2KV2A

Solution structure of the human blm hrdc domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
QREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bloom syndrome protein
publication title Structure and function of the regulatory HRDC domain from human Bloom syndrome protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kv2A01
4NLBA 3SAGA 2KV2A 4CDGA 2HBMA 2RRDA 2CPRA 3SAFA 2E1EA 2HBLA 2RHFA 3CYMA 4OO1J 1WUDA 3SAHA 2HBJA 2E1FA 2HBKA 4NLCA 1YT3A 4QIWF 4O3MA 4CGZA 2MA1A 1GO3F 1D8BA 5C0YA 4QJFB 2DGZA
chains in the Genus database with same CATH superfamily
3QUQA 5AKXA 5IIMA 3UXNA 2FLPA 2Y1JA 2J6TA 2E1EA 2FJ6A 3EPIA 1KQQA 1QTMA 3WK7A 7ICGA 5EWGA 1ZJNA 2BPCA 3EZ5A 3M1YA 3QU2A 1D8BA 3N4MB 1L3SA 1Z00A 1A0PA 3IN5A 2R18A 4DL7A 2XICA 4FZMA 3C21A 4IR1A 2B6GA 2K89A 1RXWA 1K5OA 2OEHA 3QZ7A 8ICYA 1DOQA 5AM5A 2QB0A 2YB4A 2QARB 2KSOB 3AU6A 1UA0A 3RB6A 5IINA 4O3OA 2P6UA 2DWQA 4LJXA 4B9MA 2ZIWB 4RQ5A 2KMDA 9ICUA 1IM4A 4B9SA 5DB8A 1COKA 1KBUA 4QWAA 2ASDA 2VIXA 1OUQA 5L1JA 1LB2B 4F72A 5JUMA 2V4QA 4RQ7A 7ICMA 1SV0A 4PHDA 1C7YA 2AXTU 4C7YA 4MHVA 8ICNA 2ASJA 3CNHA 3L4PA 2P6RA 3MR5A 3UQ0A 3HJEA 1ZD2P 3JPOA 2L5YA 4KLDA 2KVSA 4C8NA 5J8YA 5L1IA 3ZI4A 2EZZA 2XCPA 2BCVA 1JMSA 5J2FA 8ICGA 5DG9A 2PMZF 5GTIU 4Z6CA 3QU7A 1COOA 1Z00B 1ZQJA 2HOFA 3T3FA 4Q8FA 4CF5A 2N1RA 4O0IA 3Q8RB 3B0YA 3ETRA 4QZ8A 2EH9A 5D46A 4DS4A 1MSWD 4F4WA 1ZQQA 1XSPA 2W11A 4C8MA 4UB6U 4YXJA 2M0NA 4F5NA 1ZQVA 2QB0B 3WKDA 3UPQA 1QQ6A 4EBDA 5AICA 1ZQYA 4UATA 4EYHB 7ICQA 3H8SA 3BJYA 3UQ2A 2XVTA 4DSKA 5ALZA 2J6UA 4EELA 1KDHA 3RH5A 1KFTA 4ED6A 4KLOA 2JZBB 4P4MA 4GXJA 2VKQA 2YN4A 3PVXA 4NLBA 2KE7A 4PPXA 4AP9A 4CDGA 2HMXA 4ECQA 2GH1A 5AM2A 4RQ8A 4DL2A 1UT5A 5AM0A 3SAHA 5KG3A 3KBBA 3M6KA 4EBEA 3BQ7A 3GV5B 4F71A 3IP4B 4O3MA 3ZDAA 4ELVA 2JGAA 5KG1A 1RQNA 5KFDA 3MC1A 1D9FA 4JV2A 4ECYA 5KFSA 2KHVA 4RQ1A 4RU9A 1ZD3A 4KX3A 2G06A 5AI4A 4Z6DA 2NO5A 5KFLA 1NK7A 5BOLA 5ALPA 1Q3UA 2HBJA 3PNCA 3SZ2A 2YMLA 1JROA 2VA3A 4PHAA 2MUTA 3BDPA 4ZH4A 5DG7A 3GU3A 3N28A 3QNMA 3NS1A 1H38A 4BX9C 4YMOA 1X9MA 3LWMA 1L7OA 8ICXA 4DL3A 3IHQB 3DEEA 5AKZA 9ICPA 2H3ZA 1PVPA 1L3UA 3RH4A 3BQ0A 2HSZA 2WAQF 3PSTA 3C5GA 1ZQAA 4QJFB 4DF4A 3IG5A 4O5EA 5DLFA 1B4FA 5F3XB 4UB1A 1WYGA 5K4LA 2NO4A 2W55A 3KZXA 8ICJA 1B22A 1YT3A 5CRXA 5KFPA 1L7PA 1MC8A 4GLXA 1SB3C 1Z4NA 3QU5A 5KFZA 5CJ7A 2KTQA 4DL6A 2BQUA 4R8UA 3WK9A 3K1ZA 1RPLA 3EYZA 2IHNA 3H0MB 9ICTA 4LZGA 1ZQMA 1ZD5A 1Z4OA 3WKBA 3BZKA 3RR8A 5KFCA 8ICOA 3PSIA 3GV7B 8ICTA 4ED2A 3JPQA 4ACOA 4QZ9A 1D8LA 1RXVA 3ICXA 2HVHA 4IQUA 4ED8A 2JV3A 2FI1A 3V72A 3KHRA 3IRUA 2E3TA 1V9PA 4PHPA 3FDSA 9ICQA 4DSIA 1JALA 1KFSA 5J2CA 1NZBA 2K8BB 2AGQA 4M04A 9ICFA 4FS1A 2HOIA 2BGWA 5AI5A 4IRKA 4DEZA 8ICKA 3H8WA 2V4RA 2RDJA 4DF8A 3QU9A 1KFDA 3A0HU 3HT3A 3B0XA 2JR5A 3KHLA 2E5SA 1NOMA 4GXKA 2W7PA 3D2SA 3ED5A 4JK1A 7ICIA 5KFBA 2HHUA 2W54A 4QW9A 3SAFA 2ZIUA 4DFDA 1BPEA 3PMNA 2OXOA 9ICWA 4F5OA 4FS2A 2GWSA 4JMUA 3PO4A 2Q0ZX 1X9WA 4DLGA 2HHVA 9ICRA 3RAQA 5KT5A 5JTIA 2J6SA 5CHGA 1D9DA 3PMLA 1BPBA 2Z7JA 4RT3A 4FE3A 3GQCA 5AKKA 3T5LA 3LWLA 5KFXA 1L6NA 4GFJA 1N60A 1URJA 1ZQHA 3HW8A 5AI8A 5J0TA 1WCLA 4YD2A 4JB3A 2VA2A 2G08A 1QLNA 2ZXHA 5DKWA 3QUBA 1SZHA 4G9BA 1BNOA 3GDXA 2BDUA 3C2KA 2K4EA 2HDOA 4I2JA 9ICOA 3H8JA 3ZDCA 2BQ3A 5AM1A 4LVSA 4DLEA 1T4GA 4I2BA 5J2HA 3ONNA 1NK0A 4CGZA 3TKAA 8ICZA 4DFMA 4DSJA 5JRTA 3QX7A 4TQRA 4CF3A 1S0VA 5HHHA 5AI9A 2JH7A 2KN7A 2LI6A 3BQTA 2Y9TA 4OJ6A 1VJ5A 2GLEA 4EEYA 4QZBA 3PW7A 2FPKA 5IILA 1RG6A 3GV8B 2ZIUB 8ICIA 1SIJA 5DLGA 5KFKA 4QZHA 2FLNA 2UVWA 1NKEA 4IQTA 4YQWA 2BCSA 5L9XA 2ISPA 4M6WA 8ICWA 5KL8B 3Q8MA 4F5PA 1KL9A 4TUSA 4OJLA 4KLSA 4BWMA 2HHSA 5F9NA 1Z1VA 2NYVA 1VDVA 2C2EA 9ICVA 4DSLA 5DDYA 5ALEA 4Y2RA 1Z1BA 1DRGA 2R8KA 4RQMA 2ZG6A 4I2CA 4IC9A 2PKEA 3PO5A 2EQYA 2QKQA 1SKSA 2B0CA 5GTHU 2E8PA 5KG4A 3F2CA 4YXMA 1QSYA 2KJ9A 4F2RA 4UB2A 3MR6A 1ZXIA 1GO3F 1HUOA 3KFUF 5TISU 3MGHA 4UB5A 1BPDA 3TFRA 5ALSA 5B5EU 1ZQDA 1O08A 5AI0A 2YMQA 2ALZA 4DL4A 4GIBA 5AKYA 5KL1B 4J9SA 3DV9A 3ORYA 4PJ0U 4ED1A 3PX6A 2ZIWA 1SL2A 4TUPA 1JRPA 3AUOA 4M9LA 5KG6A 2YMPA 4C0ZA 4QZGA 2FPLA 4P0PA 5ALUA 3NVVA 2PFPA 2UVRA 3AL0B 5IIIA 4KLHA 4KLMA 5KT7A 5JU5A 1SZPA 3SENA 1HUZA 5KT3A 5CP2A 3BS7A 2RP5A 2PFOA 3SMVA 1L7NA 5DB6A 4OO1J 4NXZA 