5JRTA

Crystal structure of the human tankyrase 2 (tnks2) sam domain (dh902/924re)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
64
structure length
64
Chain Sequence
b'VDFSITQFVRNLGLEHLMDIFEREQITLRVLVEMGHKELKEIGINAYGHREKLIKGVERLISGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 22
structure length 64
sequence length 64
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jrtA00
3BS5A 1B0XA 1X66A 1LKYA 2E8OA 4MHVA 2JV3A 2ESEA 2EAOA 2KE7A 4NL9C 2GLEA 5JRTA 1SV0C 2E8NA 2FE9A 1SV0A 2KIVA 4IS7A 1UCVA 5J8YA 2D3DA 2KMDA 5L1MA 1X40A 2E8PA 3BQ7A 1KW4A 1UQVA 4RQMA 3SEIA 4PZOA 3TADC 3KKAC 5F3XB 4NL9A 3KKAA 1DXSA 1PK1B 1SXEA 2LPEA 2ES6A 2Y9UA 2EAPA 3BS7A 3K1RB 1X9XA 2LMRA 1V85A 3H8MA 1PK1A 1JI7A 2L5YA 1F0MA 2B6GA 1WWVA 2DKXA 1OW5A 1V38A 2D8CA 1Z1VA 2F8KA 1RG6A 2EANA 1PK3A 1SGGA 3SENA 1OXJA 2KG5A 3TADA 2F3NA 3HILA 2E8MA 2QB0B 1WWUA 2QARB 2QKQA 2DKZA 1B4FA 2KSOB 2K60A 2QB0A 2F44A 1COKA 3TACB 5JU5A 2K4PA 2QARA 5JTIA 2EAMA 3IDWA 2DL0A 2QB1A 4RQNA 4NJ8A 2KSOA 1SXDA 3BS5B 2Y9TA 2YTUA 5J8YC 1LKYB 5KNIA 4PZNA 1SV4A
chains in the Genus database with same CATH superfamily
5BPCA 4F5QA 2MUTB 2CRXA 1Q3UA 2ZTCA 2NRZA 3T5HA 2PI4A 1YZ6A 1BPYA 5DB8A 2HBMA 4CGZA 3M8SA 5AKZA 1N60A 3JPNA 1NK5A 2HHUA 5HR7A 1T7PA 4Z6CA 3KFUF 5KT6A 4RUAA 1JUDA 2BDPA 1X40A 1UQVA 1ZQUA 4YFKA 7ICFA 4ED2A 2C2EA 4UB6U 2NRTA 2MSNA 2PFOA 2BGWA 1ZQSA 5KFFA 1ZQYA 5KFHA 5AKXA 1NKBA 1RPLA 1ZQBA 3KKAA 4XQ8A 1S0VA 4IR9A 7ICNA 1C7YA 5AI0A 7ICSA 4J9MA 5J0TA 4QW9A 3RH5A 1XNSA 4YN4A 4UB3A 2YN4A 9ICWA 4F5RA 2A3VA 2VANA 2AGQA 1ZQDA 2WB1F 4F72A 1V38A 5J2HA 1TVAA 1Z1VA 3FM9A 1A77A 7ICQA 5J0UA 4OO1J 3I76A 2OWOA 4YP3A 4P4OA 1XSLA 3A0BU 7ICIA 3MR6A 2YX8A 3NASA 4OJ5A 1N63A 2QARA 2QB1A 2P66A 4C4SA 8ICYA 3V6HA 2Y9TA 1X42A 1QQ7A 2JMGA 4IQWA 3F5EA 4DL5A 2LBOA 1Z19A 3KZXA 4NM2A 4I2DA 4C8LA 1COOA 5J2IA 2GLEA 2LYHA 1ZOLA 4DQRA 4ZH4A 4GXIA 5ALKA 3QU2A 9ICKA 3IM1A 3RH6A 5G5GA 4O3SA 4ECZA 2F1IA 2R8KA 2HVHA 3H7IA 2MAXA 5ALVA 4XUSA 3TFSA 2C2DA 2LKYA 3ICXA 4P0QB 2VA8A 4O3MA 1N61A 3HRDD 1IG6A 5AKGA 4J9RA 3RJFA 5AK4A 2G08A 4DL7A 1TAQA 1B43A 1IXRA 4PHDA 4JV2A 4FZMA 5DG8A 4ED1A 1T94A 2KP7A 1T8EA 7ICRA 3RJEA 2WAQF 4KN4A 3M1YA 5ALSA 1SIJA 3D6JA 3CNHA 3C2KA 5AI6A 4QZHA 1SB3C 5KG6A 2W8LA 2LMRA 2KFZA 4QIWC 2L5YA 4YD1A 3B9JA 1OW5A 2HI0A 1X9MA 3GFKB 3IP4B 1N2XA 2WF8A 9ICLA 1NZPA 4M6WB 3GV8B 1C20A 1MQ3A 5J2BA 3UPQA 2ZJ8A 3IDWA 4CRXA 5KG7A 5IILA 8ICMA 4PH5A 3MC1A 1J2NA 5AKHA 8ICLA 3BS5A 2YQEA 5HHIA 4ECRA 4J03A 1X66A 1XWLA 1Q3VA 1KQQA 4JV0A 4F71A 4YQWA 2ESEA 1KEJA 5KG4A 5DKWA 5KT4A 1KTQA 4P2HA 3ISDA 2MUTA 4M0AA 3NS1A 4B9NA 4KLOA 1LB2B 5J0QA 1ECWA 4RT2A 4MF8A 3PSPA 3KHHA 4J9QA 3WU2U 8ICXA 4ED8A 4M9LA 4CF3A 2W04A 4BJQA 3BQ7A 2ZTEA 1YZ7A 3NVYA 1TK0A 3ZD8A 4EYHB 2IBKA 5B5EU 1ZQWA 3RJHA 4Y2YA 9ICUA 3NUQA 3C5GA 2FPKA 3HX0A 1FO4A 1IM4A 1NI3A 3M6KA 4ECXA 4MEYA 2WB1C 5KFEA 2EAPA 3BQTA 9ICBA 2BPCA 2BQ3A 4ECVA 3QZ8A 2DKXA 2K8BB 4QZCA 5IIKA 2C22A 4RNOA 1X9WA 1ZQQA 4CE6A 4ECTA 4K4IA 2GH1A 3EPGA 3ZDAA 3NTUA 4ED3A 4FE3A 5EE3A 1HUZA 5AK5A 3TARA 5JUMA 5KG1A 1Z00B 2EAMA 4DLGA 8ICRA 9ICMA 2AXTU 1SXDA 4F93B 3UQ0A 7ICOA 3HW8A 3PO5A 4FO6A 2FPLA 3NRWA 5AM5A 2P6RA 1ZQAA 2ZIWB 4Z6EA 1L3VA 4LVSA 1S0NA 4UQGA 2V4QA 2DQNB 4HYKA 2F1JA 1TFRA 2WF9A 5JRTA 4YR0A 4QWEA 4Q8FA 2OHFA 5KL8B 1SV0A 3UMGA 5ALLA 3HKZF 2W9CB 3G6YA 2ATLA 1JMSA 5J8YA 5L1MA 4QJFB 2ZUBA 5J2JA 4I2GA 5CJ7A 2BKEA 3SYZA 4GFJA 4C0ZA 4P0QA 1QSLA 3QEAZ 2WAQC 2AHOB 2NO5A 5AK6A 5KFPA 7ICLA 2PFNA 3T79A 4AYBC 3WKDA 3QZ7A 3WK8A 2I1QA 2JH1A 1S9FA 2HBJA 1X6IA 5ALDA 2K8AA 4YXJA 5CEHA 3ONNA 5DLGA 2C28A 5GTHU 5ALJA 4TQSA 4I27A 2G5HB 5DGBA 4UASA 5DBCA 5A0LA 2FLNA 1OXJA 4UB2A 1QH9A 4IRCA 2QB0B 1NNLA 2W9AA 3B0YA 4JV1A 5L1IA 8ICPA 1HIWA 2DUYA 2F44A 3S6JA 2PFQA 3GZFA 2K4PA 4RPZA 4M6WA 2A1JB 4NJ8A 4PHEA 4F4ZA 2P6UA 3I28A 5EE9A 2YMLA 5AI8A 2YTUA 9ICSA 5EWEA 3GIMA 4IQTA 3AUOA 3MR3A 3M9OB 1SL1A 2XCAA 2Z7JA 1ZQIA 1AQ6A 3BJYA 2KKPA 4RQ1A 3JPTA 3V7LA 1L7NA 3F53A 3AQEA 3ISCA 5ALQA 4LZDA 4LJXA 4RNNA 9ICOA 4Q45A 5DDMA 1V97A 2BCVA 4KN7A 1Z1BA 2JEIA 4RQ3A 1RXVA 