4IC9A

Crystal structure of the full-length matrix subunit (p15) of the feline immunodeficiency virus (fiv) gag polyprotein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
GQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p15
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4ic9A00
4JMUA 2LYAA 2H3IA 1ED1A 1HIWA 2N1RA 2HMXA 1L6NA 2K4HA 1UPHA 2K4EA 2H3FA 2LYBA 2GOLA 1ECWA 2H3VA 2H3ZA 2JMGA 4IC9A 2NV3A 1HEKA 2K4IA 1TAMA 4ICAA 1A6SA 2H3QA
chains in the Genus database with same CATH superfamily
4JMUA 3Q8MA 1FFVA 4RNMA 4IR9A 4F93B 4G9BA 2N1RA 4YVZA 4KLOA 3O0FA 2HBKA 5J0XA 3GIJA 4QW9A 1DGSA 3L4PA 3RRGA 4DQSA 2E1FA 1TAMA 4C0ZA 1JUDA 3SENA 4DSJA 3S6JA 1WCLA 3TANA 3G6YA 4DSEA 5JUMA 1DXSA 9ICMA 1NK0A 2F1HA 1WUDA 4C8NA 1BGXT 1S77D 2QB0B 8ICPA 2ZIVB 4J9SA 5F9NA 5KFGA 4UB6U 4EEYA 2ZXHA 1COOA 3JPSA 3CYMA 3TARA 4DSLA 4CE6A 1X40A 1JN3A 4TQRA 2PXIA 4YXJA 2MAXA 5DG8A 3KKAC 3BQ1A 3V6HA 1ZQGA 3NVYA 4IC9A 8ICBA 2KVSA 3UXPA 2KHVA 2BCRA 5ALOA 4ICAA 7ICQA 3RJFA 2KP7A 3GDXA 2HOQA 3TQ1A 2ATLA 2HHQA 2Q4TA 2JR5A 1PUZA 4GC6A 1L6NA 4O3OA 4DSFA 3T5KA 4CGZA 4DO9A 8ICKA 1DK3A 2NRVA 4OD0A 2LYBA 4Y2UA 3PX0A 1B0XA 1L7OA 4UBBA 1L8LA 4FFDA 5ALLA 5ALDA 1A6SA 2W7PA 4E0DA 3F2CA 1Y88A 1XC9A 5KFRA 1L3VA 3IG5A 3NVWA 3MABA 3NTUA 4TURA 2DKXA 3RFAA 4RUCA 3MR5A 1QSYA 1ZRMA 2C28A 2ISPA 5AIAA 5F9LA 3H0LB 1XS9D 5KFBA 4KLIA 4JUZA 4FE3A 4MF8A 3SD7A 2WTFA 3EWAA 4F8RA 5J0SA 2W8KA 5KAIU 2K8BB 3VC8A 2QARB 4G3IA 3H4DA 2JZBB 4DF4A 2YMPA 9ICJA 3RBEA 3F5AA 1RYUA 2KE7A 4CNQA 2EDUA 1T94A 2C2RA 3MBYA 1SL0A 1U4BA 3B0YA 1CEZA 2CPRA 2JEIA 1Z4NA 2KIWA 4A8EA 1LKYA 3ONNA 1PK3A 5BOMA 2R8GA 5DLFA 4YR0A 1KLNA 4F71A 4DFMA 5AKHA 3SI8A 2FMSA 4J03A 7ICVA 4KX5A 4CF4A 1KQQA 4GIBA 3WKAA 5J0TA 1ZQLA 2BDPA 1ZQKA 4C4RA 1SV0A 1SKWA 3F2BA 8ICGA 4J9LA 3LYSA 4KLGA 3SAHA 3KKAA 2LPEA 1NK9A 3QZ7A 5KG7A 1IIPA 2CRXA 2RRDA 1N60A 7ICSA 2BQ3A 2ZTEA 1D9DA 2R8HA 4F5QA 2FPMA 2W9AA 5DQIA 2JV3A 4RQ6A 1MC8A 5J2BA 4J9KA 3DV9A 4MFAA 3Q8KA 1BVSA 2K4IA 1T3NA 4UARA 3TKAA 4RPZA 1ZQTA 2YQEA 3ISBA 1H38A 3D6JA 2YMLA 2P66A 4UAYA 1D8YA 4O3PA 4PHPA 2ZIUA 2PMZC 4R65A 2EANA 9ICQA 1X9WA 1X9SA 4DL7A 2E5SA 7ICHA 4LJXA 5J2KA 8ICLA 2H5XA 3HW8A 3PNCA 4C80A 1Z00A 2ASJA 1XSPA 3IV6A 4QWDA 1S0NA 5IIOA 2BKEA 4F5OA 4BWMA 2V4QA 2NRWA 2Y9UA 1V38A 1WWUA 3I28A 5ALXA 8ICWA 1K1SA 1PVPA 4K4HA 2LM1A 4QWAA 2OYYA 9ICFA 3QE9Y 1BPEA 1SZHA 2LYAA 1Z3EB 3SAFA 2ZJ8A 3DDHA 2L5YA 4KLUA 1FEZA 4OCZA 8ICXA 2A1AA 1L7MA 1VJ5A 1ZQDA 9ICBA 1NJXA 1RQNA 8ICAA 2KVCA 1RYRA 4EBEA 2WF6A 1U47A 1NK7A 1ZQMA 2JRZA 4Q8FA 1N63A 3WK7A 3TFRA 1F0MA 1NZPA 2G09A 4QIWC 4DWIA 2KICA 3CP8A 1OUQA 3OGUA 1B43A 3KBBA 1BPDA 3EYZA 3ORYA 2HHUA 4PL1A 1HEKA 1SV4A 4RNOA 3V6KA 4DS4A 4F4YA 3PO5A 2K4PA 4P0QA 2UVWA 2M9NA 1YT3A 8ICMA 4YR3A 2MRLA 5KG0A 4P0PB 4KLQA 2KSOA 1KEJA 1TVAA 2G5IB 1XO0A 2HHXA 9ICEA 1XU4A 4AP9A 5KFEA 2XCPA 8ICQA 2W54A 3JPNA 8ICOA 3H8JA 4UASA 4KLDA 2H3IA 2AGPA 1L3TA 5AIBA 4F5RA 1NK5A 2XY7A 3ZDDA 9ICWA 2W55A 1ZQSA 1RYSA 5HMLA 2XGPA 3RB4A 2LM4A 5DDYA 3HRDD 4Y2SA 2BPFA 3AL0B 2HHTA 2KTQA 1RPLA 2E1EA 2DQNB 3RB0A 2ZIXA 1TV9A 2WHEA 1GO3F 2KFNA 2PKEA 3MC1A 4O3QA 3ETRA 2UVRA 4CRXA 1XWLA 4KN4A 4ED0A 1QTMA 2DF4B 5J0WA 1FO4A 1S10A 3QZ8A 1UHUA 4NLKA 2DFLA 2ZXIA 3V7LA 1KFTA 4UB5A 4F5NA 4JB3A 4XRHA 4F72A 4DLEA 3E2EA 2F76X 3RAQA 3GQCA 4AYBC 2HVIA 4I2GA 5J0RA 5ALEA 4QJFB 3PO4A 1TK5A 1NNLA 7ICNA 9ICUA 2Y0SC 4DCCA 4I27A 1QLNA 3C1ZA 2W11A 5DBCA 5KT2A 4Y2YA 5ALZA 1A77A 2ES6A 3ISDA 1ZETA 2A1JB 2Y1IA 3SEIA 4UB8U 4MHVA 4R63A 4I2IA 1DGJA 2PI4A 2VA2A 1HUOA 4NL9A 1BNOA 3TI0A 3RJHA 2FI1A 1JI7A 3R9KA 2EAOA 4QIWF 3EPGA 2H3ZA 3QUQA 5ALQA 5AK6A 5KT5A 4JV2A 5HHIA 1X9MA 4ED1A 3L3FX 5KL8B 2KZ3A 4YD1A 2C22A 7ICJA 4UB2A 2ZUCA 5KT6A 3KHHA 4BXOB 4B9VA 4DSKA 2KK0A 1N48A 3SV3A 1ZQ1C 4DSIA 1DOQA 1XSNA 3HWTA 7ICPA 4NY8A 2FMPA 4YR2A 4MFCA 4DL5A 8ICHA 5IIIA 3F5EA 3UMCA 1TE2A 1Z1VA 5IINA 4QZIA 1VLBA 2VA8A 4C4TA 2QKQA 2W9CA 4IQVA 1LB2B 4QWCA 4DL2A 4QZ9A 1ZQUA 3HT3A 5HHHA 3OJUA 5T14A 3ZI4A 4KMUA 4DFDA 4RUAA 1OW5A 1T3QA 5IIJA 1SGGA 2W9BB 4J9PA 1QH9A 5FP0A 4ECWA 4FZMA 4F2SA 3MFIA 4UAZA 5AI0A 4EEKA 3N7SC 1PK1A 2F3NA 2VKQA 3NVVA 5KL1B 5EOZA 2BZFA 1KDHA 4KLHA 2VJ5A 5KFHA 5KG1A 1X66A 5EE0A 2WB1F 2K8AA 3MDCA 1AQ6A 5AK3A 4MFFA 3CRXA 