2HHTA

C:o6-methyl-guanine pair in the polymerase-2 basepair position
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
580
structure length
580
Chain Sequence
KKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*CP*GP*AP*TP*CP*AP*GP*CP*TP*CP*G)-3'
publication title The structural basis for the mutagenicity of O6-methyl-guanine lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 209
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2hhtA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 2hhtA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2hhtA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2hhtA01
1BVSA 3RMCA 2WOMA 3C21A 8ICCA 3Q8RB 4AHVA 3MXJA 4X5VA 4QZIA 2M9NA 1UT5A 3UQ2A 2BQUA 3D0PA 3HXMA 3TARA 4M04A 5SWMA 5KG0A 3UQ0A 1XSNA 4I2CA 3PX4A 4FJ9A 1Q8IA 3VN5A 4R8UB 2W9BB 3WNGA 3JYTA 1U04A 1NJZA 4L8RB 4DL2A 1TKXA 4RW7A 5EWEA 4FM1A 3QEWA 2J6UA 2OPSA 4DQQA 4K4HA 4CF2A 1X2IA 4ECUA 5CY4A 3GIIA 4E7HA 4XRHA 4JS4A 4IRCA 1BCOA 2V4QA 1HJRA 3Q8LA 3V6JA 8ICBA 1YTAA 1WAJA 4PWDA 1JIHA 1V9PA 4NYNA 4RQ8A 4RQ2A 3BQ0A 4J9NA 3K5OA 3T5LA 4M41A 1SKSA 3EW9A 4PPXA 2ALZA 3S3NA 5KFSA 4KPYA 4ECTA 4XUSA 5J2EA 1S0OA 3T5HA 4Z6DA 9ICLA 4J2DA 4NCBA 1TKTA 1ZQVA 1GOCA 4DTJA 2X6SA 3QEVA 3OS2A 8ICUA 3HVTA 4AHCA 4CFCA 4I2EA 3ISNC 2W8LA 2ZE2A 3N97B 2P51A 4KHUA 4F4XA 4ECYA 1VRUA 3CQ8A 3MABA 4IRDA 3QEIA 3LP0A 2BPGA 3SPZA 5D4BA 1HRHA 2G8UA 3PW7A 3L8BA 1K1QA 4M6WB 3OJSA 2XGPA 4XA5A 3QLHA 2MUTB 3LP2A 4KKOA 4CGIA 1VRTA 4ED3A 3SV3A 4RQ1A 4LVSA 1NK0A 1S1VA 5KG5A 4YVZA 4CEZA 4LSLA 3P1GA 5EWFA 2ETJA 1XHXA 5EOZA 1X9WA 5IIOA 2HHXA 4CJ3A 4J9SA 1RYRA 4AHSA 3NGIA 2BCSA 3K5NA 3ZT1A 3GV5B 5DBCA 5KFEA 1JXLA 4RQ6A 4KI4A 2PI5A 1CXUA 2XHBA 2C2EA 1VSFA 4AILC 9ICFA 4FJLA 4KLDA 4F5PA 5KG3A 3RB4A 3AVJA 4PQUA 4ECQA 1S77D 2D0BA 4BE2A 4FJ7A 2G8KA 4DSLA 1ASWA 4AHRA 1BPXA 2B21A 4YNQA 1L3VA 9ICXA 1BGXT 2I1QA 4AHUA 2KZMA 4UBBA 2I5JA 1D8LA 3D45A 1S0VA 1HPZA 4CJQA 3KHRA 3CM5A 4UB5A 3VQQA 1XHZA 4ELUA 4FJNA 3PR4A 3GV7B 4P4OA 5DDMA 2VWKA 1I39A 1C7YA 4ECRA 1QE1A 4KTQA 1D9DA 4CFBA 4RQ0A 3CFPA 2AJQA 3V72A 2XO7A 3DLBA 1BHLA 2IAJA 4K8ZA 4IBNA 1L5UA 3DLHA 5KFLA 1X9MA 3VQDA 2IA6A 1YT3A 2ASDA 2F96A 4YR3A 5EU7A 2PFNA 2PYLA 2O4IA 1S1XA 4ICLA 8ICKA 5J2BA 4ED6A 3OYCA 1NKEA 4FO6A 2PFPA 4ZH4A 3RJHA 1JLAA 3HT3A 1T05A 2BANA 1C1AA 4MF2A 3NDKA 1XO1A 3KK1A 5KT6A 3AA3A 1ZQWA 1DTQA 2BR0A 3LPTA 3O3GA 1BQMA 1ZBUA 2YNIA 2VA8A 2QKBA 8ICWA 5J0PA 1BCMA 5DB7A 4P4MA 1MQ3A 4HTUA 1TKZA 3KIOA 4I2PA 2PI4A 4IR9A 3ISDA 3LP1A 1H38A 5DG7A 1NOYA 4OKJA 4PGYA 4O55A 2G8HA 3OYHA 1ITGA 1NJXA 8ICLA 3HPHA 3V9SA 3BDPA 3K57A 2LYHA 3PW5A 1IKYA 4OKEA 2W9CA 4BGDA 1RDDA 5KFPA 4J2BA 3DLGA 4KHYA 4OKKA 2E6MA 4J9MA 4KHNA 5IINA 1B43A 1XWLA 1NK5A 1FK9A 3VQBA 4YD2A 1BIUA 5IILA 4CECA 7ICEA 4NCAA 2BCQA 3C95A 7ICMA 8ICJA 1TK0A 3LWMA 4CK1A 3N4MB 2QXFA 1JKHA 3AVNA 1ZBHA 4DL6A 3MXMA 3MR5A 4DQPA 4MFBA 3Q8PB 1TVRA 1HNIA 4R66A 1RT3A 4YMNA 7ICUA 3SQ4A 2ZUBA 1RTIA 4PGQA 4IR1A 9ICGA 3C2MA 3KLGA 3P5JA 1XU4A 3RB3A 1W9HA 2HVIA 3OSPA 4C8MA 9ICAA 5KFUA 1BPEA 3PR5B 3MEDA 5KG6A 1ZQPA 1ZBIA 5J0UA 2BPFA 3DLKA 4M3YA 4I2BA 1O1WA 4N47A 4O3RA 3AUOA 4O9MA 7ICOA 1IKXA 1L3UA 4CGGA 4CJKA 5CHGA 3UIQA 5CZ1A 1SKWA 4I28A 3HPGA 5J2HA 5CA7A 3CFOA 3LP3A 5L1KA 4M3RA 1J5OA 3ZSWA 2HNYA 3ALYA 5CP2A 4C8NA 1RT1A 5J2FA 1MQ2A 1AROP 1VSMA 4Q44A 5I42A 3SQ2A 2GBZA 3GV8B 1S6QA 5J0WA 4MEYA 4B9VA 3VQ9A 4QZ8A 4MFAA 1VSLA 4KLTA 3EWAA 4Z4HA 4CERA 3K5LA 4DL3A 3DOKA 2OWOA 1KRPA 3NF6A 3CM6A 4PH5A 3KLIA 1NKBA 2DPJA 9ICIA 4DU3A 4DFPA 3JPQA 2Q0ZX 7ICIA 3C6TA 5KT7A 4FZZA 4KRFA 4NYFA 5J2GA 1WSHA 1LWEA 4CEQA 4UQGA 4CJ5A 1NOMA 5J2NA 5IIJA 1L3SA 1HQUA 4MQ3A 4FLVA 3DM2A 3ZSOA 3TI0A 5CWRA 4CHZA 1Z00B 4I2GA 4CJUA 1T03A 2BCUA 1BPDA 4F92B 3M8PA 4FJHA 1S1WA 3UXPA 3V4IA 4DTNA 2UVVA 5J0TA 2RPIA 2HNDA 3T5KA 4Q8EA 1JXEA 2DY4A 3QESA 5HRRA 1ZQSA 4RQ4A 5HROA 1TAQA 1A5WA 4YMOA 4W5NA 9ICWA 5J0XA 4O0IA 1SL0A 3A2FA 4CHOA 5C24A 1TGOA 4R64A 4QWCA 3ZT4A 3PV8A 3M9NB 4DSJA 2B4JA 3MGHA 3RR8A 1K1SA 4C8KA 1HUZA 2FPMA 4RPXA 1R0AA 1ASVA 3HL8A 3IM1A 4GC6A 4CF9A 2R8GA 1TK5A 4PUOA 4PY5A 4RPYA 5FROA 5FRNA 1JLBA 2YKNA 1TAUA 5KFVA 3GIJA 3AVLA 2XC9A 1ZQCA 4CHQA 4G1QA 5KFNA 4UB3A 3GDXA 4IQTA 1EXNA 4YXMA 8ICIA 4M9HA 5CYQA 3DRPA 5HP4A 4KLMA 2F8TA 5HRSA 1A5VA 2X74A 3Q8QB 1NK9A 4O5KA 1IM4A 4B9MA 3RMDA 3SQ1A 3OVNA 4FJGA 4FYDA 9ICTA 4CE9A 4F4WA 1ASUA 3DYAA 2HHVA 1BPBA 3HP6A 1KSPA 2AQ4A 1XSPA 3LZJA 4ECWA 3C5FA 5KRTA 4O5BA 3V9ZA 3O3HA 2JZBB 2OPRA 2Z1IA 5HHHA 1BQNA 4GW6A 2DFLA 1ZQTA 3ZT0A 1ZQKA 4RQ7A 4CCHA 2GWSA 2BQRA 3AA4A 1ZETA 4RUCA 2VA2A 3MDAA 4GLXA 3OYLA 3IAYA 3RJKA 4FJXA 2O4GA 3VQ4A 4N41A 4Z6FA 2P6UA 3RH5A 4HUFA 3ASMA 4KHSA 4JK1A 3KD1E 9ICMA 4IFVA 2WTFA 1VSKA 4FCYA 2Y1IA 2NUBA 3RJIA 3OS1A 1ZQQA 4I2FA 2W9BA 1QSLA 1S6PA 1HNVA 4OGEA 1A77A 4TUSA 3HSTB 4N76A 2PY5A 3RH4A 4YCXA 4BDYA 4ED2A 3H40A 2RDIA 1L3TA 3DLRA 3AVCA 5DQGA 1CUKA 1Y97A 1B9DA 3HVRA 3S3OA 1RBTA 1RDCA 4CIEA 4RT2A 4CK2A 2HMIA 4NXZA 5DGAA 2R8HA 7ICLA 4I2AA 3MFIA 4FLYA 3RB6A 1DGSA 4ZTFA 3U3YA 3RJEA 3NH0A 3TAEA 1WSFA 3ZT2A 1RYSA 3LPUA 3JPOA 3ZDDA 2ATLA 4J9OA 4UAZA 4EEYA 4FLTA 4DLEA 