2HW3A

T:o6-methyl-guanine pair in the polymerase postinsertion site (-1 basepair position)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*T)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hw3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hw3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hw3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hw3A01
3D45A 3TFRA 1JLAA 3RAQA 4ED0A 1VSKA 4PHDA 3ASMA 3LPTA 5J2FA 5CZ1A 2X78A 4BACA 1TKTA 4HUEA 4YFUA 4UAYA 5KFCA 3HM9A 1T3NA 4PA1A 3RMBA 2EHGA 4KRFA 4GVMA 1K1QA 3HWTA 5KT6A 1S5JA 1CXQA 4UB1A 4B9TA 5L9XA 7ICOA 5DQIA 4KB1A 4DOCA 2C2RA 2W9CB 2C28A 3CG7A 4M9JA 3C1ZA 3Q8PB 4FXDA 2RF2A 4AHUA 3JSMA 3OHBA 3U3GA 1HMVA 1BQMA 4G1QA 4HUFA 1Q9XA 3RB0A 2XGQA 3ZDAA 4DQIA 4M3XA 2WTFA 5C24A 5KT7A 2GUIA 4MEYA 3C2MA 1NOYA 3HJFA 3SCXA 1S9FA 3JYTA 4I28A 2ASDA 3PW2A 4FJXA 3K2PA 3B0XA 4QZDA 1VSIA 1FKOA 4KHNA 5DB9A 2I9GA 4RQ4A 3PY8A 7ICJA 2OZMA 1Z25A 3OYIA 1TGOA 5EU7A 1RILA 3RWUA 1VSJA 2HB5A 4J9OA 3OYEA 2BDPA 3L2RA 1A77A 4B8AB 4BE2A 4ECTA 4FO6A 1BL3A 1VSMA 4TSXA 2NRWA 3KHLA 9ICJA 2IGIA 4FLUA 2DPJA 4K4HA 5JS2A 4TURA 1BGXT 4AH9A 4DQRA 4C8NA 1TKXA 1Q8IA 3O4QA 1HYSA 2ZTDA 3NGZA 4WE1A 8ICOA 1WLJA 3PO5A 4PPXA 7ICRA 4CFCA 3HO1A 3C23A 2RDJA 4DQQA 4E7LA 4TUSA 3M9MB 2RDIA 3LPUA 1ZQAA 3ZSRA 3QE9Y 4KHUA 4FM2A 3LZIA 4KTWA 1ZQSA 1T7PA 3VQ9A 2YHAA 5KFVA 4DG1A 1A5WA 2YNIA 3ZD9A 4HCCA 2FBVA 2P51A 1ASWA 4DTJA 1BPXA 3KLFA 2FBTA 3C6TA 1SKSA 3AVJA 1DTTA 3MDAA 3SZ2A 2BPFA 4DTUA 3SNNA 4JUZA 2QK9A 4OGCA 2A1JB 2FPMA 4YXJA 4UAZA 3MEDA 4E1NA 4PHPA 5CR0A 5J0UA 3OS0A 2DTUA 3OYGA 5I3UA 5HROA 4ICLA 5IIIA 4KMUA 4I2BA 4F4KA 1RDAA 5I42A 2V4QA 1R0AA 1ASUA 4BE0A 3KHRA 4O9MA 5J0QA 3RB6A 7ICGA 2JEFA 2XCAA 3QERA 5J2HA 1JL1A 8ICMA 2PFNA 4NLNA 4KHWA 4KLHA 4PGXA 1BCMA 1N5YA 4TUPA 2HHWA 4KLQA 3RJGA 3TQ1A 3V9UA 4DTOA 1RDDA 3QZ8A 3JPQA 2F1JA 2BCUA 3O3GA 1XHXA 1T8EA 5KG1A 5DBBA 1RTDA 3S9HA 4UB5A 3RBDA 3HP9A 3M9OB 5KFAA 1EP4A 3IHQB 3H40A 1B9FA 1Z00A 2BQUA 9ICGA 4OPKA 3GILA 3MXJA 4ELUA 4B9MA 4BXOA 4KTZA 1WSGA 4F4YA 3CFOA 1GOBA 3ZSXA 1BPEA 2GWSA 4RW8A 3RJKA 3AO4A 4BWMA 3RJEA 2PZSA 1KFDA 5HMLA 1U4BA 3QEVA 4MFAA 5KRTA 3S3MA 1BPBA 4F91B 1ZQQA 4HVJA 4RPZA 5BOMA 3RMCA 5DBCA 3QNOA 3PUFA 1TL1A 3NH1A 1NOMA 1QE1A 2KFZA 2V4RA 3SV4A 4ECZA 4DL7A 4FJ9A 1ZBIA 1IXRA 1DTQA 2I1QA 3SPYA 2W9BA 5HLFA 1COOA 1KRPA 1NKBA 3AUOA 2XY6A 8ICJA 3BQTA 4CHZA 4CHQA 4RUCA 3T1AA 4NY8A 2BGWA 1T4GA 1IO2A 4B9LA 3Q8MA 4GC7A 4J2AA 4PY5A 2IC3A 1A76A 2X74A 4NCAA 1KLNA 2X6NA 5K14A 3QEXA 4M9NA 2HNYA 9ICHA 4E19A 4BDZA 4Z4IA 1VRTA 5JUMA 4DL5A 4CFDA 1JLGA 4I2CA 4CEAA 4FLXA 5KFPA 1MU2A 1ZBFA 1VRUA 5J2GA 4F5RA 4DL4A 4Q44A 4O5KA 4YFKA 4RPXA 4Z6FA 5KFGA 2ASJA 4B8CA 4J2EA 1QLNA 2A1RA 4Z4GA 2IMWP 5L1LA 3AA3A 4QZ9A 2ZJ8A 5SWMA 3NTUA 2FC0A 3WNFA 3LK9A 1RXVA 3RH6A 1HUZA 2PY5A 3G6YA 3RRGA 3RR7A 4BDYA 9ICUA 1NJZA 3ZCMA 1Z26A 1YTUA 4ED7A 1JX4A 2B21A 4K8XA 2E6LA 3VQ8A 4M6WA 3V4IA 2ZJ5A 2BQ3A 3L8BA 4JWNA 1LW2A 4FVMA 4IG3A 5F9LA 5HHHA 1LW0A 3HPHA 3QZ7A 8ICAA 4DFKA 3UXOA 4R66A 1IKVA 5HRSA 4MFFA 1Z3EB 4E7HA 1S6PA 4FZYA 1O1WA 1IH7A 2FMPA 3V9ZA 3QEBZ 4RW7A 1UA1A 4F2SA 3AVLA 3ETLA 1JLBA 2VANA 1B43A 4ECWA 7ICQA 5KFWA 5HP1A 3WNGA 2PXIA 5J2DA 3LANA 4FLVA 1S1WA 4LSLA 3SV3A 9ICXA 3PX4A 4AHTA 3LP2A 3V9SA 5HRRA 3AVBA 4KLLA 5KTQA 2VG5A 3JPTA 5CYMA 4CJFA 3AVFA 1C7YA 4DTRA 4W5NA 1ZQKA 2HHXA 1WSFA 1ZQLA 5KFSA 5KFRA 1ZQTA 4RW9A 4YR2A 3FYHA 2IBKA 4P2HA 4E7KA 3VQ4A 3OYFA 4QZEA 4I2GA 4LZDA 2PFPA 4CJRA 4X5VA 3MEGA 2D0BA 1D5AA 3VQCA 4O3NA 4PHAA 3PMLA 4CF9A 3C2KA 1CUKA 5FRMA 4YVZA 3JPRA 4F5OA 5BOLA 4Q8FA 2YKNA 3OYMA 4OKJA 1F21A 1J54A 3L2QA 7ICNA 4FZXC 5EWFA 4QWEA 1WAJA 3PW0A 4RT2A 1ZQJA 4IBNA 1ZJMA 4M41A 2B6AA 3Q8LA 3N97B 1ZQRA 2PYJA 3PNCA 1ZQFA 2JLEA 2HHUA 4IRKA 2YKMA 3T5JA 1B22A 4YN4A 1NK5A 4I2EA 1X2IA 3BDPA 1NK9A 4KLTA 1A5XA 3KJVA 3HK2A 9ICEA 4KFBA 1BIZA 4O5BA 4ZTJA 4KLGA 2VA8A 3Q8KA 2YHBA 3VQPA 4E1MA 3TAFA 3NCIA 4I2IA 4UAWA 1BIUA 1ZQWA 4QWBA 1RTJA 1JIHA 3SJJA 4QW8A 2VA3A 3RH4A 1S0MA 1S0OA 4QAGA 3DRPA 4DL2A 4MF8A 4QZFA 3DLRA 2AJQA 5TZVA 3RB3A 1S76D 2C2DA 4N5SA 4H4MA 3ZSQA 4O3OA 2ZD1A 3DRRA 4HUGA 5DGBA 3RBEA 5HHIA 5FROA 3HVTA 4IR1A 3C94A 3MFHA 4NCBA 4JK1A 4CJLA 4RQ8A 4DOAA 2RN2A 4I7FA 4CFBA 2HHQA 3JPNA 1S0NA 1QSSA 4M3UA 1JMSA 4XRHA 3K58A 4R8UB 4ZHRA 4HHTA 1LWCA 3KTQA 3NGIA 4AILC 4FBTA 4FJJA 5DBAA 1CZBA 2XO7A 4EBCA 4LVSA 1SUQA 4TUQA 1D9DA 1UAXA 3QNNA 2D0CA 4Z6EA 4M3YA 4J9PA 3ISBA 4YG2A 1S1TA 3B6OA 3ZT2A 4JV1A 3OSNA 1ZQEA 4DTXA 2O4IA 5KFIA 5FDLA 5KT4A 3KLHA 2YNHA 9ICCA 2KZMA 2R8KA 3BQ2A 4YQWA 1TK5A 2BPCA 5IILA 3EPGA 1SL2A 4L8RB 3DI6A 4Z6CA 4KV8A 4CHPA 4F5QA 3NFAA 3TI0A 1ASVA 1B92A 4QZIA 2ZTEA 5KFOA 3I0RA 2OA8A 4IG0A 2P5GA 3L3VA 4CF8A 4BE1A 3ALYA 4EP4A 3DMJA 8ICRA 4QWCA 3ZT3A 4DSFA 3T3FA 2OPPA 3DLHA 5KG0A 1RXWA 8ICIA 3QIOA 3QO9A 3KD5E 3G6VA 4CESA 2JEIA 8ICYA 2ATQA 3NF7A 1UT5A 4M3WA 2W42A 4MF2A 3F73A 5J2PA 2XY7A 1XU4A 4FLYA 3ITHA 4FS1A 4CIGA 3KK2A 4JWMA 2NRXA 3RMDA 3QEPA 4C8MA 5CP2A 3GV7B 3WNEA 2FBYA 4DOBA 4ECXA 1JLEA 3NF8A 8ICTA 1WNSA 4E89A 2FPLA 3LWMA 2BCRA 5J0SA 3RAXA 1L3SA 4DSLA 3MXMA 3K4GA 