2KV2A

Solution structure of the human blm hrdc domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
85
structure length
85
Chain Sequence
QREEMVKKCLGELTEVCKSLGKVFGVHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEKYGAEVISVLQKYSEWTSPAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Bloom syndrome protein
publication title Structure and function of the regulatory HRDC domain from human Bloom syndrome protein
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 85
sequence length 85
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2010-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2kv2A01
3SAGA 5C0YA 2E1FA 2RHFA 4QJFB 2E1EA 4OO1J 1YT3A 2RRDA 4NLCA 2HBLA 2HBKA 3SAFA 2HBJA 4NLBA 1WUDA 2KV2A 4O3MA 4QIWF 1D8BA 2CPRA 4CDGA 2HBMA 1GO3F 4CGZA 3CYMA 2MA1A 2DGZA 3SAHA
chains in the Genus database with same CATH superfamily
1RDFA 4ED3A 1A6SA 5K4LA 3S6JA 4ECUA 2Y9UA 2XI9A 2I1QA 5T14A 4DL3A 4KLSA 2QARB 4ZOHC 5KG4A 1QH9A 3ZDBA 1WWVA 7ICEA 1IM4A 5AKEA 2DQNB 3OHBA 3PMNA 8ICCA 1BGXT 3OGUA 1ZETA 3ISCA 4DL5A 2W9MA 3QZ7A 1BPXA 1VLBA 1S0MA 2DPJA 1DK2A 4UARA 4TQRA 3WKEA 3PW0A 2RHFA 1ZQIA 3UXPA 3EPGA 3RBDA 3QUCA 1ZQGA 2ODGA 1CI4A 1TFRA 2OH2A 3ETLA 4MHVA 5DQHA 2M9NA 3VC8A 5DG7A 3GU3A 1U9LA 5ALIA 4UAYA 2DFLA 5HR6A 2ZIUA 1NK9A 3VCBA 4F4KA 4IRDA 5J0YA 2OEHA 5J0XA 4UAWA 3RB4A 2G07A 1L3SA 3CRXA 4BUGA 4RUAA 1SXDA 2ASLA 1S97A 2RLTA 4I2DA 4YD1A 1JRPA 3NVYA 1Z19A 7ICLA 1SL1A 4M6WA 3RJKA 1X9XA 1ZOLA 4ELTA 2G08A 1JMSA 5DBAA 1L7PA 1DGSA 3LYSA 1DK3A 3TADC 4DQSA 1VDVA 3WKDA 5DG9A 1ZQHA 1QSYA 2KFNA 2BCVA 4KLHA 1QLNA 1ZQLA 4E0DA 2J6SA 4UB1A 9ICAA 9ICHA 1TK5A 1MQ2A 3KFUF 5J2HA 4BWJA 4R8UA 4LZDA 3BDPA 1L3TA 4NV0A 5IIIA 2E8NA 4CF5A 2KP7A 1ECWA 3MABA 5DB8A 2ZIVB 4QWBA 1K1SA 2KZZA 2I5HA 4P4MA 1JIHA 2ZTEA 2DGZA 1S10A 4IRCA 2NV3A 7ICMA 5AM3A 3PO4A 4FBUA 5BOLA 2BR0A 3IG8A 3FM9A 3M1YA 2J6TA 3SENA 4RQ7A 3IV6A 5L1MA 3RJFA 1U4BA 4KLEA 4B9MA 2HOIA 2KV2A 4UAUA 4DFMA 3K1RB 1ZQXA 5AK5A 1UA0A 4C8MA 5KFDA 4DOCA 4GXKA 3UM9A 3AM9A 3TAQA 1KKXA 1LKYB 4UBBA 2E8PA 4F2SA 1WUDA 1S0OA 4MEXA 3H0MB 3IP4B 1ZQQA 4F5PA 1TK8A 4IR9A 3SAHA 4DFDA 2W55A 2KSOA 4O9MA 3RRGA 2DUYA 5KFPA 2R18A 4IQUA 3Q8MA 1B43A 2JH7A 3MFHA 2HBLA 2ZG6A 2Y1IA 2AXTU 3QUTA 2HOFA 4CRXA 2W43A 1AROP 4PZOA 4F91B 4Y2RA 2YMLA 5A0LA 2IMWP 2OHFA 1B22A 2Q4TA 1S9FA 1L3UA 3BQ2A 8ICBA 3ED5A 2NRXA 2ZTCA 4Z6DA 5KFZA 1KFTA 3TKAA 4I27A 4ECXA 3J81j 3C1ZA 5CHGA 4PL1A 1D8BA 5KG0A 4EX7A 5BOMA 4CNQA 4CGZA 2MAXA 5KFRA 8ICGA 4Z6EA 4LZGA 3H0LB 4K4IA 2W8LA 5KFCA 4XQ8A 2XO7A 4J9LA 1BVSA 1QSSA 5ALZA 9ICRA 4ECTA 8ICOA 5KNIA 4YMNA 3SZ2A 3C5FA 1LB2B 1NJXA 5AKKA 3RR7A 4HYKA 2ASJA 5ALQA 5KG2A 1FFVA 5C5JA 1RYUA 1X2IA 1NKEA 2FPLA 5J0RA 2C2DA 5J29A 2WAQC 3D6JA 3D2SA 5DDYA 4O3MA 9ICCA 3ISBA 1BPYA 2K8AA 2BPFA 1IIPA 9ICLA 2XIDA 1JN3A 3B0YA 2BPGA 3F5EA 3A0BU 3NASA 4G3IA 4C4SA 3ZI4A 2Y9TA 4Y2UA 2JHDA 5KG6A 4IC9A 4J9RA 2JEGA 4DLEA 2ZUCA 1RZTA 2LM4A 5KFXA 3ZDAA 4YQWA 3BQ1A 2A19A 3GIMA 2EQYA 4I2IA 5J0PA 1Q46A 3H7IA 2KHVA 1NZBA 5E79U 3M9OB 1KBUA 2HHUA 3HJEA 2FMSA 2PFPA 7ICUA 4HAIA 3H40A 5AI0A 1QQ5A 2EAMA 2V4RA 2A3VA 4P0QA 4K4GA 9ICBA 1YZ6A 2HVHA 1FO4A 4J9NA 4UW9A 3WK8A 5KFGA 4DL7A 2KMDA 4YFKA 1NJYA 4NLNA 3CYMA 4ED7A 1ZQNA 4IQVA 3TADA 2K8BB 2NRVA 3PSTA 4I2FA 5EWGA 2KJ5A 1L5UA 3QU9A 5ALNA 1TK0A 4CCHA 4JV1A 3FYHA 4EYHB 1F44A 4KLIA 5KFLA 2QB0B 4EEYA 4XA5A 4PH5A 2DF4B 5AKJA 5ALYA 4JWNA 5KFOA 5DQIA 3N7PD 2ZJ8A 1O03A 8ICJA 3FC4A 4RU9A 1U49A 2BCQA 4C8LA 2G5HB 5ALOA 4QZEA 4F5RA 4YR2A 3Q8QB 4DS4A 3M6KA 3HP6A 5KFJA 1ZQBA 2OWOA 3MDCA 5CEHA 3M6ZA 3PW4A 3L3FX 1X42A 1KLNA 5DDMA 5J2CA 3NVWA 2F8LA 1U48A 3BZKA 3DEEA 1AQ6A 4AYBF 4US8A 1YT3A 2XY7A 5ALEA 4PPXA 4UB6U 4DWIA 1Z00A 1QQ6A 4UQGA 4P0PB 2W9CB 5IIMA 3KZXA 1V38A 1B0XA 1ZQTA 2W9BB 2W8KA 2K60A 5CA7A 4Q8FA 2DPIA 2PFOA 2NO4A 4F4YA 2H3ZA 2NRTA 5ALTA 1BNPA 3OPXA 1J97A 4GXJA 4BX9C 4DCCA 1EXNA 2XVTA 4O5CA 2WF9A 1MA7A 2JZBA 5DGBA 2HHSA 2IHMA 2Y0SF 5IINA 4C0ZA 3NS1A 2YQEA 1NK0A 3RBEA 8ICWA 2A1JA 3NUQA 3UMGA 2PI4A 3SD7A 5G5HA 3F2BA 5KFMA 2ZIXA 4TUQA 3RH4A 4DSIA 2KICA 3ETRA 4Z6CA 4UB5A 1BPZA 4M9NA 1S76D 3QE9Y 2ASDA 5GTHU 4Y2JA 2B6GA 2KE7A 1S0VA 4MFCA 1WWUA 1ED1A 5J2JA 8ICRA 8ICUA 2KIVA 3F2CA 2H3IA 3QNMA 3JPRA 2KFZA 3CW2C 3IG5A 3SYZA 4GXIA 4NY8A 4DQIA 3GDXA 4O5EA 2D8CA 5HP4A 