2KV2A

Solution structure of the human blm hrdc domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
b'QREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bloom syndrome protein
publication title Structure and function of the regulatory HRDC domain from human Bloom syndrome protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kv2A01
2HBJA 2RHFA 2HBLA 4O3MA 1YT3A 2KV2A 3SAHA 4CGZA 4NLBA 4QIWF 2CPRA 2MA1A 4QJFB 2DGZA 1WUDA 4CDGA 1D8BA 1GO3F 4OO1J 5C0YA 2HBKA 2E1FA 2E1EA 3CYMA 4NLCA 3SAFA 2HBMA 3SAGA 2RRDA
chains in the Genus database with same CATH superfamily
4QZCA 1Z00A 1BNOA 1FIQA 1JRPA 4UBBA 1OXJA 4LVSA 1ZQ1C 3OHAA 3OJSA 3AEVA 7ICFA 2JH1A 1ZQDA 2KHQA 2W04A 1X9SA 2KKVA 4K4HA 4DL5A 1V38A 2BQUA 1NK6A 2F8LA 4OCZA 3PX4A 3EYZA 5L1JA 1RYSA 2DFLA 2DF4B 3E2EA 4RNOA 4NLNA 1H38A 2XVTA 4XA5A 4Y2XA 4F8RA 4QWEA 2I1QA 3QEBZ 3H8MA 1BNPA 1SL2A 2HDOA 5B66U 5DDMA 4U7CA 3QUBA 2K4PA 9ICTA 3KBBA 4F72A 3UM9A 2YQEA 2BQRA 4UB1A 4RQ4A 3KD3A 1QQ6A 1XO1A 2HHTA 5DLFA 2ZIUA 4M9GA 5KFUA 5CRXA 2VJ5A 4NLBA 3MGHA 2JHDA 3GILA 2J6UA 3I76A 3ZDDA 3WKEA 3N28A 1BPBA 4IQUA 2R8JA 4YR0A 2HHQA 4RQMA 2KSOA 2R18A 2NV3A 4P4OA 1AQ6A 2ZTDA 2KEYA 3TFSA 4CF5A 4PH5A 2UVWA 4O5CA 4KLUA 1XU4A 2V4RA 4DFJA 8ICWA 2ZIVA 2PFOA 5DB6A 2EZXA 1TV9A 2E1FA 5GTHU 4I2CA 4GXIA 5IIMA 1ZD5A 4B9LA 4F4WA 2W9BB 2XC9A 5ALVA 4UAUA 1HUOA 5KG0A 3JPRA 2RDIA 4FBTA 4US9A 3GIIA 4QNLA 4O9MA 3L4PA 4USAA 2F1JA 2ZJ5A 4NLGA 3TADA 4RQ8A 2NRTA 2BGWA 9ICCA 4JB3A 2ASLA 4DQRA 4BUGA 5AM5A 4BXOB 1ZRNA 5KFPA 4ECQA 4JV0A 4YCXA 1NK4A 3BQ7A 3L5KA 4C0ZA 5KFVA 1NI3A 1OW5A 1ZQLA 8ICRA 1Q46A 3WK4A 2K60A 4JV1A 3S6JA 1L3SA 1ZQMA 4RPXA 1O08A 1S0MA 5ALEA 4YN4A 2H3ZA 2MA1A 3BZCA 3M6ZA 4AYBF 3IV6A 2W9CA 3H0RB 1Z1VA 5KG7A 2G07A 4I2DA 1UPHA 1NJWA 5J2GA 1XSLA 1S5LU 4C8OA 3HW8A 5IIJA 3PZPA 1UT5A 2E8PA 3U26A 2OEHA 1RG6A 3AQFA 5L1MA 1NK0A 5AKEA 1B43A 1HEKA 2AU0A 4RQ7A 2XO7A 4ED3A 9ICWA 2F77X 3NGDA 3QU4A 3SAFA 2UVUA 2KN7A 2RQ5A 3ALRA 1LKYA 2NRWA 3RH6A 2ASJA 2HOFA 5AK4A 2KNJA 3WKAA 2IBKA 4AP9A 1IIPA 3HX0A 3UMBA 1MQ3A 5EOZA 5J2DA 4DWIA 5F3XB 3SEIA 4DOCA 5ALLA 2HBMA 1L8OA 1L7OA 3LVVA 3AQEA 3I28A 5J2CA 2XCPA 9ICMA 1SL1A 2H3FA 1BPZA 2F3NA 4UW9A 2FDRA 5AM3A 1ZQBA 1UQVA 5HP4A 4PJ0U 4OJ6A 1TE2A 4FO6A 2VIXA 1QSSA 4YFKA 3THVA 4P0PB 3PW7A 2LM1A 3TANA 5DB7A 3NRZA 3K4GA 3M1YA 4NM1A 4UB5A 7ICPA 1TAMA 2ATLA 3KHRA 4QIWF 4KX5A 5D49A 3B9JA 4KMUA 3RB4A 3KHHA 4C7ZA 1WG8A 3HP6A 4BWMA 1ZQWA 1HIWA 3QUCA 4ICAA 5DDYA 2D6FC 9ICGA 2P35A 4F4YA 1HUZA 4P0QA 2W7PA 4F5OA 3Q8PB 4RQ2A 5ALUA 3Q8QB 3OSNA 4TUSA 2B6GA 2YB1A 4MF2A 3TADC 2ZTEA 3PNCA 5AK5A 4NL9C 4PZNA 1ZQSA 2NRZA 4R65A 4YXJA 3H4DA 5J0YA 1F0MA 1S97A 1Z1BA 4RNMA 2BPGA 3WU2U 1BPEA 3IHQB 4UB4A 1UCVA 4DEZA 4RPYA 1YZ7A 4OJLA 1DRGA 3CW2C 2FPMA 4UAWA 3IDWA 1CRXA 1S9FA 3A0BU 7ICVA 2EAOA 3D2SA 4TQSA 1ZQVA 3RJJA 1SV0C 2W43A 3GFKB 4DSEA 5J2EA 3Q8SB 3FAHA 3ZDEA 1Q8KA 3VCBA 1P7DA 3ZD8A 2QB0B 3KHGA 4IR9A 3E0FA 3PO5A 4RQ5A 4MFAA 5L1IA 2J6TA 5J2HA 4M04A 1D8LA 1S0NA 5KFZA 3F2BA 3BJYA 3I1YA 1Z00B 4M47A 1C20A 4WJ3B 3EPIA 1SWWA 4Q8EA 3HILA 1KW4A 2FPKA 4P4MA 4B9UA 4F50A 3ISCA 3MBYA 3SV4A 2JEFA 4Y2QA 2KZMA 2ESEA 4EYIB 1N62A 2W9MA 5J8YA 1RQLA 4KLDA 3N97B 4ECTA 2H5XA 2E3TA 3KZXA 1MN8A 2PMZC 4O0IA 1T4GA 2F44A 3QU2A 2MUTA 3JPOA 4J9QA 3RJHA 4RUCA 4XQ8A 4ELVA 8ICQA 1NK7A 4E0DA 2ZIWB 4DSLA 5KFQA 4EYHB 4KLHA 4KX3A 5ALPA 2DKZA 5KT7A 3V7KA 2KJ9A 2LYAA 3H8SA 5AKIA 3SAHA 1NNLA 4NXZA 1ZQRA 1L3VA 2KFZA 5JTIA 3PX0A 4B6JA 2FPLA 5ALTA 3JPNA 3K1RB 2UVRA 2P6UA 3NASA 3LDAA 2F1IA 2FMSA 5JU5A 3KTQA 2E8OA 4QW8A 4RQ6A 5KFYA 1X42A 4PHEA 1L5UA 1NZBA 2G09A 4PGYA 1MA7A 2OHFA 5ALFA 3T5HA 3V6HA 3HPOA 1KFDA 5J0PA 4GC7A 2VA8A 2WTFA 3FYHA 4M0AA 2WB1F 4M2YA 3RJIA 4LJXA 2DBYA 8ICZA 1U45A 1PK1A 8ICUA 3UMCA 7ICJA 3RAQA 2BDUA 2ZIVB 3QZ8A 2AJQA 1XSPA 1D8YA 4R64A 4JWNA 1YZ6A 3RJEA 2OCEA 1JXEA 2F2AB 1ZQOA 2DWQA 1ZJMA 4QZAA 5ALSA 1N5XA 7ICGA 3OJUA 3H7IA 5ALWA 2VJ4A 2JZBB 1Z4NA 4B9MA 2B21A 3IRUA 3SENA 3SAGA 4FZMA 4EEYA 9ICKA 4DL7A 2A3VA 3M7DA 2LBOA 1U49A 1KSPA 1VJ5A 3G6VA 2H3IA 2HHXA 4OJPA 3ONNA 3ISDA 2ZJAA 5HR6A 2LKYA 7ICUA 3MGVA 1ZQZA 3F2CA 4YVZA 2ZTCA 3Q8LA 3TACB 3BS5A 2RHFA 4GC6A 2PFQA 3KKAA 8ICAA 8ICPA 2IHNA 4QJFB 3PMNA 4R66A 1ZRMA 4IC9A 5A0LA 2OWOA 3DEEA 5KFFA 4DQQA 4FZLA 