4CE6A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
molecule tags Hydrolase
total genus 84
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4ce6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ce6A01
1YNSA 3AR6A 5ALWA 5FP0A 1U7PA 4G63A 5ALEA 3R4CA 4XE5A 4O8CA 2GHQA 2ODAA 4UM7A 3OCWA 3W5BA 3OCUA 4UMFA 5ALXA 2I7DA 2JAWA 3D6JA 1CQZA 2ZG6A 5AVUA 5AI6A 3J7TA 3WK4A 1RMTA 2AUTA 3ED5A 3UMCA 2PR7A 5ALSA 3U26A 3FPBA 2RARA 3QU4A 1U7OA 3FGOA 3MMZA 5AVZA 4ZEVA 5AIAA 5AW1A 1Z4PX 4UAUA 1WR8A 3A1CA 4EELA 4KNVA 3QLEA 2C4NA 1WVIA 3OCVA 1FEZA 3QX7A 5AICA 3L8HA 2MU1A 2G1AA 5ALMA 3PGVA 1F5SA 3QU7A 5ALVA 2WM8A 1EK2A 3WGUA 3UM9A 3SD7A 3QU9A 3L8FA 3QXGA 5ALJA 4DWOA 3NUQA 2MU2A 4XOUA 3KOOA 5E0OA 3BA6A 4UU1A 3EF0A 2IA5A 1N8NA 1N9KA 4CF5A 3ONNA 2Q4RA 5AI0A 1TE2A 4YCMA 5AK5A 2I55A 3EPRA 3W5AA 1ZD5A 2HI0A 1U2SA 2WFAA 5AKKA 4JDPA 4KX5A 3L8GA 5ALFA 3QU2A 3QUBA 2YJ6A 2YFYA 5AVVA 2FDRA 3MN1A 2C88A 1X42A 1RPZA 2I6XA 5ALPA 3L0CA 3WKBA 5AK4A 2NO5A 2CFTA 5ALLA 1J8DA 3ZWKA 4C4SA 4Y2VA 5AKIA 3SKXA 4Y2UA 3A3YA 4UM5A 3KDPA 4XQ0A 1ZJJA 4UU0A 3WK5A 2CN1A 4UMDA 5ALTA 1ZD4A 3U13A 1PW5A 2QYHA 3QUTA 1L7OA 4BKMA 2YMMA 5ALIA 4MWOA 3SLRA 2FPWA 4FFDA 2QLTA 2FPSA 3AR3A 4EZEA 2W4MA 2HHLA 4IFTA 3U7GA 1TJ3A 2B1RA 2WF6A 1RLMA 2B8EA 2P9JA 4CF4A 2B1QA 5AW9A 2B30A 4JB3A 2YJ5A 5A3RA 5AW4A 2FPUA 2R8EA 4G9BA 2ZBFA 3KZXA 1L8OA 2GMWA 2WF5A 3ZWDA 2BDUA 4HGNA 1L6RA 4CE6A 2YY6A 2HF7A 4E88A 1WZCA 5ALRA 2R8YA 4YGYA 1QQ7A 3NAMA 4HGOA 4Y2QA 4OFZA 4DCCA 5A3QA 3WKAA 2HO4A 5AVWA 3OTQA 4DW8A 2OBBA 2FUCA 4QQFA 3ZX5A 1Z4KA 4BX0A 2IOFK 2HF2A 1ZRMA 3WK6A 2ZBEA 4FYPA 4DFDA 1T5SA 5ALUA 3WKDA 3U7FB 3ZU6A 3IRUA 3E81A 5AI5A 1VJRA 3W5CA 2C9MA 1AQ6A 3QNMA 4BBJA 5ALDA 3L1VA 3DV9A 3L5KA 1RMQA 1ZD2P 4I9FA 5AW8A 5AK3A 2O2XA 3E84A 3ET5A 3QGMA 4J03A 3N28A 3AR8A 1RC8A 3A1DA 2BY4A 2GFHA 3PDWA 5AESA 5AM5A 3OCYA 3FM9A 1T5TA 2ZBDA 3WK7A 4PNHA 4NABA 4NAVA 1L7PA 2DQSA 4I9GA 4Y3UA 2JGAA 3AR2A 2HOQA 3SKYA 1CR6A 5AM3A 4YCNA 3KBBA 5AM2A 3AR5A 5A3SA 2P27A 1L7NA 4KX3A 1QYIA 4Y2XA 3SHQA 4ZEWA 3HLTA 2GHTA 3MPOA 4L6AA 4BEWA 3AR4A 3M1YA 1RKQA 3KC2A 5AW2A 5JJBA 2RB5A 1RRCA 4RETA 3QYPA 5IT0A 3I6BA 4HGQA 2D2VA 5AVQA 1U02A 3ZW7A 2B0CA 1ZD3A 2YMPA 4J2TA 2G0AA 4AP9A 2C8LA 3F9RA 4NFLA 1YDFA 4HGPA 1SWWA 2BDEA 2YMQA 4BX3A 5AVRA 1IWOA 2CFRA 4HGRA 5AKLA 5AKHA 4RESA 2WF8A 1QQ5A 1RMYA 2JARA 4Y2TA 4Y2PA 1KYTA 3WGVA 3L0BA 2VKQA 3ZUPA 5ALQA 3GYGA 2OA0A 3FPSA 1RDFA 3RF6A 4GIBA 2HSZA 5T41A 3ESRA 1SU4A 4XPZA 4F72A 3L0YA 5AM1A 4HAIA 4IG4A 4MUMA 3U7EB 3I28A 1RLTA 5ALZA 2CFSA 4FE3A 3W5DA 5AKGA 2FI1A 3CZ4A 1WPGA 4C4TA 1Z4QA 5AW5A 4UASA 5AVYA 1Z5UA 3BWVA 3I76A 3NASA 1Y8AA 3K1ZA 2MSNA 3NIWA 5ALYA 5AW7A 3ESQA 1YMQA 4HYTA 3ZVLA 2Q4TA 5AVSA 2JAUA 4BYGA 3QU5A 4Y2RA 3ZVMA 4EENA 1YV9A 3UMBA 2YJ3A 2HEGA 1Z4MA 3RFUA 3IB6A 1QH9A 3EF1A 2P69A 4QJBA 1LVHA 1Z5GA 4Y2JA 1Q92A 3S6JA 3B8EA 3DDHA 5AIBA 2NO4A 3DNPA 5ALKA 2EARA 3EWIA 5IT4A 1LTQA 1S2OA 2B8JA 1YS9A 1Z88A 5AM0A 3ZVNA 2G07A 2IOFA 1QQ6A 5AKJA 2ZBGA 5AKYA 2I34A 3P96A 2PQ0A 3SMVA 5AKXA 5AI4A 5AK6A 3KD3A 3B9RA 4UAVA 3UMGA 3U19A 1K1EA 2JAOA 4L6CA 4Y2SA 2X4DA 4H1WA 5AW0A 2RAVA 2YJ4A 5ALHA 1ZOLA 4C4RA 5AI9A 1XPJA 3WK9A 2EATA 1RKUA 2P11A 2RBKA 1TA0A 5AW3A 5ALNA 4AS2A 1Z4LA 2O9JA 3CNHA 2R8ZA 2FEAA 2Q5EA 2FPXA 2HX1A 1S8OA 2IYEA 2AH5A 2FPRA 3E8MA 3WKCA 1Q91A 4BX2A 1RKVA 4OHFA 1XP5A 3PGLA 5ALOA 2ZOSA 1RQLA 3R09A 4EX7A 4NWIA 3L8EA 3ET4A 1O03A 4Y2YA 2I33A 2R8XA 3OCXA 4YIHA 1L8LA 3U7HB 3PCTA 1MH9A 2WF7A 3MC1A 1NRWA 3N8GA 4KNWA 1O08A 3M9LA 4KN8A 4OCZA 4L57A 4EX6A 3HYCA 1SWVA 2W11A 4UMEA 3ZTWA 2WF9A 1TJ5A 3A1EA 3OCZA 4ZEXA 4F71A 4CNQA 4GXTA 1ZS9A 5AM4A 3QUCA 2ZXEA 1TJ4A 3N1UA 2WHEA 2EAUA 4UMVA 2PKEA 2HCFA 3QUQA 2HDOA 3N07A 4BNDB 1Z4JA 2FUEA 1NF2A 3WK8A 1XVIA 4B6JA 4NV0A 3DAOA 2C8KA 1Z4OA 1NNLA 4UARA 3AR7A 4OD0A 1T9ZA 5IS2A 3ZI4A 3N5KA 1JUDA 3NALA 5AVTA 3ZTYA 1Z4IA 3L1UA 2OM6A 3NANA 1L7MA 3R9KA 1VFPA 1J97A 3VAYA 3E58A 2B82A 1VJ5A 3SF0A 1EK1A 4BEVA 1ZRNA 3WKEA 1YJ5A 2OYCA 2YN4A 2YMLA 4KYTA 1RQNA 4CF3A 2IOHA 3NRJA 5AW6A 5AI8A 5ALGA 2G06A 2G09A 4UW9A 5AHXA 3L7YA 5AVXA 3IJ5A 4UATA 4YCLA 3I1YA 4AS3A 4YH1A 3ZX4A 2G80A 5AKZA 2AMYA 3AR9A 3TLMA 2AGVA 2YBDA 3OPXA 2NYVA 3B9BA 2GO7A 2G08A 4EEKA 4BNDA 3FZQA 1U2TA 3FVVA 2W43A 2I54A 5AKEA 4YIKA 1RLOA 1Z4NA
chains in the Genus database with same CATH superfamily
