3QYPA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with calcium and phosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 81
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qypA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qypA01
4KX5A 3HLTA 1U2SA 4CE6A 4KYTA 3K1ZA 5AKZA 2OBBA 3FGOA 2P11A 3W5DA 1RLOA 4Y3UA 1XPJA 5AK6A 3L1VA 4IFTA 2RB5A 1U7PA 2JAUA 3N5KA 3NRJA 3P96A 1J8DA 3AR3A 2EARA 4G63A 4UAVA 5AM2A 3NUQA 4C4SA 5AM5A 2YY6A 4CF5A 3UM9A 3N8GA 3SF0A 3N28A 3WK6A 4YCMA 4BEVA 3GYGA 4IG4A 3ZI4A 2GO7A 5ALKA 2JARA 1YV9A 3U19A 2CN1A 4JDPA 1Z88A 2BDEA 3SLRA 4YCLA 2C88A 3QU9A 3MPOA 4Y2RA 2HHLA 4RESA 3A1CA 2WM8A 3FPBA 1LTQA 2G06A 4YH1A 3OCUA 1EK1A 2CFTA 2FEAA 3AR7A 4DFDA 1RLMA 3QU7A 1ZRNA 3E58A 2YJ4A 2WF9A 5IS2A 2FPWA 4L6CA 5AW8A 1T5SA 2MU1A 5AVUA 2QLTA 4EX7A 1NF2A 3KZXA 3U7FB 3NIWA 5AKEA 3M1YA 1RKQA 4EENA 4L6AA 4GIBA 3S6JA 1Z4MA 1CQZA 1TJ4A 1FEZA 1U2TA 5ALTA 4UMDA 2IOFK 2P27A 2YFYA 3FVVA 2OM6A 2RARA 1SWWA 3QLEA 4Y2SA 5AM1A 1Z4NA 1EK2A 4UATA 3WK5A 2HDOA 2PKEA 4I9GA 1Z4IA 5AM3A 4Y2VA 1WZCA 3ET5A 3R9KA 3QU4A 1QQ5A 2G08A 4MWOA 2OA0A 4FFDA 3KOOA 4JB3A 3ZVNA 1L7NA 2YJ3A 5E0OA 1JUDA 3E8MA 2GMWA 3UMBA 2B1RA 3FM9A 4NFLA 4B6JA 1TJ5A 4XQ0A 5IT0A 1Z4LA 3W5AA 2D2VA 3NALA 2FI1A 4RETA 3B9BA 2I6XA 2ZBEA 4UMEA 3WK9A 3MMZA 2FUCA 1RDFA 5AVTA 5ALYA 5AI9A 3WKDA 3OCWA 4HGNA 3PGLA 1SU4A 2ZBFA 2O2XA 3I6BA 3ED5A 5A3QA 2B82A 3UMCA 1ZD2P 1Z4PX 4DCCA 4EZEA 4C4RA 5AW6A 3OCYA 2FDRA 2C8LA 3L1UA 4XPZA 3QU2A 2I33A 4HGOA 4UM5A 4YIHA 2HO4A 3W5CA 1Z4JA 4HGPA 1XVIA 1Z4OA 4Y2PA 3L0YA 2HF7A 5JJBA 3RFUA 1F5SA 1RQLA 3EWIA 5ALJA 2JAOA 1J97A 2HCFA 5AW9A 1VJRA 5ALOA 3ZW7A 2W11A 4F72A 2IYEA 4KX3A 2HX1A 1YS9A 1Z4KA 4G9BA 5AVXA 1ZD3A 1QQ6A 5AICA 3PCTA 3QUCA 2GHQA 2Q4RA 3AR6A 4KN8A 2R8XA 4BNDB 3I1YA 2ZBGA 4NV0A 3PGVA 2YJ6A 5ALWA 3IRUA 4DWOA 1YMQA 1X42A 2B8JA 4PNHA 3W5BA 3L0CA 2P9JA 3HYCA 3L8HA 1RQNA 3WKCA 3TLMA 5AIBA 2OYCA 1Y8AA 2WFAA 3MN1A 3N07A 5ALUA 4QQFA 3DV9A 3QNMA 3WGUA 1L7OA 4Y2UA 1N9KA 3A3YA 3ET4A 3SMVA 4BBJA 4H1WA 2HOQA 3FZQA 1U7OA 3L5KA 4UMVA 1QH9A 2G09A 5ALIA 2R8YA 2JAWA 1CR6A 4DW8A 4CF4A 5AESA 3N1UA 3DDHA 2MU2A 3DAOA 1RLTA 1O08A 1QYIA 4UAUA 1WVIA 4BX0A 3U26A 5AVYA 3AR2A 5AKHA 4YIKA 4OFZA 2CFSA 4J03A 1WPGA 2BDUA 3SHQA 3BWVA 5ALNA 1VJ5A 4OD0A 2B0CA 2NO4A 2PQ0A 3QU5A 3OCXA 4HYTA 3ZWDA 2GFHA 4UASA 3KDPA 1Z5UA 5ALMA 5AW3A 1ZS9A 2RBKA 3WK8A 4XOUA 3QUTA 4KNWA 2WF5A 1L8OA 3ESRA 4AP9A 5ALHA 4E88A 2G07A 5A3RA 1ZD4A 5ALVA 1RMYA 1T5TA 3CZ4A 1WR8A 1AQ6A 3IB6A 3I76A 5AVSA 2YBDA 4YCNA 1MH9A 3L8EA 2ODAA 5AW7A 2R8ZA 3U13A 5FP0A 4EELA 2C8KA 3ZTYA 3ZX5A 5ALSA 2PR7A 4UU1A 3D6JA 4AS3A 2WF7A 3NAMA 1L7PA 1IWOA 4AS2A 3KC2A 3WKAA 5AVRA 1Z5GA 3ZUPA 5ALZA 4ZEXA 1NNLA 2B30A 1ZOLA 3ZTWA 5AVWA 2O9JA 3SD7A 4BYGA 1KYTA 2NO5A 1RRCA 5IT4A 2ZG6A 1N8NA 2AUTA 3F9RA 3IJ5A 1NRWA 1K1EA 2AMYA 3AR4A 5ALEA 4UM7A 1YNSA 2B1QA 2C4NA 2YMQA 4UARA 4Y2XA 5AKLA 2W4MA 5ALRA 4CF3A 2QYHA 3B8EA 3OCZA 4HAIA 1RC8A 2G0AA 1SWVA 5AKXA 3EPRA 3SKXA 1Q91A 1TA0A 2G80A 2X4DA 2WF8A 3MC1A 2VKQA 2YMLA 1YDFA 1S8OA 4EEKA 3BA6A 4FE3A 3QUQA 5AK3A 5AI4A 3E84A 3AR8A 3A1DA 3CNHA 3WK4A 1RPZA 2AGVA 4BEWA 3I28A 1RMQA 3A1EA 4Y2JA 3QGMA 1PW5A 4MUMA 3VAYA 1YJ5A 3ZVLA 2HF2A 1L6RA 1VFPA 1Z4QA 4NWIA 5T41A 2W43A 2ZOSA 2FPXA 5AM0A 3KD3A 3OPXA 4Y2YA 2YN4A 1ZJJA 1RKVA 5AW5A 2FPSA 3AR9A 3QXGA 5AHXA 2I54A 1L8LA 3FPSA 2FPUA 4BX3A 1U02A 2HSZA 5AVVA 3J7TA 3NANA 4XE5A 1RKUA 3NASA 2GHTA 2YJ5A 2ZBDA 2R8EA 5AKYA 5AW0A 4HGRA 4QJBA 2RAVA 4Y2QA 4ZEWA 3E81A 1Q92A 3WK7A 4L57A 1S2OA 2YMMA 1O03A 2I34A 3QX7A 4KNVA 2NYVA 2WHEA 3WGVA 5AK5A 5ALDA 4BNDA 3M9LA 5AKIA 5AM4A 5AI0A 4NABA 4UMFA 2JGAA 3KBBA 3QYPA 3L8GA 2B8EA 5ALLA 2Q5EA 4ZEVA 3EF0A 3ZVMA 3OCVA 5AK4A 2C9MA 3U7EB 1RMTA 4NAVA 4O8CA 3SKYA 5AVZA 2I55A 3PDWA 2IOHA 4OHFA 5AW1A 5ALQA 2P69A 5ALXA 1ZRMA 3ONNA 2IOFA 5AKJA 3ZWKA 5AW2A 2CFRA 3RF6A 2WF6A 2HEGA 4J2TA 2MSNA 2I7DA 3L7YA 5AW4A 2G1AA 2DQSA 5AI6A 5AKKA 4CNQA 5AI8A 4C4TA 1XP5A 2FUEA 2AH5A 4I9FA 5A3SA 3WKBA 4OCZA 1L7MA 5AIAA 5ALGA 2IA5A 3EF1A 1ZD5A 1TE2A 4HGQA 4F71A 1TJ3A 5AVQA 4Y2TA 1QQ7A 4UU0A 3OTQA 3B9RA 3U7GA 3QUBA 4UW9A 1T9ZA 3ZX4A 3R4CA 3AR5A 4EX6A 2EAUA 3ESQA 5ALPA 3DNPA 4GXTA 3U7HB 1LVHA 2HI0A 2EATA 2FPRA 3ZU6A 2BY4A 3R09A 3L0BA 2YMPA 3L8FA 5AI5A 3UMGA 2Q4TA 4YGYA 4FYPA 5ALFA 4BKMA 5AKGA 2ZXEA 4BX2A 3WKEA
chains in the Genus database with same CATH superfamily