3JPOA 3PSTA 4QZBA 2EH9A 4J9NA 3PX4A 1ZQOA 2DL0A 5KT7A 3HKZC 2E8PA 2QB0A 3WKDA 3GV7B 2ZIVA 4GXKA 3ZD8A 3PZPA 4OJ5A 5ALVA 8ICVA 3Q8SB 9ICVA 2RP5A 4F3OA 2FLLA 5L9XA 4USAA 4O5KA 2E3TA 1LVHA 4KLFA 5D49A 3AN1A 2LYHA 1KKXA 5ALTA 5ALPA 5KFXA 3V72A 9ICTA 3AU6A 3F2DA 9ICSA 1DK2A 3OPXA 3A0BU 4ZOHC 3UQ0A 3BJYA 4CCHA 4FBTA 5AICA 3WKEA 4UB1A 4B9NA 1MQ3A 2W9MA 3QUCA 5ALHA 3QUBA 4ED7A 1UCVA 2AGQA 2NV3A 2PFOA 5J0PA 1PZNA 3BS5B 1D8BA 7ICOA 3BQ0A 2NRXA 4C8LA 4M9LA 2B6GA 4I2AA 3LK9A 4RT3A 4NLZA 2EZZA 4M9HA 1SV0C 5JRTA 1T4GA 1BPBA 3BQTA 5KFMA 4KLJA 4M6WB 4PJ0U 2C2DA 1C20A 5J2DA 2ZTDA 3IN5A 2W43A 3TADA 4OJPA 2E8MA 3LWLA 3QU5A 5ALJA 4C7ZA 2XICA 3T3FA 4RQ5A 3QU2A 1TAQA 5AHXA 3K4GA 3UPQA 1V85A 4Z6CA 3MFHA 3EZ5A 2BR0A 2AXTU 3IG8A 2YMMA 4YXMA 5CWRA 2B21A 1NI3A 3PW4A 4DQPA 4Y2QA 3GIIA 4UQGA 2JEGA 2IOHA 3N28A 5KFUA 2VJ4A 5AI6A 1VDVA 5KFFA 4NM2A 4R8UB 3PW0A 1ZXIA 4KLSA 2ZIWA 1KTQA 2W3RA 3H8MA 5AKKA 4F5PA 5ALIA 1KSPA 3AU2A 4O3MA 2BHNA 1SWVA 3G6XA 2ISOA 5HNKA 4NLGA 2BCQA 3ZDEA 1B22A 4OO1J 1YZ7A 4KLLA 4ECVA 4EZ9A 1ZQHA 1L7NA 3RB6A 5L1JA 4ELVA 9ICLA 5DB7A 1Q46A 4UAWA 4Q43A 3FC4A 3ZDBA 3MR6A 1XNSA 4IS7A 2AJQA 3AM9A 4J9RA 4DS5A 3A0HU 9ICAA 5ALFA 4RQMA 2ASDA 4P4PA 3RJKA 3WU2U 2XVTA 3GIMA 4JK1A 9ICIA 1NK8A 2WAQC 4PH5A 1BPXA 1L7PA 4J9MA 4PHEA 2KHQA 5AKGA 3H0RB 3WK8A 2V4RA 2V9WA 3T5JA 5TISU 2EZXA 3IM1A 4YMOA 4O0IA 5KFYA 7ICUA 5G5HA 4I29A 4M04A 2IOFA 4X5VA 3UQ2A 2KJ9A 3ETLA 2HSZA 4NWIA 3HPOA 5KFPA 4RQNA 4EBCA 1L3SA 3QXGA 2D6FC 1WG8A 4OJOA 2E8NA 4LVSA 3DEEA 3PMNA 1LKYB 1S9FA 4Q45A 8ICJA 3RJGA 2EZYA 1QSLA 5J0YA 2FPLA 3RBDA 1KW4A 3AUOA 1DRGA 2FLNA 2F77X 4JV1A 1SKRA 4YCXA 4GC7A 3H40A 3HJEA 5DGBA 2ZUBA 5CA7A 9ICCA 2B0CA 2E8OA 1ZRNA 3PX6A 4DEZA 1RG6A 2G06A 4LZGA 3OSNA 4Y2PA 1KFDA 4UAVA 2O6KA 1KL9A 4UATA 4ED6A 4F92B 2AU0A 1KRPA 3BS7A 5J8YA 2KV2A 1QQ5A 5C5JA 1ZD4A 3BQ7A 1HIWA 4QZAA 2K4HA 2I5HA 3FYHA 3D2QA 4C8OA 1Z1BA 3GZFA 3WK6A 2ZTCA 3RH4A 4ZH4A 2BPGA 1B4FA 2G07A 2KEYA 2ZIUB 1V97A 3SZ2A 1CUKA 2KKVA 3NVZA 3V6JA 2WFAA 4RZRA 5GTIU 5B5EU 1KN5A 4QNLA 1A0PA 4CF3A 2C2EA 1UT5A 1Z00B 3FM9A 3KZXA 2FLPA 8ICUA 8ICSA 4XUSA 3BQ2A 5EE9A 3N7RC 2XC9A 1AROP 2Y9TA 8ICIA 2FPKA 1ZQWA 1ZQRA 1IV8A 2YX8A 5CEHA 4GXIA 4NL9C 1SZPA 2MU2A 2MUTA 1COKA 4PPXA 2KZZA 2KN7A 4ECQA 3KHGA 3G6VA 4M47A 4Y2RA 3OSPA 5EE3A 1O08A 4RQ8A 1MQ2A 5KFZA 3M8SA 2KMDA 1U45A 1N56A 4O5EA 3THVA 4MEXA 4R64A 5BOLA 4FS2A 1NJYA 1ZQQA 5DDMA 5AK5A 1L3UA 1JX4A 5KG2A 4RQ1A 4DQRA 3M9MB 3M6KA 4DFPA 2KIVA 3C2MA 2LKYA 2H3FA 4ECYA 4BGDA 3C1YA 4PZOA 5CB1A 5DG7A 2XCAA 4RU9A 1TK0A 5L1IA 2PMZF 1SXDA 5KG6A 7ICRA 5KFAA 4EX6A 1ZYQA 4B9MA 2F1IA 4QZDA 4BWJA 2XY5A 4UW9A 1N62A 2PFQA 3PY8A 3C29A 2XIDA 2Z7JA 4IQUA 4DL3A 4P0QB 1TFRA 4GLXA 4LZDA 2JEFA 4RT2A 2JHDA 3K1ZA 7ICGA 1RDFA 5J2IA 3I76A 2KSOB 1TK8A 1RQLA 5KFCA 3MGVA 1RM6C 5AKZA 5IIKA 4EYHB 4C8MA 4RQ7A 5EWFA 3B9JA 1K5OA 2NYVA 4P4OA 1ZQFA 5C0YA 2HHWA 5HR7A 2WF5A 1Z19A 4ELTA 2ZUDA 3UM9A 4ECZA 3IDWA 4Q44A 4FZLA 4RQ2A 3KTQA 2ZIXB 4RQ3A 9ICPA 3VCBA 1S0MA 3Q8RB 3SQIA 2D8CA 3RRHA 2AHOB 2H3QA 3TFSA 1HUZA 5DB6A 1K1QA 1D9FA 3ZD9A 1X6IA 3QU9A 1CI4A 2GO7A 9ICNA 2OH2A 4IRDA 3MR3A 2CXYA 2J6TA 2DPIA 3GIKA 1UQVA 4P2HA 4B9UA 3D2SA 1MSWD 4QWEA 7ICIA 8ICNA 4Y2VA 1SXEA 2Y1JA 4I2FA 1PVRA 5F3XB 8ICYA 4RPYA 8ICEA 3N4MB 4M9JA 3ZDAA 3NRWA 8ICCA 3IHQB 3OHAA 5KAFU 2PI5A 2BQUA 2GOLA 4FZNA 4U6PA 5AI8A 5L1MA 2BCUA 3AQEA 2BGWA 3RTVA 7ICLA 1BPYA 5AM1A 5KFNA 3AEVA 4UB4A 2RHFA 2K8CB 3GU3A 4KITB 5AM4A 5AI9A 3TAQA 4O3SA 5ALWA 3NRZA 3NASA 4IQWA 2XI9A 3CW2C 5K4LA 2R8KA 1M6YA 1WCNA 4QZGA 4ECUA 3TADC 1LV5A 1NOMA 2KD1A 2IMWP 4PL2A 3JPRA 3SAGA 2YB4A 1D8LA 2RDJA 1O03A 1ZQNA 2JH7A 5KFDA 4EELA 2ASLA 3LDAA 4I28A 2K4EA 4DL4A 4BDPA 1NJZA 2AQ4A 3N7PD 1JMSA 4BX9C 4Y2TA 5DBBA 2NRTA 4AYBF 1JIHA 4IRKA 1U9LA 8ICTA 4O3NA 9ICKA 2DKZA 1A76A 2DUYA 1BNPA 3RR7A 2Y0SF 2R8IA 2RQ5A 2KZMA 1X42A 1MN8A 2W9CB 3OJSA 4O3RA 1JRPA 2OHFA 5G5GA 3C21A 2R8JA 1ZQPA 1ZQEA 5CHGA 4CF5A 1RXVA 4NLCA 2GH1A 3I1YA 5AKLA 5HP4A 2KFZA 4ELUA 4M6WA 1J2MA 3M8RA 4BJQA 2I6XA 3OTQA 3RR8A 2F8LA 5JTIA 5ALSA 2UVVA 2P35A 2IA6A 1SB3C 1PK1B 3PSPA 4ECRA 4ED2A 1Q8KA 1ZQXA 2F8KA 3H7IA 2FE9A 5DB8A 3N97B 1P7DA 2NRZA 3WK5A 2HBJA 1SL1A 4DLGA 5J2EA 3SV4A 4M0AA 1WWVA 4R8UA 5AKYA 1ZQCA 4PGXA 3TACB 3KD3A 1SL2A 2FJ6A 