2HW3A

T:o6-methyl-guanine pair in the polymerase postinsertion site (-1 basepair position)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*T)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hw3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hw3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hw3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hw3A01
5CZ1A 8ICQA 4HYKA 2YNIA 8ICCA 2H5XA 4YMMA 2OPSA 3H4DA 1QLNA 1HYSA 1QTMA 4XRHA 3QO9A 5F9NA 1L5UA 3NGIA 2W9BA 4X5VA 1ZBLA 4FW1A 1K1QA 4CJKA 2P51A 1BVSA 1S9EA 4J2EA 1U04A 4RG8A 1WAFA 3DLHA 3VQAA 3OYEA 3T5HA 4YR0A 2DPJA 5KFSA 7ICLA 3B0XA 3BGRA 4IG0A 3S9HA 5KG2A 4UBCA 1BCMA 4TUPA 3T5LA 2G8VA 1ZQLA 1UT8A 3AO1A 2PFQA 3OYDA 4RQ4A 3EZ5A 2D0CA 2FBYA 1BI4B 3ZDAA 3V7LA 3D0PA 4M6WB 3GDXA 3RJHA 4DFMA 3TAEA 2XHBA 5KFXA 1C1AA 4ED3A 5L1LA 1NK0A 4E7JA 3HW8A 3MDAA 3SQ1A 1NOYA 4J9QA 4B9LA 4CEOA 2G8UA 2YHAA 3AVMA 3SPYA 4PY5A 4DL5A 1A77A 1XSNA 2W9BB 2I9GA 1J53A 1YTUA 4QZDA 1EXQA 1HUOA 3QNNA 2BPGA 1A5WA 1Z26A 4I2AA 1BISA 4F93B 1Q9YA 3TFSA 4CGJA 1RILA 4JLHA 1T03A 1LAWA 5KFKA 1RT5A 1NKBA 2HNZA 2BCSA 3LP3A 9ICXA 3BQ1A 4JS5A 3L2UA 4DTRA 5D3GA 4F2SA 3G6VA 2NRXA 4FJ8A 4HTUA 3ZSZA 1CUKA 4YXMA 2OYQA 1Q8IA 4CHZA 4XA5A 3CFOA 2DPIA 4FZYA 2B21A 4Q0BA 3QNOA 3H8WA 5CP2A 1JN3A 5C42A 4KV8A 7ICQA 1C7YA 5F9LA 4UQGA 4XIUA 4IDKA 4PHDA 4IFYA 4F5PA 5DB8A 8ICEA 4IG3A 4DQIA 3EPGA 4KRFA 7ICTA 2KZ3A 2YKMA 1MC8A 4FK0A 5DG7A 4DSFA 1IXRA 4KITB 4F5OA 5KFRA 5T7BA 4F4XA 2OPRA 3MR2A 4CK1A 1LW2A 4KLDA 3JPOA 4NM2A 5KG0A 1BPYA 3VA0A 2HVIA 2HHTA 5K14A 8ICXA 3VQ4A 4C8MA 3LANA 4M3TA 4C8NA 3K4GA 4B9VA 4QAGA 4GXIA 3HM9A 4Q8FA 3QERA 3RB6A 5DG9A 4Z6DA 5DB6A 4E7LA 3NF6A 4I2PA 4CEEA 8ICJA 4QZEA 3V1QA 3ZT2A 2IS3A 3HPOA 3OGUA 3HYFA 3I8DA 3PX6A 4O5CA 2C22A 5J0OA 4F91B 2Z1HA 3QEBZ 1N56A 3LZIA 9ICEA 4I2BA 3MXIA 4JS4A 3KKRA 4KLMA 1CLQA 4E19A 3C2LA 4DSKA 3LZJA 2F8TA 2AGQA 4BE2A 4Z4IA 3NTUA 1YTAA 4FLUA 8ICLA 3ORYA 4UAYA 1ASWA 2Z1JA 1RZTA 4Z0UA 5J0YA 1QS4A 3C2MA 3MFHA 2V9WA 3K58A 4CIFA 3SV3A 1JLGA 3MXJA 4GW6A 4FJLA 2ASDA 5KT5A 9ICNA 3OYJA 7ICMA 4KHWA 4QZIA 2XY5A 3NH2A 3QEAZ 3OYIA 3DLEA 3H4BA 1N48A 4KLTA 1WSEA 5CR0A 3MEEA 4F5QA 3C5FA 5I42A 3NGDA 3BQ2A 4KHUA 2FPKA 1WAJA 3M8PA 4PHPA 4ECYA 4YNQA 1S0NA 4LY7A 4KMUA 2A1SA 1A76A 4KLIA 3FFIA 3CM5A 5J2EA 1JL2A 3RH6A 2QK9A 1WSGA 4PGQA 4UB4A 3VQDA 1C1BA 5EWEA 4IR1A 3QEXA 1LV5A 4ECWA 4DFJA 3AVGA 1V9PA 4M9LA 4B8CA 3KLGA 3KD1E 4DWIA 3HPHA 3V6DA 3PR4A 4H8KA 1RT2A 1XSLA 4J9LA 1A5VA 5HRNA 4TQRA 3E2EA 1D9DA 5IIIA 3ISDA 1JLFA 4P4MA 5CB1A 1U4BA 3TQ1A 3NGYA 4E89A 1G15A 2IA6A 4LZDA 2DY4A 3RR8A 1RBRA 4EP4A 2YKNA 4YN4A 4EEYA 5KFWA 5KG4A 1BL3A 3KHHA 1JMSA 2RDJA 1HRHA 1VRTA 1TL1A 2M9NA 5SWMA 4JV2A 3IHQB 5DB7A 3NH0A 1TGOA 3L2RA 3LP0A 4M3WA 4Q5VA 1RTHA 1ZQXA 4RNMA 2V4RA 3SCXA 2Y1IA 1BQMA 3NCIA 1HJPA 3ISBA 3RWUA 1L3TA 4FJGA 4K4GA 3WNEA 3G6YA 4Y1DA 3FYHA 7ICJA 1VSDA 4FZXC 1ZQQA 1MU2A 1EP4A 1WSHA 4UB2A 7ICSA 2ZQBA 1DTQA 2UVVA 1DOQA 7ICEA 1VSFA 3L3VA 1T05A 5DQGA 1JLQA 5FDLA 7ICVA 3KLEA 2PY5A 8ICYA 2KW4A 3H7IA 2Z1GA 4CEQA 5J0XA 3K5MA 5J0QA 4CK2A 3Q8SB 3HO1A 3NFAA 4G1QA 3QINA 3KTQA 2BPFA 4RUAA 1HNIA 4KAZA 2O4GA 4W5OA 3PNCA 3C6TA 5J0WA 4ELVA 3MR3A 2P5GA 3ZSWA 2W9MA 1NK7A 4CJTA 1C0TA 1RTJA 2A1RA 2YNHA 4KLHA 3V6KA 4ECVA 3JPTA 3SPZA 2IAJA 4KLFA 3NBPA 2E4LA 3DRSA 3VQQA 3M9NB 4PGYA 4YMOA 2FC0A 3DLGA 2EX3A 3RBEA 5IIMA 2ETJA 2HNDA 2IHNA 4YCXA 4OGCA 2X6SA 7ICUA 3VA3A 2I1QA 2C28A 1RXVA 4I9LA 4GVMA 2JEGA 4FLXA 3GQCA 3OS0A 4F2RA 4KB1A 3H08A 3ZT0A 1UA1A 4OPKA 4CFCA 1QSSA 1ASVA 3V1RA 2ISPA 4B3OA 4F4KA 4K4IA 3TFRA 3RAXA 3KIOA 9ICSA 5KFGA 4Z6EA 3UQ2A 1ZQHA 2ZUBA 3Q8KA 9ICFA 4I2GA 1S77D 4I2DA 3ZSXA 4AHUA 3AVIA 5HHIA 1VRUA 3SUNA 4RW8A 3OYMA 5KFCA 4FXDA 3KLHA 5HHHA 2GV9A 3QIOA 4IR9A 3KK2A 1I39A 2GBZA 3LK9A 5KTQA 5IILA 1ZQEA 4DEZA 2HW3A 2HHXA 1ITGA 4O3PA 3C94A 4OLAA 9ICJA 1ZQIA 4GXJA 4F5NA 3V6HA 4B9TA 3F73A 3AU6A 4LD0A 2BCVA 5KFNA 3PMLA 4DOCA 3FDSA 4I28A 4MFAA 3SJJA 1HYVA 3O3HA 3TR8A 5L1KA 7ICFA 2ZD1A 1AROP 3Q8PB 3RJJA 4K8XA 2R8IA 3SUOA 4MFFA 3AVNA 4CFDA 1X9SA 3OYKA 3JPRA 4CJ5A 3SUQA 3IM1A 5DG8A 4DQPA 1WNSA 4IQTA 1XHXA 1X9MA 1SL0A 1SZPA 3DM2A 3OSNA 5HLFA 9ICPA 3HK2A 4AILC 3H8SA 4QZ8A 1UWBA 2IGIA 4FBUA 5HMLA 2HVHA 1T7PA 2FMQA 4NM1A 4ID5A 5C25A 2JEFA 4ICLA 4W5TA 1RYRA 4GMJB 3IAYA 3TAGA 5J2QA 3V9XA 2O4IA 4CJPA 4DL7A 2FBTA 3O4NA 2DFEA 8ICFA 1ZQUA 1WLJA 1RDDA 4FS1A 4DL6A 5CZ2A 4CEBA 1TK5A 1JLCA 4DLGA 2RN2A 2IMWP 4RQ6A 3RJIA 1ZQOA 3CQ8A 4RQ8A 3I0SA 3AU2A 2VA2A 1JX4A 2IDOA 2JEIA 3ZDDA 4QZFA 4KKOA 1SKWA 1X1PA 7ICKA 4NYNA 1Z3EB 4AH9A 2NRTA 7ICIA 3JYTA 5FROA 2B5JA 4RPYA 3KHRA 3PW0A 1KEJA 2FLLA 3HVTA 3M8SA 4ZTJA 4CJQA 1H38A 4GXKA 4W5QA 4CJ3A 1S6PA 4RW4A 4UAZA 5DGAA 1RTIA 5KFBA 3PVXA 4CE9A 4CGDA 1IKWA 3RB4A 4JRPA 4PHEA 4E0DA 4MF8A 1ZJNA 2PZSA 4Q8EA 5L1JA 4Z4CA 2JZBA 1MSWD 1BCOA 3AA4A 3B0YA 2G8IA 1GOBA 4FW2A 4CJLA 3AV9A 4I2FA 3K75D 3VQCA 5J2JA 1KFTA 4YFKA 2ALZA 1Z25A 3MR5A 5J0UA 4DSJA 2KQ2A 2BGGA 1TVAA 4LSNA 4DF4A 3L3UA 4H4MA 4PQUA 5EU7A 4RW9A 2BR0A 1ZBHA 2ZJ8A 2ZTDA 5HBMA 3V9ZA 4DG1A 1SUQA 5DLGA 1TK8A 5HROA 1NKEA 1RT3A 4KHSA 