2HHTA

C:o6-methyl-guanine pair in the polymerase-2 basepair position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhtA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhtA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhtA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhtA01
3RJJA 1HMVA 4DWIA 3DLRA 2PFPA 1RPLA 5J2GA 5L9XA 5J2DA 3D45A 3L2RA 4E7IA 3MFHA 4KLTA 1KSPA 2ZTEA 4CGGA 4UBCA 3NGDA 4DL3A 3GFKB 1QLNA 4M3TA 3TAGA 3OS2A 3KJVA 1T4GA 4BE2A 7ICEA 1VSJA 4OKEA 4EEYA 2BGWA 1T7PA 4DOCA 1ZQCA 4CJQA 1NK9A 3S3NA 3AU2A 3B0YA 4UB5A 3M9OB 1D9FA 1D9DA 3V4IA 5HHIA 2KFZA 5C25A 1RT6A 4KTWA 3HM9A 1YVUA 4ECYA 3MAQA 5KG4A 4QWBA 8ICQA 2BE2A 4KHQA 3MXIA 4FZZA 4CJ3A 4P4PA 3T3FA 3Q8KA 5L1JA 2MUTA 5KG3A 3L2VA 1MSWD 4CJVA 5JS2A 4KREA 4I2EA 3WNEA 4QWEA 4H4MA 1S6PA 5BPCA 4PHAA 1RTJA 1WSGA 5J2CA 3PUFA 3K2PA 3G6XA 3ISNC 3OYBA 4KPYA 2A1SA 4DG1A 4YCXA 2VG7A 3IRXA 3MXJA 3P1GA 2BKEA 2AGQA 4B9LA 9ICSA 1IXRA 1VRUA 4Q5VA 2HW3A 4CGHA 3K57A 2XY7A 2HB5A 4I2CA 4RPZA 4M6WA 3PX0A 1BIZA 3MR6A 4FK4A 5IIKA 7ICHA 1T05A 8ICAA 4DOBA 8ICVA 1XO1A 3VQ4A 4ED7A 5IIIA 4FJXA 5KFIA 5KT5A 2G8HA 1TGOA 5DB6A 4EYIB 3L2UA 4YMOA 4UAWA 4CEBA 4JV2A 3T19A 2W42A 3MEDA 4HVJA 4FLZA 2BDPA 4I9LA 4NXZA 4JLHA 4C8KA 1S6QA 3RJEA 4I2DA 2X74A 1WSEA 5KFCA 4QW8A 4IQVA 1ZBIA 4LH4A 5J0UA 7ICNA 4NYNA 1ASUA 4M3XA 3V6JA 1AROP 1S9EA 9ICFA 1IM4A 3D0PA 5T7BA 1IG9A 3AVMA 4ECVA 2BCUA 3AA2A 4WE1A 1ZQDA 5KFDA 4CEOA 1C0TA 4MFFA 2PYLA 3OS0A 3QIPA 3LZJA 2C2EA 2BPGA 1X1PA 4KLOA 3C23A 1ZQEA 8ICIA 1NK4A 7ICIA 3KLFA 3K5NA 3DLGA 5KFVA 1TVAA 2YNFA 1S9FA 2DFEA 5J2BA 5J0WA 3RJIA 4YMNA 1Z26A 3RJKA 4CEAA 9ICVA 3V7KA 3RMCA 1XSNA 2I1QA 2PY5A 5CYQA 4M0AA 2XY8A 2P5GA 4LD0A 2W9AA 2ZQBA 1C7YA 1I39A 4JK1A 3P83D 4GXIA 2YNIA 3MECA 4I2BA 4BDYA 4DSIA 3DLKA 3H08A 3EWAA 2W9BA 4R66A 4ID5A 2RDJA 1ZQIA 1JXLA 2F96A 1TAQA 4O3NA 4KMUA 7ICLA 4JRQA 1QSSA 1NOZA 1U49A 1ZQAA 4H4OA 3EPIA 4OLAA 2C22A 1Q9XA 1SUQA 4PH5A 4RQ1A 3TQ1A 2NRZA 1RDCA 3DRPA 4I27A 4YFKA 3KK2A 4X5VA 4O3OA 2PI5A 3DOKA 2HNYA 4RG8A 4KB0A 2HHTA 3H4BA 4KI6A 3LWLA 1SZPA 4CEZA 1ZQZA 3AVFA 1RBRA 3V1QA 4FK2A 4YMMA 4GLXA 3RAXA 3U3GA 2G8UA 5J2EA 5F9LA 1FKOA 2VA8A 4FCYA 1SL0A 3V6KA 3K5LA 3BQTA 4BXOB 5KG2A 3MGIA 5KFXA 3DRRA 1U45A 2YHAA 3SQ1A 2D0AA 3ORYA 3LPTA 5IILA 2VA2A 1BISA 1JX4A 4EBCA 4PHEA 9ICJA 4O3RA 2WOMA 3V72A 4RU9A 2ALZA 2BCQA 4KRFA 2XC9A 1TKXA 1NOMA 4XRHA 1ZQUA 4DLGA 8ICXA 4YNQA 3NTUA 4TUSA 4OPKA 4FLYA 1H38A 3NF6A 3CYMA 2BCVA 2V4RA 1YT3A 4CERA 5KFNA 3OJSA 1S1VA 4MEYA 4QWCA 5IIMA 4JWNA 2KZ3A 1KEJA 1IKXA 2XY6A 4HHTA 3NHGA 4R8UB 3AVJA 5CZ2A 1XSPA 2ASLA 4CK1A 3TANA 1W9HA 4BE0A 2EHGA 3P5JA 3RAQA 3MEEA 1JLBA 4CJRA 4YQWA 4RPXA 2ZJ8A 2ZJAA 2F8TA 3LP3A 4RW9A 2KTQA 1ZBFA 4CJ4A 3K75D 2UVVA 1NK0A 8ICKA 1RYRA 1KTQA 3HW8A 1HUZA 3M8PA 9ICUA 1CZBA 3MFIA 1BGXT 2ISOA 2KW4A 3GIMA 4MFBA 3TAEA 1NKCA 1BQMA 4PQUA 2IS3A 2HVHA 4B9UA 1UA0A 4ED6A 4YXMA 3RJHA 9ICEA 9ICQA 3PW0A 3ALYA 4KHWA 3N4MB 1WN7A 4ECSA 4YN4A 8ICYA 4CJSA 4PGXA 4QZDA 2VA3A 3SUPA 1S1WA 3AU6A 3K59A 2BQRA 1TK5A 1BQNA 5KRTA 3OY9A 4M45A 4RUCA 3DRSA 3VQ7A 4R65A 1HJPA 1IKVA 3LAKA 5BOMA 4DSLA 4LZGA 2YKNA 4TSXA 9ICOA 3A2FA 1T3NA 5KT2A 1IKWA 5DLFA 1HNVA 3TAFA 1ZQMA 1FK9A 4ZHRA 4CGIA 1S0OA 4XA5A 4Z4IA 2FMQA 8ICSA 5TZVA 4IFYA 2AQ4A 5J0XA 1JXEA 3RH6A 1B9DA 4YG2A 4DS5A 2XCAA 1HRHA 8ICGA 3PW4A 2GV9A 2B4JA 1K1SA 3QZ8A 3CG7A 4J9PA 1A76A 4JS5A 4IR1A 3ZD8A 5KFAA 5CB1A 1ZBUA 3ZCMA 5CHGA 3NGIA 3DYAA 1S9GA 5HMMA 3NE6A 2GWSA 2EX3A 4DTNA 4KHNA 1ASWA 3O3GA 3QLHA 1Y88A 1DOQA 1RXVA 2IA6A 4Q8EA 4DFKA 4KB1A 4I2QA 1JN3A 5IINA 3AO5A 2BGGA 4GC6A 3ZT4A 4F5RA 3T1AA 3NFAA 1CXUA 3AO2A 5EWEA 4NCBA 4E3SA 2KZMA 4FLTA 1MC8A 3QEBZ 2I9GA 2R8JA 9ICNA 3FDSA 4DTUA 1ZQGA 5J2FA 4JWMA 3CM6A 3VQ9A 4M2YA 2BPFA 3HJFA 4IG0A 5KFSA 3HVTA 2M9NA 4DFPA 1VRTA 2NRWA 1JIHA 2G8WA 4QZ8A 5CYMA 2QKKA 4O9MA 3KD1E 1HYZA 4O5KA 5J0SA 4Q43A 1S77D 1KLMA 4PGQA 1ZQVA 8ICBA 4KKOA 4ECZA 1EXNA 5J0OA 2PFQA 3SJJA 4B9NA 2NRXA 4RQ6A 4BGDA 4H8KA 4DSKA 4DMNA 5CJ7A 9ICGA 4ECQA 5DGAA 4P4OA 3GIJA 3C94A 4DSJA 3SPZA 1K1QA 1HYVA 4DU1A 4CECA 1XI1A 3RR7A 1B9FA 3AA4A 4CHPA 2J6UA 4ED2A 1RT3A 4O5BA 3JPOA 3Q8RB 5DB9A 3AO1A 3U6FA 3DM2A 5J2HA 4KLFA 8ICUA 2UVWA 1SL2A 5J2IA 3C2MA 3H7IA 5DMRA 2IAJA 9ICCA 3OYAA 1RTDA 3SUOA 3KHLA 4GXJA 4Z6FA 4DTOA 4W5TA 5FRMA 1BVSA 4KLEA 3RMBA 4CF8A 2G8KA 1TK8A 2JZBB 3FYHA 2FBXA 4DS4A 4B9VA 2ZUDA 3PR5B 1ZQNA 3ITHA 3SNNA 5HHHA 4QZFA 3EY1A 4ID1A 1ZQQA 1KDHA 4AHVA 1C1AA 4DTJA 2H5XA 4IQUA 4LSNA 3ZT0A 1BIUA 5KFUA 1YTUA 1RT5A 3LWMA 1RZTA 3OYDA 3HX0A 3SQ4A 2PFNA 3EW9A 1VSMA 4YR0A 4RQ7A 5DG8A 3LK9A 1VSDA 4EP5A 2AGPA 3ZT1A 1ITGA 3IM1A 8ICCA 3QETA 4O3PA 1J54A 2G8FA 4ECRA 4ECUA 3LP0A 4O5EA 4FJ9A 1BCOA 1YTAA 4ED0A 4BDPA 4FZYA 3QEPA 4M42A 2W9MA 5HNKA 4M04A 4FK0A 3OYMA 5KFGA 2XY5A 1Q8IA 3QEWA 5KRSA 2Q3SA 4E7HA 3LPUA 4FJKA 1RCHA 3ZDBA 4RT3A 1RT4A 1LAWA 5L1KA 4B3OA 3C5FA 3V6HA 5C5JA 4KLGA 7ICQA 2R8KA 4DQIA 4E7JA 4PY5A 3HP6A 5IIOA 2RPIA 3KK3A 3QEXA 1XS9D 4QCLA 9ICRA 1NJYA 3OYNA 4O5CA 1REVA 1X9SA 4BDZA 1ZBHA 4Q0BA 1N56A 4DQSA 4M3ZA 5DQHA 5KT6A 4NY8A 2BQ3A 5HBMA 7ICKA 