2ZG6A

Crystal structure of hypothetical protein; probable 2-haloalkanoic acid dehalogenase from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
202
Chain Sequence
MKYKAVLVDFGNTLVGFKPVFYEKVYQVLKDNGYDLDLRKVFRAYAKAMGMINYLEHVDPKDFLYILGIYPSERLVKELKEADIRDGEAFLYDDTLEFLEGLKSNGYKLALVSNASPRVKTLLEKFDLKKYFDALAPKIFGFALAKVGYPAVHVGDIYELDYIGAKRSYVDPILLDRYDFYPDVRDRVKNLREALQKIEEMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein ST2620
publication title Crystal structure of Hypothetical protein; probable 2-haloalkanoic acid dehalogenase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
total genus 61
structure length 202
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.660 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zg6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2zg6A01
3J7TA 2JARA 3AR8A 4C4SA 3FVVA 4DFDA 2B1RA 4EENA 5AW3A 2HI0A 4B6JA 3L0YA 2YMQA 4XPZA 1TJ4A 4Y2RA 4DW8A 1YJ5A 2IOHA 4XQ0A 3E84A 3WK8A 1Z4JA 5AKHA 4E88A 1EK2A 2JAUA 3E8MA 3NUQA 4FE3A 1U7OA 2AGVA 3BA6A 4QJBA 2RBKA 3L8FA 1RDFA 1J8DA 3WKAA 5AVZA 2D2VA 1XPJA 1QQ6A 4XE5A 2B0CA 3QLEA 2G0AA 3E81A 2C88A 3DNPA 1L7PA 2R8YA 3PGLA 2C8KA 3MMZA 4NAVA 3WGUA 1K1EA 2JGAA 4IFTA 3QYPA 4BX2A 3NAMA 5AK5A 1Z4NA 2GFHA 2HHLA 1FEZA 3L0BA 3ZU6A 5AIAA 5AIBA 2FUCA 4OCZA 1RPZA 2IYEA 3N8GA 1XVIA 2WF7A 4G63A 5AW2A 2OBBA 4QQFA 4HGNA 2W11A 2I33A 3W5DA 4XOUA 4HGOA 4PNHA 5AKLA 1MH9A 5ALQA 2GMWA 2B82A 5AKGA 4J03A 4BX3A 2OA0A 4C4TA 2B1QA 3N07A 1ZD4A 1VJ5A 4KX3A 5ALDA 5AI9A 3MC1A 5AI5A 4UU0A 3DDHA 1U7PA 2Q5EA 4MWOA 4UM5A 2CFTA 2CN1A 4F71A 3WK5A 5ALJA 3ZW7A 3U26A 4HGPA 2QYHA 1T5TA 1SWVA 2B8EA 2W4MA 3VAYA 2QLTA 1Z4QA 4Y2JA 4ZEWA 3ZVNA 5AHXA 3A1CA 5ALFA 1QQ7A 2I7DA 3A1DA 5AK3A 2WFAA 3KBBA 4OHFA 1S2OA 4KYTA 1LVHA 5IT4A 1U2SA 4EELA 3K1ZA 3DV9A 2G09A 3W5BA 5AVSA 5AKKA 2I54A 4H1WA 3L1UA 2PKEA 3HYCA 1ZJJA 4YGYA 2R8EA 3OTQA 2G1AA 2IOFK 3WGVA 1TA0A 5T41A 1ZS9A 4Y2QA 3KDPA 4YIHA 3NALA 5IS2A 4FYPA 1ZOLA 2Q4TA 1QH9A 4IG4A 2G07A 2YJ6A 1TJ3A 1VFPA 4HYTA 3FM9A 2CFSA 1YNSA 3AR3A 1JUDA 2FEAA 4UMDA 4UARA 5AESA 2HF7A 2ZBGA 4DWOA 2YMMA 5AW5A 4YCLA 5AW7A 5IT0A 4I9GA 5AICA 2AMYA 4ZEXA 3PDWA 2WF8A 3AR7A 4BEVA 4DCCA 5AM3A 5ALOA 5ALUA 1TE2A 3SMVA 2HEGA 2HDOA 1NNLA 3E58A 4RESA 3KD3A 3WKCA 2YFYA 4BNDA 4Y2SA 1VJRA 4Y2YA 3U13A 5AVVA 4G9BA 5ALPA 4BBJA 1RKUA 4KNWA 4CE6A 5AW0A 4F72A 3OPXA 1Q92A 5JJBA 3I76A 2ZBDA 4I9FA 4Y2TA 3ONNA 4KX5A 2B30A 5AVUA 3QNMA 1ZRMA 2I34A 1Q91A 5AKJA 1L7OA 5A3SA 3QGMA 4O8CA 2JAOA 3AR9A 1U2TA 2JAWA 5ALRA 3RF6A 1L7MA 1L7NA 1YV9A 3PCTA 1J97A 4UMVA 4Y2VA 5ALEA 4ZEVA 4Y2UA 2ODAA 3ET5A 2YBDA 1AQ6A 2DQSA 3UMCA 1YS9A 3L8EA 5AM2A 1Z4OA 2RARA 5ALVA 4YH1A 3SKXA 4YCMA 3PGVA 3ESRA 5AK6A 2EARA 3IB6A 3L0CA 3UMGA 5AVYA 5ALXA 1ZD5A 5ALIA 2IOFA 2C8LA 5AI4A 3UMBA 5ALKA 5AKIA 2WHEA 3WKBA 1Y8AA 1PW5A 2NO5A 5AKEA 2WF5A 4GIBA 2NO4A 3ED5A 5AW8A 2OM6A 4CF4A 3WK4A 5AK4A 2FPSA 3FPBA 3IJ5A 4EX7A 3QU5A 3ZX5A 5A3QA 1Z88A 5AVXA 3HLTA 4Y2XA 3B9RA 1NF2A 4OD0A 5AW4A 1YMQA 2NYVA 1X42A 2B8JA 4UU1A 3U7FB 2ZOSA 3W5CA 5AI8A 1WZCA 2FI1A 1SWWA 3AR5A 5AM1A 2G80A 1KYTA 1WR8A 3AR4A 5ALNA 4YCNA 2BY4A 5ALWA 4BX0A 3KZXA 2C4NA 3EF0A 3AR6A 3QU9A 4NFLA 1RLTA 1SU4A 2GHQA 3L7YA 2HF2A 3WK7A 1ZD3A 3DAOA 5AM5A 2PR7A 4GXTA 2YJ5A 3NANA 5ALHA 4BEWA 4NV0A 2IA5A 3P96A 4Y3UA 1N9KA 2O2XA 2HCFA 3ZI4A 3N28A 4RETA 2Q4RA 2WF6A 3TLMA 3B9BA 5AW1A 3MPOA 1Z5UA 2G08A 3CNHA 1Z4KA 2ZG6A 4UASA 3W5AA 2P11A 3OCVA 3NASA 4EEKA 4UATA 4AS3A 1YDFA 4UW9A 2P9JA 3QUQA 3R4CA 4EZEA 2X4DA 3QU4A 3WKDA 3EWIA 3A3YA 4BYGA 2BDUA 3L5KA 1QQ5A 3ZVMA 3L8HA 2FPRA 3ESQA 4L6AA 1RMTA 2W43A 4CNQA 4L6CA 2FPUA 4JB3A 3SLRA 1RC8A 3NIWA 2GHTA 2FUEA 3ZUPA 3QUTA 2FPXA 5ALYA 2MSNA 2YJ3A 3GYGA 4OFZA 3QU2A 1Z5GA 2WF9A 2WM8A 5AM4A 2VKQA 5ALGA 4FFDA 3SHQA 3WK6A 3WK9A 3AR2A 1Z4PX 2R8XA 2I55A 2YY6A 1ZD2P 2P69A 4UMEA 3ZWDA 2ZBEA 4HGRA 1CQZA 3B8EA 3L1VA 4KNVA 4J2TA 2RAVA 1IWOA 1Z4LA 1Z4IA 3KC2A 5AI0A 5AM0A 2CFRA 5ALZA 5AVQA 4HAIA 4JDPA 2HSZA 4CF3A 5ALMA 3QXGA 2HX1A 2GO7A 2OYCA 2ZXEA 2I6XA 2R8ZA 2YJ4A 3M1YA 3RFUA 3QUBA 5AI6A 3OCZA 1O08A 5ALLA 4BNDB 1O03A 2C9MA 2FPWA 5AVTA 2HOQA 1F5SA 1L8LA 1QYIA 3QUCA 3IRUA 3U7EB 4HGQA 3I28A 3F9RA 3ZWKA 1ZRNA 2ZBFA 3FZQA 2EAUA 3N1UA 3SF0A 3FGOA 1EK1A 5AKZA 5ALTA 3U7HB 2BDEA 3OCUA 3R9KA 1WVIA 2AUTA 3OCYA 3QU7A 3M9LA 5AVRA 1Z4MA 2YMPA 1T9ZA 1RQLA 3EF1A 3ET4A 1T5SA 2HO4A 3I6BA 5A3RA 4NWIA 5AKYA 3ZX4A 2G06A 1RLMA 4MUMA 1TJ5A 3U19A 1RLOA 4CF5A 1S8OA 3KOOA 3FPSA 1RQNA 3U7GA 3OCWA 3N5KA 4L57A 3OCXA 1U02A 2EATA 3ZVLA 2YMLA 3SD7A 3R09A 3A1EA 3SKYA 1RRCA 1WPGA 4UM7A 1CR6A 2FDRA 3CZ4A 1N8NA 2O9JA 3MN1A 3S6JA 5FP0A 4AP9A 2YN4A 2PQ0A 4KN8A 3I1YA 3EPRA 1L8OA 1LTQA 3ZTYA 4BKMA 4YIKA 4Y2PA 4AS2A 3L8GA 2MU1A 3WKEA 2RB5A 3D6JA 1L6RA 1RKVA 5ALSA 4EX6A 4UMFA 1RKQA 4UAVA 5AW9A 5E0OA 4NABA 5AKXA 2P27A 5AW6A 3NRJA 3ZTWA 5AVWA 1RMQA 2AH5A 3UM9A 1NRWA 1RMYA 3BWVA 1XP5A 3QX7A 4UAUA 4C4RA
chains in the Genus database with same CATH superfamily
