1ECWA

Crystal structure of simian immunodeficiency virus matrix antigen (siv ma) at 293k.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
114
structure length
114
Chain Sequence
SVLSGKKADELEKIRLRPGGKKKYMLKHVVWAANELDRFGLAESLLENKEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIHAEEKVKHTEEAKQIVQRHLVVETGTAETMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Crystal structure of SIV matrix antigen and implications for virus assembly.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 38
structure length 114
sequence length 114
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1ecwA00
4ICAA 2K4IA 4IC9A 4JMUA 2LYAA 1HIWA 2H3ZA 1TAMA 2N1RA 2HMXA 2H3VA 2H3QA 2NV3A 1HEKA 2K4HA 2LYBA 1ECWA 2H3IA 2K4EA 2GOLA 1L6NA 1A6SA 1ED1A 2H3FA 2JMGA 1UPHA
chains in the Genus database with same CATH superfamily
2JH7A 5J0WA 1L8LA 2YY6A 1KFSA 4IS7A 1SL1A 2IMWP 3PX4A 5DKWA 4Y2XA 3V7KA 4J9LA 4KITB 4YMOA 1XWLA 1MA7A 5EE1A 2VANA 4Y2JA 2FMSA 1A0PA 4J9RA 3KD3A 7ICJA 3NVZA 4NLCA 4KLTA 4U6PA 4F3OA 2QARB 1F0MA 1ZQOA 3B0XA 1Z00A 3C21A 2H3VA 3OJSA 3IV6A 3RH4A 1U49A 1KDHA 3GDXA 4XUSA 4Y2QA 2O6KA 5KFAA 3JPPA 3N7PD 5KFPA 9ICQA 2AGPA 4U7CA 3NTUA 4QWBA 4C7YA 4PGQA 4ECXA 1ZJMA 2FE9A 4Y2YA 1NK8A 2RLTA 2E8PA 1FEZA 3EUB2 4QZGA 3MR5A 5DBCA 8ICPA 3RJEA 1L7MA 1ZQDA 4O3NA 3WK8A 4Z6EA 4I27A 2KP7A 5J0RA 1K1SA 4UBCA 3IRUA 1MQ3A 3WU2U 2AQ4A 5CHGA 1ZQTA 4K4GA 1Q3VA 4J9KA 2WB1C 3UM9A 2CPRA 3OTQA 3TAPA 1J2MA 5H2FU 4RUAA 4QZIA 3H8WA 2HDOA 4TURA 4KLDA 1L7PA 2W8LA 4Q8FA 3D2SA 4O3RA 4G9BA 2V4QA 7ICIA 2HHUA 8ICTA 1BPZA 3FC4A 1JIHA 8ICXA 4KN7A 4LVSA 3ED5A 5J2IA 3MGVA 1TAQA 5KT2A 2KMDA 4DWIA 3UMGA 5J2EA 4DQQA 4PL2A 2OWOA 2PI4A 2YTUA 4ZH4A 5DBAA 1RXVA 4YR3A 1F44A 4B9NA 4YMMA 1UT8A 3VC8A 7ICQA 1JROA 1L3UA 8ICUA 4KTQA 2JZBB 1S0NA 4B6JA 4R66A 1T94A 3BJYA 4I29A 2P6UA 3IDWA 2XO7A 2YMQA 3T3FA 5KFBA 1BPYA 1QSSA 2R8HA 3E0FA 2F76X 2XICA 1MN8A 3H40A 3ETLA 7ICMA 4UQGA 1TVAA 9ICNA 2MUTB 4KX3A 3F53A 5AKHA 2K4IA 4QZHA 4C8OA 4F5RA 1D8BA 2VA8A 4KMOB 1HEKA 5KFYA 3WK5A 4DSIA 2HHTA 2ZXHA 3PSPA 3T5JA 1D9FA 1QQ5A 5AI9A 1L6NA 3WK4A 5ALVA 2F3NA 5DB8A 1SV4A 1BPXA 1ZXIA 3CW2C 1T8EA 5HHHA 1SXDA 1KQQA 1Q3UA 4DFKA 5AK3A 3THVA 2W11A 2K4HA 2UVWA 4ED7A 4C0ZA 1Z1VA 3C5FA 4LZDA 4GLXA 2HBLA 4XRHA 1RQLA 5TISU 4KLOA 1CUKA 9ICLA 1SV0A 4RQ1A 5J2FA 4NWIA 4OD0A 4RUCA 5AICA 8ICFA 4BXOB 1FFUA 4JV2A 5ALQA 2P35A 2EAMA 2KJ5A 4ZOHC 1JN3A 4DOBA 1UQVA 5AK6A 5CWRA 4RQ6A 3GIKA 2Y0SC 5AKIA 7ICSA 1NZBA 5KFIA 2KEYA 1QQ6A 3MR6A 1VLBA 1PVQA 1UT5A 2KN7A 2ATLA 4O3SA 2ASDA 2YN4A 3M6ZA 2LYAA 2HMXA 1VJ5A 2BPFA 3HKZF 1SKRA 2E8MA 4EELA 5KTQA 5AM0A 3TACB 1RYUA 1DGSA 5CRXA 9ICPA 3PVXA 3A0BU 9ICFA 4UARA 1Q46A 5DGBA 1O08A 4TUQA 1L3SA 5J0SA 3F2BA 2YMLA 3SZ2A 3LVWA 2NRVA 3TQ1A 3WKDA 3VCBA 4F2SA 3SAFA 2OH2A 2JEFA 4IRCA 3Q8QB 1KKXA 4DQRA 9ICVA 2IOFK 2YMPA 1MC8A 3M9MB 2JHDA 2KHQA 4DEZA 2HOIA 4Y2VA 1ZQVA 3HKZC 1X9MA 1L7NA 2QLTA 3D2QA 3MGIA 2W03A 2YMMA 1ZQEA 3TFSA 4RZRA 3KHRA 7ICNA 4MFCA 4QZFA 9ICGA 3OHAA 2WAQF 1LB2B 4GXKA 3EZ5A 5ALZA 5AM5A 5EWGA 3AM9A 4YG2A 3PW5A 3I76A 3GIJA 3C2KA 4C4TA 4XQ8A 4UAUA 5KFTA 4I2GA 4YP3A 3MFHA 2F8KA 3TI0A 3DEEA 2Y9UA 3QU2A 3TFRA 4QWAA 3RJGA 3TANA 3QXGA 5KL1B 4Z6CA 1SV0C 3TADA 2HOQA 4Q45A 3QE9Y 1SGGA 1UCVA 2H3IA 4IQWA 4RT2A 3NASA 3G6VA 2VJ4A 3I1YA 4PHAA 4KLMA 3IM1A 2GH1A 4EBCA 1WUDA 2LHTA 4DSFA 4Z6DA 2LKYA 4QZ9A 8ICEA 1CI4A 3J81j 4BXOA 1RQNA 1Z00B 5J0OA 4RQMA 1N62A 2PXIA 2ZIXA 1X9WA 1NJZA 1HUOA 1ED1A 5J8YA 2K4PA 3QUBA 4Y2PA 1ZQ1C 5J2JA 2WHEA 3F5EA 4F4ZA 5KFQA 2DFLA 5J29A 5F3XB 3OHBA 2QB1A 1COKA 5HR6A 2KK0A 3FDSA 2DQNB 2G08A 1DRGA 4OCZA 4DO9A 1B4FA 2YB1A 1D8LA 4M47A 4BWJA 4DFJA 4ED3A 4JV1A 2LM4A 4PH5A 2WF9A 4OJ5A 1JMSA 3IHQB 3RJHA 1U48A 2FPMA 5F9NA 2C28A 7ICEA 4Y2TA 1ZQFA 2K8CB 3U26A 2W9MA 4F92B 1NK9A 2FI1A 2RDIA 4RQNA 2LYBA 4TUPA 5AI8A 2GWSA 3RJFA 1M6YA 3OGUA 3QX7A 2F1JA 2PI5A 1VDVA 4C4SA 1ZQGA 3SV3A 3KKAA 5AKXA 2DKZA 1AQ6A 1ZQZA 5HR7A 7ICPA 1T4GA 8ICVA 8ICGA 1S9FA 1NJXA 4BDPA 3NRWA 1A77A 2HVHA 3L3FX 3S6JA 4QZCA 1ZQMA 4IRKA 4QIWF 3D6JA 5KG2A 4DLGA 3O0FA 3UMCA 4NLNA 3C5GA 4YFKA 3MC1A 1UHUA 4RQ0A 4Y2SA 3KZXA 2DBYA 3NUQA 4F5QA 4TQRA 4ECRA 3QNMA 4UAVA 4NLGA 4M9JA 3HX0A 2QB0A 4ELVA 1JXEA 5JU5A 4DF4A 5DB9A 4FS1A 4R63A 3HRDD 5EE9A 2G0AA 3MDAA 5KL8B 1V9PA 5KT4A 1X2IA 