3QYPA

Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with calcium and phosphate
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
221
structure length
221
Chain Sequence
KLKAVLFDMDGVLFNSMPYHSEAWHQVMKTHGLDLSREEAYMHNGRTGASTINIVFQRELGKEATQEEIESIYHEKSILFNSYPEAERMPGAWELLQKVKSEGLTPMVVTGSGQLSLLERLEHNFPGMFHKELMVTAFDVKYGKPNPEPYLMALKKGGLKADEAVVIENAPLGVEAGHKAGIFTIAVNTGPLDGQVLLDAGADLLFPSMQTLCDSWDTIML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INORGANIC PYROPHOSPHATASE
publication title Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 81
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2011-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3qypA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3qypA01
3S6JA 1ZS9A 2YJ4A 3OPXA 5AM1A 4FE3A 1NF2A 4HGPA 5AI4A 2VKQA 1WR8A 2IOFK 5AKEA 3FVVA 3OCWA 4RETA 3QYPA 4ZEVA 4HGNA 3QUCA 4RESA 4B6JA 4Y2QA 3WK5A 2RARA 3ZTWA 2I6XA 4UU1A 2CFSA 2OYCA 3IB6A 2P9JA 2I34A 4OCZA 3FPBA 2IOHA 2C88A 1X42A 2GHTA 4L57A 1RMQA 5ALMA 3CZ4A 3ZX5A 1WZCA 2HI0A 3ESQA 5AI9A 3HYCA 4UU0A 5AVUA 4FYPA 2B30A 2HF7A 1T5TA 3OCVA 1L7OA 2G80A 2B82A 2WFAA 4Y2YA 4GIBA 2I55A 3OCYA 2B8JA 1CQZA 3L1UA 3B9RA 1RMTA 4YGYA 5AK4A 3AR3A 5AW5A 4CE6A 1Z4NA 4BYGA 2R8XA 1Z5GA 4BNDB 3W5CA 3UMBA 2I33A 3WK7A 5AM2A 3TLMA 4XOUA 4XE5A 4I9GA 4Y2RA 4YCLA 3KC2A 4HAIA 2G0AA 2FDRA 4C4RA 3N5KA 3ZWKA 1ZJJA 5AK6A 5AM4A 1RKUA 3KOOA 3P96A 1SWVA 5AVSA 4MUMA 3ET5A 4Y2SA 4HGRA 1RKVA 4UARA 3L5KA 2WF5A 2GO7A 3NUQA 4DCCA 2R8ZA 3N8GA 2C4NA 2X4DA 4JB3A 4YIKA 2MSNA 2EATA 5FP0A 1NRWA 5AESA 3FPSA 1YJ5A 3FM9A 3DAOA 3PGVA 1IWOA 4PNHA 4UW9A 2I7DA 4ZEXA 3SD7A 5ALEA 3L8FA 2YFYA 2YY6A 2AH5A 4UMFA 1Z4IA 5A3RA 5ALHA 2HHLA 4UAVA 4I9FA 4UMEA 3AR2A 2G08A 4QQFA 2C8LA 2NO4A 1Z4OA 2NO5A 5A3SA 1JUDA 2G06A 2Q4RA 3R09A 3QU5A 2P69A 2ZBDA 4MWOA 2RBKA 3B8EA 5ALLA 2YMMA 3OCXA 5AKJA 5ALSA 3SKYA 3ZW7A 4L6CA 1RQNA 2FI1A 1J8DA 3OCUA 1RRCA 3ZX4A 2W4MA 2B1QA 4ZEWA 1U7PA 4NABA 2AGVA 3BA6A 4BEWA 2BDEA 4NWIA 5AM5A 3U7EB 5ALPA 2MU2A 3WGVA 5AKLA 3A1EA 2OA0A 3AR9A 4F71A 5ALGA 4DW8A 3QU9A 2O9JA 1N8NA 3SMVA 1L8OA 2YMQA 2YBDA 2AMYA 4Y2VA 5AKIA 1L7PA 3AR7A 3E84A 1SWWA 4DWOA 1Z4PX 5AVRA 2GMWA 4XPZA 3WK8A 5AVZA 2BY4A 2ZBFA 1QQ7A 2ZBGA 4EEKA 1RDFA 3DNPA 5AVWA 3PDWA 2MU1A 3PCTA 3UMCA 2WF7A 1RLOA 3SLRA 4L6AA 2FPXA 2ZG6A 3PGLA 3SF0A 3I1YA 3NALA 3U19A 4G63A 5AVTA 5AKGA 4NV0A 3NASA 4BBJA 2G1AA 2HX1A 2WF6A 2YN4A 2W11A 5ALFA 2OM6A 3WKDA 4BX2A 3QLEA 5ALIA 3ED5A 2IYEA 3IJ5A 4KNVA 2EARA 3RFUA 2C9MA 4IFTA 1VFPA 3MC1A 1CR6A 1ZD5A 3L8EA 5ALNA 3A1CA 3EWIA 4UASA 2R8YA 3NRJA 2WM8A 3M1YA 4YCMA 2IA5A 4YIHA 3ZWDA 2RAVA 3MN1A 1Z88A 4KN8A 4KYTA 1S2OA 1QH9A 5AW1A 1Z4JA 5ALDA 3E8MA 1RLTA 3HLTA 1L6RA 3KZXA 1QQ5A 3L7YA 4QJBA 3R9KA 1YV9A 4E88A 1L7MA 1J97A 2ZOSA 4Y2JA 1PW5A 4CF5A 3OTQA 2RB5A 3A1DA 5ALZA 1EK1A 3ET4A 5AW9A 5AVVA 5IT0A 3U7GA 2P27A 2G09A 5AW2A 3GYGA 3D6JA 3QUTA 2FUEA 2CFRA 4UATA 3ESRA 5AVQA 2JGAA 4OHFA 3IRUA 2OBBA 5ALVA 3ZU6A 1AQ6A 1Z4KA 5ALTA 5AHXA 5T41A 2GFHA 1ZOLA 2FPWA 3QX7A 5ALUA 1F5SA 3N1UA 4UMDA 3SKXA 1FEZA 3WK4A 2FPUA 1RKQA 1Z5UA 3NAMA 1MH9A 5IS2A 1U2TA 5ALXA 4C4SA 4BX0A 5AVYA 3WK9A 4AS3A 3EF1A 2FPRA 3QXGA 3J7TA 4AP9A 4BEVA 2HDOA 2QYHA 3EF0A 3WKBA 3KDPA 4UM7A 4OFZA 1LVHA 2JARA 1VJRA 3R4CA 4BX3A 2WF9A 2HF2A 5AM0A 3NANA 2W43A 4DFDA 2HCFA 5ALKA 1Z4QA 3L0CA 3DV9A 5AKYA 3L0YA 4Y2TA 5AKZA 4Y2XA 2PQ0A 3W5DA 2CFTA 1KYTA 4CF4A 1ZD3A 4BNDA 3WKCA 4Y2UA 3E58A 1U2SA 3U13A 5AIAA 5AKKA 1Y8AA 1TJ5A 5ALRA 4HGOA 4BKMA 3F9RA 3ZUPA 2ODAA 4G9BA 3ZVLA 3FGOA 5ALOA 1WVIA 2G07A 2FEAA 4UM5A 2PKEA 2B1RA 3RF6A 2HOQA 1VJ5A 2YMPA 2GHQA 5ALQA 3OCZA 1N9KA 5AKHA 1RPZA 1T9ZA 2PR7A 2JAOA 4UAUA 1QYIA 2QLTA 5AI6A 4KX5A 4EELA 3EPRA 5ALWA 4HGQA 1L8LA 1Q91A 4Y2PA 4EZEA 5JJBA 5ALJA 3QUBA 3ZI4A 1RMYA 5AW7A 1XPJA 2B0CA 5IT4A 1Z4MA 3L0BA 4HYTA 3W5AA 1YMQA 2YJ3A 4NAVA 4H1WA 3N28A 3QU4A 1S8OA 3U26A 2NYVA 3L8GA 4KX3A 4EX6A 1L7NA 3AR6A 3QU7A 4CNQA 5AW6A 1YS9A 4IG4A 2FUCA 3MMZA 1U7OA 3KD3A 3MPOA 2ZBEA 4FFDA 1LTQA 1U02A 3KBBA 1NNLA 3L1VA 5AI5A 1ZD2P 2HEGA 3FZQA 1TA0A 5AI0A 1SU4A 3W5BA 5AIBA 1QQ6A 3ONNA 2JAWA 5AW4A 1ZRMA 4YH1A 4C4TA 3VAYA 1K1EA 3QU2A 5ALYA 1T5SA 3WKEA 2AUTA 5A3QA 3CNHA 3WKAA 2BDUA 4Y3UA 3ZVNA 3UM9A 1TE2A 2P11A 1RLMA 4KNWA 3K1ZA 3M9LA 4JDPA 2WF8A 1ZRNA 3ZVMA 5AM3A 5AKXA 4EENA 5AVXA 2WHEA 2JAUA 2DQSA 2O2XA 1YNSA 4F72A 5AW3A 3E81A 4O8CA 4CF3A 5AW8A 1WPGA 4OD0A 3I76A 3L8HA 1Z4LA 1O08A 2HO4A 3DDHA 2CN1A 2Q5EA 2Q4TA 2YJ6A 2IOFA 3AR5A 4XQ0A 4J03A 4NFLA 1YDFA 1O03A 3QNMA 2B8EA 3A3YA 4J2TA 1Q92A 1XP5A 3AR4A 3U7HB 5AICA 3N07A 2EAUA 3I28A 1TJ3A 1XVIA 3I6BA 3WGUA 2FPSA 5AW0A 1ZD4A 3SHQA 1RQLA 3WK6A 3QGMA 3BWVA 5AK5A 4EX7A 1TJ4A 4UMVA 3U7FB 2D2VA 2YMLA 1EK2A 3ZTYA 2C8KA 4AS2A 5AI8A 1RC8A 4GXTA 3QUQA 5AK3A 2HSZA 4YCNA 3UMGA 3AR8A 2I54A 3NIWA 2ZXEA 2YJ5A 2R8EA 3B9BA 5E0OA
chains in the Genus database with same CATH superfamily
