5JRTA

Crystal structure of the human tankyrase 2 (tnks2) sam domain (dh902/924re)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
64
structure length
64
Chain Sequence
VDFSITQFVRNLGLEHLMDIFEREQITLRVLVEMGHKELKEIGINAYGHREKLIKGVERLISGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Tankyrase-2
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 64
sequence length 64
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jrtA00
2EANA 4RQNA 5JRTA 3KKAC 1SV0A 4NL9A 2D8CA 5JU5A 2QB0A 2EAMA 4IS7A 2QARA 1WWVA 3H8MA 2E8PA 2KSOB 3BQ7A 2ES6A 4NL9C 3BS7A 1V38A 1LKYB 2QB1A 1COKA 2YTUA 3IDWA 1X40A 2KE7A 2F3NA 2LMRA 1F0MA 4NJ8A 3BS5A 2QB0B 2QKQA 1OW5A 1KW4A 2E8OA 5F3XB 2Y9TA 1UQVA 1RG6A 1SGGA 2DKZA 3HILA 2E8MA 1B4FA 3TADA 1SV4A 3TACB 2DKXA 2KG5A 1SXDA 2EAPA 5KNIA 2LPEA 2GLEA 2DL0A 2K60A 3TADC 2ESEA 1PK1A 2QARB 3SENA 1JI7A 5J8YA 1V85A 1LKYA 1UCVA 1X66A 2L5YA 2B6GA 2K4PA 3K1RB 5J8YC 2D3DA 1DXSA 1B0XA 1PK3A 3BS5B 1WWUA 2KIVA 1OXJA 1PK1B 2Y9UA 5L1MA 1X9XA 3SEIA 2KSOA 2F8KA 1SV0C 1SXEA 4PZOA 5JTIA 4PZNA 3KKAA 2KMDA 4MHVA 2E8NA 4RQMA 2F44A 2EAOA 1Z1VA 2FE9A 2JV3A
chains in the Genus database with same CATH superfamily
2EANA 4P0PA 1BPEA 1S5LU 3BZCA 4PL1A 4O3RA 4KLJA 3RJEA 1QQ6A 3F2CA 2QARA 2KD1A 4USAA 2HHWA 1ZJMA 5CHGA 5EE9A 3V7LA 5ALGA 5HHHA 1L3TA 8ICWA 1A77A 4F4ZA 3PMNA 1O08A 5KG4A 3SI8A 1COKA 2JEGA 3GV5B 5KFCA 2DF4B 2Y0SF 1ZJNA 5J2HA 4IRKA 1X9SA 4BJQA 4YN4A 2QLTA 2QKQA 3QXGA 3FM9A 2K4HA 3CYMA 1N60A 1ZRMA 3EWAA 1UQVA 3ETLA 3C5FA 4RUAA 4Q45A 4JK1A 2HHQA 2GH1A 3PSPA 1NJYA 4DLEA 2F2AB 4Y2QA 5DG7A 1VDVA 1J97A 1KFSA 5KFUA 4UBCA 1N5XA 4P4OA 4DSIA 4O0IA 3C29A 3I76A 2ZIXA 4Z6EA 1NK0A 2W9BB 5KFAA 3AUOA 2YMLA 2W9MA 1ED1A 1JUDA 4RNOA 2FMQA 5GTHU 3GIMA 1S76D 2G5IB 7ICHA 2L5YA 2HMXA 4FFDA 5KFTA 1N61A 4IQWA 2LI6A 4KLHA 4C8NA 1T8EA 2IOFK 5AM3A 3KHGA 5ALQA 4DQSA 1LV5A 1Q8KA 2JH7A 3KTQA 1SV0C 3MR6A 4O3MA 5ALFA 2HI0A 3KKAA 4UB6U 3DEEA 4ECWA 4KLQA 3F2DA 4DQIA 4KLFA 1JRPA 4EEYA 4ZOHC 4O5EA 4RQNA 3QNMA 3E58A 3GIJA 4DQQA 2NO5A 1RYUA 1AROP 2EAMA 5KT4A 4IQVA 4Q8EA 4UBBA 2QB1A 5KAIU 2HBMA 8ICSA 4MF2A 2LM1A 4O5KA 3IDWA 1ZQNA 3QUQA 3I28A 4K4IA 7ICGA 4DL2A 1PUZA 1MQ2A 2QB0B 5D49A 2EZZA 1RXWA 5F3XB 2YX8A 5CP2A 3GIKA 2C2EA 5BPCA 4F4YA 3LK9A 2VA3A 2EH9A 1S97A 5ALPA 5KL1B 5ALUA 3MABA 5KFHA 3RF9A 1ZYQA 4I2DA 2BCSA 4P0PB 2JZBB 2NRWA 3UM9A 4J03A 4FZLA 1S8OA 2P66A 5KG6A 3T79A 2AH5A 2QARB 3PW5A 1Z00A 5CA7A 2V4RA 1S10A 2XGQA 3HJEA 5AKZA 4F4KA 3V6JA 4R64A 3M8SA 1FFVA 2JEJA 2CN1A 9ICIA 7ICUA 2Y0SC 3SD7A 2PMZF 4KLUA 4I2HA 3JPNA 2Y9UA 5KFBA 5J0OA 3E2EA 3LWMA 3SEIA 5J0XA 4PZNA 5BOLA 4FBUA 1F5SA 1QQ7A 4C8MA 4QWDA 2J6UA 4J9LA 2OWOA 2KVSA 2G08A 1ZQEA 7ICSA 4B9NA 2H5XA 1JIHA 4LZGA 2KSOB 4UQGA 4YR3A 2ZIXB 3KD3A 3WK9A 2ASJA 5DB6A 3NUQA 3UXOA 1U45A 4DFPA 1O03A 2MUTB 3H40A 5J0YA 2EQYA 2ZXHA 3L5KA 1XC9A 1F0MA 5AK5A 4HAIA 1OW5A 3G6XA 4CDGA 3Q8PB 4NWIA 1TKDA 5AI8A 4LJXA 4PHPA 3MBYA 5KL8B 7ICTA 1RG6A 5AI0A 1UPHA 3SQIA 5HR7A 2BPFA 1V9PA 2BKEA 2G0AA 3GQCA 3ZDEA 3AM9A 2WF8A 1TE2A 3WKDA 4PJ0U 3NVYA 2K8BB 2KVCA 4ECQA 5KFDA 2PFQA 4PPXA 2DBYA 3H8SA 4UASA 2ZG6A 2ASDA 5KG2A 3PR5B 3M6ZA 2FLNA 2DQNB 1FO4A 5H2FU 2KK0A 4YMNA 1Q3VA 1ZXIA 5KG3A 1ZQVA 4QWBA 5J8YC 1S0OA 2R8JA 1KFTA 4PHEA 1B0XA 8ICBA 4Z6FA 1PK3A 3OPXA 4QW9A 2NYVA 1ZD2P 2ZTCA 3WK7A 1T3NA 5J29A 1ZD4A 1SXEA 1NI3A 8ICAA 1COOA 3C2KA 1JN3A 4ECVA 3RJGA 3T5JA 4UATA 5ALZA 2BCQA 4AP9A 4I2EA 4I2IA 3QU5A 3C2MA 4QZIA 2G5HB 4Z6CA 1Z00B 4PGQA 1RM6C 4B6JA 2G09A 5KFFA 4DF8A 1S9FA 3PX6A 2JMGA 1NK5A 4P2HA 4I2GA 1X2IA 4OCZA 4NV0A 4KLOA 3BS5A 7ICVA 4J9SA 9ICNA 2PMZC 1SL2A 4MFFA 1SGGA 2R8KA 1BPYA 1U48A 2E8MA 1U47A 1B4FA 3BDPA 3IG8A 1XO0A 5KG1A 4YCXA 5J2FA 1S0MA 1JMSA 1WYGA 4M04A 3N7PD 4IL6U 4U6PA 2BPGA 3TARA 2Q4TA 1A0PA 3D2NA 1NK8A 1ZQDA 4YVZA 4YR0A 1DK3A 2KZZA 5ALOA 3QYPA 1ZRNA 4B9VA 5J0UA 1UCVA 8ICXA 1KTQA 3QUTA 2PFPA 4DS4A 4F5NA 5AI6A 1C20A 1T4GA 4BUGA 2KIWA 1MA7A 5JUMA 3AU6A 3GZFA 3SAGA 3PZPA 3AU2A 1UT8A 3RB3A 1ZQQA 1PK1B 8ICHA 3IG5A 2A1JB 1P7DA 3HRDD 3K1ZA 2HOFA 1SWWA 2YB4A 1S0VA 2F1IA 4TQSA 4F50A 1NKBA 3BZKA 4UAVA 