2HHTA

C:o6-methyl-guanine pair in the polymerase-2 basepair position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhtA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhtA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhtA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhtA01
9ICJA 2VG6A 4O3QA 4NLKA 4DL5A 2EX3A 3HT3A 2YKNA 4NCGA 4NY8A 3S9HA 3NHGA 1BIUA 4FBTA 3SQ2A 2YNHA 1JLBA 4UAYA 5KGXA 2WOMA 3Q8RB 3KLEA 1LAVA 3I0SA 2E6LA 4Q8EA 2KZMA 3ISDA 4B9TA 5K14A 7ICTA 3CFPA 2ZJ5A 4KLHA 4ZHRA 3UXNA 1ZBLA 4J2BA 2O4IA 5J2DA 3KD5E 3KK3A 2FLNA 2D0CA 1UA1A 4NYFA 5I3UA 3LP3A 3MR3A 4J9RA 3MXMA 4E7KA 2G8HA 4OPKA 4KHQA 7ICFA 5DB9A 4Z6FA 2W8LA 4DSEA 2G8KA 2J6TA 4RT2A 4YR3A 4DU3A 1RYRA 5CHGA 4LSNA 3WNFA 1NOMA 2LYHA 2NRWA 3KK1A 2XGPA 3TAEA 4UBBA 2ZD1A 4CHPA 1N5YA 1LB2B 2HHWA 1JX4A 4RQ1A 4RQ5A 4RU9A 1NK8A 2FBVA 3G0ZA 1BHLA 5J0YA 3H40A 1S10A 3VN5A 4KFBA 3LZJA 3T5KA 4QWAA 5KFJA 1S1XA 3EYZA 3T5HA 2G8VA 4DQRA 1VSJA 8ICVA 4QZHA 1WSHA 3ULDA 3PW5A 2P1JA 4FM1A 3MGIA 1ZQJA 3L2UA 3IM1A 4NCBA 3GV8B 7ICIA 7ICQA 2FMSA 4CEQA 9ICPA 2R8GA 4YQWA 1S9GA 3OHAA 4KHUA 1BGXT 3TR8A 1A5XA 4TSXA 3ZD8A 4QOZB 4X5VA 1Y97A 5J2NA 4AHTA 1RXWA 3HPHA 2W42A 5CWRA 4DFJA 5J0QA 4FW1A 3C2LA 4K4HA 5KFQA 7ICVA 1J9AA 4I2IA 1RTDA 3KLFA 3RH5A 4FJNA 3KTQA 1VSDA 3FDSA 1S6QA 4Z6DA 4B9SA 3D0PA 3HL8A 2D0AA 5KFGA 4KLIA 1DOQA 1JLEA 1WCNA 3V6KA 9ICCA 2YV0X 2W9CA 1ZBHA 5KG0A 5DGBA 3T5JA 3HP9A 1ZBUA 5HNKA 3OYCA 1DTQA 4DL4A 3PO4A 2MUTA 4PWDA 4FJ5A 4ICLA 2HNYA 3SPYA 3NGDA 4HVJA 2JLEA 1LWCA 4KAZA 4NYNA 3V9WA 1S9FA 3BQ2A 4OGCA 4FJHA 3AVGA 4H4OA 4FM2A 4EZ6A 1EXNA 1NKBA 4N56A 3TAQA 1U47A 4DSKA 2IC3A 4CJKA 2PYJA 2PFOA 1ZQPA 3TARA 1JLGA 2ZUCA 4M9HA 3QNNA 3QEBZ 4RQ3A 1TAUA 4PHEA 3BQ0A 4I2BA 4KLLA 2NRZA 4R8UA 1FXXA 4J9OA 3E01A 4CGGA 8ICWA 3ZDBA 4MF2A 1G15A 5J2PA 3VQ4A 3MR2A 2DTUA 4ELTA 1VSMA 2QKBA 2PI4A 5KFFA 2YNIA 3V9ZA 2GWSA 2GV9A 2VWKA 3TWHA 1S6PA 4E7IA 3ZSWA 3OGUA 4DMNA 3E2EA 4I27A 1ZJNA 9ICOA 8ICNA 3NDKA 4ID1A 2A1JB 4Z4HA 4F2RA 4NM1A 9ICWA 5KFTA 5KFPA 4FS1A 3AVNA 4Z4EA 1RT6A 1HYVA 4LZGA 3AO1A 3RMAA 4NCAA 4FLWA 3RRGA 1VSLA 1LV5A 1HJRA 2HMIA 9ICSA 1RCHA 3HWTA 4BE1A 3G6XA 2FBTA 3RJGA 5JUMA 2C28A 4KLJA 3PX4A 1T4GA 4QZIA 2WONA 3NH2A 3MAQA 4JWMA 3V6JA 4KN7A 5CA7A 1XI1A 1IO2A 4TUQA 4FYDA 3VQEA 2ZTCA 3JPNA 3SUQA 1DGSA 3KHHA 3MFIA 3SJJA 1NK9A 1SL2A 5CZ2A 3RR8A 2JGUA 2YKMA 4CF2A 2AQ4A 2XY5A 1SKWA 5J2FA 2X6SA 4K4IA 5KRTA 3PVXA 1REVA 1LWFA 5KRSA 4MEXA 4F4ZA 3AVCA 5KG5A 3ASMA 4J2AA 3AO4A 4FK2A 1MQ2A 3I8DA 9ICHA 3DRRA 4Y1DA 4RPYA 1ZQNA 8ICLA 4O4GA 4CGIA 3VQ9A 1BPBA 4FJKA 4XIUA 4F4KA 5DB6A 4CJLA 2BPFA 3AO2A 4K4GA 3F73A 3BDPA 2F8TA 2IGIA 1Q9YA 1UT5A 1ZQXA 3DM2A 4O5BA 2ZTDA 4CJ5A 1C1CA 1JLCA 3AVJA 3ITHA 1PZNA 1S0NA 3N97B 4IRCA 4RT3A 4DTNA 2IOCA 5DG9A 3PY8A 4AHUA 1NKCA 3S3NA 5KT7A 3M8PA 3NF8A 4UB1A 3MBYA 1RT3A 3L2RA 4CGFA 4GC6A 2ISPA 4DLEA 3IG1A 3OYGA 4FJ7A 3KLHA 2XY6A 3TAMA 4XA5A 4KB0A 1RBRA 1Z00B 2YNFA 3AO3A 4IG3A 2BDPA 5FDLA 2ASJA 3U3GA 1S1UA 3HPOA 2BANA 3C1ZA 1A5WA 4IFVA 4DTMA 4F4WA 4KRFA 3C1YA 5HLFA 4QZAA 3AVMA 3JPRA 1MSWD 2LSNA 1W0HA 3WNHA 3G6YA 5KT3A 1HNIA 4GC7A 1RBSA 1N48A 4BACA 4R65A 4KLSA 1RXVA 3DOKA 5I42A 3T3FA 2F96A 4IQTA 2XCPA 3HPGA 9ICVA 4CEZA 3RJFA 2HHVA 4CJ3A 4FO6A 3BGRA 4CHQA 1ZQDA 4O0JA 4W5TA 3OYLA 1ZYQA 4PHAA 8ICQA 4CF0A 4H4MA 4AHVA 4KMUA 2W9BA 3RB4A 4KLOA 1T8EA 3ZSRA 5JS1A 2Q0ZX 4IRKA 4Z4IA 1XS9D 1RTIA 4QZFA 3ETLA 1KCFA 2KZZA 3F9KA 2AGPA 4EEYA 9ICIA 4N47A 4FJMA 4W5OA 5KFHA 3NF7A 3SZ2A 1CZ9A 4DTOA 2KQ2A 2A1JA 2XGQA 4ECTA 4E0DA 1HUZA 4IDKA 3O4NA 5DBAA 1N56A 3GIIA 3C2MA 4C8LA 3M8RA 2V4QA 4DU1A 4IR1A 4RPZA 5DLGA 1Q9XA 5F9LA 4MFCA 7ICGA 9ICLA 3M9MB 1XWLA 2VA8A 5HBMA 4ED7A 1S1WA 2ZQBA 4BDYA 4ECZA 4CJRA 4QZEA 4Q0BA 4CJVA 4UQGA 2KZ3A 2ZUDA 4MF8A 1ZQRA 8ICJA 4CHNA 1ASUA 1L5UA 3EY1A 3RMDA 4B9NA 5IILA 1VSKA 3HVRA 3V7LA 2ETJA 3JSMA 3JPPA 1BI4B 1JMSA 1BQNA 4W5QA 3JYTA 4F3TA 4FLTA 5DKWA 2DY4A 3WNEA 1Z25A 2PYLA 7ICNA 3RB3A 5KT4A 3V1QA 4CERA 2P6UA 2RPIA 1ZQMA 2KN7A 3PMLA 3PW7A 3Q8PB 3ZSQA 3SV3A 4JS5A 4YFKA 3MEGA 4CJUA 3FYHA 2G8UA 4F5PA 4ELUA 4M41A 1YT3A 1XU4A 4DSJA 4PA1A 5JS2A 4DWIA 4DSLA 7ICUA 3NF6A 1R0AA 4E1NA 4KREA 2B4JA 3WNGA 4IKFA 5E41A 1BCMA 5C42A 5EWGA 3L3VA 1XHZA 2DFEA 4CHZA 9ICAA 3RH4A 4BGDA 4E19A 3QZ7A 5HP1A 9ICQA 3QESA 4M3UA 4RW7A 8ICGA 7ICKA 1X9WA 1D5AA 2OYQA 1UAXA 4G3IA 5L1JA 2QK9A 3HX0A 3PW4A 5J0PA 2PY5A 2OPRA 3RTVA 2XHBA 2R8HA 3MFHA 1KSPA 1MQ3A 1ZQEA 3OYAA 1WSJA 4FJ9A 4CK2A 5KT5A 3H4DA 2FLPA 4B8CA 3AU2A 4HTUA 4M3ZA 2BGWA 2I9GA 3TAPA 2G8IA 1RBVA 2AJQA 4RW8A 3B6PA 4OLBA 2A1RA 4PHDA 5HP4A 3K75D 3O3HA 4ZH4A 3LPUA 5D46A 4YNQA 9ICFA 4KLMA 1AROP 3QIPA 4DFPA 3QETA 1RT1A 3PNCA 2BQUA 3ZCMA 5IIJA 5CR0A 3AA3A 8ICAA 1IKYA 1RT4A 2D5RA 4JV0A 1WSEA 1ZETA 4JK1A 3CG7A 1C1AA 4DTXA 4J9MA 3SUNA 4NLNA 4PY5A 4BE0A 3KHRA 4M3XA 1NJYA 3UXOA 4R63A 2Q3SA 4EBCA 4CJWA 2IA6A 5DK5A 4FLXA 8ICZA 2I5JA 4DQQA 2OA8A 3UQ0A 4F5QA 2P51A 1LAWA 3SQ0A 2AGQA 4I2AA 5J2MA 1C0TA 4CE9A 1HMVA 1BQMA 1TV9A 3MEEA 2F1IA 1ZQBA 2D0BA 4E1MA 4CJSA 7ICLA 1NJWA 4JWNA 3ZSOA 3M8QA 3P5JA 3CM6A 4I2EA 1C6VA 1HUOA 