2LM4A

Solution nmr structure of mitochondrial succinate dehydrogenase assembly factor 2 from saccharomyces cerevisiae, northeast structural genomics consortium target yt682a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQEFSENKEKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase assembly factor 2, mitochondrial
publication title Solution NMR structure of yeast succinate dehydrogenase flavinylation factor sdh5 reveals a putative sdh1 binding site.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2lm4A01
2JR5A 1X6IA 1PUZA 1X6JA 2LM4A
chains in the Genus database with same CATH superfamily
1U45A 1L7OA 4R63A 1X6IA 2HCFA 5J2EA 2J6SA 5J2FA 1PUZA 4LZDA 5DDMA 2GWSA 2E8MA 5KFRA 5CRXA 3MDCA 1KRPA 4J9KA 1NK4A 2W03A 4UATA 1KFDA 7ICTA 3MR5A 4ECUA 4EENA 4F2RA 2EANA 1L7NA 8ICSA 2HBKA 4YR2A 1ZQHA 1RXWA 2KJ5A 1SB3C 1ZYQA 4ELTA 5AM0A 4F92B 2B6GA 4NLBA 1X42A 4B9SA 4RQ2A 4B9TA 3KKAC 2Y1IA 2PFNA 3QUCA 3EWAA 4FO6A 4UW9A 2OM6A 3PSFA 1XSPA 2JH1A 2DL0A 2QARB 5B66U 1L8LA 3RBDA 3QUBA 2JV3A 3ZD8A 2K4EA 4RUCA 3SMVA 3NVWA 2HSZA 5L1IA 5DG7A 2JR5A 4DOBA 1ZQPA 1KTQA 3L4PA 3NTUA 4E0DA 3T5KA 4ED2A 4TQRA 2BCQA 9ICFA 4EBDA 1J97A 4PHPA 4Z6DA 4PHDA 3BQ1A 1V97A 3JPSA 5DB7A 8ICOA 2HOFA 4B9LA 4I27A 9ICUA 1FFUA 8ICGA 4PJ0U 4DL3A 5DGAA 1QQ7A 5J2HA 3B0XA 2R8GA 5CA7A 1RYRA 5KG1A 4NLKA 2HHWA 3VCBA 3C2MA 2AGQA 3RFAA 5AM2A 2DF4B 2K4PA 3UPQA 4DF4A 4IRCA 3AM9A 3ZDAA 3QXGA 2EH9A 3AU2A 4YCXA 2XGPA 1TAUA 4ICAA 3QZ7A 3NGDA 2W8KA 4KLTA 2DGZA 1S10A 3WKCA 4KLUA 5HMLA 3RJEA 1C20A 3HJEA 1MN8A 5KT5A 2BPFA 2NO4A 4DSJA 1KW4A 4JUZA 3ISCA 3G6XA 3F2CA 3EPGA 1KFSA 3C1ZA 4F5RA 2NRVA 5KFXA 3LVWA 4P4OA 2V4QA 2WHEA 5DQHA 2Y0SC 4DL7A 1TAMA 1JN3A 2YB1A 5AIBA 3K1RB 4JK1A 2HHXA 3QEAZ 3AQFA 3IRUA 3MR3A 3WK6A 4C8LA 4KX5A 2ASDA 4GXJA 7ICRA 2QARA 3UXPA 2M9NA 4DO9A 9ICXA 4RPZA 1F5SA 3QZ8A 1JALA 2W7PA 5J2KA 3H8SA 5KFDA 2WF6A 3V7JA 1U9LA 1Z3EB 4YMMA 3PSTA 4KN4A 1KDHA 2G08A 4EEKA 4QZBA 2F76X 4OD0A 3GQCA 4Y2XA 5D49A 2XVTA 3GILA 1JXLA 3SV4A 4DLEA 2AU0A 4DL6A 1QQ5A 3TFSA 1Q3UA 1SXEA 3GIKA 2KICA 1JUDA 5FP0A 8ICQA 2HVHA 1T8EA 4YXJA 1ZQEA 4P2HA 5KT3A 2JEIA 5ALOA 3QE9Y 4KLEA 3ED5A 2XGQA 2D3DA 4UB5A 4PGXA 3KZIU 4RPYA 9ICKA 4YR0A 1L6NA 1IIPA 3L5KA 4UBBA 4QZAA 2PMZC 4TURA 2VKQA 3I28A 1S97A 3L3FX 2JEJA 2FPLA 1QSSA 2HOIA 4USAA 4F4KA 1PVRA 4QZFA 4TUSA 2BQ3A 4ZOHC 2Y0SF 4C4RA 2ZJ5A 2RQ5A 1PZNA 7ICGA 2ZIUB 3SYZA 3BDPA 3E2EA 2ZG6A 4OJLA 1RQLA 3T3FA 1J2MA 5J0XA 2KIVA 3GU3A 5J2JA 8ICIA 2WB1C 7ICUA 2W54A 2C28A 4P4PA 3PMNA 2LBOA 4I2AA 2Q0ZX 5IIIA 4DLGA 4KLFA 1KKXA 1Q8KA 5ALNA 1ZQBA 3MFHA 2K89A 4RQ8A 5HHHA 4BJQA 1SWVA 4GLXA 5L1LA 3RJKA 4FBTA 2YY6A 4R64A 3Q8MA 1KBUA 4C80A 4M2YA 4NLCA 2NYVA 3GV7B 2W3SA 3GIJA 4DWIA 2ALZA 3TFRA 4ECQA 1FIQA 2K8AA 5IIOA 1ZQIA 1WUDA 2FJ6A 3UQ2A 1DOQA 4NLNA 2H3IA 2KSOB 5KFZA 9ICHA 4UAYA 3M8SA 1JXEA 3IDWA 2BCRA 2I6XA 3CW2C 1ZQQA 3MGHA 1O08A 2V4RA 1DGJA 3ZD9A 3D2SA 1SGGA 3QX7A 4US8A 5DB9A 4EBCA 1ZQDA 4LJXA 1LV5A 3Q8RB 2RLTA 2I5HA 4KTQA 4ACOA 9ICGA 1ZJNA 2WB1F 2ZUDA 2IOFK 1RZTA 4RQ1A 1ZQXA 2XY6A 4X5VA 5AM1A 1QTMA 3T79A 1NKEA 4RT2A 2E5SA 2AGPA 2D8CA 5ALSA 3KHGA 8ICYA 1SV4A 3V7LA 2ZIUA 3SAHA 5KFSA 2F3NA 2MA1A 2C22A 1M6YA 1SIJA 4ECSA 1X9MA 1MSWD 1XU4A 1TAQA 3O0FA 2KZ3A 1S76D 4OCZA 1D9FA 5EE1A 4FZNA 3V6KA 4DCCA 3GV8B 1N60A 5KAFU 2AGOA 2E8OA 1KLNA 5J29A 2PI4A 2P6RA 4NL9A 3RR7A 1A77A 5CEHA 1ZRMA 5F9NA 1KSPA 1NK8A 4DOAA 3F5AA 8ICUA 2RP5A 5J2AA 4CGZA 4DQIA 5KFAA 3PO4A 2E1FA 4IR9A 5EOZA 3JPOA 2WF9A 4TUPA 5J2CA 4DSFA 3V6HA 3M9NB 4DFDA 4PHAA 2OEHA 4R66A 2C2EA 3IHQB 8ICZA 3BQ0A 1BPYA 2KSOA 2ZTDA 1B43A 1NZPA 3K75D 5IIJA 3NS1A 1ZQLA 2NRWA 4M9JA 3ZI4A 2RDIA 5DG9A 1XSNA 4BWJA 3EZ5A 5KFMA 3MDAA 1SL0A 2R18A 