2BDPA

Crystal structure of bacillus dna polymerase i fragment complexed to 9 base pairs of duplex dna
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*C)-3')
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bdpA01
4TUSA 3UXPA 3EY1A 3RBDA 3OSPA 1B92A 4GC7A 9ICUA 2X6SA 1PZNA 1WCNA 1ZBFA 8ICNA 2BE2A 9ICKA 1RT6A 4ECZA 4E0DA 4YG2A 4KRFA 2F1JA 3DRPA 2J6SA 4FM1A 3H8SA 4KLDA 3QZ8A 3BJYA 4JS5A 3DM2A 2HNDA 3G0ZA 1CLQA 3V6HA 4DL7A 4JRQA 1ZQLA 3LPTA 3PW5A 5KI6A 4CEAA 5IIMA 3M9NB 4I27A 5J2GA 4CJ3A 1C6VA 4FLXA 2I1QA 4YN4A 2C2DA 4ID1A 5J0YA 3ALYA 4QWBA 5KT7A 4PHDA 8ICOA 3ZT4A 1RNHA 3ZSYA 1HNVA 3AVCA 2G8KA 4LSLA 3JPPA 4E19A 4NCGA 4FLYA 4DU4A 3LDAA 4M9LA 3QERA 2XCPA 2R7YA 3H4DA 2PY5A 1WAFA 3GFKB 4DTOA 3AVFA 1ZQQA 4F91B 8ICRA 7ICJA 4FJGA 2B6AA 4OJRA 5DG7A 3GIJA 3EPIA 1S1WA 1S9EA 4I2AA 1VK0A 1S6QA 4JS4A 3LDSA 3RMDA 4DTJA 5C5JA 2RPIA 1SKRA 1HQUA 4M3XA 1A76A 2W9CA 2HNZA 4I28A 4Q44A 1A5WA 4FJNA 1HUZA 4PGXA 8ICKA 5DK5A 3PO5A 4DOBA 2R8JA 4FVMA 4N56A 4KLLA 7ICFA 4RQ3A 4WE1A 4IRDA 4KN7A 1BIZA 3TAEA 5DG8A 1FKOA 3PX6A 3V9WA 5KG5A 2ISOA 3ZDBA 4YR3A 4KLFA 4FW2A 1HJRA 3AU2A 3AVGA 5KT4A 5KFQA 4C8KA 4F93B 4ED1A 4MFAA 4QWDA 3PW4A 1ZBHA 1ZQFA 5CJ7A 5CY4A 3ISBA 8ICYA 3M9MB 2LSNA 2DTUA 3LZIA 5DB6A 4ZTJA 1BI4A 2GWSA 1QTMA 2XY5A 4E7JA 4DSLA 4J9OA 3DRSA 4N41A 4W5OA 2ZJ8A 4YNQA 2O4IA 2VA3A 4KLGA 4ECVA 1TAQA 5KFWA 1QLNA 3BQ2A 3C2KA 1QSYA 8ICZA 2F1HA 2W9MA 1WN7A 4MQ3A 1O1WA 4M3RA 2FC0A 4HUEA 4CEEA 1UA0A 3ZDAA 3ZT1A 1WSFA 4DQPA 3LAKA 4Z4HA 1RBSA 5CP2A 1NKCA 3ZSVA 3B0YA 4IQUA 4FJ7A 2XCAA 3U3YA 2P5GA 2BANA 4OGCA 2GV9A 1BHLA 4KLUA 4RW9A 4DO9A 8ICPA 2PFOA 4CGIA 1ZQCA 2NRTA 3ZDDA 4Q5VA 2NRVA 1Z00B 4C8OA 4O5CA 3BDPA 5C24A 4Z4IA 2HW3A 3L2WA 4CHPA 5EU7A 2AQ4A 5KFTA 4FJKA 4QZBA 1JXBA 1VSFA 1QSLA 2UVUA 2J6UA 3KHGA 4ED0A 2G8WA 3OYAA 3QEPA 2WOMA 3KTQA 5K14A 1LV5A 1YTUA 5KFFA 1BPZA 4B9UA 3ULDA 3MR2A 3V7JA 3B6PA 4F4WA 4CF1A 3LP1A 1C1BA 4DFJA 4GW6A 4XQ8A 4I2CA 4E7HA 4IKFA 2PXIA 4LSNA 1LB2B 1RT3A 3ZDCA 4HTUA 4ECRA 4FYDA 3LAMA 1ZQOA 1Z26A 3OYHA 1BPXA 4RT3A 2BCRA 4AILC 5BOMA 9ICTA 1A5VA 4YXMA 3O4QA 5IIIA 3VA3A 5J2DA 3UQ2A 3N97B 4ED7A 2AGOA 1W9HA 1TGOA 3DOKA 4CEQA 3P1GA 3CYMA 9ICMA 5HP1A 3KD1E 4I7FA 2IOCA 3T5JA 3TR8A 1LWCA 4IQTA 3DLKA 2IHNA 4Z6CA 3SI8A 4DEZA 2I5JA 4FZYA 4GC6A 5L9XA 2F8TA 4QZ8A 2RKIA 5KFMA 3QNOA 4DLEA 4MEYA 1RT7A 4CECA 5KFVA 5DQGA 1IKXA 3RAQA 2JLEA 4PUOA 1IKWA 1FK9A 9ICRA 4UAZA 3KJVA 1VRUA 4ED2A 1QE1A 4MEXA 4DFMA 2DFHA 5KFEA 3V7LA 3KLIA 4ID5A 2XY6A 4CK1A 1D9DA 4J9LA 4DQIA 2GBZA 3GIKA 2PZSA 1ZQAA 5J0TA 2ISPA 4KI4A 1NJZA 3T1AA 3PX4A 5EWEA 3SJJA 3HJFA 1X2IA 2ASJA 3KK2A 2HNYA 4UBBA 1YVUA 4KPYA 5HRSA 3EW9A 1ZQNA 4KMUA 3K5NA 3OYJA 3ZD9A 4JK1A 3HPHA 4R66A 2ASLA 1LWFA 2VA2A 3ZSXA 4KV8A 1I3AA 1NK7A 3TWHA 3TQ1A 4NM2A 2NRZA 4QWCA 5KFCA 4RG8A 3RH4A 1RXVA 2AU0A 3DLGA 2Z1GA 1TL3A 2BCSA 4QZ9A 4Z4GA 2VWKA 2P66A 3V81A 3MXIA 4EZ6A 4I2GA 4QWAA 4I2IA 3HP9A 5SZTA 1S97A 1DGSA 3T19A 2P5OA 4DU3A 4R8UB 2PFPA 2FBTA 5BPCA 1RTHA 3DLRA 4BE1A 2YNIA 1RT4A 8ICMA 1I39A 4KHWA 4RNNA 3IS9A 2VANA 4ZTFA 1LAWA 3V1RA 3DMJA 4KLMA 3NGZA 1ZQBA 7ICGA 4CFBA 4IQVA 3MEDA 5KFYA 2F8SA 1RT5A 4CIEA 1VSKA 3RMBA 2J6TA 1XO1A 2V4QA 1JLEA 7ICSA 2E6LA 1BPDA 4FK0A 4PY5A 4ED6A 1BIUA 4M9GA 5DG9A 1XSPA 4M3UA 4O5EA 3AVHA 3ASMA 2YHAA 1CZBA 4YQWA 3S9HA 4ECQA 2P6RA 3O3FA 3QNNA 3SCXA 2LYHA 4F92B 4FK2A 1UWBA 3ZSQA 3K5LA 3V9SA 5HP4A 1MC8A 4YR0A 3WNGA 4DWIA 4RUAA 4Z6FA 2D0CA 1JXLA 4RQ5A 1N5YA 4I9QA 4R65A 4KO0A 4PHEA 4P4MA 2C2RA 4DSFA 3K59A 1ASVA 2XO7A 1VSLA 3M8SA 2VG5A 5L1JA 1D5AA 1B9DA 4ED3A 3TAFA 2NRXA 4PH5A 4DQRA 2ZTDA 5KFAA 2V9WA 3CQ8A 5JS2A 1K1QA 4J9NA 2FMQA 5KFNA 4KB1A 4RNOA 2A1JB 4LY7A 4GMJB 4C8NA 1BGXT 4CEDA 1MQ3A 5KFOA 3G6YA 2HHQA 4CFDA 4Q0BA 4CGHA 4GXKA 1NJYA 3C6UA 3RJKA 5EOZA 2BR0A 2W9AA 1JMSA 4CGJA 3KHLA 1KRPA 4BGDA 2C2EA 3MABA 5KGXA 4FJJA 4JLHA 4GXJA 5IIKA 4CHYA 4OVLA 5FRMA 3SUNA 3T5HA 4KLSA 4ELTA 4EEYA 3IM1A 2X6NA 2E6MA 1QHTA 1RBVA 3EYZA 7ICUA 1NKBA 2DY4A 3HVTA 4F8RA 1NK8A 2X74A 3PX0A 2FPKA 1NK9A 3Q8LA 4DF4A 4TSXA 4CK3A 9ICHA 3U3GA 5KG4A 3H4BA 4FM0A 4B9LA 2AGPA 4KHUA 4MFCA 1W0HA 3RWUA 4IRKA 5KFPA 4PGYA 3CFOA 2DPJA 1NOZA 4O3PA 4EYHB 1GOBA 5DQIA 5C25A 3NF8A 1ZQUA 5D46A 1IO2A 2IBKA 3SUPA 1CEZA 3PR5B 1QS4A 3V4IA 4KHSA 5D3GA 3SQ4A 2BPGA 3LPUA 5CA7A 3I0SA 4KLQA 3RB6A 1COOA 1RBRA 4W5NA 1S9GA 3ISNC 4F5OA 1C1CA 2FBXA 4OGEA 3KHHA 4JWMA 4KLEA 4TUQA 1JKHA 3HYFA 1BVSA 2G8FA 1TKZA 3C94A 3T5KA 4M2YA 3OHBA 4Q8EA 1WAJA 3AVNA 4BACA 5EWGA 1L3TA 2Y1IA 4RW7A 3AO2A 2KZMA 1S0VA 3HW8A 1DLOA 4BE0A 8ICLA 5JUMA 2BPCA 5CR0A 3L8BA 3NFAA 3WNHA 3OYFA 3VA0A 1X9SA 4AHTA 1N56A 5KG3A 2YV0X 4M3TA 4R5PA 1ASWA 4FBUA 4CF2A 3HK2A 2A1RA 4ECXA 4CJLA 3V6JA 3H8WA 4DTSA 3ZCMA 1CZ9A 4CEOA 3QEBZ 2C28A 5CYQA 3H08A 4DLGA 3DI6A 3C95A 4N5SA 5DB7A 3RBEA 4JWNA 5F9LA 4RQ1A 5KG2A 7ICIA 3VQBA 1TFRA 4F2RA 4O0IA 3C5GA 3GQCA 1YT3A 3RTVA 4R8UA 1FKPA 4I2BA 9ICNA 1JN3A 3E01A 4RQ2A 3O3GA 4F3OA 2BDPA 3OY9A 1ZQZA 1S1XA 4K8XA 4UB5A 4CHQA 2PFQA 1RDDA 1HNIA 4F50A 4LZDA 3D45A 3B6OA 2YHBA 4CERA 5IILA 4UAWA 2OWOA 3OS1A 3GIIA 3GIMA 4ECYA 3GV7B 