4O55A 1B22A 3V9XA 4C8NA 1RBTA 4TQRA 1EX4A 9ICRA 4CEAA 3ISNC 3UXPA 8ICMA 5J2EA 1ZQQA 4AHRA 1N6QA 2KFZA 3NH0A 4JLHA 4PGYA 4KLDA 1YTAA 4CEBA 9ICXA 3ZD9A 1J5OA 5IIKA 4J9KA 4O3RA 4FLUA 4CGDA 5L1IA 8ICBA 3CFRA 1X9SA 1JLFA 3DRSA 4CF1A 3QEPA 3L3UA 1KVCA 4M3WA 2HNDA 4O5CA 7ICRA 2RN2A 2JZBA 3C95A 3PV8A 2P5OA 3HXMA 4M9LA 1SUQA 4EBDA 3A2FA 4DF8A 4DSFA 2I1QA 5L1LA 2X6NA 1BPYA 3QEIA 1RDAA 4FLYA 5HRPA 5J0TA 3UQ2A 3LP2A 3ZSXA 3M9OB 8ICEA 5J2GA 1JKHA 5KG1A 2IS3A 4K8XA 1DTTA 3NH1A 3HW8A 4HUGA 4J9SA 1IKWA 4UAZA 1S77D 3PMNA 4FZZA 4KO0A 4QZDA 4MFFA 9ICNA 4NM2A 2ATQA 3O3FA 1A77A 3ALYA 4J9LA 2FBXA 3JPOA 1RT5A 3TQ1A 4JS4A 3OSNA 4DOCA 3T1AA 4TQSA 4DTRA 1TAQA 1S0OA 3C5GA 2X78A 3RB0A 7ICJA 1TVRA 3DLBA 1ZQVA 4I2JA 4DOAA 1K1SA 3DMJA 4YR2A 3AVLA 5J0WA 1RT2A 1BVSA 1RNHA 4QW9A 4UB4A 2ITGA 4EP4A 1TK5A 4FBUA 3OSPA 1L3UA 1KEJA 4GXIA 1NJZA 3GILA 1S0MA 1UA0A 5DQGA 3SYZA 3OS0A 4RZRA 5FRMA 4YVZA 3VA3A 2ASDA 1L3SA 4O44A 2R8KA 1KDHA 4C8MA 1IH7A 4LD0A 8ICKA 1TL3A 2HHUA 3LALA 3QNOA 1ASVA 4QZGA 2Z1GA 4F3OA 4IQVA 2DPJA 5KFLA 4LY7A 2G8FA 3OY9A 5IINA 4M3RA 1TFRA 2HW3A 4RUCA 3ZT1A 3HVTA 1I39A 1IXRA 1TK0A 2HVHA 2OPPA 2FBYA 3DOLA 3BQTA 3IAYA 3DLKA 2NUBA 3RMCA 2R8IA 1YTUA 3H8WA 4KLTA 2ASLA 5KG2A 4CJ4A 3UPQA 1EXQA 1IG9A 3IS9A 3JPQA 4PUOA 5KT6A 2ATLA 3SPZA 4BDZA 2OPQA 3B0XA 4QWCA 4LZDA 3Q8KA 1EKEA 1UOCA 4NLZA 4IBNA 1JIHA 4M6WB 4CIGA 4M3YA 3HK2A 3V72A 1D9DA 4LH4A 4M42A 5DG7A 3NE6A 4FCYA 4GXJA 5KFXA 4PHPA 1A76A 1SV5A 1C1BA 4YXMA 4QZ8A 2EHGA 3AVBA 1TKTA 1ZQGA 3K4GA 5HRRA 3TFSA 1RT7A 5HMLA 8ICHA 4Z4CA 2BCQA 4ED3A 1RDDA 2E4LA 1ZQWA 1A5VA 5KFRA 3V9UA 5D49A 2BCUA 2V9WA 3C21A 2G8WA 3V1RA 4M2YA 4HHTA 5KGWA 8ICSA 4LH5A 3H4BA 2YHAA 1VSIA 3ZDAA 2ZUBA 2HVIA 4ED6A 4YP3A 4P4MA 3ISBA 3AVAA 5EWEA 5BOMA 4ECUA 3KKSA 3OYMA 4KTWA 5CZ1A 2PFNA 1HNVA 1HRHA 5FROA 1LWEA 4FM0A 3OS2A 4DEZA 1WN7A 5KFDA 2JEIA 3PUFA 4ECXA 3KIOA 3EPGA 3LAKA 4O3PA 2AU0A 1QS4A 3SNNA 4KLGA 1JXBA 9ICUA 4K8ZA 4CFDA 4DF4A 1DLOA 1W9HA 2B5JA 2KW4A 3O4QA 3B0YA 9ICTA 4OPJA 1FKPA 1C0UA 5J2BA 3T5LA 5IIOA 3HM9A 4O5EA 2JEFA 5KFCA 1ZQOA 4DQSA 3HP6A 1V9PA 5DQIA 2F1HA 2BKEA 1NK5A 3EZ5A 2HNZA 2PZSA 1VK0A 3QE9Y 4B9LA 3OYBA 4QZCA 3SQ1A 4RPXA 4DG1A 3OYIA 3OYHA 1TKDA 3VQPA 3OS1A 4TUPA 4DQPA 4KTZA 3QEAZ 3OYDA 2XY8A 4RUAA 4ZTFA 3MABA 4CK3A 4KN4A 2Z1JA 4I7FA 1SL1A 4B08A 4F4XA 2UVUA 4CJPA 4I2PA 1S97A 3AA5X 3M9NB 4AHCA 3C94A 1J53A 1Q8IA 4DU4A 1X1PA 4E3SA 4F91B 4CF8A 2Z1HA 2FMPA 1JLQA 2DFFA 3ZT4A 3GQCA 3QEVA 1HJPA 3SCXA 4I9LA 2B21A 1ZBIA 1ZQFA 4DTUA 4OVLA 5KG7A 4BXOB 4OKJA 4ECVA 4Q5VA 3LAMA 4F92B 3OYNA 3JPSA 3ZDDA 5DBCA 1ZQAA 1QSLA 4DL3A 3RAXA 3LK9A 3NGYA 4ECQA 5SZTA 3K5LA 4DOBA 5KFNA 4PPXA 3TI0A 4RNOA 5BOLA 1ZQIA 3S3OA 1NK0A 2F8SA 3CM5A 3V81A 1KVAA 2ZTEA 3PR5B 2MAXA 4CIEA 3RJJA 1XC9A 4M6WA 5C5JA 2QKKA 4N5SA 3H8JA 5IIIA 2FC0A 5TZVA 3OYFA 2O4GA 2OWOA 1T3NA 5J2HA 1CXQA 1RDBA 4CCHA 4R5PA 5HMMA 4F5OA 5J2QA 1VRTA 5DDYA 4R66A 5J2IA 3P83D 1TVAA 3K5NA 4FZYA 1ASWA 8ICCA 3PW2A 4EP5A 4DFMA 1HYSA 3KJVA 4IQWA 1WLJA 7ICHA 1GOCA 3AVFA 1ZQZA 3QINA 1VRUA 4RQ4A 5BPCA 4C8OA 1ZJMA 4KPYA 1U9LA 5J0SA 2XRIA 3I0RA 3QEWA 4FJIA 2AQ0A 3K2PA 3V7JA 4I2FA 2FMQA 3LPTA 2PFQA 4HUEA 3NCIA 2IHNA 5J0RA 2HHXA 1KTQA 3TABA 1RDCA 1Z00A 4DL2A 4Z4GA 4GVMA 4PH5A 3PX6A 2ZE2A 4J9PA 4QWBA 2W9MA 3ZT3A 4E7JA 3DLHA 4CESA 4JV2A 4TURA 8ICXA 3AVHA 3ZSZA 1SZPA 1ZQYA 4ECWA 1S1TA 5HRNA 1ZQTA 3KK2A 4CJFA 4M9NA 4CK1A 1CUKA 3VQ6A 1KFSA 2BQRA 3RAQA 4ED0A 3L8BA 5CP2A 3CFOA 4GW6A 1RTJA 3HSTB 1X2IA 4FJJA 2C2DA 4FJ8A 4DS4A 5DLFA 3SI6A 4JRQA 4IG0A 3IHQB 1L3VA 3RBEA 5SWMA 4B3OA 4DS5A 4OJRA 1CEZA 3RRHA 2C22A 1J54A 1BPDA 3VQCA 5C25A 4FJGA 2IHMA 1TK8A 3HJFA 3H7IA 4RQ0A 1JXEA 2DFHA 1B9DA 4ECSA 3KLGA 8ICYA 4YXJA 1SKSA 3L2VA 4CEEA 1WCLA 1X9MA 4RQ8A 2DFLA 4KLEA 1NK6A 4QZ9A 1SL0A 9ICKA 5KFEA 3OYKA 4PGQA 3Q8QB 4RW4A 4EZ9A 2XO7A 5FRNA 4CJEA 4DQIA 2R7YA 4ZTJA 2BPCA 9ICGA 2IMWP 5J0OA 1EP4A 4UAWA 2JEGA 4C8KA 4ED1A 3K5OA 8ICIA 1WNSA 4CGJA 1Z3EB 2FPMA 1JN3A 3VQ7A 4BXOA 4O0IA 4I2QA 3NF9A 3EWAA 1K6YA 4KKOA 3VQ5A 4YCXA 4YD2A 8ICOA 5KFBA 1ITGA 1WAFA 2RF2A 4F2SA 1BIZA 4QWDA 1MC8A 4I2DA 1ZBFA 4BWJA 4WE1A 4CFBA 4OKEA 1BI4A 5D4BA 4FJXA 1HPZA 1XSNA 1VSHA 2NRVA 3OVNA 5KFMA 3NAEA 5DQHA 5KFWA 3K58A 1F21A 2VWJA 4L8RB 5DB8A 1RTHA 5HRSA 1KVBA 4DTSA 4IR9A 3DRPA 3ZSYA 2Y1IA 4O3SA 4QW8A 1CZBA 4QZBA 4Z0UA 1T05A 3AU6A 1ZQCA 4ECRA 4FVMA 4B8AB 4CGHA 1KFTA 2VG7A 3S3MA 3GIJA 2P6RA 3V6HA 1U4BA 5EU7A 2PI5A 2ISOA 4KI6A 4O9MA 2H5XA 3MXJA 2VA2A 4Q43A 1Z26A 2B6AA 3C6UA 3QO9A 3ZT2A 1D8LA 1CXUA 5CJ7A 3C23A 3G6VA 2FPLA 4YMNA 4Q44A 1COOA 4B9MA 5T7BA 1RYSA 4UB5A 4ECYA 4FK0A 2Z1IA 3N4MB 4J9NA 3GIMA 4P4PA 4N76A 4FLVA 3G10A 2XY7A 4CHOA 5EWFA 3TAFA 2UVVA 5KFKA 5DDMA 4XQ8A 3OJSA 4EYHB 1LW0A 5DBBA 1UT8A 1WSGA 3JPTA 2ZJ8A 5J0UA 2BCVA 4B9VA 3SUPA 5L9XA 1VSFA 4ED2A 3LP0A 4KV8A 3AA2A 4HCCA 8ICUA 3DLRA 3GV5B 3V7KA 3UIQA 1Y88A 4YG2A 3QZ8A 3OJUA 4Z6CA 4I2HA 2BR0A 4HUFA 1TKZA 4F50A 5IIMA 1VSEA 1NOYA 1WSIA 3AVKA 1L3TA 4GLXA 1QSYA 7ICMA 3NGIA 2RDJA 3K59A 2RDIA 4FXDA 4AHSA 2VANA 2FPKA 4H8KA 4KHWA 1BPXA 2GUIA 3LWLA 2W9BB 4CEOA 4XRHA 3VQAA 3QERA 5EOZA 