4IC9A

Crystal structure of the full-length matrix subunit (p15) of the feline immunodeficiency virus (fiv) gag polyprotein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
b'GQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p15
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4ic9A00
1HIWA 2N1RA 2NV3A 1TAMA 1HEKA 4IC9A 2H3QA 2LYAA 2K4EA 2H3IA 1UPHA 2HMXA 2H3FA 4ICAA 2JMGA 1ECWA 2H3VA 2K4HA 1A6SA 2GOLA 4JMUA 1L6NA 2H3ZA 2LYBA 1ED1A 2K4IA
chains in the Genus database with same CATH superfamily
1HIWA 5KG4A 2A3VA 4R63A 4FBUA 5J2CA 3EW9A 4QZIA 2KEYA 3C28A 2YX8A 4UQGA 2DL0A 4RQ5A 1T94A 3JPQA 2FLNA 3UQ0A 4I28A 4QW9A 1LKYB 1SB3C 3MDCA 4F72A 4PHDA 4RNNA 2BQUA 4RQ8A 1URJA 4FZMA 3UPQA 1F5SA 2AQ0A 1O08A 4NJ8A 2HHTA 4OO1J 4R8UB 5HMMA 3T5JA 2KJ5A 2HVIA 1UPHA 4IL6U 1RXWA 4TURA 3G6YA 5IIOA 5KT7A 1WCLA 5ALDA 4F2SA 3V7JA 3JPSA 4C8LA 3IP4B 2PI5A 9ICEA 3RF9A 4O3OA 2PFQA 4DF4A 4CF4A 1U9LA 5AKJA 4YVZA 2YQEA 2KVCA 2JH7A 2K4EA 3PSTA 2AHOB 1L7NA 4CCHA 2HMXA 4AP9A 3T5HA 3MABA 1PK3A 1BPZA 5ALMA 3K1ZA 2ASJA 1OXJA 7ICRA 4DCCA 1SXDA 4J9MA 1MSWD 2ZXHA 3PW4A 5KFIA 5AK4A 5DKWA 2OWOA 1SIJA 3KFUF 1BPEA 3AL0B 3HILA 5KFNA 3UQ2A 3ZDEA 3RJIA 2HCFA 3AEVA 2V9WA 2XI9A 2KKVA 1ZQZA 2EZZA 2F1IA 2WAQF 5T14A 3ALRA 2GWSA 5J8YA 1RDFA 4RQ6A 1DK3A 4JV1A 2JZBA 4J9LA 2BCVA 4UB3A 2JV3A 3KZXA 4NY8A 2K4HA 2R8HA 5KTQA 4NL9A 1L8OA 3C5FA 2KVSA 3PV8A 4JWMA 1MC8A 2KHVA 2NO5A 2P6RA 5IINA 2VA2A 5AKGA 3PX4A 1L3UA 4UB2A 2VANA 1BGXT 3RBEA 4C4TA 1SKSA 3C2LA 2W9BB 2NYVA 2W3RA 5AIBA 5EWGA 1NK9A 3IDWA 3ETRA 2DGZA 1Z00B 1JALA 2P35A 1ZOLA 4ECZA 4FE3A 1HUOA 4R65A 1CUKA 4NWIA 2LYAA 2A1JA 5KG2A 5B5EU 5DLFA 5AKHA 4PHAA 2W54A 4UASA 2ZG6A 1T7PA 1MA7A 3I28A 1RYRA 3ONNA 1PVRA 4DSEA 2NRWA 1ZJMA 7ICOA 2WHEA 2FLLA 4UAUA 2PFNA 4MFAA 1C7YA 3OJSA 1N60A 4X5VA 2W9CB 1WCNA 3RJHA 1L8LA 4YD2A 3V72A 4DQQA 2MSNA 1LKYA 4ED2A 3LK9A 3TADA 4U6PA 1ZQRA 3UMCA 4C8OA 1VDVA 1IV8A 4R8UA 2KFNA 3PR4A 4M9HA 1JMSA 2WTFA 5ALXA 1BVSA 2W55A 5ALNA 1A0PA 8ICFA 4B9UA 1ZQKA 3EPIA 8ICVA 4PGQA 4ECRA 1TFRA 3HKZC 2XC9A 4F5OA 2ZIXB 8ICNA 2JEFA 5DBCA 2KHQA 3AU2A 2YTUA 2BQRA 1MQ2A 4O9MA 9ICUA 2NO4A 3IM1A 3ZD8A 1JN3A 1UHUA 1C20A 2KZMA 4NLCA 1DGSA 1XO1A 4YD1A 1FO4A 1ZQDA 3PSPA 3OGUA 3U26A 2AQ4A 5JRTA 3M9OB 5TZVA 1ED1A 9ICBA 3NVZA 8ICYA 3M6KA 5AICA 4PHPA 4YN4A 2AU0A 1N62A 1CEZA 3H4BA 3L4PA 3QUTA 3RB0A 3NUQA 4RUAA 2C2DA 1SV0A 3IN5A 3ISBA 2ZUBA 5JTIA 3VC8A 1QSYA 5KFRA 1S0NA 8ICQA 3OPXA 1ECWA 1TK5A 2ODGA 4F8RA 1NK6A 4YXMA 3QZ8A 2KZ3A 3K4GA 4GXJA 4DO9A 3ORYA 3PNCA 4DL3A 5ALLA 4RQNA 3EZ5A 4KX5A 2K60A 4O3RA 3QU7A 2EDUA 2ZUCA 1X6IA 3T3FA 5AK3A 5AKLA 3MR3A 5B66U 4CGZA 1V85A 4I2IA 4UB5A 1AROP 2LI6A 3MR5A 4F3OA 2XIDA 3KD3A 5AKYA 1DXSA 4B9TA 4I2CA 3M9NB 1ZD4A 2AGOA 3BS5B 1SV4A 5CWRA 2W9BA 1V97A 3Q8SB 1L5UA 4KLSA 1IG6A 2VA8A 2KN7A 4F92B 1N5WA 4RNOA 1VJ5A 2BDPA 2JEGA 1XSLA 3QUBA 4J9QA 3WKAA 4PJ0U 2LPEA 9ICKA 2AGQA 2RP5A 3WKCA 2V4RA 1L7PA 4F5QA 2NV3A 4MFCA 2C22A 1NKBA 1NKEA 3TI0A 1S0MA 5KFJA 2L5YA 1BPYA 5KFEA 3PMNA 9ICNA 5HHIA 1KFTA 3SV4A 4B9LA 2K4PA 1KQQA 1KN5A 2F8KA 1S10A 4O5EA 3UXOA 4F4YA 3RAQA 1S0OA 1KFSA 5AIAA 2AJQA 1K1SA 2HBMA 4MFFA 2JR5A 1DK2A 3T5KA 2W9CA 2FI1A 4NM2A 1X9WA 3WK6A 4IC9A 4DSIA 4PHEA 5KFCA 2ZXIA 2KZZA 4QZEA 5CB1A 5J2EA 1KRPA 3Q8MA 3PY8A 2IOHA 2K89A 4UB8U 2DBYA 2HBLA 4JMUA 2I6XA 3QYPA 3C29A 2C2RA 3HP6A 1QQ5A 5K4LA 4PL1A 5DG8A 2BPFA 3H8WA 3RJFA 1U47A 4F5PA 4ED8A 1A77A 3AMZA 2ZIXA 4F4XA 3LVVA 3B0YA 2BCRA 4EZ6A 4DFMA 3D2SA 2HBJA 2WB1C 4I27A 1KDHA 4NLKA 3GIIA 1TAMA 1KKXA 4PPXA 2W7OA 4YFKA 1VLBA 1SKRA 2KKPA 4MF8A 2B21A 5DDMA 2KJ9A 2I9GA 3QE9Y 1WUDA 3TKAA 3OHAA 2HOQA 2HBKA 1PVPA 3M9MB 1D8BA 4ELVA 4ED0A 1NK5A 1H38A 1S0VA 3ZDBA 4YP3A 2H3QA 4RPYA 4CRXA 4BDPA 4B6JA 4HYKA 2BQ3A 2HHSA 1TKDA 2XCPA 3SAHA 5KFAA 2H3VA 2FMSA 1ZD3A 2MU2A 8ICJA 3TQ1A 4Y2YA 2EAPA 7ICUA 2BGWA 2KIWA 1TV9A 1BPDA 3ZDCA 5ALTA 5CHGA 5J2BA 2WF8A 2KJ8A 2EANA 2XICA 2XY6A 2ZTEA 9ICPA 5J0UA 1IM4A 3GU3A 2ZIVB 4PZOA 4ELTA 3GIJA 2JZBB 4Y2TA 2W9MA 4ED7A 2P66A 2QB1A 4QIWF 3BS5A 4RT2A 2ISPA 3DV9A 3FDSA 3QNMA 4I2AA 5KG3A 3HPOA 4OJOA 4USAA 3F2CA 3PW2A 2G08A 9ICOA 4UB4A 4KMOB 4KLLA 3CYMA 2GH1A 3GV8B 4MF2A 4KLGA 2HI0A 3Q8QB 1FFVA 3THVA 5JU5A 2RQ5A 4M9LA 4QWDA 3RAXA 1NK4A 1PVQA 1SKWA 4Y2RA 