2LM4A

Solution nmr structure of mitochondrial succinate dehydrogenase assembly factor 2 from saccharomyces cerevisiae, northeast structural genomics consortium target yt682a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
109
structure length
109
Chain Sequence
MGHHHHHHSHMIKRTNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKKMNEEELEEYDSLLNELDWDIYYWATKNFKTSPLPDKWANSKLLKQLQEFSENKEKEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of yeast succinate dehydrogenase flavinylation factor sdh5 reveals a putative sdh1 binding site.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Succinate dehydrogenase assembly factor 2, mitochondrial
total genus 37
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03937 Sdh5 Flavinator of succinate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.250 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Flavinator of succinate dehydrogenase 2lm4A01
2LM4A 1X6JA 2JR5A 1X6IA 1PUZA
chains in the Genus database with same CATH superfamily
2Y1JA 1T3QA 2W9CB 4M9JA 4QJFB 2W54A 4PL1A 2ZIVA 3RJKA 4PHEA 2HMXA 5J29A 1ZQUA 3MGIA 1UPHA 5KL1B 1XO1A 2AGOA 2UVVA 4RQ4A 9ICTA 3UMBA 3H8SA 4O0IA 4DL2A 3V7KA 4IRDA 3WK5A 4GC6A 2JEJA 5J0OA 3QUTA 1NNLA 3KZXA 4M9GA 3UXOA 9ICFA 4P0QA 9ICQA 2LKYA 2WAQF 4YMNA 4R64A 1JXLA 3DV9A 1S0VA 2LYHA 4RU9A 1A6SA 2E8PA 2KZZA 1ZQFA 4YVZA 2PFQA 1C7YA 5ALJA 5F9NA 4KTQA 4FO6A 1NK8A 1HJPA 1OXJA 3WKCA 2QB0B 1L3UA 5KFHA 5DBBA 2RHFA 4RZRA 4DQSA 4IR9A 1JN3A 2BCQA 2ZXIA 2IOHA 4IQVA 2ESEA 3QX7A 4ED0A 4I28A 5KG1A 2ATLA 3PSFA 2D3DA 3HKZC 4DL6A 4Y2TA 1NOMA 1N5XA 2N1RA 4QWBA 3UQ0A 4FZMA 3ISDA 4Y2YA 1SZHA 2PMZF 4M9NA 2BQRA 4MFFA 4CCHA 5EWFA 1ZD2P 4MHVA 4EBCA 2P66A 2KZ3A 4PJ0U 1QLNA 8ICPA 4I2EA 4R8UB 1MSWD 3KZIU 3WKBA 1IG6A 3GV8B 5KFZA 5KFJA 3H40A 5HNKA 4KLQA 4PPXA 1NI3A 4ED7A 2ZIUA 4F4XA 3KTQA 4QIWC 2NRWA 5DG7A 1ZRNA 4NLGA 1T8EA 4R65A 1NZPA 2EAMA 2W43A 3MR5A 3H0LB 4GFJA 4O3PA 3WU2U 1ZJNA 4ELUA 5KG2A 3HP6A 4EZ6A 1O08A 2HBLA 1FFVA 4YG2A 5HHHA 3C1YA 2RRDA 5ALMA 5AICA 1L8OA 5EE3A 4YMMA 4O5CA 1NK4A 3RJGA 5GTIU 3GIJA 4F8RA 3AUOA 2WB1F 4QW8A 1RPLA 2WHEA 1ZQWA 5J2CA 1TK5A 4RQ7A 2KV2A 2G06A 2D8CA 3PMLA 4ECRA 1HUZA 4EENA 2FMPA 4US8A 5KFIA 4YR2A 4JV1A 5IIOA 3A0BU 4P4PA 4TUPA 1K5OA 4X5VA 4YN4A 1URJA 3D2SA 4ED3A 2HBMA 5TISU 2F8LA 5KFEA 3BZCA 3SV3A 4DSEA 1TK0A 2ZTEA 1QSYA 1Z3EB 1V38A 3F53A 1ZD5A 5C0YA 3RJEA 1LV5A 3H0MB 3BDPA 3N7RC 3F2CA 2I1QA 5KFAA 3SAHA 2VA3A 3QU7A 5JUMA 1LVHA 2UVWA 1B22A 4P0QB 2EAOA 2Y9UA 5IIJA 2QKQA 3GZFA 1JALA 4UB3A 3GIIA 3SAGA 2C22A 2A19A 4DSFA 4I27A 1KLNA 5FP0A 5AKJA 3NASA 3KHHA 2E1FA 3M1YA 2DPJA 1BPDA 2WF6A 4RQ5A 5DB9A 8ICZA 1FEZA 1TK8A 3TAQA 5ALNA 4O3QA 2ZUDA 4C4TA 1SL1A 2YY6A 3GV5B 3RFAA 3IRUA 1DRGA 9ICXA 4F72A 1UCVA 2UVRA 3Q8QB 2XC9A 3T79A 2WTFA 2W3SA 4YD2A 5KG7A 2B6GA 4GXJA 1RYSA 3SD7A 2KKPA 2DGZA 2VA8A 3PZPA 5J0WA 3MFHA 2KOBA 3AEVA 3HWTA 1YZ6A 2DKXA 5KG0A 2K4EA 3PX6A 4EX7A 2HBJA 3FDSA 2P35A 1UT5A 4J03A 3GIKA 2PKEA 2YB4A 1YT3A 1AQ6A 1X2IA 3BS5A 3UXNA 3H0RB 5KFYA 3F2DA 4TQSA 3UMGA 2W7OA 2ZIXB 3RAXA 1JUDA 4F2SA 4QNLA 1KFDA 4DOCA 2EANA 5ALGA 3GDXA 2F1HA 3OHBA 3MR2A 1L3VA 1NK5A 4DCCA 4M9LA 2MAXA 3QNMA 2YB1A 4GIBA 3Q8PB 5D46A 4NLBA 5KFLA 1RM6C 2NO5A 5ALDA 2KSOA 4Y2PA 4I2IA 1Z1BA 2FJ6A 1EXNA 4DL3A 1CEZA 2GH1A 1TE2A 3H4DA 1JI7A 5K4LA 4RPZA 1K1QA 4YXJA 3RJFA 4EYHB 3M6KA 4YR0A 2ISOA 5KL8B 3R9KA 4C0ZA 2G0AA 2LBOA 2P6RA 2G09A 3SI8A 2A1JB 5ALUA 4F91B 2W9BB 4DQRA 3LDAA 4YR3A 4ZOHC 4LZDA 2KHVA 1BPZA 1ZQGA 1SKRA 4GXIA 5B5EU 2JH1A 2C2DA 2AXTU 4PHPA 1WWVA 3Q8MA 4KN7A 2VA2A 3FAHA 7ICNA 4F92B 1V85A 4KLOA 3ZD8A 1L3TA 1JXEA 7ICMA 4TQRA 3FYHA 4LJXA 2BDPA 1ZOLA 4XRHA 2BKEA 2F76X 3OSNA 2R8KA 3CP8A 1Z00B 5AI6A 5CRXA 5EE1A 2JH7A 2BDUA 2KSOB 