1ECWA

Crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 293k.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
SVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Crystal structure of SIV matrix antigen and implications for virus assembly.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 38
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1ecwA00
2H3FA 2H3ZA 2GOLA 2HMXA 2H3QA 1UPHA 2LYBA 1TAMA 1ED1A 2K4EA 1L6NA 4IC9A 1ECWA 2NV3A 1A6SA 1HEKA 2K4IA 2LYAA 2JMGA 2K4HA 1HIWA 2N1RA 4JMUA 2H3VA 4ICAA 2H3IA
chains in the Genus database with same CATH superfamily
5KNIA 3RBDA 4M9HA 2K4PA 4IRKA 3UPQA 1U48A 3NS1A 3LVWA 4EEKA 3LWMA 2LM1A 2L5YA 2ZUCA 3UMBA 5KG4A 5J2KA 4ECQA 4NLNA 3C5GA 5HMLA 7ICMA 4I27A 4KMUA 5ALYA 5AI4A 4EYHB 3F53A 4JWMA 2K4HA 3WK5A 1KLNA 1EXNA 4IQUA 2NYVA 2W3RA 5KFEA 1ZQXA 2PXIA 4ECTA 2JEFA 3PW7A 4ECUA 5CRXA 3MABA 2KHVA 3F5AA 1S76D 4Q8FA 4RQ8A 1KEJA 1RXVA 3BZKA 3KTQA 8ICQA 3MDAA 4PGYA 1S5LU 1QCKA 5KG5A 3ZDEA 2W11A 3PV8A 4YD1A 1V9PA 2E8NA 2XCAA 3KHRA 2OH2A 4O5KA 3TQ1A 3S6JA 4PJ0U 4RZRA 2G07A 1X2IA 1QH9A 5KAIU 4RNMA 1T7PA 4Y2VA 2NV3A 2MUTA 4Q43A 4AP9A 3G6YA 4JWNA 1WCLA 2H3VA 5KFOA 2ZJ5A 3GFKB 4DL2A 3RRGA 1SL1A 4UBBA 5TISU 4CCHA 5ALKA 1JXEA 1X42A 1MQ2A 5DB6A 1XO0A 5CA7A 5HR6A 2XY5A 2YX8A 5DDMA 5IIMA 2W9BA 2Q4TA 2ZXHA 2Y9UA 2KK0A 3ZI4A 1QLNA 5CWRA 4BXOA 3PW2A 3KOOA 3PX6A 4O3OA 5DB9A 4RQ0A 2JZBB 5L1LA 4C7ZA 3BS5B 2R8KA 5AKLA 4ECWA 4IS7A 4DFDA 2ATLA 4KLIA 2K89A 4OJLA 1S0OA 2WFAA 2GWSA 2W8LA 3IRUA 5DBCA 3L5KA 3UXOA 3ZD9A 2A19A 3OJUA 5FP0A 5EWFA 1NK5A 3NRZA 3M1YA 3EPGA 2HHTA 3T5KA 2E3TA 1JIHA 4F5OA 5F3XB 3H8WA 2DBYA 3T3FA 2BCUA 2HBLA 9ICVA 2KFZA 3EYZA 4UASA 1T3QA 3GV7B 3PZPA 3OPXA 2ZTEA 5KT5A 2KJ5A 3BDPA 5JRTA 1XSNA 4OJPA 5ALZA 1ZQBA 4CF5A 5AM3A 3GIIA 4PHPA 2KN7A 2CRXA 2E5SA 3IG8A 5ALWA 4DOAA 1BPZA 1BPXA 4X5VA 2BDPA 5KFCA 1N5WA 2ASLA 4ECSA 3RB4A 4Y2YA 4IQVA 1S0MA 3CYMA 2CXYA 1N5XA 3DV9A 3Q8KA 1MQ3A 2F1HA 2KZ3A 2VA8A 1KFDA 2UVWA 2ODGA 4P0PB 3QU7A 4F5PA 2NRVA 3JPTA 1N60A 2HHUA 4BGDA 4ECVA 2FI1A 2VA2A 3LVVA 3OGUA 3PSTA 3H0RB 3PSPA 4LZDA 3WKCA 2MRLA 5AK3A 5ALNA 2JZBA 3PNCA 1ZQYA 4J9LA 1B4FA 2NRZA 4PL1A 4KLFA 3BS5A 3NVWA 4FBUA 1SKSA 3PO5A 1ZJNA 1LVHA 3PW4A 1MA7A 3IV6A 4YR3A 2FMPA 5KFNA 2LI6A 2Q0ZX 5AKKA 1OUQA 5TZVA 5KFYA 4TQSA 3EPIA 2M0NA 2P6RA 3FYHA 4UAWA 3SENA 5J2JA 1ZQOA 2HOFA 4I2BA 3OHBA 3Q8RB 4ZH4A 4KX5A 4EBEA 4C80A 4US9A 5KFPA 2V9WA 2G06A 4KITB 4OJ5A 1S10A 4F2RA 4J03A 1ZQZA 4ED1A 3M9NB 2XY7A 1KQQA 4MHVA 8ICYA 4LZGA 3IDWA 2WTFA 1AQ6A 1JALA 4FZNA 4F91B 4P4PA 4GIBA 5EOZA 3H8SA 1RZTA 1J2MA 3H7IA 4QWCA 4J9KA 1WG8A 2CPRA 4QWBA 3PSIA 4YR2A 4J9SA 1WYGA 5J29A 4M9LA 1WWVA 4YG2A 3C23A 4QWEA 1XS9D 2KG5A 1TK5A 2J6UA 5ALVA 4A8EA 2FPLA 2E1FA 1DK3A 4UB8U 3TFSA 4B6JA 1SXDA 2D6FC 5KFTA 4YP3A 2Y1IA 4CDGA 3WK7A 4NY8A 5KG2A 4P0PA 1ZD4A 4FZLA 2YB1A 3RAXA 3SV4A 2I1QA 1IXRA 2J6SA 2H3FA 1ZQCA 2HW3A 1QTMA 1IG6A 4Y2JA 5AKGA 3KD3A 1YT3A 5AM2A 4RUCA 4F93B 2RDIA 2YY6A 3D6JA 4GLXA 3A0BU 3CRXA 4RQ1A 4M2YA 4KLUA 3FDSA 3K1ZA 1F5SA 1DOQA 1ZQEA 1Z1BA 1KFTA 1SV0C 2V4QA 5AKEA 5JU5A 2IHMA 1L6NA 1ZXIA 2ZUDA 4NM2A 5KT6A 2W04A 3RB0A 2C2RA 5AM4A 3UQ2A 3V6JA 4YFKA 4EX6A 2AGPA 4ICAA 5AK6A 1ZQUA 3KZXA 2WF6A 2ZJAA 4ED2A 5F9NA 5GTIU 1D9FA 4I2JA 4FS1A 1ZQDA 5AI8A 5J0XA 1F0MA 5AICA 4UBCA 1L3VA 3PO4A 3NASA 3RFAA 1RPLA 1UQVA 5J2HA 2WF5A 1WCNA 5KL1B 3EWAA 4QW9A 3QZ8A 5K4LA 4R8UB 1MSWD 1SV4A 9ICSA 2DUYA 5KG6A 3HT3A 5KFHA 2W9CB 3TARA 3SD7A 7ICHA 1ZOLA 3HILA 5G5GA 4J9OA 2PI4A 2ZTCA 5J0UA 3AQEA 5ALMA 3SYZA 2HDOA 4JUZA 3KHHA 3SAGA 3I76A 3G6VA 3SI8A 4YMOA 1X6IA 1Z00B 2BHNA 4UB2A 1PUZA 2HMXA 1X66A 5BOLA 1UCVA 3R9KA 1L8LA 1XO1A 5D46A 1S0VA 4MFAA 4I2EA 3N28A 2JGAA 1T8EA 2OHFA 9ICMA 3ORYA 4RPYA 4YD2A 5AK5A 5CEHA 4O3MA 1SL2A 4C8OA 3NRWA 3QYPA 2ZUBA 2KKPA 2VA3A 2BCSA 1T4GA 1T3NA 4KLDA 4QZGA 2BPFA 3PSFA 2LYAA 5J2DA 2RHFA 9ICCA 2VJ5A 4ED0A 2K8BB 2DF4B 1C7YA 2K8AA 4B9UA 2NRXA 5KFGA 1HUZA 5ALQA 3SAFA 5KFIA 2JEJA 2QKQA 1N2XA 2CN1A 1BPYA 2F44A 2ASDA 4C8LA 2HCFA 3G6XA 4F5QA 3AL0B 3RR7A 5CB1A 1BNPA 2PFQA 1Q8KA 4C4TA 3MR2A 3ZDBA 1TAQA 2G08A 1ZQVA 5AKHA 4R8UA 4RQ2A 4ED7A 2WHEA 2YMMA 3DDHA 3TAQA 1V85A 2W9CA 1Q46A 3WKEA 4DF4A 4GC7A 1O08A 4EZ6A 4PZOA 3MFIA 8ICFA 3N4MB 9ICNA 2NRWA 4K4GA 5J0SA 3QEBZ 