2ZG6A

Crystal structure of hypothetical protein; probable 2-haloalkanoic acid dehalogenase from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
218
structure length
202
Chain Sequence
MKYKAVLVDFGNTLVGFKPVFYEKVYQVLKDNGYDLDLRKVFRAYAKAMGMINYLEHVDPKDFLYILGIYPSERLVKELKEADIRDGEAFLYDDTLEFLEGLKSNGYKLALVSNASPRVKTLLEKFDLKKYFDALAPKIFGFALAKVGYPAVHVGDIYELDYIGAKRSYVDPILLDRYDFYPDVRDRVKNLREALQKIEEMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Hypothetical protein; probable 2-haloalkanoic acid dehalogenase from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein ST2620
total genus 61
structure length 202
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.660 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2zg6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2zg6A01
4ZEWA 3NIWA 1N8NA 4O8CA 2HHLA 2NYVA 4Y2TA 1CR6A 3E84A 3MMZA 3SD7A 4BX2A 1Z4PX 1ZD4A 1RKUA 2Q4TA 3AR3A 1L7NA 3UMGA 2R8XA 3FVVA 3E58A 5AI0A 2W11A 1L7OA 1SWVA 2CN1A 2G08A 5ALQA 3KBBA 5IT0A 5AKJA 5AVXA 3WGUA 3L8FA 2D2VA 1LVHA 2I54A 2YJ6A 4C4RA 5AVSA 2P69A 3OCZA 3KDPA 5AW4A 3QX7A 3VAYA 4AS3A 5AW7A 3ET5A 5T41A 2G09A 3AR7A 1ZOLA 2ZBFA 3QUQA 1L7MA 4XE5A 5AICA 2R8ZA 4KNVA 4Y2YA 5E0OA 3R4CA 4J2TA 3ZVLA 2JAOA 3IRUA 3DAOA 5ALZA 2IOFA 4BX3A 1YV9A 4UW9A 5AVZA 3I28A 2C8KA 3SF0A 1YS9A 3RFUA 2PKEA 3QU9A 5ALIA 1VJRA 3IJ5A 3ESQA 5ALOA 3R09A 1N9KA 3U7HB 4EZEA 5A3QA 3AR5A 1Z4QA 4Y2JA 3L1VA 2WF7A 4YGYA 5ALEA 3NANA 2HOQA 2OM6A 2IYEA 5AW0A 4YH1A 1Z4MA 4L6CA 3W5CA 3KC2A 5AI5A 1L8OA 1RLOA 2P9JA 3QNMA 3QU7A 1QH9A 2B8EA 1SU4A 4DW8A 2CFRA 3DNPA 1Q92A 2JGAA 4NFLA 2X4DA 4CNQA 2FPUA 2HCFA 1J97A 5AK4A 3FPBA 2HEGA 3QU4A 4CE6A 2NO4A 3SKYA 5AK3A 1O03A 2FUEA 3UM9A 2BDUA 1XPJA 3DDHA 2OBBA 3QUCA 2OYCA 1NNLA 3L8HA 3WK4A 3PDWA 5AKKA 1QYIA 2O9JA 3R9KA 2FPWA 1RKVA 2Q5EA 3MC1A 5AM5A 3N8GA 5ALFA 3ZWKA 5AK5A 3AR9A 3L0BA 2C4NA 3WKDA 4IG4A 1ZD2P 2ZOSA 5AESA 3NASA 3OPXA 2OA0A 2C9MA 1ZRMA 3U7EB 3KD3A 4UATA 2JAWA 4HGPA 1YJ5A 2G0AA 3BA6A 3GYGA 1RDFA 3ZVMA 3SLRA 1JUDA 1MH9A 3OCXA 1L7PA 3WK5A 1IWOA 2BY4A 3L8GA 5AVRA 4NABA 4OHFA 3QUTA 1Z4OA 5ALWA 2ZG6A 3AR4A 4UAVA 2I6XA 5ALTA 1O08A 2G1AA 5ALUA 4BNDB 3EF1A 1U7OA 2ZBGA 1YMQA 4XQ0A 5ALXA 2HF7A 5AVQA 1WR8A 3UMBA 4NAVA 3ZVNA 2YJ4A 4UU1A 3I6BA 5AHXA 2MSNA 3N5KA 3FZQA 2AUTA 4UMVA 1TA0A 5IS2A 1XVIA 3QLEA 4DWOA 4QQFA 1FEZA 2EATA 1Z4NA 2HDOA 2RAVA 1F5SA 4KX3A 3S6JA 2RBKA 2YMLA 2I34A 3A1CA 3AR6A 1RRCA 1X42A 3WK6A 4UMFA 2WF8A 1RLMA 3J7TA 2WF6A 3A3YA 3CZ4A 2PR7A 4G63A 4BKMA 4KX5A 3EWIA 2QLTA 4EX7A 2DQSA 5AVVA 3ESRA 4KNWA 2W43A 3KOOA 4IFTA 3BWVA 3W5DA 2GHQA 3A1EA 3FGOA 2O2XA 2QYHA 2B8JA 5AK6A 3U7FB 1XP5A 4HYTA 4EELA 5AW1A 5AIAA 1WPGA 5AW8A 5ALRA 4DFDA 5ALMA 3ZUPA 3MN1A 2AGVA 3U7GA 1Z4IA 2I7DA 2VKQA 4BBJA 1TE2A 4QJBA 1PW5A 4AS2A 1J8DA 4UMDA 1RMQA 2JAUA 2WF5A 1VFPA 4BX0A 4Y2QA 2I33A 2RB5A 3WKBA 4H1WA 3OCYA 4GXTA 2BDEA 5ALDA 2YJ3A 3P96A 4FYPA 5ALJA 3WGVA 4YCMA 2CFTA 1RPZA 2G06A 3SHQA 5JJBA 1ZJJA 2AH5A 4F71A 5AW3A 2HSZA 1T5TA 5ALYA 5ALHA 3M9LA 2GHTA 1L8LA 4Y3UA 4HGQA 2G80A 3WKEA 4UU0A 1Z4JA 3QU5A 4KYTA 5ALGA 2YFYA 1Y8AA 5AM3A 5IT4A 3QGMA 4NV0A 5ALKA 4UMEA 4FFDA 1QQ7A 3MPOA 4UASA 2B82A 2ZBDA 4HGNA 3U13A 4I9FA 4XOUA 3RF6A 5ALNA 5AKLA 5AKIA 2FEAA 1RLTA 1T5SA 2FPSA 3EF0A 4OFZA 2PQ0A 3FPSA 5AVWA 2I55A 5AIBA 3PGVA 4DCCA 5AKZA 3FM9A 1YNSA 1Z5GA 5A3SA 3TLMA 2YN4A 3PCTA 3NAMA 4AP9A 2FUCA 1RQNA 3ZWDA 4HAIA 2FPXA 3NALA 1Z4LA 3E81A 2ODAA 1QQ5A 4C4TA 1RKQA 2B1RA 5A3RA 2NO5A 2GMWA 4ZEVA 3IB6A 5AW5A 1NF2A 3NRJA 3PGLA 3QYPA 1TJ5A 3ZU6A 4XPZA 2IA5A 3QXGA 3K1ZA 4JB3A 2P11A 3SKXA 4MWOA 2HX1A 2R8EA 1U7PA 4RESA 5AKHA 1ZD3A 4BNDA 4OCZA 5ALLA 5AKGA 1Z88A 4I9GA 2P27A 5AVUA 2B30A 1L6RA 2HO4A 3ED5A 3ET4A 3M1YA 3L7YA 1S8OA 3WK8A 1EK2A 1LTQA 3HYCA 4CF3A 4JDPA 2YMPA 5AKXA 2B1QA 3W5AA 3WKAA 4Y2PA 1NRWA 2R8YA 3CNHA 2HF2A 1ZRNA 1S2OA 3L1UA 3I76A 4UARA 3ZW7A 3L5KA 3F9RA 2GO7A 1RC8A 4RETA 5AM4A 4C4SA 4CF4A 2YBDA 5AKYA 3QU2A 3E8MA 5AW6A 1RMTA 2B0CA 1Z4KA 4BEWA 5ALVA 2YJ5A 4EEKA 2ZBEA 3DV9A 3HLTA 2W4MA 3KZXA 1KYTA 2RARA 2YMMA 3N1UA 1U2SA 4B6JA 2HI0A 2FDRA 4HGRA 2YY6A 3U26A 3ONNA 4GIBA 5AKEA 4L57A 4Y2RA 2C88A 5AI6A 3OTQA 4J03A 5FP0A 5AVTA 5AVYA 3B9BA 4OD0A 3B9RA 3EPRA 3ZX4A 1TJ3A 4PNHA 1T9ZA 5AI8A 2IOHA 3ZTWA 2JARA 5AM2A 1U2TA 1U02A 3W5BA 3A1DA 3L0YA 3SMVA 4Y2SA 1ZS9A 2WF9A 2YMQA 4ZEXA 3UMCA 2EARA 1QQ6A 4G9BA 3AR2A 3QUBA 5ALSA 4NWIA 4KN8A 4BYGA 4UAUA 3N07A 4MUMA 3WK7A 5ALPA 2Q4RA 2WM8A 3U19A 3OCWA 2FPRA 2MU1A 1SWWA 4F72A 3ZTYA 5AM1A 3I1YA 2CFSA 5AW2A 4YCLA 1EK1A 1K1EA 3B8EA 2G07A 2WHEA 2FI1A 1VJ5A 1ZD5A 4Y2UA 5AM0A 4EX6A 5AI9A 3N28A 3L0CA 2EAUA 4YIKA 4CF5A 1AQ6A 2ZXEA 4L6AA 1RQLA 4BEVA 3D6JA 4Y2XA 5AI4A 3AR8A 4HGOA 4EENA 4FE3A 4UM5A 4YCNA 3OCUA 1RMYA 2AMYA 1TJ4A 2WFAA 3OCVA 3L8EA 2IOFK 1WVIA 3ZX5A 1CQZA 4UM7A 4E88A 1Q91A 1WZCA 4YIHA 3WK9A 2C8LA 4Y2VA 3ZI4A 3NUQA 1Z5UA 3WKCA 1YDFA 2GFHA 5AW9A
chains in the Genus database with same CATH superfamily