5DGAA 5IIMA 1Z4OA 2BDUA 3QX7A 2LHTA 9ICHA 5AM5A 5AM2A 3HILA 1Q3UA 4WJ3B 2KJ5A 4B6JA 5KG5A 4KN7A 5ALYA 1F44A 2HVHA 4YMNA 3WKCA 2QARA 1NKCA 3UXNA 4HAIA 2JZBA 4QWBA 4KTQA 3RF9A 5J0UA 4Z6EA 1U49A 3CNHA 4IR1A 1JXEA 2CN1A 4IL6U 5E79U 4QZFA 5DQHA 3L5KA 2EAMA 4TQSA 3Q8LA 4ACOA 5KFIA 2DBYA 4DL6A 3UMBA 3JPPA 4QZEA 2WF8A 1N5XA 1FFUA 3HP6A 4RPXA 5HR6A 3UXOA 4PHDA 2J6UA 5EWEA 3PR5B 3HKZF 5KT3A 5J8YC 5J0OA 2IHMA 4HYKA 1IG6A 1ZQYA 2PFPA 2A3VA 4ECTA 3QYPA 3C2KA 1ECWA 4YFKA 4QZ8A 2H3VA 5ALKA 1UA1A 2LMRA 1S97A 4QZCA 1NK6A 3QU4A 2HHSA 2OXOA 3D2NA 4YQWA 1ZOLA 1YZ6A 3M6ZA 1U48A 2P6UA 3FAHA 4XQ8A 5D46A 4O9MA 1NJWA 2G0AA 2BPCA 4C4SA 4US9A 1N5WA 4F4XA 2G08A 2QLTA 3HX0A 2FMQA 4EBDA 1NZBA 2YTUA 4KMOB 4TUSA 2ZIWB 3T79A 3U26A 4DFKA 2ODGA 2JH1A 3M7DA 5JU5A 4KLTA 4RQ0A 4NXZA 2M0NA 4PZNA 2ZJ5A 4YG2A 3PW5A 2YN4A 1MA7A 2P6RA 4YD2A 2W8LA 5AKEA 5A0LA 2WF9A 3PR4A 3EW9A 2IBKA 2DPJA 1S0OA 4M9NA 2KNJA 3QEBZ 1ZQJA 4NM1A 4I2CA 1SKSA 2R18A 4B9LA 3M9NB 5DQGA 4ECSA 1T7PA 5AK4A 1RZTA 5IILA 5DLGA 3WKBA 4EX7A 2F2AB 4IRCA 3T5HA 2DWQA 3MGHA 5ALNA 2MSNA 3QEAZ 3GV5B 3K1RB 2G5HB 1NK4A 3KHLA 4F4KA 2VA3A 2WF7A 1X6JA 3BDPA 4Z6DA 1C7YA 9ICXA 1N61A 4M2YA 3H8WA 1L5UA 3NUQA 4GFJA 3WK9A 3RH6A 4DOBA 4I2EA 3QNMA 3J81j 1CRXA 3BZCA 5GTHU 2KOBA 4UAUA 4ED3A 4TUPA 1QQ7A 2W03A 5KT4A 4F2RA 2JEJA 5ALMA 4P0PA 4O5CA 4F50A 3NS1A 1X2IA 5TZVA 4Y2JA 2I1QA 4MEYA 4QZHA 4K4IA 5KNIA 1T8EA 5BPCA 2YY6A 2K89A 2EQYA 5DG9A 1HJPA 3FDSA 4Z6FA 5CRXA 3SMVA 3KHRA 4EENA 3IRUA 4OJLA 2IOFK 9ICGA 4R66A 2ZJAA 4YMMA 3PVXA 3AMZA 3UMGA 2WAQF 5EE1A 2I9GA 1ZD2P 1QCKA 1S8OA 1JROA 4F4ZA 4NLNA 2HBMA 5ALUA 1J2NA 1J97A 3C5FA 2XGQA 2AQ0A 7ICFA 5KFJA 3Q8QB 3ED5A 2OM6A 4KLMA 3V7JA 1QSSA 3PSIA 5H2FU 3OHBA 5ALRA 2W04A 3EUB2 7ICKA 3PW2A 4FBUA 1JXLA 1URJA 1L8OA 4K4GA 5CR0A 1BPZA 1ED1A 2HMXA 2ESEA 2ZG6A 4UBCA 5KFTA 2HI0A 2JGAA 4B9SA 2MA1A 2K60A 1TKDA 1SIJA 2NO5A 7ICTA 1ZQAA 5KFOA 2BCVA 3B0XA 4RQ4A 3AQFA 3ALRA 1FIQA 1EXNA 2OCEA 4ED8A 3M9OB 1QQ6A 4NJ8A 5J2CA 4JWMA 5KFWA 3BZKA 2A1JA 3LVVA 4FO6A 1S76D 3GV8B 5KFKA 4YP3A 3E58A 2MUTB 1NKEA 5L1KA 4TUQA 3C28A 4YN4A 3F53A 2Q0ZX 2YB1A 4DOCA 2J6SA 4QW8A 4I2HA 5AKXA 2OEHA 1WYGA 1ZQVA 1X9XA 4C7YA 4J9OA 8ICRA 4FS1A 8ICZA 4UB3A 3C5GA 5AKJA 2F44A 1ZQIA 4BXOA 3IP4B 3NGDA 2BCSA 3SR6A 2W3SA 1XSLA 3H8SA 4DF8A 4Y2XA 5KFSA 2WB1C 5J0QA 1IXRA 2RDIA 3V7KA 5J2HA 3RJEA 2HW3A 5D4BA 5J2JA 2KG5A 5CJ7A 3LWMA 3LVWA 2LBOA 3C2LA 4I2DA 5CP2A 4BUGA 2AGOA 5AM0A 3T5LA 2ALZA 3RJIA 3JPQA 2NO4A 7ICMA 1PVQA 1ZD3A 5J2GA 4JV0A 1N2XA 3KOOA 5AKIA 3Q8PB 2F1JA 2QB1A 4JWNA 5DB9A 2VIXA 1UPHA 3RH5A 4RNNA 9ICOA 3E0FA 2GWSA 5J29A 4DOAA 3KZIU 1ZD5A 3ISCA 2HCFA 5J2FA 1UT8A 2XY6A 3PW7A 4PGQA 5HMMA 4J9QA 2GLEA 1UA0A 5KG4A 4DQIA 2W9BA 1V9PA 1ZQZA 2JXJA 2AH5A 2W7OA 5L1LA 2D3DA 3M1YA 4B9TA 2PFNA 1JALA 1KBUA 8ICFA 2BQRA 5AM3A 5DKWA 1XO1A 5J2AA 2KJ8A 2HOFA 4NV0A 4KX3A 2HBLA 1F5SA 4CDGA 3MDAA 2JMGA 4M9GA 3GFKB 2A19A 3WK4A 3H4BA 2HDOA 1ZJMA 2YMQA 3C23A 4DFJA 3ICXA 3K75D 1TAUA 5ALGA 1S5LU 4ECXA 5KFLA 3PMLA 4GXJA 3QUTA 4DQQA 2RLTA 3TAPA 5KFVA 2DGZA 3KFUF 5EWGA 4KLEA 2VANA 3QU7A 3GILA 2HOIA 4PHAA 1OXJA 4EZ6A 1SWWA 3PSFA 9ICRA 1ZJNA 1ZQBA 5KFQA 3ZDCA 4IQTA 3EPIA 5KG3A 1RXWA 2UVUA 1KFSA 4PGYA 3MGIA 2FDRA 4NLBA 4OJ6A 2IHNA 3RB3A 3MR2A 3RJJA 4Q8EA 2EAPA 5AI5A 3SYZA 4EYIB 7ICEA 4U7CA 1NKBA 2LI6A 4F4WA 4P4MA 4US8A 5KTQA 4F91B 5B66U 3JPTA 3BS5A 4I2JA 1Q3VA 5DBAA 4MF2A 1IM4A 3RAXA 3H0MB 4C8KA 1S0VA 3PV8A 2XO7A 2HHVA 4XA5A 5AI4A 2OWOA 4I2BA 2KKPA
chains in the Genus database with same CATH topology
4JMUA 3H0RB 2W7PA 3AQFA 2KKVA 3F2CA 3ALRA 3NUQA 2OXOA 3D2NA 3N7SC 4GFJA 4OJPA 2VKQA 3IG5A 2RHFA 2K8CB 3GU3A 2W7OA 4P0QA 5KL1B 2N1RA 1P7DA 2XICA 1YT3A 4QNLA 3RFAA 3MGVA 2HBJA 2ZIUA 1CRXA 1KBUA 3O0FA 2PMZC 2KOBA 2MRLA 2HBKA 2VJ5A 4P0PB 1A0PA 3LVVA 2WB1F 2KJ9A 3M6ZA 3IG8A 2K8AA 2XI9A 2KJ8A 2G5IB 4NV0A 3KZXA 2HOFA 4KX3A 2W03A 4NWIA 2E5SA 3H0LB 2HBLA 2G0AA 4QIWF 2H3ZA 2JMGA 4CDGA 3CRXA 5C0YA 3PSTA 2E1FA 1XO0A 2G08A 3C28A 2D6FC 2KD1A 1TAMA 3N7RC 5HR7A 4C0ZA 3F53A 4FE3A 2VJ4A 3HKZC 3L3FX 5KL8B 1Z19A 1NZBA 4PL2A 2YX8A 4P0PA 2YB1A 4KMOB 3SAGA 2YB4A 2BDUA 2ZIVA 2ZIWB 4OJOA 2LHTA 2H3IA 3PZPA 3T79A 2K8BB 3VC8A 4OJ5A 4FZLA 3DEEA 2JH7A 2JH1A 3ICXA 1Q3UA 4WJ3B 2ZIXB 2KJ5A 3M7DA 1WUDA 