3QYPA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with calcium and phosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
b'KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
total genus 81
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qypA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qypA01
2B82A 4CNQA 3A1EA 1L7PA 3A1DA 1U7PA 3L1UA 4YIKA 2VKQA 4Y2SA 5AIAA 5AVTA 4DWOA 3NAMA 1RKQA 2FPSA 1L8LA 2O2XA 1YV9A 4BNDB 5AIBA 1L7MA 3ED5A 1IWOA 1WR8A 4DFDA 1LVHA 1Z4QA 2BDUA 2JAUA 2FPUA 3U7HB 2YMPA 5AVRA 2G80A 3EPRA 3OCUA 4HAIA 3HYCA 1Z4NA 1Z5UA 4BEVA 2WF6A 3N5KA 4XE5A 3L8FA 1J97A 5AM5A 1LTQA 4IG4A 1ZS9A 4EX7A 2I33A 1ZRMA 1RQNA 2IOHA 2G06A 5ALVA 2C9MA 2WHEA 5ALHA 3SD7A 2PQ0A 2I55A 5ALGA 5ALOA 3VAYA 3D6JA 2GFHA 2ZBDA 3WGVA 5ALXA 3KZXA 3UMCA 4UATA 1NRWA 1RMTA 3ESQA 4B6JA 5AW4A 3E8MA 2G0AA 4XOUA 1Y8AA 5AM1A 1YMQA 2G09A 3GYGA 1VJ5A 4C4TA 4UMVA 4UMFA 5ALLA 1SU4A 5ALPA 2BDEA 4L6CA 4UMDA 3W5CA 2YJ4A 2IYEA 4NV0A 2HEGA 2HI0A 3QU9A 4FFDA 2WM8A 3RFUA 3AR5A 5AW7A 4J2TA 2CFRA 3SLRA 3WKAA 4JB3A 4FYPA 4GXTA 5IT4A 5ALEA 4DW8A 2C8KA 1N9KA 3ZUPA 2YJ3A 4MUMA 3FGOA 2ZBFA 4HGRA 3QUBA 2PR7A 4UMEA 3IB6A 4BEWA 2P11A 3AR3A 4C4SA 1O08A 1WPGA 3ZU6A 2RBKA 3U26A 3BWVA 4O8CA 5AVSA 3SHQA 3I76A 2YJ5A 1MH9A 1CR6A 1U7OA 3KD3A 4ZEVA 2OYCA 1T5TA 4BX0A 3HLTA 3KOOA 4Y2XA 2YN4A 2MSNA 3ZX5A 1ZD4A 2HDOA 1RDFA 1Z4LA 2JAWA 5ALRA 3ZI4A 2YMQA 4I9FA 1TJ4A 2HF2A 2HOQA 3L8HA 1QQ7A 2IA5A 3WK8A 2GHTA 3ET5A 4HGOA 5AW0A 3ZW7A 3U7GA 3KC2A 5AKGA 2GHQA 2JGAA 4EELA 2GMWA 4NFLA 3OCZA 1AQ6A 2W4MA 4UM7A 3ZTWA 3UM9A 4AS3A 4BKMA 5ALIA 2EATA 2FPXA 3E81A 4KNWA 3DAOA 1Q92A 1T9ZA 1L6RA 5AK4A 4J03A 4EZEA 1ZD3A 2HCFA 1TJ5A 3DV9A 1SWVA 2ZOSA 2FI1A 2WF9A 1U2SA 3IJ5A 1O03A 1Z88A 5AKZA 5AKKA 3AR4A 4CF5A 2YJ6A 1ZD5A 3FPBA 4BNDA 2MU2A 3L8GA 5AKJA 3L8EA 5A3SA 5ALSA 3R9KA 3DDHA 3OCXA 4MWOA 1RPZA 3L1VA 4RESA 1EK2A 2R8ZA 3N28A 2JARA 1XPJA 5AI9A 5AI4A 4KX5A 2EARA 2RB5A 3QU5A 1TE2A 1N8NA 1NNLA 4KN8A 2W43A 4Y2QA 5AW1A 3OCVA 3QYPA 3PGLA 5ALNA 3ZWKA 2WF7A 2B1RA 2QLTA 3RF6A 3WK9A 3KDPA 1SWWA 2B0CA 4UASA 4UW9A 3ZX4A 1RMQA 1ZJJA 3QGMA 5AM4A 3FVVA 1KYTA 4G9BA 1ZRNA 2Q4TA 3OPXA 2R8XA 2NYVA 5ALTA 3U7FB 3N8GA 4OHFA 4KX3A 3NALA 5AVZA 3EF0A 4Y2YA 4F71A 2FDRA 3K1ZA 2R8YA 2G1AA 2HHLA 4FE3A 3L0BA 4H1WA 1PW5A 4CF3A 2B1QA 2GO7A 5AKLA 5ALYA 1ZD2P 4G63A 5AM3A 4UU0A 3B8EA 3NUQA 1S8OA 2NO4A 1RMYA 3CZ4A 4L57A 4YCLA 2FEAA 2FPWA 2G07A 5AW5A 1U02A 4BX3A 3J7TA 3SKXA 4QJBA 3QNMA 5AKIA 3IRUA 5AHXA 5AKYA 3R09A 4BYGA 4ZEXA 1RRCA 1T5SA 3ZVNA 4AP9A 5AK6A 3AR8A 1XP5A 4Y2PA 5ALFA 3PDWA 5AI6A 5AVXA 4KYTA 3W5DA 3P96A 5ALDA 2ZBEA 4UM5A 5ALJA 4EX6A 4Y2UA 2ZXEA 4NAVA 5AKEA 5A3QA 5IT0A 2AUTA 3QUTA 4BBJA 3L0CA 3NRJA 3MMZA 2IOFK 2MU1A 2B8JA 3NASA 2QYHA 4JDPA 1U2TA 4HYTA 5AI8A 2EAUA 3MN1A 3QLEA 2YFYA 4Y3UA 3WK7A 4NABA 5AW2A 2IOFA 2AGVA 3N07A 4UAUA 1RKUA 5ALQA 3WKCA 1WVIA 3WK6A 4Y2VA 4NWIA 1Z4KA 1K1EA 1Z4PX 3WKBA 4IFTA 1L8OA 1EK1A 3OCWA 2WFAA 2AH5A 2DQSA 5ALMA 2RAVA 3AR9A 3UMBA 1RKVA 2OM6A 2O9JA 3WK4A 3R4CA 5AM0A 2P9JA 2JAOA 4UU1A 5AK5A 4XQ0A 2CFSA 3OCYA 2Q5EA 1Z4IA 2YY6A 3M9LA 1L7NA 2P27A 3ONNA 1Q91A 3E84A 1RC8A 4KNVA 2B8EA 3A3YA 3ZVLA 3E58A 2OA0A 2HF7A 1ZOLA 3KBBA 4YH1A 5ALKA 2I6XA 4RETA 5AI0A 3I28A 5ALUA 3WKEA 3W5AA 2CN1A 3ZWDA 3EF1A 2C4NA 2YBDA 4OCZA 3OTQA 5AW9A 5AW8A 2AMYA 1XVIA 1S2OA 3L5KA 4HGPA 3B9BA 5AI5A 4CF4A 2CFTA 3W5BA 3MC1A 3NANA 4YCNA 1QH9A 4OFZA 3A1CA 4L6AA 2ZG6A 5JJBA 1X42A 5AICA 4C4RA 3I1YA 2OBBA 4XPZA 1TA0A 5A3RA 1QYIA 1CQZA 1VFPA 5AKXA 4AS2A 2I34A 1YDFA 3L0YA 1WZCA 5ALWA 4PNHA 1YNSA 1YJ5A 4Y2JA 3AR7A 2WF5A 2ZBGA 3EWIA 2B30A 5T41A 5FP0A 1Z4JA 2P69A 2RARA 4DCCA 3NIWA 3U19A 5IS2A 4OD0A 2Q4RA 5AVWA 1QQ5A 2YMMA 2FPRA 3ZVMA 2C8LA 4YCMA 3PGVA 3UMGA 2WF8A 3WK5A 5AVUA 4GIBA 5AVYA 1QQ6A 3I6BA 1RQLA 3QXGA 2HO4A 3U13A 3BA6A 1NF2A 4I9GA 3SMVA 3S6JA 1JUDA 4Y2RA 4CE6A 3QUQA 2G08A 3PCTA 5ALZA 2ODAA 4UAVA 3WKDA 4UARA 3AR6A 5AVVA 5AW3A 2FUEA 1J8DA 4YGYA 4BX2A 1TJ3A 1Z4MA 3CNHA 1RLOA 3U7EB 4EENA 2PKEA 2NO5A 2X4DA 3QU4A 4Y2TA 3AR2A 5AK3A 3QUCA 3B9RA 1Z4OA 1RLTA 3ESRA 5AVQA 3FM9A 4EEKA 4HGQA 2D2VA 1FEZA 3QX7A 2C88A 3QU7A 5AW6A 4ZEWA 3WGUA 2R8EA 2BY4A 5E0OA 1YS9A 2HX1A 1Z5GA 3ZTYA 3L7YA 2I54A 2HSZA 5AESA 3M1YA 5AKHA 2I7DA 3F9RA 3QU2A 3SKYA 3MPOA 4YIHA 2W11A 4F72A 5AM2A 2YMLA 1VJRA 3ET4A 4QQFA 1RLMA 4E88A 1L7OA 2FUCA 3FZQA 4HGNA 3SF0A 3DNPA 1F5SA 3TLMA 3FPSA 3N1UA
chains in the Genus database with same CATH superfamily
