2NO4A

Crystal structure analysis of a dehalogenase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
LVDSLRACVFDAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Hydrolase
molecule keywords (S)-2-haloacid dehalogenase IVA
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no4A01
4NABA 1F5SA 5IT0A 3L5KA 3WK9A 2IOFK 3BA6A 5AKYA 1RQLA 3I1YA 2ZBGA 4XE5A 3E81A 3ESQA 2PQ0A 1QQ6A 1TA0A 2B82A 3ET4A 2YJ3A 3OCYA 5AK6A 4J2TA 2P27A 2CFSA 3ZX4A 2I7DA 4OHFA 2HOQA 3I76A 4E88A 4QQFA 4AP9A 3QUTA 4B6JA 2YMLA 2ZG6A 5AM3A 2YY6A 2VKQA 2B1RA 4KYTA 4ZEWA 3ZTWA 1Z4OA 2EATA 2HCFA 3FPBA 4AS3A 5ALKA 3PGVA 3WKEA 2O9JA 4UM7A 3U13A 5AW5A 5AW8A 4HGNA 1RPZA 4C4RA 2C88A 5AW4A 2P69A 1O03A 2YJ4A 4YCMA 5IT4A 1YS9A 1SWVA 3NAMA 5JJBA 2FPWA 2JAOA 3WGUA 3MMZA 1L6RA 4HGRA 3AR6A 3R4CA 4BX2A 3E84A 1U2SA 2DQSA 1ZD5A 1WR8A 5AW3A 3QNMA 4EENA 1VFPA 1RKUA 3F9RA 2D2VA 3IB6A 4KN8A 5AVSA 4L6AA 3EF0A 4BBJA 2AH5A 2C8LA 3N07A 4NFLA 5AKEA 2RBKA 2WM8A 4CE6A 2G80A 3L0CA 1Z4QA 3KDPA 5AVRA 2P11A 4Y2JA 5ALDA 4Y2VA 3ZVMA 4HGPA 5AM4A 5AI0A 4ZEVA 1EK1A 4I9FA 4XQ0A 2ZBEA 3ZWDA 3WK7A 4JDPA 1Q92A 1SU4A 3U7GA 1RRCA 2B1QA 3QU2A 4F71A 3UMBA 1EK2A 2AUTA 3ED5A 4DCCA 4H1WA 2FI1A 1L8OA 3NIWA 5ALOA 5AK3A 4RETA 1Z4JA 3FVVA 4ZEXA 2HSZA 5AIAA 1RLTA 4DFDA 1VJ5A 3A3YA 3OCVA 2YFYA 2C8KA 2FUEA 3VAYA 2OBBA 2AGVA 3L8HA 5ALJA 1X42A 4UU1A 3A1EA 2GFHA 1YDFA 3MN1A 3N5KA 3B9BA 1T5SA 3L1VA 5AK5A 5ALZA 5AW2A 4Y3UA 3NANA 3WKCA 2G09A 4Y2XA 4KNVA 3L1UA 2OYCA 2C9MA 2R8YA 2CFRA 4OD0A 2B0CA 3IJ5A 4XOUA 2BDUA 3WGVA 3U7HB 1QH9A 3TLMA 2O2XA 4MUMA 5AVUA 3ESRA 4F72A 3SHQA 2FPSA 3N28A 2YJ6A 3L8GA 3ET5A 2X4DA 3DNPA 3W5CA 1J97A 2P9JA 1O08A 3QUCA 4QJBA 2WF7A 2IYEA 2IA5A 1Z5GA 3QGMA 3NRJA 3QUQA 5AI8A 1L7OA 3B8EA 3W5DA 1TJ4A 5AW6A 1IWOA 4YCLA 2ZBDA 3QX7A 4KX5A 4BNDA 2W11A 2PR7A 3KD3A 2CFTA 4G9BA 3S6JA 5AM2A 1S2OA 3E8MA 4HGQA 3N1UA 4NAVA 2BDEA 3AR2A 3DV9A 4Y2TA 1ZJJA 2HX1A 1Z5UA 3ZVLA 4CF4A 3MPOA 2IOFA 2Q5EA 2OM6A 4UMFA 2W43A 4YCNA 5AK4A 3WKAA 1N8NA 3A1DA 4HYTA 2EARA 4CF5A 2B8JA 3SF0A 2ODAA 5AW0A 5AICA 1RQNA 1YMQA 3UMGA 5AIBA 4XPZA 3NASA 3QU7A 4CNQA 1L7MA 1NRWA 5AESA 2FPUA 1CR6A 1Z4NA 3QU4A 1RMTA 4UMVA 1VJRA 4IFTA 3CNHA 1CQZA 3FM9A 5AM5A 3L0BA 1RMYA 4HAIA 3QU9A 4NWIA 3OTQA 3DAOA 4EX6A 1LTQA 4UMDA 4UATA 5ALUA 1Z4KA 3SLRA 1Z4PX 1Z4LA 1Q91A 3L7YA 2FUCA 5ALRA 1Z4MA 5ALIA 4O8CA 3M9LA 2W4MA 3B9RA 2HO4A 4MWOA 5ALTA 2R8XA 1XP5A 4JB3A 4YIHA 3EPRA 2WHEA 3OCWA 4FYPA 4FFDA 3J7TA 1WZCA 4J03A 5ALYA 1Z4IA 5A3SA 2WF5A 3PDWA 5AI4A 4C4SA 3UM9A 2QYHA 2Q4TA 4KX3A 5AI9A 3UMCA 3ZX5A 3RF6A 5ALEA 3SKXA 1N9KA 4GXTA 2FPXA 4NV0A 3DDHA 1WVIA 1PW5A 1RMQA 2WFAA 1LVHA 2MSNA 4UU0A 1U7OA 1L7NA 4BNDB 2RB5A 4DWOA 3AR9A 2MU2A 3ZU6A 1K1EA 3RFUA 5AVYA 3HLTA 4KNWA 3L8FA 3MC1A 5AW1A 1AQ6A 1RKVA 4DW8A 4L57A 2QLTA 2B30A 2HHLA 4Y2YA 3PGLA 1T5TA 2ZOSA 2HI0A 3N8GA 5A3QA 2NO4A 5ALGA 4Y2PA 5ALNA 3NUQA 5AM1A 5AI6A 1YNSA 4Y2UA 4C4TA 4Y2RA 3AR8A 2GMWA 1J8DA 3ZWKA 4OFZA 5AVWA 4UMEA 3KC2A 2FEAA 3OCUA 2HF2A 3U26A 4YGYA 3E58A 4UM5A 2GHTA 5AKZA 4YH1A 4IG4A 3IRUA 4UASA 2HF7A 1QQ7A 1U7PA 1L7PA 2FPRA 3PCTA 2AMYA 1RC8A 4UARA 5AVXA 1TJ5A 3K1ZA 1T9ZA 1KYTA 2G08A 3QYPA 3OCZA 2JAWA 5FP0A 3WKDA 5AKKA 3CZ4A 4Y2SA 5AVQA 2I33A 2G1AA 3WK8A 2C4NA 3W5BA 3L8EA 3A1CA 1Z88A 3ONNA 2WF8A 4Y2QA 3OCXA 1ZRNA 2R8EA 4CF3A 2WF6A 1TJ3A 4YIKA 3WK6A 1NF2A 3ZI4A 1JUDA 3FPSA 3ZW7A 2HDOA 5A3RA 5T41A 2G0AA 1XPJA 3R09A 3U7EB 3AR5A 4OCZA 2YMQA 3D6JA 2RAVA 2YJ5A 2ZXEA 3SKYA 3U19A 4BKMA 1ZOLA 3HYCA 2Q4RA 4AS2A 4I9GA 3QUBA 3QXGA 2YMPA 5AI5A 5AKIA 5AM0A 1S8OA 4BYGA 4GIBA 1ZD3A 3QU5A 4EEKA 5ALWA 5ALXA 3KZXA 4EZEA 1ZD4A 1YV9A 5IS2A 5ALHA 5AHXA 3GYGA 4G63A 3U7FB 3WK4A 3AR4A 2G07A 4L6CA 5AVVA 3FGOA 1SWWA 1ZS9A 4HGOA 1WPGA 2MU1A 5ALVA 1QQ5A 3ZTYA 3I28A 1NNLA 4EELA 2YN4A 1MH9A 3OPXA 3EWIA 5AW9A 3AR7A 1Y8AA 5AKLA 2NO5A 2IOHA 1U02A 5ALMA 3WKBA 2EAUA 2I55A 5ALQA 1XVIA 5AKXA 2JGAA 4FE3A 3SD7A 2YBDA 4BEVA 3W5AA 4PNHA 2WF9A 2NYVA 5ALSA 4RESA 5ALLA 5AKJA 5AKGA 4UAVA 3SMVA 1RLOA 3R9KA 1RKQA 2BY4A 2GO7A 3QLEA 3P96A 1U2TA 2CN1A 2HEGA 2G06A 3I6BA 3AR3A 2B8EA 3L0YA 2PKEA 4UW9A 2R8ZA 3EF1A 5AVZA 3WK5A 2GHQA 2I54A 3KOOA 2JARA 1YJ5A 1RDFA 3BWVA 2I34A 4BEWA 5E0OA 1FEZA 3KBBA 1L8LA 3FZQA 1ZRMA 2FDRA 1ZD2P 5ALFA 4BX3A 1QYIA 2OA0A 3NALA 2ZBFA 4EX7A 3ZVNA 2I6XA 3M1YA 5ALPA 1RLMA 4UAUA 4BX0A 3ZUPA 2YMMA 5AVTA 2JAUA 2RARA 5AKHA 1TE2A 5AW7A
chains in the Genus database with same CATH superfamily