1AZTA 1MHPA 4I6JA 4ECYA 2C2KA 2WWFA 4BMCA 3CLUD 5JYBA 1OBHA 5FOTA 1DQYA 3B9QA 1AF4A 4PHDA 1XVVA 2YRWA 3BHMA 4IWYA 3ZZTA 2CNLA 3I2YX 4JV0A 1PYGA 5EVCA 4NICA 4Q0MA 4Y2TA 1BXGB 3FBTA 5AMXA 4B2LA 1DARA 3GJZA 2XPCA 2GZSA 2GPBA 2Y1OA 3BYZA 3EH2A 4OJLA 3LCJA 5BOSB 2NV3A 3OFKA 5EMJA 4UREA 4ZFNA 1PNTA 2W83A 3RFVA 1ORVA 1CUIA 5ALQA 1XA4A 4U6SA 1XV5A 5KJFA 5IT0A 2LM1A 4BO6A 3U62A 5D8DA 1CFZA 1YFLA 1K7FB 3NVYA 5J0UA 4QUDA 1Q3KA 1A8IA 2WYWA 3G59A 2REXB 5J47A 5GINE 3PFKA 5GY7A 4JBXA 4Q8EA 3G8BA 1N92A 3CR7A 3N76A 4EB6A 4I19A 3ZLVA 4M1TA 2DHEA 2BSAA 4FTWA 3ZWVA 2VA8A 3S2FA 2FLPA 3WQQA 3RK0A 1YCGA 1W5AA 3A1FA 1FRZA 4RY2A 1KOLA 2WPDA 4MV7A 4WKCA 4GP6A 1V8OA 5FA8A 4FGJA 4AY6A 4O3PA 2VLIA 3IURA 4NG5A 4IZ6A 4D45A 1JEEA 5A4IS 3U44A 3ZLJA 2EJUA 2YCLA 3D7SA 3PLNA 1M34B 5HSGA 3BGDA 4RF3A 2H5EA 4PJ0U 4NZZA 4MKZA 2ASLA 3OA2A 3Q7SA 5PGMA 1Y9EA 5K6RA 4O0MA 5C8XA 1KFKB 2WJVA 2UUPA 2FW1A 1YE5A 4Z2AA 1EFRA 1QTRA 2ZETA 1QHYA 1T5BA 3JYHA 3TACB 2VDOB 4PIPA 5C5IA 5IDXA 3ESQA 1Q7EA 1K1QA 1BOOA 5L4LA 1YZ3A 1ZH8A 2B8WA 3LLMA 2WJ6A 1NHGA 3EYZA 1OA0A 1GYPA 3MYYA 4CQNA 3PPXA 1FFUA 1Z5ZA 3CNBA 3PX6A 4Y2JA 4E11A 2FR0A 2QX7A 721PA 5JOQA 4YAFA 1LBHA 3K8YA 3SLKA 1FP4B 2R84A 3IMCA 3M5WA 3JV7A 3MBKA 3IMKA 3OD1A 5HQJA 3V8RA 3GJ4A 5DJ5A 5DW0A 2RGDA 4CRXA 4Q7KA 5DNWA 3UVEA 2ONJA 2A92A 3KC2A 3WLFA 3HBFA 1DIRA 1ECGA 2NVBA 3PHCA 5SY4A 2AKAB 3NH9A 4DS4A 4YALA 4MIKA 1WPQA 5FPHA 2FHSA 2CDRA 4EHNA 5KWVA 1KMCA 4ENUA 1YJ8A 3UEOA 3LP6A 2HHWA 2JVIA 1KEPA 3HMQA 4M54A 1CEEA 2D6FC 5B1YA 1R10A 4DC0A 1QYWA 4QOJA 7ICMA 1Z07A 2PKCA 4QDUA 4CM9A 3KQLA 2IHMA 3S44A 1D0IA 3WY9A 4WXYB 1GZDA 4EL0A 2WB1F 3D3NA 3JPTA 4IQUA 5KL1B 1USIA 1Z35A 1YKFA 4MF8A 4N49A 2J87A 1H23A 4P6VF 1EWTA 5HEKA 3W2TA 4DIUA 4F93B 2UUOA 2ZJZA 5EWLA 3G7UA 2OBBA 1KZ1A 3I37X 3K2EA 1DEAA 3KHTA 3BQMB 2XNDA 3QEMB 4J4HA 3WZMA 1N5OX 1ZICA 1QYIA 5CVJA 2E2WA 1Q7CA 4EO7A 1PZEA 2ZRJA 2I3ZA 3D2BA 2DBZA 2GLTA 1YS2X 2WMDA 2FA9A 3RUPA 1JR6A 1HE8B 5KT6A 1KR2A 3LXMA 3DKRA 3HJAA 5E38A 3ZY3A 1T6BY 3AR9A 5A4DA 2VNIA 5IARA 5F7JA 4MRVA 4EHKA 3JQCA 4TN5A 5FWYB 1KDZA 5BR4A 3RTBA 5KT2A 9ICPA 4MW6A 3B5IA 4TYYA 1LB1B 4BFLA 3OESA 3IXQA 4NS4A 2AXTU 1GL9B 3P5SA 1GRQA 2DF8A 2WEKA 4EFDA 3LFHA 4KVAA 3KYJB 4BCBA 1Y1TA 3O4JA 4RK0A 4LG1A 5ICFA 1MB0A 3GLIE 3ZZMA 1UM8A 4UOEA 3W78A 3NJ4A 1NLZA 2JFNA 1B2RA 5EIFA 1DEXA 1U3DA 2GXSA 2I6QA 4KLEA 1F8GA 2V6IA 3DOJA 3JPWA 4OXIA 3UV7A 1QV7A 2KV2A 4YHHB 2XIQA 4YVZA 3V2UA 1WSWA 2ZAYA 4OHFA 5AR1A 1KMNA 4RA6B 4YQFA 2DJIA 1R4ZA 2JFGA 2MSWA 4ZOLB 1XNJA 5BV1A 2VDJA 3KE8A 4Z9XA 2VFAA 1MJNA 4HJRA 2EEPA 1ESMA 2EJTA 3ABQB 2OOKA 3LP8A 2C2BA 4O3RA 3TJZA 3TJMA 3F74A 3MTBA 4ESHA 3A4NA 3GUVA 1U7OA 2YWEA 1C3VA 4HSEA 4JI2B 2YIDA 13PKA 2QLJA 3PGKA 3Q98A 4EF6A 2P9EA 5AJUA 4QYXA 3ORYA 5H9WA 2DBYA 4HMQA 2ZLBA 4LIPD 5IUJC 3IAXA 1W2HA 5CU7A 1JDSA 2OO5C 3QEKA 4P4MA 4CU5A 5DM4A 4HQRA 3WOVA 4D9GA 1VHDA 3OQHA 2GYWA 4PPNA 3BILA 3QLEA 4YRRA 4FEAA 3ZY5A 4DQKA 3I8XA 4ZCIA 1I7QB 1MQ3A 1G3MA 4D3SA 4S35A 1G42A 4BZPA 2HDOA 3AU8A 1EVIA 1M6NA 1NNSA 4NNJA 5FBRB 4TYNA 2PKQP 4CI0B 1ZXXA 4EKEA 1JJ7A 3PICA 1L5HA 4R63A 2WF8A 1RHMA 1YRHA 2IPLA 2NXWA 3K32A 3VR1A 3C6KA 4E6EA 3NVKI 5EMHA 3REFA 2WU4A 1SUEA 4BFVA 3SAFA 2GUWA 4KGZA 2YWJA 1DG9A 3ZE1B 3JR3A 3V4RA 4D46A 2GDJA 2JIZA 4L8YA 3I39X 2ZS9A 1EINA 1JKIA 1Q44A 1P0IA 1EUDA 5EZSA 2HW8A 4GX0A 4MZXA 1FIQA 4WNYA 1CWUA 4XI9A 3VSBA 4IJKA 2VBGA 4UQLA 4J1TC 3DLIA 1QKIA 3PR5B 2RHCA 3ISTA 4KLUA 5BV0A 1QZXA 1XS9D 1XSEA 3A9SA 4UHKA 3ZZUA 5BQOA 1CZLA 4I8IA 2PFNA 1ZQTA 1CW2B 2WZCA 4YB8A 2YWRA 4BV8A 2HRCA 3O2NA 4DARA 1VCMA 2A9JA 2G1PA 1VHJA 4JUZA 1PK9A 3TH5A 1F0MA 2WIFA 4LZJA 4DJDC 5E9AA 2JEIA 1HDXA 5KFXA 1BMFD 2QE6A 3N6XA 3FMGA 1GKIA 3JYPA 4P93A 5DP1A 1QHNA 3CVJA 4DLUA 1KI6A 1A8HA 1L5SA 1XQVA 3ENVA 3GPDG 5CJJA 2NPFA 2KW5A 1J8DA 2ACEA 4FFBB 4RVNA 1WX1A 3QUAA 1DPFA 1T8YA 2FWNA 3H5OA 1BHSA 3HVJA 4RNCA 4BX0A 4Y2QA 4CQMD 4MPTA 1O94A 3JAKA 3CF4G 2BONA 3TSWA 2GKOA 1SL1A 1EX7A 2C9ZA 2NQTA 1SZPA 2OQ2A 3KSRA 3L92A 3L7AA 3HC7A 1L1RA 3GFPA 2IHBA 2R7KA 3KJZA 3OCYA 1GV1A 3DL7A 4M76B 1CZKA 5CDSA 5FOQA 3FPEA 3NCTA 3HCBA 2O2ZA 1Z17A 5DDIP 1T9KA 2OO7A 4C87A 4OHUA 3VU9A 3ZWMA 4LRYA 3WL4A 1CCWA 1JDZA 5A71A 2P8SA 4RCYA 3WNVA 5BSVA 5KYKA 2ZATA 4TL8A 5ERXA 2IXFA 5TF4A 2V6JA 4OY3A 3JVEA 1D0VA 5A1TA 4A1FA 1R8QA 3CUVA 4PSDA 1Q7BA 1VDVA 4F5QA 4XUSA 3PG5A 4UVGA 5HF8A 1DJMA 5TS2A 1A50B 5KFLA 5GTHU 2QL6A 4TKVA 2NTNA 1U0LA 3HO8A 4DB2A 1L5QA 4KRXA 1K9VF 4EYEA 4RM3A 2H51A 5T64A 5BVGA 3K94A 5EIXA 1TO6A 1GNLA 1VIDA 2R6GA 2V55B 3EY9A 4X63A 2AGPA 2CVOA 3S7ZA 2PRIA 5JCOA 4N8EA 3KCQA 3ZDFA 2JHCA 4O4LA 4ZJUA 5BQ3A 4R54A 4WJKB 1ZY2A 1L5RA 4WGFA 5D5PA 4YCMA 3TR0A 1CIVA 3AIIA 1RXIA 4NDAA 1FS4A 5U1PA 1YQXA 1E66A 4IXTA 5AOBA 1TKRA 1KFJB 3C5FA 3RF6A 4W9NC 3RYIA 1J7JA 5DOZA 4X20B 1IQPA 4JUBA 1M1NA 2HVHA 1Z00B 1T5SA 4UUPA 4ZEMA 3JYOA 3PA8A 4E09A 1PQYA 3TW0A 2WYVA 2QGNA 3AHEA 7ICUA 2PGAA 4O4LB 2PT5A 3LVVA 5E2BA 4MVJE 4FFVA 4MA0A 4TYQA 5J4VA 3QVOA 2ID4A 5DMHA 3T3MB 5LWHA 3VTAA 5C32A 5CDYA 4N8SA 1SCNE 3LOPA 2EXXA 2FWIA 1I6LA 3O8DA 3UO8B 3Q3VA 5E6RB 4F7WA 1E77A 3RVOA 1TK5A 3NKFA 3OY7A 3D3EA 4EDHA 2RLTA 1GR1A 2RI1A 3DB2A 4KG7A 3SZLA 3NBMA 1RKQA 3SZGA 4QZIA 2NO5A 2IVFA 1QK3A 2WHPB 2PUHA 2P9HA 1CR2A 4E4YA 4REQB 3VUFA 2W9AA 3IGFA 2C4TA 3KR9A 1YVEI 1Y89A 3MTAA 2HNAA 5LQNA 2R00A 1JLLA 3LCVB 3Q7PA 5ADVA 1ZX1A 3VMFA 1DG3A 