3D2SA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain in complex with cgcugu rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
TDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein/rna
molecule keywords 5'-R(*CP*GP*CP*UP*GP*U)-3'
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2sA00
3D2QA 3D2NA 3D2SA 2E5SA
chains in the Genus database with same CATH superfamily
2GLEA 2ZJ5A 4DQSA 1WWUA 3DV9A 4IQUA 4F4XA 3BJYA 2W04A 5ALRA 3KHRA 7ICLA 3MGHA 3TFRA 2DKXA 3QNMA 2P35A 2HBJA 3MBYA 3MDAA 5J2HA 5KFBA 3PSIA 2KVSA 3ICXA 4ED8A 3HWTA 1ZQJA 2JR5A 4QZCA 2R18A 3C2KA 5EWGA 2ES6A 3RR7A 5DDYA 2N1RA 1U9LA 2F76X 8ICRA 9ICUA 2BPFA 2ZIVB 4KLLA 3ED5A 2FLNA 3C1ZA 4DLEA 5EOZA 1DRGA 5KFKA 4NY8A 3N7PD 3RB3A 5AM5A 2FLPA 3QU9A 5J2FA 3GV5B 3Q8SB 2DWQA 3NVZA 3RR8A 4BX9C 2ZIUB 2P6RA 4JWMA 1B22A 3EZ5A 4DFDA 2KZZA 3RFAA 2BQ3A 2H3QA 3WKEA 4OJLA 1XSLA 3EW9A 1V97A 4KTQA 3NVVA 2RHFA 2V9WA 4DSLA 2LYHA 5EWFA 7ICTA 3JPRA 5DBCA 3SZ2A 1NK5A 5J0TA 1X9SA 1RYUA 4DWIA 1NOMA 3KHLA 5DQHA 2W9MA 4GXKA 4BDPA 4RT3A 3SYZA 5EE1A 3AL0B 1N61A 1TK5A 1ZQUA 2BCQA 3G6XA 1NJYA 4Y2UA 4DQRA 3U26A 8ICZA 4BXOA 5KFUA 2ZTCA 1ZD4A 2KFNA 4OJ6A 3GV8B 1L7NA 1AROP 5B5EU 4DF8A 1SGGA 2ATLA 5GTIU 5KL8B 4HAIA 2DQNB 1URJA 1T94A 2W03A 5ALMA 5D4BA 4KLHA 2W3RA 2NYVA 1XS9D 4RQ8A 4PGXA 4TUSA 4EBDA 3A0BU 7ICIA 2M0NA 4F91B 3GIKA 2R8GA 4QZ9A 5J2DA 3QEBZ 3RBEA 5EE0A 3BQ2A 2C2DA 1T8EA 3ISDA 2AQ4A 2HHTA 2PI5A 4B9UA 7ICSA 1QQ5A 1PK3A 1ZJNA 4ECQA 2ZJAA 3QZ7A 1K1SA 4M9HA 2K89A 1S77D 4TQSA 1ZQYA 3MR2A 4ZH4A 5ALNA 5CR0A 2VJ4A 1H38A 3KZXA 3Q8MA 1X42A 3K75D 5KFGA 4ECUA 2EZYA 9ICQA 3NVYA 7ICRA 2R8HA 2I6XA 1JXLA 5AK4A 5AK3A 3MR3A 4NLCA 1RQNA 2JEFA 5AM1A 4UB5A 2HHQA 3SQIA 3AU2A 2FMQA 1NKCA 2MUTA 3B0YA 2PFPA 3UPQA 2J6TA 1ZQNA 4O3SA 5CP2A 8ICWA 4NL9A 3WK6A 3GQCA 1KLNA 2HHVA 3LVWA 2UVWA 4Y2RA 3UXOA 4MEYA 4IRCA 3PW5A 3C5FA 1SKSA 4BUGA 2H3ZA 5J8YC 1QCKA 3C23A 3PV8A 1L7MA 5KAIU 1O03A 3OGUA 4F5NA 4O5KA 2WF9A 4F5OA 4OJPA 8ICMA 4PHEA 4UQGA 3ZD9A 1SXEA 2OYYA 1RXVA 4I2EA 5J0SA 1JIHA 2J6UA 3TACB 3B0XA 1KEJA 3F53A 4TUQA 2K4EA 2D8CA 3UXNA 3H4DA 4QZIA 7ICUA 5KFFA 1QQ6A 3RJHA 3M8RA 3MFHA 2HCFA 1KN5A 2HVHA 1ZQHA 4Y2JA 1YZ7A 2KIVA 1D8LA 2IOHA 5AI5A 4BXOB 5KT3A 3FAHA 2BHNA 2HHSA 1ECWA 8ICHA 2DGZA 2KD1A 1PZNA 2QKQA 4P4OA 2XGPA 3BQ1A 5KFOA 2ZG6A 1BPBA 3PW2A 4FO6A 3HKZC 1A76A 4Y2TA 4FBTA 3PX0A 3RB4A 8ICQA 4J03A 2KHVA 1D8BA 4Z6EA 4RQ1A 1Z3EB 2G5HB 5E79U 5KG0A 5ALVA 4JWNA 1XNSA 5L1JA 5AK5A 2KP7A 4MFAA 8ICTA 2KZ3A 4O5EA 4Y2XA 5AIAA 2KEYA 1WWVA 3I1YA 4DFMA 3RF9A 2HDOA 3FDSA 4KX5A 2Y1JA 1IXRA 4PH5A 4PZNA 4DL2A 1L6NA 2W7OA 2ZIUA 4UB2A 5KFSA 1XU4A 4Q44A 4RUCA 5ALPA 2CPRA 4C7ZA 2JH1A 5KT4A 1HIWA 5CB1A 2A1JB 3IV6A 4K4HA 4DL4A 4O3OA 1KBUA 2FPMA 2XCPA 2OEHA 4Y2VA 9ICLA 3GIJA 4IS7A 3HPOA 4F2RA 2ZUDA 1D9FA 2E8OA 5IILA 3RJKA 1GO3F 3SV3A 5C5JA 3M6ZA 1UQVA 1N56A 5AM0A 8ICIA 2PMZC 1HUZA 3UMBA 5D49A 2W7PA 1HUOA 4C0ZA 2F44A 2KE7A 3MDCA 2W3SA 4C80A 3TANA 3N28A 1UT8A 2EDUA 4DOCA 4RQMA 4RQ2A 2NRXA 1X9XA 4QIWF 4OJ5A 4FZNA 4J9PA 8ICVA 2BQRA 9ICSA 4AYBF 5BOMA 5AKGA 4ZOHC 2HSZA 2AGPA 5ALHA 1ZYQA 2K4PA 1SL1A 2EZZA 4G9BA 3LYSA 3VC8A 1IV8A 2XVTA 9ICFA 3N97B 8ICAA 5DG7A 2ODGA 2W9BB 3WKAA 3SAFA 1WCNA 2KMDA 3EWAA 5KT6A 5EWEA 4F4YA 1NK8A 2KZMA 2ZIWB 4J9KA 4XA5A 4TUPA 1TAUA 1ZJMA 2DKZA 4KLIA 4U7CA 1DK3A 7ICGA 5KG4A 2YMLA 4GXJA 4ECYA 5ALZA 4IC9A 1X40A 3R9KA 2NV3A 2NRZA 1XO1A 1A0PA 4C4RA 2EAMA 2ASJA 2W55A 2ZIVA 5ALYA 3CYMA 2HHWA 1SIJA 2W11A 5AKLA 3WK8A 4ED3A 1QSLA 3JPSA 4QW9A 1B0XA 2DBYA 4ED1A 2JEJA 2F8KA 3D6JA 3HILA 3BQ7A 3RJJA 1S10A 4M9JA 4MEXA 2V4RA 4F50A 4DSEA 5J2BA 4UB3A 4EEYA 2XICA 3UMGA 1S0VA 2ASLA 3VCBA 4QZAA 2JH7A 1ZQTA 5KFEA 3K1RB 3TADC 4PZOA 3WKCA 1ZQCA 3G6VA 4FZMA 1LB2B 4UASA 3WU2U 2EAPA 1RDFA 3GV7B 5AIBA 4O3PA 1PVRA 8ICLA 4NLGA 4Z6FA 4ICAA 3LWLA 2LMRA 3EYZA 2GOLA 1ZQDA 3SEIA 4JV0A 3JPOA 4IR1A 5KFPA 3F5EA 5J0YA 3WK9A 1FIQA 3FYHA 4ECTA 3QX7A 5ALSA 4RQ5A 5DB6A 1F5SA 1X2IA 4F71A 2XGQA 3PX4A 2QB0A 4IRDA 3BS5B 3QZ8A 4F5QA 2HBLA 2AJQA 1KFSA 4DOAA 4DEZA 2QARA 4PL2A 2ISOA 5J0UA 5IIIA 4UBCA 5FP0A 1X9WA 1PK1B 2KIWA 2MAXA 3IG8A 1U45A 3Q8LA 5AK6A 4XUSA 3TADA 2FMPA 3T5KA 4JK1A 4R66A 4BGDA 5F3XB 4IQVA 4IL6U 3H8MA 5JTIA 5KG1A 