3D2SA

Crystal structure of mbnl1 tandem zinc finger 3 and 4 domain in complex with cgcugu rna
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
TDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein/rna
molecule keywords 5'-R(*CP*GP*CP*UP*GP*U)-3'
publication title Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.840 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3d2sA00
3D2SA 3D2NA 3D2QA 2E5SA
chains in the Genus database with same CATH superfamily
2F44A 3T5HA 4Q45A 4DLGA 3DV9A 4NWIA 4UAZA 5CR0A 1UHUA 3C23A 2KP7A 1HUOA 3MR3A 7ICLA 5CRXA 2VA2A 3UMBA 1TV9A 4KLDA 1NNLA 1NKBA 4JWNA 5F9LA 2H3IA 4F71A 4BWJA 4LZDA 9ICLA 3UMCA 4YXMA 4BGDA 4EZ9A 2OM6A 1COOA 1PK1B 4P0PB 4YFKA 2EZZA 3IM1A 1DOQA 4ELUA 2W11A 2Y9TA 1HEKA 1ZQBA 4GXJA 4GXIA 4YG2A 1UA1A 7ICSA 1ZQFA 2PFQA 1PZNA 2YY6A 5L1JA 3SENA 4O5EA 9ICBA 4RNNA 1ED1A 2HHUA 4F4ZA 2LYAA 1SIJA 3KHRA 2HHXA 2F2AB 2KZZA 2M0NA 1QSLA 2C2DA 7ICNA 4QNLA 2A1JB 2LBOA 2OCEA 1DGJA 3RH6A 5KFJA 1NZPA 1SKSA 1WWUA 2AGPA 4F5QA 2ISPA 5J2GA 5GTIU 2ZIUA 4G3IA 3RR7A 1BPBA 5DB9A 2YMLA 4KMOB 5J0PA 4Z6FA 2ZTCA 3NUQA 3M8SA 2ZIVB 3PY8A 4EYIB 1N5WA 3VC8A 2FMPA 1V85A 2HBMA 2K8AA 3N97B 7ICTA 3L3FX 4K4IA 2ZIWB 5EWEA 3JPTA 2K4PA 9ICUA 1SB3C 3PVXA 2A19A 4B9MA 3QEAZ 1ZQAA 2E3TA 2R8GA 2RP5A 3V6JA 1KQQA 3RRHA 2HDOA 7ICPA 3IG5A 1FO4A 3HP6A 2G0AA 2ZIWA 3MR2A 1XO0A 3H4BA 3KHHA 1PVQA 2EZYA 4UB6U 4DF4A 5AICA 1ZQMA 1Z00B 1ZRMA 3QYPA 3T5LA 1SZPA 4JV2A 3ZDDA 1YT3A 2E8OA 1N63A 2H3VA 3ISBA 4AYBC 3GIKA 3KFUF 4IQUA 2Q4TA 4JV0A 4KMUA 1SL1A 1KSPA 8ICHA 4C8MA 1X2IA 4F91B 4NLKA 7ICUA 2HMXA 4ED6A 5ALVA 3MR6A 3Q8RB 2H5XA 5HNKA 1L7NA 2DF4B 1T4GA 2VJ5A 3WK5A 1SV0A 3FM9A 2EAPA 5KFPA 2YB4A 2KFZA 3OJSA 5IINA 1Z3EB 3KD3A 3WK4A 2NYVA 1KKXA 3IRUA 4O3NA 3WK8A 3NRZA 1ZQXA 4FE3A 4NLBA 5ALZA 1RXVA 3SMVA 2KJ8A 3PO4A 4UB2A 4I2DA 4ECUA 8ICVA 2PMZF 4DSKA 5AI6A 3AL0B 4RQ1A 1V97A 3ZD8A 5KNIA 1X6IA 3HILA 4DFDA 1QLNA 5DGAA 3IN5A 5K4LA 4UAYA 3OSPA 1RPLA 5AKHA 4C4RA 5AKYA 4IRKA 2XY6A 3C1YA 3OHBA 2E1FA 2CXYA 1TAMA 5F3XB 4YP3A 4F2SA 4I27A 1Z4OA 3RFAA 2KVCA 4ED0A 2YN4A 2VA3A 2UVVA 1KN5A 1J97A 4WJ3B 4KLSA 2KHQA 3FYHA 2HHVA 3T5JA 1T3NA 5AM5A 4EEKA 3BZKA 2ODGA 1XS9D 1N5XA 5EWFA 1Z1BA 1O03A 1UQVA 3NS1A 1JX4A 7ICRA 1K1QA 5EE9A 2C2EA 3RJKA 2VJ4A 1JI7A 1X9SA 2BZFA 4LVSA 3RJEA 2YMMA 8ICNA 1FFVA 3HT3A 3GIJA 3TARA 5ALKA 4UB1A 3RH5A 5KT7A 2W54A 2HCFA 1QCKA 2ZG6A 7ICGA 1QTMA 2KSOA 4DL3A 2WF7A 1QQ6A 2K89A 4Z6CA 4F5PA 4Z6DA 2HHQA 1Z1VA 2W9CB 1Q46A 4O3QA 8ICMA 2JEJA 3TAQA 4YD1A 2A1AA 4EX6A 1MQ3A 3EW9A 4P4PA 5KFOA 4F2RA 1L3VA 3BS5B 5AK4A 3TFSA 8ICBA 3CYMA 7ICMA 3H0MB 2EZXA 2L5YA 2RHFA 4JUZA 3WKBA 1AQ6A 2AJQA 3AQFA 2KTQA 3PX4A 5L1IA 7ICJA 3LVWA 3HWTA 1ZXIA 3M9OB 3THVA 3PSFA 4UBBA 4PGXA 5AKZA 2F1JA 2K4EA 4CF5A 1JXEA 4US9A 2UVWA 2G08A 3U26A 4OJPA 2JEFA 4Z6EA 5KTQA 1U48A 4BXOA 5KFSA 1ZQUA 4TUSA 2WB1C 2W8KA 1X42A 4IQVA 1K1SA 2ZTDA 4J9PA 4GFJA 4NLGA 3GU3A 1Z19A 5J2BA 1ZRNA 1XC9A 4PJ0U 2JV3A 3ZDBA 5ALLA 4F50A 5H2FU 2G06A 4UBCA 1B4FA 2W8LA 1KL9A 3ETLA 1WG8A 4YR3A 1X9WA 2QLTA 3PW4A 3H40A 4GIBA 4UB4A 1O08A 3KHLA 2BHNA 4TUPA 4EZ6A 2J6SA 2E1EA 2VIXA 4J9RA 2KJ9A 2Y9UA 4RUAA 2NRTA 2W9BB 2DBYA 3Q8LA 1TKDA 2W7OA 1DXSA 1HJPA 2KIVA 9ICNA 3LYSA 4C4TA 2VKQA 4BDPA 5IIIA 4CDGA 4KLTA 3OGUA 4YD2A 2LYBA 1MSWD 2XY5A 4I2GA 5DQGA 5AI9A 3HX0A 4NM1A 3FAHA 4GC7A 1KLNA 1ZD5A 3QU7A 3UM9A 3F5AA 4OD0A 3Q8QB 3PR4A 3NVYA 2NV3A 2XICA 1NZBA 8ICRA 7ICFA 4KX3A 3GDXA 1TK5A 3CRXA 2RDIA 4R64A 3OHAA 3QU2A 1A76A 2G5HB 3AUOA 3LWLA 4DSEA 4QWEA 4I2AA 5L1MA 1SKRA 4XA5A 2XGPA 1V9PA 2B6GA 1KFTA 4U7CA 4RPXA 4RQ8A 3Q8PB 9ICOA 5EOZA 4QIWF 4MF8A 3PZPA 2W03A 1L7OA 2G5IB 2HI0A 2HHSA 3GZFA 1BNPA 4NY8A 2IA6A 5ALSA 2D6FC 3H4DA 2QARA 2KKVA 3EPIA 4A8EA 4KLGA 2W7PA 3WKAA 2OH2A 4Y2JA 2QKQA 4FS1A 3ICXA 3RF9A 2UVUA 3OJUA 1NI3A 3SEIA 5KG2A 1EXNA 2KG5A 4ECWA 3B0YA 1T8EA 3PX0A 2K4IA 3WK6A 1JN3A 3ZDAA 5KFEA 9ICQA 4QW9A 5DGBA 3H8WA 2W04A 4RU9A 5DG9A 3N28A 4ECYA 2VA8A 5DB8A 2AGQA 5ALJA 5ALDA 5ALQA 4J9MA 2WB1F 2C22A 3IG8A 1S8OA 4TQRA 5AI4A 5C5JA 1BPDA 3BQ7A 4US8A 3V7JA 5EE3A 2WF8A 2J6TA 5KFYA 1S0NA 3BS7A 3MGHA 4YMMA 5ALRA 2HBJA 4Q8FA 3QZ7A 5AHXA 2KVSA 4ED1A 4P4OA 2ASDA 4TQSA 1S0OA 3V6HA 4M47A 1N60A 2ALZA 3PW2A 5C0YA 