5D46A 4RQMA 2WF7A 2BCRA 4CCHA 2XC9A 3QE9Y 3QNMA 3DV9A 2HOQA 3H40A 1T3NA 2VJ4A 4RU9A 1MC8A 3R9KA 3UXPA 4DSKA 4M9NA 2W55A 8ICEA 4QZIA 4TQRA 3T5LA 9ICGA 3JPSA 5FP0A 2EZXA 4Z6FA 1JXEA 4ED0A 1FFVA 3HT3A 3WK9A 2PXIA 4J9PA 3HILA 4DQPA 4B6JA 1ZETA 3H8JA 5J2FA 3UXOA 3KBBA 1U4BA 2DKZA 3M9MB 5J0WA 3BZCA 4DSIA 1K5OA 4Q8EA 3GQCA 2UVWA 2YMQA 1ZXIA 5DQGA 3PNCA 1FIQA 3BQ2A 5J2DA 5J8YC 2OEHA 2CN1A 2ZUDA 4RT3A 3HPOA 4QZBA 1Z00A 1O08A 3TAQA 1CI4A 2IOHA 1SKSA 2I5HA 1ZQZA 2PMZF 4MFCA 9ICCA 3CW2C 2ZIWA 5KFXA 1ZRMA 3WK5A 2KE7A 8ICIA 5KFAA 1KSPA 3HKZC 4C80A 4XA5A 4IS7A 1KFTA 1NK6A 2W7OA 3VC8A 5ALRA 2NO4A 1DGJA 7ICVA 2W11A 2W9CA 3N97B 3A0HU 5ALNA 3PR4A 3L3FX 1Q46A 8ICOA 3FDSA 4DFMA 2KJ5A 2J6TA 3M9NB 2JEFA 3EW9A 3WK6A 8ICHA 4DSLA 1XSNA 3C1YA 1Z3EB 4KLTA 8ICTA 2BHNA 1N5WA 3QYPA 4O3RA 3MABA 5H2FU 4K4HA 2AJQA 4IL6U 4I29A 2I9GA 5KFLA 2F8LA 1JRPA 4DEZA 4NV0A 1QCKA 2F8KA 5AKJA 4C7ZA 1FFUA 4UAZA 1S10A 2WTFA 4DQQA 1TV9A 4KLSA 3RFAA 4PGYA 2JHDA 3LVVA 4MFFA 1WWUA 5KFSA 1KFSA 4TUQA 3K4GA 4I28A 1KL9A 2QB0A 2KKVA 1S77D 3PSFA 2AU0A 4YMNA 1QTMA 5JTIA 3RB6A 4EEKA 3QEBZ 4GIBA 3N7PD 2KHVA 4P0PB 1TAMA 4NLBA 2LI6A 5KNIA 2E1EA 3WK7A 1VDVA 3RJKA 2A1JA 5DDYA 4UATA 2W03A 4ELVA 3MBYA 3F5AA 4RUCA 2G07A 5L9XA 2EAOA 3UXNA 5J2GA 1D8LA 3TQ1A 3PMNA 3QUTA 1TK8A 3T5JA 2BQRA 2MA1A 2B0CA 5L1LA 4NY8A 1NK8A 4GXKA 4NLKA 3PW4A 2F77X 3TANA 3SR6A 3RRHA 4DL6A 4M9JA 3Q8SB 3C28A 4TUPA 2EZYA 4C8NA 5DLFA 1RZTA 2G09A 3PMLA 2FLPA 3LWMA 3ETRA 2KV2A 3Q8RB 3H4DA 4NWIA 2ZXIA 5AIBA 4NLCA 1L7PA 2BCQA 2KEYA 5KG3A 2RDIA 4DFDA 2EZZA 4BXOB 1ZD3A 2HHVA 1MN8A 1HJPA 5KFZA 2IMWP 4F4YA 1N48A 3KHRA 1XU4A 3T3FA 5AKKA 5AM0A 4RNMA 4TURA 2F3NA 5L1KA 3N28A 3OHAA 4DQIA 5DBAA 3PW2A 4YVZA 3SAHA 3ZDDA 4F8RA 1IV8A 3IN5A 4OD0A 2IA6A 3TACB 2FI1A 1KKXA 4EX6A 2UVUA 2QLTA 2EDUA 3RF9A 3GV7B 2GO7A 4KLMA 4DS5A 2HSZA 1K1SA 1GO3F 4I2CA 3THVA 2ZUCA 2FMQA 2F1HA 7ICUA 3PY8A 3FYHA 5ALWA 4BWJA 2PKEA 3JPOA 2V9WA 2RDJA 4C4RA 1J97A 3PX6A 4MEXA 1YT3A 1BPBA 1T4GA 3LK9A 3ZDCA 5D4BA 5KG2A 2HBKA 3SZ2A 2FE9A 3K75D 3RJIA 3EWAA 5J0OA 1JROA 1KLNA 2A19A 2ASLA 4GLXA 2DFLA 3IG5A 4KLDA 2KZMA 2K4EA 3M8RA 1MA7A 3LYSA 3SEIA 8ICCA 1XSPA 2B21A 5KG5A 3LDAA 7ICKA 1X6JA 9ICPA 3KZIU 3KKAC 1L7OA 3Q8QB 3RJGA 3IHQB 3N7SC 5ALTA 1PK1B 1NKCA 1ZQ1C 3T5KA 2P35A 5KFTA 4DOCA 1QSYA 3H8MA 3SV3A 1UA1A 1K1QA 1S97A 4FBTA 2UVVA 2Q0ZX 1SKWA 1ZQVA 3FC4A 1S5LU 5K4LA 5DGAA 3BQ1A 4UB5A 3RBDA 2DF4B 3SI8A 2DWQA 2YMPA 3DDHA 5ALGA 5AM1A 1D8YA 3DEEA 1CEZA 4F91B 4EX7A 1U49A 4GC7A 2AQ0A 4FBUA 3CP8A 2NRWA 5AHXA 5IIJA 4IC9A 2E5SA 2W9BB 4UAVA 4Y2UA 5KFUA 4KLEA 3C23A 4UARA 1CUKA 4M9GA 1B0XA 4P0PA 4WJ3B 5BOLA 3MGHA 1L3SA 1AROP 2E8OA 4C7YA 2W3SA 3QUQA 3H0RB 5J0YA 5CWRA 4OJ6A 4O3OA 2PFPA 4F4XA 4Z6DA 1BPXA 2KZ3A 2W9MA 5TZVA 4US8A 4Y2PA 3PX4A 1RQNA 2DPJA 4DF4A 3ETLA 3SAFA 5KT3A 3Q8MA 1UT5A 2AGOA 4Y2RA 3ORYA 8ICUA 2H3IA 5AKIA 2BCSA 3PO4A 1NK9A 3G6VA 2KIWA 2IOFA 2H3VA 5J2EA 2YB4A 4C8KA 1DXSA 1DK2A 4EZ6A 1MQ2A 2LPEA 5KAIU 2J6SA 3GDXA 1U45A 2VJ5A 3TKAA 1PZNA 4DL3A 2ZJ5A 3N4MB 3C1ZA 1L3TA 2G06A 9ICFA 4BXOA 4DFKA 3QX7A 3AM9A 4O9MA 3BQ0A 2ZJAA 1RYSA 3H8SA 1NK4A 5KT5A 2E8MA 1BPEA 4LZGA 4RQ4A 2HDOA 2BZFA 3NVVA 2NV3A 2ZTDA 3MDCA 2ZIVB 1COKA 5JU5A 3MFIA 8ICWA 2OM6A 3I1YA 3SD7A 1ZQLA 4BGDA 4KITB 3RB3A 1QQ5A 4O3QA 3TI0A 3LVWA 4R8UB 2R18A 5GTIU 5AK3A 5G5HA 4J9SA 2HMXA 1QLNA 4CDGA 4KLIA 4RPYA 1S76D 2Y0SF 4KMOB 2XO7A 4PHPA 4KLQA 1KW4A 4DL4A 3RB4A 1QQ6A 2FPMA 4YR3A 1TAUA 4TUSA 2ZIUB 5F3XB 1D8BA 2VA2A 5KFOA 2YY6A 1XO0A 3UMBA 2MU2A 4RQ2A 9ICQA 5T14A 3EYZA 9ICRA 4IR1A 1ZQMA 1ZQFA 3GIIA 1PK1A 3MFHA 4ECYA 5KFQA 2H3QA 4QWBA 4BX9C 4RQ7A 1ZD4A 4ACOA 4NXZA 2JGAA 1PK3A 1NJYA 2KJ8A 2E3TA 5F9NA 5AI9A 4J9LA 3C2LA 2BPGA 3PX0A 9ICNA 4OJOA 3V7KA 4F5NA 4U7CA 4R63A 2NYVA 2AGPA 3UM9A 5KFVA 3M7DA 2DL0A 3JPRA 2XY6A 4F5PA 4I2JA 5CA7A 4PL1A 2XI9A 1LKYB 4O5EA 4FS2A 1JXLA 5AM4A 9ICVA 2W9BA 2HHQA 1X2IA 9ICEA 2LM1A 1L7MA 3L5KA 4ECWA 4YXMA 4IQUA 5HMLA 1XS9D 2VKQA 1NJXA 9ICTA 3WK4A 1Y88A 4I2EA 3FAHA 2HW3A 1Q8KA 5ALIA 1SL2A 1SV0C 3AMZA 5KFKA 4GC6A 4KLLA 2R8GA 4EELA 3TFRA 4I2BA 3MR5A 1VLBA 3QXGA 3WKCA 