3PNVA 1OYOA 4YAWA 2GEFA 1Y88A 4RJKA 4A73A 2UYCA 4ZAGA 2PANA 2DY0A 4NOJA 4FKZA 3T3MB 1GY8A 3CT6A 2P7HA 5A06A 3GJ4A 1V5GA 3E82A 4J94A 1QCKA 1SHTX 1F2UB 4QOSA 3RWBA 4JLOA 4O4HA 4M1YA 5AIAA 3W05A 2BMVA 3BXOA 1Q1EA 2HHUA 3IUJA 3D2LA 1SL0A 4MV4A 1ZZEA 2UVRA 5BMVB 4M2LA 3MGAA 1YZKA 3X1ZA 4NJOA 3TTVA 1ADJA 1ULSA 2NQTA 4KRFA 1Y37A 4NY1A 1QIJA 2B1GA 1EFAA 1JEDA 4OP3A 4GMXA 2F9LA 4KVFA 3KBBA 2Q4DA 1SEVA 4OAOA 2KSOA 2VATA 4MW5A 2P5TB 3ND7A 2GYWA 4UBIA 4V0MA 4CUKA 3NPAA 1FUIA 2CHQA 3ZDEA 4J9PA 3Q4GA 4I2GA 1RHMA 2CB9A 5FEMA 4BTVA 5DCYA 2QVYX 4RWEA 4DLSA 1DC5A 5KL8B 1NFRA 4WASA 2XUIA 3GPCA 1F3LA 3EIQA 1VRWA 2YMMA 3GFPA 2CLOB 3STHA 3FYUC 2BBOA 2JCGA 4Y2SA 5E4FA 5JQGF 3TLBA 5EXDA 4OX9Y 3EASA 5IT5A 2BFBA 1DHRA 5IBCA 2QQFA 2CNWD 4PZNA 3HGMA 4NMHA 4E32A 3S2FA 3K1RB 3V7JA 1OLSB 2OFWA 4ECSA 1G21A 1UJ5A 2I8LA 4Y2VA 5DM60 2IVFA 1B15A 4Z4IA 4Y6SA 1B43A 4MW9A 1NUHA 3TOVA 3JQAB 3OZVA 1WP4A 2FMPA 1FCJA 4M1OA 5JQGA 4CG1A 5A9TA 2L18A 4DNXA 1H4QA 1QVAA 1YTUA 4QOFA 4JIGA 1G7TA 3N0VA 2IDKA 1CLUA 2RBEA 4P5DA 3PITA 4W8GA 3OFNA 3QE9Y 4HI0E 4DJ5X 1IN5A 5JCJD 5T6MA 3HKCB 4KAXA 1EE9A 3ETGA 2IP2A 1OFGA 1XXHB 3BWDD 4N39A 1QO7A 1NOMA 3MCTA 1YC5A 3OMWA 3UKJA 5LU8A 3A6EA 3KD2A 1UMCA 3JALB 4TMZA 4Z4FA 3H5AA 1TW3A 4F2HA 3DZJA 3GQBA 4QUDA 3KFVA 4TZ6A 1D9ZA 4BQPA 3C8ZA 1Z5UA 3PHHA 4IQVA 4Q4JA 3ZVRA 4D9BA 3TD2A 1A9YA 4XDHA 2KZMA 1IWPB 1FZTA 4CTJA 2CDNA 2I3AA 1QH1A 5C7LO 3L9XA 2QLJA 1UKBA 3L06A 4YREA 3FPAA 1TVKB 4EYIB 2GZSA 1B14A 1PE0A 4YT5A 4DAOA 4A5SA 3VCBA 9ICSA 1T3LA 2YXPX 1TTQB 3ONVA 4UMEA 3QOFA 3ZWDA 4MA4A 4EGQA 3BMQA 1XVLA 2R86A 5FJJA 4A6EA 4EPVA 4DLBA 5ALZA 3STYA 4X93A 4D3DA 1VKRA 1FYDA 2QRGA 3GLHB 2DFNA 4HB2A 3MMSA 1U8FO 3AW8A 1KQNA 1X2EA 2EFEB 2ASDA 2FUKA 1E7MA 2HO4A 1V0JA 2IT1A 4TYNA 2RAUA 1ZOSA 5EWMB 3PUJA 4K40A 5CYFA 5KFSA 2GTPA 3SYRA 2C7RA 5FFFA 5A6VA 1EM8A 1GLVA 4I6JA 2D54A 1ETUA 3IKLA 1NJ2A 3FC4A 1LKYB 1GKYA 3OKAA 1YVDA 2QTTA 4ANFA 3OSNA 2IK8A 2W6ZA 1O94A 1SL2A 5HF5A 1ORRA 4XB6B 4OMFG 4UEKA 3RC7A 2O8FB 2E3JA 3HYNA 4MSUA 3DE7X 5FNVA 3PJGA 1KJJA 2ZBUA 2O8BA 4Q8FA 1FVFA 2IJGX 1IQRA 1SVMA 3HDYA 3KKZA 4FTWA 3PPIA 4OGGA 4HUQB 1GAQA 2DHDA 1FFYA 4G3IA 4NHOA 3RSZA 3ISVA 2EP5A 2FAXA 3WXBA 2QU8A 1XV5A 3RYCB 3L4EA 3PGLA 2OYRA 3D7MA 4M0UA 3EY9A 4PVCA 1E92A 1SVKA 4RJJA 4GPIB 1X40A 2IGTA 4DUPA 9ICCA 1R64A 3F7MA 1WWUA 1Z2AA 4DPMA 2H5IA 5BO5A 2BM1A 1JAXA 3GFTA 2ZXFA 1G17A 1DIRA 3WRYA 3D4LA 3LBYA 5G0VA 1ZRSA 3E53A 1MR3F 4B9SA 1ZGHA 3BRCA 1D03A 3A1DA 1FP6A 3K1ZA 1KOGA 1GNQA 1TVAA 1QB7A 1XR3A 1T3ZA 1P4SA 4KGXA 4IHQA 1DINA 1FNCA 1UDBA 5IIMA 1T4CA 4G65A 3T61A 4KGDA 2FEAA 3DB2A 5C1BA 2Z6QA 1X7GA 3WYFA 4EFDA 4B33A 3LT2A 2TMYA 3FDXA 4XQGA 2V5AA 4JJAA 4X7BA 5E6SA 3ZWNA 1RWKA 1BEEA 1UQTA 2B3TA 1PFKA 1ZIYA 3PFGA 3ESDA 1L5QA 1L5SA 4KDFA 3CG4A 1KEEB 1QIKA 3D5TA 3DLHA 1WOYA 4B75A 1RZUA 4GE0A 4HQKA 2I34A 2H52A 3L02A 4OJOA 1TEVA 2GZ3A 3O2SB 4UB1A 2X8LA 5SZIA 4JLMA 3WZLA 1U8AA 2DLDA 2PZEA 4IUYA 3AF3A 3OG9A 5EWJA 3UMCA 4KE6A 5LD2C 2RARA 2WTAA 1ISFA 3Q7QA 5HQ3B 4D6PA 4LA4A 3LK6A 2WKPA 1K08A 3TPFA 2WB2A 3ZKWB 4RK1A 2FFRA 1ZQLA 2B7LA 4P3NA 3O2QB 3V2HA 1I7PA 1XMIA 4PL1A 2M6LA 2GO1A 2XY6A 1IBLB 1P62B 1NJSA 4L1KA 4LHYA 4HFNA 1W48A 2O2ZA 4QTTB 4Q9IA 3D7NA 2IBSA 4RUAA 4F0JA 1GZ7A 3RSOA 1GO3F 1IOWA 1U0RA 1PVRA 1JQJC 3UK1A 4D26A 1D3AA 1KK2A 1NASA 1VPLA 4NPHA 3UMSA 5ALHA 1E7WA 3H1AA 1TIKA 3NS7A 4V0LA 2J5KA 4X9XA 1NTRA 2GZDA 3ABRB 3WA6A 1ORTA 2IYAA 1ADYA 4FS8A 4RJ2A 2BIFA 3QOYA 4L6AA 4Q7EA 3DZCA 3DDOA 1U28A 3HN7A 2XBUA 1ZQEA 1IFXA 3NDBB 1TYZA 2GRAA 3JY6A 2IPAB 4JQYA 4IL5A 2K4EA 4RZRA 4IR7A 2NO7A 1DLJA 3RS0A 2IEGA 1NW4A 1VYHA 5K0ZA 3RTGA 1XLTC 2VEDA 3BXFA 3HWWA 3UUFA 2A1AA 1P2SA 4O02B 1H0RA 1G3IA 1UFQA 4JJZA 1KE2A 1N9GB 3UJCA 4ZDWA 3M9WA 1B74A 4NYJQ 1C7QA 4PRKA 1T5IA 3RVKA 4FW8A 1N78A 1W5BA 1ENZA 4ETIA 1PK7A 4LXYA 3BJYA 3OWXA 4CF7A 4LC1A 4QW8A 4BJHB 2PH3A 3L9WA 2ZW9A 3RUCA 3UK6A 4DMMA 5HF9A 5CA1A 1N8NA 3TINA 1JIKA 4XFKA 4P7JA 2PZJA 3VJLA 2IWRA 4IUCS 1UWKA 4UB6U 1YS2X 3ZIUA 1YB6A 1V6CA 1FFWA 3AXSA 5I7VA 1OLUB 1DJQA 1SK9A 3KXPA 1R3DA 1B7GO 5FWYB 3U0VA 3HG7A 1NUSA 4YVZA 4EMBA 2WQZA 1CQJA 3WR5A 1VLVA 3HXMA 5H81A 2BM0A 3GJ3A 5KINB 1W30A 5HS6A 1RYRA 4G5OA 4B7AA 2IYOA 3GVHA 2DFTA 4YVFA 5ITVA 4P36A 4FHFA 2O2HA 1ZQAA 1AO3A 4EBCA 3EOBI 2IXFA 2YQ4A 2F48A 1CBUA 2QRZA 3GZTB 1CTQA 3ZQ4A 4OCZA 3SM9A 3GU3A 4R1QA 2EKLA 4MR9A 3FSGD 3VGJA 4GOND 3OHPA 3ITDA 4NPCA 1S5LU 2UZ3A 1ODSA 1DIHA 3FYUB 1T9HA 1DWUA 1DQZA 3DONA 2ASEA 4LY0A 4Z1MA 4C9BA 1CQIA 3DLIA 1TTHA 3V1TC 1HURA 5P21A 5JAZA 2VYVD 3GPDG 2NYAA 1R4MA 4E3WA 5KFOA 5J2CA 4LCJA 3UWDA 3EQ6A 1OV4A 2AEFA 1VOTA 5C53B 1DEHA 3R3SA 1G5RA 2H18A 2YNMD 4QZVA 2XCLA 2EZTA 4EZ6A 2BCEA 2I4MA 3RIMA 1BE1A 1CE8B 5FH9A 4ND8B 3C3DA 3OT1B 1H1TA 3BMNA 1SU6A 2QY6A 1O95C 2WHPA 4JCOA 3RAXA 4ZMBA 5CJ7A 1U1EA 5KNCA 3G8BA 3HKBA 4ZRDA 3GCZA 4ALLA 3I37X 3RH5A 2ASVA 1YR9A 3ABIA 3RF6A 1MSWD 3QH4A 3RRBA 1HBJA 3G02A 3AI2A 1AF4A 3TM5A 1KHTA 1NX9A 3QMMA 2KB0A 5AK6A 4GWGA 3BFVA 4MB0A 4RU1A 4CLDA 1MRNA 3GBPA 1D8LA 4PLYA 3CEHA 4FIDA 5DGCA 4G56A 1ACMA 4ZOLB 4F2PA 4JKYA 1G4UR 4P8RA 3AZOA 1KQGA 4Z3KA 4QZ8A 5PNTA 3SX0A 1HFEL 3IX7A 3S70A 4DMGA 4UAGA 5IKXA 2X3FA 1GADO 1Q57A 3WHLA 3GHYA 3ICCA 3M5CA 4FFLA 3WV4A 4BJ6A 1IQUA 4L27A 3WDSA 3AF6A 4E07A 1Y81A 2XYQA 5IHXA 1EJBA 5FCDA 2HF2A 1UH5A 3OZEA 4B6OA 4I55F 2JAPA 5FBHA 2GAJA 2XWJI 4R1PA 3TNJA 