2HW3A

T:o6-methyl-guanine pair in the polymerase postinsertion site (-1 basepair position)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*T)-3'
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hw3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hw3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hw3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hw3A01
4I2DA 4GC7A 1KRPA 3JPNA 1RTIA 2FBXA 4KLOA 1RT7A 4Z4CA 4DSJA 4QZBA 5KFLA 3MBYA 1XWLA 8ICBA 1VRTA 3LZIA 2ALZA 4YNQA 3VQ9A 1BL3A 4RPZA 1Z25A 4CHYA 3TABA 9ICPA 1S5JA 9ICOA 3UXPA 3MEGA 3C2MA 3GV5B 4CIFA 3VN5A 3AA5X 4CIEA 4KLUA 2OWOA 4BDPA 1WSEA 4C8NA 5KFKA 2NRWA 1WCLA 1R0AA 5BOMA 4JV2A 4IQUA 3HPGA 4J9QA 3A2FA 3LP2A 4JRQA 3IAYA 4QWBA 1CXQA 2F8SA 4M04A 3U3GA 4EBCA 4AHUA 3V7JA 4GMJB 3SV4A 4G3IA 3TFRA 3CFPA 3ZSOA 2RF2A 4L8RB 2VANA 3RJJA 4O4GA 4BWMA 4FLZA 3JPPA 1EKEA 1XI1A 5KG3A 4C8OA 7ICFA 3HP6A 4UQGA 2HNYA 4R64A 8ICXA 4CK2A 3UQ0A 3RWUA 5EU7A 1RTHA 3RB6A 4M6WB 1QQCA 3H4DA 3NF9A 2VWJA 2VA2A 5J2FA 2FPMA 4MFAA 2DPIA 3OYCA 5CHGA 1L3VA 4CJWA 2BHNA 5IIOA 5JUMA 3MEDA 4OGCA 1HNIA 3T5JA 3OS0A 4FJHA 4MEYA 3MDCA 3DMJA 5KFCA 1TK0A 1QLNA 5KG6A 5DBAA 4XRHA 1NOMA 1T4GA 2A1RA 4R5PA 5HRSA 4RW7A 4ZH4A 4CEFA 2ISOA 2BCUA 5KG7A 5J0WA 4QZDA 2HVIA 4KLTA 4Z4EA 4BDZA 2MUTB 1WSIA 8ICKA 3DOKA 3NCIA 4MFFA 3LZJA 4PHPA 1CLQA 2ZUDA 5IINA 4NY8A 1KDHA 2I5JA 1VK0A 2IS3A 4GC6A 1YT3A 2VG7A 4H4OA 1B43A 1ZJMA 3KIOA 4IFVA 3VQEA 2BCSA 2G8HA 1XHXA 1SL2A 3AO3A 2Z1GA 5T7BA 1D9FA 4P4MA 3O3GA 1NK5A 2BQRA 4O44A 2VG5A 5J0YA 3E2EA 1S1VA 1JLQA 3MDAA 3K57A 3V6JA 1TFRA 1U4BA 4RPYA 3K59A 1ZYQA 1KVCA 3NH0A 4JK1A 1KTQA 1QTMA 1JLFA 4C8MA 4UAYA 3M9MB 3VQBA 1TKXA 1SZPA 3QNOA 4KLEA 4F91B 3AVLA 5DB8A 4FJ8A 2QKKA 2XCAA 3OYGA 4TUSA 4KITB 1NKCA 3K5OA 4DOAA 1GOCA 1J53A 4RT3A 1JXLA 4Q43A 4I7FA 3RH4A 4I2JA 2HB5A 1ZQKA 3M9OB 3AVKA 4M41A 4N76A 1S1UA 3PNCA 5KFUA 3BGRA 2W9MA 4I29A 5EWEA 4LY7A 5KT4A 4KREA 4YR0A 3RRGA 4KB1A 5D46A 2DTUA 2JGUA 3K4GA 3OSPA 1RBTA 2GWSA 1CEZA 3LAMA 4DSIA 8ICUA 2X74A 4W5OA 4FK4A 3QEIA 9ICAA 1BPDA 1UT5A 4ELVA 1LV5A 4CCHA 2NRTA 3VQ6A 4I28A 4J9PA 4FBTA 2RDIA 9ICJA 1ZQIA 3MR6A 1VSKA 1C6VA 1W0HA 4IR9A 3V9SA 4IDKA 1RBVA 2W9AA 5HHIA 4CHQA 3SUOA 4RQ3A 3TR8A 5J2MA 3VA0A 4RNMA 3PMNA 1TV6A 4ID5A 1ZQQA 1VSMA 2KZ3A 4LVSA 3NGIA 3EWAA 1WN7A 2DFHA 1BI4A 1YVUA 5J0XA 3S3OA 3SJJA 3S3MA 4Z6EA 3OVNA 7ICJA 2G8WA 4PWDA 4E0DA 3DLKA 3M8RA 4CJ4A 4KHYA 3AVIA 5KFRA 4J9MA 9ICEA 3SQ1A 4RQ8A 3M8QA 2BPFA 5BPCA 1LW0A 1Q9XA 3HVTA 4ECYA 4PUOA 4HYKA 1C7YA 2GV9A 1X1PA 3H8SA 4Y1CA 4DL5A 1A5XA 1JIHA 5DMRA 4EP5A 3SCXA 2X6NA 1LWCA 1TL3A 1K1QA 3LWLA 4KLHA 2PI5A 8ICYA 4F4YA 4FJGA 1BVSA 2BQ3A 3KK1A 4O3RA 4J2AA 5HMMA 1HYSA 4PH5A 4NM1A 4KAZA 4UB1A 4DU3A 2OZMA 4BGDA 3V6DA 3EY1A 3SUNA 2ZJ5A 3BQ0A 4JV1A 1FKPA 4M3RA 2Y1IA 1WAFA 1RYRA 2HHTA 4TUPA 4QZEA 1QSSA 4KLDA 5FRMA 4DQPA 2B21A 1EX4A 4QZCA 1ZQCA 3DRSA 2P6RA 1S0VA 1TAUA 3TAQA 4O9MA 3ISDA 2R8GA 9ICIA 3M8PA 4ECZA 2YV0X 7ICMA 3WNFA 4LD0A 1T3NA 3C1ZA 1C1CA 1ZQOA 4F2SA 1J5OA 1JLGA 4O3OA 1ZBIA 1KFSA 3ITHA 2R8KA 4IQVA 2YNHA 5L1IA 4UB2A 2FLNA 2IOCA 4CGHA 3LPTA 1T05A 4FJIA 5KFWA 4M3UA 3H8JA 3PV8A 3TAFA 1JXBA 2WONA 3V9UA 4KRFA 3MABA 3RJKA 2DY4A 1LWFA 3I0SA 4K8ZA 4YXJA 3DLEA 4KLLA 3HP9A 4ED0A 3T19A 1NK0A 4J2BA 8ICCA 3V7KA 1B92A 3TQ1A 3C5FA 4ZTFA 4KPYA 4CFBA 4J9RA 4CF8A 1DGSA 9ICMA 3FYHA 3NH2A 3E01A 4CGIA 2MUTA 3AVGA 4CF2A 1EXQA 4CF9A 5BOLA 4FM0A 4HUEA 4EEYA 3AVHA 5SZTA 4I2EA 4E89A 3V7LA 4KLFA 3V1QA 2P66A 3MFHA 2FBTA 2JEFA 7ICRA 1Z00B 4CESA 4O5BA 5DG9A 5L1JA 4DSKA 4I2QA 1ZQSA 4M9NA 4QZHA 3C21A 1VSDA 4Q5VA 3HXMA 2IBKA 2RPIA 3AVCA 4RPXA 1HNVA 4Q8EA 2BR0A 4GXJA 4FLYA 4AHVA 4EYHB 3LP0A 5L1LA 1D8YA 3CFRA 7ICPA 1WNSA 4FM1A 3C23A 1S1TA 3NGYA 1WCNA 2RDJA 1XO1A 2AGQA 3ZCMA 2UVUA 3V6HA 4FLUA 3V6KA 4DL7A 1KVAA 8ICLA 4ECWA 4TSXA 4Z4GA 9ICLA 3VQPA 3K5NA 3H4BA 3PO4A 3KHLA 3UIQA 4LZGA 5J2NA 3AO4A 2XRIA 4JWMA 2G8KA 2AGPA 3V9XA 2FLLA 2A1JA 1RDBA 4PY5A 1SKRA 4FLXA 3TARA 3AVAA 4MF2A 4I2GA 5DQHA 4M3TA 3NH1A 3V81A 5L1KA 2DFLA 4F4KA 2HW3A 2XGPA 5J0UA 3OYMA 5KFDA 4CHOA 1RBRA 1BPZA 4DEZA 3V9WA 3D0PA 1B9DA 4CEBA 1S9EA 5DK5A 5KT2A 2DPJA 3TAMA 3PX0A 2FLPA 4CJEA 2A1SA 4N41A 3I0RA 4ECXA 1WAJA 1IKWA 7ICNA 1W9HA 4FK2A 1CZ9A 3L3VA 8ICHA 1FK9A 1K6YA 1ZQHA 4WE1A 4Q44A 4HCBA 1D5AA 5DG8A 3V72A 2BPCA 3HSTB 5HP4A 5KFEA 5DB6A 4KO0A 3C95A 4TQSA 3OYEA 3QEBZ 3LWMA 2YHBA 4CJVA 2YNIA 3UXNA 2HVHA 8ICAA 1J9AA 1CZBA 4ZTJA 2PYJA 3OYJA 3TFSA 2W8LA 4KHWA 4CGFA 3B0XA 7ICGA 4XUSA 3AO2A 3GILA 5J2AA 1UWBA 4NLNA 1EP4A 4GW6A 1S9FA 4M2YA 2XY5A 3C94A 2YNFA 3QZ8A 4KN4A 3JYTA 4FJ9A 1DLOA 1TV9A 7ICTA 1IM4A 3TAPA 2P6UA 3EPGA 4E7HA 4YMOA 2RKIA 4M9LA 1S6QA 3HPHA 3L2RA 3OHBA 1VSEA 2A1JB 4E7IA 1ZBHA 4AILC 1EETA 1VRUA 4YFUA 3Q8QB 3V4IA 1ZQUA 3KJVA 5DGAA 2FMQA 4IQWA 3ZSVA 1UT8A 4CEDA 4RQ1A 4FLWA 5CP2A 3H7IA 2BDPA 4OPJA 8ICOA 1AROP 3TAEA 1RDAA 2OPSA 4KMUA 4OGEA 1VSIA 3BQTA 2XY8A 1BISA 1SL0A 4W5QA 1WSGA 2YKNA 5J0TA 4OKJA 4M9HA 3ZSRA 4FLVA 3RMBA 2IAJA 3EZ5A 4DFKA 5J2JA 3T3FA 3C6TA 4CK3A 4YQWA 2W9BA 2BE2A 4QZ9A 2E6MA 1ZETA 1NKEA 1ZQGA 2Y1JA 3UXOA 4YCXA 4J2EA 