2HW3A

T:o6-methyl-guanine pair in the polymerase postinsertion site (-1 basepair position)
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*T)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 207
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hw3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hw3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hw3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hw3A01
4BE1A 5KFQA 4JS4A 2DTUA 5DGAA 3L2VA 1X9MA 4DEZA 9ICRA 4OKJA 3SUNA 2I1QA 4DOCA 1S0MA 4KLMA 1BISA 4G3IA 1Z00A 5HLFA 1XHZA 8ICFA 2VA2A 1EXQA 8ICPA 1VSKA 4J9LA 1WN7A 4LH4A 4EBEA 1GOAA 1IH7A 4I7FA 1S0OA 3SCXA 1XSNA 1RTIA 2ZUCA 3LP3A 3FYHA 3QEWA 3DRRA 2W9CB 1Y88A 2BCVA 2MUTB 3C21A 3TFSA 1NK6A 1GOCA 4GC7A 3NGZA 1L3TA 2M9NA 2OPQA 3VQBA 3M9NB 2B6AA 1SL2A 1D9FA 1MQ2A 2H5XA 3Q8RB 4M9GA 2XHBA 4J2EA 4QW9A 1N56A 5CZ1A 3NTUA 1ASUA 5KG4A 1BL3A 5J2IA 3B6PA 3WNGA 3C5GA 3CM6A 4DTUA 1TL3A 9ICWA 3NE6A 5HHIA 2W9AA 5DMRA 4KHNA 5J0XA 4DSFA 2AU0A 3RJIA 1ZQHA 3I0RA 4XQ8A 4EYHB 5EOZA 3PX4A 2AQ4A 1DTQA 3Q8SB 4M9LA 1WSFA 4HCCA 2LSNA 5J2QA 3PO5A 1LAVA 3L2QA 5J2KA 3QEVA 4EBCA 1IKYA 2VWJA 3HVRA 4RUAA 3NF7A 1T3NA 3PY8A 4F5OA 2FC0A 4CJFA 3G6XA 2F1JA 1S6QA 1TL1A 3AU6A 3WNFA 4W5NA 4YXMA 4AHVA 1ZQRA 4FJMA 4ELUA 2XO7A 2YKMA 2YNFA 2IA6A 1F21A 3U3GA 3C94A 3LZIA 1ZQSA 2QXFA 2G8KA 1VSEA 4AHCA 4CK3A 3OSNA 1W0HA 2P5OA 8ICRA 4PY5A 3ZCMA 1KVCA 3C6UA 1RDAA 2XY7A 4Z4HA 3RR7A 1UWBA 3MABA 4E7IA 4F93B 4I2QA 5IIKA 4YMMA 4FK0A 1A76A 4PWDA 4YG2A 4IRKA 1XSPA 3H4BA 3RJFA 4J2BA 2WTFA 9ICFA 5HNKA 3AVCA 4RU9A 4FBUA 1RT6A 3ZSWA 2G8UA 2YHBA 3HJFA 1SUQA 4CEAA 5DG7A 3NBPA 4YR0A 1CUKA 1L3SA 4KLLA 1CZ9A 2HHQA 1C1BA 2OZMA 1V9PA 4GC6A 2AGOA 3VQQA 5CZ2A 4O5BA 1HMVA 3VQAA 9ICXA 1BQMA 3RH6A 3K59A 3NGIA 2E4LA 4KLEA 2JEGA 4CEBA 3VQCA 2XY5A 7ICHA 4FM1A 1RILA 1U9LA 3L2RA 2BCSA 4Y1DA 3K5LA 3SV4A 4CGIA 1DOQA 4E89A 5DK5A 3CFRA 4B9NA 4CJKA 3IHQB 4F4YA 1T05A 2D0BA 1JKHA 4O5CA 5CP2A 4J9SA 4CFBA 4ZHRA 4Y1CA 2VWKA 3UXOA 3P1GA 1NKBA 1RBSA 4MFFA 4ECZA 3UXNA 3OYIA 4FZXC 4OGEA 4BE2A 8ICKA 4JK1A 2X74A 3AO5A 1VSFA 4M42A 2BGWA 2C2EA 4M3TA 4ED2A 2OWOA 4FJLA 4OLBA 3L2WA 3ZD9A 3GIIA 1CXUA 4Z6EA 3F9KA 3UQ2A 4M3RA 4KLOA 3ZDEA 3HW8A 3HX0A 1AROP 4M3ZA 3M9MB 3TAMA 8ICXA 1QSLA 3V9WA 2R8GA 3LPTA 4NLKA 3S3OA 4FLUA 2FLNA 4KHYA 4OLAA 1JLQA 5DGBA 1B92A 3M8SA 4AHUA 4CK1A 3D0PA 3TI0A 1NJYA 4CJ3A 3QO9A 2ZTCA 3CM5A 1W9HA 4O3NA 3H08A 3RJGA 5F9NA 4KI6A 3MXIA 3DLRA 2FBVA 8ICVA 4CF0A 5J0OA 4RQ6A 3OS0A 3LP0A 4KRFA 1CLQA 3D45A 3KLGA 4UBCA 3ZSOA 4I2FA 4M6WA 1TVRA 4FVMA 4KHWA 5FRMA 4OJRA 4CF9A 2ZUDA 4ECRA 4FJKA 4DL7A 1VSIA 4I29A 9ICOA 4MFAA 4RZRA 1TK8A 2WOMA 4QZDA 3ISBA 4FLZA 2XGPA 1LV5A 4J9PA 4MF2A 4QWAA 5F9LA 1C7YA 3SYZA 1TVAA 4DL2A 5DB6A 5CWRA 3I0SA 4CF1A 5HP4A 3P83D 3G10A 9ICGA 4CESA 3V9UA 3T5HA 7ICEA 1ZQNA 3SZ2A 4PGQA 4PGXA 3DRSA 8ICHA 1A77A 2KTQA 4IQTA 4DMNA 1X1PA 1HNIA 3VA0A 2ZJ5A 3SUPA 3SI8A 4CJWA 3IG1A 3LAMA 1BI4A 2DFHA 1ZQAA 3GIMA 3S9HA 1EKEA 3MXJA 3QIOA 4E7HA 4QAGA 4KFBA 4CJPA 4O9MA 3HM9A 5KFCA 4KN7A 1U47A 3TAQA 5HROA 4F5NA 2UVUA 1RBRA 4Z6DA 4BDZA 2AGQA 5KTQA 1RNHA 4ZTJA 3LK9A 4C8OA 3ITHA 4GXIA 2ASLA 4N56A 3Q8PB 1ZQCA 4CEFA 4CJVA 1RT4A 5J2JA 3H8JA 1ITGA 1YTAA 4CGGA 4BE0A 1L3VA 3NDKA 4GXKA 5IINA 2HHSA 4FLYA 1B9FA 4YFUA 2DFLA 5KFYA 4DTMA 4QWDA 4E7LA 4HUEA 4DTPA 4PUOA 1C1AA 3QESA 2JEJA 4OKKA 4JUZA 5C24A 5KFAA 1ZQKA 2QKKA 4KI4A 4DF4A 2A1SA 1XSLA 1ZQYA 3NH2A 2W8KA 4YMOA 2OPSA 1CEZA 4FLTA 3ALYA 3Q8QB 4F91B 1ZQPA 2KZ3A 2HW3A 3TR8A 1D8LA 3S3NA 4DF8A 2KZZA 3KK1A 4J9QA 5L1JA 2UVRA 9ICLA 5KT4A 3UQ0A 5DG9A 5KG6A 1HUZA 7ICMA 1ZQLA 3RH5A 3MEGA 3PW4A 3QNOA 5KG3A 5J0TA 5J2EA 3KLHA 4P4MA 3ISDA 5EWEA 3RRHA 4DQQA 7ICQA 1VSJA 4CGJA 4QZBA 4O3SA 4FJNA 3C6TA 2ALZA 4K4HA 4DSKA 4BDPA 3SJJA 1U04A 4YVZA 1S1WA 3EY1A 3GIKA 4C8LA 4ECUA 5KG1A 4KKOA 5FDLA 4HHTA 3V6HA 5DKWA 2PYLA 4LD0A 1ZQZA 3S3MA 3QZ7A 1JX4A 3PX0A 3RRGA 4JRQA 1N48A 1ZQTA 4AHSA 8ICLA 3VA3A 1YTUA 4PQUA 2EX3A 5KT6A 9ICQA 1J53A 1KVBA 1KEJA 1RT7A 4E7KA 4FZYA 3MDCA 3WNEA 3JPQA 5KGXA 2RDJA 4MFCA 1LB2B 2HHUA 4NY8A 4UQGA 4I2CA 2KZMA 3NAEA 2HHXA 1UA1A 3TANA 3C2LA 4FJ7A 4PA1A 4KLDA 3KK3A 4BWJA 1KCFA 5CY4A 1WSEA 3NHGA 5KT2A 7ICTA 4LH5A 1EXNA 3V1QA 4ECXA 2B21A 2Z1HA 2KW4A 3IM1A 2RN2A 1NJZA 4HUGA 5J0RA 1S9EA 4RW6A 2W9CA 3MFHA 4CJQA 3RMBA 2MUTA 3GILA 5DDYA 3T3FA 2ASJA 4O3OA 1N6QA 3QEPA 3SQ4A 4F50A 4RW4A 2XRIA 4HTUA 3MEDA 4M9HA 3V72A 3GV8B 3GFKB 3L3VA 3GIJA 3QETA 4YXJA 2Z1GA 1TKTA 4HYKA 4B9LA 4NLNA 3KLFA 1S97A 1TKDA 4EP5A 4DTOA 4RQ8A 3MR6A 1IM4A 4YP3A 1H38A 2IHMA 1COOA 4O3PA 5BOLA 1TAQA 3QINA 1Z3EB 3LALA 3MECA 3ISNC 3B6OA 4CF2A 5CR0A 2MAXA 2GV9A 5HMLA 4IDKA 5J1EA 4QZ9A 4FK4A 1RBUA 3AA5X 3OS1A 3RBEA 4ED0A 1I39A 3PW2A 4DSJA 4CEDA 4O3RA 8ICNA 9ICUA 1CXQA 5CA7A 2F1HA 2BCRA 1TKZA 3AO1A 3MR2A 3DI6A 5J0SA 4G1QA 2X6SA 2DFFA 8ICBA 4DL5A 4CHPA 3NFAA 3T19A 4QZEA 2AQ0A 2XY6A 3M8QA 4F2SA 4CECA 3O4NA 5J2DA 5CYMA 1NOZA 2HB5A 4B9VA 3QERA 2OA8A 3AVKA 1PZNA 1JLGA 4LZGA 3AU2A 1MC8A 3UXPA 5DG8A 1FKPA 3VQ4A 3LP1A 3JPSA 1WSGA 4W5QA 2UVWA 3MBYA 4DL3A 3AVBA 2PFOA 4KTWA 4KLJA 4UAZA 4B3OA 