1U45A

8oxoguanine at the pre-insertion site of the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u45A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u45A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u45A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u45A01
2PI5A 1C7YA 9ICPA 1U47A 5HMLA 4CFBA 1S1WA 4OKEA 4KREA 3PY8A 2ZTEA 1U49A 2BE2A 2FBTA 2VG6A 7ICNA 1SL1A 2HHVA 4K8ZA 5DBBA 3U3YA 4F8RA 4KLTA 5IILA 1S1UA 5I42A 4FJLA 4EBEA 3O4QA 2NRXA 3V9SA 4RG8A 1RT3A 4KLFA 4BWMA 3RTVA 4F3OA 3C2MA 1BI4A 3UQ2A 1BISA 2R8KA 2BGWA 1S0OA 3F73A 5J0OA 2HNYA 3RRGA 3OS1A 2W8LA 4FZYA 1ZQMA 3C1YA 2BQUA 1S6PA 1CLQA 2HHXA 4DS5A 4I2CA 2YNIA 3B6PA 4Z4GA 4O3PA 3RR8A 4BE0A 1ITGA 2FPKA 4ED2A 3OYKA 1UAXA 1T03A 1WN7A 2KFNA 1U45A 2KZZA 4GVMA 5J2JA 4YD1A 1MU2A 3SZ2A 1BQNA 1X1PA 3PW0A 2PFQA 3RAQA 5C5JA 3LP0A 4LD0A 3PX0A 1RDAA 4AILC 4DL4A 5CYMA 4RPZA 4NLZA 3B6OA 5KG5A 8ICFA 3K5MA 1VSJA 4MFCA 4CECA 4K4HA 2UVUA 4M3UA 2JEGA 4ZTJA 4E7KA 4FK4A 3WNFA 8ICMA 4FJIA 4F92B 8ICWA 4FM2A 3O3GA 2KZ3A 4KLMA 3VQ7A 3HPGA 2W9CB 4RQ1A 2AGQA 3ASMA 5CWRA 4FO6A 4CEQA 5D3GA 7ICIA 3KTQA 2NRZA 1ZETA 4FLYA 1T05A 1VSKA 1UT8A 4F5RA 5KG1A 1CUKA 1RYRA 4F4ZA 4MF8A 3SQ2A 1GOAA 5IIJA 5TZVA 1SV5A 1I3AA 4MEYA 2GWSA 4CJPA 3QETA 4JS5A 4W5TA 3QZ8A 3K75D 1RT5A 9ICEA 4B9VA 3BQTA 3LWMA 1JLCA 3UXOA 4EZ9A 1IM4A 2BR0A 1EETA 4BDZA 4Z4HA 8ICRA 4DQPA 2DFHA 4F2RA 1ZQYA 3MGHA 4Z6DA 3OHBA 2ZJ8A 4TUQA 2B6AA 4UB3A 2DFFA 4TUSA 3MR2A 3RRHA 1T3NA 3RJIA 4RQ7A 3DYAA 1ZBLA 3QNOA 3QIPA 4PGQA 3CM6A 2G8HA 3LANA 2FMSA 3ZSXA 4BGDA 4ED3A 2F96A 3S9HA 5DQGA 4CERA 3HL8A 2OZMA 3P5JA 1SZPA 4DMNA 1HRHA 2VG7A 4K8XA 4HTUA 1J9AA 4YCXA 8ICLA 4NCAA 5FRMA 1SKRA 2AQ4A 4QWDA 3MR6A 9ICUA 5J2AA 4UB2A 4XIUA 4DL6A 2DTUA 1LAVA 4I2AA 3N97B 3Q8LA 4K4IA 1TAQA 2VANA 5DBAA 1HYVA 5FROA 1G15A 5BOMA 4QOZB 2HNZA 3AO2A 3RBDA 3F9KA 4FM0A 1H38A 2DFEA 4FLVA 3OYMA 2W9CA 1WCNA 4FZZA 2XRIA 1KFDA 1TKTA 3FDSA 4BXOA 4CFDA 2QK9A 1RDDA 2VA2A 4OGEA 3ZD8A 4R65A 1U04A 1WCLA 1CZ9A 3ZSYA 4CJQA 3M8QA 3L2VA 4ECSA 1VSEA 5CHGA 1EXNA 1RDBA 4UBBA 3IS9A 1RBVA 3GIJA 4M2YA 1ZBIA 1HJRA 3VQBA 2LYHA 5KTQA 2PFNA 7ICUA 3QEBZ 5CJ7A 3O4NA 4M6WB 4UQGA 4LH5A 4CK3A 1IO2A 5HP4A 1ASWA 3DLBA 5J2KA 4M0AA 3E2EA 3C95A 4KAZA 4IQVA 4DO9A 2PYJA 1WAFA 4GC6A 2I9GA 8ICPA 3RJHA 4JWMA 2ZQBA 3VA3A 1FKPA 4KHUA 1ZQIA 4ED1A 4DL3A 1S9GA 4QZIA 4FLTA 3TAEA 2NRTA 5J2BA 3NGZA 1BPZA 3ZSOA 4DOAA 2XGPA 2NUBA 3QO9A 4PGYA 3OS2A 1LAWA 4XQ8A 1RT2A 2IMWP 3LPUA 3KHGA 4KV8A 5KT5A 2FBVA 3L3UA 3PW5A 1NOZA 5F9LA 4CHYA 2RF2A 1NOYA 4I28A 8ICQA 2IHMA 2C2DA 1DOQA 3PV8A 4K4GA 1Y97A 1ZQJA 3RMBA 3RAXA 5T7BA 2OZSA 3HVTA 