3DM2A 1Z26A 4DTJA 1LB2B 4XA5A 5HHHA 5F9LA 4B8AB 2ASLA 2IHMA 1X9SA 4CHPA 4IBNA 2ZD1A 4M47A 2UVRA 1BHLA 3PO5A 2AU0A 4CHZA 4R8UB 5KFYA 4ELTA 3CM6A 1IKYA 3RMDA 5HROA 5KRTA 5KTQA 3KKRA 1BCOA 1RXWA 3OS1A 1Y88A 5DBCA 5IIJA 3HWTA 2OPRA 1HUOA 3PX6A 1KLNA 3AVJA 4KTWA 5KFNA 3EPIA 8ICNA 4UBCA 3ZSZA 2OYQA 2F8TA 4OKKA 3ZT2A 5J2QA 2XHBA 4W5RA 5J1EA 1BQNA 3P5JA 4DTUA 1IG9A 1HJPA 5J2HA 4K4HA 2J6UA 1RT4A 4YR2A 4B9VA 3OHAA 1ZJNA 3ISNC 8ICMA 1WSJA 4DLGA 3RR8A 1HJRA 4DLEA 4CEQA 8ICQA 4JUZA 3GV8B 4ECQA 4HCCA 9ICRA 1TKZA 1LW2A 3KD5E 4RW4A 3SPZA 4IFYA 3NF6A 5KFAA 3TI0A 2G8IA 4CEZA 1GOAA 4QWCA 4GVMA 1CXUA 1K1SA 4LH5A 4QW8A 1BGXT 2JEGA 5DGBA 3VQ4A 1Q8IA 1RDCA 4KI6A 1ZBUA 2V4RA 4B9LA 2BPGA 4QZAA 5KFIA 3HK2A 4EP4A 4CFCA 4OKEA 3K5MA 2KN7A 4I2HA 3K2PA 4OLBA 2JZBA 3AVNA 4I2PA 1TVAA 1ZQRA 1NOZA 4F5RA 4C8KA 1NJXA 4FJ5A 4P4PA 3AU6A 5J0RA 2W9BB 3QEWA 1S97A 3HVRA 1GOBA 4CERA 9ICSA 1QHTA 4F8RA 3NDKA 1Q9YA 1MC8A 4RUAA 3KTQA 1NOYA 4B9UA 3T5KA 4DQSA 5KT7A 4NLZA 4RQ2A 3QZ7A 2W9CB 4Z4FA 4M6WA 2B5JA 4CJKA 3AO5A 4DU4A 1NK8A 2J6SA 4KHSA 5KG0A 5HRRA 3Q8RB 4M9JA 2ZQBA 1QSYA 7ICKA 3AVMA 3NGDA 3WNGA 3C1YA 4GXKA 4BXOB 7ICIA 3ZT4A 3PVXA 4DFMA 1S0OA 2FBVA 1MQ2A 3Q8KA 3B6OA 3OYBA 3BQ2A 3NHGA 4YN4A 3QNNA 4UB5A 1ZQDA 2B6AA 5IIKA 3Q8LA 4RQ4A 1RT6A 1QS4A 4OLAA 8ICRA 4F92B 3VQQA 8ICPA 4O5CA 2Z1IA 5L9XA 1T7PA 4QAGA 3G6VA 5CY4A 3MGHA 3KLIA 3VQCA 1SKWA 3RB4A 1RBSA 3P1GA 3GDXA 1ZQLA 3QLHA 3VQDA 2E6LA 3ORYA 2W8KA 3BQ1A 2V4QA 4C8LA 5DB9A 3VQ7A 5J0QA 1HYVA 4E1MA 4PGQA 3H40A 4PA1A 4Z6DA 2O4GA 4NXZA 5HRPA 9ICUA 4DU1A 1O1WA 1Y97A 1JLBA 4F50A 1FKOA 8ICTA 2FPLA 3RJFA 4CJRA 4F2RA 1X2IA 1UOCA 3G6YA 4YMMA 5KRSA 4BWJA 3PW7A 3Q8PB 3Q8SB 5KFVA 2X78A 3HYFA 4NM2A 4B9NA 1KSPA 4QW9A 3NAEA 1RTJA 4ED8A 4CGJA 5HNKA 8ICZA 4BDYA 4KTZA 5KG5A 2KFZA 2D0CA 4J2DA 1IKXA 2JZBB 3PW4A 5J2DA 3DLHA 4KLMA 4DQQA 2YHAA 2AQ4A 1NJWA 4YD2A 3PUFA 4M3YA 4TURA 1RT3A 3S9HA 1ZQXA 1UA0A 2PY5A 4QZFA 4QWEA 3DOLA 1BIZA 4K8XA 5J0OA 3H8WA 3I8DA 3ULDA 1TKDA 4FM2A 1L3SA 2VG6A 4DTNA 3ZT1A 5CR0A 4J9NA 2C2DA 1A5VA 4MQ3A 5J0PA 4R65A 2Q3SA 4E3SA 3RTVA 3OJSA 3T1AA 2H5XA 2HHQA 1ZQFA 4BXOA 4M9GA 4W5NA 4CJTA 4PHDA 3QIOA 1SUQA 1VSFA 3MR3A 3HX0A 4E7LA 3L2VA 2HMIA 2OPPA 4F3OA 7ICQA 3OY9A 2XO7A 3F9KA 1RT5A 3GIMA 3K5LA 3MXJA 1RT2A 1B9FA 3U3YA 3B0YA 1ASUA 3AUOA 1ZQZA 2XY6A 3SI6A 1REVA 3MGIA 3QEXA 4M3ZA 4NCAA 1L3UA 1H38A 4Q45A 4NYNA 1ZQBA 4DS5A 5FDLA 1L5UA 2Z1JA 1HUZA 2KZZA 4DMNA 1BIUA 1NK7A 4DQIA 4Z4IA 4KLSA 4I9QA 3LP1A 4UAZA 2VA3A 4DTXA 2BGGA 4RNOA 3UQ2A 5HBMA 4KHNA 3O3HA 1BCMA 3KLHA 5DB7A 3G0ZA 4Z6CA 4DSEA 2C28A 4YVZA 4ICLA 4CJ3A 4B9TA 1XSPA 3RB3A 2LYHA 3SYZA 3JSMA 3ISBA 5KG2A 3KD1E 4KV8A 4DQRA 4I2IA 1D9DA 4YMNA 3ZDCA 4CFDA 4AHRA 2AQ0A 3OGUA 1S77D 3MECA 3G10A 4ED3A 1VSLA 9ICGA 4CF0A 4NLGA 3KHHA 3KLGA 4F3TA 3VQAA 9ICXA 3MFIA 4QZGA 3PY8A 4HUFA 4ED6A 4KKOA 3RR7A 1XSLA 3QETA 1ASWA 4GLXA 4QWDA 3VA3A 4F4WA 1YTUA 4ED1A 3WNEA 3LANA 2IDOA 2G8UA 3SV3A 2QKBA 2D0AA 4TUQA 3L8BA 4O3NA 5TZVA 3SUPA 3CFOA 3JPQA 3LDSA 4IRDA 2BKEA 3KLEA 1NK6A 1WSFA 4ECSA 3ZDBA 4FW1A 4IG0A 5J2PA 1JLEA 4DL4A 1EXNA 3V1RA 1F21A 1BPYA 4RQ5A 3AA4A 4I2CA 5C24A 5IIIA 4K4IA 1ZQTA 3OYHA 9ICTA 5FROA 2HNDA 1QSLA 4E19A 2Q0ZX 4M0AA 2RN2A 4O0IA 4F5NA 2IHNA 3PW0A 3PMLA 5KFZA 3LPUA 3JPSA 4J9SA 4ECUA 3ZD9A 5J2IA 3N4MB 1HMVA 5KG1A 4MEXA 2ITGA 3VQ5A 4CHNA 2C22A 4YP3A 4H4MA 5KFOA 4HUGA 1TAQA 4FZZA 3MXIA 2ZJAA 5KT3A 5KFXA 1FXXA 8ICSA 3TWHA 3ALYA 3HO1A 5EOZA 3RAXA 4M42A 1DOQA 3NE6A 3ZSWA 4FVMA 1LAVA 1IXRA 2D0BA 4CJPA 1IH7A 4Z0UA 2PFPA 3QE9Y 4F5QA 2V9WA 5DQIA 8ICJA 7ICSA 4CGGA 4G1QA 1G15A 4DF8A 1S1WA 3PR4A 3PX4A 2P51A 1MU2A 3OYAA 1V9PA 3SQ2A 4HVJA 5KT5A 5J2EA 9ICKA 4AHTA 3IHQB 5J2CA 4DTSA 4Q0BA 4FZXC 4YD1A 5IILA 1BPBA 2MAXA 3HM9A 3QERA 4O3QA 1JXEA 2P1JA 5C5JA 1NK4A 4E7KA 5KFJA 4LH4A 1XSNA 4Y1DA 3ZSQA 2B4JA 2P5OA 2BCQA 1S10A 1DTTA 3L2QA 5EWGA 3VQ8A 1BQMA 4XIUA 4DFPA 1RYSA 4KHUA 3K58A 4I2BA 2ZUBA 4MF8A 4DWIA 4CK1A 1WLJA 1X9WA 4RU9A 4B8CA 1U04A 5DKWA 2HHVA 3TANA 1ZQVA 8ICEA 4QWAA 3FDSA 4J9OA 3MXMA 5D3GA 3OYKA 3C2KA 1XHZA 2NUBA 3HJFA 2XGQA 2HNZA 3AA3A 3O4QA 4B9SA 5HP1A 3HT3A 2BCVA 4FCYA 2Z1HA 3MR5A 1RT1A 3LDAA 2LSNA 2M9NA 2X6SA 3T5LA 1ZQNA 1HPZA 9ICVA 1JKHA 4DTRA 4CEEA 3ZT0A 2JLEA 2IGIA 3KHGA 5C25A 4KB0A 3IS9A 1A5WA 4ECVA 3MR2A 3ZSYA 3ZDAA 4FJNA 4H8KA 2ETJA 8ICWA 1I3AA 4ZHRA 4LSNA 1KFTA 4F4ZA 2ZTCA 3JPTA 4CEOA 5C42A 4DOBA 4RQ0A 3C5GA 1BPEA 1C1AA 2ZUCA 2GBZA 9ICFA 4CEAA 3K75D 4EZ9A 3RJIA 1D8LA 4FK0A 1S0MA 5FRNA 2JEIA 4BE0A 1A77A 1X9MA 3SUQA 3NGZA 4CJFA 8ICIA 1RTDA 3C2LA 2OPQA 5CYQA 2KW4A 4OPKA 1ZQJA 3QEVA 4P4OA 4J9KA 1S76D 1WSHA 3OYFA 1COOA 4RW9A 2FMPA 7ICHA 4F5OA 2VA8A 5KFSA 4ELUA 3L3UA 3D45A 3LK9A 1U45A 4AHSA 2IMWP 2ASJA 1JX4A 1ZQAA 1RDDA 4RZRA 3QINA 3SPYA 3CG7A 1SV5A 1NKBA 4BE2A 1JLAA 3MEEA 4CJ5A 4CE9A 8ICVA 5KT6A 3OYDA 4NCGA 4I27A 3QEAZ 3IM1A 5KGWA 3NTUA 4DTOA 3P83D 3AVBA 1TKTA 1YTAA 3TAGA 1XC9A 4F4XA 9ICBA 1ITGA 4BACA 2GUIA 1T8EA 3L2WA 4OVLA 2XCPA 1C0UA 1ZQMA 4FS1A 1SL1A 2OA8A 4HTUA 4PGYA 4JV0A 4IKFA 5DBBA 5KG4A 5DLGA 2YKMA 5J2KA 3DYAA 1JL1A 4EZ6A 5CJ7A 1KVBA 9ICCA 4N5SA 2HHSA 4NCBA 