2G07A 4Y2UA 4BX9C 3HILA 5HMMA 3H4BA 1U47A 1NK9A 3TADC 3SMVA 4ZH4A 5J2FA 3ZDDA 8ICQA 4XA5A 5ALEA 2RQ5A 3SENA 3IDWA 3IV6A 3CNHA 3ORYA 5GTHU 2GOLA 5HP4A 3Q8SB 2OHFA 2XIDA 1XC9A 1XU4A 4KLLA 4YP3A 4OD0A 2DPIA 3KKAC 4QZBA 4IQTA 1N56A 4F4YA 2KFNA 4Z6CA 8ICJA 5EE9A 1BPBA 3F2BA 2JRZA 3VCBA 3RH6A 9ICJA 4C8NA 4UB5A 4FE3A 2W11A 2YN4A 3NVWA 3T3FA 4I2HA 2QB1A 3ZDCA 5KAIU 1FIQA 5AM0A 4B9SA 2XO7A 1HEKA 3S6JA 2VANA 4O3MA 1N60A 4PGYA 3SAFA 1ZQBA 1TKDA 2KVCA 1A0PA 3B0XA 5AK5A 3V7JA 1ZQRA 2RP5A 9ICLA 3IG8A 4C8KA 2EAPA 3LWLA 4YXMA 5IIKA 2AH5A 2QARA 3C2KA 3N7SC 5IINA 1NJXA 1PZNA 3C5GA 3MR6A 4TURA 3ICXA 3UXPA 1WG8A 4I2GA 4U7CA 2KFZA 1TFRA 2A1JA 3TADA 3JPNA 1TAMA 2E5SA 3LWMA 1FO4A 5L1JA 1UHUA 2MSNA 1P7DA 5AM3A 3KOOA 1NK6A 1ZQNA 3JPRA 1CRXA 2H3FA 2ASJA 4DS5A 5ALQA 2KTQA 3U26A 5KFKA 2LHTA 1RXVA 4ECSA 4DL7A 4Y2SA 4EYIB 4CF3A 5L1MA 5J0RA 3RH5A 3TACB 1QSSA 5KAFU 4QWCA 5DB8A 3OHAA 1IIPA 4NL9C 2F3NA 5DGBA 4RNMA 5B66U 4K4HA 5EOZA 1TAUA 4O5EA 4EZ9A 8ICFA 3ALRA 3MGVA 1N2XA 1VDVA 3SEIA 5KFBA 5D49A 9ICSA 3JPQA 1DGJA 2C2RA 5KFFA 1TAQA 7ICFA 4ECXA 9ICVA 3DDHA 1DOQA 1SV0A 5IIIA 3SQIA 4HAIA 1WYGA 4B9TA 4UARA 7ICPA 3IM1A 4UW9A 4JV2A 4DQPA 3C2MA 2DQNB 5CB1A 2JXJA 1Q3VA 1GO3F 3OJSA 4RQ6A 3H7IA 4FFDA 1SL2A 3RTVA 3IHQB 1BPEA 4IRCA 2HHVA 1KKXA 4MEYA 3QZ7A 5DQHA 5J8YC 1MQ3A 2QB0A 2XGQA 2JEGA 3C1ZA 2FLPA 5DDMA 4P4OA 5AIAA 3RR7A 1Q46A 5JRTA 1LKYA 4RQ0A 2CPRA 2K8BB 3NVZA 8ICEA 3RAQA 2H3QA 5DG8A 3N97B 1QSLA 4O3NA 5AK3A 1X40A 1ZJMA 4PZOA 3IN5A 2G5IB 4YD1A 3WKEA 1OUQA 5AI0A 1T7PA 2VJ4A 3QXGA 8ICLA 2RDJA 4QZAA 4QW9A 5ALZA 4ELVA 2ZIXA 4KITB 3SR6A 1T3NA 3N28A 2A3VA 2VJ5A 3BZKA 4R63A 7ICQA 3OJUA 1NKEA 4C8LA 5L1IA 9ICGA 4G3IA 3RH4A 4M6WB 5CP2A 4NLZA 3I1YA 2K8CB 1ZD3A 2BPCA 3OGUA 3UMCA 4DWIA 2FI1A 1JIHA 2KJ8A 3C29A 3N4MB 2KJ9A 5J0PA 2DL0A 1ZQCA 3KFUF 5L9XA 4QZEA 2E8OA 2ZTDA 4MFAA 3T5KA 3I76A 3K75D 2ZJ8A 2HHUA 3H8MA 5AI4A 2W8LA 4JWMA 8ICHA 2BPFA 2ZTCA 8ICCA 2OM6A 2AGQA 2PI4A 4Y2QA 4UAUA 3M7DA 2OYYA 1XO0A 2GO7A 2LYBA 5KG4A 2YMQA 3AQFA 3B0YA 2WF7A 3N7PD 2DBYA 4HYKA 4OCZA 2O6KA 2Q4TA 4CRXA 1ZQLA 2WB1C 2DWQA 4QIWF 4XUSA 3RRGA 1RQLA 5AM1A 5J2KA 2KHQA 3GFKB 4J9KA 3LVVA 2F77X 1N5WA 3C5FA 1WUDA 5HR6A 1D8BA 4RQMA 2JZBA 3TFRA 5J2EA 3RJIA 3MABA 1MC8A 5ALLA 5J2AA 4ECQA 2LMRA 8ICRA 3GV7B 2ZG6A 2KNJA 4P0PA 4PH5A 2K4HA 5ALIA 8ICMA 2QARB 4KN4A 2Y0SF 3H8WA 1SL0A 2F1IA 2MRLA 3CYMA 2R18A 1CI4A 2BCRA 4ACOA 1ZYQA 5AI9A 1B4FA 1L7NA 1N61A 2PFPA 2ZJAA 5EWEA 4R66A 3UQ2A 2W9CA 3EUB2 1RG6A 3LYSA 4I2JA 4QZ9A 4RQ1A 4B9MA 1ZQHA 5DBAA 2EZXA 3HW8A 4C8OA 4QZDA 1UQVA 7ICLA 1X9MA 4BWMA 1WCNA 3KHGA 2HOFA 1J97A 9ICNA 2W03A 2I6XA 4AYBC 3KHLA 4ED8A 1MQ2A 1XSPA 7ICTA 4B9NA 4K4GA 7ICVA 4UB4A 1ZQZA 5BOLA 5ALVA 3WK9A 3A0HU 2IOFK 4TUSA 2QLTA 2ASDA 3NTUA 1DXSA 3TQ1A 3T5JA 9ICPA 7ICGA 1BNOA 4US9A 4DSJA 4FBUA 4YCXA 4DFKA 1PVQA 2WF9A 3QEAZ 5J0UA 5AIBA 3BS7A 4IQWA 2XCAA 1Y88A 2XY7A 2KVSA 4FZLA 4B6JA 3GILA 2E3TA 4JK1A 3L4PA 2OEHA 2F8KA 2JZBB 1D8LA 5AHXA 5J0SA 1B43A 4CF5A 2PI5A 2VKQA 1QQ7A 2FMQA 5BOMA 3CW2C 8ICVA 3QE9Y 3Q8KA 1NK0A 4F5QA 4ECUA 2KICA 4RNNA 4OJPA 4MEXA 2L5YA 4Q45A 4UB1A 1U45A 3NGDA 3GQCA 3PMNA 3C28A 3LK9A 2XI9A 1ZETA 4UAVA 8ICOA 2PFNA 5H2FU 2NRVA 1SWWA 3JPSA 4M2YA 3WK8A 2BGWA 4YFKA 4PHAA 1X6IA 4DF4A 3GU3A 1UT8A 5F3XB 4JUZA 4QZHA 5HR7A 3QUBA 1C20A 3Q8LA 1Q3UA 4RT2A 9ICIA 4UAZA 3BQ7A 3NVVA 4KLTA 2W04A 1L8LA 1Z19A 4I29A 1F5SA 5J0TA 4AYBF 2FE9A 1RYUA 1B0XA 2K8AA 4Z6EA 4J9MA 4Z6DA 3QEBZ 4O3RA 3IP4B 2HI0A 2HBKA 1RQNA 4BWJA 5J2JA 4F2RA 1Z4NA 1V97A 5C5JA 2ZUBA 1M6YA 4GC7A 4NV0A 5ALXA 1KBUA 2HHXA 1NJZA 2M0NA 5JU5A 4C8MA 2JR5A 5ALYA 5HMLA 1ZQPA 5KT2A 4RPXA 1XWLA 3RF9A 3PW5A 3MGHA 1LB2B 3M9OB 4FS2A 4KMUA 5KFUA 2HOQA 3QUCA 5HHIA 3BQ0A 4J9LA 3HT3A 3JPPA 5AM2A 2YMPA 4NXZA 5ALRA 4Q8FA 