2EKPA 3AUYA 4N1AA 1HY3A 1WCLA 2WFLB 5B1SA 3LX5A 5EUBA 5HF6A 4MWDA 1E2DA 1WMBA 4PLTA 3FE2A 4R9UC 4CLXA 2YXBA 3WIDA 2GLXA 2QN1A 1FXWF 3TOXA 3NWJA 3H6GA 7ADHA 3DO5A 4G8CA 4A8JC 1B6RA 1W581 2WM8A 3L8MA 4OHWA 1JT9A 3BK2A 2CY0A 3QHPA 4BXOA 1MQAA 3L0OA 4RC9A 1QH8B 4I55A 4K6KA 2NW6A 4L95C 3HJFA 5JQWA 2X9NA 2WWGA 2W2MA 2XE8A 1XZHA 4EL5A 3AH8A 2ADMA 4O0MA 2H0QA 2D1TA 1N92A 2Z30A 1E98A 4R3NA 1WWVA 2AD5A 1MFPA 5DCWA 3T4EA 2X8WA 4LBZA 1YBAA 2P1RA 2XT9A 1IQPA 1JMKC 2W8BA 4JFAA 5DNEA 5CVEA 3FMVA 3ESBA 3JQBC 5CYGA 2GZRA 4KN6A 1Y8CA 1B8NA 3RF9A 1KVUA 2I7TA 1IOVA 5CFQA 3BSSA 4CCYB 5IXJA 1OKKA 2XRZA 1Y5RA 4Q47A 4BVEA 2ZTVA 1PQYA 3IQWA 3CNEA 2OBXA 5DGIA 4OHZA 4JMPA 3RASA 2I80A 1OT5A 2LNDA 2OPBA 3K0EA 1SCJA 2XKBA 1GPNA 4R66A 5FV4A 2ZR8A 3SY8A 1HA3A 2HI0A 4HRXA 3A26A 3N7TA 1JKJB 3VVLA 5AKHA 4PRLA 1LNZA 5ILQA 4QJBA 3R3UA 1ZIXA 4Q1FA 4YC7A 4J0QA 3ZDZB 3AOEA 1W2HA 5IRCD 4O2AF 1YBMA 4QUGA 4DQSA 2NAPA 1N2ZA 1P1HA 1N2EA 4ETWA 2PIAA 5JZVA 5KKAA 2HUPA 4LY6A 4Z99A 5KNCH 3SQMA 4EECA 1GJRA 4HWGA 4LDNA 4DB4A 4LS3A 4WZAA 1FDTA 4GKJB 1YI1A 5BUSA 2XMDA 1M3SA 4RANA 5I9LA 1E9CA 4D46A 2HXSA 4UHEA 2NV0A 4TMVA 2EFJA 3R2JA 1LVUA 3PQFA 4TKMA 3BXEA 4FZVA 4N82A 3QVOA 4AN0A 3RU3A 3TSWA 5CT5A 1VE9A 4QA9A 3COSA 5BYAA 2VR1A 4MW0A 1VB3A 3IUSA 2NACA 4JI8B 3L4KA 3LUPA 3UT0A 5FWXA 4JBIA 4KU4A 2JD2A 5LD2B 4TLLB 2NOAA 3CGWA 2PWYA 1L8AA 2VTEA 3AKCA 2CL5A 5EHXA 4PLWA 5KG2A 1V16A 3I58A 1PV4A 4NM2A 4E12A 1HKUA 3V7NA 3O4FA 1W5AA 2B5WA 4JVMA 3WNCA 1ESMA 4XFDA 4ND3A 1XZIA 4YQEA 3MHTA 3VRHA 2TS1A 2CJWB 2YQZA 2DUUA 4LOJA 2CXPA 2HR1A 4QUKA 3I32A 2CV2A 3H8VA 5FBVB 1KIMA 4F3RA 4I6EA 1F2TA 2F43A 1EINA 3UA4A 2BC9A 5A3VA 1G8HA 2AFIB 1DARA 3KPJA 1X0XA 2FPIB 2RAFA 2DF4B 2I9KA 2LDBA 1A2BA 5IN4A 1EFLA 3QVKA 4MUJA 3UMFA 3PC4A 2BI4A 1F6DA 4CU5A 4FZJA 1XZ8A 1FVOA 1NI4A 5BV1A 1SC1A 5JS6A 2OXTA 3RU7A 1N77A 1V25A 5KOHB 2QPTA 2IGBA 1TNDA 1IXKA 3ANSA 4PW0A 4FLEA 1PW5A 3I09A 1YIDA 1QK3A 3OAAA 3JVIA 4L5BA 1ZVKA 3CRXA 2G40A 3LC7O 1UMBB 4IUDS 2FRDC 4IGEA 4B9EA 3PUKA 4TKLA 3FDFA 2AGPA 2V97A 3QJGA 5IM5A 3S3TA 2BFWA 1RC0A 3L7DA 4NBNA 2BKAA 2HV8A 5ALWA 2Z4RA 4XFJA 4IQGA 3L7YA 5EQJB 1UAGA 1XXHE 1Q2UA 2J3DA 1FDVA 4TTSA 1Q11A 3SC3A 1AK9A 5F76A 2W7TA 4MVCA 3OQOA 3HYRA 5JBIA 1ZN8A 4IXTA 3LLVA 1EBUA 4MZXA 1OMOA 3FDSA 3HSSA 9ICJA 2Q49A 1T1RA 5HK8A 4KQ1A 2D4AA 4A36A 3LP8A 3LM8A 3ETDA 2L0XA 4QBKA 2HFKA 3UB3A 2I8CA 5JCZA 3NGLA 1BW9A 3B89A 3DKVA 1VHDA 5TQ2B 1NOJA 2K8AA 5TNXA 5AVQA 1U0LA 2R6AA 1VRVA 5BOVA 1PNOA 3A0UA 2NT3A 4BWVA 4RQTA 5DBFA 3GWZA 4BNDB 3C6XA 1HOTA 1D09A 3PFHA 3LY7A 3DT8A 1FQWA 2BDEA 4PGHA 1N5KA 1X8LA 1LW6E 2QAGB 2NTVA 3MDCA 1EIZA 1RQXA 1AJEA 4I50B 4CL0A 1QNLA 1RNLA 3GLHE 4MP6A 2XVXA 4OHVA 4ZOHC 1DOAA 4YXMA 1I9CA 4PLHA 2G5GX 2GBGA 2O9JA 4X6YA 3INNA 4D4MA 5FIUA 1YA6A 1P1JA 3A14A 3L7JA 4CKXA 1EWVA 3QKUA 421PA 1ZGAA 1F0YA 4XUCA 1ZXIA 2O5CA 4UAUA 2AG5A 3RG2A 4LTDA 3N2ZB 4IGAA 2AGVA 5JJCA 1GVNB 4HSGA 3MR6A 4GR9A 4LF7B 2WOJA 5BNIA 3R8CA 3I5MA 2NXWA 3UAZA 3F9CA 5EE0A 3QTBA 1V38A 4D4JA 4M99A 5KDOA 2GCGA 4BMCA 4AZ3B 3QIAA 2Y9PB 1QSLA 2ATEA 1I32A 2W6PA 4HGOA 1WBDA 1NX6A 3EA4A 3VVMA 3ZZ1A 4R8UB 2WIKA 4FGKA 3IBCA 5SY9A 4LGVA 4MW2A 1WETA 3WK5A 2LCFA 2QR2A 2IIQA 3PPYA 4R1LA 2O1EA 4D43A 1E1NA 1ZMRA 1E1RA 3CH4B 3I5YA 5JG7A 3DAYA 4BFTA 3B48A 5BQOA 4BCBA 3OOJA 3WGNA 3AMVA 1MU0A 4NENA 1UUFA 3HO6A 3GN1A 5KG3A 4RZ3A 1KZ4A 4DJTA 5M29A 5IYZF 3BXXA 3PX3A 4K6MA 4D92A 1O57A 2NU7B 1PT9A 1YZVA 5HKKD 2ZYIA 4P81A 4KPGA 3F2IA 3EEOA 3U61B 4HN9A 4BQFA 1EEXB 4CT5A 4ZQGA 4YRRA 3N4MB 3ZQUA 2PIDA 4I2FA 1YS6A 1W35A 4R2LA 3LUHA 2P9HA 2VZ8A 4BWJA 1OJ7A 2JRLA 4DQRA 2N42A 1I01A 3RVRA 2VPYA 1PG2A 4N54A 1F0PA 1PV1A 5CPBA 1QHSA 1UXHA 3JD2A 2D0OB 1QNFA 2QVZX 1F1BA 1TUGA 4R8VA 3T79A 5J2BA 4HBGA 2W90A 4KHZA 3WLJA 3WL7A 1EGVB 1ZQRA 2DQZA 1D1TA 3TTTA 4WDQA 4EZ9A 5KJEA 1X77A 1IY1A 3Q5DA 3B53X 3GUHA 2VDRB 3AUXA 5FOWA 4Q3KA 4B4KA 3FHLA 2A57A 721PA 1TFRA 4NYMR 3ROTA 3AY3A 3PGKA 2VH2A 4OXIA 5G0UA 5C52B 2AQ4A 1XL0A 3OZGA 4A8JB 1JR2A 4TUYF 5GMOA 1W85B 4OV6B 1H3EA 3KYBA 4KR3A 2ENUA 3DP9A 1K8XB 3DVSX 4PZDA 3VMMA 2DECA 4N6GA 1J2TA 4RLFA 2JVKA 4Q12A 4I2VA 4AKSA 3QU9A 1F2VA 4E31A 3CPJB 2YNMC 3OEED 3EAGA 5C4IA 1ZSNA 1LH0A 3PQ2A 3D8BA 1E8DA 3N28A 4IRUB 2D0PB 1Y3CE 5LC1A 1LI7A 4GOOD 2XMBA 3QU4A 1SHUX 1KTIA 8ICUA 1PJZA 3CEJA 1DO8A 4H18A 4MWTA 4MXDA 4KC0A 1NTOA 2H07A 3Q9UA 4HUJA 1MO4A 1WY5A 4HVLA 5J2DA 3SR0A 5KFAA 2CLKB 1MIOA 4R9SA 3IE2A 2MYPA 5L53A 2COKA 5LLDA 4A23A 1K3TA 1I3LA 4XVHA 4ESEA 1DAOA 2VTDA 4S3MA 1H1LA 4F1WA 3ZIAA 2BEVB 3SZ3A 4RD3A 2NNWB 1Z3IX 2I87A 3Q3GE 4N41A 2V7UA 2I6XA 1NJ6A 4YLYA 2H2HA 1NC3A 4WLUA 3E9YA 2PXCA 9MHTA 4EYHB 3Q15C 4URFA 3BFXA 2DKFA 3P9NA 3A4NA 1OX4B 7YASA 2QVCA 4XWAA 3DDWA 2HBLA 1R88A 2YVLA 3JASB 3UJNA 1V71A 4HB0A 1UBNA 4H0CA 3USZA 4PFSA 1TJNA 3JAWA 3H18A 4ZHQB 4XB1A 5LZ9A 2EYUA 3QMWA 4D0NA 4GC5A 5CP8A 4UHBA 1J9EA 2W6JD 5SY4A 3GFGA 4DOCA 3NDJA 3F53A 3U1BA 3COVA 2O6HA 2UVPB 1CY0A 1YJBA 4JLBA 4X45A 1SUDA 4UMFA 3CW8X 2IYVA 2I29A 1I1OA 2ZAOA 4K86A 3HDQA 1Q6YA 121PA 4C2TA 3FNHA 4MDEA 1QV9A 5EKXA 4JP3A 1L1RA 1H9CA 4I28A 3KHUA 3OEHD 1N8TA 1WMFA 3K1TA 3RJTA 4MQ6A 1N56A 2PPLA 1FK8A 4XM1A 