2NO4A

Crystal structure analysis of a dehalogenase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
LVDSLRACVFDAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords (S)-2-haloacid dehalogenase IVA
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no4A01
3CZ4A 4BYGA 1QQ7A 2MU2A 5AI9A 2FPRA 3KC2A 4FYPA 2GHTA 4YIKA 1RLMA 1O03A 2PQ0A 2GHQA 1WR8A 5AVVA 1K1EA 5AKHA 4BKMA 2C88A 2IOHA 1TJ3A 1JUDA 2BDUA 3NRJA 2FEAA 2EARA 4BEVA 1U2SA 4JB3A 4Y3UA 1L8LA 1L7OA 2ZBFA 3QU7A 3I76A 1ZJJA 2B82A 5E0OA 1YV9A 1U7PA 3SLRA 4XPZA 4UAVA 2X4DA 3A1CA 2HI0A 2JAUA 1QQ6A 3SKXA 5AKXA 2QLTA 4YCLA 3KDPA 3AR5A 3QU5A 4ZEWA 4HGNA 2P11A 5AVXA 1LTQA 4EELA 2G1AA 4Y2TA 1L6RA 3UMGA 3QUBA 2YFYA 5AVWA 4GIBA 2WF5A 2G80A 1WZCA 4C4TA 2EAUA 5A3RA 1AQ6A 1ZD2P 1RMQA 3NASA 2GO7A 1SWVA 2I34A 5T41A 3ED5A 4UARA 2YY6A 5AM5A 4YH1A 4C4RA 1XPJA 3BWVA 5AESA 5ALXA 1WVIA 2JGAA 1TJ4A 3NIWA 5AW0A 2IA5A 2MSNA 5AKLA 4EX7A 1L7PA 3ZTYA 1ZD5A 5AW8A 1QH9A 5ALVA 3QLEA 5AVQA 2HOQA 2OM6A 4KNVA 2AMYA 5ALTA 3KOOA 3EF1A 4L6AA 2OYCA 2PKEA 3IJ5A 2HEGA 2ZBDA 3P96A 3MPOA 4RESA 3AR4A 5ALPA 3E8MA 1VJRA 3WKCA 3ZW7A 1Z5GA 1RRCA 2EATA 5AW1A 3ZWDA 1Q91A 1QQ5A 2G06A 3UM9A 3ZX4A 4MUMA 1T5TA 3AR2A 2YJ3A 3DAOA 1T9ZA 3OCWA 3ZTWA 4G63A 4YCNA 2YMPA 3NUQA 4UM5A 2JARA 1RMYA 3WKAA 1Z4NA 1LVHA 3E58A 2RAVA 3B8EA 2R8EA 4H1WA 2G09A 3IB6A 5AKEA 5AM2A 3L8HA 5IS2A 4UASA 3WK9A 3RF6A 5ALOA 2ZXEA 4XOUA 2IOFK 2I55A 2B0CA 5AW5A 1N8NA 3R4CA 5AIBA 4J03A 5FP0A 4Y2RA 2I33A 1EK1A 3BA6A 5AIAA 2BY4A 4EX6A 4I9GA 2AH5A 4CF3A 5AHXA 4UMEA 4UAUA 3RFUA 4KN8A 2WM8A 1RC8A 3HYCA 1O08A 5ALLA 2Q4RA 2OA0A 3ZI4A 2W4MA 5AM3A 2HO4A 3FM9A 1TA0A 1F5SA 2BDEA 3L7YA 4BX2A 2CFSA 3K1ZA 3I1YA 3L5KA 3OCZA 4BEWA 2ZG6A 4UM7A 4UMVA 2W43A 3MMZA 3QUQA 1T5SA 4YIHA 2VKQA 4DCCA 4Y2QA 5JJBA 2HSZA 3WK4A 4YGYA 4NAVA 2FDRA 5A3SA 4BBJA 4JDPA 4NWIA 5AM0A 5AICA 2QYHA 4CNQA 3WKDA 3QXGA 1KYTA 2P27A 1ZD3A 4B6JA 4PNHA 3ZX5A 3E84A 1J8DA 4IG4A 1S2OA 1WPGA 4HAIA 1Z4MA 2FPWA 5AI0A 3TLMA 3W5CA 4DWOA 2B8EA 5A3QA 3B9BA 5AM4A 2Q5EA 2C8KA 4E88A 5AK6A 5IT4A 2HF2A 4L57A 3SF0A 3W5BA 1Z4QA 4F72A 3WK6A 2P69A 3A1EA 3PGVA 1RMTA 4YCMA 3DV9A 4UU0A 3M1YA 4OFZA 4UMDA 5ALRA 1Z4IA 5ALNA 3PDWA 4UU1A 2NYVA 1XVIA 4HGQA 4G9BA 4Y2YA 3N1UA 2GFHA 4UW9A 4HYTA 1U2TA 5AW2A 2R8ZA 2ZOSA 3ZUPA 4UMFA 5AK3A 2JAWA 4GXTA 3OTQA 1Z4OA 3KZXA 2WF8A 4NABA 3R9KA 1RLTA 4OCZA 3ZWKA 5ALWA 3GYGA 3W5DA 4CE6A 1FEZA 2I54A 3AR7A 4NFLA 2YN4A 2FPXA 3U7FB 2WHEA 3CNHA 2DQSA 4I9FA 2C8LA 2HDOA 2HX1A 2NO4A 4EEKA 1ZS9A 3WK8A 3N5KA 1L8OA 3A1DA 3QU2A 1TJ5A 5AM1A 5AW4A 1VFPA 1YJ5A 1CQZA 2YMLA 4L6CA 4IFTA 4QQFA 1L7MA 2YBDA 3AR8A 1YS9A 4Y2XA 3PGLA 2CN1A 4MWOA 4Y2SA 5AKKA 5ALKA 2YMQA 5AK4A 5ALSA 2Q4TA 4KX5A 3WGVA 2B8JA 1Z4KA 4BX3A 4HGOA 1Q92A 2FUCA 3HLTA 2YMMA 3QX7A 5ALEA 5AI4A 1ZRNA 2O2XA 3OPXA 3DDHA 3QU4A 3F9RA 1RPZA 1ZD4A 2RB5A 1EK2A 5AW9A 3EPRA 5AKYA 2ZBEA 5AVRA 4AP9A 5AVTA 2JAOA 3E81A 3WGUA 2O9JA 2AUTA 2AGVA 3ZVNA 2YJ6A 4HGPA 4BNDB 4DW8A 5AVZA 5AVUA 4XQ0A 3L0YA 3SHQA 1Z88A 1RQNA 4F71A 2G0AA 4KYTA 2D2VA 2ODAA 4Y2VA 1QYIA 5AVSA 4CF4A 2HHLA 5ALUA 2CFTA 3IRUA 3ZVMA 2C9MA 2B1RA 3WKEA 3SD7A 4EENA 4J2TA 2YJ5A 4OHFA 3U19A 5ALHA 2IYEA 2PR7A 4CF5A 3W5AA 1NRWA 3U7HB 3NALA 3R09A 3FVVA 2ZBGA 2HCFA 3UMBA 3VAYA 2IOFA 3FGOA 3FPBA 3M9LA 1Z5UA 3ESRA 3OCXA 3L1UA 2RBKA 3SKYA 3AR3A 3U26A 1Z4PX 1U7OA 1Y8AA 3A3YA 5ALMA 5AK5A 3N07A 3U13A 1SWWA 4QJBA 3S6JA 2WF6A 1VJ5A 3ONNA 4ZEVA 5ALDA 4Y2PA 3MN1A 3L8EA 3QUTA 1SU4A 5IT0A 3I28A 2B1QA 3ESQA 4UATA 3KD3A 2HF7A 3ET4A 4RETA 1RQLA 2G08A 3OCYA 5ALIA 3FZQA 4FFDA 1RKVA 5AKIA 3WK7A 3QUCA 5AKJA 2I6XA 3J7TA 3L0BA 4KX3A 5AKGA 1RKQA 5ALFA 2I7DA 1PW5A 3NANA 2WF7A 2W11A 3QNMA 3AR9A 4NV0A 4ZEXA 3WKBA 1Z4LA 2MU1A 4HGRA 3QYPA 5ALZA 2P9JA 3N28A 3AR6A 2FI1A 2WFAA 1NNLA 5AI6A 2YJ4A 1RKUA 2R8XA 2B30A 1YDFA 3MC1A 5AW6A 4KNWA 2FUEA 4BX0A 4EZEA 5AI5A 1IWOA 1ZRMA 3D6JA 3L1VA 3U7EB 5AW7A 5ALGA 5AW3A 2FPSA 1RDFA 3L0CA 2WF9A 2CFRA 4FE3A 5ALYA 1NF2A 3QU9A 3EF0A 3PCTA 2OBBA 3QGMA 3UMCA 3B9RA 3ET5A 2G07A 1ZOLA 1X42A 4Y2JA 3OCUA 2C4NA 3U7GA 4BNDA 3EWIA 3KBBA 1S8OA 4O8CA 3N8GA 2FPUA 1L7NA 3FPSA 5AI8A 4AS2A 1MH9A 1N9KA 1J97A 3OCVA 3ZU6A 1RLOA 1Z4JA 3I6BA 3SMVA 4C4SA 1CR6A 2R8YA 5ALQA 1U02A 3WK5A 2GMWA 4XE5A 4DFDA 4AS3A 4OD0A 1XP5A 2RARA 1TE2A 3DNPA 3L8GA 3ZVLA 3L8FA 4Y2UA 5AKZA 1YNSA 3NAMA 1YMQA 5AVYA 2NO5A 5ALJA
chains in the Genus database with same CATH superfamily
