4IC9A

Crystal structure of the full-length matrix subunit (p15) of the feline immunodeficiency virus (fiv) gag polyprotein
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
GQGRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biophysical characterization and crystal structure of the Feline Immunodeficiency Virus p15 matrix protein.
pubmed doi rcsb
source organism Feline immunodeficiency virus
molecule tags Viral protein
molecule keywords Matrix protein p15
total genus 43
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2012-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4ic9A00
1UPHA 1TAMA 2H3QA 2K4EA 1HIWA 1ECWA 2K4HA 1A6SA 2JMGA 2LYBA 2H3ZA 2K4IA 2GOLA 2LYAA 4ICAA 2N1RA 2NV3A 4IC9A 1ED1A 2H3FA 2HMXA 1HEKA 4JMUA 2H3IA 1L6NA 2H3VA
chains in the Genus database with same CATH superfamily
5C5JA 4BWMA 3B0YA 2K4HA 5AKHA 2LBOA 4EZ6A 1NKEA 1ZQIA 5KFVA 3M8SA 1L7OA 2ZIWB 3EYZA 3SYZA 1SV4A 5L1KA 1J97A 4C7ZA 2FLPA 3BQ7A 4LVSA 4I2BA 3T5KA 5J2GA 3JPRA 1RXWA 2OH2A 2P35A 4JWMA 2BPCA 4DSFA 1ZQTA 1JROA 2BPFA 5C0YA 2W9AA 3HRDD 3H4BA 3K75D 3PX0A 4B6JA 4ECVA 2Q4TA 2FMSA 8ICIA 3ZDEA 5J2DA 1CUKA 4NM1A 4FO6A 2BKEA 2K60A 3FYHA 1YZ7A 5AI8A 5JU5A 5KG7A 4ELUA 5HR7A 1P7DA 4QZGA 3LWMA 2WF6A 1HUZA 1LKYB 1Q3UA 3RR7A 3EW9A 3F2CA 4IQTA 5AK5A 4DL4A 1KTQA 5KFBA 1X9XA 4PGQA 2C2RA 2WB1C 3Q8QB 1SL2A 1UT8A 1NK6A 2PFQA 1ZQLA 2JH7A 4KX5A 4NM2A 4TQSA 3IRUA 3C5FA 2KEYA 3UXPA 4YMMA 3THVA 1SWWA 1ZQWA 2CRXA 3OGUA 4OJPA 3I28A 3C5GA 1QTMA 3SEIA 4ED8A 4UB2A 3D2SA 2KV2A 1B0XA 2NO5A 3VC8A 2DF4B 4X5VA 1T94A 2F1IA 1TK0A 1NK8A 1L8OA 3JPPA 3C21A 2MUTB 4QW9A 1ZOLA 5DDMA 5KG2A 1ZETA 2OHFA 4KX3A 4E0DA 2JXJA 4YN4A 1PVPA 2GO7A 5AK4A 3KHGA 2JH1A 7ICEA 4JWNA 3BS5A 2ZG6A 1Y88A 1AQ6A 2CPRA 2BHNA 2H3ZA 3UPQA 1SL0A 2IBKA 3V6KA 1QSSA 1NI3A 5DB8A 1ZQHA 5J0OA 2C2DA 2OEHA 1RXVA 5KFTA 2KE7A 4Y2VA 8ICPA 3SR6A 5DQGA 8ICFA 3EPGA 1SKSA 1KRPA 2NRVA 4JB3A 3K1ZA 5EWGA 2BQUA 4DFMA 2RHFA 7ICTA 5EOZA 1NNLA 3QUQA 3PSPA 1XS9D 5ALHA 2VA8A 1HJPA 2WF5A 2W7PA 4DCCA 1IG6A 4RQ8A 4IQWA 1TAMA 4MHVA 2DUYA 3RH4A 5BOLA 2E1FA 3WKAA 1LKYA 7ICMA 5AI6A 1S0OA 3IV6A 3KOOA 1B43A 2DBYA 5J8YC 4QWDA 5KFFA 4JV2A 4QZHA 5AKZA 2XVTA 5TZVA 2H3FA 4F91B 1Q46A 3GU3A 9ICBA 1NJZA 2IOFA 4UAWA 4K4IA 3KZXA 1L3TA 5ALNA 2XIDA 4RQ4A 1ZYQA 2OM6A 5KAFU 2E1EA 4CRXA 4I2FA 5KFPA 4KLMA 2DGZA 2YB4A 2KZMA 4RQ7A 3D2QA 5F9NA 1RQNA 2WF9A 1XSPA 4QZIA 3RAQA 2ZIUB 5HMMA 3OHBA 4UB4A 2G0AA 5KTQA 5J2JA 4XUSA 8ICJA 2C22A 2BQRA 2ZXIA 1SXEA 4I28A 1S0MA 4UB5A 5DQIA 3V6HA 3JPSA 3D6JA 3UQ0A 1JIHA 2G07A 2OCEA 3H4DA 1TK5A 2KZZA 1K1SA 5ALSA 4F5QA 3MC1A 2W7OA 9ICXA 2WTFA 3PSFA 4UB6U 2E3TA 2PFNA 3AUOA 5DBCA 4F4XA 3TI0A 8ICNA 4NLCA 3RB6A 2W55A 3NRWA 2HHTA 2R8IA 2HOFA 4F3OA 2K8BB 1IV8A 5EWFA 2QB0B 2XI9A 2KICA 4KMOB 1QQ6A 2JR5A 3PW4A 2PI4A 3PV8A 4DSKA 5KT2A 8ICCA 8ICBA 4CNQA 2FLNA 2ASLA 1KL9A 5CHGA 2HBJA 2V4RA 1SXDA 2KG5A 5H2FU 4B9UA 3MGHA 2HHXA 4BDPA 4ZH4A 2A19A 1N62A 4Y2JA 2R8JA 2A1JA 4UASA 3I76A 1NK7A 2Q0ZX 2KKVA 3I1YA 4P0PA 1XC9A 1MN8A 3HWTA 2P6RA 8ICAA 4O3RA 2W9MA 4CE6A 3C2LA 4EYIB 4QJFB 2GH1A 4J9SA 1ZQVA 1UCVA 4LJXA 5F3XB 3CNHA 4UBCA 1Z00A 4RQ6A 3PR5B 3PW0A 4Q43A 3JPQA 4M9LA 5J0SA 5AK6A 3UMGA 5DLGA 4EENA 2V4QA 3NVWA 4DL7A 1ZQMA 4M04A 4QZBA 9ICLA 1DGSA 3RR8A 1ZQAA 3C2MA 1A6SA 4Y2PA 4NLGA 5KT6A 1DK2A 1KQQA 4F4YA 2J6UA 2ZJ8A 4R65A 7ICJA 2KK0A 2M9NA 3MBYA 4YMOA 1O03A 5BPCA 3V7KA 1LVHA 4DL3A 3C1ZA 3MR6A 8ICQA 4YVZA 9ICUA 5DBBA 1L7MA 4JV0A 1DGJA 1JXLA 3BZCA 3MABA 2KMDA 1JRPA 1L3VA 7ICLA 4RZRA 1XSLA 1IXRA 3M8RA 4NXZA 1QQ7A 1L8LA 2LM1A 5EWEA 2K8CB 4KN7A 1YT3A 1S0VA 2KSOA 1ZRMA 2W43A 4O0IA 3G6YA 1MQ2A 3SD7A 3NGDA 8ICSA 1RZTA 3AM9A 2QKQA 4QZ9A 4IS7A 1ZD3A 3OSPA 1JXEA 3BZKA 4DF4A 3RB0A 3OJUA 4YCXA 8ICHA 3GIKA 2VIXA 3G6VA 5L1MA 3LVWA 5EE0A 2NRZA 3SI8A 4PHEA 1WUDA 3AU6A 4U6PA 5KG4A 5HHHA 5CJ7A 4YD1A 3UMBA 3RAXA 4UQGA 4I2HA 4NLNA 4F2RA 3AL0B 4NLKA 2KJ8A 3PMNA 5AKJA 4QIWC 1KBUA 4OCZA 3MR5A 1ZD2P 3TACB 4DFKA 2W9BB 1N61A 3H0RB 3KHRA 2PI5A 1N5WA 4NLBA 2HVHA 2KN7A 2HSZA 3CYMA 4J03A 1WCLA 2ZTEA 3PR4A 5JUMA 5KG0A 2ODGA 2I1QA 3ORYA 4RQMA 1A77A 4ECSA 2OWOA 4DSIA 2BDUA 2BGWA 4Y2QA 4KMUA 2ZIXB 4KLQA 4FS2A 2QLTA 1JMSA 4ED6A 4OD0A 1UA0A 1SIJA 4MEXA 3AQFA 8ICEA 4RNMA 3KHLA 3N4MB 2XGPA 1V9PA 5ALQA 2OYYA 2HVIA 3T5LA 4UBBA 