3KLOA 1N32B 2ZVQX 4ALJA 1ZQKA 1BNOA 4WOPA 1RC1A 4B2LA 4MVWA 2WJVA 1DCFA 2WJYA 4PLWA 4OCZA 4CLHA 4F4YA 3QTBA 2DFLA 1H2RS 4OHPA 2O4UX 3W9SA 1Z5VA 4JL5A 3LCJA 4GMXA 4I4NA 1XU9A 2XWJI 2IP4A 1OA1A 1BD4A 4Z9YA 3S44A 1GFWA 4RDIA 1DINA 2XDQB 9ICJA 3TM4A 4A73A 2PVCA 3IXLA 4CKWA 4EPWA 3FHJA 2Y0DA 2QP9X 4DLBA 3N5KA 5CHGA 1GNQA 1L5NA 5DHRA 2D13A 1S5LU 1Y4AE 2QMQA 1JZTA 3WGMA 3DBRA 4NONA 5EQDA 5G5HA 3TAUA 5AESA 4R1UA 4JZKA 1FDUA 2PXCA 3FWKA 4TTQA 4TQUS 4ITVA 3FROA 4MARA 2E8MA 4C0QC 2ZJYA 4F11A 4YY3B 1HX7A 4UBOA 4MS1B 2QTTA 4F3CA 3HM9A 4DV5B 2H5IA 2PUEA 1ZMBA 3AX6A 4FMPA 4YI5A 1X7ZB 3LLVA 3NEJA 3OBBA 4IIDA 3GILA 4RK4A 1UMKA 2VBCA 4MRAA 1YRBA 5A1JA 1P4GA 3G9XA 2RK4A 3LUGA 5CFZA 5H2FU 3LT4A 1GLNA 1KZHA 5EPEA 4IDBA 2FFQA 5GGXA 4HHEA 2QRZA 3B7GA 5CHEA 1TGVA 1XFDA 1YGYA 4DUPA 2EZXA 4G25A 5A5EA 1YQEA 4AO6A 3AVUA 2D7CA 4PZCA 3RSQA 1GGMA 4D0NA 3C2LA 2M0NA 4B4WA 1BE1A 2ZJ4A 5KFHA 4EIWA 1J2NA 1SXJC 1RFGE 1WMAA 4G5YA 4Q9JA 3FF4A 3I92A 1EGAA 1BPXA 4EQZA 4WOCA 3PTAA 4IRDA 4ZT4A 3QKWA 1TYAE 3PSIA 3UBMA 4PYMA 3I8SA 3WLIA 3BQ9A 2PFQA 4U5XA 3THYB 2HF2A 1SBHA 3OO0A 2GBLA 4HUTA 4DFDA 1QDUA 1EGQA 4ZWNA 1SGWA 5EIBC 2VF8A 3F2IA 3E58A 1RJDA 3KQKA 1QS0B 4IRKA 5AQ1A 4FYYA 4BDSA 3U9SA 3RC7A 5GWXA 2HBJA 1VJ5A 4G0ZA 3PXUA 2Q8NA 5IAEA 4TMWA 4EPVA 4G81A 5LD2C 2ATXA 3CU5A 7ICHA 1N5IA 1H6DA 4H7IA 1A88A 2ZYGA 4KE6A 3L3BA 2XTJA 3V72A 1E1RD 4QIHA 1C2YA 1KP3A 3F97A 1W4BA 1H2XA 4DMRA 3P2EA 4RIFA 2FPGA 2G83A 3R24A 3O95A 1QONA 2WWIA 5EIFA 1JE1A 4J07A 4GGOA 1DKNA 1AZWA 1FJ2A 4ARCA 4ZCTA 2I6GA 4P4PA 5L3SB 1PT6A 2IKSA 4GXNA 3ZLVA 2OFFA 1UQUA 3WGOA 2QP4A 2CVFA 2O2XA 5BSEA 3QLTA 4C0WA 3MR5A 1U3FA 2IT1A 1TYDE 4NL4H 1N75A 2HQOA 2OWDA 1G17A 2FZWA 1I1QB 2HYIC 2OORC 3WE7A 4A2CA 5KAIU 1XP5A 2H57A 1TVAA 4M9HA 1W0KD 3WADA 3QI7A 3FCOA 3O0DA 2N47A 4B5LA 4RHYA 5AI8A 1EJBA 1EHYA 3ZHOA 4BAUA 1PUXA 1T4CA 3AKDA 5HQTA 4LMBA 2YV1A 4AF8A 2EQAA 2ZCJA 3ZNOA 4MRNA 3BMOB 4C7YA 3FVVA 4Q0MA 4UHBA 1EQ2A 5SY6A 3S2YA 1WVMA 1UKBA 4N41A 3O4IA 3NRZA 1N2GA 3I5AA 4HDAA 4WESB 4F9TA 4QPCA 2P67A 4MS1A 3WZLA 1PT7A 4GM1A 2RHOA 4H1VA 3SKVA 5BWNA 4QZDA 4PWZA 1HUQA 1OH8A 1X7ZA 2D2FA 3OJXA 1TX4B 3U2QA 3HCDA 4S0XA 5HKKA 1K1SA 1TPYA 5IBCA 2FSIA 1T9GS 1A69A 2JZOA 5AM4A 3GRFA 1DKRA 2ZUVA 3REGA 3L5KA 4X65B 5I9BA 4I2NA 2ORED 5JD3A 1UKEA 2BFOA 1T3SA 1IL0A 2XBMA 3QVSA 5UKDA 3VU0A 4EI7A 2XCPA 2RMKA 2X22A 4FS8A 4V2UA 1TOAA 3ZY3A 4MJXA 1MMFB 3IELA 3CH4B 4CGYA 3VPFA 4DR3B 1BN6A 4NCHA 3GFVA 1LI7A 5IJWA 1FOEB 4Q9AA 3VDQA 3OCUA 1DBPA 1HEUA 3ZX4A 4KVZA 1IZYA 2Q5LA 3WB2A 2I9PA 5H80A 3ZBPA 5B3JA 5KDDA 1W48A 4RDXA 3L8CA 4EDFA 5LOVF 3FDSA 2PUGA 1D04A 3J81k 1BXKA 2Q1UA 5GMOA 2GEFA 5K8UA 5FBWB 4QPDA 2RGWA 3S7ZA 3L05A 1CS0B 4J9PA 1VCIA 3GPDG 5T4BA 1G98A 3RC8A 3GQBA 3V5NA 5BSFA 3THXA 3C0KA 3MCWA 5BSMA 3SF0A 1A82A 1H6AA 3WBJA 4PRKA 3D6NB 1YZYA 1T4BA 1CE8B 1MIOB 3UG7A 1RJEA 4Q4AB 4TWBA 2YS6A 3ZI0A 2YZGA 1ENOA 3E15A 2CLDX 1GUAA 4HVCA 2FPPB 2W03A 4HB2A 1Q2XA 3N7RC 1F0NA 2VOJA 1VSUA 1C8LA 2FRDC 4V24A 1G5TA 1KVQA 1QHHA 3L7YA 1H66A 3GYGA 4KLIA 1XTUA 3KU4A 1JXMA 2OO5C 3B1YA 4GWGA 2CXPA 3L4BC 3GLHB 4RHXA 5BW8A 3PW0A 4NE7A 3NAMA 5DBHX 3ROMA 2ONZA 2G77B 4PHCA 3H5WA 1GQFA 3UQ0A 1Z6ZA 3TRHA 4EEYA 3WMRA 1KO8A 2OZVA 1JKIA 4GOXA 4YHHB 3YASA 4ZAZA 2TECE 3A1VA 4HWSA 3C48A 1TTTA 3P5BA 2LUOA 1DAMA 1ZXBA 2P9QA 1WVIA 4NXZA 4KWCA 4ZQBA 3T9BA 2GWHA 4R3UC 4JEUA 3UBTA 5KO2A 2F8KA 1SPXA 3GLIE 1YZ7A 3HDHA 4DZRA 1ZKDA 6GPBA 3K70C 1DOHA 1CZUA 3M6ZA 3RJIA 1Z37A 4CMIB 3RAGA 2UYOA 3QLVA 2NTJA 3IHQB 1UBRS 3KAPA 1U8XX 1G8GA 3NBXX 1M2HA 1VPTA 3EGVA 1AF4A 3IG5A 3IVGA 3BXHA 4FP9A 3V00A 1SUWA 3TTSA 4DSZA 4LRTB 1A0PA 3DEYX 4O4HB 3VO8A 4RLFA 5FFFA 3D7LA 5EMMA 1NK9A 5KQSA 3I09A 9ICBA 1RYRA 2OCBA 2I2FA 1TT5B 1BVYF 1PR3A 5F4ZA 1BXGB 4U63A 3N0TA 3RFAA 5AVXA 3KTFA 2W48A 4LTDA 5E4TA 2LW7A 2GK6A 4CKZA 4QTZA 4F96A 5KJ1A 2P5TB 3BBPA 1NNUA 2Q6IA 4BFLA 4M1TA 3FLAA 4I50A 2W2OA 2AFIE 1T3QA 2XUIA 3VPDA 2CD7A 2ZVJA 3EVBA 5T5QA 3SHQA 5AK5A 3GRAA 4OVKA 1ZK3A 2HJSA 3S3TA 1L3VA 3AVQA 3AU6A 2VUTA 3CG0A 1I6WA 1MN8A 4OQNA 5KNLA 1M8GA 3A7DA 1B0AA 1SOAA 5H82A 3RODA 2R1TB 3H86A 2Q0SA 2X0JA 1UBKS 2GPWA 2PE5A 5IULC 2Q2VA 4JNCA 3JALA 2ZJ8A 3COWA 3WMXA 4MGYR 3PNPA 1PVOA 1EGHA 3WNCA 4JELA 4RZHA 3TZQA 1A5TA 4J7AA 5HKLA 5BYJA 4MHVA 3H1AA 2ZZKA 4G8DA 4WPGA 1CNEA 2OESA 5J2TF 1DC4A 2X8JA 2FF5A 3E5MA 1TU0A 4IIHA 4O25A 3NDRA 3LBAA 1AUXA 3AYXB 4KRYA 4YJ3F 3KXPA 4GUDA 2QUBA 1WU7A 3RFFA 1W47A 4H16A 4DRXB 4DLVA 2MR5A 1MO6A 1HDYA 1CF9A 3G3EA 2F3NA 1QQBA 1QTNA 4C6RA 2HJHA 3GPCA 3HKCB 1EIZA 4OL0A 3A1NA 4Z0NA 3TQTA 1P1CA 4LJ9A 4B8ZA 4F9EA 1ES9A 5HTOA 3WNBA 4NXNB 2UU9B 2OZKA 1JDJA 3QU5A 4BNKA 2HHAA 5FIUA 1TKBA 4M9GA 1GWNA 2F1JA 3CYFA 5ALSA 5KFIA 5D7NA 2KD1A 4C80A 1ZLXA 2WBLC 3QQPA 3A9CA 3FPEA 1DXOA 5TPZA 3MINB 1BQ3A 5CM9C 3EZ2A 3JX9A 4UD2A 1N57A 4PJ0U 4MUJA 4NU6A 1J5EB 2IA6A 2IU6A 4FWIB 4BLTA 1J8YF 3JWJA 2VH5R 4NEGA 1KC3A 2JI7A 1N5LA 4JX9A 3IP9A 4MF8A 1V0JA 4MR7B 3TE7A 1NVFA 1WV0A 1R00A 1N2OA 1PS9A 3KJFA 1Z6XA 3ELUA 4IEIA 1LPPA 2VTBB 3ZIUA 2D0DA 3IT0A 4OMCA 3CVWA 4LCEA 5ALIA 3DMNA 1OKKA 3C2MA 3RWBA 1PT5A 3CZMA 3CNOA 2AE2A 1CZOA 2NVOA 1WP4A 3T7RA 2M6SA 3PGKA 1XYYA 2WMYA 5KNCA 3LIPA 4MQFA 3D8UA 3DH0A 3OT1B 3BXEA 3RRNA 2J3KA 1FSFA 5LZ5A 2K7FA 3T3GA 3LOUA 1C4KA 3GN2A 1TM1E 1E2BA 1NZFA 5LFAA 1DVRA 4LBVA 3CLSD 4R2XA 2NU7B 2H3HA 5D87A 4PZNA 3ME5A 2ID4A 2AUMA 2E8PA 2WUVA 1X87A 2C3UA 4H17A 1EA5A 