4IC9A

Crystal structure of the full-length matrix subunit (p15) of the feline immunodeficiency virus (fiv) gag polyprotein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
GQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Matrix protein p15
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4ic9A00
1HEKA 2H3FA 2K4EA 2H3VA 2K4IA 2H3ZA 2NV3A 1TAMA 2GOLA 4ICAA 2LYBA 1HIWA 2K4HA 4JMUA 2LYAA 1UPHA 1ED1A 1A6SA 2N1RA 4IC9A 2H3IA 2HMXA 2H3QA 1ECWA 2JMGA 1L6NA
chains in the Genus database with same CATH superfamily
2VJ4A 4QZEA 3ZI4A 3RJFA 4F2RA 4O0IA 2MSNA 1S0OA 4RQ8A 2NRZA 2WAQF 3IDWA 3UPQA 2BGWA 5J2KA 1UCVA 2W8KA 4BXOB 4O3MA 4LVSA 3MGVA 4F4WA 1SB3C 2KZ3A 2NRXA 3KFUF 2CRXA 2HHQA 2C28A 1TAMA 3U26A 1XU4A 2DKZA 5DB7A 2JEFA 1V9PA 4Z6DA 4KLIA 3BQ7A 2KHQA 4RPXA 3J81j 3PMLA 4DL7A 4EBDA 2E1FA 2UVUA 1ZQWA 8ICJA 2RP5A 4KLOA 5AKGA 4MEXA 2DBYA 3TQ1A 3A0HU 4M9HA 1K1SA 3H0MB 1L3VA 1ZD2P 4QZHA 4KMOB 4QZFA 3GDXA 2XO7A 1JI7A 1PVRA 2F2AB 3QUTA 3LWMA 4C4SA 2AHOB 4DEZA 4JV1A 2HI0A 5L1LA 2NO5A 4KLSA 7ICPA 3V7KA 2W9BA 2F76X 5KFKA 4O9MA 2ZIUA 4AYBC 1S0MA 4F5QA 2PMZC 9ICHA 4XUSA 1RQLA 1K1QA 1KFDA 4B9MA 2HMXA 5ALMA 1X9XA 2NO4A 2OXOA 2VJ5A 3PVXA 2FPKA 3NUQA 2GOLA 3TADC 3PSFA 3PR4A 2DPIA 7ICGA 2ZJ8A 3KZIU 3SEIA 3Q8QB 4I2FA 2YY6A 1XSPA 3ZDCA 1ZQYA 1RXWA 1ZQIA 5KG5A 3Q8KA 5CWRA 3JPRA 3EPGA 4ED6A 2VA3A 1NKBA 2K60A 4IRCA 4EZ9A 3SAHA 4KN7A 5KFPA 1FFVA 2QKQA 2DF4B 1WWUA 1A6SA 2BPGA 1XS9D 5AM1A 2H3QA 2WB1C 2IOFA 2NRTA 4OJPA 1RZTA 4TUSA 1H38A 4I2JA 1A77A 5E79U 3F5AA 4P0PB 1PK1A 3G6XA 5AKKA 4ELVA 3RR8A 4QZDA 9ICLA 3PW5A 5L9XA 5HHHA 3E0FA 4EYIB 4UB1A 2HOQA 3C1YA 4CNQA 2KJ5A 4RQ1A 1KQQA 2H3FA 4EBEA 4F50A 3CYMA 2W03A 4C8NA 3RB3A 1LB2B 4O3PA 1F44A 1M6YA 1NK8A 3H8WA 8ICRA 4C80A 1DRGA 4QIWC 8ICXA 4DSKA 2W9CA 4J03A 4G9BA 4OJ5A 5FP0A 2HBMA 2W7PA 3M1YA 4XA5A 2JRZA 5DB9A 1L5UA 4UB8U 4ECTA 4P4MA 3AQFA 2UVRA 5HMLA 1N48A 2ASJA 4RQ0A 8ICEA 1JXEA 4DSJA 4UQGA 3RJGA 5AM5A 1LV5A 1FIQA 4PGXA 1TE2A 3OTQA 2JEGA 1XSLA 4F4ZA 3C21A 9ICFA 3PSIA 3RBDA 2R8HA 4RNNA 3C2KA 1S10A 2BKEA 2Y9UA 2BPFA 7ICTA 2KIWA 4BWMA 2C2DA 1QH9A 1WUDA 4F5NA 2OYYA 2LPEA 3A0BU 2F1HA 2G5HB 1D9FA 5BOMA 4DFPA 1YT3A 1DK2A 5DDMA 9ICGA 3WKDA 2PFPA 4DL2A 1BGXT 5J2DA 1XSNA 2EAOA 4LZDA 4Q45A 2FMSA 3NVVA 4KLQA 1QTMA 3EUB2 1NNLA 3M6KA 2YMMA 1NOMA 8ICNA 2AJQA 3Q8MA 2JR5A 5G5HA 1ZRMA 3HW8A 2KVCA 2ZXIA 3S6JA 5TISU 2BQ3A 5AI9A 4JB3A 3TAQA 2B21A 3BQ2A 3PMNA 1YZ6A 3AU2A 3N4MB 1SZHA 3H8JA 1KDHA 3EW9A 5KT5A 2D3DA 1D9DA 3ETLA 2H5XA 7ICMA 4TURA 4GC7A 1ZD3A 3MABA 2Q4TA 2XIDA 3GIIA 3GIJA 1XNSA 1Z3EB 2W54A 1NI3A 3F2DA 4K4GA 5AKIA 2ZTEA 4C8MA 3FDSA 1MQ2A 4M9GA 4J9KA 1U9LA 1RXVA 3H8MA 4EEKA 4ED8A 1T8EA 4XRHA 4ED0A 5KL8B 3ISCA 3EPIA 3GIMA 1PZNA 4QZCA 2KZMA 1J2MA 2V9WA 4DF8A 4DFMA 2EDUA 4OJLA 2UVVA 2PFQA 4DF4A 5F3XB 3B0YA 3N97B 4M2YA 2E8MA 3G6VA 2BHNA 3NGDA 4CF5A 5J2BA 2M9NA 2KKPA 4NWIA 3ISBA 4IR9A 4DL4A 3BQ1A 1Z19A 4UB3A 2XGPA 2IA6A 5AM2A 3V6KA 3WK9A 5KT2A 3WKCA 7ICLA 1ZQRA 4DL5A 3R9KA 4UAVA 5AI4A 5J0YA 2HHUA 1IG6A 3MBYA 4JWMA 5KAFU 4M9LA 5J0RA 1CUKA 5KG7A 2H3VA 2OEHA 4Q44A 2F1IA 3DDHA 4ICAA 4HAIA 4R64A 2K4HA 1WG8A 2VANA 5B66U 2GWSA 4BX9C 3FAHA 1F5SA 3JPQA 5DB6A 2HHVA 9ICKA 5ALRA 5T14A 2ZUDA 3OPXA 2GO7A 3GILA 4IQWA 2BDPA 9ICOA 1UT5A 8ICVA 4YR2A 4J9OA 2I1QA 3HWTA 5DQIA 3CNHA 4DCCA 2RLTA 3M9MB 1TAUA 3IG5A 4UB5A 1ZJNA 2E8NA 4OCZA 4NL9C 1JMSA 1AROP 4P0QB 4NJ8A 1ZQVA 3T5HA 1XO1A 1L7MA 3JPOA 2C2EA 3KOOA 3MR2A 2XY5A 2OWOA 3GFKB 5HP4A 1WCNA 2RRDA 2LYAA 1J2NA 5J0WA 2WF8A 2J6TA 5JUMA 1L7OA 1ZD4A 5HR6A 3WKBA 2JH1A 4I27A 4JUZA 9ICCA 3ZD8A 4O3NA 5KFLA 3TAPA 2FPLA 3V6HA 4IRKA 2EAMA 2Y1JA 2B6GA 2A3VA 4YMMA 3AUOA 1Z00A 2H3IA 2EH9A 2LBOA 3QE9Y 4I29A 1B0XA 4DQIA 3NVYA 4UAWA 5AK6A 3PW0A 5KT3A 1ZQ1C 1QSYA 5KFCA 2W3SA 4QW8A 5KFYA 3L4PA 4ZH4A 5KL1B 4Y2VA 2W9MA 4UB4A 3KKAC 4UARA 5KFGA 1KKXA 5BOLA 5KG0A 3QEBZ 2K89A 1BPBA 2DUYA 2FMPA 4KLLA 3IRUA 1ZQOA 2RDJA 4DO9A 2VIXA 1V97A 5DBAA 3FYHA 5ALOA 4QWCA 2KK0A 3L5KA 4PHAA 3AN1A 1X9SA 4J9MA 3QUBA 1QQ6A 1RM6C 5EE1A 3GV7B 4Z6EA 1PUZA 2NRWA 9ICNA 1ZJMA 2LYBA 1RYUA 2DWQA 3H8SA 3MGIA 3GV5B 4EX6A 4FZLA 3IV6A 5DB8A 1ZQEA 4QZ8A 1SV4A 4DL6A 1N60A 2P66A 4DSEA 1U48A 2ZUBA 4ELTA 2G0AA 2AQ0A 1FFUA 3KBBA 3H4DA 2JH7A 3PSPA 3T79A 2RQ5A 