4CE6A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
total genus 84
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4ce6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ce6A01
3UM9A 1MH9A 1Z4JA 4EX7A 3KBBA 1Z4NA 2ZBFA 3MN1A 4UW9A 3ZU6A 5AICA 1Z88A 2HOQA 1K1EA 5ALUA 2JGAA 3PCTA 2CFRA 3HLTA 2G09A 4Y2RA 1QYIA 3FPSA 3SKYA 1XP5A 2FUEA 2R8YA 3E84A 3A3YA 2AGVA 3N1UA 2MU1A 4L6CA 1NNLA 4JDPA 4Y2UA 5ALNA 1N8NA 3WGUA 2PQ0A 3AR2A 2OA0A 5AI8A 2IOFA 2AUTA 4YIHA 1EK2A 3KOOA 1RLMA 4DFDA 2G08A 4YCNA 5ALOA 4Y3UA 1PW5A 2ZG6A 3U19A 4O8CA 2ZOSA 4NABA 2G07A 4EZEA 4EELA 4BNDB 3ESQA 5AW5A 3W5AA 3N28A 3L1VA 4NV0A 3NASA 3ZVLA 4BKMA 1RMQA 1U2TA 4MWOA 2YJ6A 3ZUPA 1TJ3A 4XOUA 4HGOA 5AW2A 5AKXA 3M1YA 2IA5A 3GYGA 4BBJA 2WF8A 3UMGA 2R8XA 5AK3A 3DV9A 3WKCA 2MU2A 4QQFA 4E88A 3I28A 2B82A 1RQNA 3R4CA 1RKQA 3OPXA 2B1QA 5AHXA 1EK1A 4B6JA 4YCLA 3AR5A 3I1YA 3L8FA 2QLTA 1RMTA 4CF3A 3QNMA 5ALWA 5A3SA 5ALJA 1Y8AA 4BX3A 2FPUA 3DAOA 3BA6A 1ZOLA 4KX5A 3QUBA 1O03A 2C88A 5AK5A 1ZRNA 3WKBA 4UARA 3FM9A 3B8EA 2I34A 1YS9A 2Q4RA 2C8KA 2QYHA 3L0BA 3AR6A 4L6AA 4G9BA 2GHQA 5A3RA 5AIAA 1Z5GA 1RKVA 1IWOA 5IS2A 3L8GA 5AW6A 5ALRA 3QU9A 3ZTYA 1X42A 5ALZA 2JAUA 2YBDA 2FPWA 4BX0A 1Z4KA 2HF2A 3A1CA 2GO7A 2HEGA 2W43A 4UMDA 2DQSA 1L7NA 2P11A 5AKHA 4C4TA 2FDRA 5AM1A 3DNPA 3L1UA 3ED5A 4HYTA 1QH9A 2JARA 1ZS9A 4F71A 3E81A 2FPRA 4YCMA 3CNHA 3L0YA 2OM6A 3MC1A 2MSNA 5AIBA 2FEAA 1N9KA 3U26A 5AW8A 5AKKA 1ZD4A 5AVVA 4HGRA 4KN8A 3D6JA 2YJ3A 3ZI4A 1VJ5A 2WHEA 5ALVA 1T9ZA 2GMWA 3ZWDA 3ZW7A 1L8LA 4C4SA 3WKAA 2NYVA 4HGQA 4UU1A 3WK5A 3QLEA 2RBKA 3R9KA 3OCZA 3ZVMA 4YIKA 3QU7A 1WPGA 3PGVA 3R09A 3NAMA 3SLRA 5AVXA 3N5KA 1RC8A 2ZBGA 3VAYA 2G0AA 3AR9A 3NUQA 4I9FA 4DW8A 1FEZA 5E0OA 4BYGA 5AI0A 1RRCA 3WK6A 3ZTWA 2FI1A 2GFHA 2YJ4A 2I55A 3BWVA 2C9MA 4G63A 3OCUA 3OCYA 3AR4A 3N8GA 2YMMA 2WF5A 3EF0A 2YMQA 3A1EA 1AQ6A 3S6JA 5AM3A 5ALSA 3WKEA 1RDFA 1WR8A 3SF0A 2IYEA 4BNDA 4UU0A 2ODAA 2WF9A 4DCCA 4IG4A 3ONNA 2YJ5A 2ZBDA 3RF6A 3OTQA 3ZX4A 4UMEA 2BDEA 3PGLA 5AVZA 4BEVA 5AM0A 4XPZA 2FPSA 2NO4A 1ZD5A 2ZBEA 3U7GA 4ZEVA 4J2TA 5JJBA 2WFAA 4IFTA 1LVHA 5AKGA 3IJ5A 4BEWA 3MMZA 1QQ5A 2R8EA 3ET4A 3A1DA 1QQ6A 2HHLA 1T5SA 3NALA 3SMVA 2HX1A 4OCZA 2RARA 1U7OA 3J7TA 3E58A 5AW1A 4KX3A 5T41A 4CF5A 1L7PA 3KZXA 1ZRMA 3WK9A 2B30A 3FZQA 3KD3A 4OD0A 1O08A 5ALLA 1VFPA 4EX6A 4UM5A 1Z4LA 1SWWA 4UAUA 3SKXA 3UMBA 2JAOA 3B9BA 5AESA 5IT4A 1Z4MA 5AKJA 4UAVA 5AM5A 2FPXA 4GXTA 3MPOA 1Z5UA 2P27A 4KNWA 4L57A 4QJBA 2O9JA 2R8ZA 3L5KA 5AKZA 5ALDA 3EPRA 3N07A 2PKEA 5AI9A 4KNVA 2WF6A 2PR7A 3L8EA 5ALMA 3I76A 3SHQA 3OCWA 1TA0A 4I9GA 1L7MA 1Q92A 3AR7A 4FYPA 4H1WA 3F9RA 5AW4A 1Q91A 4UATA 5AVWA 3DDHA 5FP0A 4RETA 4AS2A 4CE6A 1KYTA 5ALXA 2VKQA 2HCFA 2CN1A 3QU2A 5AM2A 3AR3A 3QU5A 3FPBA 3L8HA 2WM8A 2WF7A 3W5DA 1RKUA 3L0CA 1Z4PX 3UMCA 4FE3A 2EARA 5A3QA 3FGOA 4NFLA 2RB5A 2BY4A 2B0CA 4AP9A 3QYPA 1ZJJA 4JB3A 5ALHA 1J97A 4OFZA 4KYTA 4GIBA 4F72A 3U7HB 3HYCA 5AW7A 4MUMA 5AI6A 2HO4A 1WZCA 3M9LA 4CF4A 2CFTA 5AVRA 2AMYA 5ALGA 1TJ4A 1ZD3A 4EENA 5AK4A 1F5SA 1YV9A 4NWIA 5AKEA 4NAVA 4UMFA 3P96A 3NIWA 5AM4A 2G06A 1YMQA 4Y2PA 1U02A 2C4NA 3I6BA 3AR8A 1RQLA 2G80A 3IB6A 1T5TA 2P9JA 1S2OA 5AKIA 2YFYA 1RLOA 3WK4A 2Q4TA 1TE2A 2I6XA 2B8EA 5AK6A 4YGYA 1L7OA 4AS3A 4ZEXA 2C8LA 4ZEWA 3NANA 4XE5A 1S8OA 1YNSA 3U7FB 4Y2SA 3SD7A 1NF2A 3ESRA 1CR6A 4YH1A 1RPZA 5ALFA 2NO5A 5AKYA 3KC2A 2HSZA 2IOFK 4DWOA 1U7PA 3KDPA 4J03A 1XVIA 3EWIA 1L6RA 1U2SA 4UMVA 2Q5EA 2IOHA 2YN4A 3L7YA 2YMPA 3CZ4A 5ALIA 1LTQA 4Y2TA 5AVQA 1Z4OA 1ZD2P 5AI5A 1L8OA 1J8DA 4UM7A 5ALPA 2RAVA 1SU4A 3W5CA 4CNQA 1Z4QA 5AW0A 2I54A 2B1RA 2G1AA 3IRUA 2YY6A 2X4DA 4Y2YA 5ALQA 2I7DA 2FUCA 3E8MA 1JUDA 3ZVNA 5IT0A 4HGNA 2ZXEA 3OCVA 1CQZA 2D2VA 4UASA 5AKLA 1NRWA 3WKDA 3ZWKA 2O2XA 3ET5A 2OYCA 5AW9A 1SWVA 2OBBA 1WVIA 2JAWA 2B8JA 2W11A 3EF1A 4XQ0A 1TJ5A 2BDUA 3NRJA 4OHFA 2EATA 3FVVA 2HI0A 5ALEA 4Y2XA 4PNHA 4Y2JA 1RMYA 3QXGA 3ZX5A 3TLMA 4C4RA 3PDWA 2HDOA 5ALKA 5ALTA 3WK7A 4HAIA 4FFDA 3QGMA 1VJRA 3OCXA 2HF7A 3RFUA 2EAUA 5AVSA 5AW3A 3WK8A 1QQ7A 5AVYA 3QUCA 1RLTA 2GHTA 5ALYA 1YJ5A 3QX7A 1Z4IA 1XPJA 5AI4A 2CFSA 3QUTA 4Y2QA 4EEKA 3U13A 2AH5A 2I33A 3U7EB 5AVTA 2P69A 3K1ZA 3WGVA 3QUQA 2W4MA 4Y2VA 1YDFA 4HGPA 3W5BA 5AVUA 3B9RA 4BX2A 3QU4A 2YMLA 4RESA
chains in the Genus database with same CATH superfamily