2Y1IA 4DSJA 2H5XA 4DU1A 4RQ1A 1RZTA 4FJHA 5KFLA 3PW7A 3K75D 3OY9A 3O3HA 1RT3A 1VSLA 3KHGA 5J0TA 3TFSA 3QESA 1C6VA 1J53A 4GXIA 3TAPA 4CF1A 4CJ5A 4M9LA 1BPZA 1UWBA 1X1PA 1YVUA 3QEIA 2XC9A 4QZBA 1EETA 1W9HA 5DQGA 4NLZA 3H8SA 3OVNA 2JEGA 2B4JA 4ED6A 1BHLA 3ZSZA 4NLKA 4CEFA 2AGOA 3U3YA 4F4XA 4ELVA 5F9NA 1KFSA 1T05A 4BGDA 1MSWD 3FFIA 4R5PA 5KFJA 1ZJNA 3K5LA 2ASLA 5J1EA 3UQ0A 3OS2A 4O44A 5KFMA 1ZQBA 2QKBA 3NH2A 2GBZA 4O3QA 8ICUA 2VWKA 3V9XA 3OHAA 4QCLA 1WCNA 4W5TA 3LP1A 3RMAA 5KFQA 2Z1IA 4ELTA 4ECUA 4IKFA 4BWJA 2NRVA 3ZSWA 5KG5A 4O4GA 3K5MA 3GDXA 2AU0A 4ED2A 2W9CA 4M9GA 5KFBA 2UVVA 4KN4A 3K57A 1RT5A 3T5LA 4FW1A 4E0DA 3V7JA 4ED8A 3EW9A 1C0MA 3KKSA 3EWAA 4DSKA 3OYCA 4E7IA 2FLLA 4EP5A 1Z00B 4CECA 4YD1A 4YR3A 2RPIA 4O3SA 2G8HA 1C0TA 2FPKA 3MR5A 1ZQXA 1K6YA 4CCHA 3GIMA 4RQ0A 2YNGA 2JZBB 5DMRA 2J6TA 1BCOA 5DLFA 5J2MA 2ISPA 4Q0BA 5KG7A 3OSPA 1U04A 5IIKA 4O0IA 1VSEA 4FLTA 7ICVA 5CZ2A 3GV8B 3GIJA 1HYZA 4KTQA 2P6RA 2V9WA 3RH5A 3PX6A 9ICOA 3ZSOA 1D8LA 3AVAA 1L3TA 3ISCA 3SQ4A 1XWLA 4FK4A 5IIMA 3WNHA 4DS5A 4FJ5A 9ICLA 2W8LA 3AA2A 3CM5A 1UOCA 5EOZA 3OYJA 4IDKA 4RQ6A 2I5JA 2R7YA 4KKOA 4EZ6A 1FK9A 1GOAA 4J9RA 4CJ4A 3OYNA 4DQPA 1HNVA 4ZTFA 3AA5X 4XQ8A 4CEZA 3NH0A 4QZ8A 3ZDEA 7ICEA 4JS5A 4DFJA 2P1JA 3MFIA 1S97A 1HRHA 2QXFA 3KK1A 4I9QA 3T5HA 1KVCA 4FK2A 3UIQA 2VG7A 3RJIA 1ZQDA 7ICUA 4KLDA 4I2PA 2G8UA 4EZ9A 1XI1A 3MXIA 3TAEA 2A1JA 3TANA 3SUOA 3TR8A 4CJSA 2UVRA 4M3ZA 3G10A 2BCSA 4CHOA 5KG6A 3EZ5A 3TAQA 3FDSA 3F9KA 3SUQA 4TQSA 4CFAA 4OJRA 4IRCA 3SQ0A 4YMOA 5KG2A 1S1VA 8ICNA 5IINA 2P66A 1S9GA 3DRSA 2VWJA 2HNDA 3KIOA 4O55A 1RT4A 1KCFA 3VN5A 4LY7A 3LAMA 3QETA 3GIKA 5JS1A 4NM1A 4XA5A 2KZ3A 9ICFA 2F96A 3C95A 5D3GA 4Z4EA 4QW9A 4C8KA 3DOLA 4JRQA 1LWFA 2R8IA 2M9NA 1SZPA 1BI4B 3Q8QB 5DKWA 3PVXA 4KLFA 3DM2A 3CQ8A 1RT1A 4F5PA 1RT7A 1C0UA 2J6SA 2J6UA 4Q5VA 2ISOA 2LYHA 4J9SA 4CEQA 1ZQOA 1TVRA 5KFHA 1FKPA 3S3OA 5HRPA 1SL1A 3ISNC 4IQUA 2YV0X 3VQ7A 4KLEA 4OKEA 5J2BA 2BKEA 4IQTA 9ICTA 4RZRA 3K5NA 3G6XA 5KFNA 3AO2A 2AQ0A 3HXMA 4M3RA 4O5CA 1ZBLA 1RYRA 4ED3A 2OYQA 4J2BA 4CGFA 5L1IA 3E01A 3AO1A 5DG8A 4DEZA 2DFLA 7ICLA 1V9PA 4PWDA 4I9LA 1XO1A 4DU4A 4RQ2A 3NGDA 4XUSA 3KLGA 4HYKA 4N56A 5KFEA 1TL3A 2C22A 3B6PA 3B0YA 1XSPA 2F1HA 5C5JA 9ICWA 4YXMA 3RJJA 3V6DA 4RQ5A 7ICFA 4CJKA 4JS4A 4ECVA 2ZUDA 4QZAA 3QEAZ 4E3SA 3A2FA 4KITB 4I2AA 4DU3A 1TK8A 2Q3SA 5IIJA 5DB6A 3RJFA 2DFEA 4JLHA 2OPSA 2KQ2A 5J2CA 2RKIA 3OYDA 2O4GA 1SV5A 4Z4FA 5DGAA 1LWEA 3AA4A 2PFOA 2ATLA 4R65A 4PUOA 3SUNA 3V72A 1WCLA 4DQSA 2BQRA 7ICPA 1RBVA 4I29A 3TWHA 3OYBA 5KT2A 5D4BA 2ETJA 5KFKA 5C25A 2HHSA 4KPYA 2F8SA 3PW5A 3MR3A 3MGIA 1N56A 3IM1A 3M8SA 2FLPA 3TAGA 3N4MB 3E2EA 3H4DA 1JLFA 1KEJA 2P6UA 2AGPA 3SQ1A 4O0JA 4RW6A 1CLQA 4DTNA 2DFFA 2NRTA 4F4WA 1KSPA 3KHHA 4M9HA 4UBCA 2C2EA 2VA2A 4FW2A 1TFRA 2YNFA 9ICQA 3UQ2A 3MBYA 4FBUA 1HJPA 4GLXA 1ZQZA 4F8RA 3I8DA 1TKDA 5DK5A 2IA6A 4KLSA 1RBSA 3PW4A 2P5OA 5KGXA 3DLEA 1AROP 4DLGA 4CEEA 8ICPA 4CIEA 1EKEA 3ZT0A 8ICQA 2Z1JA 5DG7A 2PYLA 5L1KA 9ICVA 4KHSA 3GFKB 2FMSA 3L2WA 3ZD8A 2E4LA 3IS9A 9ICMA 2HVHA 5CWRA 1RPLA 1ITGA 2HMIA 1ZQHA 1FXXA 3TAMA 1QQCA 5J0RA 2E6MA 1SKWA 3OYAA 4ID5A 5KFDA 4FJNA 4CJTA 8ICEA 2G8KA 1JL2A 3MR2A 1C1CA 1NKEA 1RCHA 4KO0A 1L3VA 1ZQUA 4H4OA 5KFXA 1JXLA 4W5OA 4CERA 8ICLA 3H08A 4CEBA 5FRNA 1QTMA 4ED1A 2IAJA 8ICGA 5KGWA 4MEXA 4UB2A 4EYIB 2D5RA 3OYHA 1XS9D 8ICCA 4GXKA 2IHMA 3EPIA 4GC6A 5KFFA 1WSJA 5L1JA 5CHGA 5KG3A 3MGHA 8ICBA 1RTIA 3OYLA 4F4ZA 4K4IA 8ICZA 3OYKA 5J0PA 4O3RA 3VQBA 2WOMA 4YR0A 4F50A 1TVAA 4R63A 4KLOA 1NJYA 4CGGA 5DB7A 4R64A 1NK0A 1LB2B 2LSNA 3P5JA 4UB3A 4QZHA 3CM6A 4I2HA 2XRIA 3OS1A 1N48A 4O5EA 4M42A 5KI6A 2MUTA 3JPPA 4DSEA 3NE6A 5DQHA 4EBEA 4PGQA 7ICKA 2Q0ZX 1X9MA 3RTVA 4B3OA 1BQNA 3TARA 3C1YA 3VQ5A 4R8UA 5J0WA 1W0HA 1WN7A 1KDHA 5BPCA 4KHYA 2OPQA 4P4OA 1XHZA 3HVRA 4ID1A 4IFYA 1MQ3A 4KLJA 3C2LA 2X6SA 7ICMA 5CJ7A 3KKRA 3QLHA 3DYAA 4QWAA 1XSLA 3NAEA 4RU9A 1U47A 2PI4A 4CJ3A 3LWLA 4YMMA 3VQAA 2ZUCA 4CF0A 4FK0A 3MDCA 3H8JA 5KT5A 4DTPA 3TABA 2KW4A 1IG9A 4CEDA 2PFQA 8ICHA 1ZQPA 1RDCA 2G8FA 1NJXA 1K1SA 1H38A 3NGYA 1NKCA 3AO3A 2HHTA 4M0AA 4XIUA 3VQDA 4CK3A 2AGQA 3SQ2A 3G0ZA 4IRDA 1RNHA 8ICFA 1HPZA 1B9DA 5J2NA 1CXUA 1L3UA 2G8VA 3HSTB 9ICPA 1RT2A 1RBTA 3IAYA 3BQ0A 2HVIA 4RW4A 1C1BA 2PI5A 1WAFA 2KN7A 4KHQA 3V7KA 1TAUA 3DOKA 9ICAA 5CA7A 3LDAA 3S3NA 3OJSA 4CHYA 1ZQVA 2R8GA 1JXBA 4CIFA 4JV0A 1HNIA 5E41A 2OPRA 4W5RA 3L2VA 4P4PA 4FCYA 4LH4A 1D9FA 3ZT4A 3Q8SB 1ZQGA 4B08A 3HT3A 3GIIA 3C5GA 3I0SA 1GOCA 5CB1A 1KLMA 2ZJAA 3M9NB 1L5UA 3MAQA 3UXPA 5DB8A 4DTSA 7ICSA 5D46A 4BXOB 4FJGA 1IKWA 3QINA 4DO9A 4I27A 4DTMA 4OGEA 1TAQA 3VA3A 4AHSA 4PQUA 2BR0A 1X9WA 9ICIA 4YP3A 1QHTA 4FJ8A 4QOZB 4IR9A 2BHNA 5J2JA 3BQ1A 2BE2A 5J2IA 4K8ZA 4Z0UA 1HYVA 3C6UA 1RTHA 4G3IA 3SUPA 4NXZA 1UA0A 5J2AA 3AO5A 2W9BB 3KD1E 3V9WA 1A5VA 4C8LA 2BCVA 4CGDA 4I2JA 1JLCA 3H7IA 4P4MA 4RPYA 4M04A 1JXEA 5DDYA 2GV9A 4NLGA 4CJUA 4N41A 1QSLA 2G8WA 4KAZA 1KVBA 4JRPA 5C42A 1CEZA 2B5JA 4QZGA 1NJWA 1ZETA 2EX3A 3ULDA 5DLGA 7ICIA 4K4GA 4EEYA 1X9SA 5J0XA 1WSIA 1HQUA 4TQRA 4KN7A 3BGRA 4RG8A 4H8KA 4CJVA 