2NO4A

Crystal structure analysis of a dehalogenase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
225
structure length
225
Chain Sequence
b'LVDSLRACVFDAYGTLLDVHSAVMRNADEVGASAEALSMLWRQRQLEYSWTRTLMHQYADFWQLTDEALTFALRTYHLEDRKGLKDRLMSAYKELSAYPDAAETLEKLKSAGYIVAILSNGNDEMLQAALKASKLDRVLDSCLSADDLKIYKPDPRIYQFACDRLGVNPNEVCFVSSNAWDLGGAGKFGFNTVRINRQGNPPEYEFAPLKHQVNSLSELWPLLAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords (S)-2-haloacid dehalogenase IVA
publication title Crystal structures of the substrate free-enzyme, and reaction intermediate of the HAD superfamily member, haloacid dehalogenase DehIVa from Burkholderia cepacia MBA4
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Hydrolase
total genus 87
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2006-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2no4A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2no4A01
3RF6A 4UM7A 1Z4PX 3AR2A 4UMDA 2B82A 2IOFA 4Y2RA 1L7NA 1TJ3A 2ODAA 1L8OA 1RMTA 1SWVA 3VAYA 4ZEWA 5AI5A 4C4SA 3I6BA 3HYCA 3QUCA 1Q91A 2YMPA 2NO5A 2QYHA 2YN4A 5ALWA 5JJBA 4QQFA 1CR6A 4UMFA 1U2SA 5AKYA 1EK1A 2PR7A 1N9KA 1O08A 2FUEA 4L6CA 2I33A 4CF3A 3U13A 3OTQA 1YMQA 4Y3UA 2EAUA 3MMZA 3ZVLA 2OYCA 2I6XA 3AR8A 3E8MA 3U19A 2YJ4A 3ZU6A 4UARA 5AW7A 3CZ4A 1QQ6A 5AVYA 2CFRA 4C4TA 2GFHA 3W5AA 4BNDA 5AW8A 5E0OA 4Y2VA 2YFYA 5IS2A 2FUCA 1RDFA 4CNQA 1S2OA 4KN8A 4YCNA 4F71A 3DAOA 3OCUA 2CFTA 3MC1A 1T9ZA 3A1DA 3NANA 1NRWA 4EZEA 4DCCA 4J2TA 4YIKA 3IJ5A 4HGRA 3DNPA 4RESA 3QUBA 2AUTA 1XP5A 3NAMA 3KZXA 4PNHA 2GO7A 1Z4NA 5AKIA 5ALOA 5AVSA 2JARA 3EF1A 1YDFA 2MU2A 2WF7A 3OCYA 4G63A 3NALA 5AW9A 3QU7A 5AIAA 2HCFA 3FVVA 4AS2A 3AR3A 1EK2A 4MUMA 4ZEVA 4I9GA 4Y2SA 2NO4A 2FPRA 4UMVA 3ZW7A 2YJ3A 2WF5A 1JUDA 3UMCA 4EX6A 5ALVA 4HGQA 2BDUA 1Z4IA 2OBBA 2WM8A 5ALRA 2WF8A 2YMMA 3L0YA 2AGVA 3KD3A 4NV0A 1L7OA 3ZVMA 3ZI4A 3WK5A 3QXGA 5AKLA 5AW0A 3SKXA 3EWIA 3ZTYA 3NIWA 5ALYA 3AR9A 5AVZA 1U7OA 2HF2A 2MSNA 4UAUA 4YH1A 3RFUA 4QJBA 3ONNA 3DV9A 3AR7A 1RRCA 4EEKA 3SD7A 5AHXA 1WPGA 2HSZA 3R4CA 3R9KA 3NRJA 1Z4OA 2EATA 2JAWA 3N07A 3ET5A 3WKCA 1U2TA 2VKQA 2WFAA 1TA0A 1L7MA 4UMEA 4BX0A 1T5SA 3SF0A 2CN1A 3TLMA 2BY4A 2B8JA 4RETA 4JB3A 5AW1A 5ALGA 2RB5A 1QYIA 3U7EB 1TE2A 2B1QA 5AW6A 2RAVA 3W5BA 4IFTA 3QX7A 5AVVA 5AVRA 1IWOA 4HGNA 4DWOA 4EENA 2I55A 4YCLA 4Y2UA 1NNLA 1WZCA 2ZBDA 4KX5A 4YCMA 5ALSA 2YJ5A 5A3RA 5AI0A 3OCVA 2FPWA 5AKHA 3EF0A 4L6AA 1YS9A 3R09A 2W43A 2OA0A 1Z4KA 4UAVA 3W5DA 2G08A 3ZVNA 4CF5A 2HF7A 3UM9A 3WKBA 3L8HA 4XE5A 1ZOLA 4BEVA 2C4NA 5AKXA 5AVXA 1LVHA 1XVIA 4NAVA 1YV9A 2B8EA 4Y2XA 1PW5A 3WGVA 5ALMA 5AK3A 1WVIA 3N1UA 1RQLA 1U7PA 3FGOA 2FPXA 4B6JA 5IT4A 3M1YA 4HGOA 5A3SA 2R8XA 4MWOA 1ZRMA 3QU4A 3L1VA 1VJRA 5AVWA 3UMBA 4CE6A 2G06A 4DW8A 1QQ5A 5ALXA 3PDWA 5AI4A 4GXTA 2EARA 1ZD2P 5ALJA 2FPSA 2YBDA 3N8GA 2WF9A 4Y2TA 4XQ0A 5AKGA 2B30A 4OCZA 1Z4QA 4HGPA 5AM2A 2IA5A 1Z4JA 3NUQA 4AS3A 2I34A 2ZXEA 5ALHA 4Y2YA 5AKJA 3PGLA 3OPXA 2HHLA 3K1ZA 5AW3A 2O9JA 4F72A 3ZX4A 4XOUA 2P9JA 3M9LA 5AIBA 3S6JA 2ZBFA 4FE3A 5AM1A 4Y2PA 2P11A 3P96A 2C8KA 4FYPA 2G09A 4O8CA 1RKQA 3PGVA 3WK4A 4UM5A 3ZUPA 3WK6A 2ZBEA 2HEGA 2R8EA 3ZTWA 3E81A 3I76A 2JAOA 1CQZA 2X4DA 4BYGA 3WK8A 1NF2A 2JAUA 2AH5A 3A1EA 2ZBGA 3SLRA 2IYEA 3SKYA 5ALEA 5AW5A 1X42A 1WR8A 1SWWA 4NFLA 2FEAA 5ALIA 1T5TA 2O2XA 5ALNA 3L8FA 1FEZA 1N8NA 5ALKA 3KBBA 3WK7A 5AVUA 4DFDA 5A3QA 5FP0A 5AK4A 3B9RA 3ESQA 1Z4MA 5ALPA 3ZWDA 2FDRA 5AKEA 4BNDB 5AM0A 3ZWKA 3CNHA 1Z5GA 1RKUA 4OHFA 5AESA 2P27A 3AR6A 3QGMA 1S8OA 3L8EA 2P69A 2YMLA 4G9BA 2HI0A 4KNVA 1RLOA 3FPSA 3L8GA 1Z5UA 3N28A 1ZD5A 3QU9A 5ALDA 3WKDA 3E58A 1QH9A 1MH9A 3FM9A 3A3YA 3E84A 3ED5A 2C88A 2GHQA 4EELA 3QNMA 4NABA 5AK5A 2FI1A 5AI6A 4Y2QA 4AP9A 1RQNA 5AK6A 5ALUA 3U7GA 1VJ5A 4HYTA 2WHEA 1L6RA 1AQ6A 3MPOA 1RMQA 3FZQA 1YJ5A 2Q4RA 2R8ZA 1RLTA 2HO4A 4UU0A 3QU5A 2IOHA 3I1YA 5AI9A 2QLTA 4BEWA 4IG4A 3QU2A 1F5SA 2GMWA 4UU1A 2B0CA 3BWVA 5AM3A 4OD0A 3WGUA 1RC8A 2Q5EA 1L8LA 4L57A 1J8DA 3D6JA 5T41A 4UASA 3WK9A 3L0BA 4OFZA 3SMVA 1ZD3A 2RARA 2FPUA 3NASA 1SU4A 3WKAA 4GIBA 4E88A 5AKZA 5AW2A 3PCTA 4FFDA 1O03A 2W4MA 1TJ5A 3FPBA 3SHQA 2DQSA 2RBKA 5AKKA 5ALZA 1J97A 4JDPA 2NYVA 3U7HB 1L7PA 1Q92A 3GYGA 3N5KA 5AI8A 5AM5A 3B8EA 4KYTA 3KC2A 4KNWA 2BDEA 2HDOA 2I7DA 2G1AA 4UATA 3AR4A 1KYTA 2WF6A 2YMQA 1XPJA 3F9RA 3B9BA 3DDHA 2D2VA 4BX3A 1ZS9A 1QQ7A 1Z4LA 4HAIA 4EX7A 2R8YA 2W11A 5ALLA 4YGYA 5AICA 1TJ4A 3U26A 3L7YA 3QUTA 2C8LA 2G80A 3KDPA 2ZG6A 5AVQA 5ALQA 2I54A 3A1CA 3ESRA 1Z88A 3OCWA 4YIHA 2HOQA 2HX1A 1ZRNA 1Y8AA 5ALTA 4Y2JA 2MU1A 5ALFA 3QUQA 2GHTA 2PQ0A 3QLEA 4NWIA 2ZOSA 1K1EA 3L1UA 1YNSA 4H1WA 3KOOA 2G0AA 3IB6A 2C9MA 2Q4TA 2YY6A 4BX2A 3HLTA 2PKEA 4CF4A 4ZEXA 4BKMA 3OCZA 3U7FB 3ZX5A 3J7TA 1VFPA 3BA6A 2OM6A 5IT0A 4UW9A 3I28A 4J03A 3L5KA 2CFSA 3EPRA 5AVTA 1LTQA 4I9FA 3IRUA 3MN1A 5AW4A 4BBJA 2JGAA 3W5CA 3UMGA 4C4RA 3WKEA 1RMYA 2B1RA 3OCXA 1ZD4A 2G07A 2YJ6A 1U02A 4XPZA 2IOFK 1RKVA 3L0CA 3ET4A 1RPZA 5AM4A 1ZJJA 3QYPA 3AR5A 2AMYA 4KX3A 1RLMA
chains in the Genus database with same CATH superfamily