4Z6CA 1RYRA 1TE2A 1ZQAA 3MR6A 4FE3A 2K60A 1ZD3A 3UQ2A 3UXPA 4OO1J 2E3TA 9ICIA 1SZHA 2EH9A 4J9SA 2HBMA 1C7YA 2Y1IA 3H8JA 4EZ9A 4DSIA 3HJEA 4YVZA 1OXJA 4E0DA 3H4BA 1NKEA 3SD7A 2LI6A 2CN1A 9ICGA 3LVVA 1XC9A 2KSOB 1ZRNA 2LPEA 4QJFB 1TFRA 4UW9A 1ZD5A 9ICRA 2KHQA 4JMUA 4AP9A 8ICCA 4J9OA 3PW4A 4ED0A 1SWVA 1TK0A 4KMOB 3KOOA 5KFQA 4MFCA 4C8OA 1T7PA 2HVIA 1SV4A 4UAYA 5DGBA 1RXWA 5AKJA 5KFYA 1SKWA 7ICQA 2D3DA 2WTFA 3C28A 1S0OA 2KJ8A 4P0PB 1KW4A 4NLBA 2Y0SC 5CHGA 7ICVA 4EX6A 3LK9A 3EPGA 5KT5A 5DG9A 3AEVA 1J2NA 1K1QA 1CRXA 4BWMA 2NRTA 3SAHA 1Q3VA 2VJ5A 2PI4A 1PUZA 5KT2A 3PR4A 5ALLA 1ZQPA 9ICNA 4YR2A 2XY7A 3ZI4A 1X6IA 5ALUA 3UM9A 5DLFA 5J0QA 5ALOA 3PMNA 1ZQBA 2BZFA 2LM1A 2IBKA 2OM6A 1N60A 2BPGA 5IIMA 4J9NA 4CDGA 4F92B 4CF4A 2HOQA 4ELUA 4UB8U 4PHPA 1X6JA 3C2LA 1TK8A 3S6JA 1NJZA 5J0OA 1Z19A 5C0YA 9ICWA 3M9NB 3AM9A 2F3NA 3CW2C 4QZFA 4YP3A 2PXIA 2VA3A 1RM6C 2F1HA 2JRZA 2W9AA 2V4QA 8ICBA 4RPZA 4RQ4A 4OJOA 1ZETA 2PFQA 3HRDD 5J2GA 1L8OA 1L3TA 4I2HA 3DDHA 2ZXHA 4UAWA 2BCRA 2JHDA 2LHTA 5F9LA 9ICEA 5KAFU 3RAXA 3AMZA 5AI0A 3JPNA 2C28A 3T79A 1KRPA 4O5CA 3ALRA 2AGOA 3IG5A 3MR5A 1UA1A 4I2DA 1SKRA 1M6YA 5KFMA 7ICJA 1FFVA 9ICJA 4NLNA 4C8KA 1Q8KA 4GLXA 2G09A 5CRXA 4YQWA 4F4ZA 2KKPA 4I27A 3L3FX 4PHAA 3IM1A 5KFTA 5DBBA 5CA7A 1N5WA 2FPLA 2W8KA 5AI9A 1BPZA 4J9RA 2MA1A 4KLUA 1B43A 5J0PA 4M04A 3F2DA 5J2CA 1NK7A 1VJ5A 1SWWA 2YN4A 9ICMA 4DFPA 3JPTA 3RH5A 2YB4A 4G3IA 5J2IA 4F3OA 3CP8A 3TFSA 5KL1B 3AN1A 2E8NA 2G06A 1DGJA 3TKAA 3IHQB 4QWDA 9ICAA 1JUDA 3RRHA 4I2FA 4F5PA 4ECXA 4RQ0A 2KJ5A 1ZQFA 5K4LA 1NZBA 4PL1A 3QUCA 3MABA 2HW3A 3QEAZ 2ESEA 1OUQA 1EXNA 2WF8A 3KZIU 1Q3UA 1F44A 4DS5A 3A0HU 1RYSA 4I2JA 5KFHA 1OW5A 1KKXA 3M9MB 3F2BA 3AUOA 1UHUA 1A77A 4I28A 2YTUA 1TAQA 2YQEA 2ZUBA 3ISBA 2KVCA 3B9JA 1XWLA 4RPYA 4YMOA 4DL7A 4O9MA 2G5IB 1HEKA 4FFDA 2ZIWA 3V7KA 5J2EA 4B9SA 4QIWC 1DXSA 2C22A 3WKBA 2IA6A 4Q8EA 4ECVA 3NTUA 2W8LA 2JEGA 4JB3A 3Q8KA 5KG5A 2MSNA 3WK5A 3ZDCA 4LVSA 4O3RA 5BOLA 2BQUA 2A3VA 5ALEA 1NNLA 4LZDA 2PMZF 2QLTA 5CEHA 3WKDA 4M9NA 3BZKA 2KFZA 5AKHA 1SXDA 4HYKA 3GIIA 3KFUF 2LYAA 3KD3A 3KKAC 1Q46A 1ZOLA 4C8MA 5B66U 3SMVA 3THVA 1NK9A 4P4MA 1N48A 3RAQA 2BCVA 5KFRA 2DUYA 1Z00B 2XC9A 3HT3A 3RJIA 2RLTA 3ZDEA 4GXIA 5G5GA 4OCZA 3BQ0A 1DGSA 2JZBA 9ICOA 1ZXIA 4MF2A 5JU5A 2XY5A 4B6JA 3E2EA 3N7SC 5D46A 2QB1A 5J29A 1WG8A 3H0MB 2C2RA 5KFIA 4YXJA 4O3QA 4IRKA 4IQWA 3WK4A 4MFFA 2PFNA 5DGAA 2G08A 4I2GA 3ORYA 1N5XA 2E8PA 3L5KA 8ICNA 1MSWD 3HW8A 1RZTA 1X66A 2R8KA 4B9TA 4YD2A 2AH5A 1BGXT 4I29A 2H3FA 4US9A 8ICUA 2OH2A 1TV9A 3HP6A 1JRPA 1C20A 3UMCA 2RDIA 3D2SA 5A0LA 2AQ0A 2VANA 2RDJA 1MC8A 4DO9A 1L8LA 4QZGA 1JXEA 7ICPA 1BNPA 3KKAA 1CEZA 4QZHA 5HHIA 1O08A 1ZQWA 4F2SA 3GDXA 1T4GA 1PVPA 2AXTU 2IHMA 3PW7A 2KJ9A 5KT7A 1NJWA 1LKYB 5DDMA 4KLSA 4YD1A 3M9OB 3IP4B 4K4GA 4KMUA 4CNQA 4F5RA 4RQNA 2F77X 3RB0A 3PVXA 3OSPA 5KFWA 4YMMA 4DF4A 1TKDA 4DL5A 1KFDA 2ZXIA 4RZRA 2O6KA 2JZBB 3QUTA 5AKZA 4P4PA 2MRLA 5DLGA 2K4HA 4B9MA 2B21A 5DQIA 1KSPA 1TAMA 4P0QA 3EUB2 2IMWP 4RPXA 3OJSA 5KG3A 1U47A 4C4TA 4QNLA 4WJ3B 1NK4A 4RQ7A 2YX8A 1COOA 3TAPA 2HOIA 3V6JA 8ICXA 1L3VA 3QUQA 1LV5A 4KX3A 5DQGA 1L3SA 2KNJA 4BWJA 8ICYA 1AQ6A 2R8IA 2E8MA 5J2AA 4DSKA 1CI4A 5L9XA 4XRHA 4LZGA 4R64A 4F4WA 5J0WA 2BDUA 1ZRMA 4YMNA 4P0QB 4NV0A 1IM4A 3Q8RB 2WAQF 4ECRA 2MUTB 1KDHA 4KLTA 4ED6A 3TARA 1SZPA 3UQ0A 1BPDA 5TZVA 1B4FA 3RJEA 3DEEA 1WCLA 3V6KA 4QWEA 4J9MA 4UAVA 5EE9A 2C2EA 3CNHA 3NS1A 4QZ8A 4NM1A 4M6WA 2FLLA 3HX0A 3ZDBA 4Z6DA 5AI4A 9ICCA 3C1YA 3RB6A 5TISU 3SI8A 1ZQZA 4C8LA 1T3QA 4RQ3A 3ISCA 5KFAA 5J0XA 3M8SA 2ISPA 2UVUA 3H40A 5DB9A 1SB3C 1JI7A 1LKYA 4AYBC 3RJFA 2OCEA 1P7DA 5ALDA 3IRUA 1BPEA 5KFCA 1ZQEA 2NRWA 3K1ZA 2G07A 3T3FA 3C2MA 5KG6A 3FC4A 2GO7A 1NJXA 5ALWA 3NRWA 2J6SA 4US8A 4CGZA 1Z4NA 3GILA 4PGQA 3OHBA 2OHFA 2H3VA 2CRXA 5IIJA 2FJ6A 4DL3A 1N63A 4C8NA 1L7OA 3PW0A 1NI3A 1UT5A 7ICOA 3M7DA 2ALZA 4EENA 4YFKA 2DPIA 1N2XA 4R65A 1QSYA 1DK2A 4PGYA 3I28A 4NJ8A 1CUKA 2WB1C 3C5GA 5ALJA 9ICPA 1T3NA 2K8AA 1HJPA 2BR0A 1NZPA 3ETRA 3IDWA 4X5VA 4KLQA 3PSTA 5HHHA 2XO7A 4B9LA 4DQPA 3SR6A 3H8WA 3I76A 7ICFA 5KFXA 2JXJA 4NL9C 2ZIXB 3JPPA 3RH6A 2UVVA 3TI0A 2BPCA 3BZCA 1V85A 2Q0ZX 4TURA 1S0NA 1QSSA 4EEKA 1SV0C 2RP5A 3GU3A 