3ALRA 5EWGA 4QZEA 4F92B 2KZMA 1ZQIA 1L7NA 1Z00A 4M9JA 2G0AA 2UVRA 4QJFB 1ZQPA 2A3VA 2H3QA 3SEIA 2EAPA 3B0XA 4KMOB 2R8JA 4ZOHC 2ES6A 1M6YA 1FFVA 3N7RC 4TQRA 1ZD2P 5BOMA 4P4MA 4QZDA 4RQMA 2KMDA 3I1YA 3KHGA 2DPIA 3ICXA 4ED8A 1COOA 4B9MA 2AGQA 5KT3A 1JI7A 5DQGA 1SWVA 3QXGA 3F2DA 1JROA 4UATA 3AMZA 4B9NA 2F8KA 1KRPA 5J0QA 3OJSA 4Y2QA 3RB6A 3K75D 4MEYA 1UA0A 1RXWA 3T79A 2Y0SC 4C8MA 2WF7A 1Z3EB 3C28A 4EBCA 2HVIA 2P66A 2HHWA 4K4IA 5ALJA 2PKEA 2HVHA 2RP5A 3SAHA 3H8MA 4OJ6A 3IN5A 1SWWA 5KFXA 3MC1A 1U47A 1D9DA 4NLCA 3KFUF 2YMPA 3RJEA 1ZQ1C 2YMLA 1S8OA 2FPMA 3HKZC 4NJ8A 2XI9A 5CP2A 2XGQA 5AI0A 3TACB 4USAA 1A0PA 5J2FA 5AIAA 2K8CB 8ICCA 3C2KA 3OHAA 2FMSA 4NLZA 1SZPA 1K1QA 4XRHA 3M8SA 2GH1A 3IHQB 5G5HA 1S9FA 4LJXA 4UW9A 3TFRA 3PX4A 5A0LA 4UAVA 3Q8PB 9ICTA 1SB3C 2LM4A 4XQ8A 3T5HA 4F71A 3U26A 4DCCA 2WF9A 3VC8A 4F5NA 1RYUA 5H2FU 2DFLA 4F4KA 4CF4A 1QSYA 3L3FX 5AHXA 1NKCA 2XGPA 1B22A 4EX7A 2QB0A 4F4WA 1HJPA 1U4BA 9ICWA 4DQQA 3RJKA 2DL0A 2W03A 4UQGA 1VDVA 5D49A 1HEKA 5HHIA 4IL6U 4UAYA 4Z6EA 1X9WA 2ASJA 5CHGA 1ZQWA 4DFJA 2YQEA 2XO7A 2H5XA 5KG0A 1X9MA 5EWEA 4YMMA 3N7SC 3QUTA 2LYBA 3C2MA 1BPEA 2HHQA 4U7CA 3NGDA 2V4RA 5KG1A 2HSZA 4P4OA 8ICAA 1N63A 3EW9A 3PMLA 4JK1A 1NK8A 2YTUA 2MSNA 4RNNA 3N7PD 3D2SA 3WU2U 4YR0A 4OCZA 2E8MA 2PFNA 1NZBA 3M6KA 3M9MB 2HI0A 4GXKA 4QZ9A 3PW0A 5ALIA 3IP4B 7ICRA 1DGSA 3CNHA 3M9OB 4IRDA 4KLSA 8ICBA 2F77X 2AGOA 4DL3A 5HP4A 2P6UA 5KFQA 3SQIA 4NL9A 5KAFU 4R66A 1Z19A 2WAQF 1IIPA 4Y2PA 4DSJA 4BWJA 3H0LB 3BS7A 4C0ZA 1K5OA 3RB3A 3NTUA 2K4IA 3C29A 3AU2A 5KT7A 1V38A 1ZQGA 4B9LA 1XWLA 1JMSA 1WUDA 4AYBF 1NKBA 4M6WB 2LPEA 3I28A 5AKZA 4DOCA 1ZETA 1TFRA 3M6ZA 1SV0A 2IBKA 3H8JA 2XY6A 5EE0A 2W54A 4HYKA 4G9BA 5KT2A 2BQ3A 1XNSA 2W7PA 3MR6A 2W9MA 1U49A 4M0AA 3TI0A 3Q8SB 4LVSA 4KLHA 1RYSA 9ICKA 1FEZA 9ICRA 3QU5A 2F3NA 1ZQFA 2BDUA 3NVYA 3RJHA 1QSLA 1JUDA 4UB1A 4QIWF 2OEHA 2KP7A 4M9GA 3BQ0A 4ELVA 4MFCA 9ICFA 3WK6A 4DS4A 5AM1A 2WB1F 2YMQA 5J2IA 2OYYA 2DWQA 2KIWA 3GV8B 5ALTA 4FO6A 2BGWA 5EE1A 4F3OA 4O3NA 4IRCA 3E2EA 8ICTA 4P2HA 5DBAA 2JHDA 4KLEA 3SMVA 5DG8A 2PFPA 3V7KA 3K4GA 4DL7A 2GOLA 3ZDCA 2AHOB 2LYHA 2KOBA 4DO9A 4CGZA 1NKEA 4UB4A 5AK4A 4RQ3A 3RAQA 2BPGA 5DB8A 5J2BA 2PMZF 1H38A 1FO4A 3JPQA 3SR6A 1B43A 1L7OA 4NL9C 4DSEA 4J9NA 4XUSA 1KTQA 4QZHA 5KFBA 4C7YA 9ICEA 1QSSA 1CRXA 3OTQA 4Q44A 4YCXA 4M6WA 4DLGA 4BUGA 3NUQA 4UARA 9ICHA 4IQTA 3PR5B 3AN1A 2RLTA 4DSFA 5IIKA 4RPXA 4EBDA 3ZDDA 7ICPA 4JB3A 4PGXA 2WF8A 4DSIA 2KICA 1RYRA 1Z4OA 4C4SA 2K60A 3THVA 2XICA 2W8KA 2QARB 3MDCA 3NVZA 3AM9A 4PHAA 4M47A 5J2GA 1TK0A 4DQSA 3CW2C 3TADA 2BQRA 2RRDA 1LKYB 5J0YA 4DS5A 2EQYA 5KFUA 4I2IA 8ICXA 5AIBA 3KHLA 4KLOA 4FFDA 4QW8A 8ICWA 1XSLA 1KW4A 2KHQA 4DFMA 2KVCA 4F5RA 1Z4NA 4C8KA 2J6TA 3HJEA 3H4DA 4E0DA 3AEVA 2Y0SF 4RQ4A 2F1IA 5ALPA 3QUBA 2MA1A 1ZQRA 1PK1B 5ALEA 2F8LA 3ZDAA 5KFJA 3QEAZ 3EUB2 2R8IA 1ZRMA 4YN4A 4KLQA 4M9NA 4O9MA 4PGQA 3GIMA 3WK8A 2JR5A 2KEYA 2AH5A 5AKJA 2ZIXB 3H4BA 3O0FA 4J9MA 1NJXA 5AI6A 5ALFA 2D8CA 4DLEA 3H0MB 5CJ7A 2I9GA 4KLGA 5J8YC 3F2BA 2YB4A 3JPSA 2EANA 4Y2UA 9ICOA 1N56A 4BX9C 2BCVA 2ISOA 5KFFA 1OXJA 4EEYA 2FDRA 2Z7JA 3RBEA 1CUKA 4MF2A 5C0YA 3UMGA 1B0XA 5J0WA 7ICGA 8ICJA 1HUOA 8ICIA 7ICQA 5L1IA 4UB3A 2FMQA 3M8RA 1LB2B 4IC9A 1ECWA 4ECXA 4F4XA 4B9TA 1SXEA 3LK9A 4O5EA 1BPBA 3FC4A 2QARA 9ICQA 4IQWA 2H3IA 3BQ1A 4P0QB 1RQLA 1DRGA 2ZTDA 3HPOA 2F76X 5KL8B 3KZIU 8ICGA 5KFVA 2XIDA 1LKYA 1URJA 4KTQA 8ICEA 3BQTA 3RH4A 4CRXA 3C1ZA 4O3SA 3C1YA 3WK4A 4I28A 1L7PA 2KIVA 3MR3A 1D8YA 3Q8QB 4EELA 3TADC 2W3SA 3WKBA 3DEEA 1L3UA 3C2LA 4MFFA 2IHNA 5L9XA 1PK1A 4ECRA 2BQUA 3UM9A 1LV5A 3QU2A 3V72A 5KG3A 1X40A 2N1RA 1SL0A 4NLKA 2IOHA 4I2DA 5B66U 2BCQA 5AM5A 7ICSA 2F2AB 4HAIA 1PZNA 2G09A 5DGBA 1QQ6A 5AKYA 4ELTA 2KKVA 3QUQA 3MGIA 2ZIXA 5IIOA 5DBBA 5KFDA 2JEGA 2OM6A 3ETLA 1HIWA 4RQ6A 4DQPA 4O3PA 5ALUA 2BKEA 3V7JA 5J2EA 3GIJA 3RH6A 4Y2TA 4ACOA 1L7MA 2DGZA 2A1AA 2HBMA 2RQ5A 5HMMA 1L3SA 2W9BB 3WKAA 4XA5A 4DFPA 2HOQA 4F8RA 2ZXIA 4QWDA 1NNLA 9ICJA 9ICIA 8ICMA 3OSPA 1KN5A 3RRHA 1CI4A 5ALSA 3LYSA 2IMWP 4QZ8A 4P0QA 2D3DA 4J9RA 1ZRNA 4PHEA 2ALZA 4KLLA 1TAMA 4KN4A 4J9PA 3GV5B 2I6XA 2JEIA 2AU0A 2BZFA 1J2NA 3B9JA 5JUMA 1QQ5A 5DG9A 4UB6U 5DQHA 2KD1A 1CEZA 1N62A 4M04A 2P35A 3QUCA 4Q45A 2VJ4A 1RQNA 2E8PA 5C5JA 