2LM4A

Solution nmr structure of mitochondrial succinate dehydrogenase assembly factor 2 from saccharomyces cerevisiae, northeast structural genomics consortium target yt682a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
b'MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQEFSENKEKEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase assembly factor 2, mitochondrial
publication title Solution NMR structure of yeast succinate dehydrogenase flavinylation factor sdh5 reveals a putative sdh1 binding site.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2lm4A01
2JR5A 2LM4A 1X6JA 1X6IA 1PUZA
chains in the Genus database with same CATH superfamily
1ZQAA 2BZFA 2ISPA 2WHEA 1SWWA 3WK5A 1FFUA 2BHNA 2DL0A 3OGUA 5DGAA 4ED8A 2R8GA 1N5XA 2KK0A 4DFJA 3PMLA 5J0SA 4Y2TA 4YFKA 5HMMA 1Z4NA 4Q43A 4JV1A 2LYBA 2QB0A 4P4MA 1KFTA 1ZD5A 5D4BA 3UQ2A 1NZBA 4O3QA 3D2SA 4GC6A 4DL3A 2DWQA 2IMWP 4F4WA 9ICMA 3ORYA 2KE7A 4P4OA 2FMSA 1ZQDA 2GLEA 4U6PA 1N61A 5EOZA 4O3MA 1X2IA 4TUQA 1BNPA 1UCVA 1B4FA 1D8BA 2W8KA 1HUOA 3GU3A 2C22A 4Y2XA 1KRPA 1SXEA 1ZOLA 3NVZA 2KVSA 2R8JA 2KKPA 3C5FA 2KP7A 3G6YA 2EANA 1PVQA 3BJYA 4O5EA 4M47A 2J6UA 4QWCA 1BVSA 4ED3A 1ZQWA 3IM1A 4AP9A 1D9FA 3HKZC 3JPPA 4EENA 2ASJA 3Q8QB 5FP0A 5ALEA 1JIHA 1JMSA 4M9JA 1XSLA 1CEZA 5J2EA 5AM4A 4C0ZA 3SEIA 2WFAA 2XIDA 3ED5A 5KAFU 3AL0B 4UAZA 2Y9UA 4KLOA 4ECRA 1L5UA 3UXPA 4RT2A 3M7DA 8ICWA 3BS5A 4XQ8A 1AROP 4XRHA 2G5IB 1QSYA 4F4ZA 3JPOA 4RNNA 2KVCA 4DWIA 4RUCA 5L1MA 2W9MA 2E5SA 4F3OA 3QUCA 2KNJA 2ASDA 5AM5A 1JUDA 1UHUA 1LKYA 1NK5A 3QUBA 4GIBA 4KLFA 3PX6A 2BDPA 3EZ5A 3RJEA 3UMGA 4PH5A 5L9XA 3C28A 3BS7A 2ATLA 3SZ2A 1WCLA 3H8MA 4DLGA 3BZCA 5KFEA 4IL6U 3SAFA 5KFTA 3GV5B 2N1RA 5J2BA 4I29A 2K4EA 2ZIXB 2RLTA 3KOOA 9ICNA 1PK1A 2A1JA 1KKXA 1ZQOA 2MA1A 2VA3A 5KFUA 5IIKA 4J9LA 3MDAA 5JRTA 4IRDA 3MR5A 1PZNA 3K4GA 8ICVA 3WKCA 2H3ZA 3OPXA 3IDWA 3AUOA 4F4YA 4YMNA 2G08A 1X40A 4NLGA 1COKA 1V9PA 4UQGA 2JEIA 3RBEA 3RJIA 4KLIA 4KMOB 5AKZA 2RDJA 4UAWA 1S10A 2ZXHA 4TURA 2KKVA 4KN4A 4B9MA 7ICLA 4QJFB 9ICKA 4RQ1A 8ICUA 4R8UA 2DKZA 2AU0A 2C2EA 3E0FA 9ICJA 1S0OA 1KEJA 4M9HA 4K4GA 2HW3A 2QB1A 4BUGA 4FZLA 3SAGA 2HMXA 2F1IA 7ICNA 5HP4A 4GXIA 3TADA 2D3DA 4ED6A 4ECWA 2F2AB 2W3SA 5J2JA 2YTUA 4FE3A 5J0OA 2AQ4A 1URJA 5J2DA 7ICUA 5DDYA 4ECQA 3ZDDA 5AM1A 2DPIA 3PR5B 2M9NA 4DL6A 3TFSA 4B9VA 1ZQJA 2KFNA 3ISBA 3MFHA 1S5LU 1X42A 3AEVA 1L7PA 1BPXA 1S76D 5J0PA 2KTQA 3V6HA 4EEKA 2R8KA 3M6KA 4QWDA 5IINA 3LK9A 5DB7A 4ECUA 1ZQGA 4C7ZA 3ZDCA 3WKEA 4I2JA 3NUQA 2Y1IA 8ICNA 4NY8A 4DFKA 1Q8KA 4QWEA 5J2HA 2XVTA 3AN1A 2Z7JA 2OEHA 2KOBA 3MR6A 2OYYA 4WJ3B 2D8CA 1C7YA 4I2BA 4I2HA 4ELUA 4Y2YA 4DOCA 1SV4A 3WK4A 9ICCA 4NLKA 2HBLA 2ZTCA 3AQEA 3C21A 1ZQLA 1TFRA 5DGBA 3RB4A 2C2RA 3V7LA 2H3FA 4F71A 1LKYB 1LV5A 3CP8A 3L5KA 2OH2A 2W11A 1N62A 4Q45A 1T3NA 1Z3EB 3C1YA 5J0RA 8ICBA 4MHVA 2UVVA 2KSOA 5H2FU 2KEYA 1RDFA 2PFQA 4R63A 1L3UA 3L4PA 3AQFA 3N4MB 4RPYA 1NNLA 1XU4A 5ALJA 4MFCA 1IG6A 4J9OA 1NZPA 2UVWA 1L8OA 4KX5A 2HSZA 4Y2PA 3Q8SB 1TK0A 2WF7A 4KLMA 3WKDA 2RHFA 4YN4A 2JEFA 5DDMA 2FLNA 5EWFA 3T5LA 4A8EA 4M9LA 5HHHA 2W54A 1PK1B 2A1JB 1XO0A 2YB1A 2BQRA 3PNCA 2CN1A 4RU9A 2R8HA 9ICWA 3ETLA 4F5QA 3KKAA 3PSFA 4FZMA 7ICGA 1U45A 3C2MA 1SWVA 3CNHA 4KLEA 4KLHA 5KT6A 2KJ8A 1MN8A 5J0XA 9ICGA 4QZBA 4QW8A 1RXVA 3SQIA 5AKLA 5EWGA 8ICIA 5J29A 2LHTA 4ICAA 2BCRA 5ALIA 1ZQPA 2R8IA 1NKCA 4Q8EA 1FFVA 1YT3A 4R8UB 1SXDA 2W04A 5KFKA 1PVRA 4P0PB 3F53A 4ECSA 5DLGA 5KFBA 5KFHA 4EBDA 5AIBA 1CUKA 3PW5A 3QNMA 7ICQA 2MRLA 4DFMA 3ALRA 3A0BU 3GIMA 4CF3A 2KHVA 1S0MA 3KZIU 3O0FA 3OSNA 2UVUA 2ZJ8A 4QZIA 1OW5A 9ICAA 4QZDA 4ZOHC 3J81j 4TUSA 3C29A 3DV9A 5KG5A 4DF4A 1S77D 9ICSA 1KW4A 3FYHA 1N5WA 