1EBBA 5KVVA 1N5DA 2O3UA 1I6MA 4WK2B 4F5NA 2PEYA 3WK4A 2J4CA 2UDPA 3IHWA 2LYHA 3LP5A 3HB4X 2K2WA 1E20A 4FFPA 3R9XA 3A1NA 4LXYA 2E18A 4J7XA 4BO3A 3IGFA 1SCBA 5IIMA 2C20A 3GBPA 1U0SY 9ICLA 2QLLA 3NWJA 1ORIA 3MJDA 3SQNA 2OP1A 2EZ8A 4W1SA 3K9QO 3ZIUA 4JK1A 3RBDA 2EX0A 5GWXA 3SOZA 1PD0A 3T54A 5U4XA 3W6UA 2DPMA 3A70A 1G2OA 3AYZB 3JAWA 1DRKA 3KQQA 4EB0A 1Y8QB 4YAFA 2AXTU 4PHCA 3FB1A 3P9IA 1TZBA 3LQRA 3F6BX 4PZ0A 4EZEA 3FVWA 3AEZA 1AVTA 2OV8A 3D6AA 1G66A 4CF4A 1ZQKA 3LRTA 2YJ5A 1A5SB 5L6MB 2VHEA 3W8DA 1Q1QA 1PQ4A 2FGKA 5WRFA 1ISMA 3NR2A 1WMAA 2AL7A 1HDYA 1Z3EB 3G9ZA 1VKZA 2IBKA 5ER9A 4QG3A 3K72B 1ZRMA 3M5WA 3UJ9A 4TL6A 2DBVO 2TYSB 1IXRA 5F2NA 4U7DA 5TMDA 5AI5A 1AMUA 1QZ3A 1L4LA 5EYPA 1ESCA 2CK3D 3M3HA 4R6WA 3VYSB 2SKCA 4KDFA 1IZZA 3L92A 1D4ZA 4MRMA 1XPOA 1WMSA 3M83A 4TRMA 2HTEA 1QGDA 3WK7A 1W44A 3FRHA 4ID9A 1YQXA 4HH0A 3HH8A 1DKOA 3F53A 3V2HA 2HOQA 1W0KD 4UCXA 2WJ3A 5BNZA 4J43A 2KIVA 1VKRA 2J6HA 3V4FA 3BK7A 1YU6A 2MSCB 3VDRA 4EP1A 2IS4A 4RMIA 1M54A 1JU3A 3NDIA 2GF0A 2P3SA 4E5KA 1U63A 1DRWA 5DN6A 3UGTA 1AJEA 5K6RA 1P0FA 1XHEA 2CFRA 4C87A 1OV6A 3FOEC 3GVIA 3BHJA 3FNGA 3KBOA 1UFOA 3DW3X 1GU0A 4KDEA 4DL5A 3NM4A 1ZQIA 1OXMA 1JQLB 1O95C 3I45A 5K0LA 1OY1A 4DA6A 1XAHA 1SULA 1DKQA 1U1EA 1K27A 1MZVA 1TD1A 5KSPA 3AY0A 1XZLA 1U8AA 3SLGA 3R77A 4LBYA 1OWLA 4W5QA 1BPBA 3SEZA 3BM5A 1Z0AA 2H6EA 3TOZA 4R1SA 3I9FA 2Q7DA 3FOBA 3OU2A 4F21A 1N7JA 1XDDA 2BFNA 4MA4A 3U4DA 1GR0A 1NVBA 2GCOB 3LP8A 4NDNE 4N6GA 1PVPA 5J43A 4R8UA 3N3BC 4NYMQ 1TL7C 2CXXA 3T7KA 1H9AA 4NTZA 4QUJA 2V1UA 2QRQA 2DFVA 4RUAA 4HV4A 4KR7A 2OZEA 2BR3A 5LA6A 4V0ME 3IEIA 3IPLA 4LWOA 4HOYA 3DUFB 4TRJA 1JSCA 4B7CA 3E9NA 4D82A 1JL3A 4EEYA 2YNMC 4IGKA 5KFXA 1HWYA 3WL4A 1DP4A 4FBTA 2EZ9A 3KR2A 3UMMA 4MW0A 4MAMA 4NFSA 4NCIA 3UK1A 1AQIA 4EY5A 2RAUA 5CA1B 3K30A 4CNQA 3RF7A 5K3FA 1C7JA 1EE2A 4CM8B 3RG2A 4G1UC 3Q6IA 1V3UA 1LBQA 5ENDA 5K4AA 1H66A 2HEIA 1M1UA 2H1FA 1D9DA 3D4LA 3V1TC 1DDIA 3WSWA 1ZK1A 5T3YA 1H42A 4H6XA 4ALMA 4AO7A 2QYOA 4LF9B 2GN4A 1XU9A 3ZXXA 3HRIA 2PRJA 1VG1A 3O2JA 1ZK0A 3MINA 2RHBA 1E3SA 2H4YA 2VDRB 4QA9A 2WYWA 3STXA 1XTBA 2Y0CA 1RNLA 1QS0A 3M6AA 2P9HA 4A2QA 2WOJA 4R9SA 3K4PA 4EEKA 4I4LA 2FJ6A 4KIGA 3QPCA 3W77A 3QOXA 1KHHA 3D4BA 2VCYA 3ZGZA 2WTNA 2FN4A 4AZTA 2JDID 2HUPA 1CQWA 1V38A 5AVZA 1GG9A 1O1YA 3EFHA 4X1IB 3EHEA 5KJCA 4DRYA 2Q3EA 4FLFA 4XGNA 1C20A 5KJ6A 3RG8A 3KT3A 1YB6A 3RS0A 1WDTA 2O3RA 3LSYA 4EGSA 4WY2A 1F1BA 4C8MA 2Y9UA 1PP4A 2PSEA 4O4IB 2IDKA 1KAGA 4M9ZA 1MNAA 2B92A 3K9WA 2DF8A 4U39A 1O0CA 1P5RA 1SRRA 1R8QA 3ASYA 4EA9A 1ZETA 1ZVJA 3IAM1 3GPBA 3QW2A 3REQB 5DHFA 4UM5A 3N87A 4KKVA 2GWSA 3JYHA 5EIBD 4Z0PA 5JDIC 3G2OA 3Q1LA 4FUQA 4AICA 3M1IA 1S01A 5DB4A 1SXIA 3HDJA 5BV0A 2FMTA 3HGTA 1ZQCA 3IEUA 5AW4A 4WZBB 4Z6EA 4LXGA 3RH0A 4M9GA 2BI4A 3O8BA 2UV8A 1T3GA 3EULA 1MF7A 3W6OA 1XMOB 5ECYA 3V7FA 3FCYA 1J0DA 3SSAA 4Z1MA 2YKGA 2ASVA 3KPUA 4CM3A 4TZ0A 1Y6QA 1T29A 4IDGA 2XGMA 5HS4A 4O3PA 1TRHA 4F5DA 4F6CA 3HBNA 4FGZA 2XADA 4UB4A 3USES 3P20A 1AZSC 3UOWA 5KTOA 4RVSA 2W9CA 3L3BA 4B43A 3C5HA 1SOUA 4TM7A 4RV9A 1AXRA 3HCAA 4JLKA 4O5KA 16PKA 1BPEA 2A5FA 5BQOA 2N42A 2CMHA 1O9HA 5GMOA 5BRNA 3GARA 1NJSA 2RB5A 1W59A 1QNLA 2G70A 3WE7A 1GA4A 2HC9A 3BXPA 2VG8A 8ICKA 1AB6A 3AUSA 2J9RA 2CL0X 5LZ8A 1TZJA 1GITA 2VSOA 2FSIA 2QYSA 3BWEA 4HWOA 3HJEA 1T4DA 4JXZA 4X6YA 2OA0A 1NYQA 1YZVA 2A4MA 2COKA 3RQIA 1SIOA 3BH6A 3D4OA 3I0NA 5AW5A 3OLVA 3TD6A 1NLYA 4XQCA 4E6PA 3RAQA 1K7FB 4I2IA 1KP3A 3BJZA 2RDIA 1XLVA 5HIJA 2BF7A 5H4HA 2WDZA 5FXMA 1DTWB 3KL2A 4LQCA 5GTIU 1TYDE 1QRAA 2V0CA 2I3ZA 2FWBA 3IR6A 3CPEA 3R3WA 4DL4A 4MV8A 5IT5A 3UF0A 1VA5A 1NFQA 1ZYUA 4M6WB 3G2KA 4R8MA 2AG8A 2H1RA 4B6PA 2QARB 3UYKA 4GX2A 2GJ9A 3R7NA 4UBOA 2NSYA 4M9LA 1RZ3A 3AWDA 1HR0B 3JYQA 1PUZA 4W9RA 3I4FA 1G20A 1GCUA 1TYBE 4JJIA 3RB8A 2XZDA 1NG9A 3HR4A 3MCWA 5J0UA 3QEKA 4NJOA 2HR1A 1UKEA 4QSHA 3RJIA 2NAFA 1GXSB 2WHXA 2F9LA 1Z5OA 3B1YA 5AVTA 2V7GA 1VFPA 4AJKA 1ZW1A 3ZZ0A 1RYRA 3HILA 4F3YA 2GZ1A 4UVIA 3VVLA 4DDUA 2ECFA 1B41A 3THXB 4JJAA 4KLOA 3JQBC 3IHKA 4EY4A 1A7KA 1V4BA 2H1VA 2ODWA 1YZNA 2AMYA 1BA2A 1JFRA 3PXGA 3ICQB 1PEKE 2EC5A 2NV3A 1YHNA 4DOAA 4P2HA 1RLOA 3PSPA 3ODPA 5F7JA 4EB3A 2G7MC 2RSLA 3HY6A 4BLRA 2RBEA 4HRAA 1QG0A 5BMVA 2UZ4A 4DZRA 4M76B 4PNEA 1HM5A 3U9SA 4YWHA 4CTKA 1QK3A 4UAUA 2V6JA 5JVDB 5JXJA 1KI7A 4TQAA 5BP7A 4M86A 4YV1A 4O3NA 1PUIA 5DHQA 5IEBA 3EJ6A 1OAOC 3AHIA 3MCTA 4HK4A 2QNBA 4I9HA 3PNSA 3L40A 1P5JA 5HXAA 4BNJA 3IMEA 4U5XA 1HNWB 3FMFA 2NU7B 3O92A 3O31A 4TXMA 4YHHB 3IXMA 1F17A 4F9TA 1WCXA 1S2IA 4OXRA 2W4MA 4Z6KA 1ZC3A 3QI7A 2H11A 2QU8A 5DTIA 4NATA 1YMUA 5MN6A 3JVVA 2JGRA 2YOHA 3EUEA 4B9AA 4D5GA 1R1DA 4ZQBA 3FOZA 5CPFA 2R8YA 2QUIA 1IM2A 2Y8EA 4YPOA 1EE9A 4GBJA 4OYRA 3CLKA 4GM1A 4ARVA 3E4CA 1T5BA 3JWEA 3D0QA 1GM5A 4NL9A 1T5SA 1H6DA 4BFXA 1P7ZA 5CJ2A 4FS1A 3SDBA 3W5CA 3OFVA 1VPLA 1YOVB 2EL9A 2D1RA 3H2ZA 3DR3A 2NVBA 1H4SA 5HJ2A 1FLAA 2ECKA 1GFIA 2YBEA 2NSDA 4MR9A 3GOQA 4ETIA 3IVAA 3I9NA 4NM2A 2FZKA 1L7DA 5LIPA 4JA0A 3ULKA 3W4JA 4N7RA 2JGDA 1DB3A 1IPFA 4WW0A 3AR2A 1Y1TA 4ZO4A 4P8RA 1JZSA 3RSCA 1UF9A 1ISGA 2NO6A 1TAUA 3UAZA 1DX9A 4B7AA 3HU3A 5L40A 1MFZA 4ND2A 3I5MA 4IHJF 2ZTHA 1H3EA 2X86A 5AVQA 4Y9TA 1RCTE 3IIEA 4RNOA 5JTUA 1VE1A 4UHBA 1F2UA 2DY1A 3PC7A 2CZQA 1NZDA 4NJEB 1LVGA 1II8A 4DGSA 2YQ4A 1S2LA 3KEGA 1WP9A 3A1WA 2BT4A 1URJA 3FR7A 4GBED 2QBYB 2BSXA 1ZAKA 5C1DA 3ABIA 1XN4A 1IN5A 2BUAA 1VJDA 2E3JA 5TVGA 1WYGA 1HZZC 3WISA 4RLHA 3WDSA 4BYGA 4DLUA 3EZLA 4MP6A 1ECGA 2X0RA 3OE5A 1U48A 3JTMA 3QFTA 3NM6B 5F1YA 3EQ7A 3KQYA 4J7CA 5BOLA 5LJLA 4QRDA 2VIXA 1JLRA 5H80A 2JFQA 4X66B 2A1JA 3WJ1A 2XDQB 2D8MA 1KC1A 3A3NA 5AXDA 3V7WA 4BTLA 4D42A 2V7EA 3IMKA 1XLUA 3L3FX 4QUIA 4BFLA 1E1MA 3K35A 2C2MA 3ZD9A 3O9VA 3PUWA 1M1XB 3RB3A 5CM9C 1JU4A 4WZ6A 3JPWA 1NBOA 3WDKA 2QT9A 5L3SA 3N8GA 2F48A 3PUYA 