4LOKA 3M4JA 2QRGA 3MGVA 1QSLA 4LCBA 1O87A 4US0R 4C87A 4M9JA 4BMPB 4DPLA 3YASA 4RTOA 4EGFA 2P4QA 3KOUA 5JZOA 2I78A 4YP6A 5I9NA 3TZ6A 1ZIXA 3DLBA 1ZIDA 8AT1A 5L1JA 5KKNB 4WCFB 4KNYA 4B73A 1I94B 4AECA 4B75A 1DC4A 4JJIA 1NW7A 4G1BA 1NJXA 2AEEA 4LYYA 1ICEA 3W5SA 1F8FA 3QH4A 3TR5A 1G21E 4Z0NA 4DR7B 4ZI5A 3BGIA 3OF3A 2R5WA 5EZYA 4XOIA 3F7TA 4MPTA 1ZESA 3II6X 2HJHA 4AZTA 1JHXA 4JJ6A 1X1SA 1Z7WA 3ESBA 5JNVA 3VJRA 4F8RA 3F6SA 3QKIA 1QM5A 1GPLA 1QO9A 4LZPA 2DFVA 5DO9A 3PQ8A 1M1UA 1KI9A 2AC2A 4DLEA 4UULA 4RAQA 4E3ZA 5HOEA 3NVMB 3GB9A 3KR9A 2Z3WA 3BTOA 3O82A 1P72A 2QN3A 2RSLA 1U3DA 4V0MA 1ENZA 4XGQA 2PZGA 1VL6A 1OBVA 1YL6A 3ZX5A 2A9KA 3T5LA 1D4AA 3JQ7A 3STHA 3A11A 4US9A 2EW8A 1JMSA 4EFNA 2Q5EA 3KQOA 3PC7A 1TUEA 3V4SA 4JFAA 3RBZA 4R1UA 1QF6A 4YMTA 3A58B 3BZKA 5EWLB 2A0YA 4XJXA 1ULTA 4HQ6A 3U1VA 4WINA 4L5YA 4FFPA 2JR5A 3EWNA 3E3MA 1OA1A 4HYTA 2AGPA 3GDXA 3JD2A 3ELUA 4BN5A 1MUUA 4W63A 2EANA 2FPGB 1O7JA 2WILA 5IEJA 3GDGA 1NHWA 3NGDA 1MFZA 3M83A 1Z33A 4MITA 4PLZA 3R0ZA 4P0TA 1Y8RB 2O2CA 3G6KA 2NU9B 4HNVA 1ONSA 1PVDA 2OORA 4XSHA 5CJ2A 4EHBA 4GMFA 3RJFA 5ALEA 1Q74A 4BZXA 3IAEA 5CAEA 4ZV4A 1GUDA 3PEUA 4NMMA 4ZAVA 3FNHA 4A8JB 4AYXA 1NG9A 5DI3B 3SJ7A 4CQMA 3CEMA 3ZGXA 4LZOA 1GO2A 3B7WA 1SXGA 2FW1A 5KSPA 1G5RA 2L5YA 4QUDA 1K9SA 1S77D 3G9UA 4Q3EA 4LJAA 4D9MA 1TZ2A 3A3OA 4N4AA 3QLTA 2Z8ZA 1XALA 2QK4A 2H92A 2RE8A 3G9ZA 4EYEA 3EXIB 3BRWD 1QK5A 4G1FA 4JUFA 2OGUA 1WG8A 1Y0BA 1Y81A 1ULZA 1JR4A 4E11A 3BKXA 2WV7A 4FM9A 2H7VA 1C3OB 3IPCA 1CUZA 4E03A 2MR5A 2DULA 4K86A 4DWJA 4M1EA 3FOCA 4B4OA 1VKHA 1CNEA 3AEQB 4RT2A 5JD3A 1FMTA 3SC4A 4G5HA 1FU8A 4JD5A 5DMHA 2GD0A 4IR1A 2XKAA 1PK3A 3SFTA 1L7NA 3SQWA 1Z4JA 3F53A 1WO8A 1UBUS 1H66A 3N2GB 3ILHA 5JSYA 1BE1A 4X7RA 1C0PA 1Y1KE 1CJUC 3KTQA 3ENZA 2GZ3A 1JDPA 1WSBA 4PX5A 2A1JA 3VHXA 4WUTA 1E1NA 3WQHA 5EWJB 1MB9A 2Q49A 1ECJA 1Q3TA 3H1FA 3HHPA 2Q9CA 2QGNA 3NRJA 5HCNA 2AXTU 1ZQOA 3HN6A 4XFJA 3HCRA 1O9HA 4YQZA 2MOKA 3F5MA 1QVAA 1FC0A 2HWXA 4XPZA 2BI4A 4CEIB 1KHHA 4AF6A 3OZAA 1U5CA 1WU7A 2M1ZA 4JP1A 1BWRA 5C9ZA 1ZD2P 4K8RB 4R0VA 1UPHA 4Q8FA 3WA7A 4J0FA 1XIVA 1GPNA 1UT8A 3KKMA 3EBLA 1X13A 3FZYA 5KQLA 3U7QA 3TQHA 1ULSA 3I5AA 2G06A 1R6BX 5DK4A 3IP4B 3NR2A 1RYHA 4GF5A 2K5UA 2PKYX 3Q2KA 5CFMA 3HB5X 2IA6A 3JPNA 4I29A 3IDOA 2HWUA 621PA 1ZI9A 4OMFG 2B0CA 3M1AA 3EOZA 2J09A 4TMVA 5BMVB 1QK4A 1U0SY 2VTEA 2GEUA 5GMOA 2G88A 3ROFA 4JKOA 5LXTA 1ACMA 3RVQA 2IS2A 3G2PA 5KMGA 4J0HA 4X9XA 1UHUA 1C41A 3VTZA 1E2DA 1HE1C 3G8YA 1YQXA 2YOGA 3AY3A 1B3RA 1FW8A 1X19A 4YR2A 4Z6FA 2JJ1A 1COWA 3CLTD 2KJ8A 2F48A 3W5BA 1VCIA 4NZZA 2WU3A 3PNBA 2OAP1 5B7QA 3Q1KA 4KMMA 3AV0B 4WOJA 3BCHA 4ED2A 5GTDA 4AI6A 2AFRA 1LX7A 4BQRA 4J1SA 4R05A 4L02A 4JBIA 3ZUPA 1XXLA 5L51A 1BWPA 3I9MA 2F8SA 2H6EA 4TS3A 3M6KA 5DI9A 3Q40A 1XTRA 3MMXA 4EQ6A 4NLGA 2GOLA 1ZMBA 5KVSA 2LV8A 1GV0A 4EFDA 3MDAA 1XDWA 1CY6A 2QD2A 3OQVA 3PDHA 2YQEA 1QOQB 3IC5A 3CH7A 4P98A 1OX4B 2XTNA 1PL7A 4QTUB 3GARA 4HV4A 5DVZA 3C6BA 4Y6RA 4CGYA 4XD7D 2CVQA 4X1YB 4KXNA 1Y5MA 2NRTA 1MVLA 3HZOA 4OMDA 1XWIA 5C8YB 2C7GA 2PRSA 2R7KA 3SQXA 1X7WA 5J0UA 2ZGVA 2DYKA 4LE1A 1UMBB 1PWHA 5G0WA 2O2IA 4WBNB 2FFHA 3LWZA 2LIPA 3GR6A 3QXSA 8ICEA 1OZ0A 4OB8A 3D8BA 4G9GA 4M0FA 2R7NA 1ORIA 1FUIA 1MABA 2HKIA 1R37A 1W5BA 1YVEI 2ZB4A 1ADBA 1V43A 4RS4A 4GL4A 1KTIA 1DQYA 1YT3A 1NX9A 2OR3A 3F4KA 4G24A 2NPIA 1NT2A 4XW2A 1XC7A 2ZUWA 2PPVA 4EZIA 2FLLA 3TRIA 1IZ7A 1UK6A 2WUDA 1N3YA 1QHHA 4M22A 1U31A 2JJYA 4IXTA 2XZLA 3X1XA 5HCUA 2IS4A 1ADJA 4ON9A 1R0BA 4RA9B 1YCGA 2F3RA 3PC2A 3GWGA 3PCTA 3B9RA 2G07A 2FP4A 5KAIU 2I2XB 1Z13A 1FNCA 3URMA 2CXXA 3WTBA 3QX3A 4EJ6A 4O3QA 2YQZA 2LKCA 4H17A 4XA8A 1VXRA 4ANFA 4S12A 4QZHA 1NK9A 5AUPB 1WZEA 1WMEA 1RC0A 1T9GR 5FLEX 4W82A 3K0AB 2UVRA 2C3MA 3Q85A 1NNEA 2O8FB 1L4BA 4TWJA 2BR4A 3DVQX 4JB3A 2DY0A 4E4YA 2O8CA 3FYUC 4ZO6A 1CDZA 2RHLA 1ZK1A 5M7EA 4Z4QA 4A36A 2DR2A 5MGNA 2QMEA 4CCSA 3F74A 1ZQ1A 3DNFA 1TA9A 3BFXA 5HGXA 2B9VA 2P9CA 4W5JA 4O3FA 4AMUA 3ZJTA 2F8LA 9ATCA 1LK5A 1X6JA 3GDHA 4ER3A 2I7XA 3QVKA 2F1HA 4UXHA 3PI7A 1VL2A 2R84A 3EVEA 1RRCA 3D2QA 5D5QA 1X9HA 2W9BB 1F2UA 1MC4A 5DHPA 1K08A 1MZPA 4F1KA 5KNCA 4M21A 2EBWA 3FDZB 3B82A 5TT1A 4LDNA 2VANA 3T7JA 3A10A 2RBGA 5J4LA 1TW2A 1UC9A 3BIOA 4OQNA 2A5JA 1AGPA 1XD8A 2OCDA 4MUAA 3IVAA 1IXKA 2AZXA 1U5AA 4DMLA 3MGHA 1OVMA 3HYCA 3OURA 3ILVA 4BB9A 1PR0A 3M33A 2PUCA 3SVLA 1CEQA 4ZDKA 4I2GA 3WDMA 5KFLA 3AY0A 3ROQA 4F6RA 1JZSA 1RADA 4O4LA 1QBKC 5L1LA 4O1MA 2NTJA 4LI0A 3CLHA 4QJ4A 3WZLA 3TSYA 3CZ5A 1XCJA 4GZ6A 4FE4A 2AFVA 5IVDA 2XH8A 3D5TA 2NU7A 3EC1A 1OYYA 5DYGA 5CFQA 2YOHA 1G8HA 1N7IA 3PFBA 1R0CA 2B78A 1AA9A 2NXJA 1EWTA 4JV0A 3RO7A 3HO6A 2R8ZA 1YTLA 4RSGA 1JQEA 3AGQA 5BYKA 2JZOA 5FADA 1OFTA 1RRVA 1HYEA 2CDBA 3JWIA 3KQVA 2XB9A 1X7GA 1VHJA 3DOIA 3JYLA 4INPA 3DEFA 1CJBA 1BNOA 5HHIA 4FLMA 1KSPA 3WJ1A 4RKEA 1ML4A 5AXBA 1KTQA 2AE2A 5CVJA 3I23A 3GPLA 1DWQA 3OIDA 1T0BA 3L9XA 3PFHA 5DLDA 3ZLTA 4DIOA 3IGFA 4RQUA 2N1RA 3QX9A 3EPPA 5ESRA 4R68A 3FPAA 2CSUA 3OO1A 5AOBA 1U9IA 1TYZA 3NBAA 2HHLA 3R40A 2HSDA 5IBCA 1BQEA 1XZQA 4HNSA 3E2MA 3VU1A 4PYNA 1PBNA 2ORIA 5CLLA 2ZBGA 1DBWA 1VMKA 3O74A 1UANA 1K5PA 2BI7A 2WB1F 3B0YA 5JXJA 5KFSA 4ETMA 3AVVA 4WOBA 4I2VA 1YQDA 2OHFA 1LF5A 1X7ZA 1AHIA 2V4UA 3NH6A 4EB8A 5AKIA 3WZ2A 5C7IO 2F4VB 4AZSA 1T29A 2D5CA 5DF1A 1UXOA 4PZ9A 5LUAA 3ZQ4A 5DSXA 2BMEA 3OIYA 5H59A 1XZBA 1YVPA 3QYPA 4LRWA 2BZFA 1XFDA 1CD5A 4O1IA 1FY2A 4D8TA 3OEHD 5F3XB 4YX9A 4KH1A 4DMKA 1T1EA 3WRYA 4I2IA 3B6EA 4J0GA 3RSLA 2Y1EA 3KD2A 4FOSA 1NM5C 3JQQA 3QTBA 4RVFA 1JE1A 2HQ1A 1H2HA 3JW8A 2C4NA 3ZHYA 3HS3A 3BD6A 1H69A 3EXHC 4R8RA 1BDMA 3GZTB 3GT0A 3NJ4A 2ISQA 4RK7A 4AZ3A 5K6TA 1AK1A 1DXQA 3I2HA 2WTNA 5HVNA 2GXUA 2X1VA 1CHDA 3EIFA 4MW6A 1TM2A 1P1BA 4B6FA 4GSYA 3DTVD 4NU0A 3Q3EA 3GGGA 1ETUA 1G1AA 