2ZG6A

Crystal structure of hypothetical protein; probable 2-haloalkanoic acid dehalogenase from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
202
Chain Sequence
b'MKYKAVLVDFGNTLVGFKPVFYEKVYQVLKDNGYDLDLRKVFRAYAKAMGMINYLEHVDPKDFLYILGIYPSERLVKELKEADIRDGEAFLYDDTLEFLEGLKSNGYKLALVSNASPRVKTLLEKFDLKKYFDALAPKIFGFALAKVGYPAVHVGDIYELDYIGAKRSYVDPILLDRYDFYPDVRDRVKNLREALQKIEEMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein ST2620
publication title Crystal structure of Hypothetical protein; probable 2-haloalkanoic acid dehalogenase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 61
structure length 202
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.660 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zg6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2zg6A01
3ZWKA 1RMTA 3QYPA 4NWIA 2CFRA 1RC8A 4E88A 2Q4RA 2GMWA 3WKBA 1EK1A 5ALWA 1TE2A 3AR4A 1L7OA 3AR5A 4HGPA 4CF4A 5AVZA 1YNSA 3FVVA 3OCUA 3SKYA 3WGUA 2GHQA 3MMZA 5AK4A 3ET5A 4YCNA 5AW6A 4HAIA 1T5TA 5AI4A 5ALOA 1S2OA 4EZEA 2FUCA 4UARA 4Y2RA 3ZVMA 3R9KA 2JAOA 1ZD4A 1QQ5A 2I34A 1T9ZA 4YIKA 1YS9A 3QU9A 5AI9A 5AI6A 2ZBDA 2C8LA 1Z4JA 2OBBA 4RESA 2IOFA 1TA0A 2GFHA 1RPZA 3ZUPA 5AVRA 2RAVA 3L0YA 4BNDB 3U7FB 3IJ5A 2GHTA 3L8GA 4MWOA 2I54A 3ZVNA 4EX7A 5IT4A 4Y2QA 4B6JA 5AM2A 3SD7A 5AVUA 1Z4PX 3I76A 4HGNA 4J2TA 2HOQA 1Q91A 2WHEA 3OCWA 1L8LA 4DCCA 1LTQA 3RFUA 2BY4A 4O8CA 4UU0A 2CFTA 5E0OA 3SLRA 4Y3UA 3L8EA 4CE6A 3WK8A 2JAUA 3F9RA 3N07A 4IFTA 2QLTA 3IRUA 1SU4A 5IT0A 4KN8A 5AM4A 2RBKA 2FPRA 1F5SA 2HI0A 3HLTA 2IYEA 4EELA 2D2VA 2YJ4A 3QGMA 2YN4A 4CF3A 4G63A 2W11A 5AKJA 1U7OA 4KYTA 5AW8A 2R8YA 4NABA 2P27A 1SWVA 1ZOLA 2IA5A 5FP0A 3GYGA 3QX7A 4ZEVA 3NAMA 3QUTA 1S8OA 1K1EA 5ALMA 2B8JA 1RLOA 2YJ5A 3KOOA 3SKXA 1L6RA 2YMLA 5A3SA 3SF0A 4Y2XA 1U2TA 3OPXA 3D6JA 3WK4A 1Z4QA 3ZVLA 5AKGA 3NALA 3MN1A 5AKXA 2FPXA 3L0BA 3FM9A 3R09A 4F72A 3K1ZA 4JB3A 3QUQA 4HGRA 1RKUA 3CZ4A 1EK2A 4PNHA 4UW9A 3WK7A 5ALQA 3ED5A 4DWOA 3W5AA 1TJ4A 1T5SA 2W4MA 5ALSA 1U7PA 5AKEA 3PGVA 1N9KA 4FFDA 5AVQA 5AI0A 2C4NA 2NO4A 4H1WA 3L8FA 3IB6A 2JARA 4GIBA 2G0AA 1RMYA 1ZRMA 2B1RA 2YBDA 2ZOSA 3EPRA 4J03A 5ALFA 4CNQA 5ALEA 3OCXA 5ALRA 3ZW7A 3DNPA 1RKVA 5AHXA 5AKZA 2OA0A 1ZD3A 3NUQA 5AVTA 5ALGA 2Q5EA 2P11A 3QNMA 5AI5A 1X42A 2I55A 1FEZA 5AI8A 2PKEA 1PW5A 1O03A 4YCMA 2WF5A 1L7NA 2B8EA 1QQ6A 3KZXA 2FPWA 2BDEA 5A3RA 4HGOA 4UATA 4Y2YA 2CFSA 2R8XA 2AH5A 4MUMA 3UMGA 1RQNA 4BEWA 1CR6A 1Z5UA 3ZX4A 5AICA 2WM8A 5AW4A 4YIHA 1VJ5A 4F71A 1Q92A 1XVIA 1YDFA 1VFPA 2AUTA 2R8EA 5AVYA 2G07A 4FE3A 3A3YA 3TLMA 4Y2TA 3FPBA 5ALNA 1WVIA 1NNLA 4KX5A 1KYTA 1YJ5A 4HYTA 2B1QA 2HDOA 5ALUA 4BEVA 1YMQA 3B9RA 2HCFA 5AKHA 2FUEA 3QUBA 4OHFA 4L6CA 4ZEXA 3QU2A 5AW9A 2RARA 5ALPA 5AW1A 2WF6A 5A3QA 3I6BA 3QXGA 4L6AA 4EENA 4UASA 1QQ7A 3ET4A 1WZCA 3PGLA 1L8OA 5ALJA 3AR2A 4XE5A 3L5KA 2MU1A 3ZX5A 3ZTYA 4XQ0A 4NFLA 1TJ5A 2CN1A 3EWIA 3L0CA 5AK6A 2HF2A 3FPSA 3A1EA 3I28A 1XP5A 2WFAA 3NRJA 3L1UA 2ZG6A 4KNWA 5AW5A 3ZI4A 4Y2VA 4BBJA 4AS2A 2ZBGA 3QLEA 4UMEA 2RB5A 3A1DA 2WF8A 1ZJJA 4OFZA 3DAOA 3WKEA 4C4RA 3M9LA 2FPUA 3EF1A 2O2XA 1TJ3A 2HEGA 1Z4OA 2B30A 2VKQA 1ZD2P 1Y8AA 4JDPA 2HF7A 1JUDA 3ZTWA 1NRWA 3U7EB 5ALIA 2B82A 3L8HA 2YJ6A 2ZBEA 4Y2SA 5ALYA 5ALHA 3HYCA 3FGOA 3AR8A 3E81A 5AKIA 4BKMA 1YV9A 4YCLA 5AM3A 3U7HB 3J7TA 4EX6A 5JJBA 2EAUA 2JAWA 2C9MA 3QU7A 4I9FA 5ALXA 2G80A 3NIWA 1AQ6A 2FI1A 2X4DA 3WK6A 2NO5A 4UAUA 2MSNA 4C4SA 3OCVA 3N28A 2G09A 5AKKA 1RDFA 4G9BA 3E8MA 1ZRNA 2FEAA 5AM0A 4I9GA 2ODAA 2IOHA 4QQFA 2C8KA 1N8NA 4Y2UA 1L7MA 2WF9A 2HX1A 4OD0A 4XOUA 3UM9A 2EATA 3MC1A 3W5BA 4UAVA 2FPSA 2GO7A 4UM7A 2YMPA 3BWVA 2I6XA 5AM1A 5AVVA 3FZQA 2I7DA 3QUCA 2HSZA 5AK5A 3ZU6A 3CNHA 3P96A 3AR3A 3AR9A 4BX2A 3L7YA 5ALKA 3L1VA 1CQZA 2ZXEA 5ALTA 3RF6A 2YMQA 2PR7A 4UU1A 1Z4IA 3U19A 4AP9A 2PQ0A 1XPJA 4UMDA 3U7GA 3B8EA 4CF5A 4KNVA 1Z88A 3EF0A 4IG4A 4XPZA 1NF2A 5ALZA 3KBBA 2Q4TA 3KD3A 2W43A 3OCYA 3A1CA 3WGVA 5AESA 5IS2A 2NYVA 1Z4MA 3KC2A 4Y2JA 2G1AA 1RKQA 4DW8A 3OCZA 3U26A 1SWWA 1VJRA 1L7PA 1Z4KA 2WF7A 4GXTA 3W5CA 2P9JA 3N1UA 3VAYA 4YGYA 3UMCA 5AW0A 2QYHA 2FDRA 5AW2A 5AKLA 3W5DA 3UMBA 5AVSA 1QH9A 3AR7A 4YH1A 3ESRA 4Y2PA 3KDPA 3OTQA 3PCTA 4NAVA 2EARA 1U2SA 1RRCA 5AIAA 1ZS9A 4BNDA 3ESQA 5AW3A 1Z4NA 3E84A 2P69A 3MPOA 2AGVA 1RLTA 1RMQA 1Z4LA 2YY6A 4UM5A 2I33A 2AMYA 4AS3A 1WR8A 3S6JA 3WKCA 4BX0A 4ZEWA 2ZBFA 3M1YA 4RETA 3SMVA 4DFDA 5AM5A 1MH9A 3WKDA 4L57A 4UMVA 3WKAA 3QU4A 5AVWA 3U13A 2YJ3A 3NASA 3PDWA 5AW7A 5ALDA 4QJBA 2O9JA 2B0CA 3N5KA 2OYCA 3NANA 1RLMA 3AR6A 1LVHA 1O08A 1WPGA 3ZWDA 4EEKA 3DDHA 1RQLA 1QYIA 2OM6A 5AKYA 4FYPA 3B9BA 3ONNA 3WK9A 3R4CA 2BDUA 2HHLA 4C4TA 3SHQA 4NV0A 1U02A 4HGQA 5T41A 3WK5A 2YFYA 2HO4A 2C88A 5ALVA 1J97A 2R8ZA 5ALLA 5AK3A 5AVXA 4UMFA 1J8DA 3DV9A 3I1YA 2IOFK 5AIBA 3BA6A 2G08A 3N8GA 4BYGA 4KX3A 1ZD5A 2G06A 3E58A 4BX3A 1Z5GA 2YMMA 1IWOA 2JGAA 3QU5A 4OCZA 2DQSA
chains in the Genus database with same CATH superfamily
