5JRTA

Crystal structure of the human tankyrase 2 (tnks2) sam domain (dh902/924re)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
64
structure length
64
Chain Sequence
VDFSITQFVRNLGLEHLMDIFEREQITLRVLVEMGHKELKEIGINAYGHREKLIKGVERLISGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 22
structure length 64
sequence length 64
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jrtA00
2DL0A 3BS7A 2EANA 2ESEA 1SV0A 1B4FA 2E8PA 1KW4A 5F3XB 1UCVA 5JU5A 2DKXA 1F0MA 2QB0A 3KKAC 2GLEA 4NL9C 2ES6A 1SXDA 2KMDA 2F44A 2LPEA 4RQNA 1SGGA 5JRTA 4PZOA 1PK1A 2DKZA 2EAPA 2KE7A 4RQMA 5KNIA 1UQVA 2F3NA 2Y9TA 2QB1A 1RG6A 3H8MA 1OW5A 1Z1VA 3BS5A 3TADC 1JI7A 4IS7A 2KSOA 1PK3A 2YTUA 2F8KA 2E8NA 3BQ7A 2KIVA 2JV3A 2EAOA 3SENA 2EAMA 2QKQA 1DXSA 4NL9A 1SV0C 1B0XA 2KSOB 2QB0B 2K4PA 5J8YA 1V38A 2LMRA 1PK1B 2L5YA 3K1RB 1WWUA 5JTIA 1SV4A 1X40A 1V85A 4MHVA 2FE9A 2Y9UA 1SXEA 3KKAA 2QARA 4PZNA 2D8CA 3BS5B 1LKYA 3TACB 1X9XA 3HILA 3SEIA 1COKA 2QARB 5L1MA 2KG5A 1WWVA 1LKYB 3IDWA 2E8MA 1X66A 2E8OA 4NJ8A 2D3DA 2B6GA 3TADA 5J8YC 1OXJA 2K60A
chains in the Genus database with same CATH superfamily
5EOZA 5AM0A 2G5HB 4IL6U 4KN7A 4ED2A 3T5JA 5KG5A 3EUB2 3PX0A 8ICVA 2BQUA 2BDPA 3PY8A 3SQIA 8ICNA 1KFDA 5A0LA 3MBYA 1U48A 3Q8LA 5KFEA 2W9BA 2FMSA 4PJ0U 4C8LA 4DO9A 3V6KA 3C21A 4YFKA 4O3MA 9ICNA 5KFHA 2W04A 4F4WA 2OEHA 5CWRA 1ZQMA 1RYSA 4DF8A 1XSLA 5KFYA 2AGPA 5B5EU 3ETRA 4RPYA 3PW0A 4Z6EA 4RQ1A 1S97A 9ICBA 2EAMA 4DQIA 4EBEA 7ICHA 3F2BA 1J2MA 3PO4A 3I76A 3WKDA 5DB6A 3N7PD 2CXYA 4IC9A 9ICUA 5J2CA 2UVRA 4DOCA 4RPXA 3MFIA 5AIBA 5DG7A 4QIWC 5ALOA 1WWUA 5JTIA 5KFWA 5CP2A 5AI6A 2M9NA 4O3NA 1A77A 5J2JA 4UAZA 4DSFA 4I2CA 1RDFA 3KHGA 3NASA 4EEYA 1BPDA 4UB5A 2KG5A 2RP5A 3KHHA 2CPRA 4NJ8A 5HR7A 4B9TA 1T3QA 1A0PA 2DF4B 2OWOA 2AXTU 1XSPA 4F5PA 1D8BA 4O5KA 1H38A 1XC9A 1S76D 1UA0A 2ESEA 4I28A 3UM9A 4RQ7A 3WKAA 5AKEA 4F5OA 4J03A 5KFJA 3H0RB 4I2FA 7ICLA 3KKAC 2Y0SC 5KFIA 4O3OA 2ES6A 5KFDA 4EEKA 1L5UA 4DSLA 3NUQA 4ED8A 8ICFA 1YT3A 2DKZA 1ZQWA 3D2NA 1K5OA 7ICSA 2BCQA 3R9KA 2NRWA 1FO4A 5ALHA 3RRHA 4C8OA 2R8GA 1WCLA 1NJXA 2YTUA 4US9A 4F71A 5D4BA 1F5SA 4DFPA 4UBCA 2HCFA 1KSPA 2ZIVA 1WCNA 5L1KA 2LHTA 1O08A 3MGHA 3LDAA 3HPOA 4RT2A 9ICVA 2BR0A 4P4MA 2PI5A 3VCBA 2ZIVB 8ICEA 1JMSA 4O3RA 2WF7A 1NZBA 4QWDA 1MA7A 1TAUA 5DGBA 2LYAA 1RXVA 1GO3F 1SXEA 3RJJA 2C2EA 5L1IA 1D8YA 1ZQBA 2FLNA 3V7KA 3BQTA 1S10A 4TQSA 1ZQPA 2VA8A 1N5XA 3N28A 1QQ5A 4U6PA 2EZXA 4OJOA 9ICLA 2E8MA 1S0NA 2E8OA 2R18A 3QU9A 1C7YA 1ZQNA 2GH1A 4I2HA 5HR6A 4DQSA 2MAXA 5J2GA 4ED7A 3UMGA 4EELA 2FLLA 4F5RA 2WB1C 5AM1A 1A6SA 3SV4A 2R8HA 3GQCA 4BX9C 4UATA 8ICLA 3M6KA 2DFLA 5AM2A 4IR1A 1B22A 3CYMA 5KFBA 1BPZA 1L7PA 1ZQOA 4RNOA 4RQNA 4KMOB 3IG8A 2JRZA 3QZ7A 4E0DA 4KLLA 5AI8A 5KFTA 5J0RA 5IIIA 5KTQA 3RJIA 1JXEA 2ZG6A 5DB8A 3IRUA 3ISDA 3H8MA 2ZUBA 4ED1A 5KT4A 2MUTA 3GV8B 1ZQSA 2LI6A 2AJQA 2DBYA 1T8EA 3HW8A 3RB0A 4F5QA 3C1YA 3UXOA 5AKHA 4B9LA 3HKZC 5J0SA 1Z00A 2G06A 2W9AA 2GWSA 1X2IA 4B9SA 3VC8A 4QWAA 2JHDA 2KK0A 2XO7A 3L5KA 3QUTA 4B6JA 3NTUA 2RRDA 2ZJ8A 2KV2A 5AK3A 1Z00B 2P66A 1ZQFA 2R8IA 3CW2C 2H3ZA 2H3FA 5KFKA 4DCCA 3E2EA 4PGXA 1SZPA 3HILA 3C2KA 4RNMA 1UT5A 7ICTA 1UPHA 2ZTCA 2W7OA 5J2EA 2ZTDA 2BGWA 5KFFA 2YMMA 1U4BA 4KLMA 4PL1A 1NI3A 4R65A 3WU2U 4JMUA 7ICPA 4ECWA 8ICPA 4HYKA 4ELUA 1ZXIA 3V6JA 4F4KA 4YXMA 3F5EA 2ZJ5A 5CA7A 1XSNA 2KD1A 2C28A 4ECUA 1PVPA 4R8UB 4C0ZA 5J0QA 4DOAA 1MSWD 1DRGA 4KLGA 2KZMA 1RM6C 2VA3A 3GFKB 3QZ8A 8ICBA 1K1QA 5ALJA 2YY6A 4TUSA 2PFQA 5AKYA 1RG6A 2KJ8A 5AICA 4QZ8A 3MR6A 4RPZA 3RAQA 4NLKA 3F2DA 1RYUA 4ED3A 2RHFA 3SR6A 4MFFA 4F4YA 2ATLA 2ZXIA 2UVUA 9ICXA 1BNPA 4PL2A 4J9NA 1WUDA 1XWLA 3WKBA 3PW2A 3ZDCA 2AGOA 5J0UA 2F8LA 4KITB 4DSIA 4ACOA 2HHUA 5KT6A 3TFSA 2A1AA 4KLUA 3H7IA 4RQ4A 4OJPA 3WKEA 2F77X 4F4XA 1TK0A 4KTQA 4F72A 4QZEA 5HP4A 2P35A 2YX8A 4DOBA 1X9SA 3GZFA 5C5JA 1ZQXA 4ECTA 1COKA 3N97B 8ICWA 2HDOA 4Z6FA 2KN7A 4OD0A 2V4RA 2FDRA 2FPKA 1T94A 7ICKA 2H5XA 5H2FU 5ALUA 3GIJA 4QNLA 9ICPA 5CHGA 2B6GA 4O5EA 4UB1A 3ZDDA 5L1LA 9ICRA 1SL1A 5EWEA 4FZMA 1KN5A 2HHTA 2W9CA 2G09A 5DB9A 2H3QA 