4FBTA 2KNJA 2W9AA 1V97A 2ZIUB 3AQFA 3TKAA 1X9SA 4K4HA 3D2QA 7ICVA 5HNKA 2DKZA 7ICKA 1K1SA 3M7DA 2KJ8A 1TAUA 5CR0A 8ICVA 1S0NA 3Q8LA 2OXOA 2C2EA 3E58A 1SIJA 2GO7A 3GIKA 1F44A 4PH5A 1ZQQA 1YZ7A 3ISCA 4QZFA 5IILA 4BDPA 2C28A 4DQIA 1ZD3A 2JMGA 3D2NA 5ALXA 3MBYA 5KFZA 4UB5A 4NXZA 2XVTA 1XC9A 4KLJA 3UXNA 2JXJA 3JPNA 9ICAA 2B6GA 1UPHA 3HP6A 4MF8A 4B9VA 5AKXA 5KFSA 1DXSA 3QZ7A 5DQIA 4NV0A 4R64A 1TV9A 1TKDA 5AI5A 9ICLA 1NOMA 4KLMA 2EAOA 2EZXA 3HRDD 2C22A 2W43A 3LWLA 3PVXA 4IR9A 8ICUA 2JV3A 1COKA 3HWTA 2EZZA 3V6KA 2KSOB 3KKAC 3C21A 2HHXA 1RDFA 2QLTA 1N61A 3UMCA 4QZBA 2HOIA 9ICBA 4DSLA 5D4BA 1ZQLA 5DDYA 9ICPA 2ZJ8A 1KSPA 3MGVA 2XC9A 2F1JA 2K4EA 2AQ4A 3WKDA 2HBKA 5KFAA 1WWUA 5GTHU 4UAZA 2LHTA 3RR8A 3Q8MA 8ICPA 2ZIUA 2W7OA 4I2CA 3VCBA 4F72A 5HHHA 1X6JA 2G5IB 2IA6A 4RT3A 1MC8A 2VANA 4JV2A 4BJQA 5J2AA 1IV8A 1NK0A 4CF3A 4I2GA 4ECZA 1XU4A 4JV0A 3QX7A 5DG7A 1NJWA 1DK2A 2FLPA 3EZ5A 3PX0A 2GLEA 1JXLA 4F2SA 3RJFA 4DSKA 3BQ7A 4RQ7A 1BPDA 1N48A 5JTIA 2LBOA 3IM1A 1UT5A 5DB7A 5IINA 3BQ2A 4DOBA 4EENA 5DLGA 5ALLA 4C4RA 3ONNA 7ICJA 3TANA 3CP8A 9ICGA 3JPRA 4J9QA 4DF8A 4I29A 9ICXA 3RH5A 3H40A 5L1MA 4RQ5A 2A1JB 1J97A 2KVSA 2MU2A 4NLBA 2O6KA 4Y2RA 2Y9TA 4R63A 2FPKA 1RG6A 3MGHA 4O3RA 3FM9A 2AJQA 2KSOA 4RU9A 5J0TA 4CE6A 4JMUA 1PVQA 4ED6A 3J81j 3BZCA 4ECYA 1A77A 3AU6A 3HW8A 1KL9A 2KZZA 3KBBA 3F2CA 2G5HB 5ALDA 5F9LA 4EYIB 3N97B 2FLLA 1PVRA 2B0CA 2EH9A 1BNOA 3QU9A 3JPOA 4YMNA 2M9NA 5ALOA 3TAPA 7ICIA 1Q3VA 1NK4A 2E8OA 3GZFA 5EE3A 1VLBA 1VJ5A 2EDUA 5KFWA 4DL5A 2AQ0A 5DKWA 2OCEA 5J0OA 3K1RB 3IG5A 5IIJA 8ICRA 3C5FA 1NJZA 2ZG6A 3ISBA 2JRZA 4KX3A 4Y2XA 4WJ3B 1ZYQA 5J8YA 2FLNA 4DL4A 7ICTA 4C8NA 4Z6FA 4BWMA 3ED5A 4O5CA 3AUOA 3MFHA 1Q3UA 2Y1JA 2BPCA 3V6HA 4YXJA 4NLGA 1RM6C 4TUQA 7ICOA 1X9XA 8ICOA 1JRPA 4YQWA 2BCRA 1KBUA 2HBJA 4RUAA 4US8A 4GXIA 4EZ9A 4B9SA 3SV3A 3QU4A 4QWAA 1NJYA 2NO5A 2A1JA 4TUPA 4NM1A 5J0RA 1ED1A 4DL6A 2UVVA 2ZIWB 3L4PA 1O03A 4RT2A 1MN8A 7ICUA 5KFRA 1L5UA 4Z6DA 1IM4A 4I2FA 1NK6A 1UA1A 2FJ6A 2KTQA 2IOFK 3HX0A 5KFLA 5AM0A 5KTQA 3LDAA 5AI9A 4IR1A 3UXPA 4PHDA 2RDJA 4UAUA 3OSNA 3SZ2A 4TUSA 1DGJA 1QQ7A 1T94A 1TE2A 1UT8A 2DKXA 4OO1J 2NRTA 7ICLA 4MEXA 4I2HA 8ICKA 1SKWA 2WAQC 2ZIVB 3QE9Y 4KLTA 3RF9A 1NI3A 2KV2A 3PW5A 4DQRA 5KFKA 5T14A 4AYBC 1Z1VA 3F5EA 3T5JA 3ETRA 1Y88A 4CNQA 2DQNB 5ALHA 4NWIA 7ICEA 2C2DA 2JH1A 2LMRA 2E1EA 4JV1A 1TVAA 4RNOA 2PI5A 3HKZF 3FAHA 1C20A 5E79U 4U6PA 4F4ZA 4GC6A 1SKRA 2IOFA 1PVPA 5DGAA 8ICNA 1ZQMA 1S97A 3A0HU 3GU3A 3PR4A 3UQ0A 4F4YA 3E0FA 4DWIA 1PK3A 5J0PA 4R65A 1XSPA 1P7DA 7ICNA 1D8LA 1L8OA 2EZYA 4FE3A 2DPJA 3GILA 8ICLA 1OW5A 4QIWC 1UHUA 3V7LA 4ELUA 5B5EU 2OWOA 2ZIWA 1ZQJA 4PL2A 1ZD5A 2I5HA 1NZPA 3ZD8A 2WB1C 2R18A 1S77D 1AROP 4G3IA 4OD0A 2BR0A 4O0IA 3ISDA 2LKYA 3B0YA 4DEZA 2UVUA 2PFOA 1SZHA 5ALGA 1D8BA 1FIQA 4F50A 5KFMA 1JN3A 4PZNA 1FFUA 4QZIA 5IIIA 5BPCA 4YXMA 2AXTU 2W55A 3BJYA 1SGGA 2JH7A 5ALRA 1BVSA 1ZQSA 3T5LA 1ZJMA 1NK9A 4QZCA 2KFNA 2ZIVA 2ESEA 4ED3A 1KKXA 2PMZC 2VKQA 1U9LA 4QZAA 3JPPA 5L1JA 2KE7A 2MAXA 1JX4A 2HHSA 2YN4A 4PPXA 1ZQTA 5J2CA 2R8GA 4KN7A 1U45A 1GO3F 2FE9A 5AKIA 1ZQKA 3PY8A 2H3ZA 1ZQHA 3RJJA 1YZ6A 5DLFA 2HHVA 5KG7A 4I2AA 3RTVA 1A76A 3NVVA 3RJGA 3GQCA 4O3QA 1TK8A 3MR5A 8ICSA 4FZMA 4RQNA 8ICZA 2MUTB 4Y2SA 3QNMA 2R8HA 4OJOA 3GDXA 1A6SA 2B21A 4QNLA 4FS2A 1L3TA 2VIXA 2EAMA 2KJ9A 4GXJA 9ICUA 1KDHA 4TURA 5L1KA 4GFJA 1ZQAA 5KT4A 1BGXT 4DFKA 4Q8EA 4RPZA 5EE9A 8ICHA 1NK7A 2ISPA 1KFSA 7ICFA 1ZQNA 2XCPA 4BXOB 2NO4A 5HR7A 3RJIA 2QB1A 4Z6CA 3PMNA 2QB0B 3KKAA 3WK9A 4YVZA
chains in the Genus database with same CATH topology
3PSTA 2H3FA 2MRLA 3DEEA 5A0LA 2LKYA 2GOLA 2G0AA 2HMXA 3LVWA 4QJFB 3SQIA 3PSPA 2Y0SF 4PL1A 2KOBA 2H3QA 2A3VA 2VJ4A 3MGVA 4CGZA 1SZHA 1D8BA 2K4EA 1Z19A 2MA1A 2WAQF 4KMOB 1IIPA 1YT3A 2HBKA 2G5HB 3F2CA 2KNJA 2F8LA 2GH1A 3VC8A 2ZIUB 2K89A 3N7RC 2LHTA 3H0LB 1PVRA 3AQFA 2JGAA 4OJLA 4C0ZA 1MA7A 1T94A 2ZIUA 2PMZF 3D2QA 2W7OA 4OO1J 3F53A 3VCBA 2K4IA 3C29A 2N1RA 2K4HA 2G5IB 4O3MA 3M7DA 2KJ8A 3L3FX 3CRXA 1OUQA 2JH7A 3K1ZA 3ICXA 4BJQA 1Q3VA 2M0NA 1Z1BA 3GZFA 2F2AB 3NRWA 1WUDA 2WAQC 4AYBF 2ZIVB 2G09A 2KEYA 2ZIXB 1CRXA 2HOFA 2KKVA 2ZIVA 3O0FA 3RF9A 2KKPA 2OXOA 3IG5A 5CRXA 2ZIXA 2KHVA 4BUGA 2W03A 3M6ZA 2PMZC 3NUQA 4KX5A 3F5AA 2VKQA 3H0MB 3F2DA 