3QUTA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, asp13asn mutant, an open cap conformation
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
225
structure length
225
Chain Sequence
HMRKKLKAVLFDMNGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHEGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
total genus 82
structure length 225
sequence length 225
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qutA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qutA01
4C4SA 3QU7A 3U26A 5A3SA 4PNHA 3WGVA 2OBBA 4NWIA 3ZVMA 2WHEA 2HF2A 4J03A 3L1VA 4Y2RA 5AK6A 2ZOSA 3CZ4A 5E0OA 2Q5EA 4EELA 5ALUA 5IT0A 4UM5A 1SU4A 4OHFA 2HX1A 4OD0A 5A3RA 5AKGA 3ZI4A 3IB6A 2C88A 2AGVA 4AP9A 3OCUA 4L57A 4EENA 1RKQA 3RF6A 1NF2A 3M1YA 2MSNA 2I55A 3RFUA 4JDPA 1WVIA 3VAYA 5JJBA 3WK8A 1Q92A 2ZBEA 1L8LA 1WZCA 3W5CA 2B8JA 1Z4IA 2B1RA 4Y3UA 3IRUA 3ESQA 2JAUA 2OM6A 4HGOA 3KC2A 5FP0A 4AS2A 4YCNA 3ZX4A 1Z4OA 1Z4NA 4BNDB 2PKEA 3WK6A 3MC1A 3B8EA 3QU2A 4BKMA 4CNQA 2OYCA 5AM4A 1LVHA 1Z5GA 4O8CA 3OPXA 1ZD2P 2JARA 3DNPA 3UMCA 2JAOA 1K1EA 5AI0A 4EEKA 3L8EA 2CN1A 2G80A 2RAVA 1ZD3A 3J7TA 3QLEA 4HAIA 3ZUPA 1Q91A 5ALMA 1F5SA 3L7YA 5ALOA 4L6CA 4UMEA 1O03A 1NRWA 4FE3A 2GHTA 3QUBA 1KYTA 5ALZA 4Y2JA 3F9RA 1VJRA 3NUQA 4OFZA 4YCMA 5ALYA 4NV0A 1ZRNA 3E84A 5AESA 5AVQA 1RMTA 5ALQA 1X42A 4NABA 2P9JA 3SMVA 5AIAA 2C8KA 4UU1A 2B30A 1MH9A 4CF3A 2W11A 2B82A 1AQ6A 3SLRA 4HGQA 4KNWA 5AW7A 4BX2A 2X4DA 5ALLA 2R8ZA 2EAUA 2O9JA 1TA0A 4Y2UA 3OTQA 4J2TA 1RQNA 5ALGA 3ZWKA 1YV9A 2B1QA 4ZEVA 4DW8A 5T41A 5AVXA 1Z5UA 3OCXA 4AS3A 3I1YA 2G0AA 3QX7A 5AW1A 2CFTA 1L6RA 4MUMA 3L0CA 1U7PA 2HSZA 4UMDA 4XE5A 2AMYA 1U2TA 1LTQA 3QXGA 3DV9A 5AKHA 5AKLA 4KNVA 4I9FA 1ZS9A 4HGPA 1Z4PX 3U7FB 1ZD4A 3L8HA 3U7GA 2P69A 2HHLA 3N5KA 1YMQA 5ALNA 4BX3A 5AVUA 3BWVA 2YJ5A 1ZJJA 3OCZA 1N8NA 3HYCA 5AM2A 4UMVA 3I28A 3QUCA 3M9LA 1Z4KA 4ZEWA 2VKQA 3L0YA 1Z4LA 3R9KA 5IT4A 2HF7A 4Y2TA 1T5TA 3W5DA 1RQLA 4KYTA 2HDOA 3QYPA 2YMLA 2FUEA 5AKEA 1RLOA 5AW6A 3DAOA 4XPZA 4BBJA 5ALPA 4UU0A 3EPRA 5AVSA 3I6BA 4YCLA 1NNLA 1VJ5A 3L0BA 1O08A 3ESRA 1WR8A 2W4MA 3SD7A 2FPSA 5AW5A 5ALRA 4BX0A 1Y8AA 2BDEA 1T9ZA 2NYVA 2GO7A 2RB5A 3WKBA 4UARA 5AKXA 4KN8A 4UASA 2QLTA 2P27A 1J8DA 4GXTA 4CF5A 3E58A 3OCYA 4RETA 4I9GA 4JB3A 1L8OA 5A3QA 5AK5A 3S6JA 1TE2A 1RMYA 4CF4A 2AUTA 4QQFA 5AI9A 5AKYA 2G08A 3U7HB 3KD3A 2EATA 3HLTA 1SWWA 3GYGA 2B0CA 1PW5A 4BNDA 3AR2A 5AVRA 3NIWA 3FVVA 3ZU6A 2HEGA 2R8EA 1L7OA 3ONNA 4ZEXA 5ALFA 4IG4A 3KZXA 3ZX5A 4HGNA 1YNSA 1ZRMA 5ALIA 4YIHA 4Y2SA 3ZTWA 2IA5A 1QH9A 3QUTA 4DCCA 2IYEA 3NAMA 2EARA 3MN1A 3EWIA 2YBDA 3QUQA 3WKCA 4B6JA 3R09A 4L6AA 4RESA 3CNHA 2G06A 2QYHA 2WF8A 4YGYA 2YJ3A 2AH5A 4F71A 5ALEA 1ZD5A 1RLMA 3FZQA 3ED5A 3AR7A 3NRJA 3AR4A 2YMQA 4G9BA 3UMGA 1J97A 4Y2XA 5AIBA 3E81A 4XQ0A 4UAUA 2B8EA 2I33A 2YJ4A 3W5BA 4YH1A 2C9MA 4CE6A 1RC8A 1RKVA 3AR9A 3QU9A 2BDUA 1L7PA 2GMWA 3DDHA 5AW3A 1JUDA 3PGVA 2I7DA 2WF6A 1WPGA 2G1AA 4BYGA 2NO4A 5ALDA 5AK4A 4C4RA 2I54A 5AW9A 1RMQA 4KX3A 4UM7A 3TLMA 4OCZA 3SKXA 2YN4A 4QJBA 2ZBFA 2IOFA 1RKUA 3ZTYA 3BA6A 2MU1A 3OCVA 3FM9A 3P96A 3K1ZA 3L5KA 1S8OA 1YS9A 2DQSA 5AK3A 2C4NA 1U7OA 3A1CA 2RARA 2HOQA 1SWVA 2HO4A 5AI5A 5AVWA 5ALKA 5AICA 3NASA 5AKIA 5AM0A 2ODAA 2YY6A 2FEAA 3U7EB 5AW4A 3ZWDA 4NFLA 4HGRA 1IWOA 3N8GA 1L7NA 1Z4MA 2FPWA 2W43A 5AI8A 2YFYA 2BY4A 5AKJA 3N28A 2JGAA 2I6XA 4DFDA 5AM5A 1U2SA 3SHQA 2G07A 3WK7A 1XP5A 3IJ5A 3U13A 1YJ5A 4F72A 1FEZA 2FPXA 1EK1A 3WK5A 5AVVA 1TJ3A 3L1UA 1EK2A 5AKZA 4UAVA 5AW8A 1CQZA 5AKKA 3WKDA 4YIKA 1QQ5A 3A1DA 3ZW7A 3ET4A 2IOHA 3AR5A 2PR7A 3I76A 3KBBA 2D2VA 2C8LA 3WK9A 4GIBA 4KX5A 1Z4QA 3UM9A 1Z88A 2HI0A 2ZXEA 2ZG6A 2WF7A 1VFPA 3KDPA 1S2OA 3AR3A 2PQ0A 2ZBDA 2HCFA 3R4CA 3NALA 1ZOLA 2WF9A 2WFAA 3PDWA 3QU5A 3B9RA 4EX6A 5AM1A 3E8MA 3NANA 2RBKA 2NO5A 4MWOA 3PCTA 3L8FA 2FUCA 2YJ6A 3FPSA 3FGOA 5ALVA 4UMFA 4FYPA 3WKAA 5AVZA 2R8YA 3SF0A 2IOFK 5AI4A 5AI6A 1T5SA 2G09A 5IS2A 2Q4TA 4H1WA 4BEVA 2P11A 2JAWA 1RPZA 1TJ5A 4EX7A 3U19A 3WK4A 2CFSA 1QYIA 2CFRA 4E88A 2R8XA 5AHXA 3AR6A 4NAVA 3EF1A 1TJ4A 4Y2VA 1Z4JA 4FFDA 2GFHA 3UMBA 3KOOA 2WF5A 4DWOA 3SKYA 2O2XA 2FDRA 4UATA 5AVYA 3B9BA 5ALWA 5AW2A 2YMPA 3A3YA 3ZVNA 5AW0A 1L7MA 2FPRA 4Y2YA 5ALSA 4C4TA 3WKEA 4G63A 5ALJA 5AM3A 1RRCA 5ALHA 4UW9A 3QGMA 1QQ6A 3EF0A 3N07A 1XPJA 3L8GA 1U02A 3AR8A 3ET5A 2OA0A 1RDFA 2WM8A 3PGLA 3D6JA 4Y2PA 1QQ7A 2MU2A 4IFTA 4HYTA 1N9KA 3FPBA 3ZVLA 3QU4A 1RLTA 4BEWA 2FI1A 1YDFA 4XOUA 1CR6A 3WGUA 2FPUA 3A1EA 2Q4RA 5ALXA 5AVTA 5ALTA 1XVIA 2I34A 3OCWA 3MPOA 3N1UA 4Y2QA 3W5AA 2YMMA 3QNMA 3MMZA 4EZEA 2GHQA 2ZBGA
chains in the Genus database with same CATH superfamily
