3QUTA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 82
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qutA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qutA01
4YH1A 1RKQA 2D2VA 3AR5A 1MH9A 3EF0A 1WZCA 3WK8A 4G63A 4AS2A 3I28A 2O2XA 5ALVA 4NFLA 4RETA 4YIHA 1LVHA 3J7TA 1FEZA 3QU5A 1Z4JA 3DV9A 1ZD2P 2IA5A 4CF3A 5AVTA 5AW9A 2I55A 3ZVMA 2HI0A 3EWIA 3R09A 2ZG6A 3AR9A 2WF7A 3L8FA 1ZD4A 3ZWDA 2YMQA 2P27A 3DAOA 3WK6A 1J8DA 1Z5UA 4J2TA 5ALLA 2I54A 4HGNA 4IFTA 3I76A 4BEVA 3W5BA 1NRWA 1Z4PX 3A1CA 3ED5A 3SF0A 3U13A 5AK3A 3QGMA 3ZTYA 2CN1A 3SKYA 2EATA 3ZW7A 4RESA 1U7PA 2FPRA 2EAUA 1YMQA 3W5AA 1N8NA 5ALDA 5ALOA 3EPRA 2QYHA 2ZOSA 2HDOA 5ALPA 3E81A 5AW5A 5AVXA 5AM3A 3OTQA 3ONNA 4XQ0A 4ZEWA 2OYCA 3A1EA 2G1AA 2BDUA 2W11A 3QUBA 4PNHA 3I6BA 3KOOA 5AM0A 1Q91A 2PR7A 3A3YA 3BWVA 4XE5A 5AKEA 1F5SA 3K1ZA 3L0YA 3ESQA 4OCZA 3WKBA 3QUCA 4F72A 1Z4KA 3AR3A 1QYIA 4YGYA 1Z4OA 2C9MA 5AW4A 2Q4RA 1Z5GA 1S2OA 2ZBEA 3PCTA 4Y2TA 1RQLA 3MN1A 4BEWA 2CFRA 1ZOLA 5ALIA 2IOFA 1NF2A 4DFDA 4EZEA 2B82A 2G09A 3QYPA 3FPBA 3KD3A 5AK5A 4F71A 5AKJA 1VJRA 5AI9A 3QX7A 2WF5A 4FYPA 1QQ6A 4EX6A 3AR7A 5ALTA 3ESRA 4XPZA 3KDPA 4UATA 3W5CA 4YCMA 2YFYA 3B8EA 5AICA 4IG4A 5AESA 1U2TA 1Z88A 4L57A 1O03A 2C88A 4Y2UA 4UMFA 2C4NA 3U7FB 2B8EA 3WKDA 2YMMA 2WF9A 3OCZA 4KNVA 3CNHA 3WK7A 5AW2A 5AKLA 4EEKA 4C4SA 2ZXEA 1T5SA 1RPZA 3QU9A 3U7GA 2AMYA 3QXGA 3ZUPA 5AW3A 5ALXA 3QU2A 3L8GA 4C4TA 3L1VA 5ALRA 1TJ4A 2Q4TA 3NALA 2G06A 1RRCA 5ALFA 5A3RA 5FP0A 1YV9A 3PGVA 3PGLA 2P9JA 2X4DA 1XPJA 4UMEA 2AH5A 3ZX4A 2HO4A 1S8OA 1TJ5A 4E88A 3OCVA 4QQFA 2YMLA 2FPSA 5ALKA 1RC8A 1U2SA 2BY4A 3U7HB 5T41A 1RMQA 2Q5EA 2W43A 3GYGA 3MC1A 5IT0A 3FVVA 4FFDA 5AW0A 3QUQA 1JUDA 3AR4A 4B6JA 3U26A 3SD7A 4UU1A 3WKEA 4H1WA 3EF1A 2YJ6A 3UM9A 5AKKA 3MMZA 2B8JA 3NAMA 4XOUA 1YNSA 4NABA 4GIBA 2DQSA 3OPXA 1RLOA 4YIKA 2JAOA 5ALGA 5AVWA 4NWIA 1L7NA 2BDEA 5AVSA 4AS3A 4Y2XA 1U7OA 2WM8A 3BA6A 3L1UA 5AVRA 5ALHA 5AM1A 1LTQA 3DDHA 4KNWA 3L0CA 2RB5A 5AM2A 2HCFA 4ZEXA 2WF6A 4Y2VA 2FI1A 4Y2SA 1IWOA 4UARA 3OCWA 2G08A 3L8EA 3IB6A 5AVYA 5AW1A 1SWVA 4HGOA 4G9BA 4OHFA 4BBJA 3WGUA 1QQ7A 1TE2A 2MU2A 1ZS9A 1ZJJA 3M9LA 2GFHA 2VKQA 1ZRMA 2B0CA 1RDFA 3L7YA 2FPXA 2IYEA 4NAVA 4DW8A 4CE6A 3MPOA 4ZEVA 3QNMA 3N5KA 2W4MA 2MSNA 4J03A 2JAWA 3AR8A 2I33A 2C8LA 2GO7A 2YY6A 4HGQA 3ZTWA 2WFAA 2WF8A 3I1YA 2P11A 5AKGA 5AHXA 3E58A 4EX7A 2GHQA 5AI6A 4UM5A 5AI8A 2IOFK 2G0AA 2I7DA 5ALMA 5ALUA 3QU4A 2HF7A 4I9FA 3WK4A 2RBKA 3L0BA 3WK5A 2C8KA 4UMDA 1YDFA 2YJ4A 4I9GA 4BKMA 4BX0A 5ALSA 5AI4A 1WPGA 4BX3A 5ALWA 5A3SA 4HGPA 5AVQA 1TA0A 1X42A 5ALZA 3N07A 2YJ3A 3OCXA 3TLMA 1L8OA 3AR6A 3QLEA 3ZVLA 1O08A 4Y3UA 5AVZA 2IOHA 1Z4LA 4DCCA 4UAUA 5IS2A 5ALQA 2NO4A 2HF2A 1J97A 1Q92A 2JARA 4UMVA 3ET4A 3N1UA 1CR6A 5JJBA 2HSZA 1L7PA 4CF5A 4HAIA 1ZD5A 3FGOA 4KX3A 2HHLA 3P96A 4QJBA 5AVUA 2I34A 1AQ6A 1Z4QA 1CQZA 4L6AA 5AKYA 3IJ5A 1SWWA 4UW9A 2NYVA 2G07A 3WK9A 3HYCA 3UMBA 4UM7A 2OA0A 5AIAA 2PQ0A 2FDRA 4Y2PA 3ZU6A 4EELA 3KBBA 4HGRA 1VJ5A 5AM5A 3NUQA 5AKZA 2JGAA 2ZBFA 4JDPA 3N28A 3F9RA 4O8CA 1ZRNA 4CF4A 1EK1A 4L6CA 3ZX5A 2FPUA 4KYTA 5AKIA 3KZXA 4Y2YA 3U7EB 4FE3A 1RLMA 5E0OA 5AW8A 3N8GA 2YMPA 3B9BA 4UASA 4Y2RA 1YS9A 2HEGA 4UU0A 5AVVA 3U19A 1QQ5A 5ALNA 1YJ5A 1NNLA 3AR2A 3FM9A 3HLTA 4BNDA 2CFTA 2FUEA 2R8ZA 5ALYA 3OCUA 4DWOA 3ET5A 3WKCA 3B9RA 1N9KA 4KX5A 2WHEA 1VFPA 1L6RA 4EENA 1K1EA 5AW7A 4BNDB 3RFUA 3SLRA 3ZI4A 1U02A 3UMCA 1Z4IA 3L8HA 4UAVA 3D6JA 4CNQA 3RF6A 2RAVA 3VAYA 1SU4A 3S6JA 3OCYA 4JB3A 2ZBGA 3FZQA 3NANA 2P69A 1L8LA 4OD0A 2HX1A 3NRJA 2I6XA 2B1RA 3PDWA 4OFZA 5IT4A 2OBBA 2O9JA 1RQNA 1QH9A 1ZD3A 4C4RA 2EARA 2R8YA 3E84A 3IRUA 5AI5A 1RKVA 4BYGA 3M1YA 2FPWA 2QLTA 1PW5A 2G80A 2HOQA 3UMGA 2GHTA 3QU7A 2YJ5A 2FEAA 1T5TA 2B30A 2RARA 5AI0A 2NO5A 2B1QA 5AM4A 3KC2A 2CFSA 3FPSA 3QUTA 1KYTA 5AW6A 3SHQA 5AIBA 3A1DA 1RMTA 3ZVNA 3NASA 2YN4A 5AKHA 2AUTA 2R8XA 1TJ3A 2AGVA 4BX2A 1T9ZA 1WR8A 2YBDA 5A3QA 1XVIA 3W5DA 4HYTA 3SKXA 4MWOA 1RMYA 3NIWA 2MU1A 3E8MA 4GXTA 2R8EA 1Y8AA 1RLTA 2PKEA 3R4CA 1L7OA 2OM6A 3WKAA 2GMWA 2ZBDA 3ZWKA 4NV0A 5AKXA 1L7MA 4YCNA 4KN8A 1RKUA 5ALJA 3SMVA 4Y2JA 5ALEA 3L5KA 3R9KA 4Y2QA 1Z4NA 5AK4A 4YCLA 3CZ4A 4MUMA 4AP9A 1XP5A 2FUCA 2ODAA 5AK6A 2JAUA 1WVIA 1EK2A 3DNPA 3WGVA 1Z4MA
chains in the Genus database with same CATH superfamily
1YS7A 4MHSA 5A3VA 1CUGA 3LZDA 2RGGA 2YZ2A 1THMA 3M7DA 3EAGA 4GMFA 4GM0A 2MTBA 4HEQA 3HCPA 1ZSNA 4DLWA 1DBSA 4A26A 3AR9A 4RNMA 2DMRA 1RXVA 3LRTA 3B2EA 4BNYA 4YT8A 2ZYHA 4BCDA 3A1CA 4O3NA 2PRZA 1KEPA 3E9EA 4BGDA 3MCAA 1LXCA 4MW2A 3U7QB 4BNGA 4ZICA 7ICHA 3CLSD 2EP8A 3GFSA 5F2NA 1NG1A 1Y8RA 1OR8A 1Z7GA 3WVNA 4YNBA 3ITDA 4M6WA 1LSJA 3TI9A 2Y9PB 4X1OA 1LKYB 3GLTA 3SENA 3GELA 2OGTA 3NONA 1F5SA 5KHLB 2ZWIA 3EW9A 1HDRA 3MJTA 4OQFA 3PSFA 4M0KA 4Y2TA 4BFLA 4MGYR 1BHSA 4QYTA 4YUXA 4YAOA 2CLFB 4F38A 4GQAA 1G3UA 3C4VA 1U0BB 5ITVA 2GCOA 1SAYA 3FPKA 1C30A 1KVTA 4NXMB 2JH7A 2HRQA 2H1SA 1Y8ZA 2IH2A 2Q28A 2YMMA 2QXTA 4R51A 1P4JA 1RLJA 5EMJA 1ZQCA 3CTPA 5JSQA 4UREA 2HOFA 2V4UA 1AJEA 5ALFA 1UZNA 3ABQB 3VZDA 3ZS9A 4DMKA 3OZUA 1OWLA 4YK7A 