1S10A 3NF9A 4KI4A 1SKRA 8ICSA 4AHCA 4M47A 1KVAA 4B9UA 3DLGA 4DL6A 4KREA 3L2UA 3ZSYA 1KFTA 1VK0A 5CY4A 3K5OA 3IG1A 5J2EA 8ICKA 1WSEA 1BVSA 4FJKA 2JZBA 4MFCA 3PR5B 3O3FA 4KI6A 2FBXA 3UPQA 4M2YA 1S1XA 5CYQA 1HUOA 1UT8A 2ALZA 4B9SA 2IS3A 4J9MA 4W5QA 1TV6A 4RNMA 3V1RA 4Z4HA 1U48A 4M6WB 4GW6A 4GXJA 4YMNA 2D0AA 5DG9A 3HPGA 1S9EA 4YCXA 4Q8EA 3RRHA 4CGJA 3V7LA 3ZDDA 1DOQA 4UBBA 1NK8A 3EY1A 3SI6A 1IKYA 4MQ3A 3SYZA 1S6QA 4QWDA 1I39A 8ICVA 1HJRA 1VSHA 4RNOA 1ZQNA 4N47A 2AQ4A 3NDKA 4KLMA 1SL0A 4B9VA 5EWEA 5J0OA 1KTQA 9ICNA 4F3OA 4FLWA 2ZUBA 4FLZA 5KFZA 4NCGA 4IQVA 4CJPA 2OZSA 2G8IA 3Q8RB 4OKKA 4DF8A 4DFPA 1PZNA 1Y88A 5HBMA 5DDMA 3AU6A 3ISDA 3V1OA 4AHVA 3MEEA 3EYZA 3T19A 1WSHA 2VG6A 3K59A 1U49A 3VQQA 1LAWA 3MABA 1QS4A 4LZGA 4J9LA 3P83D 1XSNA 2ITGA 2XHBA 4UQGA 3PR4A 3V6HA 3H8WA 3AVGA 7ICTA 5KT3A 3V1QA 4F92B 4QZCA 1EXQA 1JLQA 5EWGA 2IHNA 3AVHA 3MECA 1TKZA 3AV9A 9ICSA 2UVWA 2HNZA 3ZDCA 3HYFA 2QKKA 1CZ9A 1NK4A 1RT6A 2JGUA 4DSIA 2KFNA 3QIPA 3RR8A 2ZTCA 1EX4A 4OLAA 2KTQA 3ZT1A 4FYDA 1S77D 4N76A 4RUAA 3AVNA 4IQWA 3CFRA 3M8RA 4FJ7A 1RBUA 1BI4A 5KFYA 5J2QA 1YTAA 3THVA 2XY8A 5T7BA 4OVLA 1JKHA 3M8PA 4CF2A 3JPOA 2BCQA 1REVA 4FS2A 2XGPA 3CFPA 5J0YA 2NRZA 1RDBA 4CJEA 4DF4A 1Q9YA 5HNKA 5J29A 4Q45A 3AVKA 3GQCA 2IDOA 3NF6A 3VQ6A 1S0VA 2HW3A 3RB4A 3HW8A 3LZJA 4M3TA 1G15A 4I2FA 5HRNA 2W8KA 9ICRA 1S1UA 3LDSA 3PMNA 1DGSA 4ZH4A 4ECRA 3KLIA 2UVUA 4F93B 5HP4A 4FM0A 2JEJA 3U6FA 5KFUA 4LSNA 2BGGA 4F3TA 1EXNA 1ZBHA 4RNNA 3VQEA 4CK2A 5HMMA 1XC9A 3KK3A 4PH5A 4LD0A 4CGHA 4FM1A 4JV2A 3AVCA 1ZBUA 1BISA 4RQ3A 4RT3A 3O4NA 1T03A 4J9NA 3NBPA 1MQ2A 4M45A 4AHRA 4O3PA 2F1IA 3C5FA 3HL8A 3ZSVA 4ECQA 3ZDBA 4HCBA 4FZZA 5KRSA 1DLOA 2XY5A 4PGYA 4Q43A 4CEOA 4J9QA 4DWIA 1NK6A 1U45A 4KLIA 3OGUA 3BJYA 4Y1CA 4Y1DA 3P1GA 4YD2A 2ZQBA 4KB0A 1MC8A 3DLKA 4OPJA 3HX0A 1RBRA 3V81A 5D49A 1TV9A 2W9AA 1ZQIA 2BANA 3DLBA 2R8JA 4CHNA 4CJQA 1IKXA 2OWOA 2XCPA 3M8QA 1BPDA 3MR6A 3LALA 3PX0A 3SI8A 1LV5A 1NOZA 4UB4A 2KZZA 1JN3A 2Z1GA 3HPOA 2Z1HA 4Z6DA 3LP0A 2Y1JA 5IIOA 8ICWA 3JPSA 4CGIA 4DS4A 8ICXA 4KLUA 2NUBA 1VSDA 2FLNA 2DFHA 3AVMA 5KFTA 3VA0A 3KLEA 3OJUA 4PHEA 2MAXA 4B9NA 1C1AA 5KG4A 4GMJB 1J5OA 4LH5A 3SPZA 4J9KA 3V6JA 4NM2A 3AVIA 3L3UA 2WONA 2MUTB 9ICBA 4DMNA 1I3AA 4I2DA 4MFBA 4NYFA 3IRXA 3LP3A 2W9MA 4ECYA 2IOCA 2FMQA 1BPYA 1YT3A 1VSFA 7ICHA 4DLEA 3ORYA 4EBDA 3V6KA 1ZYQA 3T5KA 4FJLA 1LAVA 3CYMA 5SZTA 4EYHB 4FJMA 4F5NA 3RJHA 4CE9A 2R8HA 4I2QA 3HP6A 4NYNA 4F2RA 4FJIA 3NHGA 2ZE2A 4E7JA 1QSYA 1D8YA 4IFVA 1ZQYA 4RQ7A 1NK7A 4YNQA 1ZQMA 2DY4A 2BPGA 2DPIA 3QEWA 3LAKA 1RYSA 1N6QA 4DL3A 1J9AA 1TK0A 1ZQCA 3UXNA 4DFMA 4CK1A 4ECSA 3GV5B 4HTUA 3PO4A 2HHVA 4CJWA 4Z4CA 5J2KA 1Y97A 2A1SA 4OLBA 4C8OA 3C21A 1HQEA 4J2DA 1IM4A 3AU2A 3PV8A 2F8TA 9ICKA 4BDPA 1U9LA 3D0PA 3H4BA
chains in the Genus database with same CATH superfamily
3D45A 3TFRA 4AE5A 4UW2A 1VSKA 4PHDA 3ASMA 5J2NB 5AQOA 4IOXA 2Z2YB 2DXDA 3M2RA 2IHR1 2X78A 4RW4B 3KJQB 3HM9A 4BQLA 5AXLA 5BXIA 4J90A 4M5MA 2LBOA 1C1BB 1ZRNA 5KT6A 3IWLA 4FZNA 2D6FC 4B9TA 3VAFA 2CPFA 1T9TA 3T1HJ 4O0NA 4KB1A 1HBUA 2DY1A 4MDBA 4M9JA 3C1ZA 4ZDNA 3AD9C 4DX6A 2VF3A 2NSBA 5AQSA 2E9RX 2RF2A 2Q79A 2NRHA 3OFEA 3U3GA 1Q9XA 4FWNA 1CPZA 3ZDAA 4C8ZA 1H98A 4M3XA 1NBEB 3I0SB 2GUIA 1NOYA 1K5OA 2XVTA 3SDEA 3U9ZA 3QYYA 3AA9A 1S9FA 4CLPA 5C15A 4I28A 5AKXA 4FJXA 3K2PA 3D6RA 1IBKF 3W64A 1ZXOA 4GKKF 5HQMA 2HBRB 3M2UB 2MZ1A 2UV8G 4X4RA 5DB9A 4BRLA 4RQ4A 4BRPA 2IOHA 2OZMA 5J2MB 1TGOA 4NL5A 3RWUA 2BDPA 1A77A 4B8AB 4BE2A 4ZVEA 2GMJA 3KHLA 2BJEA 3DGVA 4MK7A 1V5IB 2UUCJ 3JXUA 3MMJA 5KPTA 5ELZA 4C8NA 1N0VC 3O4QA 2QWNA 3UWTA 4JHDB 4ZVFA 3F2KA 2AH5A 2B0CA 4H0XB 3PO5A 3NGRA 4JI2K 4CFCA 3HO1A 3C23A 2N1RA 1DQAA 4YY3K 1RWPB 3M9MB 2V69A 2GNKA 1OYEA 4FXVA 2WUSA 2DVIA 3PSFA 4JI4K 3CIPA 1OMSA 2VV5A 2YHAA 4PXDA 5KFVA 3ZX2A 1TMJA 3BH7B 2FSNA 3KLFA 2W03A 2FPHX 5AKZA 2VG7B 1SKSA 3AVJA 1DTTA 3MAAA 3MDAA 3FNNA 3SZ2A 4JUZA 1HR0F 2Q97A 2A1JB 3OL8A 2GVDB 4UAZA 2QLBB 5J0UA 3QUQA 2UXBK 4LJXA 1Q95G 2CQ4A 1S1XB 3EVOA 3OL9A 3QMLA 5KQDA 4BE0A 3PNIA 4O9MA 4JD2B 1TV6B 3SAHA 4ZPWR 2ZBPA 3U27A 4IOCL 4C3MA 1VLYA 2JEFA 2LHTA 2J7KA 4TLQA 3QERA 5RUBA 1WBDA 4EU0A 5J2HA 3DXKB 4PL8A 3NCPA 1ILYA 4KHWA 2UUBJ 1N5YA 5D3GB 2D9OA 3VAMA 4IOAQ 3CJ1A 3NVKA 1RB0A 5HQ8A 1RDDA 4OIXA 3JPQA 5U47A 4AQYK 2F1JA 3CMQA 1SIJA 3QJPA 4DV7F 2XI2A 2MQLA 3G2XA 4DV0J 2F3JA 3FGVA 3O6QA 1RT7B 5AKHA 1C0UB 3HP9A 3L7PA 2BJ3A 5F0UA 3IHQB 2A18A 2RQMA 1MN7A 3MXJA 3BSAA 4C0HA 4BXOA 1FD8A 4NCGB 1WSGA 3CFOA 1TL7A 3ZSXA 5AR0A 1BPEA 2GWSA 3RJKA 2XHCA 4BWMA 1ZAVA 2PZSA 3CDWA 2K4PA 4FWLA 2YCHA 3R3LA 4JEPA 3QEVA 1VQMN 4F91B 4HVJA 4DUTA 5BOMA 3VEVA 2DJWA 3QNOA 3DXMB 1NOMA 1QE1A 3SV4A 2AX0A 3BY5A 2K1RB 4PXCA 4ECZA 4DL7A 1NPPA 3KK7A 1IXRA 2ZJQQ 1GH8A 3SPYA 4CF3A 4PG8A 4C1NI 1COOA 1UPHA 5FPEA 4FWPA 2B43A 3E01B 2NZTA 3BN4A 4RUCA 3T1AA 4JYAJ 1IO2A 4J2AA 3FSYA 4AFFA 4CZIA 3D28A 2VBYA 3CPEA 3NOGA 3AT1B 5K14A 3NLCA 2D0PA 4ZITA 1ULRA 2HNYA 4MIWA 5AZIA 2QN6B 4DL5A 4I2CA 2FYXA 4CEAA 2Z2MA 3VEZA 4JKGA 5KFPA 3M8PB 2AHOB 2E3TA 4KBOA 3GJTB 1L8OA 3TUJC 5F2RA 3UCGA 4Z94A 4O5KA 