4R66A 5AKYA 5DQHA 1ZQJA 2HHSA 5EE0A 2FDRA 5IINA 5DG7A 3AEVA 5KL1B 2RHFA 4QIWF 3MGIA 4FFDA 4NL9A 2Y1IA 2R8HA 1NOMA 1ZJNA 1XC9A 5AI4A 4M47A 4C4TA 4IRKA 4KTQA 2OCEA 3UMCA 4KLGA 4QW8A 3J81j 1KN5A 4QZAA 2KTQA 4I2HA 1ZQRA 2D6FC 3V6KA 2DPIA 2HBLA 4EBDA 2K4HA 4JB3A 4O3PA 1WG8A 3SENA 4AP9A 2ZXHA 4RQ0A 4YG2A 1JX4A 5ALOA 1RYRA 4O5CA 1U9LA 1HEKA 3Q8LA 1X9SA 3F2DA 2OXOA 4YD2A 3PW7A 4B9LA 2GOLA 3EUB2 3OJUA 3KD3A 1PUZA 2IOFK 5D49A 2BQUA 1V9PA 3AN1A 4KMUA 1ZQKA 9ICAA 2W3RA 2ZIVA 1WUDA 5L1JA 4OJLA 1A0PA 2NRVA 4EYIB 3QU5A 2W43A 2OYYA 2V4RA 4QZGA 1ZD5A 1F44A 5AM2A 2JV3A 2WF5A 3RAQA 4Y2SA 2JZBB 2HCFA 5J2AA 4M2YA 5E79U 4RQ5A 2KHQA 2RLTA 4G3IA 3WKEA 2JRZA 4JUZA 4ED7A 1SL0A 2Y0SC 1DOQA 3D2NA 5AM3A 1WCNA 2O6KA 4EZ9A 2K4IA 4R8UA 1RM6C 2H3FA 2F2AB 5CB1A 3H8WA 1DGSA 3C29A 9ICJA 4F3OA 5DB6A 4KX3A 5EWFA 5KT7A 2HHWA 4NLNA 5J0RA 3NVWA 4UBCA 1ZQTA 4PZOA 1TK5A 1ZQCA 4BDPA 4O3NA 3HWTA 1UA0A 2VA3A 3PW5A 1NJWA 4OJPA 2HOFA 1KBUA 3OHBA 4NLZA 4PHAA 2ZIUA 5KAFU 2K8CB 4QWAA 4ELTA 5DQIA 4QWDA 2EQYA 3EZ5A 1S8OA 3PSTA 3H0LB 1WYGA 2DBYA 4MFAA 2B6GA 3QU4A 4UBBA 2H3ZA 5J2CA 3KHGA 1BGXT 1RQLA 1U47A 2XGQA 4E0DA 1Z4OA 1PVQA 3V6JA 3GIJA 4R64A 5CR0A 4M9HA 1BNOA 3OJSA 1UHUA 1SWWA 4DL2A 4ECSA 4F2RA 5AI5A 4ICAA 4UB1A 1SWVA 1L8LA 5HNKA 1D9FA 4YCXA 1ZQNA 4C8OA 4ECQA 4C8MA 4Y2VA 5ALZA 4CNQA 4ELUA 5AKLA 5ALPA 2RQ5A 1LKYA 3MGVA 2KJ9A 4FZLA 3U26A 5HR6A 4OCZA 4NL9C 2YMMA 3SQIA 2BCUA 5CHGA 3Q8KA 2I6XA 2E8NA 4KLHA 3IRUA 1DK3A 8ICSA 3WKBA 4KX5A 2PMZC 1UCVA 1N56A 2R8JA 4AYBF 4B9UA 2MRLA 5J0XA 2E1FA 5KFRA 4RZRA 3MDAA 1NK0A 4KLUA 7ICPA 5KT2A 4QNLA 4DSFA 3UQ2A 5J2KA 2W7PA 3V72A 2G0AA 3QUCA 1F5SA 4NM1A 2AQ4A 2ODGA 5B66U 3OPXA 2Y1JA 4PJ0U 4MF2A 2JEJA 1SZPA 2Y9UA 3GV5B 1S0OA 2XIDA 1JI7A 4KLFA 2UVRA 4DQSA 2D8CA 4ECUA 1RG6A 1FEZA 4DF8A 2AH5A 4UB4A 1L5UA 1B22A 2KG5A 5J29A 1ZQEA 3JPPA 3SAGA 4JK1A 3ED5A 1NK7A 2F76X 1RXWA 1J2MA 3BZKA 3E58A 4UAWA 1L3UA 4BWMA 2HHXA 4Q43A 1NJZA 2KSOB 4I2AA 5DB9A 2ASDA 3NRZA 5AIAA 3NGDA 1KFDA 4J9KA 2XVTA 4FZNA 4PPXA 5DG9A 1BVSA 7ICMA 1MSWD 4ZOHC 2ZIXB 1PVRA 1BNPA 1ZRNA 4PL2A 3F2CA 1T3QA 3SMVA 4DOAA 3PW0A 4O5KA 8ICAA 4KLJA 3WKAA 4B9MA 2KD1A 3H0MB 2KVSA 2CXYA 1N5XA 2RP5A 9ICIA 2JZBA 2WHEA 3TAPA 4DSJA 5HHHA 5IIMA 2KIVA 3OTQA 4QZDA 2GWSA 2OH2A 1KRPA 4G9BA 8ICZA 2G5IB 2KMDA 4ED6A 2DGZA 5AICA 1BPDA 1VJ5A 4B9VA 5C5JA 1UPHA 4YMMA 4GXJA 2ASJA 3HJEA 4CF4A 1ZQOA 2FJ6A 3N7RC 2JEGA 2ISOA 4UAYA 3L4PA 1TE2A 4EBCA 3RRGA 1SZHA 3KOOA 1ED1A 2JH7A 3BS7A 3ZDEA 1ZJMA 4EEYA 4DOBA 1V85A 2KN7A 3E0FA 7ICHA 1F0MA 3RB0A 2ISPA 3D2SA 1WWVA 5EOZA 2K89A 4P4MA 2EANA 1RDFA 1IIPA 4I2FA 4DCCA 2C2RA 4F2SA 4HAIA 4PGXA 5KFIA 1ZD2P 3TADA 4DWIA 4US9A 2J6UA 1JIHA 1JN3A 1H38A 4JWNA 3M6ZA 2FLLA 1B4FA 5TISU 8ICGA 5EWGA 4YMOA 3PVXA 3C5FA 3RR7A 7ICJA 4RQNA 1SKRA 3O0FA 5KFGA 1P7DA 2LM4A 2WF6A 2KVCA 3K1ZA 4PZNA 4QZ9A 3ZD9A 5ALXA 4YR2A 3LWLA 3RBEA 4K4GA 2KZZA 2CPRA 2BPFA 4IRDA 4MHVA 4F4KA 3PV8A 1RYUA 4Q44A 4Y2TA 4X5VA 3AU2A 2JXJA 4A8EA 2RRDA 4DO9A 2PI5A 4O0IA 4EENA 8ICJA 3AQFA 4RQ8A 3MR2A 1KDHA 1ZYQA 3EPIA 4UB8U 1XO1A 2KNJA 4F92B 3PZPA 5CRXA 4UW9A 5CP2A 3H4BA 1L6NA 5KTQA 2ALZA 1O03A 4NLGA 7ICGA 9ICHA 4DS4A 3SV4A 4QWCA 3IG8A 1BPZA 1ZQGA 4U6PA 3QU7A 5J0PA 3OSNA 1ZQHA 1QSSA 2KFNA 3NVZA 2NRXA 1SXEA 3CYMA 4PGQA 4BUGA 4I2IA 2XGPA 2ES6A 2XY7A 1X9XA 3GILA 1Z4NA 5DBBA 2ZG6A 4Y2XA 4Y2JA 4Y2QA 2HOIA 5ALHA 2WFAA 4F50A 1NKEA 2XY5A 3QUBA 4IQVA 5KFNA 3V7JA 3C21A 3RR8A 3BDPA 2FMPA 8ICFA 3HP6A 4J9NA 2QARB 5ALMA 4B9TA 4M04A 4RPXA 1LVHA 5IIIA 3F2BA 5HP4A 2KSOA 3ZDBA 3GIKA 5ALUA 5C0YA 1CRXA 2FMSA 3ZI4A 1SV4A 3E2EA 2M9NA 8ICNA 5KFWA 4F4WA 2ZIXA 3VCBA 3KTQA 2Q4TA 3D2QA 5F9LA 1M6YA 5ALYA 3RAXA 3OSPA 4DFPA 3CRXA 1N62A 1LV5A 4QZFA 2LHTA 2IHNA 2JR5A 5AKEA 3PR5B 4DSEA 1NZBA 4P4PA 3RJJA 1S0MA 4DFJA 3IV6A 4USAA 5HMMA 2LYAA 1HUOA 2A1AA 2D3DA 4CF5A 4DLEA 4R65A 3RTVA 2H5XA 5BOMA 2E8PA 1WCLA 1A76A 4QZEA 2VIXA 3OGUA 2KK0A 2W8KA 3GU3A 2N1RA 4QZ8A 1TKDA 5KFJA 3ALRA 3AU6A 1PVPA 3KHLA 8ICBA 1U48A 3G6XA 3TADC 2YB1A 3B0XA 5KG0A 5KFDA 5KFCA 3AL0B 2W54A 5ALFA 1UT8A 2KICA 5KFBA 1EXNA 1OUQA 5J0SA 3K1RB 4J9OA 3ISBA 8ICVA 5EE1A 5IIOA 9ICXA 2LYBA 4XRHA 3QU9A 1D9DA 2XCPA 1SGGA 5ALEA 1ZQPA 1DRGA 3Q8PB 2EH9A 2R8IA 3JPQA 5KFMA 2M0NA 4RQ6A 7ICTA 3PSIA 8ICKA 1URJA 2BR0A 2QKQA 2K60A 5KFYA 3RH4A 2HHTA 8ICQA 2HVIA 1A6SA 7ICEA 2XICA 4F5OA 3C2MA 4EBEA 4B9SA 4JWMA 4UAUA 4FS1A 2IHMA 3BS5B 2BDUA 1ZQXA 5DB7A 2KOBA 4JMUA 1JALA 1L8OA