5IIKA 4GXJA 3QU5A 1SV0A 5KFSA 4OCZA 2W9CB 2JH7A 5F3XB 1N62A 2LYBA 5AM4A 3KFUF 2KICA 5EWFA 1ZQTA 1L6NA 4G3IA 3E58A 5K4LA 2JH1A 3A0HU 4QZGA 2XI9A 4UW9A 4PZOA 4RQ0A 4FFDA 4DLEA 5AKLA 5DB7A 3UQ0A 4GXIA 3TAPA 3D6JA 3UMCA 5KAIU 4TURA 3JPOA 2XIDA 1ZQQA 4M0AA 4Q43A 1Y88A 3T5KA 4I2AA 5KG7A 1ZQRA 3NVYA 1ZQZA 4Y2PA 4RT3A 2E8NA 1YZ7A 1CRXA 2UVVA 3PX6A 2WTFA 1N60A 4UARA 4Y2RA 4EZ6A 5J8YA 1V38A 5AI9A 2DQNB 5KFXA 2K89A 3RH4A 3PSFA 3EPGA 1CI4A 3BJYA 4US8A 3RJFA 9ICTA 2JEIA 1SV4A 4QIWF 5GTHU 3DV9A 5J2BA 4ECVA 8ICOA 2AQ0A 2RLTA 2KHVA 4P4OA 2ZIXA 2LBOA 4FBTA 1FFUA 1X9XA 5FP0A 2ALZA 1U45A 1X6JA 3WKCA 2PMZC 5ALYA 3RH6A 3M9MB 4FZNA 4DL2A 3NRWA 2ZIXB 1TV9A 2P6RA 4Z6CA 3K4GA 3N4MB 2E1FA 3M1YA 3C5GA 1MC8A 4P4PA 3TADA 1Z4OA 3LYSA 3FYHA 3BS7A 5BOMA 4KLDA 8ICTA 2B21A 5HHHA 3HP6A 1S5LU 5ALGA 7ICVA 1CUKA 5J2AA 4DLGA 5AI0A 3HRDD 2HBLA 7ICEA 3FDSA 2YMQA 1IV8A 3C23A 1X9MA 2BPGA 4KLQA 2A1JB 3K1ZA 4DS4A 1N5WA 5CJ7A 3PW7A 2MA1A 2Y0SF 1FFVA 2YB1A 5DQHA 1PK1A 3C2MA 2PXIA 5ALZA 2CN1A 1ZQGA 2Z7JA 5KT7A 5DKWA 2N1RA 4KLFA 3OPXA 5DQGA 2WAQC 2EZZA 1U9LA 2KIVA 4NM1A 4ZH4A 1ZQJA 1AQ6A 2BCRA 1SB3C 4QZIA 1B0XA 5HMLA 3C28A 4CCHA 4F3OA 1ZD4A 3KD3A 3NS1A 5KG2A 4MEYA 1QH9A 2AGQA 2W9BB 3SAFA 1D8LA 4YXJA 5D49A 1NK5A 4Y2SA 4DFDA 5AIAA 3Q8SB 5EE9A 3ZDAA 3RJHA 3ZD9A 5ALLA 5J0YA 4NV0A 1KKXA 4PHEA 2M0NA 5KFLA 4KLOA 1NZPA 2K8AA 4BGDA 3NVVA 4Y2XA 4B9MA 8ICKA 2KFZA 3OJUA 5KFOA 2BDUA 2FI1A 3RB6A 2YN4A 4M9LA 4UAUA 4ECRA 2BCVA 2BCSA 3PMLA 9ICFA 8ICUA 1NJZA 3SI8A 1JUDA 9ICKA 4AYBC 4HAIA 3D2QA 2IMWP 2QLTA 1VLBA 2WB1F 2MRLA 5J2HA 2NV3A 3M7DA 5JU5A 2DKXA 1U47A 3PO5A 4YN4A 5J2FA 4O5CA 2IOHA 2LYHA 4NL9C 3M8RA 2KMDA 2H3IA 3V7LA 4R63A 4XUSA 2JXJA 5KNIA 1QSSA 4F92B 1RZTA 5ALXA 4GC6A 3RAXA 4YR2A 9ICJA 2V9WA 2XCPA 4YMOA 3M9OB 4TUPA 4MFAA 3PX4A 4FE3A 1JI7A 1Q3UA 5DDYA 3WK5A 1Q8KA 2W3RA 3BQ7A 2K8CB 1WG8A 2NRVA 4UB3A 4MFCA 4C80A 3GU3A 1JX4A 1PZNA 2RQ5A 7ICOA 3OHAA 4CNQA 3JPPA 1XNSA 4ECYA 4O3QA 5AKZA 3I28A 8ICAA 3T3FA 2L5YA 3HKZF 4UB4A 8ICYA 3IM1A 4IQTA 3RR7A 1XU4A 5DBAA 1S0MA 1SWWA 1B43A 4C4TA 1T7PA 2W8KA 3C1ZA 3N7RC 2K4EA 3HJEA 4XQ8A 3GV7B 4UB2A 2FLPA 3PW5A 5AK5A 4KLHA 1QSLA 1F44A 7ICMA 1LVHA 4IR9A 1ZQ1C 4F2SA 3ORYA 1FEZA 1DK2A 4QJFB 5ALMA 2NYVA 5L9XA 3KHLA 4P2HA 4QWBA 1ZETA 1D9DA 3AQEA 3G6VA 5KFRA 4Q8EA 1KBUA 3JPTA 1JROA 8ICQA 4P0QA 1N48A 2XGPA 3CP8A 5J29A 1HEKA 3E0FA 1NKBA 1QTMA 7ICGA 4FZLA 1QLNA 4P0QB 3PMNA 2Y9TA 2J6UA 2ZXHA 5J0PA 3PW4A 4B9NA 1OW5A 2KVCA 4BWJA 1HIWA 2AHOB 1PK3A 5IIOA 2DWQA 5KFCA 1KQQA 5DG8A 2BQ3A 4K4HA 4DSJA 5HNKA 3C29A 2PI4A 1S8OA 1VDVA 3TQ1A 1TE2A 2Y1JA 1WYGA 1JXLA 5KG6A 1ZQIA 3BQ1A 3UXPA 3IV6A 2A3VA 3KZIU 2VIXA 1XS9D 2KOBA 1SKSA 1JALA 1LKYA 4FO6A 3TACB 3MDCA 2MUTB 2GO7A 2YQEA 4QZBA 2BCUA 1LKYB 4JWNA 1X66A 2IA6A 5AKGA 1OUQA 4JK1A 5KFVA 3L4PA 5ALNA 5IINA 9ICOA 1OXJA 2GOLA 4M9GA 2OXOA 5AM3A 3QXGA 1DGJA 5ALWA 3MGVA 2OCEA 2AQ4A 2EANA 2DGZA 1ZQUA 3AL0B 5CRXA 3V72A 4MF8A 1IXRA 2EH9A 2IHMA 4RUAA 4FS1A 2J6SA 4JV0A 3OHBA 3MR2A 1SGGA 3HX0A 5F9LA 3RH5A 4OJLA 9ICHA 5J2DA 4QZCA 4F50A 4C8KA 3IG5A 4O0IA 1KFSA 3QUBA 4YR3A 3EYZA 2BQRA 2KVSA 3B9JA 2IBKA 1XO0A 4FBUA 2C2RA 2NO4A 1YZ6A 1VJ5A 4EYIB 4YG2A 1URJA 3LK9A 4Y2UA 2XC9A 3TKAA 1IIPA 4WJ3B 2HBMA 3H4BA 4NXZA 4BXOA 2KP7A 2HBJA 5TZVA 4AP9A 8ICXA 1C20A 4DQQA 2C2DA 3C5FA 4ELTA 1Q46A 2K8BB 1X40A 3WK7A 1JRPA 7ICNA 5AHXA 2Y9UA 1DGSA 2F1JA 4J9QA 2QARA 2C22A 4MF2A 3AN1A 1RYRA 2ASDA 1TVAA 2XY7A 1SWVA 3QUCA 4X5VA 3V7JA 2QARB 2I1QA 5ALPA 3GIMA 5KFUA 5KG4A 2E5SA 2ASJA 5ALKA 3QNMA 2PMZF 4G9BA 2NRXA 3PR4A 2BKEA 1ZQLA 1ZQDA 4Y2JA 1ZD3A 4F4ZA 3SYZA 4J9OA 4NLGA 5ALRA 5ALIA 8ICCA 2EZYA 1V9PA 3DDHA 4I29A 5KG1A 2E8PA 4YP3A 3PV8A 2W55A 1KW4A 2F76X 8ICMA 4MEXA 1L3TA 2QB0A 3AMZA 2GLEA 4NWIA 3KBBA 5AKXA 2JR5A 4PPXA 2W43A 9ICQA 2ZTEA 2BPFA 3QE9Y 4J9MA 3HT3A 3AUOA 1TK8A 3MABA 4J9PA 2XGQA 1NNLA 4RQMA 3MR5A 3T5LA 2WFAA 2W03A 2WF9A 4Y2QA 2VKQA 4C8MA 3ISCA 1JN3A 8ICGA 2HBKA 4DSEA 2ZJAA 5AI5A 4KLSA 1J2NA 4UB6U 2FPMA 2EAOA 3RTVA 3J81j 1T4GA 2WAQF 4CF4A 1HUOA 5KAFU 2Q0ZX 1DXSA 4NL9A 3SAGA 3NVWA 4NLBA 3UPQA 3RBDA 4FS2A 4IQUA 2W3SA 