2O8VA 1VZ2A 3TRIA 1V2HE 1H2RS 2Q46A 3ZHYA 1WZEA 1CQIB 4ENRA 4KBYA 4EFNA 4RTQA 3U3MA 2K7ZA 1Z0KA 3RUAA 3EZNA 3MXOA 3PUHA 2P1RA 3DOFA 3A9RA 3G7NA 3QNWA 2RC6A 4GKVA 2WW8A 3QXHA 4EG4A 4PW0A 5L7WA 4L75A 1YB6A 1WXDA 4LPSA 4JC0A 3NDBB 1KSHA 2PBZA 1CHNA 3H4DA 4I9GA 3KK0A 3TM4A 1L9KA 5J2EA 1ZY2A 1Y0BA 4MUYA 3VR4H 1ST3A 3T0GA 1UQUA 1H65A 2BHRA 9ICNA 5HIJA 3L06A 4GMDA 5IG2A 1KERA 1GG5A 3ETCA 3C3JA 2PVSA 3C8MA 4C5CA 3R7WB 4D8WA 2XYGA 4LRYA 3AM9A 3AM5A 1N9GA 3A6JA 3Q8PB 4NCHA 1ZPDA 5LQJA 1YU9A 4DLBA 4JJEA 4J3JA 4BC0A 2IE0A 3SE0A 5EUMA 5A0VA 3T9DA 3PC8C 3QJ5A 2X13A 2ZIVB 3PC3A 4NZNA 2A3VA 3CLVA 1E4EB 2VTKA 4MEBA 3U9TA 2HCFA 1W6RA 3DAYA 2BFBB 2IZ7A 5CAEA 3TNJA 4Y7CA 4M6WB 3MBOA 1E2LA 1Y6GA 3B5JA 2FKAA 1MO3A 1LLQA 4KR0A 5GPBA 2X4LA 3JPYA 5EE1A 2ZYSA 2C2RA 2Q1WA 4C20A 1Y8QB 1P1CA 3RS7A 2PFQA 3AUAA 1ZVMA 3SZGA 5I7OA 1EX1A 2C0PA 5DHTA 3BGIA 2AFHB 4RKEA 5B7PA 2O14A 1O08A 5EP4A 4FI3F 3ZTTA 1WZUA 4AJOA 1R88A 3KSDO 5KX5F 1AA9A 1Q0QA 4OQLA 3PL1A 2VHXA 2EU8A 2AVDA 4YRFA 2VHZA 2WJZB 1S3FA 3L7LA 2GPNA 4HX2A 2ZI7A 5BWNA 1RTKA 3PQDA 1V4BA 2M6KA 4G9EA 4X5VA 1US8B 3CTPA 4DGQA 1CDEA 4RVSA 2YY5A 4N8SA 5JCOC 1C9YA 4C4PA 4NZ9A 3DD1A 3TAUA 2ERXA 3D3EA 1XTTA 3DDNA 4QZDA 2PRKA 4I50B 3BXZA 1LPAB 2IIQA 3W5HA 4DMKA 1XZAA 5IWAB 3A6FA 3PXDA 1MIOB 4ZYTA 3QLJA 5IHXA 4PTLA 2XF2A 1JXQA 1NKCA 3GYBA 1H1TA 2GN4A 4TWAA 5TPWA 2KZMA 3JQAA 2WNHA 3R3XA 1GCOA 5MF6A 2EP7A 4TLBA 2YWDA 4LOJA 4IFIA 3SIPA 3PJGA 4FE7A 3NEAA 4DLRA 3RHSA 1L5RA 3N2YA 4OQZA 2ORIA 4C06A 1AX9A 1G63A 4ZKEA 5FQOA 2PLAA 2EZTA 1R0XA 2ISSD 4KNVA 1GPJA 5EHNA 3BMQA 4PSDA 4EB6B 4XB1A 2EIHA 3GFVA 3UJHA 2PR2A 4A2CA 1QYDA 2OB1A 3CISA 4ZI3A 3K9CA 3HGQA 3WNVA 1XTJA 3CRNA 3WLIA 1P19A 2HEGA 1QAQA 2IQIA 3USES 1BPEA 1AMNA 4MRMB 1M2EA 3ONEA 2HLPA 4CPDA 1YQEA 3AU9A 2GJKA 3AVUA 2H29A 1IJBA 1QXSA 3WZMA 3GUCA 2GLEA 3QUBA 2JIRA 3DUFB 2X5KO 1OD6A 2NZWA 5GZ3A 4H4EA 3OT5A 3O3CA 1JBKA 3QW4B 4RV9A 3P9NA 5FBHA 4DMLA 1Z34A 3LPNA 1R9MA 3V00A 1Q0SA 1C8BA 2I2BA 1XVAA 4HUJA 2RB5A 4JK1A 1V5IA 3LUPA 2ZVDA 2VYVD 5CM9C 2ODGA 3PS9A 3Q1LA 1ZNYA 4KO8A 2JNWA 4EJMA 5K8LA 1Z88A 3W2IA 2A59A 1JB1A 4R6WA 1EUDA 3UT6A 1UXOA 3GBSA 3T5MA 1NW4A 3I0NA 1T5SA 5IUKC 5CJ7A 2Z9CA 2NPIA 3GX1A 5HK9A 2XOKD 2JZBA 4CGZA 2PE5A 1HYEA 3KUKA 1CEQA 4O25A 4NLKA 2FOXA 2JL1A 1VSQA 3MQ2A 3ET5A 1XRLA 3T3PB 4WZBE 1HDCA 2FXVA 1ZSNA 4DMUB 2X7JA 1J1ZA 1LSUA 2OORA 4IOJA 3EVZA 2D8MA 4ADSG 4KLOA 5F1YA 1JILA 2C42A 2UZ1A 3HCOA 3P8ZA 4Q21A 2KIVA 2AR0A 4EGAA 2E87A 1OKKD 2R5FA 3PITA 2BPOA 5DNDA 5DDYA 3GELA 1UKYA 1SOUA 2VVTA 1ZI6A 1P6UA 4ENTA 5KOHA 2G7ZA 2QGNA 1PT8A 3T1HB 4XR9A 3GJYA 2P5UA 4JV1A 1BVRA 4FFNA 1FTNA 1UC5B 3WADA 5AW9A 2IXFA 3ZGVA 4X24A 5M04A 2BFDA 2X5NA 4ND8B 1CZNA 1G5FA 4UOEA 2ZYUX 3AY0A 4RABA 1JXLA 3V9PA 4QNLA 5ALWA 5KYGA 2CNLA 1IEQA 4OU4A 1WW8A 4QNRA 4KXNA 4IGFA 4DV0B 2BCSA 3DZFA 2QU8A 4Y2UA 1H1LB 3MYRA 3RLFA 5J29A 2C2GA 2QP9X 4RK6A 3SQMA 4KIUA 5FWNA 1RRPA 2V4ZA 2Y2UA 1H42A 4NBKA 5HF6A 5A62A 2H63A 5IAJA 5L3SA 1ZDMA 3TGLA 4XPIA 3T1VA 2OEPA 3SC6A 1ZMBA 1P29A 2M9NA 3F67A 4BVGA 4DIOA 4HXGA 5EQDA 2IRWA 1PHRA 2ORYA 3ORRA 5GTHU 3CC8A 2GO1A 4OHKA 1DJQA 4E12A 5ALSA 1BCSB 1PG0A 3CO0S 2M9MA 5H9WA 2ACVA 2F8MA 1P6XA 2Q3CA 2XTMA 3F97A 4KLEA 5AMXA 4R9RA 1GEEA 2L42A 3DJYA 2DWCA 1LK0A 1NDQA 1UKAA 1LY1A 2FJPA 2OESA 1BROA 3M6VA 4MPTA 5LKAA 2VTDA 3INYA 4UARA 5KSOA 4IIFA 3EFOA 5LXTF 3QV1A 3O5AA 1MC1A 5L51A 4G0MA 3G0GA 5CH3A 3Q3IA 3K6SB 4EEKA 3EAFA 5HG0A 1V4VA 1IRXA 4B0PA 4CQMD 3OEHD 5AP9A 4HVCA 3LK9A 2VJOA 4I4NA 1DZIA 2J6CA 4EG7A 5FUXA 4WZ6A 1AF4A 3GPCA 5CW2A 2K8CB 3LBAA 4ER7A 3WK7A 4YUWA 1PNOA 3C3BA 3M6FA 1DO2A 4YXFA 3HVRA 4DV1B 3WGMA 8ICKA 4ZD6A 2K8BB 4YUYA 3TECE 3FMIA 5K3DA 4NLNA 3OCVA 2BH9A 2AJTA 2APJA 1EXWA 4WOKA 3NJRA 3AF0A 2O8BA 1JU3A 2BOVA 1IOWA 1SRRA 2K89A 2H6EA 1G5QA 3GBPA 2YHIB 4CM8A 1NDUA 1W88A 4YMWA 4A03A 4N5LA 3TIVA 3NYRA 1L5UA 3MWFA 2E3TA 4LI0A 2QXYA 4NG5A 3RSOA 4I9NA 1N1MA 1ZQMA 4EMUA 3QEJA 5IUJC 1A9OA 4XA8A 2F3RA 2Z09A 4PQFA 4GWLA 1A9PA 2FEMA 2E1FA 5AKZA 4RZSA 3OC0A 1N2JA 3QPBA 1YVPA 1RYBA 5IFLA 1TLLA 4I5DA 5BN5B 3F96A 1WEHA 3NDRA 4EFKA 3T7CA 2XGJA 3LC7O 2ZWVA 3STTA 1NFQA 3HADA 2CFIA 2ES4A 2FQXA 6PFKA 3ZLUA 4JDPA 2JIQA 1WUIS 3NBAA 3BZCA 3SXPA 3QU9A 3N2KB 4QBGB 1O87A 1JEAA 1NQAO 3ZEAA 3RBZA 4PHTA 5HF8A 3L4EA 4ABTA 1JROA 1N3LA 3L04A 2I1WA 1EA5A 4GIBA 4JA0A 4LYAA 2CL7X 3ELUA 4X8MA 1EESA 1Y1TA 2FZVA 1QOPB 3ZU2A 2P9CA 2VRCA 3WNDA 3TZLA 3K7EA 4QW8A 2X9QA 3ZCSA 1NW3A 2C5FA 3GJ8A 1TRKA 3H2GA 1WXXA 5KT5A 5IT0A 4XKJA 5GGXA 1H05A 4UAYA 3BMCA 5IULC 2FFBA 4X7RA 3MD9A 4R9UC 1T9AA 4BC1A 3HJTA 1U63A 2GZSA 5KFLA 5KC9A 2MTBA 4HDKA 1DBIA 1RJFA 4OI4A 2JJ1D 4PFSA 4XVUA 5DTJA 1HORA 2PYDA 2P68A 1XN1A 1MJNA 1Z4JA 2CRXA 5HXAA 2QAGA 2PSJA 3BA1A 3RADC 1VSBA 4MEYA 2YUIA 3BIJA 3E2IA 7ICFA 1FFVA 2D59A 2EJCA 2WQ7A 2POCA 5JYBA 3KT8A 5EKSA 4BXOA 1HNZB 3AMZA 1DTWB 3ETJA 1XAJA 2WP0A 4J9KA 2I4RA 5DN9A 1ORVA 2L18A 4B4DA 1T2CA 4XIIA 1V5FA 3W5BA 3E9CA 3OX4A 1JI7A 1D8AA 4F5PA 1DAIA 4LYFA 1KO7A 1TYDE 4Q16A 2XLCA 1ESMA 4QRDA 1F2TB 2HIHA 4D9HA 4TV9B 2XMCA 3C8HA 3EFEA 5KMGA 2VCEA 2WQ6A 1E8DA 2QUBA 4B2YA 4YP6A 3GILA 4LHSA 3OMLA 1Y89A 2W6PA 5CH5A 2BCEA 5JVDA 2GD2A 2HTFA 3MWEB 5KYTA 5DNUA 5CFQA 2VHCA 4Z3DA 4POAA 4MVJI 2Q4OA 1V96A 1EIWA 1AN0A 2F4VB 4DM3A 2DZDA 3M3HA 3G5TA 1U49A 1R0WA 4FFBA 5FLEX 3QM1A 5KNCH 2Z8YA 4GYYA 2PH7A 3D8TA 3NORA 1FBNA 4DL6A 2XB8A 3DZDA 4WZAA 5CP2A 5T57A 2OZVA 3CA8A 4RVCA 1MEEA 1KS2A 2VDJA 1U3WA 5J1TB 2WYWA 5IF3A 1QIKA 4EMBA 4OKSA 3TUIC 2ZUEA 1SVWA 4Q47A 4TQGA 5F12A 1OAKA 4Z1MD 1VG8A 3KAPA 5K0TA 1STOA 3RJFA 4R81A 2R1ZA 3CXRA 3IKJA 2E4UA 5HQTA 2G0AA 1H6AA 5AKXA 2G0NA 3G2LA 3S4YA 1KYYA 2FW9A 2RCYA 3VNUA 2PUDA 4RVUA 4FYXA 2TECE 3CM0A 4O4JF 4P0PA 3HT3A 1RPZA 1PW5A 2KX7A 1LD3A 4C03A 2NO9A 1X7DA 3HVKA 2GEFA 1T2UA 2OO5A 