1ECWA

Crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 293k.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
SVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
publication title Crystal structure of SIV matrix antigen and implications for virus assembly.
pubmed doi rcsb
source organism Simian immunodeficiency virus
total genus 38
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1ecwA00
4JMUA 2HMXA 2H3ZA 2LYAA 2K4HA 1TAMA 2K4EA 4ICAA 1UPHA 2LYBA 1A6SA 1ECWA 2H3VA 1ED1A 1L6NA 2K4IA 1HEKA 2N1RA 4IC9A 2GOLA 2H3FA 2H3QA 1HIWA 2NV3A 2JMGA 2H3IA
chains in the Genus database with same CATH superfamily
4ECRA 2HHVA 3MABA 1SB3C 2M0NA 1RPLA 2JV3A 3SAFA 4UB4A 3RRGA 2R18A 9ICIA 1HUOA 4Y2PA 1MA7A 2VA3A 5FP0A 1ZQ1C 3BS7A 5C5JA 2F1HA 2AGQA 4F4YA 4DOAA 4F3OA 1DOQA 4R8UB 1F0MA 2YMLA 2KVSA 5KG4A 2KZZA 3M7DA 3HILA 4BXOA 4M9JA 1FEZA 3H4DA 1H38A 2FLLA 1ZXIA 4BWJA 1DRGA 1WUDA 4DF8A 2DGZA 2Z7JA 5AIBA 4TQSA 4EBEA 5AM5A 5KFUA 5J2AA 4B9NA 3K4GA 2Q0ZX 4YXMA 1LVHA 5KG5A 4GXJA 4DLEA 5F3XB 2WAQF 1ZQNA 4C0ZA 5L1IA 3E58A 1Y88A 2E8OA 4DL4A 5DG7A 3N97B 3I1YA 5DGBA 5DBBA 2P6UA 8ICHA 3PX4A 1XSLA 2XY7A 1VDVA 2H3FA 1ZQRA 3QU9A 2JZBA 1D8BA 1NI3A 2KSOB 5ALRA 1PK3A 1BPYA 1FFUA 1JIHA 3A0BU 4QZCA 5KT5A 4DSLA 5ALZA 4QZEA 3CNHA 4YN4A 2C2EA 5CJ7A 3G6YA 4QZ8A 2ALZA 4C4SA 5TISU 4I29A 5KFYA 4DL5A 3B0XA 4RQ0A 4CF3A 3AQFA 2FLPA 4O3OA 5KFFA 2EAMA 2BPGA 2HCFA 2H5XA 4HYKA 4QZHA 4FZMA 4KLMA 1CUKA 2KHQA 2BHNA 2ZJ8A 2LMRA 4CRXA 2Y9UA 1VLBA 7ICVA 3C2MA 3UMBA 3MR3A 3L3FX 2KK0A 1ZYQA 2HOQA 4P0PA 2YB4A 4P0QA 3O0FA 4ECSA 2AGPA 1SL2A 1ZD4A 4DSEA 5ALXA 3RJIA 9ICTA 1SIJA 1V85A 3PW0A 3D2NA 4GFJA 4NLBA 1KTQA 3IHQB 1RXWA 1SWWA 3RB6A 3KZXA 3EYZA 3MGVA 2PFNA 3RR8A 3DEEA 4GXKA 3NUQA 1N5XA 3M6KA 2XICA 2E8PA 2R8IA 1RXVA 4KLLA 2ZXHA 5IIJA 3HJEA 3AM9A 2A1JB 4QZAA 1IV8A 2OYYA 3MBYA 4BJQA 4RQ4A 5G5GA 4IRDA 2W9BA 3C5FA 3L5KA 2W9CB 2M9NA 4NL9C 4RNNA 4QWDA 4QWBA 4JWNA 2F76X 9ICKA 3PVXA 2H3IA 4PHDA 3N28A 5KG0A 3PO5A 3H8WA 3VC8A 3OJSA 2JRZA 3TQ1A 3T5JA 2EAOA 1L7MA 4B9VA 4YP3A 1A0PA 5L1LA 1NK7A 3IRUA 4C80A 2AQ0A 3ISBA 1LV5A 4DFDA 3PMLA 3QZ7A 1F5SA 2IHNA 4RNMA 4RPYA 2IBKA 3SYZA 4DQSA 1Z1VA 2MA1A 5D46A 5KT7A 3QZ8A 3K1ZA 8ICZA 5KFMA 3AU6A 3ZDEA 2YN4A 2J6SA 1SV0A 5EWGA 3RJFA 3TAQA 2B6GA 4M47A 4QWAA 1K5OA 3OSPA 1KW4A 5B5EU 5TZVA 4UQGA 1X40A 5DB7A 5EE9A 2YY6A 5ALFA 5HR6A 4BDPA 1ZQWA 2XGPA 4I27A 4JUZA 4FE3A 2RP5A 2PMZC 3MDCA 4TURA 5IINA 4NXZA 1SKWA 3C2KA 2WF5A 2GO7A 1L3TA 3GV5B 3KZIU 2XC9A 3WK6A 1RYRA 2EANA 7ICOA 2LM4A 4PH5A 3V6JA 2XI9A 8ICFA 1NK4A 4EYIB 4IR1A 1BVSA 3PNCA 7ICMA 3RTVA 1IIPA 1Z4OA 1SWVA 5AK5A 5A0LA 2EH9A 1WYGA 3IDWA 4CE6A 5J2IA 4QZDA 3RJGA 3PR4A 1ZQYA 3QUQA 1YZ6A 5HHIA 1RZTA 2UVWA 2JHDA 4ED2A 2WAQC 2HBLA 3IM1A 4UAZA 5DLFA 4TUQA 3ISCA 3S6JA 3RB4A 4ELVA 2E8MA 4TUPA 4KLEA 2F1IA 4UASA 5L1JA 4F5QA 4F71A 4UAYA 4J9MA 4R63A 1OUQA 3MGHA 2LHTA 1L7PA 2G5HB 1T4GA 3AU2A 3Q8RB 3KTQA 1XSNA 4XQ8A 9ICXA 2FLNA 1ZD5A 4J9KA 1Z1BA 4CF4A 3IP4B 4RQ6A 5DDMA 4MFCA 2G08A 4ED8A 5EWFA 4KLJA 5ALLA 1X2IA 4UB6U 2A19A 3R9KA 4YVZA 2P35A 5K4LA 3V72A 5ALEA 4GC6A 3PW4A 5ALUA 4UB2A 9ICQA 2KKPA 5H2FU 4PL2A 5CA7A 5J2KA 5KFHA 4M9NA 4Q43A 3QYPA 2BCVA 4R8UA 4C8KA 5ALPA 5HHHA 2BDPA 1JUDA 3PY8A 4MHVA 4KN4A 4F91B 2KZMA 1DXSA 1LB2B 4EX7A 3QU5A 4DSKA 5KFLA 3AMZA 2DUYA 2VANA 1QQ5A 2AU0A 3BDPA 5EE1A 2BCRA 2ISPA 2JH7A 2K4EA 4DF4A 4NY8A 4UB3A 9ICBA 1MN8A 3EPGA 1COOA 2JXJA 4IRCA 3TARA 3FYHA 1JROA 2HSZA 4OJLA 3PO4A 3EZ5A 2KSOA 3T3FA 1V9PA 2KD1A 3N7RC 2AGOA 1T7PA 1YZ7A 3OSNA 4U6PA 2ASDA 3QUBA 4KLIA 1Z19A 2ODGA 4ECUA 2HBKA 1ZQQA 3ORYA 3RBDA 3GV7B 4LVSA 3SAHA 2W7PA 4DSJA 3N4MB 2IA6A 2H3ZA 1ZQSA 1CI4A 3EW9A 1ZD3A 4O3NA 5HR7A 4Q8EA 2CPRA 1U47A 2LKYA 1DK3A 3RFAA 2R8JA 2WB1C 3Q8LA 4NJ8A 2K8BB 3THVA 4RQ5A 1SZHA 5KG7A 4FO6A 5HNKA 5KAIU 3Q8PB 1ZQMA 3NVYA 2EZZA 1UA0A 5ALVA 4US9A 4FS1A 5J2BA 1XS9D 4A8EA 2A1JA 1KEJA 4DO9A 1UT5A 1BNOA 1Z00B 3GV8B 2W9CA 4RT2A 1L3VA 5KFVA 5KFTA 3RBEA 3N7SC 2YMQA 2DKZA 2YMPA 2HW3A 1A6SA 4DQPA 1HJPA 2I6XA 4U7CA 2NRVA 4O3QA 5DLGA 9ICLA 5BPCA 4ED0A 4ECVA 4R66A 3TACB 4Y2VA 2NO4A 3PSPA 2W8LA 4Q44A 1X6JA 7ICQA 1SV0C 2D6FC 2H3VA 4NLGA 3OTQA 3WK8A 1F44A 3NVWA 4K4GA 4F2RA 5KFAA 4F2SA 4C7YA 4YMMA 2PKEA 2ZIWB 2P6RA 1IG6A 2YTUA 4F4XA 4MF8A 3DDHA 