2HHTA

C:o6-methyl-guanine pair in the polymerase-2 basepair position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhtA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhtA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhtA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhtA01
5EWFA 1D5AA 9ICSA 3KK2A 4I2AA 9ICKA 3L8BA 1LAWA 4AHUA 3C6TA 5DGAA 4BGDA 1JXBA 4MEXA 3Q8QB 5KFOA 4RW7A 3HXMA 3MR3A 1ZQCA 4CFDA 3O3FA 3CFRA 1BI4B 2PYLA 2OPRA 2C28A 2QKKA 5D3GA 2HHVA 2H5XA 5FDLA 5KRTA 1UT8A 2ZUBA 5J29A 1S0VA 3CQ8A 3H08A 3TAEA 1X9MA 4B8CA 2HHWA 4KV8A 3HP6A 4KLLA 3EY1A 3O4NA 1WSIA 1JLAA 3BQ0A 1LW2A 4J9NA 4I2EA 3QO9A 4G1QA 4EEYA 4FVMA 3WNHA 4CE9A 4IG3A 3V9SA 4BE2A 4GXJA 3KD1E 3QEXA 3VN5A 4YN4A 3G6YA 3C1YA 5BOMA 3VQ4A 1ZBIA 4F2SA 3H7IA 3K5OA 3EPGA 8ICJA 1ZQTA 4P4PA 2Z1JA 2P5OA 4J9QA 4NCGA 1BI4A 5DDMA 3N4MB 3VQAA 1C1CA 4DOCA 5L1KA 1RILA 1VSLA 1QS4A 3SV3A 4RW6A 5KFKA 3PUFA 4I27A 9ICXA 3M8QA 3JPPA 5TZVA 4DTJA 1WAJA 4ECZA 4PGYA 4J9LA 2W9BB 2E6MA 3NGDA 2I1QA 3V6DA 4DTMA 5DB9A 2VG7A 3ZSXA 4KN4A 4KAZA 4F92B 4ECQA 1T3NA 9ICQA 3SQ2A 3HJFA 2IA6A 3V6HA 2FBYA 4RW8A 2IAJA 4E0DA 3WNGA 3QINA 3OYKA 5KT2A 5C25A 3AO2A 5L9XA 1LB2B 7ICOA 1VSFA 2Z1GA 4F91B 1QTMA 1BL3A 1RBTA 4DU3A 4Z6EA 3BGRA 1X9SA 1BIUA 1QSYA 1TV6A 4CK2A 5KGXA 2HMIA 3CFPA 2GUIA 5KFXA 1RNHA 1JXEA 2OPPA 4CEEA 3ISCA 4E7JA 3QETA 4LD0A 2BPFA 3V72A 4JV2A 4IRKA 3HPGA 5JUMA 1SV5A 4ZTJA 3TQ1A 1XHXA 3TFRA 5DBCA 4NCAA 3SZ2A 4NLGA 7ICRA 3UXOA 1S9GA 3M8PA 1D9FA 3VQ8A 4ED2A 1Z26A 1LWCA 3RMCA 3H8JA 4BXOB 4KLMA 3DLKA 1U45A 5J2FA 4O3NA 3CYMA 2Q3SA 1S5JA 1BQNA 1TGOA 1H38A 3LAMA 2XCAA 3DRSA 3OYBA 2W9BA 5C5JA 3IAYA 4C8LA 1JLFA 5KG1A 3A2FA 4KFBA 3TWHA 4CEQA 4EP5A 1C6VA 8ICZA 3DMJA 4M3XA 1W9HA 4TURA 4FO6A 4JK1A 3AVLA 1S1VA 3MEGA 3TAGA 1RBSA 1RBVA 4K4IA 2P1JA 4R8UA 4AHVA 3RBEA 1TL3A 5IIOA 4F8RA 4YMOA 1ZQQA 1IO2A 3TI0A 2V9WA 1KRPA 4Q5VA 2PFQA 2XC9A 2QK9A 1EETA 3AVMA 4B9UA 1WCNA 1MSWD 2XGQA 4CIFA 7ICIA 3RH4A 3NF7A 1UA1A 1FXXA 3JPNA 2G8IA 1JLEA 2B5JA 3H4DA 4XIUA 7ICHA 5KG0A 2G8WA 4BWMA 3OYEA 5FRNA 4KKOA 3MR6A 4YXMA 2OYQA 2BCSA 1D8LA 1RYSA 4YMNA 4Z6CA 2LYHA 4EZ6A 1TVRA 1BPZA 1L3TA 4B9VA 5J0UA 4O4GA 3NF9A 4YG2A 4TUSA 3I0RA 4IDKA 4KHSA 1BPYA 3OYMA 1RT2A 2C2EA 4CJLA 4L8RB 3V6JA 4YXJA 4M3UA 4QW9A 3JYTA 4NM1A 3VA3A 4Q0BA 5KT4A 2OA8A 4CCHA 2ATQA 4KLDA 3EW9A 3ZSRA 3OHBA 1JLCA 1UT5A 4DL2A 4UB5A 3MEEA 5HBMA 3OYDA 4ECTA 5KRSA 2AGPA 4Q43A 4FZZA 4CGDA 1BHLA 4CESA 3OJSA 4ZH4A 1NJXA 5HP4A 1RTJA 4QZCA 1WSEA 2HHQA 9ICUA 1U48A 3V9WA 3L3VA 4M9NA 4J9RA 4PPXA 2AJQA 2OZMA 1FK9A 1CXUA 4R8UB 4Z4EA 1WSJA 2BCUA 5EOZA 3AVCA 3AU6A 3S9HA 2AQ0A 3OSPA 3K2PA 4ECXA 1RDCA 1BPEA 3QIOA 1XI1A 3TARA 1X9WA 2AU0A 3IG1A 4CJFA 3KD5E 3PR5B 4YFUA 2FBXA 4M47A 3M9MB 1SL0A 4JUZA 2O4IA 3NCIA 1K1QA 3VQ5A 4I2FA 4E1NA 4DTOA 1NJYA 3DRRA 4IQVA 4J9SA 3MAQA 2JEFA 1XU4A 4GXKA 4FCYA 1C0MA 1K6YA 4NLZA 4BDYA 4C8MA 2F1IA 4GLXA 4IBNA 4JRQA 2R8JA 4CJEA 3T5KA 2R8KA 5DKWA 1CZ9A 4B8AB 2V4RA 4J2EA 7ICJA 3PX6A 1JLQA 4Y1DA 4LZDA 4E19A 2Z1IA 3DLGA 3M8SA 3RJKA 3AO4A 4F4KA 4LSNA 4EBEA 4F5RA 1ASVA 1JMSA 1HUOA 2X6SA 1LV5A 3KLFA 4CHNA 1S0NA 2B6AA 1ZQOA 5J2NA 5KG7A 1TFRA 3RBDA 4PHPA 5J0TA 1ZQPA 3P83D 4RW9A 1RXVA 4CJUA 3G0ZA 1ZQXA 4J9MA 1KTQA 1I3AA 1SZPA 1TK5A 9ICRA 4M6WB 3RJIA 4F5QA 5T7BA 1JX4A 4RT3A 2GWSA 3NF8A 1IKWA 3K57A 4K8XA 3LP1A 3ZT0A 5IIIA 1D9DA 3ISDA 1VK0A 4YNQA 3V9XA 4DTRA 2PZSA 3RB3A 3VQEA 4DFKA 2DPJA 4E3SA 3GDXA 2PI5A 9ICFA 4CEAA 2F8TA 1BIZA 1HYSA 4DS5A 3FDSA 4ZHRA 5KFRA 4I2GA 1V9PA 3G6VA 2NRTA 2NUBA 5JS1A 3U3GA 1GOBA 1VSIA 4Q44A 1B22A 3LWLA 3RMAA 4O3OA 1A5XA 4B3OA 5D46A 1NKBA 4M3YA 4MEYA 1QQCA 4O3PA 2FBTA 5IIJA 2OPQA 2KQ2A 3P1GA 2PY5A 3AU2A 8ICCA 8ICPA 9ICLA 3FFIA 4FLUA 1L5UA 1MC8A 5KFDA 4BWJA 4YP3A 4DL4A 1NKEA 5KFUA 4O9MA 3GV8B 1IKVA 2NRXA 1J9AA 4FJJA 5HRPA 1Q9XA 4MFCA 1NJZA 4IG0A 4FW1A 3NH0A 3T5HA 4RQ3A 5HRSA 3MABA 2B21A 4KLUA 4QZIA 3Q8KA 2J6TA 3JPQA 3AVHA 5I42A 3LWMA 3OS1A 4CFCA 2JEJA 4LY7A 4YR2A 4QWAA 4DU1A 4O3QA 4IRCA 4CF1A 3TANA 3KLGA 3D45A 2MUTB 3PVXA 3SPYA 4QAGA 2ISOA 4J2DA 4FJ7A 2IBKA 4ED0A 2G8FA 9ICPA 3Q8MA 4DWIA 8ICIA 3CG7A 9ICTA 1KLMA 2XY5A 4FJLA 3NF6A 4FJGA 3RJHA 1JLBA 4CGIA 8ICAA 3C2MA 2FLLA 4DEZA 2YKNA 5HROA 3O3HA 3KHRA 2FMQA 4FJHA 4UB1A 4XUSA 4E7LA 3NGIA 3ZDAA 4MFFA 3G10A 4CK3A 1NK9A 4FYDA 1T7PA 4XQ8A 3T19A 5IIKA 5SWMA 3VQQA 2MUTA 2P6RA 4CIGA 3SUQA 1NK0A 7ICFA 4DOBA 3ZT4A 4RNMA 5CJ7A 7ICMA 3L3UA 3ZCMA 4FS2A 8ICKA 2JZBA 4UB3A 8ICVA 4O5CA 3LPTA 1VSKA 3PV8A 4E7KA 3PX0A 4I28A 4MFBA 3C94A 1S1XA 2YNGA 4CEOA 4QOZB 4I9QA 2HB5A 5HP1A 7ICVA 1ZQVA 2V4QA 4I2BA 3DLRA 1KEJA 2C2DA 4DSJA 3ZSWA 3HVTA 1U9LA 4UBCA 1XSLA 3HW8A 4R63A 4WE1A 5HNKA 3RH6A 2PYJA 4OVLA 2Y1JA 4KLIA 5KFPA 1BCMA 1NOYA 5CP2A 2ZJ5A 1RYRA 4M9LA 8ICYA 4O5BA 3L2WA 1ZQHA 3K5NA 4CGJA 1WCLA 2F96A 4ECSA 4QZEA 3MGHA 3DYAA 5D49A 4I2JA 3I0SA 4B9LA 1ZBFA 5KFJA 4KLFA 1COOA 3NH2A 3QESA 1KFTA 3ZD8A 1ZQDA 4DG1A 4F93B 5KT5A 4CF0A 3VQ9A 3OY9A 5CHGA 1N56A 3HPHA 4KPYA 1ITGA 5KFIA 2P51A 4UBBA 1JXLA 4KTZA 3ZSQA 1HMVA 3AVGA 2O4GA 5HHHA 5DGBA 3SYZA 4DQSA 4I2HA 5KFEA 1BGXT 1CEZA 4DTUA 