3RH5A 5AIAA 1S8OA 3BQ7A 4EENA 3N97B 1KL9A 4P0QA 2MAXA 5KAFU 3TADC 2FJ6A 3ZDCA 4KLFA 2M0NA 1ZD3A 4O3PA 1Z19A 2KE7A 8ICCA 5KNIA 5IILA 2HBKA 2KKPA 4QIWC 4F4KA 2ZTCA 5ALUA 2KIVA 4AYBC 4CRXA 5E79U 2XC9A 1C7YA 1ZQYA 4GC7A 4IQUA 4HAIA 3AU2A 2OCEA 5J0YA 5BOMA 2HW3A 3Q8PB 4I2CA 4ICAA 2W43A 3EWAA 5J8YC 4KN4A 4DL6A 1SKWA 1BPBA 1QQ7A 2W9AA 2LI6A 4QW9A 2MSNA 4GXIA 2KSOA 2ISPA 2ODGA 5IIMA 1A6SA 2JV3A 3FM9A 4R64A 4ECWA 5AI4A 5L9XA 1NOMA 3UQ2A 2BZFA 1NKCA 3H0RB 4DOAA 3Q8RB 4TUSA 1U47A 1N48A 3V7JA 4NM2A 2W9CA 5IINA 3KTQA 3WKBA 1TFRA 2KOBA 3BS7A 4B9SA 5ALYA 3PMNA 4C7ZA 4KLQA 1ZD5A 4ED2A 9ICTA 4FE3A 2V4RA 4NXZA 4UAWA 1WG8A 4NLBA 5GTIU 4NLKA 3SAHA 4RPZA 4UATA 5AM3A 3KZIU 5KG5A 3E58A 4EBEA 3PZPA 1RDFA 3IG8A 1FFVA 4JUZA 5KG6A 3KKAC 2QKQA 1F5SA 3UXOA 8ICLA 4PL1A 3PSIA 4WJ3B 2DF4B 3JPOA 3N7RC 3TARA 1NK0A 3MABA 2KNJA 5BPCA 4DOCA 3WK7A 2C2EA 2NRXA 3DDHA 2DGZA 4Q44A 5KFFA 2MRLA 3RBEA 4I28A 1K1QA 1PUZA 4UAZA 1O03A 4BUGA 3LDAA 2AHOB 4JWNA 5L1JA 5KFWA 1ZYQA 1XO0A 3BQ0A 1KBUA 2GOLA 4TQSA 4F50A 2Q4TA 2DPIA 9ICMA 4MF8A 4ECTA 2VA3A 3NS1A 2LPEA 3RAQA 5KT7A 9ICRA 4EYIB 1S0VA 4JV0A 3GIIA 4ED0A 5KFHA 4C8LA 3SMVA 5CB1A 3AQEA 1S76D 5KFVA 4I2FA 2JR5A 3M6KA 4DFPA 5KG1A 3NVYA 4O9MA 3SD7A 4NJ8A 4PJ0U 4YXMA 5AKYA 4FS2A 2BQRA 1UPHA 2YX8A 3RFAA 4IRDA 2P66A 4GFJA 1K5OA 5KFJA 2EZZA 1U9LA 2J6TA 4JWMA 4FO6A 3GILA 3ISCA 2BQUA 3V6JA 1J2NA 1KEJA 1YZ7A 1WWUA 1OW5A 3C1ZA 5ALJA 1QSLA 4B9TA 2ZUDA 2XY5A 4QNLA 2DL0A 2KHVA 2WF5A 4PHEA 2R18A 4UB1A 4CF5A 4EZ6A 5KFLA 4YCXA 3KHHA 3QEAZ 5KT5A 5AM1A 1XNSA 5DB7A 2RP5A 4US9A 1V97A 5EE0A 3RR8A 4PHDA 1UA0A 3ZI4A 5KFMA 1HUZA 4UB4A 3AU6A 2XCPA 1TE2A 4PZNA 3IP4B 3ZD8A 9ICHA 2KZMA 3K4GA 5DB6A 5DGAA 2KZZA 4C4RA 1KW4A 3UQ0A 5K4LA 7ICVA 4PGXA 8ICIA 3UMBA 2R8GA 1X66A 5DG7A 1SWWA 2XIDA 2OM6A 4LJXA 2WF6A 2ZIXB 4CE6A 4UW9A 4F4XA 3BQTA 8ICBA 1L8OA 2K60A 3L5KA 5DLFA 1ZQXA 4KLIA 2F1HA 4NL9A 4MHVA 2FMQA 3I28A 3UXNA 5L1KA 1S10A 5IIIA 2PFPA 5D49A 3AEVA 2JGAA 4R65A 4QJFB 1CEZA 5B5EU 1ZETA 2DUYA 1N5XA 5KG7A 3WKEA 5AKZA 4ELTA 5KFXA 1H38A 3T79A 3UXPA 4O5CA 4F71A 3EPIA 1TK8A 4PHPA 9ICAA 2VA2A 1ZOLA 3C23A 1V85A 4IR9A 4J9MA 5AI0A 5KFUA 4DL5A 5IIKA 5DQGA 2Y1IA 3TKAA 4RT3A 5AHXA 3QZ8A 4QZAA 4CF4A 1XC9A 2HHXA 3SV4A 5J2BA 1SXEA 2W04A 2LBOA 5CP2A 2HBJA 2PFQA 2FMPA 2G5HB 4C8NA 9ICEA 4BGDA 5L1LA 5HNKA 2AGOA 5DLGA 3EPGA 1LV5A 2JEJA 5T14A 4OJ6A 1FO4A 1SL2A 4Y2RA 3PW7A 4YR0A 8ICJA 4FBTA 3M8RA 1DOQA 5DDMA 3K1ZA 2DWQA 4M6WA 4P2HA 9ICWA 2XGQA 4M9NA 2K8AA 1PK3A 4B9MA 2I5HA 2KVSA 5J0XA 2LYHA 1ZQPA 4DSJA 5ALRA 2JEGA 4GIBA 2QB0B 5EE3A 4EEYA 5J2AA 3CNHA 4M9GA 4RU9A 2B6GA 3H8MA 1U4BA 4I2BA 7ICGA 4DFMA 1ZRNA 4DSKA 1X6JA 3F2DA 2J6SA 1ZQUA 4UBBA 3H4DA 4NM1A 3HP6A 3OSPA 2HHSA 3ISBA 4RNNA 4FFDA 4P0QB 2BCQA 1ZQWA 2ZTDA 1TV9A 5J2CA 1SZPA 5KFSA 1JI7A 1X9SA 2CRXA 5ALHA 1KRPA 2R8KA 2EH9A 3H8JA 2E1FA 3N4MB 1NJWA 2MU2A 2V9WA 1GO3F 1NK4A 5KFDA 2WAQC 2KD1A 2OYYA 3WKAA 4F8RA 1RPLA 2KKVA 2ZUCA 4OJPA 1ZJNA 9ICCA 3HILA 5KG0A 5BOLA 9ICSA 2BQ3A 5FP0A 3PR5B 2FLLA 2FDRA 4NL9C 4OJLA 1RG6A 1N63A 2KSOB 7ICHA 1RYRA 4KLEA 3PX6A 1RM6C 3T5LA 2W3RA 1NKBA 4P4MA 3PR4A 7ICKA 2A19A 5KFZA 2NRZA 4IQVA 1HIWA 5J2GA 2W9CB 3AMZA 2BR0A 1U45A 2H3QA 3C1YA 2NRTA 4YR2A 2A1JA 1ZQRA 2D8CA 5KFNA 1ZQKA 2G5IB 2K4EA 3ICXA 2ZIVA 1SL0A 1JALA 4K4HA 2PMZF 2R8JA 5KFRA 2H3FA 4FZLA 2VKQA 3Q8LA 2KIWA 1S77D 4J03A 3T5HA 4J9OA 2JH1A 1OXJA 3GQCA 2WFAA 3RBDA 4FZMA 2KVCA 4PPXA 3GU3A 1X6IA 1KN5A 4HYKA 4YMNA 5KT6A 1ZQAA 4DSLA 1N5WA 2P6RA 4MEXA 2EZXA 2E8OA 4AP9A 2F1IA 3HWTA 1ZQHA 4Y2UA 2NO4A 1T7PA 4KLSA 1A76A 2WTFA 3SQIA 1KFDA 2BCUA 3QU9A 1Z4NA 3CYMA 4RQ5A 3MGHA 1WWVA 2PMZC 1P7DA 3BZCA 2HBMA 2ZTEA 1MQ2A 4DQIA 4MFAA 2HHQA 2KV2A 3H7IA 4KX5A 1JUDA 3JPTA 2ZXIA 1ZQJA 2JEIA 2OXOA 2KFNA 2IOHA 2ZIWA 2AXTU 1NJYA 5HMMA 1BVSA 5IIJA 2ZJ5A 5GTHU 1NK5A 3R9KA 1FIQA 3MDCA 5KFGA 2ZG6A 4FZNA 4R8UA 1L3TA 3K75D 4DL7A 1RYSA 1B0XA 5ALPA 3H0MB 1NK7A 1X9XA 3QYPA 1ZD4A 7ICTA 4DFDA 3QU5A 4DS5A 1D8YA 5J0UA 5HMLA 5AKGA 5CA7A 7ICUA 3DV9A 2HSZA 2WF7A 5KAIU 1UA1A 1NI3A 4F93B 4RQ7A 3IG5A 2W9BA 2BPCA 2LM1A 4QWCA 1L5UA 2J6UA 7ICLA 3ISDA 3QUQA 4UAYA 1IV8A 2IHMA 1QTMA 4M04A 3PNCA 2E8NA 5AK5A 1ZQLA 2RHFA 3NVVA 5AKEA 5A0LA 2AU0A 1ZQCA 2HVIA 4GC6A 4ECUA 3NVWA 5ALOA 3V6HA 3MFIA 5ALSA 3RR7A 4KLUA 2Z7JA 4RQ3A 4I2HA 1PVPA 3QUTA 4P4OA 4BX9C 