3R9KA 5KT5A 2FE9A 1SIJA 4XA5A 3V7KA 5KFXA 2H3VA 3K4GA 5CJ7A 2IMWP 9ICHA 3WKCA 2BCUA 4CF3A 9ICXA 3VC8A 3RH6A 4A8EA 4IQTA 4NL9C 3T5HA 1S0NA 3PX0A 3V6KA 3NVVA 2M0NA 1S77D 1U49A 4ED3A 5ALHA 9ICCA 5F9NA 2IHMA 1X40A 9ICRA 5DDMA 4OJ6A 4UAZA 3PSTA 2XY6A 4R65A 4J9MA 1ZQLA 4DFDA 4DL5A 5AK4A 1NJZA 4MFAA 1ZQHA 2A19A 4I29A 3TANA 3RTVA 4U7CA 4TUPA 4RQ7A 2A3VA 3AQFA 3NS1A 2BPCA 2F76X 5AKXA 1SXDA 5EWFA 1Z4OA 8ICQA 3I1YA 2BCVA 3ALRA 4Y2TA 1KLNA 3KFUF 8ICUA 3ZD9A 2NRZA 4C8OA 1YZ7A 5DB9A 1D9FA 4GLXA 4EBCA 5FP0A 1UHUA 2VKQA 5KFPA 1Z1BA 2P6UA 2K4EA 3PW0A 8ICKA 5IIIA 3L3FX 3V7JA 3BS5B 8ICGA 1LB2B 2AJQA 4NM1A 1C7YA 1TK0A 3PX4A 2N1RA 3H8WA 4KLIA 3TI0A 5CRXA 1PVQA 3LVWA 3WKAA 3RRHA 2E8NA 3EPIA 4QWEA 3O0FA 1QSSA 5ALYA 2XVTA 1X6JA 2JEFA 7ICQA 4P4MA 4F5QA 3OGUA 4KN7A 1T94A 4IC9A 2QB0A 3EW9A 5TISU 2W8LA 4I2CA 1ZQUA 5KG0A 3QU2A 1SKRA 4RUCA 3FYHA 9ICMA 1ZQ1C 2ES6A 1NZBA 4ECRA 3IV6A 2XICA 2IOFA 4B9LA 3F2BA 4DWIA 2E1FA 3WU2U 3B0YA 1XU4A 3N7RC 2XY5A 4F2RA 4RT3A 4KMOB 5DLGA 2BZFA 3KOOA 2JZBA 1NK6A 1ZQWA 4P0QA 5J2BA 2XCAA 4TURA 1A76A 2GOLA 8ICVA 1TAMA 3RJHA 4FO6A 2Y9TA 7ICMA 1JXLA 2KKPA 2KHVA 3HILA 4UAYA 2WAQC 2RDJA 2HDOA 5KFJA 1SKSA 1ZQKA 2W11A 3OSPA 1QQ5A 1L3VA 2XIDA 7ICPA 4NXZA 4O5CA 5J0SA 3Q8LA 4UB3A 4BX9C 2C2DA 2W3RA 4OJOA 4DFMA 2AU0A 3K75D 4DSLA 1N2XA 3D2SA 1L6NA 3OHBA 1VJ5A 2F1HA 3UQ2A 3CW2C 4I27A 4RU9A 5HR6A 8ICIA 1QCKA 1DXSA 1RYRA 5AI9A 4ACOA 2KSOA 4DL4A 1NJWA 3CRXA 5AKYA 4DOBA 4J9KA 1BGXT 7ICLA 3HPOA 4NY8A 2EAOA 4O3PA 3N97B 1X42A 4IR9A 3ED5A 2MUTA 1RDFA 9ICJA 1N5WA 4ED1A 2O6KA 4RZRA 5L9XA 1UA1A 1WWVA 2OCEA 5L1LA 3ICXA 9ICPA 2WB1F 2CRXA 7ICEA 1FIQA 4FE3A 4P4PA 4O9MA 2F1JA 5L1IA 4O3OA 5DQHA 3CNHA 2W9AA 1RXVA 4JV2A 3B9JA 5BOMA 1ZQBA 2XI9A 2LYBA 3NRZA 3GV7B 3WK5A 2E8OA 3FDSA 1NK4A 2KJ9A 4AYBF 4F72A 2I9GA 2G06A 3TADA 2ODGA 3TFSA 3ZDAA 2EAPA 2OM6A 8ICYA 4EZ6A 1YZ6A 3Q8RB 1X9WA 2HVIA 3UPQA 5AKHA 3V72A 4YD2A 2MSNA 4PHDA 2E3TA 2WF5A 3PSIA 4QZFA 3S6JA 5IIOA 2HHTA 4BWMA 5IIJA 2ATLA 4ELTA 2YB1A 8ICLA 3Q8MA 2OHFA 2KEYA 5DB8A 5AHXA 3EPGA 4FBTA 5J2CA 3Q8QB 2ZUBA 4TUQA 4P0QB 1M6YA 1WWUA 3NGDA 1U9LA 8ICPA 4OJ5A 3TFRA 2NRVA 4I2FA 4DSKA 4Y2RA 4RQMA 2F44A 9ICOA 2ZUCA 2H3FA 1JX4A 4DL6A 3D6JA 7ICNA 1BNOA 3UXNA 4B9MA 7ICJA 2LM4A 3BQ7A 5ALJA 4QWCA 3PY8A 3ZD8A 4Y2YA 2AQ0A 1NZPA 1NKCA 2RLTA 9ICTA 1CRXA 1NK7A 3PW7A 2PFNA 1PVPA 4EYIB 5AM0A 1ZQMA 2JXJA 1NK9A 1F44A 4I2JA 4DSEA 2KP7A 3C1YA 4JWMA 2Y1IA 3IHQB 4JB3A 2YMMA 4F93B 2OH2A 2MA1A 4Y2VA 5AM2A 2K8CB 5ALXA 2WTFA 2KJ8A 2BQUA 4DQRA 2MAXA 2BDPA 2LPEA 4CRXA 4DEZA 1ZQOA 1TFRA 4XRHA 1N48A 1PVRA 3U26A 3EYZA 5KG7A 5AIAA 1PK1A 3M9OB 4JV1A 2KOBA 3DDHA 2A1JA 3WK8A 5B5EU 4C4RA 2WB1C 4DSFA 4DLGA 3AL0B 1ZD3A 1SKWA 4EBDA 3MR3A 2PFOA 1ZQZA 3RJJA 2AGQA 4M0AA 2HCFA 1CI4A 3TKAA 1ZOLA 3KHLA 3UXPA 3M8RA 4TQRA 2WHEA 5KFSA 2F8KA 1HIWA 2IOHA 9ICUA 4RPXA 3QU4A 5ALTA 4AYBC 3RJFA 2ASLA 1KEJA 1TK8A 2DUYA 2A1AA 4RPYA 3KKAC 3UQ0A 2EZXA 2D8CA 1MN8A 3JPTA 1TK5A 5J2JA 2ZJAA 2ISOA 3RB0A 1D9DA 2ZIUA 5AKGA 4YXMA 3SYZA 5KFYA 5A0LA 1SL0A 4FZNA 2YQEA 1X9MA 4F91B 4X5VA 5K4LA 1TAQA 5EE3A 3HP6A 3RH5A 2DKZA 1XSNA 1DGJA 4GXJA 2OEHA 1IG6A 4PHAA 3SV4A 3E0FA 1CEZA 3A0HU 3IM1A 2P35A 3G6YA 2GLEA 1TVAA 5EWEA 4JUZA 2NV3A 2AGOA 4RQ8A 4C4TA 4EX7A 5CR0A 2W9CA 4K4HA 3H4DA 1V85A 4Y2XA 2XO7A 3PMLA 4F5RA 4Y2UA 3JPQA 4KLTA 4UB5A 2DWQA 4IR1A 3M9MB 2K4PA 3K1RB 2UVUA 1L7OA 1ZQFA 2CPRA 2ZIWA 5AM4A 2KIVA 2I5HA 3QUCA 8ICTA 4ECXA 1X9XA 5J0PA 3IN5A 7ICKA 2FDRA 9ICLA 2ZXIA 1JXEA 5AM1A 5C0YA 2W7OA 1ZD5A 2PKEA 3F53A 2HVHA 3CP8A 3OHAA 1HJPA 2W8KA 3N4MB 2IHNA 4QZBA 5AKIA 3UMCA 3D2QA 3C2LA 3QZ7A 4KX5A 4IS7A 3G6VA 3M6KA 3M7DA 5EOZA 3FAHA 4NLCA 3WKBA 2JR5A 1J2MA 2WAQF 3BS7A 2FPLA 1V38A 2KFZA 5AM5A 1K1QA 1EXNA 4RQ6A 4KLGA 1L3UA 4PGYA 4NLNA 4QZ9A 3MGHA 4ED6A 3UMGA 1TAUA 1KW4A 4J9OA 4BGDA 5DGAA 2YY6A 4M9GA 1MQ3A 2J6SA 1Q3UA 1SV4A 2MRLA 2UVWA 5KNIA 3PV8A 3MDCA 2HBLA 5DLFA 3C21A 4B9TA 4RQ3A 2C22A 5CEHA 1ZQXA 4O3QA 1SZPA 5KFWA 4F5PA 4FZMA 2KFNA 3MFHA 1WCNA 1RQLA 2W03A 5DBBA 4F4XA 4ED0A 2ZIUB 5AKJA 1XS9D 5B66U 1LKYA 1Z4NA 3OSNA 1U4BA 4B9SA 2WF7A 3V6HA 2WF9A 4YP3A 