3TARA 4EELA 1ZQKA 5L1IA 3PO4A 4MFCA 2HMXA 1L7NA 1U4BA 3QU5A 4P0QA 4BUGA 5DB7A 3RJEA 1J2MA 2DQNB 5KFOA 3TAQA 2IOHA 4KLDA 5JTIA 3WKCA 3H0MB 3H8JA 3VCBA 2DKXA 2ZTDA 5AKGA 2VJ4A 3QX7A 4OJOA 4M9NA 1Q3VA 3RB4A 1WG8A 5ALPA 4Y2UA 3AU2A 5TISU 4O5EA 1SKRA 3BQ0A 1ZQCA 5AK3A 4QZDA 4RQ0A 3WKDA 1C7YA 2JV3A 3KBBA 4AYBF 5DB9A 4ED3A 4DS4A 4ICAA 4KLSA 2QB0A 1N56A 2F76X 1TE2A 5J0PA 1LV5A 4M2YA 2HBLA 4DS5A 1HIWA 3GV7B 4KLLA 1S0NA 3G6XA 2E8PA 5KG5A 2DKZA 5HR6A 5ALTA 5ALLA 4QZEA 4R64A 2JHDA 1U49A 1NZBA 1PZNA 2K89A 1N48A 2HHVA 2NRXA 3QU2A 3LVVA 1T8EA 1TFRA 2LKYA 3FDSA 2W9BA 4F5NA 5IILA 3E2EA 2F8KA 2UVRA 4B9LA 4XA5A 4O3OA 1QSYA 1TK8A 2I5HA 4P0PB 5KFXA 7ICIA 3V6JA 4OJ6A 4GC6A 3IM1A 5ALOA 1HUOA 4GXIA 1KKXA 3SAGA 3KZIU 1ZQDA 2ZUDA 2YQEA 4UB3A 4IR9A 2LM4A 2K4PA 5KFUA 4I2CA 3ALRA 3DV9A 4F71A 5T14A 2EAPA 4UAZA 2KTQA 2WF7A 4M6WB 4RUCA 4C0ZA 5ALDA 4PHDA 2JEFA 3MDCA 1KEJA 2HI0A 4ECWA 3IG8A 4F92B 4NL9C 3M9MB 4P0QB 1N2XA 5IIMA 2GOLA 3CRXA 2W03A 3SZ2A 3PY8A 1NK5A 5ALIA 4BXOA 2HW3A 3KD3A 5F9LA 3GFKB 1WCNA 5B66U 1VLBA 5KFIA 4M9HA 4P4OA 2HBKA 5KFKA 4BWJA 4WJ3B 1RYSA 1VJ5A 3BDPA 2KFZA 4EZ9A 5DGAA 4FZNA 1GO3F 2W9CB 4B9VA 2PXIA 5J29A 4FFDA 8ICRA 1XO1A 4QWAA 1ZQBA 3H8MA 3NTUA 3MR3A 1ZRNA 2P6UA 4XRHA 3QU9A 1SGGA 2KSOB 5AM3A 5DB6A 1TVAA 3AEVA 4QWBA 4OJLA 1X9WA 5J2CA 3TQ1A 4QZ8A 4B9TA 1N63A 1S77D 9ICJA 1ECWA 5KFRA 2LMRA 4R63A 2YX8A 1OUQA 2WHEA 2WF8A 3RJGA 4DO9A 3SQIA 2LYAA 4Y2SA 3TANA 5L1LA 3A0BU 4C8OA 1U47A 2GWSA 3PSTA 2ISOA 3ZD9A 5J0WA 1L5UA 2JZBB 2HDOA 4HAIA 3BQ2A 3JPOA 4DFPA 2EDUA 3WK8A 1ZQYA 2M0NA 1ZQEA 4R8UB 3T3FA 1X6IA 2N1RA 3OSNA 5D49A 3M6KA 4DFJA 2HHWA 1BNPA 4O3QA 2PFOA 3UQ2A 4C8KA 3ISCA 2F1JA 4IR1A 2YY6A 4O3MA 5K4LA 3MFIA 1NJXA 4KLUA 2XCAA 4M9GA 5CRXA 3DEEA 3N97B 4EEKA 2BCUA 4FBUA 4KLIA 2RRDA 1C20A 1OW5A 4J9QA 2H3VA 2AGQA 3F53A 2ZIWA 4Q45A 1Z3EB 8ICGA 5KT7A 4F5RA 4NWIA 3GIIA 2XY6A 3QE9Y 4BGDA 7ICNA 2DL0A 3GIMA 1BPBA 5DDYA 2KD1A 2O6KA 5DGBA 1NK4A 4P4PA 2ALZA 2Y1JA 2AQ4A 4RPXA 4RQNA 3LK9A 4K4GA 4EBEA 5ALZA 3WKEA 3V7JA 5BOMA 3K1RB 1AROP 2WAQC 4ED0A 1RM6C 3C29A 5CP2A 3EUB2 1RPLA 1RG6A 2KJ9A 3HJEA 3WK7A 5KG1A 4PH5A 2G08A 2HCFA 5KAIU 4DOCA 5KFQA 4JK1A 3HKZC 2OXOA 4C8MA 4F4KA 1D9FA 2W54A 4YFKA 3PMLA 4IRKA 2JZBA 1COOA 1X2IA 1QCKA 3QXGA 1DOQA 1HEKA 2FE9A 2MA1A 1TKDA 2W3SA 4MFFA 1B4FA 4RNNA 4KTQA 5IIKA 2ZUBA 4ELTA 1K1QA 1NK0A 3QEAZ 3KTQA 4GXJA 2EQYA 4R66A 4I2IA 5KFGA 4Q8EA 3BS5B 3KKAC 1N5XA 2G06A 2FMQA 1KFDA 1S8OA 1PK3A 4EEYA 1JI7A 2Y9TA 2CN1A 2DPIA 4K4HA 5KT4A 2D8CA 3ICXA 2E8MA 2HOQA 5KFCA 4C7YA 3TAPA 5KL1B 4QZFA 4DQRA 4Q44A 1BPZA 3SENA 3PX6A 3M1YA 1RYRA 3NS1A 3RH5A 4RT2A 9ICRA 5J0TA 5AKLA 4C4TA 2BZFA 3ISBA 2H3QA 1UHUA 2F3NA 3Q8MA 3HW8A 3MGVA 4BXOB 1SKWA 4IQVA 1XO0A 2FPKA 2B0CA 3F5EA 4ECQA 3T5HA 2HHSA 7ICRA 3OHAA 2PFPA 1QLNA 5DQHA 2FJ6A 4MEYA 3C1YA 1X40A 3M9NB 1FFUA 2E8OA 5G5HA 5DLFA 1KDHA 3NRZA 9ICVA 4J9OA 4JV1A 4RQ1A 3H8SA 8ICZA 2BR0A 4U7CA 1IM4A 2GLEA 2F2AB 2H3IA 2MSNA 3NVZA 1Z1BA 3RJIA 1S76D 2PMZC 4IRCA 4Y2XA 4OO1J 4O9MA 4AYBC 4YXJA 4O3NA 5HNKA 1L3SA 4BX9C 5D46A 3UXOA 2Y0SC 2LHTA 3EZ5A 8ICOA 5CEHA 5GTIU 4LZGA 7ICPA 3TADC 2PKEA 2E8NA 4RPYA 4NV0A 1JALA 4DQSA 1Z19A 3M9OB 3PZPA 2XICA 4PZNA 3WKBA 2JRZA 1L3UA 4DEZA 3B9JA 4I2AA 2BCSA 3H7IA 4J9RA 2C28A 3ZDBA 4C4RA 2YMLA 4R8UA 2G5IB 7ICGA 5ALJA 4HYKA 5HMLA 1ZQGA 4TUSA 4ELVA 4YR2A 2RP5A 4RUAA 4CF4A 7ICSA 3ZDCA 2W11A 2P66A 9ICPA 4FBTA 3RJJA 4C4SA 7ICVA 1ZQOA 2KVSA 4CF5A 3ETRA 4PL1A 3IG5A 3SV3A 7ICUA 4NJ8A 4YXMA 3M6ZA 3AQEA 4UARA 2VA3A 1NKBA 3SAHA 1PK1A 5J0UA 4TURA 3KHHA 8ICLA 3LYSA 1H38A 1NK9A 1KFTA 1BPXA 4NL9A 4YQWA 1QQ5A 2AHOB 2G5HB 4M47A 4EYHB 1ZQPA 4YR3A 2MU2A 3IP4B 4UB8U 3MDAA 4I2JA 4PL2A 1X9SA 4FE3A 2A1JB 5E79U 4YD2A 3N7PD 5AM4A 5J2EA 4J9NA 8ICTA 5AI0A 4O5KA 2AQ0A 3E0FA 8ICXA 1ZQUA 4PGXA 2RLTA 1TV9A 4I27A 3HKZF 4ECTA 1SZHA 4DL2A 4DSEA 5J2AA 1F0MA 3GZFA 4F5PA 1U45A 1MC8A 3R9KA 5EE9A 4KN4A 3JPNA 4ECRA 2PMZF 5CB1A 4RQ2A 3RRGA 3H8WA 5HP4A 3WK5A 4ECXA 1WYGA 5KFWA 1BGXT 1MSWD 4RQ3A 1KW4A 4PPXA 1FIQA 5ALXA 3RBDA 3J81j 3T5JA 2AH5A 3GILA 2LPEA 2NV3A 4C8NA 3IDWA 3L5KA 5ALMA 1ED1A 2KIVA 1T3NA 2D6FC 2RQ5A 3GQCA 9ICGA 1A0PA 3FM9A 2B21A 2ZIUA 4FS1A 3MGIA 5IIIA 3AN1A 4FZLA 3UXNA 5AKIA 3PVXA 2ISPA 3CW2C 2R8HA 2F77X 4CDGA 2JEIA 4UATA 4I2DA 5ALVA 4DOBA 4F50A 3QNMA 1J2NA 9ICFA 8ICMA 