1X4GA 4L3KA 4DV1F 4MT1A 3SBGA 2R3VA 5IT9O 4WBFA 3CJ2A 4B8CA 3PJ9A 3T41A 2A1RA 1V3RA 4Z4GA 2IMWP 3IKMA 4BC4A 1S12A 1QD1A 2RQ5A 2Q4TA 3HSDA 3UD4P 4PUOB 1ZQ1C 4BDYA 4MDAA 4FWRA 1FKAF 3HZGA 1YTUA 2X3DA 2B21A 3CIZA 2YMPA 1XC3A 3V4IA 4A5BA 1FRHA 3L8BA 2VJVA 1HFEL 3GLJA 5F9LA 3CE8A 3FUYA 5E79U 2JWLA 3HPHA 4R66A 1IKVA 5HRSA 4ES3A 2QA4G 4WP8A 4OYBA 1VBKA 4UT4A 3VAIA 1IH7A 2FMPA 4ZVPB 4F2SA 1JLFB 1CS4B 2IRUA 3ETLA 5ETPA 2VANA 4RW6B 1FRIA 3ZC4A 4PRFA 3WXJA 1NLKL 4W4MA 1S1WA 3PJWA 4LSLA 4X66F 2YX6A 3C46A 1PVPA 2NR0A 1YJWN 4NA2A 4ED4A 2EFQA 4K4TA 3FCHA 2VG5A 2B9YA 1MDUB 2VYPA 2BJDA 3VPZA 3V81B 5ALSA 2CQHA 1YXQA 4W5NA 3DLEB 1ZQTA 5KFRA 3A0IX 1J2VA 2E88A 2Z7JA 4YR2A 3HFZB 4E7KA 4YS2A 3OBWA 3OYFA 4I2GA 3AL0B 2PFPA 4CJRA 3MEGA 4RX6A 2MYFA 3WK4A 1HKGA 3DCAA 3C2KA 1CUKA 2HAFA 4DV3J 4QWEA 5ALGA 3ILLA 1GLDG 3Q7CA 1M1KO 4JV5J 2HVZA 4ID5B 1G3OA 1NU0A 3Q8LA 4MKBA 4H5RA 2VQEF 4BRGA 2D8CA 2NZCA 2VBXA 4LF6J 1JJHA 2CPEA 3C6HA 3T5JA 1WOPA 4KO0B 3WKEA 2DWQA 1X2IA 4HWIA 3KG0A 4XO0A 4F71A 5CQGA 1S22A 3KJVA 3HK2A 9ICEA 4O5BA 2E2QA 2L9NA 2UXDJ 2ZBQA 3TAFA 5AK5A 3Q8KA 2RMLA 4P0PA 4NO7A 1U0HA 1VLBA 5AZJB 4IXCA 4I2QB 4UAWA 1BIUA 3D6MB 1Q53A 1S72S 4DV4F 3GFYA 4WKRA 4OX8A 1RTJA 2CJ9A 3WK8A 4IFVB 1DK3A 4QW8A 1PAEX 3E51A 1NB7A 4ILMA 4TLRA 1S0OA 4P7VA 4QAGA 4KX3A 4DL2A 5FP0A 5LL6Z 2WAQF 2WOMB 4AYBF 2AJQA 2QRRA 1F3VA 1GTEA 4NLSA 2IYIA 3L4QA 4H4MA 3ZSQA 2KV2A 5DGBA 4JK9A 5HHIA 3G71S 5FROA 4GRSA 4UB6U 4DMZA 1HQEB 3WQPA 3AY9A 3C94A 4YN3B 4JK8A 3C14A 2VPWB 3B4DA 1VFJA 2W11A 2FGOA 4NXMJ 2RN2A 4B3OB 1BQNB 1S0NA 4PZOA 1QSSA 3CO0P 3IO1A 4R8UB 1NGGA 4PKIA 3WC0A 5AI8A 3I76A 3KTQA 3GFXA 3NGIA 4IQXA 5EN1A 4AILC 5LSLA 4FBTA 2RAQA 4WYWA 3HZ6A 4CZKA 4X64F 1MWMA 1E6YB 3ZZYA 3IN5A 2XO7A 4OI4A 1NGIA 4IFYB 4QIWF 2C2ZB 1D9DA 4GKJF 3OR2A 2D0CA 4Z6EA 3QMQA 4YG2A 1S1TA 4X4UA 4TY8B 4JV1A 4DTXA 2O4IA 1TMMA 5AQLA 2EKYA 1D8ZA 5DO2A 2YNHA 2KZMA 3JSMB 2QLFB 2QYCA 5IILA 7FD1A 4L8RB 3DI6A 4OPHA 3VEXA 3LDQA 5E26A 2XS2A 2BKNA 3WZ0A 1DXSA 4QZIA 1RLCL 1RTZA 2OA8A 2DISA 3KG1A 5IT0A 1T11A 3C0BA 2O8DB 1FXRA 4JNEA 3DMJA 8ICRA 1SJQA 3TZXA 1QDUB 2CRXA 2WW8A 3NAIA 3M6GA 5D4OA 2UUWA 3QUBA 5KG0A 5FLXO 3E1YA 8ICIA 1IBMK 1KC8O 4L76A 1O08A 2JEIA 1FE4A 3NF7A 2B56A 3GBTA 1S59A 3H98A 2DNNA 4DCCA 1YX2A 4DV5J 3F73A 2XY7A 1EKSA 1W7WA 3THWB 1RHQB 5BYQA 2PFDA 5KQ8A 4C8MA 3LPYA 3CNQP 3LOUA 1HUXA 1NZ8A 4DOBA 2RP5A 2ZVSA 2WCXA 1WNSA 2FPLA 3VAGA 3LWMA 1L3SA 1XMOJ 1Q81O 3K4GA 2RJZA 4RQ1A 2ZIWA 3K1RB 1KLMB 3Q86A 1DGJA 3OY9A 2P9SA 2R7QA 1KR4A 3BO3A 3O3HA 1VSLA 3TFSA 2XEXA 1QTNB 1J53A 4GXIA 3D2EB 2DIVA 2B9XA 3IP0A 1BPZA 1UWBA 3QEIA 5F0XA 5L39A 2JGAA 4NLZA 5AE1A 1B4SA 3CJBA 3CD5A 3H8SA 5EY4A 2BM1A 4ETZA 2B4JA 1YBAA 3CCUS 2J4RA 1N5VA 2HAIA 4CEFA 4F4XA 1T05A 5KFJA 3DLLQ 5I3UB 2H1YA 5AK4A 4GNIA 3UQ0A 4K8RA 1U1OA 3NH2A 5I42B 2XYGB 4WXWA 5A0YB 4QCLA 2G2OA 1WCNA 4W5TA 3CRXA 5EHHA 1GXUA 4ILRA 1KN5A 2E8NA 1U6ZA 2O8BB 1VHXA 2HBLA 1FRMA 2AU0A 3K5MA 4M8LA 4ED2A 5AQIA 4BCAA 4M9GA 3ZI4A 3FQLA 1HQUB 3HD2A 2F4VK 2VPYB 5L46A 1ZAWA 2M70A 5ALZA 3VZIA 3EW9A 1C0MA 4WCEQ 4USUA 1Y4ZB 3OYCA 8AT1B 4JI3J 4EP5A 2CDRB 3M7VA 1W25A 1WC4A 4YD1A 4O3SA 5FD1A 1P9QC 2NXNA 2FPKA 1XO0A 4JK7A 2M7SA 3S6JA 4DR4J 1XNRJ 4FOIA 4YOYA 5DMRA 3BGUA 5GADP 2J6TA 1WEZA 5J2MA 2BKPA 4ATNA 1L6NA 1B70B 2DHXA 4P73A 5K8MA 1KVIA 3A8IA 4LMZA 5IIKA 2IRYA 1VSEA 3SCLE 2ODGA 4GIBA 5CZ2A 3GV8B 1HYZA 3Q24A 3D3CJ 5M2RA 2JC1A 3D54A 1N5WA 3D2SA 3QGGA 2KG1A 1L3TA 5LMNJ 2P9LA 3PIPQ 2QA4N 3SQ4A 4JHDA 2RNEA 4DS5A 2WSFC 3QSIA 4KGMA 3OYJA 3CMES 4RQ6A 3BUZB 2KK0A 2C2KB 3AGKA 2A1BA 2B4VA 2X1FA 1FTRA 1ZZNA 4DQPA 5AJ3F 1HNVA 3TVZA 2P9NB 3GG1A 3AA5X 4UB8U 1Q16B 3MPDA 2E5JA 1GX5A 1WELA 7ICEA 1VRTB 4JS5A 2DNMA 2P1JA 4A4JA 3BEXA 2OP5A 1MU2B 1P7DA 1B0VA 2D3OR 4CGZA 2HLTA 3UIQA 4BG9A 2VG7A 4CI0B 4DV2F 4KLDA 5AM2A 1BG3A 1V97A 1RDWX 4NASA 2G8UA 2ZOGA 2E1AA 3MXIA 1KVJA 4QS7A 3O9QA 2A1JA 3C16B 4MIAA 4PKHA 2UVRA 1FEHA 1K8KA 2BCSA 2ZWOA 2I9SA 3FDSA 2BJ1A 3UE2A 3FBEA 4CFAA 2K3KA 4IRCA 2HMPA 8ICNA 3H5XA 4EEKA 2F7VA 4DUYF 2HNDA 4O55A 3WHIA 1KCFA 4LF9J 3VGLA 3QIDA 4LY7A 3QETA 3DXKA 2VB6A 9ICFA 4IG3B 3TX0A 1FRLA 5D3GA 3C95A 2EPIA 3TX8A 1KN6A 1SZPA 5DKWA 4KLFA 4F36A 3R5AA 4ZVOB 1RT1A 1RT7A 1C0UA 1UW9A 1HA1A 3DLJA 3BP8A 2AIRB 4J9SA 1Q4RA 1HNXJ 1ZQOA 2JWKA 1Q46A 4H4KA 5HRPA 3CDAA 4CNQA 2LQ9A 1S1UB 3SFGA 4CQ1A 3AY0A 3G8SA 4PZNA 2YV0X 3VQ7A 4KLEA 3KLIB 2BKEA 3TADA 1S6UA 1U8WA 4QNLA 2J0XA 3OVBA 4QYRA 1HJOA 5KFNA 3H5SA 3WX4A 4ED3A 4PAAA 4QS9A 4J2BA 3DXBA 3E01A 3AO1A 3A8EA 7ICLA 1I94J 2QWRA 2GWKA 3QICA 3O5BA 3NBPB 1VYAA 2OH2A 3NS1A 2V5HG 2E5LK 2LEPA 1XO1A 3NP5A 4DU4A 4XUSA 4HYKA 5KFEA 3DN9A 2DPNA 4ANEA 3O08A 2C22A 2ROGA 3CCMN 2KOBA 4WFNQ 1CC7A 2AYGA 2YKMB 4F25A 2E29A 3BO4A 9ICWA 1M1HA 4YXMA 4DR5K 4K0KJ 1FA0A 1H0HB 3D4JA 4FWSA 2DY9A 2Q3SA 5JMVA 2XBPA 4UF4A 3UKRB 2VC1A 3CJSA 4JI5K 3FMWA 1SV5A 3M8YA 2Y1RI 5CD4H 5TISU 4NLRA 2PFOA 2ATLA 4PUOA 3LP0B 2Z58B 3SUNA 2EWSA 1NSPA 1WCLA 2JLGA 2BQRA 4OYPA 1Q18A 2Z0GA 5IT9U 3QX7A 4I29A 1PIEA 1PGZA 4CIOA 1J5EJ 2HEKA 3OYBA 1J5OB 5AQTA 4NLTA 3L4BC 3PW5A 2OMLA 1NMDA 2MKCA 