2OPPA 4QWBA 3OY9A 5KFRA 3OYAA 3FYHA 4QWAA 2XCPA 3OYFA 4F5NA 2VWKA 4M9HA 3ZDCA 4DSKA 9ICOA 1DGSA 2PXIA 4IFYA 3QEAZ 1TL3A 5SZTA 2JEFA 4CGHA 3VQAA 1RXVA 4J9SA 5L9XA 4I27A 5KT4A 3TAFA 3KLFA 1GOCA 4N76A 2R8GA 2XGQA 2ZE2A 4KHSA 2Y1IA 2UVRA 5HMMA 1QQCA 4DFMA 2R8JA 1RNHA 4E1MA 1LW0A 1IG9A 1RT7A 5KFFA 8ICBA 3DOLA 1HYSA 5J1EA 4KTZA 1YT3A 5KFPA 1HJPA 1S1VA 4F4YA 3B0XA 4KITB 4M6WA 2ZD1A 3SV3A 4RT2A 4J2AA 2YHBA 4ED0A 1ZQBA 4R64A 1C1BA 4E89A 2R8HA 4DEZA 8ICJA 1VK0A 4CFCA 4CF8A 2G8WA 4KI4A 3SPYA 1N5YA 4IRDA 4Q0BA 2X78A 3MXJA 5HRPA 4NLGA 4YFKA 1UT5A 4ECQA 4ED7A 5HROA 4O44A 3L8BA 3GIIA 4ECUA 5KFNA 4CJ4A 4MFFA 4RQ2A 4M3XA 4OVLA 3HJFA 3V9ZA 3AVAA 3A2FA 5DG9A 1SL2A 4I2JA 7ICOA 5CYQA 9ICXA 4DU1A 3VA0A 3MECA 3NAEA 4YD2A 1XWLA 4DTPA 4J9RA 4CHNA 1NJXA 1I39A 4B8AB 3RWUA 4IFVA 9ICWA 2YV0X 2HHQA 2ASLA 4KMUA 4O55A 4CHOA 4ZHRA 3KD1E 2AQ0A 5DDMA 4P4OA 2VWJA 5KG2A 1HUZA 2UVVA 8ICUA 4PA1A 4CHPA 1MQ2A 4CGDA 4RU9A 3QEXA 4CF9A 4OLBA 4W5QA 1RTDA 8ICZA 1BCOA 3QEIA 4PHPA 3ZSRA 1VRTA 4IG3A 4E7LA 4FS2A 2I5JA 5D49A 3HT3A 1D8YA 4KLEA 1QSLA 4FJ7A 2XHBA 4NY8A 1N6QA 4CJSA 3ZCMA 3ULDA 4KHNA 4I2IA 1J5OA 4P4PA 3TFSA 3H8WA 2OA8A 4DQRA 3SCXA 1BPEA 3KK2A 2RN2A 1S0MA 4C8NA 4M3ZA 4KN7A 2G8UA 4RNMA 4M42A 4H8KA 3O3FA 2IS3A 3PR5B 1NJZA 4IR9A 4KTWA 1LB2B 3TAGA 4KB0A 1GOBA 4O5CA 5C24A 4P2HA 3IG1A 3NGDA 1C0MA 3LAMA 3EW9A 3IRXA 5J2HA 3RH4A 1S10A 2BCRA 2ITGA 4Z4CA 1A5VA 3V6JA 3V1QA 3AVLA 4NXZA 2P66A 3AVCA 3NFAA 7ICEA 4DTXA 4KN4A 5KFHA 2MUTB 4DLGA 1CXQA 4CJLA 2Z1HA 2E4LA 4Q8FA 2EHGA 4AHRA 3U3GA 4FZXC 9ICMA 4MF2A 1ZBUA 1VSMA 1ZQZA 4QZAA 1JX4A 1WLJA 2Q0ZX 4R8UA 3B0YA 1ZQXA 1DTTA 4OJRA 3JPPA 1B92A 1BVSA 3H4BA 3NCIA 4YVZA 3VQDA 3LZJA 3QEVA 3Q8PB 5KFLA 2BPGA 4RQ5A 3SUQA 2WOMA 1O1WA 2W9MA 5KFTA 4YNQA 4CK1A 4B9NA 8ICAA 1JLFA 3NGIA 1RBTA 4CEAA 2F8SA 4FS1A 7ICFA 1U48A 4LH4A 1ZQPA 2E6LA 1BIZA 4W5OA 1RT6A 3M9NB 4I2BA 1C1CA 3MR5A 4EP4A 4RW7A 1FKOA 3MEGA 2HHUA 1KEJA 1EKEA 3UPQA 4DS4A 8ICKA 1Z00B 3RB0A 3T19A 9ICQA 1Y88A 4BDPA 2O4IA 3MBYA 1MC8A 5DG8A 1WSIA 4CEDA 3ZT1A 4ZTFA 2FMPA 5CP2A 2DPJA 5J2GA 2FMQA 5I3UA 5KG6A 4OPKA 4GXJA 1S77D 4J2BA 2HVIA 2KFZA 3GFKB 3IHQB 1KVAA 3QERA 4DTSA 4CIGA 4B9UA 3K5LA 3KK3A 4DL2A 4CJUA 1WSFA 1NK4A 4DG1A 4J9KA 3UQ0A 5DGAA 3SI6A 2Y1JA 8ICOA 3LP3A 1TV9A 3IM1A 1JLEA 2GV9A 4YR2A 1XHZA 4WE1A 2R7YA 4Q43A 2J6SA 2MUTA 2ZTCA 5HP1A 1CXUA 2X6SA 3THVA 1LWFA 2JEIA 5CA7A 4ECYA 4IQUA 2HVHA 3EZ5A 4NCGA 4JV0A 2HB5A 4M3RA 3EPIA 1HQEA 1ZBHA 2C22A 5KG4A 4CESA 4RQ6A 3PX4A 4TQRA 2P6UA 4OKKA 2XY6A 3KKSA 1C6VA 4BXOB 4RW9A 3LWLA 3GIMA 4EYHB 5KRSA 1RBRA 1C0TA 4KKOA 4CF1A 2J6UA 3T5JA 1BCMA 8ICSA 4IR1A 