2EAPA 3IG5A 1NKCA 3EZ5A 3RRGA 5J8YC 2JV3A 5EE1A 1T8EA 4J9RA 2EH9A 2CXYA 1LV5A 4YR2A 5AM2A 4UASA 2GH1A 1IG6A 5DKWA 1L6NA 3ED5A 3SD7A 3HKZC 7ICQA 4EENA 4GIBA 5AHXA 4BJQA 3SYZA 4Y2RA 4PL2A 2YMPA 2K4IA 3EWAA 4DSKA 2BR0A 5E79U 3GV5B 4DL3A 2YMMA 2R8HA 2V4QA 4M9LA 5IIIA 3V7LA 4RT2A 9ICOA 1QQ5A 2HHVA 2AXTU 1ZQQA 4PGXA 2P66A 4F2SA 5DG9A 5EE0A 5CP2A 3OSPA 2JH7A 1SIJA 2BCQA 4R63A 2P6RA 1X6IA 4O3PA 4QZ9A 5L1LA 8ICBA 3GV7B 4UAVA 4Y2SA 2W7OA 3GDXA 1ZQPA 4JWMA 1S0VA 4J9NA 2ZXIA 3BQTA 2H3QA 3Q8KA 4KMOB 2WAQC 1K1QA 3PMLA 5J0UA 2KKPA 3N7RC 5CWRA 4KLFA 2BPFA 2CRXA 1ECWA 1K5OA 3C29A 1UHUA 5CHGA 1V85A 5DG7A 7ICIA 4KLGA 2Y1JA 1COKA 5AKXA 4I27A 4CF4A 2VKQA 4EBDA 1JROA 8ICEA 2HVHA 4DCCA 4QZFA 5ALRA 2XI9A 3M9MB 5L9XA 1XS9D 3C1YA 4IQVA 1RYUA 2Y9UA 7ICEA 2W3SA 3TARA 2E8NA 4I2JA 1TK8A 1NJYA 2MU2A 3GIMA 3KOOA 2MRLA 5IIOA 2VA2A 1LVHA 1WWUA 2XIDA 4DO9A 9ICJA 2ES6A 3HWTA 5CEHA 1N2XA 4JV2A 4NV0A 2HBJA 3KKAC 1SKRA 8ICOA 4FZNA 3T5KA 4C4TA 3UMGA 3KHLA 1ZQCA 4I2EA 5KAFU 4FFDA 3QE9Y 3NVVA 9ICLA 8ICYA 4NJ8A 1XNSA 4DFMA 1A6SA 2WF6A 5ALIA 4C8NA 4I2FA 1FFUA 4Y2UA 2BZFA 3SQIA 3CP8A 4BWJA 2WF8A 4TQRA 4IQTA 1Z19A 2IMWP 3MR2A 2JRZA 1WUDA 4TUQA 4IRDA 5G5HA 4UB2A 1Z3EB 1ZOLA 5DB8A 5J0WA 2W03A 2YMLA 7ICNA 2G5IB 1FFVA 3JPQA 2AH5A 2NRXA 4C8KA 4DFPA 2FMQA 4Y2VA 3MR3A 2PI4A 2ZXHA 5KFTA 3IN5A 4JUZA 3GU3A 4YD2A 4KLEA 4EZ6A 1N56A 5KFEA 4QWAA 3RAXA 2FLLA 1Q3VA 2XY6A 3UXPA 3K1ZA 5D46A 3UQ2A 7ICOA 4DQPA 2PI5A 1RQNA 2MUTB 3QX7A 1SZHA 5KFSA 4RQNA 1F5SA 2PKEA 1KBUA 1B22A 1U48A 2XY5A 3CNHA 4MFCA 2PFPA 3IG8A 2YB4A 3M9OB 4RZRA 1J2NA 3C28A 3RBDA 4XUSA 4MEXA 9ICUA 2XY7A 2KMDA 4O5KA 2HOIA 4R8UB 5AI6A 4ELUA 2KTQA 3QU7A 2YY6A 5KTQA 1L7NA 3A0HU 4M6WB 3V6JA 2YX8A 4DFKA 3F5EA 5TZVA 4QZBA 3PW4A 2KD1A 2R8KA 2EZZA 2KIWA 2ZUBA 1HJPA 2C2DA 2I9GA 2K8AA 2QARB 1SZPA 1X9WA 3TI0A 5KG1A 1PZNA 9ICHA 3M6KA 2ZJ8A 3V7JA 1V97A 2B0CA 1B0XA 1QSYA 1X9MA 4RUAA 4TUPA 2FLNA 5EWEA 3N7SC 4ED7A 3T5JA 5KFHA 4F4KA 4IL6U 1NJXA 2ZUCA 2W8KA 3Q8MA 2ZUDA 5AKYA 2G06A 5ALQA 4IRCA 2W11A 3H4BA 8ICMA 1PVQA 1A0PA 3BQ1A 2QB1A 2WF7A 3WK8A 1KFSA 3BS5B 2KG5A 4DL6A 2YTUA 4DSJA 3ISBA 1ZQAA 2NRVA 2Q0ZX 3AUOA 1ZETA 3NRWA 4BDPA 1DGJA 2ZIXA 3H0MB 2K8BB 3MFIA 4DLGA 4QWBA 4MEYA 4G3IA 2G5HB 1S0OA 1QSLA 7ICTA 1LB2B 4Z6DA 3PR4A 1BPDA 4UQGA 3RBEA 3DV9A 3OHBA 1NJZA 3SI8A 2W9BA 4YMOA 2JR5A 1L7PA 5DQIA 3QUTA 3FDSA 5J0TA 1SL0A 4GLXA 2XGPA 2WFAA 2W3RA 2HHUA 2G0AA 2AQ4A 4LZGA 2KV2A 4TURA 3QNMA 5EE9A 3HKZF 5ALMA 3ZDBA 4AYBC 3TKAA 4M9HA 4ACOA 2Y0SF 4YQWA 1ZQYA 1IV8A 1TK5A 1CEZA 4NY8A 4F5PA 1N48A 2K4EA 2A19A 3M9NB 1L8LA 5AKJA 5DQGA 3C2LA 1BVSA 3RJKA 2KP7A 3OTQA 2KZZA 4Y2YA 3AN1A 3PW0A 1D9DA 4Q44A 1JMSA 3C2KA 3T5LA 1S8OA 3KFUF 2NO4A 3LWMA 1NZPA 3N7PD 3EW9A 1JXLA 5BPCA 1DGSA 3RFAA 3HT3A 1X6JA 2Q4TA 4F91B 2ZIUB 5EE3A 1U4BA 5FP0A 2WAQF 1JX4A 5AI0A 2F8KA 5D4BA 3D6JA 2EAMA 4DSIA 1B4FA 2IOHA 3E58A 4OJ5A 4O3QA 5AM1A 2KSOB 1N5WA 5J2AA 1RXVA 2FJ6A 2C28A 2KE7A 3MR5A 2HHSA 4PL1A 3TFRA 4O5EA 3WKCA 3WKDA 4EX7A 5J0QA 4EBEA 4J9KA 1BPYA 4F5NA 4ECVA 3OPXA 7ICMA 1Y88A 1OUQA 5KFCA 8ICTA 3WK9A 4C7YA 4UARA 4QIWC 3RRHA 5L1KA 4ECRA 4CCHA 2QKQA 1DXSA 2Y9TA 4C8LA 5HHIA 1GO3F 4P0PA 1NK8A 1ZQNA 5AK3A 1ZQKA 3WKBA 4HYKA 9ICSA 3AU2A 2IOFA 4O3OA 4NM2A 5DBBA 2W54A 4U6PA 3RH5A 4DL4A 2RRDA 3PSPA 3H8JA 4MHVA 2BCRA 4KLSA 1JALA 1PUZA 3QXGA 2LPEA 4B9VA 2CN1A 4FE3A 4G9BA 4QZEA 1FO4A 1C7YA 3T3FA 2W9CB 1JIHA 4PPXA 5KT4A 3RB6A 5CA7A 5J0SA 4B9TA 3D2QA 1TAUA 1A76A 9ICFA 2H3VA 5ALJA 1N60A 5IINA 3RH4A 2AGPA 5AKLA 4P4PA 2A1AA 4J03A 2A1JA 5CJ7A 1RXWA 3QU9A 1UA0A 3GZFA 1Z4OA 2BHNA 2JGAA 2JEIA 1X40A 1BPXA 2KHVA 1KEJA 1LKYB 2WHEA 4KLJA 2DPJA 5J2KA 1SWVA 1CUKA 4QZ8A 4F5QA 4I2GA 3NVZA 5DGAA 4K4GA 9ICVA 1SXDA 1QH9A 4DF4A 3V6KA 4CGZA 4C4RA 4B9SA 3MDCA 3J81j 5HNKA 4KLQA 1M6YA 2QB0A 2GWSA 3H0LB 2QLTA 2KVCA 4KLLA 5KG4A 1SXEA 4Y2PA 5ALGA 2PFNA 1ZQJA 8ICKA 4FS1A 7ICHA 5KFLA 2XGQA 2F76X 3JPPA 2OYYA 3LVWA 5KT2A 4O3SA 4O3RA 1SKSA 4RNNA 4Z6EA 5HMLA 4J9MA 2YMQA 1NK9A 2HVIA 5KG5A 4RU9A 5AKKA 4DOAA 4P2HA 1JI7A 1BGXT 3ZD9A 3QUQA 3F5AA 3MFHA 3F53A 5KFGA 3QZ7A 8ICHA 3PW2A 3RB3A 5AICA 4QWCA 5H2FU 3PO4A 4UBCA 4EX6A 4M9NA 3AM9A 3V72A 3CRXA 1ZQFA 2ALZA 1DOQA 4KN7A 9ICQA 5AM0A 3MR6A 4ECZA 4JK1A 1T3NA 5KFDA 1ZYQA 4IR1A 4P0QB 1TAQA 2JEJA 5ALOA 1ZQIA 1UT8A 