2NO4A

Crystal structure analysis of a dehalogenase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
LVDSLRACVFDAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-2-haloacid dehalogenase IVA
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Hydrolase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no4A01
2YMPA 4UASA 3KBBA 3PGVA 5ALWA 5AM4A 5ALTA 5ALLA 1Z5GA 4CF3A 4XPZA 4BX2A 3QGMA 4Y2VA 3L0CA 5ALEA 5ALGA 5ALVA 3UMGA 3WK5A 4CNQA 2ZBDA 1YMQA 5ALSA 1ZOLA 2HI0A 3SD7A 2ODAA 2FI1A 2YJ4A 3QU5A 2WF7A 4UAUA 1TJ3A 3GYGA 3W5DA 2HO4A 1JUDA 2PQ0A 3MPOA 5AKJA 3FPBA 3ET4A 1TA0A 3AR6A 3U19A 5AVYA 5AVTA 3KC2A 5AKZA 1K1EA 4HGQA 2HCFA 2C8KA 4UMDA 3R9KA 3IRUA 4JB3A 1SWWA 1VJ5A 3FVVA 3S6JA 2WF9A 4OHFA 2IOHA 2HEGA 5AVQA 2GHTA 4BX0A 2ZG6A 2WF5A 1Q92A 2B1RA 2FPXA 2I34A 2HF2A 3WK8A 4BNDB 4Y2TA 2YJ6A 3P96A 3EF1A 3B9BA 1AQ6A 3QYPA 5AK5A 3QLEA 2Q4TA 2NYVA 1ZD4A 3SMVA 2B0CA 2FPSA 1Z4QA 2P27A 2P9JA 1ZRNA 2WHEA 5AW4A 4OCZA 3OCWA 4I9GA 3N5KA 4UU1A 1NF2A 4UARA 1VFPA 3AR2A 2I54A 1RMYA 1U2TA 1Z4PX 3SF0A 3L5KA 2AGVA 2FUCA 4QQFA 3WKCA 1L7OA 3ZU6A 5AK6A 3ZX4A 4UM7A 2W11A 4KX5A 3QUTA 3ZX5A 4RETA 4YGYA 2BDEA 1QH9A 1YDFA 2GFHA 1N9KA 3AR5A 1TJ4A 4C4RA 4XQ0A 2GO7A 2B8EA 2WFAA 2P69A 3L0YA 1ZJJA 2CFSA 2YJ3A 1WR8A 3ZVLA 1CR6A 4OD0A 3QUBA 3WGUA 2ZBGA 1N8NA 3N1UA 2B82A 5AI5A 2GMWA 1U2SA 3WKDA 1XP5A 4AS3A 3K1ZA 4FYPA 1QYIA 4F71A 4B6JA 3U7EB 3HLTA 5AW9A 5AM3A 5ALHA 1Z5UA 3A1CA 3KDPA 2RAVA 3MC1A 1Z4IA 5AVXA 3L1UA 2X4DA 3L1VA 4KNVA 4Y2JA 2WF6A 1RLMA 3AR7A 1LVHA 3QU7A 5ALRA 2YMMA 1SU4A 1NRWA 2C4NA 2G06A 3U26A 3QUCA 1L8OA 3QU9A 2FPWA 4Y2RA 4BNDA 4H1WA 2YJ5A 1RKQA 3WK9A 2G07A 4KNWA 4Y2XA 5AI6A 2FPUA 2OBBA 3W5BA 2JARA 3WK4A 2AH5A 3DNPA 4KN8A 5A3QA 2D2VA 4UMVA 3W5CA 3M1YA 4UAVA 2B30A 3L7YA 5E0OA 3WKEA 4L6CA 3A3YA 1S2OA 5IS2A 5AM2A 3N07A 2C88A 4KYTA 1RC8A 5AICA 5ALKA 3OCXA 3WGVA 3ONNA 1L7NA 1NNLA 2CN1A 3BWVA 5ALXA 3M9LA 4G63A 3ZVNA 3DV9A 4UMEA 4YIHA 5AVSA 1SWVA 4EZEA 4CE6A 3QX7A 4BX3A 3RF6A 3F9RA 4CF5A 1X42A 5AIBA 4IFTA 2EARA 3L8EA 2YY6A 1Z4MA 3AR8A 2FPRA 1U02A 4HGNA 3E81A 4HGRA 1T9ZA 4AS2A 5AVUA 3A1EA 2RBKA 5ALZA 2IOFA 4ZEVA 5AW8A 5ALJA 3FPSA 3D6JA 5ALPA 3N8GA 1RQNA 2ZXEA 2EAUA 3L8GA 4HGPA 4AP9A 3ZTWA 3W5AA 3ZUPA 5AW7A 2JAOA 4NABA 4YH1A 2Q4RA 1ZD3A 2NO5A 1T5TA 4UATA 3SKXA 3PGLA 2AUTA 1O08A 4HAIA 3FM9A 5ALOA 3WK6A 4Y2QA 1XPJA 3UM9A 1Z4JA 2MU2A 2I55A 4DWOA 3I28A 2R8XA 1RKVA 1LTQA 3ZWDA 1L7MA 4GIBA 3MN1A 5AK3A 4GXTA 2OYCA 3U7GA 3I6BA 3QU4A 4YCMA 5ALYA 1RMQA 3OCZA 3WKAA 3DAOA 4BBJA 5AW2A 3CZ4A 1YJ5A 2WF8A 5AI4A 3BA6A 1RLTA 4L6AA 3ESQA 2YBDA 2YFYA 1IWOA 2I6XA 2IOFK 1ZD5A 4F72A 1KYTA 5AKIA 1S8OA 1WVIA 1Z4LA 3FGOA 4G9BA 1L8LA 4J03A 4UU0A 3PCTA 3SKYA 5AKGA 3HYCA 4FE3A 2RB5A 2AMYA 2DQSA 3A1DA 1Z88A 5AW6A 5ALFA 2CFRA 1RPZA 5AKXA 5AK4A 2B1QA 4C4TA 1WZCA 4NWIA 1Z4NA 1Y8AA 1WPGA 5ALUA 1EK2A 1L6RA 2G08A 4E88A 2NO4A 4RESA 5AKKA 2W4MA 1QQ6A 2C9MA 5AI9A 3EF0A 5AKHA 2JAWA 3ED5A 3EWIA 4XE5A 2O9JA 3QU2A 2I33A 4PNHA 5AW1A 3RFUA 4MUMA 2R8YA 3DDHA 2FEAA 3OCUA 5AM1A 4ZEWA 2HOQA 3ET5A 3SHQA 2G1AA 3R09A 2HF7A 2P11A 3QUQA 3NANA 4NV0A 3KOOA 4DCCA 1RQLA 3WKBA 4L57A 5FP0A 4NFLA 5A3SA 3R4CA 2ZOSA 1CQZA 5AVVA 3L0BA 1ZS9A 2IA5A 1ZRMA 3U7HB 3NIWA 4QJBA 4ZEXA 3ZI4A 2GHQA 3AR3A 3J7TA 3PDWA 5AW5A 1J97A 1RMTA 1RRCA 1TJ5A 4Y2YA 2BDUA 3ESRA 3N28A 5AKYA 2QYHA 1RDFA 3FZQA 2B8JA 3E84A 2I7DA 2ZBEA 1EK1A 1U7PA 5AW0A 4IG4A 2R8EA 5AVWA 3KD3A 3MMZA 4KX3A 1YV9A 1MH9A 2G0AA 2OM6A 4BKMA 4UMFA 4NAVA 5AHXA 2HDOA 2YMQA 4EX6A 3ZW7A 2WM8A 4I9FA 5AW3A 1XVIA 3NASA 1F5SA 2RARA 4EEKA 1YNSA 3NRJA 4C4SA 4DW8A 2QLTA 4DFDA 3OCVA 3L8HA 3KZXA 3QXGA 1Z4OA 2PR7A 1L7PA 3E8MA 4O8CA 3EPRA 2JGAA 2CFTA 3B9RA 4YIKA 1RKUA 1RLOA 3OTQA 5AIAA 5AESA 4UM5A 5JJBA 2OA0A 1PW5A 2YN4A 4Y2UA 4Y2SA 1O03A 1T5SA 3I76A 4EELA 3L8FA 4MWOA 1VJRA 3U7FB 2VKQA 4XOUA 2W43A 4Y3UA 5AI8A 3U13A 3UMBA 1FEZA 3VAYA 5ALIA 2JAUA 2PKEA 2EATA 1ZD2P 4JDPA 4CF4A 2YMLA 2ZBFA 5AM5A 1J8DA 5A3RA 2Q5EA 3OPXA 1TE2A 5AM0A 1QQ5A 4YCNA 5ALDA 5IT0A 5ALMA 4OFZA 2G09A 4EX7A 5T41A 3B8EA 2BY4A 4BEVA 4HYTA 4YCLA 5AVZA 3QNMA 3ZVMA 2R8ZA 5AKLA 5AKEA 3NALA 4BYGA 4HGOA 1QQ7A 3WK7A 3ZTYA 4Y2PA 3I1YA 4J2TA 2HHLA 5ALNA 1Z4KA 4EENA 3TLMA 5AVRA 3AR9A 2HSZA 2O2XA 1YS9A 3IB6A 2G80A 3AR4A 4UW9A 3CNHA 2HX1A 3UMCA 2C8LA 5ALQA 2FUEA 3SLRA 1U7OA 3NAMA 4FFDA 2MU1A 5IT4A 2IYEA 5AI0A 3OCYA 2FDRA 1Q91A 3IJ5A 3ZWKA 2MSNA 3E58A 4BEWA 3NUQA
chains in the Genus database with same CATH superfamily