1PK3A 1N5XA 3TANA 1P7DA 4GFJA 3KD3A 1KL9A 5KG3A 5KFQA 4KTQA 2A1JA 2OHFA 4RPYA 5KFIA 4E0DA 9ICTA 4NLZA 2MUTA 5AKZA 4EENA 3E2EA 4IRDA 2FDRA 1IIPA 3SMVA 2ZIXA 1S76D 3RJEA 4EX7A 1N63A 1BPEA 4QWAA 2HHXA 2ZG6A 4TQSA 1U47A 1N61A 5DBBA 5HHIA 2KKVA 3C29A 4KLDA 2XC9A 1X9WA 4CCHA 2MU2A 3D2NA 5KFAA 3F2CA 2IHNA 4IR1A 2E1EA 3RJKA 5AIAA 5AM0A 5KFNA 1KRPA 1ZOLA 5IINA 4ACOA 1UT8A 2G5IB 5J2HA 2KFNA 1TKDA 2ZIWB 1FO4A 4JMUA 2LYHA 8ICHA 9ICBA 2J6SA 1S77D 2DQNB 3D2SA 4NLKA 5AI5A 4RU9A 4NM2A 4PHPA 2YMQA 2KSOA 1A76A 7ICNA 3NVWA 4M6WB 2OM6A 5AK4A 3ZD9A 2BCRA 3H40A 2HCFA 3AEVA 4RUAA 1MQ3A 1Q3UA 2H3ZA 1ZQXA 4DS5A 2JEIA 4Z6FA 3M9OB 3HILA 5AKXA 5ALWA 1ZQBA 2IMWP 2KD1A 4KLGA 9ICQA 1ZQCA 2WAQC 1COKA 3WU2U 2E3TA 2ES6A 2WF5A 3PX0A 5J2JA 3RRGA 5J29A 3UMCA 3MDAA 5HNKA 1LKYA 4ED3A 5ALDA 5DKWA 3QNMA 2YB1A 1DGJA 3PR5B 1HUZA 1COOA 4DQPA 3KHLA 2PFOA 1B4FA 2A1AA 5CRXA 2KN7A 2HW3A 1JROA 3UQ2A 4NY8A 4BUGA 3VC8A 4EZ6A 5DDYA 3TI0A 4A8EA 1VJ5A 5KG4A 5AIBA 4RT2A 2LKYA 3NVZA 2W55A 1RQNA 2FMQA 3RFAA 4OJ6A 1SWWA 3ALRA 2E8PA 4FO6A 3QUQA 3K4GA 8ICUA 3IP4B 3V7JA 4J9RA 1ZQSA 5KT7A 4I2IA 4YG2A 5KT6A 3KHGA 4GXKA 3SI8A 1SIJA 4FE3A 1BPYA 5CJ7A 1N62A 2XGQA 1ZQKA 1QSSA 4F5PA 2KZZA 1ZQLA 4I2AA 1XC9A 1MC8A 3NRZA 2AGOA 4DLGA 2DL0A 1Z1BA 2BQUA 1TFRA 5KFRA 4KMUA 4QNLA 2HOIA 3MGHA 1ECWA 1Z4NA 9ICPA 4AP9A 3Q8RB 1T3NA 1VLBA 5ALUA 1T3QA 4F5RA 1NJXA 1SZPA 5CEHA 2G09A 3AQEA 4KLTA 1IV8A 1YZ7A 1ZQFA 4B9VA 1EXNA 3MR3A 2KOBA 1KFTA 2MA1A 3ETRA 2IOHA 1BNPA 1SGGA 4NLBA 4DWIA 5DGBA 2W7OA 3PO5A 1TV9A 8ICLA 5AK3A 4QJFB 2FLLA 4K4HA 1S5LU 2K8CB 1X42A 3H0LB 3BS5B 5IILA 2HOFA 9ICXA 2HBKA 2KEYA 5DG7A 2HDOA 8ICSA 1NJZA 2R8KA 4LJXA 4R8UA 1DXSA 3RRHA 3GQCA 5ALZA 4RT3A 3ONNA 2I9GA 1T4GA 1ZRNA 1ZQHA 1SL1A 4I28A 2VA8A 4NLCA 1RYSA 2D6FC 4G3IA 5EE0A 3RAXA 2BCQA 4DFJA 4RUCA 9ICEA 4IC9A 4KLHA 1S8OA 5AK5A 4RQNA 4F72A 5J0TA 4RQ5A 2VKQA 1BVSA 5KG6A 3QU9A 5ALKA 4UASA 2EZYA 3RTVA 1D8LA 4KX5A 5G5GA 4O3RA 3RH5A 2HHSA 4MFCA 2MUTB 4CE6A 4U7CA 3TARA 1S9FA 4IQVA 5AICA 3HKZF 2O6KA 9ICJA 2HSZA 1U45A 5IIMA 1ZQPA 1X6JA 1CEZA 8ICFA 5ALXA 5EWFA 5J0PA 4C8LA 8ICIA 5D49A 5F9LA 8ICPA 5KNIA 4I2EA 1WWVA 5ALTA 3KHRA 3AL0B 4Z6CA 4FBUA 5EE3A 2NYVA 1NJYA 2XVTA 2ALZA 5ALNA 1A0PA 8ICYA 1NK7A 4GXJA 4F8RA 4WJ3B 2XICA 7ICEA 2W9BB 3MFHA 2ZIUB 3QUCA 1ZQAA 2E5SA 3IN5A 1XO0A 4B6JA 4BXOA 5ALIA 4J9LA 1TK5A 5TZVA 4YMNA 2XCAA 2W3RA 5L1KA 5CR0A 1KFSA 5AI6A 5KFDA 1NKEA 4RNOA 1BNOA 3CP8A 4IL6U 2BCSA 3ZDDA 2K4PA 4EELA 2K4IA 1ZQZA 2KP7A 3KTQA 3SENA 3CW2C 1PVQA 3HT3A 3CRXA 2ZJ5A 2G06A 1ED1A 9ICUA 3AM9A 8ICGA 1RYRA 4F93B 1MA7A 4J9NA 1SKWA 5ALYA 4I2DA 2WFAA 2DFLA 3GZFA 5AKYA 4P4PA 3BJYA 4GLXA 1JIHA 4BJQA 3OGUA 5KFFA 5EWEA 2AGPA 4YR3A 4OJOA 1ZQMA 5C5JA 1NK5A 4KX3A 3T5LA 1TK8A 5ALLA 4B9TA 4JV0A 1SL0A 4UAZA 5J2GA 4DFDA 4QZIA 2HHWA 4DOBA 3DV9A 1PK1B 2CPRA 1XWLA 1KTQA 3HJEA 3T5JA 2Y0SF 5KFJA 3N7RC 2FE9A 1PVPA 5ALFA 2YQEA 2BCVA 1NK0A 1GO3F 2I6XA 1N2XA 1U49A 5HR7A 1ZQJA 4F5OA 2K8AA 3AMZA 4PL2A 5KFMA 4ED1A 3ZDAA 3EYZA 4JWNA 1NZBA 7ICQA 4Y2YA 2W9CB 1TVAA 3OJSA 2KJ8A 2JZBA 1OW5A 8ICAA 1QCKA 5AI8A 5J0SA 2DGZA 3QX7A 3FM9A 4PPXA 4DOCA 3M8RA 2YMLA 4FZNA 3L3FX 1NK4A 4YVZA 5AKJA 5AKHA 2RDIA 4YCXA 3C23A 4YXMA 2JHDA 3M7DA 3TADA 4RQ4A 4P0PA 5IIKA 2BPCA 4C4RA 1DK3A 1QQ7A 4P2HA 3LK9A 8ICWA 2DPJA 4ED7A 3C1ZA 1UA1A 5F9NA 1ZQTA 1JALA 3UXOA 5KG1A 4DQRA 2KICA 4FFDA 2JV3A 1B22A 4DFKA 4QZ9A 5J2IA 3O0FA 4HYKA 2C2RA 3QU4A 1KLNA 2BCUA 3PO4A 5KFSA 4C0ZA 4TUQA 1SXDA 3PW2A 1NK6A 2GLEA 3UQ0A 4M0AA 2DKXA 3WKAA 4F71A 1IXRA 2KIVA 4UBBA 5CHGA 1C7YA 4Q8EA 4ECXA 1L3TA 2NV3A 3QEAZ 2WF6A 2R8JA 4PHDA 2ESEA 3WKEA 2J6UA 5J0XA 3PV8A 4GIBA 2WTFA 4Y2RA 3RJIA 1NZPA 4UAUA 4Y2QA 4J9PA 4K4IA 1Y88A 3WK4A 4FBTA 3LYSA 2W9AA 4FZMA 7ICUA 1V85A 4AYBF 5KFUA 4CF3A 5D4BA 4B9LA 1JN3A 4QZGA 5AKLA 2PMZF 4MF8A 7ICKA 5ALVA 1WCLA 2ASDA 1QSLA 7ICVA 5DQHA 4MHVA 3N7PD 4PHEA 4M47A 1KBUA 2KFZA 2R8IA 4OD0A 1URJA 4DQSA 1D8BA 2QB0A 4YD1A 4PGQA 1NK9A 3SAFA 2XY6A 5DLGA 2F3NA 2LMRA 3RB0A 3FC4A 3MR6A 2E8OA 4ECUA 3MFIA 4GC6A 4CDGA 2XY7A 4J9QA 4B9SA 1SKRA 2WB1F 4TUPA 2AXTU 1ZQDA 4MFAA 2MRLA 3N7SC 3WK8A 3EZ5A 1TAQA 3HPOA 1QLNA 2V4RA 1CI4A 4NV0A 4PZNA 3Q8PB 5IIIA 4MFFA 4F3OA 4QZAA 1HIWA 4UATA 5K4LA 3ICXA 2HBLA 2FLPA 3QZ8A 3TFSA 4Q8FA 2Z7JA 3LDAA 4NXZA 2KV2A 