4QNLA 1U45A 5KG3A 4F5RA 2ZIXB 3MC1A 1UCVA 1UPHA 4NLZA 5ALTA 1KLNA 3ETRA 2W9AA 3IN5A 1PZNA 2K4PA 4RNOA 1J97A 4PL1A 3Q8QB 4ZOHC 4GXIA 4EYHB 3HX0A 3WKBA 4ED7A 4BWMA 2E5SA 3V7LA 1COKA 3QU2A 2DWQA 2XIDA 1ZQKA 4UATA 3SAGA 2RDJA 1ZQUA 2AXTU 3SZ2A 3WK7A 1D8YA 5KFPA 3BZKA 2PFPA 5J0OA 4O3SA 5DQHA 4ACOA 1S77D 1ZQAA 3BQ7A 2NRWA 1L8LA 2GOLA 4C8NA 5ALQA 2HHXA 1BPBA 2O6KA 5J0PA 8ICCA 3AUOA 1L3UA 3ZD8A 4F5OA 3IV6A 3C1YA 3UXOA 5AKXA 4R65A 4M6WB 3UMCA 2W3RA 1ZQLA 5KG6A 1RDFA 5J0YA 2FDRA 4RU9A 3HT3A 4NLKA 2VA8A 5AI8A 1XNSA 4ECXA 4MFAA 5DB8A 3BQTA 4J9PA 1UQVA 2RRDA 1L5UA 3UMGA 2IOFA 4RQ7A 4QWEA 2LM1A 4YR2A 3F2BA 9ICEA 2E8NA 2C28A 2XY5A 1Q8KA 3E0FA 2E1FA 3RF9A 5C0YA 1S10A 1QCKA 5KFBA 5AKEA 3MR2A 3TADA 2OCEA 8ICUA 4B6JA 8ICRA 1NK9A 1B43A 1C7YA 4RQNA 4JV2A 4LZDA 1N2XA 4QZBA 2QARB 1ZJMA 3QU4A 2MAXA 1LKYB 3H4BA 4YMOA 8ICQA 4UAVA 4ZH4A 4M04A 4RPXA 4NM2A 3KBBA 5AICA 5ALYA 4IQVA 2XO7A 2WTFA 1X9MA 3PSTA 3GFKB 3KOOA 4PPXA 3BZCA 3UXPA 3B0YA 4IQUA 3EPIA 1ZQCA 2MSNA 3QEAZ 2Y1IA 7ICNA 5DKWA 4ECQA 5BOLA 3QXGA 2FMPA 2ESEA 3WK4A 2DFLA 2IHMA 4IS7A 3RR7A 2UVVA 2QLTA 1CEZA 2KE7A 4DL6A 3M8SA 8ICKA 4YMNA 3M1YA 4NWIA 1SL0A 5KG2A 1RYSA 1BPZA 2JGAA 2R8GA 3GILA 8ICWA 1NKCA 1N62A 4Y2YA 3WK5A 4EEKA 4DL3A 1RQLA 2N1RA 2XCAA 5AI4A 1JXLA 7ICFA 1SKSA 3LK9A 3NASA 1QSYA 5ALNA 4JMUA 1NKBA 2HDOA 2HI0A 2AJQA 2PI5A 4F92B 2RLTA 2FPKA 5DGAA 2KVCA 2V4RA 2ZJ5A 1PVQA 1Z3EB 5J2DA 1S5LU 5J2CA 4MEXA 4RQ8A 3SD7A 1VJ5A 5DB6A 1IXRA 2BKEA 1TKDA 4KMOB 1XC9A 9ICHA 2BCUA 1NZBA 2FI1A 2D3DA 3JPNA 1URJA 8ICEA 9ICFA 3M6ZA 1A76A 1S0VA 4CF5A 1S8OA 4UB8U 4OJ5A 5AI9A 4TUSA 2ZTCA 2V4QA 3GIKA 5J0QA 1NK5A 8ICMA 2I5HA 2VJ4A 3SV3A 2F1JA 1L7OA 3V7JA 1TE2A 4J9RA 2V9WA 5AM0A 1NK6A 2F8KA 2BQ3A 2RHFA 3CRXA 1V97A 4B9UA 4B9LA 3EUB2 2Y1JA 2G0AA 2YMMA 4Y2QA 3LYSA 4FBUA 4CNQA 2BPFA 4PHEA 3SMVA 2IOHA 1HUZA 3D2SA 2HOIA 4I2DA 5AM4A 3I76A 1TV9A 1N63A 1O08A 2K4IA 4C8MA 2AH5A 5AKJA 2Y0SF 5J8YC 1X9XA 5J0UA 1QLNA 7ICHA 2HBJA 5AKHA 5ALOA 1GO3F 3WKDA 4OD0A 4DEZA 3UQ0A 4Z6FA 4DL2A 4I2CA 4Y2RA 1ZJNA 3C29A 1ZQXA 1S0MA 1UA1A 2W8KA 9ICRA 5KFNA 3C23A 2E3TA 3NVVA 2FE9A 4Z6EA 1D8LA 2KZ3A 4UB5A 5ALGA 3HW8A 2QB1A 2JEGA 1BPXA 2ZJAA 5ALKA 3MFIA 2FPMA 5ALHA 4J9LA 2VJ5A 2G07A 2BQUA 4EBDA 4F4WA 1RYUA 3HWTA 4TQRA 1Z00A 3TKAA 3UPQA 3MDAA 2ATLA 7ICSA 4UB1A 3H0LB 3SI8A 1SGGA 3BQ0A 1ZQFA 4P4MA 3C1ZA 4F8RA 4ECZA 1KBUA 5IIKA 4DLGA 7ICUA 5KT4A 4ED3A 2UVUA 4F4ZA 1O03A 4EENA 3KHRA 7ICPA 5CRXA 4QIWF 1OXJA 3C5GA 2WFAA 9ICAA 2QKQA 4I2BA 3SR6A 3E2EA 5KFJA 2ZIWA 4RQ3A 2KMDA 4OJ6A 2QB0B 3PW2A 1ECWA 2G09A 2XVTA 3JPRA 3BJYA 4RZRA 2JEJA 5JTIA 3SENA 9ICSA 2ZIXA 4J9QA 7ICLA 8ICYA 3NVZA 1PVRA 2W54A 5D4BA 3PZPA 1NJWA 2W9BB 2W55A 2F3NA 5AI6A 4B9SA 4KLGA 2I9GA 2KIVA 3TFSA 4I28A 4IL6U 3ISDA 1ED1A 1NJXA 4YD2A 3SEIA 4XUSA 8ICPA 8ICJA 4USAA 3F53A 3KFUF 2K60A 3WKEA 5AM2A 4I2EA 4I2HA 4NL9A 2C22A 2F2AB 4KLQA 2DKXA 2CN1A 2K8AA 3NRWA 4ELTA 4YCXA 2KICA 5IILA 2K89A 1B4FA 3KHGA 2W04A 3HRDD 2GLEA 5T14A 4M6WA 2A3VA 5KFSA 8ICTA 1TAQA 2XCPA 3BQ1A 4DOBA 4PGXA 1C20A 2ES6A 1FFVA 2HHTA 4G3IA 3I28A 4GLXA 4DQRA 8ICSA 3TADC 4DOCA 2YX8A 4G9BA 4M2YA 4J03A 4QWCA 4PZNA 3D6JA 4KLDA 3QEBZ 7ICRA 2OHFA 1XO1A 1Q3UA 4Y2JA 5KL8B 4J9NA 4ICAA 4I2GA 4EELA 4DSFA 1CRXA 1D9FA 2LYBA 4Y2TA 5J0XA 4ECTA 3GU3A 3RH6A 1EXNA 3JPSA 4AYBF 3GIMA 4O9MA 7ICTA 1TAUA 5CWRA 3RJJA 1X9WA 1FO4A 2JMGA 5AK3A 2QARA 5JRTA 4WJ3B 4ECWA 3ICXA 1LKYA 4Z6CA 5AK4A 2PI4A 4M9HA 5J2HA 1U48A 2OXOA 4UBBA 3NGDA 3RH5A 4ED6A 4X5VA 3LVWA 3CW2C 1MQ3A 8ICBA 4QW9A 2MU2A 5ALSA 2KFZA 5ALDA 4ELUA 2HHQA 1OW5A 3GIIA 3BS5B 2Y0SC 2PXIA 2FJ6A 2WHEA 3M9OB 4I2AA 7ICJA 1PUZA 4QZIA 1JI7A 3K1RB 4FZLA 2LBOA 5KFXA 3Q8MA 2W03A 3N7PD 4XA5A 3M9NB 4HAIA 1RG6A 4BX9C 2KG5A 2FPLA 2XGQA 2OWOA 4PGYA 2VA2A 4F5NA 1TK8A 2DQNB 4OCZA 2DF4B 2A1AA 2LI6A 1DK2A 5KFEA 4LZGA 5J29A 2L5YA 4DFJA 1Q46A 5EE0A 1KFTA 2WF8A 2ZIUB 1ZQGA 1BNPA 4RUAA 3PV8A 4EZ6A 2EDUA 2J6UA 2H3QA 2NV3A 3OHAA 1UT8A 2OEHA 1T94A 1K1QA 2JH1A 1AQ6A 5JU5A 3PW7A 3WU2U 3UXNA 2KP7A 1ZQBA 4OJOA 3LDAA 2WF9A 3A0HU 1QSLA 1KSPA 8ICLA 5AK6A 2PMZF 5J2JA 1JALA 2AHOB 3PW5A 4O5KA 5KFWA 7ICKA 3PSIA 3U26A 4KX5A 1DGJA 2ASJA 1KL9A 3PX6A 4QIWC 2MUTB 5AKZA 3MGIA 2C2DA 1SZPA 1FIQA 4NLCA 2WF7A 5KFKA 4Q8FA 4KLFA 2HOFA 3GZFA 2FMSA 2J6TA 1WCLA 1JN3A 4YG2A 2MRLA 