2GLEA 1U49A 4E0DA 1XO1A 4O3PA 1FIQA 5ALIA 1D9DA 1U4BA 4R8UA 3RB4A 4IR1A 2NO4A 2AH5A 2F1IA 1PUZA 4KLFA 3Q8SB 1ZQNA 4F5OA 4DFPA 1UA0A 4MEYA 4PZOA 2BQ3A 1TE2A 2BQRA 2BDPA 2ZIXA 1YZ7A 2JEGA 3CNHA 4R66A 8ICFA 2GOLA 5KAFU 1SL2A 1S0MA 5DBBA 5KT2A 5AKGA 4EELA 4BJQA 3KKAC 3PNCA 3PMLA 5DQHA 2DGZA 4O0IA 3VCBA 2HSZA 3IDWA 2OYYA 1X9XA 2NRZA 1CI4A 3LDAA 3QXGA 3UMGA 5AI0A 1SKWA 4J9SA 1U47A 3PSIA 3F2DA 4GXKA 1PVRA 1T94A 2KIWA 3RBEA 5EWGA 4QWAA 4OO1J 1ZQIA 4J03A 2HVIA 1QSYA 3TADC 4Y2RA 4QZEA 4UASA 1ZQDA 2DWQA 5KFZA 4Q8EA 2PMZC 3EYZA 3IHQB 5J0RA 2YB1A 3EWAA 2ZIUB 5KT6A 4NXZA 9ICAA 4EBCA 2HOIA 7ICKA 4CF3A 1UCVA 2ZJAA 4PHPA 3ONNA 1NK9A 4IRDA 2FLNA 4RQ6A 2XO7A 2AQ4A 3UXPA 2NO5A 3C2MA 3FDSA 4J9KA 7ICIA 2IHMA 4EEYA 2GH1A 2D8CA 4XRHA 5KFIA 2HHWA 4Y2TA 1L8OA 8ICCA 3C29A 2LM1A 2IOFA 4YVZA 7ICEA 2BPGA 3T79A 2Y0SC 2BCSA 1JXLA 3C5GA 3RJFA 2JZBA 2DUYA 3AU6A 2K8BB 1FFUA 5ALTA 2I6XA 3UPQA 2ES6A 4U6PA 4QZAA 3WU2U 5J2AA 1L3SA 5AKLA 1ZQTA 2JGAA 3N7SC 2JRZA 2ESEA 2Y1IA 1B0XA 1KEJA 4FZMA 4KLHA 4JB3A 4QZBA 4O3SA 5TZVA 2GO7A 1L6NA 3NVWA 2FE9A 5KG6A 2RLTA 1TAUA 4FZLA 4DQQA 5ALMA 4HAIA 4K4GA 2P6RA 4UAVA 3L4PA 3ED5A 3RBDA 2DPIA 2CN1A 2CPRA 4FBUA 1XWLA 5AM1A 3F2BA 5KG5A 1J2NA 1L5UA 4RPYA 9ICFA 4EENA 4DSLA 2FDRA 2H3FA 1C20A 4J9NA 4ECQA 4XQ8A 1NKEA 1ZQGA 5KFGA 5DBAA 1NOMA 5J2IA 9ICCA 2HBLA 5DLFA 5ALFA 3JPRA 1LKYA 3PW0A 4YQWA 8ICPA 1U9LA 3QEBZ 4MEXA 1ZD3A 2AXTU 1K5OA 5J0UA 2AHOB 5AKIA 3GV5B 2UVRA 5HR7A 4YN4A 8ICYA 5ALYA 4DSJA 4NL9A 3SAGA 8ICAA 3GFKB 2BR0A 1SWWA 2FJ6A 1TK0A 4RZRA 3RAQA 3RB3A 2D3DA 1JRPA 4F4XA 2WFAA 1S97A 2W43A 1L3UA 1BPYA 8ICSA 1S5LU 2YQEA 3D6JA 1PK3A 2FPMA 2KHVA 1TK8A 2K60A 3MFIA 8ICLA 7ICOA 3ALRA 2Y0SF 5KFRA 4IQWA 4CNQA 4I2EA 2ISOA 2PKEA 3GIMA 1X40A 3DDHA 3MC1A 3NGDA 5G5HA 4NV0A 1VDVA 3RAXA 1ZD4A 4R63A 2ZJ8A 2MAXA 4DQPA 3QUTA 2EDUA 1XU4A 2KSOB 5J2JA 2FI1A 2KK0A 3KZXA 2G07A 2AQ0A 1NKCA 4ECTA 4DF8A 5CJ7A 1V38A 4ECZA 2A3VA 9ICPA 4F4KA 2V9WA 4I28A 5ALEA 2QB0A 2IBKA 5HHHA 4I2FA 2ASJA 1T3QA 2MUTA 3RR8A 1S77D 4RNOA 4UAWA 4DSIA 3JPNA 1RYSA 4UB3A 4QIWC 4PGYA 1L3TA 4DCCA 1ZETA 4G9BA 1NK6A 5B5EU 1QSSA 4FBTA 4C80A 3GV8B 5AKXA 3GILA 1Q8KA 3V72A 5T14A 2JMGA 3GV7B 4NM2A 2YX8A 4QJFB 1QQ5A 5G5GA 3BQ2A 4ELTA 4BXOB 2O6KA 5DB7A 5KFMA 4F92B 2V4QA 1ZQVA 4P2HA 2DKXA 5DG8A 1KFDA 1BGXT 3UXOA 9ICRA 1SWVA 5J2CA 1KTQA 9ICIA 2Z7JA 4YCXA 1QQ7A 4PL2A 3IP4B 3KOOA 4Y2YA 1F5SA 2N1RA 4DWIA 3M7DA 1ZQKA 3F5EA 2DFLA 3UXNA 3RTVA 9ICWA 1IM4A 4RUCA 3K1ZA 4ED3A 2BCQA 9ICHA 3ETRA 1DGSA 4DEZA 2YTUA 4UARA 2B0CA 1Z4NA 2W9AA 1ZQ1C 4ZH4A 5KFLA 1SL0A 2LHTA 5ALXA 2XC9A 2V4RA 5E79U 3RJHA 1BNOA 5BOMA 4DOAA 2JHDA 3E2EA 1DK3A 3PO5A 3M6ZA 2NRXA 4ED8A 9ICJA 1BPXA 2WF6A 3QU5A 4OCZA 2OEHA 5J0WA 2KJ5A 3BDPA 3D2QA 3KBBA 2EANA 4X5VA 4PPXA 1KW4A 1Q3VA 1WUDA 2ZXHA 4DS5A 4UB8U 8ICGA 3QNMA 1S10A 5HHIA 2E5SA 4DS4A 3WK9A 3NASA 2BKEA 3EZ5A 3RH4A 4Y2XA 2J6UA 4RNMA 2BCRA 5KT4A 5J2FA 1KDHA 1KRPA 3H8JA 2QARB 4I2CA 3PR5B 3MGVA 4JV1A 4HYKA 4DFKA 4FO6A 1JROA 1P7DA 4M9JA 4ECVA 9ICVA 2KNJA 5KT5A 4RQ7A 5J0OA 3H7IA 4USAA 1A77A 1UPHA 2DQNB 2RQ5A 1GO3F 1QH9A 2OHFA 3SAFA 2YMQA 2ZUCA 2XVTA 1ZQLA 8ICJA 3T3FA 4F3OA 2HBKA 2JEIA 2ZJ5A 5KFDA 4MF2A 3I28A 2I9GA 2KMDA 3NVVA 4JK1A 4PH5A 1SV0C 3I76A 2KFNA 8ICOA 4LZGA 3C2KA 4I29A 5KFAA 1RYUA 1H38A 4NJ8A 3WKEA 2BCVA 4Y2SA 4QZCA 4Y2QA 1RQNA 2IHNA 1M6YA 4DOBA 2PXIA 1MC8A 2KKPA 3SV3A 1PVPA 5DKWA 3H0RB 4Y2VA 1U45A 4B9SA 3N7RC 1T7PA 1IXRA 4KX5A 5A0LA 4UATA 4R8UB 3MABA 4P0QA 1IIPA 1TAQA 5AIAA 5J0QA 5CB1A 5J0TA 1ZQHA 5KFVA 4DL6A 5AK6A 4UB5A 4DL4A 4KN4A 1N48A 5IIMA 3PX6A 1S0VA 2ZIXB 3RB0A 1ZQQA 8ICQA 4CCHA 4M6WA 3MFHA 4M9LA 4EBEA 9ICTA 4RT3A 1VLBA 2HOQA 2KV2A 4FFDA 3G6VA 3SI8A 5KG7A 3ISCA 4IS7A 1B22A 1RG6A 4F72A 2C28A 5J0YA 1TVAA 2F8LA 2JXJA 4DFJA 2R8JA 5KFWA 4J9LA 2ZTEA 4NLCA 1NJWA 3UQ2A 4C8OA 2FLPA 5J8YC 4M0AA 1D8BA 4NLZA 3BZCA 4PHDA 3MBYA 7ICQA 1D9FA 4O3OA 4NLNA 8ICKA 7ICVA 3SD7A 3IV6A 2ATLA 3HKZC 4KLJA 2C2RA 3TKAA 3EUB2 3ZI4A 3T5KA 8ICUA 2MA1A 4OJ6A 1N62A 2YMPA 2G09A 4RQ2A 5AKJA 3RJJA 1UT5A 2ZUDA 4DFMA 1NJYA 3OTQA 4PL1A 1ZQEA 1CUKA 5AKKA 1NK7A 1N61A 1PK1A 4P0PA 3MDAA 1BVSA 4DQIA 4KLOA 5ALGA 1CRXA 3MDCA 4F5RA 8ICTA 1F44A 2NRWA 2R8IA 2LM4A 3V7KA 1JIHA 4KTQA 1RXWA 2KZ3A 3QE9Y 