5D4LA 3FCWA 1N56A 3IM1A 2HHHK 4JI4J 4FWQA 4WPAA 3HHEA 1JLFA 1KEJA 1CS4A 5HANA 4IO8A 4A61A 1VMBA 3OTDA 4RW6A 1EAYC 2YWWA 1N62A 4OZ0A 4F4WA 1L7OA 3KHHA 3G87A 4TNOA 3G9CA 3W2VB 5HMXA 1HIWA 2CYYA 3VEYA 5H1SV 4FBUA 1ZM4A 2F40A 3D6TB 1ZQZA 4YEAA 4WJBA 2K2PA 5DK5A 4KLSA 1H2TZ 4AM6A 1N32F 1F9FA 2P5OA 2HS4A 2FGCA 3DLEA 5FDLB 3K17A 2DGUA 2SXLA 8ICPA 4CIEA 1YJRA 3TP2A 4FF2A 1TL5A 2Z1JA 2QV6A 1WI8A 2PYLA 2A5XA 2ZNZA 5BN9A 4ZOHC 1DZ5A 2F77X 3JSBA 1FW6A 3AB2B 3GFKB 4BBYA 2NLWA 2FMSA 3I0RB 4YHHF 1HBOB 4CBUA 4H4KC 1DQ8A 1ITGA 4CZCA 2KD1A 9ATCB 1WG4A 4ILJA 4N8OA 3RSEB 3E66A 1E3MA 1RHMB 3CF5Q 1FXXA 1N5TA 3N4PA 4ZS6A 2WF5A 4ID5A 3A1YG 1RSCA 5CAAA 4LFAJ 1FTCA 2N4CA 3DWLA 2CJBA 1J2MA 5ETRA 2G8KA 3WKAA 3MR2A 4JI2F 4M1KA 1NKEA 1B0TA 4KO0A 1RCHA 1AZSA 1QZ6A 1UEVA 2AYBA 1IBKJ 5AQUA 2BZ2A 3M6XA 3PM9A 3G4SN 5BR8K 2LPEA 4IEIA 3H08A 4CEBA 2WC9A 3M1FA 2IAJA 1KD1O 4OYOA 2R7UA 5KGWA 3HKZF 4UB2A 4EYIB 4X2BA 5AZJA 2D5RA 2HGLA 1NGJA 1H3DA 3DDHA 2OAUA 5A2QY 4FVCA 4GXKA 1XEZA 2DNLA 4GC6A 4DV6J 5KFFA 3JYTB 1DFDA 2LCWA 4C3LA 3MGHA 2VASA 4EI2A 4NMLA 4BG8A 2YXLA 4QYZK 4CM0A 4K4IA 4Y6IA 5IWAK 3B8AX 5J0PA 1U1LA 5H9FJ 1UP1A 3VQBA 2WOMA 5F0WA 4F50A 3HHLB 1AW0A 2CPIA 3AGRA 4CGGA 1NZAA 4XH5A 2LMRA 4NJ8A 1IR0A 4UB3A 3L7UA 4QZHA 4B3RJ 2QARB 2E5IA 2COLA 4O5EA 1IV8A 5KOXA 3NE6A 1X9JA 2J76E 4PG4A 1FJEB 3OTEA 5M1NA 7ICKA 1TKXB 5K8NA 4B3OA 2CQ0A 3HVWA 1XNQK 1BQNA 2GO9A 3TARA 4Z37A 2CZ9A 4R8UA 4LF1A 3SQOP 1W0HA 3CD6N 1KDHA 4NLDA 1E6YA 1SQKA 2BVZA 5C10A 2RRBA 2KL8A 3OL6A 4IFYA 5B7WA 1K9MT 1HEKA 3C2LA 1UJ6A 3ZZRA 2MLZA 4JI8J 1U47A 4KH0B 3ULEB 3NY0A 3R8YA 4DG1B 1RT5B 2IJRA 1NB2A 2KXFA 2XMAA 4DTPA 4YB6A 3MPYA 3Q8VA 4UW9A 2KM8B 2MSTA 2PFQA 1JNZB 2BDUA 3HFKA 1ZQPA 5GTHU 1E4GT 1NKCA 3TNVA 3MEDB 3HILA 2QTWA 3NRZA 2WBNA 1PVRA 4Q0BB 3QDKA 5B0BA 3VGMA 3MMVA 1RBTA 5JTIA 2GAGC 3BF1A 1DURA 4A8EA 1SKUB 4UUXA 2PI5A 4KHQA 4JI1K 5L38A 9ICAA 3THWA 1ZH5A 3I1YA 2BA9A 5FLXU 3G82B 1D09B 3MN9A 4CIFA 3QWUA 4W5RA 4FCYA 1RTDB 2M3DA 1D9FA 3Q8SB 3PIOL 3HT3A 1N0UA 1EP4B 3PLAA 2ZIXB 2AJ1A 5L9NA 1KLMA 2RDDA 5CRXA 4UOCA 4HACB 3M9NB 1X66A 3OPKA 3R1HA 3OT9A 3UXPA 4DTSA 5E2QA 3N9UC 2EG2A 1OSDA 3RZAA 2FE9A 2JFKA 2EFOA 4DR3K 3D2EA 3QINA 5A8KB 3FSXA 4DTMA 4X62J 5THWA 2FB0A 3OR1A 4I2PB 3EMTA 2YMLA 3OW2R 4FJ8A 2A3JA 2V94A 5AM4A 1N5XA 3BQ1A 1F0MA 2BE2A 2WVFA 4ILGB 4DU7A 4TYAA 1S8OA 4Z0UA 1HYVA 1RTHA 1BNPA 1RKJA 4DL0C 1DTQB 5J2AA 2P9UA 5HLFB 3BZKA 2HQGA 2UXCF 1U8SA 1CJTB 5A0YA 2GHPA 2D7SA 3AXKA 2IM0A 5T14A 1YVFA 1M5PC 1RT4B 1P8ZA 3P5TL 4I2JA 1JLCA 3H7IA 3CP8A 4M04A 1UL3A 5DDYA 1VQKN 4N41A 2G8WA 4KAZA 3QGPA 2O8BA 3UI3A 1CEZA 4DR7K 2B5JA 4QZGA 1NJWA 1O03A 7ICIA 2XQCA 2Y1LB 4L3QA 1LWFB 2E8AA 1JLGB 1WSIA 1HQUA 1VIOA 2HQ3A 3HFVA 4RG8A 2BYCA 4H8KA 2KJ5A 1PK1A 4KI4A 2V0NA 4AHCA 4B9UA 4UARA 3H45C 2V8PA 3C28A 5ALPA 1TVRB 3T9NA 1X0FA 4C1NK 2XIDA 3ZTSA 3WC2A 5F8IA 4FJKA 1ATSA 3MMAB 3B4MA 1VQPS 3UPQA 4M2YA 3MCNA 3NAHA 5AXMA 4DR6K 2IS3A 4HI2A 5HJYA 4W5QA 2KRRA 2ZJPL 4NZ6A 4YDXA 4Z4HA 1U48A 3AHPA 4M6WB 2FDRA 1RWWB 2D0AA 2W4DA 4OHYA 3HPGA 2OKQA 5HL7Q 2A42A 3HHDA 3V7LA 3ZDDA 1KQKA 4K59A 1RHRB 1M5HA 2KICA 1NK8A 3EY1A 3JQKA 2ZGYA 5ADXA 2V2VA 1WUUA 4PWDB 4F3MA 4FVUA 2FDNA 1UEKA 3LVVA 4BR4A 1I39A 3MMCB 3Q83A 1T9XA 2P35A 1N5QA 2FC8A 2GVZA 5HP1B 5LJWA 2P9NA 2QWOA 3C3LA 3QXGA 3PFOA 3NXZA 9ICNA 1FESA 4F3OA 1YIJN 4FLZA 5KFZA 4M5IA 2YX4A 1ZD5A 5D0RA 4BC7A 3ISDA 2QG9B 3W5XA 5CH7B 1HWIA 5AFUH 4UOFA 1XMQJ 3T19A 1WSHA 3K59A 1WWVA 2DRDA 1LAWA 3C16A 2OPSB 4IQMA 2XHBA 3FBBA 2VQEJ 4F0HA 4ACOA 2ACYA 2NXJA 1YK9A 1PCAA 4ZVTB 4QPXA 5KT3A 3TTCA 4F4AA 2XMVA 2DNPA 4QZCA 1EXQA 3GPAA 3GDQA 2QWQA 4OJLA 2NCKL 3AV9A 5AI4A 9ICSA 2HVEA 3LGNA 3HX9A 2UVWA 4CLSA 2HNZA 4LT6A 2MPUA 1CZ9A 1NK4A 4ER8A 3DDNA 1HNZK 3M30B 3MM6B 4OLAA 3CCQN 2QM1A 2DRAA 1SAZA 2KTQA 2CIMA 1BQXA 4IH7A 4XDDA 3MCMA 2W1BA 2HFOA 1RBUA 3NVZA 1VK3A 3JPOA 2CDQA 1A6SA 1NDLA 1WG8A 2F9TA 3CFPA 2DHAA 2JRSA 3O8MA 1F60B 4IKAA 3B9JA 4DF4A 2DRBA 1SI9A 2OD4A 3GQCA 3NF6A 2C3UA 1S0VA 2HW3A 1AB8A 1FRXA 2Q1NA 3MMBA 1XTZA 4P2MA 3LZJA 4M3TA 1NNDA 1S1UA 1XERA 1ZOTA 3MM9B 1A0OB 1K8AT 2ZEJA 2WF6A 1U24A 4CW7B 3GZFA 3TPQA 1OH5A 4C98A 4CD1A 4KH6A 3KLIA 3DRPB 4ZPBA 1JJ4A 1VBXA 4LSNA 2AJFE 3I56S 2HFSA 2ZM6K 3IR5B 1B7FA 5ADZA 1O0PA 4PH5A 4LD0A 4CGHA 3SSSA 4JV2A 1IBMF 3AVCA 4I6MB 4N77A 1BISA 3A8JA 1FVQA 1FVSA 1CQNA 1XMBA 1Q8KA 1UCVA 1T03A 3NBPA 2OSQA 5AQRA 4M45A 4AHRA 3ONQA 4O3PA 5AQYA 3ZDBA 3D2FB 4HCBA 5KRSA 3VR1A 2ZZNA 2HCFA 2C42A 2IMOA 2FC9A 4DWIA 3QAUA 1WF1A 4TXSA 4Y1CA 4Y1DA 4YD2A 3A3PB 4JI6J 4EAHD 4WFZA 2IM2A 4M7XA 4K2JA 4M63A 3KLHB 4KRWA 2M8DB 3CERA 2V6AA 1RHUB 2QFJA 1CG2A 3TUIC 1ZRMA 2KZZA 2HBMA 1JN3A 1CLFA 3NWRA 3HPOA 1RTIB 3LP0A 3C29A 2XLIA 5IIOA 4CGIA 5F3XB 1OH7A 3AQOA 4DR2K 5EE0A 5KFTA 1J5OA 4GMJB 2LA4A 2FXUA 3U1LA 4LH5A 3N4QA 2HBKA 4J9KA 4NX9A 4A8WA 2QO3A 3AVIA 2V4JA 1YVNA 3P39A 4DCHA 4MFBA 4NYFA 4WYLA 2KIVA 2VDHA 4OD0A 1JNRB 2FMQA 5TKYA 1XNSA 2W4PA 5EX0A 4CLWA 3OTCA 5SZTA 4OYXA 3CMAN 4FJMA 2H3GX 4CE9A 4RTFD 3ET6B 3OTOK 1CJVB 2F4VF 5LJVA 4NYNA 4F2RA 3CWJA 4U96A 4FJIA 1JCFA 3NHGA 2C2OB 3I31A 4FYWB 