4M9LA 4RQ0A 3KZIU 1YT3A 7ICOA 3C28A 2JEIA 4E0DA 1CUKA 2CXYA 4C8LA 2W54A 1OXJA 3UMBA 4M47A 3HWTA 5L1MA 4B9UA 5IIMA 4DS5A 3LDAA 3HT3A 1UA0A 1BVSA 4EX6A 4DL3A 5IIKA 9ICSA 2W04A 5ALIA 4ZH4A 4UB1A 4YD1A 4C8KA 1K5OA 2YN4A 4DO9A 4EZ9A 2G07A 4RQ4A 4QNLA 3RBEA 3H8MA 5G5HA 2EZYA 2W9CB 1FFUA 2PXIA 3MGIA 3ISDA 3EUB2 5J0RA 4M2YA 1ZQGA 5KFQA 3H0MB 4JV0A 2VA8A 4NLBA 5ALWA 4GC6A 8ICRA 2ZIWB 3RAQA 4C4SA 3PW2A 2ISPA 3AEVA 4FS2A 1JROA 3THVA 5KFEA 3QEAZ 3F5EA 3PVXA 8ICEA 3ZDBA 2R8HA 2KHQA 2DPJA 2W3SA 5J2KA 3ISCA 3IRUA 4DQPA 2HHVA 2ESEA 2RRDA 1ZQYA 1KQQA 2BR0A 5HNKA 5J2IA 3C5GA 2HHSA 5J0TA 4HYKA 4I2AA 1DRGA 5ALKA 1IXRA 7ICRA 2FMPA 2KNJA 3GILA 5ALDA 4MEXA 4EELA 5J2AA 3BQ1A 5L1KA 5KFIA 4J9RA 4RQ5A 2W7PA 4QIWC 2BQRA 3WKEA 3HW8A 1NNLA 4JWNA 4KLDA 4NM2A 2R8GA 3MC1A 5IINA 3ISBA 2FLLA 1ECWA 1BPZA 2DFLA 1OUQA 2AQ4A 7ICIA 3RR7A 4RQ1A 4GXIA 1RQNA 3QU9A 3LYSA 2FMSA 3HKZC 1NJXA 1HEKA 1LKYB 1L8LA 3SZ2A 2R8IA 2JGAA 2JH1A 1LVHA 8ICZA 2WF6A 1N62A 4RT2A 2ZTEA 3AN1A 4QZ8A 1ZQIA 1IV8A 5J2DA 4G3IA 3NRWA 4CF4A 1KN5A 2H3ZA 5KT7A 4UB4A 4ECZA 1HUZA 4C0ZA 1KBUA 9ICAA 8ICMA 1SB3C 3MGVA 5ALRA 1MC8A 2BCRA 2I6XA 3GDXA 2KG5A 2B21A 1Z3EB 2XCPA 4M9NA 4F8RA 3OJSA 4F3OA 3BQTA 2K60A 2JRZA 3RJIA 4KITB 2UVRA 2XY7A 2VJ4A 3ZI4A 4CF5A 2HHXA 2RHFA 1KL9A 3IP4B 1T3QA 4EENA 5J8YA 1WCLA 3AQEA 1B43A 1X66A 4TUSA 4F4WA 4DL7A 4QWAA 5EE0A 3JPSA 2B6GA 2DGZA 1BNPA 2AGPA 3DV9A 2FPMA 2OYYA 2MU2A 1Y88A 2DPIA 5KFVA 2HOQA 3HX0A 3MR5A 4ECUA 1J2NA 5AKEA 2KMDA 1TV9A 3GV8B 2VA2A 4ELVA 5J0WA 2GO7A 4BXOB 3ZDDA 3J81j 1N63A 2M9NA 9ICEA 5HHIA 1H38A 5AKLA 1V97A 2YMPA 4UAWA 4C80A 3VCBA 2FI1A 1UT5A 4KLMA 1XO1A 1FEZA 4OO1J 1RZTA 4IRDA 2H3IA 2KTQA 2KICA 4NLKA 2HHUA 5D4BA 3RR8A 3KZXA 1IIPA 1GO3F 4O3SA 3ZDCA 2K4IA 2LKYA 5ALLA 2YTUA 3C23A 3KHRA 4J9NA 4OD0A 2IA6A 2KE7A 2F3NA 2VANA 2PI5A 2XC9A 5AI4A 3GU3A 4JMUA 4R8UA 3T5KA 3SR6A 3H0LB 2YMQA 4QZEA 1KKXA 3GFKB 2W55A 3WK4A 2C28A 5ALMA 4ED2A 3RRGA 5AICA 2KZMA 1ZQSA 4YMMA 2FPKA 4F71A 2KJ5A 3TQ1A 4GFJA 3LWLA 2OXOA 3PW4A 5T14A 4KMUA 5HP4A 2KN7A 4IQUA 4UW9A 5KT6A 4G9BA 4EYHB 3B0XA 4IRCA 2ZTDA 5HMLA 3SMVA 2FJ6A 3ONNA 3GIIA 4J9QA 4ED8A 1L7PA 4KTQA 5DQIA 2K89A 3ETRA 4PL2A 1BPBA 5KFOA 1KDHA 4RNNA 3AMZA 2I1QA 2NRXA 3M1YA 2Y1JA 1L8OA 1QSYA 1IM4A 4NL9A 4DOCA 4US8A 1XWLA 2B0CA 5DBCA 3RFAA 4ECYA 4Q8FA 2LYHA 2E5SA 3LVVA 4DOAA 4Q44A 4F5OA 2ZUDA 2NO4A 3N28A 4YXJA 4QZHA 2RP5A 4C7YA 5KTQA 1QH9A 5ALNA 5KT2A 2LMRA 5C5JA 2HSZA 4NJ8A 5HMMA 3L4PA 2D6FC 4YFKA 5AKKA 4ED7A 1ZQPA 5IILA 5GTIU 9ICVA 2K8AA 9ICWA 1XNSA 3TACB 2DKXA 5DB7A 2E1EA 1PZNA 4YR2A 4O3NA 9ICBA 3MR2A 2PI4A 3TADC 2BQ3A 3Q8SB 2ZIVA 4YG2A 4EBEA 5G5GA 3RBDA 3H8JA 3BQ2A 1N56A 8ICCA 1WG8A 4ELUA 5E79U 4YMOA 3RJKA 3NVWA 5KFRA 1L3SA 5KFLA 5KFGA 1D8LA 3FC4A 3KHHA 5ALVA 2ALZA 8ICNA 2VIXA 2C2RA 3T5LA 4OJLA 2D3DA 2AHOB 4KLSA 2BGWA 1B22A 4CCHA 1VLBA 1JALA 1DK2A 1DOQA 2W43A 4R8UB 4F92B 4KX3A 4KLLA 1SWVA 4PZOA 5J0QA 4MHVA 4R63A 4EEKA 3PR4A 1Z1VA 3F5AA 9ICGA 5KFNA 4UARA 4F2SA 3T3FA 4MFCA 4ECTA 5KT3A 2HW3A 1X6IA 1SL1A 4RNMA 4M6WA 2GWSA 2KZ3A 2E8PA 2P6RA 2R18A 5AK3A 3RB4A 2AXTU 5DQGA 5EWGA 1ZQAA 4CNQA 1SZHA 3SV3A 1BPXA 1K1SA 3NVZA 2BDUA 9ICKA 2WFAA 4BDPA 4MF8A 4DCCA 4XUSA 3OJUA 1KFDA 4UAUA 1QTMA 3RH4A 3MDAA 4KN4A 4M9HA 4BWJA 5DDYA 5DG8A 1A6SA 4UB2A 4NLGA 3PO4A 4GXKA 2XGPA 1L7NA 4QW8A 1XSPA 5L1JA 5J2EA 1AQ6A 4ICAA 2DL0A 4PGXA 4J9PA 5DBAA 1DGSA 4DFJA 3BQ0A 3ORYA 4FS1A 3BJYA 2Q0ZX 1JI7A 4LVSA 2H3QA 4RQ2A 4R66A 3M9NB 4QIWF 3EZ5A 1D8BA 2HBKA 1NKEA 4PH5A 4I2BA 2HOIA 5KG5A 8ICFA 3QX7A 2ZJ5A 3RAXA 2NRTA 4CE6A 5ALEA 4OJPA 4QZAA 5D46A 5DKWA 4LZDA 4GIBA 3PSFA 5AIBA 4M9JA 9ICFA 5KFZA 1WUDA 3HKZF 1D8YA 1BPDA 4DF4A 1T7PA 5JTIA 4QZGA 3A0BU 3C1ZA 1Q46A 4Y2SA 2JV3A 1NOMA 4CGZA 5JRTA 1QSLA 3SAHA 1SV0A 5DG9A 3JPPA 3QEBZ 5JU5A 4GC7A 2ZIVB 2LHTA 4NLZA 2V9WA 7ICFA 4Q43A 3NTUA 2KV2A 2J6TA 9ICQA 3OTQA 2W9BA 3QUBA 2FLPA 1URJA 4XQ8A 8ICJA 1KRPA 3WK6A 3RB6A 1Z19A 3H7IA 3QU7A 1ZETA 5CWRA 5TZVA 4DFKA 1L7MA 3JPOA 2F8LA 2VJ5A 1XSLA 3TAPA 4MEYA 4QZDA 5DGBA 2JHDA 3SAFA 5CB1A 2ZJ8A 5KFKA 2LYAA 1ZQRA 2BHNA 2HBJA 2F77X 3KBBA 4C7ZA 3NASA 3H4BA 4RPZA 1RPLA 5AI5A 1ZQTA 4KLEA 5KFMA 4QZCA 3Q8KA 1HUOA 4Y2JA 5EE1A 2RDIA 4Y2PA 4M6WB 3QE9Y 1RYSA 4WJ3B 4US9A 3SENA 2Z7JA 3MFIA 4DSJA 3H0RB 3PO5A 5AK6A 5ALSA 4BXOA 1ZQCA 1QLNA 1KSPA 4UB8U 2RQ5A 5KAFU 2KKVA 3JPRA 2UVVA 8ICOA 4I28A 2V4QA 2IBKA 3N7SC 3TAQA 2LBOA 5F9LA 1MSWD 4Z6DA 3PNCA 5J2GA 4ECSA 4QJFB 4YQWA 1L5UA 2EDUA 3QZ8A 4K4GA 1ZQJA