1C0UA 3N4MB 2NRWA 2ZJAA 4ICLA 3HK2A 4OGCA 4XIUA 4R64A 1BVSA 3TWHA 1Q9XA 7ICUA 3ASMA 2ATQA 2FMPA 4FW2A 3C5FA 4Z4FA 3DLHA 3ETLA 2ITGA 1NOYA 5EWFA 3LAKA 3GDXA 5KG0A 2RF2A 2AJQA 2VA8A 2GWSA 4E19A 5KFBA 1T7PA 3F73A 4M45A 4NLZA 1HNVA 4ECWA 4ECYA 4MFBA 1ZQWA 3V6KA 4RUCA 1C0TA 1JXEA 7ICOA 3H7IA 3K4GA 4F4XA 3GV5B 4RG8A 4FO6A 3QZ8A 2C28A 7ICIA 9ICNA 2E6MA 3EYZA 1O1WA 1QLNA 3OYMA 2GUIA 4KLSA 1C1CA 4Z4CA 5CJ7A 1S9FA 5HRNA 3HXMA 4OVLA 4IR1A 9ICKA 1ZBHA 3JPPA 3EPGA 1S1VA 8ICJA 3OJSA 4CHQA 3QEAZ 1ZBFA 2G8WA 1RCHA 5T7BA 3SPZA 1LAWA 4FJXA 2KN7A 2NRXA 2NRVA 3RH4A 4DL6A 4X5VA 3C1YA 1JN3A 3HYFA 4IQUA 5SZTA 4P4PA 2P1JA 5DQIA 1WSJA 3Q8KA 8ICUA 1IKWA 3UPQA 1MSWD 1FK9A 5DQGA 3BQTA 1YVUA 3RMCA 4IR9A 1TFRA 4Z6FA 4DG1A 3K5NA 3ZSZA 2OPPA 2C2DA 5DB7A 3KD1E 3PW5A 2NRZA 3U3YA 2D5RA 3MEEA 3B0XA 3PO4A 7ICPA 5J0YA 2BCUA 4IRDA 4Z6CA 3O3FA 4R65A 1U4BA 4RT3A 4B9SA 1KLMA 1X9WA 2F96A 4YNQA 1TV6A 3SPYA 4JWNA 4OPJA 3K57A 4M3UA 1RT2A 3AA2A 3M8PA 4KO0A 4BGDA 4IG3A 3HPHA 3QEIA 3DM2A 1RTDA 1X9SA 2R8HA 3KLEA 4NM2A 1Z25A 3ZDCA 2G8FA 5J0PA 5EU7A 4UB3A 3KLIA 4DSLA 4EBDA 4CJEA 1A5XA 2ZTDA 3V7KA 3DLGA 5KFRA 3C1ZA 4ED8A 3JPRA 1TV9A 4KLHA 3VQ7A 5CB1A 3MFIA 2BPGA 4CHNA 4O5EA 1S10A 4JLHA 1GOBA 4FM0A 1D9DA 4C8MA 4YD1A 5C25A 1IO2A 4RW7A 7ICNA 2YNGA 1R0AA 1DLOA 2E6LA 3I8DA 3SNNA 2BANA 4N47A 3LWMA 4K8XA 4I2PA 1KFDA 1B22A 3AO4A 2F1IA 2G8VA 1BCOA 3V4IA 4J9MA 3TARA 4Z4EA 4KITB 3MAQA 3BQ2A 5KFDA 1HQUA 4AH9A 2HNZA 3RB0A 3VQ9A 2BR0A 4K4IA 4KHSA 3KKRA 2PI5A 1S77D 1QTMA 4F92B 4NCGA 1KFSA 2PI4A 8ICYA 2Q3SA 2YNIA 2IDOA 2UVVA 3N97B 5HBMA 4H4OA 7ICVA 9ICBA 4KTZA 4E7JA 3AA3A 3K5OA 1VSMA 3RTVA 1JLEA 3NGDA 2C2RA 3L3UA 4R66A 4ID5A 4J9KA 2JZBB 4CFCA 4R5PA 4JS5A 3V7JA 4DSEA 5CHGA 3KIOA 4I2AA 5C5JA 1U48A 4F3OA 5DB9A 4B8AB 1Q8IA 4AILC 4W5TA 4DU3A 3OYCA 2YNHA 5KI6A 2FBTA 3AVLA 4FM2A 4YQWA 1JXLA 2D0AA 2QKBA 8ICSA 1ZQMA 3RMAA 4RT2A 3PW7A 1XC9A 1ASVA 1KLNA 4DTNA 2Z1IA 4RPXA 3V1OA 4KHQA 2ISOA 2ISPA 2FPKA 4PPXA 3DOLA 4DU4A 3Q8LA 4FLWA 2BDPA 1BPBA 4DTRA 3DOKA 1ZBLA 4NCBA 4JV0A 5L9XA 2VANA 3THVA 1QSYA 5KFFA 1RYRA 4F5RA 1DGSA 4KLUA 3ZDDA 2YHAA 3C2MA 3KTQA 4AHTA 4TUQA 3V9SA 1C0MA 1ZQIA 2W42A 1ASWA 1HPZA 3OYDA 3G6YA 1WLJA 4YCXA 5IIMA 4CIGA 4OKEA 4KTQA 2ZE2A 4ED7A 4TSXA 3SUQA 1JXBA 3KJVA 1SL0A 3K58A 1RDCA 4PHAA 1SZPA 4RQ0A 1VSDA 1T8EA 4F4WA 3LPUA 2KFZA 4FZZA 4PH5A 4IRCA 5HRPA 4RNNA 4P4OA 1U45A 3RJKA 1J54A 2Z1JA 2W9BB 1VSLA 7ICKA 2D0CA 4XA5A 5IILA 2VA3A 3M8RA 1ZYQA 2ZTEA 1S1XA 1ZQQA 2R7YA 3HSTB 3DLBA 1K1QA 4CIEA 1ZBIA 4QZHA 1S1TA 3JSMA 2V4RA 1RT5A 4M3YA 4RW9A 2BQRA 1NK5A 2IC3A 3OYLA 5KT5A 3RJEA 5DBCA 3VQPA 1NJXA 3AVNA 1IXRA 1D5AA 1HYSA 3LP2A 2I5JA 2BPCA 5KG5A 4K8ZA 3M9OB 1S6PA 1WCLA 4DOAA 1KDHA 4O0IA 5L1LA 4JWMA 2IHNA 5DDMA 1HYVA 1K6YA 3GV7B 4RQ5A 1HRHA 2HMIA 4J2DA 3AO3A 1ZQVA 1UT5A 4CCHA 1NK4A 5E41A 2KQ2A 2HHTA 4CJSA 3RB4A 2IBKA 5J29A 4XRHA 3OYKA 4MEXA 3HT3A 2PZSA 4TQRA 4M0AA 4DQRA 2HVHA 4J9NA 3FFIA 3TQ1A 5JUMA 2J6TA 9ICPA 2F8SA 1KRPA 3DLEA 3VQ5A 2V4QA 2VG7A 1JLCA 4MEYA 3CG7A 1JL2A 1KVAA 5KFOA 2A1RA 5IIIA 3TAPA 3T5JA 1JIHA 5KFVA 1JLAA 1KFTA 3IAYA 3EZ5A 4H4MA 4DS5A 5HMMA 5KFSA 4ELTA 3DLKA 4N5SA 1ZETA 3MR3A 4FYDA 8ICZA 1X2IA 1RBTA 2LYHA 1BQNA 2J6UA 3ZSQA 4KV8A 2FBYA 3MGHA 1UOCA 4O55A 3DMJA 1S0VA 4FJIA 1BGXT 4F5QA 4ID1A 3HPGA 4CJUA 4LZDA 3BGRA 4M3XA 1B43A 4GXJA 2F8TA 1LWEA 3RWUA 4CJ4A 2A1JB 1RXWA 5BOMA 4CGFA 4JV2A 4YR3A 5J0QA 4J2AA 3CFOA 3K5MA 5J2PA 3QEBZ 4Z4IA 4QWCA 3MDAA 4YMNA 1FKOA 4M47A 1IKVA 1BIUA 3VQEA 3HWTA 1Z26A 3H8WA 1SV5A 4I2DA 3G0ZA 3RJJA 4Q44A 1RTJA 3ZSYA 2BQUA 5JS2A 4IFYA 1SKWA 1SKSA 4BXOB 4R63A 1EP4A 1WNSA 3CFPA 1BPZA 2HHWA 1LW2A 3ZT0A 8ICQA 1EX4A 2B4JA 3ZT1A 4DOBA 5FRNA 4F8RA 3LDSA 3O3HA 3TAEA 5KFGA 3V81A 5IIJA 2Q0ZX 7ICSA 4ECSA 1Y97A 3V6JA 4DWIA 4QOZB 1FXXA 1YT3A 3ZSVA 5HRSA 3IS9A 5L1IA 1TK5A 1HUOA 4IBNA 4R8UB 1XI1A 1NK9A 4O4GA 4FS2A 4PHEA 4RPZA 7ICJA 2ETJA 4FJ8A 4B9TA 8ICOA 4I2EA 1EETA 5KFKA 4M9JA 3AA4A 3RB3A 4QZAA 1A5WA 2BKEA 4NM1A 2W9MA 4CE9A 1JLBA 4O5KA 4BDYA 3GQCA 4K4GA 2XCPA 1LW0A 1NKCA 4NYNA 3RR8A 3QEXA 4RQ4A 4Q8EA 3VQ8A 4FJ5A 3P5JA 4QW8A 5DBAA 3KHLA 7ICGA 3ZD8A 5DBBA 3H8SA 3PMNA 4CF8A 9ICTA 3AVFA 4JRPA 4DFKA 4MF8A 3G6VA 5D4BA 4N76A 4E3SA 4KAZA 4ED6A 9ICEA 4L8RB 4HVJA 2Y1IA 3AVAA 1ZQFA 5SWMA 4DL4A 3E2EA 3TAFA 4KHUA 1DTTA 4FJ9A 3OVNA 5J2MA 1RDBA 4NYFA 4W5RA 1BPXA 4I9LA 4IKFA 4FCYA 5CYQA 5DB8A 1BIZA 3DRPA 3HP6A 3HO1A 3T5KA 1T4GA 3ORYA 3L2UA 1J9AA 3OY9A 2B5JA 4Q0BA 1IKXA 8ICWA 5KFWA 4Q8FA 4CIFA 3LZJA 2BCQA 4KLIA 2ASDA 3BQ1A 3SUOA 1IG9A 5KFPA 2R8KA 1NK7A 4AHRA 5KGWA 1NK0A 4DQSA 2DPIA 2C22A 1QHTA 1ZJMA 5BPCA 5JS1A 4DTXA 9ICMA 1QQCA 4QWEA 4UB2A 4EEYA 4CEOA 3KHGA 2YV0X 2PFPA 1XS9D 2DPJA 3HVTA 4M04A 3KHRA 2G8IA 4E1NA 3HL8A 4FLVA 1REVA 3OSPA 1NK8A 3OYEA 4RNOA 3OYFA 4F3TA 4QZIA 2JEIA 4M41A 5TZVA 1WCNA 5EWGA 2OYQA 1Z00B 2PFNA 4CJ5A 2W8LA 1S9GA 4QZCA 4GMJB 2VG6A 2XCAA 3H4DA 4DTJA 5K14A 4E1MA 5J2HA 3RB6A 5KT3A 3WNHA 3EW9A 3LDAA 2P6RA 3OYBA 4RPYA 2G8HA 1UA0A 4KLTA 2XGQA 2V9WA 4IFVA 8ICEA 3PV8A 5KFJA 4I28A 4W5OA 3ZSXA 4DO9A 2ATLA 1BCMA 4DFPA 1A5VA 1ZBUA 3AO2A 4PGYA 4KB0A 5KFMA 1BPEA 4FS1A 