5KFBA 1ZQPA 1JL2A 5KFMA 5CWRA 1KCFA 1MQ3A 5J2GA 2QK9A 5CA7A 2ZTDA 3QO9A 4DL2A 4MFCA 3GIJA 1NJZA 3IRXA 1L3TA 1KLMA 4KN7A 5KFPA 3OYLA 1HQUA 5I3UA 4YXMA 3ASMA 3T5HA 4DTPA 4HHTA 4O0JA 3DLGA 2FC0A 4CIGA 3IG1A 4RQ6A 5E41A 3KK2A 4Z6FA 4FW2A 3S3NA 3JPRA 1RPLA 5D4BA 4JRPA 4Z4HA 2O4IA 3SQ4A 5JS1A 2ISPA 1C0TA 1BI4B 4KFBA 3ZSXA 4AHCA 3JPOA 3LAKA 2W42A 5HRNA 3DLBA 3DRRA 3DLRA 3BJYA 5CYMA 5KFFA 3NFAA 4PPXA 4IRKA 4JWNA 3DRPA 3HW8A 2R7YA 5DLFA 3RAQA 2KTQA 4UBBA 2E4LA 4FZYA 4FJXA 4FYDA 7ICOA 2VWKA 2F1JA 5KFGA 4IR1A 4I2AA 5KFTA 3BDPA 5CZ2A 3U6FA 4FJLA 2PI4A 4M3WA 1S9GA 4JS5A 2HHWA 1HQEA 2FPKA 4F5PA 4FBUA 2ZTEA 3AV9A 2BCRA 4GXIA 2KZMA 4FLTA 2JEJA 1I39A 4LSLA 3KKSA 1TVRA 5JS2A 4MFBA 4K4GA 5KFHA 5DG7A 4JLHA 3GFKB 3L2UA 1UA1A 3ZD8A 3H08A 2P5GA 4PGXA 1MSWD 5KI6A 4UAWA 5CZ1A 2HHXA 4KHQA 4KLIA 1U47A 4RUCA 2YNGA 3AA2A 4EBEA 3ZT3A 4ECRA 2ASDA 4CF1A 3SZ2A 4DL6A 4CJLA 3CQ8A 1NJYA 4N47A 4R66A 4KLJA 1ZQWA 1CUKA 8ICGA 2EHGA 1ZQYA 1BPXA 1J54A 3KLFA 3RJEA 4P2HA 4RW6A 3GIKA 9ICWA 7ICUA 1N56A 1XU4A 2DFFA 3SI8A 3ZDEA 3QEPA 1N6QA 2PYLA 3N97B 4QOZB 1UAXA 1S1XA 2G8FA 3RH5A 4CJUA 1ZBLA 4QCLA 2F1HA 4DS4A 4O55A 2PZSA 3OS2A 4RW8A 1RILA 2C2RA 2R8JA 1Z00A 1VSJA 3GV7B 1RXVA 3ETLA 4CFAA 3NF8A 1C1BA 3G6XA 3KK3A 3RH6A 2AGOA 2I1QA 2BANA 4O3PA 7ICEA 1VSHA 2D5RA 2IA6A 1U49A 2J6TA 4FS2A 3PW5A 1T03A 2R8IA 3AO1A 3RB0A 1RCHA 4Q8FA 2OZSA 2UVWA 1TK5A 4DSLA 4KI4A 3GQCA 3RBDA 4F93B 2PFQA 4CJSA 3OYNA 4KTQA 1PZNA 4PHAA 9ICQA 4UB4A 2ZJ8A 4NLKA 1RZTA 2XY7A 2WOMA 4DSFA 1DTQA 2NRVA 5F9NA 2BQUA 4CJQA 3CYMA 4J9LA 4I9LA 4TQRA 3C6UA 4IRCA 1ASVA 3THVA 4DO9A 2NRZA 4ED2A 1XS9D 4O5EA 4ID1A 4EYIB 4CGDA 4DFJA 4FJJA 4I2FA 1LAWA 5I42A 4ECTA 3OSNA 3RMCA 4YG2A 2F96A 3KHRA 4LZDA 4KLGA 4M45A 2FMSA 4B9MA 4FJ7A 2WTFA 5KGXA 2F1IA 3V1OA 5J2BA 4RG8A 1HRHA 3HL8A 4QZIA 3OYIA 3V9ZA 2KFNA 4QZ8A 2AJQA 3UPQA 4AH9A 3AVFA 1HYZA 4IG3A 2PFOA 2PFNA 5SWMA 3OJUA 4PQUA 3RJGA 4B08A 3EYZA 1QE1A 4FXDA 4O5KA 3B6PA 5J29A 2ZE2A 4EBDA 3QESA 5IIMA 2PXIA 3RJHA 4FJKA 4RNNA 3MAQA 2QXFA 4ED7A 1TK8A 1RNHA 3PR5B 1TGOA 3FFIA 4IQTA 4PHEA 1U48A 4OJRA 2DFEA 4RT2A 2NRXA 2EX3A 4FO6A 1S0NA 2KQ2A 4XQ8A 1N48A 3WNHA 4DOCA 3RBEA 4X5VA 1B22A 3O4NA 4R8UA 4B3OA 4E7JA 1S6PA 3M8SA 5K14A 4R63A 7ICLA 1NK9A 1Z3EB 5CB1A 3ISCA 3Q8MA 1A76A 4CECA 2G8VA 3F73A 2I9GA 1ZQEA 3M9NB 5HLFA 4N56A 2HHUA 5HMLA 3O3FA 5J0SA 1JMSA 2C2EA 3SNNA 2W9CA 4NYFA 5DDYA 3LALA 4BE1A 1N5YA 2XC9A 4FJMA 4DG1A 2ATQA 2UVVA 1C0MA 3RRHA 4DL3A 4M3XA 4JS4A 3SQ0A 4RQ7A 3GIIA 3NF7A 4DTMA 2ATLA 1JLCA 2BGWA 5EWFA 4YFKA 5D49A 1JN3A 2IC3A 2FBYA 5KFQA 4UB3A 8ICFA 9ICHA 1RBUA 1KFDA 1KEJA 3HPOA 3CM5A 9ICNA 1TL1A 4YR3A 1LWEA 4E1NA 3LP3A 3QIPA 4DF4A 7ICVA 1IO2A 3AU2A 3DI6A 4KLQA 2R8HA 4W5TA 5DDMA 1ZBFA 1SKSA 1IKVA 1U9LA 3ZDDA 3RMAA 5DQGA 3NBPA 4O3SA 3EW9A 3PW2A
chains in the Genus database with same CATH superfamily
3KG4A 4I2DA 2ZWHA 1KRPA 7FDRA 4CE6A 1IBMJ 1OWXA 3AQOA 2HNDB 3U1MA 1RT7A 4NCGB 2ZIXA 1V5VA 4QZVB 4F3MA 5KFLA 4DR6K 1VRTA 1KW4A 1BL3A 2E9TA 3CIPA 5IM0B 3RSEA 4MMOA 3KOAA 5AQLA 1Z25A 1U6FA 4MK8A 4ILGB 5B0AA 9ICOA 3Q89A 3UXPA 3MEGA 3OLBA 2YQEA 2IVYA 4OJHA 1M5SA 4OX7A 2XYPB 1JJHA 4JV2A 2G09A 2VONA 4J9QA 5GAGU 4AQYF 4HACA 4OYWA 3HJEA 1U7LA 1XNRF 2WC9A 3UCGA 1ULRA 4DN9A 3ZX0A 3K1ZA 3V7JA 3IXQA 4GMJB 4G3IA 2G9OA 3EKSA 1NUEA 3ZSOA 4NPOA 5B09A 2VANA 4O4GA 1PO6A 4FLZA 1EKEA 4Q0BB 1RBOB 3HD2A 3TSQA 1B0XA 3HP6A 4UQGA 4PKDB 4NL9A 4EO8A 4R64A 4CK2A 1H72C 3GOIA 3H4DA 4LF4J 3W63A 3NF9A 4MFAA 3GZ7A 1L8LA 5LMUF 2BHNA 1HNIA 3T5JA 3PSIA 3QWUA 1CI4A 2GGPB 3MDCA 1MLAA 5F3TA 1TK0A 3NS6A 2IRXA 4ZPDA 3KMSA 2A1AA 5DBAA 2ZJQL 3O6WA 4UW9A 1RT2B 2YKNB 4H4OB 3BEXA 4RW9B 4IL6U 2CKWA 2Y9UA 2F4FA 1P27B 2NCKL 3Q2TC 2F65A 2F9DA 1VLBA 5J2QB 4R5PA 3VENA 4BRCA 1CBKA 4RW7A 5HRSA 4JP8A 2DRBA 2W6LA 5KG7A 5J0WA 4ZVPB 1BC6A 5DZ6A 2XICA 3OFGA 4KLTA 4BDZA 3ZZRA 2V52B 2OKQA 4RKUC 2D0PA 4CO5A 1WWUA 3LZJA 4YOWA 2WSFC 2BE9B 5IINA 2E5LF 4LF2A 4R5PB 2NZTA 2DTJA 2FYXA 5AQNA 2ROPA 3O0FA 4HI2A 1YT3A 1V3RA 1BWVA 1B43A 4IFVA 1CJTA 1VR6A 2G8HA 3CCRN 2CDQA 2AHOB 4WJ3B 3RJMB 1M90O 2EFGA 3KMQA 5T7BA 3IV6A 3AM9A 4DR5J 5M2RA 4O44A 3H59A 1JLQA 3MDAA 2GQCA 2WHOA 4EI2A 1W2BM 4UB8U 2ZNYA 4PL8A 1QTMA 3WXKA 3SQOP 5IWAK 3BS9A 3D0HE 1RLCL 1APSA 4DU8A 3ILOA 2R2RA 2XM3A 3NVMA 3VQBA 2VFRA 4F91B 1FFGB 2KO1A 3AVLA 3AQFA 5DB8A 5AI8A 4YDXA 4BC4A 4YB5A 2FPHX 4G1IA 2FSJA 1GOCA 3HSGA 4EX7A 3TNVA 3D54A 3F9MA 2ES6A 5F2RA 1OSDA 3RH4A 4JKGA 1X66A 1ZQKA 1TL7B 2IJFA 1PYTA 4M1KA 1NSKL 3B4DA 4M41A 4B3SK 4UOHA 4DR3J 5F0UA 3G82B 2WCXA 2XO6A 1AFJA 5KT4A 2VZ9A 4KREA 2HBMA 4XH5A 4KHPK 5D46A 3CMAS 3U26A 3FCVA 4DB3A 2GWSA 4DSIA 1ITPA 1SUQB 2N7CA 1Y9OA 4W5OA 1CG2A 3QFHA 1UT5A 1OJ4A 4ELVA 1LV5A 1B0VA 3HKZC 3L4IA 4DV6K 3M1VB 1T3OA 4FBTA 2AYBA 3VQTA 1Y5IB 5ALZA 1W0HA 4IR9A 1MN7A 2W9AA 2H51B 2GS8A 4CHQA 3ITHB 2KG5A 4RQ3A 1N34F 3TR8A 3TSPA 3DLLL 1RTDB 3NS7B 1IN0A 2WAQD 3R8YA 5HMZA 2CQ1A 3DHXA 1J6ZA 3JAMO 5G4DA 1VSMA 2KZ3A 4LVSA 2FE9A 3EWAA 1WN7A 2DFHA 2F9TA 2DR7A 4WCEQ 4B3RK 1T9YA 5J0XA 5AQRA 3SJJA 3S3MA 1LWCB 2EK6A 4E0DA 4OYOA 2NRHA 3DLKA 2ILYA 4J90A 1HNXJ 2V4JA 1AFIA 