1QQ5A 3ISDA 1QQ6A 3I76A 4Z6FA 1RYRA 4DFPA 2FPKA 5T14A 1Q46A 2WF6A 4PHAA 1X9WA 4I28A 7ICTA 2ZIWA 1L8LA 3A0HU 2IOHA 3PY8A 2EDUA 2JH1A 1YZ6A 2BPFA 1NI3A 1RYUA 2EZXA 5KNIA 5KG3A 3ZD9A 3TQ1A 3MGVA 2ZJ5A 3K1ZA 1Q3VA 4MEYA 4UB1A 1J2NA 3WKAA 4K4IA 4UB2A 2BQUA 1A6SA 5ALLA 1HEKA 5DKWA 5KG6A 5ALUA 5ALZA 5ALNA 4NLNA 5HMLA 5KFGA 3G6XA 4DLEA 1MA7A 2WAQC 2R18A 3GDXA 4O3OA 4F2RA 4NLCA 4RPZA 1XNSA 5DLFA 4EYHB 2P35A 3B0XA 2AGPA 1Y88A 9ICHA 2KSOB 1GO3F 2K8AA 5KG4A 5EE1A 4B9UA 1SKSA 4F5OA 2FE9A 2YB4A 4RQNA 4YCXA 3ZDBA 3K75D 3RRHA 2HHSA 4PGYA 5F9LA 4DSIA 5HR6A 4QZ8A 4F8RA 1ZQ1C 4CCHA 4BGDA 3OJSA 4ED0A 1PUZA 2E3TA 4QIWC 5KFFA 1ZQYA 3RB3A 3B9JA 5ALDA 1VJ5A 1ZETA 5E79U 7ICJA 4KLQA 3TFRA 3GIIA 1F44A 2RDIA 1ZQQA 1TE2A 3KHRA 4RQ7A 2W43A 1SKWA 2ZTEA 3R9KA 2FJ6A 3NVVA 5IIOA 3HWTA 2MSNA 2BCQA 7ICFA 1NK0A 1SB3C 3HT3A 1JX4A 2P66A 3HX0A 1Z00A 3ETRA 2ZIUA 3BZKA 1OXJA 1MQ2A 5C0YA 1NK4A 4US9A 3RB0A 1ZQMA 2KZMA 2WAQF 2RP5A 4NV0A 1S0NA 4DQQA 2ZG6A 2LM1A 4DEZA 1ZJMA 4FS2A 2A3VA 4OJ6A 9ICRA 3SYZA 2HHXA 4R64A 1KN5A 4EBEA 3QE9Y 4OJ5A 1N56A 1L7NA 1T4GA 5L1IA 2JV3A 1JROA 1KBUA 5DB8A 3QUQA 5HR7A 4NXZA 1L3SA 1ECWA 4QZHA 4C8KA 1SGGA 5AI9A 3T5KA 3C23A 4JV2A 5ALTA 4MEXA 2WB1C 4I2DA 4Y2VA 3GV8B 3Q8KA 4F91B 4F5PA 5J0UA 1S97A 1TAMA 3FDSA 1J97A 2ZIWB 2PKEA 2L5YA 3THVA 3AM9A 4KLSA 5AHXA 1CI4A 1DK3A 5ALFA 2VA8A 5J8YC 4DSJA 2YY6A 4UASA 1Z19A 2AJQA 4M6WA 3PW4A 3H8WA 5ALYA 2GO7A 1WWVA 5BPCA 2J6TA 2CRXA 3BQ1A 1SL1A 4US8A 3MR2A 4UW9A 1JN3A 1LVHA 4Y2RA 5AI5A 3D6JA 2D6FC 5ALHA 1MC8A 1P7DA 1T8EA 4X5VA 4DO9A 4Q8FA 5B66U 3RJKA 3ONNA 1XWLA 4YP3A 8ICMA 5AK3A 4UAYA 3HJEA 1U49A 3LDAA 1IIPA 1B43A 1QSSA 1EXNA 2XC9A 5J2IA 4RQ4A 2W03A 4P2HA 3TACB 4P0QA 2F76X 4F93B 2LBOA 1SL2A 5EE3A 3EWAA 5CJ7A 4USAA 1KLNA 3KFUF 3EYZA 2YMQA 1SZPA 4ECZA 3FAHA 3CYMA 3RH4A 4HYKA 1RQNA 3MBYA 4CF4A 5TZVA 3NVYA 3C2LA 1T7PA 1ZJNA 5KG1A 5GTHU 1LB2B 3NTUA 3N7PD 4GLXA 4B9NA 1SV0C 4PPXA 2BDUA 4J9RA 4RUAA 4E0DA 4C8LA 3H0LB 1ZQKA 4BXOA 3EW9A 8ICZA 3HKZF 1ZQRA 2AGQA 2JGAA 4YXMA 3MR3A 4UB5A 1FEZA 3QU5A 3KTQA 3RBDA 3LYSA 2HCFA 3PVXA 5ALRA 1NK8A 1WWUA 2LYAA 5J0TA 4MF8A 1VDVA 1T94A 3OTQA 4DL2A 1NJXA 4I2CA 1RYSA 2ALZA 2QB0B 4DL5A 3RB6A 4DF8A 4PHPA 2GH1A 4EZ9A 2BPGA 5AKYA 4PZNA 5D49A 1IXRA 4DSLA 4B9SA 4CNQA 4PL2A 5DBBA 3ISCA 2HI0A 1RQLA 4RQ5A 3PX0A 1QCKA 7ICHA 4UB3A 3M9MB 7ICMA 1X66A 2XGQA 1BPZA 1X9XA 4UB4A 4OCZA 3IN5A 2F8LA 1MQ3A 2DKXA 3UM9A 3T3FA 2AGOA 4EBCA 2KG5A 3AU2A 4M6WB 1ZQBA 3PO4A 2JH7A 1BGXT 2ZIVA 4C4TA 3BQTA 3ZDEA 3Q8LA 4PHDA 4FBTA 4RQ6A 3DEEA 4NM2A 5AKIA 2LYHA 3IHQB 3IP4B 3TKAA 2ZUCA 2K4HA 1QSLA 5AM2A 5KFYA 4BX9C 3QZ7A 4IR1A 5TISU 2PMZC 4DCCA 3ZDAA 3M8RA 2YMLA 1V85A 5KTQA 1SIJA 3RR7A 3JPSA 2MUTA 3BS5B 3HILA 3D2NA 2KIWA 2VJ5A 2DF4B 3H4BA 3KHHA 4NLZA 2BKEA 1X9MA 3I28A 4KLTA 4P0QB 4QNLA 5KFJA 4O0IA 4DFDA 2EAMA 3BQ2A 2H5XA 2JHDA 4G9BA 4UB6U 1JXEA 1PK3A 1KDHA 5KG0A 3LWLA 2W9BA 3F2CA 2EAPA 4UARA 4KLLA 8ICCA 3MABA 1FO4A 3G6VA 4DOAA 4PJ0U 2FLPA 5ALOA 1N63A 2JRZA 3T79A 4ZH4A 4C7YA 3GILA 1QLNA 4CE6A 2QARA 2KJ9A 3TANA 4LVSA 1X6IA 5AM0A 3C1ZA 3QYPA 4BXOB 3QEAZ 3WU2U 4BWMA 4UBCA 2JEGA 9ICBA 4NWIA 1M6YA 3GV7B 3QU2A 3N7RC 4C80A 2BGWA 2KN7A 3SI8A 1NKBA 3QU9A 5AKHA 3HP6A 4K4HA 3RJGA 3IG8A 5KFNA 2PMZF 4TQRA 3MFIA 3N7SC 4LZDA 2E8PA 5GTIU 2HBKA 5KL8B 2W7OA 2PI5A 1NJYA 3IG5A 4PGXA 1QTMA 1IV8A 3ICXA 4IRCA 3Q8MA 8ICRA 2MU2A 4B9TA 2PFPA 4ED2A 3UPQA 4QZCA 5J8YA 3PW0A 1F5SA 2K4IA 2C2DA 3PR4A 4ED1A 4DS5A 2JEJA 2CPRA 2F8KA 2HBMA 2XY5A 2ZUBA 4PGQA 2NRTA 4FZNA 5JUMA 9ICPA 4AYBC 5J2AA 3NGDA 5DG9A 4GFJA 5DB6A 4OD0A 4ECXA 1DXSA 2HHWA 5BOLA 2ZTDA 4CF5A 3RAXA 5AKJA 5BOMA 5G5HA 2DFLA 2EZYA 4C8NA 3TAPA 2ZIVB 1J2MA 3N97B 2P6UA 5ALKA 2HVIA 2RQ5A 3H0RB 4F4KA 2PFOA 5B5EU 