4CK2A 4TUSA 1ZQXA 3TFRA 2JZBA 4ZH4A 4EYIB 2FPMA 1VRTA 1SL1A 4YR2A 4KMUA 4O0JA 4CHZA 3RAXA 5KFTA 5KRSA 3PX6A 3KD5E 1T03A 1QS4A 1C6VA 1ZQGA 7ICLA 1KSPA 1B9DA 2NRTA 4CJLA 5KFLA 2OZSA 3QIPA 4Z0UA 3IRXA 4FJHA 2FMSA 3AVMA 3ISCA 4ECQA 4NLGA 3OS2A 1JLFA 2O4IA 4Q45A 3RJHA 3MXMA 3DYAA 4KB1A 1TK0A 1JL1A 3JPNA 2RPIA 3A2FA 2EHGA 3PUFA 9ICSA 1I3AA 3OYNA 4ELVA 3OGUA 4H8KA 4TQSA 1L5UA 5J0UA 8ICMA 1S1UA 4CJTA 4B8CA 2KFNA 4ZTFA 4FLXA 4RW8A 3C23A 4B9UA 3PNCA 4QZGA 3NGYA 3JPTA 1HQEA 2GBZA 2JGUA 3VN5A 5KFZA 4Q5VA 9ICHA 1S0NA 4CHYA 1RDDA 4RQ3A 1XO1A 5HRRA 5KG7A 3NF9A 4UBBA 1S76D 2BPFA 1S5JA 4RQ7A 2W9BA 5KFEA 4NCAA 2P51A 4QCLA 4PHDA 3AUOA 2OPRA 4M9NA 3HP9A 2FMQA 3V6DA 4DSIA 1NOMA 3OYGA 1UAXA 3AVHA 5J2NA 1HJPA 4CEZA 1TAUA 1NJWA 3ZDAA 4I9QA 1XHXA 4KLGA 1RZTA 4KREA 1XWLA 2I9GA 3L8BA 4RQ1A 3MR5A 2X78A 1CZBA 3CQ8A 2O4GA 1BHLA 3OJUA 1D8YA 3OYAA 3OYHA 2HNYA 3LANA 1NKEA 2IMWP 2Y1JA 4FJGA 2XC9A 1ZJNA 4LVSA 4TURA 5HHHA 4C8NA 1RT3A 3O3GA 3ZSRA 1XU4A 4FK2A 1U49A 4YFKA 1LWCA 4CHOA 2BHNA 3RBDA 4ECTA 4F5PA 1LWFA 5FROA 4HCBA 1SKRA 3SQ2A 4I2IA 4LSLA 4UB4A 8ICIA 1K1SA 1RT1A 3UIQA 4OPKA 4FXDA 3K2PA 3VQ6A 1UT8A 4WE1A 3BJYA 5J2AA 3SV3A 5D46A 2IS3A 3VQDA 1HYZA 4P2HA 2YKNA 8ICAA 2IAJA 5J2FA 4J9OA 2P6UA 5D49A 5I42A 8ICGA 9ICCA 5L1KA 8ICCA 2IOCA 4GLXA 2R8JA 3CYMA 3PR4A 2R8IA 4EP4A 5C42A 3QNNA 3E01A 3NF6A 4BACA 1G15A 1MU2A 9ICVA 2BE2A 3PMLA 3TABA 4CGDA 4RQ2A 3V1RA 2DY4A 2RKIA 5KFIA 4N41A 5KRTA 3KK2A 5KFXA 1ZQOA 4M6WB 3EWAA 3AV9A 5IIOA 1ZQEA 2HNDA 2J6SA 2XY8A 3U6FA 4ECVA 3BDPA 4FJJA 4DQPA 1WSHA 5KFUA 2A1JA 4MQ3A 1KTQA 5J2GA 2RDIA 4C8KA 1ZQJA 1WAJA 2P5GA 3JPOA 4IQWA 2PXIA 4F4ZA 2FBXA 5DLFA 4DLGA 3NCIA 3QE9Y 3AVGA 2PYJA 3Q8MA 3MGIA 4F4KA 3OHBA 4BXOA 3ZT3A 4Q43A 4GVMA 4DS4A 3SI6A 2VG5A 1Q9YA 4CERA 3AVJA 4GW6A 7ICRA 4DU1A 3OYJA 3C95A 1TGOA 1VSHA 3OHAA 2IGIA 4NXZA 4B9MA 4CJRA 1L3UA 4UAWA 3H40A 1BI4B 3SQ1A 4ED3A 4UB1A 3NH1A 7ICFA 5J2CA 3AVIA 3FDSA 2P66A 2FLLA 1WAFA 1ZQUA 3LWLA 3HPOA 4FW1A 3B0YA 9ICIA 3C2KA 4YD2A 1QE1A 4R8UA 4IG0A 2ZUBA 1VRUA 4CFAA 5KFNA 3PVXA 3BQ0A 1TKXA 5DLGA 3PW0A 4CFDA 1ZQDA 5KG2A 3EPIA 4CGHA 5J2BA 2NUBA 3NH0A 4DQIA 2ZD1A 3KHHA 8ICTA 4O3QA 3ZT4A 3V9ZA 2QK9A 5DQHA 4EZ9A 4KN4A 3RMDA 4YN4A 3KKSA 2BGGA 4CEEA 1RYSA 4BWMA 1ZQBA 4QZ8A 9ICAA 1RPLA 1RBVA 3V9XA 5J0WA 3TAGA 1WSIA 2FPLA 4QWBA 4I27A 2JEFA 5HP1A 2AGPA 4EZ6A 4HUFA 4PHPA 3PR5B 4B08A 3NF8A 3SQ0A 4F2RA 4M2YA 1BPYA 4DFMA 1RXVA 3K75D 2FLPA 4KLQA 2HHVA 4DLEA 2PY5A 5I3UA 4I2JA 1QSSA 3T5LA 4KPYA 4ED1A 4M3WA 2ZQBA 4CEQA 4DFJA 4O44A 1BPDA 2WONA 2DFEA 4J9RA 4LSNA 4DTSA 1VK0A 5KT7A 1MQ3A 2ZJ8A 3V7LA 1J5OA 4RNMA 4KLFA 3JYTA 4FBTA 3ZDBA 3QLHA 4UAYA 2HVIA 4XUSA 3ULDA 1RTHA 4LY7A 2X6NA 4IQVA 2BQ3A 4UB5A 4E0DA 2JLEA 1JMSA 4QZFA 1HJRA 2PFQA 3T1AA 5D3GA 3RAQA 5KFHA 4Z4GA 4JV1A 4I2GA 3ZT2A 4TUPA 9ICJA 4I2BA 4I2HA 3O4QA 1N5YA
chains in the Genus database with same CATH superfamily
3I1YA 5KFQA 2QLXA 3WX8A 3OW2M 2XVTA 4GKKJ 3L2VA 3KK3B 1KAZA 1HBUB 2KKVA 2Z2LA 3M2RB 4I67A 1L3KA 1SPBP 4CTAA 4KLMA 2VBYA 4X62F 3M2UB 4ZP6A 1IH7A 1U2RA 4ES3A 1S0OA 1FO1A 2APOA 4ZCLA 2CQBA 3DRRA 3MCNA 5F0XA 1S9EB 1AB8A 4MDAA 2UV8G 3N79A 2BCVA 3ONNA 4OJOA 4ILMA 3C21A 3T9ZA 2A42A 4WFBL 3CT9A 4KAIA 1L3TA 2IM3A 1NGBA 1D9FA 1XNQK 2DF4B 2DGUA 2KG0A 2CPHA 5CZ1A 5KG4A 4BRQA 2G0JA 1TKTB 2EKYA 3CCRS 3C5GA 4A8XA 3G8TA 9ICWA 2ACMA 2E3TA 3NE6A 1U0SA 2VPWB 3KUHA 5J0XA 4DSFA 4UATA 3MECB 4A4JA 4EYHB 5EOYA 4K42A 5EOZA 3PX4A 1N60A 2EZZA 3Q8SB 4BUGA 3AY9A 2FVRA 1LAVA 1XNSA 3J7AP 3NS7B 1UPMB 2VWJA 5T41A 2J8AA 4DPTA 3U7JA 1XNQF 2LA6A 3NF7A 5KAIU 3CJ2A 3EUNA 2E8PA 1TL1A 1NH8A 3AU6A 2EK6A 2E2QA 4ANDA 4FJMA 1LQ9A 1HR0K 3T7ZA 1HD0A 1MNEA 4RWWA 3X3UA 4G1QB 2QXFA 1EQ0A 2P5OA 5AZIB 3DWLA 3VERA 2GJFA 1E6YA 1VBXA 3AGRA 3MTJA 2I2YA 4E7IA 4DUZJ 3C29A 3ONQA 2BRLA 3VGUA 4I2QA 4A8QA 2F9WA 3IMQJ 4H0PA 4PWDA 2QMWA 1XSPA 1JLGB 1I51B 2VD3A 4FWQA 3TSPA 1VJQA 2GIRA 1YHQS 3TZYA 2FB0A 9ICFA 1HNWJ 1Q7YT 4WFAL 2KIVA 4B1VA 4OJ6A 1PVPA 2QMXA 1YDLA 2YHBA 1SUQA 2ZJRQ 1WBDA 3W2WB 4B3OB 3RG6A 3V4MA 1HR0F 4CEAA 5DG7A 3PLAA 4YR0A 1BE4A 1HWIA 1U7LA 1L3SA 4CLLA 2IA0A 2RUSA 5AKZA 3KDNA 3OUYB 3CP8A 3G9CA 3CF5L 2BXJA 4TU8A 3VQQA 5CZ2A 3M6UA 2PBDA 3DJCA 1PCAA 9ICXA 1BQMA 4HR2A 3I32A 5LJ5Y 3M6VA 3VQCA 4PCQA 4NRTA 2RHQB 5F3ZA 1AZSA 4JV5J 1RILA 1U9LA 1FTCA 3SV4A 4CVNE 5I3PA 3CFRA 5DK5A 3ZYYX 1VQ7N 4NI2A 3IHQB 4F4YA 5A8KB 1UVIA 1Q4RA 4Y3CA 1JKHA 5CP2A 4J9SA 4M95A 2SXLA 2RHFA 5AM5A 5G5GA 3UXOA 1C1CB 3VPZA 4FF4A 3CJ0A 4ECZA 4F26A 1CLFA 3CJ5A 4JK1A 3AO5A 4F02A 2QX0A 3C8YA 2C2EA 1SCJB 4MKYA 4M3TA 3HHLB 1VRQC 3W63A 3L2WA 1WG5A 3GIIA 4DV7F 4BLGA 1CXUA 3HSDA 2W2MP 3F9KA 4N7TA 4M3RA 1YJWN 3ZDEA 3HW8A 1KHWA 3HX0A 2OH2A 4OZ2A 2K60A 3IG5A 3WXKA 3V9WA 4CYUB 3NBPB 4MK7A 4NLKA 2D0PA 2ITMA 4FLUA 1ZPWX 2FLNA 1RAEB 4Y2JA 2GQQA 4I6AA 5LT5A 5TISU 1YBTA 1JCGA 3MAAB 4P74A 2XNQA 1WDDA 3QO9A 2DNPA 3CM5A 3F5TA 2VIHA 3H08A 1GLJO 3M30A 1RAHB 1U8SA 5CE3A 2KM8C 2IY5B 2ADCA 4BS2A 2ZH4A 3KXDA 2OEKA 2QA4N 2MTLA 3DLRA 2A6MA 8ICVA 1VQYA 3FBFA 4Q2LA 1KAXA 2YY6A 2UU9K 3ED5A 3OS0A 4JN4A 5IV4A 5JVGL 2P9IB 1M1HA 2GHPA 2LXFA 1KAYA 4KO0B 