3QU4A 3T3FA 2F76X 3T79A 2JXJA 1RQLA 3N97B 3QUBA 4IQWA 9ICQA 3JPQA 1QTMA 3UPQA 3RAQA 3BS5A 1BPEA 8ICAA 4J9QA 1QCKA 4F5QA 3KHRA 4ELUA 1NKCA 3N7RC 3AU6A 3UQ0A 1OUQA 3EWAA 1ZQJA 3NRWA 4Y2TA 5KT3A 1ZD5A 4UATA 3QU2A 2KOBA 3L4PA 1NOMA 1ZQRA 4QZIA 4JUZA 3TARA 2R8JA 2E3TA 1MQ3A 4YN4A 1L7NA 3E0FA 4UB4A 4R64A 3F5AA 4GC6A 4NJ8A 2BDPA 2V4QA 5CWRA 1CEZA 3HKZC 1Z4NA 2R8IA 4CE6A 4QZ9A 4NM2A 5KFAA 2FLPA 5H2FU 4RUCA 4KLGA 2HBKA 3G6VA 4F3OA 3TACB 3UMCA 3T5KA 3MC1A 5TISU 5D49A 1XU4A 1ZQMA 3ICXA 5EE3A 1XSNA 2F1JA 2EDUA 4TURA 2K4IA 2ESEA 4I2EA 2P35A 5DB9A 1KW4A 3HILA 2ZIUB 1NK7A 4EBDA 2VANA 1N5XA 3KHGA 5DBCA 1L7MA 4OJOA 3AL0B 3GZFA 4X5VA 3MGIA 1XO1A 4PGYA 3EPIA 5KFYA 2GO7A 3AQFA 3LWLA 4B9UA 4C4TA 1Z1VA 3WK4A 1KQQA 4ECQA 1V9PA 1D8LA 3ZD8A 3BQTA 1PK3A 5DGAA 4M6WB 5ALGA 9ICMA 2KNJA 4CF4A 2HBJA 3BQ0A 4M9LA 2JV3A 3V6HA 3C23A 2PMZF 1ZJMA 1D9DA 4O3QA 2EH9A 2JEFA 2F3NA 4EZ6A 4DOBA 4RPXA 5C0YA 5J0TA 1N62A 4M47A 7ICGA 3LK9A 1S5LU 2YY6A 4R8UB 2OM6A 3MR3A 4F5NA 3C21A 4RT2A 5AI8A 4Q43A 3GV7B 2AQ0A 3LWMA 3GV5B 3WKBA 1ZQWA 5J2EA 7ICRA 2ZIWA 9ICOA 3QUQA 2AHOB 4ICAA 1SGGA 2KVCA 2NRWA 3RR8A 1NNLA 4KLOA 4KLFA 1N63A 1KFSA 5B5EU 3NRZA 4QW9A 1ZQSA 3QZ8A 5ALSA 1SL0A 5KFIA 9ICUA 1D8YA 2H3VA 3OTQA 5B66U 1V85A 1PK1A 4GC7A 5ALKA 2H5XA 4NLKA 8ICPA 4NLCA 4PL2A 4UB2A 1VJ5A 1XSLA 5KFNA 3OSPA 9ICPA 1FFUA 2DBYA 4F4ZA 3KTQA 2ZXIA 3GV8B 1PVQA 1NK8A 4KLTA 2D3DA 2LI6A 4BXOB 4KMOB 1N2XA 1X40A 1Q3UA 3I28A 4PHDA 1KL9A 2YB1A 2KSOB 2DWQA 4P4OA 2LYAA 3E58A 5AKIA 1NK4A 2LMRA 2IA6A 2E5SA 4K4HA 4DLGA 3FDSA 2JRZA 5KG1A 1RXVA 3TI0A 4ZH4A 3RH5A 2GWSA 2D6FC 8ICFA 5ALMA 1M6YA 1ZQOA 4U7CA 4UASA 4R66A 2AGQA 7ICHA 8ICHA 4QZBA 2R8HA 3SI8A 4QZHA 2KN7A 2J6UA 1IXRA 4O0IA 2JH1A 2QLTA 4QIWF 2W11A 1HUZA 1XNSA 4YMOA 5JUMA 4IQTA 1ZJNA 5KT6A 1GO3F 3M9NB 1N60A 1NJZA 3V6KA 5ALRA 4P4PA 2VA8A 4FS2A 2KHQA 2FMQA 5DLGA 4IL6U 3RJHA 3JPSA 1T4GA 1PZNA 5AHXA 4O5KA 2EANA 4NLBA 2XY6A 5J0SA 5J8YC 2Q0ZX 4B9VA 3OHAA 5KTQA 2HBMA 4OJ6A 4O3PA 4EYIB 5TZVA 8ICZA 1IG6A 2XC9A 4RQ4A 9ICWA 3QYPA 5AIAA 3PR4A 4YD2A 4ECRA 4RPYA 4NLGA 2YMQA 4RZRA 5ALJA 3TAPA 1Z4OA 2B21A 2BCSA 1T3QA 3C2LA 1T94A 5DKWA 5J0UA 2GH1A 3RJIA 1JROA 4QZGA 3M9MB 3N28A 3GIJA 4MF2A 3PX4A 1BPDA 1V97A 4I2AA 4NXZA 8ICYA 2KJ8A 2BQUA 3MR6A 2HOQA 2PFQA 4KLUA 3M7DA 5EWEA 4DQPA 2IOHA 9ICNA 4FZNA 8ICKA 4M2YA 3R9KA 3V7JA 4YG2A 2NO5A 2Y1JA 5EE0A 4RQ2A 1KN5A 4DFJA 4RNMA 2G06A 2HI0A 1UA1A 4Y2QA 3KHLA 3KOOA 5AM2A 2XGQA 2A1AA 4J9MA 4P0QB 1ZD3A 3THVA 2HW3A 2YN4A 5D4BA 5JU5A 1OXJA 2L5YA 2HSZA 4BWMA 1PVPA 4DSLA 4NL9C 3BQ7A 4KLJA 2JMGA 2W54A 1IV8A 2VJ4A 1FIQA 2ZUDA 7ICQA 1ZQVA 3Q8LA 3IN5A 4DQRA 4DS5A 2OXOA 5AI4A 5F3XB 2HHTA 4YXJA 4DL2A 3RRHA 5D46A 2RQ5A 9ICGA 3TANA 4J9SA 1B4FA 4QZ8A 4ECVA 4R63A 2ISPA 3JPOA 2JEJA 3OJUA 2VIXA 1XC9A 5AK3A 5AM0A 4M04A 2HVIA 2XCAA 7ICPA 2KKPA 2CXYA 5IIJA 2KTQA 1TAMA 1X9WA 4DSJA 4MEYA 4F50A 1ZQUA 1SKSA 2ES6A 2BDUA 4ECZA 4FZLA 3NGDA 3EZ5A 1HEKA 4EEKA 4I2BA 4FE3A 5AI6A 2KZMA 5J0QA 4QWEA 3ZDEA 1TVAA 4M0AA 4XUSA 4C7YA 2B0CA 5ALUA 1HIWA 1SZPA 2XICA 3C28A 1UQVA 5GTIU 1LV5A 4DOAA 4OJPA 4FFDA 5L1JA 3SV3A 4R65A 5EWFA 3QX7A 2F1HA 3F2DA 3SMVA 3QU7A 1KFDA 2WHEA 1QSLA 2JZBB 5AKXA 2NRZA 2FJ6A 2YTUA 4O3NA 5DB7A 2AJQA 4OO1J 4YXMA 3EUB2 3LVVA 3KHHA 1S0NA 1A76A 2K4EA 4F92B 2ZIXB 4QWDA 5ALDA 1DXSA 1PVRA 1MN8A 1SL2A 2IOFK 4PGXA 2PKEA 4ED0A 4P0PA 3TFRA 5KL8B 5KFUA 4FO6A 5KFBA 1TE2A 1ZQCA 1C7YA 2W03A 3RJJA 5F9NA 5KFWA 4US9A 4B9TA 1ZQPA 2KEYA 2WFAA 4O3OA 3V7LA 8ICTA 1KRPA 1COKA 3BS7A 1N48A 5L1IA 5FP0A 4MFAA 2N1RA 5IIOA 5KFFA 3G6XA 5J8YA 1QQ7A 4DL4A 3N4MB 4Q8EA 4RNNA 5AM5A 3WK9A 3G6YA 4ED8A 9ICEA 1N56A 4Q44A 5L1LA 1TV9A 2MUTB 4QWCA 3BS5B 4ACOA 1P7DA 4F5OA 3CP8A 4QJFB 4QWAA 5KG3A 3HW8A 1TKDA 3GIIA 2BQRA 5HMLA 4TQSA 4ED2A 2FLLA 1S77D 5KG7A 1MC8A 7ICKA 1ZQ1C 1SKRA 4P2HA 5AK6A 2CN1A 1H38A 4C4RA 5DQGA 2HHVA 2BZFA 3SQIA 4I29A 2K8CB 1RYRA 2F44A 8ICIA 3UQ2A 3JPNA 3PY8A 1ZQFA 1K5OA 2QKQA 4DEZA 4PHEA 5L9XA 1O08A 3QXGA 5KT4A 3BZCA 2P6RA 1KDHA 2KKVA 5ALLA 8ICNA 5JRTA 2ZJ5A 1UHUA 4NL9A 1A0PA 7ICNA 1HJPA 3HPOA 5ALPA 3H8JA 2BQ3A 1NK5A 2FI1A 4Y2VA 1ZQEA 4Q45A 5DLFA 1X66A 2OCEA 2KZ3A 4PHAA 4I2HA 2VKQA 3IRUA 4M9HA 2I6XA 4A8EA 3B9JA 2E1FA 1RPLA 3I76A 1X6JA 5AIBA 4DF8A 1J2NA 3AQEA 2HHQA 2FE9A 4FBTA 2FLNA 2K89A 4C8OA 3AMZA 7ICSA 9ICTA 1WCLA 5AM1A 2LHTA 