4IQTA 3SR6A 4QZ8A 2JZBB 1BPZA 2FMSA 4QZIA 1COKA 3HW8A 2FMQA 1L7PA 5D49A 1A6SA 1NK0A 3JPSA 3NTUA 4EYHB 2OWOA 5KL8B 2K8CB 4XUSA 1L7MA 3NVZA 3JPQA 4ZOHC 5L1KA 4F93B 1VJ5A 1MA7A 5KG1A 3FC4A 3KZIU 2A1JA 4F5NA 3JPPA 4FS2A 2KEYA 4ECRA 3MGIA 3AN1A 5CA7A 4QZFA 4KITB 2EAMA 4F4WA 3HJEA 3N7PD 3C5FA 5AIBA 5L9XA 4KLLA 3PSTA 2PFPA 5IIKA 5AI5A 3JPOA 5KT3A 4C8NA 1RDFA 2ZXIA 2MRLA 2R8KA 2FPKA 4CGZA 2WF5A 1Y88A 5BPCA 2ZIVA 3HPOA 3V6KA 4O3MA 1WCLA 2B21A 2LPEA 8ICIA 1RYRA 4DL7A 4BUGA 5CEHA 4M2YA 4I2IA 4YR0A 1ZYQA 5L1LA 2WHEA 5JTIA 4Y2PA 5J2EA 1LVHA 4UW9A 4KN7A 4C4SA 3BQ1A 1IG6A 5J29A 1LKYB 3H8MA 4CE6A 5HP4A 1JMSA 2EQYA 4RT2A 2IMWP 3TANA 3QUBA 2KE7A 9ICXA 2E8MA 2R8HA 4ED2A 2H3ZA 1ZQPA 1X66A 1SXEA 2EAOA 1NK5A 1Z00A 4MFCA 3B9JA 2P6UA 3TAPA 2IOFK 3HKZF 5KFTA 5J2DA 4Q44A 5AK3A 5JU5A 3I1YA 2DPJA 1ZJNA 2PI4A 3EPGA 1ZQYA 5DLGA 4EBDA 4ICAA 5D46A 4IRCA 4YR2A 1J2MA 5KFXA 4PGQA 3K4GA 4QZGA 4J9QA 1ZQOA 1XSPA 2BPFA 1XSLA 5KFNA 8ICXA 2GWSA 1MN8A 3WK7A 2P35A 5CWRA 4B9NA 4RQ0A 3M9NB 1HIWA 3RB6A 5IILA 2KZMA 3TQ1A 4Q43A 2LYHA 3UQ0A 4RQ5A 1ZQZA 5AM4A 5KAIU 1N2XA 5AM0A 3CW2C 2I5HA 5DDMA 3WKDA 4MHVA 1ZQJA 4OJLA 3QZ8A 4FZNA 1HUZA 4J9OA 5AK5A 4F4YA 4DSFA 4DOCA 3ZD9A 1MQ2A 2WAQC 4LJXA 2F3NA 5KFFA 8ICWA 2K4HA 5ALNA 4QW8A 3MR5A 4DLEA 5AM3A 3N4MB 1ZOLA 4KLQA 5IIOA 4KLMA 4PHAA 1RQLA 1KBUA 2DKZA 2F77X 2AU0A 4RQMA 2QB0B 5AKEA 9ICGA 4AP9A 3M8RA 2MUTB 5ALOA 2EH9A 5HR6A 1JALA 2WTFA 2FPLA 1ZD2P 4F8RA 2KD1A 1S9FA 3AEVA 4RQ3A 4M9GA 1LV5A 3KKAA 1KFSA 1AROP 3S6JA 1SGGA 3BQTA 2BQUA 1NK4A 3ISDA 3AQEA 4K4HA 3QU4A 1NJXA 5J8YA 2W3RA 3TFRA 1N56A 1X9MA 4IR9A 4KLEA 5J2HA 4RPZA 2KN7A 3M9MB 4B6JA 2P66A 1SXDA 5CP2A 4QZDA 1D8LA 4YMNA 4QZHA 1WWVA 5B66U 5KFKA 3TADA 2BCUA 5JUMA 5D4BA 1OXJA 4OJOA 1UT8A 4AYBF 4I2BA 2M9NA 2LKYA 3NRWA 4Y2UA 2ASLA 2W9MA 2DL0A 2Q0ZX 3J81j 3QX7A 2NRVA 3BJYA 4ECXA 5AM2A 1TFRA 3ORYA 3K1RB 5DBCA 2XCPA 2W9CA 1F0MA 2PI5A 2HVHA 5BOLA 3BQ0A 2H3QA 5ALPA 2LMRA 2PFNA 4M04A 4YXJA 4C0ZA 3L5KA 4DL5A 1A0PA 4GLXA 1NJZA 3LWMA 3BS5A 1IV8A 3B0XA 5HMMA 3OPXA 4O5KA 3C2LA 1D8YA 1DRGA 4PZNA 4DQSA 5EE0A 1YZ6A 3PSPA 2XIDA 4B9LA 1SZHA 3OSNA 3SZ2A 3F2CA 3C21A 2XGQA 5DG7A 1NK8A 4I2HA 4ED7A 2W55A 3SV4A 3KTQA 5J2KA 5JRTA 3G6YA 8ICZA 2F8KA 3F53A 3GQCA 4YMOA 3AU2A 5KFUA 3TACB 5EE1A 4GC6A 3PW7A 5DB6A 1RM6C 4QZ9A 3RRGA 2ZUBA 2W3SA 3TI0A 4EX7A 9ICEA 2RDJA 3SAHA 2LI6A 2WAQF 9ICKA 2BDUA 2KOBA 5KG4A 1OW5A 4QWCA 4I2JA 2VANA 3E58A 3DEEA 1FEZA 3Q8KA 4UAUA 4RQ4A 2XI9A 3AM9A 5KG3A 3K75D 1ZQSA 3PMNA 3C28A 3CP8A 1XSNA 4O3RA 2W9BA 4B9UA 4C8KA 1B43A 2Y1JA 4M9HA 2R18A 3A0BU 3QUQA 4MFAA 7ICHA 3H8SA 4C7ZA 5GTHU 3C1ZA 5KFBA 4JMUA 4BWMA 4BX9C 2MSNA 3LVVA 2QB1A 4M9NA 5KG0A 2CRXA 1ZQRA 1L8LA 1XNSA 2HHTA 4DO9A 2XY7A 1Q3UA 3HRDD 1CEZA 1RZTA 3QU9A 2FLLA 4DQRA 1ZQCA 3PW5A 2E8PA 4C7YA 1OUQA 5DQIA 4MFFA 4TURA 1DK2A 4C8LA 1ECWA 3LK9A 4O5CA 2OXOA 4QWBA 5KFHA 5KL1B 2WF9A 3G6XA 4ACOA 4PHEA 3KHGA 2HOFA 4CRXA 4O9MA 5IIJA 3O0FA 2RRDA 2AGOA 3QUCA 2HW3A 1URJA 4UQGA 2BGWA 4B9VA 4IC9A 4CF4A 3Q8MA 5FP0A 4R65A 9ICSA 4ECSA 3R9KA 5DDYA 3AMZA 3GIIA 1C7YA 2JH1A 2I1QA 4P0QB 1JUDA 1ZQWA 4OJ5A 4B9TA 5ALHA 5CHGA 4DL2A 4NL9C 1X6JA 2MU2A 4TUQA 3M1YA 4JWMA 3D2SA 3RJIA 2JH7A 5J0SA 5TISU 3SQIA 2KICA 1S76D 2IOHA 4QWDA 4KLIA 4ELVA 4M6WB 1WCNA 3A0HU 1ZJMA 2JR5A 3M6KA 3V7LA 1LB2B 2F76X 5ALWA 3WKCA 3RJGA 4KLUA 4IL6U 1WYGA 4RQNA 2XCAA 5AI8A 2PFOA 3ZDEA 3ZDCA 5ALUA 2F1HA 3D2NA 5HMLA 5F9NA 8ICEA 2BPCA 1SV4A 4P4MA 3SYZA 3H0LB 5KFQA 2E8NA 1BPEA 3E0FA 5J0XA 9ICMA 3PV8A 5KFCA
chains in the Genus database with same CATH topology
3LVVA 4NLCA 4C0ZA 2ZIUA 2CRXA 2ZIVA 2PMZC 4OJLA 1A0PA 1XNSA 4O3MA 2H3FA 4FE3A 4KMOB 4FZNA 4NLBA 4CDGA 1D8BA 1Q3UA 2YB1A 3KZXA 4NWIA 2G07A 2ZIUB 3NUQA 2LYBA 2ZIVB 2HBJA 3OPXA 2KJ8A 1ZQ1C 3SMVA 1DRGA 2HOIA 4BUGA 3VC8A 3ONNA 2HBMA 2K8AA 2XIDA 2WAQC 3HKZC 3PSPA 1OUQA 1SZHA 2A3VA 2LHTA 2PMZF 2K4HA 3F5AA 2HBLA 3L3FX 3F2CA 5CRXA 3AL0B 3CYMA 3H0MB 2ZIWB 2JHDA 2GH1A 2NV3A 2XICA 2MA1A 1ECWA 4OJ6A 2OXOA 2G09A 1NZBA 1KBUA 2RHFA 5C0YA 4KX3A 2F77X 2KKPA 5KL1B 3CRXA 4ACOA 4PL1A 3M6ZA 1PVPA 3IN5A 2H3IA 3H0RB 2G5HB 2RP5A 3AQFA 3F53A 2HOFA 4CRXA 3C29A 4P0PA 5HR7A 3LVWA 5HR6A 3N7RC 3O0FA 3IG5A 2RRDA 2OM6A 3SAGA 3T79A 4KX5A 5A0LA 1URJA 2Y0SC 