4EY7A 4J3JA 5DI3B 5LJIA 1Z74A 3ONFA 4ZGBA 4J16C 1TIKA 1ZGCA 4J0CA 1D9DA 1UZMA 5TZVA 2ZJ5A 1QE5A 2AXTU 3PC6A 5JZSA 4V03A 4LWQA 4KP7A 2JFFA 2QMOA 5H80A 5CDSA 2OEHA 2X0KA 3AJ9A 1TOAA 3VVCA 2KN7A 1KGSA 1TA4A 3ZE0B 4BO8A 4O8CA 2GHIA 4YQFA 3WRYC 4C08A 4BFTA 4FOLA 1DXSA 4CQMB 3ANSA 3RJGA 1LPMA 3VKHA 5DISB 3KHKA 1Z33A 2HPAA 4JUBA 1IG0A 1E2UA 1XOIA 3C2LA 3CPJB 4B8ZA 4KACA 1P4AA 3LPAA 4HWRA 4L9RA 1QHSA 5AWFC 5LWHA 4B9AA 1DKRA 4ZDWA 4QEKA 1FPQA 2NQ2C 3QUQA 3E5MA 1KFDA 3QVWA 2O19A 1C0PA 2Q0SA 1NF9A 2VP6A 1J56A 3WGOA 1UPTA 3BIFA 3E9RA 3EWAA 4GIBA 2BZFA 3I23A 3DVAB 3MFQA 2JGMA 4K4HA 5I8WA 2I6UA 2UU9B 1G7TA 3H19A 3CLTC 1DOHA 2WOOA 3IUSA 1E9DA 3IAM6 3HJGA 2VK2A 4KAJA 2N47A 3LCCA 3P0HA 4EEYA 3KV3O 4UNSA 3TD2A 1Y63A 4NLBA 9ICIA 1JECA 4Z7QB 3P2YA 2WIDA 4L5CA 1N8KA 2DWUA 1ZWKA 4EG8A 1XN1A 1UOEA 2BSXA 1PDWA 1W88A 2Q5LA 5JCXA 4AYXA 2FWPA 1M2FA 3WAKA 4CT0A 5DHFA 2D0OB 4BUGA 1DRGA 3PFCA 1VLMA 3UC5A 5IT9A 1E1NA 3JQFC 1UJBA 1CG6A 1JW9B 2F1KA 4B7CA 2FUG1 4U0KA 4PCUA 1WMBA 2UV8A 2A9OA 5CG1A 4BWGA 3KQYA 3DQZA 2BGLA 2J87A 1WQ1R 3PTLA 1QFMA 3WV5A 4DYHA 4L4ZA 5AW5A 1E0DA 4R7GA 2H18A 5IH7A 1V5WA 2YIVX 4RMHA 4XUGB 1ZYUA 2LIPA 3FAZA 1EX6A 2G40A 1Q0ZA 1I24A 2HZ7A 1C3OA 2RGCA 2NU9B 4IIFA 4IZ6A 4H59A 1KVRA 3JQ7A 3NIWA 5ELLA 3A9RA 3WHKA 4R4JA 2NYUA 3HVUA 3MJ4A 4RUCA 2VHXA 2ZIWB 1VMAA 5D7NA 4RTJA 3SFTA 5B6PA 4U8GA 3K0EA 2GM9A 4TQSA 3BM5A 3A7DA 3FWPA 2IP1A 4J9PA 3R9IA 5JZOA 4W63A 2A94A 3BKWA 4A7PA 1WPRA 3JYOA 5AHOA 1NN3A 1Q7RA 1YGPA 1WBDA 2J9FA 5JO9A 4KQ9A 6PFKA 4P5PA 5LNK1 4ZI7B 3KLNA 2I65A 5F3WB 3U3RA 4MKGA 3DDOA 1S0VA 4Q3OA 3GFSA 2AI1A 1BCRA 3HUUA 3TE6A 4AJIA 3VBCA 3FSRA 3BJZA 2H59A 1ZS9A 3BPSA 5CRIA 7MDHA 2PUGA 1BXZA 4ALNA 4XGKA 5FTMA 4OQZA 5J2EA 3ZHQA 4KO4S 4TSFD 2IZ7A 3SMVA 3TLBA 1LX7A 1DLJA 2VJYA 3VVMA 2FG6C 3L4KA 1LVHA 4EEKA 3S1SA 3OU2A 2QRNA 1T2FA 1B74A 4MI3A 1WXIA 4R8UA 2AC7A 2RHHA 3ELUA 2QTTA 3M0EA 3VR5A 4KUGA 3MJVA 4UFPA 1CUAA 1QTNA 2QPLA 3EUB2 1O8BA 2JGAA 4R54A 2PIAA 5LDHA 4TZ6A 4ARCA 2V03A 2VF7A 2BQRA 4LVUA 4R8MA 3U4GA 1L4YA 4UNRA 5T6BA 3OZCA 3LNTA 4N7MA 2FPLA 4HWPA 1PZXA 1I4DD 5KYKA 1YBAA 3UXYA 2WM2A 2HN9A 1PCXA 4Y6SA 3DLCA 4IBOA 3DS8A 5KKNB 4R2LA 3E9EA 5C5IA 1NJSA 4OYYA 3WAJA 5DHUA 4DSJA 2CBXA 2Z3WA 4BO9A 3QFFA 2GUGA 1YCFA 3EA5A 2V7EA 4PL1A 4FEYA 2B9VA 2Q1XA 3TQFA 1PF7E 4RNNA 4EJSB 3JATA 4HDMA 4J6EA 1T9CA 5FADA 1ISGA 5HZHA 1P1CA 3IE0A 3ZCTA 1E3TA 1ORTA 1WB6A 5NULA 3ZHUA 5G41A 3CF0A 4R1UA 2QR2A 3OP1A 1KEKA 3Q6MA 4HLUA 1KI1A 1JI3A 4JLNA 3U4AA 1EM8B 1HWYA 2F7SA 3MWDB 3RRJA 2C31A 3IEUA 4DLBA 3TW4A 3V3KA 2OP1A 3AEYA 2GRUA 5B58T 3B2QA 3KKPA 2GI4A 4C2UA 2R1TA 3X2SA 2WJPA 1YACA 1QQ6A 1R1DA 3KB2A 5IM5A 2QMQA 1UDXA 3RIEA 4BEJA 2X3FA 3FN4A 3HBAA 5H4HA 4WXEA 1EINA 4Q0MA 2EH9A 1FS6A 5B4VA 3SWWA 1HEYA 1P8JA 3U4DA 4KAFA 4F0JA 4PLTA 2FFAA 4ZZ1A 3Q8WA 3AG5A 2OOSA 4EF6A 4EQ6B 4YFKA 3RCBA 1PN3A 4P0PB 4JA2A 2ODGA 4HMQA 5K8UA 8OHMA 2JDIA 1XWLA 4FZNA 5A7FA 3GPBA 4F4ZA 1OH5A 2D00A 3A4LA 4RYDA 2P9TA 2I1VB 2P91A 5EWGA 3UWDA 4AP6A 1M3SA 5I7AA 5G1NA 3VTAA 3IPRA 3HUFA 9ATCA 1O95A 3DWIA 2HBZA 2FX2A 3LLCA 3SMQA 4XWAA 5K0FA 1N2HA 2PH3A 1UBOS 1YJAA 3SZMA 4OQ4A 4C22A 4HPWA 4L5JA 4RZQA 1E2KA 3E8SA 4YCLA 1OTYA 2X23A 5SICE 1NXWA 5DNDA 1XQVA 4C0XA 2CHEA 1XZQA 3ODPA 5E4JA 3FXAA 3GLGE 3VA7A 2JFYA 4ALKA 4DLYA 1Z5WA 2N46A 2NNLD 1WUDA 4RGBA 4TUYF 1YS7A 2QTAA 1JH9A 1E1LA 1OHHD 3KYDA 3SHFA 3U9LA 4R68A 3CUVA 1QAMA 2KHZA 4UBOA 2IXAA 3V7UA 4RIIA 3NGMA 4JP2A 3ZU6A 4WINA 3I37X 2B4KA 3ENNA 3QX3A 4G2NA 1SBYA 3OPYI 2BBOA 2VOJA 1M34E 2C4MA 2Q4TA 4NXZA 3WOVA 4CLHA 2H16A 2FFQA 1CY6A 1MAUA 3AGPA 2LDXA 2Q5IA 5CJ7A 4MQ4A 3S0JA 2GPBA 3LJKA 3ETLA 2O05A 2EP7A 4YRAA 4Q4LA 5HCUA 1KI7A 2VF8A 4TV9F 1AUVA 3TDKA 1YE8A 2E87A 3ZGOA 1XQ1A 4G5FA 3IMKA 2IH4A 1JBKA 2V7TA 2CDNA 1MPTA 1KP3A 3QX9A 1RXCA 2LM4A 3M33A 1YK1A 2BHRA 1HF3A 3DP7A 4ZT5A 5CFLA 1G21E 3ZXXA 1FYVA 1CR0A 2XB9A 3IP3A 3PJGA 2HO4A 5ALVA 3B8HA 1VL2A 1EH5A 1SKAA 1M7BA 1YUBA 2W6IA 1NJYA 1LLUA 4EI7A 1UKCA 2QUZA 3TEMA 3RB8A 1OB5A 1I2DA 3HYTA 4TWBA 4N39A 1G6KA 1VL0A 3CE9A 8ICJA 2NU7A 4KOAA 3NVYA 2P67A 1XA4A 1XLTC 3QVKA 3SXUA 2OAQ1 2JLWA 4F50A 5LLDA 1TU0A 3EYZA 5DK4A 2EX0A 4B1FA 4HDOB 3LVVA 1PYGA 4FM9A 4O4HA 4ZPXA 2BY4A 1BDJA 3CRQA 1U6IA 1E66A 5FPYA 2RHLA 1NN1A 1W4BA 4MV9A 5FULA 3K4HA 1G5QA 3TTTA 1GKKA 2FNAA 2YJ4A 5HIAA 3V8VA 1B00A 5E4TA 4MNTA 4WKPA 4YHBA 5J2CA 3T7JA 4IKOA 2QP4A 3C7TA 4J76A 1RHMA 3SOPA 3R7AA 1JDZA 1UXGA 1TKAA 4TS1A 4EHLA 4IHQA 1NW4A 4HX2A 1YR2A 4DXHA 2YHUA 5ALSA 1ZETA 5B1EA 5CUQA 5HZMA 2ENWA 3MLBA 1U8UA 4QWWA 2I2CA 4PGMA 2OUIA 1P4JA 3CSDA 1KJWA 1QHEA 1L5NA 2GD0A 3OF3A 3QLUA 5ANRB 1SBCA 3CGGA 4MARA 1FVOA 2EWWA 1DX6A 3DNPA 4FDUA 2ZI6A 5AVTA 3J80A 4Y6RA 3JRXA 5JNVA 1KYQA 1OH8A 1DQRA 4HFJA 4F1WA 5HX7A 4QT4A 3HR4A 1PFWA 4QYSA 2HPZA 4JVMA 5CX4A 1A7AA 5CDFA 4QWDA 3ZK9A 1FUUA 2W8BA 2JRCA 1ZQ1C 1KK0A 2QRJA 1UOQA 5T57A 1L4BA 1EFKA 1AQLA 3ASUA 1MVLA 3GLGB 2QYSA 3BXHA 3FA2A 4M1QA 5JT1A 4LRXA 2XODA 1C8LA 1XZHA 3CR7A 1SBIA 4KH1A 3IMEA 2NP7A 3RO7A 5JH7A 4MGEA 5ALPA 3DLAA 2FOXA 2BEKA 7REQB 3B3FA 1Q0UA 2P5YA 4LE0A 1CZNA 3GGOA 1D6NA 1P45A 4ER0A 5IDVA 1M34B 4BAGA 1UXOA 4CDNA 2P8JA 2WP8J 4P35A 1JT9A 3FHTA 1NK6A 3HRDD 3SBDA 3OVMA 3H2KA 2RHFA 1WX1A 4MW9A 1TEZA 5L1JA 1BMTA 3Q5DA 2B30A 4XQEA 5UKDA 1XJ0A 4DADA 4GH5A 2IZ1A 2QRVA 5CNJA 5BR7A 2BM1A 2IIPA 2YOGA 2FSFA 3JVDA 2FSSA 3D6FA 4K8OA 4JH0A 3V1MA 