2BTEA 2H1SA 5CU7A 4M89A 3UJNA 7ICKA 4C2UA 2V7VA 1I94B 1X1EA 3RTDA 4DKXA 4ZZ2A 3AEUA 4C1BA 1YZVA 3CRRA 1N0WA 2GT1A 2I2BA 3PR1A 2V6GA 3R3SA 3L4KA 4RFVA 1GEEA 2PCJA 1IZ9A 4BQFA 4XM0A 2Z2KA 4HJXA 3SI7A 1HE2A 1G21B 3ZU6A 2XUZA 5BVHA 4GR9A 4MW5A 1Z0SA 4MUHA 3URMA 5BNTA 3WZLA 3CR3C 2AB0A 1EU1A 2BMVA 5I47A 4WZ6A 1XL1A 3G02A 5EWLA 2AE1A 4J2TA 2VVTA 4YAUA 1DJPA 4WVFA 7ICNA 1U8CB 1GITA 2HOFA 1SRQA 4H3HB 2BUCA 2XQVA 3WL4A 4F06A 2ZB4A 4X6XA 3EDMA 3OAAA 2JGLA 4ZALA 1P6UA 3C5VA 1CDDA 1UDRA 2Z8ZA 1KP9A 4QDZA 2FQYA 1Z6XA 1XTJA 2OQIA 2NNWB 1RVDA 3X1ZA 3IQHX 2X22A 4JVMA 3QF4B 3WWYA 1KW4A 3ND9A 3NIWA 5CA1A 1HDGO 4D56A 1C9NA 3PENA 1EK5A 4NPAA 3KBOA 2Z43A 4PS1A 4P4SA 5IWCA 5J2HA 4P0QB 4QVIA 2I1QA 4BQQA 1FA9A 4DDKA 3GRRA 3INRA 4EW2A 4F92B 3EISA 2Y1LA 5D5QA 4JB2A 4Q3CA 4F2PA 1TMGE 5HF9A 3JZIA 1ZN8A 4QZAA 4JQCA 4ECTA 1V5IA 2B4AA 4UDNA 3TOZA 4LYAA 2RHGB 2QLBA 3VSAA 3HY6A 1PLJA 2OUKA 3GV0A 1R6UA 4KUGA 1G21E 5KHOC 1IYZA 2H3EA 3W2HA 3ASZA 2JIPA 1WF3A 4MW1A 1LVHA 4DA6A 1GNLA 4RH0A 3P71T 4WW0A 3F9CA 5ECDA 2OMEA 3IT0A 4QUDA 2DY1A 3GCZA 4C1NA 4YMSA 3VR3D 3IILA 2PZGA 3MR3A 4MR9A 3GHHA 2FE1A 3KIPA 3MJHA 1FUYB 4RQTA 3A36A 4I6EA 4QYWA 1U7ZA 5AKJA 5IANA 4JS0A 3JYNA 3WNBA 5AM1A 2RKOA 1OJ7A 3I76A 2JAOA 4M54A 2VS1A 2C58A 1UPHA 2PI5A 4W9NC 1UMCB 1HMYA 1ZN9A 2O8EA 4PAGA 5BSTA 2WVHA 3ZWDA 2FDRA 5K8UA 3MM4A 1A7KA 4B47A 5LVAA 4DEZA 2F48A 3BQ1A 2PFQA 1XDSA 5CWRA 1ISJA 4JUIA 1F48A 4K4IA 4WDQA 5KG5A 3RF9A 5IXYA 2G9QA 4NEHB 3LIIA 1FVHA 2R25B 3M8KA 5IJAA 4G89A 3WIEA 1WW3A 2A57A 2IX9A 3E3AA 3SR3A 4AK9A 4N7JA 5BQXA 4XIGS 2BM9A 4NMMA 2QGZA 3EEQA 2QGFA 3WGOA 3AVUA 4NU5A 2B9EA 2YBEA 3B3FA 2BCQA 4MS3A 2WRZA 4RVHA 1KFEB 4DZRA 3ZQJA 1ADCA 3FJ1A 2F4NA 2VK2A 4TQSA 2K4PA 3FXAA 3PHJA 4Q3BA 2JEFA 2VN8A 5J4VA 3C6ZA 2VAPA 4V0KA 3P8ZA 2C8LA 2I54A 5HYVA 4UB5A 4NWIA 2MUTB 1BDBA 1ZIXA 3IB6A 5THKA 3JWIA 4F5OA 4XGKA 2AFRA 4OHYA 4GWGA 3K70C 4RJIA 3ZD7A 3L43A 9ICJA 2UZIR 3KKAA 1NBHA 2D3TA 4W7SA 1T3ZA 4AWBA 3UNXA 4F4DA 4DJAA 3OM0A 1NOJA 4BO0A 5G0TA 5BV2P 4WA7A 3DFZA 2F8TA 3CO0S 4LNAA 4YO7A 3AESA 1OXXK 4JI3B 1RCTE 5FI0B 2EDCA 4IIJB 4RO0A 1W29A 1KY2A 4K3VA 4EYGA 3SC2A 5JSYA 3Q3JB 4MYTA 1MVOA 4B2LA 2UXDB 4JJ4A 1X7ZA 2OV3A 3HLKA 4H7DA 4ZQCB 2DWOA 4F4CA 2VWPA 2WMDA 5BR1A 1SEVA 5HIAA 3OIUA 4E03A 2EP5A 1XZEA 3ZCXA 2BKUA 4LYJA 3AU8A 4RE6A 2P67A 1H2YA 2PMBA 1JSRA 1J9ZA 8ICUA 1QO0A 3TBFA 4CKWA 2AT1A 3MBIA 3CF2A 1A96A 3UPTA 1YQEA 3D3NA 4JX8A 2VKTA 4EY6A 5HW0A 4WSOA 4FYWA 1M6VB 4TWZA 3HI4A 5SZJA 2AVNA 4U2DA 3X3HA 3UAXA 5DTRA 3W4KA 2D3DA 4UZFA 4G63A 1Y6ZA 5D3MB 3QU7A 3PVXA 4WESA 3ICXA 5EJIA 3R7NA 3MS4A 3D4NA 3GVPA 2HQBA 3JQDA 3ESCA 5ALVA 5MN6A 3A2NA 1E9AA 5IDVA 2E5WA 1DLJA 3F7NA 3NJRA 3AFNA 2R7NA 3VR5A 4OUDA 1NVEA 2WKPA 4N41A 3M7IA 4O4LF 1UA1A 1ZI6A 1RRCA 4J16C 1H6DA 1MO4A 5JTUA 4RDHA 3U5ZB 3MQ4A 3R5FA 3ALRA 4GP7A 1RI3A 1IM4A 4QZGA 4W5JA 3ASVA 2PZEA 4DA0A 3WLRA 1FY2A 3ZC3A 2L69A 5DNDA 1UP6A 1M2NA 4RPIA 2W6PA 2PGAA 4HGNA 2BTOA 3K15A 4WUVA 5J1SB 4YR0A 1N8KA 4G85A 3ZK8A 1ZL0A 2B69A 4PL2A 3Q12A 3I58A 2KB0A 2G72A 1C9MA 3V1MA 2OXFA 3WDMA 2XCTB 1XZBA 1X6JA 4K81B 2HMTA 1OVMA 1TYEB 1BRMA 3W1WA 1O6CA 4HZUA 2XUOA 2I2WA 4BV3A 4E30A 4XX1A 1KVQA 1IN5A 4XX0B 2DKFA 4JXJA 2CMFA 2QM7A 3FHLA 2CHFA 5F7XA 1DX6A 1QF6A 5JSQA 1CV2A 4AO6A 1LLCA 4IHQA 3FNFA 3RIEA 2AZMA 4EYSA 1R0BA 2QRZA 2R8OA 4AY6A 2I9PA 4TYYA 3D5TA 3MWEB 3R41A 1OBFO 3DAFA 4F6LA 3RJTA 4RPJA 2PRYA 3SEZA 1JVBA 2UZ4A 2GNOA 3VOAA 4DC9A 1FX0A 4OMDA 3EODA 2F6RA 1T24A 3SE7A 3T34A 1XXLA 3JTEA 3MF4A 3N7PD 1XOIA 1SG6A 5JD6A 1RLTA 5IKEA 3JARB 5IUKC 1D1SA 4NJOA 1GUFA 1NQAO 2A78A 3CLKA 2HEIA 2YYAA 3W2TA 1F8FA 5KKCA 1ZGBA 3CCBA 2GPSA 4DUPA 2C5AA 5JWRA 2C4KA 1K0UA 4F3NA 1PZEA 1SCKA 1LB2B 3BF7A 4MO2A 1IPHA 4DR2B 4DB2A 4GX0A 1KKUA 1YRHA 3TQOA 2ZE8A 4TTIA 5CVVA 3ZY2A 2W11A 2WB1C 2IEZA 1EFVB 4BVKA 4G56A 3IAHA 3IDFA 1XZKA 1GXSA 3I39X 5LQUA 1TLFA 2ZTSA 2IUEA 3M3HA 5IK2A 1ADFA 3U5TA 5E79U 3TQSA 3CF6R 1NK7A 3G2JA 2IODA 2Y1IA 9ABPA 3DT9A 4QGBA 2YWGA 1Z22A 5I8PA 4KLUA 3UMGA 3IURA 3OCXA 3L0CA 3IIEA 5H68A 1ZJJA 3GLFA 1VSQA 4PHCA 3WIBA 2ECQA 9ICUA 3IPXA 5HSGA 3F5EA 4MARA 2WQ6A 1ZC4A 4BB6A 2IOFA 2RAUA 3COPA 1IDOA 2QR3A 5C8VA 3E7FA 4KWCA 4G4SO 4LCJA 1GNRA 2Q5JA 2EYUA 3QI2A 4DCUA 1NLUA 4I4CA 1HT2E 4R98A 1ZU5A 4YJHB 4AT1A 2CT8A 3OUZA 3OTQA 5TGTA 4LBYA 5BR8B 1ZI8A 1X3SA 2QTRA 3M3DA 2CDCA 1X7XA 1XWWA 1ECFA 4YRQA 1UKYA 5TEWA 1CZOA 2GCGA 3KTOA 3R0VA 4CMJA 4KAXA 4QEZA 3HB5X 3UJDA 4GLFA 2R62A 3OO0A 3QBEA 4U02A 1G20A 2KHQA 2CJWB 3A1DA 2ZCVA 1E96A 1SPXA 3A9UA 3W8EA 1IATA 1G4AE 1BU8A 4KE6A 3FWKA 4IW3B 2K8BB 4GT1A 3DQQA 1CUFA 2BQRA 1L5QA 1AKRA 2CNKA 2XKBA 1EESA 1A95A 5J5VA 2VPIA 4D4GA 2EKDA 5CLHA 3PZPA 4G5QA 3WNZA 3ZI7A 3WS7A 4M1WA 4BWJA 2AKYA 2YZ7A 3HKDB 2WE8A 3VX3A 1T1JA 2I2XB 3QSYA 3UV7A 4J0KA 2I8AA 1UBHS 4A8JC 3A1SA 3IQEA 3FBWA 1PWEA 4F60A 1CR2A 4ETMA 2ZJZA 3BZCA 4HPWA 3EPPA 3JU3A 3N7SC 3BDIA 4G01B 1P6XA 4IIJF 4F8JA 5CBPB 1UPUA 1T3TA 2BJWA 1FRQA 3DPUA 3RGGA 1N0IA 1ODCA 2HHUA 2HJWA 3BH0A 4X6YA 4WLVA 1JSCA 1EVKA 1O5TA 2NXEA 2CMDA 4WOBA 2Z2YA 3U3ZA 2WJ6A 3FCOA 5ALSA 2XMBA 2IJGX 3ETJA 3TTWA 3RS8A 4X62B 4PYLA 3ZWWA 1LQTA 4Q6BA 5FRDA 1P0QA 4ARBA 2L18A 4WXYB 1PS8A 2AGQA 3PKZA 4G5SA 2BM0A 3GZNA 2G1KA 4X00A 5KOYA 3KKPA 1NJ1A 1UXHA 2B3DA 3C28A 1NW7A 