1DXQA 1FP4B 2GN9A 3A1EA 3L6RA 4NLZA 1M34E 4TQSA 1XNJA 4O0LA 4ZQGA 3PDIA 2ZYRA 3Q85A 3NM4A 1QQTA 4FZNA 4MA4A 4EY5A 5FV7A 1DB3A 2KMDA 3FN4A 3NC0C 4BVAA 1RLJA 3O38A 4LHVA 3CLUC 4DA0A 3ZOKA 2F77X 2Q41A 2PWBA 3H2HA 3TZKA 5KTSA 3PA6A 2W58A 2WYHA 4XX0B 1NV9A 2EJWA 3F5DA 1Y63A 1T25A 3MHTA 1YT3A 1PUZA 1VECA 4CV1A 1E69A 1PFVA 1JIXA 1A2KC 3OZUA 4E09A 5ICFA 2WFLB 2G8NA 1EXDA 3CNBA 5H83A 3AJRA 1W5EA 4AURA 4FYIA 3PQ6A 4GQBA 4AZ3A 3V97A 2C61A 4NU0A 2JGLA 2AUNA 3K32A 2VPQA 5H8WA 3N6XA 4ON9A 1FDSA 4TVSA 5BYBA 2HIHA 4Y6OA 4ZMRA 4Z8YA 5AM5A 1NVBA 4EO9A 3RRYA 2IW1A 1U9IC 4FDMA 5F4BA 1I4WA 3DL4A 1M8JA 4M36A 1EVEA 1I7DA 1YQWA 1AK9A 4LZOA 4XGKA 3CZMA 3SXPA 2NXCA 1CEXA 1IM4A 2Q6OA 2V3VA 2CXQA 4H7KA 5KVAA 4GXKA 1ZLXA 4MUHA 2ZWAA 1X7YA 3AUUA 3FNHA 3OF2A 3W5JA 1B43A 4Z6EA 3UJDA 3HFGA 8ICMA 2Q0HA 4I55A 5HEKA 2Y1JA 1Q12A 3CBQA 4X5OA 5CYPA 2AF3C 2PNFA 4C4ZA 2Q4OA 4FHFA 4MRAA 4N0QA 1C29B 4NEGA 4Q19A 2C5AA 3PPWA 1VYUA 5J40A 5DHAA 5TSDA 5IH7A 4JP5A 5HM8A 3GRZA 4ZICA 1H6CA 1ZMBA 2QG4A 3N05A 2N3ZA 2I2FA 3BFKA 3IE0A 2BFNA 4M22A 4RQBA 5BSVA 5FR1A 3FKJA 1NRWA 3HO8A 3FJ1A 4GLLA 1HO3A 1VYTA 4KLSA 3ESQA 1S3GA 2AZDA 4DJEC 4QUAA 2CCJA 3KHKA 3RVPA 3E5RA 2HT1A 4XIJA 1KQPA 3P0IA 1FP7A 2UVUA 4KUGA 3R7BA 1V38A 4C4TA 3JPOA 5AXBA 4NYJR 5ALLA 1GSIA 1NX9A 4RY8A 3DS8A 1SVSA 2V7QD 1XROA 4EF6A 1JHQA 3O03A 4RFSA 2B94A 4IIDA 3TB6A 5MGNA 4PQGA 4CKCA 3TOZA 1KZYC 1USVA 5C8YB 3YASA 1K2VN 4B9SA 3EEOA 2O6LA 2FH5B 3MFYA 4NU8X 2UYYA 1H9AA 1KK3A 2IS4A 1G9XA 2KYRA 2DQZA 3KBOA 3TTSA 1ZX1A 3RRBA 5AW7A 1DK3A 3IMCA 2ZULA 1NONA 3ORHA 3DZJA 5ARCA 3VU8A 3RGWS 2QP4A 2F1JA 2W3RA 7ICIA 2FW9A 2VSYA 2NNWB 2ZJYA 3PLRA 4FYXA 2IS2A 5K6RA 1BCSB 1KAEA 1K92A 2X23A 3MIIA 4GXTA 3UWSA 4TMYA 6Q21A 1YFLA 1MN8A 1BQ4A 3RS4A 5TQVA 2K2WA 1KSJA 1YSCA 4DNQA 2GLTA 3JTMA 4AJ9A 5JWOA 3OFKA 3QJYA 2I1QA 4H60A 1V9CA 3IB6A 3IVMA 1R8YA 5L1MA 2WUEA 3V6KA 2P11A 3C6ZA 3FYUA 1TFRA 3EUFA 5GQSA 1N60A 1XALA 2NZ8A 4JUFA 5FA6A 5TXGA 4G1VA 4LBVA 2IP4A 3X43A 3PJEA 3JQAA 3UV6A 3E3OA 4FHGA 2DQNB 1N5IA 5EQDA 4E3ZA 4KDRA 1ATZA 1CF4A 4KDEA 3CE6A 4R6XA 4G0VA 4R98A 1P19A 4BWMA 1S9HA 5CTJA 3GPIA 1AA6A 5JCJD 4EG7A 2VHQA 1TEVA 3H0MB 3IP1A 3LQ4A 2VQEB 1W35A 1JLRA 2GA8A 3B1VA 2PT5A 5E6UA 4KRFA 2BUAA 4JEHA 4LSZA 3UHFA 2IS6A 1JDSA 1UAGA 1UANA 1X7XA 2JFYA 3E70C 3S2FA 3RNLA 1RQGA 1BE8A 2Z3ZA 4CHGA 4OL0A 5CNMA 4DJAA 3K6RA 2ACKA 4X90A 4UQLA 3HP7A 4XVCA 2EYUA 1X39A 3PPIA 1Y9DA 3HXMA 4P08A 2H9AA 3ITEA 4X63A 5L4SA 3PFIA 3DAYA 3KKEA 2CLHB 3LKDA 3LW7A 4BASA 1J1ZA 4X24A 1P5HA 3NWJA 2PT9A 3P9KA 9ICQA 5JPDA 1MXHA 4TMKA 4DQLA 5MFPA 7ICFA 1FBNA 3GVXA 1NVGA 5GMOA 5KC9A 1O6CA 3F6BX 1H0RA 1L5WA 4JOBA 2XD9A 3H16A 4LC9A 4OHKA 4Q9NA 2O2DA 3V48A 3GAFA 5JJKA 2ZATA 4DLXA 2EATA 4B2YA 4MKGA 1A4IA 4ER3A 4A27A 5MHTA 2C82A 2I7VA 1UPCA 3K8QA 5CEFA 1AB5A 1NXWA 5AT1A 5G1PA 1Q6ZA 2HGSA 1TLFA 2J7PD 2QRZA 4I5EA 1A97A 3AVQA 4CU2A 1TZ2A 1XV5A 3QWHA 4LOHA 5BV7A 3PNCA 1RZRD 4D5GA 1L3UA 3E9NA 1WPQA 3IJ5A 4F7DA 5JD6A 1TXGA 1Q46A 4FB4A 1ZK2A 1P5FA 1X7ZB 3IBSA 4M89A 1W44A 5AKKA 2DWCA 1G6Q1 3N7RC 2WOJA 3LQYA 4J9RA 2P2LA 2A6PA 5CP8A 3JASB 4FS2A 3VR6A 3KJIA 3ICQB 3TADA 2AF4C 2FNAA 3FBTA 3L8GA 3R0IA 3HN7A 1GRNA 2O7QA 4RZ3A 4UNIA 3WLTA 1HR0B 1W8IA 3MR5A 4F11A 1TVKA 2FPPB 5KQLA 4ITRC 4M76B 2RGGA 2OC4A 3K30A 1DT5A 1DWQA 4G0QA 1T8YA 4XGIA 7ICRA 3Q7RA 1ECCA 2DUUA 1GUBA 1NQOA 3OIWA 2ZAGA 4XOIA 3GZJA 1TAHA 2W2XA 1RCFA 8ICNA 2O0MA 2SHKA 3CNOA 3GPBA 3IOEA 3RC7A 3RKRA 4HNTA 5DBGA 2EC5A 1YZ3A 4Y6QA 3THXA 4BV8A 1EDZA 5SZIA 3NHWA 1HDYA 1L7BA 3EGXA 4UEKA 1SBYA 3HBJA 2NT3A 4J0HA 4WKNA 3VDQA 5I5EA 3M6LA 1C2YA 1BGWA 1CQJA 1Z8HA 2VBFA 2W6JA 3KPUA 2MUTA 1QH8A 4Y1RB 3HNOA 3F67A 4KQMA 4MKFA 3T7DA 4W5JA 2O59A 3EPPA 4HPJB 4Z3KA 2B8NA 4BDSA 3MJEA 1CUZA 3PTLA 2BSXA 1L4NA 2GPBA 4JGBA 5LDDC 2H7VA 2SECE 2IWHA 4NBUA 3TMYA 3CEJA 1K6IA 3FHOA 2E48A 2QM3A 3KD2A 7GPBA 3W3AA 2XBMA 1KNXA 1V5EA 1FOEB 2JFZA 5H81A 2HPZA 2J46A 1NSTA 1XRRA 5JLAA 4ZYYA 3ZY6A 2OO3A 3F9CA 3VA7A 4KWIA 4M1OA 3CSUA 1LUAA 5I7RA 1GPAA 2H29A 4BO4A 2UV8A 2XCSB 3G8YA 2IITA 2H17A 1URPA 2FEMA 3FCAA 1ISJA 3GFFA 5KFLA 4B9VA 4GXRA 5ANRB 4GPZA 2VHVA 1XZDA 1BVSA 1Z82A 2VIIA 4JJZA 4O08A 4UBOA 4ENPA 1QTQA 2ZIVB 4IMJB 1XOIA 2GN0A 2WU3A 3IAHA 4P3XA 1QE5A 1MB0A 4DYHA 4NM1A 2PX4A 1R5OA 3MF4A 1G42A 3AY7A 2LCFA 3O6VA 3FLEA 3OP4A 4PLCA 4W9NC 3ODPA 3PICA 2VDVE 5AKLA 1A7AA 3A0UA 1NIPA 2PMKA 4DMUB 4OB7A 8ICKA 4Y30A 4F9EA 4G5QA 1P0MA 3RIMA 3BIOA 3F4KA 3P9PA 4BFUA 1SO8A 3L43A 5IYZB 4WBSA 2IS1A 4AYWA 2ARKA 3QF4A 4UHJA 4KO1S 2CWWA 4ED9A 1RXVA 1H2ZA 2GX6A 3MLEA 4KPUA 3U6BA 4CIXA 2VK4A 3O92A 3G0IA 2R6JA 3J7TA 3ZGYA 4MVJG 1ULHA 4BUJA 3GLRA 4KP7A 4F2GA 1F12A 2O7NA 3QNMA 4LXHA 3KVNA 2BMWA 4I8XA 5FBWB 4EPXA 1ZVJA 2COUA 3Q3CA 5AHXA 3C5GA 2DKNA 2MSCB 1OA1A 2SCUA 3I45A 1R7RA 3IAS6 9ICJA 3KOWA 1NP6A 4KAJA 2ZTEA 1T5SA 3TINA 4X44A 3N0WA 4X3CA 4DS5A 1L4FA 3OE5A 4WLFA 2ZIZA 1H93A 4AZWA 3BGVA 1Y3CE 3ICXA 4C8MA 1Y1SA 3AP3A 5GJBA 2WZDA 3P2MA 2IYOA 4DN6A 4UM5A 2FX3A 2KTQA 3O0DA 4ARZB 4AJPA 3MTGA 1Z9BA 2FK8A 4NPAA 5BWCA 5AKEA 3PZBA 1BQEA 3DCJA 3NBUA 5GV8A 4O6VA 3TKYA 1PZMA 4MV1A 3SZ3A 3PJDA 4A6XA 1X1QA 2NRVA 5TE9A 5C2JB 4GLXA 4WFKA 4BBJA 1J8VA 1JILA 4K4HA 2XQIA 1WMDA 4W5WA 1I1HA 1VG1A 3LA6A 2KSOA 3R7DA 3PPVA 4IKOA 2WV7A 1U2TA 4DF8A 1U9JA 3FNBA 4HYTA 4EM6A 4TSRA 1TQ8A 4MZDA 3K5IA 2R6DA 2YRWA 3B5IA 3OT5A 3PCXA 3RH5A 3ITDA 4HAWA 3TRJA 1E7YA 2K8BB 1UMDA 1RCTE 1SKQA 4IH9A 5AJWA 2C2BA 3EVZA 3CQ9A 3AVTA 4DSIA 1AA9A 5IUJC 5C46F 2R2AA 5H68A 5TT1A 2X19A 4DA4A 5TMEA 3C4JA 3MHPA 2XMRA 4Y6PA 3OOHA 4EAQA 1EXVA 2AMVA 3H42B 1UMBB 1J9EA 3BICA 1DINA 3OC6A 2PXAA 3P9SA 2ZKIA 4TSFD 4E5PA 2Z9CA 2DERA 1PZFA 3ZWNA 4G1UC 1NDHA 1ES9A 4NVRA 4YROA 1AKNA 4XIFA 3HYRA 4FD2A 3L07A 4EB0A 4YRAA 