2LBOA 1COOA 2QARA 2E8OA 4M9GA 1SWWA 1XWLA 2XCPA 3SEIA 3MGVA 1BNOA 4YP3A 4NLZA 2DKXA 2VA3A 2LM1A 5ALXA 2V9WA 5KFTA 3T5HA 3T5JA 4ECYA 2XGPA 7ICVA 4IR1A 3JPTA 3K4GA 3MFIA 1FEZA 2P66A 4AYBC 5L1KA 1SV4A 2WAQF 4RQ6A 1Y88A 1RQNA 1A77A 1KSPA 7ICOA 2JR5A 2ZIWB 1C20A 2RRDA 4MF8A 2F8KA 3C2MA 4TUPA 4EBEA 2MSNA 4DQQA 4EBCA 3AUOA 3C2KA 4F72A 3MBYA 1K1QA 4Y2YA 3MR2A 2ISOA 3RTVA 2K4HA 3Q8PB 5DB6A 5CP2A 3NVZA 3PW7A 4JK1A 4F71A 4Y2XA 3ZD9A 4PJ0U 4Z6FA 1JXLA 2WF7A 2Z7JA 1SWVA 3PSIA 3ONNA 9ICKA 4B9NA 1L6NA 3PO5A 3MGHA 4RQ0A 2Y0SC 3ZDDA 1DGJA 7ICJA 2WF5A 2RDJA 4DF4A 1ZQZA 1PK1B 5CJ7A 1UPHA 4QZAA 5AI5A 5IILA 2R8GA 4RQ1A 2XY5A 2CPRA 8ICXA 3LDAA 3H8WA 2AH5A 2EZYA 2ALZA 1ZQAA 5J2FA 2PI5A 2OYYA 1Z1BA 1ZRNA 1TAUA 4JMUA 2RDIA 3ORYA 8ICEA 2WB1F 3PW5A 5EE1A 5KFSA 3NVVA 3GFKB 2VJ5A 2KIWA 1NI3A 4Y2SA 3ALRA 4OJ5A 4DSKA 2PXIA 3ZDCA 5KT5A 4I2JA 4QW8A 3MR5A 4RQMA 2MRLA 2CRXA 1DOQA 5HHHA 3Q8KA 2IBKA 1URJA 1Q3VA 3UXOA 4BDPA 2ZIVA 5J0WA 2YX8A 3RH6A 2DL0A 7ICTA 5ALHA 1U45A 1N61A 3SAFA 1JXEA 3WKCA 3GIKA 1KTQA 2WF8A 5AICA 3WU2U 5KFKA 1ZRMA 4RT3A 2BCRA 1F5SA 3WK7A 5CRXA 5J0OA 4C7ZA 5AKHA 2NYVA 3WKAA 2H3QA 4KLDA 5AKZA 3OJSA 1T8EA 3KBBA 4ELVA 2YMMA 4EX6A 2E8MA 4JB3A 4DSEA 2DKZA 4BXOA 3KKAC 1KEJA 2ZUBA 3WK5A 5JTIA 1CUKA 2WF6A 2W7PA 1LKYA 3H0RB 2W04A 5KT7A 1NZPA 3FAHA 4UAZA 4DFKA 1WYGA 4FZMA 3KZIU 3NTUA 3PW2A 3PMLA 3M8SA 3M8RA 1JUDA 1LVHA 2YB4A 2KG5A 3SR6A 3U26A 1J2MA 3OSNA 1U47A 2ATLA 5KAIU 1JI7A 1ZQYA 1SV0C 4KMUA 4GLXA 4I2GA 2KVSA 1SIJA 2IOFA 1D9FA 3C5GA 2MU2A 9ICFA 3LVWA 3JPPA 3PV8A 4KX5A 3PSFA 8ICMA 4GIBA 2M0NA 4BJQA 3RJEA 2PFNA 1RYSA 4TUSA 4C8NA 3RJGA 4KLQA 3HRDD 2HMXA 2K4PA 3PSPA 2EZXA 4FS1A 1NKBA 1F0MA 3PNCA 1Z3EB 5G5GA 2ZXHA 2LKYA 3UMBA 4JV2A 4EENA 3QEAZ 2UVRA 4DL6A 4ECSA 2HHWA 3QU5A 3Q8RB 5DG8A 4KN7A 1YZ7A 1X9SA 2F1IA 2PMZC 5KL1B 2GLEA 2FPKA 1XSPA 4IRKA 9ICXA 2C2EA 2P6UA 1SKWA 2IHNA 3HX0A 3IHQB 4J9OA 3V6JA 4CF3A 1DRGA 3TQ1A 1N5WA 1NJWA 4YVZA 4YMMA 2G0AA 1MSWD 2BPCA 2UVVA 4PGQA 3AU2A 3D2QA 2VA2A 5HHIA 3F53A 5AKLA 1X9MA 2W9AA 4GFJA 4J03A 2AGOA 4B9LA 5KAFU 4J9PA 2KJ9A 3ISDA 1TAQA 3HT3A 4F93B 5ALFA 5AKYA 2HCFA 4JWMA 2KK0A 2BHNA 2E1EA 3HKZF 2O6KA 7ICFA 2LPEA 5ALVA 1ZQKA 1XS9D 3IDWA 4NWIA 1SB3C 4YCXA 4F4XA 2BGWA 2WB1C 4DFPA 4KTQA 3B0XA 3KD3A 4QZDA 4EELA 3SAGA 5EOZA 4UB3A 1RM6C 5AM4A 3HWTA 1SZHA 4WJ3B 1RXWA 4J9KA 3PVXA 3V72A 3O0FA 5BPCA 1SXEA 4OD0A 2F2AB 3RB6A 1Z00B 7ICIA 3RFAA 1XO0A 4RPZA 4RQ8A 5HNKA 1Q8KA 2QB1A 4IS7A 3E2EA 2QB0A 2FDRA 9ICIA 4USAA 5KFHA 3C29A 3K75D 3IM1A 5J2IA 4QNLA 1ZYQA 1L8OA 4JV0A 4KX3A 4PHPA 2AU0A 2R8KA 2EZZA 2C2RA 8ICSA 3PZPA 2LYBA 5HMMA 5KFVA 2C22A 3AN1A 4QIWC 2YMPA 1L8LA 4YR0A 2I9GA 2A1JB 1BPBA 1T3NA 2W3RA 3T5LA 5CB1A 2JGAA 5J2DA 4B6JA 5J2GA 4QZFA 1OW5A 5KFEA 2WTFA 1S8OA 4C80A 4B9SA 2EAPA 4CDGA 2BCUA 2ZTDA 3H8MA 3BJYA 3EW9A 4LVSA 2MA1A 4KLLA 1JALA 4RQNA 4ED6A 1CRXA 2FPMA 4EZ9A 3H4BA 3KKAA 3GILA 4DO9A 1RG6A 2HHXA 2AQ4A 2W9CA 3PX6A 9ICSA 2JEIA 5J2AA 4KLMA 3L5KA 2W9BA 1T7PA 9ICVA 5J2KA 2KD1A 3D2NA 4U6PA 1UT5A 1HUOA 3TFSA 2BKEA 4RQ5A 5IIKA 3RB3A 4ED1A 4BGDA 4UAVA 4RNOA 1ZD4A 3DV9A 1ZD2P 1PUZA 3V7KA 3RF9A 1JX4A 1SV0A 8ICQA 4PZNA 2GOLA 1UT8A 5F9LA 3RAXA 2LYHA 2EAOA 1WG8A 4DSFA 4O3RA 4YR3A 8ICVA 3A0HU 3WK6A 4UB8U 3AEVA 4LJXA 4O3SA 4I28A 3Q8SB 5KT2A 4AP9A 4RQ3A 2RP5A 4F8RA 1L7OA 1L3VA 5AI9A 4OJLA 5DBBA 3UXNA 3H8SA 3K1ZA 2UVUA 4ECWA 5CR0A 5KFQA 2HDOA 4MFFA 3MDAA 3CNHA 4F4WA 5HR7A 2AGPA 1WCNA 3RB0A 3C1YA 4G9BA 5J2BA 3N7SC 4I2CA 2ZJAA 4NM1A 4KN4A 3SV4A 2MUTA 4C8KA 4OCZA 3EYZA 1X6IA 3PR5B 4KITB 5ALWA 2G5IB 2H3FA 3H4DA 2F77X 4XRHA 9ICJA 4Y2PA 3GQCA 2W3SA 3DDHA 3I1YA 3PX0A 3QEBZ 5AK4A 1NK6A 2UVWA 2G09A 1ZQDA 4QZCA 4F2RA 1UCVA 2C28A 1ZXIA 5AKGA 4UBCA 8ICLA 2FMPA 2W7OA 4M9JA 5EE9A 5KG5A
chains in the Genus database with same CATH topology