2PXIA 4CGZA 1KFSA 3MGHA 3V6JA 4EELA 1V38A 1NKEA 4OJOA 3PSIA 3UQ0A 4BDPA 3BDPA 4JB3A 4ECVA 2DQNB 4J9PA 4Y2SA 4DSEA 5KFPA 2MUTB 2F44A 5AI4A 1D8LA 4YD2A 2W3RA 4RQ3A 1DGSA 4PZOA 2WF8A 1NK6A 8ICGA 2W8LA 2HHQA 2G06A 1N48A 3QX7A 3NASA 9ICOA 2W9BB 2ZJAA 2KD1A 2XICA 1NOMA 4AYBF 7ICRA 2HDOA 4I2FA 3F2DA 4O9MA 5G5GA 5AK4A 1SZHA 3TADC 4PL1A 5KFDA 3M9NB 3OHAA 1RPLA 1KSPA 1Q3UA 1ZQUA 2OCEA 5EE9A 2QARB 3TAQA 2F1HA 3PV8A 5AKXA 4O3SA 1K1SA 2IBKA 4C8MA 1O08A 1X9SA 5J2CA 4RNMA 1XO1A 2ISOA 4RPXA 2J6SA 5KFMA 2V4QA 5DB9A 2WF9A 3RAQA 3PW2A 4NM1A 4M9GA 3LWMA 3N28A 2YMPA 5J0WA 9ICQA 2KJ5A 4RQ2A 1T3QA 4F2SA 4EEYA 4QZAA 3KHGA 3M6ZA 2W9AA 1L6NA 2KIVA 4RQMA 2IHNA 2OWOA 1F0MA 2XCPA 4JK1A 3DDHA 4RNOA 5CHGA 1U4BA 4DOBA 1SKRA 5CR0A 3PSPA 4XA5A 4O5KA 2Y0SC 5D46A 3RR8A 4O3RA 2A1AA 1L3TA 2BR0A 2O6KA 2JMGA 3OHBA 4J9QA 5KFSA 3WK7A 1HJPA 4IQTA 1JRPA 4DL4A 1JALA 4J9NA 4M04A 5KG7A 2XY7A 5KAIU 1XC9A 2ODGA 2HOQA 3AU6A 1ED1A 3C5GA 3UMBA 1ZQTA 3QZ8A 5CA7A 5IIIA 4YMMA 2P6RA 3JPNA 7ICIA 2NO5A 3MC1A 2ASLA 3Q8PB 4KLJA 2FPMA 2ZUDA 4MFFA 2IOFA 5KT4A 3WK9A 2E8OA 4IQUA 2ES6A 4ACOA 4QWAA 4KN7A 3H0MB 1S8OA 1D9DA 4QIWF 1RZTA 4F50A 1VLBA 3OSPA 4JWNA 1WYGA 4LJXA 3EPGA 1L7OA 4JV0A 4RT3A 4HAIA 4IRKA 4RQ0A 3KKAC 4M0AA 3SR6A 5F9NA 4Z6DA 4PHEA 1ZXIA 1BNOA 4Y2UA 3PZPA 2V9WA 1K5OA 3H7IA 5CWRA 2ESEA 4KLGA 5DBAA 1DOQA 1ZD2P 4YVZA 4IQWA 4MF2A 4NJ8A 4F5RA 2K4PA 8ICOA 1FIQA 2Y0SF 2WF5A 5DG8A 3JPTA 1WG8A 2QKQA 4YR0A 2NRVA 8ICJA 4IR9A 2XI9A 4ECYA 2QLTA 4Q44A 4R65A 2YX8A 1QH9A 3H8JA 3C2KA 4C8OA 2BCVA 4UAVA 1K1QA 3T5HA 5ALXA 3QXGA 1A0PA 3TARA 2F3NA 2Y9TA 4J9KA 1KFDA 2C28A 4F92B 3SAHA 1KL9A 1S9FA 1XS9D 1UA1A 2OM6A 4ELTA 2Q4TA 2WB1F 1JI7A 5J0YA 4YR3A 4KLDA 2HOIA 3RJJA 2MAXA 2VIXA 3L3FX 4Z6EA 2E1FA 2BCUA 5L1KA 2XGPA 5A0LA 4YG2A 5KT2A 3VCBA 4YR2A 2AH5A 3RH6A 5L1LA 2DBYA 1L3VA 1ZRMA 2F77X 5JU5A 2PFNA 4I2EA 2RRDA 5AI6A 4GC7A 4OO1J 1WUDA 4FFDA 3RTVA 5KT3A 8ICLA 3CW2C 5J0QA 1BPEA 1COOA 2XY6A 7ICKA 1A77A 1Z00B 5ALMA 5ALWA 4GXKA 2NRWA 1ZQHA 2ZIUB 3M8SA 2HBJA 1WCNA 5KFLA 3S6JA 5JTIA 2GWSA 1RG6A 8ICSA 4OJLA 4I27A 1TK8A 4DQRA 2NRXA 2NV3A 2ZXIA 5AKGA 3V7KA 1AQ6A 2EQYA 1ZQNA 3U26A 2FLLA 9ICUA 8ICAA 5DQGA 2IHMA 4YD1A 7ICPA 2I6XA 4DQIA 3RF9A 3KBBA 5CP2A 4P4PA 1RM6C 1D8YA 3QU4A 4IC9A 1HIWA 3JPRA 3KZXA 4BWJA 2AXTU 5L1JA 1N60A 1DK2A 5KT7A 2DGZA 2K89A 2XO7A 2VA2A 3SV4A 5EE0A 3SENA 3H40A 5AK5A 3SV3A 4NL9C 2Q0ZX 1UT8A 4KX3A 3UXOA 3SD7A 4ELVA 3BQ0A 5ALPA 4OJPA 4I2IA 3GIKA 1ZQZA 4U7CA 1JXLA 4DQPA 5DQHA 1ZQSA 2NO4A 3PMNA 2KHQA 4Y2JA 1NJZA 2G09A 4FBUA 2LMRA 7ICVA 4P0PA 2H3VA 3LVWA 3HPOA 3MDCA 4DS4A 1ZD4A 3QU7A 4ED7A 8ICEA 1Z1BA 4QZEA 3TI0A 7ICOA 4UB8U 2VANA 2LI6A 1O03A 3MGIA 5KFOA 3I1YA 2E8MA 2HOFA 3K1RB 2H3IA 1U48A 5K4LA 2OXOA 3UXNA 9ICFA 7ICSA 5KFCA 4C4RA 2JZBA 5ALGA 8ICQA 3CRXA 3Q8RB 2YN4A 4BJQA 4DL7A 3PO5A 2F1JA 2YQEA 5KFAA 1ZQEA 3V7JA 2G07A 3SMVA 3B0YA 2Y1JA 2FDRA 1BPYA 9ICVA 2JR5A 4MFAA 5KFIA 4QZ9A 2G5HB 1TAUA 1ZQXA 4F5NA 1Z1VA 3FC4A 1XSNA 9ICTA 4B9LA 4CRXA 3LVVA 3VC8A 2UVRA 2B21A 5KL1B 3WK8A 2HHVA 4G3IA 4M9NA 2W9CA 2EAOA 3V72A 5AICA 3M9OB 4Y2QA 2B0CA 1UQVA 1SL0A 4TQSA 4YXJA 2KICA 2LKYA 2IA6A 3GFKB 5KFQA 2I1QA 3KHLA 3RH5A 4QWBA 4JUZA 3BQ7A 4Z6CA 3EPIA 5KFVA 2M0NA 3NS1A 4KLUA 4O3PA 3IRUA 5AKEA 4I2GA 4R66A 2KZZA 9ICLA 1A76A 2AHOB 3EUB2 1UT5A 4NLBA 3V6KA 5AI8A 3RJHA 1B0XA 1KTQA 5KFZA 3QEBZ 2GOLA 4JWMA 4QZFA 1UPHA 5CB1A 1CRXA 3T5JA 5DG7A 1YZ7A 3FM9A 4YMOA 4TUPA 2BPCA 4JMUA 1KQQA 3E58A 2FPLA 4EZ6A 1U9LA 1U47A 4RQ8A 9ICXA 5AI0A 9ICIA 5J2FA 3AMZA 4QW9A 5HHIA 1NK9A 3F5AA 5EWEA 2E1EA 5KFRA 5KG2A 5C5JA 3PW7A 5HNKA 4J9SA 4KTQA 2E8NA 2H3QA 2V4RA 1PVPA 5IILA 2FMPA 2KZ3A 3ZI4A 1V97A 1X6JA 2I5HA 3RJFA 2JXJA 5CEHA 1ZQVA 1XSPA 1ZQFA 4DSKA 4J9MA 