2KN7A 1BPZA 1HQEA 2Z1GA 1Y97A 4R63A 3TI0A 1BPBA 1B92A 4EP4A 3OYCA 3KLHA 2DFLA 4DL7A 4F3TA 3O3HA 3HK2A 4F3OA 4F5PA 2XHBA 4CEDA 5J29A 1KVBA 1RNHA 4I7FA 4AHTA 4YD1A 8ICWA 1RDAA 1EKEA 3NGZA 4M47A 3CFRA 2IHNA 5EOZA 4GXKA 2FLLA 3IHQB 2AU0A 2BQUA 3Q8SB 2FMPA 4CIGA 1TL3A 3O3FA 2IBKA 4ZTFA 1ZBLA 4CFAA 1COOA 1X2IA 4C8LA 1A5VA 2E6MA 3B6OA 9ICAA 1DTQA 4P4MA 3C95A 3WNFA 4M9GA 3JPNA 3G0ZA 4AHSA 2DFFA 1JLGA 2W8LA 2A1JA 3O4NA 4RQ0A 5EWGA 4Z6EA 4K4GA 4W5QA 2B21A 4F4XA 4ICLA 2HNDA 5HRRA 2XGPA 1Z25A 3K58A 4CK2A 2LYHA 4I2IA 2X6SA 5EU7A 3M8QA 2FPLA 4BXOA 4CF1A 2KFNA 4DSFA 4M9NA 1JLCA 3TABA 2MAXA 4CCHA 3KLGA 3PO4A 4QW9A 4FJMA 4KTQA 2Z1HA 4NCGA 2O4GA 2JGUA 5DB8A 8ICHA 3V7JA 3KTQA 3HYFA 3AVNA 4DU4A 3SV3A 3V9ZA 9ICXA 5J0QA 3IAYA 3OYEA 2XGQA 1NOYA 1QSYA 2DPJA 2PYJA 4IBNA 1QTMA 3UQ2A 1VK0A 3VA3A 4IFVA 3C6TA 3PMLA 1TL1A 4M3WA 4R8UA 4ZH4A 2UVUA 3G6VA 2J6TA 2JEFA 3C1YA 3AVKA 2KZZA 3UXNA 1S76D 2ISPA 2Z1JA 1NK8A 4F2RA 1X9WA 3JPPA 4AHCA 4F92B 3H8JA 2WTFA 4DL6A 5DK5A 3CM5A 4MF2A 2YKMA 3H8SA 3UPQA 3KD5E 1RBSA 1O1WA 1RYSA 4M6WB 4QZCA 3VQ6A 4J9SA 1TVRA 3DOLA 1IH7A 2WONA 2PI4A 5DGBA 1UT5A 3RRGA 4KHYA 1TAUA 2IOCA 5EWFA 3V1RA 3OGUA 9ICHA 4PPXA 1TKTA 1S0MA 3WNGA 1NK7A 3ZSWA 5SWMA 1SKRA 1JLFA 3S3MA 4I2AA 4DL2A 2R8GA 1KVCA 4FJJA 4J2AA 3KHHA 3RRHA 4CGJA 4R64A 2YHBA 1U04A 2YV0X 3K5MA 4KLJA 3PW2A 4C8NA 4CEFA 3JPSA 5KGWA 3PNCA 3UQ0A 2FLNA 2ZE2A 4HCCA 4NLKA 4LY7A 3SYZA 1CZ9A 3E2EA 5D49A 1KCFA 3UIQA 2OWOA 3H40A 4XQ8A 2P1JA 1WCLA 4DLEA 2QXFA 3MR2A 1NJWA 4F4ZA 4DU3A 4YP3A 3G6YA 3JSMA 1WSJA 2F1HA 3OYIA 4NM1A 2IDOA 2Z1IA 1B43A 5FRNA 4DFMA 3LP2A 3HO1A 9ICLA 3L2WA 3VQDA 4HTUA 1U9LA 1NK5A 1XHXA 5KGXA 2ETJA 4CJTA 3NBPA 4J2BA 1JLEA 5HROA 5KFMA 5D3GA 4HUFA 2HNZA 4PHDA 5DBAA 2VWJA 1L3SA 4OKKA 4RQ8A 3GILA 1UA1A 3ZSVA 2IMWP 1IKYA 4Z0UA 3F73A 2ZUCA 4PHPA 2NRTA 5J0TA 2PZSA 4JUZA 3HWTA 3T5KA 1LWEA 4Y1CA 3BQ1A 4FM1A 2HHUA 1DGSA 4PWDA 4E0DA 5KFKA 1RBUA 4ECTA 4CF0A 3S3OA 1X9MA 3ZDEA 3RMDA 4FLUA 3GV5B 9ICPA 4N56A 4F5OA 5KG5A 4FBTA 3ISBA 1WCNA 1J53A 2D0CA 5C42A 8ICTA 4Z4GA 1NJXA 1EP4A 1TV9A 1J5OA 3TAMA 1EETA 3AVIA 4YXJA 2OPSA 4I2JA 8ICLA 3ZSYA 4JV1A 1HYSA 2XO7A 9ICBA 4KN7A 3I0SA 1ZJMA 4UQGA 3NDKA 4J9MA 3HPOA 5DLGA 2O4IA 4NCAA 1W0HA 3QEIA 3ZSZA 9ICMA 3ZSXA 4KV8A 1SKSA 4FVMA 4MFAA 3QZ7A 2FPKA 5DB7A 3SQ2A 4YR2A 1CXQA 5KFBA 2HHWA 1DLOA 4DTPA 5KFPA 3L2QA 4DF8A 3K4GA 1S1TA 4NM2A 4FS2A 4M9HA 1Z00B 5CP2A 4CJWA 3L8BA 5KFOA 1ZQHA 4UB4A 4B8AB 1WSHA 4CFCA 3LAMA 2E4LA 2NUBA 4NLZA 2JZBA 4R5PA 2ZJ5A 3FFIA 1RTHA 1GOAA 3JYTA 4I29A 4KLQA 4Z4EA 1IO2A 4CGFA 4Z6CA 3KKSA 5DDMA 4KLHA 3LP1A 2D0BA 5KFHA 9ICIA 4N41A 2P6UA 3AVCA 3AVLA 5FDLA 4E7LA 1KFDA 3CFOA 3B0XA 4FYDA 2HMIA 4BE1A 1LW2A 2FC0A 1N6QA 4M3YA 2F1JA 4UB2A 4DTRA 3NGYA 4FXDA 3EZ5A 2LSNA 2DY4A 3V1OA 4DTMA 4KI4A 4RPYA 1RT7A 2IHMA 3CQ8A 4GMJB 2W9CB 1U48A 4FJGA 1ZQXA 3OHAA 3QO9A 5KFRA 3QNOA 2HVIA 2C28A 1BI4B 2E6LA 4E89A 4DO9A 4KN4A 3PX4A 4AHRA 5DQGA 3GIIA 3LANA 1MU2A 3MDAA 4GC7A 4FW2A 4IDKA 3NF9A 4N76A 5SZTA 1XWLA 1D8YA 1TFRA 4KLSA 8ICZA 1U47A 2X78A 1A5WA 4FLWA 3AA5X 3OYGA 4KHUA 3GIKA 1QS4A 1RT2A 1VSFA 2HHSA 4IRCA 3C1ZA 1EXQA 1J9AA 3RWUA 5KFLA 4RT2A 1TKDA 1C0UA 3LZIA 2FBVA 5KFJA 4P2HA 3Q8QB 3RB0A 3HXMA 3DLEA 3NH2A 4QZIA 2HHXA 2J6SA 1N48A 4KLIA 3RBEA 2R8IA 3RB6A 2Y1JA 4FJNA 1RTIA 2ASJA 4F91B 4CEQA 3C21A 1A77A 1FKPA 3MGHA 3SUQA 1DTTA 2B5JA 4QZAA 3RB3A 2ZTDA 3JPQA 3MR5A 1LWFA 4CEEA 4ECWA 4ED8A 1B22A 4UBBA 4RW4A 4ELVA 2P51A 3DMJA 4O4GA 4YD2A 1XC9A 1S97A 7ICMA 4Q8FA 1C1CA 1WAFA 1JL1A 1UT8A 4JV0A 3AO4A 4F5NA 1JMSA 4UAYA 5HLFA 4KFBA 2VWKA 3AV9A 4CF2A 3L3UA 4B9TA 4NLGA 3M9NB 3KIOA 4PA1A 4ZTJA 3S9HA 2JEGA 1S1XA 2VANA 1HQUA 4KLLA 4XUSA 5I42A 3HPGA 3U3YA 1LB2B 4IRDA 4YVZA 3TR8A 4M41A 4JS4A 3PMNA 4FO6A 3VQ5A 7ICJA 1WAJA 3PVXA 2BCRA 1JLQA 2BANA 1RBVA 1VSHA 3OYHA 1C1BA 2D5RA 4J2EA 7ICVA 3OYJA 4OKJA 4M3RA 3KHGA 1NKEA 2R8HA 4N5SA 3PV8A 8ICRA 1Z3EB 3VQ8A 1R0AA 1LW0A 3VQQA 1CEZA 3C2LA 4YFUA 3T5LA 3BJYA 3TAPA 5HRNA 2OYQA 2JEIA 4M9JA 1SV5A 4CJLA 4E1MA 2F8SA 4HUGA 3E01A 2RN2A 3VA0A 5HMLA 1ZQLA 4XIUA 1QQCA 3C6UA 4CGDA 4HCBA 4PUOA 2FLPA 1S0VA 4Y1DA 4QOZB 3SZ2A 3HVRA 1V9PA 4TQSA 3SPYA 4CFDA 4DTXA 4HYKA 3ZDDA 1WSFA 1ZQJA 1L3VA 3PY8A 1ZQTA 5K14A 1LAVA 3V7LA 4GVMA 4J9NA 5D46A 1C6VA 3PW5A 4CESA 3SCXA 3H8WA 3SV4A 1L5UA 2VG6A 4UB3A 3QEAZ 4LZDA 4YR3A 1MQ2A 3PW7A 3RH5A 3KK1A 4Z4HA 4ELTA 4DOAA 3BGRA 2JEJA 5KG1A 1VSLA 5J2JA 4FJIA 4TURA 1LWCA 2DTUA 5BOLA 4FJLA 5D4BA 1RDDA 5CR0A 4KO0A 3Q8MA 4J2DA 4DQRA 5HRPA 5KFZA 5C24A 5FROA 1T03A 3MDCA 2YNGA 4HUEA 3RB4A 4IQWA 1ZQBA 2RF2A 1NK6A 2PFOA 1RDBA 5DBBA 3PR4A 2DPIA 1QHTA 2OPQA 5CZ1A 1S5JA 1BPDA 5CWRA 4F50A 4CHYA 2NRVA 4I2HA 4Q45A 1MQ3A 3OJUA 1GOCA 2F1IA 1C0MA 5J0RA 2PXIA 4FZXC 4RQ2A 4CK3A 3LDAA 4DF4A 3QINA 3THVA 3VN5A 1JXBA 5HRSA 3MXMA 5KFTA 3ZD9A 3T5JA 3V9SA 2IC3A 3Q8LA 5J0PA 4RNMA 4RW6A 5J2NA 3SUNA 4K8ZA 7ICUA 4B8CA 3OHBA 4F4KA 1BHLA 4E19A 3NH1A 3M8SA 2AQ0A 3WNHA 1ZYQA 1TK0A 1CUKA 2ITGA 3M9MB 4OJRA 4IRKA 3M8RA 4AH9A 1SKWA 3MBYA 2QKBA 3KHRA 3ZDCA 1KFSA 2MUTB 4G3IA 5HP4A 1CLQA 3TFRA 5KG0A 1S10A 2FBTA 2GBZA 4B08A 9ICWA 3AVHA 