4RZRA 5HNKA 4YCXA 3GV8B 4KHYA 3OS0A 3L2UA 1U48A 1KLMA 3VQ7A 4KN4A 3SNNA 4FJIA 3H40A 5HMMA 3TABA 4DQQA 4NY8A 4EYIB 5HMLA 2PI4A 3JPRA 4DSJA 2C22A 5J2EA 4FJLA 4EBCA 4UQGA 3G6XA 1VRTA 8ICHA 5TZVA 4K4IA 3JPOA 3ZD8A 2BQUA 1ZBLA 1U4BA 3QLHA 3HWTA 4AHUA 3OYCA 9ICIA 1ZQIA 2HVHA 3OYGA 2HHSA 3OYLA 4RQ7A 4F4KA 4NLZA 4O3OA 1Q8IA 3DRRA 1KEJA 4HYKA 3RB3A 2ZUCA 4C8MA 1QQCA 1U45A 3MAQA 2OZMA 4PQUA 4YFKA 5J2AA 9ICFA 4P4OA 9ICAA 2YNGA 3HXMA 3C1ZA 4I2JA 1Q9XA 1JX4A 8ICIA 2AGQA 4RU9A 3S3NA 2VG6A 3OYIA 4I2DA 4IQWA 3AA4A 1Y97A 3ZSRA 4YD1A 4J9MA 3SV4A 4O3RA 4BDYA 2QK9A 1XHZA 1G15A 2YKNA 1ZQRA 2GUIA 3MGHA 3RJFA 5KFKA 4O4GA 5HRRA 3VQDA 2R8KA 4PGQA 4N76A 1T7PA 1IKYA 2IC3A 4W5RA 8ICFA 4ED8A 3WNEA 5J0QA 3N4MB 1S1UA 4CHOA 8ICCA 9ICQA 2A1SA 4HUFA 1RILA 3NGYA 3ISCA 5DBCA 2HB5A 1A77A 3HPOA 2ZE2A 5KG0A 4FJ5A 4KB0A 4EBEA 1TK8A 7ICNA 3RJHA 4FO6A 3BQTA 3OJSA 5J2IA 5CYMA 2IS3A 2WTFA 3SYZA 3K75D 2Q0ZX 1HYZA 5KT3A 1GOAA 3HP6A 3CFPA 3VN5A 3TAMA 4XUSA 3SZ2A 5IIOA 1S0OA 7ICTA 3ZSZA 2ZJAA 7ICRA 4FJMA 4JRPA 1WCLA 4QZCA 3OJUA 4NLNA 5J29A 1TL1A 2OPPA 3LALA 1NK5A 1D8YA 4QOZB 3GV5B 1S9FA 3RMAA 3FYHA 1Y88A 3VQ9A 3OYNA 4B8CA 4L8RB 3HPGA 2F1IA 9ICJA 3TFSA 1HPZA 4O3QA 2IAJA 2OPSA 2XRIA 1NK6A 1ZJMA 4AH9A 4M42A 1QSSA 4YXJA 2P51A 3NE6A 1JXEA 1IH7A 5C42A 2BGWA 3K58A 3PO4A 4DF8A 1LAVA 1SZPA 3ZT0A 3ETLA 3MEGA 3JSMA 4FLUA 2NUBA 1BQMA 3SPYA 4QW8A 1K6YA 4O55A 4QAGA 1RT1A 4RW4A 5KG1A 4CGFA 1ZQHA 2YNFA 4E7IA 5CWRA 5J2CA 3NHGA 3AA3A 4QZHA 2MUTA 1SL1A 5DB9A 4FS1A 4FBTA 1WSEA 3HSTB 3OS2A 5EWFA 2OZSA 4EZ9A 1ZQKA 4OPJA 1VSJA 2VWJA 3S3OA 4YP3A 4QZDA 4Z6EA 3B0XA 4FLZA 8ICVA 1BPBA 2XY7A 1HRHA 4QZIA 4CJRA 4FS2A 4TQSA 1BISA 1TK0A 9ICGA 2P1JA 4B8AB 4ECUA 3VQCA 5CZ2A 7ICOA 1KDHA 8ICJA 2D0AA 4E1MA 4LVSA 1KTQA 2BCUA 4MFBA 2HHWA 3EWAA 2FLNA 5FROA 4BDZA 3I0RA 1ASUA 3EZ5A 4PWDA 4DL5A 4IG0A 2YNHA 4CHNA 3K2PA 2JEIA 2JZBB 4NYNA 3KKRA 5CZ1A 3FFIA 4MF8A 4NCAA 3QIPA 5KTQA 2KQ2A 4RW8A 3SQ2A 1RPLA 3AVBA 5I42A 1JLGA 4FJHA 3KD5E 1ZQGA 3TAGA 4KHQA 5DDYA 3CM5A 4KLJA 4CJ4A 2ZJ5A 1RBUA 2EX3A 4CIFA 1V9PA 4C8LA 3G6VA 4ECWA 3VQ6A 1VSMA 2I9GA 1F21A 5KRTA 4O0JA 4NLGA 4RQ4A 4DS5A 4CJVA 2FBVA 1ZQEA 5HBMA 4NXZA 3Q8QB 4B9VA 1WSGA 1KVCA 2B5JA 4YVZA 4DSIA 1ZETA 4JV2A 3NDKA 4KI6A 1ZQSA 3PW7A 2IMWP 5J2NA 4I2QA 3THVA 3UXOA 5L1LA 3H7IA 5JS1A 1T4GA 7ICVA 1MU2A 1S5JA 3DLEA 3QEIA 4CJSA 4BDPA 4ZH4A 4YMMA 1J54A 5KFLA 4DL6A 5HRNA 4O3NA 9ICEA 1S0MA 1RBTA 3MXMA 4Z4CA 3RRGA 3RR7A 2ATLA 4OLBA 4KLIA 3RH5A 1ZQDA 9ICXA 4G3IA 5J2JA 4I2EA 4M0AA 4AHRA 4J2EA 2VA8A 7ICKA 8ICAA 3VQ5A 3ITHA 1C0UA 4M6WB 3PMLA 1XI1A 4P4PA 3PMNA 5KT5A 3M8QA 8ICQA 5KFDA 3QEAZ 3VQEA 3NH1A 3RAXA 1BQNA 3UPQA 3AO1A 5J2MA 4DL4A 4RNMA 3MR6A 1UT5A 5DBBA 4AHCA 4H4MA 3MEEA 3AO4A 2G8VA 4UB3A 1XSNA 4EBDA 5J0OA 1R0AA 3MDAA 2Z1HA 2YKMA 4QCLA 2MAXA 3ZT2A 3SPZA 3F73A 4N47A 3ZSWA 2OA8A 4NYFA 1HUOA 3KLGA 2G8UA 3AVIA 4IG3A 4LH5A 4IR1A 3SQ0A 1KVAA 4E1NA 2IHMA 2FLPA 4CCHA 3U6FA 3MECA 1KSPA 3OYKA 3QZ7A 2OPRA 1DOQA 4GXIA 1TK5A 3NH2A 5IINA 3CG7A 1S77D 2XHBA 1RT2A 4KLOA 8ICSA 1J5OA 4OPKA 1U47A 1RTIA 4RPZA 1TVRA 4RPXA 3PV8A 1B9FA 1S0NA 4FZZA 4FXDA 2QKBA 4P2HA 3SI6A 1A5XA 4J2DA 2PI5A 4JV1A 3QESA 3M8RA 4FZXC 4I9LA 1B43A 5J2HA 1T03A 3LANA 2MUTB 9ICWA 4OKEA 2QXFA 7ICMA 1U9LA 2Z1IA 4CF8A 4LZGA 1Z00A 3LP2A 4DMNA 1N48A 2HHVA 1REVA 4HHTA 4CEZA 2BKEA 3MBYA 4Q8FA 2W9BA 3L3VA 3UQ0A 4KFBA 4J2AA 4XIUA 4FW1A 4X5VA 4F4YA 3KLFA 2Q3SA 5CHGA 3L2RA 3V6DA 1Q9YA 4DTNA 5HROA 5CB1A 4AHSA 2ZD1A 4ELVA 5J0RA 4E7LA 1XU4A 4Z6DA 4CF9A 4M04A 1X9WA 1SV5A 4F4XA 4DFPA 8ICEA 4CJUA 3HVRA 2JEJA 1IXRA 1NKEA 5KT2A 5J0WA 5DMRA 4W5TA 2BGGA 1DTTA 4YMOA 3NH0A 4M9JA 2JZBA 2FPMA 9ICLA 1VSIA 4B9NA 3A2FA 1HYSA 2PFNA 4H8KA 5L1KA 4Y1DA 3M8PA 1WSJA 1X9MA 2JEGA 3RH6A 2G8IA 5KG7A 4M3ZA 3KKSA 4O9MA 3MR3A 2W8LA 4BWJA 1ZQMA 1VSHA 3V1QA 4F4ZA 5KG6A 3V9ZA 4IR9A 4PHPA 4KKOA 3L3UA 4KTZA 3MR5A 4CK2A 3IAYA 4M9NA 3KLHA 3ISDA 2BQRA 5J0SA 4KAZA 1RDCA 2W9BB 3BGRA 2KFZA 3V6KA 3SUOA 3QINA 3NF9A 8ICBA 4DL2A 4DL3A 1NK0A 4I29A 3V9UA 3TAQA 1FXXA 3JPQA 5FDLA 5E41A 1X1PA 1HYVA 1TVAA 3K4GA 5J2BA 4CJFA 1IKVA 4KTWA 4QZAA 4BE2A 3CFRA 3QEVA 2VG7A 4KLHA 3UIQA 4RQ8A 5D49A 4FLVA 4F5NA 5DLFA 4NM1A 3IRXA 3C2MA 3AO5A 1SL0A 3HT3A 1EXQA 4BXOB 4G1QA 1BPEA 4XA5A 4DTPA 4DU1A 2ZTEA 1XHXA 5KFJA 4Y1CA 3MFIA 3OSNA 4M9HA 1EX4A 1JL1A 1LWEA 1XS9D 1ITGA 5FRNA 3RRHA 1XC9A 3HX0A 5KFZA 1YTAA 4UB4A 3BQ0A 2FMPA 3IHQB 2AQ0A 3OHAA 4DQSA 2BCVA 4O44A 2PYLA 3RJIA 3WNFA 3RB4A 3DLHA 2HHUA 4CFCA 3RJGA 3S3MA 4J9SA 3D0PA 1VSEA 3P83D 3AVMA 2HHXA 2KN7A 3JPNA 2IA6A 3O4NA 7ICEA 4NCBA 1SKSA 4DOAA 4E3SA 4F5RA 3Q8PB 3PY8A 5IIJA 3NGIA 2RDJA 3KK3A 8ICWA 2ZQBA 1T05A 1AROP 4K4HA 2PYJA 4I2FA 1MQ2A 4I2PA 4O5KA 2O4GA 3OYDA 4CJTA 1T8EA 5KFHA 3QE9Y 3KLEA 1IM4A 2KZ3A 4CJKA 4K8ZA 4M41A 5KFSA 2A1JA 4YMNA 3Q8SB 1TKXA 3LZJA 5KFRA 1HJPA 3V1OA 1C0MA 8ICUA 4Z0UA 4CJWA 4CGGA 4ECTA 1WSIA 2EHGA 4EP5A 4DS4A 4DTMA 3VQ8A 3AA5X 3RJJA 4RQ0A 1VSDA 1RTDA 3E2EA 1SL2A 4KREA 3K5OA 3AV9A 3JPSA 1UOCA 3OGUA 5J2FA 3NAEA 2ASDA 3M9OB 2M9NA 2IDOA 1TKDA 4HCBA 1H38A 4Q43A 5KFUA 3C21A 1KFSA 4GLXA 1KFTA 5F9NA 