4EBCA 4M9NA 5JS2A 2RF2A 4KAZA 4FLXA 3I8DA 2HHUA 1Z25A 3AU6A 1TL3A 1ZBFA 4QZGA 4KLIA 1BIZA 4Z4GA 4CFDA 4W5OA 3OJUA 3OYBA 1JL2A 4KB0A 4UB2A 2E6LA 4CK3A 3SNNA 3RMBA 4JWNA 4P2HA 4NLKA 2P1JA 4YQWA 4KLHA 3G10A 4M47A 4JV1A 3U3GA 3OS0A 3V6DA 1UOCA 1Q9YA 3PO4A 4J9RA 8ICYA 3T3FA 2BGGA 2HNZA 1RXWA 3C2LA 1WSIA 4M6WA 1ZQYA 1JN3A 3OYGA 2MUTA 5KG2A 2ISPA 1RBUA 2VWJA 4FZXC 2HVHA 4TSXA 3OYKA 1K6YA 1S97A 4CHNA 3OYJA 1RXVA 4KLFA 4ECXA 4CHYA 3PO5A 3QO9A 4O44A 1WSJA 2VG6A 3F9KA 4CEAA 4M3WA 4O5CA 3LALA 2AGOA 4HUGA 4RW9A 4R63A 3TQ1A 5KFWA 4KV8A 2JEIA 3LANA 5E41A 2B5JA 3QZ8A 4BE1A 4RQ5A 4TQRA 1WCNA 2ZTDA 4TQSA 4F2SA 4Z6CA 3DI6A 2NRTA 3SUOA 8ICZA 3KKSA 2OYQA 1RT6A 4J9LA 3DOLA 2VG5A 1A76A 3GILA 4KLUA 4DFMA 3K4GA 3OHBA 4KFBA 5KFCA 3WNHA 4UB1A 1ZQGA 3C23A 2AGPA 4FJ8A 3FFIA 2A1SA 2R8IA 4IRKA 3KHLA 1QQCA 4CF8A 4RNMA 3MBYA 2Z1JA 5KGXA 3MR3A 3DRSA 4QZBA 5C25A 4EYIB 3KD5E 3JPPA 3T19A 3ZSRA 4KITB 4E7JA 2W9MA 2QK9A 3MFHA 1NJWA 1Y88A 1U48A 3ZCMA 2ZD1A 3NFAA 2ZTCA 1WNSA 3L2VA 2P66A 5KFTA 3B0YA 1C1CA 2WONA 2JLEA 1XSLA 4HCBA 2PYJA 1PZNA 4E0DA 5DK5A 4FXDA 4PA1A 1S5JA 4CJTA 1C6VA 3M8RA 9ICJA 4HVJA 5J0SA 4Z4FA 1SL2A 3ZSXA 3RAQA 4EZ6A 1RNHA 3UPQA 4JWMA 4KHQA 3VQAA 3Q8SB 5DMRA 3KHGA 5KT2A 1N56A 5KFGA 4QWEA 1D5AA 8ICXA 5DQHA 2VG7A 1RTHA 4E1MA 8ICEA 3RBEA 4YG2A 5L1JA 4M0AA 3NH2A 4DS4A 5DLFA 2XY7A 5KT5A 1ZQNA 3SCXA 5FRMA 4O3QA 1RBRA 1QSYA 2XCPA 3QEAZ 4N5SA 3OYDA 3IS9A 3VQ7A 2FLLA 3QNOA 2HHQA 4XQ8A 2BPCA 2XGQA 1RDBA 3MXIA 2YHBA 9ICNA 7ICQA 1X9SA 3QNNA 3TANA 3ZSQA 3V1OA 8ICNA 2G8WA 3JPRA 3H08A 4PHAA 5L1IA 1TL1A 1KLNA 2HB5A 3O3FA 1D8YA 3MDCA 4CGHA 3TFSA 4LH4A 1RT2A 2R8KA 3GFKB 1GOBA 4CJWA 2P5GA 3AA2A 3ETLA 1SUQA 3AVAA 5J2AA 4J2AA 1S10A 4F8RA 4LD0A 5J2MA 3B6OA 1ZJNA 3LWLA 4QZFA 1NK6A 5J0OA 4R5PA 3ZSZA 5HBMA 4Q5VA 3GQCA 4CF1A 4E7IA 1Z3EB 4O0JA 3O4NA 4M42A 1ZQUA 5DB6A 4Y1CA 3ZSYA 1Z26A 3S9HA 1TKDA 3ZSVA 4J9KA 2EX3A 2W9CB 4KREA 4F5NA 2DTUA 2PXIA 3TAPA 4DU1A 1KCFA 4DTXA 4RNNA 2V4RA 9ICPA 4LY7A 5D3GA 4N56A 1WCLA 4MEXA 3RTVA 5KFYA 3KLFA 2ITGA 3G0ZA 3UXOA 3C2KA 4FJMA 3IRXA 3RR7A 4BWJA 3BJYA 4B9TA 4Z4EA 3RMAA 2ASLA 5J2QA 3C1ZA 4F5RA 4M3ZA 1DTTA 4CGFA 3BQTA 5IIIA 8ICMA 3HX0A 4CEEA 3VQ5A 2FPLA 3V6HA 4JUZA 1TVAA 3QIOA 4IKFA 3V81A 2MAXA 4LSNA 4ED8A 3T5JA 1S0MA 1WSEA 4DSFA 4QZDA 3KKRA 3M9MB 1NK8A 2RDJA 4QCLA 1BPYA 4H4MA 4TUQA 3JPTA 4HHTA 1MC8A 1ZQIA 3RRGA 3AVFA 4FLZA 3EPGA 2IMWP 3KK3A 5KFFA 2UVUA 1EXQA 3NAEA 4DU4A 4ECSA 4JLHA 4KB1A 2IOCA 4RW6A 4FS1A 4JRQA 3ULDA 1KFSA 5KFJA 4FW2A 2PFQA 1LAWA 5DKWA 3BGRA 3T1AA 1CEZA 4HCCA 1VSEA 1KVBA 4QWBA 5KFMA 5D49A 4DL5A 3ZD9A 3NHGA 5DG8A 3V9WA 3AVHA 1IG9A 1UAXA 3SPYA 4ELVA 4IDKA 9ICHA 4F4YA 5KFAA 3ISBA 4JV2A 1Q9XA 4I2IA 5HP1A 1NOZA 2IS3A 3NGDA 4UAYA 4R65A 3MECA 3PMLA 9ICCA 4DF4A 4PHDA 5J2IA 9ICQA 1Z00A 5J2DA 3K58A 2OZSA 2DFEA 3C5GA 3SUQA 4B3OA 4O3SA 1NK4A 3V7KA 9ICEA 3AO2A 5DLGA 3ISCA 4QZAA 4RUAA 2J6TA 5DB9A 3H8WA 3QINA 7ICSA 3ZDAA 3PW2A 1TV9A 4JS5A 7ICPA 1SZPA 1KFDA 1KFTA 7ICNA 1JX4A 4FJIA 3NH1A 5KT3A 3MR6A 1UT8A 2BKEA 4CF0A 2W9AA 1ZQEA 1REVA 4B9LA 1HYZA 5KI6A 5KFHA 3AVIA 5KFKA 2YNGA 4IQVA 4ELTA 4NCGA 3TAFA 4M3XA 1KVCA 4P4PA 3ZDCA 1J54A 2UVRA 3H4DA 2XCAA 3RB0A 2UVWA 4BXOA 4KLGA 4F3TA 4KLQA 5EWGA 2F1JA 8ICOA 3NGZA 3JPNA 5D46A 3MAQA 2Y1JA 4E7LA 2KN7A 5KFQA 3AO5A 3NTUA 3AU2A 4CIGA 4CJSA 4O4GA 4CEFA 3Q8MA 4FVMA 4EP4A 3TWHA 2OA8A 1ZQFA 4CGDA 4TURA 5KG7A 3EYZA 2C2RA 1S9GA 3QEPA 4KLJA 1J9AA 3G6YA 2YNFA 3CFRA 2ZUCA 1VSIA 4CJFA 4ECZA 3HWTA 1BI4B 5J2PA 2LSNA 5DGBA 3PX0A 3QZ7A 1ZJMA 1CXQA 3H8SA 5HNKA 4F3OA 4FW1A 5DBAA 4CFAA 4K8XA 1SV5A 2I9GA 2X78A 2A1JA 1C0MA 3C1YA 3HPOA 5T7BA 1S9FA 4QW8A 3VA0A 4TUPA 2FLPA 5HMMA 5CB1A 4QZCA 1ZQJA 5C5JA 1ZQXA 8ICPA 2AQ0A 3SI8A 1BISA 2KTQA 4J9QA 5K14A 4DSIA 1GOAA 3TR8A 1NKCA 3PY8A 4DOAA 3L2UA 5I3UA 1HYSA 4DQIA 2F8SA 3SI6A 4B9UA 4KI6A 1I3AA 3H4BA 4B9NA 3C6UA 1ZQZA 4R8UA 2P5OA 3KTQA 5J0QA 4LH5A 2NRWA 1LB2B 5J2CA 2RN2A 2HHTA 1T4GA 3MR2A 3CYMA 1DOQA 3GIMA 4C8LA 9ICUA 1ZQAA 2X6NA 2AGQA 5BOMA 4M9LA 4CEDA 5HRNA 4YR2A 2FBYA 2NRVA 2EHGA 2G8VA 4YMMA 4PGXA 4OJRA 2GUIA 3PNCA 2ZTEA 8ICAA 3K5MA 4B08A 3JPSA 2FMQA 2AU0A 4QZEA 4DOCA 3HM9A 3V9XA 4Z6EA 4W5RA 4DOBA 4CJVA 2DFHA 1JLEA 3IG1A 1UWBA 3QEBZ 2KFNA 1S1UA 3ZDEA 3LDAA 4E7KA 4KLSA 3JSMA 3OHAA 1N6QA 1IKWA 1T8EA 1B22A 3L3VA 3L2RA 4QOZB 3LZIA 1RBVA 5IIKA 4UAWA 4ED1A 2BCVA 1J53A 5HLFA 4YP3A 1SKRA 4IG3A 4QAGA 4O3OA 1U45A 1QLNA 5SZTA 2ZJ5A 4M3UA 4CHPA 1KVAA 5BPCA 4AH9A 3H7IA 1NJYA 2ASJA 5J29A 8ICSA 4B9SA 1NK7A 3AVBA 2XY8A 3NF8A 4ID5A 4EP5A 2D0CA 4ECVA 3F73A 4KTZA 4MFCA 1LAVA 7ICTA 3VQCA 7ICRA 3C94A 3QIPA 4OPKA 4EZ9A 4ED0A 4DL4A 2V9WA 4FZYA 3ORYA 2C28A 4E1NA 1IO2A 1IH7A 3UXNA 4RPZA 9ICSA 4I29A 4I2HA 1RPLA 2ZJAA 5L1LA 3DRRA 4OGCA 4QWAA 3MEEA 4FJJA 3NBPA 5CJ7A 3TABA 4RQ3A 4BWMA 4M45A 3SYZA 5KTQA 2P6RA 4IG0A 4IFYA 4FM0A 3LAKA 3HP9A 4DTSA 2YKMA 1LWFA 4FJ5A 4Q8FA 4KHWA 5KGWA 5KRSA 4Y1DA 4GMJB 2XY6A 1RT4A 3EZ5A 1VSHA 2ISOA 5BOLA 3V9UA 1VK0A 1EX4A 2KZ3A 3V6KA 3V1RA 2ZQBA 3SJJA 4I9QA 5JS1A 1HQEA 4CEOA 1ZYQA 4K4GA 2ZUDA 4YR0A 3M8SA 3LK9A 2BGWA 4EBDA 4OLAA 2Z1GA 3RWUA 3ZT3A 3TFRA 4JRPA 2E4LA 1CLQA 4Q43A 3OGUA 3QE9Y 5DG9A 