2CXYA 1ZYQA 4M2YA 5DQIA 1BPBA 1TKDA 5AM3A 2HVHA 1ZQIA 1C20A 2PI4A 3NRZA 3QUTA 4XUSA 4YQWA 2A19A 1RXWA 4KITB 5IIMA 4EYIB 5KT5A 2KFZA 2KMDA 2EZZA 4RZRA 4DQSA 3HRDD 3E2EA 2HHUA 3M1YA 1L7MA 2I9GA 2XCAA 5AK6A 4FS1A 4C4SA 3F2BA 1DGJA 2VJ4A 2YMMA 3NRWA 4UAUA 5J2KA 2JZBB 1UA0A 1HUZA 4O5CA 5ALQA 1TAQA 2K60A 3PSTA 2KV2A 2OHFA 5KFXA 8ICHA 5KFWA 4I2AA 8ICFA 1Z4OA 2VKQA 4ECTA 4B6JA 2BQ3A 4QZGA 8ICPA 8ICYA 5DBCA 1SV0A 2EH9A 1ZD3A 9ICEA 4KMUA 1QQ7A 2W55A 3ZD8A 4DSFA 4EX6A 5AKKA 1ZRNA 5F3XB 3GIJA 2W7PA 3H4DA 3GQCA 1ZQCA 3NVWA 2W9CB 7ICEA 4F4XA 5IIJA 1N2XA 3H8SA 2DUYA 8ICTA 5ALSA 4UATA 2DPJA 3IV6A 3WKBA 1MSWD 3D2QA 1H38A 3JPQA 4EX7A 2FMQA 5CRXA 2WTFA 1TVAA 3RFAA 3UMCA 3WK6A 5AIAA 2K8CB 4CDGA 3OJUA 3GZFA 4O3NA 3PX4A 1NK7A 1IM4A 4NL9A 3F5EA 2HHTA 8ICKA 3KD3A 3RRGA 1OUQA 2G0AA 2LM4A 1BPDA 4UBBA 2B6GA 2AQ0A 4LZGA 4J03A 1TK5A 4IQVA 4FO6A 4F72A 1DRGA 1NJWA 1B22A 2K8BB 8ICXA 1S0VA 1TV9A 2FI1A 2LPEA 2NRZA 3HW8A 2IOFK 2NYVA 4GXJA 5J2GA 5ALVA 2BCSA 4IS7A 2ZIXA
chains in the Genus database with same CATH topology
2JR5A 2LM4A 1X6JA 1X6IA 1PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR5 A;  2LM4 A;  1X6J A;  1X6I A;  1PUZ A; 
#chains in the Genus database with same CATH topology
 1ZQA A;  2BZF A;  2ISP A;  2WHE A;  1SWW A;  3WK5 A;  1FFU A;  2BHN A;  2DL0 A;  3OGU A;  5DGA A;  4ED8 A;  2R8G A;  1N5X A;  2KK0 A;  4DFJ A;  3PML A;  5J0S A;  4Y2T A;  4YFK A;  5HMM A;  1Z4N A;  4Q43 A;  4JV1 A;  2LYB A;  2QB0 A;  4P4M A;  1KFT A;  1ZD5 A;  5D4B A;  3UQ2 A;  1NZB A;  4O3Q A;  3D2S A;  4GC6 A;  4DL3 A;  2DWQ A;  2IMW P;  4F4W A;  9ICM A;  3ORY A;  2KE7 A;  4P4O A;  2FMS A;  1ZQD A;  2GLE A;  4U6P A;  1N61 A;  5EOZ A;  4O3M A;  1X2I A;  4TUQ A;  1BNP A;  1UCV A;  1B4F A;  1D8B A;  2W8K A;  1HUO A;  3GU3 A;  2C22 A;  4Y2X A;  1KRP A;  1SXE A;  1ZOL A;  3NVZ A;  2KVS A;  2R8J A;  2KKP A;  3C5F A;  2KP7 A;  3G6Y A;  2EAN A;  1PVQ A;  3BJY A;  4O5E A;  4M47 A;  2J6U A;  4QWC A;  1BVS A;  4ED3 A;  1ZQW A;  3IM1 A;  4AP9 A;  1D9F A;  3HKZ C;  3JPP A;  4EEN A;  2ASJ A;  3Q8Q B;  5FP0 A;  5ALE A;  1JIH A;  1JMS A;  4M9J A;  1XSL A;  1CEZ A;  5J2E A;  5AM4 A;  4C0Z A;  3SEI A;  2WFA A;  2XID A;  3ED5 A;  5KAF U;  3AL0 B;  4UAZ A;  2Y9U A;  4KLO A;  4ECR A;  1L5U A;  3UXP A;  4RT2 A;  3M7D A;  8ICW A;  3BS5 A;  4XQ8 A;  1ARO P;  4XRH A;  2G5I B;  1QSY A;  4F4Z A;  3JPO A;  4RNN A;  2KVC A;  4DWI A;  4RUC A;  5L1M A;  2W9M A;  2E5S A;  4F3O A;  3QUC A;  2KNJ A;  2ASD A;  5AM5 A;  1JUD A;  1UHU A;  1LKY A;  1NK5 A;  3QUB A;  4GIB A;  4KLF A;  3PX6 A;  2BDP A;  3EZ5 A;  3RJE A;  3UMG A;  4PH5 A;  5L9X A;  3C28 A;  3BS7 A;  2ATL A;  3SZ2 A;  1WCL A;  3H8M A;  4DLG A;  3BZC A;  5KFE A;  4IL6 U;  3SAF A;  5KFT A;  3GV5 B;  2N1R A;  5J2B A;  4I29 A;  2K4E A;  2ZIX B;  2RLT A;  3KOO A;  9ICN A;  1PK1 A;  2A1J A;  1KKX A;  1ZQO A;  2MA1 A;  2VA3 A;  5KFU A;  5IIK A;  4J9L A;  3MDA A;  5JRT A;  4IRD A;  3MR5 A;  1PZN A;  3K4G A;  8ICV A;  3WKC A;  2H3Z A;  3OPX A;  3IDW A;  3AUO A;  4F4Y A;  4YMN A;  2G08 A;  1X40 A;  4NLG A;  1COK A;  1V9P A;  4UQG A;  2JEI A;  3RBE A;  3RJI A;  4KLI A;  4KMO B;  5AKZ A;  2RDJ A;  4UAW A;  1S10 A;  2ZXH A;  4TUR A;  2KKV A;  4KN4 A;  4B9M A;  7ICL A;  4QJF B;  9ICK A;  4RQ1 A;  8ICU A;  4R8U A;  2DKZ A;  2AU0 A;  2C2E A;  3E0F A;  9ICJ A;  1S0O A;  1KEJ A;  4M9H A;  4K4G A;  2HW3 A;  2QB1 A;  4BUG A;  4FZL A;  3SAG A;  2HMX A;  2F1I A;  7ICN A;  5HP4 A;  4GXI A;  3TAD A;  2D3D A;  4ED6 A;  4ECW A;  2F2A B;  2W3S A;  5J2J A;  2YTU A;  4FE3 A;  5J0O A;  2AQ4 A;  1URJ A;  5J2D A;  7ICU A;  5DDY A;  4ECQ A;  3ZDD A;  5AM1 A;  2DPI A;  3PR5 B;  2M9N