2ZG6A

Crystal structure of hypothetical protein; probable 2-haloalkanoic acid dehalogenase from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
202
Chain Sequence
MKYKAVLVDFGNTLVGFKPVFYEKVYQVLKDNGYDLDLRKVFRAYAKAMGMINYLEHVDPKDFLYILGIYPSERLVKELKEADIRDGEAFLYDDTLEFLEGLKSNGYKLALVSNASPRVKTLLEKFDLKKYFDALAPKIFGFALAKVGYPAVHVGDIYELDYIGAKRSYVDPILLDRYDFYPDVRDRVKNLREALQKIEEMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST2620
publication title Crystal structure of Hypothetical protein; probable 2-haloalkanoic acid dehalogenase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 61
structure length 202
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.660 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zg6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2zg6A01
2QYHA 2FPRA 4CNQA 1TA0A 3K1ZA 1Z5UA 3MC1A 3DDHA 3NANA 4NWIA 1Q92A 1QQ5A 5A3SA 5AW7A 2C8LA 1RQLA 2AUTA 2HSZA 3VAYA 5JJBA 1AQ6A 3AR5A 1ZJJA 2P11A 5A3RA 1TJ3A 3SKXA 2O9JA 4MUMA 5FP0A 2DQSA 3QYPA 1RLMA 2JAUA 3DV9A 3AR3A 3QUTA 4XOUA 1Z4QA 5ALXA 4HGQA 5ALLA 2G09A 2I34A 5E0OA 3W5BA 2JGAA 4C4TA 3I1YA 3SMVA 3A1EA 2B30A 4IFTA 5AVQA 2X4DA 4Y2VA 2YMQA 3OCUA 2RARA 4FE3A 3ET4A 2JAWA 2IOFK 1RLTA 4UM7A 5AM2A 3QU7A 3NALA 3NRJA 4BKMA 2OBBA 3NIWA 2HOQA 3AR4A 5AVXA 4Y3UA 1NRWA 3ZX5A 2WF8A 3ZWKA 3QUCA 1TJ4A 2HI0A 3A1CA 2B1QA 4Y2RA 2ZBFA 3PGLA 3A1DA 2I54A 5ALUA 1EK2A 2Q4TA 2AMYA 5AICA 4RESA 2RAVA 2AH5A 5AKKA 1ZD2P 5AK4A 4DCCA 2YMPA 1Z4MA 2R8EA 2WM8A 4JB3A 5AW0A 4H1WA 3EF0A 2JARA 3ZI4A 2R8XA 3HYCA 4Y2YA 1L8OA 5ALQA 2W43A 5AI6A 4UMDA 5AKGA 1U2TA 1Q91A 3L8EA 5ALKA 2GHQA 5AKLA 2IYEA 4UASA 3P96A 1RMQA 2B8JA 4HGPA 1WVIA 4OHFA 3RFUA 5AW3A 3PCTA 3OCWA 4CF4A 5AVTA 2IA5A 1RQNA 3E8MA 5AI8A 3WKAA 3OCZA 2IOFA 3B9RA 1Z4LA 2R8YA 2YJ3A 4HGOA 2B0CA 2IOHA 2PR7A 1X42A 4OFZA 2YY6A 4BNDB 2GFHA 4CE6A 2WFAA 2ZBDA 1YS9A 1RRCA 1VFPA 3NUQA 3PGVA 4DFDA 3UMGA 1N8NA 3NAMA 4UU1A 3L8GA 3W5CA 3SD7A 1RMYA 5ALFA 3ZU6A 1NF2A 5AVRA 1T5TA 1J8DA 2HDOA 2R8ZA 5ALTA 1RPZA 1CQZA 3R4CA 1S2OA 4CF3A 2P27A 4L57A 1LTQA 1YDFA 4UMEA 3W5AA 5IT4A 4GIBA 3PDWA 1Z4OA 4Y2TA 2FUCA 3FPSA 5ALSA 4ZEVA 1RKQA 5ALHA 4Y2SA 3GYGA 2W11A 4NABA 1L7PA 3EF1A 2CFTA 3QUQA 5T41A 3KBBA 4Y2XA 4UU0A 1NNLA 5ALJA 3KD3A 4BEVA 2NO5A 1Z5GA 3OCVA 3U7GA 3ZVMA 5IT0A 2G80A 5AM3A 4I9FA 2QLTA 5ALMA 4PNHA 3L1UA 4UMFA 2NO4A 4C4RA 2Q4RA 5AM4A 4BYGA 2C8KA 3QLEA 4UARA 1XP5A 4QQFA 4F71A 4I9GA 3W5DA 3FZQA 1WR8A 5ALYA 3AR7A 3E84A 4ZEWA 2FPUA 1TE2A 4NV0A 5A3QA 2EARA 4RETA 3E81A 3EWIA 1Z4IA 4C4SA 5AI9A 3UMBA 3F9RA 4FYPA 4EELA 3R09A 3CNHA 4YCMA 5AM1A 1N9KA 5AW6A 2ZG6A 4EX7A 4AS3A 1Z4KA 3MMZA 5ALRA 4ZEXA 3CZ4A 2G1AA 5AK5A 3QU2A 3N5KA 2BDEA 1T9ZA 1SWWA 1O08A 2YJ5A 4EENA 3B9BA 2WF5A 3HLTA 3SHQA 3AR9A 4OCZA 3ESRA 3QU9A 3KC2A 2YN4A 3WKBA 5AI4A 3WK8A 1IWOA 4HGNA 2FPWA 4OD0A 1F5SA 4BBJA 4EEKA 1QH9A 3S6JA 4HYTA 3QXGA 5AW5A 1RLOA 4XE5A 3L0BA 2HF7A 2G08A 3IB6A 2YMMA 4DWOA 2WF7A 3DAOA 4EZEA 5ALOA 3NASA 2Q5EA 3FVVA 3UMCA 2O2XA 2ZBGA 3AR8A 1L6RA 1XPJA 2HX1A 3N28A 4AP9A 2HF2A 3L0YA 3OCXA 4BX2A 4MWOA 3OCYA 3QU4A 2FPXA 5AW9A 4YIHA 1FEZA 3OPXA 3M9LA 5AW1A 1U7OA 1S8OA 4HAIA 3ZW7A 2WHEA 2HCFA 1SWVA 1ZD4A 4Y2PA 1U2SA 3I6BA 5ALDA 5AKZA 4CF5A 1ZRMA 5ALVA 2CFSA 4BX3A 5AK6A 2OA0A 4Y2JA 4YH1A 3WGVA 4E88A 3EPRA 2I6XA 1L8LA 2YBDA 5AVZA 5AKXA 4KYTA 1K1EA 2VKQA 4NAVA 2GMWA 3UM9A 4YIKA 2PKEA 3ED5A 3MN1A 5AW4A 3QX7A 3N1UA 2HO4A 5AM5A 3E58A 4BX0A 3ZX4A 1RMTA 5ALPA 5AVYA 3KOOA 1JUDA 4J03A 2FDRA 3N8GA 1SU4A 2G0AA 3BA6A 3WK4A 4UAUA 4XQ0A 1T5SA 2YJ4A 2ZOSA 4B6JA 2G07A 4G9BA 1ZD5A 2FI1A 1YNSA 1Z4JA 3AR2A 2C4NA 4AS2A 2MU1A 3BWVA 2B8EA 1O03A 3I76A 1KYTA 1YJ5A 3DNPA 2HEGA 2WF6A 1RKVA 3WKDA 1RC8A 4UW9A 1YV9A 1RDFA 1VJ5A 4L6AA 4KX5A 4Y2UA 5AVSA 2W4MA 1QQ6A 3U7FB 4GXTA 5ALZA 2YJ6A 5AVVA 4KNWA 3L0CA 2MSNA 2D2VA 5IS2A 2RB5A 4UMVA 3FPBA 5AVUA 2EAUA 3ZUPA 4YCLA 3L1VA 4BEWA 3WK7A 3L7YA 3FM9A 3MPOA 3IJ5A 3WK5A 1ZOLA 3J7TA 3WKCA 3KDPA 2GHTA 2ZBEA 4F72A 1L7MA 3QUBA 5AKEA 1U7PA 4KNVA 1VJRA 2PQ0A 2FPSA 1Z4NA 4UAVA 2NYVA 3WK9A 2OM6A 2G06A 4XPZA 4YGYA 2BY4A 3RF6A 2GO7A 3ESQA 1ZD3A 5AKHA 3TLMA 3L8HA 3L5KA 3M1YA 3QGMA 3FGOA 2P69A 4L6CA 2AGVA 1EK1A 1L7OA 2P9JA 4KN8A 3U7EB 5AKIA 1QQ7A 2ZXEA 4QJBA 3WKEA 2C88A 3QU5A 2HHLA 3B8EA 1WPGA 1CR6A 4J2TA 3IRUA 4UATA 5ALEA 3SF0A 1YMQA 4EX6A 3ZVNA 5AHXA 4G63A 3ZTWA 2JAOA 3U7HB 4Y2QA 2B82A 5AESA 1L7NA 3ONNA 2I7DA 5AIBA 2CN1A 4IG4A 1LVHA 4UM5A 2C9MA 3ZVLA 4HGRA 2EATA 3WGUA 1TJ5A 3SLRA 1Z4PX 1MH9A 2B1RA 2ODAA 5AIAA 2I55A 3OTQA 2BDUA 3L8FA 5AK3A 3U13A 4YCNA 1ZS9A 2I33A 3R9KA 3KZXA 2FEAA 1WZCA 5ALNA 4DW8A 5AW8A 3I28A 2OYCA 2WF9A 1ZRNA 5AKJA 3N07A 3WK6A 3ZTYA 3SKYA 5AKYA 3AR6A 1Z88A 1QYIA 3U19A 1Y8AA 1PW5A 4O8CA 5ALIA 1RKUA 1U02A 3QNMA 4NFLA 1XVIA 3ZWDA 4BNDA 2YMLA 5AI5A 2FUEA 3D6JA 5ALWA 2RBKA 2CFRA 3ET5A 4FFDA 5ALGA 2YFYA 5AM0A 5AW2A 4KX3A 5AVWA 3A3YA 5AI0A 3U26A 1J97A 4JDPA
chains in the Genus database with same CATH superfamily