2RP5A 2K4EA 3VCBA 3F5AA 2ZIWA 1F44A 3N7PD 1ZQ1C 2K89A 1T94A 4BX9C 3SQIA 2ZIVB 3AL0B 2M0NA 2E1EA 5CRXA 4AYBF 2DQNB 2CPRA 1MA7A 1PVPA 3IP4B 2KIWA 2DGZA 3SMVA 2ZIXA 4A8EA 3ONNA 2F77X 4OJLA 1DRGA 4O3MA 3KFUF 2ZXHA 5A0LA 2H3QA 3RF9A 2HOIA 1GO3F 2OYYA 3CYMA 3F5EA 1SZHA 2LYAA 2WB1C 2Y0SF 2WAQF 3PSFA 3SAFA 4CRXA 3F2DA 2CN1A 2G06A 2OH2A 4KX5A 3OPXA 2KNJA 3M6KA 3LVWA 4OO1J 2HBMA 2LBOA 4NLBA 2DF4B 4OJ6A 2LKYA 3IN5A 3D2SA 2H3FA 2KVCA 4ACOA 2R18A 4BUGA 3F2BA 2OM6A 4IC9A 2NV3A 3LYSA 1PVRA 2KHVA 2KV2A 2PMZF 2ZXIA 4U7CA 4NLCA 4ICAA 2GH1A 3PSIA 3SAHA 1PVQA 2F2AB 2W04A 3K1ZA 1XNSA 5T14A 1D8BA 5HR6A 2HOQA 1URJA 4BJQA 1ED1A 2Q4TA 1HIWA 2XVTA 2F76X 3NRWA 2HMXA 1IIPA 2F8LA 2RRDA 2K4HA 2CRXA 1L6NA 2VIXA 4AYBC 1UPHA 2G09A 4QIWC 3E0FA 4CGZA 3HKZF 2G5HB 2KICA 3CP8A 2ZG6A 3D2QA 1Z1BA 1OUQA 3GZFA 4QJFB 1Q3VA 2JGAA 2MA1A 3H0MB 2A3VA 2LYBA 3PSPA 3C29A 2XIDA 2Y0SC 2GOLA 2Z7JA 1ECWA 2WAQC 4FZNA 2G07A 2H3VA 4P0QB 4FZMA 2KKPA 4PL1A 2KEYA 4U6PA 1HEKA 2K4IA 1A6SA 3AQEA 2ZIUB 2KHQA 2JHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2LYA A;  2H3I A;  1ED1 A;  1HIW A;  2N1R A;  2HMX A;  1L6N A;  2K4H A;  1UPH A;  2K4E A;  2H3F A;  2LYB A;  2GOL A;  1ECW A;  2H3V A;  2H3Z A;  2JMG A;  4IC9 A;  2NV3 A;  1HEK A;  2K4I A;  1TAM A;  4ICA A;  1A6S A;  2H3Q A; 
#chains in the Genus database with same CATH topology
 4JMU A;  3Q8M A;  1FFV A;  4RNM A;  4IR9 A;  4F93 B;  4G9B A;  2N1R A;  4YVZ A;  4KLO A;  3O0F A;  2HBK A;  5J0X A;  3GIJ A;  4QW9 A;  1DGS A;  3L4P A;  3RRG A;  4DQS A;  2E1F A;  1TAM A;  4C0Z A;  1JUD A;  3SEN A;  4DSJ A;  3S6J A;  1WCL A;  3TAN A;  3G6Y A;  4DSE A;  5JUM A;  1DXS A;  9ICM A;  1NK0 A;  2F1H A;  1WUD A;  4C8N A;  1BGX T;  1S77 D;  2QB0 B;  8ICP A;  2ZIV B;  4J9S A;  5F9N A;  5KFG A;  4UB6 U;  4EEY A;  2ZXH A;  1COO A;  3JPS A;  3CYM A;  3TAR A;  4DSL A;  4CE6 A;  1X40 A;  1JN3 A;  4TQR A;  2PXI A;  4YXJ A;  2MAX A;  5DG8 A;  3KKA C;  3BQ1 A;  3V6H A;  1ZQG A;  3NVY A;  4IC9 A;  8ICB A;  2KVS A;  3UXP A;  2KHV A;  2BCR A;  5ALO A;  4ICA A;  7ICQ A;  3RJF A;  2KP7 A;  3GDX A;  2HOQ A;  3TQ1 A;  2ATL A;  2HHQ A;  2Q4T A;  2JR5 A;  1PUZ A;  4GC6 A;  1L6N A;  4O3O A;  4DSF A;  3T5K A;  4CGZ A;  4DO9 A;  8ICK A;  1DK3 A;  2NRV A;  4OD0 A;  2LYB A;  4Y2U A;  3PX0 A;  1B0X A;  1L7O A;  4UBB A;  1L8L A;  4FFD A;  5ALL A;  5ALD A;  1A6S A;  2W7P A;  4E0D A;  3F2C A;  1Y88 A;  1XC9 A;  5KFR A;  1L3V A;  3IG5 A;  3NVW A;  3MAB A;  3NTU A;  4TUR A;  2DKX A;  3RFA A;  4RUC A;  3MR5 A;  1QSY A;  1ZRM A;  2C28 A;  2ISP A;  5AIA A;  5F9L A;  3H0L B;  1XS9 D;  5KFB A;  4KLI A;  4JUZ A;  4FE3 A;  4MF8 A;  3SD7 A;  2WTF A;  3EWA A;  4F8R A;  5J0S A;  2W8K A;  5KAI U;  2K8B B;  3VC8 A;  2QAR B;  4G3I A;  3H4D A;  2JZB B;  4DF4 A;  2YMP A;  9ICJ A;  3RBE A;  3F5A A;  1RYU A;  2KE7 A;  4CNQ A;  2EDU A;  1T94 A;  2C2R A;  3MBY A;  1SL0 A;  1U4B A;  3B0Y A;  1CEZ A;  2CPR A;  2JEI A;  1Z4N A;  2KIW A;  4A8E A;  1LKY A;  3ONN A;  1PK3 A;  5BOM A;  2R8G A;  5DLF A;  4YR0 A;  1KLN A;  4F71 A;  4DFM A;  5AKH A;  3SI8 A;  2FMS A;  4J03 A;  7ICV A;  4KX5 A;  4CF4 A;  1KQQ A;  4GIB A;  3WKA A;  5J0T A;  1ZQL A;  2BDP A;  1ZQK A;  4C4R A;  1SV0 A;  1SKW A;  3F2B A;  8ICG A;  4J9L A;  3LYS A;  4KLG A;  3SAH A;  3KKA A;  2LPE A;  1NK9 A;  3QZ7 A;  5KG7 A;  1IIP A;  2CRX A;  2RRD A;  1N60 A;  7ICS A;  2BQ3 A;  2ZTE A;  1D9D A;  2R8H A;  4F5Q A;  2FPM A;  2W9A A;  5DQI A;  2JV3 A;  4RQ6 A;  1MC8 A;  5J2B A;  4J9K A;  3DV9 A;  4MFA A;  3Q8K A;  1BVS A;  2K4I A;  1T3N A;  4UAR A;  3TKA A;  4RPZ A;  1ZQT A;  2YQE A;  3ISB A;  1H38 A;  3D6J A;  2YML A;  2P66 A;  4UAY A;  1D8Y A;  4O3P A;  4PHP A;  2ZIU A;  2PMZ C;  4R65 A;  2EAN A;  9ICQ A;  1X9W A;  1X9S A;  4DL7 A;  2E5S A;  7ICH A;  4LJX A;  5J2K A;  8ICL A;  2H5X A;  3HW8 A;  3PNC A;  4C80 A;  1Z00 A;  2ASJ A;  1XSP A;  3IV6 A;  4QWD A;  1S0N A;  5IIO A;  2BKE A;  4F5O A;  4BWM A;  2V4Q A;  2NRW A;  2Y9U A;  1V38 A;  1WWU A;  3I28 A;  5ALX A;  8ICW A;  1K1S A;  1PVP A;  4K4H A;  2LM1 A;  4QWA A;  2OYY A;  9ICF A;  3QE9 Y;  1BPE A;  1SZH A;  2LYA A;  1Z3E B;  3SAF A;  2ZJ8 A;  3DDH A;  2L5Y A;  4KLU A;  1FEZ A;  4OCZ A;  8ICX A;  