2HHTA

C:o6-methyl-guanine pair in the polymerase-2 basepair position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
b'KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhtA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhtA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhtA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhtA01
4J9RA 3E2EA 3DOKA 7ICOA 1WAFA 4YMOA 4ELTA 4DTMA 1Q8IA 3UQ0A 1UA0A 4BWJA 2OPQA 4OPKA 4GW6A 5C5JA 3BQ0A 3PX6A 2JEIA 4YFKA 4DOBA 5DGAA 2PFNA 2DPJA 8ICMA 2ZTCA 2GV9A 4PPXA 1UT5A 2H5XA 2FLLA 4C8OA 1KVBA 1UOCA 5TZVA 4Q0BA 4KN4A 7ICKA 5I3UA 2F1IA 8ICFA 5C25A 4E89A 5DB6A 5KT5A 3VQCA 3MR5A 3QEAZ 5KG0A 5KFMA 4YR2A 2IA6A 4PWDA 1ZETA 1RT3A 3ZDCA 3SI6A 4RQ4A 2ALZA 3MGHA 3MFIA 2DFLA 2HHXA 3OY9A 4AHVA 9ICXA 4FM1A 4MEXA 3QE9Y 4P2HA 1S10A 1RILA 3TFSA 4FJJA 1CXUA 2FBVA 4O3PA 3RJGA 7ICJA 1X1PA 3MXIA 3RBDA 2W9MA 3O4QA 4CK1A 3V7LA 3AVFA 3I0SA 2C22A 2IMWP 3PUFA 5J2QA 4EYIB 2EHGA 4YMNA 1RT7A 3DYAA 2JEGA 4M45A 9ICFA 3M8RA 3AV9A 4JV1A 3GFKB 2KFZA 2JEJA 2P6RA 4FJHA 5KG6A 4I2DA 2WOMA 3TABA 4F4XA 8ICVA 5DB8A 3D45A 4TURA 4RQ5A 3VQAA 3SUQA 3C2KA 4CHYA 3NH2A 2OA8A 4ED2A 4IFVA 2YKMA 3I8DA 1ZQWA 2Q0ZX 4KLQA 3RR8A 1RPLA 4DU1A 3TAGA 1X9SA 3K58A 1S0OA 1DOQA 4AHUA 5KFQA 3QNOA 4O9MA 5FRMA 1FK9A 4DEZA 1A5XA 3HL8A 3NF8A 4I2EA 2P5GA 2F8SA 1CXQA 1RNHA 4IQTA 3TARA 2AU0A 4QWEA 4UAZA 1MSWD 3T3FA 3AVJA 3V9XA 1U49A 3NF9A 5DQIA 4AHCA 5IIKA 3OS1A 4CFBA 3UPQA 8ICRA 3RJHA 7ICEA 3SUPA 2PFPA 3GILA 4FLXA 4W5TA 4N5SA 4R66A 3V7KA 2YNGA 4F3OA 4KI4A 2YHBA 2ZTEA 2ZUBA 4RUCA 1NK8A 2UVUA 1ASVA 1RT6A 3MXJA 3B0YA 3FDSA 5F9NA 1TV9A 8ICAA 2BQ3A 1BHLA 4DLEA 3P5JA 4LY7A 1B22A 4OGCA 8ICEA 1ZQXA 3DLHA 4CJWA 4FJLA 4W5NA 4B9LA 4JLHA 1BGXT 8ICCA 1LAWA 4KLMA 2KW4A 3LANA 1KFTA 4KB1A 5L9XA 3UXPA 5KFCA 1YVUA 4ECQA 1EXQA 4J9QA 2PI5A 1RTDA 2R8KA 2LYHA 2ISOA 2KFNA 3V7JA 2ZJ8A 3O4NA 4QWBA 1QTMA 3OYLA 4FZYA 1ZQYA 5CWRA 4M2YA 2ATQA 9ICBA 4J9LA 1JLGA 3TAFA 4PHDA 3T1AA 3RB4A 1CEZA 4DL4A 3O3FA 2A1RA 1JN3A 1ZQLA 1N5YA 3MGIA 1QHTA 1LWCA 5DQHA 4O5BA 5KFUA 3BQ2A 4YQWA 3V9ZA 3FYHA 4C8KA 3GV8B 3RJIA 5CZ2A 3H4BA 4W5QA 3OHBA 1BQMA 1RCHA 1CUKA 3ZT0A 4EP4A 8ICHA 3AVIA 4O5KA 3C23A 3K5OA 3WNFA 4ECZA 3JPQA 3C2MA 1RDDA 3JPSA 4DU4A 4O3SA 2PYJA 5BOLA 3V1OA 1XI1A 5BOMA 3SQ4A 1IG9A 5KRTA 2R7YA 2IHMA 3K4GA 2D0AA 4Q5VA 1RBRA 4CGHA 1U48A 1S1UA 3ZSWA 5KT7A 3Q8PB 4M6WB 2VWKA 3HXMA 2FPLA 4CJTA 3BJYA 7ICSA 1IKXA 3H40A 3S3MA 3PW2A 2OYQA 4YD1A 2FMPA 2HHSA 4F92B 3HX0A 1RTIA 4RW4A 4M9JA 3ORYA 1BPZA 1SL1A 2R8HA 4E7JA 9ICSA 4CGIA 3RAXA 3RMCA 2I1QA 3LWLA 5KG5A 3VQ7A 3LPUA 4PUOA 4I2FA 1RBTA 3N4MB 3V9SA 3MBYA 7ICGA 3LWMA 4KLOA 4M0AA 4RNMA 4BE1A 4N76A 4J9PA 3HP9A 7ICPA 3LALA 5KG7A 4O0JA 3CQ8A 2XCAA 5IIJA 5SZTA 3AA2A 1TKZA 4QAGA 3C6UA 4M3YA 4UB3A 5J0UA 3K5LA 1WCNA 4F4KA 4DMNA 4QZDA 1CZBA 2YKNA 2XC9A 2BPCA 4RQ8A 4NYNA 5DBBA 3HSTB 4M41A 3MECA 4ECRA 5KG1A 2BGWA 4M3XA 3DM2A 4FJGA 4CECA 3I0RA 3QERA 2XY6A 1ZBIA 7ICUA 2A1JA 2BR0A 3VQDA 4DOCA 4GMJB 1XSPA 4KTZA 1ZBFA 3HT3A 2W8KA 4RPXA 2KTQA 1LW2A 5J0RA 1HJPA 3PX4A 1NOMA 3M9MB 2HHWA 3GV5B 4NLKA 2XRIA 1VSIA 2VA8A 2XCPA 3VQ6A 5J2NA 3V81A 1EX4A 3V4IA 4KTQA 1JXEA 1QSSA 4IRCA 2PFOA 4ICLA 2Q3SA 3ZDDA 1LB2B 4ED3A 1HRHA 2Z1IA 2LSNA 9ICRA 4CE9A 3PW4A 4P4OA 4PGYA 5CZ1A 1ZQNA 1RBUA 4ECWA 1LWEA 1JLAA 4B9UA 4ED0A 3T19A 2ZJ5A 4I27A 1S1WA 3CFPA 3ISNC 4RQ3A 3JPPA 3BGRA 3QETA 4E1NA 5KFYA 1WSEA 5J2EA 3QO9A 5HRSA 3Q8RB 3G6VA 4ECXA 2G8KA 1GOBA 3ZSQA 3V6KA 4DSLA 3NGIA 4Q45A 4ZHRA 1XC9A 3M8QA 4DTXA 1A5WA 4NM2A 4F4WA 3NCIA 2MUTA 3V6DA 3NBPA 2IHNA 1JLQA 5J2PA 1Z00B 2ISPA 4GXIA 2W9CA 1TVAA 5DDMA 1TK8A 2I9GA 3AVGA 5CYQA 1NK5A 1LAVA 1TK5A 1SZPA 4CFDA 2FPKA 1D9DA 4B9MA 4F93B 1FXXA 1KEJA 3VN5A 1HPZA 5DGBA 9ICEA 4OKEA 1J9AA 1NKBA 1Q9XA 2PZSA 3NE6A 4CEOA 9ICHA 1RT4A 2XO7A 4HUEA 9ICLA 3QZ8A 3IAYA 1NKCA 1WLJA 2OPRA 3DLBA 4E1MA 4CJQA 3RAQA 2R8GA 2W9BB 4LVSA 4FZZA 1CZ9A 7ICVA 4DTOA 3F9KA 4R64A 4M9GA 1L3VA 4DFMA 3AA3A 4N56A 2C2EA 1NJZA 4ED8A 2PY5A 4L8RB 2DFFA 2OPPA 1BIZA 4QWCA 4O5CA 1S0VA 9ICIA 4YR3A 4YVZA 5J2HA 3LP2A 5IINA 4OLBA 4DFJA 4RW8A 3L3VA 3P1GA 3ZSOA 1HYSA 1LV5A 2NRZA 4DTPA 1ZQPA 1LW0A 4IBNA 3MEEA 3L2VA 4E7IA 3LZJA 2V4RA 5J2KA 4DWIA 1VRUA 4Q8EA 9ICKA 2KQ2A 1EXNA 2FMQA 4GC6A 3SPYA 3G10A 5DBAA 2FPMA 3K75D 4RPZA 3SQ1A 3U3GA 4UAYA 3NTUA 5EWEA 7ICTA 3P83D 4YCXA 1BI4A 3RRHA 1Z25A 3RH5A 4CJKA 3GQCA 3MEDA 2PI4A 3PX0A 4O0IA 4FJIA 4QZGA 4CEZA 3UQ2A 4TQRA 2BANA 4IG3A 1NK0A 7ICHA 1EETA 1HNIA 3BQTA 3KHRA 5FDLA 4F4YA 3DRSA 3MDCA 3Q8MA 1R0AA 2G8IA 3QEWA 1HNVA 1ZQJA 3HYFA 1NJXA 4J2BA 1ZQVA 3RTVA 4DG1A 4BE2A 4ZTFA 9ICQA 4FO6A 7ICLA 4R8UB 2FBTA 3LP3A 2G8FA 4O3QA 5EWGA 4PHPA 4I28A 1QS4A 2Z1GA 3GIMA 2ETJA 1TGOA 3THVA 4JWNA 1D8LA 4I2IA 3NGDA 1VSJA 4CJUA 1KSPA 1WN7A 1C1BA 1I39A 2XY8A 2PFQA 2W8LA 3SJJA 2D0BA 4CERA 1YT3A 1H38A 1BCOA 4CJFA 1T05A 3CM6A 1C7YA 2BQUA 4CK3A 2HW3A 4CIGA 3MDAA 4YD2A 4K4IA 3A2FA 4CHQA 1U47A 1K6YA 5SWMA 2P5OA 3AO5A 4KITB 5J2DA 4FLUA 1VSKA 1JLBA 3S9HA 4H4MA 2V9WA 1FKOA 5HLFA 3KIOA 1ITGA 4OKKA 4IG0A 2JZBB 1QSYA 5KFJA 3OYIA 3H4DA 5CP2A 1RDBA 2X6SA 4KHUA 4UBCA 