2KV2A

Solution structure of the human blm hrdc domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
QREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the regulatory HRDC domain from human Bloom syndrome protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Bloom syndrome protein
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kv2A01
2MA1A 1YT3A 2RHFA 4QIWF 1D8BA 2HBLA 3SAGA 2E1FA 4NLCA 5C0YA 2HBKA 2DGZA 4CGZA 2CPRA 2E1EA 2HBJA 2KV2A 3SAHA 3SAFA 4O3MA 4OO1J 4CDGA 1GO3F 3CYMA 4QJFB 2RRDA 2HBMA 1WUDA 4NLBA
chains in the Genus database with same CATH superfamily
3KZIU 3N7RC 3IG5A 4C4TA 5DB8A 3TQ1A 4I2EA 1L3SA 2ZTCA 1BGXT 4X5VA 4PHDA 2PMZC 2EH9A 3GFKB 2F44A 5KAIU 1MA7A 1Q8KA 2RRDA 5J0WA 5DBBA 4RQ8A 1RYRA 4DQRA 2PFOA 4C8NA 4KLOA 8ICVA 8ICMA 2HHVA 3D2SA 2HHWA 1RXVA 3PW4A 4QZCA 9ICQA 1KEJA 4MEXA 3LK9A 5KAFU 3A0BU 4KX3A 1Z4NA 2B0CA 1H38A 5J0PA 4RQ4A 4F4YA 4KLMA 4J9RA 4OJOA 4R63A 3B0XA 3G6YA 4DF4A 7ICMA 4AP9A 1CUKA 8ICPA 4DSJA 7ICEA 3AL0B 4C8MA 3KOOA 2LMRA 3V6HA 5AI8A 1SWWA 4NLNA 5AK5A 4IRDA 1T7PA 5K4LA 2R8GA 1SXDA 2RQ5A 1KSPA 4RT2A 2EAPA 3Q8SB 1PK1A 3PV8A 3MGHA 4QWCA 1SL0A 2UVWA 2W04A 1T4GA 3QEBZ 2WF7A 2AQ0A 2K8CB 3RR8A 4YQWA 1SKRA 4DOCA 5ALYA 1KBUA 1ZRNA 1ZQNA 5AKGA 1N2XA 4RPYA 3E58A 3M1YA 1O03A 3CW2C 2C2DA 3BQ2A 2KG5A 5A0LA 5J2KA 5HP4A 1RDFA 1A0PA 2N1RA 3MDCA 5F9LA 1PK3A 2C2RA 4FO6A 4NLBA 4RQ2A 3TADC 2XO7A 2F8KA 2GWSA 4JB3A 5C0YA 3EYZA 1EXNA 3GQCA 3QNMA 1S76D 3NVVA 4DOAA 1TKDA 4UAUA 4J9QA 5IIMA 2AGQA 5G5GA 3EW9A 5KFOA 3HKZC 4UB1A 2UVVA 8ICJA 2E8OA 1HUZA 4RPZA 2XY5A 3PO4A 1NKBA 5KG6A 4LVSA 3TI0A 1TVAA 4LZDA 2G06A 3EWAA 4C7YA 4O3OA 1K1SA 3K75D 5ALEA 1ZETA 8ICBA 2DQNB 5EE0A 1WWUA 3C23A 4RQ6A 2KZZA 2IA6A 3GZFA 4ECUA 2PFQA 1UPHA 4QWAA 2QB1A 1X42A 2BCRA 4Y2YA 2PFNA 1WCLA 5AI9A 3ISDA 5KG5A 2HHTA 4U7CA 1OXJA 3KHGA 3TAQA 7ICVA 2PXIA 2YMLA 4C80A 4PHPA 4PZOA 3OGUA 2FMSA 4NL9C 5KT2A 4P4MA 3MGIA 4UAVA 3QYPA 2XC9A 3EPIA 3T5JA 4EEYA 5AK6A 2ASJA 1TV9A 1YT3A 1SXEA 3TFRA 4QIWF 3GV8B 4UAWA 9ICWA 2FMPA 4KITB 2LPEA 2AXTU 3RB4A 4Q43A 3BS5A 4PHEA 2XY6A 2AHOB 2H3QA 4J9NA 3PVXA 2VA3A 2JRZA 3WK6A 5AIBA 2NRZA 5ALJA 2A3VA 4F4ZA 1S9FA 4RNMA 3ZDAA 1UT5A 3MFHA 2E8NA 1IM4A 3JPTA 1PVQA 4M9JA 3U26A 4ECSA 2B6GA 3C21A 2BCQA 2E8MA 4DQSA 3OJSA 5EWGA 2LKYA 3GU3A 4QWDA 4BWJA 1OUQA 2OH2A 1ZQXA 1N5WA 2W7PA 2WTFA 3H8MA 2W9CB 8ICXA 3KKAA 1COKA 3V7LA 3NUQA 4QZ8A 4OO1J 4DSKA 1KFTA 3WKDA 3N28A 3ZDEA 4KN4A 5AM2A 1QTMA 1JN3A 5DBAA 4KLEA 3AUOA 3M8RA 1ZQVA 4US9A 4DF8A 1L7PA 4NLCA 5EOZA 1TK8A 4M2YA 3WK7A 3UMCA 3RJHA 8ICZA 3LWMA 4RU9A 3SENA 3CYMA 4M9NA 3TAPA 4PL2A 3NVYA 1KKXA 2YMMA 1AQ6A 2YTUA 3KD3A 7ICIA 4P0PB 2JEIA 1KL9A 2MUTB 2DUYA 2KJ5A 4MFCA 3HP6A 2C28A 2C2EA 5IILA 3RH6A 5G5HA 3CRXA 3SAFA 1XO1A 2MRLA 4F3OA 1Q3UA 4Y2PA 5CWRA 4J9PA 4DL6A 4BDPA 5KFAA 3HJEA 4F50A 3OJUA 4F5NA 2ZJ8A 2JV3A 1N48A 5DBCA 5BPCA 2IHNA 4ED0A 3WK5A 5AM0A 5CP2A 1BVSA 1O08A 1SV0C 5DGBA 3I76A 3TACB 1A77A 2BGWA 4DLEA 2NRVA 1FFVA 7ICPA 3ETRA 5J2JA 1BPBA 5AM1A 2Q0ZX 2K60A 3N7SC 1JRPA 4QW8A 3MDAA 4DO9A 1ZQOA 2QB0B 4QZIA 1URJA 2ESEA 4F5RA 9ICIA 4WJ3B 2KK0A 4Z6FA 2W54A 3H40A 5BOLA 2KFNA 1XNSA 1CEZA 3N97B 3AN1A 1NK5A 3R9KA 3KFUF 1SKWA 1AROP 1SGGA 3MC1A 4BX9C 4M9GA 4NLGA 1OW5A 4F93B 1UHUA 3AU2A 5KFVA 4UAZA 5AKLA 5ALQA 2XICA 3QU2A 3SEIA 3ALRA 4YXJA 3T5HA 3DDHA 3C2MA 4ED3A 1B4FA 2I1QA 5L1LA 4KLIA 1JXLA 4Y2RA 5J2GA 2JZBB 1ZQPA 2KHQA 2O6KA 1IIPA 1V97A 2FJ6A 3KHHA 3OSPA 2ASDA 2Y9UA 4KX5A 2W3RA 4R8UB 3UQ2A 4EZ9A 4YR3A 1F5SA 4F4XA 4M47A 3BQ0A 1ZD3A 3RF9A 4F71A 2FPKA 4YMNA 2OM6A 4O0IA 1ZRMA 3WKEA 2E8PA 5DKWA 4O5KA 4DQPA 4J9LA 4KLQA 2BCVA 1RYUA 5ALPA 1HEKA 1BPEA 3Q8KA 3QU9A 2EAOA 2HDOA 9ICCA 4Z6EA 4CE6A 3KBBA 1DGJA 4J9MA 5J0UA 3QU4A 3SD7A 4ED6A 5ALFA 4DCCA 4P0QB 3HT3A 2YMQA 1V38A 9ICTA 3T79A 3SAGA 3ONNA 2IOHA 3V7KA 3B9JA 4DWIA 4NL9A 3SMVA 2EZZA 3PSIA 1S0VA 1RZTA 1X2IA 4MF8A 4F5QA 5AI4A 2KJ9A 1ZQDA 3NS1A 2HOIA 1ZQLA 2DL0A 5AI5A 3QXGA 1C20A 4NJ8A 4K4GA 2M0NA 3PR5B 2BQRA 1K5OA 4YFKA 1F44A 4ECYA 1KN5A 3PR4A 1B22A 2HHUA 5HMLA 4EX7A 3M9NB 4PH5A 4YP3A 2H3ZA 1DK2A 5HHHA 1NKCA 1ZQWA 4FE3A 2HVIA 8ICFA 1LVHA 3K1RB 3L4PA 4GXKA 4J9KA 1VJ5A 4C8KA 4NY8A 5KFSA 5AIAA 5AKYA 2NYVA 3SAHA 3NVZA 2MUTA 3LVVA 2MSNA 4GLXA 2FLPA 1RPLA 2Y0SF 3WK9A 9ICEA 