2BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*C)-3')
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bdpA01
3G6YA 4M42A 3S3NA 5KFCA 4FLUA 1C6VA 9ICXA 4DU3A 3HL8A 3ASMA 4M2YA 2YNFA 1IO2A 4OKKA 1KFDA 4RQ5A 1ZQKA 4BDPA 1FKOA 4M47A 4CEAA 1S6PA 3PX6A 4KLOA 4W5QA 2VWJA 3RJEA 5J2GA 2D0CA 3NDKA 2FPKA 3CFPA 1U4BA 5EWFA 5KG0A 4YR0A 1ITGA 1JXBA 3AVCA 5IIMA 2FBXA 4CHPA 4UBCA 1VSJA 9ICAA 4DL4A 4TUPA 2R8KA 1XHXA 2DTUA 2I5JA 2J6TA 4YP3A 1LAWA 2BHNA 4R8UB 3LWMA 4IBNA 4PGYA 4KB0A 1IKVA 3VQBA 1Z25A 3KHRA 2X6SA 1RT1A 4YD1A 4P4OA 4DO9A 3PW0A 3OYNA 3SNNA 4FBTA 4DTMA 4O3NA 2VA3A 1TK0A 4CK2A 3WNGA 5KG7A 4CF9A 2NRWA 3JPOA 1NOYA 2PFQA 1BI4B 4WE1A 4JS5A 3DLRA 3AVLA 5J0TA 3HPGA 4DQRA 4ZTFA 5KG5A 3O3HA 4C8LA 8ICLA 1BL3A 2ZUCA 1ZQFA 3CYMA 3NBPA 3OYBA 4YFKA 3QZ8A 5DGAA 3HX0A 1LAVA 3DLGA 5J2KA 7ICGA 3AO4A 2YNHA 3LDSA 4ECRA 3U3YA 4ED8A 1TKTA 4F4YA 3LPTA 4X5VA 1NKCA 1KSPA 3PNCA 3G0ZA 4HCCA 4I29A 4NLNA 4FXDA 1S1XA 2ASLA 4M9GA 3OJSA 1ZQUA 3QEVA 2ASJA 3M8SA 1QS4A 3VQ7A 3OYEA 1C7YA 4CF2A 4M3YA 4RW6A 1X9WA 4BWMA 3NGDA 4DSLA 1NK0A 4LH5A 4PH5A 4FJIA 3AVAA 4O44A 2RPIA 4CGIA 4HHTA 1NK5A 3KD5E 3PW5A 1NK7A 4MEXA 1HJPA 4L8RB 3FYHA 3JYTA 2VANA 3VA0A 2ZTEA 4ZTJA 5DB7A 2XGQA 4QZGA 4DS4A 5KT3A 8ICJA 1CEZA 1F21A 3PMLA 3C6UA 3NE6A 3JPTA 4J2AA 1QQCA 1NJWA 5KFAA 4O5CA 4R65A 3AU2A 3C94A 2G8KA 1A5XA 4O9MA 4RNNA 2JZBB 5KT7A 2XO7A 5L1IA 5J2DA 4ECVA 4Y1DA 3BDPA 3AVMA 3VQPA 7ICFA 3EYZA 4ECWA 1S0VA 4B9LA 4O55A 8ICXA 4PY5A 3TQ1A 4M9NA 1B43A 4KO0A 5L1JA 2YV0X 4I9QA 1RT6A 4YCXA 1LWCA 3ZSXA 3SUOA 1XC9A 3QEPA 1RT2A 2B4JA 5KRTA 3THVA 3ZT1A 3JPQA 5KFJA 2UVUA 7ICVA 4FBUA 2HHVA 5J2MA 2YNIA 1C1BA 1Q9YA 3RBEA 2P1JA 4ELTA 5HMLA 1BVSA 3T19A 3H7IA 2KQ2A 2PY5A 3P5JA 3AVGA 3QZ7A 4E7JA 3PW2A 3LP2A 1HPZA 5KFSA 3C2LA 1WCLA 1ASVA 3PX0A 2DFLA 1QSYA 4E19A 5CA7A 3AA4A 3GFKB 7ICTA 1ZBLA 1TKDA 2W9CA 1SV5A 4DOAA 3RWUA 4LSNA 2VA8A 3OYDA 2OZMA 2A1JB 5KFBA 5CWRA 3AA5X 4I2AA 1D8LA 4ECYA 3C1YA 1VSIA 1N48A 4M3RA 8ICIA 4DFPA 1NKBA 5BPCA 3ISNC 2PFOA 1RZTA 4KPYA 1EKEA 8ICNA 4ED1A 3HK2A 4UAWA 1LWFA 4EZ6A 3C6TA 3BQ1A 5DG7A 3AVFA 4B08A 1SUQA 3V1OA 4KI6A 5J0PA 3MXIA 4QZDA 1RBSA 4I2JA 1SL2A 3A2FA 4GC6A 1Z26A 4P4MA 5J2IA 1VSMA 3BJYA 2GWSA 5FRMA 8ICEA 4J2EA 4YN4A 1NJYA 9ICBA 1YVUA 3K5OA 2DPIA 5C25A 2BDPA 3V4IA 3TFSA 3V9WA 3LP0A 1HNVA 5EOZA 5KFTA 3JPPA 4M3XA 3SZ2A 4CIFA 2VG5A 1QSLA 1U45A 5DQGA 2KW4A 4RPXA 3K5NA 3MR3A 3VQ4A 4IDKA 4DL5A 2HHTA 1JXLA 1W0HA 4C8MA 1J5OA 3OVNA 4FK0A 3PVXA 2W9BB 5CHGA 4JV1A 8ICAA 3PX4A 3K5MA 4J9SA 4ECQA 4M9HA 4FYDA 4KTQA 4GXKA 4FZXC 1RDDA 7ICKA 4M45A 4MFCA 5CR0A 3RRHA 1TGOA 2B6AA 2WTFA 3B0XA 7ICJA 3NFAA 4N47A 2V9WA 4B8AB 1ZQLA 3UQ0A 4B9VA 2D0BA 4BE2A 5CY4A 1ZQJA 4FJJA 8ICCA 3LP3A 1R0AA 1ZQCA 3C21A 5E41A 1A5VA 3NH1A 1XHZA 2RF2A 4H4OA 2XCPA 4DTNA 5CP2A 5J2JA 1ZQRA 4LVSA 2MUTA 3HVRA 2J6UA 5J0YA 2Z1GA 4C8OA 4FLXA 4UQGA 4PGQA 4NLGA 1WSHA 1S1WA 1LV5A 5D46A 1ZQTA 3KHHA 3L2WA 3PO4A 4HUGA 4RW7A 1CXUA 1KVCA 2R8GA 1WSJA 4MF2A 1ZQGA 1SZPA 3DRRA 3O4NA 4M41A 5CZ2A 1I39A 3BQ0A 3C2KA 1LB2B 2XRIA 8ICWA 2Z1JA 3UIQA 2F8SA 5J2PA 1WSFA 2BCSA 1VSFA 1S76D 4J9QA 3MR2A 5KG1A 4BXOB 4KLSA 2MAXA 3EY1A 4J9MA 4Z6DA 4KHWA 3V81A 5DB8A 5F9NA 1JLCA 4ECXA 2IMWP 4YXJA 1S77D 1L3VA 3P83D 2P5GA 4I2IA 5KFRA 5SWMA 4KI4A 2OYQA 3ZDEA 3RBDA 3F9KA 4CEEA 2C2RA 3OS2A 5L1LA 4M6WA 1C1AA 3MEDA 4LSLA 4NCAA 3PW4A 1BPBA 5DB6A 5J2CA 3IM1A 1QHTA 4Y1CA 9ICWA 2J6SA 4R5PA 4EBDA 4I2QA 3V1RA 3U6FA 4NY8A 1ZQHA 4RQ3A 2G8WA 4RNMA 1SL1A 3HP6A 1K6YA 1ZQZA 2VG6A 9ICMA 4LD0A 5KFXA 1W9HA 4CJVA 3OYJA 3V7KA 3HP9A 4YD2A 1DTTA 4QCLA 3TAPA 3KLHA 1MSWD 4KLQA 1KLMA 1S1UA 5KT5A 1RXVA 4CFDA 3NH0A 4Z4GA 4OGEA 4KTWA 1UWBA 4DFJA 4TUSA 4DTRA 1ZQBA 4K8ZA 3DLHA 4NM2A 3PR5B 9ICUA 4J9OA 4B9TA 4F4XA 4CJ5A 3AUOA 5KFNA 1N6QA 1RDCA 1ZQOA 3RR8A 3NHGA 4RPYA 2Y1JA 4QZCA 4FW1A 4DQPA 3ZT2A 3KHGA 1Q8IA 3AO2A 3Q8SB 4JUZA 3K5LA 4FLZA 2JEGA 3L2UA 1VRTA 1RT5A 5KI6A 4HUEA 4XRHA 2JEFA 2AJQA 4RW8A 3AA2A 3HSTB 1WSIA 3MGIA 1QSSA 7ICQA 3LAMA 3MXMA 1D9DA 1KFSA 4NCBA 4CHYA 3GQCA 5J0RA 5KGWA 2QK9A 3AO1A 1RTIA 5KG3A 5F9LA 1N56A 1KLNA 4FS1A 4P2HA 3HM9A 1HJRA 4CJSA 3T1AA 4TQSA 3VQQA 3AVKA 2BANA 4FJ5A 1TL3A 4B9SA 3ZDAA 1TK5A 1J53A 3OYAA 9ICTA 2ZQBA 1J9AA 8ICPA 4M3TA 2IS3A 3H4BA 1MQ2A 4LZGA 4N41A 2VA2A 4MF8A 2YHAA 7ICPA 2RDIA 3E01A 4N76A 3G10A 5KT6A 4GLXA 9ICPA 1S9GA 1GOAA 1IM4A 4J9NA 4KV8A 3VQ6A 3ORYA 2X6NA 4C8NA 2QKBA 3WNFA 3QINA 4OPKA 4DFKA 3RRGA 4E89A 2HNZA 5FROA 4O3SA 3GDXA 2DFFA 3JSMA 2QKKA 2HNDA 1WCNA 4O5KA 4FVMA 3NGZA 1VK0A 2B5JA 4I2DA 2G8FA 3DLEA 1CZ9A 2BQRA 1RDAA 1KCFA 1KVBA 2P6UA 2E4LA 3LWLA 4F4WA 5D49A 2NRZA 3PV8A 4FLVA 4DSKA 4UB2A 2ISPA 4QZ9A 3CFOA 1ZBUA 1NOMA 3DM2A 2I1QA 4QWCA 5K14A 1RXWA 4ZHRA 5HROA 3H8WA 2YKMA 3HPOA 4DL7A 5KFYA 4MFBA 4IFYA 4M04A 8ICOA 4IKFA 4RPZA 5IIKA 3AVHA 4BDZA 4F5PA 2JEJA 3V9UA 1FK9A 3QNOA 5I42A 5IIJA 1JLQA 5SZTA 4MFAA 3PUFA 9ICVA 4DOBA 4FJXA 3EZ5A 3ZCMA 4CJKA 4F93B 3AV9A 5J0SA 2BPCA 5J2BA 1LWEA 4K4IA 1T3NA 3WNHA 4UB3A 3DMJA 4M3UA 2PYJA 1U47A 1FKPA 5KT2A 4QW8A 4FM2A 1HRHA 3I0SA 4E7LA 3V1QA 2D5RA 9ICJA 