2YKPA 1TVRA 4KHWA 4CF9A 2ZUDA 2HHHK 1VQ9N 3M6ZA 4LJMA 3PHTA 4FPAA 1FJGJ 1HHSA 2WB1C 2CN1A 4I56A 3W60A 2AP1A 2LXIA 1PUZA 5ETPA 3TTDA 4MF2A 1NPKA 4FZVA 4QWAA 1YAGA 5F9LA 1VQLN 4JK7A 2IJFA 2UU9F 1TVAA 4CO3A 3I0SA 4FOIA 4LRDA 1VR6A 1R8HA 4DCPB 3T5HA 7ICEA 2BW2A 2I6WA 2HHHF 2BANB 4ES2A 4FP9A 4OX9J 2DHSA 1RDFA 4IQTA 4Y2MA 5LL6Z 1HNIA 2KJVA 3VA0A 3V4IB 3SUPA 3DV9A 4K2XA 2E1EA 4IJNA 1X3MA 3L95X 2VICA 3LAMA 5IC6B 1ZQAA 3S9HA 2EC0A 1YXQA 2HNZB 1SQGA 4KFBA 4ZJLA 5KFCA 4O4RA 4KN7A 3M6KA 4PXCA 2FVCA 1M90T 2CH5A 2HVZA 4NCGB 4F5NA 2UVUA 1RWPB 3DOMB 3JTOA 4OJ5A 1FWKA 2VV5A 3IWLA 4ZVPB 3Q2TC 1WKLA 1YX2A 3BO2A 1OH5A 3M3ZA 4H4OB 3LK9A 1HI1A 2O8BB 2IOFA 1SC1B 5BREA 1JLEB 3LOUA 4UY85 2ZBRA 1KHVA 1L3VA 1WNEA 1HIYA 3ZFVA 2WBMA 5KFYA 2YNHB 1P9QC 4BG8A 1B64A 2CQ1A 2RQ5A 3QXGA 4TY8B 4PUOA 4DTPA 1VQ4N 2VZ9A 2FGOA 1WOOA 3QESA 2UZAA 4OKKA 3HCXA 3BF3A 3TVZA 1B0VA 4M5JA 3NGUA 5HMXA 3OLAA 4DR5K 5KOWA 3QAEA 1U26A 1NRKA 2QWOA 1UTAA 4K0KF 3NH2A 4YMOA 3QT7A 3DOLB 1Q79A 3MURP 2A3ZA 1VQMS 3IO1A 3DOKB 2IRUA 1JCFA 4NLXA 3O8WA 3GFXA 1XR6A 3CMEN 1SXDA 2QL7B 2QA4G 2HW3A 1V5VA 3I5CA 1D8LA 3TR8A 3S3NA 3U1MA 1MWKA 2MZ1A 4J9QA 2B7CB 3KK1A 1ZRNA 1XO0A 4ED4A 2AJ4A 4DV1J 5AT1B 4Y2YA 3FSYA 4DR5F 1ZQLA 1HHQA 3RH5A 1HD1A 5J0TA 2R7XA 3KLHA 3ISDA 1SGGA 2A1AA 5KQDA 1V6HA 2LQBA 4X62J 4C8LA 4KKOA 2D3UA 5FDLA 2QI2A 3V6HA 5CD4H 4Y2KA 2QB1A 2H9ZA 2BV3A 3HHNB 4C80A 1JX4A 5HMYA 1ATRA 5DM7Q 4WFZA 3VA3A 1YTUA 3S41A 4HH1A 5ETQA 9ICQA 1XJWB 2DH9A 2XWYA 1RT7A 3WNEA 5CQGA 4OYMA 1OYEA 1FD8A 1QVFM 3GPAA 1J97A 1NU0A 1YJNS 4RW9B 3QU4A 2UUTA 3MCOA 5EUHA 3DU5A 3KK3A 3CJQA 3QWUA 2EEYA 1Z19A 3CDAA 4EUVA 1HBUA 4PYDA 3M2RA 3LP2B 4NLTA 2VASA 4WCEQ 2I5JB 5KT2A 2D6FC 2QWQA 3M2UA 1S6PB 3MMCB 1EARA 3UI3A 3A1YG 2CXYA 4AP9A 1NJZA 1S9EA 4AYBF 4USAA 1FRJA 2X1BA 3RMBA 3GILA 2K89A 3CI5A 2D1CA 1L7PA 3BQ7A 5U47A 2XRIA 4QJFB 3BS5B 1OJ4A 2KKHA 2M5YA 7AT1B 1TKTA 1M5HA 1JLCB 3A8KA 4M5HA 2W6LA 4YP3A 4O3PA 3QINA 1Z3EB 4AD6A 3MECA 1QQ7A 1IJEB 2HDOA 4QZ9A 1UCNA 1K44A 3EL2A 3VAIA 3AA5X 2D9OA 4JI8F 3RBEA 1CBKA 4IZ9A 5AK3A 2BUNA 1BQNB 3N5BA 4XDCA 4KV8B 4ED0A 3PW2A 2ES6A 8ICNA 3H5SA 2WMMA 2YX1A 2F1HA 2WF9A 4C2MA 1W7AA 1FNMA 4CLTA 2BCRA 2BM1A 4G1QA 1AT1B 3VGMA 3MDFA 3J81Y 1K8AT 5D4PA 3H6EA 8ICBA 2C2OB 1UVKA 5AZIA 1S59A 2G0CA 3DXBA 4L72B 4F0HA 1PIEA 1LOTB 3RSEB 5LJWA 4CECA 3VGLA 3HOTA 3RBZA 2YTUA 2OA8A 1F9FA 1JLGA 1MC8A 1FJ7A 1A9NB 1UKUA 5KPRA 1IR1A 4BVOA 3MF5A 3AVBA 2VKRA 4PKGA 4KTWA 3W2WA 4B3OA 4YOWA 2YWEA 3HK2A 1N5SA 1FD2A 1W25A 5AQUA 1WG1A 2M2BA 1ZBSA 3OUYA 3P31A 1Q9XA 3V81B 3FMWA 3CCMS 1IG6A 4KC5A 3AB4B 4TVAB 2ATQA 4DV7J 3C5FA 3BS9A 2MRLA 2ITGA 1NOYA 5EWFA 1K73O 3QX7A 1NM2A 2AJQA 5CHCB 1BDGA 2CWKA 1SJ3P 2FSJA 1X42A 2C3OA 4AQYK 4M45A 2ASOA 1BC6A 4NLZA 3ZX3A 3C46A 4N77A 2B4UA 4BRGA 4F4XA 1X5SA 3GV5B 2Z2ZA 5A8KA 3ICLA 3ZTPA 1KWMA 3BH7B 1CQMA 9ICNA 5FPEA 2QWNA 2AZ3A 1L6NA 5AK4A 2GUIA 5C10A 1LW0B 4KLSA 1C1CA 2BKOA 4KQZA 1ZM4A 3HHLA 4X4TA 3ZX2A 4CHQA 5B66U 2AV5A 2G8WA 4LF9K 1MWYA 3SPZA 1VFJA 1NBWA 2NQPA 4NLCA 4LF6K 2J0SD 2HIQA 2P9KB 1LAWA 1U09A 4GV6A 4CRJA 4MIWA 2JJ4D 2NRXA 2QRRA 4X5VA 4MIAA 4CYUA 4ACOA 3GG4A 2G13A 1X4EA 5DQIA 1DTTB 3K8WA 1FX2A 4G65A 1N2XA 5F8HA 1BWFO 2ZUAA 1WG4A 3BQTA 3MAAA 3I5BA 3ATUA 3RMCA 5LJ3Y 1TFRA 5CYQB 3DRPB 1GX5A 2XI9A 3NNHA 4H5WA 3CJTA 3VGVA 4KIAA 2RF2B 2LP4A 3U3YA 3DEEA 4LF6F 1IKXB 2D5RA 2EBGA 5FD1A 3MDQA 1BY9A 3O3FA 1R59O 2B0GA 2CQ4A 3IRUA 4PZNA 2ZFHA 3MPDA 5MLCQ 2P9IA 4E8UA 4GVBB 4KO0A 3K89A 2E8NA 2B8QA 3KKAC 1FXLA 3G4SN 5ALDA 3QEIA 4DX5A 3CJSA 2CQCA 3VAKA 2XYGB 3QT6A 2E88A 3J81U 3D6FB 1NO8A 1JJ2M 5HK4A 1ZZNA 5BPMA 2KRRA 4ED8A 4JKDA 1UFWA 3FK4A 3CJ8A 3VQ7A 3T1HK 5CB1A 4JKFA 2BPGA 4LMZA 2ZIXB 4ANEA 3H0MB 4KX3A 4FF2A 1IO2A 3D1HA 3D5MA 3KZBA 2BANA 4HT7A 2J0QD 4N47A 4NLOA 3LWMA 3PYGA 4HT5A 2VPYB 5L9NA 3OTQA 2DIVA 3HULA 1FWLA 2RT3A 4A5AA 1Z4NA 3V4IA 4J9MA 3PIOQ 2E1AA 4KITB 1BA0A 2DNNA 4M5MA 3NRWA 2HNZA 2RUGA 2KMDA 4IFVB 3CIZA 3J80Y 3OTOF 3KKRA 4P72A 2I6XA 4YB5A 4K0KJ 3FLCO 1S77D 3MTKA 3T1HF 1QTMA 4NCGA 3DOMA 2Y8WA 1CJTB 3ENBA 1CG2A 3JS9A 3N97B 4H4OA 5AQNA 2J7UA 2Y0SD 3BB5A 4KTZA 2ZM6K 3MN7A 4E7JA 2O8BA 5K20B 2V2ZA 4P2XA 1JLEA 4J9KA 2JZBB 4Y2AA 3KHYA 2GO7A 3V7JA 4QPTA 3UE5A 2W2PP 4YS2A 3TUPA 4JK8A 3D7EO 2XMAA 3OYCA 2YNHA 2FBTA 3H8YA 2QKBA 8ICSA 4TY8A 3MUMP 4LF8F 3CB4A 2ZJRL 2Q66A 2HSTA 4RT2A 5EVZA 1WELA 2E20A 1FRHA 1XC9A 1RGIA 2Z1IA 2I0XA 4KHQA 3NGKA 3ZO7A 4HI1A 2FPKA 4PPXA 5F41A 3DOLA 4DU4A 4URGA 4FLWA 5MLCV 3DOKA 3J7ZO 3THVA 4EX6A 5KFFA 1RYRA 2M4MA 5D0RA 4FYYB 4ZP7A 3VZIA 3KTQA 1ASWA 1UETA 2YH0A 4A2AA 1XNRJ 2HEKA 4AL7A 5AIAA 1WLJA 3V5RA 4YCXA 1WD6A 5ALVA 5IIMA 1T9UA 4JKBA 4RW8B 4KH1B 1HQEB 2KE7A 5LMNJ 5M2PA 1DRZA 3CPWM 1SL0A 1SZPA 4RQ0A 4BY9C 2HWIA 3LPEA 3CCJN 4F0MA 3BF1A 5GADI 1G2EA 1ZQ1C 4ETXA 2RRNA 2Z1JA 4PEOA 5M1FA 5EXWA 2W9BB 1F2GA 3LL3A 2Q79A 2OPRB 2ZHBA 2HQ3A 5K8OA 1VI7A 2H3GX 4RPFA 2R7YA 3DLBA 1K1QA 4CIEA 4QZHA 2MZRA 4K59A 3K2YA 1XK8A 4ZLLA 1U6ZA 4RW9A 2CRXA 4UTGA 2CJQA 3OYLA 3BPDA 1FKAF 5DBCA 2B7BB 4XO0A 3EZWA 3VQPA 4DV2K 4WKYA 1IXRA 4F04B 4UARA 5IV3A 3SAGA 2IIRA 5G5HA 4OPHA 3LP2A 