2LM4A

Solution nmr structure of mitochondrial succinate dehydrogenase assembly factor 2 from saccharomyces cerevisiae, northeast structural genomics consortium target yt682a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
b'MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQEFSENKEKEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase assembly factor 2, mitochondrial
publication title Solution NMR structure of yeast succinate dehydrogenase flavinylation factor sdh5 reveals a putative sdh1 binding site.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2lm4A01
1X6JA 1X6IA 2JR5A 2LM4A 1PUZA
chains in the Genus database with same CATH superfamily
1U49A 4DSFA 2MUTB 5AHXA 3JPOA 1TV9A 4IC9A 2W9CA 4MEYA 2KMDA 4NWIA 4QNLA 2XCAA 1NJXA 3CNHA 4CF3A 5J0XA 2C2DA 1QQ5A 4P0PA 2G08A 3H0RB 3PX6A 3AM9A 4F93B 5DGBA 3LDAA 4I2EA 2OM6A 3V72A 3G6XA 1NK7A 2BPFA 4M9JA 4DFDA 2H5XA 1B4FA 4PL1A 7ICSA 2HHXA 2JH7A 2RHFA 2HHWA 3V6KA 1T7PA 3NS1A 1KFDA 2RLTA 3Q8KA 2DUYA 3JPTA 4F4WA 4OJ6A 5KG1A 3MDCA 3UMGA 1BPZA 1FIQA 1ZQPA 5IINA 2FE9A 4KLIA 2H3VA 2KKVA 5KFUA 3R9KA 3MFHA 1X42A 5DLGA 2UVRA 1PZNA 4QZAA 3QX7A 5HP4A 1F0MA 2W43A 2MAXA 5KFFA 2KOBA 5ALNA 4F5OA 1NK0A 5DBAA 2G09A 1U48A 4TUPA 2HHSA 4P0QB 3RB6A 4CRXA 1UHUA 5DLFA 1X6IA 3QU9A 1F44A 4QZFA 4YVZA 4PHAA 1RG6A 4RZRA 8ICIA 4BWMA 3DV9A 2GWSA 4JB3A 3AU2A 5C0YA 1Q46A 3PR5B 4IQUA 2BZFA 1JROA 8ICLA 2ZTEA 9ICNA 1Z00B 3SAGA 2Z7JA 4I2AA 1JMSA 1KL9A 4F4ZA 5L1MA 4B9SA 3QU4A 1ZQIA 1NK9A 1UQVA 1HUZA 1DOQA 2YB4A 2ODGA 2H3QA 5ALOA 4FS2A 3RAQA 5CHGA 3JPQA 4KLUA 3TAQA 3RB0A 5AM1A 1PVPA 3I76A 4Y2SA 1IV8A 5DB9A 2MUTA 5DB6A 5L1LA 1RYUA 5GTHU 4JWNA 3M9MB 2UVUA 5CR0A 5AM3A 4R65A 4M6WA 1U4BA 2D3DA 2HOQA 4XRHA 4M9NA 5KFLA 3ETLA 2ZXIA 8ICJA 2EAMA 4BDPA 3N4MB 4IR9A 3FM9A 4PZNA 4RQ2A 2IOHA 3K4GA 4R63A 1QH9A 2PXIA 2ZUBA 2K4PA 5HHHA 3ZDBA 5KFMA 4O9MA 3SAHA 4KLQA 4F5RA 8ICGA 1N48A 3GILA 1CEZA 2IHMA 2XO7A 2RDJA 3KKAC 1Z4NA 4QZHA 1LKYA 1TAMA 4JV2A 2DBYA 4NL9C 3KKAA 2GO7A 4P4MA 3JPSA 4NL9A 3C2KA 3ZDEA 4ZH4A 5J0QA 2AQ0A 5T14A 1SXDA 4YMMA 2FDRA 2ALZA 1ED1A 3WKEA 2KEYA 2KTQA 1BGXT 5AK5A 1NJWA 2ZIXB 4YR3A 4KMOB 2XIDA 7ICQA 4YCXA 5J2GA 1IG6A 1S77D 1LVHA 5KNIA 4MEXA 4ECYA 3T3FA 5AM0A 5HMMA 2EZZA 1ZJMA 4DSIA 2Y1JA 4QWEA 3RJEA 3ZDDA 2V9WA 5KFBA 2WF7A 9ICMA 3QU2A 2FI1A 1UT8A 1NJZA 5HNKA 2Y0SC 5J0UA 5ALKA 5DBBA 3GIJA 2MRLA 5L1IA 1C7YA 3WK4A 4Q8FA 2KD1A 5G5GA 4ED3A 1Z00A 2KVCA 7ICUA 5AICA 5ALSA 4UB6U 4Z6FA 3ALRA 2W55A 1RZTA 5KG3A 2E5SA 4TURA 4QZCA 1BVSA 4JV1A 4KLJA 5ALXA 4PJ0U 4Y2RA 2BDUA 2IOFA 3MR2A 2Y0SF 2F1IA 1KEJA 5ALJA 1OUQA 2KV2A 2MA1A 2ZUDA 4QZEA 4M2YA 4ED0A 2FMQA 1ZQSA 4DFMA 2KJ9A 4KLLA 4DOCA 4RQ7A 2OWOA 2M0NA 4EENA 3CYMA 3L3FX 4GC6A 4DLGA 5EE0A 3BQ2A 1COKA 2QARB 1D8BA 4Z6EA 4QZGA 1AROP 3OSNA 3BS5A 2JXJA 3OHAA 2W3RA 1IXRA 2H3IA 4FZNA 4O5KA 5EWFA 1SKSA 2AQ4A 3T5JA 7ICFA 4Q43A 3H8WA 7ICIA 8ICZA 2FPKA 2ZIVB 4US8A 3AQFA 2KNJA 1N62A 4US9A 5DBCA 3GV8B 2Q4TA 3O0FA 2C22A 1DK2A 1S76D 4RQMA 1ECWA 4BGDA 5L1KA 1NOMA 1Z1BA 2C2EA 1U45A 4Z6DA 3V6JA 4C4SA 2E3TA 2I1QA 2HVIA 4BUGA 3K75D 4OJPA 4J9PA 2WHEA 1ZQLA 4EX7A 2XGPA 1ZD3A 1NK5A 1N56A 3WK6A 1SB3C 5KFVA 3RFAA 3GU3A 4KN7A 1SZPA 4O3NA 1SV0C 4Y2YA 3TAPA 1SV0A 4DFPA 4I2BA 2O6KA 3PX4A 4DOAA 1K1QA 2LBOA 5GTIU 7ICNA 3CRXA 2P35A 1X9XA 4DL5A 2E1EA 4F4YA 2EANA 1Q8KA 3NTUA 1N61A 1Z1VA 2JH1A 3M9NB 5J8YC 1IM4A 5AI6A 5DB7A 4QZIA 4EZ6A 5J8YA 5AI9A 2KP7A 4B9TA 5KFWA 2CN1A 1XS9D 1NI3A 5J2AA 2N1RA 4DS4A 2WF6A 4DF4A 1N2XA 2PFQA 4QZBA 5F9NA 4NLGA 9ICRA 1O03A 4I2HA 4PGQA 2KJ5A 2ZJ8A 3WK7A 3RF9A 1CRXA 4GC7A 2OEHA 3T5LA 3Q8PB 1NKEA 1QLNA 2H3FA 5BOMA 3HILA 1F5SA 9ICWA 3EUB2 1H38A 4IR1A 2YTUA 1UT5A 3D6JA 1XSPA 2R8HA 1ZQNA 