1TZKA 4DLUA 2VQ3A 3TQTA 4DF8A 3W2GA 5P8WA 4CI9A 3BCHA 1Z2DA 4ZDWA 4ED6A 3LGSA 3V32A 4IF6A 1TC2A 2C92A 3SMQA 3HGMA 5AKGA 4W5RA 4D6XA 4OCZA 1K86A 4BP8A 2GBCA 4ALJA 4E21A 5BSKA 4YFYA 4U5QA 4MGIR 1V85A 2RGRA 1UM8A 3PNPA 3R40A 3AIMA 2YV1A 2XITA 2HEGA 2R8EA 3VDRA 2AH5A 1WU8A 4YN3A 3VYUB 2AQ8A 3QFCA 4XGQA 4I28A 1GRNA 2R6GA 4DUGA 1U1EA 3LSTA 1WCLA 3AUXA 4MV5A 3RAFC 3P9XA 5H4GA 3BQ2A 4WQMA 1EA7A 1P62B 2VNJA 4BNDB 5DNAA 2B25A 1N7GA 2XRFA 3T61A 4L3VA 4KMUA 2DAPA 5MFZA 4KLAA 4MNTA 4HYKA 3LXUX 2E5FA 3TN7A 3H5NA 5EMNA 1UODA 1MFPA 2ACWA 2FZGA 1VKZA 3T7EA 2PA3A 4I36A 1DRVA 2WV7A 1AQ6A 3D4OA 3KT6A 4L8FA 3JYHA 3LDHA 4MMXB 5I7HA 3EAFA 1Y9ZA 3GOHA 2OCLA 3ZIAA 3LWNA 1URPA 3FAKA 4A9AA 4EJ6A 2EZZA 2B36A 1XSNA 1JALA 3L7LA 1DQSA 4AKSA 1BXRB 1CUSA 3G2HA 2Z6UA 4XYLA 1NBME 3S2ZA 1GZ4A 1H23A 5C32A 4JI0B 4G24A 5B5SA 5F1KA 4D6PA 3AJDA 4QWWA 1RIIA 1RKBA 1GUBA 2DPYA 1RD4A 2YWHA 3EEBA 4OJTA 3TDMA 3VCBA 1VB5A 4ON9A 4EY8A 1ZAYA 2KM1A 4RJLA 4YQWA 4YDRA 1OGIA 3A27A 1PZNA 3ZK9A 2HUNA 1L7EA 5LXTA 4D46A 1YQXA 3HWX1 4QGGA 3PNYA 2BI7A 4JA2A 3OKFA 2K8CB 2DBVO 3I3OA 5AW4A 1SD1A 2HLHA 3D5QA 2WD9A 4Z9YA 1XTTA 4UVIA 4XPZA 3AR5A 3UG7A 4D7AA 2PQ2A 4G2NA 1DZ3A 2FMPA 4A8EA 4UEKA 4RJTA 3PGXA 3I30X 1YZ7A 3PQ7A 2XUGA 3KYCB 3O8OB 4LGCA 4H1TA 9ICBA 1AHIA 1DKUA 5JSKA 1WBJB 1RP7A 4LC9A 4Y2HA 1EUDA 3FFXA 3UWPA 2AC4A 2JBAB 5TMEA 3BIJA 2C29D 2ZSAA 3W2IA 4PVDA 1W9HA 1FPQA 4EFLA 1OV6A 2J87A 3H2SA 4X94A 1G5QA 2G5IB 1RYRA 5EKTA 4KN8A 4RHXA 4D9BA 4Y18A 3PJEA 4BCCA 1Y3FE 2XOKA 1CF4A 3U7QB 3T5AA 1PS9A 4RFSA 3A6JA 4UCXA 2NSDA 3UT5A 1I1OA 1ZNQO 4PHFA 3A1VA 4QXAA 5LA6A 3MGHA 5AW9A 1XZLA 2QTFA 3RAEC 1WXQA 3AOEC 2KI5A 2DSNA 4EBFA 2CYBA 3N2KB 4BFUA 3LRTA 2YTUA 5IM4F 3CJTA 3HB9A 1XYYA 5BNFA 1CEYA 3TB4A 2J5BA 4E1BA 3IAS6 3H17A 3NDPA 2UVRA 4WBNB 3AIIA 5DGHA 2WWWA 2DQNB 1XC7A 1LK0A 4HLNA 4GPTA 2PMEA 1VDVA 2C2XA 4M49A 2D8CA 1DEXA 5FR1A 4RT3A 4ECXA 4Z6KA 3LBNA 1A1SA 1WCNA 5KSZA 1I14A 4CT4B 1XJCA 1Y1KE 3LYAA 3F6BX 3IDWA 4A3SA 5DX0A 3CXUA 2FPWA 5B3KA 3Q85A 3EBLA 1P3JA 4GLBA 3G0IA 4X7MA 4W1PA 3ZPXA 4Q4AB 4XFJA 3IVGA 4DLSA 1CRLA 2AR9A 2WWXA 5JSZB 3RU3A 2UUAB 2FX3A 2ZWPA 1R8YA 5BSVA 2TMDA 5K0EA 1ISHA 4KWTA 1Z0UA 2JIBA 1J42A 1GPDG 2AOVA 2Q62A 5LFAA 1UBUS 1VA5A 1AQIA 1P7CA 5JJ5A 4HDQB 1H6AA 3BH6A 4IHJB 1UR5A 1FFDA 4FYHA 5AOBA 4P4TA 4KO8A 1FIQA 1W49A 1K9VF 4B83A 4CTNA 4Z99A 4KLGA 4G0QA 4CJXA 4Q44A 2R2AA 4RMHA 1OAOC 4UD2A 2QM3A 4YD1A 5HDBB 2HLDD 3NW9A 5A5GA 2FPKA 3GEGA 4D8WA 1PWHA 3OE4A 3LO5A 3WGJA 4WZBE 1BJRE 4KLTA 4L8LA 1SA0B 1XT6A 5FLKA 4FFBB 4V24A 2VWHA 1PFQA 4KBGA 1CUIA 1L5YA 4AFNA 2F2TA 5EZYA 3R77A 3KPVA 4NLGA 4RV5A 4A0SA 4O3NA 1P4JA 5EZ5A 4M9RA 3TTXA 1GZDA 3FYUB 1JDJA 1K9SA 4BYMA 3REQB 3FOZA 2ATXA 2ODWA 2FFHA 4ZMSA 2IT1A 3DUFB 4M8LA 2CNWD 2A35A 5F3WB 3LY7A 5AWFC 3NEPX 4FFSA 2D0PB 5BSFA 4ZU6X 4BNYA 3OJCA 5I7EA 5HBGA 3PL5A 2H3HA 1U0GA 2JJ2A 1KR5A 4NH4A 4CCWA 5FUBA 3QUTA 2BGMA 2ZM5A 4TUYB 2JLAA 4MP6A 4Q3AA 2M0NA 1ZGZA 3OH8A 2FQXA 4PLFA 3K0AB 2OV8A 4QJIA 4ZOAA 4H0NA 2RIPA 3D2SA 1ZQIA 4G1EB 1RBQA 4RPLA 1IEVA 4CKEA 2IY9A 3DMNA 2J5KA 4GXKA 2ZATA 2V7XA 1FDVA 4WZAA 4MWTA 4I2IA 4IGAA 3EUFA 3A0HU 3W5SA 2IS1A 1Z7WA 3G2OA 5DRTA 1S0NA 3IKLA 5PNTA 2CL0X 1FXUA 1PGPA 3FPKA 1QP8A 4KDCA 1RJWA 3TSYA 1GDDA 1FLNA 3KPJA 4O33A 4C7XA 3UAOA 4B6GA 1CUYA 1QH1B 5JJBA 5IC5A 1P8AA 2Q4EA 1T0IA 3PKIA 2XMDA 4DNPA 5B3AA 1ZM2A 4DA8A 2HR1A 3ZQKA 5A0LA 2P4UA 3TI7A 1XCLA 1QHIA 5IASA 1I80A 1J0BA 4RHUA 2JATA 2PN1A 4E5SA 5J0SA 1JQBA 2DBYA 2PT7A 3MOIA 3OCUA 4I1SA 5ECYA 1XL0A 4WBXC 5J43A 4FMPA 4TMWA 3I6YA 4YYEA 1AT1A 1E3QA 1XTKA 1JRPA 4H4EA 2K2WA 1A82A 4C0KA 4TVBA 1QYXA 4BGIA 1ZQJA 3L93A 1P4HA 2ZE6A 3GJQA 1EVZA 3GA7A 2Y0CA 4FN4A 2AZXA 2IUTA 1S02A 2P6MA 3HB1A 4ZQIA 1GVNB 5L3SA 3CBGA 2VQ6A 1PS0A 2I29A 4JVNA 3KVOA 1TTQB 3FDIA 2HO5A 5TPWA 2GCEA 3B2QA 1K0FA 2EAOA 1GV0A 4NZOA 3JAWA 3P2MA 4I1YA 2VNKA 1WPGA 4BLPA 1U63A 1ZD9A 5IJWA 3NC0C 1KO5A 4MEYA 3JPOA 3M4XA 1GYQA 1Q12A 4Q4DA 3AU2A 3EA0A 2VK4A 5K51A 4PBRA 2IK8A 3AJEA 2P8SA 3H1TA 2W37A 1FTQA 5FBQB 1CVRA 1YVEI 2HM7A 5AVRA 4MIKA 2JLYA 5IJ9A 1XLTA 4WFIA 3PC4A 2XHZA 2FQWA 1ZQSA 4E6EA 5KDOA 4TT3A 2QORA 4DR5B 1HFEL 5COAA 1G60A 3UF0A 3PEFA 5JDIC 2VG8A 4EPXA 4QGSA 2O5RA 4E12A 4B79A 4A1OA 1KERA 1Q0TA 3CCCA 2DERA 1M34A 2HMUA 2QTWB 8OHMA 3FH0A 2IPMA 4MB0A 4O4IA 1Z68A 2J0QA 1XCJA 4EB3A 1ODIA 1PZGA 4PSDA 4UEJA 2P2GA 3VR6D 5HMMA 4EUEA 4WBNF 1PG5A 4WN3A 5BWLA 3Q3HA 2BR3A 1NVGA 3ZXYA 4DNQA 1G7TA 5SYAA 3VHXA 1O94C 3ONFA 3K94A 2ACKA 3AZOA 2C4WA 1DC8A 1O94D 2FPLA 5DHRA 2QMUA 4JBIA 1SGGA 2FQQA 1GPWB 2FGKA 4G5XA 1KEJA 4EYHB 4R3WA 4ZK2A 4WOKA 4RADA 2AWNA 5H1YA 1BKSB 2YINC 4B2IA 2ZJ4A 1EWKA 5ALUA 2XDAA 3CLVA 2L42A 3AKDA 2W2OA 4ZV7A 3PIIA 2DUYA 3L7KA 4B40A 3F2CA 5KFUA 3R6DA 1ZHOA 5IYZA 4EO9A 5ED4A 5J5AA 4PCUA 3JVEA 4J75A 3O2NA 2VF8A 1XTQA 1BPXA 4LYGA 1VMAA 3G6VA 2WB4A 1RJEA 3KTDA 4RULA 2BDEA 1JYEA 5K3AA 3RCBA 3D6NB 4IHJF 4RUAA 2BBWA 4IMPA 1GARA 4X63A 4D9GA 3DNFA 2H5EA 3K35A 1PKXA 2IGTA 4X0EA 1NR7A 3OKAA 4EKYA 4RQ7A 1XROA 2WM9B 1QHFA 4QZIA 1GKKA 3BWYA 3S8EA 1WETA 7ICVA 2WMYA 3NETA 3PQDA 3T7IA 4AQYB 2XV1A 1OB2A 4LJ9A 4JJ7A 3KJFA 2NIPA 3FY4A 3SAFA 4NCKA 1ZN2A 4Z7QB 3E9YA 1Q1BA 