4ED1A 2G6BA 5B5EU 3T5MA 3ROTA 1V1RB 2M6LA 4XPIA 2OD9A 2Y1JA 2ZB3A 4YFYA 3RV4A 2JFGA 3K8QA 3DOIA 3AVUA 4DLYA 2RJOA 4IOKA 2FXVA 4BNDB 2AUMA 3AXTA 1LD3A 4F50A 4NC9A 4LZGA 1VIMA 3RTGA 1XROA 3KSDO 4ZDWA 3H6HA 5J4YA 1RBYA 4WCFA 3R0XA 4F2HA 5CB6A 1HNZB 1YJXA 1E96A 4Q4AB 3NW9A 3JQ7A 1OA1A 1LKYB 1A8IA 5AI8A 4EKIA 1O6BA 3HA3A 1DXQA 3W7BA 1NI4B 3LT0A 3WZMA 1SFRA 4E33A 3O2NA 4HNAB 1Y81A 3LPMA 4RY9A 3IHTA 2K4MA 1W581 3FGPA 3FOAA 3WRXA 2CLFB 3RUAA 2DKNA 4PBSA 3FETA 1YMVA 3VPAA 4ZOBA 2JZOA 4FFRA 1JFVA 3QU7A 2ZVDA 1YQWA 4RZRA 1ZXBA 3E70C 1W87A 3MOIA 4M3NA 1KI9A 4PO8A 4N39A 5A7HA 2COUA 3T9BA 4TKZA 5CJ7A 2DLDA 2FEKA 2GESA 2XSZD 5J4KA 4ALKA 1I7NA 1RJEA 4BC0A 5JATA 5G3ZA 3H8WA 1YCHA 3WK5A 5HYVA 4NFYA 1WZIA 4RDIA 4YR2A 1YD7A 4PX2A 1RM6C 2PUHA 2FPPB 2L82A 3U7GA 3VR6A 4GPIB 4KLHA 1RLMA 4PGXA 3CIOA 4EJ6A 3VR5A 5E8RA 6REQB 1KHTA 2P67A 1ZGZA 2BDUA 2KW5A 4UZEA 5LL6P 2VP5A 4MYUA 1OB5A 1YL5A 3D02A 4DSKA 3ETHA 2FUCA 1U45A 1DKUA 2E4XA 2JIPA 4OQXA 1VMAA 3PUKA 1ODLA 3EUAA 1G55A 3I39X 1G1MA 3HJUA 1LEHA 5LPNA 4MAFA 1LSJA 1WY7A 2WMDA 2YVKA 1KWGA 3FFAA 3QGMA 8ICNA 4LJAA 1H38A 3I5YA 5KG1A 2JVIA 5K3CA 3CBGA 1ZA2A 2GN9A 3TNJA 5LMNB 2BMDA 3N2KB 1Y3IA 4FQ8A 5I9IA 1I80A 4BO6A 3EVDA 4JGGA 3NOXA 3KFUF 1SK8A 2OD2A 3FFXA 3FKJA 2QR5A 2YWXA 1Z36A 2GXUA 4RNDB 3GUZA 2OFXA 3U4AA 4HZUA 2V7VA 4ZI7B 1T0BA 3SHTA 4QQ8A 3T5LA 2O1WA 2HV9A 4XD2A 4P3XA 2IKQA 2CL7X 4P3PA 5DE3A 1V8PA 3HBJA 1MG0A 3VKUA 3IULA 3VA7A 3TRKA 1IRIA 4TS3A 3T41A 3PV0A 5FI0B 3ZQJA 4M46A 5KG6A 3ZUPA 5BNIA 3VOBA 4E70A 4KXWA 1EPUA 1KY3A 4AZSA 1IZ8A 4IG4A 3TINA 2X4LA 1NE7A 4HCJA 1N6IA 4RDHA 2JJ2D 4FW8A 2XNJA 4X3PA 4LEIA 2WTEA 1WLSA 3D1VA 4ODIA 4IIBA 5KNLA 3PNLA 2GZDA 3MJHA 3ABSB 5I7RA 1ZHHA 1E92A 3DLCA 3DNPA 5BO5A 3UG6A 4GP6A 4IBOA 3M9XA 2XE7A 1CB0A 3NTUA 3NHBA 3HK2A 4F4UA 1UMCB 2AE1A 2JL1A 4P5PA 5HDBB 3FUUA 5T4HA 2OSBA 3OTOB 4DXDA 5JUMA 3G59A 4UTVA 4IDEA 1Y5LA 1BDHA 1AHIA 1N63A 1QGUB 2AFIB 4H77A 2ZRBA 5JROA 1UEIA 1X8KA 4OQ4A 2HBRA 1RHRA 4B74A 3QKSA 4EMBA 4NL4H 4GO1A 4OV6B 2OL4A 3GFQA 2ZSBA 1TO6A 3A8TA 2AW5A 2GYYA 3SS8A 3MOGA 3VQTA 3Q8KA 7ICIA 4CUJA 4IXWA 1CEEA 2PX3A 1RRMA 1Y9EA 3UMSA 4KLIA 4MINA 2F43B 2VXCA 2O2EA 1IIBA 3NGLA 1T1IA 1ZJNA 4X20B 2HU7A 3EOBI 3QHAA 1HNXB 3PVCA 3H1BA 4NY1A 3OJSA 3NRJA 1I0IA 2KSQA 3EEBA 3L7YA 3NP9A 3EASA 2XWJI 1CQIB 4RTPA 3WB9A 4Y7CA 3PNCA 2D3DA 3WY9A 3O8LA 5HHTA 4RJIA 3IG8A 2C2KA 4XVUA 1YASA 1IRXA 3RK0A 2JAWA 4DBLE 1GO3F 1FP2A 1KRHA 1I2DA 2KHQA 2ISPA 2KSOB 2PR7A 3HFSA 3I6YA 1NJ2A 4B84A 2WYOA 4AN1A 4OJ5A 1Y7IA 1K8QA 5CNKA 4H60A 3GJ7A 3I3SR 4LY6A 1KZ9A 3VC2A 3QOFA 2R3SA 4V0NA 2PH1A 3ZGVA 1JV2B 4BVGA 4DUZB 3IAM6 4QUGA 4FZ3A 4Q7MB 1KOJA 4MI6A 5KG3A 4TXHA 4KQ2A 2WG0A 1KYQA 2QYHA 1HURA 3H9JA 1XB2A 2Z98A 1PGQA 2MMCA 3GFGA 1U28C 1A1VA 4FNMA 3OD1A 3FCOA 3PRJA 4KJXA 1VDZA 4WH0A 2F8KA 2JEFA 2Q3CA 5F2EA 2O0MA 1KU6A 1B4FA 4B33A 3WYAA 5F35A 3RR2A 2KPOA 3M8KA 2B4RO 2J3KA 2QSZA 2E21A 1YZHA 2Z8YM 1G2IA 3MRSA 3U7FB 4EO4A 2MRLA 1WUJS 2WIFA 4YRCA 4R41A 1YL7A 1WKBA 3E81A 4M1YA 3HXMA 4TQGA 1CJMA 3GRKA 1JEQA 4I9FA 3CZQA 3RTBA 2BHSA 3HO6A 4HZGA 4QL3A 3A1DA 4R40A 5L3QA 1Q0LA 3GNQA 3DTVB 4RTNA 4PNHA 4P3OA 1GQRA 3EGEA 3UCFA 5E1BA 5A3SA 4MDEA 1M2WA 4Q93A 4PAOA 2ZUEA 3SR4A 2VTDA 2BUCA 3EGIA 1JG2A 2DQKA 1AMOA 4KO8A 1WCNA 4Y1RA 4PQGA 5A02A 1BHJA 4EG1A 4ZMRA 1K7XB 1FUIA 1S2MA 5AVRA 4PGMA 1D5CA 4CI0B 5CLJA 2O8VA 3INNA 3B85A 1CDOA 4X97A 2JGIA 1HIWA 2D4AA 1Z6YA 1FX0A 3SAHA 3EIFA 2Q21A 5FNZA 4GE3A 1SKRA 2MA1A 1B42A 1EJBA 4H59A 1JQ3A 3H2SA 1T91A 1K68A 2BGIA 3ITEA 4K2HA 5IKXA 1RRFA 1FMFA 4PVDA 1DXYA 8ICLA 1KYIA 1PJCA 4LJ9A 4J49A 5DG9A 2PPLA 1TDJA 2H1HA 3FSGD 3GBVA 1NXSA 3QW4B 1XZ8A 4ZOQI 4PHEA 2FLPA 3RFAA 3LUGA 3SCZA 2HMXA 2ZBGA 2QE6A 4HMOA 1UFKA 2P2GA 2ZK7A 1L1RA 3CS3A 4C6TA 2R60A 1ZN2A 1UK6A 1RXWA 3GP5A 3D4PA 2BKUA 4BYMA 1USUA 1NQVA 2FPRA 3EE6A 2F8TA 3NORA 1OT3A 3BB4A 5EWMA 3FSEA 1Y89A 3K1RB 1C9DB 2ZRPA 2G5TA 4QVKA 4BWJA 1UZLA 2MJLA 4GE0A 1CDZA 3F6PA 5LU9A 2NRTA 2WD7A 4HH1A 3VR5H 2VUUA 3LC1O 1IZ9A 1V3TA 4AYBF 1G8JA 4YJ3F 4TURA 3FCEA 4E0BA 2QW0X 2ON6A 1YFKA 4RA9B 5K3OA 1V6AA 4TSFA 4F85A 1EUDB 1MIOB 4LJ4A 3GEPA 1SBHA 3SZOA 3GGJA 1ZEJA 2FCRA 4QXQA 4I5GA 3D6UA 2ZSUA 2V58A 1TPYA 3PSAA 4A82A 3RE1A 4PONA 1Q77A 2IH5A 4YD1A 1INLA 1BCSB 1MX9A 3FFTA 2FOLA 2XVZA 4TMXA 1Z6QA 4Z9YA 2QUJA 4ZT5A 2I3BA 2E2WA 3A6DA 1ZJMA 1Z34A 3NX4A 4FXOA 2EZTA 2W2XA 3S5UA 1KKMA 5MGNA 1N8SA 2QTMA 3NLLA 5C8XA 4MKXA 2ZG6A 5TEVA 3V9PA 4F04A 3H0KA 4OUDB 1MO5A 3L8YA 3M82A 2CVHA 2A58A 3PGA1 4MWCA 3PCXA 2Z56A 2VJ4A 4BECA 3H9GA 1YA6A 1RWVA 3P9PA 2AI3A 3GJTA 5FUWA 3PGVA 1OOEA 5CRIA 1QU2A 1XR3A 4DADA 3BE4A 4ZYUA 5EKUA 1LV5A 4CT4B 4DA9A 3PW5A 1WU7A 1Q0TA 1E3DA 3E22B 3ZCPA 2J9FB 1ND6A 2F1OA 4F9FA 4UBCA 2WM2A 4CMCA 2C88A 3T06B 3U9LA 2YN0A 1UKYA 3FPCA 3KJIA 2K8AA 1Q6ZA 1NZPA 4YD2A 5ARBA 4CFSA 3R3YA 4URHA 3FOFC 4L8LA 4LJ6A 1NTOA 1MOZA 4UMDA 4HDSA 4PQFA 4OQFA 4WXPA 2ZJ4A 1CCWA 5DBCA 4NEGA 2IKSA 5TF0A 1YI0A 3CEMA 3EY9A 4LHSA 4HDRB 3KU1A 3N58A 4LZLA 4R8SA 1R4NA 3CY6A 1OH6A 1S0NA 4BAZA 1ETUA 5E1MA 5I47A 1T3LA 3GJSA 4UVDA 4CG1A 5DTQA 1JE0A 