5B66U 3AMZA 5L1JA 4FO6A 3OJSA 3EPGA 1Z4OA 7ICRA 2QLTA 5CWRA 3ZD9A 2ZXHA 5KL1B 1RQLA 3BS7A 4OJ5A 2D6FC 3MABA 2KSOB 2HVHA 5KFIA 1A6SA 3TADC 5CB1A 3TADA 3PZPA 4LJXA 2W9BB 3OJUA 3SI8A 2YMLA 5TZVA 4UAYA 1TK5A 2QB1A 5DG9A 5KG4A 4DLEA 2KIVA 4ECSA 4B9LA 3EYZA 5AKJA 2GOLA 4DSKA 3RTVA 2A1JB 9ICVA 1OXJA 3RJFA 2GH1A 3RJIA 2MSNA 4JV0A 2LM4A 9ICSA 5ALTA 4YR0A 3ORYA 1M6YA 3LVVA 8ICYA 4C8NA 4FE3A 4UARA 2LPEA 3B0YA 2BQ3A 1Z19A 2JZBB 5J2CA 7ICEA 4P2HA 1J2MA 4F2RA 3UXOA 2F1HA 4ED2A 1P7DA 4IRDA 4YFKA 9ICGA 1KSPA 2UVWA 3DDHA 5EWGA 2JEJA 1MQ2A 1ZQKA 1QQ7A 1XSNA 2OH2A 4JK1A 1COOA 5E79U 2IA6A 2YX8A 3BZKA 7ICGA 4RQ5A 2HW3A 1HJPA 2JMGA 1ZQDA 3RJKA 2XCPA 1SWVA 3GQCA 4Q44A 2G5IB 4RUCA 2WTFA 5ALPA 3BQ0A 4ECZA 3C29A 9ICPA 4C0ZA 3OTQA 3Q8RB 5J0RA 4PH5A 1T8EA 2EAPA 4EEKA 4OJOA 3WK8A 3RR7A 1WWVA 5BOLA 4BXOB 3MR5A 3WKDA 4NM1A 1S0VA 4KLGA 4Y2PA 3FC4A 2W3SA 5ALGA 3PW4A 2P66A 2KSOA 2C2RA 4E0DA 5ALHA 5AKGA 4ELUA 3KHLA 3KHHA 3H8JA 1ZQEA 4YR2A 1C20A 9ICKA 2HOIA 1KDHA 1JI7A 3H8SA 5CRXA 1GO3F 2F8KA 2RQ5A 3C23A 4QW9A 2NO4A 5DDMA 4NXZA 4DO9A 2CXYA 2WB1C 3M1YA 2BQUA 5KFGA 4PGXA 8ICBA 3OHBA 1QQ6A 2A19A 3F5AA 5ALZA 1RYRA 3MC1A 3RRGA 2BGWA 3QU5A 9ICFA 1ZQUA 2KFZA 3THVA 1RDFA 4RNMA 2IOFK 2F8LA 3F2DA 2AGQA 1LV5A 3HX0A 4QWCA 1J97A 1V97A 3UQ2A 2AGOA 3NVVA 3EPIA 3KBBA 5J2HA 2JZBA 4I28A 7ICJA 3I28A 3DEEA 5KG0A 3B0XA 2G07A 3ICXA 1ZQVA 3AU6A 3E2EA 5G5HA 1BPBA 2OCEA 1NK4A 4OO1J 3RH4A 7ICTA 2IBKA 2ZTCA 3F2BA 1T3NA 5HHIA 8ICTA 4FS1A 2ZTDA 3VCBA 2PFNA 3PSFA 3PX0A 4QIWC 3TARA 2BCVA 2E8PA 4G3IA 3PW5A 4I2IA 3N28A 1B22A 1ZQXA 3HT3A 5DQHA 4EX6A 1RM6C 2VA3A 2AHOB 4NLKA 3UM9A 4DQPA 4CGZA 5AKHA 4DQIA 3QEBZ 3M8SA 2LYBA 4R8UB 7ICOA 5AKYA 3ZI4A 1CI4A 2JGAA 4QIWF 5J2FA 4P4OA 5TISU 5DDYA 5JUMA 5AK6A 4BXOA 3QZ8A 4BWJA 4FZMA 1ZQMA 1ZOLA 2W11A 5DQGA 2V4QA 4TUQA 4XA5A 4J9SA 1X9MA 1SWWA 2KZZA 2OXOA 8ICFA 4FBUA 2E1FA 5ALRA 4RQNA 2R8JA 2F2AB 1L8LA 7ICLA 5J0SA 4P0QA 2FPLA 3IHQB 2LI6A 1JALA 4QZ8A 4KITB 1S97A 3MDAA 1LB2B 4ECQA 4B6JA 3NVYA 3G6YA 3HRDD 3MFIA 4ICAA 1UPHA 4UW9A 4MFFA 4MFCA 1UCVA 4YD2A 3QZ7A 2AH5A 2XY5A 1Z3EB 3BQ1A 1YT3A 1ZD5A 4PHPA 5KFOA 1TKDA 5ALWA 1O08A 5EE1A 1CUKA 4QWBA 3BZCA 5CJ7A 1SKRA 2R8KA 4RQ8A 4C8MA 4ED7A 1B43A 5HR7A 2VANA 4J9OA 3Q8QB 5HR6A 1FO4A 2LM1A 4NLZA 1QSLA 4RPZA 4IS7A 4UB4A 1HUOA 4PHDA 1L3UA 4I2CA 5J0YA 1J2NA 3PW2A 2PI5A 2DPJA 3H4BA 1TAUA 4BJQA 2KJ8A 3ED5A 3UXPA 4DL7A 5KFQA 2KZMA 1WWUA 2JRZA 2LHTA 1D9FA 2HMXA 4ELTA 3TQ1A 5AI4A 3QUCA 4IQTA 5KFCA 3GIKA 2XICA 4Y2JA 3PNCA 4EBCA 2W54A 4M9GA 1AQ6A 2XI9A 3B9JA 3EW9A 2VJ5A 1L7PA 5IIIA 2K8CB 3N97B 3D2NA 4O3PA 3QNMA 4R8UA 3SQIA 1DXSA 2FMSA 1IIPA 5CEHA 3IRUA 3MR6A 4DFKA 2HOFA 2ASDA 4I2JA 1VLBA 5KFKA 8ICEA 1MA7A 4EEYA 4NLCA 1EXNA 4AYBC 1PK3A 1X6JA 2Y9TA 4C80A 5DGAA 4Z6CA 1KQQA 2F77X 4KLOA 4F5PA 3IN5A 1UA1A 2EZXA 4ACOA 2ZIXA 4F2SA 2JEIA 4EZ9A 5KFRA 1SGGA 4Q45A 2E8OA 3ISCA 3RH5A 4O3OA 4YD1A 2K60A 1ZQFA 1FFVA 3KHRA 3LK9A 1TFRA 3HPOA 3UPQA 2FPMA 2KN7A 2DGZA 2HBMA 3NRZA 3GV5B 3AN1A 4K4IA 2FLNA 4WJ3B 2WF9A 2Y1IA 3H8MA 4OCZA 2XY7A 5KFAA 2CPRA 3SD7A 1JN3A 1ZQ1C 2Q0ZX 4GXJA 4UB8U 3ZDAA 3QEAZ 5AM4A 4JUZA 4DQQA 4UBBA 5KFSA 1L6NA 2YN4A 2HHQA 4YN4A 2B0CA 3PMLA 2WF8A 2K4HA 4QZDA 1U47A 4MFAA 2BCUA 4F4XA 2QB0B 2FMPA 1X2IA 1QSYA 5AKLA 4NJ8A 2KFNA 3K1ZA 2OHFA 3PVXA 4JMUA 5AKEA 2PMZC 3IP4B 4O0IA 2FLLA 4K4HA 2VA8A 5BPCA 4EBDA 2P6RA 4FBTA 9ICLA 1TAQA 4ED1A 3QUQA 2UVVA 7ICVA 1XU4A 2QARA 1S9FA 4ECRA 2ZIWB 1PK1B 2J6SA 5ALQA 5ALMA 1S5LU 4UB1A 1B0XA 4F91B 3PR4A 3IG8A 3SAFA 4YG2A 2DWQA 3BJYA 1WCLA 5AI0A 5KFNA 4J9QA 4U7CA 4PPXA 2PMZF 5DB8A 5A0LA 2VKQA 2W9CB 5AI8A 1S10A 2KK0A 3OGUA 4TQSA 2W8LA 4YMNA 1NK8A 2NO5A 4PZOA 2IHNA 2AJQA 5JRTA 2ASJA 5J0PA 3ONNA 5EE3A 4QW8A 1JUDA 4C4TA 