3D2SA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain in complex with cgcugu rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
TDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/rna
molecule keywords 5'-R(*CP*GP*CP*UP*GP*U)-3'
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2sA00
3D2QA 3D2NA 3D2SA 2E5SA
chains in the Genus database with same CATH superfamily
4J9RA 4NLBA 5IIKA 5J2EA 3RH6A 5ALJA 5ALDA 3QZ8A 1ZQVA 4UB6U 3DEEA 2QARA 4QWCA 4UB4A 2KZZA 4OCZA 3OHAA 1XU4A 5KFSA 4KN4A 9ICBA 2NO5A 3TANA 2NO4A 3T5JA 4FBUA 5G5GA 2WTFA 3LDAA 4BUGA 4J9NA 1K5OA 3AL0B 4F93B 5AKLA 4YR2A 7ICJA 2ZIWA 1O08A 5AKYA 5KL8B 2ASDA 3V7JA 4P0QA 2BGWA 1Q8KA 1WCLA 3N7SC 1NKBA 4RQ2A 4UB5A 2W8LA 1MC8A 3PW5A 1UT8A 1KLNA 4DCCA 1SKSA 4C8OA 1RYRA 2HBKA 4DFDA 2AHOB 5DG9A 4J9SA 2CRXA 2G07A 3D2SA 8ICHA 4JK1A 1ZQXA 4BWMA 2XICA 4Y2XA 5AM3A 2K4EA 5IINA 1S10A 2BDPA 7ICOA 2UVVA 4RPYA 2FPMA 5BPCA 2AQ4A 1BPDA 4F4KA 4NM2A 4IC9A 1ZQQA 3RFAA 1COKA 1PK1A 4DSIA 3QU5A 4UASA 3V7KA 2OYYA 2JH1A 3TACB 4P4PA 2KMDA 5KFPA 1ZQPA 2D3DA 5KFEA 1JXLA 1UA1A 2LYBA 1KDHA 2JEGA 5AI0A 1PUZA 4GC7A 1BNOA 3V72A 4C8LA 3WK8A 1ECWA 5KFWA 4F91B 4M0AA 2N1RA 5J2HA 8ICUA 4KLMA 7ICMA 1AROP 2ASJA 3K4GA 5AKGA 1O03A 3UM9A 5C5JA 4F2RA 3RH4A 3JPQA 2BCUA 2CPRA 2DWQA 9ICFA 5J2JA 1BPXA 2LM4A 4DQQA 3H0MB 2JEFA 2W04A 5F9LA 5CEHA 1X6JA 3FC4A 3ZDEA 4UB3A 5ALNA 1N48A 1ZQTA 3OJUA 1N62A 4O3SA 5AHXA 2ZUDA 1ZQOA 4B9UA 5AICA 1Z4NA 3Q8KA 1X40A 3NRZA 1QH9A 4JWNA 2AH5A 5AI6A 2WF6A 4JV0A 3BZCA 3E58A 2OEHA 4IRCA 4PZOA 2EAPA 4RQNA 4Z6CA 1N56A 2E8PA 5KFXA 3EYZA 3EPIA 4BXOA 1V97A 4XUSA 1D9DA 5DQGA 1TAUA 2YMLA 4PGQA 7ICHA 5KG6A 4RNMA 4O3PA 3D6JA 3IV6A 4J9QA 1VLBA 4P4MA 3RR8A 2OCEA 4KLSA 1PK3A 2JZBA 1TK8A 3HKZF 3M7DA 3KKAC 2PXIA 2XY6A 9ICCA 2MSNA 2JEJA 5HHHA 5AM4A 2DPJA 3TARA 1FFUA 2NRZA 1ZQNA 3CRXA 1ED1A 2A19A 2PMZC 1BPZA 3OHBA 1Z00A 3C5FA 4EYIB 4B9LA 4YP3A 2QB0A 4RUAA 2M0NA 3PSFA 2KOBA 2HHVA 4NXZA 2HHTA 1X66A 3D2QA 8ICAA 3MGVA 2BQRA 1MN8A 2AJQA 5ALSA 7ICIA 8ICGA 4G3IA 2IHNA 1VJ5A 4RNOA 5T14A 5KFBA 4NL9C 8ICWA 3UPQA 4Y2VA 1ZJNA 3V6HA 2H5XA 1NK6A 4O5KA 3VC8A 2RHFA 1L5UA 4R65A 1SZHA 2G5IB 1MQ3A 2XCAA 4PH5A 3RH5A 4IR9A 4MFAA 4B9VA 3TQ1A 8ICBA 2KE7A 5DG7A 1B4FA 3I76A 1KFDA 4DFMA 2P66A 2ZTCA 1IG6A 1L7MA 2PKEA 4J9KA 3MR3A 1SKWA 4PHDA 4DL2A 4ECTA 1X6IA 3MABA 5L1MA 1NJXA 3EW9A 4NJ8A 3KBBA 5EE1A 3C29A 2Y1JA 4MF8A 1RQLA 3PO5A 4ECWA 2BCRA 4I2AA 1S5LU 3RJJA 3GZFA 4OJ5A 2WF7A 2VA2A 5KFUA 4F3OA 5DLFA 3RB0A 1U47A 2R8JA 2XCPA 1XSLA 2AU0A 2F1HA 4ED7A 3PW2A 3AUOA 2WF9A 4Z6DA 1B43A 3RJHA 5HMMA 3PX4A 4UATA 4GXIA 2QKQA 4GIBA 5KT5A 2VA8A 2A1JA 2ISOA 1TAQA 5AIAA 2KV2A 5AKIA 2F3NA 5DQHA 2RLTA 1IV8A 1L3SA 1HJPA 2F1IA 2ZIUA 1KKXA 9ICUA 1Z3EB 4LVSA 2I5HA 3WKDA 5ALHA 3Q8QB 2W9BB 2IHMA 4C4SA 4FS1A 4ELVA 1V9PA 1A6SA 4NLGA 2K4HA 3C2KA 2YQEA 4DSLA 3HT3A 5KFIA 2YN4A 3GV7B 4KMUA 5J0OA 8ICPA 4Q8EA 1MA7A 5KFZA 1ZQBA 4NY8A 1JUDA 2E8OA 8ICQA 3QZ7A 1B22A 1A0PA 3KHGA 8ICJA 2KEYA 3BS5B 4EEYA 4NWIA 2EH9A 1TE2A 2RP5A 2MAXA 4QZFA 3JPPA 1M6YA 3H8MA 3PW0A 1JX4A 3PVXA 1TK5A 1ZQWA 3SMVA 2FMQA 2ZXIA 4KLDA 3C2LA 3ICXA 2E1EA 1ZQUA 4F8RA 1NK4A 3KHHA 4KLJA 2QARB 2AGQA 3ETLA 4CE6A 2KHVA 3SD7A 3PX6A 3NUQA 3CP8A 4U6PA 2ZUBA 1QSLA 3KTQA 2WF8A 4YCXA 2MRLA 2DFLA 2V4RA 3MC1A 4HYKA 3OSNA 3PV8A 4XA5A 4YD1A 4Y2TA 2MU2A 3SZ2A 5KG5A 5AI5A 5HP4A 5DB7A 5J0TA 2HSZA 3ALRA 3KD3A 4CF3A 4UQGA 3V6KA 4IR1A 2K8BB 2KK0A 5EWFA 4F4WA 4F5NA 2ZIXA 4P0PA 2PFNA 4J9PA 2A1AA 2CXYA 1X9SA 4UBBA 2YY6A 3F2BA 5ALVA 2FJ6A 1LB2B 4P4OA 4DOAA 5F9NA 2D6FC 5KFAA 7ICNA 4DL7A 3ISCA 2KZMA 2W55A 4IQWA 1S8OA 1T94A 5EOZA 5HHIA 3NGDA 5KG1A 4M9LA 1U48A 3N97B 2PMZF 1L8LA 2WAQC 3WKAA 2DKZA 1S97A 5KFMA 3PW4A 3M9OB 2GWSA 5KFKA 2DKXA 3PX0A 3R9KA 2AGPA 5KT2A 2R8KA 2R8IA 5AKJA 3OTQA 3QU4A 1ZQHA 7ICUA 2EANA 4IQUA 4I2GA 2ZJ8A 4EX7A 4ECUA 1ZJMA 2LM1A 2LMRA 4UAYA 7ICLA 2XC9A 4OJOA 3GIKA 4YXMA 3MBYA 4KX5A 1RG6A 4DQSA 3QE9Y 3DV9A 3WK5A 1UCVA 2NV3A 2W03A 4F5RA 2Y0SF 4CF4A 4M47A 4DLGA 3IDWA 4IL6U 2W7PA 3NVVA 2G08A 4Q44A 1N2XA 4QZEA 1VDVA 4TQRA 2ES6A 4YVZA 4FBTA 4DL4A 5J2AA 5AM2A 3BS7A 4C4TA 1TV9A 1T3NA 4MFCA 2F77X 1RXWA 2VIXA 3KKAA 3EPGA 3PMLA 4I2JA 1S9FA 3B0YA 4YMOA 3KZIU 1HUOA 2H3QA 8ICEA 