1ECWA

Crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 293k.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
b'SVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Crystal structure of SIV matrix antigen and implications for virus assembly.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 38
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1ecwA00
2GOLA 2H3QA 2LYBA 1HEKA 2JMGA 2LYAA 2H3ZA 1ECWA 1A6SA 1UPHA 2K4IA 2HMXA 1L6NA 2N1RA 4IC9A 2K4HA 4ICAA 1HIWA 1TAMA 2K4EA 2H3VA 2NV3A 2H3IA 1ED1A 4JMUA 2H3FA
chains in the Genus database with same CATH superfamily
4Y2TA 5T14A 2XI9A 3BQ2A 1IM4A 3KBBA 5KFFA 9ICAA 1ZJMA 3RH5A 2KIWA 1QTMA 1S97A 4GXKA 3AQFA 1U48A 2BPGA 4UARA 7ICFA 3V6HA 1ZQJA 3JPNA 1L8OA 2XY5A 2PI4A 3U26A 4EELA 3C2MA 4F5OA 4F3OA 4GLXA 4O3SA 5KG2A 4KLEA 5KFEA 1SGGA 4TUQA 5KFLA 2W9BB 4I2JA 8ICIA 3D2QA 3PO5A 3BS5A 2YB4A 4DQSA 3F2BA 2KSOA 2OHFA 4IQUA 4K4HA 4DL3A 2FLPA 5CA7A 2IOFA 4CF3A 1V38A 4QNLA 4WJ3B 2KD1A 1NOMA 1X42A 3H4BA 7ICGA 7ICEA 4M0AA 2KNJA 5FP0A 3QU2A 1Z1VA 1TFRA 5AKZA 4P0QB 2WAQF 2NRTA 5ALXA 1ZD4A 2RRDA 8ICJA 3KKAC 2IBKA 1S5LU 4NL9A 4R8UB 3ISBA 4B6JA 4Y2SA 1ZQZA 1NZBA 2KOBA 1HEKA 5KG4A 2M9NA 4NY8A 1ZD2P 5J2CA 4DLGA 2YMQA 2W7OA 4OD0A 2E8PA 2ATLA 4O3MA 3M6KA 4UB6U 2RHFA 4QWDA 1F0MA 3RF9A 3A0BU 5ALOA 4F93B 2HBJA 4AP9A 2R8GA 4BXOA 4DSKA 5G5GA 2J6UA 3UXNA 4I2BA 2EZXA 5BOLA 3JPQA 5AM3A 4KLLA 4EZ9A 9ICLA 3M7DA 1VLBA 4B9VA 4IRCA 4XA5A 4DOAA 2RQ5A 4UAVA 4M6WA 1L7PA 1BPBA 1PK3A 1L5UA 3V6JA 3AQEA 4DWIA 7ICTA 3ALRA 1ZQLA 2HMXA 1ZQVA 5F9NA 1DOQA 1TK8A 2EAOA 9ICKA 1KFTA 5J2JA 4C0ZA 1D8LA 5AK5A 4IR1A 4PHAA 5J0YA 1WYGA 5CHGA 3AEVA 8ICAA 1DXSA 4OJLA 3B9JA 3ZD9A 4PGQA 2K8AA 9ICMA 3TFRA 1Y88A 2RP5A 9ICSA 2KKPA 5DB6A 4QZ9A 3C2KA 4B9LA 4F8RA 3CRXA 4DQRA 5KAFU 5D4BA 1CUKA 1X40A 4M9GA 1FEZA 4F2RA 1RQLA 2D3DA 4NLGA 3KHHA 3K75D 1ZETA 4C8MA 3NUQA 3RJIA 3NVWA 5J2DA 3RBDA 3M1YA 2HHXA 1PZNA 3PVXA 2R8HA 3NASA 4F4XA 4QWBA 3DDHA 5KFYA 4NJ8A 2KHQA 3C1ZA 5DB8A 1LV5A 2HBKA 5AI0A 2MSNA 4U6PA 1N63A 4EX6A 1BPEA 3Q8KA 3ICXA 2MAXA 2P66A 5AHXA 1XO0A 1NK6A 1FO4A 2KJ9A 1L3SA 1TAMA 2HSZA 4JB3A 2ASLA 4NXZA 2D6FC 2F44A 4P4PA 3QUCA 3UQ0A 4Q8EA 4RQNA 3T5KA 2ZIXA 1TK0A 4E0DA 2CPRA 2JEJA 4EBEA 2EAPA 5KFXA 4RQ7A 2AQ4A 3B0XA 1XSLA 9ICCA 2BHNA 1HUZA 4RQ2A 2HCFA 2DBYA 2DGZA 4C8LA 4Y2XA 3E58A 2W8KA 3M9MB 3ETLA 8ICKA 2BCRA 4JWNA 3QX7A 5J2FA 3LVVA 1T3NA 4UW9A 4PHPA 2B6GA 1C20A 3PW5A 2Y0SF 5KT6A 4QJFB 1N62A 3MDAA 7ICNA 3T79A 5DG9A 5KFJA 1ZQOA 2H3QA 3BZKA 3GQCA 4KLUA 4FZLA 3JPOA 3PR4A 5DKWA 4F4WA 2N1RA 2AGQA 4KLFA 3TADC 2OWOA 5J29A 5AKXA 2MUTB 4EYHB 4TQSA 4YFKA 4QIWC 1LVHA 2K4PA 2YN4A 4J9NA 2WF9A 4QZIA 3SZ2A 3SAFA 9ICFA 1TVAA 3SMVA 3V7JA 2ISOA 5JU5A 3RJKA 4ECTA 3SV4A 3J81j 9ICBA 3SV3A 2A1JA 2XVTA 4BDPA 1T94A 2ZG6A 2H3VA 1NJWA 3OSPA 4B9NA 1KKXA 3N7RC 1ZRNA 1NJXA 2KJ5A 5HR7A 3UXOA 3TKAA 3GV5B 4F5QA 1UPHA 5H2FU 3HW8A 4UB8U 1TE2A 3NVVA 3UM9A 3OHAA 3MR6A 5EWFA 4JK1A 2GLEA 1QSLA 1ZQGA 3C1YA 5C5JA 3QUQA 1Q3UA 4O9MA 4O3OA 4PPXA 5ALYA 5J0SA 1Z00B 3R9KA 2KFZA 1WUDA 1B0XA 5KL8B 1ECWA 2QB0A 1TK5A 1N5XA 4XUSA 1Q3VA 4IQTA 2AGPA 4CGZA 1L7OA 9ICIA 1RPLA 3VC8A 4RUAA 4F4ZA 1KW4A 1MSWD 2WF5A 2BQUA 2QB1A 2WFAA 9ICGA 2W9MA 1U49A 1U4BA 4ED8A 5EE1A 1TV9A 5KFCA 4UAWA 4OJOA 3QU7A 7ICVA 2R8JA 5L9XA 4OJ5A 4A8EA 5DG7A 4JWMA 3L5KA 3ZDAA 1ED1A 5KG5A 4EZ6A 3F53A 1ZXIA 4RQ6A 5KTQA 2W9CA 1X66A 3KHGA 1X2IA 5BPCA 8ICLA 2HHWA 4QZ8A 1RYSA 1BNPA 1CI4A 5CEHA 4UB2A 5HP4A 1ZQRA 1LKYA 2I6XA 2YMLA 3QE9Y 5ALDA 1M6YA 3UMGA 1KL9A 5AI4A 3ZDCA 7ICIA 2JMGA 2BCVA 4XRHA 3N97B 1YZ7A 3SAHA 4R66A 2DQNB 1WWUA 1WWVA 5KT5A 4G3IA 1QCKA 3H40A 2WTFA 2W9BA 3RB6A 2W8LA 5J0QA 2UVVA 2I1QA 2G5IB 4GFJA 4CE6A 4Z6EA 1DRGA 1SZPA 3GIMA 5DQGA 5J2HA 2NRVA 4DF4A 4Z6FA 2ZXIA 3C28A 5EOZA 5L1JA 2G5HB 4OCZA 1XSNA 2WAQC 2ZJ5A 4PJ0U 2WF7A 4P0QA 2XIDA 2AU0A 2B0CA 5AK6A 2RLTA 3BQ7A 3OJSA 2ASJA 1F5SA 4DOBA 2XCAA 4TUSA 2LYBA 4MEXA 3QUTA 1S0VA 5ALUA 5JUMA 5ALEA 1YZ6A 5DBBA 1A76A 3UQ2A 4MFAA 1GO3F 1F44A 3JPPA 1U45A 2CXYA 1K5OA 2BQRA 1NJZA 8ICOA 4QWAA 1NKCA 4Q45A 4C7ZA 5DB7A 2W03A 2FPKA 2LYAA 3QZ7A 4C8OA 4ELTA 5ALLA 8ICWA 1RXWA 3L3FX 1FFUA 4B9UA 3GZFA 5KFMA 2AQ0A 2VJ5A 2G06A 4P0PB 1QSSA 3H7IA 3AU6A 2A19A 3E2EA 3PMNA 3TFSA 4I2CA 4Y2UA 5ALZA 4F5RA 2F77X 