3PX6A 1UPHA 2GWSA 2BGWA 5J8YA 4CRXA 2NO4A 3EPIA 2HHUA 2VIXA 1ZQMA 4M9LA 3QU4A 4DCCA 4NLZA 1FEZA 4U6PA 3NRZA 1COKA 2BCUA 2B6GA 4I2BA 2IOFK 4Q43A 2OWOA 3RTVA 4CF3A 1N62A 4DL6A 4M6WB 2NRVA 1UA0A 3RBDA 1YZ6A 2DPJA 2G0AA 4UB4A 4RNNA 9ICBA 2DF4B 5HR7A 2HOFA 2HHXA 2Z7JA 2ASDA 5EE3A 5DKWA 4F93B 3PNCA 4NXZA 4ECSA 4YXMA 1WYGA 5H2FU 1S8OA 5JUMA 2K8CB 4R8UA 3CRXA 2KV2A 5L1MA 4FS2A 1Z1VA 1ZQRA 2D6FC 4KLMA 2DFLA 4EELA 4JUZA 1MQ2A 5ALFA 3OSNA 1ZQLA 5KNIA 1U4BA 2LKYA 1X9MA 4DFKA 5DBAA 2K4IA 5KFLA 5KFVA 2F1IA 5IIKA 2KK0A 2F8LA 3M1YA 4UB6U 2W9CB 3V6HA 1Z00A 2ZTDA 2EZXA 1ED1A 2M9NA 3ETLA 2PFOA 1RQLA 7ICEA 3GFKB 3WK7A 3AU6A 8ICPA 4F8RA 2JV3A 1S97A 1V9PA 3LDAA 4CCHA 4QWCA 4P2HA 4UB1A 5AKEA 4Q8FA 5HP4A 4KLJA 3T5JA 8ICSA 5HNKA 4NM2A 5G5HA 4BJQA 2P6UA 4DS4A 4USAA 4TQRA 4R8UB 3K4GA 3H0LB 4DSJA 4QWBA 3QE9Y 2W43A 3MGIA 3BS5A 4Y2PA 2A1JA 3E58A 4KITB 4PHDA 3T5HA 1IIPA 2LBOA 1JN3A 4YR3A 4KLGA 5L1IA 3AQFA 4PJ0U 3C29A 3SV4A 2YMPA 1SV0A 4DQQA 2CXYA 3QU2A 2WB1F 5AKKA 2YB1A 3PSFA 4EYHB 4KN4A 5KTQA 4NWIA 5KFNA 2H3IA 5J2KA 2HMXA 4FZLA 5AKXA 3OHAA 1KQQA 2KSOA 2OXOA 3L4PA 5GTHU 2WF6A 4CF5A 1ZQOA 3OTQA 3FM9A 2KICA 3QYPA 3PO5A 4RNOA 4J9QA 2FE9A 2AGQA 4M9GA 2ZJ8A 2ZIXA 5ALTA 4EX7A 2VA8A 1XSNA 1U49A 2K8BB 5DG8A 5AI6A 4ED7A 1JROA 4M2YA 5AKIA 3NGDA 2NO5A 3J81j 2KTQA 4KN7A 1FO4A 1UCVA 1YT3A 1PK1A 2Y9TA 1RPLA 5BPCA 9ICVA 4RT2A 4EYIB 4FS1A 4OD0A 4GIBA 2XI9A 2BDPA 4DSFA 4QWAA 4JV1A 1XSPA 7ICHA 2YMQA 3PZPA 1ZQGA 3V7LA 4I2CA 5KFJA 3MFIA 4IR9A 4ED2A 3KHHA 2A1AA 4GC6A 1NK0A 9ICKA 2IOFA 1Y88A 2W9BA 2PKEA 2XY6A 5DB8A 2QB0B 3RH4A 4O0IA 5HMMA 3PY8A 3KHGA 5AKYA 2FPKA 3TAQA 1WUDA 1L7PA 4Y2SA 2WAQC 2H5XA 4F72A 2KG5A 3RRGA 2F2AB 3D2QA 3NVWA 4GFJA 1FFUA 1NK6A 2GH1A 4M47A 3SENA 4QW8A 2W9CA 2ZUCA 4YR0A 3E0FA 4YN4A 2KOBA 1Z1BA 8ICGA 5AHXA 3QU7A 1F0MA 8ICOA 4RUAA 4JV2A 2WF7A 5L1KA 1MA7A 2E5SA 1PVQA 7ICMA 3KTQA 5IINA 2YY6A 2JMGA 2LM4A 5ALKA 3H8SA 3NUQA 2E1FA 2BKEA 3BDPA 5KG7A 3T5LA 3MGVA 3PMLA 2KN7A 3V7JA 4C4SA 1SL2A 5KFZA 4P0PA 1S9FA 4ECZA 4MF8A 1MN8A 4Q45A 1QQ7A 3OJUA 4QZEA 4YG2A 1ZQSA 2HI0A 3M6KA 1A6SA 2JEIA 2EQYA 2I1QA 4B9NA 2AU0A 4UBBA 5AICA 3Q8PB 2I5HA 3QU5A 3F5AA 2B0CA 9ICXA 1KFTA 2WF5A 2WFAA 1J97A 1XO0A 4FBUA 1BVSA 5HR6A 2A19A 1ZQXA 9ICTA 3BS7A 1S0MA 1RG6A 5CWRA 1KTQA 2P66A 4ELVA 1ZQIA 3QXGA 4ECWA 2XCAA 1QH9A 1S5LU 3D2NA 5CJ7A 3Q8QB 1ZQ1C 4NLKA 4R63A 4KLOA 1VDVA 3OPXA 5F9NA 2FMSA 2FI1A 2EANA 5J0RA 4DQIA 1BPXA 1QLNA 5T14A 3AQEA 5L1LA 4IQTA 1BPYA 3HKZF 1ZD2P 2F1JA 4RNMA 2Y0SF 3LWMA 1JALA 4EZ6A 2HBKA 2VA2A 3N4MB 4C7YA 3ZDDA 4A8EA 5J2JA 7ICNA 1L5UA 3N7RC 8ICFA 3ONNA 1K5OA 4QZBA 1NKBA 2UVRA 2Q4TA 1J2MA 3SAGA 4KLDA 1SL0A 3QUBA 4QZDA 4LJXA 3ZD8A 5ALIA 4J9LA 3H0RB 3IN5A 1ZQKA 4UARA 2R8JA 4DLGA 1ZQVA 4CE6A 4I2AA 4XQ8A 2XIDA 4MHVA 4RQ6A 4RU9A 5ALXA 4DOBA 2BCSA 3NASA 2L5YA 4ELTA 3RJGA 4ACOA 5DB7A 4PPXA 5AM4A 3GIMA 2RRDA 3ZDAA 1D9DA 7ICKA 1IG6A 3H7IA 8ICJA 1DOQA 1U48A 1JX4A 8ICKA 2W54A 2YMMA 4F4KA 1MQ3A 1L3UA 3BQTA 2IHNA 4Y2YA 3O0FA 5HMLA 3C21A 5ALQA 3G6YA 9ICHA 1VLBA 1JMSA 4EBCA 2DL0A 2JGAA 4UAZA 2EAOA 2VKQA 4EBEA 3F2CA 4KLFA 4I2IA 3PO4A 3V72A 1QTMA 2MU2A 4KLEA 4YCXA 2QARB 3GZFA 2KKVA 5IIOA 4UAUA 3KBBA 5KG2A 4O3MA 5AM2A 3PR5B 2E1EA 5JRTA 3PSPA 2AHOB 2LYBA 2Y9UA 1D8YA 1V38A 2FDRA 4GC7A 4UATA 4K4IA 4B9VA 2ZTEA 5AM3A 1LVHA 1Z4OA 1ZQQA 1TVAA 2RQ5A 5KFDA 1BNOA 4M0AA 1KL9A 2WHEA 2I9GA 4DFJA 3JPQA 1S76D 4O3NA 8ICEA 3TQ1A 5AI8A 4Y2QA 3MC1A 5ALGA
chains in the Genus database with same CATH topology
3CYMA 2XIDA 5KL8B 1YT3A 2K4IA 1Z19A 2DQNB 4P0PA 4OO1J 5C0YA 1SZHA 1URJA 2W04A 1T94A 1PVPA 2HBMA 2W03A 2YB4A 3DEEA 2CPRA 2JH1A 2F8LA 2KJ9A 1HIWA 2A3VA 4ACOA 2ZIXB 3CP8A 2HBJA 1KBUA 2PMZF 2XI9A 1ED1A 3PSIA 3ICXA 2RRDA 4OJPA 5KL1B 3T79A 2G06A 3IP4B 2M0NA 2OYYA 3PZPA 3M6KA 2R18A 2CN1A 1Q3UA 2RP5A 1A6SA 3GU3A 3LVVA 4OJOA 1D8BA 1UPHA 1GO3F 2F77X 3F53A 3KFUF 2LYAA 2N1RA 2F76X 2XICA 3M6ZA 4QJFB 2K4EA 4BJQA 2PMZC 4CRXA 3VCBA 2VIXA 2JH7A 2KHQA 2KJ5A 2ZIVB 3O0FA 4JMUA 3F5AA 3SMVA 3H0LB 4U6PA 4KMOB 1NZBA 3C29A 4PL1A 1XO0A 2ZXHA 1DRGA 2W7PA 5HR6A 4C0ZA 4FZMA 2JHDA 2LHTA 3N7PD 4WJ3B 2ZXIA 4AYBC 2K89A 1OUQA 1P7DA 4BX9C 2JGAA 1IIPA 1ECWA 2VKQA 2DGZA 2KD1A 2LBOA 3C28A 1WUDA 3F2CA 1PVRA 2VJ4A 