1L6NA 1F44A 2ZG6A 3F2BA 2KV2A 2YB4A 1HEKA 2G06A 2W04A 4KX3A 4OJ5A 3PSFA 4BX9C 2LYAA 5T14A 2JMGA 2OM6A 1HIWA 2W7PA 1XNSA 4WJ3B 2HBLA 3D2NA 4AYBC 2RHFA 2VJ5A 4ICAA 3F5EA 2Z7JA 3T79A 3KZXA 2Y0SC 1GO3F 2DQNB 2LBOA 5C0YA 3PZPA 3OPXA 2K8BB 2H3ZA 2OH2A 3C28A 4FZNA 2XVTA 4ACOA 4NWIA 2DF4B 3N7SC 2K8AA 2KJ5A 2JH1A 2E1EA 2DGZA 4U6PA 2RP5A 2HBMA 1UPHA 3SAHA 2LYBA 3SAFA 4OJ6A 3HKZF 3IN5A 2CPRA 4FZMA 2BDUA 1Q3UA 3PSIA 4IC9A 4OJPA 3RFAA 2G07A 1ECWA 2HOQA 2CN1A 2KICA 2ZXIA 4U7CA 3ONNA 4QIWF 2NV3A 4OJOA 1A6SA 2F77X 3CP8A 1PVPA 4QNLA 2CRXA 2E5SA 2XICA 3IG8A 2VIXA 3GU3A 5KL1B 2KJ9A 4NV0A 1KBUA 3AL0B 2HBJA 2H3VA 3N7PD 4NLCA 3KFUF 2H3IA 3LYSA 3D2SA 4GFJA 3E0FA 1ZQ1C 4P0QB 2G08A 1DRGA 4A8EA 3HKZC 2E1FA 4P0QA 2XI9A 1P7DA 1NZBA 2F76X 2WB1F 3CYMA 3M6KA 4FE3A 5KL8B 2RRDA 2OYYA 1TAMA 4QIWC 2KIWA 2XIDA 1ED1A 2D6FC 1A0PA 4NLBA 2ZIWB 2K8CB 1XO0A 5HR6A 1URJA 4P0PB 2YX8A 2ZIWA 4CDGA 4CRXA 3IP4B 2Q4TA 2ZXHA 4P0PA 4PL2A 3AQEA 4FZLA 5HR7A 2YB1A 3ALRA 2HOIA 4JMUA 1PVQA 2JHDA 3SAGA 2KHQA 2KVCA 3LVVA 2WB1C 2KD1A 2R18A 3SMVA 3H0RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3F A;  2H3Z A;  2GOL A;  2HMX A;  2H3Q A;  1UPH A;  2LYB A;  1TAM A;  1ED1 A;  2K4E A;  1L6N A;  4IC9 A;  1ECW A;  2NV3 A;  1A6S A;  1HEK A;  2K4I A;  2LYA A;  2JMG A;  2K4H A;  1HIW A;  2N1R A;  4JMU A;  2H3V A;  4ICA A;  2H3I A; 
#chains in the Genus database with same CATH topology
 5KNI A;  3RBD A;  4M9H A;  2K4P A;  4IRK A;  3UPQ A;  1U48 A;  3NS1 A;  3LVW A;  4EEK A;  3LWM A;  2LM1 A;  2L5Y A;  2ZUC A;  3UMB A;  5KG4 A;  5J2K A;  4ECQ A;  4NLN A;  3C5G A;  5HML A;  7ICM A;  4I27 A;  4KMU A;  5ALY A;  5AI4 A;  4EYH B;  3F53 A;  4JWM A;  2K4H A;  3WK5 A;  1KLN A;  1EXN A;  4IQU A;  2NYV A;  2W3R A;  5KFE A;  1ZQX A;  2PXI A;  4ECT A;  2JEF A;  3PW7 A;  4ECU A;  5CRX A;  3MAB A;  2KHV A;  3F5A A;  1S76 D;  4Q8F A;  4RQ8 A;  1KEJ A;  1RXV A;  3BZK A;  3KTQ A;  8ICQ A;  3MDA A;  4PGY A;  1S5L U;  1QCK A;  5KG5 A;  3ZDE A;  2W11 A;  3PV8 A;  4YD1 A;  1V9P A;  2E8N A;  2XCA A;  3KHR A;  2OH2 A;  4O5K A;  3TQ1 A;  3S6J A;  4PJ0 U;  4RZR A;  2G07 A;  1X2I A;  1QH9 A;  5KAI U;  4RNM A;  1T7P A;  4Y2V A;  2NV3 A;  2MUT A;  4Q43 A;  4AP9 A;  3G6Y A;  4JWN A;  1WCL A;  2H3V A;  5KFO A;  2ZJ5 A;  3GFK B;  4DL2 A;  3RRG A;  1SL1 A;  4UBB A;  5TIS U;  4CCH A;  5ALK A;  1JXE A;  1X42 A;  1MQ2 A;  5DB6 A;  1XO0 A;  5CA7 A;  5HR6 A;  2XY5 A;  2YX8 A;  5DDM A;  5IIM A;  2W9B A;  2Q4T A;  2ZXH A;  2Y9U A;  2KK0 A;  3ZI4 A;  1QLN A;  5CWR A;  4BXO A;  3PW2 A;  3KOO A;  3PX6 A;  4O3O A;  5DB9 A;  4RQ0 A;  2JZB B;  5L1L A;  4C7Z A;  3BS5 B;  2R8K A;  5AKL A;  4ECW A;  4IS7 A;  4DFD A;  2ATL A;  4KLI A;  2K89 A;  4OJL A;  1S0O A;  2WFA A;  2GWS A;  2W8L A;  3IRU A;  5DBC A;  3L5K A;  3UXO A;  3ZD9 A;  2A19 A;  3OJU A;  5FP0 A;  5EWF A;  1NK5 A;  3NRZ A;  3M1Y A;  3EPG A;  2HHT A;  3T5K A;  2E3T A;  1JIH A;  4F5O A;  5F3X B;  3H8W A;  2DBY A;  3T3F A;  2BCU A;  2HBL A;  9ICV A;  2KFZ A;  3EYZ A;  4UAS A;  1T3Q A;  3GV7 B;  3PZP A;  3OPX A;  2ZTE A;  5KT5 A;  2KJ5 A;  3BDP A;  5JRT A;  1XSN A;  4OJP A;  5ALZ A;  1ZQB A;  4CF5 A;  5AM3 A;  3GII A;  4PHP A;  2KN7 A;  2CRX A;  2E5S A;  3IG8 A;  5ALW A;  4DOA A;  1BPZ A;  1BPX A;  4X5V A;  2BDP A;  5KFC A;  1N5W A;  2ASL A;  4ECS A;  3RB4 A;  4Y2Y A;  4IQV A;  1S0M A;  3CYM A;  2CXY A;  1N5X A;  3DV9 A;  3Q8K A;  1MQ3 A;  2F1H A;  2KZ3 A;  2VA8 A;  1KFD A;  2UVW A;  2ODG A;  4P0P B;  3QU7 A;  4F5P A;  2NRV A;  3JPT A;  1N60 A;  2HHU A;  4BGD A;  4ECV A;  2FI1 A;  2VA2 A;  3LVV A;  3OGU A;  3PST A;  3H0R B;  3PSP A;  4LZD A;  3WKC A;  2MRL A;  5AK3 A;  5ALN A;  2JZB A;  3PNC A;  1ZQY A;  4J9L A;  1B4F A;  2NRZ A;  4PL1 A;  4KLF A;  3BS5 A;  3NVW A;  4FBU A;  1SKS A;  3PO5 A;  1ZJN A;  1LVH A;  3PW4 A;  1MA7 A;  3IV6 A;  4YR3 A;  2FMP A;  5KFN A;  2LI6 A;  2Q0Z X;  5AKK A;  1OUQ A;  5TZV A;  5KFY A;  4TQS A;  3EPI A;  2M0N A;  2P6R A;  3FYH A;  4UAW A;  3SEN A;  5J2J A;  1ZQO A;  2HOF A;  4I2B A;  3OHB A;  3Q8R B;  4ZH4 A;  4KX5 A;  4EBE A;  4C80 A;  4US9 A;  5KFP A;  2V9W A;  2G06 A;  4KIT B;  4OJ5 A;  1S10 A;  4F2R A;  4J03 A;  1ZQZ A;  4ED1 A;  3M9N B;  2XY7 A;  1KQQ A;  4MHV