2E1CA 2I5JA 4PL1A 4K8ZA 3M9OB 1S6PA 2I8EA 3H3NO 3MMCA 2E1MC 4ID8A 5FLXY 2G08A 4JI8J 5DDMA 1HYVA 1K6YA 4LF2A 2HQGA 1HRHA 1KQKA 1ZQVA 1UT5A 4CCHA 3MI7X 3WXJA 4UW2A 2QYGA 4QIWD 1V38A 2DHGA 2VONA 5J29A 1BMQB 2MKHA 3OYKA 3P45B 2E5HA 4WQ4A 3AL0B 1BO5O 4C4TA 3BS5A 4DV2F 1TU0B 4Y2XA 3GU0A 4J9NA 1Q53A 3TQ1A 4B6JA 2F9DA 3HILA 2KYXA 2P6TA 4PHTX 1JLCA 1WEYA 3R9LA 1NH7A 3PXGa 3CG7A 1LKYB 5IIIA 3TAPA 8ATCB 3O8MA 4YN3B 3F9MA 5GIOA 3MM9B 4RUBA 4DS5A 2FY8A 5BYQA 2FZCB 2XHCA 1MU2B 3MR3A 4FYDA 1X2IA 3ZSQA 1BQNA 3THYB 2HMXA 3B6BA 4KV8A 1BUXA 3MGHA 3QFUA 1RKIA 1TP7A 1T9VA 2Q6CA 1YJ9N 4F0KA 2A10A 3OFEA 2UXDF 4F5QA 3NWRA 5DETA 2ZH1A 3PNIA 4CJUA 4DCOB 4LZDA 4LRFA 1MLAA 2CADA 4ZP8A 1RHUB 3TEHB 3C2PA 4CJ4A 5BOMA 1FXDA 3WK7A 4JV2A 1B7YB 1C0FA 4MKAA 5ETOA 4J2AA 1NGFA 1HPMA 1H2UX 4DUTA 3QEBZ 4WZQA 2ZG6A 4AM7A 1WBBA 4LF4J 1HHTP 4CNYA 3HWTA 1Q86T 3G0ZA 1N34K 2BQUA 5JS2A 1DQ8A 2ZNZA 1WNSA 6FD1A 2HHWA 3PJWA 1QY7A 2HS0A 3L5KA 3PRVA 3FEXB 4C7ZA 2QZ8A 5FRNA 4F8RA 4CZIA 3O3HA 1X4GA 4ZKAA 3FFKB 3V81A 5IIJA 2ZHOA 2RIJA 1Y3KA 4H4KC 3V6JA 4DWIA 2CPRA 1NLKL 2B6GA 1Q81T 1YT3A 2CVEA 3BGFA 5L1IA 3WIUA 1TK5A 2LM4A 1BOTO 4R8UB 1JROA 3RU0A 1K0TA 4PKIA 2PKEA 4FS2A 4OL8A 4PHEA 4RPZA 2HFZA 2OCEA 3CJ7A 4FYXB 4FJ8A 2F5GA 8ICOA 4I2EA 5KFKA 3NWGA 3RB3A 1Q8BA 2BKEA 1PJ6A 3UNGC 2W9MA 3UKRB 3C3LA 3OVSA 1NEEA 4K4GA 2XCPA 1LW0A 1NKCA 3ILOA 3K8VA 4NYNA 3RR8A 3AXKA 4RQ4A 4Q8EA 1Y5NB 4H5TA 5AICA 4A48A 3ENHA 1RLCL 3CCZA 4FJ5A 5AQTA 4OHZA 3CQYA 2CVIA 3D67A 3FEZA 5HP1B 2C1EB 2QGFB 4PG4A 3OD2A 1FKOB 2UXBK 2J5AA 3GR1A 1X66A 4CF8A 3T79A 1WF0A 2P9KA 3NMAA 4DL0C 4UAUA 2V8HA 4N76A 4KAZA 2DKXA 4L8RB 3D2EB 5DM7L 2I38A 5SWMA 2IOHA 2XICA 4X4VA 4KHUA 1PK3A 1DTTA 1Y10A 4X64J 4Y28C 2Y0SC 2Y0BB 4KR0B 2GZOA 1RDBA 4NYFA 4O44B 5B0FA 1EB0A 3EVOA 5BN8A 4DPUA 1NPPA 3V2UC 4A8EA 4PABA 3D68A 2FJWA 5DRKA 3NMRA 5CYQA 3CJRA 4DCHA 3DRPA 4LFAJ 1T4GA 3ORYA 3THTA 4F7VA 2UXBF 3E51A 1CULB 1NHVA 3WC0A 2RVJA 5D78A 4K4WA 1IKXA 5KFWA 1R43A 4CIFA 1Q7YO 4B3SK 3O1WA 4IOCQ 4WCEL 1IG9A 4BRDA 4HDHA 2DCUB 1NDCA 1YRXA 3DGVA 4GVBA 2C22A 1QHTA 1ZJMA 2ZGZA 1QQCA 3T69A 2H3EB 1V97A 5GTIU 1U1NA 1EKRA 3KHGA 3BDEA 3OTOJ 2RE2A 4EMDA 4JI5K 5CRXA 1N5YB 1T95A 3T41A 2G8IA 1RDRA 4X65K 3R1LA 3LO3A 1VQOS 2HRTA 3M8WA 2XSFA 4ZJOA 3OYFA 4F3TA 4QZIA 2KVCA 4M41A 4BREA 2ZIXA 3M32B 5HLFB 3DKDA 1ZAXA 2HBMA 2K7JA 4I7FB 3H1QA 3SMPA 2XCAA 1RTIB 2ZH3A 2ZIWB 1QAIA 3GE1A 3F2BA 1NAQA 1U6FA 3RB6A 4M5DB 4LF8J 3VEOA 1B70B 2WF5A 1UA0A 3N7RC 4KLTA 4LF1A 3GZ7A 2OPQB 4YHHJ 1N88A 2K8CB 2R7OA 4IFVA 1SIJA 8ICEA 3JSBA 2LMRA 5KFJA 5E2QA 4E98A 3FCWA 1NLVA 3F0NA 2ATLA 1BCMA 1CJTA 4J7CA 1ZBUA 3UFCX 5GADU 3AO2A 4EIAA 3F2CA 1P8GA 1TL3B 1N62A 1N36K 4CH1A 5AQVA 2JZBA 3LDQA 5A76A 4U7UD 2NZ4A 2J9DE 3R5GA 1RHRB 4WZMA 4AF1A 1DTQB 3JQJA 5G0RB 1Y5IB 2BYCA 3MM8B 3PX6A 2WRMA 2JVRA 3HSJA 2N4CA 1RUSA 1FW6A 3SR6A 7ICLA 2KT3A 3H59A 4CJLA 1S6QB 2UYTA 1BWVA 4QIWC 2DXEA 1XTZA 4FJHA 4NWBA 3SLCA 2LHTA 2FUG9 3WEEB 2O4IA 4OJLA 3NY0A 3CD5A 1RM6C 3RJHA 1UWBB 2KHVA 3UR0A 4L74A 3NGTA 1KQSM 3W7BA 3R3TA 4URQU 2MKSA 5THWA 3GDQA 5JRTA 3JB9k 9ICSA 2M88A 3ZZ0A 1G7CB 2GQ2A 1TUWA 2CAJA 2OSQA 4ZIWA 2ZWHA 4P75A 3I4HX 3G82B 4RW8A 3C23A 2BZ2A 1EZZB 2W11A 4L76A 3NGYA 4UW9A 1HQEA 1NGCA 3D6JA 3IBPA 1VHFA 2E1ZA 3R1XA 2NZCA 4NA2A 1RDUA 2Q1LA 2VPZB 4RQ3A 3DDHA 4DCCA 3IN5A 3H3OB 5AR0A 2W9BA 5KFEA 4NCAA 2P51A 1HBOB 2ZC3A 3A0IX 3K0JA 5AQXA 2OPRA 4M9NA 4NA1A 2JC0A 1XMQF 3LUYA 3AVHA 1HJPA 3TADC 1IBKK 1R7IA 4ZVGA 3SSRA 5AE2A 3T1YJ 1VQ5N 4I9QA 4JKHA 4BC3A 4KREA 1R8CA 1HIWA 2I9GA 4OZLA 5CZVA 4ZHRB 2FC9A 2X78A 1CZBA 1WWUA 1JJCB 2HLUA 2KDOA 2COLA 4XEIA 3HJEA 3OQ2A 3CC7N 3ULEB 1HUXA 1Z4UA 2HRUA 3ZXWA 2X7IA 4K5SA 2LXUA 4GVEA 2E7VA 1S7HA 4CHOA 2BHNA 1IBKF 4F5PA 1Q3UA 3BM7A 2UXDJ 4HCBA 5D8HB 2JR5A 2A19A 3BR9A 2VUGA 3B54A 4FXDA 4OPKA 3K2PA 4J8FA 3VQ6A 5BRDA 2GX9A 2WW4A 3D0IE 3VQDA 4P2HA 2LYVA 2UXCK 1SI9A 3EO3A 1E4FT 4A57A 5DDOC 1LKYA 4FPIA 5L1KA 3M6XA 8ICCA 2IOCA 4FDFA 5HR6A 1D0EA 4JI2F 1GO3F 3QFPA 1MU2A 1TZ0A 1X0PA 1RFQA 3V1RA 3THYA 3CNQP 2HLTA 1YZ7A 5KFIA 3LP0B 4OYAA 2E7XA 2VGNA 1ZD5A 1KC8T 2M0NA 3KLGB 5GMEA 3W8PA 4EELA 4CLPA 4JYAJ 1Z4OA 4M6WB 2HQDA 3AV9A 1ZQEA 1ED1A 2W4PA 2UXCF 4PZOA 4CZHA 3U6FA 4ECVA 1ZXIA 4Y6IA 4FJJA 3AT1B 3MN5A 3PIOL 4WF9Q 4JI7F 2JH7A 2RDIA 4C8KA 1WC3A 4BC4A 2E44A 3C66A 1UAWA 4Y2UA 3Q8MA 2KVQE 3MGIA 2GAGC 3G71S 2QWPA 5EY4A 3J7YP 1B4SA 1F60B 3DRSB 3HKZF 1YIJS 1WUAA 7ICRA 3HX9A 3OYJA 1TGOA 1VSHA 2IGIA 4B9MA 4CJRA 5FPMA 1M1KO 5M1PA 3H40A 1BI4B 3SQ1A 1VQKS 2H5IB 1P1TA 3GYGA 4TXSA 7ICFA 2PSZA 4P10A 2QL5B 5CCLA 3FDSA 1YG0A 2P66A 1P27B 1TTHB 4KH6A 5HROB 1O51A 1ZQUA 4DI6A 3H46O 9ICIA 2V8PA 4R8UA 3AD7C 1NNEA 2WFAA 2VKQA 2ASYA 3PVXA 3BQ0A 2O8EB 2ZIUB 3PW0A 3ITHB 5KG2A 3NCQA 2V6AA 4Y0WA 3RRKA 3ZETB 5J2BA 1RWXB 2F4FA 2WVFA 1IBMF 3CCQS 1N5TA 2AHOB 4DQIA 4G6VB 3CEDA 1U2CA 3UKRA 2RRBA 2CJBA 4YN4A 1NHKL 2DCLA 1VJWA 1ZQBA 4QZ8A 1S22A 4P71A 1RBVA 3V9XA 5J0WA 1LEOA 3I9V9 4QWBA 1LFWA 3ILLA 4CH7A 1RI7A 4RR5A 4ENOA 3THWB 5C24B 1BWEA 3GOIA 4X4NA 1F1BB 5HP1A 1ZC6A 3NF8A 4BCAA 4F2RA 3TOQA 5D0GA 1BPYA 2I1RA 3K75D 4KLQA 