1Z4NA 1L8OA 1RM6C 3F5EA 8ICIA 3GDXA 2ZG6A 5BOMA 2KIWA 4US8A 4IQTA 2BQRA 2EAPA 3MFHA 1KFDA 5DQGA 1S9FA 5JUMA 1NNLA 3D2QA 3T5KA 4O5CA 1X9SA 4MF2A 5DQIA 5AKLA 1V38A 9ICGA 3ALRA 4Y2XA 5KL1B 3HKZF 1ZOLA 2OM6A 2ZTDA 5KFIA 5IIOA 1MSWD 2BZFA 5AM1A 2LYAA 1XWLA 3NRZA 4FFDA 2W7OA 2K4HA 1TAMA 1ZQPA 4DL7A 4I2FA 4KX3A 5J2EA 2ZIVB 4EBCA 2HHSA 3F2CA 2BDUA 2IOFK 1NK8A 4R64A 4J9OA 1MQ2A 3AN1A 3ZDCA 3RH4A 1ZQVA 2GH1A 4QJFB 1X66A 1TK5A 4FBTA 1HEKA 1PK1B 8ICVA 4CCHA 9ICVA 2PFOA 9ICUA 4F72A 3H0MB 7ICIA 5L1KA 1S76D 5J2FA 2ZUDA 2ASLA 2Y9TA 3PMNA 3LWMA 3KKAA 4IR9A 3OPXA 1QQ7A 1JXEA 5KFZA 4YD1A 2KJ5A 4QW8A 4KITB 3LVVA 4O3PA 4DFKA 2F77X 5DG8A 3PR5B 3HP6A 2HMXA 4RT3A 5KFCA 3KHLA 1NJYA 3F5AA 4FZNA 1N61A 2R8HA 3FC4A 2W11A 4MEYA 2KTQA 1N5WA 4F5PA 4QZGA 3ZDAA 1P7DA 4JV1A 1N60A 4NLNA 3QU7A 2IMWP 1SL1A 2RDIA 3J81j 4C7ZA 2BCQA 4NM1A 1X42A 2QB0A 2K8CB 4AYBC 1NK0A 4M0AA 3ZDDA 3ETLA 4DQQA 2DPIA 5KFRA 1T3QA 4JK1A 4YR0A 3JPPA 4BUGA 2B0CA 2VIXA 4ECYA 3HPOA 1JMSA 3K75D 5KNIA 1TFRA 2ZXIA 2W3SA 3B9JA 2YB1A 3F2DA 4PHAA 3RJHA 2I1QA 1T3NA 4LJXA 4RQMA 1QH9A 3AQEA 2EZXA 4Z6DA 5G5HA 9ICNA 3GIJA 3RAXA 3QE9Y 1NKEA 3RB3A 2W9MA 1MC8A 5ALIA 3JPQA 5ALJA 4M9LA 3JPTA 2ZTEA 5J0SA 5AKGA 3RJEA 4IC9A 4KLSA 3DV9A 3V7KA 4CDGA 3QX7A 3SV4A 4UW9A 5CP2A 5CB1A 2G06A 2DPJA 2KEYA 8ICAA 1U9LA 5HMMA 4YR3A 3FAHA 1SXEA 1KFSA 4DSIA 4DS4A 4UAWA 2KNJA 4P4OA 3ZDBA 4IRKA 5DDYA 4B9MA 2E1EA 4BXOB 4C4RA 1ZETA 3FM9A 1YT3A 2BPCA 1XO0A 3MR6A 4CGZA 3PX0A 3OHBA 1KKXA 1TVAA 2WB1F 1JRPA 4DCCA 5J0RA 2ZUBA 3MR5A 2KKVA 1SKRA 2BGWA 4PJ0U 4QZ9A 3BQ2A 4FS2A 2KN7A 3M8RA 1BGXT 5AKIA 4PGQA 3Q8KA 2W43A 3TAPA 5GTHU 2NRZA 3QNMA 3C28A 1NOMA 5F9NA 3PSFA 5KFQA 3KHHA 3H8MA 2D8CA 3FDSA 4RPZA 1WCNA 3G6XA 1TK0A 5J0TA 4OJPA 3C21A 4YQWA 3ZD9A 1ZQJA 5KT2A 2KOBA 5F9LA 9ICMA 1J2MA 2JZBB 1SXDA 8ICGA 1WWVA 1QTMA 3EWAA 3UM9A 2HHWA 2EZYA 5J0WA 2KFNA 2EQYA 9ICCA 3TFRA 2BCSA 1WG8A 1S0NA 4B9TA 3BS5A 1Q3VA 1L6NA 2C2RA 2OH2A 3UQ2A 2NRXA 3ZI4A 4DQIA 5HMLA 1L3SA 3H0RB 3HKZC 2LPEA 2B21A 5DBCA 4DS5A 3V6KA 1WWUA 5KFDA 4P0PB 2NO5A 8ICNA 4P0QB 3WKAA 2G5IB 1XU4A 3WKCA 5IIIA 1BPEA 2DBYA 3H8JA 5AHXA 5AM3A 2F44A 1KN5A 8ICXA 4Q45A 4J9SA 4DFMA 3OJUA 1NZPA 5EOZA 4RQ1A 4O0IA 2ZIUA 1ZQDA 1ZRMA 1KDHA 4Y2SA 1D9DA 1NJZA 1S97A 4KN7A 3CP8A 2CXYA 2Q4TA 3RB0A 4K4HA 4I2JA 1JX4A 1B22A 5D49A 4C8OA 4ED1A 2NRTA 3KD3A 5IIMA 1N56A 4XRHA 5L1MA 4UARA 1J2NA 7ICGA 4JV0A 3JPOA 3C2LA 5KT3A 2MUTA 5AKYA 3VCBA 5KTQA 5DB9A 5J2GA 1T8EA 4IQWA 5E79U 1UHUA 1U49A 8ICOA 3H8SA 5KT6A 2JR5A 2HVHA 1PVPA 1QQ6A 5DG9A 4UAUA 3TI0A 9ICPA 2KV2A 4OO1J 4E0DA 2NYVA 3QUCA 5CEHA 3IG5A 4F4KA 9ICOA 4GIBA 3ED5A 4DWIA 2LYHA 2VKQA 1IM4A 1A77A 4NV0A 4QZFA 3NTUA 2HBMA 4EX6A 3RAQA 5KAFU 2ZUCA 1KQQA 3WK9A 2XY6A 4EZ9A 3Q8SB 4P4PA 1B0XA 4Y2UA 3H40A 1DGSA 1RQNA 4DFPA 1XSPA 3H7IA 1S0OA 3AL0B 4C8LA 2ISOA 2ZIVA 3OGUA 1M6YA 3KKAC 1HIWA 4KLTA 4M9GA 1U4BA 3G6VA 1ZRNA 1PK1A 5KFGA 4UBCA 1QSSA 4C4TA 4AP9A 2PFQA 1ZQOA 4KTQA 1ZQIA 3NS1A 1SV4A 5KG1A 3V6HA 5B66U 4KMUA 3IG8A 5CR0A 1ZD2P 1ZQZA 5KFOA 2AQ4A 2KHVA 2JEFA 2KJ8A 2RQ5A 5ALMA 2YQEA 2F8LA 3RRHA 3QUTA 2FMQA 3TANA 5AKKA 2HHUA 4PHPA 4GC7A 4MFFA 4RQ2A 2HVIA 4EEYA 3RJKA 2BR0A 4O3RA 5AI5A 5EE3A 1ZQEA 4KLHA 2WF6A 5DBAA 4RUCA 1BPDA 1L7NA 5HP4A 5CHGA 4I2IA 2JEIA 4K4IA 4F93B 1K1SA 5J8YA 5AI0A 3L4PA 1N48A 4JWMA 4PZOA 4KLOA 4KLUA 1KRPA 9ICWA 3T79A 2UVRA 3SQIA 7ICEA 5GTIU 2CRXA 4P2HA 3CYMA 3M9MB 1X6IA 4JB3A 2R8KA 3GQCA 4F50A 4YXJA 5EWEA 5L9XA 2KJ9A 4BGDA 3LWLA 3T5HA 2P66A 5AIAA 1ZQTA 2GWSA 4O3MA 4YFKA 3ONNA 1AROP 3T5LA 2DL0A 1ZQHA 3AEVA 4O5EA 5ALWA 9ICJA
chains in the Genus database with same CATH topology
4QIWC 2M0NA 2HMXA 3ICXA 2JH7A 2ZIUA 1OUQA 2K4EA 2WB1F 2MA1A 3SAFA 2R18A 3F5AA 3N7SC 4FZNA 1MA7A 4NLCA 4FZMA 3K1ZA 3C29A 2LHTA 2KHQA 1A6SA 2G5HB 2OXOA 1ED1A 2HOFA 4CRXA 2KKVA 4NWIA 4U7CA 3GZFA 1P7DA 2JGAA 3LVWA 1ZQ1C 4OJLA 3CP8A 2MRLA 2Q4TA 3IG8A 3F5EA 2N1RA 3L3FX 1Z1BA 3F53A 2KHVA 1XNSA 3IP4B 3KFUF 2HOQA 2K8CB 4P0PA 3C28A 2YB4A 2KD1A 2KJ8A 2ZG6A 3PSFA 4AYBC 3N7RC 4P0QA 3O0FA 2RRDA 2KIWA 2F8LA 4JMUA 2Y0SC 4WJ3B 4U6PA 2F2AB 2G08A 3M7DA 3PSPA 3D2QA 2CN1A 3D2NA 2VJ5A 4GFJA 4OJPA 2G07A 2K8AA 3F2BA 4FZLA 3NRWA 2LBOA 1Z19A 4NLBA 2H3VA 4BUGA 2VIXA 2D6FC 2HBKA 1DRGA 5HR6A 2KOBA 2W03A 2KICA 2KVCA 1PVQA 1F44A 2K89A 