5AKGA 5J2EA 1SKWA 1UCVA 4KLSA 1QQ6A 3CNHA 4DFDA 3PSTA 4USAA 5ALTA 1SIJA 5KG3A 1IIPA 4GXJA 5ALJA 1QSYA 3RRGA 3UPQA 2PFNA 1U47A 3PSPA 1PUZA 5KT4A 2QLTA 1RXVA 3AMZA 3IN5A 4UASA 2YMMA 1B22A 4DS5A 4M9HA 2ZIUB 5IIKA 5J8YC 4IL6U 4NLBA 4RQ5A 2E8OA 1COOA 2F1IA 4J9QA 4ECWA 3AN1A 5JTIA 5KFDA 2PI5A 4NM1A 2C2RA 9ICPA 3LDAA 2OCEA 3GFKB 5A0LA 2E1EA 1X9XA 4ZOHC 2W3SA 4LZGA 3DV9A 5D49A 2EDUA 4FZNA 4NL9C 3IDWA 4UQGA 2LHTA 3BDPA 9ICJA 4JV1A 2DF4B 7ICOA 4ED7A 1NK4A 2LYHA 3AM9A 5KFTA 1NNLA 2OEHA 5KFZA 5ALFA 4X5VA 3RTVA 1RYUA 5EWGA 4M2YA 4EENA 1N48A 4B9TA 4G9BA 2ZIWB 1FIQA 2DUYA 4KX3A 4RPZA 2F1JA 7ICLA 5AKLA 5F3XB 1JMSA 8ICHA 4YMOA 1TKDA 4MFCA 4O3NA 2JEFA 2DFLA 2NRZA 4C80A 5ALKA 5DLFA 4DFKA 4FZMA 2V4RA 3G6YA 5CP2A 3CW2C 1LB2B 1KFDA 2HVHA 1Z3EB 2KZMA 5KFUA 9ICVA 4IS7A 4YR2A 2FMPA 3MC1A 3DEEA 2XCPA 1HIWA 4DSFA 8ICZA 9ICTA 1N61A 1RG6A 4J03A 5F9LA 4RQ8A 3SQIA 2F76X 2JEIA 1AROP 5AI6A 4ZH4A 3PV8A 2KMDA 4FBTA 2FMSA 3MGHA 4CCHA 5IIIA 2UVUA 2MU2A 4I2GA 2AJQA 3F5EA 1MQ3A 1P7DA 3NVYA 2Y0SC 4KLQA 4HYKA 5J0XA 4DF8A 4Z6DA 8ICMA 3LYSA 2B21A 2XY6A 5IIJA 3SENA 3ZDEA 4ECVA 3OGUA 2KKVA 1EXNA 1NI3A 5B5EU 3WK7A 2JRZA 1S0NA 3THVA 5TISU 5DDYA 5ALIA 3HX0A 2MUTA 4QZAA 3QU9A 4PZOA 2W11A 4RPXA 2W54A 2LBOA 3ZI4A 3HP6A 1YT3A 2HBLA 5AKIA 1S0OA 5G5HA 2KIVA 4PH5A 3C29A 1DGJA 4F50A 2A1AA 2K8BB 1ZJNA 3V7LA 2W7PA 1ZQQA 2KSOB 9ICNA 3BQ1A 1JI7A 3N7PD 2C28A 4EBDA 1SXDA 3KZXA 3I76A 4OJPA 5HMMA 8ICUA 3PR5B 2AHOB 2PFPA 2L5YA 2ALZA 5IIOA 3EPGA 2NO4A 4K4IA 3RRHA 2M0NA 2ZTEA 3UXPA 3RFAA 5KFBA 4YD1A 2E8NA 3GILA 3H8WA 5CRXA 1VJ5A 2H3FA 2KVSA 1UT8A 1XS9D 3RAQA 4MF8A 5KT3A 1N56A 4P4OA 4ACOA 1Z19A 5HHHA 2GWSA 4NLKA 2DPJA 2FPMA 4KX5A 5AKJA 4Q43A 4EBCA 1OXJA 3IRUA 2EZZA 2BKEA 5KFSA 4I2EA 1KDHA 1ZD3A 3K1RB 5AM5A 4RQ1A 3E0FA 1COKA 3QYPA 2Q4TA 4KLMA 1D8YA 2CRXA 1N60A 3RJEA 8ICXA 3GIKA 8ICBA 4KMOB 4ELUA 4BUGA 2KZZA 3T5LA 3S6JA 4YQWA 5GTIU 1D9FA 2PFOA 3I1YA 3C2LA 2FJ6A 2G0AA 4JV0A 3WKBA 1S9FA 3EZ5A 3F2DA 3LVWA 3WK5A 5DLGA 3M9OB 3TANA 4GXIA 4DS4A 5KFKA 5TZVA 3MGIA 2WB1F 3GU3A 5AIAA 2PKEA 2FMQA 2HHSA 3A0HU 4KTQA 4Y2YA 4RQ0A 4ECUA 3RB4A 4M9LA 4DFJA 8ICCA 4CDGA 4EYIB 4IQVA 3WK9A 2NO5A 2BCUA 5L1LA 2KVCA 1J2MA 3K4GA 2DKZA 1NK5A 1NK7A 3HKZF 7ICHA 2Y1JA 1URJA 2NYVA 2BR0A 2LPEA 2AGOA 1WCNA 9ICQA 5HMLA 3TADA 3T5HA 2C2EA 4F71A 9ICXA 1SV0A 5AI9A 2W43A 3HRDD 1ZQTA 1ZQAA 1L3TA 3B0YA 2WF6A 4ED1A 2BDUA 2W3RA 4P4MA 4TURA 1XWLA 2Z7JA 2P6RA 4BGDA 4R63A 2ZUCA 3Q8PB 4C7YA 2XY7A 1UA1A 5IILA 4RU9A 4PHDA 4UB5A 3Q8RB 1OUQA 5AM0A 4UATA 1L7MA 4P2HA 2VKQA 3D6JA 3ETRA 1KQQA 1ZQFA 2O6KA 1J97A 4B9SA 2VJ4A 1ZQYA 3PSIA 2E5SA 3ZDDA 1TAUA 1ZQDA 4ED0A 1S10A 4QZBA 4NV0A 3RB3A 4MHVA 4DFPA 4M9JA 2R18A 1JIHA 1T3QA 5CJ7A 2ZIVB 4P0PA 1O08A 3RH4A 3G6VA 2HOQA 2JGAA 3G6XA 9ICEA 3NRWA 3M8SA 4PGYA 4MEYA 1ZQWA 4QZGA 4RQ4A 4YXMA 4J9RA 1N5WA 4MF2A 2CN1A 4F92B 3NVZA 4UBCA 5DGBA 2KFNA 7ICSA 2OXOA 5C0YA 2IOFK 3ONNA 1ZQEA 4QZHA 2KZ3A 3EYZA 2WHEA 3ZDBA 1X6JA 1D9DA 1SKSA 3T3FA 8ICEA 4HAIA 7ICRA 3WKCA 2ZJ8A 4YR3A 1ZQKA 1ZQNA 2XGQA 3N4MB 3GIIA 2K89A 2ZIUA 2P35A 4DL2A 2IHMA 2GH1A 4J9OA 2JZBB 2BCSA 2JV3A 5CWRA 1ZQPA 1KBUA 3OJUA 3EWAA 1PVRA 2NV3A 4BWMA 3NGDA 1XSPA 3IHQB 4Y2RA 2HHUA 5L1KA 3QU4A 3PMLA 5AM2A 2YMPA 1X9MA 4EX7A 2W9AA 2KHVA 4FE3A 5KFVA 2JEGA 2FLNA 1JXEA 4QW9A 3WU2U 2A1JB 3M9NB 1QH9A 4RT2A 3H8MA 4QZFA 4R8UA 1IXRA 2KICA 3AU2A 4KN7A 5AKYA 2BCQA 4PL1A 3D2NA 5KG1A 3C21A 4I2DA 4QZEA 4CF4A 2ZIWA 3QEBZ 1MA7A 2HHTA 4YMMA 1Z4NA 2XICA 4I2FA 2KP7A 2HOIA 1SL2A 7ICQA 3RB0A 3KFUF 3WKEA 2VA2A 2EQYA 3WKAA 1Q8KA 3BJYA 4J9PA 4J9MA 3NTUA 4RPYA 3QXGA 2GOLA 4YP3A 2AH5A 1ZQ1C 5ALWA 5HR6A 1A6SA 3NS1A 4O3QA 1CRXA 4ED2A 4QZCA 2XO7A 3PW0A 1ZQMA 2DL0A 2EH9A 2JR5A 1FFVA 5J0TA 3OTQA 1RZTA 3MABA 2KK0A 2W04A 5KFWA 5AK4A 1PVPA 3TARA 3I28A 1MC8A 4PL2A 4F72A 4F2SA 4PGXA 1NKBA 3MR2A 4DSIA 4BX9C 8ICVA 4DQIA 4TUPA 4YD2A 3H8JA 5AI5A 1RM6C 3RJHA 3HPOA 2XGPA 4UB1A 4BWJA 3JPSA 2W9CB 2ODGA 4UB3A 3CP8A 3SYZA 3PX4A 1KLNA 3MFIA 4NLZA 1IG6A 1PK1B 1SL1A 5DDMA 2K4HA 1KSPA 3IG5A 1ZOLA 3MDCA 2ZUBA 4IR9A 5AKHA 1LKYB 4DL7A 2VA3A 3M6ZA 4QW8A 1S76D 4CRXA 1RQNA 2QARB 4DSEA 1AQ6A 3Q8SB 3EPIA 2UVWA 5K4LA 3WK4A 1ZYQA 2EANA 3GV8B 1V97A 2BQ3A 1CEZA 5DQIA 2LM1A 4C8NA 3LK9A 5KFGA 2IMWP 5J8YA 3Q8MA 7ICJA 3M8RA 2H3IA 3HT3A 7ICUA 