4CE6A

Mutagenesis of a rhodobacteraceae l-haloacid dehalogenase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
226
structure length
225
Chain Sequence
RSGILVFVNETLLDLTSLSPLFERVFGDAKVLREWFPELILYSQTLTLTGLYRPFGEIAAAVFEMVAANHQAKVTPDDIAELKTRLTSMPAYPDVAPALTRLQDAGFRLVTLTNSAPSPAPSPLEKAGIASFFEAHLTVHSSQRFKPHPSVYDSTAETLGAKPEELCMIACNIWDTIGAQARGWRGGFVARPHNTPLTLAEVPQPDFIGRDMGELADQLIASLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords L-HALOACID DEHALOGENASE
publication title Mutagenesis of a Rhodobacteraceae L-Haloacid Dehalogenase
rcsb
source organism Rhodobacteraceae
total genus 84
structure length 225
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4ce6A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ce6A01
2I54A 3QUCA 5AKXA 5AK4A 4HGNA 5AVRA 3B9BA 2I55A 3UMCA 1O08A 5AVVA 1Z4QA 1Q91A 4C4TA 2B8JA 2VKQA 1RC8A 1QQ7A 2YJ3A 5A3QA 3R4CA 4YIHA 2R8YA 5ALYA 4UU0A 1Q92A 4YCLA 4FE3A 3SHQA 3QU5A 2FUEA 2O9JA 1U02A 3W5AA 1FEZA 3WKBA 1RMYA 2RAVA 1RQNA 2P69A 3ZVLA 1L8LA 1QQ6A 2I33A 1WVIA 5ALUA 1XP5A 1U7PA 3DNPA 3MC1A 5AKEA 2G0AA 1XVIA 3OCXA 4I9GA 4BKMA 5ALNA 5AW2A 1L7PA 4OCZA 3ET5A 2GHQA 1U2SA 1TJ3A 2JAUA 5ALHA 3OCWA 1ZD2P 5AI6A 1EK2A 3N5KA 3I1YA 3QUTA 3HLTA 5AW5A 5ALKA 2HEGA 5AM2A 4HYTA 3WK9A 2GMWA 5AM4A 3ZTWA 3ESQA 1WPGA 3KOOA 3A1EA 2ZBFA 2B82A 4YIKA 2IOHA 2NO4A 3WKEA 4CNQA 4F72A 2IOFA 2CFSA 3OPXA 3BWVA 3WK6A 3L0YA 3MN1A 3OTQA 3DV9A 1RKVA 4O8CA 2YJ5A 3U26A 1YNSA 3E81A 1PW5A 3IB6A 3IJ5A 2FEAA 2NYVA 2ZOSA 3GYGA 4L6CA 5AKLA 2B30A 2C88A 2R8EA 3SKXA 3QNMA 4UAVA 4XQ0A 2WF6A 5ALIA 3UMBA 2BDEA 4KYTA 1J97A 1Z4JA 2CFRA 3KZXA 1SWVA 5ALJA 1YS9A 1EK1A 5ALLA 2NO5A 3R9KA 1Z4KA 4IG4A 3ZVMA 1Z5GA 3L1VA 4Y2XA 5IT4A 4GIBA 3W5BA 1QYIA 1L7OA 1L7MA 2EATA 2OM6A 2EAUA 3WKCA 1RRCA 4C4SA 4CF5A 1NRWA 2HCFA 2R8XA 3K1ZA 4HGOA 3L5KA 2BY4A 3D6JA 3QLEA 3QX7A 4YGYA 3HYCA 3NIWA 4UW9A 2HI0A 4FFDA 1NNLA 2ZBDA 1CQZA 3L0CA 4F71A 4Y2QA 1Y8AA 2G06A 4QQFA 4AP9A 2MU2A 2Q4RA 4FYPA 1T5SA 1VJ5A 1T9ZA 4JB3A 2YY6A 3W5CA 5AI4A 2ZG6A 3NANA 2G08A 4C4RA 5AW6A 3WK5A 4KX3A 3AR9A 4UM7A 2B0CA 3SMVA 2GFHA 5AI5A 3QUBA 3ZWDA 5FP0A 4YH1A 2FI1A 1U2TA 1YDFA 4MWOA 3P96A 2C8LA 2QYHA 3E84A 2HSZA 3TLMA 3R09A 5ALSA 1ZJJA 2WFAA 1NF2A 3KDPA 4UMDA 3S6JA 5AKKA 1YV9A 3WK8A 2HDOA 5AW0A 4UAUA 1Z4OA 3MPOA 4BX2A 2AMYA 3ZU6A 4L6AA 3I28A 1TJ4A 4CF3A 2OYCA 2B1RA 5A3SA 5AVYA 2RARA 3QU4A 3ZW7A 1N9KA 4GXTA 3L8HA 3WKDA 4MUMA 5AM1A 4JDPA 4E88A 2WF8A 2YMPA 4XPZA 4UU1A 2IA5A 5AM0A 4CE6A 3SF0A 3ZWKA 5AM5A 4CF4A 1F5SA 2C4NA 3ZX4A 3QUQA 3OCVA 3FPSA 5AKYA 2HOQA 1L7NA 2YBDA 3QYPA 3F9RA 4YCNA 5AVXA 5AVQA 1ZRMA 3OCZA 3A3YA 5AK5A 1X42A 1Z4PX 3U19A 4Y2TA 5AW4A 2WHEA 3U7HB 3FM9A 5AI9A 5AW3A 4BBJA 3KBBA 2D2VA 2JAOA 3FVVA 4BX0A 2AUTA 2RBKA 3N8GA 3W5DA 3PCTA 2Q5EA 3FZQA 2I6XA 2JAWA 4NABA 3SKYA 2JGAA 4NV0A 1XPJA 1QH9A 2RB5A 2YJ4A 2PKEA 4EENA 3AR2A 3AR3A 1WR8A 2YJ6A 4XOUA 1Z4NA 1SWWA 4IFTA 3N07A 2BDUA 4RETA 2B8EA 5AI8A 4UMEA 1J8DA 2O2XA 5ALEA 3L8GA 4AS3A 1L6RA 2MU1A 2OBBA 5AVTA 2FPXA 3E58A 3SD7A 4DWOA 5AESA 2C8KA 2AH5A 2HHLA 4EEKA 3QGMA 4UARA 2B1QA 3A1DA 2IYEA 5ALDA 2CN1A 2YN4A 1TJ5A 1T5TA 3CNHA 5AKZA 2PR7A 5AVZA 3U7FB 4BX3A 4NAVA 3NUQA 1ZS9A 4H1WA 2P11A 4KN8A 5ALQA 4B6JA 2FPSA 3FGOA 5AVWA 5AK3A 2ZXEA 2HF7A 1RDFA 3M9LA 3ZUPA 3ZX5A 2FPUA 4KNWA 3AR8A 4EELA 5AKHA 4L57A 3AR4A 2WF5A 1S2OA 3EWIA 1RKQA 3AR7A 2HO4A 5A3RA 5AW8A 3VAYA 3N1UA 2HX1A 4ZEWA 3U7EB 5AHXA 5E0OA 4HGQA 4J2TA 3ED5A 5AKIA 4AS2A 4EX6A 2CFTA 5ALRA 4UASA 5AK6A 2Q4TA 4Y2JA 2DQSA 3L1UA 4Y2YA 3KC2A 3ZI4A 2EARA 2HF2A 3NAMA 1YJ5A 2G1AA 4DW8A 3AR5A 3OCYA 3L8FA 3NASA 1Z88A 1RQLA 1Z4IA 5ALXA 1N8NA 4UMVA 5ALMA 4ZEXA 1Z5UA 2AGVA 2ZBGA 4OD0A 1JUDA 1ZD5A 2YMLA 4BEWA 2YFYA 3J7TA 1ZRNA 3QU2A 3PDWA 4DFDA 3L8EA 3SLRA 4BEVA 2ODAA 1TE2A 2IOFK 2PQ0A 1ZD4A 2R8ZA 4DCCA 3QU7A 1RPZA 2C9MA 2ZBEA 4EX7A 5ALZA 3IRUA 1RLOA 3PGLA 5JJBA 4Y2SA 3EF1A 3WK4A 3CZ4A 2JARA 1RMQA 1CR6A 4HGRA 2WM8A 3KD3A 5IS2A 3ZTYA 3E8MA 3EF0A 5ALGA 5AKJA 5ALVA 3ZVNA 1Z4LA 5T41A 5AIAA 3UM9A 2YMQA 4G63A 3U7GA 4UM5A 2WF9A 5AVUA 4NWIA 4UMFA 3A1CA 4EZEA 2GO7A 4OHFA 2WF7A 3M1YA 4KNVA 2X4DA 2MSNA 3UMGA 2W11A 1ZOLA 5AW1A 4HAIA 3WGUA 1LTQA 4Y2VA 3DAOA 3NALA 1WZCA 3ESRA 3I76A 1KYTA 4I9FA 4ZEVA 1TA0A 2FUCA 3B8EA 3B9RA 2G80A 3QU9A 5ALWA 2I7DA 3L7YA 5ALTA 3N28A 5AW9A 4G9BA 5IT0A 2FDRA 1S8OA 5AICA 3WKAA 5AM3A 1YMQA 3NRJA 2GHTA 3OCUA 1L8OA 3RFUA 3I6BA 2W4MA 3DDHA 3WK7A 5AIBA 1RMTA 4KX5A 1SU4A 2W43A 4QJBA 2I34A 4HGPA 2G09A 2OA0A 3MMZA 4RESA 3WGVA 1VFPA 3RF6A 3FPBA 4UATA 2G07A 4J03A 3EPRA 2QLTA 5AVSA 1Z4MA 1O03A 1QQ5A 4YCMA 5ALFA 4BNDA 1MH9A 1U7OA 2FPRA 4XE5A 2FPWA 4Y2PA 5AW7A 5ALOA 1VJRA 4BYGA 1ZD3A 2YMMA 4Y3UA 5ALPA 4NFLA 1RKUA 4PNHA 1AQ6A 3L0BA 1LVHA 5AI0A 3QXGA 1K1EA 4Y2UA 3PGVA 3BA6A 1RLTA 3ET4A 3AR6A 1IWOA 2P9JA 3ONNA 5AKGA 4BNDB 3U13A 2P27A 4OFZA 1RLMA 4Y2RA
chains in the Genus database with same CATH superfamily