1Z2NX 5FLXA 3IKTA 2FLNA 3EZXA 3TOCA 3QP9A 5LDHA 3ZC3A 2KFNA 4HWOA 4LKRA 4UTNA 5I4BA 4W5HA 1D2CA 2BPCA 3HA5A 3LUBA 4TRMA 5JROA 4PRZA 1KEEA 2B30A 1QAQA 1WKVA 4D3DA 3SC3A 4YP7A 3DHEA 4M53A 1D5CA 4RA6A 4PG8A 5KDLA 1NUQA 2HJ9A 5ENVA 3JQEA 4JT2A 4P38A 2X6QA 5LUAA 4OYHA 4ZPXA 2L69A 2X15A 1MTZA 4PZ0A 4CTNA 4TXMA 1I3CA 3S2SA 4PLCA 2OUKA 5ITSA 3CF0A 1FPQA 1AX9A 1VKJA 3B5EA 1XTPA 4JXKA 4OH1A 4P3NA 2DB3A 1J8MF 4FILA 3E9MA 5BSTA 3TM5A 3FYUC 1Z8DA 1PYDA 5LOVF 3RVPA 1G8FA 1D8YA 1EPUA 1YC2A 2P41A 4QZCA 2G4VA 3WICA 1KFEB 5F73A 5JSZB 4HS9A 4O25A 4KQXA 2D1YA 5KFHA 8ICFA 2H2GA 2HV9A 3LWNA 5KYUA 1I36A 5EHQA 3OMWA 1N0VC 4BMNA 4KXWA 4WOBA 3JARB 4C8LA 1ABBA 4XD7D 3S1AA 5FR2A 1G3QA 2XMGA 1PEAA 3H5WA 3STWA 3ZYCA 3L41A 5JWRA 5KQMA 2L42A 5DXAA 3RT9A 1CUAA 4ZVRA 3W3AD 1NBIA 1WUTA 3N74A 3WP1B 3DV9A 4MS1A 1QHEA 3U48A 3KZXA 1EGMB 5D5QA 4L4RA 5A1JA 4JMUA 1KYTA 1NQ5A 1SEVA 2JZCA 2WNIA 4N0DA 4KPUB 3LBFA 1T1GA 1XTJA 2B92A 3IEIA 1E32A 3DEHA 4P0PB 2F3UA 4ENWA 2E4XA 3ZI7A 3U26A 4DOBA 2Z1MA 3QVLA 4HCJA 4QGAA 3S8MA 1FC0A 3UYKA 3WLLA 1X9HA 1ZN2A 1CNEA 1QCZA 1EVQA 1DK3A 2R96A 4A82A 4AG6A 4U2DA 1EFAA 4Y2RA 1WE2A 1CUGA 3IOBA 3OTQA 5IBQA 5G53C 1KDTA 4GXQA 1EXNA 5DM70 2YASA 2ZR7A 4BJHB 4YDQA 5JJKA 3F67A 2PH3A 1X8KA 2QVCA 1CJTC 2W6PA 1NGSA 1OPXA 2F44A 2V9PA 5CXSA 3OKFA 5DSZA 3TLBA 4CT4B 5JDIA 2NG1A 4LVCA 3V8MA 1ACMA 2IYSA 2O1XA 4DQ0A 1NK5A 4O3MA 1L8QA 3W2IA 3SCZA 2JIBA 5KYVA 4GU5A 4IIDA 3E2IA 1RD4A 1E3JA 1BZYA 5IAGA 1QDUA 1JFLA 2W6JA 3C97A 3W5BA 3A1DA 2ZB3A 5B3KA 1WS6A 4TROA 2WV9A 4JUDX 1UOQA 3ICCA 4QT4A 4EZBA 3RM3A 4TUQA 3EEOA 1FL9A 3QIVA 4I4TB 3RSSA 4EPVA 2BI8A 4PONA 1PO7A 4QLBA 521PA 5TF0A 1SHJA 1JFFA 5DO9A 3NJ8A 3FW1A 4RZRA 3LX5A 1RBZA 1X9IA 3AEUA 4J9UE 5D01A 4G0UA 3SXPA 4V0LA 3K92A 3K9HA 2V4QA 1CF2O 3BUSA 4OI2A 4FR5A 3MINA 1QOPB 3V4OA 4IDAA 3RC9A 4AKEA 5KFDA 2H65A 5JEDA 4BB9A 5C0YA 3WWZA 3SPXA 1JPNA 1F7UA 1KYWA 1AT1A 2NQ8A 3JQ8A 4WZ6A 4U0KA 1VPLA 1U1IA 1QMGA 2ZWAA 3D6VA 2NSJA 3EE6A 3K0CC 4LSWA 4NENB 4BQQA 3FFXA 4L3WA 2Z1NA 2NU8B 3HV2A 4EFKA 2ZUEA 3ONWA 5GV8A 2QX4A 4RX1A 4G25A 2PUCA 1UMKA 3PUXA 4ENSA 5AI9A 2ADOA 4BFZA 5B37A 3SZ2A 3KOXA 4LNAA 1H9CA 3MM4A 1KH2A 1T3GA 3A7DA 3RYHB 1E2IA 4OGFA 3KFVA 1YUNA 2VP9A 1V8PA 2WDPA 3H8JA 3DTNA 5FOSA 3ETRA 5BYJA 4Y2XA 5U4XA 3GGOA 4UAZA 3NGMA 3AF0A 1Y34E 2XCUA 5L1IA 2WIJA 4B7AA 2VQSA 1NKCA 2Q1YA 4I55B 1PVQA 4E14A 3TGPA 1MT0A 1FXUA 4KU4A 1CJBA 4L50A 2IDKA 1PTJA 3MCZA 2J09A 3HRDD 2XCIA 3G2PA 5FOUA 1MO2A 2PIDA 3Q4GA 5CFOA 1FX0A 2AG0A 2FSPA 2WTNA 3LC1O 3OT5A 1AZWA 3S2ZA 4DCPA 5B1EA 1AKEA 1K8QA 3OJUA 2JZBB 3GEHA 1LFAA 1V7QA 3OF5A 4KTVE 3PY8A 3ZI4A 3WKCA 1GGJA 3O4FA 3GPCA 1PUZA 2GCIA 4FT4A 4JLPA 1NVVQ 4K3VA 3CCFA 3DTVD 1FYDA 3FTPA 4LJ4A 4RQ0A 2NU7B 4F9GA 4D92A 4O8CA 4YT4A 5L51A 4MOWA 1FCJA 5MN6A 5BV8A 2JHPA 1A5TA 2O3TA 2GCOA 4NF2A 3RS3A 2I4LA 4ZHQB 4MYDA 4E51A 5CBPA 4TKUB 4QDXA 4HNHA 4D96A 5EE3A 1UZLA 2H48A 1Y0BA 1YT5A 3HCEA 4IC9A 2VXOA 4BRUA 4WBNA 2D0OB 5J8YA 5BVHB 3HW8A 4FONA 1IN1A 1SRQA 2C5LA 3UIEA 1GGNA 7ICIA 1VTKA 2PFSA 3DVSX 4BNZA 1A95A 5EIEA 5I7SA 1L7OA 1SWVA 3CP8A 1AB6A 1MA3A 3PK0A 2GAIA 4EY3A 5I7WA 1IHOA 1M10A 4MW4A 4EYGA 3RGGA 3TQ1A 3HKDB 5EP2A 2B4RO 3IUJA 4I4LA 3A9VA 3VVBA 2NXCA 1FLDA 1FQJA 2GF9A 2WPDD 3STTA 3NNNA 3OE7D 8ICSA 1R0YA 4GLBA 4U2BA 1K88A 1UBLS 2QP4A 2XZTA 4HEA1 5DNYB 4ND8A 1U63A 3ERCA 5AXBA 1K4MA 2JLXA 3T9DA 3R0XA 3QOWA 1CRXA 3RS5A 3CTMA 4JJAA 5U4QA 4TTSA 4UFOA 3C15C 3RAXA 4FO6A 1OFTA 3BXZA 1S8FA 2GTHA 5KCMA 4Y2YA 1DFHA 4GI7A 5CH5A 2ZJ4A 2FWMX 2WNSA 1N34B 2Y8EA 3DAOA 1RABA 3E9DA 1YRBA 5J0OA 4QARA 4TWIA 3RSLA 3GLFB 3QE2A 4KUHA 2D2FA 4QZHA 4IJVA 2JJ8A 1HMPA 1G21B 2F55A 4BP3A 3VSAA 2ZDHA 4YPVA 1K86A 1PJTA 1UL1X 5KNDH 4GLLA 3S28A 3NYWA 2X5OA 2AD1A 4LHXA 1WNFA 3KLMX 1Z8NA 3S8YA 1OXMA 2DWOA 3ILVA 3K9QO 3LCUA 2JIQA 3CHYA 1OA1A 3JZIA 2VQFB 3RB0A 1ZQMA 4G8JA 4IXDA 4KEAA 4BV3A 4EGSA 3UMYA 3D54D 4ND2A 5K3BA 3KWMA 4JI1B 3ZWBA 5J58A 2JPDA 3MTIA 3UJ3X 4ZT5A 2V7UA 3WSWA 4YP9A 2JLVA 4KR6A 3ZK9A 2QRUA 4DLYA 4AZ3A 2V4UA 4XVCA 5KB3A 1Z5VA 2XY7A 3D2AA 4RY0A 4UJ5A 2HBJA 3NBUA 4NJMA 3VKVA 1SB3C 4FXPA 3X2SA 3IDOA 2Y76A 2WJJA 3EQ2A 5M3BA 4KXUA 2GWHA 3AUFA 3JYNA 4J6FA 2PNFA 1SU4A 2HQBA 3FLEA 4F85A 5J8YC 4JSYA 1XYYA 2O4UX 3LY9A 1CE8A 5E4TA 2HA4A 3PQ6A 4MKFA 1XNQB 3RU7A 3IKMB 4LTMA 1J97A 3C3AA 2C83A 1TUGA 2CL6X 2Y1XA 4ZAZA 2FV8A 1NK0A 2EIXA 3D1JA 2YVQA 2B34A 4IX9A 3I4CA 4KTQA 2P35A 3KKQA 3PIDA 4UBLA 4F8EA 5IANA 2WKSA 2TMYA 2VDWA 1RADA 3Q1LA 2M6LA 4P7GA 1L7VC 5DBAA 5AKKA 1G7SA 1JSZA 4M6WB 1V37A 2BF7A 2HLPA 3BL5A 5E2IA 4O5OA 4IRDA 2GPJA 1BE0A 4KXXA 4TKMA 2C2RA 5DMXA 5E3IA 5IF9A 2QTRA 3OZTA 4CDMA 3KO8A 4PU0A 4WXRA 4RQBA 3ON5A 4AZWA 4PQYA 2ZTEA 2Y0EA 3I2HA 3L0BA 3C8DA 1ZBDA 4RSGA 4N3CA 2A6PA 3ZCTA 3WKDA 1U5CA 1J9ZA 4KJXA 2MJLA 3H9CA 4ZKDA 5IHXA 4QQ8A 4DNPA 5IC6A 1GT91 4MH0R 5K0SA 1GSIA 4EFMA 2M2IA 1TV9A 2H1HA 2ZUCA 2ZJ1A 2NUTA 5C7LO 3G9UA 2BYTA 3RYFB 2IC5A 3H5LA 1T3TA 2WVGA 1U8ZA 4F2PA 3SVZA 2QJFA 4IUCS 1V5EA 1WW8A 1O1YA 2LD4A 5CLJA 4J0EA 4JWMA 2R11A 2F8LA 3LGAA 2VF5X 1CJCA 1MH9A 2G9ZA 3AONB 3IKJA 1CDDA 5E1DA 1DRWA 1UK6A 1W6RA 2IV2X 4HNVA 4ALKA 1IWOA 3L8GA 4QYTA 1AHIA 2IYVA 4QVKA 