4PR6A 3F2BA 1LXNA 3R9KA 3U02A 5BPCA 1JB0C 1LW0A 4J9VA 2QFJA 2FLOA 2XQCA 2ZH6A 3HKWA 1T6CA 4HYKA 4MYUA 2LQBA 1A5XA 3UR0A 1NDLA 5LL6d 3WIVA 1VGYA 1JIHA 1H2TZ 1QUVA 2A2CA 4IOBA 1K1QA 3D2EA 1LW0B 8ICYA 4FJGA 3DDKA 5HOOA 1ZD2P 2MYFA 3EY1A 2QFIA 2ASPA 3SUNA 4OHWA 1HBUA 4JV1A 1FKPA 2VPZB 5CXTA 3VQSA 3M3ZA 4M3RA 2Y1IA 1WAFA 5AQPA 2DK2A 2DKZA 1K8AO 2B21A 1EX4A 3H0RB 2HBYB 2C3MA 4R0JA 1J27A 3VZHA 2MZRA 1S0VA 3BKTA 1NGGA 1BNOA 3TAQA 3P8BB 3SAFA 2R8GA 9ICIA 3S8SA 2CJAA 4NE9C 4A8EA 7ICMA 4OIXA 1U6BA 2CH5A 2Y9HA 4WFAQ 1ZQOA 4KE5A 1MMLA 2KN4A 2XNQA 4RW8B 2XSJB 4O3OA 5HP1B 1WBBA 3TADA 3HZEA 2FLNA 2JVOA 4TU9A 2K89A 4USIA 4ZN1A 2LBOA 4M5IA 4QPXA 3PV8A 4JMUA 1ECWA 1IBKJ 1AUSL 2WONA 1NJIO 3RJKA 2OPQB 3C19A 3EO3A 4K8ZA 3HP9A 1JCFA 4P0QA 2OAUA 4J2BA 2CQ4A 3JSYA 4ZPCA 3V7KA 3TQ1A 5E5NA 4KPYA 2E2PA 4CFBA 1WUUA 2W4CA 3UNGC 2QARA 2AYEA 1GXTA 2DGOA 4Z7YA 2HHPA 3LW5C 3VV2B 3NH2A 5HK4A 4CF9A 4FM0A 4HUEA 4EEYA 3AVHA 5SZTA 3MDQA 4KLFA 3V1QA 1FKPB 2RE2A 3KXDA 4HTIA 2KVCA 1TL3B 1RT5B 2JEFA 7ICRA 5C42B 1IQZA 1WF2A 1WTFA 4QR1A 5HAOA 4CESA 3CCZA 4A8FA 1N5TA 3UDEA 4QZHA 3C21A 3AN1A 2GEMA 3AVCA 3FRZA 4NV0A 4RPXA 1HNVA 4PQUB 4GXJA 4FLYA 3MEEB 3GB0A 3UCZP 3FAHA 4ANDA 3DYAB 4ZPWR 3CFRA 2E88A 2DNGA 4JI8K 4K0KK 3NGYA 1WCNA 3KKAA 3H90A 2RDJA 1BE4A 1XO1A 2F8EX 1MWYA 2HNYB 4FLUA 3V6KA 5A0LA 4DL7A 1KVAA 3JQJA 3M2UB 4Z7CA 4LR8A 4GY2B 1XR5A 3KWGA 2GX8A 3K5NA 3UIQA 4OX8A 4RBVA 5J2NA 2O01C 4MT1A 1IBCB 4IKAA 2KYXA 5CAAA 5I3PA 4ILLA 2ESEA 2L3MA 2FLLA 1RDBA 1RT1B 4FLXA 1UW9A 3TARA 3AVAA 3NCQA 1J5OB 3D6RA 4I56A 3BZCA 2ZOMA 4ISGA 3NH1A 3V81A 4GNIA 2ZXIA 1PC5A 5L1KA 4F4KA 1FRLA 5IWAJ 1PC4A 2OCEA 2JDJA 3WK9A 2Z2ZA 3J7ZT 3JQMA 2YNIB 3TAMA 5K20B 3A5OC 1KQQA 3I0RA 2BACA 1WAJA 3I5CA 3ZX2A 1G6BA 2VOOA 5ALDA 1S6PB 3HHLC 5EX5A 4JHDB 5DRKA 3SLCA 2FDNA 4L73A 2DUYA 2LM1A 1IWGA 5ALQA 4ISFA 3V72A 2BANB 1YBAA 3MMBA 2DNLA 2X3GA 5HMWA 4X4RA 3OYEA 3LWMA 3H2VE 1S99A 3S6EA 1CZBA 2AXTU 2PYJA 2PFFB 5ETOA 4ZA1A 2W8LA 2HWIA 4KHWA 2JRZA 2GVZB 4WFBQ 2J4RA 1CJUA 1NGCA 5E0OA 3PEJA 2G0CA 3C94A 1OIAA 4ID8A 3JYTA 1YIJS 3FJ2A 3QYPA 4B3MK 1UL3A 5MLCV 1WUDA 3ZNJ1 2VGMA 1CQNA 7ICTA 3CIZA 2I7NA 2W3SA 4FZMA 2BRKA 2XMTA 5B0GA 3EPGA 2CZVC 3EM1A 2EK1A 5DDRC 1GLLO 2VFTA 2QE5A 3HPHA 1F0XA 1YRTA 5F8HA 3L2RA 3OTCA 3B4MA 1HNWF 4X62J 1VSEA 3QUCA 5DM7Q 1A7GE 1S49A 1TKXB 1K73T 2RU9A 5DGAA 5AQXA 4OJ3A 3CC4S 3I4PA 4NLRA 5JLHA 2Q36A 4CEDA 4RQ1A 1VQ8S 2FD2A 4DX5A 1B99A 4ZS6A 3TVZA 3L4QA 1AROP 3D28A 4ZP7A 3PFOA 1KD1O 2OPSA 2HLUA 1HBMA 1YK9A 3UDCA 2CAJA 2XY8A 1WSVA 1FJGF 1BISA 4YDUA 4TYBA 4WFXA 1VQON 3HHLB 1NGIA 2IAJA 4TLRA 2I8EA 2CNNB 4F9OA 4OZ3A 3UB5A 3I5BA 2A40A 2CGKA 2W9BA 4BR0A 1PKUA 2EI5A 1ZQGA 2HOFA 3KZXA 4FF4A 4XA5A 4U7BA 1S1XB 3MPWA 2PMHA 4CHPA 2M3DA 1FT8A 2K1RA 4IBNA 4JKGB 3MEDB 1MDUB 3PO5A 3GJTB 4F25A 4BRQA 2JXJA 4RX6A 1K0TA 3KG1A 2CJKA 4A8MP 4TVAB 1IKYA 4PJ0U 2LP4A 5KRTA 5KTQA 1VQ7N 2A19A 3KKRA 1CQMA 1BCOA 4ZOHC 3VEYA 2YWHA 3M5RA 4ZCKA 4HEA9 4PL7A 5IIJA 5H9FJ 5CYJA 3DEEA 4X4NA 3HWTA 4DFDA 1CULA 3PX6A 1KLNA 4QIVA 2GMHA 4KTWA 4UBCA 4HAIA 3FUYA 1FA0A 2OYQA 3VC8A 3ZT2A 4MDBA 2XHBA 3WK4A 5J1EA 3WZ0A 1KKHA 2G2ZA 4P10A 1L7OA 1ZZNA 3T9ZA 2J6UA 1R0AB 4M63A 1E4FT 3I31A 1EKSA 4B9VA 2JR5A 1ZRNA 2A42A 4JAXA 1U1LA 3UMBA 2E5HA 4DLGA 3IM9A 1TL4A 4WQ4A 1S6OA 1JNZB 2I5JB 3OQ2A 1GX5A 3TQEA 3TEHB 9ICRA 3D2NA 1LW2A 1LKZA 2YTCA 4RW4A 4X62F 5FLXU 3DCAA 4LF9K 5ELZA 4IFYA 2VU5A 1VQOS 2ZIWA 2G8IA 3Q22A 1GOAA 2DO0A 3BM7A 3HOTA 2HMPA 1QQMA 3VQ4A 3BGOP 5CYQB 1IG6A 4B9LA 2BPGA 4QZAA 5KFIA 3SBTA 2AJ0A 2I1RA 2JZBA 5ETMA 1JKHB 1Y10A 1SB3C 2H3VA 4ZIWA 4F5RA 2VQEK 4FJ5A 3Q8UA 2BE2B 4CERA 1IBMF 2BKNA 3GSDA 4MK7A 2VB6A 1T03B 4P75A 2HBQB 4QIWC 4TY8A 4DZDA 5AJ3F 2GHPA 5DM6L 5DJBA 1N5WA 3LYSA 2JWLA 2W9CB 4Z4FA 2B5JA 4LRAA 3J80Y 3Q8RB 3DXBA 4YY3F 2Q6BA 4C0ZA 5FJ4A 2GC8A 4CTAA 3WNGA 3C1YA 3PHTA 3ZT4A 4DFMA 3B6OA 4IO9L 3BQ2A 2E2OA 3ELHA 3BGLA 3BKUA 2B7CB 4CZLA 2G1HA 3NHGA 3CJ8A 1FRMA 2ZWOA 4YN4A 3QUTA 2M5YA 3QNNA 2NSBA 1WI8A 1N52B 2C2KB 3UQSA 1Z4UA 3IG5A 3Q8LA 3UMCA 2W11A 1XNRJ 4OJPA 3TZWA 3VVTA 2K2PA 3K9KA 4AXIA 1NCLA 4ZVQB 2KOBA 4CBXA 4K4UA 5CY4A 1FDBA 3VQCA 1FK9B 2ADCA 1P1TA 4WE1B 3P1GA 1ZQLA 2XWYA 4X62K 4ED5A 2M4MA 2COLA 4DPWA 1JI7A 2YXLA 4ZVHA 3BQ1A 2IM3A 2V4QA 5D4NA 2E66A 1FVQA 1HYVA 1YJ9S 4PGQA 1IR1A 1X5SA 3P96A 4DR2K 9ICUA 1LEOA 2ATCB 4DU1A 2R3VA 5ITHA 2M9KA 1Y97A 1QAXA 1HWLA 4F50A 3RJFA 4F2RA 4IUFA 3GJSB 2DNQA 1MWKA 3C14A 2CADA 4IQXA 3D2FB 1U2RA 3DOLB 4NLQA 1T9TA 4L76A 2BJ7A 1NPRA 5ALSA 3HYFA 2PA8D 4NM2A 4X66K 4BGAA 3NAEA 1OKJA 3BYRA 5HNKA 2RHSB 3CDWA 3CCQN 2E8OA 3HSJA 2D0CA 4FVCA 3G8QA 5AXLA 3MPDA 5J2DA 3DLHA 4IJNA 3THYB 2HFZA 5ETTA 4DQQA 1R89A 4Q2LA 3CPWM 4CM2A 5FPEA 2QLBB 1NJWA 4FZLA 4CI0B 3R6MA 1ZQXA 2PY5A 5HN0A 3UD3P 3CUNA 2VG6A 4C98A 2C2DA 4C8YA 4EU0A 2MXYA 4M5GA 2QWMA 3E8OA 3H3OB 1N6QB 1BXNA 4O5FA 1H1VA 4Y00A 1ZQFA 1VSFA 3MR3A 4FPRA 4KO0B 4DN0A 2QL9B 2EAOA 2VICA 3K5LA 5SUHA 3MXJA 3GFYA 4HWIA 1ASUA 4QOTA 4O23A 4XDCA 5KPTA 3ILLA 1HWKA 1X8DA 4Y2VA 3I87A 1REVA 3MGIA 2ZD1B 3QEXA 4PABA 5B0EA 1X3MA 4IXCA 5AQOA 4Q45A 1ZQBA 5GTIU 