2DKXA 1XO1A 4G3IA 3SYZA 4I2DA 3GV8B 4CCHA 3EW9A 5DG8A 4I2IA 7ICOA 1ECWA 3M9NB 5IIOA 4EBDA 1L7OA 4RQ2A 1MSWD 2XCAA 4KLGA 2ESEA 1BNPA 4EYHB 2ZJ8A 3K1RB 2EQYA 2ZIUA 1X40A 2Y1JA 2NV3A 2XGPA 1QCKA 1DXSA 2WB1F 2G09A 7ICFA 2EANA 9ICJA 2NRWA 1NKEA 4A8EA 3JPSA 2FPKA 1SWVA 8ICOA 5ALWA 5C5JA 3KOOA 1LVHA 5AKKA 4QWDA 1URJA 3N7SC 4NY8A 5ALKA 2BDUA 4BWMA 1AROP 4J9SA 1RXWA 4M9LA 2EAPA 3RJIA 3B9JA 1WCLA 3C28A 2W8KA 5AM4A 1NZPA 4C8KA 2Y9TA 1RZTA 3V72A 8ICNA 4ECVA 2XY7A 3C2LA 5ALXA 2BCVA 3QEBZ 3M1YA 4I2EA 3CRXA 5J2DA 3V6KA 3EYZA 2BCSA 1WYGA 3PO5A 4M2YA 2CN1A 3RTVA 2HI0A 5D46A 1D9DA 4F72A 4RQ4A 3QZ7A 1ZQBA 3Q8KA 2KZ3A 1Y88A 1DK2A 4MEYA 1BNOA 3RAXA 1XU4A 3G6YA 4RPYA 5EWEA 4QZBA 2JXJA 4UB8U 1NK6A 2FLNA 3MR2A 3NRZA 4M6WB 1XS9D 3LYSA 2H5XA 4EEKA 2AJQA 3WK6A 3L4PA 3Q8MA 5KFCA 5AKLA 2KJ8A 1V38A 5F9LA 1PK1A 2NO5A 3QU7A 2EDUA 4O3OA 2KICA 4JMUA 5ALIA 2HHWA 4KLJA 1J97A 3QUCA 5DQHA 1TKDA 5KG4A 5ALEA 3FAHA 4CGZA 4EX6A 5DG9A 3H8SA 5EWFA 2E1EA 1LKYA 5ALMA 3T5KA 4C8MA 2W7OA 4DS4A 1S0MA 3BS5B 4US8A 2PFNA 3BZKA 1IIPA 8ICZA 3SENA 2L5YA 3M8SA 4MF2A 1T3NA 1DGJA 8ICAA 1SZHA 3KHGA 1HJPA 2I9GA 3M7DA 9ICKA 2BPGA 2F8LA 3D2NA 2R8IA 4KMUA 4RNMA 5J0TA 4YD1A 2VJ5A 3C29A 5AI5A 3ZDEA 5DDYA 2Y0SF 1CRXA 1B43A 4O5EA 1TAUA 2ASJA 4QZEA 2I1QA 1DK3A 2GO7A 4JK1A 2IBKA 5JUMA 3AL0B 4F5OA 4RNOA 3ZDBA 2QARA 4J9QA 3C2MA 2WF8A 4Q43A 8ICYA 4ACOA 2OEHA 2FPLA 2YB4A 3ETRA 2A1JB 3ZDAA 4M0AA 4O3QA 2ZIVB 4UB5A 2JMGA 1N61A 2OHFA 3UPQA 3WK9A 2UVVA 2EAOA 1EXNA 2E3TA 2W3SA 2C22A 3RB6A 2GLEA 4NV0A 2F2AB 3LK9A 4ED8A 4F4WA 5JRTA 2UVRA 1Q8KA 3PV8A 2AGQA 2Q0ZX 1PVRA 3KBBA 3G6XA 3OPXA 5AI6A 2H3ZA 4K4IA 4ECQA 2MA1A 2C2RA 3A0HU 3LVVA 5AIBA 3H4BA 9ICOA 3LWMA 2ASLA 3GIMA 5HP4A 2PKEA 4O5KA 5AK4A 5J2KA 3F2CA 1NNLA 2E5SA 4CF3A 4B9VA 4IL6U 2F77X 1BGXT 3JPRA 4ECZA 1TAMA 1WCNA 4OO1J 1S0OA 4LZGA 1IG6A 2ALZA 1B22A 4XA5A 5KG3A 2W7PA 4F5PA 5G5GA 2F44A 1SKSA 2ZIWB 1KLNA 4UB2A 2D3DA 2KFZA 2JZBA 5CR0A 3RB4A 3H0LB 5DBBA 2ZUBA 4DL4A 4R8UB 5J0PA 4PZOA 3BQ1A 2HCFA 4JB3A 5KFKA 3IN5A 4I2JA 4EX7A 9ICUA 4DSEA 3BDPA 1S5LU 3AN1A 2B21A 3Q8SB 4I2AA 5KT3A 1OUQA 1N2XA 2MUTA 3F5AA 9ICIA 3SAGA 4UB6U 4YXJA 3ZDDA 1JRPA 4YVZA 1ZD2P 1ZRMA 8ICKA 5EOZA 3BS5A 2W9BB 3LWLA 1QSYA 4F5NA 1ZQSA 3RJJA 1XSPA 2HOFA 8ICHA 3HJEA 2W55A 3KHLA 1Z4OA 3PSFA 2KJ9A 3JPQA 3B0YA 3AQFA 3TAQA 1C20A 3RH6A 8ICRA 4DQSA 1T3QA 4DQPA 4P0PB 1ZQNA 1COOA 1JXLA 4J9NA 3AUOA 3SI8A 2HHVA 5AM2A 2PFOA 2ZJAA 3SR6A 1N56A 4DLEA 2YQEA 1ZQQA 1IM4A 1YZ6A 3ORYA 3PW2A 5G5HA 4UB3A 1XSLA 3RJKA 2W54A 4USAA 3SEIA 3GZFA 5JTIA 4QW8A 1QLNA 5HHIA 2RDJA 1TK0A 5CEHA 3NGDA 1ZQIA 3OJUA 2KG5A 2B0CA 1PZNA 3WKCA 3N28A 2ZIUB 4PGYA 3HPOA 4ECYA 5KFOA 4DCCA 4KLHA 5AKJA 2CXYA 3PW0A 2IOFA 2RQ5A 3GV7B 4O0IA 4IR1A 3RB0A 4F91B 5DQIA 4J9PA 2G06A 4X5VA 2A1AA 5C0YA 3PW4A 4CNQA 5ALGA 1SB3C 2G07A 4YQWA 4RQ8A 2IHNA 4O3MA 5ALDA 4RPXA 1N60A 3ZD9A 4FBUA 3FYHA 2ES6A 5ALTA 4F4YA 2A3VA 2DPJA 5ALLA 2BHNA 3QU4A 3V7LA 1S97A 1QH9A 4QZ8A 1KTQA 5TZVA 2BKEA 8ICQA 3HT3A 3ONNA 3ALRA 4IQTA 3CP8A 2XVTA 2FLPA 2IA6A 2N1RA 3E2EA 1KFTA 4UASA 4EZ9A 8ICSA 5L1MA 5L1IA 1BPDA 8ICWA 4OJOA 5B66U 3MR3A 4DF8A 5KFEA 3OSNA 2AH5A 4DL2A 3KFUF 2KTQA 2I6XA 4YN4A 4YD2A 1YT3A 3PO4A 3BQ2A 1TK5A 4BJQA 4ED1A 2D6FC 2K8BB 2VIXA 4B9LA 5ALFA 4F2RA 1Z1BA 1BPEA 2ISOA 2JRZA 2LMRA 3PY8A 4QZDA 4ELUA 3M9OB 5CJ7A 1IXRA 4KLLA 4DL3A 1PK1B 7ICRA 2AQ0A 9ICBA 4AYBF 2XI9A 3PSTA 1SIJA 4C80A 1Z3EB 4P4PA 3PMLA 4Q8EA 3RF9A 4QWEA 2BGWA 4M9HA 1XSNA 1X42A 2NYVA 2K89A 1L3VA 2M9NA 1JX4A 4E0DA 2RRDA 2BDPA 4Z6FA 3GFKB 3MBYA 4GXJA 2EZYA 5D4BA 2XY6A 4IC9A 4ECSA 3RB3A 1LKYB 1KSPA 9ICXA 2BCRA 8ICMA 3GV5B 4MFFA 4CDGA 5J2HA 3RRHA 3PX0A 4B9UA 4NLZA 5J0QA 4ED6A 3JPNA 3RRGA 2C2DA 5ALNA 4P0PA 2UVUA 3HW8A
chains in the Genus database with same CATH topology