1ZQRA 1KQFA 1J2TA 5AKXA 1QC5B 1A7UA 4LQLA 4MYHA 4TYQA 5JCOA 4I4TF 4U9IS 2V4UA 3ABQB 4D3ZA 2ENWA 2MIIA 2VXBA 2GM4A 1QSYA 2EAPA 3D8BA 1DQNA 4Z53A 3GLIE 1OXJA 4LXGA 8ICSA 1K4KA 4BY9E 2Z8YM 2BFOA 4EATA 1DXYA 3C28A 1GSOA 3TUZC 1GL3A 4RJIA 3VYVA 2GHQA 1V2HE 4PE5B 3KT3A 1EK2A 4DJAA 3TW8B 1XWFA 3O94A 1DFGA 1JIIA 2PVCA 2QI9F 3LUBA 4U02A 4KQHA 2IPNA 3WKEA 4X94A 5KREA 3PCXA 4V2UA 2I9GA 5A03A 2ONZA 1EU1A 2GA9A 2C88A 4IVPA 2RGAA 2G77B 2VQ6A 3NYRA 2ZJ5A 4YX9A 2BSQA 3WMEA 5U4QA 2WFLA 2Q9CA 4HQFA 1DBVO 2EL7A 4JYPA 2OE2A 1SCDA 1EHYA 3VC8A 5KFVA 4PFKA 1Y4UA 4NLLA 2JGMA 2NN3C 4UW9A 1I2MA 4X60A 4YG2A 4HNHA 1A82A 4UVHA 3SFTA 1VMDA 1ZYUA 1K8XB 2BF4A 1QJ4A 2O0HA 3UV6A 3AP1A 3R4VA 3U6BA 4ISBA 1GFIA 3W4IA 1Y37A 2ONCA 4A6DA 2XRZA 4ELTA 8ICKA 2V03A 1K5PA 2I9PA 4QREA 2ATEA 4DM7A 1EVJA 3IAS6 4FKBA 5ER9A 5HNKA 2QMEA 4EO7A 3LW8A 2FJ0A 4FMCB 2F8TA 4JXZA 1K92A 3ZDYB 2C4NA 5MN5A 4P7JA 4XIFA 1A9YA 1X6IA 2HFKA 2YBDA 3AC0A 1P1BA 4E70A 3CCFA 3A4MA 5J0RA 5CVTA 2X1LA 4AKHA 4OBWA 1LD3A 1P2FA 1WVMA 4QBHA 3C8HA 3BB4A 3L7BA 4G0WA 3PJFA 4NDNE 2OENG 4TWAA 1I6MA 9ABPA 2UZIR 3FMPB 1S8FA 2RHJA 4XX0B 2BRUC 5AJUA 2KBFA 4BMNA 4HFRA 1N5KA 5ES3A 1ACJA 3M70A 2V54A 2HIAA 4MWSA 3H84A 3ZUPA 5IINA 1IHUA 1KNQA 1U1DA 3TAQA 3O93A 1VI5A 5DB9A 3AVOA 1UXOA 3F7MA 3F8WA 3O26A 1TCBA 5BV1A 3GK3A 4KLGA 5CA0B 3S44A 5CDFE 4G86A 4EL5A 4RY9A 3U7QA 2GXUA 4A8JA 4WJZA 4UXHA 1PNTA 2O2HA 3OPMA 4JWNA 3LYAA 5ALMA 4CPDA 4KYUA 4J9OA 1KJWA 5C5CA 3I4LA 1N92A 1P4JA 3DC7A 3AUOA 3ZHSA 1M0EA 7ICHA 3NHMA 2FQXA 4J16A 2FG6C 3C7AA 1CVLA 1M0SA 3IDZA 4KSBA 3N0TA 1VRCA 3EBOA 3KVOA 5EFZA 4GF5A 4QO7A 4U5QA 1R2QA 2XX3A 4OJYA 1LV5A 4F5NA 3PQCA 4CQMA 3AY0A 3NHFA 3EZFA 1GZ4A 1VE6A 4GE0A 3HJBA 1XO0A 2VUIB 2QPLA 3B8EA 2IHMA 1LGYA 4M1WA 1X9HA 2PSEA 3OHMA 5EJ8A 3LW7A 3QA9A 3WGZA 4ZI5A 2WFZA 2VQ3A 2VWQA 3EXEB 4ZARA 3B13B 4DEXA 4HNAA 3DDWA 5C4IA 4KX5A 3B12A 1G8PA 4CIVA 5K01A 1IXKA 2ODPA 3K1RB 2MWMA 1WKCA 1C9DB 4J0DA 4G09A 1SQSA 3ENNA 2W55A 4HX9A 4KAFA 3D4PA 5B58C 4AY4A 2FN9A 5KTQA 5FLKA 5JSHA 3GRPA 1KWKA 2C9CA 2W22A 4REQB 1Z0ZA 3WQQA 3BHMA 3L7DA 4B3DA 3UPTA 1RZ3A 4ZVKA 4AL4A 3QY9A 2LNDA 1H8EA 2FRVA 2QR5A 1RI2A 4DZTA 3Q9NA 2R47A 4MKXA 4Y9RA 3FNBA 4EHIA 3SHFA 2C3UA 3AUTA 3OFVA 1U7TA 2I65A 2GRJA 1XC9A 3IV9A 3H0RB 3GWZA 3O7WA 1A0OA 1NW9B 1GNSA 2IH5A 1YB4A 4R9SA 2JAPA 2QZ4A 3MN1A 2JHFA 1CDEA 1I2AA 2RG1A 3PXBA 4B5LA 2FLWA 4YDHB 3PDIB 2OORA 3O31A 1ZQXA 4H9GA 5CA1F 4NATA 4MVJI 1L5YA 5KL1B 2Z8XA 2C4HA 2YRXA 5B2EA 2FW7A 1OAOA 4DQSA 2Q6IA 5B6PA 2QX8A 1U0HC 4BNXA 5K5EA 1ZSNA 3CR3C 3QX7A 1H1LB 1NZBA 4RD3A 3AETA 1QHFA 4NG5A 2JLCA 4PGMA 2WB2A 2AGPA 2E55A 1IG6A 1K5OA 1P4SA 3D0QA 1QSGA 2HWKA 4HDMB 4NH4A 2CZGA 3K94A 2DEUA 2HF8A 1AS2A 1FFVA 1O94A 5CVVA 1JFTA 2QB0A 2Y05A 4CQNA 4PL1A 3P27A 4ETWA 1E2FA 2Q4DA 2RARA 4D9EA 4NCAA 1PR2A 1A8UA 5AJTA 4AMUA 1T2VA 4JWMA 2IVZA 4V3CA 1YQUA 4DNOA 1YDGA 5MHTA 3R3WA 1EM8B 3TXYA 4Y7DA 4ALMA 3RNLA 2Z5FA 3GFSA 2WNHA 1DUIA 1Q57A 5K0ZA 3DE7X 2BDTA 4MV9A 3IESA 2F3UA 4ED3A 4A2PA 4MDYA 1X1TA 5FUQA 4Q5IA 3HCAA 2DULA 1ZU5A 4XARA 4UAGA 4QWBA 1SD5A 1Q1BA 2HRCA 4FMDB 7ICVA 4UZEA 5L45A 5JIBA 4B6GA 5CLQA 4GMXA 4N5DA 3T9DA 5CFPA 2AE1A 1KI1A 5ESRA 4ND6A 5TY0A 1V8PA 1VJGA 4DQIA 2QROA 2KM1A 1XA4A 2CDAA 5CB1A 4ALNA 3FOEC 1RKQA 2VLIA 4D0SA 4QNMA 4USAA 1XJ5A 2QUIA 1EEXB 3I8SA 1CY4A 2W6QA 4IVNA 2GEUA 2RONA 4ZP1A 4EVRA 2PBZA 4GWLA 5CB4A 1Y8QA 3LNTA 2PH3A 4IHQA 4LJSA 1GPKA 2KSOA 3WNBA 1YFKA 1T2EA 4PC6A 1P2TA 2AGVA 1EHIA 1SKYB 4KKXB 1OMOA 3WWPA 4OJLA 1QTNA 4D4GA 3EVGA 4Q7JB 3BC1A 4KQWA 2WABA 5C8YA 7ICKA 2PK3A 3O2QB 4XQ8A 5CBPA 2FWJA 3D6TB 4LXTA 1YB6A 2NTVA 1ONOA 1EFPA 1GQOA 4CDNA 2JLQA 4TV8A 3M9NB 2C7RA 1RMQA 2X3YA 4QUBA 5CB6A 1CEEA 3Q7RA 1E2EA 4W5RA 3VPGA 4ZQGA 2QJWA 3GVPA 3QYJA 1T5OA 4AMZA 2IHYA 5K0CA 1E2MA 1QV7A 2YRFA 1G4UR 3TQIA 1O0BA 1BWRA 2AI2A 3CSDA 1F8GA 3DV2A 1ISJA 4M9QA 4AYTA 2GSWA 4P4SB 1HDYA 3KDSE 3OA2A 1QO0A 2BUBA 5DGXA 4NJ8A 4MYTA 1GPWB 1VYUA 2XE8A 2QXUA 4D2IA 2O3TA 5AIBA 3NBQA 4I55F 2W43A 1XKLA 4D97A 4P9NA 1A5BB 2VJYA 4GUDA 3GMSA 3U60B 1ZCBA 5J2IA 4NY8A 3HR4A 4FEGA 3DG9A 1OZ0A 1N2ZA 3I72A 1IH8A 3DEJA 4XE5A 1II9A 1ZD8A 2KFNA 3NRWA 2R8IA 2R6GA 1SB3C 1E3WA 3HYLA 2PRYA 1GFZA 2UYYA 2G9ZA 1QRRA 3LCUA 1NF9A 3IFSA 4BMPB 4XVUA 3C3BA 1XQ6A 2BAGA 2Q1TA 4K9NA 5JSUA 1JHDA 5I45A 2E4ZA 2H92A 4JBLA 2B8JA 1CYDA 4QHSA 3FLAA 4MGIR 5ADUS 1TFRA 1YCHA 1YBFA 3GELA 4MSUA 4MJXA 4UUBA 3QVVA 5KSWB 1AD2A 4MJLA 3CUTA 3FPEA 1QLWA 1VL1A 2KWIA 4HH4A 4E5VA 3BE6A 4MEBA 4QO8A 2GK7A 5E4YA 3BTOA 4M7OA 3N2YA 3HCCA 1GPMA 3KHHA 2Y66A 3ASUA 1YXMA 3PJRA 1P73A 3JRNA 1RAAA 3LOUA 4EYGA 1A9PA 1RI5A 3K4HA 3UHOA 3OTQA 3UJBA 3RKSA 2AFHB 5EMKA 1WEHA 1FYFA 2I7TA 4PLWA 1IVSA 5K09A 1JHYA 4IIGA 3VNQA 2HMWA 5FNVB 3H86A 3PITA 5T3YA 1SL0A 3PC6A 5FB3A 1M2NA 1ZIPA 1ZQ9A 1RJEA 5CNJA 2JDIA 3WO1A 2XIDA 2QKYA 3USZA 5CTJA 2QPAA 2H07A 4M8SA 1G2IA 2OEPA 2YQEA 2KV2A 5I8WA 5LZ2A 2P77A 1YR1A 3CRVA 3RVJA 1Z8FA 2XGJA 3FW1A 3GGGA 4PSDA 5D3MB 5EMMA 2WLTA 5B7GA 5D5QA 3NOXA 1QBGA 4BNIA 2Z9CA 1R6TA 5CDUA 4YAEA 4DPLA 3TEFA 1IV8A 3VYUB 1E18A 4UEQA 4DSZA 4V0SA 2HK6A 1D1TA 3RSFA 3U62A 3LK6A 3D5TA 3JQQA 1K7YA 4KC0A 1NJ8A 4PPNA 4EG3A 3QIAA 1II8B 1P2UA 5BY2A 4QPDA 4MF8A 3EVAA 3FCSB 1JIQA 5F21A 1IB6A 1QBKC 1L8XA 4OFBA 1NP7A 1K7EB 3OC6A 1KRXA 1R6DA 2Y4OA 5CURA 5LMCA 1Z00B 1JIXA 2EAMA 1T91A 4P83A 5IEJA 3ZLJA 4J76A 3QE2A 4GPZA 1XPJA 3OJSA 3AHCA 5GV7A 4GZLA 1C7IA 3LF2A 2B8EA 