4QIWC 2G0AA 2ZIWA 3PSFA 1XO0A 2KJ5A 1CRXA 4IC9A 2KD1A 3D2QA 4P0PB 2H3ZA 1F44A 2K4EA 4P0QA 1Q3VA 1IIPA 1WUDA 2E1FA 2ZXHA 2K8BB 1PVQA 1TAMA 2G08A 4U7CA 2E5SA 1HEKA 2JH1A 4OJPA 4U6PA 5T14A 4P0QB 3RFAA 2JMGA 2KVCA 4QIWF 3PZPA 4OJ5A 3AQEA 2W03A 2ZIXA 3SAHA 2WAQF 3HKZF 2G5IB 2BDUA 2WB1C 2KOBA 2YX8A 4QJFB 3GZFA 2JGAA 2GOLA 4WJ3B 3N7SC 1YT3A 4GFJA 3D2SA 2KHQA 2D6FC 3GU3A 1Z19A 2H3VA 2ZIXB 1A6SA 2KKVA 4A8EA 4BJQA 2JH7A 4AYBC 2W7PA 3DEEA 4FZMA 5KL8B 3SQIA 2OH2A 2K8CB 1ED1A 2KICA 3ICXA 4ICAA 3RF9A 1L6NA 2LYAA 2DGZA 1Z1BA 3MGVA 2G06A 2XI9A 2KHVA 3VCBA 2F2AB 1MA7A 3KFUF 2Q4TA 2M0NA 4FZLA 1P7DA 2HOQA 2OYYA 2Z7JA 2KV2A 2K4IA 4OJOA 2KEYA 3C28A 3CP8A 4PL2A 3ALRA 3M6KA 3IP4B 4QNLA 4AYBF 2Y0SF 3PSIA 3F2DA 2VJ4A 2HMXA 2F76X 2LKYA 2KNJA 1HIWA 2N1RA 3NRWA 2W04A 1PVRA 2E1EA 2VIXA 2LBOA 3N7PD 3M7DA 1T94A 2KIWA 2DF4B 2KJ9A 2VJ5A 1UPHA 3F5EA 2DQNB 2F8LA 1GO3F 3PSTA 2CN1A 2CPRA 2R18A 3SAFA 4OO1J 3K1ZA 2W7OA 2XVTA 2YB4A 3D2NA 3F2BA 4NV0A 2HBKA 2ZG6A 2ZXIA 3H0LB 3LYSA 2H3QA 2MRLA 2K89A 2WB1F 3E0FA 2VKQA 3IG8A 4JMUA 4CGZA 4BX9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2S A;  3D2N A;  3D2Q A;  2E5S A; 
#chains in the Genus database with same CATH topology
 2F44 A;  3T5H A;  4Q45 A;  4DLG A;  3DV9 A;  4NWI A;  4UAZ A;  5CR0 A;  1UHU A;  3C23 A;  2KP7 A;  1HUO A;  3MR3 A;  7ICL A;  5CRX A;  2VA2 A;  3UMB A;  1TV9 A;  4KLD A;  1NNL A;  1NKB A;  4JWN A;  5F9L A;  2H3I A;  4F71 A;  4BWJ A;  4LZD A;  9ICL A;  3UMC A;  4YXM A;  4BGD A;  4EZ9 A;  2OM6 A;  1COO A;  1PK1 B;  4P0P B;  4YFK A;  2EZZ A;  3IM1 A;  1DOQ A;  4ELU A;  2W11 A;  2Y9T A;  1HEK A;  1ZQB A;  4GXJ A;  4GXI A;  4YG2 A;  1UA1 A;  7ICS A;  1ZQF A;  2PFQ A;  1PZN A;  2YY6 A;  5L1J A;  3SEN A;  4O5E A;  9ICB A;  4RNN A;  1ED1 A;  2HHU A;  4F4Z A;  2LYA A;  1SIJ A;  3KHR A;  2HHX A;  2F2A B;  2KZZ A;  2M0N A;  1QSL A;  2C2D A;  7ICN A;  4QNL A;  2A1J B;  2LBO A;  2OCE A;  1DGJ A;  3RH6 A;  5KFJ A;  1NZP A;  1SKS A;  1WWU A;  2AGP A;  4F5Q A;  2ISP A;  5J2G A;  5GTI U;  2ZIU A;  4G3I A;  3RR7 A;  1BPB A;  5DB9 A;  2YML A;  4KMO B;  5J0P A;  4Z6F A;  2ZTC A;  3NUQ A;  3M8S A;  2ZIV B;  3PY8 A;  4EYI B;  1N5W A;  3VC8 A;  2FMP A;  1V85 A;  2HBM A;  2K8A A;  3N97 B;  7ICT A;  3L3F X;  4K4I A;  2ZIW B;  5EWE A;  3JPT A;  2K4P A;  9ICU A;  1SB3 C;  3PVX A;  2A19 A;  4B9M A;  3QEA Z;  1ZQA A;  2E3T A;  2R8G A;  2RP5 A;  3V6J A;  1KQQ A;  3RRH A;  2HDO A;  7ICP A;  3IG5 A;  1FO4 A;  3HP6 A;  2G0A A;  2ZIW A;  3MR2 A;  1XO0 A;  3H4B A;  3KHH A;  1PVQ A;  2EZY A;  4UB6 U;  4DF4 A;  5AIC A;  1ZQM A;  1Z00 B;  1ZRM A;  3QYP A;  3T5L A;  1SZP A;  4JV2 A;  3ZDD A;  1YT3 A;  2E8O A;  1N63 A;  2H3V A;  3ISB A;  4AYB C;  3GIK A;  3KFU F;  4IQU A;  2Q4T A;  4JV0 A;  4KMU A;  1SL1 A;  1KSP A;  8ICH A;  4C8M A;  1X2I A;  4F91 B;  4NLK A;  7ICU A;  2HMX A;  4ED6 A;  5ALV A;  3MR6 A;  3Q8R B;  2H5X A;  5HNK A;  1L7N A;  2DF4 B;  1T4G A;  2VJ5 A;  3WK5 A;  1SV0 A;  3FM9 A;  2EAP A;  5KFP A;  2YB4 A;  2KFZ A;  3OJS A;  5IIN A;  1Z3E B;  3KD3 A;  3WK4 A;  2NYV A;  1KKX A;  3IRU A;  4O3N A;  3WK8 A;  3NRZ A;  1ZQX A;  4FE3 A;  4NLB A;  5ALZ A;  1RXV A;  3SMV A;  2KJ8 A;  3PO4 A;  4UB2 A;  4I2D A;  4ECU A;  8ICV A;  2PMZ F;  4DSK A;  5AI6 A;  3AL0 B;  4RQ1 A;  1V97 A;  3ZD8 A;  5KNI A;  1X6I A;  3HIL A;  4DFD A;  1QLN A;  5DGA A;  3IN5 A;  5K4L A;  4UAY A;  3OSP A;  1RPL A;  5AKH A;  4C4R A;  5AKY A;  4IRK A;  2XY6 A;  3C1Y A;  3OHB A;  2E1F A;  2CXY A;  1TAM A;  5F3X B;  4YP3 A;  4F2S A;  4I27 A;  1Z4O A;  3RFA A;  2KVC A;  4ED0 A;  2YN4 A;  2VA3 A;  2UVV A;  1KN5 A;  1J97 A;  4WJ3 B;  4KLS A;  2KHQ A;  3FYH A;  2HHV A;  3T5J A;  1T3N A;  5AM5 A;  4EEK A;  3BZK A;  2ODG A;  1XS9 D;  1N5X A;  5EWF A;  1Z1B A;  1O03 A;  1UQV A;  3NS1 A;  1JX4 A;  7ICR A;  1K1Q A;  5EE9 A;  2C2E A;  3RJK A;  2VJ4 A;  1JI7 A;  1X9S A;  2BZF A;  4LVS A;  3RJE A;  2YMM A;  8ICN A;  1FFV A;  3HT3 A;  3GIJ A;  3TAR A;  5ALK A;  4UB1 A;  3RH5 A;  5KT7 A;  2W54 A;  2HCF A;  1QCK A;  2ZG6 A;  7ICG A;  1QTM A;  2KSO A;  4DL3 A;  2WF7 A;  1QQ6 A;  2K89 A;  4Z6C A;  4F5P A;  4Z6D A;  2HHQ A;  1Z1V A;  2W9C B;  1Q46 A;  4O3Q