4DS5A 5FDLA 5GAHU 1QY7A 4JEPA 2KJVA 4B9QA 2C2NA 3B54A 2LEPA 4DUYF 4KLSA 4IOCQ 4QNLA 3THXA 1Q8KA 1C1BB 2UUAF 3CULA 4OYIA 2HZCA 1R0CB 2PFUA 3O3HA 3LOUA 3DRYA 2P9KA 3G0ZA 2JV3A 3E1YA 2ZGYA 1BA1A 4ICLA 3CEDA 2M8DB 5HMXA 4B9TA 1XSPA 4OJOA 4UASA 2VG5B 3SYZA 1I5OB 4FVUA 2MKCA 5F1XA 3W60A 3MMCA 1I51B 4KV8A 2KDOA 4PKGA 2AF6A 4Y2UA 4DQRA 4I2IA 3ZDCA 3M8PB 3A3NB 1NGEA 2G0JA 3JS6A 1MW7A 3OGUA 2HAIA 4QIWD 4P71A 2JH1A 1V3SA 3VGVA 4ED3A 1PVPA 3G10A 9ICGA 2QMWA 4CF0A 3OBYA 3KHHA 1CPZA 4BUGA 3FSYA 3M6KA 1WG4A 5EOYA 4ED6A 1WOPA 3M6XA 3RR7A 1C0FA 1QH9A 4OHZA 1ASWA 2FF6A 1Y5NB 3I76A 4X4OA 4B3SJ 1X6JA 1SIZA 4OCZA 2O3DA 1U0SA 1KOOA 1JJ4A 1YTUA 4ED1A 3LGNA 2VJ5A 4PCQA 3LANA 2IDOA 3MTKA 3PRVA 1YJWS 2NQPA 4TUQA 2QSWA 2FJDB 4IRDA 3ZI4A 3KLEA 2HPUA 1NK6A 3EZUA 3CCVN 3OL6A 3OTBA 2AH5A 4IG0A 4C7QA 5J2PA 1JLEA 4DL4A 4JYAF 3C65A 5H9FK 4NA1A 1F21A 1F9FA 1SC3B 3WQTA 4Y2KA 1BPYA 3CNQP 3BS7A 2VIXA 1HNZJ 1ZQTA 2NYIA 4BQLA 3OYHA 4OZJA 1WJ9A 2W2OP 4ZJQA 4DKWA 4O0IA 4F5NA 1ESVA 3PMLA 4J9SA 4ECUA 1YBTA 1W97L 2ITGA 2C22A 1TAQA 2B8PA 3FFKB 3DLJA 1WBDA 2ZJAA 2H5JB 2EH9A 1FXXA 2G13A 1P90A 1HQEB 1SJ3P 3ALYA 4YHHK 3ETRA 3S1TA 2YNFB 1O08A 3NE6A 2D0BA 4Z0UA 5LY3A 4WFBL 4F5QA 2QGFB 4RR5A 2V9WA 3MMJA 4HTLA 3W2WA 3IMQJ 3EVOA 5B8HA 1CJKB 5AM5A 3EXYA 3W8PA 4A8QA 3SENA 3PX4A 5RUBA 1RWVB 2IOFA 2CQHA 3PNIA 5HVHA 3IO1A 3A8EA 2B4PA 2PC6A 2RU3A 5AKEA 5IILA 3QJLA 3HM9A 4O3QA 5C5JA 2CPHA 5L38A 2BCQA 1DTTA 3L2QA 2GFFA 2N82B 1NHKL 1VOMA 1SV0A 2VGNA 3TWZA 4KHUA 1NWKA 3WKCA 4U95A 4RU9A 3ULHA 2JVRA 2QARB 1VRUB 3ETOA 1X5PA 5D3GA 3OYKA 3C2KA 4ANEA 1F2HA 4MYTA 1HUXA 4NLSA 2HNZA 3AA3A 3PCOB 2BCVA 2Z1HA 2LSNA 2M9NA 2GIFA 1XMQF 2B6AB 5JU5A 1JKHA 3OTEA 5J1EB 1KQGB 4NLBA 1RHUB 3FC4A 3NXZA 3D68A 3I1YA 3UW1A 4IO9Q 3KNAA 3BKFA 3N01A 2IGIA 5C25A 3OR1B 3ZSYA 4P7VA 1RISA 1RTZA 3W65A 1GXLA 3NVYA 3MWBA 4F4ZA 2ZNZA 2HBLA 1NNDA 2HF3A 4CEOA 4A61A 1D09B 1Q5YA 2E5JA 3NVKA 3M8ZA 1WD6A 2MGZA 2KV2A 2O67A 1SJQA 1BPEA 4WK3A 2BW7A 1KQFB 5A8WA 2GBZA 1O0PA 3OUYB 5J1PA 2ZM6F 2JEIA 1ZRMA 1X9MA 3NGZA 3R3TA 8ICIA 4FYVB 3C2LA 1RTDA 1FD8A 2OPQA 2LMRA 5CYQA 4OPKA 2J0QD 2LPEA 2V9KA 4AL6A 1S76D 3VF6A 3C29A 3D6TB 4RW9A 2FMPA 3U9ZA 3SAHA 5KFSA 1U45A 1FNMA 4WZMA 5CEHA 1XBWA 3DXKB 5IWAF 4K50A 3FGVA 4RZRA 5EVZA 4NXNF 4CP5A 5HBMB 1NKBA 2Z8QA 2PMZC 4BE2A 1JLAA 1IBLF 4BQZA 2VJ4A 3ZZPA 3AXMA 2OIHA 1E6VA 2HVDA 2E8AA 5KT6A 4NCGA 2O8EB 1Q95G 1QAJA 3DOMB 5KGWA 2RRBA 4IZ9A 4WP9A 1YTAA 1XC9A 3L2WA 3HHEA 4X4VA 4EIAA 3O44A 3FEXB 1SJRA 2KEYA 2YY3A 4UUXA 1FJGJ 4OJ5A 2OA8A 1NGAA 4DMZA 5AQUA 3DYAA 2D4WA 3MUVP 3HKZD 2J7KA 3NNAA 4EZ6A 4NXMK 3BN7A 2OHFA 3AA9A 1UJ6A 4NCBA 4JN4A 2DF4B 1JL2A 2RH3A 2QL7B 2YHXA 2W1BA 3VESA 3RRKA 2QK9A 2A6OA 1JCGA 2V69A 1SQGA 3QO9A 4LVOP 3G6ES 5HQLA 4X4UA 1SZHA 4JKDA 2W25A 1BWFO 1HQUA 1TU0B 3G71N 1VQMN 3ADAC 1K9MT 4EELA 1MA7A 3HLUA 3PYDA 4CIGA 3IG1A 4XK8C 2MQ8A 1FO4A 1FI4A 1RBAA 1VLYA 3VETA 3QJPA 2ZH1A 3S3NA 3CC2S 2PKEA 1TR0A 5D4BA 2YWKA 1HQUB 3NBPB 2O4IA 4JKEA 1O6XA 2J0SD 2ISPA 1NHVA 3LM2A 3MOZA 3ZZOA 2WAQF 3JPOA 2VOPA 5TKWA 2W42A 5HRNA 5B66U 2DISA 5KFFA 4RW7B 4CVNE 3F56A 4PWDB 3I0RB 4ZPTR 2DVIA 3UVJB 3HW8A 1HMVB 4BR2A 2E1FA 1N32J 2FVRA 1GMWD 2DNPA 4CGZA 3GE1A 2F1JA 5EDWA 5KFGA 1T3VA 1FEHA 4C4SA 3M05A 4FJLA 2PI4A 3F5EA 1NZBA 4JS5A 2HHWA 3A0HU 1OY8A 5B7WA 1S12A 3NRBA 4F5PA 2KU7A 4WP8A 4FO0A 2ZTEA 4DV7K 3HZ6A 1SC6A 2KZMA 1P1LA 1NH7A 4ES1A 3PG9A 1OH7A 3KKSA 3R8EA 4CZEA 3BSOA 2NPFA 5IM0A 1ATRA 4K4GA 2ZIVA 3FZMA 3TZXA 5DDOC 2KI2A 2VDHA 2EBEA 3IR7B 2ASMA 3UMGA 3J7YI 3OL7A 1RJJA 3DXMB 1MSWD 3KLGB 2Y1LB 5CZ1A 2VIHA 2HHXA 2BJ9A 4EBEA 2HBRB 3SZ2A 3VGUA 3M8WA 4PXBA 5JVHQ 4DL6A 1NJYA 3I33A 4N47A 3PHEA 3D1OA 4YOTA 1D8ZA 2Q4TA 2EHGA 3OTQA 3CDAA 1J54A 3KLFA 2R7WA 3RJEA 3GIKA 2DFFA 2DH9A 3SI8A 3GBTA 2DNNA 2QG9B 2XLJA 2PYLA 4DR1K 3TVKA 1U09A 4CJUA 1ZBLA 3BO3A 1HX1A 2CNKB 2PZSA 1FVSA 1QVGR 4PYAA 2R8JA 3VCBA 1KVIA 2E44A 3MM7A 4KMOB 1N33F 1N63A 2V7YA 3DNCA 1JRPA 3SK3A 3RH6A 2P9PA 1V3ZA 1X5OA 4O3PA 2WOMB 3CPWR 1RBLA 2D5RA 2IA6A 1VQKS 1FTCA 4Q2MA 3PW5A 3MM5A 1T03A 3AO1A 4Q8FA 5AK6A 1TK5A 3FNNA 3IP0A 3GQCA 5AI0A 4F93B 4CJSA 2XYGB 1IWAA 4MHVA 1PZNA 1R31A 4PAAA 9ICQA 5F3ZA 3P39A 1EKRA 3KBBA 3QSYB 1URNA 2WOMA 2KG1A 4DSFA 4CJQA 2NRVA 5F9NA 2P9IB 4LJXA 3C6UA 4AYBC 4ID1A 1N5XA 4CGDA 4WF9L 2U1AA 4WJBA 5I42A 1DKGD 3UDVA 4DV0K 3RMCA 1YHQN 4NYPA 4NZ6A 3KHRA 3IDWA 1JXVA 4M45A 2FMSA 1PG5B 1NXIA 2DEJA 2E5SA 1K5OA 1OH8A 5J2BA 4HLBA 4RG8A 2AMCB 3FM9A 2F7VA 4ZVGA 1R8BA 4OO1J 4O8KA 1M6YA 1UWBB 2KHDA 1IG8A 1Z2LA 2GVZA 4WFYA 4A47A 4JI3J 2P9SB 3OJUA 4DCPB 3UWTA 4O5KA 1QTNB 2ZE2A 3B6PA 4CJ7A 1C0GA 3RJHA 3ILIA 3P4IA 2V2QA 4ED7A 4E98A 1DURA 3DFEA 1Q46A 1SC4B 5LJ3Y 3GJRB 3SDEB 1IXKA 1NLKL 3SJHA 2M0GB 3C6HA 4AL5A 3PLAA 2NRXA 2IRYA 3O6QA 1LW2B 4XQ8A 4E2FB 1NNLA 4X5VA 1VISA 2YH1A 5EGYA 2XS7A 1S6PA 2K8GA 1DGKN 4R63A 7ICLA 3MM7B 4PXDA 4B1YB 3W5ZA 3DU6A 2IHR1 1A76A 2W55A 4ZP6A 4I64A 2FHMA 3H7HB 3DGPA 2JJ4D 4N56A 3JSRA 3R6LB 3O3FA 3SNNA 1ACMB 2VUGA 1GMVA 2OMOA 1NU4A 4DG1A 3NVZA 3ICXA 5G5HA 1TQLA 3TW0A 2VKRA 3PYFA 1H2VZ 2HQFA 1A6SA 1OPIA 2N4DA 3ULEA 