4IC9A

Crystal structure of the full-length matrix subunit (p15) of the feline immunodeficiency virus (fiv) gag polyprotein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
b'GQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix protein p15
molecule tags Viral protein
source organism Feline immunodeficiency virus
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4ic9A00
1L6NA 2GOLA 2HMXA 1A6SA 2LYBA 2H3FA 2N1RA 2NV3A 2H3ZA 4ICAA 1ECWA 2K4HA 2JMGA 2LYAA 2K4EA 2K4IA 1ED1A 2H3VA 2H3QA 1UPHA 4JMUA 1TAMA 1HIWA 2H3IA 4IC9A 1HEKA
chains in the Genus database with same CATH superfamily
3LWMA 2ALZA 3TACB 2Y0SC 1L7OA 1HJPA 5HMMA 2KKPA 1AQ6A 4ACOA 1X9SA 3A0BU 5J0PA 1Z19A 2P6UA 8ICEA 1DGJA 2HW3A 5AI9A 1FFVA 4RNNA 4ECUA 3R9KA 2G0AA 2HHUA 4C8KA 1HEKA 2KZMA 1BNOA 3LVVA 1PVQA 1ZYQA 3C1ZA 2JEIA 1COKA 3PSTA 3ZDDA 4DO9A 3F53A 2PI5A 5KT6A 4UBBA 8ICCA 4GXKA 2DL0A 4I2BA 2F8KA 1RYSA 3C29A 2R8KA 1NJXA 1P7DA 3ETRA 3PMLA 5KFJA 1QSYA 3H40A 1QLNA 3RJJA 3RR8A 9ICSA 3IM1A 2W9BA 4NLKA 4QWCA 1L5UA 2ZIVB 4F4YA 4RQ2A 3MGVA 1WG8A 1XU4A 2Q0ZX 3H0MB 3PW4A 4DQPA 4DL3A 2JGAA 2W9BB 3NVYA 5AKYA 3RB4A 4F5NA 3QUTA 3JPPA 2JZBB 3BQ2A 4EZ9A 4B9TA 1FEZA 2VJ5A 5AIAA 9ICLA 5ALXA 4QZEA 2KEYA 3M9OB 1T3QA 5DB8A 4ED7A 3RJFA 1PZNA 1X42A 5ALQA 3WKEA 4C4SA 3HT3A 4A8EA 2DQNB 4QZ8A 4QZIA 3T5JA 2PFQA 3E58A 7ICGA 4QIWF 1SV0A 2PFPA 2F44A 4MHVA 4USAA 3RJGA 4NWIA 1PVRA 3NGDA 3SAGA 4US8A 5AICA 2WTFA 1WWUA 4TUQA 2HOIA 1FFUA 1ED1A 2HHWA 4P4MA 8ICFA 5KFXA 2JZBA 2KIVA 3QUBA 5DLGA 1KTQA 1LKYB 2XC9A 3K1RB 1SL1A 2KVCA 4M0AA 5KFIA 1BPZA 2JHDA 3MFIA 4O3SA 4KLHA 5H2FU 1KL9A 4CDGA 1BPXA 3C2LA 3WKAA 5EWFA 1PVPA 1DRGA 4QNLA 1TFRA 3LYSA 2KSOA 4BWMA 4TUSA 1BPYA 3PMNA 5HR6A 5L1JA 3ZDCA 3HJEA 4JV2A 2GH1A 4DS4A 2BCSA 4DL2A 2AHOB 4YVZA 1CEZA 2QARB 4IS7A 4NXZA 3C21A 2KHQA 5J2KA 5KT7A 4RQNA 5HMLA 4KLEA 3IDWA 1XC9A 7ICLA 3ZDAA 4F4KA 1T3NA 1RYUA 3T79A 1DXSA 1SKRA 1URJA 2VANA 2IBKA 2ZIUA 2WB1C 3PO4A 2RP5A 4OO1J 5DGAA 2W9AA 2KE7A 3JPNA 2W3RA 4RT3A 3DEEA 5HNKA 2NYVA 5ALTA 4UB1A 5IIIA 2HOFA 8ICJA 4EENA 4Q43A 1T94A 1KSPA 5J2IA 1ZJNA 4JK1A 3HW8A 2RRDA 4DFMA 7ICOA 4NM2A 2C22A 1Z3EB 2YMPA 5DGBA 5KFEA 3NUQA 1SWVA 2IOFK 3SYZA 2VKQA 7ICSA 2PXIA 1QQ7A 5J8YC 4ECRA 3MR5A 3I28A 3KKAA 2OXOA 5J2CA 4M6WB 3ETLA 4XQ8A 3RH6A 2H3FA 3F2BA 3QX7A 4ICAA 1IM4A 3GIJA 1L7PA 2WF8A 5ALSA 1KFTA 3RJKA 1K1SA 3KZXA 4ELTA 8ICQA 5EWEA 4PHAA 2AGPA 2HBMA 2HHTA 2ZJ5A 2JEGA 1KW4A 4UAUA 3GILA 1JI7A 2BHNA 3ALRA 2C28A 2G09A 1F44A 3ZD9A 3NS1A 3WK6A 4KN4A 5DBCA 4JUZA 5KFPA 5KFUA 2RQ5A 5J0RA 5AI8A 2K4HA 2FPKA 4DSJA 4CF5A 3THVA 1O03A 5KFKA 5KFCA 4NLBA 4IRKA 3LK9A 2F76X 9ICHA 2EZZA 4DL7A 5AK5A 1NOMA 9ICPA 4J9NA 1F5SA 2PMZF 3QE9Y 4RQ6A 5DDYA 4LZGA 4O5CA 2AH5A 3OSNA 1L3TA 1SXDA 2JR5A 3FM9A 3QXGA 3RRHA 5KT5A 2B0CA 3GQCA 1TE2A 2IHMA 4YG2A 5DQIA 1X6IA 3PV8A 5ALYA 5AM0A 3CW2C 3TI0A 2MUTA 2HSZA 1FO4A 2JV3A 4J9MA 2E5SA 4EBDA 2KJ5A 3C2MA 3V7KA 2F2AB 2ZIUB 5F9LA 3SAFA 2BR0A 4F2SA 8ICVA 1TK0A 4KLTA 4RPYA 2K89A 1XWLA 1Q8KA 3RR7A 1TAMA 4GC6A 4J9SA 3FDSA 2YN4A 2I1QA 4KLFA 3OSPA 4F72A 1ZQNA 4YMOA 3EWAA 4GXIA 3H8MA 7ICQA 3SI8A 2FLNA 4Z6CA 2RDIA 4B9LA 2E1FA 3EZ5A 4EBEA 3BDPA 1ZD5A 4MFCA 5K4LA 2NRVA 2KNJA 4YR3A 4NY8A 1DK2A 4UAVA 2DFLA 1L8LA 2H3ZA 4RNOA 2W8LA 4UB4A 2IMWP 2ZXIA 2KZZA 3A0HU 5J0TA 4KLQA 5DQHA 2E8OA 4J9RA 1HUOA 2H3QA 4RQ5A 1RG6A 3V6JA 4IL6U 3CYMA 1N5WA 4DFDA 4F5OA 2JEJA 1X2IA 2KIWA 2EAPA 2V9WA 5AK6A 1MN8A 1WCNA 9ICEA 4GIBA 5AK4A 4DQRA 5HHHA 3M6ZA 3PSIA 2F1HA 4P0PA 5F9NA 2K4EA 1S5LU 2W04A 3AN1A 4HAIA 3RB6A 1SWWA 4Q45A 1CI4A 8ICZA 3UXPA 4DEZA 2LKYA 2F8LA 3GDXA 2OEHA 4F4XA 4ED2A 2E8PA 1IV8A 5AI5A 2VA2A 2IHNA 3N28A 3G6XA 1BNPA 2BPGA 3TKAA 4NLCA 2LM1A 3SR6A 4QW8A 3E2EA 4ECSA 3BS5B 2UVRA 1NJZA 2E8MA 4WJ3B 2LYAA 2D6FC 4K4HA 1NJWA 2K4IA 3GFKB 4Y2RA 1S0VA 1UT5A 2P35A 4M9NA 3MR2A 4AP9A 1UHUA 1MC8A 3H8SA 2RLTA 2XY5A 4KLGA 2J6UA 2FPMA 2EANA 3T5LA 5AKHA 3EW9A 5J0UA 3M9MB 1MSWD 4U7CA 2BQRA 1SL2A 9ICXA 4KX3A 4EYIB 4O3PA 3ZDEA 1DOQA 3F5AA 4UAYA 3SV4A 5HP4A 1K5OA 1NI3A 2IOHA 2HVHA 4B9VA 3SZ2A 2FPLA 5AK3A 1UQVA 5KFOA 2XVTA 4M6WA 2PFOA 2QARA 4Z6FA 2BPFA 1SV0C 3Q8QB 1SIJA 1BPDA 4NM1A 4DFPA 1ZQ1C 2PI4A 4TQSA 8ICWA 1H38A 5J2BA 5KG7A 4LZDA 1D8YA 2ASLA 3BZCA 5FP0A 3KHGA 4PPXA 5KFRA 1N48A 3I76A 