4P0PB 1KFTA 4C7ZA 2ZIVA 3Q8LA 2K4IA 3WK5A 2G5HB 1X9WA 2F1JA 2EAOA 2KHQA 2C28A 4RUAA 1MN8A 1MSWD 4UB2A 7ICPA 3KFUF 4ELVA 2DKZA 1ZQZA 5KAFU 3KZXA 2NYVA 3TFRA 9ICIA 4UBCA 1S0NA 2W7OA 4DCCA 4RNNA 2ATLA 1ZQRA 1V85A 2DF4B 5IIMA 3UXNA 4UASA 1L7MA 2ZIUB 5KTQA 1SKWA 4YXMA 4HYKA 3MR3A 3WKAA 3RB3A 1HIWA 3OSPA 3PO5A 3BQ7A 1SZHA 3H0LB 1YZ7A 1S8OA 5KT4A 9ICHA 3F5EA 4CF4A 1DK3A 2BDPA 3CP8A 4O3RA 5AKKA 1X66A 1ZXIA 1ZQGA 1TE2A 4CCHA 2XVTA 1TK0A 3V7JA 1D8YA 1PVQA 2NRWA 2K89A 2R8IA 2FLPA 4HAIA 3NGDA 2KZ3A 5EE9A 4DSJA 3T5HA 5KFEA 2NV3A 2RDIA 9ICOA 3TKAA 1NZPA 5AKXA 1ZQOA 2W8KA 3RBDA 3JPPA 2AXTU 4BX9C 8ICAA 3NASA 1ZETA 3E0FA 3KTQA 3WKCA 8ICHA 9ICQA 2EQYA 1NK6A 4O3SA 1KTQA 3L4PA 4EBEA 1KFSA 3I1YA 3UQ0A 4TQRA 3S6JA 4A8EA 2NRTA 2KVSA 1XC9A 2ZIWA 1PK1A 1RXVA 1NNLA 5CA7A 1NJYA 1RQNA 4PHEA 4OD0A 3WU2U 4RQ3A 2VIXA 2CRXA 5KFTA 4UAWA 5KT5A 1QTMA 3N7PD 2R18A 5IIJA 2KKPA 4KLMA 5KG7A 4M6WB 4NV0A 4DS5A 4B9UA 1SL0A 5AM2A 2XY6A 5H2FU 3U26A 4USAA 1MQ3A 2DFLA 3NRWA 2DKXA 4DQSA 2W9MA 2LKYA 2HHVA 3PW7A 1XWLA 1V9PA 5D49A 1JRPA 1N63A 3KHGA 5ALDA 2YY6A 3EWAA 2ZG6A 2A3VA 2ASLA 4I2DA 5AIBA 3IG5A 3IV6A 1T94A 2ZJAA 4Y2XA 5KFXA 1SL2A 1FFUA 2OYYA 2YMPA 2ZIUA 2EZYA 1DGJA 1SXEA 2FJ6A 4DL4A 1LKYB 2W9BA 2K4EA 3EZ5A 2F44A 4CE6A 3TI0A 3ETRA 4DF8A 1JXEA 2PFPA 7ICHA 1VJ5A 3UMCA 2A1JA 4ZOHC 5JTIA 3QXGA 3KZIU 1ZRMA 2I6XA 4I27A 2DL0A 2DQNB 3MGIA 3NVZA 5DQIA 1X40A 2ISPA 4XQ8A 2HI0A 1ZRNA 4NLBA 5IIKA 2XC9A 1ZQHA 3PMNA 1L3VA 3RRHA 5B5EU 3LWLA 7ICKA 4DSEA 1DGSA 3VC8A 3ZD8A 2WB1F 3BDPA 4RT3A 4KX3A 5D46A 4LZGA 1U9LA 2V4RA 1KN5A 2MU2A 3H7IA 3Q8SB 1Y88A 4PGYA 3IM1A 4J9KA 2B6GA 4OJLA 4C7YA 1V38A 1WCNA 5KFYA 5J0OA 1D9DA 4M04A 4F5NA 3T5KA 1L5UA 1Q3UA 2PI4A 3QE9Y 3PY8A 2J6UA 4J9NA 4AP9A 2ES6A 2M9NA 1VDVA 1BNPA 4LVSA 5J2JA 4MF2A 3N7RC 3UMBA 2WF5A 3PW0A 3FYHA 5ALFA 4GFJA 4DL6A 1KBUA 3K1RB 1BPDA 3M7DA 1BPYA 4M9HA 3BS5B 3C2LA 9ICEA 3H4DA 2EDUA 2YQEA 4DL3A 3C5GA 3QU7A 3MGHA 4C8LA 1D8LA 4NM2A 1N60A 4M47A 3L5KA 2HBLA 1WG8A 3QYPA 3PO4A 3RJJA 5AKZA 3N7SC 8ICOA 1XO0A 3AUOA 4QJFB 2GLEA 3C1YA 4F71A 2G06A 8ICKA 5EOZA 3MBYA 3RH6A 2NRZA 3TFSA 3HJEA 1T3QA 4PL2A 3J81j 3JPRA 3SENA 3GIMA 1ZQWA 2BHNA 2J6TA 1QSSA 1A76A 2IMWP 4KLHA 2BPCA 3KOOA 3OPXA 5AIAA 4UAVA 4LZDA 1JXLA 4I2GA 2D8CA 3C1ZA 1NKCA 3A0HU 8ICPA 4EYHB 5KFZA 3E58A 2A1AA 4CDGA 3F53A 3GIIA 2W9AA 4J9MA 1MC8A 3BQTA 1ZQTA 4U6PA 3JPNA 1PUZA 5J29A 4B9VA 4KLFA 1ZQQA 3LWMA 2JEFA 8ICUA 2ESEA 2AGPA 8ICSA 3HP6A 1JIHA 1JX4A 2JV3A 1NZBA 4KLEA 5K4LA 2F76X 3G6VA 3AEVA 2I5HA 5CP2A 5J2BA 2P6UA 4O5CA 3SR6A 5DG8A 4DOBA 4DSLA 4IRKA 4RU9A 8ICXA 4UATA 1RXWA 1KLNA 1SL1A 3M9OB 9ICUA 4QWAA 4O3QA 2K8AA 3LYSA 4RQ6A 1URJA 9ICXA 2JHDA 5HMLA 3SEIA 3MGVA 4J9RA 4DWIA 1X9SA 3IDWA 2NRXA 4YMOA 2EH9A 1WUDA 3SMVA 3NVWA 4C8OA 8ICNA 2WFAA 1RPLA 1L3TA 4M0AA 4YXJA 3M8RA 2PFOA 5D4BA 5DG7A 4NLNA 2RRDA 4Y2QA 4MF8A 5J2KA 5L9XA 1KKXA 4IQWA 4ED6A 3SV3A 1QCKA 3PV8A 4B9MA 2QKQA 1KW4A 1ZYQA 1L3SA 4KMUA 2BCRA 2G0AA 4O3MA 4RPYA 5KG6A 3SZ2A 1ZQBA 2ZJ5A 3ISDA 4F3OA 4AYBF 4DEZA 4MHVA 2YMMA 4F4KA 8ICQA 3TANA 2RP5A 1HEKA 5ALLA 2BPGA 1K5OA 2ZUCA 5KT6A 3V6HA 4DL2A 1L8OA 3FDSA 4P4PA 4X5VA 2KHVA 5KG5A 4RQ0A 3HWTA 4F92B 4ECXA 1OW5A 5KFDA 4ECVA 4R66A 4M9LA 3C5FA 2YMQA 1SIJA 5DKWA 4IRCA 2BQRA 4ED8A 3WK9A 4ECTA 2LMRA 4C4RA 3ISBA 1FEZA 3A0BU 1ZQAA 5AK3A 4J9LA 1K1SA 3TACB 2L5YA 2VJ4A 5KT3A 3D2SA 3PSPA 2JR5A 1DRGA 2BKEA 2HCFA 1ZQJA 1YZ6A 8ICWA 4DQRA 5AKIA 3PSIA 1BPEA 1ZD4A 5ALIA 4QWDA 4TUSA 2KG5A 4GXKA 3CW2C 9ICCA 5KG2A 1ZQYA 5J2EA 2XGQA 4Y2VA 5KT7A 4IQVA 2R8GA 3SV4A 2KICA 3RAXA 3M6ZA 4EYIB 3M6KA 4KLDA 5EWEA 1ZJNA 3ZDCA 3WKBA 5AI5A 5J2IA 2HHTA 3F2CA 5FP0A 3NUQA 3LVWA 4FFDA 5ALVA 3V7KA 3RJHA 3KD3A 2YB1A 2I9GA 7ICMA 4RQ4A 2LYAA 1RYSA 