1RNHA 1N5YA 4W5RA 3JPPA 2VA3A 5J2KA 4NLGA 3M8QA 3QEPA 3DRRA 1EX4A 5IIKA 3PW5A 2JLEA 4B9UA 8ICWA 4IQVA 4CF1A 3MAQA 4KLLA 4IQUA 1XC9A 2J6SA 3O4QA 3KD5E 8ICRA 4J9NA 9ICTA 1HYZA 3UXOA 4DF8A 4FJKA 1GOAA 3Q8LA 1L3SA 1S1TA 2JZBB 1MQ3A 3OS1A 4M3RA 3K5NA 4FM0A 9ICCA 3QLHA 4M04A 3KHGA 3VQ7A 2E6MA 5FRNA 4KTQA 3ALYA 1FXXA 4N47A 4FZZA 3IS9A 2BDPA 5KI6A 4MF2A 3T3FA 4DO9A 1TVRA 2FBXA 2QKBA 7ICPA 4HCCA 4O3RA 5J2NA 3CFPA 3AUOA 3AVLA 1CXQA 2ATLA 3DOKA 2KN7A 5FRMA 4QW9A 4KB0A 3LALA 3UXNA 4J2AA 3MBYA 3BQTA 4M47A 4YMNA 3E01A 4QOZB 4M42A 1FKPA 4BE0A 2ZE2A 3ZDCA 3V6JA 3VQPA 2AQ4A 1GOCA 4DL2A 4DOAA 4CF2A 3NHGA 1S6QA 4I2CA 4CJRA 1JIHA 3CFRA 3QE9Y 3TARA 9ICIA 4AHRA 2RDIA 4IRDA 2Z1IA 4CGFA 1ZQKA 4CF9A 4E1NA 3SQ0A 5KGXA 3N4MB 2KZZA 1NOZA 3SQ4A 2ISOA 3AO3A 5JUMA 1BQNA 4Q44A 5JS2A 4QWBA 2Q0ZX 2A1JA 4DTJA 3C6UA 2ZJ5A 4DSLA 1RDAA 2YNFA 4I2JA 3RJGA 4ECXA 4DTPA 4MFCA 2DFLA 4FM2A 4ED6A 7ICOA 4PWDA 4HHTA 3VN5A 4RQ5A 2RKIA 4Z4GA 3WNGA 4RW7A 4NXZA 4RQ7A 4J9SA 1YT3A 4ED8A 3SI6A 1S1VA 1DGSA 3GILA 3SQ2A 4DSEA 3K2PA 5DDYA 3MGIA 4J9OA 9ICQA 3L2QA 4EYHB 4M45A 3RAQA 1X9WA 4O3NA 4IRKA 5EWGA 4R66A 5DB9A 5KG7A 1I3AA 3ITHA 3MFIA 5DQIA 2C2DA 2ZUDA 3ISNC 1TKTA 1ZQRA 4I7FA 1K1SA 2HB5A 4MEYA 5D49A 3DI6A 1K6YA 3JPSA 1O1WA 5KFAA 4M9GA 8ICSA 5J2CA 3MEDA 4DOBA 3B6OA 1RBSA 3O3FA 5J0PA 4RT3A 3BJYA 4AHVA 3PO4A 2J6TA 4RNOA 2P1JA 3HSTB 1D9FA 1B92A 3K59A 4CJVA 2PYJA 1U49A 1BPEA 3PMNA 4BWMA 2D0AA 3AO5A 3OYFA 4PHAA 9ICAA 4R65A 1Q9XA 1FK9A 1RPLA 3HWTA 2Q3SA 4QCLA 2FPMA 1TAQA 3ZDEA 4O44A 5D4BA 5DGBA 4OLBA 4QWEA 4I2HA 4YD1A 1HUZA 4KTWA 3M8RA 2NRVA 2G8HA 3RR7A 3ZD8A 4O5BA 1SL2A 1ZBIA 7ICHA 4F4ZA 1NOMA 2ZJAA 4FVMA 8ICNA 1ZQZA 1LB2B 9ICUA 4DQQA 2R7YA 4R8UA 1U45A 2W9CA 9ICRA 1BIZA 2NUBA 3KLFA 8ICUA 2XRIA 1D8YA 4LH5A 1WCNA 4FJIA 3ZDBA 8ICKA 2P6RA 4RPXA 3KK3A 3F9KA 4FS2A 4B8AB 1IO2A 4W5NA 3RJEA 5J29A 1S9FA 4NLZA 4PPXA 4FLYA 5BOLA 1TK0A 1REVA 4YR2A 4FJ7A 4ED0A 4ECSA 3GIJA 2V4QA 1VK0A 2QXFA 5KT3A 4F4WA 3VQEA 5CHGA 4BXOA 4DS5A 3GIKA 1NK6A 5HRPA 4KREA 5J2MA 4ZTFA 4I29A 1RBTA 4RNNA 1RT1A 3LDSA 5KGWA 5IINA 3HX0A 2HHUA 2IOCA 4FM1A 8ICGA 1TFRA 4FJ9A 4N76A 4M2YA 4YD2A 1X2IA 2XY8A 1IH7A 3NF8A 4HVJA 4RU9A 1NK4A 4CEFA 3OY9A 4R8UB 3HPGA 5EWFA 5KG3A 2W9CB 3AVCA 4DTUA 4Q45A 5CYQA 4DTOA 3QESA 2D5RA 4M3ZA 1C6VA 2BQRA 4M9HA 5KFPA 4QWCA 4E7HA 5KFDA 2PI5A 4EZ9A 3SV4A 4EZ6A 3RJFA 4YXJA 5KT2A 4Y1CA 2OZMA 3G10A 3HP6A 3OS2A 4EBCA 1L3VA 3ZSQA 3S3OA 2OPPA 4KFBA 1HQUA 3NH1A 2BPCA 2OWOA 4C8OA 1TKZA 1WN7A 3RB3A 1UAXA 1RT4A 5C24A 5C5JA 3V9WA 1XSPA 4Z4FA 3V7KA 2OA8A 4O5KA 2PFPA 4LZGA 4FK4A 4CESA 4N56A 4M3YA 3D45A 5TZVA 3C23A 4BGDA 3GV5B 2HHVA 4CEZA 1KLNA 1RT7A 3ZT1A 1TL3A 1KVAA 3VQ6A 1PZNA 4CIEA 3A2FA 2XC9A 1ZYQA 3SUPA 2W8KA 1C1CA 3EPIA 3T1AA 4O3SA 4HUFA 1IG9A 9ICVA 2BCQA 2J6UA 3MABA 2G8WA 4CHYA 1T8EA 4CIGA 1RDCA 4ZHRA 5J2IA 3QETA 3OVNA 3HXMA 1T3NA 5HP4A 4L8RB 2VWKA 5KFTA 3VQ8A 4P2HA 4RQ1A 4OVLA 4EBEA 8ICPA 3U3GA 2P5OA 1ASUA 4PH5A 4QZBA 4ED7A 1B9FA 3K57A 1NKCA 4KLSA 1W0HA 4RUCA 2W9AA 3U3YA 4R64A 3VQ5A 5DBCA 3IRXA 4JV0A 3L8BA 3EY1A 1EXNA 3GV7B 3VQ9A 5KRTA 3TI0A 5JS1A 4O0IA 2PXIA 3OSPA 3RRGA 2ATQA 1S10A 3EWAA 4R63A 1T4GA 2FPLA 5HP1A 4XUSA 4QZCA 3RBDA 4M3UA 4B9SA 5KFOA 3V9SA 2ZTCA 4CJSA 4LSLA 4CEAA 1ZETA 2MAXA 2XO7A 3M9MB 4O55A 4KLEA 2IBKA 2LYHA 4BDYA 3HJFA 2AJQA 3SI8A 3MEGA 3C95A 1IKXA 2IHMA 4E1MA 4CHPA 1SL1A 8ICAA 3TAFA 4QZ9A 2PI4A 5HRSA 3GFKB 3LP1A 3V1OA 2UVWA 1TKXA 1KVCA 2RF2A 2YNGA 3AA3A 1JKHA 2NRWA 4DTNA 4M3XA 2BQUA 4J9PA 1BI4A 3ZSRA 1ZQBA 4BWJA 3P5JA 1LWEA 4FK2A 2VA8A 4M6WA 5KFQA 2DTUA 2ITGA 1S9GA 4AHTA 3OYAA 4KLJA 4O4GA 8ICZA 9ICOA 3OHAA 5KFMA 2KZMA 4F3TA 4N5SA 4RZRA 3PX4A 4CFBA 5KFZA 7ICNA 1QQCA 4MFBA 4RQ3A 5IIOA 1RXWA 1ZQVA 3QIPA 5DBBA 4CK3A 4KLQA 4B08A 2FMPA 5KG5A 4JK1A 1BPBA 5DKWA 4CFAA 3AVHA 8ICBA 3CYMA 2BE2A 4LVSA 1D5AA 4H4OA 2YHBA 3DRPA 4AHSA 5KFFA 7ICGA 2B4JA 1ZQWA 1NK5A 5SZTA 3UXPA 4ECTA 1NJXA 2WONA 3ZT4A 8ICVA 4NCGA 2X78A 4TSXA 4FLWA 4RT2A 4CECA 4FBTA 1HNVA 3ETLA 3LWMA 2LSNA 5KT4A 4QWDA 4C8KA 3OYLA 2C2RA 3SZ2A 3RH5A 5IIJA 1KRPA 2BKEA 1MQ2A 1JL1A 4NYFA 5DLFA 2BCRA 4NY8A 2AGOA 3PX0A 4KLGA 3HT3A 2DFFA 5J2PA 3L2WA 2P66A 4DFKA 3MGHA 2HNYA 3LDAA 4O5EA 3OYHA 4EP5A 5KT6A 4EBDA 1S1UA 4NLNA 4FJJA 1ZQDA 1IM4A 4TURA 3LAKA 1VSHA 4TUSA 5DMRA 1S1XA 3S3MA 3KHLA 4YG2A 3C5GA 1NJYA 1XHZA 3V81A 3B6PA 3Q8RB 4CERA 1C0MA 4CF8A 4KHNA 3TAMA 4XQ8A 4CHNA 2BHNA 5DQHA 3NDKA 5CYMA 3NAEA 2PYLA 2XCAA 5J0RA 2B6AA 4QW8A 2AGPA 4KI6A 4BACA 4CJ4A 1RTDA 1F21A 5DK5A 3TABA 5J2BA 3V4IA 4I27A 3G0ZA 4CF0A 5KFYA 3GIMA 2FLPA 8ICMA 1VSMA 1UOCA 1KFSA 2XY7A 1CZBA 3RMBA 4FJ5A 4O3QA 2IC3A 2R8GA 4BE1A 4F5RA 2FLNA 3OYCA 1QE1A 1NJWA 4CHOA 3TANA 3AA5X 2GWSA 3C1ZA 4KHQA 3SYZA 1S97A 1TAUA 2WTFA 2ZTEA 1BIUA 3HVRA 3DLBA 5L9XA 5DDMA 5D46A 4DTSA 1QSYA 1U47A 1KVBA 3NF9A 3ZT3A 2UVRA 9ICKA 1TV9A 3RRHA 3KLIA 5J0TA 5KRSA 4O9MA 1ZQTA 3MECA 5DBAA 4OKJA 1JLBA 9ICLA 3QEVA 4DU3A 4DTXA 1VSKA 3AO4A 5KFLA 5J1EA 1ZQAA 3CG7A 4CJFA 4ECUA 4UB3A 1NJZA 1N6QA 5E41A 4M41A 8ICIA 4OGEA 1FKOA 4O3OA 3TAQA 3T5KA 5J2AA 1C0UA 3UIQA 4IKFA 4LH4A 2VG7A 1BPDA 5J2DA 4F50A 1COOA 