5KTQA 2FMSA 3AVCA 5KFZA 2ATLA 2AQ4A 4ZTJA 4TUPA 4XIUA 4DL2A 4XUSA 4AILC 4YXJA 1B92A 3CFRA 1JXBA 4C8NA 3PW5A 3SV4A 3ISBA 4CHPA 4X5VA 3ZT4A 3PMLA 4J9OA 1O1WA 2B21A 1T3NA 4CF0A 1S0NA 5HP1A 3RR7A 3M8PA 3T5LA 1S9GA 4CFCA 1PZNA 4MEYA 3H8WA 1C0UA 2J6SA 4XQ8A 4PQUA 2PXIA 3MABA 4HTUA 5DB7A 8ICTA 7ICMA 2UVVA 1VSFA 4YR0A 4BXOA 3N97B 1KFDA 3RWUA 5KFBA 3C6TA 3QEIA 3RH6A 4NLNA 4HUFA 4B9VA 1D8YA 4PHEA 3L2QA 9ICWA 4I7FA 9ICGA 2NRWA 4PH5A 1S1TA 4CEDA 1BPXA 3HO1A 5EWFA 2XY5A 1JX4A 1N6QA 1J5OA 2F96A 3DRRA 2HHVA 4KPYA 3RRGA 5KFFA 4FBUA 4KLFA 4J9SA 3PMNA 4EEYA 4DTNA 5CR0A 4JV2A 5KFDA 5J29A 4KHWA 4O55A 1ZQGA 2DY4A 4AHRA 4KLIA 4YNQA 3V9UA 3K5MA 4PA1A 2UVWA 7ICFA 8ICLA 3ASMA 4KREA 4HHTA 4KTWA 3G6YA 4RQ1A 5KFPA 1NK9A 4CEEA 1EKEA 1XS9D 3ISDA 4R65A 3V1QA 4DLGA 3KLGA 3DI6A 1S0MA 5KFGA 3NFAA 5HNKA 2PYLA 3ZT3A 3EYZA 4B8CA 1Y97A 3CFOA 4DF8A 1WCLA 3QINA 4KLUA 2AGQA 4B9SA 4DSIA 3ZSXA 3AU6A 3VQPA 4CJRA 4JS5A 1QSLA 3F73A 1W0HA 3OYCA 4KN7A 4W5OA 1SV5A 5DMRA 1MQ2A 3C1YA 5KFIA 5BPCA 1BPEA 4QZAA 2NRVA 4J2EA 2I5JA 2NUBA 3GIIA 3Q8QB 5DG9A 2QKKA 4DL3A 4KFBA 3DRPA 2VG5A 1XSLA 2XGQA 5J2FA 1ZBHA 1UAXA 3AU2A 3VQ9A 2AQ0A 4TQSA 1SL2A 3AO1A 4ID1A 2E6MA 1XO1A 4QW8A 2BE2A 3KD1E 5EU7A 7ICQA 5KFXA 1MC8A 3HPOA 4FS1A 4DQRA 1FKPA 1IKVA 3QEXA 2J6TA 4FK4A 1QQCA 4KHQA 5IILA 4MQ3A 5T7BA 3OSPA 4CFAA 2ZJAA 4YN4A 1S1XA 4IRKA 1BVSA 5CHGA 1EP4A 1BQNA 3MAQA 4CJVA 3LPTA 5DLFA 1SL0A 4RQ7A 5L1KA 4EZ6A 2Y1IA 1ZJNA 3JPNA 2P66A 2C2RA 1KVCA 4DTRA 3MEGA 5DG8A 2G8UA 4FM2A 2ZUCA 1WSIA 2HVIA 4DOAA 4Z6FA 3MR3A 4DF4A 9ICTA 2VG7A 4MFFA 3KTQA 4CK2A 5DB9A 4DQSA 4CF9A 1A76A 4EBEA 4E7LA 5KG3A 3CYMA 4ELUA 4JRPA 4FLWA 3UXNA 1XWLA 4ECUA 4Z6DA 1D5AA 1HUOA 1ZQDA 3RJJA 3AA4A 1ZQKA 3AVAA 3QNNA 3C21A 3AVLA 1S6PA 1KLMA 4DO9A 2Z1JA 3IRXA 5KT2A 5KFOA 1X9WA 3DLEA 4EP5A 5FRNA 2ASLA 1NK7A 4CEBA 3PY8A 3KLIA 3S3NA 3PV8A 9ICJA 4QZFA 4HVJA 3Q8SB 1S76D 4FJXA 4B08A 3T5HA 1ZQRA 4NYFA 1BL3A 3WNGA 4F2RA 4CF2A 4DFPA 2XHBA 4UBBA 2HHUA 1ZQQA 4DTJA 2X6NA 3OYEA 3RMBA 2XY7A 1VSEA 3TI0A 5JS2A 4IQVA 1JLFA 3K57A 3QZ7A 4F8RA 3QIOA 3JPOA 4O4GA 3RH4A 4UB1A 4NCBA 1ZQTA 2D5RA 3NDKA 5KFNA 4N41A 4QZ8A 4BDZA 3OYMA 2YHAA 5J0TA 4TUQA 1HUZA 4J2DA 4FJ9A 3OSNA 5HHIA 1LWFA 4DSFA 1JL1A 4Z4GA 2DPIA 1AROP 3AVKA 4QCLA 7ICIA 3C5GA 1RT1A 2RN2A 3AVMA 4H8KA 4RW7A 1TL3A 3DOLA 1F21A 1RDAA 4E7KA 1ZQIA 1DGSA 4ELVA 3G6XA 4JRQA 3TAMA 4E3SA 4CGGA 3H8JA 2NRTA 2IGIA 1RXWA 4QZ9A 1U9LA 4FLZA 4E19A 3KK2A 2RDIA 4DL6A 3TFRA 9ICAA 2BKEA 4O3RA 2FBYA 1T7PA 3Q8KA 1HJRA 4I9QA 2IBKA 3ZSZA 1A77A 5IIMA 1DTTA 3HPHA 4G1QA 1ZQBA 4F5OA 1B43A 4CJ3A 3WNHA 4DL7A 3TANA 8ICYA 4FJMA 1TKXA 1ZBLA 5KFAA 5KI6A 2BCVA 3ALYA 4JWMA 3ULDA 4KI6A 4RPYA 4Q44A 3OGUA 5KFTA 3OJSA 4ED1A 4FJNA 4NLGA 5KG4A 3NHGA 3PVXA 1Y88A 4KAZA 1ZQEA 4AHSA 1NOYA 3OYFA 3FFIA 3KLHA 1C0MA 1J53A 2BCRA 4TSXA 2HNDA 1WAJA 2ITGA 1ZQFA 2B4JA 5J2JA 2RPIA 3T5JA 4DQQA 4DSEA 4FJ8A 3K59A 1JXLA 4J9NA 5J0PA 2R8IA 8ICSA 3SCXA 5DBCA 4QWDA 2BPGA 2G8VA 4I2CA 3SQ2A 4B8AB 3RJEA 2WONA 2ZQBA 4JUZA 2KN7A 4Z4HA 4FJKA 3VA3A 1UWBA 2G8HA 3V6HA 8ICNA 4QOZB 1MQ3A 1BCMA 4KKOA 1VSMA 4NLZA 5KT3A 2F8TA 2HHTA 3OHAA 1BIUA 4B9TA 4XA5A 4CCHA 8ICUA 2OZSA 3LK9A 3KHLA 4OLAA 3SPZA 5CJ7A 5J0OA 1KCFA 9ICVA 4C8MA 4KLHA 1SKWA 3TWHA 4LSLA 1IXRA 4M9HA 5K14A 3IS9A 3KLFA 4FXDA 3C94A 5HBMA 4F5NA 3GIJA 1B9FA 4KMUA 4OGEA 2VA3A 2YNIA 4NY8A 4Z4IA 1ZJMA 4I9LA 2ZTDA 4ECSA 1U04A 4QZEA 9ICCA 3SZ2A 2ZUDA 3OJUA 3MFHA 4HUGA 4M3UA 4KLLA 2W42A 3ISCA 3AVHA 1XHZA 3TAPA 3LAKA 1S6QA 3ZCMA 2F1JA 2HNZA 2IAJA 4O3NA 1L3SA 4OVLA 1VK0A 3AO3A 5IIIA 4WE1A 2M9NA 4FZXC 1VRTA 4YP3A 4UQGA 2VA2A 1RBVA 3LDAA 2RF2A 4M9NA 4J9KA 4BWMA 2VWJA 4IKFA 2BCQA 3M8SA 4M6WA 4LSNA 4FLYA 4J9MA 4EYHB 1RT5A 3V72A 3H7IA 3HVRA 4RZRA 4CJLA 5J1EA 1S9FA 2BQRA 4PY5A 4NCAA 2AGOA 5KRSA 1NKEA 4DFKA 2BDPA 3KK3A 4UB5A 2IDOA 1C1CA 4Q8FA 1IKWA 1UT8A 4KLSA 4IR9A 5KFWA 4P4PA 1ZQOA 4Z6CA 3CM5A 1VSHA 1L3TA 3D0PA 4IFYA 4DSKA 3O3GA 3QIPA 9ICNA 4NM1A 1NJYA 4PHAA 1U4BA 4QW9A 4QZBA 3AO2A 3GDXA 3UIQA 1QE1A 3G0ZA 4ED7A 4FS2A 3TAQA 4XRHA 1BPDA 1TFRA 3WNEA 4O44A 2YNFA 1ZQMA 2RDJA 4DTSA 4DU3A 1NOZA 4EBCA 1ASUA 4FK0A 5KFVA 4EZ9A 1YTUA 1VSLA 1ZQSA 2JLEA 3ZDAA 3SQ0A 2MUTB 3H8SA 1TAUA 1ASWA 4IDKA 1Q9YA 1NK4A 1KDHA 1ZQCA 4KLGA 2QXFA 1U45A 4LH5A 4CGFA 1C6VA 2W9CB 3H08A 2RKIA 4M3TA 1N48A 1WSGA 4DS4A 4DS5A 4I29A 8ICKA 3ZDEA 3MR6A 4CEAA 3LZIA 4GLXA 2OZMA 1TKTA 5JUMA 4M3RA 3EW9A 8ICJA 4GXJA 4TUSA 3RBEA 3NF7A 3QEPA 1S5JA 4ED6A 3ZT1A 3GV7B 2AGPA 1BPYA 2BPFA 4I2JA 1HMVA 1SKSA 5E41A 3L2WA 2BHNA 5DKWA 3B6PA 3CG7A 5CY4A 2F1HA 1KLNA 4OPJA 4FVMA 4EBDA 4RG8A 3HVTA 8ICOA 1L5UA 1WNSA 3EZ5A 8ICZA 1IM4A 5HRRA 4MF2A 2HB5A 1HQUA 3ZD9A 4DL5A 4Z4FA 4W5RA 3OYKA 4NXZA 3PNCA 3OYAA 3K5NA 1MU2A 4DQPA 4GC7A 2NRXA 3C95A 1RDCA 4IR1A 1JMSA 4G3IA 4Z4CA 3PR4A 5HHHA 5L1LA 1TAQA 3SI8A 9ICPA 9ICOA 2AJQA 5CB1A 2YV0X 4BACA 2B5JA 4RNOA 4CJ5A 5DDYA 1K1SA 3L2RA 4PGXA 1Z00A 1JLCA 4R63A 4CIFA 4LZDA 4CJ4A 4DTUA 3OYHA 4H4OA 3ITHA 2O4IA 1B9DA 3SNNA 1TL1A 4M3ZA 4PGQA 5D3GA 4IQWA 1KRPA 3ZT2A 5KG2A 5DG7A 1GOCA 2P1JA 8ICPA 1BI4B 4LH4A 4ECVA 2WTFA 1JL2A 7ICNA 5J0WA 3DLKA 