chains in the Genus database with same CATH topology
3BS5A 1B0XA 1X66A 1LKYA 2E8OA 4MHVA 2JV3A 2ESEA 2EAOA 2KE7A 4NL9C 2GLEA 5JRTA 1SV0C 2E8NA 2FE9A 1SV0A 2KIVA 4IS7A 1UCVA 5J8YA 2D3DA 2KMDA 5L1MA 1X40A 2E8PA 3BQ7A 1KW4A 1UQVA 4RQMA 3SEIA 4PZOA 3TADC 3KKAC 5F3XB 4NL9A 3KKAA 1DXSA 1PK1B 1SXEA 2LPEA 2ES6A 2Y9UA 2EAPA 3BS7A 3K1RB 1X9XA 2LMRA 1V85A 3H8MA 1PK1A 1JI7A 2L5YA 1F0MA 2B6GA 1WWVA 2DKXA 1OW5A 1V38A 2D8CA 1Z1VA 2F8KA 1RG6A 2EANA 1PK3A 1SGGA 3SENA 1OXJA 2KG5A 3TADA 2F3NA 3HILA 2E8MA 2QB0B 1WWUA 2QARB 2QKQA 2DKZA 1B4FA 2KSOB 2K60A 2QB0A 2F44A 1COKA 3TACB 5JU5A 2K4PA 2QARA 5JTIA 2EAMA 3IDWA 2DL0A 2QB1A 4RQNA 4NJ8A 2KSOA 1SXDA 3BS5B 2Y9TA 2YTUA 5J8YC 1LKYB 5KNIA 4PZNA 1SV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS5 A;  1B0X A;  1X66 A;  1LKY A;  2E8O A;  4MHV A;  2JV3 A;  2ESE A;  2EAO A;  2KE7 A;  4NL9 C;  2GLE A;  5JRT A;  1SV0 C;  2E8N A;  2FE9 A;  1SV0 A;  2KIV A;  4IS7 A;  1UCV A;  5J8Y A;  2D3D A;  2KMD A;  5L1M A;  1X40 A;  2E8P A;  3BQ7 A;  1KW4 A;  1UQV A;  4RQM A;  3SEI A;  4PZO A;  3TAD C;  3KKA C;  5F3X B;  4NL9 A;  3KKA A;  1DXS A;  1PK1 B;  1SXE A;  2LPE A;  2ES6 A;  2Y9U A;  2EAP A;  3BS7 A;  3K1R B;  1X9X A;  2LMR A;  1V85 A;  3H8M A;  1PK1 A;  1JI7 A;  2L5Y A;  1F0M A;  2B6G A;  1WWV A;  2DKX A;  1OW5 A;  1V38 A;  2D8C A;  1Z1V A;  2F8K A;  1RG6 A;  2EAN A;  1PK3 A;  1SGG A;  3SEN A;  1OXJ A;  2KG5 A;  3TAD A;  2F3N A;  3HIL A;  2E8M A;  2QB0 B;  1WWU A;  2QAR B;  2QKQ A;  2DKZ A;  1B4F A;  2KSO B;  2K60 A;  2QB0 A;  2F44 A;  1COK A;  3TAC B;  5JU5 A;  2K4P A;  2QAR A;  5JTI A;  2EAM A;  3IDW A;  2DL0 A;  2QB1 A;  4RQN A;  4NJ8 A;  2KSO A;  1SXD A;  3BS5 B;  2Y9T A;  2YTU A;  5J8Y C;  1LKY B;  5KNI A;  4PZN A;  1SV4 A; 
#chains in the Genus database with same CATH topology
 5BPC A;  4F5Q A;  2MUT B;  2CRX A;  1Q3U A;  2ZTC A;  2NRZ A;  3T5H A;  2PI4 A;  1YZ6 A;  1BPY A;  5DB8 A;  2HBM A;  4CGZ A;  3M8S A;  5AKZ A;  1N60 A;  3JPN A;  1NK5 A;  2HHU A;  5HR7 A;  1T7P A;  4Z6C A;  3KFU F;  5KT6 A;  4RUA A;  1JUD A;  2BDP A;  1X40 A;  1UQV A;  1ZQU A;  4YFK A;  7ICF A;  4ED2 A;  2C2E A;  4UB6 U;  2NRT A;  2MSN A;  2PFO A;  2BGW A;  1ZQS A;  5KFF A;  1ZQY A;  5KFH A;  5AKX A;  1NKB A;  1RPL A;  1ZQB A;  3KKA A;  4XQ8 A;  1S0V A;  4IR9 A;  7ICN A;  1C7Y A;  5AI0 A;  7ICS A;  4J9M A;  5J0T A;  4QW9 A;  3RH5 A;  1XNS A;  4YN4 A;  4UB3 A;  2YN4 A;  9ICW A;  4F5R A;  2A3V A;  2VAN A;  2AGQ A;  1ZQD A;  2WB1 F;  4F72 A;  1V38 A;  5J2H A;  1TVA A;  1Z1V A;  3FM9 A;  1A77 A;  7ICQ A;  5J0U A;  4OO1 J;  3I76 A;  2OWO A;  4YP3 A;  4P4O A;  1XSL A;  3A0B U;  7ICI A;  3MR6 A;  2YX8 A;  3NAS A;  4OJ5 A;  1N63 A;  2QAR A;  2QB1 A;  2P66 A;  4C4S A;  8ICY A;  3V6H A;  2Y9T A;  1X42 A;  1QQ7 A;  2JMG A;  4IQW A;  3F5E A;  4DL5 A;  2LBO A;  1Z19 A;  3KZX A;  4NM2 A;  4I2D A;  4C8L A;  1COO A;  5J2I A;  2GLE A;  2LYH A;  1ZOL A;  4DQR A;  4ZH4 A;  4GXI A;  5ALK A;  3QU2 A;  9ICK A;  3IM1 A;  3RH6 A;  5G5G A;  4O3S A;  4ECZ A;  2F1I A;  2R8K A;  2HVH A;  3H7I A;  2MAX A;  5ALV A;  4XUS A;  3TFS A;  2C2D A;  2LKY A;  3ICX A;  4P0Q B;  2VA8 A;  4O3M A;  1N61 A;  3HRD D;  1IG6 A;  5AKG A;  4J9R A;  3RJF A;  5AK4 A;  2G08 A;  4DL7 A;  1TAQ A;  1B43 A;  1IXR A;  4PHD A;  4JV2 A;  4FZM A;  5DG8 A;  4ED1 A;  1T94 A;  2KP7 A;  1T8E A;  7ICR A;  3RJE A;  2WAQ F;  4KN4 A;  3M1Y A;  5ALS A;  1SIJ A;  3D6J A;  3CNH A;  3C2K A;  5AI6 A;  4QZH A;  1SB3 C;  5KG6 A;  2W8L A;  2LMR A;  2KFZ A;  4QIW C;  2L5Y A;  4YD1 A;  3B9J A;  1OW5 A;  2HI0 A;  1X9M A;  3GFK B;  3IP4 B;  1N2X A;  2WF8 A;  9ICL A;  1NZP A;  4M6W B;  3GV8 B;  1C20 A;  1MQ3 A;  5J2B A;  3UPQ A;  2ZJ8 A;  3IDW A;  4CRX A;  