4N8NA 1M5HA 5D4LA 2H4WB 4LF8K 3JYTB 2DR9A 2F4VF 2V34A 1JLCA 5EWFA 4TY8B 2A3ZA 3H45C 4K42A 3GFHA 3FGUA 3N79A 2IRUA 3HPOA 5F8JA 3WEEB 1MA9B 1N5VA 3OVAA 4GKKF 4K7QA 4E1NA 3M8QB 4MDAA 3DI6A 3CCES 4Y2AA 2EZYA 3KJFB 2R8HA 5AHXA 5DDMA 1U9LA 5GMKa 4RU2A 3HULA 3VAHA 1KBRA 4O3SA 2B9WA 2ZDOA 4C2MA 2UYTA 3PW2A 1H98A 3VEZA 4GC7A 4H03B 1IBKF 2FBXA 2EXUA 4KLOA 4YB7A 2W4PA 3H2UB 4QZBA 4DCOB 1U8SA 3CCMS 3JXOA 1XMOJ 2ALZA 4YNQA 2BH1A 4CDIA 5ALKA 4RPZA 1WNEA 4CHYA 4ZVTB 1IV8A 1R0BG 4FDFA 3CDEA 3ZFVA 1VQKN 2RLTA 3MMVA 3M2RB 1M1GA 2RQ4A 4CIEA 2OWOA 4BDPA 1WSEA 1X5TA 2ZM6J 5B08A 1WCLA 4DV1F 1R0AA 3D4JA 4RWWA 5C2DA 2QA4S 3HPGA 3H0PA 1WEYA 2WF9A 3IAYA 4B3OB 2DJWA 2F8SA 1OY6A 4M04A 1H7XA 3SAGA 4EBCA 1ZD3A 2D3DA 1U2VA 5ALGA 2MZTA 5JXSA 3CVKA 3SV4A 3AA8A 2R7SA 4CZMA 3TFRA 4NI2B 4DR5K 3CFPA 1JLAB 3AOCA 2DQNB 5ETQA 3K7RA 5KG3A 7ICFA 1QCKA 3RW7A 2H3GX 3BN4A 5AE2A 2HNYA 1Q7YT 3RWUA 2O8FA 2RD5C 2E1AA 2RHFA 4M6WB 3NCRA 3OW2M 5L9NA 3IAS9 4MIAA 2VWJA 5J2FA 3GG4A 5CHGA 1L3VA 4ZCIA 1IBMK 5J2NB 2JFKA 4JI8J 1UPMB 4K0KJ 4WXOA 2H1YA 2YHWA 3OS0A 2E1RA 3QJJA 4FJHA 1IJFB 1HI8A 5D77A 4LC9B 2GNKA 4BRKA 5KG6A 4XRHA 1UVIA 5IOLA 3G6EN 1SJFA 2UXCF 3MR7A 4BRLA 3ZZYA 5FP0A 3TA1A 2OPPB 4CEFA 2BCUA 2FY8A 5ADZA 4JI4K 5CR4A 5M1NA 4GKKJ 2J0WA 4Z4EA 2MUTB 5BR8K 8ICKA 3PIOQ 3DOKA 2MY8A 2QZ8A 4NA3A 4YN3B 2ZUDA 3NLCA 3HHDA 4DR6F 2IVOA 2RUSA 1M5KC 3KG0A 2IS3A 4GC6A 2VG7A 3KK2B 4DR2F 4H4OA 5HQMA 3KD3A 5L39A 2DNMA 3LDNA 4LF4F 2KLAA 2HCFA 5ALIA 1MWQA 2F8HA 2WVFA 3O3GA 1FKOB 3S01A 1XMOF 2BQRA 3OXGA 4KH0B 5ALJA 3AOBA 5D6GA 2DH7A 2XWXA 1Q4RA 1BWEA 3HI9A 3K57A 3V6JA 1TFRA 3PYGA 3UE5A 1U4BA 4RPYA 2Z58B 3PEHA 4JK1A 2ZG6A 3MM8A 1AB8A 1RG6A 3LM9A 2ZBRA 1A6LA 4WKYA 1VS3A 4CLTA 5CCMA 4HH0A 3V4IB 3PSTA 4KLEA 4GV3A 2ZBPA 5K8MA 2ROEA 1N32F 3MECB 2QKKA 3W2VA 2DR5A 2XCAA 4NO7A 4C0OC 2ZH2A 1LWFB 5IFMA 1J53A 4RT3A 3CJ5A 4I2JA 4NLWA 5T7LB 2R2UA 3HILA 2LA4A 3PNCA 5KFUA 2W9MA 3RRGA 3G8TA 4KB1A 1U26A 3L4BC 3K4GA 1NHUA 1U2CA 3GG1A 2RHKA 3VGMA 3OSPA 1CEZA 2QEXN 4LF5K 5KNIA 3A8KA 1PJ7A 3QEIA 1B3TA 1BPDA 2G2YA 4CCHA 3H5YA 3DAWA 3F5AA 4I28A 4X4TA 4J9PA 4WFNL 3I6PA 4OX9J 2DCUB 1C6VA 2WB1D 2XMWA 3D0GE 2A3JA 4OD0A 1LCUA 3AT1B 4PG8A 4Y2JA 3SUOA 3ZETA 2O8BB 5AXKA 4RNMA 3KZBA 4LUBA 1TV6A 2A6MA 4ID5A 1O13A 3HCXA 2P9CA 1BI4A 3ATUA 4DV7J 5I3UB 3S3OA 5MLCQ 5U47A 1EAYC 2G8WA 4JK7A 2FF3B 1XJWB 3ED5A 2GAGC 4A5AA 4USUA 3M8RA 4ILJA 3AVIA 5KFRA 4J9MA 9ICEA 2MRLA 4OL8A 3SQ1A 2DKOB 3I56N 1RDWX 1DLOB 2W3RA 2HVEA 2CQPA 1AQ6A 3MM9A 1C7YA 1TELA 2V8HA 1NSAA 3D3BJ 3H8SA 5AQJA 2M2BA 4OYBA 1E6YB 4U6PA 3SCJE 5DETA 1N54B 5JMVA 4EP5A 3SCXA 1LWCA 1RUSA 2UXDK 4DR5F 3HOSA 5J8YC 1HWIA 4KLHA 4F4YA 3GMGA 2EANA 2Z4PA 3KK1A 2ZM6K 4O3RA 3LH2S 3DN9A 2C2ZB 2V67A 5CABA 4BBYA 1GLBG 5K5MA 4BGDA 2NPIA 2OEKA 4KT0C 3CCQS 1ATNA 3C7NA 3TKAA 1S72N 1RQNA 2MQPA 2ALYB 5AJ3K 1AA1B 2P9LA 3AGRA 1R8PA 1VAZA 3MWPA 1SH2A 1NRKA 4OZ2A 4TUPA 1TL1B 1VQ6S 4URGA 4JD2A 2D41A 1ZQCA 3BR8A 1YG0A 3O2IA 3E9LA 4JOUA 3I9V9 2V8GA 4O9MA 4Y2CA 1CC7A 3ISDA 3M8PA 3OT9A 1N62A 2YV0X 5IQ6A 1VDHA 2MKIA 3C1ZA 1DEJA 1J5OA 1JLGA 4US8A 1ZAXA 2IDEA 5HO4A 4LFBJ 2R8KA 2EFPA 1F3VA 2NYHA 3C15A 1XERA 2IOCA 4Y2SA 5BREA 4BC7A 2RRDA 1BO5O 4BJQA 1PAUB 4UAVA 1SS6A 2RRNA 3CC7S 2QTDA 2F9WA 3Q24A 3TAFA 1J5EK 3V9UA 4I6MA 3MABA 3DGPB 3IWLA 4KRFA 1LWFA 1YHQS 1WWVA 3LPYA 2EFOA 4FPIA 2GMJA 3CGIA 4KR0B 2XMAA 1Q53A 3C5FA 2QRRA 1X31C 4J9RA 4A62A 4YOEA 4CF8A 1NDPA 3FYHA 3E01A 2PDAA 5IT0A 4CF2A 2OANA 5E3AA 2VQEJ 3JXUA 3RBZA 1SPBP 4E89A 3Q8VA 3A4TA 5G0RB 2XI9A 2OD6A 2P66A 4X66F 4TN2A 3WX4A 4DX7A 4NL9C 1HNZK 3QBCA 1Z00B 1QVGM 2UXBK 3EUNA 4O5BA 5DG9A 4DSKA 4I2QA 4DV5K 1R8HA 4M9NA 3GCXP 3HXMA 2IBKA 2QJ3A 4DJBA 2RPIA 4YDUC 3ISZA 3NASA 4P9SA 3N7PD 1HNIB 3QPIA 1UEVA 2E5IA 2QWNA 4WQ4C 4LBIA 5AQWA 2YX7A 2AD9A 4FOEA 3EXCX 5GTHU 2LKZA 1PGZA 3Q7CA 1GTEA 1WNSA 2ZOFA 4FM1A 2B6GA 3C23A 1S1TA 2BXJA 2AGQA 3ZC4A 2RRAA 2HURA 2J76E 2R2TA 1IR0A 4C1NK 3V6HA 1DK2A 5LMNK 4ECWA 1FFSB 4TSXA 4Z4GA 9ICLA 4X2BA 1RHKB 4JI4J 1VHFA 2BKOA 3VQPA 3PO4A 3KHLA 4LZGA 1AUDA 2OLWA 2XRIA 3QU4A 4LIRA 4TY9A 2G8KA 7AT1B 2AGPA 4J37A 2A1JA 3M2VB 1SKRA 3QUQA 1FEZA 3PDNA 3U1NA 5DM7L 2DGTA 2JFDA 5AZJA 5AQGA 2NSCA 5KOXA 4MF2A 3D6MB 1O5JA 2NNWA 4DV6F 2EBGA 1FDDA 1OUQA 1S59A 1NH8A 3BGFA 3EVWA 2HW3A 1FE4A 4LFBF 1YJ7A 3QMQA 3OYMA 1I6JA 4O44B 2DR6A 1RBRA 4K41A 3V9WA 3D0PA 2XHWA 1RWPB 5DK5A 5C15A 3HX9A 1TP7A 3ATVA 5KT2A 2DPJA 1VQ5N 3PX0A 4CJEA 3L5KA 2A1SA 2C3UA 1I94K 5A8RA 4XPEA 1CZ9A 3UKRB 3GTYX 3KLIB 4HCBA 3HVTB 3EX7B 4BHQA 4RNFA 5DG8A 3CCRS 2BPCA 3HSTB 3H2LA 4KO0A 5DB6A 3C95A 2RE1A 3AJDA 1JNRB 3QEBZ 2BEFA 2CYYA 3UKUA 5FLXO 3OR1A 4CJVA 2YNIA 3UXNA 2HVHA 4ZTJA 1O03A 4QJFB 2QXLA 4DV2J 7ICGA 4XUSA 3AO2A 3DDHA 5J2AA 4NLNA 1EP4A 3IBFB 2FHJD 3CJSA 3EZWA 4M2YA 2X1BA 2HSEB 1QQ5A 3R9LA 4CLSA 2VJUA 2ZJPL 1IM4A 5AIAA 3JSMB 3IM8A 4BCAA 1A0OB 4E7HA 4U7UK 4ZVFA 3GJQB 4L72B 3OHBA 2A1JB 4E7IA 3EGWB 2BDUA 2WAQC 4AILC 1EETA 1YRXA 1LVHA 3OXLA 1N33J 2E7XA 1ZQUA 2HQ3A 3KJVA 2L9DA 1CJUB 1RAHB 4YUDA 2HF4A 5AQSA 2FMQA 1PBUA 4DUYJ 4IQWA 3WHIA 4NLVA 4QR2A 5CP2A 2BJ1A 2F76X 