2HHUA 2AGOA 2XY8A 9ICCA 2BCVA 3K59A 3S3OA 1HUZA 3K4GA 2P6UA 2UVWA 5HRRA 2RPIA 4FJ5A 8ICLA 3SQ4A 4PHDA 4F5OA 4IKFA 3H4BA 9ICIA 1C1BA 1B43A 4DQPA 4CEFA 3KK1A 3C95A 3UQ2A 3V6KA 1X1PA 1REVA 4QZ8A 1AROP 2FPMA 5J0WA 2AGQA 1J53A 1TKTA 3SNNA 4ED1A 3ZT3A 1VSMA 1TVAA 2HVIA 4CGHA 4FM1A 4BDZA 4KTQA 4NM2A 1S76D 2XY6A 2ASJA 3QERA 4KLEA 3B0YA 3UXPA 5DBBA 2G8KA 4DTPA 3UIQA 4DQRA 4DMNA 1GOCA 3PR4A 3BQ1A 1ZQFA 3RRHA 2BPGA 1XSPA 5CWRA 4JRPA 4YR0A 5IINA 4CGGA 4DL6A 8ICNA 1XHZA 4FBTA 1N48A 4JV0A 5KFWA 4I29A 4CJVA 8ICEA 3SJJA 3JPSA 3KTQA 4UAZA 1U4BA 3HP9A 3EZ5A 1T03A 3UPQA 1LW0A 1I39A 1ZQEA 1N6QA 3G6XA 1RT6A 4CJ4A 4E7HA 5DQIA 4CHOA 1IG9A 1JIHA 1TKDA 3DLBA 3L2UA 3OS0A 1ZQRA 4W5OA 3JSMA 3OYAA 3K75D 3K5LA 2OPSA 3B6OA 1IKXA 3ASMA 4FM2A 3MXJA 5D4BA 2BQRA 4J9OA 4KLJA 3E2EA 4IQTA 1W0HA 2KFNA 1RDDA 3LAKA 1RDAA 3HM9A 5KT6A 4NCBA 1XS9D 3RMBA 4CJSA 2DFFA 1Y88A 4M0AA 4DFPA 1S1WA 2FC0A 4PGXA 1B9DA 2E4LA 4W5RA 3AA3A 3KLIA 1SUQA 3RJFA 4RQ7A 2A1JA 9ICAA 4M9HA 3EPIA 1QLNA 4QCLA 2M9NA 5L1IA 3ZDDA 3GV7B 3GIIA 5KFGA 4DSIA 4GMJB 8ICFA 3DLEA 4ECYA 1RT7A 4IFVA 2W42A 4DF8A 4C8OA 2BHNA 5CR0A 4RPXA 3QZ7A 4UB2A 3OJUA 7ICUA 1HQUA 2HNZA 1ZQIA 1G15A 3WNFA 4J2AA 8ICHA 1KFDA 5CA7A 3T3FA 3EYZA 4M41A 1ZQZA 5J0QA 1JL1A 4F3OA 4Z0UA 1RZTA 1Z00B 1ZQMA 3QEBZ 4UAWA 4FK2A 1DLOA 3E01A 1ZJNA 5J2HA 2BCRA 1MQ3A 3KKRA 4QW8A 5J2CA 4P2HA 2P66A 3ZDEA 4DQQA 3DLHA 1KCFA 3V9UA 4Q8FA 3HL8A 4ELUA 1MQ2A 5DB8A 4F4WA 1CZBA 3ALYA 2RDIA 3L2QA 2GV9A 4Z4IA 3GQCA 3SUNA 3TFSA 4OGCA 2KW4A 2NRVA 5F9LA 4E7IA 1O1WA 1S1UA 4FLTA 1JLGA 5SZTA 4DQIA 2DFHA 3ZSZA 1Z00A 1A5WA 3MECA 5DQHA 2IHNA 5J2KA 3B0XA 4YFKA 2ZUCA 2XRIA 4DLEA 4I9LA 4KHQA 2HNYA 1J5OA 1LWFA 4HUEA 3M9NB 4B9SA 3C2LA 1RT5A 2X78A 3VQ7A 4W5TA 4CERA 4Q8EA 4JLHA 1KFSA 5DG8A 2G8UA 2RKIA 5KFQA 2RN2A 1Z3EB 3KLHA 1IM4A 5J1EA 1L3VA 1DGSA 1EX4A 3MR2A 1Q9YA 3RB4A 2A1JB 4EZ9A 4OJRA 5HMLA 1YT3A 4YVZA 3OHAA 2BQUA 1WN7A 4K4HA 3CFOA 1NJWA 4H4OA 3C23A 4DL5A 4DSFA 7ICQA 3MR5A 4PHEA 3SQ0A 1NK5A 2JZBB 4ED7A 2FMSA 2ASDA 2UVUA 1WAFA 3ZT2A 4M04A 3VQ6A 2YNHA 4BDPA 1ZQNA 4IQUA 3U3YA 1F21A 4FJ9A 4EBCA 4O55A 3MBYA 1GOAA 3AV9A 1C7YA 4FLWA 3SUOA 3U6FA 4KHWA 3RH5A 3RAQA 2BR0A 3LANA 2PXIA 2MAXA 4KITB 2D0CA 2HHTA 4HYKA 5J2MA 4EYIB 3SI8A 3C5GA 3BQTA 4RQ0A 5KG6A 3OSNA 2IHMA 1RTIA 3LZIA 3LDAA 4NXZA 3AO3A 1DTTA 2EX3A 4BXOA 3MFHA 1RT1A 2RF2A 3OYLA 2IMWP 3AVKA 3HX0A 1S97A 4CFBA 3VQBA 1U49A 4DSKA 3GFKB 3QEVA 1YTUA 1K1SA 1NK8A 4QZDA 3VQPA 4EP4A 2ZJ8A 1ZQJA 4OKJA 1U47A 4HCBA 1C0TA 3C2KA 3TAQA 4QZFA 1TAQA 5HHIA 9ICNA 4RT2A 2Z1HA 1RT4A 3T1AA 5KFZA 4FLYA 2VWKA 5KFCA 4G3IA 3AA4A 4ELTA 3KIOA 3OYGA 2B4JA 5J2DA 2ZJAA 5KT7A 1RBRA 4OPKA 4RUCA 2G8HA 3RR7A 4HUFA 4YCXA 1RT3A 4RQ2A 4Z4HA 3MGIA 4GW6A 1VSJA 4O0IA 2IDOA 3QEPA 4O3RA 4DTXA 3GIJA 3C6UA 2G8VA 3PO4A 8ICSA 3AUOA 1XO1A 3T5LA 4F4XA 1ZQLA 3M9OB 9ICJA 3H8WA 3ZSVA 3GIKA 4Z4CA 7ICGA 4CJKA 4NLNA 4EBDA 5J2QA 3RTVA 3HK2A 1RCHA 4CIEA 3C5FA 4E1MA 1X2IA 4LH4A 2KZMA 8ICWA 4K8ZA 4RUAA 2JEGA 3QNNA 4X5VA 2BPCA 3RMDA 3JPRA 2EHGA 2D5RA 2C22A 1NK6A 2UVVA 1UWBA 2DFEA 3QIPA 4R5PA 5FRMA 3AVAA 1J54A 5EWEA 3KHGA 5J0XA 4AHCA 4DFJA 1SKRA 1XWLA 4KLTA 4C8KA 1HJPA 7ICNA 4RZRA 2FPKA 3NGZA 4FZXC 1NK7A 1S1TA 3ITHA 4F5PA 5KGWA 4TUQA 5CB1A 4FLZA 4KI4A 4PHAA 9ICGA 4RG8A 2VG5A 2VA8A 2A1RA 2PFNA 5CZ1A 3AO5A 2LSNA 4CHPA 4CECA 4N47A 3MXIA 2IOCA 4Z4FA 2FMPA 2VANA 2KZZA 3SI6A 2BE2A 2ZQBA 3HVRA 2W9CB 4FBUA 1HNIA 1EKEA 4ECUA 1JKHA 3LDSA 4FXDA 5J0YA 4RPYA 2A1SA 2WTFA 2F1HA 2JGUA 2BCQA 4I2CA 1SL2A 2VG6A 3LPUA 4JWNA 4RQ5A 3ZDCA 5CZ2A 4CJPA 3T5JA 9ICEA 3ZT1A 5EWGA 4GVMA 4ECRA 3VQDA 3PMNA 4F4YA 5HMMA 3LP3A 4M9JA 3DOLA 3OS2A 1Y97A 4DLGA 1BVSA 4BE1A 4F3TA 4TQSA 4AHTA 3MDCA 3ZD9A 4KLQA 1WSHA 3V7JA 1KSPA 5CYMA 3OYHA 3RR8A 4KLOA 5HRNA 2GBZA 4KN7A 5J0OA 5HLFA 3BDPA 1C1AA 2W9MA 3B6PA 4R64A 1L3SA 4PA1A 3UQ0A 3V81A 2AQ4A 1JL2A 4NLKA 1BISA 1C0UA 2ZE2A 3LK9A 3RJJA 4C8NA 4UQGA 4FK0A 8ICGA 2YNFA 4KLHA 5J2JA 3TAPA 4YMMA 4E89A 3OGUA 3H8SA 4HHTA 2OWOA 3OVNA 4KRFA 3NTUA 3GIMA 5K14A 4KHUA 3QZ8A 5KFVA 4TQRA 3LP0A 1ZQAA 1WLJA 5CYQA 3MDAA 3MEDA 4O44A 4M3RA 4PGQA 3AVJA 4CK1A 4W5QA 4YR3A 2I5JA 2KTQA 3NH1A 4BE0A 4DL7A 3KJVA 1S0OA 5DLGA 4RQ4A 7ICPA 4MQ3A 3AVBA 4QWDA 3AVNA 4OPJA 4ELVA 5DB6A 2KFZA 4JS5A 4PY5A 4CJ5A 3ZDBA 1CLQA 9ICVA 2W8KA 3HYFA 5L1LA 1TKXA 2ISPA 3SPZA 2VA2A 4NYNA 1VRTA 4QZBA 1UAXA 3RWUA 4R65A 5J2EA 3PNCA 3THVA 1R0AA 5KG5A 3AVFA 3NHGA 1RTDA 2ZTEA 3KLEA 4Z6FA 5L1JA 5KG3A 8ICTA 4UB4A 1T05A 4DF4A 2D0AA 4AHRA 1LAVA 3CM5A 4FJKA 3TAMA 4TUPA 4PH5A 1SKWA 4FM0A 3IHQB 5IIMA 2ZTCA 1XC9A 1NK4A 2XY7A 3C21A 4FJMA 2XO7A 4R66A 1S6PA 4RNNA 3ORYA 1RBUA 4F5NA 3NFAA 4N41A 2NRWA 5C42A 3NAEA 4K4GA 2DTUA 3SV4A 2ALZA 1CUKA 2R8GA 4ECWA 4M3WA 1TKZA 3DOKA 4DTNA 3KHHA 1B92A 3VQCA 4FJXA 4J9PA 5DK5A 2W8LA 4B08A 2R7YA 3N97B 4MFAA 4RW4A 3HSTB 3GV5B 1NKCA 4PUOA 1FKPA 3IM1A 2KN7A 3V1RA 5KG4A 4DSEA 4UAYA 3DRPA 1HJRA 1HQEA 5BOLA 1HYZA 1KVBA 4ICLA 4HVJA 1ASWA 2IC3A 1KVCA 4PWDA 1SL1A 2DFLA 2VA3A 3V7LA 4I2DA 4HUGA 1HYVA 4CJTA 4KI6A 1DTQA 1UOCA 4Z6DA 2DPIA 4M3ZA 1BQMA 4FLXA 1ZQWA 3OYCA 3TABA 5FROA 4FS1A 3PO5A 7ICSA 