5J2AA 1UAXA 4CHQA 4Z4CA 2BCSA 1BL3A 3RH4A 1RXWA 1VSKA 1ZQWA 3EPGA 1EX4A 4FJ5A 2FMSA 4CHOA 1BPEA 3HSTB 3NH0A 3N97B 1N5YA 4EZ9A 3O4QA 2ZTCA 5J1EA 3V9WA 4AHUA 2G8VA 4K8XA 3NF7A 5F9NA 3UXPA 3BQ2A 2HHVA 3QNNA 4DL4A 4GW6A 4J9QA 4I28A 4N47A 1LV5A 4EBDA 4KHSA 1HNIA 2XCPA 2B6AA 4J9OA 4C8OA 4QZHA 4NYFA 3OSNA 4DFJA 4OGCA 4FJ8A 5J2KA 3AVBA 4CIFA 3V81A 4KAZA 4UB1A 4MF8A 5KFEA 2Y1IA 3Q8PB 4F8RA 3V6DA 4MFCA 4ED3A 3NF8A 2OPPA 4RNOA 4CJ5A 1KFTA 2IGIA 7ICTA 2A1JB 1Q9YA 1L3TA 4DQQA 2P5OA 4QZ9A 3I0RA 4BWJA 4QWDA 1HPZA 2GUIA 2UVRA 4KITB 1BCMA 4B9MA 4F4YA 1QSLA 2OA8A 3MEGA 3IS9A 2FPMA 4FM0A 7ICFA 3DI6A 8ICMA 1RILA 5DBCA 3JPRA 4OGEA 4K4IA 4DQPA 4F93B 4LVSA 1U4BA 4KLMA 1Z00A 3B6PA 4Z6DA 3JPTA 5KFYA 3TAQA 1KLNA 3BDPA 3VQPA 3SQ0A 5DDYA 5E41A 4OLBA 3ASMA 4KLDA 3RJGA 2C2DA 3LDSA 4FS1A 4QZGA 4J9RA 4I2GA 3ZSRA 1ZQYA 4I2PA 2ZD1A 5KFQA 3ZT3A 1A5XA 3V9XA 4ED1A 4F2SA 4O44A 4FW1A 1HUOA 2ZUBA 2C2RA 3GQCA 1G15A 3ETLA 3RMAA 7ICSA 2W9BB 4O0JA 3K5OA 3OYLA 3HP9A 3ZT2A 4L8RB 9ICKA 5KG7A 3ISCA 2ATQA 4LH5A 3ZSQA 5HP1A 4MQ3A 3ISDA 4FLXA 2ASDA 1ZQRA 4E1NA 5KI6A 4RQ5A 1JKHA 4FM2A 4E7KA 4F5QA 2G8IA 2W9CA 4IR9A 4RUAA 4W5NA 3QIOA 1ZJNA 1ZQKA 4CF9A 4OVLA 1SL1A 1BI4A 4O55A 7ICOA 5J2MA 3KLIA 1ZQPA 7ICRA 2HHQA 4M3UA 1UOCA 4RW8A 3DLHA 5KFFA 5CA7A 8ICOA 3OVNA 4Z4FA 2AGOA 3RJFA 4QWAA 4K4HA 5DQIA 1K6YA 4B9SA 4QAGA 1WSIA 1FXXA 2BPCA 1XU4A 5KT3A 4JRPA 2VG5A 3AVAA 3CFPA 4IG3A 3NAEA 2QK9A 1QE1A 2P66A 4I9QA 5IIJA 5DG9A 1D5AA 3RTVA 4OPJA 1ZETA 4ECXA 4CJPA 3C5GA 3MABA 2V4QA 3I8DA 3AO3A 1S0NA 4MEXA 3F9KA 4TUQA 4M9LA 8ICNA 1ASVA 4FJ7A 3OSPA 2V9WA 2P6RA 2FBYA 3AA3A 4J9KA 1BPXA 1ZQSA 7ICPA 4PGYA 3IG1A 1RBTA 1WLJA 4UAZA 2A1RA 3ULDA 3C2KA 4QZEA 3GV8B 1WNSA 4W5OA 4FBUA 4CJUA 4RW7A 1JL2A 4FLVA 2BHNA 2OZSA 3PX6A 1D8LA 4CFBA 3VQEA 3RBDA 5L1LA 3DLBA 3VQBA 1JLAA 9ICTA 1VSEA 2OPRA 3V9UA 3OYKA 1XHZA 5KT7A 1HJRA 2Q0ZX 3UXOA 5J2PA 1NKBA 1UWBA 3VQAA 4CJFA 5KTQA 5J2QA 1ZQFA 1PZNA 1L3UA 4CJEA 3KLEA 3L3VA 3TWHA 3QEVA 3SI8A 4EZ6A 3RR8A 5I3UA 4DEZA 4EYHB 3ZSOA 1KVAA 1F21A 8ICEA 1KRPA 7ICGA 4G1QA 4RQ4A 4TQRA 8ICFA 4CHNA 4LSLA 3SI6A 4O0IA 3T5HA 4W5RA 5KFWA 1I3AA 4BACA 2BR0A 4IQTA 3TARA 2XRIA 2RDIA 2I5JA 3EYZA 3VQCA 4EBEA 3QE9Y 3BQ0A 3H4DA 3OYFA 5KG6A 3HT3A 3AVGA 5CY4A 4RZRA 8ICJA 4ELUA 4CHZA 4NLNA 3G10A 4J9LA 1T8EA 1ZQOA 2KQ2A 3QERA 5JUMA 4CJKA 1TV6A 3AUOA 1NJZA 4DSEA 2ATLA 4KTZA 1BPYA 1VSIA 3HPHA 3LALA 2YNHA 2JLEA 5KT4A 3QESA 3NCIA 2RKIA 5DG7A 4O3QA 3OS1A 5L1IA 4FJHA 1TKZA 4CE9A 4DTSA 4RNNA 4QZBA 4C8MA 2X6NA 2AJQA 4IKFA 4TUPA 2W8KA 2OZMA 4KLUA 3GDXA 3GV7B 1S1UA 2DFHA 3KKRA 3HL8A 4RQ3A 5JS1A 4CIEA 8ICPA 3ZDAA 5J0YA 4O3SA 1RT1A 4DL5A 1XSLA 4BWMA 4Q44A 4I2FA 3MR3A 3PO5A 2R7YA 4F4WA 1GOBA 5DKWA 3TFSA 4AILC
chains in the Genus database with same CATH superfamily
2OEMA 1ZM9A 1RPLA 1T95A 4M5JA 2R9LA 4KQZA 1KLMB 3MFHA 1C20A 1KSPA 2NXUA 3VEYA 2VOOA 4Y2YA 3NGDA 5A0LA 3Q22A 1GX5A 4V1Ak 1BUPA 3TAGA 3R9LA 4DV7K 4BE2A 2W40A 4JBCA 1F3FA 3D66A 2E3TA 5JLFA 3Q8UA 4JI1F 3M6VA 1YZ7A 1RSCA 4URSA 4UB5A 3R6LB 2KXHA 2W41A 2E44A 5HHIA 4BROA 1VIOA 3DM2B 5C25A 2ZH1A 1RT6A 4KTWA 1VBYA 1YVUA 1YSJA 4X2BA 4LR8A 5KG4A 5FPEA 3NY0A 1NB7A 3CCQN 3MXIA 1X0FA 4FZZA 4CJ3A 3BYPA 2A6AA 2GC8A 2V4JA 2MUTA 2VIXA 4ES1A 2A6OA 4LFCK 2AZ1A 2ZH4A 3PRVA 4ZCLA 4ZLJA 4X84A 2EAOA 4PHAA 3GSDA 2ZBPA 4DR4J 3HKZD 3M2RB 2O01C 3BBBA 5THWA 3L4PA 2YWHA 3IRXA 3MXJA 1K8AT 3P1GA 4Z7CA 2BOAA 3AAWB 2ZHBA 1UZDA 5L9NA 4ZDNA 3Q24A 2QEXS 3GZ7A 3OR2B 4H03B 5AQNA 3A5MC 1T05A 2QWNA 8ICAA 8ICVA 3QAUA 1OH7A 1GT8A 1EB0A 2DNMA 1T9UA 5KFIA 4ZP9A 2G8HA 2VV5A 4YMOA 3LW5C 1KBUA 2E20A 2LFVA 3EGWB 3BGUA 5A8RA 4I9LA 2HEKA 4DR7F 3RJEA 3CCLN 1WHWA 3FRYA 3E66A 3TVYA 4M3XA 3CJ8A 2XTJP 2KP7A 2KKHA 3L7PA 2KKZA 1AROP 3UKRB 2VDHA 1O6XA 9ICFA 4BLGA 2CPFA 3N5BA 2LU2A 4XDCA 4J37A 3MPUB 2HSTA 2E7WA 3P39A 1IG9A 3ELHA 3BPSP 2CVEA 2E1ZA 3QWUA 5KFDA 1FE4A 4MFFA 1YAGA 1VLBA 3HHLA 2BV3A 4GKJK 2J8AA 1WF1A 3C23A 1S99A 4J5OA 1VQ7N 4KBIA 5KFVA 2YNFA 4Q0BB 1LKYB 1ZD3A 2BTFA 3JSYA 1UVIA 3BZKA 3ETOA 2F40A 4YMNA 2ZIVA 1Z26A 3I4PA 2IMOA 4ZP6A 2EDUA 3KLHB 1XSNA 1IN0A 2PY5A 5DO2A 3WC0A 2E29A 2W9AA 1NGFA 1C7YA 4U7UK 2XQCA 3P83D 3CQXA 4JYAF 4DSIA 2VDIA 3H08A 2D7SA 2W9BA 4R66A 4ID5A 2RDJA 3PHTA 7ICLA 1WD6A 5ETQA 1QSSA 1NOZA 1ZQAA 2A18A 4H4OA 5A0YB 2BRKA 4PH5A 4ZA1A 1RDCA 4I27A 3ZZ0A 3EL2A 4C4TA 2M0GB 2LYVA 2HNYA 3M2UA 2LXUA 4I6MB 1NGGA 3H4BA 2HQGA 2CPHA 3NOGA 3T9NA 1HWLA 4DZDA 4A5BA 4C1NK 1CJVB 4CEZA 2E7XA 1Q79A 2ZC4A 4YMMA 4GLXA 2KVIA 2IRUA 2FVPA 2G8UA 4C97A 1Z6RA 2BJ7A 3MOZA 1K8KB 3WK7A 4FCYA 3UMBA 3EN9A 2AWZA 5KG2A 3MGIA 2CWKA 3DRRA 1HBOB 2O6KA 3WIUA 1KBRA 4J03A 2AD9A 4TY8A 3EWGA 2DRAA 1R31A 1QHAA 4EBCA 9ICJA 1RQNA 4DMZA 2B9YA 1TUVA 4KH5A 3P31A 3MX5A 2HGLA 2M8HA 3OXFA 2ALZA 2MKSA 5E26A 2XC9A 5AQXA 3NTUA 4YNQA 1HW9A 2UUBK 4KHPF 3CYMA 2QIFA 3IAS9 2BCVA 4CERA 3OJSA 5LMNK 4IH7A 4IFVB 2O1PA 1K9MT 2LVWA 1NMDA 4RWWA 3NHGA 4R8UB 2W4PA 1M5OC 3CD0A 2EAPA 4BR7A 2ASLA 2Q97A 3GR1A 4CGZA 4DUYJ 1YTYA 4BE0A 1JLBA 5AQIA 2F8TA 2C2ZB 4RW9A 3LP3A 4NJ8A 2J4RA 2CQ1A 2VZ9A 4QIFA 4OHWA 3GYNA 3OPXA 1TVRB 3DOLB 