3PW0A 3KOOA 2NRXA 4YR3A 2A1JA 1HIWA 1ZQ1C 4O3NA 4K4IA 4M9JA 2NRTA 1ZQFA 2W04A 2BCUA 4MF2A 1BNPA 7ICEA 3T5KA 2Y0SC 5H2FU 4I2EA 2HHXA 1IIPA 1SXDA 4J9RA 2WF5A 2H3VA 4J9KA 3UMGA 4O3RA 1MQ2A 1FFVA 2NRZA 3AMZA 1LVHA 2MSNA 3OPXA 8ICEA 2FPMA 5J2JA 2ASLA 5ALGA 2JEIA 2Y1IA 1NZPA 4I27A 4DOAA 5HR6A 7ICNA 3AM9A 4QZAA 5J0PA 2AQ0A 4KLTA 3BZCA 2RRDA 1XSNA 2K8CB 2OM6A 1ECWA 3T5JA 4X5VA 3QXGA 4DCCA 1S97A 1VLBA 2JZBA 2XGPA 4PL2A 1LKYB 2ZIXB 4P0PB 3RBEA 1S77D 9ICJA 3TACB 3RJJA 3NASA 1TKDA 2E8MA 1PZNA 3MBYA 3SI8A 2XY5A 1ZQXA 4IQWA 4JWNA 3QEAZ 3KZIU 4UQGA 4J9MA 2FMPA 2P66A 5KFGA 2JEJA 2MA1A 2A1JB 3IM1A 3M7DA 1ZQSA 2VJ4A 2G07A 5KFQA 4YP3A 4MFFA 7ICTA 2ZTDA 1LV5A 4O3PA 3F5AA 3EWAA 5DQHA 4DFJA 1C20A 4P0QB 2A1AA 3C1YA 5KFJA 3GIIA 3GIJA 2XGQA 2I6XA 3UMBA 4IR9A 4YR2A 5KFMA 4TURA 4CF4A 4ECVA 3TADC 5KG7A 2DKZA 4NL9C 3H0RB 5IIKA 3HILA 1UQVA 3HKZC 3Q8QB 1A6SA 2ATLA 3H8MA 5ALIA 5DBBA 1DGSA 5KFAA 5CWRA 5A0LA 5AKJA 4J9PA 1P7DA 4KLEA 2JEFA 4KLUA 3WKCA 1V38A 5ALFA 5AIBA 3F2DA 4HYKA 2WB1C 4KN7A 5E79U 2F44A 2F3NA 2AHOB 9ICNA 4US8A 4EZ9A 3L3FX 2ZUDA 2CN1A 5L1KA 2PI5A 5T14A 4BDPA 3EUB2 3WK5A 2YX8A 5J2EA 3BS5A 2AGPA 2KFNA 4XA5A 2F76X 4F2SA 3JPTA 1SGGA 4JV0A 1BPZA 1FIQA 3BQ1A 1FO4A 1PK3A 3TARA 2JRZA 2GO7A 4RQ3A 1KLNA 1T94A 4QWEA 4PGYA 3RJFA 7ICHA 1U9LA 4RNOA 4EX6A 3C23A 4OCZA 4ICAA 4U7CA 4DQRA 2BHNA 2F1JA 1RYRA 2EAMA 1U48A 1XO0A 1JN3A 4QZCA 5G5GA 4OJPA 1QQ5A 1TAQA 5CA7A 4RQ6A 2I9GA 5ALJA 2WF7A 4GC6A 4FZNA 5J0WA 1U4BA 2KHQA 4B9TA 1S10A 3NTUA 4E0DA 4NM2A 1TE2A 5ALLA 4P4PA 5J0XA 4DO9A 2BDPA 3JPPA 4Q8EA 4MF8A 4I2IA 2DPJA 3RJIA 4OJ5A 8ICHA 1TV9A 3ZD8A 4F4XA 3NVYA 1Q46A 9ICSA 3OHBA 1N48A 3WKEA 4Q43A 3WU2U 1ZQLA 3BS5B 5KG0A 3I28A 4RQ0A 4NLKA 3NVWA 1UPHA 5ALQA 2EDUA 2C2DA 4EZ6A 2V9WA 1U47A 4USAA 2BPFA 2EAPA 4CRXA 3N7PD 1N5WA 7ICOA 2MU2A 2IHMA 1NK5A 3RJHA 3C5FA 4Z6FA 4YVZA 4BUGA 5J2IA 1N63A 4NWIA 5J29A 9ICKA 4DSEA 2KD1A 2KKPA 4KX5A 3M9MB 3LYSA 1J2MA 3SEIA 4K4HA 1NK4A 4TUQA 4Y2QA 1NI3A 3HWTA 3LK9A 1Y88A 3TI0A 9ICMA 4RQNA 3D2QA 5D4BA 4G3IA 3F53A 3NUQA 2H3QA 2EANA 8ICSA 3M8RA 1ZYQA 4A8EA 1NNLA 2W9CB 4B9NA 1U49A 2DL0A 3WK8A 3JPSA 4ECWA 1S0NA 5KNIA 2KOBA 5FP0A 5B66U 5ALXA 4EBCA 5HP4A 2IOHA 2KNJA 3UXOA 4NLGA 1JUDA 5KFIA 3PW4A 1ZOLA 2W3RA 2YQEA 1SKRA 2ZUBA 4JUZA 5HNKA 1KTQA 1S0MA 4WJ3B 2AGOA 4O3SA 1TAUA 4BXOB 2P35A 4IRCA 2LKYA 3K4GA 4Y2PA 3AN1A 5ALNA 2NRWA 4QWCA 2VANA 5AKEA 3PW2A 1S76D 2AJQA 1ZQRA 4I29A 1RZTA 5ALHA 2R8JA 1N61A 2XY7A 2RDIA 3C28A 2E8NA 5HMLA 3GIKA 3SQIA 5KFYA 4B9UA 1B43A 1ZQEA 5J2BA 4FBUA 5KFEA 1XS9D 4F4KA 2FDRA 2VA8A 4Y2XA 3RAXA 4R66A 4IRDA 2C28A 4ED0A 5AKHA 4UAVA 2JHDA 1ED1A 5J0RA 1L8LA 2M9NA 1RYSA 3OJUA 4RQ2A 5DQIA 5EWFA 5KFVA 3SYZA 4LZDA 4XUSA 5EWEA 2G5HB 4ECRA 1NJZA 3Q8SB 4ECZA 5J2GA 4I2DA 3C1ZA 3UMCA 4QZFA 4R65A 3H40A 4R64A 2D8CA 2LYBA 5AK6A 5ALTA 1DGJA 1UCVA 2Y0SF 5KAIU 1L5UA 1S5LU 4J9QA 2D6FC 2ES6A 3TAQA 2BKEA 3HRDD 2IBKA 3MFIA 2GOLA 4YMMA 3RRHA 5J0QA 1ZETA 4QW8A 4KMUA 2NRVA 5ALMA 5AHXA 4C80A 1Q3VA 4ECSA 2BR0A 2XI9A 1SL0A 1RM6C 1NJXA 1L8OA 2BCQA 1B0XA 1BPYA 1RQLA 2I5HA 3JPNA 3G6XA 5D49A 8ICFA 1RDFA 2OCEA 4NLNA 3CP8A 2EZYA 8ICPA 3PSPA 5ALWA 4PZNA 3RFAA 2E1FA 2W8KA 1SXEA 2OYYA 2XCAA 5KFTA 3SV4A 1DK2A 4Q45A 4RPYA 1KKXA 2F1IA 2KFZA 3SV3A 2WF9A 4P2HA 5J0YA 4UASA 3M6ZA 2ZJAA 2E8OA 2DPIA 4Y2TA 4B6JA 3MGIA 1ZQIA 2RQ5A 4KLQA 2VJ5A 2MRLA 5AK4A 4AYBC 2ZTCA 1A77A 2JEGA 1NJWA 1N56A 2W9AA 1S8OA 2I1QA 2WF6A 2FLLA 5KFWA 1J97A 4MEYA 1A76A 1N2XA 1QQ7A 5DG8A 1ZQTA 1ZD4A 1ZRNA 4I2FA 1AQ6A 3HKZF 2WTFA 3E0FA 1SV0C 3QYPA 4DFKA 1LKYA 2ZIXA 3C29A 1JXLA 1ZQUA 2CXYA 1ZQGA 3RB0A 2C22A 3KD3A 5BOMA 4RT2A 3QE9Y 3TFSA 7ICLA 1Z19A 3F5EA 2PXIA 2HBMA 2KIWA 1KEJA 2FMQA 2WB1F 5J8YC 2JMGA 2YY6A 4US9A 2O6KA 1T7PA 1TAMA 3R9KA 4Y2JA 2IOFK 4QZIA 4Z6EA 3ZDEA 2KZ3A 4Y2VA 3FAHA 3FYHA 4KMOB 3QEBZ 8ICLA 3IDWA 3AEVA 4P0QA 2OHFA 3MDCA 2XC9A 3G6YA 2BQRA 7ICJA 4QZDA 5DB7A 3KTQA 2B21A 4B9VA 5KFHA 7ICUA 3SD7A 4TQSA 2K4HA 2BPGA 3V6HA 1CRXA 5ALRA 4RQ4A 2K60A 3M8SA 4PZOA 4EX7A 1MQ3A 4F92B 4KLIA 5J0SA 5KAFU 4GXIA 3T5HA 1AROP 2F77X 1N62A 3N97B 4UBCA 4ZOHC 3QUCA 3RH6A 4RUCA 4YCXA 3SR6A 9ICCA 1Q8KA 4GC7A 4XRHA 4UAUA 4EYIB 1X42A 3MDAA 1SWVA 5EE9A 2IA6A 4JV1A 1WCNA 2KICA 2QB1A 2LYAA 4KN4A 1XSLA 5AIAA 2W8LA 3I1YA 4NY8A 5KT4A 3N7RC 1SWWA 