1LWEA 9ICWA 5KFTA 4LH5A 1BPDA 4DU4A 5E41A 4ECVA 4MF8A 1ZQSA 1TL1A 4B9NA 1ZQBA 1RDBA 5F9NA 3TR8A 4DO9A 2YKMA 3HPOA 1DOQA 2R8IA 5J0SA 5J2AA 4OLBA 3V4IA 4YD1A 1NOMA 4ED3A 5DG9A 3Q8PB 1RPLA 2KZ3A 2NRZA 2UVRA 3QEIA 3AA5X 5I3UA 1VSHA 4EYHB 4MF2A 1N5YA 4FW2A 4GC7A 8ICMA 4H8KA 2FPLA 3PX4A 1UA0A 4I2QA 1IXRA 4OGEA 1ZBLA 4P4OA 4IR9A 2IS3A 4KREA 3LP2A 3PW0A 2WOMA 4Q45A 4FZYA 1S6QA 3RB0A 2ZTDA 3WNEA 2JLEA 2X74A 4QZHA 2F1JA 3ZSYA 4HCCA 4CF8A 4CJRA 1S0MA 2DY4A 5KG2A 2ITGA 4CEZA 4XA5A 3IRXA 1ZBUA 7ICTA 3RAXA 4LSLA 3S3NA 4OKEA 2X6NA 4O3SA 4KHNA 3OYNA 1QSSA 4CJ3A 3PY8A 5KFSA 2HHXA 4JWMA 2P5GA 2HNDA 3BQ2A 5BPCA 5IILA 4KB0A 3NGYA 4FJ8A 3AA2A 4N76A 2W9CA 4M9GA 3ISBA 8ICQA 1U04A 3P5JA 1HNVA 4M45A 5DBAA 3IS9A 3HT3A 4I2IA 3F9KA 9ICOA 1EP4A 3HWTA 4FJIA 4B9MA 4KTWA 4RPZA 2WONA 4LZGA 1PZNA 5J2GA 2BGWA 1ASUA 4BACA 5J0RA 3RRGA 4CF2A 3OYFA 4DS4A 4RQ1A 4GXIA 2BQ3A 4OLAA 3LZJA 1HRHA 3AVIA 3CM6A 4CHYA 4Y1CA 1FKOA 4KB1A 1EXQA 5CY4A 3ETLA 4F50A 1CXQA 4NY8A 4O0JA 1ZQUA 8ICBA 3NE6A 4ED6A 4N5SA 3L2VA 3KHLA 5DG7A 1A76A 1NOZA 1YTAA 4DTSA 1TV9A 4Z4GA 4QWBA 5DQGA 2YV0X 4M3TA 9ICBA 4CJWA 1Q8IA 3H40A 4IRDA 4AHSA 2ZUDA 2BGGA 5KTQA 4QZGA 2E6LA 3FYHA 5KFHA 3F73A 3V1OA 3AO1A 3I8DA 3SQ1A 1BPBA 1ZQKA 1MU2A 9ICHA 2PFPA 3ULDA 4RQ6A 4O5KA 3L2RA 5DLFA 4QWCA 5J2PA 4KLSA 4FLVA 1WSGA 8ICUA 4KLGA 3O3GA 1D8YA 3ISNC 2YHBA 2ATLA 5DB7A 3SCXA 3MXMA 3KK3A 3C1ZA 4ID1A 1TAUA 1JN3A 4CHQA 1B9FA 2Q0ZX 3UXNA 3NBPA 3V1QA 1VRUA 5KT3A 7ICLA 4AH9A 3VA0A 3O4QA 2XHBA 1ZQYA 1QE1A 4W5NA 3EWAA 4CEDA 2ZD1A 4CF9A 1T8EA 3OYIA 2OZSA 3TAFA 4CGFA 4GC6A 1KVAA 2YNIA 3SUPA 3DM2A 3JPOA 4I2PA 3PW4A 1L3UA 3BJYA 4FJNA 3NDKA 5KFBA 1RTHA 4CHZA 4KHYA 2W9AA 1IKYA 4QWEA 4ZTFA 3PW7A 2BDPA 2FBVA 4JV1A 3ZSOA 4HTUA 2F8SA 1T4GA 3LALA 3PW2A 2J6SA 4M2YA 4FK4A 4IQWA 3MFIA 1BPXA 2ASLA 2QKBA 1VSEA 4RQ8A 4M6WA 1S9EA 2HHSA 5J0PA 3S3MA 3DI6A 2BANA 3D0PA 4J2BA 4F2RA 2YHAA 4NYFA 1VSDA 3QLHA 1Z25A 3Q8SB 1S77D 8ICXA 4M42A 2BKEA 4KMUA 5DMRA 1TK8A 2XCPA 5KFAA 4KO0A 5KI6A 4RU9A 3Q8LA 3PMLA 3JPTA 4OKKA 3M8RA 7ICKA 1A77A 1RXWA 2HVHA 2IGIA 2XGPA 2Y1IA 1ZBHA 4QZ9A 2JEIA 1QSLA 4CJQA 2R8HA 1KDHA 4H4MA 1QHTA 5C24A 4O5EA 1S10A 5J2BA 4ED8A 5KFFA 4CEBA 4DFMA 3QEAZ 8ICOA 4DSLA 4N56A 4AILC 2PFOA 4ID5A 3QNOA 1XSNA 4LVSA 3QEWA 5EU7A 5KFMA 4DOAA 4IR1A 3Q8RB 5JS2A 3K5MA 4JS4A 3PW5A 1SKSA 2RDJA 1KLNA 4DL3A 4RNOA 4F4ZA 2PI4A 9ICMA 3V9ZA 3QE9Y 4QZAA 4I7FA 1S9FA 3RB6A 5J2IA 5KFLA 1ZJMA 3GILA 2QXFA 4TSXA 1WNSA 2ETJA 1ZETA 1ZQGA 3V7KA 7ICEA 1IH7A 1A5VA 4PQUA 5KFYA 2VWJA 4XRHA 2HW3A 1HPZA 3HO1A 1YVUA 3RJEA 1WSFA 2I9GA 4J9KA 4P4MA 1ZYQA 8ICRA 2FLNA 2FLPA 4YD2A 3RJGA 3K58A 1TK0A 4CFAA 1EXNA 2J6UA 2D0BA 4YQWA 4IFYA 3OYJA 3KKSA 2C2RA 4B9TA 1BCOA 5DDYA 5KFNA
chains in the Genus database with same CATH superfamily
3VGUA 3H2VE 1D5AA 4WPAA 2BUPA 4YOVA 3L8BA 4DUZF 4AHUA 2HS0A 1JXBA 3Q8QB 3HXMA 1RT6B 3MR3A 3KJVB 4M5KA 4RU2A 1MWKA 4ANCA 4RWWA 1VISA 3CFRA 4EUVA 2RILA 2YXLA 1BI4B 1NLVA 3D0IE 2PYLA 2OPRA 3MMAB 5D3GA 5HQMA 1VJWA 4IFVB 8ATCB 4H0OA 2ZUBA 4PXEA 3N28A 1HNVB 5HJXA 1X9MA 4B8CA 4TY8B 3CRXA 3TSUA 2HHWA 2XB2D 2CQ4A 3KZXA 4DR6K 2LECA 2KYZA 3EY1A 3O4NA 2NUHA 4AQYJ 3UPFA 4ZLNA 1QAIA 4USKA 1VJ5A 2HZVA 3H45C 4K4WA 4FVMA 3WNHA 3TEGA 4CI6A 1PVRA 4BE2A 3KD1E 4JI6F 3M1VA 3RUBL 1WBDA 4CO2A 3G6YA 4NEYA 3C1YA 3C46A 2X1FA 3HCXA 4DCPB 3VQ4A 4U96A 4DKWA 5AQRA 1BDGA 3EPGA 2N3OA 1QJHA 1VC0A 1RILA 1VSLA 3LP2B 1HYSB 1KS2A 4OJPA 3SV3A 4EWTA 4DCJB 1VQ5S 4PXDA 4LFAK 3F9MA 1QVFM 9ICXA 2BYCA 4ECZA 4EENA 2E6MA 5LSRA 3FEYB 1FERA 5EX0A 1GXTA 1WHYA 2H65B 4ZPDA 4YHHJ 3V81B 1AFJA 1IWAA 4ECQA 9ICQA 5G0RA 3V6HA 4DV3F 2KHVA 2D7SA 2ZC4A 1Q0NA 3G4SS 1BU6O 3BF3A 5H2FU 4CLWA 1FKAF 4C3MA 1RG6A 1LB2B 3LPYA 1T3OA 3ZZOA 4NXNK 1S3XA 4JKAA 2UUCF 5DETA 3ULEA 1BL3A 4UW2A 5LMUJ 2H3FA 4Z6EA 3IFRA 2M88A 5KGXA 2BA9A 3DNCA 4Y2QA 3P38A 4OI0A 4OJ3A 4OI6A 2GVDB 2A2CA 1MN9A 2R4FA 5LM7E 4NXMK 4B3RK 3V72A 4IRKA 4JHDB 3HPGA 4F0MA 1O08A 3M2VB 2CJYB 2VDIA 4E1JA 4F0KA 3QT6A 4NCAA 4K4UA 3QUCA 1J2VA 5JXSA 4F9OA 4PUOB 1IXKA 3CUNA 3ENHA 1A6LA 5CRXA 2HWHA 2IVFB 2DQNB 4LUBA 1S5JA 3SAHA 2RKIB 2WB4A 4H0YB 2R7VA 3DRSA 3PRBA 5L9NA 1RZMA 3A8YA 3E01B 1HWLA 3KLVA 4CNQA 3A2FA 4KFBA 1H98A 4ZP9A 4AQYF 4YOWA 2ZD1B 2JFKA 3ZTPA 5BRFA 3QX7A 4TURA 2LCWA 3FEZA 3ZXWA 4FO6A 2K4HA 1NLKL 3TAGA 2E29A 1Q86T 4BR4A 3M8WA 3DCAA 1Y5IB 3CI5A 4R8UA 3DM2B 3M6KA 1WJ9A 3DXMB 3BGOP 3TI0A 2ADBA 1BA1A 5BPMA 3DOMB 3S01A 1WCNA 2E1EA 1GLDG 1DT9A 4YDDB 4LFBF 1U2VA 1MSWD 2BW7A 3NNHA 7ICIA 3NF7A 4UATA 4NL5A 4JI4J 2G8IA 4KMOB 4XIUA 3F5EA 2NZ4A 1F9EB 4U95A 4DV4K 1TL7B 3GJQB 2FPHX 2RIJA 4JI1K 1YJNN 2DGWA 1D8LA 3O2IA 3QMLA 1J5EK 4YMNA 2WVEA 1BPZA 3AAPA 2PMHA 1N32J 2KM8C 3NF9A 4YG2A 4DPWA 5GAHP 2HURA 3CPEA 2KDOA 4FYYB 1QM9A 1BPYA 3N5FA 3OYMA 1TR0A 1S1TB 4R25A 3JYTA 3SIPB 4ZDNA 4NM1A 4Y6IA 1BA0A 4Q0BA 2DISA 4ZVSB 4CCHA 1DTQB 2CG8A 3VQSA 1C1CB 3FSXA 3CPWM 2B4PA 5HBMA 5FPNA 3ULHA 4CZCA 5KRSA 1TL3B 4G9BA 3H5UA 3TVKA 1YZ7A 4Q43A 3UMBA 5HL7L 2DYAA 3NVKA 2B8PA 2W04A 1Q18A 4UQTA 2QB0B 4QU7A 2K4IA 5IT0A 2W03A 4DHVA 4YB7A 1RTJA 4QZCA 1YIJS 3PNIA 1WSEA 