2HMXA 2CRXA 1OUQA 4ACOA 1A6SA 2Q4TA 1P7DA 3PSPA 3SAGA 5C0YA 4U7CA 3MGVA 3NRWA 1URJA 2XI9A 2H3ZA 3CP8A 4QJFB 1Q3VA 5T14A 1SZHA 1HIWA 2XICA 3C28A 2KOBA 4NV0A 4WJ3B 2G06A 3OPXA 2ZIVA 2OM6A 4P0QA 3RF9A 4BX9C 2YX8A 2XVTA 2A3VA 2ZXHA 3SAFA 1ECWA 2LKYA 1MA7A 2GOLA 3E0FA 4OJPA 2JH1A 3O0FA 2DQNB 4PL1A 4QIWF 1D8BA 3F5AA 2F2AB 2ZIVB 3F2DA 4P0QB 2Y0SF 2D6FC 1XNSA 3SMVA 4C0ZA 4AYBC 1GO3F 4CGZA 3CYMA 3HKZC 1ZQ1C 3RFAA 2WAQF 2ZIWA 2DGZA 1XO0A 1PVPA 2K8BB 3NUQA 2NV3A 3PSTA 2KJ5A 2CN1A 5CRXA 3H0LB 3F2BA 2JMGA 4ICAA 2ZIXA 2RHFA 2RP5A 2KVCA 3IG8A 2ZIWB 2KHQA 4OO1J 2PMZC 2RRDA 2H3QA 2VJ4A 3LVVA 3C29A 5KL1B 3SQIA 2KICA 2K8CB 2K4EA 4QNLA 1F44A 4OJLA 3IN5A 2ZIXB 2OH2A 2HBKA 1PVRA 2OXOA 4NLBA 3K1ZA 2HOIA 2KV2A 3VC8A 3GU3A 2K4HA 4KX3A 2H3VA 2HBMA 4OJ6A 2DF4B 2W7PA 5HR6A 2ZIUA 5HR7A 3ICXA 3N7PD 3VCBA 3H0RB 2W04A 2Z7JA 1DRGA 3PZPA 2LYBA 3PSIA 1ED1A 2K4IA 3ONNA 3N7SC 4P0PA 1L6NA 5KL8B 4QIWC 4FZMA 2G0AA 2ZIUB 2KKVA 2Y0SC 4NLCA 2G5HB 3D2QA 2G07A 3F2CA 2H3IA 3F53A 4PL2A 2VIXA 1A0PA 1UPHA 2JGAA 2WAQC 3M6KA 3IG5A 4GFJA 3CRXA 4BUGA 3D2SA 2W03A 4OJOA 1WUDA 2YB4A 3AL0B 4O3MA 2KKPA 3GZFA 2CPRA 4CDGA 2K8AA 3H0MB 3IP4B 1IIPA 3M6ZA 2KJ9A 2XIDA 2G5IB 1T94A 2H3FA 2KEYA 2MA1A 2ZXIA 3L3FX 3AQFA 1PVQA 2F77X 2VKQA 3SAHA 2GH1A 3F5EA 1Z19A 1CRXA 1TAMA 2F8LA 2N1RA 2OYYA 3T79A 2F76X 3DEEA 4A8EA 2E1FA 1Z1BA 4KMOB 2JHDA 4AYBF 2E1EA 4JMUA 1Q3UA 1YT3A 2WB1F 3HKZF 2G08A 2G09A 2MRLA 2R18A 4IC9A 2JH7A 2YB1A 2BDUA 3AQEA 2KJ8A 3LYSA 2HBLA 2LYAA 3LVWA 2KNJA 2HBJA 2HOQA 4P0PB 4NWIA 2ZG6A 2KD1A 4KX5A 3PSFA 4FZLA 3M7DA 3D2NA 2VJ5A 2K89A 2E5SA 2KIWA 2PMZF 4U6PA 3ALRA 2M0NA 3KZXA 4OJ5A 4BJQA 1HEKA 2HOFA 4CRXA 4FZNA 4FE3A 2KHVA 2WB1C 2W7OA 3N7RC 1NZBA 5A0LA 2LHTA 2LBOA 1KBUA 3KFUF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAG A;  5C0Y A;  2E1F A;  2RHF A;  4QJF B;  2E1E A;  4OO1 J;  1YT3 A;  2RRD A;  4NLC A;  2HBL A;  2HBK A;  3SAF A;  2HBJ A;  4NLB A;  1WUD A;  2KV2 A;  4O3M A;  4QIW F;  1D8B A;  2CPR A;  4CDG A;  2HBM A;  1GO3 F;  4CGZ A;  3CYM A;  2MA1 A;  2DGZ A;  3SAH A; 
#chains in the Genus database with same CATH topology
 1RDF A;  4ED3 A;  1A6S A;  5K4L A;  3S6J A;  4ECU A;  2Y9U A;  2XI9 A;  2I1Q A;  5T14 A;  4DL3 A;  4KLS A;  2QAR B;  4ZOH C;  5KG4 A;  1QH9 A;  3ZDB A;  1WWV A;  7ICE A;  1IM4 A;  5AKE A;  2DQN B;  3OHB A;  3PMN A;  8ICC A;  1BGX T;  3OGU A;  1ZET A;  3ISC A;  4DL5 A;  2W9M A;  3QZ7 A;  1BPX A;  1VLB A;  1S0M A;  2DPJ A;  1DK2 A;  4UAR A;  4TQR A;  3WKE A;  3PW0 A;  2RHF A;  1ZQI A;  3UXP A;  3EPG A;  3RBD A;  3QUC A;  1ZQG A;  2ODG A;  1CI4 A;  1TFR A;  2OH2 A;  3ETL A;  4MHV A;  5DQH A;  2M9N A;  3VC8 A;  5DG7 A;  3GU3 A;  1U9L A;  5ALI A;  4UAY A;  2DFL A;  5HR6 A;  2ZIU A;  1NK9 A;  3VCB A;  4F4K A;  4IRD A;  5J0Y A;  2OEH A;  5J0X A;  4UAW A;  3RB4 A;  2G07 A;  1L3S A;  3CRX A;  4BUG A;  4RUA A;  1SXD A;  2ASL A;  1S97 A;  2RLT A;  4I2D A;  4YD1 A;  1JRP A;  3NVY A;  1Z19 A;  7ICL A;  1SL1 A;  4M6W A;  3RJK A;  1X9X A;  1ZOL A;  4ELT A;  2G08 A;  1JMS A;  5DBA A;  1L7P A;  1DGS A;  3LYS A;  1DK3 A;  3TAD C;  4DQS A;  1VDV A;  3WKD A;  5DG9 A;  1ZQH A;  1QSY A;  2KFN A;  2BCV A;  4KLH A;  1QLN A;  1ZQL A;  4E0D A;  2J6S A;  4UB1 A;  9ICA A;  9ICH A;  1TK5 A;  1MQ2 A;  3KFU F;  5J2H A;  4BWJ A;  4R8U A;  4LZD A;  3BDP A;  1L3T A;  4NV0 A;  5III A;  2E8N A;  4CF5 A;  2KP7 A;  1ECW A;  3MAB A;  5DB8 A;  2ZIV B;  4QWB A;  1K1S A;  2KZZ A;  2I5H A;  4P4M A;  1JIH A;  2ZTE A;  2DGZ A;  1S10 A;  4IRC A;  2NV3 A;  7ICM A;  5AM3 A;  3PO4 A;  4FBU A;  5BOL A;  2BR0 A;  3IG8 A;  3FM9 A;  3M1Y A;  2J6T A;  3SEN A;  4RQ7 A;  3IV6 A;  5L1M A;  3RJF A;  1U4B A;  4KLE A;  4B9M A;  2HOI A;  2KV2 A;  4UAU A;  4DFM A;  3K1R B;  1ZQX A;  5AK5 A;  1UA0 A;  4C8M A;  5KFD A;  4DOC A;  4GXK A;  3UM9 A;  3AM9 A;  3TAQ A;  1KKX A;  1LKY B;  4UBB A;  2E8P A;  4F2S A;  1WUD A;  1S0O A;  4MEX A;  3H0M B;  3IP4 B;  1ZQQ A;  4F5P A;  1TK8 A;  4IR9 A;  3SAH A;  4DFD A;  2W55 A;  2KSO A;  4O9M A;  3RRG A;  2DUY A;  5KFP A;  2R18 A;  4IQU A;  3Q8M A;  1B43 A;  2JH7 A;  3MFH A;  2HBL A;  2ZG6 A;  2Y1I A;  2AXT U;  3QUT A;  2HOF A;  4CRX A;  2W43 A;  1ARO P;  4PZO A;  4F91 B;  4Y2R A;  2YML A;  5A0L A;  2IMW P;  2OHF A;  1B22 A;  2Q4T A;  1S9F A;  1L3U A;  3BQ2 A;  8ICB A;  3ED5 A;  2NRX A;  2ZTC A;  4Z6D A;  5KFZ A;  1KFT A;  3TKA A;  4I27 A;  4ECX A;  3J81 j;  3C1Z A;  5CHG A;  4PL1 A;  1D8B A;  5KG0 A;  4EX7 A;  5BOM A;  4CNQ A;  4CGZ A;  2MAX A;  5KFR A;  8ICG A;  4Z6E A;  4LZG A;  3H0L B;  4K4I A;  2W8L A;  5KFC A;  4XQ8 A;  2XO7 A;  4J9L A;  1BVS A;  1QSS A;  5ALZ A;  9ICR A;  4ECT A;  8ICO A;  5KNI A;  4YMN A;  3SZ2 A;  3C5F A;  1LB2 B;  1NJX A;  5AKK A;  3RR7 A;  4HYK A;  2ASJ A;  5ALQ A;  5KG2 A;  1FFV