chains in the Genus database with same CATH topology
2EANA 4RQNA 5JRTA 3KKAC 1SV0A 4NL9A 2D8CA 5JU5A 2QB0A 2EAMA 4IS7A 2QARA 1WWVA 3H8MA 2E8PA 2KSOB 3BQ7A 2ES6A 4NL9C 3BS7A 1V38A 1LKYB 2QB1A 1COKA 2YTUA 3IDWA 1X40A 2KE7A 2F3NA 2LMRA 1F0MA 4NJ8A 3BS5A 2QB0B 2QKQA 1OW5A 1KW4A 2E8OA 5F3XB 2Y9TA 1UQVA 1RG6A 1SGGA 2DKZA 3HILA 2E8MA 1B4FA 3TADA 1SV4A 3TACB 2DKXA 2KG5A 1SXDA 2EAPA 5KNIA 2LPEA 2GLEA 2DL0A 2K60A 3TADC 2ESEA 1PK1A 2QARB 3SENA 1JI7A 5J8YA 1V85A 1LKYA 1UCVA 1X66A 2L5YA 2B6GA 2K4PA 3K1RB 5J8YC 2D3DA 1DXSA 1B0XA 1PK3A 3BS5B 1WWUA 2KIVA 1OXJA 1PK1B 2Y9UA 5L1MA 1X9XA 3SEIA 2KSOA 2F8KA 1SV0C 1SXEA 4PZOA 5JTIA 4PZNA 3KKAA 2KMDA 4MHVA 2E8NA 4RQMA 2F44A 2EAOA 1Z1VA 2FE9A 2JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  4RQN A;  5JRT A;  3KKA C;  1SV0 A;  4NL9 A;  2D8C A;  5JU5 A;  2QB0 A;  2EAM A;  4IS7 A;  2QAR A;  1WWV A;  3H8M A;  2E8P A;  2KSO B;  3BQ7 A;  2ES6 A;  4NL9 C;  3BS7 A;  1V38 A;  1LKY B;  2QB1 A;  1COK A;  2YTU A;  3IDW A;  1X40 A;  2KE7 A;  2F3N A;  2LMR A;  1F0M A;  4NJ8 A;  3BS5 A;  2QB0 B;  2QKQ A;  1OW5 A;  1KW4 A;  2E8O A;  5F3X B;  2Y9T A;  1UQV A;  1RG6 A;  1SGG A;  2DKZ A;  3HIL A;  2E8M A;  1B4F A;  3TAD A;  1SV4 A;  3TAC B;  2DKX A;  2KG5 A;  1SXD A;  2EAP A;  5KNI A;  2LPE A;  2GLE A;  2DL0 A;  2K60 A;  3TAD C;  2ESE A;  1PK1 A;  2QAR B;  3SEN A;  1JI7 A;  5J8Y A;  1V85 A;  1LKY A;  1UCV A;  1X66 A;  2L5Y A;  2B6G A;  2K4P A;  3K1R B;  5J8Y C;  2D3D A;  1DXS A;  1B0X A;  1PK3 A;  3BS5 B;  1WWU A;  2KIV A;  1OXJ A;  1PK1 B;  2Y9U A;  5L1M A;  1X9X A;  3SEI A;  2KSO A;  2F8K A;  1SV0 C;  1SXE A;  4PZO A;  5JTI A;  4PZN A;  3KKA A;  2KMD A;  4MHV A;  2E8N A;  4RQM A;  2F44 A;  2EAO A;  1Z1V A;  2FE9 A;  2JV3 A; 
#chains in the Genus database with same CATH topology
 2EAN A;  4P0P A;  1BPE A;  1S5L U;  3BZC A;  4PL1 A;  4O3R A;  4KLJ A;  3RJE A;  1QQ6 A;  3F2C A;  2QAR A;  2KD1 A;  4USA A;  2HHW A;  1ZJM A;  5CHG A;  5EE9 A;  3V7L A;  5ALG A;  5HHH A;  1L3T A;  8ICW A;  1A77 A;  4F4Z A;  3PMN A;  1O08 A;  5KG4 A;  3SI8 A;  1COK A;  2JEG A;  3GV5 B;  5KFC A;  2DF4 B;  2Y0S F;  1ZJN A;  5J2H A;  4IRK A;  1X9S A;  4BJQ A;  4YN4 A;  2QLT A;  2QKQ A;  3QXG A;  3FM9 A;  2K4H A;  3CYM A;  1N60 A;  1ZRM A;  3EWA A;  1UQV A;  3ETL A;  3C5F A;  4RUA A;  4Q45 A;  4JK1 A;  2HHQ A;  2GH1 A;  3PSP A;  1NJY A;  4DLE A;  2F2A B;  4Y2Q A;  5DG7 A;  1VDV A;  1J97 A;  1KFS A;  5KFU A;  4UBC A;  1N5X A;  4P4O A;  4DSI A;  4O0I A;  3C29 A;  3I76 A;  2ZIX A;  4Z6E A;  1NK0 A;  2W9B B;  5KFA A;  3AUO A;  2YML A;  2W9M A;  1ED1 A;  1JUD A;  4RNO A;  2FMQ A;  5GTH U;  3GIM A;  1S76 D;  2G5I B;  7ICH A;  2L5Y A;  2HMX A;  4FFD A;  5KFT A;  1N61 A;  4IQW A;  2LI6 A;  4KLH A;  4C8N A;  1T8E A;  2IOF K;  5AM3 A;  3KHG A;  5ALQ A;  4DQS A;  1LV5 A;  1Q8K A;  2JH7 A;  3KTQ A;  1SV0 C;  3MR6 A;  4O3M A;  5ALF A;  2HI0 A;  3KKA A;  4UB6 U;  3DEE A;  4ECW A;  4KLQ A;  3F2D A;  4DQI A;  4KLF A;  1JRP A;  4EEY A;  4ZOH C;  4O5E A;  4RQN A;  3QNM A;  3E58 A;  3GIJ A;  4DQQ A;  2NO5 A;  1RYU A;  1ARO P;  2EAM A;  5KT4 A;  4IQV A;  4Q8E A;  4UBB A;  2QB1 A;  5KAI U;  2HBM A;  8ICS A;  4MF2 A;  2LM1 A;  4O5K A;  3IDW A;  1ZQN A;  3QUQ A;  3I28 A;  4K4I A;  7ICG A;  4DL2 A;  1PUZ A;  1MQ2 A;  2QB0 B;  5D49 A;  2EZZ A;  1RXW A;  5F3X B;  2YX8 A;  5CP2 A;  3GIK A;  2C2E A;  5BPC A;  4F4Y A;  3LK9 A;  2VA3 A;  2EH9 A;  1S97 A;  5ALP A;  5KL1 B;  5ALU A;  3MAB A;  5KFH A;  3RF9 A;  1ZYQ A;  4I2D A;  2BCS A;  4P0P B;  2JZB B;  2NRW A;  3UM9 A;  4J03 A;  4FZL A;  1S8O A;  2P66 A;  5KG6 A;  3T79 A;  2AH5 A;  2QAR B;  3PW5 A;  1Z00 A;  5CA7 A;  2V4R A;  1S10 A;  2XGQ A;  