3H0RB 4KLUA 4ECQA 1UQVA 5JU5A 2CXYA 3GV8B 1L8LA 3ORYA 2P35A 4QIWF 4US9A 5J2CA 2BDUA 2NRVA 3OHAA 4F4XA 2BQRA 3PW7A 4Y2UA 3F2BA 2W11A 4PL1A 5AM3A 2P6RA 3SD7A 2KVSA 3SV4A 3K75D 3PW4A 1C20A 4JK1A 3F53A 9ICSA 3QXGA 5ALJA 3C2LA 3NS1A 9ICVA 3RB4A 1X6IA 3H7IA 4UB2A 5B5EU 2QB1A 5J2EA 3T5KA 1J97A 4GXIA 1UPHA 5KG2A 4NM1A 5KFEA 2B0CA 2KE7A 4PGYA 1S0NA 1L6NA 2JZBB 5DG8A 1X2IA 3KHHA 8ICQA 9ICRA 3IM1A 1Q8KA 4R66A 2YN4A 7ICFA 9ICMA 4O5EA 2M0NA 3GU3A 1S0VA 3SZ2A 3PNCA 4ECRA 2KTQA 3I1YA 1LVHA 2G08A 2ZTDA 3HP6A 4KLFA 2F8KA 2JMGA 3H4BA 4ELUA 2ZTCA 1O08A 2K4EA 5AHXA 3BQTA 4C7YA 2R8GA 2F44A 1WYGA 3OJUA 4YFKA 2W8LA 5J2AA 3SQIA 2A19A 1Z00B 1VDVA 2WHEA 5IIJA 5ALHA 1OXJA 4QWEA 2V4QA 2XCPA 2QARA 8ICMA 3C2MA 2PKEA 2R18A 5KFHA 3BS7A 2YX8A 4R63A 4PJ0U 4O3QA 3BDPA 5CP2A 2LI6A 4P0QA 3HX0A 4R65A 3ISDA 2BZFA 4C7ZA 1L7NA 4J9SA 2KJ9A 3M6ZA 2KHVA 3I76A 1FEZA 1JUDA 1D8YA 5BPCA 4B9NA 4Y2XA 1SKSA 4QWBA 1DGSA 3QU5A 3QZ7A 1T94A 5J8YA 2ASLA 2RHFA 3K1RB 2IBKA 1NKCA 3VCBA 1V38A 4IQTA 2ZIVA 1X40A 3I28A 1L7PA 2OCEA 2LHTA 4F92B 2ZUCA 4U6PA 4NL9A 4IQUA 5J0OA 4BWJA 5C0YA 4DL3A 2KMDA 5DGAA 3G6YA 2F77X 5GTHU 2F8LA 2EZZA 3BZKA 1JRPA 5ALPA 2ODGA 3RJHA 1JXLA 4O5KA 2PI5A 3JPNA 1SL2A 5J0UA 4JV2A 3D2QA 4I2GA 2CN1A 4NLGA 3PX4A 1HEKA 1KN5A 8ICCA 1Q3VA 5JRTA 4PZOA 2QB0B 5AI0A 4O5CA 1IM4A 5L1JA 1HUOA 3UM9A 5ALEA 2A1JB 3OSPA 1MSWD 4CRXA 5DLFA 2EANA 3QYPA 2C22A 3IHQB 2FJ6A 3GIKA 3PSTA 4C4TA 4ZOHC 3E58A 1UA0A 5ALQA 4Y2SA 2ZIXB 2PFNA 2HHTA 3LVWA 5AKEA 4RNMA 1AQ6A 4YR0A 3C5FA 5KFTA 4I2CA 3RBEA 4X5VA 3MDCA 3ZDBA 5GTIU 2LM1A 5L1MA 9ICWA 4YXJA 2YMPA 3M9NB 1JX4A 2ZXHA 4P4OA 4EYHB 2ISPA 3B9JA 8ICBA 5KFBA 4Y2PA 4IS7A 5HMMA 2LM4A 1OUQA 4Y2TA 4DOAA 3BZCA 3MC1A 1X66A 1SWVA 2YTUA 4F91B 1ZQQA 3C28A 3KKAA 1DOQA 3SV3A 3NASA 2AU0A 8ICZA 1BPDA 2KSOB 1QQ5A 5KT4A 4KLJA 3PY8A 5ALSA 4ECVA 3RJJA 3D6JA 7ICSA 2EQYA 1MN8A 1SV0A 4ECZA 2K8BB 4MF2A 2ZJAA 3ED5A 3WK6A 2OH2A 4NLNA 3SR6A 2VA2A 5CA7A 1N56A 3RH6A 2FPMA 4US8A 3NRWA 5ALGA 3V7LA 5KFVA 2ISOA 5KFZA 4EEYA 3ZDEA 4RQ2A 3UXPA 1HJPA 3QU7A 4UBCA 4ECYA 3BQ0A 5A0LA 1LKYB 3JPPA 4EBCA 2D8CA 3RF9A 1ZXIA 7ICIA 1ZYQA 2AGQA 4ED2A 1BPZA 2FLNA 2GH1A 2HBJA 4O3SA 1L8OA 5DG9A 5KFWA 4RQ6A 4UB6U 3HRDD 3OSNA 2IOFK 2QLTA 1RG6A 4F4KA 5H2FU 5J0QA 2N1RA 2ZIWA 1N5WA 9ICIA 2JGAA 4ECWA 5JTIA 5IIOA 5KFOA 2ATLA 3N28A 3PZPA 2W04A 1NJWA 3HKZC 3TKAA 4PH5A 4I2BA 4M9JA 3V6JA 4M9NA 4M6WA 4UW9A 3TACB 4KN4A 1RPLA 2YB4A 1Z1VA 2L5YA 2I5HA 4DSFA 3WK7A 1ZQUA 5EWGA 4BGDA 7ICOA 4ECSA 1CRXA 4LZGA 1O03A 5J8YC 2P6UA 3KZXA 4O3OA 5DBCA 2JEJA 1B43A 2XI9A 4C8OA 2QARB 2BR0A 7ICRA 3MR5A 2HVHA 1ZD5A 1SXEA 2EZXA 4QZBA 5D46A 4OO1J 1L3UA 5KFXA 5EE9A 2Q0ZX 3UXNA 4DSIA 3EWAA 2AQ4A 4I2HA 2HVIA 2JXJA 3K1ZA 4C8KA 4RZRA 1BPXA 2WF9A 3IG8A 4YMOA 4XQ8A 1ZQGA 4YQWA 5L1IA 2AH5A 3JPTA 3THVA 7ICHA 3LVVA 5CB1A 3B0XA 1Z4OA 4KITB 4Q43A 3JPSA 2IHMA 2UVWA 2F1JA 4FS1A 4KLMA 4RPZA 1F0MA 3RR7A 2ZIVB 1UHUA 8ICOA 4TQRA 3RB6A 3T3FA 1U4BA 1KW4A 2KG5A 1RDFA 3Q8SB 7ICJA 4FS2A 3F5EA 9ICAA 4YD2A 3NTUA 2EAPA 5AM4A 4F4YA 4RQ7A 4Y2JA 4MEYA 4R8UB 4B9UA 4F2SA 8ICTA 1T7PA 2PI4A 1KEJA 3AU6A 4CGZA 5KAIU 4YN4A 2WF7A 2Y1IA 4QWDA 4YP3A 2Y0SC 4RQMA 3UMGA 4RQ3A 4BDPA 3OHBA 4DSLA 2G07A 3UMBA 3SAGA 8ICKA 2PXIA 4KLEA 1K5OA 1KSPA 5DQGA 1X9MA 3WK5A 5J2FA 3M8SA 4UAYA 2MAXA 3DEEA 1Q46A 4DLEA 3LWLA 4USAA 4QW9A 4DS4A 2KNJA 4DQQA 2Y9TA 3SYZA 2FI1A 1ZETA 1S97A 3TFRA 5KTQA 1ZQNA 2W43A 1SV0C 4M04A 1TK0A 4CF4A 3QU2A 3Q8LA 3C5GA 3BS5A 1L3SA 5EOZA 3RH4A 3RAQA 3V72A 3PX6A
chains in the Genus database with same CATH topology
2K89A 3AQFA 2VJ4A 4ACOA 2G5IB 3K1ZA 3NUQA 4KX5A 2GOLA 1XNSA 5C0YA 4BJQA 2KICA 2F77X 2ZIWB 3PSFA 2M0NA 3IG8A 4JMUA 3GU3A 3F2DA 3NRWA 2F8LA 2VIXA 3O0FA 4OJOA 4CDGA 3D2SA 2DQNB 4KX3A 4U7CA 1Z1BA 4C0ZA 3LVVA 3IG5A 2G08A 2WAQF 2WB1F 3PSIA 3HKZF 4QNLA 2OM6A 2MRLA 2HOIA 5A0LA 1ECWA 2JMGA 3D2QA 3N7SC 2CN1A 2CPRA 4O3MA 4P0QB 3RF9A 3MGVA 2KIWA 3KFUF 5KL8B 1HEKA 2K4EA 2CRXA 1Q3UA 4NV0A 2Y0SF 2H3ZA 1Q3VA 2NV3A 2GH1A 2HBJA 1TAMA 2ZIVB 2LYBA 1HIWA 3SAHA 3SQIA 1WUDA 2OYYA 3ICXA 3N7RC 2HBLA 2KHQA 3AL0B 2G09A 2DF4B 1PVPA 2G5HB 4OJLA 4CRXA 3AQEA 2RRDA 2LYAA 1YT3A 3F5EA 4FZLA 1A6SA 2N1RA 2XVTA 2ZIWA 2Z7JA 2E1FA 2JGAA 2KOBA 1A0PA 2KD1A 3PSTA 1GO3F 2MA1A 4WJ3B 2H3QA 2WAQC 2KV2A 