1GO3F 2JH7A 1ZQ1C 3F5EA 2WAQC 4QNLA 2KHVA 3PZPA 3D2SA 2R18A 2KD1A 3ONNA 2JHDA 2OYYA 2KHQA 3ALRA 3IG8A 2KICA 2KV2A 4JMUA 3CP8A 2HOIA 2XVTA 4KX5A 2KKVA 2N1RA 2ZIUA 5HR6A 4OJPA 3HKZC 2DQNB 2G0AA 2G08A 2ZXIA 4NWIA 4PL1A 2W04A 1DRGA 5KL8B 2HOFA 2LBOA 2NV3A 2YB1A 1XNSA 1MA7A 2HBJA 2OXOA 2WB1F 3D2QA 2G09A 2F2AB 2ZIWA 2RP5A 3PSIA 2W03A 2DF4B 3PSFA 4NV0A 4OJLA 3MGVA 4WJ3B 2G5HB 3N7RC 1A0PA 2KJ9A 4PL2A 4P0QA 4A8EA 3AQFA 4OJOA 2KJ5A 1F44A 2KNJA 2M0NA 3IP4B 1Z19A 1PVRA 4NLCA 4OJ5A 2ZG6A 3VC8A 4CGZA 4FZNA 2DGZA 4P0PB 3KFUF 2WAQF 1URJA 2HBKA 3OPXA 2KKPA 3N7SC 2E1EA 2MRLA 4OJ6A 2BDUA 4QIWC 5T14A 2W7OA 1T94A 3H0MB 1YT3A 1HIWA 2H3ZA 2K8CB 4AYBC 4BUGA 4CRXA 3C28A 2H3VA 2H3QA 2Y0SC 1IIPA 3K1ZA 4BJQA 2D6FC 2LYBA 2MA1A 1NZBA 2K8BB 1XO0A 2KEYA 1KBUA 2G5IB 2GOLA 2K4EA 2XIDA 2VIXA 3E0FA 1SZHA 2F76X 2K8AA 2OM6A 2XICA 2ZIVA 3ICXA 1Z1BA 2Q4TA 2PMZF 2ZIXB 3M7DA 1PVQA 2H3FA 2F8LA 3GZFA 3D2NA 3CRXA 3F2CA 2E5SA 3N7PD 2VKQA 4FZLA 4ICAA 3DEEA 3IG5A 3F53A 4KX3A 2KIWA 2VJ5A 2K4IA 3LVVA 3M6ZA 2F77X 4U7CA 2CN1A 2LYAA 3C29A 2JH1A 1D8BA 4AYBF 1TAMA 2XI9A 2HMXA 3PSTA 4KMOB 5KL1B 3HKZF 2Y0SF 4FZMA 1CRXA 4OO1J 2ZIUB 1HEKA 2KVCA 3SMVA 3GU3A 5HR7A 2HOQA 2RHFA 5A0LA 3AQEA 3F2DA 2ZXHA 3RF9A 2W7PA 2H3IA 3PSPA 1L6NA 3M6KA 5CRXA 2E1FA 1A6SA 2ZIWB 2JGAA 2VJ4A 3AL0B 2K89A 3NRWA 4QJFB 2GH1A 4P0QB 1WUDA 1UPHA 2YX8A 3RFAA 2LHTA 3H0RB 2RRDA 3H0LB 2G06A 3L3FX 4GFJA 2Z7JA 1PVPA 5C0YA 4QIWF 4BX9C 4IC9A 3O0FA 4ACOA 2LKYA 2G07A 3F2BA 3T79A 2KOBA 3F5AA 1Q3UA 3LVWA 3IN5A 1Q3VA 4O3MA 3SQIA 2CRXA 4U6PA 2K4HA 3VCBA 4CDGA 2WB1C 2YB4A 4FE3A 3SAFA 3KZXA 3NUQA 3SAGA 3CYMA 1ECWA 2CPRA 4C0ZA 2OH2A 2ZIXA 3LYSA 4NLBA 1OUQA 2PMZC 1ED1A 3SAHA 2A3VA 1P7DA 2ZIVB 4P0PA 2HBLA 2JMGA 2HBMA 2KJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ICA A;  2K4I A;  4IC9 A;  4JMU A;  2LYA A;  1HIW A;  2H3Z A;  1TAM A;  2N1R A;  2HMX A;  2H3V A;  2H3Q A;  2NV3 A;  1HEK A;  2K4H A;  2LYB A;  1ECW A;  2H3I A;  2K4E A;  2GOL A;  1L6N A;  1A6S A;  1ED1 A;  2H3F A;  2JMG A;  1UPH A; 
#chains in the Genus database with same CATH topology
 2JH7 A;  5J0W A;  1L8L A;  2YY6 A;  1KFS A;  4IS7 A;  1SL1 A;  2IMW P;  3PX4 A;  5DKW A;  4Y2X A;  3V7K A;  4J9L A;  4KIT B;  4YMO A;  1XWL A;  1MA7 A;  5EE1 A;  2VAN A;  4Y2J A;  2FMS A;  1A0P A;  4J9R A;  3KD3 A;  7ICJ A;  3NVZ A;  4NLC A;  4KLT A;  4U6P A;  4F3O A;  2QAR B;  1F0M A;  1ZQO A;  3B0X A;  1Z00 A;  3C21 A;  2H3V A;  3OJS A;  3IV6 A;  3RH4 A;  1U49 A;  1KDH A;  3GDX A;  4XUS A;  4Y2Q A;  2O6K A;  5KFA A;  3JPP A;  3N7P D;  5KFP A;  9ICQ A;  2AGP A;  4U7C A;  3NTU A;  4QWB A;  4C7Y A;  4PGQ A;  4ECX A;  1ZJM A;  2FE9 A;  4Y2Y A;  1NK8 A;  2RLT A;  2E8P A;  1FEZ A;  3EUB 2;  4QZG A;  3MR5 A;  5DBC A;  8ICP A;  3RJE A;  1L7M A;  1ZQD A;  4O3N A;  3WK8 A;  4Z6E A;  4I27 A;  2KP7 A;  5J0R A;  1K1S A;  4UBC A;  3IRU A;  1MQ3 A;  3WU2 U;  2AQ4 A;  5CHG A;  1ZQT A;  4K4G A;  1Q3V A;  4J9K A;  2WB1 C;  3UM9 A;  2CPR A;  3OTQ A;  3TAP A;  1J2M A;  5H2F U;  4RUA A;  4QZI A;  3H8W A;  2HDO A;  4TUR A;  4KLD A;  1L7P A;  2W8L A;  4Q8F A;  3D2S A;  4O3R A;  4G9B A;  2V4Q A;  7ICI A;  2HHU A;  8ICT A;  1BPZ A;  3FC4 A;  1JIH A;  8ICX A;  4KN7 A;  4LVS A;  3ED5 A;  5J2I A;  3MGV A;  1TAQ A;  5KT2 A;  2KMD A;  4DWI A;  3UMG A;  5J2E A;  4DQQ A;  4PL2 A;  2OWO A;  2PI4 A;  2YTU A;  4ZH4 A;  5DBA A;  1RXV A;  4YR3 A;  1F44 A;  4B9N A;  4YMM A;  1UT8 A;  3VC8 A;  7ICQ A;  1JRO A;  1L3U A;  8ICU A;  4KTQ A;  2JZB B;  1S0N A;  4B6J A;  4R66 A;  1T94 A;  3BJY A;  4I29 A;  2P6U A;  3IDW A;  2XO7 A;  2YMQ A;  3T3F A;  5KFB A;  1BPY A;  1QSS A;  2R8H A;  3E0F A;  2F76 X;  2XIC A;  1MN8 A;  3H40 A;  3ETL A;  7ICM A;  4UQG A;  1TVA A;  9ICN A;  2MUT B;  4KX3 A;  3F53 A;  5AKH A;  2K4I A;  4QZH A;  4C8O A;  4F5R A;  1D8B A;  2VA8 A;  4KMO B;  1HEK A;  5KFY A;  3WK5 A;  4DSI A;  2HHT A;  2ZXH A;  3PSP A;  3T5J A;  1D9F A;  1QQ5 A;  5AI9 A;  1L6N A;  3WK4 A;  5ALV A;  2F3N A;  5DB8 A;  1SV4 A;  1BPX A;  1ZXI A;  3CW2 C;  1T8E A;  5HHH A;  1SXD A;  1KQQ A;  1Q3U A;  4DFK A;  5AK3 A;  3THV A;  2W11 A;  2K4H A;  2UVW A;  4ED7 A;  4C0Z A;  1Z1V A;  3C5F A;  4LZD A;  4GLX A;  2HBL A;  4XRH A;  1RQL A;  5TIS U;  4KLO A;  1CUK A;  9ICL A;  1SV0 A;  4RQ1 A;  5J2F A;  4NWI A;  4OD0 A;  4RUC A;  5AIC A;  8ICF A;  4BXO B;  1FFU A;  4JV2 A;  5ALQ A;  2P35 A;  2EAM A;  2KJ5 A;  4ZOH C;  1JN3 A;  4DOB A;  1UQV A;  5AK6 A;  5CWR A;  4RQ6 A;  3GIK A;  2Y0S C;  5AKI A;  7ICS A;  1NZB A;  5KFI A;  2KEY A;  1QQ6 A;  3MR6 A;  1VLB A;  1PVQ A;  1UT5 A;  2KN7 A;  2ATL A;  4O3S A;  2ASD A;  2YN4 A;  3M6Z A;  2LYA A;  2HMX A;  1VJ5 A;  2BPF A;  3HKZ F;  1SKR A;  2E8M A;  4EEL A;  5KTQ A;  5AM0 A;  3TAC B;  1RYU A;  1DGS A;  5CRX A;  9ICP A;  3PVX