3RJFA 4YFKA 2BE2A 4CJLA 3WNEA 2D0AA 3AVKA 3KLHA 4FK4A 4DSKA 4FLUA 2IDOA 1S1TA 4DTRA 1A5XA 2D5RA 3AVGA 2HW3A 1RTJA 5TZVA 3OYEA 5JUMA 4KLEA 3L3UA 3K59A 3MEGA 2BCRA 2FBVA 3KJVA 4DEZA 2VA3A 3PUFA 4E3SA 4F50A 1JLQA 3GIKA 1JLCA 5KT4A 1BPZA 5KG4A 1VSJA 2JEGA 1T3NA 1YVUA 2QKKA 4NLNA 3EPIA 7ICKA 1ZQOA 3TAQA 5L9XA 2FMSA 2IC3A 4IQWA 4H4OA 1XC9A 4DQRA 3OYNA 2IGIA 1RILA 3SZ2A 1U9LA 4DS5A 3G6XA 1D9FA 3OYMA 2F1IA 8ICHA 4RG8A 4G3IA 3B0XA 8ICTA 1IXRA 1RBSA 1KTQA 4GXIA 4GC7A 2RKIA 4DL7A 1G15A 4M9JA 4I2JA 4DFJA 4B8CA 2KZZA 1XS9D 3RAXA 4YXJA 3KHHA 4DQSA 3SUPA 3SQ0A 3HJFA 7ICHA 4NY8A 3I0SA 1MSWD 4EYHB 3RH6A 2FC0A 4GXKA 4FK0A 3VQEA 1ZBLA 2PZSA 1CZ9A 3V7JA 4F91B 4BE0A 2BHNA 9ICRA 3LDSA 4MF8A 4F93B 5KFRA 5DQIA 1C1BA 3AV9A 3E01A 4OPJA 2A1RA 4PHPA 3AO1A 1KLMA 1ZQHA 5IIMA 3QETA 2YNHA 4J9PA 4DWIA 4OLBA 1LW2A 8ICFA 3I0RA 4RW4A 5KFBA 3PW0A 4NLZA 1W0HA 1YTUA 4Z4IA 2G8FA 4M9GA 3QERA 2KFZA 8ICQA 4YD1A 2C2DA 4KMUA 4KN7A 4NM1A 1HMVA 2NRXA 4CEBA 4E89A 4ED7A 5KFOA 1U4BA 2ATQA 2FBXA 4LZGA 1QTMA 1ZQDA 4E19A 4DMNA 3E2EA 3VQ6A 1DLOA 1WLJA 4FM2A 4FBTA 4DF8A 9ICVA 1WSGA 4OVLA 1B9FA 5KFDA 4F4KA 4PHEA 5J0RA 4FBUA 3PW4A 1U49A 4DTMA 4HYKA 1SL1A 3PX6A 3P83D 2FBTA 3EY1A 4F2RA 3HK2A 4QWDA 1LW0A 5J0YA 1WAFA 4O5EA 1ZQLA 1LWCA 3HYFA 1CZBA 4ZHRA 7ICGA 4JV0A 2XRIA 1EP4A 4QW9A 3PMNA 1VSDA 4O3NA 4XIUA 3NE6A 1HJPA 4W5TA 2YV0X 4F5OA 4KN4A 3M8QA 5J2JA 3LAMA 3OYAA 2FLNA 3B6PA 3AO3A 1COOA 3OYIA 1XI1A 3U6FA 2J6SA 5CYMA 3AO4A 4GXJA 3ZDBA 5KFZA 1T7PA 3FDSA 3OYFA 3TAMA 1X1PA 1HUOA 2VANA 3SUNA 3VA3A 3OSNA 3K2PA 4EBEA 7ICVA 4FS2A 3Q8KA 1JLFA 4K4IA 2Q3SA 1S0NA 2BQ3A 1N5YA 4GVMA 4KO0A 3SV4A 1JL1A 4DFKA 4I9LA 1ZQMA 4I2DA 1UA0A 4CJEA 1FXXA 4BDZA 4NLGA 2W42A 3WNFA 4QZ9A 3AVMA 2GV9A 3RBDA 7ICJA 4RNOA 4Q45A 3QEXA 3V1QA 1S76D 2R8JA 3DLEA 4ZTJA 2OPPA 1HYVA 4B8AB 1C0UA 4RU9A 4M2YA 1N48A 1BL3A 9ICKA 4UBCA 2IHNA 5CR0A 1U47A 1RTDA 1RT5A 3VQPA 2G8IA 2F1HA 2JGUA 4DTUA 2W8KA 1KEJA 4FLWA 3MGIA 5J1EA 1FKPA 9ICBA 8ICRA 4I27A 1WN7A 1RCHA 4C8OA 1LV5A 1QSSA 9ICOA 2FPKA 4NM2A 3DMJA 2KQ2A 4CJPA 4O3PA 4HUEA 3AA5X 3BQ1A 3BQ2A 2PFOA 1RZTA 2DFFA 4KLLA 3ZD8A 3KK2A 4LZDA 4M3TA 3NGYA 2H5XA 4IQUA 8ICVA 2IBKA 4CJRA 3KLEA 3NCIA 1IKVA 3G6VA 4WE1A 4H8KA 3IHQB 4YFUA 4BACA 1TFRA 1TK8A 2JEFA 5CZ2A 2HHWA 5DDYA 5F9NA 4KTWA 3HW8A 3RJJA 4BXOB 1UA1A 3OY9A 4DSEA 4FK2A 1ZQRA 1MU2A 1JLGA 4RT3A 3O4QA 1B92A 2FMPA 2C22A 1TV6A 2R7YA 3FYHA 1JXBA 4I2QA 4DTPA 2HHSA 3S3MA 3H8JA 5HMLA 3M9OB 1KDHA 2KW4A 3ITHA 5FDLA 4DO9A 1F21A 1FKOA 4UB4A 2DPIA 8ICGA 5DBBA 1BI4A 3VQ8A 4AHTA 3L2WA 2OPQA 4DG1A 3TAGA 2XY5A 4DLGA 1S9EA 2JZBA 3THVA 5F9LA 4Z0UA 5DB8A 5C42A 5J2KA 1EKEA 4BDPA 1EETA 4W5QA 4CJ4A 4Q0BA 4I7FA 2B6AA 7ICFA 4KLOA 4CGJA 4J2EA 3NF7A 1ZQBA 4Z4CA 1JMSA 5KG1A 4RZRA 4CIFA 1QS4A 3V7LA 1C0TA 5HRPA 3CG7A 3K75D 1RT7A 4ID1A 4F5QA 5HHIA 2ZJ8A 2NRZA 2Z1HA 2A1JB 2JEJA 2BDPA 4RW8A 4F4ZA 5KFIA 1QHTA 2YHAA 4DTOA 1RDAA 2OZMA 3RJGA 4FJKA 4YN4A 3HO1A 4CESA 3RRHA 4MFFA 3L2QA 5KFXA 3NF9A 2IHMA 4QZHA 3PVXA
chains in the Genus database with same CATH superfamily
1BVSA 3GR0A 3VEOA 4DR6F 4R25A 2NCKL 4AHVA 2MSNA 1NJIT 3ZC4A 3MMVA 4X5VA 2G5IB 3VAJA 4B1ZA 3HXMA 4IFVB 2WAQC 5SWMA 3F5AA 4IKAA 1Q8IA 4DUZK 1LWXA 2VQEJ 4B1UB 3J80O 1Q7YO 5JVHQ 2QARA 1R8PA 3EZOA 2KK0A 4FM1A 2J6UA 2DNPA 2BKPA 3OTCA 3PRVA 3O2IA 2DEJA 2FGOA 4XRHA 3WC0A 1YI2S 1VQ4N 1WAJA 4DCPB 2YKOA 1P9YA 1X9JA 1V9PA 1QQ6A 2B51A 4MN4C 2COLA 4J9UE 1X31C 4M95A 4BR0A 4U8YA 4OJ1A 3BQ0A 2NPIA 5AE3A 2JC1A 1SKSA 2JV3A 4DV1J 3IG1B 1UWBB 4HHHA 3FC4A 5KFSA 2RF2B 4P6QA 3A13A 4XUSA 5J2EA 4CGZA 8RUCA 3HOSA 4IJAA 3UW1A 1Q86T 4DUTA 1N6QB 3T5HA 1JCEA 3DLLQ 4DB3A 4P74A 1KBUA 1TKTA 2HLUA 1WORA 3HX9A 2X6SA 5AQJA 3QEVA 1YIJN 1IQTA 3M2UB 2FHOB 2W8LA 2ZE2A 1CQNA 1RQ0A 4ECYA 3ENWA 4IRDA 3QEIA 2ZZNA 2HS4A 5D4BA 4RX6A 4DV6F 3C0BA 1IBKK 2J7UA 1K1QA 3W0LA 4CZLA 2VPZB 2YPYA 2EK1A 1NB7A 1VRTA 3N9UC 1NK0A 1S1VA 2FZKB 3ILIA 2BM0A 3S41A 2RD5C 1XHXA 2VFTA 4H0YB 3NGSA 3QO9B 3VEWA 5AZJA 2FF3B 5IIOA 2ADCA 3AOBA 4CZKA 4IG0B 3CMAS 4IFYB 3CJBA 4IH6A 1U1MA 2P9IB 1RYRA 1EHWA 2YKMB 2KXHA 3C66A 2NLWA 1XC3A 3DI6B 4RQ6A 2PI5A 2IIRA 4ZMMA 4QYZJ 1IBLK 1C4CA 4KFBB 3RB4A 1OSDA 4C11A 4PQUA 4DV5F 2OHFA 2I0XA 3FFIB 4FJ7A 2BE9B 4MMOA 2E1ZA 2HBMA 1PGZA 2Y1LB 4P0QA 1GQEA 1Q81T 4C4SA 9ICXA 4JI0K 1UMJA 4WQ4C 1FJ7A 2DB1A 2WTUA 2E5LK 1HPZA 4OD0A 5EDWA 3CM5A 4LF8K 4GKJK 2P6TA 4ID8A 5KNIA 4ELUA 2B4PA 2WF8A 5AZIB 3EUNA 1LOTB 5DDMA 2VWKA 2FDNA 1KEKA 3D54A 4CFBA 2R4FA 2AJQA 2FHKA 1ATSA 2PO4A 3FMWA 4CE6A 2KJWA 3MM5B 1DZ5A 3C2PA 4CNYA 2VG7B 2JH1A 2IAJA 2ZH1A 2MZ1A 1HD1A 1H6KX 3DLHA 3SBGA 1B7YB 1ECWA 2Y1RI 3CJ1A 3IS9B 4QIWD 1UVMA 5A0YB 3A5NC 5J2BA 2MLYA 4CRJA 5A8WA 1H1VA 1LEOA 3JXUA 4K0KF 2V94A 3AA3A 3M05A 1ZQWA 4M5IA 3D6FB 1ZBUA 2VA8A 2EG1A 2D3ZA 5DB7A 2KE7A 4P4MA 4RWXA 1R0CB 3POTA 2V52B 2PI4A 3CQXA 2V63A 4RU2A 5J2MB 5DG7A 4OKJA 3D6MB 1ITGA 4B02A 5ALVA 3CPEA 3JQKA 2KRBA 2D3DA 2LYHA 1B0PA 3PW5A 1N0VC 4JK8A 2YX4A 3CMAN 1IVZA 5KFPA 3PG9A 3JB9k 3OA9A 1Q8BA 2EZZA 2W11A 1FNOA 3G8QA 2YMPA 4ZPBA 5IINA 3QSYB 4ZCMA 1R6VA 2X7IA 4CECA 7ICEA 2BCQA 2ZH2A 5EXWA 3LWMA 2DR8A 2KNJA 4CK1A 4CBWA 4AT1B 1T9YA 