1UA0A 2KP7A 3NS1A 2B0CA 3TADC 5L1KA 4US8A 3AU2A 2R18A 4ECXA 2W3RA 3PMNA 3Q8PB 2ZTEA 4YD2A 3V6JA 3GFKB 4AYBF 1SV0C 2ZUCA 2KSOA 2LYAA 4UW9A 2LKYA 5GTIU 4QWEA 4R66A 2JGAA 1JMSA 2NRWA 2JV3A 8ICXA 1TVAA 4DSFA 3BQ2A 4DF8A 1X42A 3T5LA 4DLEA 3WK4A 4O0IA 2IOFA 4EENA 1X9WA 4R8UA 3SQIA 5ALXA 1LKYB 3QEAZ 2XY5A 5KG4A 2HBJA 3C5GA 8ICCA 2W7OA 4PPXA 8ICNA 1D8LA 4DL6A 3QNMA 4YR3A 4US9A 4OJLA 2W9AA 4RQ0A 3A0BU 2KTQA 4QWAA 3K75D 4QZHA 2FLLA 1HUZA 2OM6A 3BJYA 2BPCA 2GO7A 3NVYA 4BWJA 1Q46A 4RQ6A 3MR5A 3C1YA 1DK3A 2EZYA 4UAUA 1FEZA 2OXOA 2IA6A 1NJWA 4KN7A 3SYZA 3QU2A 5CR0A 1NK9A 5KFYA 2HBMA 1BPBA 3FM9A 1K1SA 2BCVA 5CWRA 3KZXA 5ALZA 1L6NA 2DF4B 4LZDA 4YN4A 4KLFA 4DSKA 5DG8A 5J8YC 3T5KA 3WKBA 4GFJA 1Z00B 4RZRA 3OPXA 4M04A 2W8KA 3ZDDA 1JI7A 4QW9A 3MR6A 2KVCA 5EE0A 3PZPA 3RJEA 2G5HB 2D8CA 2EDUA 1T4GA 2M9NA 3H8JA 3N7RC 2RRDA 2HMXA 3LVWA 1SXEA 4JV2A 1CI4A 1UQVA 5DKWA 2KN7A 2W9BA 1ZQSA 8ICLA 4ECYA 5L1JA 1WWUA 2ALZA 4ECQA 2RDJA 5KAIU 2K8CB 2WFAA 1Q3VA 4O5EA 2C2RA 2AXTU 3OSPA 4ACOA 2OHFA 2BPGA 1KTQA 1ZQJA 4PGXA 4IQVA 5KG7A 3RJIA 3WK6A 1N61A 4DO9A 3OJSA 2W9CB 2YX8A 4YMMA 4O3RA 3SR6A 1ZQEA 1MSWD 2BKEA 3PSPA 2KIVA 7ICKA 3RJKA 3ZDCA 3GIMA 3IP4B 4OD0A 5CB1A 4CGZA 4ED3A 5KFLA 2RDIA 4FS2A 1SWVA 1XS9D 5CRXA 1S0VA 4M6WA 1ZQIA 1JN3A 1NK8A 3H4DA 2ATLA 5F3XB 2WB1C 1X9XA 2KJ8A 4F2SA 4I28A 4RQMA 3THVA 4C0ZA 4Y2YA 3SAHA 2J6UA 4JMUA 8ICMA 5ALTA 2MUTA 5KFTA 5L9XA 3IN5A 2BR0A 3ORYA 4J9LA 1PK1B 4Q45A 1F5SA 2F2AB 2GH1A 2W9MA 1KRPA 3I28A 2CN1A 1YT3A 5KT7A 1ZRNA 3Q8LA 2KKPA 2VANA 4XRHA 4I2IA 3RRGA 1P7DA 2XIDA 5DQIA 2ZIVA 4O3OA 5J0SA 4RUCA 9ICSA 3C21A 4Y2UA 4JUZA 4BXOB 4M9NA 2WF5A 4PHEA 5J0UA 4B6JA 3MDCA 4EBCA 1PVRA 1SKRA 2RQ5A 5J2BA 4KLIA 3PR4A 4RQ7A 5AI9A 2PFOA 3GV5B 5FP0A 2ZIWB 5EWGA 3ISBA 1JXEA 1LVHA 2K8AA 2QB0B 4DFKA 1QSYA 9ICXA 4QZGA 8ICSA 2YTUA 3M1YA 4DWIA 3GQCA 4EBDA 1RYSA 5J2GA 4F92B 2LYHA 2HOIA 3SV4A 5BOLA 3H0RB 4UAZA 9ICEA 2ZXHA 5CP2A 3CNHA 5KT4A 1HEKA 5J2KA 2WB1F 3RB3A 4RQ4A 2H3FA 4ELTA 2W54A 2KFNA 1ZD3A 4QZDA 2Y1IA 3HILA 7ICGA 1K1QA 3LVVA 1MQ2A 2KIWA 4P0QB 3NVZA 2F8LA 3I1YA 1SZPA 2G06A 5TISU 2F76X 1SV0A 2BDUA 5DBAA 3G6YA 3QUQA 2A3VA 3PSTA 4LJXA 2PI4A 4AYBC 1D8BA 3HPOA 4GC6A 3WKCA 9ICAA 2I9GA 1C20A 4C4RA 3ONNA 2YMPA 7ICTA 1TAMA 2DUYA 5AKZA 5CA7A 4RNNA 3AQFA 5C0YA 8ICRA 1ZXIA 2QLTA 4TUSA 1KQQA 1RXVA 2PFPA 3F5EA 4F50A 5IIOA 5ALWA 2ASLA 3EZ5A 3Q8MA 3RB4A 8ICTA 4X5VA 4M9GA 5AI8A 1Z19A 2AGOA 9ICJA 2JR5A 4KLLA 3AU6A 2OH2A 1ZD4A 4R8UB 2KJ9A 4BX9C 3M8SA 2EAMA 1ZQFA 4KLEA 5KFFA 2W43A 1QQ6A 5KFOA 3V7LA 9ICLA 3E0FA 3EWAA 1DGSA 4GXJA 2FLNA 5DB6A 1C7YA 8ICVA 3U26A 1TKDA 4NLZA 4OO1J 2KSOB 1Q3UA 3Q8SB 2E5SA 5TZVA 4LZGA 4QW8A 4QZAA 4I2CA 4FZNA 1RQNA 2FMSA 3M8RA 3ZD9A 2HHWA 4BGDA 3HW8A 3F2CA 2O6KA 4TUPA 2ESEA 1V38A 4ZOHC 4QIWC 3RR7A 1OXJA 4UB2A 1LKYA 1NOMA 1FO4A 2K4PA 5KTQA 3A0HU 1YZ6A 5J2FA 4F5OA 4I27A 4ED1A 2YMMA 3BQTA 5JU5A 3PR5B 2HDOA 7ICFA 4KX3A 3JPTA 1Z1BA 4DQIA 2GOLA 2KZ3A 5AKKA 5KFHA 3GU3A 5D4BA 2LI6A 7ICSA 5KFNA 2W3SA 2MA1A 4ICAA 2WHEA 1KL9A 4KLQA 5J2IA 3L5KA 3E2EA 1RDFA 3ED5A 5ALFA 2KKVA 4RT3A 5KG2A 1A77A 4MEXA 4NL9A 2HBLA 4EELA 4FO6A 1SIJA 4YFKA 9ICTA 4Q8FA 4DOBA 1DXSA 2KFZA 2P35A 3MFIA 2HHQA 3TADA 4F5QA 3KFUF 2Y0SC 2F8KA 4DL3A 2E3TA 1RYUA 2ZG6A 2JEIA 5EWEA 1KBUA 4QZIA 4E0DA 9ICVA 4ECZA 4M9HA 5AIBA 2Q4TA 3M6KA 4MF2A 3NVWA 1COOA 1QTMA 2R8HA 4Q43A 5KFGA 4PHAA 3CYMA 3GILA 1QSSA 1KFSA 4MFFA 4KITB 1ZQMA 3QU9A 5KFJA 3M9MB 1U49A 4ED2A 2IBKA 3BQ1A 5D49A 1XSPA 1XO0A 3IM1A 3ZI4A 3JPSA 5KT3A 5JUMA 3C28A 1L7OA 1OW5A 3HWTA 3TAPA 3JPRA 2HCFA 2EZZA 2JHDA 5ALUA 8ICIA 4CCHA 2Q0ZX 2BPFA 3RJGA 4P0PB 3LK9A 7ICQA 3TFSA 5KFDA 4DF4A 2FI1A 1ZQAA 3BQ0A 2DBYA 2MUTB 1YZ7A 1BPYA 5KL1B 5AKEA 4QJFB 5J0WA 1UPHA 1S77D 4I2HA 1L3UA 1U45A 2FE9A 1ZD2P 5KG3A 4A8EA 1NK5A 2OWOA 8ICKA 2LHTA 1BGXT 4CRXA 4PL1A 3N28A 1KW4A 1ZQGA 2EZXA 4Y2RA 3B9JA 3AM9A 3BZKA 2FLPA 1DK2A 7ICPA 3J81j 3UXPA 4QZ8A 4ED0A 3PNCA 2XGPA 1NZBA 5H2FU 2PI5A 3KOOA 3RBDA 1BNPA 2HHXA 2ZJ5A 4UB8U 4B9SA 4J9OA 4PL2A 1T7PA 2YB1A 3OGUA 5ALGA 3RTVA 3H4BA 2IOFK 4F5PA 4IS7A 3F53A 3QYPA 4G9BA 4KLOA 2P6UA 3T3FA 2KNJA 4R64A 2XY7A 2V9WA 4RU9A 4EX6A 2BZFA 3TI0A 3UMBA 4C7YA 4PGYA 2Z7JA 4Y2JA 3M9NB 4DOCA 4ECSA 2Y9UA 3H8SA 4O3MA 