2YTUA 5G3YA 4MDFA 2B3DA 4QDJA 3B1ZA 2J6IA 2MRLA 1TXGA 4ED2A 5HW0A 3DYIA 2VKTA 4CT4B 3FPAA 4EI2A 1KYWA 4IVNA 1T5IA 4GO1A 3UM9A 2FLKA 2W2OA 2YJGA 2FPSA 4X62B 1JDBB 1ZEMA 5BUCA 1FYEA 4L5IA 2QTRA 2D6FC 4RFSB 3IDZA 3HDVA 1VPTA 4CLXA 3WLAA 1KQGA 3W3AH 4YMWA 1CNFA 1PBNA 1W5TA 5A4KA 3UMCA 4UM8B 3VR4H 4W5RA 2EFEB 4F11A 2HU2A 2J48A 2VTBB 3L6EA 1ZIXA 4OEHA 3INTA 2Y6UA 2XMCA 4LMRA 3H4MA 1N2EA 4MEAA 5JD6A 2DT8A 1KEPA 4XCXA 1CE8A 4UOEA 1Y7LA 2XNHA 3E70C 2K89A 4JQOA 2AHOB 2DHCA 2P9BA 1Z13A 3H8SA 1GOTA 5CW1A 2F8TA 1ECWA 4NOLA 3WZ2A 3OZXA 2VYQA 3PLAE 3KE9A 4O4HF 4JQSA 1SMKA 3EH1A 1Z17A 3ETJA 1BN7A 4RTPA 3TMAA 4DF3A 5ALLA 3CXRA 4RC9A 4FQ8A 5G3ZA 1A8IA 2V7XA 3KOYA 4XLLA 2OLKA 3X2FA 1V7ZA 4P98A 2BL4A 1RHRA 4ON9A 5ADHA 4YRFA 3RUHA 1RD4A 5KI6A 3AF4A 1W8IA 5J23A 1J22A 2QMYA 3O91A 2QDKA 3KZ1E 4PFJA 1ODKA 1TTHA 4ARZB 3V4LA 5AI4A 3FCCA 1MHTA 5J0RA 1DHRA 4NCBA 4Q7LA 2IOFA 4EYOA 2ZXHA 1O54A 1NT4A 4NNJA 4N6GA 2I4LA 4JUAA 2VHEA 1Y8RB 2FB9A 3GNSA 4Y0AA 1YVUA 1W4RA 2CDAA 1AS0A 3UBTA 3ASYA 4CLRA 4BNNA 1U48A 1BXRA 4TMFA 1MB4A 1C4KA 2Z6AA 3KYCB 3X1WA 2FVYA 2C28A 1AROP 3CONA 1GQOA 3UY4A 1RZVA 4YI3A 2OQVA 5HK8A 3C6YA 3NCHA 1QRRA 3TQ1A 2ZYAA 4RTKA 1T8UA 3FUTA 4MB0A 1H66A 1Q1GA 1DAFA 3RYCA 4JQCA 2DJIA 4ER6A 4D9IA 1JMSA 5E9QA 1WEKA 5JH7F 1UQVA 1JVNA 5KEIA 4QUEA 2O2SA 1O9HA 1TT5A 1SUFA 3IG5A 3BEDA 4BGUA 4UE2A 1CZLA 3DB2A 1UAGA 3KJZA 2OA0A 1Z16A 5CYFA 4ZODA 1E3JA 4DLPA 2ORVA 2Q8PA 4LMBA 3ZZNA 3GD7A 1KLNA 8ICWA 1VKNA 1Z08A 1PWXA 2CWDA 2ZRIA 3IEIA 1SL0A 3F7OA 3HI6A 2GRJA 5BSWA 2J6SA 4R6XA 1NBIA 1QG0A 3M8KA 3G0GA 4DLAA 3GHHA 3ROTA 2OZKA 4YO8A 2FQXA 4OH7A 4XI9A 1KY4A 3TGLA 1E6UA 1KXJA 4K4IA 3FDZB 4HZUA 1I14A 5CLHA 1IOLA 1OLUA 2NVUB 1T3GA 3SEAA 1N6KA 2GXSA 3OGUA 4DR3B 1Z07A 3D1VA 1AH2A 1BH6A 4QQRA 2R9VA 5GIPE 3JWHA 3IIIA 4GQAA 1JTVA 4TL8A 4I14A 4RLQA 2DYKA 3EWIA 4AZTA 3L0CA 5I6DA 3UK1A 1DBIA 4QECA 3H2JA 3KLPX 4EYSA 4LYGA 2CLCX 5CFPA 3IKVA 4A0GA 4RZHA 3W04A 5KNDD 3H5IA 7ICIA 2DGZA 2QRQA 1XIVA 3AY3A 4WHMA 1J2EA 1G1MA 1FP4A 3IQDB 5BW5A 4OQYA 4DRXA 3EWSA 1P7CA 1XZCA 3ZWAA 2VUIB 4BMPB 2ON6A 1U65A 4ZVUA 1RM4A 2BJHA 1QWOA 4X94A 3WO1A 5CIWA 3P9IA 2G76A 2BGUA 3H8MA 3EC2A 4J7AA 4G41A 1ZGZA 1E5LA 5LA6A 2QE7A 1X92A 2W6ZA 3S2UA 3H9QA 5TMDA 2C3YA 5B5EU 3MT0A 3K92A 1WDMA 3HJFA 1RJFA 5DEIA 2BPGA 2HKIA 4UBJA 1JEAA 5LQJA 1XVTA 3ZBTA 4DG5A 3NBAA 4UQGA 5IKPA 4GF5A 4RV4A 4DW8A 1YWGO 3FSJX 3NYRA 2C5HA 1M5UA 1KNQA 4EB6B 2DLNA 4LVCA 1MA7A 2DUUA 4ZO7A 3OTQA 2BD0A 4XIIA 4C8MA 3D0QA 2XCSB 1E6WA 1D6SA 5K0JA 4RNCA 1HDYA 4NAHA 3LCMA 2NXEA 1Y9AA 1KEEB 1VE5A 5EY5B 2DPGA 3D4PA 5E6SA 4U7PB 1WXDA 2D5CA 3M6AA 1ZQFA 5AUQA 1K6EA 4H3HB 2OLJA 3MCTA 5A9SA 3WB0A 1ZQJA 2HRBA 3A7EA 3ZU4A 4BQFA 2WBLC 4DIOA 3P4UA 2GEFA 2AL7A 5JNUA 3EB9A 2VDRB 1ORRA 4JDUA 3FFWA 3VR6H 5JSFA 4H7HA 2PX6A 3KR0A 3OU7A 2B5WA 3O92A 3JPPA 1UP6A 3KZKA 3EHEA 4BCBA 2PI5A 1LRLA 2NW6A 2PGOA 3A70A 4UCXA 5H3LA 1DWOA 2BCVA 5CDTA 4ACAA 3RVDA 3RV4A 1LPPA 3SQIA 2RGEA 4BNFA 4RHYA 3T9BA 1SXJA 4UAZA 1PUJA 1B26A 4A8JA 4OJPA 1SOAA 4B6SA 3GJTA 3IT0A 3HY4A 3IA7A 1KF0A 3RLFA 1WCYA 2I54A 2O8DA 3E0QA 3BHMA 4Q4JA 3GGDA 1W52X 1DELA 1F0KA 1V8PA 1YA6A 4OOEA 5FPTA 1Y6FA 3D8BA 1U5CA 2VP5A 5DNCA 5BUZA 3UAYA 4HN4B 1L7RA 4U1RA 1AF7A 3HEAA 4FR2A 2RGRA 3O8BA 1H2RS 1QFXA 3IMCA 2NSYA 1GGEA 2GJKA 1KZGB 5TC4A 4TURA 5DEOA 2EOAA 5FBHA 3TTUA 3KL4A 3N97B 5AHWA 4I50A 4GBJA 2VRWA 4Q3BA 2X0JA 4QC2A 3MNFA 3MINA 1DK2A 2XGJA 1KL7A 8ICBA 3PKIA 3VPGA 1AZTA 3CLUC 5KYUB 2XMRA 4P4LA 2ID7A 1U8TA 1XDSA 4ID3A 2O3JA 2B8NA 2AH5A 3L9WA 3AL0C 4C0BA 3G2QA 5AW4A 5IANA 1BIFA 1DTEA 1ZITA 4WK0B 3T5DA 4QU5A 4PWZA 3N2NA 4V0OA 4BNYA 3E23A 4ZQHA 4P4NA 1CUZA 1NQXA 1SQ5A 1HLGA 5FPHA 2ZT7A 4YG2A 1XZDA 1X1DA 1G1AA 3HR8A 1YXMA 2ZTMA 4CM4B 1CEQA 3R2JA 3KELA 2VK4A 1ID8A 2GEJA 4DNXA 1DKQA 3EASA 1JNXX 2X6QA 3NWPA 3U5ZB 1UC9A 4J6FA 3A2MA 4RQUA 3CH5A 2Z6VA 1ZKDA 4BVAA 1I3KA 2GESA 3OM1A 1YCHA 1PJ4A 1QHXA 3ECSA 3V4ZA 4KFTA 2PQ2A 1NJ5A 3C3EA 1ZNYA 1EFRA 4X3PA 2RJOA 3Q6IA 4WT7A 3X1YA 5EGNA 5GPBA 1GRCA 1E1YA 4WDQA 5MFPA 3HXKA 4LKRA 3CURA 4TTRA 3I5MA 4DIEA 3WNCA 1THTA 3GN2A 4KJXA 1JDTA 4DSUA 3QFTA 2MR5A 1MV8A 1G20A 3H2SA 3WQBA 4DDVA 5JTUA 4TS3A 3IAAA 4W9MC 2GR9A 4U63A 1BKYA 1Y9DA 1D2MA 2YHIB 3T8YA 1IEXA 4MV5A 1KPGA 4C2BA 1ZOIA 2R5WA 1UCFA 2W90A 1TUBA 3HZRA 2I8CA 5DYTA 2ZATA 1B8OA 4RD1A 1WMSA 4B0PA 4UAWA 3OQIB 3ICCA 1SZCA 3EIFA 1DRWA 2VQDA 4O2BA 1U0LA 4U39A 5CFNA 2A5DA 4LEIA 3CLRC 3DZBA 2A3VA 1AB5A 2XA1A 2GN9A 4BBAA 2ZIEA 3MTEA 4M9LA 4HJRA 5LOVA 4YN4A 4NQRA 5ICMA 5LPNA 3WAGA 3HKDB 2BM9A 2YS7A 2GPYA 4H1UA 1Q74A 4Z4IA 1UXKA 3GEHA 4TSKA 2Y1GA 1VGQA 2GNOA 1CRWG 1JHZA 3EFBA 1NNUA 1KRHA 4G9GA 3Q3JB 5A2QA 3V4SA 3WK5A 1MC4A 3O8RA 5HKOA 2O3QA 1U0SY 5L3SA 4BGDA 1L4MA 4W5QA 2VS1A 4TXHA 4IMIB 3GLQA 4RKYA 4Y1FA 1EDZA 4F4WA 3KOUA 4ED9A 1T36B 1H2ZA 2HJRA 3EBPA 1U7DA 2ODQA 4F86A 4HLDA 3GJ6A 4HGPA 1U3CA 5AUNB 3R76A 2MUTA 1RZ3A 2C97A 3IODA 4KPUA 4EJFA 2E21A 4NCKA 3TWOA 4UARA 1VLVA 1JR3E 2R751 4HFMA 4QSHA 1K68A 4LAFA 5AJVB 2J7PD 4K7JA 5BOSA 1YMVA 5B4UA 1YOVA 5KT5A 2F8SA 4QODA 3JQGB 1YJBA 3FNFA 2BM8A 8ICGA 3TS1A 4I50F 4XWYA 4GPTA 3KJGA 4RQNA 3I76A 4LW8A 5L45A 3WHLA 3C21A 2ZAOA 