1UWLA 2PGDA 1XZKA 3PW5A 1A4XA 4MGZR 2WDPA 1L5NA 3NWPA 5KFOA 2CJWA 4GP9A 4WBNB 1E2JA 4OBBA 2ZYAA 2AZDA 4OU5A 4ZI7F 3PGJA 3LC1O 2JFBA 2F4NA 1N2CB 2Q6OA 2LBOA 4OQDA 2C92A 5F9HA 3V2HA 2YJGA 4Q1EA 1AQIA 3D8BA 4UVEA 1KKMA 1U45A 1T6ZA 5CHEA 2A1AA 2AYZA 3T3FA 4FZVA 5L9AA 3USZA 3C2LA 4G86A 2L19A 4TQ9A 1XFDA 3L7BA 4BHTA 1ZCJA 4CMBA 1KH2A 3PICA 4HTFB 4MQFB 3CRRA 1YGPA 2P9BA 1E9AA 4OXYA 3QXXA 3G6WA 4CCYA 4EX6A 2QVZX 4GF5A 2WYHA 4GOMD 1ONPA 1UQRA 5DLFA 1RZUA 3REQA 4RGBA 2VQ6A 2ZYWX 4IIDA 4MUFA 2QDKA 5LUBA 4LECA 4I0WB 3O7WA 2WD7B 4GYJA 3VR5A 1MB9A 5EZYB 5DI3A 3T4PA 4TT3D 3WL4A 4EY6A 4JIMA 2LNDA 4AUEA 3AY6A 1PK3A 5B58T 2XE8A 4IG4A 2GF2A 2Z6VA 2G4CA 1GPKA 5JCOA 4ID3A 5CH8A 3M2PA 4QHTA 2H1FA 2CE7A 4V0LA 4BO3A 1TFRA 4N9WA 1DKOA 5AW8A 4FVTA 3U7FB 4BNNA 1HDYA 4X63A 3TUJC 4D46A 2OFOA 1W0KA 1PR0A 3GDXA 1JIQA 1QQ5A 4OLFA 1E79D 4CEHB 1GL9B 4KH0A 4ESOA 4XQ0A 4RQNA 3RAGA 4CN9A 1XL0A 1XRRA 3MTBA 4W5HA 2EHJA 1QFZA 5KL1B 1SD5A 8ICVA 4YR9A 5HKKA 2JKVA 1SD2A 2C58A 3TO5A 4C0AC 4LHXA 1SUWA 2HO4A 4R2JA 1N3YA 1VE6A 3E27A 5FWYB 4CTNA 5DN6A 4IXNA 5JNWA 5DP2A 4KQMA 2E1RA 3PUJA 1L3UA 1V45E 1D6MA 2I4IA 5B1HA 2BE7A 4FMCF 4C5BA 3LRXA 4XAQA 3PMNA 4FK8A 1IN1A 2YWCA 3R0VA 1FLDA 5TJHA 4C3VA 5CVEA 4FS3A 3N53A 4M1KA 3BB3A 4Q1AA 1L5QA 3KSRA 3FF1A 3SC3A 3Q7EA 4HDQB 4JBGA 2WJIA 2VP9A 4AJEA 1KY2A 3HABA 2I76A 3P94A 1U7TA 1SOAA 2D5LA 4YACA 3LZDA 2Q99A 1QPGA 1HE4A 1IWPB 4KMRA 4MQEB 3R0QA 4IMRA 3U3OA 1G66A 3HO1A 3X2SA 1M8GA 7ICHA 1M2VA 5JNUA 4JUIA 4JK3A 1OY1A 3VOBA 3R5KA 1OX6A 4MAMA 4MP3A 2HNKA 3V2UA 1N48A 1A9ZA 1BEUB 5DRYA 1OBHA 3B9JA 3KZKA 2F3NA 3PFWO 1WABA 3REOA 4Q0MA 1N57A 5MDHA 1VCMA 4BB5A 1B23P 1Z82A 3I04A 4ZMSA 5EZ6B 1ML4A 1KVTA 5H4HA 2G8LA 3AR4A 4KMOB 5A4KA 3ZK7A 5DJ5A 1IUOA 2A78A 2TMKA 1FSFA 4RKRA 2ENUA 1GLVA 3R3WA 1RYHA 3VKVA 2RSLA 2PUWA 4XLZA 1OYVA 3CV3A 4Q66C 3CUUA 4F4WA 2Y92A 2V9WA 2DFDA 4QXPA 3LQ4A 4JFAA 3AM4A 3ZV4A 5AVVA 1N5OX 1KSJA 1RJDA 1OYOA 3G5UA 2PX0A 2RHGB 2N0SA 5JO9A 4E5DA 4FC6A 4KFCA 2Y0BA 4L7QA 3SNHA 4EKGA 2Q4EA 3AW8A 4F2HA 3W1WA 4LVSA 1D2CA 1P1HA 5LIPA 1V97A 1U3TA 1KFJB 1NQUA 3HVIA 4ECRA 2VANA 3WMFA 2F3TA 1KJIA 4U9UA 1Q7TA 4RZQA 1ISJA 4PO9A 1TX4B 3HFGA 1O6CA 2HDNB 3KELA 2BPGA 1D9XA 1V1JA 2R66A 1YT3A 3KKKA 3PT9A 3EXG1 1BPDA 1E59A 1KORA 3JPPA 1EXMA 4OQNA 2IDKA 3LF2A 4AJ4A 3OKPA 2W3SA 3QQ5A 1PK7A 2FFRA 2C2EA 2WMYA 2I0FA 1GQFA 3H18A 4ICIA 3RK0A 3OKAA 3O4VA 4JUAA 2YMPA 1EP9A 1ONBA 2ASEA 4M22A 2BLNA 3L82B 4LYHA 2IYPA 4JYCA 4XWYA 1X7WB 1A0PA 2Y4OA 3BQMB 4HKTA 4EA8A 3EW7A 4R83A 1OBCA 2QL7A 2ASVA 3BZKA 4GWGA 1WB4A 4XEUA 4NTZA 2P67A 1YV9A 3ETLA 4RFVA 2EX4A 3CJTA 4HF7A 5KFKA 5KL8B 3AVTA 2WA2A 3ENWA 4U7PB 1Z0AA 1ZQFA 1IHUA 4BCCA 5JI2E 2Y0PA 4HMOA 1CBUA 2QLTA 2N1RA 4ED3A 4NS1A 4N03A 2XKKA 1MSWD 2G83A 2HCRA 3FTFA 3E61A 5EP1A 4LVUA 2BMWA 1C41A 4YEDA 3QVLA 2K5UA 3UGTA 4RO0A 1L4GA 2JLUA 2YYSA 3F3KA 4GL2A 2ZBEA 3TLEA 4FFPA 1ECPA 1T5DX 4G25A 3GWZA 5DEIA 3G17A 1ZM4A 1E8MA 2HA6A 2F17A 1J6UA 6CHYA 4M4SA 1KGSA 2BZSA 2NO0A 1HI9A 4HGPA 2MMGA 1GNQA 5DYYA 2JLSA 2B8WA 2Q3EA 3RFUA 3RRMA 4IKEA 2IWRA 3WS7A 2R6AA 4BKPA 5B37A 1C7FA 1XZJA 2WWRA 2J3KA 3VGJA 1HLDA 1CY1A 3N7UA 1IM5A 4BQIA 3O94A 2PZEA 4JJFA 1H69A 4QVKA 4UB4A 4LC9A 2G1JA 4ITRC 4DEZA 4P0TA 1XXLA 1QZZA 5C1DA 4WL0A 3Q3EA 4DC0A 2BGRA 4ZU1X 2CXQA 1J8MF 5G0TA 4RHUA 2NADA 1I6MA 1WW2A 1KP2A 5JSHA 3O82A 2W8BA 3QMWA 3M4NA 4BP8A 3FTPA 4FTWA 1GR1A 2QTRA 1XEWX 2VSQA 1OJ7A 5FXMA 2B1JA 4E4YA 3RVLA 3ZWPA 1ZNWA 3KUUA 4Q82A 1JQJC 1BYUA 1NRJB 5AOBA 4JI7B 2PMZC 3CZ4A 4KN7A 2PKWA 1AKEA 3IGFA 2RRDA 2JLWA 5I4CA 4LYGA 2HA2A 1XHEA 4OYRA 3EG5A 1AD2A 2W00A 1ZN8A 4YR0A 4DVJA 4ZHQA 1F8FA 4AS3A 4XYGA 1UJBA 3Q88A 2EKPA 1JBEA 2JPDA 4J9LA 4DNQA 3JS5A 5FH9A 1WXEA 2PNJA 1UK8A 4YONB 3V7KA 3W90A 4ND7A 3VPDA 4XQ8A 5JDCA 1K5DA 2JA2A 3JSAA 1ZH8A 1NE7A 5HS4A 2XC9A 1XWIA 4D99A 3FYDA 5IKMA 1GCUA 4LTMA 3E84A 5F51A 1U0SY 1WCYA 1K5HA 3JQDA 3WNZA 4MQUA 4F5QA 2UYCA 4FYHA 4F1JA 3O9ZA 1B3RA 4ZZ3A 4M9ZA 1L8LA 1JEYA 1FTWA 3C7CB 1TQ2A 1TIBA 3RAQA 1Z6XA 3H86A 4UUBA 5E6RA 1EQAA 2HFKA 2XB6A 3FOZA 3I2JA 4RENA 3GFBA 4NCIA 5KAPA 5HM6A 3VNVA 1QU2A 7ICPA 4CWAA 4ZEMA 5JYCA 3VI3B 2R8GA 3KOWA 4QFMA 4TTQA 3PFBA 4HVTA 4GMHA 4ZQBA 5HIKA 1ITZA 2QEQA 4Q39A 2X0KA 2P9EA 2BHTA 2EVWX 3LY7A 4J2TA 2DQSA 4MDYA 1S77D 4B1FA 1AO3A 1ISPA 2B8NA 3RC1A 1R4AA 4D6PA 4EUNA 4YT8A 3KE8A 3I52A 4B7CA 1QDEA 1JU4A 2ZI9A 3UWDA 1I4LD 1X6JA 2QARA 3KQLA 2BY4A 3VPAA 1YQXA 1I0LA 5E7JA 3LT5A 4JODA 3JYOA 4PCVA 3PNSA 4CKCB 2ZFUA 1S2DA 5CR0A 1S4QA 1ZAKA 2P9TA 1JAYA 1J4AA 3TFOA 4GNRA 1Z6AA 1KI6A 1QTIA 4N7JA 2UUCB 4EO9A 3PZBA 3N3BC 3DC7A 4WA8A 2GYUA 3HVJA 2X3FA 3TEMA 2H52A 2G9VA 4WH0A 4AYTA 2JASA 2YR0A 2UZAA 1DI0A 4J43A 1L7BA 2WICA 8ICOA 1UXHA 3MCZA 2NOAA 3AU6A 2V7GA 4PRYA 1YNOA 1FNCA 1FP4B 5ECYA 421PA 4UATA 2DHQA 2G40A 4DANA 4F85A 1V8PA 2D54A 4ND6A 4B34A 5EE0A 4UPVA 5EHGA 2W7OA 4A5OA 1H8ED 3N8IA 2PWZA 4AMZA 4IXDA 5THQA 1X70A 2H4JA 1Y9DA 3GP8A 4M37A 3WK9A 3PKIA 3I8OA 2FX3A 3IS3A 2KK0A 3P0IA 4R31A 5A3QA 3BJZA 3IG8A 3ZDCA 4QU0A 1FU7A 3CR7A 4M0DA 5LJIA 2PO7A 2GM3A 4YJ3F 4ZHSA 2AN9A 1RBYA 2PNFA 