1N2OA 1X0XA 2E6KA 5DYWA 1NJSA 1OWNA 3P0IA 5BR8B 2V5VA 1J70A 2C82A 4HVTA 3Q2OA 5CH3A 5DW3A 2O2EA 2YXLA 2HOQA 3UXMA 3VU0A 4PYRA 1XMSA 3VZRA 2F3PA 3E9CA 2JI4A 2LUOA 3DZBA 1GSAA 4YACA 4OYHA 2VLBA 2VSQA 2V6MA 2BEVB 1RLUA 3GWZA 3WRWA 5KG2A 2FUEA 4Q3NA 4LHSA 2ZYHA 2HKIA 2I2BA 4E7OA 2IGTA 5I3CA 2GJAA 2H3HA 3BK7A 4ZCPA 4AKSA 1SBTA 4B6EA 4NEQA 5A3VA 5B7QA 5JXJA 4L6CA 4XSVA 2ACVA 1RIFA 4Y2UA 1S7GA 5E4JA 3K71B 4C5CA 5CDTA 1PU2A 1RYDA 3M6AA 4PGHA 5CNMA 2PQ0A 3S2YA 3ZHSA 1OT5A 4PYIA 3H3FA 3RVSA 1XTKA 2QM0A 2CXSA 3U6KA 4L07A 1RRGA 5LXTA 2V4ZA 2DUYA 4NZYA 4YAUA 3FFBA 4QZCA 5IAJA 3ZE8A 4DO9A 1M74A 2QI9C 4ZGBA 1QS0B 1MO5A 2YDXA 3ONFA 2ZYRA 3A06A 2CK3A 1JXAA 1YO6A 3GF4A 3KTFA 4OI2A 3PC7A 3ZQUA 3ZJUA 5FTWA 5LP6B 3N8NA 3P26A 4O02B 1P7VA 2AJDA 4W5RA 4KR6A 1ADCA 4QGFA 5BN4A 1PQYA 1F8GA 2IPOA 2VYFA 3C7CB 4I3FA 5LC1A 3ESQA 3B6EA 3IG5A 1OYVA 2P5SA 2YZKA 3EG9A 3HDJA 3NHJA 3E7DA 3G8YA 4H7KA 4ND7A 3M7IA 2FYTA 4WDRA 4QUEA 2JEZA 1YB4A 3PT5A 1VMIA 1VLZA 1RJEA 4EQ6A 3N53A 1E9DA 1TCVA 4NBVA 2Q0QA 3T4UA 3DMFA 3C6MA 1WM1A 4WJLA 4TYMA 1PGQA 2C3MA 3H6KA 4P2GA 4MCIA 3V33A 1I6WA 3DBVO 2BCGY 1KC3A 3QPBA 2ZCJA 4A1FA 2GF2A 4N5DA 4LOAA 1U0GA 2ZPAA 5JR3A 2GLUA 2M98A 1DRGA 2IA5A 3UUWA 1EE9A 1WY5A 1NNEA 5G4KB 4IC9A 5TJ9A 2I65A 2PT7A 2RH8A 2PKWA 4UB3A 3T0GA 3K70C 3H9UA 4UVEA 2MU2A 4Y0VA 3NTOA 1ENYA 4KW7A 4C2BA 5SZJA 1H4QA 3KT8A 1GGFA 1C1YA 3DC7A 4NEGA 3OTOB 2B82A 1RQNA 2QUHA 2FDCA 4IXNA 5KNDD 3RB3A 1UKYA 2WG1A 4TTJA 2C2HA 2P9FA 3NRBA 4B87A 3PFBA 2BFAA 3DMPA 3IG8A 3L1HA 3C5CA 1Y6ZA 4FOLA 1G20A 3P9ZA 4HPWA 4UEJA 5HEKA 5TMEA 3A0HU 3F2VA 4AKIA 2FY8A 5FF9A 3WMEA 4Q02A 2YHBA 4MZDA 4MVJE 4AC9A 1MUUA 3L7OA 4IMPA 3DGEC 4EB6A 1SN7A 2QA5A 5KFXA 2FW9A 4YR2A 4NMLA 3LUGA 1R0SA 4IDAA 4JJ8A 2NSJA 4OBXA 3RJZA 4QARA 1P1HA 2TS1A 1Z82A 3LO5A 4HAYA 4OLJA 1X7DA 4XW2A 3IXMA 2FN4A 5DASA 3TEMA 5ITZA 3MOSA 4J9QA 4AZ0A 3OIDA 4AUNA 1FFHA 2NX2A 3ZHCA 1T25A 3VAZA 5J2HA 2ZB3A 2PU5A 5EMHA 5EIXA 2D4HA 2OCBA 3CURA 3Q85A 3NPMA 4PYQA 2NXCA 3AR6A 1EFRD 5DW0A 5C8DA 1X70A 2GHQA 4GT1A 4P82A 3PNMA 1A7AA 4DYVA 5BWCA 5CCXA 2VBGA 4UD6A 1Y1LA 1Q5PA 1JIIA 1JHDA 1TF7A 4INZA 4Z4GA 2CHVA 3FR8A 1GNLA 3PHGA 4MW9A 1K8XB 2Q3HA 4WW0A 4M9JA 2ZGVA 4HRAA 4QYSA 1I4TD 4WK0B 3DULA 1DOQA 3HFRA 4XSGA 2DKZA 4WINA 3L7KA 2NNWB 4Z0TA 2YZNA 1IG3A 2QF7A 2B2CA 2I6FA 2XUPA 2ZUTA 3UGKA 4QVIA 4R6WA 1ZIDA 2HPHA 1QH9A 1TZJA 3E81A 1P39A 3IT0A 3U3RA 3UAWA 1E3TA 4E2ZA 1KQPA 5AJZA 3ORRA 3OT5A 3OTHA 5JZBA 3R0VA 1WVMA 4PPFA 5CW1A 5CK5A 3MR2A 3WLMA 5JNSA 3C39A 2H92A 2F62A 4S1OA 2AFHA 2VJBA 1J1IA 3H4VA 1N2CB 4IX9A 1GDDA 4K8OA 3IDWA 4MQUA 5FBZA 3TBKA 2RKOA 2XNJA 5J2CA 2CVOA 1EUQA 4C8LA 1C0EA 3TCXB 1PIWA 1Z8FA 4BWJA 1BA3A 2XPCA 2F3UA 4U7HA 3W8EA 2XNDA 3AESA 1LA2A 4DBZA 1AF4A 3RHSA 2QTBA 2ZVPX 1TQHA 1WCXA 4C14A 2ZYIA 1R6BX 1QQTA 1X8LA 2P4HX 4D42A 5JAIA 3ESAA 3GI1A 4PRKA 1HETA 1YB5A 1J2EA 3KEFA 3CLRC 3I09A 3OOYA 1VJ1A 2ZT7A 4LOJA 3F6RA 1UBLS 2HJSA 4R9UC 3TZLA 1QH8A 5BSMA 4W5NA 1LZKA 1E6LA 3E70C 2WD7B 4PBSA 5F7ZA 2HU2A 2O0HA 2QZSA 4E32A 4RTKA 4FFVA 1V9PA 3EOBI 5FOSA 1KVTA 4JJ4A 4BLVA 2VAWA 1T4CB 2KQUA 3OHBA 3OMWA 4QOIA 2YHAA 2HSJA 2BFMA 1YTUA 3AVTA 1E2BA 3WDKA 3T3DA 1CWUA 3K9WA 4DR4B 2C9BA 4Y9RA 3N5CA 4XWWA 4BLUA 4B9VA 1KAOA 3MS4A 4PO9A 4EHIA 3ZDRA 1X2IA 1KXJA 3MWFA 3U16A 2I71A 3EWSA 3UK1A 4JVOA 2VDMB 4NNOA 4PG8A 5I7HA 3N8GA 1G4AE 4RIHA 4HTFB 4AYTA 1Q50A 4YVZA 2QTVA 2P4QA 4EY5A 1XLUA 4PL1A 3A1EA 4JOSA 3WAKA 3CUVA 3VZPA 3OBIA 3PW2A 1NW4A 1HSOA 3IA2A 1AKTA 5BW6B 2JEOA 3GN2A 1WMAA 4NG5A 2KJ8A 2BH2A 2QZ9A 4L27A 5EVJA 2PS0A 4BNJA 3KKEA 4DCCA 4KLFA 4XDHA 3W6NA 2I4MA 3BWYA 2W04A 1L4YA 3HKDA 4QDJA 2VH2A 3K2BA 2VBFA 4JVSB 1WO8A 4GPAA 4K86A 5HDBB 3I1JA 1T1SA 3W4KA 3WO0A 1IHDA 2J9YB 1W93A 4G5XA 4BGUA 3F73A 3D6VA 2A30A 2VC2B 3KTAB 3JZAA 3JYOA 3HBLA 2FPSA 2AWNA 1E3EA 3OZGA 4HQKA 5A2GA 3L7DA 3JQAA 8MHTA 4E0DA 3UB2A 4MXDA 4RVFA 4BNHA 4DSZA 4ZEVA 5AR1A 5JJBA 3D8HA 3EZ9A 3QTTA 2BMEA 1RJ9A 3ICXA 4HWKA 1CUXA 1PNOA 3PBKA 3TZQA 2FMSA 1UXJA 4CXMA 5EIAA 3E5NA 4QQNA 1M1ZA 3CCCA 4KN9S 4BJQA 4G0MA 5AVJA 1DL5A 1F2UA 1KHHA 1E2EA 2A57A 2HX1A 3MMNA 5KYYB 4OLAA 3IO5A 1JF8A 1XTPA 3GV0A 1ZY2A 2H54A 3KOXA 4RD1A 8ICQA 4UE2A 5GOTA 3W34A 3B3AA 2JA2A 3NG1A 1CEYA 2AX3A 5H82A 3ADOA 2Q8PA 3BZUA 4XRHA 1X7YB 4NZZA 3W3AD 1KMNA 2OV2A 2C92A 4GX0A 3WGJA 1OB2A 2H1IA 1BH6A 1UH5A 4YRCA 4B3BA 7YASA 3DYVA 2JAOA 2YQZA 3E05A 1JR4A 1QKIA 3UIEA 2AYYA 3PI6A 4EJFA 4PLYA 5BY2A 1HKHA 1Y9AA 3K94A 3VJRA 1JAXA 4NBWA 1EFDN 1F4PA 1CD5A 1I4LD 3NBQA 3NBKA 1IVYA 1V1MB 2LTAA 4BGIA 4GBGA 2OAQ1 2QTVB 5TQ0A 3UFBA 5AI9A 4OJQA 4MKZA 3TW6A 2H2DA 2Z08A 3I8SA 4M3NA 1ATIA 5DP2A 4KTQA 4NBSA 1O3YA 2EXXA 4J3NA 1AH2A 5JG7A 3N7RC 3QBDA 3MUOA 2PA0A 4X54A 5E7JA 1W7AA 1KFJB 4Q8EA 2GJ9A 4PR3A 5HS6A 2XUAA 1RIIA 1UC9A 2KFNA 3C1AA 4AT1A 2EBFX 2YZMA 3FPLA 1OH8A 4IUCS 1W36C 3SHFA 3FNFA 4JU9A 2Z5FA 3D6FA 2FLNA 1GG9A 2OSBA 4WOCA 4WZAA 3CVWA 3SP1A 3Q8LA 5F64A 5AT1A 1PZGA 5JVDA 1EVLA 3C8UA 2IYTA 2J5KA 5J4HA 4PSVA 4BLWA 4BUCA 4CL2A 1OFHA 3R6LA 4Q66C 1GXSB 2VQFB 4EM6A 1W36D 3R8FA 5I9LA 1V7PC 1Z6AA 1YUBA 3CT4A 3MCUA 4D0GA 5I9IA 1Z7GA 3HSSA 1HDCA 4ZKDA 4LOLA 4EDFA 4TV8F 3CW2C 2H17A 3UMCA 1U0RA 2PDAA 3BF7A 4K9DA 2QBYA 2H7XA 3DEZA 3ICVA 5DT9A 1NUTA 2W55A 3NONA 5GJVC 4UAWA 2VRCD 3VNAA 5HR5A 1X3SA 3OSNA 5CMLA 2O7RA 3RKRA 4PRZA 7MDHA 3NDPA 3ZJ5A 1JN0A 2NW6A 4RDCA 2XBLA 2PO7A 3ABOB 1FNBA 2LWIA 4MYDA 3TN7A 4EJ6A 4KYTA 3GYBA 5IIOA 4YV1A 1LTHR 5H0IA 5AW7A 3QE0A 5G5HA 2HO4A 5DRTA 3V8VA 2H0AA 1LEHA 2NTEA 3GJ0A 3PVSA 5G53C 5DTMA 3WV4A 2FP3A 1EH5A 2G7ZA 1RWQA 4B9MA 2ZU0C 1EVYA 3R5SA 4I2VA 4ZEOA 2VWPA 3OC0A 4HNRA 2LNDA 4W8HA 1HZJA 4NTZA 4X97A 1JR2A 3SSNA 3NYIA 2PE5A 1DC5A 2VPPA 3SAGA 1CFJA 1YAJA 1TQ6A 2HF8A 1BX1A 2AR7A 4G4IA 3IDZA 4IS2A 3FMOB 4R3NA 4AL4A 3OQIA 1X1TA 2CZQA 4HVLA 1SHUX 4HEJA 5L6MB 3IAUA 4NFSA 2XQIA 3CLSC 2VHEA 3QLVC 