1ZQCA 3OJSA 3PY8A 2G5IB 2A19A 3WKAA 8ICUA 5DGAA 5AK3A 1X66A 2RLTA 3KKAA 5AKIA 4NJ8A 4U6PA 4UB8U 3RB3A 3D2NA 9ICXA 4UAZA 3PW5A 3RJKA 1IV8A 2H5XA 1YZ6A 1JI7A 2KP7A 5HHIA 3AQFA 1TVAA 5CR0A 1BVSA 3OGUA 4ELTA 2EAOA 5J0OA 3MFHA 1HJPA 3V6KA 2HBKA 4UBBA 3NRZA 1SKWA 2H3IA 4O5CA 4QNLA 3V6JA 1D8YA 3HP6A 4UARA 4C8LA 4R63A 3LVVA 4KLLA 3SAGA 3OSNA 2XIDA 4F5QA 9ICGA 4C7ZA 3ISDA 3L5KA 3IG8A 1QCKA 1NKBA 3A0BU 4F50A 2F8KA 5ALKA 1QH9A 5ALOA 2ZIVA 1T8EA 5ALDA 2PI4A 4IL6U 1TK8A 4BJQA 5J2AA 3B9JA 2WFAA 1CUKA 2AH5A 3RJEA 1BPXA 2KZMA 4F93B 2F1HA 1TK5A 1X9SA 5ALVA 1F44A 2KK0A 5DGBA 4RPZA 4O3QA 1PVRA 2HCFA 2YMMA 3EPGA 3JPRA 1L3TA 3MABA 2ZUCA 1XU4A 5DBAA 5EE0A 1FEZA 2AQ4A 4O9MA 2KIVA 2W03A 4KLJA 4P4OA 4J9OA 9ICLA 4NV0A 2OWOA 2K4IA 2ESEA 2HW3A 4J03A 4I2AA 7ICFA 3NVZA 3RRGA 5KFUA 2BCRA 1DK3A 4I2HA 4K4GA 4M47A 5AI6A 4NLCA 1L7MA 4OD0A 4YR0A 8ICQA 1T3QA 4HAIA 2JXJA 1V85A 4Y2YA 3CW2C 4MFAA 3ZDBA 4DSFA 5J0UA 2LMRA 3H4DA 4C8OA 5DQGA 1XWLA 1JIHA 3TADA 2W9CA 4NL9A 4PL1A 3ISBA 3VC8A 2ZJ8A 3O0FA 4DQSA 3T79A 3F2BA 4O5KA 2C2RA 4DQPA 3PR4A 1ZQKA 5KFRA 5AK5A 4QIWF 2LM1A 2HOQA 2ZIVB 1N5XA 1XO1A 1ZRMA 4I2GA 8ICBA 3I76A 4ED3A 7ICKA 4F5RA 4F4ZA 1JX4A 4C4TA 3PZPA 3ISCA 1ZJMA 1XC9A 3Q8LA 4F91B 2HVIA 1M6YA 3AQEA 4DFPA 4BXOA 5DB9A 1PUZA 3E2EA 3E58A 7ICPA 2PMZC 9ICBA 2IMWP 2QLTA 3C2LA 3TANA 3PSFA 3QZ8A 4C4SA 5L1LA 3PX4A 3HPOA 1OXJA 2ISOA 2K8AA 1L3VA 4FBTA 4FZLA 5HR7A 2R8GA 3RB4A 1CI4A 3QU4A 1NK9A 1BGXT 3CRXA 2UVUA 3LDAA 1TK0A 4M2YA 5C0YA 3Q8KA 2MUTB 1UT8A 1S0OA 9ICAA 1UA1A 1PK1A 4UB4A 2W7OA 1X9XA 4DS5A 4RNMA 3WK6A 3UXPA 5IIJA 2CPRA 4PGXA 2LPEA 2ODGA 3RJGA 4YFKA 3CYMA 2K4PA 4NM1A 1OW5A 4F4YA 1Z3EB 2NV3A 2ZJ5A 5EE1A 1ZQOA 4ECXA 2DQNB 1EXNA 2R8IA 4KLGA 5KFOA 9ICHA 4BWJA 2HHWA 3GILA 1X2IA 4KITB 2WHEA 2LYHA 2MAXA 4RUAA 4F3OA 2ZXIA 2Q4TA 1WWVA 5IIOA 1MA7A 5CB1A 1F0MA 4PH5A 8ICRA 3TQ1A 1J2NA 5J2DA 4MEXA 3THVA 4ECUA 2LBOA 5EE3A 1KRPA 3H7IA 3AU2A 4DL5A 4J9NA 4BGDA 4Y2SA 2HHTA 5AM3A 4UAWA 1WG8A 5HMMA 3QUTA 1ZQWA 4MFCA 2ZTEA 4AYBF 4QWBA 4ECTA 3N7SC 2OH2A 2RHFA 4ED7A 2XO7A 2AU0A 3PX0A 1ZQZA 4M9GA 3GZFA 3DDHA 5AKGA 1ZQNA 5C5JA 4R8UB 4DOBA 2H3FA 4EENA 4JWMA 4UW9A 3WK4A 2KVCA 4DOCA 1K1QA 2HI0A 1ZQBA 7ICSA 3NRWA 5KT6A 3M9NB 2FE9A 4FFDA 3BQ2A 7ICRA 1T3NA 1ZQPA 4F8RA 4M9HA 3KHGA 4QIWC 4YD1A 4FO6A 2WAQC 3EW9A 1NKCA 2FMSA 4M9NA 1PK1B 2F8LA 4IQVA 2KJ5A 2DKXA 2PFQA 4YG2A 8ICVA 1O03A 5AM4A 4Y2UA 2G0AA 4C8KA 5G5HA 1JXEA 3LVWA 4EEKA 2KZZA 1NK6A 5DBCA 5ALYA 4DWIA 3MR2A 1QSSA 2G09A 9ICIA 4CCHA 2EZXA 4IS7A 4B9LA 1UHUA 2F2AB 5KTQA 5KFFA 1KSPA 3RF9A 4NLZA 2JH1A 1FFUA 3H4BA 2W3SA 2IOFA 5BPCA 2A3VA 4KTQA 1HEKA 3OSPA 2W43A 4C4RA 3HX0A 1K1SA 5AKLA 1WUDA 3MGVA 1X40A 1S9FA 4QWDA 4J9LA 3GFKB 1MN8A 3MR3A 1KW4A 2LHTA 1U45A 1V97A 2W9BA 2XY6A 3PR5B 5KG2A 2KV2A 5KFNA 2R8HA 2D3DA 3ALRA 5CEHA 3TAPA 3V7LA 4RNNA 4CNQA 3S6JA 3FM9A 8ICAA 2KKVA 3H0LB 4RZRA 2BZFA 3RR7A 1X6IA 4UB3A 5KG5A 1YZ7A 3VCBA 1IXRA 5F9LA 4RPXA 2DGZA 4M0AA 4OJOA 1RYUA 3RBDA 3OHAA 5DDMA 2KG5A 2KEYA 2KJ8A 1PVQA 4I28A 2UVVA 3FC4A 2LM4A 3K1RB 3ZD9A 1SL1A 2W9MA 4YN4A 5J2KA 2YB1A 4KLFA 2PFNA 5L1MA 4DQQA 2DBYA 3PV8A 1NK8A 1IG6A 3G6VA 3C2MA 3V7KA 2DFLA 3D6JA 8ICMA 1KN5A 3ETLA 2QARA 2KSOA 5EOZA 4PHEA 3NGDA 3ZDDA 1NJYA 1XNSA 1TFRA 3GIMA 2WF8A 1DXSA 3Q8PB 4UAYA 2HHQA 1WWUA 5TZVA 2Y9UA 3J81j 4PGQA 4ELUA 4CE6A 3V7JA 1CEZA 1SV4A 3U26A 7ICVA 3IV6A 3UM9A 5KT2A 2W9BB 1QSLA 4M6WB 2HBLA 3OTQA 4Q44A 9ICEA 3KHHA 3K75D 2DUYA 8ICCA 1X6JA 1F5SA 3M9OB 3RTVA 2CRXA 4DQIA 4YMNA 3KKAC 4QZEA 2YTUA 2DF4B 4XQ8A
chains in the Genus database with same CATH topology
2PMZF 3SAGA 2XIDA 2KV2A 1T94A 1ED1A 4AYBF 3PZPA 4BX9C 1NZBA 2K8BB 3M6ZA 3IG8A 3ALRA 4OJ6A 2HOFA 3N7SC 2HOIA 2E1EA 2RHFA 2OH2A 2F77X 4C0ZA 3GZFA 3AQEA 3DEEA 2N1RA 4ICAA 2ZIVA 4U7CA 4P0PA 2ZIUB 2KKVA 2MRLA 2PMZC 2VJ5A 3H0LB 4BJQA 2H3ZA 2G5HB 2H3FA 1PVPA 4AYBC 2KVCA 2MA1A 2WAQF 3M7DA 3PSTA 3VCBA 3D2QA 2E5SA 4CRXA 3AL0B 1D8BA 2VJ4A 2G07A 3NRWA 1XO0A 2W7PA 3D2SA 3PSFA 4QJFB 2M0NA 3F53A 2H3QA 3NUQA 1A0PA 2DGZA 3F5AA 4OJPA 4OJOA 3IN5A 2R18A 2LYBA 2XICA 4FZMA 1F44A 2K89A 2XVTA 3IG5A 4P0QB 3SAFA 4FZNA 5KL8B 2RP5A 2ZIUA 2KEYA 4QIWC 2WAQC 3SMVA 1PVRA 2KICA 2KJ8A 4A8EA 2KHQA 1PVQA 2OXOA 2Y0SF 2F8LA 3HKZF 3E0FA 2LYAA 3KZXA 4OO1J 2KJ5A 2K8AA 4JMUA 4FZLA 5HR7A 