2BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*C)-3')
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bdpA01
3ISBA 4MF2A 3HW8A 3HX0A 1ZQVA 3OYKA 1ZQIA 1TKTA 5J0UA 1IXRA 4LH5A 4DTRA 4K4GA 4CK3A 3PR5B 2G8IA 3MEDA 5L1IA 3OYJA 1S0NA 3OYIA 1HNVA 2DFFA 2RN2A 5KFVA 4DS5A 4FJNA 3L3VA 3KLGA 3OS1A 9ICTA 4O3NA 3TI0A 2A1RA 4KN7A 1J54A 1KRPA 1Q9XA 1ZQTA 3DLKA 2FLLA 4ZTJA 3OJSA 2YHBA 3NGIA 1ZQBA 3K4GA 3SQ0A 4RT2A 5IIOA 1I3AA 2BHNA 3C2MA 1CZ9A 2KW4A 3AA3A 2ASLA 3ZDAA 3DI6A 3AO1A 4UB1A 4KHSA 4ECZA 1T05A 5FRNA 3Q8KA 3TAPA 4YFKA 4ECXA 1D9FA 1EETA 1S97A 4DG1A 4JV0A 3MEGA 3PX4A 4Q8EA 4N56A 4CJSA 4DU3A 3V9SA 3SUNA 4F4YA 3Q8MA 3V6HA 3DLHA 3C95A 4X5VA 3NF9A 4KO0A 4E1NA 3QERA 4RW9A 4FLUA 2RDIA 2PY5A 4RQ1A 3T1AA 4RQ4A 1AROP 4LSLA 4GXKA 4JUZA 1HPZA 8ICWA 2HNYA 3MDAA 1MU2A 5D46A 4PGXA 4NXZA 5DBBA 1XSLA 4KLFA 3PW0A 3ASMA 3VQPA 4CJ3A 3KHRA 4YNQA 2P66A 5KFBA 1K1QA 1S77D 2VA2A 3M9OB 8ICRA 1UOCA 3WNEA 4ZH4A 3HPHA 3LWLA 9ICVA 4QZIA 1RTHA 2YV0X 1S1VA 4JV2A 1CEZA 3QEXA 1KDHA 3PMLA 5DLGA 1TL3A 1RDDA 3SV3A 4YVZA 5CB1A 1YVUA 4TSXA 3Q8RB 4JK1A 7ICOA 2HNDA 1X1PA 3ZSXA 3ZDCA 8ICOA 3TABA 4QOZB 3TAQA 4O5BA 1QE1A 3K59A 3OYFA 3QEPA 3AO4A 2QKBA 3HM9A 4EYHB 3KJVA 3M8QA 4HHTA 2JZBB 2XHBA 4DEZA 2EHGA 2DFHA 2C2RA 7ICIA 2UVVA 4BE2A 4BE0A 3QEAZ 1Q9YA 7ICKA 4G1QA 4F4ZA 1KTQA 4NCBA 4O5CA 8ICAA 4FM0A 4UB5A 4R8UA 3V9WA 4B9LA 3UIQA 3PY8A 1ZQEA 1FKPA 3KKSA 1UA0A 4J2BA 5HHIA 4R64A 4FCYA 4FLXA 1LV5A 8ICVA 2KFZA 1EKEA 3SNNA 3PW7A 2KFNA 5CZ2A 3G6VA 4FK0A 3KK3A 5SWMA 4ID5A 4ECWA 1QLNA 2BQUA 4EZ6A 2MAXA 3JPPA 5J2AA 1C0MA 3T19A 4UQGA 3DRPA 3KIOA 4ECUA 2BCRA 2QXFA 1BPDA 1RPLA 4UAWA 1VK0A 4M45A 3KTQA 1ZYQA 4CGJA 1NJWA 5KFQA 1A5XA 4YG2A 2FMQA 1HJRA 1TKZA 3QEVA 3ZT0A 1A77A 5BOMA 2VG7A 4PQUA 5KG6A 4C8NA 1RDAA 1NOYA 4PA1A 1NJZA 4DQPA 4CE9A 4OPJA 1KFDA 3P83D 4CCHA 4KLQA 2FMSA 3S3OA 2B6AA 1X9SA 4RQ7A 4I7FA 1Z25A 4KLHA 5JS2A 4FZYA 1MQ3A 3JPSA 3JPOA 4KLUA 1ZBFA 1NK4A 2J6SA 4ZTFA 4BWJA 1JL2A 1NKEA 3AVGA 3ISCA 2BCUA 4O3RA 2V4RA 3KLHA 1LAVA 3AVHA 4ELTA 8ICYA 4PHAA 3P5JA 3RBEA 3OSPA 5FDLA 4HUFA 2G8FA 4CEZA 4DFJA 3I0SA 4CHNA 2OPRA 3E01A 5FROA 3PX6A 4HUEA 2P6RA 7ICJA 3LDAA 4CJLA 5T7BA 3BJYA 2OA8A 4R8UB 3VQ9A 1BPXA 5D49A 5KFAA 4P4PA 3H8JA 4UBCA 3JSMA 4YXJA 3T3FA 3FYHA 4J9NA 4C8LA 9ICFA 2P5OA 4QZDA 3I0RA 4DF4A 5CYMA 5HBMA 4GXJA 3SQ1A 2DFEA 3NE6A 1D8YA 2PFOA 3ITHA 4M42A 4KHNA 4Z4FA 4J2AA 1IKVA 5TZVA 4CJRA 2BKEA 4FJIA 4FJJA 3NAEA 4YCXA 1B43A 3T5JA 3D0PA 2Z1GA 9ICJA 1BCMA 4F92B 5J29A 1TKXA 1N6QA 4M2YA 8ICTA 3H4BA 2W42A 5J2NA 1LAWA 2FPLA 4B8CA 4QWAA 4OLBA 8ICJA 2W9CA 5J2QA 4E7LA 2IS3A 4DL6A 2XGPA 3QLHA 1V9PA 1RT7A 3NGDA 5J2FA 4RPZA 2D0CA 3JPNA 1GOBA 3V1OA 4KTZA 4MFCA 1KCFA 4M6WB 1S0MA 1ZQNA 5IIJA 2PI4A 3E2EA 3NH0A 5KT6A 3T5HA 4BGDA 4F4WA 4B9TA 3RJFA 1QS4A 4RG8A 4ECQA 1DTQA 3QNOA 1COOA 3SCXA 3UPQA 2NUBA 2F8SA 2KTQA 2DTUA 4IFYA 2EX3A 2A1JA 1U49A 5HMMA 4RNMA 1S9FA 4FK2A 3C5FA 5CA7A 5CY4A 1ZQDA 5DB6A 5J2DA 1L3VA 1KFTA 2W9BA 4KLOA 4KLMA 4E1MA 3AO5A 2HW3A 2ZUCA 2KZ3A 1VRUA 4CEBA 2D5RA 5JS1A 1N56A 1T8EA 2QKKA 3P1GA 2WONA 4HTUA 4KLGA 1ZQWA 2Y1IA 2FC0A 4B9SA 4DTJA 2G8HA 2Q0ZX 3SUOA 1HYVA 4CECA 1BGXT 5I42A 5KFPA 4I2BA 3ZSRA 3VQBA 8ICZA 7ICLA 1A5VA 5EOZA 4M3WA 2W9MA 3VQEA 3VQQA 3L2WA 4NM1A 1S9EA 2YNIA 4I2CA 2XY6A 5KFZA 1XS9D 1FXXA 3KLEA 1WSGA 2W8KA 1JLEA 2XCPA 2IHNA 1U48A 4TQSA 4LVSA 4C8MA 3LDSA 1EX4A 1ZBUA 1S5JA 1ZQRA 4FS1A 3K5NA 8ICMA 3ULDA 1KVAA 3CFRA 3PR4A 4GLXA 4ECRA 3QIPA 4Q45A 4RQ8A 2RF2A 1X9MA 3MR2A 2W9CB 5KRSA 2BQ3A 4DTMA 5J2EA 2VWJA 1IKXA 5KFXA 2DPJA 4ED1A 3VQ6A 4ELUA 1XC9A 3O3HA 4QAGA 3MR6A 1RT4A 3NGZA 4GMJB 4AHCA 3MECA 2ZTEA 4DQQA 3V7KA 1MSWD 5J2MA 4M9HA 4E7KA 4J9MA 3QETA 8ICSA 4K4IA 4QWEA 1TAUA 3RJHA 3ZT1A 3SI8A 8ICLA 2RKIA 2R7YA 9ICLA 4FYDA 2BGGA 1RDCA 4CJTA 2ISOA 2BE2A 2Z1IA 4CIGA 2BCQA 2Z1JA 3DYAA 1UWBA 4XA5A 3JPTA 2P1JA 2ZD1A 1Z3EB 3GDXA 2W9BB 4GVMA 3HP6A 4J9RA 4DOCA 4KHYA 4IRDA 1Q8IA 4KPYA 4CIFA 2R8IA 3A2FA 2VWKA 4MQ3A 4Z4HA 1RT1A 1VSHA 4QW8A 4XQ8A 2P5GA 3Q8QB 4GC6A 5KT5A 1A5WA 4O5EA 3NTUA 1X9WA 3RH4A 2YNHA 3B6OA 2F8TA 4CFAA 3DOKA 4OVLA 7ICNA 3RJGA 4QWBA 4Z6EA 1TKDA 1ZQQA 3KD1E 1T3NA 4CEFA 3CQ8A 3OYNA 3ZT4A 4I2PA 4LZGA 1S0OA 4DL3A 3V6KA 5KFKA 3OHBA 2ATLA 3QZ8A 4E89A 4I2HA 2LSNA 3HPOA 2UVUA 3RB0A 1BPYA 4FBTA 4Q44A 2FBTA 2AGQA 5CR0A 4NY8A 2ZJ8A 4B8AB 5KG2A 5KG4A 5KFHA 4I28A 4Z4EA 4E0DA 3RRGA 3TAMA 5SZTA 1TV9A 2V4QA 3OHAA 3TFSA 2AQ4A 1JXBA 4LSNA 2OPSA 3K2PA 5EU7A 7ICFA 3QIOA 4PUOA 2BPFA 3C94A 1NJXA 5DLFA 2C2EA 1S1UA 1C7YA 5KFLA 1W0HA 4E3SA 4DL4A 2ZJ5A 3RR7A 4C8KA 1ASUA 3QINA 4EBDA 3BQ2A 5CZ1A 3C2LA 3MGHA 3LZJA 5J2GA 3VQAA 4CJQA 1I39A 1X2IA 4FM2A 4IDKA 3OVNA 3TAEA 2JZBA 1ZQHA 4CERA 4YXMA 5CP2A 1UA1A 1NOZA 4IR9A 3DLRA 3AVIA 8ICQA 2YKNA 2F1HA 3EPGA 3U6FA 1XHXA 4RUAA 1LB2B 4JRPA 4I2IA 3LWMA 3L2UA 3OYMA 2OPQA 3G10A 2R8KA 1FKOA 1JKHA 3OYHA 5FRMA 1DGSA 1H38A 3VQ4A 2J6UA 4R66A 1NK9A 2B5JA 1BPZA 3L3UA 2YHAA 5KFJA 1Y88A 2C2DA 4CEQA 4RNNA 2ASJA 1F21A 5KT7A 3VQ5A 5IILA 4B9NA 3O4NA 2D0BA 5IIKA 3VA0A 1BIZA 4YQWA 4FZXC 5KT2A 2O4GA 4DQRA 2F1JA 4DLGA 