2JGAA 3WKDA 4OJ6A 2DFLA 1D8YA 2W9BA 5J8YA 3AL0B 2M9NA 5KG5A 5J0XA 4ECYA 1SXDA 4J9NA 5AKIA 3QU4A 5J2DA 1PVRA 1BNPA 3J81j 2V4RA 3QU9A 4ED2A 5KFSA 2ISPA 4NLNA 4J9RA 1X9SA 4OJOA 2Y0SC 2DF4B 3V72A 1BVSA 1L7OA 1X42A 4DOBA 3B9JA 1NK7A 4QZ8A 1Z1VA 3JPOA 2GLEA 4Z6FA 3TARA 2OH2A 4M47A 3M9NB 4UAYA 4F3OA 5CEHA 4Y2XA 4QZCA 7ICSA 1S76D 8ICNA 5ALTA 2EZZA 4LVSA 3PR4A 4KLGA 4QWEA 2KEYA 3D2NA 2HW3A 1A77A 3F5EA 1JX4A 7ICHA 1PK1A 9ICRA 4DL4A 3TI0A 1QTMA 2MUTA 5L1LA 4MF8A 2W55A 4DFDA 2DKZA 2BCSA 4UASA 4BXOB 3M9MB 2W8KA 1ZQIA 2YMLA 4DFPA 2HVHA 2LM4A 2KMDA 4O5KA 4ECTA 5TZVA 2J6SA 2ZIWB 2KG5A 5DB7A 4KLJA 2WFAA 5ALFA 4J9OA 1ZD4A 2Z7JA 1COKA 2MU2A 2IMWP 1L7PA 1ECWA 4CDGA 1CUKA 2NYVA 4RUAA 5KFDA 4NJ8A 1ZQAA 2P6UA 1PK3A 2BQ3A 3NRZA 4ICAA 5E79U 3QU2A 2KD1A 1U4BA 1S0OA 2OWOA 2WAQC 5KT3A 4F4WA 2HVIA 3PR5B 2AQ4A 3MC1A 4RQNA 4EX6A 4FZNA 9ICKA 1RZTA 4F4ZA 2HOIA 4I2DA 5EE0A 3K4GA 2FLLA 2R8IA 3RJHA 3BQTA 4UAWA 4O3SA 4Y2JA 2ZUCA 1SXEA 2NRZA 5KFOA 3PSTA 4NLCA 3ONNA 5CA7A 2GWSA 2D6FC 1TVAA 2R8GA 2Y9TA 4F5RA 2JMGA 2ZIWA 2V9WA 1DK2A 7ICUA 4DSKA 4F4KA 3DEEA 3HKZF 5L1KA 4DF8A 1SIJA 2W9AA 3PSIA 8ICWA 1COOA 3PW7A 4NY8A 2FPKA 5KFGA 3RBDA 4EEKA 2KK0A 4EEYA 3AN1A 1L6NA 1BPYA 3PO5A 7ICOA 1U48A 1SGGA 3TAPA 5ALOA 5CR0A 4KLFA 1ZQ1C 3OSPA 4DQQA 1XSNA 4JWNA 3WK7A 1PVPA 5G5GA 2FDRA 3UM9A 5KFPA 1ZQDA 2JEFA 2EH9A 5DQIA 5KT5A 1L3SA 2ZIVB 3QZ8A 4DL5A 5AI8A 4YQWA 2KP7A 2XGPA 8ICGA 3EWAA 3HJEA 1S10A 4IC9A 4I2FA 3M8SA 5DLFA 5ALPA 4BXOA 1S9FA 3T5HA 3RJJA 5AI5A 1J2MA 3UPQA 3QUQA 4O3OA 5J2IA 4M9HA 1YZ7A 5DBCA 2VIXA 4ECVA 5G5HA 8ICKA 5AK6A 3RB4A 1SWVA 4CGZA 8ICXA 4KLHA 2H3VA 2XVTA 1KRPA 4BGDA 2J6TA 2NV3A 8ICTA 5KTQA 7ICIA 3SZ2A 4DOAA 3TKAA 4Q44A 3QYPA 2MUTB 2UVUA 2IBKA 4O9MA 2B21A 3NUQA 3M8RA 4I2BA 1S8OA 5A0LA 1IM4A 3MDCA 3SV4A 3KD3A 5J0YA 5DG9A 3NVYA 2IHMA 9ICAA 4RQ3A 1A76A 1JMSA 8ICUA 4M6WA 4Y2RA 2G5HB 2I5HA 1D9FA 4UBCA 1VLBA 2K4IA 4PZNA 5DB6A 2BHNA 4IQUA 5J2GA 4CF4A 3I28A 1QCKA 2R8HA 3ZDEA 2DUYA 3V6KA 5KFQA 4R8UA 1S97A 4NM2A 3MBYA 4JMUA 3D6JA 3ETLA 2AHOB 5KFRA 3ZI4A 4B9VA 3PX4A 4MF2A 9ICCA 4PGXA 5KNIA 2F2AB 2LPEA 2W7PA 1FFUA 2YMMA 9ICMA 4KLIA 2BPGA 3EPIA 3BS5B 1ZRMA 4BUGA 4BDPA 2A1AA 3V6JA 4J9SA 4KLUA 1KFTA 3MDAA 4F50A 2B0CA 1L7MA 4KLMA 3VC8A 5ALKA 3HRDD 3E58A 2H3ZA 4P4MA 4KMOB 3RR8A 1JRPA 1Z4OA 4UB2A 8ICSA 1KDHA 3KKAA 3EPGA 5AKXA 5EWGA 2HHQA 3JPTA 4RT3A 1HIWA 2JHDA 3AM9A 2AJQA 1HUOA 3L5KA 1X6JA 1WCLA 1X66A 2YQEA 1N62A 2HCFA 4P0PB 3RRHA 2ZJ5A 4CNQA 2F1JA 1Z00A 3QU5A 5AM4A 2AGPA 3RB6A 1PK1B 2YX8A 3KHRA 2LI6A 8ICIA 1ZQVA 2WF8A 4DFJA 2CRXA 1XNSA 2HDOA 5DQGA 1KN5A 2V4QA 4JV0A 5IIMA 5AKHA 5KT6A 3MR3A 3PNCA 3RB3A 2KN7A 3O0FA 9ICEA 1MN8A 1N63A 3ZD9A 5J0QA 4WJ3B 1XS9D 2OXOA 2IHNA 1ZXIA 2XCPA 1LKYB 4ELTA 2J6UA 4KX5A 4USAA 3EW9A 3RB0A 1OW5A 5AKYA 4FS1A 2OCEA 1RXWA 5AKEA 5KFCA 3V7LA 4QZIA 4UB6U 1ZQQA 1VJ5A 2IOFA 5T14A 4ED6A 2FPMA 4EBDA 1ZQTA 5DGAA 4J9QA 3THVA 4NL9A 2AU0A 3PX0A 4MFCA 4P2HA 2XY6A 1ZQJA 1KFSA 5KFXA 2K89A 4DSLA 4ECZA 5CWRA 4QWDA 1NJWA 4QZGA 2BQUA 1ZQXA 5IILA 1S77D 1ZQKA 4C80A 4IRKA 1KEJA 1S5LU 2XICA 3AQEA 4G9BA 4DLEA 4GLXA 1TV9A 4UBBA 2EDUA 5DKWA 1BGXT 3H8JA 3BJYA 2KKVA 2K4PA 4YMOA 5KG6A 4EELA 2LM1A 3IG5A 2HHWA 2BCVA 3GIMA 7ICEA 2G08A 4Y2VA 5F9LA 3BQ2A 1DGSA 4UATA 4CE6A 3K1RB 3HPOA 1ZQMA 3CRXA 4UB8U 3AU2A 2Y1IA 1AROP 2ASLA 1D9DA 2JEIA 2HHSA 1U9LA 1F0MA 1NJYA 3AU6A 1KL9A 3PY8A 3ETRA 4IS7A 2K60A 3E0FA 4Q8EA 4PL2A 3WK6A 4C7ZA 2F44A 5J2BA 4PHDA 3LVWA 1RYRA 1DK3A 4LZGA 2HSZA 1X9XA 4RQ8A 1KQQA 1SV4A 1S0MA 1PUZA 3PSPA 4ECWA 3K1ZA 5DDYA 4F5OA 5AK4A 5J2HA 2RDIA 2E8MA 4F93B 4DLGA 2FLNA 1U49A 1QQ6A 8ICBA 2KIWA 2AQ0A 4DSIA 5KT4A 9ICWA 3ISBA 2C2EA 2JV3A 1SZPA 4A8EA 4QWAA 2ZIUB 3E2EA 2EZYA 3OTQA 4ED1A 3G6VA 1J2NA 4DQIA 2E1EA 2NRTA 5AKZA 2WF5A 4OO1J 