3IIEA 2I2WA 1KFJB 4MVJA 2OHFA 4ATNA 2J9RA 3C3XA 2IKSA 4AQDA 2IYEA 3HDGA 2FZ4A 4AF6A 3VH3A 4WK4B 4G56A 1CY7A 4JI8B 2Z2JA 3TG8A 4PGXA 3SF0A 4Y9RA 4RF2A 4NLGA 2EBWA 4IO1A 4R65A 2UVUA 5EJGA 3I9V6 3LK7A 3X1MA 3ED5A 1X9XA 3BL8A 4ZU3A 1K7XB 2BMAA 1DJLA 1OW5A 4Z1MD 4ZO9A 3QWBA 9ICMA 2DKNA 1IYZA 2CPRA 3BIOA 4QFBA 4D81A 2W6MA 3LUPA 4NOJA 2F3TA 4RGYA 1XJWA 3THVA 4G5RA 1WETA 4PONA 3FE2A 1XJ5A 5CWRA 4AKSA 4ZAVA 1NMEA 1N2ZA 1Y1LA 5I4BA 4OHZA 5C52B 1L7NA 5C35A 4PQGA 1O96B 4Q6WA 4FBLA 3DBLB 4F93B 3ISTA 4TTVA 2DOKA 1ZD8A 4REMA 1T26A 3FTCA 4EKGA 3WC4A 4U6NA 3L8YA 1IIPA 3EFOA 1N6RA 3JVEA 3L93A 1NNLA 1H3EA 2UZ1A 3V33A 4G5GA 4M1WA 4BEVA 1K8RA 4F2GA 2FFJA 3H8JA 4BZXA 1K89A 3AYZB 4WRRA 4D8WA 2CF6A 3LSYA 2R1UA 1YI0A 2QRKA 2JZCA 5ALJA 2R11A 1JGTA 4O3FA 3VNVA 5LUBA 3VU1A 3FRHA 1MIHA 1G8AA 4XJXA 3NRJA 4M9UA 4R41A 1P4HA 1YVRA 2BPFA 3DJFA 5C53B 1ZOPA 3FOEC 4N8EA 5JYEA 1POXA 2Z9BA 3QE9Y 3TE7A 2KK0A 3ANLA 3GDXA 2P5UA 1Z22A 4QRHA 2WMNB 2WR8A 3TJZA 4G0ZA 2AG5A 1O0SA 3ESAA 4PNEA 2QJOA 2IY8A 3NHJA 3CHYA 4FZMA 1KDYA 4JYAB 3QZ8A 4MWCA 4GAEA 1BQ3A 4ZYVA 3EH2A 2ENUA 4FOTA 1A0PA 4Y30A 2JGRA 3H83A 5DX8A 1T2NA 1O0BA 3ZJ4A 2CL6X 3OTWA 4BQQA 5AOVA 1AKUA 5CB4F 1OTHA 4V0LA 2WW8A 1JQJC 4ETNA 4CIDA 2CXXA 4FYXA 4QD3A 3B12A 2FP4B 3IBSA 2I7DA 1JTEA 4ZTUB 4B4VA 3L7YA 1DQPA 2YFKA 1PUIA 2ZXUA 5C4IA 2RDMA 1WABA 5K0GA 1MTOA 4H17A 4OGKA 5I7UA 3ZNNA 2X0NA 1QKIA 1OX4A 1PV1A 2DP4E 5C0OE 3FZYA 5FO0A 3S8YA 4F9EA 4TYYA 2ZTCA 3KHUA 2C04A 1NJ2A 2EARA 1VM6A 1U1GA 4Q43A 1XTRA 4TZTA 2C3PA 4A0FA 2O59A 4V38A 3IIJA 2MYNA 1IUKA 1GNTA 1XNGA 4C6TA 2AF3C 1LKYA 1HMPA 2BC9A 3BK2A 3U13A 4AY6A 2W9BA 1E7RA 4LBVA 5CFRA 1PR9A 4PLHA 5BN1A 4N01A 1LJLA 4OUDB 4OJ6A 4A36A 3CLSC 1JR4A 3LDFA 3JQPA 3OOWA 4PGQA 4XSGA 3D1LA 3TI0A 2P65A 2C42A 5KX5B 3CWZA 2GN0A 3I32A 4E88A 2GMWA 5ILOA 2AC2A 3LXXA 2VJCA 4E1BA 3E5HA 2PLAA 2F2TA 3HM9A 3VYRB 5GTDA 1FFAA 4YMTA 4MYDA 1KBUA 4LTNA 2IV3A 4AICA 1E5VA 3FOAA 1K06A 1O9GA 1PK1B 1AB6A 4J9KA 1M6YA 1L5ZA 1Q3UA 1ZQDA 1L7BA 3ZZTA 2NU8A 2PAFA 3IJ5A 2H4JA 4NJ8A 3UMVA 5JBNA 4KKVA 3OLXA 1L8LA 1P18A 3N2YA 2BKLA 3F5FA 5CB8A 3IEXA 3T3NA 2RHMA 4C0LA 3K9GA 3GJ8A 2HIAA 3LWDA 5JS6A 1I1NA 2O52A 2R65A 3EXHC 4F4KA 3QH4A 1L3UA 5KFTA 2ZYDA 4K40A 5JCOA 3JWPA 1KIFA 3UJPA 3H05A 1ZMBA 3TARA 4PZZA 1GO2A 1NC3A 1HDIA 1JQLB 2DTEA 4RWEA 3WGHA 4M1KA 1VTKA 1GDTA 2AFHE 1SKUA 2TRSB 1WQ4A 4N54A 3EXIA 3ZCRA 2FZWA 3UGTA 1ECCA 1NJXA 1N78A 3LUAA 2AUNA 2I6FA 4BN4A 4FMCF 4HRYA 1P2BA 4S1NA 3BAZA 3LA8A 2A19A 3EQ6A 1GPWB 2WDZA 2MA1A 4MJ3A 1ZRMA 2AFVA 4C0SA 3MTGA 4J43A 1NNEA 1GT91 1NVVR 2P5TB 4Y6OA 2VDNB 3IXQA 4TMWA 2WAQC 3G82C 3FYUA 1VI5A 1E8MA 3N2GA 4MQFB 3EGXB 4ZVLA 1AM4D 2P4EA 4FGZA 4Y2YA 3G13A 1RPNA 2AZXA 4E13A 5GONA 3HG7A 3Q8LA 4D8YA 3F4LA 3FGPA 3RC7A 1NL3A 4GZ6A 2R8OA 1IZ0A 1T9GS 5A5FA 3OPVA 5HF5A 5CXQA 2V58A 1DGJA 4R1MA 1OBVA 3DF9A 3TO5A 1FBNA 4WPGA 4M49A 3SEIA 5DBFA 4ZJUA 3SBEA 3B1FA 1GFSA 1USKA 3KFXA 5CFMA 2LWIA 4GUDA 3MUFA 3KVOA 2I9PA 3NJ8A 2L19A 3OSZA 1ORHA 7ICFA 4MFAA 3TZHA 2J45A 1RRVA 2QTBA 3NWOA 4K81B 2YUIA 4GXQA 4GMXA 3DHWC 4MHSA 3EPGA 4YCDA 1E6MA 4YJKA 1I4WA 1WDLA 1X1CA 5L6MB 4L9AA 1J0XO 1CRPA 1CFJA 4PG5A 5MN5A 3PSFA 1Q2XA 5DLEA 1OE0A 3K9QO 3F2DA 1U2GA 3BZBA 1X8JA 1K6JA 1TK9A 4KO2S 2X9GA 3AEUA 4KODA 4EI9A 5GVSA 4BJ1A 3S68A 4DXAA 1DJQA 4DEYA 3TCKA 3KKOA 3PFKA 2WU3A 3KZMA 1YQTA 3PUZA 1QDLB 5D3QA 4HVLA 2LI6A 3AY0A 4G1BA 4TKUB 1NVVQ 3HI4A 3PX3A 3OJXA 3H9CA 4DNOA 4AJJA 4TSFA 3LF1A 4WJLA 4BWJA 3QPUA 2DERA 4RQMA 1JQKA 4ZAGA 5BSVA 3EF0A 4BVKA 1GCGA 4XARA 5B55A 4KMOB 3PWTA 5CHYA 2AOXA 4G26A 3HB1A 3RT7A 4IZIA 1AU9A 3EQ8A 2P9JA 2XRMA 2ZKLA 1JHUA 3RFVA 1XV5A 3SLGA 3FBTA 1U8CB 4GYYA 5T3UA 3KQLA 2C82A 1U2SA 3HBJA 4ASUD 4DC1A 1V39A 1PK3A 5JW6A 4PEVA 1JN3A 4CF6A 1XCLA 4EMUA 3JQAB 4XTCS 1GA4A 5LXTB 5F64A 4B4KA 1B1CA 4QEZA 3CB2A 1EJ6A 1OFVA 2AD1A 1AXRA 1P4SA 2N75A 4HB3A 4XD2A 5EJ5A 2AFHB 2Q0ZX 3EF3A 4AMUA 1U5BB 2QSUA 2Y1OA 3UCFA 1SUSA 4JXJA 5IDWA 2C2ZA 3SS9X 2JATA 3WKBA 5AVZA 1KL9A 3LBYA 3CKYA 3MIZA 3CV3A 4QLAA 1BGVA 2FE1A 3CEHA 2F3NA 4A8HA 2Q0XA 4N03A 5JY1A 3P9KA 1CVRA 1OFIA 2GFHA 1VCNA 1NJGA 2BGJA 3WLKX 1F06A 5LMZA 1EAYA 2VQ6A 4M0AA 1O94C 1IK6A 4ZZ0A 3GFVA 3O9MA 2FLLA 2E8PA 3KCQA 1J23A 4HGNA 3OCWA 1I33A 3FWZA 3GZ4A 3M2TA 2A0KA 1T8RA 4C0ZA 1OIWA 3A9VA 1T9KA 1SQ6A 5FNVB 1Z37A 3N07A 5GM2A 5TY0A 4AUKA 3UXEA 2PX3A 4KIUA 3WLEA 3OKPA 1DOQA 2R8YA 3KOZA 1A5BB 3FHLA 5BW8A 4MP6A 3VUFA 2ZM6B 1ATZA 2BW0A 3FCEA 2PZJA 3LFTA 4RY8A 3G02A 5SYAA 5GONF 2VHVA 4JI4B 2D0PB 1TVEA 1J2MA 1O9BA 5I51A 2RCNA 1Y82A 1H6DA 1QFJA 5DGDA 4DCVA 4PN3A 4GOND 3HLKA 4GMKA 1L4UA 1OD6A 1EQ2A 3GFKB 4CG1A 5CFQA 2V0CA 3B70A 1Q21A 5B12A 2KKVA 4BWYA 5E0KB 3NUZA 4NI5A 2OV3A 1WZ2A 3C8MA 1DKUA 1HC7A 1H2XA 1BD4A 4PC6A 3KWFA 2QLJA 2ZIUB 4YCMA 2JCYA 1H93A 2WF5A 3IP5A 4KDEA 5AK0A 2QTFA 1ZM7A 4UEQA 4UVDA 2FPWA 4GL4A 2BDEA 4MW2A 4GBGA 2H6EA 4HYEA 3L3BA 4K05A 3K70B 1RWVA 1UT5A 2AUTA 3RR7A 2P9GA 4MS4A 5IVPA 3TLMA 2AZDA 1V43A 4QYMA 4IOJA 4GI5A 3K75D 3B9RA 3PW7A 2DETA 5IM4A 5DGHA 4HGYA 5C18A 4DV6B 3PA6A 1KZ1A 1I2CA 4FFBA 1I4LD 2H17A 3VOBA 5CR0A 4GMFA 1WLYA 2IHVA 4FBMA 3UT0A 3A1EA 1A2KC 2DQ4A 2OWDA 5EXEA 3WNBA 4NPHA 