5KFEA 1TK0A 2EZYA 2ZIVA 1TAMA 1KW4A 5IIIA 4K4IA 3HPOA 5L1MA 9ICVA 5IIJA 2XGQA 5KG2A 3L5KA 1UQVA 5ALXA 2OYYA 3MR5A 2ZIUB 2VJ4A 1BPYA 4GC7A 3T5LA 3J81j 2WAQC 3WU2U 2HW3A 2AJQA 3G6XA 5T14A 4UATA 4RQ0A 9ICHA 9ICRA 5DDMA 1B0XA 3SZ2A 3KHLA 4Y2VA 2W9AA 3WK8A 1N5XA 3O0FA 1FEZA 3Q8MA 1Z3EB 5L1KA 4QZAA 3MBYA 2C22A 4O3MA 5ALHA 4YCXA 4KLTA 3KZXA 1JUDA 1Z4OA 4KLHA 1L7OA 2P35A 5KNIA 1Z1VA 3H0RB 1PZNA 2UVUA 2KJ8A 2LYAA 5KG1A 4M9HA 4QZFA 1BPDA 5J0RA 3PSTA 4DQIA 4CRXA 4DFPA 1YZ7A 1QSLA 2G5IB 2F77X 4JV1A 9ICMA 2DKZA 4XQ8A 2JEJA 4CDGA 9ICOA 1QH9A 4QJFB 4MEYA 4F2RA 1J2NA 1L7NA 3NRWA 2W03A 2ZIWA 2FPLA 4FZLA 2H5XA 2JHDA 1ZQHA 4ICAA 4PGYA 1ZQJA 1ZQUA 1ZQZA 2FE9A 2DPJA 5KFRA 3F2DA 1FO4A 8ICWA 1ZQFA 4P0QA 4O3RA 4ED7A 3L3FX 2NV3A 1XSPA 9ICXA 2JMGA 4BGDA 1VLBA 3QUTA 5ALWA 2YQEA 9ICBA 4DLGA 3KTQA 3IG8A 3NRZA 4M9LA 1KFSA 1ZQBA 4IL6U 1S0MA 4B9NA 3LVWA 4J9SA 3K1ZA 3PW0A 2V4QA 5DDYA 3ISCA 2AU0A 1ZQYA 5CB1A 5F9NA 4O3PA 3MR2A 4F92B 1A6SA 4M04A 2XVTA 1JXEA 4GXJA 1ZJMA 1NZPA 5J2CA 2RDIA 1ZQSA 8ICEA 3IP4B 3QX7A 2W8LA 1QQ6A 2ZJ5A 4QZBA 2W9CA 1SL2A 3ZI4A 2YN4A 4MFFA 3RAXA 3WKBA 2RDJA 4EYIB 5HR6A 2LM4A 3RFAA 4YXMA 4TUQA 2PFPA 4QWEA 4IQTA 3C28A 5ALLA 1NK4A 2W3SA 3ISBA 5EWEA 4KLFA 3AU6A 9ICLA 1TFRA 4UARA 5ALUA 5J2FA 4EYHB 1PVPA 4EENA 2OCEA 1X9XA 3I1YA 5CR0A 7ICOA 5CRXA 2YB4A 3N7PD 1XWLA 4UB8U 1S8OA 2I6XA 5HNKA 1NJXA 5KFPA 4DL3A 3AQFA 2AH5A 5HMMA 3QEAZ 4C7ZA 1N56A 3MR6A 3SR6A 4YMOA 1U48A 5KG3A 2XCAA 1QQ7A 4GFJA 5KTQA 5KFWA 4TUSA 1RYSA 2W9MA 2BHNA 1LV5A 1J2MA 4GIBA 4F4WA 5IIOA 1ZQEA 2OWOA 4LZGA 3GV5B 2ZG6A 1Y88A 4RUAA 3C2LA 7ICTA 4ECVA 4GC6A 2AGPA 2OEHA 2WF8A 3FC4A 1ZOLA 5J0QA 2I9GA 4R65A 4IQWA 4YG2A 7ICSA 3C5FA 2BQUA 4TURA 3T5KA 5DLGA 4EEKA 5KFMA 1S77D 4RQ7A 1TE2A 3GIKA 2QLTA 3QUBA 3OTQA 4RQ1A 4ED2A 5AHXA 2JH1A 2K8BB 3BZKA 1N63A 3BZCA 3M8SA 4I28A 3AM9A 1X9WA 1TAUA 4PGQA 2H3FA 1ZQCA 7ICNA 1UA0A 2BPFA 1D9DA 4KLLA 3VCBA 1U49A 4K4HA 5B66U 1XSNA 1RM6C 2JGAA 3F53A 1JROA 2CN1A 4KLSA 3UXPA 5F3XB 1S0NA 1ZQ1C 3OPXA 1IG6A 4R8UA 4KN7A 4EBDA 5DG8A 2F2AB 5DQHA 4RQNA 3NGDA 3BQ7A 2Y1JA 2KVSA 5KG0A 1LKYB 2BDUA 2XCPA 3ICXA 1XO0A 3JPNA 4ECQA 2KIWA 1N62A 5ALKA 4JWMA 3AEVA 2NRXA 5DB6A 4ECZA 2QARB 2PI4A 9ICJA 4Q8FA 3H0LB 7ICJA 1RXWA 4HAIA 3JPOA 2A1JA 7ICKA 5KFZA 5J0TA 9ICGA 4YN4A 2KTQA 1ZQTA 3RH4A 3PW5A 2AQ4A 4DL5A 3C1ZA 2E5SA 2KICA 2VA2A 4JWNA 2D3DA 2HCFA 4ED8A 3RTVA 4FS2A 4OJPA 2BDPA 4F4KA 4I2FA 1WUDA 4BXOA 5KFUA 1L8LA 7ICLA 3D2QA 4DQQA 5KFHA 2BPCA 3DV9A 3WK4A 3F5EA 4KLDA 2HI0A 3ZD8A 1MQ2A 4UB6U 3TARA 3CNHA 5AK3A 2KP7A 2JXJA 2FLNA 3PY8A 4B6JA 3AQEA 2LBOA 4ED1A 3RB3A 2G0AA 4C4SA 3V6KA 1WG8A 2NO4A 1FFUA 1SB3C 1NK0A 1LKYA 3H4BA 4DSIA 1SIJA 5DQIA 3EUB2 2LI6A 4A8EA 2YX8A 5KFKA 1L3VA 4KTQA 5J2BA 1XS9D 4ELUA 1QSYA 4F5PA 1S97A 1P7DA 2JZBA 3AMZA 1SKSA 4P2HA 8ICOA 5GTHU 4KLUA 4KMUA 5J0OA 5J2DA 2UVRA 1X6IA 4I2GA 2BZFA 2ZJAA 4Y2UA 2XI9A 3ZDDA 3GIIA 4O3QA 3GV7B 2PKEA 5KG7A 5DQGA 4OD0A 3PNCA 2A19A 3M7DA 3OHAA 4J03A 4M0AA 1XSLA 1ZXIA 2ATLA 4FZNA 4QZGA 2K8AA 4YD2A 2ZIVB 4QNLA 2JEGA 1SL1A 5KFGA 3V6JA 1NI3A 4OCZA 3ZDBA 2DWQA 4UASA 3RB0A 4B9MA 2Q4TA 3QUCA 4C8OA 3H8WA 2LHTA 4LJXA 2HSZA 2M9NA 1NK6A 3HRDD 4I2IA 5ALOA 4BXOB 5ALDA 3F5AA 1NK9A 3RRGA 4O3NA 5KT7A 3NTUA 2KD1A 4CCHA 4DS4A 5ALRA 3IM1A 1ZD4A 2EANA 2J6SA 4PZNA 5C5JA 1ZQAA 3KHRA 4P4OA 1L3TA 4Z6CA 4BWMA 4P4PA 2KE7A 1SWVA 1QCKA 2ISPA 5EE9A 3UPQA 1XC9A 1D8LA 5CA7A 5E79U 3BS5B 3IN5A 1BNPA 1X9MA 4RQMA 5KT4A 2D8CA 9ICUA 4NLZA 2VA8A 4HYKA 2WB1C 2JEFA 5D49A 1V85A 3SV3A 2W43A 5DG9A 4XUSA 5AI6A 1ZQMA 2NO5A 1Z19A 4DL7A 1DGSA 2ISOA 1ZJNA 4DOBA 1NK8A 4I2AA 4ECXA 1JX4A 4KLJA 4R64A 3RJIA 2KKPA 2IOFA 4Q44A 5KFXA 3F2BA 3EPGA 1JI7A 4ZH4A 4OJ5A 8ICSA 4TUPA 3PX4A 4ACOA 3RJJA 2E1FA 2H3VA 7ICHA 4Z6DA 2DKXA 2HMXA 3RR7A 1ED1A 4JK1A 2ZUCA 1KDHA 5TISU 5TZVA 3RBEA 2XIDA 3RJEA 1Q3VA 2Z7JA 2DF4B 2FPMA 1ECWA 1NNLA 2MU2A 3IDWA 2WB1F 3ZDCA 5AKIA 4B9TA 8ICKA 1HUOA 4BJQA 5CJ7A 5J2AA 9ICKA 2G07A 5KFLA 3JPQA 8ICUA 3UXNA 1HJPA 2ZIXB 2MAXA 1DOQA 9ICNA 3E0FA 2R8JA 2J6UA 4RZRA 4G9BA 2BCSA 4B9LA 2IMWP 4JV2A 4FS1A 2FI1A 4KLGA 5J0XA 4PJ0U 4Q45A 2HBJA 2FMQA 3KKAC 4QIWC 2HHXA 3FYHA 3RAQA 4QZDA 4JV0A 2FDRA 4AYBC 3WKAA 2R8HA 5J2HA 2A1JB 3ORYA 1S0OA 4JMUA 2KZ3A 2DFLA 5FP0A 1Q46A 3T3FA 1KQQA 4FFDA 3ETLA 2K4IA 3M6KA 2AGOA 