2NUTA 2PQ0A 1S2LA 4WBNA 4R9VA 4WZZA 4WKPA 1DOAA 4HQ0A 2Z1MA 2Z5GA 4IGEA 2W6QA 1BXZA 3B9PA 3FAKA 8ICTA 4BN0A 4Q4HB 1UODA 3TAQA 1L7BA 2Y1DA 3HK2A 5J2HA 1SBZA 4H3SA 1BH2A 2ESRA 2BR5A 1DBQA 1R0KA 5I6DA 2E6KA 1E1QA 4O3NA 5B53A 2FWBA 3EXIA 3FTPA 4D3XA 1AIPA 3MRXA 4IZHA 1IU9A 4GBED 5KG7A 2H7CA 3REFA 1CDEA 1S6YA 2GI4A 2RC6A 2A6PA 2GLXA 4LGVA 4MW2A 4OAOA 1BVRA 4AP5A 1ADBA 3X2FA 3LVWA 4BJHB 2UYGA 3PEUA 3EBLA 3T3IA 2EAPA 2M6KA 5FX2A 3JRWA 3UPQA 1OOEA 2I1WA 2CKDA 4PHPA 4AN1A 4YXMA 1K9SA 3ISVA 2R4UA 1N9ZA 1I3LA 1UBTS 4CCSA 1EFPB 9GPBA 1SKWA 2OFPA 2R8HA 1R0BA 3UMMA 4POAA 3FXAA 1U0NA 3F7OA 1H1LB 3K9HA 4YECA 1BMTA 3I76A 3RS3A 2X4GA 1T4MA 3G17A 2WM9B 2QLFA 3PYLA 1X7WA 4OSPA 2IOFA 1QV9A 3RBXA 2V4MA 4GP7A 2QPAA 2G70A 3C6XA 4Q47A 3K8OE 1M0EA 2FG6C 2ZTUA 1ZIXA 3PKZA 3Q3IA 4IMIB 4D2IA 3HBMA 1A98A 1OAOA 3G8CA 1UKYA 2C59A 3VYRB 1Y4UA 4MKFA 3UQYS 2JA2A 3I32A 1M34E 1JEAA 2O3SA 2LP4Y 1UJ5A 3RNOA 1OIWA 2BFFB 3DPSA 5LOVB 2A1JB 1JR4A 3C5CA 3O7WA 3ECAA 3GEGA 2ZP1A 2ZSEA 2QM8A 5BWBA 3TBHA 5MFPA 4L8VA 3HCCA 1OJLA 4LQCA 4KH0A 4FQ5A 3WAKA 1T5TA 1AX9A 5KTRA 1KRWA 1R5JA 5C8YF 4ZJPA 2QB0B 2M32A 1ECJA 3RT1A 2Q5FA 3P27A 1YUMA 4MYUA 2NUAB 1A76A 4U39A 4N54A 1AQLA 2RKWA 4MUMA 4ZPJA 4PGGA 1FYEA 3QVUA 5B4VA 2RQ5A 4JYAB 3DAGA 3QMPA 1CQIA 1C9DB 5JD6A 2BZ0A 2OZEA 3GAFA 5EIEA 5JNTA 3X3HA 1VL2A 5BV2P 2V9ZA 4CKYA 1J0BA 2W6ZA 4U5QA 2OV6A 7ICUA 5M34A 3EYAA 1TXGA 1CUVA 4M0AA 1KVUA 3DW3X 2C97A 3DEEA 4LWQA 2MSLA 2O7QA 2GPJA 3ACDA 3ONWA 1B22A 4IKOA 3UB4A 3CH6A 3FUXA 1DKQA 1KOJA 2QL6A 1Z5WA 4QLAA 2I65A 3KLBA 1GU7A 3E84A 3KXLA 3V4LA 1TM7E 2ZBFA 5AVOA 4ZHQF 1NVVR 2VJAA 5KAPA 1ODFA 3I3SR 1LLUA 1QHXA 3I9KA 2KW5A 1T15A 1A4RA 2FMHA 2ZBQA 1TD9A 4I81A 1XELA 5JISA 3KNZA 5D3MB 2BD0A 1YVUA 3CEHA 4MQ5A 4ESHA 3SG0A 1ONBA 2ZJOA 4R9UC 2PKXA 5FUVA 4QX6A 3KZNA 1CR6A 2G7MC 4X1OA 2Q9CA 5EHXA 4DCPA 2IF0A 1JU4A 1SXGA 2L19A 2Z43A 4D7AA 1R0YA 1A5AB 1N56A 2HBLA 4E6EA 1YT3A 3E5RA 3PQ3A 4Z99A 2ZI6A 3RVNA 4AC9A 5CLLA 1BKSB 1DT5A 3IRVA 2JLCA 2AN5A 2NW6A 2DFDA 3MBIA 4O1HA 3X44A 4AW9A 1E4EB 1GTL1 1MB2A 2A9QA 3UGQA 2P0AA 3DQPA 1DK3A 2FLNA 1P2FA 2XCLA 3ROTA 1KO5A 1XEFA 4MVJI 2M9NA 1IN7A 3BJYA 2KG5A 1P75A 4YMSA 2FCRA 1XDUA 3EC7A 3NYWA 5F2KA 1SCBA 1U65A 3RJMA 1OWPA 2QF7A 4RTMA 4AYBF 2BPOA 2VP9A 3RF6A 2BJHA 2WWFA 1T9ZA 2GZRA 3AJAA 1FA9A 3LUPA 1DZIA 4PAQA 3QENA 4IJUA 4MA5A 2ZQYA 8ICPA 1BW9B 5A9TA 4FYWA 2UVPA 3OC6A 1G9SA 2GK7A 4MI1A 2DLCX 3ZGVA 1JRLA 1AN9A 3STWA 4PZOA 2F43A 3FDIA 4WZBA 4K1LA 3FJYA 2ZRNA 3WBKA 1P2BA 3TL3A 2XQGA 3CUWA 2XI4A 5K3OA 1P72A 1XJWA 3TIXB 2ZJ5A 1T9BA 5J2TB 2CLCX 1E2NA 2BCVA 2CV1A 4ENUA 4YJ3B 4RELA 3F46A 1OQAA 3AFHA 4YRLA 1BDBA 5EKTA 2E4UA 2C96A 1B74A 3EZ9A 1BXRA 2XKBA 3CB2A 4YDRA 4IR7A 1JPNA 1QAMA 2C29D 4EBDA 1Q46A 4BN4A 2GN0A 2FPSA 3ROKA 4WLUA 4D8YA 1XWWA 2AS0A 2QVLA 3AUKA 3DOJA 1TK8A 1PSDA 1KY4A 3UXOA 2FEWB 1G2QA 4ZOHC 3ETRA 3FJ1A 1NPYA 1OLXA 1C7RA 4OI0A 1NKSA 3BHNA 2VNAA 3IBYA 2P9JA 2ZSDA 2DKFA 3U3KA 2FMSA 2XCIA 4TMXA 3BFVA 3KEMA 3A7EA 3D1LA 1ZJWA 3RYIA 3UWSA 3HACA 5DIZA 3BAZA 2Y27A 1BMDA 1TK2A 4GMKA 2AFHB 3URMA 3K4GA 4CDNA 1C1DB 1J49A 3AEVA 4LDJA 3D1JA 1EVZA 2ZWAA 3S27A 1V6AA 3J81j 3Q3JB 1L3BA 1R1DA 3K32A 3R75A 3OSNA 4BJQA 2EX4A 1IY9A 1TW2A 1N6NA 2CZGA 5BVHA 4R54A 3Q9UA 3HO6A 3TIFA 2I4LA 2W6CX 1XJCA 4MLCA 1T5OA 1XNSA 2IDKA 5DG8A 3VBEA 1S0OA 1O0BA 4GNKA 1B42A 2HBYA 2RGBA 5U4QA 4MKRA 3SKYA 2FI1A 1HLPA 2WAAA 4RTQA 3HGTA 5BNIA 2CXOA 1CZRA 4MV7A 1IK6A 3ROPA 3DMTA 4J76A 3HS3A 2ORIA 3QEKA 2B3TA 3ZWWA 2ZRMA 1N1DA 3JVDA 3WRYA 5L1IA 3RVPA 1F48A 2VBFA 1NW4A 3SOZA 4AKGA 2FJUA 4BNLA 2PRJA 5EPUA 1VIAA 2J9YB 2ZIXB 1YOVA 1WWVA 2QSZA 4U2CA 4RD6A 1NP6A 3Q3EA 4BFYA 4LMAA 4RL4A 2KJQA 3Q0IA 4M7OA 3GPBA 1N5XA 4I55A 4DOMA 3IA7A 9ICGA 3S5JA 1ZJ6A 1G4UR 2B21A 2P1RA 1EGMB 4JBWA 1PF7E 4ZTUB 1NQOA 4K6CA 1NNI1 5JRJA 2V3CC 3F6YA 2WT8A 2ISPA 2R25B 1CR0A 5K2MA 3SR4A 5KOJB 4OM8A 1GSAA 3BE5A 2A5FA 5FV7A 3G2HA 2VSOA 2V1UA 1AO0A 2OECA 3H0KA 2Q6OA 5IVDA 1L4EA 1JT2A 4R7GA 3S2ZA 1HE3A 1A3CA 4AP9A 1SQ0A 2XW6A 1UIMA 3BXZA 4FHCA 2OUIA 1E2DA 3PL5A 1W36D 1E3DA 1XK7A 3T9CA 4JXJA 4MRVA 1H0SA 4UM5A 3U44A 3IVXA 1I2BA 1FFAA 4CU5A 4Y1GA 4MQ6A 4PS1A 4GX0A 2C4UA 4EO9A 4BLWA 1XZQA 4LBZA 4F9GA 1XZEA 3H11B 4QG7A 4ER6A 3L7IA 4M7WA 3AR6A 1PK3A 3HUUA 5FUWA 2NZJA 2O1WA 2A5LA 5C8YB 4QZCA 1X9SA 3PNQA 1U9YA 4U2BA 4RQAA 3F3KA 3T1QA 1R16A 2Q50A 4I4TA 1SXEA 4Z6EA 3AESB 4ECWA 5D3KA 3GO4A 3H2GA 1Q77A 4TMTA 1A7AA 1O89A 3WLRA 4D46A 1X38A 2QYTA 5DGTA 2G63A 1NC1A 1ZJ4A 2VA8A 2C5SA 2P6PA 3K5HA 5CLGA 4PTZA 2Q6KA 3VYTB 2YYAA 3D4BA 3OLYA 1EG2A 1XLWA 3MOIA 2CMGA 1MC4A 4LZNA 1SXJA 4BQIA 3WLOA 2VJOA 1G0NA 1MQ2A 4NI5A 4YACA 2C8KA 3KXDA 1VBKA 3Q6IA 4G5FA 4LWOA 3TCXB 3Q88A 1KY5A 2BGNA 4KO8A 3ZWBA 3TPCA 1C9JA 3HVJA 1T2NA 4YDSA 1DXSA 1Y3IA 1TK5A 2AGPA 5KT7A 4RTNA 2ZT7A 1QU3A 1TAQA 4ZHQB 4HT3B 3RVQA 3RARA 3NUZA 3OZXA 1P7DA 2D2XA 5BN1A 4UDNA 3B9RA 1O8BA 3KK0A 4L1KA 1MQAA 1O3YA 5CR0A 4K9NA 2IQ5A 1QANA 4P8RA 5IJZA 4M49A 3PFCA 1GPAA 3R23A 2OPHA 4Y2SA 4HGRA 1W25A 3KQVA 4DABA 1XTQA 4PIVA 2G04A 1QG6A 2C4NA 1MB4A 2V0GA 4OGFA 3LK7A 1OXJA 5KAMA 4MW1A 4C0XA 2CWDA 2B5WA 5DYIA 5F9FA 3ZOZA 2EAOA 3EFEA 1USWA 