A;  8ICM A;  2JEJ A;  3TAQ A;  4YD1 A;  2A1A A;  4EX6 A;  1MQ3 A;  3EW9 A;  4P4P A;  5KFO A;  4F2R A;  1L3V A;  3BS5 B;  5AK4 A;  3TFS A;  8ICB A;  3CYM A;  7ICM A;  3H0M B;  2EZX A;  2L5Y A;  2RHF A;  4JUZ A;  3WKB A;  1AQ6 A;  2AJQ A;  3AQF A;  2KTQ A;  3PX4 A;  5L1I A;  7ICJ A;  3LVW A;  3HWT A;  1ZXI A;  3M9O B;  3THV A;  3PSF A;  4UBB A;  4PGX A;  5AKZ A;  2F1J A;  2K4E A;  4CF5 A;  1JXE A;  4US9 A;  2UVW A;  2G08 A;  3U26 A;  4OJP A;  2JEF A;  4Z6E A;  5KTQ A;  1U48 A;  4BXO A;  5KFS A;  1ZQU A;  4TUS A;  2WB1 C;  2W8K A;  1X42 A;  4IQV A;  1K1S A;  2ZTD A;  4J9P A;  4GFJ A;  4NLG A;  3GU3 A;  1Z19 A;  5J2B A;  1ZRN A;  1XC9 A;  4PJ0 U;  2JV3 A;  3ZDB A;  5ALL A;  4F50 A;  5H2F U;  2G06 A;  4UBC A;  1B4F A;  2W8L A;  1KL9 A;  3ETL A;  1WG8 A;  4YR3 A;  1X9W A;  2QLT A;  3PW4 A;  3H40 A;  4GIB A;  4UB4 A;  1O08 A;  3KHL A;  2BHN A;  4TUP A;  4EZ6 A;  2J6S A;  2E1E A;  2VIX A;  4J9R A;  2KJ9 A;  2Y9U A;  4RUA A;  2NRT A;  2W9B B;  2DBY A;  3Q8L A;  1TKD A;  2W7O A;  1DXS A;  1HJP A;  2KIV A;  9ICN A;  3LYS A;  4C4T A;  2VKQ A;  4BDP A;  5III A;  4CDG A;  4KLT A;  3OGU A;  4YD2 A;  2LYB A;  1MSW D;  2XY5 A;  4I2G A;  5DQG A;  5AI9 A;  3HX0 A;  4NM1 A;  3FAH A;  4GC7 A;  1KLN A;  1ZD5 A;  3QU7 A;  3UM9 A;  3F5A A;  4OD0 A;  3Q8Q B;  3PR4 A;  3NVY A;  2NV3 A;  2XIC A;  1NZB A;  8ICR A;  7ICF A;  4KX3 A;  3GDX A;  1TK5 A;  3CRX A;  2RDI A;  4R64 A;  3OHA A;  3QU2 A;  1A76 A;  2G5H B;  3AUO A;  3LWL A;  4DSE A;  4QWE A;  4I2A A;  5L1M A;  1SKR A;  4XA5 A;  2XGP A;  1V9P A;  2B6G A;  1KFT A;  4U7C A;  4RPX A;  4RQ8 A;  3Q8P B;  9ICO A;  5EOZ A;  4QIW F;  4MF8 A;  3PZP A;  2W03 A;  1L7O A;  2G5I B;  2HI0 A;  2HHS A;  3GZF A;  1BNP A;  4NY8 A;  2IA6 A;  5ALS A;  2D6F C;  3H4D A;  2QAR A;  2KKV A;  3EPI A;  4A8E A;  4KLG A;  2W7P A;  3WKA A;  2OH2 A;  4Y2J A;  2QKQ A;  4FS1 A;  3ICX A;  3RF9 A;  2UVU A;  3OJU A;  1NI3 A;  3SEI A;  5KG2 A;  1EXN A;  2KG5 A;  4ECW A;  3B0Y A;  1T8E A;  3PX0 A;  2K4I A;  3WK6 A;  1JN3 A;  3ZDA A;  5KFE A;  9ICQ A;  4QW9 A;  5DGB A;  3H8W A;  2W04 A;  4RU9 A;  5DG9 A;  3N28 A;  4ECY A;  2VA8 A;  5DB8 A;  2AGQ A;  5ALJ A;  5ALD A;  5ALQ A;  4J9M A;  2WB1 F;  2C22 A;  3IG8 A;  1S8O A;  4TQR A;  5AI4 A;  5C5J A;  1BPD A;  3BQ7 A;  4US8 A;  3V7J A;  5EE3 A;  2WF8 A;  2J6T A;  5KFY A;  1S0N A;  3BS7 A;  3MGH A;  4YMM A;  5ALR A;  2HBJ A;  4Q8F A;  3QZ7 A;  5AHX A;  2KVS A;  4ED1 A;  4P4O A;  2ASD A;  4TQS A;  1S0O A;  3V6H A;  4M47 A;  1N60 A;  2ALZ A;  3PW2 A;  5C0Y A;  2GLE A;  1U49 A;  4E0D A;  1XO1 A;  4O3P A;  1FIQ A;  5ALI A;  1D9D A;  1U4B A;  4R8U A;  3RB4 A;  4IR1 A;  2NO4 A;  2AH5 A;  2F1I A;  1PUZ A;  4KLF A;  3Q8S B;  1ZQN A;  4F5O A;  4DFP A;  1UA0 A;  4MEY A;  4PZO A;  2BQ3 A;  1TE2 A;  2BQR A;  2BDP A;  2ZIX A;  1YZ7 A;  2JEG A;  3CNH A;  4R66 A;  8ICF A;  2GOL A;  5KAF U;  1SL2 A;  1S0M A;  5DBB A;  5KT2 A;  5AKG A;  4EEL A;  4BJQ A;  3KKA C;  3PNC A;  3PML A;  5DQH A;  2DGZ A;  4O0I A;  3VCB A;  2HSZ A;  3IDW A;  2OYY A;  1X9X A;  2NRZ A;  1CI4 A;  3LDA A;  3QXG A;  3UMG A;  5AI0 A;  1SKW A;  4J9S A;  1U47 A;  3PSI A;  3F2D A;  4GXK A;  1PVR A;  1T94 A;  2KIW A;  3RBE A;  5EWG A;  4QWA A;  4OO1 J;  1ZQI A;  4J03 A;  2HVI A;  1QSY A;  3TAD C;  4Y2R A;  4QZE A;  4UAS A;  1ZQD A;  2DWQ A;  5KFZ A;  4Q8E A;  2PMZ C;  3EYZ A;  3IHQ B;  5J0R A;  2YB1 A;  3EWA A;  2ZIU B;  5KT6 A;  4NXZ A;  9ICA A;  4EBC A;  2HOI A;  7ICK A;  4CF3 A;  1UCV A;  2ZJA A;  4PHP A;  3ONN A;  1NK9 A;  4IRD A;  2FLN A;  4RQ6 A;  2XO7 A;  2AQ4 A;  3UXP A;  2NO5 A;  3C2M A;  3FDS A;  4J9K A;  7ICI A;  2IHM A;  4EEY A;  2GH1 A;  2D8C A;  4XRH A;  5KFI A;  2HHW A;  4Y2T A;  1L8O A;  8ICC A;  3C29 A;  2LM1 A;  2IOF A;  4YVZ A;  7ICE A;  2BPG A;  3T79 A;  2Y0S C;  2BCS A;  1JXL A;  3C5G A;  3RJF A;  2JZB A;  2DUY A;  3AU6 A;  2K8B B;  1FFU A;  5ALT A;  2I6X A;  3UPQ A;  2ES6 A;  4U6P A;  4QZA A;  3WU2 U;  5J2A A;  1L3S A;  5AKL A;  1ZQT A;  2JGA A;  3N7S C;  2JRZ A;  2ESE A;  2Y1I A;  1B0X A;  1KEJ A;  4FZM A;  4KLH A;  4JB3 A;  4QZB A;  4O3S A;  5TZV A;  2GO7 A;  1L6N A;  3NVW A;  2FE9 A;  5KG6 A;  2RLT