4WD3A 4R01A 3WIEA 4MVXA 3IULA 6GPBA 1J8DA 1B22A 2R8OA 4FN4A 5E8JA 1NMXA 4J4TA 3RLIA 3H3FA 4PO3X 4GMGA 4I1PA 1BFDA 4G5FA 1A1VA 1K7FB 1N5XA 4EG7A 3TLJA 1SN7A 5I9IA 4RM2A 2WINI 3QPDA 4LWOA 2R00A 2VIIA 4HQ0A 4DLNA 1GGVA 3DAFA 4L5AA 3LLSA 3QI2A 4RIGA 3UUEA 6REQB 4HRAA 2MIIA 3H1BA 1U94A 3SR3A 3KJNA 2HQRA 3QQ5A 3RJGA 3H2KA 2REXB 4IS3A 2ZANA 5J63A 4RVDA 5A1TA 4IH1A 3IVAA 4WXRA 2ZIXA 5AK3A 1X2IA 1Z33A 1RHUA 4URHA 4DLRA 2OLKA 1ZO8A 2GESA 3O4VA 3A6KA 2MSWA 3E5HA 1VCOA 1N2HA 3EXEA 1DLIA 1Q0HA 1UMDA 4G6ZA 2X2FA 1YAJA 2KD1A 4EGJA 4WFIA 2EX0A 3P9QA 3Q85A 3X2EA 1RR6A 1E2HA 3U2QA 3GGJA 2I7VA 4RQ6A 4V0SA 4OL9A 3MUEA 4OO1J 2Q7DA 4UOQA 2JC3A 3CUWA 1UJNA 1II9A 3N7RC 3G3EA 1ADBA 1N6KA 4TRJA 4FMPA 4ZI3A 4OAPA 4FC6A 3UXMA 3BJZA 1OLXB 1QFSA 3N2YA 1JZSA 2V9PA 4NK4A 5NULA 2HB6A 4FEEA 1GZVA 2GBLA 1YR6A 2JAWA 4JJ7A 5HHTA 1KP9A 1FRNA 2FSGA 2J0UA 3UVEA 1TYCA 3JQFC 4RAOA 1AKUA 2F6RA 4R0MA 3HR7A 4JUDX 2VNIA 4BVGA 4C7MA 3WA7A 3O93A 3BD7A 5JD4A 4UQLA 2BCGY 4QFDA 5KWIA 2I4LA 3KHRA 4Y2GA 2ZRKA 4AMUA 1W4AA 1FQKA 3W8EA 4L4UA 4EM6A 4CEHB 1LA2A 4BEBA 1W0JD 1Y7IA 1XCOA 1VE6A 1BWRA 1M10A 5GINE 4CM6A 2R1VA 1CUIA 1V97A 2RIRA 1E3LA 4BB5A 5KYUA 1J0EA 4F06A 3KT3A 1KU6A 2QMOA 4BRZA 2BEKA 2QYOA 5E4JA 4UEWA 4EJ2A 1ISSA 2ALJA 2C20A 2A59A 1TRKA 2PBZA 3EXHC 1NUPA 3ONFA 1ZNYA 3THWA 4BP3A 2P2LA 5DI9A 3VNRA 4CNQA 1X1AA 3MRSA 3SEFA 1TB4A 1Q1BA 5F1OA 1XNSA 3MTEA 1XSEA 3GRYA 1OILA 1XWWA 3FLAA 1HZZC 3ZLBA 4DQIA 4YP5A 1KO7A 2YY6A 1JNYA 1CLEA 2AFHE 1ICIA 1YFKA 4RA6B 1YQ9A 4JKOA 5LZ4A 2ZAMA 3HJAA 2W6MA 1SBQA 1SZDA 3KCQA 4TT3D 3ROFA 3RIGA 4LBYA 3INRA 2A9PA 4JDPA 2R8PA 5ALMA 2QT0A 7ICFA 1N9ZA 5F21A 1BS9A 3HY6A 5HFJA 3G6WA 2KHZA 2EZ9A 1M6HA 3TAPA 3D0RA 1QGYA 1UXOA 5I47A 3C8UA 3UAWA 2EJCA 1DZ3A 3X2FA 1BO6A 4QOIA 4JI1B 4ENSA 4IIFA 4LFCB 2WVAA 4HH3C 2HGZA 4N76A 521PA 1Q84A 1UFKA 3T5AA 3HB4X 3WJ1A 4MI1A 1Z07A 1RAGA 2ZTMA 4PTYA 3E8SA 3TLYA 1JAHA 2QM0A 2I4IA 4GXJA 1O77A 1P61B 3ANNA 3EXIB 1O96A 3T3HA 1LDMA 4Q4CA 3QX3A 1WM1A 5HIAA 4QO7A 2O6KA 1C4WA 4ELTA 2ZSDA 2K4IA 5BRNA 3I1JA 1JEQA 5EE9A 4B3CA 3AILA 4C6SA 4DSOA 4PYMA 4G0MA 3H1EA 4YRJA 1VJGA 1ZHFA 1GU7A 4MVJD 2ZIGA 1FJXA 1VSQA 5CG2A 2ZETA 3P5BA 2OAEA 5EIFA 2O05A 3PFCA 2G17A 4NRDA 5LQAA 4O4LF 5D84A 4V3BA 2HK8A 3RJEA 3EW7A 1MZVA 2AI1A 2PO7A 2C4VA 4D0SA 2VS1A 2C59A 5IUJC 2HJWA 2QP3A 1H1DA 4UFPA 1Y1KE 1IPEA 2NO6A 3ACBA 4UU0A 8ICGA 3WB0A 1VHLA 2EBUA 2OCAA 3R0QA 3K9NA 3U3OA 4F4DA 4CMIB 2J0EA 4DIKA 3KOMA 4G1VA 1QQ7A 4HX2A 3HO8A 4K0RA 4G5QA 4XWTA 1IQ0A 2H57A 2RE8A 1CPYA 3SQWA 1Y4ZA 1UKVY 5CDSA 1MAAA 3UMYA 4IV8A 4R2MA 1F8YA 1BWQA 4PC6A 1JDNA 1ZOLA 1N8KA 5GZ6A 1DKNA 1NM5A 4KOAA 1TD9A 4IDQA 4RKFA 5HILA 3TK1A 1FTQA 5KWEA 3ZHYA 1Q3VA 1UC4B 2PX2A 4BNKA 5HR5A 1MAWA 5FTKA 1I7SB 2WF8A 4R1UA 5B1IA 4U02A 3MT9A 3QZ8A 1ZCZA 2XXAA 5BUQA 2LPMA 2P91A 9LDBA 1BYUA 3WIUA 3KZVA 4OQEA 4EUEA 4P7GA 3TW8B 4IVPA 1NHGA 3WHPA 4ZREA 1G5IA 1KA9H 1H2BA 1UK6A 2AZDA 4AQ7A 3CE6A 2PYIA 3IILA 1A9TA 4U9UA 4PO1A 4Q9KA 3VJKA 4KWHA 1YS7A 4XJSA 2BMDA 1NYRA 2BGUA 3D1VA 4KTVE 3NBYC 3FKSD 1JDVA 1GAWA 1UPBA 4PLVA 1DRUA 1P39A 3KK0A 3LRXA 3KYCA 1OV6A 4ESOA 2NPIA 2GA8A 1TCVA 4MP8A 3SX2A 1FFDA 2Q3LA 2QS9A 2K2WA 1IM4A 3N0WA 3UUGA 5C4MA 4PG6A 3IVMA 2NP7A 4ED0A 2QENA 3B60A 4QATA 1SKUA 3H2SA 4A5OA 2BBTA 3AR6A 4G07A 4KQ2A 3DQPA 4R8SA 3R6LA 2NUAB 2FVYA 1L7DA 4I66A 1O95D 5DN6A 2VIXA 4MVJE 2YVQA 1Y5IA 2ENWA 5HGXA 2IA5A 1E2NA 3H13A 3HLKA 5GJBA 5D5HA 4GG1A 3FPKA 4JQCA 4YRNA 4DR6B 3TG8A 4PXSA 4GGMX 5HWSA 1XU7A 2QBYA 9ICXA 5AWFC 4OAQA 3W5VA 2DT8A 3N3AC 4YXWD 1R4NA 2OKGA 2OVBA 2JATA 1NW9B 2FWRA 1YQTA 2CGEA 4F6RA 4I5GA 5A02A 2VJNA 2G72A 2WV9A 3DE2X 1YF3A 2GZ2A 2JGRA 4ZVSA 1PJAA 3GAFA 5ECGC 5C3UA 1MDBA 2WJIA 2CFRA 2QTMA 4X1OA 3N0RA 1YHYA 3WTCA 4M9JA 3EZ2A 3C2KA 3IBSA 2QI9C 2PV7A 2PRKA 1Y8QA 3G68A 3AGQA 5DHSA 3FPEA 5FX2A 1O4WA 4D8YA 5FBZA 3PEVA 2L2QA 4AJIA 4X61A 2C28A 1P8AA 1G42A 1OAOC 3UQYS 1TAHA 3JQPA 5HUHA 5KPJA 2RCNA 5A5FA 3WIVA 2Q5HA 5JAUA 4J07A 2QJTA 4WBXC 2FW6A 2DHRA 3R7WB 2LM1A 4EX6A 1RKQA 3OY2A 4J9MA 3WS7A 2HHVA 2WIBA 1TPZA 4C4RA 4EUKA 1OFVA 5KHOC 2ZUBA 1BXGB 4HB3A 4B84A 4RXTA 3HT3A 3RABA 3GF4A 3OQIB 4RACA 4IEEA 1RZRD 4EZBA 4M3NA 3BERA 3JCZA 3SQIA 2WFMA 4FFOA 2VFAA 1V1RA 2ZXIA 3CWQA 1WXHA 1KQQA 3BTOA 3UK7A 2QDKA 1M5TA 1Z4NA 1J25A 1UP4A 1NSYA 2ZB8A 1EP1B 2CUNA 2VCHA 2Y1KA 5FPTA 2Y0EA 1R6AA 1RYHA 2BM8A 2B1QA 3RFFA 3E03A 4HFMA 2FPGA 2C92A 4QZEA 1U8ZA 2PT7A 3VR3D 2QXTA 4KWCA 1HDOA 4JT8A 4DV2B 7REQA 3QLJA 4CV0A 2ODWA 3PRHA 3AB7A 4RDIA 2IYTA 2QN2A 1X7XA 1M6WA 5K3OA 2VUHB 1QTQA 1JV2B 1PKEA 1XMJA 1EP9A 1THTA 4E0BA 5AQ1A 4C4AA 3G17A 1GRQA 1NT2A 3WGVA 4MCJA 3KDPA 5HRUA 3LHKA 2RI6A 3ZV3A 3IOBA 2BEUA 3TN7A 4P5PA 3HQ4O 5DULA 3LX6A 3K6KA 4I2DA 3QE3A 1P0QA 3F73A 2LBOA 3ZDCA 2YWCA 2HK7A 5KS2A 2FJUA 1WBBA 2L82A 3Q0IA 4PZUA 5BSTA 3JU3A 3BBPA 4Y6RA 3EXFA 2JEFA 1JJIA 4QBIA 2WWVD 1JBQA 4H7IA 4LW8A 4E5NA 1NW6A 1NQAO 2J6BA 2Y1WA 5C46F 5FLYA 3G2NA 4CDGA 4EVSA 2FE4A 4AO7A 4MV6A 1J22A 3CLUD 3C15C 3RVQA 1UPAA 2GEKA 1X6VA 4YQZA 3AM4A 5CA0F 5HF8A 5FJIA 4HXEB 3RJZA 3K72B 5AXBA 2BSXA 3EBLA 1O87A 4XEUA 3O4JA 3U7RA 5KNBA 1XDDA 2QD4A 4DNFA 2WSBA 3GLKA 1NXVA 1G38A 2OT3B 1FDOA 