5KG7 A;  5IIL A;  8ICM A;  4PH5 A;  3MC1 A;  1J2N A;  5AKH A;  8ICL A;  3BS5 A;  2YQE A;  5HHI A;  4ECR A;  4J03 A;  1X66 A;  1XWL A;  1Q3V A;  1KQQ A;  4JV0 A;  4F71 A;  4YQW A;  2ESE A;  1KEJ A;  5KG4 A;  5DKW A;  5KT4 A;  1KTQ A;  4P2H A;  3ISD A;  2MUT A;  4M0A A;  3NS1 A;  4B9N A;  4KLO A;  1LB2 B;  5J0Q A;  1ECW A;  4RT2 A;  4MF8 A;  3PSP A;  3KHH A;  4J9Q A;  3WU2 U;  8ICX A;  4ED8 A;  4M9L A;  4CF3 A;  2W04 A;  4BJQ A;  3BQ7 A;  2ZTE A;  1YZ7 A;  3NVY A;  1TK0 A;  3ZD8 A;  4EYH B;  2IBK A;  5B5E U;  1ZQW A;  3RJH A;  4Y2Y A;  9ICU A;  3NUQ A;  3C5G A;  2FPK A;  3HX0 A;  1FO4 A;  1IM4 A;  1NI3 A;  3M6K A;  4ECX A;  4MEY A;  2WB1 C;  5KFE A;  2EAP A;  3BQT A;  9ICB A;  2BPC A;  2BQ3 A;  4ECV A;  3QZ8 A;  2DKX A;  2K8B B;  4QZC A;  5IIK A;  2C22 A;  4RNO A;  1X9W A;  1ZQQ A;  4CE6 A;  4ECT A;  4K4I A;  2GH1 A;  3EPG A;  3ZDA A;  3NTU A;  4ED3 A;  4FE3 A;  5EE3 A;  1HUZ A;  5AK5 A;  3TAR A;  5JUM A;  5KG1 A;  1Z00 B;  2EAM A;  4DLG A;  8ICR A;  9ICM A;  2AXT U;  1SXD A;  4F93 B;  3UQ0 A;  7ICO A;  3HW8 A;  3PO5 A;  4FO6 A;  2FPL A;  3NRW A;  5AM5 A;  2P6R A;  1ZQA A;  2ZIW B;  4Z6E A;  1L3V A;  4LVS A;  1S0N A;  4UQG A;  2V4Q A;  2DQN B;  4HYK A;  2F1J A;  1TFR A;  2WF9 A;  5JRT A;  4YR0 A;  4QWE A;  4Q8F A;  2OHF A;  5KL8 B;  1SV0 A;  3UMG A;  5ALL A;  3HKZ F;  2W9C B;  3G6Y A;  2ATL A;  1JMS A;  5J8Y A;  5L1M A;  4QJF B;  2ZUB A;  5J2J A;  4I2G A;  5CJ7 A;  2BKE A;  3SYZ A;  4GFJ A;  4C0Z A;  4P0Q A;  1QSL A;  3QEA Z;  2WAQ C;  2AHO B;  2NO5 A;  5AK6 A;  5KFP A;  7ICL A;  2PFN A;  3T79 A;  4AYB C;  3WKD A;  3QZ7 A;  3WK8 A;  2I1Q A;  2JH1 A;  1S9F A;  2HBJ A;  1X6I A;  5ALD A;  2K8A A;  4YXJ A;  5CEH A;  3ONN A;  5DLG A;  2C28 A;  5GTH U;  5ALJ A;  4TQS A;  4I27 A;  2G5H B;  5DGB A;  4UAS A;  5DBC A;  5A0L A;  2FLN A;  1OXJ A;  4UB2 A;  1QH9 A;  4IRC A;  2QB0 B;  1NNL A;  2W9A A;  3B0Y A;  4JV1 A;  5L1I A;  8ICP A;  1HIW A;  2DUY A;  2F44 A;  3S6J A;  2PFQ A;  3GZF A;  2K4P A;  4RPZ A;  4M6W A;  2A1J B;  4NJ8 A;  4PHE A;  4F4Z A;  2P6U A;  3I28 A;  5EE9 A;  2YML A;  5AI8 A;  2YTU A;  9ICS A;  5EWE A;  3GIM A;  4IQT A;  3AUO A;  3MR3 A;  3M9O B;  1SL1 A;  2XCA A;  2Z7J A;  1ZQI A;  1AQ6 A;  3BJY A;  2KKP A;  4RQ1 A;  3JPT A;  3V7L A;  1L7N A;  3F53 A;  3AQE A;  3ISC A;  5ALQ A;  4LZD A;  4LJX A;  4RNN A;  9ICO A;  4Q45 A;  5DDM A;  1V97 A;  2BCV A;  4KN7 A;  1Z1B A;  2JEI A;  4RQ3 A;  1RXV A;  5D46 A;  4RQM A;  2WF7 A;  2BCR A;  4CCH A;  2XC9 A;  3QE9 Y;  3QNM A;  3DV9 A;  2HOQ A;  3H40 A;  1T3N A;  2VJ4 A;  4RU9 A;  1MC8 A;  3R9K A;  3UXP A;  4DSK A;  4M9N A;  2W55 A;  8ICE A;  4QZI A;  4TQR A;  3T5L A;  9ICG A;  3JPS A;  5FP0 A;  2EZX A;  4Z6F A;  1JXE A;  4ED0 A;  1FFV A;  3HT3 A;  3WK9 A;  2PXI A;  4J9P A;  3HIL A;  4DQP A;  4B6J A;  1ZET A;  3H8J A;  5J2F A;  3UXO A;  3KBB A;  1U4B A;  2DKZ A;  3M9M B;  5J0W A;  3BZC A;  4DSI A;  1K5O A;  4Q8E A;  3GQC A;  2UVW A;  2YMQ A;  1ZXI A;  5DQG A;  3PNC A;  1FIQ A;  3BQ2 A;  5J2D A;  5J8Y C;  2OEH A;  2CN1 A;  2ZUD A;  4RT3 A;  3HPO A;  4QZB A;  1Z00 A;  1O08 A;  3TAQ A;  1CI4 A;  2IOH A;  1SKS A;  2I5H A;  1ZQZ A;  2PMZ F;  4MFC A;  9ICC A;  3CW2 C;  2ZIW A;  5KFX A;  1ZRM A;  3WK5 A;  2KE7 A;  8ICI A;  5KFA A;  1KSP A;  3HKZ C;  4C80 A;  4XA5 A;  4IS7 A;  1KFT A;  1NK6 A;  2W7O A;  3VC8 A;  5ALR A;  2NO4 A;  1DGJ A;  7ICV A;  2W11 A;  2W9C A;  3N97 B;  3A0H U;  5ALN A;  3PR4 A;  3L3F X;  1Q46 A;  8ICO A;  3FDS A;  4DFM A;  2KJ5 A;  2J6T A;  3M9N B;  2JEF A;  3EW9 A;  3WK6 A;  8ICH A;  4DSL A;  1XSN A;  3C1Y A;  1Z3E B;  4KLT A;  8ICT A;  2BHN A;  1N5W A;  3QYP A;  4O3R A;  3MAB A;  5H2F U;  4K4H A;  2AJQ A;  4IL6 U;  4I29 A;  2I9G A;  5KFL A;  2F8L A;  1JRP A;  4DEZ A;  4NV0 A;  1QCK A;  2F8K A;  5AKJ A;  4C7Z A;  1FFU A;  4UAZ A;  1S10 A;  2WTF A;  4DQQ A;  1TV9 A;  4KLS A;  3RFA A;  4PGY A;  2JHD A;  3LVV A;  4MFF A;  1WWU A;  5KFS A;  1KFS A;  4TUQ A;  3K4G A;  4I28 A;  1KL9 A;  2QB0 A;  2KKV A;  1S77 D;  3PSF A;  2AU0 A;  