5ALPA 2C28A 4YCXA 2BZFA 2XY5A 1AQ6A 4IR9A 5KT3A 2GLEA 5DLGA 3E2EA 8ICPA 3ICXA 3FYHA 4M47A 4Q8EA 2P6UA 2IHMA 4WJ3B 1N56A 1ZRMA 2KNJA 2VIXA 1LVHA 4DFJA 1ZQOA 3T5LA 3TFRA 2E3TA 2HHUA 3F2DA 4EBCA 4QWBA 1J2MA 4NXZA 5AM1A 2IMWP 1L7MA 3D2QA 1J97A 4KLJA 4BJQA 2UVRA 3QXGA 5DB7A 3RRGA 3KHRA 1OW5A 4DQPA 1RZTA 4M0AA 4G9BA 1FEZA 9ICXA 3GFKB 4YXJA 9ICMA 2IBKA 4E0DA 1L3TA 5DGBA 5KFVA 4ECWA 3A0HU 2RRDA 3SV3A 2DFLA 3PSIA 4DSKA 3C2KA 9ICWA 2F8LA 2RDJA 2E1EA 4UAYA 1RXVA 1QLNA 3LWLA 2FMQA 2R8KA 5EE3A 3ISDA 1DOQA 1KEJA 4BWMA 4RPXA 4NLBA 5J0TA 1K1QA 1ZQYA 1NI3A 3V7LA 4M04A 3T79A 1O03A 4DS5A 5DGAA 5KFFA 4P4PA 5BPCA 1RYSA 4F93B 8ICOA 4B9VA 1D8YA 2AXTU 7ICJA 2Y0SC 5D46A 1ZQPA 1NNLA 2PKEA 4Y2XA 4F4ZA 4DFPA 4QZHA 1TK8A 1D8LA 3F53A 3N7SC 4Z6CA 2LBOA 1T8EA 7ICKA 4IRDA 4FBTA 4ZOHC 1KLNA 2BPCA 4IQVA 3M8RA 1RQNA 1NJWA 2G09A 4GIBA 3WK9A 2ZIVA 3BZKA 3ZD9A 3Q8RB 3C2MA 4DL7A 1COOA 1ZQQA 4I2JA 5EWEA 3Q8PB 1ZQGA 2KFZA 2I5HA 2F77X 5J0SA 4US8A 5AK5A 3VCBA 3BDPA 3OSNA 2FMPA 3MFIA 2LYBA 3MGVA 5DG9A 2HHXA 1QQ7A 4UBCA 3LYSA 5HR6A 5AK6A 4XRHA 2ISOA 5H2FU 3WKBA 3PX0A 3RB4A 4QZGA 2NRTA 5AKIA 5ALOA 2K8CB 4KLTA 4ICAA 4RQ4A 3AN1A 3H0LB 1JX4A 3WKEA 2KMDA 5KFMA 3SI8A 5G5HA 1ZQSA 2FPMA 2PMZC 3MBYA 2EH9A 2PXIA 1ZQIA 3GV7B 3WU2U 3NVWA 3AQFA 3I76A 3RH6A 4UATA 5IIIA 4F71A 3Q8KA 3SAFA 4DSJA 3K75D 2J6TA 3N7RC 5L1KA 5HR7A 3C1ZA 3TFSA 3FC4A 3PR5B 2Y1JA 1WWVA 3GIKA 2KG5A 1NJYA 2W7PA 2LKYA 5J8YC 5DB8A 5ALUA 4Y2SA 3HKZF 4C7YA 2HDOA 5D4BA 5KFSA 3NRZA 3QU2A 1BNOA 1BPBA 4QZ9A 2W9AA 5KG5A 3KTQA 9ICLA 4P0PB 2JRZA 3C1YA 5ALEA 3IV6A 3N28A 5J2JA 5J2IA 7ICHA 2F1JA 2HOFA 4ECTA 4J03A 1NZBA 1WG8A 4DL5A 8ICMA 4UB6U 2W04A 4CNQA 4QZDA 1S5LU 3CP8A 2FLPA 2B0CA 4EYHB 5KL8B 5AI6A 4ECSA 3ETLA 5EWFA 5F9LA 3H8MA 4IRCA 7ICMA 3UMBA 5HHHA 1Q3UA 2K8BB 4JUZA 1Z1BA 1Z4OA 4LJXA 4O5CA 2ASLA 1ZQEA 1Z3EB 5ALKA 4J9SA 4GC7A 4EELA 3HRDD 4YR0A 4GXKA 1NKCA 5KG6A 1OUQA 4FZNA 5DBAA 2YN4A 2UVUA 3L5KA 4QZCA 4TUSA 4GFJA 1NK8A 4PGYA 3SD7A 2G5HB 7ICSA 1X2IA 2J6SA 1DRGA 4YQWA 4EZ9A 1Y88A 4KLOA 4OCZA 3SEIA 2ZJ8A 2KD1A 4Y2QA 2ZUDA 1BPXA 1CI4A 4JWNA 4KLUA 5ALYA 1IIPA 4UB1A 4LVSA 3RRHA 1JIHA 4P4MA 5E79U 4DSLA 2BCSA 1RM6C 3DDHA 2H3FA 2EZXA 1NK0A 1KBUA 5KT4A 4ED6A 3HW8A 4UAWA 2V4QA 2G5IB 2KIVA 3CRXA 2XCAA 4I2EA 5KFHA 2ES6A 4Q43A 4RT3A 3PZPA 1XO0A 5KG1A 2R8IA 1COKA 4YG2A 4BUGA 3BQTA 3SAGA 2PFOA 2OXOA 4EYIB 5L1IA 5ALIA 3DEEA 4M9GA 1RG6A 3NVVA 4OJPA 3KZIU 1U45A 3H7IA 5C5JA 3KBBA 4NV0A 5ALHA 3JPTA 3KOOA 4KN4A 3RB6A 4QZ8A 4O0IA 4O3NA 2VJ4A 3WK4A 8ICKA 4F5RA 2RDIA 3ISCA 4ECYA 4JK1A 4B9NA 1RYUA 2F76X 2K8AA 4EEKA 4GXIA 3IRUA 2Q0ZX 4DFDA 1YT3A 3UXNA 4P0PA 5DQHA 5KFOA 5AHXA 2YB4A 5J0YA 5J2DA 2RHFA 3C21A 5ALWA 2MUTA 3SYZA 1KW4A 7ICEA 2O6KA 2LMRA 2DPIA 3RJJA 5J2FA 2IA6A 3PW0A 2Y9TA 1ZRNA 5KNIA 4RZRA 4RQ0A 2QARB 3KKAC 1Z4NA 5AI5A 2HW3A 5DBBA 3NVYA 3KHGA 3V6HA 3R9KA 4FS2A 3RH4A 3GQCA 1ZQ1C 2F1HA 5KFYA 4I2HA 4XUSA 3RR8A 1N61A 2WF5A 3F5EA 2MA1A 3PVXA 1HUZA 5FP0A 3JPRA 2ALZA 4DWIA 3NRWA 5CR0A 4EBEA 2E8NA 1L3SA 9ICSA 1TAUA 4UW9A 5J0PA 5KT5A 4Y2PA 3MFHA 5IIKA 1ZD5A 4RQ1A 1S8OA 5G5GA 1T3NA 5AI4A 3PW7A 3BQ1A 4J9RA 1XWLA 3AQEA 2J6UA 5GTIU 4IR1A 4NM1A 1XC9A 5KFTA 2JEJA 5KFPA 2CN1A 1ZQTA 3FM9A 7ICLA 1X42A 4QZFA 1SL2A 4FS1A 4C4RA 5KFWA 3SR6A 4P4OA 1XSPA 4DS4A 1ZQAA 8ICSA 2WF6A 1SXEA 3QU9A 2OEHA 2QB0B 5ALGA 3FAHA 4YR3A 2JHDA 1IXRA 1NJZA 2R8GA 2W8LA 4BXOB 4DOAA 5KFGA 4J9PA 4JB3A 4RNMA 1S97A 4DOBA 4I2BA 5AI9A 2W03A 8ICCA 3I1YA 2YB1A 1NK7A 1DGJA 2IOFA 5AM3A 4PGXA 5AM5A 1A6SA 1QSSA 2E8PA 3WKDA 2HSZA 2W8KA 1L7OA 4PZNA 2Q4TA 1QH9A 3TANA 2PI4A 3N4MB 4OJLA 5KL1B 2BHNA 4LZGA 2F44A 4C8NA 8ICLA 3TARA 1S76D 5ALFA 3G6XA 5KG7A 4C80A 4M9JA 3WK7A 4DEZA 2NRVA 3RTVA 1SZHA 4KLMA 1T4GA 4JV0A 4OJ5A 1SWWA 1ZQBA 5KFLA 4I2FA 4DOCA 3E58A 4LZDA 4KX3A 4ECXA 3QEBZ 3NASA 7ICPA 7ICTA 4XA5A 2HHVA 3RJEA 2LHTA 3QUQA 4IQUA 3OHBA 3QU5A 2VKQA 2OCEA 4O3PA 1FIQA 4AYBC 5J2KA 2H5XA 2E8OA 4K4IA 8ICGA 4NLZA 3LVWA 5ALRA 2QARA 1JRPA 5AM2A 1SL1A 1KL9A 3HJEA 3ZDAA 4DQIA 3GV5B 8ICEA 2ZTDA 4CF3A 1LV5A 1B0XA 3BJYA 3PSFA 1KSPA 1SGGA 2Y0SF 2OYYA 3NTUA 5D49A 1ZQWA 5KFXA 4C8KA 1SL0A 1KFDA 2MAXA 3PO4A 3RFAA 5BOLA 2KK0A 1Z19A 1MN8A 1X9XA 2IHNA 4I29A 3H0RB 4DLGA 1ZQJA 4DF8A 1ZQLA 1MQ3A 2KP7A 4FO6A 2BPGA 3NGDA 1ZD2P 3HX0A 4RQ7A 