5J0XA 4Q43A 2KZMA 3RB0A 2FLNA 3AO4A 3C5FA 3OYBA 3GIKA 3S3OA 3LP0A 3EY1A 3RMAA 2W9BA 1XSNA 2G8WA 2FBXA 4F91B 5HP4A 4I2GA 1HQEA 5C24A 3ZSRA 4ECTA 5F9LA 1WSFA 4YMMA 3KK1A 1W9HA 5C42A 1X2IA 3HWTA 3EPGA 3V9WA 3EWAA 2IS3A 3HJFA 3IHQB 5JS1A 1BPBA 3OVNA 1NJWA 1KVAA 7ICRA 1HYZA 5I42A 1RT2A 4CGDA 3SUNA 1T03A 1XU4A 4NCGA 1KTQA 4BDYA 3JYTA 4MFAA 4CEQA 2BCUA 3JSMA 2VG6A 4N47A 3AA5X 4RT3A 4Y1DA 4ZH4A 5J0SA 4FCYA 3L8BA 1TK0A 4JS4A 3M9NB 2P51A 3HP6A 2P6UA 2DFHA 3RMDA 3C1ZA 5KT4A 3KHGA 1Z3EB 4RT2A 3HPGA 2OWOA 3L3UA 1S97A 5FROA 5EOZA 3RB3A 1TVRA 5KFSA 1SKRA 3VQEA 2YNHA 2ZD1A 4KLEA 1C1AA 3HM9A 3IG1A 1S77D 3SUOA 3V1RA 3KKSA 3C2LA 3NF6A 4MF8A 1RYRA 4CJPA 4YXMA 3NH0A 1D9FA 3PR5B 3RJFA 3QESA 5KFHA 4RQ6A 1WSHA 3OYDA 4IQUA 5J2IA 4Z4EA 4I2PA 3PW7A 8ICIA 3NAEA 4Z0UA 1A5VA 3OYGA 4OJRA 4KO0A 4DSJA 1VSDA 4FLVA 3JPTA 4K4HA 4FK2A 3T5KA 3VQBA 3VQQA 4F5PA 4F4ZA 9ICMA 1C0TA 4I2QA 4B3OA 3ETLA 3QLHA 4FYDA 4K4GA 8ICBA 4KLDA 5L1IA 3KJVA 5J2GA 4F5QA 4R8UA 4FJ7A 4Z6EA 4DQIA 1HYVA 5HRPA 4I2HA 3TR8A 4FW1A 1S9EA 3B6OA 4KRFA 4B9NA 3ZDBA 3L2UA 2GUIA 3QEBZ 4K8ZA 4RNNA 3LDSA 1IKYA 2DFEA 2OPSA 4CF1A 4HCCA 2O4GA 3LP1A 1BISA 3TQ1A 4M47A 1T4GA 3PO5A 4BXOB 5CYMA 3UXOA 3KHHA 3U3YA 3QEVA 3BQ1A 1K1QA 5HMLA 2HNYA 1RZTA 9ICUA 2B6AA 2ZE2A 4F2SA 3HW8A 3TAEA 4GVMA 2W9AA 4O3OA 3PO4A 8ICXA 2QKBA 2X78A 2V4QA 1L3UA 8ICQA 1ZQHA 4MFCA 5DK5A 2DTUA 2JZBA 3MR2A 5HROA 3Q8LA 3OYJA 2D0CA 1RBSA 3KD5E 4CHZA 4I2BA 4LD0A 1ZQZA 5HMMA 4CEFA 4AHTA 4UAWA 5KT6A 1I3AA 1DLOA 2FLPA 4BE0A 2Z1HA 4FW2A 2KZ3A 2C2DA 3RJKA 4RUAA 4CJEA 2ASDA 2ASJA 3NGYA 4K8XA 2BCSA 1DTQA 5IIOA 5KFEA 1REVA 4ECYA 2R8JA 2UVRA 3KKRA 5J0QA 1QLNA 4HCBA 3DLGA 4YG2A 2HHQA 4FM0A 1ZQUA 1V9PA 3DMJA 1J54A 4M3WA 5J2BA 2GWSA 2IC3A 4F50A 4QZCA 3PW0A 2QK9A 3VA0A 4IRDA 2HVHA 5J2MA 4KLTA 2XGPA 5HRNA 5KFKA 4E7HA 1X9MA 4GXKA 4MFBA 2VANA 1RXVA 1Z26A 1JIHA 3M9OB 4UB4A 4RW9A 4KHSA 3BDPA 3DLRA 3V6JA 3SV3A 3AVBA 1IO2A 3O3HA 2E6LA 4BDPA 4KHYA 3OYNA 2JEFA 3KLEA 3HK2A 4FJ5A 5D4BA 2A1SA 3OS0A 4ID5A 1UA1A 4O5EA 2JGUA 5DLGA 4JK1A 2HMIA 1COOA 2MAXA 4LZGA 4FBTA 3RB6A 5J2CA 3E01A 4AH9A 5J0YA 4KLJA 8ICWA 3ZSYA 2KZZA 4YFUA 4JV0A 2E4LA 5L1JA 1T8EA 5KGXA 3VQ4A 2FC0A 4CHNA 1NK6A 4CGJA 8ICGA 3U6FA 4FLTA 4J2AA 2EX3A 4CF8A 1ZBUA 4M9LA 4F3TA 4UB2A 1G15A 1XHXA 4CESA 4KB0A 1CLQA 3AVNA 4RQ2A 4QZHA 4F5RA 4R5PA 3OS2A 1RTJA 1RYSA 4OKJA 1ZQAA 3LAMA 2X74A 4Y1CA 4KV8A 3K2PA 3B0XA 1JLEA 3NH1A 4RU9A 5D46A 1ZYQA 4RQ0A 5KFRA 1KFSA 3EPIA 3VQ8A 5CA7A 1TKDA 1GOAA 4RW6A 1TV6A 4CHOA 5DQGA 3VQ5A 4M04A 3ZSVA 4KHNA 5KGWA 2BGGA 1SUQA 4BGDA 3AUOA 4CJSA 4E0DA 3JPRA 1JKHA 5KFLA 4QZIA 5J2AA 1S1VA 2J6UA 3NGZA 1IH7A 4CIEA 3MXMA 2IOCA 3ZD8A 1WSJA 4I2AA 4QWAA 4P4MA 5D49A 3SYZA 1N56A 4C8LA 1YTAA 2C28A 4HYKA 1RTHA 3IM1A 2A1JB 4M42A 2GBZA 2Y1JA
chains in the Genus database with same CATH superfamily
4OO1J 2K8BB 1AB8A 1WAFA 5I9EB 3KFUF 3AARA 3DU6A 4BWJA 3ETOA 2OPQA 4ID8A 2E1MC 3CP8A 1ZD4A 5DGAA 2X1GA 3QAUA 2JJ4D 2QM1A 2H3GX 1UT5A 5ETRA 2FLLA 2FUG9 2QG9B 1ZPWX 2DBYA 1KVBA 1UOCA 5TZVA 1WB9A 2CJXB 2LBOA 5I3UA 2DCLA 5D4LA 4E89A 2CN1A 3VQCA 1XQSC 5TKYA 4ILGB 2R7QA 5KG0A 5KFMA 1S49A 1R0BG 1RT3A 1N8RO 3PYFA 2W7OA 4RCHA 2VBXA 3MGHA 4FE3A 1U2FA 2XEXA 3NVZA 1PIEA 3OY9A 5AK3A 5AKEA 4MEXA 2UP1A 3THWB 4M5LA 1NLVA 4RTFD 1RILA 3TFSA 3ZLJA 7ICJA 3UDVA 5BR8K 5HQMA 2HFUA 2W9MA 3O4QA 3V7LA 2Q66A 3F41A 2IMWP 2NS1B 4H0XB 4ISFA 4EYIB 2E44A 3SQIA 4A46A 1KONA 2EDUA 2I5HA 4FJHA 3GIRA 2WF8A 1REGX 3PEHA 3SUQA 1FIQA 5AQZA 4ED2A 4IFVA 2YKMA 2LPEA 1ZQWA 2Q0ZX 2EQYA 4KLQA 2BV3A 4G1QB 1RPLA 4DU1A 4KX5A 1M1HA 4AHUA 2CPDA 2HHHJ 5BR8F 5JVHL 2V2VA 3HL8A 3NF8A 2YWHA 1HHTP 3D0IE 3JAMO 2I6XA 4DV3J 1CXQA 5KAFU 1KEKA 3TARA 2AU0A 5CAAA 4QWEA 4NA1A 2WSFC 4G6VB 4UAZA 3QFHA 1MSWD 5F8LA 3NF9A 5DQIA 2WSCC 4OZ1A 3CCLS 4M5MA 5HO4A 2YMPA 2YKOA 3UPQA 8ICRA 4CFBA 1B99A 3RJHA 1PKUA 1X4HA 3GILA 4R66A 2HNDB 5LJWA 3V7KA 4P10A 4Z7CA 4D3GA 4W92B 2DNMA 1NK8A 3QYYA 2GHVC 1ASVA 3GMGA 2JLFA 1J2MA 4A8EA 4DLEA 2WONB 3P5JA 1DQ9A 3I4PA 3D2EA 1ZBTA 4LMZA 1ZQXA 3DLHA 4CJWA 1WHWA 4FJLA 3S01A 3HLUA 4W5NA 2JSXA 4FDFA 1NI3A 1VJWA 2XNRA 5AQRA 4KKOB 8ICCA 1WHXA 3IC1A 1KFTA 4KB1A 5L9XA 4FWMA 4G9BA 4BVPA 3L9ZA 1RTDA 5EE3A 3GFHA 2R8KA 4IO8A 3FZBA 2ISOA 5AI6A 2GA7A 3OYLA 1BDGA 1KVKA 2L08A 4AM6A 2GS8A 1JLGA 3MMCA 5HJXA 4MYUA 3A8IA 2RD5C 3RB4A 2X7IA 1R8BA 4TKTA 3GBTA 2IOHA 1DFDA 3W62A 1YI2S 1ZQLA 1Z19A 3MGIA 4URGA 2ROEA 4O5BA 3BQ2A 4LF9J 4RU2A 4CI6A 5E79U 3FYHA 4FF4A 4C8KA 2ERRA 3GV8B 2IIRA 4RJVA 2DO4A 4FWKA 2V2KA 3WXLA 3C7NA 4US8A 1S6QB 4RNHA 3AVIA 1X4DA 3C23A 2HNZB 1T6DA 1F3VA 2GMHA 1FA0A 1IG6A 4WE1B 4CBXA 2PYJA 1NNLA 4NMLA 5BOMA 4CZHA 5ELZA 4NA3A 4P0PB 2RF2B 2D0AA 4N77A 5IFMA 4CGHA 1IBLK 3CJ7A 2R7TA 3ED5A 1ZZNA 4WCEL 2O67A 4DV4J 3OV7A 4UOCA 5D0HA 3PW2A 1RT5B 5DZ6A 2VFVA 2QA4S 3ORYA 1BPZA 4BGBA 1SC6A 3Q7CA 4CGIA 3RAXA 4I0WA 3KK3B 2B43A 4PUOA 4I2FA 2AYMA 1C1CB 3MBYA 1IKWB 3LWMA 4KLOA 5AE2A 2PMZF 3NG8A 2Q36A 3I1YA 4LF4K 3RG6A 3L3FX 3QXGA 7ICPA 1GTHA 5KG7A 4PKHA 4MO4A 2F8EX 5E3QA 5SZTA 3Q8YA 4QAGA 1QE1B 4UB3A 3I5CA 4BR2A 2XQCA 2AX0A 1WCNA 1ZRNA 2Z30B 1EARA 2OEKA 