4DEZA 1BPXA 9ICRA 3I8DA 4TUQA 4BE0A 1S0OA 1TK8A 4CHQA 1ZQEA 4CEDA 1KEJA 3MXJA 4GMJB 4KLMA 1EX4A 9ICKA 4FLYA 3L2RA 5KFKA 2P66A 4RUAA 3UQ2A 7ICMA 1X2IA 2ETJA 2ZUBA 1XU4A 3GILA 4KLFA 4F2RA 2BQUA 4UAYA 3OSPA 4O3RA 3NF7A 3V72A 5FRNA 2XY5A 4Q8EA 2WOMA 4PPXA 1VSEA 3QEBZ 2FPLA 1X9SA 4XA5A 1HNIA 4YMMA 3KK1A 4CHNA 3OYLA 4FM1A 5HP4A 3AVIA 2G8IA 1NK6A 4J9LA 4EP5A 9ICFA 2HHXA 3DRPA 3NGYA 2B21A 5DGBA 3QE9Y 4B9MA 1ASUA 5DB9A 5HRPA 4EP4A 4CIEA 4MQ3A 3Q8RB 3FFIA 4DLEA 3D45A 1O1WA 3NCIA 4UB4A 4UB5A 2HVIA 1C1CA 1CUKA 3P1GA 3SI8A 3HW8A 2PYLA 4O4GA 4YR3A 1JLBA 2PZSA 8ICMA 1GOBA 3MAQA 1RPLA 1UT8A 4ED3A 1TL1A 5KG6A 4I2PA 4IG3A 1DTQA 5KFOA 8ICYA 3KK2A 2KFNA 4K4GA 4NYFA 4CEBA 4KN7A 4FJ7A 4CEQA 3H8JA 1EP4A 4RQ4A 4LZDA 3LANA 4IQUA 3BQTA 4QWAA 3V9ZA 4O3PA 1NK8A 2E6MA 1Y88A 4Z6EA 3EPGA 4J9KA 1NK4A 2FPMA 4JRQA 1YT3A 4KHNA 1LW2A 1XSLA 4RT2A 4H8KA 1JLFA 3RMBA 1RBUA 9ICCA 5JS2A 4M9JA 4CGDA 4DFMA 4KLGA 4BACA 4I2EA 1JIHA 1DGSA 2V4QA 3TAGA 1CXQA 3S9HA 1H38A 2HHQA 3OS0A 1HYZA 4RU9A 9ICLA 1ZBFA 4CJ3A 4W5RA 4IRCA 1XI1A 5J0XA 3HJFA 2ZJAA 4B9NA 5J2EA 1N5YA 4XQ8A 2C2DA 3VQDA 3MDAA 1ZQIA 1C0UA 4PA1A 1Z3EB 1TKXA 3RJFA 1ZQVA 1MC8A 2ZJ5A 4Z4IA 1JX4A 1WAFA 3GV8B 3OYHA 1NJZA 1SKRA 1RBVA 5J29A 2FMPA 2IBKA 4O0IA 5KFUA 3K58A 1VSLA 3LALA 4CJFA 8ICSA 1WSEA 5J0WA 3SYZA 5DG9A 1BHLA 2HB5A 7ICOA 3AO5A 3ZT4A 4FJKA 2DY4A 4QAGA 5DKWA 4DQSA 3RB0A 4UB1A 2BCUA 4EEYA 2Z1HA 2AGQA 3HYFA 2GV9A 3RH4A 3OHBA 4N5SA 3TANA 1WSGA 4DF8A 3SQ1A 3RH5A 4FJGA 1JL2A 4I2FA 3RMCA 3LAKA 2YKNA 4JWNA 3OY9A 4CF8A 2FLPA 4B9UA 1LW0A 2X78A 2HVHA 4F5RA 3CM5A 4M3ZA 1AROP 4CFCA 2ASDA 1JLGA 1XSPA 3V9SA 4EBCA 1RTJA 1K1QA 2W9MA 3DOLA 2OPPA 1ZETA 3N4MB 7ICSA 4CK3A 4AILC 1RDBA 3KKRA 1B9DA 3TAEA 4N56A 3GV7B 1CZBA 4O3QA 2XC9A 5KFHA 2OZSA 3C1ZA 1S97A 2FBYA 5HP1A 3RAQA 3SCXA 5KFPA 2DFHA 2OWOA 2E6LA 4Q43A 2F8TA 3H4DA 3T5JA 4DLGA 1A5WA 1NJXA 4NLZA 4KN4A 5KFFA 4F5QA 2YNGA 3ZDDA 2G8UA 1UA0A 2XHBA 4J9PA 4ECUA 3SI6A 3M8QA 4K4HA 4KREA 1JMSA 1L3SA 4IR9A 4CCHA 1VSDA 2AU0A 4Z4FA 2W9CB 4MEYA 1ZJNA 4FZZA 3BGRA 5KFIA 3UXNA 4F5OA 1VSKA 4J9RA 4FJNA 4YR2A 1NOZA 3AVBA 3C5FA 1JL1A 1B9FA 1RBRA 5KFVA 1FXXA 3RJGA 2FLNA 1DLOA 3OYFA 3D0PA 1GOCA 1U04A 4JWMA 3OYIA 1EXNA 3ZDBA 4MFFA 1Z00A 4BGDA 3IHQB 4XIUA 5IIOA 2Q0ZX 1S5JA 3ITHA 4NYNA 4I2HA 3DOKA 4FS2A 5CJ7A 3MR5A 4KLIA 4AHUA 3G6VA 4O5BA 3G6XA 7ICUA 4HCBA 3MGHA 2BKEA 3DI6A 4FLTA 4HUFA 1S1VA 2ZD1A 4RW4A 4FJ8A 1RBTA 2FLLA 5C5JA 8ICRA 8ICVA 4TSXA 2W9AA 4OKJA 4CJRA 3TR8A 2A1RA 3ZSRA 4R66A 3B0YA 3VA3A 4KHYA 4DL3A 1S1TA 3K4GA 2R8HA 3OS1A 3ZT3A 4JK1A 2F1IA 4E7IA 4DSJA 7ICNA 1K1SA 4KLDA 1WN7A 3ZSWA 5HRRA 1RT3A 3QERA 1IG9A 4OVLA 4ECSA 3QO9A 4B8CA 4PUOA 4KHSA 1D9FA 2ZTDA 1WLJA 1KDHA 1BPYA 5KTQA 3PR4A 5KFWA 8ICKA 2R7YA 4DL6A 4C8KA 3C2MA 4KLTA 5BOMA 3SPZA 3V7JA 4IG0A 1UOCA 4DG1A 2G8VA 1YTUA 3VQEA 4CEOA 5IILA 3KLGA 3CQ8A 4JV0A 4KITB 7ICIA 2BE2A 5CYMA 4AHRA 4CJLA 5KFDA 3ULDA 4DMNA 1IKYA 4DOCA 4Z4EA 4I9LA 2JEIA 3Q8PB 4CGFA 2UVRA 1RT7A 2EHGA 2NRXA 2P5OA 4R8UA 3O4QA 4FK4A 4AH9A 4I27A 4AHSA 5J1EA 3VQCA 2DFEA 4DTOA 3NAEA 3MFHA 3MBYA 1BGXT 2MUTB 1QLNA 3QETA 3V6JA 5DK5A 3ZT0A 1EETA 3ALYA 4JV2A 1I3AA 4QZAA 1BI4A 1BPZA 1UT5A 5C24A 4LY7A 4E3SA 2HHSA 3OYGA 4PQUA 4B3OA 3B6PA 3CG7A 5HNKA 3GIMA 1HUOA 2XCAA 3C23A 3BQ2A 3TAQA 5KT4A 3OYMA 1BQMA 1COOA 3OYCA 4YXMA 2KZMA 1BIUA 3S3OA 5EWEA 4DS5A 4OPJA 4E7KA 3EWAA 3NTUA 4XUSA 2XY7A 4DTJA 5KFQA 1C0TA 5HBMA 4UAZA 7ICHA 1RTDA 4I7FA 3GIJA 4UBBA 4DTXA 2DPJA 1CLQA 4ELUA 1TV6A 1NKEA 4DTSA 4YMNA 1KFTA 2PXIA 4DTPA 9ICOA 4ICLA 5DQIA 4Z4CA 5KFEA 3RTVA 4M6WB 3I0RA 4F50A 4W5TA 2AQ0A 2AGOA 1RYRA 1T05A 2QXFA 4RG8A 8ICZA 1YTAA 1X1PA 9ICSA 1EXQA 2R8IA 4O5EA 5HMMA 1S0NA 3V6DA 4JRPA 1ZBIA 3RJKA 2XY8A 2OPRA 2FMSA 4ECTA 9ICIA 3LZJA 4F8RA 3QNNA 4TURA 3VQAA 2AQ4A 7ICLA 4M0AA 3KHLA 4W5NA 2UVWA 1MQ3A 3B6OA 4CFAA 4CJTA 4I2CA 1JXEA 2XY6A 4KLEA 4CF1A 3LDAA 3ISBA 4GVMA 3V7LA 4KMUA 3MEEA 3QLHA 3TAMA 2F1JA 4KLLA 4IRDA 3M8RA 1Q9XA 1ZQXA 5JUMA 4RUCA 5L1KA 3KLIA 4KB1A 2GUIA 4RW9A 5DLGA 4DL2A 4JLHA 2IAJA 3CM6A 4I2GA 3UXOA 2JZBA 5IIIA 3ISDA 4R64A 3L2VA 2BCVA 2F1HA 2PFNA 2HHUA 3KLFA 4GXJA 3M9NB 9ICGA 9ICHA 5J2AA 2H5XA 4NLKA 2ATLA 4DWIA 2R8JA 1C0MA 4QZFA 1HYSA 3Q8MA 1QTMA 2W8KA 3T5KA 5J0OA 4CF0A 4Z6FA 3T3FA 2PFPA 2RDJA 5DG8A 2HHWA 1SKSA 3ETLA 5KFGA 3K75D 4RQ0A 3VQ8A 4KLUA 8ICBA 4G1QA 5CZ1A 1L5UA 1ZQQA 3AVJA 4KKOA 4M3WA 1TV9A 3OHAA 5CB1A 2IA6A 3K57A 4ED7A 2FBTA 1S9EA 3H40A 1ZQDA 4EZ9A 1JLAA 5D3GA 5T7BA 4PHDA 2G8HA 4YG2A 4RZRA 3PY8A 5JS1A 2PI4A 3IG1A 2A1JA 1L3TA 5KG2A 8ICUA 4QZ8A 3V6KA 3SV4A 5J0QA 3SV3A 3VN5A 1RTHA 3C5GA 4KHUA 3FDSA 2I9GA 3ZSVA 1G15A 3M8PA 3TABA 5HLFA 4FCYA 4KLHA 1SL0A 4CGJA 4F5NA 3U3GA 2KTQA 5DBAA 3DRSA 1TVAA 5KFZA 4RQ7A 4ED2A 1T03A 8ICTA 1BCOA 1BIZA 1XWLA 2BPFA 3MECA 5C42A 3UXPA 4KAZA 4ECZA 4Q45A 3L3VA 1IKWA 1S0MA 3H08A 3MABA 4LH4A 3H8SA 1S9FA 2F96A 5HRSA 4KFBA 1ZJMA 4J2DA 4I2BA 2Z1IA 7ICEA 3NH2A 4CFBA 3SQ2A 2V4RA 1A76A 2OPSA 5DMRA 3S3MA 1T7PA 1D8YA 3IAYA 3EW9A 4IR1A 4KTZA 4CEZA 4EYIB 4Q0BA 1T8EA 2BGGA 3KD1E 1DOQA 4QWEA 3L2QA 3HXMA 3ZD9A 5DBCA 4DQIA 