1PVQA 4NY8A 4ECSA 5DG9A 3K1RB 1M6YA 4YCXA 5G5HA 1NK9A 3KKAA 5EE1A 2XY5A 4EX6A 5DGAA 1HUZA 2E1EA 4J9RA 2MSNA 2FMQA 5DQIA 4LZDA 4GLXA 4EYHB 1NK6A 5AK4A 4UASA 4GXKA 4UBBA 4ECXA 4QZ9A 4CGZA 2KJ5A 2G0AA 4JV2A 4DWIA 4AYBF 1TK5A 2HHXA 4DFKA 1SL2A 1SKWA 5KT2A 3EWAA 1Z19A 2KTQA 1UCVA 1XO1A 1F0MA 2HVHA 2HHQA 5T14A 5KG3A 1NJWA 4CF5A 4M6WA 1U49A 2WF8A 4C8NA 5DBBA 2G5IB 2YB4A 3O0FA 5KL1B 1KFTA 2IOFK 2F3NA 3H40A 4M6WB 2Y1IA 3Q8QB 2QB1A 1L3UA 4PHAA 2ZUDA 3BS5A 2F1HA 4NLNA 2ZUCA 2XCAA 5ALSA 1HJPA 2F8KA 5EE0A 2NO5A 2PKEA 2QKQA 3KTQA 5DDMA 8ICRA 1ED1A 4CDGA 3FAHA 2G07A 2J6TA 5AI4A 2UVWA 2F2AB 1N56A 3AU6A 3L3FX 1Z3EB 1PK1B 2FJ6A 5DBCA 3Q8PB 2ASLA 3KZXA 3FC4A 4KX5A 4QW9A 4B9UA 5C0YA 1X42A 1SZHA 2Q4TA 3SEIA 1SL0A 1ZQYA 1QQ7A 3D2SA 3PR5B 1MN8A 3RBEA 3IDWA 5KFMA 4UAYA 4GFJA 4EBCA 3QX7A 3M8SA 7ICFA 5ALEA 4JB3A 4DS5A 4QZAA 4JUZA 4RU9A 9ICSA 4K4GA 2DUYA 5KT3A 4DF4A 5E79U 2AH5A 1ZJMA 1RQNA 1D9FA 3BQ0A 4F8RA 3ONNA 3OJSA 3BDPA 1UT8A 1NKEA 1NK4A 4I27A 1O03A 1BGXT 4PGQA 2F44A 2LPEA 8ICSA 5JRTA 8ICHA 4KN4A 1UQVA 3N7SC 1PUZA 3RB3A 4I2EA 2KHQA 4KLJA 3IP4B 5IILA 4IRKA 1ZQVA 3MGIA 1V97A 4C4SA 2R8JA 9ICEA 7ICUA 2V4QA 3QU7A 5J0TA 1SV0C 3JPQA 3RJEA 4QW8A 4QWEA 5B66U 4DL4A 3BQ2A 3QEAZ 4QZDA 4DL3A 1L7NA 4Y2YA 3PSPA 3G6YA 4UAWA 2JMGA 1ZQKA 4DQPA 2MU2A 3F2CA 3DEEA 1ZQAA 2HW3A 3QU4A 3G6XA 2VJ5A 4RQ8A 5IIMA 2PFPA 2HOQA 3SMVA 4P0PA 4C7ZA 2KIWA 4CRXA 4I2BA 1Q3VA 3GDXA 4XA5A 3GV5B 2NRTA 3PNCA 4EX7A 2HSZA 3QU2A 1ZYQA 5BPCA 1N61A 4P0PB 2XY6A 5J8YC 3NRZA 1TAMA 3WK6A 2DL0A 4EENA 4M9HA 2ZIUA 4Y2VA 3ISBA 4M2YA 3THVA 2WF5A 3RJKA 3CNHA 2ISPA 2ZIUB 4GC7A 5JUMA 4PHDA 3OSNA 2WHEA 3TARA 2K4HA 4TQRA 2KE7A 3NVZA 1L8LA 5KG0A 3CRXA 3PSIA 3PSTA 3JPSA 5ALVA 1ECWA 4RZRA 3MC1A 4ECZA 1ZD2P 2HHVA 5KFZA 3TADC 4USAA 4IS7A 1Z1BA 5KFNA 3TAQA 1BPEA 5GTIU 5ALQA 4BWMA 4QZFA 4LVSA 5L1JA 4Q45A 3A0BU 2O6KA 2JEGA 3H4DA 2JZBA 3ICXA 1L3VA 4ZOHC 3HWTA 9ICWA 2LMRA 2R8KA 1L7OA 1L8OA 2JZBB 8ICZA 1V85A 4MHVA 9ICIA 4K4IA 1CEZA 2JEFA 4BUGA 2D8CA 3TI0A 4YMNA 4ED0A 2WF6A 2G08A 4F2RA 5KFPA 3H8SA 5KFAA 3ETLA 2W54A 2KFNA 1RPLA 3AM9A 3ZDEA 2VA2A 4DFMA 2D3DA 2NRZA 5AK6A 3B0YA 1DOQA 4GIBA 5ALTA 1ZQHA 2K60A 5J2KA 3M6ZA 4BJQA 2KKVA 3JPNA 2HVIA 1J97A 3B0XA 4DSKA 2HI0A 3LWLA 2PFOA 3TANA 4UQGA 1ZQCA 5ALFA 2YMLA 3SV3A 2XICA 2HMXA 1ZOLA 3S6JA 3RF9A 3KHRA 1L7MA 1SXDA 2BZFA 7ICIA 1X6IA 4ED6A 2HHSA 4DL5A 1KEJA 1NK7A 3BZCA 2W7PA 4KLIA 1LB2B 1EXNA 2VJ4A 4YR0A 4M9JA 8ICJA 3SENA 4LZGA 5CB1A 5J0OA 2K4PA 3EPIA 5KFQA 4M9NA 3QYPA 7ICRA 1MQ3A 1X9WA 2IOFA 4RQ6A 1ZD5A 4BDPA 2EQYA 1KDHA 4I2JA 3UXNA 4ECQA 3ED5A 2ODGA 2HHWA 4OJ6A 4KX3A 3U26A 4RNNA 3PZPA 1JIHA 2VANA 4DL7A 4C7YA 3UMBA 1ZQEA 3TFRA 4JV1A 4B9VA 3H8WA 1NOMA 4PGYA 1N2XA 4M47A 5AKIA 4R66A 1AROP 3M9NB 3LWMA 1TFRA 1N63A 4R8UA 3WK4A 3RB4A 4ELVA 9ICMA 4O3SA 1KRPA 4YVZA 3H0MB 5KL8B 5AKKA 1RQLA 4BXOB 1NK8A 1TKDA 4EZ9A 4OO1J 4I2DA 1Z4NA 1BVSA 4ICAA 2KKPA 4OJ5A 3SZ2A 3FM9A 4Q44A 5KFGA 1B4FA 4Q8FA 4XRHA 2HOIA 2DPIA 3ZDBA 2AU0A 2I9GA 4KLEA 1ZRNA 5DLGA 7ICQA 4F5NA 9ICAA 4NLZA 5HMMA 3C2LA 3LVWA 1PVRA 4J9KA 4CF3A 1DK3A 3GIKA 3WK9A 2EAPA 4LJXA 1L3SA 5BOLA 4DL6A 2RDJA 4U7CA 2OHFA 1UHUA 5J2IA 4I2GA 4TUQA 3SD7A 1Z1VA 5ALDA 4KMUA 2FMPA 2KSOA 4JWMA 1QCKA 3AQFA 2B0CA 4RUCA 2JV3A 1S9FA 8ICIA 3Q8MA 7ICJA 1IM4A 4IQWA 4YD2A 2KSOB 3F5AA 4IRCA 2QB0B 1BPYA 3RJGA 5AKJA 2OM6A 1A76A 4UB8U 5TISU 3NGDA 2D6FC 1FIQA 4O3PA 1COOA 3H0LB 1RXWA 1SIJA 3F53A 4PH5A 1P7DA 3Q8KA 3JPRA 3EW9A 3UQ2A 3GILA 3KOOA 2F1IA 4QZHA 1IG6A 2W11A 4PZNA 2LM1A 4DQRA 4C4RA 4KLTA 2JEJA 1KL9A 3OGUA 3ALRA 5IIJA 4RQ2A 2OH2A 4NLCA 5L1MA 1QQ6A 1WWVA 3K75D 4EBDA 5KT5A 4J9LA 1BPXA 4M04A 3MFHA 2KJ9A 3LVVA 1SKRA 2E3TA 5CEHA 5AM5A 1NK0A 3ZI4A 4A8EA 3Q8RB 2K4IA 2P6UA 2DPJA 1QSYA 3AEVA 3H8JA 2YMPA 2I6XA 4J9SA 4UAVA 1MQ2A 1TAQA 3RR8A 1S0VA 3OSPA 3V6HA 2FPLA 4DFJA 2KZZA 1NJYA 2OYYA 2IHNA 2HOFA 4NM2A 3T79A 2KEYA 2RDIA 2EDUA 2ISOA 3SAHA 1K1SA 5J0WA 3I1YA 2W9MA 4IQVA 1BNOA 3RRGA 5CR0A 4IRDA 4CE6A 3MR3A 2LKYA 1LV5A 4YQWA 1S0OA 4YMMA 1T3NA 2BPCA 5J0XA 2ZIWA 9ICGA 2KZ3A 2I5HA 3GIIA 3AU2A 4R64A 3IN5A 4QWCA 2A19A 3ZD8A 2ZIWB 1UA1A 1KTQA 3BZKA 4PHPA 1BPBA 5G5GA 2BHNA 3OTQA 2LM4A 2JGAA 4Z6DA 5F9NA 2KNJA 1KLNA 2XVTA 2FE9A 3QUQA 2CRXA 3QEBZ 5EWGA 1NKCA 1ZJNA 3BS5B 2A1JA 3PVXA 3EZ5A 4RQ5A 4DEZA 4YD1A 5EE3A 1S77D 3IHQB 4F91B 4I2IA 5HHIA 4O9MA 9ICCA 4F93B 1ZRMA 5DLFA 2PFNA 5D46A 3RFAA 2W8LA 2H3VA 4RQ3A 3T5HA 4Y2TA 3MDAA 3WK8A