4C80A 2KHVA 3AMZA 2R8KA 2KOBA 3NVVA 1S10A 2NRWA 1PK1B 1Z4NA 3WK9A 2W8KA 3QYPA 2KNJA 3QU4A 5J0XA 4NY8A 1KSPA 2V9WA 1V97A 1PVRA 1SB3C 1BVSA 5KFHA 5KT3A 1D8YA 2EZXA 2ESEA 4PHAA 4LZDA 4EX7A 3S6JA 4P2HA 3KFUF 2EZYA 3MFHA 5AI9A 5J8YA 4RU9A 4DQPA 4DSLA 4EBDA 5FP0A 5J2HA 5ALGA 2ASJA 4MF8A 1RQLA 3ISDA 1XWLA 2FDRA 3L3FX 1YZ6A 4MFAA 3BS7A 4RT3A 2F8LA 2AGPA 4FZMA 1KLNA 2K4EA 2KFNA 2ZXHA 3BQ1A 3IHQB 2Y0SF 1TAQA 2QB1A 2XCPA 4KLEA 5AICA 5AM2A 4QW8A 5GTHU 2A1AA 4RPZA 5J0QA 2RDJA 3ZDDA 9ICSA 5ALEA 3Q8RB 4B9SA 1Z00B 3NUQA 5KNIA 4RQ5A 3RRHA 2DWQA 1U48A 2XGQA 4DLGA 1L7PA 5KG6A 1RDFA 2ATLA 3WK6A 4GFJA 5B5EU 2BDPA 1NZPA 3H40A 5AIBA 5KFEA 3Q8SB 1K5OA 2YMPA 1BPEA 2W04A 5J2KA 4KLHA 4PZOA 4O3SA 4C8LA 3E58A 4DQQA 3RFAA 4UAVA 2FPMA 3SV4A 4O3PA 4QZCA 4TUPA 3HPOA 4KLFA 4USAA 1XU4A 4IRDA 2BCRA 2H5XA 9ICIA 1JN3A 9ICTA 5KG3A 4A8EA 2J6SA 3PW2A 3C2KA 1MA7A 3BQTA 2IOFK 5HHIA 2KJ5A 5KFZA 5KFNA 2KHQA 5KL8B 2HHQA 2ES6A 3FAHA 5ALKA 3A0HU 3RJHA 2IA6A 4F8RA 2JGAA 5DBAA 1ZQQA 8ICUA 1L6NA 2G09A 2KZ3A 3ED5A 2FMPA 3V7LA 1BPYA 3DDHA 1UA1A 9ICQA 1PVQA 4DL6A 2HBMA 5J0YA 1X6JA 3PNCA 4I29A 3CP8A 3WK4A 5AKYA 4Q8FA 3L4PA 4QWCA 4M9JA 4TUQA 8ICKA 2WFAA 4QIWF 3EPIA 4B9MA 4ACOA 1QH9A 1D8LA 8ICYA 1M6YA 4PGYA 1RYUA 4TQRA 4ECUA 3RJFA 1VDVA 2L5YA 4QWEA 1COKA 4ED2A 4J9MA 3T79A 2YB1A 1ZXIA 1DK3A 5AM5A 1ZD5A 3ONNA 3IN5A 1ZQ1C 4KLOA 1Z1VA 2DFLA 5EE3A 5CWRA 2BQ3A 9ICMA 1EXNA 3C28A 4ECYA 4DL5A 2NRTA 8ICVA 3JPTA 4DWIA 3TFRA 3KKAA 2ZJAA 2ASDA 3V72A 2LI6A 3QZ8A 2FI1A 3K4GA 1N60A 4F93B 2I9GA 1TAUA 2ZTCA 4EBCA 7ICQA 4KLTA 2YMMA 1MQ3A 5KFSA 4PHPA 3NASA 4M6WA 3TADA 5J2BA 1SV0C 4G3IA 2YN4A 7ICFA 4B9NA 3OTQA 4DOAA 1ZQXA 2ZIVA 2A3VA 3RTVA 5AHXA 3H0LB 2YTUA 2YMQA 2ZIXA 4Z6DA 5KFDA 5A0LA 3RBEA 1Q8KA 5ALYA 3F2BA 3EWAA 3MR2A 2K8AA 3TKAA 3HILA 3Q8LA 3N7SC 2Z7JA 4GC7A 3ZD8A 2AJQA 2Y9UA 4DF8A 4F4WA 2W9CA 1T3QA 2F44A 3GDXA 5D4BA 2JEJA 4KLGA 1OXJA 1NKCA 4F2SA 5DG7A 1JX4A 1FEZA 2D3DA 2EAOA 4Z6CA 7ICOA 2NO4A 3GV8B 1U9LA 1NJYA 2UVVA 4J9PA 1ZQZA 3B0XA 3NVYA 4G9BA 1F5SA 5AI4A 1LB2B 2UVUA 2KIWA 1JUDA 2CXYA 4DSJA 1KN5A 3SAFA 1BNOA 4IC9A 3N7RC 2IHNA 1ZJMA 2NYVA 1ZD4A 3RF9A 1WWVA 4O5CA 2EAMA 1T4GA 8ICWA 5IIJA 2AXTU 4YG2A 3Q8KA 5J2FA 3U26A 5CA7A 4US8A 4J9KA 3M7DA 4OJ5A 4IQUA 1S9FA 1SL1A 2MUTA 1UPHA 4DFDA 4BJQA 4F72A 2XO7A 4CF3A 2MAXA 4F4ZA 3F5AA 3QU7A 2Y1IA 2B6GA 2MRLA 3HT3A 1CEZA 5ALUA 2KP7A 2AGOA 3F2DA 2WB1F 3WU2U 3HP6A 1A76A 2ZIVB 4ZOHC 5AIAA 5AI5A 2EANA 5DG8A 1NJWA 1B22A 1O08A 4Y2YA 5DKWA 2KVCA 4JMUA 2W3RA 5KFLA 1FFVA 4UAYA 5L1JA 1V85A 3OPXA 3PSIA 2BCQA 5G5GA 2XY7A 3RB3A 2FLLA 7ICKA 5IIOA 1IIPA 3HX0A 4GXKA 4MF2A 4CGZA 5KFMA 2FPLA 1UT5A 3D2NA 1F44A 1QSLA 4J9LA 1ZQRA 2QARB 4XQ8A 1FO4A 4Z6FA 1NOMA 4I2GA 4NLZA 5AKXA 5AKKA 5L9XA 2JMGA 1ZQJA 2K4IA 4YP3A 9ICEA 4US9A 4ED1A 3GIJA 1Z4OA 4IL6U 3GV5B 2VKQA 5J2IA 3QUBA 5AM1A 3TFSA 9ICCA 2DPJA 1BPDA 2I6XA 2VANA 2BPGA 2BCVA 2WAQF 3ETLA 1S97A 4GIBA 4GLXA 3Q8PB 4UAUA 2C2EA 3PO5A 1D9DA 9ICHA 4EX6A 5ALFA 1DXSA 2HOIA 3UMCA 2UVWA 2VA2A 5ALWA 2J6TA 1SV0A 2XY5A 2F1HA 3UM9A 2E5SA 5KFYA 2VJ5A 4KLJA 9ICWA 2RDIA 4Y2TA 9ICAA 3PW5A 1KFSA 4CCHA 9ICOA 1CI4A 2IMWP 4DLEA 1SWVA 3OJSA 5KT5A 4QNLA 2EZZA 4YR0A 3O0FA 1ZJNA 3FC4A 4RNOA 1X66A 3C23A 2KKPA 4PJ0U 5ALRA 4DQIA 1CRXA 1URJA 5IINA 2EH9A 4AP9A 3LWLA 1SZPA 3N28A 3QUTA 1XNSA 1S5LU 3QEBZ 1ZQFA 1WWUA 4QZAA 2LYBA 3BJYA 3ZDAA 5J0RA 1V38A 9ICKA 3ZI4A 3QZ7A 1DRGA 2IHMA 5AM0A 1PUZA 5EE1A 3RH6A 4M0AA 9ICNA 1UQVA 4Z6EA 5AKEA 2HHUA 5CR0A 5DG9A 4I2EA 2ZJ5A 3PW7A 5KFJA 2AU0A 4F5OA 3QUCA 2R18A 2JEGA 4P4MA 1X42A 2LYHA 2R8GA 1X9MA 7ICHA 3SMVA 1T7PA 1XSNA 2QARA 1D8BA 4JUZA 4ECZA 2W8LA 1ZQSA 4UB1A 4UW9A 3RJKA 4KITB 4Y2RA 3PX4A 2ZUCA 5KFAA 4YMNA 1ZQNA 4ED7A 3LDAA 5JRTA 2XC9A
chains in the Genus database with same CATH topology