3F2DA 2AQ4A 2DPIA 5AK4A 4C8MA 2FLPA 1MC8A 2FMSA 4NLZA 2BQUA 3D2NA 3AEVA 3OGUA 3DV9A 1RYSA 4IS7A 1XS9D 2CXYA 2GO7A 4YXMA 1SKWA 5DB8A 1Z00B 5DGBA 4I28A 4US9A 4NL9C 4CNQA 8ICBA 3RB3A 4O3PA 3MC1A 2DUYA 4FZLA 3RB6A 3MR2A 2LM1A 3PV8A 1VDVA 3TAPA 1SXDA 1NK9A 1T4GA 5ALFA 5KG7A 1RYUA 2DWQA 2E3TA 3PZPA 1T3NA 4ED8A 1U48A 3IV6A 1K1SA 2IOFA 4UB1A 2VA3A 3QU7A 8ICCA 2LPEA 4B9NA 4ELVA 4LVSA 2ZXHA 4C8NA 1S0NA 5AI6A 2XC9A 3R9KA 8ICNA 4TQSA 5J8YC 5BOMA 5AKXA 4F5NA 3T5JA 2ESEA 3PSIA 2ASLA 3H8JA 4F5OA 5KFTA 4MF2A 4EZ9A 4KN7A 2JHDA 4QW9A 2PI5A 4YD1A 1P7DA 2RHFA 7ICSA 1ZOLA 3LYSA 1QH9A 3GFKB 4A8EA 3UQ0A 3E0FA 1HJPA 1QSYA 4DL4A 4ELUA 2W7OA 8ICXA 4P0PB 2ZJ8A 3C5GA 5KFHA 4QZHA 1DRGA 1ED1A 1X2IA 4JMUA 1DK3A 1BNOA 2KTQA 2KJ9A 3M8RA 2EDUA 7ICJA 1D8BA 5AI8A 4EX6A 2L5YA 4P0QB 4CE6A 4O3MA 2F2AB 2BKEA 3H40A 4C4SA 1UHUA 9ICWA 2HBLA 1NK6A 1L3UA 3PX6A 2KHQA 3UMCA 2A3VA 4QZ9A 1RQNA 2EAOA 2ASJA 2IHNA 1SV0A 4UB3A 2HHQA 1Z00A 5L1MA 3RAQA 3N97B 4ECWA 2G5HB 2DKXA 4XRHA 2I1QA 5KG0A 3PNCA 3NVYA 1SZPA 2HW3A 3WK4A 2W04A 4Q8FA 3M7DA 1ZQAA 2OYYA 5ALKA 2KOBA 1S77D 5GTHU 1UA0A 2R8IA 3RH6A 5AM5A 7ICNA 5BOLA 2K60A 1SKSA 5KFQA 5KT6A 4MFFA 5KFJA 2YQEA 2EAPA 1MQ3A 4F5QA 2NRZA 2I9GA 1RPLA 2BPCA 3BJYA 4R8UB 1ZQWA 1IV8A 8ICJA 4DSKA 4ECVA 4MHVA 2IA6A 3LK9A 5DKWA 3TARA 1NKBA 7ICLA 4RQMA 3C21A 5AKLA 4F3OA 3TADA 1TFRA 5ALZA 1T7PA 4XUSA 2BCUA 8ICPA 4JV1A 5H2FU 3B9JA 4J9LA 3JPQA 3OHAA 1UT8A 1PVQA 3OSNA 1WYGA 1KQQA 3ETLA 1JX4A 2W9AA 4Q45A 4ECXA 2YX8A 1ZQCA 1NK7A 5HNKA 4YMNA 4QZDA 1Z4NA 4MFAA 1DGSA 2NRXA 2AH5A 5KFGA 1NJWA 4P0PA 1JMSA 1SV0C 1XSLA 2G0AA 2FLLA 1TK0A 4YR3A 3GIMA 5JUMA 1IG6A 3H8WA 3N28A 3C28A 3HKZC 4P0QA 2KK0A 2HBMA 2F8KA 3KTQA 2BPGA 7ICOA 4DQRA 3V72A 2Y1JA 1BGXT 1VJ5A 1UQVA 3HT3A 5KFOA 3G6VA 5AKJA 5B5EU 2LM4A 5TISU 5KG6A 4C4TA 4IR1A 4JWNA 1QQ6A 2HOQA 3QU4A 2ES6A 1EXNA 3OSPA 2HI0A 4ZH4A 7ICMA 1A0PA 4M47A 5D4BA 2R8KA 3IM1A 3UMBA 2BGWA 4UB8U 3RB4A 3RH5A 1UCVA 5CB1A 4QZCA 1ZQFA 1ZQKA 2KZZA 4NWIA 3CP8A 1ZQNA 2OH2A 5KFKA 2ZIVA 3M1YA 5K4LA 1ZQVA 1RXVA 2JEFA 4I2EA 4R8UA 4EZ6A 4Z6EA 1HEKA 1N2XA 3H8MA 5AKYA 1D9DA 1B0XA 4RQ0A 3KHRA 3C2KA 2QKQA 2VJ4A 4KMUA 1N62A 2KKPA 3ZDEA 4DFMA 3SAFA 1ZXIA 2Z7JA 3H0LB 3RTVA 3HKZF 1TV9A 1LKYB 4KLQA 3T5HA 1MA7A 5EWFA 4EBEA 5G5GA 4B9UA 4QIWC 4BXOB 1URJA 3N4MB 2LMRA 4DFJA 1NKCA 1COOA 4F8RA 5AKKA 4O9MA 4KX3A 4YD2A 4QZEA 1J2NA 4CF3A 2HBJA 3HILA 2MRLA 3ETRA 5IIKA 4J9MA 3NUQA 4Y2YA 3MFIA 4QZ8A 1JI7A 3M9MB 1SZHA 2KIWA 4JV0A 2W11A 4F4XA 2KVCA 3PX4A 4RT3A 4RQ6A 2AXTU 3B0YA 9ICBA 2PXIA 1Z4OA 1PK3A 2YN4A 5J2DA 3WKBA 4ED0A 4FZMA 2N1RA 2ODGA 3H0MB 1XWLA 3T5LA 1NJYA 3MR6A 4JV2A 2ISOA 2PMZF 2F1HA 2PFOA 9ICNA 3RRGA 2DFLA 4CF5A 1KL9A 3PSPA 4EYIB 5KL1B 1X9SA 1ZQ1C 3KD3A 4O5KA 5KFFA 4TUQA 4AYBC 4QIWF 4DOCA 3BQ2A 4QWCA 2OXOA 4UAUA 1QSLA 1S9FA 5ALYA 4PPXA 2NV3A 5ALUA 1ZQYA 4K4HA 1O03A 2PKEA 2P6UA 2XCAA 5ALTA 1ZQTA 7ICPA 2KZMA 5F9LA 2ZIXB 2DKZA 4PZOA 2ZJAA 1K5OA 3PW0A 1GO3F 1BNPA 2YMPA 1LKYA 4F72A 1PK1B 2W3RA 4JWMA 1LVHA 2JRZA 3HP6A 1S0MA 3ALRA 2JZBB 1ZQGA 4BXOA 2BDPA 3SZ2A 5J2BA 1XO0A 1SL1A 5J0UA 3AN1A 2ZIWB 3KFUF 3G6YA 3JPNA 4YP3A 3GZFA 4OJ6A 5KFWA 4RU9A 2HHVA 5ALEA 2Y9TA 3ONNA 4B6JA 2KE7A 3Q8KA 9ICVA 5ALLA 1IXRA 4C8OA 1X66A 5DBCA 1OXJA 3ISDA 2KMDA 7ICIA 4AYBF 3IP4B 2ISPA 4MEXA 1IM4A 1AROP 4GC7A 4C8KA 9ICMA 4HYKA 4G3IA 1QCKA 4IQVA 4XQ8A 2LYBA 5DQIA 4I2FA 3OPXA 5KG2A 5ALIA 3EPIA 1L3SA 3KHHA 4ECYA 2VJ5A 2HVIA 4NV0A 4RNNA 2OCEA 2HDOA 4HAIA 3EUB2 5CP2A 2LKYA 4UQGA 3FDSA 4Z6FA 4O3SA 1H38A 3F53A 2PFQA 5ALGA 2ATLA 2JMGA 2UVVA 4RZRA 5AI9A 2F77X 2AHOB 2YMLA 3I76A 2HHSA 4KLOA 3KOOA 4U6PA 1RM6C 5KL8B 3RJHA 4Y2VA 2FMPA 3PX0A 4UAZA 5TZVA 4DFKA 4Y2RA 5EE3A 1A76A 3D6JA 4I2BA 2F44A 5J0SA 