4NXZA 2C2RA 3TFRA 2HHQA 1RZTA 4QWEA 1QLNA 3VQDA 4M3TA 3V6DA 4DSIA 4GMJB 4Z6EA 3FFIA 2W8KA 3RJIA 9ICBA 2J6SA 8ICRA 3NTUA 3RMBA 4E89A 1IM4A 3O3GA 1B9FA 1KLNA 4G1QA 4CFCA 5HROA 3IRXA 4OGEA 2C2EA 4FK4A 7ICOA 3KD1E 4QAGA 3RJEA 1RBUA 4CECA 4MQ3A 2J6UA 3OHBA 5DG8A 2F1JA 3VQBA 4MFAA 4RW9A 4B9UA 4BWMA 4FW2A 2XC9A 2AGOA 3CYMA 3T19A 3VA0A 1BPEA 4Y1CA 3MR6A 2VA3A 2A1SA 3LP1A 3GFKB 3ZT0A 3SV4A 8ICFA 4ELVA 5J2JA 1GOBA 4LVSA 3KKRA 3RB6A 3ISCA 1XHXA 5KTQA 1U48A 2BCRA 3OYEA 2VG5A 5CYMA 4FJLA 5KFIA 3H8SA 3RWUA 1QE1A 4PQUA 1QQCA 2P5GA 3MGHA 2BQ3A 5L1KA 3MEDA 4AH9A 4RNMA 1NK7A 1ZQLA 4F8RA 3Q8SB 1TKXA 4YMMA 3MECA 1ZQHA 3P1GA 3GV7B 1MU2A 1NK4A 1FK9A 1TL1A 1ZQSA 5D3GA 4W5NA 3D45A 3MXIA 4IFYA 2YNGA 5J2CA 3M8SA 2HHSA 3KLIA 1EETA 1K1QA 4UBCA 4KI4A 5DMRA 3K57A 4E7LA 2IBKA 4P2HA 2QXFA 3ORYA 1BISA 4F5NA 4AILC 4PGXA 1U04A 3ZSVA 4JRPA 2JEJA 5J0XA 5KFUA 3MDAA 1S0VA 1T03A 3QLHA 4N41A 3BQ1A 3AUOA 1FKOA 4CEDA 4M45A 3NBPA 2OZMA 2P66A 1ZQUA 4MEYA 1KRPA 2RKIA 2OPSA 3L2WA 4P4OA 5CB1A 3PO5A 5J1EA 5F9NA 7ICPA 4NLGA 4RQ6A 2KTQA 2W9AA 4FS2A 4M04A 1S76D 4CHYA 4CIFA 3DLGA 1IKVA 4DO9A 4UB3A 2ZJAA 4O5KA 4FLZA 4F93B 3C5FA 2HB5A 3DYAA 5KFZA 4RG8A 3LZIA 4UB2A 4IQUA 4CFAA 4KLUA 1JLAA 3V9SA 4GXKA 4M9JA 1D9FA 1TGOA 3AVIA 2IDOA 4J2EA 4DFKA 4RQ7A 4YN4A 4J9QA 4YMOA 3RJKA 4CJQA 4HCBA 5J2KA 4KHNA 5HHHA 4O3OA 1WSFA 2WTFA 1NKEA 1B92A 5J2AA 3LWMA 5KT2A 3KHLA 3H08A 4Q45A 1U49A 4EYIB 7ICEA 4OKKA 4DTJA 4BE2A 1T7PA 1LW2A 3LDSA 3C6TA 5HHIA 1GOAA 4RQ2A 4W5RA 3L2QA 1B43A 4I2CA 4DLGA 1UWBA 3QEXA 1D8YA 2BPGA 3PX0A 2UVRA 3EW9A 1QTMA 4BDPA 1XO1A 1KFDA 2Y1JA 2PFPA 4DL6A 3NFAA 4J2DA 3TAGA 1SKRA 2V4RA 4KHSA 4KHYA 4QCLA 3V4IA 3RH6A 4I29A 2HHTA 5CYQA 1BL3A 3MR5A 1CLQA 3KHGA 2OZSA 5DGAA 4LSLA 4F4YA 3LDAA 3AV9A 4IRDA 4XUSA 3C2KA 3DI6A 8ICTA 1HQEA 1S9EA 2E6MA 4CF9A 4R64A 2YHBA 2NRTA 3AO5A 3SUOA 4EBEA 3SQ4A 2BHNA 4RW6A 5KFSA 3PW0A 5J29A 1QHTA 5KG3A 1NJXA 3Q8MA 1NOZA 4O3NA 3HYFA 4CEFA 1RPLA 3Q8LA 4E7HA 4HYKA 7ICSA 4I2GA 2X74A 5KFVA 1BPZA 1JL2A 4KITB 4M9GA 1IKXA 1BCOA 1RILA 3OYJA 4Z4FA 1U45A 3GIKA 1C7YA 1HQUA 1I3AA 5KG4A 1JXLA 4KLFA 3LANA 3VQQA 4YFUA 4ED8A 1ZQKA 1S1VA 4DTPA 2PXIA 2UVWA 2KFNA 4JUZA 3DLEA 4DL7A 3TANA 3EPIA 4TUSA 2BCSA 5KFOA 1YVUA 5C24A 3K5MA 4JV1A 4F5RA 1C0MA 4CJTA 4YR0A 8ICPA 5CY4A 4ID5A 4Q8FA 2JZBB 4KLQA 5KFAA 2FLLA 4KB1A 3HO1A 9ICEA 3V1OA 4M47A 2W9CB 2BGGA 3SI8A 3U6FA 3VQ8A 9ICMA 3U3YA 2XCAA 2MUTB 4KTQA 5KG6A 3PR4A 1XSLA 1S5JA 3RR7A 1WAJA 3AA4A 2M9NA 4OLAA 3RJHA 3QIOA 2ALZA 3RBDA 1O1WA 2NRXA 1H38A 3ZDCA 4I28A 1KLMA 5KFYA 3MDCA 4YD1A 2DPIA 1JL1A 4M0AA 4FZXC 4MFBA 4I9QA 2BE2A 1TV6A 1XSPA 3ZDEA 2IAJA 3GDXA 3BJYA 4R8UB 3NGZA 3CQ8A 1HYZA 3B6OA 3THVA 4RNNA 5DB7A 5KI6A 1QSSA 2R8JA 2GBZA
chains in the Genus database with same CATH superfamily
2CG4A 2ALYB 4DL5A 2FVQA 2EX3A 3HT3A 4DV5K 2YKNA 4NCGA 1P90A 2LI6A 1B0VA 3S9HA 1BIUA 3ONQA 3DU6A 3O5BA 3TZWA 3FZLA 3ICXA 3Q8RB 1HI1A 1N0VC 5JVHQ 4Y2XA 1LAVA 2D7SA 4KR0B 3G8TA 4FKXA 2DPNA 4Q8EA 2GCFA 5K14A 3K7RA 1MDUB 4ZN1A 3GFYA 2YQEA 3CJKB 1G1XA 2X7IA 2CZ9A 1XR5A 3TP2A 3KK3A 4C6AA 1SC6A 2R4FA 4NYFA 1CJKB 3CD6S 3K0JA 4ZLNA 1F9EB 3VESA 4F71A 1O08A 2YX1A 2W03A 3IA0A 3KNGA 3DGPA 4O8UA 4EK2A 1RYRA 1NEEA 1R8AA 3WNFA 1IV8A 2XGPA 4X4VA 3TAEA 3N7PD 3DDKA 3AA8A 4H0OA 4M5KA 3CNQP 1NK8A 3IS9B 2R7QA 1IV0A 2JGAA 5J0YA 5D6GA 1KQFB 1NGDA 4O3MA 4WTOB 4CD3A 4PYAA 1M5VC 3EZWA 1LEOA 1U0SA 8ICVA 4GKJF 1WWUA 1T3OA 1WSHA 1RUSA 3ULDA 1WKJA 3EZUA 4FM1A 4NCBA 4DR2K 3GV8B 5K5MA 1U0HA 3QFPA 2F44A 4RQMA 2R8GA 4YQWA 4KRWA 1N32J 3AT1B 1NSQA 1S9GA 2F76X 2CXEA 2DNQA 3BSNA 3WQUA 3Q2TC 1BGXT 3TR8A 1C1CB 3DKDA 4TSXA 2ZVIA 1MG7A 1RJJA 5J2NA 2VB6A 2NO4A 4IO8A 2W42A 4PEOA 5CWRA 1U1RA 2RLTA 4F4AA 3C2LA 3D2FA 1RTDA 2DCUB 4HHHA 1YQHA 3JB9k 1S6QA 4Z6DA 4B9SA 1U8SA 2CPRA 3NGTA 3HL8A 1JUDA 2D0AA 2FJXA 3VAKA 3KLHB 2DNHA 2H5EA 5A0YB 4KLIA 3L4QA 1DOQA 4X65J 1WCNA 1HBOA 3GL1A 3V6KA 1EKSA 2W9CA 5KG0A 3OR1A 4UZCA 1NO8A 3BS9A 2MUTA 3NCQA 4ICLA 1XJWB 3NGDA 2V4JA 5T41A 5IV4A 1LWCA 3KD3A 2XS7A 4G1PA 3AVGA 2FHJA 4H4OA 1R8BA 4G1IA 4FM2A 2R7OA 3DOKB 3MR7A 3TAQA 4DSKA 3MAAB 5KPZA 2PFOA 1ZQPA 3LM9A 1JI7A 3TARA 1MWMA 4GRSA 1L8OA 3QNNA 2W1BA 3QEBZ 4RQ3A 2V2ZA 1TAUA 1EARA 4PHEA 4KLLA 5LMUK 2OFGX 3EO3A 4AYBF 2HAFA 3BBFA 8ICWA 2E1CA 2HMPA 4KX5A 1AQ6A 1G15A 2YHXA 2FZGB 2DJWA 3DXBA 1KHWA 5D0HA 1X8DA 2HWTA 5ADXH 2YNIA 2P9SA 3IO1A 1X40A 1UQVA 4USHA 4ZP9A 3MM9A 4PXCA 4EX6A 1KBRA 1MW7A 1WHWA 3L09A 3EUB2 3E2EA 4B3MF 3NDKA 4X64F 1HPMA 4WFBQ 2V5HG 2F1FA 4F2RA 4NM1A 3C29A 5BREA 4JHDB 4NCAA 2FUG9 2KHCA 2K7KA 2E9ZA 2HMIA 2MJNA 1BXNA 4JAXA 4I68A 1EQYA 1WKLA 3HWTA 4BE1A 3GMGA 8AT1B 5JUMA 3GFHA 3S1TA 3DXKB 3I55N 3H0RB 1UW9A 4HWIA 4HI2A 1SXLA 3R27A 3FRZA 2WONA 3MAQA 4Q0BB 3NH2A 4OYMA 5B0DA 1A0PA 4NZ6A 1XI1A 2HOIA 4TUQA 3ZETB 4FWKA 2ERRA 2G07A 3MFIA 3RR8A 1FJEB 3JYTB 4JI1J 3P6YC 2V8DA 4A8EA 2QB0A 1SKWA 4K4IA 3PVXA 3FC4A 2DKOB 3ADAC 4IOAL 3JXUA 5ETRA 1N54B 3ASMA 3BSAA 2OSRA 5ETVA 4FVUA 5KAFU 3UVJA 3KDNA 3B54A 3DRRA 4ZDNA 4USMA 1WC6A 3IM9A 4Y1DA 4RPYA 2V2QA 8ICLA 4O4GA 4K0KJ 5ETMA 4ZVSB 2I6WA 4DUYK 4FJKA 