3HJE A;  5AKZ A;  4F4K A;  3V6J A;  4R64 A;  3M8S A;  1FFV A;  2JEJ A;  2CN1 A;  9ICI A;  7ICU A;  2Y0S C;  3SD7 A;  2PMZ F;  4KLU A;  4I2H A;  3JPN A;  2Y9U A;  5KFB A;  5J0O A;  3E2E A;  3LWM A;  3SEI A;  5J0X A;  4PZN A;  5BOL A;  4FBU A;  1F5S A;  1QQ7 A;  4C8M A;  4QWD A;  2J6U A;  4J9L A;  2OWO A;  2KVS A;  2G08 A;  1ZQE A;  7ICS A;  4B9N A;  2H5X A;  1JIH A;  4LZG A;  2KSO B;  4UQG A;  4YR3 A;  2ZIX B;  3KD3 A;  3WK9 A;  2ASJ A;  5DB6 A;  3NUQ A;  3UXO A;  1U45 A;  4DFP A;  1O03 A;  2MUT B;  3H40 A;  5J0Y A;  2EQY A;  2ZXH A;  3L5K A;  1XC9 A;  1F0M A;  5AK5 A;  4HAI A;  1OW5 A;  3G6X A;  4CDG A;  3Q8P B;  4NWI A;  1TKD A;  5AI8 A;  4LJX A;  4PHP A;  3MBY A;  5KL8 B;  7ICT A;  1RG6 A;  5AI0 A;  1UPH A;  3SQI A;  5HR7 A;  2BPF A;  1V9P A;  2BKE A;  2G0A A;  3GQC A;  3ZDE A;  3AM9 A;  2WF8 A;  1TE2 A;  3WKD A;  4PJ0 U;  3NVY A;  2K8B B;  2KVC A;  4ECQ A;  5KFD A;  2PFQ A;  4PPX A;  2DBY A;  3H8S A;  4UAS A;  2ZG6 A;  2ASD A;  5KG2 A;  3PR5 B;  3M6Z A;  2FLN A;  2DQN B;  1FO4 A;  5H2F U;  2KK0 A;  4YMN A;  1Q3V A;  1ZXI A;  5KG3 A;  1ZQV A;  4QWB A;  5J8Y C;  1S0O A;  2R8J A;  1KFT A;  4PHE A;  1B0X A;  8ICB A;  4Z6F A;  1PK3 A;  3OPX A;  4QW9 A;  2NYV A;  1ZD2 P;  2ZTC A;  3WK7 A;  1T3N A;  5J29 A;  1ZD4 A;  1SXE A;  1NI3 A;  8ICA A;  1COO A;  3C2K A;  1JN3 A;  4ECV A;  3RJG A;  3T5J A;  4UAT A;  5ALZ A;  2BCQ A;  4AP9 A;  4I2E A;  4I2I A;  3QU5 A;  3C2M A;  4QZI A;  2G5H B;  4Z6C A;  1Z00 B;  4PGQ A;  1RM6 C;  4B6J A;  2G09 A;  5KFF A;  4DF8 A;  1S9F A;  3PX6 A;  2JMG A;  1NK5 A;  4P2H A;  4I2G A;  1X2I A;  4OCZ A;  4NV0 A;  4KLO A;  3BS5 A;  7ICV A;  4J9S A;  9ICN A;  2PMZ C;  1SL2 A;  4MFF A;  1SGG A;  2R8K A;  1BPY A;  1U48 A;  2E8M A;  1U47 A;  1B4F A;  3BDP A;  3IG8 A;  1XO0 A;  5KG1 A;  4YCX A;  5J2F A;  1S0M A;  1JMS A;  1WYG A;  4M04 A;  3N7P D;  4IL6 U;  4U6P A;  2BPG A;  3TAR A;  2Q4T A;  1A0P A;  3D2N A;  1NK8 A;  1ZQD A;  4YVZ A;  4YR0 A;  1DK3 A;  2KZZ A;  5ALO A;  3QYP A;  1ZRN A;  4B9V A;  5J0U A;  1UCV A;  8ICX A;  1KTQ A;  3QUT A;  2PFP A;  4DS4 A;  4F5N A;  5AI6 A;  1C20 A;  1T4G A;  4BUG A;  2KIW A;  1MA7 A;  5JUM A;  3AU6 A;  3GZF A;  3SAG A;  3PZP A;  3AU2 A;  1UT8 A;  3RB3 A;  1ZQQ A;  1PK1 B;  8ICH A;  3IG5 A;  2A1J B;  1P7D A;  3HRD D;  3K1Z A;  2HOF A;  1SWW A;  2YB4 A;  1S0V A;  2F1I A;  4TQS A;  4F50 A;  1NKB A;  3BZK A;  4UAV A;  3R9K A;  5KT5 A;  2FE9 A;  1SIJ A;  4XA5 A;  3V7K A;  5KFX A;  2H3V A;  3K4G A;  5CJ7 A;  2IMW P;  9ICH A;  3WKC A;  2BCU A;  4CF3 A;  9ICX A;  3VC8 A;  3RH6 A;  4A8E A;  4IQT A;  4NL9 C;  3T5H A;  1S0N A;  3PX0 A;  3V6K A;  3NVV A;  2M0N A;  1S77 D;  1U49 A;  4ED3 A;  5ALH A;  9ICC A;  5F9N A;  2IHM A;  1X40 A;  9ICR A;  5DDM A;  4OJ6 A;  4UAZ A;  3PST A;  2XY6 A;  4R65 A;  4J9M A;  1ZQL A;  4DFD A;  4DL5 A;  5AK4 A;  1NJZ A;  4MFA A;  1ZQH A;  2A19 A;  4I29 A;  3TAN A;  3RTV A;  4U7C A;  4TUP A;  4RQ7 A;  2A3V A;  3AQF A;  3NS1 A;  2BPC A;  2F76 X;  5AKX A;  1SXD A;  5EWF A;  1Z4O A;  8ICQ A;  3I1Y A;  2BCV A;  3ALR A;  4Y2T A;  1KLN A;  3KFU F;  8ICU A;  3ZD9 A;  2NRZ A;  4C8O A;  1YZ7 A;  5DB9 A;  1D9F A;  4GLX A;  4EBC A;  5FP0 A;  1UHU A;  2VKQ A;  5KFP A;  1Z1B A;  2P6U A;  2K4E A;  3PW0 A;  8ICK A;  5III A;  3L3F X;  3V7J A;  3BS5 B;  8ICG A;  1LB2 B;  2AJQ A;  4NM1 A;  1C7Y A;  1TK0 A;  3PX4 A;  2N1R A;  3H8W A;  4KLI A;  3TI0 A;  5CRX A;  1PVQ A;  3LVW A;  3WKA A;  3RRH A;  2E8N A;  3EPI A;  4QWE A;  3O0F A;  1QSS A;  5ALY A;  2XVT A;  1X6J A;  2JEF A;  7ICQ A;  4P4M A;  4F5Q A;  3OGU A;  4KN7 A;  1T94 A;  4IC9 A;  2QB0 A;  3EW9 A;  5TIS U;  2W8L A;  4I2C A;  1ZQU A;  5KG0 A;  3QU2 A;  1SKR A;  4RUC A;  3FYH A;  9ICM A;  1ZQ1 C;  2ES6 A;  1NZB A;  4ECR A;  3IV6 A;  2XIC A;  2IOF A;  4B9L A;  3F2B A;  4DWI A;  2E1F A;  3WU2 U;  3B0Y A;  1XU4 A;  3N7R C;  2XY5 A;  4F2R A;  4RT3 A;  4KMO B;  5DLG A;  2BZF A;  3KOO A;  2JZB A;  1NK6 A;  1ZQW A;  4P0Q A;  5J2B A;  2XCA A;  4TUR A;  1A76 A;  2GOL A;  8ICV A;  1TAM A;  