5JAZA 3LPCA 4UU8A 3FGPA 2ZB8A 3QZUA 4LI3X 4DGSA 3G9XA 3H3FA 2WNSA 2YR0A 1R12A 2WJIA 3WLJA 4MRMA 4NQZA 1NVVQ 2I78A 4RWZA 5L3QA 3I5UA 4EJSA 3TE7A 2EWMA 3UATA 4DBZA 4TLDA 2FY8A 1LH0A 3NOVA 1SK9A 2OZEA 5CDFA 1H2HA 5J1TB 2WYHA 4TQRA 2ATVA 3SHFA 4H3VA 3CEMA 3HXOA 2HBQA 3I72A 5L51A 4J6FA 4XLZA 1TXGA 5L4SA 2VTEA 4EAQA 5BYJA 4ENWA 3FGNA 1C7FA 4F2WA 2SNIE 4TUYF 5JYBA 4F38A 1PIWA 9ICQA 3I5YA 2PKCA 1FK8A 5GJVC 2OCPA 5E1DA 4ZV9A 5HQ3A 1ZKMA 3A3KA 3EXG2 3BX1A 2O6HA 4RNDB 1OBCA 3NGLA 1G3UA 3EVFA 3C3JA 4D0GA 2OESA 1KDVA 5CHEA 2A7XA 1T0UA 1A97A 3RC3A 2NU7A 1E4VA 3CZCA 5CUQA 3O2JA 4KMMA 3IULA 5D51S 5IVIA 4FHGA 3CLUC 2I4RA 3R4CA 4OLBA 1NE7A 1R10A 3E9RA 5ECWA 3H3JA 4UNPA 3N53A 3QMWA 3IP5A 3UB3A 1H42A 1LJ8A 2V6MA 4HO1X 3A9SA 4J6EA 4NBWA 2H5LA 4M9ZA 4RKEA 1ZD1A 1TK5A 3ZZTA 2Z3ZA 3RJ9A 2QMYA 1NC3A 3ACDA 3P20A 1OI3A 4D82A 1EE9A 4EHAA 2RFLA 3K16A 1PT6A 3RJ5A 3FMVA 2W9BB 4JGBA 4AN0A 5HF8A 4RNOA 1JMSA 4RQ6A 3UJAA 4CMIA 3RADC 1BE6A 2X41A 3C70A 5CFRA 5BP7A 3DW3X 1CRWG 3SXUA 3K71B 3LPAA 4MUIA 5GIPE 1BE8A 4FT4A 1UC9A 4CE6A 2ZIVA 3ZIUA 5TPZA 4GXTA 3E8XA 3A32A 2C94A 2FFRA 3NIFB 5LZ8A 3AUJB 1KTIA 1GR1A 2AK2A 2OXIA 1LY1A 4KVGA 3AHEA 4AMBA 3ECSA 1T26A 3E9EA 4CEIB 1NNUA 5FEUA 4IRKA 1B4DA 3RRZA 5U4QA 1KP3A 1ZYQA 1IHUA 3B1XA 2V7QD 3BZWA 4OQDA 1D6JA 3L49A 1Z63A 8ICFA 1KVRA 3MELA 3PC2A 2Z09A 3TL6A 1T35A 1MW8X 4DC1A 2HV8A 3TTSA 4B0PA 4MIYA 3L8ZA 3Q8MA 1O6FA 1T9AA 3A6GA 3A3YA 3HDJA 7ICMA 3DE4X 2GFIA 5LMZA 4DQ0A 2PG3A 1QCZA 1J2EA 4TWJA 3DCIA 4DCSA 1NMYA 4J9LA 3Q8SB 5G3YA 3C5HA 2BGUA 5BW4A 1K89A 4YAEA 1UA0A 3RUAA 3R5KA 1JLMA 1MO3A 4GUAA 4I4LA 4P0TA 1I10A 2K4EA 3ZHYA 4RUCA 3ANYB 1G3IA 3L18A 1E1MA 3E5HA 3DEFA 1KO4A 2VP2A 2JK0A 3DOHA 4C2BA 4M88A 3C3CA 4BO4A 4PYRA 3ED1A 2AKEA 3G8AA 2PX5A 1JFRA 2EEZA 5G3ZA 4FDUA 4YIHA 2VZ9A 3UTCA 3RJHA 1Z0JA 5DN6D 4OEHA 2QX4A 1DARA 4FDLA 3EZFA 1M83A 4Y6OA 3WO0A 4NU0A 1GD1O 1P73A 1DBSA 2FGJA 2RGXA 4DPKA 4J0IA 3JQFC 1Y6JA 1JHDA 5E3HA 4OM7A 1CP2A 4DC0A 2B37A 1K5HA 4ARZB 2QJWA 4GRIA 1PNRA 1H1DA 2NU9B 2DR3A 3O84A 1IBRA 3AHFA 3I2JA 5KHLB 1N57A 3QQ5A 4HRYA 3P32A 1B15A 2RKWA 1NR1A 1N2ZA 1GFZA 4XARA 4DLNA 4XJVA 2GRJA 5C8YA 2FDXA 2ZIGA 2HA6A 3N2GB 4MGYR 5ADVA 3W3AA 3TLBA 4FQ7A 1U5BA 2AN3A 1RYMA 2Q2VA 3KCNA 1ISSA 2O3QA 1KJZA 1ODKA 3LQ1A 2EVWX 3THWB 4BXOA 1AV6A 1VTKA 3D6UA 1T9BA 2BT4A 2F3PA 1GPMA 3PWKA 4YREA 3DE6X 3DLHA 3JQBC 3DE3X 2R86A 5A6VA 3T9FA 3GJ0A 4YR9A 4F9FA 4UPVA 4YMMA 1QSGA 4AX4A 4FGZA 3FDZA 4I8DA 3BFKA 3VNAA 4UQOA 2P90A 4XWWA 1V95A 1EFPA 2X58A 2QENA 4F4YA 4ZU3A 4DQPA 2AGVA 1P2GA 6CHYA 3DXYA 5D3QA 5AVJA 4FN5A 3VV2A 3I01A 4PG7A 3MGCA 4UAUA 4YRPA 2DR2A 4D1YA 4F0JA 1RRMA 2XUKA 3CUUA 4BE4A 5KYTA 1E99A 1IZ7A 5A3JA 1THMA 4A2PA 4QBIA 4QU0A 3M5WA 2I2CA 1ESNA 1KSHA 3G6XA 1ZNZA 2UVPA 1W87A 3T3PB 4RTOA 3CUKA 4TYNA 2DY0A 4GI5A 5K9ZA 1DO8A 1FBTA 1YCHA 4QM7A 2FLNA 1UBNA 4GZ5A 1GGEA 5CVUA 1WQ4A 4FGWA 2G08A 3IQZA 2IU6A 4ZVUA 4J0QA 2B7LA 2GBIA 4PRZA 1XQ9A 2HYIC 5BSRA 3OC0A 4PFJA 2WHYA 4JHLA 2WUVA 1SXHA 4HOYA 1QMPA 3DBIA 1I4LD 2X15A 3K0FB 1GJRA 3X1MA 4ZKEA 2IUFA 4RA9B 4NOKA 3NUGA 3W8DA 3PV8A 3OHMA 4PM4A 5EJ8A 1R00A 2EEPA 2MIIA 3E0QA 3JZMA 5IIKA 1HO3A 4WCDA 4D42A 3A1EA 3BN3A 4M1YA 4XWYA 4YRTA 1B6TA 1SXIA 1K88A 3KBBA 1X94A 1DU4A 1J9EA 3Q5DA 4FE4A 1KL7A 3EMKA 3A37A 4E13A 5KFHA 4KR6A 4YP0A 4MWSA 4DL2A 4I55B 1QCDA 4AM8A 4M46A 1D2NA 3U3XA 1P4SA 2E5LB 2IYQA 5I7FA 3KKOA 4NXZA 1XTBA 4FIZA 1VPLA 3MJTA 1T3LA 3OTOB 3NORA 3VZSA 1Z2NX 2QG6A 1P5ZB 4HQRA 3ZHVA 3BWEA 4NK5A 2QXYA 1MOZA 4JSRA 4BB9A 4QRHA 1KZ4A 2OFXA 4C4XA 4B81A 3WK9A 1YTUA 3OE7D 2VCHA 4G0OA 4FR0A 2YVQA 3E9ZA 4EUKA 5DBHX 2QYSA 4JCCA 3KHTA 1HOTA 3G88A 3UBMA 1YT5A 3ZWXA 3PFFA 3NEJA 1W4RA 4BFZA 4H3KB 1VKHA 1X9IA 4USAA 5FBLB 5CNJA 4N9WA 5KINB 2XPCA 2GPAA 2Z4TA 3D4PA 3UANA 2AJQA 1RZUA 1P1CA 4JJKA 3CIFA 4NZYA 3ZV4A 1U3WA 5I3ZA 1UMBA 5LQSA 1NK5A 4DTIA 4EA8A 2YNMC 1ESDA 2F00A 3L8DA 4HLQB 4B4UA 2GNAA 2GASA 4OJQA 1BX3A 5JFOA 2A59A 1MPTA 1ZLXA 4ER6A 2L17A 2FZKA 2D5CA 3B1KA 3FFTA 5H3HA 3SSAA 2OILA 4E1VA 2QLLA 2R18A 5F2EA 4INJA 2I4OA 1RPZA 4KYUA 4I19A 1GPYA 2HRBA 1PVVA 4Y2RA 4DAOA 1CIJA 5IN5A 2JGNA 1TMYA 1ZH8A 2PX4A 1XHLA 4II2A 2DG2A 4MS4A 1VP3A 2IIBA 5AKYA 2PR7A 1UOOA 2XIJA 8ICQA 4EF5A 2NRTA 1WKCA 4XASA 1ZMXA 5EPOA 4FGUA 1T6NA 5EJAA 4IYJA 1IXKA 2IYWA 3AVOA 2OL4A 2QUJA 2ZWOA 3Q6IA 2HBZA 3IRVA 4PTYA 4HL6A 4GHWA 5JZVA 1S10A 5MN4A 1SEPA 1FP7A 2R1ZA 4ITVA 4YFVA 3TRDA 1JXEA 4NLCA 4P92A 3LZCA 1QFSA 4QOHA 3ZBPA 1KYWA 1V8BA 3IDSA 1I1NA 4BMNA 2ZXIA 4RD0A 3LK9A 3ZEAA 5D3ZA 2Q2NA 1DAGA 1JIUA 5KG3A 1W85A 2NAPA 3EXG1 2EQAA 4DLYA 3M6KA 1TYBE 4HDNB 4NEQA 2ATIA 4OXXA 2RD2A 5C0YA 3OZUA 5KTMA 2Q1XA 3AVWA 1Z4IA 1JT9A 2WF8A 3EXAA 2FW1A 2ZLBA 4DXAA 2IP4A 1YB6A 1Y9JA 2ZUTA 3FNBA 2ZRLA 4YH1A 1F60A 3ROFA 4D44A 2C7OA 4X61A 1DUIA 1QTIA 4YJGA 4LVCA 4QAQA 3MUOA 4R8SA 4JBNA 3UENA 4INZA 1DBWA 4NNJA 1KMNA 5CH5A 3A1TA 3I12A 1PTJA 1I2BA 3CJRA 3OHAA 1U3DA 2F7SA 3PDIB 3UXNA 2P8JA 4KQ6A 4L2IB 2JBWA 4R71A 2H5JA 3CYFA 3ESXA 3TJZA 4GSKA 4CQMA 4KR2A 1I4OA 5EKXA 4YDHB 2CEAA 3C98A 1SVLA 1IXZA 3MNFA 4MZXA 5EIEA 1P0PA 1FMFA 3KSBC 3WQQA 1QQ5A 3CC8A 3FETA 4RTSA 2VT6A 1KI4A 3DFIA 3EOAI 4E4YA 3E82A 3RRYA 5K3BA 