1X0VA 1XGKA 1NXSA 3N7TA 4K6OA 5LMNB 4EYQA 5KWVA 2LCQA 3UAZA 4RDCA 3GGPA 4YFYA 3W1VA 1I14A 1LPOA 3BZUA 4ZTZB 2VZ0A 4BB0A 2ZUTA 4CRXA 1V41E 5FEUA 3ABIA 3LWBA 2IP2A 3BWXA 3FMOB 1IM8A 1MIOB 4NBUA 1C0KA 2IX9A 1TJ4A 5AKLA 2AKAB 4DA9A 1UWKA 4EABA 5IWAB 2CNLA 2HIAA 1DKRA 2ZRCA 1RFLA 5DYIA 1X9SA 2O06A 3TSCA 2Q46A 4FGZA 4KO1S 4QPPA 3SAJA 1X66A 3IEMA 4C29A 2JH9A 2JD1A 1KTVA 2FJ6A 5KFDA 1T5IA 4C1NA 2MMCA 4X00A 1OXMA 3AHGA 4DIMA 2VUIB 2EDCA 1PG5A 2WHQA 3H1PA 2WIFA 3HA5A 3PHIA 5U9CA 3O03A 4GAEA 1WX1A 3TDMA 3NYQA 4ZGBA 1F5SA 2QUBA 2XDAA 1UPUA 5SYNA 5CM9C 4M9SA 1CRZA 2PMWB 3QIAA 3EQZA 1C30B 3TSOA 1RTKA 4YCCA 3Q0IA 4M8KA 5KT2A 4GBMA 3I58A 4M7WA 2X6TA 1BXRB 2FPIB 4CYMA 3HDQA 3V8RA 2W6JA 1FLNA 4ZAXA 1RJ9A 3DDZX 1EB8A 5CLGA 4RFLA 1NBMD 5KDOA 1BU5A 1P1IA 2ASVA 4CLEA 5GTHU 3SC3A 1BE0A 2IUYA 3KZXA 2Y68A 1L4MA 2NT4A 1YT5A 4YRGA 1XVVA 3OIWA 2ZI4A 2I3DA 4ED7A 1B0AA 1II9A 1SBHA 3RABA 1XSNA 3DE0X 3KJZA 1LB2B 4Q3KA 4B2IA 3LF2A 2R60A 1NI4B 1L3TA 1J0DA 3K4GA 2I03A 1B1CA 1RVV1 5BSRA 1NKSA 1HLGA 4XWGA 3BCSA 3VTAA 4P4SB 1OD6A 2Q6TA 3CP8A 1Q1BA 3OX2A 5MGBA 3E81A 3ACDA 1T94A 5EE0A 1CHNA 3DCIA 1OI4A 4LGMA 4EFLA 2H59A 1FVHA 5A1TA 2B8NA 1JQKA 4JLAA 1WYGA 1U4NA 4EGSA 1NRWA 4MVCA 2RMKA 3M6WA 2NVWA 3QX8A 3B60A 1Z5UA 1P2GA 2DRIA 2W7PA 3INTA 5KC9A 4P7FA 1DRVA 4CMIA 3A1SA 3K6RA 4L6IA 1N6PA 2D00A 1IBLB 5TPZA 5KT4A 4P34A 1DO0A 3HEBA 1NP3A 4F4DA 5CB0A 1IUPA 3F73A 2WD9A 1QAQA 1SNYA 1EA5A 3QVOA 3WGIA 5D00A 1MCZA 3RJHA 1J56A 4YVZA 1NZJA 3SYTA 3Q3CA 2DUJA 3GEGA 4BATA 5EWMA 5FEMA 8ICAA 4FE3A 3HN2A 3WIVA 1BPEA 4E31A 2CLCX 4BNZA 2VBCA 4MINA 3I9FA 4Z3DA 1B15A 3H6HA 2BV3A 2Q5CA 4ZARA 4EYHB 2BF7A 1N6KA 3K0CA 4TUYF 3LVWA 4LAFA 1SN7A 1C7QA 3WBFA 3ES9A 2WK1A 4YMNA 1SL2A 5L3QA 4DYHA 4LE0A 3FJ1A 4Q1EA 4MIKA 2CPRA 2NSHA 3HBLA 1ATIA 4JIMA 4JJZA 2FPRA 2WG0A 1ZUNA 3BS5A 4DL5A 3KUUA 1ILWA 2GPNA 2X1LA 1KBZA 2O2ZA 3DVRX 4R1LA 3IHTA 1ZQAA 5D5HA 4FKZA 1YI0A 2PWYA 4CHTA 1WB9A 2EIXA 4ECVA 2PUDA 4QOSA 1A8HA 5KAPA 3U7JA 3R3JA 1XPRA 4MDEA 2CXTA 1ZI8A 5A4IS 3GGSA 2C94A 3JYPA 3EIOA 4YP1A 4PN3A 2OO5A 1YIAA 5F51A 2BGWA 3C3PA 1AA6A 1Y80A 2PZLA 1JVBA 3TM4A 2WMOB 4MR9B 3RFTA 2PKEA 2BRUC 2KFZA 1Y4AE 1Z8HA 5G1PA 1OBOA 3LE8A 1CJKC 2ZVDA 5I47A 3FH0A 3AR2A 1A7KA 3INRA 4MUYA 3UT0A 4K46A 1LSJA 2WJ6A 3A2NA 4HUQB 1QYCA 3PUXA 5A4FS 1D0IA 2QN6A 3WAJA 2IU4A 4HAYA 4C5CA 2C77A 3BCRA 1VIYA 2C5GA 2RLTA 3BA6A 4ENSA 3QLUA 2JGJA 4BFLA 3GT7A 1T4GA 1Y63A 1MG5A 1Y7TA 2WG1A 3I6MA 3ZI4A 2W4MA 3HRDD 4JJ4A 4N76A 2HO4A 4DJDC 4F50A 1HDYA 1E3SA 3P0JA 1M2NA 3NUGA 1T2NA 1C8VB 5A3SA 2I4TA 4MWTA 1XQVA 1ZMOA 3EODA 1LI4A 4O3MA 1ZK2A 5I51A 4NHEA 4MKRA 3UW1A 4UD2A 3WHKA 3KQNA 3FDIA 2ZJFA 4I99A 3EIQA 4A8TA 5FTKA 1JLRA 4M0DA 5TGZA 2IIPA 4N5IX 1NNI1 2HQOA 4BTEA 1NVKA 4RQ7A 3KL4A 1W7AA 4JSRA 3EXG1 5BN1A 3EPKA 3CUSA 4Z9BA 5F12A 1RE1A 5I7UA 5AT1A 3K1RB 3F8TA 4YJ2F 3UJ3X 1GCOA 2XOKA 4KQGA 2E4AA 2HBZA 1NKTA 1E58A 3QBEA 1ZWLA 3WK8A 5AW4A 4YYEA 1UBEA 1B8NA 3W8RA 2ES6A 2QPAA 3V32A 1WABA 2AT1A 2D62A 3CXRA 2XT9A 2EFJA 2A14A 4MW5A 4D6YA 3S70A 3COVA 4ZV9A 5AW9A 4RVUA 4EIWA 2O8NA 4N6NA 2PBFA 2AF3C 2PUVA 2B37A 3ND7A 5F21A 3TLZA 5EN4A 1RWQA 5HJ7A 3RIGA 2W2QA 3NW9A 1G7CA 1JFRA 3NBXX 4A4DA 1DC5A 1G8KA 3T7CA 2O1EA 1BS2A 1RYUA 3WKEA 1CRPA 3U19A 1XYVA 1SL1A 2KMDA 2VLIA 1M2OA 4EUFA 1F4VA 4HDRB 3FGOA 2GPYA 4MRRA 5H3HA 4PZ0A 4UVHA 1XPOA 4WY8A 1JQDA 4FB4A 3ESDA 2WWGA 2GRUA 2X5OA 1RYZA 4JQZA 2BCUA 3H4TA 1OBCA 3B5JA 3WWCA 4ECEA 2X7XA 4FCTA 2IXDA 4DNPA 2X2OA 1NN0A 4UE3S 5IDWA 4X1IA 5IUJC 2F1JA 2JCSA 5F5NA 2EQBA 2PFKA 3IJEB 3THOA 3IP3A 3WGKA 3TLEA 4AMYA 4XH9B 2YJ4A 3UXNA 1FJGB 1QIDA 5KG4A 3VH3A 4OUDB 4OHZA 1N7GA 2V1XA 1DIOB 3ICEA 3VNQA 1PUIA 5DULA 4O29A 3HFSA 2J41A 4EKEA 4FZ3A 3LW7A 5CRIA 5ALYA 1AF7A 3UO8B 4DQRA 4NNJA 3BSYA 4YV0A 1SKMA 5KT6A 3TINA 5JAHA 1DDGA 1Q77A 3M82A 3PMNA 4N5DA 2LM1A 3C23A 2VDWB 5HRAA 3ZDDA 4NZYA 1J06A 1R9GA 2NO5A 2QL9A 4HDOB 2WC1A 5IT9A 4V02A 1TMOA 2XUDA 1C3VA 4J43A 2RP5A 4DCPA 1U7DA 3C98A 1KA9H 2J3EA 3UK0A 5FNVA 3QHAA 2FR1A 2E55A 1NJFA 3JPYA 4UAGA 2BKEA 4EFKA 3V48A 4ZEWA 3T12A 3GPCA 3PQ5A 2QQFA 8ICRA 1E5LA 3V1MA 4IZOA 3ZDZB 2Y92A 3K70D 4G2NA 3HJHA 4N3BA 5FQOA 2W6MA 3X2EA 2YQ4A 3MIIA 3NU1A 1F6DA 4HSEA 2JEGA 4I9NA 2F9FA 3PITA 3BWEA 1CEXA 1YBAA 2Y2VA 2CLOB 4HP8A 4F45A 4UB2A 2JLQA 3C5CA 3BTSA 4NU6A 2HLHA 4BN0A 4PRLA 4RGQA 1JEQB 5K1ZA 4XWOA 1H65A 3L8HA 1ISPA 4WZAB 1CWUA 4R8UA 4PZNA 3TBFA 3KOYA 2I55A 3BORA 4OGKA 4I6GA 1YBVA 2Q1SA 1J2EA 3CX6A 2Y8EA 3QOFA 2NLOA 2J6BA 5HK9A 4JLVA 4CT0A 3H2IA 2Z1NA 5HKAA 3NAZA 3SPXA 2XX3A 2W43A 5HKKA 4CLRA 4PYJA 4LHSA 4ZYVA 3AF2A 1AHPA 1NYLA 3RTBA 4RLSA 1JWLA 1XVLA 2IYZA 3M81A 3GLGE 5TPWB 5AI0A 4JP2A 3REOA 3WJ7A 2VJNA 1ZG3A 3KFLA 2XT0A 3JYNA 4GX1A 2V9PA 2IRWA 3L6OO 3HB1A 4DC1A 1SUDA 3CWZA 1NU6A 3I5YA 2E5WA 5CA0F 1VE5A 3BWCA 1DBRA 4IDGA 4ID3A 1N5WA 3K0KA 4AY6A 2ZR0A 2SKDA 3M6ZA 2PKRA 1L3IA 5FUVA 2R8HA 1VL1A 2YMLA 1XWFA 3ODPA 3TXYA 4Y2XA 4LJ9A 3KZCA 5KSYA 3M4NA 2Y9MB 4WOKA 3S1SA 1RAGA 2YBEA 4Y6PA 4IV8A 1N5DA 1EBUA 4YCSA 2D1QA 3P0EA 3V7JA 3L06A 4DDVA 1ARZA 5HIMA 1AMOA 1ZGGA 2I7CA 1I3KA 3MAJA 1L2TA 