1Z4OA 1N2XA 2LM4A 3RH6A 3SAGA 5CR0A 3F2CA 3MR3A 1SWVA 4GIBA 5HHIA 4O5EA 4DL6A 3N7SC 5KG6A 4Q44A 2H5XA 1DK3A 3TAQA 1C7YA 3WK6A 3JPTA 9ICWA 7ICMA 3KKAA 2ASDA 3FDSA 5KFIA 3V7KA 1BPYA 3FC4A 2ZTDA 4F4YA 3JPRA 2I9GA 4YVZA 3RJFA 3V6KA 1V9PA 5ALHA 4O3PA 4OJ6A 5ALNA 4QWCA 2ISPA 3SEIA 3IV6A 5J0PA 4LJXA 4ECRA 4RQ3A 4YXJA 4O5CA 2KN7A 3PX0A 4RQMA 1U9LA 1XU4A 2VANA 5J2GA 1S0MA 5DBCA 8ICFA 2F8LA 4ICAA 4Y2QA 4JUZA 4KLIA 2C22A 5ALGA 4I2HA 3T5JA 4EEKA 4KLDA 3SD7A 4UAZA 2FE9A 3QEAZ 4ECYA 1UA0A 3RBEA 3ZD8A 2KJ8A 4O5KA 1ZQUA 2J6SA 1KTQA 1XO1A 5CB1A 1SV4A 3FYHA 4RNOA 2WB1C 4FO6A 4F4KA 4F5NA 2DWQA 2NRWA 2Y9TA 3H0MB 3PW7A 3QU5A 1L8LA 2JXJA 1A0PA 1JALA 3H8SA 9ICHA 1X9SA 3KD3A 4KITB 5L1IA 2LMRA 4ECQA 3F5AA 5DBAA 7ICKA 8ICGA 3LWLA 2BPFA 4IRKA 3AUOA 1HUOA 4UBBA 1SWWA 2IHNA 4NM2A 3HKZC 3PY8A 4J9LA 3SR6A 5KFNA 1BNOA 3L4PA 2DKXA 2FI1A 3BZCA 3BS5B 3MR5A 2OM6A 4R64A 2HBMA 5AKKA 2ES6A 1OW5A 4YMNA 4F91B 5HNKA 2KG5A 1BGXT 5GTHU 5ALRA 3GV7B 3RJGA 2PFQA 4NLNA 3UMBA 5ALSA 3D2SA 4M47A 2HDOA 3FAHA 1L6NA 3PX6A 4B9MA 2YX8A 9ICOA 2I5HA 3IP4B 1H38A 3QUBA 3GIJA 5AI8A 4GC6A 1JX4A 3BQTA 3HILA 4CNQA 2YQEA 4TQRA 5EE3A 4DEZA 4FS1A 4RNNA 4YG2A 3MBYA 3NRZA 1Z00A 2Y1IA 4J9SA 1UT5A 2WF8A 4KN4A 4M9NA 2C2DA 2F8KA 1MQ2A 2OYYA 2MRLA 2BGWA 1BVSA 4PZNA 1D8BA 3KHRA 2E3TA 4BXOB 5ALPA 3PO4A 1JROA 3OSNA 4MFFA 5J0UA 4KLOA 2K4IA 2V4QA 4KLJA 5AIBA 3UMCA 3EW9A 2JHDA 5AKEA 1SB3C 2F3NA 5KNIA 5J2AA 2GO7A 2ZIVA 4DLEA 5ALMA 4M6WB 2FDRA 4US9A 4FS2A 2OH2A 2KV2A 4NWIA 4ELVA 1S77D 2PMZC 4UB4A 3ORYA 1V85A 2K4EA 5AK3A 1SL0A 3QZ8A 2R8KA 5KFPA 2R8IA 1NK0A 2HHQA 4C8KA 3N28A 4LVSA 2HW3A 5KT2A 3QNMA 5BOMA 5DG8A 5J2IA 5B66U 5KG7A 4DFMA 1PVQA 2ZTCA 2D8CA 2YY6A 1ZQHA 4ED6A 2YB1A 3C5GA 1ZQIA 2W55A 2LKYA 4DSJA 4DO9A 8ICRA 4YCXA 4KMUA 2JZBA 1SV0C 1J2NA 4DSLA 1ZRMA 7ICPA 4Q8FA 3H0RB 2V9WA 5KFRA 3KOOA 3MGVA 4DQPA 3PW4A 3AL0B 3IM1A 4CF5A 4KLTA 4I2IA 3TAPA 2PXIA 4IQWA 3TI0A 2ZXHA 1QQ5A 1ZQXA 3TQ1A 5J0OA 4ECSA 4Z6CA 3PZPA 2VA8A 4FFDA 2UVRA 1Z1BA 3PNCA 5E79U 4F5PA 1JRPA 4JMUA 2K60A 5KT7A 3C5FA 4AYBC 1SXEA 3BS7A 5JRTA 4RNMA 3MFHA 1DGSA 2MA1A 2F1HA 5J0RA 2BPCA 2EZYA 5KFAA 4RZRA 2XC9A 4DL5A 1ZQBA 4ED3A 5IINA 4J9KA 1MN8A 1TAQA 3OHBA 1L3VA 1SZHA 2QKQA 5IIMA 2ZIXB 5J2KA 4QZDA 1QQ7A 3ISDA 5AM4A 2IA6A 4C4SA 2HHVA 8ICSA 4ECZA 2E1FA 4DCCA 3O0FA 2KTQA 1T7PA 2KEYA 5DGAA 1JN3A 2J6TA 3HJEA 8ICTA 5D46A 3H4DA 1X6IA 1XNSA 4PHEA 4EEYA 5DQHA 5DB9A 2YTUA 4ECXA 4LZDA 1JUDA 1KRPA 2HVIA 1JXLA 2G07A 3C23A 4YN4A 4U7CA 1X9WA 9ICUA 4Y2JA 3VCBA 2PMZF 1S8OA 1ZQCA 1KN5A 4UAUA 4GC7A 3KTQA 1K1SA 4UAYA 1L7NA 5KL1B 9ICRA 4O3RA 4O0IA 3RR8A 1T8EA 1KEJA 4IRDA 3GDXA 8ICQA 4M04A 2K8CB 1L3UA 2IOHA 2EAMA 1PK1A 4IC9A 5J0WA 2FPLA 2AXTU 1UHUA 2Q0ZX 3KZIU 4DL4A 2BZFA 4C4TA 2E8MA 5KAIU 2QARA 3Q8LA 4QIWF 2FLLA 1HJPA 3CYMA 1A77A 3HWTA 1UQVA 1VDVA 2H3ZA 4XQ8A 2LI6A 2A3VA 3RR7A 5AM1A 4I29A 1RYRA 4JV2A 4DQQA 1WCLA 2BDPA 1WG8A 4RT3A 2RDJA 2G09A 1SKRA 1NZPA 3TACB 3BQ0A 5EE0A 4C4RA 3WKDA 2JH1A 4KLHA 2ZUDA 5J2BA 4AYBF 2HOFA 4Y2VA 4K4GA 5KFHA 4OO1J 2F2AB 1NJYA 1QLNA 5ALVA 1IV8A 2JH7A 3H0LB 1NK8A 4YR0A 5AICA 5KG0A 1B43A 3PW2A 1DK2A 1BPXA 4QWEA 2QB0B 3WK8A 2ESEA 3V72A 4US8A 3KHLA 1XC9A 1O03A 3FM9A 1Q46A 1K1QA 1BPZA 3K1ZA 1T4GA 8ICNA 2NRXA 5ALQA 8ICPA 5KFQA 8ICYA 4KLGA 2G08A 2Y9UA 1B4FA 3EUB2 5L1MA 5EE9A 2VIXA 4I2AA 1RDFA 3ED5A 3PSFA 2RDIA 3RJJA 5EWEA 2ZJAA 2HI0A 4I27A 1NKEA 3Q8QB 4R65A 2KE7A 3OPXA 3IG8A 3LWMA 4Y2PA 1BPDA 4RUCA 1ZQSA 3SI8A 4DOCA 4NLCA 1KFSA 5KFOA 1ZD5A 2P6UA 3ISCA 3RAXA 1NK9A 4BJQA 4FBUA 2DPIA 4I28A
chains in the Genus database with same CATH topology
3F53A 4QIWF 2G0AA 3PSIA 2E5SA 2HBLA 2W03A 3SAFA 3CYMA 4AYBC 2XI9A 5T14A 4U6PA 4PL1A 3D2NA 3ICXA 3SMVA 2LYAA 3F2DA 2H3ZA 3LVWA 3C29A 2ZIWA 2ZIWB 1XO0A 2A3VA 2K4IA 2KIWA 1MA7A 2MA1A 3AQFA 2KJ9A 4KX3A 4NV0A 2XICA 2WB1C 1TAMA 2R18A 2K8BB 2JHDA 3L3FX 2HOIA 3M7DA 3GZFA 2XVTA 3KFUF 2D6FC 2WB1F 3GU3A 2W7PA 1T94A 2ZG6A 2H3VA 3H0MB 2VJ5A 2ZIVA 2ZIVB 4P0PA 2G06A 4P0PB 1A0PA 2H3IA 4FZMA 3N7RC 2HOQA 1SZHA 2KJ5A 2ZIXA 2ZIXB 5HR7A 3F5AA 2JGAA 2G09A 2GOLA 3N7PD 3KZXA 1ZQ1C 3NRWA 2CPRA 2JMGA 4OJPA 3AQEA 5HR6A 2OH2A 1A6SA 2JH1A 2KV2A 1UPHA 3ALRA 4NWIA 3SAHA 2E1FA 2F77X 2DQNB 2HMXA 2PMZC 3O0FA 4CDGA 2KEYA 1CRXA 2CN1A 3HKZC 4AYBF 3F2CA 3DEEA 2OXOA 