5CDUA 4ZOEA 2NUAB 4YJKA 1MN8A 3I4LA 5I4CA 4FN5A 4L7VA 1VHTA 3UQ0A 3WL8A 3FVQA 2XQFA 2UYHA 1UT5A 1YC5A 4YRJA 1C0KA 1JA1A 2CFOA 2IYYA 1J2MA 4Y6QA 3WBKA 3EUFA 4E46A 3CU5A 3WWOA 5IJWA 1Y7HA 1Z33A 2AG1A 4YYEA 2GRUA 3KE9A 1L7OA 1UDAA 3D6AA 4QXQA 3R1IA 1RAFA 3O94A 4W5WA 4AKEA 5LA6A 4AN1A 2QNRA 3QMWA 1DC6A 3C28A 1NQVA 1PFWA 3HO8A 1SNYA 3AUJB 4Z9BA 1JTFA 1JRPA 1X86B 1P73A 2DCUA 3VDXA 4QOSA 1ZHHA 1UBMS 3W8DA 1CR6A 3JTEA 4YCSA 1U9IA 1P7DA 1VLLA 2XICA 3T7RA 1A8IA 1C1XA 1CUBA 3EZ2A 5DHRA 3K9HA 2FHPA 1U7PA 1V9CA 1RWWA 1O95C 1R8XA 4K5QA 3HACA 4Z1MD 1HE2A 4URFA 2IOHA 2YN4A 2ODQA 2P9BA 4R31A 5JIBA 1AHPA 3U44A 1FZQA 4QUHA 4XPIA 5A3JA 3Q10A 3JV7A 4EGCB 4X1KA 1CW2B 2GD0A 2P9TA 1P44A 5FORA 1RNLA 1XYVA 5JSHA 4UM7A 3UANA 3WLAA 4E4YA 1RKXA 1XWFA 4F84A 4KPEC 3RI3A 2YWBA 1LKYB 5FUMA 4JC4A 1MEOA 2AB0A 3BGIA 4YHHB 3U4MA 4JASB 4M76B 1NJYA 3OOJA 3TD9A 4D4LA 2CF6A 2OV3A 1IOLA 1V3TA 1NVAA 2RI6A 5KVQA 1YQQA 3TEJA 5FOTA 3D2NA 4ESHA 1PL8A 3WIVA 1Q11A 4ZOLA 3R7LA 1I36A 4C4XA 3ESYA 1WKBA 4QUGA 3W5UA 4XIFA 4RJJA 4XUEA 3GFBA 5HP4A 1FFDA 3T4EA 1JSXA 4W6ZA 4AG5A 3N6XA 2C2XA 1Y6QA 1XQYA 3WQBA 4AECA 3BZWA 4I8XA 1G8YA 3SLKA 2D6FC 1S0NA 7ICPA 5F7JA 2A9FA 1I3OA 5A5VA 1OD6A 3IIMA 5EQTA 3KHKA 1JDJA 1COKA 3D8BA 3QLVA 4I5GA 4KO3S 3RC2A 5HQ3B 3LM8A 2K4PA 1A7JA 2QRHA 1QIMA 2FRXA 4X6YA 4S1WA 4Z0PA 4D46A 2Q6IA 2XUZA 3M7DA 4MV8A 4UU8A 1AIPA 1PFGA 4LF6B 3HB9A 1P17A 3HVKA 1NKBA 2J0UA 4RJTA 3QOXA 4I2EA 4HLNA 1ECCA 3BK1A 4Q9NA 4PJ0U 5CPFA 3VVCA 1NUPA 1ZM3A 3KQKA 2QLBA 1VCHA 4H17A 3C7KA 3RK4A 4KQKA 1D8BA 2ZSKA 3SDZA 2B4QA 3HY3A 1Z38A 4QPNA 4UE6A 4F85A 5LL6P 2QAJA 1F6BA 3V1NA 3WL6A 4PONA 3RV3A 4QYMA 1RI3A 1YR1A 1XKXA 4P4LA 9ICMA 4A36A 3WB0A 5J2TF 1JDUA 1UPCA 4RIIA 4BJ1A 2ANBA 3EIEA 4DZZA 1TYDE 4IHKA 1D6JA 1NUUA 4QREA 1RD4A 2X9VA 3WTCA 1RU3A 2EEZA 3QUCA 2C5FA 1E96A 3EIOA 4I9NA 4JLNA 1R0WA 1XA0A 5E79U 4NLLA 3ZKWA 1Q7GA 5IKXA 3QX7A 4EBCA 2H29A 4X1OA 2IZOA 4IWXA 2VHVA 2ZAYA 2RGNA 3A7EA 3BKWA 1SQSA 2R66A 2JZBB 3NATA 4B44A 1VGVA 1HC7A 1HFEL 4IMJB 4M9CA 4BLSA 5B7GA 2HV8A 4GOJA 3JATB 1ECFA 1UFOA 3FZGA 2Z1DA 4FFBB 2BLLA 4I4NA 1YDFA 3LVBA 2YNMA 3GRYA 1LV7A 5CD9A 3TCNA 3BXHA 4CLRA 5KO2A 2VLIA 1V8OA 1EPUA 1JQLB 2CNWD 2DT5A 3RU2A 3D6TB 5MGNA 3FWYA 3PKJA 3ZJ4A 1G6KA 2XBUA 3KBBA 2EGGA 3L8CA 5EXDA 3VR5D 2JGRA 4AK9A 4UOZA 4D3DA 2CMFA 2MSKA 2H9YA 2QXUA 4OLHA 2Z95A 1AUPA 2G67A 3B1JA 5FR2A 4KR3A 3PICA 3NS1A 1UMBA 1Z8DA 2V5AA 1VIYA 4UCXA 2KOBA 3PO5A 2X0KA 1DRUA 2HF9A 4X5OA 3T9FA 4Y2RA 1GZ5A 1C9JA 1UFKA 1PQ4A 3G8AA 2QN3A 3FPSA 4IPTA 4WXEA 5FTMA 4DARA 1AA6A 4B2PA 1C1DB 1NRJB 1R7RA 3MJEA 4M1ZA 3VJLA 2ET6A 2QW0X 3DVSX 4A0GA 3RRHA 3V7LA 2GLTA 2H85A 3DDWA 1P4AA 4RGYA 4BZPA 1L3CA 1N34B 1QK3A 2WTEA 2BP7B 3HDHA 4YJDA 2Y9UA 1MB2A 2C8JA 1HRKA 1FRFS 5CHEA 1FMLA 4HAWA 2QRVB 1OIXA 3BMOA 3PITA 3PGXA 1S2GA 2YOFA 4QYIB 1DARA 3P0EA 1UQUA 1TQDA 4W5TA 1NK6A 2BLNA 5DTIA 3F2IA 2VN8A 4UUBA 1X7YA 4LKRA 1CLEA 1F12A 4I4CA 3JPPA 3EVEA 2VCHA 1K3TA 2Q3FA 4TLCA 3VR6D 1ZHFA 1H85A 2PZMA 2XE6A 1N61A 3OCCA 3OPNA 1PW5A 3U4QB 3ZDXB 5DNDA 4E5PA 3M3PA 5FI3A 1PL7A 1BQ3A 4JAVC 3D6HA 5KNCA 1I7NA 1P9LA 3SI7A 1FXSA 1YK0A 1YRAA 2PD4A 3VM6A 1YIOA 4FFNA 1ZCZA 5LD2B 4P0TA 3I37X 1TK3A 1UBFA 2R85A 1XWLA 4JLWA 4KPUA 2ENWA 4L4XA 4OSEA 3PDJA 2RGAA 5KYYA 5L7YA 5IEBA 3W8RA 2A3RA 3ZWPA 2B20A 3IP4B 2C83A 2J0EA 2QU8A 2W83A 3MGCA 3GEMA 4UXIA 1XLTC 1G64A 2IKSA 2A33A 4OP1A 4ZCTA 1TCCA 3HNPA 4EG6A 1FQJA 1U2TA 1VJ0A 1N77A 4M49A 4K6GA 2ARKA 2ST1A 9ICLA 4B33A 1USIA 5MFZA 2K7FA 2V7VA 1CIJA 1E2LA 1SOVA 1ZBDA 3BULA 3LXRA 1M2JA 5J0OA 1WB6A 1LCIA 2EP5A 3DFUA 4XOUA 4K81B 2PSJA 3C1ZA 2P1ZA 3G2JA 4TLLB 4NLNA 1Z1BA 5BR4A 3RIHA 2DFKB 5KFEA 3A1UA 4R7TA 4ROSA 2EKZA 1QV9A 3M9WA 3DOEA 4BC1A 4QNRA 4BN4A 1OX5A 2SKDA 3HCAA 3NVAA 3PWKA 3AUXA 1QIEA 1PT6A 3GARA 1RKQA 3PNPA 4QRHA 3RJMA 3ZY4A 4GKKB 2KZMA 5ITWA 4F8RA 3BHMA 4AJIA 1T8TA 4JBXA 3MQ4A 3NDBB 1NW9B 2WKRA 3ORYA 4DQXA 1DPGA 2ATEA 2EG5A 4BASA 5ADUS 3B5IA 1HT1E 4RTJA 1JEYB 3A3NA 4HD8A 2W6OA 1FK8A 2EFJA 4PO1A 3PCXA 1RXIA 5EXXA 1L7RA 3OSZA 4EW3A 1Q1BA 4F3CA 2XVTA 3UTDA 5AQ1A 1JH9A 4K8RB 2VDOB 1J5PA 4J2OA 4ZAZA 4P4TA 4LJRA 2GS9A 3IR6A 3SIRA 1ADYA 2QRGA 4JI3B 3ZGOA 4QTYA 2Z2XA 3S5UA 4Z4QA 1ESNA 5HOQA 3FI9A 1EQUA 3VVBA 4YMOA 3LOQA 1PR5A 5HYVA 2ZI3A 4NG4A 4BRUA 3WYDA 2HBZA 1ATZA 1R0KA 5COBA 3JR7A 2ORED 1MF7A 4G67A 5C1BA 1RPJA 2EBWA 4GPZA 5IKOA 2WWVD 3RRMA 3RHFA 4EFLA 5EJEA 4DT1A 1PX2A 1CY8A 5EGSA 3QKSA 1S8AA 3ROMA 3GQBA 5BSVA 5FUXA 1IRXA 4AN4A 3UATA 4C0AC 1W47A 2IF2A 3P9YA 3MAJA 2JAUA 4BV3A 4OTZA 5FA5A 1IXSB 3KNZA 4IDEA 2H1HA 4IIJF 3QVGB 1FU8A 5IKEA 1CQIB 1L1FA 3KUDA 2SHKA 1P33A 1LRKA 2A5DA 3LMKA 1VYUA 4ALLA 3DVQX 1C3LA 4ZI5A 4EGQA 2X0NA 4KQIA 3H4DA 4YP9A 1PFKA 2QX9A 4QYWA 3S2FA 3BSSA 4YONB 3QY0A 1JR3D 3DCIA 5I9MA 4D81A 5HKKA 2Q3LA 4TKUA 2PFKA 2JEYA 1H8EA 2KKPA 4OGGA 2DKNA 3UO8B 4MWEA 3Q7SA 1FUUA 4K6FA 2DHEA 4JX8A 3TQSA 4IDCA 2QD2A 2AC4A 4GGPA 4COOA 5CEEA 1BW9B 5F35A 3BDPA 1XTSA 3GAZA 1QHYA 4Q3OA 1U49A 2XB4A 2GN9A 2UYQA 2BI7A 3HH8A 1FNCA 2J9XB 4IUYA 1ZM7A 2GAOA 4GXIA 1YZQA 3D2CA 4FZJA 2X3YA 2GVZC 