2K4HA 2JH1A 2G5HB 1MA7A 2ZG6A 2PMZC 2LBOA 2KHVA 1WUDA 2HBKA 2KJ5A 2CPRA 2KOBA 2WAQF 4OO1J 2H3ZA 4U6PA 3IP4B 2ZXIA 4O3MA 4AYBC 5CRXA 2KHQA 4AYBF 2ZIWB 5KL8B 4WJ3B 4BX9C 2KNJA 3DEEA 4PL2A 4ICAA 2HOIA 3AL0B 4FE3A 3N7PD 2KJ8A 2G07A 3M7DA 2Y0SC 4OJ5A 2LHTA 4QIWC 2RRDA 1PVRA 2JGAA 2G06A 3E0FA 2OH2A 2F76X 1GO3F 4FZNA 2W7OA 1Z1BA 1KBUA 1D8BA 1L6NA 2ZIVA 2A3VA 3PSFA 2G09A 2H3VA 1UPHA 2HBLA 1SZHA 3F53A 3HKZF 2E5SA 4BJQA 5C0YA 2ZIWA 3H0LB 1HIWA 3F5AA 2VJ5A 2MRLA 1A6SA 3H0RB 3GZFA 2ZIXA 3KFUF 2CN1A 2Q4TA 3K1ZA 4NLBA 4NWIA 4NV0A 5HR6A 3F2DA 1PVQA 2WB1F 3CYMA 5A0LA 1Z19A 4QNLA 5HR7A 2HBMA 3ICXA 2RHFA 3O0FA 1P7DA 3PZPA 2HOQA 2ZIVB 2JHDA 2XICA 1NZBA 3F2BA 2K89A 3PSPA 4NLCA 5KL1B 2KKPA 2KD1A 3L3FX 4OJLA 3LVVA 3NRWA 2BDUA 1CRXA 1URJA 2K8AA 2LKYA 2PMZF 2HOFA 2F8LA 2ZIXB 2KVCA 4JMUA 2W7PA 1PVPA 1Q3UA 2K8BB 3N7SC 4FZMA 3F2CA 2Z7JA 3OPXA 3PSIA 2XI9A 2KICA 4KMOB 1TAMA 2H3QA 2K4EA 1XNSA 1ECWA 4P0PB 3AQFA 2WB1C 2ZXHA 2LYBA 2E1FA 2G5IB 2YX8A 2Y0SF 4QIWF 3MGVA 1OUQA 4ACOA 2OYYA 4OJ6A 3SQIA 1XO0A 1IIPA 2JH7A 4KX5A 1DRGA 2RP5A 2WAQC 4CGZA 2LYAA 3SAGA 2KEYA 3F5EA 3D2NA 1F44A 2NV3A 2XVTA 2HBJA 3C29A 1ED1A 2H3FA 2K8CB 3NUQA 2HMXA 2D6FC 3PSTA 4CRXA 1YT3A 3ALRA 3GU3A 4P0QA 4BUGA 3T79A 1A0PA 2CRXA 2YB1A 2DQNB 5T14A 2R18A 3KZXA 4OJPA 2ZIUA 4PL1A 2KJ9A 4GFJA 2XIDA 3H0MB 3IG5A 2JMGA 4C0ZA 3VCBA 3SMVA 3D2SA 2G08A 2KV2A 3ONNA 2K4IA 2OM6A 3IN5A 1ZQ1C 2DF4B 2E1EA 2KKVA 1T94A 3VC8A 2VJ4A 2DGZA 2YB4A 2OXOA 2KIWA 3AQEA 2M0NA 3HKZC 3IG8A 3M6ZA 4OJOA 2W04A 3D2QA 4FZLA 3SAHA 1Q3VA 4P0PA 4P0QB 2GOLA 3CRXA 2W03A 3RFAA 2VKQA 3SAFA 2F77X 4CDGA 4QJFB 2N1RA 2ZIUB 4IC9A 2GH1A 3N7RC 3C28A 4U7CA 3LYSA 3M6KA 4KX3A 1HEKA 2VIXA 2F2AB 4A8EA 2H3IA 3RF9A 2G0AA 3CP8A 3LVWA 2MA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UPH A;  1TAM A;  2H3Q A;  2K4E A;  1HIW A;  1ECW A;  2K4H A;  1A6S A;  2JMG A;  2LYB A;  2H3Z A;  2K4I A;  2GOL A;  2LYA A;  4ICA A;  2N1R A;  2NV3 A;  4IC9 A;  1ED1 A;  2H3F A;  2HMX A;  1HEK A;  4JMU A;  2H3I A;  1L6N A;  2H3V A; 
#chains in the Genus database with same CATH topology
 5C5J A;  4BWM A;  3B0Y A;  2K4H A;  5AKH A;  2LBO A;  4EZ6 A;  1NKE A;  1ZQI A;  5KFV A;  3M8S A;  1L7O A;  2ZIW B;  3EYZ A;  3SYZ A;  1SV4 A;  5L1K A;  1J97 A;  4C7Z A;  2FLP A;  3BQ7 A;  4LVS A;  4I2B A;  3T5K A;  5J2G A;  3JPR A;  1RXW A;  2OH2 A;  2P35 A;  4JWM A;  2BPC A;  4DSF A;  1ZQT A;  1JRO A;  2BPF A;  5C0Y A;  2W9A A;  3HRD D;  3H4B A;  3K75 D;  3PX0 A;  4B6J A;  4ECV A;  2Q4T A;  2FMS A;  8ICI A;  3ZDE A;  5J2D A;  1CUK A;  4NM1 A;  4FO6 A;  2BKE A;  2K60 A;  3FYH A;  1YZ7 A;  5AI8 A;  5JU5 A;  5KG7 A;  4ELU A;  5HR7 A;  1P7D A;  4QZG A;  3LWM A;  2WF6 A;  1HUZ A;  1LKY B;  1Q3U A;  3RR7 A;  3EW9 A;  3F2C A;  4IQT A;  5AK5 A;  4DL4 A;  1KTQ A;  5KFB A;  1X9X A;  4PGQ A;  2C2R A;  2WB1 C;  3Q8Q B;  1SL2 A;  1UT8 A;  1NK6 A;  2PFQ A;  1ZQL A;  2JH7 A;  4KX5 A;  4NM2 A;  4TQS A;  3IRU A;  3C5F A;  2KEY A;  3UXP A;  4YMM A;  3THV A;  1SWW A;  1ZQW A;  2CRX A;  3OGU A;  4OJP A;  3I28 A;  3C5G A;  1QTM A;  3SEI A;  4ED8 A;  4UB2 A;  3D2S A;  2KV2 A;  1B0X A;  2NO5 A;  3VC8 A;  2DF4 B;  4X5V A;  1T94 A;  2F1I A;  1TK0 A;  1NK8 A;  1L8O A;  3JPP A;  3C21 A;  2MUT B;  4QW9 A;  1ZOL A;  5DDM A;  5KG2 A;  1ZET A;  2OHF A;  4KX3 A;  4E0D A;  2JXJ A;  4YN4 A;  1PVP A;  2GO7 A;  5AK4 A;  3KHG A;  2JH1 A;  7ICE A;  4JWN A;  3BS5 A;  2ZG6 A;  1Y88 A;  1AQ6 A;  2CPR A;  2BHN A;  2H3Z A;  3UPQ A;  1SL0 A;  2IBK A;  3V6K A;  1QSS A;  1NI3 A;  5DB8 A;  1ZQH A;  5J0O A;  2C2D A;  2OEH A;  1RXV A;  5KFT A;  2KE7 A;  4Y2V A;  8ICP A;  3SR6 A;  5DQG A;  8ICF A;  3EPG A;  1SKS A;  1KRP A;  2NRV A;  4JB3 A;  3K1Z A;  5EWG A;  2BQU A;  4DFM A;  2RHF A;  7ICT A;  5EOZ A;  1NNL A;  3QUQ A;  3PSP A;  1XS9 D;  5ALH A;  2VA8 A;  1HJP A;  2WF5 A;  2W7P A;  4DCC A;  1IG6 A;  4RQ8 A;  4IQW A;  1TAM A;  4MHV A;  2DUY A;  3RH4 A;  5BOL A;  2E1F A;  3WKA A;  1LKY A;  7ICM A;  5AI6 A;  1S0O A;  3IV6 A;  3KOO A;  1B43 A;  2DBY A;  5J8Y C;  4QWD A;  5KFF A;  4JV2 A;  4QZH A;  5AKZ A;  2XVT A;  5TZV A;  2H3F A;  4F91 B;  1Q46 A;  3GU3 A;  9ICB A;  1NJZ A;  2IOF A;  4UAW A;  4K4I A;  3KZX A;  1L3T A;  5ALN A;  2XID A;  4RQ4 A;  1ZYQ A;  2OM6 A;  5KAF U;  2E1E A;  4CRX A;  4I2F A;  5KFP A;  4KLM A;  2DGZ A;  2YB4 A;  2KZM A;  4RQ7 A;  3D2Q A;  5F9N A;  1RQN A;  2WF9 A;  1XSP A;  4QZI A;  3RAQ A;  2ZIU B;  5HMM A;  3OHB A;  4UB4 A;  2G0A A;  5KTQ A;  5J2J A;  4XUS A;  8ICJ A;  2C22 A;  2BQR A;  2ZXI A;  1SXE A;  4I28 A;  1S0M A;  4UB5 A;  5DQI A;  3V6H A;  3JPS A;  3D6J A;  3UQ0 A;  1JIH A;  2G07 A;  2OCE A;  3H4D A;  1TK5 A;  2KZZ A;  1K1S A;  5ALS A;  4F5Q A;  3MC1 A;  2W7O A;  9ICX A;  2WTF A;  3PSF A;  4UB6 U;  2E3T A;  2PFN A;  3AUO