5BW6B 1E9DA 4OGGA 3B1VA 5F1YA 5JALA 3H9CA 3OM8A 4HH3C 2VP2A 1AQJA 1SUPA 2O6LA 3W9SA 4MWBA 2P3SA 4RJJA 4V3BA 3PBKA 4YJGB 2EQ5A 4EF5A 3A6EA 2REXB 1F7VA 3T5BA 1DI0A 1YRYE 3PFWO 1ML3A 3K73O 1MA3A 4EYKA 2FEXA 2M6RA 1R4NA 5EEGA 1ZM7A 5CNKA 1SVNA 1E98A 3HBJA 3FCSB 3H11A 1XZGA 3AR9A 4ZEXA 5IZCC 2W2OA 1XLVA 4YFVA 4EO9A 1J1UA 1QNFA 5KTQA 4JL6A 1EZZA 2ONJA 1KL7A 1DJOA 5JAPA 3BD8A 4BKRA 1QVWA 1DJMA 3NWEA 1ZLYA 2O2SA 1BMFA 1D5CA 4RFSA 3F47A 5FULA 1SKYE 1U11A 1OU0A 2H07A 2C5AA 5CBKA 3TI9A 4PSAA 5JLJA 3KBBA 3SQDA 3L0IB 5ITWA 3VPAA 5L95A 3BDVA 1E2IA 2ZIEA 3A1VA 4JXXA 3K2BA 4BLVA 1Q46A 4B82A 4BMSA 5F2KA 1TM5E 2OOKA 5JVDA 3JQ8B 2Z9CA 3IQHX 3U17A 1RIFA 4F06A 3V7LA 3UXOA 1I4TD 1ZITA 3KYDB 3EYZA 2AGQA 1ZQTA 4JLSA 4CU5A 3LT2A 1WV1A 2JAUA 1IOLA 2EP7A 1T2FA 3GQBA 1HRDA 3EGXB 1R5BA 1HE4A 1TQ8A 4QVIA 4X71A 4OYHA 3CRRA 3P9CA 3EG5A 4KUHA 3UAXA 2PFOA 3HK2A 2YRWA 1Z2NX 2ACEA 3ZTYA 3GLVA 2JB9A 1CJCA 4TKZA 1ITZA 2NACA 4TZ6A 4MQ6A 2G9VA 2W04A 1QO0A 2ERCA 2G63A 1S9DA 3KT0A 3W4IA 4YCXA 4YHBA 4UM5A 1R0YA 3QF7A 5D87A 1ZHFA 4PIVA 4LQ4A 3EVFA 2YFQA 2RKOA 5HKBA 3WGZA 4XWTA 9ICAA 3VPXA 4N0PA 1YZQA 5KFGA 4OU5A 4CDRA 3UUGA 5CBPA 1JJAA 2CL5A 1TIPA 5FUMA 2R87A 1CUGA 5A71A 1W5FA 4K1XA 3UXHA 3PFIA 4PHTA 1O6FA 4LF6B 2QRNA 1NPDA 3BB4A 5IKPA 2ZRJA 3K1ZA 3MGAA 3T7AA 3RV3A 3B1WA 4DJ5X 4DCCA 4IUYA 4LZNA 3I2JA 3O4VA 3ITNA 4M9CA 1ZVJA 4Y1EA 1NXQA 6NULA 4QULA 2R8JA 3V8EA 3LPDA 4FHGA 1ED1A 1ZP6A 5BT8A 1JT2A 4UOQA 2ODWA 1ENYA 2DH5A 1T8SA 4Q3CA 4QXRA 5SZHB 5F9HA 3C28A 5CPBA 2OWOA 2DFKB 2PKQP 4MHOA 2Q6VA 3IT0A 2ZIVB 5LA6F 3WDSA 1AKNA 2VP9A 4FZLA 3CSDA 3LF1A 3HWTA 2E4UA 5F2OA 2P6OA 3BTVA 5GIOE 4G5QA 4P3YA 2ZZKA 2ZOSA 1GPWB 2JGLA 4KREA 5TNXA 2PT5A 5HF8A 4O2AB 3LUBA 2HLNA 4NRDA 3A8TA 4YJFA 5JO9A 1DAMA 5TMBA 2QUZA 2K7FA 1J0XO 3ETEA 1RAIA 2WMYA 1KO4A 2A3RA 4QZBA 2GN6A 3HEAA 1JN0A 3LIPA 4HGOA 2R66A 3HW8A 3OX4A 1HG0A 2FEPA 1EVKA 4EI7A 2FY8A 2RC5A 1ZD4A 4GEKA 5K0BA 2NO7A 3FYUA 3NQ41 1RCUA 4TQ9A 2YJ6A 3FMFA 5CJPA 3PRHA 1BDHA 4QZGA 3LSYA 4L5CA 5JBQA 5BV1A 3RIEA 3R23A 3BK1A 3RC1A 4DA7A 2A3NA 3UPTA 1DPGA 3BXHA 3VA7A 2IYVA 1XAJA 5TQ2A 3EJ6A 1I8TA 3HRIA 3COZA 3W7AA 4WZBE 1BRTA 2Y9UA 4F3YA 4ZVKA 2ZTCA 2WAYA 1B8OA 4NR0A 1EFUA 4YK7A 2C00A 1X1TA 1ZZEA 1Z16A 1AMNA 1VRVA 3NHJA 1QLWA 1KPGA 3AKCA 4Q8EA 1ZUD1 3W8NA 4F4UA 4OFXA 3FDFA 4MEXA 1E2GA 1W0JD 2GNAA 3OFVA 4FNOA 4U8GA 4NYMQ 1OROA 4OBEA 4YAFA 1PFYA 4F4JA 4RD3A 3R5FA 2QQ5A 4ITVA 3KHLA 3HSKA 2VDPB 1Y3DE 4Z7NB 4R0NA 4JHXA 4B87A 3TE6A 2XBUA 4DV1B 2BHTA 2HBLA 3QSYA 1V6AA 1ZQMA 3DR5A 1Y88A 1TK8A 2PBLA 1JDNA 4XTCS 4HMQA 3G2LA 5IUNC 3L07A 5HHTA 1J2TA 2VQSA 2I2BA 2YCBA 3QLVC 4HVCA 4BX9C 3PIIA 2V5VA 1BG6A 1X2EA 4U5XA 4F4XA 1SM4A 4DQKA 5EE5B 2Z4SA 3GMSA 1KAEA 2IVZA 2DECA 1P9LA 1WKCA 3RS9A 1WXFA 3PXGA 3W7BA 2BELA 4J6EA 3G8AA 1G4AE 1C1YA 2V7QD 3VR0A 2ROQA 2X0RA 3QKWA 1PK8A 1N5IA 5ES3A 2OM2A 1DG3A 3UXPA 2W6CX 3U7IA 2PRZA 3EWSA 5DYNA 3QW2A 2HIMA 3GVXA 5IDYA 3Q8QB 1XDGA 1J9GA 2WSSA 3NIWA 1XX6A 2XCIA 5EMNA 5HK8A 3UJHA 1NMZA 2YWBA 4Z4HA 4X1KB 4R3UC 2EH9A 2C2BA 3JPRA 4U5QA 3N2NA 5ALPA 2HPVA 1CUFA 4ENTA 3MVEA 5BVGB 5M34A 1T9ZA 3GEHA 3ESAA 3TR6A 3LYLA 2PXIA 2ZIXA 3ZCRA 1KZ7B 3AKYA 1QRSA 2OESA 1HV8A 1FYDA 3U3OA 5JNWA 4H77A 4MOWA 1IUKA 3TZHA 4GP7A 4ASUD 1SXEA 3RNOA 5CR0A 5EOZA 2ZK7A 4PCVA 1EDEA 7ICGA 3IN5A 3UUWA 3SMQA 1XAHA 2NV2B 5CIQA 3DBHB 4YVFA 2Q41A 4BMXA 3P2EA 4E5KA 5J0PA 3E9EA 3GZJA 2H1SA 1JRLA 5JAQA 2RH5A 2FPWA 5EC8A 4QPZA 3I01M 4FPXA 3NZEA 1UOEA 1P5JA 2LZ0A 3PIDA 1KVRA 1WJGA 4NICA 1OWNA 2H3IA 3HCPA 5KG3A 2EJTA 3WL5A 5J2TA 1GP2A 1XDZA 4S1WA 4X94A 1Z8FA 5T8KC 5ED4A 2XXAA 3N1UA 3MWFA 3QQ5A 1T1SA 1L1RA 5IF3A 1NM5A 3CA8A 2HUPA 5H70A 1KI6A 3JAWB 3T3PB 5J59A 1D4FA 4HLQB 4MLCA 4I50B 3F2CA 3F3SA 4GMHA 4G37A 2BFPA 3B3GA 3ZLBA 1EGVB 1TJ5A 1NY5A 1EA7A 1A6SA 1UBHS 1BJRE 2BFWA 3U39A 1XZHA 2G9UA 1R27A 2IQIA 4JYPA 3EXEB 4D0SA 4KHPB 4R2HA 2CXOA 4XUSA 1M73E 5T3YA 1G7SA 3WRWA 2O3RA 5KQPA 5JPCA 1P4GA 4B3HA 1YS6A 2SICE 2Z8XA 4MGEA 2GF0A 5AVKA 2IBSA 3GVHA 2ZVQX 1DWOA 1XRRA 4IQGA 4P7BA 4H0CA 4J3FA 2CLEB 2OZLA 1N56A 2J5QA 3RRHA 2QKYA 2CZQA 3I4FA 3MA0A 3IA7A 2IEAA 4DDTA 2JF0A 2GA9A 4Y0AA 4ENPA 3R3VA 2RIPA 4YUVA 1N8KA 2CBXA 3QKUA 2PRJA 3SKYA 1H1LA 3LUKA 1G6Q1 3VAZA 4KE7A 4FBMA 7ICSA 1U04A 1XA4A 1VJ5A 5DLEA 2HT1A 1W94A 1DV2A 5G40A 3K70B 3V4FA 4IWNA 3HY4A 2X0KA 2Z8YM 4DTIA 4TQSA 1P18A 3SZUA 2ERYA 3MGCA 4G0WA 5JNUA 4K6CA 4KLUA 1NAIA 4MQUA 1V1RA 1BO6A 3LKVA 1A0OA 1ZHHA 3DVSX 4KNWA 1W75A 2VP5A 3COSA 4PTYA 3ZYZA 7ICJA 2KW5A 1GQRA 2KNJA 3BKWA 3L0CA 2JGDB 3PVSA 2DEUA 2ZJOA 3QVMA 1MRZA 2V97A 1QGZA 4MNTA 1VPTA 2CBGA 1NDHA 2JJ2D 4MKHA 3F5SA 3T3OA 3QI7A 4UQOA 1BVRA 3C8HA 3DHVA 1EXMA 1RRMA 4X85A 3PTZA 7ADHA 2C03A 3GLIB 3TNJA 4LWZA 2ZRFA 1L5OA 1P2SA 1WMSA 1T2UA 1ES9A 1N2HA 1Q0HA 3EDMA 1PFQA 3NS7A 1IWPB 1NWHA 3SXJA 5WRFA 1K27A 3RR8A 1EFHA 3ZDRA 1Z0UA 5F4BA 4NJMA 2HK9A 4XWYA 4UOZA 4HHEA 4QHYA 3EMVA 1UBOS 3RCBA 2QRVA 1VMIA 1YNOA 3NGMA 2GCNA 4USAA 3GV8B 2XQJA 4R2IA 1R8JA 1JU9A 3UN1A 3DZCA 5F4ZA 1LTQA 2CCKA 3GUUA 5LKAA 5BNIA 1BIFA 4U0JA 4DLTA 3KHKA 2OD7A 2ZKIA 3HVKA 5KG6A 