2QTDA 1LOTB 1P6TA 4IO8A 2AWZA 3O08A 1LW2B 4J9RA 2HZCA 4BRLA 2OZMA 1VQSA 2BCUA 1ZQ1C 5EOZA 4LFBJ 1KAZA 3BV8A 2RE1A 3M2RA 1URJA 1BPEA 4NXNF 3ICLA 1XI1A 3IG1A 3NCQA 2AP6A 4X65K 3ZNUA 4LF4J 2VPWB 4JK7A 1NHVA 4JUZA 3VQ5A 1TELA 4DTOA 1NJYA 4ACOA 3DRRA 4IQVA 2YPYA 2Y9HA 5ALPA 4GXKA 4FCYA 3P96A 1C0MA 5E33A 3MK6A 1NG9A 3E58A 4C8MA 5ITHA 5BPLA 4JRQA 4CJEA 3M6GA 4R79A 4O5FA 3PJXA 1ATSA 1CZ9A 1OIAA 1HARA 2GLEA 4LZDA 3M8SA 1T94A 1MMDA 3AO4A 1R8HA 1BWEA 4EBEA 4MKVA 5M1QA 4F5RA 1PSDA 1LEOA 2RJZA 1TMMA 4PAAA 2CH6A 1HUOA 2X6SA 4OYZA 1LV5A 5IM0B 3CCSS 4K8RA 1GLAG 5KG7A 5GINA 1TFRA 4RW9A 2ADCA 2DNRA 4HACA 4HEA9 4LRBA 3CW2C 1TK5A 9ICRA 1SS6A 5EE3A 1FNXH 1R89A 2GWSA 2LQ5A 3OTDA 3FQKA 4ZN3A 3EZOA 3ZT0A 2KG5A 4AFFA 4DCCA 2KG0A 2D1KA 3ISDA 1TU0B 1VK0A 4JI0K 4DTRA 2PZSA 3RB3A 2DPJA 2UXCF 3TU5A 1H2VZ 3PTWA 1Q8KA 4CEAA 4ZHRA 5KFRA 1ZBTA 4X62F 1JNRB 2CRLA 1X4EA 4Q44A 1B22A 4JI0F 1A5XA 1HR0J 3X1LB 3NOCA 5E3RA 4M3YA 1QQCA 4O3PA 2FBTA 2GW8A 2JC1A 4XH5A 3FFIA 4GY2B 4H5NA 1F5CA 2M0NA 1MC8A 4YP3A 2CNOB 2IY5B 2V6AA 3KYLA 3ZC4A 3R97A 1X9XA 1MROB 2D3ZA 1C0TB 2XMAA 3WXJA 2BM0A 3VMFB 4IG0A 3NH0A 4QYZK 3A5NC 5HRSA 3MABA 2HOIA 5CZVA 3WQUA 4B3RF 3MGVA 3CNQP 3C65A 4MFBB 4HVZA 2W7AA 3UD3P 1V3RA 3JPQA 2VU5A 2O8FA 2B56A 5TKWA 5I42A 4OI2A 2GO9A 2QMUB 4PRFA 4BRQA 1RAOA 2JEJA 4LY7A 4YR2A 4QWAA 4DU1A 3PDNA 3N7RC 1EARA 4AT1B 2KVCA 3D0GE 4FZMA 3KLGA 1V6HA 2MUTB 4ZPAA 2ISOA 3P8BB 4JKBA 3SCJE 4IOCL 4ED0A 2G1DA 1S1UB 3R7BB 3S8SA 2UXBJ 2DGXA 3Q8MA 1W25A 3ADAC 3D9BA 3OL6A 2XY5A 4E98A 4UY8T 5ETSA 3PM9A 8ICAA 2NYVA 5EXWA 2YKNA 5HROA 5HQLA 3TTFA 2WB1F 2MB0B 3KHRA 1Z2ZA 4RW7B 2FMQA 4ZS6A 4IO1A 2VF3A 1X7VA 1L6NA 2CAJA 4QPTA 4DV4J 3KZIU 4M5DA 4XQ8A 5IIKA 2PMZD 2YMQA 2KM8B 2MUTA 2P6RA 4CIGA 1SH0A 4CNZA 2XO6A 4DOBA 2QWPA 3MN5A 5C0YA 1PC5A 2MPUA 4RNMA 4UOCA 5CJ7A 2JRSA 2V9KA 2VFUA 2R7QA 2JZBA 4UB3A 4MHVA 3GPAA 2P9KB 2PFFB 3NVMA 1HI0P 2W6LA 4I28A 1NDCA 4MFBA 4V19X 1S1XA 3C94A 1HL6A 2YNGA 2HB5A 1PVPA 5EE1A 2H1YA 2BE2B 3DLRA 2E2PA 2Z2ZA 3ATVA 3ZSWA 4F7VA 5FD1A 4JI0J 5AJ3J 1PK3A 1TUUA 2MQNA 2RS2A 2N7CA 4OVLA 3AM9A 4KLIA 5AKZA 5H9EJ 5KFPA 2GJFA 4LF2A 1NOYA 3OFGA 5CP2A 1RWXB 4OCZA 3NKYA 1HIYA 2DO0A 1YI2S 5B66U 4TLRA 1JUDA 4BC2A 2F4VK 2W01A 3L2WA 3K5NA 3C15B 2LEBA 2BX6A 2LM4A 4PR6A 1X3NA 3NRWA 1NGCA 4GKJK 4QZEA 4ZMMA 1QTNB 3W61A 2LA4A 3MGHA 3I0SA 3A8EA 4KLFA 1COOA 2V7YA 1Z4OA 5T14A 2KFYA 4U6PA 1YWXA 4F93B 1W2IA 4MO4A 4PABA 4GMKA 1VQ4N 4KPYA 2P51A 4CD1A 4NLDA 4FF2A 5AKKA 5HROB 3AD8C 5IQ6A 2O4GA 1DQ8A 5CXTA 1X5PA 4NYZA 1RU2A 4CF4A 2E8OA 1PBAA 1LW0B 4EELA 4QIWC 5AQMA 1CEZA 1EP4B 2Y1LB 3JXOA 1ECWA 5A8RA 2BMBA 9ICCA 1L3KA 2P6UA 1QUVA 2K4EA 2UVWA 1NBWA 3ZNJ1 1RT3B 4PHDA 4KHPJ 1C1BA 2CQHA 3D54A 2HBKA 5D77A 3KOOA 2AD9A 3FJ2A 2MZQA 3L4BC 2K89A 3KNGA 5IXUA 3TSPA 4ED1A 2NO4A 1VQPN 1X4BA 3PYEA 3A5MC 2P2CB 4KTQA 2CQ0A 4BDZA 4FM1A 2RAQA 1SAZA 1S79A 2AJFE 1HHTP 3HOTA 2ZOMA 4BUGA 2OEHA 3UXPA 5DBBA 4K43A 2ASOA 2EW9A 4CLSA 1VJQA 2ZWPA 4LF7F 1U2CA 1GOCA 3DLGB 2HNYB 4LFAJ 1ZQFA 3RRHA 3CHWA 2NREA 2HBQB 2B0CA 1GMWD 5CWRA 4JRPA 4YR0A 3F53A 2EZXA 2RB7A 4DL6A 1OJ4A 3KUEA 2O67A 8ICNA 1N48A 4DUYJ 3ZZUA 4JV0A 4DR3K 5KFWA 2ZJRL 4I29A 4CJVA 1M0SA 2O5DA 2FSJA 1ZBSA 2MKYA 1T03A 1NM1A 2HFOA 2XG8A 1I39A 2GOLA 2NUUG 2WF6A 2BABA 3TYTA 1QVGR 5KL8B 2YTUA 3HSGA 5AKYA 3VEZA 4E7HA 4CHOA 4CZLA 1YKWA 1TKDA 2EEYA 2P9KA 1WF1A 3OS0A 3FZKA 1RAFB 3K5LA 2OPSA 1S57A 3B6OA 1VLOA 2I0XA 4FM2A 2V68A 1ZXOA 2KLAA 2BQRA 3K5PA 4IKAA 5JVHL 3NGTA 4HH1A 3JSYA 2WAQF 3L4IA 3A3PB 1W0HA 2KFNA 2ZHAA 4QJVA 2XI3A 3LAKA 1U1MA 4NL9C 4IQMA 3AN1A 3VGTA 3QT7A 5J1NA 2XMKA 4ISFA 1HW9A 2WRMA 3PYFA 3RMBA 4RX6A 4M0AA 1G7CB 2K7JA 2LPEA 2GIRA 4ID8A 4EMDA 1G2EA 3W9HA 1YVNA 2WAQC 2N7YA 2HBYB 4CI0B 2YHXA 5B09A 4C4WA 3AA3A 4W5RA 3KLIA 4OJ5A 1J5EF 1UQVA 9ICAA 1LK5A 2H4YB 1KN5A 5AM3A 1EWQA 4B1UB 4WP8A 3ZDDA 4KGKA 1XR7A 4GMJB 3O1BA 2WBNA 4NO7A 1NM2A 1YRTA 2CJKA 4IFVA 5GAGP 2W42A 4C8OA 3N5BA 4O8KA 2F9TA 5D3GB 2LU2A 1G15A 1DQAA 4FWLA 8ICHA 1KFDA 5CA7A 3IMQJ 2JVRA 4CH0S 3T3FA 4IEEA 4M41A 1ZQZA 4OZ2A 2FF6A 1Z00B 1ZQMA 3QEBZ 1JJCB 8RUCA 1RHKB 4WFXA 3SQOP 4ZJOA 2LBOA 2EFNA 3U9DA 2FUG9 1RK8A 2MMYA 3R7NB 3ZDEA 2D0OA 2AEJA 4JI2K 4Q8FA 2ASYA 4ELUA 1U26A 2L9DA 5EE9A 5AE1A 3L2QA 2VFVA 2AJ2A 3WZ0A 5LSLA 3CJKB 3C2PA 1RBAA 1X40A 4OGCA 4DXLA 4X4TA 4ED5A 2Q79A 1ZXIA 4CF5A 2DFHA 3QJLA 2XMMA 3A8JA 3MM7B 2K3KA 4WKRA 3ZSZA 2DHAA 4OHVA 1Z00A 2H9ZA 5DQHA 3CERA 3NS1A 5J2KA 4ZCKA 2F76X 4WFZA 3NY0A 1IIPA 4OJLA 2C3UA 1J5OA 3WT0A 3I96A 3MM8B 2PD1A 3FZMA 1RT5A 4NLRA 1XIQA 4LT6A 1KFSA 5KFQA 5DDQC 3GWCA 1FRLA 1IM4A 5J1EA 1L3VA 1DGSA 3HZ6A 2P9SB 3C28A 1Q9YA 5SUHA 5HMLA 3GDQA 1XMOK 2ZH7A 3N6LA 1NPRA 2KJ5A 2ABYA 5MLCV 3CFOA 1NJWA 2VG5B 1G1XA 3CT9A 2V94A 3CJ0A 2NLXA 4DL5A 5G4DA 3NNCA 1IVZA 4JB8B 3R6GB 2HF4A 3SQ0A 5LY3A 3WUHA 2JRZA 2JZBB 2EAMA 5T7LB 3MPWA 4LQ9A 3MEDB 2UXCK 4P6QA 2KVIA 4K7QA 1WD6A 2KJ9A 3ZT2A 2DR8A 5BRHA 2OTLS 5KPTA 2BDUA 3U3YA 1WORA 4KYZA 3D2EA 2CGKA 5FPDA 3SR6A 3AV9A 1M90O 3GYNA 1K44A 1FJ7A 2CXYA 3RAQA 4Q7AA 4OLOA 3EXYA 3D1QA 2D0CA 1W2BM 4HYKA 4EYIB 3NOGA 2R2TA 