2WB1C 2XICA 3H0RB 3PZPA 5HR7A 2ZIXB 2RP5A 2W04A 4OJPA 3HKZC 4NLBA 4CGZA 2K8AA 2R18A 2KKPA 2ZIUB 3LVWA 4NWIA 4PL2A 2JH1A 5HR6A 3LYSA 2W7OA 2YX8A 2G0AA 4FZMA 2E5SA 3F5AA 3IN5A 1Z19A 1XO0A 1NZBA 4P0PB 4P0QA 4AYBF 2Y0SC 2YB4A 2JH7A 2PMZF 3PSPA 3T79A 2YB1A 3OPXA 2KJ8A 1P7DA 4QIWF 2KJ9A 3M6ZA 3M6KA 4QJFB 3H0MB 2KHVA 2ZXHA 2G07A 2K8CB 2DGZA 2BDUA 4GFJA 3H0LB 3SAGA 4KMOB 2A3VA 5CRXA 1PVRA 3F2BA 2HOFA 2F2AB 3E0FA 3VC8A 4BUGA 2H3IA 4PL1A 4FZNA 2LBOA 2HBKA 1CRXA 2KEYA 2KVCA 2ZXIA 4A8EA 3L3FX 1OUQA 3GZFA 3CP8A 2HOQA 3DEEA 2KJ5A 3KZXA 3F53A 2LKYA 3N7PD 2H3FA 2H3VA 2K4IA 3C28A 1IIPA 3CYMA 2W03A 3ONNA 3SMVA 2ZIXA 4ICAA 1KBUA 1T94A 2XI9A 2KNJA 2F76X 2JHDA 4OJ6A 3RFAA 3M7DA 1PVQA 2ZIUA 1F44A 3ALRA 4AYBC 1ZQ1C 2K4HA 2RHFA 4NLCA 3CRXA 2PMZC 2D6FC 1DRGA 1URJA 3VCBA 1SZHA 3IP4B 4P0PA 4QIWC 2ZG6A 2G06A 4BX9C 1UPHA 1ED1A 2ZIVA 1D8BA 2KKVA 4OJ5A 3C29A 4IC9A 3SAFA 4OO1J 2HBMA 1MA7A 2LHTA 2HMXA 5KL1B 2W7PA 5T14A 3F2CA 3D2NA 2K8BB 2E1EA 2VKQA 4FE3A 4U6PA 2OH2A 1L6NA 2OXOA 2VJ5A 2Q4TA 2XIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  2H3F A;  2K4E A;  2H3V A;  2K4I A;  2H3Z A;  2NV3 A;  1TAM A;  2GOL A;  4ICA A;  2LYB A;  1HIW A;  2K4H A;  4JMU A;  2LYA A;  1UPH A;  1ED1 A;  1A6S A;  2N1R A;  4IC9 A;  2H3I A;  2HMX A;  2H3Q A;  1ECW A;  2JMG A;  1L6N A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  4QZE A;  3ZI4 A;  3RJF A;  4F2R A;  4O0I A;  2MSN A;  1S0O A;  4RQ8 A;  2NRZ A;  2WAQ F;  3IDW A;  3UPQ A;  2BGW A;  5J2K A;  1UCV A;  2W8K A;  4BXO B;  4O3M A;  4LVS A;  3MGV A;  4F4W A;  1SB3 C;  2KZ3 A;  2NRX A;  3KFU F;  2CRX A;  2HHQ A;  2C28 A;  1TAM A;  3U26 A;  1XU4 A;  2DKZ A;  5DB7 A;  2JEF A;  1V9P A;  4Z6D A;  4KLI A;  3BQ7 A;  2KHQ A;  4RPX A;  3J81 j;  3PML A;  4DL7 A;  4EBD A;  2E1F A;  2UVU A;  1ZQW A;  8ICJ A;  2RP5 A;  4KLO A;  5AKG A;  4MEX A;  2DBY A;  3TQ1 A;  3A0H U;  4M9H A;  1K1S A;  3H0M B;  1L3V A;  1ZD2 P;  4QZH A;  4KMO B;  4QZF A;  3GDX A;  2XO7 A;  1JI7 A;  1PVR A;  2F2A B;  3QUT A;  3LWM A;  4C4S A;  2AHO B;  4DEZ A;  4JV1 A;  2HI0 A;  5L1L A;  2NO5 A;  4KLS A;  7ICP A;  3V7K A;  2W9B A;  2F76 X;  5KFK A;  4O9M A;  2ZIU A;  4AYB C;  1S0M A;  4F5Q A;  2PMZ C;  9ICH A;  4XUS A;  1RQL A;  1K1Q A;  1KFD A;  4B9M A;  2HMX A;  5ALM A;  1X9X A;  2NO4 A;  2OXO A;  2VJ5 A;  3PVX A;  2FPK A;  3NUQ A;  2GOL A;  3TAD C;  3PSF A;  3PR4 A;  2DPI A;  7ICG A;  2ZJ8 A;  3KZI U;  3SEI A;  3Q8Q B;  4I2F A;  2YY6 A;  1XSP A;  3ZDC A;  1ZQY A;  1RXW A;  1ZQI A;  5KG5 A;  3Q8K A;  5CWR A;  3JPR A;  3EPG A;  4ED6 A;  2VA3 A;  1NKB A;  2K60 A;  4IRC A;  4EZ9 A;  3SAH A;  4KN7 A;  5KFP A;  1FFV A;  2QKQ A;  2DF4 B;  1WWU A;  1A6S A;  2BPG A;  1XS9 D;  5AM1 A;  2H3Q A;  2WB1 C;  2IOF A;  2NRT A;  4OJP A;  1RZT A;  4TUS A;  1H38 A;  4I2J A;  1A77 A;  5E79 U;  3F5A A;  4P0P B;  1PK1 A;  3G6X A;  5AKK A;  4ELV A;  3RR8 A;  4QZD A;  9ICL A;  3PW5 A;  5L9X A;  5HHH A;  3E0F A;  4EYI B;  4UB1 A;  2HOQ A;  3C1Y A;  4CNQ A;  2KJ5 A;  4RQ1 A;  1KQQ A;  2H3F A;  4EBE A;  4F50 A;  3CYM A;  2W03 A;  4C8N A;  3RB3 A;  1LB2 B;  4O3P A;  1F44 A;  1M6Y A;  1NK8 A;  3H8W A;  8ICR A;  4C80 A;  1DRG A;  4QIW C;  8ICX A;  4DSK A;  2W9C A;  4J03 A;  4G9B A;  4OJ5 A;  5FP0 A;  2HBM A;  2W7P A;  3M1Y A;  4XA5 A;  2JRZ A;  5DB9 A;  1L5U A;  4UB8 U;  4ECT A;  4P4M A;  3AQF A;  2UVR A;  5HML A;  1N48 A;  2ASJ A;  4RQ0 A;  8ICE A;  1JXE A;  4DSJ A;  4UQG A;  3RJG A;  5AM5 A;  1LV5 A;  1FIQ A;  4PGX A;  1TE2 A;  3OTQ A;  2JEG A;  1XSL A;  4F4Z A;  3C21 A;  9ICF A;  3PSI A;  3RBD A;  2R8H A;  4RNN A;  3C2K A;  1S10 A;  2BKE A;  2Y9U A;  2BPF A;  7ICT A;  2KIW A;  4BWM A;  2C2D A;  1QH9 A;  1WUD A;  4F5N A;  2OYY A;  2LPE A;  3A0B U;  2F1H A;  2G5H B;  1D9F A;  5BOM A;  4DFP A;  1YT3 A;  1DK2 A;  5DDM A;  9ICG A;  3WKD A;  2PFP A;  4DL2 A;  1BGX T;  5J2D A;  1XSN A;  2EAO A;  4LZD A;  4Q45 A;  2FMS A;  3NVV A;  4KLQ A;  1QTM A;  3EUB 2;  1NNL A;  3M6K A;  2YMM A;  1NOM A;  8ICN A;  2AJQ A;  3Q8M A;  2JR5 A;  5G5H A;  1ZRM A;  3HW8 A;  2KVC A;  2ZXI A;  3S6J A;  5TIS U;  2BQ3 A;  5AI9 A;  4JB3 A;  3TAQ A;  2B21 A;  3BQ2 A;  3PMN A;  1YZ6 A;  3AU2 A;  3N4M B;  1SZH A;  3H8J A;  