A;  3A0B U;  9ICF A;  4UAR A;  1Q46 A;  5DGB A;  1O08 A;  4TUQ A;  1L3S A;  5J0S A;  3F2B A;  2YML A;  3SZ2 A;  3LVW A;  2NRV A;  3TQ1 A;  3WKD A;  3VCB A;  4F2S A;  3SAF A;  2OH2 A;  2JEF A;  4IRC A;  3Q8Q B;  1KKX A;  4DQR A;  9ICV A;  2IOF K;  2YMP A;  1MC8 A;  3M9M B;  2JHD A;  2KHQ A;  4DEZ A;  2HOI A;  4Y2V A;  1ZQV A;  3HKZ C;  1X9M A;  1L7N A;  2QLT A;  3D2Q A;  3MGI A;  2W03 A;  2YMM A;  1ZQE A;  3TFS A;  4RZR A;  3KHR A;  7ICN A;  4MFC A;  4QZF A;  9ICG A;  3OHA A;  2WAQ F;  1LB2 B;  4GXK A;  3EZ5 A;  5ALZ A;  5AM5 A;  5EWG A;  3AM9 A;  4YG2 A;  3PW5 A;  3I76 A;  3GIJ A;  3C2K A;  4C4T A;  4XQ8 A;  4UAU A;  5KFT A;  4I2G A;  4YP3 A;  3MFH A;  2F8K A;  3TI0 A;  3DEE A;  2Y9U A;  3QU2 A;  3TFR A;  4QWA A;  3RJG A;  3TAN A;  3QXG A;  5KL1 B;  4Z6C A;  1SV0 C;  3TAD A;  2HOQ A;  4Q45 A;  3QE9 Y;  1SGG A;  1UCV A;  2H3I A;  4IQW A;  4RT2 A;  3NAS A;  3G6V A;  2VJ4 A;  3I1Y A;  4PHA A;  4KLM A;  3IM1 A;  2GH1 A;  4EBC A;  1WUD A;  2LHT A;  4DSF A;  4Z6D A;  2LKY A;  4QZ9 A;  8ICE A;  1CI4 A;  3J81 j;  4BXO A;  1RQN A;  1Z00 B;  5J0O A;  4RQM A;  1N62 A;  2PXI A;  2ZIX A;  1X9W A;  1NJZ A;  1HUO A;  1ED1 A;  5J8Y A;  2K4P A;  3QUB A;  4Y2P A;  1ZQ1 C;  5J2J A;  2WHE A;  3F5E A;  4F4Z A;  5KFQ A;  2DFL A;  5J29 A;  5F3X B;  3OHB A;  2QB1 A;  1COK A;  5HR6 A;  2KK0 A;  3FDS A;  2DQN B;  2G08 A;  1DRG A;  4OCZ A;  4DO9 A;  1B4F A;  2YB1 A;  1D8L A;  4M47 A;  4BWJ A;  4DFJ A;  4ED3 A;  4JV1 A;  2LM4 A;  4PH5 A;  2WF9 A;  4OJ5 A;  1JMS A;  3IHQ B;  3RJH A;  1U48 A;  2FPM A;  5F9N A;  2C28 A;  7ICE A;  4Y2T A;  1ZQF A;  2K8C B;  3U26 A;  2W9M A;  4F92 B;  1NK9 A;  2FI1 A;  2RDI A;  4RQN A;  2LYB A;  4TUP A;  5AI8 A;  2GWS A;  3RJF A;  1M6Y A;  3OGU A;  3QX7 A;  2F1J A;  2PI5 A;  1VDV A;  4C4S A;  1ZQG A;  3SV3 A;  3KKA A;  5AKX A;  2DKZ A;  1AQ6 A;  1ZQZ A;  5HR7 A;  7ICP A;  1T4G A;  8ICV A;  8ICG A;  1S9F A;  1NJX A;  4BDP A;  3NRW A;  1A77 A;  2HVH A;  3L3F X;  3S6J A;  4QZC A;  1ZQM A;  4IRK A;  4QIW F;  3D6J A;  5KG2 A;  4DLG A;  3O0F A;  3UMC A;  4NLN A;  3C5G A;  4YFK A;  3MC1 A;  1UHU A;  4RQ0 A;  4Y2S A;  3KZX A;  2DBY A;  3NUQ A;  4F5Q A;  4TQR A;  4ECR A;  3QNM A;  4UAV A;  4NLG A;  4M9J A;  3HX0 A;  2QB0 A;  4ELV A;  1JXE A;  5JU5 A;  4DF4 A;  5DB9 A;  4FS1 A;  4R63 A;  3HRD D;  5EE9 A;  2G0A A;  3MDA A;  5KL8 B;  1V9P A;  5KT4 A;  1X2I A;  3RH5 A;  5AIA A;  1S8O A;  3BQ7 A;  4EEN A;  3N97 B;  1KL9 A;  4P0Q A;  2MAX A;  5KAF U;  3TAD C;  2FJ6 A;  3ZDC A;  4KLF A;  2M0N A;  1ZD3 A;  4O3P A;  1Z19 A;  2KE7 A;  8ICC A;  5KNI A;  5IIL A;  2HBK A;  2KKP A;  4QIW C;  4F4K A;  2ZTC A;  5ALU A;  2KIV A;  4AYB C;  4CRX A;  5E79 U;  2XC9 A;  1C7Y A;  1ZQY A;  4GC7 A;  4IQU A;  4HAI A;  3AU2 A;  2OCE A;  5J0Y A;  5BOM A;  2HW3 A;  3Q8P B;  4I2C A;  4ICA A;  2W43 A;  3EWA A;  5J8Y C;  4KN4 A;  4DL6 A;  1SKW A;  1BPB A;  1QQ7 A;  2W9A A;  2LI6 A;  4QW9 A;  2MSN A;  4GXI A;  2KSO A;  2ISP A;  2ODG A;  5IIM A;  1A6S A;  2JV3 A;  3FM9 A;  4R64 A;  4ECW A;  5AI4 A;  5L9X A;  1NOM A;  3UQ2 A;  2BZF A;  1NKC A;  3H0R B;  4DOA A;  3Q8R B;  4TUS A;  1U47 A;  1N48 A;  3V7J A;  4NM2 A;  2W9C A;  5IIN A;  3KTQ A;  3WKB A;  1TFR A;  2KOB A;  3BS7 A;  4B9S A;  5ALY A;  3PMN A;  4C7Z A;  4KLQ A;  1ZD5 A;  4ED2 A;  9ICT A;  4FE3 A;  2V4R A;  4NXZ A;  4UAW A;  1WG8 A;  4NLB A;  5GTI U;  4NLK A;  3SAH A;  4RPZ A;  4UAT A;  5AM3 A;  3KZI U;  5KG5 A;  3E58 A;  4EBE A;  3PZP A;  1RDF A;  3IG8 A;  1FFV A;  4JUZ A;  5KG6 A;  3KKA C;  2QKQ A;  1F5S A;  3UXO A;  8ICL A;  4PL1 A;  3PSI A;  4WJ3 B;  2DF4 B;  3JPO A;  3N7R C;  3TAR A;  1NK0 A;  3MAB A;  2KNJ A;  5BPC A;  4DOC A;  3WK7 A;  2C2E A;  2NRX A;  3DDH A;  2DGZ A;  4Q44 A;  5KFF A;  2MRL A;  3RBE A;  4I28 A;  1K1Q A;  1PUZ A;  4UAZ A;  1O03 A;  4BUG A;  3LDA A;  2AHO B;  4JWN A;  5L1J A;  5KFW A;  1ZYQ A;  1XO0 A;  3BQ0 A;  1KBU A;  2GOL A;  4TQS A;  4F50 A;  2Q4T A;  2DPI A;  9ICM A;  4MF8 A;  4ECT A;  2VA3 A;  3NS1 A;  2LPE A;  3RAQ A;  5KT7 A;  9ICR A;  4EYI B;  1S0V A;  4JV0 A;  3GII A;  4ED0 A;  5KFH A;  4C8L A;  3SMV A;  5CB1 A;  3AQE A;  1S76 D;  5KFV A;  4I2F A;  2JR5 A;  3M6K A;  4DFP A;  5KG1 A;  3NVY A;  4O9M A;  3SD7 A;  4NJ8 A;  