chains in the Genus database with same CATH topology
2DL0A 3BS7A 2EANA 2ESEA 1SV0A 1B4FA 2E8PA 1KW4A 5F3XB 1UCVA 5JU5A 2DKXA 1F0MA 2QB0A 3KKAC 2GLEA 4NL9C 2ES6A 1SXDA 2KMDA 2F44A 2LPEA 4RQNA 1SGGA 5JRTA 4PZOA 1PK1A 2DKZA 2EAPA 2KE7A 4RQMA 5KNIA 1UQVA 2F3NA 2Y9TA 2QB1A 1RG6A 3H8MA 1OW5A 1Z1VA 3BS5A 3TADC 1JI7A 4IS7A 2KSOA 1PK3A 2YTUA 2F8KA 2E8NA 3BQ7A 2KIVA 2JV3A 2EAOA 3SENA 2EAMA 2QKQA 1DXSA 4NL9A 1SV0C 1B0XA 2KSOB 2QB0B 2K4PA 5J8YA 1V38A 2LMRA 1PK1B 2L5YA 3K1RB 1WWUA 5JTIA 1SV4A 1X40A 1V85A 4MHVA 2FE9A 2Y9UA 1SXEA 3KKAA 2QARA 4PZNA 2D8CA 3BS5B 1LKYA 3TACB 1X9XA 3HILA 3SEIA 1COKA 2QARB 5L1MA 2KG5A 1WWVA 1LKYB 3IDWA 2E8MA 1X66A 2E8OA 4NJ8A 2D3DA 2B6GA 3TADA 5J8YC 1OXJA 2K60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL0 A;  3BS7 A;  2EAN A;  2ESE A;  1SV0 A;  1B4F A;  2E8P A;  1KW4 A;  5F3X B;  1UCV A;  5JU5 A;  2DKX A;  1F0M A;  2QB0 A;  3KKA C;  2GLE A;  4NL9 C;  2ES6 A;  1SXD A;  2KMD A;  2F44 A;  2LPE A;  4RQN A;  1SGG A;  5JRT A;  4PZO A;  1PK1 A;  2DKZ A;  2EAP A;  2KE7 A;  4RQM A;  5KNI A;  1UQV A;  2F3N A;  2Y9T A;  2QB1 A;  1RG6 A;  3H8M A;  1OW5 A;  1Z1V A;  3BS5 A;  3TAD C;  1JI7 A;  4IS7 A;  2KSO A;  1PK3 A;  2YTU A;  2F8K A;  2E8N A;  3BQ7 A;  2KIV A;  2JV3 A;  2EAO A;  3SEN A;  2EAM A;  2QKQ A;  1DXS A;  4NL9 A;  1SV0 C;  1B0X A;  2KSO B;  2QB0 B;  2K4P A;  5J8Y A;  1V38 A;  2LMR A;  1PK1 B;  2L5Y A;  3K1R B;  1WWU A;  5JTI A;  1SV4 A;  1X40 A;  1V85 A;  4MHV A;  2FE9 A;  2Y9U A;  1SXE A;  3KKA A;  2QAR A;  4PZN A;  2D8C A;  3BS5 B;  1LKY A;  3TAC B;  1X9X A;  3HIL A;  3SEI A;  1COK A;  2QAR B;  5L1M A;  2KG5 A;  1WWV A;  1LKY B;  3IDW A;  2E8M A;  1X66 A;  2E8O A;  4NJ8 A;  2D3D A;  2B6G A;  3TAD A;  5J8Y C;  1OXJ A;  2K60 A; 
#chains in the Genus database with same CATH topology
 5EOZ A;  5AM0 A;  2G5H B;  4IL6 U;  4KN7 A;  4ED2 A;  3T5J A;  5KG5 A;  3EUB 2;  3PX0 A;  8ICV A;  2BQU A;  2BDP A;  3PY8 A;  3SQI A;  8ICN A;  1KFD A;  5A0L A;  3MBY A;  1U48 A;  3Q8L A;  5KFE A;  2W9B A;  2FMS A;  4PJ0 U;  4C8L A;  4DO9 A;  3V6K A;  3C21 A;  4YFK A;  4O3M A;  9ICN A;  5KFH A;  2W04 A;  4F4W A;  2OEH A;  5CWR A;  1ZQM A;  1RYS A;  4DF8 A;  1XSL A;  5KFY A;  2AGP A;  5B5E U;  3ETR A;  4RPY A;  3PW0 A;  4Z6E A;  4RQ1 A;  1S97 A;  9ICB A;  2EAM A;  4DQI A;  4EBE A;  7ICH A;  3F2B A;  1J2M A;  3PO4 A;  3I76 A;  3WKD A;  5DB6 A;  3N7P D;  2CXY A;  4IC9 A;  9ICU A;  5J2C A;  2UVR A;  4DOC A;  4RPX A;  3MFI A;  5AIB A;  5DG7 A;  4QIW C;  5ALO A;  1WWU A;  5JTI A;  5KFW A;  5CP2 A;  5AI6 A;  2M9N A;  4O3N A;  1A77 A;  5J2J A;  4UAZ A;  4DSF A;  4I2C A;  1RDF A;  3KHG A;  3NAS A;  4EEY A;  1BPD A;  4UB5 A;  2KG5 A;  2RP5 A;  3KHH A;  2CPR A;  4NJ8 A;  5HR7 A;  4B9T A;  1T3Q A;  1A0P A;  2DF4 B;  2OWO A;  2AXT U;  1XSP A;  4F5P A;  1D8B A;  4O5K A;  1H38 A;  1XC9 A;  1S76 D;  1UA0 A;  2ESE A;  4I28 A;  3UM9 A;  4RQ7 A;  3WKA A;  5AKE A;  4F5O A;  4J03 A;  5KFJ A;  3H0R B;  4I2F A;  7ICL A;  3KKA C;  2Y0S C;  5KFI A;  4O3O A;  2ES6 A;  5KFD A;  4EEK A;  1L5U A;  4DSL A;  3NUQ A;  4ED8 A;  8ICF A;  1YT3 A;  2DKZ A;  1ZQW A;  3D2N A;  1K5O A;  7ICS A;  2BCQ A;  3R9K A;  2NRW A;  1FO4 A;  5ALH A;  3RRH A;  4C8O A;  2R8G A;  1WCL A;  1NJX A;  2YTU A;  4US9 A;  4F71 A;  5D4B A;  1F5S A;  4DFP A;  4UBC A;  2HCF A;  1KSP A;  2ZIV A;  1WCN A;  5L1K A;  2LHT A;  1O08 A;  3MGH A;  3LDA A;  3HPO A;  4RT2 A;  9ICV A;  2BR0 A;  4P4M A;  2PI5 A;  3VCB A;  2ZIV B;  8ICE A;  1JMS A;  4O3R A;  2WF7 A;  1NZB A;  4QWD A;  1MA7 A;  1TAU A;  5DGB A;  2LYA A;  1RXV A;  1GO3 F;  1SXE A;  3RJJ A;  2C2E A;  5L1I A;  1D8Y A;  1ZQB A;  2FLN A;  3V7K A;  3BQT A;  1S10 A;  4TQS A;  1ZQP A;  2VA8 A;  1N5X