKA 5DLYA 1CHDA 3FKQA 3WHLA 4ES6A 2IS2A 3HM9A 4MQEB 1KAGA 2PEZA 1BH6A 3W8NA 4EJ2A 1MG5A 2CNWA 4C6HA 2XNCA 2PIAA 2GCPA 2ORWA 3IAAA 1ZQFA 2H5JA 1Y1PA 4EG4A 5ALMA 1F0NA 2CLOB 3TF5A 1ULTA 4JLAA 4NY8A 1FLAA 3OFVA 4OREX 1CY0A 1JVBA 3AIMA 4PLTA 4MI9A 1DKOA 2O2HA 3LF2A 3SLGA 3TDNA 3NWJA 4QXQA 1NPDA 4N5MA 2QSYA 3AUJB 3L8DA 1YRWA 5IN5A 3EOBI 2LCIA 3B60A 3DD5A 4G67A 4JJ7A 3WYGA 5IWAB 4BMVA 1I3KA 2WHQA 3EVTA 2WAOA 1LA2A 3FY4A 5EXSA 5K45A 4L0MA 1ZQLA 1KI1A 3C1YA 2CUNA 5A0LA 2BPGA 1JPNA 1KF0A 4MW7A 3KPWA 4U9UA 2VIXA 2P9CA 2GARA 1I36A 3W8RA 2IU4A 1AGXA 2CXTA 2QTHA 2VDJA 4UKDA 5KSZA 3KG2A 3LZCA 4IY1A 3EY4A 2D2IA 3RUCA 2RAPA 4JFAA 1KMQA 3H42B 4P92A 1U9LA 4ZAXA 3VHXB 1RQNA 2L2QA 4QTUB 5ALLA 3RS0A 3V1UA 1NNUA 5AW6A 2F55A 4KLMA 2PBRA 1MAAA 2IZZA 1NAHA 1Q1GA 1SULA 3EC2A 4OBWA 1SK9A 2JZOA 4PZYA 2KMDA 5BN5B 1X3LA 4CL8A 1R2QA 5KC9A 1BW9A 4QDUA 5NULA 3CLUD 1X2EA 3RIEA 2C9DA 2QN7A 5EMKA 5FV7A 4I3HA 3KKZA 2WPDA 5CFRA 2BF7A 3FTQA 1KI7A 2VK4A 3AWIA 1SCNE 5DNCA 3QTTA 5J8YA 1WD5A 1XTTA 4TWIA 2XXJA 1NJ2A 4RYLA 4FQ8A 5H3HA 1DEHA 4HJRA 3DOCA 1VRCA 1DIAA 4MIOA 1L1FA 5FLYA 3RS8A 4OXYA 3P2IA 4TL7A 5FNZA 1P2FA 4LYYA 3VRHA 1OI3A 3HVJA 3DLBA 5CHGA 1LSJA 1ZUHA 2CLSA 3BS5A 2VDWB 2VJBA 2ZREA 2ZTHA 3I9MA 2GZDA 3CNHA 2Q8NA 4D8YA 1KVSA 1OWNA 1EXWA 4RMGA 3OZTA 2JW5A 1N4AA 2UYHA 4ND7A 1QYDA 1XI2A 5CX1B 5TPWA 2D8CA 2OQRA 3A1VA 3RBXA 2GYUA 2AXNA 1VDMA 4PZPA 3PT5A 4ZAZA 5DSZA 1VBNA 3BERA 3TIXB 2OP0A 1DDOA 1E2FA 1GGVA 2HREA 3P9RA 4LY9A 1VKRA 1SHLA 1ZESA 1Y7IA 3GUZA 3ZHZA 1XDDA 1WB6A 1ZQNA 1NMZA 1O5IA 1QHFA 3D2AA 3IALA 3G0DA 4EF4A 2WWYA 3VH4A 2QY6A 2WA2A 5JZOA 2ASDA 3CFYA 2BGGA 4GX2A 1I7PA 2WTAA 2WYHA 5KFQA 3ZLVA 2Z30A 4N12A 3DP7A 3AVYA 1U48A 4DF4A 3MOGA 5KFCA 1BMFD 2VA3A 1Z19A 2FR1A 4QWDA 2Q9AA 3QBEA 3JASA 3OSNA 1VB3A 1JB9A 4O4HB 3PXGA 2IVFA 1Z26A 3CW9A 1B93A 2VP3A 2PYIA 5J2GA 821PA 4I2GA 4CTKA 4YRSA 3A9SA 5DCYA 5KFNA 1MJGA 4MVJE 3CPHA 4PNEA 2CW5A 5JG7A 1ND5A 1JV2B 2WBLC 5EOVA 3W77A 5D3MB 3PJDA 3V7JA 2JGLA 2LRHA 3KETA 4C2BA 3UT5A 2X8LA 5H9WA 3PUVA 2OMEA 3WK7A 1XZDA 1L5SA 1XGKA 1U3WA 1YQQA 4JKYA 5J2UB 3ZXUB 5IPFA 1E6MA 4B9MA 2IZOA 4RFSB 1O96B 4X1IA 1VBKA 2W22A 3MJTA 3NCHA 3SAFA 4QPJC 3V00A 4CM5A 2OWDA 4BO8A 5BOMA 1K4KA 5KFDA 2AG8A 2P5UA 2OYSA 3GJYA 4RQ6A 3M4XA 3ZHRA 2REBA 3V8EA 2PWZA 1MJNA 3F7NA 4XUSA 3H4VA 1IG3A 3DTYA 3MK31 4PXAA 5KNBA 3F0TA 1VYUA 2FSGA 1D8YA 1B0UA 1GNLA 3OZCA 1UOQA 2GRUA 3CVJA 4KX5A 2E49A 2EAPA 4IXWA 4CDNA 2WU3A 1WOMA 3DZBA 