5DBBA 3QJPA 2YNFB 2G1HA 3KJQB 4ECRA 3H8MA 2PEBA 3TZZA 1JK9B 4FJGA 2W2OP 4B1YB 4C4SA 3IBPA 2DT9A 2WB1D 4LF4F 2ZJQL 2A1JA 5ALXA 1VQ7S 5D0EA 4NLPA 3QUBA 4H5VA 1XSPA 2ASOA 4KTZA 3HT3A 2W8KA 5AQLA 1XEZA 1Y7PA 5J0RA 2HGLA 4FWOA 3PX4A 1EAYC 3GV5B 4NLKA 4BGAA 4OHYA 4W98A 3TUZC 5SUHA 2EI5A 1RKIA 3OT9A 5B08A 2HEKA 3NNHA 1QAXA 2RQMA 3HHKA 3KG0A 2VBZA 2HAFA 3KJNB 3MOZA 1RGIA 2LSNA 5G0RB 9ICRA 3PW4A 4P4OA 4PGYA 3H3OB 3AOCA 1GX5A 2DHSA 1IN0A 2LXFA 2XYPB 4DV5J 5A0YB 1LWEA 3T19A 5E3PA 2RHQB 3ISNC 3W5XA 1BC6A 3JPPA 1UKUA 2RQKA 5IQQA 4E1NA 5KFYA 2BJ8A 2PSZA 1WSEA 3Q8RB 3G6VA 1AYEA 2G8KA 1GOBA 2I0XA 3Q0AA 4YB1P 4EX6A 3V6KA 4N7TA 4EO6A 3WX8A 4QIWD 1XC9A 3FUYA 1NGGA 1MMDA 2ZHAA 3ENHA 1RDFA 3AQFA 4F4WA 4UOFA 2B5JB 5HL7Q 2IHNA 5RUBA 2ISPA 3P49B 2DNYA 1PVPA 1FFSB 4GXIA 3DN9A 3KK7A 8AT1B 1CJTB 1VQ4S 5HANA 5CYQA 1NK5A 5F3XB 1LAVA 3DRYA 3A8YA 1A6SA 2FQQB 2P9KA 3D54A 6FDRA 3R7SB 4CFDA 4YHHJ 4C48A 4F93B 1FXXA 1SWWA 2H4YB 2FJ6A 3QRPA 2V8DA 2HQ3A 2E2PA 3I9V9 4DN9A 3JAMU 3CJCA 2Q97A 1DZ5A 1O6XA 1QTNB 3DLBA 3IP4B 4J91A 2HBZB 3PKMA 1OKJA 2W9BB 3OTBA 1M1KT 1CZ9A 1HQEB 4DTOA 4R64A 1DQAA 3KK1B 2VPWB 2PMZC 4RPFA 2C2EA 1IWAA 3ALRA 3QGPA 3B4MA 3K17A 2DFFA 4PPZA 2EFVA 3NL0A 3SEOA 4HH0A 4QWCA 2J9DA 1V85A 4CTAB 4O23A 4DFJA 4RW8A 4TLRA 1CBKA 3P1GA 4I56A 4NCGB 3ZSOA 1LV5A 4DTPA 5B0AA 1MLAA 3JYTB 4WJBA 5ALTA 3L2VA 6AT1B 3A3OB 2V4RA 2VG6B 4P0QA 5J2KA 4DWIA 4Q8EA 1EXNA 4A8SA 2CZ4A 3PSIA 5DBAA 2FPMA 4RPZA 3L7PA 3U3GA 1NGAA 2W6LA 5JVGL 1QQOA 3Q23A 3MI7X 3OR2A 3P83D 2HOEA 2BW2A 4J03A 1UQVA 4L3QA 1Z25A 3P5BP 5AIBA 2YNHB 3GQCA 4B9QA 4NI2B 3ZNUA 2R4FA 3HHDA 1H7WA 4CP5A 3D6RA 2PKEA 4DV4K 3RSEB 2BANA 4IG3A 3B4DA 2BA9A 3QU9A 4TU8A 5AI8A 5JLFA 3DRSA 4V19S 3MDCA 3Q8MA 4KRWA 3H7HB 1RAEB 1U25A 4MKAA 3UMBA 2XICA 3MCOA 3SMSA 4KO0B 3BQ7A 2OELA 5AK4A 4I68A 3ATVA 4J2BA 1ZH5A 4IXCA 3N5FA 2G2ZA 1GXUA 3J81O 4E98A 4FO6A 3C14A 3K1ZA 7ICLA 4R8UB 1L3KA 4O3QA 1QS4A 2ETJA 4JWNA 1CULA 1D8LA 2ZUGA 3NGDA 2Y3YA 4CJUA 1NM2A 1HNXJ 1WN7A 1XERA 3SJJA 3OUYA 1YT3A 3T79A 2KICA 1U2VB 5CYMB 5ALKA 1C7YA 2BQUA 4K4IA 4A5AA 3LF0A 2P5OA 4HT5A 5AZJA 1NAQA 4DMZA 5BR9A 5BRDA 2A42A 4J8FA 2QSWA 3J8AA 2V9WA 1FKOA 2AW0A 2HBRB 4YOEA 3WIUA 1U1MA 3POTB 2LHTA 3MMBA 4FSVA 1N63A 1CS4B 3HSDA 1IBKJ 3MM9A 3MAAA 5H9FJ 1X4EA 5KFZA 2ATLA 3CJKB 3UPFA 2KVSA 3AY9A 1GLFO 4TUPA 2FSJA 4IJAA 2AWZA 4FVCA 1P1TA 3UKUA 2P9LA 1NB7A 2CGKA 4XUSA 1KS2A 4XK8C 4AILC 4UZBA 1JXBA 2LP4A 2HGMA 3PW5A 4DV5K 2F3NA 5EGYA 3PMLA 1WG1A 1KAXA 1UJ6A 4F0HA 4XPCA 3L4BC 4C3KA 2B21A 4CF0A 3U02A 2QWRA 1S9GA 3H8WA 1N2XA 5AQSA 3FBCA 3F2BA 3N97B 3RWUA 5KFBA 5JXSA 3QEIA 2K1RA 4MFBB 1TP7A 3AH6A 4MDAA 5AJ3K 4PHEA 1N0VC 3D3BJ 3D3CJ 2X1AA 2EAOA 4I7FA 9ICGA 2NRWA 1ZOLA 1VBKA 1TMJA 1NCLA 2O8BB 4C0ZA 1XC3A 2HHVA 4KPYA 2WRMA 4A47A 1Z4UA 4UUWA 1Q81O 3GFYA 4DTNA 3AGRA 2ZIWB 4YHHK 4WTOB 2OANA 5M2RA 2DNHA 2Q0RA 1Q78A 4WP9A 4EENA 4I6WA 5B0DA 4I4BA 3V9UA 4PA1A 8ICLA 2B8PA 2D0OA 4KREA 2IY5B 4HHTA 4KTWA 5AJ3F 3G6YA 4JI5J 3PCOB 4R65A 2QO3A 1LVHA 3VR1A 3KLGA 3RW7A 2NRHA 2M2BA 1ZD5A 4DV6J 2HLTA 3EYZA 4B8CA 5F8GA 4KLUA 4YHHF 3NNCA 2VV5A 4OYXA 3ZSXA 4CJRA 1MG7A 1S48A 1URJA 5AICA 3M7DA 3F73A 1RTJB 4HTIA 5ALGA 2FPHX 4X4NA 3Q24A 3C1YA 2KKPA 5BPCA 5LY3A 2W6KA 4ILRA 5L1MA 2P2CB 1ZA1B 2FD2A 2X51A 2BOPA 5DG9A 2YWKA 1J5EJ 3DGVA 3BPSP 3DRPA 1RFQA 4AL5A 2XMKA 5KL1B 4PL7A 3VGSA 3AU2A 2DGTA 1S1VB 2E5JA 3NCRA 1Q8BA 4DV2F 3SXLA 2BE2A 3KD1E 1RCXB 5AQOA 1PC5A 2XI9A 4CLSA 4B17A 4ILMA 1RDWX 3HPOA 4RUBA 4DQRA 1TUUA 1IKVA 4ZPCA 4JK7A 4J90A 4E2FB 1FRHA 4CFAA 5HAOA 4WQ4A 4USHA 3WZ0A 2IOFA 3QMQA 4DPOA 3J7ZO 2JRZA 1R8PA 3R9LA 5AZIA 3DOKB 1BQNA 1NSPA 3NP5A 4R79A 3MAQA 4UF4A 2RDDA 2XYHB 2YPZA 3OW2R 1B0XA 3JSBA 3W9IA 1OH6A 5D0RA 4KH4A 5IM0A 1L8LA 3T1YK 2DR7A 3NVKA 2QB0A 2ZIVA 1VHFA 3W9HA 2H1YA 2YHXA 3MEGA 2RLTA 1RDUA 3CC4N 2QV6A 2CNLB 2BJ9A 5ALLA 3IFRA 4Q0BB 1WSIA 2RUSA 1HNXK 1NNDA 3MR3A 4DF4A 9ICTA 2VG7A 3HMJG 1X4BA 1N62A 4CF9A 1Q82O 4PWDB 4EBEA 3CJBA 1F1BB 1PCAA 3AT1B 1Z1ZA 1J27A 3JS6A 3CCUN 1SQEA 3H46O 3NY0A 1WTFA 1ZQKA 2XB2D 2AJ1A 5AHXA 3C21A 5L46A 3AVLA 3T1YF 4C4WA 5KPRA 4DV7J 5CCLA 1Z2ZA 2HFZA 4ETXA 2B56A 3AB2B 3M30B 3D2FA 1B70B 3DYAB 1RT7B 3J81U 1HNXF 5KT2A 1LEOA 4IDKB 1UCNA 2ZJRL 2ASLA 4A62A 3PY8A 4I6YA 3TEGA 2F65A 4OI6A 3AXKA 3FFKB 4H0PA 1YXQA 1RWNB 4HVJA 1HWUA 2JX2A 4FJXA 4B08A 2DGXA 3D4JA 2ZIXB 5DM7Q 4USMA 4I67A 4NLDA 2MQNA 2FJDB 2XHBA 4J5OA 4GO7X 3GG1A 4QOTA 2I7NA 3S7RA 2CH6A 3HD2A 1T3OA 3QIDA 2ZNYA 2KN4A 3F5AA 3TI0A 5JS2A 3WIVA 3K57A 4A61A 4IKAA 5I3QA 4DXLA 4F8RA 3U1NA 4UB1A 2N1RA 4QS7A 3NDKA 5KFNA 4OI1A 4JB3A 4JKBA 4WP3A 4EGLA 3KXDA 4FJ9A 1ZD3A 3OSNA 5HHIA 3EXYA 1WDDA 1MU2B 2DPIA 1SVDA 2HWIA 5HATA 1RT1A 1H74A 1IVZA 3C16B 1YRXA 1K8KB 1PILA 2YNGB 3KHYA 1HWIA 2AP1A 3DOLA 1Z6RA 3TACB 4XO0A 4ALZA 1WF1A 4RWXA 1R89A 3TAMA 4E3SA 4QPTA 4LR8A 5HN0A 3NASA 4KGVB 3QSYB 4B1VA 5J8YA 4E19A 3KK2A 3TFRA 4BQLA 1XR7A 9ICAA 4IZ9A 2OD4A 3Q8KA 1M5SA 1G2EA 1A77A 1DTTA 3GFZA 3O8MA 1YRTA 2DL0A 3CMES 3UCZP 2MU2A 3DDKA 1RAFB 5EY4A 3TANA 5KQDA 8ICYA 1ZBLA 5AE1A 1RHUB 3ALYA 2HOQA 3BO3A 1YJUA 2N7YA 4DV6K 