1WC3A 1B64A 1DXSA 4K4GA 3W2WB 3F73A 2NZ4A 1TL7B 3W0LA 3BDPA 5L8RC 2F8TA 1ZQXA 4O5BA 1R8CA 2UYTA 4W92B 1WKKA 4LF9K 2KJ8A 1WI6A 2FJAB 1S0NA 3N97B 1VRUB 2J9DE 3OR2A 3MCAB 4CGZA 5HP1B 3FBEA 5DG9A 3PY8A 4AHUA 2IVPA 4EO6A 2ROGA 4GNIA 1Z2ZA 2NXEA 2HS0A 3MF5A 3R1XA 4CGFA 3T1HJ 3DU5A 2RE2A 5GADI 1XNRJ 2LP4A 1Z00B 2OPRB 1T11A 2ZG6A 4ALZA 2PN6A 3QMLA 3C16A 4P9SA 2G09A 3U3GA 3QFWA 4CO4A 2Q1LA 4F4WA 4YOXA 4PZNA 4UAVA 4QZAA 5HLFA 4ETZA 3JPRA 3R8YA 2FGCA 5KQDA 2K8BB 3B82A 1TL4A 5AQWA 4GVBA 4U96A 2BW2A 4BRNA 1N48A 5IWAK 2JJ4D 3T3FA 5FLXY 3W5YA 2F96A 3H42A 1KN5A 1RTJB 3VQSA 2ZITA 3I9ZA 1JJHA 3OTOK 1Q8LA 5L46A 9ICVA 3MMJA 3O3LA 4IG0B 4CJ3A 1RE1B 5IV3A 2VQFJ 3SCLE 3ZZYA 3G4SS 4W5TA 3OYLA 2O1PA 4H4MA 4BG9A 4X62J 3PM9A 2W9BA 4F3MA 3RB4A 3P49B 5AQRA 1EKRA 3LDOA 4DMZA 4WXOA 1XS9D 1RTIA 1KCFA 1SIWB 2AGPA 3IR5B 2C3OA 4FOIA 3FSXA 4NXMF 4W5OA 1RHRB 2YVSA 4MN4C 4RW4B 2KE7A 3SZ2A 1HD0A 2XGQA 1HUZA 4IDKA 5DBAA 2BZFA 4DU1A 4MKYA 2LLZA 2KT5A 1C0TB 3RRKA 1OY6A 1XBWA 2JHDA 3M2RB 7ICGA 9ICLA 2F4VF 4ED7A 2ZQBA 4BDYA 1J5EJ 5BYQA 3SDEA 3VMFB 2LDIA 1VQPS 4I2QB 2COLA 4MF8A 1ZQRA 1QY7A 1L5UA 3RMDA 2C2MB 4IEEA 4MDAA 5IILA 2G1HA 3EXYA 1FEHA 1NGCA 2KO1A 3QJLA 3VGVA 1VQLS 4FLTA 5DKWA 1H7XA 3O8MA 4F72A 2HFSA 3QU5A 7ICNA 3FEYB 3RB3A 4NLQA 4CERA 3C66A 4X4TA 2CXYA 2DRDA 3CPWR 3VAGA 3WK5A 2UV8A 1IBKF 4BRCA 2KN7A 5MLCV 2V69A 3Q8PB 1CJTA 3VVUA 2E8NA 3SV3A 3DRSB 4YFKA 3MEGA 3FYHA 1WG5A 1Q1KA 1TUVA 2A1BA 4BRQA 3J7AP 2KNJA 4DSJA 4PA1A 2G2YA 4RCHA 3C6UB 3QO9B 5EE3A 4IO9Q 5HN0A 4C8YA 2LKZA 2GVDA 2B4JA 1M1HA 3LL3A 2E88A 2QWLA 4DR6K 3RH4A 4CZIA 2H1YA 3C19A 3CJTA 3QZ7A 3D0IE 5CH7B 3QESA 1YAGA 3THWB 2ZBPA 1KP6A 1GMVA 4RW7A 5J8YA 1DTTB 8ICGA 2ZZTA 1IKWB 3NVVA 3CC2S 1S12A 2M9KA 2VIXA 1IG8A 4K5SA 1LW0B 1HARA 4WP9A 5AK3A 2AD9A 2PY5A 1BUPA 5AM0A 1CJVB 3Q24A 2FLPA 2D4WA 2W7AA 4DCJB 3IV6A 1YIJS 2I9GA 2ACMA 4FO0A 5ETOA 1NNDA 2AJQA 4RW8A 3B6PA 2HF4A 2A19A 4B3TJ 4OLBA 2A1RA 1L8LA 5HP4A 3O3HA 2CPZA 5D46A 2A3VA 3QB0A 5BR8F 4Y2RA 2IY5B 2DHSA 4WQ5C 3A3NB 3QETA 3NAIA 2V0NA 3PNCA 1HNWK 2BQUA 4FXVA 4ZLLA 1PUZA 3TJ8A 1IBCB 1IKYA 4N7TA 3V6DB 1U8WA 4O44B 3CG7A 4I6MB 1ELOA 3GLJA 3L3CA 4DTXA 3D68A 1TL3B 2IRUA 1TELA 4NLNA 4GV6A 4URGA 1VBYA 2HFZA 1NJYA 1N32F 2HKEA 4MK7A 2OPPB 2G1DA 2QXLA 4EBCA 2QKQA 1ACMB 3UM9A 3KKAA 4IC9A 4BX9C 3M2UB 5A8WA 4QQBA 3CPWM 5B66U 1LAWA 3NG8A 3SQ0A 2AGQA 1DK3A 2YKAA 5J2MA 4X84A 2OMOA 5HANA 3C14A 2RSQA 2MSTA 5D0EA 1VJWA 4E1MA 2J4RA 1SAZA 2P9KB 1UMJA 1U6FA 4JWNA 3CM6A 4I2EA 3KFWX 1HUOA 1WEZA 4O55A 2BACA 3N7RC 4U8VA 3V9XA 1RG6A 4DV0J 2DNOA 1N34J 4TQRA 1F0XA 1EX4A 4CEAA 3ISNC 3G8QA 2GLEA 3E9OA 1QE1B 4AHRA 2ASYA 1Q95G 4FPRA 4JLHA 4E98A 5C2DA 1Q79A 2MZSA 3EE8A 1VDHA 2E7XA 4DU8A 1TKXB 5FPMA 2CJYB 4O3RA 4JI3J 4FLUA 1CULB 1SB6A 3PKMA 2WVCA 5L1IA 1VC6A 3O9SA 5IT0A 2UXDJ 3G86A 1PYOB 1GLCG 2QARA 5JVHL 2BV3A 2RN2A 2JZBA 3C95A 2ZIXA 2BJEA 3HXMA 1SUQA 4CZKA 5AXKA 1GTEA 2I1QA 5L1LA 1YBUA 1EZZB 3WK7A 1BPYA 1RDAA 3N7SC 3KJNB 1A6SA 4CO2A 3LP2A 2Y1LB 3THXB 2XI2A 8ICEA 3FFKB 3AARA 4JI0F 3CERA 1S3XA 4K8XA 2HBRB 2ZIVB 3PMNA 2ZNZA 3BV8A 1FKPB 9ICNA 4JI5K 4EEKA 4NM2A 3O3FA 3ALYA 2J7UA 4ZVPB 4DV4J 4YY3K 3JPOA 5ALLA 1RT5A 1SQGA 3OFGA 2LA6A 2LCWA 4DTRA 2HNZB 2L9DA 4ISGA 2VJ4A 2DY1A 4DX7A 2WB1F 1EO1A 4BG8A 4HVZA 1UHUA 4C0BA 3RB0A 4DX6A 2QEXS 1ZQVA 2E20A 5A2QU 2XMVA 1QD1A 4I2JA 2H5IB 3AQPA 2YB4A 3N28A 3ZTQA 5J0WA 1RNHA 3BO2A 3PSIA 4QPTA 3EXCX 1TK5A 4FBUA 5TKYA 2D6FC 3AQOA 4LRDA 4C4RA 1UA0A 2GX9A 2HBYB 3BS7A 5DQGA 3SYZA 3OS0A 1ATRA 4RZRA 2B9YA 5FRMA 3H3NO 1RHUB 3QJJA 2R8KA 1QAXA 4ZS6A 4C8MA 1D9AA 3UMBA 1IH7A 8ICKA 4OHWA 2AP6A 4K0KF 4QZGA 2Z1GA 4F3OA 1N61A 3IC1A 2DPJA 1CG2A 5AR0A 5LMNK 3FKBA 3ED5A 2Y9HA 4M3RA 5CYQB 1Z6RA 1IXRA 1G2EA 3CQXA 3IRWP 3DOLA 2FBYA 3WEEB 3Q83A 1Q0NA 2DH7A 1KQKA 3DLKA 4DV2K 2Q2RA 4I69A 2R7TA 1JJ2R 2BEFA 3LDQA 4KLTA 2ASLA 1DKGD 4AYBC 1EXQA 2DUYA 4TYAA 3IS9A 1DQ8A 2ATLA 4A5BA 3N9UC 3SPZA 4WWSA 4QIWF 5D4OA 3HT0A 4EFAC 5ALHA 2FHJD 3T1HF 1EKEA 4PJ0U 2Z56B 2YJEA 4NLZA 1Y3KA 5ALMA 3MCMA 3GWCA 1XNRF 3HK2A 3V72A 3UD3P 4M42A 3OFEA 3A0BU 5DG7A 2EG2A 4GXJA 3PLAA 1SV5A 4OI4A 1E4GT 4P52A 4QZ8A 1YWXA 4XO0A 2EHGA 4EWTA 4DHVA 2DR9A 1VQNN 5EX0A 2YWHA 3RGIA 3HFZB 2VYPA 5IOLA 2DVIA 2VQEF 1XNQJ 5C24B 3KJVB 4ED3A 4MKAA 1A5VA 2F77X 2EW9A 3N01A 5KFRA 1TFYA 3V9UA 2DGOA 2DNPA 2JHEA 1NSKL 5D49A 3O6WA 4WIIA 2NRRA 1SVDA 3I0RB 4CI0B 3H4BA 5DDPC 2MQOA 1PC5A 3BZKA 4ED6A 3AVAA 2C2KB 2HHPA 5HQMA 3KKSA 1VK8A 2YX4A 1H2UX 4QS9A 3VPZA 2PFNA 1AUSL 3G82B 4X62F 3OS2A 4DEZA 3PUFA 4WFBL 2YBVA 1VIOA 4ECXA 3BDEA 3EPGA 4W4MA 5H9FK 3KIOA 6FD1A 4QZVB 1WOPA 1FO1A 5GAHI 4DV5J 4QIEA 3DXMA 4KIAA 1VHFA 2E9RX 5EE0A 3BGFA 1DLOA 2BE2B 2KW4A 3NVWA 3O4QA 4X2BA 4EU0A 1LKZA 3B0YA 3CMQA 1IBMJ 4FP9A 2ZOGA 1M6YA 2QM1A 4NZ0A 2LM4A 5J2BA 2QWNA 1NPPA 1JK9B 6FDRA 3B8AX 2VG6B 1X4CA 1T9XA 1TMJA 1AA1B 3SCJE 2OTLS 1T6DA 2PZSA 1B7FA 1J5EF 4PL7A 3QE9Y 3WXJA 2YNHB 1FD2A 4HL9A 3F44A 3HKZD 3VQPA 4DR5F 3PFEA 3C7NB 2YWGA 2XMUA 3HHLC 2GQCA 2XY8A 4YB5A 3P39A 3K1ZA 4UZBA 4CK3A 2OHFA 2XS2A 2Z57B 4JI8F 4B08A 4WK3A 2DRBA 4JD2B 2FJWA 