2HHUA 4UB3A 3HKZC 3C21A 3HW8A 1XSLA 1XNSA 1PVRA 3T79A 3RJGA 4I2FA 2PKEA 3RBEA 4F8RA 1TVAA 5KAIU 4CNQA 2BCSA 3RR8A 4O5EA 4YP3A 4UAZA 5J0TA 8ICCA 4YQWA 4CF5A 2HSZA 1ZQCA 1T4GA 4F5QA 4XUSA 1N5WA 4UQGA 3Q8MA 4C8KA 2E8NA 3HKZF 2AU0A 1L7OA 4IL6U 2DPIA 9ICAA 1A0PA 5C5JA 2LYHA 3V7LA 3QUBA 5J2DA 4ECUA 3PSTA 2KE7A 1A77A 3GDXA 3RB4A 4Y2UA 1Q3VA 1L7NA 3FAHA 3AQEA 2BCQA 1BPXA 1XO1A 4Y2TA 2WAQC 4RQ1A 5JU5A 4I29A 4KX5A 3SYZA 4GLXA 5ALEA 2W04A 8ICRA 2W03A 2W7PA 4GXIA 4UB5A 1S0MA 4FZLA 2HDOA 9ICJA 5KT2A 1NKBA 4KN4A 4RT2A 1WYGA 5IIOA 4G9BA 4KTQA 4KLSA 9ICBA 8ICMA 4EELA 4UAUA 2JEGA 5AK4A 4R64A 3AL0B 4J03A 3QUTA 3GFKB 2HBJA 4RNOA 2F3NA 1KRPA 9ICTA 1S0OA 1SV4A 4QZ9A 4KLTA 3C28A 5KFPA 2KIWA 2H3ZA 3C2MA 2WAQF 2QB0A 5KL8B 5KFJA 4K4GA 5ALUA 4F50A 5J0WA 1BNOA 3H0MB 1N5XA 2E8MA 2HBKA 4RPXA 5F9LA 1ZD2P 3H40A 2ISOA 3GV7B 2Y9UA 4F72A 5KFHA 5ALYA 5AM5A 4Q8EA 2VA2A 8ICVA 4NY8A 2BR0A 5F3XB 4B9NA 2K8BB 2NRVA 3GZFA 4JWMA 1TK8A 4ECWA 2B21A 5IILA 4DFJA 3D2QA 4GIBA 1UA0A
chains in the Genus database with same CATH topology
1X6JA 1X6IA 2JR5A 2LM4A 1PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6J A;  1X6I A;  2JR5 A;  2LM4 A;  1PUZ A; 
#chains in the Genus database with same CATH topology
 1U49 A;  4DSF A;  2MUT B;  5AHX A;  3JPO A;  1TV9 A;  4IC9 A;  2W9C A;  4MEY A;  2KMD A;  4NWI A;  4QNL A;  2XCA A;  1NJX A;  3CNH A;  4CF3 A;  5J0X A;  2C2D A;  1QQ5 A;  4P0P A;  2G08 A;  3H0R B;  3PX6 A;  3AM9 A;  4F93 B;  5DGB A;  3LDA A;  4I2E A;  2OM6 A;  3V72 A;  3G6X A;  1NK7 A;  2BPF A;  4M9J A;  4DFD A;  2H5X A;  1B4F A;  4PL1 A;  7ICS A;  2HHX A;  2JH7 A;  2RHF A;  2HHW A;  3V6K A;  1T7P A;  3NS1 A;  1KFD A;  2RLT A;  3Q8K A;  2DUY A;  3JPT A;  4F4W A;  4OJ6 A;  5KG1 A;  3MDC A;  3UMG A;  1BPZ A;  1FIQ A;  1ZQP A;  5IIN A;  2FE9 A;  4KLI A;  2H3V A;  2KKV A;  5KFU A;  3R9K A;  3MFH A;  1X42 A;  5DLG A;  2UVR A;  1PZN A;  4QZA A;  3QX7 A;  5HP4 A;  1F0M A;  2W43 A;  2MAX A;  5KFF A;  2KOB A;  5ALN A;  4F5O A;  1NK0 A;  5DBA A;  2G09 A;  1U48 A;  4TUP A;  2HHS A;  4P0Q B;  3RB6 A;  4CRX A;  1UHU A;  5DLF A;  1X6I A;  3QU9 A;  1F44 A;  4QZF A;  4YVZ A;  4PHA A;  1RG6 A;  4RZR A;  8ICI A;  4BWM A;  3DV9 A;  2GWS A;  4JB3 A;  3AU2 A;  5C0Y A;  1Q46 A;  3PR5 B;  4IQU A;  2BZF A;  1JRO A;  8ICL A;  2ZTE A;  9ICN A;  1Z00 B;  3SAG A;  2Z7J A;  4I2A A;  1JMS A;  1KL9 A;  4F4Z A;  5L1M A;  4B9S A;  3QU4 A;  1ZQI A;  1NK9 A;  1UQV A;  1HUZ A;  1DOQ A;  2YB4 A;  2ODG A;  2H3Q A;  5ALO A;  4FS2 A;  3RAQ A;  5CHG A;  3JPQ A;  4KLU A;  3TAQ A;  3RB0 A;  5AM1 A;  1PVP A;  3I76 A;  4Y2S A;  1IV8 A;  5DB9 A;  2MUT A;  5DB6 A;  5L1L A;  1RYU A;  5GTH U;  4JWN A;  3M9M B;  2UVU A;  5CR0 A;  5AM3 A;  4R65 A;  4M6W A;  1U4B A;  2D3D A;  2HOQ A;  4XRH A;  4M9N A;  5KFL A;  3ETL A;  2ZXI A;  8ICJ A;  2EAM A;  4BDP A;  3N4M B;  4IR9 A;  3FM9 A;  4PZN A;  4RQ2 A;  2IOH A;  3K4G A;  4R63 A;  1QH9 A;  2PXI A;  2ZUB A;  2K4P A;  5HHH A;  3ZDB A;  5KFM A;  4O9M A;  3SAH A;  4KLQ A;  4F5R A;  8ICG A;  1N48 A;  3GIL A;  1CEZ A;  2IHM A;  2XO7 A;  2RDJ A;  3KKA C;  1Z4N A;  4QZH A;  1LKY A;  1TAM A;  4JV2 A;  2DBY A;  4NL9 C;  3KKA A;  2GO7 A;  4P4M A;  3JPS A;  4NL9 A;  3C2K A;  3ZDE A;  4ZH4 A;  5J0Q A;  2AQ0 A;  5T14 A;  1SXD A;  4YMM A;  2FDR A;  2ALZ A;  1ED1 A;  3WKE A;  2KEY A;  2KTQ A;  1BGX T;  5AK5 A;  1NJW A;  2ZIX B;  4YR3 A;  4KMO B;  2XID A;  7ICQ A;  4YCX A;  5J2G A;  1IG6 A;  1S77 D;  1LVH A;  5KNI A;  4MEX A;  4ECY A;  3T3F A;  5AM0 A;  5HMM A;  2EZZ A;  1ZJM A;  4DSI A;  2Y1J A;  4QWE A;  3RJE A;  3ZDD A;  2V9W A;  5KFB A;  2WF7 A;  9ICM A;  3QU2 A;  2FI1 A;  1UT8 A;  1NJZ A;  5HNK