1WWUA 2FPLA 2IA6A 4I2AA 1KSPA 3PO4A 1QQ5A 3AMZA 5KG3A 9ICBA 4M0AA 1JROA 8ICYA 4IR1A 4IL6U 2H3IA 3HX0A 2ODGA 4DO9A 1ZQYA 4F5NA 3RBEA 2YTUA 4DEZA 5AKKA 5KFNA 5KFMA 1S0NA 2KIVA 4QZFA 2E8NA 5CHGA 4J9PA 5JTIA 2KJ5A 2CXYA 5KFVA 3T5LA 5KT7A 4KLSA 5BPCA 2H5XA 5KFWA 3ZDAA 4KLDA 2EQYA 2I9GA 4XQ8A 3V6HA 7ICJA 2CN1A 5AKLA 2PFOA 1XSLA 5CJ7A 1K1SA 3TANA 2W3RA 4OJ5A 1NKCA 1MA7A 2BCUA 2PMZC 1ZQSA 3PVXA 5KFTA 2KE7A 3ZDBA 2NO4A 2R8JA 4C7YA 4FBTA 2LYAA 3PW2A 3L3FX 4B9LA 3NS1A 9ICHA 4PGQA 4F71A 4TUQA 2ALZA 4KX3A 3G6XA 3G6YA 4M04A 3PW0A 1SKWA 9ICOA 3FC4A 3D2QA 3EZ5A 4RUCA 1IXRA 1BPXA 2RLTA 4JB3A 8ICAA 4OJLA 1T94A 9ICUA 3WK4A 2W9MA 4NWIA 1NKBA 3PW4A 1F44A 1KTQA 3C21A 1L5UA 1V9PA 4NM1A 1Q8KA 3C23A 3ISCA 3EYZA 4I2CA 3BQ1A 1X9WA 1IV8A 4DS4A 1SKSA 3WKAA 4NLKA 5DLGA 2HHTA 3MFIA 7ICKA 1UA1A 4U6PA 1T4GA 4C4RA 1ED1A 1RDFA 4RNOA 3PV8A 3TFSA 1QH9A 5ALWA 1O03A 3F5AA 3C2LA 2C28A 4B9UA 1ZQEA 5ALHA 1H38A 4EBEA 4DFMA 4UQGA 5D4BA 2KZMA 4GXKA 4KLEA 5AM5A 2PXIA 3M6ZA 4BJQA 2ZXHA 3ED5A 5AKGA 3KBBA 1N48A 2FMSA 2Q0ZX 4E0DA 4F5PA 4Q43A 3SYZA 2BZFA 4K4IA 2NRXA 3NRWA 2ES6A 2BR0A 4AP9A 3Q8RB 1UA0A 1NZBA 1KW4A 1SV0C 3FM9A 3OPXA 4RPYA 2MA1A 2XY5A 1ZQOA 1SB3C 4C4SA 5ALSA 7ICRA 4RQ2A
chains in the Genus database with same CATH topology
2LM4A 1X6JA 2JR5A 1X6IA 1PUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LM4 A;  1X6J A;  2JR5 A;  1X6I A;  1PUZ A; 
#chains in the Genus database with same CATH topology
 2Y1J A;  1T3Q A;  2W9C B;  4M9J A;  4QJF B;  2W54 A;  4PL1 A;  2ZIV A;  3RJK A;  4PHE A;  2HMX A;  5J29 A;  1ZQU A;  3MGI A;  1UPH A;  5KL1 B;  1XO1 A;  2AGO A;  2UVV A;  4RQ4 A;  9ICT A;  3UMB A;  3H8S A;  4O0I A;  4DL2 A;  3V7K A;  4IRD A;  3WK5 A;  4GC6 A;  2JEJ A;  5J0O A;  3QUT A;  1NNL A;  3KZX A;  4M9G A;  3UXO A;  9ICF A;  4P0Q A;  9ICQ A;  2LKY A;  2WAQ F;  4YMN A;  4R64 A;  1JXL A;  3DV9 A;  1S0V A;  2LYH A;  4RU9 A;  1A6S A;  2E8P A;  2KZZ A;  1ZQF A;  4YVZ A;  2PFQ A;  1C7Y A;  5ALJ A;  5F9N A;  4KTQ A;  4FO6 A;  1NK8 A;  1HJP A;  1OXJ A;  3WKC A;  2QB0 B;  1L3U A;  5KFH A;  5DBB A;  2RHF A;  4RZR A;  4DQS A;  4IR9 A;  1JN3 A;  2BCQ A;  2ZXI A;  2IOH A;  4IQV A;  2ESE A;  3QX7 A;  4ED0 A;  4I28 A;  5KG1 A;  2ATL A;  3PSF A;  2D3D A;  3HKZ C;  4DL6 A;  4Y2T A;  1NOM A;  1N5X A;  2N1R A;  4QWB A;  3UQ0 A;  4FZM A;  3ISD A;  4Y2Y A;  1SZH A;  2PMZ F;  4M9N A;  2BQR A;  4MFF A;  4CCH A;  5EWF A;  1ZD2 P;  4MHV A;  4EBC A;  2P66 A;  2KZ3 A;  4PJ0 U;  1QLN A;  8ICP A;  4I2E A;  4R8U B;  1MSW D;  3KZI U;  3WKB A;  1IG6 A;  3GV8 B;  5KFZ A;  5KFJ A;  3H40 A;  5HNK A;  4KLQ A;  4PPX A;  1NI3 A;  4ED7 A;  2ZIU A;  4F4X A;  3KTQ A;  4QIW C;  2NRW A;  5DG7 A;  1ZRN A;  4NLG A;  1T8E A;  4R65 A;  1NZP A;  2EAM A;  2W43 A;  3MR5 A;  3H0L B;  4GFJ A;  4O3P A;  3WU2 U;  1ZJN A;  4ELU A;  5KG2 A;  3HP6 A;  4EZ6 A;  1O08 A;  2HBL A;  1FFV A;  4YG2 A;  5HHH A;  3C1Y A;  2RRD A;  5ALM A;  5AIC A;  1L8O A;  5EE3 A;  4YMM A;  4O5C A;  1NK4 A;  3RJG A;  5GTI U;  3GIJ A;  4F8R A;  3AUO A;  2WB1 F;  4QW8 A;  1RPL A;  2WHE A;  1ZQW A;  5J2C A;  1TK5 A;  4RQ7 A;  2KV2 A;  2G06 A;  2D8C A;  3PML A;  4ECR A;  1HUZ A;  4EEN A;  2FMP A;  4US8 A;  5KFI A;  4YR2 A;  4JV1 A;  5IIO A;  3A0B U;  4P4P A;  4TUP A;  1K5O A;  4X5V A;  4YN4 A;  1URJ A;  3D2S A;  4ED3 A;  2HBM A;  5TIS U;  2F8L A;  5KFE A;  3BZC A;  3SV3 A;  4DSE A;  1TK0 A;  2ZTE A;  1QSY A;  1Z3E B;  1V38 A;  3F53 A;  1ZD5 A;  5C0Y A;  3RJE A;  1LV5 A;  3H0M B;  3BDP A;  3N7R C;  3F2C A;  2I1Q A;  5KFA A;  3SAH A;  2VA3 A;  3QU7 A;  5JUM A;  1LVH A;  2UVW A;  1B22 A;  4P0Q B;  2EAO A;  2Y9U A;  5IIJ A;  2QKQ A;  3GZF A;  1JAL A;  4UB3 A;  3GII A;  3SAG A;  2C22 A;  2A19 A;  