2HHTA

C:o6-methyl-guanine pair in the polymerase-2 basepair position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhtA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhtA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhtA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhtA01
3AVCA 8ICMA 4RUAA 4IRKA 3HVRA 5BPCA 1WSJA 1NJXA 4ICLA 1IXRA 2BCVA 2PY5A 4PHDA 4G1QA 3OYHA 1ZQPA 3HPGA 4RPXA 4B08A 5J0PA 4CFCA 4FM2A 3KLFA 4FJIA 4DG1A 1WCLA 5KFUA 1HNVA 1RBUA 4QZGA 4OKKA 2FPKA 5D4BA 4RW4A 1XC9A 4JWNA 5KFJA 4HUFA 4O5EA 2P5OA 4XQ8A 4NXZA 3TANA 1ZQKA 3NHGA 3LK9A 2QXFA 4IQTA 4CJWA 3GV7B 2XRIA 5KFBA 1T8EA 4PQUA 5J2GA 4ECVA 4AILC 1ZQFA 1MSWD 2O4IA 3UQ0A 2BGGA 2XO7A 4MEYA 3PY8A 2ZTDA 2R7YA 4KHSA 1Z00B 4FW1A 4KLHA 5KFHA 1RDDA 8ICHA 1MQ2A 3RR7A 5D46A 3PO4A 5J0WA 1S6PA 4IR9A 3ZDBA 4M3ZA 1L5UA 4ZHRA 3E01A 8ICOA 3RJIA 8ICNA 3P83D 1KVBA 4QZFA 1NKEA 4E7KA 4EZ6A 4Q8FA 4CFDA 2D0CA 2KQ2A 1X2IA 3AVBA 3SV3A 1VRTA 4B9VA 2P5GA 2Y1JA 3MBYA 4ID1A 4LH5A 7ICVA 3V6JA 2BPCA 4KO0A 2XCAA 7ICMA 3KD1E 4J9OA 3FFIA 4OLAA 3BJYA 3IG1A 4Q0BA 3RRGA 5KFPA 1ZQTA 4CEBA 2KN7A 5J2AA 3NGZA 1XU4A 5BOMA 5I42A 3QEIA 3HSTB 4JV1A 1Z00A 3C1ZA 7ICJA 1YT3A 4KMUA 3TFRA 5FROA 3Q8PB 2ZUCA 5KFSA 3JPPA 4MEXA 3LDSA 4KLOA 4CHZA 3K58A 7ICKA 3DRPA 4J9PA 8ICWA 5KT3A 3ORYA 4KLJA 3JPOA 1O1WA 2JEIA 4J2AA 4I2AA 1QTMA 5FRNA 4CK2A 4ECZA 1S9FA 5KRTA 2YKNA 4XUSA 4FJKA 1TL1A 4RQ1A 1ZYQA 1C7YA 4ED6A 2ASJA 5J2MA 4UAZA 2PFOA 5J2PA 4IKFA 3JPNA 2KZZA 1ZQGA 4CF0A 1VSJA 4F5PA 4Z4GA 3QZ7A 4YMOA 4RUCA 3M8QA 4CJRA 5KGXA 3PUFA 2XHBA 3IS9A 3QETA 3H7IA 2HNYA 4RT2A 3BQ0A 3Q8QB 2BQRA 4J9SA 2RKIA 4I2GA 4R63A 1IO2A 1ZBLA 4KLUA 3QE9Y 4DTRA 2WOMA 4I2IA 4F4WA 1BPEA 4FVMA 3LANA 5KG4A 3OYAA 4H8KA 1TKZA 3S3OA 2PYJA 4KTZA 3MFHA 4EBCA 2JEFA 2M9NA 1DTTA 2F96A 4KHWA 4DL3A 4QZEA 1ZQWA 4JV0A 4O5CA 3JSMA 4E3SA 4LY7A 1VK0A 4K8ZA 4YD1A 3DLKA 3IAYA 4BE1A 1SKSA 1QLNA 4Q8EA 4KTQA 4E7IA 3L2VA 1EP4A 2YKMA 3OYBA 3GIIA 1Z3EB 1MQ3A 4N41A 3Q8LA 1SKRA 4MFBA 2RDIA 1B43A 1ZJNA 3RB0A 5DQGA 5KFFA 3HM9A 2I9GA 1T7PA 4KHYA 4LSNA 1RYRA 5KFVA 4DWIA 9ICWA 3LWMA 4I7FA 4M3UA 4RPYA 3M9MB 9ICRA 1S1TA 2FMQA 4I2HA 2NRTA 2ZE2A 1NOYA 3VQAA 4O5KA 1D8LA 3OYCA 2IMWP 4CHPA 5KFAA 2ZJ8A 3OSNA 4ED7A 1J53A 4KITB 3BGRA 1BCMA 1X9SA 1BHLA 4Y1DA 3ISNC 4KKOA 5IIJA 3DI6A 4PHPA 4KI6A 3GFKB 4CESA 3RMBA 3MECA 4CJVA 3PX0A 2FBXA 1REVA 5JUMA 4CHYA 3VQ5A 5KT4A 3T3FA 4BGDA 4E1MA 3MFIA 4UB1A 4DL2A 4RQ6A 3AVNA 4KHNA 1U45A 2HB5A 1A5VA 4RNNA 4KLMA 1A5XA 4K4HA 5HRRA 4DFKA 1S77D 1BI4A 3RBDA 2FPLA 4OGEA 4F4XA 3DLBA 4Q44A 4TSXA 2ATQA 2C2DA 2QK9A 4B8CA 4CJSA 5KG6A 1VRUA 1S97A 5CYMA 1RBVA 4F4ZA 1J54A 3PW4A 4ECUA 2OA8A 4I29A 4XRHA 4KTWA 3NH1A 2Y1IA 3H8JA 4KAZA 2BHNA 1S9EA 1SV5A 2PI5A 4AHRA 1K1QA 4Z4CA 1F21A 4YVZA 2V9WA 3AVLA 1BQNA 4CGHA 2O4GA 4YR0A 5DDMA 2BCSA 4CIEA 1BCOA 7ICGA 1ZQOA 3ZSYA 1RTJA 3QZ8A 1JN3A 3VA3A 1RNHA 3AU2A 1WLJA 2DFEA 4CGJA 4DOAA 4FCYA 3U6FA 4DTNA 2ZUDA 2PFQA 2ATLA 1R0AA 3K5NA 4M9JA 2G8UA 2AGPA 3KLIA 1QSYA 1WAJA 3NH2A 4PWDA 5KFKA 2D0BA 4FLTA 3F9KA 2MUTA 3OYFA 5J2JA 4TURA 3THVA 2R8KA 8ICKA 3IHQB 9ICFA 3HP6A 1S5JA 3M9NB 4F91B 4TQSA 4R66A 5J2EA 1Y88A 4QZHA 3K4GA 4B3OA 1SL2A 4DS4A 3C21A 4QWEA 4CEQA 2GBZA 3EPGA 4DSJA 1RXWA 4OVLA 3KJVA 1VSLA 3C6TA 4DLGA 3O3GA 4CK3A 4O4GA 2YNHA 1LV5A 4B9LA 4DSIA 1BPBA 2AGOA 2YHAA 3DRRA 5KG5A 4CERA 9ICMA 3UXPA 4JWMA 3V9XA 5IINA 8ICJA 2X78A 1U04A 3C2MA 1KDHA 4TUQA 4JUZA 1RILA 3VQ9A 5HRNA 3GV8B 2F1JA 5HBMA 5J2BA 1XO1A 4DFPA 4ZH4A 3V4IA 4TUPA 4KI4A 1X9WA 4CGGA 5KI6A 3QINA 3QIOA 4EYHB 1HUZA 4M42A 3SV4A 3C6UA 4EBEA 8ICGA 8ICIA 4FJ5A 4J9KA 1RZTA 3DOKA 4CGFA 1WCNA 3V1RA 4DL7A 4CJ4A 3ZSOA 5CR0A 2C22A 1BPYA 9ICEA 4CF2A 4RNOA 1COOA 4JS5A 4JS4A 1L3UA 3SUNA 1TAUA 3AA3A 4FLXA 3OYDA 3Q8KA 3OYKA 2G8FA 4JRQA 5KFNA 4J9MA 1NKBA 4J9LA 8ICBA 1TAQA 3AA2A 1D8YA 9ICIA 1LAVA 4DTXA 3H4BA 5KFIA 4IRDA 1SKWA 1WSGA 1JIHA 5FDLA 4Z0UA 1LAWA 2NRXA 2B21A 5IILA 1TK5A 4JLHA 4MF8A 5EWEA 2E4LA 4F92B 4E7JA 1EXNA 3KHGA 1XI1A 1Q9XA 4M04A 4M45A 4F8RA 4R8UA 4ED2A 3OYIA 1TGOA 1TV9A 1RYSA 4DO9A 2EX3A 2YNIA 2DY4A 1B9FA 3KTQA 3LAMA 3QEVA 4FLVA 1U47A 4RT3A 4FJXA 4QCLA 2OPRA 8ICTA 2B6AA 5DLFA 3PMNA 2HNDA 3OHBA 3NGIA 1DOQA 2KW4A 4YQWA 4FBUA 1KEJA 2GUIA 4HCBA 3T5HA 1NOZA 5C42A 3SCXA 3MR5A 4CHQA 3JPRA 3L3VA 2VWKA 1S1WA 1HUOA 1LB2B 7ICTA 2ZUBA 2VG5A 4MF2A 4M9NA 2HHTA 5E41A 1UOCA 5IIOA 3LZJA 1W0HA 4PPXA 4CEEA 4DU4A 4ELUA 4FLWA 4CFAA 1LW2A 4DQRA 1JXBA 4KHQA 2ZD1A 4CFBA 1BGXT 2W9CA 3SUPA 4M3WA 4RW9A 4F5NA 4TQRA 3O3FA 5HP1A 1LWCA 4KPYA 3RRHA 4FLZA 4CHNA 4W5OA 3ZD8A 3VQ8A 2B5JA 3HVTA 3AVHA 3C94A 4LVSA 5KFWA 1ZQYA 4OKJA 1T05A 3UXNA 1RDBA 3MDCA 4J9RA 4P4OA 2BCUA 1ZQSA 4ECTA 4NM1A 4YNQA 1CUKA 4G3IA 3ZD9A 2Z1HA 4H4OA 4FJ9A 1TKDA 4CHOA 1RT3A 1ZQDA 1EETA 4QZ9A 5HRPA 4DTUA 4DTJA 4GMJB 4BE2A 4F4KA 3L2RA 4DMNA 5EU7A 2BPGA 9ICNA 3KIOA 4KB0A 4DF4A 3TAEA 4CGIA 1BQMA 2IDOA 2AJQA 1C1BA 3S9HA 1HYZA 1AROP 1SUQA 5J2QA 4KV8A 2WONA 3LALA 1PZNA 1GOAA 4NCGA 4M9LA 3V7LA 4RQ7A 3ZCMA 3SNNA 1JLBA 3NGYA 4GVMA 3B6OA 3NE6A 2VA8A 3L2QA 4Z6EA 2R8IA 8ICFA 3WNGA 3OYGA 1U48A 1RTDA 2G8KA 