4M8LA 4V0NA 3DAPA 3JASB 2DKFA 3TZEA 1BEEA 1NBMD 3Q6NA 3U7RA 3LHKA 3OJOA 1RWQA 2A9FA 3E9CA 4AZ0B 3IIJA 2I4OA 2IE8A 4MRMB 3T9CA 4CKWB 3C3BA 1O08A 3WQRA 1QWOA 2YXEA 1F44A 4Q1FA 5IP5A 3H4BA 1SBQA 1KO7A 3O83A 3LBIA 2XXJA 3KKOA 3M6WA 4UB2A 4DA8A 1MB2A 1LI4A 4WXMA 2BPOA 1WLSA 1QC5B 3OZUA 4KN5A 1DJLA 4H6WA 1MW8X 5DN6A 3I6BA 3W1EA 2VZ9A 2OHFA 9ICOA 1C4WA 4BFUA 1SU8A 2AN3A 3SC6A 3AH8A 4UMVA 1NJFA 1M6VB 1ZC4A 3PYMA 1EQUA 1U7TA 2C7VA 3LOUA 5KUTA 4BVAA 2HIHA 2W55A 4YX9A 4ZVTA 2G1JA 1UF9A 1NXOA 1IPFA 2AL7A 2E3TA 2CLOB 3B1ZA 1K08A 8ICCA 3G5AA 3LHSA 4KWHA 4WZBB 1K6EA 4CUZA 5HK8A 1J0AA 1HQDA 4TL6A 3PVCA 4I0WB 3R5FA 1THGA 1A9OA 2JJQA 3OURA 2WYUA 1Y33E 4CEHA 2NO6A 2QUHA 2R8PA 3NJRA 4ID9A 4TLBA 5ED0A 3THOA 4M0DA 5BMVB 1TQ6A 4KN7A 2I3DA 2YHBA 3AFNA 2W8BA 4WLUA 3WL7A 4YCSA 4DDTA 1KO1A 3VDMA 3V6KA 3ZK7A 1GPUA 5JAIA 2AKEA 3M4NA 4TLAA 2GZ1A 1CKEA 1JU4A 4I9HA 3IOMA 4BDTA 4GVLA 5SV2A 2W43A 3IERA 5CNKA 5KYYA 3HA2A 4JI7B 2XO7A 1E99A 1GAQA 1I13A 3T3EA 1YZUA 3TFRA 1NY6A 4O8ZA 3FVRA 3K7EA 3QZ8A 1T4CB 1R6UA 1DTWA 2B8JA 3RUCA 1MAVA 1F5NA 2QRZA 3LY7A 4A91A 3GV5B 3LWLA 1WWUA 2KOBA 1H1LB 1XB2A 3GUCA 1UKYA 3C29A 1Y5NA 4O59O 4RM2A 2A1AA 3WL6A 3PSAA 1MC1A 5FPTA 4OOFA 5AW8A 2NXNA 1SV4A 1H2HA 1Z1VA 4QXPA 2PS0A 3Q40A 4I66A 4JAVC 2OHOA 3ND6A 1UK7A 3ICOA 4KGVA 1PSZA 5BN5B 3BMCB 7ICKA 3BK1A 2H5JA 3C7TA 3SJAA 1CUKA 1AGYA 1PUXA 1XQ9A 1TU4A 2D0DA 3ETCA 3MWGA 1IM5A 3ORSA 2FN4A 4OI1A 4Z4CA 1ECCA 4AS2A 6GPBA 5FLEX 4C6TA 2Z0MA 3PSIA 3HK2A 3H3XA 1ZWKA 3DWGA 1PEDA 1R5NA 4UNQA 5KVAA 1I2DA 2ZRDA 1TM4E 3BHIA 1XDUA 2HH9A 2EFGA 2H4YA 2Q3HA 5JAZA 3ETLA 1VPEA 1WA5A 1NQUA 3U1BA 2DUYA 2Z9DA 4HVLA 4H1WA 4ZO7A 1BNPA 4EJSC 5ALDA 1ZQDA 2ODTX 2R4QA 2F90A 2ZYDA 5ALJA 2PBRA 3QI7A 4C4OA 3L3FX 3R5HA 3EF3A 4OQFA 2GVNA 3DOHA 5GGXA 3TVTA 1F48A 1V9SA 2O6LA 4QJFB 3P4XA 4MWZA 1W35A 2M98A 1ZGZA 4OFXA 2HHSA 2ZIAA 3T06B 4BQSA 4IOMA 3UWOA 3TECE 4JENA 1S8NA 3QQPA 4ZT2A 3TEMA 2YV1A 3EXFB 3IMEA 4XIFA 3EVNA 2PM8A 3TAPA 3RRJA 2I7XA 4MSUA 4ZOAA 2KZZA 2O5VA 5SZIA 4HAXA 1V6SA 2OORA 4FDLA 4OJTA 1WULS 2D1QA 4AJ9A 1S4QA 1UOPA 1ZZEA 4OQPA 2OCAA 3BK2A 4YUAA 4DC9A 1R6XA 2GERA 4MRPA 5D1HA 4HAVA 4I50A 1W36B 3KL4A 2JEOA 2VSYA 2D1TA 4R81A 5G4LA 2AXQA 2WKWA 4S04A 4B7ZA 2RAFA 7ICPA 1ZJ4A 3HUFA 3H4IA 1V2HE 4MQMA 4G1FA 2QVZX 2XW6A 4WJLA 2QR2A 3D2CA 4EHIA 1NJ1A 1HURA 4DLLA 4O3FA 1RZVA 5CEEA 2Q49A 2YYSA 2RAUA 1J5EB 2V7BA 1P8JA 4ZRMA 4NVRA 4GGPA 2DH6A 3O84A 5FWDA 5JHGB 2FEAA 1HX7A 3LUHA 1AKNA 5HDBB 3E7FA 2AZ4A 4P5DA 2WHPA 3FAZA 2VUTA 2HL6A 3O2JA 2K4MA 1SOAA 1HK7A 2I55A 2ZIUA 3C3XA 5DHFA 4F9FA 4DCCA 4DLXA 3D2QA 1X70A 2P6RA 5AKZA 2C2GA 2V9ZA 3GJ8A 3Q3EA 3FM9A 3S2UA 1O87A 3PX7A 1E9AA 3OZWA 4ELTA 1U3VA 1YNSA 3G23A 1JVSA 4K6OA 4I50F 4EMSA 3JWGA 3R20A 4YP0A 1Y1PA 4YBRA 3AV0B 1ECPA 4EVIA 2WG0A 3UHAA 1YL5A 3D2SA 2KTQA 3DHYA 4WBSA 4IYJA 1VDMA 4H4DA 4AICA 1XDGA 2I6GA 1JDBC 1N62A 1G20A 1GYQA 1WU7A 4EYQA 1XF9A 2Y0BA 2WOOA 1ZJMA 5IBPA 4B79A 1HLDA 5HW0A 1GADO 2CCJA 1Z0SA 3CQ9A 3D5EA 3GO4A 4OLHA 5CTJA 1VHQA 5E6SB 3UAGA 2WW8A 2W2KA 2OUIA 4DRXA 2X22A 1CV2A 4B3HA 2IA5A 3W6OA 5KYWB 4EHHA 2IF2A 1KL9A 2P11A 3L9XA 3WGZA 1PNRA 1VSVA 2QB0A 2R8EA 4ALLA 4XIIA 3ENWA 3ETJA 1I1NA 3HMKA 3QPBA 1K92A 4QTZA 3M82A 1ZQEA 5BSUA 1Y6FA 1G6KA 3T9AA 3QWIA 4CF7A 4IRKA 1TZJA 4TL9A 3E7WA 1NBOA 3DEFA 1GLVA 4KLHA 2ZVDA 4O6VA 4X85A 1C4XA 3F49S 5KINB 4Z4GA 3MMSA 2H11A 3L7YA 4GDMA 3HABA 5CDTA 1YO6A 4US1R 4ZU1X 1XVTA 3HDTA 4JDPA 2BFWA 4BIIA 2ZREA 3UFXB 1LDYA 1XTUA 5JH7F 1ILEA 2DOKA 5DGDA 5E3HA 3GJ5A 3MWKA 1O89A 4BRSA 2JGDB 2XCQA 3CZRA 3L2OB 1JQKA 2K7FA 4RLFA 4L75A 1MLDA 2CMFA 3NBFA 4X3CA 4AJEA 8ICUA 2K7ZA 4WKBA 3T95A 4YXFA 3AEKA 2CXTA 2PRYA 2RJOA 5KNBA 1VKRA 1JQAA 2FOXA 4WT7A 4ZQFA 3TFWA 2WYIA 4OHXA 4MWCA 5BW5A 4C6HA 3OLYA 3CKLA 1YRYE 3WLNA 3C21A 1OKKD 2BFMA 2Z8ZA 4JEMA 4DN6A 5JI2E 4QTYA 3OKCA 2AR0A 4LZDA 1FP7A 1RHQA 2VYQA 4R1LA 2J3LA 2P9FA 4PH5A 2ZQZA 2YS6A 2YWGA 3DBHB 1BDJA 3ZGYA 4ICAA 3E8MA 2XYGA 5AW6A 1PR6A 2ZXUA 3BZCA 3KTAB 3DBVO 3FNEA 2GR9A 1JQBA 3G13A 5LDGA 4EBCA 3HNRA 1XXHA 3B3FA 1V1RA 1U2RA 1U4SA 1XQYA 2ZBEA 4GM1A 4GYYA 4HX5A 1T91A 4CG2A 1U98A 1XAHA 3BRWD 4KMRA 1OXVA 4LOHA 3K96A 1CJKC 1EM8B 1WKCA 5A4KA 2DTEA 4PVCA 1O95C 3CBQA 4U6PA 3AHDA 1ULTA 3QTBA 4OJYA 3GEPA 2Z5FA 2HMUA 1P1CA 1X2BA 5AVYA 4MCHA 3MWDB 1V4BA 4I2BA 4I55F 5TB5A 1LRLA 5IXSA 1YI0A 3B9RA 3ZEAA 2CL7X 2LKCA 3OAAD 2BPGA 2IJGX 4II7A 1V9CA 4EI8A 1UR5A 2P1RA 5EFZA 4RGYA 5ADUS 5IZ4A 1R6BX 5HTOA 1EFCA 2AEJA 2FOIA 3BDPA 3AG6A 1M1YB 1DC4A 3ED1A 1RHJA 5EJIA 4RTSA 2HRRA 4EGCB 4W9RA 5EKSA 5ICGA 1Y6ZA 2NRVA 4CTOA 2XEXA 1SXEA 2WM9B 4ON9A 1ZS9A 2PLAA 3D8NA 1OC4A 1QVWA 4QC2A 3TTWA 3ZHZA 5GONB 4G0VA 9ICNA 4X95A 5CK5A 1N7GA 1YS7A 2IRWA 4AXBA 3E22A 4EUNA 4F0JA 1I4TD 2EX0A 2H07A 2XB4A 4JB0A 1N75A 3P9YA 4RENA 1UA0A 3CVUA 2R6R1 4TV8A 4FOSA 5ICEA 5L7WA 2NMVA 2AFIB 3CEAA 1UDWA 2IWRA 5DT9A 3HKZC 2XNJA 4R5HA 1XRQA 4HDCA 4Z1OA 4E3WA 1TUEA 1FTNA 5EP1A 2E1FA 2E4AA 1WV0A 3WK7A 4H4EA 4B48A 3HR4A 2AE1A 2HCJB 1SM4A 3KSMA 1GVHA 1B8PA 2JKVA 3ELDA 4L72A 4WRRA 5EY5B 3TNFA 1YQUA 3KEQA 3N0WA 4RVFA 1AUVA 3A58B 1O0CA 4LYAA 3PW4A 1P9NA 4RS4A 5CDHA 2V5VA 3CH5A 4TS1A 4NBKA 3HT3A 1NR1A 