421PA 4D98A 2Z2JA 3JX9A 2HO4A 4DIFA 3NH9A 3BCUA 2HHTA 3OQVA 1C0EA 4DFDA 1N48A 4H15A 4WNAB 2PH3A 5F3DA 2V03A 3FTDA 3HNPA 4DQSA 3LI2A 1HY3A 2XGQA 4GP9A 2HIAA 1AHHA 2CFIA 3E1GA 4PYJA 3ZDDA 1WUTA 2C07A 1NPYA 3SEFA 2JLYA 5G5GA 5IW8A 3EXIA 1KQGA 3DW1X 1XXHE 3AIIA 4ZVVA 3HKZF 3IIIA 2NTJA 3VAZA 3C24A 2L17A 5LP6C 2W90A 4EMUA 3QEOA 1KMQA 3KC2A 2JA1A 4UULA 2ZATA 3MDAA 2M0NA 3W2TA 4PSDA 5HUQA 2XDAA 3IAS1 1M2VB 4LSWA 2PSHA 3RF9A 2XRYA 5JUWA 5LQRA 4MW6A 2CDRA 4QYIA 3A6HA 1PW7A 5IG2A 5SZIA 4OU4A 3E5RA 4JP3A 4IIGA 5BWOA 4YDHB 5IIJA 3PDHA 5K0ZA 1O3YA 2LM4A 5CEJA 2CEKA 1IVYA 3ZLTA 4QO7A 2R6FA 4F5YA 2P2YA 3WMRA 2AXPA 4EKGA 1UMDA 3U6BA 4OQEA 9ICEA 1I7SB 1AS0A 3BICA 4OHPA 4CUKA 3F7OA 5HUHA 1B0ZA 1G5RA 1BCRA 4EF6A 4NBKA 2LYAA 4HY3A 1XSNA 3BAFA 3L18A 1G1AA 1CE8A 5ALHA 4PZLA 1P75A 3T3NA 2VRWA 4X91A 1JLMA 3UENA 1GGFA 1K1SA 2YOFA 4AYWA 1ZN9A 4D57A 1NOKA 5LMUB 4KPUB 5KAIU 5JS2A 4JLDA 1A82A 3I0ZA 1Z1BA 2OXEA 3WKCA 4YJHA 1CP3A 3FR8A 1X77A 5DNUA 1EDEA 3TLGA 5L4NA 3O8RA 3L4PA 1N77A 3H1TA 1S9DA 3I3OA 3NYRA 2HU8A 4HDKA 2LR0A 2D0IA 3HYNA 4PG6A 2XRMA 5CEFA 3WL7A 3FBTA 4HATA 5FA8A 4ECRA 3PW4A 4PYOA 3WLNA 4ZHSA 4KFSA 3FUCA 4Q3BA 3ONEA 5IBQA 1P1RA 3P45A 2VBFA 2ZCVA 3PJEA 3I8SA 1QKJA 1ADBA 5CAEB 1YOBA 4KGDA 2PIDA 1SUFA 3C6KA 4XUEA 2WNIA 2Y77A 1O54A 1KVSA 4X95A 5JSZB 4UBNA 4EO9A 4TWBA 5BWNA 3KKPA 3OA0A 4EQ6B 3MJRA 1E8MA 3GFFA 3ZEAA 4CXMA 3C3JA 1Z1VA 5CIWA 5JG7A 5LYJA 1N6RA 4MCHA 2H7CA 4ZCPA 2P9FA 4XX0B 1RQPA 1LS6A 2AFRA 5D01A 2ZIUB 4LJ5A 1ZY2A 4F5RA 3EW7A 2LDXA 4LSZA 2GAFA 2H5XA 3ISBA 5JAQA 4F7WA 1Z7WA 3K70C 2NU8A 1VPEA 2FPGB 2HTFA 1D2CA 1VBNA 4CEHB 2W42A 1EA7A 1Q2UA 3IDFA 3FWZA 5ALFA 4U8GA 3H5NA 2VAMA 2WSSD 4AROA 1MN8A 3X1DA 3KQTA 3DKPA 3F4KA 2ZDGA 2PLWA 4MP8A 1V5GA 1O96A 4H27A 2C1EA 3H5VA 2EFCB 4TUYB 4ISCA 3UW3A 2PKQP 1CR1A 1FVOA 4G4SO 4IHQA 3RC1A 3SFZA 4XTCS 5TJ9A 1A88A 1PNOA 3ZBUA 4D74A 2WT8A 3B3AA 1DK3A 2VWPA 3I62A 4QPDA 2JJ8A 2ZP1A 2GEUA 3H84A 5EHZA 4B3JA 1FYFA 4W6ZA 2DYKA 3WR5A 1U0OC 2PL1A 3UHFA 4NCBA 2HCJB 1EFHA 5IINA 2DBZA 5I4CA 2FQXA 5KT7A 4RIHA 3FGZA 2W2KB 4DW8A 2XF8A 2IOFK 2PKCA 4OATA 4R05A 2J5XA 2VUHB 4E4TA 2O1XA 2FEWB 5FD8A 3P26A 4PFKA 3EDMA 3B0XA 3IERA 4ZIRA 1JSXA 4BBJA 3J80A 1U7TA 2JJQA 1MTZA 1QF9A 1AS2A 2FE4A 2UUPA 1EXVA 1G8KA 3K0HA 4NAVA 1FXWF 3AL3A 1RC1A 5LWHA 1T2UA 5K3BA 5JXWA 4F5OA 2VRBA 3MCUA 5DQGA 4E5MA 3SS7X 3GRVA 3LCJA 1K8RA 4Q05A 4L6AA 1HFEL 3DOEA 3EZFA 1JMSA 1YB1A 5IM5A 5GZ1A 2X2FA 1G7TA 1U0NA 4HGQA 4EUKA 2G04A 3BSYA 3DWEX 4BNHA 1YR9A 3DDSA 1P5ZB 2E1RA 9ICAA 2KZ3A 1VL1A 3W2EA 1GD1O 1FXSA 2W03A 4FEGA 3ENWA 1ZD9A 2VUIB 3THOA 2H1OA 4ZOHC 4AJEA 4FHZA 2VSFA 3ZCSA 4MR8A 3AYXB 4RWZA 3QFRA 1C5KA 3FNBA 4JIGA 3BWVA 1AKMA 1M7GA 1L3CA 3IUQA 4F46A 3BC1A 1QQAA 3S1AA 4FXPA 5SYMA 2GBIA 1E9RA 5B1SA 3QHQA 2BR5A 2V3CC 5EQDA 1Z8NA 1IHPA 4O2AA 5EUBA 4D97A 3S6JA 3WNCA 1EXDA 2HQOA 3SF8B 3VISA 1IEXA 1K5PA 3LUBA 3A1VA 5C1BA 2BSAA 3LUAA 4P7BA 1DIOB 1SH7A 3P2KA 1K5HA 4C8LA 1UBOS 3OUTA 3PO5A 2GBGA 2UUOA 4M9CA 1OIWA 3R20A 2YFKA 4RJJA 4NNOA 3H8MA 3T7RA 2O59A 5KWEA 3CSSA 2FZ4A 4Z6FA 4MF8A 1CEQA 3W3ZB 2KN7A 4V0RA 1NRWA 1G5TA 4QSMA 4KPFC 1V3VA 1WXGA 4R1OA 4XQEA 3ZTWA 1HE3A 3KR1A 3OCZA 2XA9A 1ICEA 2JFOA 5IN5A 2R6HA 3HR7A 3E3LA 2QNRA 5BN5B 1PJ3A 1EVYA 2F4NA 2CLOB 1AXEA 4RPXA 2FX2A 3LFTA 4BQSA 2F1JA 3RYFB 3GJ4A 8ADHA 1IIPA 2ASLA 2A0XA 1PVOA 1U90A 3I01M 1RPNA 1ECBA 1LWOA 5B3KA 2WK1A 1MA3A 2ZGVA 4NCNA 3AU9A 2X8JB 3DEHA 3BQMB 2XYQA 3NS7A 4XDHA 2JZBA 1ZYQA 2DFKB 3UPUA 3BXOA 2H06A 5AMXA 3SQWA 2VPWA 2SHKA 1FFHA 2QMUA 4KXMA 4KEAA 1C80A 4ENTA 5AKEA 4YREA 3SI7A 4DLBA 1K7EB 1C0KA 1P7PA 1U7PA 3R4CA 4KLAA 2QL7A 1CETA 2NN3C 3HUEA 2LHTA 1KS9A 5JCJA 4MTLA 2PI4A 4B9VA 3IM1A 3H16A 3M3DA 5AIAA 3RSSA 4EJMA 1AO3A 4V3CA 2PMBA 1Q6YA 2OFWA 2VNKA 3BFKA 4QOIA 4YDQA 4KQJA 2JFZA 3OSUA 4A0SA 3K20A 3AOEC 2XIQA 4O5EA 3VPGA 3B6KA 4KL8S 3ZKWB 3ZHTA 3Q2KA 4IJQA 3WRWA 4BMCA 1IEWA 2R18A 2AJBA 5AKKA 3H9BA 3DBLA 3A26A 3QUBA 3AVQA 3AZOA 3VVBA 1CYEA 1N32B 5CLFA 1DCMA 1G19A 5EHNA 3PIDA 5KHAA 4JUZA 3HBMA 9MHTA 3WLEA 4Q3LA 1XFAA 2A1TR 4C5BA 1W7AA 4G5YA 3RQSA 3WNDA 5L7TA 1WDMA 2AJ8A 3AM4A 2FG7C 3MGHA 3PXEA 2FFBA 2XJ4A 3TNDA 4MJ3A 1Q14A 3M1AA 1YRYE 8ICWA 3LY9A 1Z62A 3CE9A 5COBA 1L6NA 1Q5PA 1FUEA 5FBHA 4A8TA 5INTA 5C0OE 3A28A 2XHEA 3AHFA 5H8WA 3IVMA 3EGOA 4OJMX 4BS9A 2V7QA 5BN3A 2HIMA 5EVCA 3IFSA 5EWFA 2VA8A 4KFUA 4E03A 1O6CA 3AY6A 2EW2A 1IZ7A 1KI6A 1K7CA 1LC0A 4JQSA 1KPHA 2QQEA 1XCGB 3HVUA 3LT1A 1G3UA 3AV3A 3OAAD 2YJNA 4GYJA 4ND8A 3ZCQA 2JIBA 5KBYA 1LKZA 1TEHA 1UDXA 1IHOA 4UB8U 4LN1A 3ISDA 3GFRA 3TIXB 3WJAA 4O3SA 1ZSNA 4K46A 4EHLA 3DNMA 5IJ0B 5L53A 4YRIA 1KK3A 3FIJA 4AP9A 3NVWA 3A9SA 5HF5A 1Y5MA 2XMDA 1T3HA 1U0FA 3TDMA 1PLJA 9ICHA 3WJ2A 2G83A 2HSGA 4ZO6A 1WX1A 5ICSA 1HXHA 3FLBA 3BJRA 3HUUA 4DDKA 1CJTC 4Y30A 1ZUD1 1SKBA 3AFNA 4PRKA 3P9ZA 4QREA 1URPA 2QNIA 1NM5C 3PQ8A 4B76A 1B15A 1CY6A 2A1IA 2O2SA 4J0JA 2P2LA 4MGZR 4S24A 3PC2A 5IAGA 3V2UA 1OLUB 3ZHYA 1H2AS 4R8LA 4OKSA 2XNCA 4YXJA 4KAXA 3DV0B 2WTAA 1AUXA 4EUSA 3DULA 5E1OA 2IUSA 4CM4A 4DLEA 1O0BA 4MVJD 8ICQA 1IBKB 2ZUCA 4HWKA 2IYFA 