3TANA 5KFUA 8ICWA 1TKDA 2ZIXA 5CR0A 2LHTA 4O5EA 4PZNA 3N7SC 5J0QA 4DS5A 2H5XA 5JU5A 4QNLA 4UAVA 3AL0B 5KNIA 4Y2PA 1TVAA 2E1EA 4Y2JA 2K8BB 1PK1A 3FAHA 2W9MA 4P4MA 1ZD3A 1B4FA 3WK7A 3SI8A 3EW9A 2BQRA 5GTIU 4BX9C 2JZBA 1L3TA 1S8OA 3LDAA 1FFVA 2KG5A 3BS5B 5ALDA 4F93B 2R8HA 2VANA 4ED3A 1COKA 4C7ZA 2GLEA 2ZIWA 5L1KA 5A0LA 1V9PA 2GH1A 3BZKA 2VA2A 4DS4A 2UVUA 4RUAA 1FEZA 3GIIA 3VC8A 5CWRA 2AQ0A 4F50A 3MGVA 1X9WA 4O3RA 4KLSA 2J6UA 3RRHA 5KFCA 9ICEA 9ICLA 2JH7A 5KG4A 5DB6A 3J81j 5KT4A 2FDRA 4DSEA 5KT2A 3GV5B 1JRPA 4PL1A 2XICA 2W9CB 4NLGA 4PGYA 1WWVA 4O5CA 4BUGA 2BZFA 3KKAA 4DF8A 3WK9A 5C5JA 3C2LA 5KFLA 2KFNA 1A6SA 8ICMA 4RQ4A 5KFVA 1U47A 4AP9A 2HHTA 2FMQA 3RR8A 1NI3A 4QZGA 5ALQA 2EZYA 4WJ3B 2OHFA 4QWEA 3N7RC 3AMZA 3MGIA 4IQUA 3WKAA 3PR5B 1U4BA 3NRZA 3QYPA 3PMLA 3WKDA 4C7YA 3QUTA 2CRXA 1PVPA 3PO5A 1L7PA 4CRXA 3MABA 2UVWA 4I2HA 8ICAA 2WTFA 2KEYA 4M0AA 5EWGA 5J2IA 9ICSA 2FI1A 5ALPA 3H0RB 3PR4A 2G06A 3WK8A 1N61A 8ICTA 1HUZA 2W8LA 5JTIA 2CN1A 2KD1A 8ICKA 5ALHA 3AUOA 1UA1A 3UMGA 5J0RA 4QW8A 4KLMA 2EZXA 4QZIA 2BCVA 3ZDCA 5AKGA 4KLJA 2LI6A 3QEBZ 4M9HA 4Z6CA 4BWMA 1FO4A 4RQ7A 3PVXA 5IIMA 1N63A 4DSIA 5J0YA 1B22A 2VIXA 4KITB 2FLNA 3RF9A 4I2DA 2C2DA 5EE9A 5DBBA 5IINA 4Y2TA 4YN4A 2NRTA 3BS5A 5AM4A 2J6TA 4FS1A 3THVA 2C2RA 3OTQA 4J9SA 1DK2A 4MEYA 4YVZA 3JPPA 1WCLA 3RB0A 5HHIA 2VA8A 2BR0A 2ZIVB 4Q43A 9ICAA 3A0BU 1N5XA 2R8JA 2W9CA 3QU9A 3M6KA 2OWOA 4IL6U 3Q8QB 3OJSA 3PW2A 3WKEA 4PH5A 1C7YA 5ALMA 4FE3A 2QB0B 2XY5A 2JXJA 5DG8A 3ICXA 1AQ6A 5HP4A 1S5LU 2BCSA 2DQNB 2K4IA 4B9VA 4I2GA 2UVRA 9ICCA 4YQWA 4EELA 9ICPA 4J03A 5DLGA 3LWMA 4DEZA 1BPEA 3KHLA 2G09A 3UXNA 3M6ZA 4F4YA 4J9NA 7ICHA 1L7MA 4CF4A 3SEIA 5J0OA 8ICLA 2RDJA 3BQ7A 2YMQA 7ICQA 3V6JA 1Z1BA 1V38A 5C0YA 1NNLA 1XO1A 5DQGA 8ICFA 2Q4TA 3OHBA 1ZETA 3E58A 1F44A 3H7IA 4KLIA 1CEZA 4NM2A 1NOMA 4OJOA 4FS2A 3C5FA 8ICRA 4IQTA 3RAXA 3IN5A 2BHNA 5CJ7A 5KFNA 1BVSA 3LVVA 3LWLA 9ICOA 4RPXA 2KKVA 2RRDA 1DXSA 2AJQA 4O3QA 5JRTA 1ZQSA 5ALRA 8ICHA 2WF5A 7ICKA 4DSLA 7ICVA 3N7PD 4OJPA 5J2GA 1UT5A 1VLBA 3HRDD 3HPOA 4DL2A 2EQYA 3SD7A 5L9XA 3TADC 1YZ7A 1SL2A 3CYMA 1SWWA 9ICTA 1ECWA 1BPZA 2MUTB 3C23A 2KHVA 3QUQA 2XO7A 1ZRNA 3D2QA 1TE2A 1LB2B 5KFYA 2H3VA 3SR6A 9ICRA 1ZQOA 1CRXA 5ALJA 5KFPA 2LYHA 3BQTA 3I1YA 5DLFA 5AKHA 3H4BA 4JB3A 2W55A 4XA5A 5AKIA 2KN7A 2WFAA 3HX0A 1ZQZA 9ICIA 3TI0A 1HIWA 4DFPA 5AIAA 3A0HU 2YB4A 5CHGA 2CPRA 4NY8A 4QWDA 5AI0A 4ECTA 2QB0A 5IILA 2KNJA 2G07A 1X40A 3RJIA 2W43A 3JPRA 3FC4A 4MF8A 1XNSA 4UARA 4C0ZA 3PY8A 9ICJA 1Q46A 3K1ZA 3RJFA 2ZUCA 1N48A 4UB2A 4UB6U 1KFTA 5J0WA 1Z19A 4M04A 2EAMA 1ZQUA 2O6KA 2G5IB 1U49A 1X9XA 2F8LA 3TKAA 3OJUA 3BZCA 3CNHA 2HHUA 4BGDA 2WAQC 5KFIA 5AKEA 2FPMA 4LZGA 2ZTCA 5EE0A 2IOHA 4Y2QA 3FYHA 5T14A 1QLNA 4YFKA 1OUQA 2KP7A 4FFDA 1NJZA 4M9GA 5KG3A 1S0VA 4GFJA 2XCPA 2Y9UA 2KJ8A 4KLDA 1T3QA 4I2IA 4IRKA 2FPKA 5BPCA 5AM3A 3PW5A 4I2JA 1MQ2A 2E8PA 4ECZA 4U7CA 5AK3A 4IC9A 4KMOB 4RQ5A 4Y2SA 3NVVA 3S6JA 3TACB 4DQQA 4DQPA 4J9QA 1NK0A 1X6JA 2MUTA 4O3NA 4UAWA 3RBEA 4QWBA 4ED6A 1ZD2P 4GC6A 4ED7A 4F71A 5E79U 4CDGA 1N56A 4Q8EA 3IG5A 5AK5A 1CUKA 3UXOA 2D6FC 2W9BB 1BPBA 2JGAA 2K4HA 1WG8A 2A1JB 5J0PA 2DBYA 4O3OA 1TK8A 4J9OA 7ICEA 4M6WB 3PW7A 1TK5A 3RH4A 3QNMA 2WAQF 2HMXA 3ORYA 4GIBA 5J0TA 2KV2A 4J9PA 4MFCA 3C29A 4UB4A 1SKRA 4RNOA 2MU2A 4QWAA 5KG5A 2B21A 1WCNA 3Q8SB 1ZJMA 5DDYA 3C1YA 5DBAA 3K4GA 3RJGA 1RDFA 1F0MA 2E8NA 3SENA 4KLGA 4DQSA 3WU2U 1ZD4A 4BDPA 5KT7A 4K4GA 2IHMA 4G9BA 2P66A 4GXKA 1YZ6A 4F4WA 4PHEA 8ICEA 1L8OA 2QB1A 2IMWP 3ZDBA 1T94A 3ZDDA 3QU2A 4M9LA 2WF7A 5AI5A 2XI9A 4K4IA 1ZQJA 7ICFA 5ALXA 1S0OA 5D46A 5L1JA 4OJ5A 4RNMA 5ALVA 1XC9A 5AICA 5HR6A 3BS7A 3DEEA 4F4ZA 4F91B 2KVSA 1KN5A 2B0CA 4OO1J 4RQ3A 