8ICQA 1E1YA 3T7DA 4ZCPA 4MUGA 1KE1A 3LP6A 2BI8A 4CNQA 1F0MA 4TRNA 4YT4A 4E2FA 2WAAA 2HYIC 3BQNB 5AKJA 3SK0A 5DLPA 2XY4A 2ZWVA 4ZI2A 4JKYA 2PKWA 2JEIA 3SSAA 3R9KA 2W0SA 1GNVA 3LL7A 3V7JA 1FDOA 1JAHA 1BW9B 4MUXA 3UV7A 3AJRA 4RE6A 4ZAFA 1KR5A 3PNKA 4AZVA 1EUDB 1UC4B 3NGXA 1XTKA 1GV0A 3GJXC 3H1EA 4M0FA 3ESBA 4MQ4A 4CV3A 1XHLA 4IDNA 1XALA 5G0SA 1A4RA 4N7BA 4UHKA 1QIDA 2R5WA 3CQ9A 3AYZB 4LV8B 5AQEA 4K9NA 4B9UA 5IANA 2JKYA 5IM4A 1Z34A 4QSMA 1GG9A 2CUKA 3IBYA 5AI5A 3WDLA 2HAEA 4JL8A 4Q1FA 3BS5B 3PFGA 2JZCA 4F5WA 4DARA 7GPBA 5CVUA 3CF4A 2FE1A 4US1R 3G9UA 4FT4A 3I4FA 4QTUB 1RJDA 2OCPA 4MR9A 2QVBA 2XE6A 3VBEA 1CHDA 3NCTA 1S8AA 4IMJB 5KFLA 2P2GA 4FS8A 4FZNA 2OUIA 4QIWC 4CFSA 2MHCA 3ZHZA 3OCXA 4TUPA 3ID6C 4JK3A 3MT8A 5LUBA 5H70A 3IG8A 1Q7RA 4RQ5A 4EBBA 1YMVA 2OHVA 2UXDB 4M76B 4B4OA 4CF5A 3AR8A 3PWSA 1UPCA 4Q9DA 4K6GA 1WCWA 1BEEA 1U1IA 3UA4A 2QAGA 3LZCA 3GGCA 8LDHA 4HF7A 1A2QA 3QKWA 1JWLA 1ZD3A 1T8SA 1NVFA 3CVXA 1JEYA 4GOLD 1IB0A 1PRYA 4WT7A 4RSHA 3L02A 3IGFA 2WHQA 2ZUTA 1CUWA 1TDJA 5G02A 2HIGA 1ARZA 5ALYA 5BMVF 1Z6YA 4ZYXA 2XCLA 1NJXA 1N6OA 2Z6AA 5JRJA 4WI1A 4GVPA 4BPRA 1DQPA 3VDQA 4M55A 5TSDA 3IBTA 1H6BA 4YAIA 4GMXA 2GBFA 4QAJA 1WWKA 3ZQUA 4Q05A 4NM2A 1Q3HA 4HWKA 4TSRA 3T3MB 2QRJA 3BEDA 4LN1A 3Q85A 1CYDA 2A1JB 1AUXA 1Y3DE 1N33B 3ZD8A 4YR2A 3CWZA 2PT6A 5COQA 4YRGA 3LHKA 4JSRA 1GPMA 1OI4A 1HO3A 1MH9A 2ZRBA 4YRIA 3DWEX 3M3DA 1OW5A 1SU7A 1FUYB 2QWXA 1EWKA 2VBFA 4YJFB 5KWVA 3NTVA 4ND4A 1XNQB 1M5RA 3QI7A 5JARA 4D81A 1NYTA 3RAPR 4JXJA 1EE2A 2JAUA 5KVAA 2VHQA 3ZCUA 4M53A 1QQ5A 3GMDA 3RBZA 4X1YA 5BO5A 4DKJA 4B3BA 3RIYA 5J2AA 1NUUA 1VXOA 4HFMA 2VWHA 1RJWA 2A58A 1A9TA 3BFPA 2QN7A 3OPNA 2Q8NA 4JEMA 2GTPA 1NXPA 4I1PA 4EYGA 2Q2QA 5ALNA 5BR7A 3A6EA 1FLAA 5ALQA 3E6AA 4P7GA 1JH9A 2PXIA 3PGA1 5FBHA 3GEDA 5CFMA 4EG0A 4MLCA 1RXCA 2W6IA 2C84A 3KETA 2JCXA 4C7MA 3M1IA 2B92A 1MV8A 5IHPA 1I5OA 2ODAA 4KAJA 1R0ZA 4REQA 4I14A 2QUBA 4J9PA 1H66A 1Y1RA 3URMA 8ICJA 1CZRA 3N2GA 4KVZA 4IRUB 3RJJA 1YONA 4DSTA 1L9XA 1PP4A 1JKJA 5TMDA 2VQFB 4L3VA 2YN0A 2FPXA 5CD9A 5DISB 1Y3AA 1BVRA 3TQQA 2PM8A 2GTHA 3OHAA 3PUIA 4OA5A 4C3VA 1MAWA 5EWMB 4C2AA 3WGTA 1VMDA 3S40A 2RJ3A 3JQ9A 3SF0A 3AVUA 3R7AA 2I03A 2B1GA 3WMWA 3WOHA 4ECZA 2PD3A 4HATA 3J80A 1OQAA 1F5NA 2KE7A 4DLLA 5FWDA 2HFJA 4J1TC 4QPCA 1F0KA 1ZQUA 2NMVA 4ZREA 3VR5D 4RU9A 4QZBA 3SVZA 3BCSA 3CTPA 1Z4IA 1JHYA 5UKDA 4RHEA 4N82A 4DJDC 2A0WA 1D07A 3RG2A 3AR7A 4LCEA 4MK4A 5DYTA 4WOCA 3MTBA 5FPHA 2B4KA 4X93A 1NOKA 4JASB 4EF6A 2KWIA 4WBNB 1E98A 1K5GA 2ISCA 4ARZB 1KETA 4OPMA 4KYTA 1LJ8A 4UFNA 3BQMB 3V7NA 1H65A 2B6GA 1VL6A 3NHMA 3ZDBA 4TT8A 1J0XO 3IVXA 5BN3A 3Q9SA 4PPXA 2ZSBA 4PLFA 4EHJA 2ABWA 3B36A 3EW9A 5JAPA 4R7GA 1ODIA 3OWXA 3W3AH 2PH3A 1NJZA 1TECE 1NI3A 1I5EA 1D8YA 2GD1O 5IN5A 4RZRA 2KSOA 1ZL0A 4RQTA 3AOGA 2XAAA 1J23A 3IFSA 2H31A 1DIAA 3A27A 4F4WA 1CRWG 2ZIEA 5KREA 1FMCA 4P4PA 3TAXA 4EMBA 3VU0A 4TKVB 1UEJA 1E2MA 1HFEL 3FHTA 2INGX 3SJZA 2Z2YA 4DNQA 2ALJA 5B3LA 1UIRA 3STTA 5AJZA 4X94A 5GJVC 3QKSB 3A1TA 2RGAA 4LJ9A 4BFXA 5JZVA 3HUUA 3E0XA 3HK2A 2JA2A 2RI0A 2BFDB 4FMCB 4MUBA 1QHXA 1W0JA 1IZ7A 4B31A 3D2NA 5EXPA 2GBCA 2I7TA 3OCJA 3AHGA 2VQSA 2ZCVA 4JLOA 4ONEA 4OQZA 2WWGA 2W9XA 4B44A 3BRCA 3WB9A 2B69A 3QOYA 3A2LA 1V47A 1RYBA 1F0PA 2B2NA 2I3GA 2B20A 2JIPA 2CV0A 1T1JA 4DV3B 3R7WB 5D6NA 5GONA 1OT5A 1HLGA 1JT9A 1U9IA 1BNOA 2FZ4A 4QUIA 2V4UA 3ZU5A 4AF6A 2YVKA 3KB6A 1HOTA 2WTNA 1BGXT 4Y3UA 1ICEA 2PSDA 1IQ0A 2J0QA 3GFPA 1GPNA 4RX1A 3TRDA 2EOAA 3UW1A 3G0BA 5J0RA 1ZOSA 1DQYA 1DBRA 4J8PA 2DUMA 5TQ0B 4BZQA 1FRQA 3JXEA 2AE2A 4JEHA 1U0LA 2W9MA 3F6EX 3RS3A 1BHJA 4AZ3A 2VF8A 2XX3A 3AF5A 3L8CA 9ICLA 4FBTA 4YFYA 2HBZA 1T13A 2XCQA 3VC2A 1LW7A 1U2PA 1VJ1A 4HDRB 1ZQPA 4NJEB 4EJ6A 5FEUA 1P73A 4M47A 2QRPA 1Z5ZA 4MPTA 1U2RA 4GYWA 1AZWA 5E1MA 4H7DA 4KWIA 2OMKA 2H0QA 4D43A 1W36B 1MQ3A 1GR0A 3ITNA 1EFLA 2ZDQA 2A67A 3N0TA 1KXJA 4M2LA 4B2IA 5BW6B 1RWOA 4KRFA 1SMKA 3SC3A 3TRIA 3AJ8A 2W6JD 1NFQA 1WXDA 4C3UA 3DDWA 4EFMA 4ZT5A 3UXYA 2MJLA 2WAQC 4DEYA 4XUEA 4OHWA 4ZTUB 2X1HA 1TIKA 4DZZA 3WS7A 1N5KA 4Z7NB 4NYJR 3M6MD 2HVIA 1ZSNA 3DOEA 4IEEA 5HJEA 4B6FA 3QPUA 1TM1E 1V3VA 2Q29A 1IU9A 1LFAA 1Y1LA 2BCSA 2ZR8A 3Q7IA 2HIAA 1M33A 3TOSA 3WHKA 1N8KA 1MX3A 3L0ZA 5GGXA 2CT8A 4OJLA 3VO9A 5KAIU 4C0SA 5A5VA 3NCHA 4DKXA 1SC9A 4GGOA 2HDWA 4Y8VA 5BW5A 1W93A 1NNUA 1GP2A 2NAPA 2FFHA 1U3UA 1KF0A 4YAWA 1SEPA 4RXUA 1YU6A 1KK2A 1JQDA 2KW5A 2J46A 3HXKA 1A2BA 1T8UA 2XUFA 3BHNA 3ORSA 2X9GA 4W1SA 3IHTA 5HCIA 1XRQA 3A1SA 1RM4A 3LT5A 3KZNA 1NVXQ 4UQOA 4GR4A 3RFCA 1M2KA 3T5CA 3P2EA 121PA 2OAEA 5IT5A 3BTVA 4GE0A 2C83A 4P4LA 2EW8A 2ZAGA 1WLSA 5JNVA 2F9FA 1GPDG 2Z6VA 5IYZF 1Q0ZA 3MABA 2GN1A 1RG6A 2REQB 2MRLA 2B3DA 3WHPA 4GRDA 3BZWA 4L16A 2J6SA 1N5RA 4B6PA 3HRDD 4XAQA 4G4SP 1YRAA 4DDMA 2X41A 1T8PA 1NY6A 1SK8A 4OU4A 4QJFB 4AUKA 3G1TA 3VXKA 3BQ7A 1N6LA 5TPWB 3R23A 5D3MA 1MA3A 2FWMX 4W99A 1U0FA 2ECQA 1NT2A 3JALB 2I3ZA 3W9BA 2W9CB 2LKDA 3TWOA 3EC7A 4IIHA 2ASLA 2IOFK 1ODSA 1R4NB 3FCUB 4JLWA 1GUFA 3H0LB 3PTZA 1XSPA 4JB0A 5IINA 1U7XA 3UUFA 1FP1D 9ICRA 3W06A 1CUEA 3TFWA 2BFBB 4WUTA 3K0HA 4S0XA 3DCJA 5EJ7A 2W4MA 1Y42X 4NCJA 1GJRA 1XAGA 2OUKA 1AN9A 3W8NA 1R9GA 4BDTA 2NUAA 4U3JB 3RC3A 4RS4A 1N2JA 2UUCB 1RBQA 3A05A 5EZYF 4KXXA 4ZVSA 3QE3A 5FV7A 4DJFC 1MV5A 9ICCA 4ZEXA 3BXPA 4ENRA 2A5GA 3H18A 3JV7A 3FHJA 3UMRA 4Z51A 3GVPA 4BQPA 4U7PB 2H59A 5F3XB 2E6UX 3ADBA 1FTGA 2VSYA 3K2IA 3LDHA 2NTJA 3LLSA 2D2EA 4N4AA 1FNCA 3I64A 4K6FA 3CW2A 1NF3A 5JW6A 4Q01A 1K89A 3U9SA 4Y18A 2IKSA 1X80A 2VKQA 2E82A 5ELXA 1Z00A 3WTCA 1EWVA 2D3DA 3WLIA 1XMJA 3WBJA 4HQ0A 3RRBA 3WGKA 1QIEA 5B7GA 1V3TA 2QP3A 2CCGA 1T9BA 4DQPA 4G8CA 3WBKA 4CEJA 1H1LA 1R88A 1DKUA 4R8RA 3QYJA 2NVOA 2WVJA 4IHJA 1WJGA 1UQRA 3VZRA 