4YMN A;  1QTM A;  5JTI A;  3RB6 A;  4EEK A;  3QEB Z;  4GIB A;  3N7P D;  2KHV A;  4P0P B;  1TAM A;  4NLB A;  2LI6 A;  5KNI A;  2E1E A;  3WK7 A;  1VDV A;  3RJK A;  2A1J A;  5DDY A;  4UAT A;  2W03 A;  4ELV A;  3MBY A;  3F5A A;  4RUC A;  2G07 A;  5L9X A;  2EAO A;  3UXN A;  5J2G A;  1D8L A;  3TQ1 A;  3PMN A;  3QUT A;  1TK8 A;  3T5J A;  2BQR A;  2MA1 A;  2B0C A;  5L1L A;  4NY8 A;  1NK8 A;  4GXK A;  4NLK A;  3PW4 A;  2F77 X;  3TAN A;  3SR6 A;  3RRH A;  4DL6 A;  4M9J A;  3Q8S B;  3C28 A;  4TUP A;  2EZY A;  4C8N A;  5DLF A;  1RZT A;  2G09 A;  3PML A;  2FLP A;  3LWM A;  3ETR A;  2KV2 A;  3Q8R B;  3H4D A;  4NWI A;  2ZXI A;  5AIB A;  4NLC A;  1L7P A;  2BCQ A;  2KEY A;  5KG3 A;  2RDI A;  4DFD A;  2EZZ A;  4BXO B;  1ZD3 A;  2HHV A;  1MN8 A;  1HJP A;  5KFZ A;  2IMW P;  4F4Y A;  1N48 A;  3KHR A;  1XU4 A;  3T3F A;  5AKK A;  5AM0 A;  4RNM A;  4TUR A;  2F3N A;  5L1K A;  3N28 A;  3OHA A;  4DQI A;  5DBA A;  3PW2 A;  4YVZ A;  3SAH A;  3ZDD A;  4F8R A;  1IV8 A;  3IN5 A;  4OD0 A;  2IA6 A;  3TAC B;  2FI1 A;  1KKX A;  4EX6 A;  2UVU A;  2QLT A;  2EDU A;  3RF9 A;  3GV7 B;  2GO7 A;  4KLM A;  4DS5 A;  2HSZ A;  1K1S A;  1GO3 F;  4I2C A;  3THV A;  2ZUC A;  2FMQ A;  2F1H A;  7ICU A;  3PY8 A;  3FYH A;  5ALW A;  4BWJ A;  2PKE A;  3JPO A;  2V9W A;  2RDJ A;  4C4R A;  1J97 A;  3PX6 A;  4MEX A;  1YT3 A;  1BPB A;  1T4G A;  3LK9 A;  3ZDC A;  5D4B A;  5KG2 A;  2HBK A;  3SZ2 A;  2FE9 A;  3K75 D;  3RJI A;  3EWA A;  5J0O A;  1JRO A;  1KLN A;  2A19 A;  2ASL A;  4GLX A;  2DFL A;  3IG5 A;  4KLD A;  2KZM A;  2K4E A;  3M8R A;  1MA7 A;  3LYS A;  3SEI A;  8ICC A;  1XSP A;  2B21 A;  5KG5 A;  3LDA A;  7ICK A;  1X6J A;  9ICP A;  3KZI U;  3KKA C;  1L7O A;  3Q8Q B;  3RJG A;  3IHQ B;  3N7S C;  5ALT A;  1PK1 B;  1NKC A;  1ZQ1 C;  3T5K A;  2P35 A;  5KFT A;  4DOC A;  1QSY A;  3H8M A;  3SV3 A;  1UA1 A;  1K1Q A;  1S97 A;  4FBT A;  2UVV A;  2Q0Z X;  1SKW A;  1ZQV A;  3FC4 A;  1S5L U;  5K4L A;  5DGA A;  3BQ1 A;  4UB5 A;  3RBD A;  2DF4 B;  3SI8 A;  2DWQ A;  2YMP A;  3DDH A;  5ALG A;  5AM1 A;  1D8Y A;  3DEE A;  1CEZ A;  4F91 B;  4EX7 A;  1U49 A;  4GC7 A;  2AQ0 A;  4FBU A;  3CP8 A;  2NRW A;  5AHX A;  5IIJ A;  4IC9 A;  2E5S A;  2W9B B;  4UAV A;  4Y2U A;  5KFU A;  4KLE A;  3C23 A;  4UAR A;  1CUK A;  4M9G A;  1B0X A;  4P0P A;  4WJ3 B;  5BOL A;  3MGH A;  1L3S A;  1ARO P;  2E8O A;  4C7Y A;  2W3S A;  3QUQ A;  3H0R B;  5J0Y A;  5CWR A;  4OJ6 A;  4O3O A;  2PFP A;  4F4X A;  4Z6D A;  1BPX A;  2KZ3 A;  2W9M A;  5TZV A;  4US8 A;  4Y2P A;  3PX4 A;  1RQN A;  2DPJ A;  4DF4 A;  3ETL A;  3SAF A;  5KT3 A;  3Q8M A;  1UT5 A;  2AGO A;  4Y2R A;  3ORY A;  8ICU A;  2H3I A;  5AKI A;  2BCS A;  3PO4 A;  1NK9 A;  3G6V A;  2KIW A;  2IOF A;  2H3V A;  5J2E A;  2YB4 A;  4C8K A;  1DXS A;  1DK2 A;  4EZ6 A;  1MQ2 A;  2LPE A;  5KAI U;  2J6S A;  3GDX A;  1U45 A;  2VJ5 A;  3TKA A;  1PZN A;  4DL3 A;  2ZJ5 A;  3N4M B;  3C1Z A;  1L3T A;  2G06 A;  9ICF A;  4BXO A;  4DFK A;  3QX7 A;  3AM9 A;  4O9M A;  3BQ0 A;  2ZJA A;  1RYS A;  3H8S A;  1NK4 A;  5KT5 A;  2E8M A;  1BPE A;  4LZG A;  4RQ4 A;  2HDO A;  2BZF A;  3NVV A;  2NV3 A;  2ZTD A;  3MDC A;  2ZIV B;  1COK A;  5JU5 A;  3MFI A;  8ICW A;  2OM6 A;  3I1Y A;  3SD7 A;  1ZQL A;  4BGD A;  4KIT B;  3RB3 A;  1QQ5 A;  4O3Q A;  3TI0 A;  3LVW A;  4R8U B;  2R18 A;  5GTI U;  5AK3 A;  5G5H A;  4J9S A;  2HMX A;  1QLN A;  4CDG A;  4KLI A;  4RPY A;  1S76 D;  2Y0S F;  4KMO B;  2XO7 A;  4PHP A;  4KLQ A;  1KW4 A;  4DL4 A;  3RB4 A;  1QQ6 A;  2FPM A;  4YR3 A;  1TAU A;  4TUS A;  2ZIU B;  5F3X B;  1D8B A;  2VA2 A;  5KFO A;  2YY6 A;  1XO0 A;  3UMB A;  2MU2 A;  4RQ2 A;  9ICQ A;  5T14 A;  3EYZ A;  9ICR A;  4IR1 A;  1ZQM A;  1ZQF A;  3GII A;  1PK1 A;  3MFH A;  4ECY A;  5KFQ A;  2H3Q A;  4QWB A;  4BX9 C;  4RQ7 A;  1ZD4 A;  4ACO A;  4NXZ A;  2JGA A;  1PK3 A;  1NJY A;  2KJ8 A;  2E3T A;  5F9N A;  5AI9 A;  4J9L A;  3C2L A;  2BPG A;  3PX0 A;  9ICN A;  4OJO A;  3V7K A;  4F5N A;  4U7C A;  4R63 A;  2NYV A;  2AGP A;  3UM9 A;  5KFV A;  3M7D A;  2DL0 A;  3JPR A;  2XY6 A;  4F5P