3RJH A;  4FO6 A;  2Y9T A;  7ICM A;  1JXL A;  2KKP A;  2KHV A;  3HIL A;  4UAY A;  2WAQ C;  2RDJ A;  2HDO A;  5KFJ A;  1SKS A;  1ZQK A;  2W11 A;  3OSP A;  1QQ5 A;  1L3V A;  2XID A;  7ICP A;  4NXZ A;  4O5C A;  5J0S A;  3Q8L A;  4UB3 A;  4BX9 C;  2C2D A;  2W3R A;  4OJO A;  4DFM A;  2AU0 A;  3K75 D;  4DSL A;  1N2X A;  3D2S A;  1L6N A;  3OHB A;  1VJ5 A;  2F1H A;  3UQ2 A;  3CW2 C;  4I27 A;  4RU9 A;  5HR6 A;  8ICI A;  1QCK A;  1DXS A;  1RYR A;  5AI9 A;  4ACO A;  2KSO A;  4DL4 A;  1NJW A;  3CRX A;  5AKY A;  4DOB A;  4J9K A;  1BGX T;  7ICL A;  3HPO A;  4NY8 A;  2EAO A;  4O3P A;  3N97 B;  1X42 A;  4IR9 A;  3ED5 A;  2MUT A;  1RDF A;  9ICJ A;  1N5W A;  4ED1 A;  2O6K A;  4RZR A;  5L9X A;  1UA1 A;  1WWV A;  2OCE A;  5L1L A;  3ICX A;  9ICP A;  2WB1 F;  2CRX A;  7ICE A;  1FIQ A;  4FE3 A;  4P4P A;  4O9M A;  2F1J A;  5L1I A;  4O3O A;  5DQH A;  3CNH A;  2W9A A;  1RXV A;  4JV2 A;  3B9J A;  5BOM A;  1ZQB A;  2XI9 A;  2LYB A;  3NRZ A;  3GV7 B;  3WK5 A;  2E8O A;  3FDS A;  1NK4 A;  2KJ9 A;  4AYB F;  4F72 A;  2I9G A;  2G06 A;  3TAD A;  2ODG A;  3TFS A;  3ZDA A;  2EAP A;  2OM6 A;  8ICY A;  4EZ6 A;  1YZ6 A;  3Q8R B;  1X9W A;  2HVI A;  3UPQ A;  5AKH A;  3V72 A;  4YD2 A;  2MSN A;  4PHD A;  2E3T A;  2WF5 A;  3PSI A;  4QZF A;  3S6J A;  5IIO A;  2HHT A;  4BWM A;  5IIJ A;  2ATL A;  4ELT A;  2YB1 A;  8ICL A;  3Q8M A;  2OHF A;  2KEY A;  5DB8 A;  5AHX A;  3EPG A;  4FBT A;  5J2C A;  3Q8Q B;  2ZUB A;  4TUQ A;  4P0Q B;  1M6Y A;  1WWU A;  3NGD A;  1U9L A;  8ICP A;  4OJ5 A;  3TFR A;  2NRV A;  4I2F A;  4DSK A;  4Y2R A;  4RQM A;  2F44 A;  9ICO A;  2ZUC A;  2H3F A;  1JX4 A;  4DL6 A;  3D6J A;  7ICN A;  1BNO A;  3UXN A;  4B9M A;  7ICJ A;  2LM4 A;  3BQ7 A;  5ALJ A;  4QWC A;  3PY8 A;  3ZD8 A;  4Y2Y A;  2AQ0 A;  1NZP A;  1NKC A;  2RLT A;  9ICT A;  1CRX A;  1NK7 A;  3PW7 A;  2PFN A;  1PVP A;  4EYI B;  5AM0 A;  1ZQM A;  2JXJ A;  1NK9 A;  1F44 A;  4I2J A;  4DSE A;  2KP7 A;  3C1Y A;  4JWM A;  2Y1I A;  3IHQ B;  4JB3 A;  2YMM A;  4F93 B;  2OH2 A;  2MA1 A;  4Y2V A;  5AM2 A;  2K8C B;  5ALX A;  2WTF A;  2KJ8 A;  2BQU A;  4DQR A;  2MAX A;  2BDP A;  2LPE A;  4CRX A;  4DEZ A;  1ZQO A;  1TFR A;  4XRH A;  1N48 A;  1PVR A;  3U26 A;  3EYZ A;  5KG7 A;  5AIA A;  1PK1 A;  3M9O B;  4JV1 A;  2KOB A;  3DDH A;  2A1J A;  3WK8 A;  5B5E U;  4C4R A;  2WB1 C;  4DSF A;  4DLG A;  3AL0 B;  1ZD3 A;  1SKW A;  4EBD A;  3MR3 A;  2PFO A;  1ZQZ A;  3RJJ A;  2AGQ A;  4M0A A;  2HCF A;  1CI4 A;  3TKA A;  1ZOL A;  3KHL A;  3UXP A;  3M8R A;  4TQR A;  2WHE A;  5KFS A;  2F8K A;  1HIW A;  2IOH A;  9ICU A;  4RPX A;  3QU4 A;  5ALT A;  4AYB C;  3RJF A;  2ASL A;  1KEJ A;  1TK8 A;  2DUY A;  2A1A A;  4RPY A;  3KKA C;  3UQ0 A;  2EZX A;  2D8C A;  1MN8 A;  3JPT A;  1TK5 A;  5J2J A;  2ZJA A;  2ISO A;  3RB0 A;  1D9D A;  2ZIU A;  5AKG A;  4YXM A;  3SYZ A;  5KFY A;  5A0L A;  1SL0 A;  4FZN A;  2YQE A;  1X9M A;  4F91 B;  4X5V A;  5K4L A;  1TAQ A;  5EE3 A;  3HP6 A;  3RH5 A;  2DKZ A;  1XSN A;  1DGJ A;  4GXJ A;  2OEH A;  1IG6 A;  4PHA A;  3SV4 A;  3E0F A;  1CEZ A;  3A0H U;  3IM1 A;  2P35 A;  3G6Y A;  2GLE A;  1TVA A;  5EWE A;  4JUZ A;  2NV3 A;  2AGO A;  4RQ8 A;  4C4T A;  4EX7 A;  5CR0 A;  2W9C A;  4K4H A;  3H4D A;  1V85 A;  4Y2X A;  2XO7 A;  3PML A;  4F5R A;  4Y2U A;  3JPQ A;  4KLT A;  4UB5 A;  2DWQ A;  4IR1 A;  3M9M B;  2K4P A;  3K1R B;  2UVU A;  1L7O A;  1ZQF A;  2CPR A;  2ZIW A;  5AM4 A;  2KIV A;  2I5H A;  3QUC A;  8ICT A;  4ECX A;  1X9X A;  5J0P A;  3IN5 A;  7ICK A;  2FDR A;  9ICL A;  2ZXI A;  1JXE A;  5AM1 A;  5C0Y A;  2W7O A;  1ZD5 A;  2PKE A;  3F53 A;  2HVH A;  3CP8 A;  3OHA A;  1HJP A;  2W8K A;  3N4M B;  2IHN A;  4QZB A;  5AKI A;  3UMC A;  3D2Q A;  3C2L A;  3QZ7 A;  4KX5 A;  4IS7 A;  3G6V A;  3M6K A;  3M7D A;  5EOZ A;  3FAH A;  4NLC A;  3WKB A;  2JR5 A;  1J2M A;  2WAQ F;  3BS7 A;  2FPL A;  1V38 A;  2KFZ A;  5AM5 A;  1K1Q A;  1EXN A;  4RQ6 A;  4KLG A;  1L3U A;  4PGY A;  4NLN A;  4QZ9 A;  3MGH A;  4ED6 A;  3UMG A;  1TAU A;  1KW4 A;  4J9O A;  4BGD A;  5DGA A;  2YY6 A;  4M9G A;  1MQ3 A;  2J6S