13PKA 2F43A 5FR1A 2Q9CA 3IUBA 4DCGA 5B36A 2G6BA 1EDBA 4FYJA 2OCIA 4F6LA 4A1OA 3CW8X 4CCHA 1ZVKA 1V7ZA 3IJ5A 3WB1A 2JJ1A 4F2SA 4BEWA 1HNNA 1OPXA 3ND7A 3G85A 3MMXA 1Z5GA 4WMLA 1G7RA 4C21A 4JYBA 3M6KA 3HJHA 5EJEA 3U5ZB 3AONB 3KWJA 5BOMA 4C5BA 1S6YA 2C9DA 4MNTA 1SB9A 3EA4A 4HO1X 5HR5A 2CMDA 5KT2A 3TW8A 2CSXA 4RCYA 3VPXA 2ZYRA 1RRPA 3KALA 5GZ6A 4DHWA 1QTMA 1XTSA 3KG2A 2CXPA 1URJA 1A69A 3LC2O 1ZD4A 4DSZA 2FPSA 3LV8A 4W1RA 1C7IA 5EUCA 4GGMX 4Z49A 3GLGE 2NV0A 4EO4A 3OD5A 2F1IA 3PB3A 3I09A 3B1YA 4ER3A 3LSYA 5HKAA 3RRJA 4LZPA 1T7PA 4CKEB 3EUFA 4ZYWA 1GL6A 4XIFA 3ZKWB 2GD2A 1NZJA 3JX9A 5A1JA 1DAEA 2C78A 1X7HA 1UOQA 2EDAA 5FOVA 3KNZA 4LRUA 1TGVA 2ZUVA 3BCUA 1GZ3A 2XUHA 2O8VA 2I4NA 5K8LA 2F3RA 5DX8A 4I55A 3JASB 3TZCA 4OQLA 1IHPA 2C9BA 4JI7B 4TMFA 2IUEA 1FUUA 1W75A 2GRAA 1TW3A 1NXVA 2G06A 2R1TB 4A10A 2NVBA 5EUBA 1NSFA 3L5OA 2IH5A 2C2RA 2CRXA 2VH2A 1T1GA 5T64A 1N7HA 4XVCA 2EF0A 1ZD8A 1M2WA 3VSBA 4W5NA 3CO5A 5E9WA 3L8ZA 2I6TA 4O08A 3KAPA 4QJ4A 3P5SA 4FCCA 1UQUA 1B2LA 1V96A 3RADC 8ICRA 2JK1A 1GCOA 1D1QA 3G49A 3WAJA 4KREA 5BYAA 2J59A 1N34B 3QEAZ 4CXMA 4A8JA 1CY0A 4I28A 3AFOA 4LBVA 3D4OA 3S55A 3A0UA 3FMIA 4D92A 3ND9A 4RW0A 3H2YA 5BXQC 4MQBA 3TYXA 5DBEX 1VI6A 1EK0A 3PHJA 2W6ID 1WHTA 3V8PA 4AUMA 5E7MA 5DU2A 2C04A 3B3FA 3IUMA 5ECGC 4HH1A 4BWYA 4WESA 2JFZA 3OFSA 2ZTHA 3PUKA 4ZT6A 4NENB 4AQYB 3ZWBA 2D13A 1FVHA 4ESHA 3PQ4A 2MIIA 1G3RA 3OZUA 3WG9A 4CCYB 3K2EA 3ZGYA 2YVUA 3RGGA 5AW1A 2XY6A 5JQGF 2XCIA 2Y1CA 2ZK7A 3GNLA 1FY2A 1B4DA 4GLLA 1NI4B 5JDIA 4WNIA 5MFPA 2BGNA 1TRKA 2OZEA 1X9WA 4LMBA 1NUHA 1TM4E 3ZHOA 1Y9EA 1MMFB 2IYVA 3C6KA 3H5VA 1OIVA 3DC7A 3QFHA 2RAFA 2JGFA 4BKMA 3HYRA 3TOVA 3C85A 1LTHR 1PHRA 3COJA 1VYVA 4IMRA 2QL9A 3ZV6A 2CYCA 4IHKA 2WM8A 1LQ2A 1P4SA 2Q9AA 4MW4A 2ILTA 3HCEA 4EHDA 1THGA 2OV1A 4N48A 4RD6A 5I7SA 2BSAA 4YJKA 4ZVKA 4CODB 2XKAA 5KVSA 2Q7OE 5JECA 2ODPA 2RHLA 3U7IA 3TZEA 5JJIA 3E4CA 3DCIA 4ZQGA 3DE2X 4AWAA 4YRAA 2UZAA 2PL9A 3PNLA 3RYTC 1VE1A 2DPHA 4FZRA 5IAGA 5ENZA 5I8ZA 5J0YA 1O8BA 2Q8PA 5L4SA 3ACDA 6AT1A 5H83A 1TYZA 3OEWA 1CUAA 2APJA 4II2A 4UD6A 5F1PA 1LX6A 2UZ4A 1ZNXA 2NXCA 3CO0S 3DBLB 1CY2A 5LMZA 2XYVA 1GSHA 3N75A 3OEEA 2KM1A 1OROA 4D79A 4MR8A 1ZMRA 2JLQA 4RKEA 1DRGA 2VHTA 3ZHUA 1V6AA 1Y0BA 1NYLA 4QNRA 3BWCA 3KJQA 5JNTA 5NULA 1ZI9A 3D3EA 1C81A 4G36A 1RI4A 4M1OA 3L0OA 1J5XA 5FL7D 1TCCA 2FXIA 5IG2A 3NBFA 1Z4QA 4QZVA 4DA0A 3AF3A 2KBEA 3N5KA 1BKYA 2KJQA 5GM1A 4Y2GA 2WWRA 2BZ0A 4RE5A 4EBCA 1B0XA 3E8SA 2WABA 2E85A 1K7YA 4NG5A 5KUTA 1XN4A 3LYUA 2EV9A 3ND6A 1OMOA 1LK7A 3IR5A 5L3QB 1PR4A 2QZSA 3CLVA 4IDEA 4L76A 4RMIA 1VG0B 1SV4A 2PVCA 2XIJA 3QF4A 5CD1A 2OHFA 3WKDA 4X1KB 5ELMA 3U7QB 4A91A 5K51A 4DQLA 1FP4B 2PBZA 4O4LA 2GM3A 4MV9A 1X1CA 5DGCA 2RGNA 1SHKA 3SHWA 2LIPA 1CYEA 2BPFA 3ESDA 1QSGA 2XQKA 3PY8A 1Z25A 4BVFA 5KFJA 1DUSA 5HKLA 1OXTA 1XMQB 3Q0TA 4ZCIA 3NYQA 2IYAA 3IM1A 2LM1A 2AOUB 2D2VA 4MWEA 2XCPA 5J2UB 4MDEA 1ULAA 4MRPA 1Y37A 4J94A 1ODJA 1UM9A 4AX4A 1Z26A 1NFRA 1SHJA 1S4MA 1NW6A 2Y0BA 3AKYA 2GZMA 1N0IA 3F9RA 1P0FA 3IT3A 3WVNA 1GNTA 5DLYA 5D86A 3RB0A 3LUCA 5AO9A 1AKQA 3PXUA 1WF3A 4ENWA 3UMMA 3A70A 5IFLA 4GAEA 3WL6A 1ZEMA 5KOJB 3EZ9A 2V5UA 4Z6FA 4BUJA 5EG5A 4I0WB 1FRVA 5H59A 2PUWA 3PXCX 4JITA 3VZQA 3VHRA 2BTQB 4PG6A 1LBQA 2KS6A 2VF2A 3NM5A 1BEZA 2FLLA 2VDUE 3ZE9A 2ERCA 5LU8A 4D9GA 3SZMA 3QW2A 4K0KB 3OZRA 1RQ7A 3UAOA 3QHQA 2M6LA 3FR8A 1C0LA 2G36A 2DR0A 1JV2B 4O0IA 3IO5A 5K8IA 1NC3A 5AJVB 1G5RA 4DZTA 3OVMA 5BWBA 2WA1A 4I3HA 1DCMA 2P11A 1OILA 3NXSA 3GA5A 3R5XA 1XAHA 3RUDA 1V35A 2FGKA 4JMPA 8ICLA 1Z0JA 4Y9RA 3ZBQA 2J4CA 3BS7A 4FFRA 1G8HA 4GPIB 2DH5A 3I2JA 4UTNA 5JCOA 16PKA 2E5FA 1XK6A 3O91A 3WGNA 4GBED 1FFSA 4M0LA 1X8JA 2OQVA 4B3HA 3HJFA 2AJBA 2YMQA 2CL7X 4Z4CA 2R8KA 4EEZA 4DL9A 3UJ9A 2QLTA 5E7JA 2VF5X 3RUHA 1HYBA 1SBIA 2YWCA 1RJGA 4GQAA 2EZ8A 2JL1A 4HYQA 5DBHX 2EATA 5TR9A 3C48A 3UPQA 2WAOA 3QA3E 1IBCA 5CNJA 2LD4A 1EFAA 1QIFA 1BE1A 2XD9A 2AQKA 1HFKA 4DFPA 3RAQA 3WFJA 3LWLA 5JTUA 1FP6A 5BSUA 2EFEB 1WXEA 3I9V6 2C2HA 1J8QA 2OENG 2WK1A 4D56A 4N5LA 3ROQA 3T95A 2OO7A 4A0HA 2VDQB 4UBOA 4LHXA 2SICE 2PLFA 4KQ9A 2PS9A 2DH6A 1XXHE 5J2JA 5ALEA 3KR0A 3AL3A 3CKKA 4DR7B 5EZQA 3OLYA 4PZ9A 5CFPA 2VPXA 4KGVA 4QICA 2AX4A 2WKPA 3GFTA 4DMMA 4UBMA 1G2IA 1SK9A 3KC2A 2F3UA 1ZOPA 1J25A 3DD1A 2G5GX 1XRLA 5CK4A 4Y6SA 2YICA 3C1OA 1PJ4A 4CIVA 4FKMA 3ND8A 2ID4A 5JYDA 3PWKA 2XLBA 4OI0A 2E8OA 3ROPA 2HWWA 3DNMA 4EYOA 1NF2A 3MUOA 5FI3A 3Q3JB 1HIWA 4OO3A 4GM4A 3MTJA 2HA5A 3GLQA 1GN9A 2KB0A 3TJMA 4M21A 5D84A 4H15A 5K01A 3NBMA 1EM8B 4XGNA 1QRUA 4BNHA 1GQSA 4HN9A 1V26A 4PXSA 3U4MA 2YZ2A 1H1DA 3AV0B 1O4VA 3C4VA 1EDZA 2MMCA 3FETA 4ZOCA 5IKXA 1SBQA 5J0OA 4RMGA 4GVXA 5BNIA 3ABZA 1JQAA 1B14A 3RTGA 3SBOA 2P91A 4MKZA 3W79A 2G28A 3EODA 1O7JA 4BMVA 3WWZA 1C7EA 1DWOA 5E8JA 1UHUA 1VLLA 4DOMA 2JEFA 1MLDA 1ODFA 3TF5A 3H8WA 1BRMA 1LDGA 4YYZA 4DG9A 3VR3D 2ORVA 4YBZA 1L7NA 1MZPA 9ICWA 3TH5A 3H1BA 4HN4B 1PS9A 1KO7A 2UZ0A 4E2WA 3RTCA 5G41A 4Y7DA 4AMGA 1D2GA 3P0RA 4BNXA 2G8LA 4TV8F 7ICKA 2JIZD 2XO7A 5B5SA 1PL8A 2GFQA 3GIDA 3RROA 4MYTA 4HNHA 4Q4DA 1CQPA 4PTZA 5HOQA 3Q8MA 