4JEPA 3IWXA 4X62F 1WG8A 3AVNA 2CH5A 1HNWF 4DQPA 1J5EK 4LJXA 5D77A 3Q8PB 3JSBA 3PIOQ 3HZEA 1GLAG 1RWVB 1Z19A 1L6NA 3GIRA 2XWYA 2WC9A 3I1YA 2HHHK 3KLGA 3O08A 3L7OA 3DFEA 4DCOB 2FIUA 2CQGA 1QD1A 4P7VA 4S0MA 3T1HK 1BPEA 3PR5B 2HSTA 2KB2A 1KN5A 3R27A 4RJVA 1WHXA 3DLKA 3HSGA 4I2BA 2Q4TA 3AUOA 7ICOA 1L3UA 1RAGB 4LFCF 2F65A 2P9PB 2PE8A 3D3CJ 2AP1A 2QV6A 2DKZA 3HPGA 5L1KA 1ZBSA 1BNOA 1UJ5A 1WSRA 1LW0B 3QNWB 3CW2C 1Y9OA 4KH6A 2E2PA 2HNYA 3ALYA 2W3SA 2VPYB 4C8NA 3KK3B 1KAXA 1NAQA 4RW6B 1U1LA 5J0WA 5AJ3J 2ILZA 2X51A 4B9VA 3L9ZA 3SEOA 4QZ8A 1VSLA 3EWAA 3QU2A 1X5PA 2OWOA 5KAIU 3NF6A 3O9SA 3CCMS 1JCFA 3CM6A 4I6MA 3Q2TC 2GEMA 1XR5A 5J8YC 1XNQF 2XMKA 4WPAA 3VTIA 3WXLA 2VDIA 2XS7A 1N0UA 2AKWB 5J2GA 2GMLA 2XMAA 1YUWA 3G25A 2HFSA 3MECB 1NOMA 5J2NA 5IIJA 2WF5A 3BUZB 4Y65A 4OI1A 3W3DA 2ZJQL 4CHZA 3SJHA 2Y9UA 4JYAK 2L5YA 3MMJA 4EI2A 5E26A 4EX7A 4CO4A 1T3OA 4DR2K 2AZ1A 2VB6A 3HFVA 5AM1A 2UVVA 5J0TA 4GV3A 2RPIA 4YN3B 1JXEA 4PG8A 3QESA 5HRRA 1ZQSA 5A6WA 1GXLA 1TAQA 5THWA 4YMOA 5LSRA 4WIIA 5CZXA 4B3RJ 2R7TA 2FC8A 3R6GB 1TGOA 4JKGA 4QWCA 2DR6A 2E1PA 2R9LA 2ZZMA 3CI5A 4OX7A 3NNAA 2P8IA 3G87A 2PD1A 3MGHA 2JWNA 3OR1A 4C8KA 2QYGA 2JWKA 1R0AA 3CJQA 2MKKA 4CF3A 3HL8A 3IM1A 3I28A 1IBMF 3ILJA 4PY5A 2KVSA 4I0WA 4Z7CA 5FROA 3HJVA 3CVKA 4U7UK 3CNQP 4CLPA 5F8NA 4FWMA 1ZQCA 4DR6J 1PIEA 2YX1A 2VKZG 3PJXA 4CHQA 4UB3A 3F9MA 3GDXA 1ELOA 4I6YA 4M9HA 5HSPA 3IA0A 3FKBA 5ETQA 2JSXA 4CNQA 4P7TA 5KL1B 2ZUAA 2F63A 3BPDA 4DR1J 1NK9A 5CHIA 1TAMA 1IM4A 4O5KA 3CCRS 1VR6A 2GJIA 1ASUA 4YOYA 1Z6RA 3LGNA 5H1SV 4YDXA 5L38A 1XSPA 2ADBA 4ECWA 4HH0A 1YRTA 3C5FA 5KRTA 2P9EA 3M1FA 4O5BA 3V9ZA 2Q97A 5AI0A 5HL7L 3KDNA 3VQTA 5L9NA 1ZQKA 1EETB 2E1CA 3CCMN 4I64A 2JXJA 4GLXA 4TY8B 2O4GA 3VQ4A 5MLCQ 2K2PA 4LR7A 1HNXJ 5A6PA 4BROA 3B54A 2KH9A 4PQAA 2M52A 2DH8A 4A47A 1NZAA 2SXLA 4ZLPA 4ZA1A 9ICMA 5HVGA 4IFVA 2Q1LA 1TUUA 4WZQA 3C6UB 2Y1IA 1ZZFA 4KJIA 4PJ0U 4I2FA 3CF5Q 1LKYB 2AT1B 3HSTB 3L6QA 2HF4A 4ZLJA 3RH4A 4YCXA 1TQLA 1Q7YT 1MMLA 2E7XA 3T6BA 3H40A 2RE1A 3M6XA 2E2QA 3C16B 4USAA 1VRQC 2RDIA 2P35A 2CNNB 3DLRA 5ADXA 4CLFA 1CUKA 1OVQA 1KP6A 2H5IB 2RQMA 4KYZA 1B9DA 1Y97A 3AB2B 3HVRA 2Y9HA 5HQ8A 5GAHP 3DXKB 2LXIA 4CIEA 2OPSB 2YN4A 4CLTA 4I2AA 2OHDA 1HR0J 1FX2A 2D0PA 3B4DA 2RE2A 1MN8A 3M6VA 3KNGA 3ZDDA 4RNHA 5MAOA 4UY85 3L95X 4UAZA 1RGIA 1S1UB 1F2HA 2RF2A 2GJFA 4MKYA 1BC6A 3HSJA 3I8DA 3H45C 1UWAA 4OJLA 3RW7A 4IG3B 2LYVA 1BIZA 4CFDA 4FOEA 4KB0A 2QWOA 5GAGI 5T7LB 2C2NA 4CK3A 3SNNA 2RUGA 2FZGB 1RWNB 4PPZA 2DGUA 4J7CA 3IR6B 4M47A 1BE4A 2CNOB 4JV1A 3U3GA 3LA0A 1IWGA 1T9VA 2MMYA 1L8LA 2IVFB 1A9NB 4QJFB 2APOA 1ZQYA 5A8KA 3OVAA 3QIPB 3FCVA 2VASA 3UM9A 3OYGA 2RSQA 3CCRN 2VWJA 4HEA9 3OYKA 3K89A 4U7CA 1K6YA 2DNLA 1YJWS 4OYMA 1RXVA 3SAGA 3AEVA 1U2CA 3QO9A 2YQEA 2WBMA 3BR9A 4NMLA 2Q6BA 2ZF5O 2V8VA 4CEAA 4O5CA 3I8BA 2FF6A 3TQ1A 4TYAA 2I2YA 2P9IA 3LANA 4RQ5A 3DOMB 1U2RA 4FPAA 4ILMA 1WB9A 3TW0A 2UUCF 3DI6A 3PJWA 3SUOA 3ATUA 3VAKA 1JWWA 2MB0B 1A76A 4PAAA 1BUPA 4P73A 4KFBA 4IUFA 2WAQF 5KPZA 2QTDA 3C23A 4LF2A 4ANEA 3FFIA 3S01A 3W8GA 4ZIVA 2R8IA 3F2CA 4JI2K 2U1AA 4I67A 3DXMA 3UMCA 2P9UB 4QZBA 1Z2ZA 4DHYA 4KITB 2W9MA 2QK9A 1FFWB 5LMNF 4JOUA 1Y88A 4J5OA 2ZTCA 3MCSA 2P66A 1N34F 1C1CA 2JLEA 3AGRA 1NGHA 1PZNA 1G6BA 2JJ4D 3H3OB 5DK5A 4FXDA 5BYQA 2ZNYA 4AQYF 4LJMA 1RTJB 3M8RA 1ACMB 2G5HB 3EGWB 1QAIA 2AJ0A 2LM1A 1ZPVA 1M1KO 3BDEA 3MPWA 3N0VA 1VC0A 4PKIA 3FGVA 4C4TA 2UZAA 1RHKB 4H5WA 5KT2A 2ASMA 3IWLA 3MM5A 5KFGA 5DM6Q 2JVOA 8ICXA 2KJ8A 2VG7A 3ZETB 1CJUB 4X4PA 8ICEA 4M0AA 5L1JA 2MY8A 3SFUA 1OSCA 5KT5A 1GX6A 3NGKA 5LXRA 2A6OA 2VYPA 4O3QA 1KQSM 4UZBA 1QSYA 3KG4A 3EO3A 2IVOA 3IS9A 3VQ7A 2FLLA 2G2ZA 5A0YA 2HHQA 4ZPDA 1UETA 3EKUA 5AI4A 1RDBA 5AM5A 4B6JA 1X9SA 3ZSQA 1DY3A 3V1OA 8ICNA 4HDGA 3TACB 4ICLB 5AQMA 5HK4A 5F0UA 3L3FX 5FJ4A 1WKJA 3V4MA 5E3PA 5L1IA 3WXKA 1KLNA 2HIYA 3O3FA 4ILGB 1JLAB 1WTFA 4Y2TA 3TFSA 5C2GA 4LH4A 3GFKB 3OXFA 3TX8A 4B3MK 5J2AA 5K5MA 3IO1A 1TFWA 1YBAA 5J2MA 4NJ8A 3MN9A 3R3TA 2ZM6J 2E2OA 5GAEI 1KR4A 1YJWN 2QYCA 1NK6A 5J0OA 2ALYB 3TEGA 2HI0A 4Q5VA 2HBJA 2AJ2A 5AQPA 4O0JA 1TKZB 2CPEA 1LFPA 4XH5A 3JQMA 1URRA 1HNZF 4OJ3A 1NXIA 2L9NA 4C1NK 2MYFA 3MWBA 3ZSYA 1TKDA 1EQYA 2KXFA 2OTLS 4NOHA 3WK4A 3TAPA 3QIDA 2Y0SD 3W2VB 1KCFA 4IOCL 1LK5A 2XMVA 9RUBA 9ICPA 2FY1A 4LY7A 1FJCA 2PT0A 3C65A 5ALZA 1V3RA 3BBBA 1AZSB 4MEXA 2BW2A 3RTVA 2ZBQA 4LC9B 3UXOA 4A2BA 1IXKA 1YJ9N 1H98A 4FJMA 3UD5A 3H5SA 1KQGB 4B1VA 4B17A 2HURA 2AYMA 1DBDA 2JC0A 5HJXA 3I96A 1XMOJ 3C1ZA 1ZM3A 5C2CA 1D1UA 3QT8A 4CGFA 4GKKJ 3MC1A 1AW0A 1FKAF 2BA9A 1RTIB 4ZK7M 4YDDB 2HLTA 4JUZA 2VBXA 4IKFA 3QGPA 1IIPA 2P9PA 3T5JA 5AK6A 4HTJA 4LF6F 4WBFA 2GCFA 4QZDA 2DHGA 4BR7A 3MGVA 4TXSA 3JPTA 1PYSB 4HHTA 3VVTA 3RRGA 1EZZB 2DO0A 3M6KA 4N7TA 2XVTA 5DZ6A 2IMWP 4UZCA 2NRHA 5GMKa 1RZMA 3KK3A 5KFFA 2E5HA 3GCWP 4RW6A 3O6QA 2ASYA 4OX9K 1KFSA 2D41A 1NPKA 1Y10A 4U8VA 1UVLA 1SPBP 4TVAB 4A59A 1RBAA 4QJVA 2WK4A 3GB0A 1CVJA 1S4FA 2ZJQQ 2KSOB 1L3KA 5DKWA 3JAMU 3TUPA 1XNRK 3T1AA 1CEZA 4HCCA 1S6QB 3ID6A 3MD1A 3RGIA 2H3IA 3ZD9A 1S72S 2BUNA 3GTYX 4ES1A 2RHKA 9ICHA 4EHUA 1GTHA 4RQNA 2FJEB 4JV2A 4KO0B 1Q9XA 