1HIWA 4OJLA 2ZIXA 1ZQ1C 3C29A 3N7RC 2D6FC 1YT3A 2YB1A 2YB4A 2W04A 3CRXA 2G0AA 5CRXA 3H0RB 5C0YA 2GOLA 2KOBA 2VKQA 2W03A 2Y0SC 3HKZC 3LVWA 1A6SA 2G5IB 2Z7JA 4FE3A 4NLBA 2W7OA 4NV0A 2KNJA 2K4IA 1IIPA 1Z19A 3F5EA 4CDGA 2HBMA 2KIWA 2H3VA 2HMXA 5A0LA 2WB1F 2ZIWB 2CPRA 4OJ5A 1Z1BA 2ZG6A 4GFJA 1DRGA 1L6NA 4IC9A 2GH1A 3CYMA 1URJA 2G09A 2JMGA 1P7DA 1Q3VA 3K1ZA 1KBUA 1TAMA 3OPXA 2NV3A 3SAHA 2XI9A 2VIXA 3F2CA 3M6KA 2KJ9A 4U6PA 1OUQA 1XNSA 2G08A 4NLCA 3H0MB 4WJ3B 2DQNB 3IP4B 3F2DA 4O3MA 2F2AB 2ZXHA 2WB1C 2LKYA 4KMOB 1GO3F 1SZHA 3KFUF 3D2NA 3RF9A 5HR6A 2BDUA 1UPHA 2JGAA 2K4EA 2JH1A 4P0QA 2KHVA 2ZXIA 2Q4TA 3L3FX 2CN1A 3C28A 2RRDA 3CP8A 3PSIA 3PSPA 5T14A 2K8CB 3AQFA 1MA7A 3N7PD 2A3VA 1HEKA 4KX3A 2G06A 4PL1A 2HBLA 2OM6A 3VC8A 1ECWA 2YX8A 3SQIA 3O0FA 1WUDA 3RFAA 4ACOA 2HBJA 1Q3UA 3T79A 5KL1B 3F2BA 2E1FA 2LBOA 3MGVA 4BUGA 3ONNA 2HBKA 3ICXA 4QIWF 2OYYA 4NWIA 4CGZA 4PL2A 2F76X 2HOQA 2ZIXB 2K4HA 2ZIVB 2CRXA 4P0PB 2KD1A 2LHTA 2H3IA 2KKPA 1CRXA 4KX5A 4QNLA 2DF4B 2ZIWA 3GU3A 2JH7A 2JHDA 3LVVA 3LYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLB A;  3SAG A;  2KV2 A;  4CDG A;  2HBM A;  2RRD A;  2CPR A;  3SAF A;  2E1E A;  2HBL A;  2RHF A;  3CYM A;  4OO1 J;  1WUD A;  3SAH A;  2HBJ A;  2E1F A;  2HBK A;  4NLC A;  1YT3 A;  4QIW F;  4O3M A;  4CGZ A;  2MA1 A;  1GO3 F;  1D8B A;  5C0Y A;  4QJF B;  2DGZ A; 
#chains in the Genus database with same CATH topology
 3QUQ A;  5AKX A;  5IIM A;  3UXN A;  2FLP A;  2Y1J A;  2J6T A;  2E1E A;  2FJ6 A;  3EPI A;  1KQQ A;  1QTM A;  3WK7 A;  7ICG A;  5EWG A;  1ZJN A;  2BPC A;  3EZ5 A;  3M1Y A;  3QU2 A;  1D8B A;  3N4M B;  1L3S A;  1Z00 A;  1A0P A;  3IN5 A;  2R18 A;  4DL7 A;  2XIC A;  4FZM A;  3C21 A;  4IR1 A;  2B6G A;  2K89 A;  1RXW A;  1K5O A;  2OEH A;  3QZ7 A;  8ICY A;  1DOQ A;  5AM5 A;  2QB0 A;  2YB4 A;  2QAR B;  2KSO B;  3AU6 A;  1UA0 A;  3RB6 A;  5IIN A;  4O3O A;  2P6U A;  2DWQ A;  4LJX A;  4B9M A;  2ZIW B;  4RQ5 A;  2KMD A;  9ICU A;  1IM4 A;  4B9S A;  5DB8 A;  1COK A;  1KBU A;  4QWA A;  2ASD A;  2VIX A;  1OUQ A;  5L1J A;  1LB2 B;  4F72 A;  5JUM A;  2V4Q A;  4RQ7 A;  7ICM A;  1SV0 A;  4PHD A;  1C7Y A;  2AXT U;  4C7Y A;  4MHV A;  8ICN A;  2ASJ A;  3CNH A;  3L4P A;  2P6R A;  3MR5 A;  3UQ0 A;  3HJE A;  1ZD2 P;  3JPO A;  2L5Y A;  4KLD A;  2KVS A;  4C8N A;  5J8Y A;  5L1I A;  3ZI4 A;  2EZZ A;  2XCP A;  2BCV A;  1JMS A;  5J2F A;  8ICG A;  5DG9 A;  2PMZ F;  5GTI U;  4Z6C A;  3QU7 A;  1COO A;  1Z00 B;  1ZQJ A;  2HOF A;  3T3F A;  4Q8F A;  4CF5 A;  2N1R A;  4O0I A;  3Q8R B;  3B0Y A;  3ETR A;  4QZ8 A;  2EH9 A;  5D46 A;  4DS4 A;  1MSW D;  4F4W A;  1ZQQ A;  1XSP A;  2W11 A;  4C8M A;  4UB6 U;  4YXJ A;  2M0N A;  4F5N A;  1ZQV A;  2QB0 B;  3WKD A;  3UPQ A;  1QQ6 A;  4EBD A;  5AIC A;  1ZQY A;  4UAT A;  4EYH B;  7ICQ A;  3H8S A;  3BJY A;  3UQ2 A;  2XVT A;  4DSK A;  5ALZ A;  2J6U A;  4EEL A;  1KDH A;  3RH5 A;  1KFT A;  4ED6 A;  4KLO A;  2JZB B;  4P4M A;  4GXJ A;  2VKQ A;  2YN4 A;  3PVX A;  4NLB A;  2KE7 A;  4PPX A;  4AP9 A;  4CDG A;  2HMX A;  4ECQ A;  2GH1 A;  5AM2 A;  4RQ8 A;  4DL2 A;  1UT5 A;  5AM0 A;  3SAH A;  5KG3 A;  3KBB A;  3M6K A;  4EBE A;  3BQ7 A;  3GV5 B;  4F71 A;  3IP4 B;  4O3M A;  3ZDA A;  4ELV A;  2JGA A;  5KG1 A;  1RQN A;  5KFD A;  3MC1 A;  1D9F A;  4JV2 A;  4ECY A;  5KFS A;  2KHV A;  4RQ1 A;  4RU9 A;  1ZD3 A;  4KX3 A;  2G06 A;  5AI4 A;  4Z6D A;  2NO5 A;  5KFL A;  1NK7 A;  5BOL A;  5ALP A;  1Q3U A;  2HBJ A;  3PNC A;  3SZ2 A;  2YML A;  1JRO A;  2VA3 A;  4PHA A;  2MUT A;  3BDP A;  4ZH4 A;  5DG7 A;  3GU3 A;  3N28 A;  3QNM A;  3NS1 A;  1H38 A;  4BX9 C;  4YMO A;  1X9M A;  3LWM A;  1L7O A;  8ICX A;  4DL3 A;  3IHQ B;  3DEE A;  5AKZ A;  9ICP A;  2H3Z A;  1PVP A;  1L3U A;  3RH4 A;  3BQ0 A;  2HSZ A;  2WAQ F;  3PST A;  3C5G A;  1ZQA A;  4QJF B;  4DF4 A;  3IG5 A;  4O5E A;  5DLF A;  1B4F A;  5F3X B;  4UB1 A;  1WYG A;  5K4L A;  2NO4 A;  2W55 A;  3KZX A;  8ICJ A;  1B22 A;  1YT3 A;  5CRX A;  5KFP A;  1L7P A;  1MC8 A;  4GLX A;  1SB3 C;  1Z4N A;  3QU5 A;  5KFZ A;  5CJ7 A;  2KTQ A;  4DL6 A;  2BQU A;  4R8U A;  3WK9 A;  3K1Z A;  1RPL A;  3EYZ A;  2IHN A;  3H0M B;  9ICT A;  4LZG A;  1ZQM A;  1ZD5 A;  1Z4O A;  3WKB A;  3BZK A;  3RR8 A;  5KFC A;  8ICO A;  3PSI