5EQJB 3U1TA 2PAAA 1EXNA 3PSIA 3RFVA 1TU3A 1AS3A 1H5QA 1NXTA 2ROQA 2ZRIA 1M8PA 5TR9A 2VTBB 1W5EA 5FL3A 4KLZA 1EAYA 4TTJA 1EUCA 2A1UB 4ZYWA 1NOKA 1KVQA 4C06A 1F6WA 2YKGA 1ZITA 1IY1A 3CR7A 1E0SA 3CISA 3RUDA 3QUSA 4W5TA 2CFTA 1ZVQA 2YQ4A 1V8DA 8GPBA 5ICEA 1TAMA 4PGQA 1B2RA 6PFKA 3HA5A 3FHCB 1FMTA 2G1AA 4RF3A 3OZ7A 3N8IA 1J0CA 3DAHA 4RD1A 3U48A 1G6Q1 2JS7A 2Y0CA 4DCVA 2RGWA 1PUZA 1PFWA 4DL6A 4KMOA 1BW9B 4XUSA 3O8QA 1P2DA 4JUFA 2VDNB 2P3OA 4GX1A 5HBGA 2PWBA 1E69A 3CH6A 2XI9A 4I5DA 1IM5A 3IIMA 3EWNA 4XDGA 1CR2A 3JAWB 3M1YA 4QKQA 2RG7A 1G6KA 4IHJF 4QEZA 3UQZA 2WWGA 4NL9A 4S1OA 1ZGAA 4RZRA 3T7SA 3HDYA 3EX7C 2JEOA 4JUBA 3DOFA 4P4NA 3ZBPA 4F5WA 1RHKA 3F8SA 4Q4HA 1JROA 2V59A 3CEPB 1DU4A 4L9WA 2Y1LA 1POXA 4DLSA 4CL2A 1OFUX 3MG9A 4HNVA 4ANFA 1VBKA 2WMDA 3MJRA 1VFPA 5DHTA 1RAHA 5IM4A 3THYA 1Q50A 1ZGBA 3OQPA 3R75A 2NZYA 1D9ZA 3SMQA 1IXSB 3HFJA 1JHMA 2A0YA 5L6MB 1E4EB 3ONNA 2FSSA 4OFZA 1RLMA 2J0SA 4CDGA 4QXPA 4O2BF 1EQ2A 4Q4LA 1Z4QA 2ONKA 1GZHB 4Q4DA 1YIDA 1GRCA 1I94B 2CLSA 4QPCA 5GIPE 1WXHA 5JAUA 2NAPA 3FYCA 2ZGVA 3OZRA 2LYBA 1LF5A 4BZXA 5KAMA 1NE2A 1FLVA 5T4EA 3N5KA 3CLTD 4N41A 2VYVA 4WEQA 1Y6ZA 2C2GA 1H8HA 1ZUNA 1R18A 3I4FA 3AN1A 4ZYUA 3T99A 3HK2A 1Y1RA 1NKEA 3MWJA 1UDXA 2UXBB 2IRWA 4PPYA 2VPIA 1F8FA 3P9CA 1Z3IX 3UB4A 1XELA 4CW7A 1X86B 3TEJA 1REQA 1QFXA 4L7VA 4IG4A 1L7MA 4IDQA 3HYTA 1G8FA 3UJ9A 4PCUA 4DIFA 4LISA 1OU4A 3L79A 2YWDA 2ADFA 2XBMA 1VIAA 2Q45A 4F50A 1G5RA 4Y18A 2O2YA 2NZXA 3OHBA 2J3EA 3OM0A 1U63A 2ZB7A 4U0KA 1D1PA 4UU7A 3AF1A 4UCXA 2OCXA 4RPHA 4FYXA 3KQOA 3DBLB 3JQCA 3ED1A 4YAJA 3V7FA 3D7SA 2GD2A 2PV0A 2Q3DA 2D1YA 3P2JA 2R8PA 3F2DA 3M6XA 4KH0A 1ODIA 4BV9A 5J2DA 4BMVA 1CEQA 3IQWA 1K8YB 4P7FA 4OQ4A 5BMVA 5BN4A 3GEIA 1GO3F 2ZSDA 4MV5A 1DCFA 2J9RA 5KYXB 3D3WB 1FS5A 1J4AA 1MNAA 5KVCA 2D6FA 1P7ZA 2C4UA 1WULS 2IDJA 2AOVA 4MVJG 3R23A 4EUFA 3CV3A 1FXSA 3NOVA 4F06A 3VBCA 3ZCPA 1XXHA 4B3XA 3I9OA 2FOLA 2DHCA 3A9UA 2D3TA 4M88A 5AKHA 3LH5A 1FP2A 3O8OA 2YYAA 3JQFA 5BP7A 1ESZA 1DDOA 4IIFA 4LVCA 4TQRA 4XTRA 3ZQ6A 4EY6A 3EGDA 1XZKA 3VR4A 1Y1KE 1KAHA 1UWVA 4H1TA 3GJ6A 1ZUHA 4LPKA 4RLSA 4LMAA 1MVLA 1QS0A 4I9UA 4F1JA 4D42A 2FR1A 2H9IA 1W5FA 3FB4A 2IUTA 3R41A 2V55B 2JH1A 2L5YA 4RWEA 4ZCRA 2DYKA 1KI8A 3GFGA 2SECE 4CIAA 1RM6C 4YUWA 2R3SA 1NRIA 2OCBA 3MERA 5F3RA 4TV9F 2ZPAA 3LWNA 3S1AB 1IHDA 1CY8A 2A4MA 1R9JA 1OFVA 2C0QA 4ZHQF 3KYDA 1FUUA 5T41A 2G9UA 4QYIA 1SQFA 5FQNA 5F5NA 2VKTA 5D7BA 2YFHA 4ZZ1A 3FI9A 3JCZA 5EESA 5CCEA 5IKEA 2PMCA 2HRBA 1HQKA 3K8OE 4BKOA 3RC2A 3U3KA 3BORA 4EFDA 1AK2A 1U2EA 4RJ2A 4EVSA 4JI0B 5TISU 2E8PA 4B3BA 4S1WA 1MX5A 3F7TA 3OJOA 4YONB 5KYYA 2Z3ZA 3N0XA 3UFXB 1XTTA 2DWPA 3IP7A 5KVSA 1JJ7A 1KGSA 4DR2B 4BATA 3OCUA 3ZG6A 3CGWA 1SCBA 4KFCA 4U7DA 1HO3A 3CP8A 4HDKB 3LT2A 3NDJA 2QUAA 4KUGA 2L69A 1E5XA 3W3ZB 3RK1A 3HZZA 4RPKA 1Z4MA 5A6VA 1YR3A 5KUTA 2PX5A 1DIAA 3B1JA 1K88A 4OYRA 3NDBB 3PGVA 4QUDA 2Q5CA 4Y6LA 4DR4B 4ZCPA 3V48A 2JHPA 2UUBB 5CM9C 4CV2A 4RZQA 4IYJA 3Q8WA 3RYHB 3DHNA 4B17A 2IUEA 4J4TA 3H0CA 5J2UB 4GSYA 2WMNB 3HXMA 2A0XA 3HU2A 3KQYA 5DWDA 2F44A 3R1IA 2JBHA 2BTEA 3F9IA 1RVV1 1WAMA 8ICGA 3RYIB 2QLJA 3U4QA 3FWYA 3WQHA 4ZZ2A 1I33A 1SXJA 1TJ3A 1SBZA 2G0TA 1LQUA 1WUYA 3E82A 5ADHA 3MIIA 4BNJA 4YQYA 2Z95A 2Y0PA 4KAXA 2XZLA 3I9V1 2OQ2A 1U1CA 4UHBA 1UKAA 4N0MA 2BFWA 2BLNA 1R0CA 1PSWA 4HZGA 5DCLA 1MC5A 4W63A 1E1NA 4HVAA 2AEFA 5K6AA 1BOOA 1CF4A 2A3NA 4BVHA 3IMCA 4R7TA 3VKUA 2NQ8A 4ZO8A 1JHUA 1ZN8A 3LY8A 4LV8B 5KFEA 1Y1TA 4XSHA 5C8DA 2CL7X 4LBVA 4M9RA 2RGEA 3FCEA 3BRWA 1JJFA 3E3MA 3TGWA 2VDMB 4O2AA 1V9SA 3DEZA 4JJFA 4L4XA 4CWAA 1W5TA 2GCPA 1EAMA 2IHUA 1WBDA 2CT8A 3OPNA 5I51A 2GRUA 1IPFA 3B60A 5I6DA 4F4XA 1G59A 2VL7A 4U39A 4JVNA 5LQAA 2WMOB 4Y9TA 4DSIA 3VYWA 2O3SA 2Q5QA 4KFSA 3OTOB 2HY7A 4YPVA 1FDOA 2JD0A 2NXCA 3O83A 3OSUA 3SXJA 4CM8A 1XAIA 4ZO7A 3V4VB 3JD2A 4C2BA 2EZ4A 2GTIA 1QWSA 1U4OA 2BEJA 4LZGA 3KRTA 4AXBA 3DPSA 3ONWA 2F8SA 1B22A 4GOJA 1R4ZA 1Q0TA 4YAOA 3VZDA 4A8HA 3TRKA 1ADYA 2J6BA 4LBZA 2H59A 2B78A 2DUMA 4Y6RA 2UZAA 5E9WA 5CX1A 2A9PA 4R69A 1H4TA 3LQYA 1G98A 3OIYA 1SKSA 2WP0A 1C3OB 1H6BA 1NVKA 4YRZA 3L4KA 2IKSA 1RYUA 4L9RA 1EBUA 3SXUB 3UKDA 4WA7A 1QIEA 4E5SA 4JT4A 3DV0A 3OM9A 4KPUA 3CW9A 4H7PA 3BGDA 5F4BA 1OJ7A 2AI1A 2PQMA 5A3RA 5B4UA 3LVQE 4UAWA 4IAOA 3OX1A 5CFRA 1HYEA 4I8IA 5KFKA 4EHDA 4IKOA 4I66A 3KTAB 1LDBA 3QNUA 2AJLI 3CY6A 3CO0S 4KRFA 4WESA 2IH4A 1QMPA 3WC4A 5LLTA 2KSQA 3IXQA 4ED1A 5ESXA 1XQVA 3VZQA 4QVGA 2CNDA 4B7UA 4DSTA 3T9CA 1E7WA 2O05A 4EX7A 3TLXA 1Y3CE 3QELA 4WLUA 3HJAA 4GMKA 4G24A 4UTOA 5L40A 2FSUA 4HKTA 1NXVA 4EA7A 5JANA 1CJUC 1LBIA 1XK6A 1Z25A 1PJSA 1J24A 1Q21A 2JZCA 1W88A 1A5ZA 4OP1A 2B5WA 4IQ4A 2W6ZA 2UXCB 1GEEA 1LXCA 5KWEA 3TNJA 4KK3A 1S3FA 3P0EA 3ANSA 3CZMA 1QRSA 4JBNA 3OZTA 3Q0IA 4EA6A 3TSYA 2BFDB 1ZQCA 4M9NA 2J33A 1HI9A 3T1NA 4OHCA 4YS6A 2PR2A 1BPDA 7ICOA 2HBJA 1FDSA 3CUEF 3NEYA 3O1JC 3RSHA 1WQ3A 4AB1A 4IIDA 3MMXA 1DBQA 3WG9A 2K4IA 4TSFA 1W29A 2XJ9A 1YB1A 5ALOA 3IIEA 1GKIA 1X1CA 3CMCO 5TEWA 3ZIUA 1XG5A 3QUCA 1SXEA 2Q3BA 3WB0A 3HBMA 3NVKI 2PPLA 2HQ1A 3B5EA 1CLUA 4LY0A 2YVQA 4G0YA 3KPWA 2Y67A 3AKDA 3QEAZ 4J0EA 1QHHA 1ZC4A 3ZNQA 1F51E 4HN4B 