3AM3A 4DOAA 2HUNA 3EZXA 3VA7A 4ALIA 3DJYA 5F9FA 4XD2A 3LFUA 1DJMA 2RMKA 3VPAA 5L1IA 3BIFA 3GARA 2JFWA 4M53A 1W7AA 4CN9A 4FO6A 5CA0A 3NHBA 4R8LA 4JP8A 2PSHA 4W9NC 3H3JA 4QU9A 1FTNA 3ZBQA 5JSZA 4JA2A 4F5RA 4JY7A 3WSTA 3PDIA 4I4IA 2ZJYA 3H11A 3SDZA 2ZYSA 4FHEA 2V4QA 3O1LA 2C2RA 5JPDA 5DI3A 1JLMA 2ROQA 3AVOA 4RF2A 4BFSA 1ABFA 4ENWA 4DDWA 3OHAA 3ENVA 3HYLA 3QUQA 4MWEA 4OQDA 4RA9B 2QRKA 4MOWA 1V5EA 1XU9A 5L3RA 1FTWA 3T41A 4MRMA 3MYYA 4FFNA 4Q45A 1DOZA 1HE2A 1UK8A 2YX1A 3BQMB 1I14A 4G36A 3ZBPA 1LQTA 1L0BA 1SFRA 1ZKMA 5A4FS 3PFKA 2AUMA 1KMMA 3TARA 5TISU 4AZVA 5ARBA 2OHOA 1A1SA 3EEQA 5KFLA 4Q4AB 5F12A 1VI6A 4NZ9A 1J5XA 2X2EA 2JHDA 3GW8A 4V02A 1GCOA 4HS9A 4JVNA 2JH3A 4GBGA 3QUBA 3FCEA 2JFXA 1B6GA 4CV1A 2ZDHA 3TB4A 2EWMA 4RMJA 3PNSA 1LUAA 2VA2A 4ZVMA 3WWPA 4DEYA 4XQ8A 1G55A 4ASUD 1VSBA 4RPCA 5EJ2A 1IBMB 3FCAA 1ZJYA 3L05A 4WBNB 4AKGA 4OFBA 1FQOA 1JECA 4RIHA 2QRVB 1QC5A 4L9WA 2OOKA 2KJ5A 1SZHA 1PJRA 1U81A 4JOQA 1WXQA 2Q2OA 5CJPA 2LGJA 4QOGA 3KVRA 2NV2B 2C2XA 2PQ0A 4KN8A 4KIJA 4NYIQ 5ERGB 3SE7A 1Q14A 4HWPA 4HDQB 5KNDD 5DLFA 1A4UA 4KKVA 2XV1A 2XZLA 3O84A 5AVWA 3KB1A 2EAMA 2KBEA 1SOMA 1P4AA 2ZTHA 4DCPA 3I2GA 1KJIA 5FADA 4TQRA 4LDAA 2CDRA 4YRLA 2D13A 4UUAA 1XTQA 2E4AA 4PV7A 2F3UA 1PGJA 1O1YA 2BGNA 3ZW9A 2RGBA 4MKZA 2N1MA 3THXA 5FRDA 1QSYA 4R1MA 4AUMA 1IRXA 3R3YA 4NZPA 3KEFA 2Y27A 3V4FA 4EW3A 3K0CA 5DHPA 4NC9A 2HHLA 1LW7A 5IDWA 1KMCA 4MMYB 1FYFA 4X24A 4LRYA 1LKZA 4P53A 1JXQA 5L9AA 2B1JA 2PYZA 5K0JA 5J2AA 1Q15A 2QGNA 4IH4A 2XOKD 2ATVA 3PD0A 3K4HA 4II2A 1RYEA 4KLOA 5L7TA 2EZYA 1ZCBA 5LCXA 1AB6A 3RYFA 1GL7A 2VCEA 9GPBA 4B8YA 3ZNPA 1TAUA 3OFVA 2VXCA 4KQJA 4MAFA 3HI4A 1E2UA 1LSJA 2GM3A 4QDOA 3Q5EA 4RVSA 5FB3A 2APJA 1E59A 2AG0A 2OFPA 4FYKA 2HLDA 1L7RA 3C85A 5DSXA 4YV1A 2JFBA 3O4HA 2EG9A 2LDXA 4Y7DA 4PJ0U 3U0BA 5KNBH 4DEXA 1AZLA 2NO9A 1QH9A 5EE1A 2C3YA 1P1IA 4IKEA 3U7IA 1YR2A 2E55A 4RENA 2JEZA 2BL4A 3ENQA 4MVJM 1ZUNB 4ZZIA 2MUTA 3RHSA 2VP6A 8ICTA 5CBPA 3ZE9A 3TTYA 3FKQA 1AS2A 3MINA 4PYIA 2Q45A 2XNKA 4DQUA 3VI3B 2OZEA 3JPPA 1T26A 5ALPA 4D9HA 4BMZA 1KORA 1R0RE 3A3NA 5A04A 4V39A 4EKEA 3QGMA 3R6TA 3RFTA 3P32A 4O4JB 3AXTA 3GDFA 2OCGA 1Y42X 1R4AA 4EKDA 1NQWA 2GN0A 1OBOA 2QJFA 2YYZA 3L7MA 1PNVA 1ISMA 3VSAA 3WAJA 5KYYB 1NVMB 2NYUA 4DCNA 3LU1A 1C1XB 1PWHA 5KFCA 4XUDA 3K53A 3WOHA 4W1QA 1VIDA 1ETHA 1HYEA 3H4IA 2QB5A 4DA8A 4LK3A 1HRDA 4O1IA 4W82A 2X5NA 4BIIA 2GM9A 2Q9CA 4FOLA 4JT9A 4NFLA 3CVXA 1TECE 2JVIA 1TA9A 5F35A 2UVDA 2ZDQA 3NBAA 1NVVQ 3H6KA 1QCYA 1C3EA 4BZQA 2IOQA 4K03A 4TMWA 4CLRA 1R8XA 1M2GA 1M6VB 2DWQA 4UHKA 4DSZA 1Y4AE 2CE7A 5IJ0A 2Q8NA 2I2XB 1J7JA 1VMKA 1VSUA 2CT8A 5KFQA 1Q0SA 5H3HA 2XA9A 2Q2VA 3KHHA 5KYXB 3CRZA 4UZEA 5F9NA 2MHCA 2AG1A 4PQFA 5AK0A 1G8JA 2XQKA 3PEUA 3BH7A 1KOLA 4P4SB 2J6HA 4QXOA 3RH4A 3KXIA 2R8RA 3JAKB 3LGSA 4ZTUB 3M1YA 3D4BA 1DXYA 1PVPA 1M1XB 4YY3B 4Z86A 1RBYA 2X4GA 4QGHA 1GZUA 5DP1A 1YZHA 4GLLA 4JFRA 3ZHQA 4DILA 3PXBA 3IUNA 3OC0A 4H6VA 3CZRA 4RHEA 5LA6B 2BFDB 1U7WA 4QGSA 2YDXA 3Q8KA 1EBFA 3LZDA 2BR4A 3GB9A 3G13A 3WHIA 3QV2A 3WB1A 1WLYA 1P0CA 4WOJA 2Y1DA 2BH9A 2KW5A 4G9EA 1LBEA 2WB1F 1AZWA 1VP3A 1JTEA 5EG5A 2VUTA 2OHVA 3TE6A 1VRCA 2UUAB 3REGA 1QH0A 1N2JA 2F8KA 5I7HA 3UHFA 3LPAA 4PZ0A 4MQEB 3B1XA 1C0IA 4M9NA 2PTHA 2ZREA 4GW3A 3B6JA 1RU3A 3HJBA 2DFDA 4OKIA 3R6DA 1BA3A 4JBNA 1J90A 4FI3F 5EFZA 2EP8A 2B0CA 1F17A 5TMBA 1WTCA 4X65B 3ZCTA 2JGKA 2FEXA 4J7XA 5CCDA 3ZWQA 3NVDA 2BHTA 3OKFA 4MZDA 3DQZA 3Q6NA 5DOVA 5KJ6A 3D02A 1DMRA 2ZFUA 3UXPA 5CDGA 3ULKA 3W5DA 3CUUA 1QKKA 2BLLA 4N65A 3A8TA 3OY7A 1MG0A 1YTLA 4MR7B 2RG1A 3CN7A 3DOOA 1VL6A 1DNPA 3AL0C 1Z7WA 1OC4A 1YONA 3CLVA 1ZNQO 3A1CA 4OJTA 4JLPA 3KQWA 1HKHA 3UXYA 4K9PA 3O3OB 3C1OA 1UODA 3NYIA 4X8HA 1GUFA 1MMFB 1OWNA 5IILA 5DBIA 5DG8A 4RKQA 4EH1A 3GIMA 5J0UA 3LKBA 4QUIA 1EDBA 2ZDGA 5JDIC 4DR7B 3OICA 2A5FA 2B1IA 2J7PA 1P19A 3LPLA 5IFLA 4LZPA 4ZYVA 3BSWA 4YMSA 4AFNA 5JROA 2CXQA 1IYZA 5G1NA 5KFZA 4RESA 5HE9A 4MWZA 1DAEA 2UXCB 3VOAA 1A9XB 4RLHA 2ZRBA 4MUBA 2AFHB 1JLLA 3BH0A 3DAPA 3IQFA 1HT1E 5KTPA 1GTVA 1CVRA 1UZUA 2IYUA 4HTFA 2CNDA 2P2YA 1FMFA 2JIZD 4D97A 1T6BY 4RY2A 2I2BA 4QARA 1GQFA 3Q87B 3R6WA 2DWPA 1BDBA 3RS5A 1ZJWA 3JQ6A 3ESRA 3V2GA 4JXKA 3T52A 2HQ1A 4PSCA 3KTAB 3SVLA 2JEOA 1J20A 4OB7A 2R6HA 1VG1A 3V4VB 3NHKA 2KE7A 1E1CA 3NFYA 1MTOA 2PR2A 2GDJA 2JMGA 4URZR 3M6ZA 4D3SA 4OHYA 4BZZA 3BL5A 1APBA 2VBCA 1FXWA 3MVEA 3ER9A 3CVJA 3UQZA 3E2PA 1V3VA 5BSRA 4WCFA 3T3IA 1M2OB 3NATA 5CX1A 3TQCA 2QE7A 4CIWA 2WSSD 4YCDA 1IPHA 2VP3A 1KYTA 2O2YA 1RE1A 3BOSA 3E3MA 2IXGA 2MYTA 3RTAA 4FEAA 1STOA 4ZYUA 5LN1A 1WV0A 4BEWA 2IV7A 2CPRA 3Q8MA 4EPXA 4RQ2A 2HU7A 4U6SA 3MJRA 1V6SA 4K26A 3JVVA 5D6OA 1Z2DA 4EEKA 4AWXA 1UP7A 4FFBA 1SD5A 3JQGA 4LYGA 5GGXA 2HW8A 3VHXA 3K9GA 5BOSA 4OFZA 4IH9A 3LTEA 1SOUA 5KFMA 2K7ZA 1NKCA 3SC4A 3U7JA 1ZM7A 2EWVA 3VC1A 5JRZA 5JU6A 2OQRA 5G41A 1JPVA 3B20A 5I6DA 5GM2A 5DBBA 1SUCA 5L95A 1J21A 3LKDA 1BPXA 3A06A 3MWFA 4U2KA 3VC7A 3QUCA 2Q0SA 1I7NA 3CLUC 4EL0A 4PS1A 3AKYA 1HTTA 2EIXA 3FGOA 3R9KA 3MTAA 1UC5B 3M9LA 3DEIA 4Z49A 2HCJB 1Q7CA 3U3XA 1ED1A 2DLNA 2PGXA 3TAHA 3MQ4A 2H1LA 4MB6A 4JU8A 5L3QA 1Z2CA 4MIYA 1FRQA 3KLPX 4O2AA 5IJXA 4ARSA 