A;  4DL6 A;  3TFS A;  4B9V A;  1ZQJ A;  2KFN A;  3ISB A;  3MFH A;  1S5L U;  1X42 A;  3AEV A;  1L7P A;  1BPX A;  1S76 D;  5J0P A;  2KTQ A;  3V6H A;  4EEK A;  2R8K A;  3M6K A;  4QWD A;  5IIN A;  3LK9 A;  5DB7 A;  4ECU A;  1ZQG A;  4C7Z A;  3ZDC A;  3WKE A;  4I2J A;  3NUQ A;  2Y1I A;  8ICN A;  4NY8 A;  4DFK A;  1Q8K A;  4QWE A;  5J2H A;  2XVT A;  3AN1 A;  2Z7J A;  2OEH A;  2KOB A;  3MR6 A;  2OYY A;  4WJ3 B;  2D8C A;  1C7Y A;  4I2B A;  4I2H A;  4ELU A;  4Y2Y A;  4DOC A;  1SV4 A;  3WK4 A;  9ICC A;  4NLK A;  2HBL A;  2ZTC A;  3AQE A;  3C21 A;  1ZQL A;  1TFR A;  5DGB A;  3RB4 A;  2C2R A;  3V7L A;  2H3F A;  4F71 A;  1LKY B;  1LV5 A;  3CP8 A;  3L5K A;  2OH2 A;  2W11 A;  1N62 A;  4Q45 A;  1T3N A;  1Z3E B;  3C1Y A;  5J0R A;  8ICB A;  4MHV A;  2UVV A;  2KSO A;  5H2F U;  2KEY A;  1RDF A;  2PFQ A;  4R63 A;  1L3U A;  3L4P A;  3AQF A;  3N4M B;  4RPY A;  1NNL A;  1XU4 A;  5ALJ A;  4MFC A;  1IG6 A;  4J9O A;  1NZP A;  2UVW A;  1L8O A;  4KX5 A;  2HSZ A;  4Y2P A;  3Q8S B;  1TK0 A;  2WF7 A;  4KLM A;  3WKD A;  2RHF A;  4YN4 A;  2JEF A;  5DDM A;  2FLN A;  5EWF A;  3T5L A;  4A8E A;  4M9L A;  5HHH A;  2W54 A;  1PK1 B;  2A1J B;  1XO0 A;  2YB1 A;  2BQR A;  3PNC A;  2CN1 A;  4RU9 A;  2R8H A;  9ICW A;  3ETL A;  4F5Q A;  3KKA A;  3PSF A;  4FZM A;  7ICG A;  1U45 A;  3C2M A;  1SWV A;  3CNH A;  4KLE A;  4KLH A;  5KT6 A;  2KJ8 A;  1MN8 A;  5J0X A;  9ICG A;  4QZB A;  4QW8 A;  1RXV A;  3SQI A;  5AKL A;  5EWG A;  8ICI A;  5J29 A;  2LHT A;  4ICA A;  2BCR A;  5ALI A;  1ZQP A;  2R8I A;  1NKC A;  4Q8E A;  1FFV A;  1YT3 A;  4R8U B;  1SXD A;  2W04 A;  5KFK A;  1PVR A;  4P0P B;  3F53 A;  4ECS A;  5DLG A;  5KFB A;  5KFH A;  4EBD A;  5AIB A;  1CUK A;  3PW5 A;  3QNM A;  7ICQ A;  2MRL A;  4DFM A;  3ALR A;  3A0B U;  3GIM A;  4CF3 A;  2KHV A;  1S0M A;  3KZI U;  3O0F A;  3OSN A;  2UVU A;  2ZJ8 A;  4QZI A;  1OW5 A;  9ICA A;  4QZD A;  4ZOH C;  3J81 j;  4TUS A;  3C29 A;  3DV9 A;  5KG5 A;  4DF4 A;  1S77 D;  9ICS A;  1KW4 A;  3FYH A;  1N5W A;  1QQ5 A;  3ISD A;  1QQ6 A;  3I76 A;  4Z6F A;  1RYR A;  4DFP A;  2FPK A;  5T14 A;  1Q46 A;  2WF6 A;  4PHA A;  1X9W A;  4I28 A;  7ICT A;  2ZIW A;  1L8L A;  3A0H U;  2IOH A;  3PY8 A;  2EDU A;  2JH1 A;  1YZ6 A;  2BPF A;  1NI3 A;  1RYU A;  2EZX A;  5KNI A;  5KG3 A;  3ZD9 A;  3TQ1 A;  3MGV A;  2ZJ5 A;  3K1Z A;  1Q3V A;  4MEY A;  4UB1 A;  1J2N A;  3WKA A;  4K4I A;  4UB2 A;  2BQU A;  1A6S A;  5ALL A;  1HEK A;  5DKW A;  5KG6 A;  5ALU A;  5ALZ A;  5ALN A;  4NLN A;  5HML A;  5KFG A;  3G6X A;  4DLE A;  1MA7 A;  2WAQ C;  2R18 A;  3GDX A;  4O3O A;  4F2R A;  4NLC A;  4RPZ A;  1XNS A;  5DLF A;  4EYH B;  2P35 A;  3B0X A;  2AGP A;  1Y88 A;  9ICH A;  2KSO B;  1GO3 F;  2K8A A;  5KG4 A;  5EE1 A;  4B9U A;  1SKS A;  4F5O A;  2FE9 A;  2YB4 A;  4RQN A;  4YCX A;  3ZDB A;  3K75 D;  3RRH A;  2HHS A;  4PGY A;  5F9L A;  4DSI A;  5HR6 A;  4QZ8 A;  4F8R A;  1ZQ1 C;  4CCH A;  4BGD A;  3OJS A;  4ED0 A;  1PUZ A;  2E3T A;  4QIW C;  5KFF A;  1ZQY A;  3RB3 A;  3B9J A;  5ALD A;  1VJ5 A;  1ZET A;  5E79 U;  7ICJ A;  4KLQ A;  3TFR A;  3GII A;  1F44 A;  2RDI A;  1ZQQ A;  1TE2 A;  3KHR A;  4RQ7 A;  2W43 A;  1SKW A;  2ZTE A;  3R9K A;  2FJ6 A;  3NVV A;  5IIO A;  3HWT A;  2MSN A;  2BCQ A;  7ICF A;  1NK0 A;  1SB3 C;  3HT3 A;  1JX4 A;  2P66 A;  3HX0 A;  1Z00 A;  3ETR A;  2ZIU A;  3BZK A;  1OXJ A;  1MQ2 A;  5C0Y A;  1NK4 A;  4US9 A;  3RB0 A;  1ZQM A;  2KZM A;  2WAQ F;  2RP5 A;  4NV0 A;  1S0N A;  4DQQ A;  2ZG6 A;  2LM1 A;  4DEZ A;  1ZJM A;  4FS2 A;  2A3V A;  4OJ6 A;  9ICR A;  3SYZ A;  2HHX A;  4R64 A;  1KN5 A;  4EBE A;  3QE9 Y;  4OJ5 A;  1N56 A;  1L7N A;  1T4G A;  5L1I A;  2JV3 A;  1JRO A;  1KBU A;  