4DSF A;  4I27 A;  1KLN A;  5FP0 A;  5AKJ A;  3NAS A;  3KHH A;  2E1F A;  3M1Y A;  2DPJ A;  1BPD A;  2WF6 A;  4RQ5 A;  5DB9 A;  8ICZ A;  1FEZ A;  1TK8 A;  3TAQ A;  5ALN A;  4O3Q A;  2ZUD A;  4C4T A;  1SL1 A;  2YY6 A;  3GV5 B;  3RFA A;  3IRU A;  1DRG A;  9ICX A;  4F72 A;  1UCV A;  2UVR A;  3Q8Q B;  2XC9 A;  3T79 A;  2WTF A;  2W3S A;  4YD2 A;  5KG7 A;  2B6G A;  4GXJ A;  1RYS A;  3SD7 A;  2KKP A;  2DGZ A;  2VA8 A;  3PZP A;  5J0W A;  3MFH A;  2KOB A;  3AEV A;  3HWT A;  1YZ6 A;  2DKX A;  5KG0 A;  2K4E A;  3PX6 A;  4EX7 A;  2HBJ A;  3FDS A;  2P35 A;  1UT5 A;  4J03 A;  3GIK A;  2PKE A;  2YB4 A;  1YT3 A;  1AQ6 A;  1X2I A;  3BS5 A;  3UXN A;  3H0R B;  5KFY A;  3F2D A;  4TQS A;  3UMG A;  2W7O A;  2ZIX B;  3RAX A;  1JUD A;  4F2S A;  4QNL A;  1KFD A;  4DOC A;  2EAN A;  5ALG A;  3GDX A;  2F1H A;  3OHB A;  3MR2 A;  1L3V A;  1NK5 A;  4DCC A;  4M9L A;  2MAX A;  3QNM A;  2YB1 A;  4GIB A;  3Q8P B;  5D46 A;  4NLB A;  5KFL A;  1RM6 C;  2NO5 A;  5ALD A;  2KSO A;  4Y2P A;  4I2I A;  1Z1B A;  2FJ6 A;  1EXN A;  4DL3 A;  1CEZ A;  2GH1 A;  1TE2 A;  3H4D A;  1JI7 A;  5K4L A;  4RPZ A;  1K1Q A;  4YXJ A;  3RJF A;  4EYH B;  3M6K A;  4YR0 A;  2ISO A;  5KL8 B;  3R9K A;  4C0Z A;  2G0A A;  2LBO A;  2P6R A;  2G09 A;  3SI8 A;  2A1J B;  5ALU A;  4F91 B;  2W9B B;  4DQR A;  3LDA A;  4YR3 A;  4ZOH C;  4LZD A;  2KHV A;  1BPZ A;  1ZQG A;  1SKR A;  4GXI A;  5B5E U;  2JH1 A;  2C2D A;  2AXT U;  4PHP A;  1WWV A;  3Q8M A;  4KN7 A;  2VA2 A;  3FAH A;  7ICN A;  4F92 B;  1V85 A;  4KLO A;  3ZD8 A;  1L3T A;  1JXE A;  7ICM A;  4TQR A;  3FYH A;  4LJX A;  2BDP A;  1ZOL A;  4XRH A;  2BKE A;  2F76 X;  3OSN A;  2R8K A;  3CP8 A;  1Z00 B;  5AI6 A;  5CRX A;  5EE1 A;  2JH7 A;  2BDU A;  2KSO B;  2G07 A;  4Y2U A;  4BX9 C;  3HIL A;  5HMM A;  3H4B A;  1U47 A;  1NK9 A;  3TAD C;  3SMV A;  4ZH4 A;  5J2F A;  3ZDD A;  8ICQ A;  4XA5 A;  5ALE A;  2RQ5 A;  3SEN A;  3IDW A;  3IV6 A;  3CNH A;  3ORY A;  5GTH U;  2GOL A;  5HP4 A;  3Q8S B;  2OHF A;  2XID A;  1XC9 A;  1XU4 A;  4KLL A;  4YP3 A;  4OD0 A;  2DPI A;  3KKA C;  4QZB A;  4IQT A;  1N56 A;  4F4Y A;  2KFN A;  4Z6C A;  8ICJ A;  5EE9 A;  1BPB A;  3F2B A;  2JRZ A;  3VCB A;  3RH6 A;  9ICJ A;  4C8N A;  4UB5 A;  4FE3 A;  2W11 A;  2YN4 A;  3NVW A;  3T3F A;  4I2H A;  2QB1 A;  3ZDC A;  5KAI U;  1FIQ A;  5AM0 A;  4B9S A;  2XO7 A;  1HEK A;  3S6J A;  2VAN A;  4O3M A;  1N60 A;  4PGY A;  3SAF A;  1ZQB A;  1TKD A;  2KVC A;  1A0P A;  3B0X A;  5AK5 A;  3V7J A;  1ZQR A;  2RP5 A;  9ICL A;  3IG8 A;  4C8K A;  2EAP A;  3LWL A;  4YXM A;  5IIK A;  2AH5 A;  2QAR A;  3C2K A;  3N7S C;  5IIN A;  1NJX A;  1PZN A;  3C5G A;  3MR6 A;  4TUR A;  3ICX A;  3UXP A;  1WG8 A;  4I2G A;  4U7C A;  2KFZ A;  1TFR A;  2A1J A;  3TAD A;  3JPN A;  1TAM A;  2E5S A;  3LWM A;  1FO4 A;  5L1J A;  1UHU A;  2MSN A;  1P7D A;  5AM3 A;  3KOO A;  1NK6 A;  1ZQN A;  3JPR A;  1CRX A;  2H3F A;  2ASJ A;  4DS5 A;  5ALQ A;  2KTQ A;  3U26 A;  5KFK A;  2LHT A;  1RXV A;  4ECS A;  4DL7 A;  4Y2S A;  4EYI B;  4CF3 A;  5L1M A;  5J0R A;  3RH5 A;  3TAC B;  1QSS A;  5KAF U;  4QWC A;  5DB8 A;  3OHA A;  1IIP A;  4NL9 C;  2F3N A;  5DGB A;  4RNM A;  5B66 U;  4K4H A;  5EOZ A;  1TAU A;  4O5E A;  4EZ9 A;  8ICF A;  3ALR A;  3MGV A;  1N2X A;  1VDV A;  3SEI A;  5KFB A;  5D49 A;  9ICS A;  3JPQ A;  1DGJ A;  2C2R A;  5KFF A;  1TAQ A;  7ICF A;  4ECX A;  9ICV A;  3DDH A;  1DOQ A;  1SV0 A;  5III A;  3SQI A;  4HAI A;  1WYG A;  4B9T A;  4UAR A;  7ICP A;  3IM1 A;  4UW9 A;  4JV2 A;  4DQP A;  3C2M A;  2DQN B;  5CB1 A;  2JXJ A;  1Q3V A;  1GO3 F;  3OJS A;  4RQ6 A;  3H7I A;  4FFD A;  1SL2 A;  3RTV A;  3IHQ B;  1BPE A;  4IRC A;  2HHV A;  1KKX A;  4MEY A;  3QZ7 A;  5DQH A;  5J8Y C;  1MQ3 A;  2QB0 A;  