2M0NA 1Q46A 4KN7A 2FE9A 4QZAA 2XVTA 4FZLA 1UT5A 2EQYA 1EXNA 3BQ2A 4CF5A 2VA3A 9ICIA 4FFDA 1B43A 5DQGA 5C0YA 2EAMA 5KFZA 1QSLA 2WF7A 4CE6A 4YMMA 2ASDA 1Z1VA 1X9MA 2ZIWB 2NRXA 4R64A 4Z6FA 1ZQVA 3IG5A 1S9FA 4YR2A 2HOIA 5KFBA 4GLXA 2AGPA 2N1RA 2KTQA 5L1MA 4NLNA 3SENA 1WWUA 4A8EA 3MGIA 4I2GA 1V38A 4R66A 5BOMA 3PMLA 4ED1A 5ALSA 3RBDA 2QB0A 5KFUA 3M1YA 4OD0A 2DWQA 1ZXIA 2WFAA 2BCQA 4BXOA 2PMZF 1U48A 1SZPA 2KSOA 2LYHA 3UM9A 1PZNA 1XS9D 9ICAA 4KITB 2D8CA 3RH5A 4C7ZA 3SQIA 3GDXA 5DG7A 4K4GA 3G6VA 1RPLA 5J0XA 1ZQHA 4C0ZA 4KLHA 5ALZA 4UBBA 2EAOA 3J81j 3B9JA 2BDUA 1QQ6A 5GTHU 2QKQA 3KHHA 4G3IA 2HVHA 1ZQMA 3NS1A 2H3ZA 3WK5A 1D9DA 4P0QB 5ALQA 4ED3A 5CEHA 8ICRA 4F2RA 4MEYA 2DUYA 4BX9C 4U7CA 1RQLA 1V9PA 2KICA 4QWCA 3CNHA 1PK1B 2A1AA 4EBDA 1ZQCA 1D9FA 1GO3F 2WAQC 4F5NA 2UVVA 3QEAZ 2NRZA 2VJ5A 1TE2A 2D6FC 4HAIA 1LB2B 3F2BA 2XY7A 3M6ZA 3E0FA 3MDAA 3V6KA 2BKEA 5CA7A 4QNLA 4DSFA 5AKKA 4Z6EA 4EEYA 5AM4A 5AM0A 3MGHA 2BR0A 1ZJNA 3HWTA 2Z7JA 3PX6A 2D3DA 4BWJA 2ZJ5A 4UAVA 3TACB 4TUPA 2UVWA 3SZ2A 1S77D 2AH5A 4ELUA 5F9NA 4NL9C 9ICQA 5J2HA 2MUTB 5EOZA 2KOBA 2FJ6A 4ACOA 3V6JA 3OTQA 4CDGA 5JUMA 4QJFB 4ECVA 3AM9A 3ZI4A 3B0XA 3SMVA 1UA0A 2W43A 1JXLA 3OJUA 9ICTA 1U4BA 4DL6A 4O5KA 5KAFU 3S6JA 8ICAA 2XO7A 4DL2A 5AI0A 7ICVA 4KLEA 2JEIA 1JROA 4OJ6A 1M6YA 4UARA 4Y2JA 2ZJAA 1KTQA 1FFUA 4MHVA 4J9KA 2F2AB 5J0WA 2ZIUB 1YZ6A 4TQSA 9ICFA 2A19A 9ICJA 2H3IA 2YY6A 4DFKA 4KLIA 7ICIA 3Q8LA 3AU6A 4Q8FA 5KFQA 3KHLA 4RU9A 5J0OA 1X66A 5DB9A 3M8SA 3RJKA 2Y1IA 1XNSA 4JV2A 2OM6A 3TAQA 2OHFA 2W11A 2ZIWA 2JGAA 2YMPA 5IIMA 2W3SA 2FPKA 5J0QA 3V7KA 3TADC 1F0MA 4P2HA 2GO7A 5A0LA 2LM1A 4KLFA 2WF9A 5CJ7A 2HHQA 2CPRA 4GC6A 1UQVA 2MRLA 1JXEA 4M6WB 9ICVA 5KT6A 3IG8A 4RPZA 3GILA 4Q44A 3BQ0A 4J9NA 1XSNA 4DQRA 3H4DA 1L6NA 1BNPA 2JXJA 5AKZA 3O0FA 3LDAA 2HHWA 4QZBA 4F4KA 5DQIA 5ALJA 5EE1A 1L3VA 1ZQFA 3M7DA 3C5GA 8ICUA 5AKXA 2XGPA 1ZQUA 4ZH4A 3MC1A 3JPPA 5HMLA 4P0QA 2ZTCA 3BS7A 4F50A 4XQ8A 1PK1A 3H0MB 3UMGA 2R8JA 1X9SA 4RQ3A 4O3MA 5KAIU 3C23A 1SV0C 3MR6A 3KKAA 3OSPA 2ATLA 4KLQA 4KLDA 3TAPA 4BGDA 4EX6A 3WK8A 1Z00A 1TVAA 1TK0A 3QZ7A 3QU4A 4MEXA 3H8SA 4NLGA 1CRXA 2E1FA 5KT2A 4IQWA 1JI7A 7ICQA 8ICXA 1YZ7A 2G06A 3MR2A 2IOFK 1UCVA 1PUZA 3PO5A 3JPNA 2B6GA 2WB1F 3JPOA 1UA1A 5L1JA 4B9SA 3PW5A 2FDRA 1N2XA 2JH1A 3EUB2 5KG0A 3LWMA 1NJXA 3QUCA 3BZCA 4F91B 1K5OA 4DL4A 5HNKA 2F3NA 3GIMA 2FPLA 3EWAA 4Y2VA 4EENA 4US9A 3K1RB 4DQSA 7ICGA 5EE9A 1ZETA 3RR7A 1F44A 1JUDA 4O3QA 2ZIUA 1NZPA 7ICFA 1QTMA 3EPGA 8ICZA 2Y9UA 5CP2A 5ALVA 4TQRA 3RJGA 3QX7A 1Q8KA 4YMOA 2C2EA 2GOLA 3CW2C 2M9NA 3D6JA 5DB6A 2YMQA 4C4SA 1X40A 1QCKA 2I1QA 4J9OA 2YMMA 1N5XA 4KMUA 7ICNA 2R18A 3ZDDA 4O3SA 5CRXA 4PL2A 1UT8A 8ICBA 1ZQNA 4M9NA 3BQ7A 1U49A 4B9MA 2K4IA 3N97B 4IRKA 4Q45A 5L1LA 9ICGA 2YMLA 1HJPA 4IQTA 2DF4B 4M6WA 5AI8A 5IILA 3HT3A 2CXYA 5EE0A 1SWVA 1B22A 3D2NA 4F4WA 3IHQB 1WYGA 4QW8A 2LM4A 3AUOA 2JMGA 2XGQA 3UXPA 4TUQA 3L3FX 2KSOB 5J0RA 8ICWA 1TAQA 2KE7A 3H40A 3GZFA 2OH2A 2PFPA 4UAZA 4Y2UA 4K4HA 1NOMA 4C8MA 2CRXA 8ICHA 3ED5A 2G07A 2KV2A 2BCUA 1A76A 2RLTA 4QWEA 5KFKA 9ICRA 2ESEA 2DKXA 4RUCA 4I2DA 4M2YA 1Q3VA 4PH5A 5J29A 4RQ2A 4DLEA 1J2NA 3A0BU 1N48A 5J2AA 5HP4A 4RQMA 1P7DA 2G0AA 1X6JA 4AYBF 2QLTA 9ICCA 3EYZA 1N63A 2EZYA 1ZQXA 4Z6DA 4EX7A 5F3XB 4QWAA 3RB3A 1B4FA 4ECQA 2DPJA 3H8JA 5AKEA 5L9XA 3F5AA 4IS7A 4ECUA 1XU4A 8ICTA 5DDYA 5J2GA 5IIJA 1HEKA 2DQNB 5KFDA 1ZYQA 4YMNA 4QIWC 1T3QA 9ICHA 2E5SA 3N7PD 2A1JB 4KTQA 5TISU 2DKZA 2E8MA 8ICIA
chains in the Genus database with same CATH topology
1IIPA 2Y0SF 2E1FA 2WAQF 2OYYA 1CRXA 3D2SA 1HIWA 2HBJA 2WB1C 5T14A 2W7PA 2LKYA 2A3VA 4BX9C 4U7CA 1XNSA 3ALRA 1TAMA 2DF4B 2KICA 2OM6A 3HKZF 2W7OA 2G06A 2KEYA 3C28A 3RFAA 2YX8A 2KKPA 2W03A 1Z19A 3ICXA 2ZIWA 2Y0SC 1GO3F 2WAQC 2YB1A 1A0PA 1T94A 2JGAA 2VJ5A 3D2NA 4P0PB 3H0RB 2D6FC 2WB1F 2H3FA 2KJ9A 3KZXA 1KBUA 3HKZC 2JMGA 2K4HA 1WUDA 3F2BA 1A6SA 3M6ZA 2ZIXB 2G5IB 3F53A 3E0FA 3N7SC 1ZQ1C 2HOQA 2HOFA 2HBKA 1PVPA 4WJ3B 2KHQA 5A0LA 3CRXA 3L3FX 2LBOA 2JH1A 2Q4TA 4QNLA 2M0NA 1NZBA 2RP5A 1D8BA 2XVTA 1URJA 3F5EA 4FZLA 2KHVA 2KNJA 2W04A 2NV3A 2MA1A 3CP8A 4FZMA 4OJLA 3PZPA 2VIXA 1XO0A 5KL1B 2Z7JA 3GZFA 2H3QA 2OH2A 2CPRA 4BUGA 5KL8B 4OO1J 2G09A 2MRLA 4CRXA 4NLCA 2ZIVA 3NRWA 2KJ5A 5C0YA 