5KFQA 4CDGA 3ZDAA 4QWBA 4C8NA 1WWVA 5ALPA 4JWMA 5ALEA 4UB1A 2C28A 8ICZA 5IILA 2H3ZA 3KHLA 1N63A 4YMNA 5BOMA 1QLNA 4ELUA 4RQ5A 4GLXA 1ZQCA 4IRKA 3CW2C 4F4ZA 1J2NA 5ALQA 3RJFA 5GTHU 3JPOA 9ICPA 2HI0A 4O3NA 5CJ7A 2JZBB 3H40A 1UT5A 4Y2QA 2V4QA 1RM6C 3AN1A 5EE3A 4BJQA 1NJZA 1L7PA 4GXKA 3UXOA 3MGIA 2JRZA 4P2HA 2B21A 5J2DA 1ZRMA 2G0AA 2JXJA 4QWDA 5DBBA 3T5HA 1XWLA 1SB3C 3ETRA 4NLKA 2K60A 1LV5A 3F5AA 5B66U 4ZH4A 5JTIA 4F71A 4Y2PA 3HP6A 4EBEA 1PVPA 3HKZC 3GV8B 1D9FA 4NM1A 9ICKA 4JV1A 2XI9A 4QZ9A 3G6VA 1KSPA 5DB8A 5AK5A 3NTUA 2KHQA 3PO4A 5ALRA 2UVWA 9ICRA 3ISDA 5ALIA 5HR6A 1Y88A 4J9MA 1IIPA 2E8MA 1KEJA 2HVIA 1CRXA 4IRDA 1BPEA 4OJ6A 5AM1A 4I2DA 1NI3A 3BQ7A 2KJ5A 2W11A 4C80A 3GIJA 5AM5A 3SAFA 5ALYA 4EEKA 5KT6A 5J0RA 3K1ZA 1NK0A 1ZQRA 1ZD5A 5DGAA 4Z6FA 5AKXA 4AP9A 4DEZA 1ZQ1C 1WG8A 3H8WA 1QQ7A 4ED6A 2ZJAA 4KTQA 2HVHA 3RBEA 4TURA 2UVRA 2ODGA 2C2DA 1PVQA 4RPXA 3PY8A 2IMWP 3K1RB 5DBCA 4R63A 1JIHA 3HRDD 9ICIA 5G5HA 3FYHA 1U4BA 1B0XA 3QX7A 4FE3A 2YMQA 3SI8A 3C23A 1BVSA 2DQNB 4RT2A 9ICHA 4PZNA 2XGQA 3JPNA 2K4IA 2UVUA 2HHUA 2B6GA 4I2FA 3UQ0A 2NRTA 3NRWA 5ALKA 4UBCA 2J6SA 3UMGA 2ISPA 3S6JA 3B0XA 4NLCA 2HW3A 3QUTA 2L5YA 4YG2A 1GO3F 2BCQA 5J0QA 1KFTA 4QNLA 1ZQDA 3AMZA 2JMGA 1FIQA 1SL2A 2VA3A 3L4PA 3EUB2 1ZETA 5CHGA 4DQRA 4F72A 1H38A 2FPKA 4O9MA 4KLHA 2NYVA 1AQ6A 1KN5A 3LYSA 1SXDA 4QZBA 3GDXA 4NV0A 2K89A 2FMPA 1SL1A 3KHRA 2IOHA 4CNQA 2BCSA 3TAQA 4YR0A 5KFVA 1S0MA 4I2BA 3T79A 5IIIA 4B9TA 3NASA 1OUQA 4I29A 3IG8A 1CUKA 5AM0A 4Y2SA 3Q8RB 5E79U 9ICNA 3MGHA 3QUCA 5DB9A 2LBOA 4Z6EA 1ZQYA 5DGBA 3DDHA 8ICYA 1V85A 5A0LA 5AKHA 1SL0A 3BS5A 1JRPA 3GIIA 2BHNA 4M2YA 3HJEA 1L8OA 5HMLA 2J6TA 1NNLA 2ZTDA 1N5XA 1WCNA 2NRXA 1FFVA 2EQYA 2C2EA 4DL5A 3PSIA 4I2EA 4USAA 1QQ5A 4DFJA 1S0OA 1SGGA 3M6ZA 4KMOB 3RAQA 2ZIXB 3AQEA 1WUDA 5K4LA 3L3FX 2E1FA 4M9JA 3TFRA 3IHQB 3HX0A 4RQ1A 1RPLA 5DDMA 1DRGA 3F2DA 3WK7A 1TK0A 2YB4A 2VJ5A 5IIMA 3AEVA 4C7ZA 4ED8A 4FZMA 3FDSA 4UAVA 4DFPA 4IQTA 2LPEA 1F0MA 4TUQA 4XQ8A 4KLGA 1L7NA 1A76A 3IRUA 2P6RA 3MR2A 2QB1A 9ICQA 2EAOA 4UAWA 4ECVA 2F1JA 3ZDBA 3LWMA 2W9CA 3WU2U 1CEZA 2H3VA 4JB3A 4DQPA 1N60A 4EZ6A 1ZQLA 4C8KA 3QEBZ 4QZCA 1ZOLA 2PFQA 5ALLA 5ALMA 4PHPA 9ICWA 1F44A 9ICGA 3VCBA 2G09A 4DS5A 1S76D 3RB6A 5ALOA 4F4XA 1IXRA 4EYHB 2WAQF 4HAIA 2ZIUB 1IM4A 7ICEA 1L3TA 1DOQA 4PJ0U 2HOQA 1Z1VA 3PW7A 1WYGA 4YQWA 2FDRA 5KFCA 2XVTA 2VJ4A 4K4IA 3MFHA 3BDPA 1NK7A 3QU7A 3LWLA 4DS4A 5JRTA 2HOFA 2KVSA 1ZQZA 2JH7A 1XSNA 1S0NA 1PZNA 2DGZA 2KICA 3G6XA 2C22A 5KFRA 3UXNA 4U7CA 1U9LA 4KLUA 4YXJA 4UARA 5J8YA 9ICMA 3SENA 4RQ3A 5AI4A 4KLTA 1NJYA 1L3VA 4O3QA 1T8EA 9ICOA 1J97A 3SV3A 2XO7A 2A1JB 1ZYQA 4B9MA 5HR7A 1NZPA 2GLEA 1ZQKA 2KG5A 5AK6A 2H3IA 3UMCA 1SV4A 1D8YA 1EXNA 2AQ0A 3QUBA 3RRHA 3UQ2A 5L1LA 2BQ3A 3C1ZA 5HNKA 2DPIA 4BDPA 8ICOA 3RF9A 1QCKA 1JROA 1UHUA 4ECRA 1NKEA 3C2MA 3H0LB 1DGJA 4OJPA 4M6WB 8ICFA 4CF5A 5KAFU 5J0XA 1RZTA 2F44A 3FAHA 1J2MA 2KD1A 3SEIA 4EZ9A 1N5WA 4K4GA 4QIWF 3N4MB 3TKAA 4WJ3B 3ZD8A 4RPZA 4DSEA 3IG5A 5KG0A 5DDYA 1JALA 5DLGA 1URJA 3O0FA 5KNIA 2I1QA 5J2CA 5B5EU 3QXGA 4MEYA 4FFDA 1Z4OA 3H7IA 1X2IA 5AK3A 4C8MA 4O5CA 2HHSA 4MHVA 3MDAA 3N7PD 1X9MA 7ICRA 2ZIVB 3WKEA 4TQSA 2R8GA 1XO1A 3D2NA 5L1IA 3WK9A 2E8NA 2I6XA 2DL0A 4FZLA 1NKCA 4DSJA 4NLNA 7ICVA 5J0PA 2BQUA 1T3QA 1SWWA 5IIJA 5J29A 4F4YA 1XC9A 1HIWA 2Y9TA 5AK4A 1XNSA 3RAXA 2NRVA 5D46A 2FPLA 4J03A 4K4HA 4RQ8A 5EE9A 3SAGA 2VKQA 5J0YA 4B9NA 1TFRA
chains in the Genus database with same CATH topology
2KV2A 2KJ5A 4NLBA 2YX8A 2H3IA 2K89A 4NV0A 2KNJA 2OM6A 2ZIUA 3CYMA 2W7PA 4OO1J 2G08A 2K8BB 1Q3UA 3PSPA 2HOIA 3DEEA 3SAFA 2CPRA 2E5SA 3T79A 3H0MB 1OUQA 2Z7JA 5T14A 3K1ZA 3IP4B 2W04A 3H0RB 2ZXHA 4CGZA 2OXOA 2H3VA 4FZNA 3IG8A 1A6SA 3RF9A 2F77X 2K4HA 4O3MA 2ZIXA 2VIXA 4P0PA 1HEKA 4CDGA 5CRXA 1XO0A 2WB1F 4BUGA 2HBMA 3H0LB 2LBOA 1ZQ1C 2H3FA 3VC8A 2RHFA 2H3QA 4OJPA 3F2BA 3C28A 3AL0B 3F2CA 2WB1C 2KJ8A 3KZXA 1L6NA 2ZIWA 2DF4B 4C0ZA 1SZHA 2G5IB 2JHDA 4JMUA 3SAHA 5A0LA 2D6FC 2H3ZA 3LVVA 4QIWC 1MA7A 2KIWA 1F44A 4P0QB 5KL8B 1PVQA 2F8LA 3IN5A 2R18A 3VCBA 2KD1A 2G09A 4GFJA 2G06A 1T94A 1A0PA 2F76X 4QIWF 4P0PB 4P0QA 2KEYA 3OPXA 4WJ3B 2BDUA 2WAQF 3N7SC 2F2AB 2GH1A 4AYBF 3IG5A 2LYAA 4NWIA 2ZIUB 2A3VA 