4TUYA 1WMFA 1XGKA 3ISVA 2RB5A 4Z9AA 5DH9A 1LLFA 4DO9A 1NUUA 5TR9A 4BNIA 1E9CA 1LDMA 2B82A 2YB1A 2PEYA 5ALYA 3L05A 3FAKA 1YKFA 3TVTA 2MAXA 2ATEA 4FT2A 4TMZA 2JLSA 5JE8A 2IHKA 4KLOA 1A1VA 4PTZA 1QOQB 1F3LA 4GDFA 4G37A 4PSAA 2VZ8A 3WXMA 4BNXA 2VHZA 2JR5A 1XDDA 1J07A 4PR0A 4K9DA 3NNDA 1DPFA 3ICXA 5T8KC 3VPCA 1XKXA 1AHNA 2RKWA 3SV3A 4TV9A 3D6NB 1NUAA 1XQXA 2ODEA 4RQ7A 2Q2NA 3DV2A 2UXCB 3WGGA 2BTOA 5IILA 4MEBA 4Y2JA 4TWRA 3G0DA 3OWXA 4Q02A 5E7IA 2X0RA 3MTIA 3M5CA 5EE0A 1D3AA 1HE8B 4BWVA 5EHQA 1HLPA 5JG7A 1XQYA 1R64A 4I5GA 4OQDA 1Y81A 2AZ4A 1A9ZA 4CCHA 5KTMA 1WBBA 1KMIY 4BFWA 4AJEA 2FU5C 1PO7A 4AZVA 2XBLA 1Z5VA 2CLSA 4DFDA 3HC7A 5JXJA 4ZTBA 2F1RA 3NMUF 3KDAA 3RAGA 4NJEA 1NXQA 4BQPA 3T1QA 2JFWA 3KLOA 1D4AA 1MDFA 5IJZA 1JEQA 4KNYA 2J46A 4INJA 1JLLB 1D6JA 2PUHA 3IVCA 3TKLA 1D7AA 4JMPA 5IBPA 4LV6A 1XKQA 4CG3A 1X66A 1X7ZB 2GYVA 4HEA6 4JC4A 1EWRA 2YXNA 1CJCA 4PZ0A 4FMDF 3ZJ5A 4HDRB 3MK31 2BFEA 3RVRA 1O58A 1CT9A 1MX3A 5DXFA 5JLJA 2AMLA 4DLRA 4P38A 1EWYA 1EFPB 4NBTA 4TS9A 3D2CA 1RHUA 2H07A 4BKRA 4DSLA 5D00A 1ZHOA 3OBBA 3ESBA 5AVUA 1QOPB 4OK5A 4EY3A 3FDIA 3ZHOA 2YN0A 2WIGA 2YWGA 2AV6A 1EYZA 1F12A 4Y3UA 3A4NA 3TRFA 2W03A 4TTQA 3EG9B 1U8XX 3D2LA 1WV1A 3PHLA 4ZOEA 2V5VA 3V7LA 4NR0A 5HJEA 4KQ1A 4G5SA 4A6EA 2Q8QA 1X1QA 1M0TA 1YT5A 5LQDA 3K0FA 2H1HA 2RQ5A 1GPDG 5J63A 4F3TA 4E1AA 1FFUA 5JPCA 4PO9A 1DEOA 1QIFA 2FX3A 1G8YA 2HH9A 2RGNA 1A9XA 1SEPA 1JKMA 4OMDA 1C1DA 1Z8DA 2QU7A 1EXWA 5DB7A 4I1PA 4RNOA 3IO3A 1DQNA 2AJTA 1G4UR 1T10A 2Y67A 3GFBA 5IM4F 4RYLA 4CGZA 2PUEA 3KQUA 5J8YA 2IIVA 2H7VA 4HLNA 4FGKA 3QFHA 5FQNA 3IEMA 1YOBA 2PKYX 4HAWA 4LQCA 2W37A 1VJTA 4B45A 1AXEA 5AHXA 3ZWXA 1GADO 1Q22A 3P7MA 3W5HA 3RB0A 2O14A 4JBNA 1BRTA 1NTOA 8ICRA 2HDWA 2EEPA 4UUAA 3KHLA 3GGCA 4DLNA 4MJLA 2OXTA 1E9RA 2EAMA 3L1JA 2EDAA 3KSAC 1PVDA 1TM3E 4QOHA 3KSZO 1JWAB 3DL4A 2HLDD 3KOXA 5K4LA 1TM7E 5JMPA 1I0ZA 4MH0R 4KYUA 2BH2A 2RSLA 2AGPA 4BFCA 1Y6GA 3P5SA 5IASA 2J9ZB 1V5FA 4AAYA 4IDFA 4JK1A 1BQEA 2BTQB 1V5GA 2MSKA 3IEVA 1FLAA 5IMBA 4F6RB 4QM6A 3ZHZA 3DGEC 5I7SA 1N7GA 1Q15A 3WMWA 3DM5A 2WFAA 2A5JA 3CX7A 3Q5GA 7ICTA 4I2HA 3RS9A 1GNRA 4LYAA 5K3DA 2XITA 1PK8A 3U4QA 2BM0A 1HDEA 2ZUSA 5JUWA 1SKSA 2WVAA 2IHZA 3ZCPA 3DR5A 2B4AA 2NADA 4ENVA 4W82A 2G9VA 1TZBA 5J0WA 5K2MA 4F3RA 4B71A 4EJ0A 3OQNA 1ZJWA 3FMVA 4BUCA 4KK4A 3B3JA 3GA7A 1SR8A 1E77A 2NZJA 1C0KA 1C3VA 4WNYA 5JOQA 4D5EA 1DQZA 3ILYA 4HQ6A 2I91A 1RQRA 1XZGA 3ZJUA 3ZD9A 3ROQA 4IX9A 1FNBA 2P9CA 5LZ2A 3CNHA 1Q3TA 2IEIA 3GFPA 4DN6A 4XYBA 2ZRFA 3IHWA 1O8CA 3CC8A 4RKRA 5TIIA 2O8EA 3RIHA 2ZSFA 7ICEA 3L6CA 4WQMA 1JKFA 3W06A 5JHHB 3ITKA 3SAFA 3BIXA 1ITZA 2C59A 3JAKA 3GR6A 4KVFA 1OYOA 4X9XA 3OX3A 4ND7A 1E96A 3GCXA 5BY2A 2ZQZA 2OBFA 4KLQA 4RETA 3PFNA 3U3JA 4R71A 1XZ8A 1NJ8A 2FMKA 1GYPA 1P7DA 2HMAA 2QP3A 1X94A 1EE9A 1U9IC 5GINE 2J08A 5A0VA 1OQAA 3D3WA 4PR3A 1POWA 2ZCVA 1FOEB 5DN6D 3FX2A 3L6BA 3HKEA 3OE7D 2ZSBA 3BE4A 3AFGA 1UDBA 4KN4A 1NURA 1WCWA 1VMKA 3DE6X 3K2BA 3LVWA 2CCGA 2Q3DA 2ANCA 5JQWA 4K87A 4CQMD 5EXPA 4RESA 1QR6A 3EFEA 1FVHA 2I4OA 3WL3A 1UKAA 4X6LA 5G4KB 3SD7A 3FPEA 4DABA 2UUAB 1QH1A 1YZ7A 4UU0A 4HWGA 4QU0A 1OWLA 1FDRA 3RRGA 4KDFA 3ZGLA 5HE9A 3L2OB 2CT8A 2RDJA 5CP8A 1GLNA 3BQ7A 3VR2A 2EBHX 1SG6A 5CTAA 4L2IA 2I0FA 1E4EA 2WSLA 3EWNA 3N6XA 4JUIA 3L07A 4UBKA 3BWCA 3MDAA 1EUDB 4RW0A 3MUNA 2OMEA 1EDEA 3GVIA 1VBKA 1FZTA 3FNEA 2LE0A 2PX8A 3P2MA 4XM2A 1FW6A 2PS1A 4X20B 5IHXA 4ZWNA 5A6SA 3NXSA 5BSMA 1PD1A 2IUSA 1P80A 3B5JA 4U00A 3WYGA 4L75A 4FYKA 1KI9A 4DGSA 2PVSA 3A3PA 1W581 2F9FA 3DQQA 5KNCD 1P5FA 1A2BA 3ZE6A 3MJSA 4IYJA 4WA7A 5JMTA 1ECJA 2Y71A 4PGAA 2PKWA 3SJAA 3AI3A 4AIIA 3PQ5A 3GRKA 3FNBA 2G36A 4RWZA 3B13B 2FW9A 3UUWA 4G89A 3CGWA 4PHGA 1GARA 2PSHA 5B6IA 3OLZA 4Z3DA 1GPBA 1X0VA 1XF1A 2DH6A 3DKIA 2WQZA 4JK3A 2R00C 5I47A 2PMDA 4CL0A 5IKOA 4C4XA 2WHRA 3OZBA 3DBHA 2ZQ5A 3UA4A 3BAFA 1TCUA 4J0DA 1CIVA 4PG7A 4MWEA 2XIDA 2HF2A 1E5DA 3AIMA 4M0LA 5EI5A 2QVBA 4JP3A 3PP8A 2IXGA 1YQ9A 4RKFA 3QVUA 2R0QC 3HPOA 4ECEA 1L4LA 3AM3A 3GPLA 4DV4B 5C32A 2PZFA 2BRUA 3U6KA 4Z4HA 1PRYA 4I9NA 2PBRA 4FHGA 4I9FA 1TK0A 1CQXA 3WYCA 2NO9A 4Y2GA 4AKEA 1IAVA 4QM7A 2GZMA 3I8SA 4K1XA 3BD7A 3HA3A 4ZI7F 1MT0A 4Q4AB 4R7ZA 3P9XA 2BJVA 3PDHA 2X0DA 4D6PA 1PNRA 2Y4NA 3VQTA 4ENWA 5LSAA 2PRIA 4AJKA 2J3MA 5ALTA 4IW3B 1LBQA 3TIIA 4RANA 1HI9A 3GMSA 5EWLB 3NDIA 4BJHB 2O5VA 3MWYW 4HWTA 4KJZA 2LKDA 5IMSA 4EDFA 4UHBA 1DJMA 5JAPA 4OGWA 2GN6A 5M5BA 4QYWA 3JVIA 2X3UA 1UANA 3VHXB 3TEFA 3I42A 3KEFA 1RBQA 1ENPA 2O57A 1LPSA 3DEIA 1QWSA 3N3BC 3RUAA 3BMQB 2UVVA 3PNQA 1MH9A 2PANA 3R40A 1H0SA 4A0RA 4BZWA 4N5HX 4B31A 4D46A 2C7PA 2FMFA 3RK0A 2D7JA 3I6IA 4WFQA 4RA6A 3C6XA 4H7EA 1J8DA 4OLHA 3LT0A 2W2LD 1H4VB 5JSYA 1ZQ9A 5EESA 4BPRA 1QONA 3ZCVA 2ZSHA 2W04A 5A0FA 4Q24A 4YV1A 4CF4A 3KKQA 3ELYA 1SD1A 1S9HA 5KQPA 4D9CA 4H7DA 2GETA 3RVJA 3L40A 1HT3A 1CJVC 2HJVA 4YMSA 4JVSB 4G8DA 3QBVA 1KQFA 1MFPA 1YIAA 2BFCB 1GXSA 2HLNA 4X90A 3D6MA 5ITZA 3ZBQA 4IDQA 4JB0A 4E33A 3CRVA 2PSJA 3NH6A 1N34B 4QTTB 2G8LA 4G63A 1UM8A 4P92A 1EI9A 4EIWA 1KZ4A 1HX7A 5LD2C 3AINA 3OUZA 3TTYA 4YQYA 3ZPXA 3E7PA 3WTCA 3QV1A 3KKZA 1G64A 9ICOA 3L0ZA 4UB1A 1YBFA 4X41A 1PJSA 2NUBA 