3J7Z5 4Q44A 4LJMA 3FK4A 4CZLA 5KG4A 1ELOA 1N5WA 4KY3A 1Y88A 2D69A 4KAZA 1N5YB 1ZQEA 3CJ9A 2G2OA 4TVAB 2MSSA 4AUKA 3FFIA 4F25A 3BZQA 1C0MA 4FVUA 2ITGA 2B4JA 4PZVA 4FJ8A 1FERA 3C2PA 2GUPA 3IDHA 1T03B 1FO4A 3C65A 2KKHA 4MO5A 3NLCA 4DV6F 4JBCA 3HJEA 5DBCA 3AD9C 1J5EK 2MZQA 4LVOP 3SQ2A 3HSGA 2DPNA 2VFRA 1SQFA 5ALIA 2XMJA 2VBWA 3KJFB 4Z4HA 4FJKA 1PBUA 2G8HA 1TE2A 3V6HA 2YI1A 1MQ3A 1ZAWA 5KT3A 3W2VA 1RJJA 4KH6A 4H4KC 1IKXB 2E8NA 1WOSA 2B4PA 4K0KJ 4B9TA 3BP8A 4DUZJ 4XA5A 2CADA 2WVEA 8ICUA 4C0HA 2J0XA 3ZX3A 7FD1A 3A12A 3ATUA 3KHLA 5CEHA 5CJ7A 5J0OA 9ICVA 3CDWA 3EUNA 1MW7A 3WXMB 3IGVA 1IXRA 3L7UA 4DB3A 3CCVS 3KLFA 4CYUA 4OV6A 3C94A 1IV0A 1HWLA 4LSZB 1CZAN 1GQEA 2EWHA 5HBMA 4F5NA 1MN7A 2XSJB 1SC1B 3BUZB 4L76A 1K0TA 4ECSA 4QZEA 1OH5A 3SZ2A 9ICCA 1PUZA 3C6UB 5HR6A 3KMQA 4UASA 2DR9A 2XS7A 1F5SA 3DAWA 2W03A 2MJNA 2QLFB 4DBQA 5E33A 1ZXOA 2PFUA 1U1OA 4OVLA 3VETA 1Q53A 1VK3A 3DM2B 1VGYA 3T1HJ 1U24A 4F3QA 3H1VX 4CZEA 1VRTA 3EE9A 4DR1J 3M7VA 4PYDA 3LDAA 4M9NA 4J9KA 2VWJA 3ZZYA 4IKFA 2QA4G 2CQ3A 3M8SA 1E6VB 4LRAA 1LW2B 4HTLA 1UWAA 4NLQA 4OYMA 3VZHA 2PFDA 1S9FA 2FB0A 4X4OA 3QMLA 3V81B 2V7YA 2CYYA 2OJ3A 5KRSA 3CCSN 1H2VZ 1UTAA 4C4RA 4UB5A 4CNZA 3R6LB 3VAKA 3I56N 3EE3A 2QA2A 4P4PA 4J37A 3HT0A 4FWRA 3CM5A 2NUUG 2GMLA 4PG6A 1L3TA 3H3NO 3P4IA 4A59A 1RABB 9ICNA 1U4BA 3GDXA 2HBLA 3UIQA 1RISA 4AE5A 4A8QA 2QI2A 3TAQA 4L6V3 4BRFA 1XMQJ 1EHWA 2V68A 4Y2RA 2VQFJ 1ZQMA 2F9JA 2FTRA 4FK0A 5KFVA 4EZ9A 5T7LB 1YTUA 3ISZA 1VDHA 3ZDAA 1N54B 5LM7E 2M9KA 2E2OA 3V6DB 2BJ3A 1KQSR 2Z58B 4IDKA 2MY8A 2Z4PA 3BF4A 1NK4A 1LK7A 4RO0A 1C6VA 2W9CB 3ISND 3N9UC 4C80A 1AUSL 2RKIA 4M3TA 2RSQA 1G3OA 8ICKA 1TFYA 3MR6A 3J7YU 5JUMA 4M3RA 3EW9A 4W90B 3HULA 1YUWA 4GXJA 1S4EA 3NF7A 3GWCA 1BPYA 2MQOA 4BRDA 3TZXA 4XH1A 2Z2LA 3IM9A 1RT4B 5CY4A 4FKYA 2ZDPA 3WU2U 4RG8A 3QNWB 5ETQA 1T95A 4HDHA 1CC7A 8ICZA 2IM1A 1IM4A 3MN5A 2XI2A 4MF2A 3BM7A 4P2FA 4YUDA 1HQUA 4Z4FA 3M2VA 3OYKA 5AK6A 2ZC4A 1U7LA 2D8CA 1MU2A 3MPVA 1OUQA 4DQPA 2CPFA 4GC7A 1TFWA 2GOLA 1AW0A 1RDCA 2OPPB 4IR1A 3IA0A 4G3IA 3PR4A 5HHHA 2YN4A 2XI3A 3SI8A 4CH7A 9ICPA 2VWBA 4PYAA 3GU0A 1J2VA 3ZNJ1 1JJ4A 3SCLE 4K4YA 1K1SA 1FXRA 3AA9A 4LF6J 3VF0B 1Z00A 2VONA 3UDEA 2CQHA 4CIFA 4LZDA 2O8DA 1I51B 2A0FB 2ADCA 4CJ4A 1N32J 4DTUA 3OYHA 1RU1A 4H4OA 1B9DA 3G82B 3SNNA 2PMZD 3UCUP 1KAZA 3NMRA 4IQWA 3IBCB 4LFAJ 1VQ5N 1GOCA 1RBAA 2P1JA 2LQ5A 1ZM4A 5J0WA 3TA2A 3DLKA 4Q43A 2GWKA 2KZMA 3MEDB 3DU5A 3WXKA 4DPUA 5EXWA 3VAJA 4KPCA 3EY1A 1SUQB 3RMAA 1XSNA 4K42A 4F91B 3UI3A 5HP4A 1EETB 3R27A 2N82B 3ZSRA 2ZG6A 3SEIA 4K0KK 2NXCA 3A0BU 3QFWA 4DUZK 4YMMA 2F5GA 3HWTA 4FPRA 3OVSA 5G5HA 1KKHA 3FR0A 1VHIA 4CBUA 3EWAA 1HNVB 3KWIA 5F3TA 3KOOA 1NH7A 1KVAA 1T03A 1DJ0A 3CC7N 3JS9A 1DT9A 5HMXA 4U7UK 4K5RA 4BDYA 2RE2A 1QUVA 3L3CA 2HMPA 4K0KF 3AA5X 4DU8A 3HSZA 3HDSA 4ZH4A 4DUZF 4I6AA 2CWXA 1TK0A 3WEEB 3BR8A 1Z3EB 1YITS 3L3UA 4MK8A 5KFSA 4W4MA 1SKRA 4DR1K 3HM9A 3IG1A 1OWXA 4IOCQ 2VIXA 3NF6A 1K8AO 3DGPB 1JLBB 3SIPB 2B3TB 2VODA 4H4MB 3EDRB 3AOAA 4OJLA 4IG0B 4RQNA 5KFHA 3IP0A 3VENA 5HMZA 4IQUA 3KWGA 5HK4A 5AQFA 4BRKA 3EN9A 3TX8A 3MC1A 1FKAF 5AM0A 3JPTA 5AFUH 4FK2A 3VQQA 9ICMA 1C0TA 3SD7A 5J2QB 4CD1A 2A18A 4FYDA 2E5LJ 1KVJA 4DR1F 4KLDA 1F0MA 1O08A 3LVWA 1JMTA 2O1PA 2OP5A 1AFIA 5HRPA 2QMXA 4I2HA 4NMXA 2GFFA 4FW1A 3HZEA 8ATCB 2R2RA 3VPZA 1S9EA 4EIAA 4DCHA 4B9NA 3FQKA 3KBBA 3ZDBA 2B9XA 2GUIA 2ZGZA 3QEBZ 4RNNA 4OLOA 1C0UB 2VQFK 2O8FA 2OPSA 2WHOA 2R3VA 4CF1A 2ZWPA 4ZOHC 4OJ1A 3PO5A 3SCIE 1DK3A 3M6ZA 5ALQA 3QEVA 3BQ1A 2KEYA 1G1XA 4B3TK 3IRUA 2GEMA 5ADXA 3CJAA 3JAMY 2ZE2A 3HW8A 2VZ9A 2W9AA 8ICXA 1S1TB 1YJ9N 1CG2A 4OQJA 2V4QA 1L3UA 1RM6C 4EWTA 1X3MA 3DWLA 3T41A 1N6QB 2MKKA 3PG9A 3DRRB 5HROA 3Q8LA 3P5TL 2D0CA 4EX7A 1NPKA 2VQFF 4CEFA 3GP9A 3RF9A 3N7RC 2KZ3A 2C2DA 2BE9B 1CQMA 2QRRA 4B3TF 1YBUA 3LOUA 4ILJA 1UW4A 4CNQA 5IIOA 4BG9A 4ZLLA 2IVMA 2ZZMA 1Y00A 4HCBA 3DLGA 3DI6B 4YG2A 3FMBA 4OJHA 3NS5A 1D09B 3MD1A 2C3MA 5AQMA 3NCPA 5F8IA 5J2BA 1X0FA 2B9YA 2IC3A 4F50A 2UUWA 5DDRC 1UZDA 2K4IA 4QZCA 2XNQA 3ZETB 1YJNN 1MWYA 1YLXA 2QB1A 3MCPA 4E7HA 5H1SQ 4GXKA 4P2XA 3M9OB 4USJC 4UB4A 4EELA 2B6GA 4RW9A 3I31A 3BDPA 2JL9A 4NLYA 3SQGB 4HAIA 3AVBA 4BG8A 2PMWA 3VGMA 3KLEA 1N32K 2M8HA 4FJ5A 3OS0A 4ID5A 1UA1A 5FPEA 2ZVSA 5DLGA 1IR2A 2U2FA 2HMIA 2MAXA 4LZGA 1QD1A 5ALZA 4CLUA 3QUQA 3KYLA 4NB4A 3R5AA 1PSDA 1VI7A 2RHFA 2P9UB 3E01A 1UPPA 4KLJA 3GFXA 2NO4A 4JAXA 4A48A 3O9UA 2KZZA 4P9SA 1FKPB 4YFUA 4JV0A 2HVZA 2C2NA 2E4LA 2ODGA 3NOCA 4PHTX 3QBCA 3LW5C 1N32F 4CGJA 4Z7YA 8ICGA 1S1XB 2PAVA 4ANEA 2MLYA 1UZHA 2WBMA 4OI4A 1JJ2R 2QWOA 4JI2J 2ZHBA 4M9LA 4QZVB 2JNJA 4UB2A 2DNGA 1XHXA 4CESA 3RU0A 3RRKA 3IWLA 5E0OA 3AVNA 2I9SA 3N0VA 3BS5B 2G0CA 3FZFA 1D4XA 2IHR1 3SBGA 2W43A 4ITSA 1YTYA 1WNEA 1R8AA 1FVQA 3OS2A 1RYSA 2VPYB 4Y1CA 3CQXA 3QB0A 2IVYA 1VQMS 1QQ7A 1UMJA 3OHRA 1ZYQA 2DO0A 4CZIA 3K89A 4F72A 2GQQA 2KT3A 3UNGC 3I55S 3VGUA 1GOAA 1P7DA 4RW6A 1F9HA 4URQU 4YOWA 4NYOA 4PRFA 3VQ5A 4M04A 3ZSVA 2KT5A 4CVNE 5KGWA 1SUQA 4I69A 2ZKTA 3HSJA 1GXTA 3C6HA 3JPRA 2M5YA 3CUNA 4JI8J 1LXNA 4WIIA 3A4TA 4QIVA 3NRWA 2VBYA 3DDNA 