A;  4I2J A;  5CA7 A;  4PL1 A;  2XI9 A;  1LKY B;  4O5E A;  4FS2 A;  1JXL A;  5AM4 A;  9ICV A;  2W9B A;  2HHQ A;  1X2I A;  9ICE A;  2LM1 A;  1L7M A;  3L5K A;  4ECW A;  4YXM A;  4IQU A;  5HML A;  1XS9 D;  2VKQ A;  1NJX A;  9ICT A;  3WK4 A;  1Y88 A;  4I2E A;  3FAH A;  2HW3 A;  1Q8K A;  5ALI A;  1SL2 A;  1SV0 C;  3AMZ A;  5KFK A;  4GC6 A;  4KLL A;  2R8G A;  4EEL A;  3TFR A;  4I2B A;  3MR5 A;  1VLB A;  3QXG A;  3WKC A;  4R66 A;  5AKY A;  5DQH A;  1ZQJ A;  2HHS A;  5EE0 A;  2FDR A;  5IIN A;  5DG7 A;  3AEV A;  5KL1 B;  2RHF A;  4QIW F;  3MGI A;  4FFD A;  4NL9 A;  2Y1I A;  2R8H A;  1NOM A;  1ZJN A;  1XC9 A;  5AI4 A;  4M47 A;  4C4T A;  4IRK A;  4KTQ A;  2OCE A;  3UMC A;  4KLG A;  4QW8 A;  3J81 j;  1KN5 A;  4QZA A;  2KTQ A;  4I2H A;  1ZQR A;  2D6F C;  3V6K A;  2DPI A;  2HBL A;  4EBD A;  2K4H A;  4JB3 A;  4O3P A;  1WG8 A;  3SEN A;  4AP9 A;  2ZXH A;  4RQ0 A;  4YG2 A;  1JX4 A;  5ALO A;  1RYR A;  4O5C A;  1U9L A;  1HEK A;  3Q8L A;  1X9S A;  3F2D A;  2OXO A;  4YD2 A;  3PW7 A;  4B9L A;  2GOL A;  3EUB 2;  3OJU A;  3KD3 A;  1PUZ A;  2IOF K;  5D49 A;  2BQU A;  1V9P A;  3AN1 A;  4KMU A;  1ZQK A;  9ICA A;  2W3R A;  2ZIV A;  1WUD A;  5L1J A;  4OJL A;  1A0P A;  2NRV A;  4EYI B;  3QU5 A;  2W43 A;  2OYY A;  2V4R A;  4QZG A;  1ZD5 A;  1F44 A;  5AM2 A;  2JV3 A;  2WF5 A;  3RAQ A;  4Y2S A;  2JZB B;  2HCF A;  5J2A A;  4M2Y A;  5E79 U;  4RQ5 A;  2KHQ A;  2RLT A;  4G3I A;  3WKE A;  2JRZ A;  4JUZ A;  4ED7 A;  1SL0 A;  2Y0S C;  1DOQ A;  3D2N A;  5AM3 A;  1WCN A;  2O6K A;  4EZ9 A;  2K4I A;  4R8U A;  1RM6 C;  2H3F A;  2F2A B;  5CB1 A;  3H8W A;  1DGS A;  3C29 A;  9ICJ A;  4F3O A;  5DB6 A;  4KX3 A;  5EWF A;  5KT7 A;  2HHW A;  4NLN A;  5J0R A;  3NVW A;  4UBC A;  1ZQT A;  4PZO A;  1TK5 A;  1ZQC A;  4BDP A;  4O3N A;  3HWT A;  1UA0 A;  2VA3 A;  3PW5 A;  1NJW A;  4OJP A;  2HOF A;  1KBU A;  3OHB A;  4NLZ A;  4PHA A;  2ZIU A;  5KAF U;  2K8C B;  4QWA A;  4ELT A;  5DQI A;  4QWD A;  2EQY A;  3EZ5 A;  1S8O A;  3PST A;  3H0L B;  1WYG A;  2DBY A;  4MFA A;  2B6G A;  3QU4 A;  4UBB A;  2H3Z A;  5J2C A;  3KHG A;  1BGX T;  1RQL A;  1U47 A;  2XGQ A;  4E0D A;  1Z4O A;  1PVQ A;  3V6J A;  3GIJ A;  4R64 A;  5CR0 A;  4M9H A;  1BNO A;  3OJS A;  1UHU A;  1SWW A;  4DL2 A;  4ECS A;  4F2R A;  5AI5 A;  4ICA A;  4UB1 A;  1SWV A;  1L8L A;  5HNK A;  1D9F A;  4YCX A;  1ZQN A;  4C8O A;  4ECQ A;  4C8M A;  4Y2V A;  5ALZ A;  4CNQ A;  4ELU A;  5AKL A;  5ALP A;  2RQ5 A;  1LKY A;  3MGV A;  2KJ9 A;  4FZL A;  3U26 A;  5HR6 A;  4OCZ A;  4NL9 C;  2YMM A;  3SQI A;  2BCU A;  5CHG A;  3Q8K A;  2I6X A;  2E8N A;  4KLH A;  3IRU A;  1DK3 A;  8ICS A;  3WKB A;  4KX5 A;  2PMZ C;  1UCV A;  1N56 A;  2R8J A;  4AYB F;  4B9U A;  2MRL A;  5J0X A;  2E1F A;  5KFR A;  4RZR A;  3MDA A;  1NK0 A;  4KLU A;  7ICP A;  5KT2 A;  4QNL A;  4DSF A;  3UQ2 A;  5J2K A;  2W7P A;  3V72 A;  2G0A A;  3QUC A;  1F5S A;  4NM1 A;  2AQ4 A;  2ODG A;  5B66 U;  3OPX A;  2Y1J A;  4PJ0 U;  4MF2 A;  2JEJ A;  1SZP A;  2Y9U A;  3GV5 B;  1S0O A;  2XID A;  1JI7 A;  4KLF A;  2UVR A;  4DQS A;  2D8C A;  4ECU A;  1RG6 A;  1FEZ A;  4DF8 A;  2AH5 A;  4UB4 A;  1L5U A;  1B22 A;  2KG5 A;  5J29 A;  1ZQE A;  3JPP A;  3SAG A;  4JK1 A;  3ED5 A;  1NK7 A;  2F76 X;  1RXW A;  1J2M A;  3BZK A;  3E58 A;  4UAW A;  1L3U A;  4BWM A;  2HHX A;  4Q43 A;  1NJZ A;  2KSO B;  4I2A A;  5DB9 A;  2ASD A;  3NRZ A;  5AIA A;  3NGD A;  1KFD A;  4J9K A;  2XVT A;  4FZN A;  4PPX A;  5DG9 A;  1BVS A;  7ICM A;  1MSW D;  4ZOH C;  2ZIX B;  1PVR A;  1BNP A;  1ZRN A;  4PL2 A;  3F2C A;  1T3Q A;  3SMV A;  4DOA A;  3PW0 A;  4O5K A;  8ICA A;  4KLJ A;  3WKA A;  4B9M A;  2KD1 A;  3H0M B;  2KVS A;  2CXY A;  1N5X A;  2RP5 A;  9ICI A;  2JZB A;  2WHE A;  3TAP A;  4DSJ A;  5HHH A;  5IIM A;  2KIV A;  3OTQ A;  4QZD A;  2GWS A;  2OH2 A;  1KRP A;  4G9B A;  8ICZ A;  2G5I B;  2KMD A;  4ED6 A;  2DGZ A;  5AIC A;  1BPD A;  1VJ5 A;  4B9V A;  5C5J A;  1UPH A;  4YMM A;  4GXJ A;  2ASJ A;  3HJE A;  4CF4 A;  1ZQO A;  2FJ6 A;  3N7R C;  2JEG A;  2ISO A;  4UAY A;  3L4P A;  1TE2 A;  