4Y2RA 3TKAA 3KKFA 4CVNE 4DBQA 5B0EA 5CA5A 5GAHP 3D2QA 1ICEB 1WOSA 3HJVA 3W60A 1RYSA 2O8CB 4DL3A 4TU9A 1RG6A 1OJ4A 3GV5B 4CJWA 4BRDA 2KHQA 3JQJA 1F0XA 5J2KA 3BBFA 3JSRA 3VGKA 5LY3A 3TOQA 3M6KA 1HBOA 4PYDA 3FBFA 1H7XA 2RSQA 1AFIA 3O9RA 3RAQA 3A3OB 1F5CA 2DGTA 1RADB 5B09A 3Q23A 3CC7S 4EFAC 3RSEA 3LPTA 1HPZB 2K06A 4C9DA 4ISEA 2QB0B 3MN5A 2ZJQL 3SBTA 5KFCA 4KYZA 4PA1A 4KRFA 1TUGB 1DJ0A 1K1QA 1WTBA 1S5JA 3GG0A 5M1QA 2CA9A 3CJ8A 2OFGX 2BMBA 3FZ2A 3G6ES 5DQIA 1KS2A 1VQOS 1N34K 4DOCA 3W3SA 2F3NA 2C2RA 4U67L 3MX2A 3ETOA 4B3TJ 3QGHA 4BC2A 4FXDA 2OPRB 3THXB 3KYLA 1FFVA 3G8TA 1T9VA 4DQIA 2GMHA 1UFKA 4IO1A 3M1VA 4URSA 3WU2U 3R2CJ 1YF5L 3HJFA 3CCJN 3SCXA 3JYTA 2RHQB 3BKUA 2ASDA 2V52B 4CZLA 3B0XA 1UEUA 4AXIA 2GW8A 4I68A 2V7ZA 4KHNA 1VQ4N 2ILYA 3HHLA 3PY8A 3TZWA 4A2BA 2NZ4A 1Z25A 1JJ2R 4PXBA 1SS6A 1VSJA 4M63C 3N6LA 4C7YA 3ILOA 2ZDOA 1VSMA 4BR2A 9ICJA 2IGIA 4K4HA 4TURA 5J1PA 3SENA 4M5NA 1TKXA 2XMTA 1XUPO 3ZZPA 4I6AA 2X1AA 2AEFA 3HF5A 2OM6A 5AKKA 2OSRA 1F2HA 1WLJA 3I5BA 4PPXA 7ICRA 3QFWA 2FLOA 4IDKB 3EX7B 2VUGA 2GHWA 2EDUA 5CCMA 2RDJA 4H5WA 1GLEG 1NJIT 2E1EA 3HTVA 4KKOB 2AP6A 4ZJQA 4TKTA 1T95A 3LPUA 3ZSRA 5C2DA 4PXEA 1VQ9S 3LZIA 2WB1C 1T7PA 2E20A 1Z05A 4PKGA 3ULEA 4DG1A 4LC9B 4EENA 2ZHBA 2XLKA 3M6ZA 3NVYA 3ZD9A 1UZHA 5ALFA 5JU5A 2BM0A 3IC1A 2ZC3A 2MRLA 3RGIA 4DUYJ 1RAIB 2JH3A 3AOBA 1A9NB 2ZH9A 4NRTA 3OTBA 1RKIA 2BPFA 5ALIA 5I3QA 4KHPJ 3SNNA 3QU5A 4OGCA 1PBAA 3MUVP 3MWTA 3MEDA 1WHYA 2G5IB 2I8EA 3OS0A 4QQBA 2DTUA 3OYGA 5IIIA 4KMUA 4I2BA 1N36F 1QVFM 4F4KA 2H48B 1U2VA 2HBQB 2FJBB 2CQ2A 3KHRA 2D74B 4NRUA 4IO9Q 3H6EA 2PDAA 1YZ7A 2HFZA 1KBRA 3LGHA 3LDNA 3PRVA 4ZK7M 8ICMA 2PFNA 2CVIA 1VQ5S 4PGXA 3B54A 3SD7A 3RJGA 3V9UA 3EEQA 4DXLA 4DTOA 3QZ8A 1S79A 3D6HB 3CPWM 3O3GA 4AM7A 1RTDA 1SC3B 3RBDA 2JVOA 5CZXA 4DR5F 5KFAA 4L72B 1EP4A 2ZIXA 3NGKA 3L4PA 3H40A 1NUEA 1Z00A 9ICGA 3LTOA 4HACA 4FPAA 2HQIA 4OPKA 3DU5A 3S41A 2OTJN 4ELUA 4KR0B 2ILZA 2ABYA 2CPYA 3AO4A 3GFZA 3VCDA 3S7RA 4W90B 1RQLA 2VG6B 3BYPA 3ZO7A 1BPBA 5EE3A 1ZQQA 2ZKUA 4RPZA 1UPMB 3ICLA 1FJGK 4YORA 3PUFA 3NH1A 4LR7A 2WBMA 2V4RA 4WQ5A 4CO4A 4FWKA 2W3RA 1DTQA 4BREA 5HLFA 3SK3A 2BXJA 2QSWA 1KRPA 4DZ6A 2XY6A 8ICJA 2MB0B 5DDPC 3BQTA 4CHQA 2BGWA 2K4IA 1Q82O 3DGPA 4B9LA 3HHLC 5BR8J 5ALNA 2K3IA 2IC3A 5H1SQ 2YH1A 1TTHB 3QIPB 3MZIA 4JI7J 3AM9A 2GOLA 4C80A 3F2BA 3R6LB 3ULHA 4Z4IA 4E19A 1TYQB 2E5SA 4CFDA 1YI2N 1JLGA 5JVGQ 5J2QB 5AK6A 1EB0A 2JR5A 3VGTA 2GO8A 3MCOA 3KNGA 3BKFA 4CH7A 1N33K 4QYZJ 2DCLA 3JTOA 1KTVA 2XHWA 1HHQA 3T1HK 4RPXA 5KFGA 2LYAA 1OS5A 4BR0A 2E1MC 4MKVA 3MMAA 4MIBA 2H9ZA 2D3O1 4Y2YA 5SWMA 2FUG9 3O2IA 1F2GA 2OO4A 2O1PA 3E8OA 2MZJA 2E1CA 2V63A 2YX1A 3I55S 2GWJA 1JX4A 4M6WA 2ZJ5A 5AKYA 1RAAB 2BQ3A 2KM8C 4JWNA 2H5EA 5D77A 2AF6A 3GWCA 5C25B 1VQ6S 5HHHA 1LW0A 3QZ7A 4DFKA 3UXOA 3EZWA 4LREA 1FWKA 3CCTA 4ZLPA 3VF2A 1N32J 2DNOA 3V9ZA 3G8QA 4RW7A 1UA1A 3KUGA 3VMFB 2UUCK 1IBLK 2CJAA 4ECWA 1B43A 5HP1A 4KGKA 2GELA 2MSNA 2PXIA 3JAMY 4MO4A 3LANA 2Y9HA 1EWQA 3RVCA 3SV3A 9ICXA 1CULB 5HRRA 4YHHJ 3HI9A 2F7TA 2CQDA 4LJMA 5KTQA 2U1AA 3MM7B 4MMOA 4XEIA 2E44A 1ZTTA 3VF6A 4V19J 5H2FU 4GV6A 1FXDA 4DTRA 1WSFA 2FD2A 2EFGA 3C15B 1ZTWA 3TZYA 3H1QA 3TA1A 1RABB 3EXYA 3TVKA 4QZEA 3NCQA 2HGMA 3GYNA 4OHWA 2D0BA 2WF7A 5EX5A 4O3NA 1F5AA 3GL1A 3PMLA 2I38A 5FRMA 3EGWB 5BRDA 4Q8FA 1P9YA 1K73O 4DZDA 3OYMA 4DU8A 1F21A 1HKBA 2MZTA 4JKCA 4C8YA 3WKCA 7ICNA 1WG1A 5EWFA 2GUPA 2QKQA 3PW0A 1YUWA 1ZQJA 1XNQF 1ZZFA 1ZJMA 1Q1KA 4M41A 3H1VX 5K9FA 2RUSA 2MQMA 2BUPA 1ZQRA 1GMUA 1K47A 2JDJA 1KQSM 1ZQFA 3O44A 4IRKA 1HD1A 2BRLA 5AQZA 2P5VA 1B22A 3WK9A 4YN4A 3R5GA 4RQMA 1RWMB 4I2EA 2D0OA 1RAEB 4WQ5C 3KG4A 1QQOA 3WT0A 5H9EJ 4H4OB 2KJWA 5A6WA 1LKZA 1SPBP 1KXPA 1YRXA 2ZZMA 2MQ8A 2JRZA 4ZTJA 4E1MA 2UUBK 4EHUA 3KD3A 2E1YA 4NZ0A 3UDVA 4ZPDA 4JMUA 1ZQWA 4C97A 2J5AA 3MM9A 1U1RA 1JIHA 4DV0K 2BJ7A 4FZLA 2CJQA 4WCEL 1KAZA 4IZ9A 3KMQA 3CJTA 3DRPA 4LFBJ 4MF8A 3BKTA 4QZFA 4ZP7A 2UUAF 3FKBA 4I6WA 1GMWD 2VBZA 3RB3A 5M2PA 2F4FA 3WQTA 4U7UK 3BPSP 4UATA 1DBDA 4ZVHA 1T3QA 2VOOA 3AQPA 2M4MA 2DD8S 2QEXN 1LOUA 3AFGA 1MWYA 3CCEN 1FI4A 3MTJA 1QAXA 2GIRA 5LL6d 4F3QA 4CJLA 1X3MA 4B1WB 4IUFA 5FPMA 1OPZA 4IDHA 1JMSA 4XDCA 4JI1F 3D2FA 3JQMA 2APOA 3M2RB 3SBMA 1M0SA 5DBAA 3TEGA 1Z1VA 2NYIA 2QT7A 3CJ0A 3CCWA 4LF5J 4X65J 1N54B 1UVKA 2BUNA 2AJ2A 1UAXA 5GAHU 4KH1B 3THTA 4AUKA 3ISBA 4MAKA 1HBUB 1VBZA 1MROB 3QATA 4LBIA 4HTIA 2DF4B 3SEIA 3OSNA 2RF2B 3KLHA 4J91A 2G5HB 5AE2A 2ROEA 2R8KA 2BPCA 4DR3F 4Z6CA 2FJXA 4CHPA 2DNKA 3K0JA 1L7NA 3LYSA 5AI9A 1ASVA 2KJVA 3WIUA 4UZBA 2Y0SD 3GYXB 2GQQA 2PA8D 3NVVA 2HQCA 3L3VA 2CQPA 4QJVA 4X4OA 2CZ4A 2BBEA 3ALYA 4CZMA 4QWCA 3ZT3A 4M5HA 3FBCA 4G9ZA 2AD9A 3H59A 2FSKA 3DLHA 4QR1A 3O9UA 1M1GA 5FPDA 3EJMA 4RKUC 1RXWA 2IPOB 2JC0A 1KC8T 1REGX 2B0GA 1UT5A 3HD1A 4MK8A 1X6JA 1NSKL 2LU2A 1CJKA 4M95A 4Y2IA 1WOOA 2YX8A 4FS1A 3PZPA 2HQFA 3RMDA 2KXHA 1V38A 2NV3A 2YQ1A 3WNEA 2FBYA 4KPCA 1PJ6A 2LDIA 2OUGA 2QLWA 2BCRA 3TSQA 2WHOA 1HPMA 1SGGA 1NZBA 4I64A 3MXMA 2RRAA 2Y1IA 1R7IA 4HHHA 5KFLA 3BM7A 3VC8A 4CT9A 3PFEA 4M5GA 2XYHB 3ELHA 5J0TA 4C0BA 4LFCJ 2UXCJ 