4UEWA 4U02A 3LC7O 3HJHA 4OA5A 4JLOA 2Z43A 2NXCA 1HORA 4ZK6A 1SRQA 3ECCA 2UUOA 1FNCA 1OW3B 2JIMA 5FUYA 1KTVA 1PS8A 2WYWA 2HRRA 4WGGA 1IUNA 5CA1B 3HBNA 4YR7A 1OR8A 2WILA 1ZX1A 2YZ7A 4MEJA 3EJ6A 2PQMA 4UEKA 2K60A 1WIWA 1IU9A 4DM3A 3ILVA 4KAXA 5A3RA 1YIDA 2RC6A 4ZICA 3GELA 5DCLA 2QTVB 1L4KA 3HADA 1PR0A 3T9AA 1BPBA 3U44A 1NK4A 1OIXA 1HUZA 1DC4A 2JHGA 4HZIA 1QSGA 2Y0PA 5GZ6A 1SKBA 5TJHA 3EQ7A 5DTQA 5DLFA 2XY6A 1N6NA 4DB2A 2RGYA 5BVHA 2RARA 1B0ZA 1HY3A 3ACBA 1QUEA 2O5CA 1HXHA 1WXEA 4ZYYA 4C78A 3NC0C 4MHTA 4V1CA 4EENA 2OL4A 1LKZA 3B7PA 2OE2A 4Z6DA 5H4GA 1ILWA 4WUVA 5ERGB 5H0IA 5L9XA 3C3PA 3BQ1A 3QVTA 4FW8A 4QWCA 5DBAA 1T3ZA 4YUZA 2XUGA 5J2DA 3BCRA 3RBDA 5JSZB 4UNNA 2ZB8A 4GD3Q 1GRNA 2DGDA 3H5AA 4C4RA 4HKTA 3OWHA 2VKQA 1NA5A 2RHBA 4BGIA 3C97A 2QUKA 4AYBC 4WESA 3MCWA 5BR4A 2VI5A 3IAFA 1PJ2A 3LC2O 4DF8A 4EGCB 1Q7GA 5CJJA 1KI2A 4JR0A 1WB9A 1EFCA 1AA6A 1OASA 3CH6A 5KTYA 4PHDA 5DM2A 3R3XA 2KB0A 2QN8A 1E8NA 1V37A 2R87A 3CYFA 3QLJA 4DLTA 2QRGA 2BFDB 1I6LA 2XOEA 3DCYA 1LLCA 1MGPA 4P33A 3TM5A 1KJIA 4AWXA 1W1UA 3RFAA 3M3HA 2D2EA 1DC6A 1QE0A 5J2KA 4W99A 5BQ5A 2V3WA 2FKAA 1BA3A 7MHTA 3W7BA 2D8CA 3UGKA 5DOZA 3P9ZA 3NBXX 1WUYA 2W5UA 2QUHA 1UPAA 4FYVA 2PCLA 4QDTA 4CV2A 2ERXA 1I2MA 3WQQA 5JYDA 3W5DA 4NJMB 4Z8XA 3OJLA 4J0EA 3ZWOA 4KE8A 3H0KA 3DVRX 4OM8A 2WWWA 5BSFA 4BQRA 1NZDA 2GASA 4UNIA 1JHXA 1I7PA 4PPQA 1G55A 4M9SA 2I33A 5FA6A 3OD5A 1Q20A 3BZKA 5A62A 1N6PA 2J31A 4BLWA 4DQ0A 4QZBA 2AKAB 3T7IA 5FIUA 2G6TA 2XDWA 1AUPA 4AZSA 3QVXA 2JFZA 2PK3A 1RBMA 4O4JB 9MHTA 2XUIA 5BYBA 3CVYA 2WZCA 1J8FA 3EODA 4UXJA 3DEJA 4JSRA 1S3SA 2PUTA 4D99A 1WS6A 3HXMA 3H65A 1KYZA 4GRIA 1XXHA 2D7CA 1XMIA 4JR1A 1ND6A 5TRTA 5IAOA 4DUZB 1KI4A 1TRKA 3ZI0A 3M6FA 3CWQA 2CMFA 3NHAA 4MCIA 5J5CA 4EEXA 4KR7A 1DMSA 4HO1X 2P6NA 3SEFA 3HSYA 4A9AA 3C2MA 4P7GA 1TQ4A 1CR1A 3BOSA 5SZIA 2VP0A 1T43A 4RKWA 4QUBA 3BB3A 1L2TA 3MWKA 3AF3A 4MIKA 3CRNA 1GFWA 3RIMA 5FEUA 1KU0A 2HA3A 3I6QA 1J9GA 3ABZA 5HFAA 4O1HA 4EL0A 3DD5A 3GMTA 1E5TA 4JOBA 1SXDA 2H52A 4OB7A 4RQTA 3FWKA 2FDCA 4Z4CA 1FUYB 3KQPA 2GCGA 3VU8A 2NACA 2W6JA 1RP7A 3EW9A 4BAUA 4Z4GA 1R6VA 3CRRA 3V8EA 4M46A 1GZVA 1MEOA 3NAQA 2I7VA 1MLDA 5JFTA 3SIRA 1THGA 1P0CA 1ZK4A 2YXDA 3KE8A 3M34A 3W6ZA 5CK5A 3HZOA 5CBKA 1Z6QA 2JXJA 1XYYA 1IOWA 1K92A 1TYEB 3EHDA 2ZP1A 2QMEA 4XM0A 5L3QB 3PHIA 3RWMB 3GZTB 4UVGA 3BQMB 4MUEA 3U0VA 3EUWA 3TANA 1DT3A 2CNBA 3DMPA 1IH8A 4NICA 3RSQA 3BS5A 3M9OB 1NJ6A 4QJ5A 5IBQA 4HXYA 2NV3A 2NRXA 7ICHA 4PGYA 2DSTA 2J1LA 4R1LA 4HR7A 4M98A 5KFJA 2ZGVA 2CHVA 3VX3A 3ZDBA 4F7DA 5TQ2B 2ZANA 5I45A 4DRZA 2ORWA 1YJCA 1E4VA 3AW8A 5BQXA 4H31A 2EFCB 4B83A 3AR2A 1GGJA 4IJVA 1U8YA 3BWBA 1XO1A 2O8BA 3DZ8A 2H54A 2BFPA 2FMPA 4AJHA 4IR1A 3B5IA 5KFBA 3CW9A 2ASJA 3K0AA 5CB4A 3TR6A 3K0KA 4R5HA 3GOQA 1KN5A 4Q18A 3DAOA 1QLWA 3KQVA 1GTSA 1X2BA 5DP2A 1T94A 4X7RA 1MB2A 3KKAA 4RIEA 3FJYA 4LOJA 2BISA 4XFJA 4DDUA 3IBFA 3KVRA 5DTRA 4HSEA 1KI6A 5EQJB 4KDRA 4IRCA 4IKEA 5G1OA 2X13A 1HSOA 2HTEA 5LP6C 4M2LA 1FDUA 1W6RA 5EQFA 1PKXA 1F44A 3FZEA 1MT3A 1SVLA 2WJZB 1TAMA 1PLJA 1VB5A 1BHSA 2JRZA 4K46A 2YXBA 3W6UA 1HJPA 4OD0A 4IV8A 3HCCA 3PX0A 3HKZF 2OCYC 3HFSA 4GDMA 4Y2HA 1G2IA 1YSCA 2HNKA 5TEVA 2YMQA 3YASA 3UK6A 3H2YA 2HA0A 2Z58A 4Q3EA 4DOCA 2WIFA 2KOBA 2P4SA 1Z4MA 2V4MA 4GM0A 4E5SA 4NY1A 3B53X 2FSVA 4P08A 3PNCA 1H5UA 4MUJA 2ZBVA 3IVAA 1RYRA 2OXCA 1BZYA 4EGAA 2CUNA 1UAYA 3EX7C 1ED1A 4FILA 4QICA 2CJFA 2OGTA 4HLCA 2OD7A 1MOPA 2ZRHA 3MPOA 3ADBA 4PSVA 1IJEA 1FJHA 2V1XA 4QIWC 2JB9A 1JIIA 4FCWA 3EEIA 1L5UA 5KNBH 4RQ3A 2GZ3A 4A73A 1KHHA 5KFYA 2X2EA 2H4WA 3TLGB 2OYYA 1FFCA 5ENVA 5FCDA 1E8DA 3DUFB 3OQ1A 4OHWA 1QIGA 5L1KA 2IYAA 2FTKE 1RLMA 1O08A 1WPGA 2LR0A 3KT0A 4QXAA 3ROZA 3C3MA 1ODIA 4BNKA 1G7CA 4P22A 1DAGA 1EJBA 3DDZX 4MW6A 1QHFA 4CKYA 3AOEC 3UXHA 2PS0A 3IFSA 3ZWKA 4JXXA 4ZQBA 3A06A 3OETA 4NMMA 1QV9A 3R0VA 2O0HA 2C4TA 1YIOA 4Q47A 4KI0A 4NP6A 1PVOA 1Y1RA 2BVNA 4M76B 5EXSA 2ZBDA 1MNAA 5FX2A 2QVXX 2ZE7A 1UBGA 4DMMA 5A6VA 1IXZA 1DO8A 3NTLA 3Q85A 2WTAA 5CAEB 4OU4A 3A37A 3TSYA 3BRSA 4X7BA 1GSIA 1NVEA 3NETA 3G79A 1KDZA 3MJEA 4QQNA 3HVJA 1DHTA 5E0OA 4J4TA 4MUFA 2QTCA 4RKQA 3VV3A 2VTVA 4BX8A 4IRXA 4R9NA 2P4HX 4EPXA 1G9TA 3KAQA 4M36A 1A76A 1EHIA 2C3MA 3HDJA 3KZVA 3PC8C 4EYEA 4JS0A 3ABQB 3DHEA 4J9RA 4NJOA 2GCOA 5FOXA 3UJDA 4C1NA 3LL4A 3FLMA 2PGLA 5FD8A 2WZDA 3AESA 2JANA 5HYVA 2P3SA 3GV7B 4J9MA 5FAKA 3FTFA 1IV8A 4OVKA 3U3MA 2EZZA 1EBBA 4RGVA 2Y9MB 4TUPA 1ADGA 4WL0A 1A95A 4EY4A 2XVZA 2IGTA 4LBZA 3FMIA 3E5NA 5TQVA 1R66A 4PLCA 4PQYA 4WK6A 3DLBA 4LGMA 1RRGA 4LGYA 1OLSB 3PD7A 2JAHA 3KZXA 3ENZA 5IIIA 1B16A 3TACB 4DQPA 1KR2A 1HBJA 4TXLA 2XNJA 1B0XA 3V4PB 3WISA 1DEXA 4PFKA 3S2SA 4US2R 3SQXA 4FE3A 1T4GA 3BMOA 2EKZA 3N0XA 4MVJI 3E2PA 2CUZA 5WRFA 2IYWA 2ZBUA 4R8RA 1V1RB 3B9PA 2IS2A 3OY2A 4U0JA 3T38A 5B1SA 2GAFA 3AP2A 1V25A 1Q77A 1V8DA 2YXEA 3EUFA 3QWFA 4UPVA 4EHBA 3ITDA 3O8DA 4F5QA 4IYRA 1S9FA 4XD7D 3UICA 1JG7A 2C7GA 4I4CA 2WF8A 1ZZGA 4L5YA 3N76A 4ND4A 3HJUA 3SDSA 2PRSA 4TTTS 3MMNA 4P3KA 5E1DA 1L5FA 3D6HA 2HK8A 3AFIA 1JUDA 2FUKA 4HDKA 4FDAA 3SOZA 4PZUA 1CRZA 1E3SA 4CMGA 1GG2A 4IRDA 1QH8B 4E5YA 2SHKA 3VO2A 3H0EA 1GTL1 4U9HS 2X5OA 2GX6A 