1F5SA 1EVZA 1TEZA 1DOQA 3B5JA 4HMQA 1O89A 5G40A 5K0JA 1AKRA 1UBMS 3LK6A 1LWOA 4WLFA 1E6UA 2HU5A 1YIAA 5EXDA 1E4VA 2PMFA 3OF3A 2W9BA 3FPFA 1T1JA 3IDQA 2Z2YA 3PBKA 1Y3DE 1E6CA 2JIOA 5REQB 3WMGA 3WQBA 1XZFA 5GIPE 4KWHA 3O9VA 4N41A 4REQB 4YCJA 1TJYA 3SF8A 3WBBA 4GNKA 1VKNA 2AI1A 5CCEA 2IYYA 3ZQUA 2GESA 4R8SA 4XX0B 1SK8A 2HT1A 5KHOC 5E2AA 3I9JA 3OM0A 5ADHA 1MRZA 3G0GA 1EWQA 3TLCA 4C4YA 4DR5B 4HAUA 1L3VA 1HQDA 2JFPA 2GI4A 4WXHA 3ZWNA 1FJXA 1UOPA 1CDEA 2I7DA 4ZOLF 2QQ0A 3KE8A 5A3JA 5JXHA 5KG6A 3SIXA 3WHPA 1GAQA 3KJFA 3QENA 1H66A 3ICCA 4LYFA 2GBCA 4MQLA 3NM5A 3USES 4QYXA 4CV0A 5IK2A 1Z16A 1F48A 1K6EA 3ZTWA 1N5KA 2V98A 2VSFA 1K86A 1MUUA 3HP7A 3K2QA 3K8QA 3MTAA 3PGA1 3EUEA 4YRTA 4M04A 4C8KA 1CUYA 1JE0A 1J0BA 2WJJA 3ZHOA 1FXSA 5JNUA 1RRVA 2XGQA 1C4OA 3PGVA 2WVAA 5DKWA 1VKOA 1SXJD 4IPTA 1EESA 3H9GA 2Y4OA 2P7IA 3SHOA 4RV5A 3QVXA 1YCFA 3IQZA 4EGJA 3M8SA 2JA1A 5K01A 2JG3A 1N0VC 4LF7B 4PC1A 4C0SA 3I64A 3E15A 1IG0A 2HZ7A 2ZWMA 4A6PA 3BFVA 3T3NA 5C31A 4FFSA 4NJMA 3GZNA 5B7GA 3RKRA 1CYEA 3NOXA 3SC2B 3S27A 5A5EA 1LBQA 1YFJA 3TZHA 2A0UA 1CJCA 2H0RA 3T4PA 3HU2A 2BBWA 2BMVA 2ZYSA 4LSGA 5CM2Z 2EZUA 1VKHA 1E94E 2X9GA 4FZ3A 3U16A 3NWEA 4MFFA 4RLFA 5CIQA 3T1VA 1C3VA 3EXFA 4LNHA 4KACA 3BHNA 5GZ3A 5AVSA 4MINA 3IYLW 1X2EA 3H8MA 5L45A 1N1DA 2Q21A 2FEMA 2WTUA 4ED7A 3FN4A 5LBUA 1W34A 1Z12A 1XTSA 2XVYA 3KHKA 3ONDA 4NFLA 2JH9A 3RGGA 1SEVA 3IVGA 3D7LA 1IDN1 4N0QA 4BJ5A 4CE6A 3KKAC 2BFMA 1GUZA 2G80A 4H2DA 1OX5A 4MDYA 1DKOA 3IPXA 5AVRA 3H6HA 1NUTA 1VGRA 2MSWA 4MS4B 2PRYA 4NJOA 5K3EA 1I32A 3Q9NA 5AI0A 4U7PB 3GFQA 1VBFA 5F2EA 1T1SA 3VUFA 5K05A 1L5HA 3TX2A 2CLCX 5T3YA 4K9QA 2OPHA 3ZWDA 2H0AA 1O2DA 3VO2A 3QITA 4RVUA 2BKVA 3ZDAA 3O8NA 4MUFA 3LXRA 5BWBA 3ISDA 1EK2A 2JEZA 3TLXA 2W3RA 3DMFA 2R6DA 4UHEA 3R3HA 3U1BA 4B3HA 3IAFA 3UMJA 2AOVA 3KLNA 4A73A 5I7SA 4D0NA 2Q45A 1KTIA 2C7VA 2GBLA 5HTOA 2H5XA 1PZFA 2JCGA 2PZ8A 4RVHA 1HI9A 1U1FA 2GK7A 1SL0A 1GZVA 4N7MA 2DKZA 1Z4JA 4DR6B 1RC0A 2FW8A 5F51A 2VQ6A 2ZJ6A 1XZQA 2RI6A 4YQWA 4XLZA 2HMYB 1IHUA 2ODTX 3TFRA 3PV8A 1GSIA 1L7AA 2YFYA 2C8KA 4RF4A 3SHTA 3W7VA 1M54A 3TO5A 4AU1A 1EINA 4PFKA 3K75D 1C4XA 1B73A 3A31A 4LPSA 4KDFA 3CF4G 2W6JD 2JPDA 2Z1DA 2KKVA 2FZ5A 1GA4A 3C41J 3FNFA 5BV1A 4AYWA 1FBNA 5TRTA 4CEHA 3HDJA 3T5LA 3S2EA 1Z82A 2JGKA 4YRQA 2Q4OA 2VUTA 1R88A 4FOOA 1EBBA 4R69A 4DDVA 4YRPA 3UPUA 4UM9D 4KAFA 2PMCA 1EGHA 3OC6A 4PQRA 1I5EA 4PGYA 1T3NA 4K6MA 1OI7A 5KYWA 1CUIA 3RSOA 1ESEA 1U47A 3IELA 3RK4A 1ZQVA 3PF8A 4JSRA 4M0DA 4UQLA 1XMJA 2O2HA 4EJMA 1A7JA 1MX1A 4FE4A 2J59A 1Y7PA 3E9EA 3IPRA 3I1FA 4XB1A 4XQCA 2Y6VA 2DQKA 2FLPA 1ADJA 4R84A 4V02A 1Y6GA 3EQ2A 1MQ9A 2FEKA 4MP8A 5EG5A 2OAQ1 1T2EA 3DAHA 2F8LA 4PGMA 1TQ6A 5DDYA 5BURA 5JPDA 3DMNA 3K9CA 3BH6A 3KZOA 4FZJA 3FMIA 2XA9A 1UDWA 4F4WA 3L7DA 3NTQA 3ZLTA 4CEJA 1HY3A 1UXHA 3VHXA 2GCEA 1G6HA 3O1LA 5JC8A 2HJHA 5E4JA 2XGPA 4XWGA 4IBOA 3TFWA 4G2TA 5FR1A 1L7OA 1SKAA 2I1QA 2E6UX 3U5TA 3W5DA 3FNHA 1T9CA 2UZ1B 1NRJB 4L0QA 5H80A 4KYUA 2H4JA 5J0TA 1K7SN 3HWX1 3MDCA 2W11A 4ROTA 4WUVA 1P39A 3GLHE 1OAOC 1KQOA 2J3KA 4LA4A 4ZV4A 1FFEA 2LGJA 1IU9A 5AYVA 4LZGA 3MTQA 3SCZA 3OF5A 3ZDQA 1LKYB 1Z7WA 2WD8A 5L6MB 1NV9A 1OWMA 1XMSA 1FLNA 1H8ED 4FI3C 3JYOA 4KDCA 4UB4A 4ZVQA 2BDEA 3DV9A 2NX2A 5TJHA 1V9PA 3TSWA 3KSZO 4Y9RA 1Z5UA 2UXDB 5BNTA 2EJUA 4KFUA 4DDUA 1BOOA 3I12A 3DOFA 3PFCA 2FG6C 4YQFA 2Q5EA 3ZZ0A 3TXYA 4OXNA 4E5DA 5LFAA 3A1DA 3KBOA 4YRDA 3ZWOA 1W30A 4GXNA 4NLLA 2RD2A 1WMFA 2G4CA 1LD3A 1N7GA 3GN1A 3M3HA 4ZAWA 4BWYA 1OWNA 2W7OA 2HSDA 4LBWA 3LDHA 1Z5OA 4KC0A 3MWLA 3RK1A 1ZW1A 2AI3A 3NDBB 4WI1A 4FVTA 5CRIA 4F2PA 1Y37A 5L7TA 7GPBA 2OORC 5JDCC 4FBLA 1NSTA 2VOEA 2W4QA 2ZJOA 3WR5A 1R00A 3DOEA 3EBOA 3Q7EA 1CR6A 5HR7A 4TUYB 1WXIA 4Z4EA 1XO1A 5KFWA 1IM2A 1PQUA 3VPHA 1FFHA 1S7GA 2FW7A 2VATA 4OIFA 4LJKA 5FA6A 5IKMA 1K5HA 5D84A 2WYUA 3BB3A 1QK5A 4F1WA 4CF6A 3AQEA 4EX6A 1U6KA 1VRCA 4FQ8A 3B9QA 3WDLA 3PA8A 5KFGA 1IN4A 3DZKA 1DMSA 1G5PA 5J2FA 1EFVA 1YJQA 2HA4A 3JQPA 3QY0A 4FFVA 1EGMB 4MRAA 4ZAFA 2CD7A 5HOQA 3DG9A 3PJFA 3ND7A 1QCDA 1G66A 2X42A 2WPDA 4JITA 4O59O 5J2TB 1RVV1 1OFTA 1YUNA 3D8SA 1PYDA 4QDUA 3GO4A 4XJSA 4JLBA 2QX9A 1A9QA 3LXUX 1TKBA 4MR8A 2KVCA 2QW1A 4IF4A 4B6SA 1T6NA 4OQMA 2PIAA 5A5VA 4QPNA 3E9ZA 3P0JA 3AJAA 3RSHA 3VR3D 3LYUA 3QELB 1DBRA 1FC0A 2B1IA 4GVLA 3PR5B 4LI3X 4LZZA 1Z2DA 4MIYA 4YJFA 3C15C 3QX9A 4BE7B 1NIJA 3TANA 5AMXA 3UENA 3ZGVA 1SC3A 4OJ5A 3AG6A 1TEXA 4DIDA 2IF0A 4I4CA 1IPHA 1TQ8A 3FFAA 4EG7A 4WK0B 1XNJA 1RP1A 4HDRA 4JR2A 4DFMA 2D1YA 3N59A 4U2CA 4XI9A 5SYNA 3E7XA 2X41A 3KEGA 4DV1B 4LGYA 1ZQOA 3S44A 1I3NA 3CVXA 2BDTA 1BXKA 1RHKA 3GIDA 3CIOA 5EQTA 1W6RA 4HEHA 5ARCA 1JEYB 2ORIA 2B92A 3EMVA 3T5TA 3MINB 1WU8A 2GTIA 4C88A 4G5FA 3P7MA 4CM5A 2JGFA 4ER0A 1XNQB 2I65A 3L7MA 3GZFA 3LOQA 1M1UA 1XEXB 3M3PA 3CF6R 2KG5A 2HHJA 3MT0A 1M1NB 4R1OA 4S1NA 2LIPA 4RCVA 1PVPA 2CNWD 3JAWB 4TROA 3RRZA 3HLTA 3NHLA 3UGQA 4BXOA 3CVUA 4HC4A 1S3IA 2PLRA 4KW7A 4B9TA 2IYOA 1OFVA 1GUAA 4D0RA 3LZCA 1M2VA 4HEQA 3ANMA 3PGLA 4UUQA 1PZHA 3IUBA 4HAOA 4N1AA 4YA6A 4UZFA 4KLHA 4K87A 2BCGY 3ZCSA 3HRHA 1PJBA 4E94A 1ECCA 4BVJA 2NRZA 2ACEA 3AR8A 4L27A 3EPLA 1DDGA 4OFZA 6ABPA 4JP3A 1FFAA 1YA6A 4U0JA 1P8JA 3DBVO 4DLKA 1VPVA 1U7XA 3A4TA 3OCJA 4BQFA 3IV6A 4RPLA 2G77B 2GFIA 3IULA 1SUAA 4OQ4A 3RB6A 3TBFA 1OLSB 4YH1A 3DBRB 1Y82A 4GKBA 1U8UA 4I55F 4OHZA 4K3VA 2IU3A 4QWMA 2XRMA 4RVNA 4X92A 4IQ8A 4EHKA 1JQEA 5BVHA 3MFHA 1LLUA 1ZGZA 5DB8A 3QVOA 2P0AA 1VPWA 3JPNA 5J0OA 1NVVR 2JAHA 4G4SO 2ZZMA 5JD6A 4J76A 2PL5A 3RAXA 3CN9A 2B7BA 3FDZA 4B46A 4DC1A 2NGRA 4AUEA 4RAOA 1D6JA 3UMYA 1FMFA 2GBIA 2GN2A 1RYRA 3HN6A 3EASA 4ND4A 2VWGA 4P3XA 5TVGA 5B30A 5EIXA 4O5CA 1AURA 2QMOA 1ODLA 1HFJA 4NL4H 3AESB 2H1RA 4GICA 3PHJA 3MOGA 4LDRA 1XBTA 2H1OA 4OREX 4EYGA 