1V2GA 3KV3O 1UAAA 4ZRNA 3AETB 4Z4FA 3FZEA 2PK3A 2FI1A 3F96A 4Y2UA 2JZOA 2A4MA 3N28A 1JSLA 3QIAA 2PH7A 1CUHA 3C4QA 4NYMQ 4YMGA 3PQ7A 2AK2A 1N78A 3TL6A 3A6FA 2GM4A 4OJOA 3Q10A 4BEVA 4K3UA 1E1RD 4RDHA 4BMVA 4WUVA 1WUYA 2OQVA 3UFBA 1I0ZA 1VJGA 2BGMA 1FQKA 2DZDA 2V1UA 3CTPA 3HVKA 1ZXBA 5K20A 5JY6A 1NFRA 2BEUA 1V16A 3ISBA 3KP1A 1E2QA 1H0SA 1Z9BA 5LQUA 1PQ4A 2K4HA 5FI5A 5HF5A 2BEVA 3N05A 3RF7A 1XMOB 1L4MA 1VB3A 4NCKA 4WE3A 5F51A 2WKQA 1VIVA 5REQA 3JQ9C 4L0CA 2W9BA 1J20A 3VVCA 2QTVA 2LYAA 5JT1A 1TCAA 1R8SA 2JFHA 4MHTA 3NMUF 1WTCA 1ULUA 1RLIA 1Z5UA 1OAAA 3PR4A 3L5OA 4V0ME 2BCRA 3ZE0B 1YQWA 3BZBA 4ZEWA 3NIWA 4C5CA 1SELA 2AZXA 1T8EA 3P9ZA 2ODPA 2Z4SA 4HQOA 1RRFA 5DSXA 1XG5A 2VQ6A 4RTOA 4M47A 2BHSA 1YL7A 2CLCX 4B76A 4RQTA 4UTXA 4X1KA 4Y6GB 1SBNE 5EWJA 3LJKA 3R7SA 1SB8A 3E18A 2V7EA 1YZ7A 4XQCA 1QQTA 1Z6PA 2H16A 3O1IC 3QUSA 5GTDA 5BUSA 1ISGA 3KT6A 3H2HA 3UMGA 1DTWB 1YONA 1ZCFA 3FPJA 3KALA 3E58A 1PV2A 3L05A 3F5AA 2V0GA 2MA1A 4F5NA 1HL3A 2JASA 1TX4B 1P3JA 4O2BB 5BNZA 4MW5A 2VI5A 1QPZA 4QUKA 1Y6RA 2XMDA 3G85A 2P69A 4R1MA 2WYOA 1QHHB 3KRTA 5C8VA 3KDPA 3EFOB 2F9MA 3P4YA 6PFKA 4DMFA 3DONA 3X2EA 1D4FA 1I2ZA 1ZPDA 2PA0A 4I1OA 5IH7A 2H4HA 3VMMA 3C7DB 4MI1A 5FBKA 1C0KA 1I2AA 3OJLA 4C7XA 3UW1A 4FDTA 2Z98A 3ZKWA 5FH9A 3ZUGA 3COSA 3FCSB 2HR1A 1N7JA 1ZQPA 3QUQA 2R8BA 2ZBFA 1Y3FE 3EVDA 3FNHA 3LRPA 4HJXA 2VTBB 3IBFA 3P7MA 2R8ZA 2WJHA 5BWCA 2FPGA 1BE8A 1S2IA 3QXSA 5DHAA 3T3DA 1KZ9A 4RHXA 2FDXA 2LRHA 4FVTA 2EW2A 2BI7A 4O33A 1CB7A 3DVQX 1YV9A 3PNKA 5T67A 1SVWA 3KAQA 4B9TA 3MDCA 2C5BA 2DG2A 3L7IA 4GZLA 1IXRA 5F9MA 1E2NA 5EJGA 3ESBA 4AM8A 1Z7GA 5JG7A 3PTLA 5I3ZA 5K2OA 5HTKA 2GD2A 4FW8A 5ALIA 2WM2A 1Z36A 5EIWA 1N4DA 1N2ZA 3OHSX 4ID3A 4IFEA 3QQ5A 3O9ZA 5LUBA 5I4CA 3RCBA 2ZITA 3PNQA 3TSAA 3P2JA 1N9KA 2QUIA 1FFCA 2GB4A 2I3AA 3AN1A 5C1IA 3MT7A 1HFKA 3UJ6A 2YY7A 4DIFA 3C6QA 5BUZA 4PLHA 4XGQA 2ES4A 2OG1A 3OLCX 3TZQA 2ZJOA 5MN5A 1YIAA 3H5NA 4CI9A 1RE0A 2XITA 4FPXA 1K2WA 2FVYA 2DE0X 4GO1A 4D3ZA 3AEXA 5I9SA 2D4HA 2WU1A 3G2NA 4RPYA 1X80A 4J6EA 1X8XA 2I1WA 1TU0A 1FUKA 2VQDA 2ISCA 3O6VA 2HVIA 2ONKA 2X8LA 1OGIA 2A9OA 3DW3X 3X44A 4EO9A 3WSTA 3HDJA 1UPCA 4BE4A 5LZ5A 1WF6A 2NTVA 2NV6A 3L84A 5HIAA 5FKJA 4QTUB 1H6CA 2W7OA 2R4UA 2WD9A 3DMTC 3FPAA 3G9QA 4W4TA 3CW2A 4ZVNA 2IDMA 4RD4A 5CHEA 4H4CA 5HIJA 3TK1A 3GBPA 3KHHA 4BGDA 5EKTA 2OCIA 2XZDA 2I2CA 4RK7A 3UG7A 2H17A 2V7WA 3LVBA 2W54A 2X6TA 4B71A 3Q15C 8GPBA 1C1YA 5JU6A 2K60A 4BFXA 2PCJA 3L4BA 2QARB 5KQPA 4XLZA 3SBDA 4BB5A 4R65A 1UXIA 4BMSA 3HJBA 1WOMA 4FDUA 1JPUA 3I8OA 5DDYA 1X1EA 4WJ3B 1J2RA 2MOKA 3EGOA 4F60A 3K1AA 2AEMA 3MPUA 3R5JA 3PHBE 3KJEA 3KPUA 3KXLA 2XWSA 3G8YA 3C2KA 1A6SA 3VR3D 4QUHA 4Z49A 3BMNB 3U5TA 4LFAB 1SR8A 4E2XA 3C8ZA 1Y80A 1NATA 4DL3A 4BMDA 3MZ0A 8LDHA 1KMQA 2GWSA 5ALFA 2GXUA 2KHQA 5G3YA 4V24A 3CWZA 1JBQA 1T0IA 4X8HA 3UOGA 5KDDA 1NURA 1X94A 4ZPJA 2BHNA 1KDOA 2MDTA 1BWPA 4X94A 5KG3A 5C80A 4IVRA 4LBYA 5BN3A 1U45A 1E0AA 5EHXA 5EQFA 5T57A 3JWIA 2XY6A 1TLTA 3PJGA 3W2EA 3GT3A 5J9FA 3SK0A 4C1NA 1KJ9A 1NE7A 3GDOA 3IQIX 2VWPA 1ZUNB 4GF5A 1C0IA 4IIJA 5FWXA 2C7RA 3FTFA 5HQ3B 4LI3X 5HJ7A 1PJ4A 2IDJA 3OO0A 1F8FA 1JZSA 1NVMB 3A3PA 5BOVA 3U4MA 3NG1A 3TKAA 1E1CA 3RVQA 1XUOA 3JATB 3K8OE 4J7XA 3TDKA 1L7XA 3V1KA 4KQHA 4DNOA 2O2JA 3NV7A 4L74A 5AFSA 3DJYA 2O0JA 3D4BA 5HM8A 2GJ4A 2ATVA 2IX3A 1BMDA 5F9FA 2K8BB 4GEGA 4CV3A 4FGSA 1E5QA 2EVWX 2ZRGA 3D1LA 3MAGA 5DN6D 3JQQA 4EUHA 2V8OA 3QHQA 4E4RA 1B4DA 5HWSA 3GRPA 1RXEA 3RRFA 2FYTA 1T4MA 2YV3A 4ITVA 5CLLA 2AJQA 2C99A 4NU5A 1DKQA 5ER9A 2ZBGA 2GUGA 5A9SA 3QXCA 2IEYA 5MFZA 3FNIA 3HB1A 3BRQA 4JP2A 2EL7A 4U3JB 3IHKA 4G01B 2NU9A 2SCUA 4R6XA 4WQMA 1WHSA 2OGUA 2XYQA 2AUTA 3CUUA 3EVZA 3WO0A 2KVSA 1JEDA 1FRNA 1HWYA 1O0BA 1JQJC 4OIFA 2FE4A 2R85A 3EVBA 4KCGA 4XTCS 5F64A 1C5KA 3MA0A 1PF7E 4B7UA 2WSSD 1YBMA 5JDIC 2ZB8A 3UYLA 1WY7A 3PJFA 4KIJA 1PJLA 1VG9B 4RELA 2ZR0A 2P65A 3GGDA 3DUWA 3N3BC 3RIXA 4G0MA 3CT4A 4KWEA 2HSJA 3J7TA 1RYSA 4BVLA 1U7UA 1Q0ZA 4MWTA 2P77A 5THXA 1A9TA 4GWKA 3PUKA 4E5UA 4Z3KA 4YQZA 1GZSA 1E9RA 3COVA 3AK4A 4BKMA 1FP2A 3C98A 3EWIA 1UM9B 4ZCQA 2QMZA 2I8CA 1A96A 2HGZA 1P72A 1N9GB 3K5HA 1KK2A 3QITA 5DT2A 1MB3A 2GBFA 4JVSB 1WAMA 3KJIA 3I0ZA 2C0QA 4OA5A 1BWRA 3GNQA 4PWYA 2WJ4A 2R1TA 5EJ7A 2IOYA 4RA9A 2YZNA 1PZGA 3H8MA 1KO4A 2HMSA 1TECE 1A9PA 3L04A 2FLWA 4J7UA 4OSOA 3U39A 5KFZA 4A03A 4KN4A 5IULC 1JEYA 4HXYA 2NZXA 1Z3EB 3F4LA 4BNFA 2BEKA 3KSZO 4M9UA 3HB9A 3UF0A 1WZIA 4V2UA 3MN1A 3KLOA 1C8BA 1TKBA 1GITA 2AYXA 1R3UA 3NFRA 3Q5DA 4JJEA 4UBMA 2ZAOA 5CR9A 2L18A 2PSEA 1STOA 5E4FA 1JG3A 3OIGA 4DJTA 1MVNA 4CM4A 2IHNA 1VA5A 3KYCB 1RMQA 4IQFA 4LKOA 2W9MA 1J5PA 1VPWA 3PC8C 1E63A 1PWHA 5HM6A 5GIPE 4A15A 1OF1A 1EA5A 2DT8A 2R6JA 2V9CA 3F5FA 4PX3A 5KOIA 2HT6A 3EWNA 3HG7A 4Z0NA 1U4NA 2GHIA 3OQVA 4OHWA 4ETMA 1BMQA 2KZMA 1FE8A 3A36A 3FDIA 3LUFA 2I87A 4GPBA 4NBUA 2K8CB 3WGVA 4RMHA 4WFIA 4FDAA 4LF4B 4DRXB 4NLCA 1VLZA 2FW7A 2VL7A 4ETWA 1M0EA 1EJ2A 2XCAA 1PFVA 2C5EA 1GR0A 2OLJA 2J5BA 3IDQA 5CTAA 1GN9A 5C5CA 4C4ZA 3IO3A 1Y81A 3TANA 2GZ2A 2OL4A 3GIJA 4H1HA 2GPNA 1DBIA 5IKMA 1JR3D 2BWJA 3EZGA 4K4GA 5DM2A 3DT8A 2VHJA 5CX1B 1V1RB 4BN4A 3ITNA 4YV7A 4EAAA 