1M8KA 2DBQA 4R65A 4ZC1A 2XA9A 1GYRA 3HRHA 1KEPA 3GPDG 1N75A 4E6PA 3S6JA 2FMXA 2XY5A 3E2PA 3QRWA 2Y8EA 4YWHA 3LL4A 1Z39A 3IR5A 4C0BA 4A82A 4BX8A 3VR4D 5F5NA 2JI4A 3BOSA 3W6PA 3QMMA 1ECJA 5KFYA 2B94A 3OTHA 4EB0A 3V7NA 4RIEA 3AQ4A 2JLRA 1L1EA 3TR6A 1OLSA 3QEMA 3QW2A 4ZH4A 3K70D 3QVSA 1CI4A 3FDXA 4EHKA 1HTBA 2P27A 2A33A 3LUKA 7GPBA 4ID9A 1RTKA 1QK5A 3QIAA 5B4TA 2V6IA 2H4JA 5BN5B 4LJRA 3GWGA 3CONA 1XCOA 3Q8WA 3OD5A 3QEAZ 2BHSA 1ITZA 3N0TA 3I1IA 3I01M 3VC1A 4EH1A 2XXAB 2J0VA 4TTAA 3LWZA 3ONVA 1UQVA 3AI1A 1YGPA 2QMZA 3CE6A 3VNQA 1OAAA 4F3KA 3GEDA 2H17A 5HNKA 4QWMA 4YRSA 3SIRA 3WU2U 5C5DA 1Y1TA 3UJ9A 4PINA 3T5HA 1UIRA 2QT1A 2FN9A 3T4EA 3VISA 1RZRD 5EVCA 3SZRA 4WD3A 3ZXSA 3PNBA 4RVSA 2PUJA 3GJ5A 4FO6A 1O4VA 2X2EA 2M6LA 5J2TA 1YOVA 1ZZGA 1UANA 4TS4A 3QX9A 3WGTA 2CD7A 3NVKI 5ED0A 4BMDA 5K05A 3BB1A 4DCPA 3AF4A 1QAOA 1JRLA 1XS9D 1Q84A 4HX9A 1N78A 3UFXA 3M0EA 3LKBA 2HIMA 5LWQA 1T9KA 1UPXA 2ZIEA 4F4XA 2DULA 3DMDA 3NDRA 3CWQA 1DBIA 1D3AA 1DOQA 5D6OA 1K1EA 1JQJC 2DBRA 4J3NA 3G9QA 1KYZA 2QSYA 3FOFC 2DPMA 1KJJA 4FX5A 2WY2D 1APBA 1I7QB 2CSXA 5J2IA 4I55F 3L82B 4WY8A 5FXMA 3OPVA 2CLFB 2A58A 2I4LA 2CMGA 1Z3EB 2VHCA 2KZMA 1PVQA 2EKLA 1ACLA 2O2IA 4GX5A 4WL0A 1F8GA 2OHHA 3LYHA 1SCJA 3MCTA 1QTQA 1SZPA 2P66A 1G42A 4N4AA 4Y1GA 1NYTA 3E7WA 3DF7A 4KH0A 3C3EA 4HTFA 1Q11A 3PJRA 1D6SA 3NHLA 2J0UA 3U13A 2EAUA 3JYOA 1KOGA 1M0TA 2VHVA 5KTSA 5G1OA 2H65A 1WCIA 3G1WA 4LDQA 4MW0A 2VEDA 2YJ4A 3IOBA 3TIIA 5J8YA 2PRZA 1IY1A 2XRMA 2XQJA 2OSVA 4AMZA 2WUDA 5HJ2A 3I0MA 2J48A 2OLJA 3BEDA 2SCUB 4OJKA 5IUNC 3FNEA 5KYXA 3VJLA 2H51A 3NALA 4LXYA 2SBTA 2D0IA 2QTZA 4DN6A 4PTZA 2VJBA 3IMKA 4KLMA 4ND2A 1SKBA 3OJEA 4URFA 3SKVA 1UKCA 4DPMA 2O8FA 5FWDA 1Y9EA 4IV0A 1GIAA 2Y76A 5TB5A 5CFOA 4Z54A 5AUNB 5H2FU 2QL6A 2D54A 2YN2A 1JTFA 4ZYTA 2FZEA 5A5EA 3F96A 3MINA 4AYWA 1M2OB 2TMKA 3UYLA 4BGDA 3MCZA 3OUUA 1BW9A 2D7CA 2GKGA 3UMYA 4BX0A 1GM5A 5B57C 1OLOA 3DFMA 2KZ3A 4QPNA 1VLBA 3HYSA 2ZB7A 5EXSA 1GSHA 3K2EA 3RD5A 5CEHA 4P4LA 2AC7A 4JA0A 2XB8A 4QSHA 5GV7A 3S0JA 2ZSIA 1PFYA 4TXNA 3N76A 4L6AA 3TFOA 1Y34E 4BVFA 2O14A 4RVNA 1HYHA 2LR0A 2JFFA 4KN4A 1NG1A 1RJDA 2Q5LA 3MUFA 2LMRA 2VZEA 4ESVA 1E3LA 1KYQA 4MWOA 4RHYA 2DT5A 4ZVOA 3TFWA 3MFIA 1FYVA 3JZFA 2H2HA 2VSFA 1NUSA 2Q1YA 3UJ6A 4LV6A 5BSWA 1FUIA 1BNCA 4QU5A 5JI2E 3SFTA 1C1XB 2WQ7A 1KO7A 1W4CA 1VGRA 4JT2A 5DI3B 1N56A 2ZTHA 4YMHA 2Q4BA 3M2TA 5DBAA 1X42A 3PHHA 5BMVB 2K4IA 4J4TA 3WB9A 1HNWB 3TAXA 1FFWA 1TTPB 3OG9A 2CXXA 3HK2A 3RR8A 2Y66A 4S1VA 1DGJA 3I34X 3ZHQA 421PA 2RK6A 4IVPA 4GQBA 1E3TA 4R31A 3AWIA 2TRSB 3UV6A 1RYDA 4MV0A 1HEIA 1KQNA 1F2TA 2NUPA 3KZ1E 5EJ5A 3UAGA 2JGJA 2Y77A 2ONCA 3DT8A 2IZ6A 5J59A 4U6NA 1ISPA 1E9SA 3L6UA 4YY3B 4DHEA 1EAMA 4L5BA 4DIEA 2F59A 1Q3VA 1T8WA 4D99A 4O3FA 3L0OA 3F8WA 4I08A 2Z6QA 4URYR 5KVVA 4G3IA 1U3FA 3B5JA 2B98A 2IMWP 4FZVA 4ZHSA 5MGBA 2QPOA 2UYGA 2BN4A 4URHA 1D2GA 2WD7A 4GXRA 1U8UA 4Q05A 4DSJA 1IQ0A 4BKPA 3O8RA 3MD9A 5T6BA 1GZ3A 3LKDA 3U4QA 1J0AA 1GYPA 4NBSA 3O21A 5CT9A 2JA2A 3WLOA 5JQGB 4GL2A 5DWDA 1P0CA 3HWTA 1YZFA 3OOEA 5A7GA 4ZDIA 2XOEA 3KJIA 3L3BA 2Q4TA 1TTHA 2QN2A 5JANA 2Y92A 5KSPA 5KSWB 1XZPA 5DMHA 4PZLA 1EVQA 1PR4A 4O0LA 5B7NA 1PEAA 2GWSA 5BVGA 1B93A 3I28A 2WHXA 1NBMD 1A9XB 2V55B 3AU9A 4ED3A 3IIIA 4O9MA 4OJPA 3NIDB 3MGAA 1U7DA 1CJVC 1JHYA 3EIHA 3Q9UA 1DEAA 4NM2A 5DCWA 1GZ5A 1PL8A 3W6ZA 4WJKB 1G6HA 1EE1A 3PE6A 2WDPA 2VPZA 2Q27A 2HBYA 2I6TA 3ZEIA 3RIGA 2YZKA 4TXMA 5A02A 3KKEA 5CIWA 5DGBA 5GTHU 2O2EA 3RYFA 5JUMA 1VJ1A 1DRWA 1BE1A 5ESXA 4TV8B 5IABA 5KVSA 1MHPA 3MCAA 4J9OA 1YAHA 4YTEA 2K87A 4PZCA 4W6QA 4I8XA 1QB8A 4YXWD 3R3XA 3G2LA 5B7GA 4PBTA 2ZI6A 4ATNA 1HOXA 2I62A 1A9RA 2WJZB 3QOWA 3RSZA 1LTKA 3O1IC 5CA0B 2IPNA 5JV5A 5L4LA 5BR4A 4HAUA 2FFJA 2ZR8A 1KXJA 3VO2A 4U9HS 1V3UA 4B17A 1KBZA 4HSGA 3DOCA 1XVLA 4QNLA 2ODNA 3H9GA 4OAOA 2ILTA 1ISGA 5C34B 2H31A 1T1EA 4Q1VA 2MINB 1BXKA 5G0UA 3ZQ6A 2O0MA 4YRFA 4FUTA 3OZVA 5KNBD 1U49A 2GKOA 4LCEA 3W9SA 1Z37A 2NX2A 3GDFA 5KAMA 5K3FB 1LNQA 3E7XA 2PFSA 2R1VB 1F2DA 2C2WA 4DXDA 3ZOZA 3HJNA 3ZGVA 3IMCA 1XQXA 2W8BB 1C7QA 1Z0IA 4K6HA 1C4XA 3MQ2A 1E4EA 2PGNA 3RS4A 2B1QA 3EG5A 1S9FA 1NVMB 2YJ5A 5EZQA 1ULZA 5FORA 2IRWA 5DISB 3TIFA 3PXGA 4NBUA 3TLGA 3UQ0A 4PXYA 2C7RA 2AU0A 1S3FA 4Q18A 4PPFA 1PK7A 3CG4A 5FF9A 4IINA 3D6HA 2R8PA 4B34A 2G06A 5C46F 4ACBA 1SQ6A 4XRRA 4PU0A 4G5HA 3PUXA 4ZZ1A 2FW8A 4QWAA 4X41A 1SXPA 5KIAA 4B6QA 1US8A 2HMAA 1OKKA 4GRAA 1MSWD 3I4CA 2C1ZA 3ER9A 3HXKA 4BB5A 1A7AA 1I33A 1ZW1A 2EXXA 2LV8A 3VBEA 1A9OA 4URZR 3FWHA 3I53A 1JDTA 2VF5X 2RDIA 5CAEA 2P2NA 1FP1D 5D6NA 4TL9A 1DFIA 1WSWA 3A1FA 4E94A 2YJZA 5KTKA 2AOTB 1X0VA 2BFOA 3MG9A 4X3PA 3SV3A 3H9BA 3EUWA 2ZAOA 2H11A 2ODEA 1JDNA 3OP1A 1JDBC 1Y6FA 3FTFA 1F2UA 5A6SA 2X3UA 5JCOC 1TZCA 2A0XA 5IKXA 2G4CA 3P7MA 1J1IA 2KHVA 2D3WA 3L4PA 5AI6A 2J3HA 3Q6MA 1G5PA 4PZAA 1SU6A 2H7CA 1H0SA 4MDFA 1RE1A 4P5DA 5KYVA 1RC8A 5DSXA 2QD1A 2AJDA 3C3AA 3SMVA 2OBXA 3QWAA 4MKXA 1R18A 1FFCA 3G7NA 3I1FA 3WLTA 1O95C 3C6KA 4C7VA 4P3XA 1FU8A 4OJOA 2C54A 4OBWA 3GW8A 1XKXA 4IUDS 1TKRA 2D74A 3SF8A 4A6DA 5E0KB 1KK0A 2W6OA 3KXLA 2AYXA 4EX7A 3LQQA 1NVTA 3U26A 3ETHA 3V5NA 2QN3A 5BMVF 1GA1A 3TRKA 3DE2X 2X6TA 1JDBB 