4ZN1A 2FD2A 4ZOSA 3C5GA 1X60A 2WF9A 4C98A 3GG0A 4O0NA 5KG6A 3OW2M 1RAJA 2YI1A 4NLSA 3LDAA 4NXZA 1FFWB 1VQLS 3AO3A 1N62A 3MFHA 2A2DA 2E5GA 1GTEA 4C0BA 3AVKA 1NEEA 3ET6B 2ZIVA 3K7RA 5KOWA 3OQ2A 5AZIA 1M5VC 2JFDA 4OKJA 3E0FA 5T7LA 3SBTA 5A6WA 1TAQA 5HHIA 4OJGA 4R0JA 4RT2A 2CPHA 2XSJB 1LK7A 2EC2A 5AQUA 5GMDA 2XZWA 4FLYA 1JLAB 5KFCA 1LOUA 3C0BA 3Q23A 1SB3C 2XVTA 5LMNF 2D3UA 4RUCA 2UUAF 4HUFA 1URNA 4YCXA 1RT3A 1YTYA 1GLBG 1FWLA 3CJTA 3MGIA 4NLUA 2R7SA 4GW6A 3ETOA 2IDOA 5I9EB 3M2UB 4O3RA 4DTXA 3C6UA 2G8VA 3PO4A 4RTFD 5JVGL 3AUOA 1XO1A 2IA0A 3ZZTA 1NGBA 2GJ2A 3CJ2A 2YH1A 9ICJA 2YX7A 2QA1A 4ZVHA 3GIKA 3FVYA 1HNXF 4US8A 5L46A 4USAA 4B1VA 4A8SA 5J2QA 2FJEB 3FBBA 2FTRA 5KPZA 1NPPA 1FKOB 3P45B 3HBTA 2HKEA 1N4LA 3JPRA 2EHGA 3CP8A 1RABB 1T03B 4JKEA 4ID5B 1UWBA 5ALMA 5EWEA 3KHGA 2W41A 5EGYA 1HLWA 4JKHA 4X66F 1Y64A 1OPIA 5BJRA 3R8YA 1NK7A 4KC5A 3CCWA 1LXJA 3M1YA 3ITHA 3BZCA 1Q16B 4F5PA 5EE0A 5LXRA 4GKKF 3D0HE 3H46O 3I5CA 3UD4P 4RG8A 3K0JA 2H54B 2PKEA 3AOBA 2CPZA 4DX8H 2NXCA 2RF2B 3RW6A 1H72C 4CHPA 3OTCA 2LP4A 2FMPA 2KZZA 1VQNN 2BE2A 2WSEC 5KPRA 1FI4A 4FBUA 2FJDB 1HNIA 1HHSA 3T9ZA 2AKWB 3K8WA 5AM5A 3QB0A 1EKEA 4ECUA 3LDSA 3I5BA 5DO2A 2VJ4A 2Y9UA 3PIPL 2F1HA 1E6YB 4R5PB 5M1OA 1SL2A 3IM9A 2VG6A 3LOUA 2AYEA 3EWGA 4ENOA 3LPUA 3W9JA 1WOOA 4Y2VA 4LF9K 2V2VA 1FFGB 3T5JA 4OYWA 3M5RA 9ICEA 5EX5A 4ECRA 5GAEU 5HMMA 3IFEA 1UVLA 3OVBA 2ZKUA 3OS2A 1TKTB 1FXLA 4BE1A 2CZVC 2HPUA 1SC6A 1TUVA 4A5BA 5CE3A 1FTRA 3PXGa 2HFSA 3MDCA 2EWSA 1YF5L 5ELZA 1UEUA 3CJ1A 5AKGA 1FJEB 3CXCM 2JLGA 2DGUA 3D6RA 1RXOB 2V2QA 5B0BA 1N5TA 5CYMA 3OYHA 3BY5A 4KLOA 1J5EJ 5HRNA 1SZ2A 4A8XA 1H2UX 5J0OA 2LXIA 4JI1J 2UYTA 2R7TA 1L3SA 2A42A 4DR2K 1AYEA 2QIFA 3V81A 5AQVA 2HHPA 3CJQA 4C3KA 1XQSC 4DCOB 2CVEA 1SJ3P 4K4ZA 5HR6A 4K0KK 3EGZA 4WYBA 4UQGA 1XO0A 4NLQA 2F44A 4KLHA 1UFWA 3LM2A 3THYA 3MM5B 5A0YB 4HHTA 2YKOA 3ZZPA 3NTUA 3AB4B 4TQRA 1K8KA 3IG8A 5CYQA 3MEDA 2KIVA 4O44A 2IOFA 4QR0A 4CLPA 1LWFB 1UETA 4CK1A 5ETNA 4W5QA 3O44A 4J9UE 3R8EA 3ZLJA 2I5JA 3H59A 1NB7A 4FFDA 2MRLA 1S0OA 3MWBA 1R8BA 5JICA 4V19J 5F3ZA 1N54B 3AVBA 1FCAA 3VGVA 2VQFK 4LF1A 4OPJA 4MK9A 4FF4A 4JS5A 3HHKA 2WBMA 4JV5F 4PY5A 1J2MA 5EDWA 2VOPA 3WDOA 3HYFA 5ALOA 1TKXA 2GIFA 3SPZA 3AXMA 1P8ZA 4EEKA 1VRTA 2K06A 1EQYA 2C2OB 1T3QA 3SAFA 1S4FA 5ALTA 4AP9A 1SWVA 2UUAJ 2R7UA 1R0AA 5KG5A 1DTTB 2X51A 1AZSB 1VDHA 1TL5A 5KG3A 1DQ9A 5E79U 1T05A 4J91A 2D0AA 4AHRA 1LAVA 3V4MA 1IR0A 1SKWA 1XNRF 3QWPA 3M6XA 5AI5A 1NO8A 3H2UB 4LF5J 1NPKA 3C21A 2B9YA 4RNNA 2WW8A 3ORYA 2XWYA 2BRKA 4F5NA 4ANDA 3NFAA 4EGLA 4CLKA 2IFXA 3O6QA 3W2WA 3FMWA 4YY3J 1CUKA 1GTHA 5ETPA 2CVIA 1TKZA 4OPAA 4FWPA 4DTNA 5BREA 1VFJA 4FJXA 4J9PA 5E0OA 4CDIA 2R7YA 2CWXA 1N33K 2IIRA 1HD1A 4KJIA 5F0XA 1XNQK 4BRGA 3VGMA 4IDHA 4OHXA 3IM1A 5C24B 3V1RA 4HLBA 4USJC 3OTOJ 2A10A 1HQEA 2F8EX 3MPYA 1DGKN 4YHHK 1ASWA 3UCGA 1KVCA 2J8SA 3QFHA 2HQIA 4LVNP 2XYPB 1RHQB 3V7LA 2M0GB 3L7PA 1FVQA 3F44A 4HUGA 2EDUA 1HYVA 4K5RA 4WCEL 3PFOA 5HQ8A 1UOCA 4JYAJ 5J1PA 3L3CA 1VIXA 3TABA 1EKRA 5FROA 4FS1A 4LF7K 1IWGA 3ILOA 2NZTA 9ICWA 2DCUB 2DT9A 4LH5A 2J7KA 4ECVA 2NXJA 5CEHA 1ZRMA 1NXIA 4B9NA 2MSSA 4NMXA 3WC2A 4DV5J 2YKMA 4Y00A 1RISA 1IKWB 1DOQA 2OMOA 2WHEA 3CCES 5ALHA 5J0SA 4FYXB 3V4IA 1YHQS 3SBMA 4DR3F 3J7YU 3NMUA 1RPLA 2NRZA 2N3LA 5D8HB 5A2QU 2NZCA 3IP4B 2PT0A 4FW2A 3CMAN 4BCAA 2FPLA 1ZBLA 2BE9B 2KI2A 1BWVA 4WU2A 4F26A 1HX1A 4LF7J 4K59A 4H5RA 3PJ9A 2VUGA 1RP5A 3CIMA 1UFKA 1TL1B 2PEBA 4RO0A 3BQ7A 2JV3A 5FLXY 5A8KA 4MIAA 2P9NB 1JLGB 3OTEA 1I5OB 3O9QA 2HFZA 3KLEB 4UW9A 2WONB 3MC1A 3TADC 3IRXA 1ZBUA 3RAXA 3Q2TC 3D28A 2W24A 3BO2A 3CCLS 1T6DA 4BHQA 1GT8A 4KHNA 4XAKA 2BKOA 1IR2A 1YXQA 4JWMA 3IBPA 2HNDA 3BQ2A 5BPCA 4RL1A 5IILA 3DKDA 1U1RA 4US9A 1GMVA 4G6VB 4N76A 5HSPA 2O8BA 1YI2N 3RW7A 1TL7A 3QT8A 2MLZA 1HNVA 4I56A 3T6BA 3BZKA 2PMZF 2MEWA 3F9KA 5JTIA 4OYIA 2E1CA 3KJNB 3HWTA 2IVYA 2Q4TA 2C3MA 3H8MA 4IH6A 3RFAA 1SZHA 1PZNA 3BKFA 2YWGA 4CF2A 4NJ8A 3HM8A 5ALIA 2O6KA 4ILLA 2F4VJ 3R9PA 3NVWA 4OZ3A 3ILJA 2LEPA 3HSDA 1WHVA 5E7OB 2GV1A 3PKYA 5KNIA 1MMNA 4KFBB 5J8YA 5GAEP 1B7FA 3NE6A 2OHDA 1RCXB 3OBYA 3KHLA 5DG7A 1NOZA 4DV1K 2ZM6K 3B78A 1YTAA 1W26A 3IP0A 3WXKA 1NRKA 4ZOHC 1Q8IA 1F0XA 1Q81O 1M90T 4ZVRB 2BGGA 3CCUS 2Q43A 5KFHA 3QU2A 2K1RB 3K1RB 3SCLE 2F4FA 3QU4A 4NYOA 1BPBA 1MU2A 3CJ7A 9ICHA 5A2QO 4YORA 3KKAA 2AJ0A 4A8OA 4K0KJ 1HLUA 1JCFA 1VBYA 4IUFA 4G9ZA 3PHEA 3D6HB 3JAMY 3W3SA 3NEKA 3S7RA 2GHVC 5J2PA 4KLSA 3CJ3A 4KLGA 5ETVA 1BUPA 2E5JA 3WKBA 1RWNB 2ATLA 1HPMA 3PSFA 5BR8K 4A62A 4DZDA 5K14B 1Y00A 2EVZA 4JI6K 4M7YA 1SC4B 5AKXA 7ICLA 3VA0A 3O4QA 1ZQYA 1QE1A 2FHKA 4ZPTR 4FWMA 3W7BA 1YUWA 4CRJA 4CGFA 3J7AP 3BEGB 3SUPA 3DM2A 1SQKA 2UUTA 1RWKB 3MM5A 1G3OA 2YQ3A 5KFBA 1RTHA 4QIGA 4KHYA 1E6VB 3HF5A 2FBVA 4JV1A 3W3DA 1WEXA 2QLFB 1IJFB 3PW2A 4CT8A 4BRHA 1M5HA 1CPZA 2QRRA 3EZWA 4LMZA 1VSEA 1K73T 5J0PA 3ZZ0A 3S3MA 3FGVA 3FC9A 5AQQA 3MOJB 2F40A 2BANA 4J2BA 1DRZA 2YHAA 2B3TB 3M1VB 2DNNA 3QLHA 1C4AA 5ALKA 3KLFB 1SJ4P 3HLUA 2DR6A 3G25A 1RDRA 4KO0A 1K8AT 1VRUB 7ICKA 1ZAVA 1V9OA 4QZ9A 2W4PA 2DH9A 4QNLA 4IC9A 5C24A 