1XUOA 3QVWA 2NU6A 3R09A 5DCLA 4HDMA 4JJFA 4M9GA 4GP7A 1EX6A 3EHDA 1JN0A 2XDAA 5EJ9A 5K09A 5FUQA 3N9IA 4E5SA 4XJXA 2QIOA 2BQRA 3LK7A 3F5DA 4BC1A 2VNKA 2FMUA 1OCEA 4JX9A 1QOZA 3PPVA 4NBVA 2PLWA 1VHTA 1EA7A 2PZMA 3NCTA 2BKLA 1I3OA 5KVQA 4U7HA 4M8LA 3S1SA 2WW8A 3OU2A 2CBZA 4MAMA 3U3DA 2UV8A 5ERXA 2MR5A 2IHVA 4PR3A 3BGDA 4PZAA 4LOAA 2VOEA 5DQHA 2C9BA 4IXDA 4DIUA 3PVSA 1I3MA 2HMAA 1HE1C 3K0FA 2PGJA 3UXHA 2B78A 3BZKA 4FKMA 1QGOA 2F55A 5ECWA 4C7OA 3QLUA 3RUIA 2I1WA 3IUYA 2SKEA 2P2ZA 2GN8A 1CDZA 4QWCA 4EY6A 2KFZA 1KEWA 4US2R 1NVXQ 4RT2A 1UCFA 2O20A 2PWBA 3ADDA 4DIOA 5A7GA 1V1MB 3VBEA 1F7UA 4IFIA 1T7PA 2BPCA 4A6PA 4M4SA 1H3FA 4FIZA 4CEJA 4U7JA 2NZXA 3NC4A 2B36A 4LSGA 3HCDA 1E4EA 4R54A 5LFAA 1RWWA 4JP1A 3JQEA 3ONWA 4X1IB 2RH9B 4UUMA 2ZS9A 4CQLB 4CM8B 1NK8A 4MGIR 3OQ1A 3KVOA 1AS3A 2PPVA 3I3SR 4F72A 2QV7A 4GYYA 1CF4A 3CWZA 3GV7B 4MUKA 2JEYA 2YQ5A 3DE5X 4PYLA 1KU0A 3LBIA 3WGMA 1KJQA 4WY8A 4RQ8A 4X54A 5JCOC 3L84A 2O2CA 4KKXB 4BAGA 4KAJA 1KDTA 2WTNA 2BE7A 2LVBA 4HQFA 3SVZA 4W6ZA 1CJBA 2ZTSA 1HT0A 4RD4A 1NVAA 3DMPA 3FPCA 2X7XA 3NU1A 5AKEA 4BB6A 4N8SA 4YJHB 5T57A 2AKYA 1XKTA 4L22A 4JBYA 3RVNA 3S5UA 4UBCA 1X42A 4QJ3A 1WXDA 1L4BA 4WNCA 4LHZA 2EZ8A 1S0MA 5ALNA 5EGNA 3CZ9A 2ZEJA 1DEOA 5EJIA 2NZWA 1S10A 4OH7A 4C4YA 1OFIA 2V0CA 4OBEA 4WY5A 5FWAA 3MCAA 3UHJA 2P4QA 1PK1B 2IDMA 4D45A 1JKIA 2YWHA 3ISTA 5CFZA 5E9JA 4AUKA 3L5KA 2CVZA 2COEA 4Q44A 3DF7A 3GMSA 1QGUA 5FUWA 1UDWA 3QG1A 1RC8A 3G8YA 1RWMA 3DTNA 2QRUA 4K2AA 4BGIA 4K1XA 4HXYA 4JYPA 4DBVO 1FSPA 4RNMA 3RTEA 1KAQA 3OLVA 2ILVA 3GEBA 3RGWS 1OAKA 3OQJA 4YQYA 1JLSA 3NEAA 4L50A 5DGDA 2BI8A 4AX8A 2ZSUA 1XSPA 3HWX1 4IDEA 3JQCA 2C9MA 4B79A 3EVGA 1UBOS 4PLFA 1HEKA 1XKLA 3IPYA 1UEXC 1EK1A 4EHAA 1GD1O 2RONA 3TADC 3Q3CA 3UZUA 1I0LA 5J8YA 2AOTA 3OI7A 1I4WA 2V3WA 4S1PA 4BFCA 4W8OA 1PVDA 3L7CA 1VPVA 5C8YB 5FP0A 1WF6A 1GFZA 3MWLA 1RVV1 1UC9A 4MROA 1W75A 3LQFA 1XN4A 1IG3A 3Q3VA 4ENQA 3AL0B 2VJDA 1R6BX 4TWZA 3HXPA 2ZWAA 2TMGA 4JWMA 2GAOA 4O5AA 5CK4A 3DFIA 4MYTA 1XCPA 3MFYA 1IHOA 4EEZA 4YFVA 2NN3C 3A10A 1ZGJA 3VDXA 4BN0A 4ZI7B 4B83A 1E3WA 1N0UA 2IHBA 3BN3A 3U3ZA 5IYZA 4MGZR 1Z0SA 5AK5A 4DL3A 2IYSA 2Q5CA 4MQUA 1R8QA 3G7NA 3QKIA 3VZCA 3UKOA 4C80A 3BRSA 1B93A 2R7LA 2RGWA 1P1FA 2ZIVB 2HF9A 2X22A 4DCGA 2W9CA 3SQLA 1KGDA 4BNFA 1PK8A 3T9CA 3DHEA 3STTA 4V1CA 5EJ4A 2PLNA 3E70C 2PUBA 3GFKB 4ZQHA 4LYDA 2GJSA 4G25A 3VJMA 1VMAA 5K45A 2C78A 3FTCA 1JAYA 2XPCA 2G09A 1J5PA 5KX5F 5KFWA 3QW2A 2D4HA 3OZCA 3FPJA 3ZEAA 1ZOOA 4NS4A 2ZPTX 3MT0A 1NVUQ 1YI0A 2Y3IA 1KW4A 4RADA 4DWIA 1M2NA 1K4YA 5THXA 4IXNA 1JFFB 2WWHA 5U4QA 2NVUA 3C48A 4R2KA 4DOBA 2OVFA 4WZBA 4YYZA 2ZTDA 3ROPA 4I9HA 9ABPA 4GL4A 3Q7RA 1W4RA 2ICAA 3CH5A 4ZEXA 1IY2A 1GXSA 5KFUA 3EUFA 2GAFA 2MTBA 2G7MC 3D5QA 3OX3A 3BCRA 3S2GA 4TUYA 5KX5A 4QVGA 4O25A 5EZSA 3A6FA 2D1YA 1UDRA 2JBWA 2O2IA 2WUWE 5G4KB 5JOQA 5AJWA 3D54D 3GEGA 2V7VA 4RPJA 2W71A 2I67A 4W5HA 3TQIA 2P5UA 3U60B 3KUXA 1PWZA 1SMKA 5C5IA 3UWKA 1YZQA 3TZEA 4EW1A 3HWSA 4DLLA 1IOLA 5FI0B 3G5LA 4HNTA 3I52A 3IP3A 3CLTD 5CDFE 1LRLA 5HM8A 3RBAA 4UTRA 2UVUA 3L3FX 4HDRA 4BNIA 3NHYA 4Q0MA 5IDQA 4LDJA 5G4LA 5FPHA 4CRXA 5IMBA 1USKA 3L7OA 2W22A 1P7VA 3H9EO 2QZ4A 5D87A 4HEHA 5BYBA 3INTA 5CXSA 2AN9A 4DFJA 3EXG1 1NBHA 3EF0A 2VYFA 3BD9A 1B2LA 4ZCIA 4KSCA 4ZT7A 10MHA 3R20A 7GPBA 3RNLA 3CYMA 2LXNA 4Y3UA 4C04A 3TTWA 3OA0A 3PJEA 4DT1A 3MMNA 2WABA 5TSDA 1JFVA 5GQSA 1Y3DE 5BVHA 4HWOA 4KR6A 4YR3A 2FK8A 4MP3A 1X7WB 3PWSA 5EHIA 4M8NE 1G3UA 5BUZA 4LK2A 5DG7A 4K6CA 1C1DA 3TXYA 4D9EA 5BURA 4B6QA 4IDOA 3R0VA 1D8BA 3C1ZA 1JBEA 4ZT2A 3PR5B 1JIJA 3KAQA 3D6VA 2VDMB 2PQMA 3N97B 1ZQZA 4F3YA 3NTLA 9ICKA 3PR2B 1ZQSA 3C7KA 3OCZA 1C2YA 4J9KA 2DQNB 1OH7A 4KG7A 3REQA 2BEWB 2JGNA 2ZBFA 2QD1A 3PYXA 1FW8A 1NLUA 4DQLA 4NBKA 4F2SA 1KP2A 4FEYA 3OF5A 4KFCA 1CJKC 2J4DA 5JAOA 4TGLA 4NWIA 2P9ZA 4GEKA 1VBNA 3CB4A 3R9IA 3OF2A 1KXZA 4XYBA 1TZJA 3EVCA 2DGDA 1QYCA 2BZGA 5KU1A 1BHJA 2W0SA 1WZNA 1FL9A 9ICOA 3IJEB 1DG3A 4C2BA 1DJNA 3FCYA 2IZ0A 1P1CA 3S2UA 4E14A 2IS4A 5L3ZA 4BJ5A 3IKMB 5TQ0A 3HMQA 3MSCA 3BWVA 4DDMA 3U4AA 3FVVA 2FWBA 3K8OE 3RK4A 1E9SA 2IOHA 1TFUA 2FR8C 2JIPA 2Q1YA 5LYJB 1BVYF 1U3FA 3G9UA 2P35A 2J08A 4QQ8A 3PO5A 1EXNA 3JVDA 2ZBVA 2ZJ1A 5CFRA 2O3SA 3QLVA 2AN1A 5KG7A 1PR1A 1MW9X 3UBTA 4YI5A 2XCQA 2AA3A 1VIAA 5JT1A 4U6PA 4DYDA 4MFAA 5FTWA 3KXDA 3LDGA 3EB9A 1EG2A 3C6MA 3ROQA 3GGPA 4YQWA 3BDVA 3NVZA 2OBFA 4HFJA 1JN3A 4BATA 4H15A 2EEPA 4JAVC 1NMSA 2DCUA 4DIDA 1Q7BA 3OD1A 4M1EA 1OW3B 1TD1A 1THMA 2EGHA 3GO4A 2AXNA 4I46A 4OGFA 1PD1A 3CZMA 3K8ZA 1EXMA 5LWHA 2W7OA 3RTCA 3IDFA 1XZNA 4MWCA 4YRFA 1AKWA 2VQFB 2E8NA 2JFUA 4LYJA 2H3IA 5L3SA 4ZANA 3PVXA 3MA0A 1U5BB 3I4CA 1L1EA 3GMDA 4MRPA 3C7CB 2VN8A 3E9QA 1T6NA 4G81A 2MA1A 4EABA 1CEZA 4P4GA 4TSKA 3BMXA 1Z2EA 1BRTA 4RZHA 4YCLA 2GGSA 3I6MA 1KNXA 4YNBA 4I6GA 2ZP1A 2EL7A 3K1AB 1NW7A 3SJCA 4BGDA 3F3SA 3BIXA 3RPEA 3EVTA 2EJUA 1RWQA 4ENRA 4DPKA 2D5BA 5AKJA 1GL3A 5TGZA 3VKGA 3TL6A 1QP7A 1ORDA 3EUEA 5B64A 3L0DA 3TUIC 5H3CA 2RB4A 4UMVA 4R2JA 1CUXA 1G5QA 3NTQA 1U45A 1U7DA 1W1WA 4LF8B 2DBRA 3O4IA 4J1QA 4U3JA 3SKXA 4O3FA 3VKVA 3B8HA 1X38A 1ZK4A 4TWIA 3DGFC 1WD5A 1B73A 2VEOA 4QYXA 1HQKA 