2VJ4A 3TB6A 3C5FA 4L50A 2OCDA 4R69A 1BFKA 2F90A 3O4RA 1T2CA 4PO3X 2XKAA 4K8RB 4IVPA 3OAAD 3UUGA 2SCUB 1EIZA 4DCMA 4C0AC 4M2YA 2GO7A 4ASUA 3U7QB 3AV0B 3D3JA 1NW6A 3TIGA 1KOJA 4JGBA 4UU1A 4DBVO 1MEJA 1ZQYA 3ZVRA 5FV4A 1I1HA 1SEVA 4LZDA 1UWVA 1Y6QA 4XIYA 4L7QA 1QHIA 2D8AA 4HQKA 3K09C 1BWRA 4PLFA 4TL6A 2QLLA 4PC7A 3HFGA 3MJDA 1J5XA 1ISHA 1KC3A 4LYJA 4X1YA 4ARUA 4AJ4A 2JCGA 4IZOA 1YF3A 2C2MA 2XLCA 4DMHA 5KB3A 3KTAA 4TX1A 2QWXA 1BJTA 1ZUHA 4RJ2A 3LNCA 1N5DA 3MR3A 5E9JA 1UFOA 1FXWF 1UQUA 4G3XA 1W36B 4BKQA 3C1OA 3OF2A 5BN4A 4UUNA 4HNGA 4PINA 4RDXA 4WLUA 1X1BA 3LQKA 2FMIA 2ZYVX 3AM1A 3BHJA 1V1MB 4DM4A 5KFOA 3KSMA 2W48A 4P7FA 4YCAA 2JHCA 1E69A 1BS1A 5BP7A 1KARA 3JW8A 2BTEA 2GHQA 2JIQA 2ABWA 1QTQA 4EO9A 4QG7A 4ZDKA 2OBNA 3KLMX 4CKZA 3MRVA 1JHMA 1Z3IX 3C7CB 4LNAA 1HRDA 5AVRA 2VDLB 4ED1A 1RE0A 1ISIA 3S1AB 4GSYA 1LK5A 5IIOA 1QF9A 2TMGA 1R5JA 2F6RA 1ORDA 3ILHA 5EKDA 4FXPA 1SUPA 1PFUA 4RVNA 2JLYA 3SZRA 3HS3A 2CUTA 2V9ZA 4JWTA 4KYTA 2Z8ZA 3TDMA 4HDNB 5E7QA 4DF4A 4AKIA 1LDNA 5D87A 2QGFA 1N6LA 3W7AA 3OE5A 2XGMA 3PD1A 3VMFA 4JNCA 4AUNA 5CXXA 4NBNA 4O3SA 4DWOA 3DV0B 1KY5A 2P6PA 3S70A 1U8AA 3F97A 3LT5A 5H59A 2EKPA 4QJ3A 1TI7A 1JYEA 4YAFA 5FPQA 4AG6A 4PYRA 3WLTA 3B20A 4JJ4A 1CYEA 3BH7A 2UYHA 3IPAA 1Y4UA 4PAGA 2EQBA 1DB3A 1QF6A 3CVUA 2OAEA 5JVDA 2JFPA 2FGJA 4N0PA 2ZFUA 3C24A 5J2BA 2G5CA 2KSOB 5J2IA 2Q5JA 1PE0A 1SQSA 2K2WA 2PMBA 4E4TA 2O1WA 3PT9A 3UJ9A 3QFRA 4G4JA 3F2VA 2VQFB 1YJ5A 1XWIA 1Z35A 2Z9DA 2VSOA 3VKUA 2XPCA 3BXPA 1E64A 2V9PA 2ZB2A 4YJHA 2I22A 4OBWA 5FBLB 3ZV7A 1BGXT 1R10A 1V8FA 3RFCA 4LC9A 3QWIA 3FPSA 4A26A 3KPYA 1Q0TA 3DLIA 3TTVA 1UDWA 5CM8B 5F73A 1JIKA 1RWPA 2Z4RA 3VR5H 1IOZA 1KO4A 4DFKA 1COWD 1USWA 3ULKA 1Y8AA 3FUWA 5EZSA 2OHXA 1M1NB 2DBVO 3B82A 2AN3A 2OBLA 1X7HA 4FX2A 5DVZA 3CUEF 3RKUA 1ZNZA 2X0FA 3PE6A 1E2QA 2AJDA 2K8CB 3LWZA 2XICA 2FRDA 1GEEA 4EJMA 1NAHA 5KWEA 5T67A 2GD1O 3I92A 3VHLB 4DQQA 3E8MA 4ECZA 1XYVA 2VYVD 2PLNA 5EXXA 3RTBA 4NU0A 5IAJA 4OL0A 4K6HA 1DT5A 2QSJA 3DKPA 4YV7A 1P3JA 1DBRA 4E4RA 3PIDA 3RF6A 3F8WA 3I2JA 3ZWYA 1NXVA 2O3TA 3AEVA 1ULHA 1NSTA 3TB4A 5BNTA 3OESA 5KYYB 2M9NA 2HA2A 4HH3C 4Q3CA 1N2CA 3OHMA 4P4UA 1YC5A 3WIOA 2MJLA 2VF5X 2JZBA 3GLTA 4QA9A 1TZKA 4TYQA 2IU3A 1MP0A 4KLAA 3EIOA 4O3MA 5HCNA 4DUYB 1AJEA 1BJKA 3DDUA 3KVNA 4EHNA 4X1IA 4AZ3B 1DKPA 5ES4B 2OT3B 2O6KA 1M0SA 1W5AA 2MSLA 2LV8A 1IN4A 1XMVA 3HU2A 4PH5A 1OB2A 1KVQA 4AP5A 2IEGA 4IIDA 2QT9A 2PUAA 4ZCQA 3SXPA 3HT3A 4BATA 4QGFA 3FCOA 4L8LA 1HDZA 2E1RA 5BR8B 1D2RA 5HJ7A 5FBVB 4UD6A 4J0KA 1ONBA 4RJIA 1Z6PA 1LZLA 1EEXB 3KD2A 3CKLA 5FWYA 3SC2A 5HJ2A 2B3TA 3BRCA 5D85A 4PLVA 4E07A 1DINA 1E7YA 4QWAA 4R9VA 4XPIB 1GU1A 5KL8B 1TB4A 4FLMA 4RF5A 4LZWA 3U48A 5D5HA 4CMEC 4IIVA 3SY8A 4G97A 1Z2DA 1P4RA 5EKTA 1U94A 1WBJB 3ZGYA 4OKIA 2WHEA 3ANNA 1OAAA 3TW0A 4EUSA 4P4OA 3T79A 4FI3F 3TBHA 1C41A 4DCUA 3SJZA 1ODFA 3EVBA 4E14A 1O89A 3VYWA 5GVRA 3W90A 1UBTS 1LK7A 4LCBA 5FDFA 5JVDF 2KJ9A 2XZTA 1OC4A 4YWJA 2YX8A 3LRTA 1ABEA 2AFRA 1HYGA 1QIHA 1A8HA 2V0GA 1SG0A 4AMYA 3MWEB 4C7MA 2L0XA 4RJTA 2L69A 3I34X 2XMSA 3BIWA 1OHHA 1J0BA 1QGUB 2RP5A 1RYEA 3OFVA 2QORA 2Z6QA 4F2DA 1DAMA 4KN9S 4H1WA 2KFZA 5K6AA 1CUBA 4RJJA 2WJYA 2VC2B 1X1EA 1UK9A 1KJQA 1CDOA 1L4GA 1XWFA 3EMKA 5M04A 1EXVA 2PFQA 1EP2B 1MGOA 5DHTA 3DD1A 4ITUA 3GPDG 4RK4A 1CW2B 4XASA 2QY6A 3SYRA 3GVCA 3VSBA 4C8NA 1ODTC 4UDXX 4GLOA 1R8YA 4P31A 4BBZA 5ALNA 4D9NA 1EWQA 4GE3A 1G8HA 3OQBA 1DWQA 3J81A 5CA0B 1CU1A 8ICFA 2XT0A 3D02A 4KU4A 3L7NA 3KTFA 3KJFA 1Y34E 2XUPA 4I2AA 3A6FA 3CCBA 1E1CA 4JI0B 7ICPA 1QG6A 2WA1A 4N48A 3C6ZA 1UADA 3LQ1A 1X9MA 4Q44A 1OT5A 4TSRA 4UEOA 1X13A 3RTGA 4BXOA 2GERA 4WN9B 2XBMA 3A1DA 5K3FA 3HN7A 4ZDJA 3DH0A 2WLTA 2DU8A 4JDPA 1EA7A 3M1LA 1IQRA 4WNAA 2H5XA 1EXNA 4WA8A 2DH5A 2VFAA 4OHBA 4Y2SA 4EFNA 4JHXA 4ZGGA 4DJTA 2V7BA 3K9BA 3D5EA 4TN1A 2X4DA 4I4TF 4V39A 5H3CA 3D8NA 2XSZD 5KYVA 4F8EA 2XE8A 2Q1TA 3NM5A 5A9TA 3GRFA 5GZ3A 4KLIA 1HFJA 3D4IA 4M6WB 3ND7A 4NENA 3I52A 2A5GA 1JR3D 2O54A 4CU2A 2PV7A 1LW6E 2ZIFA 4K6FA 3AR3A 5JAQA 3PNLA 1PZNA 1EBUA 3I3OA 2ZTSA 1XSNA 3R5HA 4LISA 4ZT6A 1W5FA 3P2KA 3IBCA 4GSKA 5DI3A 3FCAA 2XF2A 1V47A 4KQJA 4R40A 1X40A 2IMWP 3GCDA 4YDHB 2Q3CA 5M7EA 3F49S 3OE7A 4PLWA 4OOFA 4Q9JA 4OMFG 5J2JA 4LFAB 4BC0A 1FX0A 4DREA 3K35A 3WRXC 4FX5A 4LYYA 3B85A 2O1EA 4GR4A 5KX5F 4KMRA 2AR0A 1FTQA 4CQMA 3UANA 1PNVA 5B30A 4BLSA 4TTSA 3QV2A 1EFAA 4YUVA 2KHVA 4QXMA 4WWHA 4QGGA 4BX9A 3URMA 4CI9A 3JPNA 1WD5A 4YAKA 4CR8A 8ICQA 1PWZA 2DQKA 4K6KA 1W94A 2Y92A 4NEQA 1VPLA 1T4DA 1C4WA 2IYNA 1E2FA 5SY6A 3RADC 4OAPA 3FVVA 5AVJA 4A2CA 3F6RA 5H7XA 3L7JA 2ILVA 3NU1A 3JYLA 4II7A 2JLRA 4ZOLF 2C8VA 3EOZA 3DVAA 3SJ7A 3PHJA 3BGDA 3C5VA 4IMRA 3U2QA 2VH1A 3F6PA 3ERCA 3P4YA 1U7UA 5JNRA 4IQUA 3UTCA 5JHGB 1SOVA 3I2YX 3E2MA 1CD5A 3DUWA 3OEWA 5EIXA 1C7RA 2FUG6 3VM6A 3TD6A 1FA9A 3ETCA 3PX4A 1SZDA 3AUXA 1OI4A 1FVXA 1W36D 4XGQA 5AM4A 3OOYA 1JXMA 3LPDA 4IH4A 5J3JA 3KKLA 1JG4A 3V4RA 4M38A 5KNCA 2EKBA 3WWDA 1X3LA 2W2PA 1X1AA 4QUKA 3QPDA 4NCNA 3C70A 1KHTA 3KG2A 1QLJA 3F6BX 1MIOB 1AKVA 3N70A 2WV9A 2XNCA 4JWKA 2BHSA 4DY6A 1RYHA 3BCUA 4QNRA 3U16A 3IB6A 2QPAA 2C03A 3B38A 3OPQA 3F5QA 4YALA 2YH2A 1E2BA 