2HRRA 3L4SO 4MRMB 2XD9A 1WXXA 2DE0X 4FI3C 3BRWD 1RCTE 2ESEA 5C0OE 1D6MA 2AYZA 3E35A 3T7AA 3U4DA 3L8GA 3ZXYA 1TUBB 2A0KA 2QMQA 1BGWA 3I5YA 4ARVA 4F2HA 3C2KA 1NBOA 1ZGBA 3ELDA 1TEVA 3TJRA 2FMFA 3I1YA 3JQBC 4X45A 1ZQDA 5KJ6A 2YMPA 1CEXA 1ADBA 1G8AA 1PJQA 1NMYA 2ZB4A 5J0UA 3O5AA 3IBSA 4XYMA 4EHLA 1ORVA 1XVTA 2AJCA 1ZN2A 2PGNA 1TXGA 1XEWX 2FUCA 4WFJA 1OXXK 2FMPA 2HNAA 2YR0A 3PY8A 3TQSA 2XTAA 1KFSA 1W0KD 2H3QA 1UXIA 1FP6A 3MMNA 5C1PA 3PPYA 1KMCA 1PFYA 1UFQA 1VB5A 2H4ZA 3WQHA 2PFOA 4ZPXA 4E4RA 4OSEA 3AR8A 4ARUA 3KB2A 4E1AA 1U4NA 3OO0A 3JATA 3CHYA 3T12A 3WWCA 5KC8A 1HSZA 5FFMA 4ELVA 3AILA 2KBEA 4DDMA 1Y3IA 1D0VA 1YDGA 4XX1A 4F06A 5CCXA 1E9EA 4YJKA 3UAGA 4G9BA 4J6FA 4B5KA 2AOTA 1E6LA 1LSSA 4BMDA 4DZTA 1I3CA 5KDOA 4YC7A 4DIDA 4MW4A 3JVUA 1Z18A 1UJ2A 2PUTA 4DG5A 5KOJA 3ROTA 5C51B 3EJWA 3KB8A 2A84A 2VS1A 4HPWA 1BDBA 4N40A 3EZ5A 2DVMA 5AVOA 1O94A 2AF3C 4MCIA 3AEQB 3ESYA 2BPCA 5DQHA 4TV8A 1JEEA 2X5OA 3UVEA 1ZSNA 2WP8J 4JFRA 2XKKA 4GC6A 2AN4A 2X1MA 4IJVA 2O7NA 3HY6A 4KIUA 1DG3A 3VZPA 2PXIA 4AICA 5I9LA 1HEYA 1NR7A 2OAQ1 1RAGA 3GMTA 1GZ4A 5JU6A 4NJEB 1UWKA 4TZKA 1TT5B 3S2GA 1QZ3A 2Z98A 4EJ6A 4QKQA 2UZ0A 1UJNA 2VHXA 3OC0A 1W9HA 1G4HA 2BBSA 2ZFUA 1PG2A 4AECA 4U7PB 1R0KA 5LMNB 3DHEA 3SR6A 4RQ1A 1TE2A 1WKCA 4BV3A 1MFPA 2F4VB 3AUXA 4TL8A 4KXWA 3EXEA 1TLLA 3MGVA 1N92A 4UQLA 2ZKIA 4MW1A 4JELA 2JEOA 2OBNA 4IPTA 4ENVA 2YXBA 3PRKE 4IKEA 5E6SB 3UTCA 5L51A 3H1GA 3MIIA 4JBGA 2XY5A 3STXA 4Q7MB 2RGCA 4RY2A 2QGNA 3HDVA 1O9HA 4Z7QB 1HZZC 3T0GA 3KLPX 4ZI2A 3NW9A 3MB8A 4LJ5A 4QBFA 5F1KA 1Q50A 4IQUA 1XN4A 4RJKA 3HMQA 1YBAA 1U31A 4IDHA 5CX4A 4YLYA 3TQCA 4C8NA 2QX9A 1W1WA 2PRIA 3GGGA 4YMSA 2OFOA 3W1WA 4LV5B 4YT5A 3WA6A 1GD1O 1G3QA 2AOUB 1SUPA 2BD0A 3K5IA 3K9NA 3AKYA 2YJGA 4TXMA 2VZ8A 4OK3A 2X5JO 4XFDA 3RFCA 5LQCA 2DBQA 5AW8A 1ZL0A 2JFZA 1QMGA 3I34X 5F1PA 3VPGA 5KFSA 4EMBA 4Y1FA 5HG0A 2GBLC 3SHQA 3E9QA 3T5AA 4F9EA 2QT0A 1XCLA 1XD2A 2FY8A 2NXCA 3H3JA 3N0TA 3NHBA 4UZSA 5E2IA 4AMYA 3T1YB 2I1VB 5LZ5A 2GZSA 2P4UA 1XQ6A 2GM5A 5AVSA 2WTNA 3ZWKA 1N78A 3FCXA 1ZUNB 5LL6P 1M1XB 2A0WA 2ODBA 5BPHA 5IBCA 5KS2A 4X3OA 1GUAA 4DC9A 4XSHA 5IT5A 3CLVA 1EB9A 4JENA 4IWYA 4LJYA 5HK9A 2VAVA 1R6XA 1EFKA 3W2FA 3SC3A 2XQGA 4B4WA 3L04A 3PZRA 3HHEA 3M5DA 5B12A 5DB7A 3RR7A 5FPQA 3C3AA 5GV7A 5G0WA 3MWDA 2JZCA 1P7PA 2O2ZA 3IIJA 4QLAA 5LP6C 5KNDD 1YR3A 1Z2NX 2O06A 1IPFA 3ZD9A 2V55B 3ICWA 3KFLA 3I92A 4YALA 2Q3BA 4B2YA 1X9HA 1SXGA 3V7NA 2ZRFA 4TYPA 4P2BA 4Y9DA 