A;  5C5J A;  1RYU A;  1X2I A;  1NKE A;  2FPL A;  5J0R A;  2C2D A;  5J29 A;  2WAQ C;  3D6J A;  3D2S A;  5DDY A;  4O3M A;  9ICC A;  3ISB A;  1BPY A;  2K8A A;  2BPF A;  1IIP A;  9ICL A;  2XID A;  1JN3 A;  3B0Y A;  2BPG A;  3F5E A;  3A0B U;  3NAS A;  4G3I A;  4C4S A;  3ZI4 A;  2Y9T A;  4Y2U A;  2JHD A;  5KG6 A;  4IC9 A;  4J9R A;  2JEG A;  4DLE A;  2ZUC A;  1RZT A;  2LM4 A;  5KFX A;  3ZDA A;  4YQW A;  3BQ1 A;  2A19 A;  3GIM A;  2EQY A;  4I2I A;  5J0P A;  1Q46 A;  3H7I A;  2KHV A;  1NZB A;  5E79 U;  3M9O B;  1KBU A;  2HHU A;  3HJE A;  2FMS A;  2PFP A;  7ICU A;  4HAI A;  3H40 A;  5AI0 A;  1QQ5 A;  2EAM A;  2V4R A;  2A3V A;  4P0Q A;  4K4G A;  9ICB A;  1YZ6 A;  2HVH A;  1FO4 A;  4J9N A;  4UW9 A;  3WK8 A;  5KFG A;  4DL7 A;  2KMD A;  4YFK A;  1NJY A;  4NLN A;  3CYM A;  4ED7 A;  1ZQN A;  4IQV A;  3TAD A;  2K8B B;  2NRV A;  3PST A;  4I2F A;  5EWG A;  2KJ5 A;  1L5U A;  3QU9 A;  5ALN A;  1TK0 A;  4CCH A;  4JV1 A;  3FYH A;  4EYH B;  1F44 A;  4KLI A;  5KFL A;  2QB0 B;  4EEY A;  4XA5 A;  4PH5 A;  2DF4 B;  5AKJ A;  5ALY A;  4JWN A;  5KFO A;  5DQI A;  3N7P D;  2ZJ8 A;  1O03 A;  8ICJ A;  3FC4 A;  4RU9 A;  1U49 A;  2BCQ A;  4C8L A;  2G5H B;  5ALO A;  4QZE A;  4F5R A;  4YR2 A;  3Q8Q B;  4DS4 A;  3M6K A;  3HP6 A;  5KFJ A;  1ZQB A;  2OWO A;  3MDC A;  5CEH A;  3M6Z A;  3PW4 A;  3L3F X;  1X42 A;  1KLN A;  5DDM A;  5J2C A;  3NVW A;  2F8L A;  1U48 A;  3BZK A;  3DEE A;  1AQ6 A;  4AYB F;  4US8 A;  1YT3 A;  2XY7 A;  5ALE A;  4PPX A;  4UB6 U;  4DWI A;  1Z00 A;  1QQ6 A;  4UQG A;  4P0P B;  2W9C B;  5IIM A;  3KZX A;  1V38 A;  1B0X A;  1ZQT A;  2W9B B;  2W8K A;  2K60 A;  5CA7 A;  4Q8F A;  2DPI A;  2PFO A;  2NO4 A;  4F4Y A;  2H3Z A;  2NRT A;  5ALT A;  1BNP A;  3OPX A;  1J97 A;  4GXJ A;  4BX9 C;  4DCC A;  1EXN A;  2XVT A;  4O5C A;  2WF9 A;  1MA7 A;  2JZB A;  5DGB A;  2HHS A;  2IHM A;  2Y0S F;  5IIN A;  4C0Z A;  3NS1 A;  2YQE A;  1NK0 A;  3RBE A;  8ICW A;  2A1J A;  3NUQ A;  3UMG A;  2PI4 A;  3SD7 A;  5G5H A;  3F2B A;  5KFM A;  2ZIX A;  4TUQ A;  3RH4 A;  4DSI A;  2KIC A;  3ETR A;  4Z6C A;  4UB5 A;  1BPZ A;  4M9N A;  1S76 D;  3QE9 Y;  2ASD A;  5GTH U;  4Y2J A;  2B6G A;  2KE7 A;  1S0V A;  4MFC A;  1WWU A;  1ED1 A;  5J2J A;  8ICR A;  8ICU A;  2KIV A;  3F2C A;  2H3I A;  3QNM A;  3JPR A;  2KFZ A;  3CW2 C;  3IG5 A;  3SYZ A;  4GXI A;  4NY8 A;  4DQI A;  3GDX A;  4O5E A;  2D8C A;  5HP4 A;  3QU4 A;  3T3F A;  2F76 X;  3T79 A;  2JXJ A;  1RQL A;  3N97 B;  3QUB A;  4IQW A;  9ICQ A;  3JPQ A;  1QTM A;  3UPQ A;  3RAQ A;  3BS5 A;  1BPE A;  8ICA A;  4J9Q A;  1QCK A;  4F5Q A;  3KHR A;  4ELU A;  1NKC A;  3N7R C;  3AU6 A;  3UQ0 A;  1OUQ A;  3EWA A;  1ZQJ A;  3NRW A;  4Y2T A;  5KT3 A;  1ZD5 A;  4UAT A;  3QU2 A;  2KOB A;  3L4P A;  1NOM A;  1ZQR A;  4QZI A;  4JUZ A;  3TAR A;  2R8J A;  2E3T A;  1MQ3 A;  4YN4 A;  1L7N A;  3E0F A;  4UB4 A;  4R64 A;  3F5A A;  4GC6 A;  4NJ8 A;  2BDP A;  2V4Q A;  5CWR A;  1CEZ A;  3HKZ C;  1Z4N A;  2R8I A;  4CE6 A;  4QZ9 A;  4NM2 A;  5KFA A;  2FLP A;  5H2F U;  4RUC A;  4KLG A;  2HBK A;  3G6V A;  4F3O A;  3TAC B;  3UMC A;  3T5K A;  3MC1 A;  5TIS U;  5D49 A;  1XU4 A;  1ZQM A;  3ICX A;  5EE3 A;  1XSN A;  2F1J A;  2EDU A;  4TUR A;  2K4I A;  2ESE A;  4I2E A;  2P35 A;  5DB9 A;  1KW4 A;  3HIL A;  2ZIU B;  1NK7 A;  4EBD A;  2VAN A;  1N5X A;  3KHG A;  5DBC A;  1L7M A;  4OJO A;  3AL0 B;  3GZF A;  4X5V A;  3MGI A;  1XO1 A;  4PGY A;  3EPI A;  5KFY A;  2GO7 A;  3AQF A;  3LWL A;  4B9U A;  4C4T A;  1Z1V A;  3WK4 A;  1KQQ A;  4ECQ A;  1V9P A;  1D8L A;  3ZD8 A;  3BQT A;  1PK3 A;  5DGA A;  4M6W B;  5ALG A;  9ICM A;  2KNJ A;  4CF4 A;  2HBJ A;  3BQ0 A;  4M9L A;  2JV3 A;  3V6H A;  3C23 A;  2PMZ F;  1ZJM A;  1D9D A;  4O3Q A;  2EH9 A;  2JEF A;  2F3N A;  4EZ6 A;  4DOB A;  4RPX A;  5C0Y A;  5J0T A;  1N62 A;  4M47 A;  7ICG A;  3LK9 A;  1S5L U;  2YY6 A;  4R8U B;  2OM6 A;  3MR3 A;  4F5N A;  3C21 A;  4RT2 A;  5AI8 A;  4Q43 A;  3GV7 B;  2AQ0 A;  3LWM A;  3GV5 B;  3WKB A;  1ZQW A;  5J2E A;  7ICR A;  2ZIW A;  9ICO A;  3QUQ A;  2AHO B;  4ICA A;  1SGG A;  2KVC A;  2NRW A;  3RR8 A;  1NNL A;  4KLO A;  4KLF A;  1N63 A;  1KFS A;  5B5E U;  3NRZ A;  4QW9 A;  1ZQS A;  3QZ8 A;  5ALS A;  1SL0 A;  5KFI A;  9ICU A;  1D8Y A;  2H3V A;  3OTQ A;  5B66 U;  1V85 