4KV7A 5A3JA 4BE4A 2D5CA 4BBPA 5KTNA 5K8TA 3C1YA 1W1IA 5CLIA 5JSQA 3ZIAD 3ICCA 2ZBVA 1H42A 4YRJA 2YWBA 1IEVA 4WADA 4NZYA 5L6LB 4U39A 3PX2A 2PIDA 4XPIA 4RDCA 5IH7A 2Z8YA 4BP1A 5J43A 5IWAB 3VU9B 3UICA 3HKCA 3G2PA 4A23A 1M2JA 1HTTA 1WV0A 1KR2A 4TQ9A 4LDJA 3L02A 1N2HA 2WJWA 3IOMA 4YMGA 1L4UA 3EXFB 4E5VA 4NOLA 4BZZA 2P2DA 3O31A 3DZ8A 2WZCA 5KFPA 4R0NA 1QGAA 3GQVA 1W4CA 1TQ4A 1A8PA 1UHUA 2IC5A 2R8XA 1W35A 5GAJA 2OGTA 5L3QB 3OC6A 2C2YA 2YVQA 2B99A 4LN1A 1QF9A 5KOHA 3W7BA 4CZ2A 2A9PA 5J2JA 1BFUA 5DNVA 1U5CA 6REQA 2E3TA 2FZWA 4HAWA 2F4VB 1BEEA 2ZBDA 2I2CA 2CNDA 4RKYA 3Q7PA 1EGHA 3ER9A 1N5KA 2J0EA 5KFHA 3BXEA 4ZCPA 3EMVA 4CF3A 4ALLA 1QGUB 4F06A 1WUTA 1V16B 4HLNA 1EUQA 1JI3A 4KFSA 1ESMA 4OHZA 4EF5A 2E82A 2W9AA 3T3OA 4YB8A 3R7WA 3DLAA 1QE0A 5KYGA 4XWYA 3JSAA 4C4RA 2A35A 7ICTA 2OYYA 2QTZA 4TTAA 2IV3A 2NU8A 3FSEA 5EP4A 1E1RA 4HATA 1H65A 4Q43A 3HBJA 4YCMA 3LGXA 2HJGA 1BXZA 3W9YA 4DFKA 2IHVA 2VWGA 2YJZA 2QTLA 3KJGA 3KJQA 1GTZA 3QELB 4Q1FA 2VA2A 1SZDA 2VJDA 5A7GA 4OX9B 2D0DA 4EQ6A 1CZKA 2A1TR 1L8QA 3M2PA 3LWLA 4Y9SA 2H7VA 4KLMA 4O4IB 1JJ7A 1IRIA 1FP7A 3M4NA 1VE7A 4G86A 4L3VA 2Q49A 4KUHA 2R85A 4OYRA 4J76A 4MWOA 5J23A 3S1LA 4BV2A 4INJA 3RYFA 1CSEE 3I1FA 4TLLB 3C45A 3HA3A 4ZICA 2X7JA 2HEIA 3I6BA 3CB2A 4RBNA 3A9RA 4E88A 3EPIA 2VLIA 4GWLA 1GWNA 1UDRA 5AVZA 1K7SN 1LXCA 4YCAA 4ARCA 3A9VA 1GRRA 1HLGA 1PR1A 3UJCA 4LV8B 5GJCA 2QSJA 5FBRB 4X8LA 4OXKA 3NTUA 1RMTA 1GNLA 4G9EA 2YDXA 2G0AA 1UOOA 4B35A 1AXEA 1S3IA 5ESDA 1BNPA 3SSOA 2W6QA 1AQIA 3PUJA 4HJXA 3WIDA 3T7CA 2XCIA 1NLZA 3I30X 4GRDA 2ORIA 2CHVA 1MNAA 1RPJA 4Q7EA 1KXJA 3R9WA 3IHQB 1I7PA 1FNCA 5AVUA 1USIA 4IXDA 1J9EA 4CM4A 7ABPA 1MBZA 1YA8A 2AYYA 3RNOA 2PJRA 1P9OA 2QYTA 3IJEB 2WT4A 1Q7EA 3OQ1A 2XCSB 1TDJA 5AOBA 2XWPA 2ZUUA 3EE6A 1PSZA 3LPCA 1LRKA 3NV9A 5FR2A 2JB9A 4MP6A 4IZIA 5ADUS 2BZSA 4WRRA 1AS3A 3K2IA 4PHAA 5HBGA 3JQFA 1ZXLA 3I8OA 3VXKA 1R4AA 3DTYA 4Q9IA 4N1AA 5HFNA 1G4HA 1IM4A 4Q3EA 4PM4A 5DGXA 1L1QA 3ZGNA 2QRLA 1LUAA 3TCKA 2W0SA 4EG3A 3RQSA 3TLKA 1PR3A 3RVDA 4OJ5A 2F3RA 1J25A 2AFHE 3TZKA 3RUHA 1PR0A 2VWQA 2ZT7A 1I2BA 3C4JA 2J09A 5IZCA 4FOLA 3E3AA 1Z88A 3C3AA 3R3JA 5I8ZA 3RIYA 3T34A 1N60A 4QM6A 2G9NA 2HH9A 2NZUG 1KEKA 2UZ1B 1K92A 2B6GA 1Q0RA 1GCGA 4MR7B 2ZBPA 4MCIA 4ENWA 4BQIA 3M4XA 5ICEA 2Q7OE 1QQ5A 1KH2A 3EEYA 3H6HA 2ID9A 1GDDA 4P0PB 4FINA 1VL2A 2CVOA 2ZRPA 2OFPA 2BR5A 1E2HA 4AFNA 1F2TA 3M9WA 2EOAA 3ZHTA 1IE3A 2I4TA 2PMEA 3TTWA 5G0VA 1Z37A 1NXSA 4LYGA 1JYSA 5JBIA 4BWFB 4XGNA 4F85A 1XHLA 1TF5A 4G67A 3H8WA 1YR3A 4W5WA 3CFYA 3MJHA 2I54A 5BYJA 5MN5A 4LJRA 1W9MA 4NJMA 1JJAA 4JB3A 4B3XA 1YONA 2FP3A 2NW6A 4C78A 3RH6A 2Q5JA 1XQYA 1JDJA 3IUNA 2YQ4A 2H07A 1ZU4A 4XRGA 4OHFA 2FETA 3GILA 5EP3A 4A1FA 3P9ZA 1ZQAA 1J9ZA 1TLFA 1KFDA 2YOFA 1KMCA 5A6VA 1YS9A 4TL9A 1R5NA 1K06A 5M7EA 5CJ7A 4JVSB 3G02A 2C1EA 4TN5A 1CQZA 3BWXA 4QTXA 3N58A 2KKPA 1KAMA 2PANA 2NUTA 1KRXA 4ND3A 3STYA 3HV0A 1DKMA 1KMMA 1QZZA 5IJAA 5I4IA 2W2XA 4G4GA 3B6JA 5KQMA 3AU6A 1WF3A 4XH9B 1E2KA 1NLYA 3WB0A 5F73A 1L5LA 5KT7A 4DFJA 2E4VA 4EHBA 4I9FA 4ZGWA 1VJ0A 1U0LA 2V45A 1YTLA 1Z17A 4CLOA 2BEJA 2OAQ1 6CHYA 1SXJA 4S3MA 2WHYA 1FE8A 4BRWA 3HFJA 4QZEA 2QAJA 2QZSA 4UHKA 5LBIA 3ZJ5A 4GM1A 4X7RA 2PWPA 5FFNA 1T9ZA 1YZ7A 5LQMA 3PR1A 2PCLA 2G8LA 2OCBA 3AU2A 2PMFA 4TUYA 3G82C 3QHQA 5H80A 4Y7CA 1TGYA 2JLCA 3LUDA 2JCXA 5DCLA 1CRWG 2I67A 1SIBE 1ORIA 3CPSA 4IRUB 1CZNA 1ZA2A 2WTXA 3WB1A 5GY7A 1XXHB 1L3SA 3KSBC 3FZYA 1QKIA 3PQ4A 3TJRA 5MDHA 2ZZNA 4XVCA 2JAHA 5DCUA 4OA8A 1T2EA 1YRQA 3RSHA 4ZDKA 5JTIA 1M2FA 3V7JA 3K1YA 2HW8A 4I1SA 3L92A 1NT2A 5IAKA 5AHOA 4K0KB 1H93A 1C4WA 4FHFA 4F8JA 4EY8A 3RIGA 3MRXA 4Q9HA 4DC0A 4TRMA 3ND9A 2IOQA 1HE2A 2ZB4A 4TV8A 2XJ4A 2OLJA 4BO4A 3KE8A 4EIWA 1WZIA 4TYQA 3IERA 5INTA 4I50F 4RKQA 4Q45A 3V4RA 1JHPA 1M6NA 5JZMA 2DLDA 1PJBA 2W3SA 3OEWA 3GIIA 1GRCA 3WDLA 4Q1EA 4DNPA 2VCYA 2B9EA 4MQLA 2GHTA 3MMSA 4CHGA 4BFCA 2HK7A 5F4BA 1SQ5A 4YRIA 4OJLA 4L74A 4OP1A 2OY0A 2QRQA 3TIIA 3ZYZA 2ZYVX 2DWQA 4E1BA 3B3FA 4Z6DA 5J8YA 5CW2A 1V47A 1UPUA 1F8YA 2CLMB 4AULA 5AHXA 1SC6A 4C5BA 2G4LA 2RC6A 3ONNA 1P1RA 2AC2A 3FNFA 2C3MA 3OJXA 4G1UC 4FYWA 1TUBA 4WBNA 3IIEA 4RO0A 3AWIA 2VTEA 2Z9BA 2IH2A 1A9XB 1S02A 5J2EA 4Z1MA 1EINA 4XUDA 4AQDA 2J1LA 3LCCA 3SIWA 1Q1NA 2JW5A 4IMIB 1SXGA 5ALIA 4JT9A 4C5CA 1FBTA 3EOBI 1JEAA 4IDNA 2WK1A 4BO1A 3NT2A 3DFIA 4BO3A 5DI3A 4C5AA 2D8MA 3A2LA 4MIYA 1IHUA 4R01A 5ABPA 4DJEC 4X45A 4AQYB 5TF4A 3Q2OA 5KTMA 3OCJA 4U7CA 1XVTA 1XMIA 3UGJA 1XRQA 2CVZA 4CIAA 2AYXA 2I03A 1XRPA 1M5UA 5DSTA 5KFDA 3PHHA 3FAKA 1AUVA 1ZAYA 2A5YB 2Q27A 3HU1A 1MG5A 3WGOA 5CU7A 3OEED 3K7EA 4PLYA 2QVXX 1XN1A 3KALA 1TM7E 4UEQA 2I5PO 2FJUA 2X5JO 1R10A 3N5CA 6LDHA 1E79D 3CUSA 3BE8A 2W2KB 3LFUA 4GOND 4DPLA 1L1EA 3SQNA 3I9V1 2GHQA 3L3FX 4B34A 4GKVA 3P96A 4PR0A 4K9OA 3UPDA 3R3HA 1UPBA 4M9XA 4HGOA 2CVFA 5ITWA 3M70A 5J2UF 2VBIA 3AYZB 3HUUA 1P29A 3ZU6A 4S2UA 1A7JA 3R4CA 1ZQVA 1VXOA 1MIOB 3ZW9A 3D43A 4YAIA 2A4MA 2IEYA 2AHOB 3SLKA 4KR0A 2O2EA 4OQPA 3TR5A 5FBWB 1KSHA 1IG3A 4F4HA 1C2YA 1OV6A 2Q3LA 4IHJA 4W4TA 5ALMA 4JB8A 4I5FA 4EA9A 3I0NA 3G0BA 1EWYA 4WKCA 5BSVA 2QAGB 2BF4A 1CEQA 1Z4IA 1V38A 1JHZA 2AUMA 2HFKA 4AKEA 2XVAA 5IBRA 3ZDCA 4KH1A 3V8VA 1PAUA 4UB1A 4J29A 4YMOA 1ZQCA 3COYA 4H0CA 1ECPA 2B4QA 4OBEA 4QTUB 2VZ8A 2X42A 3CZ4A 4K81B 4ZH4A 1U1CA 3VPHA 4GZLA 5K2MA 4ZI3A 3HLTA 1W0KD 4N0EA 4QTTB 3LK6A 4H6VA 4OK5A 1FYVA 3GV7B 