4KY3A 4ILMA 9ICUA 2WONB 3MFIA 3HCXA 1BY9A 5AFUH 3GIMA 2DTJA 3FEXB 2XS2A 2CUYA 4PQUA 2ZH2A 2IS3A 1D9AA 4K4WA 4B9UA 1UA0A 5AFUA 4ED6A 9ICEA 2DEJA 3TQEA 3R2CJ 5IWAJ 2DNZA 3N4MB 4ECSA 4PGXA 4U67Q 2Z56B 1RABB 4X66K 2GIQA 3IM9A 3K59A 3OY9A 3DXSX 3GZFA 1BXNA 3UDVA 2KO1A 4OI0A 3ZI4A 1HJPA 1IKVA 3MGVA 1C2PA 2WVFA 5BOMA 1GLCG 4NWIA 1T6DA 2RHKA 2YKQA 3EM1A 3VR1A 4LZGA 9ICOA 1YX2A 3HHEA 1XMQF 5KT2A 1GK8A 1DEJA 2IJFA 3TAFA 2RQCA 1ZQMA 3O3LA 1FK9A 4LF4K 4CGIA 3DLLQ 2FMQA 2P9SB 8ICSA 5J0XA 1JXEA 1B9DA 1DT9A 4YG2A 1ZTWA 2IOFA 4I68A 2GV9A 1VQLS 3L5KA 2HNZB 3IR6B 3QZ8A 4FL9A 1A76A 2YN4A 4JS5A 5BXIA 3ZD8A 4CH1A 1ZBUA 3GR0A 5CHGA 3BR9A 3DYAA 3R1XA 1DQ8A 3QT8A 1YI2S 1GAOA 4BUGA 3QLHA 1Y88A 5AXLA 2WB1F 3MMJA 4Q8EA 3GDQA 4ZCKA 4DFKA 2WSEC 3PM9A 5LXRA 4KB1A 1JN3A 2UUCF 4BHQA 5IINA 1J2MA 3K8VA 3WBZA 2F44A 4F5RA 3T1AA 1FHTA 2IVFB 4NCBA 3O6QA 4FLTA 3QEBZ 5LSLA 2I9GA 3ALRA 3FDSA 1DK2A 4MK7A 1Q81T 2FJBB 2IPOB 2NRWA 1FJEB 4MKAA 4QZ8A 5HMYA 2QKKA 1E6YB 3NS6A 1J5OB 3KD1E 1EETB 2F65A 2CG4A 1S77D 2UXDK 2ZWHA 1ZQVA 1DFDA 1WKKA 1FVSA 2HOFA 4BGDA 4DI6A 2CADA 3SPZA 4DSJA 1HYVA 1XI1A 4C4SA 1S4EA 2E1CA 1C4AA 4DV0K 4A8OA 3R5CA 3AY9A 1YJVA 2VG5B 4JI1K 1Q5YA 2QA4G 5D4NA 2VASA 8ICUA 2UVWA 4K4SA 4PL2A 4IL6U 1SL2A 3TW0A 5DMRA 1VISA 9ICCA 3WK4A 3GG4A 5FP0A 1U8WA 4DCCA 4Z6FA 4W5TA 5FRMA 1YDLA 2ALYB 2YBVA 4KLEA 4CF8A 1TK8A 3IR7B 5GAEP 4IO9Q 4CNZA 4RBUA 3BF3A 3ZZOA 4B9VA 3JYTB 2ZUDA 4JI3F 3TKAA 3P3DA 5HHHA 2E8MA 3PFEA 4QZFA 1ZOTA 2ES6A 4DTJA 4IQUA 4FWNA 3ZT0A 4DPYA 3LP1B 5EE3A 4ILRA 1RT5A 1RZTA 5FDLB 3MXHP 4EWTA 3SQ4A 4RPFA 3ZTSA 2FHMA 4YR0A 4K7QA 4ED5A 3LK9A 1VSDA 3WXLA 5B0FA 1KW4A 1N62A 2AGPA 2PT0A 2NLWA 4OZ5A 5GTIU 2HOIA 3IM1A 5HANA 2F3NA 1RT7B 1A6SA 3NWGA 4O3PA 2J9DA 1J54A 1X4EA 2M3DA 4ECRA 5A8WB 2O8EB 3NNCA 2Y1RI 1V6HA 1RAHB 4O5EA 4C7ZA 1YTAA 3I28A 4LF8J 3MCAB 1PJ5A 1CSJA 1MN7A 4DR7K 2BJ8A 2HBZB 4IDKB 4RU2A 3OTCA 4M5HA 1FRHA 3OA9A 3QEWA 3A1YG 2SXLA 5KRSA 1U6FA 2C42A 2OANA 1PAUB 2P9CA 4FDFA 3LPUA 1RCHA 3IGVA 4RT3A 4A61A 4CH0S 5L1KA 4X4VA 2ZF5O 1HQ2A 2K60A 2FY8A 4BR5A 4KLGA 1GH8A 2R8KA 4DQIA 2JX2A 4CZJA 3HP6A 3KK3A 3I82A 1XS9D 3D2SA 2WBRA 4QR0A 3OYNA 2Y8WA 4O5CA 1REVA 1N5QA 2I5HA 2VFVA 2HMPA 2DHGA 3FSXA 2QW9A 3M2VA 4A5AA 1UEUA 3DXMA 4R63A 4FVCA 2HQIA 3W65A 2QZ8A 1DTTB 2V8HA 1GLAG 4F3OA 5ITHA 3WUHA 4L6V3 1U2FA 2XHBA 1TV6B 5EE1A 1Z2LA 3TO8A 4AQYF 1RNHA 4I7FA 3R2DJ 2PFDA 4AHTA 1RISA 3OBIA 5AQFA 3R7SB 2VPZB 1NDKA 2OSRA 3NGZA 4DV7J 4JYAK 5EOZA 1SV0C 2JL9A 2RD5C 4LRAA 3HD2A 2K8GA 2AU0A 2BQUA 1WC6A 2DD8S 2FMPA 4O23A 3D2NA 2OAUA 3O3FA 3DDNA 3JAMO 1ZBLA 1S1XB 2D3OR 1COOA 2OFHX 2E6MA 3B6OA 1DTQA 5B0AA 3A3OB 3BSOA 3C95A 4P75A 3JPNA 2DFFA 2ZUAA 4PKGA 1IWAA 3DRXA 3MN6A 2A1JA 3O4NA 5B09A 2QLTA 1KP6A 5BPNA 4Z6EA 1VQ6S 4CO3A 3M3ZA 4DV4F 2XGPA 1Z25A 4UAUA 4MDBA 2RQ4A 2LYHA 2I1RA 1B3TA 2DR8A 1GLEG 3M8QA 3OVBA 4BXOA 1UW4A 4DSFA 4M9NA 1VQ5N 1KD1T 1R0AB 4CCHA 3PO4A 4OX6A 2O8BA 4RBTA 2W2QP 1CLFA 4FJMA 4A62A 4NCGA 4LF7J 1Q0NA 1SV5B 3S6EA 2O4GA 3QSYB 5L8RC 1Y3JA 4Y65A 3MWTA 3KTQA 3A5NC 5IV4A 1RFQA 1UKUA 4N7TA 2NZTA 3KK7A 4LF5K 4FWLA 9ICXA 3NEKA 5J0QA 1NWKA 2YPYA 4IBNA 2FSJA 4OYWA 3VA3A 4KHPK 2ASPA 5E2QA 2AIRB 3A8YA 5K14B 1TL1A 4ZCMA 4M3WA 1A0OB 5L39A 2UVUA 3MUTP 2KZZA 1FJ7A 4WTOB 4ILHA 2OXOA 2Z1JA 4V19X 5AK4A 4F2RA 2F4VF 3ZZPA 2Y9TA 2WZ1A 3NXZA 2W2NP 1R8AA 2WTFA 4DL6A 5DK5A 3BGRB 2R42A 1FD2A 2YKMA 3MN9A 1LWCB 4CYUB 1WKJA 2U2FA 2FI1A 3D0HE 4QZCA 2VBYA 4LQ9A 1HBNA 2UUWA 4J9SA 1COKA 3GYXB 2Q36A 1IH7A 2PI4A 1CULB 2KICA 1TAUA 2PMZF 1OH6A 5IXUA 1KC8O 5C24B 3OGUA 9ICHA 3V1RA 1VFJA 4MLHA 2IOFK 2W3RA 1T03B 1SKRA 1GXLA 2ACMA 3S3MA 1I3OB 4I2AA 1KVCA 4FJJA 4F26A 4CGJA 2YHBA 1T44A 5D15A 3F9MA 2YV0X 2HRUA 4C8NA 3CJ5A 3KUEA 1RYUA 2MSTA 4NE9C 1NHKL 4OLOA 2FLNA 4HCCA 3QJPA 3H45C 1AB8A 3WQTA 1URJA 3MOJB 2DNHA 1KCFA 3CO9A 3NRWA 2ZM6J 1VQNN 3D6JA 2P1JA 2IC3B 2CDRB 1RWXB 3MR2A 3KJQB 1EHWA 3JSMA 2F1HA 3OYIA 2IDOA 3AY0A 4MH8A 2DO4A 2GO9A 4DFMA 1XMQK 3LP2A 4CW7B 3HO1A 1Z1ZA 1CJTA 2KFYA 4OIXA 2D1KA 3VQDA 1PK3A 1U9LA 1SCJB 1OVQA 3R1HA 1H7WA 2YNFB 1UPHA 2IVPA 2QSWA 1ZZFA 1WACA 1R8BA 2ZIVB 2ADCA 1IR0A 2RJZA 3ZSVA 3R5AA 3CC2N 1QJHA 4C0OC 1IKYA 3H3OB 5J0TA 5CR4A 4JUZA 3L4BC 2RS8A 2V8VA 2IDLA 4Y2KA 4QIWC 2HHUA 1DGSA 5KQ8A 4F67A 4C98A 4PWDA 3THWB 4E0DA 1VR6A 2UUCK 1RBUA 1SQFA 3DJCA 4K4XA 1FERA 2IY5B 3S3OA 1LOTB 3IM8A 1EZZB 1PJ7A 1HNIB 1VJWA 2F9WA 4FLUA 3GV5B 3ILIA 1JNRB 4FBTA 2ZKTA 1NGJA 1ED1A 4UOGA 2R4FA 5C42A 2DR7A 2UUBJ 1EP4A 3GTYX 4NLWA 3OFGA 1VLOA 3AVIA 1J97A 4KR0B 2E5IA 5LMNJ 3DHXA 2EPIA 1AUSL 3ZSYA 2WF9A 4JV1A 4TLQA 3CJ2A 2XO7A 4KIAA 2DL0A 3NDKA 4XTTA 3UN2A 4ZITA 2LQ5A 4K2XA 3MMBB 4LVOP 1Y9OA 2AYEA 3TJAA 5DLGA 3JQMA 2IRYA 2LYAA 1NLVA 3D2FA 4MFAA 3IS9B 3P5BP 3SQ2A 2AP6A 3QXGA 2V67A 3I56N 2FF3B 2P5VA 3HFZB 3L2QA 4DF8A 4FWQA 1I6JA 1X4CA 4CF3A 3ZTOA 4M9HA 2CPZA 5CP2A 2E8NA 5D0GA 4B8AB 1W2IA 3FZLA 1PVRA 2Z57B 3AD8C 4BY9C 4NLZA 3LDQA 3BQ7A 2K1RA 3SENA 4BRMA 2CGJA 3KJNB 4R5PA 3FFIA 1R27B 5LXYA 5IQ6A 4M95A 3TEHB 3AJDA 4X66J 3MMAB 1D0EA 1IO2A 2IYIA 4JI3K 4Y2XA 4CGFA 4PZOA 2DKXA 3SIPB 5DDMA 