A;  1TAU A;  4FZL A;  4DQQ A;  5ALM A;  4HAI A;  4K4G A;  2P6R A;  4UAV A;  3L4P A;  3ED5 A;  3RBD A;  2DPI A;  2CN1 A;  2CPR A;  4FBU A;  1XWL A;  5AM1 A;  3F2B A;  5KG5 A;  1J2N A;  1L5U A;  4RPY A;  9ICF A;  4EEN A;  4DSL A;  2FDR A;  2H3F A;  1C20 A;  4J9N A;  4ECQ A;  4XQ8 A;  1NKE A;  1ZQG A;  5KFG A;  5DBA A;  1NOM A;  5J2I A;  9ICC A;  2HBL A;  5DLF A;  5ALF A;  3JPR A;  1LKY A;  3PW0 A;  4YQW A;  8ICP A;  1U9L A;  3QEB Z;  4MEX A;  1ZD3 A;  2AXT U;  1K5O A;  5J0U A;  2AHO B;  5AKI A;  3GV5 B;  2UVR A;  5HR7 A;  4YN4 A;  8ICY A;  5ALY A;  4DSJ A;  4NL9 A;  3SAG A;  8ICA A;  3GFK B;  2BR0 A;  1SWW A;  2FJ6 A;  1TK0 A;  4RZR A;  3RAQ A;  3RB3 A;  2D3D A;  1JRP A;  4F4X A;  2WFA A;  1S97 A;  2W43 A;  1L3U A;  1BPY A;  8ICS A;  1S5L U;  2YQE A;  3D6J A;  1PK3 A;  2FPM A;  2KHV A;  1TK8 A;  2K60 A;  3MFI A;  8ICL A;  7ICO A;  3ALR A;  2Y0S F;  5KFR A;  4IQW A;  4CNQ A;  4I2E A;  2ISO A;  2PKE A;  3GIM A;  1X40 A;  3DDH A;  3MC1 A;  3NGD A;  5G5H A;  4NV0 A;  1VDV A;  3RAX A;  1ZD4 A;  4R63 A;  2ZJ8 A;  2MAX A;  4DQP A;  3QUT A;  2EDU A;  1XU4 A;  2KSO B;  5J2J A;  2FI1 A;  2KK0 A;  3KZX A;  2G07 A;  2AQ0 A;  1NKC A;  4ECT A;  4DF8 A;  5CJ7 A;  1V38 A;  4ECZ A;  2A3V A;  9ICP A;  4F4K A;  2V9W A;  4I28 A;  5ALE A;  2QB0 A;  2IBK A;  5HHH A;  4I2F A;  2ASJ A;  1T3Q A;  2MUT A;  3RR8 A;  1S77 D;  4RNO A;  4UAW A;  4DSI A;  3JPN A;  1RYS A;  4UB3 A;  4QIW C;  4PGY A;  1L3T A;  4DCC A;  1ZET A;  4G9B A;  1NK6 A;  5B5E U;  1QSS A;  4FBT A;  4C80 A;  3GV8 B;  5AKX A;  3GIL A;  1Q8K A;  3V72 A;  5T14 A;  2JMG A;  3GV7 B;  4NM2 A;  2YX8 A;  4QJF B;  1QQ5 A;  5G5G A;  3BQ2 A;  4ELT A;  4BXO B;  2O6K A;  5DB7 A;  5KFM A;  4F92 B;  2V4Q A;  1ZQV A;  4P2H A;  2DKX A;  5DG8 A;  1KFD A;  1BGX T;  3UXO A;  9ICR A;  1SWV A;  5J2C A;  1KTQ A;  9ICI A;  2Z7J A;  4YCX A;  1QQ7 A;  4PL2 A;  3IP4 B;  3KOO A;  4Y2Y A;  1F5S A;  2N1R A;  4DWI A;  3M7D A;  1ZQK A;  3F5E A;  2DFL A;  3UXN A;  3RTV A;  9ICW A;  1IM4 A;  4RUC A;  3K1Z A;  4ED3 A;  2BCQ A;  9ICH A;  3ETR A;  1DGS A;  4DEZ A;  2YTU A;  4UAR A;  2B0C A;  1Z4N A;  2W9A A;  1ZQ1 C;  4ZH4 A;  5KFL A;  1SL0 A;  2LHT A;  5ALX A;  2XC9 A;  2V4R A;  5E79 U;  3RJH A;  1BNO A;  5BOM A;  4DOA A;  2JHD A;  3E2E A;  1DK3 A;  3PO5 A;  3M6Z A;  2NRX A;  4ED8 A;  9ICJ A;  1BPX A;  2WF6 A;  3QU5 A;  4OCZ A;  2OEH A;  5J0W A;  2KJ5 A;  3BDP A;  3D2Q A;  3KBB A;  2EAN A;  4X5V A;  4PPX A;  1KW4 A;  1Q3V A;  1WUD A;  2ZXH A;  4DS5 A;  4UB8 U;  8ICG A;  3QNM A;  1S10 A;  5HHI A;  2E5S A;  4DS4 A;  3WK9 A;  3NAS A;  2BKE A;  3EZ5 A;  3RH4 A;  4Y2X A;  2J6U A;  4RNM A;  2BCR A;  5KT4 A;  5J2F A;  1KDH A;  1KRP A;  3H8J A;  2QAR B;  4I2C A;  3PR5 B;  3MGV A;  4JV1 A;  4HYK A;  4DFK A;  4FO6 A;  1JRO A;  1P7D A;  4M9J A;  4ECV A;  9ICV A;  2KNJ A;  5KT5 A;  4RQ7 A;  5J0O A;  3H7I A;  4USA A;  1A77 A;  1UPH A;  2DQN B;  2RQ5 A;  1GO3 F;  1QH9 A;  2OHF A;  3SAF A;  2YMQ A;  2ZUC A;  2XVT A;  1ZQL A;  8ICJ A;  3T3F A;  4F3O A;  2HBK A;  2JEI A;  2ZJ5 A;  5KFD A;  4MF2 A;  3I28 A;  2I9G A;  2KMD A;  3NVV A;  4JK1 A;  4PH5 A;  1SV0 C;  3I76 A;  2KFN A;  8ICO A;  4LZG A;  3C2K A;  4I29 A;  5KFA A;  1RYU A;  1H38 A;  4NJ8 A;  3WKE A;  2BCV A;  4Y2S A;  4QZC A;  4Y2Q A;  1RQN A;  2IHN A;  1M6Y A;  4DOB A;  2PXI A;  1MC8 A;  2KKP A;  3SV3 A;  1PVP A;  5DKW A;  3H0R B;  4Y2V A;  1U45 A;  4B9S A;  3N7R C;  1T7P A;  1IXR A;  4KX5 A;  5A0L A;  4UAT A;  4R8U B;  3MAB A;  4P0Q A;  1IIP A;  1TAQ A;  5AIA A;  5J0Q A;  5CB1 A;  5J0T A;  1ZQH A;  5KFV A;  4DL6 A;  5AK6 A;  4UB5 A;  4DL4 A;  4KN4 A;  1N48 A;  5IIM A;  3PX6 A;  1S0V A;  2ZIX B;  3RB0 A;  1ZQQ A;  8ICQ A;  4CCH A;  4M6W A;  3MFH A;  4M9L A;  4EBE A;  9ICT A;  4RT3 A;  1VLB A;  2HOQ A;  2KV2 A;  4FFD A;  3G6V A;  3SI8 A;  5KG7 A;  3ISC A;  4IS7 A;  1B22 A;  1RG6 A;  4F72 A;  2C28 A;  5J0Y A;  1TVA A;  2F8L A;  2JXJ A;  4DFJ A;  2R8J A;  5KFW A;  4J9L A;  2ZTE A;  4NLC A;  1NJW A;  3UQ2 A;  4C8O A;  2FLP A;  5J8Y C;  4M0A A;  1D8B A;  4NLZ A;  3BZC A;  4PHD A;  3MBY A;  7ICQ A;  1D9F A;  4O3O A;  4NLN A;  8ICK A;  7ICV A;  3SD7 A;  3IV6 A;  