4R5PA 2KTQA 4I2QA 4QZAA 3V7JA 1A5XA 1B43A 4GLXA 2ASLA 1KDHA 8ICOA 4FLVA 1TV6A 1LWFA 4G3IA 3RJKA 1XU4A 3EYZA 2QKKA 3AVFA 1WCLA 2AU0A 1RDBA 3OJSA 4GC7A 1VSEA 3G6XA 4HCBA 4NCAA 2KFZA 4CJWA 3PV8A 3THVA 4IRCA 4ID1A 3CM6A 2BQ3A 3QEWA 4ECZA 4P4PA 5EOZA 4NLKA 4AHCA 2F1JA 4DU4A 3RB0A 4IQWA 2DFHA 1DLOA 3V72A 2I5JA 1SKSA 4OKEA 2BGWA 5KFVA 4J9KA 2PFNA 2A1JB 4DTMA 4Q43A 4PA1A 3LWLA 3OYGA 1VSJA 1EKEA 3BQ0A 4JWMA 4B9NA 4CJEA 2AQ0A 2XY6A 1ZQFA 2X74A 4CJUA 1EETA 3BDPA 3DMJA 5KFIA 2ASJA 4CEDA 2HHQA 3Q8MA 1VSIA 4BDZA 3ASMA 3RTVA 2R8HA 4UBBA 4MQ3A 1BGXT 1QSLA 4CGGA 1JXEA 4ED2A 4FLZA 1CEZA 2GUIA 2OPQA 4E7KA 1XO1A 1S5JA 1Z00A 1S1WA 2EHGA 4F92B 2JEJA 4J2DA 5HNKA 4UB5A 4QWAA 4CGIA 4Z4HA 4I2IA 4KHYA 2HHWA 4ELUA 1L3UA 3LAMA 3KK1A 2VG6A 3O3GA 1Y88A 1BHLA 9ICWA 5KFUA 4FO6A 1ZQNA 3ZSYA 1UT5A 2KFNA 4KPYA 4FCYA 7ICRA 4TQSA 3QZ7A 3AVJA 5J0SA 2F1IA 3MDCA 1IKYA 1XI1A 4BDPA 4NCBA 4O0JA 2VANA 5HRRA 1CXUA 1JLEA 3VQBA 1IKVA 5HMMA 3TWHA 1KFDA 4ED1A 4DS4A 3OJUA 4J9RA 4M9JA 1KCFA 4TUQA 5CY4A 2BANA 3OYNA 1B9DA 3PR5B 4JV1A 3OHBA 1RYSA 4OKKA 3JPQA 1Z00B 1J5OA 5CJ7A 1TKDA 3LP2A 3ULDA 3S3NA 5KFHA 3QZ8A 3PO5A 3AVBA 5CA7A 5KG6A 9ICHA 1NK9A 3WNHA 3SNNA 2ZUCA 5KG1A 2XGPA 3GV8B 4IFVA 4ECQA 1SKRA 5J2FA 4C8LA 9ICMA 3U6FA 4J9MA 2Y1JA 4JUZA 1ZQPA 4DU1A 5KT7A 2F1HA 4FJXA 1U48A 1J54A 4K8ZA 3RMCA 4YP3A 2W8LA 1YVUA 4M9NA 4M0AA 4E3SA 4K4HA 1W9HA 4ELTA 4FLTA 3DLKA 4DSIA 4IBNA 3Q8QB 2BCUA 4B9MA 1KLMA 4HUEA 3OYBA 1JXBA 2HHSA 3I0RA 4KLOA 3V9UA 4Z6CA 1KTQA 4F3OA 1ZQCA 4CGHA 2D0BA 2WOMA 1ZQMA 1RBVA 1NK8A 1ZBFA 2E6LA 3K5OA 1ZQYA 4DMNA 4BXOB 3LPUA 1QHTA 3K5LA 1R0AA 3ZCMA 3IG1A 5KFEA 2F8SA 1XS9D 3UPQA 3M9OB 1VSLA 5BOMA 1BPXA 4ECRA 4GC6A 4FJMA 4F4YA 2XGQA 2G8KA 1Y97A 4RPZA 3AVAA 1KSPA 1RBUA 4FJNA 2XCPA 3C2KA 3P83D 4YVZA 3JSMA 4YR3A 4OJRA 4OPJA 4YFUA 4QZHA 3HL8A 3C1YA 4J2BA 4KN7A 3PW4A 3ZSVA 5BPCA 1UA0A 2F96A 2HMIA 3ISCA 3UQ0A 4UB1A 2NRZA 3MXMA 2FBVA 2W42A 4KLUA 3T5JA 1ZBUA 5I3UA 2P6UA 3JPNA 3HP9A 2YV0X 3N97B 5KFJA 1CZ9A 1U9LA 4RQ2A 4DLEA 3AA2A 3ZSOA 1JXLA 4RW6A 4QZGA 4MEXA 4CHQA 3T19A 4DL3A 1DTTA 1LAVA 3EW9A 9ICBA 4Z6FA 3RMDA 1S76D 1LW0A 3TAPA 2JGUA 1XWLA 4P4OA 3GIIA 1B22A 4N41A 3DYAA 4Z4EA 3WNFA 4I2EA 2X6NA 1ZJMA 2VG5A 4HUGA 1D8LA 4DQSA 3H40A 3KKSA 1RCHA 1WSFA 2MUTA 1ZQJA 2UVUA 5L1IA 2OZSA 2C2EA 8ICHA 3PW7A 4JWNA 4JRQA 2PFOA 3AO2A 1HJRA 5CWRA 4KI4A 3PUFA 2G8FA 4UAWA 3DLRA 3KJVA 3ZD9A 4WE1A 1ZQGA 1S0OA 4I9QA 4PUOA 1J9AA 1WSJA 4KTZA 4RQ0A 3NGZA 5J2HA 1SV5A 3L2VA 4EYIB 3PY8A 4F8RA 3NE6A 3AVKA 1HMVA 4YQWA 5J2GA 4KN4A 4ZH4A 1BPZA 3C21A 8ICTA 3PW2A 3RMAA 4DL4A 3QEIA 1LWCA 1HQEA 1JLAA 4DFPA 2R8JA 1S0VA 1WSIA 2R8KA 3P1GA 2VWJA 4FJHA 4DQRA 3H8JA 1RT6A 4E7IA 3MR6A 4CCHA 9ICGA 4KO0A 4PGXA 1S0MA 3DOLA 3NF7A 4FYDA 1HPZA 3RH4A 2FMSA 3LPTA 2MUTB 2RPIA 1ZQSA
chains in the Genus database with same CATH superfamily
2H4WB 3E9LA 1DGKN 3CD6N 2H5XA 2OPSA 3H4DA 2YWEA 2MEWA 4X4RA 3KJVB 3IFRA 2P9PA 1V5VA 2CQ3A 4PEOA 5F9NA 4JYAK 3QFHA 3SMSA 5HL7L 3B54A 4X5VA 1ZBLA 4MDBA 3PG9A 1EWRA 2WUSA 1S9EA 4DQ8A 1U04A 3VQAA 3OYEA 3T5HA 4B1YB 2KP7A 2ZOGA 1FNOA 2BTFA 4YR0A 1CS4B 4IH6A 2DR7A 7ICLA 3B0XA 2P9IB 1Q78A 3BGRA 4IG0A 3S9HA 4UBCA 4F9OA 1TKXB 1BCMA 1HQEB 3T5LA 2G8VA 1YJWN 1ZQLA 1UT8A 2RU3A 4FYVB 4BG9A 4RQ4A 2R2SA 3EZ5A 2EZXA 3VEVA 1RCOB 3K0JA 1RT6B 2Q0RA 3V7LA 4H0OA 4LRDA 3RJHA 2B56A 1S9GB 4HI1A 3FZ2A 1WBBA 4ED3A 4DUZF 1R0BG 1NK0A 3O9SA 4E7JA 3HW8A 1XTZA 4FWNA 3QAEA 5MAOA 2UUWA 3PYFA 2JX2A 3CMES 3QMQA 2BM0A 3EICA 3MM9A 4DKWA 3D3BJ 3MDFA 2XSFA 3QPIA 1A77A 2RHQB 1QQOA 1JUDA 4QZDA 1EXQA 4U7UK 1HUOA 5GMKa 3QNNA 1IR0A 4KAIA 4OZ0A 1UL3A 1I6JA 4I2AA 1UCNA 5LL6Z 2H3GX 1T03A 1LAWA 2B4OA 3BGRB 4IG0B 4JKBA 1RT5A 5TKWA 1FXRA 2HQIA 3BQ1A 1XNRJ 3AY0A 3UKUB 1MWZA 4YMEA 4DTRA 4F2SA 3BZCA 3G6VA 1HBMA 3NGUA 2NRXA 3CJKA 4HTUA 3ZSZA 2Z30B 1F9FA 4IXCA 2OYQA 1Q8IA 4CHZA 2ZUGA 5J2PB 3QFWA 3CFOA 1X5PA 3KBBA 2M3DA 2RNEA 5B0AA 1W97L 3HLUA 1NGGA 2ZH8A 3VGVA 3H8WA 2GO9A 3D4JA 2DO0A 1JN3A 5C42A 7ICQA 4IDKA 4XIUA 5HATA 4PHDA 2DH8A 3LW5C 8ICEA 2P35A 3EKUA 3CIPA 1M90O 5HQMA 3MM9B 1FNMA 1DKGD 4RU2A 2CZ4A 5F3ZA 1KS2A 4FK0A 4QIWF 4DSFA 3EVOA 1IXRA 1FERA 5KFRA 3ENQA 2YWKA 3MR2A 4CK1A 4PG5A 1LW2A 3I82A 5G0RA 4QIWD 3O4WA 1W25A 4DR6K 5A6PA 1OVYA 4M3TA 3LANA 3CCMS 3K4GA 1T03B 3LH2S 4QS9A 1RT5B 2W2OP 3NF6A 1WUAA 3MUVP 8ICJA 1QZ5A 6FD1A 3HPOA 3NRZA 2L5YA 1YRXA 3IXQA 3OGUA 2RU9A 1L7OA 3CJKB 2NUHA 3I8DA 2C22A 3S7RA 4EFAC 1IJJA 4DPWA 5M2UA 2Q66A 4DCJB 2G1DA 2AZ3A 2UXBF 5F0WA 2XWXA 5J8YC 1Q4RA 2F8MA 4JV5F 1VAZA 3IP0A 1VQ6N 2A3VA 4LF5K 5JTIA 4KLMA 3O9QA 4AL6A 3SMPA 2ACYA 5AQSA 3MTKA 4E19A 3K7RA 4DSKA 3LZJA 5LJ3Y 3WEEA 2WTUA 4I6WA 1ZPWX 2VFSA 1FE4A 5AIAA 1U0HA 2ZHBA 8ICLA 2BZFA 4OX6A 1LW2B 3QRPA 2L9DA 5G0RB 2YI1A 2WF8A 1N6QB 4FYXB 3L9ZA 2HOEA 1U1NA 5KT5A 3OYJA 4KHWA 2G0AA 1URJA 1O6XA 3J7Z5 4KR0B 3DLEA 3H4BA 4CZJA 1N48A 1FEHA 1WSEA 3K89A 4X2BA 2YMLA 1WC4A 3UM9A 4USIA 1KHVA 3OL6A 4WFNL 2IVFB 3CC7N 4YNQA 4YOUA 1VIXA 1TV6B 2A1SA 1LWFB 2AYGA 3W3SA 3CM5A 4J90A 2VUGA 2ZJPL 5J2EA 1JL2A 1SIJA 2ZXIA 2E1MC 2ZH4A 3WEEB 1WSGA 3H6EA 1C1BA 1U0HB 4Z7YA 3KZBA 4IR1A 