6ABPA 1QX4A 2IELA 2KEYA 3DULA 3T3IA 4Q4AB 1E5DA 2Q2VA 3FFAA 1OSNA 4RQ4A 2D0IA 3JPPA 3IJRA 4J3FA 3ER9A 4JLSA 2WAYA 1OAAA 2DKFA 4ON9A 2LIVA 5KAIU 1A5SB 3ANXA 2I6UA 4WESB 1TF2A 3FDIA 4O0MA 2CVFA 2IXAA 2AA3A 4PCVA 2FWBA 5ALYA 1KHTA 1Q57A 1H8HA 2QUBA 3EYAA 3QA3E 5JXHA 4OQ4A 1N6PA 3RJ9A 2IYYA 3QEJA 4QU9A 2CSUA 3EGDB 4NYMR 2WHEA 2ODGA 1HQYE 1RPTA 2X0IA 4JYBA 5BN4B 1G63A 4F85A 1C9NA 1E58A 5EE0A 4IF4A 1Z3IX 3PFWO 3NTRA 2R25B 2PFSA 5CWRA 2HSWA 2R1VB 2R8HA 1KY4A 2XQKA 3EVGA 4IRXA 5EVJA 2Q4TA 4BKOA 1X6VA 3IPYA 1NBMA 3PCTA 4HTFA 3IVAA 4IQ8A 2HQRA 5CJ2A 1SKRA 4O5AA 5EIBD 1VG0B 2HHCA 1EDZA 3P7MA 1F7VA 2P0EA 1UEXC 3A04A 1V11B 3CXRA 5CH8A 5DYNA 1F5NA 1CUJA 1KZ4A 1Z2CA 4J9OA 1QQTA 2WB4A 1E0JA 3G49A 2EFCB 3L1VA 2XUGA 4ZRNA 3CXUA 3WRVA 1XAIA 3KAQA 3RNOA 2NXNA 3QLUA 2IBMA 3KBOA 1JJAA 2I7TA 4F45A 1UOOA 1XWWA 2XMBA 1XK6A 2D00A 1BHSA 1PJ4A 1UBRS 2AI1A 4BVAA 1T26A 3M7DA 2IHBA 3CLRD 4LBYA 5DKFA 1P9LA 4KQ6A 1BQEA 4Z99A 1XKTA 4M7RA 1C7FA 4YR0A 1EG7A 2AD5A 2GTPA 2YWGA 3Q3CA 4GUAA 3ECCA 3ITNA 4L07A 4QZ8A 5ESRA 1H0KA 1X7XA 3K9WA 4Q01A 3V1YA 4EUSA 1LDMA 4J7UA 2FSSA 1L5HA 1U9YA 1KAEA 1ORWA 5KIAA 3S8YA 4HKTA 4RUAA 5TMEA 1P2VA 4NE7A 2JFXA 3K92A 2ZU0C 3HXPA 5AUPB 1HR0B 1W85B 4PS0A 1AF4A 2RDIA 1UT6A 2IYLD 4MOWA 4WZBB 1O0SA 2QPLA 1J5XA 2RK6A 2WOOA 3PNOA 4YRIA 5I4BA 2W83A 3BOSA 4NOJA 2FN4A 2QEQA 1COKA 2RCNA 5IBPA 3PVXA 1FFEA 4DV2B 2JFWA 2QENA 1F4LA 2C5SA 4FQ7A 1QORA 4ARIA 4TYWA 2Z57A 3TSYA 3RVQA 4CN9A 2JMGA 5KUTA 4BGEA 3QKSB 4X84A 3DTNA 4Y7CA 3RR2A 4EJSB 4YV0A 1QGZA 2YJ3A 4GUDA 4V1CB 3KEOA 4Q15A 2WSBA 1TKRA 4G26A 5IT9A 1FUUA 4FM9A 3P32A 4MVJP 1T5LA 2R8YA 1L4HA 1KP3A 5H5JA 1NKVA 1BDHA 1O57A 4NV0A 3MG9A 1GKKA 2GB4A 3PUYA 4KGZA 2XMZA 3W2IA 3VH2A 4ZT3A 1EX6A 2VYQA 4PPYA 2O54A 1W59A 1G5FA 1M2JA 2FEPA 4R1PA 3WRWA 2CBGA 5FEUA 1CC1S 3UK1A 2QLLA 2W03A 2G6TA 5KQPA 3A9WA 4ILKA 5TS3A 4ANFA 4C20A 4R8VA 3LWNA 2XOXA 2WI8A 4WJ3B 2Y66A 5LYJB 3T5KA 3T4XA 1IZYA 1K8RA 3SI8A 1LPAB 3MCVA 1NVFA 3IBGA 2CVQA 5FTWA 1USVA 5CYGA 5IC6A 1SV0A 1Q3VA 4D4IA 4ED3A 3EB9A 1EDEA 4WAUA 4LYGA 1XFDA 1QTRA 5HBRA 4EP1A 1G291 2CNNA 2DWCA 4YJ2B 2RHLA 4HDKB 5JY1A 1R0RE 2QROA 4A8TA 5SYNA 6REQA 3CNOA 2FN9A 1TX4B 2PD4A 1M2GA 1RXEA 3EMKA 4OHVA 5H2FU 3SYNA 1EVIA 1FCJA 4AG3A 4H16A 1ISIA 4QASA 1VDVA 5IF9A 2IOHA 1RHMA 2HWYA 1ICIA 1A69A 2JDIA 1B41A 3QWHA 3TEJA 1CYEA 1B6RA 1KEWA 3MFIA 2IXDA 2WSSA 3E22A 3LK7A 4IQ0A 4AFNA 1W48A 1H1DA 5KFUA 2WSIA 4HNQA 1S10A 4ECXA 1NVXQ 2Q2QA 3E4CA 