A;  3GV7 B;  8ICT A;  4ED2 A;  3JPQ A;  4ACO A;  4QZ9 A;  1D8L A;  1RXV A;  3ICX A;  2HVH A;  4IQU A;  4ED8 A;  2JV3 A;  2FI1 A;  3V72 A;  3KHR A;  3IRU A;  2E3T A;  1V9P A;  4PHP A;  3FDS A;  9ICQ A;  4DSI A;  1JAL A;  1KFS A;  5J2C A;  1NZB A;  2K8B B;  2AGQ A;  4M04 A;  9ICF A;  4FS1 A;  2HOI A;  2BGW A;  5AI5 A;  4IRK A;  4DEZ A;  8ICK A;  3H8W A;  2V4R A;  2RDJ A;  4DF8 A;  3QU9 A;  1KFD A;  3A0H U;  3HT3 A;  3B0X A;  2JR5 A;  3KHL A;  2E5S A;  1NOM A;  4GXK A;  2W7P A;  3D2S A;  3ED5 A;  4JK1 A;  7ICI A;  5KFB A;  2HHU A;  2W54 A;  4QW9 A;  3SAF A;  2ZIU A;  4DFD A;  1BPE A;  3PMN A;  2OXO A;  9ICW A;  4F5O A;  4FS2 A;  2GWS A;  4JMU A;  3PO4 A;  2Q0Z X;  1X9W A;  4DLG A;  2HHV A;  9ICR A;  3RAQ A;  5KT5 A;  5JTI A;  2J6S A;  5CHG A;  1D9D A;  3PML A;  1BPB A;  2Z7J A;  4RT3 A;  4FE3 A;  3GQC A;  5AKK A;  3T5L A;  3LWL A;  5KFX A;  1L6N A;  4GFJ A;  1N60 A;  1URJ A;  1ZQH A;  3HW8 A;  5AI8 A;  5J0T A;  1WCL A;  4YD2 A;  4JB3 A;  2VA2 A;  2G08 A;  1QLN A;  2ZXH A;  5DKW A;  3QUB A;  1SZH A;  4G9B A;  1BNO A;  3GDX A;  2BDU A;  3C2K A;  2K4E A;  2HDO A;  4I2J A;  9ICO A;  3H8J A;  3ZDC A;  2BQ3 A;  5AM1 A;  4LVS A;  4DLE A;  1T4G A;  4I2B A;  5J2H A;  3ONN A;  1NK0 A;  4CGZ A;  3TKA A;  8ICZ A;  4DFM A;  4DSJ A;  5JRT A;  3QX7 A;  4TQR A;  4CF3 A;  1S0V A;  5HHH A;  5AI9 A;  2JH7 A;  2KN7 A;  2LI6 A;  3BQT A;  2Y9T A;  4OJ6 A;  1VJ5 A;  2GLE A;  4EEY A;  4QZB A;  3PW7 A;  2FPK A;  5IIL A;  1RG6 A;  3GV8 B;  2ZIU B;  8ICI A;  1SIJ A;  5DLG A;  5KFK A;  4QZH A;  2FLN A;  2UVW A;  1NKE A;  4IQT A;  4YQW A;  2BCS A;  5L9X A;  2ISP A;  4M6W A;  8ICW A;  5KL8 B;  3Q8M A;  4F5P A;  1KL9 A;  4TUS A;  4OJL A;  4KLS A;  4BWM A;  2HHS A;  5F9N A;  1Z1V A;  2NYV A;  1VDV A;  2C2E A;  9ICV A;  4DSL A;  5DDY A;  5ALE A;  4Y2R A;  1Z1B A;  1DRG A;  2R8K A;  4RQM A;  2ZG6 A;  4I2C A;  4IC9 A;  2PKE A;  3PO5 A;  2EQY A;  2QKQ A;  1SKS A;  2B0C A;  5GTH U;  2E8P A;  5KG4 A;  3F2C A;  4YXM A;  1QSY A;  2KJ9 A;  4F2R A;  4UB2 A;  3MR6 A;  1ZXI A;  1GO3 F;  1HUO A;  3KFU F;  5TIS U;  3MGH A;  4UB5 A;  1BPD A;  3TFR A;  5ALS A;  5B5E U;  1ZQD A;  1O08 A;  5AI0 A;  2YMQ A;  2ALZ A;  4DL4 A;  4GIB A;  5AKY A;  5KL1 B;  4J9S A;  3DV9 A;  3ORY A;  4PJ0 U;  4ED1 A;  3PX6 A;  2ZIW A;  1SL2 A;  4TUP A;  1JRP A;  3AUO A;  4M9L A;  5KG6 A;  2YMP A;  4C0Z A;  4QZG A;  2FPL A;  4P0P A;  5ALU A;  3NVV A;  2PFP A;  2UVR A;  3AL0 B;  5III A;  4KLH A;  4KLM A;  5KT7 A;  5JU5 A;  1SZP A;  3SEN A;  1HUZ A;  5KT3 A;  5CP2 A;  3BS7 A;  2RP5 A;  2PFO A;  3SMV A;  1L7N A;  5DB6 A;  4OO1 J;  4NXZ A;  3PW0 A;  3KOO A;  2NRX A;  4YR3 A;  2A1J A;  1HIW A;  1ZQ1 C;  4O3N A;  4K4I A;  4M9J A;  2NRT A;  1ZQF A;  2W04 A;  2BCU A;  4MF2 A;  1BNP A;  7ICE A;  3T5K A;  2Y0S C;  5H2F U;  4I2E A;  2HHX A;  1IIP A;  1SXD A;  4J9R A;  2WF5 A;  2H3V A;  4J9K A;  3UMG A;  4O3R A;  1MQ2 A;  1FFV A;  2NRZ A;  3AMZ A;  1LVH A;  2MSN A;  3OPX A;  8ICE A;  2FPM A;  5J2J A;  2ASL A;  5ALG A;  2JEI A;  2Y1I A;  1NZP A;  4I27 A;  4DOA A;  5HR6 A;  7ICN A;  3AM9 A;  4QZA A;  5J0P A;  2AQ0 A;  4KLT A;  3BZC A;  2RRD A;  1XSN A;  2K8C B;  2OM6 A;  1ECW A;  3T5J A;  4X5V A;  3QXG A;  4DCC A;  1S97 A;  1VLB A;  2JZB A;  2XGP A;  4PL2 A;  1LKY B;  2ZIX B;  4P0P B;  3RBE A;  1S77 D;  9ICJ A;  3TAC B;  3RJJ A;  3NAS A;  1TKD A;  2E8M A;  1PZN A;  3MBY A;  3SI8 A;  2XY5 A;  1ZQX A;  4IQW A;  4JWN A;  3QEA Z;  3KZI U;  4UQG A;  4J9M A;  2FMP A;  2P66 A;  5KFG A;  2JEJ A;  2MA1 A;  2A1J B;  3IM1 A;  3M7D A;  1ZQS A;  2VJ4 A;  2G07 A;  5KFQ A;  4YP3 A;  4MFF A;  7ICT A;  2ZTD A;  1LV5 A;  4O3P A;  3F5A A;  3EWA A;  5DQH A;  4DFJ A;  1C20 A;  4P0Q B;  2A1A A;  3C1Y A;  5KFJ A;  3GII A;  3GIJ A;  2XGQ A;  2I6X A;  3UMB A;  4IR9 A;  4YR2 A;  5KFM A;  4TUR A;  4CF4 A;  4ECV A;  3TAD C;  5KG7 A;  2DKZ A;  4NL9 C;  3H0R B;  5IIK A;  3HIL A;  1UQV A;  3HKZ C;  3Q8Q B;  1A6S A;  2ATL A;  3H8M A;  5ALI A;  5DBB A;  1DGS A;  5KFA A;  5CWR A;  5A0L A;  5AKJ A;  4J9P A;  1P7D A;  4KLE A;  2JEF A;  4KLU A;  3WKC A;  1V38 A;  5ALF A;  5AIB A;  3F2D A;  4HYK A;  2WB1 C;  4KN7 A;  5E79 U;  2F44 A;  2F3N A;  2AHO B;  9ICN A;  4US8 A;  