4GXIA 3OGUA 3NF6A 5KFZA 1C6VA 4EBDA 4DTSA 3ZDDA 3SQ4A 3HPOA 1U4BA 3OJSA 2IBKA 1NK0A 1RCHA 2HVHA 4HUEA 3BQ1A 4NCBA 3KHHA 4RPZA 3ZSQA 4Z4IA 5KG1A 4FJLA 3A2FA 8ICAA 8ICQA 4P4PA 1WAFA 2UVRA 1JL1A 1QHTA 4P4MA 1TVRA 3NF8A 1WSHA 3GIKA 3T5LA 3L8BA 1QQCA 4YR2A 4I2FA 3KK3A 4FK4A 4DTPA 2E6MA 2HNZA 3CFPA 2IHMA 4CGDA 4I2JA 4ECYA 3Q8SB 1MU2A 1HYVA 2RN2A 4EP5A 3JPQA 2XGQA 2OPPA 2X6NA 4KN4A 1CXUA 4B9NA 4Y1CA 1ZQAA 1LW0A 2X6SA 1S6QA 1L3SA 3N4MB 4WE1A 3QESA 3UIQA 4LZGA 1ZETA 2AQ4A 2VG6A 5KTQA 1A5WA 4FJ8A 4CE9A 4M9GA 2PZSA 4CIGA 4RQ0A 3RMDA 5CHGA 4FYDA 2KZ3A 5J0XA 2I5JA 3VQ6A 5K14A 4J9QA 4MFFA 9ICJA 4PY5A 3LP1A 4J2DA 2F1IA 4MFAA 4ELTA 1A76A 1RTHA 4AH9A 2G8HA 2DFHA 2G8IA 3OJUA 1VSEA 1KTQA 3QEBZ 4BE0A 2IS3A 4RZRA 3V72A 3K5OA 2YHBA 3D0PA 1XSNA 4ED1A 5CWRA 1MC8A 1FKPA 8ICYA 3OYMA 4OPJA 3ULDA 2ASDA 4O3OA 5DDYA 4XA5A 3KK1A 1BPZA 3ITHA 4HCCA 4DEZA 1RTIA 3MGHA 3TABA 8ICXA 2KFNA 1ZQNA 1UA0A 1KVCA 3QNNA 3TARA 2DFLA 5L1IA 4KLQA 2HHVA 3MXMA 1JLQA 1SZPA 3V9SA 1TK8A 5DG8A 1TFRA 5KFGA 3G10A 4AHUA 5T7BA 1BIUA 2ALZA 1LWEA 3RAXA 1HJPA 1WSIA 4FJNA 3PNCA 3U3GA 4RW8A 3EPIA 2W9BB 4O44A 2Q3SA 3TAPA 2OPSA 3B6PA 4O5BA 4GC7A 4CEZA 2OYQA 3ALYA 2UVVA 1B22A 4B9UA 2ZTEA 5KFLA 4I2QA 3O4QA 2P51A 9ICLA 4QWAA 4XIUA 2ISPA 4R8UB 2E6LA 3LAKA 4UB4A 1ZJMA 1N56A 2ASLA 4FZYA 4FK2A 5J2HA 9ICTA 3RMAA 4O3SA 1C1AA 4LD0A 3T5JA 3VQ7A 3PR5B 3CYMA 1U49A 3TQ1A 4CF8A 3KHRA 2W42A 3N97B 2JEJA 9ICGA 5CZ1A 4IG0A 8ICCA 2H5XA 1RT2A 3PX6A 1YTAA 4ED8A 2BGWA 3ETLA 4NLZA 9ICBA 3DM2A 3KLHA 4ZTJA 2NRZA 3H8WA 2Z1GA 3OS2A 4RQ5A 2IAJA 1ZQJA 4YG2A 1JMSA 1S0OA 4PGQA 3SPZA 4DQSA 3RJKA 4GW6A 2ZQBA 2HHQA 4I2BA 4E0DA 4N47A 4E7HA 4FBTA 2P6UA 1D9FA 8ICSA 1KSPA 3MR2A 2JLEA 5C5JA 4O3RA 1RT1A 5IIMA 3H08A 1D9DA 4UAYA 4OPKA 9ICCA 3DLEA 3EYZA 4UB2A 4EP4A 4FJ7A 5KT5A 5J0UA 3UPQA 4W5QA 5KFYA 4CJUA 8ICEA 2A1RA 2VANA 4DFJA 1FKOA 4H4MA 4C8NA 3HT3A 5CA7A 1XSPA 2DPJA 1IKXA 4E7LA 2VWJA 3KLEA 3CM5A 3D45A 5D3GA 4KREA 4FS2A 2GWSA 3SQ0A 4BWJA 2IOCA 4ECXA 4YFUA 3K75D 4PA1A 3RJEA 2LYHA 3RH4A 2GV9A 5L1KA 4IG3A 2NRWA 4F5OA 3K57A 4IFVA 3NDKA 5CJ7A 4P2HA 3RH6A 3UQ2A 4K4GA 5HHHA 5CY4A 4QW9A 1XS9D 2EHGA 4N76A 1KFSA 1QE1A 2FBVA 3OS0A 1S1UA 3G6VA 4CJ3A 2OWOA 3EW9A 2XCPA 1IH7A 1ZQUA 4F3OA 1HQUA 4JRPA 4EEYA 4O0IA 4KB1A 3AU6A 3GV5B 3ASMA 4FLUA 4BXOB 4KLFA 4I2PA 5HROA 3C2KA 3C2LA 4KLTA 5CZ2A 3EY1A 3ZSRA 4YXMA 3M9OB 3HYFA 1QS4A 5HMLA 2LSNA 4FJHA 4UB5A 3QEXA 7ICRA 5C24A 3I0RA 2BANA 2XY7A 2UVUA 3ZT2A 3V6DA 2PXIA 3DOLA 1XWLA 1BIZA 2KFZA 4HUGA 4LZDA 4GLXA 2XY8A 7ICSA 4CIFA 4JK1A 4W5TA 1BL3A 3LWLA 4RW7A 3OS1A 3HWTA 4QZ8A 4I27A 5DBBA 4DLEA 5DGAA 4FZZA 8ICLA 2HHUA 3VA0A 1J5OA 2P6RA 4CJFA 3WNHA 4O3QA 4E19A 2D0AA 3V9WA 4E1NA 5KT2A 3WNEA 3AO3A 3BQTA 4ECSA 4QWBA 4FM0A 3OSPA 3K5MA 1YTUA 1C0TA 3QIPA 5J1EA 4KLLA 1H38A 2HVIA 3KLGA 3AA4A 5J0OA 4RU9A 4NY8A 5DLGA 2IC3A 2FPMA 3NAEA 1IM4A 1IG9A 4C8MA 4DSEA 8ICPA 1V9PA 3ZSVA 4OGCA 5CP2A 3JPSA 7ICHA 1YVUA 3O4NA 4MQ3A 3G6YA 1BPDA 4R65A 3JPTA 2BCQA 3KKRA 3MGIA 1U9LA 3B0YA 2FMPA 5KT7A 4YFKA 9ICUA 5DB8A 1WSFA 5KFDA 3HK2A 2W8KA 1S0VA 5F9NA 8ICRA 2YV0X 3TI0A 1EKEA 1B92A 3TAFA 4DTOA 4DL5A 3TAGA 3C5FA 4QZCA 5F9LA 4C8LA 4DSKA 4F93B 5HLFA 5J0QA 1JLCA 2XC9A 7ICOA 1ITGA 5DB7A 4FXDA 4K8XA 4F2SA 5DMRA 2JZBA 3V7KA 3SQ2A 5D49A 2HW3A 1CXQA 3GQCA 2P1JA 5EOZA 1HMVA 4NLKA 4QWDA 3C23A 2RDJA 1ZQMA 4F2RA 3L2WA 1HYSA 3AA5X 1KFDA 3ZSZA 1T4GA 1S1VA 4BXOA 4CF1A 3AVFA 4ECWA 3H8SA 3V1OA 4KFBA 3RAQA 5KFXA 2P66A 2FLPA 5L1JA 5C25A 1Q8IA 3O3HA 4HYKA 4KLGA 1ZQBA 1VSHA 5I3UA 5SZTA 4RQ8A 3CM6A 4YN4A 1HQEA 9ICQA 1JLFA 3VQPA 3F73A 3SYZA 3AO1A 4IQUA 4YP3A 3VQCA 3KK2A 2KZMA 3NCIA 4BWMA 2V4QA 4PGYA 5EWFA 2FBTA 4HTUA 5JS1A 4KRFA 4M3RA 3HJFA 4DQIA 1VSKA 2QKBA 4Z4FA 3UXOA 4DOCA 4CK1A 7ICNA 3AVIA 3M8PA 2R8HA 4AHCA 1RT5A 4KLIA 2ISOA 3RTVA 4QZAA 4R5PA 1B9DA 2BR0A 1CZBA 2HMIA 3S3NA 3SZ2A 1ZQCA 4QAGA 4DL6A 1BISA 1HRHA 9ICXA 4PHEA 4PGXA 2Z1IA 4NYFA 1RBRA 1JLEA 3LP2A 1FXXA 1TKXA 4DS5A 5DGBA 3LP3A 4F4YA 2PFNA 2A1JA 4M6WA 5J0YA 5DG7A 4J2EA 4DFMA 4R64A 2BPFA 4B9TA 1CZ9A 1Z26A 3P1GA 3NBPA 3V81A 4CEAA 1ASWA 3M8RA 4ED0A 9ICKA 5IIKA 4C8KA 3G6XA 1RXVA 2G8WA 5KT6A 3ISBA 1JXEA 4RQ2A 4UAWA 3HX0A 4KLDA 4Z4EA 4M47A 4FJJA 3MEDA 1WNSA 5KFQA 2G8VA 3H40A 1ZQQA 3PW7A 2Q0ZX 1NOMA 2W9AA 4I2DA 2JEGA 4NYNA 3B0XA 1ZQEA 4BDPA 5J2KA 1FK9A 3AVGA 4CJTA 3MABA 3HO1A 3JYTA 3HL8A 4GXKA 4M3YA 3RH5A 3ZT0A 3V1QA 3VQBA 3MXIA 1RT4A 4DTMA 3DMJA 1ZQLA 5J2IA 5KFOA 3RB4A 1X1PA 3ZT1A 4QOZB 2DFFA 3K2PA 1JXLA 4FO6A 3SQ1A 3V6KA 4W5RA 3ZDEA 1BPXA 4FS1A 2ZJ5A 3MEEA 1VSDA 4CJ5A 3ISDA 4GC6A 2F1HA 3ZT4A 2ETJA 1N48A 7ICEA 4YR3A 1NK7A 5KFMA 7ICQA 2RPIA 4IRCA 3AVAA 1RBSA 1GOBA 5DB6A 5DQHA 3PW5A 4CEDA 2FLLA 7ICUA 1GOCA 4F3TA 1C1CA 2Z1JA 2NRVA 5IIIA 3PR4A 3Q8MA 4FLYA 3BQ2A 5J2CA 3PMLA 3MR3A 4YD2A 3HW8A 2AU0A 1SL0A 1CLQA 5KRSA 4O3NA 2ITGA 9ICHA 2C2RA 3RB6A 1XSLA 1QSSA 4B9SA 1WSEA 2R8GA 1QSLA 1HNIA 4J9NA 1JX4A 4EZ9A 4M3TA 3AO5A 3WNFA 2FBYA 9ICOA 3OYJA 5J2DA 4UB3A 4L8RB 2A1JB 1ZQZA 4M6WB 3NH0A 4O55A 3DRSA 1IKVA 5KFEA 4CEOA 1TVAA 3PW0A 4UQGA 1DTQA 2AQ0A 1T3NA 3RJGA 3OVNA 3QNOA 2J6SA 2RF2A 5EWGA 