2CN1A 1YT3A 2RP5A 3PSTA 2PMZF 2WAQC 2KKPA 2HOQA 4AYBC 4FE3A 2KVCA 1URJA 3O0FA 4BJQA 2LKYA 1D8BA 4KX3A 2HBKA 3PZPA 5KL1B 1P7DA 3PSIA 2XIDA 2DQNB 2G5HB 2VJ4A 2XVTA 4QJFB 1Z1BA 2GOLA 2JGAA 2G07A 3SMVA 1UPHA 2CRXA 3D2SA 2ZIVA 3GU3A 3ONNA 1TAMA 2K4IA 3M6ZA 3N7RC 4KMOB 2RRDA 2G0AA 2HMXA 2XICA 3LVWA 3N7PD 4A8EA 2ZXIA 2HOFA 2ZIXB 2K4EA 2ZIVB 2MA1A 3AQEA 1WUDA 3ICXA 2E1EA 2LHTA 4ICAA 2JH7A 3AQFA 4CRXA 3D2NA 3NRWA 3HKZF 3L3FX 3M7DA 2E1FA 4PL1A 3C29A 5C0YA 2DGZA 2KICA 3F5AA 2KKVA 3F5EA 4IC9A 3RFAA 4U7CA 1PVPA 4FZLA 3SQIA 3GZFA 4NLCA 3HKZC 4OJ5A 2HBLA 2OYYA 2JH1A 1GO3F 2XI9A 4OJOA 3F2DA 1DRGA 1ED1A 3CRXA 2YB4A 4KX5A 2VJ5A 1PVRA 2KHVA 2PMZC 2HBJA 3NUQA 4QNLA 3CP8A 2K8CB 2JMGA 4FZMA 4U6PA 2Y0SC 2W7OA 1Z19A 1NZBA 3KFUF 2MRLA 2LYBA 2NV3A 1Q3VA 2OH2A 2W03A 2KHQA 1HIWA 2KJ9A 2M0NA 2Y0SF 2KOBA 3PSFA 4ACOA 2ZG6A 4BX9C 1KBUA 5HR6A 1XNSA 1IIPA 4OJLA 2ZIWB 5HR7A 4PL2A 2Q4TA 2YB1A 3M6KA 1CRXA 1ECWA 3E0FA 3LYSA 2K8AA 3SAGA 3D2QA 2N1RA 4OJ6A 2VKQA 3MGVA 3ALRA 3F53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2Q A;  3D2N A;  3D2S A;  2E5S A; 
#chains in the Genus database with same CATH topology
 4J9R A;  4NLB A;  5IIK A;  5J2E A;  3RH6 A;  5ALJ A;  5ALD A;  3QZ8 A;  1ZQV A;  4UB6 U;  3DEE A;  2QAR A;  4QWC A;  4UB4 A;  2KZZ A;  4OCZ A;  3OHA A;  1XU4 A;  5KFS A;  4KN4 A;  9ICB A;  2NO5 A;  3TAN A;  2NO4 A;  3T5J A;  4FBU A;  5G5G A;  2WTF A;  3LDA A;  4BUG A;  4J9N A;  1K5O A;  3AL0 B;  4F93 B;  5AKL A;  4YR2 A;  7ICJ A;  2ZIW A;  1O08 A;  5AKY A;  5KL8 B;  2ASD A;  3V7J A;  4P0Q A;  2BGW A;  1Q8K A;  1WCL A;  3N7S C;  1NKB A;  4RQ2 A;  4UB5 A;  2W8L A;  1MC8 A;  3PW5 A;  1UT8 A;  1KLN A;  4DCC A;  1SKS A;  4C8O A;  1RYR A;  2HBK A;  4DFD A;  2AHO B;  5DG9 A;  4J9S A;  2CRX A;  2G07 A;  3D2S A;  8ICH A;  4JK1 A;  1ZQX A;  4BWM A;  2XIC A;  4Y2X A;  5AM3 A;  2K4E A;  5IIN A;  1S10 A;  2BDP A;  7ICO A;  2UVV A;  4RPY A;  2FPM A;  5BPC A;  2AQ4 A;  1BPD A;  4F4K A;  4NM2 A;  4IC9 A;  1ZQQ A;  3RFA A;  1COK A;  1PK1 A;  4DSI A;  3QU5 A;  4UAS A;  3V7K A;  2OYY A;  2JH1 A;  3TAC B;  4P4P A;  2KMD A;  5KFP A;  1ZQP A;  2D3D A;  5KFE A;  1JXL A;  1UA1 A;  2LYB A;  1KDH A;  2JEG A;  5AI0 A;  1PUZ A;  4GC7 A;  1BNO A;  3V72 A;  4C8L A;  3WK8 A;  1ECW A;  5KFW A;  4F91 B;  4M0A A;  2N1R A;  5J2H A;  8ICU A;  4KLM A;  7ICM A;  1ARO P;  2ASJ A;  3K4G A;  5AKG A;  1O03 A;  3UM9 A;  5C5J A;  4F2R A;  3RH4 A;  3JPQ A;  2BCU A;  2CPR A;  2DWQ A;  9ICF A;  5J2J A;  1BPX A;  2LM4 A;  4DQQ A;  3H0M B;  2JEF A;  2W04 A;  5F9L A;  5CEH A;  1X6J A;  3FC4 A;  3ZDE A;  4UB3 A;  5ALN A;  1N48 A;  1ZQT A;  3OJU A;  1N62 A;  4O3S A;  5AHX A;  2ZUD A;  1ZQO A;  4B9U A;  5AIC A;  1Z4N A;  3Q8K A;  1X40 A;  3NRZ A;  1QH9 A;  4JWN A;  2AH5 A;  5AI6 A;  2WF6 A;  4JV0 A;  3BZC A;  3E58 A;  2OEH A;  4IRC A;  4PZO A;  2EAP A;  4RQN A;  4Z6C A;  1N56 A;  2E8P A;  5KFX A;  3EYZ A;  3EPI A;  4BXO A;  1V97 A;  4XUS A;  1D9D A;  5DQG A;  1TAU A;  2YML A;  4PGQ A;  7ICH A;  5KG6 A;  4RNM A;  4O3P A;  3D6J A;  3IV6 A;  4J9Q A;  1VLB A;  4P4M A;  3RR8 A;  2OCE A;  4KLS A;  1PK3 A;  2JZB A;  1TK8 A;  3HKZ F;  3M7D A;  3KKA C;  2PXI A;  2XY6 A;  9ICC A;  2MSN A;  2JEJ A;  5HHH A;  5AM4 A;  2DPJ A;  3TAR A;  1FFU A;  2NRZ A;  1ZQN A;  3CRX A;  1ED1 A;  2A19 A;  2PMZ C;  1BPZ A;  3OHB A;  1Z00 A;  3C5F A;  4EYI B;  4B9L A;  4YP3 A;  2QB0 A;  4RUA A;  2M0N A;  3PSF A;  2KOB A;  2HHV A;  4NXZ A;  2HHT A;  1X66 A;  3D2Q A;  8ICA A;  3MGV A;  2BQR A;  1MN8 A;  2AJQ A;  5ALS A;  7ICI A;  8ICG A;  4G3I A;  2IHN A;  1VJ5 A;  4RNO A;  5T14 A;  5KFB A;  4NL9 C;  8ICW A;  3UPQ A;  4Y2V A;  1ZJN A;  3V6H A;  2H5X A;  1NK6 A;  4O5K A;  3VC8 A;  2RHF A;  1L5U A;  4R65 A;  1SZH A;  2G5I B;  1MQ3 A;  2XCA A;  4PH5 A;  3RH5 A;  4IR9 A;  4MFA A;  4B9V A;  3TQ1 A;  8ICB A;  2KE7 A;  5DG7 A;  1B4F A;  3I76 A;  1KFD A;  4DFM A;  2P66 A;  2ZTC A;  1IG6 A;  1L7M A;  2PKE A;  4J9K A;  3MR3 A;  1SKW A;  4PHD A;  4DL2 A;  4ECT A;  1X6I A;  3MAB A;  5L1M A;  1NJX A;  3EW9 A;  4NJ8 A;  3KBB A;  5EE1 A;  3C29 A;  2Y1J A;  4MF8 A;  1RQL A;  3PO5 A;  4ECW A;  2BCR A;  4I2A A;  1S5L