5EE1A 4ZOHC 5BPCA 4CE6A 2EDUA 4OJPA 3AM9A 4P0QB 5KG5A 2LBOA 2VA3A 1JXEA 2DPIA 5AM2A 4ECXA 3U26A 4DFJA 5AIBA 2LYBA 2Y9UA 4FO6A 4OJ5A 4MF8A 3D6JA 1YZ7A 4FZNA 1K1QA 1X66A 2LHTA 2YMLA 3F2DA 2MRLA 5ALKA 2Y1IA 1XSLA 5G5HA 1KRPA 4UW9A 1ZQVA 3KHHA 3NRWA 4DQSA 1A77A 3T3FA 5HR7A 4OJLA 4DFKA 1MQ2A 4NJ8A 1Y88A 4JB3A 4C7YA 2R8GA 4Y2UA 3OGUA 3C1YA 3N7PD 3HX0A 1WUDA 2HCFA 3UMCA 4P4PA 2HBKA 2VIXA 1N63A 4KITB 1BGXT 1PK1A 4TQRA 5ALMA 1D9FA 2EQYA 5AKIA 1XNSA 4PHPA 4PZNA 1ZD4A 2JH1A 4UAZA 2K8CB 2W8KA 2O6KA 1BPBA 1XS9D 4F5QA 5KFAA 3M6KA 4EYHB 4FE3A 3M8RA 1NK9A 1TAUA 2OWOA 5CR0A 2XO7A 3IN5A 1ZJMA 2FDRA 4MFFA 2OYYA 4Y2JA 5KFWA 2ZIVA 3KFUF 1JRPA 5KAIU 2F3NA 2GOLA 3QYPA 1IXRA 4UBCA 2A3VA 1D8BA 3LVWA 3AEVA 2W9CA 1WCLA 2GLEA 2KJ8A 2WHEA 4NLNA 3UQ0A 4QZDA 5GTHU 1UA1A 4I2IA 4ECYA 4UB6U 5AKEA 1QQ5A 1TK8A 4EEKA 3D2QA 4RUCA 1ZQGA 4FZLA 1UCVA 5ALVA 1N56A 2MUTB 3UM9A 2GO7A 1RYRA 5ALEA 4C8LA 4US9A 1S0NA 1KN5A 3C5GA 3QU7A 4DSLA 1N60A 1AROP 3AMZA 4IQVA 2CXYA 1TAQA 2PMZC 2ZXHA 4KLJA 3IG5A 2WB1F 5CWRA 3GIKA 4M9GA 2KJ9A 2GWSA 3OJUA 5AM3A 3WK8A 3PR4A 3V6KA 4I2FA 3ICXA 4P2HA 3OHBA 1SB3C 3JPSA 4ED3A 9ICRA 1SL0A 2J6SA 5KTQA 9ICIA 8ICPA 3H0RB 3LWLA 4EBCA 1SXEA 1UPHA 1EXNA 3M7DA 4KLSA 1TV9A 3BQTA 1WWVA 3IG8A 2KOBA 1LKYA 5J29A 3C2KA 2ZIWB 1ZQYA 2F1IA 3FC4A 2VJ4A 2UVUA 4J03A 2JEFA 3B0YA 5J2DA 4O9MA 4GC7A 4DL4A 5JRTA 3GIIA 8ICSA 5AI6A 5EE0A 3PY8A 3RB0A 2ES6A 1KEJA 1UT8A 5DBBA 4OD0A 2DWQA 1ZD3A 2KP7A 2DGZA 4ELVA 5L1IA 5J2GA 2AXTU 9ICJA 3F2CA 2Z7JA 1S0MA 2AGOA 2VA8A 3J81j 9ICBA 1KKXA 1B4FA 1ZD2P 5CJ7A 3UXNA 1NK0A 3QU9A 1D9DA 1F0MA 4QZBA 2K8BB 5CA7A 2HDOA 3ZI4A 3O0FA 2BDUA 4YXJA 2B6GA 1Z4OA 3H8WA 4I27A 1ZQJA 4ECQA 2PKEA 1OXJA 1SZHA 4ED0A 1N5XA 3GV8B 1JUDA 3SV3A 3SAHA 2W7PA 3N7RC 3K1ZA 4QJFB 4NLZA 1BPEA 5AKZA 5KG6A 2WF5A 4M9HA 2I6XA 2A1JA 3KD3A 5KFVA 3SD7A 4YN4A 4LJXA 2DKZA 1U45A 4R8UA 4C8OA 3HKZF 1SKSA 2ZTDA 1NKCA 3MC1A 5JU5A 3EYZA 5KT4A 4PHDA 4YD2A 1RXVA 2IOFA 3B0XA 3HKZC 1QTMA 4PZOA 4KTQA 3PW2A 2ATLA 4UB8U 3OJSA 2XY6A 1ZQDA 1ZXIA 1S9FA 1KQQA 4JV1A 2W11A 1A6SA 4QZAA 2KD1A 3DDHA 5KFZA 5L9XA 1RPLA 1NK7A 5AHXA 2Y0SF 1V38A 2WFAA 2J6TA 2QLTA 1N62A 5KG4A 5B5EU 1T8EA 1OUQA 1ZETA 8ICAA 2QB0B 3Q8LA 2ZTCA 2I9GA 1SKWA 4Z6EA 1V9PA 2QB1A 1B22A 4BWJA 5CEHA 2JH7A 1ZQCA 9ICAA 3Q8KA 2ASJA 3F5EA 1U47A 3ISDA 1PK3A 2ZTEA 3NRZA 3MR3A 2BPCA 3QEAZ 2AQ4A 5DG7A 3QU2A 7ICUA 4XA5A 4RQ8A 2EAMA 9ICCA 4G3IA 2C2RA 2KFZA 1HIWA 5C0YA 3PW5A 1NZPA 2DKXA 3H7IA 1X40A 5KG2A 3UMBA 3AL0B 1A76A 2HHQA 2XGPA 1RQNA 3C23A 4ELUA 8ICUA 1LV5A 1KFDA 3QU5A 5J0SA 4UASA 2ZG6A 1ZQKA 4RPZA 3WKCA 4P0PB 1ZQHA 2V4QA 5ALJA 4R64A 2KG5A 2R8JA 2RHFA 4MFAA 5KFLA 2FLPA 3KTQA 4RPXA 1UA0A 1Z1VA 4DSEA 5C5JA 1XO0A 4NLGA 5KFQA 4FS2A 1RZTA 3WK4A 4FZMA 5ALIA 3H4DA 2XCPA 4IC9A 1Z4NA 1KBUA 2I5HA 4X5VA 4E0DA 3JPOA 1PK1B 3BQ1A 5J2EA 3PO5A 3WKDA 3TQ1A 1ZQRA 1VJ5A 2ZJAA 3RH5A 7ICVA 1PUZA 2BQUA 2CPRA 4QZFA 4J9PA 3HP6A 2KKVA 3JPTA 5KAFU 4PGXA 4DWIA 5D49A 2H5XA 4MEYA 5DBAA 3KOOA 4U6PA 4I2AA 3NASA 1YZ6A 5EOZA 9ICNA 5KFFA 4DCCA 1L3SA 4RNMA 7ICTA 4YD1A 5TZVA 4UB3A 4B9UA 4J9KA 3BQ0A 4I2JA 3AU6A 2XCAA 5KNIA 1V85A 4YP3A 2XGQA 4GFJA 3SEIA 3RJHA 1NK4A 4DOAA 2MAXA 2F1JA 4R66A 1S97A 2KSOB 5J2AA 2AU0A 1NK8A 2KV2A 5ALZA 3BZKA 2BDPA 5F3XB 4DSKA 4YQWA 4DOBA 4Y2PA 2LPEA 8ICHA 2W7OA 5D4BA 1NJYA 3RTVA 4Y2YA 2HHSA 5IILA 2KHVA 1L3VA 2KVSA 4C4TA 2ESEA 5KFHA 1DGSA 8ICMA 2Y9TA 5KFMA 2FMQA 2R8IA 4C4RA 8ICOA 4OCZA 4K4IA 1JMSA 2FMSA 2OH2A 1Z00A 3PX6A 4DL6A 1KDHA 4QW9A 2AGQA 4DF4A 2HBLA 2YMQA 4MF2A 4O3RA 2N1RA 3PW7A 2YMMA 4DLGA 5J0OA 3WK9A 3NTUA 1S76D 3ONNA 5ALWA 1RQLA 4CF4A 4F5PA 5ALRA 4KLIA 5J2HA 2AQ0A 3BQ7A 4M2YA 3IV6A 1QQ6A 3SENA 3EPIA 2W9CB 5DB7A 1U48A 1L7MA 2DBYA 8ICGA 5AM5A 1CUKA 4QWBA 2FI1A 3L5KA 1ZOLA 2HOQA 3G6VA 1C20A 5ALHA 1M6YA 1ZQUA 2G5HB 4RQ7A 5L1MA 2YQEA 2YB4A 3EPGA 3WK7A 3TFSA 3PVXA 3CRXA 4C8NA 3TADA 3V7LA 3ED5A 1ZQZA 8ICYA 4F71A 7ICKA 3PW0A 2C2DA 2JRZA 3T5KA 3I1YA 4J9OA 3PZPA 3MDAA 9ICTA 1L8OA 4R63A 5IINA 4TUPA 4B9SA 1ZQSA 2NRZA 1TKDA 1RM6C 5KG0A 2BKEA 3PR5B 2FMPA 2W9MA 1X9WA 1DK3A 3IP4B 2R18A 5J0YA 5TISU 2OHFA 3Q8MA 4J9LA 2DPJA 2ZUDA 9ICQA 3HPOA 1FIQA 9ICWA 3GZFA 3N7SC 4ED1A 3BJYA 2CN1A 4F5RA 3QZ7A 1OW5A 5ALPA 4R8UB 8ICLA 1D8LA 1COOA 4EX7A 2KK0A 5JUMA 2ZIXA 2C2EA 1U49A 1J2MA 