5AI0A 4UQGA 1PUZA 2H3IA 2OXOA 1JIHA 2LYHA 5AKEA 3V7JA 4PPXA 4QZ9A 4E0DA 3BS7A 5J29A 4RUCA 2K4HA 5DLFA 4IQVA 2W7OA 1NJZA 1MQ3A 3NVWA 3OSNA 2G08A 5ALIA 2ZUBA 4PHAA 8ICRA 7ICFA 3F2CA 1BPZA 3Q8LA 4PL1A 2QARA 3RB6A 4F5OA 4Q8EA 1X6JA 2I5HA 2KMDA 3HX0A 3SYZA 2HBMA 3H8JA 4MHVA 1L7MA 2ES6A 1S10A 2B21A 5AKKA 2G5HB 4YD1A 3PX0A 3BJYA 1SZHA 2KSOB 4US8A 1WWVA 3IRUA 1SV0A 4EELA 1Z1BA 1L3UA 4QZHA 3RBDA 2Y9TA 1N61A 9ICAA 2VANA 3RH5A 2K89A 4CF5A 2QB0A 2L5YA 3OHBA 2ASLA 3IV6A 1JMSA 3MABA 3K4GA 1U47A 1NJWA 3I28A 2KKVA 4MFAA 5H2FU 5L1JA 4JUZA 5KT5A 1RQNA 2JH7A 1KLNA 2F1JA 5JU5A 3B0YA 5J8YC 3BQTA 3C1YA 2A1AA 5KFCA 2EAMA 8ICNA 2ODGA 3LDAA 4UB5A 4NV0A 4DSFA 1KRPA 3FAHA 1MSWD 5KT6A 1ZQIA 7ICUA 5ALTA 4F72A 2KHVA 1KTQA 1WCNA 4DL2A 1F0MA 2LM1A 1D8YA 2F8LA 2MA1A 4FBUA 5KFIA 1QSSA 1T94A 3LWLA 4DFDA 4Y2JA 1CRXA 1X40A 2ZXIA 2ZTEA 2E1EA 5DG7A 5AM4A 2OHFA 4QWBA 2ZTDA 5ALZA 3TADA 1ZQRA 8ICCA 1X9SA 2W11A 1ZQGA 4C0ZA 4UB2A 9ICFA 4BUGA 1Z00B 8ICQA 3Q8RB 2KN7A 1BPXA 2YY6A 4ELTA 2F1IA 1NK7A 5ALSA 4I2CA 3Q8QB 2W9BA 4B9UA 4TQSA 2DPIA 1QLNA 4IR1A 3IHQB 1Z00A 1ZYQA 3LYSA 5KFTA 5JUMA 2PMZF 2CPRA 1T3QA 4RNNA 3PX6A 3BQ1A 4TQRA 2R8KA 5B5EU 1U45A 2KNJA 2HVHA 3FDSA 5KT3A 5AKZA 3N4MB 3EZ5A 5J8YA 2E3TA 2IHMA 1TAQA 5CHGA 4OJ6A 4DFKA 2BPGA 1ZQQA 5BOMA 2WAQF 5L1IA 1T3NA 5AKHA 1B43A 1RQLA 4DL4A 2GO7A 3H8SA 2KVCA 5AM5A 3TANA 3CP8A 3V72A 3QU7A 3JPRA 3HKZF 3RJGA 1MC8A 3M9OB 5DB9A 4NLKA 3PMNA 3E2EA 3D2NA 3C5GA 4RQ3A 4RQ5A 1L6NA 1JALA 2JR5A 5ALMA 3RRHA 1U9LA 2HOFA 4CF4A 3C2KA 1BNOA 1YZ6A 5GTIU 3PZPA 4Y2TA 1V9PA 4ECTA 5AKJA 4F2SA 3H4DA 3ZD9A 3GIMA 5HR7A 1UT8A 1D9FA 4AYBF 1DK3A 2BCUA 2FLLA 4DS5A 4UB4A 4EBEA 4XA5A 1XU4A 3PSFA 4O3SA 4UBCA 4G3IA 5D4BA 2ALZA 2HOQA 4O9MA 2ZUDA 3FM9A 1HIWA 1S5LU 3PW7A 2ZXHA 2WHEA 2WF6A 2KFZA 5L9XA 4EBCA 7ICGA 2W8KA 2HHQA 2NRTA 4NWIA 4Y2XA 2Y0SC 3C29A 5KG4A 2YB1A 5EWFA 3HILA 2KEYA 3PSPA 5J0SA 3VC8A 4IS7A 4FBTA 1LB2B 2D6FC 1NZBA 2EQYA 2P66A 4IC9A 1PK1B 3QZ8A 5KFQA 2GLEA 2F1HA 3PW2A 2KZMA 2W9BB 5KFDA 2WF9A 2ZIUA 4YMMA 2V4RA 2GOLA 5IINA 7ICQA 1SV4A 3THVA 3TFSA 2KV2A 4IRKA 2P6UA 4UB3A 3MFIA 1FIQA 2XGPA 2G09A 2ZIWB 3RJFA 2F76X 1L8OA 4DFJA 3JPPA 3D6JA 4P0PA 1C7YA 1RG6A 5CEHA 3QE9Y 2QKQA 1DXSA 1D8BA 3GDXA 5DGAA 1ZD5A 4CGZA 8ICLA 4DSEA 3PMLA 2HHSA 4I2HA 5KFYA 4I2JA 4DSLA 2W55A 4C4RA 3BDPA 4O5EA 1IXRA 3ED5A 1CI4A 4F8RA 5AICA 2F3NA 3UM9A 1A76A 5D46A 4J9OA 1NOMA 5DB7A 2KIVA 4CF3A 1UCVA 2EDUA 4F91B 3TKAA 5EE1A 4B9SA 4USAA 4B9VA 4NM2A 1T8EA 4DFMA 2HBKA 5KL1B 1M6YA 5J0YA 1ZQKA 3SQIA 5JTIA 4QZEA 1K1QA 3H7IA 8ICTA 3JPSA 5AK4A 5J2EA 2ZIXA 9ICSA 5JRTA 4C8LA 1N60A 3A0HU 4RT3A 3NASA 1IV8A 2R8IA 5KFJA 5ALGA 3RJKA 4ELVA 8ICYA 5IIKA 2BKEA 4M6WB 2YMPA 3SV4A 3QUQA 4YR0A 2CRXA 2WF5A 1J97A 2NRWA 8ICIA 4KMOB 2BQ3A 5J2IA 1GO3F 5AKXA 1MN8A 2VJ5A 1NJYA 4ECRA 3QU5A 4UW9A 4RPXA 3GIJA 2R18A 2P6RA 3GILA 3UQ0A 4Y2QA 4O5CA 4GXIA 2RLTA 3WKCA 1ZD2P 1U4BA 1VDVA 4OJLA 3HW8A 2IOFK 2DGZA 9ICPA 2KSOA 4EX6A 3MGVA 3SI8A 5KL8B 3G6VA 1WYGA 4M6WA 4U6PA 3M9MB 4NXZA 5KFNA 4IRCA 3S6JA 2Y1IA 1COOA 4YR2A 5ALVA 1SZPA 1PVRA 3MR3A 4XRHA 1UA1A 1DRGA 3UMBA 2V9WA 4EZ6A 2J6TA 3Q8PB 3UXOA 4I2DA 7ICRA 2CXYA 5ALNA 4RNOA 2GH1A 3H0MB 2K4EA 2RHFA 2XY7A 4R66A 2HBLA 8ICHA 1L5UA 2VKQA 2BR0A 4ECWA 2PI5A 4MF2A 4DEZA 1TK5A 4UAYA 3M6ZA 4FZMA 1KFDA 8ICAA 4ZOHC 4NM1A 2RP5A 4I2BA 1NKEA 4I27A 4PGXA 5HHIA 4IR9A 2LYBA 2WFAA 5KFFA 4IQUA 3UMGA 5EE3A 5AM3A 1X66A 3QZ7A 1QQ5A 4CNQA 2KOBA 3DEEA 4UBBA 2K4PA 8ICGA 4Y2SA 2VIXA 2IBKA 2DBYA 4QW9A 3HWTA 4I29A 2EZXA 5KFBA 4YVZA 3PO5A
chains in the Genus database with same CATH topology
2F2AB 4FZLA 4P0PB 3N7RC 2JHDA 2KJ5A 3IG5A 4ICAA 4QIWF 1P7DA 2WAQF 2ZIUA 4OJLA 2BDUA 2GOLA 4JMUA 5C0YA 1Z19A 2DGZA 1PVPA 3ICXA 1XO0A 2KIWA 2KV2A 3CRXA 2KVCA 3SAHA 3SAFA 2K4IA 2PMZC 3MGVA 5CRXA 2MRLA 2YB4A 3M6KA 3LVVA 3N7PD 3RF9A 5KL8B 1Q3UA 2H3IA 3CP8A 4NV0A 3F2DA 2OXOA 2G09A 2XI9A 4P0QA 4U6PA 2Y0SF 2ZIWB 3L3FX 2F76X 2KKPA 2OM6A 2NV3A 3HKZF 2H3QA 1MA7A 4P0PA 2RRDA 3AQFA 2ZIVA 2K4HA 3F2BA 2W7OA 2KHVA 1TAMA 2JMGA 3H0LB 4OJ5A 3D2NA 2F8LA 2A3VA 3HKZC 2MA1A 2G08A 1L6NA 1HEKA 1T94A 4GFJA 3M7DA 3D2SA 1D8BA 1CRXA 4ACOA 2HOFA 2E1FA 2ZXIA 3F2CA 2OYYA 1PVRA 2H3VA 2ZIUB 4CGZA 2VJ4A 1PVQA 2HMXA 2E1EA 4PL1A 1DRGA 4KX3A 3PZPA 1ED1A 3IG8A 2WAQC 2ZG6A 2E5SA 