2K2QB 2B6HA 1TTPB 5J2GA 1SUEA 2DF8A 3EMKA 3HBLA 4UHDA 3PFFA 4DL5A 4URHA 4TUQA 1CUEA 2Q3BA 3PWZA 2CUKA 4UB1A 1BXKA 2CUTA 4ONEA 4TXHA 2Y77A 1A71A 3ISJA 4MR9B 4D25A 2V97A 4F0JA 4ENRA 5DT9A 2QM3A 4U7WA 1FW8A 3HLKA 3PW0A 1W49A 3JZMA 4Y2RA 4O3SA 3RJFA 2NZYA 3CM0A 2V3WA 3PNVA 3QPAA 4JCCA 1XGKA 2Q5EA 1H66A 4ITVA 3X1WA 5EINA 7GPBA 3A7EA 5IT0A 3C6ZA 4C6RA 1G7SA 1ENOA 4ZYWA 3V6HA 5F3RA 3UK7A 4KVZA 3KTFA 4GSLA 3VSEA 2EP5A 1EUYA 1RACA 2AXTU 3U16A 4AP9A 1XL1A 3BL8A 2UV8A 4QBGB 1N6RA 2CJXA 5H4GA 1HUZA 3LDHA 3QWAA 4ED2A 1U28C 1HDYA 2G36A 3OA2A 4OAOA 1Z5VA 4D8TA 3ABSB 4ZGWA 2VCHA 1ONSA 2W00A 3K2BA 4P9NA 3CP8A 4QWBA 4I2HA 3U9TA 4I8DA 2B34A 2C00A 3A6GA 4NBRA 1JI3A 2WU4A 2A1JB 3HX0A 1C8LA 1YF3A 4NQRA 5BRJA 2CDRA 4FNGA 4IDNA 3SX0A 1ICIA 2OM6A 3KKAC 3D4BA 2B37A 3PSAA 1GZVA 4HNSA 3WWEA 2I9KA 5FHQA 2CCJA 1ES9A 1YR3A 2J33A 1XC7A 2R87A 3WIEA 4BJQA 4UPVA 4Q45A 1XNJA 5KYGA 2AG1A 3TRHA 5CRXA 3M3DA 2HDWA 4PSAA 3SZ3A 3HRKA 2GBLA 4DM7A 5IIKA 3HP4A 4L2IB 3OETA 4E15A 3U6BA 2GEJA 1G3MA 3KUCA 3W8DA 1ZM9A 8OHMA 3A2KA 4DMUB 1O5TA 1RABA 3LTNC 2FRXA 5BN4B 2EAMA 2ODWA 1QTQA 2UZ1A 4Q3BA 1JIKA 2EJBA 4B7CA 3RUDA 1TKAA 2J59A 4F2SA 3FKSA 1OC2A 3GRAA 4Z54A 4WL0A 3B7WA 2FZCA 1NBMD 1N61A 4OHBA 5ANRB 1TZCA 3Q4GA 3AEVA 3QEBZ 1X3SA 2YX1A 1GD1O 2QJWA 3AF4A 3V4PB 4UQLA 2FPIA 2UU9B 2AN3A 1KETA 3G9QA 3CEJA 3SR6A 1QIDA 1ZCJA 2I4MA 3ASYA 1EHCA 4GDMA 2WWRA 3EEOA 2FB9A 3C3WA 1E60A 3LRPA 3L7YA 4NS4A 5CNIA 4A92A 1RJFA 1BWQA 1PGQA 2R00A 3X2SA 3TL3A 1B74A 2ZJ5A 3TADC 4RIIA 4BDTA 1R4NA 2XQIA 3K5WA 4TS4A 2UZ0A 5EXTA 1N4DA 2E9SA 3Q9NA 3QOXA 4AS1A 1A50B 1DT5A 1KK2A 3MGVA 4CMIA 4EJMA 5C1IA 1ZRNA 3K71B 2G71A 4PANA 3NVYA 2QZJA 5JY1A 1NFFA 2PNFA 3FMPB 4KUEA 5IZCA 2JHGA 3E9YA 1RJDA 2PT6A 3SMVA 1JKXA 5T4EA 1AO0A 1TM1E 1B42A 2Z9CA 3GEEA 1U90A 1BDHA 1RRFA 1XNGA 4ITUA 4JUDX 1MJFA 2GEUA 3FSEA 4B3JA 3FYDA 1EHYA 4GPD1 2AYYA 4RC9A 4KYVA 4KNWA 2BW0A 3VMMA 3KSUA 5AQEA 3O21A 5HDQA 2VA3A 3IOBA 1B4FA 3LQ1A 3IUJA 1MABA 2X77A 3BWXA 3I0NA 4OOFA 5BORA 5IT5A 4CLRB 3GIJA 3VV3A 1V48A 3PUJA 1OZFA 4YRCA 1SVNA 2YOGA 1FFXA 1L5RA 4UE3S 3BJZA 3WL4A 3WHPA 2A1AA 2NZJA 3Q7EA 1IHYA 3D2LA 8ICQA 4KQHA 1LC3A 4GYYA 3Q41A 4ND3A 3BIWA 5AXCA 4EBBA 3H0CA 4Q3OA 4F6RB 4LNUA 5ADVA 1DBVO 1Z38A 2OYSA 5L3VA 1TT5B 4B6QA 3GQBA 3D2AA 3LRXA 3U7JA 3UTDA 1O7JA 2W2LD 3MFQA 9LDBA 3TM5A 4XE5A 2B8TA 3I8XA 1C4KA 1NJ5A 1DJQA 1RD4A 4FHDA 3DV9A 1FIQA 3ZCXA 2CLOB 4ZVLA 4BPRA 1GGEA 1YCGA 2XKKA 1ZITA 1KE1A 2Y1EA 5KFCA 2W3SA 5KG5A 1VKOA 4PGHA 4HUQA 3U7GA 3JQ6A 4IDEA 1WUDA 1NVDA 2XITA 1HE4A 2FP4A 4CFZA 1UMDA 4ITRC 5HUJA 1PTKA 2B4TO 1KQGA 1OH5A 3ZNQA 5HWSA 3CIOA 1I8TA 3AI7A 3GRZA 5BUQA 4LJ7A 7ICEA 1JIQA 2D06A 4PYMA 5AHWA 3OHBA 3FOFC 4MUGA 2CDAA 1CUKA 2BBTA 3H1PA 4X6YA 2L5YA 5C5JA 4JV1A 2X8JA 3AB7A 3QY9A 1S2LA 2OXFA 1RBQA 1IHPA 1Y8RA 4H7IA 4KYTA 1YGPA 3W06A 3OOSA 5TT1A 3QVGB 4MWEA 1VG1A 1II8B 1E1LA 2GHIA 2ATCA 1F14A 2OV1A 2YY7A 3DAGA 4IKEA 4RSGA 4HP8A 4UEQA 2YMLA 5EWLB 1PTJA 4I2IA 2ZJ1A 5LSAA 4GS5A 5DF1A 1W88B 3ICCA 1DFGA 4UTXA 3WXMA 3E1SA 4Y9RA 2PUGA 1SUPA 1VRWA 4CCSA 1JEOA 3TB6A 1SL0A 3LLCA 3AEYA 1NXQA 3TDMA 4J0CA 3VJLA 2TMKA 4YV7A 4MARA 1TYDE 3L82B 4RT3A 2W8KA 4JJZA 3ZQ6A 5JFOA 4DR4B 2H4JA 4EO7A 1E98A 2B9VA 4RK4A 1AD2A 5FORA 5CFQA 1KPIA 1W5SA 2J3IA 3SBEA 1H2EA 1QIJA 4DQKA 2OQIA 1DWPA 2G28A 4DIKA 5K99A 2GEFA 1M7HA 2ZTSA 1IIRA 1FVXA 1Y3CE 4KVAA 5AYVA 2I1QA 2OXRA 2BCRA 4J91A 3NWPA 3TINA 3T1TA 1GFZA 2NV0A 1QQAA 1K8QA 1HFWA 4D9GA 2NRVA 1NY5A 1RMYA 1XKQA 1H2RS 3PPWA 1IAVA 1O97D 4JB2A 1E2QA 5B3KA 3S2IA 1YJQA 1NT4A 1QS0A 4GXIA 2BR4A 5IF3A 2HJRA 4Y98A 4XYEA 4YHBA 1Y8RB 3PCRB 3N8HA 2ZXUA 5JTIA 3DTVB 2NQ8A 4UUNA 1QGZA 4PXSA 8ICMA 3CF0A 1QTIA 2Q50A 2XTMA 3DZBA 1E3EA 4DS5A 1IRXA 1UFKA 2C5AA 3QXCA 4XTCS 4BFUA 4GL2A 2IP2A 5CH3A 3P2KA 1C4WA 2XUOA 3EVNA 3FTNA 4I46A 4E51A 3KSMA 1F0NA 3GEMA 5H1YA 3WLJA 2H0AA 3HRIA 1G18A 3NBKA 2XI9A 5CD9A 1NG9A 4NXNB 1OE0A 3PWSA 1EXNA 2JIZD 2V6MA 4IRDA 4L8VA 3ZY5A 3TE7A 4DMFA 4EJSB 5JATA 3R3VA 3PXUA 4IW3B 4Y2SA 1OLUB 2WT4A 1WPQA 4YRRA 1PSDA 4U8GA 2IA5A 3BMNB 2VCEA 3CISA 1QXSA 1SA0B 5K0GA 2HMTA 3OBIA 3GPCA 4YP6A 5AXAA 2ISSD 3CU5A 3IAM6 4OMCA 3C5WP 1E8NA 2YHSA 4DG9A 1E1NA 2XCAA 5EN4A 3QA9A 2I80A 2EERA 4IM7A 1O94C 4QUDA 4CEHB 3ZZMA 2JGEA 2O1EA 1VJDA 2QYHA 3FUTA 1NYQA 2EP7A 3OPVA 4JBGA 5EG5A 2PH1A 4D8UA 2JFUA 4YR2A 4UBIA 4UFNA 4DYHA 5C7YA 4I9NA 2PSEA 3NNSA 4YECA 4B80A 5JBIA 1FJXA 1I0IA 1TLTA 3DG9A 4X41A 2XTZA 1QWSA 1Q5PA 2XMDA 2OHFA 2HQBA 2YVLA 1VBFA 5ICEA 4QZIA 1A4IA 1ZL0A 2FSSA 2W7PA 1YQWA 3CEPB 4E11A 4LJ9A 2GZSA 1WDWB 5ADWA 2IKQA 1YA6A 4FMCF 4JC8A 4N7RA 2QR5A 2IU0A 1OW3B 3FOZA 3UUFA 3RV3A 4GICA 5TLSA 2CV0A 4DDHA 2R66A 3T7AA 1JTFA 5F7OA 1GZ3A 4NOJA 1ZDMA 3L40A 2XGSA 3QMMA 4I81A 4BLVA 1PHRA 2CLFB 2DSNA 2VHYA 3DHNA 4FS2A 4UAYA 5HRCA 1EVQA 3IOCA 2SNIE 4ZT3A 4R1MA 3S70A 2QR2A 4WNAB 2JIOA 3TX2A 4FB5A 4G1VA 5JFTA 4WKBA 1XPOA 3A70A 3VKGA 5D46A 3KCNA 5KO2A 3ZW8A 1PFQA 4N8SA 3FCOA 3SZOA 4UM7A 2EKBA 1TI7A 3SQDA 1TUBA 1ZRHA 3L7NA 1M6EX 1FTQA 2EQYA 5BOLA 1ORDA 4JWKA 3FDIA 3HGTA 4USAA 1Y7HA 4AO7A 4YRSA 4Q00A 3C74A 3RPEA 1B16A 1UZLA 2ZIWB 4RANA 4X00A 5CVUA 3UK1A 4AECA 1EWTA 4GQAA 4QECA 3HE3A 4GXJA 1GN9A 2ZI6A 2ZR7A 2MCFA 1M6VA 5JV5A 4LYGA 2WDZA 2KVCA 4YR7A 3CLKA 4BRZA 4BLWA 2WVJA 3H5WA 1JHDA 2GYUA 1H65A 2XXJA 3CRVA 4WQMA 4ED0A 3W9YA 2KZMA 1KORA 1U9ZA 2Y1WA 6YASA 1SWVA 2C1ZA 5KFNA 2OHGA 3MNFA 2EEPA 1D2AA 2WWIA 3SS8A 2C1XA 2A9VA 4MRSA 2XC9A 1EUDA 1MJ5A 1NMQA 3QBTA 1X7XB 4E6EA 1K0UA 1VLMA 2D0DA 4KXYA 1YRWA 1GUDA 4ZTUB 3OLZA 5AM0A 2HXYA 3IP8A 3B8HA 4R84A 4S1WA 3VJKA 2YKGA 5FBQB 1OH6A 3UCXA 4RNNA 