4K6CA 2VAVA 5B30A 2QF7A 2UZ0A 1T9CA 2QT1A 3RTDA 4HDAA 4UQLA 3ZGLA 2VAWA 3ROZA 5JQGA 4US8A 1V48A 1NQWA 4NCIA 4K03A 1A9QA 1YU9A 4BIIA 5C52B 2I6FA 3HNPA 2XMCA 4ZT4A 1BDMA 1M8GA 3THYB 4KPFC 1U7OA 1QAOA 4NV1A 4HADA 1H9BA 2WFLB 1K3FA 3MUOA 3L7OA 3MJEA 3VO2A 4JNKA 1ZQ1C 1A8SA 4RVGA 1HDIA 3O0TA 4Z9BA 5KT4A 3N3AC 3WHLA 3HB1A 2Q0ZX 2JCVA 4RVHA 4LXQA 1AKTA 4Q7LA 4MV9A 1LS6A 1PWZA 4E2XA 3JPOA 1N6OA 1U9YA 4M3NA 2F3PA 1NYTA 1Z62A 1N5MA 1J2YA 2F64A 5LJIA 2BEKA 5HOEA 4ZOCA 2YJ4A 2GNPA 4ESVA 1I4LD 2J3JA 1O5IA 4KACA 3THXA 4AYXA 5A2QA 3WRVA 4XWOA 1NJGA 4WEQA 1TYEB 2A9JA 1UANA 1ZIYA 3S2IA 1B23P 3CM0A 4UZEA 4BEWA 4Z0PA 3JQRA 4QW9A 4ATNA 3RVKA 3MOGA 2QL6A 4EL5A 4O25A 4D3ZA 3QVOA 1D6MA 1GAWA 3O47A 3W3AH 2VDWB 3WWPA 2ORED 1H22A 1U31A 4CWAA 2PQ6A 4U2KA 1X7ZA 3A6FA 1UWCA 2PMKA 2H9AA 4C7VA 4AKGA 3NHPA 5KI6A 1GRVA 4KQHA 3LDUA 2XCAA 1JLSA 3K35A 1N7JA 4XARA 1T5DX 5TVGA 4MEYA 1S9DA 2M6LA 3FCSB 4L50A 1US8B 2ODAA 3N7UA 1ZUWA 4I4NA 1F6DA 4RV9A 3V8MA 1X38A 2BEVB 2H1HA 4YA6A 2J9ZB 1FYDA 4HWPA 2KW5A 3T7DA 4EEXA 1FRNA 2IVFA 3KUUA 4AJHA 3DT8A 2MYPA 5DHUA 5FTWA 3NVMB 2IXEA 3UK1A 3K2EA 2QGZA 5DLGA 3K6KA 1J5PA 3LYAA 1TM2A 2VZEA 3SP1A 1S77D 1H6DA 3JZAA 4JLDA 2EF1A 4CM7A 1Q7CA 2AIRA 1SXDA 3I45A 2ZTDA 3IDSA 4RQ5A 1THMA 2IH4A 5B7GA 5ES4B 1A2BA 1ZETA 3VDXA 3BE5A 1GTMA 4DTIA 1GPNA 2KOBA 5CJPA 2Z08A 3G7UA 5KAPA 2HNKA 5KNBA 4ZO6A 3T3MB 2XGJA 2O3UA 4N7JA 2QY9A 3BMXA 4FEAA 4EP1A 3AOEC 2CNWD 1MRSA 3FR7A 1K68A 4JELA 2C9CA 2G70A 4BLRA 1E0SA 2IXFA 4K2HA 1RBQA 1FP4B 4ME6A 3NC0C 3MSXA 3L1HA 3IOBA 3KCNA 1I33A 3JQ8B 4MARA 2BLNA 3KM0A 1VIAA 4MPDA 4DNFA 3UMGA 4LF7B 5J0UA 5U4XA 3IHWA 3I1JA 1QBKC 4KQKA 4CEHB 4YXWA 1U4BA 5DMXA 4OSPA 2IS6A 4ZANA 4NE9A 5C18A 3GHHA 3ABOB 2ZIVB 1OHHD 3ABRB 3NMUF 5ALHA 3ANMA 3WYDA 2JPDA 2WI8A 5TY0A 3EASA 1FCJA 3TSWA 4N5HX 1QH1B 5A4FS 1PVQA 7AT1A 1Z5GA 1VLVA 4F97A 4I1PA 3OT5A 1FRZA 2A59A 2COEA 3HO1A 4J9NA 4NPHA 4M0UA 4JITA 2FW1A 1NJSA 3AZQA 3DZCA 3QIAA 1ZOPA 4HWRA 3D1VA 4RETA 4LV6A 3KV3O 4L5BA 4D9CA 1O0SA 1CLUA 4R64A 3AIKA 2ERCA 3QTTA 4TLCA 2P77A 4CI0B 3DVQX 2XQIA 2WEKA 1IN4A 2DHDA 1M66A 4HDMA 5FBZA 3GOQA 2IHUA 2RBGA 1JPNA 3KC2A 3C24A 3W7VA 4Z8YA 1PP4A 3OSNA 2A14A 3O75A 3AVXA 3A6JA 3BT7A 4HRYA 1K98A 5JATA 4NTZA 2EHDA 1RCFA 4UC0A 1M7GA 3OCXA 4G0YA 1Y3CE 3ENWA 4IDEA 3AV0B 2AOXA 2VPYA 1JDTA 2UZAA 4Y2PA 1XC7A 5JNSA 1ODJA 2IP4A 5KCMA 2FE1A 4POOA 2XUPA 3IAAA 4NAVA 1DZIA 1U3TA 5KDDA 4UEOA 1MEOA 5CCXA 4YDHB 1FTQA 4B3BA 2W6OA 1QVVA 3EZXA 3IDQA 4FD3A 3OFND 4HEA6 4FFMA 4FYXA 2XZOA 5EXXA 2QSZA 4TYNA 2P1ZA 4DJTA 5ADHA 4QQRA 4HXYA 2VYVD 2VA8A 1ZGHA 2V9ZA 3SAGA 4ZVUA 2AMJA 2B8EA 1DIGA 5I7EA 3RKRA 4UW9A 4ZVMA 1E4YA 1GR1A 3PXBA 2B7CA 4O2AA 4I2JA 1O97C 1P6UA 1HTWA 3RYCB 1OLXB 3GEPA 5IJ0B 4J1QA 3VR0A 4WZAE 3Q7TA 4NATA 2NNLD 1MMFB 3ETGA 3R77A 1RXEA 4KVGA 2IZZA 3UJ9A 5CB4F 3W5SA 1U3GA 3UF0A 3ESXA 4HMOA 1BG6A 1XAHA 4F2HA 2VPQA 2P2LA 4GX5A 4F4IA 3OLCX 4NOJA 3ZWPA 2QUHA 1H66A 4MS1B 5K0ZA 3IRUA 3IVXA 4US0R 1JAIA 4P7KA 3EXHB 4RQBA 4G23A 2OO7A 3UWDA 5AIBA 4ZARA 7GPBA 4MZDA 3D2BA 5LYJA 4JR1A 3RTEA 1AHNA 3HCRA 1K66A 2QLJA 8ICFA 3M9NB 3ZJYA 2B1RA 3JTEA 4DYVA 5LXTF 1SULA 3L01A 2H2WA 1TM1E 1M2KA 1QG4A 1ZRNA 2VBGA 3VR3D 4FZJA 1KK0A 2FEWB 1W5AA 5MF6A 4HNUA 3HABA 4RK0A 4I2DA 2F1RA 2GBLA 3OURA 2YICA 5BV8A 3I0ZA 3JVIA 1OYYA 4HPXB 1BDBA 2CDNA 2MTBA 4RPIA 3RC3A 3T1VA 4LHEA 4CV1A 2FW6A 3GLKA 1AQ6A 4CF7A 3RVLA 3N86A 5IM4F 3GRUA 3PFIA 5F5LA 1CWUA 5BN5B 3HXQA 4IAOA 1G98A 1TYDE 2MA1A 4YP3A 4GOOD 4FMDB 1SVOA 2R2GA 1WU8A 1UPXA 3GROA 1DE0A 1Y3HA 3SC2B 3A1DA 1W75A 4DG9A 1AUPA 2Z30A 4HNHA 4CLEA 5C4MA 3TLAA 3LLCA 5JSFA 4Y2YA 2R1ZA 5CK4A 5L40A 3TLXA 5GTHU 1WW8A 2IYEA 3FNRA 3C3YA 3V4VB 4YLEA 3IVCA 3KHLA 5GIPE 3K0HA 2IA5A 2W8BA 4K1LA 1I1NA 4R69A 1TAGA 4KAJA 1UMBB 3VA7A 1GNSA 4G6ZA 1WXHA 5D5PA 5JFTA 2Q1XA 3GFRA 3ICXA 4JCOA 4M9CA 3PP8A 2E48A 4QOHA 1KQPA 3V1UA 4ZZ2A 4Q1BA 4YEDA 4RNCA 4ZDWA 1J0XO 5AWFC 4A5SA 5CYOA 2ZT5A 4EBBA 4P36A 3L4BC 3PUKA 5BYKA 8OHMA 3KHGA 5KFZA 1ADGA 3NBFA 2G80A 3H2KA 3ZV3A 3V34A 4BB5A 1MTZA 1AKRA 2A2ZA 3NCTA 4BVAA 5ITVA 3VR2A 3F6BX 4H7JA 4IDBA 1KQQA 4N03A 4X24A 3G8AA 3KJEA 3VAZA 2P1DA 3DEEA 1N3BA 5ILGA 3C5CA 2H3VA 3L0DA 3JQDA 4M98A 1WCIA 4ZEXA 3BSFA 4PHFA 3GX1A 5J1SB 1AK9A 2MDTA 1NP7A 4NONA 3GFKB 2O3JA 1XTVA 4HLCA 1MGOA 4J1SA 1F5SA 1W46A 2HU2A 2XTMA 1AX9A 3ANLA 5LQJA 1JHQA 4FE4A 3I83A 3OOSA 3EW7A 3EYZA 1NUQA 3V6KA 3SS8A 2C96A 3ZCSA 3JD0A 4KYUA 1SO8A 4ZDJA 1RI3A 1ZK0A 4HLDA 3PZPA 1IFXA 4Y6QA 1XEFA 3KT8A 3EG5A 4PO1A 1XV5A 1LBTA 3KTQA 3O3NB 1XU4A 1SCUA 5G3YA 4BXOA 3AW9A 3B9PA 1NU6A 1ST3A 1QOZA 2QPAA 2WVGA 4JJIA 1FJHA 4LECA 4QGAA 4BFLA 5I4KA 4QUKA 3V46A 4QGFA 4IV5A 3WNBA 4U63A 3N6XA 4FWTA 4X9XA 3HMQA 4FDAA 5BSUA 3B0YA 5CX1A 4RY9A 4L4XA 4B2LA 4LTMA 5IJ9B 4EMBA 2QUJA 3C1UA 3NHSA 3FKQA 3M7DA 2YJTD 5I6DA 8ICVA 1PHRA 3VPFA 2GEKA 1SKUA 4BJ1A 1XXLA 4DWJA 1R66A 5FWXB 4L75A 2V0GA 2K4HA 2Q0XA 2BY4A 9ATCA 3CUUA 4JVLA 4B6OA 1NOMA 1OFIA 3T5AA 5DLQC 2JLWA 2HLDD 1E9RA 4ETMA 2Q99A 3E7DA 3QKRB 4CLHA 3TACB 2VP2A 3LWBA 4Q3KA 1EUDA 1RYNA 2BQRA 5BPCA 1ND6A 3ZXYA 5JH7A 1K1SA 4H1TA 4LIPD 5C32A 5JZOA 1JLHA 1ARZA 3TBFA 3U13A 1KQGA 3U7QA 4Z7NB 3JQ7A 2VP9A 