4EBC A;  3RRG A;  1SZH A;  3KOO A;  1ED1 A;  2JH7 A;  3BS7 A;  3ZDE A;  1ZJM A;  4EEY A;  4DOB A;  1V85 A;  2KN7 A;  3E0F A;  7ICH A;  1F0M A;  3RB0 A;  2ISP A;  3D2S A;  1WWV A;  5EOZ A;  2K89 A;  4P4M A;  2EAN A;  1RDF A;  1IIP A;  4I2F A;  4DCC A;  2C2R A;  4F2S A;  4HAI A;  4PGX A;  5KFI A;  1ZD2 P;  3TAD A;  4DWI A;  4US9 A;  2J6U A;  1JIH A;  1JN3 A;  1H38 A;  4JWN A;  3M6Z A;  2FLL A;  1B4F A;  5TIS U;  8ICG A;  5EWG A;  4YMO A;  3PVX A;  3C5F A;  3RR7 A;  7ICJ A;  4RQN A;  1SKR A;  3O0F A;  5KFG A;  1P7D A;  2LM4 A;  2WF6 A;  2KVC A;  3K1Z A;  4PZN A;  4QZ9 A;  3ZD9 A;  5ALX A;  4YR2 A;  3LWL A;  3RBE A;  4K4G A;  2KZZ A;  2CPR A;  2BPF A;  4IRD A;  4MHV A;  4F4K A;  3PV8 A;  1RYU A;  4Q44 A;  4Y2T A;  4X5V A;  3AU2 A;  2JXJ A;  4A8E A;  2RRD A;  4DO9 A;  2PI5 A;  4O0I A;  4EEN A;  8ICJ A;  3AQF A;  4RQ8 A;  3MR2 A;  1KDH A;  1ZYQ A;  3EPI A;  4UB8 U;  1XO1 A;  2KNJ A;  4F92 B;  3PZP A;  5CRX A;  4UW9 A;  5CP2 A;  3H4B A;  1L6N A;  5KTQ A;  2ALZ A;  1O03 A;  4NLG A;  7ICG A;  9ICH A;  4DS4 A;  3SV4 A;  4QWC A;  3IG8 A;  1BPZ A;  1ZQG A;  4U6P A;  3QU7 A;  5J0P A;  3OSN A;  1ZQH A;  1QSS A;  2KFN A;  3NVZ A;  2NRX A;  1SXE A;  3CYM A;  4PGQ A;  4BUG A;  4I2I A;  2XGP A;  2ES6 A;  2XY7 A;  1X9X A;  3GIL A;  1Z4N A;  5DBB A;  2ZG6 A;  4Y2X A;  4Y2J A;  4Y2Q A;  2HOI A;  5ALH A;  2WFA A;  4F50 A;  1NKE A;  2XY5 A;  3QUB A;  4IQV A;  5KFN A;  3V7J A;  3C21 A;  3RR8 A;  3BDP A;  2FMP A;  8ICF A;  3HP6 A;  4J9N A;  2QAR B;  5ALM A;  4B9T A;  4M04 A;  4RPX A;  1LVH A;  5III A;  3F2B A;  5HP4 A;  2KSO A;  3ZDB A;  3GIK A;  5ALU A;  5C0Y A;  1CRX A;  2FMS A;  3ZI4 A;  1SV4 A;  3E2E A;  2M9N A;  8ICN A;  5KFW A;  4F4W A;  2ZIX A;  3VCB A;  3KTQ A;  2Q4T A;  3D2Q A;  5F9L A;  1M6Y A;  5ALY A;  3RAX A;  3OSP A;  4DFP A;  3CRX A;  1N62 A;  1LV5 A;  4QZF A;  2LHT A;  2IHN A;  2JR5 A;  5AKE A;  3PR5 B;  4DSE A;  1NZB A;  4P4P A;  3RJJ A;  1S0M A;  4DFJ A;  3IV6 A;  4USA A;  5HMM A;  2LYA A;  1HUO A;  2A1A A;  2D3D A;  4CF5 A;  4DLE A;  4R65 A;  3RTV A;  2H5X A;  5BOM A;  2E8P A;  1WCL A;  1A76 A;  4QZE A;  2VIX A;  3OGU A;  2KK0 A;  2W8K A;  3GU3 A;  2N1R A;  4QZ8 A;  1TKD A;  5KFJ A;  3ALR A;  3AU6 A;  1PVP A;  3KHL A;  8ICB A;  1U48 A;  3G6X A;  3TAD C;  2YB1 A;  3B0X A;  5KG0 A;  5KFD A;  5KFC A;  3AL0 B;  2W54 A;  5ALF A;  1UT8 A;  2KIC A;  5KFB A;  1EXN A;  1OUQ A;  5J0S A;  3K1R B;  4J9O A;  3ISB A;  8ICV A;  5EE1 A;  5IIO A;  9ICX A;  2LYB A;  4XRH A;  3QU9 A;  1D9D A;  2XCP A;  1SGG A;  5ALE A;  1ZQP A;  1DRG A;  3Q8P B;  2EH9 A;  2R8I A;  3JPQ A;  5KFM A;  2M0N A;  4RQ6 A;  7ICT A;  3PSI A;  8ICK A;  1URJ A;  2BR0 A;  2QKQ A;  2K60 A;  5KFY A;  3RH4 A;  2HHT A;  8ICQ A;  2HVI A;  1A6S A;  7ICE A;  2XIC A;  4F5O A;  3C2M A;  4EBE A;  4B9S A;  4JWM A;  4UAU A;  4FS1 A;  2IHM A;  3BS5 B;  2BDU A;  1ZQX A;  5DB7 A;  2KOB A;  4JMU A;  1JAL A;  1L8O A; 
#chains in the Genus database with same CATH homology
 3BS5 A;  1B0X A;  1X66 A;  1LKY A;  2E8O A;  4MHV A;  2JV3 A;  2ESE A;  2EAO A;  2KE7 A;  4NL9 C;  2GLE A;  5JRT A;  1SV0 C;  2E8N A;  2FE9 A;  1SV0 A;  2KIV A;  4IS7 A;  1UCV A;  5J8Y A;  2D3D A;  2KMD A;  5L1M A;  1X40 A;  2E8P A;  3BQ7 A;  1KW4 A;  1UQV A;  4RQM A;  3SEI A;  4PZO A;  3TAD C;  3KKA C;  5F3X B;  4NL9 A;  3KKA A;  1DXS A;  1PK1 B;  1SXE A;  2LPE A;  2ES6 A;  2Y9U A;  2EAP A;  3BS7 A;  3K1R B;  1X9X A;  2LMR A;  1V85 A;  3H8M A;  1PK1 A;  1JI7 A;  2L5Y A;  1F0M A;  2B6G A;  1WWV A;  2DKX A;  1OW5 A;  1V38 A;  2D8C A;  1Z1V A;  2F8K A;  1RG6 A;  2EAN A;  1PK3 A;  1SGG A;  3SEN A;  1OXJ A;  2KG5 A;  3TAD A;  2F3N A;  3HIL A;  2E8M A;  2QB0 B;  1WWU A;  2QAR B;  2QKQ A;  2DKZ A;  1B4F A;  2KSO B;  2K60 A;  2QB0 A;  2F44 A;  1COK A;  3TAC B;  5JU5 A;  2K4P A;  2QAR A;  5JTI A;  2EAM A;  3IDW A;  2DL0 A;  2QB1 A;  4RQN A;  4NJ8 A;  2KSO A;  1SXD A;  3BS5 B;  2Y9T A;  2YTU A;  5J8Y C;  1LKY B;  5KNI A;  4PZN A;  1SV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...