3F2DA 3SAGA 1UPHA 3IG8A 2OXOA 2CRXA 3SAHA 2ZIWB 2G07A 2F77X 3PSPA 2H3VA 3IG5A 2KV2A 3VCBA 1Q3UA 2K8BB 3DEEA 1Z1BA 1L6NA 2LYBA 3MGVA 1ED1A 1F44A 2HBMA 4OJPA 2DGZA 2HOIA 2ZIUA 3O0FA 3M6KA 2KOBA 1SZHA 3D2QA 3LYSA 2N1RA 1Q3VA 3IP4B 4FE3A 4ACOA 4NV0A 2KIWA 3RF9A 5HR6A 4OJ5A 4A8EA 4BJQA 4CDGA 4IC9A 3AQEA 4QJFB 4NWIA 2KJ8A 2LYAA 1P7DA 2G0AA 4KX3A 3NUQA 4AYBF 2VJ4A 2KVCA 2JH7A 2K4EA 2XICA 2ZXIA 3M7DA 3PSTA 3SMVA 3IN5A 1OUQA 2HMXA 4FZNA 2LHTA 2K8CB 3VC8A 2CN1A 2ZG6A 2PMZF 2K89A 3GU3A 4P0QA 2ZIVB 1MA7A 2HBLA 2VKQA 3OPXA 1ECWA 4ICAA 2GOLA 4JMUA 3K1ZA 3ONNA 1PVRA 4AYBC 3H0LB 2K8AA 2F76X 3C29A 2RRDA 4OJ6A 3SQIA 3PSIA 4QIWF 4GFJA 3F5AA 2ZXHA 3LVWA 4PL1A 2PMZC 3H0MB 2F8LA 1YT3A 2E1EA 4KX5A 2G5HB 2F2AB 2ZIUB 4OJOA 1HEKA 3KFUF 4P0PA 3F2CA 3AQFA 2DQNB 1DRGA 2G08A 4O3MA 3AL0B 4C0ZA 4CGZA 2R18A 2H3IA 2YB4A 4QIWC 4KMOB 2E5SA 2RHFA 2ZIXA 2GH1A 3CYMA 4NLBA 4PL2A 5CRXA 3LVVA 3SAFA 2KD1A 3N7PD 2BDUA 2JHDA 3N7RC 2XIDA 5HR7A 1PVQA 2XI9A 2KKVA 4U6PA 3T79A 3PSFA 2H3ZA 4P0QB 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HIW A;  2N1R A;  2NV3 A;  1TAM A;  1HEK A;  4IC9 A;  2H3Q A;  2LYA A;  2K4E A;  2H3I A;  1UPH A;  2HMX A;  2H3F A;  4ICA A;  2JMG A;  1ECW A;  2H3V A;  2K4H A;  1A6S A;  2GOL A;  4JMU A;  1L6N A;  2H3Z A;  2LYB A;  1ED1 A;  2K4I A; 
#chains in the Genus database with same CATH topology
 1HIW A;  5KG4 A;  2A3V A;  4R63 A;  4FBU A;  5J2C A;  3EW9 A;  4QZI A;  2KEY A;  3C28 A;  2YX8 A;  4UQG A;  2DL0 A;  4RQ5 A;  1T94 A;  3JPQ A;  2FLN A;  3UQ0 A;  4I28 A;  4QW9 A;  1LKY B;  1SB3 C;  3MDC A;  4F72 A;  4PHD A;  4RNN A;  2BQU A;  4RQ8 A;  1URJ A;  4FZM A;  3UPQ A;  1F5S A;  2AQ0 A;  1O08 A;  4NJ8 A;  2HHT A;  4OO1 J;  4R8U B;  5HMM A;  3T5J A;  2KJ5 A;  2HVI A;  1UPH A;  4IL6 U;  1RXW A;  4TUR A;  3G6Y A;  5IIO A;  5KT7 A;  1WCL A;  5ALD A;  4F2S A;  3V7J A;  3JPS A;  4C8L A;  3IP4 B;  2PI5 A;  9ICE A;  3RF9 A;  4O3O A;  2PFQ A;  4DF4 A;  4CF4 A;  1U9L A;  5AKJ A;  4YVZ A;  2YQE A;  2KVC A;  2JH7 A;  2K4E A;  3PST A;  2AHO B;  1L7N A;  4CCH A;  2HMX A;  4AP9 A;  3T5H A;  3MAB A;  1PK3 A;  1BPZ A;  5ALM A;  3K1Z A;  2ASJ A;  1OXJ A;  7ICR A;  4DCC A;  1SXD A;  4J9M A;  1MSW D;  2ZXH A;  3PW4 A;  5KFI A;  5AK4 A;  5DKW A;  2OWO A;  1SIJ A;  3KFU F;  1BPE A;  3AL0 B;  3HIL A;  5KFN A;  3UQ2 A;  3ZDE A;  3RJI A;  2HCF A;  3AEV A;  2V9W A;  2XI9 A;  2KKV A;  1ZQZ A;  2EZZ A;  2F1I A;  2WAQ F;  5T14 A;  3ALR A;  2GWS A;  5J8Y A;  1RDF A;  4RQ6 A;  1DK3 A;  4JV1 A;  2JZB A;  4J9L A;  2BCV A;  4UB3 A;  2JV3 A;  3KZX A;  4NY8 A;  2K4H A;  2R8H A;  5KTQ A;  4NL9 A;  1L8O A;  3C5F A;  2KVS A;  3PV8 A;  4JWM A;  1MC8 A;  2KHV A;  2NO5 A;  2P6R A;  5IIN A;  2VA2 A;  5AKG A;  3PX4 A;  1L3U A;  4UB2 A;  2VAN A;  1BGX T;  3RBE A;  4C4T A;  1SKS A;  3C2L A;  2W9B B;  2NYV A;  2W3R A;  5AIB A;  5EWG A;  1NK9 A;  3IDW A;  3ETR A;  2DGZ A;  1Z00 B;  1JAL A;  2P35 A;  1ZOL A;  4ECZ A;  4FE3 A;  1HUO A;  4R65 A;  1CUK A;  4NWI A;  2LYA A;  2A1J A;  5KG2 A;  5B5E U;  5DLF A;  5AKH A;  4PHA A;  2W54 A;  4UAS A;  2ZG6 A;  1T7P A;  1MA7 A;  3I28 A;  1RYR A;  3ONN A;  1PVR A;  4DSE A;  2NRW A;  1ZJM A;  7ICO A;  2WHE A;  2FLL A;  4UAU A;  2PFN A;  4MFA A;  1C7Y A;  3OJS A;  1N60 A;  4X5V A;  2W9C B;  1WCN A;  3RJH A;  1L8L A;  4YD2 A;  3V72 A;  4DQQ A;  2MSN A;  1LKY A;  4ED2 A;  3LK9 A;  3TAD A;  4U6P A;  1ZQR A;  3UMC A;  4C8O A;  1VDV A;  1IV8 A;  4R8U A;  2KFN A;  3PR4 A;  4M9H A;  1JMS A;  2WTF A;  5ALX A;  1BVS A;  2W55 A;  5ALN A;  1A0P A;  8ICF A;  4B9U A;  1ZQK A;  3EPI A;  8ICV A;  4PGQ A;  4ECR A;  1TFR A;  3HKZ C;  2XC9 A;  4F5O A;  2ZIX B;  8ICN A;  2JEF A;  5DBC A;  2KHQ A;  3AU2 A;  2YTU A;  2BQR A;  1MQ2 A;  4O9M A;  9ICU A;  2NO4 A;  3IM1 A;  3ZD8 A;  1JN3 A;  1UHU A;  1C20 A;  2KZM A;  4NLC A;  1DGS A;  1XO1 A;  4YD1 A;  1FO4 A;  1ZQD A;  3PSP A;  3OGU A;  3U26 A;  2AQ4 A;  5JRT A;  3M9O B;  5TZV A;  1ED1 A;  9ICB A;  3NVZ A;  8ICY A;  3M6K A;  5AIC A;  4PHP A;  4YN4 A;  2AU0 A;  1N62 A;  1CEZ A;  3H4B A;  3L4P A;  3QUT A;  3RB0 A;  3NUQ A;  4RUA A;  2C2D A;  1SV0 A;  3IN5 A;  3ISB A;  2ZUB A;  5JTI A;  3VC8 A;  1QSY A;  5KFR A;  1S0N A;  8ICQ A;  3OPX