A;  2Y0S C;  5J0U A;  5ALK A;  5DBB A;  3GIJ A;  2MRL A;  5L1I A;  1C7Y A;  3WK4 A;  4Q8F A;  2KD1 A;  5G5G A;  4ED3 A;  1Z00 A;  2KVC A;  7ICU A;  5AIC A;  5ALS A;  4UB6 U;  4Z6F A;  3ALR A;  2W55 A;  1RZT A;  5KG3 A;  2E5S A;  4TUR A;  4QZC A;  1BVS A;  4JV1 A;  4KLJ A;  5ALX A;  4PJ0 U;  4Y2R A;  2BDU A;  2IOF A;  3MR2 A;  2Y0S F;  2F1I A;  1KEJ A;  5ALJ A;  1OUQ A;  2KV2 A;  2MA1 A;  2ZUD A;  4QZE A;  4M2Y A;  4ED0 A;  2FMQ A;  1ZQS A;  4DFM A;  2KJ9 A;  4KLL A;  4DOC A;  4RQ7 A;  2OWO A;  2M0N A;  4EEN A;  3CYM A;  3L3F X;  4GC6 A;  4DLG A;  5EE0 A;  3BQ2 A;  1COK A;  2QAR B;  1D8B A;  4Z6E A;  4QZG A;  1ARO P;  3OSN A;  3BS5 A;  2JXJ A;  3OHA A;  2W3R A;  1IXR A;  2H3I A;  4FZN A;  4O5K A;  5EWF A;  1SKS A;  2AQ4 A;  3T5J A;  7ICF A;  4Q43 A;  3H8W A;  7ICI A;  8ICZ A;  2FPK A;  2ZIV B;  4US8 A;  3AQF A;  2KNJ A;  1N62 A;  4US9 A;  5DBC A;  3GV8 B;  2Q4T A;  3O0F A;  2C22 A;  1DK2 A;  1S76 D;  4RQM A;  1ECW A;  4BGD A;  5L1K A;  1NOM A;  1Z1B A;  2C2E A;  1U45 A;  4Z6D A;  3V6J A;  4C4S A;  2E3T A;  2I1Q A;  2HVI A;  4BUG A;  3K75 D;  4OJP A;  4J9P A;  2WHE A;  1ZQL A;  4EX7 A;  2XGP A;  1ZD3 A;  1NK5 A;  1N56 A;  3WK6 A;  1SB3 C;  5KFV A;  3RFA A;  3GU3 A;  4KN7 A;  1SZP A;  4O3N A;  1SV0 C;  4Y2Y A;  3TAP A;  1SV0 A;  4DFP A;  4I2B A;  2O6K A;  3PX4 A;  4DOA A;  1K1Q A;  2LBO A;  5GTI U;  7ICN A;  3CRX A;  2P35 A;  1X9X A;  4DL5 A;  2E1E A;  4F4Y A;  2EAN A;  1Q8K A;  3NTU A;  1N61 A;  1Z1V A;  2JH1 A;  3M9N B;  5J8Y C;  1IM4 A;  5AI6 A;  5DB7 A;  4QZI A;  4EZ6 A;  5J8Y A;  5AI9 A;  2KP7 A;  4B9T A;  5KFW A;  2CN1 A;  1XS9 D;  1NI3 A;  5J2A A;  2N1R A;  4DS4 A;  2WF6 A;  4DF4 A;  1N2X A;  2PFQ A;  4QZB A;  5F9N A;  4NLG A;  9ICR A;  1O03 A;  4I2H A;  4PGQ A;  2KJ5 A;  2ZJ8 A;  3WK7 A;  3RF9 A;  1CRX A;  4GC7 A;  2OEH A;  3T5L A;  3Q8P B;  1NKE A;  1QLN A;  2H3F A;  5BOM A;  3HIL A;  1F5S A;  9ICW A;  3EUB 2;  1H38 A;  4IR1 A;  2YTU A;  1UT5 A;  3D6J A;  1XSP A;  2R8H A;  1ZQN A;  5B66 U;  3AMZ A;  5L1J A;  4FO6 A;  3OJS A;  3EPG A;  1Z4O A;  7ICR A;  2QLT A;  5CWR A;  3ZD9 A;  2ZXH A;  5KL1 B;  1RQL A;  3BS7 A;  4OJ5 A;  2D6F C;  3MAB A;  2KSO B;  2HVH A;  5KFI A;  1A6S A;  3TAD C;  5CB1 A;  3TAD A;  3PZP A;  4LJX A;  2W9B B;  3OJU A;  3SI8 A;  2YML A;  5TZV A;  4UAY A;  1TK5 A;  2QB1 A;  5DG9 A;  5KG4 A;  4DLE A;  2KIV A;  4ECS A;  4B9L A;  3EYZ A;  5AKJ A;  2GOL A;  4DSK A;  3RTV A;  2A1J B;  9ICV A;  1OXJ A;  3RJF A;  2GH1 A;  3RJI A;  2MSN A;  4JV0 A;  2LM4 A;  9ICS A;  5ALT A;  4YR0 A;  3ORY A;  1M6Y A;  3LVV A;  8ICY A;  4C8N A;  4FE3 A;  4UAR A;  2LPE A;  3B0Y A;  2BQ3 A;  1Z19 A;  2JZB B;  5J2C A;  7ICE A;  4P2H A;  1J2M A;  4F2R A;  3UXO A;  2F1H A;  4ED2 A;  1P7D A;  4IRD A;  4YFK A;  9ICG A;  1KSP A;  2UVW A;  3DDH A;  5EWG A;  2JEJ A;  1MQ2 A;  1ZQK A;  1QQ7 A;  1XSN A;  2OH2 A;  4JK1 A;  1COO A;  5E79 U;  2IA6 A;  2YX8 A;  3BZK A;  7ICG A;  4RQ5 A;  2HW3 A;  1HJP A;  2JMG A;  1ZQD A;  3RJK A;  2XCP A;  1SWV A;  3GQC A;  4Q44 A;  2G5I B;  4RUC A;  2WTF A;  5ALP A;  3BQ0 A;  4ECZ A;  3C29 A;  9ICP A;  4C0Z A;  3OTQ A;  3Q8R B;  5J0R A;  4PH5 A;  1T8E A;  2EAP A;  4EEK A;  4OJO A;  3WK8 A;  3RR7 A;  1WWV A;  5BOL A;  4BXO B;  3MR5 A;  3WKD A;  4NM1 A;  1S0V A;  4KLG A;  4Y2P A;  3FC4 A;  2W3S A;  5ALG A;  3PW4 A;  2P66 A;  2KSO A;  2C2R A;  4E0D A;  5ALH A;  5AKG A;  4ELU A;  3KHL A;  3KHH A;  3H8J A;  1ZQE A;  4YR2 A;  1C20 A;  9ICK A;  2HOI A;  1KDH A;  1JI7 A;  3H8S A;  5CRX A;  1GO3 F;  2F8K A;  2RQ5 A;  3C23 A;  4QW9 A;  2NO4 A;  5DDM A;  4NXZ A;  4DO9 A;  2CXY A;  2WB1 C;  3M1Y A;  2BQU A;  5KFG A;  4PGX A;  