3MR6A 4BE1A 2W9BA 4CE9A 4Q44A 3SUPA 1S6QA 3TARA 4KHQA 4EYHB 2NUBA 4Z4HA 3L8BA 2FBVA 1TKZA 2BPGA 1BQNA 3AVNA 1ZQPA 2HMIA 4ID5A 4QZHA 1RILA 4R63A 2IHMA 5TZVA 3TI0A 2Y1IA 4DTUA 3KKSA 4E7HA 4CJEA 1TAUA 8ICGA 4PGXA 3DLBA 1J54A 1TFRA 3RAXA 4QOZB 4FJMA 1ASWA 3GIIA 3HO1A 3GIKA 4H4MA 3NF6A 3Q8QB 4F3OA 2BCQA 3SUNA 3ZD8A 1U9LA 4ED0A 3RB4A 2ZE2A 1KRPA 3O3GA 4DSFA 5DDMA 3IRXA 1HYVA 4PHAA 4PWDA 1ZQSA 4PHPA 4CECA 4KLJA 4HTUA 3LP1A 9ICNA 1HUZA 5J2HA 4GXIA 3KIOA 1RNHA 4Q5VA 4I28A 4OLAA 2LYHA 2D0AA 3MEGA 1NK9A 4BXOA 4NM1A 3RB3A 2BR0A 3TAFA 3SQ0A 1TVRA 3AA3A 5KG4A 4DU4A 3HPHA 4CESA 1B22A 2P51A 2WONA 4F4ZA 3LPUA 4NCGA 5HHIA 1T4GA 5IINA 3C95A 1TAQA 2UVVA 3RJHA 1REVA 4FLWA 4O0JA 4FZYA 2JLEA 3V6HA 3M9OB 4G3IA 2ALZA 3OGUA 3K59A 1XS9D 5J2FA 3L3UA 3TFRA 1JKHA 4JS4A 5J2QA 3OSNA 3ZSZA 5KGXA 4QWBA 4YQWA 1X9MA 1BISA 8ICQA 4FM0A 4ELVA 1S10A 3GV5B 4Z6CA 2GBZA 4NXZA 3PO5A 3RB6A 3VQ9A 4GW6A 4W5OA 5DBBA 2P6RA 1PZNA 1ZBHA 4RNOA 2OPQA 2PI5A 3DYAA 2JGUA 1VRUA 2O4GA 4ED6A 3JPRA 4YVZA 3RR7A 1VSHA 3QEIA 4GC7A 4IQVA 4KRFA 3F73A 4F3TA 3LK9A 5J2NA 4YMOA 1KTQA 1IKXA 2NRVA 5EWGA 1BCMA 4FK2A 3Q8KA 3QEXA 1UA1A 3KK3A 3OJUA 2C22A 2ZJ8A 4DSEA 4F4KA 2OA8A 4CIGA 3EPIA 4DU1A 1XSNA 4M9LA 3K2PA 3QIPA 2IC3A 3CFRA 3SUQA 1RT4A 3NF9A 1UAXA 2NRTA 2RKIA 3HWTA 3RJJA 5DDYA 2RN2A 1ZYQA 3NF8A 1JLEA 4CHZA 4FJLA 1BPDA 5KFMA 1SKWA 4P4PA 4FJ9A 1A77A 5D4BA 5J0UA 4CJQA 5HHHA 2KFZA 3JPSA 3JPNA 2FC0A 1KVAA 4FO6A 3MDCA 2C2EA 4F2SA 1BPEA 3ZSOA 4CJUA 3NGIA 4K8XA 3T5LA 4IFVA 4DF4A 3OYKA 2AGPA 2ZTCA 4CHOA 3SQ4A 4RQ1A 4RQ6A 2LSNA 2KN7A 3QEAZ 2ISOA 2ITGA 3ZDCA 3ISCA 2IOCA 2W8LA 1D5AA 4AHCA 4HYKA 4ID1A 4CEFA 3HVTA 5KRSA 2A1SA 2KZ3A 3LZIA 4BDYA 3PMNA 3Q8LA 1HMVA 5FDLA 4QW9A 2BCRA 3SPYA 1ZQNA 7ICRA 5I3UA 1JN3A 1V9PA 3RJIA 4QZEA 4ZH4A 4QZIA 4DSIA 3IS9A 5BOLA 3HT3A 2KZZA 4Z0UA 4E1NA 4F91B 5DQHA 1ZQWA 4CK1A 2IDOA 4E1MA 4PHEA 1WNSA 2ZUDA 3QESA 2W42A 4DQQA 3N97B 1RCHA 3DLKA 5HRNA 2HW3A 4BWJA 4OJRA 4EBEA 3RMAA 3O3FA 4OLBA 2EX3A 4QZBA 1ZQAA 3RMDA 4OKEA 9ICQA 9ICEA 4CJ4A 4HVJA 2C28A 4F92B 3E2EA 3SJJA 1Y97A 3QIOA 1MU2A 3MFIA 1L3UA 4YFUA 4IQTA 4RQ2A 3V9XA 2O4IA 2IHNA 1WAJA 2M9NA 3ZSQA 4E0DA 5EU7A 2YHBA 3AU6A 1Z00B 4Q8FA 4CJPA 1HQEA 3T5HA 1U48A 3M9MB 1IH7A 4FJHA 3ZSYA 4J2BA 2Q3SA 1IXRA 3RH6A 4YNQA 3KLEA 4CERA 4OGCA 5KFLA 2FMQA 4CGHA 1QE1A 4AHVA 8ICHA 2VWKA 3PW7A 3VQ5A 4AHTA 1ZQMA 4IQWA 4CJWA 4TQRA 3UPQA 4RQ8A 2BQ3A 3TWHA 2IGIA 1ZQYA 4RT3A 2ATQA 4FW2A 5CYQA 2BGWA 3QEWA 5L9XA 1B92A 2X74A 3WNEA 3KTQA 5DLFA 1RYSA 4QWDA 3AO3A 8ICFA 3KJVA 2XGPA 2HNYA 1HQUA 4O3OA 4IRKA 1XO1A 1U49A 4CGGA 2VG7A
chains in the Genus database with same CATH superfamily
1HKAA 3G6YA 4M42A 2DXDA 5EX0A 2I0XA 1FJEB 2I7NA 4BC9A 4OX9F 2V5HG 4WF9L 2DNPA 2W55A 4BDPA 1KKXA 1S6PA 2ZVSA 2YTCA 4KLOA 5BR8F 3CDUA 3LVVA 5DDPC 5J2GA 1S49A 1SC3B 3PCOB 2G07A 4DR4J 3I4PA 4IG0B 4DG1B 1Q46A 5KOXA 3VEXA 5C2GA 5AZJB 2K7KA 3KUGA 1VSJA 9ICAA 2IHR1 5L46A 1PO6A 2VL1A 2ZVIA 3U1MA 3CCLS 1Z2LA 2AD9A 1RT7B 4E2FB 1QDUB 4XO0A 3C14B 3AY9A 4R8UB 4AUKA 2HGMA 1NGFA 4IBNA 2DGUA 1CVJA 3VQBA 5J1EB 2KJ9A 2X6SA 3EUNA 4CIOA 3SNNA 4FBTA 3QGHA 4DTMA 2QMXA 1HBNB 3QUTA 4OI0A 4CF9A 2FC8A 4BRKA 2DHXA 2VGNA 2N7YA 2XIDA 1FNMA 2QWNA 1NOYA 1VS3A 3P8BB 2CJBA 5H1SQ 3SCJE 2G09A 2HGLA 2BM0A 4PR6A 2ODGA 3A0BU 2VQFK 4MIAA 1VMBA 2GIRA 4PG5A 3O9UA 1KQFB 1BQMB 4URSA 3DDNA 5ETMA 3QZ8A 5DGAA 2F9DA 4DR6J 3DLGA 1RCXB 3AJDA 2CG8A 5J2KA 3AO4A 1TMMA 1CBKA 5C0YA 4ECRA 2EFNA 3HHKA 3U3YA 3THPA 1NEEA 1TKTA 3ZTRA 2RD5C 3QBWA 2LCWA 3MK6A 2ASPA 4BRCA 5K8MA 4NLNA 1YDLA 4FXDA 5EY4A 3H6EA 2P9KA 1V85A 3OJSA 3GJQB 1UVMA 4L74A 3UD3P 1WEXA 4RWXA 1MROB 5H9EJ 5D6GA 3VQ7A 2G4BA 5B5EU 1M5KC 1RAHB 4BWMA 1SKUB 2ASYA 4DSLA 1KW4A 1RBOB 3I8BA 3CNHA 5M1QA 3FE1A 2C3YA 3AVAA 4EIAA 2V52B 2OPRB 4V1Ak 5B0DA 3UMCA 2KG5A 3EL2A 4K2JA 1C20A 1BLUA 2GWKA 1HJPA 2DXFA 4L8RB 4LBHA 2C2NA 1IR2A 3C66A 3B9JA 1IVZA 5DB7A 3OR1A 1XR5A 3L7UA 8ICJA 3FFKB 1XNQJ 4KHMA 1CEZA 1F21A 4K4ZA 3TAMB 2EWHA 3NE6A 2OFHX 1K73T 2GEMA 3VPZA 4RW9B 4WFZA 2CPEA 2ZOMA 4O9MA 5KT7A 5L1IA 4UOGA 1HHTP 3AQOA 1YJ9S 1O6XA 1WKKA 4QPXA 5F8LA 1Q79A 3EYZA 1FRLA 1HR0F 2ZJRQ 1WD6A 2XZWA 1WBDA 2W7AA 1VJQA 3VVUA 4PY5A 4LF7J 2XZDB 2FQQB 2ZJPQ 3AGRA 1EIYB 2RE2A 1B0XA 1XC9A 1RLDA 3M30B 1NGGA 2YX6A 2DO4A 1T3VA 1SGGA 5CRXA 5IWAK 1Q9YA 2W2OP 1T6CA 2Z58B 2D1KA 3UW1A 3P5JA 4FWOA 1HPZA 4DV7K 4DV5K 3C2LA 1HUXA 2DGTA 1WCLA 3RJMB 4E19A 5CA7A 3GFKB 1TKDA 2W9CA 3LPEA 4QS9A 3L3CA 1YJNN 2R7OA 1WOOA 3H5YA 3CQXA 4DOAA 2JH7A 3RWUA 2L9WA 4LSNA 4C3KA 3NVMA 2A1JB 3SQIA 2LU2A 3N4PA 1ZM9A 2YCHA 1RLCL 4HDHA 1N48A 5I4MA 2Y8YA 5E3CA 4DFPA 3M2VB 4K42A 5BPCA 4LFAJ 3VF4A 5HLFB 4KPYA 8ICNA 1HW9A 3HK2A 4OJ5A 4RBVA 4UAWA 1Z1BA 3N7RC 1LWFA 4P6QA 4EZ6A 3FBFA 3B8HA 3AVFA 4X66K 1SUQA 3EMTA 4A8FA 2VC1A 3ZTOA 5J0PA 2V69A 2AKWB 3UDEA 3NS6A 2MKHA 1HNXK 3MECB 3CJKA 2GWJA 4I2JA 1SL2A 1NGIA 3W9JA 2XS2A 3SMZA 5L9NA 4Q2LA 3UKRA 1Z26A 1Y64A 2DL0A 4GV6A 2V67A 1XIQA 2KT3A 4R0JA 3M32A 2ZZTA 1U1PA 3M7VA 4NLYA 3NNCA 9ICBA 1FRJA 3Q8YA 1UVJA 3K5OA 4A46A 1YVUA 2BDPA 5KFTA 4P7TA 5IQQA 2YKAA 4ZVRB 