1WSIA 4I2AA 4PY5A 1WAJA 4R63A 4KB0A 3AU2A 3ZDDA 4DTSA 1ZETA 3PO5A 5KG0A 4K8ZA 3S3NA 4KI6A 4DSKA 3SI6A 9ICKA 3AVKA 4IBNA 1YTAA 3V7JA 3OYEA 2VANA 1SUQA 1WSJA 4FJHA 3ISNC 1JL1A 4MF8A 3C5GA 5HP1A 3AO3A 4YMOA 4Z6CA 2C22A 4RUCA 1YTUA 4DQIA 2FBYA 4CFDA 1S9GA 3OYDA 4Q0BA 1D8LA 5DB9A 1RT6A 3OYBA 4QZCA 5IINA 9ICHA 4KLTA 4B9MA 4L8RB 1XI1A 5CWRA 3NHGA 2OYQA 3SUQA 2GWSA 2BANA 3AVAA 3IHQB 1K6YA 3VQCA 4N41A 2KN7A 2FBXA 3M8SA 1C0TA 3CYMA 3LP3A 2Y1JA 3AA2A 3QNNA 7ICPA 2KZZA 1RBUA 4FLTA 2HVHA 3AV9A 4FJXA 2IAJA 3ZCMA 3MXIA 5EWGA 4B9VA 5L9XA 1ZBLA 1C1BA 5KFNA 5J2IA 1Z00B 2A1SA 5KFOA 3KKRA 5J0PA 1JLBA 3KHHA 5DQHA 2BCSA 2FPKA 3RMBA 1L3UA 3NCIA 3JPQA 1RXWA 1NKBA 4FO6A 1JLFA 2I1QA 4YN4A 3RAQA 3O3GA 4B9UA 4Q43A 4E19A 1HQUA 4CGFA 3OYCA 3TAFA 3RMDA 3ZSWA 3BQTA 2OZMA 4GXIA 1ZQUA 4E7JA 1RTIA 4KLLA 3GV5B 4IFVA 4FS2A 4EZ9A 4M6WA 1ZJMA 3ORYA 4RQ3A 4DLEA 3WNHA 3LALA 4F5PA 1S6PA 2P51A 5KGXA 1WSHA 3K5LA 4BDYA 1U47A 2VG6A 2O4IA 3AA5X 3RTVA 2HB5A 1ZQPA 1ZJNA 4DL5A 4OGCA 1MC8A 2GBZA 4IR1A 2HMIA 1Y97A 4B08A 1T4GA 2MUTB 4F5RA 3HVRA 3QZ7A 4O5KA 2F1IA 1T7PA 3RH6A 4RQ5A 2BQRA 7ICUA 2IA6A 9ICNA 1L3TA 4DOAA 1QTMA 3VA3A 5J1EA 4F4KA 4E7IA 1DOQA 4FW1A 4EBCA 4FJ5A 1RT3A 3NF8A 3JPRA 1VRTA 3TFRA 4Q5VA 4CF8A 1CXUA 2IHMA 5C24A 4XRHA 4PGYA 4UB4A 2X6SA 4G3IA 2G8KA 3EYZA 4KMUA 3CFOA 1HNIA 3IRXA 3ISDA 4EEYA 2XC9A 4M0AA 1N5YA 5DG9A 5CJ7A 9ICWA 4IQUA 5DGBA 1UAXA 4DFMA 4NLGA 3SPZA 4TQRA 3O3FA 3NGYA 1C1AA 4N5SA 7ICEA 2W8LA 4NLZA 5J0WA 1EP4A 2R8JA 3B0YA 3MR3A 2KZMA 3HO1A 2BR0A 1CUKA 1RYRA 2I5JA 2GV9A 5J0XA 5HHHA 3H4DA 4JS5A 3L2VA 4CJKA 5I3UA 1A76A 4FK4A 4IRCA 2HVIA 1J5OA 2XO7A 3C1ZA 3PNCA 4CESA 4RQ6A 4DSJA 4CGHA 2G8UA 4KLEA 2AGOA 2NRZA 7ICRA 1ZQJA 4TURA 3NF7A 4CF9A 4M3XA 7ICTA 2JGUA 4M9GA 3MXMA 4EP5A 3ETLA 1JLQA 4IG0A 3OYAA 3M9MB 4DTUA 4DU1A 4PH5A 4DO9A 5HP4A 4J9KA 1JIHA 2VA8A 4RPXA 3QE9Y 3C6UA 4IQTA 3I8DA 1IM4A 3PVXA 8ICXA 9ICAA 4YR2A 4ED0A 1B22A 4J9LA 3GV8B 1IH7A 2PI5A 3T5LA 8ICFA 1ZQZA 3RJKA 4ED6A 4CFBA 1ZQYA 2IMWP 3MR5A 5KG7A 3PX0A 4DFPA 5J2BA 1HJPA 5J2HA 4CJUA 1L5UA 4W5NA 1EXNA 1RBRA 4H4OA 4O44A 4ED8A 2QK9A 1S1WA 1D9DA 4ID1A 1JMSA 4CK2A 4RQ0A 2OWOA 1S6QA 4NYFA 4JV1A 4O3QA 2E4LA 1NKCA 4YFUA 5DBCA 2UVWA 1NOMA 1ZQAA 3HWTA 4OJRA 4HVJA 4OKJA 5CHGA 3GIMA 4Y1DA 3LZIA 2HNZA 2VA3A 4F2SA 8ICEA 3S3MA 3EWAA 1MQ2A 3ZSYA 3ZDEA 5DMRA 3RJEA 1BQNA 4O55A 3AVLA 4N47A 1B9FA 1GOAA 3ALYA 2ETJA 3QEWA 4JS4A 4XIUA 3OYGA 3BQ0A 5HMLA 1CLQA 4DSIA 4FLWA 4F93B 4FJLA 3IM1A 1BVSA 4BXOA 4W5TA 4NYNA 5KFYA 3SYZA 4TUQA 4DSLA 3EZ5A 4Z6DA 3CG7A 3ZD8A 1NK6A 8ICPA 2UVRA 4QZFA 1VSDA 3AVMA 2ZE2A 3O4QA 4JRQA 2XY8A 5F9LA 1SV5A 5KRTA 3IAYA 3H40A 3F73A 1NK8A 3LAKA 1SKWA 4CHYA 3GIKA 3AVBA 4ECVA 4I2QA 4ICLA 3OS0A 4CHPA 4DSFA 4O3SA 9ICGA 4KHQA 1JXLA 4RQ2A 2RPIA 4KLJA 2AGPA 3DOLA 5L1KA 3PO4A 2G8VA 3D45A 4J2DA 1JX4A 2JLEA 5J0TA 3PMNA 4Z4IA 3C1YA 3MFHA 1KLMA 5J0OA 3BQ1A 1LW2A 1RBVA 4C8OA 3Q8PB 3NDKA 3G6YA 4MFAA 4F50A 4OPKA 1U4BA 1K1SA 4BDPA 1BISA 3NF6A 4I27A 3HVTA 2B21A 2ZUBA 4O4GA 2HHUA 3SUPA 1GOCA 5J0YA 1CZBA 3AVFA 1RTDA 3AVCA 1ASVA 5KI6A 4CHZA 3EY1A 4YR0A 4WE1A 1BIUA 1JXEA 4BE1A 1ZQKA 3THVA 4FJ7A 1BI4A 5HRRA 3NH1A 1ZQCA 1CXQA 4FBUA 4HCCA 4RZRA 2IC3A 1RYSA 5L1LA 2HHWA 4LH4A 5J0SA 8ICIA 1VSKA 3PW5A 3C23A 9ICPA 3L8BA 3EW9A 2DPIA 2IOCA 1ZQGA 3OYLA 2YKMA 2NRTA 1BL3A 5E41A 3RMCA 4FLVA 4I2GA 3DLGA 4DSEA 3LK9A 1QSLA 4DWIA 4PPXA 2KQ2A 4BXOB 3N4MB 3MABA 4AHRA 4CJFA 5KG3A 1SL0A 4ED3A 4M9LA 1PZNA 4H8KA 4ZHRA 4KI4A 4IG3A 3GFKB 2BPGA 4CEOA 4OGEA 4RT3A 1ZBIA 5EWFA 4M41A 3SV4A 1S1TA 3MXJA 4LD0A 4UBBA 4W5RA 4M3ZA 9ICRA 1XU4A 3LPUA 1RILA 3EPIA 4UAYA 8ICGA 2WOMA 4BACA 2DY4A 1BQMA 3AU6A 3BDPA 3HPGA 3LP2A 4KFBA 4UAZA 2YNFA 2I9GA 3OSNA 5HRNA 5DDMA 2BGWA 4IQWA 1Z00A 2HHXA 5K14A 4Z4GA 4RU9A 2XY5A 4O3PA 5BPCA 3HXMA 1W9HA 1TGOA 3DLEA 3L2RA 2W9AA 5KT4A 4J2EA 5J2JA 2D0AA 4FJ8A 3QO9A 1S0VA 2XRIA 4F3TA 9ICCA 3LPTA 5J0RA 4ELVA 3DMJA 2Q3SA 5KFGA 4NM2A 4KN4A 2X6NA 1VSEA 4Y1CA 9ICEA 4I29A 3RB4A 4DTPA 4FJ9A 4I2DA 3B0XA 5KFCA 1O1WA 4JWNA 4W5OA 1T03A 3NBPA 1S10A 8ICCA 3UQ0A 1WN7A 1SKSA 9ICOA 4CHOA 3ZSZA 5HROA 4F4XA 1BI4B 3V72A 7ICMA 2H5XA 1WSFA 3B6PA 4J9PA 1ZQSA 4FLYA 1NK7A 2ZTDA 2PFQA 2V9WA 4ECSA 4FJGA 4CHQA 3DRSA 5J2CA 1RXVA 4FW2A 2X74A 1L3SA 4CGGA 2MUTA 5DG7A 4DU4A 1JLGA 1Z26A 4IKFA 3AUOA 4CJVA 5J2PA 4YMMA 2PXIA 4DF8A 4DTOA 5EWEA 4EBEA 2FLNA 2F96A 4CIEA 3ZT2A 3U3YA 3S9HA 3PUFA 5KT3A 9ICBA 1S76D 3QESA 4M9JA 4O3OA 2P6UA 3K57A 4NCGA 3AVJA 1RT5A 4YP3A 1VSIA 4MFBA 4FM1A 3M8PA 4CGIA 5KFUA 1B9DA 1QSSA 7ICHA 7ICSA 4P4MA 1WNSA 3NH2A 8ICNA 5KFFA 1IKWA 3NFAA 1C0UA 3K58A 1JLCA 4FVMA 3U3GA 3TAGA 1VSFA 4YD1A 9ICQA 4QZ8A 4P4OA 1FK9A 4DL7A 1VSLA 3SQ2A 3V6DA 3SZ2A 3FDSA 3G6XA 2PFNA 2X78A 1LWCA 3RJIA 2ALZA 1C1CA 4F5QA 5KFWA 1TFRA 5KFTA 2J6TA 3TR8A 4KAZA 3MGIA 3MBYA 4NLKA 5KG1A 1WAFA 3RB3A 4MEXA 3GIJA 1RCHA 1DTTA 4QWCA 2GUIA 1KVCA 4KHUA 3RR8A 4NLNA 1XSNA 1TK8A 2NRXA 4YD2A 4IRKA 1HRHA 1RZTA 3V4IA 1TAQA 4KLSA 2XCAA 1S1XA 3QEIA 4W5QA 4RW6A 3UQ2A 4KRFA 4PGQA 4QZ9A 3HSTB 1IO2A 5DG8A 2OPPA 4K4HA 4KITB 1ZBHA 4XUSA 3VQ8A 9ICXA 3TWHA 