5KFMA 5KFKA 3PV8A 2LYBA 2ZIWA 1ZQXA 5AKZA 4RT3A 4KLTA 1ZD4A 4BGDA 5J0RA 4F2RA 8ICGA 2HW3A 3IP4B 1NKBA 2DL0A 1WYGA 4EELA 3PSFA 5HR7A 3D2NA 2VA3A 4EEKA 2EQYA 2WB1C 4KTQA 3RJFA 8ICFA 1VDVA 1D9FA 4F5RA 5KFRA 1A77A 5KFXA 5DQHA 3BQ2A 5C5JA 2IHMA 2BDPA 1O03A 1QTMA 4KN4A 4RQ0A 2ZIXB 4ZH4A 5AKGA 3JPSA 8ICLA 4DSFA 2CPRA 4J9OA 2BCVA 1MC8A 4M9JA 5KG2A 1KKXA 3N4MB 1XWLA 2M0NA 4QZDA 4YMNA 4KLIA 4MF8A 5KAIU 3FM9A 1T3QA 4CE6A 3B0XA 3JPTA 1UA1A 3UPQA 9ICBA 4XRHA 2D8CA 2BCUA 9ICEA 1JUDA 3WK6A 2JMGA 5KFBA 3B0YA 3C5GA 4ED1A 4B9NA 2JZBA 4NL9A 2ODGA 3AMZA 5J2IA 5ALKA 2ZG6A 2Y1IA 2KZ3A 5K4LA 2E8MA 4QZGA 5DB9A 4Q45A 1Q3UA 2HOQA 3ZI4A 4MFFA 5GTIU 2JEGA 9ICIA 4YD1A 1J97A 1KTQA 5KL8B 1D8BA 1QCKA 2LHTA 1ZQEA 3PW5A 2FLPA 2N1RA 3ICXA 4NLKA 2W9AA 2KICA 2LYHA 1ZQUA 2HSZA 3PVXA 4I2AA 3ORYA 1SV0A 2EANA 3H8WA 1PK3A 5KT6A 8ICIA 2KIVA 2DUYA 5B5EU 2LM4A 2PMZF 4EZ9A 4PHPA 1TVAA 3LK9A 2F1HA 1MQ2A 3HJEA 2E1EA 2O6KA 2FE9A 3ZDAA 2ASDA 1ZQGA 2LI6A 4KLOA 5AM4A 1VLBA 2E5SA 4IRKA 5J2BA 4YMMA 1QLNA 2BCSA 5JUMA 3L3FX 4J9PA 4IQWA 4J9SA 1RDFA 3MC1A 4US8A 4DS5A 7ICRA 4DOBA 5J0XA 1FEZA 1SV4A 2C22A 1PVRA 5ALYA 4UB3A 5AK6A 1PK1B 3G6XA 5ALDA 2XICA 4O3NA 3UXOA 5DLGA 5KFJA 3PSTA 9ICPA 3BDPA 2MSNA 4J9LA 1JN3A 4ELTA 1KFTA 3EPGA 2EDUA 1NKEA 2NO5A 5AI4A 1ED1A 4CDGA 3UXNA 3QYPA 5IIKA 5AIBA 1V9PA 1EXNA 2KJ5A 5ALNA 4I28A 5TISU 4QW9A 3C5FA 4JMUA 2AGOA 2GLEA 4UAYA 3AL0B 4YXMA 4Q8FA 3ETRA 2I6XA 2W8LA 1KN5A 3TQ1A 3VC8A 4A8EA 4LZDA 4Y2JA 7ICSA 2R8GA 4K4IA 5KG6A 5KNIA 2RLTA 2BQ3A 1L3TA 2K8CB 3MABA 5KFIA 2ISOA 5KFNA 1COOA 2G08A 2MAXA 3RR7A 1N63A 2HBKA 1S77D 4QWDA 1U47A 1ZQHA 5DBAA 3RJGA 1X9XA 2A1JB 5KFWA 1U9LA 3AU6A 2KOBA 3C21A 4F92B 3EUB2 1KRPA 2KJ8A 3O0FA 8ICSA 9ICNA 2KFNA 2UVVA 4YP3A 4PHAA 4CNQA 4C8MA 2GOLA 2C2EA 2L5YA 5J0OA 1QQ7A 1ZD3A 5ALHA 4F4ZA 3LWLA 5DBCA 2AHOB 3KZIU 2IOFK 5J29A 3BQ0A 5J2JA 3T79A 2HCFA 3C2MA 2OM6A 5CR0A 3NUQA 1URJA 4DLEA 3MDAA 1NK5A 2D3DA 5KFAA 4ECYA 4PHDA 5EWFA 1TKDA 3GIKA 9ICRA 4BXOA 3C23A 5EWGA 4CF3A 5AIAA 3SMVA 1L7MA 1AROP 3WK7A 1T7PA 4F4XA 3RB0A 3GQCA 2RDJA 2BPCA 1X2IA 4KLMA 3M8SA 1J2MA 2FI1A 3H40A 2LMRA 3NS1A 4ECXA 4Z6CA 1RZTA 4YG2A 2GO7A 1ZJNA 5BOMA 8ICJA 3NVYA 4PZOA 3BZKA 2W55A 3SV3A 5BOLA 4ED0A 4ECUA 2DQNB 1K1SA 3RR8A 3M8RA 4DS4A 3NTUA 5G5GA 3TAPA 4FBUA 1YT3A 4ED8A 1XC9A 3Q8RB 4HAIA 3TAQA 4YR3A 3PX6A 5KT5A 2HI0A 1KQQA 9ICAA 3DDHA 3GIJA 4OJOA 5KG3A 4KITB 2K89A 3BS7A 1T94A 2HBLA 1X66A 3K75D 1DK3A 4RQ1A 1F44A 1CI4A 5DGBA 2C2RA 4GXKA 5HHHA 2KVSA 5C0YA 1RYRA 2WF9A 4FS2A 4ZOHC 1TFRA 4RPZA 9ICXA 1SGGA 4NLCA 5T14A 4CRXA 1NOMA 3FC4A 1MSWD 1TK0A 4UATA 4R8UA 4NLZA 3PR5B 2YN4A 3WK5A 1ZXIA 2M9NA 5KT3A 3R9KA 3OGUA 1S76D 4M6WA 8ICXA 1PVPA 2DGZA 5IILA 3NVWA 1RPLA 2WF5A 5ALZA 2I5HA 4EBCA 2RP5A 4I2BA 5KFOA 3IM1A 5F9LA 4I2IA 3RTVA 4F93B 4DFDA 3PSIA 4F71A 4OD0A 2QARA 4ECWA 1ZQTA 1IXRA 4PGQA 5HMMA 2VANA 4GFJA 4I29A 5DG8A 4C80A 1IM4A 3CYMA 2EZYA 2K4HA 4BX9C 5J2FA 4UAZA 1DK2A 2OXOA 4GXJA 2NYVA 2AGQA 3SZ2A 7ICLA 1RM6C 5AI8A 5F9NA 1KDHA 1KL9A 2Z7JA 3LYSA 4ED6A 4Y2TA 4DQIA 3PY8A 4X5VA 2BKEA 2XCAA 2DKXA 4IS7A 4RQ3A 1WCLA 4QZHA 3C1ZA 4Q43A 4ECSA 4UB6U 7ICKA 2FMPA 4F3OA 1SB3C 4NWIA 3ZDCA 3ETLA 1ZD2P 2JXJA 2IA6A 3MGIA 4OO1J 2R8IA 1N61A 2HMXA 1KLNA 3HRDD 5AI5A 2OH2A 4I2HA 2AQ0A 5JRTA 5CB1A 3SR6A 3G6YA 4C4SA 4DQSA 1L3UA 4DL2A 4O3MA 3F2DA 1SKWA 2KK0A 3GV8B 4DF8A 5AI9A 3RF9A 1XO0A 4QZIA 2DPIA 4UB8U 2Y0SC 1WWVA 2HHWA 1S10A 4Z6FA 2J6SA 2PXIA 5AKHA 5KL1B 4ED2A 3UQ0A 3QEAZ 3QU5A 8ICCA 5ALXA 1XSNA 2ISPA 8ICVA 2V9WA 8ICNA 1WCNA
chains in the Genus database with same CATH topology
1Q3UA 2HOQA 4JMUA 3D2QA 3AL0B 2WB1F 4QNLA 4P0QB 1ZQ1C 3RFAA 2H3FA 2GH1A 2H3VA 1L6NA 2Q4TA 3HKZC 1KBUA 2JH1A 2ZIUB 3VCBA 3NRWA 2KHQA 2W04A 5KL8B 1P7DA 4BJQA 2KKVA 2LYBA 4GFJA 4OJ6A 2WAQF 2ZIWA 1D8BA 2F8LA 4PL2A 3VC8A 4A8EA 2K4IA 2LHTA 4BUGA 3CYMA 3E0FA 3IG8A 2YB4A 2BDUA 2DQNB 2MRLA 2VIXA 2K4HA 2ZIVB 2DF4B 2ZIXA 3H0MB 2K8BB 2XIDA 4BX9C 2N1RA 3C28A 4P0PB 3ICXA 3IP4B 3GZFA 4C0ZA 4OJ5A 2XVTA 4NV0A 2G5HB 2HBJA 2K8CB 2KICA 3PSFA 5HR7A 3D2NA 4FZNA 3F2BA 2HOIA 2OXOA 2JGAA 2WB1C 1YT3A 1TAMA 2KHVA 2G08A 4QIWF 4KX5A 2H3ZA 2MA1A 4WJ3B 3M6ZA 4AYBF 4PL1A 2PMZF 2F2AB 3H0RB 4U7CA 2Z7JA 2G07A 2HBKA 3LYSA 1XNSA 2YX8A 1A6SA 2E1EA 1UPHA 3F5EA 2JH7A 1HIWA 4ICAA 