2Z2MA 3MXMA 4EI2A 2BZ2A 2U1AA 1VQNN 1WSJA 3MURP 4I2AA 4P4MA 2QLXA 5D49A 1X4GA 2VICA 3B6BA 4K43A 1UAWA 1L7PA 2HS4A 1RTHA 4USWA 2Q3PA 3NAIA 3FVYA 7ICOA 3O8WA 3I32A 3P3DA 1K9MT 4CQ1A 5AQKA 4ELTA 4DTMA 1Q8IA 3TR5A 3UQ0A 2M4MA 1HNZF 4OYOA 1UA0A 1R43A 3T69A 1T02A 4PG4A 3DOMA 4OPKA 2XMTA 4FYWB 4GW6A 3HKZF 4GVLA 3HI9A 2E5LK 4YFKA 2YX1A 2ZTCA 4KHRA 3UDCA 1SH3A 3VAHA 3WC2A 1WBDA 2XS5A 2G09A 2XMWA 3AQOA 3HHEA 1FEEA 4F0MA 2FGOA 1S7IA 3HFZB 8ICFA 1VFJA 4HACA 5C25A 1GO3F 1JLFB 5KT5A 2ILZA 4ILLA 3MR5A 3FBBA 1FRKA 3LGHA 2OXOA 4O4GB 3TQEA 1AZSA 2IA6A 1TL7A 2NYVA 1ZETA 3ZDCA 3O9RA 2BBEA 5F8JA 2XVTA 2VQEJ 4HLBA 5AXNA 2Z2ZA 1FO1A 2PE8A 2HHXA 3MGJA 1IV8A 3M2UA 1LWFB 2E5LF 4FM1A 4DCPB 3QE9Y 3PSFA 4P2HA 4M63C 3DLJA 1F60B 2KIVA 4O3PA 2ZEJA 4RW7B 2GQCA 4CK1A 2ZIUB 3PXGa 3I0SA 2C22A 5GVQA 3PUFA 5J2QA 2BZFA 2XZTB 2EHGA 4YMNA 2JEGA 3UMGA 2DF4B 5D78A 1VC6A 9ICFA 3M8RA 2E9ZA 2RUGA 3AV9A 1NGIA 3GFKB 1CRXA 2KFZA 5K5MA 5BJRA 4UQTA 5KG6A 2FLOA 2WOMA 3X1LB 4F4XA 3C3LA 5DB8A 3VQAA 4TURA 3FEXB 4CHYA 3TSUA 2OA8A 2MHNA 3BSCA 2ZZNA 1VOMA 4FF3A 4GV6A 3G71S 2Y0SC 4BQZA 3TAGA 2EANA 1S0OA 2AT1B 2H54B 4O9MA 5BRFA 4KH1B 4ERDA 4HI1A 3BV8A 4DEZA 1A5XA 3W65A 3VF2A 3C15A 4GKJJ 3EVOA 2GO7A 2FGCA 4OYIA 1RNHA 4IQTA 4BC4A 5JLHA 4AXJA 3CCLN 3CCMN 3HSCA 3KUGA 1Q95G 1VQPN 2BJ7A 2I2YA 1NDLA 1U49A 2YQ1A 1Y64A 1J2NA 4MIWA 3IR5B 1M5OC 3OS1A 5M1NA 3SUPA 2NZCA 3BN4A 4M5DA 3AB4B 4JV5J 1NHKL 3BH7B 4FZNA 1C4AA 2ZTEA 3OR1B 4HDGA 5C0YA 3K1RB 3FCHA 4DDFA 5CD4A 4RUCA 4M7YA 1X4FA 3MCMA 2ZITA 4MT1A 4ZS6A 1WKLA 3QSIA 2DRBA 3L4PA 2BJDA 3TWZA 4BROA 4IOAL 3FDSA 1TV9A 4N8OA 2KG1A 4LY7A 2LKYA 3SENA 4WXWA 4OGCA 3M1VB 2GO9A 4YDUA 2G0AA 2RQCA 2E1AA 2KV2A 5IWAJ 2WF5A 3OBIA 1QUPA 1HI0P 1LAWA 4KLMA 2AEJA 3LANA 2KW4A 4C4TA 1WUAA 4ECQA 1EXQA 4J9QA 1RBLA 2PI5A 3UQSA 3NAHA 4CZCA 3DXKB 3FCWA 4L72B 2KFNA 2W2PP 1KTVA 2OTJN 3KFWX 5ETKA 1WACA 3BSNA 1QTMA 2ZM6J 4FZYA 3HKZC 2AV5A 2L9NA 1OW5A 4JI2K 4HHHA 1AT1B 5K14B 5GMKa 4PHDA 1SH0A 1YI2N 3IS9B 3T1AA 4Y2CA 5GAHP 3G87A 2MA1A 1CEZA 4EFHA 4DL4A 3O3FA 3EVMA 4TXSA 4TY8A 1QHTA 2GCFA 3GSIA 3N7SC 4BRGA 3E8OA 2BH1A 3UKRB 2YNIB 4YQWA 3V9ZA 2XYGB 5EE9A 4HH1A 3RJIA 5IV4A 2BRKA 1BQMA 4FWNA 2AEMA 3EO3A 4FNIA 4EP4A 3K5OA 2IAJB 3J81Y 3MXHP 2BTFA 4DKWA 4JI2F 4K2JA 3GG4A 3LDPA 2P9SB 5JTIA 4FFDA 3JPSA 4DU4A 4ZLNA 4O3SA 3D2NA 4OJ6A 1UPHA 2X3GA 2VU5A 2NRRA 2OD6A 3SQ4A 2QIFA 1B7FA 4DX5A 5K9FA 1RBRA 5GTHU 1S1UA 3J7AN 2QA4N 3CT9A 4M6WB 4LSNB 2UUBK 4CJTA 3H40A 2OYQA 4YD1A 3GE1A 2FMPA 2KOBA 5ETLA 3HX0A 3D0HE 2A3ZA 4M9JA 1RI7A 5J1EB 2JH1A 4E7JA 9ICSA 2KE7A 1JJCB 2AJ0A 1RBTA 3KNGA 4FN5A 2CDRB 4RNMA 3WK8A 4CZJA 5ETPA 4J9PA 3HP9A 1HBMB 2HK3A 3LALA 3QIPB 1DRGA 1RLDA 2UUTA 2UUBF 4ISGA 3CQ8A 2QC3A 4Y2QA 5AKYA 2XCAA 4CNYA 1C0GA 2P9PA 2KRBA 3LL3A 1PYOB 2A3JA 3CCUS 3G6ES 4H5RA 2QYCA 4NYNA 1QQ6A 2RS8A 4O44B 5KG1A 4KGZB 3I0RA 1VQ7N 1WJ9A 2XY6A 2PO4A 3O9SA 1A7GE 3HZ6A 4DOCA 3HVWA 3JB9k 4GMJB 4AFFA 1E6YA 4YS2A 1ATNA 2ZUAA 4A8WA 2HF4A 2KTQA 2JLGA 4QU6A 2QZ8A 4LIRA 1HJPA 1T9XA 1IQZA 3IRWP 1NOMA 1S6OA 3M9MB 2APOA 2XCPA 4ZVPB 3ONNA 3GPAA 2BM0A 2DKZA 5J2NA 1EX4A 4DR2J 1TKTB 4Y2TA 2KJVA 2D3O1 1QSSA 4O8KA 1EWRA 2PFOA 2CUYA 4LQ3A 5GIPA 2Q3SA 1HMVB 3JXOA 3ZDDA 1HRHA 2IOFK 4PL8A 2G13A 3QUCA 3HZGA 3VVTA 1RBUA 3OL9A 2HHPA 4RL1A 4BCAA 1JLAA 4CD3A 4B9UA 4ED0A 2ADBA 4CZGA 2YWEA 2OIHA 1S1WA 2I6WA 1VCTA 1ILYA 5ALUA 1NBEB 3BGRA 4MIBA 1NLKL 4GKJK 5J2EA 3QO9A 3MN7A 5HRSA 4ECXA 2OSRA 2F9TA 4MAKA 4WZMA 4DSLA 3NGIA 1LKYB 2XWXA 2ZIUA 5K4LA 3M8QA 3PEJA 2ZFHA 1P9YA 4C7YA 2MUTA 3L4QA 4C6AA 1JLQA 4JV5K 1V3SA 2F44A 3D68A 3PIPQ 1VQ4N 3JQMA 4WPAA 4JI4J 1QQ5A 3QU5A 4Q2MA 2D3ZA 2NYIA 5DDMA 1TK8A 2Z7JA 2I9GA 2Z57B 1TK5A 3ITHB 4GKJF 4O4RA 5D3GB 2W40A 5T14A 1LFPA 4QYZJ 3VN5A 2KKZA 1IBMJ 2OFHX 4OYZA 4OKEA 3H90A 3ID8A 1CSJA 1F6TA 2FE9A 1U0SA 3H98A 3CCRS 1VQ6S 3NE6A 3EJMA 4CEOA 3P8BB 9ICLA 3IAYA 2LDIA 1WLJA 5CQGA 5F2RA 5IWAK 4E1MA 3B8HA 4CLKA 2R8GA 1YBAA 1VLOA 4LREA 2AD9A 4LVSA 4IEIA 2F4VJ 3FZMA 5C24B 4RUHA 5BRHA 2GVZA 3LDNA 1GMWD 3GZ7A 3J7YP 2CQ0A 1LNQA 1SXLA 2ZM6K 3CXCR 1NJZA 3R5JB 1N0UA 1Q5VA 2MZRA 3ZX2A 5D15A 5FLXU 3GG0A 5GIOA 2QKQA 1S0VA 4JOUA 4YR3A 4NA2A 3GJRB 2GV1A 1RAIB 5IINA 1TYQB 4PG7A 2W2QP 1B0TA 5GAGI 5IWAF 4JI6K 1UVJA 3SR6A 2NRZA 1YWXA 1LW0A 3EM1A 3MEEA 4IBNA 5H2FU 3UD5A 3LZJA 4JD2B 3I82A 1VRUA 2KXNB 2MY7A 5DM6Q 1S12A 2KQ2A 2FMQA 2FYXA 2R42A 3SPYA 1VYAA 2AH5A 3SQ1A 2EFGA 2ZM6F 2RS2A 2YQ3A 2Y8WA 3FGUA 4QYRA 3O6QA 4ATNA 3NTUA 1IJEB 5EWEA 1HBOB 3D66A 4YCXA 1BI4A 3GCWP 4LF2A 3CCWA 5BYRA 1TVRB 3ET6A 3RH5A 3W2WA 2ITMA 3BREA 2XHCA 4CM2A 2DHGA 5LSOA 4JI6F 3GR0A 4FJIA 2MGZA 4IFEA 4QZGA 7ICHA 5LL6d 3D2SA 1DY3A 2OI2A 4UATA 2CWKA 3HF5A 4I2PB 4GVEA 1X66A 3QEWA 2ALYB 4CDGA 3FJ2A 3M32B 3VAMA 1VBZA 4IQXA 4I2QB 2HBKA 4B1ZA 1ZS6A 3UFCX 4NLTA 3FZHA 4BE2A 1VC5A 2DNQA 4NPOA 1M5VC 2GLEA 3LP3A 2G8FA 4PXDA 4B6JA 1B4FA 4PHPA 2Z1GA 2ZH1A 4YN3B 1WUDA 3GIMA 2R2UA 4WQ4C 4I2IA 4C7ZA 1YHQS 3NGTA 1S5LU 2V94A 2W8LA 3MD3A 2D0BA 4ZVQB 3AOBA 3U7JA 1IKYB 3TW0A 3W61A 1H38A 3LP1B 1OH8A 2D9PA 1Y4ZB 4FZVA 3CM6A 2HW3A 2IRXA 3MDAA 4YD2A 2LM1A 4HI2A 