1QVAA 4MR9A 3V9PA 4HYTA 2O5RA 4TVOA 3N8HA 3SV4A 2XKBA 3U4HA 4QXRA 2ORWA 2RHBA 4B0OA 3PQ3A 4X20B 3GX1A 3Q5EA 1N8TA 2YXEA 1TF7A 1MJGM 1N3IA 4UOZA 2DUJA 3URMA 2YC4C 1VLVA 3MGKA 3ZV7A 1DEKA 4MRRA 5I4KA 4HATA 4ILKA 1BCSB 3KZIU 1KO8A 1I2CA 4RMNA 4GIBA 2JR5A 1NDQA 4M89A 2GOLA 2AN4A 3DT6A 1CUFA 2MU2A 4RT3A 4K87A 5C80A 1BE0A 4V24A 1EG7A 1YIAA 3QBJA 3I0MA 3F5SA 3S55A 1YMUA 1ZIXA 1Y6GA 5E0KB 2F59A 2JG3A 3PKZA 2VDWA 4TQGA 1EMDA 4NSNA 2WSYB 4QW8A 4I5GA 4MW9A 3WBKA 1JIJA 3HW8A 1ZJ6A 2PZKA 4KP7A 2AK2A 5DASA 1YUNA 4EJ6A 3RFAA 4CTOA 2P40A 4FQ8A 4G9GA 1KHHA 3G49A 2CRXA 2PUFA 3BD9A 1ODTC 4YA6A 3EZ9A 4L1KA 4B1FA 1XUOA 3AOEA 4F45A 1THMA 3RS5A 3U7RA 1OLUA 4JI4B 4O4LF 2YHBA 1XAJA 1NIPA 4N9QA 3AR3A 3OKPA 4LOKA 4NI5A 4ND3A 2O50A 2L2QA 1PT9A 1XJCA 4CFSA 1QWOA 1BDJA 1JDBB 4Q3EA 1G3IA 4B0PA 3ZJVA 3L0ZA 1ATIA 3IUBA 2A5LA 2Q9UA 1QGUA 4X62B 4EB0A 2PR7A 4DL5A 5FBQB 2NWQA 2XBUA 5KMGB 3IEVA 4GFJA 2J0UB 5KWIA 5TNXA 4LHYA 2HCBA 1IVNA 4OLBA 4H18A 4FWTA 5F7OA 3KV3O 2PZBA 3EAFA 1XZQA 3QOYA 4DCOA 4RD4A 1YT3A 2G6TA 3IEMA 3S1LA 3IJEB 2C95A 4BDSA 2IT1A 5BW8A 1XCOA 5DX8A 3OIVA 1P9OA 3IQZA 2B7LA 4K9PA 1NBMD 1IRXA 2J5XA 1FFXB 4F0JA 3TAHA 3SAHA 1G0OA 3PA6A 1DCTA 1ID8A 4EBFA 3ULKA 1VPWA 1J0AA 4U6PA 2XEXA 1A96A 4Q3KA 2EC5A 2WWVD 2PX8A 3GEHA 1U48A 2YJZA 3A1NA 2WHRA 3TB6A 1AJEA 1P2GA 1UF9A 2BMDA 3MWLA 4DT1B 1WB5A 1WUTA 2ASVA 1G64A 2V7VA 2WYOA 1YR9A 4JYAB 1W76A 2O1SA 3D7LA 1CY2A 4CLHA 3A9SA 1ZK2A 2B34A 2JLSA 1E79A 4FINA 4CBVA 2PLFA 3G5UA 5BV0A 1QGOA 3QLJA 4RLHA 1BMDA 1R4NB 5KCMA 2WD7A 3WS7A 3JPQA 1GGKA 2O2DA 2I03A 3CS3A 3ZU3A 2GI4A 4ESHA 4YRBA 1J99A 3Q2OA 3NEJA 2BFEA 1D0VA 2JJQA 4AY5A 4YT8A 2FWMX 1QP0A 3BMNB 3JAMA 2LM1A 5LXTB 4N48A 4U2GA 1T3HA 4P3OA 4UXJA 3TWOA 2VJQA 1PFGA 4G0MA 5ARDA 2QSJA 4OK6A 4YIHA 4X7BA 1TADA 2PJDA 1XZAA 2LKDA 1QQ6A 3TIXB 4N7JA 2ERCA 3PUJA 2VCYA 3KQPA 3ROFA 1X8JA 2OHOA 4DQQA 4F4UA 3N5CA 1Q6YA 3OCWA 3VR0A 1SBIA 5DHFA 1XRRA 1O97D 3RV3A 1S2NA 1OBFO 2Z2ZA 5C8ZA 3IP3A 1MO5A 1FNSA 1NYLA 2B94A 2R1VB 2OQVA 2EU8A 4LJKA 4C7YA 1D6JA 2V9WA 1NK5A 3E81A 4ETIA 3R7WB 1N4AA 1Z19A 4UHHA 3UWKA 3VNUA 4S1NA 5LBIA 1L7OA 1E6KA 4EJMA 1XC7A 4ED7A 1W2GA 1CERA 4I2NA 1SEVA 1DAOA 4PX9A 2V6IA 5FV4A 1JI0A 3M4JA 2OCLA 1ZXBA 3NCTA 3FFBA 2G06A 4V0OA 4LDJA 5FPHA 2QQGA 3TD9A 5F7XA 3JV7A 1GQSA 1EX9A 3BE8A 2P5UA 7ICGA 1OWLA 1M2EA 1U2DC 4KSYA 3LIPA 2VBFA 2DHEA 3P32A 2CL0X 2C8LA 1U7ZA 3FCAA 1OOEA 2QI9C 2HDOA 2QN8A 4RPYA 3HNPA 1A0PA 2IDZA 3JQ9A 4XUCA 3ZCSA 3BILA 4GOXA 3LRXA 3B53X 3F74A 5T6BA 3GAZA 1C4OA 1LPNA 1WD7A 2HMXA 4QZ8A 2QRVA 1U98A 1NU6A 5LNK1 3F3SA 4GICA 4MQEA 4QRHA 3O3MB 2RHDA 3GH1A 4EMUA 3N2IA 4HQOA 1Y42X 3ICWA 2X1HA 1Y9ZA 2PGOA 2PXCA 3Q3VA 3LUKA 4B82A 2HW8A 5BWOA 4Z9YA 1C7YA 1H0KA 3B9PA 1BHO1 2BKLA 2OBBA 2XDAA 1KETA 1N78A 2VXOA 3PX6A 3ZEIA 4FDAA 1DXOA 4IOJA 4YMWA 5AVJA 4O4JA 3AP2A 5IM5A 3EIEA 4UTVA 4EELA 1XNQB 2QXTA 1T0IA 2ACVA 3DE3X 1BS2A 4XVQA 2OO5A 1PL6A 3MHTA 1MHPA 4BLUA 3OZUA 3HI6A 4TTPA 1Y6QA 2IIPA 4XJTA 1CZUA 4OYLA 5LYJB 2PSDA 3LT1A 2GBLC 5IDYA 5ALXA 2FMIA 4LS3A 1NY5A 3T0FA 3E2MA 4ZOLB 3W3AD 4ZVSA 2G72A 1V3QE 2IF0A 3AJ8A 2RH8A 2ZU6A 1QGED 3OTHA 4J9UE 3K70D 3OPYA 3F67A 2YB1A 1OGYA 4N3AA 2Q8QA 4FS1A 4ELUA 4BE9A 2EQ5A 4BWVA 2OBFA 4QDZA 2BI8A 3OT4A 4Q1VA 3SR4A 3HLKA 4DV2B 4M0UA 4AY6A 4V0ME 2QN1A 6REQB 4C7OB 3U9LA 2GO7A 2WF7A 1ECJA 2EG5A 4GXQA 4GP9A 1GFSA 1NN3A 1SKBA 1VMEA 2XMCA 3DAOA 4PZDA 2OV4A 3RJGA 3FAHA 4RV4A 4FFBA 3MBKA 1GVHA 3N3AC 4EH1A 3ZD7A 2VWPA 1JKJB 4JK1A 4WNAB 3UHJA 3L7MA 3Q41A 2LHTA 2OCYC 3KB6A 5CEFA 2V58A 3LM8A 1L5WA 1U5BB 5DSTA 5DGIA 3NM6B 1M6EX 3KUDA 3R0ZA 3PW4A 3T5PA 3EF3A 1NBIA 4GQAA 5A04A 4Z99A 2JBAB 3MCAA 1UM9B 1Z6ZA 3HN6A 3WIDA 5HJ7A 3L43A 3HP6A 1Z5ZA 3JTMA 4P53A 3MPUA 1CRXA 1ORIA 4JSYA 5B2ZA 3DKIA 1FFUA 3H2KA 1JWAB 2B1IA 1Z5PA 2DFDA 4OHYA 2XWQA 2ZJZA 5CB8A 4XR4A 3T5BA 1MVNA 2H2GA 1F0PA 3BWXA 3G8DA 2J7KA 2IUUA 3RJTA 1DT5A 1CQJB 5LOVF 3WZMA 1XP5A 3B89A 3RVRA 4ECYA 2EYUA 4CQMD 1Z62A 3ROEA 5JCJA 3A9CA 1RHUA 2ZBFA 2L0XA 3DBHB 2SHKA 2LBOA 1MX1A 3JS5A 2QNBA 5TF4A 3HHEA 4L2IB 3PR4A 2PMKA 2R18A 4XKJA 4HEJA 1AVTA 1CZOA 1N4DA 2AZ4A 2GETA 1PNOA 4IQTA 4CMCA 4F8RA 5DO9A 5KFYA 3I9MA 2B20A 2YWFA 4GMDA 1WDMA 3MWGA 5JDCC 5CA0F 1LWOA 3NBKA 1T5BA 3QTLA 4PPFA 5BSWA 1H9BA 5J4HA 5EZYF 3IHWA 4RK7A 4YRRA 2O2ZA 3H7IA 3C5HA 5JH7F 3K9NA 1N2GA 5E8RA 2O8BB 1JMKC 4KE8A 4EQ6B 2H3VA 4KLUA 4ELVA 4MYCA 1UJNA 2AMFA 3BXHA 4PNZA 1FTGA 4TMYA 1T9GR 4TMTA 1A27A 1I01A 5ERGB 3GAAA 4A0RA 4CKCB 1GGFA 5ICGA 2ZEJA 3I34X 4DQPA 1UANA 1SKAA 5FADA 4GLJA 1GUFA 1EUDA 4RUKA 3LKDA 3W5DA 1EI9A 1BMFA 5EKXA 1SB9A 4L3VA 2R8BA 3DFUA 4AZ0A 4CMHA 4GG1A 4FQ7A 4P5EA 3PD1A 1R50A 5ICFA 1AZTA 3ETLA 4DDHA 1WKBA 4I27A 2G4VA 4B87A 4JROA 4G4SP 4BLRA 4YC7A 3LAWA 2ZCUA 4PSAA 3KZOA 3UHFA 4UFOA 4JOBA 5HKKA 5L3ZA 3DJFA 1Z7EA 2D7JA 2P9BA 4IMRA 1MAAA 1O94D 4MFFA 4E03A 3CIFA 1BEUB 3BK7A 4HUQB 4EHFA 2Y0BA 5LMZA 1DC8A 1TIBA 1XZJA 2RJ3A 3GVHA 3LUCA 3KQKA 2R6HA 1EK6A 1V9LA 3EQ7A 1PR3A 3AWIA 2VDJA 4FI3F 1W93A 8AT1A 1UEXC 5KTTA 2OPHA 4M37A 1DKPA 1SV0A 1AZWA 5H16A 2WYVA 2DUNA 1EFLA 1IDOA 5FCDA 1Z28A 2I4OA 1QCYA 4P4OA 3RFCA 2AUNA 3F73A 2FMHA 3Q9LA 3BFVA 1ZNYA 2RGNA 3EUEA 