1H23A 1T6XA 5JH7B 4D4JA 3V4RA 3QBDA 3V46A 1T8YA 3VH2A 221PA 1N9ZA 3LUFA 3GN1A 5ALOA 3L79A 2ZIXB 3UHAA 2HX1A 4RVFA 2NV0A 1JJVA 2ZIZA 4BATA 3FHJA 3C1YA 3ENKA 1Y3DE 3G6VA 1T5HX 1B6RA 2CF6A 4K9RA 4RQMA 5CUQA 2VJLA 1AC5A 1N2XA 5JTTA 3D3QA 2G6BA 3HTXA 2R2GA 2X0RA 1FRVA 3GQBA 1QVAA 3D8RA 3Q0EA 1MV8A 4XB6B 2Z95A 1CNFA 4YT2A 5D84A 3DAOA 3PRYA 4XIFA 2YQ4A 4WBXC 2IDJA 3UBTA 1GTSA 3IUEA 3QU5A 4GYKA 3FPJA 5CXXA 1QAMA 2VSNA 4YQFA 2XUIA 4IWYA 4KQJA 1RKBA 3AT1A 5HR5A 2AG6A 1KQFA 3CNQS 2Y1GA 2VWQA 1IWOA 3CXUA 4URHA 2YC2C 3F6RA 2AQ4A 5LD2B 2GEDA 2IZZA 3W3AD 3DTVD 4BWGA 4B9LA 3NT2A 2O0JA 3P9QA 2TYSB 5GY7A 1NQ5A 1TQHA 1PX0A 4E5VA 2VJDA 1OT5A 4BV2A 1OX4A 2XLBA 3FSGD 3KKZA 5TDHA 1UOPA 4OBWA 4EFDA 4QZ9A 1GP2A 1NWHA 5I7HA 2JAHA 3UWSA 4YI5A 3L0IB 3WDLA 4DL3A 4WFIA 3FD8A 1QCDA 2R25B 4UOZA 2IIBA 3SXUB 4IEEA 2QNIA 3QA9A 3NHJA 4PSCA 2ZREA 5DW3A 1O9HA 1W4RA 5REQB 4U2EA 3GQCA 3UG7A 4JLJA 4BNFA 1NJ1A 4F04A 4RHTA 4J0DA 1SXJE 2FLNA 2JH9A 2A8YA 4FINA 4E1AA 4QBFA 4AMBA 4ZEVA 3HB1A 3RK4A 3QW2A 1A1VA 3BSFA 2PQMA 2O8DB 1UZMA 4NAVA 1EPUA 2GJSA 3RKRA 4XWKA 2J5RA 1C29B 3FNQA 3AWDA 4U4AA 3L7JA 1XS9D 1G55A 1DAFA 4QJIA 1FP1D 1H85A 7ICQA 1JX6A 2J4DA 4ETMA 3C85A 5LZ8A 3B9RA 3WLMA 3V7YA 1QTMA 2H7CA 3UB4A 1YU6A 5FUWA 3PFGA 3BFVA 3C98A 5H81A 5I5EA 3UJNA 5FUYA 5TPZD 5LU8A 5GJWC 1D5WA 3VSEA 1PFVA 3N7RC 1WY5A 4NBVA 1AIPA 4RZRA 4WLNA 3ZK8A 4ALJA 1RC1A 4F3NA 2BELA 3OIDA 2RDJA 2B2NA 3N8HA 5B3KA 4GPD1 2WTBA 3QIAA 3FOEC 3LVFO 2ALZA 1I5OA 4B2LA 4LJ6A 1M1UA 3I1JA 3V6MA 1UBTS 4KLHA 4E2YA 5TMPA 4W7IA 3NX4A 5CB1A 3BH7A 2GCOA 1MFZA 1RP1A 2PZKA 2DPGA 3H4IA 3VJMA 3KP1A 1UBNA 2DG2A 2R6DA 3DFFA 1T2NA 2PBLA 4EUFA 4V38A 2FAXA 1A7UA 1QF7A 2ZZKA 2Y66A 1OH7A 1FDVA 4HBZA 4BB0A 3AF5A 2V7QA 1YIOA 3LQ2A 4KZPA 3QZUA 3HR7A 5DHPA 4JR2A 1ADJA 3QFTA 1TZJA 1YZ7A 3TIFA 1JNXX 2FLWA 5DMXA 2C3MA 1FNNA 2X42A 1HKHA 2WAOA 4OHYA 1AUQA 5I7FA 2ZVJA 4GD3Q 5IIIA 3PX3A 1H93A 4LXXA 1QORA 4Q1BA 1T8EA 3V4OA 3AJ9A 1SXJD 1L7RA 2IP4A 1K8RA 2PKQP 4UBNA 2KV2A 4EYGA 3RR2A 5SV2A 3TZQA 3H1TA 2B2CA 4F46A 3OJLA 4PC1A 4RTKA 1LBTA 2VUTA 3UAVA 4Z4EA 1F0PA 3JYNA 4FHCA 4J29A 2NP7A 4HLCA 4JJ6A 3PCTA 1PR2A 2WYVA 2HK9A 2CMKA 4UEOA 4D42A 1JE0A 1TO6A 3IRUA 3IP5A 1L7VC 3EYWA 3VHRA 1UCVA 2QQEA 3T9CA 2ZRAA 4FYKA 1VJCA 3EMKA 3TUZC 3MIIA 1SKWA 1HDIA 3FMPB 1FYFA 4QTXA 2QR2A 1U6IA 2C2OA 3DEKA 3P71T 5DF1A 3OFND 3RC9A 1WO8A 2XQKA 4Q7QA 1PJTA 3VYTB 2ZRKA 2H17A 1JNYA 4BNWA 2XSZA 4OAQA 3D8UA 1D0IA 3CX8A 5AW3A 3VISA 4A6DA 4P4SB 1GYQA 4I81A 5IC4A 3RB8A 5CYFA 1DRUA 1AQ6A 4NHEA 4U00A 3UK1A 4DDVA 1W5AA 3P32A 5IKOA 2WF7A 1KN5A 5DHRA 1R16A 1MOSA 1ZLYA 4JX9A 3IT3A 3KKQA 4XDHA 4A3SA 4ZOHC 1RRCA 4M1TA 4PH5A 3H0KA 2K87A 1SHTX 2ECFA 2CXRA 1WDWB 5L95A 1PJ8A 1RKXA 2GCNA 2WG1A 2Z4SA 2OSBA 4RU9A 3SF8B 1MJHA 3ZBUA 4IQ0A 2E21A 2ZUDA 1E4OA 4UCWA 4PGQA 1UFVA 3KFUF 5CCBA 2OBMA 1MC5A 2G25A 1VFPA 4DQKA 2W43A 3KV1A 4EW2A 5G1OA 3V80A 4BTLA 4D9CA 3EXFB 3L49A 3TQ1A 1U31A 2OCKA 4ELUA 2JFHA 4BAGA 1GPLA 3CUSA 4RIFA 3IQXA 3NVZA 2ZYVX 4B6QA 4O3NA 5AM4A 2E37A 2A1JB 1CR2A 1MB3A 3CPSA 4IDDA 4PXYA 4EARA 5DBGA 2I2WA 3JWGA 1GCGA 3NHSA 3K0HA 3D3WB 4NECA 3TACB 3TADC 1B26A 1DOHA 4CJXA 1NIJA 2EERA 1TE2A 2F8LA 2KBFA 4RQUA 2BIFA 4QXOA 4MV4A 1S7CA 3NJ4A 1N7HA 4ZGBA 3DMDA 1J22A 1HL3A 4CM4A 3F2IA 4BEJA 2OO5C 3CY6A 3G8AA 1A9XB 4BZWA 2W0SA 3LPLA 5JZVA 3EIFA 3CE6A 4L3OA 2WKQA 3RIXA 2IUTA 3EGDB 3OEEA 5CT6A 2P6RA 5JAHA 2ODEA 2MUTA 5FUQA 3T54A 3R4VA 3KFLA 5KFBA 4X44A 1UKEA 1L3BA 4U2BA 5BR1A 2J59A 4MKFA 5I7SA 1I4EB 3WY9A 3K4GA 1IU9A 3M89A 1JG3A 3LBIA 3KKNA 4EX7A 2K4EA 1R0LA 2QD2A 1GSIA 5CFNA 4QLOA 4K1XA 4RHYA 3CUWA 1QKJA 1GO3F 3RAPR 2AW3A 3FBTA 3C23A 5AM3A 1V7QA 2G08A 5GIPE 1CUVA 2OEHA 1L7NA 4HQFA 3KBOA 2FSVC 3NBMA 2HJSA 4DL9A 3NALA 2HU7A 1JDVA 1U90A 5BW6B 4H7DA 4KO3S 3GVHA 5EJAA 4BMYA 2CT8A 5FX2A 4DREA 1VPEA 4Z9BA 4CQJA 1PR5A 3GCZA 4LYDA 4DT1A 3SEZA 4ZJPA 4FE4A 1S2LA 5KT3A 1HSZA 5KTYA 2XBLA 3Q4GA 1AZLA 3CRZA 4YMTA 4G8JA 1IZ9A 5U1PA 4C0QC 8ADHA 3C5EA 4K9SA 1SV0C 1TA4A 4MS3A 1AKUA 1KBQA 3MTAA 3GLHA 4DF4A 4NJEB 1O3YA 2JEIA 4QDZA 5ISMA 3I5XA 2X2FA 3HN2A 2NACA 2WSLA 5PGMA 3PC7A 3QVGA 4G37A 3CYMA 4PG7A 2G88A 4NENA 1YQTA 5G1NA 4A73A 1YZUA 3ZE6A 2YZGA 3WGIA 3M4YA 3HNOA 4R1OA 1KAMA 1LW6E 2Q8PA 4XYEA 2YWXA 1N61A 1E0DA 1N5XA 3V8PA 4F4DA 5CDUA 4KN6A 3PNMA 3PA8A 4DLUA 3X1ZA 3G8YA 2FE1A 1AA6A 1PK9A 3T7IA 3NBXX 4HVLA 1ZSVA 4JT2A 3HN6A 2XQVA 1M6EX 4M1YA 1UJNA 3UAXA 2P1ZA 1JDUA 1DK2A 3HSYA 3BXXA 4R2XA 4CR6A 3SJUA 1V2GA 5BN3B 4HPJB 1X87A 2XKBA 4TX1A 4D98A 1ZIYA 5C8YA 4B82A 3UMMA 2FP4A 4Z2AA 1BCRA 1P81A 2XGOA 2F2TA 4XGIA 1KC1A 4NNPA 1KFEB 4CVNA 5B1IA 2WFZA 3LYLA 1OBVA 4TKLA 3WQQA 3T5KA 2AFIE 3F49S 2X0FA 4F4FA 2COKA 3DMNA 3KEOA 4YAIA 2FCRA 1WXWA 4D8YA 4JI2B 2Z5LA 4NCJA 3V8RA 5FPSA 4Q9JA 1K63A 4NNOA 2C3YA 1RJ9A 3IL2A 1UPXA 1VLHA 1P9NA 3GCWA 3VX3A 1M6VA 5DXFA 5C8DA 3WAGA 4XWOA 1IB6A 1OX5A 5CURA 4B3MB 5BVGA 5EJFA 3UWKA 1LPBB 1A8IA 5F2KA 1FLVA 1Y5LA 1NI3A 4KDCA 1UBOS 4Q4JA 5DK4A 3ICEA 4RXUA 1YSCA 1OYWA 4TKVA 1ZQHA 1U65A 4IUBS 2J6IA 4YJ2B 7ICTA 3I45A 4OJOA 4HLUC 5JIBA 1NVXQ 4V0MA 1NTRA 3HJCA 