2HOFA 1HIWA 2K4EA 3PSTA 5C0YA 3ONNA 4OO1J 2F2AB 2KVCA 2M0NA 3D2QA 1IIPA 3HKZF 4C0ZA 3RFAA 3N7SC 2W04A 4GFJA 2G5IB 2OM6A 2YB4A 3SQIA 2HBMA 1URJA 1DRGA 3PSPA 2F76X 1Q3UA 2JH7A 3H0LB 2DGZA 5CRXA 3F2BA 4OJLA 1PVPA 1XNSA 2H3FA 3IN5A 2K8AA 4QNLA 2ZXIA 2RP5A 2KD1A 2KKPA 3C28A 4WJ3B 1WUDA 5KL8B 1PVQA 1ECWA 2K89A 2ZIUA 2ZIUB 2G5HB 4PL2A 4ACOA 4NLBA 1Z19A 3D2SA 2WAQC 3F5EA 2G07A 2YB1A 3LVVA 4KX5A 4U7CA 1P7DA 4BX9C 2LKYA 2YX8A 1Q3VA 2GH1A 2KNJA 2Y0SC 3IP4B 4CGZA 3CRXA 4P0QA 4P0QB 2WAQF 3VCBA 2PMZF 1KBUA 2XIDA 2RRDA 3K1ZA 1PVRA 2NV3A 2Y0SF 2BDUA 3H0RB 4QJFB 3LYSA 2G08A 4OJ6A 3VC8A 5A0LA 2E1EA 5KL1B 3E0FA 3MGVA 2Q4TA 2Z7JA 3T79A 2CRXA 2H3QA 3CP8A 1NZBA 2KOBA 2LYBA 1HEKA 2VIXA 3AL0B 2KKVA 4FZNA 3NUQA 3PSFA 4KMOB 2K8CB 4BUGA 2LHTA 2KHVA 4FE3A 4FZLA 1L6NA 2N1RA 4IC9A 4OJOA 2DF4B 2F8LA 2K4HA 4ICAA 2ZXHA 3IG5A 2W7OA 1OUQA 3OPXA 3IG8A 1GO3F 3PZPA 2OYYA 2MRLA 1F44A 4O3MA 2VKQA 2KHQA 1Z1BA 3M6KA 2LBOA 4QIWC 2RHFA 4NLCA 4OJ5A 4A8EA 2HBKA 3SAGA 2KICA 3M6ZA 3RF9A 4BJQA 1YT3A 1ED1A 4JMUA 2HBJA 4CRXA 1D8BA 2VJ4A 2KJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOL A;  2H3Q A;  2LYB A;  1HEK A;  2JMG A;  2LYA A;  2H3Z A;  1ECW A;  1A6S A;  1UPH A;  2K4I A;  2HMX A;  1L6N A;  2N1R A;  4IC9 A;  2K4H A;  4ICA A;  1HIW A;  1TAM A;  2K4E A;  2H3V A;  2NV3 A;  2H3I A;  1ED1 A;  4JMU A;  2H3F A; 
#chains in the Genus database with same CATH topology
 4Y2T A;  5T14 A;  2XI9 A;  3BQ2 A;  1IM4 A;  3KBB A;  5KFF A;  9ICA A;  1ZJM A;  3RH5 A;  2KIW A;  1QTM A;  1S97 A;  4GXK A;  3AQF A;  1U48 A;  2BPG A;  4UAR A;  7ICF A;  3V6H A;  1ZQJ A;  3JPN A;  1L8O A;  2XY5 A;  2PI4 A;  3U26 A;  4EEL A;  3C2M A;  4F5O A;  4F3O A;  4GLX A;  4O3S A;  5KG2 A;  4KLE A;  5KFE A;  1SGG A;  4TUQ A;  5KFL A;  2W9B B;  4I2J A;  8ICI A;  3D2Q A;  3PO5 A;  3BS5 A;  2YB4 A;  4DQS A;  3F2B A;  2KSO A;  2OHF A;  4IQU A;  4K4H A;  4DL3 A;  2FLP A;  5CA7 A;  2IOF A;  4CF3 A;  1V38 A;  4QNL A;  4WJ3 B;  2KD1 A;  1NOM A;  1X42 A;  3H4B A;  7ICG A;  7ICE A;  4M0A A;  2KNJ A;  5FP0 A;  3QU2 A;  1Z1V A;  1TFR A;  5AKZ A;  4P0Q B;  2WAQ F;  2NRT A;  5ALX A;  1ZD4 A;  2RRD A;  8ICJ A;  3KKA C;  2IBK A;  1S5L U;  4NL9 A;  4R8U B;  3ISB A;  4B6J A;  4Y2S A;  1ZQZ A;  1NZB A;  2KOB A;  1HEK A;  5KG4 A;  2M9N A;  4NY8 A;  1ZD2 P;  5J2C A;  4DLG A;  2YMQ A;  2W7O A;  4OD0 A;  2E8P A;  2ATL A;  4O3M A;  3M6K A;  4UB6 U;  2RHF A;  4QWD A;  1F0M A;  3RF9 A;  3A0B U;  5ALO A;  4F93 B;  2HBJ A;  4AP9 A;  2R8G A;  4BXO A;  4DSK A;  5G5G A;  2J6U A;  3UXN A;  4I2B A;  2EZX A;  5BOL A;  3JPQ A;  5AM3 A;  4KLL A;  4EZ9 A;  9ICL A;  3M7D A;  1VLB A;  4B9V A;  4IRC A;  4XA5 A;  4DOA A;  2RQ5 A;  4UAV A;  4M6W A;  1L7P A;  1BPB A;  1PK3 A;  1L5U A;  3V6J A;  3AQE A;  4DWI A;  7ICT A;  3ALR A;  1ZQL A;  2HMX A;  1ZQV A;  5F9N A;  1DOQ A;  1TK8 A;  2EAO A;  9ICK A;  1KFT A;  5J2J A;  4C0Z A;  1D8L A;  5AK5 A;  4IR1 A;  4PHA A;  5J0Y A;  1WYG A;  5CHG A;  3AEV A;  8ICA A;  1DXS A;  4OJL A;  3B9J A;  3ZD9 A;  4PGQ A;  2K8A A;  9ICM A;  3TFR A;  1Y88 A;  2RP5 A;  9ICS A;  2KKP A;  5DB6 A;  4QZ9 A;  3C2K A;  4B9L A;  4F8R A;  3CRX A;  4DQR A;  5KAF U;  5D4B A;  1CUK A;  1X40 A;  4M9G A;  1FEZ A;  4F2R A;  1RQL A;  2D3D A;  4NLG A;  3KHH A;  3K75 D;  1ZET A;  4C8M A;  3NUQ A;  3RJI A;  3NVW A;  5J2D A;  3RBD A;  3M1Y A;  2HHX A;  1PZN A;  3PVX A;  2R8H A;  3NAS A;  4F4X A;  4QWB A;  3DDH A;  5KFY A;  4NJ8 A;  2KHQ A;  3C1Z A;  5DB8 A;  1LV5 A;  2HBK A;  5AI0 A;  2MSN A;  4U6P A;  1N63 A;  4EX6 A;  1BPE A;  3Q8K A;  3ICX A;  2MAX A;  2P66 A;  5AHX A;  1XO0 A;  1NK6 A;  1FO4 A;  2KJ9 A;  1L3S A;  1TAM A;  2HSZ A;  4JB3 A;  2ASL A;  4NXZ A;  2D6F C;  2F44 A;  4P4P A;  3QUC A;  3UQ0 A;  4Q8E A;  4RQN A;  3T5K A;  2ZIX A;  1TK0 A;  4E0D A;  2CPR A;  2JEJ A;  4EBE A;  2EAP A;  5KFX A;  4RQ7 A;  2AQ4 A;  3B0X A;  1XSL A;  9ICC A;  2BHN A;  1HUZ A;  4RQ2 A;  2HCF A;  2DBY A;  2DGZ A;  4C8L A;  4Y2X A;  3E58 A;  2W8K A;  3M9M B;  3ETL A;  8ICK A;  2BCR A;  4JWN A;  3QX7 A;  5J2F A;  3LVV A;  1T3N A;  4UW9 A;  4PHP A;  2B6G A;  1C20 A;  3PW5 A;  2Y0S F;  5KT6 A;  4QJF B;  1N62 A;  3MDA A;  7ICN A;  3T79 A;  5DG9 A;  5KFJ A;  1ZQO A;  2H3Q