1KGDA 2R00A 3MQFA 2K87A 4UUNA 1SH7A 3VKWA 1Q14A 4J1SA 5DTJA 4ZOQI 4UU1A 3PXCX 3BSYA 3VI3B 2XNHA 3Q12A 1GLVA 1HT0A 2ST1A 4UVGA 2L19A 1KKLA 2BGMA 4HAZA 4X7BA 5EWLA 1PL0A 2XDQB 1XNQB 3U49A 1SD5A 3HH8A 2XC9A 2AN9A 3R6WA 1D3AA 1XSLA 3OH8A 5K0GA 4JGBA 5KTKA 4FMCF 5JSFA 4LXXA 2GO1A 2Y0SC 1ZD9A 5BWCA 3GZFA 1RLIA 3RJIA 4AJPA 1W47A 2BFEB 2XO7A 2IDZA 1Z08A 3ZU5A 1DWPA 1M2OA 3HBJA 3FVWA 3I9JA 4K6GA 3UK2A 3WP1B 5EE3A 1JYFA 7ICFA 1HUQA 4HX2A 4PGHA 5LD2C 1EFLA 1XVVA 2GBCA 3U7EB 1XZPA 4CIWA 4KYIB 1IG0A 4DV3B 5KT7A 1PRYA 2AX4A 2RARA 2QL5A 3IVRA 4FU0A 4X00A 2WG2A 4MXDA 5D3ZA 4B82A 2V58A 4DFKA 3Q7IA 2B0CA 1EWVA 4HY3A 3RGGA 4TLCA 3JWJA 2AC2A 4XARA 3DBHA 1Z0IA 1DADA 3CONA 3UAOA 4C0LA 4YRLA 5DH9A 4M9CA 3IJEB 4BGUA 2P79A 4JBWA 5KYYB 5KFVA 1XZNA 1V0JA 4KPEC 1A9ZA 5FR1A 2Q7XA 1ZJYA 3TM5A 4HN4B 3H1PA 1SQFA 1L5ZA 3P20A 4PYQA 1E64A 5BQXA 2ROQA 3MELA 3VUEA 2W9CB 5DO9A 1EIWA 1COOA 2PZMA 3KTAB 1R0BA 2YWFA 3OPVA 2RD2A 2HYDA 1VLHA 4AO6A 2NV2B 1VHTA 5AVWA 3U3MA 4RJTA 1U3VA 3FHLA 4CF5A 3HP1A 1EYZA 1Q1QA 3OE1A 3AI1A 3DZHA 2KICA 1J33A 4DS3A 1PZGA 2VDPB 1ODJA 4YMUA 3N0XA 1GNTA 2C2GA 3MPOA 1QE3A 4GRAA 4PPGA 1MU0A 1XDUA 3ORSA 3N2YA 3UO8B 1TJ3A 3CG0A 3WDMA 2CRXA 4FW8A 3PHGA 5KWSA 4QZBA 4MJ7A 2QG6A 1QFYA 2CLLB 1E1YA 1PV2A 3BXPA 2R66A 5CDSA 1DXYA 3BKXA 2JLUA 1MVLA 2K4HA 2JL1A 4ZAWA 1VKHA 1YASA 4RTMA 3F2BA 4OGWA 4BN5A 1LI4A 4GW3A 1P5HA 3H2KA 3SV3A 5LB4A 5CG2A 4CIAA 3OQPA 2P2LA 4S1NA 2QMOA 2XB4A 3BH0A 4BO6A 5IAGA 4BRZA 2C5GA 4EA8A 4P9NA 2GK4A 4ZZ1A 2B4KA 1YQGA 4LXTA 3UC5A 4EWLA 4B47A 1QFJA 4CKCA 1UK9A 3SQMA 3Q4GA 3WNQA 1HT1E 1C7RA 2PMEA 4J6EA 3NTQA 2CSXA 1WBJB 5EKUA 5ALQA 5ITSA 5H70A 3HR8A 1ZUIA 3C28A 1O5TA 1L6RA 2JJ1D 3Q6IA 4MSUA 4PZ9A 2QRHA 3PX4A 1ZQZA 4D6YA 1P7WA 5AKYA 2WU1A 1JA0A 2DULA 4MW0A 5M34A 4AP9A 2R00C 3AMZA 4AC9A 5HQ3B 5C34B 3NDRA 1ZU5A 5BMVB 3BFVA 4GXJA 3U3JA 2PR2A 1ZQKA 1P4SA 2WJJA 3AOEC 4WZZA 1CQWA 1CDEA 1DKNA 4YR9A 1HZJA 4NG5A 1ODTC 3RUAA 1DXHA 1NURA 2HW8A 4HSEA 4YVZA 2DFLA 1K9VF 1YS7A 1U7ZA 3EE6A 1RAIA 3KXIA 3MYRA 5BWNA 2X6QA 1XU7A 1J07A 4HS4A 4OI0A 5JSZB 1PEYA 4IHJF 1G5RA 4DL7A 4M4SA 3EPGA 3ITEA 4P4GA 4UOZA 1XRNA 4QQKA 3ABSB 2WPDD 4TVOA 1FU7A 4FYMA 4INAA 1KWGA 1A88A 4YLGA 3CCFA 1MMFB 2ESRA 5H02A 5JYBA 1BPBA 3L8EA 3F5SA 3IODA 1XTIA 1G21A 2RH9B 1S0NA 3D54D 1CR2A 1W5AA 2ZWOA 2A4MA 3PEVA 4HK4A 4YRDA 1IATA 1K2VN 2FX2A 4O2BA 4L8VA 1VE3A 3PUJA 4GBGA 3LBIA 3UA3A 4CETA 1DAGA 2WWHA 2V3CC 1QAMA 2QR2A 4CQJA 3IIEA 4IDAA 3C3CA 