4QZAA 5DIFA 3MWDB 5KJEA 2H7CA 1GYRA 1IG0A 4WESA 2C78A 2Q3EA 3HCBA 2C28A 5C51B 1Z2AA 4W6ZA 3AKDA 5HR7A 5FUBA 1WU7A 1YFKA 4HH0A 3VH2A 3KB2A 2W0MA 2FPKA 4MS1B 3BA6A 2XY7A 4LGVA 2XQFA 1JT2A 1UFVA 3K0KA 4NXZA 3LM8A 3GDHA 1M1ZA 3C3KA 4GT1A 2QVLA 3SZLA 3K70B 3STUA 3DAPA 4J6FA 2HAEA 3W90A 1FIUA 3FSJX 3IMCA 5HCIA 3TFOA 2XGMA 1LK7A 2WF8A 4W99A 1PR0A 1ZCAA 1ENOA 5CBPB 2P6NA 4GE0A 3FHJA 3GUYA 1U7ZA 4QODA 3KZMA 1UJCA 4TTAA 1L5YA 2MYUA 1U81A 1HTBA 2VXYA 3DL0A 4HNSA 1O1YA 3BJIC 1QRRA 3QKSA 3UAZA 1GL6A 4RZXA 5JJBA 4P86A 1HX7A 5MGBA 1Y9JA 2QLNA 3REFA 2DUMA 4MGIR 3GVXA 5GM2A 1PNTA 1Q50A 3BKXA 4AIRA 2FMKA 2WAXA 3FSEA 5DG7A 1YZVA 4ASUD 2CL6X 2DFKB 2MWMA 3DEHA 3RNOA 3AEQB 3PP8A 3K9LA 4CIYA 1V5EA 3EIQA 1FFYA 3PX4A 1J06A 3T7IA 1X9IA 4Q3CA 3EWAA 1WD5A 4L9WA 5C1IA 3O4RA 4PLZA 5JH7F 1W88A 3PRKE 3N7UA 4B4WA 2WWIA 4M0CA 5BOSA 4DV1B 1XBTA 1Y3BE 8ICGA 2YWXA 3OPYB 4BEBA 1VL0A 2RH8A 1KJ8A 5LC1A 2DQKA 1NYTA 5I7HA 2AXPA 3NOXA 5ES4B 5JDCC 3ESYA 5FTJA 3G2LA 4BFYA 4PZNA 2DTDA 4KVZA 1WB5A 2PZAA 4F85A 2JFFA 3UJ9A 3RE1A 2C1XA 3ZDFA 4JVLA 2ST1A 3TNYA 1L5GB 2ATXA 3CBGA 4QO8A 2ACVA 4IZHA 2YZ7A 3DJFA 3QNWA 2GYYA 2MU1A 4QZCA 2QW1A 4J9QA 1LA2A 3MVEA 1J8YF 2VNKA 4MUKA 1IBRA 3O0DA 1XCOA 2OUIA 4Y2JA 4OLHA 3B60A 2PGNA 3SK0A 5HK8A 1SC6A 1VXRA 3B53X 4A15A 4GICA 3MBIA 1UH5A 2C7BA 1QKIA 2PXIA 2IEBA 2UUBB 2R6R1 4JX8A 4R68A 2J30A 1FUKA 4RD2A 2REQB 1CEYA 3B85A 2VJ5A 2WINI 5A7FA 1EFLA 4DNPA 3GDOA 4YCJA 4EI8A 2I9GA 1N5RA 4DSNA 4XEUA 4I4LA 5M34A 2IV3A 4I28A 5JVDA 4BB5A 2PAAA 2R85A 3D6NB 3LSYA 2FX3A 4O6VA 4BIIA 1ZQ9A 5DHRA 4UEOA 4EKEA 1DOZA 1SKQA 1ZMRA 1VSQA 3KOXA 1E2KA 3FROA 1BWRA 3AI7A 3E03A 1WXGA 5L1JA 1VYUA 1RHMA 4JIGA 2XYGA 3EVFA 2VH2A 3KLNA 5J3JA 1C7FA 2QZSA 1Z74A 4DNOA 3GPCA 2CFRA 3CO5A 4WCVA 5AK5A 1YZYA 5MFZA 2C95A 2CVQA 2R66A 4NJMB 4JJ8A 2ZK7A 1CD5A 1M2KA 5I9BA 5LMNB 3IA2A 4G41A 3WRYC 1EDBA 2WG2A 3E48A 1WIWA 4UEJA 4IRXA 3PQ6A 4DSZA 3AU9A 3GMDA 3JARB 4XCQA 2OSVA 4WXHA 1PV4A 3RC1A 3ZK7A 1P6QA 2H6EA 3TOZA 4Y0VA 3IR6A 2DKNA 2MOKA 5H3LA 4RSHA 1X40A 1OKKA 2KMLA 3AC0A 4L8VA 2WTAA 2OCLA 2JJMA 2VBGA 4ESEA 3W4JA 3GRPA 4E88A 2FKNA 3QE2A 4E4TA 1CJCA 3KJHA 5ALKA 2EKPA 4FBMA 1E0SA 3P9XA 3BERA 3FUUA 1VIMA 1RXYA 2PKXA 1BEEA 4K40A 5JASA 3JAKA 5JTUA 3BGIA 1VMDA 2ZYSA 3PC4A 3RCBA 4K9PA 5F7XA 2QRQA 1DC6A 2UKDA 3QHAA 2BELA 1RRVA 3LT0A 5FLXA 3DDZX 1V16B 4UARA 2CLMB 1GKUB 1W19A 2ROQA 3QEJA 1T1EA 1FFEA 2BTQB 1S2NA 2GGSA 3DXFA 1MG5A 3L0IB 1LDGA 5L3SA 2WWYA 1L6NA 5IZCC 3PRJA 1JHDA 2VCYA 4H4CA 4W5QA 5EXTA 4EX7A 5KHAA 2P3QA 3G0DA 4KN7A 4NPAA 1WS6A 4IQUA 2GNAA 1U48A 3MWEB 1DBIA 5E2BA 2YJ4A 3N6RA 4C04A 1H9AA 3UKDA 5HK9A 5KFOA 3DUWA 1J49A 4D9JA 4Z53A 4HYKA 3WJ7A 5KJFA 2GX6A 3K53A 4O2AA 3AT1A 4YCBA 7ICEA 1AK1A 1CQIB 3ZDEA 2XRZA 2KICA 2NVUA 1LTKA 3G3EA 5E95A 1KO1A 3UXPA 1T9DA 1ST2A 2SKCA 4TS4A 3Q15C 1OWPA 3KZXA 3GNLA 2LP4Y 1K3TA 2BKVA 3IQWA 5D51S 5AVVA 3F6BX 3FYUB 2DKOA 2WT9A 1TQ2A 2J3IA 5JD3A 4B45A 1X38A 3F5QA 2WHEA 4DBVO 3OX2A 1SZJG 2DRIA 5KG7A 1J0EA 1LDBA 2YVQA 1R66A 4UAWA 3WSVA 1DRKA 3UB3A 3WGJA 2AN3A 1Y6RA 4IS3A 2FQWA 1P9NA 2I7CA 2VJBA 4B7CA 4NOJA 1Z6YA 5KQMA 2VQ3A 2FR0A 4QU5A 3M1YA 2FVYA 4BTVA 2GH1A 1QJ4A 8OHMA 1E5TA 5KYUA 5C53B 4LJ6A 5C0OE 1NUHA 3LXXA 5BQXA 4W1PA 1E1YA 3KALA 3SYTA 1NBHA 3NH9A 3VZPA 4O5OA 3JQCA 4YDSA 7GPBA 3OZAA 3C7AA 3D6FA 4MTLA 1R8SA 3ZVRA 2PL9A 1L7OA 1KY4A 2CLLB 1JXQA 3DBLA 2GZHA 3PFBA 3DOHA 3TLEA 4TL7A 3RJTA 3TW8A 2W9BA 5DULA 2CXUA 3JZIA 3GJ0A 5CU7A 1POWA 3TGLA 3HXMA 2W03A 1IJKA 1MHPA 1Z83A 1S5PA 2PZFA 2O50A 4TT3D 5JXIA 3AUAA 1Q8KA 5B7PA 2I7VA 1RXUA 2G7ZA 4HGNA 4RD3A 4CKCB 5KG5A 3O2SB 2BHRA 2GAIA 1LB2B 1N78A 3TG8A 4UB3A 2EAUA 2CNDA 2QQ0A 3LW8A 3U5ZB 2HDOA 3PLAE 4G1BA 2I4OA 4BUZA 1M76A 2PH3A 2ZANA 5JRTA 3ZJ5A 2PU7A 3A6HA 1R6UA 3AG6A 5ILGA 1U7DA 3BHJA 3AB8A 1U0LA 4RIIA 2IBKA 2D62A 4BVEA 2CCKA 1WBJB 2GPSA 4NZNA 3CR8A 2BI7A 2CBZA 3QVMA 4X85A 3UW3A 3FNRA 5IN4A 3RHSA 1NE7A 3OU7A 1DC8A 2Q9BA 1VMAA 4UB4A 4XD2A 2VYNA 5IXSA 2H9AA 4W63A 1E89A 1GZUA 1FNDA 3B89A 1OFUX 3KQKA 4GOOD 3GEBA 2POQX 1SMKA 4LGMA 3BFVA 4CDMA 4JBIA 2KTQA 2PH5A 3BM5A 1Q21A 5H16A 4R98A 1GKYA 4WK4B 3W8DA 3U44B 2OXIA 5KFMA 3AJAA 3UK2A 4RFSA 2Q5HA 1HE2A 4YLGA 2J4FA 1EP9A 1FE8A 2COKA 1LSSA 1QU2A 2RHGB 2BM1A 4MEBA 4FEEA 1N5JA 2V7PA 2XYQA 3LKZA 4BVFA 3CE6A 1VPTA 1OTYA 2A58A 2QR5A 5BSMA 5CDTA 1TUIA 3SEQA 4NS4A 3AR4A 4MS4B 3KUKA 3AM1A 1XGKA 2ODNA 1JIVA 1RP1A 4OU4A 5L3ZA 2IIPA 1NRXA 2BBTA 2J87A 2UZ1B 2EFEB 1NVBA 3F2BA 1MEEA 1QOQB 1FTNA 3ZE0B 3WLJA 4GLFA 4UOZA 1C7ZA 2W3SA 3GVHA 2PTHA 4YC7A 2W9MA 2WQ7A 4ED2A 2H2DA 5DIZA 3T5CA 4J94A 4RO0A 4X1IB 4U0JA 3AGQA 3U37A 1ECWA 3RVQA 2MSNA 2X0DA 3TOXA 3T6KA 2XA1A 2EDAA 1L3UA 1CEXA 1LI7A 2EKLA 3WK5A 1U0RA 4EABA 1Y3DE 4FD3A 1UPFA 1S3FA 1IZ9A 1KMHA 4G5SA 4I1OA 4JT2A 2H4JA 1KGSA 1LDNA 2JEYA 2ZIUA 4FBTA 4D4LA 5BO5A 2JDID 4LC1A 5IJAA 4RVOA 1AKEA 2JI6A 721PA 3LT4A 5KOHA 3NV7A 3JR3A 3BGOS 1ZVKA 1CEZA 2ZCUA 3M9NB 1WMFA 1KYYA 2Q5OA 2GASA 4CZ2A 3N59A 3MBOA 4BQFA 4DNXA 1PR9A 3I34X 5HF9A 5AIAA 2ECOA 4XQEA 2PLAA 4PO8A 1G64A 4ECZA 3H5LA 3BHMA 3RRXA 4BNFA 4DRXA 2D7CA 