4GICA 1K27A 5HGJA 1GTJ1 3KJZA 5H16A 3SIRA 1DPFA 4MCJA 2QJOA 4HX9A 1EFVB 2XCPA 1QGYA 4DLBA 4ZU1X 3O93A 1J2JA 2RBKA 5MN4A 5L51A 3A2KA 4AZSA 3O7MA 3DW1X 2IU0A 4F50A 2JAXA 2FN9A 4C0HA 5EJ5A 4CPDA 5FR1A 2NN3C 1KR5A 2P9TA 3OJUA 4J1TA 4JBWA 4PC2A 2H7YA 5PNTA 4ACBA 3LNTA 2XOXA 4DRXA 1DX6A 5KSZA 1SUSA 3NIWA 2JAPA 4YS6A 4R16A 4DCNA 3EVTA 2CJYA 3QPWA 5JPDA 2GJ9A 3B5EA 4OMUA 2Q1YA 1XTPA 1ZD2P 4WFKA 2EJUA 2EZTA 1YH3A 2WM8A 2WYIA 2Y27A 4LI0A 2A30A 3AFHA 3RQIA 2IPLA 2KLBA 4DIMA 2BMJA 4KEAA 3PMLA 1Z83A 4TV9F 3QVLA 3U4QA 4Q4AA 3A3NA 3V7FA 1DC7A 5CTJA 3HVJA 3QVVA 5SV2A 3OE7D 1JZTA 3CNNA 3ZI7A 3BMQB 3OETA 1WNTA 1S2GA 2VZ9A 3GNQA 2X6RA 2SNIE 4HLQB 4MTCA 2ZYSA 5F7JA 4KLOA 1NW4A 2ZE7A 3QEMA 2PN1A 2UUBB 3GFBA 2PKYX 4RY8A 3ZI0A 5DSZA 2NM0A 4PQGA 5JZ9A 2DGZA 2XCTB 4X97A 2PDAA 1R7RA 2OYSA 1YAJA 4TUQA 4ZVTA 1NURA 3W5DA 2H4WA 5BYBA 4AF8A 1ZEJA 1BOOA 1V11B 2CB9A 2BHTA 3T4UA 2X4IA 4AZ3A 3QKSA 4EM6A 3FB4A 4C8OA 1DTSA 4WI1A 2VTBA 4I4TB 2GUGA 2MSEB 3ZJUA 3PEUA 1C0PA 4GNRA 2RGAA 4ZAVA 3EB9A 1QZ3A 2ON6A 1OB2A 2ZIWB 4QYTA 5ALOA 2F1KA 1U2RA 4PAWA 5IKEA 3RIXA 3ADCA 4HWTA 3NQ41 4Q9LA 2ZRNA 2DOKA 4ML3A 1GUDA 1LX7A 3DE2X 4MGHA 4AJPA 1MN8A 4P92A 1SK8A 3CWQA 1AMNA 3I53A 3GCZA 5HS6A 2V54A 3CZAA 7MHTA 4YWHA 5IXJA 3AUSA 1MAVA 1Z12A 3VUEA 5CCDA 4V0OA 3TH5A 1P75A 1WWVA 2F90A 1QU3A 1XA0A 2V96A 3FSJX 1LW7A 3U44A 1XZHA 3R76A 3MNFA 4W9MC 5CMLA 3FCUB 1Y9ZA 3USES 3BQTA 1I2AA 1YK1A 4XWGA 1KEUA 1RJFA 4RNDB 2DUJA 3R3ZA 1P6QA 2KS6A 1TCCA 3L0CA 2FJ6A 1HSZA 3H04A 1NK4A 2HU5A 5HF5A 4UPEA 4GXRA 1Q5PA 4MV0A 4D82A 2E87A 4PZUA 3PUXA 1H2RS 2WHPB 5E38A 3ANNA 3TSYA 1GPUA 2D2FA 3O7WA 2BGGA 3UOGA 1ZVVA 3LBAA 1YQ9A 2B1IA 3M1YA 1ZQTA 1SVIA 4QYXA 4PZOA 4IH1A 2V5VA 4PIVA 4GDMA 4UB8U 4YHHB 2O20A 3HC7A 3ISBA 5JYDA 2ZYUX 3FRIA 3HN7A 4EKYA 5IAAA 1WD5A 4EKDA 5BOSB 4YAEA 5KKCA 3ZKWA 4GEKA 4BMDA 1HT2E 2B7BA 1FB5A 2WOOA 4WLFA 4V1CB 3ROPA 2QUKA 2ZJ6A 1CPYA 1OTHA 3ADPA 5B58C 1DOQA 4ZOAA 1DJLA 4HXFB 9ICUA 4BBZA 1SB3C 1WF6A 2FRXA 1J90A 5ERGB 5JNWA 4QTZA 3KPJA 4GYJA 4LJAA 5IHPA 2IXDA 2AG6A 1W5FA 4OU4A 5NLLA 4ADSG 1L7XA 3PFGA 3CRW1 4F2DA 2HREA 1KS9A 1N9GB 4KXVA 1RQLA 3GQBB 5HQTA 3AEQA 5J4LA 2JRCA 1S1MA 1T8YA 1CF9A 2KTQA 3TW0A 5TJ9A 2ZBRA 4YR3A 2QX9A 3O2JA 3MVEA 2HIGA 5LMUB 3ORFA 3PE3A 4QSHA 2ZJFA 2IEGA 2IOFK 2A9FA 3T7EA 2BTQB 1H8EA 4RUKA 3A9SA 4LJ7A 1FJ2A 1DKLA 4HAOA 1CCWA 5CFOA 1L0BA 1K9VF 5A06A 3GZJA 5BNTA 4HDRA 2CXUA 3G8DA 1YE3A 2MMCA 3DEIA 3QYFA 2IL1A 5HKAA 3EF0A 2BDPA 3S99A 3UFXA 4F4XA 2C77A 2YZNA 3HP4A 1XZKA 4IS3A 2NZJA 3RKSA 3VFDA 3EUFA 5AKLA 2QWXA 2I6QA 2F7SA 2O8DB 1XL0A 3V97A 4R1TA 2EFYA 1H2WA 2JASA 1QAQA 3S68A 3GFOA 4LXTA 4IILA 4ISBA 4HH0A 2IOHA 1X42A 3PRYA 4IL5A 2WFAA 3NUQA 1MJFA 2BMVA 5LR6A 1RWKA 2OB1A 4HDCA 4M46A 4KU4A 3WRYA 2GZ2A 2WJGA 5K03A 1EFCA 1VHJA 2VF5X 5CFNA 1WY5A 2ZYHA 1RZVA 4X93A 4KTQA 1MFPA 1IY8A 2BKLA 2WHQA 4DABA 2P9ZA 3KKQA 5LWHA 2R751 1IIBA 4WUTA 3D6NB 5KMGA 1SHTX 2Y6VA 3KJIA 4RORA 1J7KA 3SEQA 5AHRA 3P5SA 2ETVA 3E8SA 5FBQB 1DL5A 4OGWA 1IYZA 3ZCRA 3CPJB 3WMXA 1I4WA 4F5DA 3OHPA 2WUFA 3P2IA 2A1JA 1KVRA 2HGSA 3Q72A 2PXHA 5HIKA 1W0JA 4LV5B 3EPJA 2VQ6A 5DLYA 4ER5A 3W3AD 4UBJA 4LF6B 2BP7A 3NASA 3FVVA 1ZXBA 3LIPA 3D4IA 2GTHA 4C6HA 1X2IA 2O0JA 4MYRA 3HB7A 4LSGA 4WN9B 3ZWCA 3UPTA 2O1WA 4U1RA 1WIWA 4W7IA 1GGJA 5C8YF 2JK1A 3TEMA 2ZUTA 1SKRA 2XBMA 2PZEA 4QEDA 2DR2A 3BIOA 5KDOA 3I12A 3WWZA 1ECCA 4Y6LA 5GWXA 3HDHA 1I3OA 2EH9A 2VAMA 3O4RA 2PH7A 3VR5A 4ELUA 3QXXA 1A8QA 4TVSA 3H6KA 4EY6A 1LY1A 4D46A 2QN8A 3KKOA 4D6XA 2BHNA 2GPTA 4GOJA 2WAMA 2GKSA 4OEHA 5EIAA 1FFHA 3H5LA 2G72A 3HSYA 1V5WA 4K7JA 3BXFA 3KXIA 3IKTA 2ZDGA 2XUGA 1D1PA 2OBFA 4WJKB 4AB1A 5GADl 4I5GA 4AJNA 2OO5A 2BFOA 5LQRA 5BURA 4GYWA 2H1SA 2RB5A 2RJNA 4DUGA 2ONYA 4D0NA 4KQJA 1XZMA 4I3HA 4RGBA 1CJBA 3CW8X 3BDIA 3BH7A 2FMXA 3OIUA 2QB1A 4CCSA 3DE1X 1VG8A 3ZNPA 2IE8A 3G49A 1AT1A 9ICWA 1WPGA 4NFYA 2B5OA 4IVNA 4KI7A 1ID8A 1EHYA 3ZTWA 1ULBA 1HQCA 3C8MA 1OAOA 3CX4A 1QB8A 4IJMA 1Q74A 3DO8A 4RA9B 4W1RA 1EDOA 2ZQYA 1QFMA 1XYYA 4YDSA 2O7RA 2W8ZA 5J9FA 1W52X 1Q3TA 4PZCA 4GD3Q 3HILA 3KV1A 4D4HA 1U98A 4OSOA 4AJ4A 1R0WA 1BA3A 1QU2A 3VDNB 3G9ZA 2VBFA 1OW3B 2IZ1A 1ZMBA 2KJ9A 4CMKA 4QXAA 1L4BA 2GETA 4BV9A 4PYRA 4FBLA 1K3UB 3QVMA 3RADC 2XNSA 2WSYB 3CLVA 1YRAA 1CB0A 4FFRA 5IX8A 3LJKA 1BRTA 4HN4B 5EZSA 4MV1A 2JBHA 1PR2A 3EA4A 3I4FA 3PSHA 1W4ZA 4BRSA 4KLIA 4Z6EA 5CXXA 4YQWA 3IUSA 5IYZF 2PI5A 4RESA 2DQYA 4JVMA 2ZBUA 2XB2A 1ZFNA 4EA6A 1ZINA 3TSOA 3I2YX 5HP4A 3PA6A 2JHGA 3QI2A 1IN5A 2P90A 4PX5A 3LPLA 3MLBA 4CV0A 4IOKA 4DR7B 3PLRA 4IQGA 4NR0A 1Y9DA 4F04A 3TNDA 4X91A 4ZDIA 4N3NA 4GQBA 1XEAA 3M34A 1O6FA 8ICEA 2PWAA 3EWSA 3WJ2A 1RPNA 4IRDA 4XUGB 2ZB7A 1HSOA 1IXZA 1HEUA 4FFVA 2WQZA 4PANA 1YDFA 4F4YA 1X9XA 4FMBB 2VP0A 1JSXA 3IP7A 2E49A 2WSLA 4XD7A 5T5QA 4I4CA 3LHSA 3S1AA 5I51A 2Q8PA 5DBOA 1BN6A 4IQVA 4MIOA 1EWQA 1Z08A 2I4OA 3UH0A 4ETWA 3C14C 3SFVA 2UAGA 3UAOA 2QVLA 4LPKA 4JP8A 5MN6A 2CUKA 1MQ9A 1YJBA 4S0XA 1HXHA 5A02A 4Q7KA 4M9GA 3GP5A 3UXHA 4UAJA 4DSJA 2OCIA 1KO8A 4I27A 3G9TA 4E4YA 5DHSA 3I4LA 3AR9A 5FOTA 1M54A 4EFKA 4MS4A 4JLSA 2M1ZA 3WSVA 1GD1O 2J5QA 2LUOA 3PIDA 3NHMA 2Q0SA 1NLMA 3IG8A 3VZSA 2ZRFA 