1FSPA 4FFNA 4ZPXA 2X9LA 1WM1A 1QSYA 3ZWDA 1QIHA 4Z6KA 2IA6A 4NG4A 1OTHA 2PJZA 4D0RA 3DZCA 4J07A 2JJ1D 4F4HA 3LCRA 2NZUG 1BVYF 5KSOA 4WNAA 4BMPB 3AK4A 1NONA 3GFQA 5HIJA 3SNHA 5J3JA 4LDRA 1W88A 2B1JA 4O2LA 1JKMA 1ST2A 3FWYA 3T3FA 2F8LA 1ML3A 4O5AA 5HDBB 3UK0A 1YZKA 3GW8A 3D2AA 3RYIA 4QBIA 1PI3A 1JDVA 3FBTA 1KFDA 1VLVA 3EGIA 3AB8A 2BFFB 3BSSA 4A3SA 5J0SA 2YFHA 2F55A 1RQLA 2ATIA 5CTAA 1QVZA 5AJWA 3ROKA 3OZGA 5ELLA 2E21A 2GHQA 4TWBA 4U0JA 1H42A 5A9RA 5JZOA 3E82A 4GPEA 4OFXA 1W29A 2FY8A 1HMYA 5M29A 1DK3A 4MW1A 1P1IA 5JS7A 2QW8A 1IXZA 2I80A 2GRUA 5JXIA 3CZ9A 3KXIA 1C0IA 1LF5A 1M72A 1P1KA 4IVNA 1A0OA 4I29A 4E5UA 1QB8A 4YAJA 5CG1A 2JEGA 3MUNA 4UM5A 1QQTA 3FMGA 1Z35A 3I5XA 5ETJA 2ZRMA 3CH4B 1W0CA 2JAQA 5AI8A 4JBYA 4EG8A 5KFOA 2C5LA 3UWMA 1ZGAA 1LS1A 1C29B 4AK9A 5JTTA 3B6EA 3LWZA 5A6SA 4HWRA 4FYXA 4DWJA 2ISSD 3TUJC 4DV2B 3K70D 4PHPA 3BFVA 3T5TA 1R0CA 2M1XA 1N9ZA 4DNXA 3MPUA 2MYNA 1QVWA 2WJPA 1IWPB 3FSRA 3BQ9A 1K4KA 5KNDD 2EYQA 3X1YA 2CLHB 1GTRA 4P2HA 3TTYA 5EOZA 4X8OA 5DGDA 3AEXA 1E6KA 3BZKA 1K7SN 4QNMA 4RVDA 4JI3B 1EGHA 1PYGA 3FIUA 4M0AA 2ZYTX 3KRTA 1G21B 1XL0A 1I1OA 2XYQA 4YCBA 4WRRA 3CUYA 4EW1A 1XXHB 4ZHQA 3W6NA 1EFVA 3ZWWA 4BEBA 1RYMA 2L82A 1W0KD 4P36A 4Z2AA 1E9FA 2ACEA 5CVTA 2CKDA 3PSAA 5EQJB 4Q4JB 4M8LA 5FO1A 4YRBA 3T3GA 1F0NA 2WYVA 4BKOA 1C7ZA 1IQUA 4KSCA 2HHHB 3OX3A 3DLIA 1XJ5A 4RK5A 5KAFU 4FFBA 4OM7A 2C1XA 4TPKA 1QP7A 2FUCA 2Q5OA 5EHIA 4CW7A 1CUJA 1SQ5A 2W6JA 1CUUA 2V4QA 5ECYA 3KR1A 1QGAA 4I6GA 1VYTA 2P9BA 5B3JA 3MGBA 2VXBA 1X14A 1GZ7A 4DF8A 5F5LA 4NV1A 5DEIA 3UTDA 4LNHA 3R0QA 2P62A 5A62A 4BNZA 5KFWA 1L9KA 3SJUA 1EUZA 1JIJA 4Y6LA 2HIMA 2C98A 1QYIA 5DKWA 4DSOA 1Q2XA 1OXUA 5ECDA 2YV2A 3DEFA 3U3OA 4B2PA 2D1YA 2HH9A 1N5JA 2NACA 3H5RA 4GG1A 1JH8A 4M1YA 3I9LA 1PFYA 4JENA 2IQIA 1K8ZB 2HU8A 4E3WA 4X1IA 2X0FA 5HP4A 1N3YA 3VPHA 3ZNQA 3DNPA 4PSVA 3AERB 2GLXA 2KKPA 5FPTA 2M0NA 1DPFA 3UCFA 2CVQA 2ZTDA 3IKMB 3G2IA 5LOVA 3C1TA 9ICJA 4NCXA 1F9AA 1RIFA 1NVDA 5DYYA 1G42A 2QSZA 1XTIA 2IDMA 1QHGA 1V1MA 3ILXA 1HRDA 3LF2A 1RXUA 3EF3A 3K7EA 3HNPA 2QKQA 1RQNA 1L8XA 1A9ZA 4QL3A 4P3OA 3U4GA 1TF7A 2ZSIA 4TUYA 4MS4A 1GDHA 1GU1A 2A9FA 4BB6A 2YV5A 2XCTB 1MOPA 3C6XA 1KFJB 3U5TA 2C2DA 4DUPA 3V42A 3EXIB 3AVOA 1N0WA 5G5GA 3KZMA 1H38A 3QU4A 4BV3A 3L07A 1CR0A 2LDXA 2IFTA 3ESQA 2QJTA 1E7YA 4XLLA 4HNVA 5K6AC 2H2WA 3F5FA 5E1DA 3EFEA 3M7DA 4D3YA 3K4HA 5CGQB 2O06A 4QVIA 5J0TA 4IOMA 1BH6A 3BWMA 4L9AA 4DOAA 5KSYA 1AGYA 3H5TA 5K4GA 1SD2A 5LP6F 3BUSA 3V1KA 1KQ3A 4OAOA 5JASA 3DMNA 4EDHA 4JLPA 1GSAA 4CMJA 3AETB 1VA4A 4BJ5A 4DR6B 1Z8NA 2VATA 3MR3A 3PQ5A 4TXJA 4DMGA 3BOSA 2XUAA 3D6NB 4AYTA 3SZ2A 2QD2A 3LOUA 2GXQA 1TL7C 5CTJA 4DQIA 2A14A 1NF8A 5I9NA 2ZRKA 4IV0A 2M32A 2UVPB 4RH0A 2R8PA 4X5OA 5M34A 3PDUA 1OZHA 3A9WA 1P1HA 1YIAA 4YBRA 2CD7A 5AVWA 1NT4A 4ZAWA 2VK4A 2Y2UA 3DXFA 2FX3A 4I2GA 2JGRA 2BE9A 2ICAA 3UMVA 5AW3A 2GPTA 4CZ2A 4OTZA 2KBFA 2ZB4A 3AQ4A 5C1BA 3EQ8A 2YHIB 2QRVA 1FVXA 1YHNA 4C0BA 1EFUA 1Y9DA 3FTCA 3N70A 8ICKA 1JROA 4MWOA 1Z8FA 3EEYA 4KP7A 5AFSA 3FNQA 4FBUA 1LKYB 3R5SA 2OXCA 2O2YA 2CZCA 1S8FA 5EGSA 3CY6A 4R8SA 1H05A 3V7LA 1FFAA 5BOVA 3N58A 3A6ZA 2OY0A 3HR7A 3BB4A 1WCIB 1N2CA 4NZPA 1FDUA 1JG7A 1A7UA 1KJWA 4J1QA 4U02A 3UMCA 1YQEA 1KKXA 5C51B 1SKUA 2AN9A 3I2HA 5C9ZA 3EXEA 5IJXA 1IZ9A 3DLTA 6GPBA 1Z5PA 5DZSA 1TU4A 1JMVA 3KDSE 4G0VA 3EOAI 1CUZA 1ODKA 4GYKA 1JYFA 3SG0A 1T9HA 3NV7A 1OX6A 4I2IA 3QVTA 4EGFA 1YWGO 4MW6A 3KU1A 3RJTA 3A26A 1TAGA 2JMGA 4RQ8A 3EFHA 1KIAA 2BV3A 3GBPA 4YA6A 2QI9C 2RJNA 4I50F 3P9XA 1DHTA 2IL1A 2EIHA 3GG2A 3ZDFA 1T9DA 3OIWA 1NIPA 1OTXA 3TW4A 3P9ZA 3OZAA 4KFUA 5HK9A 3OLCX 3KOWA 3E7XA 4ZVRA 1PFKA 3NNDA 5AK6A 3CNQS 2E1FA 4HYYA 3SWWA 1PGQA 3C87A 4QEKA 4H6PA 4LAFA 3RC8A 4MWGA 2CVZA 1CX9B 1IPHA 4LYJA 5IVKA 2Y6UA 2C77A 1Y9AA 4G8DA 1AU9A 4ABTA 1XP5A 1FOEB 2VUHB 2PSEA 4J1NA 3WNQA 3HFGA 3WSTA 4QSHA 1RWXA 3WNDA 1RWQA 2Z2KA 4ZZ0A 4YP1A 1V6CA 3K0BA 4LI0A 2H7XA 1ESDA 1WXFA 5HUHA 1ZH6A 5K3FA 1IY1A 3PVCA 4QPJC 4PZUA 1U9ZA 1JSRA 3A2NA 3QZUA 1R37A 3LLUA 5IUJC 1W1UA 4PR0A 4OLHA 4I1YA 1XZNA 4AP5A 2QYSA 3F3KA 1SUPA 4JLVA 3K5PA 4DNPA 3KYJB 3LAWA 2OKCA 4R63A 3HP6A 3S2IA 3K6JA 3RJKA 2BQRA 1Q21A 1NQTA 3RF6A 2EX0A 4PLTA 3FUTA 4PYQA 3IQHX 1Q3UA 4HXEB 4IWYA 3W5IA 2QU8A 2A0FA 3IAXA 3L01A 2ZBRA 2MSLA 4UNPA 1HEKA 4XUDA 2CCJA 2D0OB 1EK5A 2ZXEA 4EFKA 1KEUA 2GZ2A 5T5QA 4E09A 2KI5A 1ZY2A 4QZAA 2XT0A 1TAQA 1XPJA 3HLYA 1U8FO 4NVRA 3B1ZA 3T1NA 5IYZB 2O2ZA 4TZKA 3RFAA 2O7RA 1WZIA 3GN2A 1MVOA 1GWNA 3OOJA 2ENWA 2GEJA 2JIBA 1OB2A 1X9IA 1Y7TA 4QRIA 4QU8A 1R18A 4WXEA 4R51A 1ZSVA 5LZ9A 3OP1A 1JQBA 4QODA 4GC6A 2EANA 4BC1A 2P0YA 3G23A 3SQWA 2AZDA 4XYEA 3KPYA 1DBIA 4UB5A 1QQ6A 2ALZA 5JO0A 1MQAA 3D5QA 3A2KA 5CHEA 2ZYAA 2BP7B 3QPVA 3WIOA 4MGYR 1SXEA 3OZIA 1I0ZA 5LN1A 4MUKA 5KT4A 2MSDB 1II9A 1Q17A 3NVVA 3VR2D 1YUBA 2RKWA 3CVOA 3ZJVA 5D85A 4CF6A 2FOIA 2P2YA 3ZZMA 2FK7A 4CU5A 3SI8A 1IY0A 1NXOA 2ISQA 1T5BA 3CC8A 1PL7A 3NIWA 4OB8A 3BEOA 1IK4A 2VZEA 2E18A 3RRZA 2AJLI 1K98A 4KQMA 3K6RA 1EFKA 1W581 1AO3A 1CZOA 3LU1A 4KFTA 3X2FA 4YB8A 5TS2A 2G0AA 1D5CA 1OY1A 4CT0A 3BTOA 2CXUA 