2QMQA 2IHVA 3GRPA 2JI9A 2C96A 2JGDB 3LKVA 2W43A 1JG1A 1LLUA 2IHZA 3TG2A 1C4OA 4RULA 3VDMA 4IPTA 3G1WA 5EZYB 1EXMA 3E2PA 1N56A 1YH3A 5JIBA 4YRZA 3X1MA 2AR9A 5TQ0A 2A86A 2WKPA 3BWCA 3OQJA 3OTOB 4RQ8A 1W1UA 2C2DA 1G21B 2NXCA 3QFTA 2DFDA 3LBNA 5DMXA 4IUYA 2AXPA 2J3HA 3EZFA 2GWSA 5AVVA 3H2ZA 1GTZA 1G21E 1EK2A 4OQLA 3S2YA 2DLDA 3D8UA 4N7MA 3L7DA 2VP3A 1RZUA 4DM3A 4R64A 1UXOA 2GKOA 2WUVA 4IQFA 4R5HA 1D7AA 5FYQA 3A1DA 3W4IA 1R88A 3B2QA 2OQ2A 1FMJA 4C2TA 1VMKA 1IHXA 2GN6A 2E4ZA 3RU7A 1GILA 4U7DA 2UUBB 3ELBA 5ICSA 2KE7A 3NFYA 4C7BA 3AG5A 3DO8A 1FNSA 1KZHA 4CLEA 4EPXA 1BQEA 5K0SA 5KUTA 1G5IA 1FYVA 3L7LA 3VUFA 1U2PA 3R8FA 5AJUA 4C4YA 5CG1A 2XF8A 2XQJA 2R8OA 3EGOA 2VTDA 2H59A 2ZJ6A 1BWSA 4IVRA 3TCNA 2PZMA 3MAJA 4KO1S 5LOVB 2ZXHA 1Q77A 4JBYA 4IQ0A 4KR7A 3RC8A 1E1QA 1EGVB 1HLDA 3L1JA 4XQEA 5GP1A 7ICFA 1DKNA 2EGGA 4NCIA 4Z3OA 1P2DA 4F45A 1Y1SA 3PIIA 2K4EA 1RXEA 2X0EA 1L1FA 5BOVA 3ED1A 5E9JA 2XVXA 3CTMA 4ARSA 3O8LA 2RHCA 2NM0A 4NENB 1M6NA 3FPSA 4JROA 5I7AA 2BTOA 3UJCA 3M5WA 4QBKA 4RA6A 1MC8A 4D9BA 5AJVB 4BNTA 1C3VA 1F20A 3IAS1 3ZV7A 2PXCA 4M8LA 5CCDA 3ROFA 4D3YA 3ZY6A 3N7RC 3NPAA 3DXFA 3I4CA 5IS2A 4LHSA 5EZYF 1CV2A 1L3UA 3AHHA 4L4UA 3UWOA 4BEVA 4BE9A 2OEHA 4MF2A 4C5CA 2MMGA 2FPIB 3LQYA 4R3NA 4HYKA 4M47A 3Q72A 2X15A 4HQ0A 1SIWA 4IFBA 4JBXA 4JVLA 5I7OA 1AMUA 3TWOA 1DAGA 3N0XA 2V4UA 1SKUA 2QTVA 4KVFA 1AHIA 1BMFD 5CB6A 1FOEB 1P3Y1 3GD5A 5JQWA 3H2GA 4UJ5A 3GUZA 3QKUA 3R5HA 1MR3F 2R6AA 2R8PA 2ZYDA 4PLGA 3SE0A 3NO4A 6PFKA 3HB4X 4JT4A 3NM4A 1I7PA 4KFSA 2YHAA 3GJ8A 4MIYA 1WSAA 3LUFA 4UATA 4C8OA 3KBOA 2NO1A 3ND6A 4DMMA 2EG9A 5IXYA 2YMPA 3TNYA 3EG9A 4CL0A 5EXDA 3LWNA 3TGLA 2JGNA 4RKWA 1QRRA 3EUEA 3ILVA 4ZQIA 5FNZA 1VMDA 5AVKA 4ARIA 1CDDA 3AETB 1KQNA 1GZDA 3FYTA 3ZGYA 4O1HA 1E79D 4X9XA 5EKUA 4NDZA 4D80A 5C18A 2A1JA 2WM8A 3FWKA 3D6TB 3OKCA 3C8UA 4X85A 4J9NA 3DZCA 5BNZA 5CLJA 2MU2A 4CIWA 1X92A 3IXMA 4TWAA 5DI3B 3EOZA 4BY9E 2JRZA 2QIOA 1FLVA 3VYUB 5CX1B 4NMLA 4RNMA 1NR7A 3UAGA 5EHNA 3P2JA 2FOLA 4E3ZA 5GIPE 1G98A 5KYYB 5LKRA 2R2GA 3HWSA 2JIZA 1O9HA 1QLWA 1WD7A 2ET6A 2YWRA 1ILEA 5AMXA 4XQ8A 1P1JA 1I7LA 5K0BA 2V9WA 2PYZA 5IC4A 1UKCA 2D1RA 2HLPA 2BMDA 1V7QA 2ECPA 4HGYA 3LUCA 4Z4CA 2AKYA 3DHWC 5TIIA 3A4YA 2YMMA 3HJNA 4KXQA 3UGKA 3ZVRA 4NJ8A 1E1CA 1UF9A 1JR3D 1VZ3A 4R8MA 4HAUA 4UBLA 4F91B 4OLJA 3VR2A 2HSJA 3UA3A 2OXCA 2VH2A 3RRZA 1ONOA 1YUMA 3DVSX 2E5LB 1BSVA 4BGIA 4ENUA 1DAFA 5BWMA 3KDAA 1MHPA 4KDRA 4O5EA 1PS9A 2QMHA 3H2JA 1WETA 1K6XA 4KH1A 1E1QD 1HZZC 4U0KA 1FQJA 2JC3A 4J03A 3AU2A 4B2LA 2H06A 1QZXA 4UUPA 7ICPA 4F4HA 1JZQA 1O3YA 4KPUA 2A3NA 4JMUA 2C5BA 3WWCA 1TX4B 1NFQA 3IG8A 1H3EA 1KY4A 3AXSA 6REQA 4RQ3A 3LUBA 3L3FX 2D5AA 3E53A 4GZ3A 1WXFA 3HU2A 4R54A 2H1OA 2PL3A 2PQ2A 4A0HA 3E1KA 1SPBS 2QPLA 2JCBA 4D4IA 5CDSA 4P93A 4P4SB 1CRZA 4IXMA 2JBAB 4HRYA 4YDHB 3MWLA 4KLQA 2ID7A 1Y8CA 2C3PA 3M1YA 3ESDA 4MTLA 3DMFA 2W6JA 4WTOA 5JJBA 3TLEA 3VAYA 5KX5B 5C1PA 3VX3A 3M8RA 1QMPA 3ZU3A 4QNLA 4FILA 3JYPA 1E20A 3ICEA 3VGJA 1VYTA 2QG4A 4J9UE 3EIWA 3MJVA 4IGKA 4OGFA 1KAMA 1Y7IA 4MINA 4R9UC 4EVSA 2C54A 1KRPA 3OQIA 1P72A 1VHDA 8ICTA 2WV7A 2BCGY 3SBXA 1TNDA 1OTYA 2OSVA 4LBYA 3AEUB 1ZGBA 3OY7A 4F1KA 5KNDD 2GBLC 4PNEA 5FR1A 1JEQA 1TZJA 4YK7A 5F5XA 5J5VA 1CY0A 5HCIA 1R3UA 3WXBA 4BNDB 2WK1A 5L8VA 1Z19A 3DXYA 5EJMA 2GNPA 4RQAA 5BRNA 3GLIA 1KBZA 1K4KA 1BHSA 1CYDA 2BFCB 2RGCA 3VR4H 1Y7PA 1K5PA 1X7ZA 1R9NA 3L7BA 5C7OO 1ZD2P 1H8ED 5FOSA 2QKQA 1AGPA 1HFKA 3DOCA 5DN6A 4ZTZB 4BLPA 1N32B 1PV1A 2XNDA 2VAPA 1O4VA 3HKZF 2CL6X 2OBLA 4JXJA 4MULA 4XYMA 3T4PA 1S76D 4B6FA 2J3JA 4WZBB 3LCCA 5IAJA 4OHVA 1V37A 2ZKLA 1PD0A 1FS5A 3H75A 2QGFA 4J9LA 1DX6A 1WCNA 3RRMA 5DU2A 2WWYA 2RONA 3PJGA 3BGIA 3BEOA 3MSXA 3QWFA 4R2WA 1DSSG 3L0SA 1NN3A 5EUBA 4PN7A 2JH8A 2HSEA 2Q0SA 4BYMA 3KUXA 3LNCA 1CJSA 1W48A 4FGLA 5JNVA 3HABA 1R9MA 3D7RA 1K3TA 2BFCA 3AV0B 1JB1A 1KYTA 3KXPA 9ICSA 3EPGA 2COKA 4XQCA 3VR4D 4OFZA 2WIFA 5IJWA 1DOHA 4EARA 1T3ZA 4IIJA 4IR9A 1Z6GA 3ZD9A 5KFWA 2JGRA 1RMTA 1NQWA 2FQXA 1KEPA 4LX0A 1MX5A 1RRVA 1GFSA 3FX2A 3P9SA 4FHFA 4WXEA 4DNPA 4YLGA 1DDOA 3EB9A 2R79A 3U7QA 2PJDA 3RWBA 3KTOA 3ANMA 3FETA 1PGPA 4XGKA 1GTSA 3VPHA 5ALLA 1P5ZB 1Y82A 2DP4E 4M76B 4NZMA 4Q9HA 3O8DA 3GEBA 8ICLA 3F6SA 4QQNA 2BHTA 1HNNA 2JH9A 4HXYA 4ZQCB 4YAUA 5JALA 2VSQA 5ES4B 1JP7A 1G9TA 1R5OA 5JNWA 2OCPA 4HNAB 2Y1KA 2PRZA 2BJVA 1YJ8A 1HFJA 3WB2A 4U7CA 4EAQA 5KNLA 5E3JA 4MNTA 2PSSA 3CW2C 4Z9FA 1QYVA 2DX7A 3TRFA 3V1TC 3EPHA 3S29A 2O3UA 2HYDA 2R60A 4ZO7A 4C0ZA 3GA0A 4A27A 2Y05A 2F17A 2RH4A 4QPNA 1OFTA 2I2FA 3F3SA 3ANXA 1P4SA 1YRLA 1CFZA 3TVTA 2BM1A 5EP2A 3AU6A 8ICNA 1PZXA 3AEKA 3MRVA 5J2AA 4LMAA 5TARA 5JAMA 2XDYA 3AKZA 2F3RA 1VLBA 3RNLA 2IYOA 1XAIA 2P6PA 5DGXA 4YUVA 3GLSA 5F3XB 1ZD4A 4YO7A 1Z5WA 1ZMRA 4RGVA 5KYWA 4N8DA 2VTBA 4BBAA 3N8DA 2G4CA 3D6FA 5CA1F 2SKDA 2JAPA 4O2BF 8ICOA 2YJ5A 3BWVA 3T5PA 1QANA 2DQKA 4JQOA 4WCFC 2HD4A 4XIGS 2WLTA 3WG9A 4Z4FA 1IBLB 1J33A 4XSHA 1PK3A 3A31A 3BIOA 1K63A 3WRWA 3ZH9B 1NYRA 5I9TA 1KI6A 2PMEA 5M2QA 2ZIUA 2VDQB 9ABPA 3VZDA 1J8QA 3KFXA 2B94A 3RJGA 2H11A 2XV1A 1FU4A 2FH5B 3NVMB 1C9DB 4NYJQ 4OAPA 3UJBA 5L1JA 1VIVA 