2CV2A 3QVLA 2ZIXA 3A1CA 1XTTA 4DLVA 4ZT5A 4LG1A 4O1IA 4Y2QA 1T7PA 4PANA 2C8VA 4FWBA 4KLIA 4MDFA 4QZCA 4X8HA 4NCAA 1QSYA 3UHAA 2JJ1A 4GRDA 5CB8A 2A67A 4IS2A 1I80A 3RS3A 1G21B 5DNCA 2F00A 5IARA 3O94A 4EPRA 1OPRA 1G4AE 1NE2A 4PS1A 1I2CA 4HZUB 3FGZA 2P68A 3PW5A 5HRUA 1XXHE 3RI3A 4D9FA 1AGPA 3FPSA 1OASA 4YHHB 2FX2A 5K1ZA 3RHZA 3UJDA 3KHTA 5DT2A 1KSPA 4AWBA 3ICOA 4B3RB 4GOND 4OGGA 4JC8A 1UDXA 3LO8A 2CVHA 4AYTA 5FUMA 4R1QA 5SY6A 1SC9A 1UQUA 2QD3A 4QYWA 4ZANA 2AVDA 1I1HA 3OJUA 3OEYA 1L1EA 1CB7A 1QZUA 4EKYA 3I8XA 4YQYA 4EL0A 5ABPA 1B2LA 3PMNA 4GBJA 1N2GA 3HCWA 1PTJC 1KQGA 3SSMA 1TAGA 5T8KC 2E5LB 5D46A 2FE1A 4HNRA 2Z5VA 2ZVPX 1L5FA 2JGJA 4G4IA 4URYR 4AKTA 3WA6A 4QZDA 2FFRA 2DR2A 4DG5A 1WXFA 4BKPA 4W1PA 4CQJA 3T1TA 4S05A 3IN5A 5B3JC 1C81A 4ZV7A 1NF9A 4QZ9A 1D4FA 3U37A 3HHPA 1LPBB 1JWBB 1O54A 3GQBB 4I5GA 5CNJA 3RT1A 3EC1A 4MO2A 4MH0R 4B0PA 2ID8A 2VCEA 2AJ8A 4Q02A 2VRCA 4WCVA 2W2KA 4OG2A 5GTIU 1CUDA 1AGRA 1ZPDA 1IY9A 2ONJA 2GFQA 2HNBA 3KL2A 1EA5A 1ESZA 3Q8QB 2XHZA 5IT9A 1KAOA 3PPXA 4LHYA 3IP8A 4GSYA 5EMNA 3I28A 3CO0S 2B7CA 3TLYA 3QG1A 2NG1A 1QO7A 2HIMA 2OOKA 2X2PA 1FFVA 3OQIA 4IJ5A 5WRFA 3W2FA 2AOUB 4G5HA 3F5SA 4E03A 2ZUSA 4PX5A 1CEXA 4HLUA 3WGLA 3CZCA 4I99A 4ZCMA 1FDTA 2FWIA 1DXYA 4LI0A 1F6DA 3HKCB 2EEPA 2X7JA 3IDWA 5AD1A 3OQ6A 5B58T 2TMKA 4D42A 5IDXA 1PTJA 1N6HA 2NNWB 2XIDA 1L3BA 1ZQKA 1E7YA 4PNHA 1J49A 1JLSA 1WSDA 3HGQA 3RYIB 4HQ0A 1FU7A 3GH3A 3PYLA 4LYJA 1D8AA 5DOZA 1JFSA 1I0ZA 4QRDA 3ZCXA 2JBHA 1NZPA 3A05A 4CIXA 5LPNA 4PVDA 3UAZA 4PZCA 1GJRA 2Y0SF 2O0MA 3INNA 4UUPA 3VH4A 3WY9A 1HJPA 4RACA 1ACMA 4BV9A 2BZGA 3K5PA 3QVJA 4BO1A 4DLNA 3PW4A 1MC8A 4PZLA 1F2TB 2CYCA 1XS9D 1DPGA 2JATA 4LOKA 2A3VA 1D8BA 1Y8RA 2QYOA 2E3JA 3PRKE 2ZQZA 1QSLA 3T5BA 1Q3TA 4LRXA 4JP5A 1GAXA 3PL5A 1VKZA 1HEYA 4Z7QB 5ITVA 5IM4F 5CGZA 1SD1A 1XU4A 1UKVY 3Q8XB 1TTQB 3PWZA 1V1RA 3UA4A 5CEFA 2GNAA 1RR6A 4BATA 4C2TA 4K5QA 1EZ1A 8ICJA 1MXHA 1P3JA 3LNTA 1H8HD 3RR8A 2NACA 3PLRA 2X9NA 5E0OA 4UBKA 4JJ6A 3FZQA 4QD3A 2ASVA 3T9DA 1J21A 1HDYA 3DEFA 1YKGA 2P9HA 4BQNA 4YJDA 4CTNA 1YHNA 3VR2D 5PNTA 2HRBA 2PWAA 2HJVA 3AJRA 4NSNA 2CXTA 4DSLA 1A95A 1G3MA 2DTXA 3JZIA 2AMFA 2WFLA 3E2PA 3MCVA 4RS3A 4TQUS 3H4IA 2P3SA 1N75A 2KV2A 5FUBA 3SHVA 3U3DA 4BE9A 2JAUA 1GXSA 2OHFA 1UPFA 3DDNA 1AA9A 5C5JA 1Z25A 2BD0A 3QVKA 5I7OA 9ICCA 2XOXA 4EHNA 1Y42X 4HTFB 4JQCA 4K8OA 3K0SA 2LD4A 1JHZA 1N8KA 4DLEA 1B4DA 2WKSA 2ZYHA 4DL9A 9LDBA 4F3YA 3BE6A 4LTMA 2VUHB 4Y9TA 1RJDA 4KOAA 5EJAA 1SG0A 4G36A 4P92A 5IDWA 3KQHA 1G5RA 2OCPA 2XGMA 1JBQA 1X66A 3A2LA 3EGVA 5LQNA 2K87A 4GMHA 2OGTA 4UB8U 2MYPA 2ZBGA 3FBTA 2IW3A 5CU7A 1D7AA 1CLUA 1SVIA 3KB8A 2I67A 1RJEA 3Q2OA 1LI4A 3A27A 5I5EA 3ZJVA 1TA0A 4Q48A 3HUTA 2D7DA 3H2JA 2RK3A 4G1FA 3UC9A 4KKXB 3DYIA 4LBZA 3AI7A 3BD6A 4L0MA 1G60A 1GCGA 3GRCA 4A8JC 2DLCX 2P27A 3FTPA 4QRHA 2AVNA 1RABA 1FB5A 1FP4A 4RGQA 2HOQA 2XMBA 1NUUA 3ENWA 3I3OA 2AMJA 1H2ZA 1LTHR 5DT9A 3M3DA 1CS0B 2C00A 3OE4A 5LYJB 1I4OA 2VXBA 3CX7A 1XMQB 4WZBE 4RZ3A 1F2VA 3MGGA 4P1ZA 4BO0A 5BWNA 2OUIA 3RVNA 2R18A 1IDOA 3H5RA 1SUEA 4BMDA 1CQXA 2EJCA 2NU7A 3IMCA 3I62A 3KAPA 2BWJA 4RGVA 5A71A 4M0FA 2TMGA 4KPYA 4ELUA 4MJLA 2ASJA 4HY3A 1TCVA 2COKA 8GPBA 1M8PA 4IEIA 3M6UA 1CUUA 3K8ZA 2WAQF 1XTKA 4RKFA 4XYGA 3BAZA 1Q1AA 5DM2A 3QPBA 2E4VA 4A10A 1BO6A 1QGZA 2P4SA 4O8ZA 1FP4B 1JSZA 1Y6FA 1E1CA 3I05A 5EE5B 1K88A 3OT1A 2XVZA 1FMCA 4I2HA 4UBIA 4W8HA 4BC0A 4KMOA 3GP8A 1EFUA 2OV4A 3BWCA 3QXHA 4ZOLB 3A6LA 3VHXB 5C4IA 2RI0A 3LBFA 4Z0NA 4TZ0A 1QHSA 2CC2A 3IIJA 4E7PA 1W44A 3OE5A 5DYWA 5CDYA 4NYJR 4KBFA 1ISGA 3ZD8A 1I6KA 2AU0A 4C7XA 4BNUA 5B3LA 1OH8A 2IUEA 2B99A 3OKFA 1DE0A 1H94A 3UAOA 4IGEA 2EW2A 3GT3A 1LLDA 2CZCA 2WHXA 4OM7A 3ZLBA 4HNVA 2HV9A 2XH8A 5EIAA 3RLIA 3H75A 2ZXUA 2ODNA 2FK7A 1R5BA 4RNNA 3BTOA 4NLNA 3QPUA 5DX8A 2R6ZA 4MVXA 2E55A 2K8AA 4LV8B 2IYNA 2FLVA 2VDKB 2JFBA 2GXSA 4JWKA 5ESWA 1R2QA 3VDXA 2GM9A 2QRKA 5CT4A 5HIIA 2VK8A 3TZ6A 1XFAA 3UA3A 4ZFNA 1C3JA 1EEHA 5IFKA 3NO4A 1PYOA 1W5FA 4NFSA 1ABBA 2DWCA 3D3WA 3SEFA 4NK4A 3BHMA 3EPJA 3A9VA 2QTNA 4BV3A 5JNLA 1AKYA 1ICEA 3NT2A 2NPIA 5A03A 1KZ9A 3CT6A 4ND7A 4WZAE 5DIZA 2A94A 4PLCA 3F3MA 4CMIB 5DGTA 5LZ9A 4RTNA 2QM0A 1PUXA 4U7FA 1TXGA 4LYYA 2AG6A 3F97A 1U9IA 1YJBA 3U3XA 1DV2A 4I2FA 3FNRA 3CUVA 3TARA 3GZJA 2AD5A 2VP0A 3BS5B 4NV3A 4XM0A 2OWOA 6ADHA 1PDOA 4WDQA 1UZLA 4MQ6A 4BZWA 4E1AA 4ZICA 5IN4A 1XVTA 4RU1A 1HNZB 1O9HA 1A7KA 3TLKA 4NBLA 1RLIA 2HA7A 2XTJA 5J59A 5C37A 2EX1A 1NATA 4U39A 3GX1A 5DHRA 5HNKA 5KG1A 1I2DA 3KDSE 1NMYA 3N6XA 4POAA 3L8DA 2YQEA 2D5BA 4EQZA 1N34B 1H2AS 5IDYA 5CFLA 1P7PA 3JSXA 2W2QA 3UICA 2VHXA 2JFQA 2QL6A 4HTAA 4BNYA 4O2AB 4DEXA 4Y2XA 1MO2A 5L3RA 2CDRA 1Q11A 3THOA 3BXXA 3VPAA 5K0CA 2VZ8A 2CFRA 2ZRKA 4MA5A 5FBWB 3MWJA 3PDIA 1I2ZA 1IM4A 2DQNB 4WLNA 4HQRA 4X1OA 1G3IA 4GYKA 5G02A 1JIHA 3CRQA 3VO8A 3RB4A 1MAWA 1CUKA 2OQVA 4DLXA 2FYTA 1P7CA 5DE3A 1UQVA 2O8BB 3OPMA 1VSUA 3JZAA 4P7FA 2DG2A 3IAM6 2R4UA 9ICRA 2FPGA 3K5HA 4CI9A 1NU6A 2HU2A 4PYMA 1T4BA 4PYRA 5LZ7A 3BZWA 2BEUB 3Q9LA 3IC5A 3VX4A 2NZYA 4X61A 3HU5A 2IE0A 4EYSA 4QC2A 1O87A 1C7FA 3IE2A 3A6PC 