4DSFA 3VCBA 4BXOA 1O08A 3CNHA 2MU2A 3BS7A 4Q44A 5EE3A 3Q8RB 4O3NA 2EAOA 3PX0A 2ZUBA 4O3OA 3KHLA 5KT2A 2NRTA 5J2FA 5KFNA 1N2XA 4DOCA 5IIMA 5ALGA 7ICIA 2OCEA 4RQ1A 5AI4A 4I2GA 1LB2B 3V6HA 3AU2A 5G5GA 3EUB2 4BJQA 4DLEA 5GTIU 2HHXA 7ICEA 2LM4A 1L7NA 4P0QA 1ZQFA 3D2NA 2EZXA 4PL1A 2ODGA 4P4OA 4JWMA 2W43A 4EZ6A 4G9BA 1L3UA 2HHVA 2K8AA 4AYBC 7ICNA 1B0XA 3RB3A 8ICIA 4KMUA 4PHEA 1X9XA 4Y2TA 3UMGA 4BUGA 2L5YA 2WF6A 2FLLA 3WU2U 2NO5A 4Y2VA 1KFSA 2P66A 2BQ3A 2KZ3A 1JN3A 1ZQQA 3DV9A 1HUZA 1J2NA 4PJ0U 2A1JB 9ICFA 1S0OA 3HILA 8ICKA 4XRHA 3VC8A 2HI0A 4EEYA 2M9NA 3RBEA 3L3FX 5IIOA 2D8CA 1ECWA 3KHRA 1T4GA 4QWAA 1GO3F 4M47A 5J0WA 1IG6A 4YCXA 2B21A 4HYKA 2A19A 3QNMA 2HMXA 4UARA 3RAXA 4LVSA 1SV4A 4F92B 3KKAC 3FAHA 3T5HA 4IQUA 3GV5B 3NVZA 4RQ3A 1RXWA 5AM1A 4B6JA 4RUAA 2H3VA 1XSNA 8ICRA 2KICA 2UVWA 9ICGA 2G06A 2DUYA 5A0LA 1Z00B 3KZIU 4F91B 3MFHA 5KG1A 3ZDBA 4KMOB 3M9NB 3QUCA 2YY6A 4ED6A 2FE9A 3MGIA 4FS1A 4CCHA 1JROA 2E1EA 3ORYA 4IRCA 3TADC 2XIDA 2A1AA 3S6JA 5DKWA 2NO4A 4ECVA 3C28A 3AQFA 1NNLA 4QZHA 8ICTA 5KL8B 1S10A 4PL2A 4K4GA 5IIJA 4UAWA 3ISBA 4F8RA 4OJ6A 5DG8A 2E3TA 2FJ6A 1Q3VA 4DF8A 2YTUA 4Q8FA 3HRDD 4CNQA 4KLMA 3BS5A 4YMNA 2UVVA 4GLXA 5D46A 4RT2A 4GXJA 4C8MA 2W3SA 3GU3A 4PGYA 3TFRA 2ISOA 3GIMA 3WK5A 3WKBA 3C5FA 9ICKA 4DL5A 4Y2XA 2RDJA 2ZUCA 5J0XA 9ICMA 2M0NA 3FYHA 1Z1BA 5T14A 2V4RA 4F2RA 5KFGA 2KN7A 4PH5A 5CHGA 3PX4A 5ALDA 4NL9A 1NKBA 1MA7A 4IR1A 1L6NA 9ICUA 4XUSA 5AKJA 3SMVA 4F4WA 1A0PA 2KTQA 2ZJ8A 3TAQA 4C80A 4ECTA 1NK6A 4BX9C 4R65A 3D2SA 2HBJA 2F77X 4O0IA 8ICBA 3OPXA 2BZFA 3PSFA 2QKQA 3AUOA 3MDCA 2G5IB 4BXOB 1ZQXA 4QIWC 5DQGA 7ICJA 4IRDA 2LYHA 1J97A 5L1LA 4RQ0A 4ECZA 4DQIA 4O3QA 5ALLA 2MA1A 1NZBA 3JPRA 4EELA 4YR0A 1N61A 7ICFA 4JMUA 2LMRA 1QH9A 3RFAA 3M8SA 4BDPA 5CP2A 1QSLA 2EZYA 1NKEA 1VDVA 2WF7A 4FBTA 3N4MB 9ICVA 2NV3A 2EH9A 3IRUA 5CB1A 1U9LA 2P6RA 5AKKA 5ALOA 5AKLA 1VLBA 1QCKA 2G08A 4IQTA 2E8NA 1TVAA 2Y1JA 3M1YA 5DDMA 1JIHA 3RJEA 1T7PA 2AJQA 4UB5A 1XO1A 1ZQPA 5JTIA 9ICOA 4UQGA 3MBYA 1XSPA 4ECWA 3OTQA 3RF9A 2LI6A 5DB9A 1MQ3A 3MABA 3QEBZ 5ALUA 4EX6A 2WAQC 3Q8PB 2YB1A 4MEXA 3PSPA 1Q3UA 5IIKA 4YR2A 2W55A 3V72A 5J8YA 4I2HA 4UB2A 2Q4TA 1Q46A 4M9JA 2WAQF 7ICRA 3UXOA 4DQQA 1JXLA 2NRXA 5KT3A 4F3OA 5J2JA 1YT3A 2XI9A 4OJOA 4Z6DA 5CRXA 3QZ8A 2XICA 5EWGA 4RQ4A 4CGZA 4NV0A 3NVWA 4I2DA 1IIPA 3QUQA 4TURA 4FBUA 2JMGA 5KFSA 4I28A 3RRGA 4KN7A 2XY7A 5BOMA 2NRWA 4C0ZA 2CRXA 4RU9A 2DF4B 2H3IA 2K4PA 4ZH4A 1SZPA 7ICMA 2WF9A 4QWDA 4J9QA 4I2EA 4M04A 4UATA 1ZRMA 5DLFA 5AM4A 5AKXA 4I2CA 4QZ9A 4CF3A 3HWTA 1ZQOA 1ZQTA 3CP8A 1ZQAA 5ALFA 3LDAA 5AI0A 1ZQIA 1ZRNA 4YXMA 5DG9A 5BOLA 4O5KA 5KFBA 4ED8A 1S8OA 1V97A 4F93B 3G6YA 3OHAA 1QSSA 1B43A 4B9NA 2ASDA 1ZQWA 1SGGA 4B9MA 3V7JA 1CRXA 4I29A 4O3MA 5L1KA 2K60A 4DSIA 1JX4A 4KLDA 4BGDA 1JALA 2G07A 4PGQA 2MSNA 3MGHA 3QU4A 8ICNA 2ISPA 4O5EA 5DB6A 8ICXA 4AYBF 2BCUA 2IA6A 2ZIWA 5KL1B 4YMMA 4KLUA 3AQEA 5ALNA 5KFDA 2BCRA 1WYGA 3NVVA 5AKGA 3K75D 4RZRA 3SQIA 3K4GA 5KG3A 5KFYA 4NL9C 1TK5A 4Q8EA 5HHIA 3ISCA 3GV7B 4YFKA 2KFNA 1ZQLA 1S77D 1NK5A 1KLNA 1ZQMA 2D3DA 3KBBA 3IHQB 4F4ZA 3UQ2A 2QB0A 3E0FA 1X9MA 4M9LA 4FFDA 5B66U 3MR6A 4Y2SA 4QZGA 3JPQA 2BCVA 3Q8SB 1LVHA 1RDFA 2BCQA 2R8HA 3UPQA 3B9JA 3RBDA 2KMDA 2JXJA 3RH4A 1ZQEA 4RQMA 4CRXA 4QZCA 3ZD8A 4DS5A 5J0QA 7ICHA 1X6JA 4C7ZA 1ZQBA 2PFNA 2W54A 4Y2QA 2BGWA 4JV0A 4IR9A 3H4BA 2HVIA 3TANA 4JWNA 5KFTA 3TAPA 7ICPA 1BVSA 2W03A 2OM6A 3N97B 2YX8A 5EE9A 1C7YA 3H8JA 2ZIXB 4KLLA 1U4BA 4F50A 5E79U 3RJIA 4IQWA 3RAQA 3L4PA 3TARA 4KLOA 3H0LB 4KX5A 3PNCA 4QWEA
chains in the Genus database with same CATH topology
2G07A 3GU3A 3RF9A 3VC8A 2GOLA 2Y0SC 4QIWF 3F2CA 2HOFA 2HBLA 1D8BA 2A3VA 1T94A 2LKYA 2N1RA 2Z7JA 2ZIXA 3LVWA 1KBUA 2E5SA 2WAQC 2KKPA 2F8LA 2KJ5A 2YB1A 1ZQ1C 3L3FX 2RRDA 2KJ8A 4NWIA 1PVRA 1ECWA 4ACOA 2F2AB 2ZIUB 3PSPA 3ONNA 1Q3UA 3VCBA 3SAFA 4AYBF 3SAGA 2M0NA 2K8BB 1Z19A 3O0FA 3NUQA 2ZIWA 2BDUA 2Q4TA 3D2QA 2JH7A 2HOIA 1ED1A 2WAQF 1Z1BA 4OJPA 2K89A 5KL1B 5T14A 1GO3F 4FZLA 2VKQA 2G0AA 4P0QB 1TAMA 3F5EA 2LBOA 4NLCA 3AQEA 1MA7A 1YT3A 2XI9A 4OJOA 2OXOA 1HEKA 5CRXA 2XICA 2CPRA 1L6NA 3LVVA 1SZHA 2HMXA 2KVCA 1PVQA 2LYBA 2KKVA 2H3FA 3SMVA 1A0PA 3F2BA 3SQIA 4CGZA 4ICAA 4OJ5A 4NV0A 4BX9C 3PSTA 2JHDA 3SAHA 3F53A 1IIPA 2W7PA 2PMZC 3N7RC 