2VJ4A 2KD1A 2D6FC 2KOBA 4OJOA 2E5SA 3SAGA 2K89A 2KIWA 1T94A 2ZIXB 4FZMA 4P0QA 3OPXA 2W7PA 3SQIA 3PZPA 4CGZA 3CP8A 2YB1A 2A3VA 1OUQA 2HBLA 2G0AA 3M7DA 2W7OA 2KJ8A 3O0FA 2LBOA 2ZIUA 2K8AA 3L3FX 5CRXA 2KV2A 1F44A 3KZXA 4QIWC 2VJ5A 2ZXIA 4NLBA 2CPRA 3H0LB 3HKZF 2H3IA 3AQFA 4NWIA 1Z19A 2KVCA 4OJPA 2H3QA 2JHDA 3ONNA 4AYBC 1WUDA 2PMZC 4KMOB 5HR6A 4P0PA 2LKYA 1GO3F 2GOLA 1HEKA 4OO1J 2WAQC 4ACOA 3MGVA 2M0NA 5C0YA 3F2CA 2Y0SF 1PVRA 4NLCA 2HMXA 2F77X 3M6KA 2W03A 2OH2A 2KKPA 5T14A 2G5IB 3N7RC 2F76X 2ZIWB 3SAFA 2OYYA 3LVWA 4CRXA 4KX3A 2XICA 4U6PA 1Z1BA 2R18A 3T79A 2K4EA 2NV3A 3ALRA 2RRDA 3PSTA 2OM6A 2KJ9A 2RHFA 2JMGA 2LYAA 2CRXA 3PSPA 1ECWA 2HOFA 3NUQA 4O3MA 1URJA 3C29A 2ZXHA 3F2DA 3N7SC 2KEYA 2KNJA 3SAHA 3IN5A 4OJLA 3GU3A 1IIPA 3RF9A 1XO0A 1PVPA 4QJFB 2DGZA 1DRGA 3F5AA 3F53A 4CDGA 1ED1A 2ZIVA 4IC9A 5A0LA 2Y0SC 2VKQA 3DEEA 1Q3VA 2CN1A 2E1FA 2RP5A 4FE3A 3SMVA 4FZLA 2KJ5A 3K1ZA 1CRXA 3KFUF 2ZG6A 2G06A 3IG5A 5KL1B 1NZBA 3CRXA 2G09A 1MA7A 2HBMA 2XI9A 1SZHA 3PSIA 3N7PD 3LVVA 1PVQA 3D2SA 1A0PA 3AQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBJ A;  2RHF A;  2HBL A;  4O3M A;  1YT3 A;  2KV2 A;  3SAH A;  4CGZ A;  4NLB A;  4QIW F;  2CPR A;  2MA1 A;  4QJF B;  2DGZ A;  1WUD A;  4CDG A;  1D8B A;  1GO3 F;  4OO1 J;  5C0Y A;  2HBK A;  2E1F A;  2E1E A;  3CYM A;  4NLC A;  3SAF A;  2HBM A;  3SAG A;  2RRD A; 
#chains in the Genus database with same CATH topology
 4QZC A;  1Z00 A;  1BNO A;  1FIQ A;  1JRP A;  4UBB A;  1OXJ A;  4LVS A;  1ZQ1 C;  3OHA A;  3OJS A;  3AEV A;  7ICF A;  2JH1 A;  1ZQD A;  2KHQ A;  2W04 A;  1X9S A;  2KKV A;  4K4H A;  4DL5 A;  1V38 A;  2BQU A;  1NK6 A;  2F8L A;  4OCZ A;  3PX4 A;  3EYZ A;  5L1J A;  1RYS A;  2DFL A;  2DF4 B;  3E2E A;  4RNO A;  4NLN A;  1H38 A;  2XVT A;  4XA5 A;  4Y2X A;  4F8R A;  4QWE A;  2I1Q A;  3QEB Z;  3H8M A;  1BNP A;  1SL2 A;  2HDO A;  5B66 U;  5DDM A;  4U7C A;  3QUB A;  2K4P A;  9ICT A;  3KBB A;  4F72 A;  3UM9 A;  2YQE A;  2BQR A;  4UB1 A;  4RQ4 A;  3KD3 A;  1QQ6 A;  1XO1 A;  2HHT A;  5DLF A;  2ZIU A;  4M9G A;  5KFU A;  5CRX A;  2VJ5 A;  4NLB A;  3MGH A;  2JHD A;  3GIL A;  2J6U A;  3I76 A;  3ZDD A;  3WKE A;  3N28 A;  1BPB A;  4IQU A;  2R8J A;  4YR0 A;  2HHQ A;  4RQM A;  2KSO A;  2R18 A;  2NV3 A;  4P4O A;  1AQ6 A;  2ZTD A;  2KEY A;  3TFS A;  4CF5 A;  4PH5 A;  2UVW A;  4O5C A;  4KLU A;  1XU4 A;  2V4R A;  4DFJ A;  8ICW A;  2ZIV A;  2PFO A;  5DB6 A;  2EZX A;  1TV9 A;  2E1F A;  5GTH U;  4I2C A;  4GXI A;  5IIM A;  1ZD5 A;  4B9L A;  4F4W A;  2W9B B;  2XC9 A;  5ALV A;  4UAU A;  1HUO A;  5KG0 A;  3JPR A;  2RDI A;  4FBT A;  4US9 A;  3GII A;  4QNL A;  4O9M A;  3L4P A;  4USA A;  2F1J A;  2ZJ5 A;  4NLG A;  3TAD A;  4RQ8 A;  2NRT A;  2BGW A;  9ICC A;  4JB3 A;  2ASL A;  4DQR A;  4BUG A;  5AM5 A;  4BXO B;  1ZRN A;  5KFP A;  4ECQ A;  4JV0 A;  4YCX A;  1NK4 A;  3BQ7 A;  3L5K A;  4C0Z A;  5KFV A;  1NI3 A;  1OW5 A;  1ZQL A;  8ICR A;  1Q46 A;  3WK4 A;  2K60 A;  4JV1 A;  3S6J A;  1L3S A;  1ZQM A;  4RPX A;  1O08 A;  1S0M A;  5ALE A;  4YN4 A;  2H3Z A;  2MA1 A;  3BZC A;  3M6Z A;  4AYB F;  3IV6 A;  2W9C A;  3H0R B;  1Z1V A;  5KG7 A;  2G07 A;  4I2D A;  1UPH A;  1NJW A;  5J2G A;  1XSL A;  1S5L U;  4C8O A;  3HW8 A;  5IIJ A;  3PZP A;  1UT5 A;  2E8P A;  3U26 A;  2OEH A;  1RG6 A;  3AQF A;  5L1M A;  1NK0 A;  5AKE A;  1B43 A;  1HEK A;  2AU0 A;  4RQ7 A;  2XO7 A;  4ED3 A;  9ICW A;  2F77 X;  3NGD A;  3QU4 A;  3SAF A;  2UVU A;  2KN7 A;  2RQ5 A;  3ALR A;  1LKY A;  2NRW A;  3RH6 A;  2ASJ A;  2HOF A;  5AK4 A;  2KNJ A;  3WKA A;  2IBK A;  4AP9 A;  1IIP A;  3HX0 A;  3UMB A;  1MQ3 A;  5EOZ A;  5J2D A;  4DWI A;  5F3X B;  3SEI A;  4DOC A;  5ALL A;  2HBM A;  1L8O A;  1L7O A;  3LVV A;  3AQE A;  3I28 A;  5J2C A;  2XCP A;  9ICM A;  1SL1 A;  2H3F A;  1BPZ A;  2F3N A;  4UW9 A;  2FDR A;  5AM3 A;  1ZQB A;  1UQV A;  5HP4 A;  4PJ0 U;  4OJ6 A;  1TE2 A;  4FO6 A;  2VIX A;  1QSS A;  4YFK A;  3THV A;  4P0P B;  3PW7 A;  2LM1 A;  3TAN A;  5DB7 A;  3NRZ A;  3K4G A;  3M1Y A;  4NM1 A;  4UB5 A;  7ICP A;  1TAM A;  2ATL A;  3KHR A;  4QIW F;  4KX5 A;  5D49 A;  3B9J A;  4KMU A;  3RB4 A;  3KHH A;  4C7Z A;  1WG8 A;  3HP6 A;  4BWM A;  1ZQW A;  1HIW A;  3QUC A;  4ICA A;  5DDY A;  2D6F C;  9ICG A;  2P35 