4I2PA 2KIVA 4UATA 3WXLA 3AA9A 2DNRA 2HVEA 5F8HA 1X1PA 4FF3A 3H2UB 4CF8A 2E5HA 1UETA 3D9BA 1CS4A 2K2PA 1T6CA 3GQCA 2CJQA 2WSCC 1Z4OA 2EH9A 1ZM9A 2B21A 2PMZC 3DXKA 4JYAJ 4OVLA 4BXOB 4LF8F 3C46A 3IGVA 4ZVTB 4DR2J 1S6OA 4K42A 3CJ5A 3LAMA 5AQLA 3HTVA 2JX2A 3OYNA 3JPSA 4PG7A 4EGLA 4OYAA 1ZQAA 2DNLA 5F3ZA 3RAXA 1U1OA 4ECQA 1PJ7A 5SZTA 3K5LA 4DOBA 4CLFA 3H1VX 5E3CA 2VWBA 5BOLA 1ZQIA 4N8NA 2ZF5O 4DV3K 1QHAA 5CCLA 4V19J 1KVKA 1VQ9S 1ZPWX 2L9NA 3TSUA 3RJJA 4WIQA 1XC9A 3M1VB 4M6WA 2V2KA 3DRPB 3CMAS 2KH9A 3HF5A 1E3MA 2FC0A 3BGOP 4NA1A 2CJXB 4IO1A 2O4GA 2OWOA 3QAUA 2KG5A 2E1AA 3CCLS 1GO3F 4CCHA 2ZDOA 3TA2A 2QT7A 2R7XA 2A41A 4F5OA 5DDYA 2AT1B 2B6AB 3W2WA 1TL7A 1TVAA 8ICCA 3O80A 4EP5A 4ILLA 1HYSA 3GE9A 2Q0UA 2CA9A 2CGJA 2C2NA 1VRUA 3HRDD 5J0SA 2XRIA 2IJNA 4FJIA 1NGAA 4I2FA 3LPTA 3E9PA 5ALSA 3EEQA 4ANEA 1DTQB 3C6HA 2GGPB 5LMUJ 2XHWA 4AP9A 1HFEL 2VGNA 1Z00A 4DL2A 3CQYA 4Z4GA 2ZOMA 1EIYB 4IKAA 1NM1A 2ZE2A 2DEJA 3OUYB 3UD4P 2W9MA 4RWWA 3J80U 3ZT3A 3Q22A 3DLHA 3B4DA 2F65A 1OH6A 3VR1A 3AVHA 3GG1A 4X4NA 1ZQYA 4Q7AA 1TKZB 3UR3C 3KFUF 3BF3A 4M9NA 4LF6K 5AKXA 3M6XA 1KFSA 3K1RB 3RAQA 4MT1A 1WC0A 5C15A 2E44A 3NASA 1RTJA 2ILZA 2ADBA 1X2IA 3HSTB 3LVVA 2CPHA 2GWJA 4IG0A 1N8RO 2HDOA 4DS5A 4CO5A 3PYEA 2WW8A 3TUIC 1HBMB 4C48A 1J54A 1BPDA 2WAQC 3M30B 2RS2A 3H7IA 2LYBA 3UR0A 2DFHA 4ECSA 4DV0F 3VEZA 1N34F 1KQQA 4CF4A 5ALYA 1XUPO 3L2VA 3AODA 4YS2A 1KVIA 2M8HA 5GTIU 2NXJA 1VDVA 5L39A 2L5YA 3BSOA 3OYKA 4UF4A 4PGQA 5JMVA 4RW4A 4EZ9A 3J7ZO 3E0FA 3KWIA 3W64A 2ZXHA 1VLOA 3MAHA 3P5TL 4C98A 2LQ5A 3MOJB 2JMGA 4RKUC 3MC1A 1EP4A 2HRUA 3GOIA 2RT3A 1PK3A 4P72A 2UXDF 3I87A 2P9NA 2ZM6K 1JCFA 3J81U 3K5OA 4OZ5A 4P2XA 1HHSA 4L72B 1O51A 2GEMA 2VFUA 1JN3A 1GLAG 4K59A 4XH5A 2EZXA 2YKMB 4I2QA 3FZHA 4DUYJ 1K6YA 2RE1A 5CRXA 1OH7A 4F04B 1EQ0A 4I2DA 3L3FX 1FRIA 2YHWA 1HPZA 4PQUB 4LF4K 2NRVA 3S8SA 1FF2A 2KN4A 2XVTA 5KFMA 2FLOA 1W7AA 2W7PA 5DQHA 3Q0AA 4DI6A 4L8RB 2VF3A 4NO7A 4UW2A 5MAOA 3MECB 1KVBA 2F8KA 4IR9A 1TL1B 4QW8A 1KAXA 1CZBA 4QZBA 4KGKA 3THYB 2YNGB 4DV4F 3GP9A 4WBFA 4JI6K 2P6RA 3V6HA 2DIUA 2PIIA 1PC4A 4A8SA 2QA4G 2PI5A 3W63A 2KHVA 2ISOA 4OJGA 4O9MA 3QJPA 5B8HA 3K0SA 2VA2A 4Q43A 1RK8A 1ZZNA 1Z26A 1K8AO 3CCZA 3C6UA 3QO9A 4NASA 5T7LA 5CABA 2E9TA 4WFAL 4DX8H 5T7BA 4CZLA 3NBPB 4WU2A 5AKIA 3THWA 2Z1IA 1OW5A 2KKZA 2ZH6A 2OPSB 2JZ5A 2RIJA 4N76A 4FLVA 5FDLB 5J1EB 2VU5A 5LSOA 1S1UB 1WNEA 4L76A 3OTOJ 3AGRA 5EWFA 3TAFA 3H0MB 5DDMA 3NRZA 4XQ8A 3H20A 2VPZB 3OJSA 1LW0A 5DBBA 3SR6A 1GNKA 3DLGB 1R89A 4A46A 2X1AA 4WZQA 4A4JA 2P8IA 1VSFA 4ED2A 3LP0A 3KWMA 9RUBA 3AA2A 3MUTP 1TYQB 3ZNUA 3CC4N 1B4FA 1GMWA 5IC6B 3K5PA 2BR0A 3LTOA 5M2UA 3OVSA 5IIMA 3W65A 1NOYA 1YRXA 4AUKA 2AIRB 5AE3A 1QSYA 2XMWA 2CGKA 7ICMA 2RDJA 3K59A 2RDIA 1SWVA 1NGGA 1J2MA 1HJOA 3SJHA 2KKVA 3O2IA 3VQAA 5IT9O 3ZLJA 5EOZA 4NXZA 1LOUA 3C6TB 2HHQA 3UD5A 4A8FA 3KVGA 4QWEA 3V6DA 1BU6O 1URNA 4KT0C 4FPBA 2O8FB 3LH2S 3BKTA 3RMBA 1WHYA 2M8DB 1IM4A 3N6NA 1UVNA 2MLYA 3R5BA 1YJWN 1VFJA 5HROA 4CFCA 4B9QA 1XNQF 4A48A 3T6JA 4LSLB 4CBWA 2ABYA 3RJEA 1HQEB 2J6UA 3IP4B 3VQBA 2DO4A 5AT1B 2Y8YA 3R5GA 4FW2A 2JH7A 3T19A 2FZCB 4DCPB 2N3LA 1BPEA 2YH0A 2WB1C 1V6HA 3EJMA 3GFKB 2OAUA 2PBDA 3D54A 1AZSB 4IOBA 2WSFC 3SV4A 3QU7A 5AQGA 2DGQA 1ZD2P 3W5XA 1QCKA 4JN4A 1U6ZA 3RB6A 3KLVA 3PEHA 3IMQJ 5AXMA 4JK7A 1S1VB 4ICAA 3BUZB 4DV5F 3RWUA 3PIOQ 2YMQA 1QE1A 5L1KA 2XIDA 2H3IA 1N0UA 1WWVA 4DUTA 2GELA 4XH1A 3CIZA 2FC9A 3ETRA 4ZCIA 1TKXA 4BVPA 4YMMA 2R7SA 4ZLJA 2ZC4A 4USVA 1ZQHA 4TKTA 3QUTA 1YX2A 3HSZA 3IG8A 3VF2A 1HNXJ 1O5JA 3PSPA 4W5NA 3U26A 3A8JA 1PYSB 2HHSA 4DR1K 1SJ1A 2H4WB 2GHVC 1YJ7A 5C42B 2MQLA 1C0FA 4YN3B 3K57A 3ORYA 1BISA 1TUWA 3KUHA 4OV1A 2QL5B 4RO0A 4PGXA 3ZSVA 4WCEQ 4HR2A 4DBQA 4LRBA 3M32B 4KX3A 3MDAA 1FO4A 2DHXA 1TFWA 2DITA 4QIWC 2KVQE 3MTKA 4M45A 1KLMB 3THXA 1YKWA 2DGVA 3M4XA 1KRPA 2M0GB 1TV6B 1ZAXA 5CB1A 3PO5A 4G65A 2VC1A 2YQ3A 2IAJB 5K8PA 4RQ6A 5CQGA 1NNEA 2DGXA 2CPYA 5HOOA 4U67Q 1PCAA 1HNWJ 2Q66A 4UB3A 1CRXA 1FD8A 2A6OA 3U02A 2ZJAA 4B6JA 2U2FA 4O5KA 4K41A 2W2QP 4I0WA 3DYAA 5KFZA 3CJ8A 4CDIA 2A40A 3IAM9 3BN4A 2IOFA 3QT8A 3KKAC 1O6XA 3CJ3A 3V9SA 4ZN3A 3QIPB 2VASA 1S8OA 1Q7YO 4DFKA 2PMHA 4YMOA 5IQQA 3GSDA 2QFIA 2VOPA 3AL0B 5DDRC 1VQKN 1WSFA 2JR5A 4PCQA 5AI6A 1BOTO 3LM2A 1NKEA 8RUCA 2DGTA 5CCMA 2GJ2A 1RWXB 4MHVA 1LQ9A 1GX5A 3R7BB 4OJHA 5LXYA 2GS8A 1GOAA 3L2QA 3I28A 4XDDA 4DLGA 1YGYA 2GIQA 3DLLQ 3SBTA 3PX0A 3EW9A 1QTMA 1IXKA 4LSNB 4CBXA 1K0VA 4BRHA 1U09A 3EN9A 1KFDA 2CJKA 2ZD1B 2I5JB 3TAGA 4LBHA 1UVIA 4KHSA 3FQLA 3V4IA 2ZGZA 2HHTA 1T9TA 1Y9OA 5CYQA 4XTTA 3MR5A 5C2GA 3IWNC 4P75A 1OY9A 3WEEA 2XI9A 4LSZB 2O8EA 3QATA 3LDAA 5ITHA 1R59O 2BJ9A 1F5BA 3G25A 4NX9A 2VJVA 1OVQA 3SUOA 4TU7A 1IBLJ 2FHOB 2PDAA 5KFSA 1P9YA 2BM0A 3LO3A 1M5PC 5J29A 4K2XA 4CEFA 5AKHA 1F6TA 3HYFA 5AQUA 2V94A 4FZNA 3S01A 4E7HA 5BN8A 4I2GA 2HI0A 1BPZA 5LMUF 2FSJA 1IKXA 2DWQA 5DZ7A 4N77A 1N6QB 3HHKA 3CCVS 1U45A 1C7YA 1IR2A 5KPTA 1P7DA 3LANA 4Y34A 1ZQKA 4DTPA 1LK7A 5ALJA 3RZAA 4CTAA 4JUZA 3TSQA 4Y2YA 2RQCA 3S41A 2QMUB 3Q8UA 3O44A 2BVZA 3DWLA 5C24A 1YVUA 3L4IA 5ETNA 4ZVFA 