A;  8ICY A;  4LZG A;  3IDW A;  2WTF A;  1AQ6 A;  1JAL A;  4FZN A;  4F91 B;  4P4P A;  4GIB A;  5EOZ A;  3H8S A;  1RZT A;  1J2M A;  3H7I A;  4QWC A;  4J9K A;  1WG8 A;  2CPR A;  4QWB A;  3PSI A;  4YR2 A;  4J9S A;  1WYG A;  5J29 A;  4M9L A;  1WWV A;  4YG2 A;  3C23 A;  4QWE A;  1XS9 D;  2KG5 A;  1TK5 A;  2J6U A;  5ALV A;  4A8E A;  2FPL A;  2E1F A;  1DK3 A;  4UB8 U;  3TFS A;  4B6J A;  1SXD A;  2D6F C;  5KFT A;  4YP3 A;  2Y1I A;  4CDG A;  3WK7 A;  4NY8 A;  5KG2 A;  4P0P A;  1ZD4 A;  4FZL A;  2YB1 A;  3RAX A;  3SV4 A;  2I1Q A;  1IXR A;  2J6S A;  2H3F A;  1ZQC A;  2HW3 A;  1QTM A;  1IG6 A;  4Y2J A;  5AKG A;  3KD3 A;  1YT3 A;  5AM2 A;  4RUC A;  4F93 B;  2RDI A;  2YY6 A;  3D6J A;  4GLX A;  3A0B U;  3CRX A;  4RQ1 A;  4M2Y A;  4KLU A;  3FDS A;  3K1Z A;  1F5S A;  1DOQ A;  1ZQE A;  1Z1B A;  1KFT A;  1SV0 C;  2V4Q A;  5AKE A;  5JU5 A;  2IHM A;  1L6N A;  1ZXI A;  2ZUD A;  4NM2 A;  5KT6 A;  2W04 A;  3RB0 A;  2C2R A;  5AM4 A;  3UQ2 A;  3V6J A;  4YFK A;  4EX6 A;  2AGP A;  4ICA A;  5AK6 A;  1ZQU A;  3KZX A;  2WF6 A;  2ZJA A;  4ED2 A;  5F9N A;  5GTI U;  1D9F A;  4I2J A;  4FS1 A;  1ZQD A;  5AI8 A;  5J0X A;  1F0M A;  5AIC A;  4UBC A;  1L3V A;  3PO4 A;  3NAS A;  3RFA A;  1RPL A;  1UQV A;  5J2H A;  2WF5 A;  1WCN A;  5KL1 B;  3EWA A;  4QW9 A;  3QZ8 A;  5K4L A;  4R8U B;  1MSW D;  1SV4 A;  9ICS A;  2DUY A;  5KG6 A;  3HT3 A;  5KFH A;  2W9C B;  3TAR A;  3SD7 A;  7ICH A;  1ZOL A;  3HIL A;  5G5G A;  4J9O A;  2PI4 A;  2ZTC A;  5J0U A;  3AQE A;  5ALM A;  3SYZ A;  2HDO A;  4JUZ A;  3KHH A;  3SAG A;  3I76 A;  3G6V A;  3SI8 A;  4YMO A;  1X6I A;  1Z00 B;  2BHN A;  4UB2 A;  1PUZ A;  2HMX A;  1X66 A;  5BOL A;  1UCV A;  3R9K A;  1L8L A;  1XO1 A;  5D46 A;  1S0V A;  4MFA A;  4I2E A;  3N28 A;  2JGA A;  1T8E A;  2OHF A;  9ICM A;  3ORY A;  4RPY A;  4YD2 A;  5AK5 A;  5CEH A;  4O3M A;  1SL2 A;  4C8O A;  3NRW A;  3QYP A;  2ZUB A;  2KKP A;  2VA3 A;  2BCS A;  1T4G A;  1T3N A;  4KLD A;  4QZG A;  2BPF A;  3PSF A;  2LYA A;  5J2D A;  2RHF A;  9ICC A;  2VJ5 A;  4ED0 A;  2K8B B;  2DF4 B;  1C7Y A;  2K8A A;  4B9U A;  2NRX A;  5KFG A;  1HUZ A;  5ALQ A;  3SAF A;  5KFI A;  2JEJ A;  2QKQ A;  1N2X A;  2CN1 A;  1BPY A;  2F44 A;  2ASD A;  4C8L A;  2HCF A;  3G6X A;  4F5Q A;  3AL0 B;  3RR7 A;  5CB1 A;  1BNP A;  2PFQ A;  1Q8K A;  4C4T A;  3MR2 A;  3ZDB A;  1TAQ A;  2G08 A;  1ZQV A;  5AKH A;  4R8U A;  4RQ2 A;  4ED7 A;  2WHE A;  2YMM A;  3DDH A;  3TAQ A;  1V85 A;  2W9C A;  1Q46 A;  3WKE A;  4DF4 A;  4GC7 A;  1O08 A;  4EZ6 A;  4PZO A;  3MFI A;  8ICF A;  3N4M B;  9ICN A;  2NRW A;  4K4G A;  5J0S A;  3QEB Z;  3ALR A;  5EWG A;  4QZE A;  4F92 B;  2KZM A;  1ZQI A;  1L7N A;  1Z00 A;  4M9J A;  2G0A A;  2UVR A;  4QJF B;  1ZQP A;  2A3V A;  2H3Q A;  3SEI A;  2EAP A;  3B0X A;  4KMO B;  2R8J A;  4ZOH C;  2ES6 A;  1M6Y A;  1FFV A;  3N7R C;  4TQR A;  1ZD2 P;  5BOM A;  4P4M A;  4QZD A;  4RQM A;  2KMD A;  3I1Y A;  3KHG A;  2DPI A;  3ICX A;  4ED8 A;  1COO A;  4B9M A;  2AGQ A;  5KT3 A;  1JI7 A;  5DQG A;  1SWV A;  3QXG A;  3F2D A;  1JRO A;  4UAT A;  3AMZ A;  4B9N A;  2F8K A;  1KRP A;  5J0Q A;  3OJS A;  4Y2Q A;  3RB6 A;  3K75 D;  4MEY A;  1UA0 A;  1RXW A;  3T79 A;  2Y0S C;  4C8M A;  2WF7 A;  1Z3E B;  3C28 A;  4EBC A;  2HVI A;  2P66 A;  2HHW A;  4K4I A;  5ALJ A;  2PKE A;  2HVH A;  2RP5 A;  3SAH A;  3H8M A;  4OJ6 A;  3IN5 A;  1SWW A;  5KFX A;  3MC1 A;  1U47 A;  1D9D A;  4NLC A;  3KFU F;  2YMP A;  3RJE A;  1ZQ1 C;  2YML A;  1S8O A;  2FPM A;  3HKZ C;  4NJ8 A;  2XI9 A;  5CP2 A;  2XGQ A;  5AI0 A;  3TAC B;  4USA A;  1A0P A;  5J2F A;  5AIA A;  2K8C B;  8ICC A;  3C2K A;  3OHA A;  2FMS A;  4NLZ A;  1SZP A;  1K1Q A;  4XRH A;  3M8S A;  2GH1 A;  3IHQ B;  5G5H A;  1S9F A;  4LJX A;  4UW9 A;  3TFR A;  3PX4 A;  5A0L A;  4UAV A;  3Q8P B;  9ICT A;  1SB3 C;  2LM4 A;  4XQ8 A;  3T5H A;  4F71 A;  3U26 A;  4DCC A;  2WF9 A;  3VC8 A;  4F5N A;  1RYU A;  5H2F U;  2DFL A;  4F4K A;  4CF4 A;  1QSY A;  3L3F X;  5AHX A;  1NKC A;  2XGP A;  1B22 A;  4EX7 A;  2QB0 A;  4F4W A;  1HJP A;  1U4B A;  9ICW A;  4DQQ A;  3RJK A;  2DL0 A;  2W03 A;  4UQG A;  1VDV A;  5D49 A;  1HEK A;  5HHI A;  4IL6 U;  4UAY A;  4Z6E A;  1X9W A;  2ASJ A;  5CHG A;  1ZQW A;  4DFJ A;  2YQE A;  2XO7 