3MFHA 4K4GA 7ICQA 1IG9A 4TUPA 4AHVA 1L3VA 4UAYA 4DTXA 1NOYA 3TANA 5HHHA 2B4JA 4Z4FA 2DFEA 4RW6A 2FPLA 2H5XA 4PPXA 4J9RA 3HL8A 3Q8KA 4IRCA 3RJEA 2NRWA 5J0PA 5J0XA 1L3UA 2KFNA 1BCMA 1RDAA 1T3NA 3T3FA 1NOMA 2F96A 4CE9A 5SWMA 3QIOA 1EXNA 1GOCA 5BOLA 8ICXA 3PW0A 3EPGA 4CIGA 4UB1A 4B9SA 2XGQA 2R8GA 1ZQJA 4CGDA 4M3YA 4EP4A 3O3HA 1JLBA 4ELUA 3V7KA 4HUGA 2W42A 1C0TA 1J53A 1MSWD 3NBPA 3NF6A 5DGBA 2BQ3A 5KFIA 3C5FA 2QKKA 4QW9A 3NF7A 1ZBUA 4I2HA 4B9MA 3NGDA 3AA2A 5J2QA 2R8IA 4XRHA 4FLTA 3AVKA 3SV3A 4FJ8A 1LW2A 1LW0A 1L5UA 3IG1A 3F9KA 4QZFA 1BL3A 1JLFA 1J9AA 1EP4A 2UVVA 4KLTA 2IGIA 1HMVA 1RZTA 4KTQA 4CJEA 2BCQA 1ZQXA 4RT2A 3MDCA 2JGUA 4FLWA 3K5MA 2DFLA 2W8KA 1S1VA 2W9CB 3AVLA 1D9FA 3MXJA 3DYAA 5DLGA 3MGIA 2B21A 5I3UA 1CUKA 4YR2A 4F5QA 1C7YA 3GDXA 1ZQTA 3LWMA 3LWLA 4DFKA 5D4BA 2FBYA 4Z4EA 4CJQA 1UA1A 3ZSOA 2ZUDA 4RUCA 4IBNA 2R8HA 3AU6A 3TI0A 3I8DA 1S10A 2Z1JA 3CM6A 1HQEA 2KW4A 4FJ9A 9ICVA 5DDMA 1N6QA 4BWMA 4QZGA 5KFXA 4YD2A 2JEFA 4IFYA 1JLAA 4KITB 4JUZA 1ZQYA 4TQRA 1SUQA 3HO1A 4BXOA 2D0BA 3ORYA 1ZJNA 2ITGA 5DB8A 3KHRA 2OYQA 3TFRA 3JYTA 5HRPA 4LH4A 3DOLA 4FK4A 1TV9A 5L1IA 4OKKA 4HVJA 3H8JA 1WNSA 2E4LA 3K57A 4NLKA 4MFFA 3PUFA 1BPYA 4UBCA 2ALZA 1RYSA 3LP3A 2ZTCA 3SQ1A 3SUQA 3KK1A 4J9PA 5KFGA 3P5JA 4LD0A 4E7KA 4R64A 2HMIA 1S1TA 2P6UA 4IFVA 4DSEA 3BQ1A 4CHZA 5J2KA 9ICBA 3PR4A 3PW2A 4FCYA 3G10A 4M45A 3LK9A 3OYBA 1Z25A 4E89A 3VQQA 1WLJA 3NTUA 1U04A 3AVJA 4DOCA 3ZDEA 7ICLA 1RCHA 4FM2A 4RQ6A 9ICPA 4QWEA 1TKTA 5J1EA 5HHIA 4J2BA 4FJXA 1JL2A 3PVXA 1JIHA 3GILA 2DFFA 1RDBA 3UXNA 1S76D 9ICOA 1KLNA 1UT8A 2FLLA 3VQPA 3V9XA 4J9KA 4W5QA 3JPTA 5KFBA 4B3OA 4CJ5A 3C23A 4CEBA 4PA1A 3V72A 1ZYQA 3QEWA 9ICCA 3OYMA 4O5BA 2ATQA 3QEXA 8ICTA 5J2PA 3T5LA 4DG1A 2RF2A 2ETJA 1JLQA 1NK4A 3Q8MA 2Y1JA 1RYRA 5DQHA 2FMSA 2XC9A 1UAXA 2BHNA 4HCCA 1EETA 9ICSA 3C2LA 1BI4B 2AJQA 1KFDA 1WSHA 4DSKA 1NJXA 2RDIA 1BCOA 3AUOA 3C1YA 1CXUA 3KIOA 2BPFA 3AO3A 2DPIA 1JLCA 4YFUA 4B08A 2ZUBA 1SKWA 1DTQA 4RPYA 3RB0A 3L2QA 3L2VA 4TURA 2WONA 5DKWA 1S6PA 1ZQVA 1D8LA 1K1SA 3VQ4A 5HLFA 5T7BA 5DGAA 1ZQWA 5J0UA 3TARA 2UVRA 3ZT3A 1NJWA 2OPQA 4M3WA 8ICGA 3VQAA 2G8HA 3FDSA 2RN2A 1RXWA 1XWLA 3HM9A 1TV6A 1TAUA 3OVNA 4H4OA 4CFAA 4ZHRA 5KGWA 4B9TA 2D5RA 1ZBIA 4R63A 2V4RA 3AVAA 3OYEA 3QETA 1ZQPA 4UB2A 3QO9A 4F3TA 4IDKA 2HHTA 5DBAA 5KRSA 4OKJA 3NCIA 4MF2A 4KHNA 1KCFA 4QZEA 1B22A 4CEFA 3LP0A 1L3SA 4CJPA 1RTJA 4CF0A 1EKEA 4DTRA 5KT6A 1Z3EB 4OLAA 3PNCA 7ICHA 4Q45A 4JV0A 4F5PA 4CESA 4M47A 2UVWA 4GVMA 2KTQA 3TAPA 2X78A 2KZZA 4PHAA 3RR8A 4ICLA 1KVBA 4J9QA 4O3SA 4F2SA 3C6TA 1XSLA 4M6WA 2XGPA 3DLBA 3RMCA 1CXQA 4DTUA 2HVIA 7ICPA 1U49A 3Q8RB 4ECSA 1C1AA 2XY8A
chains in the Genus database with same CATH superfamily
4TUSA 3UXPA 3EY1A 1HPMA 1OWXA 4IO1A 4OX6A 1PZNA 2R7RA 1ZBFA 8ICNA 4ECZA 4KRFA 3QDKA 3H8SA 3VTHA 1S1VB 3BZQA 2FF3B 4BC7A 2CQCA 1N5YB 2XHWA 2M0NA 2VV5A 3DM2A 5DRKA 3AOCA 2HPUA 3TUZC 2KL8A 3G0ZA 2DR8A 4JRQA 4RBTA 2VC1A 4O8UA 2QEXS 1KVJA 4HEA9 1FRXA 4CBWA 4FNIA 4I27A 4FLXA 2C2DA 1YJRA 4ZPWR 2DL0A 5KAFU 4IJNA 2B43A 5J0YA 4JV5J 4QWBA 1T02A 3AGRA 3F9MA 4PHDA 3HHLA 1NGEA 2RJZA 1B7YB 5AQYA 1F6TA 2NO4A 3JPPA 4E19A 4NCGA 3LDAA 3HKZF 5DETA 1TMMA 5BPLA 5A8RB 4ZPTR 1LW0B 2CZ4A 8ICRA 5ETMA 3NRZA 2Q31A 3H8YA 4BG8A 1QQ5A 1YTYA 2H65B 2ZH9A 4OV6A 1M90O 2WBMA 4I2AA 1VK0A 4DTJA 3UDLA 5C5JA 1WG5A 4J03A 1FNXH 2VPZB 1XNQK 1HQUA 2D4WA 2R18A 3ZZYA 1EO1A 2W9CA 4AT1B 1EB0A 3W60A 4M63C 3CF5L 4MKVA 3A8IA 2E1FA 1V6HA 2Q1NA 5E3CA 1F2GA 4KLLA 4RQ3A 3KHYA 3LDOA 3IS9B 4KN7A 3PX6A 3V9WA 2GEMA 5EDWA 4NLRA 4YR3A 1HJRA 3AU2A 3AVGA 2NXNA 3T1HJ 4CT8A 4HHJA 4F93B 3DXSX 3RG6A 3EZWA 4QWDA 2QXLA 3LVVA 1ZBHA 2E1EA 1WHYA 3O8WA 1PGZA 9RUBA 2R2SA 2EZYA 3M9MB 4C6AA 5ALZA 3AODA 5D78A 2OXOA 5DB6A 1MMLA 3LZIA 1WTFA 4E7JA 2IRYA 3VCBA 3VMFB 5JJBA 4NXMK 2FGOA 3DRSA 3CIPA 1NBWA 2ZJ8A 4JKCA 2VA3A 4ECVA 4OZLA 1TAQA 3HD1A 3I28A 4BR9A 1QSYA 3AXMA 1CJVA 4GRSA 5HN0A 1ZRNA 4P52A 5JLHA 1O1WA 4DV1K 4M3RA 4CLFA 4HUEA 1DLOB 3ZT1A 4DQPA 3E51A 5CP2A 2OFHX 4KH6A 1NKCA 1LFPA 1G3OA 2MZQA 3U02A 3LDQA 3FSYA 2UU9J 4JI8K 3EGNA 1VQOS 3THWB 4FJ7A 4H54A 3M8YA 2QO3A 3U3YA 1JXVA 2W2PP 4C11B 1UWBB 4YDDB 1X4GA 4JYAF 1BHLA 4RW9A 2PFDA 2G06A 3NWRA 4KB7A 1ZQCA 5AKEA 3FFKB 4LR9A 2NRVA 1Z00B 3BDPA 2HK3A 1R8PA 1JXBA 2IIHA 3Q0AA 4ILJA 1VQLN 4ED0A 4AFFA 3LDPA 4IJAA 4Y2YA 1U1OA 1Y5NB 2WOMA 1S6OA 2EFPA 3KTQA 2G5IB 5K14A 3ZO7A 1YTUA 4J8FA 5ALYA 2EBEA 1ACMB 3MR2A 1R43A 3MD1A 5LJ3Y 4CF1A 3LP1A 2ZJQQ 3MPDA 4I2CA 1KHVA 1R0AB 1RAIB 3TSQA 4JB8B 1AFIA 3UKUA 2MSSA 3ZDCA 4A8WA 4ECRA 2XMTA 2R2UA 4FYDA 4CYUB 1ZQOA 3OYHA 4UF4A 2ZITA 2NYHA 5BOMA 9ICTA 2EFGA 4YXMA 4Q0BB 1NDLA 3OPKA 1VFJA 3ZZOA 1UCNA 3AOAA 4ED7A 1W9HA 2Q6CA 2MKIA 3CYMA 1BE4A 1V9OA 3D1QA 2N4CA 2Z30B 3KD1E 4U96A 3SENA 1H7WA 2ZJPL 2HHPA 2YKNB 3MM8A 2LBOA 4Z6CA 2I5JA 1IKVB 1J5OB 4QZ8A 2RKIA 1NG9A 3QNOA 2DK2A 3NOGA 3KNAA 1RXOB 4KBIA 4BQLA 5EE1A 2KHVA 3ZC4A 5F8HA 1HWJA 3MUVP 5E79U 4ZKAA 3UMBA 4UAZA 3LYSA 3J81O 3N5BA 2DFHA 5KFEA 5ALFA 2YNGB 4ZPVR 4C0OC 3EM1A 3FBEA 2B4UA 2KYXA 2D3DA 3MD3A 1RZMA 1Y0HA 4CLZA 3JTOA 