1LWEA 3AVNA 1LWFA 4R5PA 4K8XA 4B3OA 1YT3A 4IQVA 5C25A 8ICUA 3TANA 3GV7B 2BCVA 4CGDA 4OKEA 5J0QA 1TK0A 2JEJA 4DOBA 1XSPA 2PYLA 5D4BA 5KGWA 1RNHA 4EP4A 4QZHA 4M04A 4CJEA 1SKRA 4E7HA 1TV6A 3PW2A 2E6LA 4TUSA 4AHSA 4KB1A 4PHPA 5KTQA 4J9OA 2PYJA 4NCAA 4J9QA 3C2KA 3OGUA 1ITGA 3VQ7A 4UB2A 5KFSA 3DM2A 4DTXA 4J9SA 4BDZA 3RRHA 3GQCA 1QSYA 2XGQA 2B4JA 1DLOA 3MFIA 1ZQMA 4CJPA 4DL2A 4QZAA 4I9LA 1D5AA 2WTFA 2ISPA 3RBDA 4FJMA 4HYKA 4BWMA 4DFKA 4HUGA 3V9UA 5KFMA 3TQ1A 4CF1A 4F5OA 2M9NA 1N48A 1U04A 5KFEA 4CK1A 4Z0UA 4QZEA 2FLPA 9ICUA 3WNFA 5KFIA 3DRRA 5HRSA 7ICQA 3AO2A 4F91B 2JEGA 1NK0A 7ICGA 5HNKA 4I9QA 4F2RA 1J9AA 4OLAA 1SZPA 1BPEA 8ICHA 4DMNA 2RDJA 4CEEA 3OY9A 2E6MA 5HRPA 3V6JA 3VN5A 3HL8A 2IGIA 2ZJAA 4O0JA 1IKYA 4PHDA 3SQ4A 2YNGA 4I2JA 3Q8LA 4RNOA 4QW9A 1KVBA 9ICIA 4N76A 4PHEA 3V9XA 2Z1HA 3K5MA 3KK2A 3IG1A 4KHWA 5DB8A 1WLJA 3H8SA 2G8WA 1HUOA 1KFSA 3RMAA 4KV8A 3H8WA 3KHLA 4KTQA 3V9ZA 3V81A 5DQGA 4CEAA 4PWDA 3ZSQA 3KLIA 3AA4A 2XY7A 5IIIA 3M9NB 1U9LA 1TK5A 2OZSA 9ICSA 1C6VA 3KD5E 4QZBA 4ED2A 4Q8FA 1XO1A 5DGAA 1KEJA 5DQIA 5L1JA 1VSJA 1VSMA 3UXPA 2LYHA 1HQEA 1WSEA 4FJKA 7ICVA 1EXQA 3UXNA 2NRVA 4LZDA 4CJ4A 3ZT3A 1REVA 4KLDA 1KSPA 4KREA 1JN3A 4AILC 3C6TA 1KLNA 2DFLA 5IIMA 4AHUA 2PZSA 5DDYA 1ZQLA 3OJUA 2ATQA 4O9MA 3VQDA 4OKKA 4FXDA 4CF0A 4YR3A 1ZQFA 3MEEA 2AU0A 4LY7A 4AHVA 3DLBA 3BGRA 4CJWA 4O0IA 1RDBA 4DTNA 5DK5A 4RW4A 4QCLA 1RT2A 1ZQXA 4M3YA 1WCLA 3MAQA 3CM6A 3OS2A 2JEIA 2AJQA 4GW6A 3H7IA 3PW4A 1RBSA 2AQ0A 5C42A 1QHTA 3RJJA 1QQCA 5C5JA 2ITGA 3HK2A 5JUMA 4AH9A 4DQSA 1HYZA 3T5KA 3TARA 2HHVA 1UT8A 1RTJA 2FPMA 2HHSA 1SL1A 9ICMA 4ECTA 1HUZA 1TVRA 1NJYA 4YMNA 2JEFA 2BDPA 1JLAA 3V1RA 2PFPA 4ED7A 2NRWA 2ZQBA 4RPYA 3ZD9A 4UB3A 4EYIB 3RAXA 8ICKA 2R8HA 3N97B 1HMVA 4KKOA 2FMPA 3GIIA 5BOLA 4FLZA 3LP0A 1BHLA 5DKWA 3UXOA 4F3OA 4FZZA 3SPYA 4HCBA 4GC7A 4MFFA 4AHTA 3ZSOA 3K75D 5CYQA 3ZSVA 3Q8SB 3CM5A 2A1JB 3M8RA 3V7LA 3LANA 5J2KA 2HHQA 3RWUA 2C28A 1ZQOA 2IDOA 3F9KA 1NK5A 3FFIA 1XHZA 4RW7A 2VG5A 4I2FA 1J53A 3C21A 3HJFA 4M9NA 4M47A 3KHGA 3V1QA 2BPCA 3HP9A 1G15A 1UT5A 5DB7A 4ECYA 1RBTA 4M3TA 3H08A 3PV8A 4F8RA 5KFRA 3RH5A 3L2QA 4M3RA 4CF2A 1IG9A 3MDCA 3SJJA 8ICBA 3LAMA 1LW0A 5HLFA 3JYTA 2HHTA 5F9NA 4CJ5A 3LP1A 4QZGA 4P2HA 3CFPA 4F5NA 1WCNA 1HYSA 4TUPA 3G0ZA 4KLIA 5KG5A 4MEYA 4CFCA 4RW8A 1BPBA 1U45A 1TVAA 2IBKA 4QWDA 2FBVA 4R65A 2ZUDA 2R8GA 3GILA 3WNGA 1SL2A 3IS9A 1ASWA 1TL1A 2ASDA 4H4MA 5KFDA 3HT3A 1BCOA 1B92A 4Z4CA 3KLFA 4DS4A 3HYFA 1R0AA 4M3UA 4Z6FA 3K5OA 5D3GA 4JLHA 4I2EA 1XWLA 3ZDBA 5DBAA 3KK1A 3QEBZ 4KTWA 4CEDA 2ZTCA 3RB6A 4JWMA
chains in the Genus database with same CATH superfamily
3WKAA 3K0SA 3DV9A 3ISBA 3FCVA 3MECB 1RLDA 2CVEA 2QL5B 5AXKA 5EDWA 1K5OA 1JMTA 2MA1A 1RHRB 2P9EA 4JKDA 1TKTA 1HMVB 5ALUA 2OI2A 2DNNA 4NEZA 2RKIB 4C0ZA 2QWMA 3QJLA 1S0NA 3OYIA 1HNVA 1IXKA 1NEEA 2DFFA 4DS5A 4JNEA 3MM9B 1ECWA 2WTUA 4O3NA 3NAHA 2UZAA 3TI0A 3R97A 4BRNA 1JRPA 2EEYA 3MM7B 4QYZK 1Q9XA 3DLKA 3CCLS 3TJAA 4HT5A 1N63A 3C6AA 3ZO7A 4HDGA 5ALEA 2VWBA 5IIOA 2AIRB 3SJHA 3AA3A 4IXCA 2ASLA 1NGIA 4OJHA 2NREA 4UB1A 1VQ4N 4ECZA 4LFBJ 2HHHJ 3Q8KA 1OY6A 4M63C 4ECXA 2BJ9A 1D9FA 3TUZC 2JV3A 2J7WA 4ZJQA 1EETA 3G71N 4JV0A 3UN2A 3GFYA 1RDWX 4YDUC 3PX4A 3PJ9A 2R2UA 4NXNF 4LR7A 1Y5IB 3OTBA 5A0YA 2I5HA 3PRVA 2XWXA 3GYGA 3Q8MA 3JSYA 5A2QY 3CPWR 1RWVB 4X5VA 4P71A 1IR1A 4RW8B 3PCOB 5ALJA 4RW9A 2RDIA 4DV5J 1WACA 1AROP 3IS9B 3PYEA 1HPZA 1KHWA 2HNYA 3MDAA 2DRAA 5GAGP 2AYMA 3FE1A 1GO3F 1ZA2B 4PGXA 5DBBA 3BH6B 3PW0A 4CJ3A 2Y9HA 1P90A 4YNQA 3TW0A 5KFBA 3WQPA 2OPSB 3BGFA 5HVFA 5EHHA 1WUAA 4P0PA 1SZHA 4JV2A 3RBXA 3A1YG 1KDHA 1LK5A 3ZTPA 1YVUA 4TSXA 1OVYA 3ZDCA 4QOZB 4O5BA 4NOHA 1RDUA 2ZWPA 5IWAJ 3BR8A 3OL7A 2E66A 4KHMA 2QKBA 4LRFA 4IDKB 2CPXA 4EYHB 5F1XA 2GIRA 2VJUA 4QIWC 3FCHA 7ICIA 2A10A 7ICKA 4G1QA 4AYBC 1RABB 4O5CA 1PVQA 4KT0C 4UAVA 3IAM9 3DLKB 1RUSA 2MLXA 2HLTA 3V9WA 2EG2A 2KHOA 2O8DB 4DV6J 3H0RB 3PSIA 1ZPWX 1HD0A 1WD6A 4UZBA 1LV5A 2CG4A 8ICVA 2CWKA 2XWYA 5A8RA 4UY8T 4WK1A 4IOBA 3X1LB 1U0HA 4Q2MA 3K0JA 1Q7LB 4MT1A 4FN5A 3BSOA 3ZTOA 4FK0A 3EM1A 1EETB 1C0MA 3T19A 4AM7A 1IJEB 4ECUA 2UXBJ 1P1TA 2OXOA 4UAWA 3KTQA 1IBKJ 1NDCA 1QY7A 3C28A 2UUAJ 2KD1A 1A5XA 4YG2A 2IOHA 2YQ1A 4I64A 3OTCA 2KKHA 3KNAA 1G7CB 1PC5A 3HULA 5BOMA 3UMGA 2RJZA 2XHCA 4FKXA 1X5OA 3BYPA 4UQTA 1IWGA 3VVTA 2VG7A 2LYAA 5KG6A 2X1BA 1WC5A 3NLCA 5DDQC 2E1CA 5BR9A 1X31C 3O9UA 3EVMA 4CWBA 4XDDA 1KFDA 4MK8A 3IGNA 4CCHA 4KLQA 3CJQA 3IR5B 2BA9A 3OLAA 1C2PA 5TKYA 2B4UA 3FGVA 1AW0A 1V3SA 4P0PB 2G0IA 4KLHA 3CPEA 3D3BJ 1F3FA 2ASOA 4IO9L 3QAUA 1FIQA 2FXUA 4B1WB 4WK3A 1G4CA 1NKEA 3AVGA 3ISCA 4ZP8A 4ELTA 3ZZYA 2XMAA 4JD2A 3AD9C 5B7WA 4WJ3B 3OSPA 5FDLA 4B3SK 4LUBA 2KLAA 1XMQK 2DHXA 3EX7B 3UE5A 4M7YA 5FROA 3PX6A 1WKJA 3CDBA 2VJVA 3PZPA 1UMJA 2NXNA 3TTFA 1Q78A 1JALA 1TP7A 5E7OB 1FXDA 1VQ4S 2OA8A 4X4PA 3VQ9A 1BPXA 5D49A 5B0GA 2FLOA 3HX9A 5C7PA 3JSMA 3G71S 4JV5J 3KZBA 5EVZA 3T3FA 4O0NA 2ROEA 4ZLLA 5A8RB 4QZDA 1KBRA 1C1BB 3QYYA 2FF6A 1GMWD 2E2QA 2U1AA 4M42A 4F71A 1RB0A 1H74A 1ILYA 2YHXA 3ISZA 3DC2A 1B43A 3T5JA 