1KDH A;  3EW9 A;  5KT5 A;  2D3D A;  1D9D A;  3ETL A;  2H5X A;  7ICM A;  4TUR A;  4GC7 A;  1ZD3 A;  3MAB A;  2Q4T A;  2XID A;  3GII A;  3GIJ A;  1XNS A;  1Z3E B;  2W54 A;  1NI3 A;  3F2D A;  4K4G A;  5AKI A;  2ZTE A;  4C8M A;  3FDS A;  1MQ2 A;  4M9G A;  4J9K A;  1U9L A;  1RXV A;  3H8M A;  4EEK A;  4ED8 A;  1T8E A;  4XRH A;  4ED0 A;  5KL8 B;  3ISC A;  3EPI A;  3GIM A;  1PZN A;  4QZC A;  2KZM A;  1J2M A;  2V9W A;  4DF8 A;  4DFM A;  2EDU A;  4OJL A;  2UVV A;  2PFQ A;  4DF4 A;  5F3X B;  3B0Y A;  3N97 B;  4M2Y A;  2E8M A;  3G6V A;  2BHN A;  3NGD A;  4CF5 A;  5J2B A;  2M9N A;  2KKP A;  4NWI A;  3ISB A;  4IR9 A;  4DL4 A;  3BQ1 A;  1Z19 A;  4UB3 A;  2XGP A;  2IA6 A;  5AM2 A;  3V6K A;  3WK9 A;  5KT2 A;  3WKC A;  7ICL A;  1ZQR A;  4DL5 A;  3R9K A;  4UAV A;  5AI4 A;  5J0Y A;  2HHU A;  1IG6 A;  3MBY A;  4JWM A;  5KAF U;  4M9L A;  5J0R A;  1CUK A;  5KG7 A;  2H3V A;  2OEH A;  4Q44 A;  2F1I A;  3DDH A;  4ICA A;  4HAI A;  4R64 A;  2K4H A;  1WG8 A;  2VAN A;  5B66 U;  2GWS A;  4BX9 C;  3FAH A;  1F5S A;  3JPQ A;  5DB6 A;  2HHV A;  9ICK A;  5ALR A;  5T14 A;  2ZUD A;  3OPX A;  2GO7 A;  3GIL A;  4IQW A;  2BDP A;  9ICO A;  1UT5 A;  8ICV A;  4YR2 A;  4J9O A;  2I1Q A;  3HWT A;  5DQI A;  3CNH A;  4DCC A;  2RLT A;  3M9M B;  1TAU A;  3IG5 A;  4UB5 A;  1ZJN A;  2E8N A;  4OCZ A;  4NL9 C;  1JMS A;  1ARO P;  4P0Q B;  4NJ8 A;  1ZQV A;  3T5H A;  1XO1 A;  1L7M A;  3JPO A;  2C2E A;  3KOO A;  3MR2 A;  2XY5 A;  2OWO A;  3GFK B;  5HP4 A;  1WCN A;  2RRD A;  2LYA A;  1J2N A;  5J0W A;  2WF8 A;  2J6T A;  5JUM A;  1L7O A;  1ZD4 A;  5HR6 A;  3WKB A;  2JH1 A;  4I27 A;  4JUZ A;  9ICC A;  3ZD8 A;  4O3N A;  5KFL A;  3TAP A;  2FPL A;  3V6H A;  4IRK A;  2EAM A;  2Y1J A;  2B6G A;  2A3V A;  4YMM A;  3AUO A;  1Z00 A;  2H3I A;  2EH9 A;  2LBO A;  3QE9 Y;  4I29 A;  1B0X A;  4DQI A;  3NVY A;  4UAW A;  5AK6 A;  3PW0 A;  5KT3 A;  1ZQ1 C;  1QSY A;  5KFC A;  2W3S A;  4QW8 A;  5KFY A;  3L4P A;  4ZH4 A;  5KL1 B;  4Y2V A;  2W9M A;  4UB4 A;  3KKA C;  4UAR A;  5KFG A;  1KKX A;  5BOL A;  5KG0 A;  3QEB Z;  2K89 A;  1BPB A;  2DUY A;  2FMP A;  4KLL A;  3IRU A;  1ZQO A;  2RDJ A;  4DO9 A;  2VIX A;  1V97 A;  5DBA A;  3FYH A;  5ALO A;  4QWC A;  2KK0 A;  3L5K A;  4PHA A;  3AN1 A;  1X9S A;  4J9M A;  3QUB A;  1QQ6 A;  1RM6 C;  5EE1 A;  3GV7 B;  4Z6E A;  1PUZ A;  2NRW A;  9ICN A;  1ZJM A;  2LYB A;  1RYU A;  2DWQ A;  3H8S A;  3MGI A;  3GV5 B;  4EX6 A;  4FZL A;  3IV6 A;  5DB8 A;  1ZQE A;  4QZ8 A;  1SV4 A;  4DL6 A;  1N60 A;  2P66 A;  4DSE A;  1U48 A;  2ZUB A;  4ELT A;  2G0A A;  2AQ0 A;  1FFU A;  3KBB A;  3H4D A;  2JH7 A;  3PSP A;  3T79 A;  2RQ5 A;  1PK3 A;  1N5X A;  3TAN A;  1P7D A;  4GFJ A;  3KD3 A;  1KL9 A;  5KG3 A;  5KFQ A;  4KTQ A;  2A1J A;  2OHF A;  4RPY A;  5KFI A;  4E0D A;  9ICT A;  4NLZ A;  2MUT A;  5AKZ A;  4EEN A;  3E2E A;  4IRD A;  2FDR A;  1IIP A;  3SMV A;  2ZIX A;  1S76 D;  3RJE A;  4EX7 A;  1N63 A;  1BPE A;  4QWA A;  2HHX A;  2ZG6 A;  4TQS A;  1U47 A;  1N61 A;  5DBB A;  5HHI A;  2KKV A;  3C29 A;  4KLD A;  2XC9 A;  1X9W A;  4CCH A;  2MU2 A;  3D2N A;  5KFA A;  3F2C A;  2IHN A;  4IR1 A;  2E1E A;  3RJK A;  5AIA A;  5AM0 A;  5KFN A;  1KRP A;  1ZOL A;  5IIN A;  4ACO A;  1UT8 A;  2G5I B;  5J2H A;  2KFN A;  1TKD A;  2ZIW B;  1FO4 A;  4JMU A;  2LYH A;  8ICH A;  9ICB A;  2J6S A;  1S77 D;  2DQN B;  3D2S A;  4NLK A;  5AI5 A;  4RU9 A;  4NM2 A;  4PHP A;  2YMQ A;  2KSO A;  1A76 A;  7ICN A;  3NVW A;  4M6W B;  2OM6 A;  5AK4 A;  3ZD9 A;  2BCR A;  3H40 A;  2HCF A;  3AEV A;  4RUA A;  1MQ3 A;  1Q3U A;  2H3Z A;  1ZQX A;  4DS5 A;  2JEI A;  4Z6F A;  3M9O B;  3HIL A;  5AKX A;  5ALW A;  1ZQB A;  2IMW P;  2KD1 A;  4KLG A;  9ICQ A;  1ZQC A;  2WAQ C;  1COK A;  3WU2 U;  2E3T A;  2ES6 A;  2WF5 A;  3PX0 A;  5J2J A;  3RRG A;  5J29 A;  3UMC A;  3MDA A;  5HNK A;  1LKY A;  4ED3 A;  5ALD A;  5DKW A;  3QNM A;  2YB1 A;  1DGJ A;  3PR5 B;  1HUZ A;  1COO A;  4DQP A;  3KHL A;  2PFO A;  1B4F A;  2A1A A;  5CRX A;  2KN7 A;  2HW3 A;  1JRO A;  3UQ2 A;  4NY8 A;  4BUG A;  3VC8 A;  4EZ6 A;  5DDY A;  3TI0 A;  4A8E A;  1VJ5 A;  5KG4 A;  5AIB A;  4RT2 A;  2LKY A;  3NVZ A;  2W55 A;  1RQN A;  2FMQ A;  3RFA A;  4OJ6 A;  1SWW A;  3ALR A;  2E8P A;  4FO6 A;  