5C8DA 3OEED 2GLEA 1Z0SA 4PIMA 4G1EB 1T3LA 5JANA 3DV0A 1RYRA 3KZNA 3EVTA 3ROTA 2I3ZA 1OE0A 5KJ1A 3N4MB 5J0YA 4J0JA 2RJ3A 2PUTA 3K0SA 1P0IA 4IMPA 4HF7A 1L4LA 3DPSA 2VTDA 1DK2A 1NVUQ 2CMGA 4H08A 4G63A 5DFAA 4WK2B 3N7SC 3TMYA 2Z83A 1KOGA 5KFWA 4J16C 3BMQA 3LPMA 3PXUA 1GR0A 1UJBA 2BP7B 4HI0E 1T13A 3CJRA 2R1TB 4G56A 5BV0A 1D2EA 4MAFA 1SCUA 2XGOA 3T3GA 1JPUA 3RVRA 4D82A 3ANSA 2EBUA 4IAOA 3NTRA 4DT1B 2E8PA 1M76A 2DQNB 4BO4A 5FBRB 2FQXA 1V25A 2B3TA 4HLCA 1DAOA 4ALJA 3DLIA 2VKQA 4KUEA 4EMTA 4PBSA 1YUMA 4YRMA 4F5PA 4RSRA 4R41A 3L6BA 5EPUA 4JUIA 3ZWNA 3AP1A 3KQPA 1NUSA 1EUCB 2ATEA 2AV6A 2H1LA 4D3ZA 2HM7A 3K0BA 3I2GA 1I9GA 5AD1A 5I9MA 3ULKA 3HDVA 1JA0A 2QYSA 4C3UA 1G9SA 4W5QA 5FWXA 3D3WA 3AESB 1ZONA 4KMUA 3C7DB 3KSBC 3M1YA 1IZYA 3AQEA 4EO7A 5LQMA 3NWJA 1NVVR 3PNQA 2EZ4A 1Y1RA 1P6QA 2F3NA 3CLVA 4QUJA 1JJFA 1M66A 1WQ3A 1X1DA 5B6PA 2QAIA 1QU3A 1FBNA 3OM9A 3M2TA 2P9HA 4CF7A 3HL0A 3D59A 4S1TA 2GERA 3Q11A 2WSIA 3O4FA 4G1UC 4W9MC 4NK4A 2XUKA 4WXMA 1RYMA 3FOWA 2CXPA 3WLTA 5I7WA 4HFNA 3MAAC 3KWFA 5BSFA 2O2XA 4HYKA 2B0JA 2C9YA 4MVJF 3KOZA 2O2EA 3UYKA 1Q11A 3I0NA 3KE9A 1E9RA 4D0NA 5IKMA 1Z88A 2FCAA 3PX4A 2Z6QA 2CBZA 4HZGA 2NOAA 5D3MB 4YQWA 4S2EA 3B20A 1Z29A 4BJHB 3JWEA 3MTDA 3G1TA 3FMGA 1CZRA 1NUTA 1GARA 3HWWA 1G8JA 2IIVA 1XNRB 4G5SA 4K9KA 2A1UA 1DTWB 2P5TB 3K0HA 4BNLA 2BRUA 1JBKA 3UWSA 2DPMA 3OPQA 4JY7A 5IT0A 4OMCA 4KLSA 1C9YA 3FNBA 2DVMA 1TI7A 2NUTA 3ER9A 5KB3A 1OFUX 4WDQA 3REFA 1OWMA 4RORA 2A5YB 1MX1A 1EHIA 3G8DA 3U0BA 2NWQA 4MS3B 3U9SA 1NVDA 3C15C 2NQ2C 2AW3A 1OI2A 1UFKA 1UK8A 4XIYA 6PFKA 1R12A 2H2IA 4I36A 2KJ9A 5EIOA 1WUHS 3BPSA 5IHPA 2XVXA 3CRNA 1GLVA 5G1OA 3PUHA 3KX2A 3M1LA 2PPLA 2CFRA 4F3RA 3T0GA 2GTHA 4B83A 2HRCA 3K2EA 4EHIA 2YB1A 1KIFA 2BHRA 2R1VB 2AUNA 3RYIB 4CLOA 2ZATA 1ZQQA 2GJSA 1M34E 5ALQA 2QHXA 1OFUA 4B34A 3DH0A 1MA0A 3E7FA 1D1QA 2DHQA 4CEJA 2FWIA 4OHWA 4X6YA 4WXPA 4P4NA 3RTCA 1PK7A 3FXAA 3T9BA 2WA2A 3G23A 4F84A 3TNFA 3ZWPA 1RWXA 1QHIA 3A14A 4C8NA 1YV9A 4R2WA 2ZRBA 4MCAA 4EYOA 1H9AA 3F8WA 2IPMA 3OU2A 3J81k 3KDPA 4G0VA 1MEJA 3HUUA 4I4TB 4CKEA 2G0TA 1V97A 3LHKA 4NZNA 5TXGA 1KEEA 3RIYA 4I2FA 4R1NA 3QYFA 1SB3C 3QF4A 4UARA 3IBTA 5A0FA 3V6HA 3WLNA 4CMGA 1R6TA 3O4GA 1HLPA 1P31A 3F1LA 1UMCB 1C1HA 1OPXA 4L6AA 3W3AD 2JFBA 4D9CA 5HZKA 2DAPA 1NU8A 1S1MA 2IBMA 2AI2A 4BNYA 5J2IA 3DR3A 5UKDA 2ZM6B 3OKPA 5CX4A 4PQFA 4KPFC 2RCYA 4O3NA 1XNHA 1U0HC 4PG8A 2B2NA 1RM5A 2PI5A 4WJKB 2NNLD 4BQQA 3LFHA 1XRJA 3IE1A 3ADOA 2NUBA 4IV0A 1YRAA 1W52X 3VGPA 4QDTA 1UXKA 4Z9AA 4ZT5A 5FOVA 2YVAA 3DKVA 1XUOA 2BDEA 1HYHA 2GT1A 2CDRA 2JANA 2P65A 3OJSA 2FK8A 3VPCA 4IJ5A 1VB5A 2ZRGA 1O95C 1FYWA 2VJQA 5CG2A 3OPYA 4AU1A 1Z3EB 2ODGA 1HDCA 3LBAA 4MGIR 5BOMA 4OA8A 1QIIA 4MRMB 2YNMC 4NATA 4A8EA 4JI3B 4W5OA 1RQRA 2TMGA 2YV2A 4QQNA 4GRAA 2CL0X 2AZTA 1OAKA 1KKUA 1QIMA 1LPAB 1K4YA 2AR9A 1CUEA 3BB3A 4MA4A 1F12A 1SCBA 1CY2A 1D4OA 1E20A 2NUAA 3P45A 3CX7A 3PJEA 4PINA 3M9NB 4CE6A 5IX8A 2MMGA 1JU3A 4HN9A 4ZVPA 2A35A 4U1RA 3KHUA 3R5KA 2J46A 1FLDA 3UAGA 2K4IA 4LXHA 2BFMA 2CUTA 3EYWA 2GXSA 1X92A 2J0SA 2WU0A 3A27A 3R7FA 3OQPA 2GCEA 3QWFA 1ZRNA 1W96A 4JVMA 1WD7A 3OTOB 3WGMA 9ICLA 2W2TA 2F55A 3VZQA 5JNTA 1MKYA 3TEJA 1GM5A 3PGKA 1GFIA 3ZHCA 1CUUA 2B1IA 3EA4A 2IS6A 1U7TA 2CMKA 4EMSA 3HGQA 4FZJA 4OJNA 4RULA 3UJNA 2Q27A 3GIKA 2OUIA 3GCXA 1Y8QA 1W8IA 4NG5A 1Q1GA 2YHIB 1M0TA 2GZMA 2W70A 3KU1A 4EI9A 2XWJI 4X24A 2OP0A 2SCUB 5CT6A 1E8MA 4EI8A 4TKUA 1B73A 4ECRA 1PSDA 4GLFA 2VJMB 5HM6A 1EFLA 3U61B 1RKVA 2O19A 1ZNYA 1BCRB 1BE8A 3PL5A 4WY5A 4GYJA 3RT7A 4WJZA 2ID9A 1AKQA 2WWVD 4OM8A 3E9RA 1M5RA 4QBTA 4JZYA 5E6UB 1RAHA 2HO5A 4NY8A 3PSTA 5C3MA 4OBWA 4H6WA 1L5SA 4HJXA 2D1SA 1ATZA 1ZRMA 2DWCA 4YMMA 1XC9A 4TSFA 1NFQA 4R2KA 4EUEA 1ORHA 4MH0R 1WETA 3AQ4A 3Q5EA 4GZ5A 5CCDA 4NCBA 5A2QA 2ZVPX 3V7WA 3IP6A 1VRCA 4IDPA 1KJIA 1Z6QA 2J7PA 4HRVA 3P9YA 3LY7A 1F2VA 3FOEC 2I65A 1O1YA 1U0NA 1XXHE 1X80A 1NJ2A 1V47A 5B57C 3I2KA 2PMDA 1TD1A 2QI9C 2NU6B 2WNHA 4QU9A 2D6FC 1FDWA 5ALJA 3RU9A 3CUKA 3DO5A 4GXKA 1IB6A 2FMTA 1E3IA 3OZRA 3L4EA 2OZKA 4GI3A 2WWXA 1MXFA 2C88A 4YS6A 1Q0QA 2GJ4A 2RHGB 5G4KB 3H4VA 2ETVA 4QSMA 4BPBA 3RRYA 4Y3UA 3X43A 2PYIA 1N5RA 5A3JA 1PNVA 1W2HA 2OV8A 5HFJA 4C7JA 2AW5A 1JBEA 3A1CA 4L5BA 4EYIB 2QLTA 2BR5A 2O5RA 1N78A 2EW1A 2VDQB 4KKVA 5TQJA 1GPBA 3DGEC 2WP8J 1TT5B 5BOSA 4C2BA 3SX2A 3F5FA 5HEKA 1SEPA 2EYQA 5KBYA 3MJ4A 5BR7A 4NJOA 2YIMA 4LIPD 5EQFA 4UDOA 2W8ZA 1PZXA 5J2UA 1L5UA 4ZO4A 5SY6A 3V1TC 3W8EA 4A0FA 1SURA 3IP7A 1N3LA 4X61A 3SS9X 1VYVA 3LXUX 2HOQA 4G89A 1GU7A 2MWMA 4BWMA 3AEVA 1TZCA 2D5BA 2HYDA 4ZQIA 2C61A 1Q91A 4UVEA 1M1ZA 3H1TA 1E7WA 2GPWA 1L3VA 3H9UA 4J9UE 3WYEA 2LRHA 1VG9B 1FNDA 3BQTA 2YX8A 2R4QA 3G1UA 5DQHA 2VTKA 1GRNA 5BSTA 5F5XA 1VXOA 3RC7A 5FBHA 3U0VA 2EAOA 2ZUDA 3WLPA 4Z51A 3CVVA 1JEYB 3VDMA 4N48A 5KFCA 1KP9A 1RZRA 5J23A 2KN7A 1K1QA 4LZJA 5EY5B 4PHHA 4ZVTA 4IIBA 4FHZA 4O02B 5KJFA 3M7DA 1SHZA 2X2EA 1A8UA 3CY6A 1J07A 5K2MA 3Q0TA 1OLOA 2JGKA 1XCOA 3KQHA 4HLUA 4UMVA 4Q1BA 1QPBA 3DEZA 1ZPDA 3PE4A 1UPFA 1U7HA 2OCPA 2Q1XA 4N6GA 1NW8A 3DOOA 2BEVB 5CLIA 1G21B 3OSNA 1DLJA 