4E8UA 3AA8A 2E1YA 2F76X 2ISPA 4KI4A 3MGVA 3PX4A 1NSKL 4UB6U 3J7Z5 2ASJA 3KK2A 2RRBA 2HNYA 1Y5IB 4LRCA 5B7WA 1EARA 4C23A 5HRSA 4JI1J 1ZQNA 1DRGA 3OYJA 1RBOB 3QGHA 1EWQA 1X42A 1I3AA 1FRKA 2NRZA 4QWCA 1JWWA 4LF5J 4UOFA 3CJ9A 2Z1GA 5CCMA 2P66A 4NASA 4EZ6A 4QWAA 1ZA2B 3BGOP 2HRTA 3O6QA 4G1QB 3CC7S 4DU3A 2PFPA 1ZD2P 1VLBA 5BPCA 1YJWN 2I7NA 2GC8A 3FVYA 3MM8B 1RT4A 3AHPA 1LAWA 4LQ3A 1IBKJ 4KLMA 2CH6A 2FJAB 2V5HG 5KFYA 1ZC6A 4K2JA 4Y2KA 1RT5A 4MYTA 3CPEA 2CJYB 4JI4J 4UTGA 3WXKA 2V4QA 2GHVC 3MCSA 7ICSA 3A5NC 4FK0A 2RHQB 2JRZA 4YS2A 4ED6A 1LKZA 1Q78A 3QT7A 1TR0A 3KG4A 4P2SA 3S41A 3CJ4A 1IQZA 2C2NA 2ZZMA 1CZBA 3S9HA 3BKUA 3VALA 3C28A 2P6RA 2LYHA 1BQXA 2KK0A 1XMOF 1RGVA 2B51A 2FZGB 2HOEA 2YMPA 3TO8A 3WQTA 4ZVRB 3T1YF 2Q97A 5HP4A 3V9SA 3WK6A 4FWKA 2G5HB 4P0PA 5AQWA 4DWIA 1NXIA 1JXLA 1QVGR 3MWTA 1WBDA 1VQKN 2JRSA 2XLKA 2QLJB 3DHXA 2YX8A 4PHEA 2NSBA 5HVFA 1CJTB 3K59A 4XDDA 1W25A 1MWYA 4FZVA 1ASVA 2XO7A 1D5AA 1RA7A 5EX3A 3TAFA 4FWLA 4HVZA 2R7QA 1VK8A 3LPEA 3CQXA 2QARB 3ZZ0A 3PSIA 3K9KA 1Q0NA 1Z1ZA 5ALUA 2B5JB 3CQ8A 3DYAB 1YI2N 2QWRA 4J9VA 5EN1A 4C8NA 4CEDA 1F0XA 2P8IA 4DR4K 5C2CA 2VG7B 4ZP8A 4DU7A 1MDUB 4CGHA 5GADP 2IPOB 1NJYA 1N5WA 3DRRB 1E3MA 3C6UA 1N63A 2BR0A 1CS4B 2W9AA 2J9DE 5IM0B 1NZPA 4BGDA 1I94J 2MGZA 4M5NA 2JFKA 4ZJLA 3KDOA 4FJJA 4DN0A 4DR1F 3H98A 4NWBA 5IIKA 4OVLA 3SUNA 3T5HA 2ZIWA 2VPYB 3VGMA 4EEYA 3IM1A 4DV4K 4MN4C 2O8EA 1QHTA 4CT9A 3EVOA 4OPAA 1C20A 3HVTA 4FN5A 4PUOB 3EVWA 2QLXA 2OJ3A 3CULA 2X74A 5FLXY 2RLTA 2VU5A 2NZCA 1ZOLA 4DF4A 4K7QA 1MWQA 2Y8WA 3QMLA 4CK3A 3H59A 9ICHA 2L5YA 5F0XA 4FM0A 2ZH8A 2AGPA 4PG7A 1JJ4A 1TV6B 2XSJA 3VGUA 4PGYA 3CFOA 2RKIB 1NU4A 2DPJA 2F40A 4O3PA 1TL7A 2BKPA 1GOBA 5C25A 1BU6O 5D46A 4KH1B 4A2BA 1IO2A 2RS8A 2IBKA 4KGZB 1HBUA 1FI4A 2JVOA 1LVHA 3VTIA 1VJWA 1QQMA 2EBGA 4ILLA 4JN4A 1RT7B 2WSCC 4NA2A 3HHDA 3KFUF 1COOA 5IS2A 4LIWA 5F8IA 1RSCA 1T9VA 1RDFA 1DQ9A 2WBNA 3ETRA 3R1XA 2G8FA 3C94A 3UB5A 1X6IA 4Q8EA 3I6PA 3SXLA 4BACA 5U47A 5EWGA 1FWPA 4ZP7A 1JUDA 4K42A 5K8MA 3AO2A 3PEHA 1N5QA 2EG2A 1S0VA 3ULEB 3DGPA 2IOFA 8ICLA 4FL9A 3H3NO 3PRDA 5CR0A 3L8BA 3VA0A 1X9SA 4AHTA 3CO9A 4AQYK 4K0KK 4P7TA 3C0BA 3US5A 1DARA 3HTVA 3FM9A 2A1RA 4UAVA 3QU9A 2CQHA 3V6JA 1KOOA 4DR7F 4DTSA 1CZ9A 4A8OA 3MN6A 3OBIA 4A8MP 5DDQC 3C29A 2KRRA 4LJMA 4DLGA 3ED5A 2DISA 4GVBB 3KLIB 4N5SA 3MMAA 2GVDA 5DB7A 3AA9A 3OR1A 4RQ1A 4U67Q 3TSPA 1AZSB 3FBCA 3VQBA 4F2RA 2EH9A 3SQIA 4ITSA 2G0CA 4O44B 4DG1B 1NB7A 1FKPA 1WG1A 1RKIA 5CEHA 2DGQA 1SIZA 3SCJE 1APSA 2L48A 1XMOK 4YHHK 4O5FA 1S1XA 4CHQA 3PSPA 1P90A 2VBWA 1GMWA 1O0PA 4LF8J 3GIMA 1TUUA 5BXIA 4RZRA 1JK9B 1KN6A 2WAQC 5ALNA 1RHKB 3CVKA 3Q24A 1GH8A 1KLMA 3CWJA 2OSQA 3SNNA 5JVHL 3NMRA 2W3RA 3PDNA 3TABA 1CULA 4NY8A 3WXJA 3I4PA 3WK4A 3CDBA 3R6GB 5HVGA 3OFEA 3G6XA 3TZXA 2ZUGA 5HMYA 4WFNL 2XULA 4H0XB 3EE9A 4K4IA 3EZOA 4OI2A 3QLHA 3HWTA 3OYCA 5K8NA 2ZJPQ 1ZQIA 2I0XA 2F4VJ 1U2FA 4NL9A 4RQ7A 3UMGA 3FEXB 4O3OA 3PIOL 4KQZA 2H3FA 3MCMA 2HQIA 4HL9A 3RB3A 3I87A 4C8MA 1A0PA 4U8VA 2MZTA 2HYIB 2FJ6A 4RW4B 9ICFA 1XN9A 1VQLS 1R8HA 2YKQA 4QZVB 1QY7A 3H2LA 3NWGA 1FESA 2VG6A 3OYIA 1Y97A 3TU5A 3ZSRA 4O3RA 5AHXA 1XHZA 4ZLLA 3TX0A 2KE7A 1ZQRA 2GUIA 3MGHA 3FBBA 2FIUA 4O4GA 4HWIA 2JXJA 4N76A 1T7PA 1KN5A 1IKYA 1S1UA 5AXNA 2A1SA 1RILA 2HB5A 3RYLA 3UCGA 4KB0A 4EBEA 1N62A 1R8AA 3RJHA 3P49B 2QRRA 4PZNA 4C80A 4WFZA 4US9A 3DXBA 3TTFA 3LUYA 2Q0ZX 4URQU 5KT3A 1T3VA 2A3JA 1QQOA 2CDQA 1S0OA 3RGIA 2BE7D 2ZJAA 7ICRA 1VHIA 3SIPB 2PMZD 3H0MB 4OX7A 3ILLA 3H25A 4X62J 2YH0A 4NLNA 5J29A 1NK5A 2R7SA 3GV5B 4QOZB 1S9FA 3FYHA 1Y88A 3VQ9A 5ALIA 3OYNA 3QU5A 2HLTA 2F1IA 3TFSA 4O3QA 2PBDA 4AH9A 3FC4A 4YXJA 1JXEA 2BGWA 2YPYA 4DF8A 3ZETB 3V6DB 3JSMA 3LW5C 3BR9A 2NUBA 1RDWX 1NSQA 4X62K 4FWNA 3PG9A 1DK3A 6FDRA 4RW4A 5HMWA 1K73O 3Q7CA 2QSWA 4CDGA 4KKOB 3NLCA 1Z4UA 1ZQHA 4E7IA 4P0QB 3CJ5A 3R6LB 2ADCA 1T9WA 2FJWA 2LM4A 1WORA 3QGIA 3FGUA 5BN8A 4A57A 2ZH7A 2V9KA 3RUBL 2R7XA 3HSTB 3OS2A 2OZSA 1ZQKA 3C7NB 4YOEA 4QZDA 1WUAA 2CGJA 2XM3A 3B0XA 8ICVA 1BPBA 1UAWA 4BRPA 1BISA 3U26A 3R7NB 5BR8J 1NMDA 1URJA 2JLFA 2P1JA 4B8AB 4DV7F 2MXYA 3UPFA 1VQNN 1GMWD 5D0EA 1OQ6A 4WFBL 3W5YA 8ICJA 3AFGA 3G71S 3SQGA 1KTQA 2K7KA 2Q4TA 3EWAA 1WKKA 5KOWA 3I0RA 5AKKA 1SVDA 3PTWA 1OO0B 4DV5J 3CCTA 4MF8A 3QIPA 5KTQA 2WTUA 2JJ4D 2UV8A 4M7XA 2E9ZA 5A8KA 4KH0B 4IYQA 2M5YA 2Z56B 2V8DA 3R5BA 1RPLA 1G99A 1NCLA 3AVBA 1ZQGA 4KLJA 1RBUA 3VQ6A 1VSMA 2I9GA 3P4IA 2C3UA 4O0JA 4CJVA 5AI8A 1UWAA 2B9XA 5HBMA 2OD6A 4NXZA 2BRKA 2VD3A 5HANA 1KVCA 4FOIA 3W2WA 5HVHA 2J7UA 3T9ZA 2FHOB 2F9JA 1HNVB 4YB1P 1ZQSA 2K06A 1FFSB 2DT9A 4WIIA 2WF5A 1ZD4A 4P0QA 1P9QC 1MU2A 4L73A 1DBDA 1L7PA 4CJSA 4ZH4A 5KFLA 4JD2B 4DL6A 3ZZTA 4OV1A 1PK1A 4O3NA 3VGTA 4X84A 1BWFO 2HFSA 3D9BA 1RBTA 4A5BA 2VFTA 2W4DA 2UV8G 4DKWA 3SEOA 4KLIA 2QA2A 9ICXA 1T9XA 2PO4A 4DV0F 4TNOA 1UETA 4K4WA 3R1HA 4DN9A 1YRUA 2F63A 8ICAA 3ITHA 1XNRJ 2MZ1A 2DO4A 3LDNA 4IEEA 2PMZF 2WB1D 3CO0P 2QTDA 2GIQA 1N33J 3DWLA 5DM6L 3WX8A 4I2PB 3M2VB 4DV2F 5E3PA 1J2VA 1NMEB 1UT5A 4ZVGA 4AHCA 4H4MA 3MEEA 4JI1F 5J0OA 3DI6B 2ROPA 4LF9J 1PSDA 