A;  3BZK A;  3GQC A;  4KLU A;  4FZL A;  3JPO A;  3PR4 A;  5DKW A;  4F4W A;  2N1R A;  2AGQ A;  4KLF A;  3TAD C;  2OWO A;  5J29 A;  5AKX A;  2MUT B;  4EYH B;  4TQS A;  4YFK A;  4QIW C;  1LVH A;  2K4P A;  2YN4 A;  4J9N A;  2WF9 A;  4QZI A;  3SZ2 A;  3SAF A;  9ICF A;  1TVA A;  3SMV A;  3V7J A;  2ISO A;  5JU5 A;  3RJK A;  4ECT A;  3SV4 A;  3J81 j;  9ICB A;  3SV3 A;  2A1J A;  2XVT A;  4BDP A;  1T94 A;  2ZG6 A;  2H3V A;  1NJW A;  3OSP A;  4B9N A;  1KKX A;  3N7R C;  1ZRN A;  1NJX A;  2KJ5 A;  5HR7 A;  3UXO A;  3TKA A;  3GV5 B;  4F5Q A;  1UPH A;  5H2F U;  3HW8 A;  4UB8 U;  1TE2 A;  3NVV A;  3UM9 A;  3OHA A;  3MR6 A;  5EWF A;  4JK1 A;  2GLE A;  1QSL A;  1ZQG A;  3C1Y A;  5C5J A;  3QUQ A;  1Q3U A;  4O9M A;  4O3O A;  4PPX A;  5ALY A;  5J0S A;  1Z00 B;  3R9K A;  2KFZ A;  1WUD A;  1B0X A;  5KL8 B;  1ECW A;  2QB0 A;  1TK5 A;  1N5X A;  4XUS A;  1Q3V A;  4IQT A;  2AGP A;  4CGZ A;  1L7O A;  9ICI A;  1RPL A;  3VC8 A;  4RUA A;  4F4Z A;  1KW4 A;  1MSW D;  2WF5 A;  2BQU A;  2QB1 A;  2WFA A;  9ICG A;  2W9M A;  1U49 A;  1U4B A;  4ED8 A;  5EE1 A;  1TV9 A;  5KFC A;  4UAW A;  4OJO A;  3QU7 A;  7ICV A;  2R8J A;  5L9X A;  4OJ5 A;  4A8E A;  5DG7 A;  4JWM A;  3L5K A;  3ZDA A;  1ED1 A;  5KG5 A;  4EZ6 A;  3F53 A;  1ZXI A;  4RQ6 A;  5KTQ A;  2W9C A;  1X66 A;  3KHG A;  1X2I A;  5BPC A;  8ICL A;  2HHW A;  4QZ8 A;  1RYS A;  1BNP A;  1CI4 A;  5CEH A;  4UB2 A;  5HP4 A;  1ZQR A;  1LKY A;  2I6X A;  2YML A;  3QE9 Y;  5ALD A;  1M6Y A;  3UMG A;  1KL9 A;  5AI4 A;  3ZDC A;  7ICI A;  2JMG A;  2BCV A;  4XRH A;  3N97 B;  1YZ7 A;  3SAH A;  4R66 A;  2DQN B;  1WWU A;  1WWV A;  5KT5 A;  4G3I A;  1QCK A;  3H40 A;  2WTF A;  2W9B A;  3RB6 A;  2W8L A;  5J0Q A;  2UVV A;  2I1Q A;  2G5I B;  4GFJ A;  4CE6 A;  4Z6E A;  1DRG A;  1SZP A;  3GIM A;  5DQG A;  5J2H A;  2NRV A;  4DF4 A;  4Z6F A;  2ZXI A;  3C28 A;  5EOZ A;  5L1J A;  2G5H B;  4OCZ A;  1XSN A;  2WAQ C;  2ZJ5 A;  4PJ0 U;  2WF7 A;  4P0Q A;  2XID A;  2AU0 A;  2B0C A;  5AK6 A;  2RLT A;  3BQ7 A;  3OJS A;  2ASJ A;  1F5S A;  4DOB A;  2XCA A;  4TUS A;  2LYB A;  4MEX A;  3QUT A;  1S0V A;  5ALU A;  5JUM A;  5ALE A;  1YZ6 A;  5DBB A;  1A76 A;  3UQ2 A;  4MFA A;  1GO3 F;  1F44 A;  3JPP A;  1U45 A;  2CXY A;  1K5O A;  2BQR A;  1NJZ A;  8ICO A;  4QWA A;  1NKC A;  4Q45 A;  4C7Z A;  5DB7 A;  2W03 A;  2FPK A;  2LYA A;  3QZ7 A;  4C8O A;  4ELT A;  5ALL A;  8ICW A;  1RXW A;  3L3F X;  1FFU A;  4B9U A;  3GZF A;  5KFM A;  2AQ0 A;  2VJ5 A;  2G06 A;  4P0P B;  1QSS A;  3H7I A;  3AU6 A;  2A19 A;  3E2E A;  3PMN A;  3TFS A;  4I2C A;  4Y2U A;  5ALZ A;  4F5R A;  2F77 X;  5AKG A;  5J2E A;  1SKW A;  1UCV A;  4KLS A;  1QQ6 A;  3CNH A;  4DFD A;  3PST A;  4USA A;  5ALT A;  1SIJ A;  5KG3 A;  1IIP A;  4GXJ A;  5ALJ A;  1QSY A;  3RRG A;  3UPQ A;  2PFN A;  1U47 A;  3PSP A;  1PUZ A;  5KT4 A;  2QLT A;  1RXV A;  3AMZ A;  3IN5 A;  4UAS A;  2YMM A;  1B22 A;  4DS5 A;  4M9H A;  2ZIU B;  5IIK A;  5J8Y C;  4IL6 U;  4NLB A;  4RQ5 A;  2E8O A;  1COO A;  2F1I A;  4J9Q A;  4ECW A;  3AN1 A;  5JTI A;  5KFD A;  2PI5 A;  4NM1 A;  2C2R A;  9ICP A;  3LDA A;  2OCE A;  3GFK B;  5A0L A;  2E1E A;  1X9X A;  4ZOH C;  2W3S A;  4LZG A;  3DV9 A;  5D49 A;  2EDU A;  4FZN A;  4NL9 C;  3IDW A;  4UQG A;  2LHT A;  3BDP A;  9ICJ A;  4JV1 A;  2DF4 B;  7ICO A;  4ED7 A;  1NK4 A;  2LYH A;  3AM9 A;  5KFT A;  1NNL A;  2OEH A;  5KFZ A;  5ALF A;  4X5V A;  3RTV A;  1RYU A;  5EWG A;  4M2Y A;  4EEN A;  1N48 A;  4B9T A;  4G9B A;  2ZIW B;  1FIQ A;  2DUY A;  4KX3 A;  4RPZ A;  2F1J A;  7ICL A;  5AKL A;  5F3X B;  1JMS A;  8ICH A;  4YMO A;  1TKD A;  4MFC A;  4O3N A;  2JEF A;  2DFL A;  2NRZ A;  4C80 A;  5ALK A;  5DLF A;  4DFK A;  4FZM A;  2V4R A;  3G6Y A;  5CP2 A;  3CW2 C;  1LB2 B;  1KFD A;  2HVH A;  1Z3E B;  2KZM A;  5KFU A;  9ICV A;  4IS7 A;  4YR2 A;  2FMP A;  3MC1 A;  3DEE A;  2XCP A;  1HIW A;  4DSF A;  8ICZ A;  9ICT A;  1N61 A;  1RG6 A;  4J03 A;  5F9L A;  4RQ8 A;  3SQI A;  2F76 X;  2JEI A;  1ARO P;  5AI6 A;  4ZH4 A;  3PV8 A;  2KMD A;  4FBT A;  2FMS A;  3MGH A;  4CCH A;  5III A;  2UVU A;  2MU2 A;  4I2G A;  2AJQ A;  3F5E A;  1MQ3 A;  1P7D A;  3NVY A;  2Y0S C;  4KLQ A;  4HYK A;  5J0X A;  4DF8 A;  4Z6D A;  8ICM A;  3LYS A;  2B21 A;  2XY6 