A;  4F4Y A;  1HUZ A;  4P0Q A;  2W7P A;  4F5O A;  3Q8P B;  4RQ2 A;  5ALU A;  3Q8Q B;  3OSN A;  4TUS A;  2B6G A;  2YB1 A;  4MF2 A;  3TAD C;  2ZTE A;  3PNC A;  5AK5 A;  4NL9 C;  4PZN A;  1ZQS A;  2NRZ A;  4R65 A;  4YXJ A;  3H4D A;  5J0Y A;  1F0M A;  1S97 A;  1Z1B A;  4RNM A;  2BPG A;  3WU2 U;  1BPE A;  3IHQ B;  4UB4 A;  1UCV A;  4DEZ A;  4RPY A;  1YZ7 A;  4OJL A;  1DRG A;  3CW2 C;  2FPM A;  4UAW A;  3IDW A;  1CRX A;  1S9F A;  3A0B U;  7ICV A;  2EAO A;  3D2S A;  4TQS A;  1ZQV A;  3RJJ A;  1SV0 C;  2W43 A;  3GFK B;  4DSE A;  5J2E A;  3Q8S B;  3FAH A;  3ZDE A;  1Q8K A;  3VCB A;  1P7D A;  3ZD8 A;  2QB0 B;  3KHG A;  4IR9 A;  3E0F A;  3PO5 A;  4RQ5 A;  4MFA A;  5L1I A;  2J6T A;  5J2H A;  4M04 A;  1D8L A;  1S0N A;  5KFZ A;  3F2B A;  3BJY A;  3I1Y A;  1Z00 B;  4M47 A;  1C20 A;  4WJ3 B;  3EPI A;  1SWW A;  4Q8E A;  3HIL A;  1KW4 A;  2FPK A;  4P4M A;  4B9U A;  4F50 A;  3ISC A;  3MBY A;  3SV4 A;  2JEF A;  4Y2Q A;  2KZM A;  2ESE A;  4EYI B;  1N62 A;  2W9M A;  5J8Y A;  1RQL A;  4KLD A;  3N97 B;  4ECT A;  2H5X A;  2E3T A;  3KZX A;  1MN8 A;  2PMZ C;  4O0I A;  1T4G A;  2F44 A;  3QU2 A;  2MUT A;  3JPO A;  4J9Q A;  3RJH A;  4RUC A;  4XQ8 A;  4ELV A;  8ICQ A;  1NK7 A;  4E0D A;  2ZIW B;  4DSL A;  5KFQ A;  4EYH B;  4KLH A;  4KX3 A;  5ALP A;  2DKZ A;  5KT7 A;  3V7K A;  2KJ9 A;  2LYA A;  3H8S A;  5AKI A;  3SAH A;  1NNL A;  4NXZ A;  1ZQR A;  1L3V A;  2KFZ A;  5JTI A;  3PX0 A;  4B6J A;  2FPL A;  5ALT A;  3JPN A;  3K1R B;  2UVR A;  2P6U A;  3NAS A;  3LDA A;  2F1I A;  2FMS A;  5JU5 A;  3KTQ A;  2E8O A;  4QW8 A;  4RQ6 A;  5KFY A;  1X42 A;  4PHE A;  1L5U A;  1NZB A;  2G09 A;  4PGY A;  1MA7 A;  2OHF A;  5ALF A;  3T5H A;  3V6H A;  3HPO A;  1KFD A;  5J0P A;  4GC7 A;  2VA8 A;  2WTF A;  3FYH A;  4M0A A;  2WB1 F;  4M2Y A;  3RJI A;  4LJX A;  2DBY A;  8ICZ A;  1U45 A;  1PK1 A;  8ICU A;  3UMC A;  7ICJ A;  3RAQ A;  2BDU A;  2ZIV B;  3QZ8 A;  2AJQ A;  1XSP A;  1D8Y A;  4R64 A;  4JWN A;  1YZ6 A;  3RJE A;  2OCE A;  1JXE A;  2F2A B;  1ZQO A;  2DWQ A;  1ZJM A;  4QZA A;  5ALS A;  1N5X A;  7ICG A;  3OJU A;  3H7I A;  5ALW A;  2VJ4 A;  2JZB B;  1Z4N A;  4B9M A;  2B21 A;  3IRU A;  3SEN A;  3SAG A;  4FZM A;  4EEY A;  9ICK A;  4DL7 A;  2A3V A;  3M7D A;  2LBO A;  1U49 A;  1KSP A;  1VJ5 A;  3G6V A;  2H3I A;  2HHX A;  4OJP A;  3ONN A;  3ISD A;  2ZJA A;  5HR6 A;  2LKY A;  7ICU A;  3MGV A;  1ZQZ A;  3F2C A;  4YVZ A;  2ZTC A;  3Q8L A;  3TAC B;  3BS5 A;  2RHF A;  4GC6 A;  2PFQ A;  3KKA A;  8ICA A;  8ICP A;  2IHN A;  4QJF B;  3PMN A;  4R66 A;  1ZRM A;  4IC9 A;  5A0L A;  2OWO A;  3DEE A;  5KFF A;  4DQQ A;  4FZL A;  2EAP A;  3IG5 A;  1NKC A;  3EZ5 A;  3RRG A;  5J8Y C;  2JV3 A;  5EE1 A;  1T8E A;  4J9R A;  2EH9 A;  2CXY A;  1LV5 A;  4YR2 A;  5AM2 A;  4UAS A;  2GH1 A;  1IG6 A;  5DKW A;  1L6N A;  3ED5 A;  3SD7 A;  3HKZ C;  7ICQ A;  4EEN A;  4GIB A;  5AHX A;  4BJQ A;  3SYZ A;  4Y2R A;  4PL2 A;  2YMP A;  2K4I A;  3EWA A;  4DSK A;  2BR0 A;  5E79 U;  3GV5 B;  4DL3 A;  2YMM A;  2R8H A;  2V4Q A;  4M9L A;  5III A;  3V7L A;  4RT2 A;  9ICO A;  1QQ5 A;  2HHV A;  2AXT U;  1ZQQ A;  4PGX A;  2P66 A;  4F2S A;  5DG9 A;  5EE0 A;  5CP2 A;  3OSP A;  2JH7 A;  1SIJ A;  2BCQ A;  4R63 A;  2P6R A;  1X6I A;  4O3P A;  4QZ9 A;  5L1L A;  8ICB A;  3GV7 B;  4UAV A;  4Y2S A;  2W7O A;  3GDX A;  1ZQP A;  4JWM A;  1S0V A;  4J9N A;  2ZXI A;  3BQT A;  2H3Q A;  3Q8K A;  4KMO B;  2WAQ C;  1K1Q A;  3PML A;  5J0U A;  2KKP A;  3N7R C;  5CWR A;  4KLF A;  2BPF A;  2CRX A;  1ECW A;  1K5O A;  3C29 A;  1UHU A;  5CHG A;  1V85 A;  5DG7 A;  7ICI A;  4KLG A;  2Y1J A;  1COK A;  5AKX A;  4I27 A;  4CF4 A;  2VKQ A;  4EBD A;  1JRO A;  8ICE A;  2HVH A;  4DCC A;  4QZF A;  5ALR A;  2XI9 A;  3M9M B;  5L9X A;  1XS9 D;  3C1Y A;  4IQV A;  1RYU A;  2Y9U A;  7ICE A;  2W3S A;  3TAR A;  2E8N A;  4I2J A;  1TK8 A;  1NJY A;  2MU2 A;  3GIM A;  3KOO A;  2MRL A;  5IIO A;  2VA2 A;  1LVH A;  1WWU A;  2XID A;  4DO9 A;  9ICJ A;  2ES6 A;  3HWT A;  5CEH A;  1N2X A;  4JV2 A;  4NV0 A;  2HBJ A;  3KKA C;  1SKR A;  8ICO A;  4FZN A;  3T5K A;  4C4T A;  3UMG A;  3KHL A;  1ZQC A;  4I2E A;  5KAF U;  4FFD A;  3QE9 Y;  3NVV A;  9ICL A;  8ICY A;  4NJ8 A;  1XNS A;  4DFM A;  1A6S A;  2WF6 A;  5ALI