2ZIUB 2KJ8A 2WAQC 3AQFA 2MRLA 3KZXA 2GOLA 4ICAA 4NLBA 4QIWF 2Y0SC 3K1ZA 4FZNA 2G07A 2ZG6A 3ALRA 4OJ5A 1F44A 5HR7A 3D2NA 3RFAA 1ZQ1C 3F5EA 2WB1F 2K4HA 3NRWA 3OPXA 2G0AA 2F2AB 1TAMA 2YB1A 3GZFA 2KKVA 3IG5A 3N7SC 3D2QA 3HKZC 4GFJA 4P0QA 2H3QA 4CGZA 3PSFA 4O3MA 4P0PB 2GH1A 3H0MB 1CRXA 4OJLA 2KHVA 4QNLA 3AQEA 5T14A 4NWIA 3F2BA 4NLCA 2DF4B 2E1EA 2HOFA 3PSPA 3SAHA 2YX8A 2Y0SF 3E0FA 2H3VA 2G09A 2G5HB 2H3IA 2RHFA 2Z7JA 3HKZF 3LYSA 2CRXA 2HOIA 1Q3VA 2HMXA 2VJ5A 4FZLA 3VC8A 2G08A 1XNSA 2KOBA 2LYBA 2XVTA 3SQIA 1Z1BA 2HBLA 2OXOA 5CRXA 2KKPA 2KVCA 2HBKA 3L3FX 4KX3A 2KNJA 3M7DA 4PL2A 3SAFA 2KICA 2K8CB 4A8EA 2G5IB 2KEYA 3CRXA 1MA7A 1HEKA 2ZIWB 2KV2A 2E5SA 3LVWA 3N7RC 3RF9A 2KIWA 2ZIXA 1PVQA 2H3FA 3ONNA 3AL0B 3IG8A 4KX5A 2OH2A 2BDUA 2WB1C 4AYBF 2ZIWA 2D6FC 4P0QB 2Q4TA 4NV0A 4U7CA 2K8BB 3SAGA 3D2SA 5A0LA 2OM6A 2JMGA 2K8AA 4QIWC 2MA1A 2WAQF 4OJ6A 4BUGA 3H0RB 3IN5A 4CDGA 3F2DA 1L6NA 2HOQA 3NUQA 2ZIUA 2H3ZA 4IC9A 2W7OA 2E1FA 2NV3A 3PSTA 1A0PA 2LKYA 3MGVA 4FE3A 2ZIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2Q A;  3D2N A;  3D2S A;  2E5S A; 
#chains in the Genus database with same CATH topology
 2GLE A;  2ZJ5 A;  4DQS A;  1WWU A;  3DV9 A;  4IQU A;  4F4X A;  3BJY A;  2W04 A;  5ALR A;  3KHR A;  7ICL A;  3MGH A;  3TFR A;  2DKX A;  3QNM A;  2P35 A;  2HBJ A;  3MBY A;  3MDA A;  5J2H A;  5KFB A;  3PSI A;  2KVS A;  3ICX A;  4ED8 A;  3HWT A;  1ZQJ A;  2JR5 A;  4QZC A;  2R18 A;  3C2K A;  5EWG A;  2ES6 A;  3RR7 A;  5DDY A;  2N1R A;  1U9L A;  2F76 X;  8ICR A;  9ICU A;  2BPF A;  2ZIV B;  4KLL A;  3ED5 A;  2FLN A;  3C1Z A;  4DLE A;  5EOZ A;  1DRG A;  5KFK A;  4NY8 A;  3N7P D;  3RB3 A;  5AM5 A;  2FLP A;  3QU9 A;  5J2F A;  3GV5 B;  3Q8S B;  2DWQ A;  3NVZ A;  3RR8 A;  4BX9 C;  2ZIU B;  2P6R A;  4JWM A;  1B22 A;  3EZ5 A;  4DFD A;  2KZZ A;  3RFA A;  2BQ3 A;  2H3Q A;  3WKE A;  4OJL A;  1XSL A;  3EW9 A;  1V97 A;  4KTQ A;  3NVV A;  2RHF A;  2V9W A;  4DSL A;  2LYH A;  5EWF A;  7ICT A;  3JPR A;  5DBC A;  3SZ2 A;  1NK5 A;  5J0T A;  1X9S A;  1RYU A;  4DWI A;  1NOM A;  3KHL A;  5DQH A;  2W9M A;  4GXK A;  4BDP A;  4RT3 A;  3SYZ A;  5EE1 A;  3AL0 B;  1N61 A;  1TK5 A;  1ZQU A;  2BCQ A;  3G6X A;  1NJY A;  4Y2U A;  4DQR A;  3U26 A;  8ICZ A;  4BXO A;  5KFU A;  2ZTC A;  1ZD4 A;  2KFN A;  4OJ6 A;  3GV8 B;  1L7N A;  1ARO P;  5B5E U;  4DF8 A;  1SGG A;  2ATL A;  5GTI U;  5KL8 B;  4HAI A;  2DQN B;  1URJ A;  1T94 A;  2W03 A;  5ALM A;  5D4B A;  4KLH A;  2W3R A;  2NYV A;  1XS9 D;  4RQ8 A;  4PGX A;  4TUS A;  4EBD A;  3A0B U;  7ICI A;  2M0N A;  4F91 B;  3GIK A;  2R8G A;  4QZ9 A;  5J2D A;  3QEB Z;  3RBE A;  5EE0 A;  3BQ2 A;  2C2D A;  1T8E A;  3ISD A;  2AQ4 A;  2HHT A;  2PI5 A;  4B9U A;  7ICS A;  1QQ5 A;  1PK3 A;  1ZJN A;  4ECQ A;  2ZJA A;  3QZ7 A;  1K1S A;  4M9H A;  2K89 A;  1S77 D;  4TQS A;  1ZQY A;  3MR2 A;  4ZH4 A;  5ALN A;  5CR0 A;  2VJ4 A;  1H38 A;  3KZX A;  3Q8M A;  1X42 A;  3K75 D;  5KFG A;  4ECU A;  2EZY A;  9ICQ A;  3NVY A;  7ICR A;  2R8H A;  2I6X A;  1JXL A;  5AK4 A;  5AK3 A;  3MR3 A;  4NLC A;  1RQN A;  2JEF A;  5AM1 A;  4UB5 A;  2HHQ A;  3SQI A;  3AU2 A;  2FMQ A;  1NKC A;  2MUT A;  3B0Y A;  2PFP A;  3UPQ A;  2J6T A;  1ZQN A;  4O3S A;  5CP2 A;  8ICW A;  4NL9 A;  3WK6 A;  3GQC A;  1KLN A;  2HHV A;  3LVW A;  2UVW A;  4Y2R A;  3UXO A;  4MEY A;  4IRC A;  3PW5 A;  3C5F A;  1SKS A;  4BUG A;  2H3Z A;  5J8Y C;  1QCK A;  3C23 A;  3PV8 A;  1L7M A;  5KAI U;  1O03 A;  3OGU A;  4F5N A;  4O5K A;  2WF9 A;  4F5O A;  4OJP A;  8ICM A;  4PHE A;  4UQG A;  3ZD9 A;  1SXE A;  2OYY A;  1RXV A;  4I2E A;  5J0S A;  1JIH A;  2J6U A;  3TAC B;  3B0X A;  1KEJ A;  3F53 A;  4TUQ A;  2K4E A;  2D8C A;  3UXN A;  3H4D A;  4QZI A;  7ICU A;  5KFF A;  1QQ6 A;  3RJH A;  3M8R A;  3MFH A;  2HCF A;  1KN5 A;  2HVH A;  1ZQH A;  4Y2J A;  1YZ7 A;  2KIV A;  1D8L A;  2IOH A;  5AI5 A;  4BXO B;  5KT3 A;  3FAH A;  2BHN A;  2HHS A;  1ECW A;  8ICH A;  2DGZ A;  2KD1 A;  1PZN A;  2QKQ A;  4P4O A;  2XGP A;  3BQ1 A;  5KFO A;  2ZG6 A;  1BPB A;  3PW2 A;  4FO6 A;  3HKZ C;  1A76 A;  4Y2T A;  4FBT A;  3PX0 A;  3RB4 A;  8ICQ A;  4J03 A;  2KHV A;  1D8B A;  4Z6E A;  4RQ1 A;  1Z3E B;  2G5H B;  5E79 U;  5KG0 