3RWBA 4LV5B 7ICUA 2GLTA 1FF9A 2H5EA 5G4KB 3DM5A 4AX4A 1UQRA 1O9HA 2CFCA 4QT4A 1ZOLA 4PO1A 4H77A 4JEUA 3HI4A 3WGUA 2ZUUA 5A0LA 4DRXB 1U0FA 2RGBA 4G1EB 4QECA 4D4IA 3ZDQA 2FPPB 3GYBA 2A86A 4XYMA 3T12A 1RYHA 1T6YA 3FTCA 2RCYA 4CM5A 4ZU3A 2I4RA 1S8OA 1TVAA 1SGWA 2X2EA 2GYUA 2FW6A 2Y99A 3H1AA 3MS7A 1MT3A 4IDDA 3SAGA 3K0FA 1Z5VA 4EPWA 5LKAA 3ZY3A 1F14A 1D8BA 1X7XB 3QVTA 4AS1A 4HWKA 1UBGA 5JMTA 1WWKA 3WDMA 4WQMA 1UMBB 1TK2A 4BXOB 3ZPXA 2O48X 4BASA 4RPZA 3A28A 1ZM2A 2QZJA 1VI6A 2UUPA 3BQ2A 2IZOA 5K0EA 1JHAA 3EPJA 2ATLA 3THRA 1T4BA 4Z4EA 4JXXA 2JB9A 1D2AA 5ALUA 4BKMA 3LYSA 2CGEA 3L0DA 4X1KA 2IYUA 3D6VA 3ZHRA 3S2GA 1JJVA 3L0IB 1DMSA 4C07A 1W1WA 2K2WA 4CCWA 3DKKA 421PA 4P93A 1NUHA 2GMWA 2ZSUA 4YRMA 9ICFA 1VKZA 4QM7A 1MGOA 2RHWA 1WPRA 3AKEA 3ZUGA 1IBCA 4B9LA 2QHXA 4EB6B 2LD4A 1KWGA 2TMYA 2AI3A 2E82A 3U7IA 4Z3KA 3V6JA 2ZQZA 3PDHA 2IPOA 2O8EB 1RCUA 4P6VF 4AWXA 2IIVA 2XT0A 1OIXA 2OZPA 5KFUA 4BCDA 2VI5A 1NYTA 3R7BA 1FUKA 4NTZA 3TAXA 3O0FA 4I50A 3WLEA 3L0OA 1B41A 1UP6A 1G19A 2CHEA 3PNYA 1I1QB 1Q1GA 2J87A 4DMMA 3GZNA 2IPMA 3HB5X 4URHA 3R7DA 1RZRA 3Q8LA 2AHRA 9ICSA 3VNAA 1ISRA 5ICSA 2EFDB 4RNCA 2YVKA 3MT8A 4JYZA 2CZQA 1DAIA 1Q0LA 5SICE 2W2QA 1FYWA 4ABYA 5DCWA 4PBSA 1W1IA 1V11B 3W2IA 3NEAA 5DCUA 1OLXA 3MR2A 2GDJA 5LQMA 3ZCXA 1IDN1 1QAOA 3TBHA 3AIKA 2HCJB 2PUHA 4I0WB 2F43B 3IA2A 4WI1A 5JWOA 4WASA 5SZHB 3G6VA 2VTKA 1CLEA 3RJJA 5CLGA 4BX9C 3V3TA 4XOUA 2Z43A 5F2OA 3EXIB 4LVUA 4DTIA 3O4JA 3DE2X 4I1PA 3H13A 2J7PA 5KOIA 4ARUA 2W9BB 1QE5A 2I78A 2OYSA 1ZVMA 2CFOA 5DB6A 2CB0A 2ATIA 1AURA 3BMCA 3AI1A 3N7SC 4NBUA 3P9PA 4GBJA 1L7VC 5J0QA 1UFKA 3I37X 3WMGA 2O8FA 5TGDA 3VR6D 5AW8A 2R97A 4UM9D 5KQMA 4QDXA 1GZUA 4B6PA 4J2TA 5KDOA 4YR2A 2ZWAA 2FW0A 3SZMA 4UB5A 1EE9A 1PDOA 3NX4A 3KXIA 4B4WA 4UQGA 2DCUA 3RH5A 3DE0X 3JASA 3U4IA 2E1EA 2Y92A 4N0DA 4HT3B 3VR3A 1I3MA 3B52X 1QFYA 1ZQ1C 2ODAA 4KODA 1AA6A 3VR2A 4J9SA 2HMAA 1FZQA 4Y2SA 3L07A 2QIPA 4R1LA 4DC1A 1TK5A 2GEVA 4EHHA 1ZX1A 1KO7A 2XMPA 4DEZA 5J2JA 1QOZA 4V0QA 3N58A 2I80A 5IDWA 5E6RB 4G1BA 1XCLA 4QEDA 1ECGA 1IK4A 2WSSD 4J0QA 1NAHA 5DOVA 3R8CA 1GG2A 4K9OA 5FNVF 4IXMA 3LX5A 3WOHA 2FGKA 4E12A 4EUNA 4CTNA 1KF0A 2IXEA 4RKQA 1AKVA 2MUTA 1KZ6A 2ZIVB 4CM3A 2XZOA 3CKMA 4EI8A 1KXZA 4DWIA 2FWNA 4PGHA 5B3KA 1XSEA 2G09A 3EG9A 2ODQA 3NDRA 1JS1X 3ZD6A 1YA6A 3R3SA 2A1IA 2Y8EA 3I52A 4EKEA 1F12A 5LWQA 4OQFA 3ZJYA 3FNRA 3WYCA 3K5HA 4C0HA 3I1IA 6AT1A 5EJ7A 4U9UA 3ESYA 1LLDA 1O4VA 2XDWA 3I61A 5EWEA 2YJ3A 3R7FA 2V96A 3OO0A 2GX6A 3BBLA 1KYXA 2OK8A 5ISMA 1I7DA 2YQ5A 3BH0A 4HDQB 3TAPA 1HT0A 3I30X 2J09A 1XVIA 3ZD8A 3PUYA 3IDAA 3CUYA 3RRBA 4Q3AA 4QRDA 4WKOA 3WO0A 1H65A 2RHOA 3GOHA 2DUYA 1A72A 2HSWA 2IOHA 2AUMA 1CB0A 3MWKA 4MYRA 3L0YA 4MOWA 2SBTA 3I64A 2SICE 2YJ5A 2HKIA 3AM4A 4EL0A 4JV5B 1R4MA 2PWYA 2C4KA 4JCCA 1AX9A 1Y5MA 5CR0A 1FMLA 4DY4A 4JYCA 5AFSA 3EGXA 4HDAA 3I53A 3ILVA 4BDTA 1YZYA 1Z29A 1ORVA 1LV7A 1HDEA 3NHPA 1QF6A 1JGTA 2Y1KA 3U3RA 1A9XA 2YCBA 1M83A 4M21A 3GI1A 3OHAA 1QGZA 3RR7A 1K06A 1HDCA 4QWWA 2CNBA 2ZYGA 4WY2A 4UM8B 4F3OA 4K28A 4S0ZA 4I2EA 4KLMA 3KFVA 1ODFA 4NULA 1RM0A 5HKAA 4JJIA 4NY1A 1HGXA 5JPIA 2X9QA 4P0PA 1PWZA 2QRZA 3PHGA 4XSVA 3E5HA 3FETA 4C6TA 5G5HA 4G2NA 1BN7A 2WI8A 2F8KA 4G1VA 1X1EA 3DEEA 4BO1A 1DC3A 3QEBZ 4WECA 5KHAA 2VYVD 4TMFA 4UQOA 2OZLA 1GG8A 8ICZA 1H8HD 3FI0A 5LYYA 4YVZA 1GA6A 5AI9A 4BO2A 3H4MA 2FZKA 1NVDA 3TTUA 2RGUA 4RZ2A 4CTMA 5A9SA 5FWDA 1EINA 3F7NA 4IXWA 4RTNA 3GC6A 4YXWA 4QBTA 2XUOA 5ILGA 5DVZA 3LBYA 3KFLA 4MDFA 3LUDA 3HKEA 2B0JA 2FN3A 3PRKE 1GSHA 1UH5A 4CG0A 3GUUA 4DMHA 5MN6A 4AUNA 5D7NA 2IYEA 1WCIB 1XCPA 2QAGA 1RPAA 1P77A 4XJXA 3ASZA 1WMDA 4JVMA 5EPOA 3SF8B 4Q18A 1V6AA 1B0ZA 4OSEA 1V3TA 4TZTA 4N6OA 2ZB8A 4OM7A 3LWZA 4E0DA 1LDNA 3L7NA 1UBHS 1JG3A 3TW0A 1WXEA 1T29A 4QAJA 5CXXA 5CAEA 3TM4A 4B7AA 4E94A 5GGXA 2JCXA 4YV0A 4HNGA 7ICRA 1Z5WA 3LQQA 1I7SB 2GN2A 3A8TA 4DS5A 5IDQA 1QRDA 3IDFA 1AZSC 5HVNA 1QZ3A 4Q16A 1XPUA 5HFAA 4QYSA 4D25A 3MZ0A 3RS3A 3L82B 1GGEA 3GRZA 1FFWA 2HT6A 1KEKA 2BZ0A 5C1OA 1BCRA 4MVJD 5DBAA 2VTEA 5C8VA 5I7FA 4H4CA 4DLZA 2FUG6 3AJ9A 4DSEA 2H5LA 4HB3A 4HL6A 5JNSA 2F9FA 4Q21A 4DDWA 5J0PA 2JFZA 1Z63A 2KMLA 3I8XA 2FLVA 4RE5A 2WWIA 1LTKA 4LYEA 1LRKA 5JRJA 3NOQA 5DGAA 2J9XB 2ZSIA 4IS7A 1E5QA 1JXQA 2DQNB 3OQ6A 2JAXA 1VFNA 5KNIA 4FCWA 5BUCA 4RJJA 1VLJA 2PJZA 3QQ5A 4YP7A 2CVQA 5KYGA 3U1BA 1UDBA 3CRRA 3HJEA 4GOKA 4AZTA 4XGRA 1QVVA 3Q12A 2QT9A 4KE7A 3ANTA 1BWPA 1KY4A 1WRBA 5ECWA 4AYBF 4Y3UA 4GPAA 3OQMA 3E9QA 1DO0A 3IKVA 1KY5A 5EJAA 4C6RA 2V8BA 3GZJA 3D7RA 1QUFA 3H4DA 2FMSA 2HSDA 4PRLA 1HLFA 3HE3A 4J9KA 1QFJA 4EA8A 1MC8A 3SBOA 4BKUA 3HKCB 1QFSA 3TFWA 1Q92A 1E20A 4EK9A 1EA5A 3OE5A 4WLFA 3HCRA 2DF8A 3SS7X 4EYOA 3HDQA 9ICWA 3F78A 1DSSG 4R2LA 3DXZA 2OHJA 4QYXA 3ICPA 4GZ5A 4U1RA 2G71A 1HZZA 3O9ZA 3GJ8A 3NWBA 1S8AA 1Z68A 1XJWA 1KEEB 3H4IA 4IDGA 1SQGA 3GFFA 5AH0A 4BLSA 4ARZA 2ZYAA 3FXAA 3P2IA 7ABPA 3CLHA 3KQTA 3F4BA 3LS2A 3IQHX 1A4UA 3KLNA 3DJYA 3GMTA 5FHQA 1N2OA 3PVCA 3I5XA 4FKZA 1Z4JA 3TD6A 1PVQA 2DB3A 2QYOA 3VHLB 2D8AA 4FX5A 3AQIA 2QE7D 4R5MA 2J45A 1JLSA 4HGOA 5CLFA 4XIIA 2EZYA 1UWLA 4FYPA 1RS0A 1VPLA 3HBLA 3JWJA 4II3A 4E3WA 4C4RA 