4DDFA 1OQ3A 1P8ZA 4F92B 2H3VA 4WCEQ 1WOQA 2W42A 2FPLA 4Y2SA 2C2ZB 8ICJA 5J2QA 1LFPA 2PKEA 8RUCA 1QQNA 4OYZA 1SJ3P 4C80A 2CIMA 2XS7A 2VG7B 1RT7A 2YWFA 3D6RA 4RPZA 5J2FA 1F6TA 2L9NA 1GOBA 4KTZA 4M6WB 2PI4A 2UU9J 2B8QA 2UXCK 3T5HA 2A3ZA 4P73A 1WJ9A 1QS4A 1VOMA 3QNOA 3PFEA 2F8SA 2NXUA 2DNGA 4RUBA 4CLPA 3W9IA 2BKPA 4IFYA 2EX3A 1U49A 1S9FA 3ULHA 2CPIA 3IUCA 5DB6A 1QJHA 5L1MA 1NGDA 3Q8YA 2JFDA 4ZPWR 3NCRA 1XMOK 4IQXA 5FDLB 2HW3A 4JI4K 4NLXA 3VEXA 3BQ7A 1I6JA 2NXJA 3CEDA 4DV2F 3K1ZA 1O03A 3NOCA 1T8EA 3D2EA 2WONA 1VK8A 3CO0P 3A0HU 2Y1IA 4KHPF 1IQZA 2JH7A 4KAIA 1HNIB 4A8OA 4CECA 1BGXT 4L3KA 5I42A 5KFPA 5A76A 7ICLA 5EE3A 1VQ7S 2J0QD 1GX6A 1V4SA 3THPA 1DGKN 5BRHA 1NM2A 2YNIA 5AI4A 1FXXA 4MH8A 3JAMY 3DN9A 1JLEA 2XCPA 4OYWA 4DUTA 1DFDA 2ZM6K 2CQ3A 2P9NA 2IRYA 3NS1A 1RU1A 1ZQRA 1S5JA 4FS1A 8ICMA 5K8NA 4EGLA 3LH2S 4DB3A 1ZXOA 4GLXA 4ECRA 1L7NA 2RF2A 1X9MA 3MR2A 3MPWA 2XMVA 1WOOA 3PTWA 2VQEJ 4ED1A 4ELUA 2A3JA 3AOBA 2HYIB 2XMKA 4AHCA 2BW2A 3MMAB 5IM0A 2FC9A 1CBKA 4PWUA 3LOUA 5G0RA 3ZT1A 5B0EA 5K8OA 1Z6RA 2VBZA 5C2DA 3QT6A 5ETMA 2YH0A 2CQ2A 2J0XA 2ZOGA 1QZ6A 3FM9A 2OH2A 3HILA 1OH7A 5AQHA 1E6YA 4MJKA 4C3KA 2D0OA 2BCQA 1PJ7A 2HRTA 3C6UB 1ZXIA 1UWBA 2HGMA 4DR6K 3CHWA 4DR1J 1Z3EB 2FJAB 3OVBA 1HKCA 4GVMA 4FNIA 3OFGA 5M2PA 3JAMO 4DOCA 2XZTB 4JOUA 1IBLJ 4CIFA 4X4NA 3LQVA 4I69A 1U1PA 5GAEI 1SAZA 2XSJA 5CA5A 4QW8A 3AARA 1ZZNA 1FERA 3THXB 4GC6A 5ADXA 3FZKA 5LMNF 4O5EA 1IR0A 3MGJA 3D2EB 3NTUA 3AAPA 1X9WA 1X4GA 3RH4A 1X42A 4CFAA 1QM9A 2BUNA 1P7DA 7ICNA 1QVFR 2N7CA 4QWBA 1OY8A 2OSQA 4JI5K 1X7VA 3ISND 4WQ4C 2KL8A 2HF3A 1YI2N 1SZ2A 3PSTA 1UTAA 3ZT4A 2FJVA 4LZGA 1URRA 2EZZA 3OHBA 3V6KA 1FE0A 3CMAN 3R2DJ 3QZ8A 4CDIA 2CH5A 1ZRMA 3HPOA 2MQNA 2HURA 2EW9A 4GV3A 3KVGA 4JI6K 5KG2A 4B8AB 1HWKA 3QICA 2W3RA 4LF2A 4QR0A 4LFCK 3OHAA 1J97A 4DCOB 1N5TA 2AQ4A 3R5AA 5F8GA 4LSNA 3K2PA 4C6AA 4X4OA 4PUOA 3AL0B 4K5SA 3MR7A 3JTPA 2D41A 2C2EA 1C7YA 1GMUA 2JHEA 5E3AA 4KGKA 4KPCA 5LMUF 1FI4A 2VOOA 2WBRA 1FEZA 2G0CA 3RR7A 1ASUA 2OHDA 3HD2A 4EBDA 4A8WA 4URGA 5CZ1A 2ZH7A 2EC0A 4ANDA 3IRUA 3LZJA 3C19A 4DR7K 2E1MC 2R7VA 3J7ZT 2W7PA 2Z8QA 3KFWX 4BC9A 2ADBA 3TAEA 1N5WA 4CH1A 2JZBA 1ZQHA 3CWJA 4C3MA 4YXMA 5CP2A 1E6YB 3HI0A 1UA1A 4IR9A 1UWBB 1HKGA 2Z2ZA 2F1HA 4QIGA 2PFDA 4JRPA 3LWMA 2H65B 2YJEA 3VAHA 3L2UA 2DPNA 2P8IA 2OPQA 1BNOA 3G10A 3CD7A 1M6YA 2A6MA 1B0VA 2WHEA 1JKHA 1QUVA 1DGSA 1YSJA 2KDOA 2KRBA 3JXUA 1H6KX 2XLKA 3W3DA 2FVQA 2AYEA 5AK6A 4E8UA 1SJRA 1KLMB 1GQEA 1HWIA 2OTJN 1WG8A 2CXEA 3O4NA 2D0BA 2W01A 3GYXB 1IVZA 3C65A 1KD1O 2G2OA 2WFAA 3VA0A 2R4FA 1RHMB 5KT2A 4C7QA 3PXGa 3H8YA 4PY5A 5AQRA 2WF9A 4JI3J 1KBUA 4R63A 3MPVA 5AFUA 1NHKL 1EQYA 4NLUA 1ZETA 1NI3A 3CUNA 4K8ZA 3J81Y 3PKMA 3CDUA 4FYYB 1T0TV 4S0MA 4KI6A 3PG9A 2CRLA 9ICKA 5GADU 1CC8A 4LSNB 2IC3B 5LY3A 1N0VC 2AP6A 4J91A 1X3MA 4DV1K 1NGBA 1SUQA 3TUIC 3T1HF 4FJHA 3ISNC 3H5YA 1DHMA 1JL1A 4MF8A 3MGVA 2D8CA 1L8LA 1YTUA 3R5JB 1S9GA 1VBYA 4Q0BA 5DB9A 4UUWA 4QZCA 1XUPO 3BF3A 3BB5A 1OO0B 2HBLA 2CGJA 4MLHA 3QUQA 4OYMA 2XEXA 2L5YA 4KGVB 5F8HA 1YJWS 2B0CA 3NKYA 3HD1A 1GEHA 1C0TA 2DHSA 4I6WA 3LP3A 2R2RA 5F8JA 3B6BA 1F9HA 4I4BA 2OD6A 2ZGZA 3AV9A 3SR6A 2OPQB 1HNZJ 5ALRA 2JRSA 3UCUP 3D4JA 3S01A 1JKHB 3JQMA 5C2CA 1R8BA 1VJQA 4NYPA 1Z00B 2A1SA 3PSPA 3KKRA 1JLBA 2BCSA 3H25A 1YI2S 4P72A 2E8PA 4CLWA 4IC9A 2MKIA 1N0UA 3D2WA 3JPQA 3EGVA 2DGUA 3CMAS 2YPYA 1HIYA 4CTAA 3O3GA 2GMLA 5ALSA 3ZSWA 4CT8A 4B3SF 3VVUA 4DHVA 1XMQF 1QDUB 1B7YB 1KONA 1ZQUA 3NBPB 1KC8T 1RTIA 9RUBA 4KLLA 2W55A 1T9WA 4HDHA 3ENOA 2WF5A 2FJBB 3R5CA 5HROB 4DV4J 3H1VX 1MWZA 4Y2AA 5DO2A 3WNHA 2JC1A 2K06A 2CJKA 4CZEA 4F5PA 1S6PA 4WFZA 2DT9A 3K5LA 4BDYA 3CCQN 3AA5X 3RTVA 4AF1A 4ZJLA 1ZJNA 1UFKA 2CPHA 3BO3A 2V7ZA 3KZXA 1T4GA 3FSXA 4F5RA 2HMXA 2DF4B 3QYPA 1S9GB 4Q0BB 4QS9A 3P3DA 3UB5A 1QAYA 1I5OB 7ICUA 2IA6A 4L74A 2XYHB 1HBOA 1SXLA 2ZIUA 2IVPA 1L7OA 1QTMA 2Y9TA 4NI2A 2OANA 4FW1A 3ETMA 1VRTA 4WTOB 3TFRA 2DL0A 5C24A 2X6SA 2HAIA 4NL5A 1Q86O 5GAGU 3TJ9A 3ONNA 2HBYB 3WZ0A 2G06A 5M1KA 3ISDA 1FA0A 1I51B 2H48B 3QGIA 3T6JA 2UXCF 4BS2A 4NMXA 3H6EA 3SMVA 4NLGA 1YG0A 2OTJS 1HNWJ 4G9ZA 1JLBB 2DITA 3I1YA 3WBZA 5AK3A 2FQQB 5J0WA 2QWRA 1R59O 3U26A 3MR3A 3HO1A 3HDSA 2BR0A 3V6DB 1CUKA 1FDNA 1YXQA 3CJ1A 3CE8A 5AM4A 3W5ZA 1D8BA 1X9XA 1TMMA 1XMOF 4GV6A 4CJKA 3HJEA 4JI4F 3SAHA 4IRCA 1J5OA 1FRIA 2ZUAA 1YJVA 2W24A 2P9CA 2F3NA 4CESA 2DCUB 1AQ6A 3MCAB 2POKA 2NRZA 4DV0K 3U27A 4B17A 4FFDA 4TURA 3NF7A 2WF7A 1DBDA 4DCCA 2H3ZA 2JGUA 1S6UA 1SIZA 2J9DE 2H5EA 4Y3CA 4URQU 1VQ6N 3ETLA 4QR2A 4WFYA 1E4GT 4OJ5A 2WSFC 3FZ2A 4PH5A 1MW7A 4DO9A 4A46A 3F44A 3F41A 1JIHA 1S8OA 2MTLA 3QRPA 2ZKUA 2BJ8A 3W8GA 4CBUA 2BYCA 2E8MA 1Z2LA 3H3NO 3W62A 1B22A 4ZVRB 1GTHA 3T5LA 1KP6A 3RJKA 1HBOB 2ZIUB 5A8KB 1BD6A 3ICLA 4WFXA 1T6DA 5ALWA 1YAGA 4LT6A 3UM9A 1VRTB 1DARA 2CPJA 4CJUA 1L5UA 4RLEA 4BC2A 1FDDA 4O44A 5B0DA 2QB0A 2QK9A 3LM9A 1NJIO 4ID1A 5FPMA 1F0XA 2ADCA 4HTLA 2OWOA 3C7NB 4NYFA 2VIHA 2G5IB 3TTDA 1NZ8A 5AM3A 4JV1A 2MQPA 1NKCA 4YFUA 1NOMA 2BACA 4KGMA 2QWQA 4HVJA 3GIMA 4Y1DA 2HNZA 2VA3A 8ICEA 