A;  1ECW A;  1TK5 A;  2ODG A;  4F8R A;  1NK6 A;  4YXM A;  3QZ8 A;  2KZ3 A;  3K4G A;  4GXJ A;  4DO9 A;  3ORY A;  3PNC A;  4DL3 A;  5ALL A;  4RQN A;  3EZ5 A;  4KX5 A;  2K60 A;  4O3R A;  3QU7 A;  2EDU A;  2ZUC A;  1X6I A;  3T3F A;  5AK3 A;  5AKL A;  3MR3 A;  5B66 U;  4CGZ A;  1V85 A;  4I2I A;  4UB5 A;  1ARO P;  2LI6 A;  3MR5 A;  4F3O A;  2XID A;  3KD3 A;  5AKY A;  1DXS A;  4B9T A;  4I2C A;  3M9N B;  1ZD4 A;  2AGO A;  3BS5 B;  1SV4 A;  5CWR A;  2W9B A;  1V97 A;  3Q8S B;  1L5U A;  4KLS A;  1IG6 A;  2VA8 A;  2KN7 A;  4F92 B;  1N5W A;  4RNO A;  1VJ5 A;  2BDP A;  2JEG A;  1XSL A;  3QUB A;  4J9Q A;  3WKA A;  4PJ0 U;  2LPE A;  9ICK A;  2AGQ A;  2RP5 A;  3WKC A;  2V4R A;  1L7P A;  4F5Q A;  2NV3 A;  4MFC A;  2C22 A;  1NKB A;  1NKE A;  3TI0 A;  1S0M A;  5KFJ A;  2L5Y A;  1BPY A;  5KFE A;  3PMN A;  9ICN A;  5HHI A;  1KFT A;  3SV4 A;  4B9L A;  2K4P A;  1KQQ A;  1KN5 A;  2F8K A;  1S10 A;  4O5E A;  3UXO A;  4F4Y A;  3RAQ A;  1S0O A;  1KFS A;  5AIA A;  2AJQ A;  1K1S A;  2HBM A;  4MFF A;  2JR5 A;  1DK2 A;  3T5K A;  2W9C A;  2FI1 A;  4NM2 A;  1X9W A;  3WK6 A;  4IC9 A;  4DSI A;  4PHE A;  5KFC A;  2ZXI A;  2KZZ A;  4QZE A;  5CB1 A;  5J2E A;  1KRP A;  3Q8M A;  3PY8 A;  2IOH A;  2K89 A;  4UB8 U;  2DBY A;  2HBL A;  4JMU A;  2I6X A;  3QYP A;  3C29 A;  2C2R A;  3HP6 A;  1QQ5 A;  5K4L A;  4PL1 A;  5DG8 A;  2BPF A;  3H8W A;  3RJF A;  1U47 A;  4F5P A;  4ED8 A;  1A77 A;  3AMZ A;  2ZIX A;  4F4X A;  3LVV A;  3B0Y A;  2BCR A;  4EZ6 A;  4DFM A;  3D2S A;  2HBJ A;  2WB1 C;  4I27 A;  1KDH A;  4NLK A;  3GII A;  1TAM A;  1KKX A;  4PPX A;  2W7O A;  4YFK A;  1VLB A;  1SKR A;  2KKP A;  4MF8 A;  2B21 A;  5DDM A;  2KJ9 A;  2I9G A;  3QE9 Y;  1WUD A;  3TKA A;  3OHA A;  2HOQ A;  2HBK A;  1PVP A;  3M9M B;  1D8B A;  4ELV A;  4ED0 A;  1NK5 A;  1H38 A;  1S0V A;  3ZDB A;  4YP3 A;  2H3Q A;  4RPY A;  4CRX A;  4BDP A;  4B6J A;  4HYK A;  2BQ3 A;  2HHS A;  1TKD A;  2XCP A;  3SAH A;  5KFA A;  2H3V A;  2FMS A;  1ZD3 A;  2MU2 A;  8ICJ A;  3TQ1 A;  4Y2Y A;  2EAP A;  7ICU A;  2BGW A;  2KIW A;  1TV9 A;  1BPD A;  3ZDC A;  5ALT A;  5CHG A;  5J2B A;  2WF8 A;  2KJ8 A;  2EAN A;  2XIC A;  2XY6 A;  2ZTE A;  9ICP A;  5J0U A;  1IM4 A;  3GU3 A;  2ZIV B;  4PZO A;  4ELT A;  3GIJ A;  2JZB B;  4Y2T A;  2W9M A;  4ED7 A;  2P66 A;  2QB1 A;  4QIW F;  3BS5 A;  4RT2 A;  2ISP A;  3DV9 A;  3FDS A;  3QNM A;  4I2A A;  5KG3 A;  3HPO A;  4OJO A;  4USA A;  3F2C A;  3PW2 A;  2G08 A;  9ICO A;  4UB4 A;  4KMO B;  4KLL A;  3CYM A;  2GH1 A;  3GV8 B;  4MF2 A;  4KLG A;  2HI0 A;  3Q8Q B;  1FFV A;  3THV A;  5JU5 A;  2RQ5 A;  4M9L A;  4QWD A;  3RAX A;  1NK4 A;  1PVQ A;  1SKW A;  4Y2R A;  5ALP A;  2C28 A;  4YCX A;  2BZF A;  2XY5 A;  1AQ6 A;  4IR9 A;  5KT3 A;  2GLE A;  5DLG A;  3E2E A;  8ICP A;  3ICX A;  3FYH A;  4M47 A;  4Q8E A;  2P6U A;  2IHM A;  4WJ3 B;  1N56 A;  1ZRM A;  2KNJ A;  2VIX A;  1LVH A;  4DFJ A;  1ZQO A;  3T5L A;  3TFR A;  2E3T A;  2HHU A;  3F2D A;  4EBC A;  4QWB A;  1J2M A;  4NXZ A;  5AM1 A;  2IMW P;  1L7M A;  3D2Q A;  1J97 A;  4KLJ A;  4BJQ A;  2UVR A;  3QXG A;  5DB7 A;  3RRG A;  3KHR A;  1OW5 A;  4DQP A;  1RZT A;  4M0A A;  4G9B A;  1FEZ A;  9ICX A;  3GFK B;  4YXJ A;  9ICM A;  2IBK A;  4E0D A;  1L3T A;  5DGB A;  5KFV A;  4ECW A;  3A0H U;  2RRD A;  3SV3 A;  2DFL A;  3PSI A;  4DSK A;  3C2K A;  9ICW A;  2F8L A;  2RDJ A;  2E1E A;  4UAY A;  1RXV A;  1QLN A;  3LWL A;  2FMQ A;  2R8K A;  5EE3 A;  3ISD A;  1DOQ A;  1KEJ A;  4BWM A;  4RPX A;  4NLB A;  5J0T A;  1K1Q A;  1ZQY A;  1NI3 A;  3V7L A;  4M04 A;  3T79 A;  1O03 A;  4DS5 A;  5DGA A;  5KFF A;  4P4P A;  5BPC A;  1RYS A;  4F93 B;  8ICO A;  4B9V A;  1D8Y A;  2AXT U;  7ICJ A;  2Y0S C;  5D46 A;  1ZQP A;  1NNL A;  2PKE A;  4Y2X A;  4F4Z A;  4DFP A;  4QZH A;  1TK8 A;  1D8L A;  3F53 A;  3N7S C;  4Z6C A;  2LBO A;  1T8E A;  7ICK A;  4IRD A;  4FBT A;  4ZOH C;  1KLN A;  2BPC A;  4IQV A;  3M8R A;  1RQN A;  1NJW A;  2G09 A;  4GIB A;  3WK9 A;  2ZIV A;  3BZK A;  3ZD9 A;  3Q8R B;  3C2M A;  4DL7 A;  1COO A;  1ZQQ A;  4I2J A;  5EWE A;  3Q8P B;  1ZQG A;  2KFZ A;  2I5H A;  2F77 X;  5J0S A;  4US8 A;  5AK5 A;  3VCB A;  3BDP A;  3OSN A;  2FMP A;  3MFI A;  2LYB A;  3MGV A;  5DG9 A;  2HHX A;  1QQ7 