3E3MA 3ZV4A 4BVBA 4YMHA 3NBMA 2G9NA 5KJ6A 4ZHQB 1NUPA 4N65A 4TQAA 3ESBA 3WO1A 2JBAB 5DQHA 3FTFA 5CA1A 5KQMA 3V8EA 2JGRA 1PWZA 5JZSA 2BMEA 4KX5A 3QFHA 5FBZA 1GKIA 1K5DA 3CRW1 1QJCA 4FDVA 3ZCUA 1X86B 3FNQA 4R1SA 1IQPA 4I9HA 1J1ZA 3NBAA 2CL5A 4E14A 4PLGA 4UNPA 1XVAA 1LBIA 2JFUA 3IA7A 5DGCA 2F44A 5A05A 3QHAA 4GP6A 3HTXA 2EQ5A 3DZHA 3Q4GA 4DFJA 2HUPA 3A4YA 5IXSA 3C3PA 3COWA 1CSEE 3QMMA 3I5XA 1Z2NX 5F77A 2GKSA 3NQ41 1GD1O 5H02A 1MAHA 1DAFA 1R0YA 2MMCA 4UMFA 3D8TA 5LZ8A 4R9RA 2DFKB 1VMAA 3IQXA 2W43A 4L73A 4A0QA 3R7NA 3WLNA 4KH1A 2P67A 1EH5A 2E7ZA 4LY3A 1BX3A 3C3AA 3MJVA 1QU3A 4DLAA 3A1TA 4ZGWA 4GH5A 1G8JA 4IDDA 4ALKA 2BFPA 2ZYIA 5CG1A 1XZKA 3UHFA 5AW0A 4U0KA 4NICA 2YZNA 4YJFB 2FP4A 5B2ZA 1N32B 2KI5A 2KE7A 2CY0A 2PZJA 1MKYA 2RAFA 2YS7A 3WWEA 3OM8A 1RT9A 2BMWA 4O2BB 1MC5A 2GM5A 3KZCA 3DO6A 2J4FA 1B76A 4FNOA 3D8UA 4NULA 2ZB8A 3D5QA 2HDHA 4Q01A 2Q5JA 4M9HA 1GKYA 1RMTA 1EK0A 1ESCA 1YHZA 1NLYA 1V7QA 4DHEA 1DQRA 5AM5A 1I1OA 3L0BA 1PEAA 1RMYA 4Y9SA 2Y1GA 4KXQA 3ISCA 1FRFS 5HIAA 2GBLC 1N2CA 1YJXA 4BN4A 1XP8A 4BDSA 1EG7A 2QE7A 3KJGA 5BMOA 5F64A 3GC6A 3H1EA 1FSPA 2PGDA 4Q3KA 1VA4A 5DNDA 5E9QA 1DKNA 1JB9A 2DWUA 4QQKA 5T6BA 2IYPA 5HTKA 1YGYA 1Z1VA 5CDGA 2EIXA 3G2QA 2GCOB 1YVDA 3WGZA 3JQAA 2NPOA 2CLFB 1OGJA 3LPAA 1Y9AA 5IKEA 4RKWA 3AF6A 4US2R 3VOSA 3I2GA 1Z4MA 4PAOA 3QPVA 2JZNA 3TQQA 4E4RA 3EYAA 5LVAA 1WXHA 4I81A 5BSUA 3M8KA 2EFGA 1U4NA 5HIKA 2GRJA 3MCTA 3OZWA 3PNSA 3W2TA 3A10A 4UNRA 5JDIA 4FYPA 1V8PA 4X90A 4CEHB 1I13A 2DFDA 4A5OA 2Q9CA 5A3SA 2ZUFA 1ZQXA 1VGVA 3I2FA 1HE5A 1VLQA 4RAQA 4M0KA 1AZTA 2J3HA 2WP0A 2QSJA 4IS7A 4GXIA 2JZBB 3AHJA 4C4SA 2ZRGA 1H0SA 5EGNA 1V5FA 3O93A 1E3IA 1XJWA 5TB5A 1SVMA 4FZMA 2B4QA 3M1AA 2O50A 3LVVA 4LXTA 3R75A 1PN3A 1SXHA 4EVSA 4OH7A 4P3OA 5KKNB 3IHQB 1DWPA 2BR0A 4KNYA 4L72A 3FCEA 1KE1A 5KMGB 2P5TB 3E4DA 2VOJA 3G2HA 1KVUA 1LLCA 4P4TA 5FPSA 3K71B 1CU1A 2P6PA 1UDBA 1ZQHA 3ELUA 3D6MA 1J5XA 4DDWA 5HR6A 2XX3A 4DIUA 3R41A 3NHRA 4HXFB 4ARCA 1KP9A 2VF4X 2VYVA 2X6QA 2MU2A 3H2IA 1K1EA 5FI1B 3AUSA 5EE0A 3QVUA 1NLUA 1RRMA 1KJIA 5CVVA 1XTRA 3AVPA 3IP7A 3PJDA 3II6X 2JCYA 1QS0A 1BDBA 5L7YA 1AXEA 1ESMA 2O2CA 1A5SB 3VPGA 3ZCTA 2D5LA 1E2IA 2P90A 3LUJA 3L7AA 3ROEA 2B30A 1T3QA 4E5PA 1DP4A 3MGBA 5IXYA 3Q5DA 3HLKA 2BGNA 4MV4A 1KKXA 2Y1XA 5L3SA 2IYXA 3NUQA 1P2UA 2R60A 3H3XA 1QRSA 1JQJC 1U0FA 3OWOA 1WSWA 2ZJAA 4FDLA 4HYQA 1W4RA 3LBIA 3PXXA 5D3MB 5ADVA 5KO2A 3F9CA 4QEKA 1CKEA 2NLOA 1EZ4A 4X7BA 2VPIA 3REQA 3PRJA 2VO1A 3HGTA 1PLKA 4UEJA 1EU1A 1Y4DE 2CLIB 2F4NA 3AM1A 2PWBA 4ED1A 3OBIA 2QS9A 1JHVA 1F5NA 2Z3VA 2JEGA 3OWXA 4LCEA 3JWPA 5ESXA 3V1NA 2QTHA 2VEOA 2FLNA 1C9NA 2R1VB 5JNVA 1MFZA 1ZETA 3BIWA 5EAIA 4O4IB 1L3TA 2XODA 5C0OE 5KWVA 1P8AA 2KEYA 1AO3A 2VP6A 3EBPA 2JIQA 4M9RA 8LDHA 5E6SB 3T7CA 4DANA 5A4JA 3HB5X 4RADA 1RCFA 1UKYA 2AG0A 1OD6A 2GX6A 5IP5A 5FP0A 3CRXA 3PEFA 4X20B 5EYPB 9LDTA 1LH0A 4YJGA 4OYHA 1PJ4A 4YJHB 2AHOB 1JX6A 2VR1A 2GJ4A 1USWA 3M6AA 1QTNA 2R8RA 3ACDA 4FJ1A 4JYPA 3LT2A 4L6IA 5GADl 3P27A 5J8YC 1YT3A 1QZXA 4JIMA 3EVNA 4K6OA 1HDZA 3EFBA 4G0ZA 1MJ5A 4PW0A 1KKMA 4TS4A 4UEOA 3N74A 3PNVA 3PGXA 2BYTA 1FYXA 4CF3A 4TUQA 2AD1A 2R5FA 4J0EA 1T36B 2ROQA 4KLNA 4G41A 1MGPA 5IWAB 4QODA 5FUXA 2AF4C 3FMPB 1EA7A 1ZZEA 1XAIA 3TRHA 2ZCJA 3BICA 4UUMA 4ZVUA 3M6ZA 4MS1A 2OCEA 3TTWA 4KWTA 2CLSA 4LJYA 2QR2A 3DWFA 1YVPA 2ZB4A 2IHZA 3P2YA 3ZDBA 4M9ZA 5BPHA 2J9FA 3QY9A 1W94A 2KHZA 3F8WA 4WXEA 1NKSA 1XYVA 3M7IA 1GAEO 2ZJZA 1M6VB 4RD0A 3KYCB 3WSVA 5MFZA 2OBXA 5K0BA 3IJEB 1RTTA 1C0KA 5AM0A 4IXMA 4Q7JB 4ECYA 1J06A 2IFTA 4NRDA 3C43A 4UBNA 1COKA 1KFBB 1UADA 4QWBA 5JMOA 4TS9A 3QI2A 2OY0A 7YASA 1L6NA 1NW4A 1WMAA 3KZNA 4N82A 1N5LA 4HBZA 4ARAA 4CL3A 5U1PA 3V34A 3ID6C 3HN2A 3M1LA 4QGAA 3IOBA 2YJNA 1T6XA 2ES4A 1BU5A 3FPHA 2LZ0A 3BF8A 2V7UA 1CCWA 4H1UA 4E08A 1IZ0A 4EO9A 4YPFA 4DXHA 1I51A 1RE0A 5ENDA 5F76A 3VNAA 2ZTEA 1PFVA 4MQFB 3WLEA 5MN4A 4P3NA 2G07A 2W6QA 3LQRA 3C5WP 3KEQA 1A69A 3HT3A 2P4HX 4IIFA 1P4AA 5IBPA 1VHQA 4C2AA 1E1YA 3T79A 3INRA 3F6BX 4ZOBA 5B12A 5LUAA 3ZYZA 2BFWA 4Y0NA 1G2OA 2XA2A 3QM1A 3DAPA 3ROMA 2B8NA 1QORA 3FB4A 1XIVA 4I1OA 2E8OA 4IUDS 4JWTA 1Z5ZA 2J1LA 3AKZA 5AKLA 2BUAA 4HWPA 4H31A 3T4XA 1M7GA 1XTIA 5BRJA 2OC4A 3JQRA 3WIUA 3SYMA 4Z7OB 1KQFA 4HSGA 4WD3A 5KT5A 3UT5B 1YRQA 5J0SA 4BNKA 5MFPA 2JJ1D 4FOPA 3ZOZA 1T0JB 1E5TA 1Z45A 1FVHA 2O2IA 3GVIA 5KAIU 4U3JB 4RFSA 4I6JA 1EVYA 1GIAA 3IOCA 4D43A 4EG0A 3GFRA 2CMKA 1QANA 2XMGA 1ZGHA 2CXXA 4K05A 3IDZA 4A8JB 4AF7A 4B85A 5IASA 3PNYA 1ZD8A 2IHUA 4OXIA 2MYUA 4IILA 5KOYA 9MHTA 3PZBA 2E5SA 1RLOA 2H5JA 1N6RA 1CQJB 2ZULA 2LNDA 1WUHS 3R9WA 1U3UA 1BGVA 3EW9A 4MW7A 3UJ8A 1GN8A 1QIFA 2ZSIA 4IXNA 1K7FB 1NG1A 2RIPA 5DYGA 1WMBA 2C57A 4UHBA 3NEPX 4YUYA 3L0YA 4YLYA 1QIJA 1NAIA 4J2OA 4O5OA 3SR6A 1K5PA 4WHMA 3IIMA 5REQA 3ZGXA 1WXQA 5DK6A 5AVZA 2J6CA 1XQ1A 2VJCA 3VZDA 1P0MA 2I54A 2Y1JA 5J2AA 4F5DA 3OPYB 2Z08A 4LQCA 3RVJA 4Z2AA 1CZRA 3RSCA 5A62A 4J1QA 3ZCRA 2D06A 2C7OA 2LKCA 5EEGA 1JQAA 2ZJ4A 2VYCA 2NW6A 3TIIA 1S7CA 1WWKA 1NV8A 1MNAA 3EGDA 4EX7A 3L4PA 4P2HA 1E2JA 1YE3A 2EEZA 2OT3B 1CUSA 1DUIA 1WXGA 1YRYE 