A;  5DBC A;  4F4X A;  3TI0 A;  8ICN A;  4NLC A;  3RB6 A;  2W55 A;  3NRW A;  2HHT A;  2R8I A;  2HOF A;  4F3O A;  2K8B B;  1IV8 A;  5EWF A;  2QB0 B;  2XI9 A;  2KIC A;  4KMO B;  1QQ6 A;  2JR5 A;  3PW4 A;  2PI4 A;  3PV8 A;  4DSK A;  5KT2 A;  8ICC A;  8ICB A;  4CNQ A;  2FLN A;  2ASL A;  1KL9 A;  5CHG A;  2HBJ A;  2V4R A;  1SXD A;  2KG5 A;  5H2F U;  4B9U A;  3MGH A;  2HHX A;  4BDP A;  4ZH4 A;  2A19 A;  1N62 A;  4Y2J A;  2R8J A;  2A1J A;  4UAS A;  3I76 A;  1NK7 A;  2Q0Z X;  2KKV A;  3I1Y A;  4P0P A;  1XC9 A;  1MN8 A;  3HWT A;  2P6R A;  8ICA A;  4O3R A;  2W9M A;  4CE6 A;  3C2L A;  4EYI B;  4QJF B;  2GH1 A;  4J9S A;  1ZQV A;  1UCV A;  4LJX A;  5F3X B;  3CNH A;  4UBC A;  1Z00 A;  4RQ6 A;  3PR5 B;  3PW0 A;  4Q43 A;  3JPQ A;  4M9L A;  5J0S A;  5AK6 A;  3UMG A;  5DLG A;  4EEN A;  2V4Q A;  3NVW A;  4DL7 A;  1ZQM A;  4M04 A;  4QZB A;  9ICL A;  1DGS A;  3RR8 A;  1ZQA A;  3C2M A;  1A6S A;  4Y2P A;  4NLG A;  5KT6 A;  1DK2 A;  1KQQ A;  4F4Y A;  2J6U A;  2ZJ8 A;  4R65 A;  7ICJ A;  2KK0 A;  2M9N A;  3MBY A;  4YMO A;  1O03 A;  5BPC A;  3V7K A;  1LVH A;  4DL3 A;  3C1Z A;  3MR6 A;  8ICQ A;  4YVZ A;  9ICU A;  5DBB A;  1L7M A;  4JV0 A;  1DGJ A;  1JXL A;  3BZC A;  3MAB A;  2KMD A;  1JRP A;  1L3V A;  7ICL A;  4RZR A;  1XSL A;  1IXR A;  3M8R A;  4NXZ A;  1QQ7 A;  1L8L A;  2LM1 A;  5EWE A;  2K8C B;  4KN7 A;  1YT3 A;  1S0V A;  2KSO A;  1ZRM A;  2W43 A;  4O0I A;  3G6Y A;  1MQ2 A;  3SD7 A;  3NGD A;  8ICS A;  1RZT A;  3AM9 A;  2QKQ A;  4QZ9 A;  4IS7 A;  1ZD3 A;  3OSP A;  1JXE A;  3BZK A;  4DF4 A;  3RB0 A;  3OJU A;  4YCX A;  8ICH A;  3GIK A;  2VIX A;  3G6V A;  5L1M A;  3LVW A;  5EE0 A;  2NRZ A;  3SI8 A;  4PHE A;  1WUD A;  3AU6 A;  4U6P A;  5KG4 A;  5HHH A;  5CJ7 A;  4YD1 A;  3UMB A;  3RAX A;  4UQG A;  4I2H A;  4NLN A;  4F2R A;  3AL0 B;  4NLK A;  2KJ8 A;  3PMN A;  5AKJ A;  4QIW C;  1KBU A;  4OCZ A;  3MR5 A;  1ZD2 P;  3TAC B;  4DFK A;  2W9B B;  1N61 A;  3H0R B;  3KHR A;  2PI5 A;  1N5W A;  4NLB A;  2HVH A;  2KN7 A;  2HSZ A;  3CYM A;  4J03 A;  1WCL A;  2ZTE A;  3PR4 A;  5JUM A;  5KG0 A;  2ODG A;  2I1Q A;  3ORY A;  4RQM A;  1A77 A;  4ECS A;  2OWO A;  4DSI A;  2BDU A;  2BGW A;  4Y2Q A;  4KMU A;  2ZIX B;  4KLQ A;  4FS2 A;  2QLT A;  1JMS A;  4ED6 A;  4OD0 A;  1UA0 A;  1SIJ A;  4MEX A;  3AQF A;  8ICE A;  4RNM A;  3KHL A;  3N4M B;  2XGP A;  1V9P A;  5ALQ A;  2OYY A;  2HVI A;  3T5L A;  4UBB A;  3TAR A;  4EEL A;  1ZQK A;  5L1I A;  3PO4 A;  4MFC A;  2HMX A;  1L7N A;  1U4B A;  3QU5 A;  4P0Q A;  4BUG A;  5DB7 A;  3RJE A;  1J2M A;  2DQN B;  5KFO A;  3TAQ A;  2IOH A;  4KLD A;  5JTI A;  3WKC A;  3H0M B;  3H8J A;  3VCB A;  2DKX A;  2ZTD A;  5AKG A;  2VJ4 A;  3QX7 A;  4OJO A;  4M9N A;  1Q3V A;  3RB4 A;  1WG8 A;  5ALP A;  4Y2U A;  3AU2 A;  5TIS U;  4O5E A;  1SKR A;  3BQ0 A;  1ZQC A;  5AK3 A;  4QZD A;  4RQ0 A;  3WKD A;  1C7Y A;  2JV3 A;  3KBB A;  4AYB F;  5DB9 A;  4ED3 A;  4DS4 A;  4ICA A;  4KLS A;  2QB0 A;  1N56 A;  2F76 X;  1TE2 A;  5J0P A;  1LV5 A;  4M2Y A;  2HBL A;  4DS5 A;  1HIW A;  3GV7 B;  4KLL A;  1S0N A;  3G6X A;  2E8P A;  5KG5 A;  2DKZ A;  5HR6 A;  5ALT A;  5ALL A;  4QZE A;  4R64 A;  2JHD A;  1U49 A;  1NZB A;  1PZN A;  2K89 A;  1N48 A;  2HHV A;  2NRX A;  3QU2 A;  3LVV A;  1T8E A;  1TFR A;  2LKY A;  3FDS A;  2W9B A;  4F5N A;  5IIL A;  3E2E A;  2F8K A;  2UVR A;  4B9L A;  4XA5 A;  4O3O A;  1QSY A;  1TK8 A;  2I5H A;  4P0P B;  5KFX A;  7ICI A;  3V6J A;  4OJ6 A;  4GC6 A;  3IM1 A;  5ALO A;  1HUO A;  4GXI A;  1KKX A;  3SAG A;  3KZI U;  1ZQD A;  2ZUD A;  2YQE A;  4UB3 A;  4IR9 A;  2LM4 A;  2K4P A;  5KFU A;  4I2C A;  3ALR A;  3DV9 A;  4F71 A;  5T14 A;  2EAP A;  4UAZ A;  2KTQ A;  2WF7 A;  4M6W B;  4RUC A;  4C0Z A;  5ALD A;  4PHD A;  2JEF A;  3MDC A;  1KEJ A;  2HI0 A;  4ECW A;  3IG8 A;  4F92 B;  4NL9 C;  3M9M B;  4P0Q B;  1N2X A;  5IIM A;  2GOL A;  3CRX A;  2W03 A;  3SZ2 A;  3PY8 A;  1NK5 A;  5ALI A;  4BXO A;  2HW3 A;  3KD3 A;  5F9L A;  3GFK B;  1WCN A;  5B66 U;  1VLB A;  5KFI A;  4M9H A;  4P4O A;  2HBK A;  5KFK A;  4BWJ A;  4WJ3 B;  1RYS A;  1VJ5 A;  3BDP A;  2KFZ A;  4EZ9 A;  5DGA A;  4FZN A;  1GO3 F;  2W9C B;  4B9V A;  2PXI A;  5J29 A;  4FFD A;  8ICR A;  1XO1 A;  4QWA A;  1ZQB A;  3H8M A;  3NTU A;  3MR3 A;  1ZRN A;  2P6U A;  