2IYFA 4CN9A 1PJAA 2PD6A 1CDZA 3EGDA 3RB3A 1I0IA 3AVVA 4OJ5A 3W7VA 2DQSA 3QEBZ 3E5HA 3LHFA 3OEEA 3PDJA 5JNWA 2G77B 4CI9A 2O9JA 4H18A 3CZCA 2JI4A 3OY2A 1U0OC 4UU1A 2J59A 4N0PA 2IL1A 2R6FA 3RREA 1ZXLA 1Y6FA 3JQ8B 1L6NA 1RPTA 3W4KA 1MRSA 4OXYA 1Z0AA 4PNPA 1UKCA 1QIJA 2HXGA 1L7NA 3IT0A 5F2NA 2P27A 3JR7A 5DB9A 4EVSA 4HDSB 2A9FA 1VCOA 5JU5A 1X2EA 3DEYX 4MUXA 1XXHE 4O33A 6ADHA 1EB9A 3ENZA 4UE6A 5JH7F 2VDJA 4XEHA 4X3PA 3ZVKA 1T9HA 3GLQA 1XFDA 2Y1OA 4OQXA 2YB1A 3MWGA 4RETA 3VKUA 4I55F 3DOJA 4HDRA 3WGZA 4A73A 1H6AA 3NVKI 1K2WA 1VLBA 4ALMA 2IIQA 1QHYA 2C2XA 3DR3A 4PCVA 1GA4A 1QBGA 3OTQA 1FXWA 1JDUA 4Q7MB 1YI1A 3BE5A 3L0SA 4IVRA 1QU3A 2HPVA 4JKOA 3MD9A 1EFRD 1QWOA 3P94A 4WGFA 1HEUA 3B9BA 1OV4A 2ZPAA 3V8MA 3D7LA 3EODA 3EDQA 1CULC 1I33A 4CF4A 4FZMA 3QOWA 4IQ8A 1VDZA 2QRQA 4ER7A 3FVTA 3OIVA 4IKEA 3TCKA 4FINA 4MLCA 1SVWA 4AQDA 2W8KA 3GLFB 3OJOA 4W9MC 2B25A 4HWKA 1A76A 2MYNA 3GFKB 2QENA 5J8YA 2IDZA 3I9OA 1DJMA 1YR2A 4HYEA 5AICA 4LNHA 4MQFA 1PK8A 2OBBA 1LBTA 3RAXA 2OAGA 4E0DA 3V6MA 4R3UC 4NE2A 2HEIA 2GVNA 4ATNA 2HADA 4Z7OB 4UTPA 4AO7A 1PK7A 1TVMA 3UBTA 1ENYA 1S7CA 2VYVA 2XB8A 4L5IA 2ZBQA 2I34A 3OA0A 4RACA 1V35A 3ZDZB 4NBNA 3GAZA 2HF9A 2HT6A 5FHRA 2V3CC 4QBFA 2XB6A 1RS0A 3J80A 1FSZA 2O3QA 1AE1A 2YV4A 1BEZA 2D8MA 5AUOB 2BCQA 3SWWA 4RXUA 3SQOA 4RU1A 2ZBGA 4CMGA 3BMXA 5K9ZA 3BS4A 4X92A 1CTQA 2QRPA 4PC3A 3G0BA 4M1MA 3PITA 4LW8A 4L5JA 3K2QA 1D0SA 4GM1A 1QQ5A 4I29A 2BZSA 4J07A 1T1EA 1Q1EA 2C31A 4YEDA 1K9VF 3S2ZA 4XVUA 4FN4A 5KTQA 5I7OA 2YQ4A 4B7XA 1V9PA 5BSEA 5GOZA 4RY0A 3IKJA 4TS4A 4NONA 4HLUA 4XM0A 5FEMA 5B53A 5NLLA 1M8FA 3FDXA 2PZMA 2BJWA 1PQ4A 4C14A 4JC5A 1SD1A 3I6BA 1BU8A 1GTZA 1M5UA 2HO4A 1PTJC 5K0NA 1NF2A 4B17A 3CEAA 2DU8A 4OXQA 4M8SA 4CI0B 1R6TA 1EUYA 3VPXA 3FGPA 2HA4A 3G6WA 3QY0A 1A96A 2ZCJA 3TMAA 3WKDA 3BG5A 1E1QD 3N0TA 2K8AA 2PLNA 2P2SA 1TLLA 2H4FA 4GC9A 4LJ6A 3CWZA 3WG9A 1C3OB 4YGYA 1NMEA 1XAIA 5FLYA 3GMDA 2RDIA 4JL8A 1HFJA 2OFXA 4P0QB 2QE6A 4JZKA 3UGQA 4URZR 2GEDA 1H2BA 1RE1A 1XLTA 4UUOA 2KI5A 2NO5A 4YP9A 4MR7A 1T2NA 4YAUA 2VTBA 4O4HA 2CHVA 2OHVA 1XRNA 3OF3A 3H1BA 2PBFA 1WUJS 3NKVA 1OREA 2IQIA 3L05A 1PDOA 3OFJA 4MCHA 4P4LA 3U3MA 3U3OA 2BISA 3DKVA 1KSHA 3QWAA 3C1YA 3DVAA 4R1MA 2A0KA 4ZC1A 5KFHA 3JQDA 1YKFA 4W5OA 2P77A 3VH1A 4TN1A 4HMQA 1GPNA 4HRAA 5C1PA 1JIHA 1Z8FA 3C39A 5ICSA 4MHVA 3WIDA 1UFQA 4DCUA 4RK7A 3ZTYA 1XQVA 4GRAA 3AEZA 1OGIA 2X9GA 5EUBA 2K6GA 3ABSB 3D64A 4OQQA 3B36A 3QKRB 1P7DA 4OQEA 2UZ4A 1XZGA 5DNYB 2W11A 2PRYA 4MS3A 3UKOA 3TIFA 4GWLA 2J8ZA 1S9DA 3ETEA 1P2SA 3ZGNA 3JQCA 4QIHA 3OOEA 1HNNA 3RVJA 5CFOA 4A6DA 1T5IA 3WRYA 5EEGA 2C3UA 2B61A 5A9SB 4ZTUB 1NMZA 2EWMA 2JB9A 4TUSA 1A1SA 4TKMA 2FJ6A 1FTSA 3KYDB 1P2FA 3VR3D 1WBBA 1N1MA 3I4CA 1GPYA 1TCBA 1GZSA 2OCDA 4OAQA 4QAJA 5AIAA 4R0NA 2CHFA 3HHPA 1P5ZB 2P4EA 2WA1A 2FPSA 4DS3A 4EJ6A 3FDSA 4O5CA 1YV9A 2YY5A 1GTMA 1RWQA 2BZ1A 1BCRA 1I6MA 4J8PA 3U3JA 9GPBA 3EHEA 5FUWA 2P91A 4G41A 3HEMA 1F8YA 4S35A 5K0LA 1FL9A 4ZVPA 3BTOA 3ANSA 2B2XA 2G80A 1IXSB 5JYCA 1X13A 1FTQA 4XARA 5K20A 1CVIA 3DHEA 4WX2B 2PKRA 5B7PA 4YD2A 5CM9C 2HD4A 2CEAA 4E46A 4QM7A 1E66A 1U8YA 5A0VA 3EG5A 2XH8A 3QNUA 1SFRA 2WHQA 5BQOA 3A4LA 4DLVA 3N8NA 4KGZA 2ASVA 2GD0A 2RC6A 2IDMA 2EFJA 3BRCA 2OR3A 4WI1A 2X15A 4A0SA 4IPTA 4KLRA 4NJMB 2G6BA 4L27A 4LJSA 2HRRA 2JJ2A 5EYPA 5BW4A 4KHPB 3KKOA 1PL8A 3HZZA 1IHOA 1LQUA 5HIAA 1RQNA 4NH4A 2IOHA 4PSUA 3USES 3FSGA 4LVUA 1QS0B 2KHVA 2HLNA 2I1VB 1BVRA 2BGJA 3BBLA 3SGLA 2JI7A 3LOPA 1O0SA 4MUIA 2C2YA 4Q1CA 1JROA 4QPZA 2C4WA 3D7RA 2WNIA 1XWWA 4XWTA 1JIIA 1MO2A 3L6UA 5ALOA 2I87A 1WSDA 2ZWPA 2GPAA 3ETDA 2MSEB 5CFRA 1H65A 3MJFA 4RIGA 4D80A 4ESOA 3B6EA 2JFOA 2NRWA 5KYXB 3KAKA 1VYVA 4IGEA 3UCEA 2IHBA 3ZV7A 1MJHA 2ODBA 4D9NA 4EMBA 1M2OA 4EGAA 4CXMA 5HZGA 1J8YF 1LLQA 2WJHA 3QFHA 4QOJA 1ZDMA 3RYFA 5BSTA 5ICGA 2ZJ6A 4V0LA 3QX9A 5G3YA 3OQIB 3DEEA 1H2YA 5H4GA 2P5YA 3DNFA 4BCDA 2CRXA 5IG2A 2W9BA 3RCBA 1VJ5A 1IE3A 2NRXA 3HKZF 4KVFA 4DIOA 1DRVA 3CKYA 1IXYA 5JDIC 2EZZA 3K4GA 1ZH8A 5IKXA 5LMCA 3SC6A 1Q11A 3FDIA 3AUOA 3NP7A 3B9PA 5CGZA 5GIPE 1M2EA 1FFXA 1NVAA 3VPSA 1XZIA 1AUPA 1QIEA 1EXNA 1QRSA 4Z4HA 3M4YA 3H2KA 3ICVA 4JCCA 4LMAA 4FHDA 1Z0FA 3DL2A 3IAUA 3ZLUA 5JBIA 4RPIA 1ULZA 2R4QA 1VPWA 3STYA 2V7QA 1FC0A 1P1HA 3ICPA 5IVKA 2X8BA 3FZGA 4FBGA 1TW2A 2O1EA 1FNMA 1L5MA 1XDUA 2FZVA 3IBYA 2WIFA 5A7GA 2CHGA 3CUEF 5F1OA 4RTPA 1P7WA 1TYDE 1R5NA 1TU0A 2ADFA 2XF8A 3QIVA 4ZU3A 1D8AA 1YHNA 3RIYA 2EFGA 2NSLA 1VDVA 4QFMA 4DJDC 2POCA 3THYA 1NUUA 2ZRDA 3R7WA 1V43A 2DCMA 3LYLA 4L1KA 3AI3A 1IIRA 3PRYA 3QXCA 4MKHA 9LDBA 5T64A 4HVCA 2J3LA 2TECE 4H1VA 2I2CA 1YGYA 2H5IA 3OU2A 4ZOCA 5IEBA 4JKYA 1DJNA 1DWPA 1TM7E 3W8EA 3RASA 3CYMA 2NZJA 2Z8XA 1EH5A 4TUQA 1T8UA 3E82A 1E5DA 1MH9A 2ZIGA 2PZFA 3L04A 4JR2A 2OG1A 3S27A 3WRXC 2M1XA 1M0TA 1W88A 4XUEA 4EA9A 1N7GA 1OAOC 4D9FA 5A2GA 2OYCA 5KTPA 4JJFA 4PYMA 1MUUA 1YRQA 2PJRA 5EN4A 3AHFA 3FMVA 3QKIA 3K6SB 1JT2A 2W6CX 1U0FA 3LY7A 1TVCA 4I2AA 2GHIA 1B4FA 1XLWA 2WSSD 2FSPA 1JQ5A 2GYVA 2XQJA 4TKLA 2JZNA 4M0CA 1N6IA 2PCLA 4UQOA 4ZGGA 3C8MA 4C5CA 1YCFA 2JAWA 2L19A 5C52B 3PR1A 2JA1A 