3JQAA 1OIVA 4AI6A 2C83A 3WVNA 4QWAA 3Q9LA 4QZCA 3LHKA 3E2EA 3BDPA 4YRJA 3HCEA 1M0WA 3Q3VA 2G3YA 2P65A 4WXYB 1RAAA 5CD9A 9ICWA 2HZ7A 4M1KA 2RGEA 4PG5A 3T1VA 3VHXA 4DOMA 1R0LA 3OKAA 3S7ZA 1U65A 2QI9F 1PK1B 2Q3DA 8ICBA 3T1NA 3I5XA 1Z7BA 3SDSA 2ZWAA 3RS3A 1Q44A 4B6JA 4NMLA 1IOVA 3W9YA 1QHFA 2H5IA 3WO1A 2H4HA 4ALIA 2O07A 2ZRAA 4WZAA 1ZQRA 1ACLA 1UXIA 4V0KA 1NOJA 4HDMA 5KCZA 4FFMA 1HF3A 2AI1A 2I4OA 1GKKA 3CZCA 4XKJA 1RWQA 1DIHA 3WKEA 4DG8A 4HJRA 4F3TA 4MW1A 3LUHA 3FLEA 4ND1A 2GK7A 3ZDBA 3UTDA 2XIDA 1QX4A 2AG1A 4HDNB 1KP2A 4GLFA 4YPVA 3VSDA 2KP7A 3V8EA 4L50A 4FNGA 3PT5A 1PF7E 3AR6A 2GUWA 1JNYA 3T7EA 3EGWA 9ICVA 3GLQA 1KWKA 2CF5A 2XITA 3ADBA 3ITKA 2J9XB 1DXSA 4XB2A 5I7EA 2AVDA 1XTVA 3GU3A 4FYKA 1K6XA 5IANA 1Y98A 3KHKA 3VR4H 4OXIA 4K3VA 2GF2A 3CRNA 4KO1S 5EHQA 4DWWA 2I9KA 2WTXA 3CF0A 2A1AA 3PZRA 3PL5A 2OZVA 2VHZA 1ZH4A 1TF5A 1SUEA 3ONDA 3O6VA 1NR5A 5AVVA 4KUEA 3W5JA 4J1QA 9ICNA 2HJRA 2QTGA 4WAUA 2QTRA 5LP6B 1KW4A 4TLBA 1G4AE 4ZA2A 2WP8J 1E94E 5BN4A 2B99A 2QE7A 3DMRA 4OXYA 3PRHA 2YV2A 2XZOA 3LWZA 2FZCA 4RFSB 2FTKE 3OEHA 2YWFA 3K9GA 3AEUA 4IZOA 3WGTA 3VC1A 4QZHA 4AD8A 5F7ZA 4EGFA 3IR7A 1WZCA 2O2DA 1XZAA 5GZ3A 1DJPA 1N3IA 1Z4KA 4RAQA 2QW8A 3GYBA 3G2HA 4I9UA 3HJRA 1O57A 1TVEA 1XEXB 1Z22A 1XIVA 1OBCA 4V0OA 4LTNA 3GQBB 3ZK7A 1FNDA 2CL5A 3OM9A 4AQYB 2GT1A 4H7HA 5DG7A 1RM3A 2HRCA 3P2IA 4RVGA 2EFYA 1Y9ZA 2LV8A 2QRJA 4YAWA 1NVDA 1ZQTA 2I76A 1CK4A 3B1XA 4RYDA 4UHCA 3TOSA 2H2WA 4CQMA 3X1MA 4IRXA 4LX0A 4UDNA 1FYEA 3U80A 2BM8A 4RD1A 2DR0A 1C2TA 4Z7JA 2PFOA 3P0JA 5AJVB 3T3OA 2VH2A 4NI5A 5ENZA 2BFCB 4B0OA 2VDMB 1KETA 5E0KB 5J2UA 2G1UA 3IAS6 4BRWA 1G8SA 5I45A 2WI8A 1R74A 4R6XA 3X2FA 4OBEA 2PS9A 1IMOA 2VS1A 3W9UA 4PSAA 2A19A 2SICE 1BVHA 4WV3A 4DV1B 4AQDA 3B89A 1JIIA 2OV3A 4Z51A 5E4FA 1LDNA 3SQLA 3K0FB 2CLKB 2ZIVB 2QB0B 4Y6RA 4HGYA 5C4MA 4BMPB 3GFKB 3G2QA 1DBPA 1AO0A 4Y9SA 5D6OA 5CLHA 1UBSB 1NLFA 4IHAA 2W2VA 3CKYA 1JJBA 5FNVF 4RGBA 3P96A 3GPLA 1OBFO 3UBMA 3SR0A 3ZWOA 3AZPA 3IAAA 5KOHA 2PL3A 2UYYA 3FAKA 2EANA 1GLGA 4DLRA 4RL6A 1M2JA 4HH3C 4J3FA 2RBKA 4KLZA 1KK1A 4DIDA 4OQMA 3TLCA 3C1YA 4BFVA 4LF4B 4IX9A 2UVPA 3LY7A 4WLEA 5B7GA 2OGWA 3BEOA 3GDFA 4Q7JB 4K88A 1L8LA 3IURA 3G1TA 4KNWA 3IO5A 1FQJA 5TARA 4Q82A 1CV2A 9ATCA 1Z16A 4EZ9A 4QT0A 4H3SA 4ES6A 3K70B 1FZQA 5ADHA 2Q41A 3OQ6A 4L27A 4YYZA 5EFZA 1GRQA 1JSLA 5TE9A 5DP1A 1A96A 4BFUA 1H85A 5LYYA 2DZDA 4I2VA 4ENPA 3WYCA 2WRZA 1WOMA 2GVZC 4EHDA 1V9CA 4AZ3B 1XEWX 4IS3A 2QTVB 3M0EA 4RZUA 3HEBA 1N36B 1U8FO 2L69A 3DXZA 1YJAA 4YA6A 4BNMA 2QKYA 1E1CB 1U7DA 1RE0A 1DQRA 2AUNA 3ZEIA 3B9JA 1UJMA 3H11A 5JMOA 4TLLB 3HCWA 3MXOA 4HMPA 4W7SA 3P7MA 5AVUA 4GX1A 3WZ2A 3PZPA 1E8DA 1T0UA 5KQMA 2X42A 4EB6B 1E79A 1BVUA 2NVUA 3I5UA 1F0NA 4HKTA 3R5HA 1YB5A 4A3SA 2FUG1 4DR7B 4TV8A 2XQVA 1G2PA 2AMJA 1UPUA 2X2EA 4QIWC 5EWJB 1L5HB 5AK5A 5T57A 2EIXA 3LSTA 1K66A 1XL0A 3IEKA 1W76A 2FZLA 2JLSA 4OKNA 1FY2A 4EZBA 1N2EA 4P36A 2M9MA 1PZXA 3T52A 3GJ3A 3H3JA 1TVKB 4FMCF 2ZWMA 3RK1A 4RS3A 3EG9B 3KHUA 5AOVA 1NW3A 2ZS7A 4C3UA 5F9HA 5KYWB 1UBTS 4NS1A 2C2EA 3WYGA 3VOSA 4UNSA 1GT6A 4URUR 1H1DA 4NJMB 1JHRA 1W5TA 2D5LA 2P9JA 1T8SA 1NXOA 3A31A 2H54A 4WIAA 4Z0HO 4CEJB 1PT7A 3G5LA 4PSVA 3PTZA 1CDDA 4IICA 2OVFA 2PUEA 1HBJA 3PUJA 5GM2A 3HB5X 4Y2QA 3FDFA 2KMDA 3IP7A 3M6ZA 4DL6A 4IDBA 5IPFA 4D9NA 1UQUA 1W36C 4LNUA 3X2EA 3EVZA 4WFQA 3TLZA 4YRLA 4B4KA 3W2FA 3IUBA 1GNVA 3ZN2A 1E2UA 3RAEC 3QF4A 3N75A 3AJ8A 4G8BA 4FOTA 2C2BA 1T15A 3E15A 1M2GA 1TVMA 1XD2B 1SUPA 3H9CA 4L3OA 4DF4A 1H8HD 4M8IA 4FOPA 4A0HA 1M0SA 3EXFA 3SEQA 4ETMA 3ND7A 1MB9A 1XJ5A 2I5HA 1SC3A 1SCKA 1UFRA 3MCVA 5FLXA 4YR0A 4GOOD 4OMCA 5H3HA 1ST2A 1RZVA 1R88A 4DIEA 1KMCA 2HO5A 3AR4A 2EFGA 2BM0A 3A6FA 3RJEA 5IU6A 3HGMA 4ZAVA 1CF2O 3W04A 1I8TA 2AFHA 3BQ7A 3G8YA 4QXPA 4F5ZA 1QHGA 1B93A 3L93A 2JZCA 2JNWA 3ILXA 1PL6A 4OIFA 4DNQA 4IVPA 4Z7OB 3O8OA 3OPMA 3DMDA 3QOYA 1E1NA 2DCUA 2B35A 1IQRA 3RVQA 1MR3F 4PVCA 1KKLA 1VBFA 4TZKA 2GN2A 4UCQA 2XTNA 3PYXA 3MWDA 1YVEI 2Y76A 2ZQ5A 2ZI7A 2YZGA 1HUZA 2WYHA 1DARA 4EENA 1V35A 3LDHA 1F06A 2QSUA 3KOXA 4S3MA 3IAFA 4Y2JA 3BIWA 1UIRA 3GG2A 2GN8A 3LDGA 3DC2A 1QCCA 1YS9A 4LIPD 5LDHA 1YI1A 3QZ8A 2Q6OA 2VTEA 3SMVA 4I8XA 2NYUA 3O4RA 2AHOB 2MTBA 3NAZA 1T3TA 4R3NA 3V2IA 4F06A 4ZZ0A 3GLTA 1WPQA 4MVWA 3IQWA 2ZYHA 4D6XA 4BC1A 1XTUA 2FMSA 4COKA 3V4OA 4Q9JA 4BX2A 2D5AA 4LE2A 1NSTA 1M34A 3FPGA 4L72A 4MGHA 1V1MB 2H17A 3K4QA 1KOLA 3HVHA 4JV1A 1J70A 2JAHA 2BKXA 1YIAA 4PGAA 1QUFA 3WGHA 1H4QA 1AGPA 3ETEA 3AC0A 2VK4A 2IE8A 2AOXA 3N07A 1SXHA 3ANMA 4HAOA 1CWUA 3JPYA 1IXYA 1H65A 3D4IA 3UJAA 5A03A 3AR7A 2VJNA 3R0ZA 1QGYA 3OTHA 5IH7A 2KBEA 2BIFA 3KAKA 1TM1E 4PYRA 2VYND 3E8SA 4N40A 2KJ8A 2PV0A 5L1MA 1EHYA 1DPGA 1T3NA 1TT5A 1TJYA 3JZDA 2VNIA 3RIYA 2R8JA 1N2ZA 1KDTA 1BKSB 3GEDA 2J9YB 3Q0EA 2R1VB 2VPPA 3VGJA 3LYSA 3WOHA 2L42A 2QM0A 2PX0A 3GCDA 4YO7A 2YY5A 1P9RA 5BOSA 3K1JA 1WW8A 3MW8A 2OWDA 4MDYA 2AQ4A 1G64A 2BFBB 2KEYA 3PDIA 2F2AB 3U4MA 2I6GA 4GD3Q 1BEUB 1YDWA 1F0KA 3THWA 1EA5A 1CRQA 1XQ1A 3UT6A 1P7CA 1PWXA 4DABA 4B6QA 1SJ9A 3H1FA 5KFTA 4HUQB 3I73A 1MB3A 1EAYA 2RD2A 3Q5EA 