4PJ0 U;  4YXM A;  5AKY A;  4FS2 A;  2BQR A;  1UPH A;  2YX8 A;  3RFA A;  4IRD A;  2P66 A;  4GFJ A;  1K5O A;  5KFJ A;  2EZZ A;  1U9L A;  2J6T A;  4JWM A;  4FO6 A;  3GIL A;  3ISC A;  2BQU A;  3V6J A;  1J2N A;  1KEJ A;  1YZ7 A;  1WWU A;  1OW5 A;  3C1Z A;  5ALJ A;  1QSL A;  4B9T A;  2ZUD A;  2XY5 A;  4QNL A;  2DL0 A;  2KHV A;  2WF5 A;  4PHE A;  2R18 A;  4UB1 A;  4CF5 A;  4EZ6 A;  5KFL A;  4YCX A;  3KHH A;  3QEA Z;  5KT5 A;  5AM1 A;  1XNS A;  5DB7 A;  2RP5 A;  4US9 A;  1V97 A;  5EE0 A;  3RR8 A;  4PHD A;  1UA0 A;  3ZI4 A;  5KFM A;  1HUZ A;  4UB4 A;  3AU6 A;  2XCP A;  1TE2 A;  4PZN A;  3IP4 B;  3ZD8 A;  9ICH A;  2KZM A;  3K4G A;  5DB6 A;  5DGA A;  2KZZ A;  4C4R A;  1KW4 A;  3UQ0 A;  5K4L A;  7ICV A;  4PGX A;  8ICI A;  3UMB A;  2R8G A;  1X66 A;  5DG7 A;  1SWW A;  2XID A;  2OM6 A;  4LJX A;  2WF6 A;  2ZIX B;  4CE6 A;  4UW9 A;  4F4X A;  3BQT A;  8ICB A;  1L8O A;  2K60 A;  3L5K A;  5DLF A;  1ZQX A;  4KLI A;  2F1H A;  4NL9 A;  4MHV A;  2FMQ A;  3I28 A;  3UXN A;  5L1K A;  1S10 A;  5III A;  2PFP A;  5D49 A;  3AEV A;  2JGA A;  4R65 A;  4QJF B;  1CEZ A;  5B5E U;  1ZET A;  2DUY A;  1N5X A;  5KG7 A;  3WKE A;  5AKZ A;  4ELT A;  5KFX A;  1H38 A;  3T79 A;  3UXP A;  4O5C A;  4F71 A;  3EPI A;  1TK8 A;  4PHP A;  9ICA A;  2VA2 A;  1ZOL A;  3C23 A;  1V85 A;  4IR9 A;  4J9M A;  5AI0 A;  5KFU A;  4DL5 A;  5IIK A;  5DQG A;  2Y1I A;  3TKA A;  4RT3 A;  5AHX A;  3QZ8 A;  4QZA A;  4CF4 A;  1XC9 A;  2HHX A;  3SV4 A;  5J2B A;  1SXE A;  2W04 A;  2LBO A;  5CP2 A;  2HBJ A;  2PFQ A;  2FMP A;  2G5H B;  4C8N A;  9ICE A;  4BGD A;  5L1L A;  5HNK A;  2AGO A;  5DLG A;  3EPG A;  1LV5 A;  2JEJ A;  5T14 A;  4OJ6 A;  1FO4 A;  1SL2 A;  4Y2R A;  3PW7 A;  4YR0 A;  8ICJ A;  4FBT A;  3M8R A;  1DOQ A;  5DDM A;  3K1Z A;  2DWQ A;  4M6W A;  4P2H A;  9ICW A;  2XGQ A;  4M9N A;  2K8A A;  1PK3 A;  4B9M A;  2I5H A;  2KVS A;  5J0X A;  2LYH A;  1ZQP A;  4DSJ A;  5ALR A;  2JEG A;  4GIB A;  2QB0 B;  5EE3 A;  4EEY A;  5J2A A;  3CNH A;  4M9G A;  4RU9 A;  2B6G A;  3H8M A;  1U4B A;  4I2B A;  7ICG A;  4DFM A;  1ZRN A;  4DSK A;  1X6J A;  3F2D A;  2J6S A;  1ZQU A;  4UBB A;  3H4D A;  4NM1 A;  3HP6 A;  3OSP A;  2HHS A;  3ISB A;  4RNN A;  4FFD A;  4P0Q B;  2BCQ A;  1ZQW A;  2ZTD A;  1TV9 A;  5J2C A;  1SZP A;  5KFS A;  1JI7 A;  1X9S A;  2CRX A;  5ALH A;  1KRP A;  2R8K A;  2EH9 A;  3H8J A;  2E1F A;  3N4M B;  1NJW A;  2MU2 A;  2V9W A;  1GO3 F;  1NK4 A;  5KFD A;  2WAQ C;  2KD1 A;  2OYY A;  3WKA A;  4F8R A;  1RPL A;  2KKV A;  2ZUC A;  4OJP A;  1ZJN A;  9ICC A;  3HIL A;  5KG0 A;  5BOL A;  9ICS A;  2BQ3 A;  5FP0 A;  3PR5 B;  2FLL A;  2FDR A;  4NL9 C;  4OJL A;  1RG6 A;  1N63 A;  2KSO B;  7ICH A;  1RYR A;  4KLE A;  3PX6 A;  1RM6 C;  3T5L A;  2W3R A;  1NKB A;  4P4M A;  3PR4 A;  7ICK A;  2A19 A;  5KFZ A;  2NRZ A;  4IQV A;  1HIW A;  5J2G A;  2W9C B;  3AMZ A;  2BR0 A;  1U45 A;  2H3Q A;  3C1Y A;  2NRT A;  4YR2 A;  2A1J A;  1ZQR A;  2D8C A;  5KFN A;  1ZQK A;  2G5I B;  2K4E A;  3ICX A;  2ZIV A;  1SL0 A;  1JAL A;  4K4H A;  2PMZ F;  2R8J A;  5KFR A;  2H3F A;  4FZL A;  2VKQ A;  3Q8L A;  2KIW A;  1S77 D;  4J03 A;  3T5H A;  4J9O A;  2JH1 A;  1OXJ A;  3GQC A;  2WFA A;  3RBD A;  4FZM A;  2KVC A;  4PPX A;  3GU3 A;  1X6I A;  1KN5 A;  4HYK A;  4YMN A;  5KT6 A;  1ZQA A;  4DSL A;  1N5W A;  2P6R A;  4MEX A;  2EZX A;  2E8O A;  4AP9 A;  2F1I A;  3HWT A;  1ZQH A;  4Y2U A;  2NO4 A;  1T7P A;  4KLS A;  1A76 A;  2WTF A;  3SQI A;  1KFD A;  2BCU A;  3QU9 A;  1Z4N A;  3CYM A;  4RQ5 A;  3MGH A;  1WWV A;  2PMZ C;  1P7D A;  3BZC A;  2HBM A;  2ZTE A;  1MQ2 A;  4DQI A;  4MFA A;  2HHQ A;  2KV2 A;  3H7I A;  4KX5 A;  1JUD A;  3JPT A;  2ZXI A;  1ZQJ A;  2JEI A;  2OXO A;  2KFN A;  2IOH A;  2ZIW A;  2AXT U;  1NJY A;  5HMM A;  1BVS A;  5IIJ A;  2ZJ5 A;  5GTH U;  1NK5 A;  3R9K A;  1FIQ A;  3MDC A;  5KFG A;  2ZG6 A;  4FZN A;  4R8U A;  1L3T A;  3K75 D;  4DL7 A;  1RYS A;  1B0X A;  5ALP A;  3H0M B;  1NK7 A;  1X9X A;  3QYP A;  1ZD4 A;  7ICT A;  4DFD A;  3QU5 A;  4DS5 A;  1D8Y A;  5J0U A;  5HML A;  5AKG A;  5CA7 A;  7ICU A;  3DV9 A;  2HSZ A;  2WF7 A;  5KAI U;  1UA1 A;  1NI3 A;  4F93 B;  4RQ7 A;  3IG5 A;  2W9B A;  2BPC A;  2LM1 A;  4QWC A;  1L5U A;  2J6U A;  7ICL A;  3ISD A;  3QUQ A;  4UAY A;  1IV8 A;  