2HU8A 2P8SA 2ZE8A 2DAPA 3GOQA 4HN4B 2RDIA 2FUEA 4O5AA 5DBOA 3JARA 4EB6A 1QB7A 2P6RA 1T1SA 2ZJ4A 4Y1FA 3DUFA 1DQZA 4O0LA 5CP8A 4TYWA 5HP4A 3TZQA 4PPXA 2XZDA 2H3EA 3CUEF 5IDYA 3DVAB 5HZGA 4AO8A 5K8CA 4D9NA 2GVZC 4TMZA 4WKCA 1BG6A 2QRZA 2G88A 5F76A 4IVQA 4FMDF 3I83A 3IAXA 3Q3EA 1FXWA 3V9PA 4B74A 1ZCAA 4EYEA 2RH5A 4PR0A 3RR7A 4EYIB 3DEEA 3KRTA 4ZXFA 1QGOA 3ENQA 2WYHA 2N9UA 4P7BA 5FBZA 4AG3A 1ECLA 4RD3A 1M0WA 1VKRA 2I3ZA 4TTQA 1M66A 3GFFA 4L16A 4ZYTA 1WDKA 4L9AA 5DB4A 1XXLA 2FF7A 3CJTA 3RBVA 1J2YA 2R96A 5KYTA 1PK8A 3CVWA 1CY1A 1PS0A 1ZCZA 3THYA 4GYWA 5DO9A 5C8YF 2Q1TA 5F9MA 3C4QA 4BJ5A 3HRDD 4WA8A 5LP6F 4MR8B 3IMFA 2R85A 3MS4A 1GSIA 3TLCA 3LV8A 2MOKA 4QJ4A 5ESWA 1KTQA 1Q1QA 1HM5A 2AI2A 1U0GA 3IQEA 4BZZA 4ED7A 5KQSA 4KE9A 5IWCA 5K3FA 3L8ZA 5EIHA 4BB0A 3C4JA 2WAXA 4ROTA 1KJ8A 4ND1A 4WKNA 3VISA 4CMJA 3TQ1A 2V9PA 3OZXA 2ZTDA 1NQTA 3G0DA 4WOBA 2XW6A 3JSXA 2HCRA 3JD0A 4F3OA 4TQUS 3QE9Y 5AT1A 1E9VA 3H5OA 2R8EA 3LCUA 2UVUA 3U3MA 4KSYA 2PXHA 4MKZA 1PEYA 3EXEB 4US0R 2FN4A 3KKQA 2HYIC 4EQZA 2A4MA 1IEWA 3FN4A 3SN6A 1YVUA 4ZGGA 2VP2A 3ZU2A 1FSFA 4AF6A 3QP9A 3OIFA 2IS4A 1IBKB 1PJZA 1VSQA 3D8TA 2A2ZA 2H7CA 1RXVA 3AONB 5ERGB 1LI7A 1X2EA 3A14A 4L8FA 3DDCA 4B79A 5ERYA 4OJNA 3QUTA 1Z5PA 4P31A 3ZE9A 3EWIA 4YXWD 4N47A 2QDXA 2RHBA 3DZJA 5DSZA 3FPFA 1XSNA 5KWIA 4PSCA 3DNMA 4PC2A 1UWKA 2ZZKA 5I3ZA 4R3WA 5K3CA 9ICBA 3DMTC 3FE2A 4LNAA 4PZAA 3RIXA 2C7RA 1U2GA 3ZS9A 1WABA 2ZB8A 3JQPA 3WRXC 1K9VF 1UBMS 4N49A 3SC2B 1ZD5A 1SBYA 4AIRA 1NW6A 1ZQ1C 1NN0A 4DL4A 2D4HA 2VDLB 4FFLA 1RVV1 1E6LA 1V7ZA 2EX0A 2GETA 3D7LA 3KVOA 4TUYA 1SCUB 5G0TA 5CDUA 1K8ZB 1JI7A 5JJ5A 5U9CA 2FZKA 4G9BA 1F2UA 1P2UA 4FZLA 1KK1A 1Y6QA 1GRNA 4PGQA 3GZNB 4FXOA 4XQ0A 5IJ0A 1EIWA 1N7IA 4GPZA 1IMOA 4X60A 2C9MA 3MIZA 5K3BA 1RBMA 3AR9A 3RTAA 4AUEA 5FBVB 1MTZA 5CDFA 4GRDA 3I6IA 1Q2UA 2HMAA 3EGDA 4NOMA 6ADHA 3UKOA 5KSYA 5FAKA 1B0PA 2AF3C 1R27A 2J5KA 2RC5A 3GAMA 4KFRA 2CHUA 3EZNA 3GJYA 4PZYA 4PHHA 3SEIA 3RUIA 2HPHA 1VXRA 1GLNA 2Z30A 5AW3A 2FZVA 1F0MA 2B5OA 4GVLA 4DR6B 2JFVA 3MMNA 4MP6A 3OX4A 5EQDA 2AFIE 2YZNA 4D74A 1PSZA 4Q7EA 1X7YA 4XZ3A 4EYOA 1WPGA 1Q8KA 4KWIA 5F7JA 1HMPA 1LNZA 2H9IA 2JMGA 5KNCD 4LI3X 5KREA 1YK0A 3O94A 1H0RA 5AUQA 2IZ6A 2OVFA 2VT2A 4G0NA 4ZC1A 4CMGA 4J0KA 4PTLA 4LXGA 1TK2A 1DNPA 1NSTA 3PQ3A 2KPOA 4W4TA 4X0EA 4RQ2A 1JSRA 1TC1A 1YWGO 3G23A 4P80A 5B2FA 3ZTYA 1WB5A 1DOZA 3D4OA 4TTRA 5CM2Z 3H04A 1MOZA 3DKKA 3LP6A 1O5IA 1EAYA 2XMBA 5LR6A 3VPGA 13PKA 1F60A 5HNKA 3ZWXA 4PHAA 1BKDR 1TIBA 1QRAA 1Z28A 1MA0A 3EAQA 4QYTA 5BV2P 1QC5B 4NBKA 2JJ2D 3TTTA 2RIRA 3CNLA 2JKYA 1UEXC 3EQ8A 1SXIA 2JJ1D 1IXRA 3KYIB 4W5WA 2FMFA 4Z3DA 1MRSA 1TYAE 3VC8A 2AHRA 3RJEA 1KMIY 4JX8A 3USES 5J9FA 5TE9A 2I29A 1Z6PA 1V1JA 3ZHQA 5I8PA 3EUWA 3ZWDA 1VE9A 5J4HA 2QR3A 5J0TA 4OSOA 3ZH2A 3HV0A 4REQB 4DQ0A 1NTOA 4ENTA 3TARA 4U9IS 4B3FX 1FSZA 1CFJA 2C1EA 3EYAA 4UVIA 2I6XA 3SDBA 2OCEA 3B7PA 4J4HA 4KK3A 2FF5A 4CV1A 4QWCA 4MQLA 2NQTA 1XP5A 4HWGA 2I3AA 1LX7A 4QJ3A 2B1GA 2F2AB 1TGVA 1ZQWA 3AI1A 2XB9A 2HHCA 3M8SA 4PFKA 3MW8A 4IY1A 3AFHA 4MWZA 3C2KA 2VCYA 4FBLA 3CRNA 1OBVA 1N0UA 5AW8A 3PEYA 3F5MA 1XDUA 4JJGA 1Y1RA 2NP6A 3KQOA 4M9RA 1PKXA 3V3KA 3DEZA 1C20A 1Q84A 4XJTA 2PWZA 2PKQO 3K4PA 3RAXA 3KKPA 1XZNA 1P7DA 2B78A 1EP2B 1Y4AE 3GARA 3NHWA 1TK5A 4C5BA 3PJDA 4YQFA 1WUKS 2C5EA 3DFZA 4I4IA 3K53A 3ZYZA 4C20A 3FUXA 5DHPA 1RCFA 2QARA 4FKMA 2WF7A 1CVIA 5TQ2B 4F84A 5IRCD 1L3SA 1K92A 1Z2EA 3DLIA 1Y98A 4J9OA 5KT6A 3A2MA 1XD8A 1T26A 2VP4A 2A92A 3C6BA 3CT6A 4A26A 3ON5A 2DPXA 1YS6A 1RWVA 1ZOLA 2WF9A 4FS8A 5K4GA 1E2PA 1T4DA 4ALLA 4UVGA 2PYDA 4DL2A 3N39C 2OXEA 3B9RA 1MAVA 1F2DA 3ETNA 4QD3A 3KXIA 3HUTA 4B33A 2HU2A 4OQQA 1YKGA 4UU7A 3ZWOA 5DN6D 1M7GA 2XSZD 5TC4A 3AJEA 3DEJA 1CF2O 2WPNA 5JMTA 3O26A 1PZHA 4F4JA 4LGMA 2ZT7A 4MV1A 1O97C 2B4YA 4KLEA 1K8RA 7ICJA 4YFYA 1AZSC 1L1EA 1UPFA 2PTHA 5LQUA 1B4DA 3M2PA 3WKAA 2DGDA 5JO9A 1FFYA 3HYTA 4DV7B 1NMXA 1O54A 4DQPA 1Y9DA 2VRWA 5FOXA 1C7ZA 4O2BA 3LECA 3PHCA 1OGIA 2BEWB 5TJHA 1PUIA 5LFAA 2XUFA 4ED6A 3G59A 4RLQA 3NTRA 4DRXB 4H7PA 3B5EA 5D85A 2BGLA 2JAWA 3UWMA 1N0WA 1PP4A 2GM3A 4AFNA 3OO0A 4IL6U 1XVTA 4D9FA 4DG5A 4EX7A 3L43A 3KWLA 3BIJA 3UANA 2RJ3A 2PUJA 5DBGA 1DIGA 2CFRA 3WB1A 4N76A 2WOOA 1S9HA 1XTTA 3RFFA 2GA8A 1D0IA 4DSNA 3HFJA 2P67A 1YZUA 3TLZA 3I2IA 1AQJA 5CD1A 1HDZA 2VQFB 5IDWA 3MJRA 4YMHA 1KAGA 2KSOA 1RI5A 3GBPA 1N1GA 3RHFA 1D2RA 9ICWA 3MTDA 2EHDA 4EKIA 4H0CA 3UXPA 3EE6A 1EG7A 2GEBA 5EYPB 1I5OA 3HNOA 2Y9PB 4JLKA 3MD0A 1GDDA 4OMUA 1TRKA 2Z6VA 2F3UA 2YZGA 3LT4A 2GTIA 3O74A 3VZBA 4X64B 3H86A 5HM6A 3ZI0A 4TX1A 1C7RA 1PQYA 3LGSA 1S2NA 1MO5A 1KZGB 5EE0A 2Z2YA 3QGMA 1KZ7B 4TUYB 4ZT4A 3VPCA 4E5MA 2KFZA 1EX7A 1HXHA 5E7MA 4OQMA 1U2QA 1DWUA 1CIVA 3WYBA 5REQB 2XMCA 4V39A 2QW1A 3GILA 3KB2A 3PGLA 2CXXA 1WCIA 2H1RA 3A10A 4K86A 3AHCA 4K6GA 3TQIA 4HYTA 4PL1A 1Z2OX 1BRMA 3IPAA 1FUEA 1VL6A 5TVKA 4DLNA 2ZUVA 3LX5A 2HU5A 3SC3A 4XCQA 3MGIA 4H7DA 4BEWA 2GESA 1C1XA 2E4XA 3ND5A 3GT4A 1BAPA 1Y9AA 4JYBA 3S2GA 1JA0A 2ZRQA 3T0IA 3WGUA 4DIEA 4N40A 2D3DA 3PSFA 1MIOB 3B9JA 2P79A 3A1EA 3AY3A 5DNUA 2RD2A 5JVDA 2O6KA 1KAQA 3ZYCA 2OGWA 4J6FA 