4OYHA 5CB8A 4WECA 1PJCA 3I32A 4KODA 5IU6A 2VH1A 4RGBA 3CH7A 2ZJ3A 2ZVQX 2VWGA 1OUMA 4MVJG 4WXPA 1HLPA 1G2PA 3HXQA 3PJDA 4IEIA 4CKBA 5JPDA 4DBVO 1S7CA 4BWGA 4UTPA 4HQFA 1L5LA 3DV0A 4WACA 4Q3DA 5JNTA 1WUIS 2E4WA 4RAQA 1P7DA 2K5UA 2BF4A 4EYIB 2YMPA 4C20A 4UAZA 4OHRA 4EL0A 3DG9A 4IGEA 3RANA 1YMUA 1Z2CA 2ASDA 2FSVC 3L41A 3PC8A 2CZQA 3UOWA 1EM8B 2QLMA 4GQAA 3DQZA 1RBYA 3GV8B 2A5GA 1OOEA 3N97B 3ENWA 3VUEA 1ONOA 1JX6A 3GD5A 3K1AB 3ORQA 3ZJUA 3JD4A 3NKVA 3PR5B 2O6KA 4IQ8A 2BZ0A 3GRVA 4ADSG 8GPBA 1C7ZA 3BVPA 4RK0A 4AY4A 5JQGF 3WSTA 4WGGA 1SBYA 1EP1B 3FYUC 3RT1A 1V1RB 3H8VA 3TI0A 2ZIUA 2MOKA 4AO8A 3MJEA 3NC1C 3MSXA 2BPGA 2G36A 4ZVPA 3TW4A 2WAMA 2A92A 1KI8A 5IZ4A 1R2QA 1EAYA 4IRUB 5EMHA 4MQMA 4QTTB 4HQ6A 1SKMA 4IQFA 5G4KB 2IS2A 1TZ2A 2FUG1 3HG7A 4MS1B 4R8UA 2BI8A 4YRJA 3RFUA 4B73A 3WG9A 4P32A 2IEGA 5FH9A 4HS9A 3RT9A 2BRUC 2JRCA 4M99A 1VHWA 4P3NA 4AZ0A 5DWVA 1NZBA 2ZTCA 3HTXA 3S8MA 1UM9A 2RSLA 1GCUA 1OC4A 3WA6A 2EJBA 3K9HA 4Z2AA 4J7CA 4BJ5A 2O1EA 2BFDB 4IZIA 3ZR4B 1KL9A 4X1KB 3AF1A 4TV8F 2PZFA 3P45A 4DM3A 5JCZA 1IN1A 4UB2A 4DQSA 4HUQA 5AKHA 2PD3A 4DUZB 5IARA 3FPHA 1IOLA 3RYTC 3E1GA 1Q7BA 4DANA 2AXTU 5KMGB 3O03A 4Q3EA 1EE2A 1HLFA 4IJKA 4LMAA 5CA0F 1JAIA 2P6UA 4BN0A 3ISDA 4TT8A 3GAAA 1L5WA 1AUVA 4L72A 4O4HA 2FSSA 2VRBA 1R4MA 2FPSA 1J1UA 2ZAYA 3NVVA 4KAAA 4H18A 1BNPA 2IDZA 4H6WA 2FWNA 3VPCA 2VLBA 3EPIA 3F78A 2ZRNA 4RXMA 1MRZA 1TQ2A 2JRLA 3ANSA 5GP1A 1M54A 4F56A 1BCSA 1JR3D 4N7RA 3DJYA 2WZQA 2O2XA 1P2FA 4Z0TA 4B84A 4C0SA 4E11A 1DO0A 3PGMA 4R2KA 3JQQA 4TKUA 4P2BA 2N47A 3QKWA 3DHWC 2P69A 1Y6QA 1ZD5A 3MB5A 5U9CA 4Y2GA 1I30A 2HCBA 3NVAA 2A94A 2IY7A 4NL9C 1GUZA 2NQTA 3HKZF 1MTZA 3EZNA 3CLSC 1PX2A 1E69A 3GGCA 2B4YA 1YZYA 2ZBRA 3ILVA 2W6ZA 3CLSD 3BS5B 1XEWX 3PBKA 3QW4B 5K0ZA 1OLXA 3K4HA 1Y37A 3AJ9A 2XUFA 1KFJB 2E9SA 13PKA 1CX9B 1Z26A 3MJVA 2KE5A 1OPXA 1QCCA 4FFDA 2B4QA 2ZI4A 1YVRA 1E59A 4U7GA 2KE7A 3WLHA 5K6TA 3DUWA 1KYTA 3R9XB 3ESZA 3F4KA 2BFEB 4HAZA 4IJ5A 1JG3A 4GRDA 1R50A 4TV9A 4URWR 2FZVA 1AH2A 2NUTA 3BTSA 3REOA 3PIRA 2WVGA 4EI7A 2QDKA 1FFVA 1QPGA 2BC9A 1P8JA 1SVKA 2ICAA 2DLCX 2GBGA 7MHTA 2PLAA 4OHUA 4YYZA 4C76A 3C6QA 3CVWA 1Y4ZA 3AKYA 2YOGA 1GGFA 1M3SA 4K9RA 2VYQA 3SSOA 1QYDA 5F23A 1P39A 2YJ6A 5GMOA 3EH2A 1EVJA 1HFKA 2XA2A 4UMDA 2FK8A 1J09A 1T3GA 4C8OA 4UM8B 5AXBA 1X1QA 2JFBA 4OREX 2G9VA 2GM3A 1YKGA 1XDGA 4MCIA 1HG0A 3WLLA 2XVMA 1YASA 3JQ9C 3PC3A 4HDSA 5K6AA 5F3RA 1B4FA 3KKQA 3H75A 5FOWA 2OD7A 5BSHA 4CM3A 4P54A 4DM7A 2E82A 4KBFA 3V1YA 3NNSA 2IX3A 2IBSA 4F71A 1LJLA 5F73A 3RNOA 4TRRA 2JGDA 4WGFA 3RJGA 4F1JA 1MOQA 2ZYUX 3EZGA 5C7OO 1KDYA 2DYKA 1D6MA 1T36B 4RVGA 3DKRA 5EEHA 5KNDD 2FF7A 3QLUC 2YHBA 2YOFA 3T3OA 1KFCB 4JBGA 4BFXA 4MIEA 2OAQ1 4EB6B 1Y98A 4I5FA 3R23A 4QXMA 4JIMA 4H08A 2GTHA 1E6LA 1NYQA 3ZWYA 2YFKA 1YR8A 2WE7A 3QEBZ 4PN3A 5JATA 3SKXA 3L05A 2VJNA 2P1RA 4FZLA 2BZGA 3TXXA 3P2EA 3EUB2 3AHHA 3UO8B 3PRYA 3H2GA 4Q8EA 4DQVA 5L1IA 1NK4A 2Y71A 3M5CA 5JNVA 2GVNA 2J07A 2PH7A 5JYEA 3NOXA 2CVZA 2DQYA 1YC2A 4JKIA 4YUZA 5I9SA 4WH0A 3STXA 3FNQA 4RETA 1Z17A 3SSNA 2PMKA 4ZYXA 4DPLA 1XQWA 5J0TA 3HEMA 4JX9A 3H87A 3QPBA 4AICA 2VJPA 4W9RA 1NNLA 4MR8A 4FFPA 5K4LA 1TYDE 3PO4A 3I2FA 3RRHA 3R5SA 1TKAA 2A1TR 1QM5A 2Z9BA 1T4CA 1Z6QA 1Y1PA 3G2MA 4AIRA 2DH5A 2QZ4A 4MVJM 3KYJB 3TQFA 3C5GA 1GO2A 1NY6A 3USCS 1UDWA 5K0SA 2C9CA 1DDGA 2YVAA 4C7OB 4I2EA 2IQ5A 4YJ3F 5LBIA 2B9VA 3PUVA 2C83A 3UW1A 3AU6A 2H4FA 1ZQDA 3J81k 1Z4JA 2XBLA 2SKEA 2PMDA 3ZY4A 1IB0A 4R54A 2NYRA 1YDHA 3GLQA 1T13A 1TT5B 2GEBA 4PZ0A 3KSAC 4X5OA 4FBMA 1E92A 1PDWA 3V7YA 4YMWA 3LPNA 2GEVA 3C7KA 1JKIA 3K8QA 1DSSG 4P22A 4B43A 1H85A 2J7PD 1W94A 1V8PA 3GT3A 3OX1A 4RIHA 1FFSA 5AKEA 1MP0A 2OG2A 2FZ5A 2I3DA 3T0GA 2XB2A 5JSUA 3DBRB 3OFND 1AF4A 1AB6A 2J41A 2EX0A 1CUDA 2DETA 1H66A 1KA9H 2HPZA 3BWXA 4G0MA 3PEUA 1ZBQA 1ESCA 1O54A 1SELA 1W8DA 1CJSA 3SYTA 5H82A 4M0UA 5E9WA 2FMFA 3ROTA 5K20A 3BSFA 4FBTA 2BGIA 1PNTA 5DM1A 3RHTA 3ROXA 1NKEA 1CUAA 4FHCA 4IJ6A 3R7LA 2O0JA 1B42A 1VLHA 4DWWA 3DZCA 3U49A 1OXMA 1I3MA 4MKZA 3G3EA 3C2MA 1C3OB 1CWUA 4E88A 4LISA 2D4HA 1BJTA 1HRDA 2CUKA 4LHVA 4C78A 2MR5A 3FWYA 1U11A 4YV7A 1JT2A 2POQX 1AXGA 4EL5A 4LSZA 3A7EA 4AC9A 4KIFA 4HPJB 1K27A 4ZTZB 5JUWA 5EA2A 2QB0B 4ZO4A 2NO1A 1D0IA 3K8OE 2ZU0C 3B89A 2RGYA 4TL8A 3OSPA 2V59A 1T15A 1VFPA 4QPPA 1FFYA 4IS7A 2QRQA 4M4SA 3R7AA 5DRYA 3CRVA 4Z4HA 1GGNA 1YVUA 3H9CA 4NL4H 7AT1A 1Y42X 4PZZA 4ELTA 3CLUD 1MO2A 4JXZA 1SUWA 2H1IA 3KJZA 4K6OA 4S12A 2C3PA 1KWGA 5HFAA 2E48A 1L8AA 4V0MA 3BHMA 3MYRA 1M2FA 3ZLUA 4MDHA 1YS1X 1V5WA 3P9KA 4DIBA 1X80B 2V97A 1U7UA 2PK3A 2PANA 4M9XA 5LP1A 4QWBA 1DOZA 3BMQA 5FTLA 3D1JA 3JPPA 4IRDA 2OYCA 1RXCA 1K06A 3KG2A 1R88A 1NASA 4MX8A 2J1LA 2RBGA 2YYSA 1DKQA 4ECRA 1VPTA 2WPDA 3FTEA 3Q9SA 4L0DA 5REQB 1JHVA 1W46A 3S7ZA 4Q5IA 3AUYA 1VSUA 3ITNA 2VHTA 1OBHA 3NAMA 5JO0A 1X7HA 1H2ZA 1OZHA 3OOJA 1QZXA 1LCIA 2PSDA 2OKGA 4P98A 4KQKA 2PH5A 2OM2A 3FSGD 2HRRA 2D6FC 1M7GA 1DAHA 3PEVA 1QO7A 3DEIA 4J29A 5KYUA 3CPHA 2OBBA 3BDPA 3IE0A 4IQUA 3AGPA 1JAZA 2CVQA 4L8GA 1BG6A 4QW9A 2IYPA 1TAQA 4KXYA 2AMLA 1IV8A 1XJ5A 2D59A 3R0XA 1VMEA 3GL9A 3BXGA 3K9NA 3GDHA 3SAGA 5LP6A 4EZIA 5B66U 4E1AA 1IH8A 3SNHA 1QANA 