3OHAA 2A1SA 3SNNA 3AVJA 3RR7A 1JKHA 4Q5VA 4O3QA 2XY5A 2ZUDA 3KJVA 4J9LA 4KLSA 4RZRA 3V6KA 5J0YA 2DPIA 4QW9A 3OYEA 5IIIA 1HQUA 3C94A 3N4MB 3RB4A 1CEZA 1RILA 2G8VA 3TAMA 2RDJA 3MABA 4MEXA 5KFEA 3CFOA 4F4WA 1JL2A 4QZFA 4YP3A 1X9MA 1Z00A 4ID1A 4O5EA 1ZQNA 5J2IA 4B9SA 1NKBA 5CR0A 1RBSA 3GV5B 4GLXA 3WNHA 3S3OA 1KFSA 3Q8SB 3T5HA 1KLNA 2ZUCA 3DI6A 1WSEA 4F2SA 3CG7A 5CY4A 3AV9A 2FPMA 1XS9D 1QHTA 2PFOA 4CEFA 4B8CA 4DTOA 4GC7A 3JPRA 4AHSA 2JLEA 3CQ8A 5J0QA 5FRNA 3TAQA 3HPHA 2ALZA 4MFBA 3AA5X 3ZT3A 3MEDA 2AJQA 2Z1IA 3UXPA 1KVBA 4KHYA 4FJGA 1NK6A 1HNIA 4XUSA 2BCUA 3TWHA 2BANA 3M9MB 3ZDBA 3ZT2A 2E6MA 2P5GA 2HHTA 1UA0A 4J9PA 8ICVA 1LV5A 1HPZA 4N41A 3OYHA 3QNNA 4UB1A 5IIMA 3MXIA 3V1RA 4DTJA 4KHWA 1BHLA 2O4GA 9ICGA 5CZ1A 2C2RA 9ICSA 4EBCA 4ECZA 3TANA 1IKYA 3S3MA 1XSPA 3VQEA 4Q44A 1RZTA 5KFAA 1U4BA 1A5WA 4QZ8A 2ISOA 3MR3A 4FK0A 4N47A 8ICNA 3HW8A 3ZDEA 1A76A 4RW4A 4O3OA 3MDCA 2PZSA 4KLLA 1TKZA 3VN5A 2F8TA 5L1JA 4DFKA 3UXNA 4J9MA 1TVRA 4AH9A 5J0SA 3M9OB 2V4RA 2W9BB 3V9XA 3K5OA 1VSLA 4W5RA 2AGOA 3LDAA 2B4JA 4GXIA 3DRPA 2D5RA 1SKSA 4DU3A 2OYQA 4N56A 1X2IA 5E41A 1TGOA 4F4KA 5C42A 1JXBA 9ICVA 2IAJA 3SUPA 1BIUA 1R0AA 3AUOA 5J2EA 4Y1CA 3ZDAA 4ECTA 3CFRA 3NH2A 4HHTA 4FLWA 3V7LA 1S1XA 2PYLA 1JL1A 3ISDA 2NRWA 3ETLA 3VQ8A 4CE9A 3E01A 1KVCA 1NK7A 4HUEA 5EWEA 5J2CA 4F5OA 4G1QA 3OYGA 4F91B 3PR4A 1J53A 4J2EA 4RW8A 3T5KA 5J0XA 4LY7A 3ZT4A 3RH5A 5J0UA 1KFTA 5KT3A 5HLFA 4M3WA 1RDCA 4UAZA 5IINA 1XHXA 5DK5A 4Z4FA 3C6UA 4EZ6A 3K59A 2XY8A 4O0JA 2OWOA 5DGBA 4O0IA 4JV2A 3BQ2A 4EEYA 3SQ1A 4DFPA 2B5JA 4BDYA 2RPIA 3HO1A 4YMMA 4DOCA 3KHRA 3RB6A 1S1TA 3JPOA 2W8KA 1WSGA 2W9AA 1KTQA 3GIKA 4CIEA 4X5VA 3V9UA 4OPJA 2FBXA 3ISNC 3V7KA 1C0UA 2I1QA 4QWEA 4QZHA 3ZD9A 1L3VA 2QKKA 3V4IA 1TKXA 3BJYA 4DTNA 4Q45A 4CFAA 5J2FA 3VQQA 4DL5A 4UB5A 3RJJA 1ZJNA 4DF8A 2W9BA 4P4MA 4E0DA 4AHTA 5HRRA 3HPOA 4J2DA 9ICAA 4J9QA 4DOBA 3SUOA 2EX3A 3C2LA 4KHQA 1QE1A 1K1QA 1UOCA 1K1SA 5J2PA 3SJJA 3RJEA 2XCAA 2IOCA 1BGXT 1ZBFA 3DLRA 1T4GA 1JLQA 5EWFA 3JYTA 1LWEA 4QCLA 4OGCA 3OGUA 4KLGA 3HVRA 4Z4EA 4QW8A 5L1KA 3NF9A 4F93B 3V72A 1KDHA 2KZMA 1ZQKA 1RYSA 4F5PA 4M47A 4CJ3A 3SPZA 3HYFA 5BOLA 1X9SA 8ICCA 2BCSA 3KLIA 4ECXA 4R8UB 4TURA 2IC3A 4KLIA 8ICHA 5KFXA 3VQ9A 2FLNA 4NM1A 3RJKA 3C21A 1D9FA 4ECWA 2P51A 4QZEA 5K14A 3VQ4A 3AA3A 4FW2A 5J0WA 7ICSA 4I29A 1ZQSA 3S3NA 2ZJ5A 3OYCA 3V1OA 3KLHA 3CFPA 3OSNA 1L5UA 1ASVA 4KTQA 2XY7A 4DQSA 4ED6A 4ECVA 7ICJA 3PNCA 3AVGA 2ATLA 4DF4A 4FLUA 3KLEA 1TVAA 3ISBA 1NK9A 2OPSA 5J29A 4CEOA 2FLLA 4KPYA 2ZUBA 5KFGA 4UAWA 4YXMA 5KGXA 4JK1A 4RUAA 7ICVA 3QESA 3I8DA 1S97A 2A1RA 2F1JA 4M9NA 5HHIA 1LW2A 