A;  4UBC A;  3LYS A;  5HR6 A;  5AK6 A;  4XRH A;  2ISO A;  5H2F U;  3WKB A;  3PX0 A;  3RB4 A;  4QZG A;  2NRT A;  5AKI A;  5ALO A;  2K8C B;  4KLT A;  4ICA A;  4RQ4 A;  3AN1 A;  3H0L B;  1JX4 A;  3WKE A;  2KMD A;  5KFM A;  3SI8 A;  5G5H A;  1ZQS A;  2FPM A;  2PMZ C;  3MBY A;  2EH9 A;  2PXI A;  1ZQI A;  3GV7 B;  3WU2 U;  3NVW A;  3AQF A;  3I76 A;  3RH6 A;  4UAT A;  5III A;  4F71 A;  3Q8K A;  3SAF A;  4DSJ A;  3K75 D;  2J6T A;  3N7R C;  5L1K A;  5HR7 A;  3C1Z A;  3TFS A;  3FC4 A;  3PR5 B;  2Y1J A;  1WWV A;  3GIK A;  2KG5 A;  1NJY A;  2W7P A;  2LKY A;  5J8Y C;  5DB8 A;  5ALU A;  4Y2S A;  3HKZ F;  4C7Y A;  2HDO A;  5D4B A;  5KFS A;  3NRZ A;  3QU2 A;  1BNO A;  1BPB A;  4QZ9 A;  2W9A A;  5KG5 A;  3KTQ A;  9ICL A;  4P0P B;  2JRZ A;  3C1Y A;  5ALE A;  3IV6 A;  3N28 A;  5J2J A;  5J2I A;  7ICH A;  2F1J A;  2HOF A;  4ECT A;  4J03 A;  1NZB A;  1WG8 A;  4DL5 A;  8ICM A;  4UB6 U;  2W04 A;  4CNQ A;  4QZD A;  1S5L U;  3CP8 A;  2FLP A;  2B0C A;  4EYH B;  5KL8 B;  5AI6 A;  4ECS A;  3ETL A;  5EWF A;  5F9L A;  3H8M A;  4IRC A;  7ICM A;  3UMB A;  5HHH A;  1Q3U A;  2K8B B;  4JUZ A;  1Z1B A;  1Z4O A;  4LJX A;  4O5C A;  2ASL A;  1ZQE A;  1Z3E B;  5ALK A;  4J9S A;  4GC7 A;  4EEL A;  3HRD D;  4YR0 A;  4GXK A;  1NKC A;  5KG6 A;  1OUQ A;  4FZN A;  5DBA A;  2YN4 A;  2UVU A;  3L5K A;  4QZC A;  4TUS A;  4GFJ A;  1NK8 A;  4PGY A;  3SD7 A;  2G5H B;  7ICS A;  1X2I A;  2J6S A;  1DRG A;  4YQW A;  4EZ9 A;  1Y88 A;  4KLO A;  4OCZ A;  3SEI A;  2ZJ8 A;  2KD1 A;  4Y2Q A;  2ZUD A;  1BPX A;  1CI4 A;  4JWN A;  4KLU A;  5ALY A;  1IIP A;  4UB1 A;  4LVS A;  3RRH A;  1JIH A;  4P4M A;  5E79 U;  4DSL A;  2BCS A;  1RM6 C;  3DDH A;  2H3F A;  2EZX A;  1NK0 A;  1KBU A;  5KT4 A;  4ED6 A;  3HW8 A;  4UAW A;  2V4Q A;  2G5I B;  2KIV A;  3CRX A;  2XCA A;  4I2E A;  5KFH A;  2ES6 A;  4Q43 A;  4RT3 A;  3PZP A;  1XO0 A;  5KG1 A;  2R8I A;  1COK A;  4YG2 A;  4BUG A;  3BQT A;  3SAG A;  2PFO A;  2OXO A;  4EYI B;  5L1I A;  5ALI A;  3DEE A;  4M9G A;  1RG6 A;  3NVV A;  4OJP A;  3KZI U;  1U45 A;  3H7I A;  5C5J A;  3KBB A;  4NV0 A;  5ALH A;  3JPT A;  3KOO A;  4KN4 A;  3RB6 A;  4QZ8 A;  4O0I A;  4O3N A;  2VJ4 A;  3WK4 A;  8ICK A;  4F5R A;  2RDI A;  3ISC A;  4ECY A;  4JK1 A;  4B9N A;  1RYU A;  2F76 X;  2K8A A;  4EEK A;  4GXI A;  3IRU A;  2Q0Z X;  4DFD A;  1YT3 A;  3UXN A;  4P0P A;  5DQH A;  5KFO A;  5AHX A;  2YB4 A;  5J0Y A;  5J2D A;  2RHF A;  3C21 A;  5ALW A;  2MUT A;  3SYZ A;  1KW4 A;  7ICE A;  2O6K A;  2LMR A;  2DPI A;  3RJJ A;  5J2F A;  2IA6 A;  3PW0 A;  2Y9T A;  1ZRN A;  5KNI A;  4RZR A;  4RQ0 A;  2QAR B;  3KKA C;  1Z4N A;  5AI5 A;  2HW3 A;  5DBB A;  3NVY A;  3KHG A;  3V6H A;  3R9K A;  4FS2 A;  3RH4 A;  3GQC A;  1ZQ1 C;  2F1H A;  5KFY A;  4I2H A;  4XUS A;  3RR8 A;  1N61 A;  2WF5 A;  3F5E A;  2MA1 A;  3PVX A;  1HUZ A;  5FP0 A;  3JPR A;  2ALZ A;  4DWI A;  3NRW A;  5CR0 A;  4EBE A;  2E8N A;  1L3S A;  9ICS A;  1TAU A;  4UW9 A;  5J0P A;  5KT5 A;  4Y2P A;  3MFH A;  5IIK A;  1ZD5 A;  4RQ1 A;  1S8O A;  5G5G A;  1T3N A;  5AI4 A;  3PW7 A;  3BQ1 A;  4J9R A;  1XWL A;  3AQE A;  2J6U A;  5GTI U;  4IR1 A;  4NM1 A;  1XC9 A;  5KFT A;  2JEJ A;  5KFP A;  2CN1 A;  1ZQT A;  3FM9 A;  7ICL A;  1X42 A;  4QZF A;  1SL2 A;  4FS1 A;  4C4R A;  5KFW A;  3SR6 A;  4P4O A;  1XSP A;  4DS4 A;  1ZQA A;  8ICS A;  2WF6 A;  1SXE A;  3QU9 A;  2OEH A;  2QB0 B;  5ALG A;  3FAH A;  4YR3 A;  2JHD A;  1IXR A;  1NJZ A;  2R8G A;  2W8L A;  4BXO B;  4DOA A;  5KFG A;  4J9P A;  4JB3 A;  4RNM A;  1S97 A;  4DOB A;  4I2B A;  5AI9 A;  2W03 A;  8ICC A;  3I1Y A;  2YB1 A;  1NK7 A;  1DGJ A;  2IOF A;  5AM3 A;  4PGX A;  5AM5 A;  1A6S A;  1QSS A;  2E8P A;  3WKD A;  2HSZ A;  2W8K A;  1L7O A;  4PZN A;  2Q4T A;  1QH9 A;  3TAN A;  2PI4 A;  3N4M B;  4OJL A;  5KL1 B;  2BHN A;  4LZG A;  2F44 A;  4C8N A;  8ICL A;  3TAR A;  1S76 D;  5ALF A;  3G6X A;  5KG7 A;  4C80 A;  4M9J A;  3WK7 A;  4DEZ A;  2NRV A;  3RTV A;  1SZH A;  4KLM A;  1T4G A;  4JV0 A;  4OJ5 A;  1SWW A;  1ZQB A;  5KFL A;  4I2F A;  4DOC A;  3E58 A;  4LZD A;  4KX3 A;  4ECX A;  3QEB Z;  3NAS A;  7ICP A;  7ICT A;  4XA5 A;  2HHV A;  3RJE A;  2LHT A;  3QUQ A;  4IQU A;  3OHB A;  3QU5 A;  2VKQ A;  2OCE A;  4O3P A;  