4B75A 1EJ2A 1NNSA 2X22A 4MYRA 5AOCA 2A14A 3HFJA 4PAOA 1YL5A 2PJDA 2WDPA 2WTMA 3W90A 4AJLA 5ABPA 5JNRA 1N9ZA 3R41A 4LDRA 2O4CA 2C5GA 3TARA 3DE7X 4YJ3B 3Q88A 4TSFD 1F8FA 2B7BA 5JSZA 1XELA 1MOQA 2GR9A 2QX4A 2VBCA 3KJQA 3LBHA 4N0MA 3BAFA 5LMCA 2O8NA 3T3MB 2FUG6 3WVNA 4MPRA 1UXOA 3IVRA 2XE7A 4ANFA 1ZINA 1LZLA 2FEWB 3QYAA 1B8VA 4NULA 4H4CA 3C5FA 4Q1BA 3RB8A 1XF9A 1U94A 3MM4A 3MJRA 3PPXA 2H3IA 3R6TA 1BQEA 4TUSA 2HSWA 1W4BA 2VPYA 3P2IA 1KYYA 1VIAA 3VAYA 2PFSA 3WQRA 3S70A 4BFUA 1SBZA 1VGQA 4FMPA 4DLPA 4DW8A 1JN3A 2IPAB 3NVKI 3AI2A 3FLBA 4U2BA 4BYGA 4CFZA 5AOBA 2IU3A 1ZGJA 1BPBA 3PMNA 5FLEX 1VKHA 2HVHA 2FMKA 2YRWA 5CA1A 2YJ4A 4OHOA 1C3XA 5ETJA 2GRJA 3ZHRA 2IV7A 1UOOA 4WXRA 2WWXA 5TS3A 2QV0A 1TCUA 1T13A 1GYRA 1K4KA 4IL5A 4RVUA 4EI8A 2NZJA 1NFFA 3WO1A 3T5AA 2IZ5A 4WKBA 1JMSA 3HT3A 4LWZA 3CT6A 1QPGA 3C5GA 1NYLA 2D5IA 1U4NA 1UZNA 1HL3A 4TSFA 3TW0A 1A77A 5I45A 3AVVA 2GLEA 3E8SA 2FFHA 4Q7LA 2E89A 5EG5A 4AI6A 2CNKA 2V74B 4UU0A 3WGGA 3F97A 4WQMA 5FPKA 4YY3B 1M76A 4Q3KA 2HA3A 1Y4AE 2VUSA 4XB2A 4G0YA 2DGZA 2QG4A 4K9PA 3RF6A 4EVQA 1GZUA 4EYIB 3GDWA 3I9KA 3W6PA 4Q3CA 3TFQA 4PZLA 2XNHA 2A7XA 3T5TA 1QV7A 4RQ6A 2AA3A 3CNQS 4RE5A 3IUNA 1E5VA 4HX9A 4FPXA 4ZOCA 3KTAA 3O0DA 4WACA 2V6FA 4YQZA 4ARVA 3NDJA 4AYWA 2DETA 3KB1A 2GBIA 1P60A 1B76A 2EQ5A 2H1VA 2HQOA 2ISSD 3MJ4A 5KS2A 4JYZA 1UOEA 2B1GA 3LK9A 1QDEA 3ZU5A 4RZ3A 5H59A 1YS1X 2WYWA 3KVRA 2EEPA 2HHLA 3AHHA 4YMUA 1TGYA 1T3LA 3EPKA 4IIDA 3KV1A 1QFZA 4F4YA 2RARA 4J1SA 3GOHA 3RIXA 3SVLA 3WWPA 1JKMA 5DBAA 1ZRMA 3L7MA 5KFNA 1AQUA 5KYTA 3B6ZA 4TYPA 4BV2A 1CS4C 5BUZA 3QXCA 1I24A 5ALLA 1G19A 3DOCA 1TF5A 4CMCA 1YQWA 1IZ8A 2NVUA 2V7QA 3G0DA 3GRUA 4CGYA 4CHTA 2FGJA 1T3SA 3WHLA 4NP6A 3VDQA 3MGHA 1F44A 3WR5A 4FNGA 3H7IA 1IYZA 5EMJA 3VPAA 4RF4A 1PGJA 1ZD1A 2CDAA 1ODIA 4XJTA 3L8MA 2YWHA 4MV6A 4QWDA 4P08A 3U31A 3WLKX 5IM4A 3LQ2A 3H87A 2PS1A 3N07A 4L3WA 1NZJA 4RPLA 4OO1J 3KZCA 1IHPA 2HU5A 2DAPA 5EEHA 3U9LA 3O38A 2MINA 3BWEA 3V2GA 4FXPA 4Q4DA 3JRNA 5EPUA 4OX9B 1TU4A 4B34A 2D2FA 2VWHA 1SOUA 3OZAA 3I76A 4WUVA 1W5SA 5AXDA 2NP6A 4PHGA 1A9TA 1BE6A 1DIAA 1TA0A 2O7QA 3WB1A 1L7MA 3RJJA 3IALA 5KBYA 3BEOA 4U7DA 1JEOA 3WY9A 3MG9A 5CP8A 2RFLA 1ZQUA 3RYFA 1UBCA 4AG6A 1PUZA 1K7CA 3H16A 4HNGA 1AN9A 1U6KA 4DM7A 4IP0A 1FS4A 3DE0X 2B1JA 4RVHA 4AQDA 4CE6A 1SA0A 1NNUA 3P20A 3R0JA 5E1DA 5IJXA 4N6NA 2Q9UA 1VPVA 4EFKA 4UNIA 3REQA 3SAJA 1J2NA 1PCXA 3ENKA 3OHSX 3JAWB 5K0LA 4AZSA 1E1RD 4Y18A 3UGQA 3KAKA 4QDZA 2ZIVB 1A7KA 1KDHA 1FFBA 2JGKA 1QK4A 1W49A 3LT5A 1M6VA 2FB9A 4P4NA 3G88A 4XM1A 4PPYA 3S81A 2F8SA 5FJIA 2QNBA 2R60A 3PXDA 2WZQA 3HN6A 1TM3E 5H9VA 1KBQA 3BTSA 2AHOA 4TXJA 1NXVA 2XVAA 1FFSA 4OK6A 1CULC 3UH1A 4WA8A 2PI5A 1STOA 2BGNA 2WPDA 2B0CA 4OSPA 3TZHA 2YV1A 3KQOA 3TM5A 2FMPA 1Z74A 4O29A 1QDLB 3C8DA 5IDVA 4B4OA 4EEZA 2ZYWX 1QANA 2FP4B 3HP1A 2YIMA 3OPYB 4OFZA 1G4HA 1TVCA 5IZ4A 4HJRA 3LD9A 2H4WA 4FR5A 4O5EA 2AWOA 4UUMA 4QZHA 1R6DA 1KE1A 3HVRA 3TOSA 3AM3A 3CUKA 4NBKA 2CFTA 3B85A 5JCXA 2CHGA 3VOAA 2M6RA 2FN7A 4OMUA 3P9KA 3DOOA 3QMVA 2O3RA 1OMOA 3RLIA 3G2HA 2X5JO 3GEIA 3BWCA 4NRDA 4TQUS 3BILA 4F7DA 4NWIA 3TUZC 4M8IA 3BDAA 3HG7A 3V4SA 3GLFB 4UBNA 2E48A 2PRJA 1P2SA 4BZXA 3MXOA 2IC5A 4PG5A 2G63A 1JIVA 2G28A 3MIIA 5BR7A 2D1TA 2XMGA 4BQIA 2G80A 2PKRA 2KLHA 2ZS7A 4KMSA 4EB0A 4EUKA 8ICIA 3CVXA 5KQRA 5LPNA 3B89A 5DRYA 3UB3A 5AKIA 1D07A 2WVGA 4Q1CA 2NG1A 4HBGA 4XR9A 5KIAA 3O4JA 3BJMA 1KZ4A 3WZMA 3CM0A 1C30A 6REQB 2N3ZA 2QLLA 4PIPA 3V5NA 3VR4A 4CV3A 4MHOA 1CF4A 4YJFA 4GC7A 4UBIA 4FCVA 3U3ZA 3GLGE 1XGKA 2F2AB 2ZSHA 3WOVA 2AZXA 3N2GB 1WUJS 5F73A 4YREA 1ZJYA 3CRNA 1ZGBA 3HRHA 3U7JA 1UKCA 2NOAA 2AFHE 2W6PA 3T5CA 3O8OB 4B7XA 3ER9A 3FRJA 1XK7A 4Z2AA 3NHMA 4DDHA 5T4EA 1A27A 1VIVA 4S1TA 1WB5A 2CUTA 2IY8A 3MJVA 4XWAA 3SC2A 5BRAA 1J2YA 3TG2A 4KLCA 2PVCA 5DB7A 2VDQB 4NOMA 3ZWYA 3PRJA 3LRTA 4PZNA 2F90A 4AP5A 4HUTA 3CWCA 3O1IC 1KO4A 1T1EA 1VBKA 2Q5EA 3NBZC 4H7JA 2Q5IA 4YNBA 4IWNA 4Q4LA 3THWB 4L9WA 2PZGA 3X44A 4Y2TA 1SKYB 2HUNA 1ZNZA 3EEFA 3C21A 1WUIS 1SIUA 4OB8A 2BEVA 3SKVA 3UHFA 2PD3A 3NWEA 2FSUA 3N76A 4FZ3A 2C22A 2RHWA 3K1RB 1E3SA 1GPDG 2WYOA 4UB4A 2H5XA 3BMXA 4IKPA 3K0KA 3Q3EA 2RGGA 3T06B 4O63O 3JVUA 1XJCA 4FBGA 2B8WA 5ALQA 2EZ8A 3DMRA 2WP0A 5DBBA 2FUCA 1VHJA 2XE4A 3ENZA 3TLAA 4D82A 2ZWAA 4EHBA 4LHZA 3GBSA 4G56A 4J9LA 3SAHA 1XTJA 4MF2A 2QZZA 1HT3A 3BHJA 1Z37A 3BIFA 2OBMA 3HGQA 4HWOA 5FUWA 4DS3A 2NO9A 3BWMA 4F6RA 5K3OA 2JKVA 2ZXEA 3NCHA 4RZRA 3D6NB 2V96A 4CT4B 4HO1X 1WBDA 3KT0A 5AKLA 4NECA 2BZ1A 5JWHA 3AL0B 3T79A 1M1YA 4BS9A 1KYIA 2O6KA 4M9QA 2NRTA 1ZK3A 3A27A 3AWIA 3ET5A 3FYCA 2KG5A 2AMFA 1RWKA 1XWIA 2TMGA 2C3PA 3D4IA 4IDOA 4KLTA 2IHMA 4ZCMA 3HKEB 1OREA 3ZDCA 1VJDA 1T2UA 3OLYA 3ICCA 1Q7RA 1JSCA 3A58B 2BDUA 1DX6A 2ZRMA 3QIAA 4IV0A 4OHFA 5DE3A 1A8UA 4JJEA 1VKNA 1XJ0A 2NO6A 1E9VA 2XLBA 5DG8A 3FVVA 3IOCA 4JYCA 5A9TA 1D1SA 1DO2A 2JGNA 2V8OA 1EWRA 1NXOA 2QROA 4B3TB 1PL6A 1NY5A 1P7YA 3KCQA 4UPDA 3WRYA 1QE3A 4S1VA 4C2TA 2WB4A 2VJLA 3U9SA 2DUNA 1EFPA 7ICRA 3C15C 5E1BA 5C0OE 4DTCA 4CV2A 4FFDA 2FMXA 2Q2WA 1H4SA 3LUPA 3OCXA 2IHTA 3C8HA 