1R59O 4ZDNA 4QCLA 2I6XA 4GMKA 3DLLQ 3ZT2A 3BBFA 4B6JA 2V2KA 3Q22A 4IG3A 5GINA 1X5SA 2HAIA 2WBRA 3GMGA 3H3OB 4IR1A 4LF5F 4AQYJ 4E1NA 1E6VB 4LF7K 4DR2J 4HH1A 4OPHA 1U1KA 3RSEB 5AJ3K 1F5BA 3NH2A 2C1EB 4YDUC 2JX2A 2OPQB 5AE2A 4NLQA 4KLOA 1GLJO 1CBKA 4KY3A 5ADXA 2YBVA 1U47A 5LMNF 2WC9A 4A8YA 1B9FA 1S0NA 2QKBA 3AD9C 1KD1T 2BZ2A 3G6ES 1IBKF 3SI6A 2RQ4A 3EO3A 1T3OA 2Y9TA 3QESA 3A0IX 5K9FA 2UXDF 2B56A 4IDKB 1PK1B 5KNIA 2J7WA 2MUTB 4AM7A 3CCMN 9ICWA 5EX0A 2D3OR 4XTTA 2QJ3A 1Z00A 3LP2A 4DMNA 1O03A 2HHVA 4CEZA 4PKHA 3UQ0A 2GJ2A 2LA4A 2XS7A 4ED4A 1SPBP 4DTNA 4IOAL 1OH7A 1TL5A 1BWEA 3N4WA 1YF5L 1XMQJ 4CF9A 3M2VA 2PFFB 3DHWC 3HVRA 3WQPA 3V2UC 2F9WA 2JZBA 2FPMA 4B9NA 3KYLA 2PFNA 2CYYA 3IP0A 2BJEA 2H9ZA 2W8LA 3Q8UA 2QYCA 4FPIA 1Q3UA 2BUNA 4KTZA 4PL2A 4AYBF 1YJ7A 3IAYA 4PAAA 4DV0K 2RE2A 1HBUB 5D8HB 4ZVOB 4M95A 4ZMMA 1K8AO 1UVMA 2FDNA 4BVPA 2LPEA 4KAZA 2IMOA 5AM3A 3A3OB 5AKJA 5FPNA 3EGZA 1M1KT 3VEYA 3QATA 3QINA 2HWTA 8ICBA 2NQPA 4DCJB 2DRAA 2KYZA 4OYBA 2MRLA 4NB4A 3CJRA 1SJQA 2HZCA 2G0AA 3JQJA 3R5CA 1FFUA 3RFAA 5E41A 1ZM4A 1HW9A 1TELA 1TVAA 4ACOA 1RADB 2AJ2A 1R8BA 2W2OP 3HHLC 4NLVA 4ALZA 5DO2A 2YNHB 3NL0A 3AO5A 1SL0A 5D15A 1BNPA 3D6RA 1SJ3P 4TY8B 1QUVA 2ALYB 1F9FA 4Y1CA 1Q3VA 3ETMA 1EX4A 4ZJOA 2YKOA 1Q86T 2BM0A 1FX2A 5FLXU 4FWPA 1LWEA 3GFZA 1YHQS 3MMBB 5FRNA 3WDOA 2W2QP 3OBWA 4OI0A 2FMPA 2KT2A 1LWFB 2C3YA 2BCVA 4O44A 2PYLA 3RJIA 1MG7A 3WNFA 1XNQF 3RB4A 1SUQB 3CCSN 3KLGB 3RJGA 4RUHA 3DLLL 3WEEB 4L76A 3GBTA 2YN4A 2KVCA 4QPTA 3JPNA 4KHRA 2E2QA 4NCBA 4NO7A 4DOAA 1WACA 4E3SA 2YTCA 1SJFA 3MTJA 3O2IA 4I2FA 2H3ZA 1UVIA 4BRNA 4O5KA 3D2EB 3MAHA 4A2AA 5ITHA 1UTAA 3GPAA 5KFHA 1C0TB 2HZVA 3ZEUB 1ILYA 4WFBQ 2JWLA 1IM4A 1E4GT 4DR7J 4M41A 3W63A 2A1JA 2W4PA 1N34K 4YMNA 2WVBA 3NS5A 5KFRA 4HR2A 2UU9K 4K0KF 4DUTA 3IG8A 4GO7X 4CGGA 4GKJF 3QSYB 4EP5A 4DTMA 1YIJN 2H5IB 2FSNA 2C3OA 1KW4A 1Q8BA 4RQ0A 4ZIVA 1VSDA 3HFZB 3E2EA 4DL0C 3KVGA 3WQUA 3UCZP 5KAIU 1W2IA 2HQFA 3JPSA 5ADXH 3WXMB 1OJ4A 1Y11A 3NAEA 5AKZA 3M9OB 2M9NA 3VOVA 1N36J 2YX1A 4MDBA 1H38A 4Q43A 1HHSA 4FYVB 5KFUA 3FCVA 4KMOB 2F7TA 3MFHA 1HNZJ 1ZH5A 3DLJA 2FC9A 1L3VA 5HI7A 4UAYA 4B3MK 1NOYA 3JAMO 2JC0A 4PXBA 4JI7F 4EIAA 5DZ7A 5B0EA 1SV5B 3H46O 2H5XA 4PPXA 4ZJQA 1MU2B 3O1WA 3HL8A 1Y5LB 4EO6A 1L3UA 3FUYA 4EI2A 3B8AX 1Q5VA 3MCPA 1LWXA 1XR5A 3T3FA 3FZBA 5ALKA 1NOMA 4QS9A 3T6JA 4C48A 2ZF5O 4YDUA 1Y9OA 3IA0A 4AP9A 1SC1B 2GHPA 3EJMA 5BOLA 4JI3J 2MPUA 4Y2XA 3BF1A 1FWLA 2Z0GA 1H2UX 1WSVA 3KZBA 4E2FB 1WOSA 2DXEA 3CCSS 2WONB 2AEJA 4ZVEA 2BBEA 4M3YA 4LIRA 3WC2A 1U1RA 3V7KA 2DNNA 2YMLA 1MSWD 2XI2A 3AEVA 4NOHA 1O08A 3THXA 4NLTA 5C10A 2CNOB 4M5IA 5CXTA 1SH0A 1VQNS 4B9MA 3G25A 3OL9A 2IYIA 1AW0A 4P0PB 5THWA 3S01A 3W3DA 3DJCA 2BKNA 3IG1A 3F9KA 1VS3A 3OUYA 4TKTA 3OL7A 1JLFA 2E5LJ 5EGYA 4MO5A 5A6PA 2UVVA 3TQEA 4CJ7A 2KXHA 3WIUA 2DHSA 3WKDA 2XMVA 8RUCA 4M5LA 1LK5A 2IVYA 3TUPA 3TA0A 4Y34A 2A1AA 3K5MA 2DFLA 1X4FA 2HNZB 2DCUB 1D9FA 4LT6A 3MGIA 2EEYA 5IV4A 2O8FB 4OLOA 1OSCA 4N77A 4OJ5A 5ETLA 3P5TL 3H45C 2GIRA 3PIPQ 2VGMA 5AR0A 2JWNA 5D4BA 2FBYA 4AYBD 4CJQA 4CF5A 3R3TA 3A0HU 4HAIA 1O6XA 2ZH3A 1RBLA 1S10A 3NVKA 2JVRA 4PHTX 3V5RA 3I55S 1HQEA 1NGDA 2KW4A 3AOBA 4X62F 2FLOA 5KFXA 5HAOA 4CZLA 1OVQA 3HDSA 2P9LA 2E5SA 2HF4A 1JLAA 2AEFA 4BROA 1B99A 1YX2A 4QIWF 3HI0A 1ZQYA 3BGFA 2R2RA 4LFCK 2ZJRQ 1SUQA 4WK1A 1X40A 1CULB 4EU0A 3A5LC 4BXOA 1RM6C 2D0BA 1ZJNA 2ITGA 3THWA 2ATCB 3SR6A 5AQOA 4KX3A 1FFWB 3DDNA 1M5HA 1TV9A 5M1PA 3AAWB 3H8JA 1E6VA 1LKYA 1U02A 4NLKA 4MFFA 5BRDA 5A0YB 4XEIA 2JGAA 3M1VB 5AM1A 5A8KB 2CJ9A 3CCRS 2ZTCA 4M1KA 1NDCA 3SUQA 1FFGB 4J9PA 2HBKA 5AQGA 4C8ZA 4C3MA 4E7KA 4R64A 2HBQB 1CPZA 4DSEA 1B0XA 3BQ1A 2D7SA 2E5JA 2K4EA 2LYAA 4FCYA 3MMBA 4CLWA 3OYBA 1RCOB 3CI5A 1TKXB 5L8RC 3E1YA 2G08A 1Q7YT 3VQQA 1ATSA 1HNXF 4DUZF 3ZDEA 2I38A 2DNZA 3QT6A 4CM2A 1TKTA 4GV6A 5J1EA 3TP2A 3MWPA 4FJXA 1JL2A 2YI1A 1U8WA 4X64K 1UZHA 1GO3F 2RE1A 3QQCD 2XQCA 1KLNA 1UT8A 3OTOJ 1P27B 2WSEC 2M3DA 3JPTA 4B3OA 2MQLA 3SSSA 2Y0SD 2PA3A 5K20B 3VAMA 3OYMA 4ZK7M 4FZLA 3VF2A 2A2DA 1Q7YO 4IDHA 2MDAA 2P9UB 2AWZA 5ALSA 5A2QY 1NK4A 2IC3B 4B1WB 2N1RA 3ETOA 1RYRA 2HBJA 5KQ8A 4USIA 4KC5A 1S1TB 5GAHP 4I7FB 1WBBA 1SJ4P 2Y8YA 3NVYA 2AJQA 2NLXA 1RLDA 2CQ3A 1J6ZA 3HFKA 2EZZA 2HRYA 1Q7LB 2JHDA 2BPFA 4ER8A 4B08A 2ZUBA 3VR1A 2E3TA 1RDRA 1SKWA 4DX6A 2V2ZA 3L9ZA 1UMJA 2ASPA 3CC4N 4WQ5A 3Q89A 3L2VA 2BV3A 4TURA 1B4FA 5DKWA 1LXJA 3JTPA 5G5HA 2K60A 2RHFA 1Z2ZA 2K8CB 1B3TA 5J0UA 4UOGA 3I0RB 3TARA 1NJWA 3FZLA 1MA7A 1NGHA 3VQAA 3M6XA 2BXJA 4LF7F 1HI8A 3D2QA 3ZZZA 1RXWA 5AZJB 2WB1C 2CPHA 1TV6A 2XSJB 1TAUA 2NUUG 3OVNA 4BHQA 2ZH1A 2M88A 4CFAA 2D5RA 5GIOA 1TKTB 2DR7A 2XS2A 1Q79A 1YITN 2ZVIA 5AIBA 1ZBIA 2QZ8A 3QETA 1RTZA 2Q43A 2V67A 4QYRA 5JRTA 5LSRA 5ETTA 3CMAN 4IDKA 4P2MA 1ZM9A 1M5PC 3NCIA 2HOIA 1RWXB 2DRDA 4MDAA 4CEFA 1CJKB 4A4JA 4X4SA 3W5XA 2VG6B 5AFUH 3CETA 4HI1A 4Q45A 1URRA 5HR7A 1IIPA 4M47A 4NLBA 1J27A 3BBBA 2WF8A 2DWQA 4HHUA 5A8WA 3BUZB 2HEKA 4QIEA 1KVBA 1W2BR 3JAMU 1S6UA 2B6GA 4MIBA 4M6WA 3DLBA 4J90A 2MYFA 2YVSA 1CXQA 2KVQE 5T7LB 1PC5A 2VJVA 2E7WA 