U;  3RJJ A;  3GZF A;  4OJ5 A;  2WF7 A;  2VA2 A;  5KFU A;  4F3O A;  5DLF A;  3RB0 A;  1U47 A;  2R8J A;  2XCP A;  1XSL A;  2AU0 A;  2F1H A;  4ED7 A;  3PW2 A;  3AUO A;  2WF9 A;  4Z6D A;  1B43 A;  3RJH A;  5HMM A;  3PX4 A;  4UAT A;  4GXI A;  2QKQ A;  4GIB A;  5KT5 A;  2VA8 A;  2A1J A;  2ISO A;  1TAQ A;  5AIA A;  2KV2 A;  5AKI A;  2F3N A;  5DQH A;  2RLT A;  1IV8 A;  1L3S A;  1HJP A;  2F1I A;  2ZIU A;  1KKX A;  9ICU A;  1Z3E B;  4LVS A;  2I5H A;  3WKD A;  5ALH A;  3Q8Q B;  2W9B B;  2IHM A;  4C4S A;  4FS1 A;  4ELV A;  1V9P A;  1A6S A;  4NLG A;  2K4H A;  3C2K A;  2YQE A;  4DSL A;  3HT3 A;  5KFI A;  2YN4 A;  3GV7 B;  4KMU A;  5J0O A;  8ICP A;  4Q8E A;  1MA7 A;  5KFZ A;  1ZQB A;  4NY8 A;  1JUD A;  2E8O A;  8ICQ A;  3QZ7 A;  1B22 A;  1A0P A;  3KHG A;  8ICJ A;  2KEY A;  3BS5 B;  4EEY A;  4NWI A;  2EH9 A;  1TE2 A;  2RP5 A;  2MAX A;  4QZF A;  3JPP A;  1M6Y A;  3H8M A;  3PW0 A;  1JX4 A;  3PVX A;  1TK5 A;  1ZQW A;  3SMV A;  2FMQ A;  2ZXI A;  4KLD A;  3C2L A;  3ICX A;  2E1E A;  1ZQU A;  4F8R A;  1NK4 A;  3KHH A;  4KLJ A;  2QAR B;  2AGQ A;  3ETL A;  4CE6 A;  2KHV A;  3SD7 A;  3PX6 A;  3NUQ A;  3CP8 A;  4U6P A;  2ZUB A;  1QSL A;  3KTQ A;  2WF8 A;  4YCX A;  2MRL A;  2DFL A;  2V4R A;  3MC1 A;  4HYK A;  3OSN A;  3PV8 A;  4XA5 A;  4YD1 A;  4Y2T A;  2MU2 A;  3SZ2 A;  5KG5 A;  5AI5 A;  5HP4 A;  5DB7 A;  5J0T A;  2HSZ A;  3ALR A;  3KD3 A;  4CF3 A;  4UQG A;  3V6K A;  4IR1 A;  2K8B B;  2KK0 A;  5EWF A;  4F4W A;  4F5N A;  2ZIX A;  4P0P A;  2PFN A;  4J9P A;  2A1A A;  2CXY A;  1X9S A;  4UBB A;  2YY6 A;  3F2B A;  5ALV A;  2FJ6 A;  1LB2 B;  4P4O A;  4DOA A;  5F9N A;  2D6F C;  5KFA A;  7ICN A;  4DL7 A;  3ISC A;  2KZM A;  2W55 A;  4IQW A;  1S8O A;  1T94 A;  5EOZ A;  5HHI A;  3NGD A;  5KG1 A;  4M9L A;  1U48 A;  3N97 B;  2PMZ F;  1L8L A;  2WAQ C;  3WKA A;  2DKZ A;  1S97 A;  5KFM A;  3PW4 A;  3M9O B;  2GWS A;  5KFK A;  2DKX A;  3PX0 A;  3R9K A;  2AGP A;  5KT2 A;  2R8K A;  2R8I A;  5AKJ A;  3OTQ A;  3QU4 A;  1ZQH A;  7ICU A;  2EAN A;  4IQU A;  4I2G A;  2ZJ8 A;  4EX7 A;  4ECU A;  1ZJM A;  2LM1 A;  2LMR A;  4UAY A;  7ICL A;  2XC9 A;  4OJO A;  3GIK A;  4YXM A;  3MBY A;  4KX5 A;  1RG6 A;  4DQS A;  3QE9 Y;  3DV9 A;  3WK5 A;  1UCV A;  2NV3 A;  2W03 A;  4F5R A;  2Y0S F;  4CF4 A;  4M47 A;  4DLG A;  3IDW A;  4IL6 U;  2W7P A;  3NVV A;  2G08 A;  4Q44 A;  1N2X A;  4QZE A;  1VDV A;  4TQR A;  2ES6 A;  4YVZ A;  4FBT A;  4DL4 A;  5J2A A;  5AM2 A;  3BS7 A;  4C4T A;  1TV9 A;  1T3N A;  4MFC A;  2F77 X;  1RXW A;  2VIX A;  3KKA A;  3EPG A;  3PML A;  4I2J A;  1S9F A;  3B0Y A;  4YMO A;  3KZI U;  1HUO A;  2H3Q A;  8ICE A;  1UA0 A;  2KP7 A;  3NS1 A;  2B0C A;  3TAD C;  5L1K A;  4US8 A;  3AU2 A;  2R18 A;  4ECX A;  2W3R A;  3PMN A;  3Q8P B;  2ZTE A;  4YD2 A;  3V6J A;  3GFK B;  4AYB F;  1SV0 C;  2ZUC A;  2KSO A;  2LYA A;  4UW9 A;  2LKY A;  5GTI U;  4QWE A;  4R66 A;  2JGA A;  1JMS A;  2NRW A;  2JV3 A;  8ICX A;  1TVA A;  4DSF A;  3BQ2 A;  4DF8 A;  1X42 A;  3T5L A;  4DLE A;  3WK4 A;  4O0I A;  2IOF A;  4EEN A;  1X9W A;  4R8U A;  3SQI A;  5ALX A;  1LKY B;  3QEA Z;  2XY5 A;  5KG4 A;  2HBJ A;  3C5G A;  8ICC A;  2W7O A;  4PPX A;  8ICN A;  1D8L A;  4DL6 A;  3QNM A;  4YR3 A;  4US9 A;  4OJL A;  2W9A A;  4RQ0 A;  3A0B U;  2KTQ A;  4QWA A;  3K75 D;  4QZH A;  2FLL A;  1HUZ A;  2OM6 A;  3BJY A;  2BPC A;  2GO7 A;  3NVY A;  4BWJ A;  1Q46 A;  4RQ6 A;  3MR5 A;  3C1Y A;  1DK3 A;  2EZY A;  4UAU A;  1FEZ A;  2OXO A;  2IA6 A;  1NJW A;  4KN7 A;  3SYZ A;  3QU2 A;  5CR0 A;  1NK9 A;  5KFY A;  2HBM A;  1BPB A;  3FM9 A;  1K1S A;  2BCV A;  5CWR A;  3KZX A;  5ALZ A;  1L6N A;  2DF4 B;  4LZD A;  4YN4 A;  4KLF A;  4DSK A;  5DG8 A;  5J8Y C;  3T5K A;  3WKB A;  4GFJ A;  1Z00 B;  4RZR A;  3OPX A;  4M04 A;  2W8K A;  3ZDD A;  1JI7 A;  4QW9 A;  3MR6 A;  2KVC A;  5EE0 A;  3PZP A;  3RJE A;  2G5H B;  2D8C A;  2EDU A;  1T4G A;  2M9N A;  3H8J A;  3N7R C;  2RRD A;  2HMX A;  3LVW A;  1SXE A;  4JV2 A;  1CI4 A;  1UQV A;  5DKW A;  2KN7 A;  2W9B A;  1ZQS A;  8ICL A;  4ECY A;  5L1J A;  1WWU A;  2ALZ A;  4ECQ A;  2RDJ A;  5KAI U;  2K8C B;  2WFA A;  1Q3V A;  4O5E A;  2C2R A;  2AXT U;  3OSP A;  4ACO A;  2OHF A;  