3DT6A 3CVWA 5EI5A 3C5HA 4AJPA 3UWPA 2GN6A 5IF9A 5AW8A 2ARKA 2RQ5A 4URWR 4JN6B 3VYUB 4P84A 4RZUA 5JC1A 3JQ8B 3HX0A 1I2DA 3LXXA 4EO4A 1TGVA 2PX4A 2G80A 1QUEA 4LXUA 3WHKA 4EHLA 2CD9A 2QL7A 2OUKA 3MOGA 4BAUA 3W4KA 4PPXA 1ZQMA 3B1KA 3LBAA 2CDAA 3E9DA 3LY5A 2P8SA 4QVIA 1CJVC 5FFNA 3WRWA 2V98A 4UW9A 2X4DA 3F7OA 2XI4A 4A2QA 1SXEA 2ODBA 1XRSB 5HW0A 2GASA 4MTLA 3AP2A 4NXZA 1EVEA 5C18A 2Y1FA 2XMRA 3OP1A 2YWXA 4OJLA 4FYHA 4MR8A 5LQKA 1T2DA 4AMGA 2VQ6A 3UIEA 3T3OA 2B21A 3JWIA 4YCBA 1YRYE 1PUJA 3WMWA 5C5EA 2R8ZA 4S0XA 1GA4A 4ZCTA 4JJGA 4GLXA 3NEYA 3D4IA 3T9EA 3PE4A 4H17A 2R87A 2G4VA 3PSAA 1UPFA 1XQ9A 3SI8A 2V6FA 2Y0SC 2E4WA 5L1MA 2C2HA 2FZCA 4XVRA 5DK6A 1U0GA 2QB0A 3PICA 1LV5A 4V0KA 4DWVA 2OK8A 1K7EB 4YT4A 2JLBA 4O4LA 3KDAA 2Q8QA 1N5MA 2CD7A 4DCJA 4EHIA 1K0UA 2GARA 1DRKA 5GJVC 3PW5A 3PGMA 4OKNA 2GB4A 1RMQA 5IIKA 1U9YA 3D2SA 4FLFA 1MO2A 4FMDB 1COZA 1ZQKA 5F52A 3IUEA 4HNGA 1S02A 3J7TA 2OLEA 4BE4A 2VHJA 2XRYA 3HSYA 5CVJA 5CX4A 3FTEA 2FP3A 3G0DA 2J33A 4ME6A 2ZYGA 2B8WA 5BORA 2RHRA 1JDJA 2C88A 3EW9A 3CT4A 2AZMA 1NRJB 4PZPA 1JHAA 1P2TA 4J9NA 4LJAA 5KFNA 4FZLA 5CW1A 3M6XA 1SXDA 1XMOB 3PB3A 4OK6A 4Q1VA 5MFPA 5KDDA 3K0KA 2KYRA 1RRGA 1ZK2A 1GZ4A 4NU5A 2PQ6A 3EXAA 3L1HA 4LPSA 3ERCA 1NE2A 3K1YA 1I5OA 5FL3A 1TCCA 1C14A 1GG5A 3BIOA 2V7BA 2OTCA 1E69A 3K70D 2DULA 1HFWA 3GJ5A 2OBMA 2VJKA 5KT4A 1CUKA 5LKRA 2WILA 3P45A 1NWCA 2ZWPA 3GH3A 1RYFA 1L5HA 4P54A 4KE8A 4IDGA 2BFFA 2LW7A 3LT4A 1I4LD 2PUVA 4PQGA 4C88A 2J4CA 1LPAB 3ZU2A 3PNPA 3G2IA 2WUDA 3H8SA 1CIPA 1MIHA 1OVMA 2O0JA 1Z15A 4MRRA 4Z7OB 2IU6A 2Q6LA 2L5YA 2OFOA 3JQ7B 4P0QB 3NUZA 4B40A 2I6FA 3PJRA 3KKQA 4YO8A 2YFYA 3QFCA 5HCIA 1LPSA 3FGZA 4C0XA 2V03A 3SXUB 5KAIU 2KK0A 1P2VA 2C2GA 4ZT4A 4IMPA 4ZQEA 1T1IA 4Z6FA 3HBAA 3T3PB 1B42A 1S9HA 4I1RA 4Y8VA 2ZRAA 4V0QA 4LX0A 2C04A 3U4DA 4G1EB 2DQSA 3MYRA 1PJSA 3G7SA 3EYWA 1XNGA 3NBMA 4DSFA 2RBGA 2E18A 1OC2A 2WU1A 3N8IA 3FMOB 3AUKA 4YUWA 3GWGA 1MPXA 5G3YA 2LUOA 3NHAA 2WVGA 3TW0A 1ZRHA 3NAQA 2PMZF 3HLTA 4BLVA 1N2GA 1P5FA 4B3JA 4QTXA 4R9NA 3ZXYA 1WQ4A 2BY4A 1BTOA 3KEOA 4LG1A 5A9SA 1SXPA 4GO1A 3F78A 3G8AA 1XS9D 1AXGA 2A9RA 3ZPXA 2DBZA 3D59A 3O8NA 1EIWA 4L74A 3GZNB 1C7EA 1KI6B 4RV9A 2ZSKA 2GCNA 4RU9A 3BT7A 4J4BA 1JQLB 1E9DA 1YB4A 3PUHA 4C6HA 2R7MA 1YC2A 2JKVA 2AEEA 1S8FA 2ID9A 4RTMA 3SYZA 3BK1A 4UVDA 3K2BA 5C2JB 3CKYA 4KWEA 3OPNA 1ESDA 1R27A 1VPTA 1Q77A 4GR4A 3VPHA 3N5CA 1CF9A 1WE2A 5A4JA 1AV6A 3SZUA 2QZSA 4YJ3F 4D4IA 1ZNZA 4DV4B 3KXLA 3BE8A 4PZLA 2DLCX 3QXSA 4JBXA 3THVA 5EERA 2ZXEA 1RPTA 2P5YA 1REQA 1YZUA 2HMYB 4RD0A 1EYZA 5IVHA 2O8VA 1IMOA 1T91A 3X1XA 2JPDA 4LRSB 3QZ7A 2CW5A 3K4QA 1H2WA 3MCWA 2AJLI 2JD0A 2OAGA 2IXTA 3NX4A 4YJ3A 3MRXA 3S8YA 2OQ2A 3CLTC 4TKUB 3TZBA 1TUEA 4B3TB 1BJTA 3SC2A 4H0FA 4R84A 1NYQA 4G8DA 1EG7A 3A1UA 4LCBA 1H69A 3A1FA 3JPWA 2PS0A 1CZLA 4C4PA 1XC7A 3FCCA 1P7DA 3CVVA 3UG7A 1NRWA 2ZZKA 4FB4A 3GLIA 2IHKA 5GOTA 2HPZA 2YWRA 3A70A 4IG9A 2XUFA 4UEOA 5KBYA 2DTXA 3HEAA 4MTCA 2A1IA 4HDCA 4LHXA 3RAPR 1R5NA 3OEWA 4MYUA 3CGGA 3Q3JB 1W19A 2R4UA 2G1JA 2XD9A 5CDUA 4PSDA 2FPKA 1HV8A 4ECQA 3KFUF 1Q95A 3FJ1A 3N75A 1S77D 2C4KA 4U1RA 4KR0A 2IIVA 3I04A 5K3CA 5B5EU 2H5XA 1GG8A 1AZTA 1UCVA 3EH1A 1NUAA 1SVWA 4X3PA 4IIGA 1JU3A 3U7QA 5JXIA 4P3OA 3EXHB 1S8NA 3KO8A 3B0XA 3FSEA 3Q7PA 4IQ4A 3QY0A 1WUTA 4QPZA 1UAYA 1WB4A 1RI2A 2B5VA 3RC3A 3P52A 3AIIA 4YP3A 3DBHB 3VAAA 1NMYA 4QXAA 4UZSA 2V5VA 1DEXA 4GC6A 4U63A 3N8NA 4Z51A 3T35A 1T9DA 3BYZA 2ZS8A 3SNHA 4KIGA 1MOQA 1CZKA 3AF1A 4KO2S 2XB8A 3H8WA 2ZI3A 5B2FA 2G07A 2OCPA 2PUAA 4M0LA 3HABA 3IDOA 5BNZA 1Y80A 5TGTA 4FSDA 3TRJA 2Y4NA 4O3SA 1CCWA 4A2CA 3PX4A 3PW7A 1Y9ZA 1BKYA 5F1YA 2XY7A 3KJZA 4J9SA 1Y8RA 3HXKA 4ITUA 4C3UA 4H0NA 2XE4A 3WGLA 4UB2A 4OGKA 3I6QA 1UXKA 1H6AA 4QZAA 4PBRA 3R5HA 2CL0X 3IEKA 4TSFD 2W9BB 4EG6A 4G4GA 3ZJTA 4U9IS 1LLUA 1DIAA 1UWLA 2IBTA 4DO9A 2CXTA 4P80A 3ZLVA 2GF9A 4WLNA 1NU6A 4GZ6A 3CEAA 2BRUC 2A5GA 3BWEA 5MN5A 3D1JA 1BX1A 1M75A 2QG4A 4I99A 2PUDA 5DRTA 1VKZA 1JSCA 1I4TD 8ICVA 3EA0A 5AJUA 1WEKA 2HKIA 3AHIA 1PL6A 4IIHA 3T1YB 2PA0A 1QIHA 1QK5A 1E79D 2XW6A 3S40A 3VNUA 1Q46A 3PIDA 2ZBRA 3PXAA 4DR1B 4IJVA 4MLPA 1BVHA 5DT2A 1YIOA 4MQFB 4C21A 5FPYA 1MAUA 3SYTA 5JZSA 3D8RA 4JL5A 1PBNA 5I7SA 3FJYA 1XMQB 1BVUA 5CT6A 3DEKA 4R51A 1T5OA 2AHOA 3ONEA 2P9JA 3VU9A 3NHJA 4YMLA 1UZMA 5F51A 2QTCA 3ESQA 4K2HA 1OH5A 1RIIA 3DV2A 3I9OA 3E23A 2BPOA 3T5BA 3ZD6A 1H8HA 2QVLA 3T95A 1UBLS 3FWHA 3E3NA 1VMDA 4B85A 5BSWA 3GLUA 3C24A 1F48A 5DLDA 1GKKA 1CZHA 1AKVA 5JAIA 2RCYA 4O59O 4ACAA 4TLBA 4RVOA 1UIMA 1K66A 2RGXA 2MT9A 5CDYA 4CWAA 3WFIA 3PF8A 2XMSA 2CUZA 5A2QA 1KMHB 5KJCA 4KRYA 3C3BA 2YVUA 5D3QA 1II8A 2JI9A 4PIMA 4WKBA 4N5IX 1ZQPA 4F5ZA 1ENPA 5K20A 2JNWA 3LW7A 1GPH1 1QMPA 3OKPA 3PNCA 2WYOA 4IOKA 3OCXA 5T3YA 4QO8A 2ZRFA 2Q7OE 4WH0A 5J2TB 4G0XA 3AHJA 4COOA 3BFPA 3MBIA 2GHIA 3V7FA 2BFEB 4NABA 4BQEA 4R1TA 4WT7A 4HTAA 1RI3A 3G5UA 2W2KA 4IRMA 1W44A 2POCA 4YV2A 5DTJA 1XTPA 1EFVA 1EE1A 1JH8A 2II6A 1T9GR 1AQIA 1MVNA 3ZN2A 3H05A 1CWUA 1G7CA 1LWNA 3SS8A 2A94A 2C7BA 1SEPA 2RHCA 5B1DA 4AL4A 4JR1A 4CQJA 4CG3A 4RQ4A 2HTFA 2XA1A 5COAA 3QY9A 4YWJA 3OUTA 1X80B 1UJCA 3GILA 4S2UA 1SVIA 1RHQA 1YR7A 3UHPA 3RB3A 