3D5TA 3JQGA 4Z4CA 1GPLA 2FZWA 3T7KA 4UQOA 1BCRA 3AFOA 4V0NA 2C0QA 5F1OA 1A0OA 3Q6NA 3TUIC 5FX2A 4PZPA 5AVTA 2YMMA 1KWGA 3CUYA 4HO1X 3ADDA 1WF3A 4KODA 3KPUA 3EIXA 1RM0A 3HKDB 4UEWA 2VTBA 1A0PA 3HB7A 2E0IA 3RAPR 3UNXA 2Z8YM 4MJXA 5EJ4A 4LJAA 1YI0A 4LWPA 5G0TA 4HK4A 4QJFB 5JTIA 1US8A 1FRZA 1UPUA 2WM3A 3IUPA 1PJZA 3K1AA 3PJEA 4LK2A 2OFOA 4M8IA 4QFDA 5ETJA 2F90A 5LQAA 2BFEB 4IIYA 4BQRA 3PENA 2M9NA 4XUSA 1MMFB 7ICVA 1K3FA 3ZHYA 1KC1A 4EFNA 3HHEA 2PKQP 2WWIA 1D6MA 1FFBA 2MDTA 1MB2A 5JAHA 4MV0A 3G3EA 1PS8A 1ODSA 4IIJB 3UV3A 4YVZA 1M8GA 4BNNA 2BMFA 2G1KA 3HJHA 3RH5A 2XUKA 2YJ3A 1CRQA 4M7PA 4EZ6A 1K27A 3U4HA 2LW7A 3T3HA 3HFRA 2VDNB 3DTTA 3NTUA 4H6VA 1GNVA 3MRTA 1GYPA 1JTVA 2ZDHA 3A4NA 3HUFA 4GUAA 4MI1A 5FNVF 5HQ3B 4ZO8A 3QNWA 1SXIA 1KMCA 3W77A 3NBZC 4EK9A 1QG2A 3NM6B 3H87A 1JDUA 1GGKA 1TM5E 4EYHB 2VWHA 3G2OA 1A98A 4WBNA 4YXJA 5DN6D 4YEDA 5FLKA 4ZI5A 2IX3A 4ZAGA 3L0IB 2NQ8A 2OAEA 5I8WA 4M0LA 1ULUA 5EHZA 3H3JA 4UTVA 4JI3B 3R3SA 1JRLA 2B69A 2X13A 3FAHA 1K89A 3IXLA 4HNUA 2HHHB 5JALA 4IJUA 3GG2A 4GPEA 3IP4B 1NN1A 1RI3A 3K35A 3LPMA 2ZIWB 4FQ7A 4MCAA 5EPUA 5K0FA 3G0HA 2Q4BA 5LSAA 3R76A 2JAOA 4Z9AA 2H3ZA 4KN9S 1K97A 5G4KA 2EW1A 4XB6B 4JV5B 5IM5A 1EFCA 2P5YA 3NNSA 3CPEA 3KZMA 4F8EA 5DYTA 3U3RA 2VDQB 3PWKA 4RD3A 3ASVA 1XL1A 2DFPA 2XYVA 3FWYA 1FUUA 4NCXA 1ZG3A 4R7GA 1RKUA 4F5PA 1W0KA 1X1CA 3IB6A 5KFKA 3R5JA 1K5GA 3G2LA 4BDTA 1K7CA 1RJWA 3NEYA 4X66B 4C8MA 3S3TA 2JB9A 9ICLA 1UFOA 4NESA 4BC1A 2UUBB 1EZZA 3FDXA 2O7VA 1S77D 4OQLA 4X8MA 1JG2A 2E37A 5D00A 2H3IA 1Z22A 2V03A 2WUEA 5CVUA 1M0WA 1HO3A 1GT91 1C7IA 1BX0A 3PO4A 2JD1A 1HWYA 3W7BA 3Q41A 1OKKD 1P80A 1LDGA 1X1TA 3BMCB 4KJZA 4RVFA 2NU8A 5GP1A 2JZCA 2QLFA 4TS3A 3CTPA 5G5GA 4B79A 2YJTD 1OUQA 3H8WA 3WL4A 2JLUA 1L4FA 1QUEA 3EA5A 4L75A 1BE1A 2QN9A 6NULA 1MX9A 1GT6A 3QEKA 4FPXA 5EZYB 1I7DA 1VE6A 4F85A 3V7FA 3VGPA 2Q2NA 4NR0A 5EP2A 1W2GA 1KWKA 2VF5X 2V4QA 1VG0B 4N5IX 4ZOEA 1SBIA 2P9EA 4G0WA 1Y48E 2YVAA 2NP6A 4DA4A 1GLGA 2IXDA 4L4SA 2PLAA 4EFKA 3PMLA 2HK7A 2RI1A 1R8XA 1H22A 1N57A 2V4RA 2F8MA 3LQYA 1B0ZA 1JR3D 1Y7HA 3LIIA 4Q5IA 3SSNA 3TCNA 3NVVA 2QZJA 4RLSA 1ZX1A 5BSRA 1R9GA 5K99A 4BGDA 2AGVA 2CDNA 5F3WB 3I30X 3UAWA 4MGYR 3V6JA 4JLWA 1SU8A 1L3SA 1W75A 2OE2A 2R8PA 3B9BA 3THYA 5KKAA 4GVXA 5GAJA 3SICE 4IF6A 3O4VA 2Y1EA 2QRNA 4OBWA 4CQMD 3M9NB 3N7UA 1AMNA 5JQGA 1G6Q1 1FYWA 2E21A 2AXPA 5JEDA 3KYDA 5A4IS 2C9MA 4JI6B 1E59A 2OFPA 4HVLA 4BQPA 4MRPA 1G20B 3K5WA 1KQQA 1OZ0A 1EUZA 4TKZA 1RS0A 1VCMA 4Z3DA 4TPKA 1Q84A 4DJEC 4N0EA 3Q8KA 2FSVA 4OQDA 4WK6A 3FZEA 2B6GA 4AP6A 1VJ1A 1PT5A 3E27A 4L8VA 5D5QA 1A27A 2GH1A 5LIPA 1PD1A 1XU9A 2NYUA 2V6BA 3DOCA 3C5GA 5TPWA 1YB1A 2W6JA 5KG7A 1HTBA 1WD5A 4JBYA 4MGKR 4CMBA 2XDQA 1J20A 1LQUA 2FOLA 2OV8A 2PMEA 5JCJD 1XTQA 5J1TB 1SUBA 2LTAA 2WMNB 3MPUA 1NMQA 3T7AA 5EKDA 1LC3A 3RSGA 4CDGA 4ML3A 4R0MA 5JQGB 1RAAA 2XBMA 1PEKE 1WO8A 2OVFA 2W70A 2ZYAA 3TQCA 5B2EA 2RIRA 3G8YA 1KQPA 1OI4A 4M9CA 2G6BA 1AKEA 2EDCA 2X9VA 5DBGA 3AIOA 3VHQA 1IWOA 2ATIA 4EBEA 2J9GA 4QO8A 5GOZA 5JNRA 2I2XB 2P2DA 3AFIA 1LBHA 2BHSA 5KFOA 1USGA 3KEFA 1KJYA 3BWEA 4EM6A 1NQVA 1JHUA 4IC9A 4UB2A 3DHEA 4YBRA 3WLRA 1M7HA 2DJIA 4GKVA 3P5SA 4AG5A 3JR7A 4H59A 1WMSA 3AR2A 3KKOA 3TIFA 2VHVA 1LPMA 2QKQA 4ECWA 4ECEA 3CLRC 4TWZA 3DW1X 3QTLA 3AXSA 2FSHA 1P9WA 4UPVA 2W2XA 2YN0A 1KTQA 3BOSA 5BSFA 1FTGA 1E2LA 4JT2A 2XWSA 5GGXA 3EZ5A 4B9LA 3WJ2A 5C7YA 4K40A 2EARA 2UKDA 3VV3A 4WV3A 3DO5A 1TO2E 2V3CC 1TCAA 3SF0A 4JC5A 2I03A 1TVCA 4CIAA 3BSSA 4KZPA 2CJYA 3EGXB 5BSTA 1RQNA 4LJ7A 5B55A 1XSEA 3H0MB 4ZEMA 4MUAA 1SCAA 1TX4B 4LE2A 2E4WA 5F5NA 1WW2A 3PTZA 1QM5A 2VDOB 1E8DA 1U04A 3BQNB 3VJLA 4UHJA 5KUTA 3TD9A 4R6XA 1MCZA 3E1KA 4YV2A 1NJFA 2KQUA 4L51A 3D0RA 3U3JA 3C2LA 4IFTA 4ACOA 3UWMA 4DXDA 2DKOA 4Q1CA 1BWPA 1E8MA 3TIXB 3ZLJA 2FPIA 1XT6A 3KLPX 3RKSA 4CYMA 5JARA 3HY3A 4K9RA 4BAUA 4RU9A 3OZSA 4F12A 1UCVA 1XVLA 1G8KA 1NW6A 1X1RA 4AW9A 1YR7A 3I2KA 4E5SA 2QLJA 4AUNA 3O47A 2YWHA 3NBQA 5GJWC 2GEFA 1WY7A 1TF2A 1GZ6A 2IC5A 5L8VA 2O48X 4PJ0U 1Y1LA 3OZGA 1ZOPA 2JLZA 3UEOA 1GPH1 3LY8A 3FWNA 1YQWA 1P2DA 2UZAA 4FDMA 2ZSJA 3W4JA 3U56A 1ENOA 1ZW6A 3RU2A 1ACJA 1BJKA 2H06A 2ZSKA 3MBIA 3JQBA 4M8LA 3WFJA 4AZ3B 5JMPA 4B83A 2W03A 5C7OO 2E6KA 2FW9A 4NQRA 4WINA 3NVMB 1KY4A 4HMOA 2GAIA 2P91A 4GLOA 2UAGA 3K4QA 3D0OA 4CM8B 2X0EA 2N47A 4EYEA 2I22A 4DQKA 5HQTA 1M1YA 1ZA2A 1NUHA 5F3RA 1D03A 4BGIA 4F11A 1RXUA 5AHWA 3KALA 8ICVA 8ICSA 2IDMA 2JBWA 1VLBA 2VPQA 4M1OA 4ND5A 4YJ2F 5B1IA 1E79A 1YVRA 2QRGA 1V48A 4FN5A 2HHTA 5GMOA 5TQ0B 5HUQA 5AI9A 1Y80A 4CQNA 1MENA 1W47A 3JQDA 2HREA 3U4QB 4R5MA 4TSKA 5B4VA 4CKWA 4ECSA 1GU1A 1ZCJA 2ALZA 2IZ5A 1BRTA 4CUZA 2RE8A 1YK1A 4N76A 4DKXA 1Y8RB 3MEQA 3VDMA 4AJKA 5KFQA 1M1YB 3LNCA 4KYVA 3PXUA 2WAXA 3VPFA 5FWYA 1PQWA 2PWZA 5HYVA 5J0QA 1GN9A 4Y18A 5I9TA 1M72A 1TYCA 1U7OA 1WABA 1HYBA 3NP9A 4E21A 1XI2A 2QDXA 5IZCC 1C9KA 2QLLA 1BNCA 3A1SA 4WAUA 1CUEA 4RX1A 3V3TA 4I4TB 4N0DA 2L0XA 5EWMB 4EW1A 1H5QA 2B0JA 4B9SA 3STXA 4AICA 2IU4A 4QHTA 3V8NA 4EB6A 3EGCA 5AW1A 5K0GA 4JL5A 1GFWA 4S35A 4BWMA 5BNIA 4DA9A 5CVJA 3SS9X 1X1EA 2H3QA 3WIDA 