4O3RA 5KFWA 3Q8RB 2V9WA 3QZ7A 1IXRA 4E7HA 2NRVA 3ZSVA 4N5SA 1EXQA 3Q8QB 3NHGA 9ICJA 2KTQA 4CJ5A 2IA6A 2ETJA 4I7FA 4OLAA 7ICTA 1QSYA 3G6VA 2F1HA 1TV6A 4KI6A 2IGIA 2YNHA 4ELTA 1U9LA 2BHNA 4DQIA 2DFLA 1TK5A 2FLPA 4I2EA 2LSNA 3RJFA 2YKNA 2F1IA 3LAKA 3LP2A 2B21A 4FJXA 3OSPA 1IKVA 3EWAA 4AHUA 4DQQA 2YKMA 4I9QA 3H4DA 1JXLA 3DLHA 1RTIA 2P1JA 1AROP 3CYMA 1NK5A 4R5PA 3GILA 4JRPA 2A1JB 1J54A 1RTHA 2JZBA 2VA8A 1PZNA 3JPQA 2HW3A 4CHQA 2QKBA 3NF8A 3NBPA 4M04A 1S9FA 4B3OA 2BQ3A 4BE1A 4I2QA 3RH6A 2VA3A 3ZT0A 3T3FA 2FPLA 4QWCA 1KCFA 2WTFA 3IAYA 1IH7A 4H4OA 4TQSA 4F5QA 2ISPA 3HX0A 3PO5A 5J2DA 3FFIA 4E7JA 4E3SA 4L8RB 1ZQLA 1T8EA 4RQ4A 2GUIA 3G0ZA 4PY5A 3OYIA 5KG7A 2BDPA 3MGIA 5KFBA 3GV7B 2RKIA 2HHSA 5L1LA 4QZCA 4HCCA 2P5OA 1B9DA 1XSLA 3H8JA 4IDKA 3NH1A 4FJ5A 4RNOA 3G6YA 1D9DA 3EY1A 4EBDA 2ASJA 2YNGA 5KI6A 5KT2A 3C5FA 3AO3A 4RPXA 4M41A 3AVHA 1QLNA 3SI8A 4Z6EA 3JPSA 1QTMA 3NF7A 2HNDA 4IRCA 1ZQEA 3RMCA 4F3TA 1UWBA 1UA1A 3LP1A 5KFZA 4ZH4A 3HK2A 4O5KA 1L3UA 4E7IA 4M45A 3Q8MA 5KFSA 4DLEA 3U6FA 3TQ1A 3VQ6A 4JV1A 1W9HA 3MDAA 3D0PA 5DB9A 3T1AA 3MFIA 4ED8A 5CZ2A 3QIOA 4CGFA 1RTJA 1JXEA 4DFJA 4EYIB 7ICRA 1ZQAA 4TSXA 4KLHA 1NK0A 5JUMA 3AO5A 1NOMA 3WNGA 3ZSWA 9ICKA 4LSLA 4Z0UA 1Q9XA 4CJWA 4C8LA 4YR3A 4ELVA 1BQMA 4DU4A 2A1JA 1BPDA 4FVMA 5DMRA 4CF0A 1JMSA 1ZQRA 2IDOA 1DLOA 3OYBA 3VQPA 4B08A 4NLNA 3PX6A 2H5XA 1X9WA 5DQIA 4JWNA 4CEZA 3QEPA 2PFPA 3UIQA 3DLGA 1IKWA 4KO0A 5J2QA 1XI1A 4CJTA 1T7PA 3TABA 4AHVA 3KHLA 1D8LA 3KHHA 3PW2A 5KRTA 4IKFA 2BCVA 4O9MA 4FLZA 3EYZA 3NDKA 1ZQGA 5DQHA 2P6RA 2KW4A 1C1AA 1SL0A 4ECRA 1L3SA 1RT4A 4OKJA 4CGIA 1YTUA 4M3YA 5HRSA 2G8IA 3H08A 4B9TA 5C25A 4FJ9A 4ELUA 4CEBA 9ICLA 1JN3A 3L2RA 1REVA 1RT1A 3BQ1A 4O5BA 4JLHA 3BQ0A 1L3TA 3C2KA 5SWMA 5D46A 3L2UA 3K57A 3LDSA 4IG0A 4FJJA 4LSNA 5IIOA 1WNSA 3ALYA 4C8MA 9ICBA 3L2WA 7ICGA 5DKWA 4QZBA 3NTUA 3Q8KA 1IKXA 9ICTA 5L1IA 4B9LA 4PPXA 3OVNA 4M9JA 3KK1A 4RQ0A 2BQRA 1ZQFA 4BACA 2G8KA 4NCBA 4YXJA 1SUQA 4HUGA 3KIOA 4FJKA 2JGUA 5KT7A 1V9PA 3V81A 1VSHA 5KFJA 3AU2A 4NLKA 4IRKA 2AGPA 2X74A 3AA4A 1RXWA 1VSFA 3AVNA 4FK2A 4UAYA 3PVXA 4UB4A 4LVSA 1COOA 4O3NA 8ICGA 7ICKA 1ASUA 4DSFA 1XC9A 5DB6A 4KLQA 1S76D 4YN4A 4F4XA 1ZQHA 4I2PA 4O3SA 4IQWA 7ICPA 4Z6CA 2JEJA 1S6QA 8ICYA 3KLGA 1TK8A 5KFDA 3PUFA 1CZBA 3DOKA 4FYDA 3AVFA 4XA5A 9ICHA 4JRQA 2BGGA 1TK0A 4B9MA 5HBMA 2ZTDA 4CF2A 3C23A 4FJ8A 2Z1GA 2PI4A 7ICLA 2M9NA 5DB8A 1TFRA 5KFVA 4QAGA 7ICQA 3OYDA 7ICHA 1S0VA 3ZDDA 1JLGA 4E1NA 3HSTB 4M9GA 4DTMA 9ICNA 5F9NA 3HXMA 3AVMA 4QZDA 1TAUA 3ISCA 1YTAA 8ICXA 4JS4A 4PGXA 4FLXA 5HRNA 8ICIA 2BKEA 4I2DA 4CEEA 1JIHA 5KFCA 2R8IA 2OPQA 3CM5A 