2M9KA 3HSGA 2HHVA 4QR1A 1BD6A 3D2EA 2BKNA 1IBCB 1ATSA 4ED1A 3R6GB 2EZYA 1Q78A 4L75A 4O44A 2CPJA 2QKQA 1RKJA 1VK0A 5KT7A 2GO9A 1YKWA 1CULA 4F67A 1R8AA 2OM6A 2CA9A 3A8YA 4XUSA 3EKSA 2YMLA 5HL7Q 2X6NA 1HNXK 4CP5A 4UB5A 3A5MC 1JMSA 5EE0A 2FHMA 2I5HA 2W3SA 2MGZB 3WDOA 3FBBA 2W41A 4Z4GA 4LRAA 5ALNA 1RQNA 1UVMA 4TUPA 9ICJA 4I2BA 4I2HA 2QL9B 2HZAA 1VQSA 4ILLA 3H25A 1N5YA 4CLSA 4JS4A 2F3NA 2A6AA 1LKZA 5DGAA 3CWJA 3DFEA 3CJ1A 4DEZA 2YWHA 2VJUA 2XULA 4DV0K 1S0MA 3M32A 1BISA 3AGKA 5HLFA 1XHZA 2J0WA 2EQYA 8ICPA 5I3UB 4DTXA 1Z2ZA 4I7FA 3SCXA 1RTIA 4RWXA 2ZIWA 5KQ8A 1N5VA 2ASPA 3F41A 4ZVFA 4UOGA 1N6QB 3TFSA 4M5DA 5HQ8A 2GMLA 1NK6A 1XIQA 4FVCA 1GOCA 1X60A 4CJ7A 4GC7A 3D28A 2OPQA 5AJ3F 3M9NB 3A3PB 1SL2A 3SCKE 4NLWA 4RQMA 2CPZA 4HDGA 3Q8RB 1NBEB 1KS2A 5L1MA 3ULHA 1IV0A 2GELA 3NTUA 4WFYA 2B4VA 3JAMY 1JB0C 3D6HB 3MC1A 4CO2A 1TL3A 4LFBF 1L7OA 4H5NA 5HHIA 2DO4A 1DBDA 5DMRA 2IM0A 3MR7A 4OHWA 5CYJA 2AQ4A 1DTQA 4M9LA 1WSFA 5G0RA 3QBXA 2QIFA 3PO5A 4DUYK 1JQGA 3MM8A 3OA9A 2J0XA 4EBCA 4OYBA 2JWNA 2MY8A 1HA1A 4LQ9A 1VQ6N 3TPQA 3PY8A 1JNRB 2HQIA 2F1JA 1S6QA 3WNFA 4J03A 4OI1A 2GVZB 2Z58B 3EE8A 2IA6A 3DI6B 3UPFA 1NMDA 4LF5J 3RUBL 3GJRB 3WEEA 3JS6A 3TUZC 1IVZA 3OV7A 2QM1A 5AKEA 2WZ1A 4Y2CA 1UWBA 4DUYF 2HZCA 1PO6A 2CJKA 4YMMA 4FK0A 1S6UA 1RA7A 1XMQJ 1AUSL 5DDPC 2MYFA 1CC8A 1FKPB 1VLBA 3H4BA 3BYRA 3QBWA 2AA4A 1WG8A 1S79A 3OPKA 4DV5J 3NGSA 3HLUA 4JP8A 2G8UA 1C0UB 3OR2B 3G82A 1IV8A 4LSZB 2LDYA 3E9PA 1COKA 2OANA 2HHQA 4GY2B 1V9PA 4BBYA 1HMVA 2KJ8A 2XNRA 3RH6A 3K59A 4EX7A 4D3HA 3NGIA 1DQ9A 2V2KA 4ZK7M 5LSLA 2XY5A 1P8ZA 7ICHA 1GXUA 1ACMB 1HBOA 3MCSA 3IG8A 4H0OA 1YJUA 3K5LA 1HNVB 4MFBB 3IFEA 4CGIA 2V52B 2BZFA 2BABA 1C0TB 2YWWA 3VEWA 3CXCR 2HZVA 3MWBA 5KOXA 2LYBA 4WQ5A 2XMJA 5HMZA 4ZHRA 3F5EA 4Y1CA 1WSVA 1YITS 1YJRA 1WDTA 4OGEA 4X66K 2E29A 4WWSA 1DK2A 2X74A 4DV4J 5BJRA 4M42A 1GAOA 2KRBA 2BGWA 1RA6A 2W2NP 1S1VB 2OWOA 3QUTA 1LK5A 3A4TA 4JI2J 2DGSA 2W24A 4Z6EA 1UVLA 5EDWA 4IOCL 2R9LA 4N8OA 2XMTA 1QSLA 5K8NA 2ZIVB 3VENA 2BM0A 3UM9A 3OT9A 2ABYA 3O3LA 2NZTA 4KPCA 4PZVA 1K0VA 3CC7S 5A2QU 4JI7J 1JLQA 3RFAA 2R4FA 1FK9B 2OTJN 2M8HA 4PG7A 1NJYA 3UD5A 2K8BB 1GH8A 5C2FA 1W9HA 3H5UA 3RVCA 4OJ1A 2ZDOA 2YI1A 1JMTA 2V94A 1CS4B 4HI2A 1YRTA 1I94K 4OYPA 3SSSA 3MXIA 4DU7A 2VJ4A 2AT1B 5D15A 4UF4A 4CF0A 1YVNA 3AODA 5J0OA 4RQ6A 3LP0A 3WQTA 2DKZA 4MH8A 3KLGA 5LMUK 4UBCA 1RT2B 5BR8F 3M8PB 1SIWB 4IG3B 4I2FA 2G07A 4M6WA 1VGYA 5FRMA 1BLUA 2WB1F 2NRHA 2OTLS 4KH4A 1KW4A 1UEUA 1GTHA 4RZRA 4R25A 1TK8A 4QZDA 3FMBA 2PEHA 4IS7A 3TKAA 5E3QA 2FHKA 2QWLA 2ZVIA 4FNIA 4GV9A 2EFOA 1Q16B 2X3GA 1FNXH 1LCUA 3P3DA 2AKWB 1IBMJ 1K8KB 3U26A 3SFUA 3UDEA 5CWRA 1SVDA 4CF1A 5HP4A 1GMWD 1U0HB 5C25B 3M1YA 3NAIA 9ICGA 1DLOB 1OS5A 2FTRA 4DR1K 3KWIA 4PGQA 3DRSA 8ICHA 1E3MA 4ZDNA 2AJFE 4M94A 2KTQA 4I2PB 4DMNA 4GVLA 5B0DA 1SV0C 3SI8A 4IL6U 2B4PA 2P9PB 3FE1A 4CJWA 2P9GA 4M5KA 4C7YA 1BI4A 1H2TZ 3QIOA 3K7RA 2IJNA 4OV1A 4CJPA 3HM9A 3CHWA 2HOIA 5HROA 5AQLA 4Z6DA 1V3ZA 4BDZA 2AGQA 2YNIB 1T3QA 1RNHA 5HBMB 4FZNA 3BUZB 2O8EA 2ZIUA 4C8OA 3ITHA 4UOFA 1SJQA 4DZDA 4GXIA 2ASLA 2AYEA 4DR1F 1MG7A 3ZETA 1SV4A 2ZEJA 4ID5B 4KHRA 3Q8PB 1ZQCA 2IDLA 5J2JA 1QQOA 2WBNA 2E2NA 1ITGA 3C7NB 4BE0A 4GXKA 2FF3B 2HHSA 4FLYA 4CNZA 4B1YB 4B3RK 3M05A 4DTMA 1OY6A 3VVUA 4QWDA 1QVGM 1Z1ZA 2C3YA 3I87A 2FHJD 4ISFA 2JEJA 3VAHA 3CD6N 3THWA 3UN5A 5C24A 5KFAA 2QKKA 2EI5A 2DGQA 4CM0A 5AQMA 1OQ3A 3EJMA 1FEEA 5AXMA 2HFNA 1URNA 4FLTA 3ALYA 3Q8QB 4FF3A 2CWXA 1VQ8N 1KEKA 3U8XA 2PA3A 3ETOA 4QYZK 4WFNQ 2XG8A 3TO8A 1S49A 4B3RF 5ETKA 2GUPA 4C48A 5L1JA 9ICLA 5KT4A 3UQ0A 2CRLA 3ZZOA 3DXSX 4QR0A 1HPZB 5EE1A 3MM7B 4ERDA 4P4MA 2O6KA 3RRHA 4DQQA 2CG8A 1VSJA 2ROEA 1XMOF 4K4HA 1Q86O 1CJUB 1NJIO 1S1WA 4X4UA 3CCUS 1KOOA 3VEXA 3D6MB 2Q4TA 2PYLA 1SWWA 1S72S 2KG5A 1ELOA 2MKYA 3FR0A 1OUQA 4C4SA 3QZ7A 5C12A 1NMNA 3PEJA 4KHMA 1UP1A 1SJ4P 5AKKA 8ICLA 5GAHI 4NO7A 5KT6A 1KVBA 5CHIA 4USJC 5AJ3J 3JPQA 1FO4A 1HNZJ 2RDJA 1NSPA 5LL6d 2HHUA 1Q81O 4NY8A 4BRCA 1FRMA 1R6VA 3Q8YA 4NEYA 2HHXA 4A47A 3ZTQA 4LFCJ 4LFBJ 1UW9A 4YB6A 4FJ7A 1GLDG 4BWJA 3R5CA 4GO7X 1KCFA 2Q6BA 2FJBB 2DR6A 1QD1A 4DV6F 2HMPA 7ICTA 1EXNA 5AKHA 1VC5A 1SC4B 1VDVA 2G5HB 4ZVRB 2FI1A 3V1QA 2B21A 2JHEA 1GLFO 1MROB 3IM1A 2RN2A 5J0RA 3WKEA 2O8FB 4KRWA 4CJQA 2B9EA 5DDYA 2GLEA 3T3FA 2ASJA 1N6QA 2W55A 3QEPA 3LGMA 4F50A 2FQQB 4CNQA 4JAXA 1IM6A 3V72A 3GU3A 1Z05A 1WF2A 4EO6A 3DU6A 1HFEL 5JXSA 3GIJA 4YXJA 3TVYA 1NPRA 3CCWA 2ROGA 2HOEA 3KMQA 1PYSB 3KFWX 2E5IA 3H1VX 4A5BA 1S97A 1TKDA 2ZH9A 4CLWA 3MR6A 1IM4A 2IHMA 1H38A 2DGWA 5AXKA 1COOA 3VAGA 3ID8A 4IWVA 3J80O 4BJQA 3LALA 5IFMA 4CZKA 3B6OA 3OFGA 2MAXA 1CJVB 3BKFA 3MD1A 2KHDA 2JWKA 2XI3A 1RBUA 3OS1A 3O9UA 5ETLA 2P5VA 2WSFC 2IVFB 2QXLA 3L09A 2EZXA 3QWPA 1YBAA 1SJFA 5GVQA 2VJVA 4GKJJ 1ZTWA 3FQLA 4BC2A 2D0OA 3BGRB 3AO1A 4QU7A 2AX1A 5CA5A 3DI6A 5J0SA 4QIEA 4N8NA 1UZHA 5M2RA 1QCKA 3T19A 3NFAA 5A0LA 1YUWA 2XY6A 4JMUA 5IT9Y 3A13A 2WSCC 4M7XA 1IR2A 3MUVP 3PDNA 2HS4A 1WHXA 3QERA 1Q3VA 2LKZA 3N4WA 3K17A 3LGNA 4BRMA 1PZNA 2PA8D 3UXPA 1FKPA 3VQ4A 5GMDA 2F7VA 3JPSA 2HWTA 1WSGA 1HKAA 3MBYA 4IFYB 