5DYWA 5TMDA 4KK3A 2HOQA 1E6UA 2GGSA 5KOIA 4ITVA 4UB2A 1U47A 1WCNA 1Z2PX 2JBWA 1A0OA 1ITZA 4RABA 4CCAA 2EGHA 4R64A 3MG9A 4HGOA 4B8ZA 3UB2A 2B5VA 1GQ2A 3VR4A 3THWA 4GL2A 2JGAA 3GGJA 2GNAA 1L4EA 5KMGB 1LDBA 3E0XA 3SBEA 2OPHA 2GMWA 4OYYA 3SP1A 2P9FA 3GIIA 2VAWA 3TEJA 5D87A 4ZDKA 2CNWD 2BM1A 4IR1A 2VTDA 3OZWA 1XTIA 3MTJA 1P7PA 1NW4A 4EKIA 2BTQA 1RJWA 1FU7A 1W4BA 1OAAA 3VMMA 1HL7A 1B41A 3CLRC 3IPAA 4ENWA 2ZZKA 1J49A 5EIOA 3EFEA 1IY1A 1UMCA 2GRJA 1FPQA 1M7BA 1RVV1 3BD7A 1SMKA 3OZAA 2YRFA 4MRVA 3OQOA 4NCAA 2P9CA 5H3HA 4AUKA 4ENTA 1YA6A 4UUPA 4AMGA 4OHVA 4OHWA 2XCQA 2DTEA 3WGJA 1RXCA 5KG4A 2AOTA 2H7CA 4LRYA 1TYEB 2PN1A 5GINE 3ZNQA 3AR4A 2P30A 4F3CA 2EFDB 3I37X 2HH9A 4QBIA 2YQZA 1JQAA 1IONA 5KHOC 4M86A 3BXGA 3ZU3A 1E4EB 1KZ4A 1KORA 1VHTA 3CG0A 3IALA 4OUKX 2XDYA 5LYYA 3A9WA 2O5VA 3ZPXA 1V11B 2WBLC 2H18A 2CF5A 2ZRAA 3ABQB 3VTKA 3RR2A 1I80A 4UNSA 1KDPA 1HQYE 4ZXPA 3F3MA 4ENSA 2UYGA 2ZSJA 1IXRA 2QAGB 2QM7A 1EEHA 3KQUA 1AZLA 3CP8A 4DR1B 2J33A 4CMHA 1RRMA 3QEJA 4YUXA 2XA9A 4KLNA 1FW6A 4Q47A 1NNLA 4KN8A 4P31A 3PNQA 4FZVA 5CXQA 2IQ5A 3AHEA 3HB4X 4YQEA 1KVUA 5A4JA 2NX2A 4EYOA 4EW1A 4U9IS 1JPNA 4CM1A 1XHFA 2VSXA 4HT3B 1MOZA 4FCVA 3R3WA 4GXNA 1CC1S 3GUUA 4N5HX 1BW9A 1KJWA 4JVLA 1G9SA 4M0KA 3PEYA 3C7TA 2E49A 4Q93A 1GFWA 1HRKA 2DR3A 2WT4A 3LT2A 3QBTA 3UKDA 1MB2A 3B1WA 3WK9A 2GJ9A 3ZWYA 3IP5A 2BCRA 3R6WA 4XA8A 1M1YB 2JFWA 3Q98A 6GPBA 2AI2A 1QO7A 2IZZA 3H5VA 3VU9B 3IDQA 1S2GA 1VHDA 3MQ2A 4MQFB 4PX2A 4QPPA 3UF0A 4EW3A 1KWKA 1KMMA 2IXAA 3WOHA 2DT5A 2GKGA 1C9EA 2AJDA 3N87A 2DKXA 3S2YA 1PKEA 5IW8A 4RHFA 1QGZA 2E87A 4RZIA 5F35A 5GY7A 2EH9A 4PGFA 5EMNA 3I6YA 4FZRA 1XCMA 1NUAA 4FYMA 2B3DA 3K0AB 2R1TA 2QOEA 2Z30A 3BMCA 1YS7A 2SBTA 2YV5A 4RDIA 4G3IA 3P5BA 2Q62A 1NLZA 2KWIA 2WYWA 4KBYA 1UC9A 4Q7LA 2DGDA 3E2IA 4RQUA 3TDMA 2GCOA 4FE3A 3D3EA 4NS1A 3ND8A 2IYVA 4USAA 2K89A 2UKDA 2LDBA 2GO7A 4OB8A 2YICA 5BPHA 4GE0A 1UT5A 1X1RA 3LKVA 4G63A 4F5WA 3O3MB 4D9IA 3RF9A 3BEDA 3O1IC 3O84A 4RA9A 3X1DA 2IDKA 5KVCA 2E37A 3OI7A 4WOKA 3IODA 2Z5VA 1RQRA 3D0QA 3LUJA 5PGMA 3UJPA 2CVHA 5JASA 2FZ5A 3ULKA 5AW5A 4IDOA 1CDDA 3L3FX 1U8UA 2XSZA 4DL7A 2HSDA 3HA3A 4KCGA 1BXRA 1WA5A 4P4SB 1MX1A 3ZWXA 4GI7A 4F46A 1CU1A 1OTHA 1WKCA 2EFCB 2NVBA 1MB4A 3KVRA 1XVUA 3QMVA 2G36A 4PQEA 4R2XA 1CY0A 1G5FA 3AP2A 2M32A 4BQPA 3DKRA 3ZVNA 1GADO 2OK7A 3VR6D 3AR8A 4AUNA 2LWIA 3RBVA 3G5LA 4MK4A 1PJ4A 1SY7A 4O4HB 3ZHYA 4X6UA 3SLKA 2WR8A 4R2JA 1P0IA 5EJFA 3VVCA 2WP8J 4P9NA 5JY1A 2QSZA 5J2UA 5TRTA 1XPOA 2EKPA 3V34A 4BP8A 4L08A 3W3ZB 1JNYA 2JCGA 2MU1A 4LY3A 3COJA 1UK6A 3OZFA 4J49A 3KHTA 4Y9RA 2FYTA 1FUKA 4YDSA 4XUDA 4A0QA 2GZSA 2FR0A 3GH1A 2DUMA 1M0WA 3ICOA 2LCQA 5JT1A 1Z17A 4QZIA 2BFCB 2JAPA 3E0QA 3GOQA 2PUBA 3LUFA 2RH9B 1VL8A 3QHPA 2I2BA 5KT5A 2YFYA 2QXUA 3IUBA 4G5RA 1PG5A 1QX4A 1TF2A 1ZQBA 2BE9A 2JIDA 3LHSA 4IMRA 4D4JA 4DIEA 3CVXA 2AV6A 3D5QA 4LZDA 2C2WA 3NVDA 4Y7CA 1F38A 1REQB 4ZGWA 3O94A 5DQIA 4EW6A 1HUOA 1CZRA 5D3KA 5EZSA 2Z98A 4ZYTA 4F3KA 4K28A 3WKBA 5LBIA 3HPQA 4DCOA 2PEYA 2IKSA 5F1PA 5IXYA 5JAIA 4DJFC 3DAFA 4OK5A 1D3AA 3V80A 4DY4A 1V45E 3B13B 2P2CA 2PVSA 5KSPA 1YZ7A 2DEUA 2F17A 1NI4B 3IQFA 5EJGA 1YO6A 2WFMA 1YRWA 4CRXA 2QL5A 3TQOA 4Z6KA 4LDZA 3H7IA 2R44A 4M88A 5J2FA 1N5MA 3PLNA 3JAWA 4F0JA 5AM0A 3RRGA 1HDXA 2CJYA 3JARB 2XCOA 4IO0A 3V8RA 1AO0A 2L2QA 2V65A 3IEIA 3QMPA 3T9EA 3WFJA 2CFSA 2ZZMA 4P98A 4HD8A 3ZHBA 4UDOA 5KDOA 2GEKA 3OC0A 3KT6A 5J0TA 1WABA 4MI3A 2Q8NA 1R0CA 3F4LA 2X5KO 4PGQA 1F2TA 4X6XA 1GUAA 2AGQA 1NQWA 1RNLA 4J9MA 4KSBA 2B7BA 4BO6A 1YQUA 4URFA 4B44A 4V0KA 1QHNA 3I9LA 4KB5A 1ODJA 2V7BA 1UCFA 4RJTA 1I7SB 2BF7A 2Y93A 4TVBA 4F5YA 2G82A 3D4OA 1L7XA 1RAGA 1W46A 2VHEA 4P22A 5FTKA 3TL3A 4JI5B 1JXOA 4IWXA 1H2RS 3HA5A 4LEIA 4KO2S 3VYWA 4R5HA 1XNGA 2H2IA 3D2CA 4IIEA 2ZYDA 3GG9A 1STOA 2JRZA 2A0FA 1KBUA 1R3UA 3INRA 3SN6A 3UATA 1ZYUA 2Z56A 1ADBA 2QROA 3WJ2A 2LZ0A 2UU9B 1DC7A 5BP7A 5E95A 5JJCA 1NK0A 1KDHA 1IG3A 2BE7A 3CLTD 1XZMA 5CB4B 3UH0A 5KYXA 2ES4A 2EHJA 1JDNA 1EP1B 3LYHA 5EIXA 4UDNA 1IYZA 3AM1A 5A4FS 4W9RA 1WM1A 5ICEA 2CC2A 3P2JA 4DTCA 1JFFA 1UXOA 1XCBA 3AY0A 1SKWA 2GYWA 2H54A 1C0PA 5H7XA 5KG0A 2XT0A 1X77A 3I32A 3E18A 1G66A 3L4BC 3KSAC 1PJ8A 5TB5A 1H85A 1P1JA 2C1ZA 2APJA 2GWHA 2X41A 2C54A 3CZ5A 4PGAA 4EHLA 5HKBA 1DEOA 1NVDA 1TT5A 1VFPA 2C7VA 1NZJA 2HQRA 3A9TA 3IIMA 1XELA 1YWGO 4C43A 3OHBA 4M2YA 5JD3A 4HDNA 5TJHA 9LDTA 5JQGF 2B5WA 4NXZA 4PY2A 2ZUEA 3LUBA 5D5QA 3ZEIA 4YCSA 1ZHOA 1P4HA 3ZXXA 4URWR 3TLCA 2I29A 1G8KA 4IJ6A 4JLOA 4JNKA 4TYNA 3AF6A 1ZQRA 1EWTA 3EMBA 4OHXA 4AMVA 2QR2A 3T0IA 2WM9B 3SHTA 4DSNA 4LGVA 1AKVA 1X1BA 4F5DA 3P8ZA 4TZ0A 4GBED 3FNIA 4DQ0A 2FVXA 3AVXA 1V47A 2YMMA 1PV2A 9ICIA 4EF4A 1ZVQA 5ISMA 1NK9A 4E5UA 3D4LA 4OGGA 1P1BA 4MVJM 2PPVA 4WXYB 4F4KA 3AUAA 4X7MA 3RAFC 1FNCA 2YJZA 4I36A 3L92A 4R1UA 3VBCA 2GK3A 3K8ZA 1T0PA 1CY7A 1UBMS 2GTHA 2QQGA 2VRCA 3NAQA 3M5WA 4ZZ2A 2VSQA 2J1LA 4XDYA 1QHHA 3ZWBA 4KGXA 3SMVA 5L6MB 2BSQA 4I9HA 4J1QA 5KAPA 1JQKA 2OKGA 4NG5A 3C14C 5KREA 1Y8ZA 3ID6C 4DEXA 1E64A 1PWEA 3M6AA 1NNEA 2M0NA 2C7QA 3D7NA 1QBKC 3DOOA 2AFHB 2XVYA 5DCWA 1D9XA 1G8PA 