4I9LA 3PO5A 3AVMA 1RPLA 2FMSA 3OYLA 1ZQVA 4PUOA 4CEFA 4M41A 4HHTA 9ICAA 3MAQA 5KFCA 2BCRA 3C1YA 4Z6DA 4C8OA 1S9GA 4AHSA 4KN7A 5FRMA 1KLMA 3ISCA 2JGUA 3QEAZ 3TAMA 5BOLA 3RB3A 1RDCA 4Z6CA 2HHSA 9ICVA 3RJFA 2PYLA 1UT5A 3LP0A 1J9AA 3FYHA 1X9MA 3HPHA 5L9XA 3LZIA 4OJRA 5KG3A 1ZBIA 4FJGA 4PHAA 3AVJA 3SPYA 4YMMA 1TL3A 5HNKA 5DBCA 4DSFA 2AGQA 1EXQA 2OZSA 5DB9A 3C5GA 4ED3A 2IGIA 1C0UA 2OZMA 4KLEA 3OYEA 3QERA 2BQUA 3K5LA 5KFTA 3RBEA 3G0ZA 5HRSA 3GILA 1I39A 3MDAA 4OKEA 2OPQA 3TR8A 4I9QA 2F8SA 5CB1A 3Q8RB 3DYAA 4M2YA 3FDSA 4EYIB 2BE2A 4NLGA 3TAQA 3DLHA 3L2UA 3U3YA 1TK0A 7ICFA 4CCHA 1KLNA 4YMNA 1ZQIA 4FW2A 4M3XA 1ZQXA 3VQEA 3VQDA 2R8JA 4DSLA 1JLAA 4IQVA 1XHXA 2NUBA 2YNFA 4J2BA 3IM1A 7ICIA 1L3VA 3IRXA 4F5RA 5J0TA 3SI6A 4QZIA 1RBTA 3QLHA 1KFTA 3V7JA 1ASVA 1WN7A 4CECA 3T5KA 4DL4A 1D5AA 3KHLA 1ZQRA 2J6TA 1ZBUA 4Q45A 4BACA 4N56A 1DGSA 4NM2A 5J0RA 2ZJAA 1W9HA 4CJQA 4M0AA 4NLNA 1C0MA 3TFSA 3TWHA 7ICPA 1VSIA 2KTQA 4Z6FA 2B4JA 4KLSA 1S0NA 3T1AA 4UBCA 1LWFA 2J6UA 3ZSXA 3EZ5A 4CF9A 4FJMA 1ZBHA 4O0JA 4CJLA 3RR8A 4CJPA 5HP4A 1NK4A 1G15A 9ICSA 2VG7A 4AHTA 4RNMA 4ECRA 3SJJA 4ID5A 4Q43A 3M8SA 4LH4A 4QWCA 1CEZA 3CFOA 1EX4A 2FC0A 1NK8A 4F5QA 4IDKA 4BDYA 4IQWA 4Q5VA 3S3MA 3ZSWA 3KKSA 1RDAA 2DPIA 4MFCA 1K1SA 4I28A 2C28A 2ZTCA 1Z25A 5CYQA 1UA1A 3CFRA 5J29A 3ZT3A 3PX4A 4I2EA 1S10A 3K59A 2MUTB 1ZQHA 4ELVA 4GXJA 3NFAA 3QO9A 4AHVA 5HMMA 3MR6A 4N5SA 1TV6A 3SUOA 4YXJA 3P5JA 3HXMA 4UBBA 1UWBA 4CJEA 2JZBB 4DF8A 3L3UA 3KD5E 5J2FA 4ZTFA 3RMCA 2X74A 4W5NA 4DQPA 3V9UA 3RJJA 1DLOA 2XGPA 5DBAA 4NCAA 5KG7A 3RWUA 1NJWA 1JL2A 3SI8A 2W9MA 4I2CA 1XHZA 2IHNA 4M9HA 3LDAA 2F8TA 1RT7A 2V4RA 2XY6A 4X5VA 2VA3A 2W9CB 5DG9A 4DU1A 1UT8A 4RW6A 2VA2A 3NF7A 4ECQA 2HHXA 3GDXA 8ICZA 1K6YA 3I8DA 4RQ3A 3AVKA 4Z4HA 3OY9A 5DKWA 3GIMA 4O9MA 3AV9A 2W9BA 1BI4B 3NTUA 5J0SA 1NK5A 5HHIA 1VSFA 1NK6A 2BDPA 4QZBA 1A77A 1KVAA 4LSLA 3C95A 3T19A 3GIJA 2D5RA 4JV2A 5KG2A 1JLGA 3QEWA 2DTUA 1TKTA 5JS2A 4KHUA 3EWAA 1IKYA 2HHWA 4IFYA 3PVXA 4DU3A 3DLRA 1S0MA 4HVJA 7ICLA 5KFRA 3DLGA 3VQ4A 1N5YA 3V9ZA 4QZDA 1S76D 5DQIA 3AO2A 4IR1A 2PI4A 9ICPA 4F50A 1ASUA 1Q9YA 3VN5A 3PV8A 8ICVA 3PW2A 3LPTA 2C2EA 4DQQA 1SL1A 3NGDA 3AUOA 2PFPA 3HP9A 3VQQA 3E2EA 4FK0A 1IKWA 3CG7A 1L3TA 2FLNA 3ZDCA 1UAXA 3CQ8A 4FZXC 1KCFA 3AO4A 4IBNA 1I3AA 4OLBA 2XY5A 1HJRA 2UVWA 2QKKA 3NF9A 4BDZA 1RT6A 2WTFA 3MXJA 2W8LA 3ZDAA 1HPZA 3LPUA 2BQ3A 1VSMA 1ZBFA 5L1LA 1N6QA 1NJZA 4O3PA 2MAXA 8ICUA 5J2NA 1JKHA 1KRPA 3QEPA 2I1QA 3I0SA 3OYNA 1S1XA 1T03A 4K4IA 4TUSA 5KGWA 1NK9A 3H4DA 2BKEA 4E89A 4B9MA 2YNGA 5KG0A 4QW8A 2A1SA 4YCXA 4CJKA 3SUQA 5DK5A 3MEGA 3RJHA 5SWMA 4B8AB 2IA6A 4DOBA 4FM1A 3OHAA 3BDPA 4RG8A 1BVSA 3V6HA 4PH5A 1NJYA 1NKCA 1Y97A 4RQ4A 5TZVA
chains in the Genus database with same CATH superfamily
3A0HU 1TUUA 4RUAA 1UVJA 4ICLA 2BXJA 4UW2A 2BCVA 1K73T 2DD8S 4PHDA 2HHHK 2VBWA 1DQAA 3OYHA 1PCAA 3WK7A 4B08A 4RPXA 4CFCA 4FM2A 4Y2PA 3KLFA 2LEAA 1HR0J 1URRA 4DG1A 3CDBA 4N77A 1IKVB 3MMCB 5DDQC 4NLCA 4JWNA 3C14B 1SAZA 3WK6A 4XQ8A 4FPRA 2AHOB 3EXYA 2E1FA 5D6GA 3NHGA 3FRYA 3BGRB 2QXFA 4IQTA 3C46A 3HOTA 1S6OA 3GV7B 4ILGB 1L3KA 1HX1A 4PQUA 2VBZA 4ECVA 1XMQF 3T9NA 1H73A 3ICXA 3NMUA 4KO0B 4DR4F 4WXOA 2QMWA 2V69A 1UW9A 2R7YA 4KLHA 5IV3A 1XMQK 4BRMA 1T9UA 5KFHA 4I56A 3HFZB 3RR7A 5CABA 1W2BR 1PG5B 5G4DA 3OTCA 2J0XA 3H90A 3NGUA 2M5YA 3FZLA 3F2DA 3GCXP 4M3ZA 3SMPA 1SI9A 3E01A 3RF9A 1RTZA 2GOLA 3C66A 1BWFO 1NCLA 4YDUC 1UJ5A 3R8YA 2KQ2A 2KMDA 3AVBA 3SV3A 1VRTA 4B9VA 4MMOA 2O8BB 4USJC 4RBUA 4ID1A 4IC9A 4LH5A 5F8NA 2VG7B 7ICVA 5CYMB 2VOPA 2NR0A 4DV7F 1N36J 1UAWA 1S9EB 4J91A 4UOFA 4DV3J 4HHJA 5BR8K 1LWXA 5IC6B 2GGPA 3QEIA 1Z00A 4FXWA 4XO0A 4LF4F 2P6SA 4OD0A 2DPNA 5FROA 1QUVA 5KFSA 1LFWA 3QGIA 2GO9A 3UKRA 2QB0A 3UR0A 5C2DA 2F63A 2LQBA 3DRPA 4OZ1A 4EELA 8ICWA 3ZC4A 3UWTA 2WAQC 2O67A 3ORYA 2IA0A 3JAMO 1U1RA 1X4CA 3A1YG 1X40A 5DDRC 2E1YA 4WJBA 2GS8A 4I2AA 1QTMA 4ECZA 1R3NA 2YKNA 4XUSA 3P31A 3GJQB 1TL1A 3SSRA 4FJKA 1DTQB 4JI3F 5J2PA 4EEKA 4UAZA 2PFOA 1YJ9N 3JPNA 4JI8F 2ZM6F 5ALXA 3MMBB 2J0WA 1VBYA 1S3XA 2F8EX 5HQMA 1EHWA 4CZHA 4RUCA 2XHBA 3IS9A 3ATUA 1IIPA 5ALQA 2ZM6K 4CLYA 2BQRA 4BR9A 4J9SA 2FVQA 3QU2A 4O23A 1IQTA 4I2GA 3PEJA 4KMOB 4KLUA 2WOMA 2OP5A 3EO3A 3QFHA 4ERDA 3Q8VA 2IAJB 1TKZA 2XYHB 4H8KA 3OUYB 2SXLA 2MQOA 4FKXA 4KTZA 4ZCIA 4WIQA 2JSXA 4G6VB 3EWGA 3HZEA 4TU8A 1DGKN 4JV0A 1NM2A 4K8ZA 1COKA 3DLKA 1SKSA 3BREA 1RHRB 4E7IA 3Q7BA 3OYBA 3VF4A 4N41A 1SKRA 3MCAB 2PMZC 5C24B 2RDIA 1VBXA 1VQ4S 5B5EU 3EGNA 2I9GA 1XR5A 4GKJF 2DY1A 5KFVA 1HA1A 3M9MB 1S1TA 4Y2MA 4I2HA 4IJNA 4BVOA 2ZE2A 3CJ7A 4G65A 3R27A 3UE2A 4O44B 1M5OC 4CHPA 3OSNA 3H98A 1RLCL 4J7CA 4PQAA 4KKOA 5IIJA 2DBBA 4LFBF 2MSNA 2DGVA 3CCUN 4US9A 2IPOB 5F8JA 2NPFA 4WFAL 4X4PA 1REVA 5JUMA 4C0OC 3T3FA 2LHTA 2VPYB 3NWGA 1SZ2A 1MA9B 2FSKA 2NXEA 2ZIUA 3VZHA 2P9PB 4QPTA 4DCCA 1T9VA 4DFKA 3DKDA 3OV7A 1BI4A 2Q3PA 4F4XA 3MDQA 3IP4B 3DLBA 4Q44A 2MQPA 4YN3B 3EE8A 1OKJA 1U1MA 2F7TA 5KL1B 1PBAA 4AUKA 3AGRA 1J54A 1VQ8S 4FP9A 3FZHA 3BKFA 3FCVA 2Y1IA 4CZGA 2BHNA 1HD1A 1U1OA 2BA9A 2EC0A 3QUQA 4P75A 1E6VA 2P9LB 