2BPG A;  1KTQ A;  1ZQJ A;  4PGX A;  4IQV A;  5KG7 A;  3RJI A;  3WK6 A;  1N61 A;  4DO9 A;  3OJS A;  2W9C B;  2YX8 A;  4YMM A;  4O3R A;  3SR6 A;  1ZQE A;  1MSW D;  2BKE A;  3PSP A;  2KIV A;  7ICK A;  3RJK A;  3ZDC A;  3GIM A;  3IP4 B;  4OD0 A;  5CB1 A;  4CGZ A;  4ED3 A;  5KFL A;  2RDI A;  4FS2 A;  1SWV A;  1XS9 D;  5CRX A;  1S0V A;  4M6W A;  1ZQI A;  1JN3 A;  1NK8 A;  3H4D A;  2ATL A;  5F3X B;  2WB1 C;  1X9X A;  2KJ8 A;  4F2S A;  4I28 A;  4RQM A;  3THV A;  4C0Z A;  4Y2Y A;  3SAH A;  2J6U A;  4JMU A;  8ICM A;  5ALT A;  2MUT A;  5KFT A;  5L9X A;  3IN5 A;  2BR0 A;  3ORY A;  4J9L A;  1PK1 B;  4Q45 A;  1F5S A;  2F2A B;  2GH1 A;  2W9M A;  1KRP A;  3I28 A;  2CN1 A;  1YT3 A;  5KT7 A;  1ZRN A;  3Q8L A;  2KKP A;  2VAN A;  4XRH A;  4I2I A;  3RRG A;  1P7D A;  2XID A;  5DQI A;  2ZIV A;  4O3O A;  5J0S A;  4RUC A;  9ICS A;  3C21 A;  4Y2U A;  4JUZ A;  4BXO B;  4M9N A;  2WF5 A;  4PHE A;  5J0U A;  4B6J A;  3MDC A;  4EBC A;  1PVR A;  1SKR A;  2RQ5 A;  5J2B A;  4KLI A;  3PR4 A;  4RQ7 A;  5AI9 A;  2PFO A;  3GV5 B;  5FP0 A;  2ZIW B;  5EWG A;  3ISB A;  1JXE A;  1LVH A;  2K8A A;  2QB0 B;  4DFK A;  1QSY A;  9ICX A;  4QZG A;  8ICS A;  2YTU A;  3M1Y A;  4DWI A;  3GQC A;  4EBD A;  1RYS A;  5J2G A;  4F92 B;  2LYH A;  2HOI A;  3SV4 A;  5BOL A;  3H0R B;  4UAZ A;  9ICE A;  2ZXH A;  5CP2 A;  3CNH A;  5KT4 A;  1HEK A;  5J2K A;  2WB1 F;  3RB3 A;  4RQ4 A;  2H3F A;  4ELT A;  2W54 A;  2KFN A;  1ZD3 A;  4QZD A;  2Y1I A;  3HIL A;  7ICG A;  1K1Q A;  3LVV A;  1MQ2 A;  2KIW A;  4P0Q B;  3NVZ A;  2F8L A;  3I1Y A;  1SZP A;  2G06 A;  5TIS U;  2F76 X;  1SV0 A;  2BDU A;  5DBA A;  3G6Y A;  3QUQ A;  2A3V A;  3PST A;  4LJX A;  2PI4 A;  4AYB C;  1D8B A;  3HPO A;  4GC6 A;  3WKC A;  9ICA A;  2I9G A;  1C20 A;  4C4R A;  3ONN A;  2YMP A;  7ICT A;  1TAM A;  2DUY A;  5AKZ A;  5CA7 A;  4RNN A;  3AQF A;  5C0Y A;  8ICR A;  1ZXI A;  2QLT A;  4TUS A;  1KQQ A;  1RXV A;  2PFP A;  3F5E A;  4F50 A;  5IIO A;  5ALW A;  2ASL A;  3EZ5 A;  3Q8M A;  3RB4 A;  8ICT A;  4X5V A;  4M9G A;  5AI8 A;  1Z19 A;  2AGO A;  9ICJ A;  2JR5 A;  4KLL A;  3AU6 A;  2OH2 A;  1ZD4 A;  4R8U B;  2KJ9 A;  4BX9 C;  3M8S A;  2EAM A;  1ZQF A;  4KLE A;  5KFF A;  2W43 A;  1QQ6 A;  5KFO A;  3V7L A;  9ICL A;  3E0F A;  3EWA A;  1DGS A;  4GXJ A;  2FLN A;  5DB6 A;  1C7Y A;  8ICV A;  3U26 A;  1TKD A;  4NLZ A;  4OO1 J;  2KSO B;  1Q3U A;  3Q8S B;  2E5S A;  5TZV A;  4LZG A;  4QW8 A;  4QZA A;  4I2C A;  4FZN A;  1RQN A;  2FMS A;  3M8R A;  3ZD9 A;  2HHW A;  4BGD A;  3HW8 A;  3F2C A;  2O6K A;  4TUP A;  2ESE A;  1V38 A;  4ZOH C;  4QIW C;  3RR7 A;  1OXJ A;  4UB2 A;  1LKY A;  1NOM A;  1FO4 A;  2K4P A;  5KTQ A;  3A0H U;  1YZ6 A;  5J2F A;  4F5O A;  4I27 A;  4ED1 A;  2YMM A;  3BQT A;  5JU5 A;  3PR5 B;  2HDO A;  7ICF A;  4KX3 A;  3JPT A;  1Z1B A;  4DQI A;  2GOL A;  2KZ3 A;  5AKK A;  5KFH A;  3GU3 A;  5D4B A;  2LI6 A;  7ICS A;  5KFN A;  2W3S A;  2MA1 A;  4ICA A;  2WHE A;  1KL9 A;  4KLQ A;  5J2I A;  3L5K A;  3E2E A;  1RDF A;  3ED5 A;  5ALF A;  2KKV A;  4RT3 A;  5KG2 A;  1A77 A;  4MEX A;  4NL9 A;  2HBL A;  4EEL A;  4FO6 A;  1SIJ A;  4YFK A;  9ICT A;  4Q8F A;  4DOB A;  1DXS A;  2KFZ A;  2P35 A;  3MFI A;  2HHQ A;  3TAD A;  4F5Q A;  3KFU F;  2Y0S C;  2F8K A;  4DL3 A;  2E3T A;  1RYU A;  2ZG6 A;  2JEI A;  5EWE A;  1KBU A;  4QZI A;  4E0D A;  9ICV A;  4ECZ A;  4M9H A;  5AIB A;  2Q4T A;  3M6K A;  4MF2 A;  3NVW A;  1COO A;  1QTM A;  2R8H A;  4Q43 A;  5KFG A;  4PHA A;  3CYM A;  3GIL A;  1QSS A;  1KFS A;  4MFF A;  4KIT B;  1ZQM A;  3QU9 A;  5KFJ A;  3M9M B;  1U49 A;  4ED2 A;  2IBK A;  3BQ1 A;  5D49 A;  1XSP A;  1XO0 A;  3IM1 A;  3ZI4 A;  3JPS A;  5KT3 A;  5JUM A;  3C28 A;  1L7O A;  1OW5 A;  3HWT A;  3TAP A;  3JPR A;  2HCF A;  2EZZ A;  2JHD A;  5ALU A;  8ICI A;  4CCH A;  2Q0Z X;  2BPF A;  3RJG A;  4P0P B;  3LK9 A;  7ICQ A;  3TFS A;  5KFD A;  4DF4 A;  2FI1 A;  1ZQA A;  3BQ0 A;  2DBY A;  2MUT B;  1YZ7 A;  1BPY A;  5KL1 B;  5AKE A;  4QJF B;  5J0W A;  1UPH A;  1S77 D;  4I2H A;  1L3U A;  1U45 A;  2FE9 A;  1ZD2 P;  5KG3 A;  4A8E A;  1NK5 A;  2OWO A;  8ICK A;  2LHT A;  1BGX T;  4CRX A;  4PL1 A;  3N28 A;  1KW4 A;  1ZQG A;  2EZX A;  4Y2R