1RJDA 2ZEJA 4C0WA 4QZVA 1JZSA 3T0IA 1OFTA 3BGWA 1RKXA 2GBCA 1T1GA 1EUDB 3SFVA 5CM8B 3X1XA 4MPDA 1RG6A 1NBEA 1R27A 4BO4A 4ZCMA 3HPOA 5AXAA 3TE7A 3IMFA 1CE8A 2UUPA 5L6MB 5EC8A 4E4YA 4ECVA 3FB1A 3E05A 4GOLD 1QHYA 1ECBA 1YRYE 2FOXA 4QREA 3PCXA 4QDOA 1Z00B 4EEZA 2YBDA 2PZ8A 2JRLA 5YASA 1JXEA 5JC1A 1M2OB 3OFVA 4GLJA 3T38A 4POAA 4DJTA 2BF7A 1D0IA 3IH5A 3ZWPA 3L4BC 2B1IA 3DVRX 3RBAA 2RI0A 4J3FA 5GTDA 3ZJUA 3EEOA 2A9QA 2OGWA 4KKXB 1OILA 2E1PA 2E48A 2BGMA 4D80A 3AR5A 2OKGA 4GE3A 1YVUA 2XBMA 4YAIA 1FP6A 5EP2A 4YLYA 2BUBA 3D2NA 3TQHA 1L4HA 3CZ5A 3GLGB 2H52A 1GILA 3RTAA 1JPNA 2OHJA 4Y2GA 1JWBB 3ZPXA 1EM8B 4S0ZA 1UBHS 3NVKI 4Z4FA 1KDTA 3DLTA 3FDIA 1JHXA 2CKMA 4LJ7A 4IIVA 1VLVA 4ITRC 1FX0B 1YMQA 2GZ1A 5LYJF 5CLHA 4QSHA 1FQOA 2UYOA 4KLJA 3A36A 4ZEWA 5TT1A 4LRUA 4G07A 4RBNA 5IVIA 2R84A 1J2RA 2MT9A 4X8HA 4F4IA 2JGKA 1FW8A 3K4GA 3PNKA 3QE3A 3UPTA 3K0FA 1F51E 1G63A 5FEUA 1A0PA 2R6ZA 3GRYA 5IMSA 2Z4SA 1T1SA 1DXSA 3PNMA 3QZ8A 2BVNA 3IIMA 2JZBA 5J29A 1MA7A 1B6TA 1A77A 4INOA 4Q6WA 4ZT6A 3T9AA 1S0UA 5F77A 1P1JA 2WEKA 1KAMA 5FDFA 5EQDA 1QHSA 1KTIA 4HS9A 4XX1A 1D1TA 5KVVA 3PO5A 4ZEMA 4OXQA 3KDPA 3VR5D 2FV8A 1CNFA 2Y93A 5EE9A 2QRGA 4EVQA 1JYEA 3EASA 1DHTA 3SQDA 1G7SA 1EQAA 4J16C 1GNLA 3Q10A 2QVYX 4URHA 3IAM1 3TIGA 4Y0AA 3KKAA 4UM9B 4PRKA 4OHPA 1RTTA 4R8RA 1ZJ5A 5ICEA 1ADBA 3HA7A 4XJXA 3PR1A 1KKUA 1QBGA 5B7NA 1X80B 2HRBA 4HX9A 4ZVPA 1NY5A 5KG0A 2F76X 4MJ7A 2RGBA 1HBJA 4BLOA 4ZWNA 2Z6UA 3WADA 4OQLA 1ZH2A 1RC1A 2C4UA 1U7OA 3AYZB 3D6VA 3RLIA 4JI7B 1M67A 5TQ2B 3Q3CA 1IWOA 3LT5A 2DWOA 3L7DA 4OHKA 3WA6A 4OHFA 3V1MA 1IN5A 1Q1QA 4DLGA 2FSGA 3U17A 2GFHA 4XH9B 1JQAA 2QQGA 3LDAA 4YR2A 3QPBA 1I5OA 5JAUA 1CVIA 4KDFA 3KHTA 4DQXA 3LXRA 2QZJA 3M5PA 4UB6U 1A9YA 4ZV7A 4BPBA 2ECFA 2J9FA 5HILA 2E0IA 3AKCA 3BS5B 4IV0A 1JXLA 3BQNB 1A9SA 5C5EA 3VPFA 3WYDA 5A3SA 3SC2A 3HB1A 3HVJA 1XZEA 4NICA 2HV8A 3ZBPA 3VHXB 5K4LA 3OU2A 1Q92A 3UJPA 2G5GX 3TI0A 5C0YA 1CIPA 3PIIA 1T24A 4BGUA 2QIOA 3QY9A 1DX4A 4JB2A 3WP0A 3EUEA 1RIIA 7REQA 4DLKA 4PQGA 1HXHA 4P5PA 2IGTA 1VJ5A 3ASZA 1AQNA 2CNOA 4JMLA 4NSNA 3GV8B 1E4YA 4FR5A 1USKA 4FN5A 4TQAA 1Y1LA 3OESA 3W1EA 3I52A 1LPNA 2I65A 5JZMA 2TMGA 4JVMA 2GEKA 1HDEA 1WCNA 3WGHA 2EERA 4FW8A 1HA3A 4RGVA 4DVGA 4XW2A 4LE0A 4JB3A 1JDBC 4HNAA 4D8YA 3SI8A 2KBFA 4I1UA 1O8CA 5FJIA 4RK7A 3PDWA 1SVOA 3G23A 3WR5A 4KN6A 4DMMA 3F5DA 1R10A 4YFYA 1N2CB 1N5XA 3LL7A 3ZWMA 5IUKC 1H5UA 3IBFA 3F5SA 2GF9A 4A2CA 4LJ9A 1QS0B 2YVUA 3HA3A 5D3MB 4AYBF 4CT4B 2R8PA 3LP6A 4ZVMA 3BK2A 3H17A 3W5DA 1I1OA 1RMYA 2AX3A 2EWVA 1O4VA 2QBYB 1P39A 2ZVQX 4A92A 5CXUA 2AEFA 4YX9A 1BPYA 4ZOCA 2EW1A 3FIUA 1HLPA 3HYTA 5D1NA 2VP5A 2M9NA 4G9GA 3QTBA 5JQGF 3GL9A 4QU0A 1WXWA 3FCXA 1W4RA 1TMGE 1B42A 8ICPA 3FSGD 4GPZA 4R1QA 4X20B 2IGBA 3QF4B 4DIEA 1ISSA 1VG9B 2XZDA 4WNAB 1FY2A 4HB0A 1C8BA 3ZDXB 4WBNF 3NNSA 2LPEA 4TV8B 2AZ4A 5JARA 3TZ6A 2Y1IA 1C8VB 3I30X 1G60A 4CWAA 3QX3A 4ZXFA 2XOKA 4Q3AA 2YWCA 5DFAA 4L8WB 3KJQA 4Y67A 4BMZA 1OAOC 3HLKA 4BFUA 2CPRA 2W58A 3KQSA 4NX2A 1PQ4A 4GG1A 3GXBA 2HZ7A 1JAXA 5H2FU 3TSAA 1XFDA 4BMYA 2VZEA 4YAUA 1JTVA 4IRDA 5BSVA 3LK7A 1P0PA 3FHLA 1IB6A 1DP4A 3SU8A 3B78A 1PSZA 5JMOA 3Q72A 4RKRA 3ZIDA 4EZEA 3DF7A 3KD3A 3WGMA 4R4JA 2J85A 1EWKA 5F5XA 3VOAA 3RVRA 3ZE8A 2O8BB 3PCRB 5AHWA 1YGPA 2VJCA 3KT6A 2QSUA 4P80A 3WIUA 8ICLA 4U7JA 3A04A 1R5BA 4WOPA 1XC9A 4LISA 4NV3A 2AQ0A 3KUDA 1B15A 1CEEA 1MA3A 1WWKA 3GI1A 2F1OA 1HT1E 3QQPA 1ZI9A 3JWIA 3THYA 3AY0A 2VTVA 4O1HA 1OREA 4OBEA 3H9QA 4Y1RB 4QVGA 3EC1A 2HJGA 3TM5A 3BG5A 4IH9A 4EARA 2X7HA 4YMHA 2D7JA 5F9HA 3BL6A 4CKBB 1PBNA 1FSZA 2JR5A 4MKFA 1W85B 4P4TA 1YZ3A 2QM8A 4ELUA 1P45A 3BK7A 5I7SA 4XRGA 1ES9A 4XTRA 1YR2A 4URYR 3IT2A 3FVWA 1ARZA 1YQWA 3OHAA 4XFKA 2ZRJA 1WOMA 4JV5B 3HO8A 4E6PA 2YHBA 3R0IA 4JXJA 3I9OA 3V80A 3EGXB 1SB3C 3L77A 2DB3A 4UOQA 3BH7A 2VZLA 5A9RA 3QKRA 2Z1NA 1JVBA 4M9XA 3HUEA 4V39A 3Q6MA 4X9XA 3U0VA 3VDQA 1CY8A 3H2KA 5IULC 4PRZA 1G16A 2QWXA 3RBXA 4KXWA 2C82A 1AS2A 3NW9A 1J99A 4BKMA 1I2AA 1PHPA 4JP2A 1NBMA 1EVIA 1B14A 2DLDA 5AVQA 3X0DA 3SP1A 2PHZA 2NV0A 1U45A 2EGGA 1IXRA 5DM4A 3VZRA 3FYDA 5LQDA 5CPBA 2B61A 2GVNA 1JKJA 5KO2A 3SR6A 1GPKA 1W8DA 1X3SA 2JBWA 4J0DA 2Q5FA 3VTZA 2IY7A 1J20A 1V8ZA 4MGZR 4ND8A 3LX6A 3RSSA 3NHSA 1T35A 3EPHA 3KUXA 8ICVA 1OI7A 3RRFA 3HL0A 2CFTA 3PF8A 4JQSA 3WLRA 1C9NA 4MKHA 1T34A 3ABSB 1DTEA 1JEAA 5CT5A 9ATCA 1QH8A 5IVDA 1U7HA 3UXYA 3OQIB 4TXNA 3WQBA 3FTDA 3QI7A 3Q2IA 2J5KA 2JAQA 2O1WA 9ICSA 4BYGA 1E2UA 2SECE 4O2BF 4B17A 1E1MA 5FUYA 4M8NE 4J4TA 4IKOA 3P2OA 2ZWAA 3ADKA 4AZTA 3V7LA 3KU1A 1MNQA 4TLBA 2ID8A 1QPGA 3RKRA 3KQNA 3K8ZA 2E87A 1Q14A 2ZAMA 4LQLA 3ZQJA 3AVVA 4MQEB 2WJIA 1M34B 3HJRA 3SVZA 1TVAA 4R41A 3RSLA 3CZ4A 1KPIA 2Z8YM 2WSLA 3PXDA 3IUJA 3BEOA 3T3IA 1XTQA 3ILHA 4DL4A 1WABA 2PUAA 3SQNA 1JXOA 4LFAB 4Z9YA 4W5RA 5LIRA 3HCAA 2QQFA 3BBLA 4C8NA 4UKDA 2XADA 4AJNA 2P6MA 4PHHA 1QIMA 1DWOA 3ZQKA 3VRHA 3ON5A 2FQXA 3LC7O 5KFIA 2ZOSA 1RAFA 3OJXA 2CV2A 3HSKA 4KFSA 2Z56A 1ISJA 3ZLUA 2VAPA 2PGOA 1C7EA 2Q1XA 2IYRA 1KVRA 1NLUA 1WOYA 2Q6OA 4BWGA 4AKGA 3RRJA 4N8SA 3EBLA 4BEWA 3D0RA 4DZTA 