3LQFA 5LNK6 2VH1A 9ICGA 5F35A 1XDZA 2R25B 4J0JA 4BPRA 3OT1B 4EZ6A 1RI2A 4JS0A 2J7PD 3I2GA 2ATLA 5ALVA 1NMQA 4X6UA 1K08A 1IBRA 2VDJA 4F4CA 5LP6F 2FKAA 4X1OA 4AURA 3UAGA 2AK2A 4DV2B 1QO9A 4LDRA 1UL1X 3U3DA 2DULA 1CR0A 1KJIA 3NBQA 4H7EA 1NXVA 4OKSA 2L82A 1YRYE 1JLLB 1UP4A 2A9KA 4DWVA 5JNTA 1O6CA 2RHDA 3PJDA 4RY0A 5DM60 4PAOA 2B35A 3C29A 5KL8B 1ULSA 4KQXA 1DOAA 1F2UB 3QYAA 4XKJA 2HEGA 3F47A 3CYMA 1Y9EA 2GD1O 1SKYE 3JY6A 1QX4A 5LLSA 4EI8A 4KQIA 3GA7A 1E0JA 3STTA 4RZHA 5CB1A 1Z36A 1JR4A 2RHFA 3T5PA 1POXA 4EYKA 1A2OA 3EGOA 4B6GA 2VPIA 3NT5A 4HB4A 4LTNA 4E46A 2VIIA 3MTQA 1ZK3A 3BXXA 1PJQA 1KF0A 3EZGA 3KAQA 1FMCA 4H7KA 4Z0HO 1F7UA 4UUOA 1TO6A 1W4AA 5EHIA 5HUQA 3ETCA 3EVAA 3HZRA 3DVAA 3MT8A 1Z6AA 3PR5B 4ZYUA 2OV3A 3A6GA 4RQ2A 4IG4A 5KTYA 3K0AB 4DJAA 3V80A 1DJNA 5I9SA 4XQGA 5IUJC 1PNRA 1BX3A 3WL7A 4YN3A 3E9QA 1TZKA 3ICWA 5KUTA 4PYNA 2I1VB 2EAMA 5EHXA 4I14A 3N8HA 1SOVA 3UJNA 2PG3A 3SPXA 3E22A 3GEBA 3RBDA 4B6FA 1GQYA 3WZ2A 1TO1E 5AP9A 2PM8A 4CNQA 4FU0A 1T13A 2F8TA 1IEXA 3U80A 4FFBB 4GG1A 1MP0A 1KYQA 3DQPA 3GGCA 3ZHRA 4JT8A 8ICPA 2XDWA 4P08A 1ISHA 3Q8WA 2VPWA 4DQQA 3D8NA 1T8RA 4POAA 1OU0A 1M2HA 4PL1A 3TD9A 3K96A 4INPA 1MPXA 2FSVA 2GLTA 4ZAFA 3GZFA 5C1DA 2HWXA 4RHYA 1NJWA 3I2HA 5B3JC 4TS3A 3H0MB 4YRFA 1Y6RA 3B3JA 3O84A 4KIGA 3SXPA 4KXUA 2X5NA 3LP6A 3MBYA 5BPHA 1YCDA 3WB9A 4C0JA 3ROQA 4DLLA 4PYOA 4O59O 1DOZA 4J3FA 1UPAA 3EIHA 3LM8A 3HKEA 3PC7A 3GLTA 2E4WA 2HFJA 4TMXA 3KJHA 3U9SA 1OXBB 1PZEA 3K0FB 1QPZA 4G2TA 4IOJA 3CEJA 2NQ2C 3W6PA 4A10A 4W8HA 1IWBB 3JR7A 1UJBA 3H4VA 1ELOA 1HA3A 2JGKA 3MS7A 2OCPA 3FPSA 3OIWA 5ELLA 3NTQA 2A1UA 1FMJA 1E6UA 3F2IA 4JLOA 1U0NA 4M0EA 1IDOA 3SS7X 3QUSA 4HTAA 4JU8A 4ZZ3A 2XHEA 4LZGA 5DBFA 1J70A 1FW6A 1NW6A 3KKAA 3LUKA 4K46A 3W1EA 1X94A 2WG1A 3O1IC 3D4NA 3ZEIA 4LXGA 2O3RA 3MD9A 4CKCA 4ZEWA 4RGQA 2BZGA 1KIMA 2VDVE 3MJ4A 1UAGA 4QZAA 1M2WA 3B1YA 4W9NC 4LJ8A 4OBBA 3PPYA 3GWGA 5BR4A 4YO7A 2WB1C 3ZY4A 1GU7A 2GD6A 5TV2A 4IQ8A 4RXUA 2WSMA 1Z0IA 3AX6A 3WLMA 3AONB 9ICVA 5IILA 1NMZA 4UNQA 4HUQA 2W93A 2HK9A 3UKOA 2YN4A 1PWEA 2MCFA 1FRVA 1FC0A 4MKXA 4P1ZA 2A3NA 1B0UA 2WF7A 2IEDA 4A36A 1C80A 2YWHA 3KTDA 3UMCA 2RI1A 2ZSDA 4YK7A 1PBTA 3FTCA 3FMVA 4JXKA 4YIHA 3EXAA 2IHBA 4AUKA 1ENZA 1OH8A 3U09A 1Y1SA 1OVMA 1KRWA 5KOJB 4WK2B 1NP6A 3OQOA 2P0EA 2W6IA 1JMYA 1O94A 3RSQA 2OCEA 5IINA 1EVJA 1IQRA 3QE2A 2C99A 2QUZA 3CLKA 4NPAA 3NTOA 5EKSA 2W2TA 2RHLA 4YJFA 4RTLA 5C1OA 1ZGZA 2BMEA 4ED6A 1Y6JA 1SIWA 4ER7A 1D8BA 2V6GA 4BZXA 5L1IA 1DRVA 4P3YA 2FZCA 3P9XA 2MWMA 3LUCA 3H5VA 3EFOB 1PJSA 4QLAA 1BPBA 4JCCA 4UU7A 1D4FA 4MEJA 1UKVY 4XQ9A 2PTHA 3OKCA 2W4QA 4UMVA 4D74A 2PL1A 1P7DA 5HK8A 4DR5B 1XZQA 4WECA 3QUBA 4RZUA 2R4TA 1YB2A 1RWPA 3UHOA 1N6KA 4YMSA 3QZUA 2ZUSA 4HQ0A 2ZIUA 5DW3A 4MAMA 1WUIS 3C98A 1QRDA 5BN4A 3BILA 4KFCA 1LQTA 1MJGA 1QKJA 3NIDB 2OD9A 5EXSA 2FLWA 4F4KA 1SXPA 3HYNA 3VU1A 1H0KA 5CK5A 1D2RA 1TT7A 4PHDA 5E0KB 2JGIA 2BLLA 3QP9A 5D5HA 4TQUS 3K9QO 4PU0A 2E6UX 3BULA 5FORA 5E1MA 2VUIB 1PUXA 4NJEA 1RZRA 2OOSA 4NZZA 1EVQA 2OR3A 4AWXA 3BTOA 3ADOA 1DGQA 3GFTA 3OZUA 4GI7A 1DIRA 1DAHA 3UAXA 5CT8A 4JDPA 5TGTA 2DKXA 3FUWA 3A25A 3IUBA 1GKLA 5H68A 3TW8A 3F5AA 1CRQA 4G3IA 2GO1A 3V7NA 2PXIA 1U5BB 2XD9A 4J9VA 5FUYA 2C78A 3SR3A 3DO5A 4IIUA 1DQSA 3DV9A 2C7PA 3DDWA 3OLQA 1OXJA 2GPJA 3A1EA 4MB6A 3ENNA 3TRIA 3UWSA 4RE6A 5D85A 3IO3A 1GADO 4OXRA 4BNGA 3VQTA 4RQ8A 2F3NA 1IIRA 4JEUA 4UTRA 3OTGA 4AJKA 1MC1A 2O7VA 4UVIA 2VUTA 3PICA 5IT9A 2CT8A 3ZE7A 1NP3A 1U2PA 3EEQA 3NWPA 4HP8A 1NKTA 3LSTA 3TPZA 5AUOB 5JEEA 3AQEA 5DWVA 4PX2A 3H9EO 4DQKA 3CYFA 3FLMA 3TZEA 1JNYA 3ENZA 2ZGVA 4BFXA 1E2QA 3H1GA 1K6EA 1TECE 1KY3A 4OTZA 3ROXA 3VNVA 1D2HA 1PT6A 1OW5A 4Q03A 3L84A 4I1RA 3G59A 2GK7A 1KFJB 4KZPA 3VC8A 3I9OA 1RIFA 1E2MA 3AI1A 1P91A 1Z7GA 4IQUA 1XIVA 5ETJA 1F14A 2O8EA 4LQLA 7ICUA 5E4FA 1TVKA 1T4DA 1N1MA 5IVPA 1IEWA 1OQAA 3QFHA 2W6PA 4MRMA 3QPAA 4YCBA 5A4KA 4JJ6A 4PNHA 4RUAA 2AG5A 2J87A 4Z9AA 4XA5A 4BQEA 2V4UA 4F46A 1QIJA 3FIUA 1IHOA 5F7OA 3OPYB 3QFSA 3KFUF 1A9ZA 1F6BA 3DOCA 4KPUB 5CR9A 3OQMA 4KXFB 1CY2A 4OGKA 4D8YA 2JFHA 2NPOA 3UN1A 3U6KA 3G0HA 2Q46A 1CUDA 3B5JA 1OFUX 2BPFA 5IXSA 4O5KA 3RCBA 5L4NA 2V0CA 1LPNA 1EP9A 8ICUA 7ICPA 1NTOA 4QU8A 1A9PA 2NSDA 3BAFA 1E1YA 3DUWA 4D0SA 1RRVA 4XTCS 2OCKA 5JROA 3OZAA 2G36A 4BNJA 1RQ2A 1IHPA 4U2DA 4IQ4A 4M8NE 1DBIA 4JLVA 5IJWA 1M1UA 2A33A 4UVGA 4DB2A 4FOPA 5JCZA 1Y88A 5B2EA 4FZNA 3JS5A 4KPGA 1K6IA 2BONA 5E9JA 5JRZA 3T4PA 2AEMA 5TGZA 4MEAA 3LCRA 3IH5A 1OPXA 2A9VA 5E6UB 4XX0A 4B6EA 1KAEA 2AFVA 3QUAA 4C0SA 1E98A 4XCXA 1LSUA 1R16A 4TSRA 1CE8A 1T3NA 2EZ9A 3P4YA 3MW8A 1W85B 1ZD5A 4RT3A 2E37A 4P4MA 4GPD1 4KX5A 1OI7A 4OI1A 3R23A 4MYTA 4NBWA 4M9RA 1KDVA 2PWBA 2NXCA 4F3NA 1J2TA 3VR6H 1V3TA 4F72A 1MV5A 2I99A 2PQ0A 1TK8A 4UDOA 5HXAA 4FQ5A 2DHCA 4IFEA 3MMXA 1ORDA 3DE7X 3IR5A 3PD1A 5HZHA 1UCFA 1W96A 2W2VA 4MWZA 4B0OA 1KFSA 2AFIE 1JEOA 1Y9JA 2NLOA 5BQ3A 4M7WA 1V1MB 5EL0A 4RDIA 5I9NA 3QIVA 4Q18A 4O3FA 4UCWA 3SLRA 3D0QA 1F38A 1DAEA 3PPWA 4US1R 3CURA 1E58A 3ZU4A 1ZX1A 4TVKA 1X1DA 2WF9A 2QNIA 3RRMA 4UB3A 1WXIA 3UK7A 1R9GA 2OSBA 2VWHA 4YRAA 5JXGA 4NCJA 4HZIA 3B89A 4YJDA 1S76D 4A8EA 4G0NA 3JASB 2Y9UA 