A;  5ALV A;  4JWN A;  1XNS A;  5L1J A;  5AK5 A;  2KP7 A;  4MFA A;  8ICT A;  2KZ3 A;  4O5E A;  4Y2X A;  5AIA A;  2KEY A;  1WWV A;  3I1Y A;  4DFM A;  3RF9 A;  2HDO A;  3FDS A;  4KX5 A;  2Y1J A;  1IXR A;  4PH5 A;  4PZN A;  4DL2 A;  1L6N A;  2W7O A;  2ZIU A;  4UB2 A;  5KFS A;  1XU4 A;  4Q44 A;  4RUC A;  5ALP A;  2CPR A;  4C7Z A;  2JH1 A;  5KT4 A;  1HIW A;  5CB1 A;  2A1J B;  3IV6 A;  4K4H A;  4DL4 A;  4O3O A;  1KBU A;  2FPM A;  2XCP A;  2OEH A;  4Y2V A;  9ICL A;  3GIJ A;  4IS7 A;  3HPO A;  4F2R A;  2ZUD A;  1D9F A;  2E8O A;  5IIL A;  3RJK A;  1GO3 F;  3SV3 A;  5C5J A;  3M6Z A;  1UQV A;  1N56 A;  5AM0 A;  8ICI A;  2PMZ C;  1HUZ A;  3UMB A;  5D49 A;  2W7P A;  1HUO A;  4C0Z A;  2F44 A;  2KE7 A;  3MDC A;  2W3S A;  4C80 A;  3TAN A;  3N28 A;  1UT8 A;  2EDU A;  4DOC A;  4RQM A;  4RQ2 A;  2NRX A;  1X9X A;  4QIW F;  4OJ5 A;  4FZN A;  4J9P A;  8ICV A;  2BQR A;  9ICS A;  4AYB F;  5BOM A;  5AKG A;  4ZOH C;  2HSZ A;  2AGP A;  5ALH A;  1ZYQ A;  2K4P A;  1SL1 A;  2EZZ A;  4G9B A;  3LYS A;  3VC8 A;  1IV8 A;  2XVT A;  9ICF A;  3N97 B;  8ICA A;  5DG7 A;  2ODG A;  2W9B B;  3WKA A;  3SAF A;  1WCN A;  2KMD A;  3EWA A;  5KT6 A;  5EWE A;  4F4Y A;  1NK8 A;  2KZM A;  2ZIW B;  4J9K A;  4XA5 A;  4TUP A;  1TAU A;  1ZJM A;  2DKZ A;  4KLI A;  4U7C A;  1DK3 A;  7ICG A;  5KG4 A;  2YML A;  4GXJ A;  4ECY A;  5ALZ A;  4IC9 A;  1X40 A;  3R9K A;  2NV3 A;  2NRZ A;  1XO1 A;  1A0P A;  4C4R A;  2EAM A;  2ASJ A;  2W55 A;  2ZIV A;  5ALY A;  3CYM A;  2HHW A;  1SIJ A;  2W11 A;  5AKL A;  3WK8 A;  4ED3 A;  1QSL A;  3JPS A;  4QW9 A;  1B0X A;  2DBY A;  4ED1 A;  2JEJ A;  2F8K A;  3D6J A;  3HIL A;  3BQ7 A;  3RJJ A;  1S10 A;  4M9J A;  4MEX A;  2V4R A;  4F50 A;  4DSE A;  5J2B A;  4UB3 A;  4EEY A;  2XIC A;  3UMG A;  1S0V A;  2ASL A;  3VCB A;  4QZA A;  2JH7 A;  1ZQT A;  5KFE A;  3K1R B;  3TAD C;  4PZO A;  3WKC A;  1ZQC A;  3G6V A;  4FZM A;  1LB2 B;  4UAS A;  3WU2 U;  2EAP A;  1RDF A;  3GV7 B;  5AIB A;  4O3P A;  1PVR A;  8ICL A;  4NLG A;  4Z6F A;  4ICA A;  3LWL A;  2LMR A;  3EYZ A;  2GOL A;  1ZQD A;  3SEI A;  4JV0 A;  3JPO A;  4IR1 A;  5KFP A;  3F5E A;  5J0Y A;  3WK9 A;  1FIQ A;  3FYH A;  4ECT A;  3QX7 A;  5ALS A;  4RQ5 A;  5DB6 A;  1F5S A;  1X2I A;  4F71 A;  2XGQ A;  3PX4 A;  2QB0 A;  4IRD A;  3BS5 B;  3QZ8 A;  4F5Q A;  2HBL A;  2AJQ A;  1KFS A;  4DOA A;  4DEZ A;  2QAR A;  4PL2 A;  2ISO A;  5J0U A;  5III A;  4UBC A;  5FP0 A;  1X9W A;  1PK1 B;  2KIW A;  2MAX A;  3IG8 A;  1U45 A;  3Q8L A;  5AK6 A;  4XUS A;  3TAD A;  2FMP A;  3T5K A;  4JK1 A;  4R66 A;  4BGD A;  5F3X B;  4IQV A;  4IL6 U;  3H8M A;  5JTI A;  5KG1 A;  4Z6C A;  1RYR A;  1TE2 A;  1ZQA A;  3MR6 A;  4FE3 A;  2K60 A;  1ZD3 A;  3UQ2 A;  3UXP A;  4OO1 J;  2E3T A;  9ICI A;  1SZH A;  2EH9 A;  4J9S A;  2HBM A;  1C7Y A;  2Y1I A;  3H8J A;  4EZ9 A;  4DSI A;  3HJE A;  4YVZ A;  1OXJ A;  4E0D A;  3H4B A;  1NKE A;  3SD7 A;  2LI6 A;  2CN1 A;  9ICG A;  3LVV A;  1XC9 A;  2KSO B;  1ZRN A;  2LPE A;  4QJF B;  1TFR A;  4UW9 A;  1ZD5 A;  9ICR A;  2KHQ A;  4JMU A;  4AP9 A;  8ICC A;  4J9O A;  3PW4 A;  4ED0 A;  1SWV A;  1TK0 A;  4KMO B;  3KOO A;  5KFQ A;  4MFC A;  4C8O A;  1T7P A;  2HVI A;  1SV4 A;  4UAY A;  5DGB A;  1RXW A;  5AKJ A;  5KFY A;  1SKW A;  7ICQ A;  2D3D A;  2WTF A;  3C28 A;  1S0O A;  2KJ8 A;  4P0P B;  1KW4 A;  4NLB A;  2Y0S C;  5CHG A;  7ICV A;  4EX6 A;  3LK9 A;  3EPG A;  5KT5 A;  5DG9 A;  3AEV A;  1J2N A;  1K1Q A;  1CRX A;  4BWM A;  2NRT A;  3SAH A;  1Q3V A;  2VJ5 A;  2PI4 A;  1PUZ A;  5KT2 A;  3PR4 A;  5ALL A;  1ZQP A;  9ICN A;  4YR2 A;  2XY7 A;  3ZI4 A;  1X6I A;  5ALU A;  3UM9 A;  5DLF A;  5J0Q A;  5ALO A;  3PMN A;  1ZQB A;  2BZF A;  2LM1 A;  2IBK A;  2OM6 A;  1N60 A;  2BPG A;  5IIM A;  4J9N A;  4CDG A;  4F92 B;  4CF4 A;  2HOQ A;  4ELU A;  4UB8 U;  4PHP A;  1X6J A;  3C2L A;  1TK8 A;  3S6J A;  1NJZ A;  5J0O A;  1Z19 A;  5C0Y A;  9ICW A;  3M9N B;  3AM9 A;  2F3N A;  3CW2 C;  4QZF A;  4YP3 A;  2PXI A;  2VA3 A;  1RM6 C;  2F1H A;  2JRZ A;  2W9A A;  2V4Q A;  8ICB A;  4RPZ A;  4RQ4 A;  4OJO A;  1ZET A;  2PFQ A;  3HRD D;  5J2G A;  1L8O A;  1L3T A;  4I2H A;  3DDH A;  2ZXH A;  4UAW A;  2BCR A;  2JHD A;  2LHT A;  