A;  2H5X A;  5KG0 A;  1X9M A;  5EWE A;  4YMM A;  3N7S C;  3QUT A;  2LYB A;  3C2M A;  1BPE A;  2HHQ A;  4U7C A;  3NGD A;  2V4R A;  5KG1 A;  2HSZ A;  4P4O A;  8ICA A;  1N63 A;  3EW9 A;  3PML A;  4JK1 A;  1NK8 A;  2YTU A;  2MSN A;  4RNN A;  3N7P D;  3D2S A;  3WU2 U;  4YR0 A;  4OCZ A;  2E8M A;  2PFN A;  1NZB A;  3M6K A;  3M9M B;  2HI0 A;  4GXK A;  4QZ9 A;  3PW0 A;  5ALI A;  3IP4 B;  7ICR A;  1DGS A;  3CNH A;  3M9O B;  4IRD A;  4KLS A;  8ICB A;  2F77 X;  2AGO A;  4DL3 A;  5HP4 A;  2P6U A;  5KFQ A;  3SQI A;  4NL9 A;  5KAF U;  4R66 A;  1Z19 A;  2WAQ F;  1IIP A;  4Y2P A;  4DSJ A;  4BWJ A;  3H0L B;  3BS7 A;  4C0Z A;  1K5O A;  3RB3 A;  3NTU A;  2K4I A;  3C29 A;  3AU2 A;  5KT7 A;  1V38 A;  1ZQG A;  4B9L A;  1XWL A;  1JMS A;  1WUD A;  4AYB F;  1NKB A;  4M6W B;  2LPE A;  3I28 A;  5AKZ A;  4DOC A;  1ZET A;  1TFR A;  3M6Z A;  1SV0 A;  2IBK A;  3H8J A;  2XY6 A;  5EE0 A;  2W54 A;  4HYK A;  4G9B A;  5KT2 A;  2BQ3 A;  1XNS A;  2W7P A;  3MR6 A;  2W9M A;  1U49 A;  4M0A A;  3TI0 A;  3Q8S B;  4LVS A;  4KLH A;  1RYS A;  9ICK A;  1FEZ A;  9ICR A;  3QU5 A;  2F3N A;  1ZQF A;  2BDU A;  3NVY A;  3RJH A;  1QSL A;  1JUD A;  4UB1 A;  4QIW F;  2OEH A;  2KP7 A;  4M9G A;  3BQ0 A;  4ELV A;  4MFC A;  9ICF A;  3WK6 A;  4DS4 A;  5AM1 A;  2WB1 F;  2YMQ A;  5J2I A;  2OYY A;  2DWQ A;  2KIW A;  3GV8 B;  5ALT A;  4FO6 A;  2BGW A;  5EE1 A;  4F3O A;  4O3N A;  4IRC A;  3E2E A;  8ICT A;  4P2H A;  5DBA A;  2JHD A;  4KLE A;  3SMV A;  5DG8 A;  2PFP A;  3V7K A;  3K4G A;  4DL7 A;  2GOL A;  3ZDC A;  2AHO B;  2LYH A;  2KOB A;  4DO9 A;  4CGZ A;  1NKE A;  4UB4 A;  5AK4 A;  4RQ3 A;  3RAQ A;  2BPG A;  5DB8 A;  5J2B A;  2PMZ F;  1H38 A;  1FO4 A;  3JPQ A;  3SR6 A;  1B43 A;  1L7O A;  4NL9 C;  4DSE A;  4J9N A;  4XUS A;  1KTQ A;  4QZH A;  5KFB A;  4C7Y A;  9ICE A;  1QSS A;  1CRX A;  3OTQ A;  4Q44 A;  4YCX A;  4M6W A;  4DLG A;  4BUG A;  3NUQ A;  4UAR A;  9ICH A;  4IQT A;  3PR5 B;  3AN1 A;  2RLT A;  4DSF A;  5IIK A;  4RPX A;  4EBD A;  3ZDD A;  7ICP A;  4JB3 A;  4PGX A;  2WF8 A;  4DSI A;  2KIC A;  1RYR A;  1Z4O A;  4C4S A;  2K60 A;  3THV A;  2XIC A;  2W8K A;  2QAR B;  3MDC A;  3NVZ A;  3AM9 A;  4PHA A;  4M47 A;  5J2G A;  1TK0 A;  4DQS A;  3CW2 C;  3TAD A;  2BQR A;  2RRD A;  1LKY B;  5J0Y A;  4DS5 A;  2EQY A;  5KFU A;  4I2I A;  8ICX A;  5AIB A;  3KHL A;  4KLO A;  4FFD A;  4QW8 A;  8ICW A;  1XSL A;  1KW4 A;  2KHQ A;  4DFM A;  2KVC A;  4F5R A;  1Z4N A;  4C8K A;  2J6T A;  3HJE A;  3H4D A;  4E0D A;  3AEV A;  2Y0S F;  4RQ4 A;  2F1I A;  5ALP A;  3QUB A;  2MA1 A;  1ZQR A;  1PK1 B;  5ALE A;  2F8L A;  3ZDA A;  5KFJ A;  3QEA Z;  3EUB 2;  2R8I A;  1ZRM A;  4YN4 A;  4KLQ A;  4M9N A;  4O9M A;  4PGQ A;  3GIM A;  3WK8 A;  2JR5 A;  2KEY A;  2AH5 A;  5AKJ A;  2ZIX B;  3H4B A;  3O0F A;  4J9M A;  1NJX A;  5AI6 A;  5ALF A;  2D8C A;  4DLE A;  3H0M B;  5CJ7 A;  2I9G A;  4KLG A;  5J8Y C;  3F2B A;  2YB4 A;  3JPS A;  2EAN A;  4Y2U A;  9ICO A;  1N56 A;  4BX9 C;  2BCV A;  2ISO A;  5KFF A;  1OXJ A;  4EEY A;  2FDR A;  2Z7J A;  3RBE A;  1CUK A;  4MF2 A;  5C0Y A;  3UMG A;  1B0X A;  5J0W A;  7ICG A;  8ICJ A;  1HUO A;  8ICI A;  7ICQ A;  5L1I A;  4UB3 A;  2FMQ A;  3M8R A;  1LB2 B;  4IC9 A;  1ECW A;  4ECX A;  4F4X A;  4B9T A;  1SXE A;  3LK9 A;  4O5E A;  1BPB A;  3FC4 A;  2QAR A;  9ICQ A;  4IQW A;  2H3I A;  3BQ1 A;  4P0Q B;  1RQL A;  1DRG A;  2ZTD A;  3HPO A;  2F76 X;  5KL8 B;  3KZI U;  8ICG A;  5KFV A;  2XID A;  1LKY A;  1URJ A;  4KTQ A;  8ICE A;  3BQT A;  3RH4 A;  4CRX A;  3C1Z A;  4O3S A;  3C1Y A;  3WK4 A;  4I28 A;  1L7P A;  2KIV A;  3MR3 A;  1D8Y A;  3Q8Q B;  4EEL A;  3TAD C;  2W3S A;  3WKB A;  3DEE A;  1L3U A;  3C2L A;  4MFF A;  2IHN A;  5L9X A;  1PK1 A;  4ECR A;  2BQU A;  3UM9 A;  1LV5 A;  3QU2 A;  3V72 A;  5KG3 A;  1X40 A;  2N1R A;  1SL0 A;  4NLK A;  2IOH A;  4I2D A;  5B66 U;  2BCQ A;  5AM5 A;  7ICS A;  2F2A B;  4HAI A;  1PZN A;  2G09 A;  5DGB A;  1QQ6 A;  5AKY A;  4ELT A;  2KKV A;  3QUQ A;  3MGI A;  2ZIX A;  5IIO A;  5DBB A;  5KFD A;  2JEG A;  2OM6 A;  3ETL A;  1HIW A;  4RQ6 A;  4DQP A;  4O3P A;  5ALU A;  2BKE A;  3V7J A;  5J2E A;  3GIJ A;  3RH6 A;  4Y2T A;  4ACO A;  1L7M A;  2DGZ A;  2A1A A;  2HBM A;  2RQ5 A;  5HMM A;  1L3S A;  2W9B