5DB8 A;  3QUQ A;  5HR7 A;  4NXZ A;  1L3S A;  1ECW A;  4QZH A;  4C8K A;  1SGG A;  5AI9 A;  3T5K A;  3C23 A;  4JV2 A;  5ALT A;  4MEX A;  2WB1 C;  4I2D A;  4Y2V A;  3GV8 B;  3Q8K A;  4F91 B;  4F5P A;  5J0U A;  1S97 A;  1TAM A;  3FDS A;  1J97 A;  2ZIW B;  2PKE A;  2L5Y A;  3THV A;  3AM9 A;  4KLS A;  5AHX A;  1CI4 A;  1DK3 A;  5ALF A;  2VA8 A;  5J8Y C;  4DSJ A;  2YY6 A;  4UAS A;  1Z19 A;  2AJQ A;  4M6W A;  3PW4 A;  3H8W A;  5ALY A;  2GO7 A;  1WWV A;  5BPC A;  2J6T A;  2CRX A;  3BQ1 A;  1SL1 A;  4US8 A;  3MR2 A;  4UW9 A;  1JN3 A;  1LVH A;  4Y2R A;  5AI5 A;  3D6J A;  2D6F C;  5ALH A;  1MC8 A;  1P7D A;  1T8E A;  4X5V A;  4DO9 A;  4Q8F A;  5B66 U;  3RJK A;  3ONN A;  1XWL A;  4YP3 A;  8ICM A;  5AK3 A;  4UAY A;  3HJE A;  1U49 A;  3LDA A;  1IIP A;  1B43 A;  1QSS A;  1EXN A;  2XC9 A;  5J2I A;  4RQ4 A;  2W03 A;  4P2H A;  3TAC B;  4P0Q A;  2F76 X;  4F93 B;  2LBO A;  1SL2 A;  5EE3 A;  3EWA A;  5CJ7 A;  4USA A;  1KLN A;  3KFU F;  3EYZ A;  2YMQ A;  1SZP A;  4ECZ A;  3FAH A;  3CYM A;  3RH4 A;  4HYK A;  1RQN A;  3MBY A;  4CF4 A;  5TZV A;  3NVY A;  3C2L A;  1T7P A;  1ZJN A;  5KG1 A;  5GTH U;  1LB2 B;  3NTU A;  3N7P D;  4GLX A;  4B9N A;  1SV0 C;  4PPX A;  2BDU A;  4J9R A;  4RUA A;  4E0D A;  4C8L A;  3H0L B;  1ZQK A;  4BXO A;  3EW9 A;  8ICZ A;  3HKZ F;  1ZQR A;  2AGQ A;  2JGA A;  4YXM A;  3MR3 A;  4UB5 A;  1FEZ A;  3QU5 A;  3KTQ A;  3RBD A;  3LYS A;  2HCF A;  3PVX A;  5ALR A;  1NK8 A;  1WWU A;  2LYA A;  5J0T A;  4MF8 A;  1VDV A;  1T94 A;  3OTQ A;  4DL2 A;  1NJX A;  4I2C A;  1RYS A;  2ALZ A;  2QB0 B;  4DL5 A;  3RB6 A;  4DF8 A;  4PHP A;  2GH1 A;  4EZ9 A;  2BPG A;  5AKY A;  4PZN A;  5D49 A;  1IXR A;  4DSL A;  4B9S A;  4CNQ A;  4PL2 A;  5DBB A;  3ISC A;  2HI0 A;  1RQL A;  4RQ5 A;  3PX0 A;  1QCK A;  7ICH A;  4UB3 A;  3M9M B;  7ICM A;  1X66 A;  2XGQ A;  1BPZ A;  1X9X A;  4UB4 A;  4OCZ A;  3IN5 A;  2F8L A;  1MQ3 A;  2DKX A;  3UM9 A;  3T3F A;  2AGO A;  4EBC A;  2KG5 A;  3AU2 A;  4M6W B;  1ZQB A;  3PO4 A;  2JH7 A;  1BGX T;  2ZIV A;  4C4T A;  3BQT A;  3ZDE A;  3Q8L A;  4PHD A;  4FBT A;  4RQ6 A;  3DEE A;  4NM2 A;  5AKI A;  2LYH A;  3IHQ B;  3IP4 B;  3TKA A;  2ZUC A;  2K4H A;  1QSL A;  5AM2 A;  5KFY A;  4BX9 C;  3QZ7 A;  4IR1 A;  5TIS U;  2PMZ C;  4DCC A;  3ZDA A;  3M8R A;  2YML A;  1V85 A;  5KTQ A;  1SIJ A;  3RR7 A;  3JPS A;  2MUT A;  3BS5 B;  3HIL A;  3D2N A;  2KIW A;  2VJ5 A;  2DF4 B;  3H4B A;  3KHH A;  4NLZ A;  2BKE A;  1X9M A;  3I28 A;  4KLT A;  4P0Q B;  4QNL A;  5KFJ A;  4O0I A;  4DFD A;  2EAM A;  3BQ2 A;  2H5X A;  2JHD A;  4G9B A;  4UB6 U;  1JXE A;  1PK3 A;  1KDH A;  5KG0 A;  3LWL A;  2W9B A;  3F2C A;  2EAP A;  4UAR A;  4KLL A;  8ICC A;  3MAB A;  1FO4 A;  3G6V A;  4DOA A;  4PJ0 U;  2FLP A;  5ALO A;  1N63 A;  2JRZ A;  3T79 A;  4ZH4 A;  4C7Y A;  3GIL A;  1QLN A;  4CE6 A;  2QAR A;  2KJ9 A;  3TAN A;  4LVS A;  1X6I A;  5AM0 A;  3C1Z A;  3QYP A;  4BXO B;  3QEA Z;  3WU2 U;  4BWM A;  4UBC A;  2JEG A;  9ICB A;  4NWI A;  1M6Y A;  3GV7 B;  3QU2 A;  3N7R C;  4C80 A;  2BGW A;  2KN7 A;  3SI8 A;  1NKB A;  3QU9 A;  5AKH A;  3HP6 A;  4K4H A;  3RJG A;  3IG8 A;  5KFN A;  2PMZ F;  4TQR A;  3MFI A;  3N7S C;  4LZD A;  2E8P A;  5GTI U;  2HBK A;  5KL8 B;  2W7O A;  2PI5 A;  1NJY A;  3IG5 A;  4PGX A;  1QTM A;  1IV8 A;  3ICX A;  4IRC A;  3Q8M A;  8ICR A;  2MU2 A;  4B9T A;  2PFP A;  4ED2 A;  3UPQ A;  4QZC A;  5J8Y A;  3PW0 A;  1F5S A;  2K4I A;  2C2D A;  3PR4 A;  4ED1 A;  4DS5 A;  2JEJ A;  2CPR A;  2F8K A;  2HBM A;  2XY5 A;  2ZUB A;  4PGQ A;  2NRT A;  4FZN A;  5JUM A;  9ICP A;  4AYB C;  5J2A A;  3NGD A;  5DG9 A;  4GFJ A;  5DB6 A;  4OD0 A;  4ECX A;  1DXS A;  2HHW A;  5BOL A;  2ZTD A;  4CF5 