1PFVA 3G7NA 1ZW6A 5FUVA 3A9RA 2AFHB 4MKGA 2B5WA 3K8YA 2BHNA 2VOJA 4M46A 5EZYB 5BVGA 3RRMA 3KUKA 3O2SB 4N41A 4XVRA 5B1IA 1RHRA 3HRKA 4HWSA 3KZIU 5KTYA 3BMQB 3MQ2A 3UWKA 3DLPX 3ZWQA 4O59O 2OHGA 3CGGA 1XDBA 1P9WA 3QNUA 3USES 5F98A 4GR9A 1QOZA 3SQXA 4FQ5A 4TV9F 3BIOA 4RJ2A 2QS9A 2J4FA 3BE8A 2IGBA 1R0KA 1FZTA 2YRWA 2DFNA 1FPQA 1PJAA 3KQLA 2ZB3A 3VNBA 1CJKC 1CB0A 2E4XA 5F4ZA 2IYRA 1DJQA 3EZFA 3C6YA 4QZCA 2TECE 3FF1A 2FETA 2TMYA 4H3HB 4RDIA 4RQ7A 1GFSA 3HXLA 3GCXA 3E58A 3L7JA 2JFQA 3R41A 2PBFA 3RG8A 2H4HA 4CM5A 5ICGA 4OGWA 1BVHA 2EJCA 3B9QA 1N5MA 5KBYA 4R16A 5IKEA 3F4KA 4ZRMA 4ZI7A 1L7QA 3G9ZA 5EI5A 2W6PA 1RPAA 4F5EA 1FSSA 3E5HA 1JHZA 2BMAA 4CLOA 4KO3S 1ZJNA 1H5UA 4YR3A 1WBJB 3O2QB 1IG6A 5BSVA 2I8CA 2J7KA 4C0ZA 4ARIA 4TWRA 2GM5A 1P1RA 3KWLA 3FWPA 1Y7LA 2MSEB 4AJ1A 1JEEA 5G4KB 5ERYA 4J0HA 3IP7A 3ABIA 4CL0A 4C8KA 1PQWA 4XQCA 4EHLA 4BNFA 2YKGA 1N6RA 1WG8A 2DPJA 4YP5A 3VH1A 1JIQA 4KMRA 5C7LO 1FDVA 1MABA 4TS1A 5FL7A 1C30B 1E7SA 4MVXA 1AMNA 2JGDB 3VHQA 1P2TA 1U7WA 3WWOA 5KPJA 1XXLA 1K7XB 8ICSA 4PX5A 4EFLA 3HBJA 3O8OA 4PCLA 4XQEA 4C07A 2DHDA 2YCBA 3SIXA 1HG0A 4N12A 1IBRA 2VT3A 3TQIA 4RAQA 1Z29A 3ZQ4A 2HRZA 3L7BA 3WLSA 2Y2VA 2C3YA 3ITEA 5KB3A 3BC1A 1UAAA 1TUBA 2V58A 3S2ZA 1UKZA 1AS2A 4ED6A 9ABPA 4NK4A 4RPCA 1J2UA 4Z86A 1ZH2A 1G5HA 4ZQBA 3T5DA 4M37A 4KNWA 1MG5A 4DIUA 3COWA 3L0PA 4ML3A 3GVXA 4GDFA 2I5HA 4HUJA 1ZQOA 3PFIA 3E9DA 1B73A 3RAFC 2DR2A 1D3AA 3KSMA 2JIDA 4E4TA 1A27A 1IJFA 4LYAA 2QX4A 3BMCA 1RYUA 3INGA 5KG2A 1TAHA 2IW1A 4U1RA 2ADMA 1RWMA 2G7ZA 4BKRA 1U2DC 4YO7A 1XTQA 1S5LU 1KAGA 2VRCD 5JZ9A 2GWSA 1ZW1A 2HJGA 5GADl 3C6ZA 1FQKA 1XEXB 4FSHA 1X7WB 4Y7CA 3HJTA 3N0VA 1A77A 2ZYIA 4MKHA 4OYLA 3THXB 1UPTA 5KFVA 5DGAA 5DHSA 3NV9A 4FYYA 1YKGA 4IQWA 5L4NA 5DBFA 4ZHSA 1N2SA 1KFBB 3WIBA 4YJDA 2V7XA 3RJEA 4ND8A 1YHZA 1L4EA 4BDPA 4HG2A 4FBLA 1RYEA 3HH8A 3QJGA 4F1KA 3GLKA 4B83A 3DH0A 5TMEA 1DWUA 3A1NA 1LQTA 1T8TA 2JFYA 2F3NA 3GFFA 5LQDA 4D6YA 4LC1A 4OUDA 3LCCA 4TYPA 5DBAA 4P22A 3GJSA 1CVLA 3CH5A 3TS1A 1VMKA 1O6FA 4X97A 2BRUC 4KLNA 2W04A 4UUMA 1U0TA 5J8YA 3ONVA 3GD5A 2OM6A 1T1RA 3QKRB 4HTFA 2EQYA 2V5VA 2V4MA 3N7TA 2OPBA 2VS1A 3E3LA 1H2YA 4UM8B 4AKGA 2FFAA 1P9LA 5AXAA 5JQGB 4F5DA 2V1UA 4EYSA 1Y7IA 2A5JA 1EDDA 2PMZF 3HKDA 1JECA 4R8KA 4Z4IA 3H5WA 2WT9A 2JRZA 1L7EA 2RDJA 1AHHA 2COUA 4UVDA 4WXRA 1QC5A 1EQUA 1JRPA 4K6OA 1K06A 2FW0A 4DUYB 2IHBA 3O2NA 4I5EA 4F5RA 1BGWA 1UDRA 2VHVA 4MVJI 3LUKA 5CGZA 1NR1A 1I3NA 1LSOA 2Z30A 1NG1A 4F45A 4EKGA 1ZAKA 3P9SA 4HFNA 5FBZA 4QZGA 1J39A 1HORA 3B85A 2CLOB 1T2VA 1NJGA 10MHA 4YXMA 2VPYA 3FPLA 2DWUA 2GKOA 3HY3A 4PO9A 4V2IA 3GG9A 2E0IA 1DPGA 1ND5A 2WUDA 2ZT6A 1UWVA 2H16A 5EJ9A 5DASA 5MDHA 2SBTA 2KZ3A 2ZREA 4GP7A 1NXXA 4U2FA 3ZLTA 3R8FA 3LO5A 4RHXA 1YJAA 4FJ2A 1A1VA 3L1HA 3U0BA 1PSWA 4JLKA 2IS1A 2Y9PB 4PF1A 2GEKA 2YY5A 1FFHA 5C31A 4DL4A 1JA1A 1G9TA 3K9WA 2I2BA 1P5JA 1Y8QB 3EYAA 3GVCA 1G55A 1TMYA 4P33A 1EP2B 4DV4B 4B4WA 5E9QA 2XB8A 1N8TA 3WKCA 1QG6A 1S7GA 1S4QA 4YVFA 4B80A 1QDEA 3VC7A 4RK4A 2XB4A 3SQIA 4B7XA 3KR2A 4M54A 2C0QA 2JLBA 5L7WA 2GMWA 3CPJB 5DRTA 4Q21A 5KJ6A 4ITUA 1XQ1A 3OJEA 3PHBE 5AHKA 5IBQA 4EB6A 2RK6A 4EPTA 2FH5B 1UKBA 2Z04A 4LKOA 4O0LA 3UH1A 4RY0A 1OUQA 2XYRA 2GEVA 4L95C 4JLSA 2HHVA 3PU6A 1M5TA 2BHRA 3EXG2 1S2NA 1F6WA 5E0OA 4CLDA 2GR9A 3TLGA 4QU5A 1C0EA 4OYHA 1EA7A 4C04A 1FRZA 4LWPA 3RK0A 2GJSA 1SCUB 4ND5A 4BX9C 2ZSJA 1B0AA 1X42A 4WE3A 4QGHA 4IDFA 4NQZA 2XGSA 1SY7A 4BO3A 5IDQA 2H4XA 5BN5A 2QKYA 4LE0A 3HDJA 3N7AA 4BNJA 4ER6A 1BMDA 4M49A 1KPHA 4IDQA 4DEVA 4ETNA 1VCOA 3VDXA 3VR3A 3BMOA 1C1DA 2AC4A 1ZH4A 3EFBA 2O4UX 4CEHA 4TYQA 5I51A 3EQ7A 1XEWY 2BEWA 3MJFA 1RMQA 7ICSA 2WF8A 2UUOA 5TS3A 4HS4A 3HDGA 4Z4EA 2JIZA 1ZQHA 1WVIA 1YQGA 2REBA 4X65B 3RYCB 1RHJA 3HYCA 3T0IA 3ZK9A 4O4JB 2DFKB 4L07A 2XT6A 2PLWA 4XLTA 3IV7A 3V3TA 1N62A 1Y3BE 1E9DA 2FW8A 4HZUA 3SS8A 3ASZA 1ZETA 2BGMA 1OLXA 1ZA2A 2YQEA 3EZLA 4F5QA 3Q88A 3HYTA 3N7SC 5I7EA 3AI1A 3CT6A 2D6FA 1B8PA 1Q16A 1CQZA 1B4FA 5B53A 2JCSA 1E7QA 5CYFA 2XOKA 4UHJA 5AHOA 3M34A 2AK3A 4WPGA 1KQGA 1GTZA 2QUIA 4PH5A 1RD4A 3DDUA 4N3AA 4NAVA 1UR5A 4LI3X 1HL3A 2RDIA 3B20A 3RS2A 2CMHA 1U0HC 3I4CA 4E5DA 3PRJA 3ZBPA 4FDMA 5DB9A 4I19A 2CFTA 4UEJA 3FCOA 4FZJA 1GD1O 1RBYA 2OXTA 3GLIB 4AECA 1KAQA 1FZQA 1Y98A 4EY7A 3NBQA 1ZD1A 1ZC3A 3BXEA 4NPHA 4NMWA 3GEIA 2G1PA 1F2UA 3NALA 3EZNA 2XAUA 5NLLA 4IJKA 8ICZA 1ESMA 3LGAA 1P0QA 4KOEC 3WB0A 1ORDA 3EGVA 2Q5HA 2NNWB 3NAMA 4RK7A 2K5UA 1OBHA 1KDPA 2K60A 1WXIA 1CR4A 5EIOA 2XVXA 4KV7A 2UYOA 3H97A 4RDXA 4HVTA 4MYDA 3M6FA 4CMHA 3OQ6A 1EZZA 4URXR 5BSWA 4QGFA 1P2BA 4YMGA 4LZJA 3LGSA 2ZSEA 1M6VA 3RTBA 1T3SA 4YDSA 4A8TA 1KY3A 1GYQA 2YJ4A 2BONA 4UAUA 2QN6A 2X8BA 5LZ7A 1Y63A 4L8GA 3PZPA 5HBGA 1VTKA 1G0NA 2ZYSA 2PUVA 3G2MA 5KNDA 2D1TA 2R8JA 2QTVB 1JZQA 4JB3A 2GX6A 4DFMA 5C5CA 1AGXA 3ECSA 1P60A 4R98A 3ZXUB 4PYMA 4GT1A 2C82A 4Y6GB 2Y3IA 2ZWIA 4TUSA 5B1DA 4BMDA 5BPCA 4RT3A 3CG0A 4F84A 4O5CA 1HUOA 3C15C 5E6RB 1UQTA 1OFIA 2EVWX 3K4GA 1UXKA 3KO8A 3UA3A 4EKDA 2IPXA 3VMFA 5A4KA 1Q77A 2VPZA 3E27A 1NRIA 5T4HA 1I3OA 3OZ7A 5C37A 4TYNA 1W0KA 3H7AA 3QPCA 4TQSA 