2VG5A 4EU0A 4DV0K 2F77X 2J8AA 3WUHA 1OH6A 3M5RA 4B3TK 4X65J 4C8MA 3UKUB 1WC5A 2E29A 5GAGI 4KH5A 9RUBA 3PX4A 4J9SA 3GTYX 4M9HA 4FYDA 4GXKA 4FZXC 1RDDA 7ICKA 4DV6K 4Y28C 1TGOA 2RAQA 4ZLPA 3NFAA 4B8AB 4BRDA 2VQEJ 1RHKB 1ZQLA 4MK9A 3PIPQ 3VAKA 3OV7A 8ICCA 3LP3A 4LIWA 5ETKA 3M8WA 1ZQCA 5E41A 2X1GA 4M5GA 4XH1A 3NCPA 1N32K 4C11A 2P9SB 4BRQA 4JD2A 2PN6A 4B3MF 3BREA 3HVRA 2J6UA 5C15A 5DM7Q 1SPBP 1S1WA 1LV5A 4UY8T 4ZVQB 5E2QA 1RGVA 2H3ZA 3L2WA 3PO4A 4RW7A 3LDPA 1CXUA 4LF9F 1KVCA 2LA4A 3HX9A 3IR5B 5DZ7A 1F2GA 4M41A 4C7YA 3DDIA 2Z1JA 3QFHA 4P73A 3MCMA 3VGTA 1SV0C 3UIQA 3AFGA 2DIVA 1GMWD 5AQKA 5KG1A 2DR7A 1KP6A 5JVHL 4FWQA 4OV1A 3IV6A 1X3NA 4Z6DA 2P35A 4FF3A 4Y2XA 4YXJA 1S77D 1L3VA 5D8HB 2P5GA 4I2IA 2E1RA 3ZDEA 4L3QA 4WIQA 4USVA 2DIUA 2HFZA 2LECA 1BPBA 4AQYJ 4UARA 5DB6A 5F8JA 1JKHB 5AKZA 5J2QB 2HQDA 4Y2VA 4RNFA 2P9LB 3CIPA 4RQ3A 3FCWA 3IWNC 3GFZA 4DR5K 3P39A 2BRLA 1XO0A 2VGMA 1OIAA 4LD0A 1L7MA 4NL9A 3HP9A 1FFGB 5A6PA 1OY8A 3KLHA 2KT5A 1QQOA 3H5XA 4OJPA 4KLQA 5TISU 3T1YF 2E5LJ 2ZM6J 4X62K 4OGEA 1M1GA 1FWPA 5C7PA 4TUSA 2JL9A 4A8YA 3K1ZA 4QYZJ 1ZQBA 4K8ZA 3CHWA 2QWMA 2UUCJ 2P9UB 4J9OA 2CWKA 4DV3J 3U8XA 1UEUA 3W2WB 3UMGA 4NEYA 1UJ5A 3RU0A 4LVNP 1CZAN 3NWGA 1HL6A 1WHXA 5B8HA 4NXNJ 2IVMA 3F41A 2ITMA 3NHGA 4ETXA 2RKIB 1GLDG 4FW1A 1YRTA 1ZOLA 3Q8SB 3K5LA 3R27A 3BH6B 4V19S 1EHWA 3BYRA 1RT5A 4XRHA 4TYAA 1MWQA 1B7FA 2O8EB 3OTOF 3BBBA 5GMDA 2VPZB 4RW8A 3AA2A 3TX8A 1KFSA 4CHYA 1FJGF 1FRMA 1H3DA 2L9NA 5JMNA 1RUSA 3LL3A 1WKLA 5KG3A 5F9LA 3FSXA 4OZ1A 2DH7A 5GAEU 2ZIVB 3HM9A 1O0PA 3CCUS 2CUYA 4BRFA 3VQQA 3P45B 3CMEN 1V97A 3OYAA 1QAIA 3KKFA 2ZQBA 2ZIWB 1GEHA 2WAQD 2VBZA 3BH7B 1MQ2A 2M0NA 2KKHA 4CM2A 2VA2A 3HZ6A 4MF8A 7ICPA 2YB1A 4GLXA 1MWMA 1WBBA 1GOAA 1QVFM 4I67A 4J9NA 4TNOA 5FDLB 1UPPA 3ORYA 2X6NA 2QKBA 3WNFA 1RAOA 3THWB 4DFKA 3OUYB 3GDXA 3GIRA 1YITS 2ZNZA 2HNDA 1NMEB 4O5KA 4FVMA 1VQ4N 3NGZA 4FKYA 4KSEB 3TUJC 1NBWA 4C97A 2J4RA 4I2DA 3BUZB 4UOHA 1CZ9A 4K4YA 2E4LA 2MHEA 2NRZA 3PV8A 4DSKA 4FWSA 5GVQA 2PMWA 2EH9A 3QIDA 4O23A 3B78A 4QWCA 1IBMF 5M1NA 1RXWA 4ZMMA 2F8LA 1KL9A 2OH2A 1IJJA 4DL7A 3A3NB 3W3DA 2BA9A 1OY6A 2JLFA 2O66A 5EN1A 2BABA 3M8YA 4RPZA 5ALLA 4BDZA 2Q0UA 3V9UA 3GJTB 1JLQA 1RE1B 5SZTA 4MFAA 1KBUA 4FJXA 3EZ5A 2EFGA 5BN8A 2MU2A 4W92B 4CJKA 1LK5A 3AV9A 2BPCA 1LWEA 3QGPA 4P74A 3ATVA 4UB3A 3AOCA 3DMJA 2ZDPA 6FDRA 4M3UA 2PYJA 4C48A 1FKPA 5KT2A 4M5JA 4QW8A 3I0SA 3E9OA 3QWPA 3L4PA 3V1QA 4ZLNA 5M1OA 4DEZA 3I9ZA 9ICRA 3I8DA 2AEMA 4JYAJ 3I4HX 1TK8A 2HBKA 1RHQB 1PAUB 3O4WA 1ZQEA 1XMOF 2DNLA 4CEDA 1KEJA 2B8PA 2MJUA 5CYQB 4FLYA 2YVSA 5KFKA 1MLAA 4RUAA 3M6VA 1H6KX 3FGVA 5GTIU 4KLFA 3G82B 1B0TA 4O3RA 2MSSA 5D0RA 1NM2A 4M5LA 5HJXA 3IG8A 2WSCC 1MNEA 1X9SA 1YJVA 4YMMA 4IDHA 3KK1A 1XNRF 3VTHA 4FM1A 4A4JA 2J7WA 3AVIA 5LL6d 1FX2A 2HHXA 1FI4A 3ZNJ1 4CZMA 3DRPA 3QE9Y 1ASUA 2F65A 2MZSA 1NPKA 4KMOB 4LF4J 2UXDF 3F5AA 5ALRA 4UB5A 3MTKA 2HS4A 3LM9A 1U0SA 2QZ8A 2PYLA 3B6BA 4YR3A 3ULHA 3FRYA 1NZBA 3A0HU 2E8AA 2GVDA 4GKKK 5KG6A 1N0VC 2VKQA 4OX7A 8ICYA 1E6YB 4NYFA 3HHDA 2K8AA 1RT1B 4LZDA 2JSXA 3LANA 5DRKA 4CZEA 2A0FB 3M2UB 1ATNA 1NGHA 1HBMB 3QPIA 5HMYA 5D4LA 3V9ZA 3KG4A 2UYTA 4Z6EA 3EPGA 3ZEUA 2OSQA 2XEXA 2ZIUB 1WG4A 2B4OA 3MAAB 4ETZA 4RR5A 5ALJA 4RT2A 3RMBA 2B0GA 1RBUA 1JQGA 2NPIA 2AV5A 3S6JA 1U2FA 3NBPB 1LFWA 2GELA 1QY7A 2HLTA 1FF2A 4YUDA 1Q7YO 1WORA 4O8KA 1CXQA 2O6KA 1EQ0A 2W41A 3TAGA 2HHQA 2YNHB 3O2IA 4LF8J 4W5RA 4IRCA 5J0XA 2IVPA 3ENBA 4B9NA 2OI2A 5B0EA 3VQDA 2X1AA 2V8HA 1YG0A 3EVWA 4MIBA 3CCZA 3CPEA 4DR7F 3KWGA 3D68A 3FK4A 5C2CA 4YY3K 1S1XB 5H9FK 1WAFA 1K44A 4QU7A 2FMPA 2FJXA 4PPZA 3SR6A 3EN9A 3C7NA 2GZOA 4FWPA 4CJFA 1CJKB 5G0RB 1SQFA 4CO5A 3ZC4A 1QH9A 2G06A 3AO5A 3WXJA 1RU1A 2DY4A 4QAGA 2V2QA 3AD7C 4UB1A 3IMQJ 1M5PC 2Z1HA 4IO8A 3NOCA 3OHBA 3TU5A 2QJ3A 2R2TA 3TANA 3N01A 5F8IA 4HACA 4FZLA 4DF8A 4H0YB 2FHMA 1RP5A 2GJIA 1FWLA 3QUQA 4K0KK 2F7TA 1BC6A 2APOA 2YKNA 4JWNA 1H7WA 1GFWB 2JZ5A 4KT0C 1JROA 1VLBA 1QVGR 2EQYA 1GLFO 4QS7A 1XBWA 1LW0A 1S4FA 4DV4K 4M3ZA 2ZH6A 4CFCA 2ASDA 1XSPA 1FRHA 1HBOB 1RTJA 1YJRA 2CQ3A 1KHWA 2RT3A 5ETTA 3DOLA 1OS5A 2BW2A 3AQPA 2FHJD 2V63A 2QWPA 3WXIA 5AQXA 4Y0WA 2CJQA 3ZLJA 7ICSA 4MKYA 4AILC 4OLOA 4N56A 1HI0P 1GAOA 3N28A 4M5DB 3TQEA 5KFHA 5J2MB 1S97A 2YNIB 3EKSA 1FVQA 1P8GA 2K4IA 5AKXA 2DFHA 4TU9A 1NSAA 3L6QA 5LMUF 3AODA 1UCVA 2WF9A 2XSJB 3CI5A 3LP2B 5E3AA 2OCEA 4NLZA 3TSUA 1VQ5S 4PZOA 2XICA 4NASA 4NXMF 2JOQA 1F0XA 3AJ1A 4G65A 3D0GE 3J81Y 4MEYA 1SV5B 1ZJNA 5KFIA 1VSKA 3C0BA 5ALDA 4DR1J 4YR2A 4OYAA 2KHDA 1N36J 3OYFA 2H54B 1GOCA 3NLCA 4I64A 4WJ3B 2AEJA 2LYBA 2HBQB 2XMJA 3SCIE 4DR2K 2KJWA 3Q7CA 2Q97A 2GNKA 4BS2A 4KLIA 3DXSX 3G6VA 2UU9F 3B54A 4A61A 4TLRA 5G5GA 2O3DA 2BKEA 3TSPA 2D3OR 3O08A 5LY3A 4OJGA 1Q7LB 5G4DA 3MCOA 1X5TA 3E51A 1LFPA 4CJRA 4WZQA 1YRXA 4WP9A 5IOLA 4R66A 2VF3A 2VC0A 4LRBA 4AM7A 4XDDA 1TELA 4JV5K 4KHYA 2MSNA 1Q8KA 1S1TA 3HSZA 5IT9Y 4WTOB 1NGBA 1CQNA 4XEIA 5AFUA 5KQDA 1VQLN 1TFYA 1FFWB 3GB0A 7ICNA 1K1SA 2HQIA 3LUYA 2VQFF 4OVLA 3QO9A 2FY8A 4B8CA 2LMIA 1D9FA 4IDKB 4ANCA 2V8VA 1BPYA 2MQMA 