5KJ6A 2YFKA 4N18A 1G4AE 1C3LA 4KR3A 1QMPA 3BJRA 1NR1A 3BGVA 3WSWA 3F9CA 4UTOA 4MIKA 3V8PA 3K0CC 2C57A 4F93B 3SKXA 2GAOA 2O9JA 1ZPDA 2XEDA 4M9QA 1PO7A 1SR8A 4F5EA 3K4PA 4BJ3A 8ABPA 4D4JA 4OFXA 1RHKA 3IA2A 1XOIA 1ORRA 5B4UA 3SBOA 1TVEA 3M5PA 4E30A 2R6GA 4RDXA 2EFDB 2PSJA 4I5IA 2BV3A 4BP3A 3U9TA 2X9VA 3KWJA 2FR8A 3Q7SA 4PGFA 3DMFA 4I8DA 3V33A 4RPCA 3M6WA 2ZTEA 4FO6A 3NUGA 4MA4A 4CMAA 4ZK6A 3CUKA 5IIKA 2UZ3A 1M72A 1JR6A 2EJBA 1YQDA 4FM9A 4YMUA 2QE6A 2WB1F 3TLGA 3D4LA 1X9IA 3HU5A 4INOA 2MUTB 1G7SA 1E6LA 3LOPA 5HILA 3F5FA 4BB0A 5DGIA 1MJ5A 3LX6A 5BNZA 2W71A 3TAHA 4Y2XA 5JI2E 4OXNA 1OXMA 3UOAB 4TYMA 4L1KA 4B9NA 4FS2A 2OC9A 1PNOA 2WWHA 1C7JA 2SBTA 3FUUA 3IKMB 4GR9A 4WESA 1XHEA 3C16C 2BFWA 1OT5A 2BFMA 3OLYA 3CTMA 2QARA 1SUDA 2C1XA 3FZQA 2IGTA 1T1GA 4PS0A 2K89A 4MJ3A 3MLEA 2X14A 1CKEA 2FW8A 1H8HD 1I1HA 2AMVA 3DEZA 4QNRA 1KVSA 3IRVA 2ZG6A 4NOKA 2VF7A 1NASA 4FWIB 4JLNA 4E6PA 3E9RA 5KEIA 4L4RA 4LTDA 3QVUA 5F23A 1Z6XA 4EHJA 1CS0A 4F6LA 3TLYA 5DYGA 2C2HA 5BWLA 5DX1A 4P83A 3GZTB 3MWJA 1K7EB 3VPSA 4F6RB 2GNAA 4WEOA 3OZSA 3EPGA 1TFUA 2JJ2D 3CE9A 1Q8KA 2CLDX 1BVSA 1HH4A 2JFZA 5F4ZA 3KOYA 1JKJB 5KNCA 1ULAA 4ED8A 2JIOA 1W6RA 2H2IA 2J6CA 1W6UA 3DV0B 3FKSD 4FZMA 9ICOA 3CH5A 4DR1B 2WUDA 4FGWA 2YXLA 1XKLA 5AW4A 4ZO9A 3JQBA 3R6DA 2HMTA 1J8FA 3UB3A 4LXYA 5DJ5A 1T3QA 3E58A 3EGIA 3RVSA 1YUMA 1PV2A 4KBYA 3I0MA 4H3HB 3C4QA 3ILSA 3T54A 2JLYA 2IUTA 1YS4A 5CLFA 5KG4A 4BMCA 1MVLA 1JIIA 3GJ4A 1CP2A 1Z5VA 3C3BA 4I2CA 4OUDB 1JU3A 3EEOA 3CH7A 3C1AA 3KAKA 3UZUA 4GAEA 4YYEA 5JYEA 4RAQA 1SA0A 3GJ8A 3E9DA 1XEWX 4BN5A 2DT5A 3I42A 1CD5A 5CA0A 3J7TA 1KP9A 3HFRA 1Q84A 4RPZA 2JEOA 3BTUA 1JTVA 5KQGA 1N1EA 4YBZA 1IZ0A 3FDJA 3DOEA 3RJIA 1Y37A 4B3GA 1R6XA 3U48A 4D57A 2ZXEA 2JLQA 3QI7A 4L78A 2X2PA 3DO6A 5ALEA 1O89A 3NWBA 4B3HA 4G63A 3IESA 4RAOA 3C6MA 3MT7A 4PYIA 3IUJA 3WICA 3QVGA 4J4BA 2ZM6B 4UM5A 1XAJA 2MR5A 4EUSA 4B32A 2QUAA 1M67A 5FPQA 3MHTA 5TVKA 3Q5DA 1UDBA 5A6SA 4TLBA 2HIHA 4N48A 4IPTA 5JS1A 3QFRA 2AFRA 4UAZA 3LG2A 4HAVA 4P93A 2C31A 3A9TA 5TQ2B 4GBGA 1LBEA 2XD4A 5D4BA 1GQOA 1JFVA 3PEYA 3UWOA 2QZ9A 3ASZA 3T06B 1MA7A 4I46A 1XYVA 3HJFA 3HVHA 2OENG 1N62A 3BMCB 3PRKE 4EH1A 1YZFA 4YD2A 1U8AA 3RUIA 3X2FA 4KO2S 2O2GA 4RACA 1KP2A 3QLJA 1ULHA 1KO4A 4P4SA 1RLMA 5EXDA 1Z4QA 2JFGA 3L7KA 4K9MA 5CNIA 5DPMA 1SHJA 4GNKA 4NU5A 2D0OB 2Z1NA 3REQB 1BPYA 1E7QA 1LU9A 2CYAA 3CWZA 1XI2A 2JLBA 2QW0X 5JCPA 1JJBA 1BJRE 3MCZA 2V6IA 2RB4A 5L3ZA 1G21B 4AT1A 4ND1A 1CY0A 1P62B 4CUKA 3VO1A 5AXDA 5JAOA 1UBRS 1W88A 4EJFA 2YWXA 2EYQA 4YMLA 2ANBA 3RUEA 3OCWA 2QQ0A 4C0XA 4MZXA 2H2HA 4C7BA 2YNMD 2AEEA 4YFKA 3JAWA 1NWHA 2G71A 5HFJA 4OP2A 1YOVB 4MR8B 2F43B 2LBPA 5REQB 4W99A 3MCVA 3DKPA 1RCTE 4PQFA 5TPWB 1UBMS 3PD7A 4R0VA 4PAMA 3DHEA 1BE0A 3ETDA 3LH5A 1E61A 5KNDD 1BGVA 1UC4B 4QYWA 3QUQA 3ZLUA 3IDFA 3D64A 4IHQA 2JBWA 5AOVA 1Y1RA 3FPKA 4S1TA 1PZFA 2P8SA 4C2UA 3Q4GA 4QNMA 3GVXA 1AK2A 4QOFA 1HO3A 4QQFA 1KDTA 5H9VA 2WJPA 4XGRA 2F1OA 1E3SA 3NVDA 3QENA 4S24A 3WGGA 1JZQA 2UV8A 1ODKA 3DBLB 3GJ7A 5T4BA 5J2UB 4PLHA 3LQ4A 3TB4A 2HQRA 4BRZA 1Q11A 1MABB 5IJZA 2RH5A 1N63A 3DV2A 4YCJA 3SR4A 2C98A 3LE8A 1ZISA 5ELMA 2I1QA 3H4DA 4DV7B 3L46A 4IF4A 2PSSA 4YJ3A 1M6YA 3GA0A 1O58A 2PGOA 5DU2A 1NZDA 4RIGA 4EW1A 4J91A 3TG8A 1P4HA 1FTYA 3DAYA 4OL0A 2FMSA 1HWYA 3Q8PB 5EKXA 2FSHA 1WXFA 2PUVA 2WD7B 4E31A 4BX3A 5KU7A 2ADMA 1WZUA 5DFAA 2FDCA 2OG2A 3GPCA 1JFTA 2DH5A 5JRTA 1DAPA 2CLHB 1OZAA 3CIOA 3VR1A 3JYPA 2R6DA 3EHDA 3IOEA 2IS2A 1X40A 1QH8B 1I9GA 2IUEA 3GV5B 1XKXA 2HT6A 2QTGA 1L6NA 4I1UA 3ZE9A 1ZI8A 2I3GA 4DNQA 4XJVA 2QUIA 2HC9A 3TZQA 2KJQA 3KQYA 2ZTVA 3OSPA 4M0FA 4P35A 2OC4A 3PI6A 4C2AA 3E9EA 3KPWA 1LJ8A 3FWYA 3HNOA 1XVLA 1AHPA 4H7PA 4YRBA 7REQA 3Q6NA 1KJ9A 1CQJA 4C89A 1LWOA 2JHFA 3BKWA 1ZZGA 4MCHA 2GEDA 1EUCB 1KVQA 2CUZA 2IUSA 3FC4A 3CH6A 1K9SA 2FOIA 2P4UA 4RNOA 1V43A 1Z2EA 2X6TA 3KSUA 3N59A 3L8FA 4V0NA 1CVRA 3TLCA 1BW9B 1FSSA 3PFHA 1U04A 4G0ZA 3L7DA 3PHCA 3ZBPA 4QM7A 4A27A 3O74A 3DZJA 5KNIA 1RKUA 5CHGA 5B58T 3BHIA 4NYJR 3BQ7A 4ECYA 3U6BA 4LOJA 3VGJA 3F73A 2CXOA 5TIIA 2HF9A 5LBUA 4TKUA 2LVBA 5BRNA 3NANA 4P4UA 4MKZA 2FK8A 2V5UA 1TLLA 2WTBA 3R9XA 4EDFA 3TQRA 4P82A 4G0PA 3WGJA 3CUEF 4RULA 4AKSA 3QFTA 4BNHA 3KKLA 2B36A 1GPAA 1R8QA 2QD3A 2IZOA 1JEQB 4HLUA 4E22A 4ENUA 4QUBA 3ET4A 4GBED 1LNQA 5CDTA 1MHTA 3VYTB 3DUFA 2P79A 1W34A 4UB5A 4RJKA 1ECJA 2F1JA 5C8VA 3UC5A 2YWFA 4U6QA 2IV7A 1XQ6A 1Z0FA 2WG0A 1P77A 4JK1A 2CXXA 3PQ8A 2A1IA 3L7LA 2PSEA 4CI9A 3EF3A 1JEYA 2GRAA 1BQ4A 5FPPA 2X19A 3RFUA 1IMOA 3K3PA 1W2GA 2C5GA 1FU4A 3SK0A 4J9KA 5HOQA 4IO0A 3UQZA 4TZ0A 3BEDA 3M6FA 1OGYA 4BLVA 2LCQA 4ZU3A 2IYFA 4GHWA 1JQEA 3NCHA 2PHZA 1N2CB 1C7RA 3OM0A 5E4YA 2JHCA 7ADHA 2QTAA 1QC5A 3S0JA 5T41A 4M1OA 4ZVOA 2ZWPA 1CRZA 3WGTA 1ZP6A 2O5RA 1UZNA 1TMYA 4OP3A 5AXAA 4LZLA 3KFXA 5E4JA 3IIJA 3PC3A 1KQ3A 2JIZD 1IXRA 1UOQA 3C43A 2QZZA 5GVRA 5GONF 3K8ZA 2VR1A 2XC9A 1LPMA 5BORA 4MJXA 4WZBE 2QBYB 5BV7A 5EHZA 3EISA 3J7AC 1LLFA 2FEOA 4YT2A 2IQ5A 1JQBA 4B9TA 2VXCA 1XMJA 1OA0A 4YQEA 4P7BA 2J3EA 3NIFB 3QKUA 1WB9A 3CLRD 4K87A 5LP6C 4XWTA 2HLNA 5EZ6B 4ZGBA 4AM8A 3DDZX 5G3ZA 4X63A 1TUGA 3LX5A 4RA6A 3LBFA 3NFYA 2PGAA 3W9UA 