3KZXA 1WUDA 3N7PD 3VCBA 3MGVA 2ZXIA 2DGZA 3E0FA 2E1FA 4BX9C 3H0LB 2Z7JA 3ALRA 3RF9A 5C0YA 2ZIWB 3DEEA 4FE3A 5KL1B 2YB1A 3NUQA 2RP5A 3HKZF 3M6KA 2XICA 2PMZC 2OM6A 3SAHA 1PVPA 3F2DA 4KMOB 2W7PA 2W04A 1NZBA 2DQNB 5T14A 2A3VA 2DF4B 2KV2A 2KKPA 1URJA 2ZXHA 2H3ZA 2LYAA 3AQEA 3M6ZA 4QNLA 1KBUA 2W7OA 4OO1J 2K4HA 1TAMA 4OJ5A 2ZIXB 4PL2A 5HR7A 4KX3A 2ZIVB 2WAQF 3IG5A 2CPRA 1UPHA 2OYYA 2LKYA 3F2CA 2BDUA 3RFAA 4C0ZA 4BJQA 2VJ4A 2WB1C 1Q3VA 1L6NA 3IN5A 2XI9A 2OH2A 2YX8A 2GH1A 2K8BB 4QJFB 4PL1A 3T79A 2ZIUB 2RHFA 1HEKA 2VKQA 3SQIA 1SZHA 3CRXA 4IC9A 4NV0A 5CRXA 4QIWF 1IIPA 2HBMA 4CDGA 2F76X 2H3FA 2H3QA 2E5SA 5A0LA 2NV3A 3H0MB 2CRXA 2G0AA 2H3IA 3CYMA 3H0RB 1Q3UA 2XIDA 3HKZC 3LYSA 1T94A 2JH1A 5KL8B 3VC8A 3SAGA 2G06A 2KEYA 2KJ9A 3PSTA 4ICAA 2ZIWA 1D8BA 1CRXA 4OJ6A 2LYBA 2JHDA 4OJOA 4O3MA 1ECWA 3ONNA 2G09A 2XVTA 3SMVA 4P0PB 1A0PA 3GU3A 2HOIA 3D2SA 4P0QB 3OPXA 2WAQC 4ACOA 2PMZF 2G5IB 2KNJA 3AL0B 2K4IA 4AYBF 2ZIXA 2HBLA 4A8EA 2ZIVA 2E1EA 2KJ5A 1PVRA 2GOLA 2Y0SF 3LVVA 3PSIA 2HBJA 4KX5A 1HIWA 2F77X 1GO3F 2JMGA 3AQFA 1YT3A 3PZPA 1XO0A 4CGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JMU A;  2HMX A;  2H3Z A;  2LYA A;  2K4H A;  1TAM A;  2K4E A;  4ICA A;  1UPH A;  2LYB A;  1A6S A;  1ECW A;  2H3V A;  1ED1 A;  1L6N A;  2K4I A;  1HEK A;  2N1R A;  4IC9 A;  2GOL A;  2H3F A;  2H3Q A;  1HIW A;  2NV3 A;  2JMG A;  2H3I A; 
#chains in the Genus database with same CATH topology
 4ECR A;  2HHV A;  3MAB A;  1SB3 C;  2M0N A;  1RPL A;  2JV3 A;  3SAF A;  4UB4 A;  3RRG A;  2R18 A;  9ICI A;  1HUO A;  4Y2P A;  1MA7 A;  2VA3 A;  5FP0 A;  1ZQ1 C;  3BS7 A;  5C5J A;  2F1H A;  2AGQ A;  4F4Y A;  4DOA A;  4F3O A;  1DOQ A;  4R8U B;  1F0M A;  2YML A;  2KVS A;  5KG4 A;  2KZZ A;  3M7D A;  3HIL A;  4BXO A;  4M9J A;  1FEZ A;  3H4D A;  1H38 A;  2FLL A;  1ZXI A;  4BWJ A;  1DRG A;  1WUD A;  4DF8 A;  2DGZ A;  2Z7J A;  5AIB A;  4TQS A;  4EBE A;  5AM5 A;  5KFU A;  5J2A A;  4B9N A;  3K4G A;  2Q0Z X;  4YXM A;  1LVH A;  5KG5 A;  4GXJ A;  4DLE A;  5F3X B;  2WAQ F;  1ZQN A;  4C0Z A;  5L1I A;  3E58 A;  1Y88 A;  2E8O A;  4DL4 A;  5DG7 A;  3N97 B;  3I1Y A;  5DGB A;  5DBB A;  2P6U A;  8ICH A;  3PX4 A;  1XSL A;  2XY7 A;  1VDV A;  2H3F A;  1ZQR A;  3QU9 A;  2JZB A;  1D8B A;  1NI3 A;  2KSO B;  5ALR A;  1PK3 A;  1BPY A;  1FFU A;  1JIH A;  3A0B U;  4QZC A;  5KT5 A;  4DSL A;  5ALZ A;  4QZE A;  3CNH A;  4YN4 A;  2C2E A;  5CJ7 A;  3G6Y A;  4QZ8 A;  2ALZ A;  4C4S A;  5TIS U;  4I29 A;  5KFY A;  4DL5 A;  3B0X A;  4RQ0 A;  4CF3 A;  3AQF A;  2FLP A;  4O3O A;  5KFF A;  2EAM A;  2BPG A;  2HCF A;  2H5X A;  4HYK A;  4QZH A;  4FZM A;  4KLM A;  1CUK A;  2KHQ A;  2BHN A;  2ZJ8 A;  2LMR A;  4CRX A;  2Y9U A;  1VLB A;  7ICV A;  3C2M A;  3UMB A;  3MR3 A;  3L3F X;  2KK0 A;  1ZYQ A;  2HOQ A;  4P0P A;  2YB4 A;  4P0Q A;  3O0F A;  4ECS A;  2AGP A;  1SL2 A;  1ZD4 A;  4DSE A;  5ALX A;  3RJI A;  9ICT A;  1SIJ A;  1V85 A;  3PW0 A;  3D2N A;  4GFJ A;  4NLB A;  1KTQ A;  3IHQ B;  1RXW A;  1SWW A;  3RB6 A;  3KZX A;  3EYZ A;  3MGV A;  2PFN A;  3RR8 A;  3DEE A;  4GXK A;  3NUQ A;  1N5X A;  3M6K A;  2XIC A;  2E8P A;  2R8I A;  1RXV A;  4KLL A;  2ZXH A;  5IIJ A;  3HJE A;  3AM9 A;  2A1J B;  4QZA A;  1IV8 A;  2OYY A;  3MBY A;  4BJQ A;  4RQ4 A;  5G5G A;  4IRD A;  2W9B A;  3C5F A;  3L5K A;  2W9C B;  2M9N A;  4NL9 C;  4RNN A;  4QWD A;  4QWB A;  4JWN A;  2F76 X;  9ICK A;  3PVX A;  2H3I A;  4PHD A;  3N28 A;  5KG0 A;  3PO5 A;  3H8W A;  3VC8 A;  3OJS A;  2JRZ A;  3TQ1 A;  3T5J A;  2EAO A;  1L7M A;  4B9V A;  4YP3 A;  1A0P A;  5L1L A;  1NK7 A;  3IRU A;  4C80 A;  2AQ0 A;  3ISB A;  1LV5 A;  4DFD A;  3PML A;  3QZ7 A;  1F5S A;  2IHN A;  4RNM A;  4RPY A;  2IBK A;  3SYZ A;  4DQS A;  1Z1V A;  2MA1 A;  5D46 A;  5KT7 A;  3QZ8 A;  3K1Z A;  8ICZ A;  5KFM A;  3AU6 A;  3ZDE A;  2YN4 A;  2J6S A;  1SV0 A;  5EWG A;  3RJF A;  3TAQ A;  2B6G A;  4M47 A;  4QWA A;  1K5O A;  3OSP A;  1KW4 A;  5B5E U;  5TZV A;  4UQG A;  1X40 A;  5DB7 A;  5EE9 A;  2YY6 A;  5ALF A;  5HR6 A;  4BDP A;  1ZQW A;  2XGP A;  4I27 A;  4JUZ A;  4FE3 A;  2RP5 A;  2PMZ C;  3MDC A;  4TUR A;  5IIN A;  4NXZ A;  1SKW A;  3C2K A;  2WF5 A;  2GO7 A;  1L3T A;  3GV5 B;  3KZI U;  2XC9 A;  3WK6 A;  1RYR A;  2EAN A;  7ICO A;  2LM4 