1UPHA 5DZ7A 4Q0BB 5J2BA 1C0GA 4CIOA 4BR7A 3QEAZ 4P0QA 4DSLA 4TYAA 4LVSA 3IDHA 3CJ4A 3MX2A 4RNHA 3K5MA 4Y2RA 4DR1F 3ZX2A 2ZVSA 3CCMS 2GIQA 2JXJA 1FNOA 2I1RA 2LXUA 3V9ZA 3QE9Y 1HFEL 4QZAA 4I7FA 3W62A 1S9FA 3RB6A 4V1Ak 3LF0A 5J2IA 1ZJMA 1HI8A 3GILA 1N52B 5H1SV 4TSXA 2ETJA 3V7KA 2F9DA 4A47A 2F8LA 4RKUC 5AQYA 3AFGA 2HW3A 4IQXA 5IT9Y 3LO3A 4JYAK 3K1ZA 1WSFA 1E4GT 5GIPA 4YS2A 5LMNJ 3I55S 3T1YK 2D9PA 2VBWA 4IFYA 1Y5LB 3QNWB 1AUSL 1WG4A 2EI5A 2BKPA 2C2RA 2GO7A 4B9TA 1BCOA 1QQMA 4KB7A 1N33J 3FSIA 1N2XA 2OEMA 5C42B 1LAWA 4BGDA 2M2BA 4PYDA 4MEXA 4PZNA 1S59A 4ED4A 1N33F 4YOYA 2MA1A 3A0HU 1U1QA 1UWAA 4CO5A 4P0PB 1IJJA 2QKKA 3M2UA 2HHVA 2H5XA 5FDLA 1R0BG 2DNLA 5ETKA 1VQ9S 2KP7A 3CQ8A 4U8VA 3U7JA 3H08A 3PRDA 1BNOA 4I4BA 5KQDA 1WSIA 1JLAA 2JDJA 3VEWA 4J9NA 2E8MA 4I2EA 3QO9A 3CD5A 1SV4A 2VKQA 2AEMA 4K5SA 3RSEB 4EEYA 5J2MB 4CE9A 5LSOA 3LYSA 2OIHA 4IG3A 3V9SA 3OL7A 4L72B 4RW4B 1EQMA 3OR2B 3QEXA 4EFAC 4KE5A 3EXCX 4YN4A 2F8MA 3UMGA 2XBPA 2YKAA 5U47A 3SENA 3W9IA 2DIUA 3QATA 4F2SA 3K5OA 2VPYB 2ZJPL 4HWIA 3FAHA 3MCMA 2WFBA 2V63A 4NCGA 4FWSA 2X1AA 3P4IA 3VQAA 2GHWA 5FPEA 1RHJB 2JHDA 3CXCR 4PKIA 3NVYA 3ZETB 3HJVA 1N32F 2KHOA 5KFKA 4UAUA 1CJKA 3FNNA 3M8QA 3JPPA 5TZVA 3WK5A 4DTJA 2F77X 3UFCX 4IJNA 3TPQA 1FO4A 3V6DA 2LQJA 2FVPA 4AYBD 3QDKA 4JV5J 3QU5A 3VZHA 3ZSXA 2UUCJ 4F92B 4WYLA 1SB6A 3JSRA 4RUBA 2Y1RI 4RW8A 2IAJA 5GAGU 3QXGA 3OYKA 1ACMB 4M5IA 5C25A 5L9XA 4P75A 2I9SA 2Z1GA 2B51A 1RBTA 2ZBPA 1P8GA 4DU3A 2UUBJ 3BGRA 2HMIA 3HFKA 5FDLB 1WG5A 1L8OA 1HWIA 3WK7A 3DXKA 3GE9A 1EETB 3QETA 2ZJQQ 2VONA 3C6HA 1N0VC 4X2BA 4ZTJA 3TQ1A 1XMOF 5CD4A 1C20A 2DRBA 1XHXA 3TFRA 3H5SA 3ALRA 4XK8C 5DBCA 3VTHA 2Q6CA 3F5AA 2VJ5A 3SZ2A 4UZBA 1WBBA 3RBZA 4NLGA 4BS2A 3UXOA 1S9GA 4WQ4A 1D9FA 4IO9Q 5DM7L 2P9PB 4IOAL 1FD2A 4WWSA 2ZE2B 2W3SA 3H8JA 1FFSB 2KT2A 1U45A 4O3NA 3CYMA 1BQNA 1YJ9S 2IMOA 4J90A 2BJ3A 4PKHA 2PA3A 3EJMA 2WZ1A 2W9BA 5C5JA 5J8YC 3IAYA 2IYIA 1JLFA 1SKUB 5KG1A 3TWZA 2Z7JA 2PC6A 5AQPA 2V2ZA 2MXYA 4NL9A 1R8CA 1GAOA 4Y2UA 3DMJA 3ISND 4Z7CA 5ALUA 3HHLD 2AX1A 4C97A 4EHTA 4CLYA 1RBVA 4K4IA 2P1JA 3BH7B 4L75A 1SC3B 2VQEK 4M5JA 1FVSA 2FDRA 2L48A 1PAUB 1IO2A 3CCSN 3WEEA 5AK3A 3A4TA 2V9WA 3DYAB 1JWWA 2XC9A 4NXNJ 1EETA 4B9UA 1U6BA 3L3FX 3UO0A 3N4PA 5AIBA 2HNZB 2XGQA 1MW7A 3OFEA 1DZ5A 1NGIA 1UA1A 1FXXA 3J81O 1V3SA 3CDEA 2B5JA 3I5AA 2W11A 3AH6A 4FVCA 3J81U 4DV6J 5AXNA 2KH9A 2MZTA 3BPSP 4KKOA 3E1YA 2BCSA 4URGA 2AZ3A 2MSTA 1NZPA 1PGZA 4C6AA 4Z6CA 1TVRA 2A3JA 1L3TA 4B9VA 2ZBCA 3DC2A 5J0UA 3W65A 1VQYA 2DGZA 4IDKA 2B4OA 2CFXA 4KX3A 2C2EA 4CJLA 4L8RB 4UZCA 4QW9A 2CQ1A 5EY4A 2EFPA 2UV8G 4KLDA 1EKSA 3EW9A 2DITA 3G87A 1IBLF 2RNEA 5L39A 2RHFA 4U7UK 1UT5A 4UB5A 3LH2S 2DB1A 3FLCO 5G5HA 2ZIWA 5E3QA 2D8CA 3J7A1 4FZZA 1GXUA 2UXDJ 3UVJA 1FRJA 4CESA 3CCRS 5AFUA 1FE4A 2Y8WA 3OJSA 4BROA 2R2UA 4I2QB 2Y0SC 1KC8T 3QGHA 5HP4A 2OMLA 1C4CA 1LKZA 3A5OC 4DV7K 1U48A 2GS8A 2OKQA 1HBUA 2DY9A 4JI7F 3L3VA 1X5OA 2G0CA 4MK7A 1NWKA 5KL1B 2AJQA 1NGEA 1FK9A 2VIXA 1WSJA 3T1HK 3AU6A 3OSPA 1RDCA 2QWMA 2E9TA 2RQKA 1ZM9A 2DY1A 4CJFA 3KD5E 3OPKA 2FJWA 3OLBA 5ETQA 3M9MB 2VICA 1JKHB 1R31A 2O4IA 4ZKAA 1K1QA 3KDOA 4DV0J 1X4DA 2FC8A 3R3TA 4J9SA 2K8BB 2JEFA 3D1OA 3CMQA 5AQNA 3SJHA 1A0OB 2C42A 4NLZA 2O3DA 2VFSA 4BVPA 2F1IA 4GLXA 2CN1A 4HT7A 3NL0A 2L08A 5K4LA 5GVQA 5DKWA 4JBCA 3DRPB 7ICJA 1JLQA 4Y1DA 4E19A 4X64F 3DLGA 1VQ8S 2Z1IA 1TZ0A 1HHQA 3KLHB 3KK1B 1TUGB 4ZLLA 2QWRA 1JMSA 2NNWA 4B6JA 1S0NA 1ZQOA 1D0EA 2J0QD 3THTA 2ZDPA 1AW0A 4PHPA 2KIWA 2IAJB 4NZ0A 3A3NB 1ZQXA 4J9MA 1KTQA 1JLCB 1Q79A 1I3AA 2PE8A 1OH5A 1UVMA 4M6WB 1S9EB 4I7FB 2FIUA 1C1BB 3NF8A 3LP1A 2KRRA 1X9JA 2KXNB 5JU5A 1D9DA 3CCVS 3AGKA 4YNQA 3VQEA 1XR5A 2CZ9A 4MLEA 3FDSA 2PFUA 3TUIC 1V9PA 1V85A 3G6VA 2NRTA 4P71A 1T95A 3U3GA 1GOBA 1VSIA 3ZYYX 3LWLA 2E88A 1XNQF 4B3OA 1NI3A 3IG5A 1NKBA 4LIRA 1OQ3A 2YNIB 2OPQA 2PY5A 8ICCA 1J97A 4OX6A 8ICPA 3GL1A 9ICLA 1JLEB 4DV1J 1L5UA 5KFDA 4BWJA 3WQPA 4I1TA 3FBFA 3WX8A 4AUKA 2HHHK 4Z37A 4B1XB 5HRPA 1KQFB 3L09A 4YOXA 1AQ6A 3F2KA 2KHCA 3W5XA 4UY8O 1OY6A 2B21A 4KLUA 4RCHA 3GSIA 2W7OA 4P2FA 1B0VA 3Q7CA 4CO0A 5ADXA 1WB9A 4FNIA 4O3QA 3TANA 2HMXA 2KEYA 3IBFB 4YEAA 2EQYA 3PVXA 5KAFU 1YRXA 1V4TA 2Z30B 5DDRC 4J2DA 3Q8UA 2IBKA 2HBJA 2DHXA 4RW8B 4PXCA 2GQQA 2QE5A 9ICPA 1H1VA 5ETOA 3L6QA 4DWIA 5KAKA 2G2ZA 1KLMA 1KOHA 4P7TA 5BYSA 1RQLA 3GJSB 2FLLA 4DEZA 4KH1B 4F3MA 4X62K 4QU6A 5HVGA 3O3HA 2G5IB 4A8EA 4LSZB 4JK8A 4FJHA 4UB1A 1YITS 3ID8A 3NRZA 4K4VA 1DURA 4E7LA 2APOA 4QIFA 3ZDAA 4MFFA 3C7NB 4CK3A 4X4OA 3SQGA 2DL0A 4TKTA 2H3VA 3T19A 5D6GA 4TLQA 3THXB 4ZPVR 1FJGF 3SUQA 7ICFA 1B64A 2ZBQA 4O8UA 3ZT4A 5DM6L 4MKYA 4C2MA 2RLTA 3ZCMA 3IDWA 1SH3A 2YPZA 1Q95G 3LPTA 2GH1A 3PV8A 4E7KA 3G8TA 3P5TL 2MZSA 3OPXA 4K4SA 2FC9A 2B4VA 2V4QA 2DHHA 1KEJA 4LRDA 4YDXA 2C2DA 4DSJA 5BN8A 2LEAA 3GSDA 3HVTA 2DNKA 4UBCA 4KHMA 3HW8A 5GMEA 3IBWA 2OTJS 2Y1JA 5D4NA 2VDHA 1K9MT 1MA9B 3D67A 3O1WA 2CWKA 3UDLA 8ICYA 2Z2MA 1VRQC 3QAEA 5CHIA 1WCLA 2QN6B 4ECSA 2GMLA 2WVBA 3DYAA 5D49A 3GOIA 4DR1J 2YWWA 2L3MA 2F8KA 3QESA 1KFTA 2MQLA 1F44A 1ZQDA 3SD7A 4DG1A 1RWOB 