4I2IA 3FFKB 4QR1A 3NGDA 4UAYA 3MECA 2W04A 3HDSA 4DXLA 2KIVA 9ICCA 3M30B 4PHDA 1RU1A 9ICQA 3CXCR 1SKUB 2OUGA 3PYEA 2BACA 4KBIA 4O3SA 3V7KA 3L7PA 3AO2A 1AXQA 1RTDB 4MLEA 2QLJB 4QZAA 4DBQA 2AXTU 3L0QA 3HHLC 1OVYA 2BKNA 4EEKA 3VQSA 5J1EB 3WC2A 1V97A 2OTLN 3C46A 1FTCA 1KFDA 1KFTA 7ICNA 2CPZA 1PVQA 1JX4A 4DU7A 1UT8A 1GAOA 3HHEA 4A8MP 4CF0A 5HN0A 3S7RA 3F5TA 4K41A 3KG1A 1HYZA 5KI6A 4MTPA 1S3XA 2L08A 2MZTA 5KFHA 1TYQB 2YNGA 4ELTA 3GR1A 3K2YA 4NCGA 1KVCA 2KMDA 3ZDCA 4O0NA 3RB0A 2UVWA 2QL7B 4BXOA 1U8SA 1KS2A 4KLGA 2A1BA 4J91A 2P9KB 4LRDA 3JPNA 1GXTA 1Z4NA 2HZCA 3G86A 1MDUB 4E7LA 2KN7A 2IMOA 3AO5A 2G13A 3VC8A 4CIGA 4A8FA 1JLGB 3WK7A 1FEEA 1ZQFA 2CIMA 3EYZA 1S9GA 3GWCA 4KLJA 3MMAB 3CFRA 2YKQA 3MCOA 3N28A 4GY2B 4CO1A 1FNMA 1S7IA 4CJFA 4ECZA 3HWTA 4FZNA 4WP9A 2YPZA 3CETA 1KKHA 1HHTP 3H8SA 3HHLB 2HWIA 1YK9A 2R3VA 2Q0UA 5L8RC 3NG8A 1Y0HA 1S9EB 3AAQA 3DYAB 3OBWA 2MEWA 2QG9B 3TTFA 1B99A 1C0MA 5EN1A 3QGHA 2CRXA 2Y0SC 1S9FA 4V19J 3CT9A 3DC2A 3R7SB 2FLPA 2NYIA 2PFUA 4QZCA 5C5JA 8ICPA 4TY8A 4NZ6A 3CMQA 5AXLA 4ILLA 1HWIA 1S72N 2CYYA 2KTQA 5JMNA 2RS8A 1SZHA 2MSSA 1KONA 1JK9B 2C3PA 2E66A 2LU1A 4C97A 5LY3A 1HYSA 2WOMB 2F8SA 5LSLA 3C6UA 3O1BA 1ZQZA 4R8UA 2BJ3A 2P5OA 4MKBA 1LKYA 2R42A 4GO7X 3QICA 2LM4A 4AL6A 4C8LA 4FWPA 3C16A 2FSJA 4CEDA 5HRNA 1CJTB 2HZVA 2ROEA 4NLDA 5ALUA 2NRVA 4X66F 4XPEA 1HNVB 1X3NA 4YMMA 2FJVA 4OJRA 3IFEA 3OBYA 1QVGR 2JVRA 2ZVIA 1BOTO 1PO6A 1D9AA 4X64K 4B08A 1FFGB 1KHWA 2FMQA 4DOCA 4Z6EA 2AX1A 4W5RA 4DV7F 3NMUA 5LJ3Y 4B3SJ 2E8AA 2I1RA 5DM7Q 1XEZA 2DK2A 1S1UA 4NXMK 3JSMA 2BJEA 3W3SA 2EAPA 1RHUB 1KOHA 3CCTA 4BG9A 1J53A 4YP3A 4FWLA 2UXCK 1I94F 4PL1A 2OEHA 2M4MA 4IG3A 4OJ5A 4QAGA 3QT5A 1IQZA 1QLNA 2H3GX 5HOOA 1FJGF 2PMZD 3R97A 4AH9A 3PRBA 3RJMB 2UU9J 3JAMY 1TL3B 4LMZA 3CC7S 4Y00A 1NJYA 2ASJA 5J29A 3AVBA 3BF3A 3NF8A 1L7MA 1C20A 3F73A 2JMGA 4CVNE 1RLCL 7ICRA 2CQBA 1HWKA 3QIPA 4EZ9A 2V9WA 4ED4A 3ORYA 2C28A 3QFHA 4E1NA 2D4WA 4USMA 5GAHI 3CULA 5L1LA 1W2IA 4OGCA 3MEEA 3NBPA 3LP2B 1R3NA 1FEHA 4NLUA 1A6LA 3SYZA 1WUUA 7AT1B 1JXVA 1S12A 3LAKA 3JTPA 5AM4A 4KHWA 5KGWA 1Q16B 5CCMA 4F71A 1R8CA 3DOMA 3G6ES 3NVKA 3OR2B 4Y1DA 2VG6B 3KHYA 2XY6A 5BOLA 2Q43A 3OFGA 3SJJA 4CEOA 3NGTA 2RILA 4CO0A 1N32F 2DNOA 1ZRMA 1N5XA 3M8SA 2BGWA 4BRKA 1ATRA 2EFNA 4B3TJ 1Z4OA 1HBOB 1A6SA 1P9QC 3RWUA 3ZT3A 3IG8A 1BLUA 3TFRA 2E4LA 1P27B 2P9UA 3PHTA 5DG9A 2GFFA 1UW4A 2J9CA 4UOGA 4CJLA 3WNEA 2D0AA 4WFAL 1WG4A 3WKAA 3CD0A 4MHVA 2E20A 1NG9A 4DV0K 2F7VA 4DUZF 5JMVA 4FK4A 3AAWB 2IDOA 3TTDA 4DTRA 3THYB 2HW3A 1RTJA 4KLEA 3L3UA 2K8GA 2ZD1B 2YXLA 4ETZA 5E84A 3QJJA 3P4IA 1HW9A 3VEVA 2ESEA 3ONNA 1KHVA 3C7NA 1RQLA 1KWMA 1MA9B 5ALYA 4H4KC 4C8ZA 4HL9A 1OMSA 2DNRA 1QZ5A 3ZETA 3D0HE 5KG4A 1CJUA 3QGGA 2H3FA 2VODA 2W4CA 4BRHA 1YJTA 3CCWA 1W25A 1HBNB 4L75A 3L4PA 1VCTA 3MM7A 2E29A 4DN0A 4EAHD 2DT9A 2IGIA 3SZ2A 2PBDA 2WVBA 1CPZA 1SI9A 5F41A 2BMBA 1NEEA 2QLBB 1VJQA 4QS9A 1D9FA 3BYRA 1U1KA 2F1IA 3B0XA 8ICTA 3P5TL 5DDPC 1RBSA 4X65F 1CZAN 4CJ7A 1MW7A 3WKDA 4DL7A 2E1RA 3IC1A 1U25A 3ISZA 3CC7N 2V8GA 1HW8A 4DV2J 1PYOB 2MGZB 4AYBD 2QEXS 2IDLA 2ZH8A 3P96A 3KHHA 1N36K 2D3UA 4CIOA 2DNGA 2DCLA 1L7OA 2KVIA 3I0SA 1DTQB 3AB4B 3U1LA 4EYHB 3RH6A 2HQ3A 2KO1A 1O08A 4K4VA 1X42A 4FK0A 1ZBLA 4F0HA 3HD1A 3THXB 2P5VA 3M8ZA 1OXJA 1SC3B 3OTOJ 4IOCQ 1Y3JA 3LDSA 4EWTA 1A0PA 1SV4A 4I2PB 4MF8A 1SUQB 3MMCA 5HVHA 4F93B 3O6WA 4NLCA 2W1BA 3HRGA 3FQLA 1NGCA 2NREA 3E51A 5LMUF 3PFOA 3RBXA 1SQEA 5EOYA 4P0PA 4QR0A 2JGAA 2G0CA 3G6EN 1I3OB 7FDRA 4OPJA 1GLCG 2HVEA 2FHJD 1SJQA 4PHPA 1T3VA 1UEUA 1RXOB 3QDKA 3MTKA 5IIMA 2C2MB 3BF4A 4DWIA 1HPMA 4FYYB 5KFBA 3W2VA 2E1AA 4DR3F 3O9QA 3KJNB 4JNEA 4OI3A 5E2QA 1YTUA 4KQZA 1AZSA 7FD1A 3CCJS 1WF0A 2MPUA 3FNNA 1JKHB 2X1GA 2D1KA 3MOZA 3HD2A 2PIIA 4G9ZA 3GMGA 2VPWB 2ZH3A 4L73A 1QTMA 4NV0A 2FSKA 4DMNA 3QYYA 2CQIA 3I56S 3P38A 4UUWA 2AH5A 4DF8A 4JI0F 1GX5A 2B9EA 5J0RA 1IBCB 2E5LF 2XZTB 4LF8F 2VHGA 3BM7A 5J2QB 3UFCX 3N7PD 4GKJF 3DGVA 3EXYA 3P83D 1FTRA 2GO7A 3DKDA 3NKYA 3HK2A 1IKXB 4QWDA 1RHQB 5J0YA 4K4YA 2CADA 2R7UA 1WAFA 2VOOA 1ZQLA 1XN9A 4BR5A 1Q5VA 2FXUA 2AD9A 4JV0A 3OPKA 4OYWA 3PSPA 4LF7K 1HI8A 5HMYA 1E4GT 3H25A 4W5TA 4P72A 2YV0X 1D8ZA 4F5OA 4A8SA 4MK9A 4DJBA 2MJUA 4F67A 3NS1A 5H1SQ 3KMSA 2UUBK 5CYMA 3ZDBA 5KFZA 3KOAA 3AY9A 3TAMA 2AHOB 4JI6J 2OMLA 1Q7LB 3DOKB 3OSNA 4F36A 3QJPA 3K2PA 4EBEA 5AQXA 3Q8KA 2QEXN 3VCDA 5AQZA 4M5LA 4KO0A 2A6AA 2X1BA 1JL1A 3CDBA 4ZP8A 5J1PA 4R0JA 1BMQB 4I2DA 1UA0A 4WJBA 1NGIA 2F40A 4WYWA 2WUSA 2OEJA 3AVMA 3M30A 3RBDA 1NI3A 2QB0A 4Y2XA 3D2SA 1Q46A 4ZJQA 3HMJG 1BL3A 4MDBA 2IHNA 3WK8A 1RTDA 3FVYA 2DH9A 2CJYB 1DJ0A 2F1HA 3KKAC 2YHYA 3MGIA 5J1EA 2YKPA 2NO4A 3AJ1A 4JKEA 9ICBA 3ZZ0A 2HNDB 2Z30B 5ETOA 1RCHA 4ED5A 1LV5A 9ICOA 4NM2A 1PKUA 5IQ6A 3LUYA 4GO5X 5HMZA 4JI1K 1S99A 2DO4A 3BQ1A 1U8WA 2PFOA 3CDUA 2IVNA 1TYQA 2H5XA 4WXWA 3CCJN 4ZCLA 2IBKA 4CJRA 3G6VA 3W66A 1J5EF 3MAAB 4A8XA 3CD7A 4H8KA 1QZ6A 3IHQB 3OVBA 5JVGL 2P9KA 4AYBC 2OD6A 3BN7A 4PUOB 1N5TA 3I56N 2B4OA 2HHWA 4ZLNA 2DGTA 5F9NA 2E7VA 3HW8A 2HHHF 3AODA 2FHMA 1JLGA 4JBCA 1QHAA 4NZ7A 4QS7A 3T1HF 1B92A 2ZGYA 5DDRC 2C22A 1IJFB 2R7YA 2OJ3A 1JXBA 