4EZ9 A;  3L3F X;  2ZUD A;  2CN1 A;  5L1K A;  2PI5 A;  5T14 A;  4BDP A;  3EUB 2;  3WK5 A;  2YX8 A;  5J2E A;  3BS5 A;  2AGP A;  2KFN A;  4XA5 A;  2F76 X;  4F2S A;  3JPT A;  1SGG A;  4JV0 A;  1BPZ A;  1FIQ A;  3BQ1 A;  1FO4 A;  1PK3 A;  3TAR A;  2JRZ A;  2GO7 A;  4RQ3 A;  1KLN A;  1T94 A;  4QWE A;  4PGY A;  3RJF A;  7ICH A;  1U9L A;  4RNO A;  4EX6 A;  3C23 A;  4OCZ A;  4ICA A;  4U7C A;  4DQR A;  2BHN A;  2F1J A;  1RYR A;  2EAM A;  1U48 A;  1XO0 A;  1JN3 A;  4QZC A;  5G5G A;  4OJP A;  1QQ5 A;  1TAQ A;  5CA7 A;  4RQ6 A;  2I9G A;  5ALJ A;  2WF7 A;  4GC6 A;  4FZN A;  5J0W A;  1U4B A;  2KHQ A;  4B9T A;  1S10 A;  3NTU A;  4E0D A;  4NM2 A;  1TE2 A;  5ALL A;  4P4P A;  5J0X A;  4DO9 A;  2BDP A;  3JPP A;  4Q8E A;  4MF8 A;  4I2I A;  2DPJ A;  3RJI A;  4OJ5 A;  8ICH A;  1TV9 A;  3ZD8 A;  4F4X A;  3NVY A;  1Q46 A;  9ICS A;  3OHB A;  1N48 A;  3WKE A;  4Q43 A;  3WU2 U;  1ZQL A;  3BS5 B;  5KG0 A;  3I28 A;  4RQ0 A;  4NLK A;  3NVW A;  1UPH A;  5ALQ A;  2EDU A;  2C2D A;  4EZ6 A;  2V9W A;  1U47 A;  4USA A;  2BPF A;  2EAP A;  4CRX A;  3N7P D;  1N5W A;  7ICO A;  2MU2 A;  2IHM A;  1NK5 A;  3RJH A;  3C5F A;  4Z6F A;  4YVZ A;  4BUG A;  5J2I A;  1N63 A;  4NWI A;  5J29 A;  9ICK A;  4DSE A;  2KD1 A;  2KKP A;  4KX5 A;  3M9M B;  3LYS A;  1J2M A;  3SEI A;  4K4H A;  1NK4 A;  4TUQ A;  4Y2Q A;  1NI3 A;  3HWT A;  3LK9 A;  1Y88 A;  3TI0 A;  9ICM A;  4RQN A;  3D2Q A;  5D4B A;  4G3I A;  3F53 A;  3NUQ A;  2H3Q A;  2EAN A;  8ICS A;  3M8R A;  1ZYQ A;  4A8E A;  1NNL A;  2W9C B;  4B9N A;  1U49 A;  2DL0 A;  3WK8 A;  3JPS A;  4ECW A;  1S0N A;  5KNI A;  2KOB A;  5FP0 A;  5B66 U;  5ALX A;  4EBC A;  5HP4 A;  2IOH A;  2KNJ A;  3UXO A;  4NLG A;  1JUD A;  5KFI A;  3PW4 A;  1ZOL A;  2W3R A;  2YQE A;  1SKR A;  2ZUB A;  4JUZ A;  5HNK A;  1KTQ A;  1S0M A;  4WJ3 B;  2AGO A;  4O3S A;  1TAU A;  4BXO B;  2P35 A;  4IRC A;  2LKY A;  3K4G A;  4Y2P A;  3AN1 A;  5ALN A;  2NRW A;  4QWC A;  2VAN A;  5AKE A;  3PW2 A;  1S76 D;  2AJQ A;  1ZQR A;  4I29 A;  1RZT A;  5ALH A;  2R8J A;  1N61 A;  2XY7 A;  2RDI A;  3C28 A;  2E8N A;  5HML A;  3GIK A;  3SQI A;  5KFY A;  4B9U A;  1B43 A;  1ZQE A;  5J2B A;  4FBU A;  5KFE A;  1XS9 D;  4F4K A;  2FDR A;  2VA8 A;  4Y2X A;  3RAX A;  4R66 A;  4IRD A;  2C28 A;  4ED0 A;  5AKH A;  4UAV A;  2JHD A;  1ED1 A;  5J0R A;  1L8L A;  2M9N A;  1RYS A;  3OJU A;  4RQ2 A;  5DQI A;  5EWF A;  5KFV A;  3SYZ A;  4LZD A;  4XUS A;  5EWE A;  2G5H B;  4ECR A;  1NJZ A;  3Q8S B;  4ECZ A;  5J2G A;  4I2D A;  3C1Z A;  3UMC A;  4QZF A;  4R65 A;  3H40 A;  4R64 A;  2D8C A;  2LYB A;  5AK6 A;  5ALT A;  1DGJ A;  1UCV A;  2Y0S F;  5KAI U;  1L5U A;  1S5L U;  4J9Q A;  2D6F C;  2ES6 A;  3TAQ A;  2BKE A;  3HRD D;  2IBK A;  3MFI A;  2GOL A;  4YMM A;  3RRH A;  5J0Q A;  1ZET A;  4QW8 A;  4KMU A;  2NRV A;  5ALM A;  5AHX A;  4C80 A;  1Q3V A;  4ECS A;  2BR0 A;  2XI9 A;  1SL0 A;  1RM6 C;  1NJX A;  1L8O A;  2BCQ A;  1B0X A;  1BPY A;  1RQL A;  2I5H A;  3JPN A;  3G6X A;  5D49 A;  8ICF A;  1RDF A;  2OCE A;  4NLN A;  3CP8 A;  2EZY A;  8ICP A;  3PSP A;  5ALW A;  4PZN A;  3RFA A;  2E1F A;  2W8K A;  1SXE A;  2OYY A;  2XCA A;  5KFT A;  3SV4 A;  1DK2 A;  4Q45 A;  4RPY A;  1KKX A;  2F1I A;  2KFZ A;  3SV3 A;  2WF9 A;  4P2H A;  5J0Y A;  4UAS A;  3M6Z A;  2ZJA A;  2E8O A;  2DPI A;  4Y2T A;  4B6J A;  3MGI A;  1ZQI A;  2RQ5 A;  4KLQ A;  2VJ5 A;  2MRL A;  5AK4 A;  4AYB C;  2ZTC A;  1A77 A;  2JEG A;  1NJW A;  1N56 A;  2W9A A;  1S8O A;  2I1Q A;  2WF6 A;  2FLL A;  5KFW A;  1J97 A;  4MEY A;  1A76 A;  1N2X A;  1QQ7 A;  5DG8 A;  1ZQT A;  1ZD4 A;  1ZRN A;  4I2F A;  1AQ6 A;  3HKZ F;  2WTF A;  3E0F A;  1SV0 C;  3QYP A;  4DFK A;  1LKY A;  2ZIX A;  3C29 A;  1JXL A;  1ZQU A;  2CXY A;  1ZQG A;  3RB0 A;  2C22 A;  3KD3 A;  5BOM A;  4RT2 A;  3QE9 Y;  3TFS A;  7ICL A;  1Z19 A;  3F5E A;  2PXI A;  2HBM A;  2KIW A;  1KEJ A;  2FMQ A;  2WB1 F;  5J8Y C;  2JMG A;  2YY6 A;  4US9 A;  2O6K A;  1T7P A;  1TAM A;  3R9K A;  4Y2J A;  2IOF K;  4QZI A;  4Z6E A;  3ZDE A;  2KZ3 A;  4Y2V A;  3FAH A;  3FYH A;  4KMO B;  3QEB Z;  8ICL A;  3IDW A;  3AEV A;  4P0Q A;  2OHF A;  3MDC A;  2XC9 A;  3G6Y A;  2BQR A;  7ICJ A;  4QZD A;  5DB7 A;  3KTQ A;  2B21 A;  4B9V A;  5KFH A;  7ICU A;  