2UUAF 4DFJA 1VBZA 4BC7A 2UV8G 1AA1B 1SQKA 2OCEA 2AP1A 5AE1A 5ETTA 4H8KA 2K7KA 2X3GA 2DKOB 2XMJA 2JL9A 2ROEA 3D2QA 3CDBA 1A5VA 5HRNA 1VQSA 3H0RB 4IEIA 3PIOL 3E2EA 3T6JA 3CCVS 2V34A 4ETXA 4BRQA 2G1HA 2FGCA 3T9NA 2HRTA 1ZAWA 2V2QA 1UP1A 3DXKB 1U4BA 2OLWA 1OJ4A 5DM6L 3NGYA 2IA6A 1RBRA 2YKNA 4YN4A 4QU6A 3WX8A 4YS2A 4EEYA 5DDPC 2VBZA 5KFWA 5KG4A 3KHHA 3RG6A 3IR6B 2Q6BA 3A0BU 5LXRA 1E6VA 3CCSN 2HQCA 2QB1A 1S1WB 1K0TA 1C1BB 2D3UA 3L2RA 1YI2N 2E1AA 4Y00A 4OYIA 2Z2ZA 4Q5VA 1U2CA 4RNMA 3PFEA 1XUPO 2YB1A 4Y2AA 1BQMA 1NMNA 3ISBA 3RWUA 4FJGA 2FYXA 4WCEQ 1VSDA 3F2KA 1K8KB 3CIMA 4ATNA 2HIQA 2HPUA 3D2WA 2W7AA 1EP4A 7ICSA 4DV5F 4X62J 4WYBA 7ICEA 4MIWA 1VSFA 2J9EA 3L3VA 1T05A 5FDLA 1S6UA 3KLEA 4Y2JA 3K5MA 5J0QA 4WQ5A 2QRRA 5AQYA 1EWQA 1YSJA 3QINA 1Z1ZA 1TYQA 3L4PA 4RUAA 3PFOA 3AA8A 2NO4A 2YX4A 3AMZA 4W5OA 3C6TA 1SC3B 5LMUF 4M63C 2P5GA 3GG0A 2BANB 1SC4B 2YKNB 4I0WA 4CJTA 1RTJA 2A1RA 4LR7A 3BGLA 1KBUA 3C14B 2MLXA 6AT1B 3JPTA 1KDNA 2AV5A 2IAJA 2BJ8A 4FL9A 1KQGB 1PYOB 3BEGB 4P0QB 5H9FJ 3GE1A 4DR1J 4NE9C 3VQQA 3M9NB 1P8GA 1GEHA 4YMOA 5IIMA 1BQMB 3QRRA 4QPTA 2X6SA 4AUKA 3VA3A 1N0UA 4DR5F 4QIWC 2I1QA 2C28A 1RXVA 3I55S 2E5LJ 4I9LA 4X64K 2UV8A 1NDPA 2MQ8A 1LFPA 3ZETB 2JEGA 3D6JA 4F2RA 2NNWA 4JI8F 1UA1A 4AL7A 3BPSP 3GZ7A 4RLEA 3CD0A 5IM0A 2WRMA 4DJBA 4EIAA 1YJUA 2BABA 2N4CA 4B3OA 3DLKB 2OFHX 5JMVA 2D4WA 4OL8A 3QYPA 3KIOA 9ICSA 3IKMA 5AT1B 2RHFA 3UQ2A 2L48A 3I0RB 1ZAXA 2W55A 2XG8A 4JI4K 2EH9A 1S77D 3ZSXA 4Y2IA 4IEEA 1RKJA 5FJ4A 3AAQA 2W4CA 5B0GA 2NSCA 3AVIA 4PZVA 1RTJB 1VRUA 2Z57B 3O08A 3KLHA 2Q1LA 2UUBF 2UXCF 4FWMA 3RBXA 3HOTA 5IILA 3GCWP 1BY9A 4L76A 4IC9A 2VBXA 1S7IA 4LT6A 2IAJB 1ZQIA 3V6HA 2KV2A 3MZIA 1WEYA 3WK5A 3IA0A 2UUTA 5CD4A 4JI0F 1LK5A 4CLTA 3FDSA 3I9V9 1GH8A 1XQSC 1HWJA 2NPIA 4TN2A 5HI7A 1AROP 3TADA 4K8XA 3DLLL 5GMEA 2ZJRL 5IM0B 3SUQA 3T6BA 3IM1A 3DNCA 3H46O 4P71A 4B3OB 2CRXA 1SL0A 3FRYA 1NGIA 3FCHA 2VB6A 4DUZK 3GG4A 2KM8C 1PK3A 3H8SA 2KLAA 2ZJQL 3GFZA 2HVHA 1T7PA 2UU9F 2HIYA 2V0NA 5ALWA 3L4QA 5F1XA 3IO1A 2FMQA 3WXJA 1DTTB 4P75A 3KLHB 3IAM9 3R5BA 1ZM4A 2Q1NA 3BREA 1NRKA 1RYRA 3F0NA 3MCMA 5J2QA 2ZC4A 4WP9A 4CJPA 4DL7A 1FJEB 2B9WA 3TX8A 3ISND 2DFEA 8ICFA 4JKCA 4CEBA 1SV0C 1AQ6A 4ICAA 1YHQS 4P2MA 2IMWP 4NXMK 4FDFA 4RQ8A 2VA2A 3SLCA 4KKOA 4NLWA 4JI6F 1RAGB 4NYNA 4FNIA 4NZ7A 2PFUA 2ZH9A 3BQ7A 2DYAA 4OZ5A 4DMZA 7ICIA 3JYTA 3A0HU 2FLLA 4PUOB 2E1FA 2W6KA 1PJ5A 3M8SA 1H38A 1REGX 4QPXA 2Y1LB 2VFUA 3M6WA 3M1VB 5EY4A 4CE9A 5A2QY 2NRHA 3W5YA 9RUBA 3QJJA 1MSWD 3AA4A 2Z4PA 1GOBA 4CJLA 3AV9A 4WP3A 1O0PA 1T3OA 4EX7A 2ALZA 1SAZA 1Z25A 4CZIA 3MR5A 1HARA 2AX1A 2HZCA 4L75A 1IM6A 4DF4A 3UQSA 1Q86T 5AQOA 4BQZA 5LMNF 3OL9A 3ETRA 4PQUA 3CEDA 3I31A 4RW9A 1U2FA 3EXYA 4X4PA 1T95A 1IBMJ 3V9ZA 4DG1A 4JKGA 2O8DA 1K8AO 4PXBA 2ZKTA 3ATUA 1WACA 5HROA 1RT3A 1GO3F 4LMZA 4KHSA 1RNHA 3DXSX 2CJAA 5HVGA 2H9ZA 1CI4A 3PW5A 2D3ZA 1DT9A 2YX8A 1RDRA 4WXWA 4F4AA 4IQVA 1HBUA 4KLLA 3P39A 3KD5E 2UXBK 3KHYA 1HYZA 4JV5K 3G8QA 3R2DJ 3UXOA 4DF8A 4FJKA 3QUBA 1GOAA 3ONQA 3D1QA 2OYYA 3CWJA 1OH6A 1FDNA 2XSJB 3Q86A 3CCES 4IDHA 1EIYB 4M3RA 4FM0A 4WKRA 1Q3VA 1HA1A 5FRNA 1WWVA 1PJ7A 5KI6A 2QARA 3T3FA 3GBTA 1HHTP 1ROFA 1FRHA 1N61A 4CBXA 3AD9C 4AYBD 7ICPA 3FQKA 1R8BA 4RW9B 1CXQA 4B1XB 4BLGA 3DOKA 4NL9A 4DG1B 5AQJA 1YJNN 1RWKB 4US8A 3UXNA 3MBYA 2ZITA 2HK2A 2LQ9A 2ZE2A 3VQPA 2K1RA 3MX5A 3R1HA 3OLBA 2FZGB 4DOAA 3NP5A 1R27B 1AB8A 2OFGX 4I2CA 4F3MA 2KYZA 3WXLA 3M8ZA 2ZBCA 3CUNA 1Z05A 3HF5A 2PFFB 4AHRA 1HNZF 3OXGA 4E1NA 3SQ0A 1LEOA 1IR1A 4FP9A 3SFGA 5KGXA 2KZZA 2F5GA 1GXTA 4A8QA 1FWPA 2UUAK 2QARB 5D0GA 3AO3A 3VZIA 2WSCC 1CRXA 4NXNF 2F7TA 2A18A 4DV6J 1GLBG 3D3CJ 2ZGZA 5ETSA 4DTJA 3DOKB 4MJKA 3BBFA 3G8TA 3JAMU 2HBKA 4ZP9A 4BG8A 4PWDA 1VQ9N 3FEZA 2A5XA 4Z4GA 2B7CB 5E0OA 2ZE2B 4NLDA 2K1RB 2OUGA 2Y0BB 5JLFA 2WMMA 1Q53A 4Y34A 1S1VA 2ZZMA 4JMUA 2ZBQA 1W7AA 3VVUA 2IPOB 1X4FA 9ICQA 3HHKA 4QS7A 4YDUA 4BGBA 2GGPA 4O3NA 5C0YA 4UY85 3HSGA 4KHPF 5EWGA 2E5JA 1JALA 2K60A 3ITHA 5DQIA 2C2DA 4LQ3A 2ZUDA 4CWBA 3KG0A 3ISNC 1TKTA 1YKWA 1Y3KA 4L72B 2FJ6A 1UJ4A 3HFZB 1L3KA 4CD3A 2I0XA 4DV5K 1O1WA 4WF9L 5ALIA 5J1NA 5J2CA 1QM9A 4LF8K 2CADA 3SSRA 2Q0UA 3O3FA 4CO5A 2GH1A 4AHVA 3PO4A 1LOUA 2EFOA 4RNOA 3HSTB 3K59A 1B92A 4DR7J 1L7NA 2PYJA 1Q86O 4K4XA 1FTRA 4EAHD 3BKUA 1S1VB 1Z6RA 1YVNA 2D0AA 5LMUK 4IUFA 3OYFA 2XEXA 2VD3A 2YH0A 1Q9XA 4ILMA 3J7AP 4DV1F 5TKYA 4QCLA 4PXDA 1TAQA 3R7SB 2GGPB 4OLBA 4I2HA 1R31A 1HUZA 3ITHB 3EUB2 2VICA 3ZD8A 1X4AA 4A46A 1ZBIA 1TKTB 2DGTA 4F4ZA 2MZRA 4ITSA 4FVUA 4YN3B 2CGLA 1FFWB 4DQQA 2YPZA 2I5HA 2HQ3A 1U24A 2HWTA 1BWFO 2W7OA 4DR5K 5GTHU 4JHDA 2W9CA 5IC6B 8ICUA 2XRIA 4F36A 1FO4A 1GXUA 3EJMA 8AT1B 2ZVSA 1N33F 3TTDA 4OJLA 4JI8K 3LO3A 4B3MF 5ETMA 8ICKA 3D1HA 3KK3A 3F9KA 5AI5A 4FS2A 1IO2A 1HHSA 4C11A 5J29A 5BOLA 3MPVA 4UT4A 3G9CA 2V51B 4ZPWR 2KKHA 3KLGB 2E66A 4B9QA 2A3JA 3V6DB 4BXOA 2NPFA 4DS5A 5HRPA 4KREA 2AMCB 3MCSA 5J2MA 5AHXA 2UUBK 2UXCK 1MLAA 2DHAA 1RBTA 3WKDA 4FM1A 1TFRA 3BH7B 3A8JA 4DCCA 4FJ9A 4M2YA 2A19A 1X2IA 5GADI 1IH7A 1UETA 3NF8A 4PKIA 4JI0K 2M70A 1NK4A 2FJVA 1WD6A 1NZPA 1HJOA 4AYBC 