4IKOA 4EOGA 1C3EA 1Y5IA 2HH9A 2PGJA 2DTXA 3GV5B 1DQRA 3G8CA 3B3JA 3PDCA 5E6RA 4EHJA 5ICCA 1NV9A 2PCJA 2QD5A 3CWCA 2WF5A 1KH2A 2HJHA 3X1MA 1T6XA 1GARA 2P41A 1N2OA 2X5XA 3KKMA 1QH1A 4XYLA 4P22A 4XR9A 5CXQA 3PQFA 1VGQA 4L5CA 1ZJNA 1GAWA 2CLFB 2HRZA 2ZXEA 3N6RA 3OUTA 4OM7A 3V32A 4FI3F 1SWVA 1KFDA 1TMGE 2Q41A 2Z1DA 4MS3A 4V0MA 5B1EA 4C6RA 1OX5A 2XGJA 1NJXA 4TURA 3AEKA 3BXZA 1UM9A 4HQKA 2RJNA 2V7GA 2D0OB 2ON6A 3R0IA 4ZARA 2G76A 3N2GA 3SVZA 2CFCA 3TLAA 4TROA 1QR6A 4TLEA 3H5VA 1JHAA 3D4OA 4BTVA 1JB1A 3G0GA 3DEIA 1UPBA 1QX3A 4KLEA 1NLZA 4YFYA 1I0LA 1S01A 4PCLA 1XZ8A 3E9YA 2BHRA 3HBAA 2YIMA 2D5AA 1T0BA 2AXEA 4ZICA 3AKEA 4HDOB 4E88A 4EAAA 5B6PA 3TBFA 1XFAA 1BU5A 1JVSA 3RIMA 3V4SA 2PFKA 4JK3A 3KZKA 2QBYA 3MGCA 4DOCA 4V02A 4B3SB 3ZDZB 4JVLA 1DKRA 1P9RA 2DBZA 2FW8A 2IYEA 1OWMA 1GWNA 1VG9B 3QWBA 4MQLA 3BGDA 5T4EA 3U17A 3WL5A 2VN8A 2B83A 4BNIA 2CXOA 3GLGA 1SBCA 3P9KA 4ZYZA 1JQJC 3U3XA 4Z4CA 3QXJA 4DEZA 3TIVA 4CLRB 3ZHSA 1NHGA 1DJNA 1Q77A 2BHTA 1GPBA 2X4IA 3EH1A 4NK4A 4C0XA 4ZO8A 1KH1A 1S4QA 4UPVA 2QM0A 3G2LA 4JVMA 1F2UA 1E3LA 3R7WA 4XEUA 5JCXA 1L7MA 1RAAA 1U04A 3PSPA 2HA0A 1GZ3A 2PUHA 4QE3A 3UH1A 3EUFA 4K0KB 3EEOA 4ZFNA 3F9RA 3I9KA 5AI6A 2YIVX 5IINA 3DO5A 3FGPA 4KQ2A 4O08A 2PRYA 1BPYA 1J99A 4QUEA 5E8RA 3EWAA 1CDDA 4N6NA 1W2HA 2H59A 4E11A 3A2NA 5JQWA 1TADA 4IBOA 5A2QA 1H66A 2RK4A 4UJ5A 3ELBA 3I32A 1JHMA 4N18A 7ICVA 5JAQA 4YWHA 3TTXA 4BZXA 3EXFA 4RC9A 1E8NA 1A8SA 1NQAO 2A0UA 3CB2A 5FNVA 4POOA 5HM8A 2F2TA 2ODWA 1KFTA 1ADJA 4IH9A 5CXUA 4PG5A 1GPJA 4UULA 1FQWA 5D85A 3GJ6A 2O48X 3E22B 3D6HA 1YIOA 1Y80A 2GEKA 5KFPA 1KKXA 5D51S 4ZH4A 4P0QB 1OLSA 1ZOLA 2DGZA 4FNGA 3ZU3A 4FILA 4XRGA 1TEZA 4RIIA 6Q21A 4QO7A 4EZ6A 1ILEA 5CCEA 4ECWA 1TK2A 2J3QA 3LS2A 4WFQA 3EZYA 3G23A 4FGZA 3F6CA 4PG6A 3KLMX 4CMIB 4C01A 4TQAA 1H2AS 2E0IA 3P9QA 5BMVF 5K6AC 1L4UA 3HRIA 3ZE1B 4B73A 3H8MA 1SBQA 1Q1BA 2ES6A 2BI8A 2G17A 1FBTA 2NRTA 1NI4A 1WMBA 1ZBQA 4HFJA 3AIOA 4B9AA 5CB6A 1Z1BA 1Z74A 1FQOA 4YT8A 2VUSA 4EDFA 6CHYA 1JIVA 1T25A 1FA9A 2WU0A 3LT1A 8ICIA 4I9GA 4JUFA 4OQMA 1EQAA 1H65A 2IC5A 5EAIA 1A9XA 2AMVA 1IMOA 2X7XA 2RG7A 4IZ6A 3HSSA 3FFTA 4NYMQ 4Y9UA 1K0FA 3NGXA 5CK5A 4C76A 2FSHA 2I6SA 1YS6A 2B5WA 1YK0A 2AGVA 3V48A 5ENVA 2D7CA 3G2NA 1JAHA 3DP9A 3UAXA 1Q1AA 1X1SA 2GDZA 4MQFB 4L4XA 1UPHA 4LJ7A 3RYCA 3WLSA 1I01A 4MV6A 5IDWA 3THWB 2CGEA 4ZV4A 5EP4A 2GKGA 1H8HD 3L7YA 3O47A 2RI6A 5CD1A 1X0XA 2C2YA 1AX9A 2M6KA 5EJGA 3PA6A 2G5TA 2ZYUX 3TIIA 4UB4A 