4CF1A 3SR6A 1IKWB 2B4PA 4M9LA 3KLFB 4QZBA 1D3WA 1UFLA 1UKUA 5DQGA 2FZCB 4CLLA 4PQUB 4US9A 2ASMA 1VQMS 1I6JA 4ILHA 3ZSZA 1OXJA 4L74A 3FFIA 2KJ9A 2E1RA 3K5LA 2ASLA 3CGIA 3GP9A 4L73A 2V50A 3KWGA 4USMA 1RM6C 1RAJA 3A5LC 4FFDA 2GBZA 8ICUA 2KIWA 3OHAA 4BRMA 1CJUB 2G0IA 2ZH2A 2LKZA 4ELTA 4IKFA 2NRVA 5KG5A 5C42B 1N5YB 5ALMA 4DV3K 3ETRA 3FJ2A 2HDOA 4OJ3A 7FDRA 1VQ8N 2W6KA 5LSRA 2J0SD 1F44A 4JV5K 3M4XA 2RHFA 4WFNL 4E0DA 4ED8A 1VBYA 4LF6K 5AICA 3KKSA 1S5ZA 2ES6A 1E6VB 1OPIA 3DC2A 4CECA 4Y2JA 4YR3A 2Y8WA 2G8HA 1C0TA 3MR5A 2YWKA 4ENOA 4HH1A 4OFZA 2W41A 2OHDA 1KEKA 4U7UD 3B6BA 3V4MA 2UXDK 2Y3YA 3IAS9 1C4CA 2YWFA 3BS9A 3J7YI 3BPDA 2MKJA 5DLFA 1BCOA 2LLZA 5E3CA 2OIHA 2P8IA 4CLFA 3MOZA 4C2MA 5M1PA 4FLTA 3QBWA 2P6RA 2V9WA 2LVWA 3PX6A 3QYPA 3DDIA 3H5UA 2LM4A 4UQTA 4OHZA 1HNZF 3EZUA 3M6WA 2CJKA 2UZAA 4FK4A 4F02A 3WNHA 4FJ5A 4DN9A 1U7LA 4RU2A 3AA2A 3CM5A 4ETXA 3PSTA 3PKYA 4C23A 3L09A 3NS5A 4IDKA 3R2DJ 3LDOA 2G0CA 3NVMA 3PJXA 1OQ3A 5AI6A 4KKOA 1GOAA 1S6QB 2GQ2A 4USJC 4K41A 3ZTPA 4HDGA 4ZVSB 4J9RA 5K14B 4NXMK 5LM7E 3KDNA 4CEZA 3NH0A 2FVQA 5JLFA 3VQTA 4Z7CA 3MFIA 5BPMA 1YJWS 3T5HA 5DM6L 1KVCA 5E3RA 1URRA 2RT3A 4Z2XA 5K20B 3RBZA 4EZ9A 3HLUA 1XI1A 5LXRA 2X51A 2N3OA 3TANA 4CJSA 3MUMP 4CHOA 3AOCA 5ADXH 2IJNA 3ETMA 3SUQA 4TQSA 2WF9A 2CXYA 1LCUA 3UKUB 1XJWB 3CXCR 5KG2A 1S1VA 1NHVA 2P66A 1JLQB 2KHCA 2OHFA 2M2BA 1YJ9N 1HW8A 3KIOA 4CDGA 3V4IB 4CO3A 3LAMA 3H0PA 3Q8UA 4NYZA 5JS1A 4NM1A 1F5SA 4ALZA 1EHWA 1GAOA 5IQ6A 3D2WA 4C8KA 2KSOB 4NEYA 2R8IA 4YMEA 1BI4B 3Q8QB 4OX9F 4DN0A 3PVXA 3DXSX 1YWXA 4PPZA 4A47A 1REVB 4F5PA 3H3NO 4ZVQB 1IIPA 3TA2A 3QFPA 4DV5K 3DEEA 3HM8A 2PBDA 4USVA 4KX5A 4IJNA 2BOAA 4LSLB 3CJ4A 3MR7A 1RBAA 4BR7A 1WDDA 4NLVA 2EEYA 2YQ0A 4NYPA 1MN8A 4DJBA 5GAEP 3X1LB 3EGNA 1U6FA 2DNRA 1XMOK 3ENAA 2X7IA 3W66A 2HBYB 4IQTA 9ICTA 5HO4A 4NZ7A 5D0HA 3BSNA 4GY2B 2AQ0A 3MEGB 2DB1A 5ETOA 1Y00A 3UNGC 2DTJA 2ASPA 5AQHA 2CUYA 4BRAA 3B8HA 4JN4A 4DEZA 4A8FA 3QRPA 2FY1A 3TSPA 2WFAA 3SEOA 2H65B 1V9PA 4KMOB 2QE5A 1KQQA 3P6YC 5AKLA 4I9LA 3H90A 3NGDA 3A8KA 2QFIA 1URJA 2BW2A 5FPNA 1QVGR 4F72A 3B6PA 5KAFU 3P5BP 4J7CA 2E1PA 3UB5A 5C5JA 3LM2A 4RQ5A 4CJKA 3BGFA 3OTOF 4P6QA 3HMJG 1FEZA 4JS4A 2A6OA 2W2QP 2NREA 5ALVA 3QEAZ 4E3SA 2K60A 4DU3A 3R6GB 4K43A 1IBCB 4NMXA 4FYXB 1U0HB 3IRUA 4JLHA 2NS1B 1IKXB 2J9CA 1Q8BA 2EI5A 3M8QB 3U4LA 2D4WA 1IR2A 5AQNA 2DGSA 3R1XA 3W61A 1S3XA 2HRYA 2XO6A 4CNZA 2RD5C 5FJ4A 2CQGA 3V72A 4MHVA 1HNWK 1XR6A 2IVFB 2E9ZA 4JI3K 4OX7A 3A5OC 5AKEA 4H4MB 5KT2A 1EX8A 4DR4K 1XNRK 5B0GA 2Q1LA 4OYZA 3K2YA 2A0FB 5C25A 2UV8A 3LA0A 1QQMA 2F8SA 1VQLN 4HDHA 1ZBTA 3MGIA 1FD2A 3M8SA 3TAGA 1HHSA 3CULA 2R42A 1MG7A 4I69A 3V5RA 3H4DA 1QQ5A 2P6UA 1EQ0A 4YB7A 4O0JA 1XR7A 1RDRA 1CLQA 1NU4A 2RRDA 4DCPB 5HMZA 5LMNK 2VA2A 4FW2A 1RWXB 4BRFA 5DRKA 1TFRA 2P9PA 4O8UA 3CCVN 2WB4A 4IL6U 3MBYA 3OR2B 3I8DA 2QLXA 2HF4A 3WQUA 3QQCD 4EX7A 2YNHB 1Q7YO 3JAMO 3C15A 3IAM9 1R8BA 2DKXA 4H0VB 3DI6B 3WEEB 1WI6A 4QIFA 1O51A 4N8NA 3NASA 2LQ5A 2EVZA 9ICMA 4JKEA 1KNZA 4FPIA 3H3OB 2F8MA 5A8RA 2DHHA 2QL7B 3DV9A 1GQEA 1B0PA 2H3QA 1QQCA 1R0CB 4DOZA 4B1ZA 2E6MA 2CG4A 3OYAA 2VQFJ 2ZBIA 1TKTB 4BRIA 8ICEA 2ZH1A 2EKNA 1NGEA 2MDAA 1BNOA 4GMKA 4URGA 3AA8A 4H4OA 5KFXA 1OSCA 1JXLA 4LF9K 1RQNA 1R8HA 8ICLA 3RU0A 2HBJA 2XNQA 1IJFB 4ED1A 8ICGA 5HR7A 4MEXA 1HMVB 3GSDA 1KD1T 1AFJA 1XS9D 4B9QA 5ALWA 4OJ6A 2E8PA 3NOCA 3GIRA 3RRKA 3KOOA 1P8GA 2BTFA 1WSJA 2P9SB 1MW7A 1C0GA 1V4TA 8ICZA 1W2IA 3GU0A 1FKOB 4O3RA 1WB9A 1UWBB 2HSZA 1HNXK 3NCRA 1TVAA 3ONNA 4R63A 3VGSA 2MZQA 2MQOA 1NK0A 2B51A 2GMLA 2VFVA 3EVMA 3T1YJ 4K7QA 3JSYA 4AL5A 2XRIA 1X5OA 3OS1A 2A2CA 3F41A 2MUTA 4DSEA 3NL0A 4LRBA 4DHVA 5KL8B 3CETA 2Q0ZX 1N52B 4K4SA 3FZKA 2QA4S 1N2XA 4NWIA 3C1YA 5IV3A 5GMEA 2W40A 3FFKB 4WE1B 1PO6A 1FIQA 4OJPA 5L1MA 5G0RB 4PG6A 4UAUA 4KHYA 4U9RA 5HL7L 1ATNA 2LFVA 1N33J 1O8BA 1WSVA 2ZNYA 2MGZB 1CRXA 2AXTU 2DK2A 2ZZTA 1I94K 1VC6A 2EFNA 1TUYA 3DYAA 4QWAA 1MROA 4HEA9 4BR5A 1LWXA 5ALUA 4NXNF 1N36J 3LWLA 2K4EA 1RGIA 3VQAA 4FK0A 4U7CA 3MDCA 3H8JA 4Q2MA 4PQAA 5KT5A 3FZLA 1Y5LB 2KW4A 3C6TB 4HTJA 1HI8A 4DUZJ 1WTFA 3U8XA 4JP8A 1R8CA 3M8WA 3R7SB 1RDCA 2G8FA 4K0KK 3GFHA 1NJXA 3AH6A 2ASOA 2VODA 4V19X 1V85A 4M0AA 1KBUA 1CBKA 2KU7A 4OHXA 5AXKA 3CJ3A 2AGQA 4RBVA 3MF5A 4TU7A 4DB3A 1CXUA 2GTDA 2YPZA 1X9XA 5KPRA 1S5LU 4ZN3A 2HVIA 4LF8F 1IBLJ 2W6LA 4Q7AA 1PYOB 3PDNA 1TAUA 4M5LA 2LEBA 3H25A 2P9LB 1J5EK 1WF0A 3J7ZO 1HW9A 3S3NA 5A76A 5F41A 3C66A 2CH5A 1VCTA 1JXBA 5E41A 5ALOA 2MMYA 3L2VA 4JB3A 4OJGA 1GK8A 2XLJA 4LH4A 1WSRA 2H4YB 4H54A 4ZJLA 4H03B 4OO1J 3C5GA 3BQ7A 1DAXA 1HNVB 2YVSA 3JS9A 4X4NA 1L5UA 2A40A 2PIIA 7ICSA 4KT0C 3LO3A 3T1HF 3LGMA 2CAJA 4B3MK 4FJGA 3F2CA 1IKWA 4UOHA 1GLAG 4DO9A 4RW8B 4I27A 1RJJA 3I4HX 2EZXA 4PQUA 2BR0A 3D67A 2VZ9A 2ZXIA 3D0IE 3EUNA 1K8KB 3SMSA 3SSRA 3TJAA 1UJ4A 2NSCA 1JALA 4MTPA 3SUPA 2ZWPA 1HQ2A 3QSYB 1UA0A 2IRXA 2W9BB 1H72C 2MZSA 5JLHA 2BCVA 4CGDA 1CJUA 2HNDB 1H6KX 5AQVA 4P4MA 2QX0A 6FD1A 1UPPA 1KVBA 4JRPA 5HATA 2W3SA 2DH9A 3CCMS 5C42A 3T79A 5DLGA 2NQPA 3MEKA 5KOWA 2MU2A 5J0XA 2HOIA 4KN7A 3VWSA 4P75A 3LM9A 4LFAK 1VLOA 