4FZNA 2ZXHA 3K1ZA 4QJFB 4U6PA 3KZXA 2JMGA 3D2SA 2LYAA 4BJQA 2LHTA 4CDGA 2D6FC 4WJ3B 3F2DA 2MRLA 3C29A 3IG5A 2WB1F 2HBJA 2HOQA 1P7DA 2F77X 2KJ9A 3E0FA 3OPXA 2K4IA 2HBMA 2E1FA 2H3VA 4P0QA 3NRWA 1PVPA 4QNLA 2KICA 2G5HB 3PSFA 1DRGA 5HR7A 3D2NA 2YB4A 3ALRA 3ICXA 4OJLA 4C0ZA 1HIWA 2CRXA 2KNJA 3LYSA 2DF4B 2G09A 2H3IA 2G06A 5A0LA 1F44A 5C0YA 4PL1A 3CRXA 2G5IB 4QIWC 3HKZF 5HR6A 4KMOB 2H3ZA 3AL0B 4GFJA 3N7PD 2ZIVB 2ZXIA 2GH1A 4CRXA 3MGVA 1WUDA 2E1EA 2K4HA 2K8AA 4AYBC 3H0MB 3PZPA 2MA1A 2HBKA 2XIDA 2VIXA 3H0RB 4U7CA 3HKZC 1NZBA 3C28A 3AQFA 2JGAA 4KX3A 2H3QA 1UPHA 2KHQA 4NLBA 5KL8B 4JMUA 2ZG6A 2KV2A 3M7DA 1XNSA 4BUGA 3RFAA 3CP8A 2W03A 2OM6A 3IG8A 3CYMA 3F5AA 2YX8A 2KOBA 4PL2A 2VJ5A 2F76X 2KIWA 4P0PB 2ZIWB 2JH1A 1A6SA 2K8CB 4OJ6A 2NV3A 2VJ4A 2KD1A 2KEYA 2RHFA 2ZIXB 2W7OA 3T79A 3IP4B 2R18A 1Q3VA 3M6KA 2G08A 2PMZF 1URJA 4FE3A 2XVTA 1XO0A 2KHVA 2ZIUA 3M6ZA 3PSIA 3IN5A 4P0PA 2WB1C 2K4EA 2Y0SF 4FZMA 2W04A 1CRXA 2RP5A 3GZFA 4O3MA 3N7SC 2OYYA 4A8EA 4OO1J 3H0LB 4KX5A 2ZIVA 1OUQA 2CN1A 2OH2A 3KFUF 2DGZA 2DQNB 3DEEA 4IC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6N A;  2GOL A;  2HMX A;  1A6S A;  2LYB A;  2H3F A;  2N1R A;  2NV3 A;  2H3Z A;  4ICA A;  1ECW A;  2K4H A;  2JMG A;  2LYA A;  2K4E A;  2K4I A;  1ED1 A;  2H3V A;  2H3Q A;  1UPH A;  4JMU A;  1TAM A;  1HIW A;  2H3I A;  4IC9 A;  1HEK A; 
#chains in the Genus database with same CATH topology
 3LWM A;  2ALZ A;  3TAC B;  2Y0S C;  1L7O A;  1HJP A;  5HMM A;  2KKP A;  1AQ6 A;  4ACO A;  1X9S A;  3A0B U;  5J0P A;  1Z19 A;  2P6U A;  8ICE A;  1DGJ A;  2HW3 A;  5AI9 A;  1FFV A;  4RNN A;  4ECU A;  3R9K A;  2G0A A;  2HHU A;  4C8K A;  1HEK A;  2KZM A;  1BNO A;  3LVV A;  1PVQ A;  1ZYQ A;  3C1Z A;  2JEI A;  1COK A;  3PST A;  3ZDD A;  4DO9 A;  3F53 A;  2PI5 A;  5KT6 A;  4UBB A;  8ICC A;  4GXK A;  2DL0 A;  4I2B A;  2F8K A;  1RYS A;  3C29 A;  2R8K A;  1NJX A;  1P7D A;  3ETR A;  3PML A;  5KFJ A;  1QSY A;  3H40 A;  1QLN A;  3RJJ A;  3RR8 A;  9ICS A;  3IM1 A;  2W9B A;  4NLK A;  4QWC A;  1L5U A;  2ZIV B;  4F4Y A;  4RQ2 A;  3MGV A;  1WG8 A;  1XU4 A;  2Q0Z X;  3H0M B;  3PW4 A;  4DQP A;  4DL3 A;  2JGA A;  2W9B B;  3NVY A;  5AKY A;  3RB4 A;  4F5N A;  3QUT A;  3JPP A;  2JZB B;  3BQ2 A;  4EZ9 A;  4B9T A;  1FEZ A;  2VJ5 A;  5AIA A;  9ICL A;  5ALX A;  4QZE A;  2KEY A;  3M9O B;  1T3Q A;  5DB8 A;  4ED7 A;  3RJF A;  1PZN A;  1X42 A;  5ALQ A;  3WKE A;  4C4S A;  3HT3 A;  4A8E A;  2DQN B;  4QZ8 A;  4QZI A;  3T5J A;  2PFQ A;  3E58 A;  7ICG A;  4QIW F;  1SV0 A;  2PFP A;  2F44 A;  4MHV A;  4USA A;  3RJG A;  4NWI A;  1PVR A;  3NGD A;  3SAG A;  4US8 A;  5AIC A;  2WTF A;  1WWU A;  4TUQ A;  2HOI A;  1FFU A;  1ED1 A;  2HHW A;  4P4M A;  8ICF A;  5KFX A;  2JZB A;  2KIV A;  3QUB A;  5DLG A;  1KTQ A;  1LKY B;  2XC9 A;  3K1R B;  1SL1 A;  2KVC A;  4M0A A;  5KFI A;  1BPZ A;  2JHD A;  3MFI A;  4O3S A;  4KLH A;  5H2F U;  1KL9 A;  4CDG A;  1BPX A;  3C2L A;  3WKA A;  5EWF A;  1PVP A;  1DRG A;  4QNL A;  1TFR A;  3LYS A;  2KSO A;  4BWM A;  4TUS A;  1BPY A;  3PMN A;  5HR6 A;  5L1J A;  3ZDC A;  3HJE A;  4JV2 A;  2GH1 A;  4DS4 A;  2BCS A;  4DL2 A;  2AHO B;  4YVZ A;  1CEZ A;  2QAR B;  4IS7 A;  4NXZ A;  3C21 A;  2KHQ A;  5J2K A;  5KT7 A;  4RQN A;  5HML A;  4KLE A;  3IDW A;  1XC9 A;  7ICL A;  3ZDA A;  4F4K A;  1T3N A;  1RYU A;  3T79 A;  1DXS A;  1SKR A;  1URJ A;  2VAN A;  2IBK A;  2ZIU A;  2WB1 C;  3PO4 A;  2RP5 A;  4OO1 J;  5DGA A;  2W9A A;  2KE7 A;  3JPN A;  2W3R A;  4RT3 A;  3DEE A;  5HNK A;  2NYV A;  5ALT A;  4UB1 A;  5III A;  2HOF A;  8ICJ A;  4EEN A;  4Q43 A;  1T94 A;  1KSP A;  5J2I A;  1ZJN A;  4JK1 A;  3HW8 A;  2RRD A;  4DFM A;  7ICO A;  4NM2 A;  2C22 A;  1Z3E B;  2YMP A;  5DGB A;  5KFE A;  3NUQ A;  1SWV A;  2IOF K;  3SYZ A;  2VKQ A;  7ICS A;  2PXI A;  1QQ7 A;  5J8Y C;  4ECR A;  3MR5 A;  3I28 A;  3KKA A;  2OXO A;  5J2C A;  4M6W B;  3ETL A;  4XQ8 A;  3RH6 A;  2H3F A;  3F2B A;  3QX7 A;  4ICA A;  1IM4 A;  3GIJ A;  1L7P A;  2WF8 A;  5ALS A;  1KFT A;  3RJK A;  1K1S A;  3KZX A;  4ELT A;  8ICQ A;  5EWE A;  4PHA A;  2AGP A;  2HBM A;  2HHT A;  2ZJ5 A;  2JEG A;  1KW4 A;  4UAU A;  3GIL A;  1JI7 A;  2BHN A;  3ALR A;  2C28 A;  2G09 A;  1F44 A;  3ZD9 A;  3NS1 A;  3WK6 A;  