4WL0A 2WG1A 1YAJA 3UUGA 1G5IA 3HKEA 4YJ3A 1SUBA 2ZBGA 4HXYA 1OA0A 2EFHB 4MHTA 4FHEA 1L4UA 5F3RA 3DVAB 1F60A 1HDRA 3RUAA 5DSXA 1L7VC 3RVBA 4JI6B 1ONNA 2YFKA 3KKPA 1JXLA 3FOCA 1Q50A 3IPCA 2QMUA 1A5TA 1AKYA 1YO6A 4RJKA 3NBYC 2QAGC 2JD2A 2WA2A 3L7AA 3A11A 3RIEA 1ABFA 1UZNA 4ZO6A 1IHUA 2FVYA 3HDYA 3ZTTA 1LTKA 2BLNA 2Q3MA 4LGVA 1B15A 1QTNA 3N05A 3BS4A 3GOHA 3C3MA 2ZRJA 4B6QA 4KQFA 4NLKA 3BB3A 3MOIA 1SL0A 3ED1A 1SVOA 4YT2A 1GDTA 2G88A 4F93B 3G5AA 3V8MA 1QAMA 2ZI7A 1ZGGA 3NIGB 3Q7EA 3LRPA 4HGYA 1W5AA 1W4LA 3GDXA 3CCCA 1KOFA 3ZU3A 3HO6A 1J22A 1JIKA 3AZPA 2GB4A 4TQUS 2JATA 4ANFA 2OQIA 1LV8A 1TPYA 1RQPA 2X19A 1ODLA 3LGXA 3UUWA 3F8WA 1Z73A 3IPXA 4TV8B 4IRDA 2P4QA 2C42A 1IQRA 4U2GA 2MUTB 2FLNA 5AK4A 5JHHB 2LXNA 3PDJA 3OHBA 1DFGA 2ZZKA 1NI5A 1QQBA 1IEXA 1HDOA 4S12A 1JN3A 1ZYQA 2ECOA 3LZ6A 3CURA 2W3SA 4RHUA 1ESEA 2BF7A 2Q41A 3EPKA 3R77A 4MB6A 4LYFA 3ETCA 4ZH4A 1VSTA 1OAAA 3D2SA 4YJ2F 3QVSA 5DNCA 5LSAA 1NUAA 5KU1A 3ZI4A 2DOKA 1A4UA 4OLBA 4DLWA 5SZHB 2XE4A 1Y88A 1GFWA 3OKAA 4DDKA 1QH8B 1L4FA 4FOOA 4PYLA 3HNRA 4RTRA 3IJRA 1GPKA 1P18A 4NAUA 4I9FA 4LZLA 5LQNA 7ICJA 4R1TA 4YDRA 4WCFA 2H1LA 3PFHA 5JJBA 1IJBA 1XWIA 3O03A 4A27A 4I36A 3AI7A 5HZMA 5CRIA 1JW9B 1R3UA 1TMOA 2RJOA 4DCVA 1I10A 3IT1A 4TLEA 1PR6A 2GKSA 3ELBA 2PJRA 3JTMA 2YN2A 2VJBA 3ZVMA 3OECA 1WAMA 5DM2A 2CDRA 4UTXA 1XEAA 5BMOA 2YZMA 1UPUA 1IJEA 1UWCA 3GB9A 3W8DA 4ZYTA 2PNJA 1NTOA 1SGGA 3PR4A 3BDPA 1S3GA 4CQLA 2QG6A 2YMPA 5I01A 5ALWA 4JOBA 1ZINA 3WICA 4AMYA 1XWLA 1OZAA 3DCYA 2GNOA 3SHVA 4L9SA 3BZUA 4UAZA 4DWIA 1FUIA 2Q1XA 3JQ9C 1C3VA 3SR4A 1TJ3A 1S96A 1S9DA 2CJWB 8ADHA 2ZAYA 1YZYA 1ZVQA 2D1RA 2R87A 2WFMA 2R1UA 3UEOA 3IMEA 2GXSA 4TTPA 3H4DA 2EKQA 4EUEA 2XTJA 3PSPA 3WK8A 1UPBA 3UJ6A 2E1PA 4MVJF 2V59A 5I4BA 3TSCA 2Z5FA 3QWBA 2CXQA 3LKZA 2Q3HA 4O4JF 1OYYA 1BXGA 3WWPA 1U2TA 3GT3A 4O3FA 1Z4PX 2MYTA 3H87A 1ENYA 2EERA 1XZQA 2NTEA 3IUJA 4J9NA 4B4UA 3UIEA 2WUGA 3O4RA 1TJ4A 1XOIA 1OH7A 2QLBA 4EG5A 4REMA 4NTZA 5HE8A 2BCEA 1ISIA 3ZD7A 5HMMA 3GRCA 3ASYA 3JPRA 3CUUA 4G26A 2A9JA 4KMSA 1KK0A 3R5TA 1FFYA 3CRQA 3F96A 2X8LA 3G8AA 4CMIB 4WOJA 5D3QA 4YWJA 3HWRA 4RVHA 4C0JA 4KR3A 1OWPA 3QFFA 2QMEA 4FZVA 5ED0A 3TLJA 5A3QA 4OIMA 2AHRA 1MDFA 4Q5IA 3D4BA 2ZIWA 3IKVA 1UXOA 4QOSA 4BVAA 2HKIA 2D7JA 1F4LA 2HJ9A 4C8OA 2UVUA 1SKYB 3PIDA 5AM2A 2WV7A 4DAOA 4MB2A 3IRVA 3DV2A 1SQGA 3GRZA 3TE6A 3MQ4A 4DSLA 3RABA 2DPGA 4R9NA 2FP4B 2ZANA 2YB4A 1U5AA 1V8FA 4HRYA 1E2DA 3SOPA 4BFZA 3GEPA 2ESEA 2P3SA 4UTOA 3HV2A 2Y6VA 1U1FA 2XDQA 4FFMA 3HRIA 3VKHA 2Q1UA 4NYMR 3MTDA 3LA8A 1ECJA 4PE5B 4LVOA 2OXOA 5KHOC 2VZLA 3B2NA 2ZJ7A 1SBHA 2X15A 1DAOA 3IDAA 5K8JB 1V0JA 5PGMA 4R2WA 2HLDD 1PD1A 4ZVTA 3ODPA 4COKA 2K7FA 4QT4A 3WV5A 3LQ2A 4FDUA 4QDXA 4DJ5X 5T6BA 3H0RB 3PXDA 1QV6A 1VJ0A 2ZGVA 2P7IA 1GYPA 3SJCA 1QUEA 2W2KB 4QFDA 3K8QA 5MN6A 4B82A 3UN1A 4XUGB 2E9SA 1YASA 1DXYA 5EE0A 1U9IC 1G21E 1OXSC 2BDTA 3IX7A 3H9QA 1RZTA 1PS8A 1CEQA 1SHZA 2GCEA 1OLOA 4PZPA 3KSDO 4AI6A 3B78A 2OGWA 4Z7QB 4QYSA 3ESRA 3X1KA 1PFQA 5G40A 3FMPB 1X9HA 3ZDQA 1T1SA 2LCFA 5LP6B 3WGLA 4HJXA 3OQBA 4ZDIA 3Q0EA 1DOHA 3TZHA 4G6ZA 5DCUA 4ZAXA 4RDHA 1HDXA 2WHPA 2C2MA 3FLAA 4ENTA 3VR2A 2O8BB 3VI4B 2DC1A 2Z57A 2GZ1A 4RH3A 3TPCA 4TYMA 3KL2A 1RLOA 4ENPA 1E5LA 3DVRX 4YD2A 3H83A 3OY2A 1PG0A 1QO9A 3E7PA 5FB3A 4B8WA 3SENA 1YQ9A 4GRAA 3IOMA 1LNSA 3LPMA 1VRCA 4JDPA 4NEGA 1IONA 2YMLA 2C5FA 4EQZA 1RLUA 3TR0A 4E94A 4L9RA 4OHUA 3CH6A 5FNZA 1L3IA 2V7PA 4LNUA 1R0SA 4XYGA 3I5AA 3AILA 3W90A 1JDPA 2RGXA 3LLMA 4V02A 2Z8ZA 3TRJA 3RF7A 2NV3A 1CY6A 4ND2A 1U2GC 3WP0A 1WWUA 5JJCA 4RQ2A 4YRMA 4BC0A 1EHYA 2C8LA 3MWFA 2V7VA 1R10A 1QG4A 1EP3B 2FOXA 3QE0A 4ZICA 4YRPA 2VTVA 3EFOA 4BX2A 3P8ZA 3UXHA 4EF4A 1MT3A 3I0NA 4QFCA 3ZWNA 5ERXA 2C5SA 2GWHA 2QM8A 1XF9A 3JQFA 1CRPA 3TFOA 1RPNA 4NE7A 2JHDA 2H4YA 3PW7A 2CNLA 1V11A 3L7IA 3FVTA 2C8KA 1UKYA 3QFRA 3IH5A 3RKRA 3GQBA 3ZW9A 4HN2A 5E79U 4XWYA 5HR7A 5K0CA 3MAAC 3UHAA 4GX2A 3SQLA 2B2CA 1EI9A 2K2QB 4NMHA 5KYUB 3QYPA 2HU5A 1G0OA 4EPYA 4PZYA 4B7AA 3REQB 3DZGA 2XYGA 1J7JA 4R1UA 2ZATA 4G1FA 1XJCA 3ZLVA 3I9NA 3AEVA 2HQ1A 2C5AA 3ZX5A 3DUWA 3PNCA 5FBKA 1GUDA 2EZZA 5IDYA 5JXHA 4DXHA 5HBRA 2CUZA 2WJJA 3WL4A 4OFWA 3D6UA 3LH5A 4I50B 3QUBA 1YCHA 3WGUA 3KK0A 4ZC1A 3EWAA 3NOVA 5LWHA 3K1ZA 3AM3A 1K3UB 4HADA 4UXJA 1XZCA 4WK0B 5D87A 4EPWA 2XOKD 4IGAA 3OF3A 2H2AA 3CSDA 4KVAA 3QUCA 2HHQA 4Y2RA 3RVNA 2EGHA 1PNQA 4DVGA 5JC8A 1FPMA 1SC1A 1HF3A 3S5UA 4ZPJA 2YC4C 3GFOA 1C9JA 3RVMA 4QGBA 4RWEA 1V38A 1YXMA 1IZ0A 5FWAA 4KGXA 4QXMA 3ZWOA 1P3DA 5CK5A 1XYVA 5C4IA 3VTKA 4CT5A 1RXWA 2B8WA 3Q0IA 4C4OA 1JILA 2Y92A 4ECSA 1NKCA 1UBKS 4ICAA 1YE3A 4UUOA 2HYDA 3N8GA 1X87A 4OATA 2HMUA 4OI1A 3HKZF 4KJZA 2FZKA 1HM5A 2AUTA 1KI9A 3VYSB 1M2NA 2YWFA 4OX9B 4WVLA 3TW0A 3ZHXA 1XELA 4H1VA 1P1CA 2BH9A 5H5JA 5B2FA 5FPSA 2GJKA 2DRIA 4RY9A 5D3KA 2JFGA 4IUCS 2B4YA 2QSYA 3CPHA 1XS9D 1W6UA 4HDKB 4Y6PA 4PQGA 2HWUA 4DDVA 1O6ZA 2IELA 1L5FA 1K97A 4EA6A 3IJPA 3HV0A 1JEDA 1JDBC 4LHWA 4X3CA 1VPTA 1EKXA 1YZGA 2YXDA 4KLEA 2ZRPA 1K0UA 3GJ7A 2VRBA 1RFGE 2AG6A 2H51A 3V4FA 3M3PA 1A8QA 1FFUA 2VRCA 4XYMA 5IXJA 1WTCA 2NU6A 