1D04A 4DFDA 3ANTA 5LDGA 2WB2A 2MAXA 1US8B 1SHUX 3KTFA 1PZFA 1YK1A 5EQFA 3GVPA 4HAXA 1SH7A 3HKZF 2F00A 3RQSA 4D0NA 1KO8A 1Q22A 3S68A 1VL8A 3ONFA 3PEUA 4BB0A 3AH8A 4D6YA 4I55F 3B6ZA 4TTSA 1H6DA 3PGKA 3S8MA 1TPYA 1RRCA 1HY3A 1PTJA 1MO5A 2R4TA 9LDTA 3H05A 4Z5XA 3KKPA 1P3JA 4NU0A 4UB1A 4UNPA 4X66B 4LCJA 4DQKA 2V4MA 2ESEA 2OHOA 4KAXA 4MW5A 3RYCB 5J2JA 3IQDB 1PV2A 4KWTA 2PVPA 4HAUA 4O5AA 1YOBA 4G65A 4UBBA 1HDOA 4EYIB 1I4OA 4FYYA 5JLAA 5KCMA 4GOKA 1AMUA 2CHUA 1MIOB 3AVPA 4KPGA 2PY6A 4TS3A 2EJTA 2H18A 4J1TC 3IP1A 3LGAA 5KQRA 1ZQOA 3H2JA 1Y7TA 3RRMA 1U3DA 3CR7A 4OSPA 3EIHA 1GGEA 1OFHA 1C5KA 1WXIA 3SR4A 1JI7A 4WN9B 3OFKA 1WCIA 4OK5A 1RCFA 2OWOA 2P11A 1E2LA 4BATA 4CCYA 2AR7A 4PHPA 3TM4A 3F2CA 2OP1A 3FDJA 4MV8A 2DFLA 1QKJA 2Q2VA 3CWCA 1RJWA 4MMZB 4EYQA 3OWOA 1CJBA 1VCMA 4KFRA 4YRKA 2YNMC 1KWKA 4F6RA 4MQMA 4MZDA 1YFJA 4YPVA 2M6LA 2B20A 1JSCA 4QATA 4RHEA 3OHMA 4KXVA 5D01A 1C9DB 5EIWA 1WDMA 3MFHA 1GQFA 3G2KA 5KYYB 3C1UA 4LW8A 5LMZA 1GADO 4RFVA 3V9AA 2KMDA 3K1JA 2EZZA 4OTZA 3R0XA 4UC0A 4GLOA 4KJXA 4CN9A 2X6TA 2J41A 3MOGA 2F3TA 3QITA 2CVOA 1BRTA 1WF6A 2G5CA 2C2YA 2IE8A 4PC3A 3WI7A 1BFDA 2AG6A 3DT8A 3DOUA 3R6LA 2BGJA 1P74A 3F1LA 4KIWA 2NU9B 4I5IA 4ZPXA 3KM0A 4ITUA 3DWGA 1A9RA 3ZIUA 5FADA 2IL1A 2WWXA 2O8NA 4MPJA 4Q4AA 3UCXA 2W2LA 5E9JA 2I6XA 5FIUA 3FTNA 1EEXB 2COUA 2A7QA 1OIWA 2D0DA 1I3KA 4V0RA 1FBNA 3GJRA 1Z38A 2JGRA 1MOSA 5KFBA 1VPWA 1OH6A 1MPXA 3O38A 3VTAA 3PTAA 3FZGA 5FWXA 1ZUHA 3H5VA 4UHHA 3ZD7A 2RK4A 2AGVA 2VR1A 4N0MA 1XZJA 2HL6A 1KMNA 2C5FA 2YC4C 2C3YA 4IOJA 4P38A 1G291 3RK4A 3GFTA 1VP9A 4DCGA 4KTQA 1G9XA 4YCLA 1A7JA 5FORA 3AU6A 5FLKA 2JJ8A 1RBQA 4EIWA 1PR1A 3GFBA 1LNSA 3FOFC 3EVEA 4PSVA 3H7AA 2Y1EA 4EFLA 4M36A 1F0YA 3ETGA 3IV6A 1MB0A 4BVBA 2QL9A 5KFTA 1RQ7A 1VSVA 1PW7A 4TPKA 4OL0A 4QPJC 1RYUA 4NYMR 1DWQA 3AWDA 1D2AA 1OU0A 2OV6A 3EHDA 4JKOA 3ZQ4A 5BV0A 2QM0A 5T5QA 4OAPA 5ED4A 4WCFB 2A1JA 5K0ZA 4NR0A 5I7OA 1GGFA 4BBAA 5TISU 4AZ3A 4YGYA 5CB4A 2VT3A 3OOWA 1GGKA 3PZPA 3NTQA 2XNKA 3MS7A 4UTZA 4HSGA 2I6FA 2YIDA 4JUIA 1EVLA 3LRXA 3TRIA 4F96A 1ZESA 3AQ4A 2EF1A 4D74A 5L9AA 1QQBA 1ZU5A 3UO8B 5THXA 2CHQA 2HIMA 2WF9A 3EJWA 4KNVA 3WK7A 4BVAA 3LI2A 2I6TA 4QGFA 3F46A 1IBCA 1X8KA 1TJ4A 3ZHUA 1PEDA 3QVWA 2GLTA 5T57A 3RODA 3BOSA 2OO3A 4OI0A 2VDWA 1ZQGA 3IAAA 1J8QA 1XCJA 4XX0B 3ITNA 2H3ZA 5HGXA 4L4XA 2OZPA 3QWFA 2ZXFA 3TPZA 2HNKA 2WZBA 5GZ3A 4DFMA 1GVHA 3KDAA 4QJ3A 5DKWA 3RS8A 2XUZA 4JHLA 4JLMA 5L7WA 2BFEB 2VBCA 4ARAA 5BURA 4YY3B 4F2RA 1NFRA 3WLIA 1JILA 2Q46A 1Y4SA 3BH0A 3GUUA 3OJSA 4MVJD 1IQ0A 5J4LA 1ZBDA 1WXDA 2V5VA 1CDZA 4U7PB 1FUUA 2H07A 3NVZA 1QH1A 4Q03A 5HUQA 5K6AC 5K0SA 4C3OB 1I4TD 1XVUA 5DKFA 4D41A 5D5HA 3U60B 1JHPA 1JE0A 4I9FA 4RW0A 4DG5A 3JW8A 1R0WA 3JQBC 1WPGA 5C4IA 5I4KA 1Y0BA 1Z8DA 4GR5A 3PR4A 2E4UA 3PT5A 4HRVA 4W1QA 3DVLA 5C8DA 2PJUA 3Q8MA 2HRDA 1WB6A 4ILEA 5C5CA 2PRSA 1PZGA 3VI4B 2ZYAA 2BIFA 3EXFA 3ABRB 1NBME 2AV6A 3GA5A 4Z1OA 1RAHA 3AEZA 4KLOA 1T3ZA 1RAAA 5DK6A 3CSUA 1XQYA 1GD1O 4OQMA 3RIEA 1W48A 3TFWA 2FWBA 2LBOA 2Q6LA 4PTLA 4B3SB 3LYUA 4HMOA 4IQWA 3ELWA 1FF9A 3WLAA 5E1MA 1PWYE 4G8JA 4R64A 1UIRA 2D1SA 3RUHA 3TPCA 3H16A 1E2MA 1XZMA 1W93A 4RT2A 1P4AA 4BFZA 2AC7A 2P2CA 3WLEA 1KFTA 1VSBA 1OE0A 2XYVA 4BZWA 2CDNA 1BOOA 1NW9B 4IOLA 4FMCF 2C9YA 2ZWMA 2HHUA 3VVLA 4GVPA 4CLOA 1EI9A 1NP6A 1FRVA 5LP6A 4FHDA 2YICA 2O4CA 1DHRA 3T5TA 2XUDA 2E5WA 4OH7A 5AJZA 1W49A 1Z12A 1PS0A 3KKQA 4QYWA 1PF7E 2ZE5A 5EMKA 2Q8QA 3WZMA 4E09A 2OCKA 2IU0A 1KVSA 4KIUA 3BRSA 3K92A 3NASA 4X63A 4II2A 4G5GA 5U9CA 4LNUA 3UTCA 2DBYA 3KVVA 1LU9A 1FLAA 1LS6A 1UP6A 5CH8A 3M6LA 1PDWA 2Q49A 1PJZA 4BUGA 1W36D 1P2GA 3F47A 4G2TA 2PX4A 2CXNA 4LBWA 1UJ5A 1WEKA 2G6BA 1VM6A 1FJXA 2DR3A 2D3TA 1U8FO 2IZ5A 2HJVA 3F1KA 5LQJA 4IV5A 3NM5A 2V1UA 5FOTA 2QHXA 5COQA 2ZSFA 5JU5A 2FDXA 4GXNA 4K0KB 1YBMA 1NK9A 2HCJB 2PXXA 4B6PA 1XNHA 3RFXA 2BEWA 1SUWA 3WBFA 2CWDA 4A0QA 4YJGB 1O87A 3MPUA 1T2AA 4G5XA 2GUGA 4HGYA 1BRMA 3AF0A 3RJJA 3RVDA 4DV6B 1GUZA 4YMNA 2JBAB 1GZ3A 2XUAA 4FM9A 3E9DA 1F0NA 4J0FA 2IJGX 2Z4TA 4YQFA 3CRZA 2QTWB 3W4IA 5EUQB 1LK5A 4HWKA 3MN1A 2CT8A 4KPFC 5HE8A 2GJAA 5CFZA 4XB6B 2JG3A 5H3CA 5J43A 4DT1B 3KOWA 3IOBA 2FRDC 4DMGA 2XVTA 5CURA 1N63A 4R83A 4N5NA 3NWPA 4TXLA 1BU5A 2G0TA 1EA7A 4H7EA 4NJ8A 1JEEA 3PFIA 4G0WA 3RC8A 1W4CA 2V6FA 2MMGA 1J9ZA 2H3EA 1AB5A 1SBTA 1N3BA 3R7WA 2LKYA 2J09A 2Z3WA 2C7GA 3SZRA 3RS4A 1JIJA 3Q9UA 3N7TA 4FFMA 4B82A 2V7EA 1GAWA 1NLMA 1DKPA 4DSFA 4TLMB 4A10A 3IJRA 1S8OA 3B5JA 8ICEA 1TW2A 1C14A 3E1KA 1OYWA 5AR1A 1QMPA 4UNQA 3MG9A 5IARA 5MN6A 3VSBA 1ZGZA 2ZQZA 2ZRKA 1PJCA 3UK6A 4I2CA 1YCFA 3VKFA 4FZJA 1UBFA 2CE2X 3VU9A 4MI1A 3NHLA 2YYZA 1G3MA 4QOHA 4L6IA 2EFDB 4RUCA 4CCWA 4FGKA 1IRXA 3O0TA 1NASA 1B8OA 3MRTA 3CW8X 3L0CA 4Z9XA 2H16A 1Q16A 2I3DA 5EIFA 4MQUA 3THSA 3MT0A 1K6EA 2NG1A 4XQ9A 2WUFA 1IK4A 4OJMX 3B38A 1ADJA 1LNZA 3H75A 1CRXA 3RTGA 4N76A 3VR3A 1A82A 3LNCA 3OU6A 2FLLA 4KGDA 3T5DA 3ZWBA 1YBVA 3P27A 5AI6A 4UM5A 4YP9A 1VDZA 4HJRA 5CAEA 1XZBA 5C5JA 4TMXA 1V8OA 3L0BA 3AUFA 1BW9B 1N2SA 2G70A 1IFXA 3OI7A 3JQ8A 3OIUA 4BX3A 4EBDA 3D6MA 4IDNA 