A;  4PH5 A;  3V6J A;  2XI9 A;  8ICF A;  1NK4 A;  4EYI B;  4IR1 A;  1BVS A;  3PNC A;  7ICM A;  3RTV A;  1IIP A;  1Z4O A;  1SWV A;  5AK5 A;  5A0L A;  2EH9 A;  1WYG A;  3IDW A;  4CE6 A;  5J2I A;  4QZD A;  3RJG A;  3PR4 A;  1ZQY A;  3QUQ A;  1YZ6 A;  5HHI A;  1RZT A;  2UVW A;  2JHD A;  4ED2 A;  2WAQ C;  2HBL A;  3IM1 A;  4UAZ A;  5DLF A;  4TUQ A;  3ISC A;  3S6J A;  3RB4 A;  4ELV A;  2E8M A;  4TUP A;  4KLE A;  2F1I A;  4UAS A;  5L1J A;  4F5Q A;  4F71 A;  4UAY A;  4J9M A;  4R63 A;  1OUQ A;  3MGH A;  2LHT A;  1L7P A;  2G5H B;  1T4G A;  3AU2 A;  3Q8R B;  3KTQ A;  1XSN A;  4XQ8 A;  9ICX A;  2FLN A;  1ZD5 A;  4J9K A;  1Z1B A;  4CF4 A;  3IP4 B;  4RQ6 A;  5DDM A;  4MFC A;  2G08 A;  4ED8 A;  5EWF A;  4KLJ A;  5ALL A;  1X2I A;  4UB6 U;  2A19 A;  3R9K A;  4YVZ A;  2P35 A;  5K4L A;  3V72 A;  5ALE A;  4GC6 A;  3PW4 A;  5ALU A;  4UB2 A;  9ICQ A;  2KKP A;  5H2F U;  4PL2 A;  5CA7 A;  5J2K A;  5KFH A;  4M9N A;  4Q43 A;  3QYP A;  2BCV A;  4R8U A;  4C8K A;  5ALP A;  5HHH A;  2BDP A;  1JUD A;  3PY8 A;  4MHV A;  4KN4 A;  4F91 B;  2KZM A;  1DXS A;  1LB2 B;  4EX7 A;  3QU5 A;  4DSK A;  5KFL A;  3AMZ A;  2DUY A;  2VAN A;  1QQ5 A;  2AU0 A;  3BDP A;  5EE1 A;  2BCR A;  2ISP A;  2JH7 A;  2K4E A;  4DF4 A;  4NY8 A;  4UB3 A;  9ICB A;  1MN8 A;  3EPG A;  1COO A;  2JXJ A;  4IRC A;  3TAR A;  3FYH A;  1JRO A;  2HSZ A;  4OJL A;  3PO4 A;  3EZ5 A;  2KSO A;  3T3F A;  1V9P A;  2KD1 A;  3N7R C;  2AGO A;  1T7P A;  1YZ7 A;  3OSN A;  4U6P A;  2ASD A;  3QUB A;  4KLI A;  1Z19 A;  2ODG A;  4ECU A;  2HBK A;  1ZQQ A;  3ORY A;  3RBD A;  3GV7 B;  4LVS A;  3SAH A;  2W7P A;  4DSJ A;  3N4M B;  2IA6 A;  2H3Z A;  1ZQS A;  1CI4 A;  3EW9 A;  1ZD3 A;  4O3N A;  5HR7 A;  4Q8E A;  2CPR A;  1U47 A;  2LKY A;  1DK3 A;  3RFA A;  2R8J A;  2WB1 C;  3Q8L A;  4NJ8 A;  2K8B B;  3THV A;  4RQ5 A;  1SZH A;  5KG7 A;  4FO6 A;  5HNK A;  5KAI U;  3Q8P B;  1ZQM A;  3NVY A;  2EZZ A;  1UA0 A;  5ALV A;  4US9 A;  4FS1 A;  5J2B A;  1XS9 D;  4A8E A;  2A1J A;  1KEJ A;  4DO9 A;  1UT5 A;  1BNO A;  1Z00 B;  3GV8 B;  2W9C A;  4RT2 A;  1L3V A;  5KFV A;  5KFT A;  3RBE A;  3N7S C;  2YMQ A;  2DKZ A;  2YMP A;  2HW3 A;  1A6S A;  4DQP A;  1HJP A;  2I6X A;  4U7C A;  2NRV A;  4O3Q A;  5DLG A;  9ICL A;  5BPC A;  4ED0 A;  4ECV A;  4R66 A;  3TAC B;  4Y2V A;  2NO4 A;  3PSP A;  2W8L A;  4Q44 A;  1X6J A;  7ICQ A;  1SV0 C;  2D6F C;  2H3V A;  4NLG A;  3OTQ A;  3WK8 A;  1F44 A;  3NVW A;  4K4G A;  4F2R A;  5KFA A;  4F2S A;  4C7Y A;  4YMM A;  2PKE A;  2ZIW B;  2P6R A;  1IG6 A;  2YTU A;  4F4X A;  4MF8 A;  3DDH A;  4QNL A;  1U45 A;  5KG3 A;  4F5R A;  2ZIX B;  3MC1 A;  1UCV A;  1UPH A;  4NLZ A;  5ALT A;  1KLN A;  3ETR A;  2W9A A;  3IN5 A;  1PZN A;  2K4P A;  4RNO A;  1J97 A;  4PL1 A;  3Q8Q B;  4ZOH C;  4GXI A;  4EYH B;  3HX0 A;  3WKB A;  4ED7 A;  4BWM A;  2E5S A;  3V7L A;  1COK A;  3QU2 A;  2DWQ A;  2XID A;  1ZQK A;  4UAT A;  3SAG A;  2RDJ A;  1ZQU A;  2AXT U;  3SZ2 A;  3WK7 A;  1D8Y A;  5KFP A;  3BZK A;  2PFP A;  5J0O A;  4O3S A;  5DQH A;  4ACO A;  1S77 D;  1ZQA A;  3BQ7 A;  2NRW A;  1L8L A;  2GOL A;  4C8N A;  5ALQ A;  2HHX A;  1BPB A;  2O6K A;  5J0P A;  8ICC A;  3AUO A;  1L3U A;  3ZD8 A;  4F5O A;  3IV6 A;  3C1Y A;  3UXO A;  5AKX A;  4R65 A;  4M6W B;  3UMC A;  2W3R A;  1ZQL A;  5KG6 A;  1RDF A;  5J0Y A;  2FDR A;  4RU9 A;  3HT3 A;  4NLK A;  2VA8 A;  5AI8 A;  1XNS A;  4ECX A;  4MFA A;  5DB8 A;  3BQT A;  4J9P A;  1UQV A;  2RRD A;  1L5U A;  3UMG A;  2IOF A;  4RQ7 A;  4QWE A;  2LM1 A;  4YR2 A;  3F2B A;  9ICE A;  2E8N A;  2C28 A;  2XY5 A;  1Q8K A;  3E0F A;  2E1F A;  3RF9 A;  5C0Y A;  1S10 A;  1QCK A;  5KFB A;  5AKE A;  3MR2 A;  3TAD A;  2OCE A;  8ICU A;  4B6J A;  8ICR A;  1NK9 A;  1B43 A;  1C7Y A;  4RQN A;  4JV2 A;  4LZD A;  1N2X A;  4QZB A;  2QAR B;  1ZJM A;  3QU4 A;  2MAX A;  1LKY B;  3H4B A;  4YMO A;  8ICQ A;  4UAV A;  4ZH4 A;  4M04 A;  4RPX A;  4NM2 A;  3KBB A;  5AIC A;  5ALY A;  4IQV A;  2XO7 A;  2WTF A;  1X9M A;  3PST A;  3GFK B;  3KOO A;  4PPX A;  3BZC A;  3UXP A;  3B0Y A;  4IQU A;  3EPI A;  1ZQC A;  2MSN A;  3QEA Z;  2Y1I A;  7ICN A;  5DKW A;  4ECQ A;  5BOL A;  3QXG A;  2FMP A;  2ESE A;  3WK4 A;  2DFL A;  2IHM A;  4IS7 A;  3RR7 A;  2UVV A;  2QLT A;  1CEZ A;  