2A9OA 4PBSA 2J5RA 1O95C 3LVQE 5JDIA 2VIIA 4K3VA 2XB6A 4EJ2A 2QTVB 4FBTA 4RJTA 3RRXA 4JD5A 2GHQA 3N6VA 1LDMA 5J47A 4QL3A 1JFFA 1Q0TA 1JB9A 4DNQA 3JPNA 1F4VA 4H7EA 3ORSA 1O0BA 3H4DA 1RM6C 1N5LA 4AUNA 1Y3DE 5JC8A 3HM9A 1UMKA 5HEKA 2JLAA 2GK3A 1GG2A 3AERB 4RZXA 4KR2A 4ASUD 5KFYA 2RCNA 5B7GA 1GADO 1X1TA 4S35A 2OFWA 3F3MA 4OB7A 3OSUA 4ZJZA 1C7EA 1K89A 2OEPA 4UM5A 4KXNA 4XJVA 3OC6A 3VOBA 4G25A 2ZT8A 3KT3A 1DO8A 1Y3FE 1UUFA 2UDPA 3LDGA 4M9XA 4Q39A 4MQ4A 4C7YA 3MBYA 1JHUA 3SLGA 4NBWA 5EA2A 3FTPA 5KAIU 2ZI9A 1H22A 3F8TA 5BWLA 2HNBA 4J1TA 1J0BA 1JDUA 2WJIA 1PLJA 4TS9A 5SZJA 3I52A 1IK6A 5FI5A 1XL0A 1Q92A 2ECOA 4CQNA 4S05A 4KLDA 2OBFA 1SUDA 4I99A 5KKAA 4EHKA 4CMAA 5LWHA 1KDYA 2F43B 1Z82A 1ZN9A 4RVDA 1WX1A 4OIFA 4R1LA 4PCUA 5D3MA 5I9SA 4FGZA 3VO9A 3W2IA 4PHPA 2H1LA 3BGSA 4BZPA 4DCUA 4OKSA 4H4DA 3SIPA 4RFLA 3JWEA 3QVWA 2CZQA 3H9JA 4KACA 4YP5A 1GKKA 4OJ5A 2QAGC 1U0LA 3QPUA 1RQPA 4W99A 5DX1A 1CP3A 5EJEA 4DWJA 1EFHA 1RHJA 3O4IA 1KMNA 4HRXA 4UBOA 4CIVA 3PI7A 1MB0A 4LJ8A 3ETHA 1QNLA 3BK2A 5HF5A 2WSYB 4AG6A 3T41A 3ES9A 3WQHA 3HJGA 3OQBA 4M1SA 3CPEA 4WKPA 2GI4A 3KM0A 2B25A 2AFHB 2FLWA 1F38A 2YW2A 3O90A 4YMNA 3KQQA 4OFXA 4EHHA 3EX7C 4FLEA 3IE0A 3VJMA 3FRJA 5LLTA 3Q3GE 3IP7A 2VH1A 3PUIA 4L3OA 5F1KA 3RJ5A 4LY9A 5KIAA 5JXWA 5AI0A 4IIHA 1OX4A 1R5JA 2E4UA 3M6VA 4RHFA 4ERNA 3PW7A 1A7AA 4DLLA 1I2AA 4B2YA 2EFCB 3IA2A 1MKYA 4GC6A 4I55A 5IMBA 4QGSA 2ZWMA 3MWEB 1BEUB 2IITA 421PA 1UDCA 4UTRA 4C4XA 1R0SA 3BH0A 2XOKD 3E22B 4QULA 3Q8LA 2P2CA 2ZTLA 4JLMA 4NLBA 1G4UR 4LBWA 3X3HA 4EG8A 2CSUA 3AJDA 3NUQA 1VJRA 2EVWX 2YS6A 3JPQA 1U3UA 2I2CA 3KYJB 1AKMA 3LQ4A 5EHQA 4L2IA 3ZV5A 4B81A 4EW2A 3EIOA 2PVPA 1TZMA 5I6DA 1XIVA 3OEYA 1S10A 2VPYA 2CMFA 5KT2A 2UYYA 1E3SA 1FSSA 4JH0A 1N75A 3HY4A 2JFYA 3KR0A 5D1NA 4CFYA 2OFFA 4G9GA 2GXQA 4XGIA 1AA9A 3MJSA 3K32A 1AQYA 3VOTA 4CM5A 4MGKR 3D8SA 4F38A 4Y2HA 4B09A 1KO5A 4EEXA 1WWKA 5FFMA 3C43A 2PSJA 4ESVA 4NH0A 2C9YA 3L07A 2VP9A 1XMIA 2GD1O 4C1NA 4ZU3A 2QXYA 2JCVA 5FUQA 1Z29A 3AESB 3THXB 3FCSB 1OJ7A 3FB4A 3NJ8A 4XEUA 5KJ6A 1QHSA 2XCOA 5FV4A 1ACJA 4ZZ0A 1BFDA 2J0QA 2AYZA 1OVMA 1ZO8A 4RVSA 5JE8A 1TK8A 1EJ0A 4QG7A 3ZGNA 3G6VA 1YB1A 2FMQA 3MPUA 5CNJA 5DGBA 1J00A 3OCXA 1K5OA 1Z7BA 3Q11A 3M0EA 7ICGA 1L6RA 1EI9A 3K16A 3B53X 3L0CA 5CMLA 3TRIA 1SCDA 4BNFA 5BMVF 5GMOA 1F6DA 4REOA 3ZKAA 3RUEA 1XRNA 3M1IA 2VOEA 2G6TA 4PQRA 1UFOA 1RPLA 3CR3C 4X93A 1HQDA 3I32A 4FQ8A 3UWPA 1HDIA 1X1EA 3CNOA 3D3EA 4MMYB 2BSAA 4A3SA 1T6ZA 3BE4A 4H9GA 1U7XA 3EZ9A 2GNAA 1HX7A 1MMFB 1IZ9A 2G25A 4LA4A 4OHZA 4B1FA 4XWGA 3SC6A 4CM9A 1G8JA 3OCZA 4TZ6A 3EA4A 2WSLA 3DXXA 1GL7A 3HG7A 4AN0A 3JQ9C 3BS5A 3B3JA 4BJ1A 2B7LA 1ZI8A 3M6ZA 4P2HA 2JH1A 1JVNA 4WGGA 3MTBA 3D3QA 5HZHA 3Q3HA 2XWJI 3K0SA 1DB3A 1FFSA 2EZ8A 2JVIA 2HMYB 3EIFA 3L5OA 1WQ3A 4QBTA 1XK7A 3H0MB 1NWCA 1SCNE 3F6RA 4BECA 1AKQA 3SHOA 1PF7E 1U5BA 4AJEA 4HVAA 4W9RA 4AN1A 3T1HB 3OP4A 1KOJA 2HDOA 1Q1AA 1EXDA 1V1MB 3GRRA 3ZDBA 2IMWP 1XZPA 3FNQA 3UUGA 3AF2A 4YR0A 2OQVA 2MAXA 2JS7A 3EA0A 2DWUA 3NXSA 3IJEB 2VRCA 1QP8A 2VOJA 2NU9B 5AW6A 4KPYA 4BBJA 2FFBA 3SQOA 5IJXA 4OO1J 4M89A 5FDFA 2MHCA 3STTA 1DPFA 3NFRA 2BCQA 2AOTA 3D31A 3OE1A 3ADOA 3C1OA 4HG2A 4JEHA 5ITZA 4Z49A 2PUAA 2SBTA 4CEJB 1ZSVA 1EESA 2HCBA 1EQ2A 2CF6A 1O5OA 4REQA 3OZ7A 4JI5B 2VRBA 4E5KA 2I4LA 2RHTA 3NGLA 4QG3A 1RWQA 2J32A 3ISVA 1SBTA 4MPDA 1JZSA 1Z3CA 3EXAA 1JBKA 5DLPA 5JYBA 3IURA 4R51A 1YQ9A 1PFKA 4GI2A 5HZMA 2WE7A 3NVKI 2OT3B 3I5UA 4I9GA 1VMEA 2WJHA 4FMDB 4G3IA 4FGKA 2OD7A 5EEGA 1VQ1A 4WW0A 1BN7A 4HD8A 4MJXA 4V0OA 3W5JA 3G13A 1ZOIA 2QVZX 1CJKC 3CTPA 5MN4A 2ZRFA 4Y6RA 4Y6QA 3WFJA 4ZFNA 5I48A 2VSYA 4B3MB 1U3CA 3ROQA 2Z83A 4Q66C 3WGNA 4RLSA 5THQA 3EULA 1Y42X 5FTMA 4MYSA 1DXQA 2YYAA 2D0PB 1DQPA 3JASB 4GMGA 4DA9A 4F5RA 4RVCA 1U3GA 2VDMB 3FPHA 3HU1A 4LPKA 2J9XB 1WP9A 4FW9A 3C98A 1OAOC 4B8ZA 4M9NA 2GPTA 3ISCA 1S0NA 3IQZA 2ZI3A 1GVHA 2HWUA 4JJ6A 3BICA 5ICCA 4M98A 4C7ZA 1KZ9A 3E4CA 1L7OA 4IYRA 2QW8A 4C7MA 5H59A 3W5IA 2CHEA 2DULA 3H9QA 2XNDD 2WABA 3L6EA 4NPHA 1BE8A 3KL4A 3KPVA 2Q2VA 5DIZA 1U04A 3FTDA 1LEHA 5DLEA 4LRUA 3NONA 1KJZA 5TZVA 3ENWA 4GBMA 1GPH1 3ROZA 2PA3A 3OFND 3T4XA 5B3JA 5IKEA 1K2VN 5COQA 4G0PA 2XRYA 3JPPA 3LK7A 1R12A 3PB3A 1UP4A 3MVEA 3PHHA 1GPYA 3SJAA 3W8RA 3CEHA 4ARVA 3WYDA 1B00A 1B93A 3K72B 2ZJBA 5FBRB 5JCJA 3QUQA 5DBHX 4BQFA 1NAHA 1T0UA 1HR0B 1IDN1 2AFHA 4M22A 4IEFB 1C7QA 1GNSA 2AG8A 4KWTA 5ECGC 2AG6A 2VS1A 5BR7A 3RG8A 4K0RA 4UBNA 4RESA 2XUGA 2FMXA 3V8EA 3O31A 1LVGA 4N5DA 4DV6B 5KG0A 1A69A 1Z36A 4QSHA 1CUHA 4F71A 1KDHA 2PEZA 5KFAA 2ZUSA 1LXCA 4HAXA 4S1NA 3TL2A 1NOKA 3LCVB 1UJCA 4X1YB 1NK7A 2GN8A 4WLFA 2OV8A 1U3FA 1W35A 4Z9AA 1YC2A 4J4BA 2W9CA 1RYSA 1RADA 4LZOA 3B9QA 3E81A 1KYYA 3ANTA 4PC7A 4DB4A 5DG8A 2IVFA 3FUUA 2CLMB 1V2HE 1NBIA 5EFZA 1VXOA 5K2OA 3AL0C 5KOJB 4FGSA 2G83A 3SYMA 4MA5A 1WVMA 2VK8A 3Q7SA 6AT1A 1DRJA 3K70B 1LDBA 2DMRA 1XS9D 4JP3A 1IUOA 3VNSA 1QH1B 4V24A 4KH0A 3PGVA 1K66A 3DYBA 4H08A 3DMRA 2FSUA 2ICAA 3K0AA 4CW7A 1FVOA 1ST3A 4W5TA 2OGZA 4KEAA 2CB9A 3AOGA 3RH4A 3H1EA 5EL0A 1IQUA 3CF2A 1XKTA 3V2GA 5CFMA 4O5CA 2O2EA 3E3LA 1HT2E 1ZI9A 3IP9A 3L1KA 