3E70C 5JSZA 3M34A 2EP7A 4KXQA 3TZHA 5KFMA 3AW8A 4CMAA 4OOEA 1D4FA 3HP1A 3X1MA 1WP4A 5E6SA 1UHUA 2VK2A 1TF2A 4UUPA 4BTVA 1RW4A 3EPGA 4BO6A 4RVGA 5EHNA 1TGVA 3QMVA 1LKYA 4P98A 4JI6B 3VPBA 2GTHA 1H2EA 5IIKA 2OZKA 1OH7A 1JN0A 3QHAA 4S1VA 1ZQTA 4MUMA 3M8KA 5AHWA 3C7DB 1OYOA 4KV9A 2CJWA 2OFFA 4DZZA 2OOKA 4M9XA 5C1PA 1IHYA 3NRCA 1QQTA 1PGJA 1KGDA 1PVVA 3AUYA 2XGPA 4UTZA 3IJPA 4D8TA 4BUCA 1K2WA 3W0LB 3HCPA 3X1YA 5KG7A 3E5NA 3Q5DA 1P5RA 2XVZA 3Q2IA 4IRXA 1JMSA 2Q8PA 4RANA 2XI4A 1ONSA 1GADO 2Y1JA 5ARBA 2R11A 3KPUA 3KQSA 4W5OA 3HJGA 1AQIA 3ORSA 3QGMA 1P74A 3DEHA 1NYRA 4INOA 1QONA 5BT9A 3FYSA 3GIMA 1HF3A 1TUEA 4RVNA 5FO1A 1TC2A 1D6MA 3EGVA 1T3SA 4KV7A 1SA0B 3U7EB 5IX8A 1V47A 3ABZA 3TTVA 1K68A 3OQHA 1N7IA 4CCYA 3DO6A 4IUDS 2W5UA 2BGGA 3ILHA 1FNNA 5JCZA 4C0XA 3TKLA 1Z3EB 4BCCA 3V7LA 3PGKA 2B2XA 1X9WA 3VU1A 1W52X 5A4JA 3BHIA 4K9LA 3C3DA 1SBYA 3C74A 1GZDA 4O08A 3ADBA 2XF8A 3UWMA 5EFOA 4PZUA 2FOXA 3P19A 2WV7A 5HOQA 1I30A 4Z9BA 1MB0A 5ALZA 2IHJA 1TCUA 4LJRA 2Q27A 3AVVA 1YZNA 4MYDA 5J4VA 1UINA 2G3YA 1L4UA 2CUTA 3CZ9A 4CIDA 3EXHA 2WG0A 1E94E 5KEIA 3S0JA 4F2PA 3LYLA 3MCWA 3FUTA 4IOKA 3NB0A 1HFEL 4AC9A 3OLYA 1OYVA 1Y8RB 2AG1A 3WNCA 1QFMA 3IAHA 4Y7CA 4NLCA 2JLVA 3VHXB 5L1JA 3BL8A 3QNWA 3SYLA 2XV1A 2ADMA 4KRXA 1U04A 4ZI7F 2ZIXA 2N46A 4LJ8A 3W3AH 4INJA 4RCYA 2WA2A 1SUBA 2QJFA 4IX1A 2OA0A 3GRCA 5DBHX 5FRDA 3U6KA 3CBQA 4MRSA 4KN5A 4WBSA 4WGFA 4BNDA 1XKTA 3UEOA 4POOA 3IVXA 3WLSA 7ICJA 3RTAA 2YMMA 1NKSA 1XZIA 2F62A 3T35A 1I6WA 3U5ZB 5IG2A 4ECXA 2V9ZA 1AMOA 3ZHTA 1SVSA 1GLNA 2V4QA 1Z1VA 3DM9B 4K9QA 4CG2A 1S9DA 3DSRA 4I99A 1WHSA 4BQNA 2B7CA 4O5AA 1USUA 1GP2A 5BNTA 2CWDA 1P0IA 3MBYA 1KEZA 3G0BA 4AO6A 3NS7A 1QDLB 3PFFA 4BOYA 1M2VB 1NUTA 1CU1A 1WTAA 1I6KA 3ZTWA 3D6MA 3P9IA 3R5HA 3FJ1A 3OPYI 5KNLA 4XEUA 2CNLA 5BXYA 1XA3A 4EFKA 4B3RB 4U7FA 1APBA 3GY0A 2QMQA 2VJMA 3MWEB 4JSRA 2XXAB 1KSPA 3L01A 4LUCA 5FPTA 1GNLA 5F9LA 1SOAA 1AQNA 5AD1A 4QPJC 3BSSA 4HN2A 3H5AA 4M53A 3HY4A 3MSXA 4K0RA 1DG9A 5ELMA 4C7JA 1NJ1A 1TF5A 2JFOA 2E4UA 1SKYE 1VCNA 1EWQA 2VXCA 2W3SA 5B2FA 2EFEB 2W6CX 5JTTA 5K2OA 4AJIA 1DAFA 2F3TA 1UCVA 1RKXA 1DBIA 3C15C 4FNOA 1L3TA 1Y82A 2PUGA 3B1WA 5JRDS 1F0YA 1JEQB 5EL0A 4JT9A 3TOZA 4JL5A 5EVJA 4GVXA 2WRZA 3G0OA 3RSOA 1F7UA 1B6RA 4I5IA 3UG6A 1MOZA 1QK5A 4E4YA 4LRXA 2XGSA 2IA6A 4DQXA 1T34A 5DQHA 3TR6A 1YGPA 4QZGA 1EFRA 1W96A 3Q1LA 1JEYA 1MOPA 1PT6A 3QWAA 1E9VA 4Q02A 3JQ7A 1CX9B 3OETA 2W70A 4GC5A 1DC4A 5EJ2A 1K6IA 2LP4Y 2ZPTX 4GBMA 4A8TA 5DMHA 1MDBA 4IIYA 4RORA 3ACBA 1M7BA 4Q03A 1J8DA 4I2DA 3V42A 3THVA 4F1KA 2C78A 1ELOA 3KTOA 3T1HB 3SY8A 3L6BA 1W30A 4WLVA 1GTRA 3STXA 1N7HA 1OBOA 4RVFA 5ALDA 5TT1A 5ECDA 1VLMA 4ENSA 3SAFA 4F84A 1Q1AA 1ADBA 5JPCA 4REMA 4WN9A 2FKNA 2BPOA 3AQ4A 4DFKA 1SU7A 1UKZA 2R7AA 3ZR4B 3QZ8A 5J8YA 3M4XA 1IUNA 1L4GA 4N6GA 3M8SA 4QUIA 3B7WA 1HG1A 5CFOA 2W9CA 4M8NE 2WYUA 5K1ZA 2HHSA 4TUYB 4D98A 2XKJE 3TZBA 3THXA 4DLWA 2ERYA 5FFFA 1G9TA 2IU6A 2AX3A 3H19A 4NM1A 1HFKA 4I29A 1RFGE 2ATVA 1FXUA 1ITZA 1ZUD1 2GNPA 3QLVC 2R5FA 4K6MA 3ILYA 4AZ3B 1XSPA 1USKA 3O4HA 5EJIA 1KFJB 2YHIA 2DFPA 2D59A 4M1QA 4NS1A 3I9KA 4IF4A 2K4PA 3HP7A 1YQGA 2GFIA 3R3JA 3CW2A 4FZRA 3VKVA 5AIAA 4KVZA 5JVDF 4PV7A 1CFZA 4PINA 5LBTA 5F9FA 1QZTA 3BMQA 4DG9A 4DL7A 4CKXA 1RBQA 3JQBC 3LDUA 3SQIA 1NULA 1LJLA 1VKOA 4NU5A 4FJ2A 2KE7A 2ZB2A 1F6DA 5AK0A 4U7GA 3N28A 1V5FA 2AFIE 2H4XA 1L5VA 1RYYA 1AGYA 2EG9A 4NBLA 2D74A 3GFBA 3L8DA 2AYYA 1J0EA 3NEPX 2ATCA 1C1DA 2D7DA 5JS1A 5I3CA 1LLCA 5EWMB 4YDRA 4JBWA 3CZCA 4LTMA 3NIGB 4NR0A 2LBPA 2DPHA 1I5OA 2HSGA 3NKVA 3GDHA 3T79A 1OXVA 1VIMA 2WIGA 3O4IA 4XYGA 3WLHA 5K0GA 1NTRA 1E7QA 2BM0A 3F6RA 3LECA 4A4DA 5HE9A 1NNUA 4WK2B 1ZK4A 4YXMA 5C0YA 1Y81A 1AA9A 4LNUB 4J7CA 1SIBE 1Z36A 3OU2A 4H0FA 1NXOA 3ZDZB 1KU6A 4NZYA 1RC8A 5LVAA 1SB8A 1SO8A 3ZDFA 4HYEA 1PX0A 4XLTA 1QYCA 4KPFC 4PHPA 4ZO9A 5JROA 8ICHA 2H1RA 3QYAA 2VRCA 2JD2A 4MR8B 2H31A 3DOHA 2RDIA 4LTDA 4YAWA 2W3RA 1H4VB 1XRPA 2ZJ4A 5ALKA 3VFDA 1JIKA 2HDHA 4L3OA 1B8PA 1ESNA 3T61A 4RYLA 1R7RA 3FB1A 4PSVA 4ECSA 3N6RA 2XUKA 2PIAA 3VSAA 3EJ6A 4Z4HA 2GKOA 4Y9DA 4YRJA 3PJGA 3VTAA 2DBVO 1YVRA 4OB8A 3WRXA 2F4VB 4EY4A 1RCFA 2ST1A 4C7KA 4AD8A 3PNKA 4AIRA 4BFXA 3AU6A 5A1JA 4MIEA 3HKBB 2PFOA 1AO3A 3F97A 1QG0A 5LUBA 3U61B 1KOGA 1N56A 1T5SA 2VDLB 2ZG6A 4KR3A 1YI0A 3AR9A 4BMOB 2Q0HA 3QUBA 1U2TA 3L06A 4HZIA 1NJFA 1SURA 3S8EA 3VAAA 1Z7GA 4BVKA 2ZIZA 4DB4A 1RJ9B 3TLMA 4UNIA 1YR2A 1D8LA 1SOMA 4WACA 2FRXA 4L0CA 3U31A 1FDIA 3C2LA 3KQHA 4BN4A 1FFCA 3TSZA 3QOWA 2E48A 1TEZA 1PJBA 4WNYA 3CB4A 4S1TA 1GEGA 4JDPA 3UQ2A 3NGDA 2I1LA 3F2CA 3ABIA 3PNMA 2P3QA 4OF4A 3R6DA 4QTTB 3C5FA 1V5GA 5GMOA 4UAZA 4G0OA 1PK7A 3H97A 3PC4A 3B3GA 3PIDA 4EQZA 3LKVA 2YJ6A 3ZGVA 3ASVA 3L7KA 1UBEA 4FBLA 2CV1A 6NULA 3H7AA 3KKNA 9ICVA 4HS4A 4DIUA 4MCHA 1NMEA 4JHLA 1BOFA 3MWDA 3T5DA 1IQRA 3B85A 2HJ9A 1OZGA 1VGQA 5JUWA 3M3PA 5EXEA 5BVGA 4RZXA 5KYWA 2KN7A 4RAQA 1RT9A 3N6VA 4YT2A 5BR1A 2K89A 3CLSC 1OKKA 1EP1B 5EIWA 3A31A 5KOHB 3G2LA 3OZEA 1FLDA 3RB0A 4ZIRB 3E4DA 4ZICA 3SXPA 1XAGA 1KRWA 5JXGA 4IOLA 5LP6A 4CMIA 4YN3A 3R6TA 2PDAA 2DQSA 4RULA 3KPJA 3SZ3A 4R8UB 1AN0A 1Z88A 3HMKA 4D81A 4R54A 2OL4A 1E0JA 