1RHRA 2P6NA 3FHTA 5J4HA 3SIPA 3DE0X 4PGQA 1P31A 5A6VA 4P0QA 2R9VA 4PLZA 1J2YA 3F5FA 3LPNA 8ICXA 2BE7A 3NOQA 3HKCA 1G0NA 2BBTA 3PI7A 4O02B 1D4ZA 2D0IA 2LMRA 3EFOB 3FMFA 2NU9B 4MQ5A 2PUTA 1TU0A 5C8ZA 4GKAA 2Q7XA 4F96A 3ZDYB 3HPOA 2PU7A 5G0WA 3V4LA 3KC2A 5F9LA 2ATXA 3QE3A 4K3UA 4YGYA 4FBUA 3AF3A 3DVAA 1OU4A 4QICA 2AK3A 1VLHA 3GGSA 2JIRA 3MRXA 3ZWPA 4F2DA 2G36A 1C9DB 3EVBA 1KPGA 2VRNA 4N3BA 4XD7A 3RAFC 1I2BA 1IVYA 3ZH9B 2OCAA 1S9FA 2A30A 4IO0A 4ZKDA 4DBLE 1JQDA 1Y89A 1OPXA 4PYIA 4WFQA 4IDHA 5LP6A 1EGQA 4IIUA 5KG3A 4YUVA 5JS2A 1UUFA 3IBFA 3PDCA 5FWNA 4D99A 3MFIA 2OK8A 3D7SA 3ZNQA 4FCTA 4Z9YA 3I61A 1HEUA 4ZT6A 1EEXB 1RYDA 4XIJA 3W8RA 1SB9A 3N76A 1KYTA 1VG1A 4KXMA 3OCZA 3AF2A 3U7QB 4J8PA 3ZXYA 1JVNA 2WYIA 4AJ2A 3LHKA 2FXVA 4E2XA 5IILA 5AVQA 4IFEA 4Q7MB 3QVMA 3AHGA 4QU9A 1QR2A 3WWZA 3RTVA 1X77A 4UOEA 4I2VA 5JSZB 4G5GA 1M5RA 1K68A 3OZUA 4BKOA 4OJOA 3PRYA 3IVCA 1C8BA 4I50F 5LP1A 3NHSA 1JPNA 3OCXA 1LFDB 4PHTA 5GQSA 4ZQCB 5AFSA 4EW6A 3V3KA 3T12A 1ZC4A 4Q34A 5DOVA 4LZJA 2NTNA 2XAUA 2I76A 4LNUA 4RH3A 2PYDA 3IXMA 3VZQA 4OATA 4X71A 1HE1C 3EDCA 4MHSA 5EIBD 1ZCBA 1X9HA 5EP4A 1V47A 1MC1A 1SKBA 3SS7X 3RC9A 3PSFA 3TB4A 4PSCA 3VZRA 4KRYA 3ZU2A 1N5OX 1CUGA 3ONFA 4OQNA 1RFLA 4Y1RB 2KZZA 1XUOA 1JQKA 4GXRA 4BP8A 3K70C 2CZQA 4AUKA 1WOMA 4E7OA 4OCZA 1BHJA 1SV4A 3D6TB 3E8XA 4P84A 3NFYA 2PNFA 3KOWA 2AK2A 4INPA 5K45A 5HKBA 2EW8A 1MB9A 3C3XA 3CWQA 1JL3A 2QM3A 1EUCA 3PQ3A 2PUBA 2YL2A 4BLOA 4F4UA 4IDQA 1I6WA 1FX1A 4KTQA 4BKMA 2J9YB 4CVNA 3SNKA 3SDSA 4YMUA 4GC7A 2FJPA 4N48A 2YMPA 1E3SA 1YZNA 9GPBA 1GTL1 2PDAA 4S3MA 3Q12A 4RMIA 4OHPA 1YF3A 2WSSD 1Z36A 1GFZA 3DEIA 3BXZA 3IS3A 2FVXA 1QP8A 1V3VA 3FUWA 4CV1A 2CHVA 4PPFA 2XT9A 3AESA 3QKSA 2VQSA 3EZ6A 4IHQA 8ICYA 1C2YA 3CUEF 3VU9B 1JDZA 2PT6A 3BJYA 3G2JA 2IL1A 1SD2A 4MR7B 4O1HA 3KAQA 1DIGA 5K3FB 3VGJA 1EXVA 1DK3A 2LVBA 1NJ8A 1LRJA 4Q1FA 1OJLA 5FOVA 8ICEA 4QJ5A 3TKYA 3TAPA 4L6CA 4UREA 4DLBA 1U63A 1M2OA 1DWQA 1MO4A 2ZRBA 4NMMA 3CMMA 3A0UA 1IONA 1RPTA 2P4UA 3IKTA 3CY6A 4FKBA 2VPYA 3NHZA 4M98A 3BK1A 5ALVA 1K4KA 3E9QA 3KJQA 4B31A 4F7DA 4RJTA 5FOUA 4CBVA 5BNZA 1JMVA 4MVYA 1LK0A 1LX6A 3O0TA 5BMVF 3HBAA 1OLSA 2ID7A 3TPCA 4V2UA 3WYEA 4PC6A 1EK5A 1XRLA 3ZC3A 3R5SA 4TZ6A 3LRXA 2IQIA 2R5WA 4MGZR 1MHPA 2GZ1A 2XQJA 1BS2A 1S1MA 1U02A 3LWBA 3CNOA 1NG9A 3HS3A 1ZI8A 3NGLA 2R7MA 4Y6LA 2VRBA 4BN5A 4NU5A 4RPJA 4R2MA 2OWEA 1ZKMA 1CT9A 2VJ5A 1H05A 1NLZA 2D4AA 4Z6DA 1DJPA 3JZMA 2ID4A 3MD0A 4C0XA 1YE8A 5C8XA 2C99A 3EE6A 3L4EA 4BEVA 3HKEB 2WABA 2X3YA 5MGNA 3C4VA 2ST1A 2B9VA 3AMZA 1K6MA 1VPLA 1B8NA 3AETB 3DW3X 4N12A 4BBJA 2G3YA 5J2IA 3TTTA 2C82A 2G5PA 3DF7A 1KOGA 1TF7A 4Q4DA 4KAXA 4NFYA 2O2ZA 2ZRAA 4RKYA 1KMIY 2YXBA 3IUMA 4WFJA 1D9ZA 4OMCA 1G5QA 5D4BA 1P5RA 1IL0A 1L7QA 3MJSA 4P31A 3T6KA 3ND5A 2AUNA 4XDYA 1XTPA 2H4ZA 4TT8A 5E8RA 2PO7A 5BWOA 2OGSA 4JLJA 2VHTA 4EUEA 1AKVA 3VYUB 3ZQ4A 1BPBA 2BZSA 4D6YA 3OOHA 1UBFA 3R3XA 2C2XA 4IDOA 1HL3A 4Q4AB 4R6WA 4FK8A 3BWBA 1PEDA 3DBIA 2VA2A 4QFMA 4X20A 4ZZ0A 1QP7A 1C3OB 4DCUA 3JD1A 1NOJA 1R3DA 4RTLA 4HDRB 3H1TA 4RZXA 1KSHA 4IDNA 4RE5A 4EDFA 1P19A 1KL7A 4JGBA 3L4KA 4HATA 1J33A 4FFWA 3TXXA 3EQ8A 4F4FA 4F3TA 2WTXA 2X58A 1Y33E 1SGGA 4LJRA 3A32A 3QF7A 4MB2A 1EFPB 3WWDA 3V7YA 2JLBA 3NCHA 4ARUA 4C5AA 1PK1A 3PK0A 4EOGA 5KDOA 1DC4A 2BI8A 1FIUA 2PS3A 4NARA 3ASUA 3N53A 4WKPA 4I2AA 5KNCA 3VPCA 1SIUA 2CXYA 3IHKA 3Q11A 3WAKA 4QUDA 3VTZA 3QUAA 2VYVD 4G0UA 4OB6A 5LJLA 4EYIB 2G7ZA 1R74A 2ORVA 1ST2A 8ICFA 3DT9A 4NOLA 3C97A 3WYFA 1UJMA 1SRQA 4ZGGA 3TTVA 1A88A 1VXOA 4U9HS 3VYSB 1NKBA 1BCSB 1O6CA 3CQ9A 4D9BA 4E07A 5HJ5A 3BS5A 1YU6A 2WR8A 4YP0A 1WXWA 3GGOA 1O9BA 1L4YA 2A5LA 3F8TA 4YNBA 2M6LA 1VL2A 1LNSA 3FOCA 4RTMA 4JYZA 4AKGA 5DNVA 4DNOA 3O8QB 5FTMA 1ZQ1C 2OD9A 5J2UA 2P9TA 2JIZD 3OFJA 4LCBA 1CR4A 4ZI7F 3W6NA 1U31A 2WG0A 3GCZA 3ESQA 3T8YA 4B9EA 1QQ6A 3H2YA 3D43A 3PFKA 4B3IA 3HMKA 4QTTB 1K06A 2R79A 3JQ9A 4P4UA 4TWBA 3ET4A 4W4TA 4EHHA 4ECAA 5KWSA 1X14A 3KPJA 3T5PA 2BCJQ 4JASB 1BXZA 4TMYA 4UKDA 2B9EA 4Y1EA 4YRRA 3T41A 1ZLYA 3V4PB 1XTZA 1FRQA 4JYCA 1U0SY 1UR5A 4P82A 4Q3EA 5EP3A 4EY8A 5K0TA 2CLEB 3B6EA 3KZKA 2WB1F 5FIUA 2DQ4A 2X1VA 4E88A 4OLFA 5EHXA 1ISPA 4O2RA 1AD2A 3C28A 3GLIE 1ZMTA 4M8SA 4YCXA 1BN6A 4QPCA 4AJNA 2NIPA 4O33A 5C1IA 2GD0A 3HXLA 3QWIA 4JC0A 4PZYA 4H77A 4KBGA 2NUBA 1P77A 2OOSA 3IESA 1XC9A 2HHQA 1IQ0A 1FP6A 1M2HA 1XXLA 2R6AA 3FDFA 4PLYA 4UHDA 4KLGA 3WKEA 1GG9A 5ICGA 1DCTA 3HKDA 3V8PA 8ICLA 2IBMA 3KG2A 4GRIA 4YRKA 3EXHC 1QONA 2NO9A 1MHTA 1NJSA 3M9WA 1QV6A 4BX9C 1MN8A 3X2SA 5AXAA 2XI4A 3ZS9A 5ECWA 4C20A 4HDSB 4MAAA 3AP1A 3F9IA 4M7OA 2D00A 1H5NA 3FLAA 3L6CA 3QKTA 3IQDB 1ZICA 3GRPA 1RQ2A 4JP1A 2WTMA 4D0LB 2D1SA 2RHHA 2TS1A 1R12A 4BX2A 2CBGA 4YRLA 1VKRA 3ZHBA 4C0WA 2DQSA 1UC4B 4EVRA 4QUIA 2RGRA 1D2NA 2AMLA 4J7XA 3B6IA 5ILOA 1XZBA 1YFKA 5LA6A 4M9NA 2G4VA 2OYRA 3U4IA 3QKSB 1THTA 1C7YA 2PHZA 2Q5HA 4L8LA 1A5ZA 5KX5B 3PKIA 1T0IA 4NYIQ 3UCXA 1IBSA 3EB9A 1KERA 1CRZA 1NLFA 1VC2A 1ZJ4A 1EDZA 2JGNA 2ZI7A 3PQ4A 2F9FA 4K2AA 4Q1AA 3N07A 1BEUB 1A8SA 2P3OA 4J94A 4Q4JB 3C4QA 2ZI9A 1B15A 5AKEA 1B0UA 2BFDB 1F2UA 