4S1OA 5IZCA 2O3JA 3OPVA 5K8UA 4AWBA 3PMLA 1UDCA 4KWCA 4UNSA 4RIEA 1TL7C 2QARB 2Q9UA 4BQSA 5KTYA 3LLVA 5C53B 3QE2A 1MDFA 4G5YA 1R5JA 1MJGA 1HDZA 3OQIA 3GVPA 4FT4A 1JAYA 3ENKA 3I9LA 4W8OA 2Q4BA 3AB8A 4U3JB 1GQFA 3PQ3A 1IDN1 4OHUA 1JHPA 4XYMA 5D1NA 3BMOB 2IXTA 1TADA 3NV7A 2UVUA 2ZRIA 1KIMA 1PIWA 3ZK8A 2YUIA 1EESA 4MUFA 4QWAA 5TX7A 3A4VA 1P8JA 4BMCA 4F2HA 1U3FA 1F8UA 4NESA 1Z34A 4WZZA 3T7IA 5DBFA 3RF9A 3EZ7A 4UC0A 4D8UA 5DCUA 2I8LA 5FH9A 5KYNA 3L8ZA 4IIJF 5JG7A 5HQ3B 1PRYA 2CD7A 3W05A 1D8YA 3A6KA 3IRUA 4GOLD 3MMNA 1E59A 4KN9S 2JA1A 5LUBA 1Z6GA 3KEGA 3P97A 1RCFA 4FKMA 4N3GA 3GEMA 3U7HB 5K3DA 2UUOA 2JIDA 1ZJ6A 3S5UA 2XY7A 5EJMA 2PUFA 3INNA 2LWIA 3PFGA 4M55A 1P2VA 1WBBA 3SF8A 5E4JA 3D1JA 1XZNA 4QOEA 2YXLA 3K8OE 1Y3BE 4BBZA 1GTJ1 1XK6A 3UWKA 3VC3A 1E4EA 4HX5A 2GAAA 4DGSA 4RYDA 1W5AA 1YA8A 4L8VA 1IEVA 4RJIA 1MF7A 1VHTA 2J0UA 2JBAA 4YBRA 2JIOA 5IYZA 3JZMA 1ZNWA 4BB6A 3H2GA 2R65A 1HT1E 2FEWB 4ALNA 2R85A 3FF4A 2PCJA 4X62B 3SQIA 4FFSA 5BNWA 1I0ZA 2BDPA 1Z62A 2C4WA 5K0TA 3C6QA 3G9XA 4NFHA 1NW6A 3DDSA 3HGMA 3WJAA 2I3AA 3DE1X 2PJDA 2X58A 1Y9JA 2H17A 1UFOA 2O48X 3FPEA 3TCNA 4PNEA 4CDMA 4V0KA 3G7SA 1WLSA 4B3BA 1CY0A 4IJKA 3RKSA 2WJIA 1F14A 4YMIA 4H1UA 4KO3S 2WP0A 3ZIDA 1GY8A 3LUPA 4FNAA 2YIVX 2XCLA 3JQ9C 1OI3A 2F2TA 4CR6A 1M6WA 4DSJA 3M70A 3BHMA 1PJSA 2V9ZA 1WHTB 4DLYA 1JEJA 1OQAA 5DB7A 3IYLW 3C45A 4NPHA 2O54A 4XQ9A 4C7ZA 3ILXA 1G2QA 3OZIA 4U6PA 2ZJAA 5IJ9A 3ABQB 3PDIA 1E2LA 5KL8B 2XMCA 3EISA 1W6RA 1ZISA 3I9KA 3SXPA 3VZBA 3LV8A 2CB0A 3ZLUA 5E9AA 4L0CA 3NJRA 3JARA 2WFZA 4B43A 4BX8A 9ICNA 3M5CA 4LE2A 1XHLA 1I7LA 2OBMA 4URXR 1MR3F 3LPLA 5CR9A 1BPYA 1ECBA 3VSEA 1NRJB 3O83A 1ULAA 2A0UA 3T1OA 1V11B 1ZIPA 2WVAA 4H1VA 5SY4A 2QRPA 5H4HA 2V3CC 1UH5A 4GMKA 1E1MA 1QGAA 4LRUA 2A7XA 3DBRA 2QTHA 3L7JA 1PK1A 3W6PA 2PZ8A 4HPXB 3TEFA 4QWWA 1JDZA 2XXBA 2WIAA 3TGWA 2VBIA 1GT6A 5D2CA 3F3MA 4NONA 4ISBA 2J9FB 4XJSA 9ICOA 1VC2A 1DELA 3RS5A 8ICWA 2VC2B 3JVUA 1XQXA 2H0QA 1B0ZA 3SJAA 4GKKB 4O0MA 2WTUA 2W3RA 5L4NA 2V4RA 1DAFA 1KAHA 3UWOA 4HS4A 1PQPA 2ORWA 1DFHA 5EMLA 2JI7A 1LNSA 4KPUA 2ZB2A 1R8YA 2OHGA 1U8TA 2VZLA 3GF4A 5P8WA 3WNVA 4V2IA 4D44A 3S2SA 3B1XA 1VCHA 5HSGA 3NC0C 4IHJF 2NVOA 3PFFA 3BE4A 1OYWA 3QLVA 4Q12A 2DPYA 1ZQFA 5KCMA 4HTFA 4BX9A 3ZE7A 4OV6B 3KSAC 3AUKA 1D2AA 5BN3A 4QQFA 1LZKA 3BJEA 2PH7A 5DM2A 3AXTA 5KG7A 5ALKA 1B74A 2RG7A 4BX3A 2HU2A 3HXKA 1ZH2A 1X1EA 3FBGA 3OPNA 1NMQA 3A6DA 3TSWA 3AW9A 3W2EA 3DLCA 2X19A 1D1PA 4D6PA 3N7AA 1LA2A 2JFVA 3MILA 1X7YA 4OLJA 2ZJYA 2HF9A 1S8AA 1ZIYA 2KVCA 4RQMA 4BNFA 2QNBA 1J2YA 4REQB 1MB0A 2NRVA 4DLRA 3GUCA 4GMDA 2DF8A 2AR7A 2XHEA 2IYLD 3DCNA 3FRIA 2QMHA 4GPBA 2RBKA 3U1BA 5DHFA 2FG6C 5C37A 1VLJA 3C1ZA 3E48A 3DE2X 4FDLA 1PKEA 1OH7A 1TCCA 4AYTA 3HU3A 2W2VA 3BBPA 2XKBA 3N8DA 3NHKA 4OQZA 2ZYDA 3EZXA 3QEKA 1ZQJA 5LBUA 1E1RA 4TXNA 1L4GA 1LZLA 1CR4A 4KR9A 1DBSA 4L5AA 3ND5A 4I1RA 1IWOA 1WQ1R 1ISJA 3HU1A 4HAVA 1P5HA 1XKQA 1XN1A 5KTSA 2CMHA 1SK9A 1RI3A 3R0XA 3T7SA 2CXHA 5JHGB 3KFVA 3R9XB 2JI8A 2PLFA 2CE7A 3H3FA 4ED8A 5DTJA 1SEVA 2DKNA 3TNDA 4DFDA 3DUFB 4H7JA 5KSWB 1WWKA 1IY0A 4Q7MB 5FFNA 4FFVA 5KKCA 2Q0QA 3EE6A 4HVAA 2HV8A 4NYIR 2QTNA 4M0LA 4OYYA 4P84A 5J43A 4OHMA 3M49A 1QZXA 5T8KA 4EGJA 1PUZA 5EZQA 4URHA 3ICQB 2IYUA 2EWMA 2X4DA 4QQ8A 1OX6A 5TS2A 4JYAB 3PUYA 3VU3A 4IFIA 3RAXA 3TLXA 4BZWA 4TS1A 3KJQA 2NG1A 4K4IA 2ZTHA 3WX0A 3A4IA 4IUCS 1G0OA 3AVTA 4DSNA 5IC6A 1T4CA 4Y2HA 3KKAC 1XNJA 1AK9A 1H2EA 3EA0A 3IQEA 4AW9A 2P5YA 5CMLA 1ETHA 2E3JA 1OLSB 4YLGA 4PEVA 1N2OA 4H59A 1JFFB 2MTBA 2QW8A 2Y99A 3ICCA 4ZT4A 4QVGA 4II7A 4HYQA 3VH4A 1USVA 3DP7A 1FJHA 1CK4A 1CULC 4N12A 4BVGA 5HA5A 421PA 5GPBA 2QUAA 2JMGA 1JDVA 4C8MA 4LVSA 4OX9B 2ZBRA 1E7QA 3ENQA 1E3DA 1VJCA 5JIBA 1DMRA 4FO6A 2GSWA 4RU1A 3H2SA 4D98A 3U48A 2WY2D 4X20B 4M9LA 1SOAA 1DQSA 5ALLA 2MHCA 1E9FA 4H18A 4G8BA 5AXDA 4CCWA 2NXCA 1XEWX 2CFSA 3DAPA 2O8BA 1UWVA 1JYFA 1H4VB 2QLFA 5JNLA 4GECA 4OL9A 4D80A 2BM9A 5IVHA 3NRCA 1WAMA 4ZOLF 1AS0A 4Y9DA 3ZV5A 2V0CA 1K3TA 4HDMA 3L4BC 1EBFA 3JD0A 1HUOA 2RHTA 3ZNPA 5AFSA 3UATA 1JAXA 2XLCA 1KQNA 4E5PA 1ANKA 2YY5A 4TZKA 5E7QA 4MQFB 5ALNA 2WPDA 2P0YA 3BBLA 1U1CA 2WBLC 4TROA 1FBTA 4EDFA 5HS6A 1ZJNA 3KUCA 4RWEA 2JVKA 4B2PA 3QMMA 1E7RA 2DHCA 2E8NA 4G9EA 5F1KA 5BQ3A 2AWOA 4BMNA 1B76A 5EJGA 3I1JA 2OVBA 3C1TA 3CSUA 3R5HA 4NOLA 5JS8A 4GC5A 3P9IA 1DL5A 2ZUBA 4CTNA 1WPQA 1DXSA 2DWPA 2VF8A 2PD6A 4U2DA 1JRPA 4WNIA 3L0OA 5KFMA 2VSNA 4QTYA 3RRJA 3DEKA 4TV8A 1YZFA 1XD2A 4KIUA 4LXXA 1YRQA 5HBRA 4UDYX 3AMZA 3V2IA 3UJ8A 3FA2A 5DGDA 3KALA 3SJCA 2PBZA 3IEKA 3IMKA 3SHVA 4UFOA 4I14A 2QRZA 3L84A 4O4IA 4I2BA 3W2FA 2KBEA 2DR3A 3DZBA 1VKRA 2XJ9A 2KLHA 2W2KA 4FNGA 221PA 2Q3LA 1BKDR 5HBGA 4F7WA 1O9GA 3TTUA 4L0MA 1JHDA 4D0LB 5KFKA 4D4HA 3VX3A 4U9HS 3O8OA 3U26A 4ZCSA 3C6ZA 3DV2A 4O4HB 2FGKA 1ZH6A 3RSZA 4YXWD 4IW3B 1YAHA 2OCGA 4OH1A 1WNFA 4OJQA 4QWDA 1OUQA 4ARBA 2XMBA 2PS1A 2W2PA 4GEGA 3J81j 1P2UA 1RAEA 3TX2A 2J5KA 3DEIA 1B8PA 1FFWA 1R0ZA 4J16A 2OVFA 3THVA 5KYXA 3AEUA 1F2DA 2D2IA 1QGYA 4ARZB 4AROA 5G2OA 4H35A 2ECOA 4C5BA 2FE9A 3OIGA 4LBZA 4YQFA 5FYDA 1YZGA 2FPSA 