A;  4C8N A;  4I2F A;  1FFU A;  4Y2U A;  2BZF A;  3SQI A;  3CP8 A;  4BWJ A;  2WF8 A;  4TQR A;  4IQT A;  1Z19 A;  2IMW P;  3MR2 A;  2JRZ A;  1WUD A;  4TUQ A;  4IRD A;  5G5H A;  4UB2 A;  1Z3E B;  1ZOL A;  5DB8 A;  5J0W A;  2W03 A;  2YML A;  7ICN A;  2G5I B;  1FFV A;  3JPQ A;  2AH5 A;  2NRX A;  4C8K A;  4DFP A;  2FMQ A;  4Y2V A;  3MR3 A;  2PI4 A;  2ZXH A;  5KFT A;  3IN5 A;  4JUZ A;  3GU3 A;  4YD2 A;  4KLE A;  4EZ6 A;  1N56 A;  5KFE A;  4QWA A;  3RAX A;  2FLL A;  1Q3V A;  2XY6 A;  3UXP A;  3K1Z A;  5D46 A;  3UQ2 A;  7ICO A;  4DQP A;  2PI5 A;  1RQN A;  2MUT B;  3QX7 A;  1SZH A;  5KFS A;  4RQN A;  1F5S A;  2PKE A;  1KBU A;  1B22 A;  1U48 A;  2XY5 A;  3CNH A;  4MFC A;  2PFP A;  3IG8 A;  2YB4 A;  3M9O B;  4RZR A;  1J2N A;  3C28 A;  3RBD A;  4XUS A;  4MEX A;  9ICU A;  2XY7 A;  2KMD A;  4O5K A;  2HOI A;  4R8U B;  5AI6 A;  4ELU A;  2KTQ A;  3QU7 A;  2YY6 A;  5KTQ A;  1L7N A;  3A0H U;  4M6W B;  3V6J A;  2YX8 A;  4DFK A;  3F5E A;  5TZV A;  4QZB A;  3PW4 A;  2KD1 A;  2R8K A;  2EZZ A;  2KIW A;  2ZUB A;  1HJP A;  2C2D A;  2I9G A;  2K8A A;  2QAR B;  1SZP A;  1X9W A;  3TI0 A;  5KG1 A;  1PZN A;  9ICH A;  3M6K A;  2ZJ8 A;  3V7J A;  1V97 A;  2B0C A;  1B0X A;  1QSY A;  1X9M A;  4RUA A;  4TUP A;  2FLN A;  5EWE A;  3N7S C;  4ED7 A;  3T5J A;  5KFH A;  4F4K A;  4IL6 U;  1NJX A;  2ZUC A;  2W8K A;  3Q8M A;  2ZUD A;  5AKY A;  2G06 A;  5ALQ A;  4IRC A;  2W11 A;  3H4B A;  8ICM A;  1PVQ A;  1A0P A;  3BQ1 A;  2QB1 A;  2WF7 A;  3WK8 A;  1KFS A;  3BS5 B;  2KG5 A;  4DL6 A;  2YTU A;  4DSJ A;  3ISB A;  1ZQA A;  2NRV A;  2Q0Z X;  3AUO A;  1ZET A;  3NRW A;  4BDP A;  1DGJ A;  2ZIX A;  3H0M B;  2K8B B;  3MFI A;  4DLG A;  4QWB A;  4MEY A;  4G3I A;  2G5H B;  1S0O A;  1QSL A;  7ICT A;  1LB2 B;  4Z6D A;  3PR4 A;  1BPD A;  4UQG A;  3RBE A;  3DV9 A;  3OHB A;  1NJZ A;  3SI8 A;  2W9B A;  4YMO A;  2JR5 A;  1L7P A;  5DQI A;  3QUT A;  3FDS A;  5J0T A;  1SL0 A;  4GLX A;  2XGP A;  2WFA A;  2W3R A;  2HHU A;  2G0A A;  2AQ4 A;  4LZG A;  2KV2 A;  4TUR A;  3QNM A;  5EE9 A;  3HKZ F;  5ALM A;  3ZDB A;  4AYB C;  3TKA A;  4M9H A;  4ACO A;  2Y0S F;  4YQW A;  1ZQY A;  1IV8 A;  1TK5 A;  1CEZ A;  4NY8 A;  4F5P A;  1N48 A;  2K4E A;  2A19 A;  3M9N B;  1L8L A;  5AKJ A;  5DQG A;  3C2L A;  1BVS A;  3RJK A;  2KP7 A;  3OTQ A;  2KZZ A;  4Y2Y A;  3AN1 A;  3PW0 A;  1D9D A;  4Q44 A;  1JMS A;  3C2K A;  3T5L A;  1S8O A;  3KFU F;  2NO4 A;  3LWM A;  1NZP A;  3N7P D;  3EW9 A;  1JXL A;  5BPC A;  1DGS A;  3RFA A;  3HT3 A;  1X6J A;  2Q4T A;  4F91 B;  2ZIU B;  5EE3 A;  1U4B A;  5FP0 A;  2WAQ F;  1JX4 A;  5AI0 A;  2F8K A;  5D4B A;  3D6J A;  2EAM A;  4DSI A;  1B4F A;  2IOH A;  3E58 A;  4OJ5 A;  4O3Q A;  5AM1 A;  2KSO B;  1N5W A;  5J2A A;  1RXV A;  2FJ6 A;  2C28 A;  2KE7 A;  3MR5 A;  2HHS A;  4PL1 A;  3TFR A;  4O5E A;  3WKC A;  3WKD A;  4EX7 A;  5J0Q A;  4EBE A;  4J9K A;  1BPY A;  4F5N A;  4ECV A;  3OPX A;  7ICM A;  1Y88 A;  1OUQ A;  5KFC A;  8ICT A;  3WK9 A;  4C7Y A;  4UAR A;  4QIW C;  3RRH A;  5L1K A;  4ECR A;  4CCH A;  2QKQ A;  1DXS A;  2Y9T A;  4C8L A;  5HHI A;  1GO3 F;  4P0P A;  1NK8 A;  1ZQN A;  5AK3 A;  1ZQK A;  3WKB A;  4HYK A;  9ICS A;  3AU2 A;  2IOF A;  4O3O A;  4NM2 A;  5DBB A;  2W54 A;  4U6P A;  3RH5 A;  4DL4 A;  2RRD A;  3PSP A;  3H8J A;  4MHV A;  2BCR A;  4KLS A;  1JAL A;  1PUZ A;  3QXG A;  2LPE A;  4B9V A;  2CN1 A;  4FE3 A;  4G9B A;  4QZE A;  1FO4 A;  1C7Y A;  3T3F A;  2W9C B;  1JIH A;  4PPX A;  5KT4 A;  3RB6 A;  5CA7 A;  5J0S A;  4B9T A;  3D2Q A;  1TAU A;  1A76 A;  9ICF A;  2H3V A;  5ALJ A;  1N60 A;  5IIN A;  3RH4 A;  2AGP A;  5AKL A;  4P4P A;  2A1A A;  4J03 A;  2A1J A;  5CJ7 A;  1RXW A;  3QU9 A;  1UA0 A;  3GZF A;  1Z4O A;  2BHN A;  2JGA A;  2JEI A;  1X40 A;  1BPX A;  2KHV A;  1KEJ A;  1LKY B;  2WHE A;  4KLJ A;  2DPJ A;  5J2K A;  1SWV A;  1CUK A;  4QZ8 A;  4F5Q A;  4I2G A;  3NVZ A;  5DGA A;  4K4G A;  9ICV A;  1SXD A;  1QH9 A;  4DF4 A;  3V6K A;  4CGZ A;  4C4R A;  4B9S A;  3MDC A;  3J81 j;  5HNK A;  4KLQ A;  1M6Y A;  2QB0 A;  2GWS A;  3H0L B;  2QLT A;  2KVC A;  4KLL A;  5KG4 A;  1SXE A;  4Y2P A;  5ALG A;  2PFN A;  1ZQJ A;  8ICK A;  4FS1 A;  7ICH A;  5KFL A;  2XGQ A;  2F76 X;  3JPP A;  2OYY A;  3LVW A;  5KT2 A;  4O3S A;  