3RJEA 4PGGA 4ZC8A 4URXR 1SV0C 4DB4A 1XWWA 4TKVB 2XI9A 4HGYA 3R6WA 4HAIA 4LJLA 1G8AA 3F8TA 1TTTA 3QMVA 1VGRA 3DWEX 1KY2A 3PUWA 2WUGA 2OESA 2BGLA 3ALRA 4PYJA 4N65A 1KSPA 5DYIA 2QD4A 4B2IA 5JALA 1JLKA 2QS9A 4GUAA 2EP5A 2UXBB 2H3HA 1OWNA 2CZQA 3ZV4A 2WAYA 1V96A 5KDLA 1YDWA 2BMDA 2PBZA 1NVAA 5TQ0A 2OBXA 1VG1A 4RNNA 4RZSA 5DN6D 3PEEA 4DLZA 1W30A 1EGQA 4A8JC 2P35A 3RO7A 1Q3UA 3B51X 5FUXA 4HZUA 5EKDA 3F9IA 4H27A 4IQ0A 2DF4B 5TB5A 1E5TA 1YS1X 5CDFE 4I99A 3KG2A 2J6UA 4BMNA 3FMGA 2PLWA 1LPOA 5AVJA 1OFUA 1Z5ZA 1SOAA 2XYVA 4O08A 3I04M 1Z3IX 5JEDA 1VKOA 1UC5B 2E7ZA 4O0IA 4NBNA 2CVHA 3A6PC 3SVTA 4V03A 4HDNA 1U0SY 2GPNA 4PLWA 1P5HA 1EAMA 1GZ4A 2VK1A 1PYGA 4L5AA 3T99A 2QHXA 3N2EA 4ZGGA 1DP4A 3T3IA 4HGRA 1Z4PX 4CKWA 4GSKA 4JLJA 4QATA 3TCNA 1C1DB 9ICPA 2RONA 4HWSA 3Q3JB 3KLMX 3AG5A 2QRJA 3CXUA 4X20B 1Q17A 1O1YA 5CB4B 1OXVA 2Q2NA 1BRMA 1M83A 3IULA 5IWCA 4HVAA 4NV3A 3ESDA 3TB6A 3KQOA 1OVGA 4N4AA 2XMSA 4IZOA 4KQ6A 2OCAA 2LTAA 1PFWA 1NONA 4TXLA 4G1FA 5JRJA 5FOUA 5C81A 4LNHA 3QUTA 4OB6A 5HR6A 5JCJA 4MF8A 3ORHA 8ICWA 5IUKC 4BUCA 1AGXA 5DDYA 2ZUVA 3JPYA 1SQSA 2VDNB 4GPTA 2AE1A 2O14A 1Z8NA 2I76A 1LV7A 4CODB 2X0NA 4E08A 1Y8ZA 2Z83A 3BWCA 3NIGB 5EWJA 3A0BU 5JVDA 2NACA 4ZCSA 1M6WA 3DOJA 4MUAA 4KSBA 2X8BA 3ER6A 3WHIA 3F1LA 3AY0A 3G7SA 8ICHA 1NC1A 2GESA 5K0JA 1GJRA 1V35A 2AR0A 4MVXA 5HR5A 2C61A 5DWQA 3CRVA 3AZOA 3RHTA 3VO8A 1IB6A 1ONOA 4I9NA 1G5TA 3AERB 5DP1A 6ABPA 3ZIDA 2GTIA 4K9RA 2QU7A 3D7RA 4IIBA 4CW7A 5IT4A 1YE8A 2GCGA 5TISU 4RZXA 4Q48A 1M9NA 1NQTA 1NVGA 1WB4A 5ALJA 3ZWYA 4IRKA 1M74A 1ZM2A 1N32B 2I4IA 1GPDG 2VHWA 4IEFB 4RV5A 2Q3CA 3NH6A 1FXUA 1UDXA 5SYAA 5KT5A 1SC4A 4Y18A 1TZBA 1WG8A 3DEYX 4NRDA 4B6SA 5CVDA 1Z6TA 2VJMA 4FDUA 1GHTA 3FCAA 5EWFA 4Q4LA 5GOTA 3FA2A 2DHEA 3QE3A 4RYLA 3KETA 3QU2A 3D0OA 5AJVB 4Q7JB 3VR6D 5LIPA 1EXWA 1SCJA 2AR7A 1LLUA 2ODWA 4B45A 5HZGA 1ZJWA 1GAJA 2QRZA 2VYND 4PGQA 8ICAA 2ZANA 2WJAA 3AESB 2X9GA 4DWOA 2E85A 1YR6A 2R00C 4WNAA 4KN7A 1MV8A 4AP9A 2HF2A 1Z1VA 8ICSA 1ZQLA 1N1DA 4QIHA 2KV2A 4BEJA 2AOWA 4M8SA 2JJMA 2E5WA 3IT0A 5AW1A 3BB3A 1DS6A 4WNYA 3NBYC 5IFLA 4X90A 3WFJA 3W6ZA 4G07A 1QOPB 5HRUA 3AL2A 4NNOA 1DG3A 1LF5A 1RVV1 3PHIA 1SELA 3DMRA 3U3JA 4JZYA 4L02A 3BFPA 3BL8A 1I2ZA 3G2LA 3K1AA 1G18A 1HURA 2YZGA 5KWIA 1TEZA 2PFSA 2QR5A 2AJDA 1NV9A 3L0PA 5K7SA 1KEZA 5IK2D 4WXEA 4MDFA 3JATB 1SC1A 4RQ0A 3VR4A 4RTOA 3FDZA 3FNHA 4QGSA 5AVSA 2QVGA 1LCIA 5ERYA 3C8UA 2Z6VA 1H6BA 1P8JA 3GH1A 1G20E 4DLKA 3WKCA 1SXIA 4JV2A 1XZJA 4D81A 1CS4C 4KNVA 4DL3A 4GSYA 1ZH4A 3RC7A 2VCHA 3UKDA 2FCRA 4OOFA 4M0DA 5DX8A 1YCFA 5HMMA 3MTIA 3GLIB 5KYVA 3NEYA 3IDAA 4MQFA 4O33A 3LF1A 1U63A 4MVJA 1ZUD1 4KO3S 3LWZA 4ES6A 5DLPA 4PCAA 2JEFA 2HJSA 5JJCA 4KN9S 4RK1A 2B2NA 2ZUFA 3M6ZA 3IVAA 4AK9A 4RVNA 4F92B 4DJJA 1G42A 1ZR2A 4YVZA 5JARA 1A4IA 5LJLA 1V71A 1JVNA 4NCXA 2AJLI 3O8QA 4ESEA 4NXZA 4B47A 4F4UA 5DM70 4KQMA 1VMDA 5EIEA 3MTAA 5F9MA 3X43A 4AF7A 1N2BA 3MWGA 3OZDA 2PEYA 1DAFA 1FYXA 1TTPB 3FPHA 2KIVA 4R2HA 5DKWA 2WQ7A 4NECA 2XRFA 5J47A 2ATXA 2JAUA 2CLFB 1XZLA 1GZ5A 1Y6ZA 4WKGA 2CXNA 4LF4B 2RH4A 7ICGA 2YC4C 2ZJBA 4FE3A 3N4MB 2FGJA 3RF7A 2YIMA 3EA0A 1FXWA 4ER3A 5DRTA 4NE2A 1GZVA 5L45A 1RM4A 4NARA 2BUAA 1ZMXA 3A1CA 4IH4A 3OMXA 4YRCA 5J5CA 5A3VA 5BR1A 4H60A 3IAUA 5E7MA 5LB2A 1VCHA 1K5DA 4M9SA 4RZ3A 3IPRA 4R41A 2V7WA 3C23A 3QVSA 1NK9A 5JZSA 5EGSA 5KZMB 2OECA 5DM0A 3I6IA 4XDGA 3P0RA 2ZS7A 1XF9A 1A97A 4LA4A 3TIVA 2GK4A 1XWFA 3E8MA 1K89A 3ORSA 3FLEA 3E4CA 2PL3A 1XEWY 3W2EA 2GN0A 4EDHA 3PWKA 4MR9A 4KIWA 4U5XA 3SC6A 4MV7A 3Q6MA 2QN3A 1ZKDA 2IITA 2AB0A 3RIMA 4KVZA 3SOZA 2XH8A 1MOZA 5DN9A 3OBBA 5KNDH 2Z2JA 3ZD6A 1RBMA 4Y2SA 4M0AA 1L7PA 4P5PA 1CRXA 3CGGA 3HPQA 4X5VA 3A6EA 5DHFA 4R98A 3TDMA 3DPIA 3LLUA 4CM5A 3RUFA 4INZA 3LK9A 1QRTA 2KPOA 2LIVA 4IOLA 8ICOA 1G8PA 1RWBA 3WTCA 1D3AA 2NG1A 3FVRA 4LSMA 1T2DA 2ZB2A 4FT2A 4TV9B 5AM1A 1XZGA 3BREA 4WAUA 3WVNA 2BI7A 3VISA 1YJQA 2E1RA 2HQOA 2CBGA 5KHOC 3BJEA 5TDHA 1ZGAA 2P9YA 4D4MA 5CA1B 4L95C 5HE9A 2WF5A 4DR3B 1FNNA 2HXGA 3AFOA 3IDOA 3R24A 1TXGA 3MCAA 3NEPX 3PFFA 4QA9A 1QF6A 2HM7A 4AZWA 3W4KA 4B6RA 2G08A 4O4JF 4PIPA 4K8RB 1SBTA 4ZHQB 1KRPA 3TZ6A 3UJPA 1QO0D 1S4MA 4QWCA 1ZH8A 5F1OA 1T2CA 3OQIA 3LWNA 5JO9A 4BKUA 5ILQA 3VC3A 1WBDA 3SEIA 2GLUA 3RD5A 2ZAIA 1FFXB 1XG5A 3DEAA 2MSLA 4FZ3A 2NRWA 4DIFA 2W6CX 1F06A 2IBMA 2OQRA 1YZNA 4AIRA 1MDBA 3TECE 2XKKA 1KEWA 2E21A 3COZA 5B57C 3F3YA 1QXSA 3WWYA 1MB3A 4CLDA 3CIFA 1DEAA 3BA6A 3KUDA 1FRQA 4IG9A 5U1PA 3UV6A 3H1PA 1IONA 1PZHA 4AJLA 4Y2UA 1K6JA 1SOMA 3IP5A 4MI1A 2YJ6A 2RQ5A 2Q2QA 3MMNA 2H0RA 3IEKA 3GPBA 1ZK4A 3L4KA 2IHNA 3WLLA 2ZBEA 2G5TA 4C8KA 3SZMA 1HLFA 1PVPA 1U0EA 4IS7A 1T91A 1RRGA 3U7IA 3CN9A 1SU7A 3RF6A 4TXNA 1JDBC 1LGYA 2A1AA 3QGMA 1MB4A 4CGZA 2NVBA 4R5MA 4KE8A 2H54A 2WQ6A 1Z18A 3A4VA 1ORHA 3U9LA 1S8FA 3LQQA 2A7QA 4Y2QA 3UGKA 5CVEA 4ZJPA 2W2NA 1GNVA 2PLNA 1JIVA 5FNVF 5IUNC 3U7JA 3L6BA 3BCSA 3H4BA 4PG8A 2QX8A 4CDNA 4BE7B 1C9DB 1T1IA 5AT1A 1MW9X 5FO0A 3B2EA 4YT4A 4BO6A 5CFMA 4QPDA 5FD8A 2PGJA 5AR1A 1E2PA 2WAXA 1JR3A 1T5BA 1B8VA 3RODA 1GTL1 1GGNA 4PR3A 1Z15A 1Z8HA 3BUSA 3QX8A 2GEFA 1O95A 1DCFA 1Z7BA 3JYLA 2WU8A 4UQPA 1BPZA 4EK9A 1N4AA 5I9BA 