2IHJA 5KNCH 3PWZA 3MMXA 4P3KA 2Y0PA 4YRJA 3QU4A 3RJHA 4ZAFA 1T10A 1USIA 1YI0A 2HMSA 1JHZA 2DKFA 2NO9A 2QV0A 2G71A 3B9RA 3ESRA 3VZRA 4IIGA 4KQHA 4MV8A 4HC4A 1EE1A 1SM4A 2WHPA 2Y0CA 3E9YA 1NYLA 3W7AA 4DDKA 4HGQA 4BPBA 2M6SA 2V7EA 4YB8A 1DKRA 2YHIA 4DLWA 3CN9A 4J1TC 2RIRA 5BNTA 1H0SA 2CJWA 3PUZA 1X3SA 3U4HA 4Y8VA 5CMLA 5EZYA 4O02B 3HVHA 3OQJA 3OEHD 4ZT6A 4L5BA 1X2BA 3QBVA 4KXYA 3DE2X 2IOYA 1JMVA 1LX7A 1YGPA 2R1VA 3D31A 2X1HA 3H19A 1RRGA 2BTQB 1FRQA 2RHCA 3B1ZA 3NIBA 3TK1A 3UUGA 2I6UA 4PINA 5IF9A 2CFCA 4Q9DA 3ET4A 3HABA 4NI5A 3MLBA 2ZJ2A 3ERCA 3VKWA 1NBOA 1XK7A 4IFEA 4QG3A 2DC1A 4ECAA 3AESA 4BPRA 4FFMA 2GZ3A 3ZWDA 2PS0A 2E4VA 4EYSA 4Q01A 4RPZA 3UT6A 5C4MA 2AJQA 1C14A 2JDIA 4HBGA 4KIFA 2QPOA 2Y0DA 3H3XA 2VKQA 3MWDB 1UQVA 5U1PA 4EDFA 5AJZA 4G1EB 1N0WA 3D3JA 3K96A 3AQFA 3O74A 3EVEA 2UZ0A 3L49A 3N3BC 4PZPA 4QHTA 3PV0A 5AOVA 3FLBA 5DHQA 1PNVA 4JIMA 2XNJA 3TANA 2IEBA 1SULA 3BJRA 1IMOA 1VIMA 1XDBA 1QK4A 5FWYA 3JQ8A 5HF5A 1CQXA 3IOYA 3VPHA 4U5QA 1ORVA 1XB2A 2EHDA 1PGJA 4M1WA 4WZAE 3EPRA 3FBWA 1GLGA 1XVAA 4G65A 4EG4A 2KE5A 2WF6A 3DFKA 1I13A 5COQA 1TM2A 3L8FA 2K7FA 4G89A 1LDGA 1U9LA 2JMGA 3IP3A 3JY6A 4YV7A 3Q11A 5JS7A 2VRBA 4F2WA 1N36B 3A05A 5ITZA 2JEOA 1DO8A 4PAQA 2Q4BA 3C87A 4D4LA 1O3YA 1E1CA 3HWRA 1KY2A 5DOVA 5HOQA 1YIAA 1OFGA 3BE8A 1NY6A 5JY6A 2HDHA 1JQLB 3H2IA 4D9BA 3NT5A 4N5LA 3OHMA 1EXWA 3H6KA 4A6PA 2A30A 1FF9A 1QG6A 2R7AA 3L82B 4ZOLA 2R79A 4WLEA 5I7WA 1CJKC 4QGHA 3FCYA 3N2GA 2KP7A 2PRSA 4RD6A 4RDHA 1GYRA 3ILYA 4U6NA 1RXUA 4WHMA 1Y1RA 3DM5A 4AJ4A 3GHYA 3FSGD 2ASEA 3H0KA 1AK2A 2ISPA 3EQ6A 2F64A 2R6CA 1Y1QA 4MVJF 4TYMA 1QIDA 3AF5A 3TI0A 3EDCA 3ZIDA 4AF6A 1NK4A 2R1TB 1GNRA 4FEEA 4JL6A 2A9OA 2QX4A 4S1OA 1ZQOA 3A10A 2OD7A 3DZFA 3A25A 4DTIA 4PPXA 4X61A 1XA3A 4ISCA 1T9AA 3OZXA 2VHXA 3R0VA 1MJ5A 3GYGA 1YOVA 3C3AA 2WUDA 4PHEA 1Y5LA 4XEUA 3U48A 1LBHA 4A1OA 4F8JA 3C21A 3G2PA 2EFYA 4LNUB 5DTQA 4U7FA 4HEHA 5F9LA 4P0PA 1W47A 2OMKA 4QOIA 3RHSA 4ACAA 1ILWA 4DSJA 3Q6IA 1R9NA 1GD1O 4REOA 2XD4A 3A31A 4RS3A 1D9DA 2EJTA 5B3AA 4XUSA 1WY7A 3O1LA 5J0RA 4IRKA 2WPDD 3RHZA 4LXQA 5EXSA 5JI3E 3VAZA 1JH8A 4QGBA 4YMTA 3WGMA 4L4XA 4TWZA 2Y9PB 4J2TA 4LF9B 3NRCA 2HQBA 2RONA 4N6GA 2BGGA 3TFWA 3EPJA 2BCGY 2GUWA 3G2KA 3N8HA 5DBEX 4IIJA 3UGKA 3GJ3A 5IT4A 4NX2A 2VF5X 2EBUA 2ZBPA 3AQIA 2C8KA 3PQ8A 3Q12A 1ZRHA 1C80A 1GNVA 2DJ5A 3CUYA 5B12A 4C0XA 5JE8A 1OH7A 2NYUA 2XXJA 4C7VA 2GOYA 4IEFB 3V55A 3DBHA 4MVJA 3TB4A 3UAZA 5I7UA 4GPEA 4CGZA 3RVMA 4BZZA 5HFNA 3P27A 4Q66C 3PNLA 2BH9A 4RZHA 2YJ5A 5J2UF 3ZBUA 1JEYB 1CR6A 4L9AA 4BFZA 1QV7A 5DKFA 1X7GA 1FSGA 2EDCA 3MT0A 5BUSA 1NYRA 1UOEA 3KD3A 1KJ9A 2CY0A 1JLLB 3MJTA 3CY6A 4CRWB 3G82C 5B36A 3IPCA 1VE3A 3O4VA 1OX6A 3HB5X 3QSGA 1USKA 3T3EA 3VR5A 2R84A 3A0RB 1F4PA 4PPFA 4DM4A 1E0JA 4EJSA 2BFCA 1SCAA 3A4NA 1XN4A 2HDOA 2OG2A 4QASA 4X7RA 5AQEA 1T2FA 2JCXA 4R8VA 1AMOA 4JOCA 4RTNA 4I9FA 4OYRA 1YQEA 1HG1A 1EM8A 3EB9A 3EGCA 3EZGA 3WE7A 5JTUA 1N2CB 5F1KA 2Z5LA 2JCSA 4MA0A 5CM2Z 3RTGA 1KSPA 3OQ1A 5AKGA 3K1RB 2G83A 4DY6A 2J32A 4J4TA 3T4EA 4OGKA 3SZLA 2QL9A 1L5YA 3F6RA 5IJ0B 4LQ4A 3R7AA 3UM9A 1BOFA 3NVZA 4QYXA 4CCHA 3T1QA 3QY9A 4W5QA 3G1TA 3QKRA 4RLQA 3EXG2 3UB3A 4KNWA 5JAZA 4WTOA 2CZGA 1C3JA 3C48A 1MN6A 1VG0B 3F71A 4OA5A 2VF8A 1NUQA 1L6RA 1THTA 5B7GA 1XRJA 3KJZA 4PHGA 3G5TA 1NNSA 3L7KA 4WAUA 1QF7A 1ZONA 1HL3A 1KJZA 1T91A 2D2XA 4IHJF 4EBFA 1C4KA 3UAGA 3OD1A 1S89A 3WL5A 2YUTA 3ZV3A 1B3BA 3ZHVA 1JLMA 5J2GA 2WB2A 1RZ3A 1A95A 1F3OA 3BS7A 1UK7A 1ZQHA 1OI4A 1E9FA 4MWCA 4ZOLF 4C29A 4MS4B 2EQAA 5T8KC 2QLBA 3RUIA 3EWAA 2JH1A 3F3KA 3G8AA 4MVJE 4OJNA 2YWCA 1HV8A 1NK7A 1KO8A 3I64A 2H3FA 4GOMD 1PVRA 2RHJA 1XZHA 3BBPA 3ISVA 1JG1A 2FJPA 3O0TA 4NP6A 5K4HA 1RPZA 3L1VA 4NFYA 3WFZA 1EK2A 3O4FA 5I45A 2ZZNA 3WYNA 1NTRA 4KE8A 5B6JA 4WACA 1VHQA 3EISA 4EK9A 4NHEA 5CPBA 1DC3A 3W2EA 4DV3B 1W0KA 2YWDA 3AFOA 2IGBA 1IB6A 1ZD1A 3MK31 3X1JA 3H8VA 1T9DA 4LY9A 3IMFA 4I6JA 1ST2A 4K26A 5CCDA 1UJCA 2YHBA 3WYEA 4EHKA 3CVVA 4HWSA 1EJ6A 4V0QA 3IT2A 3NGMA 3BS5A 2GLUA 4B9UA 2WF7A 1A7JA 1OKKD 4GKAA 4CMJA 5CB4A 5IIJA 1FFEA 1FFHA 3UMJA 3BDAA 4HKTA 2PLAA 3PX4A 4AYBC 1H1LA 3OBBA 1BYUA 1Z62A 2QM8A 3OTWA 2B4AA 4UCQA 1G4AE 2GA9A 4HG2A 5CB8A 3ZU2A 3FMIA 1RTKA 3FPFA 5F5NA 5K7SA 4IHJA 4N41A 5F64A 4LJ4A 5IIKA 1QR2A 1X9SA 5BV0A 4UW9A 4Z4IA 3C5WP 3G9TA 4YBZA 2BFDA 3E5MA 1HYGA 1Y6QA 1U8EA 2G7ZA 4CR6A 3T1NA 3DZ8A 4Y2HA 1ZRNA 3FC4A 1HDGO 2YL2A 5D8DA 3RFCA 3ENNA 4ENUA 5DJ5A 4O4JA 4ZT5A 4NICA 4IDDA 2YWEA 2GPWA 2JJYA 4RPJA 1XZJA 3RVDA 4MRPA 1IPEA 4EECA 2VNSA 1AKEA 1RYNA 4KLOA 3AHCA 4KAFA 4IDBA 2CXOA 3BORA 3C6XA 4HMOA 4AUMA 3VOSA 4EHAA 1S0NA 3R9XA 1ICIA 3D8UA 4GXQA 3HJNA 1F4LA 1FMJA 4KR9A 4Z5XA 3UK2A 3U09A 2XBLA 4MW7A 5CXUA 2RFLA 3STVA 4TQRA 1SZCA 1XEXA 5DHTA 5IDYA 2OCGA 1IJEA 2X8JA 1SXIA 5AM3A 4PS0A 1KE2A 4UU0A 4F5PA 4ECUA 4H4DA 1RMYA 2H5EA 2ZCUA 4RAOA 2R48A 1Y3IA 4IILA 4KR7A 3JD4A 3K0SA 4DANA 3BQMB 4K46A 4LYGA 1NM5C 1V1JA 2IIPA 3EXFB 3N9IA 4MDYA 4O63O 4BX3A 5C7LO 1HGXA 2PZBA 4PLGA 1EZ1A 1OR8A 4EQ6A 3NEAA 1Z68A 5LQJA 4X8LA 2ZTCA 4R9SA 4U8GA 5KPDA 4QUHA 3C6MA 5IM4A 3TNDA 2FOIA 