2BJEA 3CJBA 2QWOA 2N4CA 3H7IA 3K2YA 2JHDA 4Y2XA 4OPJA 1BQMB 4CQ1A 3O4WA 1RDAA 3J7A1 4OGEA 3KJVB 1VSIA 3BQTA 1Y3KA 1X6IA 1SL0A 1WSGA 2GJFA 4OKJA 4M9HA 3FSIA 1YTYA 2YQ1A 4OV6A 1AW0A 1J2NA 4ACOA 2KXHA 1YDLA 4A59A 3P45B 1HEKA 3TO8A 4CK3A 3C6UB 2CA9A 4JV5J 1SQFA 4JI1K 4DXLA 3S41A 3MM6A 3WDOA 1SV4A 4J2EA 2FXUA 3DM2A 4DTJA 4HKQA 1QQ7A 5F9LA 4B8AB 1X9SA 2HQDA 5T7LA 1GXUA 3W9JA 1T6DA 3CC4N 3KLFB 1BHLA 3WKEA 4I67A 3MAHA 4J9UE 3OL8A 4ELTA 5HROA 3IWXA 4RTFD 1HBNA 3WKAA 1SJ4P 3ZZ0A 3RYLA 2YMMA 1TZ0A 1Y88A 5DBCA 2I7PA 2OPRA 3AVJA 3THWB 8ICNA 1RHMB 2EG2A 3WBZA 4HT5A 3ZSZA 1Q86T 2F8TA 4MFBB 4OKKA 1P7DA 3CMQA 2Q0RA 4AD6A 5J2QA 2BE7D 3VCDA 4FZNA 2HK3A 3P5JA 4DTUA 1QD1A 1O51A 2IVPA 4HI1A 3UN2A 1QQ6A 3WC0A 2QWPA 1G2EA 5K4LA 2FQQB 3NUQA 2QLTA 5HR6A 3OHAA 1CJTB 4WFNQ 1UJ4A 1N4LA 4DLEA 4X64K 2CQBA 2CGLA 4M5JA 4ECQA 2BVZA 3UKRA 2Y1RI 2HLTA 2QTWA 1WG8A 2E2NA 5KFAA 3TI0A 1FX4A 1CS4B 4FNHA 3MX2A 4QWCA 3R5CA 4JKFA 5C0YA 1CXUA 3RF9A 4LH5A 2XB2D 2VHGA 3VTHA 1Q8IA 1RDCA 1ZBUA 4ZVSB 4PL1A 2V4RA 2WONB 2LU1A 5BN8A 3CF5Q 2NR0A 2PAVA 1RA7A 1U0HA 4EP4A 3K5MA 5KAIU 2PO4A 3ZTRA 2KN7A 2L41A 3FLCO 1RQLA 4A8YA 3D7SB 4OLBA 3AVNA 1ZQRA 5E3RA 1UWAA 2DH8A 1NOZA 4KH1B 1T02A 1ZM4A 1RT3B 3OTDA 3Q8YA 5J0RA 1TYQB 4QJVA 3DMJB 2ZE2B 5LMNF 5LT5A 1QHTA 5DDPC 1RGVA 3M2RA 1Q9YA 4RUAA 2MLXA 5KL8B 1KLMB 3EJMA 1EZZB 1DHMA 1Q81T 1ZQ1C 3QZ7A 4KHSA 4OLOA 2C3OA 3H25A 4LJMA 1Q82T 2RUGA 3AVMA 2CG8A 2FVQA 2LI6A 2WUSA 3HD1A 1UCNA 2R7UA 3OYBA 3JTOA 3L09A 2G5IB 1SBRA 2UUTA 2UUWA 5I3QA 4WWSA 2BOPA 1ZQDA 3DC2A 2B6AA 4URQU 2ZZMA 1HPMA 3KKFA 4Y65A 2WF5A 3S6JA 1CRXA 2NXJA 4BRAA 3VQQA 2IBOA 1T7PA 4CLPA 3WKBA 1TAMA 1RAGB 4DR2J 2YTUA 2KD1A 1SKWA 3RB4A 4QIFA 3ENVA 3GDXA 2G5HB 1SH0A 2P9LB 2K8CB 2KKVA 1N33K 3VQDA 1VQ5S 2E6LA 2RKIB 3ORYA 5ADXH 3IG1B 1HKAA 3D5MA 4C8LA 3VQ7A 4E1MA 3OUYA 4PA1A 3CW2C 4GMKA 3O3LA 5JVGL 1F5CA 4QIGA 1FIQA 1O1WA 3QGHA 2FPLA 5J8YA 2FUG9 4G65A 2U2FA 4HHUA 2RNEA 2LYVA 3CJTA 4UW2A 3G6YA 4A46A 5KRSA 4BWJA 2F4VJ 3PW7A 2QEXS 5G0RA 3Q8PB 5KFVA 2B4UA 2RQCA 3C0BA 1KSPA 2VQEF 3HI0A 2KRRA 3FQLA 2FSNA 1VQLN 3G4SS 4NA2A 4J2DA 3NG8A 2YKMB 3C2PA 4FXVA 1RHQB 3V4MA 2FVPA 2FZKB 1HI1A 4YD2A 1UEUA 4TURA 3S9HA 1NLVA 2KIVA 3TVYA 1LOTB 2ZITA 3DOLA 1MNEA 5AKJA 1VLOA 3H8WA 3CRXA 2OUGA 4B3TJ 3FFIB 4CO0A 4LF1A 5CR0A 3SSQA 2UUCF 3LL3A 4MQ3A 2H4YB 3QSIA 4R65A 2Q3SA 4C4TA 2BJDA 3OJSA 4RWXA 4F71A 3MCNA 4ZMMA 3H8YA 2HHQA 4BXOA 4M9GA 3UN3A 2F1FA 1P6TA 1RTIB 3QIOA 1SUQA 3QNWB 4E7LA 2KNJA 1XIQA 4C8ZA 3UO0A 5GADP 2XO7A 2G2OA 2Y8YA 3H1VX 1YWXA 2EAMA 4USKA 4PG5A 1B9FA 3B0YA 5CHIA 1ZQZA 2H3IA 1WKKA 3I28A 4M3ZA 1L3UA 3T6JA 3R5DA 5C25B 2QA4G 4OJ6A 3IRUA 1RA6A 2CQ0A 1L5UA 3VGTA 2NS1B 2MPUA 1YJRA 1NK7A 2PN6A 5IT9O 4DQIA 4Z4IA 4UAZA 2XG8A 1HLUA 4P0QB 1HYSB 1COKA 2XMVA 4L3NA 5DB7A 3TZYA 4OYZA 3ICLA 2C28A 4CJ3A 2E1YA 4BC5A 3A8YA 2JH3A 1YJWN 3L7PA 4QBUA 1RTHB 4CIOA 3QT5A 1BDGA 3ISBA 3KD1E 3CCJS 2HIYA 1HD1A 3JTNA 3MZIA 2FB0A 3CJ2A 2JSXA 2GW8A 1R27B 3VAIA 4P73A 1URRA 3SMZA 2KICA 3UFCX 2OMLA 3HKZF 3CCLN 2OSQA 4KGXB 5LMUK 2O8EA 3NVWA 1D3WA 3CMAN 3NVVA 3G25A 4HUFA 3H5UA 1BY9A 2WF7A 3QETA 3Q7BA 1NGDA 4GIBA 3R2DJ 3QU7A 5HATA 1VFJA 2Q1LA 2ZFHA 1S1VB 2G8UA 3C28A 2CJ9A 3SV3A 4C11A 3N5BA 5AKZA 4CLYA 3L8BA 2K4HA 5TZVA 3CFOA 5I4MA 3QGPA 4CLWA 4LFCJ 2KL8A 1WSFA 3A8JA 2P9GA 3W66A 4QR0A 2YY6A 1KVJA 4K4WA 3V1RA 1NMEB 2NZCA 5ALTA 4MKYA 1Y0HA 1LFWA 1QSLA 4GKJF 1D0EA 4IQMA 1ED1A 4OYXA 4JV5F 2ZIUA 2LCWA 3JS9A 4LRCA 4H4MA 5KFOA 4PZNA 1T9VA 2EEYA 1IVZA 5AQIA 5CD4A 2I6XA 2XMMA 2OEHA 2WBMA 1B7FA 3CCJN 1RM6C 1DT9A 4JI0F 1OY9A 2DHGA 4C1NI 1S9EB 3ZSWA 4B1UB 2OH2A 4IEEA 5A8KA 5BR8F 2VJVA 2PFPA 1VBKA 1OYEA 5DQIA 3FEYB 8ICJA 4G1QA 3UVJA 1G15A 1JLGB 4JI5K 2QA2A 4DUTA 1S1WA 4P2XA 5E3QA 5EN1A 1V9PA 3T1YJ 5J2EA 2EFQA 2M0NA 9ICKA 4DTSA 4YD1A 1BPBA 2MAXA 3KOOA 2CZ9A 3QERA 1NK4A 4Y1DA 1GTHA 2P5OA 2B4JA 1S10A 1KOHA 4B17A 3B78A 5EWGA 4EUVA 3TU5A 4RL1A 2ZGZA 4I2BA 3ZTQA 2KXFA 4CK1A 1FD2A 2OO4A 1S48A 4JI8F 4K0KF 1U04A 3LGHA 4CF3A 1V85A 2HHVA 3THTA 3TANA 4QWAA 1PJ5A 3C7NB 1CS4A 3PIPL 1HI0P 4RQMA 3O4QA 5HP1A 1G7CB 3HT3A 2MTLA 3MR5A 1RT1A 4M8LA 3LDAA 2X6SA 3T5LA 5M1FA 3W9IA 2BM0A 9ICVA 1YI2N 2P9UB 2LQ9A 4CEEA 2YQ3A 5ETRA 4JK8A 3IS9A 3GCWP 2PD1A 4OPHA 4JKAA 4NB4A 4C80A 4W92B 8ICWA 3NKYA 4ZHRA 4LSNA 2YKAA 2A5XA 2VKZG 1AXQA 3I56S 2Q31A 3WUHA 2XMKA 3LO3A 2B43A 3C5GA 1QAIA 1YVNA 1B64A 1QVFR 1D8LA 1S0MA 1HNXF 2VFVA 3EKUA 4FZVA 4JK9A 2F5GA 2GV1A 5KOWA 1RP5A 1XEZA 1ZC6A 2KKHA 4P4OA 2ZC4A 3MM5B 4J9KA 1G3OA 1WSHA 3QEVA 4ILMA 1DQAA 3LDQA 2D0OA 4F5OA 2VA8A 1H3DA 1VDVA 1HBOB 2YKOA 1RWUA 1CJVA 4AHSA 2F44A 2BA9A 4OZNA 2HFUA 1JX4A 3WT0A 1RDDA 5AR0A 3MM9B 3BB5A 4PPZA 2DRDA 4NMXA 1SB6A 3MEEA 2MKJA 2QMXA 4CJ5A 1OVQA 8ICVA 3EGNA 4C23A 3W1YC 4NLDA 1AT1B 2HK2A 4CNQA 4DUYK 3T1HF 5ETPA 3NS5A 5AICA 4DTOA 2XZWA 3MN5A 1TKTA 1WHYA 1YXQA 4CO4A 1FFVA 3TAGA 5BRHA 1ITGA 3NRZA 2GUIA 1HNWK 4K2JA 2KSOA 2FVCA 3A5LC 1SL1A 5AI9A 1NMNA 4HTUA 2WK4A 5DBBA 4U7CA 5KG4A 2YX4A 5DLGA 2EC2A 1N8RT 3X1LB 4KJIA 3UN5A 5J2KA 4RBUA 4BRPA 4EMDA 2F63A 6FDRA 4B3MF 3IR5B 4EK2A 2CJXB 2HHSA 3NAHA 4NXMJ 3MMAA 