2IHM A;  1QTM A;  4M04 A;  3PNC A;  2E8N A;  5AK5 A;  1ZQL A;  2RHF A;  3NVV A;  5AKE A;  5A0L A;  2AU0 A;  1ZQC A;  2HVI A;  4GC6 A;  4ECU A;  3NVW A;  5ALO A;  3V6H A;  3MFI A;  5ALS A;  3RR7 A;  4KLU A;  2Z7J A;  4RQ3 A;  4I2H A;  1PVP A;  3QUT A;  4P4O A;  4BX9 C;  2DKX A;  1XO1 A;  4G3I A;  3SYZ A;  4I2D A;  3GV8 B;  4CCH A;  3EW9 A;  5DG8 A;  4I2I A;  7ICO A;  1ECW A;  3M9N B;  5IIO A;  4EBD A;  1L7O A;  4RQ2 A;  1MSW D;  2XCA A;  4KLG A;  2ESE A;  1BNP A;  4EYH B;  2ZJ8 A;  3K1R B;  2EQY A;  2ZIU A;  1X40 A;  2Y1J A;  2NV3 A;  2XGP A;  1QCK A;  1DXS A;  2WB1 F;  2G09 A;  7ICF A;  2EAN A;  9ICJ A;  2NRW A;  1NKE A;  4A8E A;  3JPS A;  2FPK A;  1SWV A;  8ICO A;  5ALW A;  5C5J A;  3KOO A;  1LVH A;  5AKK A;  4QWD A;  1URJ A;  3N7S C;  4NY8 A;  5ALK A;  2BDU A;  4BWM A;  1ARO P;  4J9S A;  1RXW A;  4M9L A;  2EAP A;  3RJI A;  3B9J A;  1WCL A;  3C28 A;  2W8K A;  5AM4 A;  1NZP A;  4C8K A;  2Y9T A;  1RZT A;  3V72 A;  8ICN A;  4ECV A;  2XY7 A;  3C2L A;  5ALX A;  2BCV A;  3QEB Z;  3M1Y A;  4I2E A;  3CRX A;  5J2D A;  3V6K A;  3EYZ A;  2BCS A;  1WYG A;  3PO5 A;  4M2Y A;  2CN1 A;  3RTV A;  2HI0 A;  5D46 A;  1D9D A;  4F72 A;  4RQ4 A;  3QZ7 A;  1ZQB A;  3Q8K A;  2KZ3 A;  1Y88 A;  1DK2 A;  4MEY A;  1BNO A;  3RAX A;  1XU4 A;  3G6Y A;  4RPY A;  5EWE A;  4QZB A;  2JXJ A;  4UB8 U;  1NK6 A;  2FLN A;  3MR2 A;  3NRZ A;  4M6W B;  1XS9 D;  3LYS A;  2H5X A;  4EEK A;  2AJQ A;  3WK6 A;  3L4P A;  3Q8M A;  5KFC A;  5AKL A;  2KJ8 A;  1V38 A;  5F9L A;  1PK1 A;  2NO5 A;  3QU7 A;  2EDU A;  4O3O A;  2KIC A;  4JMU A;  5ALI A;  2HHW A;  4KLJ A;  1J97 A;  3QUC A;  5DQH A;  1TKD A;  5KG4 A;  5ALE A;  3FAH A;  4CGZ A;  4EX6 A;  5DG9 A;  3H8S A;  5EWF A;  2E1E A;  1LKY A;  5ALM A;  3T5K A;  4C8M A;  2W7O A;  4DS4 A;  1S0M A;  3BS5 B;  4US8 A;  2PFN A;  3BZK A;  1IIP A;  8ICZ A;  3SEN A;  2L5Y A;  3M8S A;  4MF2 A;  1T3N A;  1DGJ A;  8ICA A;  1SZH A;  3KHG A;  1HJP A;  2I9G A;  3M7D A;  9ICK A;  2BPG A;  2F8L A;  3D2N A;  2R8I A;  4KMU A;  4RNM A;  5J0T A;  4YD1 A;  2VJ5 A;  3C29 A;  5AI5 A;  3ZDE A;  5DDY A;  2Y0S F;  1CRX A;  1B43 A;  4O5E A;  1TAU A;  2ASJ A;  4QZE A;  2I1Q A;  1DK3 A;  2GO7 A;  4JK1 A;  2IBK A;  5JUM A;  3AL0 B;  4F5O A;  4RNO A;  3ZDB A;  2QAR A;  4J9Q A;  3C2M A;  2WF8 A;  4Q43 A;  8ICY A;  4ACO A;  2OEH A;  2FPL A;  2YB4 A;  3ETR A;  2A1J B;  3ZDA A;  4M0A A;  4O3Q A;  2ZIV B;  4UB5 A;  2JMG A;  1N61 A;  2OHF A;  3UPQ A;  3WK9 A;  2UVV A;  2EAO A;  1EXN A;  2E3T A;  2W3S A;  2C22 A;  3RB6 A;  2GLE A;  4NV0 A;  2F2A B;  3LK9 A;  4ED8 A;  4F4W A;  5JRT A;  2UVR A;  1Q8K A;  3PV8 A;  2AGQ A;  2Q0Z X;  1PVR A;  3KBB A;  3G6X A;  3OPX A;  5AI6 A;  2H3Z A;  4K4I A;  4ECQ A;  2MA1 A;  2C2R A;  3A0H U;  3LVV A;  5AIB A;  3H4B A;  9ICO A;  3LWM A;  2ASL A;  3GIM A;  5HP4 A;  2PKE A;  4O5K A;  5AK4 A;  5J2K A;  3F2C A;  1NNL A;  2E5S A;  4CF3 A;  4B9V A;  4IL6 U;  2F77 X;  1BGX T;  3JPR A;  4ECZ A;  1TAM A;  1WCN A;  4OO1 J;  1S0O A;  4LZG A;  1IG6 A;  2ALZ A;  1B22 A;  4XA5 A;  5KG3 A;  2W7P A;  4F5P A;  5G5G A;  2F44 A;  1SKS A;  2ZIW B;  1KLN A;  4UB2 A;  2D3D A;  2KFZ A;  2JZB A;  5CR0 A;  3RB4 A;  3H0L B;  5DBB A;  2ZUB A;  4DL4 A;  4R8U B;  5J0P A;  4PZO A;  3BQ1 A;  2HCF A;  4JB3 A;  5KFK A;  3IN5 A;  4I2J A;  4EX7 A;  9ICU A;  4DSE A;  3BDP A;  1S5L U;  3AN1 A;  2B21 A;  3Q8S B;  4I2A A;  5KT3 A;  1OUQ A;  1N2X A;  2MUT A;  3F5A A;  9ICI A;  3SAG A;  4UB6 U;  4YXJ A;  3ZDD A;  1JRP A;  4YVZ A;  1ZD2 P;  1ZRM A;  8ICK A;  5EOZ A;  3BS5 A;  2W9B B;  3LWL A;  1QSY A;  4F5N A;  1ZQS A;  3RJJ A;  1XSP A;  2HOF A;  8ICH A;  3HJE A;  2W55 A;  3KHL A;  1Z4O A;  3PSF A;  2KJ9 A;  3JPQ A;  3B0Y A;  3AQF A;  3TAQ A;  1C20 A;  3RH6 A;  8ICR A;  4DQS A;  1T3Q A;  4DQP A;  4P0P B;  1ZQN A;  1COO A;  1JXL A;  4J9N A;  3AUO A;  3SI8 A;  2HHV A;  5AM2 A;  2PFO A;  2ZJA A;  3SR6 A;  1N56 A;  4DLE A;  2YQE A;  1ZQQ A;  1IM4 A;  1YZ6 A;  3ORY A;  3PW2 A;  5G5H A;  4UB3 A;  1XSL A;  3RJK A;  2W54 A;  4USA A;  3SEI A;  3GZF A;  5JTI A;  4QW8 A;  1QLN A;  5HHI A;  2RDJ A;  1TK0 A;  5CEH A;  3NGD A;  1ZQI A;  3OJU A;  2KG5 A;  2B0C A;  1PZN A;  3WKC A;  3N28 A;  2ZIU B;  4PGY A;  3HPO A;  4ECY A;  5KFO A;  4DCC