1Q0UA 3LYLA 1KFEB 5H7XA 4ACOA 3NWJA 1X7XA 3JQ6A 5AI9A 5DNEA 4MQFA 3FUUA 3EWIA 3M4YA 4QM6A 4WFQA 3E48A 4L2IA 4A5OA 4RA9A 4JWKA 1VM6A 4B79A 1YGPA 2F77X 2ZJFA 4C9BA 1X7YA 3EVAA 3SHFA 4BQRA 2FPIA 3BE6A 4WASA 3QH4A 1LBHA 4ALJA 4HS9A 3LE8A 3OO1A 3QFCA 4FOPA 2R7LA 1GKIA 5H68A 4MV8A 4I4IA 2EHJA 5ISMA 3F67A 5CNMA 2A5DA 1F4PA 5GTDA 3FYUB 1GEGA 1KGSA 4FD2A 4DFKA 5K0TA 1A50B 3BDAA 3A2MA 4NY1A 3UMBA 3S1SA 5ALIA 5CM8B 4K4IA 2P9GA 1AUQA 3I1FA 4JCCA 5F51A 4O4IF 2JCGA 2ZIVA 1Y8ZA 1BDBA 3B2QA 1PO7A 4JP1A 2KQUA 3AUUA 3DKKA 4PU0A 4EY4A 1O96A 1EK6A 5EVJA 1SURA 2X4IA 1ZZEA 4G0MA 1FSGA 2PGOA 2YS7A 1BYIA 1W73A 1F44A 3TLMA 2GXUA 4JFRA 1AB6A 4C1NA 1ZM7A 3DPSA 2MAXA 4NONA 3FRIA 2JJ2D 2PS1A 1RYNA 4E1BA 3LUAA 5JWOA 2A35A 4IXWA 4DUZB 4HH0A 3QKTA 4TV9B 4L75A 3NVZA 1O3YA 3FG9A 2DVMA 4LQLA 3OETA 2XHEA 2Q2OA 5BRJA 2C2YA 3CWCA 1YRHA 1XRNA 4CGYA 2FUG6 1XVAA 4DL2A 3CUKA 5F1YA 3VPDA 1E32A 2RGRA 1JNXX 1ZVJA 5H82A 4EB8A 4B46A 3UW3A 3RAGA 4OHFA 4B9NA 5F64A 5CW1A 3JZDA 1J8MF 1KU0A 2P2LA 1MG0A 3V4OA 4R41A 7MDHA 1RXYA 4IR9A 2QT9A 4XSVA 3U62A 4O1IA 2FNAA 5BYKA 1E5QA 1NG9A 2ZKIA 1ZQTA 4TWAA 3AR2A 1MVLA 3QVWA 3ER6A 4D8WA 5KDOA 1WUJS 4INOA 3DF9A 1I7DA 1A98A 2V7WA 4MEJA 3H11A 1E94E 2ZAOA 2PVPA 5SYNA 3C1YA 4NS4A 2AZXA 3ASVA 4FYIA 1X86B 3N0RA 4I1SA 2QGZA 1VLJA 4ZU1X 4BGDA 1FNNA 2G9UA 4I6JA 1GT6A 3CB4A 4CG1A 1W96A 3M8RA 4G5OA 1CZKA 3PZBA 5HQ3B 3GARA 3HRHA 3UWDA 2NVWA 1KEEB 3L1VA 4I08A 1D9ZA 5KFKA 3F98A 5DIZA 1M7GA 1PVDA 4DQSA 4A8PA 1RVV1 3D8UA 4LYEA 2VJKA 3DVQX 4GX1A 2O5RA 4KQXA 4A8JC 1M8PA 3PL1A 3WKEA 2BBWA 1WOMA 3HL4A 3T1HB 2EJTA 1HFJA 1TK8A 3PYLA 1R8XA 3DV9A 4JJGA 2VNIA 1G8FA 1Q22A 4I81A 4GRIA 4A23A 3GZJA 3ICOA 4H6WA 2AFHE 1YBAA 4I2DA 1M8FA 3FYHA 3EB9A 1X8LA 5A9SA 6REQB 4FGZA 1KVQA 1BXKA 4D6PA 5KX5A 4KDCA 3WR5A 3HGQA 4RULA 3G2NA 1QG2A 4KH0A 2OD2A 2IXAA 3M9NB 1TC2A 4ERXA 2YOFA 3COZA 2VHJA 3KEFA 4TTRA 2PUDA 5EZ6B 4NICA 4DDHA 1IUOA 3I53A 2DP4E 1WULS 3EVZA 1DC5A 3OCZA 3JATB 5AI4A 5JDIC 5LMUB 1BWSA 4X7BA 1P9NA 2XZPA 2XUJA 3FZGA 1RJFA 1N5OX 3G82C 3ZU2A 5E3HA 4EHNA 4S1OA 3FNBA 2QARA 2E8NA 1NMEA 5T7BA 1RNLA 4MHOA 4UTRA 3LXUX 4X7RA 1I24A 2WG2A 4H7JA 5A2GA 1Z45A 3EZ2A 1MPTA 1FYDA 1JMKC 1L4BA 1S0MA 3F8SA 1RC1A 1LV7A 3UAGA 4BKPA 5DW0A 2AKYA 4EVRA 2RHWA 2IZZA 1ECBA 3OURA 2IZOA 4WZAA 2BDUA 1LDMA 1RDFA 5KQGA 5B6JA 5GZ3A 1ZBQA 1JX4A 2Q28A 2AUNA 2D4AA 1YV9A 1LWOA 4M9GA 2JZBA 4PY2A 1XCJA 1J4AA 4WECA 2C2ZA 4JBGA 3IOBA 3DDCA 3T9CA 5SICE 2J9GA 1TT7A 3EIHA 2J1LA 2HLHA 2GUGA 4F1WA 2I9PA 5EIBC 5JCXA 3C1AA 2QYOA 2W00A 4OBXA 5JI3E 1AUOA 4M9UA 3U13A 2A5FA 1EHCA 2VPTA 1TF5A 1GHTA 4O3RA 3NWBA 1FYFA 4ECTA 1GN8A 1D0VA 3AJAA 3IEUA 2VOEA 5I4CA 3ZDCA 3VTZA 4JJEA 1OR8A 1UK6A 3T5PA 4FWBA 3FOBA 1WOYA 2O0KA 1V9PA 1TJPB 2OP1A 1C3LA 1MOSA 3HL0A 4CYMA 3ENQA 1STOA 4WXHA 1C4OA 3SE0A 5IJ9A 3Q4GA 3SYMA 5A71A 3PR3A 4CKBB 5ENVA 5HR6A 2GEUA 1I5RA 4MKFA 1PR0A 5JYCA 2R5NA 4JYCA 4DT1A 4XPIB 4YUAA 5KEIA 1JEAA 2I87A 1T5OA 1QR6A 2RBEA 1PUIA 2ILVA 2PSJA 1PGJA 3LPDA 5FAKA 5HJ5A 1EVIA 1BWQA 1TK3A 3G6VA 2FI1A 1JKFA 3LFUA 3O3OB 1N0UA 1RZVA 1COKA 5CDTA 4D25A 1ZXLA 3LX8A 1W85B 1HE1C 5KQMA 4O2AA 3AQEA 5JG7A 2D74A 2IHKA 4GKVA 1GLNA 3BQ0A 2WV9A 1E3TA 4J9KA 2OFXA 3VSAA 5IJWA 2ZT7A 5IIMA 1F6BA 1U0BB 2PK3A 4IIEA 3E9EA 3GGJA 4EPRA 1YZ6A 1OJ7A 5BSHA 3JQAB 3G9TA 2DB3A 1HBJA 2WQ7A 1IPFA 1XO1A 4LKRA 1R4MA 3TR6A 5AJUA 3O4VA 4RCZA 4CI0B 1XD2A 1G64A 4ECXA 1ZU5A 3NKLA 3BWXA 4KXFB 2C22A 5EPOA 3ONWA 5EWGA 1RQGA 2QN9A 3AU2A 621PA 1V9LA 1XFAA 2UVQA 4KNVA 4MRAA 2BFMA 2C5GA 2ZTCA 1X9GA 5FCDA 1W5FA 2FYTA 4RQ1A 2V6BA 1E6LA 4P35A 5L3VA 3WK9A 1A04A 1UFOA 1IM2A 5F77A 3M1YA 4AP6A 3BXZA 4MKIA 3B51X 1QFJA 2FG5A 4RSMA 4YMNA 2AGPA 2I9GA 1EA5A 1HMPA 4NIMA 3FUWA 4OREX 4TN5A 4MDYA 3CHYA 4FC6A 4TL9A 3I9MA 1X1AA 1V2GA 4HGPA 1K63A 2MSCB 2GZ3A 1K5PA 1TVCA 4YN4A 1NZDA 3OPVA 2I71A 1I6KA 2I55A 1RZUA 3IAS1 2VJ4A 3U37A 5HNKA 3QMWA 1P91A 1D2EA 3PUWA 3GNTA 4E08A 2X5JO 4HUTA 4LGMA 4OY3A 2WG0A 2K2WA 1YVEI 2CXYA 1PBTA 3IEKA 4RTLA 4QDJA 4X63A 3GWGA 3T7AA 1UFKA 9ICUA 3V8EA 4ESVA 4ZYZA 4PHDA 1AROP 4XYBA 2YXBA 3V6MA 4DMKA 2DSTA 3DC2A 1QE5A 2XR1A 2XYPA 5DQHA 4UB3A 1VHDA 1TZMA 5JCOC 3WLMA 2VH5R 2Q3JA 3TK1A 1QJCA 3H19A 5IJ0A 4QBKA 3TG8A 1BAPA 4P31A 4OB7A 1L1EA 4CEIA 4EEYA 3N8NA 4AYBF 2WHXA 3M4ZA 4EW6A 1QP8A 2F9MA 3USCS 1WPQA 3E0QA 3FN4A 1DX6A 3MMSA 5BUZA 1S3IA 3AR3A 1BPXA 3LX5A 1ZZGA 3OKCA 1FX0A 3H8SA 3E84A 1EFDN 3W4JA 2BM1A 4GMFA 4KCGA 1QRDA 4Z4FA 2QR3A 3ROXA 4B87A 5A4AA 1HX7A 3TLAA 4LDJA 3BXHA 4X5VA 3ZI0A 2C4TA 1YFZA 1M1YA 1Q0QA 4UCXA 5EFOA 1YL5A 1RW4A 2FPLA 2AD1A 3G9XA 2OOKA 4KYVA 4B48A 2GJ9A 5J0XA 3RB4A 3O8RA 1SCIA 1NNEA 1C7RA 2VJMB 2D1QA 1G66A 2BHLA 4LSGA 5LCXA 1N60A 3UCEA 3GYBA 1ID1A 4XSHA 3I2GA 4AJKA 3GUYA 3L7KA 5B2ZA 3T79A 3ANYB 2Z7JA 2ZTEA 3L9WA 3QE4A 4HQLA 4RC9A 3DW1X 2YNMA 2BELA 4CHGA 1MC5A 1HUQA 1X7GA 3EXFA 1W2WB 2Y1KA 3KD2A 3OKPA 2CV2A 1E64A 3KWFA 3N74A 1JLLB 1YS9A 4DSKA 3KSAC 2W6MA 4HDAA 2XPCA 5EKUA 1DE0A 3TM5A 2QPOA 3WIUA 4ZQEA 4ZK2A 1VJDA 4KFCA 1RWWA 4RQAA 1YA6A 4R69A 3FF4A 2LCQA 2IEIA 5LXTF 3ICQB 1WY5A 3C3WA 5KWEA 1BWRA 1QP0A 2ZUCA 5T57A 