5KFCA 1DB3A 2KI5A 3O4IA 5FT9A 4NY1A 5G0UA 1DRWA 5AJYA 1ZQRA 1Q17A 4KN4A 1NKCA 1EB8A 4WJZA 1NK5A 1ESNA 1VKOA 2H3IA 1R4AA 1TO2E 4MI3A 3FIJA 2ZT7A 3M5DA 4JODA 2W2MA 1MIHA 5P8WA 1WMSA 3PX0A 1S1CA 1ODSA 1VDMA 4E0DA 5CDHA 3DEKA 5K0CA 1F2TB 4C4YA 3PVSA 4Z0PA 3WMRA 2RGCA 3TXXA 4Y2YA 3ICWA 2WUGA 5HQTA 2YMPA 1P7PA 2FE4A 2GRAA 2BZ1A 1XHEA 2ECKA 4CKWA 4G4SO 3GPLA 5BR4A 2BH2A 3UAGA 4U8GA 5TJHA 5GOTA 1Z2NX 4CNQA 3SKVA 4MJXA 3AEKB 3Q88A 4TWRA 2ZXUA 4IVNA 4FILA 2O8EA 3BE8A 1WW8A 4HUQB 4OQZA 3T4PA 2KE7A 1XZIA 2DG2A 3ADDA 3MGBA 4HDSA 4DQQA 3G0CA 4HH3C 1DGJA 4FHZA 2EVWX 2MRLA 3H8WA 3C5FA 4HXYA 5I9LA 3RHTA 5CPFA 4C4AA 4M47A 3CZQA 4BXOA 3H13A 5EJAA 3W2FA 4GZ3A 3N0XA 1DXOA 1XSLA 1HE3A 3VKUA 1SELA 2F8SA 4NC9A 2PJZA 5A7HA 4LQ4A 3VSAA 1XPRA 3C87A 4KXXA 4K88A 3R0JA 5CIWA 2ZAGA 1V4NA 4LDPA 2RBGA 4FIDA 3ZV5A 4I4IA 3H5NA 3AV0B 2HHSA 2F8LA 2W8KA 3DLHA 3D31A 2OXTA 5CA1B 5AFSA 4EPRA 3RRNA 1UR5A 1BJKA 2F3RA 4MPPA 5HOQA 2V65A 1RE1A 3QLVC 2NPOA 1WBBA 4EF6A 4KQGA 4JR0A 2NRTA 3F3KA 2PE5A 1C41A 2O52A 4ND7A 2HN9A 1MFPA 2HWYA 3KFLA 3K94A 1HT3A 5AVXA 2X9NA 1K97A 4MLZA 1NXOA 5JPDA 1NOMA 4KWCA 5KDLA 5JOQA 2C2ZA 3ICCA 3PD1A 2WPDD 1O0BA 4TLCA 5DN9A 4HKTA 2PBFA 3RQIA 3MRXA 3ESQA 10MHA 1GYPA 5KI6A 2HMSA 5BSTA 2GJKA 1S2OA 3HVUA 4KI7A 4BQIA 2IOFA 5E0KB 4DAOA 3QBDA 1JHQA 4NFSA 5CB1A 4CM8B 4QU9A 4JYAB 1Y5NA 2DUWA 4XYGA 4EUNA 2BCGY 4WLNA 3D1JA 2VTBA 3DBVO 1CQJA 2JAXA 3MTGA 2IPAB 3E7WA 1L1RA 4LWZA 1C9EA 2RHFA 1GPYA 3QOWA 1ZJNA 1RPJA 2FPGA 4KHPB 1QGYA 2GZ2A 1UCVA 5IANA 1MJFA 1G2PA 2PZEA 2VSFA 2XIDA 3CLHA 5TPZD 3PPIA 3ZWQA 3WQHA 5K3SA 3RV4A 5HF8A 1GPBA 3DWIA 4QZIA 3FD8A 3GH3A 1WVGA 1OB2A 2B8JA 1FB5A 4O1IA 3E5MA 2W8BB 1I3CA 4XB1A 5IILA 1K6IA 1FFSA 3IN5A 4E0BA 4KXMA 2WWWA 9ICHA 1RZRA 1UF9A 2O8VA 2QXUA 1C3XA 1Y82A 3PNQA 2W83A 1XDSA 4EO7A 1T8TA 3V4SA 5BWOA 3C5WP 2V7QA 4DJJA 2FPXA 3GUVA 2ZZMA 4RGYA 1XRLA 3EB9A 1OYYA 2XUOA 3BH6A 4J03A 1KAOA 2JFXA 2IPXA 2GO7A 1MQAA 3DONA 1BH6A 3TZHA 4PLGA 5KG3A 2PUBA 3RSOA 2H1VA 2XGPA 1PG2A 3Q9NA 4QECA 2RH4A 1E3LA 4YB8A 2WWTA 4R3NA 5I9MA 3VBEA 3L05A 1LY1A 1DIRA 1KJ9A 3DPUA 2ZUSA 4P4LA 4PXYA 1X42A 4MRSA 2YXDA 5C81A 3LW7A 4HNUA 2ZBQA 2X5JO 4NHEA 1CNMA 4XSVA 5F5LA 4JI5B 2JK1A 3S2EA 3D2LA 1JB1A 1R15A 2XNCA 5CCBA 1C0EA 3MEQA 1ZHHA 4X1YA 2EAPA 2Y4OA 2JIZD 5DGAA 1E60A 1C81A 1PVOA 3C5CA 1J7KA 2OFXA 8MHTA 4MYDA 5E2AA 1Y5RA 1U3GA 3KBBA 3KYJB 4UUPA 2V4RA 1CUIA 2YQZA 5BWLA 3GQBB 4AJ4A 4A0SA 2IZZA 3HR4A 3TIFA 2PFSA 4JJIA 4OJYA 5J0YA 3MABA 1UMBA 5K2MA 3NXKA 4D4GA 4BGVA 4LF8B 1QTNA 3CT4A 1PUJA 3BMQB 1FOEB 1TZKA 3MMPA 5JAIA 4A2WA 5A4JA 2Y1LA 3ID6C 2H92A 2J8ZA 2V1XA 3ECCA 5ENDA 2P65A 1G5FA 1V7PC 4QBFA 3C28A 3DW1X 1NBAA 1SUCA 5HX7A 5HTOA 1UKYA 5EKXA 4XIIA 1U0TA 5EG5A 2GCPA 5CFNA 5B6PA 1VRWA 2JHAA 5LBTA 1E9BA 3VC1A 4RNOA 2JGJA 3R7NA 3CGWA 3ZCTA 3ISDA 3AGPA 2I2BA 1VKJA 3K6KA 4E2YA 5DYTA 2QP4A 1OGIA 2Q50A 4AK9A 1YQQA 1KOJA 1D4FA 2ZFUA 4B87A 3PR2B 4I46A 1U11A 3N58A 3VPGA 3PXEA 2HBQA 3TTTA 2PX0A 1KE2A 1ZUNA 1YJCA 4NHOA 1Q57A 2F8KA 4X1KA 2LYBA 1Y3IA 3RFCA 3MGAA 5LDHA 2KWIA 4RNDB 4GNKA 1FQWA 4O4LA 1FK8A 4QTYA 3MHTA 3LWZA 2CL7X 5E6RA 3EPLA 4R8LA 5B6IA 3F5AA 4ZOLB 3AUJB 2FUKA 3VYSB 1Z62A 4FMDF 2IPNA 3HG7A 2B94A 5J2GA 1ND5A 3KKOA 2O5RA 1KIFA 1CKEA 2ANBA 1IZ0A 3ZHOA 1ETHA 4ANFA 2NUBA 4U7GA 3LF2A 1W25A 3PQ5A 2HBRA 2DFTA 1KAQA 3QEMB 2EH9A 2HHAA 4H60A 2H7VA 4BV9A 5EPEA 1N92A 2AXEA 2NO7A 1TRKA 3FKJA 4FBUA 5L40A 2OBXA 4X90A 5BWNA 3I8OA 3QNUA 4RMNA 5CIQA 5TZVA 1OBCA 3U39A 2B7BA 5HZKA 4QPZA 5ALIA 1Z0IA 2EFCB 4XYMA 4EA9A 5JVDF 1U0GA 1MC8A 5JAOA 1VHQA 2QUIA 4HH1A 1KU6A 3C8MA 3PXBA 4OIMA 1OBHA 2I2AA 2BP7A 1CDEA 3AJEA 1FS4A 4KLHA 2GWSA 1KS2A 2BJVA 3GT4A 3ZDDA 5ECDA 1BKDR 4YCSA 1E79A 3SPXA 2QK4A 1IYZA 1U0SY 3VH1A 1XTUA 1PK8A 4YJFB 2UXDB 1H2FA 3EH2A 3JATA 1CB7A 2OHHA 4LJ4A 4CTKA 1RMQA 4ZU3A 1Z6QA 3FFWA 5E6SB 2GXSA 4A73A 3QVJA 2OGZA 3QENA 2CMKA 5C31A 5L7TA 1T2FA 1ZUD1 2WAOA 4ALIA 3VZQA 2RKOA 4TVOA 1PLJA 3WQSB 5TGTA 4BJ1A 2RB5A 3K0SA 5E38A 2C7RA 2X1MA 4HNGA 3IUBA 2WJHA 3LBNA 4TLAA 5EZQA 5IKPA 2RJOA 1V1MA 3FX2A 1OH8A 1DCFA 3STWA 3GEMA 3T5LA 4O33A 2F8TA 3UG6A 5DVZA 3BXFA 1V3TA 1DMRA 4L4SA 1XTJA 4F8YA 3GXOA 4TKUB 2PX8A 2PKYX 3DZKA 2XE7A 5C52B 1HURA 2B8TA 3GJTA 1HEUA 4AO8A 1N36B 4RFLA 5ES3A 1K27A 2OXFA 1WLSA 4K1XA 4MO9A 1W0JA 3N07A 1TZJA 3M9WA 2W9CA 2G7MC 2HHQA 3MR3A 1KBQA 1P5JA 1M1YA 3L1HA 2HW3A 4BU1A 2UYGA 2OV4A 1XRMA 4JBGA 3QE9Y 5J2TB 1JMSA 3O8OB 3NBQA 1I4EB 3UZUA 3WG9A 3FHCB 3K70D 3WK9A 3HV0A 4MRVA 3ETJA 3KSRA 2XMBA 4IUDS 3N8GA 4L0CA 4UU0A 1GFIA 4NE9A 4ZQIA 3FTFA 5B3AA 4E94A 3LRPA 4F9EA 3ZCVA 3VO2A 2GCGA 3NETA 1ID8A 4O3MA 1UA1A 4O2AF 1CHNA 2I6SA 2DT8A 2SCUA 1NXPA 3FZNA 2QUBA 2QL6A 3U3DA 4BECA 4R2JA 3DTNA 3BDPA 1GPH1 1AKQA 3IURA 4OFXA 2BTEA 2JC3A 4D92A 1KYIA 1NKEA 4Y8VA 2ISOA 1P75A 1F0MA 4IHAA 2G80A 3UOAB 4BLRA 2HDNB 4M60A 1NNI1 3CKYA 1KSFX 3UTDA 1ZYQA 4O2LA 3FPSA 1F4PA 1B41A 2OZLA 1J0DA 4K86A 3WFJA 1FU4A 3REOA 1RBMA 1TJ3A 2B98A 3VZBA 3CKMA 2NUPB 3HE3A 2NYUA 4ZCIA 1YUBA 1ONNA 2Z3ZA 3V8BA 2YS7A 1A4UA 3M6ZA 1CFZA 1QE0A 1QR6A 4PIMA 1LBIA 5G5GA 5B66U 1J24A 