5HCNA 3C23A 3SHTA 3SR0A 4EHNA 2ZE8A 1QO9A 1JTFA 4EGCB 1T5DX 1FYEA 5BV7A 2DPJA 4IDEA 5HRAA 4KR6A 4CVNA 2VPYA 6ADHA 3OPXA 1SBNE 4PGFA 2H48A 3WRYC 1CUBA 1D8TA 4MYUA 1IK4A 5G02A 4IVQA 4EUNA 4LF5B 1ZEMA 3IB3A 2PFPA 3LP8A 3AG6A 3EIFA 3OIWA 4MO2A 1BROA 4ASUA 2A88A 3PYXA 4OXIA 1Q0ZA 1XNHA 1ENOA 4LDZA 5JARA 1NU6A 3RWBA 1R9JA 2PKEA 2XECA 3C5EA 3EZNA 4D9NA 1V47A 1YHZA 2KYRA 2O8CB 3DZIA 1NVMB 2V0NA 1LNQA 2WTUA 4DC1A 2VK1A 1EFRA 1CRZA 1JZQA 2ODQA 3CRVA 3EWIA 3HCEA 4MFFA 1AN9A 3LA6A 4QDKA 4YMHA 2VVTA 5EJ6A 5FBQB 1E5VA 3FB1A 4MIYA 1ISFA 1B22A 1L8QA 1TQ6A 4J75A 4WOPA 1W75A 3I9V6 4OEHA 4PSDA 1DT5A 1IC6A 3ICOA 5CT5A 4Q1BA 2OGTA 5B1HA 4DMGA 2D5CA 1GUYA 5DW3A 4INPA 5HJEA 4PYOA 1Y9DA 4M9XA 3A9RA 3AUTA 3SLKA 1NBMD 3PL1A 1WHTA 3M9OB 1HLGA 3FDSA 3JSXA 2PU5A 3A3NA 4NBVA 3AY6A 5FBHA 5CAEB 4EHFA 2ZU6A 2H4HA 3IDOA 1EE2A 1P4JA 1GQ2A 1NN0A 1XQXA 4ZVLA 3EC7A 2XH8A 1ECBA 2B7BA 3IIKA 4LFAB 1FJ2A 2YBEA 4JYPA 4YACA 3GP3A 2R97A 1ESEA 4I8XA 4LHVA 1BD4A 5AVZA 1X74A 4IHQA 1EGQA 3DGEC 4P2HA 1W52X 3WLAA 4MVJD 4JQZA 3PXBA 3TAUA 3JASB 3OTHA 1KSHA 2LKCA 2PT9A 2AHRA 2DPYA 4K4HA 1CERA 1OXMA 1F6WA 5CXSA 5FI0B 1KFJB 3DE7X 3NALA 1CQJA 1XP8A 3K9LA 4RWEA 5DGAA 2GAJA 3QXSA 3U7JA 5C4MA 5KTTA 1XOIA 2EG9A 2XCRB 5AQEA 1B4FA 3DVQX 1H6BA 1D9ZA 1LBQA 4R5HA 4JEMA 4J9RA 1Z47A 2IK8A 3LWZA 4UUPA 4HMPA 5BR7A 1DKQA 4E2FA 1XZBA 1M9NA 2LM1A 1WXIA 2DPXA 1OT3A 2HF7A 5DV9A 2ZIAA 4YXWA 4F4UA 3IE1A 1UK6A 2IEGA 4PL1A 2FZEA 3AEQA 3IV9A 1YR9A 4MYCA 2WJAA 3K96A 4CT0A 3EF0A 4RTPA 1U8AA 3L0YA 2Y71A 2QTCA 3AM4A 3BZWA 3DMGA 4IDQA 4NFSA 4Q4HA 2ORED 3GUUA 2WUDA 3IUBA 3DPUA 1PQ4A 5D7BA 3LPNA 1EFDN 1L7QA 1WF3A 2NUAB 2F9FA 3TSCA 2JH3A 1LPNA 2PGLA 2YB4A 3JQAB 4AZ0B 4EARA 1JN0A 5A6SA 4BUZA 3FSEA 3ZQUA 3NGMA 3WBBA 3OTOB 3QWFA 4QJ5A 2BCRA 2OLJA 2L42A 4FYIA 2KE5A 2DZDA 2JBHA 3OQBA 3T1TA 4PZUA 4L78A 2C0QA 2C07A 3ZYCA 4C4AA 4IR1A 3NWOA 4MGYR 4JL5A 3RRFA 4AWAA 4CRWB 5JTIA 2ZRIA 3UHJA 5B6IA 2QRKA 4UC0A 4OYLA 1VMIA 2HMSA 3A6EA 1JJFA 4DSLA 2VAMA 1SA0B 3HCWA 2KHVA 5E6UA 3DMNA 5F33A 5IIIA 2QZPA 4QARA 3CIFA 4TYMA 4RV9A 1IJFA 4MWSA 4DO9A 4X1OA 1AMOA 3QMPA 1OIVA 3R7BA 3SYKA 3BJMA 1X7WA 1PFGA 1E7MA 1W9MA 4DZRA 13PKA 4LZOA 1ADCA 1K6XA 4PZ0A 1JHXA 4PFKA 1SEPA 3HCDA 3KAPA 4WNIA 4F4YA 2YZ7A 5BSFA 2XCAA 1ZGCA 1TTPB 1MSWD 1KOFA 5FPKA 2P4QA 1P2DA 2R11A 4KXLA 1OIXA 4RHTA 1JEYA 5E4JA 4CMHA 4LZJA 2P6NA 5KMGB 2KJQA 4RZRA 1ED1A 3ZZTA 2NSHA 1FZQA 3DMTC 4FOSA 4IDBA 1Q3UA 2VTKA 2XWBF 3U9SA 4CMGA 1C9YA 