4R25A 1C0MA 1HWKA 4YB6A 3H6EA 2V67A 2XM3A 8ICPA 3ET6B 4CLLA 2F8EX 4Q8FA 3BH6B 5AXNA 2W11A 4KB1A 4KHPK 2HZVA 4O4RA 4JI5J 3SI8A 4YY3J 4OJOA 4H5RA 2R2RA 3PR4A 3SAHA 1ZA2B 3D67A 3G82A 1S5JA 5AK5A 3RR7A 3L4PA 4HH1A 2O8CA 2HLUA 3RJHA 3RBDA 3TWZA 4DPWA 1VQYA 3F5AA 1H38A 3ZDCA 1OIAA 2IC3B 5M1OA 5GADU 4IZ9A 3CF5L 5ALDA 2EFOA 4FZXC 2CZ4A 2BE2A 4I9QA 2ODGA 4FWQA 1XSPA 3ZDEA 3GDXA 3BJYA 2Q43A 3KUEA 1FX4A 4QU7A 4OL8A 5DB7A 1KR4A 3W2VA 2KICA 2AEJA 2NYHA 1MROA 2VG6A 3UKRA 3UN5A 3MPUB 4DR4F 1KAYA 1WACA 4R79A 2ADCA 4MLHA 3ALRA 2FSKA 2EBEA 3SQ2A 4H0XB 2YNHA 4UAYA 2WOMA 1X3NA 5LSRA 5FP0A 4DUYF 4C80A 2VKQA 1FERA 2KZMA 4B9TA 1X7VA 1M5HA 4IQMA 3TADA 4LF9F 4J2BA 4C7YA 4DV2J 2FC8A 2KIWA 2CNKB 4Y2CA 2D0CA 5I3UA 1PK1B 3C6AA 3MXMA 2O8DB 2KVCA 1FTRA 3TEGA 4AL5A 3H5YA 4DV1K 4KHQA 2G0CA 3P8BB 2FVPA 1LOTB 2V7ZA 2YXLA 4DSEA 1NM2A 2IM1A 4YOUA 1NOMA 2NRWA 4DPUA 3BBCA 3PEJA 1LFWA 2F8HA 3O9TA 2EAPA 2ZJPL 1LB2B 4LR9A 3F2KA 4RQ5A 5DDQC 4TY9A 1TE2A 1REVB 3H7HB 4I4BA 1BHLA 2OPQB 4K43A 4WYLA 4KFBA 3LZJA 2EZYA 2IFXA 3EYZA 5IWAF 2EC2A 1WC1A 2V51B 1Z1VA 4D3HA 3GONA 3A5LC 1RAGB 3A8YA 1ZQJA 7ICIA 3JAMU 4HT7A 1HKCA 1RT7B 3OHAA 2RQ5A 3MMAB 1GLFO 3ITHB 1V4TA 3IRUA 4JB3A 2UXBJ 5H9FJ 2OEJA 2G9OA 2P9LA 2ZFHA 1N8RT 3NGSA 5J0QA 4NA3A 4BR9A 3FZBA 1SB3C 2OJ3A 1PBAA 3RH5A 3KTQA 3W9HA 3FDSA 4BRLA 2Q0RA 2IOHA 3IR7B 3EVWA 4NXMK 2VZ9A 4JBCA 5GMDA 3WK8A 2HCFA 4IG3B 9ICCA 4F67A 1RHJB 5E3PA 3O5TB 3T5JA 4NMXA 3HHEA 2IVOA 3HP9A 3AD7C 1M1GA 3AD8C 4UB6U 5A8RA 2MQ8A 1DTQA 2GGPA 2VONA 2FJEB 3ZI4A 3QRPA 3J7ZT 2AYMA 4HVJA 4GV9A 2CQBA 1DEJA 3I96A 4DV6J 1GH8A 4LBIA 1S9FA 2B5JB 1M5OC 1GT8A 3MK6A 3D7EO 2EK1A 3QIDA 4N56A 2PYJA 1JLGA 1V3SA 1KHVA 2AW0A 4WFXA 1XQIA 2P9PB 4J91A 2GH1A 2YN4A 3BQ0A 5A6WA 3J7AN 2LEAA 3TJAA 1TMMA 4DPTA 4J9OA 1MA9B 4WYWA 3ZDBA 2AEMA 2V2VA 5J2PA 3VQ4A 4USTA 3MR2A 3ENVA 2DK2A 1VSMA 2DH9A 2LHTA 5L1MA 4NRTA 5E84A 4ZVQB 2GWSA 2VWKA 3TWHA 1QQ5A 3I32A 4WU3A 2WVDA 3T1YJ 3WK4A 4XAKA 1TAMA 1OSDA 4Z4HA 1NLKL 9ICWA 2LMRA 3TYTA 4Z4EA 2HQDA 4DR6F 3QGPA 3RMAA 4FLWA 2F3JA 1QQ6A 9ICSA 1HR0K 3D2QA 5HBMB 1FFWB 4XEIA 4DV3J 2FBTA 4FE3A 3RJGA 3MM6A 1K8AT 3VEWA 1KD1O 2HQ3A 4TY8B 4ZPTR 4IFEA 4QZIA 2DIVA 3V6JA 2GNKA 2A3JA 1GQEA 4B1YB 1X9XA 3CGIA 2CJBA 1IN0A 3SUQA 5E3AA 5FJ4A 3SQIA 3JSMB 3Q7CA 2W01A 2YKMA 1UP1A 1B99A 1RA7A 4ZJQA 5KRTA 1LWFA 3MUMP 5KRSA 1P27B 1L6NA 1FVQA 4MEXA 2LQJA 3AVCA 2HZAA 1LWXA 5F8NA 3H25A 1RA6A 4J2AA 1GMWD 2KT3A 4P0PB 3I8DA 9ICHA 1RABB 1O13A 3C8YA 1B0XA 2KP7A 2RUGA 1H0HB 3EGVA 4MO5A 3I82A 1HNWF 1VRTB 4B3SK 1L3KA 3TU5A 1DZ5A 4PKDB 3I76A 2W7OA 1R0AB 1Q9YA 1KNZA 2XSJA 1N33K 1WI8A 2EWSA 1JLCA 1R31A 5IC4B 2HFUA 3AVJA 3SAGA 2MQNA 3JS6A 1W7WA 2GAGC 3VGKA 2EC0A 2MRLA 5HR7A 4RT3A 4TLQA 3K89A 3QWPA 1QUVA 1NKCA 3GB0A 3M2VB 2K89A 2DXFA 3A13A 1RT3A 3NVZA 3HCXA 3ID8A 4GC6A 2ISPA 1VJQA 4DLEA 4DU7A 3ETOA 1LKYB 4LF6J 4OZNA 5I4MA 1NGFA 3OYGA 4FJ7A 1MN7A 2BDUA 1X5OA 2XY6A 2NXNA 4F02A 4XA5A 3DRYA 2BDPA 4NXNK 4DKWA 5FDLA 3EKUA 3VAIA 3SSQA 1S1UA 3HPOA 3OL6A 3QU2A 4P2SA 4DN0A 3TUPA 5LL6Z 1K5OA 4NE9C 4KRFA 1NZAA 3RW6A 1SZHA 3PYGA 3TTCA 4FWLA 2YKOA 1W0HA 1RHQB 4EENA 1RBSA 4P0QB 4JKHA 2MSNA 2UU9K 5I42A 2GA7A 1SH0A 1UW4A 2Z7JA 5AZIB 4IQTA 3H98A 3BM7A 3HPGA 2PEHA 4CEZA 1RT1B 3N6LA 2MGZB 4DR7K 4FO6A 4OI1A 4B3OB 1UJ4A 4PHAA 2BE7D 2UUCK 1RYUA 3LYSA 4KMUA 3IMXA 2OCEA 2EEYA 3D1HA 3ZSRA 3PIOL 4IRKA 3L95X 3ZTRA 3I56N 4QZFA 3ETLA 2ZM6J 2ZIUB 9ICIA 4FJMA 1KVJA 2X3DA 1S99A 3M8ZA 4LFCK 2A1JA 1C0GA 3R7SB 1VQ5N 1R6VA 1N56A 3L7PA 1N5XA 3KHYA 4Y2VA 3C2MA 4QS7A 4H5WA 3M8RA 2V4QA 2PE8A 3W9JA 1OQ3A 1F0MA 5DLGA 1Q9XA 3MM5A 5F9LA 4MFCA 1F5CA 1HMVB 4CZFA 2GVZB 1KOHA 1XWLA 1CJUA 3CD0A 1S1WA 1YJWS 2BOPA 4WCEL 1B70B 3BEXA 4JI0K 3PTWA 1LCUA 4ECZA 1XNSA 1KC8O 5A0LA 2ZUDA 1YJNS 4JI5F 1ASUA 4DX5A 2BMBA 4BRGA 2YB1A 2CQHA 1VSKA 3HVRA 3L5KA 1Q53A 3KG0A 4JI6J 2EFGA 4K2JA 1ZXIA 4H5TA 2DY4A 3R6MA 2K7JA 2B4VA 1XO0A 2ROPA 2V68A 2K3KA 4U67L 1J5OB 1IJJA 3F56A 2P6UA 4WKYA 5LL6d 4LREA 4QPXA 4PYDA 1Y3JA 3ZZZA 4DV7J 2PAVA 3ZSQA 3P31A 4JS5A 3E8OA 2NPFA 1X42A 2JC0A 3NGRA 2NXCA 3PZPA 1C4CA 4X66K 2D9PA 2MSSA 3IGNA 3MUVP 1XU4A 3HZGA 1Q7YT 1D4XA 1YJ9N 3U7JA 1S49A 2XTJP 3NF6A 3D2EB 1YBTA 3WNGA 5E41A 3CMES 2QJ3A 5C42A 5EWGA 2MZ1A 4CHZA 4BGDA 2DGSA 3TZXA 1HNZJ 3WX8A 2G06A 5LMNF 2OKQA 1NWKA 4OZ0A 2QFJA 3C3LA 2OYQA 3DLLL 3ZXWA 3R8EA 4BUGA 4DV2F 5SUHA 4F0MA 1NCLA 2J0XA 2XHBA 5U47A 1FFGB 4OZ1A 2RMLA 3GFZA 3UCZP 5E5NA 3W3DA 2J9CA 1S79A 2Z4PA 2MZQA 2I2YA 4FJ9A 4CK2A 5KT5A 5GAHU 4U7CA 5EOYA 1TVRB 1OWXA 1SJQA 3TAPA 4AE5A 1RDWX 3JS9A 1ZOLA 4OYXA 1RT2B 3L7OA 3FVYA 4KLMA 1F3FA 1AROP 3QIPA 4ZCKA 2KHQA 4CO1A 1NGBA 2IJFA 4UOFA 4AD6A 4IXCA 5EDWA 3ZCMA 4S0MA 1F60B 2D5RA 4JV0A 1RCOB 1WSEA 4JK1A 1YUWA 1N63A 4J9MA 2DL0A 1K73O 3SUNA 3CCRS 2D3UA 4PY5A 3M05A 1VQKS 4BE0A 4M5MA 3X3UA 3CTRA 3TEHB 1LK5A 4CLTA 4R63A 4CZJA 2PSZA 4BJQA 4X4SA 4WQ4A 3FMWA 4MTPA 2CN1A 5DK5A 3MWPA 8ICZA 2I5JA 3J8AA 3QGHA 1B0PA 3FE1A 2OA8A 2QG9B 4F5QA 1CZAN 4PUOB 1U2FA 5AXLA 1BQMA 1TV9A 2A18A 2MLXA 4BC3A 2F1IA 4LIWA 3CJCA 1Z4UA 4Y2IA 3OPXA 3TVKA 2QA4S 1ZQBA 1NJWA 3VQTA 