8ICB A;  3OHB A;  1QQ6 A;  2A19 A;  3F5A A;  5ALZ A;  1RYR A;  3MC1 A;  3RRG A;  2BGW A;  3QU5 A;  9ICF A;  1ZQU A;  2KFZ A;  3THV A;  1RDF A;  4RNM A;  2IOF K;  2F8L A;  3F2D A;  2AGQ A;  1LV5 A;  3HX0 A;  4QWC A;  1J97 A;  1V97 A;  3UQ2 A;  2AGO A;  3NVV A;  3EPI A;  3KBB A;  5J2H A;  2JZB A;  4I28 A;  7ICJ A;  3I28 A;  3DEE A;  5KG0 A;  3B0X A;  2G07 A;  3ICX A;  1ZQV A;  3AU6 A;  3E2E A;  5G5H A;  1BPB A;  2OCE A;  1NK4 A;  4OO1 J;  3RH4 A;  7ICT A;  2IBK A;  2ZTC A;  3F2B A;  1T3N A;  5HHI A;  8ICT A;  4FS1 A;  2ZTD A;  3VCB A;  2PFN A;  3PSF A;  3PX0 A;  4QIW C;  3TAR A;  2BCV A;  2E8P A;  4G3I A;  3PW5 A;  4I2I A;  3N28 A;  1B22 A;  1ZQX A;  3HT3 A;  5DQH A;  4EX6 A;  1RM6 C;  2VA3 A;  2AHO B;  4NLK A;  3UM9 A;  4DQP A;  4CGZ A;  5AKH A;  4DQI A;  3QEB Z;  3M8S A;  2LYB A;  4R8U B;  7ICO A;  5AKY A;  3ZI4 A;  1CI4 A;  2JGA A;  4QIW F;  5J2F A;  4P4O A;  5TIS U;  5DDY A;  5JUM A;  5AK6 A;  4BXO A;  3QZ8 A;  4BWJ A;  4FZM A;  1ZQM A;  1ZOL A;  2W11 A;  5DQG A;  2V4Q A;  4TUQ A;  4XA5 A;  4J9S A;  1X9M A;  1SWW A;  2KZZ A;  2OXO A;  8ICF A;  4FBU A;  2E1F A;  5ALR A;  4RQN A;  2R8J A;  2F2A B;  1L8L A;  7ICL A;  5J0S A;  4P0Q A;  2FPL A;  3IHQ B;  2LI6 A;  1JAL A;  4QZ8 A;  4KIT B;  1S97 A;  3MDA A;  1LB2 B;  4ECQ A;  4B6J A;  3NVY A;  3G6Y A;  3HRD D;  3MFI A;  4ICA A;  1UPH A;  4UW9 A;  4MFF A;  4MFC A;  1UCV A;  4YD2 A;  3QZ7 A;  2AH5 A;  2XY5 A;  1Z3E B;  3BQ1 A;  1YT3 A;  1ZD5 A;  4PHP A;  5KFO A;  1TKD A;  5ALW A;  1O08 A;  5EE1 A;  1CUK A;  4QWB A;  3BZC A;  5CJ7 A;  1SKR A;  2R8K A;  4RQ8 A;  4C8M A;  4ED7 A;  1B43 A;  5HR7 A;  2VAN A;  4J9O A;  3Q8Q B;  5HR6 A;  1FO4 A;  2LM1 A;  4NLZ A;  1QSL A;  4RPZ A;  4IS7 A;  4UB4 A;  1HUO A;  4PHD A;  1L3U A;  4I2C A;  5J0Y A;  1J2N A;  3PW2 A;  2PI5 A;  2DPJ A;  3H4B A;  1TAU A;  4BJQ A;  2KJ8 A;  3ED5 A;  3UXP A;  4DL7 A;  5KFQ A;  2KZM A;  1WWU A;  2JRZ A;  2LHT A;  1D9F A;  2HMX A;  4ELT A;  3TQ1 A;  5AI4 A;  3QUC A;  4IQT A;  5KFC A;  3GIK A;  2XIC A;  4Y2J A;  3PNC A;  4EBC A;  2W54 A;  4M9G A;  1AQ6 A;  2XI9 A;  3B9J A;  3EW9 A;  2VJ5 A;  1L7P A;  5III A;  2K8C B;  3N97 B;  3D2N A;  4O3P A;  3QNM A;  4R8U A;  3SQI A;  1DXS A;  2FMS A;  1IIP A;  5CEH A;  3IRU A;  3MR6 A;  4DFK A;  2HOF A;  2ASD A;  4I2J A;  1VLB A;  5KFK A;  8ICE A;  1MA7 A;  4EEY A;  4NLC A;  1EXN A;  4AYB C;  1PK3 A;  1X6J A;  2Y9T A;  4C80 A;  5DGA A;  4Z6C A;  1KQQ A;  2F77 X;  4KLO A;  4F5P A;  3IN5 A;  1UA1 A;  2EZX A;  4ACO A;  2ZIX A;  4F2S A;  2JEI A;  4EZ9 A;  5KFR A;  1SGG A;  4Q45 A;  2E8O A;  3ISC A;  3RH5 A;  4O3O A;  4YD1 A;  2K60 A;  1ZQF A;  1FFV A;  3KHR A;  3LK9 A;  1TFR A;  3HPO A;  3UPQ A;  2FPM A;  2KN7 A;  2DGZ A;  2HBM A;  3NRZ A;  3GV5 B;  3AN1 A;  4K4I A;  2FLN A;  4WJ3 B;  2WF9 A;  2Y1I A;  3H8M A;  4OCZ A;  2XY7 A;  5KFA A;  2CPR A;  3SD7 A;  1JN3 A;  1ZQ1 C;  2Q0Z X;  4GXJ A;  4UB8 U;  3ZDA A;  3QEA Z;  5AM4 A;  4JUZ A;  4DQQ A;  4UBB A;  5KFS A;  1L6N A;  2YN4 A;  2HHQ A;  4YN4 A;  2B0C A;  3PML A;  2WF8 A;  2K4H A;  4QZD A;  1U47 A;  4MFA A;  2BCU A;  4F4X A;  2QB0 B;  2FMP A;  1X2I A;  1QSY A;  5AKL A;  4NJ8 A;  2KFN A;  3K1Z A;  2OHF A;  3PVX A;  4JMU A;  5AKE A;  2PMZ C;  3IP4 B;  4O0I A;  2FLL A;  4K4H A;  2VA8 A;  5BPC A;  4EBD A;  2P6R A;  4FBT A;  9ICL A;  1TAQ A;  4ED1 A;  3QUQ A;  2UVV A;  7ICV A;  1XU4 A;  2QAR A;  1S9F A;  4ECR A;  2ZIW B;  1PK1 B;  2J6S A;  5ALQ A;  5ALM A;  1S5L U;  4UB1 A;  1B0X A;  4F91 B;  3PR4 A;  3IG8 A;  3SAF A;  4YG2 A;  2DWQ A;  3BJY A;  1WCL A;  5AI0 A;  5KFN A;  4J9Q A;  4U7C A;  4PPX A;  2PMZ F;  5DB8 A;  5A0L A;  2VKQ A;  2W9C B;  5AI8 