2O8DB 2FFBA 5C4GB 1MU0A 5FUBA 4FDLA 2GVDC 5JW6A 1RRCA 2WYOA 1PJRA 3PTAA 3SXUB 1HT1E 5H80A 3C1OA 1LLDA 4QWAA 1IN8A 4PZUA 4F9GA 1O94D 4C8OA 5ALDA 2JC3A 2WJPA 1WTCA 4LHEA 4F2DA 2O3RA 2R60A 3R24A 1T2DA 2I5PO 1C1XB 4FE7A 1WHSB 4DNFA 4U9HS 2JV3A 4G8JA 4MS1B 4K3VA 5CEJA 1PFWA 1T0JB 4M46A 2Z5GA 4YR3A 3INTA 1QB8A 2G1KA 1AHHA 5GV7A 3I09A 4F56A 1W25A 2E8MA 4P86A 3D43A 3GT0A 4JI1B 2I4IA 2J0UA 1SG0A 2GETA 2CDBA 3H4TA 4PLWA 5L6LB 2EAUA 1I4TD 2PFKA 2QNIA 3AEVA 3H0LB 1NR7A 2R1VB 2MIIA 3LWBA 3U9LA 4FOLA 4Q9LA 1BGXT 4MS3B 3N07A 1C1DB 4OGFA 4Y9SA 4FNGA 1UP6A 4LG1A 4M99A 2FEWB 2ZQ5A 2HZBA 1NQTA 5ALQA 4UZEA 4Z8XA 2R9VA 5IP5A 1NVFA 4MRSA 3U9SA 3ZE8A 5G3ZA 2ZRJA 4DIUA 1Q1AA 1Z4PX 4GPIB 4UUMA 4BNLA 1I24A 1U2GA 1TF5A 5DSTA 3PW4A 3DT6A 1ECWA 1DIAA 2W5UA 1FDTA 2CMGA 1P1FA 1BGVA 2WAAA 2WKRA 3PE3A 4LMPA 1KHTA 2VP4A 1YVUA 4ZMSA 5KSZA 4DL2A 1EE2A 4F3OA 2AX4A 4B5LA 3J7AC 2KZMA 3W3AH 5ALMA 1AJEA 3UMBA 5C18A 1ID1A 1UBCA 1KI3A 1J2JA 2EKQA 2EKLA 3WK4A 2HUNA 1HYBA 3TF5A 2P9JA 2CL6X 2XNCA 3D8BA 4JLNA 4ZALA 4CU5A 2KMLA 4RTMA 4NSNA 2P9YA 4YRBA 2VAVA 3NONA 1PV1A 1Q17A 1K06A 2P9QA 2JFNA 4AVYA 2OWDA 1NXTA 1OIWA 3D2LA 4YJFA 3E1GA 1OXKB 4KWEA 4O4LB 4B0PA 3QX8A 5JQWA 5JEDA 4LOLA 3W4JA 2IYYA 1R16A 3DE3X 7ICHA 4N39A 4OUDB 1DELA 3QEMB 4DIFA 2ZIXB 3DZGA 1GZ6A 3NHYA 1XAHA 1BX3A 2DYKA 1DAGA 2VUHB 3BB3A 3H1EA 1YA4A 2HFJA 4FOPA 3ZV6A 3RABA 1ZXBA 5ALKA 4P81A 1CUVA 1JW9B 1Z5WA 4L9SA 3TZLA 3ZE0B 3GZ4A 3SNKA 2KHZA 4D43A 4RGBA 3AU2A 2PH7A 4YMWA 3ZBPA 5JHHB 5DI3B 1PWHA 2R7LA 5DT9A 1RRKA 3E53A 3VZCA 2ZRPA 4P8RA 2FP4B 4QQNA 5F5LA 4DSZA 4U4AA 1PYGA 5BN4A 1IRXA 3H86A 1GRCA 4IQUA 4MFCA 1W2WB 4H2DA 6AT1A 2OXIA 1HETA 3CNLA 3HC7A 3OAAD 4MR9B 2REOA 1OKKA 3CF4A 2VJMB 4CMAA 4E15A 2HQSA 2FF7A 3BQNB 1XS9D 4XDHA 4FO6A 3D6AA 1QHGA 3FG9A 3LECA 2ASLA 1BW9B 2HBZA 3OX4A 4DL3A 2PFQA 1CJTC 1DFIA 1G1MA 2E3JA 5TF0A 3SHVA 3T9BA 2PX2A 3I5MA 3BFXA 1A9YA 1X8JA 1EZ4A 3OJWA 1YZKA 3K9CA 5FI1B 2ZG6A 1P9RA 3OQIA 1CE8B 1EB8A 2IXBA 2O2SA 1L0BA 1R0YA 2GAAA 4L4ZA 2GEFA 4DL9A 1GM5A 3ABRB 3B85A 1SXDA 4YO8A 3P9ZA 2GHRA 4N9WA 3O82A 4C04A 1RE0A 3SG0A 3UQZA 5DWQA 5ADUS 2B2NA 1Y7HA 2QHXA 2W71A 4KTQA 2ZRIA 4YJ3A 3SCZA 4C0WA 1ZQLA 4KUEA 1ZK1A 1U1GA 2GZAA 3COSA 3EGOA 5KQMA 3MB5A 1U2EA 3UUWA 4IQFA 4PXAA 1SB3C 1L5KA 5KFIA 2IYQA 1ISMA 3HZOA 5HHIA 3KXIA 1KR2A 2IUUA 1NDUA 2ADMA 4OH1A 1KEVA 4UKDA 3TECE 1E79D 1CIVA 3NBKA 5D1HA 2BFAA 2YNMD 1QV6A 4D9MA 5DU2A 1KK2A 3HYTA 4TYYA 1Q83A 1UDCA 2XNHA 2OSVA 4WY8A 1JA1A 4OD0A 5KFDA 4PPYA 3SIPA 1VIVA 4DA6A 1E59A 2QG6A 3BMNA 2I1WA 2N0SA 2CKDA 3QSYA 4E2ZA 4DWWA 1OIXA 5CK4A 2NU9B 3C0KA 3WGNA 5BV1A 2OHIA 4NKRA 1O0BA 1JIKA 1KH3A 4AJIA 1JXAA 4E30A 3UHOA 3BIWA 1LPSA 2ZRQA 3D4PA 4Q7EA 2H92A 2VBCA 3A6GA 4YAGA 4GBJA 1ZC3A 1ZETA 4LQLA 3S6JA 3K1JA 2JLZA 3EASA 4HXYA 1OXXK 2G08A 4MR8A 1FYFA 3CRW1 1JLLA 5HR7A 4F8RA 1O6FA 1V1MB 3DZKA 5C31A 3TS1A 3TSCA 3HM9A 3KWLA 3I62A 9ICHA 4RELA 3D1JA 1I7PA 5BW5A 1ETUA 2SKCA 1HFKA 4KXXA 3BXZA 3EGVA 1OI7A 3BJMA 2R8BA 4ZOAA 4AX4A 1B23P 2VANA 3U4DA 1N3BA 2P6NA 3O4RA 2V4MA 2XE4A 4MEYA 3HRKA 4U0KA 1UXKA 1TUBB 2G9UA 4ER5A 5IC6A 5TT0A 2P65A 1SOUA 2BI7A 3TIVA 2L0XA 2NADA 2WJVA 3EJWA 3QVLA 3D7SA 5KMGA 4J4BA 2I4LA 4G0YA 3W1WA 1U7UA 2CNWA 2C5FA 3N5CA 4P1ZA 4A2WA 1NIJA 3JPTA 1Z7WA 3L7IA 4DFJA 3OBIA 5FADA 1SV4A 1T5LA 5AJVB 1SQ6A 1J9ZA 1N8TA 4LGMA 1CJBA 4RPLA 4BP9A 4ND2A 3PC7A 2ZR7A 1T3NA 1D7AA 5I7HA 5FYDA 1A2QA 1QK5A 1BC5A 4HP8A 5TS2A 3I04A 5KFPA 1RXEA 4RH0A 1OHHD 5BN5B 4GYYA 4UM9D 4Q4DA 3TLMA 3I8OA 4D6XA 4LYEA 1UR5A 3GJRA 4FQ8A 2ODPA 2GNOA 4MEXA 1M9NA 4DOBA 1Z19A 1ZQIA 5KYYA 2NU8B 2IIBA 2YIDA 3BRWA 3TOCA 4UCFA 4A0GA 3QPDA 4H27A 4B75A 3RS8A 2JEJA 5C80A 4TZTA 1PK1B 1X7HA 1Z6XA 2AW5A 2YHUA 2FPMA 2NVOA 3FROA 4M9RA 3S2EA 4D9KA 2PXHA 3OEWA 4MS4A 2IYAA 2O2XA 4K40A 3BHJA 2HGZA 1IVSA 4EEYA 4MJXA 2X8AA 4R16A 1ONBA 3HVIA 3V7NA 5U9CA 2UXCB 1CBUA 1Q0PA 3FVRA 4B3IA 3KTFA 1ZCAA 1BH2A 2ZYAA 5SY9A 3F5EA 5DGTA 3HRIA 3DPUA 1BU5A 2BF4A 2WKWA 3F6SA 5KFRA 3IQZA 3LC0A 2JD1A 4LNAA 1B42A 2G04A 2H63A 4PAMA 4Z2YA 3FPKA 3NHUA 2I91A 1IXZA 2G9QA 2R5FA 3AL2A 4KVAA 2C2EA 4UQPA 1IEXA 4J3NA 3HZRA 2XYVA 3C3EA 3N0XA 3R3UA 1QYVA 4J0QA 1VMEA 1U9ZA 2OLEA 2PWYA 2PD3A 2QMZA 3CV3A 2VDWB 3HWSA 4FLEA 4G36A 4YUYA 1EFKA 4IOJA 3TLZA 4C9BA 5KNLA 1K5GA 4BL5A 3G6VA 5ELXA 2GF0A 3CUTA 2MINB 1VL0A 1LK5A 5B3JC 2V59A 2H0QA 1D2AA 3KR1A 3MINA 2XI9A 3UPQA 4M9SA 4I5GA 3SM3A 2EAOA 3R2JA 3DTYA 3DZBA 2OHJA 5DLEA 2WQ6A 3NDBB 4JV2A 3DVLA 1JHPA 2P90A 3IVAA 3WQSB 4K4IA 2HR1A 4GE3A 1AG9A 1V8OA 2YHSA 3NHFA 1MPXA 3W06A 1SA0B 8LDHA 5LQUA 4Q1EA 1PJTA 4ZDWA 2I3DA 4EBDA 1MEJA 2I6GA 4ANFA 1ZGBA 5ALXA 1VIDA 3W4IA 4COOA 4Q16A 3V4RA 2Q46A 4LAFA 5JMTA 1JFFB 5F3RA 1VE7A 1FUEA 1PT5A 4KOAA 1GKIA 1PR5A 4H1UA 4KG7A 1FQWA 3K9LA 4U2CA 8ADHA 3BSWA 4QUEA 3FFBA 2VDPB 2G09A 3VQTA 4NYMR 3KFLA 2A3RA 3NI2A 4PLPA 4U6QA 5I47A 2A5YB 4IRMA 4JENA 3HJAA 2I66A 1MMFB 1TT5B 4FBTA 2UVDA 2HJGA 2I4OA 3DMRA 1Z33A 2BGNA 4F5NA 3VH2A 4CUKA 4CIWA 2VWPA 2PFNA 2DWPA 2J4DA 2UUCB 2KVCA 1E2DA 3D4BA 1IZ7A 4R51A 2OO7A 1Y3BE 3HGQA 5M29A 2F9FA 3NHLA 4FFDA 3RF7A 3RFUA 2O8EA 5JVDF 