1FIQ A;  4AYB C;  5J2K A;  2H5X A;  2E8O A;  4K4I A;  8ICG A;  4NLZ A;  3LVW A;  5ALR A;  2QAR A;  1JRP A;  5AM2 A;  1SL1 A;  1KL9 A;  3HJE A;  3ZDA A;  4DQI A;  3GV5 B;  8ICE A;  2ZTD A;  4CF3 A;  1LV5 A;  1B0X A;  3BJY A;  3PSF A;  1KSP A;  1SGG A;  2Y0S F;  2OYY A;  3NTU A;  5D49 A;  1ZQW A;  5KFX A;  4C8K A;  1SL0 A;  1KFD A;  2MAX A;  3PO4 A;  3RFA A;  5BOL A;  2KK0 A;  1Z19 A;  1MN8 A;  1X9X A;  2IHN A;  4I29 A;  3H0R B;  4DLG A;  1ZQJ A;  4DF8 A;  1ZQL A;  1MQ3 A;  2KP7 A;  4FO6 A;  2BPG A;  3NGD A;  1ZD2 P;  3HX0 A;  4RQ7 A;  2M0N A;  1Q46 A;  4KN7 A;  2FE9 A;  4QZA A;  2XVT A;  4FZL A;  1UT5 A;  2EQY A;  1EXN A;  3BQ2 A;  4CF5 A;  2VA3 A;  9ICI A;  4FFD A;  1B43 A;  5DQG A;  5C0Y A;  2EAM A;  5KFZ A;  1QSL A;  2WF7 A;  4CE6 A;  4YMM A;  2ASD A;  1Z1V A;  1X9M A;  2ZIW B;  2NRX A;  4R64 A;  4Z6F A;  1ZQV A;  3IG5 A;  1S9F A;  4YR2 A;  2HOI A;  5KFB A;  4GLX A;  2AGP A;  2N1R A;  2KTQ A;  5L1M A;  4NLN A;  3SEN A;  1WWU A;  4A8E A;  3MGI A;  4I2G A;  1V38 A;  4R66 A;  5BOM A;  3PML A;  4ED1 A;  5ALS A;  3RBD A;  2QB0 A;  5KFU A;  3M1Y A;  4OD0 A;  2DWQ A;  1ZXI A;  2WFA A;  2BCQ A;  4BXO A;  2PMZ F;  1U48 A;  1SZP A;  2KSO A;  2LYH A;  3UM9 A;  1PZN A;  1XS9 D;  9ICA A;  4KIT B;  2D8C A;  3RH5 A;  4C7Z A;  3SQI A;  3GDX A;  5DG7 A;  4K4G A;  3G6V A;  1RPL A;  5J0X A;  1ZQH A;  4C0Z A;  4KLH A;  5ALZ A;  4UBB A;  2EAO A;  3J81 j;  3B9J A;  2BDU A;  1QQ6 A;  5GTH U;  2QKQ A;  3KHH A;  4G3I A;  2HVH A;  1ZQM A;  3NS1 A;  2H3Z A;  3WK5 A;  1D9D A;  4P0Q B;  5ALQ A;  4ED3 A;  5CEH A;  8ICR A;  4F2R A;  4MEY A;  2DUY A;  4BX9 C;  4U7C A;  1RQL A;  1V9P A;  2KIC A;  4QWC A;  3CNH A;  1PK1 B;  2A1A A;  4EBD A;  1ZQC A;  1D9F A;  1GO3 F;  2WAQ C;  4F5N A;  2UVV A;  3QEA Z;  2NRZ A;  2VJ5 A;  1TE2 A;  2D6F C;  4HAI A;  1LB2 B;  3F2B A;  2XY7 A;  3M6Z A;  3E0F A;  3MDA A;  3V6K A;  2BKE A;  5CA7 A;  4QNL A;  4DSF A;  5AKK A;  4Z6E A;  4EEY A;  5AM4 A;  5AM0 A;  3MGH A;  2BR0 A;  1ZJN A;  3HWT A;  2Z7J A;  3PX6 A;  2D3D A;  4BWJ A;  2ZJ5 A;  4UAV A;  3TAC B;  4TUP A;  2UVW A;  3SZ2 A;  1S77 D;  2AH5 A;  4ELU A;  5F9N A;  4NL9 C;  9ICQ A;  5J2H A;  2MUT B;  5EOZ A;  2KOB A;  2FJ6 A;  4ACO A;  3V6J A;  3OTQ A;  4CDG A;  5JUM A;  4QJF B;  4ECV A;  3AM9 A;  3ZI4 A;  3B0X A;  3SMV A;  1UA0 A;  2W43 A;  1JXL A;  3OJU A;  9ICT A;  1U4B A;  4DL6 A;  4O5K A;  5KAF U;  3S6J A;  8ICA A;  2XO7 A;  4DL2 A;  5AI0 A;  7ICV A;  4KLE A;  2JEI A;  1JRO A;  4OJ6 A;  1M6Y A;  4UAR A;  4Y2J A;  2ZJA A;  1KTQ A;  1FFU A;  4MHV A;  4J9K A;  2F2A B;  5J0W A;  2ZIU B;  1YZ6 A;  4TQS A;  9ICF A;  2A19 A;  9ICJ A;  2H3I A;  2YY6 A;  4DFK A;  4KLI A;  7ICI A;  3Q8L A;  3AU6 A;  4Q8F A;  5KFQ A;  3KHL A;  4RU9 A;  5J0O A;  1X66 A;  5DB9 A;  3M8S A;  3RJK A;  2Y1I A;  1XNS A;  4JV2 A;  2OM6 A;  3TAQ A;  2OHF A;  2W11 A;  2ZIW A;  2JGA A;  2YMP A;  5IIM A;  2W3S A;  2FPK A;  5J0Q A;  3V7K A;  3TAD C;  1F0M A;  4P2H A;  2GO7 A;  5A0L A;  2LM1 A;  4KLF A;  2WF9 A;  5CJ7 A;  2HHQ A;  2CPR A;  4GC6 A;  1UQV A;  2MRL A;  1JXE A;  4M6W B;  9ICV A;  5KT6 A;  3IG8 A;  4RPZ A;  3GIL A;  4Q44 A;  3BQ0 A;  4J9N A;  1XSN A;  4DQR A;  3H4D A;  1L6N A;  1BNP A;  2JXJ A;  5AKZ A;  3O0F A;  3LDA A;  2HHW A;  4QZB A;  4F4K A;  5DQI A;  5ALJ A;  5EE1 A;  1L3V A;  1ZQF A;  3M7D A;  3C5G A;  8ICU A;  5AKX A;  2XGP A;  1ZQU A;  4ZH4 A;  3MC1 A;  3JPP A;  5HML A;  4P0Q A;  2ZTC A;  3BS7 A;  4F50 A;  4XQ8 A;  1PK1 A;  3H0M B;  3UMG A;  2R8J A;  1X9S A;  4RQ3 A;  4O3M A;  5KAI U;  3C23 A;  1SV0 C;  3MR6 A;  3KKA A;  3OSP A;  2ATL A;  4KLQ A;  4KLD A;  3TAP A;  4BGD A;  4EX6 A;  3WK8 A;  1Z00 A;  1TVA A;  1TK0 A;  3QZ7 A;  3QU4 A;  4MEX A;  3H8S A;  4NLG A;  1CRX A;  2E1F A;  5KT2 A;  4IQW A;  1JI7 A;  7ICQ A;  8ICX A;  1YZ7 A;  2G06 A;  3MR2 A;  2IOF K;  1UCV A;  1PUZ A;  3PO5 A;  3JPN A;  2B6G A;  2WB1 F;  3JPO A;  1UA1 A;  5L1J A;  4B9S A;  3PW5 A;  2FDR A;  1N2X A;  2JH1 A;  3EUB 2;  5KG0 A;  3LWM A;  1NJX A;  3QUC A;  3BZC A;  4F91 B;  1K5O A;  4DL4 A;  5HNK A;  2F3N A;  3GIM A;  2FPL A;  3EWA A;  4Y2V A;  4EEN A;  4US9 A;  3K1R B;  4DQS A;  7ICG A;  5EE9 A;  1ZET A;  3RR7 A;  1F44 A;  