3PYMA 2GS9A 2GN1A 2JS7A 5EJ8A 3RRGA 2CFRA 3RF6A 1PLLA 2C1ZA 5HMLA 4ZZ1A 4C8KA 1E3SA 1PTJC 4UQPA 7MHTA 3ROPA 5TARA 3FMOB 2G04A 3ZX4A 3DBIA 5A6SB 1PJAA 4EA9A 1Z38A 1MR3F 1ZUIA 3QPWA 1WD7A 2VNJA 1QHYA 4N6NA 5HJ2A 2VAXA 4WCDA 2QVGA 4JUFA 5DG9A 1X7ZB 3B8HA 4P4GA 2P11A 4AYXA 4CIDA 1HZJA 3QKSA 1UFQA 1X9IA 3KYDA 4R4JA 3B7WA 1J09A 2IHJA 4CF5A 4F86A 1T9CA 3ZHSA 2O5EA 3GI1A 3VU3A 1X7GA 2RHHA 1VLJA 3D3JA 2LRHA 3AJ8A 4TROA 3WDMA 1SIOA 4NATA 3HCNA 1NY5A 3HGMA 1ZIOA 4ECSA 4PJ0U 2A1TR 3KXDA 1RJWA 2VHTA 4IH4A 4DV3B 5LOVA 1GKKA 3SNKA 4BNYA 1CU1A 1L4MA 2BGGA 2VEDA 1UM9B 3P9IA 1I7DA 5D1HA 4M0UA 2HHVA 4D9MA 5CX1A 4IQ4A 1FEZA 4ME6A 3NCTA 4ARZB 3VR6H 3W7AA 4BNKA 3KQSA 1K8ZB 3O2SB 2FLVA 4UUMA 1L5KA 5IK2D 1Z4LA 4HMQA 4CCAA 1F4LA 2BCRA 3TBHA 2ABWA 5AVTA 2AG8A 3IT1A 1NVGA 1ZH6A 2R8JA 1CY0A 4LJ9A 1LPMA 2GETA 5ENZA 1G16A 1D9DA 2B4QA 3F6SA 5J43A 3D2AA 3N0RA 4F5RA 3FAKA 4OUDB 3NGMA 5LLTA 1VL6A 3SDZA 5FYDA 3PC2A 1CJSA 3GGGA 1E5QA 4KXYA 3LWZA 5KNDD 2Q4BA 1GFSA 3T95A 3PFIA 4EVQA 2QLJA 5CCEA 2ZK7A 1QBKC 3C3KA 5C35A 3QVXA 5JZSA 3JQGA 2XECA 4M1MA 4UXJA 4F9EA 4O4HB 1HDRA 1U7WA 1JR6A 3HYCA 2VDUE 5BUZA 1U0BB 4WA7A 3VPFA 5DP1A 1P5JA 3L5KA 5DI9A 3ZIAA 1RWQA 5BSMA 4CMEC 3DLIA 5DCLA 3GQVA 2BFPA 3M82A 1LUAA 3HGTA 3C3PA 2PWPA 2D8AA 1U2DC 1DFGA 1OLOA 3LFHA 2BMFA 4QJ3A 2IYQA 3ZGNA 1JQBA 1FTQA 3WIUA 1TTTA 2FWBA 2NU7A 3EVBA 4TXJA 4F50A 5HCUA 4IJWA 4IDFA 1N33B 3I01M 4W8OA 4OXKA 4QTUB 3OIYA 3AIIA 2PVCA 2CVOA 4G8CA 3VFDA 4OHCA 4B3GA 1NV8A 1TNDA 4Q37A 2WIKA 5LQAA 5LBTA 1REQB 5JS6A 3DBLA 1WG8A 2WU1A 1CF4A 1YBMA 1SCJA 5HCNA 5AVWA 2AN4A 1IBKB 1E96A 3K0FA 1N8NA 4RM3A 3ZZ0A 4UM7A 3OJOA 2F3PA 4O5KA 1OCEA 3O4GA 4NM1A 5TX7A 2NRZA 2X77A 4AN4A 3T5LA 2ILVA 2J6SA 2F43B 1CIJA 3NHRA 2JF0A 5KFWA 1JG4A 3A3OA 2PUVA 5IN5A 4MV7A 1F2DA 3DBOB 1RXIA 5C31A 2VLBA 4GI7A 2HEIA 4RVDA 4UBJA 4RLFA 4YGXB 1RKVA 3HO6A 2NTVA 3NTQA 3P9ZA 3IOYA 3FPSA 4O4IA 2PFOA 4DZZA 2CHFA 4ZAVA 4EF5A 5AKYA 1AS0A 4BRUA 4Y2QA 1CE8B 3BS4A 5FOVA 5DNYB 3U9SA 3KTAB 3VPSA 1MJFA 1J1UA 3NV9A 3E9QA 4MYUA 2J08A 3T5PA 5ICSA 2JGAA 4GC5A 2AYYA 4FW9A 3PI7A 3OMXA 2Y67A 2GLTA 1CJCA 1U0JA 5AW2A 5JDCC 3VBEA 1UPBA 4PLVA 3KOMA 5CXSA 2PXCA 1ORHA 1P60A 4AKGA 4RQ5A 1MUUA 4QSMA 4LJLA 2P6PA 1MVOA 4PNEA 4TTSA 3B2NA 3OQOA 4E7OA 2GI4A 5DBCA 1MQ9A 4MS4A 5K0SA 2ZIWA 1P3DA 5F77A 3RRJA 2B25A 3AGQA 2X23A 4ZARA 2KS6A 3T1QA 1M34A 2VNSA 3LBHA 3SJCA 4G0OA 2QSJA 2Y4NA 3VVLA 4S1OA 1QMGA 4UTVA 2OXOA 1YB4A 5DG8A 5AUNB 3GZFA 1LC3A 4GGPA 3L93A 3X1DA 2QRZA 1G9TA 2VXCA 4JJ4A 3UOAB 3OE1A 1M1NB 4F2PA 2XCLA 1ENYA 4OHBA 1W1WA 9GPBA 2LIPA 5K8VA 3DKKA 2R8RA 2FMHA 4FJ1A 1QZUA 4ZDJA 3IOEA 4F21A 4TYQA 2J45A 4PM4A 5DCUA 2I2DA 1YUNA 2Y1DA 4A0HA 4M99A 1G2IA 3BDIA 1WHTB 2Q45A 3QLEA 4K4IA 2X8LA 3IQGX 1PP4A 4W1RA 2DCMA 5E9JA 3VR2A 1E6KA 2QZ4A 1M1YB 3DL4A 1HE5A 3PNLA 2P4QA 3UUEA 2RHJA 4OX9B 1LWOA 2R4QA 3ESXA 4N4AA 5E7IA 4L4UA 3TDMA 2A88A 4UMEA 3SOPA 3MMZA 1SQ0A 2FPKA 2GUWA 4URUR 4C8MA 1AVTA 2RJOA 3UMCA 1X3SA 5J2UB 3IODA 1SC4A 3NTXA 4F3YA 5FNVB 1RZVA 3TSWA 3OTIA 7ICKA 3CLUC 1JN3A 4D3SA 3MFQA 3G5LA 3G0OA 1ZWKA 1L5HB 4ZDKA 1HL7A 1Q11A 1P3Y1 5HYVA 2B1IA 1TVEA 2IBKA 4ND3A 1DJOA 3QVVA 1FUEA 5EJ2A 2Q6KA 3TADA 2O2YA 4PIPA 2NQ2C 1OZFA 1Y42X 2W6CX 4LYEA 4EOGA 4EF4A 1IIBA 1NL3A 5FV4A 4BV9A 3MCUA 1TQDA 1PT5A 4L5BA 2IV2X 2R97A 1VHJA 3CQ9A 2B69A 4JUZA 1RRGA 4IDQA 4HWGA 3EVNA 2GASA 2I8CA 3X1JA 2E48A 3RTVA 5D01A 2Y05A 1TZBA 5KDOA 1FDSA 3AKYA 2D5CA 4IICA 3LUDA 3TL3A 3M5DA 4UAUA 3L7NA 1SBTA 2J9FA 2FW1A 4M8SA 4ZDWA 4MWDA 4KQKA 5F21A 3Q3JB 1TLTA 4MR7B 4HV4A 1TM1E 2V6FA 2DF8A 2WPDA 3IQWA 5ELMA 3ORFA 3PR4A 1PQPA 1ZD4A 2PGJA 2FN3A 2H3EA 2R6FA 5C81A 4CLOB 1MH9A 3W1EA 4OIFA 1JGTA 2G4VA 2EFCB 2P5YA 4WSOA 3W9BA 3FSJX 5ALZA 3LWMA 5CA1A 3THXA 2YVLA 4KACA 1E5DA 3QOWA 4FNGA 4OQFA 5EQJB 1ZGCA 4EPVA 4TLMB 3V97A 5ITWA 3C5FA 4W4TA 4YUXA 4TTJA 5I9NA 2QRGA 3KSAC 2FSVA 2VDOB 1FMTA 4GXRA 5IMBA 1KPHA 4DOBA 4OXRA 1XDDA 2JB9A 1FTSA 2I03A 4I28A 2ATVA 4RFSB 3RJ5A 1CUDA 5TQ2B 3X44A 4DLSA 1EIZA 1JJBA 1DAHA 1KAHA 4J9SA 4XH9B 2O2EA 1U94A 3F3YA 4FONA 1Z0JA 1B73A 2DUUA 1QGED 3V1UA 1XBTA 1QRUA 2IU3A 3NANA 4JLMA 4OLJA 2NUTB 4L4YA 4LTDA 2F8KA 1XD2B 3NVVA 4D25A 1SV0A 2Q50A 2H5LA 4BMVA 1TEHA 1D6SA 2YVUA 2XE6A 1X9SA 3VGPA 2QT0A 2ZRGA 2XB4A 4TUSA 1MJ5A 2WAXA 1JQAA 1XDBA 3AV3A 1G8PA 1T2AA 3ZCPA 1ADGA 1JLLB 1A1SA 3WIVA 3WGNA 2BISA 1UP4A 3ADCA 3DT8A 3M6WA 3SZOA 4WVFA 4EABA 4U7FA 1N2BA 2IA5A 3MJDA 1LWNA 4CM6A 4UU0A 4HH3C 2JJ2D 5AJXA 4ER6A 4DNXA 3W8EA 4W5RA 1FTGA 4HT3B 4PV7A 5IYZF 2UDPA 1FX1A 1JKIA 3U7JA 4HRAA 4HNRA 3W5DA 4RMGA 1T2VA 4D8XA 4IW3B 3AVPA 2ZCVA 1Q44A 1NYRA 2KFNA 5ADUS 4CKBB 1O95D 4NRDA 3SF0A 2RB4A 3H9BA 2JCGA 2YXLA 4BFSA 3V72A 3PQ4A 2IXEA 3K9WA 2ZRIA 1XMPA 1XKXA 2PZJA 3IQDB 1UOQA 4QQKA 5FL3A 3Q85A 2IF0A 1LTQA 4GPEA 4RXMA 4DWVA 2FEAA 4CDRA 4DFDA 4YRNA 1X38A 1NXTA 1Q1BA 4K9OA 3SYLA 3V8VA 4FLFA 3C21A 3LCVB 2C7RA 1G2OA 3H2YA 3GLRA 2HVIA 5FOUA 4NU5A 1JT2A 4O0IA 2XI9A 3RRHA 2VSOA 4QTYA 2WUVA 4DY6A 1X1SA 4Q19A 2Z3WA 4ECVA 2FTKE 2ZUBA 2UYOA 8ICHA 1FDWA 4HWTA 4QZBA 1U0HC 3KTDA 4R05A 5CDFE 5AI9A 1RHUA 3H0MB 5LZ5A 