5EWEA 3TQ1A 1BPDA 5G5HA 1NJXA 4Q44A 3QU5A 2H3ZA 4M9NA 4RQNA 4ED1A 1YT3A 1NK5A 5AHXA 1KEJA 3Q8PB 1OW5A 2NO5A 3M9OB 2YMMA 3HWTA 3SV3A 1ZD5A 4UBCA 4IRDA 1JROA 2F1JA 1Z1VA 4GXIA 3KBBA 5KFBA 2W9BA 3UM9A 1NZBA 2A1JA 3CRXA 5HR7A 3TAQA 4Y2UA 4KLHA 3GDXA 1V85A 3AU6A 4NXZA 8ICVA 2A19A 3SQIA 4M6WA 2H3FA 4F5PA 5KFEA 4KLLA 1D8LA 2ZXIA 9ICQA 2H3QA 4EYHB 3V7KA 1RG6A 1L3VA 3EYZA 2YTUA 2A1AA 5J8YA 1Q3VA 3F5EA 1N5WA 2MAXA 3WK5A 2XY7A 3Q8LA 2LYAA 4I29A 4IQWA 3HW8A 3RJJA 3AQEA 2F1IA 1HUOA 3IG8A 5AK6A 4YMOA 3U26A 4FBUA 1UPHA 4NJ8A 1L5UA 1Y88A 2K8CB 1K1QA 2ZTEA 3H4DA 2FE9A 2MSNA 4DL5A 3PW4A 1JIHA 2KFZA 2BDUA 4I2CA 2WF8A 5F3XB 1CI4A 5AI4A 2M0NA 2P35A 3MBYA 2DPJA 3KZXA 3F2BA 4CCHA 3JPTA 3SAGA 2GOLA 4J9RA 5ALWA 4PGQA 3ISBA 2PFPA 4R65A 5HMMA 3DDHA 4F2SA 1ZQRA 2ZUBA 4UASA 3NVZA 3NRWA 3FM9A 2XIDA 1WWUA 4YG2A 4ECRA 4PL2A 5KAIU 4QJFB 2IBKA 2QLTA 3NASA 4EX7A 4O0IA 1D8YA 2V9WA 4EEYA 5AKZA 1BPXA 4NM1A 2JEGA 2EZZA 1ZQMA 4B9MA 5KTQA
chains in the Genus database with same CATH topology
2JR5A 1X6IA 1PUZA 1X6JA 2LM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR5 A;  1X6I A;  1PUZ A;  1X6J A;  2LM4 A; 
#chains in the Genus database with same CATH topology
 1U45 A;  1L7O A;  4R63 A;  1X6I A;  2HCF A;  5J2E A;  2J6S A;  5J2F A;  1PUZ A;  4LZD A;  5DDM A;  2GWS A;  2E8M A;  5KFR A;  5CRX A;  3MDC A;  1KRP A;  4J9K A;  1NK4 A;  2W03 A;  4UAT A;  1KFD A;  7ICT A;  3MR5 A;  4ECU A;  4EEN A;  4F2R A;  2EAN A;  1L7N A;  8ICS A;  2HBK A;  4YR2 A;  1ZQH A;  1RXW A;  2KJ5 A;  1SB3 C;  1ZYQ A;  4ELT A;  5AM0 A;  4F92 B;  2B6G A;  4NLB A;  1X42 A;  4B9S A;  4RQ2 A;  4B9T A;  3KKA C;  2Y1I A;  2PFN A;  3QUC A;  3EWA A;  4FO6 A;  4UW9 A;  2OM6 A;  3PSF A;  1XSP A;  2JH1 A;  2DL0 A;  2QAR B;  5B66 U;  1L8L A;  3RBD A;  3QUB A;  2JV3 A;  3ZD8 A;  2K4E A;  4RUC A;  3SMV A;  3NVW A;  2HSZ A;  5L1I A;  5DG7 A;  2JR5 A;  4DOB A;  1ZQP A;  1KTQ A;  3L4P A;  3NTU A;  4E0D A;  3T5K A;  4ED2 A;  4TQR A;  2BCQ A;  9ICF A;  4EBD A;  1J97 A;  4PHP A;  4Z6D A;  4PHD A;  3BQ1 A;  1V97 A;  3JPS A;  5DB7 A;  8ICO A;  2HOF A;  4B9L A;  4I27 A;  9ICU A;  1FFU A;  8ICG A;  4PJ0 U;  4DL3 A;  5DGA A;  1QQ7 A;  5J2H A;  3B0X A;  2R8G A;  5CA7 A;  1RYR A;  5KG1 A;  4NLK A;  2HHW A;  3VCB A;  3C2M A;  2AGQ A;  3RFA A;  5AM2 A;  2DF4 B;  2K4P A;  3UPQ A;  4DF4 A;  4IRC A;  3AM9 A;  3ZDA A;  3QXG A;  2EH9 A;  3AU2 A;  4YCX A;  2XGP A;  1TAU A;  4ICA A;  3QZ7 A;  3NGD A;  2W8K A;  4KLT A;  2DGZ A;  1S10 A;  3WKC A;  4KLU A;  5HML A;  3RJE A;  1C20 A;  3HJE A;  1MN8 A;  5KT5 A;  2BPF A;  2NO4 A;  4DSJ A;  1KW4 A;  4JUZ A;  3ISC A;  3G6X A;  3F2C A;  3EPG A;  1KFS A;  3C1Z A;  4F5R A;  2NRV A;  5KFX A;  3LVW A;  4P4O A;  2V4Q A;  2WHE A;  5DQH A;  2Y0S C;  4DL7 A;  1TAM A;  1JN3 A;  2YB1 A;  5AIB A;  3K1R B;  4JK1 A;  2HHX A;  3QEA Z;  3AQF A;  3IRU A;  3MR3 A;  3WK6 A;  4C8L A;  4KX5 A;  2ASD A;  4GXJ A;  7ICR A;  2QAR A;  3UXP A;  2M9N A;  4DO9 A;  9ICX A;  4RPZ A;  1F5S A;  3QZ8 A;  1JAL A;  2W7P A;  5J2K A;  3H8S A;  5KFD A;  2WF6 A;  3V7J A;  1U9L A;  1Z3E B;  4YMM A;  3PST A;  4KN4 A;  1KDH A;  2G08 A;  4EEK A;  4QZB A;  2F76 X;  4OD0 A;  3GQC A;  4Y2X A;  5D49 A;  2XVT A;  3GIL A;  1JXL A;  3SV4 A;  4DLE A;  2AU0 A;  4DL6 A;  1QQ5 A;  3TFS A;  1Q3U A;  1SXE A;  3GIK A;  2KIC A;  1JUD A;  5FP0 A;  8ICQ A;  2HVH A;  1T8E A;  4YXJ A;  1ZQE A;  4P2H A;  5KT3 A;  2JEI A;  5ALO A;  3QE9 Y;  4KLE A;  3ED5 A;  2XGQ A;  2D3D A;  4UB5 A;  4PGX A;  3KZI U;  4RPY A;  9ICK A;  4YR0 A;  1L6N A;  1IIP A;  3L5K A;  4UBB A;  4QZA A;  2PMZ C;  4TUR A;  2VKQ A;  3I28 A;  1S97 A;  3L3F X;  2JEJ A;  2FPL A;  1QSS