1MUUA 2EZYA 3SQMA 4Y2QA 3DE4X 3LC1O 3QYFA 2ZJ0A 1JRPA 3KXPA 5D87A 3P9CA 4L27A 4OGLA 1AN9A 2D06A 3HABA 3H3XA 4X6UA 1KI7A 3ZVMA 2WHPA 4ARUA 2DCMA 2XOEA 1SOWA 3I53A 3PEVA 1RWPA 3BWYA 2P79A 3JALA 3T9EA 1TAGA 4G0PA 5E7MA 2M98A 2P9ZA 3OZDA 3KTOA 2VN8A 4A8HA 4IICA 2HLDA 1M10A 2OAQ1 3TACB 1YDMA 4CIWA 1WCLA 2L5YA 4IRKA 3ECSA 2PRIA 4QUAA 7MHTA 4GVXA 2MSWA 4RUKA 1N6KA 4D98A 4PLFA 3A3YA 3A3NA 4M21A 4QE3A 5DQHA 5IC4A 1CUAA 4YS6A 1RPLA 3I64A 4NCIA 4MCJA 4WLVA 3W5SA 3KLPX 3P1JA 3ABIA 1TM7E 1BXGA 1T5BA 4O5KA 4NYIQ 5FUMA 4MB6A 4R1PA 3WRYA 7ICPA 2BSAA 2C1ZA 1HUOA 3D3JA 1PWHA 1P0MA 9ICXA 4UB5A 3HJEA 2DFDA 5D49A 4KDCA 2YB1A 2XGSA 1KI1A 1P4HA 5JSHA 3HDVA 1U2DC 3WC4A 3K6JA 2KJ5A 1SBZA 2R6FA 1KEJA 2GAJA 3SEFA 1XYVA 4RQUA 5L7YA 3W2IA 3LBYA 4MO2A 1UPBA 3KELA 3GCXA 2R25B 2G71A 3CH6A 3SQXA 4HFNA 4DOBA 4E1BA 2VJPA 3F9CA 4PXSA 1E62A 4WT7A 2PQ6A 4ERNA 2B2NA 4B6JA 3SD7A 3ACCA 4DE5A 2FETA 4NAUA 2RIRA 1OUMA 1XC7A 1X1DA 2LMRA 2C54A 1COZA 5BSHA 4JWTA 4A23A 4DEYA 5IXYA 5K09A 4QZEA 2JXJA 2J0UB 4YJHA 1V25A 3NV9A 2GZRA 4MI9A 3V55A 3AF5A 5IZCA 3OHBA 4NQZA 5LQMA 2R8GA 2IYSA 1I1QB 1ZQIA 2B8NA 2O3RA 2HRRA 1GUDA 4PIVA 1JIQA 3WYAA 3T1HB 3HM2A 1HKHA 3ROKA 2X0FA 1SU6A 1L5HB 1N6HA 1PFUA 1OW3B 1IAVA 3DOFA 6REQA 2V8OA 1X77A 3SZGA 1GUYA 2QRNA 1FP4A 5EWLB 2XDQB 2JRCA 4E2ZA 1B6GA 1NPYA 3MLEA 2ONJA 5JZVA 2K89A 2C4MA 3CPSA 1BDBA 1ZM7A 4MQFA 2WTUA 3PRHA 4LYAA 1IHYA 4PYIA 1DKOA 3A6DA 4J3NA 2KQUA 1TIBA 4EHIA 5KJCA 4NNPA 1S2IA 5HCUA 1ESZA 1NW3A 1HFWA 4QQ8A 5KQLA 3HT3A 2I67A 4R1SA 3VU0A 1XWLA 1HYQA 2WSSA 1APBA 5FH9A 3RBZA 4DS4A 3RBVA 2VCHA 4B3IA 3SS7X 3CNBA 2XO7A 5CNMA 2PO5A 2BLNA 2Q0SA 2VH1A 3FWNA 4JU9A 1QANA 2GI4A 4C0SA 1GZ5A 5ALNA 4F4YA 2C22A 2W6IA 5FNVB 4PGQA 4AKSA 4MS3B 5CWRA 3T95A 4M9JA 4O0IA 2CLSA 1Z6GA 1V1RB 3NTRA 2QLLA 4R6WA 3LX4A 4ABTA 3HY6A 2MR6A 3CW9A 1G8MA 3ML1A 1ZGGA 3UHOA 3DBIA 2LYAA 2DHDA 1YR8A 3NATA 1ECFA 2OBBA 4PPQA 4N65A 1DDIA 1HDIA 2O7NA 4IIUA 4LY9A 2YHUA 4V0NA 1CRWG 5TDHA 5H0IA 1Z7EA 3T7SA 4FZMA 3FYCA 2ZROA 2R8XA 4Z0HO 3G1WA 2FMHA 2FMFA 3GGSA 3UJAA 1XWFA 3OZWA 1XLTC 2R7AA 4PHTA 4KWHA 5AHKA 5HZHA 4EVIA 4FMPA 5ALJA 1ICIA 3PE4A 3KEGA 5EMNA 2AVDA 2LGJA 2Q2OA 5K6TA 1U4NA 3DMTC 5C35A 3DP9A 4Q4JA 3KUCA 2XQIA 2FW0A 2HCRA 1ZR2A 1X1EA 1EE9A 2JV3A 5DU2A 4RETA 7ICLA 2CZGA 5M29A 1UM8A 2LM4A 4RVFA 4FDTA 3OAAD 4LGYA 1X9HA 4GQIA 4NCAA 2XNDA 3AZPA 4F12A 4FUTA 2IHJA 2YXBA 8GPBA 1O95C 2OP0A 1RM4A 4NYJR 4R54A 2AF4C 1KDPA 1WP9A 1XQ1A 3CQ9A 5DHPA 2OHFA 2NYRA 1XMIA 2JGMA 4PPNA 3OH8A 4Y0NA 5TQ0B 2LHTA 1JALA 3MNFA 3OQOA 2W04A 1RKBA 3UUFA 4EGCB 4BQNA 4BNNA 2NP6A 2WMYA 2AEJA 2Q4RA 3CLTD 3EK2A 4TYMA 2GFQA 2C2EA 3JQEA 4QGBA 3C1YA 4ARIA 4DMRA 3PX3A 4GOND 1R5JA 1VG0B 2PYIA 1OT3A 3HCOA 3SX4A 2WHXA 4LY3A 3MD0A 4U7HA 2VC2B 5FL7A 3WNZA 5F98A 1NUAA 4Z4GA 1I4DD 4FS8A 3WAJA 3KAKA 2ZAOA 2ZYGA 1C7YA 2WW8A 4OJQA 1SUIA 3D4PA 1VJCA 3TTWA 5IABA 4MUFA 4QFDA 3QWAA 4J9LA 1HV8A 5G0VA 3RW9A 4R8SA 4CI9A 3PXCX 4UBJA 3UANA 1Z47A 4GPIB 3BXXA 3NT5A 2QTZA 4BC0A 4QZ8A 2J9ZB 3RJIA 4Q8FA 1F20A 3ZHRA 4OHVA 1G5IA 3FGZA 4PIPA 3O1JC 2ALJA 3SNHA 1KAEA 4AURA 4CMAA 3EGOA 3CUSA 4YT5A 1MQSA 3DAYA 2PL1A 1ZJMA 2BCQA 1SA0A 2QN1A 1TEVA 5AVYA 5AW1A 3O84A 1AH2A 1Z17A 4IX9A 4G81A 1UFKA 3IAS6 3ICPA 1EH5A 1Z2PX 2ZUWA 3IVMA 1OOEA 1NK4A 1TRHA 4PQFA 1SBYA 1YJ8A 1EX7A 5J2CA 3EC2A 4QRDA 4DA0A 4A8JC 5TLSA 1GTRA 3SJUA 3W5JA 2ZSAA 1NQTA 4GZ6A 1QPBA 3WP1B 4XDGA 3K2QA 5JIBA 2W6QA 3OUUA 1QO0D 3KQOA 5AVZA 1WNTA 2IUTA 2WAYA 4EBEA 3MINA 1G3IA 2K7ZA 3N39C 3BCHA 4DOCA 5LMCA 5ADWA 4B3HA 1ABEA 1EK6A 1L7BA 4DIFA 1YTLA 2B4RO 1VQ1A 2KOBA 4PHEA 1SZDA 4N7RA 3TR6A 4YQZA 4DIUA 1TK2A 1M1YE 2HRZA 2GXAA 3K6SB 4BNDA 2PWPA 4DCNA 2FUEA 5BSFA 5CCXA 4KVGA 4CKEA 1GU1A 4M0DA 2ABWA 2YWBA 4Q48A 3I39X 4GPD1 2FPPA 1DRJA 3FAHA 3NAZA 1NF9A 2FG6C 2G4CA 5GIOE 3KKEA 1GCGA 1A50B 3TOSA 4ZDJA 1Q0ZA 2V3VA 2HDWA 4MVJI 4F45A 2LKCA 2B1RA 5CR9A 2XVAA 4L7QA 4L2IA 2ZPAA 1G8HA 5HM6A 5FL3A 5ELLA 2EG9A 3S2SA 3STHA 2EQYA 4WVLA 4YBZA 1EGVB 4BQEA 2YN4A 2NU7A 1Y8QA 4E3WA 1XV5A 1OUQA 3ZU2A 3L4BA 2WWGA 1Y9AA 4RCYA 4O08A 4WN3A 4UCXA 4X45A 4NVRA 5ITZB 1A1VA 4GLLA 3H42B 3RJHA 1MRZA 1NUQA 4B4UA 4L76A 3SAFA 2A7XA 1SXQA 3KETA 3D0OA 1E2FA 1ZOOA 1D7AA 4C9BA 4NBLA 4PG4A 1UEIA 1BVUA 1XTZA 1TV9A 3E2EA 3C29A 1LDMA 1ISMA 2CDBA 2O2HA 1K75A 3DULA 2V7UA 4PLCA 1MEJA 2IS2A 3HFJA 3RROA 1W34A 1LBQA 2YIMA 1JAYA 1LJLA 2JJ1A 2FLPA 1MTOA 3EFHA 3SF8A 1TD1A 2VWGA 1E61A 3Q2OA 3LCVB 3KQUA 1NN5A 1K8QA 5A4FS 1Q0QA 5J0RA 2IYUA 4GMDA 1DRUA 1GPMA 3S44A 4KBGA 4M49A 1TF7A 4QWBA 1ZLYA 1IY1A 1QIFA 4MGHA 4CIAA 3S99A 3T35A 3FPCA 1ZGJA 3GILA 4GD3Q 3U49A 2ZYWX 3HKCB 1M8PA 4QQKA 3EULA 1H3NA 4MGEA 3EZ7A 1AY0A 3BMXA 3NC4A 3GK3A 4L5CA 2QTNA 5JSZB 4D8XA 3FDFA 1FS6A 4GZLA 4IPTA 4Y18A 5I47A 4X95A 1RWQA 2D1TA 1PYGA 4A82A 1M0EA 4KLTA 4XYLA 1NR7A 3VNBA 2VDQB 4MWBA 4ZCPA 4Z86A 4J16A 1GVNB 3CLRD 1UAYA 2DR2A 4EUEA 3H1TA 1ZISA 3PR3A 1GNTA 5G0WA 1JDVA 3KQVA 4ZAVA 2H2WA 2QY9A 4AKHA 1NYRA 4KPEC 3ZX4A 2HO4A 3PFKA 3RYHB 3BULA 1ZXLA 4EBBA 2YMLA 4LDJA 4EB3A 2I3BA 2C2WA 5T41A 3GYGA 1CT9A 3LK9A 2NRZA 4HQLA 3F73A 5KOIA 