2KE7 A;  4DL6 A;  3M8S A;  8ICK A;  4YMN A;  3M1Y A;  4NWI A;  1SL0 A;  5KG2 A;  1RYS A;  1BPZ A;  2JGA A;  2R8G A;  3GIL A;  8ICW A;  1NKC A;  1N62 A;  4Y2Y A;  3WK5 A;  4EEK A;  4DL3 A;  1RQL A;  2N1R A;  2XCA A;  5AI4 A;  1JXL A;  7ICF A;  1SKS A;  3LK9 A;  3NAS A;  1QSY A;  5ALN A;  4JMU A;  1NKB A;  2HDO A;  2HI0 A;  2AJQ A;  2PI5 A;  4F92 B;  2RLT A;  2FPK A;  5DGA A;  2KVC A;  2V4R A;  2ZJ5 A;  1PVQ A;  1Z3E B;  5J2D A;  1S5L U;  5J2C A;  4MEX A;  4RQ8 A;  3SD7 A;  1VJ5 A;  5DB6 A;  1IXR A;  2BKE A;  1TKD A;  4KMO B;  1XC9 A;  9ICH A;  2BCU A;  1NZB A;  2FI1 A;  2D3D A;  3JPN A;  1URJ A;  8ICE A;  9ICF A;  3M6Z A;  1A76 A;  1S0V A;  4CF5 A;  1S8O A;  4UB8 U;  4OJ5 A;  5AI9 A;  4TUS A;  2ZTC A;  2V4Q A;  3GIK A;  5J0Q A;  1NK5 A;  8ICM A;  2I5H A;  2VJ4 A;  3SV3 A;  2F1J A;  1L7O A;  3V7J A;  1TE2 A;  4J9R A;  2V9W A;  5AM0 A;  1NK6 A;  2F8K A;  2BQ3 A;  2RHF A;  3CRX A;  1V97 A;  4B9U A;  4B9L A;  3EUB 2;  2Y1J A;  2G0A A;  2YMM A;  4Y2Q A;  3LYS A;  4FBU A;  4CNQ A;  2BPF A;  4PHE A;  3SMV A;  2IOH A;  1HUZ A;  3D2S A;  2HOI A;  4I2D A;  5AM4 A;  3I76 A;  1TV9 A;  1N63 A;  1O08 A;  2K4I A;  4C8M A;  2AH5 A;  5AKJ A;  2Y0S F;  5J8Y C;  1X9X A;  5J0U A;  1QLN A;  7ICH A;  2HBJ A;  5AKH A;  5ALO A;  1GO3 F;  3WKD A;  4OD0 A;  4DEZ A;  3UQ0 A;  4Z6F A;  4DL2 A;  4I2C A;  4Y2R A;  1ZJN A;  3C29 A;  1ZQX A;  1S0M A;  1UA1 A;  2W8K A;  9ICR A;  5KFN A;  3C23 A;  2E3T A;  3NVV A;  2FE9 A;  4Z6E A;  1D8L A;  2KZ3 A;  4UB5 A;  5ALG A;  3HW8 A;  2QB1 A;  2JEG A;  1BPX A;  2ZJA A;  5ALK A;  3MFI A;  2FPM A;  5ALH A;  4J9L A;  2VJ5 A;  2G07 A;  2BQU A;  4EBD A;  4F4W A;  1RYU A;  3HWT A;  4TQR A;  1Z00 A;  3TKA A;  3UPQ A;  3MDA A;  2ATL A;  7ICS A;  4UB1 A;  3H0L B;  3SI8 A;  1SGG A;  3BQ0 A;  1ZQF A;  4P4M A;  3C1Z A;  4F8R A;  4ECZ A;  1KBU A;  5IIK A;  4DLG A;  7ICU A;  5KT4 A;  4ED3 A;  2UVU A;  4F4Z A;  1O03 A;  4EEN A;  3KHR A;  7ICP A;  5CRX A;  4QIW F;  1OXJ A;  3C5G A;  2WFA A;  9ICA A;  2QKQ A;  4I2B A;  3SR6 A;  3E2E A;  5KFJ A;  2ZIW A;  4RQ3 A;  2KMD A;  4OJ6 A;  2QB0 B;  3PW2 A;  1ECW A;  2G09 A;  2XVT A;  3JPR A;  3BJY A;  4RZR A;  2JEJ A;  5JTI A;  3SEN A;  9ICS A;  2ZIX A;  4J9Q A;  7ICL A;  8ICY A;  3NVZ A;  1PVR A;  2W54 A;  5D4B A;  3PZP A;  1NJW A;  2W9B B;  2W55 A;  2F3N A;  5AI6 A;  4B9S A;  4KLG A;  2I9G A;  2KIV A;  3TFS A;  4I28 A;  4IL6 U;  3ISD A;  1ED1 A;  1NJX A;  4YD2 A;  3SEI A;  4XUS A;  8ICP A;  8ICJ A;  4USA A;  3F53 A;  3KFU F;  2K60 A;  3WKE A;  5AM2 A;  4I2E A;  4I2H A;  4NL9 A;  2C22 A;  2F2A B;  4KLQ A;  2DKX A;  2CN1 A;  2K8A A;  3NRW A;  4ELT A;  4YCX A;  2KIC A;  5IIL A;  2K89 A;  1B4F A;  3KHG A;  2W04 A;  3HRD D;  2GLE A;  5T14 A;  4M6W A;  2A3V A;  5KFS A;  8ICT A;  1TAQ A;  2XCP A;  3BQ1 A;  4DOB A;  4PGX A;  1C20 A;  2ES6 A;  1FFV A;  2HHT A;  4G3I A;  3I28 A;  4GLX A;  4DQR A;  8ICS A;  3TAD C;  4DOC A;  2YX8 A;  4G9B A;  4M2Y A;  4J03 A;  4QWC A;  4PZN A;  3D6J A;  4KLD A;  3QEB Z;  7ICR A;  2OHF A;  1XO1 A;  1Q3U A;  4Y2J A;  5KL8 B;  4J9N A;  4ICA A;  4I2G A;  4EEL A;  4DSF A;  1CRX A;  1D9F A;  2LYB A;  4Y2T A;  5J0X A;  4ECT A;  3GU3 A;  3RH6 A;  1EXN A;  3JPS A;  4AYB F;  3GIM A;  4O9M A;  7ICT A;  1TAU A;  5CWR A;  3RJJ A;  1X9W A;  1FO4 A;  2JMG A;  5AK3 A;  2QAR A;  5JRT A;  4WJ3 B;  4ECW A;  3ICX A;  1LKY A;  4Z6C A;  5AK4 A;  2PI4 A;  4M9H A;  5J2H A;  1U48 A;  2OXO A;  4UBB A;  3NGD A;  3RH5 A;  4ED6 A;  4X5V A;  3LVW A;  3CW2 C;  1MQ3 A;  8ICB A;  4QW9 A;  2MU2 A;  5ALS A;  2KFZ A;  5ALD A;  4ELU A;  2HHQ A;  1OW5 A;  3GII A;  3BS5 B;  2Y0S C;  2PXI A;  2FJ6 A;  2WHE A;  3M9O B;  4I2A A;  7ICJ A;  1PUZ A;  4QZI A;  1JI7 A;  3K1R B;  4FZL A;  2LBO A;  5KFX A;  3Q8M A;  2W03 A;  3N7P D;  4XA5 A;  3M9N B;  4HAI A;  1RG6 A;  4BX9 C;  2KG5 A;  2FPL A;  2XGQ A;  2OWO A;  4PGY A;  2VA2 A;  4F5N A;  1TK8 A;  2DQN B;  4OCZ A;  2DF4 B;  2A1A A;  2LI6 A;  1DK2 A;  5KFE A;  4LZG A;  5J29 A;  2L5Y A;  4DFJ A;  1Q46 A;  5EE0 A;  1KFT A;  2WF8 A;  2ZIU B;  1ZQG A;  1BNP A;  4RUA A;  3PV8 A;  4EZ6 A;  2EDU A;  2J6U A;  2H3Q A;  2NV3 A;  3OHA A;  1UT8 A;  2OEH A;  1T94 A;  1K1Q A;  2JH1 A;  1AQ6 A;  5JU5 