3QINA 3VQ5A 1NJYA 4Z4IA 5D4BA 5CB1A 1FK9A 3DRSA 4O4GA 4LZGA 4NYFA 3OYNA 4PHDA 1B9FA 2IHNA 1WAJA 2FBYA 5KFOA 3P83D 4CJEA 2YNFA 1Q8IA 5DG7A 5KFQA 4I2GA 4PHEA 5JS1A 2C28A 4GW6A 2V4QA 3H7IA 4W5NA 4FW1A 3D45A 4FJHA 4NYNA 3PMNA 3MFHA 1ZQDA 1HNVA 4QZ9A 4KLOA 3VQCA 4CJFA 4FBTA 3M8RA 1B22A 3PMLA 2DY4A 3K2PA 3SQ0A 2ATQA 5DB7A 4HUFA 4C8OA 1MQ3A 3G6XA 3LZIA 1ZYQA 4FJMA 1JLBA 1BPYA 4UBCA 4M3TA 1VSDA 3NE6A 5KG0A 1RBUA 1Z25A 4RQ3A 3H40A 2Q3SA 3C6TA 5EWGA 5J2NA 2BPCA 5DLGA 1D5AA 2IBKA 3O3HA 3GQCA 3HWTA 2OPRA 4PQUA 4DSIA 1K6YA 3KKRA 3OYJA 4R66A 4FCYA 1ZJMA 1N56A 5HHHA 4HYKA 3T5LA 4DSLA 4RT3A 1JLAA 1ZQCA 1KLMA 3OJSA 2YHAA 2PY5A 1TKDA 2D0AA 2J6TA 4AHCA 4NM2A 2X6NA 7ICMA 1FXXA 4XRHA 4RQ8A 3MXMA 5BPCA 5KGWA 3QEWA 4IBNA 3BDPA 4DTRA 1F21A 9ICRA 4CGJA 5FDLA 3SYZA 4DSEA 3PW7A 2BCQA 3C5GA 3RMAA 5KFMA 3GV8B 8ICEA 4BWJA 9ICCA 1QS4A 1TL1A 4IQTA 1NJWA 4ICLA 4KFBA 3HP9A 3RJGA 2HMIA 9ICIA 4M9LA 5EU7A 3PO4A 4Z6FA 3LPTA 3C1ZA 2GBZA 4ID5A 2Z1JA 3AO1A 3NGYA 2ZJAA 3DMJA 1BPBA 3H8SA 2W42A 2BPFA 3LALA 5J0TA 3SUNA 2JZBB 3KD5E 4J9OA 9ICFA 4KLJA 4H4MA 2KQ2A 4DTUA 1DTQA 4PH5A 5DBCA 3AU6A 3I0RA 1Z3EB 5KFKA 1S0NA 5EOZA 1VSIA 4PUOA 3K4GA 1XU4A 4JUZA 1ZQTA 4RPYA 3V9WA 5DDYA 1YVUA 4CJKA 3AA2A 4F50A 3ORYA 4DL7A 1EP4A 3OYLA 5KT6A 3V6HA 4KLDA 3DM2A 1NKCA 1HUOA 3NF6A 5J0PA 4PWDA 2ASDA 3TARA 3MAQA 4DWIA 2UVWA 4E19A 2XC9A 1ZQOA 3SV4A 4FXDA 1N48A 3ZSQA 3RMDA 3RB3A 1VRUA 4I9LA 3JPTA 2RDIA 3G10A 1Q9YA 4PHAA 3PW4A 1SKWA 4QZGA 1S5JA 3NH0A 4DSJA 4G3IA 3DLKA 1A77A 1WSJA 3L2QA 5IIKA 4CGGA 4I2FA 3SQ4A 5KFUA 3RBEA 2QXFA 1XO1A 2XO7A 1BPXA 4CIFA 3K58A 4FM1A 2KN7A 3WNEA 2D0CA 3HP6A 4KB1A 4RNNA 1XSNA 1WSHA 1Z26A 5KFYA 4CK2A 2AU0A 1MSWD 3L3VA 3TR8A 5HNKA 1KSPA 4BE2A 4GMJB 1ZQUA 2WONA 3TI0A 4TUPA 1BI4B 4YMNA 3K5NA 3OS0A 1ZQQA 1S9EA 3AVKA 4Y1DA 4Q8EA 3BGRA 4YR0A 4I2HA 4RUCA 5KFIA 4KLUA 4YG2A 1NK8A 4GXKA 3AVIA 3DLEA 5J2MA 4YMOA 2D0BA 4EP5A 3LK9A 4FJNA 4CJRA 3TFRA 4LZDA 1B43A 4RW6A 4MFAA 3OJUA 2G8FA 3MEEA 8ICTA 5J0RA 4YQWA 3V6DA 3HM9A 5KG3A 1RCHA 3M8PA 1NKEA 4MQ3A 1W0HA 3QLHA 5DLFA 4R63A 5JS2A 1ZQWA 2C2EA 2VG5A 1LWCA 3ZSZA 3ITHA 4CJVA 1QSSA 3M8SA 4C8KA 1RPLA 1HYZA 3V7JA 1A5XA 3AO4A 3GDXA 4J9NA 4HVJA 1BL3A 3JPNA 4CCHA 3JSMA 3QE9Y 3P1GA 3I0SA 4FBUA 4HCBA 1KRPA 4YFUA 4CHZA 3TAPA 2FC0A 2MAXA 1EX4A 4KRFA 2HHWA 1HMVA 3DRRA 3EPGA 1ZQVA 3AVBA
chains in the Genus database with same CATH superfamily