4ZIWA 2V8GA 1KQSR 1C6VA 2OM6A 4I6WA 2CQ0A 3T41A 2EZZA 1WOOA 3TNVA 2ZH1A 1FI4A 1NZBA 4H4KC 5J2EA 1ZQQA 4DR1J 3QNWB 4M1KA 1N6QA 3NH0A 1YTAA 4HTLA 4OYZA 3HOSA 9ICXA 4J9KA 2FHKA 4OJ3A 3PIPL 3IFEA 5E3QA 2UUWA 1KQGB 4CGDA 1NLVA 8ICBA 2RHKA 4L3QA 3LQVA 2KFYA 2GO7A 2HNDA 4HTJA 3BR9A 1HNVB 3WC0A 4M9LA 2LEPA 5EE1A 3BH7B 2HS4A 3JQJA 1LFPA 3QEIA 4FLYA 4FF4A 1VQ7N 2B0GA 2LFVA 3M6VA 5J0TA 2EANA 3ZSXA 3HHDA 5TKWA 1JKHA 5KG1A 1RQLA 2A5XA 3W9IA 4GKJJ 4HUGA 4J9SA 2DCLA 3WKCA 4UAZA 2JVOA 4ZCMA 2WF9A 4FZZA 2MYFA 4QZDA 3CDEA 3MHYA 1C0UB 4KH0B 3ULEA 2I1RA 3C28A 1RAJA 4AF1A 1A77A 1AFJA 4DFDA 1X4DA 2FBXA 1VR6A 2XWYA 2K3IA 1YI2S 4JS4A 3RW7A 1ZD4A 1NU0A 3T1AA 4NL9A 4OYIA 1UPHA 2X78A 3BN7A 2AJ2A 4QS8A 5CZVA 3BGLA 3UO0A 7ICJA 4DG1B 4LRFA 4ZP7A 3OXGA 2R2UA 1T3VA 2HLTA 3I4HX 4DOAA 4ENOA 3R5CA 1BVSA 1NUEA 1Q5YA 2EWHA 4I7FB 1NMEB 4KSEB 1RWVB 3T9NA 1FNMA 3IXQA 2LXFA 2KM8C 4ZKAA 4XPCA 2QIFA 2ASDA 1WJ9A 4LD0A 4JEPA 2O8DA 3NP5A 2ZXIA 1ASVA 4HT5A 1UFLA 5JICA 4QNLA 4IQVA 1JXVA 4LY7A 3M6ZA 2G8FA 3Q7BA 2VL1A 1TFRA 4FPIA 4IEIA 2HVHA 3W8GA 4ID8A 4ILHA 3IAYA 1WHVA 4GKKF 2NUBA 2D69A 3DI6B 3ZTPA 4JV5K 3D5MA 2Y0SD 2R8IA 1YTUA 1KKHA 4BREA 4CJ4A 3UPQA 3MMBB 3VAJA 4BQZA 2QRRA 2P9CA 3A3OB 3JPQA 1MMLA 4RW6B 2KRRA 1VQON 2L3MA 2MKCA 2OPQA 4BDZA 4OJ1A 3CCQN 1JCEA 2ATCB 4LF7F 3ENAA 4LF6F 1NGIA 4LH4A 5E3RA 1S48A 3TO8A 1BNOA 4UOCA 5KFXA 4I56A 5AQNA 3CVKA 4PQAA 3WXKA 3UDCA 3WKDA 1BWFO 2B8PA 3AVBA 3MX5A 1ZQGA 2AF6A 4KHPJ 3DLEB 3AXKA 5A8KB 1HWUA 2ZKTA 3BF1A 1RT7A 2AHOB 1IQTA 4L73A 3TVYA 4H5VA 2BCQA 1RDDA 5AFUA 2B9EA 4V1Ak 2BCUA 2V9WA 2LM1A 2GW8A 3EMTA 4ID5B 5FLXU 4HHTA 5JRTA 1RZMA 2GJFA 8ICSA 5DM7Q 4LH5A 3I8BA 5G5HA 1VSIA 4GV3A 2DNZA 3ZDAA 4M8LA 3HJVA 1QVGR 1FEEA 2O5DA 4JB8B 2BRKA 5EWEA 4M63C 1Q86O 5BOMA 1NGHA 2AA4A 4KTWA 3CCUN 3R2CJ 1R8HA 3UDEA 2QL7B 2EXUA 1R0BG 3R9KA 2HOFA 3LAKA 4H54A 3SNNA 1YLXA 2KSOA 2ZM6F 2PEBA 3FEZA 1V9OA 4YOVA 2HGLA 9ICUA 5F8LA 1VQMN 3KK2B 4CFDA 4DF4A 2B5JA 2QLJB 1KD1T 3AOAA 5TISU 2B6GA 2R2SA 4YOEA 4BC2A 9ICTA 1N36K 4YMEA 3HRGA 1HKBA 5IIOA 1P1TA 1T9UA 4ZLPA 1I94K 1RKJA 3HP6A 4LF4F 4JK9A 5EHHA 4ILJA 4YHHK 2NREA 2F1HA 3RG6A 1IQZA 4A8XA 1VK0A 3D4JA 1WDTA 2V8HA 1ZM4A 1AFIA 3OYIA 3KLEB 3MMCA 1TKDA 3OS1A 4J7CA 3LUYA 1JROA 4TUPA 2HAIA 4KTZA 3I9V9 4RUAA 2HBQB 1XIQA 2YCHA 4KN4A 1WSRA 1WF1A 4US8A 1Q81O 2UXCK 2Z2LA 4UAUA 4CJPA 1S97A 3CJ2A 3JSRA 3C94A 2VBWA 5KAIU 3BB5A 2OFHX 3D1QA 3AHPA 2HZCA 5LXRA 4JKAA 1JLQA 1Y5NB 5EXWA 3ZT4A 2B3TB 3QEVA 1RU1A 3KK1B 4C1NI 4I9LA 4PG8A 2CNNB 2CPDA 5H9EK 4OKJA 4ECVA 3VF4A 5AK6A 4F92B 1L7PA 2RF2B 2I5HA 2QN6B 2W41A 1Y11A 3LK9A 1T02A 1RKIA 1SV0A 2N4CA 4PL8A 3TI0A 1Z05A 5AHXA 4ER8A 3V81A 1CI4A 2ZTEA 2ASMA 3IM8A 2X1FA 4P0PA 3BS5A 1YJRA 2NR0A 1ZRNA 3ZZUA 5GTHU 5TZVA 1T05B 3OYFA 5GIOA 1VBZA 2Y0SC 1FDAA 2VG7B 4J9VA 2WK4A 4NXMJ 5GADP 3HSJA 4R5PA 4C0OC 4NLPA 2D74B 3P45B 4OHXA 1VRTA 4O0NA 5J2IA 3DAWA 3T69A 2HWIA 3CDUA 3P83D 2E5LK 2Q6BA 4OPHA 3K5NA 3FAHA 1ZS6A 3M8WA 4FZYA 3PW2A 3WQPA 1HW9A 1X4GA 2QTWA 2NRHA 2XMTA 1YVFA 2Q4TA 2HRTA 7ICHA 2F4VJ 1GOCA 1FNXH 1FFUA 2MY8A 3JTOA 3SSRA 4BRFA 4KPYA 4L3KA 5BJRA 3G71N 1JLEB 2GUPA 3M2VA 4E1JA 5DZ6A 2AQ0A 3OFFA 1TUUA 4K4YA 1LKYA 2LU2A 1KTQA 2DKZA 2NSCA 2HNYB 1RDCA 3DN9A 1CC8A 4I1TA 3PX6A 3V4MA 2W4PA 4QWBA 5B0CA 4TN2A 2B4UA 3FGUA 4JV2A 8ICXA 2NSBA 3CDAA 4PKIA 1OXJA 3KNAA 2E1FA 2E8PA 1SZPA 1S1TA 1ZQTA 3QU9A 2CZVC 4CK1A 3VQ6A 2B8QA 3J7YI 4ED0A 4RR5A 2FE9A 4PWUA 3CFOA 1KC8T 4FJJA 2C2DA 5DLFA 3SI6A 4JRQA 1LXNA 1L3VA 3WIUA 2RRAA 1UCVA 5AIBA 4B3OA 4CYUB 4FYYB 1A7GE 4OJRA 1CEZA 4WJ3B 1PYTA 2A10A 2ZIWA 3MM7B 5C25A 1NMDA 1SQEA 1S6PB 3HJFA 4ISEA 4CZHA 1AUDA 2BABA 4WXWA 3ZX3A 4EMDA 2K4EA 5CXTA 1XK8A 1WCLA 2E5GA 4RQ8A 4DR1F 4KLEA 4ILMA 2WCXA 3MN5A 3IRXB 4A8QA 2GHWA 2RILA 4PPDA 2BJ1A 4WP8A 4UW9A 3BEGB 2FVRA 2BPCA 9ICGA 3AQEA 2MQPA 1HBUB 3G8SA 3PJ9A 1R8PA 2HPUA 3PXGa 5CHCB 4C8KA 2GVZA 1HD1A 5LJ5Y 1VQ5S 1RSCA 3FZKA 3NWGA 5CAAA 4CGJA 1Z3EB 2QE5A 3QUCA 3VQ7A 4X4UA 4F7VA 3OBYA 5BR8J 3DOMB 3EWAA 4AM7A 4FZVA 4YCXA 8ICOA 5KFBA 1ITGA 2KJ5A 4F2SA 2VG5B 1BIZA 1ZBFA 4BWJA 4OKEA 1VBXA 1DRGA 3OVNA 1J2NA 2JLFA 3NAEA 5KFWA 5HMYA 3K58A 2VWJA 5DB8A 2QWOA 2YQ0A 3TR5A 2KK0A 5HK4A 2VDHA 2XI3A 3O9RA 3QBWA 2QTDA 5ALKA 1JRPA 3SCKE 1DBDA 3NVKA 1U4BA 1FIQA 5F1XA 4LQ9A 3TW0A 4NXNJ 4KI6A 2HRYA 1SH3A 3GCWP 3GPAA 3MXJA 3UDLA 3M8PB 3C23A 5ETPA 4YMNA 4OYWA 5A2QO 3ZTOA 3OBIA 2OELA 3QLHB 4B9MA 5GAEI 1RYSA 4UB5A 3H1QA 3DXSX 3IG1B 2E1ZA 1K73T 1HX1A 4FK0A 3TX0A 3N4MB 2UU9J 2K1RB 5B09A 5HJYA 3HHNB 2YX8A 3SQGB 5KL8B 1RBOB 2G2ZA 5KFKA 4NLTA 2W6KA 2FTRA 4EYHB 5FPNA 4IFVB 3HSGA 2VFVA 1IKVB 3MM8B 3PDNA 2LVWA 1IWAA 1WOSA 5J0UA 4A59A 1ZC6A 2ZDPA 3PFOA 1NJIO 4NWIA 1T9VA 1O0PA 2UUCJ 1HNIB 2G13A 3GU0A 4HCCA 3GV5B 3V7KA 3HKWA 3UIQA 1SC3B 3DV9A 1W97L 1RM6C 1VC0A 3QZ8A 1D8BA 4ILGB 2K8AA 1T9WA 3TQEA 4F50A 2B4PA 1VSEA 1HIWA 3R9LA 4M5HA 1GTHA 2AX1A 5JLHA 4JI4F 1Y5IB 4EFHA 1PAEX 3CCSS 4LFCJ 4BQLA 4FXDA 1EX8A 2Z58B 4AHSA 2FPKA 3G9CA 4PG5A 2GFFA 4H8KA 3VEVA 1JQGA 2GUIA 3ISZA 3Q8VA 3UMGA 5C0YA 4IUFA 3QT7A 4I6YA 1WDDA 4A5AA 2N4DA 2W6LA 4Z6EA 1U6BA 