3ZWVA 2RGCA 2QNBA 4QPPA 2RGXA 3ADDA 2WIGA 4REQB 2OLKA 3LDGA 1MMFB 2KHZA 2ODBA 2WYUA 1K88A 3HH8A 4MUGA 4PS0A 3M6XA 1EE9A 4EW1A 4MHTA 3I0ZA 2JHGA 2PL3A 4I2IA 3HB4X 2VJ5A 1WNFA 4HHEA 2O2HA 4HLUA 4ZGGA 4FM9A 5BT8A 2H31A 4C6TB 4RK5A 3ZGXA 4OJLA 4MH0R 3VPXA 2XUZA 3UKJA 3KB2A 1PTJA 3WMEA 1XRNA 3VNRA 5KFGA 3GEHA 4A0GA 1B8PA 4HWRA 5KNIA 3THOA 1QH1A 4FOSA 1H0RA 2FFHA 2IHBA 3B0XA 4JKYA 1L4HA 3IOCA 4FHEA 4WNAB 1TK5A 3M8SA 4UHFA 3R0JA 1IM2A 3M0EA 3C45A 1Y3BE 4Z0NA 1FMFA 1W87A 1F0MA 1ZBQA 4QWEA 2QTHA 3GT0A 3EZ9A 4D9EA 2BF4A 3SC2B 2Z0MA 4TVKA 5K5EA 3HA5A 5ERXA 3C43A 2H00A 3SHWA 5ERGB 4DJEC 1KOGA 4LOLA 3QUTA 1Z2OX 4JJGA 3EXHA 2PTGA 2H0QA 1ULHA 4B84A 5BYAA 5KAMA 1SXGA 4DCUA 3PXUA 1UCFA 1NK8A 1IVSA 5LQSA 2KICA 9ICIA 3EUWA 4WKPA 2JDID 5F9FA 1K3FA 4TN1A 1JYSA 2O2IA 4WT7A 2XYPA 3IHLA 4CZ2A 4JKOA 4ZYWA 2NYAA 1TEXA 4FYIA 5HF5A 2JLCA 3PUKA 2JJQA 4NM2A 2RC5A 5IIMA 3AYXB 1PJ2A 4JYMA 1FJGB 3ZKWB 2FX5A 1HA3A 3EDRA 2QL6A 4MYTA 1J1IA 4URVR 3IHQB 3T8YA 1XCMA 4RGVA 1INLA 3NDIA 3SM3A 1TM5E 4B32A 2QRPA 4R2KA 1QQTA 3BS7A 1THMA 3OP1A 3ILYA 3S44A 1BGXT 3IFSA 1EM8B 5JR3A 2QT1A 1NX9A 4P36A 4J8PA 1AN9A 1T24A 1U7XA 3HBFA 1Z56C 3KZCA 4MAAA 4GX0A 4A16A 3ZE9A 3F6CA 4GI2A 1P62B 1KAQA 3D64A 3I6MA 2B4KA 4I29A 3DDWA 4DSFA 4E4TA 2G5HB 5CT4A 3I9MA 1U8UA 1E0SA 2VJYA 4RQ8A 2JCXA 4OP2A 2O6HA 2FR8C 1E1QD 1TK3A 1A4IA 3G8CA 4CMEA 4IL6U 3IT0A 1KDVA 4JQCA 3ZY6A 3FUXA 3A10A 3KLNA 3EIXA 1U2DA 5CIQA 3VVMA 3GJ5A 1RXSA 1GZ6A 3FA2A 4UU8A 5AJHA 3VNSA 2ZJ7A 4FYPA 1W0CA 1EH5A 5E2IA 2LD4A 3QVWA 3BHNA 2WMDA 1U28A 2GWHA 3SZ3A 1M67A 3SS7X 1A9SA 5AUQA 2HBRA 3QBJA 4PL2A 3N28A 1NA5A 2JGMA 3GRFA 5A3VA 5FKJA 2NU8A 3THRA 2IPLA 3O8RA 5FT9A 5I9MA 1TV9A 1UAYA 4TV8F 4JS0A 3EAQA 3AW9A 3PWZA 3OM0A 1WUJS 4AJLA 3ZWNA 1ID1A 5EXPA 4UHHA 1AKYA 1ZEMA 2QD4A 1FBTA 4RSMA 1W5EA 2A84A 3A2KA 4HNAB 1KJYA 3O1IC 2CLKB 1V95A 3A36A 1WPQA 2YC4C 3FGPA 2J1LA 2HDOA 3T7KA 2GRAA 3W3ZB 1CDZA 2OA0A 3KOOA 1XWWA 3FPGA 2O06A 5KYUA 2ZJ1A 4UHKA 4BQOA 1PFUA 3ABOB 3SQNA 4JC4A 2L17A 1OH6A 2P6UA 1WF6A 3KR2A 3D4IA 1GGVA 4XR4A 2NNLD 4EZBA 5B3AA 4L0DA 3EZ5A 1B14A 2HOIA 5ELXA 1A8UA 2E55A 4BQFA 4PCUA 5KWVA 3IN5A 3O8OA 2FSFA 1NSFA 1LB1B 4AQYB 1SCNE 2LZ0A 2R7KA 3X0DA 1ZH4A 4H1VA 2DPLA 5C4GB 3SHTA 1ZL0A 4BLRA 5FTLA 2GZRA 4ZVRA 5KU1A 1U1DA 3EZFA 4GUAA 1XXHB 3M6UA 1P77A 3CKKA 4M7OA 4X8OA 5D3ZA 3W9SA 2Q4RA 1PR6A 4KLTA 1Y6FA 2X7XA 2RIPA 1NOJA 2UUOA 4N01A 3WNQA 1RYSA 1PF7E 3OWXA 3MN1A 3DL0A 1Z16A 2AZTA 3GJQA 2HRBA 1U4BA 4RZXA 2VYVA 4KV9A 5IZ4A 1PK1B 1JXMA 2VPQA 5IH7A 2D4AA 4LK2A 4YIKA 4ACBA 1NJ5A 4TYMA 1VJ5A 2P78A 5T4HA 4J49A 1EHCA 3AG5A 1N78A 3MWGA 2FLPA 4QLBA 3CINA 3KQTA 2D1FA 4KTVE 4NYIQ 2KYRA 4DCVA 2XOKA 4JBXA 2UVWA 5TJ9A 3ANNA 1WL8A 1IK4A 4YMVA 4RNMA 1E6UA 5DYIA 1Z5GA 1G8JA 1YCFA 3KHTA 4K3UA 4UB3A 2MSDB 3M33A 2FYTA 1KI4A 3K4QA 1O58A 1WSDA 5LB2A 1U0OC 1RC0A 5FAKA 1NVKA 1VMKA 1LFDB 3B1ZA 4DS3A 4EPRA 4ZEOA 3F90A 2WILA 1GGFA 3LVWA 2RKBA 3IPAA 2G5TA 2ZR8A 1OKKA 4D9NA 5I7WA 1GSAA 1W8IA 2DR2A 1U3UA 1UKZA 3WWZA 1U1EA 4RK7A 1XAIA 2CKMA 1WM1A 2Q5CA 1V25A 3IUPA 5T4EA 2AI3A 3IKLA 4QC2A 4RZ3A 4AU1A 4ZT3A 1OXXK 2OHGA 3JQ7B 4OQEA 5KQMA 2XVTA 3ZXUB 3I2KA 1ADYA 4UKDA 4ETIA 2B36A 1XZMA 4CODB 2WK1A 5ALDA 3N75A 1JMKC 4NABA 5DHFA 2VDWB 2R1VB 1WQ4A 2I8AA 3AHCA 3GOHA 3PX0A 1EAMA 2YUTA 4F12A 1F2VA 4JVSB 3ZHRA 5EN4A 3A4NA 1P0PA 2GK3A 2HKIA 3G6KA 2IT1A 1HFJA 4ZZIA 5C4IA 2CV1A 4HNTA 3M4JA 3NEYA 1ZN2A 3WL8A 1QYXA 3DA8A 4Y2TA 2QN2A 4EYOA 3HL0A 4N3AA 3R4CA 3QSYA 4HYKA 3DEAA 2ZB4A 1IG3A 3ZD7A 3ZU6A 3M6KA 1PWXA 1X8LA 4HLNA 2RGUA 2HHQA 3OBBA 1H2AS 1EMDA 4R0VA 5DW0A 3OZGA 4N5NA 4PFKA 4DKJA 5JBQA 2RHDA 1UL1X 3FCEA 3ZQ4A 1ZUNA 1ULZA 2FN7A 3B2EA 2AWNA 4V03A 3JAKA 2R00C 3IP4B 3NO4A 4BFYA 2HJRA 2AOTB 2QXUA 5E6SA 4WZBA 2HHXA 3BKXA 5D1NA 2DOKA 1NZPA 2LPMA 3K3PA 2ZITA 4B87A 3VZQA 5CGZA 1RKQA 4HH4A 4AMYA 2Q6VA 4CQMA 3OEHA 5DTQA 3ZV6A 1ESEA 4NXNB 1UMCA 2BDPA 1IV8A 4DTIA 1N1GA 1Z4IA 1FVXA 1U0RA 2P4SA 2CUZA 4IHJF 4P2BA 4RZUA 4QBTA 3SX0A 1DQNA 4A82A 1V6AA 3MR2A 4HGNA 3PPXA 3ZLJA 1JG2A 1ZGHA 3RTEA 1HYGA 2KFZA 3D5QA 1VMEA 1HUQA 3TPZA 3LUJA 2NP6A 8AT1A 4RZ2A 4C87A 3IEXA 5KCMA 4YJGB 4UBLA 3A9SA 1VDVA 5KDDA 1I32A 1VRCA 3PSIA 1I7SB 3AONB 1PVVA 5JS1A 5TNXA 2P9YA 4ON9A 4GOLD 2Z5GA 3BXOA 5INTA 3DC2A 1POWA 3MRSA 3TGWA 1EJ2A 5K0GA 3IIEA 2UUAB 4C2BA 1LRKA 4Z4FA 5KQLA 1RQNA 4YRIA 3SQIA 2JK1A 1SELA 4FZNA 3L7KA 1U8XX 1T15A 4HK4A 1G3MA 2FEOA 4B4OA 4IV0A 4CF4A 1LDEA 2YXNA 3ICPA 3AEQA 2B4AA 3ADPA 2H7YA 4DXHA 3ON5A 4GOKA 4E3ZA 4PFJA 3LSYA 5TLSA 1HLGA 2D0DA 2PQ0A 2VP5A 5TVKA 1CF2O 1I1QB 3PPWA 3TAHA 2IXGA 2HRZA 3EX7C 1AQNA 1N8KA 1KQOA 1QM5A 1NT2A 4CL2A 2I7CA 3WLRA 3LVBA 5KFJA 3QLVA 3U3XA 3EB9A 1QGUA 1YOVA 1THTA 1GKYA 1V43A 5CLJA 4FYVA 2DY1A 4CR8A 5H59A 2C1XA 1UA1A 1HUOA 3IUYA 4AK9A 1ZQ9A 2X0IA 4QECA 3HUUA 1X80B 3R1IA 5D49A 4KYVA 1VMAA 1Z0FA 1Z36A 3TTXA 1VLQA 5EZQA 1KFCB 5IVKA 4E2FA 4DF3A 3EYAA 1V71A 2JBWA 3NCHA 1FYDA 3UATA 2OAQ1 1NBMA 2NG1A 3BSWA 2WZCA 4EJSA 2QSZA 2EAPA 1TYAE 3GRZA 4D44A 4BDSA 3HKBA 2C95A 4J2OA 1SBZA 1YTUA 3PHLA 3U6KA 1PV4A 1Y63A 5A3JA 3MR6A 3NAGA 4GBJA 4Y9SA 