1K8KB 2GS8A 3M9OB 1RCXB 3DRPB 1CC8A 1AT1B 4O4GB 2DPIA 1UZDA 4G65A 3VQ8A 3OFFA 3F44A 3B4MA 3HHLA 1WD6A 5AHXA 1T6CA 3DAWA 3HKZC 5H9EJ 1S9EA 1MWMA 1SS6A 3CJ8A 2E9TA 4CJ4A 2I8EA 4DV7J 7ICFA 1W2BR 1ZQBA 2VQFJ 4CIFA 1QS4A 3QPIA 1FESA 2GVZB 2MKJA 2E8MA 1BQNB 3CG7A 3K75D 4F5QA 2DY1A 1NM2A 2NRZA 2A1JB 1VHIA 4BG8A 3FJ2A 4F4ZA 4NYPA 1RDAA 3RJGA 4NLPA 3WKCA 2KEYA 1J97A 1PILA 4QZHA 3RMCA 2WOMA 3C21A 4NA3A 1FJGJ 1F6TA 2RQKA 2QIFA 3Q8RB 1DEJA 4LF5J 4OHYA 3OPXA 4CDGA 5ALDA 4QZIA 2MKHA 3UQ2A 1UT5A 4FZMA 1BU6O 3HILA 5KG0A 4ZN1A 2BKOA 2ZKUA 3PX4A 1CJTA 1K5OA 4C98A 1IR2A 1S6PB 1N4LA 4M7YA 1U04A 2ABYA 1X4GA 4DL2A 5DRKA 2YY6A 4RW7A 5EWEA 4DR2F 4DQQA 2E5JA 1NDCA 3RFAA 5G5GA 1X2IA 4ECUA 4QIEA 5CY4A 3SSRA 2K4EA 4ES3A 4JS4A 4IRCA 2EFQA 2NZ4A 2WVEA 2V4QA 1TL7B 8ICBA 1YTAA 4NLWA 4PWDA 4OYOA 1JIHA 5ALNA 5LOQA 4NYNA 4RQ8A 2YQ1A 4A48A 1APSA 5B0CA 4RQ2A 5C2DA 4F26A 2N7CA 4PKGA 2K60A 4J9NA 3K5OA 1WUDA 2ALZA 2XMTA 3S3NA 3PNIA 4KPYA 3OXGA 2O8DB 2XWXA 2QLFB 3SDEB 2UP1A 1S0OA 4ERDA 2ZBRA 4NCBA 2VJ5A 1ZQVA 4IQMA 2BDUA 4LR9A 3OS2A 1K47A 3WDOA 4CFCA 5KPTA 4AXIA 3MN5A 5E3AA 4KHUA 1VQ9S 3PSIA 3LP0A 2DNKA 1T9WA 4GVBA 3FRYA 3L8BA 3KK7A 2O66A 4M6WB 3NWRA 2GX9A 2XGPA 3C14B 4XA5A 1SWVA 3LP2A 4IH5A 4ED3A 3U1MA 2Y0SF 4RQ1A 5AQWA 1XK8A 5LL6d 2HGNA 5KG5A 3ILOA 4LSLA 5AKEA 3VZHA 1X5OA 2F8MA 2HBZB 1Y64A 2ZHAA 4NMXA 5SUHA 4WQ5C 2R2TA 5EOZA 2GAGC 1OJ4A 4RW9B 5AFUH 2XZDB 4CJ3A 2GO8A 3FAHA 3AQEA 4J9SA 1S8OA 4UT4A 2B7CB 3KJQB 4AHSA 4ZOHC 2BCSA 3D5MA 3G8TA 3ZT1A 1ROFA 1RGVA 1CXUA 4HTIA 3M1VA 1V9OA 5AKZA 1VSFA 3K0SA 1RT4B 3BS7A 2F1FA 5CXTA 4FJLA 5FP0A 3U1NA 2OEKA 3AVJA 3BO2A 1S77D 4BE2A 2C3OA 2H4YB 3DJCA 2G8KA 4DSLA 4M5KA 5E3RA 4FPIA 1FDBA 3QFUA 1BPXA 2I6WA 3RUBL 3IRUA 4YNQA 4OI2A 3DRSB 2RQ4A 3VGSA 3Q24A 2OTJS 5C25B 2KZMA 4UBBA 3A8IA 2I5JA 2XSFA 4NLOA 5LT5A 4CJQA 3THYA 4TNOA 4B1YB 1IBKJ 3TTCA 1EWQA 3FBCA 3K9JA 3KLHB 4DUYJ 2PA8D 1NWKA 2CNKB 1WOOA 1JJ4A 3PR4A 4JK7A 4P4OA 2XYPB 4JD2A 1QE1A 4KTQA 3AAPA 3MEGB 3HFKA 4RQ0A 4ISFA 3WQTA 1OY9A 4DZDA 1HBNA 4GVEA 4ZP9A 4ZVSB 4ZITA 2JLGA 1BHLA 4DU8A 3CJ2A 1K73O 2VBWA 3ZTOA 2KJ9A 1F5SA 5AI8A 1YT3A 2CN1A 2ASDA 5EU7A 5C0YA 4WFNL 3QU9A 3QUCA 3TPQA 1IBLJ 2J8AA 4ED6A 1YJRA 3VPZA 1YBTA 4KT0C 2MGZA 3OYCA 2YHWA 3RJHA 5D6GA 4XH4A 1T05A 1PG5B 4RUHA 4HHJA 3L7UA 3CXCM 5EE9A 2ZIWB 1DTQA 1KKXA 1UFKA 5HVFA 3LPTA 1VQ9N 4JI0J 1Q3VA 3O3GA 2A42A 2EC2A 3HI9A 5BXIA 4ZVOB 2E1FA 5AQYA 4HTUA 4I2PA 1JCGA 2VIXA 1P8GA 3ISDA 3C28A 2UV8A 4N8OA 4ZIWA 1DRGA 4FYWB 2Z2YB 3HPHA 4DKWA 1UTAA 3TZYA 3KOOA 1WBDA 4ZN3A 2O6KA 3K57A 1OYDA 2IPOB 4F04B 1ZM4A 5H9FK 3FSYA 3Q7CA 4BGDA 4IL6U 1RDDA 3WIVA 1SH3A 2F7TA 4OKKA 1C1BB 3PCOB 4UW9A 1BIUA 5IILA 2AW0A 3C95A 3D6JA 1SJ3P 5GADI 3IMXA 1YXQA 3DNCA 2OD4A 3H1VX 2QXFA 4C0ZA 5BR8K 1JKHA 2M5YA 3E66A 2WHOA 2M9KA 3D2FB 1HLWA 4FWNA 1PJ6A 2RU3A 4DPWA 2LQ9A 4IOAL 4KPCA 4R66A 4Y2QA 1OPIA 2MA1A 7ICUA 2VU5A 4JI2F 5F8HA 1NRKA 2OTJN 4EIAA 4PGQA 4G9BA 4IR1A 4DFDA 2F4VK 1XU4A 1W9HA 3WKBA 2BJ8A 2CDRB 3VZIA 2EAOA 5KG6A 1UCVA 1ZBIA 4ZJLA 5J0UA 2BPFA 2NXNA 1O1WA 4A8YA 2E8NA 3P6YC 1IKXA 1WEXA 4L3NA 4LSNB 3PACA 3GONA 3CRXA 2E5IA 4IFEA 5A0LA 3QUQA 3TZWA 1N63A 5CA7A 2NXCA 1RWXB 1V5IB 4BVOA 1J5OA 1RK8A 3ZSWA 1BUXA 3QWUA 4K4ZA 2DD8S 1YVNA 4W92B 1BNPA 5J2FA 1M1GA 3FZ2A 2ZIXA 4Q44A 4FZVA 3H42A 3JAMO 3G82A 3MPYA 3ZZPA 5GVQA 3BO4A 3GJSB 4YHHJ 1XUPO 2CJ9A 3M6ZA 2LYAA 4DL3A 3DOKA 2LMRA 3M8YA 3E58A 4TLRA 2FSNA 4QU6A 3KLIA 1YHQS 3W2WA 1JB0C 3MK6A 3O9RA 3EJMA 1X5TA 1HARA 3GSDA 4IDKB 2KIWA 3IBPA 2FVRA 4IQXA 4WZMA 4FZZA 4KRFA 1N5YB 3Q7BA 3CCVS 5HP1B 4CEQA 2BX6A 3EMTA 2VFRA 5C12A 4JI3F 2R7SA 1XO0A 2AMCB 2WSEC 1FWPA 5RUBA 4B3MF 2E2NA 4FLVA 3G4SS 2LEBA 3TI0A 3AHPA 3VV2B 1Z00B 4CJUA 2BCUA 4A2AA 3M8PA 4CH1A 4HH1A 1QVGM 5ALOA 4B3OB 2HS3A 3T1YJ 5BRFA 4DCJB 2CPHA 2HNDA 1BA0A 2BE7D 4Q8EA 2DY4A 3H6EA 1NGBA 3DU5A 3O8MA 4W5NA 2RRBA 5K8NA 4ZPWR 5J0XA 3A3PB 1S49A 1RE1B 2E9RX 5AE1A 2XHWA 3A2FA 4CHOA 1YDLA 1IN0A 4RL1A 2B6GA 2C42A 1YRUA 3GYGA 2KJVA 1KVJA 4DSJA 1TU0B 2BYCA 3RR8A 2CZ9A 1K1SA 2UXBJ 1HUZA 3MAAA 2R7XA 4RPXA 4N77A 4OZ5A 4ALZA 5FLXU 3DGPA 1TK5A 4PUOA 1RAHB 3KDOA 1ZTTA 5FRNA 3Q8VA 3GIJA 1HWUA 3I5BA 5IT0A 4G1QA 4YOWA 5KFNA 2N4DA 1AA1B 4IQTA 3BREA 4OJ6A 1FFVA 2K8BB 2R7WA 2XLIA 5CYQA 3DRPA 2NYVA 3QAEA 1Z2LA 4KLMA 1MU2B 2O1PA 2PSZA 2F8TA 2EFGA 1DGJA 1A5VA 3ZTSA 4JYAJ 2X74A 3CO0P 2GWJA 4I2QB 2B4VA 3O9TA 3Q8QB 3AFGA 3ID8A 3RMDA 3KKAA 2CXEA 4FJGA 4CE9A 4H5RA 5FDLB 1F0MA 4BJQA 5AM0A 5CYJA 2CQ3A 3QRPA 3OUYB 4US8A 4RO0A 3CE8A 2XI9A 3LZJA 1YJNN 1WKLA 4OI6A 4H0XB 4LREA 5LSOA 2D7SA 4OX9F 2E1EA 1VYAA 2JZBB 4FZLA 3I9V9 2GVZA 4DV1K 3BBFA 1BQNA 2DCUB 2AYBA 2CQ4A 4Y0FA 1M5KC 4RR5A 1N88A 3ZT0A 4CCHA 2RRNA 1XNRF 2VFVA 3AA4A 1FD2A 4RUCA 1AYEA 1NMDA 1YHQN 3MDAA 2XQCA 3OYLA 4LF4J 2ZVSA 2V8HA 1CBKA 1X6JA 1VC5A 2ZZTA 4N41A 1UFWA 2P6UA 1NMNA 2W7AA 1RHMB 2LU2A 3ASMA 3CCVN 4ISEA 3SR6A 2CAJA 5JU5A 2HQFA 3G4SN 4FCYA 1K8AO 4USUA 2PA3A 2EQYA 4K5RA 1QSLA 1S6PA 1A77A 1KQQA 4NI2A 1CLFA 4BDYA 5LMNK 1HJOA 2A6MA 1URJA 3AOCA 3DN9A 2ZJPL 5B66U 4WCEQ 3BSNA 3AVCA 2MHNA 4J8FA 4AQYK 1TL7A 1B7FA 1RBTA 1RDCA 2X3GA 2GQQA 2R8HA 3MFIA 4KX3A 