3SD7 A;  4TQS A;  2K4H A;  2BPG A;  3V6H A;  1CRX A;  5ALR A;  4RQ4 A;  2K60 A;  3M8S A;  4PZO A;  4EX7 A;  1MQ3 A;  4F92 B;  4KLI A;  5J0S A;  5KAF U;  4GXI A;  3T5H A;  1ARO P;  2F77 X;  1N62 A;  3N97 B;  4UBC A;  4ZOH C;  3QUC A;  3RH6 A;  4RUC A;  4YCX A;  3SR6 A;  9ICC A;  1Q8K A;  4GC7 A;  4XRH A;  4UAU A;  4EYI B;  1X42 A;  3MDA A;  1SWV A;  5EE9 A;  2IA6 A;  4JV1 A;  1WCN A;  2KIC A;  2QB1 A;  2LYA A;  4KN4 A;  1XSL A;  5AIA A;  2W8L A;  3I1Y A;  4NY8 A;  5KT4 A;  3N7R C;  1SWW A;  1ZQC A;  3OJS A;  3PY8 A;  2G5I B;  2A19 A;  3WKA A;  8ICU A;  5DGA A;  5AK3 A;  1X66 A;  2RLT A;  3KKA A;  5AKI A;  4NJ8 A;  4U6P A;  4UB8 U;  3RB3 A;  3D2N A;  9ICX A;  4UAZ A;  3PW5 A;  3RJK A;  1IV8 A;  2H5X A;  1YZ6 A;  1JI7 A;  2KP7 A;  5HHI A;  3AQF A;  1TVA A;  5CR0 A;  1BVS A;  3OGU A;  4ELT A;  2EAO A;  5J0O A;  3MFH A;  1HJP A;  3V6K A;  2HBK A;  4UBB A;  3NRZ A;  1SKW A;  2H3I A;  4O5C A;  4QNL A;  3V6J A;  1D8Y A;  3HP6 A;  4UAR A;  4C8L A;  4R63 A;  3LVV A;  4KLL A;  3SAG A;  3OSN A;  2XID A;  4F5Q A;  9ICG A;  4C7Z A;  3ISD A;  3L5K A;  3IG8 A;  1QCK A;  1NKB A;  3A0B U;  4F50 A;  2F8K A;  5ALK A;  1QH9 A;  5ALO A;  2ZIV A;  1T8E A;  5ALD A;  2PI4 A;  4IL6 U;  1TK8 A;  4BJQ A;  5J2A A;  3B9J A;  2WFA A;  1CUK A;  2AH5 A;  3RJE A;  1BPX A;  2KZM A;  4F93 B;  2F1H A;  1TK5 A;  1X9S A;  5ALV A;  1F44 A;  2KK0 A;  5DGB A;  4RPZ A;  4O3Q A;  1PVR A;  2HCF A;  2YMM A;  3EPG A;  3JPR A;  1L3T A;  3MAB A;  2ZUC A;  1XU4 A;  5DBA A;  5EE0 A;  1FEZ A;  2AQ4 A;  4O9M A;  2KIV A;  2W03 A;  4KLJ A;  4P4O A;  4J9O A;  9ICL A;  4NV0 A;  2OWO A;  2K4I A;  2ESE A;  2HW3 A;  4J03 A;  4I2A A;  7ICF A;  3NVZ A;  3RRG A;  5KFU A;  2BCR A;  1DK3 A;  4I2H A;  4K4G A;  4M47 A;  5AI6 A;  4NLC A;  1L7M A;  4OD0 A;  4YR0 A;  8ICQ A;  1T3Q A;  4HAI A;  2JXJ A;  1V85 A;  4Y2Y A;  3CW2 C;  4MFA A;  3ZDB A;  4DSF A;  5J0U A;  2LMR A;  3H4D A;  4C8O A;  5DQG A;  1XWL A;  1JIH A;  3TAD A;  2W9C A;  4NL9 A;  4PL1 A;  3ISB A;  3VC8 A;  2ZJ8 A;  3O0F A;  4DQS A;  3T79 A;  3F2B A;  4O5K A;  2C2R A;  4DQP A;  3PR4 A;  1ZQK A;  5KFR A;  5AK5 A;  4QIW F;  2LM1 A;  2HOQ A;  2ZIV B;  1N5X A;  1XO1 A;  1ZRM A;  4I2G A;  8ICB A;  3I76 A;  4ED3 A;  7ICK A;  4F5R A;  4F4Z A;  1JX4 A;  4C4T A;  3PZP A;  3ISC A;  1ZJM A;  1XC9 A;  3Q8L A;  4F91 B;  2HVI A;  1M6Y A;  3AQE A;  4DFP A;  4BXO A;  5DB9 A;  1PUZ A;  3E2E A;  3E58 A;  7ICP A;  2PMZ C;  9ICB A;  2IMW P;  2QLT A;  3C2L A;  3TAN A;  3PSF A;  3QZ8 A;  4C4S A;  5L1L A;  3PX4 A;  3HPO A;  1OXJ A;  2ISO A;  2K8A A;  1L3V A;  4FBT A;  4FZL A;  5HR7 A;  2R8G A;  3RB4 A;  1CI4 A;  3QU4 A;  1NK9 A;  1BGX T;  3CRX A;  2UVU A;  3LDA A;  1TK0 A;  4M2Y A;  5C0Y A;  3Q8K A;  2MUT B;  1UT8 A;  1S0O A;  9ICA A;  1UA1 A;  1PK1 A;  4UB4 A;  2W7O A;  1X9X A;  4DS5 A;  4RNM A;  3WK6 A;  3UXP A;  5IIJ A;  2CPR A;  4PGX A;  2LPE A;  2ODG A;  3RJG A;  4YFK A;  3CYM A;  2K4P A;  4NM1 A;  1OW5 A;  4F4Y A;  1Z3E B;  2NV3 A;  2ZJ5 A;  5EE1 A;  1ZQO A;  4ECX A;  2DQN B;  1EXN A;  2R8I A;  4KLG A;  5KFO A;  9ICH A;  4BWJ A;  2HHW A;  3GIL A;  1X2I A;  4KIT B;  2WHE A;  2LYH A;  2MAX A;  4RUA A;  4F3O A;  2ZXI A;  2Q4T A;  1WWV A;  5IIO A;  1MA7 A;  5CB1 A;  1F0M A;  4PH5 A;  8ICR A;  3TQ1 A;  1J2N A;  5J2D A;  4MEX A;  3THV A;  4ECU A;  2LBO A;  5EE3 A;  1KRP A;  3H7I A;  3AU2 A;  4DL5 A;  4J9N A;  4BGD A;  4Y2S A;  2HHT A;  5AM3 A;  4UAW A;  1WG8 A;  5HMM A;  3QUT A;  1ZQW A;  4MFC A;  2ZTE A;  4AYB F;  4QWB A;  4ECT A;  3N7S C;  2OH2 A;  2RHF A;  4ED7 A;  2XO7 A;  2AU0 A;  3PX0 A;  1ZQZ A;  4M9G A;  3GZF A;  3DDH A;  5AKG A;  1ZQN A;  5C5J A;  4R8U B;  4DOB A;  2H3F A;  4EEN A;  4JWM A;  4UW9 A;  3WK4 A;  2KVC A;  4DOC A;  1K1Q A;  2HI0 A;  1ZQB A;  7ICS A;  3NRW A;  5KT6 A;  3M9N B;  2FE9 A;  4FFD A;  3BQ2 A;  7ICR A;  1T3N A;  1ZQP A;  4F8R A;  4M9H A;  3KHG A;  4QIW C;  4YD1 A;  4FO6 A;  2WAQ C;  3EW9 A;  1NKC A;  2FMS A;  4M9N A;  1PK1 B;  2F8L A;  4IQV A;  2KJ5 A;  2DKX A;  2PFQ A;  4YG2 A;  8ICV A;  1O03 A;  5AM4 A;  4Y2U A;  2G0A A;  4C8K A;  5G5H A;  1JXE A;  3LVW A;  4EEK A;  2KZZ A;  1NK6 A;  5DBC A;  5ALY A;  4DWI A;  3MR2 A;  1QSS A;  2G09 A;  9ICI