3DLEB 2PI5A 3SCKE 1K1QA 4R0EA 4Z4CA 1BDGA 4QJFB 1ULRA 1VHFA 4YR0A 1HD0A 1NGHA 3MMVA 2EFNA 7ICGA 2QWPA 1RTJA 1KW4A 4GNIA 3VA3A 1CJUB 3N7SC 4P10A 4LF6F 2P9NB 5BJRA 1V3SA 1HHTP 2I9SA 2VGMA 3ENHA 1Z1ZA 1S8OA 2V67A 4DTNA 3JYTB 1FFWB 1HHSA 3KLIA 1R0CB 1IKWB 1NGJA 4OJ5A 5KFKA 1CULB 1GLAG 3J81U 3OYFA 2VHGA 1ZRNA 3DLLQ 1RACB 3OFFA 4TN2A 5MLCV 2QSWA 1JB0C 1S5JA 2HIQA 4WK3A 3M9NB 1DHMA 3DHWC 4UZBA 2L9NA 3R5BA 3HD1A 1PUZA 2NZTA 3MGVA 4QWEA 1WF0A 1T44A 3IKMA 4WCEL 2FSJA 1QDUB 1YJ7A 3DFEA 3BR9A 1VSLA 1LNQA 3C6TA 2ZM6J 5GIOA 5T14A 3L7PA 5DM7L 1BPBA 4NLYA 4HTLA 5ELZA 1K47A 3UXPA 1WKLA 4JKCA 4F72A 1NMDA 3V9XA 2M9KA 2HQDA 3A4TA 2X78A 1NLKL 3Q2TC 5AQRA 2MKHA 4ED5A 4EO6A 1QZ6A 1KDHA 1EARA 2E1ZA 5HRNA 2NO5A 1NSQA 3J81j 2KIVA 2F4VF 1XO1A 4DFPA 3V4IA 4OJ3A 3EVMA 2B0GA 4KI4A 3BF4A 4TXSA 2DGOA 1EO1A 4WFXA 3VGTA 1RAIB 2GJIA 1ELOA 5HVGA 4Y2VA 4M42A 3SV4A 3KLEB 2W41A 2G08A 2ZXIA 3I56S 1RZTA 3AXMA 3D7EO 3THPA 3DOKA 3IBFB 1VJWA 4ZA1A 2V52B 3R8EA 3S6EA 4DCPB 4RNOA 4OPHA 1COOA 3C8YA 4JS5A 4JS4A 4P73A 2RHSB 2ZH5A 2KKZA 1TAUA 1IV0A 3OYDA 4NL9A 3BYRA 1HQ2A 1W7WA 3TZZA 4P6QA 3OYKA 1WOSA 2G8FA 4JRQA 3GR1A 5IFMA 1PKUA 1VK8A 1T05B 2OPQB 3KVGA 1LAVA 4OJHA 1N4LA 1VQMS 3QRQA 3AARA 1SKWA 1JIHA 3L5KA 4Z0UA 1ECWA 2NRXA 1U1PA 3HOSA 4OJPA 5K8MA 2D4WA 4MF8A 3X3UA 4F92B 1CJTA 4IDKB 4QS9A 1EXNA 4E7JA 1XI1A 3J7Z5 3MPDA 4M04A 4R8UA 4RX6A 4BS2A 1HBUB 4FF1A 4DCHA 2YNIA 3H6EA 2DY4A 2MZTA 2JX2A 4KHMA 2HHPA 2W24A 3R1LA 4QCLA 3HKWA 3DLGB 2QMXA 3NEKA 2RKIB 3OHBA 5KQDA 3FGVA 3NGIA 3H59A 3M2UB 4FBUA 1KEJA 4C1NI 1N5SA 3BF1A 3SCXA 3JS9A 4NXMF 2VWKA 1S1WA 1YKWA 4WU3A 5FLXU 1LB2B 1SQKA 3OXLA 4LBHA 2ZUBA 3QU5A 2YX8A 4B3RK 3P5BP 3THXA 2HHTA 2XEXA 4OX9K 1EZZB 4NO7A 3LZJA 5G5GA 4DR6J 3IP0A 4CEEA 3KWIA 3M2RA 3M6VA 4M8LA 3M6WA 3UVJB 2VUGA 5FIIA 1BGXT 3MD1A 2OHFA 2HPUA 3SAGA 3IR7B 3M30B 4F5NA 2VD3A 4TQRA 3ET6A 1NLVA 2ZHAA 3RFAA 4KPYA 4CHNA 1W26A 2CQHA 3JAMY 2OMLA 3AVHA 2CGLA 1JCFA 4OKJA 2QRRA 3KKAA 4MFBB 2YHYA 4FYVB 3UMBA 2E29A 1M5SA 3MEEB 5A8WA 1VGYA 1UWBB 4ECTA 1M1KT 1PC4A 2FHOB 4P0PB 4X4RA 2Z1HA 4FJ9A 1SJ3P 1TKDA 3FE1A 4GVLA 4DR3J 4PG6A 4CHOA 5EE1A 1EETA 1SPBP 5KNIA 4GO7X 2W6KA 4JHDB 4CO5A 1YRXA 4AQYF 4B1VA 3L2RA 1HQUB 2OTJN 4DMNA 2BPGA 4F02A 4CZLA 4KB0A 3JS6A 3LGMA 2M2BA 4BC9A 2E5SA 1YDLA 4TVAB 1BQMA 4X65J 4JI0J 3S9HA 2GFFA 2BYCA 1SUQA 5IT4A 3W9IA 2KXHA 4YOEA 4ZVHA 4JKHA 4L3KA 1GOAA 4NCGA 4OHYA 1YVFA 5GAGI 2VWBA 1VRUB 5JVHL 3K17A 4ENOA 5L39A 1BA1A 2KLAA 3U8XA 1JLBA 3NGYA 3IM8A 3HULA 4GVMA 1BNPA 5ALRA 3MN9A 3NE6A 1X4BA 3HHLA 3BBCA 1TMMA 4Y2KA 4E2FB 2R8IA 5BN8A 2IYGA 3BSAA 3C7NA 1RTDA 2G8KA 4C3LA 2XMKA 3NNCA 3S41A 3OGUA 2HBQB 1C6VA 4KGMA 5E3RA 2E66A 4OFZA 2D1CA 4DX6A 4FJLA 1EQMA 8ICQA 3CJCA 3O1LA 3QDKA 4P4MA 3CXCR 2O6KA 2DEJA 1YJTA 2QL7B 1MWZA 5AQSA 3L8BA 2WRMA 1QQ6A 4YR2A 4R79A 3PZPA 2J5AA 2E6MA 2HNZA 2IVYA 1RFQA 2BRLA 4FWMA 4CGDA 4F25A 2W3SA 1C1CB 1XNQK 1RWWB 3AGKA 2XGQA 4ZLPA 4DB3A 4KN4A 2GIFA 1E3MA 1IG6A 2K4PA 2Z2MA 4Y1CA 2CKWA 3O80A 1PK3A 2HHHJ 1OMSA 2X6SA 1L7NA 2AT1B 2OYYA 4PG7A 3N4MB 3PJWA 3ZTSA 3QESA 1RQNA 4WJ3B 3UIQA 4QS7A 1VQMN 3KG0A 2N7CA 4CE9A 4NEZA 1HBOA 2KZ3A 1VQ6N 5J1PA 2I5JA 1RAAB 3HZ6A 1NPPA 4GVEA 3O5BA 1HUXA 5HLFB 4J2DA 3MWPA 2EKYA 4ELTA 1PILA 1RTHA 1SH0A 4OZ5A 3OJUA 3GCWP 3MMBA 4OJGA 2DNRA 1VSEA 3G82B 4YHHF 5BYQA 2VKZG 5CWRA 1HPMA 3L09A 4Y6IA 3AH6A 2E9ZA 5M2PA 3D0GE 2HBKA 5AM0A 1YRUA 4XA5A 4HR2A 3KK1A 2IOFA 4HCCA 3EJMA 4DEZA 1VIOA 3W3SA 3TABA 4USHA 4BRDA 2B56A 1ZQNA 4B3SF 1UA0A 3ITHB 2GMHA 5BRDA 3UN2A 2DFLA 4KT0C 5B0EA 2YX4A 2LM1A 3TW0A 2IC3B 3UM9A 4P7VA 3IM9A 3V9SA 2KHCA 5DG8A 3IDHA 2YWWA 5KFGA 2J9DE 1LWEA 2BJEA 2GGPB 5E3PA 3EPIA 1HHQA 2W9BB 2ZBCA 4F7VA 1CS4B 3B6PA 3HHEA 3D6MB 3U4LA 2GV1A 1B22A 1KR4A 1D8BA 2K1RB 1N33K 1WEZA 4EFHA 2G2ZA 1Q8LA 3OFGA 2X1BA 9ICLA 3BGFA 3LAKA 2E6LA 1B4FA 4NLXA 3KK2B 4IOCL 2M7SA 2IRXA 4TU9A 2YTUA 4KB7A 4NXMK 5J2HA 1UPHA 9ICTA 1C1AA 3MMJA 2XMMA 2E1AA 1GLDG 3PR5B 2JRSA 2FJEB 2YBVA 3AHPA 3CF5Q 4QIFA 4GV6A 3TQ1A 4F0MA 3BO3A 3KHRA 2W42A 5M2UA 1R27B 4WKYA 4AM7A 2JEJA 4Z94A 2YI1A 5BYRA 3H5XA 2H5XA 2BGWA 1NNDA 1FK9B 2VDHA 3SFGA 3H8WA 2Z1GA 2CJXB 3OS2A 1VHXA 3P4IA 5BPMA 1ZQJA 4XH5A 1I51B 1S59A 4B6JA 4NLOA 1RHJB 4PQUB 1OVYA 4GW6A 4PPDA 4RQNA 1KHVA 1S5ZA 1U1NA 4P52A 2ZQBA 1X4GA 2HHQA 2VFVA 4I2BA 3NAHA 1APSA 4E0DA 4N47A 3WQTA 2PMZD 1JLCB 4RL1A 3F5AA 1RWOB 2P6UA 2HS0A 2YKAA 4C1NK 8ICSA 3MR2A 4O3RA 1NZ8A 4O8KA 5IIMA 2KE7A 3O44A 1RYUA 1IBLJ 5G5HA 1D9DA 3K89A 4EP4A 1TTHB 1ATRA 2FIUA 1FTRA 4XH1A 3FKBA 2A1RA 4DFJA 4H4MA 2WVDA 3HT3A 5CA7A 1XSPA 1SJRA 4E7LA 2VWJA 3FC9A 1SQGA 2IOHA 2J4RA 3ZXWA 4E1JA 3EKSA 1X66A 2E1PA 1M1HA 3C65A 1FXDA 3GZ7A 2KJ5A 3IV6A 3NS7B 1X42A 1V4SA 2LYHA 3EM1A 3VERA 3K57A 1B0VA 3SQGA 1HIWA 3H2UB 2MQMA 4ACOA 3K2YA 3EXCX 2OKQA 5K8NA 2GIQA 4QW9A 4BHQA 3W9HA 2Y9UA 3M32B 1QE1A 1FRKA 1Q7YO 4RQMA 1F0MA 4GO5X 4CJ3A 2XCPA 2IM3A 2DL0A 5I3QA 2DXFA 1NH8A 4CGZA 4Y2IA 3AU6A 5DDPC 1FFVA 4FLUA 4GMKA 2UU9J 3LO3A 4ILHA 2AJ0A 4QNLA 5BN9A 1NAQA 4I2PA 1ZH5A 3C2KA 4KLTA 3EY1A 2ITMA 3ZSRA 4YXMA 2XSJB 2ZEJA 5E3AA 4HH0A 3HYFA 5HMLA 