3CDUA 2OXOA 1RT1B 1SVDA 2FHJD 1S10A 4OI1A 3L5KA 8ICSA 4QR0A 4DL6A 1VRUB 3ZSYA 1E6VA 1KFTA 1IBKK 3OFGA 1CSJA 5CY4A 3DHXA 2YB4A 3WXIA 5J2EA 1NHKL 1LNQA 2N82B 1WSEA 5IFMA 1L7MA 2LQJA 1MWZA 4LF4J 1CZAN 1XQIA 5HVGA 3O3FA 2HK2A 4M5KA 5IOLA 2FBXA 4FPRA 2O6KA 1HUOA 3W8PA 1UT8A 3GR0A 3CNHA 3HOSA 5ETSA 2CQIA 1E4FT 2IDEA 2JLFA 4RNMA 2RS2A 4LF7F 4DV6K 3R27A 3TQEA 3NNHA 4GW6A 4GXJA 4YMNA 2G0JA 4KJIA 1FRKA 5DG9A 1GLCG 5H9FK 2C3PA 3SMZA 4YCXA 4Q8EA 4DR1F 1X6IA 3SI6A 2V68A 4B3RK 1WG5A 3VVTA 3SYZA 4CF5A 1S6QA 4U67Q 3MM5B 2IVYA 2ZIVB 2LKYA 3NNCA 1N60A 3CC4N 3L4IA 5E7OB 4MKYA 2YWHA 4WK3A 3DJCA 2FJDB 4JB8B 4N47A 3UPFA 2VL1A 5GAEU 5EWEA 5F3ZA 3IFRA 1KTQA 1Y3JA 2UUBF 4CJPA 4IQVA 2G8IA 3Q8RB 5DZ6A 2HZAA 1PZNA 4FE3A 3UDLA 3P3DA 1HR0K 3KZIU 1ROFA 4RW9B 1XSNA 3KLVA 2QWMA 4JI8K 5AQPA 1SV5B 3PR4A 3AVGA 2IM3A 7ICTA 4I4BA 3UKUA 3J7AN 3AQFA 3FZFA 3BBCA 1JLQA 1Z2LA 1Q5VA 2WRMA 2YKNB 4OLOA 3O80A 3MPUB 2VPZB 1ECWA 2F5GA 3HYFA 4YB5A 3MURP 2D3ZA 2C1EB 1YSJA 1RBLA 4ISFA 2ZTCA 2G0AA 5AFUA 1WKJA 1NPRA 2B6AB 1S77D 2GJ2A 3WXKA 4K42A 4C7ZA 4EFHA 2KSOA 5GTIU 1BI4A 2HVDA 2HMXA 4NLQA 2CNKB 2XY8A 4OVLA 1JKHA 3UR0A 2XS5A 1FFGB 1REVA 3G4SS 4FS2A 2PMHA 5BRHA 1UMJA 4JYAF 2UUAJ 3RAMA 5J0YA 4MK9A 2NRZA 1RDBA 3EN9A 3H0RB 1Q9YA 4CLYA 5HNKA 5J29A 4Q45A 2PEHA 3WXLA 1Q7LB 4ZVUB 1DRGA 2YWEA 5TKWA 3RB4A 3HW8A 1VI7A 3MI7X 2UUTA 1ZBSA 5HRNA 2RVJA 1YAGA 4BVOA 4Y28C 2EQYA 3OXLA 5JVHQ 2E7WA 4ECRA 1XR5A 3J7YU 2UVUA 4V19S 3I8BA 5K5MA 1UFWA 3QT8A 2DGVA 4FM0A 2ERRA 1EXNA 2AJ4A 1ZBHA 3ZETA 5M1KA 1BWVA 2ZD1B 3JTNA 3GTYX 4JI0F 5HMMA 2OD6A 2XSJB 3A4TA 2ACMA 2PE8A 3T6BA 3KK3A 1XK8A 5GAGP 3K9KA 1MMLA 4X62K 1ZBUA 2KJ8A 2BH1A 3O4NA 4E2FB 4KAIA 2GC8A 4I7FB 3J80O 1MQ2A 5E3PA 1IQZA 2F1IA 3RF9A 3CD6S 1LWCB 2X1BA 3ZTOA 1LXJA 3ADAC 4WTOB 4PGYA 1JWWA 2N7YA 1LFPA 1H73A 4J9QA 4KLIA 4C0ZA 1TUUA 3BJYA 1SUQB 3N0VA 3D7SB 1AZSB 3P1GA 4X4VA 2ZQBA 1S49A 4OPJA 4TVAB 5K4LA 1UVNA 1MMDA 1U02A 3JTPA 5D49A 1ZQIA 2BANA 2IAJB 2R8JA 3DLBA 4CHNA 1PG5B 1IKXA 1IM6A 1C2PA 3BS5A 3AEVA 2XCPA 3M8QA 5GADI 1LV5A 2HG4A 3K9JA 3EVWA 1RWKB 2RUGA 3GG4A 5ITHA 2YWGA 4DS4A 2EFVA 2WB1F 3OUYB 4KLUA 3AJ2A 1M5SA 2CADA 2LXUA 1FJCA 4WP9A 2RHKA 4PHEA 2EW9A 2YMMA 2VDIA 1LK7A 1SWWA 5KG4A 3IDWA 5LJ3Y 3M6VA 2ZH7A 2M8HA 9ICBA 4NLPA 1Y7PA 5BREA 2O8EB 5DDRC 2V2KA 2I7NA 3MDQA 4I2DA 2K8BB 3Q22A 1QUVA 5J2PB 3LP3A 4IO9L 2A1AA 2W9MA 2J8SA 3RW7A 3RBXA 7ICHA 3H2VE 2KHOA 1G7CB 4EBDA 3T5KA 4DV3F 3W62A 5AK3A 1NBWA 1M90O 3H20A 3OFHA 3UN2A 2R8HA 5DS7A 4RL1A 5HQLA 3NUQA 2F8HA 1TFYA 4FOEA 4OX6A 4LF6F 4M5JA 1KAYA 1QSYA 3TTDA 1YBUA 1NK7A 1QM9A 2DY4A 2D3DA 1RAGB 3GSIA 4G65A 4CTAA 5G5HA 2QMXA 1SC4B 2DPIA 2POKA 3LAKA 2DCUB 1TK0A 3WEEA 2R2SA 3WDOA 4ECSA 2KT5A 4U8VA 5HOOA 1TZ0A 3E58A 1Y97A 4OLBA 2NO5A 4J2DA 1IM4A 3A3NB 3AU2A 2KRBA 5ALTA 3H4BA 5J1EB 3JAMU 1XMQK 4O44B 4URQU 4B3SJ 5J2FA 2EXUA 3FMBA 3IBWA 2VQEK 5CZ1A 5A6PA 2ATCB 4CLZA 5F8HA 4BACA 1TKTA 2L48A 2QMUB 3PG9A 2J0WA 4HUEA 3NG8A 2D1KA 2OEKA 4UAYA 3RMBA 2EHGA 4GVMA 1K9MO 3M3ZA 1VQKS 3BS7A 5A8WB 4OZ5A 1CXQA 4PL7A 3CCLN 5EGYA 4PR6A 4USTA 5D78A 3HT0A 2YN4A 4KHRA 3CG7A 4NXMF 1V5VA 1YDLA 4C3KA 3WX8A 2CWXA 4S0MA 3SMVA 2AWZA 1HMVA 1BQMA 1EZZB 1UWAA 1FX2A 3RB0A 3R8EA 1AYEA 4WZMA 2WTFA 5JVGL 1HL6A 3C2MA 3R7BB 3AAQA 2QA1A 2I6XA 5CABA 2EK6A 3QUCA 4A2AA 4QZDA 2KN4A 4DPUA 3UQSA 1FKOA 2YY6A 3NGSA 2QC3A 1RHKB 2VOPA 2H3FA 1UZDA 3OYIA 5EU7A 3OR1B 4FN5A 2BEFA 4J9OA 5ETVA 2P9IB 4YUDA 3L2RA 2Z30B 1ZC6A 2JXJA 3N7PD 2DPJA 4FLUA 5JS2A 2G1HA 4DQRA 2BE2B 4CRJA 4XH1A 1RTHB 2VWBA 3PYGA 1Q8IA 3BYRA 2GJFA 3FEYB 1HYSA 2P9UB 3QT6A 2ZTDA 1ZPVA 3NGZA 4Y2TA 4WE1A 2MQQA 4X64K 4LRAA 2GAHC 5G0RA 4YOTA 4PL2A 1JLCB 4DQQA 3EE3A 3W9HA 1X5SA 1FK9B 5C7PA 2QYGA 4IH5A 2MGZA 3IBCB 4MLEA 1ZQAA 2LU1A 3QE9Y 3ILJA 2B5JB 1QZ5A 4X84A 4JOUA 4KTWA 4DV5F 1ZQSA 4NYOA 5AQJA 1NNLA 1YIJS 1NHUA 3C65A 1W26A 3W2WB 2RQCA 2YNIA 4CH1A 2P51A 1ASWA 4DTJA 1PK1B 1BPXA 2V8DA 2FBTA 4DDFA 3C6TA 4Y2KA 3N6NA 3W5ZA 2UU9F 1HNWJ 4H0TB 5GMDA 3HDSA 3N4WA 4V1Ak 1YHQN 2QK9A 4JI6K 1VQ7N 4Z7YA 3TA0A 1VR6A 5HROA 3F5EA 1SZHA 2Q43A 2VBWA 4OX9J 2XI9A 3V2UC 3PSPA 4XH4A 2XMMA 4RUBA 5J0QA 3ZX3A 3VGVA 1FDDA 2XCAA 3R9KA 4RNFA 2O66A 2LEAA 2W55A 3CCQS 1WJ9A 4PCQA 5BPNA 2RU9A 4KLHA 3CCSN 4DQ8A 2YQEA 4KLQA 2AZ3A 4M94A 3TQ1A 3QJJA 2V8HA 5IT9Y 2IVOA 1KVKA 3G96A 3KHYA 5AI0A 2CPDA 1W7AA 4JKFA 2BCUA 1J27A 1XHXA 1T8EA 3I28A 5KG1A 3DM2B 1VQSA 1SJRA 3VEOA 2B9EA 4LQ3A 2P9GA 3MD3A 3M9OB 4OI2A 1HD0A 1IXKA 2XM3A 2GVZB 2ADBA 3D1QA 1B9FA 1A6LA 4J37A 1R8AA 5GMKa 1CI4A 1I1GA 2VKQA 3CW2C 2A3ZA 2KHVA 3L6QA 2RHSB 1X3NA 5IZHA 4F4YA 1GOBA 3S01A 4RW8A 2VPXB 3VETA 2A3VA 3O8WA 1KFDA 5HMLA 2XB2D 1U4BA 1P90A 4OV1A 5BYSA 2Z2LA 1WOQA 3E9LA 3RMCA 1IWGA 1YG0A 4JI3F 2KFZA 2MQNA 5LMUJ 2ZJRQ 4EO6A 3BBBA 2I1QA 2HWTA 2W9BA 1RWOB 4DR4F 1XNRF 2V51B 1NKBA 2W25A 1NLVA 3MC1A 3UD5A 5D4PA 4US8A 1IR1A 4NY8A 1T4GA 4ZPVR 3Q8MA 3SAFA 4GC7A 2HNZB 4PY5A 1Q82T 4J9UE 2VHGA 3UCUP 1A76A 4GVBB 3KLGB 4JAXA 4ICAA 1KLNA 2X6NA 5DZ7A 3QEXA 2MY7A 1NGHA 2HLUA 4K4UA 4BDZA 5JUMA 5LMNF 2VFSA 1OQ6A 3GONA 3HVAA 3EUB2 1ZBFA 5FIIA 5DDOC 1VRUA 5J2GA 4DL4A