1JUD A;  4O3Q A;  2ZIU A;  1NZP A;  7ICF A;  1QTM A;  3EPG A;  8ICZ A;  2Y9U A;  5CP2 A;  5ALV A;  4TQR A;  3RJG A;  3QX7 A;  1Q8K A;  4YMO A;  2C2E A;  2GOL A;  3CW2 C;  2M9N A;  3D6J A;  5DB6 A;  2YMQ A;  4C4S A;  1X40 A;  1QCK A;  2I1Q A;  4J9O A;  2YMM A;  1N5X A;  4KMU A;  7ICN A;  2R18 A;  3ZDD A;  4O3S A;  5CRX A;  4PL2 A;  1UT8 A;  8ICB A;  1ZQN A;  4M9N A;  3BQ7 A;  1U49 A;  4B9M A;  2K4I A;  3N97 B;  4IRK A;  4Q45 A;  5L1L A;  9ICG A;  2YML A;  1HJP A;  4IQT A;  2DF4 B;  4M6W A;  5AI8 A;  5IIL A;  3HT3 A;  2CXY A;  5EE0 A;  1SWV A;  1B22 A;  3D2N A;  4F4W A;  3IHQ B;  1WYG A;  4QW8 A;  2LM4 A;  3AUO A;  2JMG A;  2XGQ A;  3UXP A;  4TUQ A;  3L3F X;  2KSO B;  5J0R A;  8ICW A;  1TAQ A;  2KE7 A;  3H40 A;  3GZF A;  2OH2 A;  2PFP A;  4UAZ A;  4Y2U A;  4K4H A;  1NOM A;  4C8M A;  2CRX A;  8ICH A;  3ED5 A;  2G07 A;  2KV2 A;  2BCU A;  1A76 A;  2RLT A;  4QWE A;  5KFK A;  9ICR A;  2ESE A;  2DKX A;  4RUC A;  4I2D A;  4M2Y A;  1Q3V A;  4PH5 A;  5J29 A;  4RQ2 A;  4DLE A;  1J2N A;  3A0B U;  1N48 A;  5J2A A;  5HP4 A;  4RQM A;  1P7D A;  2G0A A;  1X6J A;  4AYB F;  2QLT A;  9ICC A;  3EYZ A;  1N63 A;  2EZY A;  1ZQX A;  4Z6D A;  4EX7 A;  5F3X B;  4QWA A;  3RB3 A;  1B4F A;  4ECQ A;  2DPJ A;  3H8J A;  5AKE A;  5L9X A;  3F5A A;  4IS7 A;  4ECU A;  1XU4 A;  8ICT A;  5DDY A;  5J2G A;  5IIJ A;  1HEK A;  2DQN B;  5KFD A;  1ZYQ A;  4YMN A;  4QIW C;  1T3Q A;  9ICH A;  2E5S A;  3N7P D;  2A1J B;  4KTQ A;  5TIS U;  2DKZ A;  2E8M A;  8ICI A; 
#chains in the Genus database with same CATH homology
 1IIP A;  2Y0S F;  2E1F A;  2WAQ F;  2OYY A;  1CRX A;  3D2S A;  1HIW A;  2HBJ A;  2WB1 C;  5T14 A;  2W7P A;  2LKY A;  2A3V A;  4BX9 C;  4U7C A;  1XNS A;  3ALR A;  1TAM A;  2DF4 B;  2KIC A;  2OM6 A;  3HKZ F;  2W7O A;  2G06 A;  2KEY A;  3C28 A;  3RFA A;  2YX8 A;  2KKP A;  2W03 A;  1Z19 A;  3ICX A;  2ZIW A;  2Y0S C;  1GO3 F;  2WAQ C;  2YB1 A;  1A0P A;  1T94 A;  2JGA A;  2VJ5 A;  3D2N A;  4P0P B;  3H0R B;  2D6F C;  2WB1 F;  2H3F A;  2KJ9 A;  3KZX A;  1KBU A;  3HKZ C;  2JMG A;  2K4H A;  1WUD A;  3F2B A;  1A6S A;  3M6Z A;  2ZIX B;  2G5I B;  3F53 A;  3E0F A;  3N7S C;  1ZQ1 C;  2HOQ A;  2HOF A;  2HBK A;  1PVP A;  4WJ3 B;  2KHQ A;  5A0L A;  3CRX A;  3L3F X;  2LBO A;  2JH1 A;  2Q4T A;  4QNL A;  2M0N A;  1NZB A;  2RP5 A;  1D8B A;  2XVT A;  1URJ A;  3F5E A;  4FZL A;  2KHV A;  2KNJ A;  2W04 A;  2NV3 A;  2MA1 A;  3CP8 A;  4FZM A;  4OJL A;  3PZP A;  2VIX A;  1XO0 A;  5KL1 B;  2Z7J A;  3GZF A;  2H3Q A;  2OH2 A;  2CPR A;  4BUG A;  5KL8 B;  4OO1 J;  2G09 A;  2MRL A;  4CRX A;  4NLC A;  2ZIV A;  3NRW A;  2KJ5 A;  5C0Y A;  3F2D A;  3SAG A;  1UPH A;  3IG8 A;  2OXO A;  2CRX A;  3SAH A;  2ZIW B;  2G07 A;  2F77 X;  3PSP A;  2H3V A;  3IG5 A;  2KV2 A;  3VCB A;  1Q3U A;  2K8B B;  3DEE A;  1Z1B A;  1L6N A;  2LYB A;  3MGV A;  1ED1 A;  1F44 A;  2HBM A;  4OJP A;  2DGZ A;  2HOI A;  2ZIU A;  3O0F A;  3M6K A;  2KOB A;  1SZH A;  3D2Q A;  3LYS A;  2N1R A;  1Q3V A;  3IP4 B;  4FE3 A;  4ACO A;  4NV0 A;  2KIW A;  3RF9 A;  5HR6 A;  4OJ5 A;  4A8E A;  4BJQ A;  4CDG A;  4IC9 A;  3AQE A;  4QJF B;  4NWI A;  2KJ8 A;  2LYA A;  1P7D A;  2G0A A;  4KX3 A;  3NUQ A;  4AYB F;  2VJ4 A;  2KVC A;  2JH7 A;  2K4E A;  2XIC A;  2ZXI A;  3M7D A;  3PST A;  3SMV A;  3IN5 A;  1OUQ A;  2HMX A;  4FZN A;  2LHT A;  2K8C B;  3VC8 A;  2CN1 A;  2ZG6 A;  2PMZ F;  2K89 A;  3GU3 A;  4P0Q A;  2ZIV B;  1MA7 A;  2HBL A;  2VKQ A;  3OPX A;  1ECW A;  4ICA A;  2GOL A;  4JMU A;  3K1Z A;  3ONN A;  1PVR A;  4AYB C;  3H0L B;  2K8A A;  2F76 X;  3C29 A;  2RRD A;  4OJ6 A;  3SQI A;  3PSI A;  4QIW F;  4GFJ A;  3F5A A;  2ZXH A;  3LVW A;  4PL1 A;  2PMZ C;  3H0M B;  2F8L A;  1YT3 A;  2E1E A;  4KX5 A;  2G5H B;  2F2A B;  2ZIU B;  4OJO A;  1HEK A;  3KFU F;  4P0P A;  3F2C A;  3AQF A;  2DQN B;  1DRG A;  2G08 A;  4O3M A;  3AL0 B;  4C0Z A;  4CGZ A;  2R18 A;  2H3I A;  2YB4 A;  4QIW C;  4KMO B;  2E5S A;  2RHF A;  2ZIX A;  2GH1 A;  3CYM A;  4NLB A;  4PL2 A;  5CRX A;  3LVV A;  3SAF A;  2KD1 A;  3N7P D;  2BDU A;  2JHD A;  3N7R C;  2XID A;  5HR7 A;  1PVQ A;  2XI9 A;  2KKV A;  4U6P A;  3T79 A;  3PSF A;  2H3Z A;  4P0Q B;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...