3QUQ A;  3K4G A;  8ICU A;  3IP4 B;  3V7J A;  4J9R A;  1ZQS A;  5KT7 A;  4I2I A;  4YG2 A;  5KT6 A;  3KHG A;  4GXK A;  3SI8 A;  1SIJ A;  4FE3 A;  1BPY A;  5CJ7 A;  1N62 A;  2XGQ A;  1ZQK A;  1QSS A;  4F5P A;  2KZZ A;  1ZQL A;  4I2A A;  1XC9 A;  1MC8 A;  3NRZ A;  2AGO A;  4DLG A;  2DL0 A;  1Z1B A;  2BQU A;  1TFR A;  5KFR A;  4KMU A;  4QNL A;  2HOI A;  3MGH A;  1ECW A;  1Z4N A;  9ICP A;  4AP9 A;  3Q8R B;  1T3N A;  1VLB A;  5ALU A;  1T3Q A;  4F5R A;  1NJX A;  1SZP A;  5CEH A;  2G09 A;  3AQE A;  4KLT A;  1IV8 A;  1YZ7 A;  1ZQF A;  4B9V A;  1EXN A;  3MR3 A;  2KOB A;  1KFT A;  2MA1 A;  3ETR A;  2IOH A;  1BNP A;  1SGG A;  4NLB A;  4DWI A;  5DGB A;  2W7O A;  3PO5 A;  1TV9 A;  8ICL A;  5AK3 A;  4QJF B;  2FLL A;  4K4H A;  1S5L U;  2K8C B;  1X42 A;  3H0L B;  3BS5 B;  5IIL A;  2HOF A;  9ICX A;  2HBK A;  2KEY A;  5DG7 A;  2HDO A;  8ICS A;  1NJZ A;  2R8K A;  4LJX A;  4R8U A;  1DXS A;  3RRH A;  3GQC A;  5ALZ A;  4RT3 A;  3ONN A;  2I9G A;  1T4G A;  1ZRN A;  1ZQH A;  1SL1 A;  4I28 A;  2VA8 A;  4NLC A;  1RYS A;  2D6F C;  4G3I A;  5EE0 A;  3RAX A;  2BCQ A;  4DFJ A;  4RUC A;  9ICE A;  4IC9 A;  4KLH A;  1S8O A;  5AK5 A;  4RQN A;  4F72 A;  5J0T A;  4RQ5 A;  2VKQ A;  1BVS A;  5KG6 A;  3QU9 A;  5ALK A;  4UAS A;  2EZY A;  3RTV A;  1D8L A;  4KX5 A;  5G5G A;  4O3R A;  3RH5 A;  2HHS A;  4MFC A;  2MUT B;  4CE6 A;  4U7C A;  3TAR A;  1S9F A;  4IQV A;  5AIC A;  3HKZ F;  2O6K A;  9ICJ A;  2HSZ A;  1U45 A;  5IIM A;  1ZQP A;  1X6J A;  1CEZ A;  8ICF A;  5ALX A;  5EWF A;  5J0P A;  4C8L A;  8ICI A;  5D49 A;  5F9L A;  8ICP A;  5KNI A;  4I2E A;  1WWV A;  5ALT A;  3KHR A;  3AL0 B;  4Z6C A;  4FBU A;  5EE3 A;  2NYV A;  1NJY A;  2XVT A;  2ALZ A;  5ALN A;  1A0P A;  8ICY A;  1NK7 A;  4GXJ A;  4F8R A;  4WJ3 B;  2XIC A;  7ICE A;  2W9B B;  3MFH A;  2ZIU B;  3QUC A;  1ZQA A;  2E5S A;  3IN5 A;  1XO0 A;  4B6J A;  4BXO A;  5ALI A;  4J9L A;  1TK5 A;  5TZV A;  4YMN A;  2XCA A;  2W3R A;  5L1K A;  5CR0 A;  1KFS A;  5AI6 A;  5KFD A;  1NKE A;  4RNO A;  1BNO A;  3CP8 A;  4IL6 U;  2BCS A;  3ZDD A;  2K4P A;  4EEL A;  2K4I A;  1ZQZ A;  2KP7 A;  3KTQ A;  3SEN A;  3CW2 C;  1PVQ A;  3HT3 A;  3CRX A;  2ZJ5 A;  2G06 A;  1ED1 A;  9ICU A;  3AM9 A;  8ICG A;  1RYR A;  4F93 B;  1MA7 A;  4J9N A;  1SKW A;  5ALY A;  4I2D A;  2WFA A;  2DFL A;  3GZF A;  5AKY A;  4P4P A;  3BJY A;  4GLX A;  1JIH A;  4BJQ A;  3OGU A;  5KFF A;  5EWE A;  2AGP A;  4YR3 A;  4OJO A;  1ZQM A;  5C5J A;  1NK5 A;  4KX3 A;  3T5L A;  1TK8 A;  5ALL A;  4B9T A;  4JV0 A;  1SL0 A;  4UAZ A;  5J2G A;  4DFD A;  4QZI A;  2HHW A;  4DOB A;  3DV9 A;  1PK1 B;  2CPR A;  1XWL A;  1KTQ A;  3HJE A;  3T5J A;  2Y0S F;  5KFJ A;  3N7R C;  2FE9 A;  1PVP A;  5ALF A;  2YQE A;  2BCV A;  1NK0 A;  1GO3 F;  2I6X A;  1N2X A;  1U49 A;  5HR7 A;  1ZQJ A;  4F5O A;  2K8A A;  3AMZ A;  4PL2 A;  5KFM A;  4ED1 A;  3ZDA A;  3EYZ A;  4JWN A;  1NZB A;  7ICQ A;  4Y2Y A;  2W9C B;  1TVA A;  3OJS A;  2KJ8 A;  2JZB A;  1OW5 A;  8ICA A;  1QCK A;  5AI8 A;  5J0S A;  2DGZ A;  3QX7 A;  3FM9 A;  4PPX A;  4DOC A;  3M8R A;  2YML A;  4FZN A;  3L3F X;  1NK4 A;  4YVZ A;  5AKJ A;  5AKH A;  2RDI A;  4YCX A;  3C23 A;  4YXM A;  2JHD A;  3M7D A;  3TAD A;  4RQ4 A;  4P0P A;  5IIK A;  2BPC A;  4C4R A;  1DK3 A;  1QQ7 A;  4P2H A;  3LK9 A;  8ICW A;  2DPJ A;  4ED7 A;  3C1Z A;  1UA1 A;  5F9N A;  1ZQT A;  1JAL A;  3UXO A;  5KG1 A;  4DQR A;  2KIC A;  4FFD A;  2JV3 A;  1B22 A;  4DFK A;  4QZ9 A;  5J2I A;  3O0F A;  4HYK A;  2C2R A;  3QU4 A;  1KLN A;  2BCU A;  3PO4 A;  5KFS A;  4C0Z A;  4TUQ A;  1SXD A;  3PW2 A;  1NK6 A;  2GLE A;  3UQ0 A;  4M0A A;  2DKX A;  3WKA A;  4F71 A;  1IXR A;  2KIV A;  4UBB A;  5CHG A;  1C7Y A;  4Q8E A;  4ECX A;  1L3T A;  2NV3 A;  3QEA Z;  2WF6 A;  2R8J A;  4PHD A;  2ESE A;  3WKE A;  2J6U A;  5J0X A;  3PV8 A;  4GIB A;  2WTF A;  4Y2R A;  3RJI A;  1NZP A;  4UAU A;  4Y2Q A;  4J9P A;  4K4I A;  1Y88 A;  3WK4 A;  4FBT A;  3LYS A;  2W9A A;  4FZM A;  7ICU A;  1V85 A;  4AYB F;  5KFU A;  4CF3 A;  5D4B A;  4B9L A;  1JN3 A;  4QZG A;  5AKL A;  2PMZ F;  4MF8 A;  7ICK A;  5ALV A;  1WCL A;  2ASD A;  1QSL A;  7ICV A;  5DQH A;  4MHV A;  3N7P D;  4PHE A;  4M47 A;  1KBU A;  2KFZ A;  2R8I A;  4OD0 A;  1URJ A;  