2WCXA 3PR4A 5KFWA 4RQMA 5K8OA 1P1TA 2JNJA 1SCJB 2L48A 3V7JA 1PG5B 2QRRA 2CJ9A 3VQEA 2RRNA 2X51A 4M1KA 5IILA 4FF1A 3FQKA 3DAWA 2DNYA 1UVKA 3KLGA 4OJOA 1RAAB 2EEYA 3BBCA 5EX3A 5CYMA 5KFDA 2ZDOA 3QJPA 3Q8PB 4LQ3A 3CCTA 2J0XA 3TP2A 1MWKA 2BKPA 4AH9A 4I27A 2H3VA 4AHSA 4K43A 5A8WB 2VBXA 5IS2A 5GAEI 1CJUA 4TLQA 3RSEA 2PA3A 4OX8A 1I3AA 4PABA 4QZAA 2CNKB 3VR1A 2HHSA 1S4EA 3CJ4A 5ETNA 3MWTA 4B3OA 3QRQA 3W61A 2PMZC 3CCRS 3LTOA 2MHNA 2WB1D 4GVBB 1COOA 2KB2A 4C0BA 2JX2A 3O9TA 4E7KA 3NASA 2I38A 1N63A 4DTJA 2EWSA 3QSYB 7ICHA 2JDJA 1RTDA 4UTGA 4DTXA 3WK4A 2NQPA 2ZBPA 5LJ5Y 3V81B 3ZZTA 3CXCR 2MZJA 1JLCB 3I32A 2LEBA 4DTSA 2Y9TA 5HMWA 1PBUA 2D7SA 1KFTA 4B3RJ 4DTPA 2AZ3A 2YMPA 1SH2A 2ZJPL 2RQ4A 3I0RA 3MEDB 4U7BA 1RYRA 2L5YA 2FJAB 3N5BA 1T05A 3CF5Q 4RG8A 8ICZA 4TVAB 1YTAA 9ICSA 5EE9A 2R8IA 3T6JA 1S0NA 3L3FX 5HATA 1B99A 4OI6A 2E3TA 2VYPA 2XY8A 1M5SA 4DCPB 1Q78A 3QNNA 4TURA 5BPMA 4DR3F 3E9PA 4K4WA 3KLVA 3THYA 3DKDA 1DTTB 4W5NA 4CT9A 4CJTA 4I2CA 3K0JA 1S1UB 2UUBK 3CJ7A 4K4VA 5KPZA 1UWBB 5T14A 3QLHA 7FD1A 4L3NA 1Y9OA 3GFYA 4IRDA 2O8FA 1CQMA 5JUMA 1URNA 3MM9B 2EC2A 4NMXA 3KLIA 2WBNA 4KB1A 3TZZA 1N6QB 2UUWA 1Q7YT 2DKOB 1WF2A 3CNQP 3CVKA 3C46A 4DXLA 2P9EA 5EHHA 4LF7F 5HJYA 2YWGA 1OPIA 1VQPN 4GXJA 3M9NB 9ICHA 1VRTB 5J2AA 2FGCA 1VGYA 4DWIA 2AJ4A 1VJ5A 2AMCB 4DV2J 4GRSA 2N82B 1C0MA 1O51A 3HKZD 5F0UA 4NEZA 4DR4K 1UFLA 3T3FA 3CPWM 2XBPA 3J7AP 2M88A 1ZAWA 2HHWA 3OPKA 2D4WA 3K75D 4RQ0A 2IOFA 4UASA 1IBLF 1XMQK 5CZ1A 4Y2CA 4G1QA 4IS7A 3HHEA 3OLBA 1ZD4A 4KKOA 4M3WA 1N61A 1EQMA 2DHAA 5CB1A 1X5OA 2KSOA 2ERRA 2VJUA 5M1PA 3I9V9 2ZH7A 3CB4A 4EZ9A 4PHDA 2GH1A 4YG2A 4RZRA 1NHKL 4FYWB 5JJBA 1BE4A 3IG1A 3OTDA 2V9KA 3GSIA 1VQ8N 1PK1A 3MMBB 8ICUA 4QZ8A 3H8MA 4KV8B 2CNLB 5AQZA 2CH5A 3VN5A 5LOQA 2HNZB 4DZ6A 1P9YA 2FSJA 4KLHA 4B02A 4KQZA 4CGJA 2JH1A 1TZ0A 2ILYA 4MDBA 3IR7B 2B5JB 3DRSA 4ED2A 5HVGA 1WI6A 1HI8A 1DK3A 5AK4A 2Q43A 3K2YA 1KN6A 8ICTA 1PYTA 1BCOA 4QJFB 2KRBA 3P5BP 3BSAA 1M1KO 3CC4S 3IG5A 1IKWA 2YKMB 5A8KB 3VAJA 1EB0A 4IFYB 2H1YA 5TKWA 1T94A 2FLOA 1S9FA 4R25A 4KFBA 2IVOA 2VIHA 2PO4A 5JLFA 4CFBA 4NMLA 5H9EK 5I42B 2KHVA 2I8EA 4AF1A 1A76A 5DM7L 3CC7N 3M1VB 3AEVA 2DY1A 1D8YA 3IAYA 1DQ9A 5LM7E 3QGGA 3BM7A 3NG8A 3GBTA 3G6ES 3DXKB 3U9ZA 1SJFA 2LU1A 1W97L 3NVVA 2W9BA 1X31C 3TW0A 1WB9A 4Q44A 3SUPA 1DT9A 3TARA 1YQHA 3I28A 4EYHB 4XTTA 1GLEG 2BMBA 2NUBA 3L8BA 5CCLA 1TKZA 3AQEA 1PVQA 4NL9C 1GMWA 3M2RA 2V7YA 1RILA 1GO3F 4R63A 1W7AA 5TZVA 4CJEA 3MPYA 8ICGA 2ZC3A 1ROFA 3H5SA 5JRTA 2HLUA 3D2SA 1N5SA 5ALQA 3RAXA 2AHOB 5AQQA 4QOZB 2QN6B 3TR5A 3QYYA 2FJBB 3HO1A 2DD8S 1AFIA 4RCHA 2F9WA 2QLJB 3IBWA 1DAXA 1UVIA 1W2BM 4DPTA 3O3GA 3RRKA 4DSFA 3HSDA 4ITSA 5DDMA 3CULA 1HYVA 1CJVA 4EENA 1FJ7A 3BKTA 3THXB 4MH8A 2QIFA 4GXIA 1BNOA 5CABA 4Q5VA 3FEXB 3FZBA 5AKYA 2FC9A 4OLAA 1MWZA 2D0AA 1NK9A 2POKA 2F2AB 4O4GB 3H7HB 1TVRA 4I6WA 3ADAC 5BYQA 3PRDA 5AE2A 2N4DA 2WONA 4KH1B 4JI8K 2CG4A 3KK2B 5IINA 5ALYA 3R7NB 3EUB2 2UVVA 3RJHA 1REVA 3CEDA 4QPTA 3Q0AA 3E1YA 2JLEA 1U6BA 1EP4B 1R8AA 1R8PA 4G3IA 1SXDA 1ZM2A 2D9PA 4BRIA 4B1YB 3OBWA 3L3UA 2JVOA 4JS4A 4BUGA 3IGVA 3ZSZA 4LFAK 2KXHA 2B56A 3U7JA 3TYTA 4K5SA 2QB0A 1N54B 4OZ5A 5DJBA 3BR8A 1LW2B 3QUBA 3MWBA 1WTFA 3UE5A 2FYXA 1JLFB 2I2YA 4GV3A 2BV3A 1VQ9N 5DBBA 2HKEA 4WKYA 4U6PA 2IDLA 5CQGA 3HRDD 4RNOA 2PI5A 1VRUA 2GHPA 3CD7A 3JPRA 1P90A 3QEIA 1WC1A 4IQVA 2HWTA 3UD5A 4F3TA 3LK9A 1ESVA 4YMOA 1SJ1A 4FK2A 5F41A 2UUCF 3TA1A 2NXJA 3MPUB 1QZ6A 2KT2A 2ZJ8A 4M8LA 4F4KA 2OA8A 2GV1A 2FTRA 4CIGA 3OR2A 1VHFA 2FSKA 4DU1A 1XSNA 3QIPA 2IC3A 3CFRA 3SUQA 1RT4A 3OW2R 2NRTA 3HWTA 3RJJA 1JUDA 1ZYQA 1BPDA 4U9RA 5KFMA 3FEZA 4X65K 4QIFA 1M90O 2C2ZB 3J7YP 3TO8A 4N8NA 2GO9A 4CJQA 1IR0A 2F4FA 5HHHA 2GA7A 3EGZA 3JPSA 5E26A 2FC0A 1KVAA 2VZ9A 3ZSOA 5LSRA 1HBUB 3R1XA 4DF4A 5BR9A 2R7RA 3OYKA 2VQEK 1FE0A 3TUIC 2DBBA 2HFSA 3ISCA 1CLFA 2W8LA 1N2XA 1Y10A 4EMDA 3BV8A 2CQIA 3L4QA 3HVTA 3VAMA 5LSLA 2KZ3A 2Z2ZA 1SJ4P 4BDYA 1F3VA 1L6NA 3ZZUA 2F3NA 1N33J 3O80A 3W66A 3I5AA 2OPPB 5AI0A 4LR7A 2K60A 1Z1ZA 2KYZA 3POTB 2HQGA 4OJLA 4QZEA 3CCJN 4DSIA 4QZIA 1FDDA 2Y0SF 3IS9A 4AL6A 4PKGA 2YJFA 3M8ZA 2D3ZA 2DCUB 1ZD5A 5HP1B 4QIWC 5F2RA 1ZQWA 4I6AA 2IDOA 4GKJJ 2NXEA 1RCOB 4E1MA 2VASA 3QESA 1FJCA 2OPQB 3DLKA 2DT9A 1IUJA 1G6BA 2GX9A 5JU5A 3PYDA 1NLVA 2YNGB 4BVPA 1PJ6A 1HLWA 4CZIA 4DBQA 4U7UK 4X64J 3RMAA 2FJDB 4CLSA 4QZBA 1ZQAA 3GONA 3KWMA 2NLWA 5EE3A 4NWBA 3GZ7A 2C28A 1NNEA 4A8OA 4F92B 2AP1A 2H9ZA 3ZYYX 1DGKN 3I56N 1Y97A 1U2CA 1RK8A 4WU2A 1L3UA 3RVCA 2F8MA 2HVDA 4CDIA 2DGSA 3ZSQA 1NSQA 3TNVA 4CRJA 1EWQA 1J2NA 1NZPA 4ZPWR 1OYEA 3T5HA 4WFNQ 1U48A 4FJHA 4A48A 3DOKB 2ZH8A 2Q3SA 2DF4B 1IXRA 3IKMA 3KLEA 4JHDA 4YHHF 2P5VA 4JKBA 1QE1A 8ICHA 3VQ5A 2E5LK 5M1FA 5D0GA 1RHUB 4GKKF 2HZVA 2UXBJ 2FDRA 4IH5A 4RW4B 4FZMA 3MMCB 4CJWA 2BUPA 3CE8A 4JI4J 5AKEA 3IFRA 3TWHA 5ALPA 2F8HA 4DX7A 2G08A 1GLCG 3B82A 2IRXA 4DV3K 2BE7D 4LF2A 5BXIA 1U0HA 4F36A 3A8JA 3ILIA 2FJ6A 3KJVA 2HNYA 1HQUA 4IRKA 4PKHA 5IQ6A 4ANEA 3AMZA 4C98A 1M1KT 2MXYA 4CD1A 4FLUA 9ICXA 4DU3A 2W2QP 4M2YA 2YNFA 4OKKA 2KP7A 4DUZJ 