3TEGA 4DR6F 3DRRB 4WYWA 2EAPA 1NGGA 2VHGA 4Y2KA 4B1VA 1NRKA 4NLYA 2DNLA 2PEBA 1CQMA 4UATA 4Y2YA 5HMLA 3VEOA 5FLXY 4FLWA 2EFPA 2LEBA 2CYYA 1IKYB 4U7CA 2YNGB 3BSNA 4W5TA 1OSDA 1HI0P 4BVOA 2DWQA 5ETOA 3O9RA 1Q3UA 4DR2K 1Q8BA 4JI5F 4JYAJ 3D2QA 2E5GA 2UVRA 1YJUA 4KV8B 3AHPA 2ES6A 1SV5A 3FSIA 4WKRA 3JQJA 2NPIA 1SKWA 2CADA 5FD1A 1VBZA 1X4HA 2DY9A 2WK4A 3DXBA 4JI6F 2CJQA 1HUXA 5AI6A 4DV5K 2YY3A 1ED1A 4O3SA 4X4RA 1GLEG 4RQ2A 1UEKA 4LFCF 3QDKA 1K8KB 5BYSA 3CCMN 1X6JA 1Z19A 1LQ9A 2QLJB 3PMNA 1REVB 3C1YA 4O44B 2GAGC 2QB0B 3MFHA 5J0OA 3H0LB 3WT0A 3BQ1A 1LW2A 1NPPA 2MB0B 4C8OA 3NDKA 3VCBA 5FLXO 1H98A 4OPKA 1OUQA 2WF6A 4LREA 4DR7F 4I27A 1K9MT 2HHUA 3GR0A 5E3QA 3FRZA 1RTDA 5FJ4A 3ZX2A 2VD3A 1V9OA 3WK5A 5IWAK 2BOPA 4YR0A 1UQVA 4BE1A 2XMTA 4CRJA 1ZQKA 1CI4A 2GHWA 3D3CJ 3THVA 1AUDA 4FJ7A 1UAWA 3H5SA 1BI4A 3I28A 3FZHA 1Q81T 1CXQA 4FBUA 4HCCA 4NX9A 2KH9A 2UUCJ 3NL0A 5L1LA 2DGSA 1ZAXA 3ZFVA 5J0SA 3M7VA 3POTA 3NCQA 3C23A 2IOCA 3JQKA 1ZQGA 3AA9A 2H3GX 4F02A 1SIJA 3RMCA 4I2GA 3U1MA 1VQ6S 4DV6K 1S7HA 1QSLA 3HKZD 2KQ2A 2O66A 3MABA 2MKKA 4HI2A 3TA2A 4QJFB 2HMPA 1SL0A 2Z57B 4ED3A 2K1RA 2UUBK 4H8KA 2J0WA 2EXUA 5GMEA 2UXBK 2V69A 1DAXA 1EKRA 3NG8A 1S1TA 1MWMA 1LCUA 4W5RA 4P0QA 3DFEA 2UUAK 4DN9A 4UAYA 3O6WA 8ICGA 1CJKA 1SGGA 1BQMA 3AU6A 2KP7A 2ZDPA 2CXYA 5D4LA 1N4LA 4J03A 2YNFA 2XS5A 2I9GA 5CYQB 1MA7A 1A0OB 3DKDA 4OYBA 3LGNA 3E8OA 2BGWA 5K14A 4O3PA 4PWWA 2QSFA 4DV1F 3MWTA 3DLEA 2RP5A 2W9AA 3DU5A 3QRQA 1B0XA 3WK4A 5J2JA 2CQDA 1KQKA 1PCAA 2HFUA 3EVOA 3CJ0A 1TUGB 3S7RA 5KFGA 4KN4A 2PD1A 3FSYA 2K4PA 4CI6A 4DTPA 5B09A 4I2DA 3B0XA 1RTDB 4W5OA 8ICCA 4YOYA 4OX9F 5HLFB 1WN7A 2A5XA 1RWPB 1SKSA 1R0BG 5ALFA 4CHOA 4HH0A 1BI4B 3GG0A 3AMZA 5H9EK 1WSFA 4J9PA 1ZD4A 4FLYA 5BPNA 2CGLA 1NK7A 5DM6L 2KKVA 1RISA 2XMMA 4CHQA 2FZCB 4H4MB 2WBNA 3LGMA 1LK7A 3S8SA 1TL5A 3TZYA 5KQDA 2HG4A 2MUTA 4DR3K 2IRXA 5DG7A 1WG1A 2RU9A 1JLGA 3L7OA 3A13A 3N01A 2GX9A 2DVIA 4KBOA 3MTKA 4YB6A 4EBEA 1X66A 3CJ8A 4DQ8A 1F2GA 1UVJA 2ZWHA 4LF5J 3U3YA 3PUFA 5KT3A 9ICBA 2QX0A 1S76D 1LFWA 1S1TB 4M9JA 1U1LA 4WJBA 2QWPA 1UHUA 4NCGA 2IDEA 3I6PA 1RP5A 2N4DA 4JK9A 1QZ5A 1RQLA 3CJAA 4MFBA 2AV5A 3CCMS 4LMZA 2MDAA 1CJKB 1NPKA 4FM1A 2NSBA 3ZLJA 1QSSA 1J5EJ 2QC3A 4USHA 3KLGB 3HKZC 3US5A 5IC6B 1HR0J 3Q24A 2V52B 2QEXN 3NFAA 5K14B 5ALMA 5AQSA 2R7XA 2ZIXB 3RUBL 2O8FB 2EKNA 3TJ8A 4C0BA 1FDAA 4EO6A 5GAHU 3DLEB 4NA1A 3K8WA 5CAAA 1FK9A 4JP8A 3SQ2A 3GJSB 1EARA 1IIPA 4WU3A 3LDPA 1FRXA 3TR8A 3MGIA 1XIQA 4NLKA 1JWWA 4Y2PA 4KRWA 2ZZMA 1WAFA 3MC1A 4CD3A 4QWCA 3FRYA 3J7A1 2CNNB 4BRDA 2DNZA 3BM7A 4OZ3A 4NLNA 1TK8A 2NRXA 1HW9A 1MWQA 2MY7A 8ATCB 3O3LA 1PG5B 4FZVA 1NSAA 3BO2A 4QIWF 4PGQA 4QZ9A 2EFQA 4B3RK 4BRIA 2Q2RA 2CDQA 1MMDA 4AYBF 9ICXA 3H5UA 5HVHA 2KJ9A 3TYTA 1LWFA 4R5PA 5C10A 2WBMA 2HGNA 1ZZFA 4USWA 1NM1A 1JLGB 1BWEA 8ICUA 3OQ2A 5EN1A 3ATVA 2JEJA 3DRYA 5KGWA 1RTHB 4ITSA 1S1VB 2N3OA 4C7ZA 2BZFA 1SKRA 1JNRB 5BRFA 5L38A 4YN3B 2P9UA 4CZCA 3PW2A 1GXTA 1H0HB 4WP9A 4L76A 3PEHA 4PHPA 4NCGB 2NXCA 3C2KA 3UO0A 4MFBB 3OGUA 3B9JA 3HHLB 5E3CA 4UB2A 2F4VJ 5KFSA 4DV0F 4MDAA 4BDZA 1ZQ1C 3GQCA 3C16A 5MAOA 4DL2A 2P6TA 1H1VA 1PAEX 2V8HA 4I9LA 3LYSA 3O8MA 2I1RA 2WTFA 3PHTA 4LQ9A 1Z1BA 3UCGA 2ZH8A 3V9UA 4DV3K 3P5BP 4CZHA 3GCWP 2KV2A 1B0TA 4CK1A 3MEKA 3WNFA 5KFIA 3QNMA 4Y65A 7ICQA 4ZA1A 1FJ7A 5MLCV 1C0FA 2JGAA 3O80A 4JMUA 4EFHA 4U8YA 1SZPA 2ZJQL 1DKGD 2PO4A 2E6MA 3M2VB 3V6JA 2BJ7A 3VN5A 3IP0A 3P49B 1TR0A 1OW5A 3ONQA 3NMRA 1IBLK 2CQGA 1M1KO 2R7OA 3DWLA 1BMQB 2FJ6A 2BOAA 4K41A 3SQ4A 1TKZB 4I2JA 9ICIA 4N76A 2Y1RI 4DX7A 1NDLA 3KK2A 2B3TB 1FD8A 3EDQB 3OA9A 1S57A 5DB8A 1FCAA 3MD1A 5HAOA 5K5MA 1BO5O 4BR7A 3V9ZA 4R5PB 3GFZA 4CEAA 4CD1A 4PWDA 5AKXA 2J5AA 2V5HG 2RUSA 4FL9A 1U9LA 2AJ1A 1HBNA 5ADZA 1Y5LB 2AD9A 2W4PA 2WVCA 1XO1A 2O67A 4G1IA 5J1PA 3QT5A 3UXPA 2W7OA 4FJKA 2P9UB 3NGRA 1ZTTA 1HI8A 3LF0A 2W6KA 4KGXB 4ISGA 3W2WA 3BS5A 4B1YB 5DETA 4NO7A 2QEXS 4KREA 3O1WA 5HMYA 1JN3A 2YKOA 3C6TA 1HBMA 4LFBF 2HHHF 3I5BA 4N7TA 1N34K 2EBGA 2EK1A 5AQPA 3SBTA 3TX0A 3QPIA 4O9MA 3VQDA 1G3OA 4OKKA 3M2UA 1ATNA 2VOPA 2LXUA 4YR3A 1ZQFA 1W2IA 3K5PA 3MEEA 4LY7A 3THTA 4DTNA 3VC8A 2MHEA 2ASPA 2DBBA 3JSBA 5HBMB 4H5RA 1YLXA 3ITHB 1RHKB 4DV5F 1IKVB 1RBSA 2M8HA 4QU6A 1RFQA 1XNSA 1PBAA 3M1YA 2V67A 3IMQJ 3W5YA 4DQSA 3T5KA 3TARA 1M5OC 1UT8A 3T1YK 3AY9A 1TAMA 5C15A 2VUGA 4UB8U 5J2NB 4DX8H 9ICMA 3CRXA 3E9PA 3HRDD 4JKGA 3MHYA 1JCGA 4P10A 4USTA 2NRWA 1KDNA 4RPYA 1A6SA 1FVSA 3ENAA 4A8YA 1KQSM 5AM2A 2QFIA 2CWXA 1N5VA 3WXMB 1VFJA 4U6PA 1NG9A 5DZ6A 4PWDB 8ICKA 3R1LA 4KKOA 2FMPA 1RDRA 4P7VA 3FCWA 2IA0A 1RAEB 5DKWA 4P74A 5IWAF 1EQ0A 3UXOA 4JK8A 3SPYA 3F5AA 2DXEA 4MFFA 2F40A 3K75D 4CYUA 3M05A 1YVNA 3Q8SB 1QTNB 3ZSVA 2A1JB 3V7LA 1UPPA 3CMQA 4B9QA 5ETLA 4IOAQ 3BS5B 3CJSA 3FFIA 3QWPA 1XHZA 4RW7A 2D6FC 3M30B 4BRQA 1T9TA 3QU5A 3NRBA 4DV6F 2K2PA 5AZJA 3QWUA 2HFNA 4BRHA 4M9NA 4M47A 3BO4A 2QB1A 1VQNN 4OHYA 3V1QA 2BPCA 3C2PA 4ECYA 1TU0B 3OPXA 3D68A 3M2UB 5KFRA 2UXBF 4CF2A 3SJJA 4M63A 4H0VB 3LAMA 3CQYA 3JYTA 5CEHA 4ZVHA 3RW7A 4DFDA 1WCNA 1IBKF 1HYSA 2RE1A 2M5YA 