1TZ0A 4JHDB 3S41A 4ZVFA 2MKIA 2W9CB 1DZ5A 1NI3A 3AVCA 1F5BA 4JBCA 4GRSA 5D6GA 1J5EF 4I6MA 2GAHC 3E3XA 1C6VA 2BQRA 1RAJA 3KK3B 3KWIA 5CABA 2RS2A 4WFZA 4WQ4C 4E7HA 3CJQA 5KFDA 4C11B 2PI5A 4DCHA 4WKYA 2OZMA 3G10A 3HP6A 3OS2A 4EBCA 5L8RC 2UU9K 3N0VA 4KFBA 4X4OA 4KH5A 3DCAA 4C8OA 4ED4A 4S0MA 3O0FA 1RT4A 4WFNQ 2O8BA 5B7WA 5C5JA 3V9WA 5ETNA 4BRMA 3GYNA 2HQDA 2HAFA 2QL9B 2D7SA 4NZ0A 3V7KA 2OA8A 4O5KA 1MWKA 3B9JA 2PFPA 2D0OA 2ZJPQ 4N56A 1WG5A 4M3YA 2V2ZA 2BVZA 3MMJA 3GV5B 2FY1A 4WFBL 1RT7A 2YMQA 4L74A 4JI6K 2LEPA 4DDFA 4R79A 4O3SA 9ICVA 1COKA 2JJ4D 3L0QA 2BCQA 4CHYA 3UWTA 2F8LA 1XNRF 3OVNA 4Z94A 5EE9A 1FRKA 4Q2LA 4ZITA 1PYSB 4W92B 2VWKA 5KFTA 4RQ1A 4OVLA 4EBEA 2M0NA 3VV2B 3SDEB 2P5OA 2XHCA 3M1FA 1RT4B 2NZTA 1OPIA 2AIRB 1YIJN 3P4IA 2ZBRA 2CA9A 5CA5A 1EXNA 2EBGA 1NGDA 3VQ9A 2XTJP 4JI2J 3A8KA 1X31C 4EGLA 4O0IA 2PXIA 4OLOA 1M1GA 2ATQA 5AZJB 3EWAA 3FCVA 1T4GA 5LMNK 5HP1A 1KQKA 1S6OA 2JMGA 4B9SA 2D69A 5KFOA 2VJ4A 1D9AA 4CM0A 2ZTCA 1IJFB 4DU8A 2W1BA 4CEAA 2XO7A 1DQ8A 2MY7A 4KLEA 3SI8A 3MEGA 2HGMA 1IKXA 3DGPA 1UVLA 1NG9A 2F4VJ 4AL5A 3NCQA 2OMOA 2IVPA 1FXLA 2PI4A 2YTCA 5JVHL 3LP1A 2UVWA 3MK6A 3AN1A 2QYGA 3M5RA 5C2FA 5J8YA 1F0MA 1KONA 2L41A 2OEKA 1BI4A 1WJ9A 3KOAA 1LWEA 4FK2A 2VA8A 4LFAJ 1O03A 5ETLA 2R42A 4O4GA 2R2UA 4CFBA 2I7NA 2CQHA 3Q2SC 5DBBA 1Y0HA 4BUGA 4KLQA 3UE2A 1UWBB 1RWNB 4K0KJ 1BPBA 4CFAA 2NYHA 2HBMA 5HR7A 4KH1B 3UDVA 2EW9A 2H5IB 5C25B 2XMWA 4WFAQ 1RWXB 2B4JA 2A10A 2F3JA 3TYTA 1VBKA 3UXPA 3MEGB 1IKXB 1F1BB 1NJXA 3GJSB 5FLXU 4NWIA 4DUYJ 3ET6A 4DXLA 3ZT4A 1JLCB 2OELA 4NCGA 3MCAB 2X78A 2F76X 4TSXA 4NA1A 2GIFA 3TRGA 5GTIU 4LF7J 4FBTA 4RQNA 3LWMA 2YY6A 1Q3UA 2E9RX 2CPFA 3R1LA 2OTJS 1MQ2A 4J9VA 1JL1A 3AJ1A 4NYFA 4HHHA 1LWEB 1HNZK 1VQ7N 2KJ5A 1WHXA 4ZVPB 2HZAA 3ZXWA 3OYHA 2QA1A 2HK3A 1P8ZA 2FDNA 3ZTSA 5BR8J 2QB0B 1S1UA 4FJJA 2AYMA 3M8YA 4TURA 1VSHA 4NXNK 2A3ZA 2DPNA 5DMRA 2DGOA 2V8GA 1IKWB 3C5GA 2DK2A 1WKKA 3Q8RB 4CF8A 4KHNA 3TAMA 2BHNA 1SKUB 4FF4A 5BXIA 2DBBA 1GLEG 2QA4G 3NAEA 3IV6A 2J0SD 1G2EA 3BEXA 3ET6B 4BACA 2VFRA 4QU7A 1WC3A 3QSYB 1F21A 2LA6A 3DLLQ 2DBYA 2CQCA 3C8YA 1W26A 2ZNYA 3R5DA 4CF0A 3GIMA 2FLPA 8ICMA 3ATVA 5KPTA 4O3QA 3FC9A 2NO5A 1BUPA 2H3VA 1B99A 1QE1A 4C7YA 3ULEB 4C7ZA 1QVFM 4KHPK 2ZJQQ 4CHOA 3TANA 2FXUA 3O9RA 1N4LA 3AA5X 1U1OA 3M8QB 4P73A 3IBWA 1S97A 2WTFA 2A6OA 3HVRA 4JB8B 1S1UB 3DLBA 5DDMA 2W3SA 5AI8A 3BZQA 4HTJA 2CH5A 4BR0A 4DTSA 2J0XA 4BRKA 2QWQA 2LEBA 3SCJE 3L09A 4MLEA 3NOGA 5KRSA 1FF2A 1JLBA 1ZZFA 4DU3A 5KFLA 5J1EA 4CJFA 3QLHB 3ICLA 1PVRA 1U1LA 3MD3A 4UB3A 4X62F 1EAYC 1NJZA 5AZIA 3IS9B 8ICIA 4OGEA 1FKOA 4CRXA 1G4CA 1V5IB 5KOWA 3WQTA 4IO8A 5J2AA 4J37A 4DPTA 2BXJA 4DV1K 2YVSA 4WFXA 3MUTP 3THYB 2KOBA 4EENA 4F0MA 2NZCA 1H74A 2PO4A 3IRWP 5GAEP 2KTQA 4XH1A 1TR0A 3MM6B 2HF3A 2DR6A 4WTOB 2M2BA 1BNPA 4TU7A 4Z37A 8ICOA 3A13A 2CJ9A 2BA9A 4G3IA 5DZ6A 4H54A 3PSTA 3PTWA 4DR1F 3LTOA 4CZMA 3AB2B 3FZLA 1HEKA 2KFZA 3PV8A 3OTOJ 4IRCA 1WHWA 4G1IA 1FI4A 1N33K 2WVEA 4ZPAA 4JK8A 4B3MK 3DDIA 2E5LF 4K42A 5ALGA 4U7BA 3KNGA 4NJ8A 4P4PA 5LT5A 3BSOA 4AHCA 4G9ZA 2F1JA 2AA4A 1U0SA 2VQFJ 3A1YG 3FEXB 5AZIB 1G1XA 3P49B 3RB0A 4IQWA 1JCFA 2DFHA 2ASOA 4DX7A 3KUHA 4DPOA 3CCLN 2DL0A 4J5OA 4J9KA 4DTMA 2R7TA 3MPYA 3WK7A 2KVQE 1EKEA 2CYYA 3AGRA 3ENVA 3CF5L 4B9NA 2W7PA 2V2VA 3TA0A 4PHTX 1RWUA 2XY6A 2HWHA 1NB7A 2KMDA 1EETA 3BDPA 3DMJA 2ASJA 3MCOA 3W60A 4CEDA 2HHQA 4QIVA 1S59A 3VZHA 2YMMA 1H1VA 5M1KA 2KVCA 1ZD2P 3G6ES 3NVMA 5HOOA 3O1LA 3CIZA 1ZAVA 1CEZA 2OPQA 4P6QA 4GVBB 1MN7A 2EWHA 4XH4A 2QTWA 2JEJA 5G5HA 3JSRA 4Y2YA 1WG8A 1VQKS 3HKZD 2R9LA 1J5EK 3KK1A 5K8NA 3VGKA 2WB1F 4C4RA 4C1NK 3OL8A 5GIOA 2KFNA 4KPYA 4DZ6A 1KAXA 7ICRA 5J1PA 3UD5A 3CJCA 1HR0J 4ZPBA 4OHZA 5FPNA 2QLTA 4MAKA 1T6DA 1SXLA 4IO9Q 4BDPA 3HFVA 4Y2KA 4O0JA 2CPEA 1CXUA 4KQZA 3CC4S 3N28A 3MEDB 3CHWA 4DUTA 4IZ9A 1YITN 2WFBA 5HMMA 2BX6A 3TWHA 1NGJA 4U95A 1GAOA 3OJUA 1EETB 3DMJB 5BRDA 3V2UC 2CNLB 2LU1A 5CY4A 4B1ZA 1VQ5S 2G2OA 4USTA 3OYNA 5BN9A 2IMOA 2ZZTA 5CR4A 3I6PA 4ZPDA 2NXNA 4K41A 3OHBA 1RYSA 3G82A 1W2IA 4O44B 3S3NA 3ULDA 4KBIA 5KFHA 3PO5A 1CJTB 3D6RA 2RHSB 3KD3A 3KK1B 1OY9A 5ALNA 4GKKJ 4TXSA 3U6FA 9ICMA 1VQNN 1HIYA 1ZOLA 3HBTA 4J9MA 1QAJA 3R6LB 3OBWA 5K5MA 2KKPA 4BRNA 1KVKA 4FJXA 3HHLB 1J54A 2LXFA 4K8ZA 2W8LA 1VQLS 2KM8B 3T1YF 5CQGA 2W11A 2ZF5O 1BMQB 2JHDA 4B9MA 1JMTA 4KLOA 1KTQA 3R3LA 3MMVA 2KRBA 2FHOB 4CGHA 2DY1A 3CNHA 5U47A 1OPZA 1RBVA 3MD1A 3UMBA 5C7PA 3DN9A 1ZBTA 3I96A 2WHEA 2ZDPA 1UVIA 4DCPB 2OM6A 2Z7JA 2DGSA 4ERDA 2Z0GA 1O13A 3CERA 2F8SA 5HJYA 2H4YB 2BDUA 3P8BB 1BPXA 4GC6A 4FJMA 2P9EA 1RU1A 2QLXA 3WC2A 2HRUA 3AVAA 4WF9Q 2DF4B 3WHIA 3ELHA 1RBUA 1X66A 5AXLA 1D8BA 3C2KA 4CD1A 4YVZA 1HI0P 4YFUA 3MF5A 2GHPA 4P7TA 5BPCA 1J2VA 1C20A 4UB1A 2F77X 3RF9A 3WQUA 1MW7A 2FBVA 2W42A 3CMEN 4KLUA 3TEGA 3W2VB 3T5JA 1MWQA 1EQ0A 1YJ7A 2LQBA 1ZBUA 4EI2A 3N97B 1XEZA 1U9LA 2YJFA 1NLVA 1DRZA 3NVKA 4DLEA 3ZSOA 1JXLA 4M5DA 4FWLA 4DL3A 3SENA 3THXA 2VQEF 3RMDA 1M5PC 1LW0A 3KVGA 2JGUA 1SH3A 1XWLA 3H3OB 1B22A 2OPPB 4N41A 2COLA 4Z4EA 2VOPA 3ZZTA 1EJ7L 1U1MA 3M6VA 4F02A 2F65A 4MYTA 2LBOA 1X42A 3IG5A 