1QRAA 1ZL2A 2MINB 1VRCA 4ZXFA 3ZW8A 1HQDA 4A16A 7ICKA 2H00A 5G0SA 1SUPA 1JIJA 3AM9A 5DM4A 2X6QA 5HCNA 4IICA 2OEHA 2EL7A 2FSFA 1LI4A 4ETIA 4TN1A 4IH9A 1VL6A 1BWSA 3KVYA 5ALUA 2QNRA 3UKJA 3GV8B 2JZNA 4MS3A 4JV0A 2A78A 5ALQA 1UKAA 4AIIA 2BELA 4F4DA 121PA 1KFTA 5JJLA 2PZMA 5IKXA 3LP5A 4DLSA 2GK6A 4OB8A 2QD1A 1HFKA 4RH1A 3TSZA 5K20A 4OJNA 1HPLA 1VBFA 1Y63A 4CHTA 1EFHA 3UA4A 3QY0A 5IMBA 2NVOA 5KINB 2H2DA 5F9NA 1OIWA 2C8JA 2P4SA 4G3XA 3GYGA 5EC8A 3R40A 1EM8B 1MT0A 1G19A 2COUA 3L7JA 1A50B 3L4PA 2C97A 1HDEA 4MRPA 2RE8A 3QBTA 2DKFA 3KQKA 2E8NA 3SJ7A 5IXYA 1V8ZA 1XDGA 1QFZA 2Y2UA 3FCCA 4DUPA 1A04A 3ADDA 2ZVPX 4PHCA 2C28A 5JE8A 1B00A 3P2MA 1VLHA 3LYSA 1VB3A 4XAQA 1CY6A 2G5HB 1WWKA 2MRLA 4YRZA 4KLHA 5IAEA 3QEOA 2FOLA 3O3MB 3IUPA 3K4QA 4OV6B 4Z5XA 4TKLA 3EZLA 4O3RA 1LRJA 2YV5A 2ID8A 4M1SA 4DCTA 4O2BA 5J5VA 4OJMX 4IM7A 3OM8A 2JVJA 1QNFA 3CPHA 4O3NA 4BWJA 2H52A 5TRTA 3M9OB 2D1RA 4ZRMA 1U0GA 2CE7A 5C34B 2QP4A 3MWEA 3KZ1E 1YZHA 3B6EA 1A9TA 1BCSB 4D5GA 3HJCA 1WMEA 4PLVA 1KETA 2HXYA 3OOWA 4RLHA 1M34B 1N2EA 2Q41A 4QEKA 4QYMA 1DFHA 1V26A 2CV0A 4YECA 4Y1RA 3D54D 1KPIA 3UV7A 1L6IA 3L1IA 4C43A 2NNWB 1Q12A 3LLMA 5H83A 3B1FA 1M5RA 2GYVA 2VCEA 5DNYB 3QLUC 4EI2A 4DY4A 4CR8A 1JVBA 3ANSA 2PU5A 4QBTA 3OOEA 1MNQA 5KAFU 2Y4OA 4FJ0A 5DNEA 4LF9B 4E6EA 1XKTA 1T8UA 3FYSA 2OGWA 2DWCA 1YNSA 4Q3CA 3TXXA 1IMJA 3CRRA 4O0MA 4QELA 4LHWA 1D5WA 3PNMA 3GDFA 3S7ZA 3UYKA 1ZICA 4B3FX 3KLNA 1RWVA 1BEZA 2AJCA 4O02B 4L4YA 1NW8A 2NOAA 1MT3A 4U2GA 4OB7A 4QGGA 1UFOA 5AYVA 2FHPA 1GY8A 1P0FA 2Y1CA 4JBIA 4KQFA 3SHOA 1XYGA 1AQJA 3O1HB 3EXIA 2NTJA 3B53X 3V2HA 3RV4A 1WWUA 4WXPA 5TQVA 2WU1A 4EAQA 1T4CA 5KX5A 2Z95A 3WZLA 2KICA 2JA1A 3OP4A 3JPRA 4I1IA 1EHCA 1ODCA 3IM1A 4BAUA 2VQFB 3N2YA 1PG0A 3TVTA 4ARAA 3WIBA 1IBCA 2V9PA 3Q3CA 4U6NA 2I6TA 2IXTA 4K4HA 4K9QA 5BSGA 1U9IC 4AMGA 3ONVA 2TMGA 1EX7A 2GAJA 4MQ5A 3SSAA 3CEHA 3D02A 1X7WB 4YFVA 1PR5A 2VF2A 3FWPA 3K5PA 1HDOA 4HH3C 4BJ6A 4NSNA 3H75A 2GM4A 3ET5A 2G9RA 2VN8A 5T8KA 2RGUA 4BEBA 3T1YB 3FOFC 3ZZNA 2QRMA 2YV1A 5LA6F 2ZAGA 4UBIA 2HTFA 2KD1A 7MDHA 2PI4A 5HKLA 4X3CA 3WNCA 5ALXA 5ALLA 3OECA 3H3FA 2AI1A 3QA9A 4GC5A 5EXEA 4FGJA 2E5SA 4IZHA 1UQTA 5J2DA 2WZBA 3QHAA 1OREA 2OXCA 4GECA 2J3DA 5EYPB 4GXJA 2I6SA 3DE5X 2Z56A 4WMLA 3B52X 1ZLYA 4ZOEA 2JNWA 1N2JA 3LSYA 2OQIA 4CCWA 3ZH2A 1G5PA 1J8VA 3QV2A 5AI6A 5LOVF 4P34A 4YR0A 4MI6A 2BFDB 1T9KA 4MUIA 1N3IA 1YVEI 2ATEA 3ELBA 1GRQA 1V9CA 3MINB 3B12A 1U7DA 1Z33A 4AMUA 1F8GA 3WE7A 1V97A 3M49A 2H08A 1KY5A 5C5JA 2J3KA 5CLQA 4N0QA 1PRYA 3G2QA 1OC4A 3EGEA 4LZZA 4Q9JA 4G56A 4LXIA 1I30A 3T5JA 2YS6A 1TK0A 2P27A 3W5AA 1NVMB 1RJGA 5LZ8A 5BV2P 4D9JA 1X9WA 2Q5HA 3R1IA 3IIMA 1KNXA 2R84A 3BIWA 4IINA 3KKKA 1M2VB 3ZVMA 5AM3A 2Q3BA 1VKHA 3NHBA 3BL6A 5I7WA 4GI3A 1V6SA 5KYUA 5KYWA 1XZIA 5AM4A 4UARA 5EWMA 2GCNA 2YL2A 3WAGA 3EAFA 2AW5A 3PTAA 1X7HA 4RF4A 1IAQA 3PEFA 5D84A 1AD2A 3E0FA 4BRUA 3SQDA 1X9MA 1BEUB 4MGKR 3QE0A 4W82A 1SC3A 1EGAA 2HHQA 1A7AA 2WKRA 5G0UA 1JNXX 1XZBA 3DMNA 1T15A 1YASA 2P4QA 4LDAA 1DPGA 2ES4A 1N57A 4LXUA 1SGWA 2J85A 4ZOLA 1PFVA 2O8FB 3D8RA 2D5AA 1ZQIA 5T14A 4UUAA 4YRQA 3WBFA 4HH1A 4RKEA 2O3QA 2JATA 4V24A 3U3RA 1CF4A 3EGVA 4OI0A 1BCRA 2GXUA 3IGFA 1EJ0A 2GMWA 3UNXA 2D62A 5HZKA 3X3HA 2FX3A 3IAFA 1LS1A 1QZUA 3MRTA 4OQMA 1OKKD 3SR6A 1ZQEA 4BZWA 1JUDA 1HORA 4CQLB 3LUHA 3VZBA 2XEXA 3FRHA 1KYTA 3NC4A 2LGJA 4PRZA 2BSQA 3EGXB 3NBZC 3K0KA 4FSDA 2BCUA 1QFJA 3V6JA 1YGPA 4E5DA 1GYPA 3W79A 4I81A 3UMVA 1I4TD 4Q21A 1B3BA 4TMYA 3WK5A 5CHYA 3AB8A 5I7AA 1J39A 4ZTBA 5JMWA 2RHMA 4CMCA 2OG1A 2SKEA 2GK3A 3ITKA 3NOXA 2VOEA 2J6BA 4NICA 2GWHA 4MVJI 5EHQA 1Y9AA 2DFVA 3JR3A 5K0GA 3C2QA 4E33A 3AEKA 5GV7A 1I6KA 2Y1FA 1GR0A 2J33A 4E1AA 1V95A 4K9PA 3CR8A 3KL4A 4YAOA 3OTQA 2NPFA 2L42A 5FYQA 1D09A 4XVUA 2YHIB 3IAS6 1EWVA 4CM9D 1XRLA 4XYGA 4DSTA 2HUNA 3DEHA 1REQA 5E95A 4BU0A 2ZJ7A 1E3WB 4DR4B 5DB4A 1HUQA 1T36A 4UEJA 1BXKA 1FK8A 2W6JD 4PZPA 2Q2WA 1J7JA 5FA8A 2ZRLA 4G8BA 3JQ6A 4OBWA 4D80A 2HSJA 2G5GX 3K70C 1LBHA 3PX3A 3TAXA 2GYWA 1K5OA 3BD7A 3O03A 2Q5CA 3U56A 5L53A 2G4VA 2YVUA 3UCEA 2WILA 1OPRA 1ZJJA 2BF7A 1UXHA 2O5EA 1G3RA 5JT1A 4U3JB 4BBAA 2I4NA 2W3RA 1XHFA 5MGBA 1ITZA 4Q19A 5E0OA 4N3BA 2UYGA 3FETA 4LY6A 1B74A 1SVMA 1PGQA 4IYJA 9GPBA 2B1JA 4GOMD 2BH2A 2KMDA 1DTEA 3QXHA 3LXUX 5EE0A 3AHDA 1UBHS 2DY1A 3G68A 1E9AA 1E77A 1NJFA 2Z3ZA 2E3JA 1L7VC 3ORQA 1D0IA 3FUTA 3LBHA 1THTA 1EXVA 2F8MA 1V85A 4OK6A 1KYYA 1ESDA 2QJRA 4FNAA 3LRXA 3FLAA 1XCLA 2IDZA 5KB3A 2G76A 3U81A 1Z4LA 4Y9DA 3DMTC 5J1TB 1KZ4A 5CAEB 1UMCB 1E1NA 1IM2A 2GYYA 1Z5NA 2DG2A 2JBAA 3OG9A 3WRXA 4MOWA 3LWDA 1AQYA 1GA1A 4LC0A 2ACVA 1EP3B 1WB5A 2AN9A 1F51E 2X23A 4BPBA 2R1TB 4YXMA 3K6SA 1XLTA 3UJ6A 4ARUA 2BEWB 1DSSG 1XMSA 5K6AC 4LJSA 4D99A 3NOOA 1FFSA 4ZEMA 1H0RA 3OJLA 1C4KA 3JV7A 4ZYTA 4FQ7A 1JWBB 2ILVA 5H4GA 1IHDA 3INRA 1C1XB 3LL7A 2WYUA 5YASA 5SZJA 1Z74A 4P7JA 1EM6A 5JISA 3M5CA 1ZQWA 5G4KA 5FYDA 4PZYA 2W04A 4LCBA 1NBIA 3OD5A 3NETA 4BATA 2ZI9A 3U4IA 2HZ7A 4R40A 8LDHA 3PRHA 3MWFA 3DULA 4O4HA 4F5YA 2WHRA 4D9FA 4D8WA 4WK0B 1W5BA 1KZ1A 3R41A 5CFLA 4XW2A 1ZGJA 3H5WA 4FDMA 1KBQA 5CD9A 2Q6VA 1DBQA 3EHEA 4ITVA 3KHUA 3P27A 2UVDA 4HYQA 3PZRA <