1LPBB 1KEVA 1RLUA 1WMAA 3I5AA 2ZM6B 1I7DA 1CZNA 1KYXA 4R01A 2B8TA 4RNMA 4UU0A 4BWGA 2H5XA 3Q6IA 5LZ2A 5DB6A 1KVRA 3R9WA 4X5VA 1HMYA 2ETXA 3BXHA 2W04A 1FNBA 2A1JB 1DE0A 1NLMA 3QGMA 4TWAA 2DMRA 3VGJA 5DYIA 1G63A 3LSTA 1UFKA 2NP7A 3B7PA 2BFCB 3OCJA 2HMTA 3DUFB 3RU3A 4S05A 1WXXA 3AESB 3OPYI 4XJSA 1YFKA 4MKIA 2Y68A 1IG0A 5GIOE 1EWRA 4MEJA 1R5BA 1K5OA 2RJ3A 1EEHA 3CXUA 1V8ZA 3CX8A 4MW0A 3OTWA 2SNIE 4HDSA 5ABPA 3OZXA 1ZQ1C 1KAOA 7ICLA 1PT5A 5A3JA 2CUTA 3OQPA 1VM6A 3UAVA 3BQTA 1L3VA 5LQCA 1JDTA 3QHPA 1UJBA 1H2AS 2VOEA 4EY7A 1M83A 4NG4A 3L0SA 4QD3A 4AY4A 3DCJA 3DMTA 1B42A 4NV3A 1LTHR 4P36A 4X7PA 3WMRA 3GRUA 4BO2A 1H8EA 3HPQA 1GTL1 4KLZA 3RK4A 3CX3A 4FFBA 2HMXA 4Z4QA 3L7LA 4BFWA 3KZVA 4D8YA 5JVDF 1LNZA 1NKBA 4IHJB 3NHKA 3ADKA 4RTNA 4PQRA 3ZWDA 1YHNA 5BN5A 1VPTA 5CITA 2ZYVX 3UT6A 3JQDA 4ARZA 2WJAA 4LBZA 2H3QA 2YHAA 1E2PA 1VPDA 3IT0A 3UGTA 3W5JA 5FWNA 2FUKA 2PYZA 4IRXA 1IG3A 3E1GA 2GTPA 4B6EA 4Q9AA 4NZPA 2VHEA 2YXBA 1KAGA 4LJ8A 5ENDA 2I1VB 5MGNA 2IV3A 1ZL2A 4TM7A 1PD1A 1TJ5A 4N0MA 8ICKA 3OJFA 4UBBA 3CPEA 4G8DA 1M33A 4JUCA 4E03A 1KVTA 4MWOA 1U80A 1Z2DA 4G9EA 2HX1A 5MF6A 1IQUA 2G5TA 3LW7A 1G20B 4JI6B 4DCVA 4KLLA 3P94A 5F5NA 3GNSA 4OCZA 2H2FA 2XQFA 3CNQS 1QSSA 1XZDA 3NWEA 5KT7A 3RLFA 3U7IA 3LO5A 1NKTA 2C98A 1HZZC 2HJVA 4U9UA 1K8RA 1F17A 2Y92A 1RBYA 1YQTA 2BISA 3KQYA 4N01A 4PYMA 2VT6A 1VJ0A 2LTAA 2XODA 3HKCA 3QVGA 4MV9A 1LTQA 1GGFA 3T38A 1V3QE 2XMRA 5DASA 1TMKA 1UINA 4AAYA 2ZKLA 3JARA 4UUNA 4P84A 1Z28A 5DVZA 3HEAA 4ZIRB 4NE7A 5AKXA 1XFDA 3R3VA 2PUFA 3PR1A 4L85A 1W0KA 4PYLA 3RADC 4DV2B 3CNHA 8ICGA 3AW8A 4ZMRA 4B9LA 2RKOA 2HHTA 2BRUC 2W48A 3ESDA 1U7HA 5EZ6B 1LBIA 4DANA 1ZETA 1XD2B 4GEKA 2AUNA 1S2OA 1AGPA 2ATLA 1ECLA 3GCDA 4MGEA 4D42A 2Z6AA 1CEYA 4AC9A 4RHTA 2EKDA 5EERA 5KG5A 4HRXA 1PYOA 2O19A 3C1AA 3M9XA 2YFKA 3NBQA 4MXDA 5DNUA 3B51X 2JGEA 5DBEX 1RMTA 1RYBA 2XXAA 2KNJA 5KOYA 2ZUUA 1F1JA 1JS1X 1Z4KA 1T6ZA 3OG9A 4AJIA 4F5YA 1E5TA 4TKLA 4CIVA 5ALVA 4ZI7F 5LNK1 2NZJA 4YYZA 4J49A 3LPCA 4ASUA 4KC0A 4KMMA 2BM9A 1KTVA 3KOYA 4L9SA 2ODNA 2MINB 2QQGA 1J2TA 3DAGA 4RABA 4BLQA 2CNWA 4TT3D 2G6TA 4N12A 4LX0A 4HGRA 4BQIA 3QVTA 1FUUA 3AZQA 2YV4A 1IXZA 1XZJA 3BMOA 4UTPA 3FOEC 4ZEOA 1ZN8A 3EDCA 4IJMA 1QC5A 3OETA 4Q4LA 2HA3A 1SXPA 2PMZC 1FFSA 5FP0A 2DSNA 4O5KA 4BLWA 4L95C 1SQGA 1ZQFA 4UB6U 1ZUHA 2CHQA 4LDPA 3RWBA 3VJLA 4BRZA 2ZT5A 3DZFA 4YCCA 3WLRA 3TI0A 2PUTA 2Z2YA 3CW2C 4JJKA 3PIRA 4JSTA 4IQTA 1TM7E 4LRWA 5FXMA 1BDIA 1TJ3A 2A1JA 2ZUBA 1TD1A 4R64A 1BH6A 3CV3A 2QUZA 1JHZA 2ECOA 2EHDA 4IJWA 2GCGA 3F8TA 1U0JA 2XUPA 3SJ7A 2C58A 2OC4A 2VUIB 4NP6A 5LQSA 5B1DA 2QWXA 1UC5B 1TZBA 1I94B 3MFQA 3JPQA 1U02A 3BIOA 3CF4A 3D3JA 3EDRA 2HBRA 4HFMA 4QDZA 5I7UA 4JS0A 3N58A 3JD2A 3AUUA 3D4LA 1ZGBA 4R8UA 2C5HA 5KFTA 3BS4A 1N2HA 3LW8A 4OK5A 4IRUB 3OC0A 2BMWA 3WLSA 2RK6A 5G2OA 3WV4A 4QZGA 3SEZA 3GLGE 1KP3A 4UB4A 1EDOA 3BGSA 4FB4A 1U0RA 2HADA 2QSYA 3F4KA 1T4CA 1OY1A 4NYJQ 3EISA 3DEEA 4ED8A 5AOCA 3ELWA 4AULA 4DJ5X 3W8DA 2IXAA 5CVCA 4TUSA 3K75D 2RK3A 4CMIA 3IVGA 5H68A 3LYLA 4LISA 3H0CA 2CV2A 2XGJA 3FJYA 2BUCA 1R88A 1KKMA 2Z43A 4UD6A 3C1UA 1MC4A 5H5JA 4W5QA 1I51A 4TSKA 4CDGA 1ZNZA 1VMEA 2AHRA 4W5TA 4MI9A 3ANTA 5FEMA 1NU6A 1L5VA 1MW9X 4TYPA 1TKAA 4BZWA 1SEPA 3LK7A 3IEKA 4MVJA 1KJQA 2Z5VA 2CB0A 2V1XA 2ZJ6A 1CULC 1WZNA 2PT6A 3KUXA 3O82A 3QVWA 1ORDA 4AVYA 5AD1A 5BR1A 2BCVA 5H1YA 5EXPA 4LJ5A 3L0CA 2EAUA 1RI1A 3MSCA 2JBHA 3NKLA 2VEDA 1F4PA 4K0RA 1FFYA 3FTCA 3WLIA 1NONA 2BV3A 2FP3A 3OQIA 4PZNA 4R0VA 5TEVA 1H66A 2DSTA 3LRXA 2Q6TA 3K9FC 2Y9TA 3WISA 1JIUA 2E4YA 2PVSA 3UMFA 3IN5A 2Y1JA 2EANA 1BVSA 1R6AA 4FI3C 3EPKA 2J3IA 1W88B 2G76A 4F5ZA 3W6UA 1VP3A 2WAAA 5KTOA 4FFMA 4YO7A 5H3HA 1N5WA 1T8RA 1V1MB 5ILOA 1RRKA 1V25A 2OXTA 3LLVA 4D02A 1MOSA 2MR6A 5BUCA 1NMXA 4MR9A 4MRMA 5FBZA 5LBIA 4CKWA 4RLSA 4ZXFA 2O7SA 1U6JA 2C22A 1D6JA 2AUMA 1TYDE 3H5AA 4DO9A 3JSXA 4LXQA 2IYFA 1JXEA 4ONEA 4YRMA 4DYHA 5AK0A 4IAOA 4XFDA 3O47A 2XGPA 3IIMA 5TX7A 1NVBA 3W2FA 4RPZA 4B09A 4BMZA 3TTXA 1JROA 1JHMA 1ZUD1 3M83A 5G40A 1ZGAA 4FR2A 4OB8A 2W7TA 3AF1A 2XECA 2ILVA 1AKYA 2OVBA 5D5HA 1R7RA 1X9SA 3KSAC 1XZGA 2AZMA 3I9NA 1L3SA 3LWDA 3KTOA 3IEXA 5BRNA 2VZLA 3R3JA 3LDAA 1CUWA 1MPXA 3I30X 1KP9A 8ICJA 2HDNB 4G3XA 3G1TA 3W8NA 2PMWB 5C37A 3KBBA 3EPPA 1ZNYA 1RG6A 1V6CA 2VHZA 3RROA 2XGOA 2A78A 4MA4A 4D6XA 4EY5A 1DZIA 3FRHA 3N53A 4II3A 4RA9B 2R60A 3REQA 3CEJA 3GWZA 3VR2A 4C4RA 4ZYVA 5BSKA 3TZBA 3WDLA 3TQFA 3GLFA 4KPFC 1ZH6A 4BYMA 1GARA 5FUWA 4KW7A 2HT1A 4Q3LA 5EMMA 3VAYA 2WTBA 4DQIA 2ASVA 4YWJA 1IMOA 4LQ4A 1CF9A 4QWWA 4KQEA 5T41A 4ZGBA 3R76A 3AR7A 1GQQA 3TTUA 1E62A 2GJKA 1V0JA 3TB4A 2ENWA 1BXZA 4HHEA 2Q0XA 2G5IB 1BAPA 4Q3CA 4R0MA 1U0TA 3U1TA 2QE7A 5JISA 3OOJA 3A9RA 5HQ3A 2VHVA 5E0OA 3TADA 1OTHA 1A7JA 1VE1A 1KPHA 1QTNA 2CYAA 1O6BA 3EXAA 3R4CA 4LHVA 1SBIA 2IOFA 4QSHA 4ZQEA 1E0SA 4AP6A 4YRLA 1XRLA 1GL7A 3IR7A 4WY8A 2ORIA 3RPEA 1Z2CA 2OXOA 1ZIXA 3T7DA 3TGLA 1UAGA 2XVAA 2ZJAA 2NVUB 2DKNA 4EJFA 5JU5A 5J2EA 1CY7A 2UZIR 5DSTA 2QMOA 2AJTA 3TD6A 3DE5X 3C5GA 2WTFA 5TIIA 3HXTA 5BWMA 3VISA 4DWJA 5K3DA 2LYBA 3CX7A 2O0KA 1PDOA 4ILKA 4DCJA 3R09A 2EP8A 1X1CA 1YB6A 3K5IA 4P9NA 4RK6A 1SD5A 4DMKA 