3MPWA 2GJ2A 2EANA 1EP4B 4UAZA 1C0UA 3W9HA 3OR2A 4B1UB 3N4MB 2B3TB 2W7PA 2ZJAA 1NHUA 3TX8A 3CERA 3CJ9A 3ICXA 4OGCA 4DDFA 2EFVA 1ROFA 4R64A 3UDCA 3TWHA 3CJBA 5B08A 1SB6A 1W2BR 4DHYA 1GK8A 3DLHA 3DGPB 4LRCA 1TE2A 3TX0A 2O8CB 3GDXA 5KG0A 2CQIA 2ERRA 3NNAA 4CH0S 1KKXA 2GWSA 4HTJA 2QFJA 4E19A 3MM6B 5KFBA 1T7PA 4YDDB 4O4GB 4PAAA 3AM9A 4K2JA 3O5TB 2ASMA 2EAMA 1HNVA 1WWVA 4MFBA 1ZQWA 4RUCA 1C0TA 1JXEA 7ICOA 1EETB 4WXOA 2RU3A 3O9QA 4FO6A 1PYOB 5IS2A 3EYZA 1O1WA 2L5YA 1S9FA 3EGZA 5HRNA 2NYVA 3JXUA 4JI6J 1XR5A 1S1VA 4PKDB 1ZOTA 8ICJA 1N32K 2ZOMA 5F8JA 2QE5A 2F65A 4OZJA 3H0LB 1Z2LA 1RCHA 2R7QA 5T7BA 1UFLA 5AZJB 2PIIA 5LSOA 4BRHA 3CCRN 5BR8J 4FJXA 1N8RO 5HL7L 1Z6RA 2Z0GA 5FLXO 3RH4A 3P38A 4DL6A 2ZIVA 3HYFA 3O4WA 2P1JA 4UZCA 2DJWA 1WSJA 1ZM2A 2NPIA 1N0UA 5A6WA 5J2MB 5GAGI 1WHYA 3WU2U 1SXEA 1MSWD 1FK9A 5H9FK 1H2VZ 3BV8A 4Z6FA 3IR7B 4KHPK 2OFHX 2DHAA 3ZSZA 3FEYB 4AYBD 1LXNA 1CS4A 3PW5A 1PVRA 2NRZA 4B3MJ 1Y9OA 2B5JB 5A8WB 4OI2A 3B0XA 3PO4A 7ICPA 2EH9A 3GCWP 1KN5A 4PPZA 1SZ2A 3SQIA 3W0LA 1NGEA 2GIQA 3GSDA 2KHQA 1X9WA 4HHJA 4YNQA 3H5YA 4OPJA 4M3UA 1RT2A 1T02A 3M8PA 3AA2A 1EWQA 4IG3A 1UVJA 3EVWA 4KHPF 1T9WA 4MO4A 2R8HA 3ZNUA 5AFUA 1IBLK 4DSLA 3FRYA 1YHQN 1H7WA 1A5XA 1REVB 5KFRA 4LF5K 1B4FA 1ZPVA 2YHWA 3JPRA 1YSJA 5IWAK 3N5FA 3EZOA 2HFSA 3OW2R 1TV9A 1QQMA 2VQFF 2EFQA 1K8KA 3BN7A 3TTFA 4OIXA 1GOBA 4C8MA 5H9EK 3RW6A 1O03A 1U0HA 5C25A 1RCOB 2JWLA 3HFZB 4RQNA 4UQTA 7ICNA 1SJRA 4Z2XA 1DLOA 2CNOB 3I8DA 4OFZA 2ZGYA 2GFFA 2HK3A 1IBLF 4I2PA 4DR3F 1B22A 3AO4A 3QRQA 4NLYA 2BJ9A 1NZBA 4Z4EA 3F56A 2P9PA 3ENVA 3MAQA 3BQ2A 1A0OB 5KFDA 3U02A 3RB0A 5TKWA 4K4IA 4KHSA 5LJVA 4F92B 5J8YA 2MDAA 3K9JA 3N4QA 3OTDA 3HZ6A 3K0SA 2YNIA 5HBMA 4OHXA 7ICVA 3EWGA 3K5OA 2K1RB 3RTVA 3NGDA 1TV6B 3L3UA 4LF7K 4ID5A 4RJVA 1VRTB 3BS7A 3C7NA 4DBQA 1U48A 4F3OA 3E58A 1NB7A 3TRGA 2F77X 2OEJA 1B0PA 5B09A 2HGLA 3KJNB 4IOBA 1XMOJ 4EU0A 1NU4A 2Y9UA 3PW7A 3UVJB 1KLNA 2OMLA 4TYBA 3QIPB 4MDBA 3LTOA 4BR5A 3IRXB 3P6YC 4F25A 4JI4J 4X4PA 7FD1A 4PR6A 3GLJA 3R3LA 2BDPA 1ZBLA 2MLYA 2XO6A 2V69A 2IJRA 5L9XA 4NCBA 3MCMA 1DGSA 1N5XA 2MZQA 3HKWA 5HJXA 3ZDDA 2DT9A 2YHAA 3FZFA 3V9SA 2J4RA 2N3LA 2WF7A 2W42A 2F9TA 4MK9A 3LDOA 4KGZB 3KWGA 2OMOA 2RQMA 1HPZA 4DZ6A 3MM7A 4F3QA 2XLJA 2B9YA 4EWTA 3HBTA 1OWXA 4KH5A 1D9AA 4FKXA 1VS3A 3OFHA 4DV6J 4YORA 4M63C 1VQ8S 1CJUA 3GSIA 3K58A 2RS8A 1VSDA 3O5BA 2M3DA 4A62A 4ICAA 2CPEA 2GV1A 2KFZA 2QTWA 4PH5A 3OVAA 4RNNA 2FXUA 5HR7A 3RJKA 5JMNA 2AJ0A 1J54A 1W26A 1XBWA 1P7DA 3PFOA 1U25A 3V6DB 1T9YA 1CI4A 2F8EX 2ZF5O 4C7QA 1RWVB 1ZBIA 4BR9A 2V4RA 3QUQA 1FI4A 2BQRA 2C2MB 2YVSA 4FOEA 4WP3A 2D69A 1NJXA 3AOAA 3AVNA 4ETZA 3KJQB 2D7SA 1JNZB 2DTJA 1WCLA 3QATA 4NXMK 1KDHA 4RO0A 1AFIA 2OHFA 3DHXA 2UUAK 4JWMA 5E3RA 1MROA 3J7A1 4KH0B 2O8FA 4RQ5A 2UUCF 2BE7D 1LWFB 1NK4A 5E41A 3QFWA 2H3QA 3BZKA 3TZWA 3ZLJA 4XRHA 4MEXA 5B0CA 2PZSA 2DISA 4TQRA 3TW0A 2HVHA 3CIMA 3WT0A 4DHVA 3MCAB 2F8SA 4YY3K 3VQ5A 3TA0A 4D3GA 2VG7A 3G8QA 2ZH8A 4CZLA 3CDBA 5LY3A 2XYPB 5LOQA 1JL2A 2UUAF 4NZ0A 1GEHA 4YOUA 3T5JA 2MKIA 1CJVA 3H45C 1XQSC 1VIOA 3FNNA 4ELTA 4EENA 1ZETA 3OL9A 2RAQA 2LYHA 2J6UA 3GG0A 2DR7A 1JCEA 1UWAA 2UUBK 1UOCA 1NNLA 4QYRA 1S0VA 2E7WA 1U8WA 1BGXT 3MD3A 4ID1A 4FJIA 1W2IA 1VQMN 4DR2K 1XC3A 2HNDB 3BGRA 1B43A 3MMVA 3RWUA 3KOOA 4HVZA 2KJ9A 4YR3A 5J0QA 1FRLA 4C4WA 1Y0HA 2GOLA 4AL5A 3AAPA 4O23A 2UV8A 2WSEC 2V63A 2XBPA 1BIUA 3VQEA 2UUBF 2PN6A 2ZBPA 3GFHA 1Z26A 3H8WA 3G86A 3QIDA 5K8PA 4I2DA 1TQLA 3ZSYA 5GAGU 4DR2F 2E1FA 4IFYA 5HSPA 4JI1F 3FRZA 1SKSA 2GMHA 4R63A 1EP4A 3J81j 1GLLO 4EFAC 3FGVA 1I1GA 2NLXA 4MAKA 4DOBA 3ZZYA 3ENOA 2HWHA 1URRA 4IH6A 3TAEA 5G4DA 2Q0ZX 1FJCA 7ICSA 4ZPAA 4JKGB 3NL0A 4ECSA 4LREA 4QOZB 1FXXA 4ER8A 3ZSVA 4GO5X 2O8CA 5JMVA 1YJNN 4BRNA 1CC7A 3R1HA 2IRXA 3C28A 4IG0B 4R0EA 1XI1A 1IUJA 1VRUB 3MM6A 2ESEA 2WHEA 3PSIA 4O4GA 7ICJA 3MX5A 1EETA 1SJ1A 4WFNL 3AA4A 2VQEF 2ZD1B 1RP5A 1YJ7A 4YB7A 1M5PC 3NLCA 2YQ0A 4RLEA 1J6ZA 3TA2A 4WKRA 1YBUA 4CZEA 3KD3A 3CC4S 1BNPA 3Q2SC 2VC1A 2VCPA 1QDUB 3EE9A 7ICGA 5E33A 1RWOB 3AOCA 3H8SA 3PMNA 2JH3A 3EDQB 9ICTA 4USKA 4C98A 3VAFA 1KD1T 5AZJA 4DFKA 4WU2A 4MF8A 4YDXA 1J5EK 1P9YA 1CQNA 4ED6A 2HBYB 9ICEA 3I5AA 4HVJA 2Y0SF 3D6TB 5AQIA 4DL4A 3E2EA 2HBRB 4JI3K 3G8SA 3TAFA 3OVNA 4DV3J 5J2MA 1C20A 2WONB 1BPXA 3W9JA 2KM8B 3W64A 4UT4A 1RWNB 4EO8A 3HO1A 3T5KA 3NVYA 5D0EA 1R8BA 3L2UA 2BJ8A 2VQFJ 3OY9A 3C14B 3O08A 3W9IA 2B4OA 2B5JA 1MMDA 5A8WA 5JVHQ 3E3XA 4Q8FA 3B8AX 5CCMA 3OL7A 2F9JA 4KLIA 2ASDA 4JBCA 1J5EF 1SQEA 1MA9B 1FESA 1T3VA 4NL5A 1HKGA 4JI3F 3SD7A 1H6KX 4LBIA 1NK0A 4DR3J 1Q8LA 2EG2A 2VFSA 3GB0A 3GZFA 3L4IA 3EZUA 3D3CJ 2BJ7A 4CEOA 1RAOA 2V34A 2OFGX 2PFPA 3DCAA 1ITPA 1XS9D 2DPJA 1E4GT 1QVFR 4OZ5A 4DR7K 3O44A 1REVA 1SB3C 3OSPA 2NSCA 1U02A 3MMBB 2JEIA 3GBTA 5TZVA 3VESA 1NM1A 3TJAA 1DFDA 2Z8QA 1RSCA 1Z00B 2PGCA 2XMVA 1F44A 4GMJB 2HQFA 3CCMN 2V8GA 4A8WA 3BSOA 4OYZA 4ZVSB 4E1MA 1D8BA 4A8FA 4KT0C 3P5BP 3QPIA 3LDAA 3E1YA 3OYBA 1MW7A 4EGLA 3UNYA 3X1LB 2E9RX 5AQKA 2Y8YA 4G9BA 3UE2A 2B6AB 4A8OA 2V9WA 1XMBA 4NL9C 1RWKB 4BHQA 3VGTA 3ZSXA 4DO9A 1NZPA 4M5LA 5CZXA 1A5VA 2J9CA 1M5VC 