4KN4 A;  5DBC A;  4JUZ A;  5KFP A;  5KFU A;  2RQ5 A;  5J0R A;  5AI8 A;  2K4H A;  2FPK A;  4DSJ A;  4CF5 A;  3THV A;  1O03 A;  5KFK A;  5KFC A;  4NLB A;  4IRK A;  3LK9 A;  2F76 X;  9ICH A;  2EZZ A;  4DL7 A;  5AK5 A;  1NOM A;  9ICP A;  4J9N A;  1F5S A;  2PMZ F;  3QE9 Y;  4RQ6 A;  5DDY A;  4LZG A;  4O5C A;  2AH5 A;  3OSN A;  1L3T A;  1SXD A;  2JR5 A;  3FM9 A;  3QXG A;  3RRH A;  5KT5 A;  2B0C A;  3GQC A;  1TE2 A;  2IHM A;  4YG2 A;  5DQI A;  1X6I A;  3PV8 A;  5ALY A;  5AM0 A;  3CW2 C;  3TI0 A;  2MUT A;  2HSZ A;  1FO4 A;  2JV3 A;  4J9M A;  2E5S A;  4EBD A;  2KJ5 A;  3C2M A;  3V7K A;  2F2A B;  2ZIU B;  5F9L A;  3SAF A;  2BR0 A;  4F2S A;  8ICV A;  1TK0 A;  4KLT A;  4RPY A;  2K89 A;  1XWL A;  1Q8K A;  3RR7 A;  1TAM A;  4GC6 A;  4J9S A;  3FDS A;  2YN4 A;  2I1Q A;  4KLF A;  3OSP A;  4F72 A;  1ZQN A;  4YMO A;  3EWA A;  4GXI A;  3H8M A;  7ICQ A;  3SI8 A;  2FLN A;  4Z6C A;  2RDI A;  4B9L A;  2E1F A;  3EZ5 A;  4EBE A;  3BDP A;  1ZD5 A;  4MFC A;  5K4L A;  2NRV A;  2KNJ A;  4YR3 A;  4NY8 A;  1DK2 A;  4UAV A;  2DFL A;  1L8L A;  2H3Z A;  4RNO A;  2W8L A;  4UB4 A;  2IMW P;  2ZXI A;  2KZZ A;  3A0H U;  5J0T A;  4KLQ A;  5DQH A;  2E8O A;  4J9R A;  1HUO A;  2H3Q A;  4RQ5 A;  1RG6 A;  3V6J A;  4IL6 U;  3CYM A;  1N5W A;  4DFD A;  4F5O A;  2JEJ A;  1X2I A;  2KIW A;  2EAP A;  2V9W A;  5AK6 A;  1MN8 A;  1WCN A;  9ICE A;  4GIB A;  5AK4 A;  4DQR A;  5HHH A;  3M6Z A;  3PSI A;  2F1H A;  4P0P A;  5F9N A;  2K4E A;  1S5L U;  2W04 A;  3AN1 A;  4HAI A;  3RB6 A;  1SWW A;  4Q45 A;  1CI4 A;  8ICZ A;  3UXP A;  4DEZ A;  2LKY A;  2F8L A;  3GDX A;  2OEH A;  4F4X A;  4ED2 A;  2E8P A;  1IV8 A;  5AI5 A;  2VA2 A;  2IHN A;  3N28 A;  3G6X A;  1BNP A;  2BPG A;  3TKA A;  4NLC A;  2LM1 A;  3SR6 A;  4QW8 A;  3E2E A;  4ECS A;  3BS5 B;  2UVR A;  1NJZ A;  2E8M A;  4WJ3 B;  2LYA A;  2D6F C;  4K4H A;  1NJW A;  2K4I A;  3GFK B;  4Y2R A;  1S0V A;  1UT5 A;  2P35 A;  4M9N A;  3MR2 A;  4AP9 A;  1UHU A;  1MC8 A;  3H8S A;  2RLT A;  2XY5 A;  4KLG A;  2J6U A;  2FPM A;  2EAN A;  3T5L A;  5AKH A;  3EW9 A;  5J0U A;  3M9M B;  1MSW D;  4U7C A;  2BQR A;  1SL2 A;  9ICX A;  4KX3 A;  4EYI B;  4O3P A;  3ZDE A;  1DOQ A;  3F5A A;  4UAY A;  3SV4 A;  5HP4 A;  1K5O A;  1NI3 A;  2IOH A;  2HVH A;  4B9V A;  3SZ2 A;  2FPL A;  5AK3 A;  1UQV A;  5KFO A;  2XVT A;  4M6W A;  2PFO A;  2QAR A;  4Z6F A;  2BPF A;  1SV0 C;  3Q8Q B;  1SIJ A;  1BPD A;  4NM1 A;  4DFP A;  1ZQ1 C;  2PI4 A;  4TQS A;  8ICW A;  1H38 A;  5J2B A;  5KG7 A;  4LZD A;  1D8Y A;  2ASL A;  3BZC A;  5FP0 A;  3KHG A;  4PPX A;  5KFR A;  1N48 A;  3I76 A;  5EE1 A;  4ZOH C;  5BPC A;  4CE6 A;  2EDU A;  4OJP A;  3AM9 A;  4P0Q B;  5KG5 A;  2LBO A;  2VA3 A;  1JXE A;  2DPI A;  5AM2 A;  4ECX A;  3U26 A;  4DFJ A;  5AIB A;  2LYB A;  2Y9U A;  4FO6 A;  4OJ5 A;  4MF8 A;  3D6J A;  1YZ7 A;  4FZN A;  1K1Q A;  1X66 A;  2LHT A;  2YML A;  3F2D A;  2MRL A;  5ALK A;  2Y1I A;  1XSL A;  5G5H A;  1KRP A;  4UW9 A;  1ZQV A;  3KHH A;  3NRW A;  4DQS A;  1A77 A;  3T3F A;  5HR7 A;  4OJL A;  4DFK A;  1MQ2 A;  4NJ8 A;  1Y88 A;  4JB3 A;  4C7Y A;  2R8G A;  4Y2U A;  3OGU A;  3C1Y A;  3N7P D;  3HX0 A;  1WUD A;  2HCF A;  3UMC A;  4P4P A;  2HBK A;  2VIX A;  1N63 A;  4KIT B;  1BGX T;  1PK1 A;  4TQR A;  5ALM A;  1D9F A;  2EQY A;  5AKI A;  1XNS A;  4PHP A;  4PZN A;  1ZD4 A;  2JH1 A;  4UAZ A;  2K8C B;  2W8K A;  2O6K A;  1BPB A;  1XS9 D;  4F5Q A;  5KFA A;  3M6K A;  4EYH B;  4FE3 A;  3M8R A;  1NK9 A;  1TAU A;  2OWO A;  5CR0 A;  2XO7 A;  3IN5 A;  1ZJM A;  2FDR A;  4MFF A;  2OYY A;  4Y2J A;  5KFW A;  2ZIV A;  3KFU F;  1JRP A;  5KAI U;  2F3N A;  2GOL A;  3QYP A;  1IXR A;  4UBC A;  2A3V A;  1D8B A;  3LVW A;  3AEV A;  2W9C A;  1WCL A;  2GLE A;  2KJ8 A;  2WHE A;  4NLN A;  3UQ0 A;  4QZD A;  5GTH U;  1UA1 A;  4I2I A;  4ECY A;  4UB6 U;  5AKE A;  1QQ5 A;  1TK8 A;  4EEK A;  3D2Q A;  4RUC A;  1ZQG A;  4FZL A;  1UCV A;  5ALV A;  1N56 A;  2MUT B;  3UM9 A;  2GO7 A;  1RYR A;  5ALE A;  4C8L A;  4US9 A;  1S0N A;  1KN5 A;  3C5G A;  3QU7 A;  4DSL A;  1N60 A;  1ARO P;  3AMZ A;  4IQV A;  2CXY A;  1TAQ A;  2PMZ C;  2ZXH A;  4KLJ A;  3IG5 A;  2WB1 F;  5CWR A;  3GIK A;  4M9G A;  2KJ9 A;  2GWS A;  3OJU A;  5AM3 A;  3WK8 A;  3PR4 A;  3V6K A;  