A;  3B9J A;  3AM9 A;  3BZK A;  2FLP A;  1DK2 A;  7ICP A;  3J81 j;  3UXP A;  4QZ8 A;  4ED0 A;  3PNC A;  2XGP A;  1NZB A;  5H2F U;  2PI5 A;  3KOO A;  3RBD A;  1BNP A;  2HHX A;  2ZJ5 A;  4UB8 U;  4B9S A;  4J9O A;  4PL2 A;  1T7P A;  2YB1 A;  3OGU A;  5ALG A;  3RTV A;  3H4B A;  2IOF K;  4F5P A;  4IS7 A;  3F53 A;  3QYP A;  4G9B A;  4KLO A;  2P6U A;  3T3F A;  2KNJ A;  4R64 A;  2XY7 A;  2V9W A;  4RU9 A;  4EX6 A;  2BZF A;  3TI0 A;  3UMB A;  4C7Y A;  4PGY A;  2Z7J A;  4Y2J A;  3M9N B;  4DOC A;  4ECS A;  2Y9U A;  3H8S A;  4O3M A;  5KFQ A;  4CDG A;  3ZDA A;  4QWB A;  4C8N A;  1WWV A;  5ALP A;  4JWM A;  5ALE A;  4UB1 A;  2C28 A;  8ICZ A;  5IIL A;  2H3Z A;  3KHL A;  1N63 A;  4YMN A;  5BOM A;  1QLN A;  4ELU A;  4RQ5 A;  4GLX A;  1ZQC A;  4IRK A;  3CW2 C;  4F4Z A;  1J2N A;  5ALQ A;  3RJF A;  5GTH U;  3JPO A;  9ICP A;  2HI0 A;  4O3N A;  5CJ7 A;  2JZB B;  3H40 A;  1UT5 A;  4Y2Q A;  2V4Q A;  1RM6 C;  3AN1 A;  5EE3 A;  4BJQ A;  1NJZ A;  1L7P A;  4GXK A;  3UXO A;  3MGI A;  2JRZ A;  4P2H A;  2B21 A;  5J2D A;  1ZRM A;  2G0A A;  2JXJ A;  4QWD A;  5DBB A;  3T5H A;  1XWL A;  1SB3 C;  3ETR A;  4NLK A;  2K60 A;  1LV5 A;  3F5A A;  5B66 U;  4ZH4 A;  5JTI A;  4F71 A;  4Y2P A;  3HP6 A;  4EBE A;  1PVP A;  3HKZ C;  3GV8 B;  1D9F A;  4NM1 A;  9ICK A;  4JV1 A;  2XI9 A;  4QZ9 A;  3G6V A;  1KSP A;  5DB8 A;  5AK5 A;  3NTU A;  2KHQ A;  3PO4 A;  5ALR A;  2UVW A;  9ICR A;  3ISD A;  5ALI A;  5HR6 A;  1Y88 A;  4J9M A;  1IIP A;  2E8M A;  1KEJ A;  2HVI A;  1CRX A;  4IRD A;  1BPE A;  4OJ6 A;  5AM1 A;  4I2D A;  1NI3 A;  3BQ7 A;  2KJ5 A;  2W11 A;  4C80 A;  3GIJ A;  5AM5 A;  3SAF A;  5ALY A;  4EEK A;  5KT6 A;  5J0R A;  3K1Z A;  1NK0 A;  1ZQR A;  1ZD5 A;  5DGA A;  4Z6F A;  5AKX A;  4AP9 A;  4DEZ A;  1ZQ1 C;  1WG8 A;  3H8W A;  1QQ7 A;  4ED6 A;  2ZJA A;  4KTQ A;  2HVH A;  3RBE A;  4TUR A;  2UVR A;  2ODG A;  2C2D A;  1PVQ A;  4RPX A;  3PY8 A;  2IMW P;  3K1R B;  5DBC A;  4R63 A;  1JIH A;  3HRD D;  9ICI A;  5G5H A;  3FYH A;  1U4B A;  1B0X A;  3QX7 A;  4FE3 A;  2YMQ A;  3SI8 A;  3C23 A;  1BVS A;  2DQN B;  4RT2 A;  9ICH A;  4PZN A;  2XGQ A;  3JPN A;  2K4I A;  2UVU A;  2HHU A;  2B6G A;  4I2F A;  3UQ0 A;  2NRT A;  3NRW A;  5ALK A;  4UBC A;  2J6S A;  3UMG A;  2ISP A;  3S6J A;  3B0X A;  4NLC A;  2HW3 A;  3QUT A;  2L5Y A;  4YG2 A;  1GO3 F;  2BCQ A;  5J0Q A;  1KFT A;  4QNL A;  1ZQD A;  3AMZ A;  2JMG A;  1FIQ A;  1SL2 A;  2VA3 A;  3L4P A;  3EUB 2;  1ZET A;  5CHG A;  4DQR A;  4F72 A;  1H38 A;  2FPK A;  4O9M A;  4KLH A;  2NYV A;  1AQ6 A;  1KN5 A;  3LYS A;  1SXD A;  4QZB A;  3GDX A;  4NV0 A;  2K89 A;  2FMP A;  1SL1 A;  3KHR A;  2IOH A;  4CNQ A;  2BCS A;  3TAQ A;  4YR0 A;  5KFV A;  1S0M A;  4I2B A;  3T79 A;  5III A;  4B9T A;  3NAS A;  1OUQ A;  4I29 A;  3IG8 A;  1CUK A;  5AM0 A;  4Y2S A;  3Q8R B;  5E79 U;  9ICN A;  3MGH A;  3QUC A;  5DB9 A;  2LBO A;  4Z6E A;  1ZQY A;  5DGB A;  3DDH A;  8ICY A;  1V85 A;  5A0L A;  5AKH A;  1SL0 A;  3BS5 A;  1JRP A;  3GII A;  2BHN A;  4M2Y A;  3HJE A;  1L8O A;  5HML A;  2J6T A;  1NNL A;  2ZTD A;  1N5X A;  1WCN A;  2NRX A;  1FFV A;  2EQY A;  2C2E A;  4DL5 A;  3PSI A;  4I2E A;  4USA A;  1QQ5 A;  4DFJ A;  1S0O A;  1SGG A;  3M6Z A;  4KMO B;  3RAQ A;  2ZIX B;  3AQE A;  1WUD A;  5K4L A;  3L3F X;  2E1F A;  4M9J A;  3TFR A;  3IHQ B;  3HX0 A;  4RQ1 A;  1RPL A;  5DDM A;  1DRG A;  3F2D A;  3WK7 A;  1TK0 A;  2YB4 A;  2VJ5 A;  5IIM A;  3AEV A;  4C7Z A;  4ED8 A;  4FZM A;  3FDS A;  4UAV A;  4DFP A;  4IQT A;  2LPE A;  1F0M A;  4TUQ A;  4XQ8 A;  4KLG A;  1L7N A;  1A76 A;  3IRU A;  2P6R A;  3MR2 A;  2QB1 A;  9ICQ A;  2EAO A;  4UAW A;  4ECV A;  2F1J A;  3ZDB A;  3LWM A;  2W9C A;  3WU2 U;  1CEZ A;  2H3V A;  4JB3 A;  4DQP A;  1N60 A;  4EZ6 A;  1ZQL A;  4C8K A;  3QEB Z;  4QZC A;  1ZOL A;  2PFQ A;  5ALL A;  5ALM A;  4PHP A;  9ICW A;  1F44 A;  9ICG A;  3VCB A;  2G09 A;  4DS5 A;  1S76 D;  3RB6 A;  5ALO A;  4F4X A;  1IXR A;  4EYH B;  2WAQ F;  4HAI A;  2ZIU B;  1IM4 A;  7ICE A;  1L3T A;  1DOQ A;  4PJ0 U;  2HOQ A;  1Z1V A;  3PW7 A;  1WYG A;  4YQW A;  2FDR A;  5KFC A;  2XVT A;  2VJ4 A;  4K4I A;  3MFH A;  3BDP A;  1NK7 A;  3QU7 A;  3LWL A;  4DS4 A;  5JRT A;  