4XRH A;  3QU9 A;  1SGG A;  2KSO B;  5AM3 A;  5DB6 A;  1TVA A;  3AEV A;  4QWB A;  4OJL A;  1X9W A;  5J2C A;  3TQ1 A;  4QZ8 A;  4B9T A;  1N63 A;  1S77 D;  9ICJ A;  1ECW A;  5KFR A;  2LMR A;  4R63 A;  2YX8 A;  1OUQ A;  2WHE A;  2WF8 A;  3RJG A;  4DO9 A;  3SQI A;  2LYA A;  4Y2S A;  3TAN A;  5L1L A;  3A0B U;  4C8O A;  1U47 A;  2GWS A;  3PST A;  2ISO A;  3ZD9 A;  5J0W A;  1L5U A;  2JZB B;  2HDO A;  4HAI A;  3BQ2 A;  3JPO A;  4DFP A;  2EDU A;  3WK8 A;  1ZQY A;  2M0N A;  1ZQE A;  4R8U B;  3T3F A;  1X6I A;  2N1R A;  3OSN A;  5D49 A;  3M6K A;  4DFJ A;  2HHW A;  1BNP A;  4O3Q A;  2PFO A;  3UQ2 A;  4C8K A;  3ISC A;  2F1J A;  4IR1 A;  2YY6 A;  4O3M A;  5K4L A;  3MFI A;  1NJX A;  4KLU A;  2XCA A;  4M9G A;  5CRX A;  3DEE A;  3N97 B;  4EEK A;  2BCU A;  4FBU A;  4KLI A;  2RRD A;  1C20 A;  1OW5 A;  4J9Q A;  2H3V A;  2AGQ A;  3F53 A;  2ZIW A;  4Q45 A;  1Z3E B;  8ICG A;  5KT7 A;  4F5R A;  4NWI A;  3GII A;  2XY6 A;  3QE9 Y;  4BGD A;  7ICN A;  2DL0 A;  3GIM A;  1BPB A;  5DDY A;  2KD1 A;  2O6K A;  5DGB A;  1NK4 A;  4P4P A;  2ALZ A;  2Y1J A;  2AQ4 A;  4RPX A;  4RQN A;  3LK9 A;  4K4G A;  4EBE A;  5ALZ A;  3WKE A;  3V7J A;  5BOM A;  3K1R B;  1ARO P;  2WAQ C;  4ED0 A;  1RM6 C;  3C29 A;  5CP2 A;  3EUB 2;  1RPL A;  1RG6 A;  2KJ9 A;  3HJE A;  3WK7 A;  5KG1 A;  4PH5 A;  2G08 A;  2HCF A;  5KAI U;  4DOC A;  5KFQ A;  4JK1 A;  3HKZ C;  2OXO A;  4C8M A;  4F4K A;  1D9F A;  2W54 A;  4YFK A;  3PML A;  4IRK A;  2JZB A;  1COO A;  1X2I A;  1QCK A;  3QXG A;  1DOQ A;  1HEK A;  2FE9 A;  2MA1 A;  1TKD A;  2W3S A;  4MFF A;  1B4F A;  4RNN A;  4KTQ A;  5IIK A;  2ZUB A;  4ELT A;  1K1Q A;  1NK0 A;  3QEA Z;  3KTQ A;  4GXJ A;  2EQY A;  4R66 A;  4I2I A;  5KFG A;  4Q8E A;  3BS5 B;  3KKA C;  1N5X A;  2G06 A;  2FMQ A;  1KFD A;  1S8O A;  1PK3 A;  4EEY A;  1JI7 A;  2Y9T A;  2CN1 A;  2DPI A;  4K4H A;  5KT4 A;  2D8C A;  3ICX A;  2E8M A;  2HOQ A;  5KFC A;  4C7Y A;  3TAP A;  5KL1 B;  4QZF A;  4DQR A;  4Q44 A;  1BPZ A;  3SEN A;  3PX6 A;  3M1Y A;  1RYR A;  3NS1 A;  3RH5 A;  4RT2 A;  9ICR A;  5J0T A;  5AKL A;  4C4T A;  2BZF A;  3ISB A;  2H3Q A;  1UHU A;  2F3N A;  3Q8M A;  3HW8 A;  3MGV A;  4BXO B;  1SKW A;  4IQV A;  1XO0 A;  2FPK A;  2B0C A;  3F5E A;  4ECQ A;  3T5H A;  2HHS A;  7ICR A;  3OHA A;  2PFP A;  1QLN A;  5DQH A;  2FJ6 A;  4MEY A;  3C1Y A;  1X40 A;  3M9N B;  1FFU A;  2E8O A;  5G5H A;  5DLF A;  1KDH A;  3NRZ A;  9ICV A;  4J9O A;  4JV1 A;  4RQ1 A;  3H8S A;  8ICZ A;  2BR0 A;  4U7C A;  1IM4 A;  2GLE A;  2F2A B;  2H3I A;  2MSN A;  3NVZ A;  1Z1B A;  3RJI A;  1S76 D;  2PMZ C;  4IRC A;  4Y2X A;  4OO1 J;  4O9M A;  4AYB C;  4YXJ A;  4O3N A;  5HNK A;  1L3S A;  4BX9 C;  5D46 A;  3UXO A;  2Y0S C;  2LHT A;  3EZ5 A;  8ICO A;  5CEH A;  5GTI U;  4LZG A;  7ICP A;  3TAD C;  2PKE A;  2E8N A;  4RPY A;  4NV0 A;  1JAL A;  4DQS A;  1Z19 A;  3M9O B;  3PZP A;  2XIC A;  4PZN A;  3WKB A;  2JRZ A;  1L3U A;  4DEZ A;  3B9J A;  4I2A A;  2BCS A;  3H7I A;  4J9R A;  2C28 A;  3ZDB A;  4C4R A;  2YML A;  4R8U A;  2G5I B;  7ICG A;  5ALJ A;  4HYK A;  5HML A;  1ZQG A;  4TUS A;  4ELV A;  4YR2 A;  2RP5 A;  4RUA A;  4CF4 A;  7ICS A;  3ZDC A;  2W11 A;  2P66 A;  9ICP A;  4FBT A;  3RJJ A;  4C4S A;  7ICV A;  1ZQO A;  2KVS A;  4CF5 A;  3ETR A;  4PL1 A;  3IG5 A;  3SV3 A;  7ICU A;  4NJ8 A;  4YXM A;  3M6Z A;  3AQE A;  4UAR A;  2VA3 A;  1NKB A;  3SAH A;  1PK1 A;  5J0U A;  4TUR A;  3KHH A;  8ICL A;  3LYS A;  1H38 A;  1NK9 A;  1KFT A;  1BPX A;  4NL9 A;  4YQW A;  1QQ5 A;  2AHO B;  2G5H B;  4M47 A;  4EYH B;  1ZQP A;  4YR3 A;  2MU2 A;  3IP4 B;  4UB8 U;  3MDA A;  4I2J A;  4PL2 A;  1X9S A;  4FE3 A;  2A1J B;  5E79 U;  4YD2 A;  3N7P D;  5AM4 A;  5J2E A;  4J9N A;  8ICT A;  5AI0 A;  4O5K A;  2AQ0 A;  3E0F A;  8ICX A;  1ZQU A;  4PGX A;  2RLT A;  1TV9 A;  4I27 A;  3HKZ F;  4ECT A;  1SZH A;  4DL2 A;  4DSE A;  5J2A A;  1F0M A;  3GZF A;  4F5P A;  1U45 A;  1MC8 A;  3R9K A;  5EE9 A;  4KN4 A;  3JPN A;  4ECR A;  2PMZ F;  5CB1 A;  4RQ2 A;  3RRG A;  3H8W A;  5HP4 A;  3WK5 A;  4ECX A;  1WYG A;  5KFW A;  1BGX T;  1MSW D;  4RQ3 A;  1KW4 A;  4PPX A;  1FIQ A;  5ALX A;  3RBD A;  3J81 j;  3T5J A;  2AH5 A;  3GIL A;  2LPE A;  2NV3 A;  4C8N A;  3IDW A;  3L5K A;  5ALM A;  1ED1 A;  2KIV A;  1T3N A;  2D6F C;  