1KU6A 3SS7X 2P9GA 3JPQA 5A7HA 3JQAA 3RR7A 2PX8A 3BXOA 1F9AA 5FA5A 1AIPA 2KIWA 3VR4D 4DUGD 4J90A 1N9ZA 4D2IA 2YYSA 3OCVA 3I6BA 3WQSB 4QFDA 3OZEA 3L4JA 4N0EA 4FMBB 4C7XA 4IJ6A 1HK7A 1RQ2A 3L8FA 2X4LA 1OY1A 3PICA 1Z3IX 3TUZC 2CNNA 4YB8A 3UAVA 2BMWA 1IXYA 1QC5A 1ZZGA 4ZVOA 3JS5A 2I71A 3SC6A 1F3LA 1UBRS 2KM1A 4F6LA 4UHEA 2SHKA 1W6UA 3B85A 2R0QC 2W6NA 3H0MB 1AGYA 3R0JA 4HDAA 2QENA 4CTJA 2V1UA 1M5UA 3L41A 1RJEA 3ANLA 4JLDA 3I3SR 5EHGA 5K09A 3TARA 2ASJA 2EAUA 3V8MA 3GXOA 1LBSA 5EXDA 3V72A 2C4TA 1E3TA 1XU7A 3DGFC 3KL2A 5D7NA 4UTXA 3P9KA 2P3QA 2YQ5A 1T1RA 1VJRA 2DGZA 1JLLA 4QOFA 4PR3A 4KWTA 1YB2A 3PNCA 4IIEA 3TIXB 1IOVA 1V6CA 5BYAA 3TBKA 2RFLA 4JV5B 3KCNA 2PZEA 5BSVA 1JR2A 3RBVA 3RTDA 1GZDA 4QX6A 2BYTA 5E3IA 4S2UA 1YBHA 1MJFA 5DWDA 4DUPA 3TQTA 2PX4A 3DW3X 5LL6P 4EKGA 5BN5A 3WQBA 3JZFA 2Q4DA 4FT2A 4LTNA 4QVKA 3B48A 4AJ4A 4MJ3A 3TEMA 1GGJA 3RYCB 2PJRA 1L4EA 1RPLA 3GZNA 1MW9X 5JS7A 5JC1A 2HXYA 2I0FA 4V03A 1CJVC 1ZX1A 1T2VA 3U4QA 2ZYUX 1NF9A 1CNMA 4HKTA 1PFGA 4NSNA 3WVNA 1FW6A 4CNQA 1ONBA 2DFPA 3AVXA 2Q5FA 4C88A 3ONDA 4PO1A 1L9KA 4ZOHC 1YVDA 2B8EA 3SQMA 4ED9A 1T5HX 5P21A 3RRMA 2C1XA 5NULA 2AXEA 2Z43A 4KDFA 1VCMA 1SUBA 2QS9A 5EYPB 3V8NA 1WPXA 3CCFA 2ZR8A 5L7TA 3K1AA 4KQ2A 5LMUB 3GMIA 1I2AA 3AL0C 5FOSA 3E1KA 5CVTA 1IQUA 3MNFA 3K1YA 1WZUA 4GT1A 1KQOA 1RPJA 3FLAA 1KC3A 3VKWA 1U8EA 5KOJB 1I13A 1ENOA 2C57A 3C6YA 1ORRA 2WI8A 2CNKA 1KFDA 3ZIAD 1ZQBA 4BFZA 2VCHA 1PUXA 4BKUA 1Z4KA 1ZK0A 1PGPA 2PZJA 3PUZA 1DSSG 3FHLA 2WAQF 2E7ZA 5AVRA 5DHQA 3L1HA 4NIMA 4MO2A 1QLNA 3E35A 1H8EA 5EHQA 3FSJX 4XYGA 4Z1MD 1TFRA 1YOVA 3JR7A 3CG4A 3O90A 3Q6NA 3UQ0A 3SKVA 2JGRA 2YJ5A 1FTWA 1TUGA 5EJIA 2PA3A 4ZYYA 1JI7A 1V1MB 3PXDA 2C4VA 3U13A 1BVSA 4EO4A 3C97A 5JADA 3JQGB 2GWHA 1XZLA 2ZRPA 1NK6A 1I7DA 3BDIA 3F6CA 5JZBA 1DV1A 3CSSA 1PBTA 3RUCA 4PRKA 3JR3A 3MWKA 3L7OA 1LDMA 1BXKA 1T36A 2A0WA 5IM4A 2WB1C 3BJIC 3DC2A 4M9QA 4ND7A 1VCOA 2BFCB 3IAFA 1LJLA 2IEGA 4DL9A 4Q4AA 4JR0A 4DA0A 3GEEA 2Z57A 4TMFA 2GWSA 5E6SA 4DGQA 2XDQA 3NDPA 1O95A 3LPAA 3PEEA 1JXLA 5IK2D 4JROA 4KXUA 4LECA 1H2YA 4I66A 4KFRA 1D0SA 1U28C 2X23A 3JZDA 2I2WA 2EBFX 1O5OA 1G20A 1NASA 3CQ9A 2NU8B 2YNMA 4DG5A 4YC7A 3KKQA 1U2GC 3C4JA 4JT2A 1NOMA 1R74A 1ABBA 3P9XA 3DOUA 2GJKA 3ZLVA 1DAGA 4GI7A 1I4EB 3ED1A 5IFKA 3UMYA 1RWWA 2G71A 3K9NA 4TWAA 4M53A 3CR7A 4Y2TA 4EG1A 2C2GA 5B5EU 1UBJS 4PHCA 3L01A 4V1CB 2WICA 2H5LA 4US8A 1QGUB 9ICSA 4DADA 1PQWA 1OTHA 4RESA 1ZGZA 5KYUB 1JB9A 1XJ0A 3IESA 4M76B 2HCRA 3BSWA 7REQB 2W2XA 1PHPA 3KR2A 3EXHA 1C50A 5MDHA 5DE3A 4EHHA 3B8EA 1KEWA 1LJUA 1U7WA 3RFFA 2JZBB 2BWJA 1ECGA 1KI7A 4PX2A 2A1IA 4JI7B 2OHJA 4DJFC 4XEHA 3D2AA 1JHVA 2SBTA 3QE4A 3AJ9A 2KE5A 3KQYA 1ZM9A 1IN4A 2HFJA 3W6ZA 3KKNA 4PF1A 5CIYA 3BN3A 4HS9A 3L5KA 2ZZNA 3R77A 2ZAOA 1SL0A 2GN4A 1DOZA 4OHYA 4UAZA 1KMHB 4QBIA 4BBJA 1SD1A 4JZKA 3DL4A 4XIFA 3V7YA 1ZD3A 3RTAA 1S2MA 4NZPA 4JLNA 2P66A 2MSWA 1BXGA 1B6TA 5TEVA 3SNHA 2BBTA 2DFNA 4W8GA 1SMKA 3HHEA 3UMSA 3UJ6A 4FYKA 1B00A 2Z3ZA 5DX8A 4H0FA 1AO0A 5EKSA 5PGMA 5DTRA 4IQTA 3JD4A 3GJYA 1XTSA 4CM7A 2JK1A 1N6RA 2QUJA 1CKEA 4MJ7A 3T3IA 1W5SA 4PGGA 1W88B 3N2IA 1K97A 3R44A 4I2DA 3EVCA 3OCCA 1KJ9A 1E66A 5K3BA 4JODA 2AXQA 3J7AC 3NWOA 4N6OA 2B4YA 2FPXA 4QUGA 1TTTA 1ZSNA 2ZITA 2D6FA 3CUWA 4DB2A 5J47A 3K9BA 2ZTMA 1GL3A 2GEJA 1DHRA 4P1ZA 4YR3A 4ZJUA 2YMMA 1ZW6A 3PL1A 4D97A 5HWSA 1YB5A 1L3SA 5DM0A 3EY9A 1T7PA 5FPKA 1SKWA 5JSHA 2DTDA 3VV2A 1S89A 5JO0A 4RZQA 1NQXA 3H6GA 4BNXA 1DIHA 4F91B 2QV0A 3EAGA 4EJSB 4J8PA 3V7FA 5TLSA 4OI2A 3A9TA 3CNLA 3STVA 1EQUA 5ADUS 2CL7X 2CRXA 2C42A 4BJ6A 4J2TA 3PTLA 1FQOA 1NATA 2WFLB 2IKQA 1C29B 2ZIGA 5J4HA 2KVSA 4PZOA 5HTKA 1VLQA 2MINA 3RREA 2GASA 3VTKA 1ZXLA 3AERB 1LF0A 5AJZA 4D1YA 3RARA 3OAAA 2QRLA 2REQB 4DUZB 4YHHB 4NVRA 5DCYA 4C4XA 1QH8B 4N01A 3OZSA 3H5IA 1K7SN 4QBFA 2WFAA 3AETB 3Q9SA 1OUMA 4J7XA 1M2VA 4DR3B 3UB4A 2QM3A 2OC9A 1EEXB 1VLVA 5TC4A 4DIUA 1SZPA 2YH2A 2JDID 2ET6A 2VWGA 4AQYB 3ZHTA 3HEMA 3QU9A 4BQPA 5J0XA 2I6UA 4K9MA 5FI1B 4D3YA 3OLZA 5K99A 4DBLE 1PJAA 1NK4A 4J9LA 4KAFA 1XRLA 2FF7A 2VK2A 2EXXA 2HQSA 1Z75A 2X3UA 1C3EA 2CKDA 2UZ1A 1FU7A 1F3OA 1QHEA 1T9KA 1SBIA 3DO6A 4D8VA 4JBHA 3QG1A 3VR2A 3NAMA 2EC5A 2AZ4A 2O7NA 3RROA 4EATA 4HNRA 2H54A 4D9FA 3GVIA 3T95A 4TXHA 3KTAB 2YWHA 4DIEA 1O8BA 1B23P 1JIIA 3CRQA 5FXMA 4F9GA 4D4LA 4E21A 1HMPA 1IHPA 1BNPA 5H4GA 3P9PA 1TO1E 1KAGA 3DZDA 3GRUA 4L75A 2IFTA 3BXEA 4MKZA 1U65A 5HE9A 1K6XA 4KLFA 4R8VA 3TZKA 4QWBA 4Z7JA 4DNXA 1YI1A 1G5IA 2XE4A 4RE5A 3BFPA 4G1VA 1UPAA 1G18A 4J9MA 3IR7A 5A6SB 2C2XA 3INGA 3UIEA 1GPKA 1OV6A 5LQDA 2A92A 3VVBA 2GKSA 1KZ1A 3UBTA 2CMFA 3NHUA 1EDDA 4KWEA 4R8KA 2JARA 1X9WA 3BTUA 5BN4B 1U47A 3UHOA 5DRTA 2AEMA 1GNQA 3MQ2A 5LN1A 5K0SA 4CKBA 2I76A 1DCMA 2KSOB 2VBFA 4C22A 1XTTA 2LPEA 4U39A 1XJCA 1JVNA 2F3UA 1KY5A 4UBNA 5AJHA 3DOFA 1SUWA 4N39A 5A9SB 1FP4B 2WEKA 4QYSA 2X0FA 4RXUA 2HXSA 1RI4A 1NE2A 1ESDA 4G4SO 3C0KA 1QP0A 3ZE2B 2GLUA 1ZMTA 1P9NA 3UK1A 4TN1A 1SBTA 3SOZA 1DQPA 4ZHQB 2JH8A 3INYA 2NSDA 3RODA 3P5BA 4Q39A 2J7KA 5JSQA 2ZSEA 2LCIA 2QM8A 1PS9A 5L3RA 2AVNA 2GOYA 4JU9A 2Q2VA 4KFSA 