2XGQ A;  2JEG A;  3C1Z A;  2FLP A;  5DDM A;  4P4O A;  5AIA A;  3RR7 A;  1Q46 A;  5JRT A;  1LKY A;  4RQ0 A;  2CPR A;  2K8B B;  3NVZ A;  8ICE A;  3RAQ A;  2H3Q A;  5DG8 A;  3N97 B;  1QSL A;  4O3N A;  5AK3 A;  1X40 A;  1ZJM A;  4PZO A;  3IN5 A;  2G5I B;  4YD1 A;  3WKE A;  1OUQ A;  5AI0 A;  1T7P A;  2VJ4 A;  3QXG A;  8ICL A;  2RDJ A;  4QZA A;  4QW9 A;  5ALZ A;  4ELV A;  2ZIX A;  4KIT B;  3SR6 A;  1T3N A;  3N28 A;  2A3V A;  2VJ5 A;  3BZK A;  4R63 A;  7ICQ A;  3OJU A;  1NKE A;  4C8L A;  5L1I A;  9ICG A;  4G3I A;  3RH4 A;  4M6W B;  5CP2 A;  4NLZ A;  3I1Y A;  2K8C B;  1ZD3 A;  2BPC A;  3OGU A;  3UMC A;  4DWI A;  2FI1 A;  1JIH A;  2KJ8 A;  3C29 A;  3N4M B;  2KJ9 A;  5J0P A;  2DL0 A;  1ZQC A;  3KFU F;  5L9X A;  4QZE A;  2E8O A;  2ZTD A;  4MFA A;  3T5K A;  3I76 A;  3K75 D;  2ZJ8 A;  2HHU A;  3H8M A;  5AI4 A;  2W8L A;  4JWM A;  8ICH A;  2BPF A;  2ZTC A;  8ICC A;  2OM6 A;  2AGQ A;  2PI4 A;  4Y2Q A;  4UAU A;  3M7D A;  2OYY A;  1XO0 A;  2GO7 A;  2LYB A;  5KG4 A;  2YMQ A;  3AQF A;  3B0Y A;  2WF7 A;  3N7P D;  2DBY A;  4HYK A;  4OCZ A;  2O6K A;  2Q4T A;  4CRX A;  1ZQL A;  2WB1 C;  2DWQ A;  4QIW F;  4XUS A;  3RRG A;  1RQL A;  5AM1 A;  5J2K A;  2KHQ A;  3GFK B;  4J9K A;  3LVV A;  2F77 X;  1N5W A;  3C5F A;  1WUD A;  5HR6 A;  1D8B A;  4RQM A;  2JZB A;  3TFR A;  5J2E A;  3RJI A;  3MAB A;  1MC8 A;  5ALL A;  5J2A A;  4ECQ A;  2LMR A;  8ICR A;  3GV7 B;  2ZG6 A;  2KNJ A;  4P0P A;  4PH5 A;  2K4H A;  5ALI A;  8ICM A;  2QAR B;  4KN4 A;  2Y0S F;  3H8W A;  1SL0 A;  2F1I A;  2MRL A;  3CYM A;  2R18 A;  1CI4 A;  2BCR A;  4ACO A;  1ZYQ A;  5AI9 A;  1B4F A;  1L7N A;  1N61 A;  2PFP A;  2ZJA A;  5EWE A;  4R66 A;  3UQ2 A;  2W9C A;  3EUB 2;  1RG6 A;  3LYS A;  4I2J A;  4QZ9 A;  4RQ1 A;  4B9M A;  1ZQH A;  5DBA A;  2EZX A;  3HW8 A;  4C8O A;  4QZD A;  1UQV A;  7ICL A;  1X9M A;  4BWM A;  1WCN A;  3KHG A;  2HOF A;  1J97 A;  9ICN A;  2W03 A;  2I6X A;  4AYB C;  3KHL A;  4ED8 A;  1MQ2 A;  1XSP A;  7ICT A;  4B9N A;  4K4G A;  7ICV A;  4UB4 A;  1ZQZ A;  5BOL A;  5ALV A;  3WK9 A;  3A0H U;  2IOF K;  4TUS A;  2QLT A;  2ASD A;  3NTU A;  1DXS A;  3TQ1 A;  3T5J A;  9ICP A;  7ICG A;  1BNO A;  4US9 A;  4DSJ A;  4FBU A;  4YCX A;  4DFK A;  1PVQ A;  2WF9 A;  3QEA Z;  5J0U A;  5AIB A;  3BS7 A;  4IQW A;  2XCA A;  1Y88 A;  2XY7 A;  2KVS A;  4FZL A;  4B6J A;  3GIL A;  2E3T A;  4JK1 A;  3L4P A;  2OEH A;  2F8K A;  2JZB B;  1D8L A;  5AHX A;  5J0S A;  1B43 A;  4CF5 A;  2PI5 A;  2VKQ A;  1QQ7 A;  2FMQ A;  5BOM A;  3CW2 C;  8ICV A;  3QE9 Y;  3Q8K A;  1NK0 A;  4F5Q A;  4ECU A;  2KIC A;  4RNN A;  4OJP A;  4MEX A;  2L5Y A;  4Q45 A;  4UB1 A;  1U45 A;  3NGD A;  3GQC A;  3PMN A;  3C28 A;  3LK9 A;  2XI9 A;  1ZET A;  4UAV A;  8ICO A;  2PFN A;  5H2F U;  2NRV A;  1SWW A;  3JPS A;  4M2Y A;  3WK8 A;  2BGW A;  4YFK A;  4PHA A;  1X6I A;  4DF4 A;  3GU3 A;  1UT8 A;  5F3X B;  4JUZ A;  4QZH A;  5HR7 A;  3QUB A;  1C20 A;  3Q8L A;  1Q3U A;  4RT2 A;  9ICI A;  4UAZ A;  3BQ7 A;  3NVV A;  4KLT A;  2W04 A;  1L8L A;  1Z19 A;  4I29 A;  1F5S A;  5J0T A;  4AYB F;  2FE9 A;  1RYU A;  1B0X A;  2K8A A;  4Z6E A;  4J9M A;  4Z6D A;  3QEB Z;  4O3R A;  3IP4 B;  2HI0 A;  2HBK A;  1RQN A;  4BWJ A;  5J2J A;  4F2R A;  1Z4N A;  1V97 A;  5C5J A;  2ZUB A;  1M6Y A;  4GC7 A;  4NV0 A;  5ALX A;  1KBU A;  2HHX A;  1NJZ A;  2M0N A;  5JU5 A;  4C8M A;  2JR5 A;  5ALY A;  5HML A;  1ZQP A;  5KT2 A;  4RPX A;  1XWL A;  3RF9 A;  3PW5 A;  3MGH A;  1LB2 B;  3M9O B;  4FS2 A;  4KMU A;  5KFU A;  2HOQ A;  3QUC A;  5HHI A;  3BQ0 A;  4J9L A;  3HT3 A;  3JPP A;  5AM2 A;  2YMP A;  4NXZ A;  5ALR A;  4Q8F A;  2JGA A;  3WKD A;  4OJ6 A;  2DFL A;  1D8Y A;  2W9B A;  5J8Y A;  3AL0 B;  2M9N A;  5KG5 A;  5J0X A;  4ECY A;  1SXD