2OFGX 3TZYA 1EO1A 2JLFA 5KFHA 4HAIA 4NXMJ 2WB4A 2MQOA 2Q4TA 3C65A 2A2CA 2HMIA 2NQPA 1LW2A 4WU2A 1VCTA 4M3YA 2YX1A 4NEYA 4FXDA 4EK2A 1U25A 4NLXA 4LF4J 2IHMA 3CQ8A 1B4FA 1IJJA 2WF6A 2GWKA 3W60A 1OUQA 2HS3A 3CCRN 3QO9A 5TKWA 3QRRA 2HVIA 3FAHA 3GU0A 2HZAA 4JOUA 1BI4B 1DXSA 4OJGA 3TVZA 5J2MB 4A57A 2MLYA 4X62F 4KN4A 3QYYA 4OZ0A 4QS7A 3CJ3A 3LANA 2PAVA 2X3DA 1HUXA 1XWLA 1D8YA 3AMZA 2IRXA 2N3LA 3GG1A 4MN4C 8ICZA 4JKDA 4PKHA 4PR6A 3BYRA 1SWWA 1RA6A 1A5WA 4YN3B 1N5SA 4DN0A 4OJLA 1P7DA 4IG3B 4KHUA 1QS4A 4K4VA 3D6RA 4Y2UA 1RT2A 2ASMA 5BJRA 1VSFA 4IRCA 5F8HA 3RWUA 2NLXA 4RT2A 1TKDA 2E5HA 3MWBA 3LZIA 4P2HA 3CXCM 3RB0A 1DRGA 1Q82O 2E5SA 3DLEA 4LRDA 2O8FA 3BSAA 1NDLA 2CQGA 1OYDA 4KLIA 5AM5A 3RBEA 2ASJA 3C21A 3ILLA 3CCJS 3MGHA 3FZBA 3WQUA 2C3MA 3E0FA 5D0RA 3RB3A 1LWFA 3BGOP 2P9NB 1WG5A 3MMCB 4ED8A 2K4HA 2M5YA 2P51A 2I2YA 4RW7B 4L3QA 2KG0A 1YITS 3O9SA 4AQYK 1T3QA 4JP8A 4MLEA 2FJXA 3WK9A 3CGIA 4UAYA 3HHDA 3PIOQ 1RHKB 1N8RT 1H72C 4NLGA 3WEEB 4DV0J 1TFWA 1HKBA 4PA1A 5AZIB 4GFJA 3S9HA 3GJQB 5G0RB 4CI0B 3DXBA 4JI1J 2LPEA 1HQUA 1NO8A 1NB2A 1VQMS 1T9VA 5J2PB 1Q3VA 3IA0A 4IRDA 4CZHA 1HWKA 3TR8A 4O5FA 1SC6A 1UW9A 3QT5A 4JS4A 4FYYB 5LJ3Y 3A8IA 2NPFA 7ICJA 1MWZA 3HULA 1WAJA 2RRDA 2ACYA 4FKYA 1C1BA 3WKBA 3OYJA 4OKJA 5AQZA 1I51B 4DV4K 1J5EF 3PKMA 4ZJOA 1W97L 4OYZA 1Z3EB 3SLCA 1BG3A 1S3XA 2QTDA 3BJYA 3TAPA 2X7IA 5TKYA 2I5JB 4J90A 4IOBA 3A0BU 4WCEQ 2DYAA 4HUGA 3P45B 4BJQA 4C80A 3E01A 2RN2A 3KNAA 1QQCA 1F9EB 1WC5A 1UTAA 1U1NA 1Q5VA 1S0VA 1N34F 2DNQA 3MM9A 3BN4A 3HVRA 3J7A1 4TQSA 2AF6A 1LVHA 2QMWA 4DTXA 4Z94A 4HYKA 4IOXA 2FDRA 3WKAA 2RS2A 1ZQTA 1YGYA 1LAVA 2CNOB 2P6SA 2EG2A 4DR7J 4CF5A 5D46A 3PW5A 4CESA 3AXKA 2G5IB 2IOHA 1XQSC 1L5UA 2VG6A 4EHUA 2KJ8A 1KN5A 4YR3A 4ELTA 2VQEJ 2F4VK 1QUPA 3I55S 1VSLA 5J2JA 2FB0A 2HLUA 2BKOA 1M90O 1VQNS 2DTUA 5BOLA 4HHHA 1J2VA 3IDWA 2YJFA 4CT8A 5CR0A 3P4UB 1NBWA 3CCVN 4J2DA 3HSGA 2CQDA 2PIIA 4TKTA 3LDOA 2YNGA 4JI4F 5KOXA 3M6UA 2RF2A 4YEAA 2XSJB 3AOAA 4RX6A 4UY85 2UV8G 1QHTA 1UVKA 1S5JA 1NGEA 4DZ6A 4IXCA 2K06A 1MQ3A 2FJ6A 2Y9HA 2F1IA 1BUXA 4QPXA 3BO2A 4GV3A 1MROA 5J0RA 4BRDA 4FZXC 4RQ2A 4CK3A 5HJXA 3VN5A 3QPIA 3IBPA 3ISND 1JXBA 3KJVB 4JK9A 1YRTA 4JYAJ 3NMRA 2G08A 2CH6A 2O3DA 3V9SA 5SUHA 2FHJA 5J0PA 1HX1A 3UR0A 5J2NA 1RI7A 4K59A 1NU0A 4G9ZA 1BHLA 4E19A 2ADBA 5CXTA 4CBUA 3CJBA 3M8SA 2AQ0A 1WELA 2GHVC 1ZYQA 4WP3A 3WNHA 3GLJA 2BVZA 4ZVPB 4AH9A 5BR8F 2KOBA 3QJJA 3PYFA 4H0OA 1KFSA 2LQ8A 2R7VA 1H2UX 5KG0A 4B08A 5GAEI 2FBTA 9ICWA 2D0OA 3R6MA 1UAXA 5C2CA 4H4MB 2IIHA 4QYRA 1RTJB 2BCSA 3FRZA 1RXWA 4KGZB 4FJ5A 3HT0A 3HSTB 1QVFR 3T6BA 2L9NA 3CCUS 3VAIA 1N5YA 1EIYB 1Q86T 2FC8A 4BRQA 2K3IA 2ZEJA 3G2XA 2HHVA 3CCEN 3IBFB 3J7YI 4HL9A 4UB6U 1LV5A 1NNLA 2HVDA 3QT6A 4EBDA 4NLOA 2B6AA 2XCPA 4LRCA 3B6BA 2QFIA 4LF5J 3M1YA 3PYGA 4FJ8A 3V81A 1F5SA 2HFZA 4UB1A 1FESA 5AQHA 5KFEA 4BRKA 3MGJA 2EXUA 3V6DA 1UVJA 2H4WB 2R7TA 2OPPA 3NF8A 1KFTA 4KHPJ 2AXTU 2IGIA 1Y10A 3NG8A 1X5TA 2A1JB 1JMTA 3JQKA 1PK1A 2P5OA 4XPCA 3QB0A 2ZBIA 3EDQB 3MX2A 5A76A 1ZXOA 1HBUA 2GUIA 2OEJA 4P2SA 4M8LA 1BCMA 5AE3A 3CJQA 2KN4A 5BPLA 4WFYA 1FX2A 4Y2VA 2RHQB 3QIPB 3LO3A 4C1NI 1P6TA 1IBMK 2O8BB 5DBCA 3T6JA 2KMDA 4MYUA 3TA1A 4BRCA 3TUPA 4DQPA 3N79A 4LVSA 3DLGB 1M5PC 2PSZA 3Q8YA 2GGPB 1F9HA 3I5BA 1PUZA 1SXEA 1I5OB 1Z00A 2E5JA 1TYQB 1KQQA 3TAQA 1VDHA 3A0HU 4KLDA 3LDSA 1DAXA 4QZGA 4J9RA 4USUA 1TMMA 4I2PA 1ZA2B 2K4IA 2ZD1A 1OS5A 4ZVFA 1OVYA 3M6WA 1PSDA 1A5XA 2RQKA 1NH7A 4FW1A 1SS6A 4ETXA 4LBHA 2VGMA 2YNIB 3MECB 3RMAA 2W24A 4WJBA 1TUGB 4CLSA 4CQ1A 4DU7A 2FYXA 1RWWB 2KKPA 2HBYB 5E84A 3Q8VA 3OYLA 3PFOA 4MIBA 1OH5A 3ISCA 2ATQA 4H4KC 3W62A 4MQ3A 4OJHA 4FLXA 1ZQRA 1OYEA 3BKFA 3PRBA 1WG8A 1XMQJ 4FM2A 1OO0B 4E7KA 4F5QA 4ZMMA 5FLXO 5DM6L 4RUAA 2KV2A 1ZJNA 1ZQKA 3DU5A 1IG8A 3J80U 1J27A 1M1KO 2AV5A 4F3MA 2Y0BB 3RJMB 3OLBA 1BWFO 3KLIA 1ZQPA 3KKAC 4CD3A 4N8OA 4ERDA 1R0CB 3ZXWA 5AT1B 4X62K 2KVCA 1CVJA 2AGOA 2RE1A 4FNHA 2GVZA 2RLTA 4Y2RA 4FWPA 4B9SA 3H1VX 2D0PA 4BRLA 3THXB 4QAGA 2CJ9A 5ETPA 3MTJA 4JRPA 1XU4A 2CQIA 3GFZA 3W8PA 3KBBA 2P66A 4NLYA 2LXFA 6FD1A 4I9QA 2G1HA 4CTAA 2IVNA 5AQWA 2BZ2A 5DG9A 1RACB 3RTVA 4K43A 4ECXA 2E66A 2V4QA 3NVVA 1BLUA 3SCLE 2RHSB 2BYCA 2K8AA 4QNLA 3DGPB 4KH6A 3I32A 1YK9A 1ASVA 2MU2A 1U1MA 1EJ7L 1NZAA 1WC1A 4P9SA 2MGZB 3NMUA 2KJVA 3NCQA 3R3TA 3J7YU 4DXLA 3DNCA 2ZJQQ 4UAZA 2H3QA 2A1RA 3A8KA 3I9ZA 1NM2A 3WDOA 3C2KA 4BC5A 4BC9A 4BQLA 4Y00A 1AUDA 1RWKB 5GIOA 3AAQA 1ITPA 4CZMA 4JHDA 1SH0A 3HHNB 5AKGA 2D3ZA 3MEEB 5E3PA 1D8LA 3VQEA 3RBDA 5ETKA 5DETA 2L41A 3DLBA 1PILA 2DHHA 3MZIA 4A8SA 3V9UA 3ZZRA 3MM7B 2K7JA 1BQMB 1H98A 1UWBA 1AT1B 3VAFA 2CN1A 5KTQA 5J2QA 2W11A 3VEOA 1L3UA 2XMAA 3QEVA 4EZ6A 3R97A 4KGVB 5I3UA 3QYPA 2LBOA 2CJYB 1PGZA 3QAEA 2HGMA 3HKZF 1S1WB 7ICGA 2BKNA 4RQ4A 1JXVA 1AYEA 2DB1A 1S72S 2DH7A 3BGLA 1J5EK 3T5HA 4UT4A 2XVTA 3D1OA 4CZFA 1UQVA 4GNIA 3CD6N 2Q2RA 1GLDG 4Q7AA 2EW9A 3EYZA 2DR6A 2VH7A 2YWWA 3HT3A 2AJFE 3P49B 4QJFB 4RZRA 2YWGA 1FKAF 3PCOB 3E9OA 4EFHA 4NLNA 4R79A 4CRXA 2Q1NA 3QERA 5JUMA 1W26A 3TADA 3AUOA 3BBCA 3D28A 1N34K 4DSEA 2CRLA 3IP0A 1BPYA 