A;  4KLH A;  5AKJ A;  2CXY A;  3PW0 A;  2IOF A;  2RQ5 A;  3GV7 B;  4O0I A;  4IR1 A;  3RB0 A;  4F91 B;  5DQI A;  4J9P A;  2G06 A;  4X5V A;  2A1A A;  5C0Y A;  3PW4 A;  4CNQ A;  5ALG A;  1SB3 C;  2G07 A;  4YQW A;  4RQ8 A;  2IHN A;  4O3M A;  5ALD A;  4RPX A;  1N60 A;  3ZD9 A;  4FBU A;  3FYH A;  2ES6 A;  5ALT A;  4F4Y A;  2A3V A;  2DPJ A;  5ALL A;  2BHN A;  3QU4 A;  3V7L A;  1S97 A;  1QH9 A;  4QZ8 A;  1KTQ A;  5TZV A;  2BKE A;  8ICQ A;  3HT3 A;  3ONN A;  3ALR A;  4IQT A;  3CP8 A;  2XVT A;  2FLP A;  2IA6 A;  2N1R A;  3E2E A;  1KFT A;  4UAS A;  4EZ9 A;  8ICS A;  5L1M A;  5L1I A;  1BPD A;  8ICW A;  4OJO A;  5B66 U;  3MR3 A;  4DF8 A;  5KFE A;  3OSN A;  2AH5 A;  4DL2 A;  3KFU F;  2KTQ A;  2I6X A;  4YN4 A;  4YD2 A;  1YT3 A;  3PO4 A;  3BQ2 A;  1TK5 A;  4BJQ A;  4ED1 A;  2D6F C;  2K8B B;  2VIX A;  4B9L A;  5ALF A;  4F2R A;  1Z1B A;  1BPE A;  2ISO A;  2JRZ A;  2LMR A;  3PY8 A;  4QZD A;  4ELU A;  3M9O B;  5CJ7 A;  1IXR A;  4KLL A;  4DL3 A;  1PK1 B;  7ICR A;  2AQ0 A;  9ICB A;  4AYB F;  2XI9 A;  3PST A;  1SIJ A;  4C80 A;  1Z3E B;  4P4P A;  3PML A;  4Q8E A;  3RF9 A;  4QWE A;  2BGW A;  4M9H A;  1XSN A;  1X42 A;  2NYV A;  2K89 A;  1L3V A;  2M9N A;  1JX4 A;  4E0D A;  2RRD A;  2BDP A;  4Z6F A;  3GFK B;  3MBY A;  4GXJ A;  2EZY A;  5D4B A;  2XY6 A;  4IC9 A;  4ECS A;  3RB3 A;  1LKY B;  1KSP A;  9ICX A;  2BCR A;  8ICM A;  3GV5 B;  4MFF A;  4CDG A;  5J2H A;  3RRH A;  3PX0 A;  4B9U A;  4NLZ A;  5J0Q A;  4ED6 A;  3JPN A;  3RRG A;  2C2D A;  5ALN A;  4P0P A;  2UVU A;  3HW8 A; 
#chains in the Genus database with same CATH homology
 1GO3 F;  2JH7 A;  1ZQ1 C;  3F5E A;  2WAQ C;  4QNL A;  2KHV A;  3PZP A;  3D2S A;  2R18 A;  2KD1 A;  3ONN A;  2JHD A;  2OYY A;  2KHQ A;  3ALR A;  3IG8 A;  2KIC A;  2KV2 A;  4JMU A;  3CP8 A;  2HOI A;  2XVT A;  4KX5 A;  2KKV A;  2N1R A;  2ZIU A;  5HR6 A;  4OJP A;  3HKZ C;  2DQN B;  2G0A A;  2G08 A;  2ZXI A;  4NWI A;  4PL1 A;  2W04 A;  1DRG A;  5KL8 B;  2HOF A;  2LBO A;  2NV3 A;  2YB1 A;  1XNS A;  1MA7 A;  2HBJ A;  2OXO A;  2WB1 F;  3D2Q A;  2G09 A;  2F2A B;  2ZIW A;  2RP5 A;  3PSI A;  2W03 A;  2DF4 B;  3PSF A;  4NV0 A;  4OJL A;  3MGV A;  4WJ3 B;  2G5H B;  3N7R C;  1A0P A;  2KJ9 A;  4PL2 A;  4P0Q A;  4A8E A;  3AQF A;  4OJO A;  2KJ5 A;  1F44 A;  2KNJ A;  2M0N A;  3IP4 B;  1Z19 A;  1PVR A;  4NLC A;  4OJ5 A;  2ZG6 A;  3VC8 A;  4CGZ A;  4FZN A;  2DGZ A;  4P0P B;  3KFU F;  2WAQ F;  1URJ A;  2HBK A;  3OPX A;  2KKP A;  3N7S C;  2E1E A;  2MRL A;  4OJ6 A;  2BDU A;  4QIW C;  5T14 A;  2W7O A;  1T94 A;  3H0M B;  1YT3 A;  1HIW A;  2H3Z A;  2K8C B;  4AYB C;  4BUG A;  4CRX A;  3C28 A;  2H3V A;  2H3Q A;  2Y0S C;  1IIP A;  3K1Z A;  4BJQ A;  2D6F C;  2LYB A;  2MA1 A;  1NZB A;  2K8B B;  1XO0 A;  2KEY A;  1KBU A;  2G5I B;  2GOL A;  2K4E A;  2XID A;  2VIX A;  3E0F A;  1SZH A;  2F76 X;  2K8A A;  2OM6 A;  2XIC A;  2ZIV A;  3ICX A;  1Z1B A;  2Q4T A;  2PMZ F;  2ZIX B;  3M7D A;  1PVQ A;  2H3F A;  2F8L A;  3GZF A;  3D2N A;  3CRX A;  3F2C A;  2E5S A;  3N7P D;  2VKQ A;  4FZL A;  4ICA A;  3DEE A;  3IG5 A;  3F53 A;  4KX3 A;  2KIW A;  2VJ5 A;  2K4I A;  3LVV A;  3M6Z A;  2F77 X;  4U7C A;  2CN1 A;  2LYA A;  3C29 A;  2JH1 A;  1D8B A;  4AYB F;  1TAM A;  2XI9 A;  2HMX A;  3PST A;  4KMO B;  5KL1 B;  3HKZ F;  2Y0S F;  4FZM A;  1CRX A;  4OO1 J;  2ZIU B;  1HEK A;  2KVC A;  3SMV A;  3GU3 A;  5HR7 A;  2HOQ A;  2RHF A;  5A0L A;  3AQE A;  3F2D A;  2ZXH A;  3RF9 A;  2W7P A;  2H3I A;  3PSP A;  1L6N A;  3M6K A;  5CRX A;  2E1F A;  1A6S A;  2ZIW B;  2JGA A;  2VJ4 A;  3AL0 B;  2K89 A;  3NRW A;  4QJF B;  2GH1 A;  4P0Q B;  1WUD A;  1UPH A;  2YX8 A;  3RFA A;  2LHT A;  3H0R B;  2RRD A;  3H0L B;  2G06 A;  3L3F X;  4GFJ A;  2Z7J A;  1PVP A;  5C0Y A;  4QIW F;  4BX9 C;  4IC9 A;  3O0F A;  4ACO A;  2LKY A;  2G07 A;  3F2B A;  3T79 A;  2KOB A;  3F5A A;  1Q3U A;  3LVW A;  3IN5 A;  1Q3V A;  4O3M A;  3SQI A;  2CRX A;  4U6P A;  2K4H A;  3VCB A;  4CDG A;  2WB1 C;  2YB4 A;  4FE3 A;  3SAF A;  3KZX A;  3NUQ A;  3SAG A;  3CYM A;  1ECW A;  2CPR A;  4C0Z A;  2OH2 A;  2ZIX A;  3LYS A;  4NLB A;  1OUQ A;  2PMZ C;  1ED1 A;  3SAH A;  2A3V A;  1P7D A;  2ZIV B;  4P0P A;  2HBL A;  2JMG A;  2HBM A;  2KJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...