5D4NA 3A2FA 3CNQP 4WF9Q 1K6YA 2B6AB 4KITB 1ZRMA 1FD2A 3AD8C 4LFBK 3EGNA 5HLFA 4BRAA 2F7VA 2E1FA 1QSYA 4Y2XA 3H4DA 4JHDB 2YQEA 3I9ZA 1MROA 5CP2A 4DR2K 4UBCA 1YVNA 3AVCA 5KNIA 1H2TZ 5CHCB 3G9CA 3OXFA 1T9YA 3GCXP 1X5SA 3AY0A 2K7KA 1UPMB 1B92A 3MCSA 3CFRA 4C8NA 3C0BA 5FD1A 1DKGD 1REVB 3SV4A 3ISBA 1O5JA 5G4DA 4LFBF 5M2UA 4RX6A 1F2HA 1Z2LA 4J9OA 1BUPA 3VERA 1K0VA 3WQTA 1NMEB 2FSKA 1O1WA 1V4TA 1SZ2A 3DMJB 1NWKA 2ASYA 4FPIA 4DR7J 1B0PA 4HWIA 2O8CB 5T41A 4PQUA 1RZMA 4K50A 2UVVA 3O08A 4YR0A 3MWTA 2HKEA 5J2MB 3ADAC 3RH6A 2QA1A 3U8XA 4PJ0U 4NLNA 1HW9A 3ZTOA 2KJ9A 2K7JA 5ALYA 2WVDA 2NLWA 2V51B 1RWPB 3L2QA 2QTDA 1X60A 4PH5A 3OL7A 4CEDA 1SB6A 4LJXA 1GXLA 4JI4K 3CDAA 4QIWC 1JX4A 5EVZA 1NPPA 3B78A 1I94J 5C2FA 3EEQA 1S6UA 3PMNA 1IXKA 4AL7A 4QYZK 1BA1A 2YB4A 5J29A 4KHWA 4O55A 2DY4A 1IBMK 1PK1A 3TVKA 3SFUA 4ZP6A 1HBUA 1AA1B 4USVA 2HBYB 2IVFB 3HOSA 4GVBA 3J7A1 5MLCQ 1XS9D 3EWGA 3F0NA 4JI4F 1XR6A 3HILA 1K44A 4PAAA 1QM9A 2DEJA 5KFGA 2PYLA 4YOVA 1M5PC 4U7BA 3ILIA 5J8YC 2Q79A 1WUUA 2OTLS 1T6CA 3QINA 3DHXA 4B9SA 4DSIA 4U7UD 3KNAA 2PT0A 2HBQB 3W0LA 1QSLA 1M90O 2AYBA 1FWPA 4PG5A 1W0HA 4AT1B 4KN7A 3KWMA 4KV8B 1SV5A 1MQ2A 5KFIA 2QL5B 1R0CB 1KW4A 1DBDA 3DC2A 1GMUA 4J2EA 2NLXA 5C2GA 2I5JA 1RHKB 2LYAA 3Q8QB 4JKFA 1VDVA 5A6WA 3H2LA 2E7WA 2XLKA 1Z1VA 4K4XA 1XSLA 2CG8A 2H4WB 2XGQA 5J2FA 1RADB 5A8KB 3WKAA 2IM0A 3VQ9A 4TQSA 1WEZA 2QE5A 4ID1A 2E6MA 4OX9J 7ICQA 2GAHC 3R6GB 3P4UB 3WXJA 3WX4A 1W2BR 4FS1A 3R2DJ 1S4FA 2BX6A 5AI9A 1X0PA 4FK4A 5J1NA 2E1YA 5IILA 5T7BA 3OSPA 4X4RA 2ZJAA 4P74A 4CO5A 4IRKA 5DDOC 1TTHB 3CJSA 4M5HA 2WMMA 2YXLA 4NRTA 3LPTA 5DLFA 1SL0A 1RWXB 2OPQB 2UXDJ 1ZJNA 1UVIA 3PLAA 2QTWA 3TOQA 2C2RA 2BUPA 1H1VA 2H5EA 1H98A 2RH3A 4AXIA 2G8UA 3AGKA 3OVBA 3VVUA 3THYA 2K4PA 2V67A 5ALMA 1N8RT 2HVIA 5JVHQ 4DOAA 3CCES 4CLPA 4Z6FA 3BB5A 1V5VA 4F67A 3CPEA 4CK2A 1FNOA 1RT3B 1N34J 4LF5K 4E7LA 2JHDA 2JRSA 3UXNA 3G2XA 1XWLA 4ECUA 4Z6DA 3BF1A 5IT9O 1RBOB 3AA4A 2DBBA 2FHMA 4YMEA 3K0SA 3IXQA 2B7CB 3NWRA 2LMRA 2Y8YA 3CJQA 3IRXA 1V3RA 4V1Ak 2IJFA 4PG8A 3CMAS 1X5PA 2HZVA 1X9WA 4DUTA 4ZIWA 2CJAA 3DLEA 4BRNA 5FRNA 4O3MA 4LF5F 4WFBL 3KLIA 3Q2TC 4QZFA 4DR4F 4YB5A 1S76D 2BKPA 4IFVB 3GJTB 2YKMB 3T5HA 1ZQRA 5E7OB 1O0PA 4UBBA 2JVRA 1ZQQA 3JQJA 4DTJA 1HIYA 2LXIA 2YJFA 3RMBA 2DXFA 2XY7A 4Y6IA 1VSEA 3HHLA 2GX8A 4IQVA 5IT4A 4Y2MA 4DR7K 1FJEB 3QZ7A 2FZCB 3QIOA 4FOIA 4B3MJ 3W5YA 3IN5A 4BR5A 5J0TA 4MH8A 1A6LA 3QGHA 4JKGB 4DSFA 5GAGU 2K8AA 1JL1A 4JHDA 1AROP 3AVKA 7ICIA 1HBNA 2FZGB 2IFXA 2V9KA 3IAS9 2E3TA 2IIHA 2RN2A 4A8YA 4TY9A 3AVMA 3QUTA 1TL3A 1RDAA 4ZJLA 4C8YA 4ELVA 1I94K 3FNNA 1MNEA 3B82A 2HSTA 4CGGA 3H8JA 4FWLA 4DR7F 1RXWA 1BNPA 4RWWA 2D3UA 4HL9A 1GEHA 2F9DA 1RSCA 5AQIA 3CCQN 4DL6A 3D2EB 4OMFG 1FW6A 2BVZA 4GV9A 1T7PA 4I9QA 3CMEN 2IBKA 3ZSZA 4YEAA 2OAUA 3HPHA 1ZQBA 2O8CA 1CJUB 4CJ3A 1PJ5A 2R7VA 4M95A 4WCEQ 1RTDB 4FJMA 1TKXA 3THPA 5KI6A 2BCVA 1EQYA 1I94F 4JWMA 5AE3A 1OJ4A 3KKAC 1PAEX 3QT5A 4BR4A 4FJNA 1JLGB 3MMCB 1ULRA 1DURA 5HVGA 1CPZA 3PVXA 1R3NA 1XBWA 1T9WA 4C3LA 1CVJA 4BC9A 2COLA 1NOYA 3CC2N 5H9EK 3KLHA 1WAJA 3R5DA 5ADZA 4NLCA 2RPIA 1U0HB 4KSEB 1D8ZA 4DSEA 3IBWA 2EW9A 3K59A 1BWVA 4C1NI 3C7NB 1OMSA 1FTCA 3CJTA 2W3RA 3HKZD 2EXUA 3WQUA 5HQLA 2BPGA 1W2BM 3R5GA 4I2CA 1CLFA 4GV3A 2ZQBA 4JUZA 2KN7A 3JSMB 4ZVOB 4USIA 3BSAA 2PA8D 3BKUA 4Y2KA 1UWBA 5CA5A 1VQ9S 1JROA 8ICNA 5ETMA 5AR0A 4QOZB 4OX9K 2WZ1A 4R25A 2HSZA 4ZVRB 4NLZA 2ZJQQ 2EH9A 5ALJA 2HHTA 4F71A 1LOTB 2RHSB 2KNJA 4ES2A 4CCHA 4DX6A 4PABA 5D6GA 4OLAA 3SPZA 3V5RA 3I4HX 1OYEA 1M6YA 3CCVN 2YTUA 4LSLA 4PUOB 2LU1A 1NSAA 4ES3A 1ZTTA 2RRDA 4FXDA 3A8KA 3NGKA 3L6QA 2UXDK 1DRZA 2EVZA 2RQ4A 3SMVA 2KXFA 3GIJA 1B9FA 2OM6A 4TU9A 4OX9F 1SJ4P 1YZ6A 4PXCA 1EIYB 2ZUDA 2LCWA 2UXBJ 4K41A 4Y2YA 3CDUA 4KLLA 4MYTA 5A8KA 3WK7A 3ISCA 3TAPA 3MDFA 3NOGA 1O51A 2XLJA 4Y2VA 1NNEA 2F1JA 3NMUA 3NS1A 2E5SA 4O3NA 1UETA 1L3SA 3LM9A 1N34K 1Z4NA 5DDPC 4ZN1A 5AQNA 2MDAA 4QIFA 2M9NA 4BC2A 2UXDF 4YP3A 4Y2UA 3Q22A 1XUPO 4DCJB 1YJTA 5D4OA 2NSBA 2BCQA 1P8GA 4EYHB 2MHEA 1RWKB 1UVMA 3HVRA 5EE0A 3LUYA 1YSJA 2NUHA 4WBFA 3QWUA 4LF4J 1UVLA 2MTLA 2J8SA 4NCAA 2MRLA 2CGJA 4DFKA 2BDPA 1J6ZA 3RBZA 1N34F 2IDOA 4HR2A 4Q8FA 1ZQOA 4OIXA 2DY1A 2XWYA 4IFYA 2ILYA 1B7YB 2EC2A 3O3GA 3MWBA 1LWEB 4QW9A 3AO2A 2DHXA 2MEWA 3G0ZA 3FAHA 1Y10A 4U9RA 5IT9U 3M6WA 4P7VA 3KUHA 5F0UA 4IOBA 1MN8A 1TFRA 1QVFR 3ILLA 2OLWA 4B3MK 4KHPJ 4DTSA 5A8RB 2E1PA 1NOZA 5M1QA 2BJ1A 4NL5A 1VSLA 1ZQSA 2JLEA 4ILHA 3W7BA 2UU9J 3SQ0A 4DPXA 1Q16B 1TAUA 4X4TA 2HQDA 4JK9A 2O8EA 2A6AA 4YOXA 5AQTA 4A8FA 4CGFA 3F5EA 3CQYA 1KNZA 1RHMB 2RAQA 3BPDA 5CYQB 4DS4A 4DS5A 2CPZA 1SPBP 2P9KB 4CEAA 1VS3A 3TX0A 2V0NA 2EAMA 1HPMA 4B3MF 4TUSA 3RBEA 4ED6A 2YTCA 5HJYA 1SKSA 5JVGQ 1FHTA 2CPYA 4QIEA 1EKRA 3D9BA 4TYAA 4PXEA 3B6PA 3F2KA 3CG7A 1QJHA 2F1HA 3WKBA 1KLNA 5M1KA 4OPJA 4EBDA 2MQ8A 8ICOA 1L5UA 4ED5A 2RU3A 4OZ3A 1HJOA 3MM5A 3J7AP 3PRVA 3CCMS 1VQPS 4JKGA 2KIWA 1WG8A 4I6MA 4MDBA 2AZ1A 4NLXA 2MKCA 3C95A 2GQ2A 1W26A 4WFNL 5IQ6A 2K89A 3Q7BA 4Z4CA 2L5YA 4UUXA 2MZJA 4UZCA 3N5BA 2E1EA 3PACA 5CB1A 4P52A 2AHOB 2AEFA 3CJ2A 4RW8B 