A;  3RAX A;  5AKJ A;  5BOM A;  5G5H A;  2DFL A;  2EZY A;  4C8N A;  3TAP A;  2ZIV B;  1J2M A;  3N97 B;  2P6U A;  5ALK A;  2HVI A;  2RQ5 A;  3H0R B;  4F4K A;  2PFO A;  5B5E U;  2PXI A;  4CGZ A;  1KFS A;  3MGH A;  3V6J A;  4EEL A;  1V38 A;  1NKE A;  4OJO A;  3PSI A;  3UQ0 A;  4BDP A;  3BDP A;  4JB3 A;  4ECV A;  2DQN B;  4J9P A;  4Y2S A;  4DSE A;  5KFP A;  2MUT B;  2F44 A;  5AI4 A;  1D8L A;  4YD2 A;  2W3R A;  4RQ3 A;  1DGS A;  4PZO A;  2WF8 A;  1NK6 A;  8ICG A;  2W8L A;  2HHQ A;  2G06 A;  1N48 A;  3QX7 A;  3NAS A;  9ICO A;  2W9B B;  2ZJA A;  2KD1 A;  2XIC A;  1NOM A;  4AYB F;  7ICR A;  2HDO A;  4I2F A;  3F2D A;  4O9M A;  5G5G A;  5AK4 A;  1SZH A;  3TAD C;  4PL1 A;  5KFD A;  3M9N B;  3OHA A;  1RPL A;  1KSP A;  1Q3U A;  1ZQU A;  2OCE A;  5EE9 A;  2QAR B;  3TAQ A;  2F1H A;  3PV8 A;  5AKX A;  4O3S A;  1K1S A;  2IBK A;  4C8M A;  1O08 A;  1X9S A;  5J2C A;  4RNM A;  1XO1 A;  2ISO A;  4RPX A;  2J6S A;  5KFM A;  2V4Q A;  5DB9 A;  2WF9 A;  3RAQ A;  3PW2 A;  4NM1 A;  4M9G A;  3LWM A;  3N28 A;  2YMP A;  5J0W A;  9ICQ A;  2KJ5 A;  4RQ2 A;  1T3Q A;  4F2S A;  4EEY A;  4QZA A;  3KHG A;  3M6Z A;  2W9A A;  1L6N A;  2KIV A;  4RQM A;  2IHN A;  2OWO A;  1F0M A;  2XCP A;  4JK1 A;  3DDH A;  4RNO A;  5CHG A;  1U4B A;  4DOB A;  1SKR A;  5CR0 A;  3PSP A;  4XA5 A;  4O5K A;  2Y0S C;  5D46 A;  3RR8 A;  4O3R A;  2A1A A;  1L3T A;  2BR0 A;  2O6K A;  2JMG A;  3OHB A;  4J9Q A;  5KFS A;  3WK7 A;  1HJP A;  4IQT A;  1JRP A;  4DL4 A;  1JAL A;  4J9N A;  4M04 A;  5KG7 A;  2XY7 A;  5KAI U;  1XC9 A;  2ODG A;  2HOQ A;  3AU6 A;  1ED1 A;  3C5G A;  3UMB A;  1ZQT A;  3QZ8 A;  5CA7 A;  5III A;  4YMM A;  2P6R A;  3JPN A;  7ICI A;  2NO5 A;  3MC1 A;  2ASL A;  3Q8P B;  4KLJ A;  2FPM A;  2ZUD A;  4MFF A;  2IOF A;  5KT4 A;  3WK9 A;  2E8O A;  4IQU A;  2ES6 A;  4ACO A;  4QWA A;  4KN7 A;  3H0M B;  1S8O A;  1D9D A;  4QIW F;  1RZT A;  4F50 A;  1VLB A;  3OSP A;  4JWN A;  1WYG A;  4LJX A;  3EPG A;  1L7O A;  4JV0 A;  4RT3 A;  4HAI A;  4IRK A;  4RQ0 A;  3KKA C;  4M0A A;  3SR6 A;  5F9N A;  4Z6D A;  4PHE A;  1ZXI A;  1BNO A;  4Y2U A;  3PZP A;  2V9W A;  1K5O A;  3H7I A;  5CWR A;  2ESE A;  4KLG A;  5DBA A;  1DOQ A;  1ZD2 P;  4YVZ A;  4IQW A;  4MF2 A;  4NJ8 A;  4F5R A;  2K4P A;  8ICO A;  1FIQ A;  2Y0S F;  2WF5 A;  5DG8 A;  3JPT A;  1WG8 A;  2QKQ A;  4YR0 A;  2NRV A;  8ICJ A;  4IR9 A;  2XI9 A;  4ECY A;  2QLT A;  4Q44 A;  4R65 A;  2YX8 A;  1QH9 A;  3H8J A;  3C2K A;  4C8O A;  2BCV A;  4UAV A;  1K1Q A;  3T5H A;  5ALX A;  3QXG A;  1A0P A;  3TAR A;  2F3N A;  2Y9T A;  4J9K A;  1KFD A;  2C28 A;  4F92 B;  3SAH A;  1KL9 A;  1S9F A;  1XS9 D;  1UA1 A;  2OM6 A;  4ELT A;  2Q4T A;  2WB1 F;  1JI7 A;  5J0Y A;  4YR3 A;  4KLD A;  2HOI A;  3RJJ A;  2MAX A;  2VIX A;  3L3F X;  4Z6E A;  2E1F A;  2BCU A;  5L1K A;  2XGP A;  5A0L A;  4YG2 A;  5KT2 A;  3VCB A;  4YR2 A;  2AH5 A;  3RH6 A;  5L1L A;  2DBY A;  1L3V A;  1ZRM A;  2F77 X;  5JU5 A;  2PFN A;  4I2E A;  2RRD A;  5AI6 A;  4GC7 A;  4OO1 J;  1WUD A;  4FFD A;  3RTV A;  5KT3 A;  8ICL A;  3CW2 C;  5J0Q A;  1BPE A;  1COO A;  2XY6 A;  7ICK A;  1A77 A;  1Z00 B;  5ALM A;  5ALW A;  4GXK A;  2NRW A;  1ZQH A;  2ZIU B;  3M8S A;  2HBJ A;  1WCN A;  5KFL A;  3S6J A;  5JTI A;  2GWS A;  1RG6 A;  8ICS A;  4OJL A;  4I27 A;  1TK8 A;  4DQR A;  2NRX A;  2NV3 A;  2ZXI A;  5AKG A;  3V7K A;  1AQ6 A;  2EQY A;  1ZQN A;  3U26 A;  2FLL A;  9ICU A;  8ICA A;  5DQG A;  2IHM A;  4YD1 A;  7ICP A;  2I6X A;  4DQI A;  3RF9 A;  3KBB A;  5CP2 A;  4P4P A;  1RM6 C;  1D8Y A;  3QU4 A;  4IC9 A;  1HIW A;  3JPR A;  3KZX A;  4BWJ A;  2AXT U;  5L1J A;  1N60 A;  1DK2 A;  5KT7 A;  2DGZ A;  2K89 A;  2XO7 A;  2VA2 A;  3SV4 A;  