3N2KB 3GCGA 5COBA 1H9CA 3UKJA 3VNAA 1CX9B 5DTEA 1QFZA 5AI5A 4JJ7A 1Z0UA 2GWRA 3WWCA 2B34A 2WU0A 4B9VA 1E62A 5EUCA 2ISCA 2NTEA 3LWNA 3MHTA 1JXOA 2NU9A 4JVNA 3NOXA 4GXNA 3OF5A 3L7DA 5E2BA 3QKRB 4EY6A 1QLNA 2ZTHA 1T2AA 2NVOA 5JDIC 5LNK6 3B3AA 2PUCA 1WVIA 1JKIA 5I4IA 4KVAA 2E3TA 1DKMA 1TMOA 2ZIWA 2NTNA 4JUZA 2FG5A 3B6JA 4D9GA 2ACWA 4OP2A 4R8VA 1P7WA 1PFYA 2XB6A 1QPGA 1E2NA 3H11B 3R1IA 5J58A 3HGQA 3GP5A 3M5PA 3BWMA 4MKZA 2Q27A 3E2IA 3PGLA 4P0TA 3VRHA 1DIGA 4EW6A 2AXPA 2H1OA 3ZOKA 4JL6A 3ZGVA 1CUYA 3H9BA 2CHFA 5KYTA 2G72A 2VTKA 4TQRA 1C80A 3HHEA 2REQB 3VPXA 1CVIA 3AB8A 4N3GA 2WJWA 2O2YA 4ZI7A 3QELB 4FD2A 3OSPA 4WBNB 1MW8X 2JAQA 4F3NA 2OGUA 4IH9A 8ICVA 4RD6A 4O3NA 3VO1A 5B3AA 4UVEA 4HYYA 2NRZA 2XCPA 2PZMA 4DLVA 3OTHA 4A2QA 1Y4DE 4E2XA 3CH4B 4DLWA 1LBTA 4G9EA 2NZ2A 1PHRA 3G9XA 5DYNA 3H1PA 3PQ7A 4NM1A 2WD7B 2H1VA 1XTVA 3A6ZA 4LOAA 2FZEA 2PZ8A 3REOA 1FRFS 4K6MA 9ICHA 3RODA 3ZWQA 4NOMA 1BPZA 2A7QA 3DOIA 3TRKA 4OK6A 4KFUA 2JS7A 4NS4A 4I1YA 2I6XA 1XVUA 1HUQA 1GCUA 3RH4A 4M3NA 3QHAA 9ICRA 4MUBA 4HAYA 5IJWA 2PKQP 1KTQA 3BF7A 2QZSA 3QMMA 3I8OA 2NYVA 3ZLTA 3WB1A 4CM6A 1F2UB 3IEKA 2OKGA 3Q2KA 2VDWB 2VDOB 2UYGA 4H27A 3JQAD 4I2CA 3I45A 1A8QA 3NS7A 4Y9UA 5H16A 2W2LA 1PJLA 4MQEB 3O4VA 5AUOB 4BS9A 1XHLA 2BCSA 2A14A 1FMLA 3MHPA 3EYWA 5I7FA 5TARA 3LPLA 2ZRJA 1U8ZA 3TSZA 3EDQA 5D3MB 4ESVA 1SC4A 1CTQA 1ZDMA 4AG3A 4RT3A 1U0FA 2JCXA 3E2EA 4MRAA 4FMPA 5E95A 1CUXA 3IIMA 1O97D 3NH9A 3HU1A 5B3JA 3B9BA 4KRFA 3AM5A 5FOVA 1KYYA 2X8LA 2BEVB 4EJSA 5BNIA 4KX3A 1IM8A 2VO1A 4HQFA 3L9XA 2C4WA 7AT1A 5KYNA 2WWVD 3DMTC 2OZLB 1PVQA 3ADOA 3M7DA 3HYSA 4WMLA 5FNVF 2OXEA 2VLIA 4B74A 5ETJA 1W48A 3VX4A 5C8DA 4C05A 4DMKA 1L4FA 3HA5A 1EM8A 4KG7A 2NNWB 3MWDA 2QLFA 9ICSA 2DEUA 4H6PA 4A0QA 1ZR4A 2PHZA 5JPDA 1DGSA 1GQFA 2G9UA 3EGOA 2J9XB 3HCBA 1NMZA 4F4YA 2A86A 4FC6A 3QYFA 4H35A 3C6QA 2JAUA 5KNDA 3H84A 4IC9A 4TKVB 1GQSA 2RAFA 4BPBA 1GZDA 3JPWA 2I3AA 2E8MA 4I9UA 4PCVA 4GLLA 5KTPA 4ZEVA 2PSSA 1HEIA 1BXKA 3K1YA 1FP2A 4Z3KA 3B78A 4BCDA 1QO0D 1F7VA 3OPXA 4EQ6A 3AKCA 1JU9A 5BQPA 4P0PA 4HB4A 5TV2A 1RCFA 5KINB 4YT5A 4LXYA 2V7PA 5K3BA 3DEAA 5LLTA 5EHNA 3NBKA 2JI8A 3UWKA 5J5AA 4BMVA 3Q10A 2Q3EA 3U7IA 3MJCA 4ZIRB 3K70D 4JR2A 2V4RA 2ETXA 1X70A 2J3LA 4BY9E 2HSGA 4HPXB 2E1EA 4BV9A 2HWKA 3DW3X 4G81A 4LTMA 4NMXB 3PTAA 2IK8A 3W0LB 3G6XA 4RPXA 1IDOA 4YBRA 2G4CA 2I7XA 1MAAA 4MDHA 2OAGA 1ZP6A 1LNZA 2PBZA 4FZJA 1KSHA 4GKJB 4PO8A 3SIWA 3D31A 2FQWA 2CLIB 3QKSB 1SBZA 1DEAA 5DRTA 1GT6A 8ICXA 4RCYA 4M89A 1X9GA 1F0NA 2H29A 3O47A 3UJHA 4PS0A 4PZEA 3E3OA 4G0YA 4R81A 1BN6A 3S5UA 3V4VB 3SLKA 4MKXA 3VKWA 3UAWA 4ZVQA 4J49A 1XL0A 1H5QA 4DJ5X 1Y5MA 2DUNA 4OSPA 3ZX5A 1L5GB 2B1GA 1FFXB 1CZUA 4W5HA 3AUSA 2IHBA 4CBVA 4ZVMA 2E4AA 2FN8A 1Q3VA 2VT3A 1EP9A 2EAOA 1OZFA 4WE3A 4XLZA 4RY2A 2Q6IA 4H77A 3BSFA 3JY6A 4YYZA 4EY8A 3D2SA 1ZG3A 5DNWA 1SURA 2KG5A 3FGOA 2JIBA 3EAGA 2GPSA 3C5EA 5DO9A 4EB0A 1IIRA 1ZONA 5KAFU 4JGIA 4IGKA 4W1RA 4YGXB 3KVYA 1EP3B 5DW0A 1HM5A 1NOMA 5HFNA 3UB3A 3B9QA 1B0AA 3BXZA 3FMOB 3I01M 5K4AA 5DQIA 4CDRA 3W77A 5SZJA 1VJ0A 2WIJA 1KOFA 3JPQA 2JRLA 3D6AA 8ICZA 5AP9A 2COKA 3EGIA 1KETA 3L92A 4W1QA 4D92A 3W6NA 1MN8A 1NRJB 1P75A 1JFLA 5D51S 1CZKA 4GLFA 4TVKA 2HPVA 3UUEA 3A05A 3HX0A 1ND5A 4CMHA 1WXHA 3FCXA 4U7FA 3U4HA 1EDOA 5FFFA 1SZHA 1G17A 3KAKA 3IAEA 4RK1A 2XVAA 3GFRA 2H3QA 4JJZA 4X3CA 2FK7A 1JEEA 4PBTA 1DC5A 3O75A 4P4MA 3KKMA 1I13A 3MWFA 4B2LA 4G0VA 3I04M 4GGOA 2AE1A 5KFMA 2Q6LA 5ES3A 2ZW9A 3ZWDA 1YZNA 3LX4A 1VLJA 4DR7B 4FYPA 4Q8FA 5ECWA 5BWMA 2Y68A 2CLKB 4DHEA 4JBLA 4W1SA 1CY0A 3RJIA 4X6XA 2QF7A 4MZDA 2EJUA 5PGMA 3ITEA 3ZN2A 3HR7A 1NT2A 3JPSA 2G5GX 2FWIA 4RENA 4P4PA 4RZIA 2BP7B 5EUMA 3ZVMA 1QQ5A 3BSWA 5JMWA 5LQKA 3PUJA 3HFRA 4MHVA 2ECPA 2PFKA 2LYHA 3L8GA 3RS8A 3T3FA 3MBIA 2RI6A 3DMNA 4AQYB 3FCYA 1Y3CE 3G17A 2HU8A 5SY4A 4LJAA 4Q9HA 3DLTA 3OZEA 4GP6A 1TO2E 1QNFA 5KYXB 4I1SA 5EIFA 5HKKD 3LLUA 4CXMA 1S2IA 1GU7A 1RM6C 2PMCA 4L8WB 1UPBA 3QIVA 1JRPA 1G5RA 3KETA 3GLGA 4OYLA 2QJTA 5E1OA 1X8XA 3QPWA 4IR9A 2WKQA 1QH0A 4ZYTA 3CMCO 1NQOA 3DOUA 3ZVLA 3KPJA 4F72A 3F73A 3ZWNA 3MT7A 7REQA 2XZDA 1AQIA 5U4XA 1HZZC 4B9SA 4NYIR 1SK8A 1NU8A 4F2HA 4PVDA 1ZUD1 1QE3A 4G4SP 2Q4BA 1M34A 2XB4A 3JD2A 2TMDA 3KQNA 2ZDHA 5HGXA 2R44A 1L7VC 2C2XA 3M1AA 4FK8A 3PCRB 4ZZ2A 3LIPA 3ANMA 4E46A 1YDEA 5F5LA 2UVQA 5DSZA 3PPIA 4R2XA 1XZLA 2O8FB 5L4LA 4MUMA 3D7KA 3AZOA 4OHCA 4E09A 1W59A 2I6TA 2HMTA 3HB5X 3WIUA 5HMMA 5EJ6A 2O7QA 2ZPAA 4HEQA 3RVOA 2ZSKA 3KPWA 3WFZA 3LMKA 3C45A 4KRXA 4LKOA 4G84A 1ODJA 4NDAA 1MO3A 2VSFA 1WXXA 1B2RA 3DOOA 1IJKA 3WJ2A 1ZGGA 1G21A 4ZT2A 1SXQA 5EINA 4DAEA 5A4FS 4GXIA 4ZCSA 3I6BA 3KQOA 1TJNA 4CFZA 1AO3A 1PWHA 4I4NA 3NHKA 2DSNA 3ORRA 2EEZA 4RFSA 2ZYHA 4YROA 2Q1WA 1YONA 5IXSA 3FSGD 4DEXA 2ZU0C 3C74A 2Y1EA 4LHYA 2GPJA 5HS6A 1KMMA 2YNMC 1OBCA 2K7FA 1P7ZA 5DBCA 1QFSA 4Z9XA 4L4XA 2Q2OA 2VSNA 2VTBA 2J7PA 2JIPA 3EC7A 3MOGA 2W2XA 1K8QA 1Q0RA 5CEEA 2AEMA 4F91B 4XGNA 1J25A 3NEJA 3A31A 3WWZA 4A92A 3COPA 1TC2A 2WJ4A 5EJEA 4JI6B 2WICA 2AHOA 4RL6A 2B20A 4NYIQ 2ZCJA 2ALZA 1S0OA 3PXAA 3WP1B 3RIGA 5JAHA 4X3OA 4Y98A 3GEBA 2HOIA 1QP7A 3CW2A 5IJ9B 4I99A 4I6EA 3SHOA 1HDRA 2KZMA 4MVJH