A;  1Q3U A;  1SV4 A;  2MRL A;  2UVW A;  5KNI A;  3PV8 A;  3MDC A;  2HBL A;  5DLF A;  3C21 A;  4B9T A;  4RQ3 A;  2C22 A;  5CEH A;  1ZQX A;  4O3Q A;  1SZP A;  5KFW A;  4F5P A;  4FZM A;  2KFN A;  3MFH A;  1WCN A;  1RQL A;  2W03 A;  5DBB A;  4F4X A;  4ED0 A;  2ZIU B;  5AKJ A;  1XS9 D;  5B66 U;  1LKY A;  1Z4N A;  3OSN A;  1U4B A;  4B9S A;  2WF7 A;  3V6H A;  2WF9 A;  4YP3 A;  4M9L A;  4RQ0 A;  3KZI U;  1YT3 A;  7ICO A;  3C28 A;  2JEI A;  4E0D A;  1CUK A;  2CXY A;  4C8L A;  2W54 A;  1OXJ A;  3UMB A;  4M47 A;  3HWT A;  5L1M A;  4B9U A;  5IIM A;  4DS5 A;  3LDA A;  3HT3 A;  1UA0 A;  1BVS A;  4EX6 A;  4DL3 A;  5IIK A;  9ICS A;  2W04 A;  5ALI A;  4ZH4 A;  4UB1 A;  4YD1 A;  4C8K A;  1K5O A;  2YN4 A;  4DO9 A;  4EZ9 A;  2G07 A;  4RQ4 A;  4QNL A;  3RBE A;  3H8M A;  5G5H A;  2EZY A;  2W9C B;  1FFU A;  2PXI A;  3MGI A;  3ISD A;  3EUB 2;  5J0R A;  4M2Y A;  1ZQG A;  5KFQ A;  3H0M B;  4JV0 A;  2VA8 A;  4NLB A;  5ALW A;  4GC6 A;  8ICR A;  2ZIW B;  3RAQ A;  4C4S A;  3PW2 A;  2ISP A;  3AEV A;  4FS2 A;  1JRO A;  3THV A;  5KFE A;  3QEA Z;  3F5E A;  3PVX A;  8ICE A;  3ZDB A;  2R8H A;  2KHQ A;  2DPJ A;  2W3S A;  5J2K A;  3ISC A;  3IRU A;  4DQP A;  2HHV A;  2ESE A;  2RRD A;  1ZQY A;  1KQQ A;  2BR0 A;  5HNK A;  5J2I A;  3C5G A;  2HHS A;  5J0T A;  4HYK A;  4I2A A;  1DRG A;  5ALK A;  1IXR A;  7ICR A;  2FMP A;  2KNJ A;  3GIL A;  5ALD A;  4MEX A;  4EEL A;  5J2A A;  3BQ1 A;  5L1K A;  5KFI A;  4J9R A;  4RQ5 A;  2W7P A;  4QIW C;  2BQR A;  3WKE A;  3HW8 A;  1NNL A;  4JWN A;  4KLD A;  4NM2 A;  2R8G A;  3MC1 A;  5IIN A;  3ISB A;  2FLL A;  1ECW A;  1BPZ A;  2DFL A;  1OUQ A;  2AQ4 A;  7ICI A;  3RR7 A;  4RQ1 A;  4GXI A;  1RQN A;  3QU9 A;  3LYS A;  2FMS A;  3HKZ C;  1NJX A;  1HEK A;  1LKY B;  1L8L A;  3SZ2 A;  2R8I A;  2JGA A;  2JH1 A;  1LVH A;  8ICZ A;  2WF6 A;  1N62 A;  4RT2 A;  2ZTE A;  3AN1 A;  4QZ8 A;  1ZQI A;  1IV8 A;  5J2D A;  4G3I A;  3NRW A;  4CF4 A;  1KN5 A;  2H3Z A;  5KT7 A;  4UB4 A;  4ECZ A;  1HUZ A;  4C0Z A;  1KBU A;  9ICA A;  8ICM A;  1SB3 C;  3MGV A;  5ALR A;  1MC8 A;  2BCR A;  2I6X A;  3GDX A;  2KG5 A;  2B21 A;  1Z3E B;  2XCP A;  4M9N A;  4F8R A;  3OJS A;  4F3O A;  3BQT A;  2K60 A;  2JRZ A;  3RJI A;  4KIT B;  2UVR A;  2XY7 A;  2VJ4 A;  3ZI4 A;  4CF5 A;  2HHX A;  2RHF A;  1KL9 A;  3IP4 B;  1T3Q A;  4EEN A;  5J8Y A;  1WCL A;  3AQE A;  1B43 A;  1X66 A;  4TUS A;  4F4W A;  4DL7 A;  4QWA A;  5EE0 A;  3JPS A;  2B6G A;  2DGZ A;  1BNP A;  2AGP A;  3DV9 A;  2FPM A;  2OYY A;  2MU2 A;  1Y88 A;  2DPI A;  5KFV A;  2HOQ A;  3HX0 A;  3MR5 A;  4ECU A;  1J2N A;  5AKE A;  2KMD A;  1TV9 A;  3GV8 B;  2VA2 A;  4ELV A;  5J0W A;  2GO7 A;  4BXO B;  3ZDD A;  3J81 j;  1N63 A;  2M9N A;  9ICE A;  5HHI A;  1H38 A;  5AKL A;  1V97 A;  2YMP A;  4UAW A;  4C80 A;  3VCB A;  2FI1 A;  1UT5 A;  4KLM A;  1XO1 A;  1FEZ A;  4OO1 J;  1RZT A;  4IRD A;  2H3I A;  2KTQ A;  2KIC A;  4NLK A;  2HHU A;  5D4B A;  3RR8 A;  3KZX A;  1IIP A;  1GO3 F;  4O3S A;  3ZDC A;  2K4I A;  2LKY A;  5ALL A;  2YTU A;  3C23 A;  3KHR A;  4J9N A;  4OD0 A;  2IA6 A;  2KE7 A;  2F3N A;  2VAN A;  2PI5 A;  2XC9 A;  5AI4 A;  3GU3 A;  4JMU A;  4R8U A;  3T5K A;  3SR6 A;  3H0L B;  2YMQ A;  4QZE A;  1KKX A;  3GFK B;  2W55 A;  3WK4 A;  2C28 A;  5ALM A;  4ED2 A;  3RRG A;  5AIC A;  2KZM A;  1ZQS A;  4YMM A;  2FPK A;  4F71 A;  2KJ5 A;  3TQ1 A;  4GFJ A;  3LWL A;  2OXO A;  3PW4 A;  5T14 A;  4KMU A;  5HP4 A;  2KN7 A;  4IQU A;  4UW9 A;  5KT6 A;  4G9B A;  4EYH B;  3B0X A;  4IRC A;  2ZTD A;  5HML A;  3SMV A;  2FJ6 A;  3ONN A;  3GII A;  4J9Q A;  4ED8 A;  1L7P A;  4KTQ A;  5DQI A;  2K89 A;  3ETR A;  4PL2 A;  1BPB A;  5KFO A;  1KDH A;  4RNN A;  3AMZ A;  2I1Q A;  2NRX A;  3M1Y A;  2Y1J A;  1L8O A;  1QSY A;  1IM4 A;  4NL9 A;  4DOC A;  4US8 A;  1XWL A;  2B0C A;  5DBC A;  3RFA A;  4ECY A;  4Q8F A;  2LYH A;  2E5S A;  3LVV A;  4DOA A;  4Q44 A;  4F5O A;  2ZUD A;  2NO4 A;  3N28 A;  4YXJ A;  4QZH A;  2RP5 A;  4C7Y A;  5KTQ A;  1QH9 A;  5ALN A;  5KT2 A;  2LMR A;  5C5J A;  2HSZ A;  4NJ8 A;  5HMM A;  3L4P A;  2D6F