3N7SC 2KICA 4FZNA 2XIDA 5T14A 2K8AA 2ZIVB 4QNLA 1Q3VA 2Z7JA 2DF4B 4OJOA 2HBMA 5HR7A 1ECWA 4OJPA 2G06A 3LVWA 4C0ZA 1URJA 2LKYA 2GH1A 2WB1F 4NLBA 1WUDA 3GU3A 2Q4TA 4AYBF 4P0QB 3K1ZA 4BUGA 3H0MB 2DQNB 2LHTA 2K4EA 2RHFA 4WJ3B 3AL0B 1OUQA 2OH2A 2W7PA 2HBLA 3O0FA 3D2QA 3T79A 3SAGA 3ONNA 3GZFA 2HBKA 4BJQA 5KL1B 3PSFA 3SMVA 2G07A 3F5AA 3PSIA 2VKQA 1XNSA 2G5HB 3SQIA 1UPHA 3NUQA 2KD1A 1SZHA 4O3MA 1A6SA 2HOQA 2JH1A 2XVTA 2K8BB 4OO1J 2KJ9A 2ZIXB 3M6ZA 3KZXA 1HIWA 4FZMA 2HOIA 3F5EA 3KFUF 4BX9C 2RP5A 2ZXHA 1Z1BA 2ZIXA 3E0FA 3H0RB 2W04A 2XICA 3ALRA 2LYBA 2KJ8A 4NWIA 2H3FA 3IP4B 2LYAA 4U7CA 2K8CB 2M0NA 2K89A 2Y0SC 3C29A 3LYSA 3VCBA 3PSTA 3AQEA 2LBOA 4CRXA 2G0AA 1F44A 1KBUA 2YB1A 2PMZF 2KOBA 4NLCA 3DEEA 2G5IB 2CPRA 2F77X 2CRXA 2JGAA 3IN5A 2HBJA 2VIXA 3F53A 2CN1A 4KMOB 2KEYA 2H3ZA 2KHQA 4QIWC 3PSPA 2KNJA 4CDGA 5A0LA 1GO3F 2KKVA 5HR6A 1IIPA 3CYMA 3VC8A 4PL2A 2VJ5A 4QJFB 4A8EA 4FE3A 1A0PA 2N1RA 3RFAA 4AYBC 1ZQ1C 2WB1C 2YX8A 3OPXA 1NZBA 2D6FC 4IC9A 2R18A 3C28A 2JH7A 3NRWA 4OJ6A 2W03A 2ZIWA 1YT3A 4KX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MA1 A;  1YT3 A;  2RHF A;  4QIW F;  1D8B A;  2HBL A;  3SAG A;  2E1F A;  4NLC A;  5C0Y A;  2HBK A;  2DGZ A;  4CGZ A;  2CPR A;  2E1E A;  2HBJ A;  2KV2 A;  3SAH A;  3SAF A;  4O3M A;  4OO1 J;  4CDG A;  1GO3 F;  3CYM A;  4QJF B;  2RRD A;  2HBM A;  1WUD A;  4NLB A; 
#chains in the Genus database with same CATH topology
 3KZI U;  3N7R C;  3IG5 A;  4C4T A;  5DB8 A;  3TQ1 A;  4I2E A;  1L3S A;  2ZTC A;  1BGX T;  4X5V A;  4PHD A;  2PMZ C;  2EH9 A;  3GFK B;  2F44 A;  5KAI U;  1MA7 A;  1Q8K A;  2RRD A;  5J0W A;  5DBB A;  4RQ8 A;  1RYR A;  4DQR A;  2PFO A;  4C8N A;  4KLO A;  8ICV A;  8ICM A;  2HHV A;  3D2S A;  2HHW A;  1RXV A;  3PW4 A;  4QZC A;  9ICQ A;  1KEJ A;  4MEX A;  3LK9 A;  5KAF U;  3A0B U;  4KX3 A;  1Z4N A;  2B0C A;  1H38 A;  5J0P A;  4RQ4 A;  4F4Y A;  4KLM A;  4J9R A;  4OJO A;  4R63 A;  3B0X A;  3G6Y A;  4DF4 A;  7ICM A;  4AP9 A;  1CUK A;  8ICP A;  4DSJ A;  7ICE A;  3AL0 B;  4C8M A;  3KOO A;  2LMR A;  3V6H A;  5AI8 A;  1SWW A;  4NLN A;  5AK5 A;  4IRD A;  1T7P A;  5K4L A;  2R8G A;  1SXD A;  2RQ5 A;  1KSP A;  4RT2 A;  2EAP A;  3Q8S B;  1PK1 A;  3PV8 A;  3MGH A;  4QWC A;  1SL0 A;  2UVW A;  2W04 A;  1T4G A;  3QEB Z;  2WF7 A;  2AQ0 A;  2K8C B;  3RR8 A;  4YQW A;  1SKR A;  4DOC A;  5ALY A;  1KBU A;  1ZRN A;  1ZQN A;  5AKG A;  1N2X A;  4RPY A;  3E58 A;  3M1Y A;  1O03 A;  3CW2 C;  2C2D A;  3BQ2 A;  2KG5 A;  5A0L A;  5J2K A;  5HP4 A;  1RDF A;  1A0P A;  2N1R A;  3MDC A;  5F9L A;  1PK3 A;  2C2R A;  4FO6 A;  4NLB A;  4RQ2 A;  3TAD C;  2XO7 A;  2F8K A;  2GWS A;  4JB3 A;  5C0Y A;  3EYZ A;  1EXN A;  3GQC A;  3QNM A;  1S76 D;  3NVV A;  4DOA A;  1TKD A;  4UAU A;  4J9Q A;  5IIM A;  2AGQ A;  5G5G A;  3EW9 A;  5KFO A;  3HKZ C;  4UB1 A;  2UVV A;  8ICJ A;  2E8O A;  1HUZ A;  4RPZ A;  2XY5 A;  3PO4 A;  1NKB A;  5KG6 A;  4LVS A;  3TI0 A;  1TVA A;  4LZD A;  2G06 A;  3EWA A;  4C7Y A;  4O3O A;  1K1S A;  3K75 D;  5ALE A;  1ZET A;  8ICB A;  2DQN B;  5EE0 A;  1WWU A;  3C23 A;  4RQ6 A;  2KZZ A;  2IA6 A;  3GZF A;  4ECU A;  2PFQ A;  1UPH A;  4QWA A;  2QB1 A;  1X42 A;  2BCR A;  4Y2Y A;  2PFN A;  1WCL A;  5AI9 A;  3ISD A;  5KG5 A;  2HHT A;  4U7C A;  1OXJ A;  3KHG A;  3TAQ A;  7ICV A;  2PXI A;  2YML A;  4C80 A;  4PHP A;  4PZO A;  3OGU A;  2FMS A;  4NL9 C;  5KT2 A;  4P4M A;  3MGI A;  4UAV A;  3QYP A;  2XC9 A;  3EPI A;  3T5J A;  4EEY A;  5AK6 A;  2ASJ A;  1TV9 A;  1YT3 A;  1SXE A;  3TFR A;  4QIW F;  3GV8 B;  4UAW A;  9ICW A;  2FMP A;  4KIT B;  2LPE A;  2AXT U;  3RB4 A;  4Q43 A;  3BS5 A;  4PHE A;  2XY6 A;  2AHO B;  2H3Q A;  4J9N A;  3PVX A;  2VA3 A;  2JRZ A;  3WK6 A;  5AIB A;  2NRZ A;  5ALJ A;  2A3V A;  4F4Z A;  1S9F A;  4RNM A;  3ZDA A;  1UT5 A;  3MFH A;  2E8N A;  1IM4 A;  3JPT A;  1PVQ A;  4M9J A;  3U26 A;  4ECS A;  2B6G A;  3C21 A;  2BCQ A;  2E8M A;  4DQS A;  3OJS A;  5EWG A;  2LKY A;  3GU3 A;  4QWD A;  4BWJ A;  1OUQ A;  2OH2 A;  1ZQX A;  1N5W A;  2W7P A;  2WTF A;  3H8M A;  2W9C B;  8ICX A;  3KKA A;  1COK A;  3V7L A;  3NUQ A;  4QZ8 A;  4OO1 J;  4DSK A;  1KFT A;  3WKD A;  3N28 A;  3ZDE A;  4KN4 A;  5AM2 A;  1QTM A;  1JN3 A;  5DBA A;  4KLE A;  3AUO A;  3M8R A;  