4ESVA 2PX6A 3EJWA 3NVVA 4LVOA 4WJZA 3VR6D 2E21A 4WWHA 5ALDA 4DR3B 5C1PA 4MS1B 2NU8A 1VGQA 3V4RA 3RRXA 3EZ5A 4RCVA 4TXMA 1GNVA 1ZX1A 2XRMA 4C07A 4BKQA 4XLLA 2QD5A 3PDJA 3KJXA 4BAZA 1C0KA 3HVRA 2VDNB 4YJ2F 3TZ6A 3PC6A 2KP7A 3BL8A 4XWOA 4CHTA 4WX2B 4D9NA 3ZE1B 5H5JA 3CO5A 4Q43A 3O8RA 5LLTA 2WIDA 1BMQA 4HL6A 4KMOB 2XCOA 3PMNA 1ZFNA 3LZ6A 1YL5A 3TNDA 1JDZA 5FI1B 1OYYA 3EDMA 3AW9A 3EWNA 4JGGA 5HIIA 4M1WA 5IJAA 4YACA 5AW0A 4F6CA 1XQXA 4JLSA 3GP3A 2M9NA 1YRQA 5DLYA 2JFYA 5DVZA 2GNOA 2W37A 3DCIA 1N3YA 3HLYA 2PUHA 3GDWA 4KPYA 3Q6IA 4WNIA 4CM7A 3TIVA 4D3YA 3H5NA 2Z8ZA 3BWXA 4RS4A 4IM7A 3C39A 2ZT7A 1WHSB 1TUBB 4JEMA 4BNNA 5AM2A 3F5EA 1L6NA 1ODFA 2ZUTA 5AVYA 2BR5A 1PR3A 4FNOA 3V4OA 3AFMA 3V97A 2VUIB 3BXHA 3HBNA 1UBTS 4UM8B 2M32A 2Q6VA 4B76A 3QU5A 4NMWA 1R7RA 4BKRA 1TKRA 2D5IA 1JJAA 1EZ1A 5KAMA 1U2GA 1YT3A 3K70C 4DC0A 5DXAA 1S6YA 1JEYA 2B8JA 1ID1A 1PJCA 2GX6A 2W04A 1GDHA 3H9QA 4IJWA 3A9RA 4PE5B 2ZRIA 5B6JA 4MLCA 4PCLA 2Q46A 1C2TA 1CHDA 1J39A 1YXMA 1ZH6A 2IX9A 5C1IA 2DETA 2E5WA 1P2DA 4AZ0B 4BYGA 2RH4A 5LVAA 2VRCA 3TPZA 3ZJ4A 1SO8A 1QVZA 2Z4SA 4FM9A 3IQHX 1M6YA 2Q3FA 4KUHA 1DTSA 4D6XA 2EJBA 3FPGA 1IM5A 4ML3A 4F3KA 5B53A 1N7HA 4LC9A 1GPAA 3RS8A 4UNIA 4BUJA 4S1OA 1WU8A 4ON9A 5JWOA 3CV3A 3KUKA 4CQMA 1G63A 3LC2O 2UZ1A 3I2KA 1YDHA 1TAMA 4HO1X 3DDUA 4UTPA 2P9QA 3H2GA 1YJ8A 3WJ7A 3NVMB 1SKQA 5JTUA 3JXEA 3PFFA 3ZYCA 4MEXA 3ET4A 3CX3A 4B3FX 5T4FA 2OFXA 3O7WA 3PF9A 1TAGA 4PGAA 2OXRA 3RUDA 5FA6A 2IY9A 2PKWA 3QZUA 1U2ZA 5G1OA 3NUGA 2HA0A 3ZVLA 5EZYB 4PM4A 3PSHA 2YZMA 5IX8A 1RYNA 3S2SA 4DANA 2QV0A 2I4OA 4ENTA 4ED1A 2JGEA 1DV1A 2KLHA 4UBMA 2GETA 4ALKA 1B1AA 1P4RA 1NWHA 1AQJA 1TJYA 3TDNA 3QFHA 3P0FA 4KL8S 4L02A 3RAQA 3AUTA 1HSOA 2WHRA 1Y5MA 1BNCA 1DFIA 1NAHA 5E7MA 1ZH8A 2YIDA 3D6MA 5MHTA 3N6RA 4Y2RA 3HKEB 4A0FA 3HZHA 1U65A 4HLDA 1N2CA 1H6CA 4GGPA 3KQLA 1EFHA 2C8KA 2IEIA 2BW0A 1SHZA 2C3OA 3IV6A 5T4BA 1UBJS 2TSYB 4HC4A 2JHPA 4TMFA 1WSWA 2G77B 3MTDA 1PQ4A 1N5RA 3EPPA 1S9DA 4OFXA 3KWLA 3K15A 1JDPA 5BOMA 3ZI7A 2W2VA 3DXFA 3QE0A 2D1FA 1RQ7A 4OGWA 5ARDA 5ISMA 1EWYA 4H59A 1ZLYA 8ICRA 5E1OA 1Z28A 4WCVA 2NSJA 5A05A 3DUFA 3FDZB 4CM4A 5B57C 2ABWA 3VNAA 2OGWA 4GKAA 5BV0A 4KN9S 5FOTA 3M1AA 2X8AA 4R98A 2ISOA 4F4KA 2RK3A 1KBQA 1KZHA 1S9FA 1SB8A 4OSPA 3MGBA 2AJQA 3O8OA 2NTNA 4ZJZA 3HADA 3SMVA 3OJLA 1OH6A 3NFRA 2QP4A 1MVOA 4JB2A 2RH5A 3P9IA 2VHZA 2HD4A 2NO1A 4MW1A 4XSGA 1HE5A 4L4RA 1H23A 3IH5A 5F2NA 1IHDA 4U6NA 3IIEA 3I5AA 1U2TA 4IDAA 3D4NA 2HGSA 2MINB 2H06A 2Y76A 3ICWA 1KJZA 1FP7A 1SOVA 2ZPAA 4LE1A 1OYWA 3QBJA 4M60A 4J1NA 3AZQA 5IMSA 1KFEB 5F64A 1GL9B 5ITSA 1E5VA 2ZZMA 2CYAA 4F4ZA 5IJ9B 4YRBA 2AF4C 4ARBA 1LPOA 1KFJB 3ZHXA 5CXUA 5JSHA 4LSMA 3A9UA 3IKVA 2QQ5A 4YV7A 5E6RA 1PEAA 4GPBA 4DF4A 5E1BA 1A0OA 4HYQA 4R7GA 3CRVA 3DEEA 3WGJA 1XCJA 4Q66C 1AY0A 5TE9A 3LLMA 1F60A 2YY7A 1ZIPA 1HYGA 1ZR2A 2YHSA 1FRFS 2FPPB 1KSGA 2FP4A 2ZVDA 4HN2A 5KYNA 1SXHA 3B9QA 2FSUA 3IHTA 3WVNA 3L4SO 1YQEA 1SXJC 2XCPA 3T5HA 5H02A 4AUEA 3ZE2B 3LMKA 3B9BA 4FS2A 2EV9A 3VNSA 1YS1X 2JFZA 3T9AA 5CFNA 4IDDA 5LQSA 3FD8A 4N0EA 5CURA 3I3OA 3VZSA 1BGXT 4WDRA 3FLMA 3THOA 4BKUA 2YN0A 4C20A 5HJEA 3RRYA 1EB9A 4DLWA 5A7HA 5JUWA 3QVGA 4MITA 5BXYA 5E3IA 1V1JA 4JASB 1E2GA 5J0SA 3FAZA 3H4VA 5HK9A 5I7FA 2OQIA 1CRXA 2W2OA 1HJPA 1YDEA 3D7KA 5CVCA 1C4KA 2JGLA 3IAHA 2O1SA 4ABYA 2W6IA 4I2CA 2XR1A 4B4WA 1CS0B 1ORVA 5F4ZA 2BPGA 1YK1A 3MSXA 1AU9A 4IMRA 4L73A 4XIGS 2H4FA 2FEWB 3QXCA 3DFKA 1OIXA 3LTNC 4CEIA 1P6QA 1HE8B 1R10A 1BHSA 4PRYA 1QHFA 3RQSA 3AVWA 4B3HA 3MD9A 3U9LA 4NY8A 3OE7D 4MUMA 1AQYA 9ICVA 1EFTA 4LUCA 4LRQA 2JDIA 4L57A 4Z8XA 4QC2A 1G5PA 2P4EA 1LQ2A 4YEDA 3D2NA 2ZRNA 4AP9A 4Q1EA 2WSLA 3KOYA 3U4IA 3FOZA 3FWYA 2BR0A 1L5KA 3QOXA 4C2UA 3PRJA 5HTOA 2VTVA 5J4YA 3N0XA 4FW9A 2WJVA 3RBVA 1KVRA 4LECA 1C3LA 1JE0A 4AIIA 1YRLA 1GNTA 1EUYA 3KSMA 2V8BA 1SHJA 1U1GA 2ZUVA 1ZAYA 5KMGA 2IE8A 3OC6A 1XD2A 4C06A 3WLMA 2ZIZA 3GZJA 3QLEA 1WUKS 3OZAA 1RPNA 2VNHA 1DXSA 1FP2A 1KBZA 4CCHA 1A9RA 3L6UA 4JSTA 4JENA 3KCNA 2GFHA 1QG4A 3C6BA 5BQFA 2PAFA 1G8FA 3GD7A 5FO1A 2LV8A 2WWWA 5M7EA 5D7BA 1XTVA 3LK9A 4B7XA 1MOSA 4RIEA 4YJGB 3GRPA 5EWLB 3MC1A 3JYOA 2JJ8A 4RF3A 4TRRA 3L01A 3AU6A 3TQFA 3KQTA 4L4SA 3OLXA 2A5YB 1TMOA 2VP2A 4NJEA 3H1FA 1CRPA 3U09A 4F5WA 2A3RA 3QXXA 1K1QA 3PC3A 3L6DA 3ZG6A 2ZQZA 1RYSA 5I8ZA 3MGGA 1GN9A 3EGDA 3LO5A 1OU0A 4Q4HA 2IOFK 1N1DA 3KZ1E 3ZU5A 1DBRA 3JSXA 2C97A 2YV4A 3H5IA 1IMJA 3MAAC 4HYTA 3OUZA 1SVUA 4XUSA 2C95A 3UQ2A 5AW7A 2JLUA 4YUYA 4DJEC 4MB2A 3HCAA 1YOVA 1L3CA 2Z0MA 4I4TB 4HLUA 3SR4A 3MG9A 3PQEA 5TS3A 3K70B 3IOMA 4F4YA 3G9ZA 4IIJB 1OA1A 3RFVA 1H5UA 1R6VA 2FSHA 5DX8A 1D0SA 2CJFA 1Z6TA 2O59A 1HDGO 3D43A 1O5TA 1IZYA 2ZXUA 4QJ4A 3KSDO 4AUNA 5E7QA 1QIGA 1E20A 4CL3A 1TJPB 1JG2A 2ONCA 4JBHA 3GZFA 1JDTA 4M1SA 1RJGA 2GOLA 1XNQB 2AUNA 2Q27A 1G2QA 4ZGWA 4TRMA 4QXMA 4ZN6A 1CZNA 2QMZA 4GL2A 3V8MA 2AEMA 3N58A 3ZX5A 3WO0A 1PQPA 3CTMA 4Y2XA 3QVLA 5A0TA 2F3PA 1CNEA 2FLKA 2EVWX 4L5CA 3WRXC 2J48A 4XDGA 1E7SA 4JYMA 1KFDA 1LBTA 1HMYA 4XGQA 4FNMA 2GPNA 1Z8NA 4XYGA 2FLVA 1QJ4A 4Q82A 5JV5A 4RVHA 3KE8A 1BEUB 3MPOA 4BLPA 1PEYA 1IATA 1XBTA 3C1UA 1J0BA 3R9XA 4XCQA 4HZUA 2QTVA 1FP4A 4RHUA