4UB5A 3QEXA 2BKNA 2EC2A 2CPYA 4USVA 3I0RA 3P96A 2BUNA 1PVPA 2BANA 4C7YA 5IWAJ 4TYAA 1C0UB 2ZBQA 4HUGA 3DEEA 4OQJA 4GLXA 4DR3F 2XMTA 1SV0A 1RWUA 2MXYA 3CTRA 5LMUJ 3L7UA 1PYTA 2EFVA 3PKYA 5JTIA 2CDRB 2DJWA 1JJCB 4RW7A 3OS1A 3I76A 4Y2CA 1S72S 4I27A 3OL8A 5DGAA 5LY3A 3NGKA 3VA0A 1J5OA 4CJFA 2HBMA 2I7NA 1TZ0A 2LBOA 2X3GA 3V9WA 2ASPA 2YWHA 4ECSA 4QWBA 3K5MA 1T0TV 2FHJA 3UDLA 3QIPA 2PFFB 4KH4A 3KLGA 1X4HA 4NY8A 1BUXA 3W66A 1T3VA 1IG9A 2DNPA 1KEKA 4EHUA 4OYPA 1RQ0A 2NYIA 4RBTA 5IC4B 1Y10A 1YVUA 1NGCA 4MQ3A 3G6YA 5A8RA 3PEHA 4R65A 3KKRA 3MGIA 2Y9TA 3TR5A 2FMPA 3MAHA 2ADCA 4LRFA 3RBZA 1HLUA 3ZZ0A 3J8AA 5DB8A 4CT9A 3F44A 3HK2A 3B8HA 8ICRA 1QQ7A 5B7WA 2RHFA 2YV0X 3TI0A 2GW8A 3FEYB 3KK1B 1JUDA 3U27A 4H0TB 1U7LA 5C7PA 4Q7AA 3IUCA 2UUCK 2XZWA 3UCUP 1Q82O 5J0QA 1GTEA 4FXDA 3FEXB 2MRLA 5AM2A 3W61A 3LTOA 5AQZA 1Y7PA 5DMRA 1GX5A 2RUGA 3U7JA 4A47A 1CXQA 1RZMA 4NLBA 4PWUA 5EOZA 4IO9L 3KZXA 3DXMA 3Q86A 4QWDA 3C23A 2RDJA 3HHLC 1GXTA 1HYSA 4ZKAA 2YQ0A 1T4GA 4LF5F 4JD2B 4BRLA 3G6EN 1IBLF 4ECWA 3V1OA 4KFBA 3MM5A 3C29A 4IZ9A 5A2QY 1Q7LB 2FLPA 5L1JA 4NLVA 2LA6A 2MKIA 2YQ1A 1IN0A 1MU2B 2ODGA 3CM6A 4F4AA 4ZLLA 3JSMB 1HQEA 1JLFA 1EJ7L 3SYZA 5GAGP 2F76X 1CBKA 3AO1A 4IQUA 2ASMA 4YP3A 3R6GB 3W3DA 3NCIA 4BWMA 2V4QA 5EWFA 2FBTA 2VU5A 4UZCA 3J7A1 4A8YA 3R1HA 2Z2ZA 2F77X 2DK2A 3GPAA 1VSKA 2YX1A 3IFEA 3UXOA 3T1HJ 3A3PB 2KIWA 2W2QP 7ICNA 1FRLA 2AYEA 3RTVA 4R5PA 5EXWA 4H5NA 2BR0A 1OS5A 1D9AA 4QAGA 2RQCA 2ZUGA 2VFRA 2D3UA 3NGSA 1BISA 3D66A 4PGXA 2Z1IA 1FX4A 3LP2A 1TKXA 5A8KA 3UI3A 4DS5A 5CEHA 2DNMA 1N34J 4F4YA 2A1JA 3POTB 1VS3A 1U2CA 1X4AA 3V81A 3NASA 4JI2F 1ASWA 2KJ9A 4B3RF 4WQ4A 2W7PA 2U2FA 2K4IA 2XLIA 3S6JA 1IUJA 2EANA 4CRXA 3R5GA 1F3VA 1JXEA 4PAAA 4K59A 3SDEB 1CRXA 1AXQA 4ZITA 1P90A 3D6HB 5HMWA 2UYTA 4QIWD 1QY7A 1ZQQA 3PW7A 3I5BA 4RWWA 2ZZTA 3QJJA 2W9AA 1S99A 3RZAA 3TZYA 4PWWA 1U2RA 3QO9B 2CQCA 2H3IA 4IG0B 6FDRA 5AKXA 4QIVA 3V1QA 5LJ3Y 3ZETA 1KAYA 4DTMA 4Y2QA 2XMAA 2OH2A 5J2IA 5KFOA 3RB4A 1X1PA 3E9OA 2DNHA 4IJAA 3NVYA 3ZDEA 1BPXA 3EL2A 1NGEA 5MLCQ 1XNRK 5FPEA 3B82A 1HJOA 5J1NA 3LQVA 3AVAA 1GOBA 5DB6A 2ZH2A 3N4WA 3RSEB 3B4DA 3SBTA 2FLLA 2CQPA 2MMYA 3AQPA 1PAEX 4LVOP 1P1LA 3Q8MA 1DK3A 3TJ8A 2LYVA 1UCNA 3HW8A 3MR3A 4YD2A 2AU0A 1SL0A 1D0EA 3CWJA 2HSZA 2ITGA 3A8JA 4B9SA 3MD3A 3BSNA 1FJGF 1WSEA 3VV2B 2MLXA 4J9NA 3CMQA 3S7RA 1JX4A 2EBGA 3TA0A 2DNQA 4MLHA 4OHZA 3WNFA 2JH7A 2EWSA 2A1JB 1ZQZA 2IOFK 2RDDA 1FJGK 1HKBA 5KFEA 4JKGA 4M7YA 4Y28C 1M5VC 1WDDA 3PNIA 4KBIA 2HS4A 4F26A 5ETTA 4DR3K 2ZIVB 3PCOB 1ZBTA 2E8OA 2X1FA 3HSZA 2HFUA 4I9LA 2GJFA 3PO5A 4WK1A 2FMSA 5E84A 5M1FA 1ZQVA 2HZVA 5CD4H 4NEYA 2M52A 1NSKL 4DR4K 3M6GA 2OHDA 1WBBA 1IWGA 4OYOA 4BC5A 4OYZA 2LQ9A 2BCRA 4KN7A 5AZIB 3ETRA 3ISCA 2CN1A 3IAS9 3TAMA 3SLCA 2IVPA 1XEZA 2LDIA 2HHSA 4W90B 2K3KA 2YH0A 3O9QA 5AICA 4OLOA 2GVDB 2PYLA 3JSBA 3THYB 4M94A 3FYHA 2LPEA 3S1TA 3BPDA 4OJRA 3AY9A 1WHVA 1ZBIA 5IV4A 4FJGA 3BQ7A 3AVJA 2K60A 1F9FA 1HBOB 1PVQA 3MM5B 1EXQA 3OTDA 2OZSA 1RU2A 5HVFA 3C5GA 3NAIA 2IGIA 2OZMA 4KLEA 1N60A 3MMAB 5BRHA 2H54B 4YOWA 3NXZA 5AQWA 1I39A 3MDAA 5AKEA 2OPQA 3TR8A 3VGKA 2EWHA 3TAMB 3E1YA 5CB1A 3D1QA 3Q8RB 3M6XA 2FGOA 3GLJA 2L9DA 4EYIB 3NY0A 3GSIA 1UQVA 1OJ4A 3EE9A 5DZ6A 4CO2A 1WG5A 4EFAC 2HMXA 3ONNA 4UY8O 3IDWA 1UCVA 4M3XA 3TO8A 1MNEA 1IQZA 3A8KA 3VQEA 3BO4A 4LFAJ 4BC4A 1XHXA 5ITHA 2F3NA 4CE6A 3I5CA 5LMNK 5AI4A 1VQLN 2WZ1A 2KJWA 4MKVA 4F5RA 5J0TA 3SI6A 1KFTA 3R7BB 3GG4A 4PG4A 5FPNA 3T5KA 3AB4B 4DL4A 3KHLA 4K4XA 1H2TZ 1MWYA 1IJFB 2L48A 4CJQA 3DRRB 3LA0A 7ICPA 3WKBA 4UF4A 4UY8T 1N5QA 3T1AA 3CMAS 2ZITA 3WKDA 3CDAA 2B6AB 4CF9A 3N4QA 5KAFU 1M6YA 2A6AA 1S49A 4CJLA 4I6MA 4DN0A 1G15A 2BVZA 4RNMA 2IHR1 3SJJA 2Q31A 4RW7B 2H3FA 2IRYA 4WFNQ 2IM1A 1I94F 4BDYA 3C6AA 3M4XA 3AA9A 1SXDA 4F3MA 3A5NC 4ES1A 2DPIA 4MFCA 1XNQF 4P71A 1WACA 4DHYA 3G9CA 2C28A 2UV8G 5GADU 1ZTTA 5CYQA 3E58A 4JHDA 2ZDPA 1H2UX 1BE4A 3KG1A 3K59A 2DYAA 1ZQHA 1HKCA 1T9TA 4GXJA 3NFAA 4JI4K 3H45C 3QO9A 1X4FA 4AHVA 3MR6A 2E88A 3E0FA 3HXMA 2KVCA 5JRTA 1UWBA 2WB1F 4CJEA 1M1GA 1CC7A 1YRTA 1M0SA 4MKYA 1V9OA 3IBCB 3C15A 3A5MC 4CI6A 1HNZK 5B66U 2QW9A 1QVFR 4X66K 1XJWB 5JVHQ 5T41A 4PL7A 4NCAA 2X3DA 1KBUA 2RQMA 4F0HA 5D8HB 4IWVA 3ZNUA 3SI8A 3FGUA 3N7PD 4OYIA 1N36F 2QLBB 3UB5A 2A5XA 4LVNP 2R7TA 2V4RA 2VA3A 2V8GA 4DU1A 2F5GA 1UT8A 2AP6A 2IVOA 3NF7A 1S4FA 3NCQA 2ES6A 4CO4A 3GDXA 1BY9A 3HD2A 4FVCA 4OV1A 4KY3A 4X62F 3AVKA 5DKWA 2EZXA 4CDGA 4O9MA 4OYMA 1C0FA 1BI4B 1QCKA 2HNDB 1QAIA 4QZBA 1Y5LB 5EX3A 1U24A 2CWKA 1V5IB 2BJDA 2E7WA 2RRNA 3GIJA 3C95A 5DM6L 1C4AA 1KD1T 1FRJA 2DTUA 3M1YA 2BH1A 1TKTA 1NXIA 5JS2A 4EX6A 1IKYA 3PSIA 3TKAA 1WD6A 2Y1LB 4J9UE 4RTFD 2HHWA 1JLAB 2EEYA 2Y0SF 3GE9A 3FMWA 3KZBA 1S0MA 4HVJA 7ICLA 2EI5A 5KFRA 2KN4A 2JZ5A 3DLGA 1VJQA 3I8BA 3FSYA 2DHAA 4B3OB 4DPUA 3DHXA 2DT9A 2F9WA 2ZZNA 2IVNA 4PABA 2PI4A 2GO8A 8ICVA 4KC5A 1RA7A 5AQMA 2C2KB 5ETMA 2V7YA 4X64J 1SL1A 5ALWA 4C2MA 3QPIA 2PFUA 5AFUA 2R7QA 4JD2A 3HP9A 2OAUA 1O8BA 1G99A 1L3TA 3RG6A 2FLNA 5GAGU 1I3AA 3N5FA 3AD7C 2BJ3A 1HWIA 2W8LA 2AEJA 1YHQS 1ZBFA 1BWEA 5L1LA 1R31A 1C0GA 