1ZQV A;  4US9 A;  4DF8 A;  1L7P A;  4NLC A;  5EOZ A;  1TK8 A;  4M2Y A;  3WK7 A;  3UMC A;  3RJH A;  8ICZ A;  3LWM A;  4RU9 A;  3SEN A;  3CYM A;  4M9N A;  3TAP A;  4PL2 A;  3NVY A;  1KKX A;  2YMM A;  1AQ6 A;  2YTU A;  3KD3 A;  7ICI A;  4P0P B;  2JEI A;  1KL9 A;  2MUT B;  2DUY A;  2KJ5 A;  4MFC A;  3HP6 A;  2C28 A;  2C2E A;  5IIL A;  3RH6 A;  5G5H A;  3CRX A;  3SAF A;  1XO1 A;  2MRL A;  4F3O A;  1Q3U A;  4Y2P A;  5CWR A;  4J9P A;  4DL6 A;  4BDP A;  5KFA A;  3HJE A;  4F50 A;  3OJU A;  4F5N A;  2ZJ8 A;  2JV3 A;  1N48 A;  5DBC A;  5BPC A;  2IHN A;  4ED0 A;  3WK5 A;  5AM0 A;  5CP2 A;  1BVS A;  1O08 A;  1SV0 C;  5DGB A;  3I76 A;  3TAC B;  1A77 A;  2BGW A;  4DLE A;  2NRV A;  1FFV A;  7ICP A;  3ETR A;  5J2J A;  1BPB A;  5AM1 A;  2Q0Z X;  2K60 A;  3N7S C;  1JRP A;  4QW8 A;  3MDA A;  4DO9 A;  1ZQO A;  2QB0 B;  4QZI A;  1URJ A;  2ESE A;  4F5R A;  9ICI A;  4WJ3 B;  2KK0 A;  4Z6F A;  2W54 A;  3H40 A;  5BOL A;  2KFN A;  1XNS A;  1CEZ A;  3N97 B;  3AN1 A;  1NK5 A;  3R9K A;  3KFU F;  1SKW A;  1ARO P;  1SGG A;  3MC1 A;  4BX9 C;  4M9G A;  4NLG A;  1OW5 A;  4F93 B;  1UHU A;  3AU2 A;  5KFV A;  4UAZ A;  5AKL A;  5ALQ A;  2XIC A;  3QU2 A;  3SEI A;  3ALR A;  4YXJ A;  3T5H A;  3DDH A;  3C2M A;  4ED3 A;  1B4F A;  2I1Q A;  5L1L A;  4KLI A;  1JXL A;  4Y2R A;  5J2G A;  2JZB B;  1ZQP A;  2KHQ A;  2O6K A;  1IIP A;  1V97 A;  2FJ6 A;  3KHH A;  3OSP A;  2ASD A;  2Y9U A;  4KX5 A;  2W3R A;  4R8U B;  3UQ2 A;  4EZ9 A;  4YR3 A;  1F5S A;  4F4X A;  4M47 A;  3BQ0 A;  1ZD3 A;  3RF9 A;  4F71 A;  2FPK A;  4YMN A;  2OM6 A;  4O0I A;  1ZRM A;  3WKE A;  2E8P A;  5DKW A;  4O5K A;  4DQP A;  4J9L A;  4KLQ A;  2BCV A;  1RYU A;  5ALP A;  1HEK A;  1BPE A;  3Q8K A;  3QU9 A;  2EAO A;  2HDO A;  9ICC A;  4Z6E A;  4CE6 A;  3KBB A;  1DGJ A;  4J9M A;  5J0U A;  3QU4 A;  3SD7 A;  4ED6 A;  5ALF A;  4DCC A;  4P0Q B;  3HT3 A;  2YMQ A;  1V38 A;  9ICT A;  3T79 A;  3SAG A;  3ONN A;  2IOH A;  3V7K A;  3B9J A;  4DWI A;  4NL9 A;  3SMV A;  2EZZ A;  3PSI A;  1S0V A;  1RZT A;  1X2I A;  4MF8 A;  4F5Q A;  5AI4 A;  2KJ9 A;  1ZQD A;  3NS1 A;  2HOI A;  1ZQL A;  2DL0 A;  5AI5 A;  3QXG A;  1C20 A;  4NJ8 A;  4K4G A;  2M0N A;  3PR5 B;  2BQR A;  1K5O A;  4YFK A;  1F44 A;  4ECY A;  1KN5 A;  3PR4 A;  1B22 A;  2HHU A;  5HML A;  4EX7 A;  3M9N B;  4PH5 A;  4YP3 A;  2H3Z A;  1DK2 A;  5HHH A;  1NKC A;  1ZQW A;  4FE3 A;  2HVI A;  8ICF A;  1LVH A;  3K1R B;  3L4P A;  4GXK A;  4J9K A;  1VJ5 A;  4C8K A;  4NY8 A;  5KFS A;  5AIA A;  5AKY A;  2NYV A;  3SAH A;  3NVZ A;  2MUT A;  3LVV A;  2MSN A;  4GLX A;  2FLP A;  1RPL A;  2Y0S F;  3WK9 A;  9ICE A;  5KFE A;  1TK0 A;  2EZY A;  2ZIV A;  1TAM A;  1KW4 A;  5III A;  4K4I A;  3HPO A;  5L1M A;  9ICV A;  5IIJ A;  2XGQ A;  5KG2 A;  3L5K A;  1UQV A;  5ALX A;  2OYY A;  3MR5 A;  2ZIU B;  2VJ4 A;  1BPY A;  4GC7 A;  3T5L A;  3J81 j;  2WAQ C;  3WU2 U;  2HW3 A;  2AJQ A;  3G6X A;  5T14 A;  4UAT A;  4RQ0 A;  9ICH A;  9ICR A;  5DDM A;  1B0X A;  3SZ2 A;  3KHL A;  4Y2V A;  2W9A A;  3WK8 A;  1N5X A;  3O0F A;  1FEZ A;  3Q8M A;  1Z3E B;  5L1K A;  4QZA A;  3MBY A;  2C22 A;  4O3M A;  5ALH A;  4YCX A;  4KLT A;  3KZX A;  1JUD A;  1Z4O A;  4KLH A;  1L7O A;  2P35 A;  5KNI A;  1Z1V A;  3H0R B;  1PZN A;  2UVU A;  2KJ8 A;  2LYA A;  5KG1 A;  4M9H A;  4QZF A;  1BPD A;  5J0R A;  3PST A;  4DQI A;  4CRX A;  4DFP A;  1YZ7 A;  1QSL A;  2G5I B;  2F77 X;  4JV1 A;  9ICM A;  2DKZ A;  4XQ8 A;  2JEJ A;  4CDG A;  9ICO A;  1QH9 A;  4QJF B;  4MEY A;  4F2R A;  1J2N A;  1L7N A;  3NRW A;  2W03 A;  2ZIW A;  2FPL A;  4FZL A;  2H5X A;  2JHD A;  1ZQH A;  4ICA A;  4PGY A;  1ZQJ A;  1ZQU A;  1ZQZ A;  2FE9 A;  2DPJ A;  5KFR A;  3F2D A;  1FO4 A;  8ICW A;  1ZQF A;  4P0Q A;  4O3R A;  4ED7 A;  3L3F X;  2NV3 A;  1XSP A;  9ICX A;  2JMG A;  4BGD A;  1VLB A;  3QUT A;  5ALW A;  2YQE A;  9ICB A;  4DLG A;  3KTQ A;  3IG8 A;  3NRZ A;  4M9L A;  1KFS A;  1ZQB A;  4IL6 U;  1S0M A;  4B9N A;  3LVW A;  4J9S A;  3K1Z A;  3PW0 A;  2V4Q A;  5DDY A;  3ISC A;  2AU0 A;  1ZQY A;  5CB1 A;  5F9N A;  4O3P A;  3MR2 A;  4F92 B;  1A6S A;  4M04 A;  2XVT A;  1JXE A;  4GXJ A;  1ZJM A;  1NZP A;  5J2C A;  2RDI A;  1ZQS A;  8ICE A;  3IP4 B;  3QX7 A;  2W8L A;  1QQ6 A;  2ZJ5 A;  4QZB A;  2W9C