2Q4DA 3JU3A 1VECA 2AGQA 4KYUA 4NESA 2IU0A 1KJWA 4I2DA 4R40A 1J2MA 1NUSA 3QF7A 3OOJA 2WFZA 2YN2A 4QNLA 1PV1A 4O08A 4C0JA 3LOQA 2DR2A 4QOFA 4EO4A 1WL8A 5HBRA 2ZWVA 3E3LA 3UWDA 4Q16A 4J0FA 2WU1A 5JFOA 3M4JA 9ICHA 1U8FO 1XTPA 1WCYA 4ZT5A 1PQWA 4IR1A 3DP7A 2OORA 3EJ6A 3MEQA 1WB4A 2IU4A 1KJYA 3A3NA 1RDFA 4YFYA 3WYNA 4TL9A 3SM3A 6NULA 3D4NA 4UULA 4YMNA 1QVWA 1YCDA 2C83A 2VTVA 1XFAA 4HDSA 1PYOA 1TIKA 4ON9A 2W11A 1Z6TA 1T2DA 4WLNA 1SVSA 1Z16A 4HEQA 1YS2X 3OAAD 2BELA 3W5HA 2V7TA 1SV4A 3CXRA 2YV4A 3SBDA 4CM8B 3X1JA 4HO1X 1Z19A 3DL7A 3ZZ0A 1WKVA 2EFYA 1FRZA 1H22A 3ZNQA 3RRXA 1E3LA 2GBGA 4IKEA 1XRQA 1E2KA 2DERA 3BD6A 3IAS1 1YE5A 2F00A 3PV0A 2X9VA 2WZCA 3MTGA 1DDIA 3FDZA 4RCZA 4OIFA 2Q41A 4X64B 3QMVA 4N3NA 2X0EA 4E03A 3DXXA 3V8NA 2UZIR 3EQ2A 3USZA 4H0FA 2YHIA 1KI4A 3HKBA 3JYOA 1Z00A 3UFXA 3L7CA 4B6EA 4TYWA 1VPEA 2K2QB 2J5KA 4ERNA 2Y93A 1CY7A 4EJMA 2ZM6B 3LX5A 3DV0B 4E7PA 1Q1NA 5EMKA 2UVVA 4UUMA 3JD3A 3PNMA 3PI6A 1EB9A 5G5GA 3WWEA 1CHDA 1R4AA 1RMYA 2YINC 4PGYA 4ENRA 1HK7A 5LQKA 4K2AA 2LM4A 3L8GA 4H3KB 3G7NA 4FTWA 3AJ9A 1UXHA 4DKXA 5CDYA 3VR6A 4YMHA 2QTNA 2ZUBA 3M6FA 5KZMB 4BXOB 3AFNA 2JDID 2GEKA 3PITA 3BX1A 2AEJA 3PSHA 4O5AA 5B6JA 1XQVA 1W1WA 1BOFA 2MYTA 3ZV5A 1IVYA 1P19A 2HBQA 3WZ2A 1YJ8A 4OTZA 4DM7A 2DUNA 1VI5A 1L1QA 9LDTA 2I1QA 1FDTA 1L5FA 1P1RA 3PEYA 3OWHA 3V6HA 4LNHA 5BN5A 16PKA 2QW1A 4DIMA 3A31A 2V3VA 2W2KA 3FUVA 2C42A 5ES4B 2FRDA 3SAHA 4ZVKA 4ESVA 5DNEA 1MABA 2NV0A 5B6IA 2XBLA 2IPAB 1LDBA 2J9FB 4W5JA 5EMJA 1ZQXA 1ZISA 3UK6A 1YH3A 3BGWA 1NQWA 4KN9S 4Y2HA 2J3QA 3WK6A 1YA6A 2JKVA 2XA1A 3B1ZA 1I4EB 2OO5A 4Q3AA 3L4BA 3B89A 3B48A 1SMKA 2GDZA 2ZT8A 4XWYA 2KI5A 1PL7A 2AG6A 3GA5A 2AVNA 3EY4A 4PONA 4LTNA 1BEEA 4QHTA 3ETGA 1C4WA 1QHYA 3K0BA 3LQRA 4Y2QA 2O59A 3B36A 4L4XA 4UEWA 1T5LA 4R81A 2ZLBA 3HNPA 1CB7A 1RJ9A 1W4ZA 2HZBA 3DR3A 4QGFA 2JGJA 3N70A 1Y88A 4MKZA 5KFTA 3P19A 4HNRA 4G9GA 2MSDB 4WZAE 3QE0A 1WTAA 4W5TA 1VLHA 4M46A 3E1SA 1G38A 3DULA 2XBUA 2CNKA 1RXEA 1K06A 7AT1A 1F9AA 1LPNA 3LK9A 1HH4A 2Y1IA 5DMHA 4FLFA 1XZNA 1EM8A 4G2TA 2KZZA 1ZXLA 3BK1A 4L50A 2D8MA 1NRWA 2WU8A 4PLYA 2BEWA 1PVQA 1Y33E 1LBTA 5DMXA 4K03A 3RBDA 4RZRA 3CXUA 5HTKA 3SM9A 1X80B 4R2KA 3GB9A 1ZM7A 1NKVA 3VHLB 1XLVA 2I78A 2LHTA 4RV9A 2J0UB 4HQRA 4TLEA 1NRIA 1P60A 3PD7A 1FUYB 4O3FA 5CD1A 2R1VB 3M6MD 1ZGJA 3M9WA 2Z95A 3AFIA 1R18A 3FDXA 1TYBE 5B36A 2WKPA 1EAYA 4M8LA 3QOFA 2BDEA 2P9FA 1EMDA 1GL6A 4B3CA 1ZQSA 4JB0A 3SAFA 3TVYA 3P45A 4B82A 4OY3A 1OAKA 3VSBA 5C7LO 2CK3A 5K3DA 4PG6A 3T3OA 1OLOA 2B4QA 4FJ2A 5I7RA 2GWSA 1Y4ZA 8ICLA 4OJPA 3RO7A 4D80A 3STHA 4KTQA 3HP7A 3WHIA 2ERYA 5JATA 1IZ7A 2XVYA 5FWDA 2OCXA 3K0FB 4ELVA 2PY6A 3A3OA 1ZDMA 4ZZ3A 1NBIA 2VS1A 2J4CA 2WNIA 1JV2B 1JSZA 1N6HA 4P3YA 1S76D 3WS7A 3WGHA 4V1CA 4YCSA 3OTQA 4Q01A 2AJLI 3D6JA 1DRGA 1H2FA 2A35A 3QSYA 5LYJF 1RLIA 3QFCA 1OA0A 4DNPA 2Z2JA 1WD7A 1E6KA 1DARA 4B2PA 2JAXA 4ZRNA 8ICMA 3T5LA 3Q1KA 2P91A 5EZSA 2BW0A 1WXQA 3KYDB 3WSVA 2RHMA 5DT9A 4LDAA 3GNTA 4K9KA 3COZA 1S9FA 5JO9A 3N6XA 4IP0A 2BFAA 2H5EA 4G9BA 2RG1A 3E9NA 4BAGA 3WU2U 2P4EA 2BZFA 4N49A 2R5WA 2FSHA 2A78A 2HWWA 3ZDAA 2C28A 9ICIA 1DT3A 3RKUA 3C3KA 3GHHA 1GPNA 3OIUA 3WL8A 2JCYA 2GYWA 3QY0A 3NHZA 2OVFA 2BFBA 4UCQA 4ER7A 1H0HA 3Q41A 2WI8A 4Y18A 1Z5NA 3NM5A 1C29B 7ICVA 2HXGA 2PUFA 3KBBA 1A7KA 5JXWA 4U2DA 4ARBA 4IDEA 3TG2A 1C1XB 4FYKA 3RQIA 4DF4A 2GH1A 2Z83A 1DNPA 4HSGA 1WNTA 1QGUB 3CTMA 3AUOA 3OJSA 4B09A 3EA4A 3S2EA 1GILA 3L41A 5FDFA 3T7SA 1VOTA 5BSVA 4GBGA 3L0ZA 2BEUA 2QL7A 2VNJA 3AUSA 2EHDA 1ZQ9A 1ISPA 3AR4A 1QE5A 3I28A 4HRVA 4LYAA 4EP1A 5E9WA 2EYQA 3PC3A 5CB6A 3V46A 1QUFA 2ZYUX 4DJJA 2BEKA 1KPGA 1F1JA 1GKYA 1LU9A 1PJLA 1NVGA 4BBAA 1RAEA 3OESA 4LYFA 2YJ4A 3NVZA 5KFMA 4I0WB 1IOLA 3PZRA 4BFUA 4LQDA 1OU0A 2IY8A 1R5OA 3EEQA 3LAWA 5THQA 1FNMA 3LSYA 5BXYA 5I7EA 4N8SA 4Q1DA 1IN1A 1KDRA 5HMMA 2Y76A 1PUJA 1ZCZA 3ZOKA 4BJ3A 3WHPA 3CRW1 2ZR8A 1YL5A 5IC5A 1FBNA 4AJ1A 4Z2YA 5KYGA 3TZBA 2A19A 1DU4A 3GZ4A 4C1NA 2AR0A 3CF4G 4K87A 4EO7A 5KNDH 3IJRA 4KPEC 3DTNA 5KL8B 3TLAA 3WLAA 3OKPA 1DIHA 3QKTA 4EHJA 2B0JA 1QKJA 2M9MA 2DVMA 1N8SA 3HXPA 2PUCA 4IC9A 721PA 4L16A 5C53B 4J0GA 3NHRA 4ECTA 3RS5A 3WMGA 1SH7A 2QTHA 4UB2A 3T94A 5LP1A 2VVTA 3AIKA 1SL2A 2G08A 5T67A 2COUA 1JG7A 1FSZA 3IEIA 3F2DA 1L4UA 3FRHA 4G01B 2P69A 4B3XA 3UXHA 2Q3EA 2WSIA 1UADA 4DOCA 2OK8A 4BPRA 4RQ0A 3WXMA 1Z26A 1ZNZA 2XODA 2F17A 3PMNA 3JYQA 3VM6A 3MTDA 3X1WA 3WWCA 3HB9A 4OB6A 5CLHA 3PYXA 1NU6A 3PTLA 2Q1YA 4NICA 3PE6A 2EC5A 4DWOA 1JR3E 3PUZA 3DEZA 1E59A 1DRJA 4D4IA 1GPBA 4MR9A 1Q0HA 1I01A 4UXJA 1YQGA 1CERA 3OD1A 1YUBA 3KB8A 1NF3A 3TTVA 3U9LA 2RIRA 4R8KA 4DQSA 1XZFA 2ISSD 1WPRA 1MB3A 3A9VA 3QEMA 1RYSA 4I27A 1KFKB 3WYGA 1MT3A 4F60A 1GEGA 3WDSA 4DNOA 4TLMB 2UXCB 1I7LA 1QJCA 3GK3A 2IIPA 5KFAA 2OH2A 4UUOA 2FTKE 1HNWB 3PNYA 3QIAA 1D07A 3W6ZA 5I7VA 4JQSA 3ASVA 3RU2A 4JJAA 3PQEA 3GJTA 4NOJA 4EKIA 4YMMA 1N7GA 3ETNA 4ROSA 2GJ8A 4AIRA 4C2UA 4ZQIA 1JKXA 3V55A 2DQYA 2WQ7A 3OJUA 4FDUA 4G0WA 1XQWA 4YG2A 4DMCA 4FW9A 2C7BA 5TMDA 1HORA 4YP6A 1GGFA 2P5UA 2XDQA 3AF0A 1KK2A 1FTQA 3DDNA 1SVUA 3UJ7A 4WOJA 1N5MA 1J5XA 4IGKA 2XRZA 4O9MA 5F78A 1QE0A 1ZN2A 2NXWA 2BJVA 1YVPA 