B;  3WKA A;  4XA5 A;  4DFP A;  2HOQ A;  4F8R A;  2ZXI A;  4QWD A;  1NNL A;  9ICJ A;  9ICI A;  8ICM A;  3OSP A;  1KN5 A;  3RRH A;  1CI4 A;  5ALS A;  3LYS A;  2IMW P;  4QZ8 A;  4P0Q A;  2D3D A;  4J9R A;  1ZRN A;  4PHE A;  2ALZ A;  4KLL A;  1TAM A;  4KN4 A;  4J9P A;  3GV5 B;  2I6X A;  2JEI A;  2AU0 A;  2BZF A;  1J2N A;  3B9J A;  5JUM A;  1QQ5 A;  5DG9 A;  4UB6 U;  5DQH A;  2KD1 A;  1CEZ A;  1N62 A;  4M04 A;  2P35 A;  3QUC A;  4Q45 A;  2VJ4 A;  1RQN A;  2E8P A;  5C5J A;  4FBT A;  2KNJ A;  2W9A A;  1V97 A;  2ZIU B;  3AQF A;  3TKA A;  1X9S A;  4K4H A;  3D2Q A;  7ICV A;  5HNK A;  2DKZ A;  7ICK A;  1K1S A;  3M7D A;  2KJ8 A;  1TAU A;  5CR0 A;  8ICV A;  1S0N A;  3Q8L A;  2OXO A;  2C2E A;  3E58 A;  1SIJ A;  2GO7 A;  3GIK A;  1F44 A;  4PH5 A;  1ZQQ A;  1YZ7 A;  3ISC A;  4QZF A;  5IIL A;  4BDP A;  2C28 A;  4DQI A;  1ZD3 A;  2JMG A;  3D2N A;  5ALX A;  3MBY A;  5KFZ A;  4UB5 A;  4NXZ A;  2XVT A;  1XC9 A;  4KLJ A;  3UXN A;  2JXJ A;  3JPN A;  9ICA A;  2B6G A;  1UPH A;  3HP6 A;  4MF8 A;  4B9V A;  5AKX A;  5KFS A;  1DXS A;  3QZ7 A;  5DQI A;  4NV0 A;  4R64 A;  1TV9 A;  1TKD A;  5AI5 A;  9ICL A;  1NOM A;  4KLM A;  2EAO A;  2EZX A;  3HRD D;  2C22 A;  2W43 A;  3LWL A;  3PVX A;  4IR9 A;  8ICU A;  2JV3 A;  1COK A;  3HWT A;  2EZZ A;  3V6K A;  2KSO B;  3KKA C;  3C21 A;  2HHX A;  1RDF A;  2QLT A;  1N61 A;  3UMC A;  4QZB A;  2HOI A;  9ICB A;  4DSL A;  5D4B A;  1ZQL A;  5DDY A;  9ICP A;  2ZJ8 A;  1KSP A;  3MGV A;  2XC9 A;  2F1J A;  2K4E A;  2AQ4 A;  3WKD A;  2HBK A;  5KFA A;  1WWU A;  5GTH U;  4UAZ A;  2LHT A;  3RR8 A;  3Q8M A;  8ICP A;  2ZIU A;  2W7O A;  4I2C A;  3VCB A;  4F72 A;  5HHH A;  1X6J A;  2G5I B;  2IA6 A;  4RT3 A;  1MC8 A;  2VAN A;  4JV2 A;  4BJQ A;  5J2A A;  1IV8 A;  1NK0 A;  4CF3 A;  4I2G A;  4ECZ A;  1XU4 A;  4JV0 A;  3QX7 A;  5DG7 A;  1NJW A;  1DK2 A;  2FLP A;  3EZ5 A;  3PX0 A;  2GLE A;  1JXL A;  4F2S A;  3RJF A;  4DSK A;  3BQ7 A;  4RQ7 A;  1BPD A;  1N48 A;  5JTI A;  2LBO A;  3IM1 A;  1UT5 A;  5DB7 A;  5IIN A;  3BQ2 A;  4DOB A;  4EEN A;  5DLG A;  5ALL A;  4C4R A;  3ONN A;  7ICJ A;  3TAN A;  3CP8 A;  9ICG A;  3JPR A;  4J9Q A;  4DF8 A;  4I29 A;  9ICX A;  3RH5 A;  3H40 A;  5L1M A;  4RQ5 A;  2A1J B;  1J97 A;  2KVS A;  2MU2 A;  4NLB A;  2O6K A;  4Y2R A;  2Y9T A;  4R63 A;  2FPK A;  1RG6 A;  3MGH A;  4O3R A;  3FM9 A;  2AJQ A;  2KSO A;  4RU9 A;  5J0T A;  4CE6 A;  4JMU A;  1PVQ A;  4ED6 A;  3J81 j;  3BZC A;  4ECY A;  1A77 A;  3AU6 A;  3HW8 A;  1KL9 A;  2KZZ A;  3KBB A;  3F2C A;  2G5H B;  5ALD A;  5F9L A;  4EYI B;  3N97 B;  2FLL A;  1PVR A;  2B0C A;  2EH9 A;  1BNO A;  3QU9 A;  3JPO A;  4YMN A;  2M9N A;  5ALO A;  3TAP A;  7ICI A;  1Q3V A;  1NK4 A;  2E8O A;  3GZF A;  5EE3 A;  1VLB A;  1VJ5 A;  2EDU A;  5KFW A;  4DL5 A;  2AQ0 A;  5DKW A;  2OCE A;  5J0O A;  3K1R B;  3IG5 A;  5IIJ A;  8ICR A;  3C5F A;  1NJZ A;  2ZG6 A;  3ISB A;  2JRZ A;  4KX3 A;  4Y2X A;  4WJ3 B;  1ZYQ A;  5J8Y A;  2FLN A;  4DL4 A;  7ICT A;  4C8N A;  4Z6F A;  4BWM A;  3ED5 A;  4O5C A;  3AUO A;  3MFH A;  1Q3U A;  2Y1J A;  2BPC A;  3V6H A;  4YXJ A;  4NLG A;  1RM6 C;  4TUQ A;  7ICO A;  1X9X A;  8ICO A;  1JRP A;  4YQW A;  2BCR A;  1KBU A;  2HBJ A;  4RUA A;  4US8 A;  4GXI A;  4EZ9 A;  4B9S A;  3SV3 A;  3QU4 A;  4QWA A;  1NJY A;  2NO5 A;  2A1J A;  4TUP A;  4NM1 A;  5J0R A;  1ED1 A;  4DL6 A;  2UVV A;  2ZIW B;  3L4P A;  1O03 A;  4RT2 A;  1MN8 A;  7ICU A;  5KFR A;  1L5U A;  4Z6D A;  1IM4 A;  4I2F A;  1NK6 A;  1UA1 A;  2FJ6 A;  2KTQ A;  2IOF K;  3HX0 A;  5KFL A;  5AM0 A;  5KTQ A;  3LDA A;  5AI9 A;  4IR1 A;  3UXP A;  4PHD A;  2RDJ A;  4UAU A;  3OSN A;  3SZ2 A;  4TUS A;  1DGJ A;  1QQ7 A;  1T94 A;  1TE2 A;  1UT8 A;  2DKX A;  4OO1 J;  2NRT A;  7ICL A;  4MEX A;  4I2H A;  8ICK A;  1SKW A;  2WAQ C;  2ZIV B;  3QE9 Y;  4KLT A;  3RF9 A;  1NI3 A;  2KV2 A;  3PW5 A;  4DQR A;  5KFK A;  5T14 A;  4AYB C;  1Z1V A;  3F5E A;  3T5J A;  3ETR A;  1Y88 A;  4CNQ A;  2DQN B;  5ALH A;  4NWI A;  7ICE A;  2C2D A;  2JH1 A;  2LMR A;  2E1E A;  4JV1 A;  1TVA A;  4RNO A;  2PI5 A;  3HKZ F;  3FAH A;  1C20 A;  5E79 U;  4U6P A;  4F4Z A;  4GC6 A;  1SKR A;  2IOF A;  1PVP A;  5DGA A;  8ICN A;  1ZQM A;  1S97 A;  3A0H U;  3GU3 A;  3PR4 A;  3UQ0 A;  4F4Y