A;  4CCH A;  2EZX A;  4IS7 A;  4B9L A;  1UHU A;  2F2A B;  5KTQ A;  5KFF A;  1KSP A;  3RF9 A;  4NLZ A;  2JH1 A;  1FFU A;  3H4B A;  2W3S A;  2IOF A;  5BPC A;  2A3V A;  4KTQ A;  1HEK A;  3OSP A;  2W43 A;  4C4R A;  3HX0 A;  1K1S A;  5AKL A;  1WUD A;  3MGV A;  1X40 A;  1S9F A;  4QWD A;  4J9L A;  3GFK B;  1MN8 A;  3MR3 A;  1KW4 A;  2LHT A;  1U45 A;  1V97 A;  2W9B A;  2XY6 A;  3PR5 B;  5KG2 A;  2KV2 A;  5KFN A;  2R8H A;  2D3D A;  3ALR A;  5CEH A;  3TAP A;  3V7L A;  4RNN A;  4CNQ A;  3S6J A;  3FM9 A;  8ICA A;  2KKV A;  3H0L B;  4RZR A;  2BZF A;  3RR7 A;  1X6I A;  4UB3 A;  5KG5 A;  1YZ7 A;  3VCB A;  1IXR A;  5F9L A;  4RPX A;  2DGZ A;  4M0A A;  4OJO A;  1RYU A;  3RBD A;  3OHA A;  5DDM A;  2KG5 A;  2KEY A;  2KJ8 A;  1PVQ A;  4I28 A;  2UVV A;  3FC4 A;  2LM4 A;  3K1R B;  3ZD9 A;  1SL1 A;  2W9M A;  4YN4 A;  5J2K A;  2YB1 A;  4KLF A;  2PFN A;  5L1M A;  4DQQ A;  2DBY A;  3PV8 A;  1NK8 A;  1IG6 A;  3G6V A;  3C2M A;  3V7K A;  2DFL A;  3D6J A;  8ICM A;  1KN5 A;  3ETL A;  2QAR A;  2KSO A;  5EOZ A;  4PHE A;  3NGD A;  3ZDD A;  1NJY A;  1XNS A;  1TFR A;  3GIM A;  2WF8 A;  1DXS A;  3Q8P B;  4UAY A;  2HHQ A;  1WWU A;  5TZV A;  2Y9U A;  3J81 j;  4PGQ A;  4ELU A;  4CE6 A;  3V7J A;  1CEZ A;  1SV4 A;  3U26 A;  7ICV A;  3IV6 A;  3UM9 A;  5KT2 A;  2W9B B;  1QSL A;  4M6W B;  2HBL A;  3OTQ A;  4Q44 A;  9ICE A;  3KHH A;  3K75 D;  2DUY A;  8ICC A;  1X6J A;  1F5S A;  3M9O B;  3RTV A;  2CRX A;  4DQI A;  4YMN A;  3KKA C;  4QZE A;  2YTU A;  2DF4 B;  4XQ8 A; 
#chains in the Genus database with same CATH homology
 2PMZ F;  3SAG A;  2XID A;  2KV2 A;  1T94 A;  1ED1 A;  4AYB F;  3PZP A;  4BX9 C;  1NZB A;  2K8B B;  3M6Z A;  3IG8 A;  3ALR A;  4OJ6 A;  2HOF A;  3N7S C;  2HOI A;  2E1E A;  2RHF A;  2OH2 A;  2F77 X;  4C0Z A;  3GZF A;  3AQE A;  3DEE A;  2N1R A;  4ICA A;  2ZIV A;  4U7C A;  4P0P A;  2ZIU B;  2KKV A;  2MRL A;  2PMZ C;  2VJ5 A;  3H0L B;  4BJQ A;  2H3Z A;  2G5H B;  2H3F A;  1PVP A;  4AYB C;  2KVC A;  2MA1 A;  2WAQ F;  3M7D A;  3PST A;  3VCB A;  3D2Q A;  2E5S A;  4CRX A;  3AL0 B;  1D8B A;  2VJ4 A;  2G07 A;  3NRW A;  1XO0 A;  2W7P A;  3D2S A;  3PSF A;  4QJF B;  2M0N A;  3F53 A;  2H3Q A;  3NUQ A;  1A0P A;  2DGZ A;  3F5A A;  4OJP A;  4OJO A;  3IN5 A;  2R18 A;  2LYB A;  2XIC A;  4FZM A;  1F44 A;  2K89 A;  2XVT A;  3IG5 A;  4P0Q B;  3SAF A;  4FZN A;  5KL8 B;  2RP5 A;  2ZIU A;  2KEY A;  4QIW C;  2WAQ C;  3SMV A;  1PVR A;  2KIC A;  2KJ8 A;  4A8E A;  2KHQ A;  1PVQ A;  2OXO A;  2Y0S F;  2F8L A;  3HKZ F;  3E0F A;  2LYA A;  3KZX A;  4OO1 J;  2KJ5 A;  2K8A A;  4JMU A;  4FZL A;  5HR7 A;  1HIW A;  4OJL A;  2ZIX A;  1ZQ1 C;  3C29 A;  3N7R C;  2D6F C;  1YT3 A;  2YB1 A;  2YB4 A;  2W04 A;  3CRX A;  2G0A A;  5CRX A;  3H0R B;  5C0Y A;  2GOL A;  2KOB A;  2VKQ A;  2W03 A;  2Y0S C;  3HKZ C;  3LVW A;  1A6S A;  2G5I B;  2Z7J A;  4FE3 A;  4NLB A;  2W7O A;  4NV0 A;  2KNJ A;  2K4I A;  1IIP A;  1Z19 A;  3F5E A;  4CDG A;  2HBM A;  2KIW A;  2H3V A;  2HMX A;  5A0L A;  2WB1 F;  2ZIW B;  2CPR A;  4OJ5 A;  1Z1B A;  2ZG6 A;  4GFJ A;  1DRG A;  1L6N A;  4IC9 A;  2GH1 A;  3CYM A;  1URJ A;  2G09 A;  2JMG A;  1P7D A;  1Q3V A;  3K1Z A;  1KBU A;  1TAM A;  3OPX A;  2NV3 A;  3SAH A;  2XI9 A;  2VIX A;  3F2C A;  3M6K A;  2KJ9 A;  4U6P A;  1OUQ A;  1XNS A;  2G08 A;  4NLC A;  3H0M B;  4WJ3 B;  2DQN B;  3IP4 B;  3F2D A;  4O3M A;  2F2A B;  2ZXH A;  2WB1 C;  2LKY A;  4KMO B;  1GO3 F;  1SZH A;  3KFU F;  3D2N A;  3RF9 A;  5HR6 A;  2BDU A;  1UPH A;  2JGA A;  2K4E A;  2JH1 A;  4P0Q A;  2KHV A;  2ZXI A;  2Q4T A;  3L3F X;  2CN1 A;  3C28 A;  2RRD A;  3CP8 A;  3PSI A;  3PSP A;  5T14 A;  2K8C B;  3AQF A;  1MA7 A;  3N7P D;  2A3V A;  1HEK A;  4KX3 A;  2G06 A;  4PL1 A;  2HBL A;  2OM6 A;  3VC8 A;  1ECW A;  2YX8 A;  3SQI A;  3O0F A;  1WUD A;  3RFA A;  4ACO A;  2HBJ A;  1Q3U A;  3T79 A;  5KL1 B;  3F2B A;  2E1F A;  2LBO A;  3MGV A;  4BUG A;  3ONN A;  2HBK A;  3ICX A;  4QIW F;  2OYY A;  4NWI A;  4CGZ A;  4PL2 A;  2F76 X;  2HOQ A;  2ZIX B;  2K4H A;  2ZIV B;  2CRX A;  4P0P B;  2KD1 A;  2LHT A;  2H3I A;  2KKP A;  1CRX A;  4KX5 A;  4QNL A;  2DF4 B;  2ZIW A;  3GU3 A;  2JH7 A;  2JHD A;  3LVV A;  3LYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...