4FFPA 2ZS9A 4F5YA 5CAEB 1W9HA 3ROTA 3ROZA 5L3SB 4CV1A 4HQFA 2WDPA 2XNJA 4YJGA 4TROA 4Q9AA 2WJZB 4FBGA 1SZDA 1FDSA 3LUGA 1XTRA 4KITB 3OE1A 3H8MA 5JMOA 4FXOA 1SVKA 1MP0A 4AN0A 4RUAA 1X8KA 2R7NA 1JFLA 4KK4A 3YASA 4XX0B 4NXMB 3NVMB 3E70C 4S1TA 1RWBA 1WCYA 2HQOA 4YS6A 1RAFA 2XNSA 5JAOA 2QRKA 1S01A 4ZGBA 3G8CA 1LPOA 1YE5A 3TSWA 1WQ4A 4HDQB 2BFEB 4Z6EA 4N6GA 2FF5A 3PJDA 4PZ0A 4FS2A 4IUDS 1BJRE 2YJ3A 1V37A 5F9HA 5REQA 5CT8A 3S2YA 4WXPA 3G88A 2YUTA 5FPYA 3WIDA 4UNQA 1G5TA 3RUEA 1X9XA 3T3NA 5A5EA 4U2CA 4UE6A 3G2OA 4Z1OA 3H2HA 2WAYA 3BTSA 4WA8A 5DOVA 2C9ZA 5HRCA 5EKDA 3D8HA 2C5BA 2WR8A 1F12A 2QTMA 3DL4A 5TV2A 4IIUA 2OQRA 1F0YA 3ME5A 1AX9A 1E9AA 3VNQA 3CGWA 2ZWOA 3OMLA 4EGJA 3D43A 3AVQA 1X0VA 1YH3A 3P2IA 4G23A 3UJAA 5K4AA 1BPZA 4LRYA 2OXFA 4OQXA 2WJWA 2YC2C 1GAEO 1Q1BA 2C3OA 1JR3E 2A0XA 5AVUA 5CXXA 4DABA 3B1FA 2OCKA 1KORA 5TRTA 3UKDA 2VSQA 3LK9A 4IV8A 3IAEA 1HETA 1ZMBA 3LT0A 2WWXA 3R1IA 4X91A 2AR9A 3GLIE 3ABSB 1XCPA 1CJCA 3FMVA 2GF9A 5KT7A 4Q8FA 1YR3A 3H2ZA 1E5TA 1C1HA 2R6CA 3WYEA 4KO8A 1JPJA 3KYIB 2QTFA 2AFIA 1HFWA 4EO9A 2YWGA 3MCUA 5KYNA 1H9BA 1PBNA 2ZXHA 3HI4A 5FTLA 2VIIA 3MCVA 4DG8A 4CCWA 4O25A 4QGAA 1XSLA 4W5WA 1ILEA 2NU9B 3GLVA 2W9BB 1GZVA 2NSYA 4RS3A 1D8LA 2CNNA 3SY8A 4MUHA 2HLDA 2I2DA 5FWXB 3GH1A 3EGWA 2OFOA 1MR3F 4NX2A 4UVGA 1ZESA 3VBCA 1XQXA 1ODTC 2R8GA 2NV2B 2WI8A 2QQGA 3KLMX 3TZKA 2OZVA 3N0XA 5DJ5A 5KFRA 5CVCA 1H2XA 3TTTA 4WKPA 2BFOA 3HUDA 5HQJA 3U44A 5T3YA 4GLBA 1NK7A 4XQ8A 4AJEA 4RNCA 3DXYA 1Q57A 3UXNA 3BGSA 4M89A 2NZJA 4FGLA 4YJ2B 3UJDA 2B7LA 2CB0A 5BWCA 1W30A 5HIAA 2EKBA 2ZITA 2H9IA 4JU8A 4GFDA 2RHJA 4BO9A 1J1IA 2QPAA 3VNSA 4B2YA 1DEOA 3F2BA 2R6GA 1FMLA 1WD7A 3LY7A 1QLWA 2Q45A 3TIFA 2NG1A 5E4FA 3B3GA 5JH7A 1FDRA 1FXSA 3A8TA 1AZSC 5F7XA 3MW8A 3QEMA 1CQXA 4IMIB 3N2LA 4UPDA 3HBFA 2A19A 3V8NA 3SR6A 3GA7A 1KMQA 4JT8A 1YZ7A 4YP0A 4M9HA 1KI7A 2ZS7A 5GMOA 1TZ2A 4QBGB 4QWDA 2DFPA 2V9CA 4UUAA 2EZUA 5JV5A 1NMQA 3IG5A 2X9VA 3H1GA 2AZTA 3OLXA 3EXHA 1Y33E 5B3JC 4IJ5A 2J9ZB 4OJTA 4P2GA 1A76A 3QIAA 4ZZ1A 4R8UA 3TFQA 1SBTA 3F6RA 4ZTBA 1TVEA 2M6SA 4YDHB 2G4LA 1AKMA 1FUEA 2J30A 4OV6B 3E7FA 1LA2A 2LYAA 4YI5A 4C80A 1DTWA 1ZVVA 1B93A 4HDMB 4FDTA 2OHXA 2IX9A 2Q3FA 3D3WA 4QT0A 3U9TA 4DCUA 3EAFA 2ZU0C 3UAXA 3N3AC 5FJIA 2Y8EA 1SUFA 5C4MA 1E0AA 4QQRA 4IQTA 4D7AA 4F5OA 4RA6A 5DB8A 3AUOA 5BW4A 1YS7A 1GL7A 2R8OA 2QGFA 2QW1A 3OZFA 3IUSA 3RBXA 1FW6A 5CT9A 1OX4A 3RH0A 1UC8A 1IBLB 4YLEA 3MCTA 1QCCA 4KQCA 2ERXA 2C8VA 4U7GA 1YQTA 4MDHA 1H0HA 4DV1B 2I4LA 3HWX1 1IM5A 1FE8A 5G1OA 4F3NA 1NURA 3H3XA 2FFBA 2RAUA 1IC6A 1XTVA 2AH5A 1MX5A 1CY1A 4ZVMA 1ZQCA 2OK8A 2JH9A 4CL2A 1ADBA 4AUEA 3PYMA 5TGTA 3MGHA 2UYHA 2ZKLA 5KTSA 2P7HA 1YZTA 2FEKA 1WUDA 4JUFA 1A4XA 3L7DA 2HPZA 3FFAA 4B3FX 4BVJA 2F2AB 1TVKA 2HIHA 4PSCA 4V1CI 1RM5A 2OD7A 3G89A 3TXYA 1H0SA 3VR5H 2WFLB 3JD4A 3DG9A 4TX1A 3BTUA 2F1HA 4PGGA 4X20B 4GE3A 1JKXA 4U6QA 1R0RE 1KMHA 3PLRA 2EQBA 5AHRA 3FCXA 3LK6A 1QIKA 1J33A 4TZ0A 5JFTA 2OEHA 4P7FA 2ACKA 3G0OA 2XTZA 1WWVA 2GILA 4K9MA 3NW9A 4LPKA 1E6CA 4BP3A 4F9FA 3PCTA 1U1GA 1TAUA 3P71T 4Q82A 5JT1A 3MWEA 1RPZA 4TYWA 1H3FA 4GPZA 3UG7A 2ZW9A 1CZNA 4JBHA 2X8WA 2F9LA 3VO8A 1WKVA 4PIMA 1FCJA 2NYUA 2UKDA 1GXSA 5BOSA 4A0FA 1ORRA 1E9BA 3RAXA 3PPYA 5A3SA 1OU0A 1DL5A 2W90A 4UBNA 3TQSA 2RGGA 3PNMA 5HKBA 3KAKA 3UT5A 2JHGA 1EGAA 1P7PA 4AG3A 1VYHA 1L5YA 4CKWA 4M7WA 4ECYA 1KN5A 2HK7A 2YWRA 2GOYA 5CEEA 3X3HA 3P26A 4NU6A 4EUNA 2CHQA 1CNEA 5BR1A 4V39A 1HG1A 1GA6A 1NNI1 3PNQA 1O1YA 3UJ3X 4L9WA 3GK3A 3A4MA 3IP1A 2QF7A 3LRTA 3RK4A 4TLAA 3HP1A 1IY9A 1A8HA 4X24A 2VTBB 4PBSA 1JJ7A 4FFVA 4IRMA 3C24A 2CEKA 2Z6UA 2VAXA 2B5OA 4EI8A 5KFNA 1I4TD 4IXNA 4EX7A 4IW3B 3ETGA 3HR8A 4OJQA 5SY9A 3ANXA 3IQFA 1KI6A 1PR3A 2E4AA 5AJXA 3RSLA 1A8IA 5TJ9A 3O8QA 3OU7A 2V0GA 2R66A 1V85A 4JC5A 4NJOA 4IG9A 2H00A 2CL0X 1SKSA 2JHAA 3S1LA 5JSHA 2Z5LA 2MSNA 1CLUA 2NN3C 3UT0A 4P0PA 4HX2A 3RC7A 1V5WA 5J0WA 1SKYE 2BGUA 3UMGA 3F47A 3U81A 3ILHA 2DQYA 2AN3A 4N8EA 1SEVA 3A0BU 3MPOA 3SLGA 3R3ZA 4GQBA 1ADJA 4EARA 1OX5A 1W9MA 2CY0A 5LNK6 2AN1A 2JJ2A 1C3OB 2E49A 2I34A 4B0PA 1DT5A 4OJ5A 2E89A 2IUSA 5AK5A 3PFFA 1QKIA 1O0CA 1YOVB 2FSPA 2I78A 4KLGA 2DWOA 1NP6A 1EFPB 3DHEA 4XGRA 3NS7A 1KO8A 4LDZA 2O2CA 1IVYA 3IQGX 4F96A 1ISHA 5CFZA 1PTJA 4ABYA 2F2TA 2IZ5A 2PKYX 4BQIA 3MWDB 1UFVA 4EHIA 1CUHA 3D4NA 2NWQA 4ZOLA 2GOLA 4PLPA 4LY0A 2ZRLA 1I94B 1YDGA 1YOBA 2X7XA 4IX9A 1XROA 4CR7A 4X7PA 2J5XA 2MTBA 4ALMA 3FJ1A 1I2AA 4WVFA 1JSLA 4L22A 1KL7A 4QUBA 2GHIA 3VOTA 5JRZA 3RUIA 1DCFA 3ZJTA 5KWSA 2JLRA 3I42A 3K6SA 3IIEA 4C6TA 1CV2A 4KR0A 3G8DA 1SXJE 1Z0IA 3BB1A 4YUVA 4KLJA 4LV5B 3OIDA 1AKUA 1HE5A 4RTKA 4GZ3A 4JI1B 3EGDA 1I33A 1OVMA 4U9UA 1Q83A 2ZXFA 3BJIC 1IBSA 2RRDA 4FS1A 3ICEA 1KDRA 3QVKA 1A97A 4KQHA 4QULA 2BM8A 4CCAA 1YQDA 2W8KA 2AR0A 5KFHA 2ZSFA 3C3BA 4KO1S 5BN4A 1WMAA 4JZKA 4R01A 1UBHS 4JYPA 4BO2A 3H5AA 4URFA 1NDQA 1A8PA 4EY5A 2YNMD 3RPEA 1O08A 3Q8RB 4AIIA 1QAQA 2COEA 4O2RA 4Q03A 4AC9A 4YCXA 1IXSB 3V2GA 3I6ZA 3HVIA 3PSTA 3TI0A 3K9QO 4L15A 1PT6A 1UOEA 4B9AA 2YRXA 1EIZA 4TTIA 3MN1A 1Z6GA 3U7GA 1LZLA 2X6RA 1ZICA 3FRHA 3WLRA 2A9OA