5JICA 3K7RA 2NXNA 5DDYA 1KQQA 1JCFA 2DR8A 1JLCA 4R63A 1OIAA 5FPDA 1NGJA 4P0QB 1XNQJ 4C11A 1TL1A 2QSFA 1A0PA 3R7BB 4PGQA 5KG2A 1CJUA 5EUHA 3ZYYX 3OR2B 2QWPA 5AM2A 8ICPA 1ZAXA 2WTFA 2E8PA 4UB8U 4IC9A 3ZXWA 2NPIA 2CQGA 5CH7B 2R7UA 3AO4A 3D67A 3C5FA 3WKDA 3OYBA 2OTJS 3GIKA 3SK3A 3LP0A 2G8WA 2BANB 4IG3B 1OXJA 3O4WA 4I2GA 1TUVA 1Z1BA 2C3UA 2LQ8A 5F9LA 1WSFA 2B4VA 4FF1A 4Y34A 3DRSB 5C42A 1W9HA 2I1RA 1KAYA 3NRBA 1ZZFA 3N6MA 4DV0K 1U0HA 1YIJS 2KSOA 3HJFA 3IHQB 2X3DA 2HSEB 3W8PA 1NJWA 3R7NB 5I42A 3HX9A 1RT2A 1WI8A 4CGDA 3SUNA 1PYSB 4NZ0A 3C14B 2EKNA 2IMOA 4MFAA 3QPIA 2UXBK 3O44A 5GAEU 2BCUA 3JSMA 5BPLA 2FVPA 3H6EA 4N47A 1CULB 1DHMA 3TYTA 3R3LA 4JS4A 3ENWA 4P2MA 3OFFA 3OUYB 4USUA 1YITN 4MLHA 3HP6A 1WWHA 2J7WA 3RMDA 1N52B 4DV0F 4RT2A 2UUAJ 4CF3A 1WKJA 2OWOA 5FROA 3QU2A 5EOZA 3PSTA 2ZD1A 1IR0A 3VF6A 4RBTA 5AZJB 2RQ5A 3KKSA 5AK5A 2FJAB 5EOYA 2J4RA 2UXBF 4YXMA 1N61A 1D9FA 3RYLA 1FKOB 2KJ5A 2YPYA 1S59A 2AP6A 3W60A 3QESA 4RQ6A 3MMBB 4OI2A 1IM6A 2GNKA 1A5VA 3MM9B 3MAAB 1GFWB 3MDQA 1PBAA 4DSJA 4FLVA 3O9QA 1Q3UA 1TUYA 4K4HA 2VFTA 3T5KA 2CJKA 3AL0B 1NU4A 4RLEA 3ETLA 3QLHA 3UKUB 2P9LB 8ICBA 2R7RA 2HWHA 1QVFM 2LU2A 5J2GA 4F5QA 4UW9A 4FJ7A 1R6VA 1HYVA 2WHEA 1A9NB 1VBXA 2XHWA 2ZDOA 2IM2A 2H51B 5ETNA 1WDTA 1RWMB 2OMOA 1N4LA 1SWVA 4R0EA 1S9GB 2FVSA 3GZFA 3CCJS 2Q4TA 2R2TA 1XNRK 5DRKA 4KHPK 4CZKA 2LEBA 5FP0A 4M47A 4ZVSB 2KK0A 3UXOA 3U3YA 2G5IB 1BMQB 2K1RB 1S7HA 2UU9K 3R3TA 9ICUA 2DNRA 1RGVA 3N4QA 4ZCMA 5KAIU 4LBIA 2CNNB 4I7FB 2QKBA 4YOUA 5DK5A 4OJOA 1RAAB 3BBCA 2HYIB 1NDCA 3VQTA 2JZBA 3OYJA 2XMVA 2E7VA 2KRRA 1RBSA 4CHZA 2ROGA 1XNRF 3LA0A 4KHPF 3U9DA 4AHTA 4UAWA 5KT6A 2IYGA 1DLOA 1RU2A 3BZCA 3AMZA 3CIZA 4KGKA 2KI2A 2G06A 4X84A 2MQMA 4CJEA 2UU9F 2WAQF 2ASJA 3VWSA 3NGYA 3CI5A 2QWQA 4CO1A 1DTQA 2GC8A 3PFEA 2NQPA 3MPUB 2R7XA 2JFKA 5J0QA 5I4MA 2O3DA 5A8RA 1QLNA 1ZC6A 2M3DA 3KLGB 3C8YA 1V9PA 5B0EA 5C12A 2P5VA 2WFBA 2MKHA 5AJ3J 2ZJPL 1SJQA 2L3MA 4G65A 4Y2PA 3H45C 2D41A 3T9NA 3K0JA 1FRLA 3OXLA 4C0OC 2HVHA 4OX7A 2XGPA 1UCVA 1X9MA 1RXVA 4KHSA 4PKIA 3V6JA 4QS8A 2L41A 3A5OC 3ZI4A 3O3HA 2E6LA 4BDPA 4KHYA 1XNQK 2QL9B 4PZNA 3IV6A 1LWCB 2HQGA 2AJFE 2OHFA 1IQTA 2JGUA 2KLAA 2ZBIA 3DRPB 1V38A 2O5DA 2KP7A 2W4DA 3THTA 5EX5A 4TYBA 5IC6B 1NSQA 1GLJO 3VTHA 2FJEB 3FC4A 2V4JA 2BE2B 5K20B 1UFKA 4LFCK 4MIAA 5AM4A 2VIHA 1SS6A 2SXLA 4DR3K 2D3DA 8ICWA 2CQBA 2FVRA 1IKVB 3CJ5A 4UB6U 3J7ZT 1XNQF 4CHNA 2F8LA 4DV2J 1MDUB 4FLTA 5F8NA 2QXLA 4J2AA 3JTOA 4O0NA 5C2CA 5AZIB 1BQNB 2AZ3A 1H7XA 3BDEA 5L8RC 2HI0A 2ZJRQ 2ZOMA 4YDUC 3AXMA 4ZDNA 3OTOJ 4QZHA 3GJQB 2BW7A 3VHQA 4R5PA 2CPJA 2D1KA 4F4AA 1VQMN 4LFCF 1MA7A 1YJ7A 4H0VB 2K4HA 2F76X 5IM0B 1JLEA 2QB0B 2ZIVB 4DR3F 4L75A 3I55N 3MEGB 3TJ9A 4U67L 2KVQE 4QR0A 4AQYK 1Q82T 3GOIA 5GAHI 3SBTA 1KC8O 5CR4A 3U4LA 2P6TA 3MM7B 2VG7B 1PK3A 5DQGA 2ZH5A 2UUCJ 2BGGA 3HKWA 1KXPA 3AUOA 2FDRA 2H3EB 1G4CA 1JKHA 2UUAK 2Y1RI 2UV8G 3TRGA 4QZIA 5JU5A 4JYAJ 3C29A 4RKUC 3K8WA 3NGZA 2HLUA 2CPRA 4CIEA 3AODA 2CAJA 1PG5B 2OUGA 2F8MA 5BXIA 3MMAA 4AQYF 3D2FB 1N56A 3MMJA 5J1PA 4DCOB 4BRIA 1HLUA 4PQAA 2F7TA 2Y1JA 5FRMA 4J9RA 3T1YJ 1U1PA 2WAQC 2YMLA 2XZWA 2J7KA 3SCJE 1P1LA 4YMOA 2ZXIA 1SI9A 4C0BA 2UUAF 1AQ6A 5AQPA 3CJ8A 4LF8K 3MPDA 2VJ4A 5C5JA 3PX6A 2JEIA 1TUWA 5JMNA 1RK8A 2GV9A 5MAOA 4PPXA 2H5XA 2QX0A 2Z56B 1WC0A 3UMCA 1WHVA 4NEYA 3T6JA 4MN4C 3TUJC 2KVCA 5AQUA 2E5IA 4KN4A 7ICKA 3OLBA 2F1IA 5DB6A 2MXYA 3QEAZ 1X5OA 4YR2A 5HI7A 1FFWB 4ZPDA 1IUJA 2ALZA 5HVHA 1ZQ1C 4LVNP 3IAM9 3MFIA 5E26A 4LF8F 3MTJA 3LGNA 4Y3CA 4AHVA 9ICXA 1K73T 1RAHB 3ZC4A 4FYVB 3VGKA 1RQ0A 1S10A 3CSKA 1BE4A 1RT1B 4FJJA 2A1AA 1GX6A 1CXUA 4DCCA 3RJGA 4FWSA 4Y2IA 1R8CA 3DOLB 3MXIA 3RBDA 2BMBA 3AVFA 3EDQB 2QWLA 1BHNA 2H5JB 2OMLA 1RHJB 5GINA 4LRFA 3TAMB 2P9IA 4OJPA 2ES6A 4WFAL 3NBPB 1BUXA 5J2PB 3H42A 4KQZA 1ZA2B 3KK2B 4ZVHA 2YVSA 2LECA 3OPXA 8ICVA 4RQ5A 3G71N 1DTTB 3I8DA 4BS2A 4H0YB 4X66K 1SBRA 4WFZA 4M5KA 1VLBA 5HQ8A 1LQ9A 3HTVA 2W7PA 3WK9A 2D1CA 1DOQA 5KFQA 3QNOA 1XK8A 2L9WA 4DR6J 4NL9A 1FK9A 2XG8A 5E84A 1N60A 1IJJA 3AEVA 3MM6A 3VCBA 2YX6A 2F8SA 4ZCKA 4M94A 3IMXA 4Y2SA 1LKZA 1E4FT 2HPUA 4YDXA 3T3FA 2JR5A 1WELA 2VPZB 4ES1A 3V9XA 4AHCA 3GU3A 3K2YA 5IIKA 5ETVA 3MPYA 3IDWA 3E1YA 4UARA 3FFIB 2PFPA 4X66F 2ASMA 4N5SA 4QQBA 3OPKA 3C6AA 3R1LA 4F3OA 2YHBA 4FZLA 4YDDB 2ZUBA 3A8EA 3ONQA 5M1PA 1RT6A 3MXJA 4WU2A 3B0YA 1U1KA 1F5CA 1KOHA 2KM8B 8ICAA 2BQ3A 1BHLA 1WOOA 3AJ1A 3BY5A 3A1YG 2GIQA 4R0JA 1X9JA 4X4PA 5LL6Z 4NV0A 4OL8A 3TTFA 3ENQA 4JKCA 5GAGP 4B9LA 3SSSA 3FEZA 2RMLA 3Q86A 2FHJA 1AXQA 5B09A 3A5NC 3W2VB 1F3FA 3RJMB 5AKHA 4MHVA 1VLYA 2WSEC 5KFCA 1F0XA 1XMOK 3OTQA 2LYHA 4KX3A 2EBGA 1YVFA 4ZITA 3LDOA 4DV2K 3O4NA 4QWBA 1RWWB 2G5HB 2E5GA 1R31A 2OEHA 1B0VA 9ICBA 4J9LA 2P6SA 3KUEA 3TAFA 3M8ZA 3UWTA 3KLFB 4CYUB 4CRJA 2KYXA 3OTOK 5D4PA 2A1RA 1JN3A 1N5XA 4BR0A 1Q79A 5HBMB 2R7SA 2KU7A 1LWCA 1BO5O 5DQHA 5KFUA 1LXJA 3N6NA 3J7YI 4X2BA 1Q86O 3H8YA 1NGBA 3MGVA 4KC5A 5CZ2A 3H4BA 1XMOF 4W5QA 2HURA 3KMSA 1OH7A 2EZXA 3ZT0A 4KT0C 3W1YC 4O5KA 3S6EA 1Y5LB 3DEEA 3JPQA 2UUCK 3C2MA 3Q2SC 3DRXA 4NLVA 4RNFA 2ACMA 2BUNA 3M4XA 4C8ZA