A;  1SL2 A;  3ZI4 A;  2YN4 A;  4MFF A;  3RAX A;  3WKB A;  2RDJ A;  4EYI B;  5HR6 A;  2LM4 A;  3RFA A;  4YXM A;  4TUQ A;  2PFP A;  4QWE A;  4IQT A;  3C28 A;  5ALL A;  1NK4 A;  2W3S A;  3ISB A;  5EWE A;  4KLF A;  3AU6 A;  9ICL A;  1TFR A;  4UAR A;  5ALU A;  5J2F A;  4EYH B;  1PVP A;  4EEN A;  2OCE A;  1X9X A;  3I1Y A;  5CR0 A;  7ICO A;  5CRX A;  2YB4 A;  3N7P D;  1XWL A;  4UB8 U;  1S8O A;  2I6X A;  5HNK A;  1NJX A;  5KFP A;  4DL3 A;  3AQF A;  2AH5 A;  5HMM A;  3QEA Z;  4C7Z A;  1N56 A;  3MR6 A;  3SR6 A;  4YMO A;  1U48 A;  5KG3 A;  2XCA A;  1QQ7 A;  4GFJ A;  5KTQ A;  5KFW A;  4TUS A;  1RYS A;  2W9M A;  2BHN A;  1LV5 A;  1J2M A;  4GIB A;  4F4W A;  5IIO A;  1ZQE A;  2OWO A;  4LZG A;  3GV5 B;  2ZG6 A;  1Y88 A;  4RUA A;  3C2L A;  7ICT A;  4ECV A;  4GC6 A;  2AGP A;  2OEH A;  2WF8 A;  3FC4 A;  1ZOL A;  5J0Q A;  2I9G A;  4R65 A;  4IQW A;  4YG2 A;  7ICS A;  3C5F A;  2BQU A;  4TUR A;  3T5K A;  5DLG A;  4EEK A;  5KFM A;  1S77 D;  4RQ7 A;  1TE2 A;  3GIK A;  2QLT A;  3QUB A;  3OTQ A;  4RQ1 A;  4ED2 A;  5AHX A;  2JH1 A;  2K8B B;  3BZK A;  1N63 A;  3BZC A;  3M8S A;  4I28 A;  3AM9 A;  1X9W A;  1TAU A;  4PGQ A;  2H3F A;  1ZQC A;  7ICN A;  1UA0 A;  2BPF A;  1D9D A;  4KLL A;  3VCB A;  1U49 A;  4K4H A;  5B66 U;  1XSN A;  1RM6 C;  2JGA A;  3F53 A;  1JRO A;  2CN1 A;  4KLS A;  3UXP A;  5F3X B;  1S0N A;  1ZQ1 C;  3OPX A;  1IG6 A;  4R8U A;  4KN7 A;  4EBD A;  5DG8 A;  2F2A B;  5DQH A;  4RQN A;  3NGD A;  3BQ7 A;  2Y1J A;  2KVS A;  5KG0 A;  1LKY B;  2BDU A;  2XCP A;  3ICX A;  1XO0 A;  3JPN A;  4ECQ A;  2KIW A;  1N62 A;  5ALK A;  4JWM A;  3AEV A;  2NRX A;  5DB6 A;  4ECZ A;  2QAR B;  2PI4 A;  9ICJ A;  4Q8F A;  3H0L B;  7ICJ A;  1RXW A;  4HAI A;  3JPO A;  2A1J A;  7ICK A;  5KFZ A;  5J0T A;  9ICG A;  4YN4 A;  2KTQ A;  1ZQT A;  3RH4 A;  3PW5 A;  2AQ4 A;  4DL5 A;  3C1Z A;  2E5S A;  2KIC A;  2VA2 A;  4JWN A;  2D3D A;  2HCF A;  4ED8 A;  3RTV A;  4FS2 A;  4OJP A;  2BDP A;  4F4K A;  4I2F A;  1WUD A;  4BXO A;  5KFU A;  1L8L A;  7ICL A;  3D2Q A;  4DQQ A;  5KFH A;  2BPC A;  3DV9 A;  3WK4 A;  3F5E A;  4KLD A;  2HI0 A;  3ZD8 A;  1MQ2 A;  4UB6 U;  3TAR A;  3CNH A;  5AK3 A;  2KP7 A;  2JXJ A;  2FLN A;  3PY8 A;  4B6J A;  3AQE A;  2LBO A;  4ED1 A;  3RB3 A;  2G0A A;  4C4S A;  3V6K A;  1WG8 A;  2NO4 A;  1FFU A;  1SB3 C;  1NK0 A;  1LKY A;  3H4B A;  4DSI A;  1SIJ A;  5DQI A;  3EUB 2;  2LI6 A;  4A8E A;  2YX8 A;  5KFK A;  1L3V A;  4KTQ A;  5J2B A;  1XS9 D;  4ELU A;  1QSY A;  4F5P A;  1S97 A;  1P7D A;  2JZB A;  3AMZ A;  1SKS A;  4P2H A;  8ICO A;  5GTH U;  4KLU A;  4KMU A;  5J0O A;  5J2D A;  2UVR A;  1X6I A;  4I2G A;  2BZF A;  2ZJA A;  4Y2U A;  2XI9 A;  3ZDD A;  3GII A;  4O3Q A;  3GV7 B;  2PKE A;  5KG7 A;  5DQG A;  4OD0 A;  3PNC A;  2A19 A;  3M7D A;  3OHA A;  4J03 A;  4M0A A;  1XSL A;  1ZXI A;  2ATL A;  4FZN A;  4QZG A;  2K8A A;  4YD2 A;  2ZIV B;  4QNL A;  2JEG A;  1SL1 A;  5KFG A;  3V6J A;  1NI3 A;  4OCZ A;  3ZDB A;  2DWQ A;  4UAS A;  3RB0 A;  4B9M A;  2Q4T A;  3QUC A;  4C8O A;  3H8W A;  2LHT A;  4LJX A;  2HSZ A;  2M9N A;  1NK6 A;  3HRD D;  4I2I A;  5ALO A;  4BXO B;  5ALD A;  3F5A A;  1NK9 A;  3RRG A;  4O3N A;  5KT7 A;  3NTU A;  2KD1 A;  4CCH A;  4DS4 A;  5ALR A;  3IM1 A;  1ZD4 A;  2EAN A;  2J6S A;  4PZN A;  5C5J A;  1ZQA A;  3KHR A;  4P4O A;  1L3T A;  4Z6C A;  4BWM A;  4P4P A;  2KE7 A;  1SWV A;  1QCK A;  2ISP A;  5EE9 A;  3UPQ A;  1XC9 A;  1D8L A;  5CA7 A;  5E79 U;  3BS5 B;  3IN5 A;  1BNP A;  1X9M A;  4RQM A;  5KT4 A;  2D8C A;  9ICU A;  4NLZ A;  2VA8 A;  4HYK A;  2WB1 C;  2JEF A;  5D49 A;  1V85 A;  3SV3 A;  2W43 A;  5DG9 A;  4XUS A;  5AI6 A;  1ZQM A;  2NO5 A;  1Z19 A;  4DL7 A;  1DGS A;  2ISO A;  1ZJN A;  4DOB A;  1NK8 A;  4I2A A;  4ECX A;  1JX4 A;  4KLJ A;  4R64 A;  3RJI A;  2KKP A;  2IOF A;  4Q44 A;  5KFX A;  3F2B A;  3EPG A;  1JI7 A;  4ZH4 A;  4OJ5 A;  8ICS A;  4TUP A;  3PX4 A;  4ACO A;  3RJJ A;  2E1F A;  2H3V A;  7ICH A;  4Z6D A;  2DKX A;  2HMX A;  3RR7 A;  1ED1 A;  4JK1 A;  2ZUC A;  1KDH A;  5TIS U;  5TZV A;  3RBE A;  2XID A;  3RJE A;  1Q3V A;  2Z7J A;  2DF4 B;  2FPM A;  1ECW A;  1NNL A;  2MU2 A;  3IDW A;  2WB1 F;  3ZDC A;  5AKI A;  4B9T A;  8ICK A;  1HUO A;  4BJQ A;  5CJ7 A;  5J2A A;  9ICK A;  