4MWTA 5J0UA 2GNAA 5D4BA 2I7CA 5AW3A 2BTQB 3UUFA 3C3DA 2QYSA 1GQOA 5KVVA 4LC0A 3VBCA 2XWBF 1Z4IA 4EEXA 1DTWB 5KJEA 5AI4A 2FU5C 4GX5A 4KMOB 2BCJQ 2IELA 2VH5R 3KYDB 3P2KA 4MWBA 3U7EB 2P69A 3BJZA 3TK1A 3PNSA 5K6RA 2R6ZA 4JKIA 1XD2A 1Y8QA 1Z47A 2BMFA 2OV8A 3AL2A 1PGPA 1BCSA 1FS5A 4IJUA 1DXQA 3T1YB 4AXXA 4QZAA 4AB1A 1NBMA 2QZJA 4HGPA 2HBMA 4ONEA 1NUAA 3O91A 1CIPA 1K63A 2WUGA 2GEJA 4RMJA 3TD2A 2AI1A 3G0HA 3QU4A 1N4DA 1OU0A 3HU1A 5EZ6B 2XCTB 4RESA 1FMFA 1IUOA 3UM9A 2BIFA 2GSDA 2WB2A 4DL5A 1CJBA 3L1IA 1AV7A 4EY8A 1XDBA 2NQTA 4UTOA 3BPSA 4JITA 5ITZB 3MN1A 2VJYA 2I8CA 2OEPA 1UK8A 3FYTA 3ZV4A 4B4WA 5JEEA 1LK7A 5JQGF 4TVKA 1IPHA 1K1EA 3I9V6 4FDVA 2WJYA 2VYNA 3MUEA 4L8WB 3PD0A 4I3HA 2AOWA 1S6YA 3NBXX 4A8JB 3ITDA 5BMOA 3WLJA 4MEYA 1BXRA 3UJ7A 2MSLA 3JZIA 3HDVA 3NOVA 5DB4A 1TZMA 4Y1GA 2ETVA 3L5OA 4IJWA 2PEZA 2PUTA 2EFCB 5KG6A 3O4RA 2P3OA 1GSHA 1K6XA 4YJ2B 3A3YA 4U2FA 3WJ1A 4GI2A 4X65B 1S4QA 4YGXB 4YA6A 4MH0R 1H2ZA 2ATVA 4O1IA 4V0KA 4JOCA 5F33A 3VH2A 4F04A 1BS2A 1ODTC 3L8DA 3TAXA 5G0SA 3ND5A 2IFTA 4O2AA 4FBTA 1T94A 3AFIA 3SQOA 3RYCB 1H94A 2ESEA 5DEOA 4GL4A 4PXSA 2GQ0A 5ALOA 1E6WA 2QT0A 2X0IA 3LGAA 3OHMA 4I4LA 3CZAA 3WA6A 5J43A 4R0VA 4HYKA 4XASA 2WQ6A 1E3DA 1A4XA 1Z2DA 2WV9A 3PHBE 4XLZA 5FWAA 4PCAA 3UWKA 1W88B 3RSQA 3MWDA 4RIGA 2IVFA 1OC2A 2WINI 5HG0A 1YZ3A 1DCKA 4FDAA 1O6FA 3E2PA 3NFYA 2ZJ0A 2OCEA 2NSYA 2ONCA 4FBMA 4O4JA 3WLFA 4I2DA 4ESEA 3U1VA 5T6MA 5M29A 4YUZA 3O0FA 1EFVB 1ETHA 4JJGA 4G5OA 2PH3A 4ACOA 2FNAA 1VG8A 1CZHA 4HQLA 4RJIA 2BEWA 2PX2A 1NF3A 5JALA 1T3QA 1JPJA 1P5JA 2G71A 1A1SA 1TZBA 4O4HB 5KFJA 2FR8C 3INNA 1W0JD 1E1DA 1XZHA 2JI6A 1L4FA 4O3SA 1KI7A 3PU6A 1XCJA 4RPIA 4E5SA 2PAAA 3RLFA 5A7FA 4U7FA 3PTAA 4A15A 5AK3A 3AB3A 1U6IA 2H4YA 1GZ7A 3A9CA 5K01A 2QG6A 2AFIB 1ZGCA 4WT7A 3S1AB 5GP1A 5GIOE 2OZKA 4Z6KA 4MUAA 3PSPA 4MJ7A 4PLFA 4PCLA 3TQTA 1TLFA 5J4YA 4KXQA 2VT6A 7AT1A 4B81A 3RGWS 4KQ2A 5L3SA 4QJ3A 3PZRA 1C7FA 1QBGA 3L6DA 1CR0A 3IURA 3LCUA 1TI7A 4XX0B 1SOMA 4D4KA 3ETLA 3QNMA 4ZO9A 4NVRA 1RYFA 3DEYX 1G6Q1 4PLGA 1IXZA 4XGKA 1M34E 4AMYA 1QOQB 4KTTE 3P2MA 3DAOA 2XVMA 3BA6A 2X6RA 1ZETA 1GGEA 2CLCX 1KFKB 3B20A 3GFFA 2LR0A 2I3DA 4I6JA 3K75D 1LV5A 3CC8A 2WIBA 2JHCA 3GHYA 1XHEA 2IUTA 1U0NA 5EJIA 1G4UR 5EQFA 5AVKA 3EJWA 4GUAA 3TIVA 2OFFA 4E33A 4QOHA 5TQ0B 2O14A 2J3JA 6ABPA 3TQ1A 1RHUA 2EWVA 2JLRA 3B6MA 3Q8WA 3O95A 3RH0A 2QYHA 4TS3A 3ZIAA 4WESA 1LDBA 2EHDA 3PQEA 4W1RA 2JJ2D 3WWCA 1F4LA 4EATA 1OKKA 1HG1A 3LQRA 3U7RA 2VQ3A 3AJDA 5JROA 1T6NA 1T4GA 4X5VA 1MP0A 4NLZA 1RWOA 4MB6A 3ZV5A 2I6SA 4BX0A 5DDYA 3Q9LA 4EQZA 5FOXA 2ZFUA 3K9FC 4ZU1X 4KV7A 4N40A 1YI0A 4B17A 9MHTA 1U04A 2HEGA 2O57A 1YA4A 1EESA 2OZLB 1DQNA 3TIXB 1IDOA 2FUNB 1GAJA 4B35A 1WABA 5H7XA 3N2GA 3AU9A 1J8FA 1J24A 4WY2A 3PX6A 1K7YA 1NW8A 1N2BA 3NHSA 1T2NA 3S40A 4FDLA 5F9HA 1DGQA 3ANLA 3KKAA 2OHHA 4ASUD 2PRSA 4R9NA 4Q43A 1EVQA 1CZRA 1FSFA 2J85A 5FB3A 1DK3A 1SCKA 3KTQA 4JLSA 4KWTA 3U3KA 4B9EA 4FFOA 4EW1A 1H0SA 1XAIA 1AUQA 3R7DA 3WGNA 5EHZA 5LZ7A 1J7JA 4QU0A 4N4AA 4ND2A 4ZOBA 4ZOLB 5IBRA 4NS1A 4GBMA 5H68A 3F5MA 5CG2A 4GKJB 2JJ2A 3D3WA 1CLUA 3FN4A 1OVMA 3IMEA 3U26A 4WJKB 3SXPA 2NN3C 4WX2B 2CWDA 2P0EA 2AXQA 2C97A 1DMSA 2CLOB 3C45A 2W42A 3H1GA 4MA5A 1VJ5A 3AUFA 2WHEA 1E9CA 2JI9A 1Z39A 2NV6A 3LZCA 1ETUA 5T6BA 4A7PA 1JJVA 4D0SA 1OJLA 5FNZA 3FI0A 3HN7A 5JFGA 3FOEC 1OLUA 4EYHB 1K5PA 2CHQA 1J8YF 2OUKA 2AN9A 1Y7IA 5DCUA 1EKXA 3A05A 3HYSA 2UYGA 1O54A 3A9UA 3IBCA 4O4IA 2ZYDA 2BRUA 3DMNA 3I05A 5B4UA 4K1XA 4Z4EA 2ZITA 4QRIA 4QRDA 1KETA 1KBUA 4KMRA 4L51A 2EX4A 4EG8A 3KJXA 1ID8A 3KOZA 4ZYXA 5I6DA 4ND4A 5AI0A 4A5SA 2YVKA 2JH8A 3G5AA 1T43A 1R0YA 4RZHA 3RS9A 1A8QA 1HLFA 2OCLA 2H2HA 3VPXA 1P1BA 1V3QE 3IQZA 2Q5JA 4YMGA 5CJ2A 2J9FA 4XD7A 4L15A 5K4LA 1Q74A 1FDSA 1ZR2A 4L9AA 4PRYA 1ZN7A 4D9EA 4AMUA 5LJLA 3Q12A 3F5DA 3EIFA 4DYDA 4H3VA 5EI5A 5BSKA 4XM2A 1UIRA 2HNAA 4GMHA 1T35A 4PX3A 3VX3A 1RZRA 2D0IA 1LBHA 4L3VA 2X2PA 4KE6A 1OI2A 3WQSB 4KR2A 5BVGB 2TSYB 3N0TA 3C1TA 1X7GA 4YLGA 3RYIA 1MT3A 2ZRFA 3ONNA 2MYUA 6GPBA 1SZCA 1L6NA 3E61A 4W7IA 2VP2A 1C4KA 1GT91 4ARSA 4Z7NB 5KNCD 1I6KA 4ZARA 1H8HA 3PC8A 2VIXA 2D4AA 3I32A 3PGLA 4UULA 4WZZA 5ULLA 7REQA 2H4FA 4Q9KA 2LM1A 1T4MA 5LXTB 3FTCA 3LDFA 4OQ4A 2FXVA 1OXXK 2AYZA 4X3OA 2HQRA 2P35A 1N92A 1ADGA 721PA 2XRZA 3GLIA 2EH9A 4MGYR 1K68A 5JMOA 4Q1AA 4R5MA 3W2EA 3GNQA 1ULZA 1KY5A 2VF2A 1XDGA 3PHLA 4UD2A 1N6NA 2PPVA 2VNJA 4ES6A 1KKUA 5CVJA 4YRNA 4V1CB 3ANSA 3GPBA 1PJ2A 2ONKA 3SHVA 4BTLA 1T5SA 4B9UA 4G0ZA 4R69A 2I1LA 5HDQA 3SV4A 5IHXA 1O4VA 1M34A 4QPPA 2C57A 2GM4A 3HVIA 1MN6A 1LLFA 3BRQA 4FDTA 1DCMA 4JNCA 4EP1A 3BL6A 4MMXB 5CLQA 4ARIA 5IJZA 4DLBA 1OH6A 4LC1A 5EWEA 1RXCA 3OMLA 1EZZA 4P4GA 5JXIA 1Z2AA 2QJWA 1CY2A 3L6OO 2ZJYA 3CLSD 4CQLB 1YU9A 5CLJA 3SKXA 4Q12A 3LOPA 3HB0A 1LD3A 1ZM4A 3LT0A 3UK6A 3ZWOA 3OECA 2OE2A 3FMPB 5EOZA 2X0FA 2ON6A 3M83A 3LHIA 4KXNA 4EI9A 1FP7A 1GEEA 3H9JA 2OAEA 4UUPA 1U8AA 1ZUWA 1KH3A 1U99A 2CF5A 2RIPA 2PEYA 2GZDA 3IVAA 4R1PA 3B52X 3FFWA 3HUFA 2QIPA 5HRAA 3EFOB 1DFHA 4R2IA 4JT8A 3WICA 1J21A 4JLPA 3R74A 5KDOA 2RHCA 4F4ZA 2XQGA 1E0DA 