1C3OA 1SUPA 5SICE 2RKOA 2R87A 4D3FA 3CCBA 3WGVA 5J2TF 5K2OA 2MOKA 4LS3A 1NKEA 2NU6B 1H0SA 3IM1A 3MJSA 3PDWA 3RBEA 4GMGA 5CW1A 3ZV7A 3PX2A 4MICA 4TUYF 2G5GX 1XYGA 2GQ0A 4O4LB 4X1KB 5IJ9A 3SVTA 4ALLA 3UH0A 2O50A 3IHTA 3L43A 1TO1E 1V11A 4AG3A 1QQ7A 1JSRA 1V37A 1DAMA 2ERCA 1DX9A 1Y9AA 3ESQA 1C1DA 4ND4A 1JKXA 2YIJA 3ZS9A 1U47A 1PO7A 1K8YB 4QEKA 2OL4A 2Z98A 2RFLA 2XOEA 3AH8A 3DWFA 2D74A 3U1TA 1M73E 5JSQA 1LV8A 1W36D 3V5NA 1T8RA 3NHBA 2FMUA 1OWPA 2A0XA 5ILOA 4JLPA 4MVJP 5CHYA 4PGAA 4H60A 3WJ1A 4LXHA 4XJSA 3W9UA 1ZQJA 4Z1MA 5IEJA 1ETUA 1FFAA 3AL0B 2OO7A 3PRJA 4KAXA 5E4FA 1GUFA 1TCAA 4HDNA 4MR9A 5JY1A 2O2JA 3PA6A 3NNDA 3P0JA 4ED1A 2O8CA 3W06A 3QELA 2COUA 2R47A 3H19A 2WZDA 1AV7A 3ETEA 4Y98A 3USCS 1YVRA 3FGNA 2P27A 4AZVA 3NHPA 4RMIA 1M2WA 2QV0A 3VYRB 4ATNA 4Y2SA 1NGSA 1A5ZA 1KVRA 3R9KA 7GPBA 3A1VA 4YR2A 4U7GA 2BZ1A 1QVRA 1TKCA 3V1KA 4MW6A 3AYZB 1J0AA 3MS4A 4BNMA 2XCIA 1SH7A 2D2VA 4XXHA 1WSBA 3NZEA 4ZALA 5BSEA 4DC9A 4G4GA 6YASA 2PD6A 4I66A 2N1MA 4UB6U 3RR7A 5D4BA 1MX1A 3PHGA 1ENZA 4H7IA 4CU5A 2MINB 4DSZA 3GOQA 4EG6A 3MJVA 1IATA 2ZBVA 2HV8A 4U7JA 5DQGA 1WWUA 4J76A 1KR2A 1N6RA 1DMRA 5EESA 1TL7C 2HF7A 2X1LA 3C6KA 4FLMA 1V1MA 4W1QA 3LH5A 3R3YA 4G8BA 3E15A 3K20A 3KR1A 1RABA 1M5UA 1ZJ4A 3RAXA 3UJDA 3GLGA 1YZYA 2FR8A 2O1SA 1I10A 3HPOA 2NYRA 3WB2A 4B6FA 1L2TA 2ODWA 1BOFA 2VFAA 3T61A 3O03A 4KHPB 1YD7A 1AMOA 4PN3A 4GKAA 3REGA 2EBWA 3V32A 4BO1A 1Y4ZA 3IBGA 2F9MA 4B47A 2WUGA 1IOLA 1AHHA 3GDGA 4BQQA 2X8BA 2Q3LA 4PBTA 4FFMA 4TT3A 3KVVA 1XZ8A 4U3JA 2WD8A 1DXHA 5B57C 4UCQA 3G2NA 5H83A 2XTZA 5DTRA 2XITA 1BXGB 2HA0A 2LTAA 1C7YA 1BXRB 3FKSD 5K3FA 5JS2A 5CJPA 3I76A 3LZ6A 4JNKA 3NHWA 3SSAA 2J8ZA 1EYZA 3ZTYA 1ZG3A 1ZN9A 4IIGA 3RDPA 6REQB 2C94A 4I9HA 4BKRA 1E79A 4LHWA 2XYVA 3FBWA 3E9ZA 4NOLA 2EDCA 4RPCA 3I9FA 1PT7A 4LZJA 1MXFA 3FETA 4UB8U 3ZZ1A 2NTYC 4S1PA 5AJWA 9ICBA 1E3DA 3LT1A 4ZVMA 5IDWA 1P2TA 2MYTA 1YB5A 2XKAA 1G60A 4ZYUA 1K92A 3T5CA 3E9MA 3KD3A 5C7YA 3KZ1E 1UMBA 4P22A 2XRMA 5B4TA 3LMKA 4HGRA 2G17A 4L76A 4N9QA 4JP3A 1DKLA 4QDTA 3N2GB 2GN2A 2VPPA 4KGVA 4X65B 3IEVA 1HEIA 1ZK4A 1H4TA 1FZTA 4DL7A 5GZ1A 1YR3A 4KIWA 1I2CA 5AK4A 4U9HS 4YRDA 3KT3A 3UY4A 1HNXB 3CF2A 1MQSA 4A0QA 4KGDA 1ZJ6A 5KX5B 5G3YA 3PGKA 3QUAA 1N2EA 2O3RA 3RFTA 4EDFA 1JJ7A 3EF1A 4CT0A 4MS1B 4US8A 3FCAA 5BVHB 5B4UA 1YDHA 5LL6P 3UW3A 4UVDA 9ICAA 2EQBA 1WMDA 1KFDA 1UDXA 4MITA 4DFMA 3AU2A 3DNMA 1EFKA 4MQ6A 4PPFA 3OLWA 1BQ4A 4KQIA 5IXYA 4FEEA 3QEMB 5AKGA 1USGA 3I58A 4Z99A 1ZSYA 4B31A 4FCVA 1CXZA 1GV0A 3HFSA 1EGQA 3IVAA 4ITVA 2GTPA 4I7EA 1G8MA 1K6IA 4MIKA 2LHTA 2IBMA 4EGCB 5CA0A 1DPFA 3PQ2A 5J4VA 1GL3A 4K3VA 5CFZA 1TXGA 1F1BA 2HSJA 2G9UA 3EWAA 1JFLA 1M54A 4GOND 3ADOA 2N3ZA 2ONCA 4S35A 3U48A 3B6JA 4ZK2A 3CB4A 5F23A 3R3JA 4U0JA 1TU3A 3W1VA 3C39A 2G1KA 4WESA 1XSPA 4Z8XA 1PJ4A 5E6UA 5K6TA 3GU3A 4E2WA 2XTJA 4O3OA 5D46A 2HU2A 1JPNA 2OC4A 3CLSD 4WLUA 4PTYA 2W2KA 5DXAA 4BV8A 1KXJA 1YR7A 4IV5A 4B3RB 1G4HA 1JHYA 4Q5IA 3IX7A 3CZRA 3FWYA 4Q9NA 2VPXA 4KWEA 4JT9A 3PBKA 1SULA 1SQGA 2Y27A 4X6UA 2IYTA 4LIPD 3T5AA 4V0KA 3T38A 1MO6A 4J4HA 3DOIA 5JAZA 4YBRA 1NF9A 1KAOA 1FFEA 4Q48A 1LK5A 5KTKA 2OBXA 1EFHA 4L50A 1ZM2A 3R76A 3LLMA 2OGSA 2ZSEA 3OZRA 2FWJA 3VOTA 4D4IA 2KJ5A 2QN3A 4TQSA 3A9WA 4M9HA 2ZJYA 3WJ7A 2WJWA 5AO9A 1R27A 4F3RA 2ZJFA 3DVAA 3INRA 1VKHA 4Q45A 3HKEB 1G5HA 4HFNA 4YJHA 4C4XA 4KE6A 3RB0A 4D0GA 2VJAA 3U26A 4WLOA 16PKA 2DBRA 5IBRA 1IZ0A 4OFZA 1AUXA 3RJMA 3OPVA 4GM4A 1P7VA 3PDHA 2VP4A 4EM6A 2XR1A 1KOJA 1EE2A 3RIYA 1DQSA 4II2A 4XUDA 2R00A 1FPQA 2JHAA 3VU9B 2ON6A 4EUEA 1QGYA 2YV4A 4CIVA 2EX0A 2F9FA 4CLHA 1ZOLA 1NU8A 2A9OA 2V59A 4Q1VA 2ZJ3A 4I4TF 3TI7A 1PVQA 2GWSA 3E9NA 2BLLA 2WFLB 1EQ2A 2V7UA 2JLRA 1N56A 4WY8A 1G18A 3BF7A 4LNHA 2BWJA 1LC0A 1V8DA 5DBEX 1LKYB 1L5WA 1S8OA 5A5VA 5I47A 3OQIB 1AHNA 3RYCB 5AI4A 3I12A 2DVMA 4P5PA 4RLQA 4IRUB 1VLZA 2YVAA 5E4YA 3IUNA 3Q40A 1LQ2A 3LRTA 3EXHC 3GUYA 3D6FA 1UJCA 2XI4A 3GJZA 3CH6A 4MJLA 4MW2A 4OHVA 3O92A 4FU0A 3E81A 1JSXA 5FI1B 5A4FS 2HQOA 5JO0A 4J75A 3E5HA 4FFRA 4GVPA 4J0GA 3GXBA 1XSEA 5COBA 4XQ9A 4EZIA 4IKPA 2XHZA 3WIOA 2R4UA 5JQWA 4DLAA 3I09A 4I2AA 4BQSA 3GA7A 1K4KA 3OQMA 1EP1B 4DDUA 2K4IA 3Q8RB 1XHFA 3QVKA 1T3NA 3K5HA 4MIYA 2SBTA 1JFSA 3ZNNA 2QORA 2OHIA 1C7ZA 1ZCBA 3GLTA 3I2HA 1G8HA 3FTNA 4WD3A 1K6XA 4KPUB 1L4NA 5TGZA 4JCOA 1N36B 3GA5A 5JAOA 2GD0A 4PPXA 2X1MA 3JWIA 1LQTA 2RHWA 2X86A 2VN8A 4DS4A 5HQ3B 3UV7A 1P2SA 4K9DA 1BWQA 3DTNA 3NVAA 3KVRA 5G0WA 3AIKA 2H1IA 2GKGA 1I6WA 3I9LA 3VMMA 3AB7A 3RVRA 3QFCA 3LU1A 2P2GA 4MI1A 3IP6A 2Z2JA 5LXTB 2QYSA 4RESA 5KVCA 2C00A 3URMA 3H6GA 3PUXA 1RLMA 3ZHUA 5AXAA 4U2GA 1UEJA 5IC6A 1YJ8A 4LJ5A 1PUIA 4M0PA 1E1LA 5EWJB 2QVLA 1NUAA 2OCEA 3C3WA 3TEFA 2NVWA 3PWKA 5BOSB 4CKWA 4CM9D 2W2LD 4CEIA 5K8JB 1NLUA 3LT4A 2E9SA 3HUDA 2GEJA 2GMWA 5ARCA 4KW7A 2GCIA 3MUEA 2EYUA 3K0AB 1U28C 7REQB 1JVBA 3PX4A 4OL0A 1QC5B 3DWEX 2O2XA 2LPEA 3CPJB 4B9AA 4QIHA 2XB9A 3MGBA 2WJJA 1WU8A 4F3OA 3THWB 1L4KA 4DABA 3EZ2A 4N6OA 1FFWA 2JIOA 1XC7A 2VCHA 2IGBA 3AU8A 4Y1RA 3AFHA 4HVAA 2A9PA 1Z37A 3LS2A 4DQIA 3FNBA 3HV2A 4Q9HA 5FCDA 3S28A 3C6BA 