2A1A A;  1L7M A;  1VJ5 A;  1ZQD A;  9ICB A;  1NJX A;  1RQN A;  8ICA A;  2KVC A;  1RYR A;  4EBE A;  2WF6 A;  1U47 A;  1NK7 A;  1ZQM A;  2JRZ A;  4Q8F A;  1N63 A;  3WK7 A;  3TFR A;  1F0M A;  1NZP A;  2G09 A;  4QIW C;  4DWI A;  2KIC A;  3CP8 A;  1OUQ A;  3OGU A;  1B43 A;  3KBB A;  1BPD A;  3EYZ A;  3ORY A;  2HHU A;  4PL1 A;  1HEK A;  1SV4 A;  4RNO A;  3V6K A;  4DS4 A;  4F4Y A;  3PO5 A;  2K4P A;  4P0Q A;  2UVW A;  2M9N A;  1YT3 A;  8ICM A;  4YR3 A;  2MRL A;  5KG0 A;  4P0P B;  4KLQ A;  2KSO A;  1KEJ A;  1TVA A;  2G5I B;  1XO0 A;  2HHX A;  9ICE A;  1XU4 A;  4AP9 A;  5KFE A;  2XCP A;  8ICQ A;  2W54 A;  3JPN A;  8ICO A;  3H8J A;  4UAS A;  4KLD A;  2H3I A;  2AGP A;  1L3T A;  5AIB A;  4F5R A;  1NK5 A;  2XY7 A;  3ZDD A;  9ICW A;  2W55 A;  1ZQS A;  1RYS A;  5HML A;  2XGP A;  3RB4 A;  2LM4 A;  5DDY A;  3HRD D;  4Y2S A;  2BPF A;  3AL0 B;  2HHT A;  2KTQ A;  1RPL A;  2E1E A;  2DQN B;  3RB0 A;  2ZIX A;  1TV9 A;  2WHE A;  1GO3 F;  2KFN A;  2PKE A;  3MC1 A;  4O3Q A;  3ETR A;  2UVR A;  4CRX A;  1XWL A;  4KN4 A;  4ED0 A;  1QTM A;  2DF4 B;  5J0W A;  1FO4 A;  1S10 A;  3QZ8 A;  1UHU A;  4NLK A;  2DFL A;  2ZXI A;  3V7L A;  1KFT A;  4UB5 A;  4F5N A;  4JB3 A;  4XRH A;  4F72 A;  4DLE A;  3E2E A;  2F76 X;  3RAQ A;  3GQC A;  4AYB C;  2HVI A;  4I2G A;  5J0R A;  5ALE A;  4QJF B;  3PO4 A;  1TK5 A;  1NNL A;  7ICN A;  9ICU A;  2Y0S C;  4DCC A;  4I27 A;  1QLN A;  3C1Z A;  2W11 A;  5DBC A;  5KT2 A;  4Y2Y A;  5ALZ A;  1A77 A;  2ES6 A;  3ISD A;  1ZET A;  2A1J B;  2Y1I A;  3SEI A;  4UB8 U;  4MHV A;  4R63 A;  4I2I A;  1DGJ A;  2PI4 A;  2VA2 A;  1HUO A;  4NL9 A;  1BNO A;  3TI0 A;  3RJH A;  2FI1 A;  1JI7 A;  3R9K A;  2EAO A;  4QIW F;  3EPG A;  2H3Z A;  3QUQ A;  5ALQ A;  5AK6 A;  5KT5 A;  4JV2 A;  5HHI A;  1X9M A;  4ED1 A;  3L3F X;  5KL8 B;  2KZ3 A;  4YD1 A;  2C22 A;  7ICJ A;  4UB2 A;  2ZUC A;  5KT6 A;  3KHH A;  4BXO B;  4B9V A;  4DSK A;  2KK0 A;  1N48 A;  3SV3 A;  1ZQ1 C;  4DSI A;  1DOQ A;  1XSN A;  3HWT A;  7ICP A;  4NY8 A;  2FMP A;  4YR2 A;  4MFC A;  4DL5 A;  8ICH A;  5III A;  3F5E A;  3UMC A;  1TE2 A;  1Z1V A;  5IIN A;  4QZI A;  1VLB A;  2VA8 A;  4C4T A;  2QKQ A;  2W9C A;  4IQV A;  1LB2 B;  4QWC A;  4DL2 A;  4QZ9 A;  1ZQU A;  3HT3 A;  5HHH A;  3OJU A;  5T14 A;  3ZI4 A;  4KMU A;  4DFD A;  4RUA A;  1OW5 A;  1T3Q A;  5IIJ A;  1SGG A;  2W9B B;  4J9P A;  1QH9 A;  5FP0 A;  4ECW A;  4FZM A;  4F2S A;  3MFI A;  4UAZ A;  5AI0 A;  4EEK A;  3N7S C;  1PK1 A;  2F3N A;  2VKQ A;  3NVV A;  5KL1 B;  5EOZ A;  2BZF A;  1KDH A;  4KLH A;  2VJ5 A;  5KFH A;  5KG1 A;  1X66 A;  5EE0 A;  2WB1 F;  2K8A A;  3MDC A;  1AQ6 A;  5AK3 A;  4MFF A;  3CRX A;  3JPO A;  3PST A;  4QZB A;  2EH9 A;  4J9N A;  3PX4 A;  1ZQO A;  2DL0 A;  5KT7 A;  3HKZ C;  2E8P A;  2QB0 A;  3WKD A;  3GV7 B;  2ZIV A;  4GXK A;  3ZD8 A;  3PZP A;  4OJ5 A;  5ALV A;  8ICV A;  3Q8S B;  9ICV A;  2RP5 A;  4F3O A;  2FLL A;  5L9X A;  4USA A;  4O5K A;  2E3T A;  1LVH A;  4KLF A;  5D49 A;  3AN1 A;  2LYH A;  1KKX A;  5ALT A;  5ALP A;  5KFX A;  3V72 A;  9ICT A;  3AU6 A;  3F2D A;  9ICS A;  1DK2 A;  3OPX A;  3A0B U;  4ZOH C;  3UQ0 A;  3BJY A;  4CCH A;  4FBT A;  5AIC A;  3WKE A;  4UB1 A;  4B9N A;  1MQ3 A;  2W9M A;  3QUC A;  5ALH A;  3QUB A;  4ED7 A;  1UCV A;  2AGQ A;  2NV3 A;  2PFO A;  5J0P A;  1PZN A;  3BS5 B;  1D8B A;  7ICO A;  3BQ0 A;  2NRX A;  4C8L A;  4M9L A;  2B6G A;  4I2A A;  3LK9 A;  4RT3 A;  4NLZ A;  2EZZ A;  4M9H A;  1SV0 C;  5JRT A;  1T4G A;  1BPB A;  3BQT A;  5KFM A;  4KLJ A;  4M6W B;  4PJ0 U;  2C2D A;  1C20 A;  5J2D A;  2ZTD A;  3IN5 A;  2W43 A;  3TAD A;  4OJP A;  2E8M A;  3LWL A;  3QU5 A;  5ALJ A;  4C7Z A;  2XIC A;  3T3F A;  4RQ5 A;  3QU2 A;  1TAQ A;  5AHX A;  3K4G A;  3UPQ A;  1V85 A;  4Z6C A;  3MFH A;  3EZ5 A;  2BR0 A;  2AXT U;  3IG8 A;  2YMM A;  4YXM A;  5CWR A;  2B21 A;  1NI3 A;  3PW4 A;  4DQP A;  4Y2Q A;  3GII A;  4UQG A;  2JEG A;  2IOH A;  3N28 A;  5KFU A;  2VJ4 A;  5AI6 A;  1VDV A;  5KFF A;  4NM2 A;  4R8U B;  3PW0 A;  1ZXI A;  4KLS A;  2ZIW A;  1KTQ A;  2W3R A;  3H8M A;  5AKK A;  4F5P A;  5ALI A;  1KSP A;  3AU2 A;  4O3M A;  2BHN A;  1SWV A;  3G6X A;  2ISO A;  5HNK A;  4NLG A;  2BCQ A;  3ZDE A;  1B22 A;  4OO1 J;  1YZ7 A;  4KLL A;  