5F9L A;  9ICE A;  5KAF U;  3RAX A;  3AMZ A;  5AI0 A;  3JPN A;  2C28 A;  3T79 A;  1KRP A;  4O5C A;  3ALR A;  2AGO A;  3IG5 A;  3MR5 A;  1UA1 A;  4I2D A;  1SKR A;  1M6Y A;  5KFM A;  7ICJ A;  1FFV A;  9ICJ A;  4NLN A;  4C8K A;  1Q8K A;  4GLX A;  2G09 A;  5CRX A;  4YQW A;  4F4Z A;  2KKP A;  4I27 A;  3L3F X;  4PHA A;  3IM1 A;  5KFT A;  5DBB A;  5CA7 A;  1N5W A;  2FPL A;  2W8K A;  5AI9 A;  1BPZ A;  4J9R A;  2MA1 A;  4KLU A;  1B43 A;  5J0P A;  4M04 A;  3F2D A;  5J2C A;  1NK7 A;  1VJ5 A;  1SWW A;  2YN4 A;  9ICM A;  4DFP A;  3JPT A;  3RH5 A;  2YB4 A;  4G3I A;  5J2I A;  4F3O A;  3CP8 A;  3TFS A;  5KL1 B;  3AN1 A;  2E8N A;  2G06 A;  1DGJ A;  3TKA A;  3IHQ B;  4QWD A;  9ICA A;  1JUD A;  3RRH A;  4I2F A;  4F5P A;  4ECX A;  4RQ0 A;  2KJ5 A;  1ZQF A;  5K4L A;  1NZB A;  4PL1 A;  3QUC A;  3MAB A;  2HW3 A;  3QEA Z;  2ESE A;  1OUQ A;  1EXN A;  2WF8 A;  3KZI U;  1Q3U A;  1F44 A;  4DS5 A;  3A0H U;  1RYS A;  4I2J A;  5KFH A;  1OW5 A;  1KKX A;  3M9M B;  3F2B A;  3AUO A;  1UHU A;  1A77 A;  4I28 A;  2YTU A;  1TAQ A;  2YQE A;  2ZUB A;  3ISB A;  2KVC A;  3B9J A;  1XWL A;  4RPY A;  4YMO A;  4DL7 A;  4O9M A;  2G5I B;  1HEK A;  4FFD A;  2ZIW A;  3V7K A;  5J2E A;  4B9S A;  4QIW C;  1DXS A;  2C22 A;  3WKB A;  2IA6 A;  4Q8E A;  4ECV A;  3NTU A;  2W8L A;  2JEG A;  4JB3 A;  3Q8K A;  5KG5 A;  2MSN A;  3WK5 A;  3ZDC A;  4LVS A;  4O3R A;  5BOL A;  2BQU A;  2A3V A;  5ALE A;  1NNL A;  4LZD A;  2PMZ F;  2QLT A;  5CEH A;  3WKD A;  4M9N A;  3BZK A;  2KFZ A;  5AKH A;  1SXD A;  4HYK A;  3GII A;  3KFU F;  2LYA A;  3KD3 A;  3KKA C;  1Q46 A;  1ZOL A;  4C8M A;  5B66 U;  3SMV A;  3THV A;  1NK9 A;  4P4M A;  1N48 A;  3RAQ A;  2BCV A;  5KFR A;  2DUY A;  1Z00 B;  2XC9 A;  3HT3 A;  3RJI A;  2RLT A;  3ZDE A;  4GXI A;  5G5G A;  4OCZ A;  3BQ0 A;  1DGS A;  2JZB A;  9ICO A;  1ZXI A;  4MF2 A;  5JU5 A;  2XY5 A;  4B6J A;  3E2E A;  3N7S C;  5D46 A;  2QB1 A;  5J29 A;  1WG8 A;  3H0M B;  2C2R A;  5KFI A;  4YXJ A;  4O3Q A;  4IRK A;  4IQW A;  3WK4 A;  4MFF A;  2PFN A;  5DGA A;  2G08 A;  4I2G A;  3ORY A;  1N5X A;  2E8P A;  3L5K A;  8ICN A;  1MSW D;  3HW8 A;  1RZT A;  1X66 A;  2R8K A;  4B9T A;  4YD2 A;  2AH5 A;  1BGX T;  4I29 A;  2H3F A;  4US9 A;  8ICU A;  2OH2 A;  1TV9 A;  3HP6 A;  1JRP A;  1C20 A;  3UMC A;  2RDI A;  3D2S A;  5A0L A;  2AQ0 A;  2VAN A;  2RDJ A;  1MC8 A;  4DO9 A;  1L8L A;  4QZG A;  1JXE A;  7ICP A;  1BNP A;  3KKA A;  1CEZ A;  4QZH A;  5HHI A;  1O08 A;  1ZQW A;  4F2S A;  3GDX A;  1T4G A;  1PVP A;  2AXT U;  2IHM A;  3PW7 A;  2KJ9 A;  5KT7 A;  1NJW A;  1LKY B;  5DDM A;  4KLS A;  4YD1 A;  3M9O B;  3IP4 B;  4K4G A;  4KMU A;  4CNQ A;  4F5R A;  4RQN A;  2F77 X;  3RB0 A;  3PVX A;  3OSP A;  5KFW A;  4YMM A;  4DF4 A;  1TKD A;  4DL5 A;  1KFD A;  2ZXI A;  4RZR A;  2O6K A;  2JZB B;  3QUT A;  5AKZ A;  4P4P A;  2MRL A;  5DLG A;  2K4H A;  4B9M A;  2B21 A;  5DQI A;  1KSP A;  1TAM A;  4P0Q A;  3EUB 2;  2IMW P;  4RPX A;  3OJS A;  5KG3 A;  1U47 A;  4C4T A;  4QNL A;  4WJ3 B;  1NK4 A;  4RQ7 A;  2YX8 A;  1COO A;  3TAP A;  2HOI A;  3V6J A;  8ICX A;  1L3V A;  3QUQ A;  1LV5 A;  4KX3 A;  5DQG A;  1L3S A;  2KNJ A;  4BWJ A;  8ICY A;  1AQ6 A;  2R8I A;  2E8M A;  5J2A A;  4DSK A;  1CI4 A;  5L9X A;  4XRH A;  4LZG A;  4R64 A;  4F4W A;  5J0W A;  2BDU A;  1ZRM A;  4YMN A;  4P0Q B;  4NV0 A;  1IM4 A;  3Q8R B;  2WAQ F;  4ECR A;  2MUT B;  1KDH A;  4KLT A;  4ED6 A;  3TAR A;  1SZP A;  3UQ0 A;  1BPD A;  5TZV A;  1B4F A;  3RJE A;  3DEE A;  1WCL A;  3V6K A;  4QWE A;  4J9M A;  4UAV A;  5EE9 A;  2C2E A;  3CNH A;  3NS1 A;  4QZ8 A;  4NM1 A;  4M6W A;  2FLL A;  3HX0 A;  3ZDB A;  4Z6D A;  5AI4 A;  9ICC A;  3C1Y A;  3RB6 A;  5TIS U;  3SI8 A;  1ZQZ A;  4C8L A;  1T3Q A;  4RQ3 A;  3ISC A;  5KFA A;  5J0X A;  3M8S A;  2ISP A;  2UVU A;  3H40 A;  5DB9 A;  1SB3 C;  1JI7 A;  1LKY A;  4AYB C;  3RJF A;  2OCE A;  1P7D A;  5ALD A;  3IRU A;  1BPE A;  5KFC A;  1ZQE A;  2NRW A;  3K1Z A;  2G07 A;  3T3F A;  3C2M A;  5KG6 A;  3FC4 A;  2GO7 A;  1NJX A;  5ALW A;  3NRW A;  2J6S A;  4US8 A;  4CGZ A;  1Z4N A;  3GIL A;  4PGQ A;  3OHB A;  2OHF A;  2H3V A;  2CRX A;  5IIJ A;  2FJ6 A;  4DL3 A;  1N63 A;  4C8N A;  1L7O A;  3PW0 