A;  4J9N A;  5AKI A;  3QU4 A;  5J2D A;  1PVR A;  1BNP A;  3J81 j;  2V4R A;  3QU9 A;  4ED2 A;  5KFS A;  2ISP A;  4NLN A;  4J9R A;  1X9S A;  4OJO A;  2Y0S C;  2DF4 B;  3V72 A;  1BVS A;  1L7O A;  1X42 A;  4DOB A;  3B9J A;  1NK7 A;  4QZ8 A;  1Z1V A;  3JPO A;  2GLE A;  4Z6F A;  3TAR A;  2OH2 A;  4M47 A;  3M9N B;  4UAY A;  4F3O A;  5CEH A;  4Y2X A;  4QZC A;  7ICS A;  1S76 D;  8ICN A;  5ALT A;  2EZZ A;  4LVS A;  3PR4 A;  4KLG A;  4QWE A;  2KEY A;  3D2N A;  2HW3 A;  1A77 A;  3F5E A;  1JX4 A;  7ICH A;  1PK1 A;  9ICR A;  4DL4 A;  3TI0 A;  1QTM A;  2MUT A;  5L1L A;  4MF8 A;  2W55 A;  4DFD A;  2DKZ A;  2BCS A;  4UAS A;  4BXO B;  3M9M B;  2W8K A;  1ZQI A;  2YML A;  4DFP A;  2HVH A;  2LM4 A;  2KMD A;  4O5K A;  4ECT A;  5TZV A;  2J6S A;  2ZIW B;  2KG5 A;  5DB7 A;  4KLJ A;  2WFA A;  5ALF A;  4J9O A;  1ZD4 A;  2Z7J A;  1COK A;  2MU2 A;  2IMW P;  1L7P A;  1ECW A;  4CDG A;  1CUK A;  2NYV A;  4RUA A;  5KFD A;  4NJ8 A;  1ZQA A;  2P6U A;  1PK3 A;  2BQ3 A;  3NRZ A;  4ICA A;  5E79 U;  3QU2 A;  2KD1 A;  1U4B A;  1S0O A;  2OWO A;  2WAQ C;  5KT3 A;  4F4W A;  2HVI A;  3PR5 B;  2AQ4 A;  3MC1 A;  4RQN A;  4EX6 A;  4FZN A;  9ICK A;  1RZT A;  4F4Z A;  2HOI A;  4I2D A;  5EE0 A;  3K4G A;  2FLL A;  2R8I A;  3RJH A;  3BQT A;  4UAW A;  4O3S A;  4Y2J A;  2ZUC A;  1SXE A;  2NRZ A;  5KFO A;  3PST A;  4NLC A;  3ONN A;  5CA7 A;  2GWS A;  2D6F C;  1TVA A;  2R8G A;  2Y9T A;  4F5R A;  2JMG A;  2ZIW A;  2V9W A;  1DK2 A;  7ICU A;  4DSK A;  4F4K A;  3DEE A;  3HKZ F;  5L1K A;  4DF8 A;  1SIJ A;  2W9A A;  3PSI A;  8ICW A;  1COO A;  3PW7 A;  4NY8 A;  2FPK A;  5KFG A;  3RBD A;  4EEK A;  2KK0 A;  4EEY A;  3AN1 A;  1L6N A;  1BPY A;  3PO5 A;  7ICO A;  1U48 A;  1SGG A;  3TAP A;  5ALO A;  5CR0 A;  4KLF A;  1ZQ1 C;  3OSP A;  4DQQ A;  1XSN A;  4JWN A;  3WK7 A;  1PVP A;  5G5G A;  2FDR A;  3UM9 A;  5KFP A;  1ZQD A;  2JEF A;  2EH9 A;  5DQI A;  5KT5 A;  1L3S A;  2ZIV B;  3QZ8 A;  4DL5 A;  5AI8 A;  4YQW A;  2KP7 A;  2XGP A;  8ICG A;  3EWA A;  3HJE A;  1S10 A;  4IC9 A;  4I2F A;  3M8S A;  5DLF A;  5ALP A;  4BXO A;  1S9F A;  3T5H A;  3RJJ A;  5AI5 A;  1J2M A;  3UPQ A;  3QUQ A;  4O3O A;  5J2I A;  4M9H A;  1YZ7 A;  5DBC A;  2VIX A;  4ECV A;  5G5H A;  8ICK A;  5AK6 A;  3RB4 A;  1SWV A;  4CGZ A;  8ICX A;  4KLH A;  2H3V A;  2XVT A;  1KRP A;  4BGD A;  2J6T A;  2NV3 A;  8ICT A;  5KTQ A;  7ICI A;  3SZ2 A;  4DOA A;  3TKA A;  4Q44 A;  3QYP A;  2MUT B;  2UVU A;  2IBK A;  4O9M A;  2B21 A;  3NUQ A;  3M8R A;  4I2B A;  1S8O A;  5A0L A;  1IM4 A;  3MDC A;  3SV4 A;  3KD3 A;  5J0Y A;  5DG9 A;  3NVY A;  2IHM A;  9ICA A;  4RQ3 A;  1A76 A;  1JMS A;  8ICU A;  4M6W A;  4Y2R A;  2G5H B;  2I5H A;  1D9F A;  4UBC A;  1VLB A;  2K4I A;  4PZN A;  5DB6 A;  2BHN A;  4IQU A;  5J2G A;  4CF4 A;  3I28 A;  1QCK A;  2R8H A;  3ZDE A;  2DUY A;  3V6K A;  5KFQ A;  4R8U A;  1S97 A;  4NM2 A;  3MBY A;  4JMU A;  3D6J A;  3ETL A;  2AHO B;  5KFR A;  3ZI4 A;  4B9V A;  3PX4 A;  4MF2 A;  9ICC A;  4PGX A;  5KNI A;  2F2A B;  2LPE A;  2W7P A;  1FFU A;  2YMM A;  9ICM A;  4KLI A;  2BPG A;  3EPI A;  3BS5 B;  1ZRM A;  4BUG A;  4BDP A;  2A1A A;  3V6J A;  4J9S A;  4KLU A;  1KFT A;  3MDA A;  4F50 A;  2B0C A;  1L7M A;  4KLM A;  3VC8 A;  5ALK A;  3HRD D;  3E58 A;  2H3Z A;  4P4M A;  4KMO B;  3RR8 A;  1JRP A;  1Z4O A;  4UB2 A;  8ICS A;  1KDH A;  3KKA A;  3EPG A;  5AKX A;  5EWG A;  2HHQ A;  3JPT A;  4RT3 A;  1HIW A;  2JHD A;  3AM9 A;  2AJQ A;  1HUO A;  3L5K A;  1X6J A;  1WCL A;  1X66 A;  2YQE A;  1N62 A;  2HCF A;  4P0P B;  3RRH A;  2ZJ5 A;  4CNQ A;  2F1J A;  1Z00 A;  3QU5 A;  5AM4 A;  2AGP A;  3RB6 A;  1PK1 B;  2YX8 A;  3KHR A;  2LI6 A;  8ICI A;  1ZQV A;  2WF8 A;  4DFJ A;  2CRX A;  1XNS A;  2HDO A;  5DQG