4YDUA 4KLIA 2UUAF 2QG9B 1S9EB 2Y0SF 2IBKA 2ZUDA 1FX2A 2W43A 4BRCA 1U02A 3CJKB 4JEPA 1TL1A 2ASDA 3G4SN 5KFDA 1BCOA 4BRGA 1B92A 1F0MA 1K8AT 4JI7J 3KG1A 1GLBG 1FE4A 5D3GA 4JLHA 4F0HA 4DCJB 4ZIVA 3ID8A 3L0QA 3VPZA 2V8PA 2JWLA 3RB6A 4JWMA 1T02A 4MF2A 4OQJA 3HVAA 2FGOA 3NUQA 4BUGA 4URSA 3PIPQ 2IFXA 3C15B 4E2FB 4KKOB 5J0UA 2D4WA 4LH5A 2DH7A 3O4WA 3PR5B 2P9LA 2XZDB 4CT9A 1QAIA 4LF7J 4PHTX 5KFVA 4FJNA 2R9LA 3B4MA 3OS1A 5ALKA 5DZ7A 2A1RA 3VEWA 3GYNA 3D2NA 3DYAB 3VESA 4KN7A 1J54A 1ZQTA 1BDGA 4ZTJA 1N52B 3NGIA 3FFIB 4ZN3A 4RT2A 4RW7B 1OPZA 4PYAA 3C2MA 1YVFA 2CQPA 3JTNA 4JV5F 4CBWA 3KMQA 2IRUA 2KIVA 5GMDA 3TAPA 3O9SA 2BX6A 3KJFB 5IS2A 2GGPA 4JBCA 4W4MA 2V2VA 2EFVA 1S97A 2VU5A 1PIEA 4DG1A 3RSEA 4X62J 3IM8A 2WFBA 2CDRB 4BCAA 3R5DA 4Q8EA 4OO1J 2W1BA 4CJSA 4DU3A 1KVJA 3R3TA 3SUNA 1DK3A 3V6HA 3DLHA 4K25A 1RG6A 4BY9C 2HQDA 3NF9A 4E1NA 3MCPA 4M8LA 4M5KA 4F9OA 2PY5A 2BVZA 3CCRN 4RQ1A 3OVSA 4IFEA 2VDIA 4FYVB 4RQ4A 3I31A 4LSLA 4QPTA 2GUPA 5BYQA 1TL1B 4EK2A 2XULA 2VH7A 3VTHA 1TL4A 2UU9F 5I3PA 2K4EA 2P66A 5HR6A 3AQFA 5IC4B 1NZPA 2PC6A 2G2ZA 1S77D 3WNEA 3BP8A 3FK4A 3L4BC 4NA2A 3KDOA 2BRLA 3HPHA 2YV0X 1HNWK 2Z2MA 1URNA 4HI1A 4RL1A 1X5TA 3ZETB 3PMLA 1R8AA 1RDDA 3NXZA 3SV3A 2F8LA 4YVZA 5CB1A 2HGLA 3R8YA 3N5FA 3V5RA 3TABA 5H2FU 2ZJRQ 3TAQA 1CJTB 2IJFA 2P9LB 4C0HA 3AO4A 4F4AA 4XAKA 4CNQA 4ACOA 4RJVA 1V5IB 2YMPA 2DFHA 3WK6A 1NGFA 2VODA 1COKA 4BE2A 4BE0A 3QEAZ 2FHMA 4M7XA 2W40A 4F4ZA 1KTQA 2BE9B 3HFVA 4NCBA 1R6VA 3VOVA 4UB5A 4FPRA 1VQNS 1X0PA 3WEEA 4B9LA 1U8SA 1HEKA 3VAFA 3BBBA 2VV5A 1UA0A 5HHIA 4R64A 4FCYA 4FLXA 3PYGA 3UVJB 4LR8A 4HVZA 1EKEA 3SNNA 3PW7A 2KFNA 5CZ2A 2E7VA 3KK3A 4ECWA 3A5OC 2YX1A 3TTCA 4UQGA 3DRPA 3KIOA 1JI7A 1CC7A 1L3KA 2VFTA 1PAUB 2CZ4A 2YPZA 5G5HA 1BPDA 4Y2TA 2R42A 3VAKA 1VRQC 4M45A 2CNOB 2EZYA 3MM6A 1KKHA 3KUGA 4IOCL 1WHYA 1LVHA 3G4SS 3ZT0A 4LBPA 4F7VA 3HI9A 3GE1A 1I3OB 2VQEF 4LSLB 4PQUA 4GKJK 2QA4G 2D3ZA 4PXEA 1VI7A 1FFSB 2H3IA 4OHVA 3P83D 3IM9A 2FMSA 2C1EB 1X9SA 1NZAA 4X64K 2K8BB 3QBWA 3CP8A 4RQ7A 1TYQB 4I7FA 3B8AX 5JS2A 4FZYA 1WYGA 2VC0A 1ELOA 4KLUA 3AEVA 3A8JA 4BC3A 4BWJA 4BQLA 1U24A 2R7UA 2RRNA 3NRWA 3WXKA 4DR1F 2V4RA 2DY1A 3KLHA 5F8LA 1V3ZA 8ICYA 3DOMA 1EWQA 1EB0A 4OHZA 1RE1B 4LRAA 3G6EN 3M6ZA 4CEZA 1IBLF 1MROB 4CVNE 2HI0A 2OPRA 2RMLA 4HUEA 7ICJA 4NYOA 2MQ8A 3FZLA 1DGJA 1QH9A 2I38A 2MLYA 4X4SA 2CVIA 2LP4A 3BJYA 4EEKA 3WEEB 5KAFU 1ZH5A 4BC7A 1VC6A 2O1PA 1B99A 4GO7X 3OUYB 5GADI 2IAJB 3L7PA 2P5OA 3I0RA 4DF4A 5CYMA 3NE6A 2PFOA 4P2XA 3KK3B 4B3TK 4Z4FA 3BREA 4KY3A 2GS8A 4FJIA 1VJ5A 1QAXA 3DRPB 3P6YC 1Y5NB 4OJ3A 4YCXA 1SBRA 4JN4A 4XEIA 3FQKA 1UJ6A 2N82B 2Z2YB 4OI3A 9ICJA 3CCRS 5J29A 3ETOA 3S6EA 1TKXA 3KD3A 2B7BB 3MM6B 2NRRA 3NGUA 4B8CA 4QWAA 4HTIA 3VZIA 2QA1A 2E2OA 2IS3A 4DL6A 4NXMJ 2F63A 1BXNA 2DB1A 3QLHA 4PQUB 3NGDA 3VGSA 4CH0S 3LUYA 2D0CA 2GAHC 5B0CA 3FVYA 3V1OA 4ANCA 2X7IA 4BGAA 4MFCA 1TE2A 1KAYA 1S0MA 1ZQNA 5IIJA 4LC9B 3VENA 5KT6A 4MKAA 2YWGA 3BUZB 3CD5A 4B9TA 3VEZA 4I7FB 3O0FA 4NLOA 3TRGA 3UKRB 2VG6B 3SCXA 2KTQA 5AKIA 5ETTA 2KJ5A 4QIVA 1Z2ZA 2WCXA 2BW7A 5HQ8A 1N32J 3H90A 5CA7A 2PDAA 5CY4A 2HSZA 3V4MA 2Y8WA 5D8HB 4EX6A 4KLMA 3CIMA 4HWIA 2YWWA 5LJVA 3EGNA 3M2RA 3G8TA 3CMES 2OPRB 5JS1A 1N56A 1BQXA 5H9FK 2G09A 2Q4TA 1RT3B 2E2NA 2MJNA 4ZVUB 4UY8O 4KLGA 1ZQWA 4M5LA 2XICA 3SD7A 5IT0A 4GY2B 1WC6A 1HYVA 1H2TZ 3CERA 4U7BA 3ZSRA 3VQBA 2VBWA 3BEXA 1EX8A 4DBQA 1FFUA 2ROGA 2W9MA 5CYMB 3VQEA 4LF8J 3L2WA 4I2CA 4PYDA 2D3DA 1WSGA 3RFAA 2QGFB 4JI3F 1U48A 2I7NA 2FDNA 2W54A 5JVHL 3OPKA 1KVAA 1R8PA 3QIPA 4Q45A 1A0PA 1U6ZA 5KRSA 2BQ3A 4DTMA 1JNZB 5KFXA 2DPJA 4X4UA 3O3HA 4QAGA 1RT4A 3L5KA 3BSCA 2ZTEA 3J81j 4DQQA 3OW2R 1MSWD 3W65A 4M9HA 1CQNA 2P6SA 5GAGI 1HD1A 3QETA 2NYIA 3A4TA 3ZZ0A 2Z58B 3CPWM 1N54B 8ICLA 1IG6A 4C97A 2W2PP 2CPYA 2PBDA 1JLQB 4FYDA 4OV6A 2BGGA 1M5KC 2D3O1 4AUKA 1FHTA 3KJQB 3W9HA 2R7WA 3DCAA 2Q79A 3G6ES 4QIFA 4CIGA 2ERRA 2ZD1A 5BREA 2P1JA 1JCFA 1N88A 3CC7N 2G0JA 2DNHA 1YBTA 2YBVA 1Q8IA 3M2RB 3Q7BA 4MQ3A 1HNZF 2WMMA 2P5GA 3QUBA 4Q2LA 1DQ8A 5LM7E 1I94J 2FDRA 1Q0NA 4P6QA 2H1YA 2A6AA 2ZIWA 4ETZA 4C9DA 3ZTSA 2YNHA 4CJ7A 2KICA 1QCKA 3SDEA 4H0XB 4Z6EA 4OJPA 4HHHA 4CEFA 1Q82T 5CD4A 3CQ8A 4LF5K 2ODGA 3UD4P 2L08A 1S0OA 3A5MC 2Q1LA 4I2HA 2LSNA 1HHTP 2FBTA 4PZNA 3LDQA 5CR0A 3PLAA 4NY8A 3CJRA 2NZ4A 4PG4A 3RRGA 3AJ2A 1J5EK 4LVNP 4GMKA 4KSEB 1SV4A 1TV9A 2BBEA 4DV4F 2XG8A 1BQNB 1E6VB 3N9UC 3SSQA 1HJOA 1VAZA 2OAUA 3GLJA 3AM9A 5DLFA 1S1UA 1YDLA 2APOA 5KFLA 2F8HA 3CIZA 1R43A 1FEHA 2QW9A 1ZM3A 3GU3A 1Q5VA 4AM6A 1X60A 2WVDA 4M5DA 1MWYA 4CJQA 4FM2A 2GJFA 3AJ1A 5BN9A 5HQLA 4NB4A 1WF1A 1NOZA 4OLOA 1NLVA 2ZD1B 8ICQA 1ZTWA 2YKNA 3EPGA 3U6FA 1XHXA 4RUAA 3SXLA 1X5SA 3N4PA 2FY1A 4I67A 5CE3A 4G1PA 3MMVA 1NGEA 3OYMA 2CH6A 1NDPA 4IOAL 4UOCA 4DXLA 2HOQA 1UKUA 2K8AA 4IJNA 2J6UA 4R66A 1BPZA 1HNWF 2ZIWB 4RKUC 3WKCA 3HHKA 1Y88A 2YNHB 3F2BA 4GFJA 1VQ5N 1IG8A 2GJIA 4B3MJ 5IILA 2LQ8A 3SDEB 4OZLA 1FTCA 4LIRA 3Q23A 4DOZA 3VF0B 1S22A 4WP3A 3IN5A 4YB7A 3TADA 2QXLA 1WSIA 5AQQA 4TNOA 4KB0A 4DTSA 3HSDA 4AQYJ 2D1KA 4AP9A 3AD8C 2MGZB 