2W00A 3DLPX 1BWRA 5IDVA 4RFLA 3TQQA 5HCNA 1KE2A 1X9WA 1NLMA 4O6VA 5EE3A 1WBDA 4V1CA 1DCFA 1XGKA 3MSXA 1LV7A 2OMKA 3Q3JB 4OM8A 2RMKA 2J85A 3PUXA 5DBBA 1XQXA 3LUKA 5EPEA 5I7VA 1OUMA 4NX2A 4DR4B 4N12A 1V8BA 3BORA 5TPWB 4LRSB 3NO4A 1M0EA 1WP4A 1KU0A 5IDXA 3A1SA 2GZAA 1PVQA 2BHNA 1BN7A 1PLLA 3KE8A 2XZLA 3Q9UA 1NJYA 2ZIEA 2C2GA 5FJIA 1YONA 1GNQA 5EESA 2DOKA 4D3SA 3H42B 3ZY3A 2QUHA 3DO8A 5FA6A 4KNYA 4UAGA 3C8HA 2XTAA 3JQCA 4DARA 2NUTA 5EL0A 2XY4A 1SHJA 3E1KA 3I1JA 2EKPA 2PAAA 3NHLA 1WHSA 2GK3A 4KQFA 5JH7F 2J32A 2E48A 1MCZA 5C8YB 1FVFA 3MPOA 2QMHA 3DFMA 2GLEA 3ABQB 5T4EA 2J3DA 4JI2B 1RYNA 2EFDB 4P2BA 4C0ZA 1DXOA 3QPDA 4PYQA 4XJSA 1BWQA 5HQTA 3NOOA 2QQGA 4UB3A 5FX2A 4A16A 3A36A 4HQRA 2DTDA 2WKPA 1WBJB 3W3AA 4O9MA 3OECA 4IIUA 3SYNA 4KITB 2NM0A 2EFEB 2FEXA 2GB4A 3R2JA 7ICKA 5ABPA 4P84A 3VZQA 3LZDA 4U02A 3KXLA 2FETA 3AGPA 4N76A 1UPXA 5DVZA 4U2BA 3OCJA 4BVBA 4UASA 1V8FA 3A0HU 5DB6A 3RPEA 3VPDA 3PEUA 1UBMS 2GNPA 3K1ZA 3HDTA 2Y0SC 3JXEA 3QFCA 3ZVLA 4PZNA 5ANRB 4YRSA 1Z37A 1XTIA 5BR4A 1ZMOA 4N5MA 3IUSA 1P1JA 2ZJ6A 3U39A 4J4BA 1GU7A 5J2IA 1Y8QA 1TQ4A 5IT4A 1S2OA 3Q6MA 1ZNYA 2M2IA 3KYDA 1FLVA 5EIBC 3DOHA 1IUNA 3MGKA 1ELOA 4EBDA 1D07A 1JAZA 3HCBA 4QM6A 2RAVA 4WNIA 3ITNA 1I2ZA 6YASA 3R3ZA 1ZJWA 5L3RA 5J8YC 2VLBA 2VNJA 1E0SA 2GJAA 4MK4A 2E5WA 4JQYA 3CU5A 3AKCA 3X3HA 3LHSA 2XD9A 1AH2A 4GZLA 1AC5A 3IAHA 3ZHXA 2FN8A 1C14A 4A1FA 3SICE 5IH3A 4GXRA 3WYBA 1KI2A 4AECA 4QOGA 1CQPA 4GXTA 4XA5A 5CT8A 4XWYA 2R8PA 2GM3A 4D8YA 1Z0JA 1MQSA 3MBIA 1X3LA 1LGYA 3LECA 1HC7A 1RZRA 5IWAB 1M1NB 1PUJA 4WI1A 3AVYA 2N9UA 1ZQJA 3U3DA 2G4CA 1AV7A 5DASA 1NUPA 4UB2A 2HHQA 4DEXA 4DG9A 2HK8A 2JGJA 5KJEA 2H7YA 5E9AA 1CS0B 5I3ZA 3WBBA 1XJ0A 2C00A 4YMOA 4FOLA 3NEJA 2QVLA 1F9AA 1ZMBA 4QO8A 4Q0MA 5F5XA 3TMYA 1E7QA 2WSYB 2QYTA 5KFZA 2QV0A 2YBDA 4B9SA 2BMJA 5DB8A 1G5HA 1RTTA 4EG8A 5IM4A 1RT9A 1V97A 3FSRA 4FFVA 5JDCC 1B8PA 5G0TA 4C5CA 2P6UA 5KFQA 3PRKE 4KQ1A 4J9SA 4L28A 3QX7A 4PL2A 1FRFS 1F7UA 2F76X 3OA2A 4KLUA 2AOTA 3JQRA 1VG9B 4BJHB 2UZAA 5A4KA 4GKAA 2X1MA 3EUFA 1PK3A 4W9NA 4OLFA 3C6MA 2ZJFA 1JR3A 2WY2D 2ZJOA 3L02A 2CNWA 2GNOA 1H2BA 3FIUA 2C4MA 2OC4A 3GLIA 2O2YA 3RSHA 4C4SA 1W2HA 1LPOA 2CXOA 1SVWA 2B98A 3G1UA 1AQYA 1XTPA 4A27A 4DLPA 4HQKA 1QKKA 3DR5A 3JATA 3ZV4A 4AJOA 2ZRHA 1Q3VA 1ZXXA 3RVDA 1RLJA 1NN1A 5C80A 2QM7A 4MFFA 3IT2A 2CXQA 4DRZA 4Q9NA 2G17A 1U47A 2FNAA 2ZBVA 3KAQA 8ICZA 2WB1C 1PKEA 1KE1A 2IGBA 2Y1EA 4OG2A 5DB7A 5DDIP 2HF7A 1TCVA 2Q1TA 4LFBB 5JQGA 5GONF 3P4XA 1M6YA 3E2MA 4BO1A 4IV5A 5L9XA 1HK7A 1Z74A 1N2HA 1AX9A 5AOCA 1C2YA 3GJ6A 3KLOA 4LYJA 2V54A 2O2IA 4A03A 4NONA 4LF5B 4TN5A 2IPNA 1U2RA 4ZKDA 5BYKA 1BX0A 2W2LA 3LUJA 1TAHA 1RTKA 4BMVA 1EFDN 2PJRA 1G38A 4QFCA 1YZLA 1W48A 4ZI3A 1F0MA 3HSKA 2FMQA 5DW0A 4F6RB 1ML4A 1EINA 1F60A 3VR3D 4ZEWA 4NH0A 4MKGA 3HDVA 3K6KA 4P22A 2JFNA 1N6NA 1U7HA 3FTEA 1IN7A 2VSNA 1JEYA 3LVQE 3VR6H 4LVCA 4MHOA 2CJPA 3GIMA 2C03A 2R62A 1W1UA 2EWWA 4TL8A 1GUBA 1QK4A 2QG4A 3VU8A 4D9IA 4X1IA 2PBZA 1ZL0A 1W5AA 3RSGA 2VK2A 3B1KA 1E9BA 3CYMA 1Z5ZA 3VKHA 1H6CA 4CL3A 2EDUA 1F2VA 3QWFA 1BXKA 2ZU0C 4E32A 4AFNA 1OMOA 3SQOA 5KC8A 3E9CA 4Q9LA 1X66A 4W8GA 821PA 2AOVA 2X7HA 4XFKA 1HT0A 2A9VA 1JIJA 4HYTA 9ICOA 3F3KA 1FDTA 3REQA 1V0JA 4PYNA 1ZIYA 3W5SA 3UMBA 3GD5A 2HEGA 1U0EA 2WJZB 3AONB 1MBZA 3UXOA 3F67A 2PUDA 5KX5F 2DERA 1ONBA 4D0NA 3B9PA 2HWXA 1TEZA 4YUWA 1P2TA 1SOVA 4IOLA 2ACKA 2DQ4A 4QC2A 2XY6A 3WMEA 1JDPA 2AH5A 1H2EA 4XQGA 1GL7A 1RKVA 5HF8A 4TKMA 1AIPA 5L3ZA 3LKDA 1FYXA 2VHUA 5ARDA 4LGYA 3U3JA 4G67A 3QVOA 3AI7A 3P2OA 1O6ZA 4MI3A 2VZ9A 3OLXA 4Q6WA 2GX6A 2WUDA 3CR8A 4UFPA 3ZW9A 2H2GA 4O2AF 2ODNA 3N9IA 4GC6A 2ONKA 4XB6B 4DCVA 4OGGA 2A3NA 2P79A 4MNTA 1WG8A 4RKFA 4P0PA 3MWLA 1OPRA 3BRWD 3TBFA 4Q9AA 1TJPB 4ZGBA 3Q2OA 1GJRA 1LVUA 1C1DA 4ZVPA 3RFVA 4UBKA 3VYTB 4JUAA 4MPRA 4C30A 4ECQA 4GPZA 2ZR8A 4PHFA 1YGPA 5JCPA 1KMHB 2W6MA 4NCKA 3PA6A 3AP3A 4MB6A 1Y4SA 1UOOA 1M72A 4UEJA 2K4PA 3JWHA 3U4CA 3CCFA 4HS9A 3VJMA 2X5OA 2PFQA 2ZUVA 1MHPA 1EX6A 2VQ6A 3LQYA 5IVIA 4RJLA 3A1UA 3W4KA 4FOSA 2W9AA 3BXZA 1W36B 121PA 4FYVA 4G3XA 1A1SA 4C0KA 5H5JA 2Z6AA 1MMFB 2WTBA 5LUAA 3UHPA 1PR0A 4LBVA 1VDMA 1U3VA 1HE8B 2BHTA 2D00A 3HWWA 1ZQQA 2FUG6 2JFPA 3W3AH 5K9ZA 2AXNA 3EVEA 1WZNA 1DTWA 2NIPA 3FJ1A 3H5AA 4D0LB 4M21A 1T8WA 2Z2ZA 2I6XA 5A4AA 2R8BA 2NV6A 3AY7A 5IASA 2P78A 1CERA 5E6UA 2R44A 4U7TB 2B36A 3KYBA 1IE3A 3DCNA 4TZTA 1PW5A 5AUPB 3HCCA 4M6WA 1JG1A 1FMCA 1DRJA 1QE3A 1NZJA 1KRPA 2CVFA 4YVFA 2VP6A 1M6VB 4DJ5X 3UUFA 3S2FA 4Y0NA 1BJKA 5AVKA 4B9NA 1CSEE 3F71A 5AVWA 2C84A 2Q4OA 3O8CA 2HGZA 3PYMA 5ILOA 1DSSG 4H0NA 1NUQA 2O8CA 2ODEA 2AEEA 4MO2A 1YS7A 2P5SA 2PTGA 5EHIA 4HLDA 4JOBA 1GKIA 3D6NB 3HRKA 4KOEC 2F1IA 2C7BA 1ZQWA 3HSYA 1OX4A 2HK6A 4ZU3A 3NU1A 1T36B 3N2EA 1V96A 1U8YA 4HXGA 2ZLBA 3GWGA 4E3ZA 4ETWA 4M47A 3SBDA 1UXJA 2WWXA 1SPBS 4TGLA 1SO8A 3CEPB 1L3IA 1QYDA 1PEAA 1U2QA 1NNEA 8ICFA 1SUWA 4CM6A 1VIVA 2B0CA 1LH0A 1U9JA 3KXDA 1OI3A 1QSLA 5JVDA 1T2NA 2WPDA 4WNCA 3T4UA 3VNUA 2XCLA 2V4RA 2R8RA 1HLGA 1CEYA 3MGVA 1XCPA 1IZYA 3TTSA 1VSTA 3Q7PA 4Q3DA 3OHSX 4H6WA 1CP2A 