3UA4A 2AIRA 4IDHA 3EAFA 1M2KA 1A5ZA 1FP7A 2PLWA 5LIPA 4ETIA 4MYSA 2A5GA 4DSZA 1EVJA 3M2PA 3NCHA 2B5OA 3HUFA 1GRQA 3OGUA 3RVMA 4PFKA 2ST1A 3GYGA 1DINA 4F2WA 3BYZA 3ZDQA 1G2PA 2OV2A 1FZTA 3H17A 1L8OA 1QO7A 4ZCLA 5IHXA 3MCWA 4C20A 4ECAA 1MC1A 4BNWA 4CUZA 4WNAB 4HADA 1ZRSA 1L1QA 5EXXA 4PGHA 2PGIA 2I5HA 2CNWD 5DBIA 3M3PA 2DG2A 3JQ9A 4IDOA 3WLKX 4KHZA 5AVJA 4RM2A 1DEAA 3ND6A 1Y9EA 4K6MA 3GAZA 2ESEA 2QUIA 2KOBA 3OPMA 4H31A 1M1XB 3CV3A 3UCEA 3BGVA 4M8NE 2ZU6A 3ASVA 4KTVE 3LK6A 2WQZA 3UBMA 5ICMA 4LHXA 3TZEA 4BMVA 4DM7A 1Z2AA 2WOJA 4O8ZA 3HSSA 5J2BA 2JLAA 3ORYA 4NLLA 1JLSA 2CFIA 4QECA 2W11A 5M3BA 1E1QD 1MHTA 4E15A 1VIAA 2G4CA 3CXUA 2DMRA 5L4SA 3TIVA 4CG1A 1T6XA 5F73A 4F5NA 1O0SA 4IRUB 5FOUA 4BX0A 4JJFA 4XB2A 3WZMA 1EWKA 2CF5A 1C80A 2OQVA 2BFFA 2QGZA 2BTOA 4FEYA 1KOFA 2ORYA 1R3DA 3EG9A 2I87A 4Q4LA 3VHLB 1NQ5A 3ZD7A 2UVWA 3R4VA 3M5WA 2AKEA 3CB2A 4MS4A 2Z6VA 1QJ4A 5FORA 3KSZO 4FYWA 1BMTA 5F7OA 3L8GA 5LMCA 2YZMA 5JQGB 4JKIA 3PS9A 1NVWQ 8ICFA 1LPPA 4FFBB 3UK7A 4YRIA 2R44A 3S40A 3OE7D 1TJ3A 4ENRA 3FYDA 5FOQA 1NR5A 2NADA 1GTG1 1U4BA 2E0IA 4YJ3B 4B4VA 2C7PA 2GBLC 3ML1A 2EEZA 1N8TA 4U2KA 5DBOA 5KX5A 1OZAA 3THYA 3MWDB 2WKSA 1Z82A 1KO7A 1PCXA 4OHBA 2GCGA 3BWVA 1JDSA 1UBSB 3RVPA 2A19A 1ISFA 2GVDC 4XUDA 2AFHA 5AW8A 1Q83A 4MRAA 1IZ8A 3WRXC 1YVRA 1NYRA 1EE1A 3I5XA 4AKEA 6LDHA 3REGA 2CKMA 4BAGA 2ODQA 2Q4OA 2JIRA 5BVHB 3L7DA 4O4JB 3DA8A 2JH1A 2R1UA 3X1KA 1R9MA 1LBEA 2JH7A 2Y1JA 3WKAA 1NBHA 2J67A 1HEUA 1YGYA 1UJMA 3ONWA 3TCXB 1TAUA 3O84A 3ND9A 4PVCA 1ZNXA 4URYR 3BWMA 1P7DA 3C5VA 3H8WA 2JPDA 4L3VA 3THSA 4M9UA 3BQ0A 3EXFA 4LOIA 4IEEA 3JRNA 4O08A 2CHEA 1Z5WA 3RUEA 1HE2A 1CZKA 4ARSA 3CLSD 4MF8A 2ZDGA 3K5WA 4IKPA 4Y0NA 3A26A 4JQOA 4DCTA 3W1WA 2YX1A 4AK9A 1W9MA 1JSZA 3PSFA 5K4AA 1EUZA 3D5EA 2A33A 4AYBF 3GNLA 3N39C 2NZ8A 2NUPA 5GJVC 3U60B 3JPPA 3F71A 1IG3A 2BSQA 1EFCA 1ADGA 1L5HB 3OP4A 4DLUA 1P81A 3TLGA 3O2SB 1Z45A 1C9JA 1RBZA 2GN9A 1K5GA 3BL5A 4RLFA 4LRQA 4GE3A 2IP4A 3P0FA 1N1GA 2RK6A 4PG6A 2CT8A 2QNIA 1ZM2A 4IIFA 1SFRA 1WCIB 3PKIA 5DNCA 3A31A 4M1YA 2VYQA 2VS1A 5FJIA 5J3JA 3HA3A 2XCRB 1NZPA 3IUJA 4QXMA 1IMOA 1BXZA 2WT4A 1LW6E 2O20A 4BLWA 3DHEA 1RU3A 4G5FA 4ZCPA 5D49A 4TT8A 2FU5C 3GV7B 1M1YE 3KLPX 1GZ4A 5KG0A 5C18A 4QJ3A 2FDXA 5IASA 3G1WA 3K6SA 1TYEB 4ZANA 3ELWA 3Q4GA 1RQNA 4KYTA 2X6RA 1Z0KA 5EIBC 2NO9A 2FSVC 3A25A 5I8PA 3X1JA 4KXWA 5GZ6A 3VZPA 1SO8A 1PVQA 5A04A 4W5NA 3THXA 1B14A 3SV3A 2EGHA 3DPUA 2AOUA 4AL4A 3KKAA 4ZQBA 4J7AA 1RWKA 2QZJA 4UHFA 3NDBB 1P9RA 2A9PA 1LRJA 3K4PA 1FXSA 2X5NA 4TTSA 2OAEA 2ZI7A 2DUWA 2EDUA 1TVMA 3S1AA 1ST2A 1FO4A 1T1IA 4QATA 1OYOA 4PWYA 4YV2A 5KFAA 1AHNA 4QODA 3UUFA 3JASA 1QWOA 2X77A 1HMYA 4RZUA 2IZZA 4M47A 4QOIA 2P1RA 1GCUA 1FTYA 4XVUA 1TA4A 1C2YA 2DWUA 4F93B 1PD1A 2R8XA 1YASA 5BMVF 4RTNA 2FUEA 3BE5A 2ID7A 3GCGA 3PCRB 1P0MA 5DIZA 3PA8A 2WUFA 1E0KA 2NT3A 4J9NA 3LX8A 3VNSA 5KHOC 4ZIRA 3ZGOA 1UKBA 3WOHA 4RTQA 3ZJYA 2GUGA 2GS9A 2VPYA 4Q0MA 5LDGA 5F1OA 3AHCA 4O0LA 2K89A 2H3HA 1YQGA 2DPJA 2Q5OA 4ND8A 4J2HA 2RDIA 2QD4A 4FBLA 4QXPA 5GIPE 2IY8A 4BU1A 4C07A 3UB3A 4DAOA 3DNPA 1F06A 3U7RA 4OQEA 3BMCA 2OOSA 4UREA 3HCOA 3NIGB 2IV3A 2LDXA 3P9ZA 2HJVA 2C28A 1K4KA 1TEHA 3BHNA 2RHWA 3RE1A 4U7DA 4M7PA 3KJFA 2FWNA 4TTTS 2ZI5A 3WU2U 2ZTEA 4A03A 2XRYA 3CONA 4QIWF 1HOXA 2FWJA 1AUOA 1KOLA 4A9AA 1LPMA 3IT1A 3C5GA 1OOEA 3VX4A 1UZAA 5C3UA 3HJRA 3IS3A 3GRKA 4F38A 1WM1A 1A9RA 4RSMA 2XSZD 1DUIA 3I6YA 2IIQA 4XDZA 2K87A 1IB0A 1UM9B 3Q72A 1UPXA 3SIWA 1UOPA 1QCYA 4HN2A 4FP9A 3P26A 5KI6A 3TTWA 4MO9A 9ICGA 2VJLA 1EUYA 2FFAA 4WAUA 5I4CA 1JDBC 2AFIA 2FQ1A 2VP6A 3TO5A 4URUR 5C8YF 1NMSA 4NP6A 1T1GA 5IEBA 5TRTA 3VPDA 3D4PA 1XMPA 5DNWA 1X39A 4TT3A 2Q3BA 4CQJA 3R9IA 1JHQA 1TM1E 4WBNF 4Q4CA 3S28A 4M04A 2Q6IA 1BQ4A 3ANXA 4BNUA 7ICVA 2GHIA 5FUQA 2C84A 4FHCA 4PO8A 2PR2A 3HYSA 4TQRA 1E2FA 2FMFA 5I4KA 4MUGA 1V6SA 2ZVJA 1N36B 1K7EB 4IDEA 4UTZA 1WU8A 4BO9A 2A59A 5AJTA 2EDAA 3IHWA 3BJMA 1CUYA 2Z7JA 2QX9A 4L9WA 2W2MA 5F9NA 1L5ZA 3IA2A 4Y2QA 4WSOA 1ONNA 4E70A 2IEBA 3PENA 4X5OA 2ZJ4A 4CDGA 4ZI2A 4WLOA 1PZNA 1DAPA 1CERA 4PFQA 1EVQA 1WUTA 1XMJA 1K0UA 3A4MA 3H19A 4B7ZA 2X4GA 1NBEA 3DL7A 1HRKA 2IQ5A 4YPFA 1U1IA 3Q7TA 4MV1A 3HCBA 3M9WA 4MQBA 4TUSA 4CCHA 2MSDB 2JIMA 2NM0A 1U2PA 3BOSA 2XGJA 4NBVA 1PR6A 3GH1A 5B12A 2PJUA 5CT5A 2IBTA 1GNRA 4OCZA 4IX1A 2XZDA 1GG9A 1LDBA 4DPKA 3PVCA 1V85A 2IXBA 3LGXA 4J7UA 4YRTA 4MPRA 2HLDD 2AL7A 1YS9A 4QLAA 1FSZA 1EX7A 5ITVA 1AO3A 1T9DA 5G1NA 4MFCA 1NXVA 3MF4A 3OFSA 2I4MA 3UKDA 3FDXA 5CT4A 2Q7XA 3K0FB 5J0TA 1FTSA 2QP3A 4BIIA 3OHMA 3EIUA 5L6MB 2WLTA 1JKIA 2TYSB 1CF9A 4LJKA 2UZAA 5U1PA 2PGDA 3STWA 2Q1WA 2ZYHA 1TZMA 3BGDA 3DL2A 1N2CE 1L5KA 2H5XA 4B46A 4EZ6A 2X4IA 2ZBQA 4AG5A 3KLBA 4ZO8A 1ISIA 5I7EA 4LSMA 3HNOA 1ZD9A 1XPUA 4MFFA 1T15A 2W3SA 1I3OA 1E79A 2FN9A 1H85A 1H6AA 1E3QA 3I73A 1GKIA 3HKDA 2Y1LA 3SVZA 4RKYA 3SEAA 2FLKA 2NZVG 2EG9A 4NCHA 4B35A 2Q1UA 3X2SA 3U7EB 5JXIA 3NYRA 5HZHA 3O4JA 1KZGB 1UINA 1Y3AA 3EQ6A 4BFCA 1RWNA 4HAWA 4CN8A 5C8VA 2AHOA 4CR7A 3TD6A 1NVBA 2AJTA 3OQ1A 2OSBA 1ZMRA 2W9CB 3N2KA 1TE2A 2Q6OA 3MS4A 1A9ZA 4RQ2A 1QH1B