A;  1PK1 A;  4GC7 A;  5ALK A;  2H5X A;  4NLK A;  8ICP A;  4NLC A;  4PL2 A;  4UB2 A;  1VJ5 A;  1XSL A;  5KFN A;  3OSP A;  9ICP A;  1FFU A;  2DBY A;  4F4Z A;  3KTQ A;  2ZXI A;  3GV8 B;  1PVQ A;  1NK8 A;  4KLT A;  2D3D A;  2LI6 A;  4BXO B;  4KMO B;  1N2X A;  1X40 A;  1Q3U A;  3I28 A;  4PHD A;  1KL9 A;  2YB1 A;  2KSO B;  2DWQ A;  4P4O A;  2LYA A;  3E58 A;  5AKI A;  1NK4 A;  2LMR A;  2IA6 A;  2E5S A;  4K4H A;  4DLG A;  3FDS A;  2JRZ A;  5KG1 A;  1RXV A;  3TI0 A;  4ZH4 A;  3RH5 A;  2GWS A;  2D6F C;  8ICF A;  5ALM A;  1M6Y A;  1ZQO A;  4U7C A;  4UAS A;  4R66 A;  2AGQ A;  7ICH A;  8ICH A;  4QZB A;  2R8H A;  3SI8 A;  4QZH A;  2KN7 A;  2J6U A;  1IXR A;  4O0I A;  2JH1 A;  2QLT A;  4QIW F;  2W11 A;  1HUZ A;  1XNS A;  4YMO A;  5JUM A;  4IQT A;  1ZJN A;  5KT6 A;  1GO3 F;  3M9N B;  1N60 A;  1NJZ A;  3V6K A;  5ALR A;  4P4P A;  2VA8 A;  4FS2 A;  2KHQ A;  2FMQ A;  5DLG A;  4IL6 U;  3RJH A;  3JPS A;  1T4G A;  1PZN A;  5AHX A;  4O5K A;  2EAN A;  4NLB A;  2XY6 A;  5J0S A;  5J8Y C;  2Q0Z X;  4B9V A;  3OHA A;  5KTQ A;  2HBM A;  4OJ6 A;  4O3P A;  4EYI B;  5TZV A;  8ICZ A;  1IG6 A;  2XC9 A;  4RQ4 A;  9ICW A;  3QYP A;  5AIA A;  3PR4 A;  4YD2 A;  4ECR A;  4RPY A;  4NLG A;  2YMQ A;  4RZR A;  5ALJ A;  3TAP A;  1Z4O A;  2B21 A;  2BCS A;  1T3Q A;  3C2L A;  1T94 A;  5DKW A;  5J0U A;  2GH1 A;  3RJI A;  1JRO A;  4QZG A;  3M9M B;  3N28 A;  3GIJ A;  4MF2 A;  3PX4 A;  1BPD A;  1V97 A;  4I2A A;  4NXZ A;  8ICY A;  2KJ8 A;  2BQU A;  3MR6 A;  2HOQ A;  2PFQ A;  4KLU A;  3M7D A;  5EWE A;  4DQP A;  2IOH A;  9ICN A;  4FZN A;  8ICK A;  4M2Y A;  3R9K A;  3V7J A;  4YG2 A;  2NO5 A;  2Y1J A;  5EE0 A;  4RQ2 A;  1KN5 A;  4DFJ A;  4RNM A;  2G06 A;  2HI0 A;  1UA1 A;  4Y2Q A;  3KHL A;  3KOO A;  5AM2 A;  2XGQ A;  2A1A A;  4J9M A;  4P0Q B;  1ZD3 A;  3THV A;  2HW3 A;  2YN4 A;  5D4B A;  5JU5 A;  1OXJ A;  2L5Y A;  2HSZ A;  4BWM A;  1PVP A;  4DSL A;  4NL9 C;  3BQ7 A;  4KLJ A;  2JMG A;  2W54 A;  1IV8 A;  2VJ4 A;  1FIQ A;  2ZUD A;  7ICQ A;  1ZQV A;  3Q8L A;  3IN5 A;  4DQR A;  4DS5 A;  2OXO A;  5AI4 A;  5F3X B;  2HHT A;  4YXJ A;  4DL2 A;  3RRH A;  5D46 A;  2RQ5 A;  9ICG A;  3TAN A;  4J9S A;  1B4F A;  4QZ8 A;  4ECV A;  4R63 A;  2ISP A;  3JPO A;  2JEJ A;  3OJU A;  2VIX A;  1XC9 A;  5AK3 A;  5AM0 A;  4M04 A;  2HVI A;  2XCA A;  7ICP A;  2KKP A;  2CXY A;  5IIJ A;  2KTQ A;  1TAM A;  1X9W A;  4DSJ A;  4MEY A;  4F50 A;  1ZQU A;  1SKS A;  2ES6 A;  2BDU A;  4ECZ A;  4FZL A;  3NGD A;  3EZ5 A;  1HEK A;  4EEK A;  4I2B A;  4FE3 A;  5AI6 A;  2KZM A;  5J0Q A;  4QWE A;  3ZDE A;  1TVA A;  4M0A A;  4XUS A;  4C7Y A;  2B0C A;  5ALU A;  1HIW A;  1SZP A;  2XIC A;  3C28 A;  1UQV A;  5GTI U;  1LV5 A;  4DOA A;  4OJP A;  4FFD A;  5L1J A;  3SV3 A;  4R65 A;  5EWF A;  3QX7 A;  2F1H A;  3F2D A;  3SMV A;  3QU7 A;  1KFD A;  2WHE A;  1QSL A;  2JZB B;  5AKX A;  2NRZ A;  2FJ6 A;  2YTU A;  4O3N A;  5DB7 A;  2AJQ A;  4OO1 J;  4YXM A;  3EUB 2;  3LVV A;  3KHH A;  1S0N A;  1A76 A;  2K4E A;  4F92 B;  2ZIX B;  4QWD A;  5ALD A;  1DXS A;  1PVR A;  1MN8 A;  1SL2 A;  2IOF K;  4PGX A;  2PKE A;  4ED0 A;  4P0P A;  3TFR A;  5KL8 B;  5KFU A;  4FO6 A;  5KFB A;  1TE2 A;  1ZQC A;  1C7Y A;  2W03 A;  3RJJ A;  5F9N A;  5KFW A;  4US9 A;  4B9T A;  1ZQP A;  2KEY A;  2WFA A;  4O3O A;  3V7L A;  8ICT A;  1KRP A;  1COK A;  3BS7 A;  1N48 A;  5L1I A;  5FP0 A;  4MFA A;  2N1R A;  5IIO A;  5KFF A;  3G6X A;  5J8Y A;  1QQ7 A;  4DL4 A;  3N4M B;  4Q8E A;  4RNN A;  5AM5 A;  3WK9 A;  3G6Y A;  4ED8 A;  9ICE A;  1N56 A;  4Q44 A;  5L1L A;  1TV9 A;  2MUT B;  4QWC A;  3BS5 B;  4ACO A;  1P7D A;  4F5O A;  3CP8 A;  4QJF B;  4QWA A;  5KG3 A;  3HW8 A;  1TKD A;  3GII A;  2BQR A;  5HML A;  4TQS A;  4ED2 A;  2FLL A;  1S77 D;  5KG7 A;  1MC8 A;  7ICK A;  1ZQ1 C;  1SKR A;  4P2H A;  5AK6 A;  2CN1 A;  1H38 A;  4C4R A;  5DQG A;  2HHV A;  2BZF A;  3SQI A;  4I29 A;  2K8C B;  1RYR A;  2F44 A;  8ICI A;  3UQ2 A;  3JPN A;  3PY8 A;  1ZQF A;  1K5O A;  2QKQ A;  4DEZ A;  4PHE A;  5L9X A;  1O08 A;  3QXG A;  5KT4 A;  3BZC A;  2P6R A;  1KDH A;  2KKV A;  5ALL A;  8ICN A;  5JRT A;  2ZJ5 A;  1UHU A;  4NL9 A;  1A0P A;  7ICN A;  1HJP A;  3HPO A;  5ALP A;  3H8J A;  2BQ3 A;  1NK5 A;  2FI1 A;  4Y2V A;  1ZQE A;  4Q45 A;  5DLF A;  1X66 A;  2OCE A;  2KZ3 