1JPJA 4LQ4A 5FBLB 4GYYA 4D8UA 1U6KA 3K16A 3SE7A 4C0LA 5AVSA 1TTHA 2YIMA 5LA6F 3R24A 1QO9A 3RJ5A 3NEYA 2NU7A 3ASVA 2RONA 2FFRA 5AIBA 1QVWA 1F6WA 1PWHA 4CEIB 1E4OA 1F1JA 2MYUA 5IX8A 4NVRA 2G07A 2IOFA 2ZRKA 2OUIA 4YFVA 2J45A 2VNAA 1Q7EA 2PN1A 5DNEA 1WEHA 2JIRA 5CXXA 2KICA 2OLJA 4GXKA 3PNBA 2FQWA 3W1EA 4JVLA 1UODA 1OVMA 1X15A 1OFHA 3VI3B 2C78A 1MFPA 2XCTB 2HVIA 1TIBA 4BLOA 1A9XB 2WAQF 4DLNA 3NKLA 5EEHA 7ABPA 2XXAB 2BEUB 1MAVA 1UPCA 3W78A 2NZYA 2A9JA 4YJ2A 4HEQA 3EVGA 5LM3A 3NBQA 1R10A 1YR7A 5FLKA 1GLNA 3QXXA 1C4XA 3I9OA 4ZALA 1XHFA 1KQFA 1A77A 3LUCA 4FC7A 4AMZA 2VCHA 1E0KA 2VDPB 5JV5A 5LQSA 3AB3A 1SUIA 3NANA 4EFNA 3BDIA 4DF3A 5DBHX 4HC4A 2DKFA 4GVLA 2PJUA 1PJ2A 1MEJA 2B0JA 4TWIA 4CCYB 1DCTA 4I4TB 3EARA 5TZVA 1I3KA 1YTLA 1P1KA 4PFSA 4FBUA 4DL2A 8ICSA 1VYHA 3AETA 1EUZA 3V00A 4PPXA 4DANA 5K8IA 4X61A 4ENQA 4HRVA 2ATXA 1BMFD 2QBYA 1Y9AA 2FSPA 2I7DA 1CQZA 1HUQA 4PYIA 4QFMA 5D5PA 4GEKA 3ZTTA 1QAMA 3TGWA 1KDRA 1EI9A 1CYDA 3RC7A 5BSWA 2W2OA 3VR0A 3ZWWA 3IJEB 3DT8A 5FL7A 2BDTA 5SYNA 1ZQYA 2RCNA 4NU0A 1C3OB 2Y99A 5DWDA 4V2IA 4IP0A 5JFOA 3SLKA 4D3XA 4N4AA 3S27A 1P3JA 1XZQA 3I0MA 3D7MA 2RGAA 3TDKA 5BV1A 3RC9A 2C0CA 3DHWC 1EXNA 4E5DA 3IQFA 3G9XA 3WLFA 2G72A 3ICCA 4OAPA 3D7NA 3H2JA 4CKCB 3MCAA 5CB4B 3G02A 5KPJA 5DM4A 1XZCA 4GI7A 2FPUA 2R8EA 3F6CA 3H9EO 4IMJB 2IV7A 1MC5A 1B8NA 1UUFA 3L7JA 2VIIA 4DL3A 1V1RA 1HEIA 2FG5A 3AZQA 3P94A 2OBXA 1ZHFA 3TRHA 1KK0A 4I55A 4M1WA 1ONPA 2O1EA 2SCUA 1YBHA 2DPGA 1UEJA 4A8PA 4PPFA 2WMOB 1M5RA 4LA4A 1A8UA 2GWHA 3M6XA 4IIJB 2NOAA 3NVAA 4MWZA 4Q18A 2WJAA 5C8VA 3HX0A 4BO8A 4E15A 1I5RA 1C29B 3FPFA 4HP8A 2Z1DA 1DU4A 1LNSA 4K9QA 1LKYA 3HYLA 1Z33A 3V6LA 3SNKA 1MW8X 2WUFA 4JJFA 4LUCA 1NI4A 1E1QD 2GPBA 1HOTA 5CP8A 1YBFA 4KQMA 4Q4JB 4RQMA 1D1PA 1YB4A 1XZKA 5KFPA 2M1XA 4HNAA 3QBVA 1WETA 3EN0A 3IYLW 5K0CA 1YVDA 1IY0A 1MJFA 2NQ8A 3AG5A 2BDEA 1FB5A 4OXXA 5J2BA 3P9CA 4YRZA 4PSUA 4UBIA 4JBYA 2VJ5A 1F51E 3LWMA 3QNUA 4MW5A 1BMDA 1GGJA 1NQWA 4IH1A 5KTYA 5HJ5A 2C7QA 2R6JA 2YV4A 3AN1A 2X4GA 1C0LA 2J4DA 1V26A 1UC9A 4FFLA 3SAFA 4L78A 1R5BA 1MO4A 3SZLA 5KNCA 1UA0A 1PFWA 2FUNB 3REFA 3NGDA 3OTIA 5JYDA 3DE0X 4YAKA 4G3IA 3GV0A 3NJ4A 5AUNB 1BGWA 3TFSA 3GRRA 5B6JA 4YP6A 4AO6A 7MHTA 5IJWA 1M66A 1Q92A 4B3TB 1W4RA 3EWIA 3OT4A 2B9VA 4JASB 1KEZA 1BRMA 5CA0B 4WOBA 5FWNA 5LVAA 3OHMA 3UMGA 1T2FA 3RYHB 1J22A 6REQA 1W5BA 1M2OB 1CNEA 5J4HA 5AI9A 3F49S 2PUGA 4EOGA 3K1AA 4QYXA 3MT7A 1Z2OX 5ALNA 4EI2A 4G4JA 1VI2A 3C1ZA 5DLPA 4CR6A 3MZ0A 1O95A 4JI1B 1O4VA 2GPSA 4ERNA 2IHUA 3RTCA 3HMQA 3DCIA 3HZOA 4ADSG 1JLLB 2YHIB 2XT9A 4FC6A 1VQ1A 2Q4DA 3HP4A 3GIJA 2W11A 5J40A 3HGQA 5J2JA 5I48A 4PW0A 5E38A 1Y6RA 2NW6A 4UPVA 1Z00B 1A2KC 5TC4A 3U1BA 2EJBA 2OBLA 1I9GA 3A25A 4LYAA 1VI6A 4PQEA 1K2VN 3PFHA 3DHNA 3VSEA 3ZY5A 4F84A 4WFIA 2RK3A 4L1KA 4CIDA 4B47A 3SC4A 1X6VA 1Q1GA 2WKQA 4FNOA 1VJ5A 2IZOA 5IIIA 5BMVF 4KQ9A 1J2TA 1JDNA 1JA9A 2FMFA 1KFCB 5AW6A 4PNPA 1R6TA 3NMUF 1Q1NA 2WINI 3GLGB 1O2DA 4RUCA 1ZOPA 4BP3A 2PH7A 2BISA 5L1IA 4MHSA 4RZ3A 3LKBA 2R8HA 4I29A 2VSQA 2CYBA 4RJKA 5DGDA 1Y4UA 1ZICA 1DNPA 4XUSA 4RWEA 5PGMA 5AQ1A 3F2DA 1XA0A 5DGCA 5CM2Z 3Q2IA 5IFKA 3H5LA 2D0PB 3QXHA 4D81A 1C8BA 2HY7A 4MYHA 2IU3A 3MJFA 4PEVA 2P9EA 3KLBA 4DXAA 1Y42X 2O05A 3V80A 3PSFA 1LLFA 1QNFA 3D6VA 4YMIA 4GP7A 4DC0A 3ZHRA 2XRZA 3MAJA 3ZD6A 4HRXA 2WB2A 2HLDA 3ZHVA 2XUGA 3ZE6A 3PKIA 4D9FA 1AUVA 5I6DA 3OFJA 1X7XB 4BLWA 2FGJA 3IVCA 3N7TA 3I23A 1K4YA 4ITRC 5HKOA 5H59A 2JIQA 1SGWA 1G8HA 3ZC3A 2F17A 2ERYA 5B3JC 2AFIA 4AG5A 4FN5A 1CKEA 1OZFA 1ZBQA 2R0QC 4KE7A 1DJMA 4MVCA 5BPHA 2EAPA 2V4MA 3EDYA 3LCRA 4P34A 3KTOA 1TZMA 2E4YA 3B2QA 2WV9A 1T0PA 4I1UA 2OBMA 4MLDA 2GTIA 1G4HA 4PXAA 1H23A 1ZI8A 3SU8A 1D6JA 4BGIA 1YQQA 2PKQO 2HPZA 1EMDA 5HFAA 3KYIB 4EYQA 3ZU6A 1LFAA 1X1TA 3ZIAA 2Q3JA 4M98A 4I36A 3DL0A 4X5OA 3QE2A 4RQ0A 3RHTA 4KCGA 2UYCA 5HR6A 4X20A 2PMCA 4YT8A 1SG9A 2ZM6B 2F2TA 2BW0A 1GZHB 4MV9A 5EJEA 2GLTA 3KALA 3SR3A 4E94A 4TXNA 2ZDHA 5H9VA 1CQIA 2WD9A 2GK4A 4R01A 4CMEA 2EL7A 1ZNWA 3C14C 5BUZA 3W6PA 1N0WA 2XMBA 1BOOA 4N47A 4X6UA 2EW1A 1E3QA 1ISPA 3WAKA 1UFQA 3EXG1 5I01A 1C30B 4RPGA 5CBPB 2RGWA 1JFSA 1BWSA 3CPSA 4YXWA 3RAXA 2CBGA 1SHKA 1EJ2A 1V5FA 5ALQA 2UZ3A 5FUBA 1A6SA 1Q1BA 2D0DA 4M4SA 2IEDA 4G0WA 5FWXB 4BN4A 4C0JA 1IOZA 4M1ZA 4MW2A 3WLHA 3EEYA 3A9RA 3AFIA 3CNOA 3VPSA 5IJ9B 4YONB 5H68A 5G4KA 1KY4A 2P6OA 3CRRA 4ZN6A 1FUUA 3H9QA 4RK4A 3ZHOA 3EA5A 3QWIA 2IVFA 3BCRA 3R7WB 3IP1A 2QPAA 3ZQKA 1N2SA 1JDSA 2ONCA 2ZKIA 3ZU3A 3QV2A 1FIQA 2QRMA 4WLUA 4TV9A 4L22A 1DT5A 2I2FA 1GZ5A 4B75A 4MULA 4B71A 3NBKA 4HFMA 2JG3A 1JDVA 4OIMA 2QRHA 3FG9A 4MQFA 4Q7QA 5D46A 1L5MA 2R751 1A0PA 1R8XA 1CI4A 4TLDA 2AN3A 1YJCA 5IVDA 3BXFA 1LI5A 3BZUA 1FDWA 3G68A 2JH9A 4OM7A 4MWEA 1GWNA 1I3LA 1IG6A 3IELA 1ZK3A 4RMHA 4MTCA 1JWAB 1L9XA 4ED3A 1OPXA 3AU6A 2IJGX 1FP7A 3K1TA 3RJZA 1VCOA 3ILSA 3M1LA 4DQDA 2WZQA 5IT9A 4RPJA 2JEZA 1CUDA 2ODTX 3QVMA 1H5QA 1WZ2A 5JXIA 4X1YB 1E6KA 2YMLA 1LX6A 3AB8A 1RQNA 1R7RA 5IXSA 3RBAA 4NPCA 2R96A 4C08A 3BMQB 3FVQA 1X1CA 4KG7A 4QZAA 2FMPA 4EFLA 2QZPA 1WB4A 3QEMB 2BP7B 1B0AA 5CDHA 1JHYA 