4OCZA 2V7VA 4RE5A 2PUDA 4MS1A 1FDOA 2CKMA 2JIMA 5JNLA 2WB4A 1JH8A 2X1VA 4Q3LA 2RGEA 4XDHA 4HDOB 4MITA 5ISMA 4R6WA 2I6FA 4WX2B 1TVEA 3N9IA 1TQHA 2YFHA 3UT5B 4D81A 5GM1A 2QEQA 1JVBA 4X66B 3IBSA 4RWZA 3MTGA 3T4EA 1TFUA 3A4MA 2YC2C 5D3QA 2A7XA 4KPEC 2R65A 1T8UA 2O0KA 3P9XA 4M7RA 3ZWYA 1TW3A 3MR2A 1TKDA 5DB8A 4JV2A 3TI9A 3OAAA 1AXRA 2XVZA 4JC0A 4F6RA 3O91A 4ND7A 1GGNA 2A9KA 5EMNA 4Q6BA 3NHPA 1KWGA 3D64A 5EC8A 4G01B 1KBQA 1U7UA 2JIBA 1VLZA 2VUHB 3C5EA 1X14A 3HVUA 1XJWA 3E05A 5IUKC 4LJ4A 3SBDA 5JPIA 3UYKA 5JSFA 2DPJA 3MRSA 4AULA 2ODAA 4ZYZA 2R3SA 3PFKA 3PUYA 3TH5A 2YYYA 4FX5A 4C21A 4E14A 5AW4A 4W5OA 4MI1A 4MQEA 4UQOA 5TMDA 3N8GA 1UDBA 4EUFA 2BSQA 2P2LA 2VHJA 1XR3A 2DPIA 5HRUA 2BY4A 4FIDA 3HB9A 3HYLA 4F5EA 2JEZA 3NR2A 1HWYA 2JGAA 2XUKA 1I7DA 3EG5A 4RD6A 4H16A 4XX1A 1OA0A 1Y7TA 3EVEA 1N5XA 2IZ0A 3H5NA 3NRBA 4HB3A 4LXTA 1JKIA 4KLLA 2KX7A 4UUQA 3X1YA 1S77D 5BSVA 3DTNA 2XWBF 2NO6A 2DUYA 3FROA 2V55B 1M0SA 4II2A 1EK1A 4QUKA 4KXUA 3ENNA 3X1JA 2FSPA 1RW4A 2G5PA 2Z6UA 4AYTA 2H4YA 1UXGA 1ZAKA 2FJPA 1UDWA 3GJQA 1H2ZA 4FGUA 1OCEA 3GLFA 2FUG6 3LL7A 2H5EA 5T3UA 3FCXA 4G85A 1DI0A 2BUAA 5TRTA 3B9PA 2DL0A 3QJGA 4XTRA 1KLNA 3HJTA 3FDFA 1H2BA 4RMGA 1V6AA 3WK9A 1EH5A 2BFFA 2BH9A 3L92A 4MYCA 4TLMB 2PX0A 5BNWA 1KFKB 3MK31 1J0DA 1SPXA 2C2XA 3OT4A 2F67A 1LZKA 1Z88A 1YZTA 2AMVA 3ZG6A 1G2OA 3FKSD 4M1EA 3SEQA 4TROA 4K03A 4NLLA 3CVVA 2J0SA 2G5CA 1HEUA 3FGNA 3T54A 1BVRA 2PFKA 1A96A 4YMGA 4B32A 3DMYA 2BR3A 4QQRA 4EDHA 2WWVD 1Z34A 3I72A 4I55F 1E4EA 2PQ0A 2SCUB 3ANSA 4N3GA 4RKRA 5DI9A 1UC9A 3IAUA 3Q6MA 4PAQA 2EDCA 2O48X 3EVDA 4HZUB 3PDWA 1ZVJA 5G4KA 5BWOA 2FJ0A 4WXPA 5FA5A 4PPGA 3D2BA 2VSNA 1QB8A 3F7MA 5AVJA 5IABA 2JFZA 3RIGA 3TDKA 3FJOA 3JTMA 2P9YA 2QVCA 2J08A 3PK0A 4KQ2A 2YJ6A 3GX1A 4PQFA 2K4PA 3GMSA 4JYAB 2B8NA 3HO6A 4DOBA 4IUBS 4Y9TA 2G7MC 5CRIA 5T4BA 5KSZA 3R3SA 1HDEA 4ATNA 5ED4A 1EP9A 3ERCA 3IIMA 3FYUC 3SF0A 3DXZA 4D5GA 4P0PA 1VIAA 2QSJA 2VK1A 1Z2NX 4ZQGA 4UQPA 5CEFA 1KEKA 1USKA 1TZKA 2MSCB 2ZUDA 4P4GA 1V3UA 3F96A 2WUGA 5GOTA 4Z2AA 2HA4A 2OFXA 1AMNA 1AGRA 1UPXA 2PM8A 4C0SA 4FI3C 4IWNA 1BQ4A 2GBIA 4RM2A 4CQLB 4UC0A 3CZ5A 2EW2A 2C4KA 3LX6A 2JD0A 4UBJA 1QYIA 1XHEA 2KJQA 1RTTA 4RXUA 4IKPA 4QNRA 4EGAA 3K09A 4E88A 4F86A 5IHPA 2ZE6A 4CKXA 3BRSA 5FLKA 4BX8A 4QA9A 4D7AA 4NZ9A 1ODIA 2KI5A 3PIRA 1X66A 1RM5A 4JJFA 1EJBA 2V7UA 4QHTA 1TJ4A 4Y2VA 3PR3A 3EFBA 1RWPA 3IR6A 1RQXA 1J5EB 3OZFA 1HQYE 2FFRA 1USVA 1EX6A 2BRUC 2YRXA 2PMDA 4ZDKA 4C30A 4WERA 3MBOA 5JLJA 3WX0A 3C3MA 3PC7A 2JGJA 4FSDA 4JIGA 5LZ9A 3R7NA 2FPRA 5ALSA 3NBYC 3CH7A 3AEUA 3PNKA 5E4TA 4OTZA 1XSPA 2IXAA 3KU1A 3O2NA 4N9QA 5HVNA 3E3OA 3T5MA 3OFVA 1T8WA 1Q1ZA 4E2YA 2HK6A 2DY1A 2IHKA 4ISCA 5TQJA 4C08A 4AU1A 1ODJA 4YMLA 1I24A 3GT0A 3SENA 2GPNA 3MUNA 1XU4A 1ZKMA 1ECBA 2R62A 1L5QA 3GPBA 1NW3A 1JFVA 4JBHA 5M5BA 2BPCA 5H0IA 1GNRA 2QI9F 4YONB 4X8LA 1EHIA 2V96A 5DX8A 2HK9A 1NZFA 3L7IA 3F71A 4FXPA 3ZK8A 721PA 1GL3A 1YMVA 2AA3A 2OP0A 4KMOA 4Z86A 2QRLA 1JHMA 1ADJA 2TYSB 4GM0A 4XWTA 3I4LA 3ZN2A 2PFNA 1W9HA 1NVUQ 1IRIA 1I33A 1NI4A 2FOIA 4ZVUA 3TN7A 2PT7A 1KAEA 3AK4A 3RQSA 3KOMA 3I2KA 5JWOA 2EW8A 2G5IB 3CVJA 3NXKA 4AJHA 4Z4IA 3U3KA 3KQHA 2OOKA 2EZUA 2JDIA 1LF5A 3DWFA 2J4DA 4LVSA 1EMDA 1Z8FA 3MPOA 4EF5A 2EQ5A 4BO6A 1TO1E 2ES6A 4EM6A 5JWRA 4EYQA 4QXMA 4YP0A 3DLPX 3MMZA 1OI2A 1UA0A 2W42A 6GPBA 4FD3A 2QROA 7ICRA 1ZU4A 2XSZA 4JU8A 2NU6A 3JQEA 2WSSD 4OB6A 5CW2A 4YHHB 5DLGA 3G89A 1G41A 4JLAA 2X8AA 3F6YA 4RADA 4FZNA 3H99A 2E49A 1SHZA 3SI8A 1CC1S 1JQEA 2C5FA 2I0FA 1C2YA 2VJAA 2X2PA 1NK5A 4I29A 3MT0A 3QWBA 4KHZA 4QUIA 4Z9BA 5ITZB 1INLA 1I3MA 2HSDA 2O0JA 3G0GA 5C4MA 1IBMB 3BTUA 2BJHA 4X8MA 2IHTA 2YHBA 5EHXA 1XRMA 4WWHA 2LKYA 1QCCA 2ISQA 3MQ2A 5DCLA 1D2NA 2OL4A 4OHFA 4N48A 2KWIA 4DLPA 3TQHA 4KXFB 3T5DA 3E5RA 4QYWA 3IL2A 2ODBA 3BMNA 3B3AA 2B5VA 3WISA 3NYWA 1A9SA 4MV3A 2ZRBA 4N9WA 1DGQA 3RF6A 3E3AA 2GASA 4TMTA 2V3CC 1GNTA 1LGYA 4Q47A 4KIGA 4EVIA 4I2NA 4EY3A 1T4CA 4MI6A 2QF7A 1ZJMA 4B85A 2ATXA 2LPMA 4BZXA 1SIJA 1ZCFA 1TKCA 4PY2A 2PVCA 3Q87B 2LPEA 1V9SA 4E4YA 1LBHA 3HXMA 4YFVA 3VTAA 3OP1A 4MQFA 1A9XB 1VKNA 4P54A 1Z0FA 2D5BA 2WP8J 4PWYA 4WK2B 2YXPX 3R7WB 2SHKA 1QKJA 3Q7PA 4YV1A 3VR6H 1AH2A 1U63A 1BH6A 3MGBA 2I4IA 1KFJB 3G1UA 2IZZA 3P45A 3E9RA 3ZLTA 4EY7A 1WQ4A 3MINA 4RQNA 1ZMTA 2ADOA 3WNQA 3UAOA 1Q0RA 2IP4A 1NLZA 1IG3A 1KAOA 4JQCA 4W6ZA 3JASA 1C9KA 4XIJA 5FXMA 5E7JA 1QUFA 2PU5A 2OYCA 4DJEC 1Q44A 3HYRA 4HK4A 3DT9A 3KALA 4C05A 10MHA 1VCMA 3C3CA 4CR6A 3QYAA 1EAMA 1D6MA 3EY4A 2C5HA 3GR6A 3H65A 4DLUA 4NU5A 4RGYA 3KHGA 3ELWA 2ZIUB 3N58A 4KQ6A 3MWYW 2E4AA 1EK6A 1S3IA 3TQFA 3NH9A 3LP5A 1YB7A 5KFDA 4IINA 2IX3A 3I5MA 3CSSA 1FDSA 2X41A 4RSHA 4RHXA 3U4DA 2WPDA 3PXBA 2EFEB 4E2ZA 3K6SB 4LHZA 1P2BA 3D8RA 2V5AA 3J7TA 1VFNA 2Q7XA 3KZOA 2Q2OA 3TFWA 1D3AA 4WFQA 1ZOOA 2WTAA 3TKLA 3KE9A 3WZLA 3T79A 2LI6A 4Q48A 4KXXA 5ALOA 3DZDA 2P5YA 3AZOA 3O38A 5KFPA 1NJWA 4L6CA 4MTCA 1XO1A 4PHDA 4X3CA 1I3LA 2O14A 4NPAA 4HRAA 4PZDA 1PL6A 1KJQA 3CZRA 4KMMA 4BFCA 5HSGA 2W58A 4J90A 2JFPA 4YCMA 1L3VA 4IL5A 4IS3A 3WIBA 1JG3A 2HA6A 3FJYA 4NZZA 5LP6A 4NPCA 2X2OA 3ICXA 4DLGA 2EF0A 5I9IA 