4YJ2A 4PS1A 1JHZA 4RCYA 3PDWA 4MEJA 3INRA 1DBQA 4NRDA 1SCIA 1SVWA 3NC1C 4WZBA 2IV7A 4A0SA 1YE3A 2QORA 2B61A 2Z2XA 3Q5EA 4AMVA 4KSCA 2BJHA 1R6VA 3GN1A 2W9BB 4BMYA 2LE0A 4Z9BA 4BO1A 3AVXA 2NVBA 5JRZA 4Z0TA 4C4RA 2B1JA 3CP8A 5H59A 5JS6A 4MH0R 1PF7E 2Q6KA 5CM9C 1CZNA 1P73A 3O4IA 3LBHA 5I9SA 5LA6F 5LXTA 4K81B 1JDBC 1HTBA 3CR7A 4MVYA 1ZQXA 2ZUSA 4P08A 4JJZA 3VZQA 4DWVA 5JROA 4QWEA 1JF8A 1RXCA 1M1YE 5K3EA 3MHPA 2VUUA 2BQ3A 3VDNB 3JWGA 1NUTA 4OAOA 1MLDA 5E9WA 1DMSA 4YCCA 2BSQA 1MQ9A 1B7GO 2AW3A 4FYJA 1N2GA 3QPCA 2M6SA 4JT2A 1L9XA 1F4PA 2OK8A 3WB1A 4M0KA 4H7KA 2NO6A 3M6WA 5ALHA 2IF2A 2WV7A 3FDJA 4RVSA 2FOXA 2ANCA 1M1NA 5KG5A 1EBFA 5JWRA 3IDSA 3FCAA 4B9TA 4FDTA 1MGOA 3UGTA 2H07A 2CK3D 1FSSA 2V9CA 4Z0NA 5GZ1A 1M34A 4AY4A 1CS4C 1MPTA 2DLCX 2P4EA 3OOYA 3GFQA 1NVBA 2PXCA 2FAXA 1N60A 1KE1A 4RXMA 3H40A 3SQXA 4CQLA 4EKEA 2PXHA 5EE1A 1TJPB 2OV4A 5ALFA 1KYWA 3DEKA 2IPOA 4LV8B 2GN0A 4EYQA 3BXGA 1TL7C 4URFA 3ZGYA 4HWKA 2EKBA 4MUGA 1S9DA 1XJWA 5AJTA 4KFCA 2NO5A 1O95C 2H1CA 4IHJB 2C58A 4LYDA 1W0JA 1CNMA 2FE1A 2I6TA 2BHSA 4HADA 4ZVSA 5CMLA 3ANTA 4A2WA 2ETXA 1P4GA 2PLRA 3VUFA 1R00A 2GHRA 1ZD8A 2Z7JA 3HCAA 3OLQA 2HZ7A 3ZCUA 2HPZA 3EPKA 1T5BA 1JSXA 3N75A 4TQRA 2CFIA 5EEGA 3GEDA 1ZD4A 4LG1A 4DCCA 3H19A 3SYTA 1K7SN 2Z3ZA 5JPCA 1YU6A 4Q9NA 3UHFA 1POWA 2QNBA 1G64A 4DFPA 2YWDA 2DKXA 4YO8A 3T7IA 2CEAA 2ZULA 3RU2A 3U81A 2L69A 1UR5A 3I3OA 4IFTA 3GRPA 4F3TA 1BQ3A 3HKBA 3ZGNA 2BFBB 3EC1A 1N5RA 1XNJA 4K9OA 5KMGA 1NM5A 2OY0A 3AFIA 3FR7A 4ZOBA 5KVAA 2P9HA 1F6DA 3CE9A 1NN1A 2P75A 4MMXB 1WCWA 2ZATA 1TLFA 3SJCA 1JYSA 3KUXA 1GUFA 4YQZA 1PVVA 4I4LA 3RJHA 3VKUA 4BB9A 3O0FA 1CUZA 2C04A 1USWA 5LD2B 3I2YX 5AKKA 1JMYA 1PFWA 4TZ0A 4OJPA 3H8VA 1T5SA 2GCEA 4RF2A 4G1BA 1QSGA 2XE4A 1KRHA 4LA4A 3QYJA 1C8LA 1S96A 1FYDA 4NDNE 3EXAA 2Q46A 4E08A 4WLFA 2A3RA 3MRTA 1RQRA 3JQPA 1BNOA 4PGXA 1DCKA 1NA5A 2BEUA 3E70C 3I6IA 4HDRB 1FS4A 1B15A 3H5AA 2ZCUA 1DG1G 1GIAA 1LV5A 5BV1A 1Z5OA 2YNMA 3BX1A 4PHFA 4LF8B 1ESNA 3BQTA 1TZKA 3EMDA 1CZRA 3HUTA 4Q4JB 3DOEA 3HCRA 1M7HA 5U4QA 4BP1A 1Z5NA 1OQAA 1TUBA 4GI7A 2JZBA 3VFDA 4ED2A 4C6SA 3SXUA 4AO7A 1RIIA 3BFKA 3E05A 3R75A 2TSYB 3MJRA 3CJRA 5FUXA 1XYYA 2NXEA 3BH6A 4DCPA 3OFSA 2VA9A 2IY9A 4IO1A 5AI0A 2EKZA 3DSRA 3SYLA 4CIYA 2B99A 2FEKA 3DC2A 4OJNA 1H93A 1O2DA 1JFLA 5DBHX 4Y9SA 3SEAA 5EJ8A 3VVLA 4CQLB 3IKJA 4IIHA 1UKZA 1G8HA 2CL7X 4M0MA 3HB4X 2DKNA 1ZC4A 4AZ3A 1IQUA 2ZDQA 4P36A 5JQGF 1YB7A 2BPFA 2PL3A 2ZWMA 3BBLA 3AR7A 2BFAA 