4O3R A;  1SKS A;  4RNN A;  4Z6E A;  5HML A;  4J9M A;  2YMQ A;  1NK9 A;  2HVI A;  5KG5 A;  4RU9 A;  5AKK A;  4DOA A;  4P2H A;  1JI7 A;  1BGX T;  3ZD9 A;  3QUQ A;  3F5A A;  3MFH A;  3F53 A;  5KFG A;  3QZ7 A;  8ICH A;  3PW2 A;  3RB3 A;  5AIC A;  4QWC A;  5H2F U;  3PO4 A;  4UBC A;  4EX6 A;  4M9N A;  3AM9 A;  3V72 A;  3CRX A;  1ZQF A;  2ALZ A;  1DOQ A;  4KN7 A;  9ICQ A;  5AM0 A;  3MR6 A;  4ECZ A;  4JK1 A;  1T3N A;  5KFD A;  1ZYQ A;  4IR1 A;  4P0Q B;  1TAQ A;  2JEJ A;  5ALO A;  1ZQI A;  1UT8 A;  5KFM A;  5KFK A;  3PV8 A;  2LYB A;  2ZIW A;  1ZQX A;  5AKZ A;  4RT3 A;  4KLT A;  1ZD4 A;  4BGD A;  5J0R A;  4F2R A;  8ICG A;  2HW3 A;  3IP4 B;  1NKB A;  2DL0 A;  1WYG A;  4EEL A;  3PSF A;  5HR7 A;  3D2N A;  2VA3 A;  4EEK A;  2EQY A;  2WB1 C;  4KTQ A;  3RJF A;  8ICF A;  1VDV A;  1D9F A;  4F5R A;  5KFR A;  1A77 A;  5KFX A;  5DQH A;  3BQ2 A;  5C5J A;  2IHM A;  2BDP A;  1O03 A;  1QTM A;  4KN4 A;  4RQ0 A;  2ZIX B;  4ZH4 A;  5AKG A;  3JPS A;  8ICL A;  4DSF A;  2CPR A;  4J9O A;  2BCV A;  1MC8 A;  4M9J A;  5KG2 A;  1KKX A;  3N4M B;  1XWL A;  2M0N A;  4QZD A;  4YMN A;  4KLI A;  4MF8 A;  5KAI U;  3FM9 A;  1T3Q A;  4CE6 A;  3B0X A;  3JPT A;  1UA1 A;  3UPQ A;  9ICB A;  4XRH A;  2D8C A;  2BCU A;  9ICE A;  1JUD A;  3WK6 A;  2JMG A;  5KFB A;  3B0Y A;  3C5G A;  4ED1 A;  4B9N A;  2JZB A;  4NL9 A;  2ODG A;  3AMZ A;  5J2I A;  5ALK A;  2ZG6 A;  2Y1I A;  2KZ3 A;  5K4L A;  2E8M A;  4QZG A;  5DB9 A;  4Q45 A;  1Q3U A;  2HOQ A;  3ZI4 A;  4MFF A;  5GTI U;  2JEG A;  9ICI A;  4YD1 A;  1J97 A;  1KTQ A;  5KL8 B;  1D8B A;  1QCK A;  2LHT A;  1ZQE A;  3PW5 A;  2FLP A;  2N1R A;  3ICX A;  4NLK A;  2W9A A;  2KIC A;  2LYH A;  1ZQU A;  2HSZ A;  3PVX A;  4I2A A;  3ORY A;  1SV0 A;  2EAN A;  3H8W A;  1PK3 A;  5KT6 A;  8ICI A;  2KIV A;  2DUY A;  5B5E U;  2LM4 A;  2PMZ F;  4EZ9 A;  4PHP A;  1TVA A;  3LK9 A;  2F1H A;  1MQ2 A;  3HJE A;  2E1E A;  2O6K A;  2FE9 A;  3ZDA A;  2ASD A;  1ZQG A;  2LI6 A;  4KLO A;  5AM4 A;  1VLB A;  2E5S A;  4IRK A;  5J2B A;  4YMM A;  1QLN A;  2BCS A;  5JUM A;  3L3F X;  4J9P A;  4IQW A;  4J9S A;  1RDF A;  3MC1 A;  4US8 A;  4DS5 A;  7ICR A;  4DOB A;  5J0X A;  1FEZ A;  1SV4 A;  2C22 A;  1PVR A;  5ALY A;  4UB3 A;  5AK6 A;  1PK1 B;  3G6X A;  5ALD A;  2XIC A;  4O3N A;  3UXO A;  5DLG A;  5KFJ A;  3PST A;  9ICP A;  3BDP A;  2MSN A;  4J9L A;  1JN3 A;  4ELT A;  1KFT A;  3EPG A;  2EDU A;  1NKE A;  2NO5 A;  5AI4 A;  1ED1 A;  4CDG A;  3UXN A;  3QYP A;  5IIK A;  5AIB A;  1V9P A;  1EXN A;  2KJ5 A;  5ALN A;  4I28 A;  5TIS U;  4QW9 A;  3C5F A;  4JMU A;  2AGO A;  2GLE A;  4UAY A;  3AL0 B;  4YXM A;  4Q8F A;  3ETR A;  2I6X A;  2W8L A;  1KN5 A;  3TQ1 A;  3VC8 A;  4A8E A;  4LZD A;  4Y2J A;  7ICS A;  2R8G A;  4K4I A;  5KG6 A;  5KNI A;  2RLT A;  2BQ3 A;  1L3T A;  2K8C B;  3MAB A;  5KFI A;  2ISO A;  5KFN A;  1COO A;  2G08 A;  2MAX A;  3RR7 A;  1N63 A;  2HBK A;  1S77 D;  4QWD A;  1U47 A;  1ZQH A;  5DBA A;  3RJG A;  1X9X A;  2A1J B;  5KFW A;  1U9L A;  3AU6 A;  2KOB A;  3C21 A;  4F92 B;  3EUB 2;  1KRP A;  2KJ8 A;  3O0F A;  8ICS A;  9ICN A;  2KFN A;  2UVV A;  4YP3 A;  4PHA A;  4CNQ A;  4C8M A;  2GOL A;  2C2E A;  2L5Y A;  5J0O A;  1QQ7 A;  1ZD3 A;  5ALH A;  4F4Z A;  3LWL A;  5DBC A;  2AHO B;  3KZI U;  2IOF K;  5J29 A;  3BQ0 A;  5J2J A;  3T79 A;  2HCF A;  3C2M A;  2OM6 A;  5CR0 A;  3NUQ A;  1URJ A;  4DLE A;  3MDA A;  1NK5 A;  2D3D A;  5KFA A;  4ECY A;  4PHD A;  5EWF A;  1TKD A;  3GIK A;  9ICR A;  4BXO A;  3C23 A;  5EWG A;  4CF3 A;  5AIA A;  3SMV A;  1L7M A;  1ARO P;  3WK7 A;  1T7P A;  4F4X A;  3RB0 A;  3GQC A;  2RDJ A;  2BPC A;  1X2I A;  4KLM A;  3M8S A;  1J2M A;  2FI1 A;  3H40 A;  2LMR A;  3NS1 A;  4ECX A;  4Z6C A;  1RZT A;  4YG2 A;  2GO7 A;  1ZJN A;  5BOM A;  8ICJ A;  3NVY A;  4PZO A;  3BZK A;  2W55 A;  3SV3 A;  5BOL A;  4ED0 A;  4ECU A;  2DQN B;  1K1S A;  3RR8 A;  3M8R A;  4DS4 A;  3NTU A;  5G5G A;  3TAP A;  4FBU A;  1YT3 A;  4ED8 A;  1XC9 A;  3Q8R B;  4HAI A;  3TAQ A;  4YR3 A;  3PX6 A;  5KT5 A;  2HI0 A;  1KQQ A;  9ICA A;  3DDH A;  3GIJ A;  4OJO A;  5KG3 A;  4KIT B;  2K89 A;  3BS7 A;  1T94 A;  2HBL A;  1X66 A;  3K75 D;  1DK3 A;  4RQ1 A;  1F44 A;  1CI4 A;  5DGB A;  2C2R A;  4GXK A;  5HHH A;  2KVS A;  5C0Y