3CJAA 1UWAA 3VHQA 2ZJPQ 5HMLA 3SR6A 4CFBA 1U2CA 4OKEA 2QLTA 1Y3JA 1ZS6A 1WF2A 3B8HA 3A5NC 4LSZB 3QU9A 3AARA 1SL1A 1EETB 4K8ZA 2EDUA 5C2GA 1EZZB 4F8RA 2Q79A 3LDPA 5IILA 5AQUA 2YMLA 4NL9C 1G4CA 2DNOA 3HSDA 3GSDA 4RPFA 4LRDA 3RTVA 4CDIA 3C2MA 3VENA 3GPAA 2HZAA 1E6VB 3F73A 3OS1A 2ITMA 3LDLA 2J0XA 2NRRA 1ZQMA 1ELOA 2GIRA 4DS5A 3FRYA 1PVQA 1QVFM 2CGLA 3B6PA 1KWMA 2Q0UA 3CJ8A 2Y3YA 4OI1A 1ZPWX 1CJKB 1HWUA 3NNCA 2K1RA 1RWKB 4ED2A 4UAUA 3QWPA 4YD1A 1MU2A 2P6TA 2DO0A 3EVMA 2VG7B 3OVAA 2QEXS 3ICXA 2HBRB 2E1FA 2F9JA 2JWNA 4BJQA 3B78A 4EK2A 3DGPA 3AH6A 1HR0F 4AILC 1TTHB 4OZ2A 4DL4A 4USWA 2XMMA 4BLGA 2R7VA 5CEHA 5A2QO 3H2UB 3PJXA 3D2EB 4M3UA 4ZTJA 4OJ6A 1ECWA 4LFCJ 3CJTA 8ICMA 2ZJQQ 3FSIA 8ICWA 1PSDA 3O3GA 3ZTRA 3PYEA 5HK4A 2AGQA 4CEQA 2A41A 1M1HA 7ICIA 3EZOA 1F1BB 1S49A 1T05A 1VSKA 4UOCA 5KG1A 5SUHA 2A40A 1F3FA 4W4MA 1FDNA 1X4GA 1GOAA 5TZVA 3CE8A 1I3AA 2ZGYA 4YOVA 3FMWA 2MY7A 1WOQA 3QZ8A 2HQFA 2AJ0A 9ICEA 4P10A 2OEJA 3LWMA 3U1MA 3DRSB 4EZ9A 1RHRB 2PBDA 3CDAA 1IM4A 2BR0A 1EETA 3WIUA 1C4CA 2CAJA 1VLBA 3LGMA 5LJ5Y 5T41A 1MA9B 4H0YB 2VQFJ 4TUQA 5DDQC 2DFFA 5ALRA 3MR2A 1E6VA 1RQ0A 1T3NA 4CNZA 1QM9A 3QO9B 2NV3A 5EE1A 1ZOTA 4Y2UA 4Q7AA 1D8BA 3H0MB 3ZSXA 1CJKA 4L6V3 4BGDA 4C0HA 1CQMA 1T9WA 2VKZG 2DNMA 4DMNA 5C2CA 1K73T 2VG7A 1BD6A 3CCTA 4WQ5A 4K8XA 2GQCA 1B99A 5AQVA 4HHHA 4BRMA 1J9AA 3PRDA 4Y2VA 4NCAA 1R31A 4S0MA 2ACYA 3NKYA 1TL7A 1WWUA 2M7SA 1KTVA 4XIUA 4DL6A 1S72N 4I2AA 2G09A 1X4EA 1KR4A 2ZVSA 2CNOB 3TPQA 4DR7K 1M5HA 1J97A 1HYVA 1EIYB 4C7QA 1TL3B 3ED5A 4LUBA 2XRIA 2XZWA 4CFDA 3WXMB 4KGKA 2DUYA 1B4FA 3J7YU 4WZQA 4A59A 2GW8A 4ZITA 1WCLA 1VQON 3ZSYA 1WB9A 4X4RA 1DK2A 4CJQA 3DGVA 2V51B 2QA4S 4ECSA 1VSEA 1PK1B 3ZNUA 1HWLA 4LJXA 3NS7B 3R5AA 3THWB 2ZM6J 3ZLJA 4JEPA 4JP8A 3VAFA 3WBZA 2LYHA 1S1VB 5CJ7A 1N0UA 2F4FA 1HKAA 3UPFA 2AYGA 4KFBB 1B64A 2J76E 5KL1B 2ZOMA 4QS9A 4KAZA 2Z30B 2PYJA 5HROB 1FF2A 2CQ3A 2I9GA 4O44B 3KUHA 8ICPA 2HFVA 2MJUA 1ZQIA 1RAJA 4ED1A 4DL3A 3C3LA 2V8PA 4ILLA 5HSPA 4FLTA 2BMBA 4ILGB 2E1YA 2NXJA 3QO9A 3ETMA 4XPEA 3HZ6A 4LF4K 3ZX2A 4GO5X 1VC5A 1CC8A 2AD9A 1VQMN 4YB5A 3MCOA 4MK9A 4DV0F 3WIVA 2GJ2A 5KT5A 2XYHB 4C3LA 3T6JA 2J9DA 4DR3F 3PW5A 4B1XB 3NGKA 5IC6B 8ICQA 3CWJA 3OTOJ 5CH7B 4OYMA 4IFVB 1JNRB 4OJOA 1MMLA 1SC3B 4U8YA 3O3LA 1GEHA 4JI5K 4PZNA 1S3XA 4C97A 2QZ8A 4QQBA 4QWBA 2POKA 4DV7J 2CPYA 3M05A 4C7ZA 4B9QA 5BPLA 2F8EX 3P39A 3OYFA 4IH5A 1TELA 1SH0A 1RADB 2K89A 2YB1A 3CCMS 1RTDB 5F8IA 1VRTB 3I55N 1TL3A 4CO0A 2DITA 5SZTA 2JEFA 4ZMMA 1HNZJ 2XHWA 4I27A 2B43A 4J7CA 2P9CA 1AUSL 4KHSA 2Y1IA 2UVRA 5HMMA 5CA5A 4W98A 5H9EK 1U2VB 1RNHA 3PIPL 4ATNA 1IG9A 3ZZOA 5KFFA 2DR6A 3P5BP 1M5OC 2WFAA 3UE5A 5KFPA 5C0YA 2KB2A 1X40A 1S1VA 3EICA 1FJGJ 3BSOA 4YOYA 4J2AA 2YHBA 3D9BA 4NLCA 2JH1A 4J9VA 2KH9A 1U8WA 1K8KB 4U7UK 4IRDA 3IG1B 4B6JA 3AOAA 3CD6N 3O6QA 3QSIA 4ECQA 4ED7A 5HROA 