2J9DE 5AK5A 2B8QA 3SSQA 2A42A 1RCHA 1RB0A 2E9ZA 2UVUA 4YOTA 1ZRMA 3I4HX 2C2EA 8ICHA 4JRQA 1MROB 2H3ZA 1UEVA 3MM7B 3VCBA 5F8JA 3O9UA 3VAJA 5CWRA 2QMXA 3DLRA 1XIQA 2QN6B 1NGBA 1ZQGA 1CPZA 1SPBP 3NWGA 1QVGR 3CETA 5KL8B 2HKEA 2CQPA 4FPIA 1RUSA 4EYIB 2XLKA 4PRFA 1QQMA 2DT9A 2W6LA 4ZH4A 1Q7YO 3AQEA 1X4DA 2HBRB 2YPYA 4EWTA 1DQ9A 1YDLA 3PW2A 4M5DB 1SXEA 1R8AA 4DFPA 1RISA 2HFSA 1LW0B 4NA3A 3O44A 3EEQA 3CE8A 1SC1B 2VWJA 1P1LA 5BPLA 4DV6F 2DJWA 3A8YA 3BB5A 2XMUA 3SBGA 4BRCA 4OHYA 2GHVC 2JH3A 3I32A 3HKZC 1S72S 2D41A 3RH4A 3BR8A 3DLJA 2CPXA 1NGFA 3AT1B 2CPDA 3OFFA 4HYKA 3M05A 2J5AA 1QLNA 4MK9A 3SD7A 2HSZA 1HYSA 4NA2A 4M5MA 2W9BA 4FW1A 5CHCB 5GADP 4ZVHA 2XIDA 5AKYA 2R7RA 1BVSA 7FDRA 2F44A 1GMWD 1PO6A 1VI7A 3KZIU 1S3XA 2CQIA 2G08A 5KOXA 5AQVA 1ECWA 5AK6A 5KFSA 5F41A 3BYRA 3TZZA 3CJ8A 2R7UA 2CUYA 3A0IX 1RGIA 1H3DA 4FPAA 3MMCA 5CZVA 2D6FC 3W5ZA 3ZDAA 3CXCR 4M6WB 1M1KT 4NLVA 1A6SA 5KFXA 4X62K 3IN5A 5ITHA 3MDAA 4OYPA 2LA4A 1NB2A 4LIWA 4RNHA 3SQGA 3NEKA 2GMJA 4B9LA 4B02A 4DR7F 4ZOSA 2F9TA 5D15A 5AK3A 4PY5A 4HH1A 1XR6A 2W9BB 3CCRN 8RUCA 1K9MO 2I9GA 1J53A 5IC4B 4KX3A 5H1SV 2NLWA 4BBYA 4PWUA 2BPGA 1Z26A 3H25A 1BISA 2D1CA 4F93B 2E5IA 3DOMA 3DXMA 2VC0A 1Q9YA 4FO0A 2HURA 5ALKA 3VF4A 3CD5A 3W2WB 2HNZA 4N8NA 5H9FK 4DR1K 2BCSA 3KZXA 2OSQA 2Q36A 4Y2MA 4QBUA 4JS5A 5D3GA 2W43A 3W1YC 1S79A 4FJ8A 1Q16B 2DNHA 3R9LA 2E5LK 4XA5A 2JWLA 2QX0A 5AKIA 3CCVN 4FZYA 2B21A 1X4HA 4Q0BA 2ASPA 5CP2A 3VEWA 4KV8A 5M2RA 5DB8A 1QDUB 2U1AA 4IG3A 4DQIA 1SI9A 2HBQB 2J8SA 3Q0AA 2YKMA 4OCZA 2IM0A 1VQPS 5B09A 2V9KA 2JDJA 5DG7A 3S1TA 2V6AA 4KITB 3CCTA 5T7BA 4HR2A 3K1RB 5ALTA 3JPOA 2IJFA 2QFJA 4NM2A 1Y64A 3NASA 3JAMO 3HZGA 3H98A 5SUHA 5F8HA 2G4BA 8ICXA 3DOMB 1RM6C 3DXMB 2MU2A 4QAGA 5F0XA 4GXIA 3HM9A 1JJ4A 5KNIA 4Q8FA 3RB6A 4ZMMA 4Z6DA 5C10A 5DB6A 2HNZB 3V4IB 3LDOA 2DXEA 4CEEA 3V1QA 4QZEA 4ISEA 4EHTA 2VPWB 5D3GB 3TSQA 3FR0A 3HYFA 3M6KA 4O5CA 3IGNA 3GYXB 3E66A 2Z1HA 3CJ7A 3QEBZ 4NOHA 3MMAA 2LPEA 2ZIUA 4Q0BB 2E2NA 3MXIA 3IWXA 1U02A 3W63A 5F8IA 4WQ4A 2DNNA 1CLQA 4JI4J 4IG3B 3C2LA 5ALFA 2YKMB 3KLIB 1U25A 4BE2A 4Z4IA 4OHWA 4EU0A 2KU7A 1H6KX 4FLUA 1ASWA 3HULA 2KJ8A 2E20A 3DC2A 3ENBA 1ZM2A 3TJAA 5JJBA 5AQQA 2IJNA 1HD0A 4UOFA 4URQU 4JD2A 5ADXA 1AXQA 1MNEA 3ZX0A 4CIFA 2P5VA 1QH9A 5K8MA 2XMKA 1JLGA 3G2XA 7ICMA 3F2BA 2GV1A 4QZIA 3VTHA 3U4LA 3I55N 3OYIA 3CPWR 5CR0A 1O5JA 2VJ5A 4F5QA 4I2QB 5B0DA 4BR9A 1WAJA 4C98A 4ECYA 5H2FU 4K7QA 2KHCA 4KC5A 1HD1A 2ZIUB 4KMUA 3GE9A 3NNCA 3M1YA 1A76A 4BC2A 4GV9A 5G5GA 4ES2A 3BGOP 3FFIA 2FVCA 2B9EA 5GAGU 4DUZJ 4C8YA 1NBWA 3RH6A 3R97A 1Z1BA 2GWJA 3T1YK 1CC8A 4W4MA 4UB4A 2MPUA 4IKAA 2FJXA 3VQDA 3Q8UA 1LV5A 1UAWA 4M5JA 1TL5A 2BJ3A 2W4DA 1K44A 4B8CA 4CO3A 4N77A 3KD1E 1B0PA 3HPHA 2C3UA 4ZCLA 2BV3A 3FMBA 3GOIA 3D66A 1KEKA 1CC7A 2DGWA 4NXMJ 1RT2A 1JLGB 1HWKA 4JI2F 4DV4J 1OKJA 4HEA9 4TQRA 2E5HA 1D9DA 1L7MA 1M5VC 3C16A 1T9UA 3O9TA 2Q79A 1BXNA 1PAUB 4MT1A 3TQ1A 2GWKA 2KSOA 3RAMA 2DY4A 2MYFA 1JK9B 1F9HA 3QUCA 1KQSR 2CRLA 1BL3A 2RDJA 1JMSA 3CP8A 1TL1A 4TLRA 2RIJA 2F4VF 2M9NA 4J9UE 2MB0B 5SWMA 4PYDA 3EGWB 3O3LA 2AJ0A 1HPMA 3SMVA 3L4BC 3NH0A 2XZDB 3LP0A 2PAVA 2E1YA 1ZQXA 3SCXA 1OH8A 3ZX3A 4WK3A 3NCIA 3HJEA 2ZWOA 4K4GA 3WNEA 3NS1A 3R7BB 1ZQQA 1MU2A 1VS3A 2ZQBA 2VQEK 1Z2LA 1RT2B 1DTQA 1NZ8A 5DQGA 1QCKA 4I64A 1XERA 2DB1A 3WT0A 3H7IA 3ZNUA 3SK3A 4A8OA 2LYBA 2BKOA 2O8EB 1KOHA 4KE5A 3WX4A 4F26A 3NFAA 4WJ3B 1TP7A 2EDUA 4G1QA 3C16B 4K0KF 2BPFA 1RBOB 3PIPL 1F2GA 2YKQA 3PNCA 1KAYA 2YQ0A 1V9OA 5L9NA 4ED5A 1WUDA 3E0FA 4AXIA 2YNHA 3V6KA 1ZZNA 3SPZA 4YORA 5E3CA 3NBPA 3DRSA 3LP0B 3ZC4A 2P9UA 1PAEX 1N62A 3DLGA 1WHVA 2FC0A 4DL0C 3RBEA 3WK6A 2HNDA 2IHNA 2MSTA 4IFVB 1FO1A 3VF2A 2DGUA 4OFZA 4MTPA 3LGHA 2FF6A 1DTQB 4NLQA 3KXDA 4USHA 2ZG6A 2N3OA 1S49A 4KB1A 3T79A 3MCPA 3ZT0A 5BR8F 1UQVA 2GW8A 4OPKA 3T1HF 1QSSA 1N5TA 1NSPA 3V1RA 2H5EA 4F4KA 4K4IA 4DV6K 2NXUA 4G1QB 3EGVA 2LHTA 4Z6EA 1ZQHA 3IRUA 3Q8KA 2UZAA 4M1KA 2VOOA 4M5GA 2M9KA 3NAIA 2GFFA 3MN5A 4AHUA 2WOMB 3W9HA 3KJQB 3OYMA 4FXDA 2GV9A 1CJVA 3KK2A 3QIOA 2VJVA 1I39A 3LK9A 2F3NA 4DEZA 2HW3A 2NSBA 2H1YA 4OLAA 1YWXA 4C3KA 4F5NA 3NBPB 2P9UB 1ACMB 5JMNA 3SR6A 4LD0A 3DLGB 2HNDB 4WIQA 3F53A 3G4SN 1H2UX 2IYGA 3AAPA 3TP2A 2E1ZA 1TFWA 1T9YA 2V68A 5L1KA 2CXYA 2DNZA 1FDDA 4GVLA 2B43A 3RJJA 4A47A 3EO3A 2R8IA 2FGOA 1U2VA 3FQLA 1V3SA 4ZVEA 4CFDA 5EX5A 4B3RK 1WNSA 1OSDA 3CMQA 5HLFA 1ZH5A 1D09B 3HK2A 1LOTB 3OW2R 1R3NA 4ILGB 2IGIA 2LP4A 1HX1A 4NM1A 2JEFA 2VC1A 2W2MP 3HMJG 3KK2B 3IAYA 4DR7K 3HTVA 4FYWB 3V9XA 2P6TA 2AH5A 2GNKA 1ZQUA 1E6YB 3OVAA 5F3XB 2HBZB 1TK5A 4C0HA 2LXIA 2A2CA 1Q0NA 1HWLA 2RAQA 1GMUA 1VQMS 3AU2A 1YRTA 2IDOA 2HMPA 2RLTA 4QZFA 1FXDA 4PCQA 2EI5A 3PHEA 1ZOTA 1RHUB 5FROA 3W3DA 2B5JA 4RPYA 3PW0A 1U2VB 4CJQA 1U2RA 4GXKA 4CJ3A 3J80Y 3QWPA 2A41A 3N4PA 4RW4A 4LF8J 2XI3A 2YH1A 5DGAA 4K2JA 5F2RA 3PVXA 1XNSA 1K5OA 4CGDA 4FOEA 3QT5A 4PHEA 1ZJNA 5L1JA 1B4SA 1BCOA 2V7YA 2VQFF 2VDIA 3NY0A 1G99A 1XMBA 2K4EA 1HQ2A 3VQCA 5J2JA 2FTRA 3W8PA 1MN9A 2OKQA 5LSLA 4CW7B 1OQ3A 2HS3A 5J0UA 4HT7A 5BN8A 4DSJA 2KQ2A 1TL7A 3DOLB 3CJ9A 5EU7A 2BR0A 1ZBHA 2ZJ8A 