A;  3N28 A;  1QQ5 A;  4U6P A;  2EZX A;  4OJO A;  9ICL A;  2E8M A;  1S0N A;  2E8O A;  2R18 A;  3QU9 A;  1C7Y A;  1ZQN A;  2GH1 A;  4I2H A;  5HR6 A;  4DQS A;  2MAX A;  5J2G A;  4ED7 A;  3UMG A;  4EEL A;  2FLL A;  4F5R A;  2WB1 C;  5AM1 A;  1A6S A;  3SV4 A;  2R8H A;  3GQC A;  4BX9 C;  4UAT A;  8ICL A;  3M6K A;  2DFL A;  5AM2 A;  4IR1 A;  1B22 A;  3CYM A;  5KFB A;  1BPZ A;  1L7P A;  1ZQO A;  4RNO A;  4RQN A;  4KMO B;  3IG8 A;  2JRZ A;  3QZ7 A;  4E0D A;  4KLL A;  5AI8 A;  5KFT A;  5J0R A;  5III A;  5KTQ A;  3RJI A;  1JXE A;  2ZG6 A;  5DB8 A;  3IRU A;  3ISD A;  3H8M A;  2ZUB A;  4ED1 A;  5KT4 A;  2MUT A;  3GV8 B;  1ZQS A;  2LI6 A;  2AJQ A;  2DBY A;  1T8E A;  3HW8 A;  3RB0 A;  4F5Q A;  3C1Y A;  3UXO A;  5AKH A;  4B9L A;  3HKZ C;  5J0S A;  1Z00 A;  2G06 A;  2W9A A;  2GWS A;  1X2I A;  4B9S A;  3VC8 A;  4QWA A;  2JHD A;  2KK0 A;  2XO7 A;  3L5K A;  3QUT A;  4B6J A;  3NTU A;  2RRD A;  2ZJ8 A;  2KV2 A;  5AK3 A;  1Z00 B;  2P66 A;  1ZQF A;  2R8I A;  3CW2 C;  2H3Z A;  2H3F A;  5KFK A;  4DCC A;  3E2E A;  4PGX A;  1SZP A;  3HIL A;  3C2K A;  4RNM A;  1UT5 A;  7ICT A;  1UPH A;  2ZTC A;  2W7O A;  5J2E A;  2ZTD A;  2BGW A;  5KFF A;  2YMM A;  1U4B A;  4KLM A;  4PL1 A;  1NI3 A;  4R65 A;  3WU2 U;  4JMU A;  7ICP A;  4ECW A;  8ICP A;  4HYK A;  4ELU A;  1ZXI A;  3V6J A;  4F4K A;  4YXM A;  3F5E A;  2ZJ5 A;  5CA7 A;  1XSN A;  2KD1 A;  2C28 A;  4ECU A;  1PVP A;  4R8U B;  4C0Z A;  5J0Q A;  4DOA A;  1MSW D;  1DRG A;  4KLG A;  2KZM A;  1RM6 C;  2VA3 A;  3GFK B;  3QZ8 A;  8ICB A;  1K1Q A;  5ALJ A;  2YY6 A;  4TUS A;  2PFQ A;  5AKY A;  1RG6 A;  2KJ8 A;  5AIC A;  4QZ8 A;  3MR6 A;  4RPZ A;  3RAQ A;  4NLK A;  3F2D A;  1RYU A;  4ED3 A;  2RHF A;  3SR6 A;  4MFF A;  4F4Y A;  2ATL A;  2ZXI A;  2UVU A;  9ICX A;  1BNP A;  4PL2 A;  4J9N A;  1WUD A;  1XWL A;  3WKB A;  3PW2 A;  3ZDC A;  2AGO A;  5J0U A;  2F8L A;  4KIT B;  4DSI A;  4ACO A;  2HHU A;  5KT6 A;  3TFS A;  2A1A A;  4KLU A;  3H7I A;  4RQ4 A;  4OJP A;  3WKE A;  2F77 X;  4F4X A;  1TK0 A;  4KTQ A;  4F72 A;  4QZE A;  5HP4 A;  2P35 A;  2YX8 A;  4DOB A;  1X9S A;  3GZF A;  5C5J A;  1ZQX A;  4ECT A;  1COK A;  3N97 B;  8ICW A;  2HDO A;  4Z6F A;  2KN7 A;  4OD0 A;  2V4R A;  2FDR A;  2FPK A;  1T94 A;  7ICK A;  2H5X A;  5H2F U;  5ALU A;  3GIJ A;  4QNL A;  9ICP A;  5CHG A;  2B6G A;  4O5E A;  4UB1 A;  3ZDD A;  5L1L A;  9ICR A;  1SL1 A;  5EWE A;  4FZM A;  1KN5 A;  2HHT A;  2W9C A;  2G09 A;  5DB9 A;  2H3Q A;  5IIK A;  4GXJ A;  3QU5 A;  1SV0 A;  5KFS A;  4OCZ A;  2W9C B;  2JH7 A;  5F3X B;  1N62 A;  2LYB A;  5AM4 A;  3KFU F;  2KIC A;  5EWF A;  1ZQT A;  1L6N A;  4G3I A;  3E58 A;  5K4L A;  2JH1 A;  3A0H U;  4QZG A;  2XI9 A;  4UW9 A;  4PZO A;  4RQ0 A;  4FFD A;  4DLE A;  5AKL A;  5DB7 A;  3UQ0 A;  4GXI A;  3TAP A;  3D6J A;  3UMC A;  5KAI U;  4TUR A;  3JPO A;  2XID A;  1ZQQ A;  4M0A A;  4Q43 A;  1Y88 A;  3T5K A;  4I2A A;  5KG7 A;  1ZQR A;  3NVY A;  1ZQZ A;  4Y2P A;  4RT3 A;  2E8N A;  1YZ7 A;  1CRX A;  2UVV A;  3PX6 A;  2WTF A;  1N60 A;  4UAR A;  4Y2R A;  4EZ6 A;  5J8Y A;  1V38 A;  5AI9 A;  2DQN B;  5KFX A;  2K89 A;  3RH4 A;  3PSF A;  3EPG A;  1CI4 A;  3BJY A;  4US8 A;  3RJF A;  9ICT A;  2JEI A;  1SV4 A;  4QIW F;  5GTH U;  3DV9 A;  5J2B A;  4ECV A;  8ICO A;  2AQ0 A;  2RLT A;  2KHV A;  4P4O A;  2ZIX A;  2LBO A;  4FBT A;  1FFU A;  1X9X A;  5FP0 A;  2ALZ A;  1U45 A;  1X6J A;  3WKC A;  2PMZ C;  5ALY A;  3RH6 A;  3M9M B;  4FZN A;  4DL2 A;  3NRW A;  2ZIX B;  1TV9 A;  2P6R A;  4Z6C A;  3K4G A;  3N4M B;  2E1F A;  3M1Y A;  3C5G A;  1MC8 A;  4P4P A;  3TAD A;  1Z4O A;  3LYS A;  3FYH A;  3BS7 A;  5BOM A;  4KLD A;  8ICT A;  2B21 A;  5HHH A;  3HP6 A;  1S5L U;  5ALG A;  7ICV A;  1CUK A;  5J2A A;  4DLG A;  5AI0 A;  3HRD D;  2HBL A;  7ICE A;  3FDS A;  2YMQ A;  1IV8 A;  3C23 A;  1X9M A;  2BPG A;  4KLQ A;  2A1J B;  3K1Z A;  4DS4 A;  1N5W A;  5CJ7 A;  3PW7 A;  2MA1 A;  2Y0S F;  1FFV A;  2YB1 A;  5DQH A;  1PK1 A;  3C2M A;  2PXI A;  5ALZ A;  2CN1 A;  1ZQG A;  2Z7J A;  5KT7 A;  5DKW A;  2N1R A;  4KLF A;  3OPX A;  