A;  5IIJ A;  3SEN A;  3ZDE A;  4ECV A;  3OGU A;  2KKV A;  1EXN A;  1NI3 A;  5B5E U;  3WK7 A;  2JRZ A;  1S0N A;  3THV A;  5TIS U;  5DDY A;  5ALI A;  3HX0 A;  2MUT A;  4QZA A;  3QU9 A;  4PZO A;  2W11 A;  4RPX A;  2W54 A;  2LBO A;  3ZI4 A;  3HP6 A;  1YT3 A;  2HBL A;  5AKI A;  1S0O A;  5G5H A;  2KIV A;  4PH5 A;  3C29 A;  1DGJ A;  4F50 A;  2A1A A;  2K8B B;  1ZJN A;  3V7L A;  2W7P A;  1ZQQ A;  2KSO B;  9ICN A;  3BQ1 A;  1JI7 A;  3N7P D;  2C28 A;  4EBD A;  1SXD A;  3KZX A;  3I76 A;  4OJP A;  5HMM A;  8ICU A;  3PR5 B;  2AHO B;  2PFP A;  2L5Y A;  2ALZ A;  5IIO A;  3EPG A;  2NO4 A;  4K4I A;  3RRH A;  2M0N A;  2ZTE A;  3UXP A;  3RFA A;  5KFB A;  4YD1 A;  2E8N A;  3GIL A;  3H8W A;  5CRX A;  1VJ5 A;  2H3F A;  2KVS A;  1UT8 A;  1XS9 D;  3RAQ A;  4MF8 A;  5KT3 A;  1N56 A;  4P4O A;  4ACO A;  1Z19 A;  5HHH A;  2GWS A;  4NLK A;  2DPJ A;  2FPM A;  4KX5 A;  5AKJ A;  4Q43 A;  4EBC A;  1OXJ A;  3IRU A;  2EZZ A;  2BKE A;  5KFS A;  4I2E A;  1KDH A;  1ZD3 A;  3K1R B;  5AM5 A;  4RQ1 A;  3E0F A;  1COK A;  3QYP A;  2Q4T A;  4KLM A;  1D8Y A;  2CRX A;  1N60 A;  3RJE A;  8ICX A;  3GIK A;  8ICB A;  4KMO B;  4ELU A;  4BUG A;  2KZZ A;  3T5L A;  3S6J A;  4YQW A;  5GTI U;  1D9F A;  2PFO A;  3I1Y A;  3C2L A;  2FJ6 A;  2G0A A;  4JV0 A;  3WKB A;  1S9F A;  3EZ5 A;  3F2D A;  3LVW A;  3WK5 A;  5DLG A;  3M9O B;  3TAN A;  4GXI A;  4DS4 A;  5KFK A;  5TZV A;  3MGI A;  2WB1 F;  3GU3 A;  5AIA A;  2PKE A;  2FMQ A;  2HHS A;  3A0H U;  4KTQ A;  4Y2Y A;  4RQ0 A;  4ECU A;  3RB4 A;  4M9L A;  4DFJ A;  8ICC A;  4CDG A;  4EYI B;  4IQV A;  3WK9 A;  2NO5 A;  2BCU A;  5L1L A;  2KVC A;  1J2M A;  3K4G A;  2DKZ A;  1NK5 A;  1NK7 A;  3HKZ F;  7ICH A;  2Y1J A;  1URJ A;  2NYV A;  2BR0 A;  2LPE A;  2AGO A;  1WCN A;  9ICQ A;  5HML A;  3TAD A;  3T5H A;  2C2E A;  4F71 A;  9ICX A;  1SV0 A;  5AI9 A;  2W43 A;  3HRD D;  1ZQT A;  1ZQA A;  1L3T A;  3B0Y A;  2WF6 A;  4ED1 A;  2BDU A;  2W3R A;  4P4M A;  4TUR A;  1XWL A;  2Z7J A;  2P6R A;  4BGD A;  4R63 A;  2ZUC A;  3Q8P B;  4C7Y A;  2XY7 A;  1UA1 A;  5IIL A;  4RU9 A;  4PHD A;  4UB5 A;  3Q8R B;  1OUQ A;  5AM0 A;  4UAT A;  1L7M A;  4P2H A;  2VKQ A;  3D6J A;  3ETR A;  1KQQ A;  1ZQF A;  2O6K A;  1J97 A;  4B9S A;  2VJ4 A;  1ZQY A;  3PSI A;  2E5S A;  3ZDD A;  1TAU A;  1ZQD A;  4ED0 A;  1S10 A;  4QZB A;  4NV0 A;  3RB3 A;  4MHV A;  4DFP A;  4M9J A;  2R18 A;  1JIH A;  1T3Q A;  5CJ7 A;  2ZIV B;  4P0P A;  1O08 A;  3RH4 A;  3G6V A;  2HOQ A;  2JGA A;  3G6X A;  9ICE A;  3NRW A;  3M8S A;  4PGY A;  4MEY A;  1ZQW A;  4QZG A;  4RQ4 A;  4YXM A;  4J9R A;  1N5W A;  4MF2 A;  2CN1 A;  4F92 B;  3NVZ A;  4UBC A;  5DGB A;  2KFN A;  7ICS A;  2OXO A;  5C0Y A;  2IOF K;  3ONN A;  1ZQE A;  4QZH A;  2KZ3 A;  3EYZ A;  2WHE A;  3ZDB A;  1X6J A;  1D9D A;  1SKS A;  3T3F A;  8ICE A;  4HAI A;  7ICR A;  3WKC A;  2ZJ8 A;  4YR3 A;  1ZQK A;  1ZQN A;  2XGQ A;  3N4M B;  3GII A;  2K89 A;  2ZIU A;  2P35 A;  4DL2 A;  2IHM A;  2GH1 A;  4J9O A;  2JZB B;  2BCS A;  2JV3 A;  5CWR A;  1ZQP A;  1KBU A;  3OJU A;  3EWA A;  1PVR A;  2NV3 A;  4BWM A;  3NGD A;  1XSP A;  3IHQ B;  4Y2R A;  2HHU A;  5L1K A;  3QU4 A;  3PML A;  5AM2 A;  2YMP A;  1X9M A;  4EX7 A;  2W9A A;  2KHV A;  4FE3 A;  5KFV A;  2JEG A;  2FLN A;  1JXE A;  4QW9 A;  3WU2 U;  2A1J B;  3M9N B;  1QH9 A;  4RT2 A;  3H8M A;  4QZF A;  4R8U A;  1IXR A;  2KIC A;  3AU2 A;  4KN7 A;  5AKY A;  2BCQ A;  4PL1 A;  3D2N A;  5KG1 A;  3C21 A;  4I2D A;  4QZE A;  4CF4 A;  2ZIW A;  3QEB Z;  1MA7 A;  2HHT A;  4YMM A;  1Z4N A;  2XIC A;  4I2F A;  2KP7 A;  2HOI A;  1SL2 A;  7ICQ A;  3RB0 A;  3KFU F;  3WKE A;  2VA2 A;  2EQY A;  3WKA A;  1Q8K A;  3BJY A;  4J9P A;  4J9M A;  3NTU A;  4RPY A;  3QXG A;  2GOL A;  4YP3 A;  2AH5 A;  1ZQ1 C;  5ALW A;  5HR6 A;  1A6S A;  3NS1 A;  4O3Q A;  1CRX A;  4ED2 A;  4QZC A;  2XO7 A;  3PW0 A;  1ZQM A;  2DL0 A;  2EH9 A;  2JR5 A;  1FFV A;  5J0T A;  3OTQ A;  1RZT A;  3MAB A;  2KK0 A;  2W04 A;  5KFW A;  5AK4 A;  1PVP A;  3TAR A;  3I28 A;  1MC8 A;  4PL2 A;  4F72 A;  4F2S A;  4PGX A;  1NKB A;  3MR2 A;  4DSI A;  4BX9 C;  8ICV A;  4DQI A;  4TUP A;  4YD2 A;  3H8J A;  5AI5 A;  1RM6 C;  3RJH A;  3HPO A;  2XGP A;  4UB1 A;  4BWJ A;  3JPS A;  2W9C B;  2ODG A;  4UB3 A;  3CP8 