1X9IA 2RIPA 1CUWA 4LTMA 1GGVA 7REQA 1QB7A 1S2DA 2O8DA 2CVOA 3CLSD 5GJVC 1JYFA 4F1WA 3A7EA 3EEYA 4DUGD 1XTTA 1N32B 4MFFA 1KL9A 3B3FA 2AFHE 3ZCSA 3CH4B 2XTAA 3PI7A 1FJGB 1O08A 1Y5MA 2XVZA 1E7SA 1XDWA 4PHFA 4CT4B 4FOTA 2VZ9A 4H1TA 4I4TB 3REQB 4CM9A 1XJWA 1CPYA 1IHDA 1PK3A 2PKWA 3BWVA 3F6EX 3LY9A 1ZNQO 1UPTA 4K9QA 4KW7A 5AVSA 4FLMA 3DCNA 1X7WA 4YP1A 3RVBA 2R7NA 3H2ZA 4IHKA 3AEKB 3DYIA 3LO8A 3VVMA 1R18A 4LV6A 1F0NA 5KFZA 1KTIA 1LV7A 1KO5A 2H65A 4IDGA 1Y7PA 5C0YA 3L7BA 1N6HA 3U40A 1V39A 3PSTA 1KFCB 3QUSA 2J0UB 1R9JA 4H3HB 1WB9A 1RPAA 4NNJA 1Z39A 4WD3A 3HXKA 1O5OA 5FTJA 3ORQA 4YASA 5IXSA 4MW1A 3CONA 2GZMA 1N5KA 1VA4A 3IKLA 3EHDA 3TR5A 2D1SA 1KW4A 2IA5A 4AJEA 1DRKA 1WDTA 1SQGA 2FEPA 3BRSA 3V7LA 3B52X 3UJAA 3BZCA 2IDJA 4G0MA 1Z63A 4NFLA 3O8RA 1LRKA 1Y4UA 3DV2A 3FSJX 3M9WA 2BV3A 4FQ7A 4U02A 4C0LA 2FEOA 3ZGLA 1J8QA 2WYVA 4YJKA 4AT1A 3JPWA 1SQFA 1CY4A 3NUZA 4BN5A 4ZYZA 5JZMA 1VLHA 2ERXA 4JI2B 1J2YA 1OZAA 1AZWA 4JJGA 2TRSB 3WVNA 3WAKA 3ZWWA 1IATA 2PX8A 3C8UA 4QWDA 2V96A 2JHCA 1H0KA 2DAPA 4DLAA 3KYCB 1NN1A 1DFHA 1SQ0A 2REXB 3M1AA 4I66A 1GG9A 2Z6UA 5FJJA 3W6UA 1LS6A 1WWKA 3QOXA 1DIHA 1EINA 2XUJA 3R0JA 2N46A 3F5FA 1RACA 3WWDA 2YW9A 4ECSA 4NBKA 4YJFB 3UOGA 1CV2A 5LKAA 4DG5A 1JFSA 2V0NA 2JCYA 1NC3A 4CGYA 4GLOA 3TD6A 3IAEA 1RJ9B 2EZ8A 4MPJA 4C30A 4F4IA 5A3SA 2VUTA 4LUCA 4BNYA 4OJ6A 1WP4A 3WLQA 1OE0A 1ZM7A 4R84A 2OEHA 1A8SA 4NYMQ 4N40A 4XW2A 1YBFA 5EIWA 5EXPA 3ZE9A 4F4CA 1NWCA 4KREA 1ZINA 4NAUA 5C34B 4M04A 2RHBA 3PQ7A 4JVOA 4XR9A 1Y9JA 3PQFA 5JNRA 5ER9A 2RGYA 4CDMA 4W8GA 1JG7A 4PQYA 2E8OA 1TM3E 1GU0A 2E6KA 2IYXA 1R0SA 3E9RA 3WNBA 2EARA 1V16A 3K09C 4BFSA 2FP4A 1E2IA 2I67A 3OIFA 4YPFA 1JHUA 4GNKA 1VRVA 1P81A 3TW8B 4FNAA 2N1RA 2X3UA 2ZE7A 3GNLA 4JXKA 4FFOA 4MR9A 4NZMA 5DHUA 4C21A 3SC2A 1MZPA 4KXQA 3JQAD 1XZBA 3KLMX 4FYJA 5CUQA 1CDOA 3OT1B 1GVHA 1IEQA 2NUTA 4A82A 4Q0MA 1G20E 1CJCA 2PL9A 1KI9A 2J9RA 3AHGA 1OXMA 2ZYIA 1VJDA 1PR2A 3OPVA 4EZIA 5KNBD 2ORIA 2WU1A 3G9QA 5DQHA 3KR2A 4TUYF 3WHPA 3X2SA 5J43A 1ZWLA 1G5IA 4JLMA 1CXZA 2VP5A 2E4AA 1K0UA 1V4NA 4L7QA 4N0DA 3N2GB 3OSUA 1RMQA 3SDBA 1XN1A 1E94E 1PJBA 3FVVA 3SEQA 2FMSA 1XC7A 3VMFA 2QKQA 4ELTA 4RLFA 3T95A 3DTVB 3H40A 2QTFA 2XA1A 3KB2A 3OPXA 2JGKA 2P5TB 2R8XA 4OL9A 2P4HX 1D2HA 1JZQA 5GM1A 1W0JD 3SY8A 5I51A 1BH6A 8ICLA 3IUYA 1W30A 1KZ7B 4MROA 1ZUD1 4WESA 4RVCA 1P75A 3FMPB 4OOFA 2OB1A 4TRRA 5GONF 1JBKA 1KYYA 4I1PA 4HYQA 2LR0A 4BO9A 4OB6A 1TKRA 1ESNA 1X80A 1E2KA 3EXIB 4NQZA 4ES6A 3GDOA 3H04A 4CF3A 1T8WA 2F3NA 1JL3A 4JP2A 1NA5A 1BPYA 3JQBC 3M3DA 1HT0A 4D57A 2PU5A 1R74A 1SKAA 3NUQA 3KWFA 1TK8A 2RJ3A 4DHEA 4HGZA 4PVDA 1SBTA 3CSSA 3LT1A 3Q6MA 5KJCA 4YRGA 2Y66A 2V4RA 2CVFA 3DW3X 4X1IB 1LX6A 5J5VA 3UC5A 3GWZA 3LFUA 4B73A 4EFMA 2VNAA 3LCJA 3T06B 1QAQA 3JZAA 2WAOA 4QWMA 4PICA 3U39A 5DTRA 1PZNA 2FPKA 1WUKS 3LKZA 4RMIA 5FTMA 1YZ6A 3I6QA 2DQKA 2V6GA 5AKYA 4N7MA 2A9VA 2IP2A 3GLSA 4RVGA 2PSFA 3E2PA 3PWSA 1PR1A 4UHBA 1QE0A 4KN5A 3TLKA 2A57A 3EW7A 3FCXA 3NHMA 2W4QA 4B45A 1B8UA 1XQ9A 5JVDB 2G7MC 1JKIA 5TDHA 4G5XA 1XQXA 1DAMA 3ZHXA 1WWVA 1MQ8B 1X3LA 3OPQA 2HDNB 5KFOA 2OOKA 4RHEA 4YK7A 3ZK7A 4BFCA 4F96A 2ZM5A 4M8IA 1PJSA 2CLSA 1OLUA 1YDGA 5THXA 4IDPA 3GOHA 3NATA 4WNCA 2HBJA 4AKTA 3K92A 3LYSA 4US9A 1ZL2A 4H0CA 4ED3A 1USWA 4L8GA 1H6DA 2RGRA 1JVSA 4JDPA 1SHLA 2C4VA 4G26A 3SBDA 3OE4A 3GDFA 1U9IA 5EZYB 2Q21A 5J5AA 1VCNA 5CDSA 4NF2A 3AMVA 1EWRA 4YD1A 4TSFA 4YHHB 1YC2A 2DFPA 1M6EX 4M9CA 3KEFA 4Q12A 3RRXA 1BKSB 5K4GA 1PNTA 3T3DA 4II2A 3QELA 5AW2A 1CRZA 3BUSA 4M6WA 1GR1A 5BR8B 2OBLA 3F8SA 4R0VA 2JIPA 2J87A 3OZTA 4QOHA 4Z1MA 2BEVB 3QA9A 3OJSA 1CJMA 3LXMA 4L8YA 3MMPA 3ZLBA 6PFKA 3ESDA 4E12A 4IUYA 4JU8A 4IX1A 1OI2A 1GTJ1 2BJHA 4EPRA 3FETA 2P79A 5HZHA 5L3RA 3AJEA 4INZA 1FVHA 1UKYA 4CKEA 3VFDA 5LXTB 1J0BA 1THGA 4C6TB 2GH1A 1U2RA 2JBAA 4R54A 5DI9A 5CRXA 3GV8B 4GLFA 4DQSA 4ZQHA 2LTAA 1RKVA 4CL8A 2ESRA 2W6ID 2VYFA 4HNAA 5EHZA 1ZXIA 4R1TA 1MHTA 2R8HA 5J47A 1KQOA 1F7UA 1GPDG 1GN8A 1RAHA 4ZVMA 1H3NA 1ZM2A 4LVCA 3DOCA 1H4TA 2W7TA 2YOHA 2W9MA 1Z4IA 2Z95A 3OOYA 4RX1A 1FXWF 2PZLA 2Q50A 3CN7A 1U0LA 2DPMA 2J6CA 4L2IB 4C7OA 4D1YA 3CRMA 4JITA 3QHQA 3E7WA 3C41J 3KIPA 2JGNA 3M34A 4W1PA 1E0DA 4ZV9A 3VTFA 4CNBA 1KIMA 4GPTA 2OQRA 1MRNA 1EJ0A 3H9UA 1OJLA 1UWKA 4M9LA 1U6IA 1KEPA 4KQ1A 3JQ9A 1R0XA 1ELOA 3VZPA 3TFSA 2C9OA 3TNJA 2LXNA 5HWSA 1X7YB 2FQWA 2VT2A 4IXNA 5BWNA 1R8QA 3U44A 1CNEA 3KRTA 1RJDA 3JW8A 3WKEA 1Z47A 3IEPA 4OLFA 1YE8A 4WXHA 4BO1A 2AXQA 2LGJA 1G8MA 4JR1A 1ZVMA 1VIAA 2GFQA 3PUHA 4G1BA 3SNHA 4CMEC 3DDZX 3GMTA 1HZZA 4NTZA 3UWKA 1W75A 3JTEA 1U49A 1AU9A 1ZJMA 1IZZA 1BX0A 3NX4A 4GSYA 4M54A 3GLGA 1L5RA 1VCIA 2JGMA 3OZDA 3SQDA 1SBNE 3VJMA 4E4TA 1U3FA 4CMCA 3NORA 1G5PA 3CUSA 1ID8A 3U2QA 4IQWA 1I3NA 4M7RA 2FZKA 2HA3A 4IQGA 4E32A 2XXAA 2LYBA 4B4OA 4FGSA 2M98A 4R2WA 4YCCA 4B3DA 4Q8EA 1Z07A 3EPKA 1JYSA 3C5VA 1D1TA 1G7RA 3ESZA 2DLDA 4Q4AB 4WNAA 1CEEA 2E5LB 2Z09A 1RQ2A 1YK0A 3FKQA 3GVHA 4N65A 3AZPA 2JPDA 8ICVA 1SOMA 2MSKA 3FCOA 5BT8A 3C45A 2GDJA 4GI2A 2QLMA 2XPCA 2VZEA 3GLHE 4X20A 3T3GA 1IQUA 2XNDA 2XZPA 2A67A 3JQEA 5IU6A 3E7FA 1L5HB 