A;  2HOI A;  4USA A;  4F4K A;  1PVR A;  4QZF A;  4TUS A;  2BQ3 A;  4ZOH C;  2Y0S F;  4C4R A;  2ZJ5 A;  2RQ5 A;  1PZN A;  7ICG A;  2ZIU B;  3SYZ A;  3BDP A;  3E2E A;  2ZG6 A;  4OJL A;  1RQL A;  3T3F A;  1J2M A;  5J0X A;  2KIV A;  3GU3 A;  5J2J A;  8ICI A;  2WB1 C;  7ICU A;  2W54 A;  2C28 A;  4P4P A;  3PMN A;  2LBO A;  4I2A A;  2Q0Z X;  5III A;  4DLG A;  4KLF A;  1KKX A;  1Q8K A;  5ALN A;  1ZQB A;  3MFH A;  2K89 A;  4RQ8 A;  5HHH A;  4BJQ A;  1SWV A;  4GLX A;  5L1L A;  3RJK A;  4FBT A;  2YY6 A;  4R64 A;  3Q8M A;  1KBU A;  4C80 A;  4M2Y A;  4NLC A;  2NYV A;  3GV7 B;  2W3S A;  3GIJ A;  4DWI A;  2ALZ A;  3TFR A;  4ECQ A;  1FIQ A;  2K8A A;  5IIO A;  1ZQI A;  1WUD A;  2FJ6 A;  3UQ2 A;  1DOQ A;  4NLN A;  2H3I A;  2KSO B;  5KFZ A;  9ICH A;  4UAY A;  3M8S A;  1JXE A;  3IDW A;  2BCR A;  2I6X A;  3CW2 C;  1ZQQ A;  3MGH A;  1O08 A;  2V4R A;  1DGJ A;  3ZD9 A;  3D2S A;  1SGG A;  3QX7 A;  4US8 A;  5DB9 A;  4EBC A;  1ZQD A;  4LJX A;  1LV5 A;  3Q8R B;  2RLT A;  2I5H A;  4KTQ A;  4ACO A;  9ICG A;  1ZJN A;  2WB1 F;  2ZUD A;  2IOF K;  1RZT A;  4RQ1 A;  1ZQX A;  2XY6 A;  4X5V A;  5AM1 A;  1QTM A;  3T79 A;  1NKE A;  4RT2 A;  2E5S A;  2AGP A;  2D8C A;  5ALS A;  3KHG A;  8ICY A;  1SV4 A;  3V7L A;  2ZIU A;  3SAH A;  5KFS A;  2F3N A;  2MA1 A;  2C22 A;  1M6Y A;  1SIJ A;  4ECS A;  1X9M A;  1MSW D;  1XU4 A;  1TAQ A;  3O0F A;  2KZ3 A;  1S76 D;  4OCZ A;  1D9F A;  5EE1 A;  4FZN A;  3V6K A;  4DCC A;  3GV8 B;  1N60 A;  5KAF U;  2AGO A;  2E8O A;  1KLN A;  5J29 A;  2PI4 A;  2P6R A;  4NL9 A;  3RR7 A;  1A77 A;  5CEH A;  1ZRM A;  5F9N A;  1KSP A;  1NK8 A;  4DOA A;  3F5A A;  8ICU A;  2RP5 A;  5J2A A;  4CGZ A;  4DQI A;  5KFA A;  3PO4 A;  2E1F A;  4IR9 A;  5EOZ A;  3JPO A;  2WF9 A;  4TUP A;  5J2C A;  4DSF A;  3V6H A;  3M9N B;  4DFD A;  4PHA A;  2OEH A;  4R66 A;  2C2E A;  3IHQ B;  8ICZ A;  3BQ0 A;  1BPY A;  2KSO A;  2ZTD A;  1B43 A;  1NZP A;  3K75 D;  5IIJ A;  3NS1 A;  1ZQL A;  2NRW A;  4M9J A;  3ZI4 A;  2RDI A;  5DG9 A;  1XSN A;  4BWJ A;  3EZ5 A;  5KFM A;  3MDA A;  1SL0 A;  2R18 A;  3F2D A;  2AQ4 A;  2DPI A;  5AK4 A;  4C8M A;  2FLP A;  1MC8 A;  2FMS A;  4NLZ A;  2BQU A;  3D2N A;  3AEV A;  3OGU A;  3DV9 A;  1RYS A;  4IS7 A;  1XS9 D;  2CXY A;  2GO7 A;  4YXM A;  1SKW A;  5DB8 A;  1Z00 B;  5DGB A;  4I28 A;  4US9 A;  4NL9 C;  4CNQ A;  8ICB A;  3RB3 A;  4O3P A;  3MC1 A;  2DUY A;  4FZL A;  3RB6 A;  3MR2 A;  2LM1 A;  3PV8 A;  1VDV A;  3TAP A;  1SXD A;  1NK9 A;  1T4G A;  5ALF A;  5KG7 A;  1RYU A;  2DWQ A;  2E3T A;  3PZP A;  1T3N A;  4ED8 A;  1U48 A;  3IV6 A;  1K1S A;  2IOF A;  4UB1 A;  2VA3 A;  3QU7 A;  8ICC A;  2LPE A;  4B9N A;  4ELV A;  4LVS A;  2ZXH A;  4C8N A;  1S0N A;  5AI6 A;  2XC9 A;  3R9K A;  8ICN A;  4TQS A;  5J8Y C;  5BOM A;  5AKX A;  4F5N A;  3T5J A;  2ESE A;  3PSI A;  2ASL A;  3H8J A;  4F5O A;  5KFT A;  4MF2 A;  4EZ9 A;  4KN7 A;  2JHD A;  4QW9 A;  2PI5 A;  4YD1 A;  1P7D A;  2RHF A;  7ICS A;  1ZOL A;  3LYS A;  1QH9 A;  3GFK B;  4A8E A;  3UQ0 A;  3E0F A;  1HJP A;  1QSY A;  4DL4 A;  4ELU A;  2W7O A;  8ICX A;  4P0P B;  2ZJ8 A;  3C5G A;  5KFH A;  4QZH A;  1DRG A;  1ED1 A;  1X2I A;  4JMU A;  1DK3 A;  1BNO A;  2KTQ A;  2KJ9 A;  3M8R A;  2EDU A;  7ICJ A;  1D8B A;  5AI8 A;  4EX6 A;  2L5Y A;  4P0Q B;  4CE6 A;  4O3M A;  2F2A B;  2BKE A;  3H40 A;  4C4S A;  1UHU A;  9ICW A;  2HBL A;  1NK6 A;  1L3U A;  3PX6 A;  2KHQ A;  3UMC A;  2A3V A;  4QZ9 A;  1RQN A;  2EAO A;  2ASJ A;  2IHN A;  1SV0 A;  4UB3 A;  2HHQ A;  1Z00 A;  5L1M A;  3RAQ A;  3N97 B;  4ECW A;  2G5H B;  2DKX A;  4XRH A;  2I1Q A;  5KG0 A;  3PNC A;  3NVY A;  1SZP A;  2HW3 A;  3WK4 A;  2W04 A;  4Q8F A;  3M7D A;  1ZQA A;  2OYY