2RBKA 1Q0RA 2EFJA 1KI8A 1LDMA 2BKEA 2GEBA 4C8OA 3HYRA 4H7PA 4M46A 4BMZA 3OJLA 3IA2A 3NKLA 3FPGA 4QECA 5JCOA 2Z6VA 4QIWF 5ALDA 1X9WA 3TQSA 4BFWA 2VJMA 2ZSEA 1DGSA 1GCIA 5BWLA 2PL1A 2X3FA 4I9FA 1WPXA 1XDUA 1T8UA 2AXQA 2B5OA 2C5EA 3BRWD 3MCZA 1Q14A 4H0FA 4RMHA 3WK7A 5BVGB 2QTBA 5B5SA 4E32A 1EXNA 1RQPA 1VL6A 2DSTA 2X5JO 3F3SA 3ONEA 1H9AA 4KBYA 4B4UA 5FWXB 1SMKA 2FSIA 1BZYA 1E3QA 1NOIA 2NXJA 2WFMA 3PGKA 5CH5A 3FZGA 3ZE0B 4AWXA 2I6SA 1PR1A 1YS7A 3B6MA 3LM8A 5E6UA 1IXRC 1J8MF 1T3LA 3VNUA 1XZNA 2YV1A 1Z1BA 4JOBA 4D8UA 1KYYA 5P8WA 3HE3A 2WB1C 5J0WA 2VVTA 2DY0A 1FSFA 1VE5A 2F48A 2ECPA 4KIGA 4EBDA 3F4KA 3L7IA 3ADBA 3WHIA 4RETA 1Z6AA 3IMFA 4DLZA 3H1FA 4E5KA 1N62A 5JXIA 4JVLA 3U4QA 3ZQJA 1CUCA 1GNTA 2LM1A 4TTJA 5TQ0A 3KSUA 2B4KA 3OQJA 2FUEA 4OBBA 1GUDA 2L19A 2W8BA 1GHTA 4JOCA 4GPIB 1X42A 3B53X 4TSFA 3I8OA 4PU0A 1TMOA 1YDFA 9ICKA 3FNEA 3ILYA 4M76B 5B1HA 3LK7A 4ALNA 5AK5A 2GDZA 1UAGA 5AW2A 4LSWA 4JVOA 4HP8A 5DNEA 4B7UA 3GJ0A 4EJSC 3H04A 4ZIRB 4LIPD 2BFNA 4B3DA 4CUKA 3ES9A 1V25A 2CHQA 2FP3A 4QHYA 3SFVA 3V46A 1V8DA 3GIWA 1DC6A 3LMKA 3SVTA 3ER9A 4QWAA 4MTCA 2JRZA 5K0EA 1SUDA 4QYSA 3RTGA 1EXDA 2VP5A 4Q3AA 4ZOCA 2IU0A 2OKGA 1ENPA 4Q6BA 2KSOB 2L2QA 2QORA 3GRAA 2C5LA 2WMYA 1UPAA 4IMJB 2YW9A 5AVUA 5D8DA 4QYIB 4TVKA 3UAXA 9ICWA 2MWMA 1S9HA 3KYCA 4IWYA 2J09A 3ET5A 1QGAA 1GKLA 2X4DA 3KEOA 4K7JA 4IICA 4M60A 3W8DA 3DBLB 3AV3A 1U0GA 4HAYA 3WWOA 3L6BA 1J39A 1B8VA 2C0CA 3DVQX 3V42A 1HLDA 4GOXA 1ZVMA 5IT5A 1EVJA 3B5EA 1MB4A 1GGFA 1RQRA 1WZUA 3DBHA 1M2KA 3NAQA 3PFFA 4QYTA 2O7QA 2Q29A 4B3SB 4Z6EA 1J7JA 3B8EA 4M3NA 4N5LA 2Q6OA 6Q21A 1TYZA 3JPSA 4F5OA 2IEBA 3IUQA 3VR4D 2YXPX 4XIGS 5KOIA 2BGTA 3T38A 3SZ2A 3MBOA 2MCFA 1RHUA 3SFZA 4EECA 4HDOB 3WNDA 4ABYA 5KKCA 2JC3A 4HGQA 2E8PA 4BO3A 4ESEA 1UBHS 2HOIA 1CZLA 4FFBA 3ESCA 4ZK2A 1YOVA 3KSRA 1YK0A 3CPJB 4WKOA 2IOFA 5KNLA 1NIPA 2CD9A 1RHJA 1V6AA 1II8B 3NT5A 1H85A 1N8NA 4GR9A 1L7VC 4JA0A 5JI3E 2RBEA 1EI9A 1SB8A 1E1RD 4LYGA 4OLHA 4W6QA 1SBHA 3JD3A 2CSXA 1R0ZA 3LL7A 4K6FA 4MUGA 5FFMA 3K32A 3MRVA 3GRRA 1VHDA 3CZRA 2OCGA 1B6RA 3B6KA 3LL4A 4N0MA 3RIXA 1YMQA 3VH1A 4CU5A 1ZQRA 4YMVA 1SKUA 1EFHA 4Q7EA 3GVXA 1QPBA 3QX3A 4GLLA 2DGDA 5DNWA 3OZVA 2Y8EA 3NASA 1PG2A 3KFUF 1NAHA 5FUVA 2FPUA 3W8EA 5CYOA 4YDSA 5EZYF 4DSTA 4A0SA 2BSQA 3DR3A 2VNIA 1KVSA 2HIHA 3MIIA 4NM1A 3W7AA 4OXXA 1GVNB 2F55A 1TVAA 4XB2A 4GKJB 1I6MA 1PNTA 1OBOA 1L9XA 2QROA 3DC2A 3KZIU 3S8YA 2JJ2A 4E70A 4NVRA 1DBSA 1FZTA 2QGNA 3BH0A 1HETA 2OXRA 4HG2A 3DPSA 1J6UA 3GJ4A 2O1XA 5E7MA 3B5IA 2AV6A 2Y67A 3CKMA 5KFJA 3I5UA 4MICA 5DF1A 1EB8A 1FDUA 3CVJA 2VQFB 4I66A 4J43A 2FUCA 4L15A 5CG2A 1EDEA 4BFUA 5DWVA 5B4TA 3OT1B 4LY9A 4RELA 3W9SA 5CH8A 1U8XX 4H4EA 2ZAMA 4CNBA 4ZPJA 1LX7A 1Y5IA 3RF9A 2HJWA 2MUTB 3D4IA 4CMCA 2XVTA 1B42A 1E2PA 1Z4IA 3CR7A 3DE6X 4RQ3A 4HNSA 3CF0A 4OQXA 3GOQA 3M4JA 1KXZA 2CWWA 4R3UC 4EF5A 5JC1A 5EOVA 2IGBA 1ZQ1A 4OQEA 4DA0A 3QOYA 2NV0A 1SCBA 4H15A 2OPBA 2ZPUA 5IJXA 1EE1A 5JATA 1LK7A 1JR6A 1EIZA 3FYCA 2RKBA 1XQYA 3OETA 1XHFA 1YBFA 4JIGA 4OJQA 1SBZA 4DQIA 3CW2A 2VUIB 1SZCA 2J0UB 3BL6A 5HGXA 1T5IA 3PT5A 1GAWA 3M6VA 5A0VA 9ICPA 2N1BA 1X0VA 3G8BA 5FPPA 4W9MC 1CZUA 4AFNA 3N2NA 4RHEA 5HSGA 1RNLA 1DK2A 1S6YA 1SQ6A 3ANLA 4V1CA 4C04A 1UPHA 4PAMA 1GEGA 3EH2A 4R0VA 3H1PA 1E61A 1ZUHA 4KZKA 4DSOA 5C8YF 3RFUA 2NPFA 1NVEA 2EXXA 1H6BA 3T7SA 1D0IA 1D7OA 1UDRA 4FS1A 1NULA 4I1IA 5GV8A 5HIJA 1NPYA 1ULTA 4A1OA 1OB2A 1AQIA 5HFJA 5HQJA 3SJUA 3WIEA 4E22A 2FB9A 2C28A 3ZY2A 4IW3B 1PK3A 2HI0A 1H8HA 4GQAA 4ZC8A 3GU3A 4Y2PA 1PZMA 4KXYA 4ECTA 2PKWA 2WYWA 1VSVA 1YNSA 3TADA 2FZGA 3AUXA 2HCRA 3G1WA 3P32A 1N6OA 2AQ8A 1OT5A 2EIHA 4ID3A 3Q3JB 4ZODA 3M6IA 2W6IA 4DLGA 4KMUA 2VLIA 2GMWA 1Z38A 3OIUA 3QJYA 3R1IA 3R5HA 3WB1A 1SXPA 1FFWA 3GJSA 4CDNA 1ZJNA 3M89A 4QUKA 1Y1PA 1TUIA 3SX4A 3E58A 1ZXXA 3C7DB 3NW9A 1BWSA 3CJQA 2BCQA 3N2LA 2GHTA 2UZ0A 3QIVA 4YUZA 2QL5A 2BHLA 3SQNA 5JNWA 4LF5B 1FQKA 1TIKA 5L1MA 2PSFA 2UUPA 5IIIA 1N3YA 3JD2A 4K9NA 4L4RA 4Q9LA 4UASA 4KSYA 3UXMA 5JBIA 4XIYA 5LR6A 3RS7A 3ND8A 4YV7A 4RANA 4AN4A 3GL9A 4II7A 3BFKA 3Q1KA 2HV8A 2WWVD 1NMEA 3NGXA 1GQSA 1AZWA 3AU6A 1N25A 2IHKA 3PL1A 3IALA 4AMYA 3CXRA 1F8GA 3H83A 3KHLA 3HA7A 2XXBA 2EKQA 3DXXA 3JALB 1X1DA 3NDRA 4MF2A 2I71A 1DBWA 4UE3S 4ER5A 2VJOA 1ZEMA 3R5TA 4HH3C 1F2TA 1TFRA 4NF2A 2H29A 3WGJA 1QG0A 4JC4A 1PO7A 1N2HA 2Z58A 3HLYA 1GZ5A 7AT1A 3IEPA 2O8CB 2KSQA 5BOLA 4MOWA 4I8DA 2KM1A 2X5OA 2WF6A 1DX9A 1XMIA 1N0IA 1U99A 2CBXA 4TLCA 5FCDA 3RE1A 3USZA 4WN9A 4A92A 4IIHA 3WZMA 5C51B 2Z1NA 4TV8B 5L1IA 1G8SA 1B43A 2WUGA 3Q6MA 3U1TA 3F2CA 1UMKA 2FGKA 1OH6A 1DQPA 2GD6A 2YYAA 3HDYA 4NMHA 2JGDA 4HPWA 3WBFA 2PX2A 1M2WA 3L5OA 5A3RA 2GHRA 4ARSA 1MG5A 2G0AA 4RH1A 2O2DA 2RCYA 3CR8A 3GLTA 1WB6A 2Z83A 4TQGA 3LYLA 4RGYA 5J2KA 1PJAA 3ENVA 3BXFA 1VHWA 5UKDA 4DMKA 1SUWA 2I91A 5KNDA 2JFFA 2HW8A 5JU5A 4RIEA 1GL9B 4UDYX 5DP2A 1TA4A 1IG3A 4YJ2B 2Q6LA 2XMQA 5F3DA 1IEXA 3ETRA 1AH2A 4OA8A 4U8HA 3RIGA 4NLGA 1VCHA 2LP4Y 3LFTA 1L3UA 4B4OA 1Q17A 4RZSA 4QBGB 3ZDDA 1FQOA 1IZYA 1ZD3A 1YXMA 3W06A 1UKBA 5ARBA 2QAGB 4Z99A 4DCGA 2P75A 2PX6A 3P4UA 4C2UA 