A;  1KN5 A;  2V4Q A;  4JV0 A;  5IIM A;  5AKH A;  5KT6 A;  3MR3 A;  3PNC A;  3RB3 A;  2KN7 A;  3O0F A;  9ICE A;  1MN8 A;  1N63 A;  3ZD9 A;  5J0Q A;  4WJ3 B;  1XS9 D;  2OXO A;  2IHN A;  1ZXI A;  2XCP A;  1LKY B;  4ELT A;  2J6U A;  4KX5 A;  4USA A;  3EW9 A;  3RB0 A;  1OW5 A;  5AKY A;  4FS1 A;  2OCE A;  1RXW A;  5AKE A;  5KFC A;  3V7L A;  4QZI A;  4UB6 U;  1ZQQ A;  1VJ5 A;  2IOF A;  5T14 A;  4ED6 A;  2FPM A;  4EBD A;  1ZQT A;  5DGA A;  4J9Q A;  3THV A;  4NL9 A;  2AU0 A;  3PX0 A;  4MFC A;  4P2H A;  2XY6 A;  1ZQJ A;  1KFS A;  5KFX A;  2K89 A;  4DSL A;  4ECZ A;  5CWR A;  4QWD A;  1NJW A;  4QZG A;  2BQU A;  1ZQX A;  5IIL A;  1S77 D;  1ZQK A;  4C80 A;  4IRK A;  1KEJ A;  1S5L U;  2XIC A;  3AQE A;  4G9B A;  4DLE A;  4GLX A;  1TV9 A;  4UBB A;  2EDU A;  5DKW A;  1BGX T;  3H8J A;  3BJY A;  2KKV A;  2K4P A;  4YMO A;  5KG6 A;  4EEL A;  2LM1 A;  3IG5 A;  2HHW A;  2BCV A;  3GIM A;  7ICE A;  2G08 A;  4Y2V A;  5F9L A;  3BQ2 A;  1DGS A;  4UAT A;  4CE6 A;  3K1R B;  3HPO A;  1ZQM A;  3CRX A;  4UB8 U;  3AU2 A;  2Y1I A;  1ARO P;  2ASL A;  1D9D A;  2JEI A;  2HHS A;  1U9L A;  1F0M A;  1NJY A;  3AU6 A;  1KL9 A;  3PY8 A;  3ETR A;  4IS7 A;  2K60 A;  3E0F A;  4Q8E A;  4PL2 A;  3WK6 A;  4C7Z A;  2F44 A;  5J2B A;  4PHD A;  3LVW A;  1RYR A;  1DK3 A;  4LZG A;  2HSZ A;  1X9X A;  4RQ8 A;  1KQQ A;  1SV4 A;  1S0M A;  1PUZ A;  3PSP A;  4ECW A;  3K1Z A;  5DDY A;  4F5O A;  5AK4 A;  5J2H A;  2RDI A;  2E8M A;  4F93 B;  4DLG A;  2FLN A;  1U49 A;  1QQ6 A;  8ICB A;  2KIW A;  2AQ0 A;  4DSI A;  5KT4 A;  9ICW A;  3ISB A;  2C2E A;  2JV3 A;  1SZP A;  4A8E A;  4QWA A;  2ZIU B;  3E2E A;  2EZY A;  3OTQ A;  4ED1 A;  3G6V A;  1J2N A;  4DQI A;  2E1E A;  2NRT A;  5AKZ A;  2WF5 A;  4OO1 J;  1WWU A;  2FPL A;  2IA6 A;  4I2A A;  1KSP A;  3PO4 A;  1QQ5 A;  3AMZ A;  5KG3 A;  9ICB A;  4M0A A;  1JRO A;  8ICY A;  4IR1 A;  4IL6 U;  2H3I A;  3HX0 A;  2ODG A;  4DO9 A;  1ZQY A;  4F5N A;  3RBE A;  2YTU A;  4DEZ A;  5AKK A;  5KFN A;  5KFM A;  1S0N A;  2KIV A;  4QZF A;  2E8N A;  5CHG A;  4J9P A;  5JTI A;  2KJ5 A;  2CXY A;  5KFV A;  3T5L A;  5KT7 A;  4KLS A;  5BPC A;  2H5X A;  5KFW A;  3ZDA A;  4KLD A;  2EQY A;  2I9G A;  4XQ8 A;  3V6H A;  7ICJ A;  2CN1 A;  5AKL A;  2PFO A;  1XSL A;  5CJ7 A;  1K1S A;  3TAN A;  2W3R A;  4OJ5 A;  1NKC A;  1MA7 A;  2BCU A;  2PMZ C;  1ZQS A;  3PVX A;  5KFT A;  2KE7 A;  3ZDB A;  2NO4 A;  2R8J A;  4C7Y A;  4FBT A;  2LYA A;  3PW2 A;  3L3F X;  4B9L A;  3NS1 A;  9ICH A;  4PGQ A;  4F71 A;  4TUQ A;  2ALZ A;  4KX3 A;  3G6X A;  3G6Y A;  4M04 A;  3PW0 A;  1SKW A;  9ICO A;  3FC4 A;  3D2Q A;  3EZ5 A;  4RUC A;  1IXR A;  1BPX A;  2RLT A;  4JB3 A;  8ICA A;  4OJL A;  1T94 A;  9ICU A;  3WK4 A;  2W9M A;  4NWI A;  1NKB A;  3PW4 A;  1F44 A;  1KTQ A;  3C21 A;  1L5U A;  1V9P A;  4NM1 A;  1Q8K A;  3C23 A;  3ISC A;  3EYZ A;  4I2C A;  3BQ1 A;  1X9W A;  1IV8 A;  4DS4 A;  1SKS A;  3WKA A;  4NLK A;  5DLG A;  2HHT A;  3MFI A;  7ICK A;  1UA1 A;  4U6P A;  1T4G A;  4C4R A;  1ED1 A;  1RDF A;  4RNO A;  3PV8 A;  3TFS A;  1QH9 A;  5ALW A;  1O03 A;  3F5A A;  3C2L A;  2C28 A;  4B9U A;  1ZQE A;  5ALH A;  1H38 A;  4EBE A;  4DFM A;  4UQG A;  5D4B A;  2KZM A;  4GXK A;  4KLE A;  5AM5 A;  2PXI A;  3M6Z A;  4BJQ A;  2ZXH A;  3ED5 A;  5AKG A;  3KBB A;  1N48 A;  2FMS A;  2Q0Z X;  4E0D A;  4F5P A;  4Q43 A;  3SYZ A;  2BZF A;  4K4I A;  2NRX A;  3NRW A;  2ES6 A;  2BR0 A;  4AP9 A;  3Q8R B;  1UA0 A;  1NZB A;  1KW4 A;  1SV0 C;  3FM9 A;  3OPX A;  4RPY A;  2MA1 A;  2XY5 A;  1ZQO A;  1SB3 C;  4C4S A;  5ALS A;  7ICR A;  4RQ2 A; 
#chains in the Genus database with same CATH homology
 2LM4 A;  1X6J A;  2JR5 A;  1X6I A;  1PUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...