4WQ5C 4X66F 2HVIA 7ICPA 2HHQA 4HACA 3M8PA 2XY8A 1C2PA 3AARA 1R7IA 3M4XA 1GXTA 4GC7A 2PMHA 9ICKA 1RT6A 1V5IB 1M5SA 3AB4B 2IVPA 3M2RA 4KLDA 3QZ8A 4OYAA 2DBBA 3ZEUA 3BJYA 5A0YA 4JS5A 4X4NA 4YHHJ 5ALWA 1WC5A 2ZWHA 2HNDA 3V6HA 3CF5Q 3U8XA 4PG5A 3M5RA 3D5MA 3CC4S 3PW5A 4CEAA 5IIMA 2V52B 1DT9A 2RHSB 3M9NB 4PKIA 5ALPA 5J2GA 3BY5A 2HS0A 2GO8A 2CJXB 1HHQA 2I1QA 2P9NB 3QJPA 4M5GA 2E1PA 4ID1A 1KQQA 1RQ0A 4ZPDA 3UWTA 1XMQF 8ICOA 5LSOA 2Z8QA 1IKXB 3TTCA 3ZT4A 3M1YA 5IFMA 3ZSYA 5EE0A 1RHQB 4LSLA 1JJ2M 3KOOA 3KK2B 1Q95G 2Q3PA 1S59A 2UUCJ 2XNRA 3H4DA 1VQPN 3R2DJ 3B82A 4NA3A 2MKHA 2WFAA 4Y2AA 2LYVA 1NGIA 3EE8A 4Y2PA 2MGZB 4F91B 1KBRA 5BPMA 4ZIWA 1JLFB 4GIBA 4OJRA 2HDOA 5DG7A 4CIOA 1X4AA 3GIJA 1VBXA 4F4AA 1S9EA 3GTYX 3H7HB 1P7DA 5AM2A 3MHYA 4CLTA 4FNHA 2IM3A 1YIJS 3GFHA 2WB4A 2RPIA 4KJIA 2D1KA 3NGUA 2ZG6A 3V81B 4LF6F 2HNZA 4I28A 5ETNA 1HEKA 2AD9A 2MHNA 1A5WA 2VICA 4FJNA 4WFAQ 4X4UA 1HUZA 3PO5A 2HWHA 1FX4A 4DDFA 4B1UB 4PYDA 5E3RA 1YBAA 1H6KX 4N56A 4FVMA 1YGYA 7ICFA 4WE1A 4OZJA 2MLXA 4IZ9A 2ISOA 4DV6F 3NP5A 2ZIUB 4G9ZA 4KLFA 2IHR1 2WAQF 4JB3A 4JI4F 3OTCA 2K89A 4C8KA 4GKKF 5A2QO 4ZN1A 3N6MA 2ZC4A 1GMVA 4DUYJ 2XYHB 5EOYA 5G4DA 1BUPA 4NCGB 2AKWB 5CY4A 8ICYA 3NEKA 1ZPWX 2LSNA 1W26A 2DTUA 3AH6A 2GWSA 3AD8C 2XY5A 4MHVA 4DSLA 2QWNA 1IJFB 1DQAA 1J5EJ 4N41A 3D3BJ 4X4QA 3OFGA 2D0PA 3ZLJA 4YNQA 3IRWP 3P38A 2EK6A 1HYSB 6AT1B 4K8RA 4WJBA 3MDFA 3PIOQ 3BQ2A 2NPIA 3C2KA 1DXSA 8ICZA 1NPPA 3MUTP 3BF3A 2W9MA 1WN7A 4JI0K 4MQ3A 4CEEA 3ZDAA 1WSFA 2UUCK 3HLUA 1VC0A 1BDGA 4IC9A 2D41A 2HHHF 4GNIA 4JI6J 3HRDD 2KFYA 2LDYA 4R5PB 4ES3A 4X65F 2FE9A 2XCAA 3NAIA 3IR5B 2GJFA 4G65A 1HWIA 1S12A 2OSRA 4HH0A 3BGLA 4YORA 2WF6A 2DY9A 2OO4A 2GV9A 1XQIA 4UOCA 3EXYA 2CH5A 4KLUA 4MKBA 2CN1A 3O5TB 2PFOA 3UO0A 1RQNA 4R0JA 3CJ0A 4Z4IA 4O5CA 2V4JB 1KAZA 3RVCA 2HW3A 2OD4A 2DNHA 4CHPA 5KFTA 4FJKA 2DGSA 4CD1A 3PEJA 1QSLA 2UVUA 2J6UA 2CZVC 3E8OA 4CZJA 4KGMA 3UKRA 1F9HA 1PVPA 2ZBIA 2J5AA 2ZOGA 4YY3K 4KX5A 4B9UA 2SXLA 3ULDA 1N61A 3ONNA 5BYSA 4DX8H 3JS9A 2IOFK 5AI0A 1M0SA 1X5PA 3CCLN 4DFJA 2EK1A 4E7HA 4NA1A 3BS7A 2PXIA 4M5JA 1LB2B 1RT3A 1X31C 2UUAJ 2E2PA 3PIPL 1J5EK 1Z26A 2NYVA 1H2TZ 2BCRA 5JXSA 2VQFK 4AILC 1NZBA 1MLAA 1U26A 2X1AA 3L4PA 1B0PA 2MKKA 5IIIA 3M1VA 5J2DA 2HFVA 4P73A 3GYXB 2DB1A 4V19S 2DR6A 5IWAJ 1DGKN 4C2MA 2IM2A 9ICMA 1V3SA 1SKUB 3AAPA 2GTDA 4WP8A 3ATUA 3T5JA 3JSYA 4K41A 3TR8A 4IQTA 4QBUA 3KLHB 2IHNA 2Q36A 3SI8A 1TU0B 1OW5A 4RW7B 3CNQP 4GC6A 1FDAA 4I64A 4DLEA 4MEYA 2PAVA 5BN9A 1RT7A 2V0NA 3PYEA 5DQGA 1AB8A 4DR6K 1T05B 3CQYA 1IKWA 1FK9A 2G9OA 2EW9A 2V69A 2ZJQL 5AKHA 1IBCB 1OPZA 4LSZB 4ED2A 2P2CB 3PLAA 1V38A 4CK1A 2UUBJ 1D9DA 1ZXIA 4PL1A 2KU7A 4NZ0A 1S7HA 4F71A 2J0QD 2HOFA 3J80Y 3NCRA 1NJZA 4JV5F 1H0HB 1S4FA 2RDDA 2X51A 1FTCA 4A8FA 1RHMB 4WCEL 2GOLA 2BJ9A 3KZIU 2YHWA 1RACB 2Z58B 2C2ZB 1YVUA 1YK9A 3EDRB 4KPYA 1S9GB 3SDEB 1HBOA 2O1PA 1M5KC 1VK3A 4DJBA 2P9SB 2HIYA 2YMMA 1QQNA 1NK7A 3TWHA 4NM2A 1MA9B 2AU0A 4FF2A 1TL3A 3L3FX 2BCSA 4Y3CA 4USAA 1OVYA 2OEJA 2W1BA 2YWKA 3MXIA 1WWVA 3HP9A 1NSAA 1PYOB 1AZSA 3ATVA 4OIXA 2L3MA 4PCQA 2P5OA 4DR6J 2ZOMA 2E2NA 4F25A 5B08A 5IT0A 1OSDA 2DH9A 2W2MP 4BE1A 4UUWA 3PRVA 8ICMA 4RNNA 2VANA 3LGNA 4OJLA 2H51B 3PZPA 3NGZA 3QGPA 7ICGA 4CFBA 4PL7A 3CUNA 4LR8A 2O5DA 4DV1F 4H4MB 1VSKA 5CE3A 3E01B 1XO1A 4WYBA 3MX5A 3QBWA 4DR1K 3KOAA 4M9GA 5DG9A 3FNNA 2FSJA 1SI9A 2YJFA 4O5EA 1KAYA 2M0GB 3ASMA 4YQWA 3K2YA 2ZXHA 3FRYA 3BB5A 3C65A 2ZOFA 1UWBA 3ZSQA 2VASA 4H5WA 5AT1B 2I5HA 2XYPB 3VF6A 4B1YB 1MC8A 5IOLA 1V97A 4Z6FA 2WF9A 3NS6A 2FTRA 4R65A 4KO0A 4G9BA 3IBFB 4ZCLA 4B3MF 3H90A 4EX6A 1KDNA 2VG5A 3M8SA 1Q82O 4BY9C 3RAMA 3J7A1 4ED3A 1EAYC 1YITS 1YRXA 2V4JA 4DQRA 2HBYB 4OHWA 3VQSA 1DZ5A 4CM0A 3SD7A 5M1NA 3E66A 5KFAA 5F8GA 2V9WA 1B4SA 3W2WB 5JS2A 4JYAJ 5BRHA 2FJEB 2H48B 2M7SA 4Y0WA 3LL3A 4JK9A 4GMJB 1HIWA 2QA1A 3QU2A 2YQ0A 4CFDA 4IO8A 4GXKA 4EELA 2VBZA 1YVFA 3RJKA 1HNXJ 4BRLA 4DUZJ 1X3NA 2ZGYA 1JMSA 3D1OA 2LMIA 4LFBK 1KRPA 1EX8A 5IZHA 2RS2A 8ATCB 4HTIA 1N6QB 4ZP6A 3MABA 5IT9O 5KGXA 2V8PA 2HIQA 2KG0A 2CPYA 4QU6A 5FRMA 4RW9B 5AQRA 3R9KA 2CPEA 4NLDA 1IBMK 1PKUA 3NMAA 2KM8C 2MKSA 3B9JA 1XMBA 4ZCMA 2LXUA 1WC4A 2JH1A 2K7JA 4F8RA 3CJ2A 1NK8A 3UKRB 3MMCB 4LFAF 2IJRA 3C19A 3MI7X 2FPKA 1NK9A 2MJNA 2DGUA 5LOQA 2DYAA 3IAS9 1U2RA 4OYZA 3MM9B 3HHNB 4PABA 4IRKA 2IM1A 3GSIA 3A1YG 3LPYA 3DLKB 1VBKA 2W3SA 1ZQUA 5BREA 5LT5A 3NGKA 3H20A 2XICA 3SUPA 1CEZA 1GNKA 3E3XA 5D3GA 3SQ4A 2BPGA 4RBVA 3LPUA 2HNYB 3RB6A 4FDFA 4EEKA 4F5OA 4C4SA 1NI3A 1C1CA 3TR5A 1IBLF 2FBXA 2MKCA 2KDOA 1PAEX 4KLEA 4LVNP 1HIYA 3AQFA 3NBPB 1TKZA 1HKBA 2CQ2A 4PXEA 3AVNA 1ZBSA 2DNGA 2Y1IA 4PPZA 4RW7A 4FO0A 4U9RA 3HW8A 4BE0A 2CQ1A 4KHPJ 4H0PA 1QVGM 5JUMA 1FJ7A 2RNEA 5E2QA 5G5GA 2XG8A 5ALDA 5KG3A 2V7ZA 5ALHA 4CF2A 3JYTB 1FK9B 4PYAA 3H8WA 5J2PB 3ZCMA 2V8VA 3QEBZ 4Q2LA 2C28A 5CYQA 2WVEA 3TX8A 4ZS6A 2IJNA 5KG2A 3HBTA 5A0LA 4O0IA 3J80U 4OZNA 1CC8A 2G4BA 2VWBA 3RTVA 4I2BA 3AQOA 4B3TF 4RQ2A 2W43A 2WAQD 3H5YA 3O3GA 2Y0SF 3D4JA 3OY9A 4P7VA 2Q0RA 1IKYB 3NNHA 4RW8B 4F50A 4LZDA 1FVQA 4MTPA 1DK2A 4K59A 2YHBA 