3D0OA 2H1LA 5EY5B 3OM1A 3RS4A 1ZJ5A 3SLRA 1N9ZA 3TLCA 5G41A 1OI4A 3B7GA 3P4XA 1NN1A 4HGRA 5F7JA 5HM8A 4CMJA 2BGKA 4IGEA 5BUSA 1II0A 3OZDA 1WW2A 3VR6H 1EPUA 2ZUWA 1GQQA 5CNIA 1FSSA 4QOGA 2KPOA 4WBNF 3P97A 4DLGA 1MB4A 3S1SA 1ZMXA 1M34B 3AEQA 4YQWA 2O5EA 1T36A 5MF6A 3BXEA 1IY8A 4YAIA 2ZI9A 5J0YA 2HHAA 3DCYA 2CSUA 3NRJA 3NTOA 3Q6MA 2EDUA 4PRKA 2E3TA 2QMYA 1S8NA 2VAWA 3LHDA 3FSJX 1YTLA 2Z4RA 3U4GA 1YRHA 1V48A 3AJRA 2YIVX 3OBIA 3B82A 2QMOA 1IPHA 3CKYA 3ODPA 3EVFA 3S2ZA 2O4CA 2KZZA 4YJHB 4CL3A 1KZ7B 1ULTA 4Y2RA 2PD3A 1P9RA 3PPIA 2XY7A 3R0QA 3DUFA 4BMZA 1MFZA 2RGDA 1F5NA 2OBYA 2IH2A 1FX1A 2BM1A 5EJMA 3UJ3X 3A6ZA 1U02A 3P9NA 9ICKA 2WM9B 4YFYA 5FBVB 1JX4A 3PRYA 1WVIA 3RRZA 1O5IA 4XOIA 1UOOA 3SN6A 3FPKA 3AHFA 1E7YA 4PQRA 1NF3A 4NU8X 4I7EA 5LR6A 3PNCA 1LSJA 1Q0UA 1GV1A 4S0XA 2PNFA 4PS1A 2HD4A 4F7DA 2ZS8A 1BXGB 3K0EA 4F2WA 4WT7A 4E1VA 2EZTA 4BLQA 4A2QA 4HTFA 1MQ8B 3GLVA 2EATA 4DGQA 3DTNA 4J3JA 1FU7A 4FFSA 3N59A 2GJKA 3TI7A 4W5HA 2H48A 2A9VA 4K4GA 1KDRA 1RM3A 4K03A 1BGVA 1Z0DA 4NQRA 2CL5A 2BTOA 4BRWA 1IC6A 2OT3B 1BPZA 2OHVA 2WTAA 5TQVA 1E59A 3LUHA 1KQOA 3TR5A 1LPAB 4M47A 1AY0A 1H2YA 3MS2A 3KXDA 2ZJ6A 3V3KA 1P7YA 1PSDA 3JVDA 3QEMB 2P4EA 4IR7A 3DXXA 3L8HA 2QX9A 2XCLA 5JCJD 4MINA 1X80A 5JOQA 2VHQA 4X5OA 1C3EA 2F3RA 5C3MA 1SZDA 2FR0A 2AOWA 4G23A 3T7TA 1ILWA 1HL3A 1Z6GA 2J5QA 5EIEA 2G6BA 4BBJA 2XDQA 4TTAA 3LFHA 4K9SA 3T7JA 2ET6A 2AXPA 4Y2GA 4NV0A 2Q2QA 1WR8A 5HE8A 1BU5A 2GERA 2VZ0A 4YREA 4JC0A 1JQEA 5DNEA 4ES6A 3KKOA 1UPTA 4DWOA 2V9CA 1OWNA 3C4VA 4RXUA 4HDRB 2JAQA 2FFBA 4KGVA 5T4FA 2FW8A 4K9RA 3S4YA 3RK4A 2XCQA 2PMDA 3OPVA 4ZOCA 2ODBA 2BHSA 2NPOA 4K0KB 3TANA 4J94A 4LF6B 3F71A 3G88A 2QLFA 5J1TB 3I6YA 3QKIA 1DLIA 2FMFA 1OX4A 3VKWA 3QVSA 1YCFA 4OD0A 3HKDB 1PFYA 4NZPA 5CIYA 3PLRA 3IMFA 4IJKA 2F6RA 2ZE5A 1N32B 4Q1DA 2LYHA 4FMCF 1CF9A 1NQ5A 4RTOA 4GKKB 3T9EA 1XZ8A 3RB8A 4F4FA 3ZK7A 4DJ5X 3KD3A 3PMNA 2XNKA 3KQLA 2H63A 1VIVA 4IJ6A 4HDCA 2AR9A 4XUDA 3TAUA 4P2BA 5CHEA 2G9NA 5FTJA 4NBKA 1ZXIA 5ADWA 4FZ3A 4MRVA 1DJLA 4HDNA 3VYTB 1FFAA 1YJ8A 1U9LA 5BURA 4Z0HO 1TA0A 1GGHA 2FWRA 2E6UX 1SH7A 2ZSJA 3MJSA 5ADVA 2A88A 2RLTA 4FI3C 4ZANA 4I1OA 2ZRPA 3PR1A 3ZDRA 2HIMA 2BFBA 2WJ6A 5B6JA 3MMZA 1SN7A 5TT0A 4NLNA 4MVJH 1JLRA 4FJ1A 2R60A 2Q4OA 4QDKA 2JI4A 1ZVVA 1L3VA 4NFLA 1X8LA 3KOZA 2KJ5A 2JGDA 1SHUX 2J8ZA 3GW8A 2NXJA 1KI9A 1XB2A 2X4GA 1JR3A 4GHWA 2QTHA 5A3JA 1NBOA 4NXNB 5HIIA 1OZFA 1QCDA 5IZCA 1PL8A 4RVHA 4XLZA 2ZUFA 2PG3A 2JH3A 2JCVA 1U8CB 4KJZA 1H8ED 3B1YA 1SC6A 3GHYA 4FLMA 4HN9A 3Q3IA 2Q99A 3ELYA 4A16A 2MCFA 2BEWA 4Y0VA 2FF5A 4TVBA 1PS9A 3DFFA 5EWLA 4EF4A 2EOAA 3KXKA 3PD0A 1JG6A 5DWQA 1T2UA 4MJ3A 3IGFA 3ELWA 4KWEA 5AI6A 4QC2A 2WSBA 3T3HA 1NZFA 5AM2A 4S3MA 4TQAA 3M9OB 3OSPA 4RSGA 1BXKA 4X71A 2W6JA 1XMVA 3ITDA 4PLYA 3T3DA 1OV6A 1P62B 3K96A 1TYBE 4BC0A 1DOZA 1QUEA 4QBFA 3EYZA 2EZXA 3UMBA 1V6SA 2G36A 1F4PA 2QY9A 4ARVA 1DRKA 5JATA 3DCJA 1G2PA 1TTPB 2CHFA 1Q8KA 3MTAA 2VBIA 1LI4A 4NEQA 3F6YA 2Q6VA 3FHJA 3RTEA 2C99A 3RB4A 2WFLB 1FVOA 3AG5A 2FWPA 4XR9A 4LHSA 3C23A 2BW0A 4RO0A 4LC0A 1KYVA 4C87A 1T6NA 4D45A 2ILTA 3MDCA 2Z2XA 4DR1B 4ZN6A 1KBOA 5KDDA 2OECA 1KPIA 3RU2A 1UC4B 5A4DA 1M2FA 1N0IA 2J31A 3ORRA 1Z16A 2B4AA 2PU7A 1JIHA 3FFTA 1JLHA 3I04M 3D4OA 5ITZA 3OE1A 4JCOA 2YHAA 1KR5A 4ZC8A 2J4CA 2YMPA 1HR0B 1M1YE 4JP8A 3C7TA 4PHFA 2ORVA 1ZI9A 2PGAA 1Z73A 5FPKA 1KSGA 1Z47A 1WDTA 2X4LA 1D6NA 3UG7A 2K8AA 3LK7A 3NHYA 1NLZA 3KELA 1KKLA 3HUUA 4KO1S 3PWZA 1E1CB 1DS6A 1WDLA 4YRQA 3K70B 1X1AA 3FRHA 1K9SA 4MQ6A 4JB2A 2VHEA 4HB4A 2FX3A 3WL3A 5JXJA 1T0BA 2C8KA 1DG1G 4HVLA 1QFZA 5KQSA 2XA9A 3F5DA 2CXUA 3SQDA 3EYAA 4JLVA 821PA 3E9ZA 4G8DA 3C1AA 5AXAA 4L5BA 1KARA 4B74A 4MLPA 5FD8A 1T2DA 1W5SA 5HDQA 3D3NA 1LJUA 1RZRD 2CEKA 4YV7A 4IZOA 3VAYA 3HO8A 1YHZA 2O07A 1HQYE 1VPVA 5LMNB 4X1YA 1AF4A 3QVMA 3MEQA 1PCXA 4R05A 2XRFA 2C04A 1R6UA 4G65A 2C5FA 2IYWA 1RPJA 4LMPA 4OQLA 1ACMA 3D5EA 4ZEXA 4XWOA 3U7QB 4UB8U 3MGVA 4B8WA 4G5SA 3TIIA 4GQIA 1PSZA 1VGVA 2H1CA 3TZCA 4FZ5A 1V71A 1SIJA 4AY3A 4NZMA 3QX8A 5D2CA 1YQEA 5CK5A 2I3ZA 5DX0A 2HVIA 1JQJC 4TKVB 3FUVA 1ZQKA 4EHJA 3KE8A 4LIPD 4LZJA 1O5OA 3RAFC 3D8NA 1D9FA 3BF8A 3DBVO 5DJ5A 4FT2A 1LLUA 5DK4A 5IANA 1NPTO 2WF9A 1SXPA 1T0PA 3ZXIA 4POAA 1ULBA 2VA9A 3AKCA 4K1LA 1XWIA 4FMDF 1C8LA 3NALA 1PJ3A 4GZ6A 2YOGA 1QO0D 2CUZA 4RHCA 1GNPA 1BN6A 1KR2A 1XWWA 4CQMB 3A9TA 2M98A 2V4MA 5CFQA 1XTZA 1NV8A 2C3YA 3IMKA 2P4QA 1KERA 1STOA 3PSTA 4RTQA 2IEZA 3RFUA 3A4YA 2D54A 4HWPA 1SQ0A 4CLOA 1ZCZA 4NPCA 3DUWA 1F4LA 4HNAB 3AHHA 1QORA 3WJAA 1HYHA 1YZ6A 1YR7A 1Z8DA 4G84A 4FO6A 2ZIFA 2GCEA 4ECAA 5BQOA 2WJIA 1VHQA 2FH5B 4GOMD 1M74A 3WWZA 1NSYA 2IUFA 4H35A 1ID1A 3FCOA 2X8JB 1HNXB 3STYA 3PPYA 5DV9A 4C4TA 2OZVA 3TRJA 1R3DA 2ODWA 4F4WA 3R4CA 5ALYA 1COKA 3G2JA 4UZFA 2O8CA 3W5AA 5IH7A 5MGBA 2QK4A 1S7GA 3IT0A 1ZH8A 4TRJA 2DLNA 2X15A 2K8CB 2ISCA 3BFJA 4M9GA 4EPVA 1JJIA 5HJEA 4AKSA 3EWAA 3BGIA 4LK2A 1HQCA 3WRVA 4X00A 4KK4A 4QNNA 3SSAA 1NBHA 3KOOA 3FLMA 2VA8A 1YZLA 3TNDA 1NHWA 3WY9A 1WUKS 3WK6A 2O2JA 4NEHB 3DULA 4Q1BA 5CCBA 3KAJA 4WY5A 3HM9A 1PJ8A 4OJNA 2VQEB 5F9MA 3QIVA 2JDID 2CF5A 4CIYA 3G8YA 1ISPA 2HN9A 2WKPA 2ZIWA 4E6EA 