2G07 A;  5KFL A;  3JPQ A;  8ICU A;  3UXN A;  1HJP A;  2ZIX B;  2MAX A;  1DOQ A;  9ICN A;  3E0F A;  2R8J A;  2J6U A;  4RZR A;  4G9B A;  2BCS A;  4B9L A;  2IMW P;  4JV2 A;  4FS1 A;  2FI1 A;  4KLG A;  5J0X A;  4PJ0 U;  4Q45 A;  2HBJ A;  2FMQ A;  3KKA C;  4QIW C;  2HHX A;  3FYH A;  3RAQ A;  4QZD A;  4JV0 A;  2FDR A;  4AYB C;  3WKA A;  2R8H A;  5J2H A;  2A1J B;  3ORY A;  1S0O A;  4JMU A;  2KZ3 A;  2DFL A;  5FP0 A;  1Q46 A;  3T3F A;  1KQQ A;  4FFD A;  3ETL A;  2K4I A;  3M6K A;  2AGO A;  5AI0 A;  4UQG A;  1PUZ A;  2H3I A;  2OXO A;  1JIH A;  2LYH A;  5AKE A;  3V7J A;  4PPX A;  4QZ9 A;  4E0D A;  3BS7 A;  5J29 A;  4RUC A;  2K4H A;  5DLF A;  4IQV A;  2W7O A;  1NJZ A;  1MQ3 A;  3NVW A;  3OSN A;  2G08 A;  5ALI A;  2ZUB A;  4PHA A;  8ICR A;  7ICF A;  3F2C A;  1BPZ A;  3Q8L A;  4PL1 A;  2QAR A;  3RB6 A;  4F5O A;  4Q8E A;  1X6J A;  2I5H A;  2KMD A;  3HX0 A;  3SYZ A;  2HBM A;  3H8J A;  4MHV A;  1L7M A;  2ES6 A;  1S10 A;  2B21 A;  5AKK A;  2G5H B;  4YD1 A;  3PX0 A;  3BJY A;  1SZH A;  2KSO B;  4US8 A;  1WWV A;  3IRU A;  1SV0 A;  4EEL A;  1Z1B A;  1L3U A;  4QZH A;  3RBD A;  2Y9T A;  1N61 A;  9ICA A;  2VAN A;  3RH5 A;  2K89 A;  4CF5 A;  2QB0 A;  2L5Y A;  3OHB A;  2ASL A;  3IV6 A;  1JMS A;  3MAB A;  3K4G A;  1U47 A;  1NJW A;  3I28 A;  2KKV A;  4MFA A;  5H2F U;  5L1J A;  4JUZ A;  5KT5 A;  1RQN A;  2JH7 A;  1KLN A;  2F1J A;  5JU5 A;  3B0Y A;  5J8Y C;  3BQT A;  3C1Y A;  2A1A A;  5KFC A;  2EAM A;  8ICN A;  2ODG A;  3LDA A;  4UB5 A;  4NV0 A;  4DSF A;  1KRP A;  3FAH A;  1MSW D;  5KT6 A;  1ZQI A;  7ICU A;  5ALT A;  4F72 A;  2KHV A;  1KTQ A;  1WCN A;  4DL2 A;  1F0M A;  2LM1 A;  1D8Y A;  2F8L A;  2MA1 A;  4FBU A;  5KFI A;  1QSS A;  1T94 A;  3LWL A;  4DFD A;  4Y2J A;  1CRX A;  1X40 A;  2ZXI A;  2ZTE A;  2E1E A;  5DG7 A;  5AM4 A;  2OHF A;  4QWB A;  2ZTD A;  5ALZ A;  3TAD A;  1ZQR A;  8ICC A;  1X9S A;  2W11 A;  1ZQG A;  4C0Z A;  4UB2 A;  9ICF A;  4BUG A;  1Z00 B;  8ICQ A;  3Q8R B;  2KN7 A;  1BPX A;  2YY6 A;  4ELT A;  2F1I A;  1NK7 A;  5ALS A;  4I2C A;  3Q8Q B;  2W9B A;  4B9U A;  4TQS A;  2DPI A;  1QLN A;  4IR1 A;  3IHQ B;  1Z00 A;  1ZYQ A;  3LYS A;  5KFT A;  5JUM A;  2PMZ F;  2CPR A;  1T3Q A;  4RNN A;  3PX6 A;  3BQ1 A;  4TQR A;  2R8K A;  5B5E U;  1U45 A;  2KNJ A;  2HVH A;  3FDS A;  5KT3 A;  5AKZ A;  3N4M B;  3EZ5 A;  5J8Y A;  2E3T A;  2IHM A;  1TAQ A;  5CHG A;  4OJ6 A;  4DFK A;  2BPG A;  1ZQQ A;  5BOM A;  2WAQ F;  5L1I A;  1T3N A;  5AKH A;  1B43 A;  1RQL A;  4DL4 A;  2GO7 A;  3H8S A;  2KVC A;  5AM5 A;  3TAN A;  3CP8 A;  3V72 A;  3QU7 A;  3JPR A;  3HKZ F;  3RJG A;  1MC8 A;  3M9O B;  5DB9 A;  4NLK A;  3PMN A;  3E2E A;  3D2N A;  3C5G A;  4RQ3 A;  4RQ5 A;  1L6N A;  1JAL A;  2JR5 A;  5ALM A;  3RRH A;  1U9L A;  2HOF A;  4CF4 A;  3C2K A;  1BNO A;  1YZ6 A;  5GTI U;  3PZP A;  4Y2T A;  1V9P A;  4ECT A;  5AKJ A;  4F2S A;  3H4D A;  3ZD9 A;  3GIM A;  5HR7 A;  1UT8 A;  1D9F A;  4AYB F;  1DK3 A;  2BCU A;  2FLL A;  4DS5 A;  4UB4 A;  4EBE A;  4XA5 A;  1XU4 A;  3PSF A;  4O3S A;  4UBC A;  4G3I A;  5D4B A;  2ALZ A;  2HOQ A;  4O9M A;  2ZUD A;  3FM9 A;  1HIW A;  1S5L U;  3PW7 A;  2ZXH A;  2WHE A;  2WF6 A;  2KFZ A;  5L9X A;  4EBC A;  7ICG A;  2W8K A;  2HHQ A;  2NRT A;  4NWI A;  4Y2X A;  2Y0S C;  3C29 A;  5KG4 A;  2YB1 A;  5EWF A;  3HIL A;  2KEY A;  3PSP A;  5J0S A;  3VC8 A;  4IS7 A;  4FBT A;  1LB2 B;  2D6F C;  1NZB A;  2EQY A;  2P66 A;  4IC9 A;  1PK1 B;  3QZ8 A;  5KFQ A;  2GLE A;  2F1H A;  3PW2 A;  2KZM A;  2W9B B;  5KFD A;  2WF9 A;  2ZIU A;  4YMM A;  2V4R A;  2GOL A;  5IIN A;  7ICQ A;  1SV4 A;  3THV A;  3TFS A;  2KV2 A;  4IRK A;  2P6U A;  4UB3 A;  3MFI A;  1FIQ A;  2XGP A;  2G09 A;  2ZIW B;  3RJF A;  2F76 X;  1L8O A;  4DFJ A;  3JPP A;  3D6J A;  4P0P A;  1C7Y A;  1RG6 A;  5CEH A;  3QE9 Y;  2QKQ A;  1DXS A;  1D8B A;  3GDX A;  5DGA A;  1ZD5 A;  4CGZ A;  8ICL A;  4DSE A;  3PML A;  2HHS A;  4I2H A;  5KFY A;  4I2J A;  4DSL A;  2W55 A;  4C4R A;  3BDP A;  4O5E A;  1IXR A;  3ED5 A;  1CI4 A;  4F8R A;  5AIC A;  2F3N A;  3UM9 A;  1A76 A;  5D46 A;  4J9O A;  1NOM A;  5DB7 A;  2KIV A;  4CF3 A;  1UCV A;  2EDU A;  4F91 B;  3TKA A;  5EE1 A;  4B9S A;  4USA A;  4B9V A;  4NM2 A;  1T8E A;  4DFM A;  2HBK A;  5KL1 B;  