3RB6A 1DGSA 4GNIA 3ZT2A 4AYBF 2F8HA 3NAIA 3IBWA 2ATLA 3BBCA 3SMPA 1QY7A 4EEYA 4DV4J 4QYZK 4FLTA 1VQNS 1ZM9A 5L39A 2O8DA 3SDEA 5HLFB 4QZGA 4KLIA 3VAHA 4W5OA 2HZAA 2EPIA 4UB2A 2E6LA 4JWNA 1E6YB 4NLKA 4YQWA 3JQJA 2NYHA 2AJ1A 1N5SA 1TKTB 3QB0A 2O01C 4NLTA 1UOCA 1Q9YA 3PO4A 3HKZF 4J9RA 2BBEA 2BGGA 3C2LA 1WSIA 4M6WA 2DF4B 1JN3A 1FO4A 2AJFE 1RBUA 1SIWB 3FC9A 3DRRB 3DDIA 3OYJA 1ICEB 5D0HA 4CHYA 2DQNB 2H5JB 3K9KA 1WSJA 3F9KA 4RW9A 4OZ3A 2MLXA 4U6PA 3HT0A 2NNWA 1SJ1A 4JV5J 3QZ8A 2WRMA 4BE1A 4TQRA 1Q79A 2YWEA 5LM7E 4F2SA 8ICZA 1WOQA 3CCES 2OYQA 1IR0A 4OV1A 1UQVA 3MXHP 4YEAA 2VG5A 4PRFA 2AWZA 4LF9J 3GILA 4KLUA 3PYFA 3K4GA 1U09A 3CUNA 3OHBA 3MUMP 2I9SA 2EC0A 4FJ8A 2BW7A 1F5AA 3ZZUA 2CQ0A 3EDRB 4IRKA 5LXYA 4CF8A 4IS7A 4OYXA 3DRSA 4C11B 4PQUB 5C25A 4MDAA 4Y2YA 2KL8A 3ZSRA 4E7JA 1WI6A 5FLXY 2LXUA 2DGOA 3SQGA 1BWEA 1NJWA 5AXKA 1A7GE 4P0QB 2DRDA 3B0YA 1Y5IB 1VISA 3F0NA 4BR2A 1H7WA 5B0DA 4WFNQ 1C6VA 3OQ2A 3TA0A 5J0SA 2H1YA 4OJGA 3AQPA 4LF6K 2V7ZA 1RNHA 2HDOA 2DITA 4X64F 5ALMA 2EBGA 3Q8SB 2VL1A 3TEHB 3VQAA 3KHGA 2LEAA 3CJ0A 4WQ5A 3D6HB 1N56A 5AQVA 4QWEA 5DQHA 1DK3A 4YOXA 1RTHA 2AP6A 4YG2A 5EVZA 4U96A 1FDDA 4AFFA 2XY7A 2YJEA 4NXMF 5FRMA 1RBRA 4Y2JA 3J7YI 4CRXA 2IM1A 2XCPA 1GEHA 4N5SA 2OI2A 2IAJB 2W4DA 4DX7A 3M8WA 3QNOA 2UXCF 3LGMA 3AARA 4PR6A 2GVDA 3PM9A 3FCWA 2YHBA 2K4PA 3HSCA 4IZ9A 5ALRA 2AF6A 1U1NA 3WK9A 3QUTA 3OFEA 2G8WA 3JPRA 3BV8A 5ETRA 4ATNA 2WB1C 1Q3UA 4JI2J 3R8EA 2ZIWA 3VERA 3AQFA 3WBZA 1TL1A 5A8WB 4A62A 2HB5A 2FLOA 4A4JA 1V4TA 4W90B 3OXLA 2LMIA 2DR9A 1HI1A 4BY9C 4CJWA 3AA2A 3MPDA 1NHUA 1HHSA 3CJ4A 3HCXA 4LD0A 2EXUA 3ILLA 4NRUA 2IHR1 3M2VA 4R5PA 1BA1A 4RUBA 3TP2A 3GQCA 5A2QY 4CF1A 3PIPQ 3NNCA 4E7IA 3POTB 4CZJA 5AKJA 2CDQA 4JI5J 4IOAQ 2NSCA 2G2OA 2GHPA 1ZQUA 4H5TA 3GU0A 2CG8A 1X3MA 2CJAA 1FF2A 3J7A1 2GWKA 2W2OP 5BYSA 5AJ3K 3ZX2A 3HHKA 4J9KA 4JKBA 4LFBJ 3P31A 3FZBA 4F5NA 5EUHA 2D3OR 2DTUA 1Y11A 4F0MA 3CJ9A 4DU1A 3FSIA 4K43A 1M0SA 2OELA 3CMES 4DTXA 2ZDPA 3D2FA 1RG6A 4OZJA 2ZUGA 3R1LA 1J2NA 2RQCA 2J0QD 5KFYA 3KLFA 5AI9A 1FD8A 3G0ZA 2IOHA 1DQ8A 3GL1A 3D1HA 3PEJA 2HVDA 2M3DA 1U02A 1MROB 4B9TA 4Z4EA 3HHDA 4NEYA 3RMAA 2ASLA 1C0GA 4CH7A 2B9XA 1WELA 3HF5A 3C8YA 5IIIA 3HX0A 4DZ6A 3E8OA 4B3MJ 4J03A 3V6HA 3KLGB 3JXOA 3NVWA 2ZBCA 5KPRA 1R8BA 5D0EA 3V81A 4LSNA 2WAQD 1S0MA 3PTWA 4DSFA 1F3FA 3KKRA 1NK8A 2RDJA 2VBZA 4CM2A 4H4MA 5KL8B 3DLKB 3I5AA 4KX5A 4TUQA 5ETSA 1JNRB 2OH2A 1MC8A 3HBTA 1S5ZA 1ZQIA 4CLZA 3FR0A 3N7SC 1WKKA 2MDAA 2DIUA 4JLHA 4KB1A 1HI0P 2F3NA 3CERA 3ULDA 2V2KA 5M2UA 3WEEB 4BS2A 4YB6A 5KFJA 2J8SA 2DGZA 4DN9A 2HNYB 4FW2A 3BGRA 1BWVA 3A0BU 3I55S 3CJ5A 2QLTA 4OMFG 4QWBA 4J9VA 4A46A 3IKMA 3MX5A 3OL8A 3AVHA 1IG9A 1KQSR 3SPYA 4ELVA 1FCAA 4IDKA 3ZZRA 2QSFA 1JLFB 3OLAA 4F4YA 1FWKA 4USIA 1GTEA 1N36F 5HP1A 2RMLA 3TVYA 2IS3A 4KE5A 2D6FC 2J5AA 3EGZA 2YMQA 2HOIA 4CO3A 1PVRA 2AIRB 1FE4A 1Z00A 3UDCA 4DR1K 1KVIA 1XJWB 2NXJA 4A8QA 3C5GA 4B3OA 3ZTPA 2O8EA 3TJ9A 1B0XA 9ICEA 3SIPB 4PL8A 1KC8O 3QMLA 1ZM2A 4ISGA 3EL2A 2QT7A 3CPWR 1VQMN 4FE3A 2IRXA 2K7JA 3H8WA 3QINA 4DR7J 1FKPB 3CNHA 1CI4A 1CSJA 3VGUA 4ZS6A 1NO8A 4O23A 1ZD5A 3RRKA 5KT3A 1SJRA 4L3KA 3MR6A 4IDHA 3LVWA 3DMJB 3CMEN 4C1NI 1ZQEA 2F5GA 4UOCA 4C0BA 3VGLA 4V1Ak 4OX6A 3H5UA 3TAFA 3IM9A 3VR1A 3W9HA 4P4PA 1HNXK 1CJVB 4YDUA 1VQPS 3DRXA 4WE1B 4JI8J 4RWTA 1GK8A 3H90A 5EE3A 1R0AB 4F3TA 5EWGA 1QCKA 3NGZA 1AB8A 5D46A 1VAZA 4JMUA 5KFQA 2QA4G 4K42A 4CJSA 1GO3F 4CYUA 4CEFA 4RBVA 4FVMA 4EP4A 2OA8A 1FE0A 2VCPA 3LDQA 1TV6B 3BKTA 5KG7A 4F02A 4CLWA 2PN6A 1RHRB 1J9AA 2EKYA 4ZCIA 4DPYA 1FKOB 1TZ0A 2RDDA 5F1XA 2EDUA 3W9JA 1BI4B 1EB0A 5J2PA 4A57A 3DXBA 1WF2A 3AH6A 1CXQA 1ZJMA 1HR0K 3D9BA 3H5XA 4F3OA 3DDHA 5DBAA 4LF7F 1VBZA 2XI3A 1P1LA 3H1QA 4F3QA 3PKYA 2E5SA 4LQ9A 3C1YA 3R1XA 3HPOA 4ANCA 3VA0A 3I55N 2UUBF 1WYGA 1YKWA 2GHWA 3FK4A 1YWXA 3I87A 5JTIA 1VK8A 3J7AP 3H2VE 3SI8A 4CI0B 4UW2A 3IUCA 1PK3A 4J9QA 3SBTA 4RW8B 4DSIA 1Q1KA 1VDVA 3TR8A 4X4RA 3PY8A 5AQIA 1U0HB 5F0XA 3I6PA 4USHA 2MZSA 1H0HB 4KI6A 3QRQA 4B9NA 1OS5A 1RJJA 1K8AT 4HAIA 4OIXA 4USKA 1LB2B 3C29A 1RABB 2NS1B 2M70A 3CD6S 5GAGP 3CYMA 3OTQA 1NBEB 4HLBA 9ICUA 1ZQAA 2X6NA 2ZH9A 4M9LA 3D2EB 4YR2A 3J80U 2WMMA 3PSTA 2F4FA 3ZZTA 4ZOSA 4Y3CA 3TZZA 5DDOC 3PNCA 2DISA 3JPSA 2QX0A 3NXZA 4Y2KA 4UAUA 2F8LA 3A3OB 3NRWA 5C7PA 1VQLS 4JI1F 3N7RC 2GMHA 2DFHA 3FLCO 3QEBZ 3ZDEA 1R31A 3LGHA 5M2RA 3LDAA 1CJKB 3AM9A 4KGVB 1T8EA 3OT9A 3VMFB 3L2RA 4C2MA 3LZIA 4IO9L 5IIKA 5HLFA 1VQPN 1VQ5S 2KHCA 3MWTA 4O3OA 2IFXA 2M0GB 1RTZA 2Q1NA 4M3UA 4DV3F 4MYTA 2XB2D 1E6YA 2Z2ZA 3RVCA 4X65K 2CJBA 2C3UA 4M5NA 1IWAA 8ICSA 1NK7A 3WQUA 4BC3A 3M6UA 2FGCA 3GE1A 1IG8A 4ID5A 2D0CA 4YY3J 4F4AA 4JI7J 1LAVA 7ICTA 1N52B 2GJ2A 4DL4A 1VRUB 4FZYA 4DX6A 1FVSA 2ODGA 1IH7A 3TQEA 9ICSA 1SCJB 4KGKA 2CQ1A 1RPLA 2GOLA 3DRRA 3MF5A 3GOIA 4I1TA 3QLHB 5A8KB 3TABA 4BWMA 3PYGA 1E6VA 4CT8A 2V7YA 3D2NA 2HEKA 2P9LA 5LMUK 4DTSA 4WFBL 4QR2A 4Q8FA 2PKEA 3QU5A 5KRSA 3A0HU 2HAFA 1ZD2P 4GMJB 3GPAA 2ISOA 1SBRA 3V9UA 1VK0A 1J2VA 4CZHA 3V1RA 2ZQBA 4I9QA 2FQQB 1HQEA 4ACOA 3T41A 1X40A 2QWRA 4DR3K 1YX2A 2V67A 1H2TZ 5E0OA 1HA1A 4DPTA 4BRQA 2Z1GA 2L41A 2ZC3A 