1PK1A 2MAXA 8ICUA 5J2NA 3QEPA 2E7VA 2W7OA 2AWZA 4K4IA 2XMVA 1NK9A 3ZX2A 3VVTA 1N54B 3LDLA 4EO8A 4E89A 1N5XA 1X5TA 3TQEA 3OW2R 2A1SA 3GONA 4IFYB 4CJKA 3KDOA 5DK5A 4B8AB 2H3ZA 4FM1A 4DKWA 2WC9A 2E20A 4I6MB 1VQNN 1NI3A 3M8QB 4ISFA 4DR1F 4A8MP 2OSQA 1L8OA 1CS4A 3QUTA 4NYOA 5JMVA 3CETA 1V38A 3KK3B 3Q24A 2DQNB 1AUDA 4JI7J 2BACA 4ZVUB 1Y97A 4JKEA 4CF4A 2WSCC 1XMOF 4FDFA 4IRKA 1WDTA 1WSJA 1NJXA 4KIAA 1IXRA 2PY5A 3WUHA 1ZQPA 3KLGB 4L3NA 3QIPB 5FPMA 4TY9A 2UXBK 3QNWB 1ZD2P 4FJIA 1WCLA 2FDNA 1HNVA 3EUB2 2QL5B 4OKKA 4JB8B 3HM8A 1UEKA 4RW4A 1XC9A 3TTFA 4HUFA 5KFJA 4O5EA 1E6YA 2FSNA 2P5OA 1KQSM 3VCBA 1P9QC 3EMTA 4DUZF 3T69A 3LK9A 3NVKA 4H5TA 5KQ8A 1CQMA 3KMQA 5F8GA 5KFBA 3KDNA 2XM3A 2I38A 1HNXF 3X1LB 1ZQFA 2Y0SC 1MSWD 5L9NA 2RLTA 4MEYA 5AQTA 2ZTDA 1PIEA 1N88A 1Z00B 4FW1A 4C97A 3R1XA 3CI5A 3PYDA 1WUUA 1RT2B 3K7RA 1RDDA 2LXUA 2LYBA 1CULA 5ALGA 1NG9A 4DZ6A 2E9TA 3QGPA 3LOUA 4BRPA 3ZDBA 3SEIA 4ZHRA 8ICNA 2GJ2A 4QZFA 4C3MA 2QO3A 2G0JA 3MX2A 4LREA 1X2IA 3DLJA 3CHWA 2RHKA 4F67A 3MBYA 3D7SB 2LCWA 3L9ZA 3WC2A 4HKQA 3KD1E 2G0IA 5DDOC 3FFIA 4MH8A 1E6VB 2WF7A 1ZQTA 2KN7A 2ZH8A 1WEYA 2W1BA 3CC4S 2EFPA 4P2FA 3A3NB 4KMUA 3BV8A 3CC4N 2ZUCA 2KNJA 3RBXA 3ZLJA 1Q95G 5TKWA 3IXQA 3KMSA 4AL7A 3LDSA 3MEDB 4J9PA 2EW9A 5E5NA 1AZSB 1HNVB 4DV7J 4DR5J 1O1WA 2K8GA 3FR0A 1OYDA 2KHOA 3D2FB 2FC8A 5M1KA 2DKOB 4NI2A 3C14A 2WHOA 2L5YA 4RQ1A 3NOCA 3T41A 3CSKA 1C7YA 2PT0A 4UB6U 4HT5A 2V9KA 3CW2C 1ZQGA 1RBOB 3AFGA 2KHDA 3KLVA 1VSJA 3DCAA 4DR6F 4F5PA 4PXCA 1EQ0A 2E5JA 3M8QA 4CJRA 1A7GE 3QETA 1KQSR 3BQ0A 3Q8QB 3ILJA 1YAGA 3PRVA 2XYPB 1NDPA 1T9YA 2R3VA 3VWSA 4WZQA 3MK6A 4MJKA 4DTRA 4I2IA 1S79A 1WOQA 2D7SA 4KE5A 3LANA 4Q2LA 2Z7JA 2DH7A 3FFKB 3S3OA 4U7UD 2HI0A 1GMWD 4DR7J 2ZF5O 3H8MA 1F44A 1RWVB 4KHWA 3MUMP 1UL3A 1ZQWA 4O5CA 4NLDA 4LY7A 4LFBK 4LF7F 1GH8A 3UMGA 3F56A 4KTQA 2FHKA 1EP4A 2YKMA 4M63A 2KG0A 1VQ6S 3GZFA 3IGNA 5A8WB 1Z3EB 3Q8LA 4MFBA 1URJA 3RB0A 5KFFA 3HM9A 4LF7K 1RYRA 2GH1A 9ICWA 5MAOA 9ICRA 3SAFA 5HK4A 2FMQA 1NWKA 4KYZA 2NRTA 3GTYX 3VAHA 4PUOB 3VQAA 4O5KA 1D8LA 3MCNA 4BLGA 1N5WA 3LPYA 5GMKa 1J53A 4KITB 3VF0B 2KYZA 4Y1DA 3ISNC 3CC7S 5ALTA 1OY9A 3GFKB 2QLXA 2OFGX 5IS2A 4CJVA 2RQ4A 2YX6A 2FBXA 4NMLA 4CHYA 2AJ4A 3VAKA 4WQ4C 2FD2A 4DUTA 1T9WA 1MMLA 4B3MJ 2B6GA 3BGLA 3CPWR 4XDCA 1NDKA 4RQ6A 1WHYA 2BW2A 1JJHA 1QQOA 4RNNA 1A5XA 2FGCA 4H0OA 1ZAVA 1S77D 1SWWA 2CRLA 2C2DA 4CJSA 2P9KB 1GAOA 2RQ5A 1U26A 1WUDA 2QYGA 2V68A 4ECUA 5AE2A 4FYYB 4L6V3 3IGVA 1N8RO 2RRAA 2NXJA 3FSXA 1KNZA 3PIPL 1S9EA 2QLTA 2VDIA 2KT3A 2NUHA 4YVZA 2P9CA 1JJ4A 2V9WA 4MIWA 2ZKTA 4YOXA 2B9XA 2QARA 2MEWA 2BCSA 2GZOA 1BCOA 4CZCA 3ZSYA 2KEYA 1WLJA 1B7YB 4CGJA 4DOAA 4U8YA 1MA7A 2GQQA 2EFGA 4KFBB 5IT0A 3THTA 3U6FA 4DPWA 3VGLA 4NXNF 1J97A 2PFQA 3DXMB 4M9JA 4C0ZA 4NLPA 2MPUA 4CZIA 1QSYA 3W8GA 2D0BA 4K0KK 3EZUA 4DCOB 2UXCK 2AKWB 3F9KA 4TURA 3B8AX 3GJTB 2QZ8A 3G8TA 4L73A 2R42A 3CJ4A 3HP6A 3EE3A 4JI0F 4X65F 4F91B 3TADC 4TQSA 4R66A 4A8SA 3NBPB 3T1YK 1S1UB 4A61A 1VAZA 3VGUA 4WTOB 4DS4A 2DHHA 2LXIA 3C21A 1LOUA 3DWLA 5IQQA 3DLLL 2VKRA 4FWOA 4DLGA 1GEHA 1UTAA 4OLPA 5HMZA 4O4GA 2FY8A 4B9LA 2YNHA 3LM9A 2AGOA 3OL9A 1YIJS 3DRRA 2W43A 2KVQE 2IDEA 2E5HA 5IINA 8ICJA 3HHLB 3BH6B 2QWNA 4DUYJ 2PMWA 4FF2A 3U1NA 5L1MA 2OPRB 3H3NO 1RILA 3CCVS 3GV8B 2F1JA 1IBMF 4UT4A 1ZXOA 4MDBA 4MKBA 5HR7A 1KD1O 2KKPA 3GB0A 4TUPA 1S4EA 3N7RC 2PO4A 2ZJRL 1GXUA 4CGGA 1KOOA 1V97A 5AZJA 3QINA 2VODA 3QIOA 4EYHB 3C16B 2AX0A 2E5LK 4HHUA 3JXOA 1YJNN 3HDSA 4LF7J 3H5SA 4FJ5A 3RJMB 1TYQB 4DL7A 4CJ4A 3BUZB 1BPYA 9ICEA 1MN9A 1XC3A 2B51A 4JBCA 3QYPA 5GAEI 3CNQP 4UW9A 2Q1LA 3KLIB 2M8DB 4BUGA 2ZJQL 2MHNA 1FCAA 1K8AT 4KHPJ 4AYBF 3GP9A 1NKBA 4J9LA 4NYZA 1SC4B 2W4PA 3HHLD 1TAQA 1WI6A 4OZNA 5ETLA 2QIFA 2E8PA 2EFOA 5D4OA 3DU5A 3D9BA 2P9IA 3AAPA 4JI1F 2OLWA 3ZTOA 4JLHA 2HWTA 3ET6B 1X6IA 2E4LA 4DV2K 4PG5A 1TMJA 2BTFA 3KHGA 4HWIA 4XH4A 1OWXA 3MAAA 4F8RA 1X4EA 2CG4A 3D5MA 3OYIA 3C6HA 1R6VA 1TV9A 4B1WB 1B9FA 2M0NA 2VBXA 2HDOA 1SIZA 3WBZA 3FBFA 2G13A 2AJ1A 4FJXA 1TUYA 4R25A 3QXGA 3THXB 2ACMA 5DLFA 1KLMB 2HNDA 1X31C 1WG1A 2Q66A 3HF5A 3EX7B 2COLA 5FJ4A 2ZIWA 2KJVA 2RT3A 1WSVA 3Q22A 4HCBA 1MWMA 3L3CA 1MMNA 1OW5A 1SXEA 2CPRA 3PSPA 5J8YC 4USMA 5HMXA 1JXVA 3MR5A 4CHQA 3JPRA 5JJBA 3J7AN 5AT1B 1HUOA 3BS5A 1PSDA 4CI0B 2HBYB 2HOFA 3ZTRA 4DDFA 4MF2A 2EAMA 3PYEA 3O3LA 3MTJA 2ZJPQ 3WK9A 4LR7A 1RTDB 3C7NB 1W0HA 3MWBA 4ELUA 3CD6S 4CFAA 1JXBA 2QWOA 1Z1BA 4M5GA 2D1KA 1ZTWA 1UJ6A 1UZHA 2W9CA 1R89A 4BQZA 2FVCA 2GMJA 3C15B 2KL8A 5A6WA 2PMHA 3G96A 1Q16B 4PWDB 5HP1A 2P9UB 2RU9A 4FLZA 3ZD8A 2B5JA 2QX0A 1R0AB 5H1SQ 2M88A 1ZQYA 2J9DA 1NGIA 3MPYA 1IJJA 1T05A 3UXNA 2QG9B 1WG8A 1RDBA 4AFFA 4DR2J 2FVSA 1D4XA 4I4BA 3MDCA 2BCUA 2ESEA 5IZHA 4FOIA 1UPMB 3CJ2A 4DV1K 4NM1A 4FZVA 3THWB 1HNWF 3G6ES 4G3IA 1H3DA 3VHQA 2DWQA 2D3ZA 4LF2A 5CXTA 2LFVA 1BLUA 1Q79A 3ZI4A 5HRPA 1N0VC 4C0HA 4GMJB 1X60A 4BE2A 4M5JA 4QYZK 9ICNA 3IO1A 3ISZA 5B0BA 3CCLS 3TAEA 3TSQA 5K4LA 5AK4A 3QT7A 2AJQA 2AYMA 1QAYA 2AIRB 4X66F 4B9QA 3TEGA 2WONA 2L3MA 1CQNA 3SR6A 1N8RT 4M9LA 1IR1A 1TVRB 2D3OR 4MLEA 3R5JB 2JL9A 