4IO8A 4FPBA 4DV1J 1BA0A 2R7TA 5KFMA 4UATA 1NAQA 1KCFA 2HFNA 5J2GA 4DU7A 1E4GT 1QUPA 3SD7A 1EWQA 1K8KA 1FJGK 4FWLA 5M2PA 4G9ZA 4IO1A 4O4RA 5IT9U 2H3FA 1Z1VA 1NJZA 2JHEA 1L3TA 1SH3A 4IOAQ 4YXMA 3ASMA 1FKAF 3T5HA 3ENQA 1VC5A 4HHTA 1UFKA 3N6LA 3DLGA 4PG7A 4IDHA 5D8HB 1FRKA 3FZ2A 2FC0A 3H8MA 1WUAA 5AXMA 2H48B 4ER8A 3QQCD 4C7ZA 2AJ1A 5CYMB 3JPRA 3OXFA 2L5YA 2E8MA 3FK4A 2LDIA 1UVMA 3P31A 2J9DE 4JRPA 1DZ5A 5JS1A 2ROGA 4LIWA 4AHCA 2CG4A 5D0HA 3DLBA 3DRRA 3DLRA 5CYMA 4XDDA 4PPXA 4IRKA 4Y6IA 1Q7LB 2R7YA 2IYIA 4DV1K 1WKLA 1RDUA 2KJ9A 3A13A 3BGUA 3FBEA 4JKHA 2E4LA 4FYDA 4FJXA 1TUWA 5D15A 2GQ2A 2VWKA 2QYCA 4NLUA 2YPZA 3PJWA 3FZHA 1L7PA 2MZQA 5T14A 4I2AA 5KFTA 3BDPA 2O66A 4M3WA 1SV5B 1S9GA 1HQEA 2Q2RA 1OW5A 5CZVA 4QU6A 2CWXA 5FPMA 4Z2XA 2G0IA 4FLTA 4LSLA 3AH6A 1S3XA 2BUPA 2DY9A 5JS2A 4MFBA 1NB2A 4CT8A 3TPQA 5E2QA 4WF9Q 3VAJA 2E20A 1HNVB 3QFPA 1URJA 3QGGA 4UAWA 5GIPA 2PMZD 4KYZA 1BUPA 2HDOA 2ASDA 5AQQA 5EE9A 2IC3B 1B4FA 2KKZA 5KQ8A 2ABYA 2EWSA 3Q86A 3WX8A 4KLJA 1WC6A 8ICGA 4NLYA 2DNHA 5LSOA 2R7XA 3OPXA 1ZQYA 5AKXA 1N56A 1XU4A 3F5TA 3CMEN 3HHLA 3FBFA 1HR0K 1HWJA 2K7JA 3N97B 4OYMA 1H7WA 1ZH5A 4NLPA 5F0XA 2F1HA 4QIEA 2VG6B 3IRXB 2QKQA 1YLXA 2AT1B 4RW8A 4JI6F 1RILA 3QFWA 4BROA 1F0MA 1K9MO 1XNQJ 1Z00A 3GV7B 2RSQA 3VTIA 2ZJQQ 3NF8A 2ZOGA 2WRMA 1AZSA 5ETLA 2IJRA 1JUDA 1TFWA 4RJVA 1HR0F 5TISU 3ZTOA 1U49A 2J6TA 2KT3A 3HF5A 2R8IA 4O8UA 1WEXA 5A8WB 1PVRA 3I82A 1RCHA 4ZLLA 1HHSA 2IFXA 2PFQA 1IQTA 4KTQA 1S1TB 4LF6F 3R5AA 5E79U 3SSRA 2ZJ8A 3FBBA 3TUJC 1VQLS 1RZTA 3OL9A 4DV2K 3CYMA 4J9LA 4BRDA 1Q8BA 1J2VA 1ASVA 3D67A 2NRZA 3MUTP 4EYIB 4DFJA 3EE9A 4PPDA 2YX8A 1LAWA 3CJRA 2H3ZA 1VRTB 2WTFA 3TX0A 5KGXA 4ZLJA 3RBXA 2VBYA 5D0RA 3THPA 1HRHA 4BR4A 1RWOB 3HL8A 4C6AA 3AMZA 4QZIA 3CC2N 3OYIA 3V9ZA 1M1HA 2KFNA 2AJQA 3UPQA 2MSSA 2QO3A 5C2CA 2KB2A 2LDYA 3VOVA 2BM1A 3C6TB 4PQUA 3RJGA 4QYRA 3M1YA 4DV2F 2E2QA 1EARA 4EBDA 5D4OA 5IIMA 2PXIA 4FJKA 2JLFA 3VEWA 4ZP9A 3O5BA 3MAQA 2BOAA 3DRRB 1TK8A 1TGOA 1EETB 4I2PB 2RB7A 2GVDB 1ZBSA 1NPPA 3WQPA 2IOFK 4BVOA 4IQTA 1U48A 2PMZF 5E7OB 2HOEA 4FO6A 1S0NA 4DOCA 3RBEA 1B22A 2A41A 2D74B 1RAAB 4WPAA 3M8SA 5K14A 5LSLA 1Z3EB 1OSCA 4Y2TA 2G8VA 2EFVA 3M9NB 2W6KA 1RT4B 5HLFA 2HHUA 5HMLA 1ROFA 4DV4F 2C2EA 3PSFA 2W9CA 4K8RA 5DDYA 2E5GA 4BE1A 4H4KC 4FJMA 2UVVA 4Y3CA 3RRHA 4M3XA 4JS4A 2F8LA 4CYUA 2IAJB 3GIIA 5LM7E 1PK1B 1REGX 4JI1F 5F8LA 3ENBA 2WBNA 4DTMA 4DV0F 1WELA 1R6YA 5A2QU 2VWBA 2YMPA 1GLFO 2BGWA 1KVKA 2IM2A 3I9ZA 1Z1ZA 3SQGA 4YFKA 1JN3A 2IC3A 1K0VA 4C97A 4IG0B 9ICHA 1RBUA 4H54A 1KEJA 4KKOB 2KG0A 1NZAA 5FPDA 1LWEA 4TNOA 2RQMA 3GFXA 3QIPA 7ICVA 2Y3YA 3FBCA 3VHQA 1QQOA 4Z94A 3CNHA 4KLQA 2CWKA 2C2OB 2WHEA 3OFHA 5IXUA 3TTFA 1JLEB 3SXLA 2FY1A 2P5VA 1SKSA 3ZDDA 5DQGA 4ZK7M 3NBPA 1IKYB 1LFPA 5ALFA 5IT9Y 4M5HA 1KQKA 2KXNB 4V1Ak 4DV4J 3JPNA 1RTIA 4X64F 4O0NA 4DSJA 1ZS6A 3BBBA 3LP2B 3TUIC 3WEEA 1YJNN 1XWLA 3I96A 1R3NA 3OTOF 2NXNA 4PEOA 2OP5A 2MB0B 3LZIA 3VQ9A 3O1LA 3MEKA 1Q3UA 1JLQB 1OH5A 9ICPA 1S5JA 3B8AX 1A0PA 1MN8A 2AKWB 3C14B 3MD3A 1VHIA 3KUGA 1RSCA 3E0FA 3PZPA 2WVEA 3C2MA 3GV5B 1VQNN 4CIFA 1R8CA 4U7UD 1OH6A 2DHXA 5KFKA 4GVEA 3TJAA 5BOMA 3CJ4A 2YB1A 1PSDA 3U4LA 2MA1A 4JRQA 4QWBA 1CXQA 2KP7A 3CCEN 2KVIA 3OW2R 4IDKB 4AHUA 4HHHA 3AJ2A 1U02A 2PBDA 3AQPA 1GLAG 4M5NA 4J7CA 1FRXA 3RJJA 3NOGA 2AJFE 1I3OB 4BWMA 3QXGA 1NDCA 1XI1A 4LSNB 4XPCA 3OR2B 2FJVA 2D1CA 1RTHA 3RB6A 1TKTB 1QQCA 4PHTX 4ZN3A 2EC0A 5EHHA 2XHCA 2VA2A 4WP3A 2DPIA 1M0SA 3OYCA 4CJWA 5IIOA 4IOAL 5DO2A 2VPYB 5HR7A 3PIOL 1H74A 2DNZA 2HGNA 4MEYA 3HVWA 3DMJA 5BRDA 1W26A 2AYGA 2DD8S 1HFEL 1QLNA 3PRDA 1FEEA 1VBYA 3W3SA 2CZ4A 5GMDA 1T4GA 5BXIA 2A1RA 3A12A 3CO9A 1MWZA 4ZH4A 2EAPA 2KM8C 4PKIA 3UD5A 3ZZZA 4QZDA 2HVIA 2R18A 3US5A 1C0TB 1WSIA 4M7YA 2EFNA 2XYHB 4MFFA 1JJ2R 4GVLA 1S72S 3GG0A 4NY8A 4YB6A 2VPWB 1T9WA 3QFUA 3ONQA 3OFEA 1VK0A 1FDAA 5ALHA 2P6TA 1VQNS 1ZJMA 2BCSA 4CYUB 1SL2A 3J80U 3AO3A 3KNGA 2Z1GA 3MEGB 1YF5L 1D9FA 3SMPA 1TVRB 4LMZA 1VYAA 5J0YA 3E2EA 1S1VA 4P0PA 4EENA 3T6BA 4LREA 5LJ5Y 2G0AA 1JQGA 3NH0A 3A0IX 3L3FX 4OHVA 1KQSM 3TTDA 3GYNA 4C8MA 4AYBF 1Z1BA 3M6UA 3N7SC 3M9MB 1X0FA 3ET6B 2JOQA 4IFEA 1YITN 1LK5A 1TKXA 4P0PB 3QNOA 1QVFM 3SR6A 1FRIA 2DITA 2E1CA 4KH4A 5KL1B 1Y64A 5HVFA 4DOAA 2CVIA 2ZBQA 1L7NA 2V94A 4ZCMA 4Q43A 2W03A 1ZAVA 4I7FA 4B3RJ 2HBJA 3OBIA 2MJNA 3M9OB 3C46A 1QM9A 4OZ5A 2KT5A 2DBBA 4JV5K 1S1UA 2R42A 2DIUA 5HJXA 3BGRA 2G07A 5EWEA 4I29A 4LY7A 1MROA 3LA0A 5AK3A 2FZGB 2DTUA 5GVQA 2HHHF 3H42A 2YMQA 1RBTA 2M52A 2O8CA 9ATCB 4FK4A 2M8HA 4DDFA 9ICAA 5F41A 2NRTA 3R1LA 4B3MJ 3VF4A 3VQ6A 4UB6U 4L75A 1Q86O 1C20A 3M2VA 2WW8A 3T1YK 1WACA 9ICJA 1ZQIA 2OJ3A 4A8SA 2MQNA 3QUBA 4IDKA 1RBVA 3NMRA 2AP1A 3V9SA 3K1RB 3EVMA 3AAQA 1TMMA 3H46O 5HHIA 4MK9A 3QWPA 5J2MA 4CLZA 4M94A 1S9GB 3PMNA 3SQIA 1ZQQA 3R7SB 2NLWA 8ATCB 3PACA 3FMWA 3EN9A 2YWFA 4Z6EA 7ICJA 2MU2A 3TA2A 3CF5L 1JALA 4NWBA 2VH7A 3BSAA 4HDHA 1A9NB 2HYIB 4RQ8A 3M8QA 2BPFA 3KFUF 3T1HJ 3O1WA 2RQKA 1S7HA 1Q9XA 3HVTA 3ZLJA 4ECYA 3HFZB 3J7AN 4GO5X 1ZM3A 4KGKA 2E1ZA 4XH1A 4RPFA 3QT6A 1X1PA 3IAM9 4DL5A 4I4BA 5D4PA 2X6NA 2XSFA