A;  1RYR A;  2WF9 A;  4FS2 A;  4ZOH C;  1TFR A;  4RPZ A;  9ICX A;  1SGG A;  4NLC A;  5T14 A;  4CRX A;  1NOM A;  3FC4 A;  1MSW D;  1TK0 A;  4UAT A;  4R8U A;  4NLZ A;  3PR5 B;  2YN4 A;  3WK5 A;  1ZXI A;  2M9N A;  5KT3 A;  3R9K A;  3OGU A;  1S76 D;  4M6W A;  8ICX A;  1PVP A;  2DGZ A;  5IIL A;  3NVW A;  1RPL A;  2WF5 A;  5ALZ A;  2I5H A;  4EBC A;  2RP5 A;  4I2B A;  5KFO A;  3IM1 A;  5F9L A;  4I2I A;  3RTV A;  4F93 B;  4DFD A;  3PSI A;  4F71 A;  4OD0 A;  2QAR A;  4ECW A;  1ZQT A;  1IXR A;  4PGQ A;  5HMM A;  2VAN A;  4GFJ A;  4I29 A;  5DG8 A;  4C80 A;  1IM4 A;  3CYM A;  2EZY A;  2K4H A;  4BX9 C;  5J2F A;  4UAZ A;  1DK2 A;  2OXO A;  4GXJ A;  2NYV A;  2AGQ A;  3SZ2 A;  7ICL A;  1RM6 C;  5AI8 A;  5F9N A;  1KDH A;  1KL9 A;  2Z7J A;  3LYS A;  4ED6 A;  4Y2T A;  4DQI A;  3PY8 A;  4X5V A;  2BKE A;  2XCA A;  2DKX A;  4IS7 A;  4RQ3 A;  1WCL A;  4QZH A;  3C1Z A;  4Q43 A;  4ECS A;  4UB6 U;  7ICK A;  2FMP A;  4F3O A;  1SB3 C;  4NWI A;  3ZDC A;  3ETL A;  1ZD2 P;  2JXJ A;  2IA6 A;  3MGI A;  4OO1 J;  2R8I A;  1N61 A;  2HMX A;  1KLN A;  3HRD D;  5AI5 A;  2OH2 A;  4I2H A;  2AQ0 A;  5JRT A;  5CB1 A;  3SR6 A;  3G6Y A;  4C4S A;  4DQS A;  1L3U A;  4DL2 A;  4O3M A;  3F2D A;  1SKW A;  2KK0 A;  3GV8 B;  4DF8 A;  5AI9 A;  3RF9 A;  1XO0 A;  4QZI A;  2DPI A;  4UB8 U;  2Y0S C;  1WWV A;  2HHW A;  1S10 A;  4Z6F A;  2J6S A;  2PXI A;  5AKH A;  5KL1 B;  4ED2 A;  3UQ0 A;  3QEA Z;  3QU5 A;  8ICC A;  5ALX A;  1XSN A;  2ISP A;  8ICV A;  2V9W A;  8ICN A;  1WCN A; 
#chains in the Genus database with same CATH homology
 1Q3U A;  2HOQ A;  4JMU A;  3D2Q A;  3AL0 B;  2WB1 F;  4QNL A;  4P0Q B;  1ZQ1 C;  3RFA A;  2H3F A;  2GH1 A;  2H3V A;  1L6N A;  2Q4T A;  3HKZ C;  1KBU A;  2JH1 A;  2ZIU B;  3VCB A;  3NRW A;  2KHQ A;  2W04 A;  5KL8 B;  1P7D A;  4BJQ A;  2KKV A;  2LYB A;  4GFJ A;  4OJ6 A;  2WAQ F;  2ZIW A;  1D8B A;  2F8L A;  4PL2 A;  3VC8 A;  4A8E A;  2K4I A;  2LHT A;  4BUG A;  3CYM A;  3E0F A;  3IG8 A;  2YB4 A;  2BDU A;  2DQN B;  2MRL A;  2VIX A;  2K4H A;  2ZIV B;  2DF4 B;  2ZIX A;  3H0M B;  2K8B B;  2XID A;  4BX9 C;  2N1R A;  3C28 A;  4P0P B;  3ICX A;  3IP4 B;  3GZF A;  4C0Z A;  4OJ5 A;  2XVT A;  4NV0 A;  2G5H B;  2HBJ A;  2K8C B;  2KIC A;  3PSF A;  5HR7 A;  3D2N A;  4FZN A;  3F2B A;  2HOI A;  2OXO A;  2JGA A;  2WB1 C;  1YT3 A;  1TAM A;  2KHV A;  2G08 A;  4QIW F;  4KX5 A;  2H3Z A;  2MA1 A;  4WJ3 B;  3M6Z A;  4AYB F;  4PL1 A;  2PMZ F;  2F2A B;  3H0R B;  4U7C A;  2Z7J A;  2G07 A;  2HBK A;  3LYS A;  1XNS A;  2YX8 A;  1A6S A;  2E1E A;  1UPH A;  3F5E A;  2JH7 A;  1HIW A;  4ICA A;  2VJ4 A;  2KD1 A;  2D6F C;  2KOB A;  4OJO A;  2E5S A;  3SAG A;  2K89 A;  2KIW A;  1T94 A;  2ZIX B;  4FZM A;  4P0Q A;  3OPX A;  2W7P A;  3SQI A;  3PZP A;  4CGZ A;  3CP8 A;  2YB1 A;  2A3V A;  1OUQ A;  2HBL A;  2G0A A;  3M7D A;  2W7O A;  2KJ8 A;  3O0F A;  2LBO A;  2ZIU A;  2K8A A;  3L3F X;  5CRX A;  2KV2 A;  1F44 A;  3KZX A;  4QIW C;  2VJ5 A;  2ZXI A;  4NLB A;  2CPR A;  3H0L B;  3HKZ F;  2H3I A;  3AQF A;  4NWI A;  1Z19 A;  2KVC A;  4OJP A;  2H3Q A;  2JHD A;  3ONN A;  4AYB C;  1WUD A;  2PMZ C;  4KMO B;  5HR6 A;  4P0P A;  2LKY A;  1GO3 F;  2GOL A;  1HEK A;  4OO1 J;  2WAQ C;  4ACO A;  3MGV A;  2M0N A;  5C0Y A;  3F2C A;  2Y0S F;  1PVR A;  4NLC A;  2HMX A;  2F77 X;  3M6K A;  2W03 A;  2OH2 A;  2KKP A;  5T14 A;  2G5I B;  3N7R C;  2F76 X;  2ZIW B;  3SAF A;  2OYY A;  3LVW A;  4CRX A;  4KX3 A;  2XIC A;  4U6P A;  1Z1B A;  2R18 A;  3T79 A;  2K4E A;  2NV3 A;  3ALR A;  2RRD A;  3PST A;  2OM6 A;  2KJ9 A;  2RHF A;  2JMG A;  2LYA A;  2CRX A;  3PSP A;  1ECW A;  2HOF A;  3NUQ A;  4O3M A;  1URJ A;  3C29 A;  2ZXH A;  3F2D A;  3N7S C;  2KEY A;  2KNJ A;  3SAH A;  3IN5 A;  4OJL A;  3GU3 A;  1IIP A;  3RF9 A;  1XO0 A;  1PVP A;  4QJF B;  2DGZ A;  1DRG A;  3F5A A;  3F53 A;  4CDG A;  1ED1 A;  2ZIV A;  4IC9 A;  5A0L A;  2Y0S C;  2VKQ A;  3DEE A;  1Q3V A;  2CN1 A;  2E1F A;  2RP5 A;  4FE3 A;  3SMV A;  4FZL A;  2KJ5 A;  3K1Z A;  1CRX A;  3KFU F;  2ZG6 A;  2G06 A;  3IG5 A;  5KL1 B;  1NZB A;  3CRX A;  2G09 A;  1MA7 A;  2HBM A;  2XI9 A;  1SZH A;  3PSI A;  3N7P D;  3LVV A;  1PVQ A;  3D2S A;  1A0P A;  3AQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...