A;  1NI3 A;  1UT5 A;  7ICO A;  3M7D A;  2ALZ A;  4EEN A;  4YFK A;  2DPI A;  1N2X A;  4R65 A;  1QSY A;  1DK2 A;  4PGY A;  3I28 A;  4NJ8 A;  1CUK A;  2WB1 C;  3C5G A;  5ALJ A;  9ICP A;  1T3N A;  2K8A A;  1HJP A;  2BR0 A;  1NZP A;  3ETR A;  3IDW A;  4X5V A;  4KLQ A;  3PST A;  5HHH A;  2XO7 A;  4B9L A;  4DQP A;  3SR6 A;  3H8W A;  3I76 A;  7ICF A;  5KFX A;  2JXJ A;  4NL9 C;  2ZIX B;  3JPP A;  3RH6 A;  2UVV A;  3TI0 A;  2BPC A;  3BZC A;  1V85 A;  2Q0Z X;  4TUR A;  1S0N A;  1QSS A;  4EEK A;  1SV0 C;  2RP5 A;  3GU3 A;  3PX6 A;  1UPH A;  2GWS A;  2BGW A;  5J8Y A;  4CRX A;  2NO4 A;  3EPI A;  2HHU A;  2VIX A;  1ZQM A;  4M9L A;  3QU4 A;  4DCC A;  4NLZ A;  1FEZ A;  4U6P A;  3NRZ A;  1COK A;  2BCU A;  2B6G A;  4I2B A;  2IOF K;  4Q43 A;  2OWO A;  3RTV A;  4CF3 A;  1N62 A;  4DL6 A;  4M6W B;  2NRV A;  1UA0 A;  3RBD A;  1YZ6 A;  2DPJ A;  2G0A A;  4UB4 A;  4RNN A;  9ICB A;  2DF4 B;  5HR7 A;  2HOF A;  2HHX A;  2Z7J A;  2ASD A;  5EE3 A;  5DKW A;  4F93 B;  3PNC A;  4NXZ A;  4ECS A;  4YXM A;  1WYG A;  5H2F U;  1S8O A;  5JUM A;  2K8C B;  4R8U A;  3CRX A;  2KV2 A;  5L1M A;  4FS2 A;  1Z1V A;  1ZQR A;  2D6F C;  4KLM A;  2DFL A;  4EEL A;  4JUZ A;  1MQ2 A;  5ALF A;  3OSN A;  1ZQL A;  5KNI A;  1U4B A;  2LKY A;  1X9M A;  4DFK A;  5DBA A;  2K4I A;  5KFL A;  5KFV A;  2F1I A;  5IIK A;  2KK0 A;  2F8L A;  3M1Y A;  4UB6 U;  2W9C B;  3V6H A;  1Z00 A;  2ZTD A;  2EZX A;  1ED1 A;  2M9N A;  3ETL A;  2PFO A;  1RQL A;  7ICE A;  3GFK B;  3WK7 A;  3AU6 A;  8ICP A;  4F8R A;  2JV3 A;  1S97 A;  1V9P A;  3LDA A;  4CCH A;  4QWC A;  4P2H A;  4UB1 A;  5AKE A;  4Q8F A;  5HP4 A;  4KLJ A;  3T5J A;  8ICS A;  5HNK A;  4NM2 A;  5G5H A;  4BJQ A;  2P6U A;  4DS4 A;  4USA A;  4TQR A;  4R8U B;  3K4G A;  3H0L B;  4DSJ A;  4QWB A;  3QE9 Y;  2W43 A;  3MGI A;  3BS5 A;  4Y2P A;  2A1J A;  3E58 A;  4KIT B;  4PHD A;  3T5H A;  1IIP A;  2LBO A;  1JN3 A;  4YR3 A;  4KLG A;  5L1I A;  3AQF A;  4PJ0 U;  3C29 A;  3SV4 A;  2YMP A;  1SV0 A;  4DQQ A;  2CXY A;  3QU2 A;  2WB1 F;  5AKK A;  2YB1 A;  3PSF A;  4EYH B;  4KN4 A;  5KTQ A;  4NWI A;  5KFN A;  2H3I A;  5J2K A;  2HMX A;  4FZL A;  5AKX A;  3OHA A;  1KQQ A;  2KSO A;  2OXO A;  3L4P A;  5GTH U;  2WF6 A;  4CF5 A;  1ZQO A;  3OTQ A;  3FM9 A;  2KIC A;  3QYP A;  3PO5 A;  4RNO A;  4J9Q A;  2FE9 A;  2AGQ A;  4M9G A;  2ZJ8 A;  2ZIX A;  5ALT A;  4EX7 A;  2VA8 A;  1XSN A;  1U49 A;  2K8B B;  5DG8 A;  5AI6 A;  4ED7 A;  1JRO A;  4M2Y A;  5AKI A;  3NGD A;  2NO5 A;  3J81 j;  2KTQ A;  4KN7 A;  1FO4 A;  1UCV A;  1YT3 A;  1PK1 A;  2Y9T A;  1RPL A;  5BPC A;  9ICV A;  4RT2 A;  4EYI B;  4FS1 A;  4OD0 A;  4GIB A;  2XI9 A;  2BDP A;  4DSF A;  4QWA A;  4JV1 A;  1XSP A;  7ICH A;  2YMQ A;  3PZP A;  1ZQG A;  3V7L A;  4I2C A;  5KFJ A;  3MFI A;  4IR9 A;  4ED2 A;  3KHH A;  2A1A A;  4GC6 A;  1NK0 A;  9ICK A;  2IOF A;  1Y88 A;  2W9B A;  2PKE A;  2XY6 A;  5DB8 A;  2QB0 B;  3RH4 A;  4O0I A;  5HMM A;  3PY8 A;  3KHG A;  5AKY A;  2FPK A;  3TAQ A;  1WUD A;  1L7P A;  4Y2S A;  2WAQ C;  2H5X A;  4F72 A;  2KG5 A;  3RRG A;  2F2A B;  3D2Q A;  3NVW A;  4GFJ A;  1FFU A;  1NK6 A;  2GH1 A;  4M47 A;  3SEN A;  4QW8 A;  2W9C A;  2ZUC A;  4YR0 A;  3E0F A;  4YN4 A;  2KOB A;  1Z1B A;  8ICG A;  5AHX A;  3QU7 A;  1F0M A;  8ICO A;  4RUA A;  4JV2 A;  2WF7 A;  5L1K A;  1MA7 A;  2E5S A;  1PVQ A;  7ICM A;  3KTQ A;  5IIN A;  2YY6 A;  2JMG A;  2LM4 A;  5ALK A;  3H8S A;  3NUQ A;  2E1F A;  2BKE A;  3BDP A;  5KG7 A;  3T5L A;  3MGV A;  3PML A;  2KN7 A;  3V7J A;  4C4S A;  1SL2 A;  5KFZ A;  4P0P A;  1S9F A;  4ECZ A;  4MF8 A;  1MN8 A;  4Q45 A;  1QQ7 A;  3OJU A;  4QZE A;  4YG2 A;  1ZQS A;  2HI0 A;  3M6K A;  1A6S A;  2JEI A;  2EQY A;  2I1Q A;  4B9N A;  2AU0 A;  4UBB A;  5AIC A;  3Q8P B;  2I5H A;  3QU5 A;  3F5A A;  2B0C A;  9ICX A;  1KFT A;  2WF5 A;  2WFA A;  1J97 A;  1XO0 A;  4FBU A;  1BVS A;  5HR6 A;  2A19 A;  1ZQX A;  9ICT A;  3BS7 A;  1S0M A;  1RG6 A;  5CWR A;  1KTQ A;  2P66 A;  4ELV A;  1ZQI A;  3QXG A;  4ECW A;  2XCA A;  1QH9 A;  1S5L U;  3D2N A;  5CJ7 A;  3Q8Q B;  1ZQ1 C;  4NLK A;  4R63 A;  4KLO A;  1VDV A;  3OPX A;  5F9N A;  2FMS A;  2FI1 A;  2EAN A;  5J0R A;  4DQI A;  1BPX A;  1QLN A;  