3FSYA 3CCMN 2V2QA 4XH5A 1U8SA 2YNHA 1BA0A 4YDXA 3F0NA 1N32F 3J80Y 1X6JA 4QR1A 3UKUA 1N54B 4NOHA 2CYYA 1YVFA 4JI0J 2MQLA 3AL0B 2ZJRL 1NHUA 3M5RA 4I2QB 1TKZA 1P9QC 3C16A 1UP1A 4RNNA 4QZBA 2UXCJ 1VQ9N 4TUPA 3OW2M 1XIQA 4P0QA 2OZMA 4JB3A 4ATNA 2A3VA 4NLQA 1S1UA 2L08A 4RQ3A 2K8CB 2HVZA 4K4UA 5J0YA 4DL5A 5T41A 4HTIA 3VGMA 2BABA 3BSNA 3MR3A 2WF8A 2KHVA 1HD1A 4F4WA 4PZVA 1UEKA 3M1VA 1VS3A 5B0BA 2ESEA 3RJJA 4DR3F 4JI4K 3S8SA 4G6VB 3N5FA 1MA7A 4ZVRB 4L74A 2ZTEA 1VC6A 3OVSA 4AQYJ 2JC1A 7ICEA 4IUFA 4OYOA 3MWPA 2MKYA 2MQNA 4EEYA 2NXCA 1ZQCA 4MMOA 3AU2A 3N6LA 1P1LA 3M9OB 3SCKE 1D9FA 3GFHA 1RB0A 5GIPA 1RAIB 2KFZA 4ECYA 2XLKA 3BR8A 1HBMB 4TU7A 3GJSB 2XB2D 3MAQA 2V7YA 4ETZA 2BE2A 2JWNA 3JXOA 1RTDB 4P4PA 1H2TZ 3DLEB 3ZETA 3G8SA 5KG3A 4ZKAA 2B4OA 2XS5A 1EWRA 4PZNA 2ZKUA 3HVWA 4KREA 1M5KC 5H1SV 4F04B 2E8AA 4QWEA 5HR6A 3F2BA 1QAJA 3HZEA 5BPCA 3ITHB 5J2CA 3M1FA 3G9CA 1JWWA 3QMQA 1WG4A 4KPYA 2ZIXB 5LJWA 3R3LA 3K0SA 2VG7A 4DV4J 4OI4A 4OKKA 4B9LA 9ICSA 3K57A 1IXRA 2HSZA 4CGHA 2JV3A 1KQKA 1XNQF 1JNZB 2K4PA 2CPRA 3PX0A 2G13A 2J0SD 3FBFA 3M32A 1U0HB 3AJ1A 3SEOA 3VQ4A 2F76X 2MKJA 4ED7A 4FJXA 4D3GA 3OR1B 2PD1A 1TGOA 3TU5A 2DXEA 2ATCB 2HYIB 1MNEA 1T9WA 2W42A 3MEDA 4HVJA 2HVEA 4FLZA 1KR4A 3A12A 3LP0B 2PMWA 1S6QA 4U9RA 3OHRA 1IBKF 5KFCA 4IQVA 4LH4A 4NYNA 7ICNA 1ASUA 2AHOB 2E2PA 5ALZA 3V6JA 4IC9A 4IFEA 1GX6A 1S9EA 5C2GA 3ZEUB 2QL5B 3J81Y 3CTRA 3AVMA 4ECVA 4WE1A 3AA2A 2H48B 2G4BA 4CEOA 4B3OB 1NH8A 1RA7A 4OJ3A 2KI2A 3S7RA 3RVCA 1GFWB 3MR7A 4WXOA 4OV6A 2BPGA 4NZ0A 3W7BA 1X1PA 3BF1A 3LDPA 4DUZF 4NASA 1ZQEA 4FZVA 8ICIA 1YBAA 1NK4A 2QI2A 3K5NA 1VQOS 2V8PA 1TVAA 5HOOA 5ALHA 2OH2A 3UE5A 1QVGM 3BH6B 5ALRA 3IRUA 2QA2A 3EGZA 3KKFA 2BJ9A 1EQ0A 1UWAA 2Y0SD 4CZCA 2GVDB 3HHLC 2KVSA 3E1YA 2I1QA 4P52A 4CZEA 1Q8KA 1UVNA 4M1KA 3W9IA 3SQOP 2ZQBA 4I2BA 4C0HA 2OD6A 4BDYA 3F53A 2EANA 4XH1A 3SAHA 3EWAA 3NVZA 1ZQIA 1JXLA 2F96A 2QV6A 1WBBA 2QT7A 2VG6B 2B9XA 2GW8A 2XWYA 3OFFA 4ES2A 3W3SA 1ZAVA 4OLPA 5DDOC 3EPIA 4OLAA 2C22A 1Q9XA 2EWSA 4Z37A 1O03A 1FFWB 4RQ1A 3G8QA 2NRZA 3DRPA 4X4NA 2VJ4A 4CF4A 3J7AN 2O8CA 3DOKA 2PI5A 4RG8A 4KB0A 3R7BB 2YY3A 3DC2A 4KI6A 2LEBA 1ZQZA 2ZH8A 2V51B 2Y9UA 3RUBL 4FK2A 2HHHF 5GADI 3H1QA 3P8BB 3CP8A 4ICLB 5ETRA 4YMEA 3UM9A 5CABA 1FKOA 1H74A 5AQMA 4K4YA 3V6KA 1RHRB 3D7EO 5KFXA 2OSQA 2YHAA 4FZNA 1JLCB 2W7PA 1DBDA 4G1IA 3KLGB 2RVJA 5B5EU 1EAYC 2MHNA 1SIWB 1BA1A 1JX4A 4PHEA 1YVNA 2CJAA 2IDEA 5LT5A 4HWIA 5IT4A 3W9JA 1W2BM 3V72A 2D69A 3CMQA 3Q7CA 4RU9A 3KWGA 5J2NB 1HI8A 4QR2A 3D1QA 3QU4A 1TTHB 4B02A 1LCUA 1NOMA 4XRHA 3TNVA 4JKCA 4Y0WA 5FPDA 2BZFA 2XMTA 4AL6A 3ZZUA 1L8OA 1YT3A 2FDNA 3SMVA 4MEYA 4JWNA 4B9QA 4F4AA 1WBDA 3C6TB 5KL1B 2XZDB 4IOAL 2HWHA 1OIAA 1RAAB 1QQNA 3AARA 3AVJA 5B0EA 4LJXA 1XSPA 4X4PA 3A5OC 5ALGA 1LFWA 2YTUA 1EQYA 3ZX2A 3GSIA 4WXWA 3JS9A 5FD1A 1KVJA 3TX0A 1FFGB 3TANA 5CE3A 2EHGA 3P5JA 3RAQA 3IXQA 2Z4PA 3AH6A 2MSNA 4Y0FA 4YQWA 4USKA 1N5YB 3QSIA 4CJ4A 1GEHA 2UVVA 2K2PA 1B0VA 1IBMJ 2XYGB 3M8PA 1Q3UA 1KAYA 3OL7A 5BRFA 3ID6A 1BGXT 2YTCA 2DNKA 5CQGA 3CJAA 4CLWA 2HVHA 4ZLNA 2H51B 2EC0A 4YXMA 1S4FA 3IWXA 3PW0A 1LEOA 4YN4A 4NLSA 3VV2B 2ZH3A 2HOQA 2VA3A 2QG9B 1UFLA 3B8HA 2OPPB 3CCMS 1VQSA 1BE4A 2KE7A 3AD9C 4ZCIA 2ZE2B 2QE5A 1TK5A 5BREA 5E79U 2KD1A 2JWKA 3H20A 1RQ0A 1HBUB 1UPMB 4DSLA 4P73A 1H6KX 3AODA 2YKNA 4HDHA 3A2FA 1T3NA 3AA8A 2XHCA 1IKWA 3UVJB 4BRPA 3CPWM 4ZHRA 2QKQA 4XA5A 2HMXA 3P38A 4IFYA 3DXKA 2XS7A 3B54A 2DR5A 4DS5A 5J1NA 4CRJA 8ICGA 3NBPB 3PW4A 3CJKB 2ZOMA 1K1SA 3PRDA 4K0KF 5ALPA 3NRZA 4J9PA 3FNNA 5DZ6A 5IS2A 3CULA 5KFAA 2PC6A 3ADAC 4I6AA 3ZCMA 3WXJA 3U9DA 1KL9A 2A40A 1S9GA 4EHTA 3DFEA 3P96A 3J7Z5 3G71N 2EX3A 4KX5A 2MKHA 1DOQA 1N32K 3UD3P 2IA6A 1LWEB 2M88A 5M2UA 1P27B 4WFNL 3DHWC 1WJ9A 3FKBA 2HOEA 2ZWPA 3AO5A 2BGGA 5GADU 2H3FA 3BS7A 3AO2A 1HLWA 4E3SA 1MW7A 4OHVA 5AHXA 5LM7E 1MC8A 5EVZA 3OTBA 2IFXA 4PEOA 1KC8T 3EUNA 3LM9A 3CM6A 3VQ9A 2BPFA 4IG0A 1NSAA 5KFSA 3HVTA 3C66A 4DFPA 3ID8A 4U7UD 2AP1A 1SXDA 4BRHA 4CLYA 4XAKA 1HNZF 4JI7F 3D6TB 4O5KA 1GMVA 2YQEA 1KLMA 2HRYA 4DR3K 3LVWA 4PGQA 8ICBA 1IV8A 3CCSS 3I0SB 4ECZA 2OMLA 4WK3A 1QZ5A 1IBLJ 3SJJA 3I5CA 2VUGA 3QFWA 2V2KA 4TYAA 2NRXA 4QJVA 4H8KA 4DSKA 2VFUA 4ALZA 5EHHA 1K1QA 4DU1A 4CECA 3U4LA 8RUCA 3R5BA 2J6UA 3JPOA 4OPAA 3UW1A 5AKYA 4H0VB 4C3LA 3G25A 1DLOB 3DM2A 4YOUA 2ZGYA 5AZJB 3CJTA 1TQLA 3ATUA 1JRPA 2NSBA 3NVMA 1N52B 1HKCA 5IFMA 4OJ5A 1MWMA 3KG0A 1S12A 1BVSA 2F9DA 1REGX 4PL8A 3RMBA 2F5GA 3BEGB 1X40A 4CLLA 3JTOA 3DKDA 3GMGA 3EKUA 2VQFF 3GU3A 1RTHB 2FBXA 2GHPA 4DS4A 2KG1A 3PR5B 3U1NA 3LL3A 3FQLA 3M2RA 4AHVA 4MO4A 1LOUA 1SVDA 1QQMA 3CCWA 1VK3A 1YTUA 1N5XA 3NWRA 4WU3A 3G87A 3OR2A 2PFNA 1XNQK 3EVWA 1N6QB 1FDDA 3TEGA 4A8KA 1G2EA 4RQMA 1GLLO 2ZOFA 4Y2SA 8ICCA 3OL6A 3RGIA 3QETA 3VZHA 2E88A 1RCXB 4AT1B 2G8FA 1TFYA 2B9WA 3V5RA 3O44A 3VQTA 1FJCA 4OZ2A 4K41A 3C14B 4FJ9A 1BCOA 2YHWA 3RG6A 1VC0A 3PYDA 4AXJA 1N34J 4M42A 1HLUA 1VMBA 4WQ4C 1MU2B 1IBKK 4X4OA 4CM2A 3A4TA 1NM1A 4W90B 1WI8A 1VHIA 1Q8IA 4KT0C 1QVGR 1S7IA 1VC5A 1OY9A 3VZIA 4P7TA 2Q3SA 1JJCB 4LFAF 1JI7A 3ZDBA 2XNRA 1RT4A 1LAWA 