1X8XA 4DV6B 2J3QA 2JGMA 3N05A 4QAJA 1DEHA 2Y1IA 4GM0A 1WB9A 1LS6A 1J8YF 1VBMA 3PXEA 1T8RA 3NT4A 2O7NA 2CL6X 3RUHA 4WTOA 8ICIA 1N8SA 2DGZA 3U7JA 3D3JA 2CBZA 4YQEA 3KXLA 4KN4A 4UC0A 3ZPXA 3QA3E 1C0PA 2A2ZA 1PT7A 3LF1A 4B2IA 2H85A 2C2MA 1J9EA 2QTWB 2X2EA 3QQPA 2R6FA 4V1CB 3OZTA 9ICAA 2PUJA 2R85A 4M9XA 4UNNA 4DQXA 1ZQNA 1HUZA 2JIDA 3EGDB 3Q2IA 5DW3A 3WGGA 1QQ5A 2EFHB 2M32A 4PHHA 1AGXA 1J07A 2HFKA 2XTAA 3T1QA 1V9CA 3E2IA 3LBHA 4C0QC 4YAFA 4BYMA 4ENTA 2JI8A 3HVJA 4KVGA 5AW9A 3DSRA 3E2EA 4WPGA 3SAJA 1L4HA 1RWBA 3GXBA 4KDRA 1R8QA 4NDAA 4BWVA 4QUGA 5IUJC 5GVSA 4DV4B 5E6RB 4ZAYA 2QV7A 5TARA 4FN4A 1LSJA 1VI6A 5EWLA 5BOSB 3KSAC 3I9V1 1CHNA 1L0BA 3WLKX 4TLLB 5KVSA 1R0LA 5BWMA 3VH2A 1FS4A 4MQMA 4GL4A 3IP3A 2IMWP 3QHPA 1PFQA 3CRNA 4NQZA 5JHGB 2INGX 3DP9A 3H5TA 2IYVA 4JAVC 5FD8A 3EULA 1O9GA 1QH8B 1LW7A 4JUFA 3A0HU 1XZLA 1C7EA 7ICNA 1AKTA 2IXGA 4NBTA 3RVSA 5CX1A 3X1ZA 1YFZA 3VC8A 4DJAA 3SAGA 2DM6A 2KBEA 2YRWA 1DEAA 5DEOA 4HDNA 4B8WA 5JXGA 1IZ9A 1GSAA 1EUDA 1M2JA 1O0SA 4MW1A 4NYIR 3V1YA 1Z6PA 2DECA 4R40A 1J00A 2J31A 2CXSA 3H1GA 5J2BA 3I6MA 4RIFA 3TK1A 1THMA 1HURA 3ESYA 4BQQA 3OX4A 1PNVA 3W6ZA 2Q4EA 1KJ9A 5C32A 1NVKA 1PKEA 4C06A 3UQ0A 4BKUA 2GHQA 2MTBA 2KK0A 4GSKA 4CTJA 4JOSA 3ELBA 2SHKA 3PPIA 3OD5A 1R6UA 1D2CA 3HKZF 4Y0AA 1VYTA 3Q8SB 2Y9PB 2IHYA 3T15A 3AKCA 4Y67A 2J5RA 1L8LA 3F4BA 4MDHA 3NRBA 4EW2A 3DL4A 1PJTA 4L1KA 4F6CA 2LPEA 3NALA 3R77A 4H7JA 4RMGA 1XMOB 3C7KA 1BHQ1 1R50A 2I6XA 2CNNA 1Q0LA 4JI4B 1OT3A 3V1TC 3OJOA 3ODGA 2BGWA 3D4NA 2Z6UA 2CWDA 1JDSA 2JLYA 1L4LA 3AKYA 1DX6A 4YRMA 4R8UA 1TT5A 2JKVA 2GYUA 4NG5A 1N77A 2GCPA 2VAXA 3AIIA 2QJFA 4KXVA 3CRRA 2IPXA 1NUAA 3VYTB 4EP1A 3D4BA 3C1OA 3GPDG 3WYBA 2QI9C 1UAYA 4QUHA 2C31A 4AJOA 4EA6A 2GAOA 3R8FA 3HCBA 4EH1A 3HXPA 2XXAB 3EUWA 7ICQA 2I3GA 3BA6A 3U3ZA 2BFFB 1YC2A 4OQZA 4P80A 1WBBA 2WHPB 1G8HA 3LKBA 4A0HA 1FNMA 2AGOA 3A6HA 4XE5A 1T6YA 4FX5A 2PQ0A 1R8JA 4QBIA 4BNTA 1D8TA 3EIWA 4QTYA 3E6AA 3EA0A 5FPYA 3FZNA 1GRRA 3Q7QA 2D62A 5CBPB 3C14C 1ISRA 3D7MA 2JAQA 1AUXA 1QF9A 4KLZA 4MZXA 4UD2A 1H1LB 1JFTA 1JEYA 2V5UA 4JXZA 3CINA 4JJZA 2EC5A 4TXJA 3TMAA 2ORWA 1KBUA 2A9KA 3ESAA 1Z63A 2JK1A 4FWTA 1GR0A 3A7EA 1C1DB 1K4MA 1Z29A 3UT5A 1Z37A 4EIWA 4TKVA 1OQAA 2WG2A 2VQ3A 1ZQJA 2FZEA 1Z28A 3BCUA 3RQIA 3G6VA 3QF4B 4YB8A 3ULKA 1NK4A 2CGEA 4DRYA 4MPJA 2CYBA 1LVGA 2QIOA 2FUG1 3R3UA 1WULS 1BNPA 1P33A 1KP2A 2ZWIA 1Z0IA 3G23A 3MSXA 4YDHB 1DUVG 1G64A 3P0RA 4L85A 2FN7A 4H7KA 4IKEA 4WLUA 1JSRA 2QMQA 4JB0A 1YS9A 1P6XA 1HTTA 4A8PA 4ARZB 2XT6A 4ZP1A 3TL6A 1L9KA 4ZDWA 4Z53A 2IXBA 2OR3A 4I9NA 2Q50A 3B60A 2CZGA 4DGQA 1U2SA 2GTHA 1A7AA 3GLUA 3IDOA 1JQ3A 4CG2A 4EPYA 1KW4A 1PF7E 1Y7TA 1S0VA 2X0FA 4GS5A 5G53C 3W2GA 4D3DA 1QHIA 3RS8A 1YBAA 1PVQA 2BRUA 3SOZA 3U6KA 1X7HA 3HACA 1N8TA 1Y4ZA 9ICIA 4F84A 7ICRA 1MP0A 2Z2XA 2Q0ZX 1MAAA 2BJHA 3RTEA 2C8LA 4G1EB 3U3OA 2BM9A 2Z57A 2BCSA 1JXOA 2NADA 3WLMA 5HRAA 1JU9A 1W8DA 3AUUA 4S1VA 2LCIA 2PTHA 1I9GA 3AQFA 3VC3A 2Y9TA 2AN4A 4GMDA 1WZ2A 1RD4A 3ZU5A 1LF5A 1USVA 4A2CA 3SI8A 2C03A 2FRVA 1R6TA 2C7GA 2OD2A 3G2PA 4TZKA 5CTAA 2BJVA 5KTNA 4A15A 5AJWA 3MAJA 3BXOA 3WZ2A 1QS0B 1CJVC 2ONKA 3VZCA 4R9VA 5CT6A 4BFXA 2B1QA 1PBNA 1ZO8A 4IIGA 4MUIA 4E1BA 1ODTC 1IULA 5CYFA 4OI0A 5FO0A 3VR5H 5C3MA 2ZAIA 2ZI5A 3FMVA 2HU7A 2IV7A 5CB0A 5BN3A 1F60A 3MCWA 4BFLA 2AHRA 4REQA 1BPEA 3VZPA 1OBVA 3L40A 2XWPA 4RXMA 1XEWX 3OA0A 3VFDA 3R0XA 2WYVA 5DULA 5E3IA 2GXQA 4QPJC 3FCAA 2HRZA 1ORWA 2MRLA 3K0CC 3ZE9A 1UMBB 1T2FA 1KI1A 3IEIA 3SSOA 2EL9A 4ZVMA 1UK8A 1YS4A 2B34A 2D5IA 1JR4A 2ZRCA 1CUHA 3UGTA 4WKGA 4TQSA 1MU0A 1VPDA 4M7RA 4DYHA 4QIWC 5HMMA 4GE0A 4P7BA 2UZ1A 3UXPA 1KPIA 4JELA 2DX7A 3F2BA 3L8HA 4LBYA 1SUSA 1QO9A 2VXYA 1SFRA 1RYUA 2DHCA 2GFHA 4FYHA 3L1IA 5KVQA 3SQIA 2VDUE 1DOZA 3FWPA 5CXQA 5ELLA 4GWLA 3ZNPA 4WESA 5IZ4A 4A2PA 2BGGA 2WJPA 2ZVQX 1KAQA 2HNKA 3UXOA 3U6BA 4MDEA 1ESNA 1KY5A 4J9UE 3E22A 3QYAA 4GPTA 4AN1A 2BEVA 3OAAD 4DEYA 4KXUA 2R8YA 3ZJ4A 2JFZA 4QWCA 3VSDA 1L1FA 2E8MA 2W2TA 4GWGA 4BNLA 1J0DA 4P36A 5A02A 4LJ4A 1E1RA 1TOAA 2ALJA 4L02A 3JQ8B 1PL0A 2H1FA 1HFWA 1V39A 2BP7B 3OZ7A 1OIVA 2EKPA 3ZXSA 2HHUA 3R24A 4DIEA 1U48A 3OQOA 3WL8A 2ES6A 2GARA 5IX8A 3PP8A 2PVSA 1PWHA 1OFGA 3GCXA 4KCGA 4WN3A 3N28A 4G0NA 2W9XA 5JSKA 5TX7A 3W5VA 3MDAA 1KEEB 4AG3A 5C1BA 5EI5A 2VANA 4W7IA 1EFDN 2WVJA 4OO1J 2F3NA 1U80A 1CRXA 1IH8A 4FLFA 2WIGA 3AUJB 4GXKA 1MGOA 4HEJA 2BBOA 2P9JA 5CLHA 4BB5A 1O08A 5A4DA 1JLRA 4BNVA 5EHGA 5LQRA 2O20A 1N6NA 2ECQA 3LOUA 3FNBA 5FTNA 3RIEA 3LZ6A 4J90A 1UXOA 1KI7A 2QGZA 1SNYA 1V6CA 5EN4A 5LQSA 1NQAO 2I7VA 5JRTA 2QA5A 4TMFA 1T0PA 1NXWA 1YIOA 1XX6A 2V9ZA 2QB0B 2D1FA 4YXMA 3RRNA 4NNJA 7ICJA 2PR7A 3BEOA 2W6NA 2D6FA 2D7CA 1W5SA 3IX7A 2XIQA 2WJ6A 1MQ2A 1HORA 2R86A 2E1EA 2A0XA 4PX2A 8ATCA 4CN9A 2JLWA 1ZQQA 3DA8A 3OE7A 2HLPA 4PHCA 1DAPA 1YU9A 1TMKA 3AV0B 3FKQA 3P0IA 5FWAA 3PUHA 4BEJA 3TM4A 3AVWA 1DJMA 3I2HA 4DM4A 8ICHA 1G9TA 5L4NA 5P21A 5JAUA 4DCTA 1TV9A 3EXG1 2YUIA 2OUKA 4JVSB 2EH9A 4RF5A 3DB1A 4B32A 1PQPA 1LB1B 5INTA 4UTXA 4BNMA 1ZC3A 1X1AA 3KLOA 4RTQA 2GPAA 9ICVA 3IG5A 4N7RA 4NI5A 1M76A 1T0UA 3VA7A