A;  3SYZ A;  3PX4 A;  1KLN A;  3MFI A;  4NLZ A;  1IG6 A;  1PK1 B;  1SL1 A;  5DDM A;  2K4H A;  1KSP A;  3IG5 A;  1ZOL A;  3MDC A;  2ZUB A;  4IR9 A;  5AKH A;  1LKY B;  4DL7 A;  2VA3 A;  3M6Z A;  4QW8 A;  1S76 D;  4CRX A;  1RQN A;  2QAR B;  4DSE A;  1AQ6 A;  3Q8S B;  3EPI A;  2UVW A;  5K4L A;  3WK4 A;  1ZYQ A;  2EAN A;  3GV8 B;  1V97 A;  2BQ3 A;  1CEZ A;  5DQI A;  2LM1 A;  4C8N A;  3LK9 A;  5KFG A;  2IMW P;  5J8Y A;  3Q8M A;  7ICJ A;  3M8R A;  2H3I A;  3HT3 A;  7ICU A;  1Z4O A;  1N2X A;  2LM4 A;  3RH6 A;  3SAG A;  5CR0 A;  3F2C A;  3MR3 A;  1SWV A;  4GIB A;  5HHI A;  4O5E A;  4DL6 A;  3N7S C;  5KG6 A;  4Q44 A;  2H5X A;  1DK3 A;  3TAQ A;  1C7Y A;  3WK6 A;  3JPT A;  9ICW A;  7ICM A;  3KKA A;  2ASD A;  3FDS A;  5KFI A;  3V7K A;  1BPY A;  3FC4 A;  2ZTD A;  4F4Y A;  3JPR A;  2I9G A;  4YVZ A;  3RJF A;  3V6K A;  1V9P A;  5ALH A;  4O3P A;  4OJ6 A;  5ALN A;  4QWC A;  2ISP A;  3SEI A;  3IV6 A;  5J0P A;  4LJX A;  4ECR A;  4RQ3 A;  4YXJ A;  4O5C A;  2KN7 A;  3PX0 A;  4RQM A;  1U9L A;  1XU4 A;  2VAN A;  5J2G A;  1S0M A;  5DBC A;  8ICF A;  2F8L A;  4ICA A;  4Y2Q A;  4JUZ A;  4KLI A;  2C22 A;  5ALG A;  4I2H A;  3T5J A;  4EEK A;  4KLD A;  3SD7 A;  4UAZ A;  2FE9 A;  3QEA Z;  4ECY A;  1UA0 A;  3RBE A;  3ZD8 A;  2KJ8 A;  4O5K A;  1ZQU A;  2J6S A;  1KTQ A;  1XO1 A;  5CB1 A;  1SV4 A;  3FYH A;  4RNO A;  2WB1 C;  4FO6 A;  4F4K A;  4F5N A;  2DWQ A;  2NRW A;  2Y9T A;  3H0M B;  3PW7 A;  3QU5 A;  1L8L A;  2JXJ A;  1A0P A;  1JAL A;  3H8S A;  9ICH A;  1X9S A;  3KD3 A;  4KIT B;  5L1I A;  2LMR A;  4ECQ A;  3F5A A;  5DBA A;  7ICK A;  8ICG A;  3LWL A;  2BPF A;  4IRK A;  3AUO A;  1HUO A;  4UBB A;  1SWW A;  2IHN A;  4NM2 A;  3HKZ C;  3PY8 A;  4J9L A;  3SR6 A;  5KFN A;  1BNO A;  3L4P A;  2DKX A;  2FI1 A;  3BZC A;  3BS5 B;  3MR5 A;  2OM6 A;  4R64 A;  2HBM A;  5AKK A;  2ES6 A;  1OW5 A;  4YMN A;  4F91 B;  5HNK A;  2KG5 A;  1BGX T;  5GTH U;  5ALR A;  3GV7 B;  3RJG A;  2PFQ A;  4NLN A;  3UMB A;  5ALS A;  3D2S A;  4M47 A;  2HDO A;  3FAH A;  1L6N A;  3PX6 A;  4B9M A;  2YX8 A;  9ICO A;  2I5H A;  3IP4 B;  1H38 A;  3QUB A;  3GIJ A;  5AI8 A;  4GC6 A;  1JX4 A;  3BQT A;  3HIL A;  4CNQ A;  2YQE A;  4TQR A;  5EE3 A;  4DEZ A;  4FS1 A;  4RNN A;  4YG2 A;  3MBY A;  3NRZ A;  1Z00 A;  2Y1I A;  4J9S A;  1UT5 A;  2WF8 A;  4KN4 A;  4M9N A;  2C2D A;  2F8K A;  1MQ2 A;  2OYY A;  2MRL A;  2BGW A;  1BVS A;  4PZN A;  1D8B A;  3KHR A;  2E3T A;  4BXO B;  5ALP A;  3PO4 A;  1JRO A;  3OSN A;  4MFF A;  5J0U A;  4KLO A;  2K4I A;  2V4Q A;  4KLJ A;  5AIB A;  3UMC A;  3EW9 A;  2JHD A;  5AKE A;  1SB3 C;  2F3N A;  5KNI A;  5J2A A;  2GO7 A;  2ZIV A;  4DLE A;  5ALM A;  4M6W B;  2FDR A;  4US9 A;  4FS2 A;  2OH2 A;  2KV2 A;  4NWI A;  4ELV A;  1S77 D;  2PMZ C;  4UB4 A;  3ORY A;  1V85 A;  2K4E A;  5AK3 A;  1SL0 A;  3QZ8 A;  2R8K A;  5KFP A;  2R8I A;  1NK0 A;  2HHQ A;  4C8K A;  3N28 A;  4LVS A;  2HW3 A;  5KT2 A;  3QNM A;  5BOM A;  5DG8 A;  5J2I A;  5B66 U;  5KG7 A;  4DFM A;  1PVQ A;  2ZTC A;  2D8C A;  2YY6 A;  1ZQH A;  4ED6 A;  2YB1 A;  3C5G A;  1ZQI A;  2W55 A;  2LKY A;  4DSJ A;  4DO9 A;  8ICR A;  4YCX A;  4KMU A;  2JZB A;  1SV0 C;  1J2N A;  4DSL A;  1ZRM A;  7ICP A;  4Q8F A;  3H0R B;  2V9W A;  5KFR A;  3KOO A;  3MGV A;  4DQP A;  3PW4 A;  3AL0 B;  3IM1 A;  4CF5 A;  4KLT A;  4I2I A;  3TAP A;  2PXI A;  4IQW A;  3TI0 A;  2ZXH A;  1QQ5 A;  1ZQX A;  3TQ1 A;  5J0O A;  4ECS A;  4Z6C A;  3PZP A;  2VA8 A;  4FFD A;  2UVR A;  1Z1B A;  3PNC A;  5E79 U;  4F5P A;  1JRP A;  4JMU A;  2K60 A;  5KT7 A;  3C5F A;  4AYB C;  1SXE A;  3BS7 A;  5JRT A;  4RNM A;  3MFH A;  1DGS A;  2MA1 A;  2F1H A;  5J0R A;  2BPC A;  2EZY A;  5KFA A;  4RZR A;  2XC9 A;  4DL5 A;  1ZQB A;  4ED3 A;  5IIN A;  4J9K A;  1MN8 A;  1TAQ A;  3OHB A;  1L3V A;  1SZH A;  2QKQ A;  5IIM A;  2ZIX B;  5J2K A;  4QZD A;  1QQ7 A;  3ISD A;  5AM4 A;  2IA6 A;  4C4S A;  2HHV A;  8ICS A;  4ECZ A;  2E1F A;  4DCC A;  3O0F A;  2KTQ A;  1T7P A;  2KEY A;  5DGA A;  1JN3 A;  2J6T A;  3HJE A;  8ICT A;  5D46 A;  3H4D A;  1X6I A;  1XNS A;  4PHE A;  4EEY A;  5DQH A;  5DB9 A;  2YTU A;  4ECX A;  4LZD A;  1JUD A;  1KRP A;  2HVI A;  1JXL A;  2G07 A;  3C23 A;  4YN4 A;  4U7C A;  1X9W A;  9ICU A;  4Y2J A;  3VCB