2HQDA 4Q43A 3HVAA 3ATVA 5DETA 3OGUA 3QE9Y 2CFXA 3OVSA 4CWBA 2GIFA 2F77X 3RJFA 5CQGA 3M4XA 3NGUA 2NR0A 4C48A 3JTOA 3CD6N 4WKYA 1NLKL 4ZVEA 2YH1A 1CC7A 3AVKA 3K7RA 4DR4J 3DXMB 4MAKA 5IS2A 1S1TA 4TU7A 3QAUA 1F9FA 3D1QA 3K59A 2W4PA 2LKYA 2BCRA 5AXNA 1C1CB 2GHVC 5IV4A 5K8OA 2H51B 3HI0A 3PUFA 1NCLA 3ENVA 1NH8A 3GIKA 4G6VB 4NYOA 2ASPA 1VQLN 1YI2N 5GAEP 1VSJA 4NLNA 2WBNA 7ICKA 2RJZA 2GC8A 4DHVA 2FMSA 2IC3A 1XC9A 2HQIA 2RLTA 2UXDJ 1RILA 4DR5J 1LNQA 5ITHA 4M1KA 2GO9A 1U9LA 3ZX0A 3VCBA 1S22A 3G6XA 2ZWHA 4ZVUB 2KT3A 3CJAA 1KTQA 5HQMA 1Y5LB 2KG5A 3GJRB 1G15A 5GAEU 4M9JA 4NL5A 4EO6A 4B8CA 4NWIA 2KZZA 4MLHA 2BANB 4L74A 1XS9D 2DYAA 2GQ2A 4YXJA 4DQSA 3SQ0A 2ZWOA 2FTRA 1WJ9A 5IT9Y 1SH0A 3AD7C 1BY9A 2YNIB 1DARA 5B0AA 4DV0J 3KLVA 8AT1B 2XICA 4F91B 5F8LA 9ICRA 2V5HG 3Q23A 4OI0A 3P45B 3BEGB 3WXJA 2EFVA 3KUHA 1JJ2M 4Y34A 4UOHA 1IKYB 1CS4A 2A1RA 3AO1A 1N61A 5B5EU 3DLGB 8ICFA 3I0RA 4RW4A 5BN9A 3NUQA 3A5LC 2A2DA 1U2VB 1RBOB 4Z4IA 2KFZA 8ICQA 2I38A 5E3CA 4TLQA 1H7XA 2C2DA 3P8BB 4KMUA 4KN7A 2YY3A 4CEBA 4MFBB 4UQTA 1MROA 1TMMA 3VF6A 5IWAJ 4LZGA 1PYTA 1T95A 4E19A 1TVRB 1WLJA 2WSFC 1RT3B 2BM1A 3W60A 1V5VA 2D3O1 4WJ3B 1WSGA 1NU0A 1B9FA 4F4KA 4PHEA 4ANDA 5HR6A 1HL6A 4PHTX 3PW4A 2O8CB 4OI4A 1NNEA 1P7DA 3CJCA 4HYKA 1SL1A 3MEDB 1OH6A 1VQKS 2FBTA 3EY1A 4C8YA 5AICA 4CZGA 4F2RA 5ALLA 2CGLA 2Z57B 1Q82T 1NMEB 1CULB 2OCEA 2YWFA 4ZHRA 3I4PA 2CVEA 4P10A 2I6XA 7ICGA 2XRIA 1EP4A 4QW9A 4XIUA 3WU2U 3BGUA 2CPXA 3WEEA 4CW7B 3L09A 4C0HA 3JS9A 2KJ5A 3OYAA 3UR3C 3IN5A 3AO3A 2WB1F 5I42B 1MMNA 4CLKA 3NCQA 1XI1A 4F0KA 3AO4A 2KT5A 1T7PA 4O8UA 3OYFA 1GNKA 1HUOA 2G09A 5DO2A 3MAHA 4FS2A 3SD7A 1UVIA 3UO0A 3ZEUB 1SVDA 1JLFA 4K4IA 2KYXA 2Q3SA 2BQ3A 2IJNA 3TRGA 1R89A 2VWBA 2DNMA 1ZOLA 3MEKA 4YB7A 1ZQMA 2W42A 4QZ9A 2DHHA 3TO8A 1HBMB 3ZZYA 3QEXA 2R8JA 4ZTJA 1G1XA 2UUAF 5JRTA 1HYVA 3CJKB 3RW6A 4B8AB 3HZ6A 1C0UA 3DM2B 4KIAA 4M2YA 1N48A 4UBCA 1KC8T 3GDQA 2LVWA 2G8IA 3N4WA 4DTUA 1KEJA 1S7HA 2B56A 1FKPA 8ICRA 2QM1A 2KLAA 3TSPA 2LKZA 4H0VB 4O5FA 1VI7A 1PBUA 3DMJA 4Q7AA 1P6TA 4CJPA 3CC2S 5ALKA 4FPBA 3BQ2A 3AMZA 5C24B 4F9OA 1YLXA 3PYDA 4LZDA 3BSOA 4LQ3A 3FBFA 4IQUA 5FLXO 1HEKA 5BR8F 3QJLA 4JK9A 2YX8A 4HT5A 1RFQA 1SJFA 1CJVA 4WE1A 1D09B 1RWWB 3QYPA 1MWYA 3PXGa 1TK8A 1FIQA 2JEFA 2YNGB 2BV3A 4NCGB 5CZ2A 3QT6A 4TKTA 4CZFA 5CRXA 4BXOB 2F4VF 1UA1A 2FYXA 5ALEA 3NEKA 4RT3A 4M5DA 2EI5A 2FMPA 1TV6A 3FYHA 1XERA 1VJ5A 1VQKN 4A5AA 2VDHA 1G7CB 3GZFA 4LFAF 4V19X 4MH8A 4UB4A 1FKOA 2VFSA 1QQMA 3UWTA 4DQ8A 1BI4A 3L2WA 2YWHA 3BPSP 2LQ5A 2GW8A 1XR7A 4UATA 1U2FA 1S9GB 5AKXA 1JMTA 3B9JA 4BUGA 4IYQA 3THVA 4DCCA 4FWOA 4B3SK 4FOIA 4BDPA 3OL9A 1AUDA 1SGGA 2B6AA 1HFEL 2O67A 4H5NA 4CGJA 3MX2A 1RHJB 2OFHX 3NF7A 1YQHA 1JMSA 2OXOA 5HRPA 3OBIA 3PZPA 4ZKAA 3CDWA 2JEJA 4USTA 4X4NA 3E9LA 3QU7A 2BDPA 4RW8A 5KFIA 2YHAA 3Q2SC 4DTOA 2KHQA 2OZMA 2DEIA 1VQYA 2DTJA 2UU9K 1U0HA 4I2JA 2LP4A 2XI2A 2LDYA 3D2QA 4Z7YA 5A2QO 3I33A 2W3RA 4EUVA 1GMWA 1YG0A 4B9QA 3TZXA 2BTFA 1YZ6A 3TARA 2C2ZB 2LDIA 4M04A 1HYSB 1XSNA 2FJXA 3KVGA 4NLSA 4I2CA 4E2FB 3D2EA 4R8UB 2W9BB 4FNHA 3B8AX 2YWKA 2JWLA 4BR9A 3JYTA 1NJZA 1IR1A 2OSRA 3UVJA 2R2UA 2DGQA 3QEWA 4DV6J 4K4HA 4CF2A 4US9A 1ZZNA 4E7HA 5JJBA 4U9RA 4DDFA 1BCOA 1HJRA 1BO5O 3V6JA 3F56A 2VC0A 3CC2N 4X2BA 2HMIB 5LJWA 4EX6A 1CJKA 2IOFA 3VGKA 1C2PA 4Y2UA 5JVHL 3KNAA 3T5LA 4M41A 2RAQA 2CVIA 5B09A 4B3TK 4NRTA 5D4OA 5M2PA 3LDNA 1W97L 4UY8O 4ECTA 1SXDA 3JSMB 4OYPA 1M5OC 4H0TB 4Z6DA 1TL4A 4J2DA 2GZOA 5GAHU 1PK1A 4DV5J 3Q8YA 3HVTA 1MA7A 4E1JA 4I2EA 1HQ2A 3ISNC 2WF7A 2PFFB 1B4SA 4FL9A 3R5CA 2P51A 1VRUA 3CQ8A 2KKHA 3V6DB 2BPGA 1HRHA 4AE5A 3K8VA 2J9DA 4JB3A 2MUTB 3QLHA 3QSIA 4CGIA 1N62A 4YVZA 5EWFA 2OFGX 1FDNA 2ETJA 3NVMA 4OHWA 1WNEA 3MEEB 1NNLA 3NBPB 4O44B 1WI8A 1SJ4P 3HULA 3W5YA 1FXRA 2KM8B 4KV8B 3V5RA 4QPTA 5BJRA 4DV1F 2B5JB 3EUB2 5DBCA 5KFEA 1JXLA 4KI4A 3FBBA 2O3DA 1SXEA 5IZHA 1RT6B 3IM8A 2C2EA 4KHMA 2EZXA 2QLWA 2XHBA 4KLDA 4F5PA 4DV2K 5KG3A 2W24A 2K8CB 3EGVA 5ETNA 2GTDA 3CCZA 2QMUB 4P2XA 4HVZA 4P9SA 2KKZA 3ALRA 2DKXA 2VKRA 1ASWA 1PJ7A 3FSXA 3OHRA 4AHRA 4CD1A 2GQCA 4MK7A 4K0KJ 5C2FA 1XR6A 2DHSA 4AHUA 3OTOK 1S0VA 4DMZA 5CZVA 3KHRA 1UW9A 3MD3A 1PC4A 5C15A 4EFHA 5DDQC 4BBYA 4IOBA 1XHZA 2VJ4A 2WONB 1GLBG 4BRGA 3FUYA 4FJNA 3AJDA 2GIRA 3AOAA 3GV7B 1I39A 4OFZA 2HOEA 1URNA 1ZTWA 5TISU 1D9DA 2DRBA 1HKCA 3V72A 4CLYA 5GINA 1FI4A 2XO7A 3WIUA 3IDWA 3C7NB 3HHLD 3DLBA 3VGMA 1L5UA 4TU9A 1NPRA 5KFLA 2CPDA 2W2PP 3CGIA 1O5JA 1S6UA 2DH7A 2OLWA 2WVDA 3IDHA 2XO6A 3MM7B 2ZIUA 2P9NA 2PYLA 5K20B 2O4IA 4CO2A 1NNDA 1XMQK 4X62J 2YJFA 4FO6A 4ZH4A 1RISA 1NGJA 4OJPA 1RA6A 3HT3A 2W7PA 3BGOP 1HNWJ 2BANA 1C1AA 2V34A 3NVZA 5AK4A 2X3DA 1ATNA 3R9KA 4NLBA 1ZH5A 3N5BA 3R9LA 4I56A 3MR7A 5AQHA 1XNSA 4IC9A 1BQMA 2YNIA 2DR7A 1L7PA 1TR0A 1ZBTA 2K4HA 5J0PA 2DXEA 1VGYA 2FJAB 2VJUA 1BCMA 2CQCA 2DNZA 1UZHA 3HSDA 1MQ3A 4KHPK 4JI3K 3I0SB 4ZP6A 5BYRA 1H38A 2WVCA 3CPWM 4ILJA 2G8HA 5AQUA 1NJXA 3D68A 3CSKA 4DCHA 4U7UD 1OQ3A 3TSQA 4LFCJ 1DGKN 3R6LB 3K1ZA 1IKYA 2G9OA 4OKEA 3MMCB 4NL9C 2W9CA 2BEFA 4X4OA 3DLGA 1VDHA 4R0EA 5IV3A 1X60A 2Z4PA 4J9MA 4P0PB 2QJ3A 3O8WA 1B43A 1XWLA 1FK9A 5T41A