4F46A 3HP6A 2WLSA 5ALWA 4GICA 3H5NA 4LXIA 2NIPA 4FM9A 3IBSA 1EWRA 4GC7A 3DHNA 4KLHA 3KQYA 3ZHBA 4J1SA 4QPJC 5J0WA 3DQQA 3S28A 1K88A 3FNHA 1QSYA 4ZK2A 5C0YA 1WM1A 4E13A 4EMTA 5IVIA 5D6NA 3U3ZA 1G9XA 3ANNA 5E8JA 5E2BA 3RAXA 1HE8B 1YR8A 5KNBD 4G86A 2XKAA 3NTUA 1VE5A 4AZ3B 1ZQVA 3KVOA 2GTHA 3JZFA 3LF2A 4DF3A 2Q07A 4O0IA 3UGKA 2VJBA 4F72A 3FMIA 1YB2A 3RH6A 4F4XA 2GT1A 1E69A 2AA3A 4MUKA 5J2IA 5THKA 1UBFA 2YVKA 4BWYA 3ZGXA 2YWBA 4O2RA 2XEDA 4PQGA 2AOXA 4YAJA 2ZUDA 1QYRA 2R60A 4WNAB 5I9SA 1KH1A 1K0FA 1T6ZA 3LECA 4RYDA 3ELWA 2FA9A 3VPAA 4ETNA 4FWTA 4DV4B 1URJA 3RFCA 1J5PA 1N8KA 2D0PB 3HYNA 3CP8A 2X0FA 5LU8A 4OQZA 2EGGA 1F7UA 5JBIA 4BO8A 4F2GA 5HJ7A 3PHLA 3FWYA 2CFSA 6ADHA 4NCAA 3RTDA 2Z09A 4F5NA 4MRSA 4HFJA 4QDKA 1LK7A 2X5OA 2OYYA 3TARA 1XTJA 1FFVA 3CLUD 3HL4A 4AT1A 1W4LA 3IE2A 2WG2A 1SOMA 3THYA 4KLLA 2FZ5A 3T5TA 3WQRA 1SHUX 4X44A 5D3ZA 1W2GA 3JAKB 1TF2A 1RKXA 1QS0A 2CRXA 5A5DA 5HUQA 4H2DA 1S2DA 4XB2A 5G3ZA 1QIMA 3OLWA 1HDEA 3PXXA 3JQ8B 1QRUA 2O1XA 2UXDB 1Z08A 4DNXA 3EX7C 1D03A 4HMPA 3AJDA 2FAXA 4NYJR 2ZIGA 1PWEA 5LYJB 3I1FA 2PFKA 3FTEA 1QWOA 4P53A 4CW7A 2I87A 4V39A 2B5OA 1M2WA 2XGMA 4JOBA 3CX4A 3V9AA 3IIKA 4CRXA 1U5BB 2NU9B 1GN8A 2A88A 2W6PA 3PS9A 4RBNA 2XY6A 5GM2A 1IIBA 3GDGA 4MCAA 5U4XA 2GEUA 3FCUB 1ISMA 3ZEAA 4DLWA 1FMCA 2QV0A 3M1LA 3PQ4A 1NBWB 5JS1A 2XNDD 1B26A 1XROA 4WN9B 5L3SA 4AO8A 1KZ6A 1FTYA 1WY5A 3ISJA 2N9UA 1UC4B 2J6TA 1AGYA 4LZLA 4AYBC 3KHLA 3NHPA 4QFCA 3L04A 4F85A 1QC5B 2Y1OA 3E3NA 1JEDA 2X0NA 3ZNNA 2GK4A 1FFYA 2OLKA 5F7JA 2LYHA 3C5FA 3ZCTA 1HUZA 1KJQA 4GGPA 2QHXA 2XMQA 1BYUA 3BMOA 2FKAA 3ESRA 3FOZA 3BD7A 4ZZ2A 4KXUA 3CSUA 4LZDA 4IIUA 5A0LA 5C9ZA 1EXDA 1RHQA 4ZHSA 2O3JA 4N5NA 4AURA 2ZIAA 4WESA 3WK9A 3ZBUA 3H5VA 2ZS9A 3VVCA 2JL1A 1NHWA 2XZOA 2XYHA 2CDNA 4A1FA 1Q16A 2XRFA 3CPHA 3R7AA 2CFTA 3Q6NA 4C2AA 1V38A 2PBFA 1FSSA 3AINA 5AKKA 3QKRB 1LBHA 1S8AA 1NRXA 4I6JA 4GXJA 1B0ZA 1KAHA 4KI0A 2UUBB 1SC1A 3FGOA 5KVCA 2EZ8A 1X8KA 1GA1A 1E60A 4D25A 7ICMA 3VI4B 1JNYA 4MP6A 1E2FA 3EEIA 3JARB 5IBPA 1B4FA 4LSMA 4ELTA 3MS4A 5E0KB 5J8YC 2A84A 2REXB 1JXQA 1VQ1A 2OT3B 1KERA 1X70A 3WO1A 4D5GA 1RZ3A 4L27A 3KUKA 1U7OA 1TDJA 3C1AA 1T9HA 3LC7O 3Q0TA 3HRKA 1A2KC 2NRZA 2VJ4A 2ISCA 4KO3S 4QWWA 4UHFA 4OI1A 4FFRA 3CX3A 4C78A 1YMUA 4I5IA 2ZJ1A 2Q3LA 3O8NA 4BRWA 4QXAA 4QWAA 4FBLA 3X1DA 3U9TA 5JY1A 2I4IA 1TZ2A 1CS0A 4GPBA 4TL7A 4XVRA 1QGZA 4YRPA 1P0IA 1VKZA 2VHYA 3CN9A 2MMCA 2VHCA 2P4QA 1EFAA 3KEGA 4KE8A 3L0PA 5LQRA 2HMVA 5G3YA 2F8MA 1CE8A 1MIOA 1V9CA 3T1NA 4Q4AA 4L74A 2O0LA 5B1IA 3RUAA 3KKAC 2W04A 5BW5A 3DHYA 5DLPA 5BSUA 3JAKA 3U7FB 2FPPA 4LVOA 3NM4A 4ZC8A 4EI9A 3QUQA 1W0KA 4LC9A 4UHKA 2EZYA 2ECFA 3NI2A 3NIWA 1DGSA 3IGFA 1P0MA 5HIIA 1X9XA 3FTFA 5B1EA 4B48A 1NF2A 3EC2A 4L22A 1CP3A 3MNFA 1ABEA 2GPTA 3CPJB 1IN4A 4BVJA 1AHNA 3C3JA 1I4WA 3V1UA 5DB7A 3GLHA 2GBIA 4BKRA 2R6HA 4R1PA 4EB0A 3EW7A 3RW9A 4PYJA 1JHVA 4F84A 1PFQA 1S96A 2BC9A 2A14A 3C7DB 5E7QA 3UMBA 3KEFA 4U2EA 1YRWA 1NWHA 3KKLA 4Q1FA 1U04A 2X9NA 4DSUA 3PZBA 3DLBA 1OF1A 1E2GA 3SC2B 2EATA 3L7BA 4FJ0A 2X8WA 3FYDA 4O3PA 4CMIA 2NRWA 3EDOA 1JVSA 4L15A 5A3RA 4ZQGA 1Y7IA 1Z0AA 1CUWA 5LIRA 2ZTDA 4EA6A 4FOOA 4O4HA 4XUEA 1WBJB 1U81A 4KWEA 4B83A 4LZWA 1KAOA 4NAHA 4YAFA 2JJ1A 4OJ5A 5KQRA 4YP5A 1U8EA 3PR4A 1S2MA 3NCTA 1TT5A 5DM1A 4RMGA 4YV7A 1G16A 1BXGA 3FFWA 4Q7MB 4LDQA 3PC7A 1GARA 4Q1BA 4JAVC 4H7DA 4AY4A 5TB5A 1N5WA 5DTEA 1BFUA 4R9RA 1X7GA 4URFA 2JVKA 2RK6A 1R3UA 2IQIA 1GDDA 3LWZA 1PNQA 2HPVA 4UVEA 1RQGA 4OI2A 4ETWA 3GXOA 5C1OA 3HHEA 2VWQA 1DQNA 4RTSA 1U99A 3WISA 4KXVA 3EVTA 2HMSA 1ZQIA 5JVDF 2I3ZA 2BF7A 1T5DX 3I6MA 3ET4A 5B1SA 1AROP 3QVVA 4DMHA 3AM5A 3H8SA 1W44A 2R1TA 3AF3A 1CR2A 2IYQA 3C43A 1SVOA 1ZOLA 1CB0A 1EA7A 3ZU5A 5ESXA 1GLVA 3RRBA 3QVXA 1B6TA 3CT6A 2PSDA 3TCNA 5LL6P 1CRLA 3JZAA 2FPRA 5KFPA 4MUGA 4U7DA 3W0LB 3EIOA 2J8ZA 1AZLA 2X3YA 3CR3C 2W43A 2FV8A 4ISCA 4U7WA 1BS2A 5AKZA 3E3AA 1NE7A 1N78A 2ZW9A 2PIDA 1CG6A 5B58T 4MS3B 5TRTA 4HNAB 1KSJA 5B3LA 1AKYA 1U7TA 4QUDA 1FF9A 3ADPA 3T15A 1QYIA 2FMTA 2H3FA 5J0QA 4DYHA 4IVPA 3CLKA 4DRXA 2QAJA 1SGGA 1P6XA 3LY9A 2ZAIA 1LRJA 4LZZA 2PGXA 4F7DA 1X9GA 3SEAA 1O6CA 1XHLA 1E3WB 3IE1A 3FLMA 3HKCA 4JT2A 1Q0LA 1JHUA 2GOYA 3HDTA 2HK9A 2N1RA 4CKEB 2BEJA 4KL8S 2BHLA 4D98A 3B1VA 2FETA 3V8MA 4KP7A 4RORA 2OVBA 1IVSA 1HTBA 1SBNE 4ZT2A 1O77A 3IN5A 2DHEA 4RQMA 3UJPA 2QE6A 4KO2S 1DKUA 1QXSA 3WKAA 1JAXA 2CB9A 3MINA 3IA2A 4OJQA 4QXQA 5E7JA 4CG3A 4F5OA 3TR0A 1MJGM 3E81A 4Q7QA 3IP6A 2PZGA 4Z6FA 2V59A 3ABZA 2HMUA 3WFZA 3DWGA 4MR7A 4MVJM 4GU5A 2AL7A 4TN5A 4C9BA 1KMCA 2Z4SA 2VTBA 821PA 4URWR 3Q8SB 1RE0A 3QZ8A 1X2BA 3GJ7A 1OBHA 1H2HA 2B4YA 5DULA 1M73E 1BGXT 3FNEA 4M9NA 1PJRA 5AYVA 4FC7A 5K1ZA 2RIPA 2YDXA 3WRWA 3OT1A 3AFMA 1J7JA 2W37A 3TL2A 1UIRA 4QULA 3R6GA 4M1QA 1PX2A 3B70A 2VK2A 3LX8A 3HDGA 2YHUA 2EX0A 2CL5A 2P79A 4JJFA 2NU7A 1R4MB 3ZXSA 2VI5A 2QD2A 1GQOA 5FB3A 4JB2A 3O9MA 2K8AA 2A4KA 3DBOB 3S1LA 4Z51A 3KYCB 3LPAA 4HYQA 1L7RA 2JASA 2AYYA 1U3WA 3TUZC 5LJLA 2R7KA 1DTWB 4A6EA 3GLTA 1XTSA 2WHQA 2W7PA 4Q4HA 3AXSA 5I45A 1JE0A 3G49A 1P31A 1U1CA 5LZ2A 4CR6A 1WV1A 3GF4A 4NPAA 1DPFA 3V1NA 2ZPUA 2ZRJA 1OI3A 3Q11A 4MDYA 4KPGA 