4ECV A;  4EZ9 A;  1ZQH A;  1L7N A;  3RB6 A;  5L1J A;  4ELV A;  9ICL A;  5DB7 A;  1Q46 A;  4UAW A;  4Q43 A;  3FC4 A;  3ZDB A;  3MR6 A;  1XNS A;  4IS7 A;  2AJQ A;  3AM9 A;  4J9R A;  4DS5 A;  3A0H U;  9ICA A;  5ALF A;  4RQM A;  2ASD A;  4P4P A;  3RJK A;  3WU2 U;  2XVT A;  3GIM A;  4JK1 A;  9ICI A;  1NK8 A;  2WAQ C;  4PH5 A;  1BPX A;  1L7P A;  4J9M A;  4PHE A;  2KHQ A;  5AKG A;  3H0R B;  3WK8 A;  2V4R A;  2V9W A;  3T5J A;  5TIS U;  2EZX A;  3IM1 A;  4YMO A;  4O0I A;  5KFY A;  7ICU A;  5G5H A;  4I29 A;  4M04 A;  2IOF A;  4X5V A;  3UQ2 A;  2KJ9 A;  3ETL A;  2HSZ A;  4NWI A;  3HPO A;  5KFP A;  4RQN A;  4EBC A;  1L3S A;  3QXG A;  2D6F C;  1WG8 A;  4OJO A;  2E8N A;  4LVS A;  3DEE A;  3PMN A;  1LKY B;  1S9F A;  4Q45 A;  8ICJ A;  3RJG A;  2EZY A;  1QSL A;  5J0Y A;  2FPL A;  3RBD A;  1KW4 A;  3AUO A;  1DRG A;  2FLN A;  2F77 X;  4JV1 A;  1SKR A;  4YCX A;  4GC7 A;  3H40 A;  3HJE A;  5DGB A;  2ZUB A;  5CA7 A;  9ICC A;  2B0C A;  2E8O A;  1ZRN A;  3PX6 A;  4DEZ A;  1RG6 A;  2G06 A;  4LZG A;  3OSN A;  4Y2P A;  1KFD A;  4UAV A;  2O6K A;  1KL9 A;  4UAT A;  4ED6 A;  4F92 B;  2AU0 A;  1KRP A;  3BS7 A;  5J8Y A;  2KV2 A;  1QQ5 A;  5C5J A;  1ZD4 A;  3BQ7 A;  1HIW A;  4QZA A;  2K4H A;  2I5H A;  3FYH A;  3D2Q A;  4C8O A;  1Z1B A;  3GZF A;  3WK6 A;  2ZTC A;  3RH4 A;  4ZH4 A;  2BPG A;  1B4F A;  2G07 A;  2KEY A;  2ZIU B;  1V97 A;  3SZ2 A;  1CUK A;  2KKV A;  3NVZ A;  3V6J A;  2WFA A;  4RZR A;  5GTI U;  5B5E U;  1KN5 A;  4QNL A;  1A0P A;  4CF3 A;  2C2E A;  1UT5 A;  1Z00 B;  3FM9 A;  3KZX A;  2FLP A;  8ICU A;  8ICS A;  4XUS A;  3BQ2 A;  5EE9 A;  3N7R C;  2XC9 A;  1ARO P;  2Y9T A;  8ICI A;  2FPK A;  1ZQW A;  1ZQR A;  1IV8 A;  2YX8 A;  5CEH A;  4GXI A;  4NL9 C;  1SZP A;  2MU2 A;  2MUT A;  1COK A;  4PPX A;  2KZZ A;  2KN7 A;  4ECQ A;  3KHG A;  3G6V A;  4M47 A;  4Y2R A;  3OSP A;  5EE3 A;  1O08 A;  4RQ8 A;  1MQ2 A;  5KFZ A;  3M8S A;  2KMD A;  1U45 A;  1N56 A;  4O5E A;  3THV A;  4MEX A;  4R64 A;  5BOL A;  4FS2 A;  1NJY A;  1ZQQ A;  5DDM A;  5AK5 A;  1L3U A;  1JX4 A;  5KG2 A;  4RQ1 A;  4DQR A;  3M9M B;  3M6K A;  4DFP A;  2KIV A;  3C2M A;  2LKY A;  2H3F A;  4ECY A;  4BGD A;  3C1Y A;  4PZO A;  5CB1 A;  5DG7 A;  2XCA A;  4RU9 A;  1TK0 A;  5L1I A;  2PMZ F;  1SXD A;  5KG6 A;  7ICR A;  5KFA A;  4EX6 A;  1ZYQ A;  4B9M A;  2F1I A;  4QZD A;  4BWJ A;  2XY5 A;  4UW9 A;  1N62 A;  2PFQ A;  3PY8 A;  3C29 A;  2XID A;  2Z7J A;  4IQU A;  4DL3 A;  4P0Q B;  1TFR A;  4GLX A;  4LZD A;  2JEF A;  4RT2 A;  2JHD A;  3K1Z A;  7ICG A;  1RDF A;  5J2I A;  3I76 A;  2KSO B;  1TK8 A;  1RQL A;  5KFC A;  3MGV A;  1RM6 C;  5AKZ A;  5IIK A;  4EYH B;  4C8M A;  4RQ7 A;  5EWF A;  3B9J A;  1K5O A;  2NYV A;  4P4O A;  1ZQF A;  5C0Y A;  2HHW A;  5HR7 A;  2WF5 A;  1Z19 A;  4ELT A;  2ZUD A;  3UM9 A;  4ECZ A;  3IDW A;  4Q44 A;  4FZL A;  4RQ2 A;  3KTQ A;  2ZIX B;  4RQ3 A;  9ICP A;  3VCB A;  1S0M A;  3Q8R B;  3SQI A;  2D8C A;  3RRH A;  2AHO B;  2H3Q A;  3TFS A;  1HUZ A;  5DB6 A;  1K1Q A;  1D9F A;  3ZD9 A;  1X6I A;  3QU9 A;  1CI4 A;  2GO7 A;  9ICN A;  2OH2 A;  4IRD A;  3MR3 A;  2CXY A;  2J6T A;  2DPI A;  3GIK A;  1UQV A;  4P2H A;  4B9U A;  3D2S A;  1MSW D;  4QWE A;  7ICI A;  8ICN A;  4Y2V A;  1SXE A;  2Y1J A;  4I2F A;  1PVR A;  5F3X B;  8ICY A;  4RPY A;  8ICE A;  3N4M B;  4M9J A;  3ZDA A;  3NRW A;  8ICC A;  3IHQ B;  3OHA A;  5KAF U;  2PI5 A;  2BQU A;  2GOL A;  4FZN A;  4U6P A;  5AI8 A;  5L1M A;  2BCU A;  3AQE A;  2BGW A;  3RTV A;  7ICL A;  1BPY A;  5AM1 A;  5KFN A;  3AEV A;  4UB4 A;  2RHF A;  2K8C B;  3GU3 A;  4KIT B;  5AM4 A;  5AI9 A;  3TAQ A;  4O3S A;  5ALW A;  3NRZ A;  3NAS A;  4IQW A;  2XI9 A;  3CW2 C;  5K4L A;  2R8K A;  1M6Y A;  1WCN A;  4QZG A;  4ECU A;  3TAD C;  1LV5 A;  1NOM A;  2KD1 A;  2IMW P;  4PL2 A;  3JPR A;  3SAG A;  2YB4 A;  1D8L A;  2RDJ A;  1O03 A;  1ZQN A;  2JH7 A;  5KFD A;  4EEL A;  2ASL A;  3LDA A;  4I28 A;  2K4E A;  4DL4 A;  4BDP A;  1NJZ A;  2AQ4 A;  3N7P D;  1JMS A;  4BX9 C;  4Y2T A;  5DBB A;  2NRT A;  4AYB F;  1JIH A;  4IRK A;  1U9L A;  8ICT A;  4O3N A;  9ICK A;  2DKZ A;  1A76 A;  2DUY A;  1BNP A;  3RR7 A;  2Y0S F;  2R8I A;  2RQ5 A;  2KZM A;  1X42 A;  1MN8 A;  2W9C B;  3OJS A;  4O3R A;  1JRP A;  