2HWHA 4LJXA 2CNOB 3ZCMA 5J8YA 4FSVA 1HW9A 1SCJB 2ILYA 3H25A 1P27B 1KC8T 5A8KB 1TKXB 2VA8A 4BRQA 3MECB 3QBXA 4PEOA 3CIPA 4CLLA 4DV3K 3TACB 3WNGA 3OYGA 4GXIA 2HCFA 2V2VA 1ITPA 2YQ3A 4EBDA 3SQ4A 4CTAB 4FNHA 1I6JA 2W2OP 2IBKA 1JWWA 4WYLA 2HVHA 3KHHA 1H2VZ 3KG4A 4U7CA 3GU0A 3A2FA 3DOMA 8ICAA 3HT0A 2UVRA 4YMEA 1JL1A 2F3JA 4IH5A 3HILA 4FVUA 1WBDA 3T5LA 5D0EA 1SQFA 2LQJA 1Q4RA 2WBNA 5EN1A 4FK4A 4M5IA 3CCRS 4KHPF 3QFUA 1MMDA 4LF6K 2YKOA 2VV5A 1EX8A 2B9YA 1MU2A 2E8MA 1HBNA 1IWAA 1ZD5A 1HYVA 4EP5A 2UUAJ 2ZGYA 2QYCA 1WWHA 2X6NA 1VHIA 3KLHB 1NJIO 4JMUA 2A6MA 1CXUA 3OTEA 2J7UA 3EGWB 3RAMA 1CJKB 2OI2A 2AYBA 2DVIA 1RT3B 3VAIA 1L3SA 2OMOA 4WE1A 1RTJB 3AJDA 1TE2A 4LZGA 1DT9A 5I3UB 2C2MB 5GMDA 2AQ4A 4CJ7A 3MI7X 1SH3A 3THYA 1QH9A 4M9GA 4CIGA 4RQ0A 2FHJD 2O5DA 3BZQA 2O01C 3WEEB 4FF3A 3VQ6A 1QTNB 3O6QA 2R2SA 4FKYA 1DAXA 3OBIA 2FJBB 4CM0A 4O0NA 1NZPA 1RG6A 2NRRA 3HCXA 4X4OA 3TP2A 1U6BA 2G8IA 1HIYA 4NL9C 4RW8B 5E79U 1KTQA 4FE3A 4HEA9 2IS3A 3V72A 3D0PA 1KN6A 1FKPA 5AQOA 2VQFJ 1N32J 4DV5K 4OPJA 2HURA 2ZIVA 2DNGA 2WBRA 1Y64A 3C2PA 5DDYA 3QIDA 3R2DJ 1BPZA 2HVEA 3DDNA 3MMCA 1J5EK 2QXLA 8ICXA 2KFNA 3KLFB 1NSPA 3V4IB 3H0LB 3JXUA 4TNOA 1KVCA 3QNNA 3G87A 3TZXA 4A57A 2W01A 1GXLA 3ENBA 1SZPA 1TK8A 5M1OA 1TFRA 2HMIB 1Y9OA 2D3DA 3H0MB 4NB4A 3KOAA 3RAXA 3HHDA 4FJNA 3U3GA 5ETNA 3K1RB 4IL6U 4O44A 3GR0A 2A1AA 4O5BA 1RM6C 2OEJA 4CEZA 5AK3A 1ZD3A 2R4FA 5E2QA 3DGPA 4NCGB 1KC8O 4ITSA 1YI2N 2A3VA 5D4NA 2ZIWB 4I2QA 2P51A 1RAJA 4RW6B 4QWAA 1PO6A 6FD1A 1ZJMA 2F8KA 1GNKA 4LR8A 3O9UA 3QAUA 4FK2A 3RMAA 3S01A 4LD0A 2IM2A 4WFYA 2MYFA 1U49A 2VPXB 4CF8A 5FDLB 3SCJE 2B0CA 2NLWA 2BANB 3I4PA 3GMGA 9ICGA 4NRUA 3CUNA 5CZ1A 5CZVA 1RT6B 4IG0A 8ICCA 3H0RB 3CJAA 3PX6A 1YTAA 4ED8A 4NLZA 3ETLA 1FRHA 3ELHA 2KKHA 4QU7A 3C19A 5EGYA 2GAGC 5ALNA 2WVCA 1PJ6A 3SEOA 3QRRA 1YHQN 1TFYA 3FBEA 2KK0A 2IAJA 3ONQA 3K9JA 5AKJA 4YG2A 1H72C 1S0OA 5TISU 4B17A 3SDEA 1EWRA 4DQSA 5ETVA 4PYAA 3ENVA 3HVAA 1YZ6A 2KM8B 4E7HA 2V8VA 4UOHA 3BN4A 4WFNL 5AQHA 1BNOA 5ADXA 2UU9K 2FI1A 3HKZC 3AMZA 4V19X 9ICCA 3DLEA 5B8HA 4UB2A 4FJ7A 2F8MA 3UPQA 1N33F 4W5QA 3QUCA 2D0PA 3MCOA 4NA1A 1FKOA 3FZBA 3QT6A 2DHSA 1KP6A 4JV5J 5C15A 1BUPA 1IKXA 2O66A 3KUHA 3D45A 1TL1B 2UXDK 1Q1KA 3C16A 5HJYA 2Y0BB 4FS2A 3VF6A 2P9EA 2XZDB 3SQGB 2QGFB 5HI7A 4LFBJ 4F36A 2NREA 1SB3C 4PA1A 1SWVA 3RH4A 3W1YC 5LXRA 5L1KA 4F5OA 1DQ9A 2D41A 3NDKA 3HSJA 2QB0B 4JI3J 5GIPA 3RH6A 3PIOQ 3UQ2A 3CMAN 5CY4A 3I9V9 1C0TB 3MEGB 4JK9A 3LW5C 4JI8J 2OD4A 1JJ2R 1NPRA 2DITA 4RBVA 5GAHU 3AQOA 2WBMA 4P2SA 5AQFA 3WZ0A 2NV3A 2R7SA 4KKOB 1LK7A 3EW9A 1V5VA 2UZAA 2YNHB 1ZQUA 3WU2U 3AA8A 2JOQA 1V3ZA 4EEYA 2Z2LA 2WHEA 2YWEA 3Q8YA 4OI3A 2PAVA 1VQPN 1SJ4P 3P8BB 5IT9Y 3GV5B 4BCAA 3QBWA 2ZE2B 3JTPA 1FD8A 1VLBA 2ZNYA 4H4OB 4CLKA 5F2RA 4I0WA 3AODA 4ZVFA 5HMYA 3M9OB 2O8DA 2QLFB 2BMBA 2XICA 4FJHA 3GFZA 4ILMA 1KVIA 3OTOJ 3QMLA 4KH1B 5C24A 3MTKA 1DKGD 2YMMA 1DEJA 1RBAA 1KONA 4JYAK 2UVUA 3V6DA 3DOLA 1HNWJ 4OYBA 2MZSA 5G0RB 2YPZA 2ZBPA 3IA0A 3SIPB 5LMUK 3ZTQA 5A6PA 2AP1A 7ICSA 5T7LA 4JK1A 2G1HA 2LU1A 1QQ5A 1HFEL 1OY6A 4ZCLA 2M3DA 1YBAA 4QZ8A 2BUPA 1LW2B 1TKZB 2Z4PA 4LRDA 8ICLA 2MSTA 4OI0A 2J9CA 2HQ3A 4X4VA 2GELA 3CVKA 3FMBA 4G9BA 1VQNS 2G09A 3AOCA 4DG1B 2MU2A 3CC2N 1LWEB 1ILYA 3VESA 4KRWA 2DY9A 4KLLA 2W40A 5GAHI 4URSA 3CDEA 1PVRA 2HSEB 1QVGR 2IC3A 3WXLA 2FPMA 2OEMA 5ADZA 2OUGA 3FJ2A 2HZAA 8ICPA 2OPSB 4J90A 2E1EA 5GADP 5CP2A 4WF9Q 2KDOA 1T02A 4PL8A 4A2BA 3M3ZA 2YTCA 3PLAA 3QATA 3LDQA 1BPDA 2BCQA 3QFWA 1YXQA 2YKNB 4I67A 4G9ZA 1XR6A 5EE3A 3W5YA 3WT0A 1J2MA 4EI2A 1WSFA 4TLQA 2CPHA 1I94K 3CDWA 1O6XA 1EKEA 5JICA 2GHPA 1ZZNA 2DNOA 3O9TA 1JCEA 4QZCA 4URQU 3NCRA 4DSKA 1GTHA 3IC1A 3CIZA 4PKGA 1J5EF 5HLFA 1C4CA 2GX9A 4LSNB 1DLOB 1VCTA 1RGIA 4OJOA 4FPAA 3D6RA 3V7KA 3SQ2A 3PIOL 4Z2XA 2P1JA 5AI0A 1DY3A 3N6NA 3MCMA 4NLKA 4K8RA 4JI7K 2JJ4D 4IEIA 1TV6B 2K4EA 3AA5X 1S1VA 3F53A 3AVFA 2WB1D 1GLEG 1GMVA 2ZJQQ 5HATA 5C25A 1Q8IA 4GRSA 3QBCA 2ZH3A 1ZQBA 5LT5A 3A0IX 4DJBA 4YORA 1VDVA 4YN4A 4FPBA 5RUBA 5ALUA 3A8IA 1O13A 3H0PA 2UP1A 4NXNJ 3NVWA 3VQCA 1S72N 2KZMA 6AT1B 1VLOA 1SQEA 1YLXA 3DAWA 1NGGA 3HJFA 4M3RA 3HFKA 3OBWA 3V5RA 2Q6CA 3DXKB 3DGPB 4DOCA 4CK1A 3CCSS 2F2AB 4M5DA 3VR1A 3ULEB 3M1VA 5CR4A 1NNEA 4QZAA 3SCLE 1CZBA 2W2PP 5LJWA 1NB7A 5M1QA 1U2VA 4UOCA 4E98A 4NASA 2E5IA 2W2NP 3PJXA 5AI9A 3ZNJ1 3MN5A 4DBQA 2KKVA 1XTZA 1JLEA 2ZWPA 1O51A 1FFGB 2OGUA 3M2VA 1GLBG 3LP3A 1P9YA 2HF4A 2AV5A 2PFNA 2NYHA 2LQ5A 2DTJA 2Y0SD 4J2EA 4B9TA 2BPFA 1CZ9A 3P1GA 3EDQB 4B1ZA 4NI2B 2F8LA 3M8RA 1PYOB 4D3HA 1HR0F 2AEMA 4DV6F 4C8KA 1F6TA 2AZ1A 3G6XA 3K9KA 1AZSA 4RQ2A 4C7QA 3HX0A 4KLDA 3M8YA 3T1HK 4LR9A 4Z4EA 3MEDA 2PD1A 5KFQA 4FWNA 1RT1B 1NJIT 1RWXB 2HBJA 2JEGA 2DUYA 1EIYB 2Y9HA 1FK9A 1RABB 3A13A 5C2FA 2F40A 3HL8A 3RH5A 2MY7A 4JEPA 3DMJA 3FNNA 1WTBA 3ZT1A 1KXPA 3K2PA 1JXLA 4DV0J 4UOGA 2B4OA 1N34K 4H0PA 2ZJ5A 3MEEA 2WAQF 5AM4A 3ISDA 1WTFA 2ETJA 3KKAC 4ZPVR 1S1VB 2RPIA 1REGX 3BYPA 3PW5A 4OI1A 5BREA 1H0HB 7ICUA 1GOCA 2DEIA 4ZOHC 1HBNB 4AQYJ 2XLJA 3PR4A 3BQ2A 1XNSA 4DZDA 5KRSA 3KYLA 3F5EA 2W04A 9ICHA 1XSLA 3RB6A 3NVZA 2FJXA 5A0LA 4ALZA 4ES2A 4GV3A 4QIEA 2YB4A 4TY8A 1VQOS 4EZ9A 4GKJJ 4K25A 1YG0A 3UN5A 3ZEUA 3FZMA 3DOMB 1BXNA 4BG8A 2XBPA 4NXNK 2W7AA 1TVAA 2A0FB 4ZJQA 4YUDA 1Y4ZB 4RU2A 1DTQA 1F1BB 1K44A 1T3NA 3SXLA 1WF2A 1T94A 5BXIA 1W25A 3QNOA 4NRTA 2J6SA 2RF2A 4ID8A 2BE7D 2OEHA 2HLUA 2IBOA 4DV7K 2O3DA 2IMOA 3U1MA 2M0GB 5AXNA 1WUAA 4IO9Q 3SENA 3T9ZA 4R0JA 1X3NA 4O3MA 4Z6DA 4CH7A 5FRMA 4OX7A 1HW8A 1WKKA 2QEXN 1QQMA 1RDCA 1W2BM 3QSYB 3K5PA 4OYAA 3SJHA 5KOWA 3RJFA 1MWKA 1UT5A 4KGXB 1J9AA 2DNNA 3IBPA 4CD1A 3ILIA 3CJKB 2FJDB 2RUSA 1VQ7S 3QAEA 1RE1B 2R7UA 3QYYA 5DBCA 5HNKA 5D0HA 2P8IA 3F41A 2BABA 5J2NB 3OYEA 3QERA 4NZ6A 3CJSA 2C3YA 1X0FA 2A2DA 5HRSA 3GILA 4DR2F 3QGHA 4I9QA 1FXRA 4WPAA 4WCEQ 2DXDA 4ZVPB 3G8SA 2BE2A 4DR2K 2G5HB 1NZAA 2XMUA 1VBZA 4PL2A 1ACMB 2KRRA 1ZQIA 2CPZA 1ZQXA 3VQDA 3CJBA 4B1YB 2NUBA 4J2BA 1RGVA 1PYSB 4ES3A 1ZM9A 1L3VA 2D69A 1F5AA 1T9XA 4JI4J 1RBTA 1FJCA 3CJQA 1NB2A 2CZVC 3V7JA 1ASVA 4ANEA 1IM6A 3M2VB 1K9MT 3AJ1A 1ZQRA 4DV6J 1IKYB 4N56A 4FWQA 4NM2A 5J0RA 2ZJAA 1W7AA 4GKJK 4M0AA 7FD1A 5A0YB 3TWHA 2JDJA 4HTIA 1VSIA 2KTQA 1UKUA 4B3SJ 2B4JA 3J81O 4I6YA 2NS1B 1LWFA 2J6UA 3IRWP 3C6TB 3CNHA 1B64A 3I5AA 3VAGA 2MDAA 5THWA 1CLFA 3P6YC 4LFCJ 2UXDJ 4U6PA 4O0JA 3DXKA 3QLHB 3W5ZA 7AT1B 3WKEA 5HP4A 4CJPA 3SFUA 1IKXB 2QWQA 4AHTA 4Y2YA 1YJNS 4ECRA 4Q43A 2EG2A 4QWCA 2R7VA 4F5QA 2GVZB 4O8UA 3ZZTA 3WKAA 2FDRA 1YJRA 3OR2A 4JI3K 3DNCA 2FPHX 4A5AA 3KKSA 1RDAA 1HMVB 4I28A 1M90T 2ZTCA 3E66A 1VQ7N 3LYSA 1Z25A 1VQYA 1UA1A 1YF5L 4Z7YA 1O08A 5J29A 4UB8U 4LRBA 3A5OC 4N5SA 3SUOA 1TV6A 4YXJA 3ZFVA 4UBBA 3OPKA 3T79A 3GFYA 1JROA 4DOZA 4DF8A 2PE8A 4ZPDA 3KD5E 2ZH6A 3RMCA 3OR2B 4W5NA 4DQPA 2ZG6A 2A2CA 5B08A 4Y2RA 1DLOA 1O0PA 1Y0HA 3GYXB 5DBAA 1LQ9A 4A46A 2WVEA 1YGYA 3RWUA 4U7BA 2JV3A 4I2CA 3LPEA 4IOAL 5AQVA 4WXWA 2K3IA 2F8TA 4X5VA 4K42A 5DG9A 2LA4A 2F4FA 1K0TA 4RW6A 3H8YA 1HNWK 5AIAA 1R0BG 2VPWB 3E51A 5CZXA 1BHNA 3VGMA 2CDQA 2HQGA 4LSLB 2JXJA 3AV9A 3O08A 5DS7A 3CF5L 3NTUA 1NK5A 2FZCB 1NK6A 4KPCA 2VH7A 1A77A 3M8PB 3I96A 3L95X 4KSEB 3TA2A 1JLGA 4EHTA 2YNIB 4HDHA 3EWAA 4Y2SA 3PVXA 4V1Ak 3DLRA 4BREA 4WP9A 5H9FK 3SSQA 4A8QA 1WC1A 1RWNB 3DV9A 3TX0A 2DBYA 4QZDA 1S76D 4IQXA 3HRGA 1E4GT 2V34A 3W9JA 2BE2B 1SZHA 5AQIA 1ASUA 4C11B 1GO3F 5M1NA 1XO0A 2OD6A 2Z2YB 4USWA 4LFCK 2PFPA 1BG3A 3UD4P 1DJ0A 2RU3A 1Y5IB 3E2EA 5ALOA 3M6UA 3ZDCA 3K8WA 2MSSA 3CQ8A 2XHCA 3AO4A 4I69A 2V5HG 4DV4F 2J8AA 3HBTA 2UVWA 2Q0RA 5AKIA 2JFDA 2QKKA 1MLAA 3TUZC 4U67L 2L41A 3W65A 3ZDAA 1HPZA 4EU0A 2ZHBA 3CJKA 2MJUA 3IFRA 1GT8A 4O3PA 1JKHA 4X65K 4JI0K 3OYNA 2BKPA 4KHPK 3CXCM 4TUSA 2PA8D 2BKEA 2A40A 1U0HA 4B9MA 2YNGA 5ALPA 4BG9A 4BC7A 2F44A 3PYFA 4YCXA 2FLOA 1NHKL 2G06A 5LMUF 3SUQA 3PACA 3BBBA 1R59O 5SWMA 2ZNZA 2IA6A 4GIBA 4DOBA 1CC8A 3ID6A 3ZX0A 5LXYA 5KPTA 1M5HA 3BDPA 4C4RA 4QPXA 2ZOFA 1YZ7A 2GAHC 2LM4A 4USUA 3N79A 5AZIA 2G5IB 1T6DA 3VEZA 3ZO7A 1X9JA 5J2PB 5HBMB 2RF2B 4B3TF 3AAQA 3BH7B 5ETSA 5HAOA 1A0OB 3T7ZA 4B3MF 3BEXA 5KFUA 4XDDA 4USTA 2MTLA 2UUWA 5D4BA 2E5LF 1VC6A 3Q23A 1AFJA 2R18A 2AZ3A 2Z8QA 4NXZA 4WFBL 3TANA 4B3MK 4TY8B 1ZQKA 1RAHB 2CPJA 4CJWA 1FIQA 1LVHA 1YI2S 1OVQA 2FZKB 2XRIA 1T8EA 3PFEA 4K50A 4AL5A 3DN9A 1FT8A 1SJ1A 5J2GA 4PYDA 1VJ5A 4AILC 2VBYA 3UQ0A 3I55N 2HBRB 3LH2S 2BGGA 3TTCA 2HFNA 1QUPA 3PY8A 3I55S 2QN6B 4KHSA 2WONB 5F1XA 2HGLA 1MW7A 4BRCA 1MQ2A 2EXUA 1FERA 4IFEA 5D46A 1OSDA 4AYBD 3UMCA 3PO4A 5J0WA 4IR9A 1HI0P 2HS3A 1Q46A 2F65A 5E33A 8ICOA 1B70B 5AKHA 1KVBA 1NKEA 4CFDA 5CAAA 2D0CA 3MPVA 2UXBF 4A2AA 2O1PA 2R7RA 2BOPA 2Y1JA 2HQFA 3HX9A 1U25A 3U9DA 2ZIXA 4KO0A 7ICMA 4J9OA 2N1RA 1YTYA 4OLAA 3J7ZT 4Q0BA 3RRGA 5KFPA 2CPFA 5J2AA 3NGZA 2AYGA 1XU4A 5I42A 3HSTB 4JV1A 4F04B 2MKYA 3TFRA 3W63A 5HOOA 3Q8PB 5LSLA 1X5OA 4X62J 3P39A 3JPPA 2QA4S 5FD1A 5HP1B 3CJTA 1XN9A 4KLOA 2ERRA 1VQ9N 3ETMA 3TYTA 3K58A 3RW6A 2IJRA 1KDNA 3CC2S 2V63A 3KWGA 5KT3A 3JPOA 4J2AA 3UCZP 2K8AA 4S0MA 2HSTA 2CQ4A 1S9FA 4F9OA 1B0XA 3GJSB 4Z7CA 3V81B 4QS8A 3KKFA 2MZ1A 3A0BU 2GCFA 1U2VB 4IKFA 3UW1A 4CO3A 3LP2B 4CF0A 1TR0A 3Q2SC 3HTVA 3QZ7A 3MM9A 2IYIA 5IXUA 1G3OA 5IQ6A 4YMOA 2EQYA 5KGXA 3HHNB 5HVHA 3PUFA 1N61A 2CNLB 4RT2A 3J7AP 2XNRA 5J1EB 2FQQB 2PKEA 2CAJA 2MKSA 3LP1B 4R63A 1ZA1B 2EG1A 5HQ8A 1IO2A 2XG8A 5GAHP 4TKTA 3HVWA 3PKMA 1BPEA 4FVMA 1HR0K 4ILRA 3N6MA 4MYUA 3OYAA 4ER8A 2XSFA 2E44A 3MFHA 1UFKA 4RUBA 5KAIU 4OX9F 3KUEA 2KH9A 4EBCA 1GLCG 5GAEU 2C3PA 2M9NA 4BRGA 3CERA 2FJAB 1L6NA 1DTTA 4QZEA 4WZMA 3JSMA 5IT9U 4E3SA 1VK0A 4LF8F 4YD1A 2E2PA 3AOAA 2BRKA 1A6LA 4XEIA 1K8KB 4UARA 1I3OB 3GIIA 2M4MA 2QV6A 1WC3A 3H20A 1B43A 1QJHA 2WOMB 4LF9J 2HRUA 4LF8K 2LXFA 2I6XA 2XVTA 4KHYA 4LSNA 1MN8A 4BR7A 4PL1A 4M3UA 4RPYA 2JVOA 4DR1J 5HROB 1NOYA 1OUQA 3EZOA 4UUWA 3HKZD 3PRDA 2IMWP 4Y2AA 3CRXA 2QA4N 2DIVA 4C0BA 4C6AA 1ZXIA 1X9SA 3OL6A 1BHLA 3DI6A 1RKIA 4KI6A 4CESA 3RMBA 3AXKA 5AZJB 3WXIA 3PX0A 1U0SA 2D0OA 1J2VA 4JV5K 3VQ5A 5AI8A 4K41A 5KT4A 1NRKA 4BGDA 1ZA2B 1R8PA 2V2QA 2BJ8A 4UB1A 4DX8H 4ATNA 5C10A 3MEKA 2YXLA 3R5AA 1U45A 4A8FA 3QQCD 2F4VJ 4C7ZA 2HB5A 4ANDA 4KLMA 4MT1A 4LUBA 2ZXHA 4PR6A 3IWNC 4OGEA 1SXLA 3CO0P 4TSXA