2E49A 2W42A 1JU3A 2HVHA 1J8MF 3BBPA 2RK4A 2NVOA 3BCRA 4QHYA 3LAWA 1ZOIA 2ZBDA 1YBAA 3DA8A 3GJ8A 1C80A 4CLHA 2ZIFA 2HLPA 1CHNA 2OXTA 2OB1A 2FB9A 1IY2A 3HDQA 4FBLA 4BAZA 1L8XA 2C4NA 1C9YA 5IIJA 3LHSA 3M1LA 2B8EA 5J2AA 1OZFA 3BMCA 3FGOA 1XSPA 2IZOA 2J4FA 5GZ1A 3NEYA 1KJ8A 3HU2A 3K05A 4D4MA 4K6MA 3GXBA 2OYSA 4Q48A 3LC2O 1OWOA 3RVPA 2OVBA 3E53A 4BGVA 2OQVA 4I4TA 5K4AA 3V80A 4ICIA 5A05A 3KZNA 1RYZA 3QENA 1R64A 2Y1WA 4ALIA 1QIJA 5AW3A 1TAMA 1T3NA 3TDNA 1WCV1 3LOPA 1QS0A 3DW1X 4BKOA 4FE3A 2P11A 4DMGA 4EHLA 3ANLA 2BH2A 3VBCA 2YS6A 1MAHA 1IM2A 1XLWA 5TXGA 3IP7A 5JSHA 1YE5A 2WVAA 3F2VA 1J06A 3GRAA 3U4IA 1CYEA 4BJHB 3UHOA 3FZEA 4DFMA 4LYYA 1G3QA 2PLFA 4RVDA 2Q0XA 1O9GA 4WBSA 5HZKA 1CLUA 4LF9B 4TWBA 3PQ3A 1FMLA 4YJ2A 4MHVA 1Y9AA 1V8ZA 5CRIA 1S8AA 1ZMOA 2J6SA 3QYFA 3R74A 3H5RA 2Q4DA 4GI2A 5EYPA 2BFWA 4LDZA 1I4EB 3TMKA 3Q8QB 2O19A 1DT3A 1QH8B 1X6VA 5IJXA 1CPYA 5BOLA 4WK0B 1OREA 3KPUA 2WG2A 1AJEA 1PJ8A 1K97A 2FN4A 2Y1GA 5JMTA 3ZHZA 2RARA 3UWKA 4K1LA 1UPFA 3S2IA 2W4MA 3ONEA 4E08A 5KHAA 2XQFA 3EFHA 4F5RA 3EZLA 4RDIA 4KYTA 3UYKA 2LWIA 4F46A 3V4RA 4CG3A 5I4CA 4LXUA 1IN7A 4U7DA 1E2MA 3HLYA 2Z4SA 5JCJD 4LBWA 3G5UA 4W1SA 3LLVA 1KHHA 2OC4A 2ENUA 5F9FA 1OE0A 4TLBA 4DR1B 2UYQA 5CRXA 1ZQOA 2LD4A 3DWEX 3NB0A 3J81A 3VC8A 5LL6P 2Q3LA 4QT4A 1JQKA 2XYGA 4JP3A 4FI3F 4HNVA 3N58A 2I03A 1SHTX 3TEJA 4O1MA 4Y6RA 1Y6RA 2WOOA 1H1LA 1FP2A 2H8GA 4ZMRA 1T6ZA 5EWLB 4C4RA 2OD2A 5DM70 4EKIA 4Q9NA 2HY7A 2WWGA 4EABA 3IXMA 2KFNA 1WUHS 4UB6U 2QTGA 5AI5A 3PITA 1JPJA 3WAGA 3HKEA 3WFZA 5DJ5A 4FNAA 5J47A 3QP9A 2GR9A 3S1AB 4FHZA 3B53X 2R6ZA 1QK3A 1ZRSA 2BW0A 3HHPA 4X3CA 3ZVLA 5CA1B 5KTYA 4KLHA 1XF1A 3DBHA 4QQ8A 5JSFA 1LBTA 3VYWA 3NHSA 1CJCA 3RSHA 2BFAA 3I5MA 2ECPA 4RX1A 1H4SA 1YUNA 1ZQPA 5EJGA 3QPVA 3VVBA 2WSMA 2L0XA 2GO7A 2X6RA 2BFFA 3QITA 3RS5A 1KBQA 3U0VA 2IZ1A 2JGKA 1F1BA 2HK7A 5J4HA 3QE4A 1JIHA 3SDZA 1DTWA 3LYSA 3KQVA 3ZHRA 3E8SA 2YHSA 2NZXA 4MVJI 5BWBA 2OP1A 4UNIA 1ZCBA 5IEJA 3A0UA 3RVNA 4D4LA 1J2NA 2ZIXA 1P3Y1 2H85A 4K46A 4QZ8A 3GHYA 4REQB 1RYFA 2EJVA 1DL5A 4Z7OB 2RGDA 1V38A 1JU4A 3L4BC 5IT9A 2R8GA 1M1NA 1Y8CA 4ZI7A 5J2DA 3TLMA 5DBOA 3EIOA 4DRYA 2QX9A 2VAMA 5FBRB 2NN3C 4Q9KA 1RM5A 1YDWA 3GZTB 1KI7A 2XCOA 4L4SA 1D2HA 2ZEJA 2GWHA 3SIPA 3U6KA 1W4AA 1EHYA 2VJDA 1DJQA 4YAKA 4L22A 1JLLA 1N2OA 3QVGB 4YRAA 1QIHA 4RK6A 5ALMA 3WWEA 3FNHA 5KEIA 4MQFA 1PYOA 2ZSUA 2XI9A 2YB4A 4AN4A 7REQA 1VJRA 4KMOA 3UUGA 5AVKA 4MV9A 2PT6A 4RVFA 4DLTA 3RV3A 3LI2A 2GEUA 2V9PA 5KFJA 2MJLA 3KLBA 2C7QA 4LFBB 2IXAA 3LUCA 4N39A 1JECA 4XOUA 1HFWA 3HE3A 3JQRA 2HRDA 3FPEA 1RKQA 1E79D 1OQAA 2SKCA 1MQ8B 5EERA 4XYEA 1VA4A 4EVQA 1RHJA 5ALEA 5AW5A 1L3CA 1MPXA 4D9CA 2YNMD 4F8YA 1NGSA 3N2YA 2CLOB 5K09A 3ESBA 4OU5A 3B9RA 4IIFA 4J9MA 2F3UA 4NSNA 4LA4A 2PFPA 4HEQA 2H92A 5EWMA 2F1OA 4G5FA 3QE3A 4RQ3A 3T9BA 5IINA 2BGLA 3WYCA 1BGXT 1JEEA 5HKBA 2FF5A 1OH8A 5CIYA 1Y4UA 2F1JA 5JDCA 3E4DA 3D81A 4F4ZA 4EKDA 1N2CA 4IJQA 1H3FA 1F1JA 2B8NA 4PO3X 2FN3A 4MYDA 4ANFA 1C7YA 1W88B 4I50A 5DPMA 3L4SO 2C03A 4GXNA 4XTCS 2P79A 1ZOSA 1KOFA 5KOHA 3DLBA 1KYYA 1P2DA 1DPGA 4ZDJA 3FR7A 1P1BA 1MLDA 1UAGA 1Z7EA 3EGXA 5FWXA 2COEA 5H8WA 3AESB 3W1VA 4JJIA 5EQFA 4W5NA 3ID6C 2X6QA 1N5JA 2VL7A 4IDQA 2I2FA 2YV2A 4EUSA 2R00A 3SAHA 4QUKA 3SYLA 2XNJA 5CH8A 1HA3A 3E7PA 2IBMA 2AXPA 3LDUA 4DCNA 4Q4HA 1Q20A 5IIIA 5BN4A 4G67A 2HBKA 1OI2A 5AVTA 1B2LA 3EIEA 4BV9A 2VT2A 1KDZA 5I4KA 1RLMA 2E4ZA 2AEFA 4PSAA 5JOQA 4DR3B 4J94A 1MX1A 1U9IA 1E9BA 2HYDA 2ZYGA 4Y3UA 1J0XO 2Q1SA 4QULA 2Z56A 4LN1A 1FSGA 1PP4A 3D2NA 3KOZA 1QR6A 3NUZA 4GSLA 4C4TA 3FUCA 4Y2VA 2DPXA 3FPAA 2DE0X 1Q19A 2FX2A 4C5BA 5LQMA 3JQ8A 2LBOA 3V9PA 1UFQA 3STWA 4DJ5X 1V1MA 1OT3A 5DBGA 5DCYA 1G8KA 4JD5A 2WDZA 1N9ZA 3TMYA 4MTLA 4OKSA 3GD7A 1GPJA 1Y9DA 3U44A 1ZM3A 1H0HA 1P6QA 2DR0A 3FCAA 5CTJA 1VJ0A 1XEAA 4LJXA 2ZRQA 1KZGB 3G5AA 3ZHSA 1VP9A 1HR0B 3CRXA 4G9GA 1IMOA 1QMGA 2ERYA 1JG1A 4DMCA 1RXWA 2R96A 2PUBA 2UV8A 2VDPB 2R0QC 2BBTA 4EB8A 3HPRA 2QA5A 4HZUB 4EBDA 1C1YA 4HPXB 3JV7A 4EQZA 1YRYE 1XAHA 3DEYX 4P83A 1FRZA 3I83A 5AVVA 5CA1F 1Z08A 3VU0A 5FL7A 3C1TA 1GKIA 2FN7A 4YCMA 3TARA 3FKSA 3KJXA 2NV2B 1QV6A 3MJSA 3GEBA 1RJGA 3D8HA 3N2IA 4X8MA 5EGSA 5I9LA 1Z8FA 1C3JA 4IUBS 4LHSA 1DXQA 2GZ3A 2O7RA 3QH4A 4QBTA 1MO6A 2OP0A 5LYJA 2UVVA 3QOXA 4D8VA 3O75A 2YUIA 3QX3A 4J1TA 1U3VA 1J2JA 4WAUA 1COZA 4UAGA 3F8TA 1K98A 2HHAA 2PE5A 4H7FA 1BQ4A 4X97A 4UBBA 4YAJA 3SKYA 3IP8A 3RUDA 2FH5B 2NGRA 5JBNA 2BHLA 4S2UA 4GLXA 4HLDA 1P4GA 4RMIA 2YWCA 3KQQA 1NJXA 3RE1A 2O7VA 5IVKA 4Q82A 4DEYA 3FOEC 1L4GA 4RMNA 2X0RA 3LKZA 1TUIA 9ICIA 2Y9UA 4KGZA 3WNVA 2PY6A 4WADA 4KOAA 1P9LA 1P9OA 4GG1A 2KLBA 4NMXB 5C7LO 4D0RA 2WKQA 1IJEA 4ZAWA 3ZWMA 2XLBA 2QAGB 1GXSB 4NP6A 2F9FA 3N6XA 4IXDA 1WQ1R 1NF9A 1PR5A 1U7TA 3F2BA 5IAAA 4PX2A 3ML1A 2OR3A 5TT0A 1TCVA 1SUDA 4RY9A 4UNSA 2VXBA 1DTEA 5FWYA 3GJTA 4A8HA 2R8BA 4LE2A 5E6SB 4RNNA 3R3JA 4IGKA 1KC1A 2DQSA 3K9GA 2O8DA 1Y0BA 3BRWD 3RDPA 1H3NA 1II0A 4V2UA 1TQHA 4CHTA 2X8JB 4LVUA 1FX1A 1BROA 1K6IA 3DDHA 1SG9A 3C21A 4NS4A 5JS8A 2GZSA 2ZWVA 4RPCA 1QV9A 4ZVSA 1JSZA 4G9EA 3M6XA 3Q5GA 1X7XB 3Q8RB 3TF5A 5CVCA 3HB4X 2B21A 1IJBA 2CUNA 1AKEA 4B6PA 2HF8A 1KQPA 9ICFA 3BA6A 