3FZMA 4O44A 4JN4A 1QUPA 5KFNA 2PFDA 3MZIA 3CMES 1JJ2R 5U47A 1R7IA 4WFBL 1WUDA 3AVAA 3M8PB 2UXCF 3QLHB 4OYAA 2D0PA 7ICOA 4JI1J 1S79A 3WC2A 4DU1A 2CPDA 3CJ1A 3NMUA 4ZLLA 3UMCA 3CJCA 4YD2A 3M6VA 3CCRN 1IQZA 3LQVA 5E3CA 4B8AB 4NYPA 4IFVA 4AYBF 2WB1C 4KMUA 2QSWA 4ZHRA 5A76A 4BR9A 3D2NA 4P4OA 2UVVA 1T94A 4PA1A 4DUTA 2WOMB 5AQYA 3HI0A 1WDTA 1X3NA 3NRZA 2BBEA 2KLAA 5BPMA 2VFVA 4WK1A 3W1YC 2CXEA 3QFHA 1RTDA 2NUUG 1BCOA 2C2NA 1VRTA 5DS7A 2R7OA 4US8A 3BV8A 2I5JA 3A8EA 5B0GA 1RCOB 3MR7A 2EVZA 2BV3A 1B0VA 2N1RA 2QGFB 4RW7B 1E4GT 4LF6J 2Q0RA 5IC4B 4NY8A 1XMOF 1U2VA 4OMFG 4CJSA 2VPXB 3JB9k 2Z8QA 4I2IA 1J5OA 2CN1A 2Z0GA 3Q8VA 2UU9J 2HWTA 2RN2A 5E79U 1S0MA 1RABB 4WJBA 4C9DA 2G8UA 2R7UA 4LC9B 1Q82O 3FR0A 5CE3A 3IBCB 4DR6K 3MN6A 3PR5B 2V2VA 4DR1K 5JICA 2W2QP 2YY6A 1LB2B 2YWWA 3OFFA 1GOBA 4KB0A 4LMZA 1UKUA 1FERA 1GLAG 3IG1A 3T1HK 2HKEA 2MKYA 2KG5A 3LAMA 3QT5A 2OXOA 1T03B 3OL7A 5ETMA 1S10A 2IVFB 4JAXA 2FDRA 3SFUA 4C0ZA 4NXZA 1P27B 2KN4A 7ICEA 7FD1A 4DLGA 2LM4A 3IM8A 4CNQA 2Z1HA 5ALYA 5CYMB 4Q8FA 2EH9A 2RRNA 1YXQA 3UWTA 3ALRA 1IV8A 3AJ1A 4USUA 4JI3J 2A3JA 3AQFA 5HJXA 3VTHA 4K4VA 2QE5A 2MQOA 4M95A 3VEWA 3CD6S 4I1TA 1BXNA 4L73A 2IM3A 2FC8A 4UTGA 3WQUA 4DB3A 2Q0ZX 1ZBTA 3FZKA 1MN8A 1ZQXA 5D3GB 4H0VB 4OJRA 1B92A 1U6ZA 1BVSA 4I6WA 2PO4A 3NCIA 3VQDA 3W3DA 2J8AA 3KZIU 3JSRA 5DDRC 3Q8PB 1CQNA 2XLKA 2WOMA 4YNQA 4CK1A 8ICAA 3OR1B 1U48A 3TP2A 2R18A 4WK3A 4DCHA 1UCVA 1HL6A 2ILYA 5AQQA 3O0FA 4CLTA 2ZH7A 4BRNA 2AJ2A 4CO3A 4RLEA 3M9NB 2MKSA 3H46O 2GMHA 3MR5A 4RW7A 3N9UC 2HHUA 1A6SA 2Q97A 3UPQA 4A2AA 2BE9B 4USIA 2O4IA 1MC8A 1NI3A 2B6AB 5K4LA 5CRXA 4CEDA 2ZWPA 4C4TA 2IRYA 3RW7A 5J2GA 2FMQA 5KG6A 1N88A 4HTJA 2DGXA 4O3MA 2KFZA 3QIPB 4DU7A 4DTSA 2DKXA 4YHHF 3GTYX 2CGKA 4F71A 1X6JA 3NCQA 4ILMA 3BEXA 3UQ0A 3ZC4A 5DGAA 1YQHA 3SI6A 1WC3A 1Z19A 4ZA1A 3S8SA 1SQFA 1DXSA 3H5YA 2Y1JA 4DJBA 1TV9A 1H2UX 2OSQA 2B56A 4JI0F 3A3NB 1FRIA 2R7YA 1ZAWA 5HANA 4Z37A 4Q43A 4JYAK 3L95X 4X62J 4WTYA 3EXYA 4H0TB 1ZM9A 3QSYB 1RLDA 5JVHL 3BPDA 1HKBA 5D77A 2QXLA 1PYOB 4FWQA 4IQUA 2HVHA 2H3GX 3N4QA 1Q78A 3WK6A 2XBPA 4AL6A 4NXMK 1ZBHA 2C22A 4NLXA 3PX4A 3IDWA 4OKKA 4IO9L 3KKSA 4EMDA 5AI4A 3LWLA 1URRA 5AKLA 1PC5A 2AX1A 4WFXA 3AD8C 2H1YA 3M8QB 3SNNA 4NEYA 2F1FA 4O3QA 2OO4A 1YBTA 3I96A 2PA3A 4RZRA 5J0YA 4K5RA 3Q7CA 2DPIA 3OYEA 4XDCA 2VQEK 3I28A 4FWRA 3RB4A 1LEOA 2YQ0A 1FTRA 2EK6A 2W25A 4MEXA 5KFEA 3P49B 3GYNA 3MM6B 4ID1A 3BR9A 4O5EA 4B9SA 1NKBA 4TLRA 4DR7J 3GV5B 3VQSA 2IMOA 3T1YK 4QPXA 2E1RA 5HI7A 3NAHA 1FWKA 2YY3A 1RAAB 5AQRA 2VBZA 1KLNA 2EFNA 1R0AB 1RAGB 1Y64A 2RVJA 1MN7A 4IEEA 3L0QA 4U67L 2ZUAA 3AD9C 