2WUSA 3VERA 3S3NA 1IQTA 2G9OA 3C29A 1UFLA 3QAEA 2EANA 4IBNA 5AJ3J 4U7UD 2ZIVB 3EJMA 3E51A 4DUYK 1KNZA 2VANA 4X4VA 4LF9J 2NLWA 2KVIA 2R7TA 2O8CB 1RTZA 3BY5A 2DIUA 5HP1A 4HKQA 4YMOA 3U8XA 2VBXA 5IXUA 2Z56B 5E84A 2P9KA 3QFHA 4HT7A 2F9WA 4NA3A 2NCKL 2E1RA 4P7TA 4M5DB 4L8RB 5ALLA 3CC7S 5ADXH 2L3MA 4NXNK 4M5GA 1FRHA 3H2VE 2OYQA 4GVLA 3SUQA 2BANA 1SXEA 5CHCB 1K6YA 2KN7A 2I6XA 2KJVA 3FC9A 3CF5L 4IH6A 2YX8A 2EQYA 4K0KJ 1GLJO 2Y1JA 3TSPA 3QNNA 3P4UB 3UDLA 2H54B 3D7EO 3I9V9 1NMNA 3J7YI 5AIBA 2CJXB 2HVHA 3TSUA 2YMLA 3MXIA 4B9VA 1R7IA 2GEMA 1EHWA 1ZBLA 2VPXB 3MX2A 4X64F 5KFNA 3H59A 3BYRA 5AQNA 2XLIA 5J0PA 4PXBA 3ZZUA 2FPKA 2ZH5A 3CCSN 1CPZA 4MDBA 3I5AA 2K89A 5TKWA 4WKYA 1JLFA 3THYB 2H4YB 4OI0A 3VZHA 4HR2A 4YN4A 3HOTA 3RAQA 1ZD5A 4B9UA 3RMDA 3BQTA 4XTTA 3THWA 2XSFA 2LKYA 3WXJA 4L3QA 3GV5B 4IFVA 4FS2A 4EZ9A 4BBYA 1ZJMA 1EAYC 4F3QA 2VBYA 1BWFO 1RWMB 4IEIA 2Y0BB 2YTUA 3LALA 4PZVA 2KG0A 2MKHA 3IDHA 3HKZF 1WSHA 3UD3P 1U47A 1YRUA 1VLOA 4V19J 4JYAF 2LYVA 2F2AB 1T9UA 2F65A 3J7ZO 3HMJG 5ETVA 5JVGL 2GBZA 4IR1A 5HP1B 3LVVA 1AFIA 1Y97A 3OR2B 3HVRA 2RU3A 2P9KB 4CO5A 1U2CA 1WEXA 1T7PA 3SFUA 1SJQA 2BQRA 5EY4A 5B08A 3F2KA 9ICNA 3VTIA 1L3TA 3D9BA 2L41A 1I1GA 2E20A 4FJ5A 3SMPA 2J8AA 4Q5VA 2HOFA 1CXUA 1VC0A 4XRHA 4UB4A 4FOIA 2EAOA 1HX1A 4KMUA 1SI9A 3MCOA 3CFOA 1WG4A 4WFAQ 3A0IX 2F77X 5E33A 2FHKA 4TY9A 5DG9A 2GVDA 4IQUA 5DGBA 3NY0A 4K4YA 1HNXJ 4B1UB 1FFGB 1IKWB 1UAXA 2YKAA 1VQ5S 2HOIA 3IAS9 5AFUH 4Y2CA 3A5LC 4CO2A 4LJXA 3NGYA 1C1AA 4N5SA 3TVYA 1EP4A 2EI5A 4CZLA 3B0YA 4J7CA 2KZMA 4IQMA 1RYRA 2OMOA 1JLFB 2QA4N 5HHHA 1SV0A 3A3PB 3L2VA 5I3UA 3MTJA 3HSZA 2UUCF 2ZBPA 3CXCM 3THWB 1ZRNA 3QT8A 4F36A 3QUCA 3R9PA 4CGHA 4KLEA 2YTCA 4M5NA 4C2MA 3MN9A 1QVFM 3DAWA 2M9KA 1NH8A 4CF9A 3D7SB 4M3XA 4FPAA 4JAXA 4EI2A 4M9GA 2J7KA 4EP5A 4LIWA 3RRKA 1RK8A 4IG0A 1VBXA 3MMCA 4DTUA 2FE9A 4DU1A 3H20A 4J9KA 3R3LA 2G07A 2H3FA 4B3OB 3QGHA 5C25B 3I8DA 1IM4A 8ICXA 9ICAA 4YR2A 2MMYA 4J9LA 4A2BA 3GV8B 1IWAA 1IH7A 4QS7A 2A1BA 1ZQYA 5KG7A 3PX0A 2LMIA 5D0RA 5J2BA 4ZVOB 1B64A 2GFFA 2KKZA 4JI7K 4W5NA 4H4OA 2V8DA 5IT9U 4UW9A 5M1PA 3IMXA 1IBMJ 3SAGA 3A3OB 3KUHA 2EFGA 3EWGA 3OTEA 1S6QA 3H3OB 5KOWA 4Y2UA 1N5QA 4PKGA 2W41A 1ZQAA 4QR1A 4NMLA 2RHFA 3CB4A 3JS6A 4XO0A 3WKEA 2YMQA 1MQ2A 2PMZD 2RQCA 4LF7K 1F5CA 2KXFA 1KC8O 2BRKA 2E1ZA 4USMA 3RJEA 2VCPA 4ZS6A 3ALYA 1OYDA 2D69A 4BGBA 3EZOA 5AQMA 2KU7A 4RNHA 4EX7A 3ATUA 2PT0A 3U4LA 4HACB 3G86A 3D2FB 2LBOA 4OX7A 1CLQA 2OELA 1HLUA 2Q66A 2NV3A 5LXYA 5D6GA 1SJ1A 1BVSA 2W11A 4WFNQ 1PO6A 3IG1B 4DSLA 2AF6A 3DDKA 4EHTA 4IG0B 4KHPK 2MZQA 2GIQA 3MURP 4CF5A 2HHPA 2A19A 1FJEB 4LF5F 1HPMA 1VSDA 3AVMA 2ZE2A 2XY8A 1DRZA 3NGSA 2VKZG 3GJRB 3F73A 3I8BA 4CHYA 3GIKA 2JVOA 2GVZB 1JQGA 4ECVA 1O0PA 4I2QA 2QWOA 4ICLA 3OS0A 4OJGA 1IV8A 4DSFA 9ICGA 1J5EF 3UW1A 1JXLA 4KLJA 3D1HA 1HR0F 4PJ0U 3CSKA 2F1FA 1CS4B 1HQEB 2Z4PA 3M6VA 4LBIA 3D45A 3WU2U 3KFUF 3QBCA 4H4OB 4NJ8A 3WXLA 2IIHA 2VQFJ 3CJCA 3N0VA 3EZWA 1RBVA 3Q8PB 1SC6A 1S6QB 4ZCLA 1URJA 1DT9A 4MFAA 3KOAA 1U4BA 1K1SA 1LWXA 2CJAA 4K8RA 4BDPA 1Q3VA 1BISA 5LJ5Y 2B21A 2ZUBA 3GL1A 3SUPA 2UYTA 2QA4S 4N8NA 4U96A 1V4TA 2E44A 5KI6A 4CHZA 4ALZA 1T11A 5ALXA 4WE1A 1JXEA 5K9FA 2E9RX 2V63A 4EIAA 3CW2C 2F8KA 4RW4B 4F3MA 4ICAA 1SH0A 3BZQA 5HRRA 3NEKA 1ZQCA 4Y0FA 1WDDA 2P9PB 5GINA 2RHQB 3R2CJ 2CFXA 1VSKA 4JI2J 2UV8G 5AK5A 3K7RA 1RA7A 1QUPA 2YKMA 1NBWA 2LU1A 1RKIA 3DLGA 4QZVB 3E58A 2GX8A 1OH6A 5D0EA 3FZMA 3CCVN 4CJFA 4E1JA 3PJWA 4TYAA 5LMNK 5HVGA 1BHNA 4ZHRA 4KI4A 3J80U 2FZKB 2PMZC 1CG2A 2C3YA 2BPGA 3GB0A 4OGEA 4RT3A 1FJGJ 4M41A 1IV0A 5FPNA 4F25A 2M88A 2M7SA 3MXJA 2JLGA 4LD0A 1FF2A 9ICRA 3IA0A 3LPUA 1RILA 4PG6A 4U8VA 4I2QB 5E79U 2GMJA 1ZPVA 1O6XA 2DY4A 3MM5A 3D0HE 3LP2A 2F4VF 4KFBA 2F5GA 2ABYA 4DR5J 3SMSA 3OSNA 5HRNA 4CO1A 1FT8A 4KJIA 2GW8A 2HHXA 4IQWA 2MKSA 4Z4GA 1IUJA 4DUYF 2GCFA 5BPCA 3G8SA 3HXMA 1W9HA 1F1BB 5KT4A 5BN8A 4KHRA 3QO9A 2E5LJ 5LMUK 5J0RA 3DMJA 2KSOA 2Q3SA 3I76A 3NS6A 3GFXA 5A6PA 5AQGA 2EG1A 3E66A 1T03A 1P9QC 3FBEA 3FEZA 4WPAA 3PIOL 1JB0C 3LP1B 2BTFA 2YHYA 4FPIA 3ZSZA 4F4XA 2QLBB 3VMFB 7ICMA 1S59A 3TVZA 1M90O 1ZQSA 3ZZRA 2ZTDA 3FEYB 2LM1A 3UN3A 4ECSA 2MZTA 1R0CB 2XQCA 1RXVA 4FW2A 2X74A 1W25A 2ALYB 5AI0A 1ZAVA 3DLGB 2EKYA 1PILA 3UMCA 3AUOA 4RBTA 1QAJA 4JHDB 5J2PA 2LQBA 4YMMA 3UPFA 4DF8A 1LKYB 4ZHRB 2FLNA 2BKNA 2G1HA 5KPRA 3ZT2A 3J7AP 1CZAN 2HSTA 3AAWB 1NLKL 2JLFA 4CO3A 1NU4A 2BXJA 5EGYA 3LM2A 1TKTB 4YOWA 5E0OA 3VV2B 2LDYA 3AVJA 4YP3A 1UZDA 1RBOB 1VR6A 3M3ZA 5KFUA 1HNVB 4NXMK 3MM5B 4KFBB 7ICHA 1REGX 1TUVA 1RACB 4J90A 2HBKA 3AXKA 4KB7A 8ICNA 2FI1A 5KFFA 3N7PD 3JS9A 2AW0A 3DLLQ 1BUPA 2Y9UA 4CP5A 3K58A 2G5HB 1FD2A 1JLCA 4R25A 4HAIA 1NO8A 4LF4J 3TAGA 4KGZB 2FJXA 5EE1A 9ICQA 4DL7A 4CLKA 2OJ3A 3G6XA 4UW2A 2X78A 3T1HK 2V2ZA 3RJIA 4NLRA 2KSOB 2LQ5A 4KAZA 3UFCX 1N32K 2JMGA 3P4IA 4I56A 3RB3A 1Q81O 1RCHA 1ZOLA 2JXJA 2D3UA 2GUIA 5A0YB 3IP4B 1KVCA 3RR8A 1YRTA 2A40A 3A8EA 4WFBQ 4MK7A 3R7BB 1HRHA 2DCLA 1RZTA 2AX0A 4RW9B 4KLSA 2FJWA 1PJ6A 2CQ1A 4W5QA 4RW6A 1F5SA 3HSTB 2OPPA 1UCVA 4K4HA 5CZVA 5E26A 3VQ8A 