5DQG A;  2WAQ C;  2EZZ A;  1U9L A;  2KIV A;  4NM1 A;  4ZH4 A;  1ZQJ A;  1AQ6 A;  2BCR A;  1SB3 C;  4QZI A;  1B0X A;  5HML A;  3C28 A;  4CCH A;  4F3O A;  1ZD4 A;  3KD3 A;  3NS1 A;  5KG2 A;  4MEY A;  1QH9 A;  2AGQ A;  2W9B B;  3SAF A;  1D8L A;  4YXJ A;  5D49 A;  1NK5 A;  4Y2S A;  4DFD A;  5AIA A;  3Q8S B;  5EE9 A;  3ZDA A;  3RJH A;  3ZD9 A;  5ALL A;  5J0Y A;  4NV0 A;  1KKX A;  4PHE A;  2M0N A;  5KFL A;  4KLO A;  1NZP A;  2K8A A;  4BGD A;  3NVV A;  4Y2X A;  4B9M A;  8ICK A;  2KFZ A;  3OJU A;  5KFO A;  2BDU A;  2FI1 A;  3RB6 A;  2YN4 A;  4M9L A;  4UAU A;  4ECR A;  2BCV A;  2BCS A;  3PML A;  9ICF A;  8ICU A;  1NJZ A;  3SI8 A;  1JUD A;  9ICK A;  4AYB C;  4HAI A;  3D2Q A;  2IMW P;  2QLT A;  1VLB A;  2WB1 F;  2MRL A;  5J2H A;  2NV3 A;  3M7D A;  5JU5 A;  2DKX A;  1U47 A;  3PO5 A;  4YN4 A;  5J2F A;  4O5C A;  2IOH A;  2LYH A;  4NL9 C;  3M8R A;  2KMD A;  2H3I A;  3V7L A;  4R63 A;  4XUS A;  2JXJ A;  5KNI A;  1QSS A;  4F92 B;  1RZT A;  5ALX A;  4GC6 A;  3RAX A;  4YR2 A;  9ICJ A;  2V9W A;  2XCP A;  4YMO A;  3M9O B;  4TUP A;  4MFA A;  3PX4 A;  4FE3 A;  1JI7 A;  1Q3U A;  5DDY A;  3WK5 A;  1Q8K A;  2W3R A;  3BQ7 A;  2K8C B;  1WG8 A;  2NRV A;  4UB3 A;  4MFC A;  4C80 A;  3GU3 A;  1JX4 A;  1PZN A;  2RQ5 A;  7ICO A;  3OHA A;  4CNQ A;  3JPP A;  1XNS A;  4ECY A;  4O3Q A;  5AKZ A;  3I28 A;  8ICA A;  3T3F A;  2L5Y A;  3HKZ F;  4UB4 A;  8ICY A;  3IM1 A;  4IQT A;  3RR7 A;  1XU4 A;  5DBA A;  1S0M A;  1SWW A;  1B43 A;  4C4T A;  1T7P A;  2W8K A;  3C1Z A;  3N7R C;  2K4E A;  3HJE A;  4XQ8 A;  3GV7 B;  4UB2 A;  2FLP A;  3PW5 A;  5AK5 A;  4KLH A;  1QSL A;  1F44 A;  7ICM A;  1LVH A;  4IR9 A;  1ZQ1 C;  4F2S A;  3ORY A;  1FEZ A;  1DK2 A;  4QJF B;  5ALM A;  2NYV A;  5L9X A;  3KHL A;  4P2H A;  4QWB A;  1ZET A;  1D9D A;  3AQE A;  3G6V A;  5KFR A;  4Q8E A;  1KBU A;  3JPT A;  1JRO A;  8ICQ A;  4P0Q A;  1N48 A;  2XGP A;  3CP8 A;  5J29 A;  1HEK A;  3E0F A;  1NKB A;  1QTM A;  7ICG A;  4FZL A;  1QLN A;  4P0Q B;  3PMN A;  2Y9T A;  2J6U A;  2ZXH A;  5J0P A;  3PW4 A;  4B9N A;  1OW5 A;  2KVC A;  4BWJ A;  1HIW A;  2AHO B;  1PK3 A;  5IIO A;  2DWQ A;  5KFC A;  1KQQ A;  5DG8 A;  2BQ3 A;  4K4H A;  4DSJ A;  5HNK A;  3C29 A;  2PI4 A;  1S8O A;  1VDV A;  3TQ1 A;  1TE2 A;  2Y1J A;  1WYG A;  1JXL A;  5KG6 A;  1ZQI A;  3BQ1 A;  3UXP A;  3IV6 A;  2A3V A;  3KZI U;  2VIX A;  1XS9 D;  2KOB A;  1SKS A;  1JAL A;  1LKY A;  4FO6 A;  3TAC B;  3MDC A;  2MUT B;  2GO7 A;  2YQE A;  4QZB A;  2BCU A;  1LKY B;  4JWN A;  1X66 A;  2IA6 A;  5AKG A;  1OUQ A;  4JK1 A;  5KFV A;  3L4P A;  5ALN A;  5IIN A;  9ICO A;  1OXJ A;  2GOL A;  4M9G A;  2OXO A;  5AM3 A;  3QXG A;  1DGJ A;  5ALW A;  3MGV A;  2OCE A;  2AQ4 A;  2EAN A;  2DGZ A;  1ZQU A;  3AL0 B;  5CRX A;  3V72 A;  4MF8 A;  1IXR A;  2EH9 A;  2IHM A;  4RUA A;  4FS1 A;  2J6S A;  4JV0 A;  3OHB A;  3MR2 A;  1SGG A;  3HX0 A;  5F9L A;  3RH5 A;  4OJL A;  9ICH A;  5J2D A;  4QZC A;  4F50 A;  4C8K A;  3IG5 A;  4O0I A;  1KFS A;  3QUB A;  4YR3 A;  3EYZ A;  2BQR A;  2KVS A;  3B9J A;  2IBK A;  1XO0 A;  4FBU A;  2C2R A;  2NO4 A;  1YZ6 A;  1VJ5 A;  4EYI B;  4YG2 A;  1URJ A;  3LK9 A;  4Y2U A;  2XC9 A;  3TKA A;  1IIP A;  4WJ3 B;  2HBM A;  3H4B A;  4NXZ A;  4BXO A;  2KP7 A;  2HBJ A;  5TZV A;  4AP9 A;  8ICX A;  1C20 A;  4DQQ A;  2C2D A;  3C5F A;  4ELT A;  1Q46 A;  2K8B B;  1X40 A;  3WK7 A;  1JRP A;  7ICN A;  5AHX A;  2Y9U A;  1DGS A;  2F1J A;  4J9Q A;  2QAR A;  2C22 A;  4MF2 A;  3AN1 A;  1RYR A;  2ASD A;  1TVA A;  2XY7 A;  1SWV A;  3QUC A;  4X5V A;  3V7J A;  2QAR B;  2I1Q A;  5ALP A;  3GIM A;  5KFU A;  5KG4 A;  2E5S A;  2ASJ A;  5ALK A;  3QNM A;  2PMZ F;  4G9B A;  2NRX A;  3PR4 A;  2BKE A;  1ZQL A;  1ZQD A;  4Y2J A;  1ZD3 A;  4F4Z A;  3SYZ A;  4J9O A;  4NLG A;  5ALR A;  5ALI A;  8ICC A;  2EZY A;  1V9P A;  3DDH A;  4I29 A;  5KG1 A;  2E8P A;  4YP3 A;  3PV8 A;  2W55 A;  1KW4 A;  2F76 X;  8ICM A;  4MEX A;  1L3T A;  2QB0 A;  3AMZ A;  2GLE A;  4NWI A;  3KBB A;  5AKX A;  2JR5 A;  4PPX A;  2W43 A;  9ICQ A;  2ZTE A;  2BPF A;  3QE9 Y;  4J9M