3WGZA 2LYAA 1GYRA 3VNSA 5JHHB 2OV3A 5AJTA 1IQUA 2I1VB 1HZJA 3BDAA 5DH9A 3V7WA 5ISMA 4QJIA 3SX4A 4XQGA 2IH2A 1U2EA 4E2ZA 5KSYA 4G4JA 2XMPA 3M6XA 2VQDA 4D9KA 2IYPA 4NRDA 3AR9A 2IEYA 1GZ5A 2R6R1 2AQ4A 2Y68A 3MABA 2LI6A 4ZI5A 1QG0A 5TQJA 3O84A 2OD7A 2W0MA 2J41A 4R0MA 2IZ0A 2JJ8A 1EFPA 4BHTA 3AIIA 5AVWA 3BULA 2FWIA 1OBVA 4NNJA 3CGGA 2DETA 1E6MA 2IKQA 1H1LA 3L5OA 1ZQUA 1XX6A 4O2AF 7GPBA 2NLOA 1NK6A 3PWKA 1PT8A 4XGIA 1TCVA 1NBAA 3VUFA 4PNZA 4RD3A 3PX2A 3SZRA 2NO0A 4IQGA 2DBQA 3IDAA 5T3UA 5KJ6A 1W0JD 2C9BA 1PJ2A 2WWHA 4IIJF 1ZUHA 4GW3A 5DN9A 1Z88A 2DUWA 1LSSA 2ZVPX 2VHQA 1XQYA 1HWYA 2EQYA 4CMCA 3AT1A 4RPGA 1EUCB 4B4KA 2BFFA 2R5FA 2GKGA 5LOVA 4DSFA 2A1JA 3BXOA 4H7KA 3SFZA 5JDIC 3G7UA 1AS3A 8ICXA 4HXEB 4N65A 3WOHA 3QIVA 3LY5A 4Q8FA 3LY7A 1LVHA 4KN4A 1T8TA 4ICAA 1EWKA 2QB0A 4HMQA 4YVZA 4LAFA 4Y30A 4LHEA 1JFTA 4C87A 3KHSA 4IEEA 3I6QA 4FMBB 3STXA 2NUAA 1XZPA 3EBOA 4D9MA 4HRXA 1YDWA 2OCGA 3A37A 2JIBA 5B30A 3DVRX 2GM9A 1WKCA 5TEVA 5CH5A 5H3LA 1ZH4A 3OMXA 3QSGA 3TIVA 3TXXA 4YAEA 4QU9A 4CKBB 3KJQA 2CXTA 2BGGA 2XYRA 4RLHA 4YUVA 3R7FA 4E1BA 4H4DA 3FVWA 4BYMA 4US9A 1QCZA 5KPDA 3RASA 5CJ2A 2GA9A 4PQEA 5FBZA 3QHAA 1FLDA 3EPJA 2OCAA 2ZI3A 3HP4A 4M0PA 2ZYAA 1LS1A 3UHAA 3VAZA 3CO0S 4NKRA 5DFAA 1MUUA 1FVXA 2L82A 1RHKA 2IW3A 1T6YA 3GOHA 1PIWA 3DKIA 4TQ9A 1Y80A 4AJOA 5SZHB 3ZD8A 1QIJA 1DAFA 5ECGC 1SO8A 5KQGA 2IHYA 1L1EA 4YRZA 1ZD8A 1R0ZA 1KMHB 2VT2A 4X97A 1WUDA 4YVFA 1HT0A 3BWMA 4OAQA 2CXXA 1SD2A 4H6VA 4KVFA 5D3MA 1BZYA 4S1PA 1JBEA 4V03A 4KAJA 2CNWD 3N2ZB 2KKVA 5F9HA 2W2VA 1JDVA 3ABSB 5DXJA 1DC6A 4DAOA 4S1OA 3PIIA 1TVEA 4NBLA 2A1UB 2P41A 4QOJA 3AHFA 1HMPA 2ZYIA 1RR6A 5ELXA 4GC5A 4AQYB 1JMYA 4M9ZA 1NXWA 4WMLA 1WR8A 2FK8A 4D9HA 2YVQA 2PTGA 5INTA 4NF2A 1ZQLA 3GLKA 1T5BA 4JP3A 5TNXA 3FUCA 3QEAZ 4N76A 1J2EA 4ZO6A 5CDFE 1OX5A 1E4EA 4J0DA 4O4JF 2XT9A 4OIMA 1UPHA 1M83A 4H1HA 9LDBA 3C7CB 1OB5A 1JROA 5JAOA 3UWOA 1F60A 1XR3A 3GFPA 1CJVC 2QPTA 5A9SB 3ANLA 3KQMA 4UCXA 4RNCA 1PKXA 2V5VA 5F9NA 4BNFA 3BJRA 4A8EA 4HI0E 3QTLA 4PSDA 5JVDB 3QA9A 3LNTA 3ONFA 2KMDA 1U9IC 4G0UA 1U1FA 5JYEA 2VPQA 1U28C 2C0PA 1BW9A 1KSGA 3E9QA 1YB4A 2CFIA 1DJOA 5DU2A 1Z4OA 2JFZA 3ROQA 3M5WA 1QGED 4ESEA 4J16C 4PGFA 1USIA 1UFOA 1A1SA 2F77X 3VMMA 4V0KA 3JQRA 2MYPA 3O8RA 2ARKA 1KW4A 4DAEA 5J2UF 3DOEA 3IHLA 2O0MA 4UNPA 1I7NA 4TTTS 2R18A 3OZSA 5J2TA 3TI9A 3IQWA 2B4AA 5JQWA 2FY8A 3PNLA 5PGMA 2I4TA 1WCXA 5AWFC 1RNLA 1SR8A 1L4MA 4BNNA 4YJ3A 3MERA 3VR4D 2LCQA 5HOQA 4M83A 2QVCA 2HMXA 4HAYA 1PU2A 4JCCA 2CLLB 3HJCA 2ERXA 4JJ8A 4ZCQA 5DTIA 4PANA 4S04A 3DG9A 5M29A 2IYEA 2QQFA 5CBKA 2EFGA 1SNYA 4L0DA 3VU9B 5EE0A 3N0WA 2ZRIA 1LV8A 1E4YA 5FI0B 1UDWA 1L5QA 3VPSA 3EEFA 1VPVA 3M2PA 3C4QA 2FN8A 4QIWF 2ZOSA 5ECYA 1G8FA 1B2RA 1KYQA 4WBXC 4TURA 2JD2A 1N0IA 4DC9A 3VGJA 2ZK7A 4CMAA 3A6JA 2NXJA 4RKQA 3DZFA 1MZPA 4GMFA 3U81A 1M9NA 1U2TA 5DB6A 1L4NA 2QAGB 4EZ6A 4XJSA 2P77A 3D2BA 5E1OA 1IQRA 1TZMA 4TLBA 2OBYA 1HMYA 1TMYA 4PZLA 5IDYA 2AFHA 2JD0A 4BB9A 1NVDA 1C1DA 2WP0A 2A59A 4Q48A 2B7LA 1HYQA 5KTOA 4QU0A 4RIHA 1S1CA 2RI0A 1N0UA 2W58A 4EHKA 4FGWA 3ST7A 5JTUA 2YYSA 4UNRA 4MMYB 1VHJA 4KR6A 2ZEJA 2VYFA 1OCEA 5JSUA 3RLFA 3NVKI 2WUGA 4DL5A 4NX2A 5TF4A 4DR5B 2XI9A 5JJBA 1ZQBA 5JTIA 2CXRA 3DE7X 1T2FA 3ECCA 4YAGA 4TRMA 4LYJA 3TKYA 1C81A 4UCWA 4CMJA 1JJIA 4QLBA 2O8EB 2VP6A 4QSHA 1ZQYA 2WKQA 4A92A 1Z33A 2PL1A 1WCV1 2LGJA 3NC1C 4HQKA 4OFXA 4ND5A 8ICCA 4IJ6A 3R3YA 4IOMA 3MGIA 4N40A 4TM8A 3PD1A 3I2KA 2QQGA 3ZDRA 4AK9A 1E6UA 1PQUA 4PSUA 5CHYA 4W1SA 4YLGA 5A6VA 1DAKA 1UAGA 1W36B 3LP8A 2CJWB 5EYPB 5SYAA 3UT6A 2AX3A 2OCYC 1AKQA 3ZNPA 1L7DA 4EENA 4EMUA 2NSYA 4MUNA 1E2UA 3N6VA 4UB6U 5DLGA 3O73A 4M99A 4PFQA 5DCYA 3PJRA 2ZIXA 2WMDA 1S3GA 4GT1A 1Q92A 3LD9A 2NMVA 4YONB 1FSPA 5KG4A 3NEPX 4YUAA 1H8HD 2VXOA 3PE4A 2Y66A 3ITKA 1T0JB 2H51A 2IVZA 3GHYA 1WDTA 5BW6B 2AMJA 3SF8B 3PUKA 5HRUA 3EEYA 4QXOA 5DYNA 4F4DA 4MI3A 2CUTA 5BQ3A 5JAIA 3GFSA 4TL6A 3MBYA 2QX6A 5AXAA 5KOJA 1LBSA 4HGNA 2IOHA 5CXSA 5ILGA 4XW2A 3SHWA 1D5WA 1CJSA 3SWWA 5AI9A 4WX2B 4N5MA 3A9TA 1AN0A 5DO9A 3AVPA 5J58A 3MMNA 1NOMA 2HMTA 4O2AB 1WUYA 5HZHA 4PEVA 2IYAA 4RK7A 1UZNA 3BIOA 4NH4A 5BORA 1SCDA 4LJKA 2JIPA 2SECE 2AMVA 2O6HA 1D4AA 1YHYA 1YK1A 2OENG 3EH1A 4IIJB 2CY0A 2W9CB 3GRZA 4F21A 3D4LA 3ZE7A 3GV7B 3TECE 3H5RA 3UCXA 4O3MA 1AM4D 4P93A 4G2NA 5A4AA 1LDGA 1ZW6A 2CUKA 3H11A 5CRXA 3KTQA 1OYYA 2OBFA 5JZBA 3MJEA 4MRPA 4JBXA 3OZ7A 5JAHA 1Q95A 4ER5A 2MUTB 4Z4FA 2W2LA 2W6JD 4N9WA 1DTSA 5C8YA 4G4SP 2VYND 4WGGA 4XDYA 4A8PA 4FB5A 4CGZA 3N7TA 4DEVA 3ZCSA 3QU9A 4V2IA 2ZGVA 3AESA 2YKGA 2Q62A 4PG8A 4ND2A 3EW9A 1I0LA 1U3TA 3WL4A 3PRHA 5F7OA 1NAHA 4QICA 3HXQA 1VE7A 1SB9A 1XDBA 3F8SA 2YV2A 1BWPA 2CVOA 3NUGA 2BKEA 1NIPA 4G89A 5D7BA 1DX6A 1NJ8A 3MRSA 4TZ0A 1BQEA 6PFKA 2PAAA 2DFVA 3O1JC 1P8JA 1TM3E 2XWQA 2QA5A 4NU5A 3MLAA 3MQ4A 3DMDA 3I1IA 4R3NA 1NC3A 3UPTA 2RHBA 1L3UA 3QXCA 1WUHS 5FLKA 4ZHQA 1PZNA 1E9EA 1H4TA 1QRAA 3G1WA 2Z6AA 3P9QA 2NV3A 3SYMA 3BUSA 2ZWPA 2PO5A 1CVIA 3R5XA 4MI9A 4RPYA 2C58A 2GZAA 1U2SA 5JMTA 3UF0A 3EB9A 3BHJA 4JLKA 2YZMA 2OYRA 1R8SA 3QXSA 2OP1A 1N8TA 4Q4LA 3DMRA 3IPRA 3ORFA 5AJUA 3VH3A 4O5CA 2BTOA 3G6WA 5DWVA 1AQIA 4MW9A 