4UAWA 2V34A 2AV5A 3BPSP 3FFIB 3UQSA 1U6BA 4X66J 3KDNA 4PWDB 1Q8KA 2KKHA 2KIWA 3L2UA 2JSXA 4KN4A 4BX9C 4KSEB 4WFYA 5HMMA 2K8BB 2E88A 4FYWB 5HMLA 5LMNK 3JPRA 1YWXA 4FZNA 1VLYA 2QFJA 3CPWM 4WK3A 3OW2R 2QGFB 3MF5A 1VRTA 3E0FA 8ICHA 5TZVA 2N82B 4ZPBA 1MN8A 3JPOA 4YHHF 4DHYA 1JROA 1U4BA 4AYBC 2MB0B 3AT1B 1KVIA 2VQEF 2QARA 2HHSA 3D2SA 3OYLA 3W7BA 4NLZA 2R7UA 2HQCA 4RX6A 1Q8IA 1KEJA 1GTHA 3SJHA 2HRUA 3J8AA 4DR3J 1N33F 4C7ZA 3MPVA 3TUIC 4CTAB 2V2VA 4CWBA 2YB4A 4DV2J 3Q2SC 3NS7B 3C6UB 2A40A 3HXMA 2LDIA 3C1ZA 4I2JA 1Q1KA 2DO0A 2D0OA 2X7IA 4IQWA 3AA4A 3IMXA 3L09A 1Z19A 2QK9A 2YKMB 1NU0A 4BDYA 1G15A 3MCOA 5HMZA 5D0GA 2FXUA 3MEEB 3QXGA 3IFEA 2DGTA 3RJFA 5KFKA 1GXUA 3R9LA 2R8KA 4PGQA 5GAEU 5DDPC 4W5RA 2IC3A 1FD8A 8ICFA 3VWSA 4ED8A 3HULA 4CHOA 1WELA 2F1FA 3ISCA 5ALGA 1U7LA 3NVZA 3IM9A 1A77A 3HPOA 1TK8A 5DS7A 2Y9HA 4H4OB 2KVSA 3MPUB 2IS3A 3VGSA 2WTFA 3FZFA 5MLCQ 3DLGB 2VL1A 3BGRB 1E4FT 2HK2A 2HFZA 4AE5A 4ZVQB 3I32A 1HI0P 3HP6A 2HMPA 2DR5A 3CFPA 4DV6J 3TAMA 2HVEA 4BS2A 5IIOA 7ICTA 5KPTA 4FJMA 5C0YA 3W3SA 4JRPA 2HQGA 3I33A 3G2XA 4OFZA 1WCLA 4QZCA 1EKRA 4P9SA 2OPPA 1TL1A 5AQUA 3T1YK 7FDRA 3M7VA 1P8GA 2EANA 1JLGB 3RMAA 2Z2MA 2GZOA 2QB1A 2RU9A 5F41A 5LMUF 4LBHA 4B8CA 3Q8YA 3TW0A 5ALLA 3V4IB 1HPZA 3F2CA 4WTYA 3NE6A 2P51A 3FMBA 1VHXA 3QUTA 3CTRA 5GMDA 5HBMB 3PO4A 3F5EA 3K58A 1LAVA 4A61A 3R3LA 2BOAA 3I76A 3MEGA 1BQMA 2W6KA 1K6YA 3I0SB 4QAGA 2BW2A 2XI3A 1VGYA 5KG1A 2VGNA 1IV0A 5CWRA 2V63A 2HHHJ 1T9TA 3NHGA 1DTTB 2ZC3A 4QZHA 2MQNA 4MH8A 3ENAA 1SL1A 2E8AA 4L3KA 2DIVA 5DB9A 4FS1A 3QAEA 4O0NA 1WSEA 2DD8S 3MZIA 2XI9A 5J8YC 1IV8A 1BO5O 3JAMY 2XB2D 2W01A 1U8SA 3D6HB 4IXCA 2XY7A 2B8PA 2QMUB 4QZIA 4FS2A 3A3NB 1CI4A 3C2PA 4A48A 2W25A 2Y0SC 2K8AA 4MIAA 4ECUA 3A13A 4USVA 3VQCA 3BZCA 4UATA 3SAGA 4BRQA 2D0AA 1BOTO 2BCUA 4FFDA 4F3QA 4DPWA 3CC7N 1U1MA 3BS5B 2NXJA 1RT6B 2CG4A 3P31A 4OX9J 3QICA 3FFIA 1BUXA 5I3PA 3ZETA 5L1MA 5KQDA 5AQKA 2W40A 1TL1B 4RW8A 4NLUA 1JLGA 4KHQA 5DDYA 3CM5A 3CPWR 3THXB 1FEZA 2EX3A 3G6VA 1ATNA 1RWKB 1HNIB 3K8WA 1ZA1B 5KRTA 3SQOP 3CSKA 3G6EN 2FBVA 1N32K 5IWAF 4E98A 4K2XA 4LF8F 4FF1A 3ZX2A 2AX0A 3R9PA 1RAHB 2EKNA 2DF4B 1ZQ1C 1FO4A 1UPPA 2YX7A 4YVZA 4JV2A 3O9TA 2NXCA 1OS5A 2FYXA 3JQMA 4H03B 4K4ZA 3PW7A 3CCMS 4C7QA 5IC4B 1Y4ZB 1NJIT 4PKGA 2CNLB 3UXOA 2HFOA 2BJDA 1T4GA 1SB3C 3CC2S 3O1LA 3FR0A 1RAAB 1S79A 2K2PA 9ICEA 3MUMP 5AK4A 1S0MA 3UKUB 3N7PD 3NNAA 1JJ2R 4OZ0A 1P9YA 5E3QA 2A6AA 5J2JA 4WXWA 4M0AA 2CPJA 4AHRA 4CO4A 1LFWA 2LECA 3AJ1A 1EQMA 3PMNA 3I56N 5KT5A 1EQYA 4UARA 2DGXA 3NH1A 3RAXA 2P9KB 3UPQA 2I5JB 1KC8O 4J5OA 4RNMA 4NX9A 3ENBA 4UB3A 1XSNA 4EBDA 2VPXB 2KD1A 2CUYA 2Z1HA 1MWMA 3QYPA 3NS1A 2G2ZA 1RP5A 1ZD5A 2O8FA 2G8UA 2KJ9A 3NG8A 4WJ3B 2F9TA 5M2PA 2DUYA 1RG6A 1ZAVA 2A3VA 3JQKA 1SQGA 3VEOA 1KVAA 4CCHA 3U6FA 2VDIA 4AD6A 4WIQA 4KHPK 2OPRA 1DOQA 2NO5A 5IINA 2E8MA 2AZ1A 4FYXB 4RWWA 2D1CA 2ZZNA 4DU8A 4OPKA 1RTIA 4B3SK 1TVRA 3W9IA 1HJOA 2QWLA 2Z2YB 2Z2LA 5J2NB 4Y2MA 1A5XA 3IDHA 2PI5A 4J2DA 1TZ0A 2CJBA 3M8RA 1R31A 4U8YA 2CPDA 5HK4A 4FZXC 4ISEA 1KBUA 1B43A 3LOUA 4ES2A 4A8QA 4B3RK 1PAUB 1NPKA 2AXTU 4ZA1A 1VQ7S 1Y10A 1WHWA 3O3LA 4K5SA 5EVZA 1IBKK 1U9LA 4ID5B 4OI6A 3CC2N 1RAGB 4JI3F 3QFWA 4YUDA 3L3VA 5KOXA 3NXZA 4XIUA 4DR2K 1LEOA 3D7EO 4KPCA 4F4YA 2Q3SA 4CI0B 5LSLA 5CB1A 3W66A 5D6GA 4AUKA 3OT9A 2ZD1A 4ELVA 4E7LA 3G82A 3WK5A 8ICEA 4CJUA 2JEJA 1IXRA 1NKEA 4W5TA 4LF9K 4WYWA 2JWKA 4DV4J 4KV8B 4U7BA 3TJ9A 3AM9A 2DNPA 4JOUA 1HYSA 1FRLA 4H8KA 5L1KA 2Q79A 1WSJA 4V19J 2LLZA 3GU3A 3RH6A 5KG7A 3OV7A 4ICAA 3ELHA 3BO4A 1NGAA 2YXLA 3IG1B 3MR3A 4NMLA 1H73A 1ZQMA 4B3TK 1UFWA 3V1QA 4F4ZA 3M2UB 2HVZA 4HTLA 3V9ZA 3BS9A 4KKOA 3CD0A 2UUBK 4PWWA 3MR5A 2ODGA 3A4TA 1NNEA 2OYYA 2KV2A 5IT9Y 4M9NA 2FSKA 2G2YA 3THYB 2VJ5A 3DGVA 1F5CA 3KLHA 4LSNB 5D3GB 3BO3A 3UNGC 4IG0B 1TL4A 1RDCA 2W9BB 5CD4H 4WCEQ 3SUOA 5D77A 4CBUA 4LSLB 4RWXA 1NK0A 3MAAA 1KKHA 1K0VA 2WB1F 3T1HF 3ONQA 1VQMS 5GIPA 1HYVA 3A0BU 4KTWA 1DRZA 2QI2A 1YJNS 2CGKA 1NWKA 3QEVA 4PKDB 2PSZA 4NM1A 1IBLK 3W9JA 4DTPA 4WFXA 4DU1A 3LGHA 1S8OA 1XHXA 5ALOA 3MFIA 3IC1A 4WP9A 1YBTA 1HNZK 2FVCA 2HSEB 5KFZA 1YTAA 3BKTA 1LKYB 4X66K 3IHQB 3VCDA 5HL7Q 3H0PA 2UU9F 3FBFA 2Q1LA 2ZIUA 2WFBA 3AY9A 5T7LA 2W2NP 3N6NA 2HHUA 1EJ7L 2CVIA 1VSEA 2IA6A 3SAFA 3O4NA 1GMUA 3ID6A 3S6EA 1GEHA 2DCLA 3Q8PB 3PY8A 3LM9A 5IIJA 1QVFR 1X66A 2RDJA 3KK3A 1F3FA 2ZQBA 1T05A 3W1YC 3M32B 4QIWD 3TKAA 4DXLA 4O8KA 1B7FA 2O4GA 4BJQA 2XLJA 3J7AP 3KLEA 1SJ1A 1VJQA 2Y1LB 3T7ZA 4M5DB 2AEMA 4E1JA 1TKXA 3PSFA 5I3QA 4LF9F 1JLQB 1HJPA 2HMIB 4DPTA 2LYBA 3OTOF 1V4TA 2EHGA 4DS4A 3QIDA 2DKZA 3RJJA 1GXLA 1RTDA 4ZCKA 1FFVA 2KO1A 3MECB 2CKWA 2E2OA 3AV9A 1RT1B 5J2FA 4DR2F 1NDKA 4CBXA 1VQMN 1FNMA 3DGPB 1KFSA 1MMDA 4GLXA 4PR6A 2MY7A 4ZN3A 5F9NA 3CCUN 1ZTTA 2GO7A 4K4GA 2ACYA 3MDQA 7ICQA 4QOTA 1VDVA 1N5SA 1UVJA 1GLDG 4IG3B 4DTXA 3QUBA 2F4FA 4H5NA 1CG2A 5HHHA 3JSBA 2B4JA 4Z4FA 3BP8A 1WOOA 2FPLA 3T1HK 3C3LA 2UXDJ 4J9RA 4I4BA 1XR7A 3Q8KA 4IRCA 3MM9A 2W55A 2MHEA 3B6BA 3R8EA 1WF2A 5J0PA 3RSEA 1F0MA 2ZH4A 2ZBCA 3O08A 2AP1A 2P9NA 2KFNA 2GH1A 5L9NA 1BCMA 4GVEA 