4DQS A;  1D8B A;  2QB0 A;  4YD1 A;  4PGQ A;  1NK9 A;  3SAF A;  2XY6 A;  5DLG A;  2F3N A;  2LMR A;  3RB0 A;  3FC4 A;  3MR6 A;  2E8O A;  4ECU A;  3MFI A;  4GC6 A;  4CDG A;  2XY7 A;  4J9Q A;  4B9S A;  1SKR A;  2WB1 F;  4TUP A;  2AXT U;  1ZQD A;  4MFA A;  2MRL A;  3N7S C;  3WK8 A;  3EZ5 A;  1TAQ A;  3HPO A;  1QLN A;  2V4R A;  1CI4 A;  4NV0 A;  4PZN A;  3Q8P B;  5III A;  4MFF A;  4F3O A;  4QZA A;  1HIW A;  4UAT A;  5K4L A;  3ICX A;  2HBL A;  2FLP A;  3QZ8 A;  3TFS A;  4Q8F A;  2Z7J A;  3LDA A;  4NXZ A;  2KV2 A;  3H0R B;  4KLU A;  4ECQ A;  1UQV A;  5JU5 A;  2CXY A;  3GV8 B;  1L8L A;  3ORY A;  2P35 A;  4QIW F;  4US9 A;  5J2C A;  2BDU A;  2NRV A;  3OHA A;  4F4X A;  2BQR A;  3PW7 A;  4Y2U A;  3F2B A;  2W11 A;  4PL1 A;  5AM3 A;  2P6R A;  3SD7 A;  2KVS A;  3SV4 A;  3K75 D;  3PW4 A;  1C20 A;  4JK1 A;  3F53 A;  9ICS A;  3QXG A;  5ALJ A;  3C2L A;  3NS1 A;  9ICV A;  3RB4 A;  1X6I A;  3H7I A;  4UB2 A;  5B5E U;  2QB1 A;  5J2E A;  3T5K A;  1J97 A;  4GXI A;  1UPH A;  5KG2 A;  4NM1 A;  5KFE A;  2B0C A;  2KE7 A;  4PGY A;  1S0N A;  1L6N A;  2JZB B;  5DG8 A;  1X2I A;  3KHH A;  8ICQ A;  9ICR A;  3IM1 A;  1Q8K A;  4R66 A;  2YN4 A;  7ICF A;  9ICM A;  4O5E A;  2M0N A;  3GU3 A;  1S0V A;  3SZ2 A;  3PNC A;  4ECR A;  2KTQ A;  3I1Y A;  1LVH A;  2G08 A;  2ZTD A;  3HP6 A;  4KLF A;  2F8K A;  2JMG A;  3H4B A;  4ELU A;  2ZTC A;  1O08 A;  2K4E A;  5AHX A;  3BQT A;  4C7Y A;  2R8G A;  2F44 A;  1WYG A;  3OJU A;  4YFK A;  2W8L A;  5J2A A;  3SQI A;  2A19 A;  1Z00 B;  1VDV A;  2WHE A;  5IIJ A;  5ALH A;  1OXJ A;  4QWE A;  2V4Q A;  2XCP A;  2QAR A;  8ICM A;  3C2M A;  2PKE A;  2R18 A;  5KFH A;  3BS7 A;  2YX8 A;  4R63 A;  4PJ0 U;  4O3Q A;  3BDP A;  5CP2 A;  2LI6 A;  4P0Q A;  3HX0 A;  4R65 A;  3ISD A;  2BZF A;  4C7Z A;  1L7N A;  4J9S A;  2KJ9 A;  3M6Z A;  2KHV A;  3I76 A;  1FEZ A;  1JUD A;  1D8Y A;  5BPC A;  4B9N A;  4Y2X A;  1SKS A;  4QWB A;  1DGS A;  3QU5 A;  3QZ7 A;  1T94 A;  5J8Y A;  2ASL A;  2RHF A;  3K1R B;  2IBK A;  1NKC A;  3VCB A;  1V38 A;  4IQT A;  2ZIV A;  1X40 A;  3I28 A;  1L7P A;  2OCE A;  2LHT A;  4F92 B;  2ZUC A;  4U6P A;  4NL9 A;  4IQU A;  5J0O A;  4BWJ A;  5C0Y A;  4DL3 A;  2KMD A;  5DGA A;  3G6Y A;  2F77 X;  5GTH U;  2F8L A;  2EZZ A;  3BZK A;  1JRP A;  5ALP A;  2ODG A;  3RJH A;  1JXL A;  4O5K A;  2PI5 A;  3JPN A;  1SL2 A;  5J0U A;  4JV2 A;  3D2Q A;  4I2G A;  2CN1 A;  4NLG A;  3PX4 A;  1HEK A;  1KN5 A;  8ICC A;  1Q3V A;  5JRT A;  4PZO A;  2QB0 B;  5AI0 A;  4O5C A;  1IM4 A;  5L1J A;  1HUO A;  3UM9 A;  5ALE A;  2A1J B;  3OSP A;  1MSW D;  4CRX A;  5DLF A;  2EAN A;  3QYP A;  2C22 A;  3IHQ B;  2FJ6 A;  3GIK A;  3PST A;  4C4T A;  4ZOH C;  3E58 A;  1UA0 A;  5ALQ A;  4Y2S A;  2ZIX B;  2PFN A;  2HHT A;  3LVW A;  5AKE A;  4RNM A;  1AQ6 A;  4YR0 A;  3C5F A;  5KFT A;  4I2C A;  3RBE A;  4X5V A;  3MDC A;  3ZDB A;  5GTI U;  2LM1 A;  5L1M A;  9ICW A;  4YXJ A;  2YMP A;  3M9N B;  1JX4 A;  2ZXH A;  4P4O A;  4EYH B;  2ISP A;  3B9J A;  8ICB A;  5KFB A;  4Y2P A;  4IS7 A;  5HMM A;  2LM4 A;  1OUQ A;  4Y2T A;  4DOA A;  3BZC A;  3MC1 A;  1X66 A;  1SWV A;  2YTU A;  4F91 B;  1ZQQ A;  3C28 A;  3KKA A;  1DOQ A;  3SV3 A;  3NAS A;  2AU0 A;  8ICZ A;  1BPD A;  2KSO B;  1QQ5 A;  5KT4 A;  4KLJ A;  3PY8 A;  5ALS A;  4ECV A;  3RJJ A;  3D6J A;  7ICS A;  2EQY A;  1MN8 A;  1SV0 A;  4ECZ A;  2K8B B;  4MF2 A;  2ZJA A;  3ED5 A;  3WK6 A;  2OH2 A;  4NLN A;  3SR6 A;  2VA2 A;  5CA7 A;  1N56 A;  3RH6 A;  2FPM A;  4US8 A;  3NRW A;  5ALG A;  3V7L A;  5KFV A;  2ISO A;  5KFZ A;  4EEY A;  3ZDE A;  4RQ2 A;  3UXP A;  1HJP A;  3QU7 A;  4UBC A;  4ECY A;  3BQ0 A;  5A0L A;  1LKY B;  3JPP A;  4EBC A;  2D8C A;  3RF9 A;  1ZXI A;  7ICI A;  1ZYQ A;  2AGQ A;  4ED2 A;  1BPZ A;  2FLN A;  2GH1 A;  2HBJ A;  4O3S A;  1L8O A;  5DG9 A;  5KFW A;  4RQ6 A;  4UB6 U;  3HRD D;  3OSN A;  2IOF K;  2QLT A;  1RG6 A;  4F4K A;  5H2F U;  5J0Q A;  2N1R A;  2ZIW A;  1N5W A;  9ICI A;  2JGA A;  4ECW A;  5JTI A;  5IIO A;  5KFO A;  2ATL A;  3N28 A;  3PZP A;  2W04 A;  1NJW A;  3HKZ C;  3TKA A;  4PH5 A;  4I2B A;  4M9J A;  3V6J A;  4M9N A;  4M6W A;  4UW9 A;  3TAC B;  4KN4 A;  1RPL A;  2YB4 A;  1Z1V A;  2L5Y A;  2I5H A;  4DSF A;  3WK7 A;  1ZQU A;  5EWG A;  