2RQ5 A;  3GQC A;  9ICG A;  1A0P A;  3FM9 A;  2B21 A;  2ZIU A;  4FS1 A;  3MGI A;  5III A;  3AN1 A;  4FZL A;  3UXN A;  5AKI A;  3PVX A;  2ISP A;  3CW2 C;  2R8H A;  2F77 X;  4CDG A;  2JEI A;  4UAT A;  4I2D A;  5ALV A;  4DOB A;  4F50 A;  3QNM A;  1J2N A;  9ICF A;  8ICM A;  4C80 A;  2KHV A;  3AMZ A;  2R8K A;  2KOB A;  3NVV A;  1S10 A;  2NRW A;  1PK1 B;  1Z4N A;  3WK9 A;  2W8K A;  3QYP A;  2KNJ A;  3QU4 A;  5J0X A;  4NY8 A;  1KSP A;  2V9W A;  1V97 A;  1PVR A;  1SB3 C;  1BVS A;  5KFH A;  5KT3 A;  1D8Y A;  2EZX A;  2ESE A;  4PHA A;  4LZD A;  4EX7 A;  3S6J A;  4P2H A;  3KFU F;  2EZY A;  3MFH A;  5AI9 A;  5J8Y A;  4RU9 A;  4DQP A;  4DSL A;  4EBD A;  5FP0 A;  5J2H A;  5ALG A;  2ASJ A;  4MF8 A;  1RQL A;  3ISD A;  1XWL A;  2FDR A;  3L3F X;  1YZ6 A;  4MFA A;  3BS7 A;  4RT3 A;  2F8L A;  2AGP A;  4FZM A;  1KLN A;  2K4E A;  2KFN A;  2ZXH A;  3BQ1 A;  3IHQ B;  2Y0S F;  1TAQ A;  2QB1 A;  2XCP A;  4KLE A;  5AIC A;  5AM2 A;  4QW8 A;  5GTH U;  2A1A A;  4RPZ A;  5J0Q A;  2RDJ A;  3ZDD A;  9ICS A;  5ALE A;  3Q8R B;  4B9S A;  1Z00 B;  3NUQ A;  5KNI A;  4RQ5 A;  3RRH A;  2DWQ A;  1U48 A;  2XGQ A;  4DLG A;  1L7P A;  5KG6 A;  1RDF A;  2ATL A;  3WK6 A;  4GFJ A;  5B5E U;  2BDP A;  1NZP A;  3H40 A;  5AIB A;  5KFE A;  3Q8S B;  1K5O A;  2YMP A;  1BPE A;  2W04 A;  5J2K A;  4KLH A;  4PZO A;  4O3S A;  4C8L A;  3E58 A;  4DQQ A;  3RFA A;  4UAV A;  2FPM A;  3SV4 A;  4O3P A;  4QZC A;  4TUP A;  3HPO A;  4KLF A;  4USA A;  1XU4 A;  4IRD A;  2BCR A;  2H5X A;  9ICI A;  1JN3 A;  9ICT A;  5KG3 A;  4A8E A;  2J6S A;  3PW2 A;  3C2K A;  1MA7 A;  3BQT A;  2IOF K;  5HHI A;  2KJ5 A;  5KFZ A;  5KFN A;  2KHQ A;  5KL8 B;  2HHQ A;  2ES6 A;  3FAH A;  5ALK A;  3A0H U;  3RJH A;  2IA6 A;  4F8R A;  2JGA A;  5DBA A;  1ZQQ A;  8ICU A;  1L6N A;  2G09 A;  2KZ3 A;  3ED5 A;  2FMP A;  3V7L A;  1BPY A;  3DDH A;  1UA1 A;  9ICQ A;  1PVQ A;  4DL6 A;  2HBM A;  5J0Y A;  1X6J A;  3PNC A;  4I29 A;  3CP8 A;  3WK4 A;  5AKY A;  4Q8F A;  3L4P A;  4QWC A;  4M9J A;  4TUQ A;  8ICK A;  2WFA A;  4QIW F;  3EPI A;  4B9M A;  4ACO A;  1QH9 A;  1D8L A;  8ICY A;  1M6Y A;  4PGY A;  1RYU A;  4TQR A;  4ECU A;  3RJF A;  1VDV A;  2L5Y A;  4QWE A;  1COK A;  4ED2 A;  4J9M A;  3T79 A;  2YB1 A;  1ZXI A;  1DK3 A;  5AM5 A;  1ZD5 A;  3ONN A;  3IN5 A;  1ZQ1 C;  4KLO A;  1Z1V A;  2DFL A;  5EE3 A;  5CWR A;  2BQ3 A;  9ICM A;  1EXN A;  3C28 A;  4ECY A;  4DL5 A;  2NRT A;  8ICV A;  3JPT A;  4DWI A;  3TFR A;  3KKA A;  2ZJA A;  2ASD A;  3V72 A;  2LI6 A;  3QZ8 A;  2FI1 A;  3K4G A;  1N60 A;  4F93 B;  2I9G A;  1TAU A;  2ZTC A;  4EBC A;  7ICQ A;  4KLT A;  2YMM A;  1MQ3 A;  5KFS A;  4PHP A;  3NAS A;  4M6W A;  3TAD A;  5J2B A;  1SV0 C;  4G3I A;  2YN4 A;  7ICF A;  4B9N A;  3OTQ A;  4DOA A;  1ZQX A;  2ZIV A;  2A3V A;  3RTV A;  5AHX A;  3H0L B;  2YTU A;  2YMQ A;  2ZIX A;  4Z6D A;  5KFD A;  5A0L A;  3RBE A;  1Q8K A;  5ALY A;  3F2B A;  3EWA A;  3MR2 A;  2K8A A;  3TKA A;  3HIL A;  3Q8L A;  3N7S C;  2Z7J A;  4GC7 A;  3ZD8 A;  2AJQ A;  2Y9U A;  4DF8 A;  4F4W A;  2W9C A;  1T3Q A;  2F44 A;  3GDX A;  5D4B A;  2JEJ A;  4KLG A;  1OXJ A;  1NKC A;  4F2S A;  5DG7 A;  1JX4 A;  1FEZ A;  2D3D A;  2EAO A;  4Z6C A;  7ICO A;  2NO4 A;  3GV8 B;  1U9L A;  1NJY A;  2UVV A;  4J9P A;  1ZQZ A;  3B0X A;  3NVY A;  4G9B A;  1F5S A;  5AI4 A;  1LB2 B;  2UVU A;  2KIW A;  1JUD A;  2CXY A;  4DSJ A;  1KN5 A;  3SAF A;  1BNO A;  4IC9 A;  3N7R C;  2IHN A;  1ZJM A;  2NYV A;  1ZD4 A;  3RF9 A;  1WWV A;  4O5C A;  2EAM A;  1T4G A;  8ICW A;  5IIJ A;  2AXT U;  4YG2 A;  3Q8K A;  5J2F A;  3U26 A;  5CA7 A;  4US8 A;  4J9K A;  3M7D A;  4OJ5 A;  4IQU A;  1S9F A;  1SL1 A;  2MUT A;  1UPH A;  4DFD A;  4BJQ A;  4F72 A;  2XO7 A;  4CF3 A;  2MAX A;  4F4Z A;  3F5A A;  3QU7 A;  2Y1I A;  2B6G A;  2MRL A;  3HT3 A;  1CEZ A;  5ALU A;  2KP7 A;  2AGO A;  3F2D A;  2WB1 F;  3WU2 U;  3HP6 A;  1A76 A;  2ZIV B;  4ZOH C;  5AIA A;  5AI5 A;  2EAN A;  5DG8 A;  1NJW A;  1B22 A;  1O08 A;  4Y2Y A;  5DKW A;  2KVC A;  4JMU A;  2W3R A;  5KFL A;  1FFV A;  4UAY A;  5L1J A;  1V85 A;  3OPX A;  3PSI A;  2BCQ A;  5G5G A;  2XY7 A;  3RB3 A;  2FLL A;  7ICK A;  5IIO A;  1IIP A;  3HX0 A;  4GXK A;  4MF2 A;  4CGZ A;  5KFM A;  2FPL A;  1UT5 A;  3D2N A;  1F44 A;  1QSL A;  4J9L A;  1ZQR