2PA8D 4Q7AA 2J9EA 2MLYA 1A9NB 5SWMA 3GIRA 2DNOA 3I5BA 4BGBA 2CNNB 2FB0A 4EFAC 4H5VA 8ICXA 1Y00A 7FD1A 1NGBA 3TOQA 1EETB 1Z6RA 4I0WA 3DXKB 2DKOB 1K8KB 2HMXA 4CIGA 4EWTA 4K4XA 2XGQA 4A8KA 1FKAF 4L6V3 2VBXA 2DBYA 1ZZFA 2ZM6K 1RT4B 3NBPA 4WU3A 1TUVA 3GYNA 3VHQA 4QW9A 2QYGA 2FGCA 2O8EB 4I2HA 1FEEA 5FJ4A 5J2QA 2PE8A 3AVKA 1ZZNA 3MTKA 1DY3A 1LW2A 2L9WA 1K47A 4DR3K 2KN4A 1BG3A 4QZFA 1BL3A 1J9AA 1EP4A 2P9GA 5D4LA 2JNJA 3E58A 1IG8A 1SXLA 2IGIA 3OFHA 2BE2B 1HMVA 1YSJA 2AJ1A 2EAOA 3DLEB 2O67A 1ZQXA 5E5NA 2L08A 2XBPA 4CVNE 1TYQA 2BVZA 1HARA 2F2AB 5GMKa 5FDLB 3GDXA 2HF3A 3FEYB 2P6SA 3LWMA 1WEXA 4DFKA 2HZAA 2LXFA 5AQVA 3CT9A 4U7UK 3IWXA 1X5TA 1RUSA 2ZUDA 3C16A 3TI0A 3I8DA 2YKAA 2Z1JA 4H5TA 4QS7A 1N6QA 4QZGA 1M6YA 3OR2A 3Q23A 1Z4NA 2G0IA 4P75A 1VRQC 1R6VA 4UY8T 1D9AA 2CNKB 4JK7A 1OYDA 4CQ1A 3ICLA 3KJFB 4I6YA 4ZVPB 4QIWC 2E66A 3DOMB 2OYQA 3POTB 2VIHA 2ASYA 4LH4A 3DOLA 4X4OA 5L1IA 1VMBA 4TY9A 3VV2B 2XZWA 1WNSA 3CDWA 3K57A 1XUPO 3OTQA 1NNDA 1BPYA 2K3KA 3H2VE 4UBCA 1FRMA 2ALZA 3MEDB 1C4AA 3KG1A 2J0SD 3DN9A 3F5TA 3BM7A 4NRTA 4H4KA 1RYSA 1M5VC 3SQ1A 1P1LA 5GTHU 2YB1A 2HURA 1RTIB 4QJVA 2EFNA 3P5JA 3WC0A 2WCXA 1NEEA 2HMIA 2P9IB 3N4PA 3FSIA 4DV3F 1FE0A 2LQ9A 4WU2A 2B3TB 4CHZA 1NHUA 2R7WA 5GADU 1CRXA 3LK9A 1FIQA 4H5RA 4LF6J 3NTUA 4DOCA 7ICLA 1RCHA 4FM2A 4PRFA 5ALEA 2AX1A 3R5GA 4QWEA 3IN5A 1HQ2A 3QNWB 2HLUA 1SQKA 4JKAA 4J2BA 2HGMA 4DR1J 3H1QA 3PVXA 2OELA 3GILA 2HVDA 1RDBA 3UXNA 1S76D 3I5CA 3C16B 4OX9F 2FLLA 3VQPA 3RW6A 2ZDPA 3MN7A 1KTVA 4DPOA 5EXWA 5ALXA 4WWSA 2OMOA 4O4RA 4GKKJ 4PA1A 9ICCA 1XJWB 5AKXA 4DUYF 5C2DA 4Y65A 3CDUA 3QEXA 4DPYA 4A59A 5J2PA 2E7VA 2HQDA 2JC1A 5F1XA 1N36F 2RUSA 3KWGA 4IOBA 3QUCA 4F72A 4DG1A 4EFHA 1EIYB 2ETJA 4YN3B 4FVCA 2P9PB 2DNMA 3L7UA 2BHNA 1IXKA 3F44A 1D8BA 1EETA 2LVWA 2Y1RI 4F26A 1WSHA 4EHTA 3CHWA 1NJXA 1HR0F 5CYMB 4BLGA 3C1YA 3M2UA 3KIOA 5HO4A 3AO3A 3AJDA 4YFUA 3HZEA 4MLHA 4BQZA 2E7XA 2QWPA 5K4LA 2LKYA 1X4EA 3ZX3A 2CQDA 3E9PA 1NHKL 3M8WA 4W92B 1BXNA 5HLFA 3CIMA 3CJAA 1OPIA 3KZXA 2YMQA 4M3WA 1OIAA 3W2VB 2RN2A 5JICA 1XWLA 1JLEB 4CNQA 5G0RA 5AE3A 4H4OA 3GE9A 3OVSA 1CQNA 1VQPS 4LMZA 1H2VZ 1FNOA 4AL5A 1ZQPA 2XNQA 2DNRA 3QO9A 3NKYA 2WHEA 3H2UB 4MF2A 3EKUA 5AQIA 5DZ6A 1KCFA 3SCIE 2VIXA 2DJWA 3UMCA 3B4DA 1RTJA 3I82A 4CF0A 4Z7CA 4DTRA 4LJXA 5AFUA 2UXBK 2F9DA 3M30A 4OLAA 1IUJA 1FJGF 3LA0A 2KZZA 4O3SA 4F2SA 1TFWA 5D4OA 2ZD1B 4EAHD 5F0UA 3C6TA 2KVIA 3H5SA 2OTJS 1M1GA 2F8KA 3BF4A 5I9EB 1RB0A 3QRQA 3DXMB 2ZH5A 1IVZA 1YJNN 1OY6A 1QE1B 3VAJA 3W61A 1QZ5A 3RBDA 3OSPA 2AMCB 1WI8A 5J1PA 4IWVA 1B92A 4A47A 9ICUA 2QWMA 2ITMA 3W62A 4JI0F 4E0DA 4YG2A 2ZHOA 1RAOA 4ES1A 2F1JA 3DRPA 4FM1A 3TJAA 2C3MA 2KG5A 4MK8A 1WC6A 1OUQA 1D8ZA 2JZ5A 1HWKA 4OX8A 3W65A 1N0UA 4KGKA 4DL7A 1ZQLA 1Q46A 2A2CA 4JI5F 2DNQA 1TMJA 4WQ4C 3DXKA 1LWCB 3LPTA 1K8KA 2VFVA 4AL7A 4QR2A 3CMQA 1VQ4N 2F5GA 3CJCA 4CJ3A 3F41A 1S57A 1PG5B 2O8BA 3HM8A 1ZAXA 3KKAA 3ALYA 2XYGB 5KT7A 4UY8O 3KUGA 5EE9A 2E1MC 2VFSA 3MPYA 2R2TA 3F2KA 3AVCA 3OTOK 1UQVA 1N0VC 4NWIA 2P9IA 4DU4A 4M9LA 4PWUA 2XCPA 2R7YA 2PY5A 4U67L 1I1GA 3J7AN 1OQ3A 3GFKB 3AVFA 5AM4A 1FE4A 3WIVA 4EMDA 3DRSB 1BA0A 3GCWP 1VRTB 3OXGA 1B0TA 1SC3B 1S1WA 1PYTA 1WWUA 1RT2B 2VC0A 4JS4A 3RMDA 3MEKA 4L75A 3B4MA 1XEZA 5JVGL 2E1RA 2YY6A 2I8EA 2R4FA 3IWLA 3FKBA 4Q44A 3QT8A 4CLSA 4BRHA 1C0UB 2EG1A 4L3QA 1GTEA 8ICKA 2AJ4A 2KT3A 4DV2K 1K5OA 3CCLS 5F3XB 7AT1B 4DOBA 2R8JA 2FJVA 3EN9A 1BIZA 5DG8A 1FKOA 3AGKA 5KG5A 4CI6A 3ZDBA 1BLUA 1IN0A 4USWA 4ZVTB 4LRDA 2I9SA 4DR4F 5GVQA 4MFAA 3PW4A 3HKZD 3R6MA 4OYXA 2FC8A 3ZTPA 1W97L 4Y2SA 1QAJA 1VIOA 2VQFF 4R79A 5GAHU 3THPA 4DR5J 1AQ6A 3TSUA 4ZTJA 3N7RC 3WKEA 1QTMA 4LBPA 1HBNA 2QA4S 3LVWA 2UXBF 4JAXA 4W5OA 2AJFE 1UEUA 2RQ5A 2LEAA 2O4IA 3N01A 1SZ2A 1RU2A 2CXEA 3C8YA 1VBZA 3R97A 1ED1A 5KFWA 4ZHRB 2HBZB 1OMSA 3JSRA 2EFQA 3CDEA 5F8MA 3T9NA 3VETA 2RRNA 4IQXA 1FF2A 3D6MB 1UA0A 2O66A 1YBUA 3LAKA 2I6WA 1REGX 3ZSVA 3H1VX 3N7SC 1PILA 3B0YA 5ALVA 4CZIA 1FTRA 2CJAA 2EKYA 4BC5A 1MROB 2P5GA 2BANA 3D0HE 3D1HA 3EE3A 8ICPA 2F77X 5J2MB 2IM0A 4CGIA 2YWEA 5B0DA 3KJVB 4Q5VA 4C8OA 5C24A 1N8RO 1Z1VA 1D4XA 3MMAB 4X2BA 3N0VA 5EU7A 2P9EA 3WK8A 4QZBA 1W7AA 2OHFA 2R42A 1L8LA 3FQLA 2ILYA 1HWUA 3KHGA 4OMFG 3OYAA 3QEPA 3FGVA 2QMXA 3NRBA 1LV5A 4JI8J 2ZGZA 5KFFA 4C3LA 5CABA 3L95X 4GY2B 5HLFB 3UDEA 2ABYA 3MM7A 3V7JA 3B6PA 4F4WA 2V50A 4JD2A 2H5EA 3M05A 2FZKB 4XQ8A 4IKFA 1KQFB 4UT4A 4LSNA 2Q2RA 4HTUA 2DHXA 1NHVA 5IV3A 4LFAJ 4RT3A 1U1LA 4PQUB 2OIHA 3VAGA 3FCHA 4NYZA 1A5VA 2RU3A 1AUDA 3VA3A 2VOPA 3UQ2A 2PKEA 3N97B 2AGOA 3DOKA 1TGOA 4CEQA 2LHTA 3P1GA 2VKQA 2CQPA 5HP1A 1DHMA 1VHFA 4I7FA 3NUQA 5AK5A 1C0FA 1CJKA 3QAUA 2CPZA 2ZIWB 2WVCA 5L9XA 2F8TA 2N7CA 2I7PA 2FHMA 3R5DA 1RYUA 4CECA 5KFVA 4C4TA 1JALA 4J37A 1IKXA 4ANEA 4JKDA 3RAQA 2J0XA 3QB0A 3GJQB 2JLEA 1QH9A 3TNVA 4PUOA 4TY8A 1KL9A 3CJ1A 4CTAA 3ZX0A 3CD6N 1MWKA 1Z1BA 3PJWA 1ELOA 3KJVA 5AM5A 3H5XA 1QE1A 3M8PB 4HACB 4DFMA 3SBMA 4DV0J 5AK3A 3V7LA 3K17A 4TVAB 5GAEI 2A6OA 3CNHA 1SQEA 2ZJRL 4DQIA 3BSOA 3BEXA 4BGAA 1XNRF 1ZQAA 2EVZA 2OI2A 2G13A 3T1AA 3IM8A 3SJJA 2P5VA