2OHF A;  5G5G A;  3C21 A;  2R8J A;  1ZQP A;  1ZQE A;  5CHG A;  4CF5 A;  1RXV A;  4NLC A;  2GH1 A;  3I1Y A;  5AKL A;  5HP4 A;  2KFZ A;  4ELU A;  4M6W A;  1J2M A;  3M8R A;  4BJQ A;  2I6X A;  3OTQ A;  3RR8 A;  2F8L A;  5JTI A;  5ALS A;  2UVV A;  2P35 A;  2IA6 A;  1SB3 C;  1PK1 B;  3PSP A;  4ECR A;  4ED2 A;  1Q8K A;  1ZQX A;  2F8K A;  3H7I A;  2FE9 A;  5DB8 A;  3N97 B;  1P7D A;  2NRZ A;  3WK5 A;  2HBJ A;  1SL1 A;  4DLG A;  5J2E A;  3SV4 A;  4M0A A;  1WWV A;  4R8U A;  5AKY A;  1ZQC A;  4PGX A;  3TAC B;  3KD3 A;  1SL2 A;  2FJ6 A;  5DGA A;  5IIM A;  1Z4O A;  2BDU A;  3QX7 A;  2LHT A;  9ICH A;  5AM5 A;  5AM2 A;  3HIL A;  1Q3U A;  4WJ3 B;  2KJ5 A;  4B6J A;  5KG5 A;  4KN7 A;  5ALY A;  1F44 A;  2HVH A;  4YMN A;  3WKC A;  2QAR A;  1NKC A;  3UXN A;  4HAI A;  2JZB A;  4QWB A;  4KTQ A;  3RF9 A;  5J0U A;  4Z6E A;  1U49 A;  3CNH A;  4IR1 A;  1JXE A;  2CN1 A;  4IL6 U;  5E79 U;  4QZF A;  5DQH A;  3L5K A;  2EAM A;  4TQS A;  3Q8L A;  4ACO A;  5KFI A;  2DBY A;  4DL6 A;  3UMB A;  3JPP A;  4QZE A;  2WF8 A;  1N5X A;  1FFU A;  3HP6 A;  4RPX A;  5HR6 A;  3UXO A;  4PHD A;  2J6U A;  5EWE A;  3PR5 B;  3HKZ F;  5KT3 A;  5J8Y C;  5J0O A;  2IHM A;  4HYK A;  1IG6 A;  1ZQY A;  2PFP A;  2A3V A;  4ECT A;  3QYP A;  3C2K A;  1ECW A;  4YFK A;  4QZ8 A;  2H3V A;  5ALK A;  1UA1 A;  2LMR A;  1S97 A;  4QZC A;  1NK6 A;  3QU4 A;  2HHS A;  2OXO A;  3D2N A;  4YQW A;  1ZOL A;  1YZ6 A;  3M6Z A;  1U48 A;  2P6U A;  3FAH A;  4XQ8 A;  5D46 A;  4O9M A;  1NJW A;  2G0A A;  2BPC A;  4C4S A;  4US9 A;  1N5W A;  4F4X A;  2G08 A;  2QLT A;  3HX0 A;  2FMQ A;  4EBD A;  1NZB A;  2YTU A;  4KMO B;  4TUS A;  2ZIW B;  3T79 A;  3U26 A;  4DFK A;  2ODG A;  2JH1 A;  3M7D A;  5JU5 A;  4KLT A;  4RQ0 A;  4NXZ A;  2M0N A;  4PZN A;  2ZJ5 A;  4YG2 A;  3PW5 A;  2YN4 A;  1MA7 A;  2P6R A;  4YD2 A;  2W8L A;  5AKE A;  5A0L A;  2WF9 A;  3PR4 A;  3EW9 A;  2IBK A;  2DPJ A;  1S0O A;  4M9N A;  2KNJ A;  3QEB Z;  1ZQJ A;  4NM1 A;  4I2C A;  1SKS A;  2R18 A;  4B9L A;  3M9N B;  5DQG A;  4ECS A;  1T7P A;  5AK4 A;  1RZT A;  5IIL A;  5DLG A;  3WKB A;  4EX7 A;  2F2A B;  4IRC A;  3T5H A;  2DWQ A;  3MGH A;  5ALN A;  2MSN A;  3QEA Z;  3GV5 B;  3K1R B;  2G5H B;  1NK4 A;  3KHL A;  4F4K A;  2VA3 A;  2WF7 A;  1X6J A;  3BDP A;  4Z6D A;  1C7Y A;  9ICX A;  1N61 A;  4M2Y A;  3H8W A;  1L5U A;  3NUQ A;  4GFJ A;  3WK9 A;  3RH6 A;  4DOB A;  4I2E A;  3QNM A;  3J81 j;  1CRX A;  3BZC A;  5GTH U;  2KOB A;  4UAU A;  4ED3 A;  4TUP A;  1QQ7 A;  2W03 A;  5KT4 A;  4F2R A;  2JEJ A;  5ALM A;  4P0P A;  4O5C A;  4F50 A;  3NS1 A;  1X2I A;  5TZV A;  4Y2J A;  2I1Q A;  4MEY A;  4QZH A;  4K4I A;  5KNI A;  1T8E A;  5BPC A;  2YY6 A;  2K89 A;  2EQY A;  5DG9 A;  1HJP A;  3FDS A;  4Z6F A;  5CRX A;  3SMV A;  3KHR A;  4EEN A;  3IRU A;  4OJL A;  2IOF K;  9ICG A;  4R66 A;  2ZJA A;  4YMM A;  3PVX A;  3AMZ A;  3UMG A;  2WAQ F;  5EE1 A;  2I9G A;  1ZD2 P;  1QCK A;  1S8O A;  1JRO A;  4F4Z A;  4NLN A;  2HBM A;  5ALU A;  1J2N A;  1J97 A;  3C5F A;  2XGQ A;  2AQ0 A;  7ICF A;  5KFJ A;  3Q8Q B;  3ED5 A;  2OM6 A;  4KLM A;  3V7J A;  1QSS A;  3PSI A;  5H2F U;  3OHB A;  5ALR A;  2W04 A;  3EUB 2;  7ICK A;  3PW2 A;  4FBU A;  1JXL A;  1URJ A;  1L8O A;  4K4G A;  5CR0 A;  1BPZ A;  1ED1 A;  2HMX A;  2ESE A;  2ZG6 A;  4UBC A;  5KFT A;  2HI0 A;  2JGA A;  4B9S A;  2MA1 A;  2K60 A;  1TKD A;  1SIJ A;  2NO5 A;  7ICT A;  1ZQA A;  5KFO A;  2BCV A;  3B0X A;  4RQ4 A;  3AQF A;  3ALR A;  1FIQ A;  1EXN A;  2OCE A;  4ED8 A;  3M9O B;  1QQ6 A;  4NJ8 A;  5J2C A;  4JWM A;  5KFW A;  3BZK A;  2A1J A;  3LVV A;  4FO6 A;  1S76 D;  3GV8 B;  5KFK A;  4YP3 A;  3E58 A;  2MUT B;  1NKE A;  5L1K A;  4TUQ A;  3C28 A;  4YN4 A;  3F53 A;  2Q0Z X;  2YB1 A;  4DOC A;  2J6S A;  4QW8 A;  4I2H A;  5AKX A;  2OEH A;  1WYG A;  1ZQV A;  1X9X A;  4C7Y A;  4J9O A;  8ICR A;  4FS1 A;  8ICZ A;  4UB3 A;  3C5G A;  5AKJ A;  2F44 A;  1ZQI A;  4BXO A;  3IP4 B;  3NGD A;  2BCS A;  3SR6 A;  2W3S A;  1XSL A;  3H8S A;  4DF8 A;  4Y2X A;  5KFS A;  2WB1 C;  5J0Q A;  1IXR A;  2RDI A;  3V7K A;  5J2H A;  3RJE A;  2HW3 A;  5D4B A;  5J2J A;  2KG5 A;  5CJ7 A;  3LWM A;  3LVW A;  2LBO A;  3C2L A;  4I2D A;  5CP2 A;  4BUG A;  2AGO A;  5AM0 A;  3T5L A;  2ALZ A;  3RJI A;  3JPQ A;  2NO4 A;  7ICM A;  1PVQ A;  1ZD3 A;  5J2G A;  4JV0 A;  1N2X A;  3KOO A;  5AKI A;  3Q8P B;  2F1J A;  2QB1 A;  4JWN A;  5DB9 A;  2VIX A;  1UPH A;  3RH5 A;  4RNN A;  9ICO A;  3E0F A;  2GWS A;  5J29 A;  4DOA A;  3KZI U;  1ZD5 A;  3ISC A;  2HCF A;  5J2F A;  1UT8 A;  2XY6 A;  3PW7 A;  4PGQ A;  5HMM A;  4J9Q A;  2GLE A;  1UA0 A;  5KG4 A;  4DQI A;  2W9B A;  1V9P A;  1ZQZ A;  2JXJ A;  2AH5 A;  2W7O A;  5L1L A;  2D3D A;  3M1Y A;  4B9T A;  2PFN A;  1JAL A;  1KBU A;  8ICF A;  2BQR A;  5AM3 A;  5DKW A;  1XO1 A;  5J2A A;  2KJ8 A;  2HOF A;  4NV0 A;  4KX3 A;  2HBL A;  1F5S A;  4CDG A;  3MDA A;  2JMG A;  4M9G A;  3GFK B;  2A19 A;  3WK4 A;  3H4B A;  2HDO A;  1ZJM A;  2YMQ A;  3C23 A;  4DFJ A;  3ICX A;  3K75 D;  1TAU A;  5ALG A;  1S5L U;  4ECX A;  5KFL A;  3PML A;  4GXJ A;  3QUT A;  4DQQ A;  2RLT A;  3TAP A;  5KFV A;  2DGZ A;  3KFU F;  5EWG A;  4KLE A;  2VAN A;  3QU7 A;  3GIL A;  2HOI A;  4PHA A;  1OXJ A;  4EZ6 A;  1SWW A;  3PSF A;  9ICR A;  1ZJN A;  1ZQB A;  5KFQ A;  3ZDC A;  4IQT A;  3EPI A;  5KG3 A;  1RXW A;  2UVU A;  1KFS A;  4PGY A;  3MGI A;  2FDR A;  4NLB A;  4OJ6 A;  2IHN A;  3RB3 A;  3MR2 A;  3RJJ A;  4Q8E A;  2EAP A;  5AI5 A;  3SYZ A;  4EYI B;  7ICE A;  4U7C A;  1NKB A;  2LI6 A;  4F4W A;  4P4M A;  4US8 A;  5KTQ A;  4F91 B;  5B66 U;  3JPT A;  3BS5 A;  4I2J A;  1Q3V A;  5DBA A;  4MF2 A;  1IM4 A;  3RAX A;  3H0M B;  4C8K A;  1S0V A;  3PV8 A;  2XO7 A;  2HHV A;  4XA5 A;  5AI4 A;  2OWO A;  4I2B A;  2KKP A; 
#chains in the Genus database with same CATH homology
 4JMU A;  3H0R B;  2W7P A;  3AQF A;  2KKV A;  3F2C A;  3ALR A;  3NUQ A;  2OXO A;  3D2N A;  3N7S C;  4GFJ A;  4OJP A;  2VKQ A;  3IG5 A;  2RHF A;  2K8C B;  3GU3 A;  2W7O A;  4P0Q A;  5KL1 B;  2N1R A;  1P7D A;  2XIC A;  1YT3 A;  4QNL A;  3RFA A;  3MGV A;  2HBJ A;  2ZIU A;  1CRX A;  1KBU A;  3O0F A;  2PMZ C;  2KOB A;  2MRL A;  2HBK A;  2VJ5 A;  4P0P B;  1A0P A;  3LVV A;  2WB1 F;  2KJ9 A;  3M6Z A;  3IG8 A;  2K8A A;  2XI9 A;  2KJ8 A;  2G5I B;  4NV0 A;  3KZX A;  2HOF A;  4KX3 A;  2W03 A;  4NWI A;  2E5S A;  3H0L B;  2HBL A;  2G0A A;  4QIW F;  2H3Z A;  2JMG A;  4CDG A;  3CRX A;  5C0Y A;  3PST A;  2E1F A;  1XO0 A;  2G08 A;  3C28 A;  2D6F C;  2KD1 A;  1TAM A;  3N7R C;  5HR7 A;  4C0Z A;  3F53 A;  4FE3 A;  2VJ4 A;  3HKZ C;  3L3F X;  5KL8 B;  1Z19 A;  1NZB A;  4PL2 A;  2YX8 A;  4P0P A;  2YB1 A;  4KMO B;  3SAG A;  2YB4 A;  2BDU A;  2ZIV A;  2ZIW B;  4OJO A;  2LHT A;  2H3I A;  3PZP A;  3T79 A;  2K8B B;  3VC8 A;  4OJ5 A;  4FZL A;  3DEE A;  2JH7 A;  2JH1 A;  3ICX A;  1Q3U A;  4WJ3 B;  2ZIX B;  2KJ5 A;  3M7D A;  1WUD A;  2RP5 A;  2K4E A;  3VCB A;  3F5A A;  2ZIW A;  1F44 A;  3N7P D;  1ZQ1 C;  2K89 A;  1T94 A;  4BX9 C;  3SQI A;  2ZIV B;  3AL0 B;  2M0N A;  2E1E A;  5CRX A;  4AYB F;  2DQN B;  2CPR A;  1MA7 A;  1PVP A;  3IP4 B;  2KIW A;  2DGZ A;  3SMV A;  2ZIX A;  4A8E A;  3ONN A;  2F77 X;  4OJL A;  1DRG A;  4O3M A;  3KFU F;  2ZXH A;  5A0L A;  2H3Q A;  3RF9 A;  2HOI A;  1GO3 F;  2OYY A;  3CYM A;  3F5E A;  1SZH A;  2LYA A;  2WB1 C;  2Y0S F;  2WAQ F;  3PSF A;  3SAF A;  4CRX A;  3F2D A;  2CN1 A;  2G06 A;  2OH2 A;  4KX5 A;  3OPX A;  2KNJ A;  3M6K A;  3LVW A;  4OO1 J;  2HBM A;  2LBO A;  4NLB A;  2DF4 B;  4OJ6 A;  2LKY A;  3IN5 A;  3D2S A;  2H3F A;  2KVC A;  4ACO A;  2R18 A;  4BUG A;  3F2B A;  2OM6 A;  4IC9 A;  2NV3 A;  3LYS A;  1PVR A;  2KHV A;  2KV2 A;  2PMZ F;  2ZXI A;  4U7C A;  4NLC A;  4ICA A;  2GH1 A;  3PSI A;  3SAH A;  1PVQ A;  2F2A B;  2W04 A;  3K1Z A;  1XNS A;  5T14 A;  1D8B A;  5HR6 A;  2HOQ A;  1URJ A;  4BJQ A;  1ED1 A;  2Q4T A;  1HIW A;  2XVT A;  2F76 X;  3NRW A;  2HMX A;  1IIP A;  2F8L A;  2RRD A;  2K4H A;  2CRX A;  1L6N A;  2VIX A;  4AYB C;  1UPH A;  2G09 A;  4QIW C;  3E0F A;  4CGZ A;  3HKZ F;  2G5H B;  2KIC A;  3CP8 A;  2ZG6 A;  3D2Q A;  1Z1B A;  1OUQ A;  3GZF A;  4QJF B;  1Q3V A;  2JGA A;  2MA1 A;  3H0M B;  2A3V A;  2LYB A;  3PSP A;  3C29 A;  2XID A;  2Y0S C;  2GOL A;  2Z7J A;  1ECW A;  2WAQ C;  4FZN A;  2G07 A;  2H3V A;  4P0Q B;  4FZM A;  2KKP A;  4PL1 A;  2KEY A;  4U6P A;  1HEK A;  2K4I A;  1A6S A;  3AQE A;  2ZIU B;  2KHQ A;  2JHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...