4F4AA 4L73A 5KFMA 1BPEA 4FS1A 2K1RA 4Y34A 1O13A 4TUSA 1X7VA 2MQQA 3HVAA 1I6JA 4EYIB 2NLWA 3FCHA 1VRTA 4YR2A 2P9LB 4O0JA 5J2QB 1EWRA 2QB0B 4GFJA 5KFTA 5KRSA 1IKYB 5L38A 3SQOP 1XEZA 4CGZA 2DNZA 2IDEA 3UVJA 3N0VA 3GCXP 1RAFB 2NXJA 4HKQA 1RADB 1H7XA 2YKMB 3AARA 2YNFB 1FIQA 3QIPA 4IH5A 2H3IA 3IRXA 5HATA 2FPHX 4QU6A 5T14A 4NLGA 3OS2A 5ALKA 1QAXA 3C6UB 3GJQB 4Q45A 4I1TA 1KQQA 4CRXA 1JL1A 2N7YA 4DQ8A 2ODGA 2LKYA 3JPNA 3H5XA 2RPIA 4BR2A 4PL7A 3A2FA 3CUNA 1T9XA 4Y00A 1OVQA 1I3AA 3SDEB 3OGUA 1ZM3A 1N0VC 2AYMA 1RT6B 3H2LA 2KFNA 2DXDA 4ZTFA 1QZ5A 2JGAA 5KPTA 1B0TA 3PNCA 1SH2A 4ES1A 2MZSA 3UKUA 3JPTA 2XZTB 2H1YA 3CULA 1C1BB 3RZAA 3S6EA 3VN5A 5KFZA 4Q5VA 3CJ4A 4WJBA 5H2FU 1XO1A 1QZ6A 5KG7A 4K4ZA 3NF9A 3NS5A 2DEJA 3D6RA 4WP9A 4USUA 4OX7A 4PHDA 3IC1A 2FMQA 3V6DA 4AM6A 4DSIA 5DS7A 1NOMA 2Y9TA 4CEZA 2IVNA 1NJWA 3ZDAA 9ATCB 1XHXA 3VGKA 3Q22A 1T05B 4U7BA 5ADZA 1F2HA 3L8BA 4MTPA 3KG1A 3CQ8A 3MPUB 1NGDA 4KYZA 4P7TA 2XLIA 2O4GA 3TP2A 2RDDA 2QJ3A 1Y4ZB 1TUGB 3OYHA 3D66A 3LANA 2Y1JA 2Q1NA 4FJGA 3FZHA 3IGNA 2KV2A 4LVSA 3O9RA 2FSKA 3HFKA 3O3GA 4ZCIA 4PL2A 3RBDA 2GVDB 1P6TA 4ECTA 1LWFA 2Z2MA 3QT8A 3MHYA 4I2IA 4UB4A 8ICIA 1K1SA 2D3O1 3IXQA 2FDNA 4QZVB 1M5OC 2WVCA 5DZ6A 4ZVEA 2E9TA 3C65A 5IQ6A 1T0TV 2IVOA 1ZD4A 3BBFA 2CQDA 3ENAA 2IS3A 2G09A 1HYZA 3ID6A 4HAIA 7FDRA 3SMVA 5D49A 9ICCA 3O9SA 3JSRA 2F4VK 2JLGA 5ALRA 4CBXA 3PR4A 4EP4A 1VBKA 3JAMO 4HTLA 2LI6A 1R89A 2NR0A 3NF6A 1YRUA 4BACA 3S1TA 1G15A 2VFRA 4JI1J 3PMLA 2QV6A 4CGDA 5AQHA 2G4BA 2GIFA 2KD1A 4J91A 4WJ3B 2GNKA 4I6WA 4FF1A 4HHHA 1MN8A 4IQMA 4DXLA 5IIOA 2HNDA 2J6SA 3SQGB 2A1BA 4P0QB 1FRKA 3BDPA 2W43A 2MPUA 1WSHA 2MHNA 1YF5L 3FZMA 4YOYA 2F4VF 1K5OA 3NASA 4CO4A 2JRSA 3FKBA 1WAJA 4DN0A 2P5GA 4OJHA 4YOXA 3O1BA 2PXIA 1JJ2R 4FZLA 4F4ZA 2K3IA 1GLCG 2E5LK 5ALLA 2VQEJ 4I4BA 4S0MA 2MKKA 2YN4A 2EFNA 4JHDB 2KXFA 2YCHA 4GVMA 3SI6A 1Q9YA 4CERA 3AVJA 2J9EA 4GW6A 5A0YA 4DU1A 1N33J 1PGZA 3IG1B 4DJBA 4JKGA 3WZ0A 2C3UA 4KJIA 1RHQB 3L7UA 5J2CA 3I28A 3SAHA 1F3FA 1WAFA 2X1GA 2G06A 3B0YA 5ALJA 4PWWA 2E5LF 1JI7A 1DJ0A 3CJAA 4IG0A 1VRUA 2ZUBA 1TR0A 5KFNA 4KMOB 2LU2A 1S5LU 1ZQDA 2WVBA 2RKIB 4CGHA 3NH0A 5ETMA 1CSJA 3AB2B 4WXWA 2ZD1A 2B9WA 3V9ZA 3B78A 3TA1A 2WK4A 4CEEA 3UN2A 4A8MP 4U7UK 2BA9A 2ZH2A 4BWMA 9ICAA 2KH9A 1YVFA 2AW0A 2P9EA 1ZA2B 5DJBA 2D3ZA 2FPLA 1NDPA 4IOAL 2POKA 1JJHA 4IUFA 2AGPA 2R7WA 3WHIA 1PAEX 4JI0K 4OHVA 3SQ0A 2OPSB 1UQVA 4M2YA 3FVYA 2FD2A 4DFMA 1VLYA 2FLPA 4FE3A 1VC6A 3N4PA 2YWFA 4FWMA 1QSSA 4CI0B 3IBCB 2H4WB 4KPYA 3KLVA 4DR6K 4I0WA 4M7YA 4C11B 1XNQJ 1F9EB 4DFJA 2HFOA 2WONA 1HI8A 4LQ3A 4DTSA 2LQ8A 2YKOA 5F3TA 5AXLA 3MEGB 4MHVA 2ZJ8A 4JI0F 4DR4K 1M1GA 3DC2A 4U8VA 5E3AA 5A6PA 3C14A 2NV3A 3CMAS 3C6TB 4RNMA 2VL1A 2MSSA 3WUHA 2HVIA 3ULDA 3CCTA 3I33A 5JLFA 1PG5B 1U1LA 3SJHA 4DR6F 2BQ3A 4USHA 5ADXH 1ZAVA 5KNIA 1AXQA 3VF0B 3T1AA 3AJ1A 5KFHA 4JV1A 3OFFA 1HR0J 3VOVA 2JHDA 3OBWA 4I2GA 1RB0A 1ULRA 4DR4F 2W54A 1WUUA 3SENA 2YPZA 4JKAA 4BE1A 3WX4A 1IWGA 3KK7A 2GQCA 1FFGB 4B3TK 1YTYA 3AD9C 1X9MA 1RDWX 9ICRA 3CC2S 3TZZA 3MMBA 2OI2A 2W6KA 3R6MA 1Q82O 4B9QA 1WF1A 2I1QA 2ZZMA 4G3IA 1Z00A 1BXNA 2F2AB 2JFKA 3KG0A 3ZI4A 1EXQA 5HOOA 1VSKA 3QNNA 4J9LA 2DKOB 4LH4A 2WAQD 4BVPA 5JJBA 1XUPO 4JEPA 2ZUCA 1S6OA 1HKCA 3FYHA 1MN9A 3QEWA 4F9OA 3E66A 2D8CA 1OSDA 3M7VA 2W9CB 3G6ES 1Y88A 3H8MA 1FFWB 2QN6B 5GIPA 3FUYA 2KKPA 3SMSA 2MEWA 5ALTA 2ZVSA 3HD2A 1KQFB 3J7Z5 4RW4B 1RBLA 1SC3B 1MMLA 3C16B 4OX6A 2DH8A 3VQTA 4B3TF 2M9NA 3VQBA 5AQWA 3MEDB 2B6AA 3WK9A 4ZS6A 3R5JB 2L9WA 1MQ2A 1KDNA 2AJ2A 2DNOA 3M1VB 4M9GA 2XHBA 2AXTU 4QW9A 1N56A 1ASUA 4ZLPA 5AE1A 1JWWA 4NXNK 1PYTA 2N82B 1BL3A 5J2IA 3ENQA 3B6PA 1GLEG 3KLFB 2W9AA 2WB4A 1OIAA 1ZBTA 5M1QA 4BG9A 4IDKB 5J1EB 4HCCA 5J2QA 2QB0A 3WBZA 3M6GA 4K4VA 2YKQA 3L2QA 5J2KA 1F5CA 3QEVA 3P39A 3TTCA 2RLTA 1IKYA 4YDUC 3HVRA 1UHUA 3BEXA 4BRLA 1S4FA 4F5OA 4CJFA 4URSA 1ZQRA 4L6V3 2LMIA 2CNKB 1TKZB 4BRIA 2XO7A 2YKMA 2CYYA 5HVGA 2YNFA 3U1NA 3U3GA 3C94A 2GHWA 4TY9A 3LZIA 1ZQSA 2G8KA 2AWZA 3CDUA 1VSEA 4AHCA 4CK3A 1W0HA 1ZH5A 3C6UA 5RUBA 1KVCA 2XY7A 4ILJA 4Z4HA 4GKKK 5JVGQ 4F93B 4XK8C 2A2CA 4AQYF 3PIPL 1A76A 4IRKA 1K73T 2W40A 3R97A 3KYLA 5IT0A 4FXVA 3SDEA 5HNKA 4NWIA 3AVCA 4UY8T 3QGIA 2HURA 1RT6A 2CQ0A 3NEKA 4FL9A 3HJFA 1CVJA 3G2XA 2ALYB 3NBPA 1X0FA 4KLLA 3ADAC 3ZZPA 1AYEA 3NVZA 3L4BC 1X5PA 3HF5A 3WKCA 1C1BA 5E84A 4ZVTB 1KQGB 2G2ZA 4DX8H 2XM3A 3O9TA 2WCXA 1DHMA 3HI9A 3NS6A 3DRXA 5L8RC 2UU9J 4LF9F 1X3NA 4CEBA 2CZ4A 3CCLS 1FDNA 2CDRB 5D6GA 3OXLA 3U9ZA 3L2RA 4I6MB 2K4HA 1VQON 2BCSA 4IYQA 2DHXA 5AQOA 1H1VA 1OH8A 2HHHJ 2HI0A 4OI3A 2BVZA 1ZA1B 4CJKA 1RAIB 2RJZA 1T05A 1H74A 3R9KA 3ATVA 4IC9A 2FJDB 2VWKA 5BPNA 4MFFA 2LQ9A 3TZXA 3KZIU 1EIYB 3UXNA 3OYIA 4FZXC 4BE2A 8ICKA 1VSFA 3L9ZA 4RNFA 3ZD9A 3QAUA 5E3CA 3DHWC 1VAZA 3SBTA 1T44A 3AMZA 4KLOA 4NMLA 2MQPA 2GVDA 3GFYA 2KXNB 3P5TL 1AROP 4M3ZA 1UCVA 4DUZK 3M9MB 5BRFA 2KL8A 4OMFG 2R8GA 1FA0A 3S3OA 1NXIA 1HNWK 4KHYA 3CIPA 1IKWB 1ZS6A 5DGBA 2F8MA 1B92A 4AHUA 2QA1A 3D0PA 3AFGA 2J9DA 2G1DA 4CJ3A 2GX8A 4O3NA 1P1LA 3OBIA 2OPPB 3W5ZA 3KDOA 5B0AA 3R7SB 2GWJA 3B4MA 5F9NA 4KI6A 3LM2A <