5B5EU 2OAP1 4YK7A 2IPAB 1GQFA 3O2SB 1Y7HA 4CLRB 1TJYA 5FV7A 1KRWA 1CUWA 5EHXA 2WTUA 2JRZA 2WU3A 2VJ4A 1KGDA 2JFGA 3A0RB 3FYCA 2OK8A 4C8NA 4ZEWA 2KEYA 1F06A 5JLJA 2GN0A 1EDDA 2E18A 3FYSA 3HU5A 3TR0A 4TQAA 1Z2PX 2AUMA 5SY9A 1V25A 1XZCA 3MLBA 2LCQA 2ZYWX 4HQ0A 2OO3A 1G8FA 1U1FA 3K96A 4UKDA 2NUAB 4YRNA 1EP2B 3QA9A 2ZIWB 4ZT7A 2ISOA 5JD4A 4E5NA 2CHEA 4KVAA 3WMEA 2R6AA 3PUYA 4YIKA 4RDCA 2YWEA 4ZCPA 3T94A 2AKAB 4YMGA 2V45A 1S3IA 2DPIA 2BFBA 5A04A 4C29A 2R5WA 4A6EA 4DB4A 1NJ8A 2O4UX 3OZSA 4UEWA 2G28A 2MHCA 2G9ZA 3NIGB 4GLLA 5HKKA 3B20A 5D5HA 3D0QA 2GQ0A 5BUQA 5E4JA 1RC1A 5C1BA 3ZDRA 2PCLA 1JJBA 1UJ4A 1FTNA 3OMLA 3EAQA 5CT4A 3SQLA 5F2OA 2AN4A 3SD7A 1Q17A 5E95A 4MI3A 4LZAA 2ZZKA 3RIHA 4Q7EA 2CMHA 3ZQUA 4Y1RA 2XWQA 4FDTA 3PXBA 2BEVA 3TVYA 3P2IA 2NVUA 5GJCA 3QG1A 2GERA 5KFMA 2IBTA 1YC5A 5ADUS 3RTEA 3Q11A 4FSDA 4PZNA 3IP3A 2ZUDA 3CYMA 4PN7A 2Z83A 4AZ3A 2OYYA 1KRXA 4QOGA 3S27A 1U8AA 1W4LA 5K0TA 1OIVA 2BELA 2GVDC 3S2FA 3D7NA 3KTAA 4C4YA 4YUYA 4S0XA 4L4YA 1EXDA 4XM2A 2M9MA 4V1CA 2JLQA 2BMFA 4HLUA 1DZIA 3VTFA 4X66B 2WF9A 3UB4A 2NZUG 4OQZA 3HVUA 3OPYB 5BV1A 1OHHD 2BGJA 3CUWA 3OU6A 1N2HA 3LCMA 2VAXA 4IP0A 4TYPA 1YMVA 2PKYX 2IWHA 2JJ8A 5BSMA 5IVHA 3EOBI 5TISU 1ZUNA 5KU7A 4KTVE 5CDGA 2BCEA 3GDOA 4GKBA 3L40A 4NFYA 3GNSA 3K9WA 4AY2A 4CZ2A 3KXPA 4IJMA 1IPFA 2BGGA 4ECZA 1M7HA 3MWFA 3QJ5A 3I42A 4D9IA 4JB8A 2P9BA 2JZNA 4ECSA 8ICRA 1TOAA 2IVFA 1UPCA 1S6YA 2VPPA 1KYVA 1VG1A 5HE9A 4KZKA 3ED5A 5DI9A 2W7PA 5INTA 1WBBA 4F6CA 2IU0A 1R0LA 2JJMA 4O0MA 5CXQA 3WB0A 2AR0A 5FQOA 3KCQA 3KHLA 4IDPA 1ML4A 1SZCA 5LXTB 1R0KA 3D8NA 3SM3A 4P4MA 1GPUA 2VP6A 4YJFA 4BU1A 2IYVA 4JI4B 1UBOS 3N7TA 3V33A 2REXB 4B9UA 1L4UA 2QVCA 1HM5A 1E6WA 1JQEA 5CFZA 1ZETA 3RVLA 3HKZC 2C77A 3CV3A 4UHDA 1LX7A 2HWYA 5EE3A 3IQWA 1TD1A 1ZJMA 1CNMA 2VATA 3TCKA 5G5GA 5BN3B 4QTYA 1EUDB 4C7BA 1VRCA 1E1RA 1C7EA 3WL5A 2WYOA 5KFVA 1ZISA 3U1BA 5DK4A 4LJ5A 1UAYA 2ZTLA 4R6WA 3VR5H 1W19A 3B1WA 3TAQA 4DNOA 9ICSA 3MN1A 1Q16A 1KAQA 4IR9A 5HEKA 1M0WA 2IZ7A 4X91A 5KFCA 3UT5B 3P2OA 2EARA 4WNAB 2VJ5A 1LBSA 1JFFA 4AKTA 1EFRD 1IHPA 2P9ZA 2C4HA 1UINA 3GNTA 4OHKA 4CEJB 3BKWA 3TZKA 2ID4A 5HK8A 3H99A 3V1LA 1DEKA 1KETA 1JXOA 4QUIA 3ZWNA 4G09A 3JRXA 3MBYA 2WFLA 2X8BA 3FNRA 4M86A 2AN9A 2CDAA 3TX6A 1ZGCA 2DM6A 1V11B 2OBLA 3F5AA 2V5UA 2C9YA 4CLOB 2DHCA 4YCNA 2GHRA 5C1DA 1KI6A 2OQRA 2PV7A 1J21A 1RYNA 2QJRA 3WBJA 4LZLA 1JTVA 3MVEA 4BNMA 3R8XA 1JI7A 1B00A 4BNGA 1UC8A 4W99A 4IXNA 3R4VA 3FTCA 4EGCB 1CY6A 2WSSA 3VZRA 4WFQA 3SZ3A 4G1VA 1QVAA 3GUHA 2D5IA 3TWOA 5K3DA 4R9RA 5FT9A 3KOWA 5AHXA 3NYIA 1XMOB 3DDNA 3ZXUB 4EW3A 1UBKS 2VF7A 2VH2A 1SCNE 3LMKA 3K09C 2M6KA 2QV7A 2F67A 1EWQA 1TVMA 1KQGA 4M53A 2J3KA 8ICIA 4Q9DA 3KUXA 4CHGA 5KDDA 4E4TA 2FMUA 2I80A 1W76A 3HCAA 2WQZA 4M9GA 4NS1A 4EG6A 2JH3A 3IOEA 3M9XA 4ZV4A 4U2CA 4IIXA 1IHDA 2ENWA 3NWEA 5MDHA 3B3QA 1QQAA 1WXHA 4PQFA 3HZZA 3O94A 1HT0A 2VRNA 3PVCA 3VR2D 4US8A 4AJJA 1QAQA 1SXDA 4X9XA 4P58A 2KFZA 3ZBUA 4JT4A 2F1IA 1PQYA 6Q21A 4F8RA 1P29A 3AHCA 1U0OC 1O95D 1JU9A 4AVYA 4XB6B 1A27A 2C5FA 1Z3CA 1ZA2A 4GMXA 1MABB 4RQ0A 2X2OA 1FOEB 2FLLA 2AX3A 3TG2A 1ZK0A 2ZBEA 4BJ1A 2WUFA 1DXOA 2NYUA 1H8EA 2DF4B 1KEZA 1AN0A 1QX3A 1SOAA 4ZXFA 1IU9A 2FG7C 1EVYA 4M38A 4UZEA 3NFRA 3TADC 5DG9A 5JXIA 1YE3A 4RTKA 4EKGA 3HR8A 1JL3A 4EPWA 5DZSA 2BI4A 2NO0A 2QN1A 4MVJA 3EUEA 1TU0A 1DJMA 1JKJA 4RH3A 4LWZA 4KLJA 4MA0A 5KOJA 2RH9B 2VBIA 2IH5A 3T1HB 1ZVQA 3A28A 5DG8A 1JR6A 1VDZA 3LKVA 3MBKA 4RY2A 1A8QA 3KOXA 3TSZA 1OX4B 1K5GA 1W96A 4RPKA 3RTVA 2LKYA 3H2ZA 2CB0A 4I5EA 4LYEA 4XB2A 4KJZA 4XSGA 3IT3A 3DDZX 3QLTA 3KC2A 3AUUA 3QELB 3ENQA 2CYAA 3EQ9A 3Q7IA 1FS4A 2PDAA 2GCIA 5C52B 1SL0A 3C4VA 1T2AA 1BHO1 2QX8A 4KPUA 2VYND 5GWXA 3J80A 4YJ3B 3H8SA 1NE2A 3RBXA 2EJWA 5JECA 4O2AA 2GARA 1JIKA 1KZ6A 5HRCA 1V8OA 1PHRA 4V0NA 3JQCA 1SVWA 5JBQA 4RLSA 4BAUA 4DLGA 5LUBA 3OFSA 4DV3B 3T7JA 3NNDA 4K4HA 1IM8A 4H4DA 4TMZA 4ZREA 4DRZA 5FBHA 2C7VA 4H7EA 2ZRDA 1UXIA 2IOFK 3H11B 4G0ZA 1CS0A 3K0EA 1AK9A 1YI1A 1E6UA 1SIBE 4JBXA 2HSJA 5KG7A 2B92A 3GT7A 2QYHA 5SY6A 6ABPA 3CPSA 1E1QA 5LXTF 4J9NA 3DKKA 2CXYA 4C3OB 1HC7A 3NHJA 2Z5LA 3WVNA 4IR1A 3PX2A 1BXGA 1E1DA 2XMRA 3LYUA 4HEA6 3T1VA 1QYWA 3AR8A 1YFLA 5D01A 2Q5HA 4HC4A 3IL2A 2OO7A 3QPCA 3X1KA 4UARA 4P0PA 1OUQA 5F52A 2YHIA 1R8XA 5CM9C 1HDZA 3QFHA 2CXTA 5EIHA 2WG0A 2O4CA 1OZ0A 4KMRA 3E7DA 2VYVD 4FNGA 1T94A 1GGMA 2DGDA 4BO6A 3K75D 4XZ3A 4C9BA 1MBZA 1PLKA 4XDHA 4RH1A 3SQWA 3OLQA 4ZI5A 3FVVA 5TS3A 1ZXLA 3JALA 4YS6A 3DPSA 4X65B 3JQ7A 3ROMA 4A1FA 3MYYA 1WZ2A 5CNIA 3D0KA 2Z9CA 4WN9B 2OBFA 2C3UA 1G8SA 1DKMA 2FOLA 3TUZC 3QE9Y 4ENPA 4Y6LA 1FYDA 3QOYA 4EY7A 1O58A 2EJCA 2Q7XA 3VNVA 3CUEF 2JAWA 1QSLA 3FUUA 4GC9A 7ICIA 1GPBA 1M34B 2KW5A 5SICE 4WHMA 4UNRA 5CB4B 1NXPA 2PS1A 1BPYA 4CMGA 4OIFA 4JVSB 5A06A 1SUIA 2IH4A 4YQYA 1SRRA 1TQ8A 1X1SA 1AGRA 4JLVA 5T8KC 1UJBA 2BHNA 5CDTA 1W5SA 4H31A 1W0JA 1OIWA 4JVOA 2P2CA 2NP6A 3ZUGA 3VH3A 2DKOA 1PV4A 1WMAA 4DG5A 4MWGA 3MJFA 4UPDA 1TMOA 4MMYB 5CYGA 4U4AA 1YS7A 4ESHA 5LQRA 1WCYA 3EXIA 4OATA 1XA0A 2Q07A 3K0SA 4UTZA 4O5AA 3FHCB 2J59A 1GKUB 4FDAA 4UTOA 3UXHA 3L9XA 3O4RA 5J3JA 5FADA 7MDHA 4P4PA 1Y3BE 4OHBA 4YMTA 4ONEA 4MPDA 2E3TA 5IYZB