3G0BA 1ZIOA 2H1IA 1AHHA 3OKFA 5ALJA 2X8BA 3HKEB 4UB4A 4DJAA 1ULUA 1VL0A 2G0NA 1S8OA 1OWNA 4Z4EA 1W46A 1RXCA 4Q3KA 3FAZA 3HUEA 3RFTA 1ZIDA 5EP1A 4DEZA 2Z6VA 1IJBA 3FI0A 5MN4A 1XRNA 2QRHA 4C0AC 1D8YA 2XYQA 3O6VA 2O07A 2BGLA 3FNIA 3VZDA 1UJ6A 4BB5A 4F5ZA 3CLSC 1GNLA 2J3JA 2JMGA 1J24A 3STTA 3MIZA 1FYDA 2OCDA 3T5MA 5COBA 1USGA 1E89A 3HU5A 4FIDA 4HQNA 2ZM5A 1ZONA 4B0OA 2X7HA 1R9GA 1DAIA 4KN6A 4N0EA 1TFUA 2GRJA 3PO4A 1RWKA 2KVCA 5H02A 2QTFA 1OFVA 4ZV4A 3GVCA 4ARUA 3VJKA 4QUGA 4Q19A 4DA0A 1KZ7B 1ENPA 5ITVA 4CM8A 3SJBA 4M1ZA 3ZN2A 4HS9A 2G5IB 1OI2A 2LIVA 4DWVA 1ZVJA 1DRKA 4K26A 1XNJA 4QLOA 3EMKA 1O5OA 2H85A 4BVEA 1TGYA 1T43A 2DFKB 4CLXA 2G25A 4GLXA 4JLUA 2H4FA 2PSEA 2I55A 2WYIA 5GJBA 4OLAA 2J5QA 5JJKA 4M89A 3BGSA 3DVAB 2AKAB 3I8OA 5EUBA 1JQDA 1IY1A 4YA6A 2EP7A 1HQYE 1VJGA 4ABYA 1MXHA 3Q0EA 5J8YA 2WF5A 1L5UA 1NYRA 1OTXA 1XK6A 2PD3A 3MCZA 3DV0A 5FP0A 4U0JA 1YACA 1DP4A 2G5CA 1R15A 4LQ4A 3ADDA 4P0PB 3SCZA 5JNVA 1QB8A 5JNLA 4BC0A 5H16A 4BQNA 1S2IA 4EW3A 2LBPA 4PLTA 5TVKA 2J3HA 2OFOA 3ETLA 3Q8RB 4BDTA 2WKRA 4ENPA 4NS1A 3DO6A 4BXOA 5TMBA 1F0YA 1JHAA 3D3JA 4IW3B 1PD1A 3RS7A 1KFSA 3B3GA 1IPFA 4DQVA 3WA7A 1EHCA 1NYQA 2FLKA 4FW8A 5TQVA 1PP4A 3UJNA 3C3CA 5I3ZA 1TC2A 2JI6A 3ZLBA 1RWOA 2EKZA 3FPCA 3B60A 3BSWA 3KKAA 5CXXA 3P9XA 4Q8EA 3U4AA 3WGKA 3ZUGA 3NG1A 2O3RA 3OEEA 1Q1QA 4FFPA 3UHJA 3K31A 2H5XA 1KSHA 1U5AA 1C9KA 2ODPA 4YUXA 4EPTA 4OLBA 2J9FA 2ZIWB 3VPGA 4IL5A 1CRPA 3C23A 4J9MA 4TSRA 2O20A 3NBQA 3R44A 3M89A 5TARA 3HEMA 4KYTA 1GUBA 4MMZB 3LCVB 2W7TA 5L45A 4NEHB 2DGDA 4WY8A 1P7CA 3PX6A 4R2IA 1A9YA 2I4NA 4KFSA 2PKQP 4KUGA 1V1RB 3UC9A 2CXQA 2GHRA 3SIPA 2IEDA 2IIVA 1KTQA 4JBGA 2PMDA 4TYQA 2IYYA 3HA3A 4KMMA 4RK6A 1FQKA 1KO7A 3C41J 2ZPAA 2VQEB 5KTNA 1KFBB 2XA2A 2HW3A 1E8NA 1I4LD 4DR7B 3SENA 1IJKA 5FUXA 5AOAA 1Q57A 5EKDA 3PQ8A 1ZQJA 3GVPA 3KIPA 3LLSA 4CF4A 4DZTA 4ID3A 1ITZA 2C5FA 3ID6C 2RHHA 3IBFA 1NMZA 3ZE6A 1J33A 1EXNA 2WM2A 3QITA 3NFYA 3NORA 1EPUA 3ZWVA 2BDPA 1MAVA 3TSOA 1OFUX 1F2VA 3U16A 4JVLA 5HP4A 2C54A 2ZDQA 2VG8A 4DRZA 4UOZA 3QUBA 4CG1A 1EVKA 1X80A 4D0GA 2Q1SA 4YV1A 1V8ZA 4KXNA 4PSCA 2J0UA 3NGLA 1PSWA 3JQ7B 3HCBA 3ZV4A 4CKXA 1TAHA 1NYLA 1YS9A 2R1VA 3NGDA 1E1LA 4RVNA 1NNLA 1P9RA 2REOA 4P4SB 1CRXA 2XJ9A 1GLGA 5AIBA 1N5OX 3L9XA 3JQGB 2JH1A 4XUSA 1A27A 4MW4A 3FNGA 4WRRA 3CNHA 2BBOA 4OA8A 2XGGA 1JQLB 5FPQA 3V7KA 1PWYE 2XUQA 2E7ZA 5DKFA 2HUNA 4YI3A 4MK4A 4OD0A 4KJZA 4WOBA 1Z47A 1MFPA 2D3WA 2Z56A 1SELA 3R3SA 3ZC3A 4UD6A 4NFLA 5K8JB 4LJSA 4P86A 1GCOA 3FPHA 3FCYA 1Z8FA 3GJZA 4AJJA 3A70A 4NJEB 1BMFD 2C3MA 3K0FA 1YXMA 2FE4A 4HG2A 1PFKA 1U0BB 1REQB 4HDCA 1XNRB 4MYSA 4QZIA 1USKA 2VF4X 2IP2A 5IU6A 4HQLA 4EHBA 2W9XA 4EKYA 2O14A 2NVBA 1I2MA 3NX4A 3L43A 4ZEVA 2HJRA 4E5YA 2Q7XA 3F6PA 3UG6A 3RBVA 5EEGA 3CPSA 5DISB 4F1WA 4H4CA 1WZCA 1Z6GA 5DEIA 1VI2A 1EJ0A 3KPUA 4KUHA 1OXVA 1XI2A 2C3PA 3ELYA 3BF7A 4B84A 4MV6A 3ODPA 2AXTU 3E7PA 1A1VA 1COWA 3RK4A 2DL0A 4E0DA 3QH4A 5D5PA 4KHPB 4BYGA 5IN4A 3TLCA 1XSPA 4HLDA 2CHGA 3KYDA 3NJ4A 4CV3A 1EVJA 4HUQB 4YXFA 1TU4A 4P4TA 4WV3A 4BLPA 2I6SA 3WL7A 1PL0A 1ECWA 5F9MA 4US0R 5D5HA 5AMXA 4UNNA 2IUEA 3T5DA 4C7OB 4C4XA 3GEMA 3REQB 2IK8A 1IHDA 2ZBRA 4HH0A 1UBOS 2VDQB 1MH1A 4LDNA 3Q6MA 2G1KA 5ALHA 4C8LA 4C0HA 3IQDB 4R1MA 1XEXB 4DLTA 3SJCA 5CX1B 4HSEA 2WJWA 2XB9A 1Y3HA 3OPYB 4B6GA 4QVKA 1YWGO 3B8EA 4ZK6A 4MAMA 4X6YA 3WGGA 3KVRA 1NLZA 1C1XA 2HJWA 1IE3A 1QDLB 3OQJA 4JLBA 2GPYA 3TVDA 4B3JA 1QGUA 4M8NE 2O5CA 4EG0A 3GGSA 1O95D 2PV7A 3DWFA 3H3XA 4M9QA 3ORHA 1SPBS 5KYXB 3PCTA 2O8DB 1JFVA 3SYZA 4NIMA 3IVMA 2BLLA 2CHQA 3JQDA 1FFSA 2XLBA 2IEAA 2PG3A 3KQLA 3UUFA 4X24A 1XF9A 4OX9B 2HZ7A 3FPGA 1EP9A 2D0IA 1ORIA 4M9LA 5KFYA 1QMGA 3Q5GA 3SEQA 1ZMTA 3NYRA 2R7AA 5K0GA 2IY9A 4RJLA 3SOPA 3IQEA 2HWYA 1OYOA 5CLQA 3V7YA 2BPFA 2VDUE 2BYTA 2CFRA 1U31A 4LJ7A 1RI3A 4YAIA 1I13A 4FZLA 4L7QA 5T41A 2FPWA 4AKEA 1RCUA 5FUMA 1P91A 1NIJA 1RKQA 2W3SA 3RJHA 1MNQA 5LLTA 2VDWB 3Q8LA 3V7LA 2VNSA 3RABA 2AC4A 1MTOA 2YFHA 3FMFA 3A28A 4D8VA 3PRKE 5L4LA 1SG6A 3HYLA 3QX9A 4LJAA 1UDRA 2QAGC 4HNHA 4GHWA 2WK1A 1M2JA 1UC8A 2DTEA 2B1RA 3OCZA 2AV6A 4QL3A 2C92A 3V6JA 2QIPA 1FIQA 4LY6A 9ICVA 1NATA 1VG9B 1JPUA 3UT0A 4GLFA 1F0PA 2J7PD 2HA4A 5D01A 2IP1A 2Q3BA 4F8YA 1QBGA 4UTVA 3L0BA 4ECEA 4R63A 1ULHA 1U4OA 4EAQA 2LPMA 4HAWA 5IIOA 1V9PA 4O3QA 4CMHA 4JLJA 3KKOA 2O2EA 1E79D 3ISCA 1SB3C 3KB1A 2GUGA 1NYTA 3L1VA 3NVYA 3OJWA 1JFFB 4B9VA 4LOJA 4JBIA 3LA8A 1M8JA 4RV4A 5DW3A 5JPIA 1ZI6A 8ABPA 4QKQA 2QG9A 1A9QA 4RY0A 4UVHA 3ZJ5A 3KT6A 3IOBA 4Z1OA 2BUCA 2WNSA 2DTXA 3JSXA 4UHHA 2FP3A 1JQAA 1IXYA 4C89A 5JNUA 1A9OA 5CFQA 1UKZA 2MA1A 5KDOA 4PCLA 1L7XA 3GLUA 3ZIDA 3PSAA 3A06A 1W36C 3A3YA 3SZGA 2QORA 1DIGA 4FT4A 4P31A 2ATLA 4MW7A 1R66A 4EF5A 4EGQA 5EZ6B 4RQBA 3SE7A 3KOMA 3EFHA 4CL0A 1AQYA 3WLJA 4B34A 5JDIA 3ZDXB 1JH9A 2P8SA 3BS7A 3QNWA 1JTVA 1IV8A 4HGPA 4C7OA 3GLFB 3GFGA 1NI3A 1GUZA 4HNSA 3UAVA 4WERA 4I4CA 1SU8A 1ZN8A 3CKMA 2OPBA 3ZDBA 5E7IA 4DSOA 1OW3B 3ESCA 1Z28A 1JYSA 2BKLA 4EVQA 4GPIB 5EI5A 1E64A 2XMSA 2A1TR 4LRYA 4M7PA 2IJGX 2Z4RA 2NSJA 3G2MA 3B6ZA 2GAOA 1RIFA 3ABOB 3ZG6A 3IAM1 1Q14A 3PCRB 3N2EA 3H9UA 4JNKA 1PNRA 3PUVA 3CPEA 1Y8ZA 