A;  3E0F A;  4DWI A;  1PK3 A;  5J0P A;  4R65 A;  1XSP A;  1P7D A;  7ICN A;  1D8L A;  1L8O A;  2EZY A;  4FE3 A;  2DPJ A;  3GIL A;  8ICL A;  1OW5 A;  4QIW C;  1UHU A;  3V7L A;  4ELU A;  5B5E U;  2OWO A;  2ZIW A;  1ZQJ A;  4PL2 A;  1ZD5 A;  2I5H A;  1NZP A;  3ZD8 A;  2WB1 C;  2R18 A;  1S77 D;  1ARO P;  4G3I A;  4OD0 A;  2BR0 A;  4O0I A;  3ISD A;  2LKY A;  3B0Y A;  4DEZ A;  2UVU A;  2PFO A;  1SZH A;  5ALG A;  1D8B A;  1FIQ A;  4F50 A;  5KFM A;  1JN3 A;  4PZN A;  1FFU A;  4QZI A;  5III A;  5BPC A;  4YXM A;  2AXT U;  2W55 A;  3BJY A;  1SGG A;  2JH7 A;  5ALR A;  1BVS A;  1ZQS A;  3T5L A;  1ZJM A;  1NK9 A;  4QZC A;  2KFN A;  2ZIV A;  2ESE A;  4ED3 A;  1KKX A;  2PMZ C;  2VKQ A;  1U9L A;  4QZA A;  3JPP A;  5L1J A;  2KE7 A;  2MAX A;  1JX4 A;  2HHS A;  2YN4 A;  4PPX A;  1ZQT A;  5J2C A;  2R8G A;  4KN7 A;  1U45 A;  1GO3 F;  2FE9 A;  5AKI A;  1ZQK A;  3PY8 A;  2H3Z A;  1ZQH A;  3RJJ A;  1YZ6 A;  5DLF A;  2HHV A;  5KG7 A;  4I2A A;  3RTV A;  1A76 A;  3NVV A;  3RJG A;  3GQC A;  4O3Q A;  1TK8 A;  3MR5 A;  8ICS A;  4FZM A;  4RQN A;  8ICZ A;  2MUT B;  4Y2S A;  3QNM A;  2R8H A;  4OJO A;  3GDX A;  1A6S A;  2B21 A;  4QNL A;  4FS2 A;  1L3T A;  2VIX A;  2EAM A;  2KJ9 A;  4GXJ A;  9ICU A;  1KDH A;  4TUR A;  5L1K A;  4GFJ A;  1ZQA A;  5KT4 A;  1BGX T;  4DFK A;  4Q8E A;  4RPZ A;  5EE9 A;  8ICH A;  1NK7 A;  2ISP A;  1KFS A;  7ICF A;  1ZQN A;  2XCP A;  4BXO B;  2NO4 A;  5HR7 A;  3RJI A;  2QB1 A;  4Z6C A;  3PMN A;  2QB0 B;  3KKA A;  3WK9 A;  4YVZ A; 
#chains in the Genus database with same CATH homology
 3PST A;  2H3F A;  2MRL A;  3DEE A;  5A0L A;  2LKY A;  2GOL A;  2G0A A;  2HMX A;  3LVW A;  4QJF B;  3SQI A;  3PSP A;  2Y0S F;  4PL1 A;  2KOB A;  2H3Q A;  2A3V A;  2VJ4 A;  3MGV A;  4CGZ A;  1SZH A;  1D8B A;  2K4E A;  1Z19 A;  2MA1 A;  2WAQ F;  4KMO B;  1IIP A;  1YT3 A;  2HBK A;  2G5H B;  3F2C A;  2KNJ A;  2F8L A;  2GH1 A;  3VC8 A;  2ZIU B;  2K89 A;  3N7R C;  2LHT A;  3H0L B;  1PVR A;  3AQF A;  2JGA A;  4OJL A;  4C0Z A;  1MA7 A;  1T94 A;  2ZIU A;  2PMZ F;  3D2Q A;  2W7O A;  4OO1 J;  3F53 A;  3VCB A;  2K4I A;  3C29 A;  2N1R A;  2K4H A;  2G5I B;  4O3M A;  3M7D A;  2KJ8 A;  3L3F X;  3CRX A;  1OUQ A;  2JH7 A;  3K1Z A;  3ICX A;  4BJQ A;  1Q3V A;  2M0N A;  1Z1B A;  3GZF A;  2F2A B;  3NRW A;  1WUD A;  2WAQ C;  4AYB F;  2ZIV B;  2G09 A;  2KEY A;  2ZIX B;  1CRX A;  2HOF A;  2KKV A;  2ZIV A;  3O0F A;  3RF9 A;  2KKP A;  2OXO A;  3IG5 A;  5CRX A;  2ZIX A;  2KHV A;  4BUG A;  2W03 A;  3M6Z A;  2PMZ C;  3NUQ A;  4KX5 A;  3F5A A;  2VKQ A;  3H0M B;  3F2D A;  1L6N A;  1F44 A;  2ZG6 A;  3F2B A;  2KV2 A;  2YB4 A;  1HEK A;  2G06 A;  2W04 A;  4KX3 A;  4OJ5 A;  3PSF A;  4BX9 C;  2LYA A;  5T14 A;  2JMG A;  2OM6 A;  1HIW A;  2W7P A;  1XNS A;  4WJ3 B;  2HBL A;  3D2N A;  4AYB C;  2RHF A;  2VJ5 A;  4ICA A;  3F5E A;  2Z7J A;  3T79 A;  3KZX A;  2Y0S C;  1GO3 F;  2DQN B;  2LBO A;  5C0Y A;  3PZP A;  3OPX A;  2K8B B;  2H3Z A;  2OH2 A;  3C28 A;  4FZN A;  2XVT A;  4ACO A;  4NWI A;  2DF4 B;  3N7S C;  2K8A A;  2KJ5 A;  2JH1 A;  2E1E A;  2DGZ A;  4U6P A;  2RP5 A;  2HBM A;  1UPH A;  3SAH A;  2LYB A;  3SAF A;  4OJ6 A;  3HKZ F;  3IN5 A;  2CPR A;  4FZM A;  2BDU A;  1Q3U A;  3PSI A;  4IC9 A;  4OJP A;  3RFA A;  2G07 A;  1ECW A;  2HOQ A;  2CN1 A;  2KIC A;  2ZXI A;  4U7C A;  3ONN A;  4QIW F;  2NV3 A;  4OJO A;  1A6S A;  2F77 X;  3CP8 A;  1PVP A;  4QNL A;  2CRX A;  2E5S A;  2XIC A;  3IG8 A;  2VIX A;  3GU3 A;  5KL1 B;  2KJ9 A;  4NV0 A;  1KBU A;  3AL0 B;  2HBJ A;  2H3V A;  3N7P D;  4NLC A;  3KFU F;  2H3I A;  3LYS A;  3D2S A;  4GFJ A;  3E0F A;  1ZQ1 C;  4P0Q B;  2G08 A;  1DRG A;  4A8E A;  3HKZ C;  2E1F A;  4P0Q A;  2XI9 A;  1P7D A;  1NZB A;  2F76 X;  2WB1 F;  3CYM A;  3M6K A;  4FE3 A;  5KL8 B;  2RRD A;  2OYY A;  1TAM A;  4QIW C;  2KIW A;  2XID A;  1ED1 A;  2D6F C;  1A0P A;  4NLB A;  2ZIW B;  2K8C B;  1XO0 A;  5HR6 A;  1URJ A;  4P0P B;  2YX8 A;  2ZIW A;  4CDG A;  4CRX A;  3IP4 B;  2Q4T A;  2ZXH A;  4P0P A;  4PL2 A;  3AQE A;  4FZL A;  5HR7 A;  2YB1 A;  3ALR A;  2HOI A;  4JMU A;  1PVQ A;  2JHD A;  3SAG A;  2KHQ A;  2KVC A;  3LVV A;  2WB1 C;  2KD1 A;  2R18 A;  3SMV A;  3H0R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...