1M6Y A;  5J0Y A;  1ZQK A;  3SQI A;  5JTI A;  4QZE A;  1K1Q A;  3H7I A;  8ICT A;  3JPS A;  5AK4 A;  5J2E A;  2ZIX A;  9ICS A;  5JRT A;  4C8L A;  1N60 A;  3A0H U;  4RT3 A;  3NAS A;  1IV8 A;  2R8I A;  5KFJ A;  5ALG A;  3RJK A;  4ELV A;  8ICY A;  5IIK A;  2BKE A;  4M6W B;  2YMP A;  3SV4 A;  3QUQ A;  4YR0 A;  2CRX A;  2WF5 A;  1J97 A;  2NRW A;  8ICI A;  4KMO B;  2BQ3 A;  5J2I A;  1GO3 F;  5AKX A;  1MN8 A;  2VJ5 A;  1NJY A;  4ECR A;  3QU5 A;  4UW9 A;  4RPX A;  3GIJ A;  2R18 A;  2P6R A;  3GIL A;  3UQ0 A;  4Y2Q A;  4O5C A;  4GXI A;  2RLT A;  3WKC A;  1ZD2 P;  1U4B A;  1VDV A;  4OJL A;  3HW8 A;  2IOF K;  2DGZ A;  9ICP A;  2KSO A;  4EX6 A;  3MGV A;  3SI8 A;  5KL8 B;  3G6V A;  1WYG A;  4M6W A;  4U6P A;  3M9M B;  4NXZ A;  5KFN A;  4IRC A;  3S6J A;  2Y1I A;  1COO A;  4YR2 A;  5ALV A;  1SZP A;  1PVR A;  3MR3 A;  4XRH A;  1UA1 A;  1DRG A;  3UMB A;  2V9W A;  4EZ6 A;  2J6T A;  3Q8P B;  3UXO A;  4I2D A;  7ICR A;  2CXY A;  5ALN A;  4RNO A;  2GH1 A;  3H0M B;  2K4E A;  2RHF A;  2XY7 A;  4R66 A;  2HBL A;  8ICH A;  1L5U A;  2VKQ A;  2BR0 A;  4ECW A;  2PI5 A;  4MF2 A;  4DEZ A;  1TK5 A;  4UAY A;  3M6Z A;  4FZM A;  1KFD A;  8ICA A;  4ZOH C;  4NM1 A;  2RP5 A;  4I2B A;  1NKE A;  4I27 A;  4PGX A;  5HHI A;  4IR9 A;  2LYB A;  2WFA A;  5KFF A;  4IQU A;  3UMG A;  5EE3 A;  5AM3 A;  1X66 A;  3QZ7 A;  1QQ5 A;  4CNQ A;  2KOB A;  3DEE A;  4UBB A;  2K4P A;  8ICG A;  4Y2S A;  2VIX A;  2IBK A;  2DBY A;  4QW9 A;  3HWT A;  4I29 A;  2EZX A;  5KFB A;  4YVZ A;  3PO5 A; 
#chains in the Genus database with same CATH homology
 2F2A B;  4FZL A;  4P0P B;  3N7R C;  2JHD A;  2KJ5 A;  3IG5 A;  4ICA A;  4QIW F;  1P7D A;  2WAQ F;  2ZIU A;  4OJL A;  2BDU A;  2GOL A;  4JMU A;  5C0Y A;  1Z19 A;  2DGZ A;  1PVP A;  3ICX A;  1XO0 A;  2KIW A;  2KV2 A;  3CRX A;  2KVC A;  3SAH A;  3SAF A;  2K4I A;  2PMZ C;  3MGV A;  5CRX A;  2MRL A;  2YB4 A;  3M6K A;  3LVV A;  3N7P D;  3RF9 A;  5KL8 B;  1Q3U A;  2H3I A;  3CP8 A;  4NV0 A;  3F2D A;  2OXO A;  2G09 A;  2XI9 A;  4P0Q A;  4U6P A;  2Y0S F;  2ZIW B;  3L3F X;  2F76 X;  2KKP A;  2OM6 A;  2NV3 A;  3HKZ F;  2H3Q A;  1MA7 A;  4P0P A;  2RRD A;  3AQF A;  2ZIV A;  2K4H A;  3F2B A;  2W7O A;  2KHV A;  1TAM A;  2JMG A;  3H0L B;  4OJ5 A;  3D2N A;  2F8L A;  2A3V A;  3HKZ C;  2MA1 A;  2G08 A;  1L6N A;  1HEK A;  1T94 A;  4GFJ A;  3M7D A;  3D2S A;  1D8B A;  1CRX A;  4ACO A;  2HOF A;  2E1F A;  2ZXI A;  3F2C A;  2OYY A;  1PVR A;  2H3V A;  2ZIU B;  4CGZ A;  2VJ4 A;  1PVQ A;  2HMX A;  2E1E A;  4PL1 A;  1DRG A;  4KX3 A;  3PZP A;  1ED1 A;  3IG8 A;  2WAQ C;  2ZG6 A;  2E5S A;  3N7S C;  2KIC A;  4FZN A;  2XID A;  5T14 A;  2K8A A;  2ZIV B;  4QNL A;  1Q3V A;  2Z7J A;  2DF4 B;  4OJO A;  2HBM A;  5HR7 A;  1ECW A;  4OJP A;  2G06 A;  3LVW A;  4C0Z A;  1URJ A;  2LKY A;  2GH1 A;  2WB1 F;  4NLB A;  1WUD A;  3GU3 A;  2Q4T A;  4AYB F;  4P0Q B;  3K1Z A;  4BUG A;  3H0M B;  2DQN B;  2LHT A;  2K4E A;  2RHF A;  4WJ3 B;  3AL0 B;  1OUQ A;  2OH2 A;  2W7P A;  2HBL A;  3O0F A;  3D2Q A;  3T79 A;  3SAG A;  3ONN A;  3GZF A;  2HBK A;  4BJQ A;  5KL1 B;  3PSF A;  3SMV A;  2G07 A;  3F5A A;  3PSI A;  2VKQ A;  1XNS A;  2G5H B;  3SQI A;  1UPH A;  3NUQ A;  2KD1 A;  1SZH A;  4O3M A;  1A6S A;  2HOQ A;  2JH1 A;  2XVT A;  2K8B B;  4OO1 J;  2KJ9 A;  2ZIX B;  3M6Z A;  3KZX A;  1HIW A;  4FZM A;  2HOI A;  3F5E A;  3KFU F;  4BX9 C;  2RP5 A;  2ZXH A;  1Z1B A;  2ZIX A;  3E0F A;  3H0R B;  2W04 A;  2XIC A;  3ALR A;  2LYB A;  2KJ8 A;  4NWI A;  2H3F A;  3IP4 B;  2LYA A;  4U7C A;  2K8C B;  2M0N A;  2K89 A;  2Y0S C;  3C29 A;  3LYS A;  3VCB A;  3PST A;  3AQE A;  2LBO A;  4CRX A;  2G0A A;  1F44 A;  1KBU A;  2YB1 A;  2PMZ F;  2KOB A;  4NLC A;  3DEE A;  2G5I B;  2CPR A;  2F77 X;  2CRX A;  2JGA A;  3IN5 A;  2HBJ A;  2VIX A;  3F53 A;  2CN1 A;  4KMO B;  2KEY A;  2H3Z A;  2KHQ A;  4QIW C;  3PSP A;  2KNJ A;  4CDG A;  5A0L A;  1GO3 F;  2KKV A;  5HR6 A;  1IIP A;  3CYM A;  3VC8 A;  4PL2 A;  2VJ5 A;  4QJF B;  4A8E A;  4FE3 A;  1A0P A;  2N1R A;  3RFA A;  4AYB C;  1ZQ1 C;  2WB1 C;  2YX8 A;  3OPX A;  1NZB A;  2D6F C;  4IC9 A;  2R18 A;  3C28 A;  2JH7 A;  3NRW A;  4OJ6 A;  2W03 A;  2ZIW A;  1YT3 A;  4KX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...