A;  2QAR B;  4XQ8 A;  1FO4 A;  4Z6F A;  1NOM A;  4I2G A;  4NLZ A;  5AKX A;  5AKK A;  5L9X A;  2JMG A;  1ZQJ A;  2K4I A;  4YP3 A;  9ICE A;  4US9 A;  4ED1 A;  3GIJ A;  1Z4O A;  4IL6 U;  3GV5 B;  2VKQ A;  5J2I A;  3QUB A;  5AM1 A;  3TFS A;  9ICC A;  2DPJ A;  1BPD A;  2I6X A;  2VAN A;  2BPG A;  2BCV A;  2WAQ F;  3ETL A;  1S97 A;  4GIB A;  4GLX A;  3Q8P B;  4UAU A;  2C2E A;  3PO5 A;  1D9D A;  9ICH A;  4EX6 A;  5ALF A;  1DXS A;  2HOI A;  3UMC A;  2UVW A;  2VA2 A;  5ALW A;  2J6T A;  1SV0 A;  2XY5 A;  2F1H A;  3UM9 A;  2E5S A;  5KFY A;  2VJ5 A;  4KLJ A;  9ICW A;  2RDI A;  4Y2T A;  9ICA A;  3PW5 A;  1KFS A;  4CCH A;  9ICO A;  1CI4 A;  2IMW P;  4DLE A;  1SWV A;  3OJS A;  5KT5 A;  4QNL A;  2EZZ A;  4YR0 A;  3O0F A;  1ZJN A;  3FC4 A;  4RNO A;  1X66 A;  3C23 A;  2KKP A;  4PJ0 U;  5ALR A;  4DQI A;  1CRX A;  1URJ A;  5IIN A;  2EH9 A;  4AP9 A;  3LWL A;  1SZP A;  3N28 A;  3QUT A;  1XNS A;  1S5L U;  3QEB Z;  1ZQF A;  1WWU A;  4QZA A;  2LYB A;  3BJY A;  3ZDA A;  5J0R A;  1V38 A;  9ICK A;  3ZI4 A;  3QZ7 A;  1DRG A;  2IHM A;  5AM0 A;  1PUZ A;  5EE1 A;  3RH6 A;  4M0A A;  9ICN A;  1UQV A;  4Z6E A;  5AKE A;  2HHU A;  5CR0 A;  5DG9 A;  4I2E A;  2ZJ5 A;  3PW7 A;  5KFJ A;  2AU0 A;  4F5O A;  3QUC A;  2R18 A;  2JEG A;  4P4M A;  1X42 A;  2LYH A;  2R8G A;  1X9M A;  7ICH A;  3SMV A;  1T7P A;  1XSN A;  2QAR A;  1D8B A;  4JUZ A;  4ECZ A;  2W8L A;  1ZQS A;  4UB1 A;  4UW9 A;  3RJK A;  4KIT B;  4Y2R A;  3PX4 A;  2ZUC A;  5KFA A;  4YMN A;  1ZQN A;  4ED7 A;  3LDA A;  5JRT A;  2XC9 A; 
#chains in the Genus database with same CATH homology
 2K4H A;  2JH1 A;  2G5H B;  1MA7 A;  2ZG6 A;  2PMZ C;  2LBO A;  2KHV A;  1WUD A;  2HBK A;  2KJ5 A;  2CPR A;  2KOB A;  2WAQ F;  4OO1 J;  2H3Z A;  4U6P A;  3IP4 B;  2ZXI A;  4O3M A;  4AYB C;  5CRX A;  2KHQ A;  4AYB F;  2ZIW B;  5KL8 B;  4WJ3 B;  4BX9 C;  2KNJ A;  3DEE A;  4PL2 A;  4ICA A;  2HOI A;  3AL0 B;  4FE3 A;  3N7P D;  2KJ8 A;  2G07 A;  3M7D A;  2Y0S C;  4OJ5 A;  2LHT A;  4QIW C;  2RRD A;  1PVR A;  2JGA A;  2G06 A;  3E0F A;  2OH2 A;  2F76 X;  1GO3 F;  4FZN A;  2W7O A;  1Z1B A;  1KBU A;  1D8B A;  1L6N A;  2ZIV A;  2A3V A;  3PSF A;  2G09 A;  2H3V A;  1UPH A;  2HBL A;  1SZH A;  3F53 A;  3HKZ F;  2E5S A;  4BJQ A;  5C0Y A;  2ZIW A;  3H0L B;  1HIW A;  3F5A A;  2VJ5 A;  2MRL A;  1A6S A;  3H0R B;  3GZF A;  2ZIX A;  3KFU F;  2CN1 A;  2Q4T A;  3K1Z A;  4NLB A;  4NWI A;  4NV0 A;  5HR6 A;  3F2D A;  1PVQ A;  2WB1 F;  3CYM A;  5A0L A;  1Z19 A;  4QNL A;  5HR7 A;  2HBM A;  3ICX A;  2RHF A;  3O0F A;  1P7D A;  3PZP A;  2HOQ A;  2ZIV B;  2JHD A;  2XIC A;  1NZB A;  3F2B A;  2K89 A;  3PSP A;  4NLC A;  5KL1 B;  2KKP A;  2KD1 A;  3L3F X;  4OJL A;  3LVV A;  3NRW A;  2BDU A;  1CRX A;  1URJ A;  2K8A A;  2LKY A;  2PMZ F;  2HOF A;  2F8L A;  2ZIX B;  2KVC A;  4JMU A;  2W7P A;  1PVP A;  1Q3U A;  2K8B B;  3N7S C;  4FZM A;  3F2C A;  2Z7J A;  3OPX A;  3PSI A;  2XI9 A;  2KIC A;  4KMO B;  1TAM A;  2H3Q A;  2K4E A;  1XNS A;  1ECW A;  4P0P B;  3AQF A;  2WB1 C;  2ZXH A;  2LYB A;  2E1F A;  2G5I B;  2YX8 A;  2Y0S F;  4QIW F;  3MGV A;  1OUQ A;  4ACO A;  2OYY A;  4OJ6 A;  3SQI A;  1XO0 A;  1IIP A;  2JH7 A;  4KX5 A;  1DRG A;  2RP5 A;  2WAQ C;  4CGZ A;  2LYA A;  3SAG A;  2KEY A;  3F5E A;  3D2N A;  1F44 A;  2NV3 A;  2XVT A;  2HBJ A;  3C29 A;  1ED1 A;  2H3F A;  2K8C B;  3NUQ A;  2HMX A;  2D6F C;  3PST A;  4CRX A;  1YT3 A;  3ALR A;  3GU3 A;  4P0Q A;  4BUG A;  3T79 A;  1A0P A;  2CRX A;  2YB1 A;  2DQN B;  5T14 A;  2R18 A;  3KZX A;  4OJP A;  2ZIU A;  4PL1 A;  2KJ9 A;  4GFJ A;  2XID A;  3H0M B;  3IG5 A;  2JMG A;  4C0Z A;  3VCB A;  3SMV A;  3D2S A;  2G08 A;  2KV2 A;  3ONN A;  2K4I A;  2OM6 A;  3IN5 A;  1ZQ1 C;  2DF4 B;  2E1E A;  2KKV A;  1T94 A;  3VC8 A;  2VJ4 A;  2DGZ A;  2YB4 A;  2OXO A;  2KIW A;  3AQE A;  2M0N A;  3HKZ C;  3IG8 A;  3M6Z A;  4OJO A;  2W04 A;  3D2Q A;  4FZL A;  3SAH A;  1Q3V A;  4P0P A;  4P0Q B;  2GOL A;  3CRX A;  2W03 A;  3RFA A;  2VKQ A;  3SAF A;  2F77 X;  4CDG A;  4QJF B;  2N1R A;  2ZIU B;  4IC9 A;  2GH1 A;  3N7R C;  3C28 A;  4U7C A;  3LYS A;  3M6K A;  4KX3 A;  1HEK A;  2VIX A;  2F2A B;  4A8E A;  2H3I A;  3RF9 A;  2G0A A;  3CP8 A;  3LVW A;  2MA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...