1P90A 1SZ2A 1ZZNA 2F8MA 3V6HA 3PNIA 2QYGA 3THYB 3FEYB 2J76E 4PY5A 2FIUA 2RPIA 4QCLA 4UB8U 9ICRA 2GAHC 3A8JA 4BDZA 2FD2A 4Q0BA 1LKYA 2YMLA 5DQHA 4DUZK 4NY8A 4FOEA 2BQ3A 4HDGA 1QUVA 7ICKA 2UXBF 4U7CA 1NDPA 1BPZA 2Z1GA 3KOOA 1Y97A 3SQGB 3Q2SC 3O1BA 3TI0A 1FKPB 2A2DA 2M52A 3KLHA 2B5JB 4F3TA 3O3HA 4US9A 5HSPA 5C2FA 4NXNF 3JAMU 3OTOF 2CPIA 1GQEA 4RW4B 5J29A 1SJ1A 2QWOA 2W7OA 1FWLA 3CD7A 8ICWA 2E5LK 2HSEB 4PCQA 4B1YB 1EKEA 4OYPA 3ZTPA 2LP4A 1SAZA 4GKKF 5HLFB 4N77A 4JK8A 3TZXA 2FLLA 5A0YA 2QA1A 3Q8SB 3CJ4A 1CZAN 3CC4S 4ID8A 1TL3A 2IBKA 2NZCA 4CFAA 1DK3A 5ETLA 1X2IA 2BXJA 2FUG9 4M5GA 4MJKA 5I42B 4LF9F 9ICAA 4YB6A 5IC6B 1KS2A 3W5XA 4M9GA 1YBTA 3G4SN 1CI4A 2EG1A 2GFFA 4W92B 1HNWF 1CJVA 2W8LA 3VCDA 3AOBA 4ZP7A 3W9HA 4K4GA 1JLQB 2B21A 4F4XA 5DS7A 2XMVA 4WYWA 4CBXA 2HHHK 1K8KA 4OMFG 2O67A 4I6YA 4CBWA 2NO5A 1FO4A 4A48A 3D2QA 5C10A 1HBOA 4DX5A 1KVKA 2KK0A 4WIQA 1LW0B 2MZTA 4QW9A 3WIVA 2B3TB 4P2XA 3MPVA 4F9OA 5DB8A 2FJAB 5MLCQ 3UQSA 2AJ2A 1ZS6A 3GCXP 3HYFA 4DU4A 4DX7A 1HI0P 2BJ3A 3CETA 2X3GA 3C6UB 2R7RA 3SBGA 2XGQA 2BE2B 3R9PA 1VK0A 4IFVA 1TUWA 4YDUC 4R8UA 2DH8A 2HWIA 2V6AA 1KQSM 3VHQA 1RLDA 3BH7B 4FP9A 1PVQA 2V63A 2ISPA 5ALXA 5BYRA 4M5IA 5ALTA 4F92B 1FCAA 3WXMB 2HQ3A 3CM5A 4MF2A 1IV0A 1O1WA 3DOMB 5HMWA 1RYSA 1U1OA 3CIMA 3TZZA 2NREA 5B0GA 3WX8A 3VQ6A 3CC7S 1TVRA 3DOLA 2Q1LA 1VBKA 4BC2A 2WONA 1ZM4A 3GFXA 4NL5A 2OTLS 2H5EA 3RRGA 3VAJA 2XMKA 3O9TA 4IO8A 3N0VA 3WNGA 1S0MA 1NK7A 2X1AA 3ZSWA 1CBKA 1XR5A 2W2MP 2MJNA 3THTA 3L7OA 3RYLA 3TOQA 3KHHA 2RQMA 2YMMA 2AJ4A 3OFHA 4KLJA 3PW2A 4CEFA 2GJFA 3SR6A 4V19J 2CPDA 5ETOA 4LMZA 4LRBA 5KGWA 3PNCA 2AJ0A 5AQOA 3IBWA 3HHLD 4LY7A 1CZ9A 2BOPA 3MDQA 5D49A 3G71S 3JAMY 1VOMA 3VERA 5A8KA 2YKOA 2R7OA 4DV1F 3LGNA 4DX6A 3I5AA 2QXFA 1NJWA 1RU1A 2B8QA 2KJ5A 3G6YA 4JI8F 4GMKA 3WHIA 3JXUA 3GONA 5ADZA 3MAAB 1U1PA 3HZ6A 3ZO7A 2P9SA 3CT9A 3L2WA 5IC4B 2OELA 3O0FA 5KGXA 5F3ZA 2ETJA 2ZJPL 4I1TA 3MM5B 2PKEA 4ANDA 2DHXA 3TWZA 2HNZA 5DBAA 2VWJA 4RQ8A 3GILA 4B3MF 4K2JA 2Z0GA 4Z0UA 3F73A 4MHVA 3FE1A 3CDWA 4KYZA 2I8EA 3T5KA 4FWMA 1WUDA 3BV8A 5GAHP 4NMXA 5J1EB 2E2OA 2XHWA 1M90T 3OXGA 1D09B 1VHXA 4BRAA 4ZOSA 2GV1A 2ZBRA 3RSEB 3OXLA 1ATNA 2F9JA 1KEKA 1P8GA 1Z2ZA 3MD3A 1I94F 2XI2A 2IHR1 3RMDA 3DRPB 4LIRA 4CLPA 1TAMA 6AT1B 5F1XA 2OKQA 3C6HA 8ICTA 1OQ3A 4FWKA 1NJXA 1E6YA 1TV9A 1J5OA 1NNEA 1EETA 3SCIE 4FZMA 4I2JA 1BHNA 1HNZK 4JI7K 4KN7A 4UQTA 2G07A 1ZJMA 4OYMA 4UQGA 3I0RB 1Y5LB 1HPZB 2BMBA 5JVHL 1A7GE 2LEAA 3FZMA 3HHKA 1N5TA 2W55A 1W0HA 1UL3A 2IJNA 3F5AA 5B08A 3ZSZA 3MHYA 9ICMA 1SKSA 4FVMA 2YMPA 3MEGB 2FPKA 2YHXA 4TLRA 1T3OA 2ZC3A 2DNPA 4DTPA 1IVZA 2HFOA 2FSNA 3K4GA 3CMAN 4NM2A 1YJWS 4NLDA 5AQVA 1PAEX 2EBGA 5KFOA 1ZQHA 3QBCA 1KAXA 1F5AA 1S8OA 2HQFA 4YHHF 5G5GA 3H6EA 4O44B 3MUMP 4K4TA 3JYTA 1OMSA 1VBXA 4P6QA 2E8OA 1HARA 1T9TA 3U1LA 4Z4EA 2VQFK 2VBZA 2WHEA 3C29A 4H5NA 4DFDA 4Z6CA 3LP1A 3UMCA 3H98A 4OYXA 9ICIA 1JK9B 4N41A 5FDLA 3AVCA 3AVLA 3CFOA 3O9UA 4CLUA 2W43A 2R7UA 5MAOA 2FC0A 1DQ9A 2F1JA 5AR0A 3FR0A 3HI0A 1N33F 3NGYA 4FNIA 5HP1B 3HFKA 5E7OB 4X64F 2CXYA 1A9NB 4BS2A 1RT7A 3CIZA 2A19A 3MEKA 1OQ6A 2W9CB 1ZBTA 1U48A 5A8WA 2ILYA 2O8EA 1T9XA 2FE9A 3SFUA 4X4QA 4J9VA 5EE0A 1WUUA 1BC6A 4WFBL 2BM1A 4BG8A 3QNOA 2C28A 2GMJA 3Q23A 2ZH9A 3U7JA 1ILYA 4G65A 2JVRA 2CJKA 4DO9A 3PX4A 5DQGA 3GIIA 3MDAA 1D8BA 4OYIA 4IDKA 3NF9A 1KONA 4N76A 5SZTA 1MG7A 4KLSA 3TUZC 1HIWA 4X4UA 1N32J 2CGLA 4FLWA 2P9UB 3AA5X 3OYGA 3GIKA 4LFAK 3AFGA 3C1ZA 4NZ6A 1EXQA 3SAFA 5FIIA 4A8FA 4JMUA 1YHQN 3AQOA 1LK5A 2DXDA 4ZVOB 3OTQA 3Q8QB 2CNLB 2J6SA 3T1HF 3NNAA 5ETNA 2Y1JA 4FPRA 4IFYB 3BEXA 4F91B 1A77A 4H5TA 2UXBK 4DV2K 5DM6Q 1DTTA 4DV3F 1FRKA 3IG1B 2ZTDA 2L9WA 4CEEA 2HK2A 2H3VA 4UBBA 2QARB 2VFSA 4DR3J 4JN4A 4AYBD 5EX5A 1S97A 1FNOA 3OTOK 4G9BA 1RE1B 2I6XA 1VQ4N 1EKRA 1JL1A 2QSFA 3F44A 1RDWX 1OSDA 1SGGA 5AKHA 1X4FA 3K17A 3L3UA 3SSQA 4B9TA 4GKKK 3M9NB 3KIOA 5IV3A 5C2DA 2OPRB 1B7YB 1S1XA 3G96A 4UW2A 2LI6A 2WVEA 3SMSA 2M4MA 1QH9A 1S5ZA 1QZ6A 3VMFB 1LB2B 4LF9K 4EELA 2Q79A 2YY6A 3VTHA 4IG0B 1F2HA 3VEZA 3HVTB 3LA0A 2HFNA 3RF9A 4FO6A 1HNWK 2V50A 3HMJG 3RZAA 3UI3A 5F2RA 2AEMA 1XK8A 2J7KA 4PQAA 2HURA 1SPBP 3SSRA 2WB1D 2ZH7A 3KHGA 4G1QB 5D8HB 2JH3A 3HOTA 1N36J 1R0AA 3C2LA 4HR2A 1WF2A 1XNQJ 4C7QA 5HRNA 2K7KA 2OYQA 3S1TA 4C11B 2YB4A 1SV5A 3BGFA 4CJLA 1KQSR 1XO0A 3QUQA 1FFSB 3SJHA 3QGGA 2F8SA 5AM0A 4XK8C 3U26A 2ROPA 5HMLA 1ZQLA 4XIUA 1KHVA 1SV0A 4CGDA 4HCBA 3B4MA 3SZ2A 1VK8A 3G6EN 3SPYA 4P2MA 3WK8A 1R8PA 4M5KA 1OY6A 4J8FA 1BD6A 2NXJA 1L3VA 3PY8A 5K14A 3CJ0A 4GVMA 3V7LA 1NZPA 2H4YB 4ICAA 1IBKJ 3UNYA 2G0IA 4KBOA 4A59A 2W4CA 3SCXA 7FD1A 1X31C 3H8WA 2RKIB 2BW7A 3LPYA 2F77X 3PW7A 4Z4HA 2AH5A 1YJNS 3BGRA 5A6PA 2JEJA 4BVPA 3HJVA 4TURA 1LWCA 2D9OA 4CYUA 4PYAA 4QQBA 1U26A 2CNNB 1X7VA 1DJ0A 4UZBA 1RDDA 4YB5A 1YJRA 3Q8MA 3OD2A 4CO0A 4A8YA 3NS1A 5EE9A 4DQRA 1CULA 1ZD2P 5KFZA 5C24A 4DUZJ 1RT1B 1T03A 5DJBA 3PSPA 1S22A 4HUEA 3RB4A 1FXRA 3UPFA 1HMVB 3W2VB 2PFOA 2EFQA 4IOCL 2ZZNA 1BPDA 5CWRA 2UUTA 4YOVA 4C7YA 2RSQA 4YY3K 1FDNA 4Q45A 2OM6A 3IP4B 2PXIA 2E5LJ 2HAFA 3QINA 1VQ8S 3LGHA 