4G6VB 1FKOA 4CO1A 4M47A 1NBEB 3DDHA 5K4LA 4W5QA 3RJEA 2BJ8A 3MHYA 3ET6B 4UZBA 3AD8C 2L3MA 4CO3A 2XS5A 5KG0A 4UY85 4WP8A 1ITGA 2KJ5A 1YIJN 4ZVTB 2OTLS 4UBCA 3RFAA 4TUPA 1DQAA 1F9FA 1BD6A 5TKYA 1SJ3P 2DTUA 4YY3F 3F5EA 2I5JA 1PVRA 3MMAA 5F8GA 4BJQA 4YP3A 2FI1A 1LAWA 1T3OA 3IXQA 5ALTA 3CMQA 3QSIA 4KB0A 1IKVA 1Z25A 3KHRA 4P4OA 5LL6Z 2VBWA 3HZEA 5AQOA 2ZH9A 4DX6A 1TK0A 3D2EA 4CK2A 2RLTA 3DC2A 4MKBA 4URGA 5KG7A 5F0XA 2XG8A 3M30A 4HHHA 3W64A 2CQ1A 2GQCA 2C42A 3M6UA 4OI4A 5C24B 2Q66A 3AVLA 2QYGA 1DK2A 2JXJA 8ICLA 2HHHK 1BL3A 1T9XA 2B9YA 3D0HE 2WZ1A 5DDRC 4YFKA 4C80A 2EFOA 3C65A 2HCFA 3BO3A 3MM8A 4IFEA 7ICGA 3LDSA 4LF6K 3C2PA 3CW2C 4I7FB 3RBZA 2FVCA 3LPTA 4X5VA 3G0ZA 2CFXA 1TV6B 3NRZA 1WSVA 3DOMB 3LA0A 4Y2MA 3R6LB 3ISND 1ZQUA 4ICLB 2ASJA 3UR0A 1LCUA 2V4JB 3OL7A 2K7JA 1DZ5A 4RW6A 4DFDA 2E1FA 2KMDA 3LW5C 3BS9A 2W7OA 3V6DB 4JI2K 4FJIA 4KGKA 3S7RA 3VCDA 2HSTA 3MCSA 3NUQA 4O44A 4CGIA 3KD5E 2HBJA 1NK7A 2DRAA 5BR8J 3QQCD 2WF8A 1VQ6S 2VANA 2ZTEA 1WOSA 2XGQA 4QZGA 2D6FC 5IT4A 4DS4A 5KT3A 1YJWN 3FZFA 3C6UA 4LJMA 3GG1A 2LYVA 3JPTA 4J2AA 2HK2A 1NJWA 4O5CA 1WWHA 2JZBB 1X7VA 4KGVB 4HVZA 2C3PA 1NDCA 3AVMA 1KAXA 3VQPA 2OSRA 7ICFA 4M5IA 3FEYB 1TUGB 3AN1A 4ECWA 1S0VA 4AL5A 4B9LA 8ICXA 4X2BA 4HI2A 1B43A 4KO0A 1WOPA 5L1JA 2YV0X 3C16B 3MEKA 4LRDA 1RT6A 3IGNA 2GVZA 2ASMA 1LWCA 3SUOA 1A0OB 3C8YA 1RT2A 2B4JA 2ZKTA 3EGVA 2MKSA 3O9SA 4KHPK 2HHVA 3VOVA 3VZHA 1C1BA 2B7BB 1Q82O 3RBEA 5D4NA 1HYSB 4P0PB 4LF4K 4ELTA 1YJ7A 5J1NA 5HMLA 4HTJA 3T19A 3SDEB 2KQ2A 2PY5A 3CCLN 2Q4TA 1HNZJ 1DXSA 3BS5A 2VPWB 4JV5F 1M90T 4W90B 4UW9A 3SJHA 4PG8A 5FPEA 1S9EB 2DFLA 1QSYA 3A12A 1IM6A 3AA4A 3M6XA 1JLAB 1UEKA 5D3GB 1OJ4A 4CJ7A 2BVZA 1DEJA 4DR1F 3K89A 3TKAA 4ACOA 3OYDA 1PVPA 1CI4A 2IJRA 1SV4A 3AA8A 3WKCA 4YS2A 2WF5A 4I2AA 4AYBD 1D8LA 3WHIA 1FDBA 8ICIA 3EO3A 1NKBA 1RTHB 1YVNA 3IUCA 1RWNB 4RL1A 5AK6A 3K8WA 1RZTA 1LKYB 1WC6A 5IZHA 2E7WA 4ILGB 4URQU 4ED1A 5CZVA 4MKVA 4ZJLA 5JLHA 2DRBA 3DV9A 2WMMA 2HFUA 4C4SA 4HWIA 3C6TA 4PPDA 2DNZA 3H25A 2AYGA 2YMLA 4GMKA 4KI6A 4LF8K 5GAGP 2KD1A 3A3OB 1TFWA 1MA9B 4GC6A 4KAIA 3I31A 2XQCA 5AM0A 2EC0A 3AQFA 5AZIB 4A5BA 2ZNYA 5D0HA 3AM9A 2J9DA 4IUFA 4CZHA 5ALSA 5HL7Q 2JR5A 3TRGA 2BJ9A 1PC4A 3AJ2A 3V4IA 3TFSA 3LP0A 3JPPA 2OPSB 1VLOA 4CIFA 2DGVA 1QSLA 2KW4A 2ZGYA 5ALWA 2QEXS 3SD7A 4FPIA 1U02A 2NXCA 2OKQA 1W0HA 3R6GB 3WXLA 3ICXA 3PVXA 1NMNA 4DPXA 1N34K 5CHGA 2N7CA 5B0CA 1S6QB 4ECQA 1IBKK 1GT8A 3FZKA 4BRMA 2OAUA 2FIUA 4BRNA 5CR0A 4ID5B 2FSNA 3W9HA 3UDVA 2WTFA 4FZNA 4BROA 2V9WA 3SQGA 3UQ0A 2C3OA 2PC6A 1YJ9N 3QFWA 1R0AA 2Q2RA 3C21A 4YDXA 3NH1A 3O5BA 4H4OA 2XCPA 1X4CA 3CF5L 3SBGA 2P9CA 3DXMB 4UOFA 3V4MA 1NNDA 2F7VA 1P27B 5J0YA 2Z1GA 4NPOA 4FLXA 1YWXA 2XI3A 4PGQA 2XWYA 4FXWA 5BN9A 2ZE2B 3VEZA 2YX7A 4BR0A 2QX0A 3K9JA 3KHHA 4GIBA 4HUGA 2R8GA 4PWDB 4YOWA 3O1BA 1OO0B 3EJMA 4CYUB 3O4NA 3LP1B 1RHRB 3OVSA 2E5GA 2F8SA 4ZVSB 3TUZC 5J2PA 3EDQB 5C2FA 2D9OA 5AE3A 2IM2A 4DN9A 3F2CA 2Z8QA 2KV2A 3MR2A 3MEGB 2AT1B 4BXOB 1SWVA 2MAXA 3BEGB 2WF7A 4KHWA 5DB8A 3QU4A 2QLFB 2LQ9A 4WP3A 5F9NA 4NCGB 4ECXA 2W11A 2VFUA 2RS2A 3GU0A 4KI4A 4B3RF 3RBDA 3ZX2A 4CBUA 5F3XB 5F8MA 5L1LA 1N36K 4M6WA 4NCAA 5J2CA 4PL8A 2LA6A 9ICWA 1HNWK 5DDOC 4EBDA 1Q0NA 3U6FA 3H1VX 3UD4P 2EXUA 1LOUA 1SL1A 3HP6A 4DQ8A 9ICMA 5KFXA 3G8QA 4YD2A 4KC5A 2RS8A 3UQSA 1KLMA 4PEOA 4CFDA 3NH0A 3VF6A 4CLLA 5J2NB 4EFAC 4DFJA 4CTAA 3FR0A 2QE5A 4K4SA 1NH7A 4NM2A 5JVGQ 3W5XA 2MMYA 1TYQA 4H03B 1TL7A 4F4XA 2RVJA 3VEWA 5KFNA 2EFVA 4ISFA 2QARB 2K8GA 3ETOA 2DGXA 4IXCA 2XNRA 3KHGA 4AFFA 3QRPA 3L0QA 1JLEB 2JEGA 4FPBA 4HUEA 3HHLD 4B3MJ 2JEFA 3WDOA 5IC4B 1K0VA 4DN0A 4LJXA 3MGIA 2P9NB 1HD0A 3FZLA 3MXMA 1NG9A 2J5AA 1Z4NA 3RW6A 2QK9A 3TJAA 3C6HA 4LF9J 2U1AA 1WKJA 5EGYA 2ZIXA 1CJTA 1N56A 3N79A 2D3O1 4P2HA 1Q4RA 1HJRA 4TQSA 4F7VA 2VCPA 1YX2A 2RRBA 4FJ5A 2F5GA 3NGKA 2QI2A 1DBDA 4KY3A 5LMNF 4M3TA 3H4BA 8AT1B 5AJ3J 1WF1A 1XJWB 2GHVC 2BRKA 2RDIA 2YHWA 1S9GA 9ICPA 3C15B 3P4UB 1HMVB 1SI9A 5BPNA 2XWXA 4OPKA 5I3UB 2ILZA 2ROPA 4E89A 4O3SA 2NREA 3W9IA 3QUCA 5IM0A 2QKKA 1M1HA 2RILA 1QJHA 3MX5A 1NGEA 2G8FA 2A2CA 2K1RA 2VJ5A 3TACB 1RDAA 1KVBA 2P6UA 4N7TA 4ZPAA 2RUGA 4HI1A 5D49A 3VCBA 3F53A 3MCAB 4CF5A 4QZ9A 3CFOA 4IH7A 3HSJA 2HURA 3DM2A 4JBCA 1Y3JA 3UO0A 3PRBA 5K14A 3T1YJ 1QAYA 4NI2B 4ZHRA 4F0HA 1IG8A 3LGMA 1E6YA 5KFYA 3O6QA 2BJ7A 1Q82T 4M04A 2KH9A 2CJXB 3X3UA 4IKFA 3R9KA 3A4TA 2A42A 1NZAA 4QBUA 4DOBA 1GMVA 3AAWB 4MMOA 4BC3A 2EAOA 2ASOA 1LXJA 3EE3A 5ALVA 3LGHA 3QXGA 1T3NA 3WNHA 4OYZA 1RAFB 1RDFA 3OTOJ 1U47A 4F0KA 1Z1VA 4IOCQ 3UE2A 4E7LA 2B4UA 2YI1A 2KXNB 9ICJA 2I6XA 2YKQA 1FJGJ 1Y4ZB 1IQTA 4OMFG 2P9IA 2O8BB 1NSPA 1R6YA 1S0OA 4P2SA 1WC0A 1D0EA 2Y0SD 2DNNA 3LDQA 4KLMA 1RZMA 4H0OA 3O3LA 2BANB 4CLPA 3I1YA 2UXCF 2M4MA 2P66A 1F9EB 4X4PA 3UQ2A 2ETJA 1OWXA 4C4WA 1XU4A 3GILA 1R8HA 1JXVA 2F4VK 4ZA1A 3NF7A 2GTDA 4C23A 2VG7B 1SZ2A 1H98A 4PPXA 5FIIA 4XA5A 1HNIA 3VZIA 4CHNA 2W43A 1L7PA 1NK6A 4DV2K 4YOXA 9ICFA 3PKMA 3PLAA 1S6PB 5LT5A 2JWLA 4M7XA 4EO6A 2B21A 4B9MA 3FNNA 5DB9A 5HRPA 3JSMB 2HI0A 4RWWA 4A59A 4CIEA 3CCUN 