4US9A 2KIWA 2GERA 3O1HB 2UZ3A 3HMKA 1JI3A 4CEJA 4KYIB 4TMXA 1PR3A 3NOQA 3OQBA 5L9XA 2J32A 1P4SA 4Q01A 1NKSA 2YVLA 2QYTA 4LECA 4BB5A 3TINA 5J2KA 2ZBUA 5GONB 1ZHOA 5FIUA 1A6SA 3OKFA 3F46A 4G2TA 2O8EB 1XL1A 3LY8A 4O0LA 5BPHA 4FC6A 3DF7A 2R2AA 2A86A 2GETA 1ISSA 4JLKA 4YXJA 4QX6A 4D92A 2VKQA 4FWTA 3OUTA 5KSZA 2QMYA 2YS7A 3EOZA 4CM9D 1LPOA 1QHFA 2OB1A 2R5NA 1YE5A 1XHFA 2NTJA 4IH9A 5D7NA 3LC7O 3DQPA 2C4UA 2QD4A 5KNBA 1MJHA 1S3SA 4QUBA 1JA9A 4CR7A 2WF7A 3F7TA 1U4BA 2OO5C 2FW0A 3T8YA 1J22A 4R1OA 5LIRA 1DZ3A 2F8TA 1UIMA 2BGRA 3I0ZA 1BWSA 2Y0CA 4RH1A 3WS7A 3WLRA 4C89A 1KK1A 1ND6A 3G9ZA 4YC7A 4AZVA 5JY1A 2C7OA 1VHWA 2PT9A 1XZGA 1XKLA 3FD8A 4TQSA 3FPEA 1E3MA 1F0NA 1H23A 2EZ4A 2QDXA 1XYGA 4Q82A 1QIFA 2GOYA 3ZJTA 4IH4A 2XDQA 1T0PA 4WLEA 4GE3A 4P3XA 3RAEC 1QH1A 2XWSA 3AJAA 1OWPA 4IH1A 4X71A 4YRLA 3C2LA 3BJYA 5HJEA 3DMTA 1USGA 3F9CA 3FNGA 3HDGA 2C99A 2XXJA 1A95A 2PUJA 1UMBB 4JLDA 3WHKA 2BFBA 9ICNA 4NV1A 5JJKA 4Q37A 1M7HA 1JQAA 2VPZA 1Q6YA 1UBTS 2CYAA 1WDLA 1LUAA 3AZPA 2YXPX 2WQ7A 3CLKA 3K9NA 4PC7A 1PDWA 4DDVA 1NV8A 2BMVA 3A2MA 4G1CA 2JIZA 4F8JA 2DWCA 2VJKA 3LWLA 5EPEA 1YS6A 4Y2PA 1P2DA 4DVGA 3DE2X 3R2JA 3VDRA 3PNVA 1ZD9A 3CYMA 1NX9A 1OTHA 3U1BA 1S7CA 3C3EA 4BATA 1RVV1 1GN9A 1HZZC 1L4UA 1ZQAA 4QDOA 2V7QD 1YBFA 2IEDA 4B3HA 5KQGA 3K0AA 5B4VA 5K3AA 5BW5A 3SYLA 2I6XA 3NB0A 5DGAA 4H15A 5B5SA 3PR2B 3UXNA 4ECQA 1NFQA 3GH3A 2YBEA 4JL8A 4L0DA 3UJBA 2VYQA 4ZEWA 4ARZB 4GYKA 4BB0A 1U0FA 2IX9A 2REXB 4G01B 4MI1A 1IHUA 1J90A 1C20A 3GGSA 3LT1A 2HAEA 1MQ8B 1TMKA 1UMKA 3ZLBA 4YH1A 2QPAA 4M9NA 2N1RA 1N6IA 1KR5A 3DT9A 1XQ1A 3LC1O 4HDAA 4LZWA 2NAPA 3SX0A 1IL0A 3QP9A 1E3IA 1ORRA 3UPDA 4XVQA 2O59A 3B9JA 1E69A 3FBTA 1M6WA 1NATA 3KUCA 4J1TA 5JU6A 5KJ6A 3C3AA 3E5HA 1QIKA 1PN3A 4C30A 4XVRA 3ZIDA 3KHUA 1U2SA 2DWQA 4YJ2F 2XC9A 2IRWA 4KPFC 4YYZA 4X1YA 3CZ4A 3G6VA 3A6LA 1E7MA 4ZT2A 2ISOA 3L02A 4TLBA 4OJ6A 5AVQA 1KEJA 1TKRA 1VTKA 2G4VA 4ZT7A 4FB5A 1ZD2P 5AI5A 3VGJA 3VU3A 2EP8A 1H5QA 2FJPA 4HDRB 1GT6A 4XTRA 4XEUA 3AHIA 3HX0A 3T5KA 2GDJA 3SJAA 3TOCA 4E08A 2Z09A 3PO4A 1WDTA 4KGVA 1RM5A 2W8ZA 3C7TA 4ARZA 2A67A 2JVJA 4XYBA 3DFMA 3PZPA 2DBQA 4XCQA 1RBYA 3H0KA 2HQ1A 2PUBA 4EHKA 4RM2A 2IHUA 1DQYA 2FVXA 3GLKA 4LGYA 1ESEA 1CF9A 2Q49A 4XWKA 2WHQA 4PS1A 2XKJE 4G8CA 5TGTA 2HHQA 5IANA 3HCOA 4ZCIA 1V6SA 5CM8B 1EXWA 3GY0A 4OJPA 3WKDA 1LDEA 5ICSA 1UQVA 1QMPA 1X74A 2F8KA 3H7AA 3KKOA 1SEVA 2IL1A 4IZ6A 2J59A 4XWTA 5SYMA 1B1CA 4AXBA 4GXJA 4LMAA 4HDNA 4D2IA 2QJFA 1ZQ9A 3QVSA 4H6WA 5KFCA 5G1OA 4C0QC 3RAQA 2GYWA 1EVIA 3E9NA 5TSDA 1HUQA 1HO3A 1U8YA 2BKUA 1UMCA 1TZKA 2EKPA 1L5QA 1OUQA 4ZVNA 3MFIA 1ZSVA 3E35A 1ZNQO 1F8YA 4XQ0A 3JQCA 4IR7A 3KX2A 3L1KA 1MPXA 2HGZA 2YKGA 2V4UA 4OHVA 1U80A 1JHPA 1MDFA 4MVJM 5C31A 4YP3A 3HILA 1ORDA 2PTHA 2FF7A 3ZTTA 5K8TA 3WYGA 2W37A 3M9OB 3RSOA 3QBVA 4IIJA 2WZCA 3RC1A 2HDOA 1NU6A 3DVRX 4UUOA 4Y2HA 3HCBA 3FKJA 7GPBA 2PKQO 3OFVA 4QXOA 5KFGA 1UM9A 3L84A 4JCOA 5FWXA 3G82C 2DWPA 1QYDA 4DKXA 5CFOA 1Q0UA 1Q0HA 3GRZA 4WK6A 1L5KA 4CIDA 3ADDA 1G60A 3RFUA 1VIDA 3D3JA 3NTRA 2PYDA 1NQUA 1X1CA 2GHTA 4MI6A 4F4FA 1RWPA 2BGGA 3AHDA 2O23A 1DX9A 3F3MA 4PLVA 2IKQA 1HYGA 1FU4A 1M2OB 3LPNA 3U4DA 3VXKA 4BFTA 4POAA 3ECSA 4B2LA 1NMZA 4R9SA 2COEA 5JAMA 1L3SA 5FL3A 3VOSA 5H4HA 1NZFA 3MR6A 1A9XA 2WU8A 5JRTA 4LPKA 5JQWA 1TQ8A 2WU1A 1J2JA 3IBYA 4GLFA 2X23A 4TUYA 2HA6A 2E4WA 4JUCA 4PYJA 1J20A 1UQTA 1FP4B 3DZGA 4BX2A 4KFSA 5BT8A 4AICA 1BCSB 1A69A 2GN4A 3RHTA 1YACA 1TAGA 3T0IA 3R5JA 5EJ4A 2ZXUA 3L4KA 1N0WA 5BV8A 3RJKA 2PS3A 3QUSA 1DBSA 3HHPA 4HN2A 2BFEA 3HJBA 4FLEA 4RF5A 4YASA 4RZQA 4EKIA 4B3MB 1QKJA 2PX3A 3QFRA 4N0EA 4LI0A 2Q2NA 3HLTA 2VFAA 2L19A 1J39A 3DV0B 3W3AA 1GFSA 3KSDO 3RVRA 2QRZA 2SCUB 2FMQA 1DNPA 4LVNA 2D0OB 1KTQA 1PVRA 3OM1A 5GTHU 4JBNA 1KP3A 2BP7A 2WLTA 2JCSA 4IHJA 2O06A 4LRQA 3G5MA 3PA8A 3QE4A 1EIWA 2G9RA 1Y3HA 1YZNA 4BNVA 3U6BA 4JYPA 2BBOA 1Z0AA 3O1JC 4TLDA 3SYRA 2GK4A 3LWZA 2KS6A 5JVDB 2JH9A 4S04A 2ID7A 1JHAA 2A1TS 2BGWA 2HHSA 4MVJD 1EWQA 1CRWG 4UHCA 2Z9BA 5IMSA 3SY8A 3U3DA 3R40A 4IKEA 1NVVR 1YZUA 4PW0A 4GPBA 1Y5NA 2NU6A 1EK2A 1GPLA 2H2GA 1NA5A 3CF2A 3B12A 4KFTA 5ELXA 2GBPA 3LFUA 4FLFA 4NYJR 4YCNA 4CEIB 4B3IA 1BDMA 2G4CA 3JQDA 2XY4A 2KHQA 1JFVA 2AOTB 2M9NA 2RK4A 2ZPTX 3DQZA 3HYTA 3JQ8B 4WL0A 3T3PB 3VR5H 3KB8A 3SFVA 4GLOA 2GASA 4DHEA 3GGGA 2EQYA 3BH7A 5MN6A 3D4PA 2C5EA 1M2VA 3FKQA 4II3A 5IBQA 1Q46A 2R1TB 4EELA 4UBKA 3F71A 2V9CA 3HJEA 1N1GA 1C7IA 1W88A 3NGXA 3QPAA 4J0HA 1V85A 1VSUA 2J5RA 2JEIA 1MABB 2SECE 2RI0A 3L1VA 1KMQA 4QQ8A 1R12A 5F1YA 4FCCA 3S8MA 2AGQA 5EMLA 3WJ2A 4R1UA 3FB4A 2QVZX 2BPFA 1G5PA 1BXGB 2ZBQA 1GRRA 2MTBA 3QPVA 2C4HA 4D8WA 5A5EA 2AFIE 3AEKB 5H8WA 3RR7A 2HHJA 2NYAA 3TZKA 1PVDA 2F8MA 1IAVA 4IQ0A 2LE0A 4U2DA 4CQLA 4EA7A 1WXWA 2NSDA 2Y6VA 5AHWA 2A5FA 3W5HA 8ICRA 4DDUA 3LP6A 4XAQA 2VJDA 2Q27A 1H66A 1P5RA 2AVDA 3M1YA 4JB8A 4XYMA 1QYWA 3HZRA 2C8VA 3PC4A 4ZQEA 4BV8A 4DR3B 2GN1A 2R8XA 3IQFA 1R8YA 1PHPA 4MS3B 5KOJB 2J3KA 3E5MA 3KOUA 2QXYA 4PHAA 3KZVA 4X6XA 4EK9A 2O2SA 2YQ5A 3COVA 5KKCA 3AT1A 1A50B 3KTOA 1P7PA 3COYA 2B1QA 2BFOA 3NTLA 4WKOA 