3VVTA 5IT0A 5KFTA 5M1PA 1NMEB 3ZD9A 3GJRB 1F1BB 2CJBA 2IC3A 2ZJRQ 4ILLA 4DV1K 4RNMA 1SZHA 1RT4B 4K8ZA 2R2RA 4B1ZA 1R8CA 1X0PA 3V4IB 3NH1A 4PWWA 4JI8K 1G7CB 1SXLA 2YXLA 2KJ9A 3CI5A 2YKPA 1JJ4A 3KFWX 2ITGA 3M9MB 4IRKA 1NZBA 3CB4A 4KHRA 4W98A 4NL9C 1SKWA 1SH3A 5ALIA 3KHRA 3ZDCA 4JI5K 2ZIWA 3TTCA 2NNWA 1CLQA 3LUYA 6FDRA 4ZVTB 5LJVA 3AVHA 5J2AA 4NLPA 4Z4CA 1S6PB 4LFBK 3PG9A 2HHHJ 2VOPA 2JMGA 2OP5A 1BL3A 1ZQWA 1VSKA 1Y64A 4B3MK 1TL5A 3H59A 1BPEA 2CPEA 4DG1B 2R3VA 1VRUB 4LQ3A 4EZ9A 2LMIA 3NAHA 4AHUA 2LMRA 5CZVA 1RJJA 2F9TA 2OCEA 3LF0A 3OV7A 3THWA 3H7HB 2MA1A 1OSCA 2LKZA 5F9NA 2Z8QA 3BQ2A 3WT0A 4DL4A 5GINA 2QB1A 1VI7A 4J9QA 4ZJQA 5M1NA 4QIWF 1HNIA 2QJ3A 1RQLA 3CJCA 3WKDA 1I94K 4J9OA 1TL3B 4C23A 4C8OA 1TL7B 2V2ZA 2A5XA 2VONA 1O51A 2EFGA 1Q7YO 4JI6J 4F8RA 4JV5F 4J91A 3VGSA 3O1LA 3VQSA 1L3TA 4Y2QA 5AQTA 3NS5A 4RNHA 4JEPA 3JB9k 3MMBA 1CJUA 4DUTA 2QMXA 2IM2A 3IS9A 3MM6B 2OIHA 2PEHA 4FM0A 1VQKN 1RILA 4A8MP 3JPRA 4OGEA 3KLFB 2BW2A 4XPEA 2D74B 4CZKA 1U4BA 4KLMA 2XM3A 4Z6DA 1FEHA 3K0JA 3SQ0A 1IR2A 4BC4A 4BX9C 4OLBA 3ASMA 3PIPL 3WC2A 2O5DA 3SMZA 4I2GA 4ED4A 5CYQB 3ZT3A 3QU7A 3MCSA 4ED1A 4OJ1A 2JDJA 3O6WA 1XR6A 2ZUBA 4YHHK 3MMAA 4KGXB 1SWVA 3DLKB 5FLXU 1RAEB 2AJ1A 1X4AA 3KYLA 4JI2J 2K3KA 3BREA 1V5IB 3HP9A 1SUQB 1BNOA 3M6KA 3BS5B 2YI1A 2MQMA 5KG7A 2F63A 3ZSQA 3ISDA 2ASDA 3KK2B 3NUQA 4BR4A 5KI6A 4RQ5A 1N33K 1JKHA 1UFWA 2LQJA 2G8IA 3D3CJ 3JTNA 3VGKA 4IR9A 2Y1LB 1G4CA 4W5NA 4CF9A 4RKUC 5KPZA 1RKJA 3MF5A 1BI4A 4O55A 2OTJS 2BJEA 5J2MA 5K8MA 5B0CA 7ICRA 2HHQA 3BO3A 1UOCA 4PXBA 2AKWB 2C3UA 1X5OA 4NI2B 4ZPWR 3IKMA 3TZWA 1AA1B 4C3KA 5CA7A 8ICOA 3D2EA 4Z4FA 2OLWA 5F8GA 1F0XA 1K6YA 2DGOA 5AQPA 2P9PB 3W2WB 2VB6A 1WSIA 4EX7A 4OZ3A 2BPCA 1HR0J 3CFPA 3LPEA 4IG3A 4L73A 5A8KB 1QE1A 2LEPA 2OO4A 1X9XA 1FRIA 4TU9A 5B66U 2WOMB 3VAHA 4KPCA 3ZFVA 1N5WA 3D54A 1ZETA 2F7VA 1VGYA 2MKIA 3C5GA 3MABA 3MDFA 2V68A 2E1AA 3NS7B 1TKXB 1S0NA 3I1YA 3F9KA 4E2FB 4GRSA 5BYQA 1Y7PA 4EO6A 5IT9U 2IBOA 2P6RA 3AA3A 3T1HK 1QY7A 2DY1A 3P5TL 1S1VB 4FOIA 4PGYA 3D68A 2EFVA 4B3SJ 2P9NA 4USAA 1IKXB 4WFAL 3MMCA 1HNZJ 3ULDA 4DV3K 3QX7A 4O3MA 4JI7J 4DR5F 4QZEA 3GV8B 5LSRA 1WNSA 2QWQA 4W5OA 4CJUA 4RW7A 2G0CA 2KM8C 2GUPA 1JL2A 3K2YA 1B64A 2KIWA 3I87A 2HS4A 3PX6A 4CDIA 2Z7JA 3DWLA 1ZBSA 4CFBA 3AOCA 2RU9A 1ZPVA 5DRKA 1NSPA 4PL7A 3WEEA 1UMJA 1ATRA 5AZIA 2EKYA 5G0RA 3OL9A 5ALEA 1YLXA 2CQHA 2J9EA 5D77A 1FE0A 5HMXA 1HJRA 2Q0ZX 3UXOA 4C4WA 3UFCX 5J2PA 1NKBA 3B82A 2D8CA 8AT1B 4CJEA 2KG5A 4OI3A 3UB5A 3K89A 1SQEA 2JNJA 3CCQS 1IR1A 3L6QA 1KVAA 1F21A 2XBPA 2H3IA 3F41A 4IOAQ 2VQFJ 2P9LB 1BQNB 4U8VA 4TQRA 2NO4A 4UARA 4BGBA 8ICFA 3DRSB 2AA4A 1OWXA 4CHNA 4DQ8A 2RE2A 3OQ2A 3SI6A 4CZGA 1RDFA 4IQTA 3SCJE 4WPAA 2JHEA 5FLXY 2I5JA 1V4TA 1JUDA 2YH0A 1HNVB 4O4RA 2KM8B 4WIIA 2CQPA 3AVGA 3TRGA 1OY8A 4JK7A 4Y34A 5JU5A 2A41A 8ICJA 4QIGA 3CMEN 3BUZB 3SSSA 3GB0A 2ZXHA 4J9LA 3AHPA 4CJKA 1NJZA 4Y6IA 4EU0A 2QWMA 1RGIA 1PIEA 1RWVB 2GAGC 2H65B 4ZPBA 5KT4A 2YKAA 5AKJA 3CCLS 4S0MA 5DG7A 4O3QA 2D4WA 2XMMA 5GAHI 4URGA 1OW5A 1RU2A 3ZTQA 4LFAJ 3K8WA 4IKFA 4KLUA 3GDXA 1U0SA 2LKYA 4P0PB 3J7YP 2D3UA 4CIEA 3ZX3A 1ZRNA 3DDIA 1XSLA 1KNZA 1FD8A 4Q44A 3OFEA 1VRTB 3SD7A 1UJ4A 4WK1A 1GOBA 5CYMB 2DGZA 5DKWA 1VQ7S 1LK7A 5AM3A 4DWIA 2UXBJ 3CHWA 1B7FA 4DV2J 3DLRA 2XSJA 2PFPA 3OUYB 3TUIC 4HHUA 3C19A 4HLBA 5L9XA 5J2DA 8ATCB 4OX8A 5IT9Y 3PDNA 4KLTA 3CIPA 4W4MA 3IWNC 4KKOB 2W25A 4CGGA 2WBNA 1ZOLA 4DL3A 3OTOJ 1QLNA 4YOWA 3HVAA 2GCFA 2PFUA 3KJVA 1ZQ1C 5ALQA 4OKEA 1Z4NA 1H73A 1T7PA 4QU7A 4DOCA 2J9DE 2EFNA 4CJQA 4WFNQ 1CS4B 3W1YC 4ZPTR 1Z05A 1RT3B 3IFEA 3B0YA 1D9DA 2JLGA 5ALLA 5JLHA 2ZOGA 4HI2A 5HVHA 4YUDA 4LR9A 2RRAA 5AKKA 8ICQA 2IAJB 4PG8A 3T69A 3QUTA 5EN1A 3KWIA 3GWCA 1HEKA 1FFUA 1L7PA 3GG0A 3ZZZA 4HTLA 3T3FA 4P74A 1NDCA 4JKFA 3Q8KA 3VTIA 5L1JA 1K73T 5M1OA 3FEZA 1YBUA 2L9DA 1WHYA 2ROEA 5JS2A 4I2EA 3T79A 4LIWA 4H4MA 2DGQA 2A0FB 1O8BA 1RTJA 1WSGA 3PUFA 4KH1B 4LBPA 1T11A 3G6XA 3ISNC 3OYBA 2GO7A 4NX9A 2A1SA 2BKEA 4LSNB 4YOEA 2XY7A 4UF4A 2HB5A 2F7TA 2DWQA 1BIZA 2E9RX 3TPQA 1H7XA 5IIKA 5EDWA 3DV9A 2G0AA 1SC4B 4URQU 4LF1A 1XO1A 2HI0A 2CDQA 4GVBB 1WTBA 1HWUA 5IIIA 5KT5A 3ZTRA 4JB8B 2DK2A 4F0HA 2XZTB 4CEBA 4JV2A 1YG0A 2B43A 2BDPA 4LSZB 2H3GX 4C8KA 4I2DA 1E6VB 1R6YA 4QW8A 2JC0A 3L09A 2A3JA 2B4UA 3DAWA 4BBYA 1D4XA 4JV5K 4JKGA 2G9OA 4LFCJ 4OQJA 3DN9A 3TTFA 4JAXA 2HIQA 4M5LA 3D0PA 5T7BA 2QWRA 2BCUA 1ZQDA 3GYGA 1FF2A 5GMEA 2PYLA 3OS0A 3QIPA 3LZJA 4OO1J 2WSFC 4LUBA 5DDPC 3GL1A 4KLOA 1RKIA 1SJ3P 3TR5A 5EOYA 7ICIA 2HIYA 2NXNA 3CUNA 1V3SA 5T7LB 3DLGA 3JSRA 2GGPA 5GMDA 4AFFA 5C12A 4IH6A 5J2BA 4JNEA 2N4DA 5GAHU 1TYQA 3RJIA 1KDNA 3RJKA 5DDQC 5IM0B 9ICVA 3W0LA 5HVGA 3V7KA 1FTCA 4K4ZA 1R3NA 1F5CA 4M0AA 2XY8A 4LD0A 4YY3J 1PBUA 3DU6A 2Z2LA 4GXIA 2YNIA 3CJRA 3MECA 1AFJA 3C3LA 4ZJLA 2UUAF 3OBYA 4G1PA 1ROFA 4LF7F 1XC3A 3KMSA 2PMHA 1YZ6A 4JRQA 4KMUA 3LQVA 1DHMA 2MMYA 3HX9A 1S48A 3R5DA 4HH1A 1CJKB 4DV1J 3TQ1A 4JKBA 2M2BA 3IAM9 2VU5A 2PGCA 5BPMA 3CEDA 4X5VA 4GKJJ 3ILOA 3ET6B 3LWLA 3TACB 3O9RA 1T02A 3AVFA 2GHWA 2DBBA 2LU1A 4JI5J 4MK9A 2E1YA 1EX8A 2KT2A 4GV6A