1N3YA 1JSLA 3KU1A 3Q8MA 4P0PB 1C7IA 3O2SB 4Q39A 2XY7A 5G0VA 5IBQA 4RULA 1GO2A 1ZJ4A 3EPHA 2CV0A 5KFUA 4B9MA 2E4UA 3JATA 3DLIA 4RQAA 2FSIA 4XH9B 2XCAA 3WHKA 2CV1A 2WTBA 4BO0A 5KT3A 2A0WA 2BKUA 2PZ8A 3WL6A 5AHKA 5JAPA 1NTOA 3O8QB 5EMJA 4AYXA 3OD5A 4LRSB 3AL0C 1T8SA 2UDPA 4B85A 2XW6A 3K15A 4E2FA 3WLHA 1NASA 3CPSA 2WKSA 4FONA 4XLTA 2AG0A 3AZQA 3T7AA 2DETA 1VZ2A 3KQVA 5BNWA 3SV3A 2IV7A 1EI9A 2CEKA 2V3WA 3ED1A 1C3VA 4GU5A 1PYDA 4I2EA 4URVR 5I8PA 4BMPB 3W6OA 1YFJA 4I4TA 1TJYA 5AVUA 3AFNA 3RWOA 4Q24A 4LWPA 4I2HA 2D3WA 2WHXA 1FE8A 1LBQA 3JZIA 3K8YA 4GBMA 4LY0A 4JIGA 3U13A 4F4YA 5KYNA 2PE5A 5JV5A 3ZNPA 1AV6A 1T6YA 1X7WB 1TM4E 1D9ZA 2VQFB 2BMDA 1U6JA 1ED1A 3OGUA 3PCTA 4Y9DA 1OWMA 5A71A 1HURA 4YUVA 1DMRA 1YR8A 1KDVA 3WA6A 1J8DA 1XWIA 3MS4A 2XUQA 4TURA 5HK9A 4X95A 3EFHA 1BHSA 3GLVA 3UICA 1QYWA 2QPAA 3C3CA 3VPFA 3UMMA 1ZK3A 1C8LA 5DHSA 1O0CA 1JMKC 3LZDA 4C5AA 1BNCA 3EAQA 5DLPA 5HQ3B 3SDSA 5H82A 4PFJA 1RLTA 4ARAA 2W42A 1VE9A 4Q03A 1UM9B 2GR9A 4H1HA 5G0UA 1B16A 2QTRA 3Q8LA 1QC5A 1X92A 2C88A 3H2SA 2OMEA 4KFUA 4MWDA 1K97A 1TU4A 5EGNA 3GLHA 2AOVA 2RAPA 3B9JA 3JQ6A 3OMXA 2R8EA 3P32A 4N8EA 1DX6A 1YS9A 2DY0A 4LF5B 5CH8A 2WK1A 5IJ0A 1IUNA 1ZVKA 1A7UA 2EDAA 1LPAB 4P7KA 3GFSA 4UBLA 1UADA 3FWYA 2LBPA 4NZ9A 8OHMA 4OJKA 1Q0SA 2KS6A 4J0CA 4YIHA 3M4XA 2JCVA 2V8OA 4JR0A 3AOEA 1NYQA 2C59A 2HK9A 2XGMA 4RPHA 3VAAA 4DCMA 4KDFA 3AF2A 2GAIA 2VXBA 1D6NA 1CR4A 1N8KA 3WRVA 1XZFA 3IE2A 2HLDA 2CLLB 2FSSA 3AB3A 4AJLA 1DI0A 1MKYA 4BNTA 1MAUA 2QSJA 5SYMA 1WCWA 1WX1A 3R76A 4PG4A 5LOVA 4R05A 3GJ8A 3IP7A 821PA 3QJGA 4Q8FA 1TEHA 1L8LA 2G25A 3HI6A 1KDRA 1M75A 3STXA 5C35A 1ZOPA 1J25A 3MFQA 4MVJP 2QUIA 4EQZA 1FW8A 3ZW9A 2VQDA 2FPPA 3H9CA 4J3FA 3DUFB 3TPFA 1MEEA 1BMFA 1ZIPA 2JAUA 2FPUA 3B3AA 4II3A 5EWJA 3ZHCA 1R66A 1E3WB 2IYNA 1B22A 3ZDQA 5I8ZA 1QZ3A 5CRIA 4L50A 2XKKA 2XBUA 2CB0A 1T6BY 5JFTA 2GTIA 2ZIUB 3P71T 1EVYA 1GWNA 1UBEA 2AK3A 1DEHA 1XTZA 3HJGA 4D74A 4EB6A 3THXB 1OBHA 4L4YA 2K4IA 1NURA 4LDQA 1D4ZA 3U60B 4HSGA 1KEJA 5FUYA 2VOEA 3W34A 5BYJA 3BS5B 2F59A 3GQCA 1UPUA 2V4ZA 5GVRA 4E3WA 2QRMA 3DVRX 5ENDA 4KLHA 1O96A 5LYJB 1U1DA 1WCLA 1NHGA 3FWHA 1QQBA 5TQ2A 4UBJA 2J9ZB 2HBYA 1SHKA 2UYOA 3HLYA 3NG1A 3JRXA 2C3MA 3TIGA 1BFKA 4BECA 2HY7A 2DXIA 2PQ0A 4D5EA 4I3GA 3ECSA 1COWA 1P3JA 3HVUA 4BNXA 1CZLA 4WV3A 1JTFA 5L3QA 5IVPA 2BBWA 1QH1A 1ZUNA 5CFLA 3EQZA 2AU0A 3GZNB 5EA2A 1M6VA 3SR4A 2ZLBA 3NVWA 3VH3A 3MMSA 5LMNB 4UB5A 4X0EA 1PVPA 3FAKA 4C6HA 2G1UA 1SIOA 1JTVA 4LZPA 5G4KA 5P8WA 4BCCA 1V96A 3GUZA 1KAMA 4HBZA 4FJ1A 4ND1A 1JRLA 2YZNA 3H1PA 4LZZA 2C5LA 2WUVA 1YZUA 2C2GA 3GLIB 3MOIA 4O0MA 4P2BA 2CYAA 4C03A 3U17A 5L8VA 4Z99A 1V48A 3BERA 4UMFA 4R71A 1Z29A 3A2MA 1M1XB 4DIDA 1XMJA 2GK7A 3PWTA 1CQIB 2ECPA 4GUAA 5K0BA 2HLHA 2X8JB 2ZDQA 4BOYA 4YMVA 2PUAA 3ELWA 3ZNOA 4W5HA 1KK1A 4R5MA 4GO1A 1KYXA 1P9LA 4I6GA 5GADl 3H2BA 1ZIDA 2FW7A 2WM8A 1XP8A 3MRXA 3QK7A 4WK2B 3L40A 3ZS8A 2ECOA 2XWPA 5J2TB 5HYVA 1I0ZA 1NJ5A 4CM4A 5B3LA 1F9AA 2HSGA 2OCEA 5CPFA 2DUJA 2YZKA 2YXDA 2G5TA 1F9EA 2J3MA 2QVYX 3QFFA 4UVDA 4YT8A 4L07A 5J2CA 3QBDA 4FHCA 3WLRA 4U1RA 1BD4A 2JF0A 4EKDA 4CEJB 3C6BA 1IBKB 2YIJA 4PZCA 4M0MA 4RENA 3ZJUA 4HGRA 1SUCA 3MBOA 1EUQA 3C3KA 2HMAA 4DO9A 1EFTA 1IDOA 1W0KD 2XTNA 3NJRA 3K2BA 5BVHA 2ZUFA 3P20A 4JI0B 1N2BA 4RQ1A 4FUTA 5IYZF 1YU6A 4ZA2A 2KW5A 4BZQA 2DF4B 3DD5A 3LMKA 3OLCX 3QBEA 1NJFA 4G85A 4KRXA 4MI6A 3UCFA 1WXGA 2QUAA 4WZZA 5FRDA 3RS5A 1COZA 3VNAA 3SHQA 3OZSA 1DTSA 5A06A 2F1HA 1VKHA 1IEWA 1A4UA 2QE7D 1OCEA 2GEUA 1NW8A 1NXPA 5CA1A 4MR8B 1QRDA 5ERYA 2V58A 4CKBA 4L72A 1V1MA 1P8AA 4MRMA 2GSDA 4K03A 4MO9A 2WZBA 4CF7A 3AVYA 4PS1A 2D6FC 1GARA 1YZFA 1C8BA 1KI7A 2XKAA 3KLBA 1SHJA 1C30B 3P0HA 5MF6A 1TGVA 3MTAA 3NWOA 2IV2X 2K4PA 2AZMA 4D82A 1SUIA 3H1FA 4PV7A 2Y8EA 4HN2A 4IVQA 2JFBA 4C0HA 1GQSA 1RI5A 1TUBA 2FXIA 4YR7A 3HX0A 4UPDA 3WWYA 1JVBA 4MIEA 4O5EA 3ET5A 4GFJA 4C0BA 1OMOA 2ZJBA 2WB1C 1BKDR 2XT9A 4B4WA 4I5IA 1KLNA 2BFWA 3CSDA 4OQPA 4B6OA 1UMBA 3GAAA 4KITB 1T3LA 1I6LA 3LBFA 1ZA2A 2VJQA 2N47A 1VI2A 5AVOA 1IZYA 1JJFA 3D2QA 3OQBA 2WNHA 3E35A 3NO4A 4GG1A 1SHUX 3IUMA 4MV3A 4XQCA 5D3ZA 5FIUA 4AS3A 2BDPA 5ALIA 5FPHA 1F1BA 1NKVA 2R8OA 4MYTA 2OZLB 1RI1A 1JBQA 3EGDB 2BM9A 1XUOA 5KINB 1KS2A 2EF0A 3K2IA 2VRNA 3V5NA 5BV8A 1HDCA 3DYVA 3EVGA 4GVXA 1HDOA 5EIFA 1SUWA 3N53A 4LPKA 4F92B 1R37A 5AHOA 1ZD3A 5J8YC 1WXQA 1FP4A 2C2KA 2LRHA 2YIMA 1Z1BA 3SOZA 5BRJA 2QP3A 1B8OA 1IZ9A 5KYYB 4PHDA 3LU1A 1O03A 4HJXA 3AW9A 3BL6A 1G3UA 2NU6B 3WIVA 1TVAA 1MRZA 4J2OA 2QNRA 1QFSA 4BDPA 3IIIA 2I76A 2ZYSA 2XLBA 3OHSX 3VVLA 2FSVC 4P3YA 2J3QA 2ODTX 3GCXA 3FDJA 4MO2A 4V39A 1E2BA 1E8NA 1I2AA 1WHTA 2PS3A 4Y1FA 4B1FA 4B3FX 1OYOA 1PKXA 3G7UA 4OXXA 1JDJA 2P4QA 2Q0SA 3NM6B 4LHSA 5CLHA 2BGTA 3Q5GA 3STTA 3AHDA 2ZPUA 4HDRB 1MO5A 3FPEA 4WY2A 4N8DA 4AZ3B 4QTYA 2AWOA 1Y33E 3GFOA 2OECA 3KXPA 4TMWA 3AEQB 3HTXA 1PEDA 1ZUHA 3K9NA 1V2GA 4G4JA 4EITA 2X9NA 5BN4B 1L8XA 3U80A 3A6FA 5E4YA 1IY9A 1PUJA 1ZH2A 3BGIA 3VHRA 1N4AA 2ZUTA 4TT3A 9ICPA 3RTDA 1KQFA 1O57A 1XT6A 2Y0SF 1QR6A 3A27A 4DHWA 2HTFA 3L6BA 2XUHA 1C8KA 4LZGA 3O3NB 4RXTA 4ZAVA <