2Y27A 4HF7A 3UH0A 1TUIA 4R1LA 3W5BA 1FW6A 1W4CA 3TIFA 1VHLA 3K5PA 4MV1A 2EOAA 1N5XA 3MWEB 3RRZA 5B12A 4J3NA 4EECA 1UEXC 1ESEA 4PAQA 5HK9A 5ALMA 1OB2A 4YLYA 4B3RB 4GXIA 2PS1A 4CIXA 2IYVA 1LB2B 4DLVA 1EFCA 3EMDA 4EHKA 3E1SA 3N2GA 4YMNA 4B5LA 3JQBA 1K8ZB 5KTKA 5KNCH 4KP7A 3GN2A 3ZWKA 5BSGA 2PG3A 2Z2IA 3CCCA 4BFTA 1N5RA 3KQPA 2GJ8A 1U5BB 4DV3B 2AC7A 4P33A 4INOA 4ZYVA 4AMUA 3E2PA 4H7DA 3AHDA 3BQNB 1FFUA 4S0XA 5F4ZA 4FZLA 2C2DA 2BQRA 4X7RA 1FYDA 5KFJA 2ZBFA 2LI6A 3GDOA 5B4TA 3GT3A 1U0TA 2EQBA 3QYAA 2G63A 2XDWA 2XNKA 3V4ZA 3JTEA 4MEAA 2POQX 1GTVA 2YW2A 1OBHA 2BYTA 4EUFA 2YIVX 1HFJA 5HTKA 4KV9A 4QQFA 4Q01A 5JI2E 4TMVA 1QGOA 2IEGA 1NJ5A 5HP4A 1E2LA 5EIWA 3PWSA 4BMYA 4RA9A 3Q8SB 5T14A 4E5VA 4EVRA 3V4RA 5KNBD 2ODQA 2Z30A 1EUDA 1JIUA 2F3QA 3BHNA 3MBYA 1MIOA 3I6MA 3OZFA 4K5QA 3ZHUA 2D7DA 5HE8A 4FS2A 1WF6A 4ZT3A 4DR5B 1WZEA 3PDWA 5BVHA 5DULA 1H2RS 4RTRA 2GLUA 4KQEA 3ENVA 4Y0VA 4DMLA 6ABPA 4CMJA 2O50A 2E8PA 5CCEA 2XKAA 1C3XA 3SKYA 3LX6A 2B21A 2FX3A 4JT8A 2VWHA 3FVRA 3OHBA 1N34B 3D8SA 2BRUC 2ZREA 4MH0R 4OUDA 3QRWA 2B3DA 4JJKA 1TXGA 3A4IA 1KH2A 2QTHA 4DO9A 1PKXA 3PB3A 4JMUA 3GGGA 4C2AA 4EG5A 4LMPA 1UBJS 1G21B 2XRFA 1BXGB 4XSHA 3SYZA 3I9MA 1QPBA 1KEUA 3OOYA 1GG5A 2PZGA 3MILA 2JLZA 4UHJA 5LXTA 4GNKA 4E5YA 1FUKA 4ZQGA 3K6JA 2J6CA 4A1OA 2ZRLA 2W6JA 3IXQA 1CQJA 2FPOA 3E7XA 3CO0S 4YT5A 4EATA 5ECDA 4ZU6X 2FP4B 2WUVA 4L8GA 1PFYA 5DV9A 5IDYA 5J2HA 4XFDA 2C95A 5JTIA 3E9YA 5AHWA 2G5HB 3PPXA 4L6IA 4BZQA 2V0GA 1RYUA 3K8YA 5T8KA 5I3CA 3OOEA 5DBAA 3NUZA 1II9A 2JLVA 4FYYA 2LZ0A 2B61A 1NU8A 5FAKA 2ZJZA 4FCTA 3A2MA 2P2DA 1I7DA 3KQWA 2FZ5A 4RVDA 1DAIA 3GXOA 3H4VA 1UQRA 5K0JA 3PGLA 4QDUA 5BV2P 3OJCA 4NWIA 4TM8A 3NZEA 1DBQA 4WNAA 1WMFA 3PNYA 2OXTA 1T8TA 2XBLA 4D4IA 3LUFA 1GAEO 3LY8A 4LF8B 5A3VA 3MDCA 5IXYA 4JOQA 3AL2A 3M4NA 1AKNA 2WFLB 4Z9BA 1R15A 5A4JA 4MYSA 1ZLYA 3AEQA 2EP7A 3H2BA 5JADA 1D8BA 5J47A 3BWDD 1DEKA 1EWTA 4UEKA 1IBSA 2Q5LA 2GZHA 3QG1A 2GSDA 4GQBA 4GRDA 4OTZA 4ZQEA 1M2VA 4AK9A 3TEMA 2ZXHA 4MA0A 3IOYA 4G9EA 2V6BA 4HDQB 1PR6A 1ZH0A 3MRVA 1C50A 5TXGA 3OZDA 1LSOA 2W7PA 1UP7A 1E4VA 2GHQA 1DCKA 2GZSA 1AY0A 3IJRA 4FWTA 1NK6A 4P2GA 3F2IA 5H02A 5KDOA 1MV5A 4KQGA 4DNPA 3E27A 4Y9RA 4R65A 2A1UB 2ZW9A 1OKKD 4IH9A 1RI4A 3DKVA 2I6SA 1KI3A 1XQWA 4XYMA 3KT0A 1MGPA 2V59A 3OFND 3H1AA 3PQCA 3ZNQA 3ZHSA 3SVZA 5F5NA 4H18A 5ALLA 1QONA 2VAPA 3GGOA 4EW6A 2O3QA 3ZV5A 5FO1A 4UU0A 3VMMA 8ICIA 1G7SA 1ZZGA 1UJ6A 5U1PA 3E5HA 4EUNA 1RQRA 1Z25A 1TU4A 1Y1KE 3ZBTA 3SZUA 3ENZA 4ARIA 4EFKA 1CRLA 3S0JA 1IIRA 5IP5A 4Q47A 4OQZA 5KI6A 1GAWA 3GZFA 4YTEA 5LCXA 1RWMA 4BMSA 1QQ7A 1QTNA 3ZDZB 4BWVA 4RK7A 2R8OA 1O6FA 5LQKA 4CM9D 2ZRJA 5KFMA 3NV7A 1NFFA 5I9SA 3FNRA 3GDXA 4NE9A 3SZGA 3DM9B 1TA9A 2C9DA 2NRWA 1E1YA 4CW7A 4PRLA 1L8XA 1POXA 2C22A 3F7TA 4ZPJA 2ZR0A 4FMPA 2UKDA 4JJ8A 2AMVA 5JSZA 4REQB 3HCOA 2R25B 3GXBA 4DV5B 2ZVQX 3NONA 2PGXA 1FP4B 3SKVA 4MIYA 4C78A 4BJ3A 1A7AA 5IVKA 4D9MA 5EKTA 5J3JA 1OLSB 7ICLA 3KJHA 4OGFA 2KKPA 1JDUA 2JLCA 3L01A 4XX0A 4UUBA 4NFLA 1FBTA 3VVMA 2DGDA 3R0JA 4EAAA 3D5EA 3U16A 2I78A 2UVUA 1WQ3A 4ZTBA 2ATCA 1VYUA 3CX6A 4B3GA 2AKAB 3TW4A 3TOVA 4DR6B 1QFSA 2FSUA 3ZZ1A 5IMSA 1QLJA 3NGXA 1JX4A 1H8EA 3THVA 4XWTA 4FEYA 3TNFA 2CFSA 2LVBA 4DQUA 5K8VA 4S05A 5A7GA 2OO5C 1DFHA 1T43A 1LUAA 2OV6A 3TKLA 2QENA 1PFVA 2AJLI 1YMQA 4O4LB 3NYWA 2A5JA 3Q7SA 5BSFA 5IN4A 1RHJA 4TUYA 1R18A 3QXSA 3SY8A 3LNTA 3HL4A 4NENB 2VI5A 2RAPA 3LM8A 4CZ2A 3DTYA 2JJ1D 1MVNA 1K7YA 2O5CA 1B73A 3DM5A 1F3OA 2P90A 3D43A 3QEJA 1RHMA 1B0UA 1X1DA 1E7WA 1XPJA 1PHRA 1JYFA 1P29A 5NULA 5ITZB 1XRMA 3HI4A 3CNLA 1VLLA 1RI1A 4J94A 5I7AA 1D9XA 2GO1A 2W98A 1H1LA 1AGRA 1GGKA 4CL8A 1I5EA 5D4BA 1FDUA 2JVKA 2DCMA 1GIAA 2REOA 1WXXA 1LPAB 3OZAA 1UJ5A 2Y6VA 4KK4A 4JI3B 3MEQA 1Z4JA 1NF2A 3EUB2 5IYZA 3VR2A 4RMJA 4NV0A 4O5AA 1Z4OA 1R0ZA 3QPBA 2O2HA 1BH2A 3RU7A 5ARCA 1WSAA 2GKSA 4KPEC 4WBXC 4MCJA 3U56A 1NW9B 4KVFA 5JFGA 4IJWA 2R00A 1IAVA 1NBME 4ACOA 4MW4A 5C51B 2FRVA 4LFAB 2CLSA 1NXWA 1Z18A 4FI3C 5DYWA 1D4OA 3QMVA 3NGMA 3UCEA 3OWOA 4QICA 3B2EA 2CJXA 1PGNA 2XIJA 4LXXA 2NNLD 2QJTA 4QPJC 3MHTA 2OBNA 1OX6A 3HKCA 1Y5RA 4J6FA 1B76A 1NR7A 2HMSA 4QUKA 3FYCA 4R1PA 2H2HA 2EKZA 1ECCA 4PHGA 2AZDA 1H4TA 2IEYA 2VDLB 1U5AA 1FDRA 2V9WA 1WVIA 4JI8B 3EWSA 1H94A 2GD2A 3IUYA 4C2UA 2GI4A 4LXUA 1QRDA 4G89A 3L0SA 4AKIA 1CR4A 1JQJC 2Q3MA 1F38A 1M6EX 3HJAA 1SAYA 1PZMA 1KVTA 2C2ZA 4K9DA 3SF8A 1Z5VA 4PCVA 2PEZA 1DS6A 3GRPA 2C99A 4S0ZA 5TGZA 1T2EA 1OLXB 1UM8A 1XZPA 5C5DA 3PC6A 2Y1WA 2P2SA 1F12A 3KKOA 5HIMA 3WICA 4MR7B 1FVHA 3C5VA 5BW6B 2RGYA 1W0JA 4MV3A 2DUWA 1AKVA 1S8NA 3ZCXA 4NYJR 1YS2X 3CMMA 3KEFA 3SX2A 4XYEA 1N2GA 3BG5A 3IHLA 3E0QA 1RAFA 4IWXA 4HQ0A 3KHHA 3T15A 2YJGA 3K94A 4X8OA 2W0SA 4EDFA 3ZQ4A 4M9NA 4C22A 4JBHA 1U6JA 9LDBA 2PLRA 1M8JA 3H99A 1ZQDA 5KKNB 3RYFA 3VTAA 4AB1A 3PLAE 1ULZA 4Y1FA 1XF9A 3QTTA 4RC9A 3D8UA 3PYLA 1AS3A 1XEFA 3L07A 1PE0A 3QLVC 3R3XA 3OWXA 2HSDA 4E6EA 1T1GA 2DUNA 2BM1A 2W6CX 5LD2C 5NLLA 5BW5A 3JQ9C 2IHTA 1VHDA 4DOBA 4EA8A 1PG2A 4QBIA 3DZGA 3KBBA 3VU9B 1YBMA 2KJ9A 3T12A 4B34A 2AJTA 1V6CA 3CNNA 3B52X 3I52A