4C0HA 4YEAA 4WFYA 3TZZA 4JI0J 1Q4RA 1YRTA 3IFRA 2G0AA 4KHPF 1E6VB 2KHDA 3HMJG 4BVOA 4D3GA 4DPXA 2VFRA 5AE1A 4OGEA 2LYAA 1H6KX 4FK4A 2GIRA 3KD1E 4QAGA 1S9EB 4MQ3A 3OHBA 3NLCA 5DG8A 2F1JA 3VA0A 3NNCA 3UMCA 1RFQA 1WF0A 2QA1A 2OTJN 1HHTP 4LFBK 4ELVA 2F8LA 4X66J 4LVSA 3KKRA 5CE3A 4ZJOA 2XZWA 1U48A 3JXOA 3CCEN 5K8OA 5CYMA 5KFIA 5AQXA 2VKRA 3H8SA 5K20B 5ADXA 3A0HU 2P5GA 3MGHA 4GVLA 4DR4K 1X5PA 2K06A 1RWNB 4HTIA 4ZA1A 1ZQLA 3MPDA 4CLYA 3GV7B 4Q2LA 2ESEA 1MU2A 1NK4A 1FK9A 1ZQSA 5D3GA 3OD2A 2PD1A 2ZEJA 5ALWA 1T95A 1S22A 1EETA 1FJCA 4UBCA 2WSEC 5DMRA 2HHHF 2IBKA 2QXFA 3CC7N 4F5NA 4AILC 5IM0B 4FKYA 4DV1F 4JRPA 2FHMA 1AYEA 1U1KA 4Y2SA 1W25A 3R97A 3FBCA 5D4NA 4FWRA 3W62A 4Y0WA 1S0VA 4N41A 5ALEA 3CO9A 4K8RA 1FKOA 3AUOA 1NHKL 5GAGI 3NGUA 4EUVA 2IOFK 5LJVA 1VS3A 3U1MA 1ZQUA 2V63A 4ZJLA 4LF1A 4P4OA 4H5NA 3L2WA 5T14A 2XULA 7ICPA 4PXBA 4X65K 3BZQA 2ZH4A 1L7MA 2H3VA 1S4EA 2KTQA 1S76D 4M04A 1DQAA 2W2NP 2YKNB 4OV6A 2PMZF 4FLZA 4NCGB 4F93B 4K50A 3C5FA 2HVDA 4RBTA 4FXWA 2KXFA 2VQEJ 2HB5A 1QTNB 4RG8A 4ZITA 4WQ4C 2YWFA 4KLUA 5EE9A 2L9WA 1PGZA 1JLAA 4M9JA 1D9FA 3SFGA 3AVIA 2IDOA 3KK7A 1E6YB 2RU3A 2IMOA 2VFTA 4YN4A 4J9QA 4HCBA 4O5FA 4A2AA 5J2KA 4BR4A 3CD6N 5ALFA 5CA5A 5HHHA 2DQNB 3NMUA 2CGLA 4OX7A 3QSIA 1B92A 3VC8A 3KK3B 3LWMA 3BBBA 4Q45A 2F40A 2PFUA 5ELZA 2C3PA 3TPQA 2YY6A 3N4WA 1T7PA 2H3FA 1LW2A 1SJFA 5HHIA 2FY8A 4NYZA 4I2CA 4A62A 3DGPB 1D8YA 2BPGA 2ZZMA 3GE1A 3GR0A 1ZPVA 4J2DA 1SKRA 4K7QA 2MA1A 4IJAA 1Q86T 3KHGA 4BC9A 3HHLB 4FWPA 3R3TA 5DGAA 4F4YA 3H90A 3WKBA 1V4SA 3DI6A 3FBBA 3LA0A 3VGMA 3EICA 2NRTA 2JRZA 4U9RA 3MMBA 8ATCB 4EBEA 2Z2MA 3HX9A 3SQ4A 3A4TA 1RWUA 3PYDA 4RW6A 2XMMA 4DR5J 5KG3A 4W90B 2AWZA 2KYXA 2AJ0A 4O3NA 5AKZA 2MY7A 1RPLA 4HYKA 1NGEA 2H54B 1BC6A 5KFVA 3TTDA 2I8EA 4M9GA 4UY85 4JI2K 3B4MA 2XYPB 5C12A 3CCQS 2G4BA 2I6XA 2XMJA 4KLFA 1RAIB 3ATVA 4JKBA 2OEHA 4JI8J 4JI1K 3NL0A 2H51B 3BF4A 2FD2A 2EDUA 3DLEA 3J80O 2CUYA 5J2NB 3N4PA 2B9WA 2J7WA 2PGCA 5GAHP 4JV1A 3HD2A 2ZZNA 1JLFB 1PKUA 1TU0B 2BUNA 1RTDB 4UASA 7AT1B 4HEA9 3VALA 4ID5A 3CXCM 3QYPA 5M1KA 4NL9C 4KLQA 3VTIA 2FLLA 1ZTWA 3U1LA 3HO1A 9ICEA 1HBOB 4LF8J 3VCBA 1S72S 2W9CB 3DDIA 4ED5A 2BGGA 3H45C 5JXSA 3MTJA 3OR1B 9ICMA 2WAQF 1NZ8A 2F5GA 2XCAA 2MUTB 4KTQA 5KG6A 1Q81T 1HR0F 2EFNA 1WAJA 1X60A 3AA4A 2QZ8A 1IVZA 4EAHD 2UUTA 4OLAA 1LWCB 1AXQA 2CPEA 3QIOA 1WBDA 3CCMS 4OIXA 4IS7A 4UB8U 1G7CB 2Y9TA 2R9LA 2QX0A 3MDCA 3KOAA 1JL1A 4M0AA 2RHFA 3M7DA 4AL6A 4IOXA 4M5GA 2HFOA 5B0BA 2J9DA 4OCZA 2Q6CA 3ONNA 2AZ3A 5ALTA 1HYZA 4CJ7A 2HBLA 4RNNA 1QSSA 2R8JA 2GBZA 1ZOTA 1Q78A 2Q31A 4ZOSA 4C0ZA 3WUHA 3J81O 3WBZA 3KLEA 3I31A 3I0SA 4B3SF 3OXLA 2LA4A 3KXDA 1F9FA 3ISDA 3W66A 3IR6B 4I67A 5AQHA 1ZD3A 3F2DA 2I7NA 3CFPA 5HI7A 4ZHRA 4Z94A 1WUUA 1UL3A 1N33F 3UXNA 2A2DA 2O4IA 2VQFK 2ZOFA 2GJIA 4HACB 3UNGC 4L74A 5J2DA 4MJKA 1Y4ZB 2FLNA 1UA1A 3LP3A 1W2BM 3MR3A 2HMIB 4J9RA 3DHXA 3CRXA 1Z1BA 4NLWA 4USIA 2VV5A 4BC5A 4OPKA 1K8KB 7ICFA 2LQBA 5DB9A 4Z6FA 2W8LA 2G8KA 4YR3A 1FWKA 3LVWA 2LQ9A 4B17A 1V97A 4NB4A 2KJWA 4CE6A 4DQ8A 3KK1A 3O1BA 3FM9A 4NXNF 5AQKA 3OTBA 4US9A 1JX4A 2CFXA 1BNPA 4RQ1A 2NCKL 5CYJA 4RU9A 1P8ZA 2FBVA 4CVNE 3NRWA 3ETMA 1CC7A 4CLPA 2WBRA 3H40A 3VN5A 1VQ6N 4ZK7M 1S1XA 2G8VA 2UU9F 1UPMB 3E1YA 2P1JA 4IQXA 3QT6A 1C1BB 5EVZA 4NPOA 3L2UA 1BDGA 2QLTA 1DAXA 2XMAA 7ICQA 4DR7F 4CEQA 2QLWA 5M2RA 4FNHA 4DPOA 3TSPA 5H2FU 5BYSA 2UUCF 2HSTA 4KHUA 2JSXA 5JVGQ 2FDNA 3ZD8A 4QOZB 1YITS 1Y97A 4PHTX 2JXJA 2ZWPA 1S7HA 3HPHA 2CVIA 3ELHA 1FW6A 4IYQA 1OMSA 1RISA 5AM4A 1J9AA 3KLFA 4FJNA 4WJBA 4ZPVR 3D0PA 5C10A 3UKUA 4LFCF 5KFGA 1I5OB 4YORA 1JLEA 1N36J 2WF5A 3SBGA 2YV0X 1ZBHA 5BXIA 5DGBA 2JH1A 1U7LA 1I94J 1ZBUA 3T7ZA 7FDRA 2UP1A 4PWDA 2P9UB 4YHHJ 2HNYA 2BTFA 3FJ2A 5D0GA 4BC4A 2JLEA 3GCXP 1G6BA 4OYPA 3R1HA 5DM6Q 3BQ2A 5BR9A 4XK8C 1EXNA 2C3UA 3G2XA 4PG4A 1U47A 3NVMA 4CJKA 3GU3A 3G4SN 3IN5A 1BMQB 5KQ8A 1O8BA 3OXFA 2ZUCA 4M9HA 3HOTA 1UJ6A 4FYWB 5GIPA 1OPZA 1XR7A 1X0PA 2WF6A 4I2BA 1C2PA 4H0TB 2NRZA 2W2OP 3KOOA 4R8UA 2CAJA 2UXCJ 1FXXA 2IPOB 3E01A 4CGGA 4H4MB 4MF2A 2HF3A 2IYGA 2DTUA 1WEYA 4KHRA 2PI4A 4NLOA 5KFFA 1BUXA 3V9ZA 3M5RA 2DISA 2DNNA 2GV9A 4PPZA 3MM7A 4A2BA 4B3TK 1S6PA 4X66F 5JLFA 3ZSWA 3EE3A 1XQSC 9ICOA 1ZJNA 1UKUA 3ZNJ1 4FWMA 8ICNA 4OX8A 5H9EJ 3CD5A 2NS1B 4IDKB 2NZTA 5KFPA 4FS1A 3AVNA 3CJKA 1OVYA 3NS7B 4LZGA 2OEKA 3AO1A 4ISFA 2VODA 4AL7A 1HJRA 1CJKA 2VUGA 1RCHA 3G6XA 4B1XB 1RWWB 5E79U 4KLJA 4WQ5A 3R6GB 4DR3K 3SDEB 2JDJA 1WHXA 2EFPA 3FZ2A 3O08A 1VQLN 1HEKA 2UZAA 1IO2A 1NHVA 2WW4A 1UVLA 1OYDA 3JPNA 3W3SA 3KHHA 1VGYA 1SL2A 1U24A 4JMUA 2AQ4A 3RBZA 1KEKA 3DOMA 4OZ2A 5J2FA 2X6SA 5F8IA 2PC6A 2E5LJ 2PKEA 4F4ZA 1QVFM 3PKYA 1DQ9A 4BR2A 3AO4A 1MQ2A 2HQFA 4R0JA 1FRMA 1NJIT 2A1AA 3ID6A 1NXIA 1CJTB 5KPRA 1ZQNA 3MURP 1A0OB 4CGIA 1N5TA 2MB0B 3VQ9A 4KMOB 2IYIA 4FL9A 2CG8A 2BH1A 4XIUA 4AQYK 4F4KA 2BPFA 3HFVA 3AO2A 1FRHA 2VD3A 1YHQN 1J6ZA 5AQFA 1FFSB 1R6YA 2GVDB 3IWLA 1QJHA 1C1CA 1T44A 3ZX2A 4P74A 1GXUA 5DDOC 4IRCA 2IOCA 3NCPA 3S3NA 5IT9Y 3M8PA 4JI3K 4A57A 4JK8A 3UQSA 1NDLA 2E1MC 3MBYA 3D7SB 2OANA 3L2RA 1MWZA 2N3OA 3GJSB 3FLCO