A;  3PW7 A;  3WU2 U;  3UXN A;  2KP7 A;  1ZQB A;  4OJO A;  3LDA A;  2WF9 A;  3A0H U;  1QSL A;  1KSP A;  8ICL A;  5AK6 A;  2PMZ F;  5J2J A;  1JAL A;  2AHO B;  3PW5 A;  4O5K A;  5KFW A;  7ICK A;  3PSI A;  3U26 A;  4KX5 A;  1DGJ A;  2ASJ A;  1KL9 A;  3PX6 A;  4QIW C;  2MUT B;  5AKZ A;  3MGI A;  2C2D A;  1SZP A;  1FIQ A;  4NLC A;  2WF7 A;  5KFK A;  4Q8F A;  4KLF A;  2HOF A;  3GZF A;  2FMS A;  2J6T A;  1WCL A;  1JN3 A;  4YG2 A;  2MRL A;  1Z4N A;  1L8O A;  1RM6 C;  3F5E A;  8ICI A;  3GDX A;  2ZG6 A;  5BOM A;  2KIW A;  4US8 A;  4IQT A;  2BQR A;  2EAP A;  3MFH A;  1KFD A;  5DQG A;  1S9F A;  5JUM A;  1NNL A;  3D2Q A;  3T5K A;  4O5C A;  1X9S A;  4MF2 A;  5DQI A;  5AKL A;  1V38 A;  9ICG A;  3ALR A;  4Y2X A;  5KL1 B;  3HKZ F;  1ZOL A;  2OM6 A;  2ZTD A;  5KFI A;  5IIO A;  1MSW D;  2BZF A;  5AM1 A;  2LYA A;  1XWL A;  3NRZ A;  4FFD A;  2W7O A;  2K4H A;  1TAM A;  1ZQP A;  4DL7 A;  4I2F A;  4KX3 A;  5J2E A;  2ZIV B;  4EBC A;  2HHS A;  3F2C A;  2BDU A;  2IOF K;  1NK8 A;  4R64 A;  4J9O A;  1MQ2 A;  3AN1 A;  3ZDC A;  3RH4 A;  1ZQV A;  2GH1 A;  4QJF B;  1X66 A;  1TK5 A;  4FBT A;  1HEK A;  1PK1 B;  8ICV A;  4CCH A;  9ICV A;  2PFO A;  9ICU A;  4F72 A;  3H0M B;  7ICI A;  5L1K A;  1S76 D;  5J2F A;  2ZUD A;  2ASL A;  2Y9T A;  3PMN A;  3LWM A;  3KKA A;  4IR9 A;  3OPX A;  1QQ7 A;  1JXE A;  5KFZ A;  4YD1 A;  2KJ5 A;  4QW8 A;  4KIT B;  3LVV A;  4O3P A;  4DFK A;  2F77 X;  5DG8 A;  3PR5 B;  3HP6 A;  2HMX A;  4RT3 A;  5KFC A;  3KHL A;  1NJY A;  3F5A A;  4FZN A;  1N61 A;  2R8H A;  3FC4 A;  2W11 A;  4MEY A;  2KTQ A;  1N5W A;  4F5P A;  4QZG A;  3ZDA A;  1P7D A;  4JV1 A;  1N60 A;  4NLN A;  3QU7 A;  2IMW P;  1SL1 A;  2RDI A;  3J81 j;  4C7Z A;  2BCQ A;  4NM1 A;  1X42 A;  2QB0 A;  2K8C B;  4AYB C;  1NK0 A;  4M0A A;  3ZDD A;  3ETL A;  4DQQ A;  2DPI A;  5KFR A;  1T3Q A;  4JK1 A;  4YR0 A;  3JPP A;  4BUG A;  2B0C A;  2VIX A;  4ECY A;  3HPO A;  1JMS A;  3K75 D;  5KNI A;  1TFR A;  2ZXI A;  2W3S A;  3B9J A;  2YB1 A;  3F2D A;  4PHA A;  3RJH A;  2I1Q A;  1T3N A;  4LJX A;  4RQM A;  1QH9 A;  3AQE A;  2EZX A;  4Z6D A;  5G5H A;  9ICN A;  3GIJ A;  3RAX A;  3QE9 Y;  1NKE A;  3RB3 A;  2W9M A;  1MC8 A;  5ALI A;  3JPQ A;  5ALJ A;  4M9L A;  3JPT A;  2ZTE A;  5J0S A;  5AKG A;  3RJE A;  4IC9 A;  4KLS A;  3DV9 A;  3V7K A;  4CDG A;  3QX7 A;  3SV4 A;  4UW9 A;  5CP2 A;  5CB1 A;  2G06 A;  2DPJ A;  2KEY A;  8ICA A;  1U9L A;  5HMM A;  4YR3 A;  3FAH A;  1SXE A;  1KFS A;  4DSI A;  4DS4 A;  4UAW A;  2KNJ A;  4P4O A;  3ZDB A;  4IRK A;  5DDY A;  4B9M A;  2E1E A;  4BXO B;  4C4R A;  1ZET A;  3FM9 A;  1YT3 A;  2BPC A;  1XO0 A;  3MR6 A;  4CGZ A;  3PX0 A;  3OHB A;  1KKX A;  1TVA A;  2WB1 F;  1JRP A;  4DCC A;  5J0R A;  2ZUB A;  3MR5 A;  2KKV A;  1SKR A;  2BGW A;  4PJ0 U;  4QZ9 A;  3BQ2 A;  4FS2 A;  2KN7 A;  3M8R A;  1BGX T;  5AKI A;  4PGQ A;  3Q8K A;  2W43 A;  3TAP A;  5GTH U;  2NRZ A;  3QNM A;  3C28 A;  1NOM A;  5F9N A;  3PSF A;  5KFQ A;  3KHH A;  3H8M A;  2D8C A;  3FDS A;  4RPZ A;  1WCN A;  3G6X A;  1TK0 A;  5J0T A;  4OJP A;  3C21 A;  4YQW A;  3ZD9 A;  1ZQJ A;  5KT2 A;  2KOB A;  5F9L A;  9ICM A;  1J2M A;  2JZB B;  1SXD A;  8ICG A;  1WWV A;  1QTM A;  3EWA A;  3UM9 A;  2HHW A;  2EZY A;  5J0W A;  2KFN A;  2EQY A;  9ICC A;  3TFR A;  2BCS A;  1WG8 A;  1S0N A;  4B9T A;  3BS5 A;  1Q3V A;  1L6N A;  2C2R A;  2OH2 A;  3UQ2 A;  2NRX A;  3ZI4 A;  4DQI A;  5HML A;  1L3S A;  3H0R B;  3HKZ C;  2LPE A;  2B21 A;  5DBC A;  4DS5 A;  3V6K A;  1WWU A;  5KFD A;  4P0P B;  2NO5 A;  8ICN A;  4P0Q B;  3WKA A;  2G5I B;  1XU4 A;  3WKC A;  5III A;  1BPE A;  2DBY A;  3H8J A;  5AHX A;  5AM3 A;  2F44 A;  1KN5 A;  8ICX A;  4Q45 A;  4J9S A;  4DFM A;  3OJU A;  1NZP A;  5EOZ A;  4RQ1 A;  4O0I A;  2ZIU A;  1ZQD A;  1ZRM A;  1KDH A;  4Y2S A;  1D9D A;  1NJZ A;  1S97 A;  4KN7 A;  3CP8 A;  2CXY A;  2Q4T A;  3RB0 A;  4K4H A;  4I2J A;  1JX4 A;  1B22 A;  5D49 A;  4C8O A;  4ED1 A;  2NRT A;  3KD3 A;  5IIM A;  1N56 A;  4XRH A;  5L1M A;  4UAR A;  1J2N A;  7ICG A;  4JV0 A;  3JPO A;  3C2L A;  5KT3 A;  2MUT A;  5AKY A;  3VCB A;  5KTQ A;  5DB9 A;  5J2G A;  1T8E A;  4IQW A;  5E79 U;  1UHU A;  1U49 A;  8ICO A;  3H8S A;  5KT6 A;  2JR5 A;  2HVH A;  1PVP A;  1QQ6 A;  5DG9 A;  