4GE3A 1R0SA 1PGPA 2WHXA 3SZMA 1D5WA 1NSTA 2VK2A 1P2UA 2V58A 3H83A 1E3EA 1LF0A 2ZWPA 1ZQUA 4MK4A 4QNLA 1PGJA 3GAFA 1LSUA 2EFYA 2HSGA 3AWIA 5AJTA 4YJHA 3UHFA 1OB5A 1VSTA 2QARA 5B3JA 2UV8A 2AJLI 3LWMA 4F3RA 4F2RA 3K0SA 3CN9A 5AW0A 3K05A 1G18A 4L6CA 2RGGA 1AK9A 3KAKA 1Z16A 1TM5E 2GBIA 2NO9A 5AI5A 3QBVA 1NN0A 2ZZKA 4M8NE 1CFJA 4OJNA 3WYAA 1FDWA 1NUSA 1RLOA 2ZE5A 4ITUA 5GAJA 2R1UA 2NTEA 3TMYA 3AMZA 1FMJA 4R66A 2HSDA 3CWCA 4I1PA 1EXDA 1QZTA 4MQEA 4UXJA 3V1MA 4D79A 3IOYA 2AEEA 3THYA 5EYPB 1G5RA 1ORHA 3IDAA 3ORHA 4DV7B 2BM1A 2ZT6A 3KB2A 4FK8A 3Q2OA 4KREA 3X1WA 1DAGA 4KWIA 4M1QA 4GX5A 3RR2A 4YAKA 2PSDA 3HJGA 3VU3A 2A86A 2PVCA 3DYIA 4JR0A 1X80B 4L0MA 4LZOA 4QOGA 4PSVA 3WG9A 3ZCVA 2YIVX 1ZR2A 3WLKX 5JC8A 2OYCA 4IFIA 1K3FA 4HAWA 2WSIA 1Q6YA 4LDAA 1BC5A 5L9AA 4AQYB 3DHVA 4PRYA 1Q20A 1AA6A 3NOVA 3V8PA 3ND9A 4JT8A 4Y2GA 2Q27A 3WGMA 2J9GA 1W76A 2GJ9A 3H2SA 4BVHA 1LXCA 2ZSUA 4QGFA 1XC7A 3IT3A 3LPLA 2GBLA 1VLQA 3GPLA 5KOHB 3PNBA 1DFGA 1YRLA 1BCRA 3EXEB 4HBZA 9ICGA 4JN6B 3LPMA 2HLDA 3AEUB 4HXFB 3PRJA 2JAWA 4WA7A 1J2MA 1T0PA 4MV0A 3TI9A 5C2JB 2RK4A 3R0JA 4E5PA 5L95A 3BF7A 1E4EA 3LQYA 2VPZA 4RS3A 3SLRA 7ICQA 4BU1A 4C5BA 2HV8A 5EIAA 3D3WA 1JZQA 3OCXA 4UHCA 1XJ5A 1KQOA 3AL2A 4J90A 1AU9A 5EE5B 5FBWB 1YS4A 2OAP1 1Y4ZA 4QW9A 1EVZA 4LY3A 4EZIA 2YDXA 3LKBA 4LK3A 1Z0FA 5ALWA 1L6IA 5H83A 3AR4A 3FWYA 1AV7A 3OZEA 5EZQA 5KKCA 2X77A 1FX0B 4LZWA 3I05A 5IN4A 2HD4A 3LA6A 2Z2XA 1SO8A 2KHVA 1WCYA 3E9EA 3H16A 3KVRA 3MCVA 3PSHA 4MCJA 4D57A 2CLKB 3SFVA 1JG2A 3EK2A 1GCAA 1A77A 3D43A 3VR5H 5DK4A 3GJRA 3JZFA 3G2HA 4QGHA 3NRWA 3FE2A 5AHXA 2MSNA 1TVCA 3CLRD 2YOHA 4PCUA 1CY2A 1P5ZB 4GPIB 4B3XA 4JQOA 5HZKA 3STHA 2J3JA 4YWHA 1JRLA 1KTQA 3E61A 3JQ6A 2YNMC 1PDWA 1QLHA 4QU5A 4C21A 2OORC 3R5XA 5J63A 4NC9A 3FYCA 4OUKX 4Q4CA 2RHMA 1T94A 3DZJA 4H27A 2F4VB 2JW5A 3VC2A 4A1OA 3AR6A 1O5OA 1R8XA 4BO4A 2XCTB 1E9CA 4PLPA 3ZY4A 2O59A 1K6IA 1MCZA 4IUBS 3O3OB 4JCCA 5LQMA 4BB0A 3BB3A 2QORA 2H2AA 3CZ4A 1HBJA 4JXXA 1RP1A 1YDGA 1RACA 5JRJA 3T7SA 2VYVD 4XDZA 3PF8A 3FPCA 1R4MB 3IPXA 1CEXA 1K4KA 1P7VA 1Z38A 3KOOA 3E6AA 3F5MA 3HL0A 2Z04A 1N2CA 3PKIA 3S29A 4NCBA 2BQRA 4GBGA 3CPSA 3LBAA 5C5DA 3JX9A 3QXXA 1PU2A 1M1UA 3H2ZA 2VANA 4Q02A 1SKQA 3TZ6A 2ZRLA 4AYWA 2WP8J 3GIKA 3L6OO 3RF9A 3ZWQA 4EELA 4BX9A 3L7JA 1VLMA 2IEBA 1Q17A 4FZRA 4JB8A 3JSAA 1HDRA 5ED4A 3IB3A 5MGBA 4RF5A 3U7GA 3JRWA 4A8PA 4DR5B 1D8AA 4ZDWA 4G23A 1HR0B 3IS3A 2J67A 3UENA 1C7EA 1PW5A 2OQIA 3EVFA 4DDUA 4LNUB 4I4NA 2J6BA 3WQHA 4L8VA 4C7OB 3F5QA 2YC2C 4L2IA 4LPKA 1P8AA 4LTNA 5JYCA 3DHWC 4KUEA 5JZVA 2JI4A 3DE1X 1D2HA 2GYYA 3UJ7A 1H5NA 3FSGA 5BV7A 3WKBA 3MR3A 1ZQBA 1JR3A 1XZCA 3BBLA 3DOCA 2J0EA 2J3MA 3NVMB 3OJWA 3P9NA 2CHVA 4WZAE 3GJ3A 3NYIA 4RWEA 4PXSA 1TAMA 5DYTA 1J07A 5I51A 4QPNA 4NIMA 1A5BB 1FDVA 5REQB 4C14A 3T5TA 5K8IA 4F97A 3MGHA 4Q3AA 4ETNA 4TM8A 5J4LA 5K03A 3Q1KA 2V7TA 4OGWA 1VLHA 1ECFA 4AQDA 2HQRA 4IGAA 2LBOA 2YB1A 2F8KA 1M2OB 1U7DA 1NQXA 1WIWA 3UXPA 3PFGA 3VBEA 1P18A 1L5ZA 3M9LA 3MWYW 2V0NA 4JYMA 4B3MB 4D97A 1E6LA 4YUVA 4JBWA 4K9RA 3TXYA 1SUIA 3WKEA 1W2GA 2CW5A 1YUMA 1JIHA 2FCRA 2P90A 1QK5A 1KDHA 4YJHB 1YFZA 4Z8YA 1EFRD 2OD7A 4MFCA 4U5XA 3VOSA 4NV0A 4X61A 5ALKA 1VJTA 4GE0A 5FBQB 1HG0A 4GLJA 4FFDA 1JIJA 2OK8A 3L9WA 3IQZA 2AI1A 4TPKA 4LF6B 1Z15A 3E53A 3KEOA 1JG6A 3PXCX 1Z22A 2D1SA 3O0FA 2BEVB 2XMPA 2J8ZA 2A1TS 4H77A 5BT9A 5E7IA 2QBYB 1DXYA 1M9NA 2ZBDA 4LEIA 3QKSA 4XOUA 4B5LA 1UDBA 3H9JA 2PFOA 1IZ9A 3BXOA 3PUWA 3Q88A 4RNDB 4U6NA 1H9AA 2X2OA 5IU6A 1ZEJA 3DLCA 4GFJA 4UCWA 3ROKA 2IIBA 2HBZA 1ZIOA 1DC3A 3JCZA 1U3FA 2WA2A 1W46A 1GNQA 3PGJA 4LRTB 1Y4UA 3SMQA 2ZM5A 3FMOB 2G3YA 4ECVA 3DF9A 2PL1A 4ENTA 4KQKA 5D6NA 3AP2A 4ZZ2A 5FI1B 2OMKA 3EZ2A 3ELYA 3IAM1 1FFEA 3NAMA 3P5BA 3PTZA 4KQGA 3WFIA 3QBDA 1FW8A 3CRW1 4MPPA 1A9RA 1KEEB 4RDIA 1L4BA 3KT8A 5TR9A 1AIPA 3TLJA 2AMVA 1N5RA 3HSSA 2B7BA 2YHSA 2XA2A 1GGMA 2Z2ZA 4G4GA 4C4TA 4UAWA 2Y1GA 4KFSA 2VJPA 3LC2O 3BQ0A 1HQCA 1WMSA 1YZTA 2YOFA 3B6IA 3H18A 3M8KA 3N75A 5GWXA 4QUIA 6AT1A 3AYZB 1FTWA 2ZJYA 1H2XA 1ZG3A 1GN8A 2O0HA 1XKTA 2X2EA 3P9SA 4BZQA 3ZDYB 2YV2A 1YBVA 2AOUB 1B16A 2JCGA 4FKZA 4PCVA 4TXJA 3R7LA 1OXTA 5EMKA 1JMKC 1OHHD 2RIRA 4TTAA 3DCNA 3EFBA 3RTDA 3WLQA 1Z6TA 1ZYUA 3DP7A 3AHJA 2MIIA 5LU9A 3IUPA 1XR3A 1EM8A 2PQ6A 4F45A 3R23A 3FBGA 2XLBA 4LC1A 4Z1MD 2VG8A 1HOTA 3HJEA 1IUNA 3SHFA 3X1JA 1K8ZB 2DAPA 4JL8A 3EX7C 1VBMA 2K89A 1XNSA 5IDQA 2ID8A 3I3OA 1SZHA 3IHWA 3GN2A 2DL0A 1QCYA 3RRBA 4Y7CA 3UWDA 1OXUA 4XUGB 3I9OA 1RCUA 4AFNA 1KYIA 4RD1A 4RL4A 1RZ3A 1SUWA 1Z3IX 2WC1A 1ECJA 2FQ1A 1V3UA 3GLHA 3VBCA 4AIIA 5FORA 1KGDA 1W5TA 3D6UA 1NI3A 5DCWA 5KTNA 4PHPA 1RVV1 1BVHA 4IWXA 1FXWF 2W3SA 4RMNA 4J9PA 2HQSA 2X4IA 3PWZA 3SIRA 5I8WA 3ENKA 4PQFA 3UN1A 1W36C 2WKRA 2UVUA 1OYWA 2GNAA 4X7BA 1C3OB 1HE1C 3D4NA 4HAZA 4KTTE 4QOSA 4UARA 1UWCA 1OIVA 5LD2B 3B6JA 3MIZA 3Q9NA 3CX4A 1MC8A 4KXVA 4ARUA 4RQ5A 3QBEA 2CXUA 1B93A 3NT4A 4UDNA 3ZGOA 4UOZA 2K4IA 4OI4A 3KTQA 1XHFA 1R8YA 1YCFA 3OTIA 2PL3A 4OHBA 1QFYA 2B5VA 1H2FA 1CIJA 1VZ2A 1ZHOA 3VNBA 2B25A 3IRVA 1IY2A 3V4VB 4D9NA 3SDZA 3QKRB 3ZGVA 2GPWA 4M9LA 1A8UA 4FNGA 1IBCA 1T4GA 3DV0A 3LCRA 1XJCA 5TQVA 2Y9UA 1FFGA 5KFCA 