A;  2PMZ F;  1S8O A;  1ZQC A;  1KN5 A;  4UAU A;  4GC7 A;  3KTQ A;  1K1S A;  4UAY A;  1L7N A;  5KL1 B;  9ICR A;  4O3R A;  4O0I A;  3RR8 A;  1T8E A;  1KEJ A;  4IRD A;  3GDX A;  8ICQ A;  4M04 A;  2K8C B;  1L3U A;  2IOH A;  2EAM A;  1PK1 A;  4IC9 A;  5J0W A;  2FPL A;  2AXT U;  1UHU A;  2Q0Z X;  3KZI U;  4DL4 A;  2BZF A;  4C4T A;  2E8M A;  5KAI U;  2QAR A;  3Q8L A;  4QIW F;  2FLL A;  1HJP A;  3CYM A;  1A77 A;  3HWT A;  1UQV A;  1VDV A;  2H3Z A;  4XQ8 A;  2LI6 A;  2A3V A;  3RR7 A;  5AM1 A;  4I29 A;  1RYR A;  4JV2 A;  4DQQ A;  1WCL A;  2BDP A;  1WG8 A;  4RT3 A;  2RDJ A;  2G09 A;  1SKR A;  1NZP A;  3TAC B;  3BQ0 A;  5EE0 A;  4C4R A;  3WKD A;  2JH1 A;  4KLH A;  2ZUD A;  5J2B A;  4AYB F;  2HOF A;  4Y2V A;  4K4G A;  5KFH A;  4OO1 J;  2F2A B;  1NJY A;  1QLN A;  5ALV A;  1IV8 A;  2JH7 A;  3H0L B;  1NK8 A;  4YR0 A;  5AIC A;  5KG0 A;  1B43 A;  3PW2 A;  1DK2 A;  1BPX A;  4QWE A;  2QB0 B;  3WK8 A;  2ESE A;  3V72 A;  4US8 A;  3KHL A;  1XC9 A;  1O03 A;  3FM9 A;  1Q46 A;  1K1Q A;  1BPZ A;  3K1Z A;  1T4G A;  8ICN A;  2NRX A;  5ALQ A;  8ICP A;  5KFQ A;  8ICY A;  4KLG A;  2G08 A;  2Y9U A;  1B4F A;  3EUB 2;  5L1M A;  5EE9 A;  2VIX A;  4I2A A;  1RDF A;  3ED5 A;  3PSF A;  2RDI A;  3RJJ A;  5EWE A;  2ZJA A;  2HI0 A;  4I27 A;  1NKE A;  3Q8Q B;  4R65 A;  2KE7 A;  3OPX A;  3IG8 A;  3LWM A;  4Y2P A;  1BPD A;  4RUC A;  1ZQS A;  3SI8 A;  4DOC A;  4NLC A;  1KFS A;  5KFO A;  1ZD5 A;  2P6U A;  3ISC A;  3RAX A;  1NK9 A;  4BJQ A;  4FBU A;  2DPI A;  4I28 A; 
#chains in the Genus database with same CATH homology
 3F53 A;  4QIW F;  2G0A A;  3PSI A;  2E5S A;  2HBL A;  2W03 A;  3SAF A;  3CYM A;  4AYB C;  2XI9 A;  5T14 A;  4U6P A;  4PL1 A;  3D2N A;  3ICX A;  3SMV A;  2LYA A;  3F2D A;  2H3Z A;  3LVW A;  3C29 A;  2ZIW A;  2ZIW B;  1XO0 A;  2A3V A;  2K4I A;  2KIW A;  1MA7 A;  2MA1 A;  3AQF A;  2KJ9 A;  4KX3 A;  4NV0 A;  2XIC A;  2WB1 C;  1TAM A;  2R18 A;  2K8B B;  2JHD A;  3L3F X;  2HOI A;  3M7D A;  3GZF A;  2XVT A;  3KFU F;  2D6F C;  2WB1 F;  3GU3 A;  2W7P A;  1T94 A;  2ZG6 A;  2H3V A;  3H0M B;  2VJ5 A;  2ZIV A;  2ZIV B;  4P0P A;  2G06 A;  4P0P B;  1A0P A;  2H3I A;  4FZM A;  3N7R C;  2HOQ A;  1SZH A;  2KJ5 A;  2ZIX A;  2ZIX B;  5HR7 A;  3F5A A;  2JGA A;  2G09 A;  2GOL A;  3N7P D;  3KZX A;  1ZQ1 C;  3NRW A;  2CPR A;  2JMG A;  4OJP A;  3AQE A;  5HR6 A;  2OH2 A;  1A6S A;  2JH1 A;  2KV2 A;  1UPH A;  3ALR A;  4NWI A;  3SAH A;  2E1F A;  2F77 X;  2DQN B;  2HMX A;  2PMZ C;  3O0F A;  4CDG A;  2KEY A;  1CRX A;  2CN1 A;  3HKZ C;  4AYB F;  3F2C A;  3DEE A;  2OXO A;  2HOF A;  1HIW A;  2K4E A;  3PST A;  5C0Y A;  3ONN A;  4OO1 J;  2F2A B;  2KVC A;  2M0N A;  3D2Q A;  1IIP A;  3HKZ F;  4C0Z A;  3RFA A;  3N7S C;  2W04 A;  4GFJ A;  2G5I B;  2OM6 A;  2YB4 A;  3SQI A;  2HBM A;  1URJ A;  1DRG A;  3PSP A;  2F76 X;  1Q3U A;  2JH7 A;  3H0L B;  2DGZ A;  5CRX A;  3F2B A;  4OJL A;  1PVP A;  1XNS A;  2H3F A;  3IN5 A;  2K8A A;  4QNL A;  2ZXI A;  2RP5 A;  2KD1 A;  2KKP A;  3C28 A;  4WJ3 B;  1WUD A;  5KL8 B;  1PVQ A;  1ECW A;  2K89 A;  2ZIU A;  2ZIU B;  2G5H B;  4PL2 A;  4ACO A;  4NLB A;  1Z19 A;  3D2S A;  2WAQ C;  3F5E A;  2G07 A;  2YB1 A;  3LVV A;  4KX5 A;  4U7C A;  1P7D A;  4BX9 C;  2LKY A;  2YX8 A;  1Q3V A;  2GH1 A;  2KNJ A;  2Y0S C;  3IP4 B;  4CGZ A;  3CRX A;  4P0Q A;  4P0Q B;  2WAQ F;  3VCB A;  2PMZ F;  1KBU A;  2XID A;  2RRD A;  3K1Z A;  1PVR A;  2NV3 A;  2Y0S F;  2BDU A;  3H0R B;  4QJF B;  3LYS A;  2G08 A;  4OJ6 A;  3VC8 A;  5A0L A;  2E1E A;  5KL1 B;  3E0F A;  3MGV A;  2Q4T A;  2Z7J A;  3T79 A;  2CRX A;  2H3Q A;  3CP8 A;  1NZB A;  2KOB A;  2LYB A;  1HEK A;  2VIX A;  3AL0 B;  2KKV A;  4FZN A;  3NUQ A;  3PSF A;  4KMO B;  2K8C B;  4BUG A;  2LHT A;  2KHV A;  4FE3 A;  4FZL A;  1L6N A;  2N1R A;  4IC9 A;  4OJO A;  2DF4 B;  2F8L A;  2K4H A;  4ICA A;  2ZXH A;  3IG5 A;  2W7O A;  1OUQ A;  3OPX A;  3IG8 A;  1GO3 F;  3PZP A;  2OYY A;  2MRL A;  1F44 A;  4O3M A;  2VKQ A;  2KHQ A;  1Z1B A;  3M6K A;  2LBO A;  4QIW C;  2RHF A;  4NLC A;  4OJ5 A;  4A8E A;  2HBK A;  3SAG A;  2KIC A;  3M6Z A;  3RF9 A;  4BJQ A;  1YT3 A;  1ED1 A;  4JMU A;  2HBJ A;  4CRX A;  1D8B A;  2VJ4 A;  2KJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...