2ATL A;  3HKZ C;  4KLJ A;  2C2R A;  3TKA A;  3EUB 2;  3ZI4 A;  3T5K A;  8ICU A;  2MA1 A;  4OJ6 A;  1N62 A;  2YMP A;  2G09 A;  4RQ2 A;  5AKJ A;  3RJJ A;  1UT5 A;  2ZUD A;  4DFM A;  1NJY A;  3OTQ A;  4PL1 A;  1ZQE A;  1CUK A;  5AKK A;  1NK7 A;  1N61 A;  1PK1 A;  4P0P A;  3MDA A;  1BVS A;  4DQI A;  4KLO A;  5ALG A;  1CRX A;  3MDC A;  4F5R A;  8ICT A;  1F44 A;  2NRW A;  2R8I A;  2LM4 A;  3V7K A;  1JIH A;  4KTQ A;  1RXW A;  2KZ3 A;  3QE9 Y;  4IQT A;  3SR6 A;  4QZ8 A;  2JZB B;  1BPZ A;  2FMS A;  4QZI A;  1COK A;  3HW8 A;  2FMQ A;  1L7P A;  5D49 A;  1A6S A;  1NK0 A;  3JPS A;  3NTU A;  4EYH B;  2OWO A;  5KL8 B;  2K8C B;  4XUS A;  1L7M A;  3NVZ A;  3JPQ A;  4ZOH C;  5L1K A;  4F93 B;  1VJ5 A;  1MA7 A;  5KG1 A;  3FC4 A;  3KZI U;  2A1J A;  4F5N A;  3JPP A;  4FS2 A;  2KEY A;  4ECR A;  3MGI A;  3AN1 A;  5CA7 A;  4QZF A;  4KIT B;  2EAM A;  4F4W A;  3HJE A;  3N7P D;  3C5F A;  5AIB A;  5L9X A;  4KLL A;  3PST A;  2PFP A;  5IIK A;  5AI5 A;  3JPO A;  5KT3 A;  4C8N A;  1RDF A;  2ZXI A;  2MRL A;  2R8K A;  2FPK A;  4CGZ A;  2WF5 A;  1Y88 A;  5BPC A;  2ZIV A;  3HPO A;  3V6K A;  4O3M A;  1WCL A;  2B21 A;  2LPE A;  8ICI A;  1RYR A;  4DL7 A;  4BUG A;  5CEH A;  4M2Y A;  4I2I A;  4YR0 A;  1ZYQ A;  5L1L A;  2WHE A;  5JTI A;  4Y2P A;  5J2E A;  1LVH A;  4UW9 A;  4KN7 A;  4C4S A;  3BQ1 A;  1IG6 A;  5J29 A;  1LKY B;  3H8M A;  4CE6 A;  5HP4 A;  1JMS A;  2EQY A;  4RT2 A;  2IMW P;  3TAN A;  3QUB A;  2KE7 A;  9ICX A;  2E8M A;  2R8H A;  4ED2 A;  2H3Z A;  1ZQP A;  1X66 A;  1SXE A;  2EAO A;  1NK5 A;  1Z00 A;  4MFC A;  3B9J A;  2P6U A;  3TAP A;  2IOF K;  3HKZ F;  5KFT A;  5J2D A;  4Q44 A;  5AK3 A;  5JU5 A;  3I1Y A;  2DPJ A;  1ZJN A;  2PI4 A;  3EPG A;  1ZQY A;  5DLG A;  4EBD A;  4ICA A;  5D46 A;  4IRC A;  4YR2 A;  1J2M A;  5KFX A;  4PGQ A;  3K4G A;  4QZG A;  4J9Q A;  1ZQO A;  1XSP A;  2BPF A;  1XSL A;  5KFN A;  8ICX A;  2GWS A;  1MN8 A;  3WK7 A;  2P35 A;  5CWR A;  4B9N A;  4RQ0 A;  3M9N B;  1HIW A;  3RB6 A;  5IIL A;  2KZM A;  3TQ1 A;  4Q43 A;  2LYH A;  3UQ0 A;  4RQ5 A;  1ZQZ A;  5AM4 A;  5KAI U;  1N2X A;  5AM0 A;  3CW2 C;  2I5H A;  5DDM A;  3WKD A;  4MHV A;  1ZQJ A;  4OJL A;  3QZ8 A;  4FZN A;  1HUZ A;  4J9O A;  5AK5 A;  4F4Y A;  4DSF A;  4DOC A;  3ZD9 A;  1MQ2 A;  2WAQ C;  4LJX A;  2F3N A;  5KFF A;  8ICW A;  2K4H A;  5ALN A;  4QW8 A;  3MR5 A;  4DLE A;  5AM3 A;  3N4M B;  1ZOL A;  4KLQ A;  5IIO A;  4KLM A;  4PHA A;  1RQL A;  1KBU A;  2DKZ A;  2F77 X;  2AU0 A;  4RQM A;  2QB0 B;  5AKE A;  9ICG A;  4AP9 A;  3M8R A;  2MUT B;  5ALO A;  2EH9 A;  5HR6 A;  1JAL A;  2WTF A;  2FPL A;  1ZD2 P;  4F8R A;  2KD1 A;  1S9F A;  3AEV A;  4RQ3 A;  4M9G A;  1LV5 A;  3KKA A;  1KFS A;  1ARO P;  3S6J A;  1SGG A;  3BQT A;  2BQU A;  1NK4 A;  3ISD A;  3AQE A;  4K4H A;  3QU4 A;  1NJX A;  5J8Y A;  2W3R A;  3TFR A;  1N56 A;  1X9M A;  4IR9 A;  4KLE A;  5J2H A;  4RPZ A;  2KN7 A;  3M9M B;  4B6J A;  2P66 A;  1SXD A;  5CP2 A;  4QZD A;  1D8L A;  4YMN A;  4QZH A;  1WWV A;  5B66 U;  5KFK A;  3TAD A;  2BCU A;  5JUM A;  5D4B A;  1OXJ A;  4OJO A;  1UT8 A;  4AYB F;  4I2B A;  2M9N A;  2LKY A;  3NRW A;  4Y2U A;  2ASL A;  2W9M A;  2DL0 A;  2Q0Z X;  3J81 j;  3QX7 A;  2NRV A;  3BJY A;  4ECX A;  5AM2 A;  1TFR A;  3ORY A;  3K1R B;  5DBC A;  2XCP A;  2W9C A;  1F0M A;  2PI5 A;  2HVH A;  5BOL A;  3BQ0 A;  2H3Q A;  5ALP A;  2LMR A;  2PFN A;  4M04 A;  4YXJ A;  4C0Z A;  3L5K A;  4DL5 A;  1A0P A;  4GLX A;  1NJZ A;  3LWM A;  3BS5 A;  1IV8 A;  3B0X A;  5HMM A;  3OPX A;  4O5K A;  3C2L A;  1D8Y A;  1DRG A;  4PZN A;  4DQS A;  5EE0 A;  1YZ6 A;  3PSP A;  2XID A;  4B9L A;  1SZH A;  3OSN A;  3SZ2 A;  3F2C A;  3C21 A;  2XGQ A;  5DG7 A;  1NK8 A;  4I2H A;  4ED7 A;  2W55 A;  3SV4 A;  3KTQ A;  5J2K A;  5JRT A;  3G6Y A;  8ICZ A;  2F8K A;  3F53 A;  3GQC A;  4YMO A;  3AU2 A;  5KFU A;  3TAC B;  5EE1 A;  4GC6 A;  3PW7 A;  5DB6 A;  1RM6 C;  4QZ9 A;  3RRG A;  2ZUB A;  2W3S A;  3TI0 A;  4EX7 A;  9ICE A;  2RDJ A;  3SAH A;  2LI6 A;  2WAQ F;  9ICK A;  2BDU A;  2KOB A;  5KG4 A;  1OW5 A;  4QWC A;  4I2J A;  2VAN A;  3E58 A;  3DEE A;  1FEZ A;  3Q8K A;  4UAU A;  4RQ4 A;  2XI9 A;  3AM9 A;  5KG3 A;  3K75 D;  1ZQS A;  3PMN A;  3C28 A;  