2V94A 3E58A 2IM3A 1PJ6A 1TK8A 4PYAA 1F9EB 2D3OR 2LMRA 3C7NA 4V19S 4CP5A 4DR5J 4ZLNA 2B5JB 3OTDA 1N5YA 2VA3A 5J2KA 1X5OA 3F56A 4ZVQB 4NLGA 2Q2RA 3S8SA 3QGGA 2FVRA 3QEPA 5M1NA 4C4SA 4CZLA 4JI8J 4B9UA 3EL2A 5IT9Y 1M5KC 1T6CA 4RW4B 3MAQA 1XC9A 2J6SA 4MO4A 1R7IA 4J9NA 3NMRA 2WB4A 3Q8LA 2HOIA 2G0IA 2LECA 4EELA 2H3QA 1VQ4N 3E51A 4M04A 3VQ7A 3TJ8A 2E6MA 2R4FA 1QJHA 5IFMA 1HR0F 3WIVA 2UUBJ 4FZZA 2K8CB 2HG4A 1OO0B 3ZTPA 1TVRA 3NNHA 2Q6CA 1R59O 1VYAA 4DB3A 3GU3A 1NSKL 3AUOA 4USJC 2RB7A 5FRMA 2FHJD 4NWBA 1VIOA 3LALA 4JI1J 3GR0A 1XNQJ 2EXUA 1N5YB 2B8PA 5ALEA 4OI4A 4BE0A 1UPPA 3ZDCA 1CZAN 4RNFA 5ALHA 2GX8A 2H3IA 4QS8A 1R0CB 2X1AA 4RBVA 2VZ9A 1NU0A 3NHGA 1S6QA 1LQ9A 2MKJA 3GONA 4MKYA 3E9PA 3CFRA 1TELA 4WU3A 4E2FB 3TARA 2RILA 2WZ1A 2I6WA 1UPHA 4GKKF 5HVFA 2WFAA 1QD1A 1TUVA 2KK0A 2BE7D 1JCGA 2Z1IA 4CGFA 1S5LU 1ZQKA 4CF9A 3N4MB 1C2PA 1RAFB 3I5CA 3JQKA 5GAHI 4IOXA 2HGNA 2RSQA 5F0UA 2V69A 2EK1A 4Q44A 1NGEA 1TVRB 3CD6S 3ETMA 5KAIU 3U27A 1NJIO 2A1JA 2H54B 3RSEA 3H42A 2V5HG 1D0EA 3C6UA 3BF3A 1T3QA 4DSLA 1WEZA 4ECXA 4DTPA 4MFCA 9ATCB 2DFLA 4JI2K 4ED6A 7ICOA 3CC2S 2QEXN 3WNGA 1YK9A 2J0QD 4RW7A 4OZ2A 3VGLA 4RQ7A 5D0EA 4U7UD 4K4YA 3SQ2A 1LKYA 3RFAA 2FSKA 5K14B 4M95A 1HW8A 3HHDA 2IM2A 1X3NA 4UATA 4J9OA 3ID8A 4OX9J 3L2QA 3AB4B 2N3LA 4CLYA 2F4VK 1FA0A 4M45A 1FFVA 4I2PB 3RAQA 1YQHA 5AI4A 4R66A 2GQQA 3RZAA 4QR2A 1KBRA 3N5BA 5A2QU 3EGZA 1K1SA 4BRDA 1BA1A 1LK7A 4MEYA 2VH7A 2ZVIA 3CCZA 5D49A 3RSEB 1KAZA 3A5MC 4H5RA 1CBKA 4M9GA 2CJKA 2F40A 2HDOA 4O3MA 1UW4A 3GSDA 2IVOA 3B6OA 3IG8A 2VKQA 4RT3A 3BJYA 3KWMA 5EOYA 2J6TA 4K0KK 1FX4A 5ETRA 4ZIWA 1BPEA 4BC3A 4P10A 9ICAA 4R65A 1FCAA 1RPLA 2DEJA 3HWTA 1RAOA 1FKAF 2HQFA 3ZDEA 4Y2CA 3A12A 2IDLA 1OMSA 5DGBA 3VF0B 3M8RA 2NRVA 4EO6A 4CJ7A 2RQMA 1S4FA 2YQEA 1SH2A 4RL1A 5AQXA 7ICHA 4OJ1A 2ZJAA 1X3MA 8ICNA 1ZQZA 2FUG9 3ENOA 2R7YA 4Q7AA 1NMEB 1U45A 1KKHA 4ZCKA 9ICRA 4KHMA 1SWWA 5CYJA 2BW2A 2ZGYA 3CT9A 1D8YA 1O08A 1RBLA 2F7VA 2R7SA 5EXWA 3AQOA 5BRHA 2E3TA 4YOVA 2ZWPA 3BKTA 5BR8K 2C2ZB 4P2SA 4O23A 4RPXA 4L6V3 4YDXA 3T1HK 3QT8A 1N32J 5A8KB 2QO3A 2CPIA 3M30A 3RJEA 1TK0A 4DX6A 4ECSA 3C19A 3GIJA 3D2EA 1VK0A 1RBAA 3EN9A 3H45C 5T41A 4F4WA 4PL8A 3QXGA 3EUNA 4FSVA 2AD9A 4I29A 1OXJA 2QA4N 2IVNA 3KKFA 3R5GA 4RNNA 2AJ1A 2LQ5A 4LF2A 4NMXA 5IINA 2Y0SF 3GYGA 5RUBA 4UOGA 1JQGA 3UD3P 3HRDD 2BOPA 4N76A 4Y2PA 1VQ6S 2PMWA 2MJNA 4XPEA 1R89A 2N82B 3LDNA 3W61A 2Y0SD 2E8PA 3OY9A 3L5KA 3WQPA 2WF9A 1PCAA 3WZ0A 1CULA 1S48A 1VRTB 3ZZZA 3ENAA 4DTUA 1IBLJ 5C2CA 4NXNJ 3NS5A 5CE3A 3KKAA 1LKZA 2RJZA 4M3ZA 4IFEA 3KDNA 2F9DA 4M9HA 3H0MB 5HR6A 2GC8A 3PYGA 4HH0A 4EZ9A 4EZ6A 4UUWA 3NGRA 4CF5A 2CQBA 1FRIA 3D2EB 3S3OA 1V38A 1HQUA 4DV7J 3NH1A 5AFUA 2F8KA 1Q8LA 3W65A 4ANCA 1J27A 1B7FA 3FZHA 3G96A 2RQCA 4HACA 2Q97A 4ZA1A 2OTJN 3K2YA 3D2FA 4CESA 5ALYA 5F8GA 1HNIB 1SIWB 2B4UA 5K4LA 4ZDNA 3HOSA 3AJDA 2HHVA 1Y5LB 4CEZA 1KLNA 4M7YA 1TL3A 1PZNA 4UZBA 4ANEA 2E29A 1F3VA 1C1CA 1DQAA 3T1AA 3BS7A 2FHKA 4HUFA 2X3DA 5HK4A 3MABA 1T11A 4M5LA 2IVMA 1UFWA 3MAAA 3MURP 1VDHA 1T9XA 3HJVA 3QGPA 3CJ0A 1T3NA 4JI3J 4L8RB 3I28A 3VQ8A 3Q8YA 8ICPA 3U3GA 2Z2LA 2AHOB 2JV3A 1HQUB 3K57A 1VISA 5HSPA 1W0HA 2VQFK 4CT8A 1Y10A 3HDSA 2HYIB 1OIAA 2ZM6J 3VQ5A 5DBCA 4HACB 4XTTA 3WK9A 5KAKA 3KDOA 1F6TA 2MGZA 3TI0A 3D2FB 2W40A 4RPFA 2E2PA 4ES3A 3RRGA 1S10A 2FPLA 2HFOA 5EN1A 1QAIA 3CCSS 3V9SA 1U8SA 3OV7A 1UCVA 1TL3B 2MAXA 3M9MB 1C1CB 3LGMA 2IBKA 2LYHA 1P27B 4JKFA 3HJFA 2AJQA 1ZTTA 3HVAA 2XZWA 5LY3A 1X8DA 2YX7A 4OX8A 3BR9A 1XQIA 3MMBA 1N33J 1SL1A 3ILOA 2P9IA 2A6MA 4M5HA 3FE1A 1ZA2B 4C3LA 1TKXA 3UVJB 1KVCA 2RF2A 1KQQA 1BLUA 3I76A 2YQ3A 2K3IA 3AA3A 4L73A 2F9WA 2NRWA 4AD6A 2EZZA 3NL0A 2IOHA 1P1TA 4J9PA 2Y8WA 1NAQA 3PIPQ 4QJFB 2JRZA 4BWJA 1F5CA 3HRGA 2LU2A 1VJQA 1IBKK 2ITGA 1S9GA 3ZZOA 4AHTA 3SXLA 4OQJA 3LDLA 9ICOA 3OHAA 2EFNA 1HR0K 5KFMA 2KZMA 2LMIA 4RZRA 3VC8A 3PM9A 4RQ3A 3LGNA 2MGZB 2HF4A 4FWKA 1RXWA 1K0VA 3DM2B 4B08A 1IN0A 4JP8A 3IUCA 4ES1A 3AVHA 2QT7A 2I38A 3CYMA 4LVSA 3HCXA 3DRPA 4AHSA 3AAWB 3CJAA 4ICLB 4CBWA 2K8BB 3T41A 3C65A 1ZQWA 2BH1A 2CH6A 3GDQA 3SCLE 3M2RB 3ZTOA 2EANA 1RHJB 4DR2F 4Y2TA 3G25A 3MMBB 2ZUAA 4X4UA 8ICVA 3UDLA 1J5EJ 4KPCA 3DDNA 2XS2A 5DDRC 4FLWA 2RF2B 4UW9A 1HNVA 3Q8VA 2VF3A 5LM7E 2Z58B 3UKUA 4QOTA 4C8KA 4UZCA 4GKKK 1KRPA 4OO1J 2AGOA 1ZPVA 4KLGA 5E33A 3HT3A 5J2PA 2P66A 2FIUA 3LDAA 2CQ2A 4DX5A 5JVGQ 1UVNA 2EQYA 3I1YA 1ZQDA 2IFXA 4PG4A 3VALA 2YJEA 2W25A 1M0SA 4Z7CA 1H72C 4AM7A 3HT0A 2O66A 1KN5A 1NM2A 1NJYA 4C2MA 1GLAG 1GMWA 1Y00A 2Y0SC 5AICA 3GU0A 3G6EN 3DFEA 3DRPB 4CTAB 1F5SA 4ZJLA 1CLFA 3NDKA 3QMLA 4O8UA 1NSQA 3CDWA 5CYMA 7FD1A 4NXMF 3VQTA 3I87A 2CVIA 4DV4F 4TU9A 1AT1B 4CZCA 1RTDA 1VQKN 3B82A 2IJRA 4DX8H 2M8HA 2NS1B 2HRYA 1BA0A 3TABA 2PE8A 1AW0A 5J2BA 4IOAL 2BBEA 1HNVB 2EFQA 2IVYA 3SAHA 1KFSA 4ISGA 1TAMA 1CZBA 2R8GA 3GFYA 4FXVA 1VFJA 1YJVA 1RWMB 1NJWA 3TTFA 3VPZA 1JJCB 3C1ZA 4KHQA 1VRQC 4LQ9A 3DRRB 4FNHA 3CCQN 3CC4N 1BIUA 3K0SA 5D46A 3NF9A 9ICKA 1TUGB 1TV9A 3N6NA 1S1TB 4KMOB 2BJ7A 5DBAA 4NLXA 3RU0A 1LNQA 5LSOA 3QEVA 3K5PA 4DTXA 2HGLA 5CZXA 5CYMB 2LKYA 4ECUA 4DCOB 5G4DA 