1HPZB 3CCVS 3DDIA 3TWHA 1LWEA 2RQMA 3KDNA 2HNYB 4Y28C 2F9TA 1WUUA 2AX1A 5FIIA 2ROPA 2BJEA 3QQCD 4IQVA 4Y34A 4YOUA 2W2MP 5EUHA 1EO1A 1KL9A 5IV3A 3TANA 2BCVA 4OKEA 5J2PB 1TK0A 2KVQE 4BRAA 1XSPA 1NGAA 4EP4A 5B0FA 3WKBA 3EKUA 1SH3A 4QZHA 4A8KA 4CJEA 4NYZA 3NAIA 3CIPA 4ZPVR 4DPXA 4TUSA 3P31A 4KB1A 2DKXA 3T7ZA 5AXMA 2PYJA 3UCZP 3WK7A 2ZJPQ 2CQIA 4J9QA 2YX7A 1J2VA 3R7NB 4HHJA 2JR5A 3HSCA 2HQCA 2E9ZA 1WBDA 4J9SA 3EE8A 4PKHA 2B4JA 4G1QB 3D1OA 1Q46A 3M6XA 4CZMA 1FESA 3RBDA 1DK2A 4HYKA 2MXYA 4CF1A 4O3MA 3PKYA 3TSQA 1U04A 3LA0A 1UZHA 4Z0UA 9ICUA 4UOHA 4UT4A 1T44A 1RAHB 1U0HB 3N7RC 2JEGA 4H54A 1NK0A 3CJ4A 2HWHA 5HNKA 1Y00A 1AA1B 3PRBA 4OLAA 4BRPA 2QIFA 4USKA 2PAVA 2RDJA 4CEEA 2LLZA 3OY9A 3ILOA 4OZ1A 2G13A 2CKWA 4JI7F 2ZJAA 4NWIA 4MYTA 4M95A 3Q8LA 3OL8A 1VLBA 4KQZA 1X40A 2Z1HA 4ZP9A 3WC0A 2E5SA 4RW6B 1QD1A 3L09A 2OPPB 4U95A 5F0WA 3RG6A 1HUOA 1KFSA 1UVIA 3RMAA 3CCEN 3H8WA 2UXDJ 4KTQA 5IQ6A 2GMHA 3VAIA 3ZSQA 4KYZA 2YQ3A 3M9NB 4FF3A 2JX2A 4GKKK 4OD0A 3ET6A 2E9TA 2OZSA 1C6VA 4LF7F 3CETA 1F2HA 1FFWB 1NGJA 2W2QP 5DGAA 3MMJA 5L1JA 1VSJA 5C0YA 1G1XA 3TNVA 1VBKA 1XNQK 3UXNA 4CJ4A 4LZDA 4IUFA 2HWIA 3ZT3A 3ICXA 4JD2B 4Y2RA 1Q7YT 1KSPA 4K4UA 4AILC 2HSEB 3VAGA 2MPUA 1Y9OA 2DFLA 2DGOA 1RADB 5IIMA 4AHUA 1ZM9A 4U7UK 2P9IA 3OJUA 2ATQA 3DGPA 4MMOA 3GCXP 3EXYA 4PG5A 4X62F 2EWHA 4FXDA 5L39A 4EWTA 2QL7B 3JSMB 5KQ8A 3BGRA 1KKXA 2JH1A 1T6CA 4M3YA 2OCEA 5ETRA 4CLTA 2JEIA 4Z7YA 4GW6A 3IO1A 3W3SA 5C42A 1QHTA 3RJJA 5C5JA 4RO0A 3HK2A 3PM9A 5B5EU 1B4FA 3JB9k 3TKAA 1FNMA 1IJJA 5DM7Q 3UNYA 4FWQA 4ECTA 1KAXA 2W4DA 1TVRA 5J2QB 4NWBA 1JK9B 2D1CA 2X1AA 4EELA 4C4WA 3V1RA 2YX4A 1AYEA 4USVA 4K4TA 4ED7A 3SEOA 3CJTA 4M5MA 1RT7B 4FF4A 5AQUA 2YI1A 2Y1LB 4UB3A 4EYIB 4NLQA 2EFNA 4B3MK 4K50A 1HKAA 4FLZA 3LP0A 4ED4A 2XS2A 4O5FA 5KOXA 3ET6B 4FZZA 2DGTA 1U6FA 3QATA 3EN9A 4IWVA 4BLGA 3O5TB 4IFYB 4DZDA 2BABA 3CM5A 3CDAA 4PABA 2NZTA 4JKEA 3MCMA 3F9KA 2WSEC 1P1LA 1IBCB 4JI8J 4WQ5A 3C21A 5AJ3K 2BJDA 3HJFA 5A8WA 4DPYA 1W2BM 1RAAB 3K2YA 4Y2JA 3HP9A 2P9IB 2RILA 2ATCB 1BA0A 5F3XB 5DB7A 2WONB 1RBTA 3DGPB 2RE2A 2ZKTA 3H08A 2OEHA 4F8RA 2LCWA 5U47A 1K0TA 4UUXA 2FSNA 2L9DA 1UPHA 1LW0A 4OFZA 2W04A 5I42B 5F9NA 2X3GA 4F5NA 4NLSA 2OFHX 3KMSA 4RBVA 4MEYA 1U2RA 3HSJA 1U45A 2YNIB 4PRFA 2CJYB 1CVJA 2FBVA 2HFOA 2R8GA 3WNGA 1JLEB 3UNGC 4K0KK 3HT3A 4KBIA 2P9NB 5ETPA 4Z4CA 1SQGA 3QU4A 4DS4A 4OHWA 4ZP7A 3HYFA 1R0AA 1P9YA 3K5OA 1PK1A 1RQ0A 1KN5A 3KK1A 2RF2B 3CCES 2ZTCA 1EKSA 1FXRA 3F9MA 1G99A 4LQ3A 3H5XA 4WFNL 4IH7A 3HX0A 5IM0B 3W66A 5GAHP 5AQJA 2AWZA 1ZQIA 2VJ5A 5G0RB 5AE3A 1LXJA 1IXRA 4K4GA 3MEDA 2ZM6J 5L1IA 3OYJA 3DHWC 2AEMA 3WC2A 3IC1A 3VGTA 4DPTA 4IZ9A 1NDKA 5CYJA 3UDCA 9ICTA 2CJBA 1VHXA 5HL7L 3EEQA 3MAAA 1KRPA 4RNFA 2FLLA 3OJSA 1RWUA 3PYFA 3HM8A 3SQ0A 4BR5A 1VQMN 2FC8A 1I3AA 1CZ9A 1WI8A 4Y2MA 1WHWA 3DI6A 3AO1A 2H3EB 1S7IA 4KHSA 1T05A 3NNHA 5FRNA 2XSJB 4YFKA 2HCFA 2XNQA 2RIJA 3Q0AA 3VHQA 3AAQA 1KQSR 2GZOA 2A18A 3B4DA 2LECA 1LW0B 3V9SA 4F4YA 3BN4A 4AD6A 3QNWB 4I6MA 3I82A 3C95A 4KO0A 3QERA 4FLUA 2DGXA 4GVBA 4NXMF 2E88A 3ENWA 2B4VA 5THWA 1FNOA 3L7UA 3OL9A 4IO8A 5HO4A 5FP0A 3I4PA 2DJWA 3IFRA 1WG5A 3G96A 2GV1A 3PEJA 1XSLA 3CJBA 3UDEA 2HVEA 3R1HA 1WEYA 3ASMA 3VQPA 3WX4A 2EDUA 4ZMMA 3OLBA 1K1QA 4TKTA 8ICRA 3M9OB 1HNXK 4IO9Q 2XI2A 4PUOB 4ZH4A 9ICVA 3SMZA 2I8EA 3M6GA 1CEZA 1AZSA 5DLGA 2HBZB 1TL3A 3KK7A 1N32F 3D6MB 3Q8RB 4JK1A 7ICOA 1X1PA 3ZSXA 8ICOA 1Y11A 1QE1A 3AFGA 2QI2A 3SSRA 4TLQA 4NLDA 3SQGA 3OYFA 3SQIA 2HIQA 3WIVA 3MEDB 3K9JA 1A6LA 5BRDA 3HM9A 3KJVA 3HBTA 2JZBB 2XHBA 4DEZA 2UVVA 1YRXA 2K7KA 2VJ4A 4OX9K 2MU2A 4Y0WA 3HOSA 4L6V3 4RX6A 4LFAJ 2ZZNA 3IBCB 2ZWOA 3QMLA 2NPFA 4R8UA 3DXKA 5HOOA 4PXCA 1CJVA 4MAKA 3MPYA 5AE1A 4CRXA 1ZQEA 1FKPA 2AKWB 3D2SA 1UP1A 4J2BA 3TZZA 3DI6B 4OYPA 5LXRA 2WRMA 1N61A 1SC4B 5JICA 4LF8F 5M2RA 4ID5A 4FWMA 5SWMA 3BDEA 3DU6A 3RAMA 3OD2A 5J2AA 3VEVA 1Q8KA 1NXIA 3I4HX 4K59A 3AA8A 1E3MA 3TADC 2RS8A 1UCNA 2QXFA 1RPLA 1QHAA 1PK3A 3H2LA 4WZMA 3CCJN 2W3SA 1ZYQA 4CGJA 3HSGA 2B51A 3KG0A 4CLSA 5KFQA 1K8AO 4RU2A 2YQEA 4PG7A 1A77A 1SVDA 2GH1A 1RCOB 2CRXA 2QTDA 4M5IA 3AQPA 3CDEA 4C8NA 4EENA 1GTEA 1RDAA 1NOYA 2ASYA 1NJZA 1KOHA 1H73A 1NBEB 3W61A 4CE9A 4FWSA 2W03A 4BRKA 4OPJA 2B6AA 1YX2A 2IOFA 1RGVA 2K8GA 2VONA 2M3DA 2JNJA 1WC4A 1SUQB 3JPOA 1AZSB 3OTOK 1NK4A 3TUPA 4ZTFA 4C11A 2LXIA 2BCUA 4O3RA 3MOJB 4TY8A 1LAVA 3AVHA 3I32A 1QE1B 2KN4A 2QLWA 2YXLA 2DUYA 4YY3J 3P39A 4NLPA 4CW7B 4WBFA 1F3VA 2IM0A 4DFJA 1X8DA 3I0SA 4FXVA 1JJ2R 4NZ7A 5AKYA 3AOAA 5LSLA 3QMQA 3KJVB 2K60A 3E01A 5GTHU 3LO3A 2P6RA 3UMBA 3LDAA 1VQMS 1I94F 1O5JA 2ZDOA 4K4WA 2ZEJA 2FTRA 1T3OA 4I0WA 1C0TB 4R8UB 2UP1A 3DXKB 5KFAA 2FSJA 3H8JA 2VGNA 4UBCA 1TFYA 2A2DA 3FYHA 4C8LA 3EO3A 9ICFA 5CR4A 2RQ5A 4CZGA 4PL8A 4FO0A 1KQGB 2DFEA 1D8YA 4RWTA 4GKKF 5F2RA 4ID5B 4C1NI 4KHNA 3WX8A 1NZBA 3CNHA 3IG8A 4FJJA 1VDHA 3N4QA 3UKUA 2CJ9A 1M5HA 1UWAA 1QVGR 3D0PA 2KEYA 3RYLA 5CHIA 5HK4A 2KHDA 1XNQF 1N6QA 1D8ZA 4M2YA 3H4BA 5IV4A 4CTAB 1D4XA 1LAWA 4A62A 4QQBA 4OLBA 2V4JA 4MTPA 5DJBA 2DGWA 4OLPA 4E7LA 2XGPA 3CT9A 5ITHA