3CP8 A;  1XSN A;  4O3R A;  2W9B A;  4B9U A;  4C8K A;  1B43 A;  2Y1J A;  4M9H A;  2R18 A;  3A0B U;  3QUQ A;  4MFA A;  7ICH A;  3H8S A;  4C7Z A;  5GTH U;  3C1Z A;  5KFB A;  4JMU A;  4BWM A;  4BX9 C;  2MSN A;  3LVV A;  2QB1 A;  4M9N A;  5KG0 A;  2CRX A;  1ZQR A;  1L8L A;  1XNS A;  2HHT A;  4DO9 A;  2XY7 A;  1Q3U A;  3HRD D;  1CEZ A;  1RZT A;  3QU9 A;  2FLL A;  4DQR A;  1ZQC A;  3PW5 A;  2E8P A;  4C7Y A;  1OUQ A;  5DQI A;  4MFF A;  4TUR A;  1DK2 A;  4C8L A;  1ECW A;  3LK9 A;  4O5C A;  2OXO A;  4QWB A;  5KFH A;  5KL1 B;  2WF9 A;  3G6X A;  4ACO A;  4PHE A;  3KHG A;  2HOF A;  4CRX A;  4O9M A;  5IIJ A;  3O0F A;  2RRD A;  2AGO A;  3QUC A;  2HW3 A;  1URJ A;  4UQG A;  2BGW A;  4B9V A;  4IC9 A;  4CF4 A;  3Q8M A;  5FP0 A;  4R65 A;  9ICS A;  4ECS A;  3R9K A;  5DDY A;  3AMZ A;  3GII A;  1C7Y A;  2JH1 A;  2I1Q A;  4P0Q B;  1JUD A;  1ZQW A;  4OJ5 A;  4B9T A;  5ALH A;  5CHG A;  4DL2 A;  4NL9 C;  1X6J A;  2MU2 A;  4TUQ A;  3M1Y A;  4JWM A;  3D2S A;  3RJI A;  2JH7 A;  5J0S A;  5TIS U;  3SQI A;  2KIC A;  1S76 D;  2IOH A;  4QWD A;  4KLI A;  4ELV A;  4M6W B;  1WCN A;  3A0H U;  1ZJM A;  2JR5 A;  3M6K A;  3V7L A;  1LB2 B;  2F76 X;  5ALW A;  3WKC A;  3RJG A;  4KLU A;  4IL6 U;  1WYG A;  4RQN A;  2XCA A;  5AI8 A;  2PFO A;  3ZDE A;  3ZDC A;  5ALU A;  2F1H A;  3D2N A;  5HML A;  5F9N A;  8ICE A;  2BPC A;  1SV4 A;  4P4M A;  3SYZ A;  3H0L B;  5KFQ A;  2E8N A;  1BPE A;  3E0F A;  5J0X A;  9ICM A;  3PV8 A;  5KFC A; 
#chains in the Genus database with same CATH homology
 3LVV A;  4NLC A;  4C0Z A;  2ZIU A;  2CRX A;  2ZIV A;  2PMZ C;  4OJL A;  1A0P A;  1XNS A;  4O3M A;  2H3F A;  4FE3 A;  4KMO B;  4FZN A;  4NLB A;  4CDG A;  1D8B A;  1Q3U A;  2YB1 A;  3KZX A;  4NWI A;  2G07 A;  2ZIU B;  3NUQ A;  2LYB A;  2ZIV B;  2HBJ A;  3OPX A;  2KJ8 A;  1ZQ1 C;  3SMV A;  1DRG A;  2HOI A;  4BUG A;  3VC8 A;  3ONN A;  2HBM A;  2K8A A;  2XID A;  2WAQ C;  3HKZ C;  3PSP A;  1OUQ A;  1SZH A;  2A3V A;  2LHT A;  2PMZ F;  2K4H A;  3F5A A;  2HBL A;  3L3F X;  3F2C A;  5CRX A;  3AL0 B;  3CYM A;  3H0M B;  2ZIW B;  2JHD A;  2GH1 A;  2NV3 A;  2XIC A;  2MA1 A;  1ECW A;  4OJ6 A;  2OXO A;  2G09 A;  1NZB A;  1KBU A;  2RHF A;  5C0Y A;  4KX3 A;  2F77 X;  2KKP A;  5KL1 B;  3CRX A;  4ACO A;  4PL1 A;  3M6Z A;  1PVP A;  3IN5 A;  2H3I A;  3H0R B;  2G5H B;  2RP5 A;  3AQF A;  3F53 A;  2HOF A;  4CRX A;  3C29 A;  4P0P A;  5HR7 A;  3LVW A;  5HR6 A;  3N7R C;  3O0F A;  3IG5 A;  2RRD A;  2OM6 A;  3SAG A;  3T79 A;  4KX5 A;  5A0L A;  1URJ A;  2Y0S C;  4QIW C;  2G0A A;  2ZIW A;  3PSF A;  1XO0 A;  2KJ5 A;  1CRX A;  4IC9 A;  2KD1 A;  3D2Q A;  4P0P B;  2H3Z A;  1F44 A;  2K4E A;  4P0Q A;  1Q3V A;  1IIP A;  1WUD A;  2E1F A;  2ZXH A;  2K8B B;  1PVQ A;  1TAM A;  2G08 A;  4U7C A;  2E5S A;  1HEK A;  2JH1 A;  4OJP A;  4U6P A;  5T14 A;  4P0Q B;  3RFA A;  2JMG A;  2KVC A;  4QIW F;  3PZP A;  4OJ5 A;  3AQE A;  2W03 A;  2ZIX A;  3SAH A;  2WAQ F;  3HKZ F;  2G5I B;  2BDU A;  2WB1 C;  2KOB A;  2YX8 A;  4QJF B;  3GZF A;  2JGA A;  2GOL A;  4WJ3 B;  3N7S C;  1YT3 A;  4GFJ A;  3D2S A;  2KHQ A;  2D6F C;  3GU3 A;  1Z19 A;  2H3V A;  2ZIX B;  1A6S A;  2KKV A;  4A8E A;  4BJQ A;  2JH7 A;  4AYB C;  2W7P A;  3DEE A;  4FZM A;  5KL8 B;  3SQI A;  2OH2 A;  2K8C B;  1ED1 A;  2KIC A;  3ICX A;  4ICA A;  3RF9 A;  1L6N A;  2LYA A;  2DGZ A;  1Z1B A;  3MGV A;  2G06 A;  2XI9 A;  2KHV A;  3VCB A;  2F2A B;  1MA7 A;  3KFU F;  2Q4T A;  2M0N A;  4FZL A;  1P7D A;  2HOQ A;  2OYY A;  2Z7J A;  2KV2 A;  2K4I A;  4OJO A;  2KEY A;  3C28 A;  3CP8 A;  4PL2 A;  3ALR A;  3M6K A;  3IP4 B;  4QNL A;  4AYB F;  2Y0S F;  3PSI A;  3F2D A;  2VJ4 A;  2HMX A;  2F76 X;  2LKY A;  2KNJ A;  1HIW A;  2N1R A;  3NRW A;  2W04 A;  1PVR A;  2E1E A;  2VIX A;  2LBO A;  3N7P D;  3M7D A;  1T94 A;  2KIW A;  2DF4 B;  2KJ9 A;  2VJ5 A;  1UPH A;  3F5E A;  2DQN B;  2F8L A;  1GO3 F;  3PST A;  2CN1 A;  2CPR A;  2R18 A;  3SAF A;  4OO1 J;  3K1Z A;  2W7O A;  2XVT A;  2YB4 A;  3D2N A;  3F2B A;  4NV0 A;  2HBK A;  2ZG6 A;  2ZXI A;  3H0L B;  3LYS A;  2H3Q A;  2MRL A;  2K89 A;  2WB1 F;  3E0F A;  2VKQ A;  3IG8 A;  4JMU A;  4CGZ A;  4BX9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...