A;  3HT3 A;  3AUO A;  1TK8 A;  3MAB A;  4J9P A;  2XGQ A;  1NNL A;  4RQM A;  3MR5 A;  3T5L A;  2WFA A;  2W03 A;  2WF9 A;  4Y2Q A;  2VKQ A;  4C8M A;  3ISC A;  1JN3 A;  8ICG A;  2HBK A;  4DSE A;  2ZJA A;  5AI5 A;  4KLS A;  1J2N A;  4UB6 U;  2FPM A;  2EAO A;  3RTV A;  3J81 j;  1T4G A;  2WAQ F;  4CF4 A;  1HUO A;  5KAF U;  2Q0Z X;  1DXS A;  4NL9 A;  3SAG A;  3NVW A;  4NLB A;  3UPQ A;  3RBD A;  4FS2 A;  4IQU A;  2W3S A;  1PVQ A;  4NY8 A;  4ECS A;  5DG9 A;  3K1R B;  1M6Y A;  4YCX A;  5G5H A;  1NK9 A;  3KKA A;  5EE1 A;  2XY5 A;  4EX6 A;  5DGA A;  1HUZ A;  2E1E A;  4J9R A;  2MSN A;  2FMQ A;  5DQI A;  4LZD A;  4GLX A;  4EYH B;  1NK6 A;  5AK4 A;  4UAS A;  4GXK A;  4UBB A;  4ECX A;  4QZ9 A;  4CGZ A;  2KJ5 A;  2G0A A;  4JV2 A;  4DWI A;  4AYB F;  1TK5 A;  2HHX A;  4DFK A;  1SL2 A;  1SKW A;  5KT2 A;  3EWA A;  1Z19 A;  2KTQ A;  1UCV A;  1XO1 A;  1F0M A;  2HVH A;  2HHQ A;  5T14 A;  5KG3 A;  1NJW A;  4CF5 A;  4M6W A;  1U49 A;  2WF8 A;  4C8N A;  5DBB A;  2G5I B;  2YB4 A;  3O0F A;  5KL1 B;  1KFT A;  2IOF K;  2F3N A;  3H40 A;  4M6W B;  2Y1I A;  3Q8Q B;  2QB1 A;  1L3U A;  4PHA A;  2ZUD A;  3BS5 A;  2F1H A;  4NLN A;  2ZUC A;  2XCA A;  5ALS A;  1HJP A;  2F8K A;  5EE0 A;  2NO5 A;  2PKE A;  2QKQ A;  3KTQ A;  5DDM A;  8ICR A;  1ED1 A;  4CDG A;  3FAH A;  2G07 A;  2J6T A;  5AI4 A;  2UVW A;  2F2A B;  1N56 A;  3AU6 A;  3L3F X;  1Z3E B;  1PK1 B;  2FJ6 A;  5DBC A;  3Q8P B;  2ASL A;  3KZX A;  3FC4 A;  4KX5 A;  4QW9 A;  4B9U A;  5C0Y A;  1X42 A;  1SZH A;  2Q4T A;  3SEI A;  1SL0 A;  1ZQY A;  1QQ7 A;  3D2S A;  3PR5 B;  1MN8 A;  3RBE A;  3IDW A;  5KFM A;  4UAY A;  4GFJ A;  4EBC A;  3QX7 A;  3M8S A;  7ICF A;  5ALE A;  4JB3 A;  4DS5 A;  4QZA A;  4JUZ A;  4RU9 A;  9ICS A;  4K4G A;  2DUY A;  5KT3 A;  4DF4 A;  5E79 U;  2AH5 A;  1ZJM A;  1RQN A;  1D9F A;  3BQ0 A;  4F8R A;  3ONN A;  3OJS A;  3BDP A;  1UT8 A;  1NKE A;  1NK4 A;  4I27 A;  1O03 A;  1BGX T;  4PGQ A;  2F44 A;  2LPE A;  8ICS A;  5JRT A;  8ICH A;  4KN4 A;  1UQV A;  3N7S C;  1PUZ A;  3RB3 A;  4I2E A;  2KHQ A;  4KLJ A;  3IP4 B;  5IIL A;  4IRK A;  1ZQV A;  3MGI A;  1V97 A;  4C4S A;  2R8J A;  9ICE A;  7ICU A;  2V4Q A;  3QU7 A;  5J0T A;  1SV0 C;  3JPQ A;  3RJE A;  4QW8 A;  4QWE A;  5B66 U;  4DL4 A;  3BQ2 A;  3QEA Z;  4QZD A;  4DL3 A;  1L7N A;  4Y2Y A;  3PSP A;  3G6Y A;  4UAW A;  2JMG A;  1ZQK A;  4DQP A;  2MU2 A;  3F2C A;  3DEE A;  1ZQA A;  2HW3 A;  3QU4 A;  3G6X A;  2VJ5 A;  4RQ8 A;  5IIM A;  2PFP A;  2HOQ A;  3SMV A;  4P0P A;  4C7Z A;  2KIW A;  4CRX A;  4I2B A;  1Q3V A;  3GDX A;  4XA5 A;  3GV5 B;  2NRT A;  3PNC A;  4EX7 A;  2HSZ A;  3QU2 A;  1ZYQ A;  5BPC A;  1N61 A;  4P0P B;  2XY6 A;  5J8Y C;  3NRZ A;  1TAM A;  3WK6 A;  2DL0 A;  4EEN A;  4M9H A;  2ZIU A;  4Y2V A;  3ISB A;  4M2Y A;  3THV A;  2WF5 A;  3RJK A;  3CNH A;  2ISP A;  2ZIU B;  4GC7 A;  5JUM A;  4PHD A;  3OSN A;  2WHE A;  3TAR A;  2K4H A;  4TQR A;  2KE7 A;  3NVZ A;  1L8L A;  5KG0 A;  3CRX A;  3PSI A;  3PST A;  3JPS A;  5ALV A;  1ECW A;  4RZR A;  3MC1 A;  4ECZ A;  1ZD2 P;  2HHV A;  5KFZ A;  3TAD C;  4USA A;  4IS7 A;  1Z1B A;  5KFN A;  3TAQ A;  1BPE A;  5GTI U;  5ALQ A;  4BWM A;  4QZF A;  4LVS A;  5L1J A;  4Q45 A;  3A0B U;  2O6K A;  2JEG A;  3H4D A;  2JZB A;  3ICX A;  1L3V A;  4ZOH C;  3HWT A;  9ICW A;  2LMR A;  2R8K A;  1L7O A;  1L8O A;  2JZB B;  8ICZ A;  1V85 A;  4MHV A;  9ICI A;  4K4I A;  1CEZ A;  2JEF A;  4BUG A;  2D8C A;  3TI0 A;  4YMN A;  4ED0 A;  2WF6 A;  2G08 A;  4F2R A;  5KFP A;  3H8S A;  5KFA A;  3ETL A;  2W54 A;  2KFN A;  1RPL A;  3AM9 A;  3ZDE A;  2VA2 A;  4DFM A;  2D3D A;  2NRZ A;  5AK6 A;  3B0Y A;  1DOQ A;  4GIB A;  5ALT A;  1ZQH A;  2K60 A;  5J2K A;  3M6Z A;  4BJQ A;  2KKV A;  3JPN A;  2HVI A;  1J97 A;  3B0X A;  4DSK A;  2HI0 A;  3LWL A;  2PFO A;  3TAN A;  4UQG A;  1ZQC A;  5ALF A;  2YML A;  3SV3 A;  2XIC A;  2HMX A;  1ZOL A;  3S6J A;  3RF9 A;  3KHR A;  1L7M A;  1SXD A;  2BZF A;  7ICI A;  1X6I A;  4ED6 A;  2HHS A;  4DL5 A;  1KEJ A;  1NK7 A;  3BZC A;  2W7P A;  4KLI A;  1LB2 B;  1EXN A;  2VJ4 A;  