5KT5A 1SV0C 1S7IA 3VQ9A 3KKFA 1WI6A 3ZTRA 3HPHA 3G9CA 1FDDA 5KFIA 4H5VA 4UBBA 4M5GA 5IC4B 3LL3A 2H48B 1HMVA 4USHA 1HBNA 1SQGA 4DV7F 2F8HA 4I2HA 2ZDOA 4QIEA 3DI6B 2YX6A 2Z4PA 4A8KA 2BCVA 3S3OA 2R7XA 4DR5K 3OTOF 2DVIA 5HRRA 3V5RA 4FJ5A 8ICLA 5F8HA 4L3KA 2KG1A 3SQ4A 5AE2A 4IKFA 2ROPA 4EI2A 1B43A 2B9WA 3WXMB 3C95A 3SCIE 1REVA 4QZ8A 5J0WA 2AGQA 1J53A 2DD8S 5IZHA 3SNNA 2P35A 1JMTA 2OH2A 4PHTX 1ZOTA 2GWJA 1KKHA 2HVIA 1YJ9N 5CYQB 4CW7B 2XI2A 2YHWA 1S1XB 3FRZA 3H6EA 2PIIA 4DTPA 4WXWA 2RHSB 2NXUA 3BQ1A 3MURP 1NSAA 1JNZB 5J2PB 1FF2A 2RT3A 2BPGA 1XSPA 4X4UA 4EK2A 1A7GE 1FESA 2OP5A 1OH7A 4OI3A 1N5QA 5I3PA 1RBLA 4GKJJ 4FBTA 3M3ZA 3VVUA 4CWBA 3SK3A 3R5DA 2YQ0A 2V8HA 2FJVA 1NZAA 3SJJA 2D41A 1U4BA 1X6IA 4Y2MA 4IJAA 1O03A 1N32K 5B5EU 3PSTA 2RRDA 1PVQA 4AL7A 4LFCK 2HLTA 3BR8A 3K75D 4CYUB 3HHEA 3CJSA 3DGPB 5ALGA 1K0VA 4JKGA 4GV6A 4IDKB 4OX8A 2G2OA 5D4BA 1V97A 1EJ7L 1YRUA 2I8EA 1WKJA 1DARA 2KXFA 1Q3VA 4IQTA 2Y3YA 2O8FB 2I5HA 1CG2A 3X3UA 1CJTA 3WC0A 2Q3PA 2EKYA 4YDUA 4KBIA 3U1MA 2QA4N 1SBRA 4NCBA 2ACMA 3I0RB 4FNHA 4IG0B 4CJSA 1Y88A 4DFPA 2RUGA 3D2FB 2JL9A 4PGXA 5AI9A 2E4LA 3ONQA 1X42A 3CC2S 1RACB 4CM2A 4P9SA 3KD3A 5K8OA 3NP5A 3CCMN 1U1NA 1QLNA 1UEKA 4QCLA 2VFTA 4LF5F 1QZ5A 2M9NA 2OXOA 4Y0FA 3GIIA 2Q6BA 5KFGA 5IWAK 9RUBA 2OANA 3NVVA 2VGNA 4KPCA 4P0PA 4ECYA 1WG8A 3B9JA 5CR0A 4UB2A 4DV4F 2AIRB 3D2NA 3TW0A 1WUUA 3QBWA 3A13A 5K5MA 3QMQA 2J9CA 5HJYA 1KQQA 3EVWA 1YJNS 2BJ7A 1JL1A 1VS3A 2K1RA 4Z0UA 5CCMA 1RZTA 1WC0A 3THXA 1DLOA 3T7ZA 3TKAA 3IN5A 2C2MB 1ZJNA 1PAEX 1N0UA 3KKRA 3FBCA 5C2GA 4QW8A 5J2CA 1NDLA 4P2HA 2ZKTA 2FHOB 1AZSA 2P66A 4H54A 2QLWA 3DLHA 4BRMA 1KCFA 1YQHA 3V9UA 4LQ3A 1VK3A 3ALYA 4P7VA 2R2SA 2RDIA 1RAAB 2HI0A 2OFHX 3TFSA 1ZD2P 3MUTP 4UASA 1Q5VA 4UB6U 1YAGA 2JC0A 3L4PA 2V4JA 4E7IA 2XTJP 4FLTA 1VQ7S 4HH0A 1FX4A 3TEHB 5LMUK 1YHQN 3B0XA 2X7IA 2DRAA 2KMDA 4BRIA 3CMES 1LWFA 3DDKA 1S6UA 4DR5J 4B9SA 3C2LA 2Q36A 1NH8A 2G5HB 2HMIB 4CERA 3BSCA 2DJWA 2EFOA 2RKIA 2G8UA 1FDBA 3KLHA 1JLQB 1EX4A 3MR2A 1FXDA 2C2KB 3RB4A 4CT9A 4EZ9A 1EAYC 1HBMB 5EX3A 2B6AB 2YJEA 2IHR1 3OHAA 3CE8A 4OZJA 2O8DA 3BO3A 1RWUA 2O8BB 2KRBA 2HZAA 3EM1A 1JRPA 3AA8A 4H4OA 3US5A 4PG7A 4DSFA 1B4FA 3UR3C 2L41A 1NK5A 4P72A 4DV5F 3EZUA 4ED7A 1N36F 3HILA 2FMSA 2H3IA 4ILMA 5FPMA 4M04A 2E2OA 1DKGD 1OO0B 1ZQNA 4IQUA 1PYTA 2H5EA 5M2UA 3BR9A 3J7AN 4QIWD 1S1VB 3MEGB 3R5AA 1C2PA 1UPPA 3BH6B 3LP1B 2CJBA 4FP9A 2XMUA 3HMJG 4KHWA 3RH5A 1FDNA 2BR0A 3LANA 3BN4A 2GX8A 3DJCA 2D0PA 5J2MA 4OYAA 2V4JB 1SPBP 4FWOA 1NMDA 3I32A 2LU1A 4X65J 1JLFB 3QRPA 4JI7K 3BQTA 5D0EA 4RQ0A 5AIAA 1N8RO 1ZA1B 1ZD4A 3W5YA 2IHMA 1RTIA 3LZIA 1BO5O 2I38A 2P9GA 1R6YA 2QLJB 1DTTA 3CCVN 1FFVA 2VGMA 5AKLA 1QE1B 3SSSA 2E9RX 4M63C 5HL7Q 4JI3J 3J7ZO 2P9PA 2RF2A 3OYLA 1LXNA 2DEJA 1YVFA 1WWUA 3GTYX 5LJ3Y 3HX0A 1S97A 4N8OA 3VQBA 1U49A 4JB3A 3OVSA 2VHGA 4DSKA 1X4HA 5LL6d 3RZAA 3GFKB 1K1SA 1NK8A 2V34A 4EP4A 2QT7A 3H5YA 1RU1A 3C6AA 3TAQA 4DR4K 4GVLA 1U0HA 2C2ZB 2Z1HA 1HWJA 2YX4A 4WJ3B 1U0SA 3IRUA 2E7VA 4USMA 2VWKA 1YITN 4LREA 1IKXB 1U8SA 2FY1A 3KIOA 3LGHA 1CBKA 3OYGA 5J2DA 1RBRA 4QR2A 2LXFA 3KVGA 3HI9A 3WIUA 4Z4HA 1NGAA 1TUWA 2JH3A 3PHTA 2I6XA 4JI5F 1VSJA 2QEXN 3QEPA 1N6QB 2A1BA 3CMEN 3O9RA 2JWLA 4NASA 1N5VA 2QA2A 1SCJB 5B0DA 2EWHA 4Z4CA 3TQEA 2GQCA 1B0XA 4EBDA 3RTVA 3HK2A 1F5SA 2MU2A 2HBLA 4FWKA 1X2IA 4A2AA 1OKJA 8ICWA 1IV0A 3VEOA 3GFYA 1OH8A 5A76A 4RUAA 4LIWA 1X8DA 2WHOA 4NLBA 5F8NA 1RWPB 2UVVA 5HO4A 3QIPA 2PO4A 5BR9A 5FRMA 3AVAA 4Y2CA 3SQGB 3ICXA 2HQFA 4TYBA 4KLTA 4C8KA 2AX0A 2LFVA 4FZXC 4Y0WA 4ILGB 4KQZA 2YKPA 1F2GA 1QZ6A 1U1PA 5CB1A 4FLZA 4KI4A 3J7Z5 4PHAA 5CZXA 2CKWA 2X3DA 2Y0SD 3L9ZA 1NDKA 1O51A 3P4UB 4B02A 4ER8A 3PSPA 3KK7A 4N47A 4H0VB 3MXIA 1OXJA 4LF6K 2JLFA 1VMBA 3SI6A 3DLKB 3CCJN 3HVRA 1ZPWX 3EUNA 3MAAB 1ESVA 2VKZG 1VCTA 3BO4A 2ODGA 3DDHA 1JKHA 5J0YA 2A1SA 5AQFA 2JGUA 2UU9K 2BCQA 3HSZA 1KN6A 4PL8A 2QXLA 2H3QA 3NVZA 2G07A 1UW4A 2BACA 4LSLB 1UTAA 2WB1D 2ZZMA 3MMVA 3MOZA 3VQDA 3LP3A 4M9JA 3I82A 2A18A 3DOLA 2ZG6A 4FDFA 5B0FA 1BVSA 4F3TA 2QMXA 3J8AA 3O8WA 4F67A 4N77A 3TZWA 1PK1A 2HSZA 2YX1A 5IWAJ 2W2OP 2VC0A 1Q8BA 3T79A 5IS2A 1NNDA 1CULB 1W97L 3RR8A 2MKIA 3Q22A 2LYBA 2ZGYA 5J2NB 4KN7A 3BDPA 2HIQA 1S48A 1C1AA 1WUDA 4R64A 3LDLA 4PA1A 1M1KO 4XPEA 1JL2A 1BISA 1C0UA 3DN9A 4Q2LA 1K73O 2ZE2A 3LK9A 4CLUA 2IVOA 3Q8VA 3MTKA 4YB6A 8ICGA 2YNFA 3T1HJ 2BUNA 3PIOL 1FJCA 3TAPA 2MSNA 3OGUA 4TY9A 1JJHA 3AY0A 3OVNA 4KRFA 5FP0A 3GIMA 1CS4A 3AGRA 3H1QA 4F02A 4YOEA 3E66A 1WWVA 5IT4A 1KVJA 1X5TA 2BE7D 4Z7YA 4IWVA 3MM8A 4CBXA 1LWEB 1R27B 4MKBA 4KKOB 2QL7B 3NH1A 4DL7A 3KJVA 5DLGA 3VV2B 4YHHF 4M1KA 5CR4A 1UFLA 5ALYA 2KFZA 1MA7A 1LQ9A 3D4JA 2J8AA 2CNLB 4X4QA 3GG4A 2ISPA 2VA2A 3GR0A 3NGRA 4ZVFA 3AODA 1NGFA 5M2PA 4OO1J 3W5ZA 3BDEA 5J2EA 1RTDA 8ICTA 4A5AA 3HI0A 4JKGB 1CS4B 5JMVA 3ZFVA 1Z19A 1OQ6A 4AQYK 1ATRA 5AQJA 1WKKA 4FJKA 2DNYA 3Q0AA 3PIOQ 4NB4A 2ZTCA 4JI2F 1RE1B 2XY7A 4R66A 1RQ0A 5BXIA 2F2AB 5ALVA 1S6PA 1WF0A 2QZ8A 3UDEA 2CDQA 3KXDA 1ZOLA 2V50A 2NRWA 1I94J 3NAEA 2ALZA 4NCGB 1FIQA 1RWWB 3KHHA 1R0AB 3VGSA 1B92A 3VQCA 3DHXA 5DK5A 