2ORVA 1UMCB 2QX6A 1XEAA 2QDKA 3SDSA 1T2NA 1E9FA 1ECGA 3GLHA 1JPUA 2K2QB 2ZTVA 4Y2HA 1UPAA 3AUOA 4ICIA 1GL9B 2HMXA 4R8UA 4L5JA 2B6NA 3GPDG 4ECTA 3BGDA 3HEMA 4DGSA 1P77A 2A1TR 1Y7IA 2GPJA 4AZVA 3DOJA 3OLCX 2FGJA 4UM9D 1DSSG 3O9MA 1JAHA 1KFEB 2Z2XA 3VC2A 3T4XA 3N2KA 2XYHA 4K2AA 3UXOA 5DG9A 4C2TA 3GQCA 2CNNA 3CIFA 4HL6A 1AXRA 1BAPA 2H08A 4UMDA 3T52A 5BWBA 3IXLA 1JHRA 2JAHA 2O2GA 3SSMA 3D4IA 5JEEA 3OECA 4Y1EA 3TL6A 1D6JA 3V8PA 1UUFA 4BJHB 5DRTA 1YQDA 2IODA 4FNOA 4A1OA 1DBRA 5KTNA 3T3NA 2AMVA 4LYDA 2GA9A 5K7SA 4X65B 3CUTA 1SXDA 3A6FA 1YU6A 1KH1A 2GZMA 4RH1A 2ORED 4DBLE 4F91B 4MKRA 1J2EA 3N28A 4G0XA 1RI5A 1JEQB 2NU6A 3FNIA 3AL0C 2LIPA 4QAQA 4BLUA 2CBXA 1C3VA 3AILA 3TRDA 2OD7A 4F8EA 2CVPA 2ETVA 5FNZA 1BPBA 3H9EO 3W04A 1X86B 5HZMA 1SC1A 4PFQA 4HDMB 4DCJA 5HHTA 2WT8A 1B7GO 2B5OA 5CTAA 3JRNA 1FPMA 1XTRA 4Q12A 1GDTA 1ZSVA 3WHPA 4JUAA 2HX1A 4ENTA 2JVIA 4B4OA 4HWRA 2RB4A 1KL7A 3UMGA 2VOEA 4NLKA 5KNCA 3SHOA 2BFPA 4YMUA 2NV3A 5KFUA 6GPBA 5AOCA 5E8JA 3UMYA 1KRXA 3G0IA 4RTOA 4LFBB 5JD4A 4B3TB 5D3ZA 1DQZA 3N2NA 2E6KA 1KKXA 1LW7A 5KNDD 2XGJA 9ICNA 4RQ3A 4LSZA 1V8PA 3KSUA 3RD5A 2AXNA 4OO1J 1V3QE 4B44A 2ZUFA 4MR8A 2H4HA 5JCJA 1ECPA 1YHNA 4OJ6A 1Y9EA 3N7PD 1KRHA 3QVVA 5DBOA 2X9LA 1X6JA 4C08A 2X2FA 3IHQB 3F3SA 1LX6A 4ZD6A 4OAQA 3MJCA 1KO7A 1KZ1A 2JPDA 4ZRDA 3O9ZA 3ZXYA 1BEZA 1EFAA 3TCKA 1VG8A 2VPIA 3HVKA 3H8MA 3E3MA 3D5QA 3GLQA 2XLBA 4QXMA 1OAOA 3DVSX 3EA4A 4V38A 1URPA 4QX6A 5GJBA 3ZBTA 3CF4G 1TFRA 1VOTA 4X7PA 1N77A 2Q3LA 3DM5A 5AM0A 3JQ6A 3ELYA 4PZ0A 3X3HA 1I24A 1XX6A 3GARA 3QVGB 1XRPA 1SUSA 5JYBA 2ESRA 2VHZA 2A0WA 3TNDA 1F2DA 2F1RA 2HXSA 2B37A 5IJXA 3DE0X 4Z1MD 3HBNA 3EIEA 2BGRA 1MN6A 4KRYA 3U3ZA 2Y99A 1YZQA 5LLSA 2P3LA 4GMHA 3CP8A 2BDPA 3GZFA 1C29B 1ZCFA 2HGZA 4CV1A 3RABA 5AKLA 2K4PA 4QUGA 4Q5IA 3V7UA 3FOEC 1SXEA 3GQVA 3DBHA 3A7DA 4I5GA 4M3NA 2P0AA 3OCVA 5IJ9B 5JXJA 4JY7A 5HHIA 3TQOA 4M9NA 4FFBA 3S3TA 1F0PA 4RPXA 2XEDA 5JISA 1QDUA 2NUTA 4QDJA 4ZI7A 1PK1B 1B74A 4AS3A 4REQA 4AQ7A 1LTQA 4H7HA 3M8RA 3CLKA 3NB0A 3OZGA 1F7VA 4LG1A 4EK9A 4MITA 4URVR 2FNAA 4F3OA 4DQVA 3QMVA 3W4KA 4A5OA 1F2UA 4O4IB 2K60A 2WMOB 4F2HA 1ZRSA 3MJHA 4L9RA 1A6SA 3ANLA 4TTQA 4PGFA 1FDIA 1LW6E 3PRYA 1W59A 2WY2D 2AFVA 1E8DA 2P2YA 2P6UA 5KU7A 2IOFK 5IT9A 2XTNA 5FBLB 4JL5A 1T8UA 3G1UA 1HUZA 3I04M 3K30A 5ALWA 3BB4A 3IUQA 4DLUA 4ID9A 1UWVA 4M8LA 4Q93A 1TKRA 1EAMA 4FFSA 1GQOA 3RAQA 4BO8A 1WEHA 1IBMB 1ESMA 3BXZA 4ZT7A 4FOTA 3QHPA 1YCHA 3HYRA 3WMFA 3MB5A 4Q66C 4C07A 5AKYA 3IJ5A 4UEQA 4N1AA 2FEXA 5DLFA 2BHNA 1E5LA 1E59A 2A9OA 1W5SA 3STYA 1QIHA 3IALA 4MEAA 3K2IA 1OWMA 3LPAA 4USAA 4XYBA 1N2GA 5FPKA 3KP1A 2FZ4A 1KEUA 1HTTA 4KQ6A 2YW9A 2C8VA 1ZM9A 4IIXA 3HUFA 3VKGA 1QWOA 3W9YA 2QT9A 1DARA 3D6JA 3AIKA 5H80A 4BAZA 1RI3A 5C7OO 4LTDA 5A6SA 1UC8A 1YS1X 4M4SA 3SJZA 2DUYA 1R5NA 3T06B 5DNCA 3AEYA 1XNGA 4A27A 5TVGA 4B46A 3L6BA 3EVBA 4RHYA 3WYNA 2VP9A 3U5TA 3GBSA 2VTEA 3TXAA 1DOQA 1PT5A 1YIDA 3LTNC 1AHIA 1B1AA 1MABB 3VDRA 3OOSA 1BDJA 1QG4A 3PVXA 3MT7A 2VJMA 1HH4A 1E1QD 3V5NA 3LCCA 1ULBA 3F2DA 2X4LA 1QHHA 2FRXA 3ES9A 2O6LA 2E1FA 4D45A 1V7QA 1PG5A 1Z4MA 3VU8A 3RB0A 1MO3A 5IZ4A 2H5IA 4BQSA 2L0XA 3D7NA 3CZAA 3R5FA 1KAHA 5AW9A 1T8YA 4D9NA 4BQPA 5KYNA 3CNNA 4KQWA 2VWPA 4P8RA 3TZBA 2J1LA 1DLIA 3COJA 3IEPA 2O1XA 4D9CA 1QHFA 4DL7A 3PD7A 2NZUG 3ELBA 2JKYA 3EQZA 3N2IA 2PXAA 5EUMA 5GVRA 2E2WA 2Q7OE 4WBSA 3UCEA 4MF8A 2HRCA 4GGMX 1Z0KA 4OHBA 3UBTA 1Q91A 1LDEA 5BW6B 1H4VB 4G67A 1DK3A 1YZ6A 3OWHA 4LVOA 3QUCA 5EIEA 5ERXA 3PCTA 1JFVA 4PPXA 1GRVA 2Q9CA 4WINA 1JDNA 3FHOA 1H8HD 1E58A 5K8VA 1P6UA 3W5CA 3DZDA 2BEUA 3NHFA 4GFDA 3F78A 3GROA 2C29D 5F64A 3U7FB 9GPBA 3CU5A 4FI3F 1NMXA 4PSUA 3RAFC 3SZ2A 1XCGB 1NYLA 5LQNA 4J7AA 4OBXA 4KMOA 2JFYA 5IKOA 5CB4F 1SXIA 4ALLA 4A6DA 4V0LA 1N7HA 3PF9A 2ZIFA 3F98A 2OWEA 5GONA 4HVCA 5LIPA 4E31A 1KW4A 4I3HA 4OI1A 5KYXA 4J1TA 4PN3A 5BQFA 4U7DA 4NJEA 1DC4A 4JBNA 3J81j 3OSPA 1F17A 1BCSB 4HQ6A 1H9CA 3N70A 1ULAA 1UKAA 1P17A 2P5UA 2EDCA 1SOAA 3IHKA 3NVMB 3Q3HA 3N8IA 4LOHA 1X2BA 3UENA 3KZCA 1ZZEA 4JITA 3C3WA 3IPCA 4Q4HB 2D5AA 1G6OA 1HEKA 3GLHE 3N5KA 1EVZA 3ECAA 3X2FA 3H1GA 5B4VA 5JCOC 5JRJA 2ZZNA 2FJ6A 1TM2A 4D81A 3TN7A 2DERA 2IHNA 4X6YA 4K9KA 1GLNA 5IYZB 2BJHA 4WI1A 9ICWA 1LV8A 2ADMA 2UUCB 3HJAA 4PS1A 1IQUA 4P2HA 1OF1A 1U2GC 1UKZA 1TD9A 1KHHA 2AYZA 2CFOA 4H3SA 3MJEA 4Y3UA 4YAGA 3OKAA 2B69A 3L1KA 2WVHA 4YONB 1X9MA 3OSNA 3HYNA 3U3JA 3FHTA 2P1DA 3BGVA 5A0LA 2V6IA 1H1DA 4LK3A 3OIFA 1BXRA 3VNRA 3CNEA 2IHVA 3NP7A 4H18A 1D8LA 1O6BA 2FZWA 5B57C 2HJ9A 3U4DA 4E5MA 2JJYA 1NI4B 5KMGB 4R8KA 2HCTA 4O8CA 1JYSA 4F3NA 2SICE 3GLFB 1XMOB 1PFGA 2QRUA 3BE5A 2EANA 3WU2U 4ISBA 3DV0B 3LFUA 3NVVA 4MDHA 3RVNA 4BVLA 4DY6A 3TTVA 5GV7A 2ZPTX 4B1FA 2JHGA 3ZCPA 2HU7A 3G9XA 2NUAA 2GRUA 4U7WA 3ESAA 3AFGA 4YT4A 2ODQA 3HDYA 3L7KA 5FAXA 2IH5A 1L8LA 2ZJAA 1UADA 5C80A 4E08A 1OFIA 1EXVA 5EXSA 4ARZA 2YVAA 2OHIA 4AP6A 4LZJA 1UFQA 2E4AA 5IC5A 4ZI7F 3OVMA 2ZAYA 3UMJA 4RTPA 1S8FA 2M1XA 5JI3E 4Q1EA 1CUHA 9ICTA 1IJBA 3DL2A 4JXKA 4M0AA 4JS0A 5I8WA 2DR0A 3A1NA 3O95A 2C84A 2ZRMA 3OC0A 1BJTA 2PWAA 4V1CB 