4ITUA 2M2IA 5JNVA 3GHHA 4CL8A 1JMVA 1CY7A 5EQDA 4DILA 3M8RA 2E4XA 2ORED 3HDTA 3L0CA 4F71A 3IURA 2BSAA 3FNQA 2Q4RA 2XUHA 3VHQA 4GZMA 5AI4A 1F06A 4FOSA 2JEIA 1PT8A 4MUHA 5GJVC 5L1MA 5CG2A 3B3JA 4DR7B 2KK0A 4DOCA 3OZFA 3AETB 2A6PA 3LBIA 4WKPA 5IRCD 1YDFA 4ER0A 9ICHA 1GUZA 3K75D 1TQ8A 2JAHA 5ALSA 1NF2A 5CUQA 2F76X 1GSAA 3T3FA 1Q22A 1S9HA 2WJVA 1OZHA 3C6KA 3CZAA 2O6KA 1GM5A 1DV1A 1AT1A 1PL0A 4FOOA 4CKBA 1WB4A 3DE1X 3ANXA 2Q4BA 1N5WA 1ICIA 3MM4A 4C89A 1TB4A 3KUKA 2JZOA 2WHEA 4ML3A 1PFQA 2P35A 2GEFA 1TI7A 2C9YA 4R1MA 3ZXSA 3WV4A 3EG5A 5IASA 3RAGA 2C2ZA 4UNPA 2FG5A 3NC1C 4HYKA 4EEXA 3ZE8A 2XTJA 2PXXA 3X43A 1CUYA 5E95A 2AL7A 1KP2A 1CQXA 5BWNA 4OQYA 4MI6A 4MWDA 3R7AA 3CINA 3E3NA 3T6KA 3AINA 1YB7A 1XLTC 1CR0A 4XWGA 3TPFA 2ZYUX 2VWGA 5BR4A 1UKBA 2R1ZA 1YUBA 1AUOA 1FTQA 1G2QA 3IODA 3O91A 4LY9A 4HG2A 4QU0A 2PCJA 5KTSA 1M66A 1Z45A 3FJYA 3P71T 3DOOA 2AVNA 1OH5A 4ZGBA 1YDEA 1HOXA 4ZZIA 3LWDA 2YOFA 3KOYA 1ZNZA 2XB4A 1T3ZA 1JDSA 2LRHA 4HWRA 4TQ9A 1Z2DA 4AZSA 2ZTLA 5IBQA 5CB4B 3G6XA 1Y8QB 2ZE7A 1ST2A 5IHPA 2KSOB 3KBOA 4A1FA 2OD9A 4MS1B 3SZRA 2EBUA 3K9CA 1YULA 5E7QA 4TKZA 4AROA 4C7BA 5C8YB 5IS2A 2WWHA 4DBZA 4U7PB 5KT6A 3EDYA 2Y4NA 2XWSA 5CIQA 4ECUA 4G63A 4CU2A 1SD1A 3QXJA 4TV8B 3WQSB 4PIVA 4QGBA 1VSVA 3RAJA 3V97A 4B3TB 3DHEA 1XQYA 2FSHA 4M3NA 2TMDA 3HACA 5IBRA 4EA9A 3P9RA 2DTDA 2FDRA 1YOBA 2ZI4A 3TZ6A 1C5KA 1LC0A 3GJQA 4F8JA 3ACCA 2R48A 3KZCA 5G0SA 3EZLA 3VRHA 1QO7A 1CUCA 1P0MA 4I3HA 4ITRC 3L2OB 4RF5A 4J91A 2XHEA 3CNNA 5DI9A 1SOWA 5FFNA 3ZKWB 4TQSA 4ZRDA 4KQKA 2VOJA 2GHRA 4ZTBA 2KZMA 3SSOA 3W1VA 2NUBA 2XLBA 4O8ZA 3IOYA 5JR3A 1P75A 3I3OA 1A7KA 3RJEA 1IHPA 3OEYA 3M81A 2QKQA 4FZMA 3ZDBA 1XFDA 4UU0A 1WSBA 3BQMB 4WADA 5EOVA 4ATNA 4W7HA 5HK9A 1JKXA 1WW8A 1JPUA 3PR3A 2Y0SF 4M0PA 3VU8A 3RYFA 1SM4A 1KK0A 4IXTA 5EHQA 1XRNA 3DHVA 5CGZA 1GT6A 2I3GA 3UMSA 5ERYA 2Z7JA 4YALA 3N7PD 4Q4AB 1HRDA 1D2RA 2IOFA 3R0IA 4AYBC 2O7VA 2Y93A 3H5VA 3AHIA 1GG5A 1BHQ1 1CEYA 1A1VA 2MAXA 2GZSA 3VDRA 3ZS9A 2IZ0A 4B6RA 4BE7B 5H80A 1D1QA 4PTZA 2DSTA 3EVEA 2ZR9A 4A0HA 1CUIA 3V2HA 3SYKA 4GXRA 4YJDA 3HYCA 1B7GO 1DC7A 3QOXA 1NIJA 3TO5A 1B73A 2WVHA 1OB5A 5KT2A 3R9WA 1NOIA 2XRYA 2PLAA 4ZOAA 2Y0EA 5I5EA 1QG2A 1U2RA 1QDEA 3E9EA 2WILA 4L4YA 1DRUA 4BX8A 4HMPA 3W90A 4M46A 1ADJA 4R2XA 4F93B 2PT6A 2P6UA 3PYLA 4UM9B 4G41A 3BZBA 4IDNA 3QSYA 1ZSVA 4UU1A 4HH1A 2HLNA 1YZTA 2ID4A 4KO3S 4BGVA 4PNEA 3I01M 2YVAA 3R5SA 4IVRA 1CJMA 2BJWA 4C9BA 4M60A 3GFKB 1B0PA 5B1YA 3RT1A 1B6GA 1T0JB 4XPIA 3QFHA 5G53C 3M6FA 3AY6A 4IFTA 3GRKA 3RR8A 5SZKB 1GTG1 4HAVA 3QKRA 3VYRB 1L6RA 2RGYA 2WMYA 2IZ7A 3CEMA 4XI9A 2FPXA 2MSCB 3JZMA 3HO6A 4Y1FA 1U11A 1WHTA 4LJYA 1QTRA 1O5TA 2N47A 1QB7A 5BUQA 2JZBB 3H9UA 3IDOA 4I2HA 2HVHA 3FUCA 4DKXA 2VDPB 1RYZA 2P1ZA 9MHTA 2GDZA 3UJ8A 4ITVA 4WUTA 1X1BA 1PK1A 2CE7A 3VR4D 1VLZA 1NA5A 2J3LA 4BU1A 1P0FA 2UV8A 3OF2A 1EUCB 1XWLA 4WXHA 4LYHA 1BO6A 1NUAA 4JMLA 3FMIA 3CX8A 2ZZMA 2PY6A 4MVWA 3A4TA 1RQLA 3N2GA 3FFAA 3IV6A 4IIJA 4X85A 2FEPA 4FB4A 3FDSA 1FTSA 1ZM9A 4BEVA 1NK0A 4ENPA 5KTNA 1GAWA 1CEXA 1XDSA 3MF4A 1SIUA 2VHUA 3QU7A 4IR9A 1JFSA 4QX6A 4D79A 2UVPB 1L4KA 3FUWA 1MMFB 2GM3A 3RFXA 4N47A 4CF7A 1N2EA 4IY1A 2QGFA 4KMOB 1BYUA 1UQUA 3HZRA 3O8QB 3CTMA 3G82C 2KIVA 4J6FA 4NOMA 5BYKA 3C5CA 2A1TR 1D03A 3TGLA 1J2UA 2BBTA 4QD3A 1YE5A 1KIFA 3RJ9A 1DUSA 2CXYA 3L6UA 1P5HA 4M38A 1A9TA 3NT5A 3U3JA 4DA4A 4KNYA 1ZNQO 1N36B 2IUYA 4IXDA 3ICOA 1XI2A 4ED6A 1WXDA 3AEUA 5TE9A 1M67A 4KG7A 1BS1A 1DJNA 4Q4HB 4CHTA 1NASA 1G8KA 2A7QA 2AJTA 1T8RA 2QZPA 3SZ2A 1P1CA 4KQ6A 1TCVA 1TVEA 4OGKA 4Y1GA 3QFRA 4PM4A 3IUNA 1RKUA 5GOTA 3NJ8A 1VYVA 1IBSA 3RVDA 4BKQA 1P9WA 2HLDA 1OWPA 3LI2A 4O3NA 1VDMA 1YK0A 2OCIA 4RQAA 3B70A 2YIDA 1IN7A 3NBXX 1EBBA 3F1LA 4B84A 2JKZA 3PF8A 3HMQA 4UULA 4TS3A 5AVRA 5K05A 3WMWA 3VOSA 4PIMA 4EGCB 4JLAA 3K8YA 1ZJYA 1OXSC 1SY7A 3K09C 4IQWA 2NZ8A 4B3IA 4DSJA 1SXJD 3H9BA 3KR0A 3B2EA 4XVHA 2FFAA 3U4AA 4D4JA 4YFVA 2PZJA 4B83A 2PWPA 2ETVA 4L4SA 2IBTA 4Q9AA 1XMOB 4YIKA 4DNPA 3F3YA 1ZICA 2ZTMA 1G9XA 2ZBVA 3O3OB 5B7PA 1C0PA 1RHJA 4G2TA 3I4CA 4V2IA 2OKCA 1NK6A 3NAZA 3RGGA 3FRIA 2R7MA 2FSGA 1XU9A 1P2SA 4W6ZA 1ZUNB 3H1FA 1X7DA 1BDHA 5F23A 2QTBA 1R6AA 3VPFA 2AW3A 1X74A 3BRWD 2NU8A 2AF3C 5DBIA 2JIDA 2HI0A 5JAMA 1REQB 5CT8A 5LQSA 4LOAA 1KO4A 4KZPA 2N9UA 4LC1A 1KH2A 4ENQA 3JARA 1G5IA 2BUCA 2HUPA 1Z6TA 4ETMA 4RK5A 3BXOA 3KJQA 3R3UA 1SK9A 4MQLA 3FMOB 3SWWA 4Q44A 1XQ1A 1GXSB 1N6HA 3PPWA 4UAUA 3VH1A 2TRSB 4DHEA 5J2UF 4DXHA 4C0QC 2EGHA 3PNPA 1KP3A 3TB4A 4INZA 5DN9A 1Y1SA 5HSGA 3LGSA 3RJMA 1GJRA 2W6MA 1N2CA 1S9FA 4DPMA 3DT8A 3DE5X 4AICA 1QPGA 4HX2A 3LLVA 5BNWA 1YFZA 1H2FA 1UAGA 2DPMA 4YEDA 3CYFA 4RGVA 1NW4A 3C3YA 5HK8A 3CVJA 4XQEA 3IEXA 4F6CA 4NU0A 4IH4A 2ATXA 3OZIA 2IIBA 3TR0A 1ZK1A 3BIFA 4JX8A 1M0WA 9ICRA 4EG7A 1MNQA 1GPUA 2QM0A 1U47A 2CHUA 2XGGA 2JD1A 3ZZNA 1SCJA 4TKUA 4WZZA 5DFAA 1NQUA 3U7FB 5EEHA 1VMKA 4S35A 4Y6GB 1E66A 3NAGA 2ZUTA 2QUHA 1MAUA 3OEWA 3S3TA 3ZWPA 4M9HA 2POQX 3WLNA 1XXHB 4EW6A 4HJRA 1T1EA 3EODA 1PJ2A 2VP9A 4LYFA 1NLYA 5ICMA 1LDEA 1RYFA 2BZ1A 3UGJA 5F64A 4BQIA 5AKIA 3K73O 1Q83A 5H4GA 4R2WA 3VDXA 2GQ0A 2FP4B 4Z1MA 3UT6A 1XLWA 3JWEA 3SI8A 2PYZA