A;  4PHA A;  4I2H A;  2VKQ A;  3IRU A;  4M9H A;  2I6X A;  4A8E A;  3B9J A;  2E1F A;  1RPL A;  3I76 A;  1X6J A;  5AIB A;  4DF8 A;  1J2N A;  3AQE A;  2HHQ A;  2FE9 A;  4FBT A;  2FLN A;  2K89 A;  4C8O A;  3AMZ A;  7ICS A;  9ICT A;  1WCL A;  5AM1 A;  2LHT A;  2LBO A;  1COO A;  2QAR A;  2E8O A;  4M9G A;  1SWW A;  1XWL A;  2XCP A;  3SEI A;  3MGV A;  1BNO A;  4YP3 A;  4NLZ A;  2DKX A;  2VA3 A;  2LM1 A;  5ALX A;  2V9W A;  5KFT A;  3T5H A;  3T5J A;  4ECY A;  2XGP A;  7ICV A;  4IR1 A;  3JPT A;  3K4G A;  3MFI A;  1FEZ A;  2P66 A;  4AYB C;  5L1K A;  1SV4 A;  2WAQ F;  4RQ6 A;  1Y88 A;  1RQN A;  1A77 A;  1KSP A;  7ICO A;  2JR5 A;  2ZIW B;  1C20 A;  2RRD A;  4MF8 A;  2F8K A;  3C2M A;  4TUP A;  4EBE A;  2MSN A;  4DQQ A;  4EBC A;  3AUO A;  3C2K A;  4F72 A;  3MBY A;  1K1Q A;  4Y2Y A;  3MR2 A;  2ISO A;  3RTV A;  2K4H A;  3Q8P B;  5DB6 A;  5CP2 A;  3NVZ A;  3PW7 A;  4JK1 A;  4F71 A;  4Y2X A;  3ZD9 A;  4PJ0 U;  4Z6F A;  1JXL A;  2WF7 A;  2Z7J A;  1SWV A;  3PSI A;  3ONN A;  9ICK A;  4B9N A;  1L6N A;  3PO5 A;  3MGH A;  4RQ0 A;  2Y0S C;  3ZDD A;  1DGJ A;  7ICJ A;  2WF5 A;  2RDJ A;  4DF4 A;  1ZQZ A;  1PK1 B;  5CJ7 A;  1UPH A;  4QZA A;  5AI5 A;  5IIL A;  2R8G A;  4RQ1 A;  2XY5 A;  2CPR A;  8ICX A;  3LDA A;  3H8W A;  2AH5 A;  2EZY A;  2ALZ A;  1ZQA A;  5J2F A;  2PI5 A;  2OYY A;  1Z1B A;  1ZRN A;  1TAU A;  4JMU A;  2RDI A;  3ORY A;  8ICE A;  2WB1 F;  3PW5 A;  5EE1 A;  5KFS A;  3NVV A;  3GFK B;  2VJ5 A;  2KIW A;  1NI3 A;  4Y2S A;  3ALR A;  4OJ5 A;  4DSK A;  2PXI A;  3ZDC A;  5KT5 A;  4I2J A;  4QW8 A;  3MR5 A;  4RQM A;  2MRL A;  2CRX A;  1DOQ A;  5HHH A;  3Q8K A;  2IBK A;  1URJ A;  1Q3V A;  3UXO A;  4BDP A;  2ZIV A;  5J0W A;  2YX8 A;  3RH6 A;  2DL0 A;  7ICT A;  5ALH A;  1U45 A;  1N61 A;  3SAF A;  1JXE A;  3WKC A;  3GIK A;  1KTQ A;  2WF8 A;  5AIC A;  3WU2 U;  5KFK A;  1ZRM A;  4RT3 A;  2BCR A;  1F5S A;  3WK7 A;  5CRX A;  5J0O A;  4C7Z A;  5AKH A;  2NYV A;  3WKA A;  2H3Q A;  4KLD A;  5AKZ A;  3OJS A;  1T8E A;  3KBB A;  4ELV A;  2YMM A;  4EX6 A;  2E8M A;  4JB3 A;  4DSE A;  2DKZ A;  4BXO A;  3KKA C;  1KEJ A;  2ZUB A;  3WK5 A;  5JTI A;  1CUK A;  2WF6 A;  2W7P A;  1LKY A;  3H0R B;  2W04 A;  5KT7 A;  1NZP A;  3FAH A;  4UAZ A;  4DFK A;  1WYG A;  4FZM A;  3KZI U;  3NTU A;  3PW2 A;  3PML A;  3M8S A;  3M8R A;  1JUD A;  1LVH A;  2YB4 A;  2KG5 A;  3SR6 A;  3U26 A;  1J2M A;  3OSN A;  1U47 A;  2ATL A;  5KAI U;  1JI7 A;  1ZQY A;  1SV0 C;  4KMU A;  4GLX A;  4I2G A;  2KVS A;  1SIJ A;  2IOF A;  1D9F A;  3C5G A;  2MU2 A;  9ICF A;  3LVW A;  3JPP A;  3PV8 A;  4KX5 A;  3PSF A;  8ICM A;  4GIB A;  2M0N A;  4BJQ A;  3RJE A;  2PFN A;  1RYS A;  4TUS A;  4C8N A;  3RJG A;  4KLQ A;  3HRD D;  2HMX A;  2K4P A;  3PSP A;  2EZX A;  4FS1 A;  1NKB A;  1F0M A;  3PNC A;  1Z3E B;  5G5G A;  2ZXH A;  2LKY A;  3UMB A;  4JV2 A;  4EEN A;  3QEA Z;  2UVR A;  4DL6 A;  4ECS A;  2HHW A;  3QU5 A;  3Q8R B;  5DG8 A;  4KN7 A;  1YZ7 A;  1X9S A;  2F1I A;  2PMZ C;  5KL1 B;  2GLE A;  2FPK A;  1XSP A;  4IRK A;  9ICX A;  2C2E A;  2P6U A;  1SKW A;  2IHN A;  3HX0 A;  3IHQ B;  4J9O A;  3V6J A;  4CF3 A;  1DRG A;  3TQ1 A;  1N5W A;  1NJW A;  4YVZ A;  4YMM A;  2G0A A;  1MSW D;  2BPC A;  2UVV A;  4PGQ A;  3AU2 A;  3D2Q A;  2VA2 A;  5HHI A;  3F53 A;  5AKL A;  1X9M A;  2W9A A;  4GFJ A;  4J03 A;  2AGO A;  4B9L A;  5KAF U;  4J9P A;  2KJ9 A;  3ISD A;  1TAQ A;  3HT3 A;  4F93 B;  5ALF A;  5AKY A;  2HCF A;  4JWM A;  2KK0 A;  2BHN A;  2E1E A;  3HKZ F;  2O6K A;  7ICF A;  2LPE A;  5ALV A;  1ZQK A;  1XS9 D;  3IDW A;  4NWI A;  1SB3 C;  4YCX A;  4F4X A;  2BGW A;  2WB1 C;  4DFP A;  4KTQ A;  3B0X A;  3KD3 A;  4QZD A;  4EEL A;  3SAG A;  5EOZ A;  4UB3 A;  1RM6 C;  5AM4 A;  3HWT A;  1SZH A;  4WJ3 B;  1RXW A;  4J9K A;  3PVX A;  3V72 A;  3O0F A;  5BPC A;  1SXE A;  4OD0 A;  2F2A B;  3RB6 A;  1Z00 B;  7ICI A;  3RFA A;  1XO0 A;  4RPZ A;  4RQ8 A;  5HNK A;  1Q8K A;  2QB1 A;  4IS7 A;  3E2E A;  2QB0 A;  2FDR A;  9ICI A;  4USA A;  5KFH A;  3C29 A;  3K75 D;  3IM1 A;  5J2I A;  4QNL A;  1ZYQ A;  1L8O A;  4JV0 A;  4KX3 A;  4PHP A;  2AU0 A;  2R8K A;  2EZZ A;  2C2R A;  8ICS A;  3PZP A;  2LYB A;  5HMM A;  5KFV A;  2C22 A;  3AN1 A;  4QIW C;  2YMP A;  1L8L A;  4YR0 A;  2I9G A;  2A1J B;  1BPB A;  1T3N A;  2W3R A;  