1NBWB 3F3SA 4YMTA 621PA 3UC9A 4GOLD 1GKLA 4DCVA 3I1YA 2MUTB 4KPGA 4LJKA 4TSKA 1NBAA 3EVTA 1S97A 2LZ0A 4HDOB 5CXQA 5TT0A 1EB9A 4C88A 4J2HA 1WHSB 4ENWA 4Y1RB 2X41A 1LFDB 1CVIA 4CVNA 1JALA 3RU7A 3QUBA 2ZT8A 2R8BA 4C6TB 2Z2YA 3JQBA 2E5WA 3FDXA 1OXKB 2OOKA 2QJTA 4P4OA 2LKYA 3GQVA 1HEUA 2W5UA 4OFWA 3VOBA 3TGPA 4XLLA 2ESRA 2J9GA 1ULBA 3Q7EA 1RZRD 2XF2A 1D1PA 1NQAO 3B1VA 3BX1A 1KNQA 3HA7A 4HSGA 3PNLA 4J7UA 1I2BA 4FHCA 1MVLA 2Q7DA 1OXBB 3OPVA 4OUKX 4N5IX 1DCTA 3B1KA 3IMCA 3GCWA 5BYJA 3QU9A 4BX9C 3GFGA 3SS7X 4QZ9A 1K2WA 4EECA 3B2QA 4QNMA 1SKSA 4MKRA 1UEIA 1K8RA 1M8KA 3AKEA 2NUPA 4H0FA 5D00A 4F3TA 4NSNA 4DJTA 3KFUF 1PFUA 1QLHA 1YIDA 3HKCA 3RYHA 1BDIA 4BJHB 2QYOA 3SFZA 2FQWA 1Y3FE 5JVDF 5CGZA 2XZLA 4C9BA 2W00A 5JTIA 3WFJA 1AKRA 2FLPA 2GYVA 3WRYC 5HF9A 4TUYB 3E9DA 2PMBA 3L6UA 1T3HA 2A9QA 5MN5A 2JARA 4F1KA 4F2PA 4NOJA 1JEJA 4ZRNA 3CNHA 1Y8RB 4WDQA 4ZT4A 4RVOA 3TVDA 5HRCA 5IJ9A 2F4VB 5KNBH 3PR1A 3UBTA 3QENA 3ZK7A 3OQHA 3FZEA 5JASA 3BCHA 2WHPB 5C32A 3RUHA 4RY8A 1VLBA 3PR4A 2EBHX 2YR0A 3BD8A 4BC0A 1P1IA 4P3KA 5DX8A 3ZGVA 3M6WA 4JI0B 4C0LA 3QLJA 4MX8A 2P68A 2XMDA 3I5UA 3OQIB 4K7JA 2ZTCA 1GLNA 2YRXA 3AVOA 4K4IA 2RHBA 3EXEB 3HQ4O 4RL6A 1DAFA 2AXNA 5J63A 1N62A 3TFSA 3UK0A 4BQRA 4QODA 1VG9B 4L8LA 1S8NA 2XMSA 4HNTA 5JH7F 3N4MB 3IHWA 3L9XA 1RPLA 5KAMA 2XUKA 1JDSA 2VZEA 1QVZA 1DFGA 1ANKA 3KM0A 1U4SA 1XC9A 1P0CA 3BIJA 3NTXA 3ZCTA 2B2XA 5K45A 1P3JA 1T9DA 3GMTA 4RV5A 4LQCA 4RQNA 1XROA 1BE8A 4NYMR 3L46A 4ZHSA 1QHEA 1XU9A 3VH3A 3STVA 3OEEA 1NG9A 2VO1A 3T3GA 2DF8A 2W6ZA 4DFKA 2GYYA 2AQ4A 1JAIA 1KQOA 5CJJA 5FI5A 2KZ3A 1V8ZA 3T7EA 1EUZA 3EAGA 1QAMA 1Q1ZA 3TKAA 2A9VA 3GVHA 1CUZA 4RLSA 4YV2A 4NXMB 1G8PA 1F06A 4IXWA 1IOVA 1AS0A 2GFHA 4AWAA 4BBAA 1ZJ5A 4KVZA 3AUTA 4MS4A 4QDTA 5CDFA 1V4BA 2OK8A 4KGXA 4WE3A 7ICJA 1V5GA 2RHHA 5REQB 3NM4A 3FAHA 1CUDA 1NSYA 2C3UA 3AF2A 3GGPA 3QOFA 4RV4A 4C01A 4YDQA 4MR9A 3IV6A 4W7SA 5DCWA 1NRIA 1JEQA 2MMCA 3WKEA 3FZNA 3GFQA 3OTWA 3OH8A 3B1FA 1GYQA 3P2OA 4ZZ1A 4YO8A 3SF0A 1TRHA 5J2UF 2TMDA 1K7XB 8LDHA 3L82B 2AIRA 1QJCA 2J3EA 3OURA 5LU8A 3OQNA 3FMGA 3Q8XB 5HNKA 5CDYA 1XZFA 1ST3A 4MMZB 3OTQA 3UOGA 2B94A 3B1XA 3G5LA 2HADA 1JL3A 1E79D 4QTUB 4E5DA 3GT3A 2BFCB 3FIUA 5ICFA 2GCEA 3RIMA 4A91A 2HDHA 1GZ4A 1QNFA 1YZYA 1E5DA 3EXHC 2I80A 2Y27A 4P0QB 1UDCA 1DK2A 4IRDA 4HDQB 4M21A 1O77A 4MJXA 1GPBA 3BMNB 9ICJA 1NVBA 4REQB 5AHRA 1J6UA 2IPMA 2X15A 2PXXA 1EXMA 1H4TA 1M54A 1R0RE 2CYBA 3EZLA 1ZM2A 3N8KA 4WZBE 4BEWA 5HIKA 3COZA 4OF4A 4WECA 3LJKA 3VHLB 4A6PA 4AJEA 5J8YA 4WJ3B 2NTVA 2AEMA 3GJRA 1CQWA 1QDUA 4KKXB 1O9GA 1SKMA 4PC3A 3HCCA 1SHJA 4XQ8A 3OFSA 1RYYA 3E58A 1WCV1 1N8SA 1XRPA 1PD0A 1Q44A 3DZIA 2PWZA 5E6RA 5GQSA 4CF5A 3WL7A 5H16A 3ZNPA 4XA5A 1GJRA 2ZIZA 5HA5A 4QC2A 3RB0A 3OX2A 5DN6D 1HIWA 5DOVA 4BBZA 3WGMA 3JWEA 1ZOPA 1X3LA 3FETA 5BYKA 5CR0A 3MMPA 3O3NB 1P19A 5CEFA 1NNI1 5KVCA 3C97A 4MW7A 1ZITA 5I7WA 1WRBA 4DUYB 1JG1A 2E5FA 2QW1A 3DM9B 1YVEI 2BBWA 3NHFA 2XUDA 1SD5A 1Z4MA 1NR7A 5AKJA 1WX1A 1C0IA 2OTCA 2J6UA 1CQPA 3AERB 2KEYA 2P27A 1IOZA 3BMOB 3PC8C 2ZSIA 1Q1QA 2AUMA 2BV3A 5CU7A 3BMQA 4BX9A 2FMTA 3ESCA 4KLGA 2P90A 1DX4A 5AOAA 1CY0A 1D8LA 4YS6A 4HWGA 3AKYA 4YFYA 4ABYA 4YDSA 3EQZA 4FD2A 4WN9A 1WJGA 3VZQA 5DQIA 1XDUA 2PFGA 2A8YA 2RKBA 2KN7A 3N2YA 4NF2A 4ZZ2A 5KG1A 3BRWA 4INJA 5KYGA 4CRXA 4BNXA 1NVVQ 2Q2OA 3D3QA 5EXSA 3UXOA 3VVLA 4HPJB 1FOEB 4ELTA 3HRIA 2KICA 3K0FA 1CPYA 1J8VA 3N2EA 4UZEA 3UF0A 4F9EA 4C0XA 3EXG1 2ECQA 3KK0A 9ABPA 2UV8A 3LY7A 3RUPA 4EO7A 2AJLI 3OO0A 4WZ6A 4BO5A 3WB2A 1Q92A 2JC3A 1GUAA 4FYPA 1H6AA 4PYNA 4IDBA 4KCGA 1YKGA 1P4RA 3EVZA 3GUHA 5IIMA 5TF0A 3OJOA 1JQ5A 3B78A 4KYVA 3M4XA 3QITA 1GZ6A 4ABTA 2H5LA 2PMKA 2QHXA 1F1JA 1Y1KE 2UVWA 2UUPA 5EKSA 2IU0A 4JV0A 1X8JA 3JD4A 1N36B 3QU2A 3IKTA 3Q72A 4RANA 1D1TA 2XUQA 3OEYA 3QU5A 3EQ7A 4HFRA 3C48A 2EW1A 4KBGA 1P1JA 4Z0HO 3ZXIA 1VBMA 1V35A 3V7UA 4AMVA 3H2HA 3ABQB 1E1LA 1OROA 3IEKA 4RF2A 2WVHA 3BJIC 2EJUA 1G55A 4U1RA 4GDFA 3ZWBA 5BWBA 3FTDA 3TRJA 2JLXA 1JROA 2JIPA 5ER6A 2HMWA 3LUBA 4M0FA 1X2EA 1IBKB 1DOHA 3ZHOA 3TGLA 4AO7A 2QTCA 4Y98A 1XMPA 1ZL0A 4DCOA 2X77A 3GBPA 2X1VA 3LWNA 1QCDA 2V59A 1QH8B 2BF4A 4MFFA 1JHRA 1WW3A 2OFWA 3VR2A 5TQJA 2BEUA 3M9MB 4MLDA 1KFDA 2AMYA 5KSPA 2GF9A 3D1LA 5ALGA 3H84A 4EENA 4GRAA 2CHFA 3L40A 2BHRA 4EUFA 2HJGA 5LZ2A 2JA1A 4L02A 1FUKA 1TUIA 2R8OA 1YR2A 3AVUA 1MJFA 1SCIA 2A88A 4JHXA 4KQ1A 5CR9A 2HVIA 5LQCA 1LDMA 1YMQA 3UG6A 1IPEA 4AD8A 4F92B 3HBFA 2OR3A 2IP1A 1KC1A 1KVRA 4IUDS 3SV3A 2LIVA 4NCHA 5HZHA 2FN9A 1AURA 2FG6C 2IBKA 1O97D 4N18A 2Y1GA 2A5GA 3ER8A 3VGPA 1V45E 4E1VA 5IUJC 3TACB 3CW8X 3RWMB 2QRQA 5K4GA 2XUIA 1L8AA 4ZIRB 1U2ZA 4P4SB 5KG4A 1LS1A 1RYEA 5GINE 3WBBA 1EXDA 1Y3CE 1GZSA 4YT5A 5JBQA 4N0QA 1Y88A 3VHRA 4OI1A 5EJ9A 2FFAA 1YNSA 1WSDA 2C5LA 2C42A 4BEBA 5IYZF 1WMFA 2ACWA 2YXNA 2ZIXB 5F23A 3FOZA 4DEYA 1FW8A 1FFYA 1N63A 2GJKA 3N2LA 2PK3A 2F43B 1UJ4A 2HHVA 3N75A 5C3MA 1ZISA 3GELA 3SFTA 3GLGB 3C6QA 5LUBA 3RS2A 3IR5A 3KDPA 3DLPX 4KGDA 4DBLC 5C7YA 3IQDB 3KAQA 1SELA 1NOMA 3V8NA 4CJXA 3PWTA 2BMAA 1TPYA 2BFPA 3JSXA 3L6CA 5FLKA 1IM8A 3E7WA 