5EE0 A;  3SEN A;  3H40 A;  5AK5 A;  3SV3 A;  4NL9 C;  2Q0Z X;  1UT8 A;  4KX3 A;  3UXO A;  3SD7 A;  4ELV A;  3BQ0 A;  5ALP A;  4OJP A;  4I2I A;  3GIK A;  1ZQZ A;  4U7C A;  1JXL A;  4DQP A;  5DQH A;  1ZQS A;  2NO4 A;  3PMN A;  2KHQ A;  4Y2J A;  1NJZ A;  2G09 A;  4FBU A;  2LMR A;  7ICV A;  4P0P A;  2H3V A;  3LVW A;  3HPO A;  3MDC A;  4DS4 A;  1ZD4 A;  3QU7 A;  4ED7 A;  8ICE A;  1Z1B A;  4QZE A;  3TI0 A;  7ICO A;  4UB8 U;  2VAN A;  2LI6 A;  1O03 A;  3MGI A;  5KFO A;  3I1Y A;  2E8M A;  2HOF A;  3K1R B;  2H3I A;  1U48 A;  5K4L A;  2OXO A;  3UXN A;  9ICF A;  7ICS A;  5KFC A;  4C4R A;  2JZB A;  5ALG A;  8ICQ A;  3CRX A;  3Q8R B;  2YN4 A;  4BJQ A;  4DL7 A;  3PO5 A;  2F1J A;  2YQE A;  5KFA A;  1ZQE A;  3V7J A;  2G07 A;  3SMV A;  3B0Y A;  2Y1J A;  2FDR A;  1BPY A;  9ICV A;  2JR5 A;  4MFA A;  5KFI A;  4QZ9 A;  2G5H B;  1TAU A;  1ZQX A;  4F5N A;  1Z1V A;  3FC4 A;  1XSN A;  9ICT A;  4B9L A;  4CRX A;  3LVV A;  3VC8 A;  2UVR A;  2B21 A;  5KL1 B;  3WK8 A;  2HHV A;  4G3I A;  4M9N A;  2W9C A;  2EAO A;  3V72 A;  5AIC A;  3M9O B;  4Y2Q A;  2B0C A;  1UQV A;  1SL0 A;  4TQS A;  4YXJ A;  2KIC A;  2LKY A;  2IA6 A;  3GFK B;  5KFQ A;  2I1Q A;  3KHL A;  3RH5 A;  4QWB A;  4JUZ A;  3BQ7 A;  4Z6C A;  3EPI A;  5KFV A;  2M0N A;  3NS1 A;  4KLU A;  4O3P A;  3IRU A;  5AKE A;  4I2G A;  4R66 A;  2KZZ A;  9ICL A;  1A76 A;  2AHO B;  3EUB 2;  1UT5 A;  4NLB A;  3V6K A;  5AI8 A;  3RJH A;  1B0X A;  1KTQ A;  5KFZ A;  3QEB Z;  2GOL A;  4JWM A;  4QZF A;  1UPH A;  5CB1 A;  1CRX A;  3T5J A;  5DG7 A;  1YZ7 A;  3FM9 A;  4YMO A;  4TUP A;  2BPC A;  4JMU A;  1KQQ A;  3E58 A;  2FPL A;  4EZ6 A;  1U9L A;  1U47 A;  4RQ8 A;  9ICX A;  5AI0 A;  9ICI A;  5J2F A;  3AMZ A;  4QW9 A;  5HHI A;  1NK9 A;  3F5A A;  5EWE A;  2E1E A;  5KFR A;  5KG2 A;  5C5J A;  3PW7 A;  5HNK A;  4J9S A;  4KTQ A;  2E8N A;  2H3Q A;  2V4R A;  1PVP A;  5IIL A;  2FMP A;  2KZ3 A;  3ZI4 A;  1V97 A;  1X6J A;  2I5H A;  3RJF A;  2JXJ A;  5CEH A;  1ZQV A;  1XSP A;  1ZQF A;  4DSK A;  4J9M A;  2CXY A;  1ZYQ A;  4M2Y A;  5DQI A;  1BPB A;  1TKD A;  5AM3 A;  2HVH A;  1ZQI A;  1C20 A;  2PI4 A;  3NRZ A;  3QUT A;  4XUS A;  4YQW A;  2A19 A;  1RXW A;  4KIT B;  5IIM A;  4EYI B;  5KT5 A;  2KFZ A;  2KMD A;  2EZZ A;  4RZR A;  4DQS A;  3HRD D;  3E2E A;  2HHU A;  3M1Y A;  1L7M A;  2I9G A;  2XCA A;  5AK6 A;  4FS1 A;  4C4S A;  3F2B A;  1DGJ A;  2VJ4 A;  2YMM A;  3NRW A;  4UAU A;  5J2K A;  2JZB B;  1UA0 A;  1HUZ A;  4O5C A;  5ALQ A;  1TAQ A;  2K60 A;  3PST A;  2KV2 A;  2OHF A;  5KFX A;  8ICH A;  5KFW A;  4I2A A;  8ICF A;  1Z4O A;  2VKQ A;  4ECT A;  4B6J A;  2BQ3 A;  4QZG A;  8ICP A;  8ICY A;  5DBC A;  1SV0 A;  2EH9 A;  1ZD3 A;  9ICE A;  4KMU A;  1QQ7 A;  2W55 A;  3ZD8 A;  4DSF A;  4EX6 A;  5AKK A;  1ZRN A;  5F3X B;  3GIJ A;  2W7P A;  3H4D A;  3GQC A;  1ZQC A;  3NVW A;  2W9C B;  7ICE A;  4F4X A;  5IIJ A;  1N2X A;  3H8S A;  2DUY A;  8ICT A;  5ALS A;  4UAT A;  2DPJ A;  3IV6 A;  3WKB A;  1MSW D;  3D2Q A;  1H38 A;  3JPQ A;  4EX7 A;  2FMQ A;  5CRX A;  2WTF A;  1TVA A;  3RFA A;  3UMC A;  3WK6 A;  5AIA A;  2K8C B;  4CDG A;  3OJU A;  3GZF A;  4O3N A;  3PX4 A;  1NK7 A;  1IM4 A;  4NL9 A;  3F5E A;  2HHT A;  8ICK A;  3KD3 A;  3RRG A;  1OUQ A;  2G0A A;  2LM4 A;  1BPD A;  4UBB A;  2B6G A;  2AQ0 A;  4LZG A;  4J03 A;  1TK5 A;  4IQV A;  4FO6 A;  4F72 A;  1DRG A;  1NJW A;  1B22 A;  2K8B B;  8ICX A;  1S0V A;  1TV9 A;  2FI1 A;  2LPE A;  2NRZ A;  3HW8 A;  2IOF K;  2NYV A;  4GXJ A;  5J2G A;  5ALV A;  2BCS A;  4IS7 A;  2ZIX A; 
#chains in the Genus database with same CATH homology
 2JR5 A;  2LM4 A;  1X6J A;  1X6I A;  1PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...