4I2F A;  3ICX A;  4P2H A;  3OHB A;  1SB3 C;  3JPS A;  4ED3 A;  9ICR A;  1SL0 A;  2J6S A;  5KTQ A;  9ICI A;  8ICP A;  3H0R B;  3LWL A;  4EBC A;  1SXE A;  1UPH A;  1EXN A;  3M7D A;  4KLS A;  1TV9 A;  3BQT A;  1WWV A;  3IG8 A;  2KOB A;  1LKY A;  5J29 A;  3C2K A;  2ZIW B;  1ZQY A;  2F1I A;  3FC4 A;  2VJ4 A;  2UVU A;  4J03 A;  2JEF A;  3B0Y A;  5J2D A;  4O9M A;  4GC7 A;  4DL4 A;  5JRT A;  3GII A;  8ICS A;  5AI6 A;  5EE0 A;  3PY8 A;  3RB0 A;  2ES6 A;  1KEJ A;  1UT8 A;  5DBB A;  4OD0 A;  2DWQ A;  1ZD3 A;  2KP7 A;  2DGZ A;  4ELV A;  5L1I A;  5J2G A;  2AXT U;  9ICJ A;  3F2C A;  2Z7J A;  1S0M A;  2AGO A;  2VA8 A;  3J81 j;  9ICB A;  1KKX A;  1B4F A;  1ZD2 P;  5CJ7 A;  3UXN A;  1NK0 A;  3QU9 A;  1D9D A;  1F0M A;  4QZB A;  2K8B B;  5CA7 A;  2HDO A;  3ZI4 A;  3O0F A;  2BDU A;  4YXJ A;  2B6G A;  1Z4O A;  3H8W A;  4I27 A;  1ZQJ A;  4ECQ A;  2PKE A;  1OXJ A;  1SZH A;  4ED0 A;  1N5X A;  3GV8 B;  1JUD A;  3SV3 A;  3SAH A;  2W7P A;  3N7R C;  3K1Z A;  4QJF B;  4NLZ A;  1BPE A;  5AKZ A;  5KG6 A;  2WF5 A;  4M9H A;  2I6X A;  2A1J A;  3KD3 A;  5KFV A;  3SD7 A;  4YN4 A;  4LJX A;  2DKZ A;  1U45 A;  4R8U A;  4C8O A;  3HKZ F;  1SKS A;  2ZTD A;  1NKC A;  3MC1 A;  5JU5 A;  3EYZ A;  5KT4 A;  4PHD A;  4YD2 A;  1RXV A;  2IOF A;  3B0X A;  3HKZ C;  1QTM A;  4PZO A;  4KTQ A;  3PW2 A;  2ATL A;  4UB8 U;  3OJS A;  2XY6 A;  1ZQD A;  1ZXI A;  1S9F A;  1KQQ A;  4JV1 A;  2W11 A;  1A6S A;  4QZA A;  2KD1 A;  3DDH A;  5KFZ A;  5L9X A;  1RPL A;  1NK7 A;  5AHX A;  2Y0S F;  1V38 A;  2WFA A;  2J6T A;  2QLT A;  1N62 A;  5KG4 A;  5B5E U;  1T8E A;  1OUQ A;  1ZET A;  8ICA A;  2QB0 B;  3Q8L A;  2ZTC A;  2I9G A;  1SKW A;  4Z6E A;  1V9P A;  2QB1 A;  1B22 A;  4BWJ A;  5CEH A;  2JH7 A;  1ZQC A;  9ICA A;  3Q8K A;  2ASJ A;  3F5E A;  1U47 A;  3ISD A;  1PK3 A;  2ZTE A;  3NRZ A;  3MR3 A;  2BPC A;  3QEA Z;  2AQ4 A;  5DG7 A;  3QU2 A;  7ICU A;  4XA5 A;  4RQ8 A;  2EAM A;  9ICC A;  4G3I A;  2C2R A;  2KFZ A;  1HIW A;  5C0Y A;  3PW5 A;  1NZP A;  2DKX A;  3H7I A;  1X40 A;  5KG2 A;  3UMB A;  3AL0 B;  1A76 A;  2HHQ A;  2XGP A;  1RQN A;  3C23 A;  4ELU A;  8ICU A;  1LV5 A;  1KFD A;  3QU5 A;  5J0S A;  4UAS A;  2ZG6 A;  1ZQK A;  4RPZ A;  3WKC A;  4P0P B;  1ZQH A;  2V4Q A;  5ALJ A;  4R64 A;  2KG5 A;  2R8J A;  2RHF A;  4MFA A;  5KFL A;  2FLP A;  3KTQ A;  4RPX A;  1UA0 A;  1Z1V A;  4DSE A;  5C5J A;  1XO0 A;  4NLG A;  5KFQ A;  4FS2 A;  1RZT A;  3WK4 A;  4FZM A;  5ALI A;  3H4D A;  2XCP A;  4IC9 A;  1Z4N A;  1KBU A;  2I5H A;  4X5V A;  4E0D A;  3JPO A;  1PK1 B;  3BQ1 A;  5J2E A;  3PO5 A;  3WKD A;  3TQ1 A;  1ZQR A;  1VJ5 A;  2ZJA A;  3RH5 A;  7ICV A;  1PUZ A;  2BQU A;  2CPR A;  4QZF A;  4J9P A;  3HP6 A;  2KKV A;  3JPT A;  5KAF U;  4PGX A;  4DWI A;  5D49 A;  2H5X A;  4MEY A;  5DBA A;  3KOO A;  4U6P A;  4I2A A;  3NAS A;  1YZ6 A;  5EOZ A;  9ICN A;  5KFF A;  4DCC A;  1L3S A;  4RNM A;  7ICT A;  4YD1 A;  5TZV A;  4UB3 A;  4B9U A;  4J9K A;  3BQ0 A;  4I2J A;  3AU6 A;  2XCA A;  5KNI A;  1V85 A;  4YP3 A;  2XGQ A;  4GFJ A;  3SEI A;  3RJH A;  1NK4 A;  4DOA A;  2MAX A;  2F1J A;  4R66 A;  1S97 A;  2KSO B;  5J2A A;  2AU0 A;  1NK8 A;  2KV2 A;  5ALZ A;  3BZK A;  2BDP A;  5F3X B;  4DSK A;  4YQW A;  4DOB A;  4Y2P A;  2LPE A;  8ICH A;  2W7O A;  5D4B A;  1NJY A;  3RTV A;  4Y2Y A;  2HHS A;  5IIL A;  2KHV A;  1L3V A;  2KVS A;  4C4T A;  2ESE A;  5KFH A;  1DGS A;  8ICM A;  2Y9T A;  5KFM A;  2FMQ A;  2R8I A;  4C4R A;  8ICO A;  4OCZ A;  4K4I A;  1JMS A;  2FMS A;  2OH2 A;  1Z00 A;  3PX6 A;  4DL6 A;  1KDH A;  4QW9 A;  2AGQ A;  4DF4 A;  2HBL A;  2YMQ A;  4MF2 A;  4O3R A;  2N1R A;  3PW7 A;  2YMM A;  4DLG A;  5J0O A;  3WK9 A;  3NTU A;  1S76 D;  3ONN A;  5ALW A;  1RQL A;  4CF4 A;  4F5P A;  5ALR A;  4KLI A;  5J2H A;  2AQ0 A;  3BQ7 A;  4M2Y A;  3IV6 A;  1QQ6 A;  3SEN A;  3EPI A;  2W9C B;  5DB7 A;  1U48 A;  1L7M A;  2DBY A;  8ICG A;  5AM5 A;  1CUK A;  4QWB A;  2FI1 A;  3L5K A;  1ZOL A;  2HOQ A;  3G6V A;  1C20 A;  5ALH A;  1M6Y A;  1ZQU A;  2G5H B;  4RQ7 A;  5L1M A;  2YQE A;  2YB4 A;  3EPG A;  3WK7 A;  3TFS A;  3PVX A;  3CRX A;  4C8N A;  3TAD A;  3V7L A;  3ED5 A;  1ZQZ A;  8ICY A;  4F71 A;  7ICK A;  3PW0 A;  2C2D A;  2JRZ A;  3T5K A;  3I1Y A;  4J9O A;  3PZP A;  