A;  5ALK A;  2KOB A;  1S77 D;  5GTH U;  1UA0 A;  2R8I A;  3RH6 A;  5AM5 A;  7ICN A;  5BOL A;  2K60 A;  1SKS A;  5KFQ A;  5KT6 A;  4MFF A;  5KFJ A;  2YQE A;  2EAP A;  1MQ3 A;  4F5Q A;  2NRZ A;  2I9G A;  1RPL A;  2BPC A;  3BJY A;  4R8U B;  1ZQW A;  1IV8 A;  8ICJ A;  4DSK A;  4ECV A;  4MHV A;  2IA6 A;  3LK9 A;  5DKW A;  3TAR A;  1NKB A;  7ICL A;  4RQM A;  3C21 A;  5AKL A;  4F3O A;  3TAD A;  1TFR A;  5ALZ A;  1T7P A;  4XUS A;  2BCU A;  8ICP A;  4JV1 A;  5H2F U;  3B9J A;  4J9L A;  3JPQ A;  3OHA A;  1UT8 A;  1PVQ A;  3OSN A;  1WYG A;  1KQQ A;  3ETL A;  1JX4 A;  2W9A A;  4Q45 A;  4ECX A;  2YX8 A;  1ZQC A;  1NK7 A;  5HNK A;  4YMN A;  4QZD A;  1Z4N A;  4MFA A;  1DGS A;  2NRX A;  2AH5 A;  5KFG A;  1NJW A;  4P0P A;  1JMS A;  1SV0 C;  1XSL A;  2G0A A;  2FLL A;  1TK0 A;  4YR3 A;  3GIM A;  5JUM A;  1IG6 A;  3H8W A;  3N28 A;  3C28 A;  3HKZ C;  4P0Q A;  2KK0 A;  2HBM A;  2F8K A;  3KTQ A;  2BPG A;  7ICO A;  4DQR A;  3V72 A;  2Y1J A;  1BGX T;  1VJ5 A;  1UQV A;  3HT3 A;  5KFO A;  3G6V A;  5AKJ A;  5B5E U;  2LM4 A;  5TIS U;  5KG6 A;  4C4T A;  4IR1 A;  4JWN A;  1QQ6 A;  2HOQ A;  3QU4 A;  2ES6 A;  1EXN A;  3OSP A;  2HI0 A;  4ZH4 A;  7ICM A;  1A0P A;  4M47 A;  5D4B A;  2R8K A;  3IM1 A;  3UMB A;  2BGW A;  4UB8 U;  3RB4 A;  3RH5 A;  1UCV A;  5CB1 A;  4QZC A;  1ZQF A;  1ZQK A;  2KZZ A;  4NWI A;  3CP8 A;  1ZQN A;  2OH2 A;  5KFK A;  2ZIV A;  3M1Y A;  5K4L A;  1ZQV A;  1RXV A;  2JEF A;  4I2E A;  4R8U A;  4EZ6 A;  4Z6E A;  1HEK A;  1N2X A;  3H8M A;  5AKY A;  1D9D A;  1B0X A;  4RQ0 A;  3KHR A;  3C2K A;  2QKQ A;  2VJ4 A;  4KMU A;  1N62 A;  2KKP A;  3ZDE A;  4DFM A;  3SAF A;  1ZXI A;  2Z7J A;  3H0L B;  3RTV A;  3HKZ F;  1TV9 A;  1LKY B;  4KLQ A;  3T5H A;  1MA7 A;  5EWF A;  4EBE A;  5G5G A;  4B9U A;  4QIW C;  4BXO B;  1URJ A;  3N4M B;  2LMR A;  4DFJ A;  1NKC A;  1COO A;  4F8R A;  5AKK A;  4O9M A;  4KX3 A;  4YD2 A;  4QZE A;  1J2N A;  4CF3 A;  2HBJ A;  3HIL A;  2MRL A;  3ETR A;  5IIK A;  4J9M A;  3NUQ A;  4Y2Y A;  3MFI A;  4QZ8 A;  1JI7 A;  3M9M B;  1SZH A;  2KIW A;  4JV0 A;  2W11 A;  4F4X A;  2KVC A;  3PX4 A;  4RT3 A;  4RQ6 A;  2AXT U;  3B0Y A;  9ICB A;  2PXI A;  1Z4O A;  1PK3 A;  2YN4 A;  5J2D A;  3WKB A;  4ED0 A;  4FZM A;  2N1R A;  2ODG A;  3H0M B;  1XWL A;  3T5L A;  1NJY A;  3MR6 A;  4JV2 A;  2ISO A;  2PMZ F;  2F1H A;  2PFO A;  9ICN A;  3RRG A;  2DFL A;  4CF5 A;  1KL9 A;  3PSP A;  4EYI B;  5KL1 B;  1X9S A;  1ZQ1 C;  3KD3 A;  4O5K A;  5KFF A;  4TUQ A;  4AYB C;  4QIW F;  4DOC A;  3BQ2 A;  4QWC A;  2OXO A;  4UAU A;  1QSL A;  1S9F A;  5ALY A;  4PPX A;  2NV3 A;  5ALU A;  1ZQY A;  4K4H A;  1O03 A;  2PKE A;  2P6U A;  2XCA A;  5ALT A;  1ZQT A;  7ICP A;  2KZM A;  5F9L A;  2ZIX B;  2DKZ A;  4PZO A;  2ZJA A;  1K5O A;  3PW0 A;  1GO3 F;  1BNP A;  2YMP A;  1LKY A;  4F72 A;  1PK1 B;  2W3R A;  4JWM A;  1LVH A;  2JRZ A;  3HP6 A;  1S0M A;  3ALR A;  2JZB B;  1ZQG A;  4BXO A;  2BDP A;  3SZ2 A;  5J2B A;  1XO0 A;  1SL1 A;  5J0U A;  3AN1 A;  2ZIW B;  3KFU F;  3G6Y A;  3JPN A;  4YP3 A;  3GZF A;  4OJ6 A;  5KFW A;  4RU9 A;  2HHV A;  5ALE A;  2Y9T A;  3ONN A;  4B6J A;  2KE7 A;  3Q8K A;  9ICV A;  5ALL A;  1IXR A;  4C8O A;  1X66 A;  5DBC A;  1OXJ A;  3ISD A;  2KMD A;  7ICI A;  4AYB F;  3IP4 B;  2ISP A;  4MEX A;  1IM4 A;  1ARO P;  4GC7 A;  4C8K A;  9ICM A;  4HYK A;  4G3I A;  1QCK A;  4IQV A;  4XQ8 A;  2LYB A;  5DQI A;  4I2F A;  3OPX A;  5KG2 A;  5ALI A;  3EPI A;  1L3S A;  3KHH A;  4ECY A;  2VJ5 A;  2HVI A;  4NV0 A;  4RNN A;  2OCE A;  2HDO A;  4HAI A;  3EUB 2;  5CP2 A;  2LKY A;  4UQG A;  3FDS A;  4Z6F A;  4O3S A;  1H38 A;  3F53 A;  2PFQ A;  5ALG A;  2ATL A;  2JMG A;  2UVV A;  4RZR A;  