4JK1A 1XZKA 3Q8WA 4G4JA 3VZCA 4LXYA 1AVTA 4QM7A 3AUXA 3FVQA 4CODB 4UU1A 3KB8A 3DBLA 1VIMA 1XEFA 3HJAA 4QRIA 4X90A 4ABYA 2QPOA 3GLHB 4L74A 3JALA 3OTHA 1NDHA 3WGHA 1QV7A 3SWWA 3OSNA 4XIIA 1K7FB 2BCEA 2CW5A 3QBVA 4JNCA 1VG0B 4L9SA 5K3OA 2E8PA 3NYIA 4AP5A 4BLSA 3M4YA 1O6CA 1ONPA 3V1MA 5KQPA 4P86A 2QAIA 4Q4HB 1I51A 2D13A 4ZVQA 2W9CB 3DKPA 2FPKA 4MB0A 4RYDA 1OFHA 4A36A 1E2HA 1BHO1 3AIMA 5GONA 1JJ7A 4J0EA 3W6OA 5JNSA 1EFVA 1ZCBA 1UXHA 4ZOBA 3WBJA 3F0TA 2Q6IA 4QUEA 3AI2A 2XTAA 1IWBB 2KLHA 3PA6A 4Q24A 1W85B 1YS4A 4TQGA 3G9UA 4XM1A 4P35A 1R0CA 2VBFA 4OM7A 3CNEA 3ZXXA 3GV8B 1FNDA 3DBLB 1F8GA 2Y2VA 3GFPA 3PNSA 4KMSA 1W8DA 2J6SA 3QVUA 5DM60 1M5UA 2V0NA 4CL8A 2CSXA 2NACA 5DE3A 1IHOA 4NJOA 3DR3A 1L5NA 2QQEA 2W8LA 2LXNA 4G26A 1BGXT 2R9VA 5C1BA 5C7IO 4U0JA 1JTEA 2JI4A 2IPAB 3GFSA 1BTOA 2PX4A 1EUCB 5TR9A 5KPJA 4ND5A 2A14A 1NQ5A 4ZAGA 3U4MA 1M6WA 2IYZA 1MOQA 4IWYA 3Q0TA 4ZJYA 1XZFA 4BX3A 3R44A 3B1XA 2IXDA 4TL7A 1RQ7A 4C76A 1Q0UA 2XY5A 1FK8A 1X94A 2D54A 2ZAIA 4NOLA 3I28A 1HYEA 4NH4A 3F7TA 4AY6A 3CX8A 2GRJA 1HQKA 3AFOA 5B4UA 1LZLA 2C5SA 1CRXA 2BHSA 3BFVA 3HJRA 3SYNA 3SZUA 3P9IA 3X1DA 2NZVG 4G8BA 3N8IA 2PBFA 4IV8A 1VCIA 3FCCA 1RWXA 1WZNA 4YRNA 1S8NA 4L95C 2KOBA 1QBGA 1D9ZA 2DR0A 4RZ2A 1SC6A 3PDHA 4BNKA 3R3WA 3IQDB 4Z4GA 3NNDA 3IN5A 2NU7A 5F7ZA 2WQ6A 2R5NA 2OECA 1ZIPA 2E85A 2EDUA 4QYXA 3S28A 2NV3A 4L4ZA 1C9EA 2QPAA 2A9QA 4F3RA 5TPZA 2OY0A 4D02A 1QRTA 1K5GA 5B12A 2C61A 1MF7A 2EBFX 4PVDA 1Y34E 2PE5A 1OIXA 2FPSA 4IH9A 2XQVA 2EL9A 3BCHA 1ZEMA 4ZPJA 3Q3VA 3GRCA 4O4IA 3AYXB 2RB5A 4QATA 5E3IA 1JLKA 2I3BA 3HM2A 1AS2A 2PRYA 2F1RA 2O8CB 3DVQX 4QZCA 3K2EA 3NV7A 4NEQA 2D1SA 8ICJA 1MVLA 1P4HA 2PX2A 1UFVA 2X9QA 1G63A 4GXTA 4I8IA 3C5CA 2PFOA 1XTQA 4IDHA 4F96A 5B7NA 4RTJA 5ICGA 1HL7A 3BD7A 5IASA 2VSOA 2AN9A 1XLUA 2AG0A 2AUTA 1XZGA 1OUQA 4GKKB 3DFMA 3T52A 2HUNA 1AC5A 4RZHA 2Q3EA 3LM8A 2EATA 2WMNB 3KFVA 1DHRA 4LRSB 1C30A 2XTJA 3J7AC 3P97A 3PC8A 4FYWA 4DSFA 2Q5QA 4L07A 2QNRA 4KSBA 3AUAA 3ADDA 4QZBA 2J9GA 3ASVA 3IILA 3WA7A 4CQJA 2Y99A 2YXDA 4MGZR 5FOVA 4O0IA 1XC9A 4MW0A 3DV0A 1U5BB 4K9RA 3JQBC 5E7IA 3CRRA 3BRWD 3RIHA 4K88A 4US2R 3MZ0A 1MQ2A 4LXHA 2ETVA 4XJSA 5E7QA 3PL5A 2Q3FA 2WUWE 2VK2A 2H5XA 4GP9A 4HGNA 2Q6TA 5EOVA 3RHTA 1PVQA 1L5LA 4OPMA 1DADA 2O8NA 5EIWA 2LV8A 1Q17A 3E5HA 2B1JA 1ZEJA 1TADA 2IYWA 2OKGA 5ESXA 4ZCTA 4BO7A 1KMHB 4IOKA 4OO3A 2WWXA 1EIZA 3V7LA 7ICVA 2V7EA 4YUAA 3UPTA 4P3XA 3HSSA 3GV7B 2Z56A 3KELA 1N60A 2KSOB 3C5HA 3PX7A 2GZDA 2IW3A 2Q2NA 4H3VA 1HTBA 1KQPA 2FPOA 4LKOA 4RKFA 3UAYA 3ZWBA 2GBCA 4C3VA 1V1MA 2X13A 3BQNB 1NOJA 1T2NA 3SM9A 4O4LB 3AW9A 2YTZA 3T99A 5BSEA 5CWRA 3R09A 4L6AA 3RFXA 2X22A 1TJPB 1QGAA 1I4DD 4M04A 1MLDA 3O4GA 3OVMA 3IDSA 1RM4A 4NSNA 2RH8A 1XDGA 4TV8B 3JU3A 5EWEA 3PEWA 1VA4A 4KMOB 4RTKA 2NQ2C 1OXUA 4D9CA 3MJTA 4YAKA 2FSFA 1P74A 7ICIA 3NHFA 4FT2A 3THRA 5LNK1 4CCYA 1OB2A 1WSBA 3JPTA 4RTMA 1WBJB 2P9FA 3I6MA 1UZAA 3TX6A 4BNLA 1B2RA 4QZ9A 3NOXA 4TTIA 1JW9B 2JGKA 3RVLA 3WLNA 2LKDA 2PBLA 1ZH0A 3QSYA 4MDHA 2JAHA 3LQRA 4MGEA 4C0HA 3DTTA 4KU4A 2WHPB 1W75A 1WZIA 1N6HA 3FOWA 3KLPX 4INAA 3OM9A 1J09A 4C04A 3EC1A 2ZIZA 4PS0A 1UBGA 1UAAA 1WVGA 2RGAA 4G41A 4OGWA 4CVNA 4EUKA 2QX6A 1PT5A 3EGIA 4R0MA 1IY8A 2OB2A 3TFRA 2WB1F 3ORFA 1K75A 1RAAA 1A2OA 3HCRA 3LAWA 5AW9A 2QB0A 1SO8A 5DULA 1CS0B 4HDMA 2FPMA 3PRJA 3A1SA 5J2IA 4RY0A 2R97A 5I4BA 1E1MA 3FDSA 2XVTA 1I0ZA 2W2MA 4UM9D 2Z4SA 1EINA 2MIIA 3F6PA 4Z1OA 1GUYA 3R3HA 4F7WA 1KYQA 1U47A 5KOHB 3C5VA 2KV2A 3T1OA 2FJ6A 3OCVA 4GAEA 3SV4A 4OP3A 5CU7A 3N87A 4R2LA 2WKSA 1TU3A 1TF2A 2BFDA 1T8YA 3LLUA 3K0HA 3VU0A 2BONA 4LPSA 4WN9B 3ZV3A 4L1KA 4HNRA 1H2XA 1LBTA 2YOFA 4TXNA 1EP3B 3WLTA 4KAJA 3ZU4A 4E6PA 5JNUA 1UAGA 2FWBA 4GOXA 3TUZC 4P0QB 1LNQA 1X6JA 1W73A 5E4JA 5AK3A 2Z8ZA 4EI7A 5HHIA 3BJIC 1DRWA 3NP9A 1IK4A 4O33A 4GNRA 4Y7CA 3WYCA 4B9NA 5BSKA 2ZYHA 4MW1A 4DV4B 3KLMX 1X7WA 4QWMA 4FOLA 4S04A 1XQ6A 3N86A 3VI3B 4XCXA 1JDJA 3PKZA 1SV0C 2ZIGA 3DDZX 1XDWA 2BGMA 1OHHA 3LA8A 3P0HA 4KR0A 4UFPA 1NC3A 4E70A 1ESCA 1CUGA 1FIUA 2C29D 1AGYA 1GGJA 1NRJB 2F8MA 4QYMA 1NHGA 4P82A 2WA1A 4FFNA 3MGHA 4KBGA 1NXXA 4YPOA 4P92A 1JAIA 2R8BA 2IBTA 4X20A 4UVHA 5LQDA 1NXTA 2HAEA 4MWCA 2QAJA 1EFTA 1TVCA 4NX2A 3BUSA 4QOHA 1E18A 3HKBA 3IAM1 4HUQB 4EFKA 3T4UA 5MHTA 4ILEA 2PEYA 2OG1A 2NU7B 2QMZA 3TAHA 2Z6QA 2PXXA 1TJ3A 2ZLBA 3L1UA 4MPRA 4D92A 1W25A 4OBXA 5AKZA 4UAVA 2VHZA 2GF0A 3IQIX 3LBIA 2QMYA 1E6KA 2QAGA 4JJ8A 4EKNB 4R4JA 2GCGA 2G1UA 3DPSA 5HIAA 3BSYA 2PT9A 4M0KA 2BGGA 2PKRA 1I13A 2A58A 1V8FA 2J3EA 2J0UA 3BGDA 1R37A 3FIJA 3KT0A 4TL8A 4PYOA 5I7WA 1K68A 3SPXA 2BKAA 2HJVA 1BU5A 3ANLA 4A91A 2VSFA 1T4GA 1PGJA 4J1NA 1PVVA 1SKAA 1D2CA 1CUYA 4MS4B 4D45A 3UUEA 3TXYA 2TECE 2GXSA 2J31A 3KVRA 2VZ9A 4KQFA 4QLBA 2KG5A 2D5CA 1Y5IA 2VWQA 2JFXA 1M76A 4W82A 4W63A 4ZVTA 4DCOA 4EPRA 3LT1A 1WXIA 4P4NA 1NR1A 5F35A 4EQ6B 5DXAA 5E1MA 4YCXA 1BXGB 1H05A 2YIDA 1S7CA 1IATA 1RLUA 1VP9A 3EWAA 3QPVA 2V98A 3HI6A 3UB3A 3VR0A 5KJFA 5K4AA 1W0JD 3DGEC 3DZGA 4DQSA 2CJFA 4OUDA 2ZSBA 2C82A 3L6DA 2ORVA 4EX6A 4DG8A 4LF8B 3VNBA 4OM8A 2Q3JA 3C7CB 1EUDB 4R63A 1R8YA 2IYLD 2AT1A 3E7XA 4UB4A 