4BPBA 4LXGA 2A4MA 1RQGA 2FFAA 2OGWA 1P4JA 1TJYA 2PSHA 2IUUA 1GUBA 3OIWA 4EFMA 3I9JA 1ZITA 1CUGA 2ZXUA 4PIVA 1NUPA 1UUFA 2O8EA 4GWKA 3L8HA 3ESAA 1R6VA 5KHOC 3JR3A 5L4NA 4YVZA 3UTDA 5BPHA 3MS7A 1TI7A 2MWMA 3QXSA 3UCXA 1JH8A 3GN2A 4I2FA 4XFKA 3EGOA 3DJFA 3LKVA 4DQRA 5TY0A 4QX6A 2CDAA 4B7AA 2Y0SC 4WV3A 3BMOB 4EGJA 2YWEA 3PNKA 3WJAA 2QN8A 1NUHA 4BZZA 1IM8A 1T9GS 3EXG2 4V0OA 3L4SO 2DUMA 2NV2B 3A1UA 1M1ZA 5AW7A 1VA4A 5C5EA 4Q9LA 2K7FA 4RTLA 4AY2A 4C9BA 4V1CA 4M9XA 3PV8A 1VBFA 3FB4A 5JC8A 3I6ZA 3SR4A 2FEKA 4E30A 4GZ5A 1H8EA 4HNUA 1ZIDA 2CKDA 4RY8A 4AWBA 1BGWA 3DEJA 2C3PA 4MVJG 2QW0X 5T3YA 1S6YA 1QG6A 5C0OE 4BFVA 5CBPB 4EUKA 4MNTA 1VRWA 3LTNC 1W4AA 2YZKA 4OHPA 4N12A 3FC4A 3LK6A 1YJ5A 1SR8A 2QJWA 3BD7A 1FDRA 5KYWB 4CTKA 4K9QA 3K35A 1FLAA 4AZTA 1ZOIA 2AKYA 3QI2A 2XMPA 2KLHA 4G6ZA 5CLHA 3P9CA 1ZZEA 5BR7A 2XZTA 1WMEA 3I34X 2I34A 2LKYA 3ESYA 3MNFA 3CPEA 3WISA 5IP5A 1Q15A 3KNZA 3EXEA 5F2NA 4ISBA 3B1YA 2C7OA 5DU2A 4HCJA 5DDIP 1MTZA 3WWDA 1NK7A 2QY6A 3KIPA 2HW8A 4KJZA 2D7JA 3C5WP 1CLUA 4F9GA 3OHMA 4K8RB 4F06A 4RZHA 4JI5B 5AI8A 2JD0A 5KC8A 3ZZTA 3AERA 3W4KA 1JYEA 1UPAA 3T12A 1HYHA 3K15A 4G0PA 4BS9A 3TTTA 2YL2A 1FLNA 1M72A 4JEHA 3GUHA 3SV4A 2X5OA 1XDUA 4KMSA 2AHOA 4M83A 4QTZA 3IAXA 2I4LA 3MRTA 2BPFA 3AHEA 2DHRA 4F91B 3EH1A 3LKDA 1ZGGA 2ZXIA 3CF6R 1PKXA 1J7KA 3UIEA 2J3HA 2KD1A 3W3AA 3DTVA 3VKHA 2HR1A 1UOEA 3JASA 1Q20A 3I0MA 1O96B 1CT9A 5BRNA 1ZNXA 1N8TA 5IANA 4MR8A 2HHWA 2OR3A 3A4LA 4O4JB 3QIVA 3FSGA 3EA5A 3TOSA 1QONA 2YRXA 4L6CA 5AVUA 4FNMA 3HFJA 4M36A 2NSLA 4RDXA 2CLLB 3AVYA 4Q4AB 2WBLC 4KZKA 1JAZA 3CKLA 3V6LA 4NVRA 4XJXA 3TZHA 4ZI7B 5LYJF 2CUNA 5BY2A 4GHWA 1GADO 4QDKA 5E2AA 5EEGA 3WV5A 1SUFA 3U44A 5LNK6 4QXAA 4UD2A 5CT8A 3R5SA 4PZPA 4B3TB 3KPWA 1YCHA 1SA0A 3M6ZA 2J9RA 4I1VA 3R2JA 4DSLA 3WB0A 5JE8A 1XRJA 3DVRX 3UK7A 2QF7A 1HWYA 5T14A 2V5AA 1G8YA 5EKUA 4DRYA 3OURA 4GPTA 1JA0A 4QARA 5JJBA 3D2BA 1KYWA 4BZXA 4PPQA 1Q22A 2GPWA 4OXQA 2WSIA 1EX7A 3P4YA 3O4HA 4JY7A 5IJXA 3KV3O 3G9ZA 4MLDA 2A9VA 5BV8A 3H1BA 4LDZA 3I1YA 1RM5A 2D4HA 2XDQB 1HNWB 3QJYA 1X14A 1XO1A 1WETA 3ZJVA 5TPZA 3Q5EA 4FHFA 1PKEA 4RWZA 2PGAA 1LBIA 3ABIA 5BOMA 3R5TA 3H4MA 4AXXA 3M3DA 3AXSA 1DVRA 3P2IA 4FS8A 3RUEA 3P26A 2FPIB 4KQEA 5CDTA 1QYIA 1H4QA 10MHA 4RMHA 3AR2A 2WLTA 5K45A 3KETA 1QHIA 1SC1A 3KZIU 1CQJA 4ZC1A 1AQYA 5HBRA 4YR3A 3WK8A 5JXWA 1PT9A 1YQUA 5BUCA 3O21A 4AMUA 1MB4A 3OQ6A 1T5TA 3NRCA 1WR8A 1NK5A 1SKRA 4UZSA 1DKNA 3I8XA 1RLIA 1WWVA 1FQJA 4RACA 4FDAA 1HOXA 3UN1A 3DW1X 2AK3A 3IBCA 4D0RA 8ICBA 5E1BA 3LYHA 5DMHA 5ALEA 2QVCA 3IEMA 4DCSA 1AMUA 1JHUA 1Z35A 3PDIB 4NPAA 1AM4D 4ZOCA 5D6NA 3WMRA 2AGVA 4CEJB 5AFSA 1D07A 2WIFA 2QK4A 1HYBA 2VK4A 3OTWA 1SXJA 3CVOA 4C4AA 4F5EA 1TAMA 4QTTB 4Z53A 2QROA 4JFRA 1I7PA 2J0UA 3FXAA 4X1IB 3HRIA 4YP7A 5HW0A 4FMCB 2IEYA 2P8JA 2NRVA 1OGYA 3DDZX 3A2MA 1O4WA 2AG0A 1BVYF 3QLVC 2VK2A 3TZEA 1SCDA 1IDOA 1WE2A 2W6JD 2GA8A 2Y76A 1TU0A 4A8EA 1R1DA 3EZ6A 2B35A 3NBUA 2OFXA 4UXIA 5DLGA 3JD2A 1SUSA 4Z6FA 1Q77A 1A82A 3C3DA 1I51A 1XROA 1J20A 5JG7A 1LV7A 5LP1A 2C9MA 4DLXA 4BLTA 2ZSUA 2GZAA 2VP0A 2H0AA 1ZC4A 5CB4A 3SZ2A 2C4TA 4ESHA 1MIHA 4EEYA 2CL5A 3RRXA 5JLAA 5DQHA 4JVLA 1B41A 4CNQA 3VU1A 4K46A 5A1JA 2DF4B 3RF9A 5B36A 1DO0A 3MYYA 1ZQNA 1QYWA 4W6QA 4EJSC 4C7OB 4G5RA 2P3LA 3KWLA 1MO5A 1CZRA 1H3FA 1CRQA 5A05A 1GO2A 3STVA 2DHEA 1BWPA 1E2MA 1YDMA 2J5BA 4KE7A 3DZ8A 1E3WB 1Z68A 2ENWA 1E1RA 4CLDA 1RI2A 5K4HA 3KOUA 3RYIB 2DT8A 4M98A 4UOQA 3IO3A 3NATA 1KLNA 3R8CA 1NNSA 5ALKA 1JMYA 3KYCB 3VNAA 1R8JA 2TS1A 4JQOA 3K5IA 1N5JA 1PW7A 5BWOA 1U11A 3AF1A 2R68A 3CBQA 1NQOA 1LH0A 2VAWA 5JROA 1U8CB 2QE6A 1QP0A 1V38A 4L6AA 2FWIA 3NIDB 3S0JA 3RJEA 3GT7A 4TURA 5J2IA 5M29A 3MJEA 1Z4NA 5I9LA 5K03A 4DY4A 1WZCA 3V4FA 2IXAA 3AFIA 1VL1A 4L78A 1QP4A 3F9IA 3PE6A 5FTNA 3O8BA 2HMXA 5DWDA 3VZPA 4MMYB 4ZU3A 2HPZA 2FF7A 1EJ0A 1IYZA 3FTDA 4HDMA 5EMMA 1KYIA 4B3HA 3OO0A 4DIDA 1FMCA 4R66A 5BW8A 3WLHA 4IJKA 3UT5B 2F1HA 2P2DA 4OGFA 1XLVA 3WL7A 3CMMA 3KXLA 2P4HX 1X7YA 1JHDA 1QU3A 1SIUA 2B2XA 2G0TA 3TNLA 3H97A 1O6ZA 4XFJA 4K2HA 2PH3A 2VJMA 5LA6A 3O8QA 1BFKA 1VCNA 3A9CA 1YS9A 2BUBA 4OMCA 1E69A 4YUVA 5H82A 5B12A 3DFUA 3HXPA 4D5EA 1TD1A 4BNDB 2WM3A 4GR9A 4FGSA 3DOCA 5F7ZA 4LK3A 3OIGA 1EVQA 3LHKA 5B58C 1Y6QA 1W4BA 2PKYX 1SCAA 3HG7A 2EZUA 1CUYA 5J9FA 2BEJA 2HOQA 1R6AA 4R1UA 1C30A 4INAA 5C3UA 1MABB 2DLDA 5JQGF 2PIAA 2BCJQ 3PR1A 4FSDA 1LLDA 4ZOQI 9ICLA 2AA3A 4DJAA 1ZAYA 3E7WA 2GVDC 4I1IA 3V48A 2D6FC 2XUHA 2WABA 4E3WA 4KJXA 1F4PA 2HD4A 1OJLA 1CEXA 3ODGA 1JSCA 2HBMA 4DAEA 1LRLA 3ER8A 4Q7LA 1E60A 2CYBA 4F8YA 4I4CA 2K60A 2P2ZA 4KVFA 4RYDA 3TH5A 2QLLA 3JYHA 2BT4A 4E2ZA 3PLAE 3ZD9A 3ZUPA 4KNYA 3Q87B 2R2AA 2IXDA 5IT4A 1BS2A 4ZYZA 4YPFA 4C0KA 4KIJA 4NE7A 5KFPA 3S8MA 2YV5A 4H18A 4AB1A 3IVCA 1H2ZA 3HQ4O 2E49A 1BE1A 5CNMA 1X7XA 1X8KA 2ZPUA 1DBPA 4IJUA 3CIFA 1FMLA 3KSZO 5BXYA 5KJ1A 2XMSA 2UYGA 1JDTA 4JI8B 3NTOA 5IBQA 1KSFX 3DG9A 4H7KA 3S55A 3HHEA 3ZBTA 5FO1A 3ZLVA 2GOYA 3ZNQA 4JYBA 1R8YA 1IQUA 2XZDA 1R4NA 1BW9A 1TEVA 4L57A 1ATZA 3CCCA 4MMXB 1UZLA 3ZE0B 3COJA 1C50A 1ZM3A 7ICUA 3HJRA 3TTUA 3KQPA</