2LP4A 3D45A 1O1WA 3FKBA 2HVIA 5AQPA 1HWKA 1CUKA 1WDDA 4UZCA 1QVFR 2HFVA 1JLBA 4USJC 2OANA 2PZSA 1GOBA 2A3ZA 4C0HA 1UT8A 4ED3A 1TL1A 4FWKA 4IG3A 2ZEJA 1DTQA 4ZVHA 3J80Y 2E8MA 3CMAS 2UUAK 4I6YA 1AXQA 3MN9A 3CJCA 2BE9B 3M05A 2LEAA 4A8QA 4A5AA 2FVQA 2QM1A 4KN7A 1ZXOA 4FJ7A 4CEQA 3H8JA 2JV3A 1V3SA 2ZBIA 2A1BA 3KG1A 2Z56B 3BQTA 3JQMA 5F3ZA 3R6MA 1YITN 3EZUA 3KJQB 2W04A 1YRUA 3DEEA 3F2BA 4FWNA 2IIRA 5K8NA 4P9SA 3T1HJ 1YT3A 1WACA 5KAFU 3GZFA 3DGPA 2G1HA 3CDAA 2FJWA 5JS2A 5MLCV 4KLGA 1B3TA 4O3MA 1IJEB 3Q2TC 2WFAA 4ZJOA 4I2EA 2HOFA 3DLGB 4PYAA 2V4QA 1LNQA 1Q5VA 1BA0A 3WEEA 1HYZA 1ZBFA 3PFEA 1YBUA 1TKTB 2ZBCA 4I56A 4OYMA 2DKXA 1R8BA 1C0UA 4PA1A 3GCXP 2YQ1A 1TKXA 3RJFA 3ZZRA 4Z4IA 2P9KB 4JI0F 4PAAA 2KEYA 1NJZA 5ADXH 1C4CA 2MSTA 4FNIA 3N5FA 5KFUA 3HDSA 3K58A 1X4BA 4KIAA 2WSEC 8ICSA 1WSEA 3GU3A 2BKNA 5DG9A 2NRRA 3T9NA 1IWAA 3NCQA 3QICA 4IOXA 4ZVPB 4DQSA 4EEYA 3R3LA 2LQ5A 2QG9B 3HYFA 2ZZMA 5AI5A 3RH4A 2Y9HA 4LC9B 3E58A 2W6LA 4JP8A 4ZP6A 3UB5A 1ED1A 3SSRA 1WSGA 3E3XA 3OTEA 4ZVOB 2DR5A 2G13A 3OR1B 3JAMY 4FJGA 3SBTA 3LAKA 3N4QA 2CPJA 2FLPA 4CLUA 2XS7A 4F5RA 4HH1A 3JSYA 1VQOS 4FSVA 3D7EO 1AROP 5ETVA 3MCPA 1RTZA 4I1TA 2K4EA 5GMEA 3V9SA 4DUYJ 4NYOA 3QFPA 3HM8A 4WFNL 5HVFA 4LBIA 3D6TB 3N4MB 2MQQA 2HZAA 4CK3A 1R8CA 5FPMA 2GJ2A 1RDBA 3KKRA 3TAEA 2Y1LB 5BYSA 2OTJS 2RHQB 1CZBA 4O3QA 1GH8A 4CH0S 4UATA 2ZH5A 3NVZA 2CJAA 2KI2A 2WAQF 4Q43A 2DVIA 2ADBA 1A5WA 1HPZB 2G2OA 3ID8A 4ZCKA 1UA0A 5KPRA 3D9BA 3M8QA 5U47A 4X64F 3H42A 2YPYA 1JMSA 1L3SA 3BF3A 2CVIA 4MYTA 2W9CB 4D3HA 3UXNA 3O1LA 3BO4A 4DR7J 2NCKL 4LSNB 3C5FA 1JL1A 2X7IA 2KVSA 2ZOFA 2W40A 3K1RB 1DLOA 3H0LB 1U04A 3OYIA 4BGDA 1OPZA 5IIOA 2ZZNA 1RADB 3ILLA 4NYNA 4FE3A 3F9MA 4EAHD 2WB4A 1LWFB 2J9DE 5CJ7A 4U95A 4AHUA 4K8RA 3H8YA 4CZLA 4HCBA 1IBCB 4M95A 2IJNA 4NE9C 2QKQA 1SUQB 3ZXWA 3IDWA 2UXBF 1S1VA 2ZD1A 4NWIA 1NPPA 4D3GA 1O8BA 3BZQA 5AXKA 2W9AA 3TR8A 4USAA 3CJKB 2WHOA 3CCQS 1V38A 3WKEA 4BQLA 3GOIA 2XVTA 3UKRB 4M63A 4DJBA 3SQOP 1YHQS 3M32B 3AARA 4X4TA 3OS1A 4PWWA 4E7IA 3W5ZA 1MN8A 3HBTA 2DGZA 3I5BA 3I96A 3KUHA 2O8CA 3ZSWA 2H5EA 3PIOQ 4DCHA 1RT3A 5HSPA 4JKGA 2MEWA 3E8OA 2EFQA 2VG5B 4ECSA 2E1MC 2H3IA 2HHHF 4PUOA 4DUZF 3BZKA 1QQ6A 3R2DJ 2MGZA 3QU5A 8ICKA 2R7YA 5ETLA 4DL6A 2G2YA 4KLTA 1GTHA 2OO4A 4DX8H 4LF6F 2GOLA 3JSRA 1H7XA 4DV1J 3CQ8A 1PK3A 1P7DA 3DN9A 2NUHA 4NLQA 2BE2A 1IKYA 2JEIA 1I94K 3NCRA 1D4XA 2IM0A 5K8PA 3O4QA 5HQLA 4FK4A 4J9VA 3DLJA 4NXMJ 1BY9A 4BG9A 1T0TV 1EZZB 3FQLA 1J5EJ 3VQCA 3CDBA 3F0NA 4JB8B 3TVZA 4C11B 3NAEA 2MZRA 4JD2B 2RJZA 5FLXY 3MBYA 1BGXT 1IIPA 1N33K 1QLNA 3QETA 3CJAA 1GNKA 4J7CA 3ZT0A 1EETA 3DLLQ 4NLXA 4JV2A 3VESA 2M0GB 1BI4A 1S1WB 3ETRA 2XMKA 4LY7A 1EJ7L 4PQUA 2E7VA 3L4IA 4RW7B 1MA7A 4ZPCA 2CVEA 2XCAA 4X4QA 5AE1A 1UJ6A 3BQ2A 3TAQA 5J1PA 2V0NA 2CPRA 2CGKA 3T41A 3I82A 3CJBA 1NGJA 2GHWA 4YXMA 3S3OA 1KBRA 4O4RA 4DS5A 2GIFA 2W01A 1VQ5N 5ALOA 4CH7A 2XY7A 1C0TA 4F9OA 5HBMA 4UAZA 4QIEA 3GIJA 4WXOA 1VI7A 1V5IB 1PILA 2GC8A 5AR0A 4OPHA 1U2RA 2ZC4A 4DDFA 4YN3B 4CNZA 2PXIA 4Q2MA 4KH4A 4Z4CA 4DI6A 3WX8A 4F50A 1ZH5A 2ZFHA 5A0YA 3L7OA 5HMMA 1TUWA 1N5TA 2VQFJ 4WQ4A 3RJKA 4JI1K 2FMSA 1UFWA 4DHVA 3LZJA 3HFKA 3O6WA 1S7IA 3VQAA 1ZM4A 7ICLA 5IT0A 4TXSA 3KLHB 2UVWA 3VGMA 2PFFB 4JI4K 1JXEA 1FERA 1HHQA 4JKEA 2OXOA 1S22A 2P9PA 3V7LA 3MEEA 2R7WA 5L1KA 1TL5A 5AM1A 4DL2A 1NJIO 2IAJA 4I2GA 3UXOA 5KNIA 1KAZA 3ISDA 2R3VA 1S6UA 1VC6A 1WC3A 2PFNA 5CR4A 2HHUA 4W98A 3KLFA 3UCZP 2NO4A 4FO0A 2XMVA 2QLBB 4H5VA 1RT5B 2CGJA 2H5XA 2LI6A 4FXVA 4PQAA 2ATLA 4RW8B 1GLAG 4DOZA 4QZFA 2NYVA 3NMAA 3VEYA 4AD6A 3HVAA 4NRUA 2NYHA 3T5KA 1RISA 5FPDA 4Z6FA 1NRKA 2E2NA 3HF5A 4HAIA 1BNPA 3IM9A 5KFGA 3VGUA 1HNZF 3VQ8A 1AQ6A 8ICBA 2KK0A 4B3SK 1SQGA 3AVJA 3OHAA 2ZH3A 1U1LA 2KHOA 4H0PA 3K57A 2FBTA 3CT9A 2RP5A 3FGUA 5HL7L 1AT1B 1VIXA 1NMDA 3TJ9A 5T7BA 2HBYB 2G8HA 3FSYA 3OA9A 2QLWA 1L3TA 4OV6A 3TEHB 1XN9A 3SV4A 1UVNA 1ATRA 3OL8A 2LQBA 5FPNA 4YB1P 1L7OA 2DNMA 4ZVGA 2D0OA 3C5GA 4KHUA 1YXQA 4K41A 5H1SV 1RM6C 3CCRN 2HBLA 3M8PA 2KM8C 4F5NA 2HNDB 3TA0A 2A3VA 2MKCA 2GQQA 1ZAXA 2KTQA 5DBAA 5KFZA 3GDQA 4RQ7A 3HRGA 3NEKA 4DR3J 2CADA 1T03A 1CRXA 1YVFA 1H72C 1BIZA 2E1CA 3GR1A 4DV7J 3AOAA 2EZXA 5C42A 3I55S 4KAZA 3FMWA 4Q45A 3L3VA 4MTPA 1TU0B 2VB6A 4B1VA 3H08A 2CZVC 4KRWA 3TTDA 2Q6CA 2F96A 2BEFA 1MMNA 1ZJMA 4J2DA 4I2BA 3SQ2A 2HS3A 1JLQB 1DQ8A 2V94A 4IJNA 5DMRA 4USUA 3S3MA 2W1BA 3UM9A 3T7ZA 4CZFA 3BR9A 2P6TA 2ZGZA 4WF9Q 2O1PA 4OX9K 4IR1A 1LWEB 4Q0BA 2EAMA 3DMJB 1T8EA 2BGGA 1FKPB 1WEZA 5BR8K 3L2QA 2KJ8A 3I0SB 2HOQA 3ZD9A 5DBCA 1OVQA 3MR6A 4BE1A 3EWGA 1KQGB 2VDHA 4RTFD 3VVTA 1F0MA 4A8XA 2JMGA 2BPGA 1BQNA 3AVNA 2HMIA 5B7WA 4FFDA 4CO4A 4QZHA 4QR0A 1IBLJ 3KKSA 2FE9A 1T3QA 2GUPA 4ZPTR 2QTWA 2D8CA 3R7SB 1J54A 3Q8VA 4WYBA 5H2FU 1VQSA 1F60B 4USIA 4ZPVR 3GIKA 2IIHA 4H4MA 3Q8QB 1VCTA 3AGKA 1FXDA 1UW9A 3TEGA 5BRFA 3CPWR 2X1FA 4R0EA 3KK1B 3AB2B 4ED0A 4CT8A 1KRPA 2JJ4D 1F5BA 3IRXA 2FVSA 3DRPB 4C6AA 4HTUA 2QSWA 4BC2A 1REGX 3H90A 5J2HA 5ALZA 2OUGA 2QA4G 3DCAA 4OL8A 1FXRA 1RNHA 3B4MA 4DV6J 4PRFA 4L6V3 1VIOA 2LYHA 1OH5A 1NXIA 