3MDA A;  9ICT A;  1L8O A;  4R63 A;  5IIN A;  4TUP A;  4B9S A;  1ZQS A;  2NRZ A;  1TKD A;  1RM6 C;  5KG0 A;  2BKE A;  3PR5 B;  2FMP A;  2W9M A;  1X9W A;  1DK3 A;  3IP4 B;  2R18 A;  5J0Y A;  5TIS U;  2OHF A;  3Q8M A;  4J9L A;  2DPJ A;  2ZUD A;  9ICQ A;  3HPO A;  1FIQ A;  9ICW A;  3GZF A;  3N7S C;  4ED1 A;  3BJY A;  2CN1 A;  4F5R A;  3QZ7 A;  1OW5 A;  5ALP A;  4R8U B;  8ICL A;  1D8L A;  1COO A;  4EX7 A;  2KK0 A;  5JUM A;  2ZIX A;  2C2E A;  1U49 A;  1J2M A;  4DSF A;  3VCB A;  4BXO A;  1O08 A;  3CNH A;  2MU2 A;  3BS7 A;  4Q44 A;  5EE3 A;  3Q8R B;  4O3N A;  2EAO A;  3PX0 A;  2ZUB A;  4O3O A;  3KHL A;  5KT2 A;  2NRT A;  5J2F A;  5KFN A;  1N2X A;  4DOC A;  5IIM A;  5ALG A;  7ICI A;  2OCE A;  4RQ1 A;  5AI4 A;  4I2G A;  1LB2 B;  3V6H A;  3AU2 A;  5G5G A;  3EUB 2;  4BJQ A;  4DLE A;  5GTI U;  2HHX A;  7ICE A;  2LM4 A;  1L7N A;  4P0Q A;  1ZQF A;  3D2N A;  2EZX A;  4PL1 A;  2ODG A;  4P4O A;  4JWM A;  2W43 A;  4EZ6 A;  4G9B A;  1L3U A;  2HHV A;  2K8A A;  4AYB C;  7ICN A;  1B0X A;  3RB3 A;  8ICI A;  4KMU A;  4PHE A;  1X9X A;  4Y2T A;  3UMG A;  4BUG A;  2L5Y A;  2WF6 A;  2FLL A;  3WU2 U;  2NO5 A;  4Y2V A;  1KFS A;  2P66 A;  2BQ3 A;  2KZ3 A;  1JN3 A;  1ZQQ A;  3DV9 A;  1HUZ A;  1J2N A;  4PJ0 U;  2A1J B;  9ICF A;  1S0O A;  3HIL A;  8ICK A;  4XRH A;  3VC8 A;  2HI0 A;  4EEY A;  2M9N A;  3RBE A;  3L3F X;  5IIO A;  2D8C A;  1ECW A;  3KHR A;  1T4G A;  4QWA A;  1GO3 F;  4M47 A;  5J0W A;  1IG6 A;  4YCX A;  2B21 A;  4HYK A;  2A19 A;  3QNM A;  2HMX A;  4UAR A;  3RAX A;  4LVS A;  1SV4 A;  4F92 B;  3KKA C;  3FAH A;  3T5H A;  4IQU A;  3GV5 B;  3NVZ A;  4RQ3 A;  1RXW A;  5AM1 A;  4B6J A;  4RUA A;  2H3V A;  1XSN A;  8ICR A;  2KIC A;  2UVW A;  9ICG A;  2G06 A;  2DUY A;  5A0L A;  1Z00 B;  3KZI U;  4F91 B;  3MFH A;  5KG1 A;  3ZDB A;  4KMO B;  3M9N B;  3QUC A;  2YY6 A;  4ED6 A;  2FE9 A;  3MGI A;  4FS1 A;  4CCH A;  1JRO A;  2E1E A;  3ORY A;  4IRC A;  3TAD C;  2XID A;  2A1A A;  3S6J A;  5DKW A;  2NO4 A;  4ECV A;  3C28 A;  3AQF A;  1NNL A;  4QZH A;  8ICT A;  5KL8 B;  1S10 A;  4PL2 A;  4K4G A;  5IIJ A;  4UAW A;  3ISB A;  4F8R A;  4OJ6 A;  5DG8 A;  2E3T A;  2FJ6 A;  1Q3V A;  4DF8 A;  2YTU A;  4Q8F A;  3HRD D;  4CNQ A;  4KLM A;  3BS5 A;  4YMN A;  2UVV A;  4GLX A;  5D46 A;  4RT2 A;  4GXJ A;  4C8M A;  2W3S A;  3GU3 A;  4PGY A;  3TFR A;  2ISO A;  3GIM A;  3WK5 A;  3WKB A;  3C5F A;  9ICK A;  4DL5 A;  4Y2X A;  2RDJ A;  2ZUC A;  5J0X A;  9ICM A;  2M0N A;  3FYH A;  1Z1B A;  5T14 A;  2V4R A;  4F2R A;  5KFG A;  2KN7 A;  4PH5 A;  5CHG A;  3PX4 A;  5ALD A;  4NL9 A;  1NKB A;  1MA7 A;  4IR1 A;  1L6N A;  9ICU A;  4XUS A;  5AKJ A;  3SMV A;  4F4W A;  1A0P A;  2KTQ A;  2ZJ8 A;  3TAQ A;  4C80 A;  4ECT A;  1NK6 A;  4BX9 C;  4R65 A;  3D2S A;  2HBJ A;  2F77 X;  4O0I A;  8ICB A;  3OPX A;  2BZF A;  3PSF A;  2QKQ A;  3AUO A;  3MDC A;  2G5I B;  4BXO B;  1ZQX A;  4QIW C;  5DQG A;  7ICJ A;  4IRD A;  2LYH A;  1J97 A;  5L1L A;  4RQ0 A;  4ECZ A;  4DQI A;  4O3Q A;  5ALL A;  2MA1 A;  1NZB A;  3JPR A;  4EEL A;  4YR0 A;  1N61 A;  7ICF A;  4JMU A;  2LMR A;  1QH9 A;  3RFA A;  3M8S A;  4BDP A;  5CP2 A;  1QSL A;  2EZY A;  1NKE A;  1VDV A;  2WF7 A;  4FBT A;  3N4M B;  9ICV A;  2NV3 A;  2EH9 A;  3IRU A;  5CB1 A;  1U9L A;  2P6R A;  5AKK A;  5ALO A;  5AKL A;  1VLB A;  1QCK A;  2G08 A;  4IQT A;  2E8N A;  1TVA A;  2Y1J A;  3M1Y A;  5DDM A;  1JIH A;  3RJE A;  1T7P A;  2AJQ A;  4UB5 A;  1XO1 A;  1ZQP A;  5JTI A;  9ICO A;  4UQG A;  3MBY A;  1XSP A;  4ECW A;  3OTQ A;  3RF9 A;  2LI6 A;  5DB9 A;  1MQ3 A;  3MAB A;  3QEB Z;  5ALU A;  4EX6 A;  2WAQ C;  3Q8P B;  2YB1 A;  4MEX A;  3PSP A;  1Q3U A;  5IIK A;  4YR2 A;  2W55 A;  3V72 A;  5J8Y A;  4I2H A;  4UB2 A;  2Q4T A;  1Q46 A;  4M9J A;  2WAQ F;  7ICR A;  3UXO A;  4DQQ A;  1JXL A;  2NRX A;  5KT3 A;  4F3O A;  5J2J A;  1YT3 A;  2XI9 A;  4OJO A;  4Z6D A;  5CRX A;  3QZ8 A;  2XIC A;  5EWG A;  4RQ4 A;  4CGZ A;  4NV0 A;  3NVW A;  4I2D A;  1IIP A;  3QUQ A;  4TUR A;  4FBU A;  2JMG A;  5KFS A;  4I28 A;  3RRG A;  4KN7 A;  2XY7 A;  5BOM A;  2NRW A;  4C0Z A;  2CRX A;  4RU9 A;  2DF4 B;  2H3I A;  2K4P A;  4ZH4 A;  1SZP A;  7ICM A;  2WF9 A;  4QWD A;  4J9Q A;  4I2E A;  4M04 A;  4UAT A;  1ZRM A;  5DLF A;  5AM4 