5T14 A;  3AQE A;  5L1L A;  4IQT A;  1BPY A;  3HKZ F;  1ZD2 P;  2F1J A;  4RNM A;  2Y0S F;  3LWM A;  1JAL A;  4EZ6 A;  2HBK A;  2VA2 A;  3N4M B;  4C7Y A;  3ZDD A;  4A8E A;  5J2J A;  7ICN A;  1L5U A;  3N7R C;  8ICF A;  3ONN A;  1K5O A;  4QZB A;  1NKB A;  2UVR A;  2Q4T A;  1J2M A;  3SAG A;  4KLD A;  1SL0 A;  3QUB A;  4QZD A;  4LJX A;  3ZD8 A;  5ALI A;  4J9L A;  3H0R B;  3IN5 A;  1ZQK A;  4UAR A;  2R8J A;  4DLG A;  1ZQV A;  4CE6 A;  4I2A A;  4XQ8 A;  2XID A;  4MHV A;  4RQ6 A;  4RU9 A;  5ALX A;  4DOB A;  2BCS A;  3NAS A;  2L5Y A;  4ELT A;  3RJG A;  4ACO A;  5DB7 A;  4PPX A;  5AM4 A;  3GIM A;  2RRD A;  3ZDA A;  1D9D A;  7ICK A;  1IG6 A;  3H7I A;  8ICJ A;  1DOQ A;  1U48 A;  1JX4 A;  8ICK A;  2W54 A;  2YMM A;  4F4K A;  1MQ3 A;  1L3U A;  3BQT A;  2IHN A;  4Y2Y A;  3O0F A;  5HML A;  3C21 A;  5ALQ A;  3G6Y A;  9ICH A;  1VLB A;  1JMS A;  4EBC A;  2DL0 A;  2JGA A;  4UAZ A;  2EAO A;  2VKQ A;  4EBE A;  3F2C A;  4KLF A;  4I2I A;  3PO4 A;  3V72 A;  1QTM A;  2MU2 A;  4KLE A;  4YCX A;  2QAR B;  3GZF A;  2KKV A;  5IIO A;  4UAU A;  3KBB A;  5KG2 A;  4O3M A;  5AM2 A;  3PR5 B;  2E1E A;  5JRT A;  3PSP A;  2AHO B;  2LYB A;  2Y9U A;  1D8Y A;  1V38 A;  2FDR A;  4GC7 A;  4UAT A;  4K4I A;  4B9V A;  2ZTE A;  5AM3 A;  1LVH A;  1Z4O A;  1ZQQ A;  1TVA A;  2RQ5 A;  5KFD A;  1BNO A;  4M0A A;  1KL9 A;  2WHE A;  2I9G A;  4DFJ A;  3JPQ A;  1S76 D;  4O3N A;  8ICE A;  3TQ1 A;  5AI8 A;  4Y2Q A;  3MC1 A;  5ALG A; 
#chains in the Genus database with same CATH homology
 3CYM A;  2XID A;  5KL8 B;  1YT3 A;  2K4I A;  1Z19 A;  2DQN B;  4P0P A;  4OO1 J;  5C0Y A;  1SZH A;  1URJ A;  2W04 A;  1T94 A;  1PVP A;  2HBM A;  2W03 A;  2YB4 A;  3DEE A;  2CPR A;  2JH1 A;  2F8L A;  2KJ9 A;  1HIW A;  2A3V A;  4ACO A;  2ZIX B;  3CP8 A;  2HBJ A;  1KBU A;  2PMZ F;  2XI9 A;  1ED1 A;  3PSI A;  3ICX A;  2RRD A;  4OJP A;  5KL1 B;  3T79 A;  2G06 A;  3IP4 B;  2M0N A;  2OYY A;  3PZP A;  3M6K A;  2R18 A;  2CN1 A;  1Q3U A;  2RP5 A;  1A6S A;  3GU3 A;  3LVV A;  4OJO A;  1D8B A;  1UPH A;  1GO3 F;  2F77 X;  3F53 A;  3KFU F;  2LYA A;  2N1R A;  2F76 X;  2XIC A;  3M6Z A;  4QJF B;  2K4E A;  4BJQ A;  2PMZ C;  4CRX A;  3VCB A;  2VIX A;  2JH7 A;  2KHQ A;  2KJ5 A;  2ZIV B;  3O0F A;  4JMU A;  3F5A A;  3SMV A;  3H0L B;  4U6P A;  4KMO B;  1NZB A;  3C29 A;  4PL1 A;  1XO0 A;  2ZXH A;  1DRG A;  2W7P A;  5HR6 A;  4C0Z A;  4FZM A;  2JHD A;  2LHT A;  3N7P D;  4WJ3 B;  2ZXI A;  4AYB C;  2K89 A;  1OUQ A;  1P7D A;  4BX9 C;  2JGA A;  1IIP A;  1ECW A;  2VKQ A;  2DGZ A;  2KD1 A;  2LBO A;  3C28 A;  1WUD A;  3F2C A;  1PVR A;  2VJ4 A;  2ZIU B;  2KJ8 A;  2WAQ C;  3AQF A;  2MRL A;  3KZX A;  2GOL A;  4ICA A;  4NLB A;  4QIW F;  2Y0S C;  3K1Z A;  4FZN A;  2G07 A;  2ZG6 A;  3ALR A;  4OJ5 A;  1F44 A;  5HR7 A;  3D2N A;  3RFA A;  1ZQ1 C;  3F5E A;  2WB1 F;  2K4H A;  3NRW A;  3OPX A;  2G0A A;  2F2A B;  1TAM A;  2YB1 A;  3GZF A;  2KKV A;  3IG5 A;  3N7S C;  3D2Q A;  3HKZ C;  4GFJ A;  4P0Q A;  2H3Q A;  4CGZ A;  3PSF A;  4O3M A;  4P0P B;  2GH1 A;  3H0M B;  1CRX A;  4OJL A;  2KHV A;  4QNL A;  3AQE A;  5T14 A;  4NWI A;  3F2B A;  4NLC A;  2DF4 B;  2E1E A;  2HOF A;  3PSP A;  3SAH A;  2YX8 A;  2Y0S F;  3E0F A;  2H3V A;  2G09 A;  2G5H B;  2H3I A;  2RHF A;  2Z7J A;  3HKZ F;  3LYS A;  2CRX A;  2HOI A;  1Q3V A;  2HMX A;  2VJ5 A;  4FZL A;  3VC8 A;  2G08 A;  1XNS A;  2KOB A;  2LYB A;  2XVT A;  3SQI A;  1Z1B A;  2HBL A;  2OXO A;  5CRX A;  2KKP A;  2KVC A;  2HBK A;  3L3F X;  4KX3 A;  2KNJ A;  3M7D A;  4PL2 A;  3SAF A;  2KIC A;  2K8C B;  4A8E A;  2G5I B;  2KEY A;  3CRX A;  1MA7 A;  1HEK A;  2ZIW B;  2KV2 A;  2E5S A;  3LVW A;  3N7R C;  3RF9 A;  2KIW A;  2ZIX A;  1PVQ A;  2H3F A;  3ONN A;  3AL0 B;  3IG8 A;  4KX5 A;  2OH2 A;  2BDU A;  2WB1 C;  4AYB F;  2ZIW A;  2D6F C;  4P0Q B;  2Q4T A;  4NV0 A;  4U7C A;  2K8B B;  3SAG A;  3D2S A;  5A0L A;  2OM6 A;  2JMG A;  2K8A A;  4QIW C;  2MA1 A;  2WAQ F;  4OJ6 A;  4BUG A;  3H0R B;  3IN5 A;  4CDG A;  3F2D A;  1L6N A;  2HOQ A;  3NUQ A;  2ZIU A;  2H3Z A;  4IC9 A;  2W7O A;  2E1F A;  2NV3 A;  3PST A;  1A0P A;  2LKY A;  3MGV A;  4FE3 A;  2ZIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...