4UAU A;  3TI0 A;  9ICP A;  2KV2 A;  4OO1 J;  4E0D A;  2NYV A;  3QUC A;  5CEH A;  3IG5 A;  4F4K A;  9ICO A;  4GIB A;  3ED5 A;  4DWI A;  2LYH A;  2VKQ A;  1IM4 A;  1A77 A;  4NV0 A;  4QZF A;  3NTU A;  2HBM A;  4EX6 A;  3RAQ A;  5KAF U;  2ZUC A;  1KQQ A;  3WK9 A;  2XY6 A;  4EZ9 A;  3Q8S B;  4P4P A;  1B0X A;  4Y2U A;  3H40 A;  1DGS A;  1RQN A;  4DFP A;  1XSP A;  3H7I A;  1S0O A;  3AL0 B;  4C8L A;  2ISO A;  2ZIV A;  3OGU A;  1M6Y A;  3KKA C;  1HIW A;  4KLT A;  4M9G A;  1U4B A;  3G6V A;  1ZRN A;  1PK1 A;  5KFG A;  4UBC A;  1QSS A;  4C4T A;  4AP9 A;  2PFQ A;  1ZQO A;  4KTQ A;  1ZQI A;  3NS1 A;  1SV4 A;  5KG1 A;  3V6H A;  5B66 U;  4KMU A;  3IG8 A;  5CR0 A;  1ZD2 P;  1ZQZ A;  5KFO A;  2AQ4 A;  2KHV A;  2JEF A;  2KJ8 A;  2RQ5 A;  5ALM A;  2YQE A;  2F8L A;  3RRH A;  3QUT A;  2FMQ A;  3TAN A;  5AKK A;  2HHU A;  4PHP A;  4GC7 A;  4MFF A;  4RQ2 A;  2HVI A;  4EEY A;  3RJK A;  2BR0 A;  4O3R A;  5AI5 A;  5EE3 A;  1ZQE A;  4KLH A;  2WF6 A;  5DBA A;  4RUC A;  1BPD A;  1L7N A;  5HP4 A;  5CHG A;  4I2I A;  2JEI A;  4K4I A;  4F93 B;  1K1S A;  5J8Y A;  5AI0 A;  3L4P A;  1N48 A;  4JWM A;  4PZO A;  4KLO A;  4KLU A;  1KRP A;  9ICW A;  3T79 A;  2UVR A;  3SQI A;  7ICE A;  5GTI U;  2CRX A;  4P2H A;  3CYM A;  3M9M B;  1X6I A;  4JB3 A;  2R8K A;  3GQC A;  4F50 A;  4YXJ A;  5EWE A;  5L9X A;  2KJ9 A;  4BGD A;  3LWL A;  3T5H A;  2P66 A;  5AIA A;  1ZQT A;  2GWS A;  4O3M A;  4YFK A;  3ONN A;  1ARO P;  3T5L A;  2DL0 A;  1ZQH A;  3AEV A;  4O5E A;  5ALW A;  9ICJ A; 
#chains in the Genus database with same CATH homology
 4QIW C;  2M0N A;  2HMX A;  3ICX A;  2JH7 A;  2ZIU A;  1OUQ A;  2K4E A;  2WB1 F;  2MA1 A;  3SAF A;  2R18 A;  3F5A A;  3N7S C;  4FZN A;  1MA7 A;  4NLC A;  4FZM A;  3K1Z A;  3C29 A;  2LHT A;  2KHQ A;  1A6S A;  2G5H B;  2OXO A;  1ED1 A;  2HOF A;  4CRX A;  2KKV A;  4NWI A;  4U7C A;  3GZF A;  1P7D A;  2JGA A;  3LVW A;  1ZQ1 C;  4OJL A;  3CP8 A;  2MRL A;  2Q4T A;  3IG8 A;  3F5E A;  2N1R A;  3L3F X;  1Z1B A;  3F53 A;  2KHV A;  1XNS A;  3IP4 B;  3KFU F;  2HOQ A;  2K8C B;  4P0P A;  3C28 A;  2YB4 A;  2KD1 A;  2KJ8 A;  2ZG6 A;  3PSF A;  4AYB C;  3N7R C;  4P0Q A;  3O0F A;  2RRD A;  2KIW A;  2F8L A;  4JMU A;  2Y0S C;  4WJ3 B;  4U6P A;  2F2A B;  2G08 A;  3M7D A;  3PSP A;  3D2Q A;  2CN1 A;  3D2N A;  2VJ5 A;  4GFJ A;  4OJP A;  2G07 A;  2K8A A;  3F2B A;  4FZL A;  3NRW A;  2LBO A;  1Z19 A;  4NLB A;  2H3V A;  4BUG A;  2VIX A;  2D6F C;  2HBK A;  1DRG A;  5HR6 A;  2KOB A;  2W03 A;  2KIC A;  2KVC A;  1PVQ A;  1F44 A;  2K89 A;  3KZX A;  1WUD A;  3N7P D;  3VCB A;  3MGV A;  2ZXI A;  2DGZ A;  3E0F A;  2E1F A;  4BX9 C;  3H0L B;  2Z7J A;  3ALR A;  3RF9 A;  5C0Y A;  2ZIW B;  3DEE A;  4FE3 A;  5KL1 B;  2YB1 A;  3NUQ A;  2RP5 A;  3HKZ F;  3M6K A;  2XIC A;  2PMZ C;  2OM6 A;  3SAH A;  1PVP A;  3F2D A;  4KMO B;  2W7P A;  2W04 A;  1NZB A;  2DQN B;  5T14 A;  2A3V A;  2DF4 B;  2KV2 A;  2KKP A;  1URJ A;  2ZXH A;  2H3Z A;  2LYA A;  3AQE A;  3M6Z A;  4QNL A;  1KBU A;  2W7O A;  4OO1 J;  2K4H A;  1TAM A;  4OJ5 A;  2ZIX B;  4PL2 A;  5HR7 A;  4KX3 A;  2ZIV B;  2WAQ F;  3IG5 A;  2CPR A;  1UPH A;  2OYY A;  2LKY A;  3F2C A;  2BDU A;  3RFA A;  4C0Z A;  4BJQ A;  2VJ4 A;  2WB1 C;  1Q3V A;  1L6N A;  3IN5 A;  2XI9 A;  2OH2 A;  2YX8 A;  2GH1 A;  2K8B B;  4QJF B;  4PL1 A;  3T79 A;  2ZIU B;  2RHF A;  1HEK A;  2VKQ A;  3SQI A;  1SZH A;  3CRX A;  4IC9 A;  4NV0 A;  5CRX A;  4QIW F;  1IIP A;  2HBM A;  4CDG A;  2F76 X;  2H3F A;  2H3Q A;  2E5S A;  5A0L A;  2NV3 A;  3H0M B;  2CRX A;  2G0A A;  2H3I A;  3CYM A;  3H0R B;  1Q3U A;  2XID A;  3HKZ C;  3LYS A;  1T94 A;  2JH1 A;  5KL8 B;  3VC8 A;  3SAG A;  2G06 A;  2KEY A;  2KJ9 A;  3PST A;  4ICA A;  2ZIW A;  1D8B A;  1CRX A;  4OJ6 A;  2LYB A;  2JHD A;  4OJO A;  4O3M A;  1ECW A;  3ONN A;  2G09 A;  2XVT A;  3SMV A;  4P0P B;  1A0P A;  3GU3 A;  2HOI A;  3D2S A;  4P0Q B;  3OPX A;  2WAQ C;  4ACO A;  2PMZ F;  2G5I B;  2KNJ A;  3AL0 B;  2K4I A;  4AYB F;  2ZIX A;  2HBL A;  4A8E A;  2ZIV A;  2E1E A;  2KJ5 A;  1PVR A;  2GOL A;  2Y0S F;  3LVV A;  3PSI A;  2HBJ A;  4KX5 A;  1HIW A;  2F77 X;  1GO3 F;  2JMG A;  3AQF A;  1YT3 A;  3PZP A;  1XO0 A;  4CGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...