3T5L A;  5CB1 A;  2JGA A;  5J2D A;  4B6J A;  5J2G A;  4QZF A;  1OW5 A;  5KFE A;  2WTF A;  1S8O A;  4C80 A;  4B9S A;  2EAP A;  4CDG A;  2BCU A;  2ZTD A;  3H8M A;  3BJY A;  3EW9 A;  4LVS A;  2MA1 A;  4KLL A;  1JAL A;  4RQN A;  4ED6 A;  1CRX A;  2FPM A;  4EZ9 A;  3H4B A;  3KKA A;  3GIL A;  4DO9 A;  1RG6 A;  2HHX A;  2AQ4 A;  2W9C A;  3PX6 A;  9ICS A;  2JEI A;  5J2A A;  4KLM A;  3L5K A;  2W9B A;  1T7P A;  9ICV A;  5J2K A;  2KD1 A;  3D2N A;  4U6P A;  1UT5 A;  1HUO A;  3TFS A;  2BKE A;  4RQ5 A;  5IIK A;  3RB3 A;  4ED1 A;  4BGD A;  4UAV A;  4RNO A;  1ZD4 A;  3DV9 A;  1ZD2 P;  1PUZ A;  3V7K A;  3RF9 A;  1JX4 A;  1SV0 A;  8ICQ A;  4PZN A;  2GOL A;  1UT8 A;  5F9L A;  3RAX A;  2LYH A;  2EAO A;  1WG8 A;  4DSF A;  4O3R A;  4YR3 A;  8ICV A;  3A0H U;  3WK6 A;  4UB8 U;  3AEV A;  4LJX A;  4O3S A;  4I28 A;  3Q8S B;  5KT2 A;  4AP9 A;  4RQ3 A;  2RP5 A;  4F8R A;  1L7O A;  1L3V A;  5AI9 A;  4OJL A;  5DBB A;  3UXN A;  3H8S A;  3K1Z A;  2UVU A;  4ECW A;  5CR0 A;  5KFQ A;  2HDO A;  4MFF A;  3MDA A;  3CNH A;  4F4W A;  5HR7 A;  2AGP A;  1WCN A;  3RB0 A;  3C1Y A;  4G9B A;  5J2B A;  3N7S C;  4I2C A;  2ZJA A;  4NM1 A;  4KN4 A;  3SV4 A;  2MUT A;  4C8K A;  4OCZ A;  3EYZ A;  1X6I A;  3PR5 B;  4KIT B;  5ALW A;  2G5I B;  2H3F A;  3H4D A;  2F77 X;  4XRH A;  9ICJ A;  4Y2P A;  3GQC A;  2W3S A;  3DDH A;  3I1Y A;  3PX0 A;  3QEB Z;  5AK4 A;  1NK6 A;  2UVW A;  2G09 A;  1ZQD A;  4QZC A;  4F2R A;  1UCV A;  2C28 A;  1ZXI A;  5AKG A;  4UBC A;  8ICL A;  2FMP A;  2W7O A;  4M9J A;  5EE9 A;  5KG5 A; 
#chains in the Genus database with same CATH homology
 2HMX A;  2CRX A;  1OUQ A;  4ACO A;  1A6S A;  2Q4T A;  1P7D A;  3PSP A;  3SAG A;  5C0Y A;  4U7C A;  3MGV A;  3NRW A;  1URJ A;  2XI9 A;  2H3Z A;  3CP8 A;  4QJF B;  1Q3V A;  5T14 A;  1SZH A;  1HIW A;  2XIC A;  3C28 A;  2KOB A;  4NV0 A;  4WJ3 B;  2G06 A;  3OPX A;  2ZIV A;  2OM6 A;  4P0Q A;  3RF9 A;  4BX9 C;  2YX8 A;  2XVT A;  2A3V A;  2ZXH A;  3SAF A;  1ECW A;  2LKY A;  1MA7 A;  2GOL A;  3E0F A;  4OJP A;  2JH1 A;  3O0F A;  2DQN B;  4PL1 A;  4QIW F;  1D8B A;  3F5A A;  2F2A B;  2ZIV B;  3F2D A;  4P0Q B;  2Y0S F;  2D6F C;  1XNS A;  3SMV A;  4C0Z A;  4AYB C;  1GO3 F;  4CGZ A;  3CYM A;  3HKZ C;  1ZQ1 C;  3RFA A;  2WAQ F;  2ZIW A;  2DGZ A;  1XO0 A;  1PVP A;  2K8B B;  3NUQ A;  2NV3 A;  3PST A;  2KJ5 A;  2CN1 A;  5CRX A;  3H0L B;  3F2B A;  2JMG A;  4ICA A;  2ZIX A;  2RHF A;  2RP5 A;  2KVC A;  3IG8 A;  2ZIW B;  2KHQ A;  4OO1 J;  2PMZ C;  2RRD A;  2H3Q A;  2VJ4 A;  3LVV A;  3C29 A;  5KL1 B;  3SQI A;  2KIC A;  2K8C B;  2K4E A;  4QNL A;  1F44 A;  4OJL A;  3IN5 A;  2ZIX B;  2OH2 A;  2HBK A;  1PVR A;  2OXO A;  4NLB A;  3K1Z A;  2HOI A;  2KV2 A;  3VC8 A;  3GU3 A;  2K4H A;  4KX3 A;  2H3V A;  2HBM A;  4OJ6 A;  2DF4 B;  2W7P A;  5HR6 A;  2ZIU A;  5HR7 A;  3ICX A;  3N7P D;  3VCB A;  3H0R B;  2W04 A;  2Z7J A;  1DRG A;  3PZP A;  2LYB A;  3PSI A;  1ED1 A;  2K4I A;  3ONN A;  3N7S C;  4P0P A;  1L6N A;  5KL8 B;  4QIW C;  4FZM A;  2G0A A;  2ZIU B;  2KKV A;  2Y0S C;  4NLC A;  2G5H B;  3D2Q A;  2G07 A;  3F2C A;  2H3I A;  3F53 A;  4PL2 A;  2VIX A;  1A0P A;  1UPH A;  2JGA A;  2WAQ C;  3M6K A;  3IG5 A;  4GFJ A;  3CRX A;  4BUG A;  3D2S A;  2W03 A;  4OJO A;  1WUD A;  2YB4 A;  3AL0 B;  4O3M A;  2KKP A;  3GZF A;  2CPR A;  4CDG A;  2K8A A;  3H0M B;  3IP4 B;  1IIP A;  3M6Z A;  2KJ9 A;  2XID A;  2G5I B;  1T94 A;  2H3F A;  2KEY A;  2MA1 A;  2ZXI A;  3L3F X;  3AQF A;  1PVQ A;  2F77 X;  2VKQ A;  3SAH A;  2GH1 A;  3F5E A;  1Z19 A;  1CRX A;  1TAM A;  2F8L A;  2N1R A;  2OYY A;  3T79 A;  2F76 X;  3DEE A;  4A8E A;  2E1F A;  1Z1B A;  4KMO B;  2JHD A;  4AYB F;  2E1E A;  4JMU A;  1Q3U A;  1YT3 A;  2WB1 F;  3HKZ F;  2G08 A;  2G09 A;  2MRL A;  2R18 A;  4IC9 A;  2JH7 A;  2YB1 A;  2BDU A;  3AQE A;  2KJ8 A;  3LYS A;  2HBL A;  2LYA A;  3LVW A;  2KNJ A;  2HBJ A;  2HOQ A;  4P0P B;  4NWI A;  2ZG6 A;  2KD1 A;  4KX5 A;  3PSF A;  4FZL A;  3M7D A;  3D2N A;  2VJ5 A;  2K89 A;  2E5S A;  2KIW A;  2PMZ F;  4U6P A;  3ALR A;  2M0N A;  3KZX A;  4OJ5 A;  4BJQ A;  1HEK A;  2HOF A;  4CRX A;  4FZN A;  4FE3 A;  2KHV A;  2WB1 C;  2W7O A;  3N7R C;  1NZB A;  5A0L A;  2LHT A;  2LBO A;  1KBU A;  3KFU F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...