2HOF A;  2KVS A;  1ZQZ A;  2JH7 A;  1XSN A;  1S0N A;  1PZN A;  2DGZ A;  2KIC A;  3G6X A;  2C22 A;  5KFR A;  3UXN A;  4U7C A;  1U9L A;  4KLU A;  4YXJ A;  4UAR A;  5J8Y A;  9ICM A;  3SEN A;  4RQ3 A;  5AI4 A;  4KLT A;  1NJY A;  1L3V A;  4O3Q A;  1T8E A;  9ICO A;  1J97 A;  3SV3 A;  2XO7 A;  2A1J B;  1ZYQ A;  4B9M A;  5HR7 A;  1NZP A;  2GLE A;  1ZQK A;  2KG5 A;  5AK6 A;  2H3I A;  3UMC A;  1SV4 A;  1D8Y A;  1EXN A;  2AQ0 A;  3QUB A;  3RRH A;  3UQ2 A;  5L1L A;  2BQ3 A;  3C1Z A;  5HNK A;  2DPI A;  4BDP A;  8ICO A;  3RF9 A;  1QCK A;  1JRO A;  1UHU A;  4ECR A;  1NKE A;  3C2M A;  3H0L B;  1DGJ A;  4OJP A;  4M6W B;  8ICF A;  4CF5 A;  5KAF U;  5J0X A;  1RZT A;  2F44 A;  3FAH A;  1J2M A;  2KD1 A;  3SEI A;  4EZ9 A;  1N5W A;  4K4G A;  4QIW F;  3N4M B;  3TKA A;  4WJ3 B;  3ZD8 A;  4RPZ A;  4DSE A;  3IG5 A;  5KG0 A;  5DDY A;  1JAL A;  5DLG A;  1URJ A;  3O0F A;  5KNI A;  2I1Q A;  5J2C A;  5B5E U;  3QXG A;  4MEY A;  4FFD A;  1Z4O A;  3H7I A;  1X2I A;  5AK3 A;  4C8M A;  4O5C A;  2HHS A;  4MHV A;  3MDA A;  3N7P D;  1X9M A;  7ICR A;  2ZIV B;  3WKE A;  4TQS A;  2R8G A;  1XO1 A;  3D2N A;  5L1I A;  3WK9 A;  2E8N A;  2I6X A;  2DL0 A;  4FZL A;  1NKC A;  4DSJ A;  4NLN A;  7ICV A;  5J0P A;  2BQU A;  1T3Q A;  1SWW A;  5IIJ A;  5J29 A;  4F4Y A;  1XC9 A;  1HIW A;  2Y9T A;  5AK4 A;  1XNS A;  3RAX A;  2NRV A;  5D46 A;  2FPL A;  4J03 A;  4K4H A;  4RQ8 A;  5EE9 A;  3SAG A;  2VKQ A;  5J0Y A;  4B9N A;  1TFR A; 
#chains in the Genus database with same CATH homology
 2KV2 A;  2KJ5 A;  4NLB A;  2YX8 A;  2H3I A;  2K89 A;  4NV0 A;  2KNJ A;  2OM6 A;  2ZIU A;  3CYM A;  2W7P A;  4OO1 J;  2G08 A;  2K8B B;  1Q3U A;  3PSP A;  2HOI A;  3DEE A;  3SAF A;  2CPR A;  2E5S A;  3T79 A;  3H0M B;  1OUQ A;  2Z7J A;  5T14 A;  3K1Z A;  3IP4 B;  2W04 A;  3H0R B;  2ZXH A;  4CGZ A;  2OXO A;  2H3V A;  4FZN A;  3IG8 A;  1A6S A;  3RF9 A;  2F77 X;  2K4H A;  4O3M A;  2ZIX A;  2VIX A;  4P0P A;  1HEK A;  4CDG A;  5CRX A;  1XO0 A;  2WB1 F;  4BUG A;  2HBM A;  3H0L B;  2LBO A;  1ZQ1 C;  2H3F A;  3VC8 A;  2RHF A;  2H3Q A;  4OJP A;  3F2B A;  3C28 A;  3AL0 B;  3F2C A;  2WB1 C;  2KJ8 A;  3KZX A;  1L6N A;  2ZIW A;  2DF4 B;  4C0Z A;  1SZH A;  2G5I B;  2JHD A;  4JMU A;  3SAH A;  5A0L A;  2D6F C;  2H3Z A;  3LVV A;  4QIW C;  1MA7 A;  2KIW A;  1F44 A;  4P0Q B;  5KL8 B;  1PVQ A;  2F8L A;  3IN5 A;  2R18 A;  3VCB A;  2KD1 A;  2G09 A;  4GFJ A;  2G06 A;  1T94 A;  1A0P A;  2F76 X;  4QIW F;  4P0P B;  4P0Q A;  2KEY A;  3OPX A;  4WJ3 B;  2BDU A;  2WAQ F;  3N7S C;  2F2A B;  2GH1 A;  4AYB F;  3IG5 A;  2LYA A;  4NWI A;  2ZIU B;  2A3V A;  2CN1 A;  1YT3 A;  2RP5 A;  3PST A;  2PMZ F;  2WAQ C;  2KKP A;  2HOQ A;  4AYB C;  4FE3 A;  2KVC A;  1URJ A;  3O0F A;  4BJQ A;  2LKY A;  1D8B A;  4KX3 A;  2HBK A;  3PZP A;  5KL1 B;  1P7D A;  3PSI A;  2XID A;  2DQN B;  2G5H B;  2VJ4 A;  2XVT A;  4QJF B;  1Z1B A;  2GOL A;  2JGA A;  2G07 A;  3SMV A;  1UPH A;  2CRX A;  3D2S A;  2ZIV A;  3GU3 A;  3ONN A;  1TAM A;  2K4I A;  3M6Z A;  3N7R C;  4KMO B;  2RRD A;  2G0A A;  2HMX A;  2XIC A;  3LVW A;  3N7P D;  4A8E A;  2ZXI A;  2HOF A;  2ZIX B;  2K4E A;  2ZIV B;  2MA1 A;  3AQE A;  1WUD A;  3ICX A;  2E1E A;  2LHT A;  4ICA A;  2JH7 A;  3AQF A;  4CRX A;  3D2N A;  3NRW A;  3HKZ F;  3L3F X;  3M7D A;  2E1F A;  4PL1 A;  3C29 A;  5C0Y A;  2DGZ A;  2KIC A;  3F5A A;  2KKV A;  3F5E A;  4IC9 A;  3RFA A;  4U7C A;  1PVP A;  4FZL A;  3SQI A;  3GZF A;  4NLC A;  3HKZ C;  4OJ5 A;  2HBL A;  2OYY A;  2JH1 A;  1GO3 F;  2XI9 A;  4OJO A;  3F2D A;  1DRG A;  1ED1 A;  3CRX A;  2YB4 A;  4KX5 A;  2VJ5 A;  1PVR A;  2KHV A;  2PMZ C;  2HBJ A;  3NUQ A;  4QNL A;  3CP8 A;  2K8C B;  2JMG A;  4FZM A;  4U6P A;  2Y0S C;  2W7O A;  1Z19 A;  1NZB A;  3KFU F;  2MRL A;  2LYB A;  2NV3 A;  1Q3V A;  2OH2 A;  2W03 A;  2KHQ A;  1HIW A;  2KJ9 A;  2M0N A;  2Y0S F;  2KOB A;  3PSF A;  4ACO A;  2ZG6 A;  4BX9 C;  1KBU A;  5HR6 A;  1XNS A;  1IIP A;  4OJL A;  2ZIW B;  5HR7 A;  4PL2 A;  2Q4T A;  2YB1 A;  3M6K A;  1CRX A;  1ECW A;  3E0F A;  3LYS A;  2K8A A;  3SAG A;  3D2Q A;  2N1R A;  4OJ6 A;  2VKQ A;  3MGV A;  3ALR A;  3F53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...