4YR0 A;  4M9J A;  8ICJ A;  3SEN A;  4LZG A;  5CB1 A;  5J0O A;  2K4P A;  3EPI A;  5KFQ A;  4M9N A;  3QYP A;  7ICR A;  1MQ3 A;  1X9W A;  2IOF A;  4RQ6 A;  1ZD5 A;  4BDP A;  2EQY A;  1KDH A;  4I2J A;  3UXN A;  4ECQ A;  3ED5 A;  2ODG A;  2HHW A;  4OJ6 A;  4KX3 A;  3U26 A;  4RNN A;  3PZP A;  1JIH A;  2VAN A;  4DL7 A;  4C7Y A;  3UMB A;  1ZQE A;  3TFR A;  4JV1 A;  4B9V A;  3H8W A;  1NOM A;  4PGY A;  1N2X A;  4M47 A;  5AKI A;  4R66 A;  1ARO P;  3M9N B;  3LWM A;  1TFR A;  1N63 A;  4R8U A;  3WK4 A;  3RB4 A;  4ELV A;  9ICM A;  4O3S A;  1KRP A;  4YVZ A;  3H0M B;  5KL8 B;  5AKK A;  1RQL A;  4BXO B;  1NK8 A;  1TKD A;  4EZ9 A;  4OO1 J;  4I2D A;  1Z4N A;  1BVS A;  4ICA A;  2KKP A;  4OJ5 A;  3SZ2 A;  3FM9 A;  4Q44 A;  5KFG A;  1B4F A;  4Q8F A;  4XRH A;  2HOI A;  2DPI A;  3ZDB A;  2AU0 A;  2I9G A;  4KLE A;  1ZRN A;  5DLG A;  7ICQ A;  4F5N A;  9ICA A;  4NLZ A;  5HMM A;  3C2L A;  3LVW A;  1PVR A;  4J9K A;  4CF3 A;  1DK3 A;  3GIK A;  3WK9 A;  2EAP A;  4LJX A;  1L3S A;  5BOL A;  4DL6 A;  2RDJ A;  4U7C A;  2OHF A;  1UHU A;  5J2I A;  4I2G A;  4TUQ A;  3SD7 A;  1Z1V A;  5ALD A;  4KMU A;  2FMP A;  2KSO A;  4JWM A;  1QCK A;  3AQF A;  2B0C A;  4RUC A;  2JV3 A;  1S9F A;  8ICI A;  3Q8M A;  7ICJ A;  1IM4 A;  4IQW A;  4YD2 A;  2KSO B;  3F5A A;  4IRC A;  2QB0 B;  1BPY A;  3RJG A;  5AKJ A;  2OM6 A;  1A76 A;  4UB8 U;  5TIS U;  3NGD A;  2D6F C;  1FIQ A;  4O3P A;  1COO A;  3H0L B;  1RXW A;  1SIJ A;  3F53 A;  4PH5 A;  1P7D A;  3Q8K A;  3JPR A;  3EW9 A;  3UQ2 A;  3GIL A;  3KOO A;  2F1I A;  4QZH A;  1IG6 A;  2W11 A;  4PZN A;  2LM1 A;  4DQR A;  4C4R A;  4KLT A;  2JEJ A;  1KL9 A;  3OGU A;  3ALR A;  5IIJ A;  4RQ2 A;  2OH2 A;  4NLC A;  5L1M A;  1QQ6 A;  1WWV A;  3K75 D;  4EBD A;  5KT5 A;  4J9L A;  1BPX A;  4M04 A;  3MFH A;  2KJ9 A;  3LVV A;  1SKR A;  2E3T A;  5CEH A;  5AM5 A;  1NK0 A;  3ZI4 A;  4A8E A;  3Q8R B;  2K4I A;  2P6U A;  2DPJ A;  1QSY A;  3AEV A;  3H8J A;  2YMP A;  2I6X A;  4J9S A;  4UAV A;  1MQ2 A;  1TAQ A;  3RR8 A;  1S0V A;  3OSP A;  3V6H A;  2FPL A;  4DFJ A;  2KZZ A;  1NJY A;  2OYY A;  2IHN A;  2HOF A;  4NM2 A;  3T79 A;  2KEY A;  2RDI A;  2EDU A;  2ISO A;  3SAH A;  1K1S A;  5J0W A;  3I1Y A;  2W9M A;  4IQV A;  1BNO A;  3RRG A;  5CR0 A;  4IRD A;  4CE6 A;  3MR3 A;  2LKY A;  1LV5 A;  4YQW A;  1S0O A;  4YMM A;  1T3N A;  2BPC A;  5J0X A;  2ZIW A;  9ICG A;  2KZ3 A;  2I5H A;  3GII A;  3AU2 A;  4R64 A;  3IN5 A;  4QWC A;  2A19 A;  3ZD8 A;  2ZIW B;  1UA1 A;  1KTQ A;  3BZK A;  4PHP A;  1BPB A;  5G5G A;  2BHN A;  3OTQ A;  2LM4 A;  2JGA A;  4Z6D A;  5F9N A;  2KNJ A;  1KLN A;  2XVT A;  2FE9 A;  3QUQ A;  2CRX A;  3QEB Z;  5EWG A;  1NKC A;  1ZJN A;  3BS5 B;  2A1J A;  3PVX A;  3EZ5 A;  4RQ5 A;  4DEZ A;  4YD1 A;  5EE3 A;  1S77 D;  3IHQ B;  4F91 B;  4I2I A;  5HHI A;  4O9M A;  9ICC A;  4F93 B;  1ZRM A;  5DLF A;  2PFN A;  5D46 A;  3RFA A;  2W8L A;  2H3V A;  4RQ3 A;  3T5H A;  4Y2T A;  3MDA A;  3WK8 A; 
#chains in the Genus database with same CATH homology
 2DL0 A;  3BS7 A;  2EAN A;  2ESE A;  1SV0 A;  1B4F A;  2E8P A;  1KW4 A;  5F3X B;  1UCV A;  5JU5 A;  2DKX A;  1F0M A;  2QB0 A;  3KKA C;  2GLE A;  4NL9 C;  2ES6 A;  1SXD A;  2KMD A;  2F44 A;  2LPE A;  4RQN A;  1SGG A;  5JRT A;  4PZO A;  1PK1 A;  2DKZ A;  2EAP A;  2KE7 A;  4RQM A;  5KNI A;  1UQV A;  2F3N A;  2Y9T A;  2QB1 A;  1RG6 A;  3H8M A;  1OW5 A;  1Z1V A;  3BS5 A;  3TAD C;  1JI7 A;  4IS7 A;  2KSO A;  1PK3 A;  2YTU A;  2F8K A;  2E8N A;  3BQ7 A;  2KIV A;  2JV3 A;  2EAO A;  3SEN A;  2EAM A;  2QKQ A;  1DXS A;  4NL9 A;  1SV0 C;  1B0X A;  2KSO B;  2QB0 B;  2K4P A;  5J8Y A;  1V38 A;  2LMR A;  1PK1 B;  2L5Y A;  3K1R B;  1WWU A;  5JTI A;  1SV4 A;  1X40 A;  1V85 A;  4MHV A;  2FE9 A;  2Y9U A;  1SXE A;  3KKA A;  2QAR A;  4PZN A;  2D8C A;  3BS5 B;  1LKY A;  3TAC B;  1X9X A;  3HIL A;  3SEI A;  1COK A;  2QAR B;  5L1M A;  2KG5 A;  1WWV A;  1LKY B;  3IDW A;  2E8M A;  1X66 A;  2E8O A;  4NJ8 A;  2D3D A;  2B6G A;  3TAD A;  5J8Y C;  1OXJ A;  2K60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...