A;  1S10 A;  2KK0 A;  3OGU A;  4TQS A;  2W8L A;  4YMN A;  1NK8 A;  2NO5 A;  4PZO A;  2IHN A;  2AJQ A;  5JRT A;  2ASJ A;  5J0P A;  3ONN A;  5EE3 A;  4QW8 A;  1JUD A;  4C4T A;  4P0P B;  1KFT A;  4C7Z A;  2ZIV A;  3Q8L A;  2K4I A;  3WK5 A;  2G5H B;  1X9W A;  2F1J A;  2EAO A;  2KHQ A;  2C28 A;  4RUA A;  1MN8 A;  1MSW D;  4UB2 A;  7ICP A;  3KFU F;  4ELV A;  2DKZ A;  1ZQZ A;  5KAF U;  3KZX A;  2NYV A;  3TFR A;  9ICI A;  4UBC A;  1S0N A;  2W7O A;  4DCC A;  4RNN A;  2ATL A;  1ZQR A;  1V85 A;  2DF4 B;  5IIM A;  3UXN A;  4UAS A;  1L7M A;  2ZIU B;  5KTQ A;  1SKW A;  4YXM A;  4HYK A;  3MR3 A;  3WKA A;  3RB3 A;  1HIW A;  3OSP A;  3PO5 A;  3BQ7 A;  1SZH A;  3H0L B;  1YZ7 A;  1S8O A;  5KT4 A;  9ICH A;  3F5E A;  4CF4 A;  1DK3 A;  2BDP A;  3CP8 A;  4O3R A;  5AKK A;  1X66 A;  1ZXI A;  1ZQG A;  1TE2 A;  4CCH A;  2XVT A;  1TK0 A;  3V7J A;  1D8Y A;  1PVQ A;  2NRW A;  2K89 A;  2R8I A;  2FLP A;  4HAI A;  3NGD A;  2KZ3 A;  5EE9 A;  4DSJ A;  3T5H A;  5KFE A;  2NV3 A;  2RDI A;  9ICO A;  3TKA A;  1NZP A;  5AKX A;  1ZQO A;  2W8K A;  3RBD A;  3JPP A;  2AXT U;  4BX9 C;  8ICA A;  3NAS A;  1ZET A;  3E0F A;  3KTQ A;  3WKC A;  8ICH A;  9ICQ A;  2EQY A;  1NK6 A;  4O3S A;  1KTQ A;  3L4P A;  4EBE A;  1KFS A;  3I1Y A;  3UQ0 A;  4TQR A;  3S6J A;  4A8E A;  2NRT A;  2KVS A;  1XC9 A;  2ZIW A;  1PK1 A;  1RXV A;  1NNL A;  5CA7 A;  1NJY A;  1RQN A;  4PHE A;  4OD0 A;  3WU2 U;  4RQ3 A;  2VIX A;  2CRX A;  5KFT A;  4UAW A;  5KT5 A;  1QTM A;  3N7P D;  2R18 A;  5IIJ A;  2KKP A;  4KLM A;  5KG7 A;  4M6W B;  4NV0 A;  4DS5 A;  4B9U A;  1SL0 A;  5AM2 A;  2XY6 A;  5H2F U;  3U26 A;  4USA A;  1MQ3 A;  2DFL A;  3NRW A;  2DKX A;  4DQS A;  2W9M A;  2LKY A;  2HHV A;  3PW7 A;  1XWL A;  1V9P A;  5D49 A;  1JRP A;  1N63 A;  3KHG A;  5ALD A;  2YY6 A;  3EWA A;  2ZG6 A;  2A3V A;  2ASL A;  4I2D A;  5AIB A;  3IG5 A;  3IV6 A;  1T94 A;  2ZJA A;  4Y2X A;  5KFX A;  1SL2 A;  1FFU A;  2OYY A;  2YMP A;  2ZIU A;  2EZY A;  1DGJ A;  1SXE A;  2FJ6 A;  4DL4 A;  1LKY B;  2W9B A;  2K4E A;  3EZ5 A;  2F44 A;  4CE6 A;  3TI0 A;  3ETR A;  4DF8 A;  1JXE A;  2PFP A;  7ICH A;  1VJ5 A;  3UMC A;  2A1J A;  4ZOH C;  5JTI A;  3QXG A;  3KZI U;  1ZRM A;  2I6X A;  4I27 A;  2DL0 A;  2DQN B;  3MGI A;  3NVZ A;  5DQI A;  1X40 A;  2ISP A;  4XQ8 A;  2HI0 A;  1ZRN A;  4NLB A;  5IIK A;  2XC9 A;  1ZQH A;  3PMN A;  1L3V A;  3RRH A;  5B5E U;  3LWL A;  7ICK A;  4DSE A;  1DGS A;  3VC8 A;  3ZD8 A;  2WB1 F;  3BDP A;  4RT3 A;  4KX3 A;  5D46 A;  4LZG A;  1U9L A;  2V4R A;  1KN5 A;  2MU2 A;  3H7I A;  3Q8S B;  1Y88 A;  4PGY A;  3IM1 A;  4J9K A;  2B6G A;  4OJL A;  4C7Y A;  1V38 A;  1WCN A;  5KFY A;  5J0O A;  1D9D A;  4M04 A;  4F5N A;  3T5K A;  1L5U A;  1Q3U A;  2PI4 A;  3QE9 Y;  3PY8 A;  2J6U A;  4J9N A;  4AP9 A;  2ES6 A;  2M9N A;  1VDV A;  1BNP A;  4LVS A;  5J2J A;  4MF2 A;  3N7R C;  3UMB A;  2WF5 A;  3PW0 A;  3FYH A;  5ALF A;  4GFJ A;  4DL6 A;  1KBU A;  3K1R B;  1BPD A;  3M7D A;  1BPY A;  4M9H A;  3BS5 B;  3C2L A;  9ICE A;  3H4D A;  2EDU A;  2YQE A;  4DL3 A;  3C5G A;  3QU7 A;  3MGH A;  4C8L A;  1D8L A;  4NM2 A;  1N60 A;  4M47 A;  3L5K A;  2HBL A;  1WG8 A;  3QYP A;  3PO4 A;  3RJJ A;  5AKZ A;  3N7S C;  8ICO A;  1XO0 A;  3AUO A;  4QJF B;  2GLE A;  3C1Y A;  4F71 A;  2G06 A;  8ICK A;  5EOZ A;  3MBY A;  3RH6 A;  2NRZ A;  3TFS A;  3HJE A;  1T3Q A;  4PL2 A;  3J81 j;  3JPR A;  3SEN A;  3GIM A;  1ZQW A;  2BHN A;  2J6T A;  1QSS A;  1A76 A;  2IMW P;  4KLH A;  2BPC A;  3KOO A;  3OPX A;  5AIA A;  4UAV A;  4LZD A;  1JXL A;  4I2G A;  2D8C A;  3C1Z A;  1NKC A;  3A0H U;  8ICP A;  4EYH B;  5KFZ A;  3E58 A;  2A1A A;  4CDG A;  3F53 A;  3GII A;  2W9A A;  4J9M A;  1MC8 A;  