4WK6A 3W4JA 4YRMA 5ILQA 3URKA 5IC4A 1FUIA 3GQBA 4G01B 5KTSA 1MABB 1RZRD 4QT4A 2YH2A 3MJHA 3V6MA 1NP7A 1PIWA 4AULA 3FI0A 2LPEA 2QVCA 3B5EA 1T9GR 3DVAA 5HUQA 4Z4QA 2Y9MB 1OFVA 1TA0A 1AUOA 5GJCA 3RVDA 4EY8A 5L40A 3P2JA 6REQB 3EARA 3O94A 2ZB8A 3RVJA 2D13A 2YOGA 1UDXA 1RQ7A 2AG0A 2VQ6A 5FOXA 1OTYA 2GEBA 1UMCA 1R6DA 5B53A 4Z7OB 2JIPA 1RQPA 3KR1A 2O0JA 4KVFA 5KSWB 8ICUA 2FEOA 2PX6A 1USKA 2WAXA 2J8ZA 5FPHA 5LMCA 1QF7A 2AVNA 4FGKA 4Q12A 4GEKA 3T4UA 3A0BU 1RJGA 4ESHA 4D0RA 3DA8A 2XZTA 2G9RA 2B9EA 4I5GA 1R4AA 4ZQFA 1RJFA 2IE0A 1TT5A 4R1SA 1SCJA 3G2QA 1VYTA 2WWXA 3BZUA 3H8SA 4IQVA 1CP2A 3B1WA 4N54A 4ZTBA 3OMWA 2I1WA 1Z17A 3R9WA 3AP1A 3VV2A 5EUBA 3HKZF 1YZGA 3ENZA 2KKPA 3NKFA 3BIOA 2NNWB 3OEWA 4W1SA 4U3JA 4FTWA 3AJDA 1NKEA 1JR3E 2P9ZA 1SXJC 1LSUA 3N59A 1N0WA 1QYIA 3VC1A 4KLGA 2H06A 3IQEA 5GGYA 5KNCA 1A0PA 3K8QA 4XVHA 1S3GA 2IZ5A 1B1CA 3HFGA 3WFIA 4YR3A 1GSIA 4BLOA 4D81A 4RT3A 3E4DA 3NWEA 4BCDA 4FLMA 3GLTA 5GM2A 3VR3D 1NR1A 4PC6A 3BJIC 4LXUA 1Z6YA 2QX6A 5BORA 1RYBA 4GLBA 3GBSA 4NFHA 4DUYB 4WLVA 1JSCA 2G83A 5G4LA 1G4UR 1TIKA 2IPAB 3D8BA 4ETIA 4ISCA 1DIRA 1DAHA 2BAGA 4MB2A 4R65A 2G9VA 4TM7A 1NBIA 1ZD3A 1OA0A 3E7DA 2IYVA 3DXFA 3BWVA 2HGZA 1SA0A 3FZNA 5E1DA 1JHYA 4JBIA 2I71A 4MKZA 5IYZB 1ZRMA 2EZYA 2D2XA 2ISCA 2VNSA 1E9FA 1IXZA 5DLPA 5BWLA 3ENNA 1PWZA 1IN8A 4PAQA 3RUPA 4D0SA 4KEAA 3I8OA 1Q11A 3ADKA 1VI6A 1YU9A 4J7CA 4D3XA 1XD9A 3QY0A 3DFFA 8ADHA 3AKZA 1ACLA 2ACVA 4RK1A 4PSVA 5TQ0B 5IIJA 1Z37A 4L22A 4X61A 1Z6PA 1RMQA 2IUEA 4MVJF 4QULA 2FSVC 3MINA 2JFYA 5G0VA 1SGWA 3VDMA 3K75D 3O4GA 2EP7A 4DNPA 3U7GA 4XPIB 4FKBA 1WVIA 1GPKA 1YBMA 2B34A 2BL4A 3OZXA 1Q22A 4G4GA 3RAXA 4RMIA 2O2XA 4ZAFA 5KFOA 5DE3A 5BSUA 2WB1F 3K0FA 1A4XA 1G5PA 2HV8A 4KIJA 4YP0A 5FWYA 3W4IA 2BFMA 3EW9A 1XTBA 5LFAA 4LF6B 2POCA 4J0FA 4NU6A 1WDWB 3QV1A 4UEJA 1ZVVA 1QCZA 4LYEA 3FBGA 4PYKA 1ZQVA 5DBFA 2MSNA 3ZIAD 2YCBA 2ZSJA 4CR7A 3SXPA 3T5GA 3PCRB 3RB4A 2J87A 5DBIA 1K5HA 2FWMX 1YHYA 3IUEA 3V7WA 5JAOA 4HDNA 3H0MB 1D4AA 3WB9A 4ZYVA 4JWTA 4ZVUA 4BJQA 1EM8A 1QG4A 2Q27A 3HWSA 4QUBA 2YC4C 3JPTA 2PZ8A 1Y8QB 4C08A 4COOA 1SQGA 3DE5X 2FLWA 4UB3A 2J3IA 3GZNB 1NKSA 3IPCA 1MB2A 2WP0A 4ZJZA 1GVNB 2YN0A 3GMDA 1XAGA 3NGDA 1AVTA 3GT0A 3VJLA 3VDXA 4E5SA 3ILSA 3MPUA 1T5TA 3PDIB 2G07A 3TXYA 4BX9C 1N5KA 1QKKA 1RI2A 4JB0A 4K9DA 4KMRA 5ANRB 4AYTA 2DHRA 5LXTF 4LY6A 1CUUA 4ZJUA 1GAJA 4Y6SA 5KYYA 1G2QA 4ZZ3A 3MTIA 3HKCA 4DQLA 4BO0A 4D4KA 5J4YA 2GBGA 3HJRA 5DM1A 1O8CA 2O8BA