3TDMA 5A03A 3GLIB 5L53A 3DOIA 2LHTA 4TKZA 3QVUA 1NQOA 3MWGA 4KEAA 2JH1A 1JLLB 4BN5A 4JJZA 3O90A 3UNXA 3K53A 5ILOA 1R37A 2G82A 1FQWA 3A6ZA 1NAHA 3AW9A 3E1GA 4KBYA 1FLAA 1NMYA 4E12A 2GM9A 1OXJA 4EJSA 2PWPA 4AKHA 3G5TA 1FLVA 2Q1SA 3KKKA 5B30A 2OK7A 4R9RA 3HLKA 2G1AA 3CR3C 3IRUA 5CH8A 5E2IA 1UCVA 4DUGA 5SYNA 4EJMA 4Y2YA 3PSIA 2PZJA 5DM2A 5B3JA 3NHAA 1XZDA 3USZA 3GGCA 2PZAA 3C5HA 1RM3A 1VYHA 4NJMB 4BQFA 3IDSA 4GPTA 5IJ9B 1UP4A 4W8OA 4YMLA 1U0HC 3CUYA 1CQZA 3R23A 3FHTA 5DGHA 2JFOA 5LMUB 4NJ8A 2XBMA 1IQUA 4KU4A 4QECA 4Q45A 3ZBUA 4YEDA 2WA1A 3O31A 5F4ZA 2BHNA 4G8JA 4ZJYA 4L73A 2IS1A 5DG9A 3DE5X 2QGNA 4R81A 4Y6OA 4YJHA 4O33A 4GX1A 5NLLA 3NJ8A 3T52A 4F06A 1QO0D 3G8BA 1JRLA 1VM6A 4IR1A 1POXA 3LLUA 3BF8A 4LXUA 2E2WA 3TKLA 3X1JA 2FV8A 3VR6H 2A1AA 2VANA 2XNSA 3EF1A 2BFWA 4HDNB 3BQTA 1KSPA 3REOA 4UUAA 4PRLA 2HW3A 5IZCA 1K98A 2ZIAA 5ALEA 4E13A 1KQGA 5BOSB 3PFIA 3KD2A 4Q93A 1MQ9A 1ZCJA 1DG1G 5FWDA 3ADBA 5F2OA 2Q6KA 1GTRA 1NN0A 3PDWA 2X4IA 4NOKA 1KDYA 2QRPA 1NJ2A 5DXAA 1C9EA 1I0LA 4UCFA 1COWD 4FDUA 1Y42X 2PXHA 3NAZA 4HB4A 1BPXA 4NBRA 3R5HA 4QIWF 3ETEA 3I5AA 2QTFA 3MGAA 2WUFA 1H2XA 2J4CA 3K9BA 4XDZA 1SXGA 4RDXA 4O2BA 5KTMA 4JLJA 4TXNA 5BYBA 1OX4A 2Y1FA 3F5AA 1NIJA 2QM7A 4F2GA 1NMQA 5A6SA 5EJ6A 3NGLA 2CFSA 4MF8A 3QUTA 4Y2QA 1HLPA 3IAM6 1UPHA 3Q9SA 4Y8VA 4PO3X 3R3YA 1GTSA 3OU2A 1HE8B 4CCAA 2GAIA 4BHTA 1XZEA 1U4OA 3QWHA 3RR8A 5IXSA 2RIRA 2HU8A 3V6LA 1M72A 1HLGA 4KG7A 3HB5X 4EMUA 3IOBA 4V3CA 2Z2JA 1SQ0A 5DGIA 1GPUA 2X5KO 1OFIA 4F4UA 1DRJA 1GGNA 3AM1A 1I94B 2EU8A 2L42A 3CV3A 1TO1E 2NU8B 5E38A 3IULA 3O1LA 5LOVB 5M3BA 1KYWA 1G291 1QHHB 1JMKC 3ITEA 2CJWB 3FWZA 1FX0B 2DULA 1X39A 2BFCA 4DLUA 3ZY5A 1E89A 1GM5A 1TQ4A 2OGTA 4XUSA 4KRYA 3ZH9B 2LDXA 5EP3A 4EO4A 5JSUA 1XKTA 2HOFA 2QRJA 3VYUB 3K6SB 1EFHA 1R6XA 4E30A 2OWOA 2WWFA 3K1AA 4GICA 4JUZA 1XTBA 4Y7DA 2LBPA 2JLZA 3F49S 5DLGA 4PVCA 4TV8B 3BQNB 3NWBA 3OQ6A 1RRFA 3I45A 4D9NA 4B0OA 2GCPA 1G21B 4KLUA 3DZCA 2R9VA 3AIMA 3NEYA 1XNRB 1T2CA 2BR4A 2ZE6A 4MVJF 1YZ6A 2WB1F 2ZRQA 1XCBA 4FSHA 4GEKA 3WGUA 4IOMA 4M8SA 5EY5B 2E4VA 4C78A 3H0LB 3M6KA 4E1AA 4YMSA 5LQAA 3GCDA 3FNRA 2CUNA 1K8YB 4RGBA 3G0CA 1QG0A 1A9QA 4D4JA 2Y2VA 2VA3A 3R3SA 4L9SA 1W4RA 3PNKA 2B3DA 1QHHA 3PGA1 3TOVA 1FW6A 2CLFB 2MRLA 4DFMA 1OX4B 4BO2A 1ZQLA 3CF0A 3ZWVA 1FYXA 1Q0RA 4G26A 1XMJA 2EAPA 4RKRA 4CBVA 3DJFA 1CR4A 2WWGA 2VK2A 3TX2A 4RSGA 1BMFA 3QQ5A 2F76X 3ISBA 1R5BA 4KE8A 4QOFA 2R8IA 2XYVA 1TDJA 4OJMX 1TKDA 1DIRA 2WAYA 5FEMA 4BNMA 1N2HA 3NVWA 7ICFA 1MV8A 3W0LB 2IYZA 3O4FA 1D4FA 3PQ7A 5KFZA 2E1PA 5D1NA 5F78A 4MFCA 1MX1A 5T64A 3NTVA 1XNGA 2DFPA 5BWMA 2EANA 4X92A 1CS0B 3SEZA 3SJ7A 2FEKA 3DB1A 1C4XA 4TMKA 1AKMA 4ZT5A 5A9SA 5DHUA 3N87A 1KOJA 1V9SA 4XM0A 4OXQA 4MA0A 3RT9A 5A9RA 1VA4A 5F7OA 5IC4A 3INGA 1YFZA 3GYGA 2NPOA 3O2QB 4RPCA 2IYQA 3O8OA 4WOKA 2TMYA 2RK6A 3GA5A 4ITVA 1KI6A 4UNSA 1QSGA 1PYDA 1JG2A 2YJNA 3G9QA 3P9CA 4TWAA 4D5GA 2B6GA 2DBVO 2FG5A 1SXPA 1QGAA 3S4YA 3OPXA 1C1DA 4PS0A 1L4HA 2GA9A 2HMYB 3LW7A 4C7VA 1F3LA 1F6WA 4RV9A 1FTWA 3AR5A 3C87A 3STHA 1RMTA 4DR6B 3ZDEA 5CA7A 1C30B 4GH5A 1FYVA 4AUMA 3PSTA 4KUHA 5E0KB 1CY6A 4C7YA 2WMYA 4WRRA 5AXCA 4JWMA 1DBRA 3CZ5A 2JJ1D 3NW9A 2ZUFA 4Q7JB 1EGVB 3GIKA 3PFCA 3TI9A 4ED1A 5KFLA 2HBLA 3B6KA 1KDZA 2NU9B 2ZQZA 2HBQA 3WI7A 1QHXA 3A6KA 2QVCA 5A9SB 2Q9BA 3FAKA 4RHYA 5F77A 2ZWMA 3BRWD 5CVDA 1C2YA 3NHZA 4ID3A 2VBIA 4UTZA 1NVEA 1PG2A 1YS9A 3IUBA 5KHAA 4A26A 2ZJ7A 4JB0A 2JHGA 4KO1S 4A9AA 5FNVB 4FHGA 1IWOA 3NVYA 1XZNA 2VHXA 3DOHA 4JP8A 4A5OA 3H11B 4E11A 4F2HA 3V4ZA 3K4QA 1PG0A 5DHSA 2KI5A 4J0JA 4IZIA 3AP2A 5HQJA 3ENVA 9ICTA 3TKYA 3U17A 4DXHA 4WBNB 4F5NA 1Y34E 2LKCA 2ZZMA 4QWBA 2GWSA 4C8KA 4J0CA 1XRNA 4WOBA 3BTUA 4DJFC 2VPXA 3EVNA 4PHPA 3BG5A 1P0IA 4TKMA 2AG8A 2I9GA 2B34A 1KOFA 4HDRA 1ZN9A 2VPWA 5SZIA 3HJCA 1BPZA 2C61A 3GVIA 4HNAB 2DBZA 1J0DA 2Q1TA 4C08A 3ZXUB 4US1R 3RUFA 2WR8A 5CDFE 3NBFA 3QLTA 1OLSB 2PNJA 1EGHA 2JPDA 4ZIRA 2Y0PA 1CJCA 3MFHA 3JZMA 4PU0A 4FFRA 1H05A 1Z2CA 2QMZA 3HJFA 1XZPA 5DX0A 5L1MA 3ASYA 1CJSA 3FH0A 3COPA 9ICXA 4CMEC 1RC0A 3D0OA 1GG8A 5TQ2B 4HWTA 4Q39A 4ECTA 4FXOA 4L2IA 3UT5B 3HKBB 3S2ZA 3WWYA 1IV8A 3TUJC 3LP5A 2E4UA 4BWVA 1NSFA 1D0VA 2WSSA 3ZZNA 1WXQA 3SZ3A 3IUYA 2O8DA 2HDWA 3UWMA 2W9CB 4FYVA 3I83A 4MPTA 4USAA 4KN8A 4X8MA 3I42A 1RWVA 3E15A 3VV3A 5AQEA 3Q6NA 2I1WA 5JJIA 5ALVA 1L4GA 1T9ZA 4QEDA 2B8TA 1NLMA 2EQBA 2P6PA 2Q3CA 3KEOA 5LZ5A 4B3XA 4F9GA 4G4JA 3A0UA 1KDVA 5ILGA 4HYEA 5BN3A 4GMFA 5L51A 1PWEA 1MX3A 3LW8A 4BP8A 4CMAA 3K0SA 3DLHA 4D9MA 1WKCA 2D6FA 3ZVMA 3LUJA 4YIKA 2K8BB 1SBYA 1W1IA 1WLYA 2SBTA 3KPWA 3R09A 4WZAB 2I22A 3DMYA 3NV9A 421PA 4DLXA 4F4IA 5JYEA 3V6MA 2HT6A 3M4NA 1I6MA 5CFMA 3IKJA 2FFJA 3HA5A 3W1EA 2XDQB 1XPUA 2HR1A 4E3WA 3JQ8A 2W9BA 2BKXA 2HK9A 1DAPA 4LY0A 1NVGA 1V26A 3CLRD 1RRCA 3QOYA 1YZ7A 4NU0A 5JDCC 1OZAA 1YSCA 4X64B 4ZCQA 2KTQA 1FFEA 1IEWA 5DDIP 4UJ5A 3MQFA 4X45A 3OCUA 2YCBA 5KHOC 2OXRA 5TX7A 4Z4FA 2QAGA 2VQEB 3P7MA 5LQKA 3GK3A 2WT4A 4FINA 5C1OA 3I5YA 1UEJA 1GSIA 3BE4A 3MS2A 4ZHQF 3L8ZA 3F2BA 2Y1JA 1Q3TA 1SVWA 2CLLB 3OHPA 1QFMA 2WW8A 1NN1A 2ZRK