3CYFA 4EAQA 1FRVA 1H5QA 4KI7A 4N40A 3OD5A 1P1HA 5G0TA 1QSGA 1U7WA 1NBAA 3TNYA 2REBA 3B89A 1CUCA 4IH4A 1NVXQ 4Q4JA 3IVMA 2V9WA 1G8KA 3IT1A 2D8MA 5K0NA 1HE5A 3EXHC 3RH0A 4UZFA 2Q0HA 2WABA 4W6QA 4OBXA 4JNCA 2Z4RA 3ME5A 2JAPA 3PCXA 4LHWA 4XVUA 1AS2A 2D5IA 2Y1EA 5LLTA 1XZLA 1VKOA 3FTEA 4F5PA 2JAQA 2LBPA 4O29A 4BO1A 1YZLA 1W52X 5GJVC 1GXSB 4RIIA 3DLBA 4BQOA 1H1DA 2HJHA 2D6FA 4YVFA 1QORA 4FMDB 4LDZA 1P7ZA 3D6AA 2C3OA 5C8YF 1QR2A 2BKVA 1OLUA 3IPYA 4PL2A 4Q43A 3CE6A 3T34A 3RQSA 1U2TA 2FDCA 1Q15A 2JJ2D 4PC3A 3AF5A 3LG2A 5K4GA 1TZMA 5GJWC 5J2TB 3QA3E 4YAOA 4WEOA 4LDNA 1QQ6A 3JQ9A 1J0CA 3A1WA 3QUBA 5KYWA 3ZJVA 1BKYA 4XCVA 5TRTA 4NWIA 4RFSA 1HEUA 2Q4OA 4C0QC 2XIDA 3TVDA 4YMNA 3PHJA 4QO7A 2WE8A 4QX6A 3VDRA 5FWYA 4B3GA 5DGIA 3C28A 1J39A 2VIIA 3I8SA 2VF2A 1JHYA 3I2JA 4HVCA 5IT5A 5K09A 5FULA 1N5IA 4LHEA 4R2MA 2R4TA 1GPDG 4U9IS 4BFYA 2QVBA 2CFSA 2HJGA 4P86A 3RIYA 3OLVA 3DR3A 5AW2A 1XMQB 1HTBA 3H0KA 4MF2A 5BN1A 1UKEA 3ROZA 1GCIA 4AKHA 3R3XA 4DBLE 1QIKA 2AJDA 3AUKA 1QGZA 2DQZA 3FKSD 3JWPA 4ZC8A 3B12A 4FHCA 3WBBA 3IT2A 3UAXA 4Z7JA 1CUJA 3W7VA 1J5XA 2P9BA 3LHFA 2MAXA 1QXSA 1ZBQA 2BFFA 3ESXA 3SI7A 2Q0ZX 2JFXA 4OSEA 3LPNA 1NBME 1JG4A 2VBFA 3V8NA 2V97A 1BG6A 1I3KA 3AR8A 4HGOA 3SEIA 2G36A 2H59A 3LV8A 3VR6H 3P2MA 1KK1A 2HY7A 5F1YA 5HUHA 3H8WA 3H7AA 1MO5A 3O74A 2W6QA 1SVUA 4FHFA 4XSGA 3B3QA 5KYYB 3EDMA 4US8A 1PS8A 3BJYA 4PFSA 1R5JA 3O8RA 4LCEA 4KSCA 2CXPA 3COZA 3D3QA 2VRWA 1CXZA 2JIDA 1PJQA 4C6SA 1TEZA 1FYXA 4Y8VA 1CDEA 3GT7A 1WVMA 1XEWY 3CNNA 4QZEA 1GIAA 1OIWA 4X1OA 4G84A 1NT2A 3DL2A 4RTQA 2WFMA 3OLWA 1F20A 2G04A 3LZ6A 4EW3A 2XC9A 4ZIRA 2IS4A 4HB4A 2ILTA 1C3EA 1E79A 2Q8PA 3E9NA 1OIXA 4KHPB 2CDNA 1LDEA 1DC8A 4ND4A 4YAJA 3WL3A 1NUUA 2VHCA 3ESYA 2JDID 3ANNA 3WZLA 1UBUS 1OT5A 4IGIA 1QANA 2HOFA 1AKRA 1QGYA 3RFFA 1PQUA 2Q4TA 1DC5A 1N2EA 1JQLB 2CE7A 2HQ1A 3F1KA 1S5LU 3G02A 1DWQA 2ZULA 4OMCA 2X41A 1HFEL 3PPYA 5AI0A 4FD2A 2KP7A 3HHEA 4QHYA 3GBSA 1GTSA 4DABA 3WA7A 4PGYA 1JAYA 2XE8A 3ENZA 2VHWA 4S1OA 1RRMA 3D0KA 2F8TA 1AA9A 1EI9A 5KSZA 2WT4A 4C6RA 1X39A 2QA5A 1C8KA 1FDUA 2QAJA 2QI9C 2X0JA 3GJ7A 4L16A 2FR1A 1PFUA 3I04M 5EIHA 2Z2KA 3VHRA 4CCSA 2YX1A 1RWPA 4IGFA 1ISSA 1V4NA 1JDBB 4JYBA 5ESXA 3T52A 1ZGHA 4RQ6A 5CRXA 1US8B 3AW9A 4RPHA 4TMXA 3UT5B 1WY5A 4OJ6A 5EWLB 1RAEA 3WGIA 3IJPA 3O38A 2E48A 2KVCA 3T4XA 1GA6A 3EA4A 4C80A 2C2MA 5JAPA 1OXXK 4YR0A 4KQ9A 3W4KA 3I5XA 2IPMA 1K1SA 2BGWA 3FIUA 1M2FA 4KPYA 2IIVA 2DWQA 1NQWA 4P31A 1M7GA 1UPBA 3MJFA 5AXDA 2EFHB 5T14A 1L2TA 1R27A 2Y1WA 2C2HA 3X1XA 5WRFA 5AVZA 2ZU6A 5KU7A 4I3FA 3UK2A 3WMGA 3AVQA 3PT5A 1W7AA 1Z0KA 3ZS8A 4WMLA 1IONA 4NH0A 4X6YA 1BPDA 4AF6A 4CG1A 4E1BA 3A6GA 2QJOA 3IO5A 2DUUA 4AMVA 4C3OB 1NWHA 2JBAB 1RC0A 2HO5A 4Y0NA 2B3DA 3WGHA 4BNJA 3L93A 1YVPA 3PWSA 1EFLA 5E9QA 1V85A 2NO7A 3NR2A 1VHLA 1R0XA 4Z51A 2Q6LA 2BPFA 3V7NA 4EJ2A 4N0QA 1DJQA 3JQ7A 1GGEA 4OXNA 3R41A 4JY7A 4EY4A 3AJDA 3MMNA 4UAJA 2IP2A 9ICXA 3BVPA 3K73O 2OFFA 4ECRA 1JI0A 5ALEA 2DVMA 3KSDO 3ZU5A 3GFOA 2CJFA 2KE5A 2HOQA 1L5WA 5FJJA 3T1YB 1CVLA 1JWLA 2GAFA 5F1PA 4KR2A 3I4FA 4JLBA 2VTBA 3G79A 3E2EA 1HUQA 2Q3FA 5BSHA 3H1GA 1XQWA 1S96A 5BSWA 4MFFA 4GQAA 2AV6A 4MUAA 3BTOA 1X0XA 4YBZA 5PNTA 3EPJA 2WA1A 3Q9UA 4QYWA 1Z0IA 4PRKA 3F7TA 5G4KA 1K3UB 1DHRA 3VKFA 1LB2B 5FD8A 3KKEA 4I9UA 1XO0A 4NDNE 2O8FB 3SQOA 3W8EA 3HKBA 3DMRA 4R5MA 4PG6A 4DY4A 4HDKB 5I7EA 1MQAA 1W5EA 1WD5A 2WY2D 4E2FA 4H6PA 1EJ0A 3FYDA 1IZYA 1EX9A 4K8RB 2MUTB 3GFSA 3V48A 4EK9A 5C5JA 2J9YB 2PSSA 3IOEA 4DLBA 1QBKC 4PLTA 1KS2A 1F9EA 2OV8A 5JCPA 1DKOA 3DMPA 5JSQA 4J1TA 4C4XA 2HMWA 2R00C 2EF1A 1BXRB 1U0GA 4B81A 5F3WB 3N8GA 4JUAA 1LPOA 3BTVA 3OCCA 1FX1A 3C6ZA 1GUBA 3HCNA 2PXHA 4O2RA 4TSRA 1C8VB 2QRVB 1EGQA 4HUJA 2I62A 2V3VA 4BQRA 2XTNA 2NV0A 3PFCA 3A1SA 2AN5A 1R00A 1XRRA 1E3WA 3PNSA 4KOEC 1CK4A 5CXUA 5J4YA 3JQGB 4G4JA 2YZMA 1BTOA 5DOVA 1WCIB 5CJ2A 4YR7A 1OU0A 3P19A 3ZWOA 4FS2A 1Q21A 2KLBA 4KR3A 1ARZA 1JWBB 2W22A 4JJ6A 3Q5EA 1KAMA 1RP7A 1HM5A 5DYNA 2NM0A 4OQLA 4QWAA 4DZZA 5JQGF 1QVZA 3EQZA 1D2AA 1JUDA 1HL7A 1WHTB 3N5CA 4MUXA 1I14A 3Q72A 2O7RA 4FP9A 2GEBA 4DM7A 5AVRA 1V71A 1UZAA 5J2IA 4FZVA 3F2DA 1O77A 2XLCA 4JI5B 2GN2A 4NL9C 1I01A 1ATZA 1DDGA 2FMKA 4F3CA 2WWYA 1N8TA 1NR5A 3DHNA 2YJZA 3G5LA 4IO1A 4MVWA 3MLEA 2BHTA 4C20A 3BS5A 2G1AA 4EMUA 2PJRA 1RYDA 1SD2A 1T29A 4LHSA 5HMLA 2UVWA 2WBLC 2G9UA 4AO6A 4JYAB 1P7CA 1YBHA 4KV7A 2A3RA 2P6MA 3C41J 3NYQA 4AWBA 2ATCA 1NJ8A 4OK6A 2RCYA 1W1IA 1HRKA 2E6KA 2QB5A 2VT3A 4IUYA 5D84A 4BNUA 1X1TA 2SCUB 2MSEB 1YCHA 2OBNA 3D59A 3D7KA 4Q47A 3KHLA 4F4XA 2O5CA 4TLDA 3W2GA 5LDDC 2BTOA 1LQ2A 3NXSA 1N2CB 3S1SA 4NFYA 4IIJF 5CAEA 3PDHA 1GPKA 4F4DA 3MJTA 1K6MA 4RCVA 4OHVA 1LRKA 1ZOIA 5BQPA 2BR5A 8ICQA 3DFFA 1R74A 2FH5B 3PQ3A 2HQOA 2ZJ2A 2K8AA 3L8CA 2VN8A 1OZGA 3O8QB 3WHKA 3HPOA 3I1IA 1RJ9A 1AMNA 1QG4A 1IM8A 4MINA 2PQMA 2Y2VA 1R0KA 2CL5A 3O9MA 2ZYTX 1GG9A 1ENOA 1G2OA 1I10A 4G41A 4K05A 2RG1A 1DGJA 4YN4A 1QIEA 4WASA 3QWAA 3RFXA 2G7ZA 4KQWA 4LS3A 5E8JA 1ZMOA 3N70A 1XN4A 5I7VA 2PS1A 3WB0A 5HKOA 5IKXA 4MQLA 2UYOA 3LFUA 2J31A 2R9VA 2PXAA 3T1OA 5G0UA 4YJ2F 4GKJB 1GSOA 1KTIA 8ICAA 1MFPA 3AEZA 3IL2A 5CG1A 5CA7A 2PWAA 5J0TA 4HYTA 4TTQA