4BGD A;  7ICO A;  4ECS A;  1CRX A;  4LZG A;  1O03 A;  5J8Y C;  2P6U A;  3KZX A;  4O3O A;  5DBC A;  2JEJ A;  1B43 A;  2XI9 A;  4C8O A;  2QAR B;  2BR0 A;  7ICR A;  3MR5 A;  2HVH A;  1ZD5 A;  1SXE A;  2EZX A;  4QZB A;  5D46 A;  4OO1 J;  1L3U A;  5KFX A;  5EE9 A;  2Q0Z X;  3UXN A;  4DSI A;  3EWA A;  2AQ4 A;  4I2H A;  2HVI A;  2JXJ A;  3K1Z A;  4C8K A;  4RZR A;  1BPX A;  2WF9 A;  3IG8 A;  4YMO A;  4XQ8 A;  1ZQG A;  4YQW A;  5L1I A;  2AH5 A;  3JPT A;  3THV A;  7ICH A;  3LVV A;  5CB1 A;  3B0X A;  1Z4O A;  4KIT B;  4Q43 A;  3JPS A;  2IHM A;  2UVW A;  2F1J A;  4FS1 A;  4KLM A;  4RPZ A;  1F0M A;  3RR7 A;  2ZIV B;  1UHU A;  8ICO A;  4TQR A;  3RB6 A;  3T3F A;  1U4B A;  1KW4 A;  2KG5 A;  1RDF A;  3Q8S B;  7ICJ A;  4FS2 A;  3F5E A;  9ICA A;  4YD2 A;  3NTU A;  2EAP A;  5AM4 A;  4F4Y A;  4RQ7 A;  4Y2J A;  4MEY A;  4R8U B;  4B9U A;  4F2S A;  8ICT A;  1T7P A;  2PI4 A;  1KEJ A;  3AU6 A;  4CGZ A;  5KAI U;  4YN4 A;  2WF7 A;  2Y1I A;  4QWD A;  4YP3 A;  2Y0S C;  4RQM A;  3UMG A;  4RQ3 A;  4BDP A;  3OHB A;  4DSL A;  2G07 A;  3UMB A;  3SAG A;  8ICK A;  2PXI A;  4KLE A;  1K5O A;  1KSP A;  5DQG A;  1X9M A;  3WK5 A;  5J2F A;  3M8S A;  4UAY A;  2MAX A;  3DEE A;  1Q46 A;  4DLE A;  3LWL A;  4USA A;  4QW9 A;  4DS4 A;  2KNJ A;  4DQQ A;  2Y9T A;  3SYZ A;  2FI1 A;  1ZET A;  1S97 A;  3TFR A;  5KTQ A;  1ZQN A;  2W43 A;  1SV0 C;  4M04 A;  1TK0 A;  4CF4 A;  3QU2 A;  3Q8L A;  3C5G A;  3BS5 A;  1L3S A;  5EOZ A;  3RH4 A;  3RAQ A;  3V72 A;  3PX6 A; 
#chains in the Genus database with same CATH homology
 2K89 A;  3AQF A;  2VJ4 A;  4ACO A;  2G5I B;  3K1Z A;  3NUQ A;  4KX5 A;  2GOL A;  1XNS A;  5C0Y A;  4BJQ A;  2KIC A;  2F77 X;  2ZIW B;  3PSF A;  2M0N A;  3IG8 A;  4JMU A;  3GU3 A;  3F2D A;  3NRW A;  2F8L A;  2VIX A;  3O0F A;  4OJO A;  4CDG A;  3D2S A;  2DQN B;  4KX3 A;  4U7C A;  1Z1B A;  4C0Z A;  3LVV A;  3IG5 A;  2G08 A;  2WAQ F;  2WB1 F;  3PSI A;  3HKZ F;  4QNL A;  2OM6 A;  2MRL A;  2HOI A;  5A0L A;  1ECW A;  2JMG A;  3D2Q A;  3N7S C;  2CN1 A;  2CPR A;  4O3M A;  4P0Q B;  3RF9 A;  3MGV A;  2KIW A;  3KFU F;  5KL8 B;  1HEK A;  2K4E A;  2CRX A;  1Q3U A;  4NV0 A;  2Y0S F;  2H3Z A;  1Q3V A;  2NV3 A;  2GH1 A;  2HBJ A;  1TAM A;  2ZIV B;  2LYB A;  1HIW A;  3SAH A;  3SQI A;  1WUD A;  2OYY A;  3ICX A;  3N7R C;  2HBL A;  2KHQ A;  3AL0 B;  2G09 A;  2DF4 B;  1PVP A;  2G5H B;  4OJL A;  4CRX A;  3AQE A;  2RRD A;  2LYA A;  1YT3 A;  3F5E A;  4FZL A;  1A6S A;  2N1R A;  2XVT A;  2ZIW A;  2Z7J A;  2E1F A;  2JGA A;  2KOB A;  1A0P A;  2KD1 A;  3PST A;  1GO3 F;  2MA1 A;  4WJ3 B;  2H3Q A;  2WAQ C;  2KV2 A;  2WB1 C;  2XIC A;  3H0R B;  3PZP A;  5HR7 A;  2ZIX B;  2RP5 A;  2W04 A;  4OJP A;  3HKZ C;  4NLB A;  4CGZ A;  2K8A A;  2R18 A;  2KKP A;  2ZIU B;  3LVW A;  4NWI A;  4PL2 A;  2JH1 A;  5HR6 A;  3LYS A;  2W7O A;  2YX8 A;  2G0A A;  4FZM A;  2E5S A;  3F5A A;  3IN5 A;  1Z19 A;  1XO0 A;  1NZB A;  4P0P B;  4P0Q A;  4AYB F;  2Y0S C;  2YB4 A;  2JH7 A;  2PMZ F;  3PSP A;  3T79 A;  2YB1 A;  3OPX A;  2KJ8 A;  1P7D A;  4QIW F;  2KJ9 A;  3M6Z A;  3M6K A;  4QJF B;  3H0M B;  2KHV A;  2ZXH A;  2G07 A;  2K8C B;  2DGZ A;  2BDU A;  4GFJ A;  3H0L B;  3SAG A;  4KMO B;  2A3V A;  5CRX A;  1PVR A;  3F2B A;  2HOF A;  2F2A B;  3E0F A;  3VC8 A;  4BUG A;  2H3I A;  4PL1 A;  4FZN A;  2LBO A;  2HBK A;  1CRX A;  2KEY A;  2KVC A;  2ZXI A;  4A8E A;  3L3F X;  1OUQ A;  3GZF A;  3CP8 A;  2HOQ A;  3DEE A;  2KJ5 A;  3KZX A;  3F53 A;  2LKY A;  3N7P D;  2H3F A;  2H3V A;  2K4I A;  3C28 A;  1IIP A;  3CYM A;  2W03 A;  3ONN A;  3SMV A;  2ZIX A;  4ICA A;  1KBU A;  1T94 A;  2XI9 A;  2KNJ A;  2F76 X;  2JHD A;  4OJ6 A;  3RFA A;  3M7D A;  1PVQ A;  2ZIU A;  1F44 A;  3ALR A;  4AYB C;  1ZQ1 C;  2K4H A;  2RHF A;  4NLC A;  3CRX A;  2PMZ C;  2D6F C;  1DRG A;  1URJ A;  3VCB A;  1SZH A;  3IP4 B;  4P0P A;  4QIW C;  2ZG6 A;  2G06 A;  4BX9 C;  1UPH A;  1ED1 A;  2ZIV A;  1D8B A;  2KKV A;  4OJ5 A;  3C29 A;  4IC9 A;  3SAF A;  4OO1 J;  2HBM A;  1MA7 A;  2LHT A;  2HMX A;  5KL1 B;  2W7P A;  5T14 A;  3F2C A;  3D2N A;  2K8B B;  2E1E A;  2VKQ A;  4FE3 A;  4U6P A;  2OH2 A;  1L6N A;  2OXO A;  2VJ5 A;  2Q4T A;  2XID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...