3BQT A;  1ZQT A;  4U6P A;  3JPN A;  1PUZ A;  5J29 A;  4B9V A;  4KLF A;  1ZQQ A;  3LWM A;  2JEF A;  8ICU A;  2ESE A;  2AGP A;  8ICS A;  3HP6 A;  1JIH A;  1JX4 A;  2JV3 A;  1NZB A;  4KLE A;  5K4L A;  2F76 X;  3G6V A;  3AEV A;  2I5H A;  5CP2 A;  5J2B A;  2P6U A;  4O5C A;  3SR6 A;  5DG8 A;  4DOB A;  4DSL A;  4IRK A;  4RU9 A;  8ICX A;  4UAT A;  1RXW A;  1KLN A;  1SL1 A;  3M9O B;  9ICU A;  4QWA A;  4O3Q A;  2K8A A;  3LYS A;  4RQ6 A;  1URJ A;  9ICX A;  2JHD A;  5HML A;  3SEI A;  3MGV A;  4J9R A;  4DWI A;  1X9S A;  3IDW A;  2NRX A;  4YMO A;  2EH9 A;  1WUD A;  3SMV A;  3NVW A;  4C8O A;  8ICN A;  2WFA A;  1RPL A;  1L3T A;  4M0A A;  4YXJ A;  3M8R A;  2PFO A;  5D4B A;  5DG7 A;  4NLN A;  2RRD A;  4Y2Q A;  4MF8 A;  5J2K A;  5L9X A;  1KKX A;  4IQW A;  4ED6 A;  3SV3 A;  1QCK A;  3PV8 A;  4B9M A;  2QKQ A;  1KW4 A;  1ZYQ A;  1L3S A;  4KMU A;  2BCR A;  2G0A A;  4O3M A;  4RPY A;  5KG6 A;  3SZ2 A;  1ZQB A;  2ZJ5 A;  3ISD A;  4F3O A;  4AYB F;  4DEZ A;  4MHV A;  2YMM A;  4F4K A;  8ICQ A;  3TAN A;  2RP5 A;  1HEK A;  5ALL A;  2BPG A;  1K5O A;  2ZUC A;  5KT6 A;  3V6H A;  4DL2 A;  1L8O A;  3FDS A;  4P4P A;  4X5V A;  2KHV A;  5KG5 A;  4RQ0 A;  3HWT A;  4F92 B;  4ECX A;  1OW5 A;  5KFD A;  4ECV A;  4R66 A;  4M9L A;  3C5F A;  2YMQ A;  1SIJ A;  5DKW A;  4IRC A;  2BQR A;  4ED8 A;  3WK9 A;  4ECT A;  2LMR A;  4C4R A;  3ISB A;  1FEZ A;  3A0B U;  1ZQA A;  5AK3 A;  4J9L A;  1K1S A;  3TAC B;  2L5Y A;  2VJ4 A;  5KT3 A;  3D2S A;  3PSP A;  2JR5 A;  1DRG A;  2BKE A;  2HCF A;  1ZQJ A;  1YZ6 A;  8ICW A;  4DQR A;  5AKI A;  3PSI A;  1BPE A;  1ZD4 A;  5ALI A;  4QWD A;  4TUS A;  2KG5 A;  4GXK A;  3CW2 C;  9ICC A;  5KG2 A;  1ZQY A;  5J2E A;  2XGQ A;  4Y2V A;  5KT7 A;  4IQV A;  2R8G A;  3SV4 A;  2KIC A;  3RAX A;  3M6Z A;  4EYI B;  3M6K A;  4KLD A;  5EWE A;  1ZJN A;  3ZDC A;  3WKB A;  5AI5 A;  5J2I A;  2HHT A;  3F2C A;  5FP0 A;  3NUQ A;  3LVW A;  4FFD A;  5ALV A;  3V7K A;  3RJH A;  3KD3 A;  2YB1 A;  2I9G A;  7ICM A;  4RQ4 A;  2LYA A;  1RYS A;  2HHU A;  4UB3 A;  3HKZ C;  3C21 A;  3HW8 A;  1XSL A;  1XNS A;  1PVR A;  3T79 A;  3RJG A;  4I2F A;  2PKE A;  3RBE A;  4F8R A;  1TVA A;  5KAI U;  4CNQ A;  2BCS A;  3RR8 A;  4O5E A;  4YP3 A;  4UAZ A;  5J0T A;  8ICC A;  4YQW A;  4CF5 A;  2HSZ A;  1ZQC A;  1T4G A;  4F5Q A;  4XUS A;  1N5W A;  4UQG A;  3Q8M A;  4C8K A;  2E8N A;  3HKZ F;  2AU0 A;  1L7O A;  4IL6 U;  2DPI A;  9ICA A;  1A0P A;  5C5J A;  2LYH A;  3V7L A;  3QUB A;  5J2D A;  4ECU A;  3PST A;  2KE7 A;  1A77 A;  3GDX A;  3RB4 A;  4Y2U A;  1Q3V A;  1L7N A;  3FAH A;  3AQE A;  2BCQ A;  1BPX A;  1XO1 A;  4Y2T A;  2WAQ C;  4RQ1 A;  5JU5 A;  4I29 A;  4KX5 A;  3SYZ A;  4GLX A;  5ALE A;  2W04 A;  8ICR A;  2W03 A;  2W7P A;  4GXI A;  4UB5 A;  1S0M A;  4FZL A;  2HDO A;  9ICJ A;  5KT2 A;  1NKB A;  4KN4 A;  4RT2 A;  1WYG A;  5IIO A;  4G9B A;  4KTQ A;  4KLS A;  9ICB A;  8ICM A;  4EEL A;  4UAU A;  2JEG A;  5AK4 A;  4R64 A;  3AL0 B;  4J03 A;  3QUT A;  3GFK B;  2HBJ A;  4RNO A;  2F3N A;  1KRP A;  9ICT A;  1S0O A;  1SV4 A;  4QZ9 A;  4KLT A;  3C28 A;  5KFP A;  2KIW A;  2H3Z A;  3C2M A;  2WAQ F;  2QB0 A;  5KL8 B;  5KFJ A;  4K4G A;  5ALU A;  4F50 A;  5J0W A;  1BNO A;  3H0M B;  1N5X A;  2E8M A;  2HBK A;  4RPX A;  5F9L A;  1ZD2 P;  3H40 A;  2ISO A;  3GV7 B;  2Y9U A;  4F72 A;  5KFH A;  5ALY A;  5AM5 A;  4Q8E A;  2VA2 A;  8ICV A;  4NY8 A;  2BR0 A;  5F3X B;  4B9N A;  2K8B B;  2NRV A;  3GZF A;  4JWM A;  1TK8 A;  4ECW A;  2B21 A;  5IIL A;  4DFJ A;  3D2Q A;  4GIB A;  1UA0 A; 
#chains in the Genus database with same CATH homology
 1X6J A;  1X6I A;  2JR5 A;  2LM4 A;  1PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...