2C9OA 4YCNA 1FNBA 1TM3E 2XF2A 5DBGA 5A4IS 2NPIA 5FOUA 2PNJA 3EG5A 3HL4A 5LP6F 3X43A 4GKVA 4HNHA 2BFOA 2R1UA 3L40A 4F9GA 4MTCA 4P83A 4PQYA 5IUJC 1Z8NA 4FZLA 2J7PD 3JD4A 4TKMA 4WH0A 3N8HA 4YALA 5K8LA 5TJ9A 1ZXIA 4UQOA 5KT7A 2VT6A 2VT7A 3DLAA 5IBRA 4AROA 4NFYA 2WFLB 3L02A 4FBLA 5ALOA 5LU9A 3OE7A 1ISFA 4FYWA 1XEWX 4M76B 2PR2A 3OT4A 3KT8A 3A1EA 3GIIA 3ZZ1A 3SZ3A 4DLBA 4KLSA 4DABA 3KVOA 1R6DA 4PX2A 3EQ9A 4F72A 2E1RA 3DKPA 5CT6A 1KZ6A 1GZSA 3LO8A 3ULKA 3KAQA 1ZQTA 2XXAA 1VCIA 1LGYA 1J22A 4JWNA 2A1UB 2DU8A 1KYZA 5EIOA 1K8ZB 2XJ9A 2L2QA 4W5NA 1ZCJA 3TZKA 4ESVA 3KX2A 4BQQA 1UWLA 2I8CA 3QHQA 3NHKA 4IWYA 3ZEAA 4R84A 1OXSC 3DYBA 1G20B 5FO1A 4YXMA 4ERXA 2MHCA 3VOTA 4IW3B 2KKPA 3QA3E 3M6VA 3PUXA 1AKUA 1QGOA 3U7GA 3Q7TA 2PSFA 5DSZA 1T8EA 1GRQA 1S77D 3RUFA 2D0OB 1EEHA 3OPYI 4EKDA 3WGNA 4ZDIA 3WWYA 4JJ7A 3HNRA 3NBAA 1STOA 2PNFA 4TROA 1XNRB 1E0DA 4MQ6A 2RC5A 4XRRA 3EWSA 1SOMA 2PLRA 1QNLA 4XGKA 2IYQA 3OUZA 1E1DA 3V3TA 3W6ZA 3HKDA 1EGQA 4RZ2A 3LE8A 3TGPA 1CQXA 4NV1A 4MVCA 3B5EA 1IEQA 1FFWA 5ENZA 1BXKA 3KYIB 3OF5A 2XCOA 1TU3A 1UA0A 1XAHA 5CITA 4EGQA 2OGUA 1IJEA 3P5BA 2DJIA 3THWB 4F4JA 2O1EA 4QQRA 1VKRA 3QJYA 2RK3A 1ZRMA 4UBOA 5ANRB 2QN3A 5K6AA 4JEHA 5CFMA 4OXYA 3M6XA 3RYFB 4TZKA 4JCOA 5DB6A 4EFKA 9ICPA 5LDDC 4HH4A 2IQ5A 4MUBA 1L4YA 1UP4A 4IGKA 3QU4A 4R2IA 3I01A 5B2FA 5GAJA 3ZHZA 4BX0A 3INNA 1KMMA 2PMEA 2BMWA 2CDCA 4EB6A 2BD0A 5ERYA 2OV8A 5B58T 3WNDA 2ZB7A 1P18A 5IH3A 4I2BA 1T0HB 4DG9A 3HJBA 4UBIA 4IR7A 2IRWA 2VHEA 3EUWA 1KEKA 1T6ZA 2DF8A 1A8SA 1IIBA 3Q8RB 4OSOA 3RYIB 1S0MA 4NXNB 5E0OA 3BF7A 5HZGA 2QR2A 5JY1A 2A9KA 4CDNA 3LHFA 2X8WA 4DOAA 5ADUS 4O0MA 5KVQA 1CV2A 2XSZA 3GFOA 3T4EA 4UBMA 2IZ6A 4G24A 3KQLA 5KX5B 1K98A 1M6EX 2D4HA 1SZPA 4BUCA 1EDEA 1QLWA 2HHTA 1AHNA 1HM5A 3KAJA 4ZCLA 1EA5A 2MA1A 3U0BA 2XY4A 1M5RA 3L0SA 2FEAA 3HUUA 3LT1A 2AK2A 4YJ2A 2BGTA 3ZK8A 4M9QA 5TE9A 1N2IA 2R8KA 2AYYA 1WCYA 3OBBA 2X1LA 4CQMB 4G85A 4EHLA 2WAAA 1SVUA 2W8LA 3I6QA 4YYEA 1MB4A 4Y6GB 3GX1A 1DQSA 1UM9B 1EDOA 4TWZA 1YVRA 1U0HC 2A2ZA 5JCXA 1NK8A 2EJUA 3OKFA 3ZWWA 4AP9A 4CL3A 3DWEX 1GSOA 2XB6A 1R4NB 5LYJB 2Y27A 2XWSA 4DUGA 3CINA 1YZNA 3H65A 4QZBA 1C2TA 4G63A 3I28A 1Z2DA 2P2ZA 4DF3A 4PSCA 1Q5PA 2XCQA 1A5AB 1KI6A 1CXZA 1NN0A 2J46A 4X8MA 4EFNA 1QGDA 4YRBA 4F8RA 4QELA 1YOVA 1LPPA 2CSXA 4NZPA 2P9FA 3G1TA 3BXPA 2QM3A 4P3NA 3N3AC 3GRKA 5FV4A 4V2IA 1GRCA 1ZK4A 1A4XA 3FVRA 2OYCA 3FUWA 4IGFA 5HDBB 2WOOA 1J2TA 1E6WA 5JS2A 3PYLA 1UDRA 4MUHA 1X7XB 4UM8B 4BB6A 4H2DA 2PUJA 1E3SA 2G3YA 1G8GA 4GMXA 1Z5VA 4TXHA 2AD1A 4RXMA 3N6VA 4DC1A 1KFJB 2OR3A 4MJLA 1VGVA 2F7SA 4EO4A 3CEPB 3OM8A 1KTVA 3D2QA 3UGJA 1YR6A 4V3BA 1UAGA 2XE4A 4PZCA 3OCZA 2C98A 3LJKA 1L1QA 2D13A 3STXA 3LQFA 5JLJA 1XZDA 1YMUA 3TUJC 3QU2A 1LSOA 4NENB 2DFPA 4BLTA 3QSYA 4BFCA 4AULA 1VLHA 3FSRA 1G59A 3OQJA 3KQYA 2W43A 2CL0X 2JD1A 2B1GA 2X5KO 2HSDA 3LYAA 5TS3A 2JZNA 3OIYA 4FDUA 5F3RA 3NIDB 4MVJP 3GV5B 3IMEA 4PTZA 3VYRB 1AN0A 3W1VA 3V1LA 1TVKB 5EJMA 1Y4ZA 3A9CA 3L1UA 4GI1A 2XHZA 3PC8C 4ZEXA 3SWWA 3JX9A 2Y6UA 3OFNA 2FXIA 1JF8A 2ZZKA 1NVVR 1CY6A 4JELA 1RIFA 1DE0A 5JDCA 1HE1C 1XZCA 1UJ4A 1HZZC 4J0QA 4CMEC 3DHWC 4MDYA 4UJ5A 1BE6A 2MYTA 1Z68A 4QFBA 5DX0A 2XMDA 1Y7PA 2CVHA 1OZFA 2ZI4A 4H77A 2R6JA 1DQPA 4LV8B 2EZ8A 1XAGA 3NZEA 3E1SA 1Q0TA 5TPWA 2VIXA 1XJ5A 4KO8A 3REQA 3QMWA 3NYWA 2VHWA 4MV6A 1AU9A 4E5SA 1RCUA 1RTKA 5EQJB 4H17A 4EWLA 3BRWA 1L5KA 1T7PA 1LTHR 1IEVA 2G07A 1GPAA 3BIFA 2AKEA 1GNSA 5DCLA 3F5MA 4P35A 1TT5A 2WWFA 2YIVX 3HVIA 3NO4A 4HUJA 3Q12A 2XB8A 3ORFA 4O4HA 1REQB 1U4BA 3HW8A 1NVDA 2NTEA 4OLBA 1PDVA 4E4RA 1IZ8A 4E5KA 4DCOA 3C1ZA 1JECA 3NM6B 1C7QA 4PAGA 1NT2A 3GEIA 1B0XA 1VP3A 5LNK6 3ELUA 1E5DA 4K6MA 3FCOA 2QM7A 5F73A 1IM2A 3BTOA 4FS2A 4JC5A 3PVZA 2I3GA 3W1WA 3ROXA 5D7NA 4GWKA 3O93A 2F1HA 2RSLA 5ECWA 4OATA 3JQAB 2ATCA 1Y9DA 3DR3A 3TEMA 4C6TA 2XZLA 1RRGA 2RI6A 1YKGA 1XUOA 2EZTA 4CHTA 5JQGB 3ZGNA 2YV4A 4B6OA 3IPRA 4PHDA 3WRWA 2VPYA 2R8EA 2P3OA 2CXQA 1MTZA 2AOWA 2CNKA 2DX7A 3DEIA 4CVNA 1R37A 4B3RB 3TARA 4AYTA 1ZR4A 3DDNA 4NOMA 4TQUS 2HWXA 4WBNB 3GEDA 1L5MA 2JJ2D 3MK31 1HLDA 2JCXA 1A7UA 4A0RA 3DZIA 1QIGA 4DCMA 4LC0A 3ESXA 2QAGC 3D8RA 4KTTE 2EBWA 3EVTA 5C8YB 5ALVA 3G2NA 4ZZIA 3G6VA 3A28A 4QWDA 3QLVA 3FNBA 2IA5A 3NRZA 1ZM2A 2G28A 4B2IA 2HQRA 4B6FA 1Y7HA 2DPIA 4D8UA 2PMBA 2Y6VA 1AA9A 3UWOA 3I9V6 5AJWA 1OSNA 1RYHA 2JGFA 1CJTC 2ANCA 1YGYA 3X1WA 1YL7A 1N4AA 4DSJA 3K3PA 4NCBA 4MIYA 2EKBA 1U6JA 1SKYB 3PYXA 1QKKA 2OBNA 2AR9A 2CW5A 3LVQE 3V97A 1PEYA 4O4LF 4S2EA 4MWSA 3NVAA 3JAWB 3RWBA 3WB2A 2XODA 1MGOA 4J0JA 3WSWA 3DE6X 1TZ2A 5EJ4A 4CR8A 1GA4A 4MIKA 4U2DA 4RQ8A 1G19A 1JR3D 1MCZA 3LWMA 1FO4A 3FMVA 2CCJA 4QUDA 1SEVA 3GJ7A 2WK1A 4O25A 1ORVA 2C94A 4XUCA 9ICCA 3IKJA 4EMSA 4RM2A 2RHWA 4DM7A 4F84A 3HY3A 2VP2A 4DV7B 1XXLA 5KTOA 1ZMXA 2OXRA 4Z99A 4YJ2F 4JCCA 1K7XB 1C8LA 1UOOA 1JPJA 1ISGA 5F9NA 4IX1A 1NP7A 4NKRA 4MI6A 3GHHA 3CJRA 2BQRA 1MJ5A 5J0SA 1JHUA 2XQJA 1GCUA 4O3SA 1QVZA 2J6HA 2ZP1A 2EIXA 3B1KA 4X5VA 1K5DA 5AVWA 2FSPA 5DI3B 5E4JA 3D81A 1I1NA 3BKWA 1L7DA 2G08A 1I0LA 4G09A 4HX2A 2QS9A 1HSOA 5A5EA 1SCIA 3Q1KA