3NXZA 1T02A 4PZVA 1FJGK 2HQGA 4RW4A 4DV3K 4JKFA 4F25A 3HVAA 1RBOB 2KN7A 5KG4A 5IFMA 2KNJA 1HYZA 4OJ6A 4NRUA 3EMTA 1KVBA 2IC3A 3HHLA 1YGYA 4PWDA 2K8AA 3P6YC 2QWOA 1VBKA 2D3OR 3QWUA 3NMAA 5BR8F 1VQKS 2E1AA 1KNZA 1BQMA 2X3GA 4FZNA 3FCWA 4L6V3 3RYLA 4TU8A 5KFTA 4DU4A 5E41A 3W2VB 1TL1A 3ELHA 3N7PD 3ENBA 2P8IA 5F9NA 1RT5B 4FYVB 3TTDA 3HPOA 1RKIA 5E3CA 3OL8A 1D1UA 1NOMA 3JQJA 4ED3A 3N4WA 2V69A 4NLWA 1N5YA 4CGZA 1RA7A 4XH4A 3RVCA 3TUPA 2MGZA 2BZ2A 3N0VA 1HBNB 4OGEA 4B3OB 2BOPA 2QI2A 3NGUA 1UVIA 2ZZNA 3QIPB 4BRPA 1S5ZA 4OPHA 4Q45A 2YY6A 4EO8A 3RB0A 3WNEA 5L1MA 3M6WA 2DPNA 3NASA 4ZLPA 5C7PA 1YBAA 2GAGC 2MKKA 3B4DA 4CJRA 1RAHB 2WCXA 1P27B 3OXGA 1WEYA 3NNAA 2Z58B 3OLAA 2B4UA 5E5NA 2ZEJA 4Y2YA 3CGIA 3J7ZT 2ZWHA 3W0LA 2GELA 3MWPA 4MKAA 4WF9L 2OPPB 4CJ3A 3PY8A 5KFSA 4XDCA 3BREA 3RG6A 4FXWA 2P5GA 1ZZFA 3C3LA 4CJ7A 4KB0A 4FJ8A 3AA2A 2DXEA 2W40A 1KOOA 4M9GA 4M8LA 1U04A 2WF5A 3CULA 3B82A 4C4TA 2B9XA 1AUDA 2AHOB 1Q46A 1UZDA 3J80U 1S9GB 3HT3A 1QY7A 9ICOA 1EP4A 4B3TJ 2HMPA 5EHHA 4B9MA 2XNQA 4EFHA 5AKEA 3G8QA 4NRTA 4DJBA 5B8HA 1ZTWA 2IM1A 5J2GA 2K4PA 3CCRN 3J80Y 1HA1A 4HTJA 3SDEA 3OYFA 2GVZA 4DS4A 3W64A 4NI2B 1EWRA 2HWTA 1WTFA 1RLCL 5A8KB 1S6QB 1HRHA 4Z2XA 4Y1CA 2VKRA 5AQHA 1FKOA 1EXQA 5CY4A 3MWTA 2OPSB 5CABA 3I6PA 4LF6J 5AXMA 4F50A 3G2XA 5GADI 2M70A 4NY8A 3K9KA 3RGIA 3VAJA 1ZQUA 4DV6F 1RYUA 3ENVA 3FM9A 3L2VA 3KZBA 1NAQA 3KUHA 5DQGA 2QL5B 4M3TA 4AM7A 2F65A 2RE2A 3H40A 3UKUA 4YMEA 4CYUA 3V4IB 1BQXA 1UJ6A 2GMHA 5KTQA 2FVSA 3SLCA 4JI3K 2LYAA 4O44B 2CG4A 1K8KB 3Q86A 5ETTA 1VIOA 2QW9A 3TVZA 3FC4A 1FT8A 2KICA 1IG6A 5DLFA 4QWCA 4FLVA 1WSGA 5AZIB 3A1YG 1D8YA 4N8NA 4B9QA 1WC3A 2G0IA 1F3FA 5C2CA 1EIYB 2MJNA 2E44A 3KK3A 4BRFA 4ID1A 1TAUA 3KWMA 2JSXA 2V67A 3UXNA 2HBMA 2XS5A 5KT3A 2FSNA 2DNMA 4QIWF 2EAPA 4J03A 4CEDA 4CF9A 1VR6A 1FFUA 1IN0A 1Q8LA 1X31C 4HI1A 3TAFA 1NUEA 1KVAA 1MMLA 3EUB2 1M5PC 5IWAF 2Q1NA 2CPEA 4CTAB 2W2MP 2GQ2A 5AZJA 3NDKA 4HKQA 3N4QA 1RA6A 4GKKJ 2W9AA 1IKYA 1YJ7A 3WKDA 1VBZA 4UUXA 4NLXA 2F8SA 3VENA 4U7BA 4DV0K 3LALA 4C1NK 1E6YA 1IBKK 4MK8A 1OYEA 4O4RA 3WXLA 2MYFA 2C3PA 5K20B 2ASLA 1IBMJ 2HHSA 2DRDA 3DI6A 1BLUA 3D0PA 2R2RA 2MLYA 4BREA 3TTCA 1Q7LB 3I0SB 4E2FB 1ITPA 4KHPF 1VSDA 2VH7A 2YB4A 3QU7A 1B3TA 3C14B 3GE1A 3Q8SB 8ICXA 1URRA 1JJ2R 3ZEUB 3KFWX 5DMRA 1TK8A 3HDSA 4AYBC 4OX9K 1IBKJ 3CJ8A 3PMLA 3JPTA 4OKKA 1A77A 4ILRA 5I3UB 3A0BU 2XGPA 2KJ8A 4Y2PA 4WQ4C 1ZBHA 2HFVA 3H42A 1X6JA 4CJQA 1KDHA 2YJFA 2VJUA 3G86A 4O5EA 2IOHA 1S10A 4DI6A 1XQIA 5KFFA 4WKYA 4DFMA 5IV3A 2POKA 3N7SC 4LR9A 4ID5A 3QNOA 1XSNA 3M1FA 4DR7K 4RBTA 1GMUA 3MDQA 4DOAA 2IDLA 2RDJA 4DL3A 1Y4ZB 2VFRA 3KKAC 2FVCA 3QSYB 2M5YA 3UN2A 1TAMA 3SEIA 4F4ZA 2M52A 1KVIA 1IM6A 2AH5A 5ALFA 2PI4A 2QSFA 4RR5A 2DEIA 1JJ4A 4OYPA 3KG1A 2UV8A 2BOAA 4JI6J 1R0CB 2PMZC 2OO4A 3PJWA 3BBCA 1QQ5A 1ZETA 1ZQGA 1LKYA 2LA6A 4PQUA 1IH7A 5AZJB 3QRRA 4DOZA 1Y0HA 2R7OA 4AE5A 1R3NA 3HO1A 5A2QY 3GCWP 3RJEA 4AL5A 2Q66A 4J9KA 1WC5A 4P4MA 1ZYQA 3UN3A 1S12A 3QLHB 4YD2A 1I3OB 3K58A 3I9ZA 3OYJA 3KKSA 2NYHA 5DDYA 4K4TA 1CJVA 2DHSA 1N61A 1SIJA 9ICSA 1UP1A 2JWNA 9ICKA 4CO4A 1CRXA 3CWJA 4PWUA 5DGAA 4JYAF 3KK3B 1F5AA 5KFOA 2WVCA 1ZQCA 2LVWA 4CFDA 3ATUA 3PSIA 1WTBA 5HK4A 3HKZF 1Z6RA 3F0NA 4BR9A 2K7KA 1F6TA 3IG1B 5KRTA 4MLHA 2QWLA 3QYYA 4F36A 1S0VA 4MN4C 2DHGA 4IG3B 4P73A 5A6PA 3HP6A 2I5JB 4KLLA 2LLZA 2MJUA 5H9FJ 3R1HA 1S22A 2VBYA 3BQ0A 1LW2A 2I6WA 1JJ2M 4DL0C 1TL4A 5AICA 1MDUB 3C6TB 2F63A 5BOMA 4JKDA 4L3NA 3IR5B 4KGMA 1ZQTA 4P4PA 2P5OA 4J9QA 9ATCB 3N4MB 4QZVB 2VQFJ 2YKQA 1C1CA 1V4SA 1QS4A 1DFDA 3THWB 1HBOA 4FYWB 4RW6A 1IV8A 3PUFA 3TX8A 2IBOA 1EO1A 2LQBA 4FKYA 2OPQB 5LJWA 2OSRA 2RQ4A 4PGYA 2M7SA 4L3QA 4J9LA 2W9BB 2I1QA 1YLXA 3IUCA 5K8PA 4DTMA 5AE3A 3HZEA 1HJOA 5B7WA 3MZIA 3GU0A 4PKGA 1T3NA 5ALZA 1HI1A 1H7WA 3JB9k 3HJFA 2FBYA 4PEOA 2VBXA 4BRCA 1H73A 4YOTA 2N4DA 2G06A 5KT2A 2P9SA 4DV3J 4B3MK 7ICOA 1VSFA 4F91B 1QTMA 5HR7A 2HGNA 5THWA 2LMRA 3I56S 4HHUA 4FN5A 3M4XA 1X9SA 1TV6A 2C2NA 2DNGA 1BIUA 1YK9A 4Y28C 3EE9A 1LNQA 2GUIA 1UCNA 1J2NA 1JXEA 1YIJN 3SFGA 2XSJA 4CZHA 2OPPA 1TTHB 4CEEA 5B0AA 1U1KA 3DEEA 4MH8A 4BQZA 5IT9U 2BPFA 3D3BJ 3MM6A 1MWZA 1LFPA 2R9LA 3FBEA 2V8DA 4PJ0U 4TU7A 3GFHA 4BQLA 4IFEA 4WFNL 7ICRA 1NGDA 1EX8A 3IWXA 2MDAA 3QFUA 3M8PA 4DUYK 4ED2A 1Z26A 4DR1K 1GLCG 4LC9B 5J2FA 1NGGA 1H38A 4WFAL 2IRYA 3V6DB 5L8RC 3PCOB 4CTAA 2BH1A 1HKGA 4C8LA 3EE8A 2PAVA 2FJXA 3RJMB 1N5YB 4DV2K 3TWHA 4GNIA 4CEQA 3HJEA 4EP5A 1C6VA 2QWQA 4M3XA 1W9HA 1RTJB 1NSKL 3JTNA 3AVLA 1XEZA 2CPYA 5LT5A 4A8MP 4DV0F 2CNNB 5AXLA 2QL9B 4WZQA 3RBEA 1TL3A 4CZJA 5IIOA 4F8RA 4YMOA 2CPIA 2GMJA 4M7XA 2P9IA 3F2DA 3D3CJ 2ZH8A 4Q5VA 2PFQA 1E6VA 4QJFB 2DBYA 1VRTB 4DUZJ 2GVDA 2VG6B 1RDWX 1HQUB 1KLMB 3RSEA 4CIFA 3RH4A 3JYTB 4DMZA 1HNXJ 3HSCA 5GIOA 2HVZA 3CETA 2ZBIA 2NYIA 3ULEB 1RI7A 3H4DA 3L0QA 5KG0A 4OJHA 2G8WA 4BWMA 3OYEA 4W90B 4FF1A 3K0SA 4YXMA 2RRBA 2FJ6A 2LYHA 4EZ6A 1I6JA 4OI4A 3B54A 2ZH4A 1NSQA 1FRIA 2CXEA 2P9IB 4KHSA 3BPDA 1KD1T 3S41A 1RT2A 4L74A 4PYAA 3CQXA 2E1FA 5BRDA 4M3UA 3CSKA 3ZZYA 4I64A 2NSCA 4IH5A 4CF3A 1U2VB 3VA3A 3N6MA 3UQSA 2X1BA