A;  5AKX A;  4I2C A;  4QZ9 A;  4CF3 A;  3HWT A;  1ZQO A;  1ZQT A;  3CP8 A;  1ZQA A;  5ALF A;  3LDA A;  5AI0 A;  1ZQI A;  1ZRN A;  4YXM A;  5DG9 A;  5BOL A;  4O5K A;  5KFB A;  4ED8 A;  1S8O A;  1V97 A;  4F93 B;  3G6Y A;  3OHA A;  1QSS A;  1B43 A;  4B9N A;  2ASD A;  1ZQW A;  1SGG A;  4B9M A;  3V7J A;  1CRX A;  4I29 A;  4O3M A;  5L1K A;  2K60 A;  4DSI A;  1JX4 A;  4KLD A;  4BGD A;  1JAL A;  2G07 A;  4PGQ A;  2MSN A;  3MGH A;  3QU4 A;  8ICN A;  2ISP A;  4O5E A;  5DB6 A;  8ICX A;  4AYB F;  2BCU A;  2IA6 A;  2ZIW A;  5KL1 B;  4YMM A;  4KLU A;  3AQE A;  5ALN A;  5KFD A;  2BCR A;  1WYG A;  3NVV A;  5AKG A;  3K75 D;  4RZR A;  3SQI A;  3K4G A;  5KG3 A;  5KFY A;  4NL9 C;  1TK5 A;  4Q8E A;  5HHI A;  3ISC A;  3GV7 B;  4YFK A;  2KFN A;  1ZQL A;  1S77 D;  1NK5 A;  1KLN A;  1ZQM A;  2D3D A;  3KBB A;  3IHQ B;  4F4Z A;  3UQ2 A;  2QB0 A;  3E0F A;  1X9M A;  4M9L A;  4FFD A;  5B66 U;  3MR6 A;  4Y2S A;  4QZG A;  3JPQ A;  2BCV A;  3Q8S B;  1LVH A;  1RDF A;  2BCQ A;  2R8H A;  3UPQ A;  3B9J A;  3RBD A;  2KMD A;  2JXJ A;  3RH4 A;  1ZQE A;  4RQM A;  4CRX A;  4QZC A;  3ZD8 A;  4DS5 A;  5J0Q A;  7ICH A;  1X6J A;  4C7Z A;  1ZQB A;  2PFN A;  2W54 A;  4Y2Q A;  2BGW A;  4JV0 A;  4IR9 A;  3H4B A;  2HVI A;  3TAN A;  4JWN A;  5KFT A;  3TAP A;  7ICP A;  1BVS A;  2W03 A;  2OM6 A;  3N97 B;  2YX8 A;  5EE9 A;  1C7Y A;  3H8J A;  2ZIX B;  4KLL A;  1U4B A;  4F50 A;  5E79 U;  3RJI A;  4IQW A;  3RAQ A;  3L4P A;  3TAR A;  4KLO A;  3H0L B;  4KX5 A;  3PNC A;  4QWE A; 
#chains in the Genus database with same CATH homology
 2G07 A;  3GU3 A;  3RF9 A;  3VC8 A;  2GOL A;  2Y0S C;  4QIW F;  3F2C A;  2HOF A;  2HBL A;  1D8B A;  2A3V A;  1T94 A;  2LKY A;  2N1R A;  2Z7J A;  2ZIX A;  3LVW A;  1KBU A;  2E5S A;  2WAQ C;  2KKP A;  2F8L A;  2KJ5 A;  2YB1 A;  1ZQ1 C;  3L3F X;  2RRD A;  2KJ8 A;  4NWI A;  1PVR A;  1ECW A;  4ACO A;  2F2A B;  2ZIU B;  3PSP A;  3ONN A;  1Q3U A;  3VCB A;  3SAF A;  4AYB F;  3SAG A;  2M0N A;  2K8B B;  1Z19 A;  3O0F A;  3NUQ A;  2ZIW A;  2BDU A;  2Q4T A;  3D2Q A;  2JH7 A;  2HOI A;  1ED1 A;  2WAQ F;  1Z1B A;  4OJP A;  2K89 A;  5KL1 B;  5T14 A;  1GO3 F;  4FZL A;  2VKQ A;  2G0A A;  4P0Q B;  1TAM A;  3F5E A;  2LBO A;  4NLC A;  3AQE A;  1MA7 A;  1YT3 A;  2XI9 A;  4OJO A;  2OXO A;  1HEK A;  5CRX A;  2XIC A;  2CPR A;  1L6N A;  3LVV A;  1SZH A;  2HMX A;  2KVC A;  1PVQ A;  2LYB A;  2KKV A;  2H3F A;  3SMV A;  1A0P A;  3F2B A;  3SQI A;  4CGZ A;  4ICA A;  4OJ5 A;  4NV0 A;  4BX9 C;  3PST A;  2JHD A;  3SAH A;  3F53 A;  1IIP A;  2W7P A;  2PMZ C;  3N7R C;  4FZN A;  2ZXH A;  3K1Z A;  4QJF B;  4U6P A;  3KZX A;  2JMG A;  3D2S A;  2LYA A;  4BJQ A;  2LHT A;  4CDG A;  2D6F C;  4WJ3 B;  3F2D A;  2MRL A;  3C29 A;  3IG5 A;  2WB1 F;  2HBJ A;  2HOQ A;  1P7D A;  2F77 X;  2KJ9 A;  3E0F A;  3OPX A;  2K4I A;  2HBM A;  2E1F A;  2H3V A;  4P0Q A;  3NRW A;  1PVP A;  4QNL A;  2KIC A;  2G5H B;  3PSF A;  1DRG A;  5HR7 A;  3D2N A;  2YB4 A;  3ALR A;  3ICX A;  4OJL A;  4C0Z A;  1HIW A;  2CRX A;  2KNJ A;  3LYS A;  2DF4 B;  2G09 A;  2H3I A;  2G06 A;  5A0L A;  1F44 A;  5C0Y A;  4PL1 A;  3CRX A;  2G5I B;  4QIW C;  3HKZ F;  5HR6 A;  4KMO B;  2H3Z A;  3AL0 B;  4GFJ A;  3N7P D;  2ZIV B;  2ZXI A;  2GH1 A;  4CRX A;  3MGV A;  1WUD A;  2E1E A;  2K4H A;  2K8A A;  4AYB C;  3H0M B;  3PZP A;  2MA1 A;  2HBK A;  2XID A;  2VIX A;  3H0R B;  4U7C A;  3HKZ C;  1NZB A;  3C28 A;  3AQF A;  2JGA A;  4KX3 A;  2H3Q A;  1UPH A;  2KHQ A;  4NLB A;  5KL8 B;  4JMU A;  2ZG6 A;  2KV2 A;  3M7D A;  1XNS A;  4BUG A;  3RFA A;  3CP8 A;  2W03 A;  2OM6 A;  3IG8 A;  3CYM A;  3F5A A;  2YX8 A;  2KOB A;  4PL2 A;  2VJ5 A;  2F76 X;  2KIW A;  4P0P B;  2ZIW B;  2JH1 A;  1A6S A;  2K8C B;  4OJ6 A;  2NV3 A;  2VJ4 A;  2KD1 A;  2KEY A;  2RHF A;  2ZIX B;  2W7O A;  3T79 A;  3IP4 B;  2R18 A;  1Q3V A;  3M6K A;  2G08 A;  2PMZ F;  1URJ A;  4FE3 A;  2XVT A;  1XO0 A;  2KHV A;  2ZIU A;  3M6Z A;  3PSI A;  3IN5 A;  4P0P A;  2WB1 C;  2K4E A;  2Y0S F;  4FZM A;  2W04 A;  1CRX A;  2RP5 A;  3GZF A;  4O3M A;  3N7S C;  2OYY A;  4A8E A;  4OO1 J;  3H0L B;  4KX5 A;  2ZIV A;  1OUQ A;  2CN1 A;  2OH2 A;  3KFU F;  2DGZ A;  2DQN B;  3DEE A;  4IC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...