2GERA 3ZY6A 4UQOA 1XV5A 3GRVA 4AUNA 4UDYX 2WAXA 4QRHA 1YCHA 1E7SA 1Z2OX 5EWFA 1GPDG 4UM8B 1KI8A 3N2GB 1ATIA 1WEHA 3BFXA 2ID9A 2VXCA 1KGSA 3PFIA 5LDHA 3LCUA 4XVHA 5IJXA 1J2TA 3P0RA 3QKIA 4B87A 3ZWMA 1Y34E 2ET6A 1ZXXA 4JITA 4N6OA 4AZ3A 4N9QA 1RLUA 1CP2A 4BEWA 4B80A 1NQUA 3BFJA 3TRJA 3L8ZA 3OT5A 3FMPB 3BORA 1Q0SA 3D0OA 2QXYA 3B6MA 3VYUB 1WTCA 5JJLA 1GZ4A 4QOGA 5AR1A 4G0QA 4PC1A 3Q7IA 5DG7A 5JC8A 5EZYF 2CDRA 2NU6B 4DQ0A 2TSYB 4I3HA 4KBGA 3UY4A 2V7EA 3AMVA 4S12A 1TUBB 3KFLA 2I5PO 3O2QB 4IPTA 2J85A 4NU8X 3C1YA 2FVXA 2XGOA 4NMWA 3ED5A 4DNFA 4WNAA 5CG1A 1BA3A 2FWRA 2DTDA 1H85A 5EJ8A 2J0QA 1E1RA 3UJ3X 5J43A 1UZMA 5L7YA 4DVGA 1K2VN 2RHTA 1Z0DA 4RQ6A 4FEYA 5ALDA 2P65A 2EBFX 1H1DA 1SKYE 1I36A 1FNNA 4BGDA 2KJ9A 2OV8A 1RLJA 3ER8A 2WB2A 1Z8HA 4P0QB 3O9VA 3BCSA 4FSDA 4LIPD 3B9QA 2MRLA 4EYGA 4R8SA 2FNAA 3BMQB 4BX3A 5BVGB 3M83A 4YJHB 2Z1DA 5KT4A 5HKOA 5ADVA 1R6XA 5JANA 3W5DA 1A7JA 1RM4A 3DMGA 1ZI8A 1TJ5A 2PK3A 4JUDX 3E82A 1PKEA 2C99A 1U9IA 5SYNA 1GIAA 4ZN6A 1ISFA 4N48A 1JAIA 1U28A 4HWRA 4KQGA 1L3IA 2WJAA 3DSRA 2J08A 3JQ8A 2FZKA 4G1BA 5A03A 1HYGA 4U2FA 5FA6A 1X9WA 3RC3A 3RC2A 2VHTA 1QO0D 3A05A 3MUFA 2PX6A 4FSHA 4J16A 4QQKA 4X20B 5HW0A 3TFRA 4X6XA 2OGSA 4KKVA 1P1JA 3NBMA 5LYJA 5KCZA 2P3OA 3DWIA 5KHLB 4FLMA 2VF2A 3BTVA 1LI4A 4D96A 3VX3A 5C7YA 3N28A 2PLNA 3GR6A 3S55A 1SD5A 1DC7A 4NULA 4RQ5A 1U5BA 2NU9A 1U02A 3AETB 5FXMA 2DPGA 4UVGA 3IUBA 3R7WB 3IMKA 3RIEA 3CGWA 2Z57A 1LFAA 2G9NA 3T3PB 1N6RA 4HXFB 5HM6A 2R6ZA 2HFKA 2BT4A 4FEGA 2R79A 4KBYA 4BEBA 1RYZA 4RPXA 1RRKA 3JASB 5AJYA 1CLUA 4WN9A 1IOZA 7ICGA 2NWQA 3SIWA 4NBSA 1UANA 4L95C 3FCXA 1ZJ5A 2WVHA 3CMMA 3LQKA 3L0IB 9ICAA 4AWXA 4JXXA 1XSLA 3FE2A 5HSGA 1FS6A 2QSYA 1T9DA 1B8OA 5IKMA 4ZREA 1N3BA 4IYRA 3JTMA 1QC5A 3DBLB 4J9VA 5HHTA 4HWGA 1EK2A 4DHWA 1FX0B 2DPHA 4EGJA 1JEEA 2KSOB 3N53A 3KM0A 4K8RB 1TF5A 2W4QA 2EEPA 5U1PA 3HI6A 3O0TA 4FOLA 4EUEA 3IV6A 3IEUA 4R1TA 1CJMA 2X8LA 4K6OA 5EIXA 1M8FA 2HPAA 4I14A 4OXIA 4XR4A 2KIWA 5HF9A 1FRFS 2ASLA 2WE8A 2QR5A 3PY8A 4I3GA 3IAXA 5FJJA 4F2RA 3F73A 1UPXA 1QRDA 5CCEA 4B17A 4F3RA 3QKRA 3OM9A 4HAIA 2WYWA 5H0IA 1E8DA 3IHWA 3R74A 3JARA 2FDXA 4KAXA 1QYWA 3EPPA 3DPIA 1G7RA 1JR3D 3FDJA 4JIMA 2B37A 4UAVA 3NOXA 4CL3A 4GYKA 3H4MA 1VE3A 2JHCA 4URZR 1LBEA 2JJQA 1RZRD 1X86B 5KFQA 4LRWA 3B53X 2IC5A 1HEIA 3OOYA 4NP6A 4JOSA 4JCOA 2OP0A 1L3TA 3DKRA 5I7SA 2O2HA 2I8AA 2P0YA 1HFWA 4QXMA 5I01A 3EGDB 5ULLA 2Q9AA 2ZS8A 4XX1A 3C8MA 1IB6A 3LWDA 3FPJA 3COJA 2AD5A 2WF7A 1RLOA 2Q3MA 4IIVA 4AJNA 1A4UA 2IYOA 3EQ9A 3OQMA 3UJ9A 1VMEA 4D3DA 4JV1A 2XVMA 2J0VA 2GXAA 4G97A 5CA1F 4R7TA 2WF6A 3AHCA 3GJ0A 3CFYA 3OTHA 2AK3A 3TOCA 1IXSB 1JFSA 1VZ3A 2QRQA 2GJ9A 3H5LA 1Z29A 2AOTB 2X0RA 3UUEA 3W78A 5DHPA 1W7AA 2YIVX 4L76A 3FVTA 3LBYA 1K7EB 3SBOA 1AKMA 4OJMX 4CIWA 2J30A 3NH9A 4B7CA 4EB6B 1YI0A 3CZPA 5AT1A 2X7XA 3U3OA 3QWBA 3U4CA 4EUSA 3UAGA 3DM5A 3NB0A 3LUFA 4XIGS 4G65A 1RI4A 3WKBA 3KDPA 3X1XA 2VUIB 2LM1A 4LZOA 1VGRA 2V4UA 3WIBA 2PUJA 4E6PA 1ZQPA 3FOWA 2ZRGA 2P68A 1NZJA 3DQZA 4R4JA 4OBWA 4FFNA 4QXRA 3F78A 1HNZB 4MA0A 3SJ7A 3IOCA 4HX5A 4WUVA 2Q3FA 2OLEA 2IYUA 1YVDA 3T3MB 5IN5A 1LQ2A 5CIQA 2A30A 3ZCXA 4JKOA 4WFIA 4EELA 2OZLB 3SC2A 4YQZA 4DL2A 4LXYA 3R1IA 3CZAA 2QMOA 1MC1A 4JLAA 4HWTA 1GJRA 4YR0A 3A3KA 3SICE 3MGKA 4TOIA 2QVBA 1I7QB 2QUHA 4B74A 5KNIA 4MROA 2N0SA 1L4HA 1LTQA 5TT1A 4AMYA 5G40A 1UFRA 3GP3A 1KQQA 4LSZA 1A5BB 5KCMA 3MR6A 2W2QA 2V7GA 4ND7A 2V6FA 1NG1A 5LZ4A 3ZWNA 2FW7A 2R6GA 5L3RA 4FOSA 3TRDA 2ZI7A 2VJLA 1GPH1 2C7PA 4DA7A 3OX2A 1YTLA 5LA6F 1FDSA 2ATIA 1KQFA 4DQLA 2VHZA 4FZ3A 2UKDA 3NM6B 2YC4C 4J2TA 1VSBA 5CW2A 2F90A 3C2KA 5DW0A 4LFBB 1QCCA 4WLEA 4MB6A 1RBZA 3QGMA 1CEEA 3PC8C 5EP2A 1CF4A 2WMOB 2UYCA 5BUSA 2FMUA 5AFSA 2C4WA 4B9MA 2CXUA 2QNRA 1M6NA 4ASUD 1EFRD 3A2LA 4KMOB 3O3NB 3DVQX 4Z0HO 2JFBA 2WKWA 3W6OA 1PL6A 2C5GA 1XZCA 1P1BA 4L07A 4KW7A 3U1TA 2OFWA 2RLTA 4GLJA 4DQDA 3EASA 5EZYB 2CHEA 2SCUB 4UE2A 4EL0A 1H6BA 2FUG1 3KSAC 3STVA 4M37A 3JD4A 1P29A 4I4LA 2EJWA 4CI0B 2C82A 2XMZA 4FMCF 2D5IA 2O2CA 3D8HA 4MS3A 3AP3A 5HIKA 4HNAA 1ZZGA 4P98A 4EY3A 4U4AA 2ZSFA 3KQQA 5LN1A 1V45E 3U3MA 1ZAYA 3A6ZA 1H4SA 3FNFA 2QPLA 1ZICA 3FM9A 2E3JA 2QDKA 4YRJA 1JJVA 2V45A 3LJKA 5G1NA 1Z74A 3TB6A 5JJIA 2ENWA 4DRYA 1JGTA 4WKCA 4E1VA 4F12A 4F4CA 1E3WA 1GR0A 4MGKR 3LBIA 3C8UA 3QWHA 1VP3A 5K0JA 4CKEA 3WR5A 4A03A 3CCBA 4FFVA 2YMMA 4M04A 3A4VA 1JXEA 1BAPA 4FGUA 5C51B 3DZGA 1IY0A 3NH6A 1PJTA 3OSPA 3IP1A 1MAAA 4G84A 1WW2A 4CL2A 1L8XA 2H1VA 1G291 1JX6A 3FIUA 1YOBA 3CF0A 1V71A 2HMWA 1F2UB 4RE6A 4A27A 1N5DA 2FZGA 1ZESA 2VJKA 2BZSA 2WPDD 1NOIA 4JXZA 1ZK0A 4JK1A 2YN4A 5ALFA 2GPBA 2PS0A 2GN1A 4KNVA 2WUFA 4KPUB 3K0HA 1N5KA 4EJ0A 4WEOA 4RGBA 3RTEA 2H1OA 2ZITA 1EUDB 3BCRA 4YIHA 1WW3A 1Q19A 1BFKA 1Z4JA 3E8MA 1DL5A 3TJZA 1FDRA 2PGNA 1E2MA 1SL0A 1FMJA 1LLFA 4PLCA 2BBSA 4GUAA 1IONA 3C5WP 4DIEA 3TCKA 4V0LA 4I1IA 4DLAA 5T14A 4FOTA 1GM5A 3H7IA 4DM3A 5EOZA 3QXGA 5DNWA 1R4MA 4R0NA 3HKZF 3CVXA 1VB3A 4UAGA 2XSZD 1NX6A 3KYCA 4DCVA 1GSIA 2PM8A 5FQOA 3PXDA 5A5VA 5ALRA 2RAPA 3HFGA 4OXKA 3ZGNA 1ZETA 5ALOA 1PVDA 4AJHA 1KEPA 4DFPA 2WU0A 3O2SB 3VR5D 2JFUA 1DTWA 2Q0XA 3MAGA 1C41A 4HD8A 5EE5B