1EM8B 3FCEA 5EFOA 5E4YA 2PMBA 2WNSA 1FDVA 2XNJA 2REBA 1EX9A 5DKWA 1H85A 1OU0A 1L4NA 3DKVA 3RB0A 2PWBA 5FPYA 2CFCA 1U2DA 3QX3A 3DP7A 5AJYA 5GONB 2PUBA 4PX5A 1DEXA 1A8SA 2FRVA 3NRWA 3EF3A 3I2HA 5EHGA 2FV8A 4AM8A 3L1IA 3SAFA 4JOQA 4CNBA 5DTQA 3RVJA 1POWA 3BZWA 4I3GA 1T5SA 3AVPA 2A9JA 2VR1A 3D3WA 4QWDA 3CF4G 4MWGA 4JVSB 2FWMX 5KVQA 4RPZA 1HG0A 1MEOA 2Z2JA 3HCBA 4DA4A 1GT6A 3F6BX 3AEZA 3A05A 4CTKA 1SOAA 1JAZA 2ZAYA 2V8OA 5JRDS 4WBNA 3ZGVA 3DWEX 2ZRJA 3ZNOA 2IH5A 1VYVA 4IMJB 1XB2A 2OZPA 2BFEB 1NE2A 2F2TA 4BO1A 2I7VA 4KIUA 5JS2A 4N54A 4HWRA 4HVTA 3FFTA 4CEIB 5A4IS 2ID4A 2CXSA 4Q7KA 5C8YA 5A5FA 4ELTA 5IEJA 1U1DA 2FEWB 1MXFA 2FOXA 4O4LA 2VJMB 2FXVA 2I4RA 4K6OA 1J20A 5B53A 1Y3IA 3HILA 4XR9A 3F46A 3B9BA 3FFXA 3TL6A 3SQIA 7ICHA 2AI1A 4GI5A 5E6RA 1ZD9A 2J9YB 1OZHA 2VPZA 1Y3AA 4LWQA 4Q37A 1VE5A 3WADA 5AW0A 3KX2A 1NPDA 4D5EA 4PPFA 5JASA 1GQSA 2XZLA 3RUCA 1ZR2A 3MQFA 2WB1C 3FHOA 3S2FA 4OSEA 1R18A 1FVFA 4Z99A 1Q1NA 4GPBA 3VOAA 4LF5B 2IY7A 2VA9A 5CIYA 1ZM7A 1YIOA 1EB9A 3M4JA 4LDQA 2OD9A 1QVVA 5F9FA 1EPUA 1SVUA 2EH9A 1OQAA 1PW7A 1LDEA 1GRRA 2W8BA 4R1QA 1FF9A 4IJ5A 1GM5A 4F5WA 3RJTA 3UPUA 3IDOA 3B3GA 3DC2A 2PX5A 4PG7A 2PMZC 4IO0A 2LCQA 2ZPUA 1EGQA 2RC6A 1Y5LA 3UMJA 3UHPA 2O20A 2ZBVA 3LGXA 1XLTA 1XRSB 3H16A 3PE6A 3FVWA 2CE7A 4QFDA 2HW8A 3QHQA 4MIEA 4V0KA 1IM2A 1TKBA 1K3UB 4G5QA 4DWIA 5J5CA 3N1UA 8ICYA 2YWFA 1QVZA 1AK1A 3DLCA 3AI3A 4Y2QA 1TDJA 1NBWB 1V16B 3LHKA 4MQUA 1NR5A 1ZGCA 2C20A 4O25A 2YUIA 1QK5A 3IEUA 2YWXA 3STYA 4M0DA 2I6TA 4MFFA 1CE8B 1WCV1 1YZQA 2C03A 2X4IA 1WXQA 3AW8A 3CCFA 1P4RA 3O2JA 3R6GA 5I45A 3JXEA 4DL6A 1CIJA 2IZ5A 5GVRA 4D3ZA 1NQXA 4UUOA 3TO5A 2BFDB 2REOA 5JS7A 1COZA 2C0QA 2WUDA 3GJ0A 5CHEA 4BUCA 1R6AA 3DPIA 2V4ZA 4H4EA 1D5WA 2ISPA 4UOQA 4RUCA 4INPA 3T94A 2J45A 4IQUA 2XE8A 5CIWA 4LJXA 2H16A 3L1VA 3L4EA 2H2GA 2GO1A 3IE2A 3I5AA 4Z0HO 4F2HA 4QDOA 3JQQA 1ZHFA 3H4BA 2ZRNA 2ZW9A 4K1XA 2AJDA 3JAMA 2PD4A 4H77A 4K46A 4DO9A 2Q5IA 2O2GA 1SV4A 5BUCA 2R6DA 1X6IA 4TKUA 3IB6A 2ANBA 2XYVA 2KJ5A 1UBOS 2AGVA 4QUAA 4OQ4A 3V4SA 1ZAYA 4TYYA 4FN4A 1RKQA 3U3DA 1K27A 2D1FA 5D5HA 1N7HA 3B1JA 4AT1A 1JG4A 1NV9A 3BF7A 1C0EA 4LX8A 3HVRA 1MEJA 1SKYE 2G6BA 2QRHA 2ONJA 1A9OA 2RHHA 4BAUA 5BW4A 5DQIA 3EBOA 4LQ4A 1BIFA 3F5AA 1OAOA 2FZEA 1L8LA 1U2EA 1SC1A 2JGFA 3QWHA 4KE8A 1ISIA 2X0FA 4DLWA 4ZHQB 1EA5A 3HSYA 8ICRA 1QTNA 1KK0A 5CLQA 2PO5A 1JHXA 3T12A 3I6QA 3M6WA 3IM1A 4DLSA 2BM8A 4BMNA 4CN9A 1L5MA 3LCRA 1KEUA 2QM7A 2OAP1 4WCVA 4CETA 2DUMA 2R1TB 2YWEA 3IVXA 3SQWA 1ZA2A 1MOSA 3FAHA 3ISBA 1DC6A 2XVYA 3JD4A 3G9TA 3NC0C 1VL8A 2JJQA 3RUAA 5CEEA 5C31A 3GD7A 3V2HA 4JLUA 1NP6A 4BQRA 3FNIA 1SG6A 1HF3A 1D4ZA 3RO7A 4G89A 3K1JA 4IMRA 5F2OA 1EDOA 1M2JA 2IPOA 1YBHA 2AW3A 3VHQA 1CEEA 3BMQA 2D5LA 3OURA 4R8KA 4MVCA 5IAOA 3L4PA 1SVIA 1UOPA 2JIDA 2GSDA 3AM5A 3KCQA 4A2CA 3WIUA 2EZ9A 2DR3A 1DJMA 1G3QA 4I2JA 2HJHA 2JBHA 3Q3CA 4BFWA 4DR1B 1BS9A 4ZAXA 1DO0A 3L7OA 1B23P 3IBFA 4KPFC 1DP4A 2DHEA 2X1LA 1ZQOA 1RXWA 4RY9A 3AJRA 5IVHA 1Y81A 4FN5A 4BP1A 3H1GA 3JQCA 4NHOA 3LCJA 4RWEA 1MPTA 1T36A 1BVYF 3ACBA 3FB1A 5A02A 3RYCB 1IZ7A 1ZZGA 2MINA 4PCAA 5ILQA 4B6GA 4QREA 4ZYXA 3FMVA 1G55A 1MJHA 1K2WA 3G8BA 3P27A 4IJUA 3UBMA 5A2GA 2BDTA 1KL9A 1CK4A 1LTKA 3EGEA 3ZHUA 3UT0A 3IUQA 5ALQA 5DHUA 3FYHA 4QJFB 2GN9A 2UVPB 2ZBPA 4WEOA 3VTKA 5LQRA 1P4JA 4RPIA 3J81A 2YASA 4JLBA 4RACA 1LNSA 4DCSA 5C7LO 2JIQA 1ZIOA 1FQOA 1QYRA 5CEHA 2R6FA 4W7SA 5M34A 2WJYA 4FJ0A 4BNUA 4B9UA 1SXJB 4YROA 3PX3A 5KNBA 2Q0HA 4RUAA 1B1CA 2R8ZA 3D02A 4HLNA 5KFLA 4Z7OB 1M8FA 1OFIA 3KB1A 4B83A 3VYVA 2H52A 2V03A 1QNFA 2WZCA 1SVMA 2GERA 4KQ1A 4PRKA 4M1YA 1F7VA 5ALGA 1GO3F 1WL8A 3MTEA 5I4IA 5I7FA 1O58A 4AQDA 4FYHA 1MB3A 5KFIA 2VJPA 4BASA 5EE9A 4EPVA 2DECA 7ICTA 3WDSA 2D00A 4AKGA 2EANA 2VDRB 1A95A 2D2XA 2PGAA 5SYNA 1TLLA 2QD3A 4DNXA 4EUNA 3PUXA 4D4KA 2UVRA 1E66A 4YJ3A 1S97A 3RRGA 3CB2A 4J1TC 2Q6VA 4UMDA 5B3JC 2JIRA 3KWFA 3N7TA 5JQGA 5BNTA 1UKVY 1E4VA 1LTQA 1Y4ZA 2ZCUA 3IB3A 4PRLA 2BYTA 2DPLA 5TY0A 5IZCC 1R4NB 2ACVA 1QU2A 4ZCRA 1BQ3A 2RHOA 3KEMA 1UXKA 1MAUA 2RAPA 3GFQA 3QKTA 4RCZA 3U39A 4BJ6A 5JD5A 5IX8A 4C7XA 4XB1A 1VRVA 5CNMA 4Y8VA 1WOYA 1YI0A 4NXZA 1EBUA 2AWOA 5AVUA 3KVVA 2GCIA 3VPDA 3KZKA 3K20A 3HEMA 2CPRA 3M6FA 5I7RA 4RL6A 3R3ZA 1NJ2A 1SQ6A 1ZXLA 1N2IA 4MCHA 2ZJZA 1KS2A 1UJ4A 1WS6A 4GLLA 4QTTB 4JUAA 2XBMA 5EIAA 4YQWA 1T5LA 2GVDC 3EYZA 3NOVA 1SXJA 1P7PA 2PKXA 2X42A 3STUA 1P1BA 4ESHA 3PNMA 1E99A 3HZZA 2AK3A 1YR9A 2M0NA 3R0QA 4BMXA 2WFLB 4XLZA 2QE7D 1W5FA 5KAPA 1F6BA 1KAHA 3KOZA 4P58A 1HV8A 3I6BA 4QT0A 5TF4A 3NBXX 4TS1A 1LSJA 2D6FC 1GA1A 3W2GA 5P21A 3FTEA 5JYCA 1UIMA 1EZZA 1ZN8A 2B6NA 4N5MA 3BFJA 2QUIA 4AJPA 4C06A 2AEJA 3BQ1A 1KEVA 2BDEA 2NO7A 4JLOA 5CT5A 4M9ZA 2LD4A 1NF9A 4NU8X 3WKBA 4DBVO 4K1LA 1UFQA 5KWJA 5E0KB 4F9FA 5JOQA 3PWKA 4K9QA 4RTQA 3ZWNA 1NBAA 1NQVA 3C4VA 3E58A 1E5DA 3ZY3A 3TQCA 5HR5A 2QOEA 4WOCA 1IXRC 2GKGA 4BKRA 1LU9A 4FYKA 1MT3A 1EFPB 4J76A 2J07A 2GH1A 2GKSA 2W2PA 3TEMA 3ESXA 4FHGA 2XLCA 2LHTA 4G5FA 3IKTA 4JKIA 1NOMA 4F3TA 1X9IA 2WILA 9ICJA 1RAHA 2XUZA 1UPBA 1G8FA 2WSIA 2ZDGA 5DHFA 2UUPA 4R66A 4BL5A 5J58A 3GLIE 3P9QA 3ENZA 4KDEA