C;  4YFK A;  5AKK A;  4ED7 A;  1ZQP A;  5IIL A;  5GTI U;  9ICV A;  2K8A A;  9ICW A;  1XNS A;  3TAC B;  2DKX A;  5DB7 A;  2E1E A;  1PZN A;  4YR2 A;  4O3N A;  9ICB A;  3MR2 A;  2PI4 A;  3TAD C;  2BQ3 A;  3Q8S B;  2ZIV A;  4YG2 A;  4EBE A;  5G5G A;  3RBD A;  3H8J A;  3BQ2 A;  1N56 A;  8ICC A;  1WG8 A;  4ELU A;  5E79 U;  4YMO A;  3RJK A;  3NVW A;  5KFR A;  1L3S A;  5KFL A;  5KFG A;  1D8L A;  3FC4 A;  3KHH A;  5ALV A;  2ALZ A;  8ICN A;  2VIX A;  2C2R A;  3T5L A;  4OJL A;  2D3D A;  2AHO B;  4KLS A;  2BGW A;  1B22 A;  4CCH A;  1VLB A;  1JAL A;  1DK2 A;  1DOQ A;  2W43 A;  4R8U B;  4F92 B;  4KX3 A;  4KLL A;  1SWV A;  4PZO A;  5J0Q A;  4MHV A;  4R63 A;  4EEK A;  3PR4 A;  1Z1V A;  3F5A A;  9ICG A;  5KFN A;  4UAR A;  4F2S A;  3T3F A;  4MFC A;  4ECT A;  5KT3 A;  2HW3 A;  1X6I A;  1SL1 A;  4RNM A;  4M6W A;  2GWS A;  2KZ3 A;  2E8P A;  2P6R A;  2R18 A;  5AK3 A;  3RB4 A;  2AXT U;  5DQG A;  5EWG A;  1ZQA A;  4CNQ A;  1SZH A;  3SV3 A;  1BPX A;  1K1S A;  3NVZ A;  2BDU A;  9ICK A;  2WFA A;  4BDP A;  4MF8 A;  4DCC A;  4XUS A;  3OJU A;  1KFD A;  4UAU A;  1QTM A;  3RH4 A;  3MDA A;  4KN4 A;  4M9H A;  4BWJ A;  5DDY A;  5DG8 A;  1A6S A;  4UB2 A;  4NLG A;  3PO4 A;  4GXK A;  2XGP A;  1L7N A;  4QW8 A;  1XSP A;  5L1J A;  5J2E A;  1AQ6 A;  4ICA A;  2DL0 A;  4PGX A;  4J9P A;  5DBA A;  1DGS A;  4DFJ A;  3BQ0 A;  3ORY A;  4FS1 A;  3BJY A;  2Q0Z X;  1JI7 A;  4LVS A;  2H3Q A;  4RQ2 A;  4R66 A;  3M9N B;  4QIW F;  3EZ5 A;  1D8B A;  2HBK A;  1NKE A;  4PH5 A;  4I2B A;  2HOI A;  5KG5 A;  8ICF A;  3QX7 A;  2ZJ5 A;  3RAX A;  2NRT A;  4CE6 A;  5ALE A;  4OJP A;  4QZA A;  5D46 A;  5DKW A;  4LZD A;  4GIB A;  3PSF A;  5AIB A;  4M9J A;  9ICF A;  5KFZ A;  1WUD A;  3HKZ F;  1D8Y A;  1BPD A;  4DF4 A;  1T7P A;  5JTI A;  4QZG A;  3A0B U;  3C1Z A;  1Q46 A;  4Y2S A;  2JV3 A;  1NOM A;  4CGZ A;  5JRT A;  1QSL A;  3SAH A;  1SV0 A;  5DG9 A;  3JPP A;  3QEB Z;  5JU5 A;  4GC7 A;  2ZIV B;  2LHT A;  4NLZ A;  2V9W A;  7ICF A;  4Q43 A;  3NTU A;  2KV2 A;  2J6T A;  9ICQ A;  3OTQ A;  2W9B A;  3QUB A;  2FLP A;  1URJ A;  4XQ8 A;  8ICJ A;  1KRP A;  3WK6 A;  3RB6 A;  1Z19 A;  3H7I A;  3QU7 A;  1ZET A;  5CWR A;  5TZV A;  4DFK A;  1L7M A;  3JPO A;  2F8L A;  2VJ5 A;  1XSL A;  3TAP A;  4MEY A;  4QZD A;  5DGB A;  2JHD A;  3SAF A;  5CB1 A;  2ZJ8 A;  5KFK A;  2LYA A;  1ZQR A;  2BHN A;  2HBJ A;  2F77 X;  3KBB A;  4C7Z A;  3NAS A;  3H4B A;  4RPZ A;  1RPL A;  5AI5 A;  1ZQT A;  4KLE A;  5KFM A;  4QZC A;  3Q8K A;  1HUO A;  4Y2J A;  5EE1 A;  2RDI A;  4Y2P A;  4M6W B;  3QE9 Y;  1RYS A;  4WJ3 B;  4US9 A;  3SEN A;  2Z7J A;  3MFI A;  4DSJ A;  3H0R B;  3PO5 A;  5AK6 A;  5ALS A;  4BXO A;  1ZQC A;  1QLN A;  1KSP A;  4UB8 U;  2RQ5 A;  5KAF U;  2KKV A;  3JPR A;  2UVV A;  8ICO A;  4I28 A;  2V4Q A;  2IBK A;  3N7S C;  3TAQ A;  2LBO A;  5F9L A;  1MSW D;  4Z6D A;  3PNC A;  5J2G A;  4ECS A;  4QJF B;  4YQW A;  1L5U A;  2EDU A;  3QZ8 A;  4K4G A;  1ZQJ A; 
#chains in the Genus database with same CATH homology
 2EAN A;  4RQN A;  5JRT A;  3KKA C;  1SV0 A;  4NL9 A;  2D8C A;  5JU5 A;  2QB0 A;  2EAM A;  4IS7 A;  2QAR A;  1WWV A;  3H8M A;  2E8P A;  2KSO B;  3BQ7 A;  2ES6 A;  4NL9 C;  3BS7 A;  1V38 A;  1LKY B;  2QB1 A;  1COK A;  2YTU A;  3IDW A;  1X40 A;  2KE7 A;  2F3N A;  2LMR A;  1F0M A;  4NJ8 A;  3BS5 A;  2QB0 B;  2QKQ A;  1OW5 A;  1KW4 A;  2E8O A;  5F3X B;  2Y9T A;  1UQV A;  1RG6 A;  1SGG A;  2DKZ A;  3HIL A;  2E8M A;  1B4F A;  3TAD A;  1SV4 A;  3TAC B;  2DKX A;  2KG5 A;  1SXD A;  2EAP A;  5KNI A;  2LPE A;  2GLE A;  2DL0 A;  2K60 A;  3TAD C;  2ESE A;  1PK1 A;  2QAR B;  3SEN A;  1JI7 A;  5J8Y A;  1V85 A;  1LKY A;  1UCV A;  1X66 A;  2L5Y A;  2B6G A;  2K4P A;  3K1R B;  5J8Y C;  2D3D A;  1DXS A;  1B0X A;  1PK3 A;  3BS5 B;  1WWU A;  2KIV A;  1OXJ A;  1PK1 B;  2Y9U A;  5L1M A;  1X9X A;  3SEI A;  2KSO A;  2F8K A;  1SV0 C;  1SXE A;  4PZO A;  5JTI A;  4PZN A;  3KKA A;  2KMD A;  4MHV A;  2E8N A;  4RQM A;  2F44 A;  2EAO A;  1Z1V A;  2FE9 A;  2JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...