1R59O 3FMBA 1DFDA 2MY8A 2BR0A 2IRUA 2O8DA 2GVDB 2GO8A 1W26A 2GIQA 3CD6S 3LPUA 3CJTA 5HHIA 2IPOB 2RRDA 4P2XA 1N32J 4FLWA 4CGZA 4U67L 3OGUA 1GX6A 2A10A 5J2FA 3RZAA 3TFRA 2UP1A 4OYBA 2XMMA 4YQWA 2WB1F 3ZEUB 3HHLA 3MM5A 3CCMS 8ICQA 4LFCK 4CWBA 1S10A 3GV5B 4Z6CA 3H20A 1IJFB 5D0EA 3LQVA 2NLXA 2P6RA 3GE9A 4C9DA 5D4OA 1EKSA 2CPDA 1Q1KA 1T11A 4PXCA 2HYIB 5KL1B 4F4AA 2OPQA 3DYAA 4ED6A 3F44A 3RR7A 4JI6K 3TTCA 1VSHA 3ULEA 2L41A 4J5OA 3CC4N 5KL8B 2Q6BA 5E33A 1IKXA 2NRVA 5EWGA 2M2BA 3D67A 2LFVA 3Q8KA 3QEXA 3CC2N 1UA1A 4IOBA 3KK3A 4ZK7M 4P0QA 3QATA 2C22A 3PG9A 2H3QA 4US9A 3NVYA 1RWMB 3FC4A 3K2PA 3CJ8A 3CJ1A 2PMZD 2DY9A 1X5PA 3C7NB 5DDYA 2RN2A 4M94A 1HR0K 4Y2IA 3NNHA 3G6EN 5AM5A 4CLWA 3OPXA 2QL7B 4PG7A 4TKTA 4FJ9A 4ZIVA 3UFCX 4JI5F 1Z6RA 4J91A 1A77A 5D4BA 4QIVA 1S59A 4YOVA 1B7YB 1VQKS 5AQRA 4JOUA 3PHTA 4CNQA 2VDIA 1R89A 2M70A 4HACB 4X62J 4F2SA 4CP5A 2E5JA 3CJ2A 2AA4A 1R6VA 1C2PA 3CCSS 3NGIA 2EZYA 3M6ZA 4IFVA 1PCAA 4K4XA 3TVYA 2ZTCA 4CHOA 1GXLA 4RQ1A 4LQ9A 2YKNB 2FPHX 1NO8A 4JI7F 3R5BA 4H0TB 2W7PA 1LW0B 4HYKA 3J8AA 4CBXA 1RAIB 2W4CA 5AJ3F 3HJVA 1RHMB 3QT8A 2FHKA 2A1SA 3IMXA 5I9EB 2XNQA 3W2VA 1S99A 2AX0A 3LZIA 1RTJB 3D28A 3Q8LA 2H3EB 3DOLB 1NU0A 3HKZF 1C0GA 7ICRA 4H5TA 2VICA 1T9TA 1JN3A 4JKHA 2IOHA 1NJIT 3IN5A 3E0FA 4IOCL 2ZWOA 2E2PA 3WKDA 4A2AA 3VF2A 1CC8A 3BGOP 5GMKa 2MQLA 2W24A 1G1XA 4WQ5A 3QWUA 4CK1A 2E8PA 4PHEA 1OH8A 1CS4A 3TZWA 2JC0A 1RCHA 5HRNA 1ZS6A 4WFBQ 2KFYA 1UVLA 4OJRA 2EVZA 3BF4A 2YX1A 2U2FA 5CD4H 2YWFA 4TY8A 2B4VA 4OKEA 1Q8BA 2W4PA 9ICEA 4UUWA 4U7UD 4PXEA 3E2EA 2XMTA 2CZ4A 1MU2A 4YFUA 1NHUA 4IQTA 4RQ2A 3V9XA 2O4IA 1WAJA 2M5YA 3DFEA 2YHBA 4Q8FA 3BP8A 4CJPA 2CNOB 1HQEA 3NL0A 3IDHA 2ROEA 4J2BA 1NZ8A 1WELA 5T7LA 5DZ6A 4OGCA 3M4XA 3H2LA 1SIWB 5IXUA 2FMQA 1EKRA 4CGHA 1H74A 2XLIA 3CIMA 3PW7A 3MM7A 2GGPA 2P6SA 4AHTA 1ZQMA 4IQWA 1RDRA 3KVGA 3UPQA 2ESEA 2IGIA 3VGLA 4USTA 3OL9A 4CLZA 1ZQYA 2ATQA 4AT1B 2BGWA 2FF6A 5L9XA 1B92A 2KLAA 2PKEA 1RYSA 1Y5LB 3UVJA 4CZJA 1S1TB 1FTRA 1N0UA 3BO2A 2QLTA 1XO1A 4CGGA 1RABB 2QL9B 2DB1A 2F9JA 5ALGA 2KHQA 3S3NA 1XR7A 3RAMA 1C6VA 3V2UC 1OKJA 3QO9B 3HL8A 1U1MA 1NGCA 1IO2A 2CGLA 1KFDA 4NZ0A 3H98A 4ILRA 1ZBSA 2DHHA 1GMUA 3CJSA 4RBUA 2VWJA 2ZHBA 2C3MA 2D0CA 3NDKA 4Z37A 1C4AA 4QU6A 1KC8O 3W8PA 1D09B 3FBCA 1KQSM 3SMSA 4YR0A 3GWCA 5IIMA 3SSQA 3KLGB 4N8OA 2I6WA 1XHXA 1SXLA 2ZG6A 5CYMB 5JVHQ 2AF6A 4OIXA 1HKCA 3QT6A 1TUVA 2RU9A 2PBDA 2ZHAA 3UDLA 2LXFA 3LWMA 4IEIA 4YORA 3R9LA 3K5PA 3W60A 4FVCA 3BN7A 1SZHA 4YD1A 4CI6A 3LOUA 1CJUB 1U8SA 2WK4A 3PW0A 3OYNA 1V5VA 1PKUA 2VA3A 1GLJO 3WNGA 4FDFA 2ATCB 1TUYA 3JPOA 4P7VA 2PFQA 3W65A 4WE1A 4JS5A 4CLYA 2CPHA 5J0TA 3GR0A 3T1HF 4B3OB 5KG5A 2ADCA 2ZUCA 3JTOA 3CYMA 5JXSA 2ZBRA 3OYBA 1FD2A 5CZXA 4I0WA 1M6YA 3HX0A 2F40A 4YHHJ 1A7GE 4WK3A 2V50A 3T1YK 1U2VA 1GLLO 3W1YC 4GKKJ 1RTDB 4L3KA 4HT5A 1KTVA 1KSPA 3PNCA 3UR3C 4OQJA 3TJ8A 2JC1A 3VAIA 2ASLA 4M9GA 2DNOA 3QEVA 2DISA 3LPYA 3A8EA 3ENVA 3I0RB 5HO4A 3H0MB 3OYEA 1T05B 5E79U 3SAFA 4UW2A 3MN6A 3NOGA 1X9WA 3DHWC 1NK0A 4LH5A 1ZD3A 1UEVA 3BYPA 4PH5A 2RPIA 4ZCMA 3OTOK 1YGYA 1PAEX 3KBBA 3J80O 3PW5A 1SBRA 2DCLA 4LF5F 1FJGK 3THYB 2Q3PA 2IVNA 3JYTA 5D15A 4NA1A 3TA2A 4JI3F 1X8DA 1FDNA 4R79A 4TY9A 2RE1A 3QLHB 4H0VB 3PMLA 4F67A 1N62A 2O8FB 2O67A 5KFAA 3KLIB 4R65A 4YY3J 2RHFA 3MI7X 1CULA 2E2OA 1T02A 4Y2QA 1A5XA 2Q31A 4RNNA 2L08A 2XO7A 2EBGA 4ECVA 5J2DA 4Y1DA 3BDPA 1HFEL 5C10A 2CJYB 4M63C 3IR6B 1SH0A 4M9NA 4DUYF 5ADXA 1R31A 4I9QA 4HEA9 3D5MA 4ZDNA 3ZSXA 1X4FA 2DWQA 4FF4A 2LEPA 1G2EA 3EKUA 4UB8U 3THVA 3ZT1A 3NRWA 5KFJA 2UVUA 3O9RA 4FBUA 2YQEA 2OTLN 2P1JA 1KOOA 3AD9C 2NZCA 1BXNA 3H7IA 3G4SS 2OMLA 4K0KJ 3AVGA 3QZ7A 4G1QB 4NLWA 3T79A 1SC1B 4KKOB 3ENWA 5KFSA 2G0IA 3DGVA 3HLUA 4MLEA 1IBMK 3OLAA 1R7IA 2KSOB 1XTZA 2X3GA 3PX0A 3OTBA 4IO9Q 4F04B 1HX1A 4FWLA 1ZBLA 3GFXA 3R5AA 3VC8A 2FVPA 4C1NK 2FXUA 3ZX0A 5LJVA 3IG1B 3PIOL 4LVOP 2VA8A 2OZMA 3LVWA 4ZITA 2K06A 1PK1B 5KFBA 4AXJA 3AA5X 4CM0A 1S3XA 4ECYA 3C1YA 4ZCLA 1VSIA 4M3RA 2HGNA 5ADZA 2HAIA 1RAGB 4ID8A 1NSKL 3ISNC 1VQMS 3G86A 3O8WA 1IN0A 1EKEA 4P2FA 5AQMA 3P4IA 2M3DA 3DRSB 4QR2A 1X4AA 5DG7A 3CETA 4B08A 3V1OA 1WEYA 5IFMA 2E88A 4ZP9A 4KYZA 4AM6A 3MXIA 1PC5A 1RBSA 4MO5A 1PUZA 1J2MA 3A2FA 1PIEA 1IKWB 2WTUA 1XMOK 4IL6U 2ZXHA 5GTHU 3RUBL 1VSMA 3IRUA 2GWSA 1RSCA 3QDKA 2GS8A 8ICEA 1FRXA 3WKAA 4KFBB 4ILMA 1NJYA 4M5NA 4H5NA 3DLLL 2DPIA 2KVCA 4YOYA 1RACB 4QIWD 2Z4PA 5C25A 1LQ9A 3V9WA 1HNVA 2H65B 5EOZA 3JQJA 1UJ4A 3SZ2A 3IA0A 3A8KA 3A0IX 2DR8A 4RPXA 2CQCA 3K5NA 3ZTSA 5LXYA 3MR3A 1XNRK 4M5HA 4I4BA 1K73O 4YEAA 2HHTA 1JXLA 4BHQA 3LF0A 1U1RA 2FGOA 2D74B 5AKIA 4ANDA 1J5OA 4FK0A 1VQ6N 5ALUA 4WQ4C 2BH1A 2OD4A 2W9BB 8ICAA 2OGUA 1J2VA 3QU9A 5ALEA 4KTQA 3BKUA 2YMQA 2DNRA 4NL5A 4DV1F 2UXDK 1TKZB 4MFCA 3RRHA 3M2RB 2B6AA 3L7PA 3B0XA 7ICJA 4O0NA 2RB7A 2XYHB 3SAGA 4JV5J 2D0BA 4BE2A 1Q86O 1ZQJA 4FJJA 2YWEA 2QSFA 2IFXA 1A5VA 1J5EF 3KK7A 1L3KA 1XHZA 2RF2A 3CDEA 4PXBA 4EUVA 3A1YG 4DTNA 5CP2A 1R43A 3IAM9 5J2JA 4LVSA 2Y0BB 2MUTA 3VGVA 1VBZA 3ZO7A 1MWYA 1PBAA 4C8OA 4UQGA 1LWXA 4K59A 3NGRA 5D46A <