4WZMA 3M8WA 1N6QA 3IMXA 4PPDA 1RTDB 3T5KA 4TNOA 4ILJA 3UIQA 2DQNB 5BYSA 1QHAA 4LH4A 3ULHA 2IHR1 1R8CA 2HEKA 3QT6A 4F50A 2LQJA 5BYQA 1DEJA 4R5PA 4EMDA 4FF1A 2W01A 3FZMA 4WIIA 4QZAA 3OT9A 3CB4A 1A5XA 4BRFA 1VQLN 3SBTA 3MXHP 1QTNB 1FKPB 5EE1A 2ASLA 3VAGA 1FTCA 2WVBA 1TV6A 1LWFA 3EYZA 2P9KB 3GP9A 2QKKA 4GC7A 2CDRB 5C2GA 4CM2A 3NKYA 2KNJA 1ZM3A 1NXIA 1HKGA 4CJWA 2OTLN 4HWIA 2A2DA 5AJ3J 4ID1A 2BQ3A 5AQTA 1L6NA 5EOZA 1ZTWA 4NLKA 2EBEA 4P2XA 1YZ7A 3U26A 2FLOA 5AE3A 1YGYA 1PKUA 1DLOA 2XQCA 1BQNB 2PSZA 2VGMA 2I5JA 1SKSA 2FC9A 3EZUA 4KGKA 1W7WA 4IH5A 4V19X 2PFNA 2HBYB 5I3QA 3AOBA 1U26A 1VSJA 2JRSA 2E8AA 4DV0J 1HNXF 1VQYA 4R5PB 3BQ0A 3HHLD 4CJEA 2AQ0A 2ZIWB 3DXKA 4CJUA 2RKIB 2DNYA 1GQEA 1X4CA 1VSIA 4FYYB 5A8WB 2MQPA 3ASMA 3LM2A 1L8OA 2R8HA 1OYEA 1V6HA 5IWAF 1VBYA 4ED2A 1VBXA 3OTQA 2KKZA 3LM9A 4FLZA 2HLTA 2KG1A 1RABB 4WBFA 1NM1A 1S1WA 2EHGA 3VGTA 4F92B 4UB5A 4NLTA 4PZOA 2FZKB 4I2IA 4DN0A 3OTEA 3PSPA 3OXFA 1L3UA 2QC3A 4RJVA 3CGIA 1PVPA 5ETPA 2JHEA 5KFUA 2DGQA 2V2KA 4FO6A 1ZQNA 3MM5A 1WKLA 3ZSYA 2QWLA 1K8KA 1UT5A 4FF3A 2ESEA 4H5WA 4FCYA 1DLOB 4O0NA 1X5SA 3BZKA 1VQ8S 4BRHA 4TQSA 3QZ7A 5A0LA 1CSJA 1H0HB 2I5JB 2WBRA 1YJNS 3C2PA 3FZKA 4H0YB 2CZVC 3AVJA 1FJGJ 1NHUA 3H1QA 1CJKA 5J0SA 4C0OC 2F1IA 4OYXA 1WSRA 1XI1A 3PSIA 2RQKA 4NCBA 2VANA 3WK8A 1SV4A 2K7JA 4O4RA 4HHJA 4PXEA 1NEEA 2ZH1A 1GNKA 2LVWA 1IKVA 1KFDA 4A2BA 2ZH5A 3FZFA 2BANA 3R6GB 2VKRA 1JNRB 4WP8A 5DDOC 1JJ2R 3C14A 2A6AA 1OSCA 3HSDA 1Q18A 3F41A 3FEYB 4K4SA 1IUJA 3CDEA 1AZSB 2EAMA 3JPQA 2X1FA 4LFCJ 1XBWA 4P0QA 4QIEA 1J5OA 5CJ7A 2EVZA 4LSZB 1GLCG 5B08A 1V85A 3WNHA 3SNNA 2ZUCA 5KG1A 2KG5A 1SXDA 3GV8B 3ZTRA 3OPXA 3CSKA 5ALZA 1RP5A 5J2FA 3MM5B 4ILHA 3QRQA 1HL6A 5FLXY 3J8AA 2F1HA 5JXSA 3ZETA 1S72N 2QMWA 1CJKB 4A59A 2J4RA 3RUBL 2GVDB 1VQ9S 3QGIA 4LF8F 2KEYA 3KLFB 5GAHP 1KVJA 4K4HA 3Q7BA 4MK8A 4FLTA 3DLKA 4HLBA 4IBNA 1KLMA 4HUEA 1JXBA 3I0RA 1IKVB 3TUJC 3H7HB 4Y6IA 4X4SA 3WKBA 2B4VA 4FZLA 2D0BA 1HKCA 1REVB 1ZQMA 1ZA1B 2DNPA 3KMSA 1U7LA 3BBBA 1ZQYA 4IOCQ 1R0AA 3LPUA 1QHTA 2LFVA 3MGJA 1J5OB 5KFEA 1T9VA 1RT1B 3PJXA 3VAHA 3BKFA 1WNEA 1DBDA 2XGQA 4WFAL 2G8KA 1KSPA 2X1BA 3P83D 5B66U 3CD7A 3BO4A 4QZHA 1Z4OA 4JEPA 1MMDA 4J2BA 2DXFA 4KN7A 1UA0A 2HMIA 3G8SA 1U1PA 3CJ4A 4ER8A 1NHVA 4BJQA 2XNQA 1VDVA 3R9PA 3GTYX 1KLMB 3U8XA 1SJFA 2OAUA 2FD2A 5HO4A 4V19J 2IOFA 2CQ4A 3SCIE 4RW6A 4QZGA 4CHQA 2IRYA 1DTTA 1K73T 3EW9A 9ICBA 3WBZA 1Z19A 4P4OA 2PMZF 2C3YA 1XR5A 3PXGa 1R0AB 2AEFA 4OJOA 2AEMA 4I2EA 3DAWA 3AGKA 5F8MA 4C23A 3NLCA 3ZI4A 4HUGA 2XMTA 4MDAA 4DQSA 4DR2K 2PMZD 2KHVA 3VAIA 5EVZA 1Q7LB 2YKOA 1WSFA 1H98A 1ZQJA 5L1IA 4JI1F 4A8MP 2JFKA 4CH7A 1XNQF 5D78A 3B6BA 4AQYK 2EG1A 2YWWA 3ZD9A 4WE1A 3FBBA 2HMIB 4PUOA 1WSJA 4RQ0A 3OPKA 2M7SA 2FSNA 2XNRA 1SV5A 1RLCL 3PY8A 4F8RA 2K4HA 3HHLC 4LR9A 1WTFA 3DGVA 3M1VA 4NPOA 3T69A 4OYZA 2HZVA 3TKAA 4NRTA 4RW6B 4YOXA 1S57A 5FPMA 5B5EU 1LCUA 3NWRA 1HHQA 5AI9A 1S0VA 3X3UA 2E2QA 2ILYA 3CO0P 2VIHA 4FJHA 3K8WA 3P4UB 4WTYA 3H8JA 4YB5A 3MR6A 4B17A 5GAEI 4X65J 9ICGA 4KO0A 4PGXA 5ALSA 5A8RB 5C2DA 3IRXB 1NUEA 1SC6A 3NF7A 2P9CA 3LPTA 3QU7A 4DV4K 7AT1B 1UTAA 3IAS9 2IRUA 2H65B 2RRDA 2YNIA 3VEYA 4I69A 5DM7Q 1J2NA 3WXKA 4YMMA 2R7OA 4OJGA 4WQ5C 4WE1B 4XRHA 3QO9A 1N60A 4FXWA 1SV5B 1K1QA 2J9CA 1WDTA 5L46A 1V3ZA 4CJKA 2P51A 2GUPA 3NG8A 4NEYA 4OX9F 3T1YJ 1RFQA 4RG8A 2QMUB 3U7JA 3CMAN 4IO1A 1EO1A 5ETVA 3ZLJA 3PJ9A 1IVZA 2OHDA 3ISZA 5KG2A 2XSJA 3PCOB 3TEHB 4TUPA 1F2HA 4MYUA 3AO1A 3LDPA 2PFQA 3OYDA 3MI7X 4WXOA 2MJUA 2DNQA 2FBYA 3D0PA 4DFMA 3TAEA 2ZIXB 4KO0B 1NDLA 2XHBA 1C1AA 2MKSA 1SVDA 1Q81T 1GFWB 1R43A 3SQ1A 3ZTQA 3MAHA 1DHMA 3QIPB 3CJBA 2YNIB 4NRUA 4J9QA 2PD1A 2P9GA 3WK4A 5AQLA 2G8UA 3SPYA 3QO9B 4W98A 3GPAA 3BO3A 3QBCA 4CBUA 1U6FA 1XSNA 4H4OB 4NZ6A 1FFUA 2HMXA 4BRAA 1A5WA 2VL1A 5B0BA 1E3MA 4UAVA 1HKAA 1MDUB 2WONB 2DVIA 2PN6A 4L3NA 2M5YA 2JH1A 2WF6A 3ZZPA 4CGJA 1RILA 5KFKA 2FZCB 2LEAA 3E8OA 3QX7A 5D0RA 2ZBIA 3LP3A 3AEVA 3L2UA 3HI0A 4B6JA 3UKRB 2VQEJ 2JWKA 2DR5A 4MMOA 4DPUA 3J81j 1SH0A 4IJAA 1HBOA 1WEXA 2RQ4A 3J81Y 2DPIA 2O8CB 1YVFA 1HWUA 2CNOB 3J7AN 4QR1A 4MK7A 1C7YA 2QYCA 1K73O 1N32F 4F5PA 2V4JB 4C3MA 3EPGA 2E7WA 2OIHA 1HIWA 1MC8A 3V81B 1HNXK 2A1BA 4IO9L 4IQMA 4F4XA 2OPRA 1HNWJ 2FVQA 5KG0A 1BPYA 1VR6A 3VA0A 2HVIA 4BR4A 4QYZJ 1BQXA 3VQ4A 4C8MA 2B6AB 4JKHA 1EB0A 3FBFA 5IWAK 2GO8A 2P6SA 4E7LA 3HSJA 2Z56B 3ZT2A 4K4VA 2JZ5A 2QE5A 2PT0A 3H59A 2IS3A 2C1EB 2SXLA 2O1PA 1WORA 1D3WA 2XMAA 1N5SA 4JKEA 4ZJQA 4FZNA 5D77A 5J0OA 1YJ9N 2FHJA 2QWPA 1CVJA 1HBOB 5T14A 1N56A 1IBLF 2QWNA 1Y5IB 3LZIA 4KH0B 4I2BA 3HHNB 2PMZC 2XULA 3ZZRA 4CF4A 2CFXA 5GAGI 4JS4A 4C48A 4CO4A 4Y2RA 5AK4A 1RI7A 1B3TA 2QGFB 1XK8A 5A2QO 5AI0A 2F8TA 2F9JA 2I7PA 3NTUA 1YTAA 3RYLA 3E1YA 3OFEA 4UAYA 3H5XA 2OPRB 2Z1JA 1S4EA 1RZTA 2HCFA 5HVHA 4DV7F 1HLWA 2ALYB 3AA9A 1A0OB 3P5BP 3C2MA 3MFHA 2IA0A 1UEKA 5KPZA 3K58A 4ZVUB 3MXJA 1H2VZ 2KD1A 2WF5A 1C0UB 4U7CA 3G71N 2X7IA 2QL7B 2W2PP 5AQRA 1ZQ1C 2QA2A 4KLTA 3MEEA 5I42A 3NGDA 3L6QA 4KHUA 5CCMA 3NVYA 4OLPA 2ZH3A 3M8PA 4PHPA 3CDAA 3LYSA 1WDDA 3HI9A 4LRFA 4B1UB 4B3RJ 1NGCA 2FSJA 5KQDA 3W62A <