5AI9 A;  2F77 X;  2AHO B;  2YML A;  3I76 A;  2HHS A;  4KLO A;  3KOO A;  4U6P A;  1RM6 C;  5KL8 B;  3RJH A;  4Y2V A;  2FMP A;  3PX0 A;  4UAZ A;  5TZV A;  4DFK A;  4Y2R A;  5EE3 A;  1A76 A;  3D6J A;  4I2B A;  2F44 A;  5J0S A;  3TAN A;  5KFU A;  8ICW A;  1TKD A;  2ZIX A;  5CR0 A;  2LHT A;  4O5E A;  4PZN A;  3N7S C;  5J0Q A;  4DS5 A;  2H5X A;  5JU5 A;  4QNL A;  4UAV A;  3AL0 B;  5KNI A;  4Y2P A;  1TVA A;  2E1E A;  4Y2J A;  2K8B B;  1PK1 A;  3FAH A;  2W9M A;  4P4M A;  1ZD3 A;  1B4F A;  3WK7 A;  3SI8 A;  3EW9 A;  2BQR A;  5GTI U;  4BX9 C;  2JZB A;  1L3T A;  1S8O A;  3LDA A;  1FFV A;  2KG5 A;  3BS5 B;  5ALD A;  4F93 B;  2R8H A;  2VAN A;  4ED3 A;  1COK A;  4C7Z A;  2GLE A;  2ZIW A;  5L1K A;  5A0L A;  1V9P A;  2GH1 A;  3BZK A;  2VA2 A;  4DS4 A;  2UVU A;  4RUA A;  1FEZ A;  3GII A;  3VC8 A;  5CWR A;  2AQ0 A;  4F50 A;  3MGV A;  1X9W A;  4O3R A;  4KLS A;  2J6U A;  3RRH A;  5KFC A;  9ICE A;  9ICL A;  2JH7 A;  5KG4 A;  5DB6 A;  3J81 j;  5KT4 A;  2FDR A;  4DSE A;  5KT2 A;  3GV5 B;  1JRP A;  4PL1 A;  2XIC A;  2W9C B;  4NLG A;  4PGY A;  1WWV A;  4O5C A;  4BUG A;  2BZF A;  3KKA A;  4DF8 A;  3WK9 A;  5C5J A;  3C2L A;  5KFL A;  2KFN A;  1A6S A;  8ICM A;  4RQ4 A;  5KFV A;  1U47 A;  4AP9 A;  2HHT A;  2FMQ A;  3RR8 A;  1NI3 A;  4QZG A;  5ALQ A;  2EZY A;  4WJ3 B;  2OHF A;  4QWE A;  3N7R C;  3AMZ A;  3MGI A;  4IQU A;  3WKA A;  3PR5 B;  1U4B A;  3NRZ A;  3QYP A;  3PML A;  3WKD A;  4C7Y A;  3QUT A;  2CRX A;  1PVP A;  3PO5 A;  1L7P A;  4CRX A;  3MAB A;  2UVW A;  4I2H A;  8ICA A;  2WTF A;  2KEY A;  4M0A A;  5EWG A;  5J2I A;  9ICS A;  2FI1 A;  5ALP A;  3H0R B;  3PR4 A;  2G06 A;  3WK8 A;  1N61 A;  8ICT A;  1HUZ A;  2W8L A;  5JTI A;  2CN1 A;  2KD1 A;  8ICK A;  5ALH A;  3AUO A;  1UA1 A;  3UMG A;  5J0R A;  4QW8 A;  4KLM A;  2EZX A;  4QZI A;  2BCV A;  3ZDC A;  5AKG A;  4KLJ A;  2LI6 A;  3QEB Z;  4M9H A;  4Z6C A;  4BWM A;  1FO4 A;  4RQ7 A;  3PVX A;  5IIM A;  1N63 A;  4DSI A;  5J0Y A;  1B22 A;  2VIX A;  4KIT B;  2FLN A;  3RF9 A;  4I2D A;  2C2D A;  5EE9 A;  5DBB A;  5IIN A;  4Y2T A;  4YN4 A;  2NRT A;  3BS5 A;  5AM4 A;  2J6T A;  4FS1 A;  3THV A;  2C2R A;  3OTQ A;  4J9S A;  1DK2 A;  4MEY A;  4YVZ A;  3JPP A;  1WCL A;  3RB0 A;  5HHI A;  2VA8 A;  2BR0 A;  2ZIV B;  4Q43 A;  9ICA A;  3A0B U;  1N5X A;  2R8J A;  2W9C A;  3QU9 A;  3M6K A;  2OWO A;  4IL6 U;  3Q8Q B;  3OJS A;  3PW2 A;  3WKE A;  4PH5 A;  1C7Y A;  5ALM A;  4FE3 A;  2QB0 B;  2XY5 A;  2JXJ A;  5DG8 A;  3ICX A;  1AQ6 A;  5HP4 A;  1S5L U;  2BCS A;  2DQN B;  2K4I A;  4B9V A;  4I2G A;  2UVR A;  9ICC A;  4YQW A;  4EEL A;  9ICP A;  4J03 A;  5DLG A;  3LWM A;  4DEZ A;  1BPE A;  3KHL A;  2G09 A;  3UXN A;  3M6Z A;  4F4Y A;  4J9N A;  7ICH A;  1L7M A;  4CF4 A;  3SEI A;  5J0O A;  8ICL A;  2RDJ A;  3BQ7 A;  2YMQ A;  7ICQ A;  3V6J A;  1Z1B A;  1V38 A;  5C0Y A;  1NNL A;  1XO1 A;  5DQG A;  8ICF A;  2Q4T A;  3OHB A;  1ZET A;  3E58 A;  1F44 A;  3H7I A;  4KLI A;  1CEZ A;  4NM2 A;  1NOM A;  4OJO A;  4FS2 A;  3C5F A;  8ICR A;  4IQT A;  3RAX A;  3IN5 A;  2BHN A;  5CJ7 A;  5KFN A;  1BVS A;  3LVV A;  3LWL A;  9ICO A;  4RPX A;  2KKV A;  2RRD A;  1DXS A;  2AJQ A;  4O3Q A;  5JRT A;  1ZQS A;  5ALR A;  8ICH A;  2WF5 A;  7ICK A;  4DSL A;  7ICV A;  3N7P D;  4OJP A;  5J2G A;  1UT5 A;  1VLB A;  3HRD D;  3HPO A;  4DL2 A;  2EQY A;  3SD7 A;  5L9X A;  3TAD C;  1YZ7 A;  1SL2 A;  3CYM A;  1SWW A;  9ICT A;  1ECW A;  1BPZ A;  2MUT B;  3C23 A;  2KHV A;  3QUQ A;  2XO7 A;  1ZRN A;  3D2Q A;  1TE2 A;  1LB2 B;  5KFY A;  2H3V A;  3SR6 A;  9ICR A;  1ZQO A;  1CRX A;  5ALJ A;  5KFP A;  2LYH A;  3BQT A;  3I1Y A;  5DLF A;  5AKH A;  3H4B A;  4JB3 A;  2W55 A;  4XA5 A;  5AKI A;  2KN7 A;  2WFA A;  3HX0 A;  1ZQZ A;  9ICI A;  3TI0 A;  1HIW A;  4DFP A;  5AIA A;  3A0H U;  2YB4 A;  5CHG A;  2CPR A;  4NY8 A;  4QWD A;  5AI0 A;  4ECT A;  2QB0 A;  5IIL A;  2KNJ A;  2G07 A;  1X40 A;  3RJI A;  2W43 A;  3JPR A;  3FC4 A;  4MF8 A;  1XNS A;  4UAR A;  4C0Z A;  3PY8 A;  9ICJ A;  1Q46 A;  3K1Z A;  3RJF A;  2ZUC A;  1N48 A;  4UB2 A;  4UB6 U;  1KFT A;  5J0W A;  1Z19 A;  4M04 A;  2EAM A;  1ZQU A;  2O6K A;  2G5I B;  1U49 A;  1X9X A;  2F8L A;  3TKA A;  3OJU A;  3BZC A;  3CNH A;  2HHU A;  4BGD A;  2WAQ C;  5KFI A;  5AKE A;  2FPM A;  4LZG A;  2ZTC A;  5EE0 A;  2IOH A;  4Y2Q A;  3FYH A;  5T14 A;  1QLN A;  4YFK A;  1OUQ A;  2KP7 A;  4FFD A;  1NJZ A;  4M9G A;  5KG3 A;  1S0V A;  4GFJ A;  2XCP A;  2Y9U A;  2KJ8 A;  4KLD A;  1T3Q A;  4I2I A;  4IRK A;  2FPK A;  5BPC A;  5AM3 A;  3PW5 A;  4I2J A;  1MQ2 A;  2E8P A;  4ECZ A;  4U7C A;  5AK3 A;  4IC9 A;  4KMO B;  4RQ5 A;  4Y2S A;  3NVV A;  3S6J A;  3TAC B;  4DQQ A;  4DQP A;  4J9Q A;  1NK0 A;  1X6J A;  2MUT A;  4O3N A;  4UAW A;  3RBE A;  4QWB A;  4ED6 A;  1ZD2 P;  4GC6 A;  4ED7 A;  4F71 A;  5E79 U;  4CDG A;  1N56 A;  4Q8E A;  3IG5 A;  5AK5 A;  1CUK A;  3UXO A;  2D6F C;  2W9B B;  1BPB A;  2JGA A;  2K4H A;  1WG8 A;  2A1J B;  5J0P A;  2DBY A;  4O3O A;  1TK8 A;  4J9O A;  7ICE A;  4M6W B;  3PW7 A;  1TK5 A;  3RH4 A;  3QNM A;  2WAQ F;  2HMX A;  3ORY A;  4GIB A;  5J0T A;  2KV2 A;  4J9P A;  4MFC A;  3C29 A;  4UB4 A;  1SKR A;  4RNO A;  2MU2 A;  4QWA A;  5KG5 A;  2B21 A;  1WCN A;  3Q8S B;  1ZJM A;  5DDY A;  3C1Y A;  5DBA A;  3K4G A;  3RJG A;  1RDF A;  1F0M A;  2E8N A;  3SEN A;  4KLG A;  4DQS A;  3WU2 U;  1ZD4 A;  4BDP A;  5KT7 A;  4K4G A;  2IHM A;  4G9B A;  2P66 A;  4GXK A;  1YZ6 A;  4F4W A;  4PHE A;  8ICE A;  1L8O A;  2QB1 A;  2IMW P;  3ZDB A;  1T94 A;  3ZDD A;  3QU2 A;  4M9L A;  2WF7 A;  5AI5 A;  2XI9 A;  4K4I A;  1ZQJ A;  7ICF A;  5ALX A;  1S0O A;  5D46 A;  5L1J A;  4OJ5 A;  4RNM A;  5ALV A;  1XC9 A;  5AIC A;  5HR6 A;  3BS7 A;  3DEE A;  4F4Z A;  4F91 B;  2KVS A;  1KN5 A;  2B0C A;  4OO1 J;  4RQ3 A;  5EWE A;  3TQ1 A;  1BPD A;  5G5H A;  1NJX A;  4Q44 A;  3QU5 A;  2H3Z A;  4M9N A;  4RQN A;  4ED1 A;  1YT3 A;  1NK5 A;  5AHX A;  1KEJ A;  3Q8P B;  1OW5 A;  2NO5 A;  3M9O B;  2YMM A;  3HWT A;  3SV3 A;  1ZD5 A;  4UBC A;  4IRD A;  1JRO A;  2F1J A;  1Z1V A;  4GXI A;  3KBB A;  5KFB A;  2W9B A;  3UM9 A;  1NZB A;  2A1J A;  3CRX A;  5HR7 A;  3TAQ A;  4Y2U A;  4KLH A;  3GDX A;  1V85 A;  3AU6 A;  4NXZ A;  8ICV A;  2A19 A;  3SQI A;  4M6W A;  2H3F A;  4F5P A;  5KFE A;  4KLL A;  1D8L A;  2ZXI A;  9ICQ A;  2H3Q A;  4EYH B;  3V7K A;  1RG6 A;  1L3V A;  3EYZ A;  2YTU A;  2A1A A;  5J8Y A;  1Q3V A;  3F5E A;  1N5W A;  2MAX A;  3WK5 A;  2XY7 A;  3Q8L A;  2LYA A;  4I29 A;  4IQW A;  3HW8 A;  3RJJ A;  3AQE A;  2F1I A;  1HUO A;  3IG8 A;  5AK6 A;  4YMO A;  3U26 A;  4FBU A;  1UPH A;  4NJ8 A;  1L5U A;  1Y88 A;  2K8C B;  1K1Q A;  2ZTE A;  3H4D A;  2FE9 A;  2MSN A;  4DL5 A;  3PW4 A;  1JIH A;  2KFZ A;  2BDU A;  4I2C A;  2WF8 A;  5F3X B;  1CI4 A;  5AI4 A;  2M0N A;  2P35 A;  3MBY A;  2DPJ A;  3KZX A;  3F2B A;  4CCH A;  3JPT A;  3SAG A;  2GOL A;  4J9R A;  5ALW A;  4PGQ A;  3ISB A;  2PFP A;  4R65 A;  5HMM A;  3DDH A;  4F2S A;  1ZQR A;  2ZUB A;  4UAS A;  3NVZ A;  3NRW A;  3FM9 A;  2XID A;  1WWU A;  4YG2 A;  4ECR A;  4PL2 A;  5KAI U;  4QJF B;  2IBK A;  2QLT A;  3NAS A;  4EX7 A;  4O0I A;  1D8Y A;  2V9W A;  4EEY A;  5AKZ A;  1BPX A;  4NM1 A;  2JEG A;  2EZZ A;  1ZQM A;  4B9M A;  5KTQ A; 
#chains in the Genus database with same CATH homology
 2JR5 A;  1X6I A;  1PUZ A;  1X6J A;  2LM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...