3JPRA 3C15B 5C15A 3ZFVA 3E01B 2MLXA 4P2FA 5AXNA 3AA5X 3ZT3A 1T11A 2FVQA 3ZZUA 3QJLA 4HEA9 1KVBA 2HQGA 3IN5A 3W5YA 3GG1A 4DN9A 4MKVA 3M8ZA 2RE2A 3RBXA 2DHHA 2KXHA 5DRKA 1DGKN 5AM2A 1Z6RA 4DR2K 4UB1A 5IIMA 2PE8A 3GONA 3R3LA 4LF4J 3GG4A 3O8MA 2ZHOA 2R2UA 9ICGA 2C2RA 3TANA 4JI2K 4FYVB 4DHYA 1ZH5A 1TAMA 4GKJF 2WSFC 1Z4OA 1RZTA 1U4BA 1FVSA 1TQLA 1A5WA 2EFPA 1N34K 3BS5B 4FK0A 4N47A 3HW8A 1ED1A 1A76A 1Q5VA 2H5EA 1TKXB 3L4PA 5BXIA 2Y0BB 4JI5J 5AHXA 4IQMA 3UXNA 4J9MA 2W9BB 2KVIA 1N5YB 1F5CA 2KM8B 4Q0BB 2LXFA 3KXDA 1YUWA 1VQ6N 3LDAA 1TL4A 4GXIA 2VONA 2RS8A 3NEKA 3GL1A 1CBKA 3Q22A 3W9IA 1ZA1B 3FCWA 5DO2A 4OO1J 4DV3F 2CPRA 4A8EA 5F1XA 1R0AA 1FO4A 1LKZA 4ZJOA 1M1KO 3F2KA 2ZH3A 4Y1CA 2BKPA 3JYTB 1NH7A 4HHTA 1OPZA 5H9EJ 3TRGA 2JH3A 2PYLA 1JL1A 5AQXA 2HOFA 3ISDA 1W2IA 3C15A 5A8KB 3ETLA 4GIBA 1IG6A 5K5MA 3E01A 1KVCA 1PIEA 3LM9A 1VQKN 1TFYA 4B1YB 5JLHA 4B3RJ 3JTNA 1DFDA 2AA4A 1NPRA 3DEEA 2OD4A 3PR4A 1J53A 2IC3B 4J2EA 3U8XA 2YKPA 4LR8A 4CYUB 5E0OA 5B66U 5BN8A 1RWMB 1UW4A 3OW2R 1R8AA 4AE5A 3M6WA 1RDCA 2O3DA 3UDCA 1Q18A 1XHXA 1OY9A 2W03A 2P8IA 4CZGA 4US9A 3T69A 2ZBIA 2FE9A 2IRUA 1YI2N 4UY85 1JNZB 4O0JA 1GNKA 5BRHA 5DGBA 4O0IA 5AKYA 5ALKA 2PKEA 1BWVA 2OPSB 3SIPB 2RPIA 4XEIA 4BDYA 2KP7A 3BGFA 3KHRA 1IJFB 3RB6A 1S1TA 3JPOA 3ZZPA 3UDEA 1RAEB 2W9AA 5DM6Q 2PGCA 3GIKA 3MAAA 4WU3A 4CO5A 4Y2SA 3ZTOA 2QL9B 4B3SK 4OPJA 4TYBA 2LDYA 4LR7A 3BS5A 1F2GA 2I1QA 4QWEA 2CNNB 3D2FB 1S6OA 1L3VA 3V4IA 1TKXA 4DTNA 4Q45A 4BX9C 3KJFB 4CFAA 4WF9Q 1U6BA 1VQYA 1YJNN 2NZ4A 4NLTA 3CVKA 2ABYA 4G1IA 2W9BA 4OV6A 4QIWD 5CR4A 2DR8A 3M2VB 1SJRA 3UD5A 5HRRA 3HPOA 1GLCG 9ICAA 2DGVA 4A47A 3SUOA 2YKNB 2CWKA 1UOCA 2RNEA 4A4JA 1IBMK 5J2PA 2AEJA 2YKMB 1SV4A 1F5AA 2XCAA 1ZBFA 1P6TA 2J5AA 3JYTA 2UUCK 2G4BA 4OGCA 3U26A 3HVRA 5IQQA 2XWXA 1N60A 1U0SA 5A8KA 4OYZA 1KN6A 3SPZA 2F8LA 3HYFA 2MQQA 1W97L 5AIAA 4XTTA 3G25A 2HCFA 2MKIA 3DCAA 1RWNB 3PYGA 4F36A 4C6AA 4R8UB 4DR6J 2IC3A 4M7XA 2BJ7A 1N36F 3EVOA 4DR1J 4CYUA 5D8HB 2QW9A 3VEVA 1AZSB 5K14A 3OTQA 3T1HJ 2L41A 1SWWA 7ICSA 4IC9A 4LT6A 1VHIA 4RBTA 3FFIB 1ZQSA 1Y5IB 2V8DA 3OSNA 1RBAA 5GAHP 2XY7A 3R8EA 3FVYA 2B0GA 4ECVA 2X1FA 3HKWA 3UCUP 3ISBA 4DZDA 2OPSA 4KPYA 2Y8WA 1VQKS 4FF3A 5KFGA 1C1CB 4RUAA 5BREA 1WC1A 2B51A 3HHLD 4YB1P 2VJUA 1EX8A 4FOIA 2FSJA 4QIFA 3BY5A 4G9ZA 1FFWB 2ADBA 4M9NA 1PYTA 3CCUS 2DQNB 2FJXA 4WFYA 4Y2JA 1ZA2B 5KFWA 3JS9A 5EHHA 2H3FA 2D1CA 3CCSS 2H5IB 3MWBA 2GWKA 4N5SA 2YN4A 2X1GA 2HQIA 1FNOA 2KTQA 1YI2S 1GK8A 4CJ5A 1P90A 4ZP7A 2XMVA 1D9AA 1M5PC 3J81Y 4FWKA 1S57A 2OTJS 2OELA 3M2VA 5BN9A 2XULA 1U9LA 4DQIA 2QWNA 4FF1A 1TK5A 4I2EA 2YKNA 1VIXA 4CZFA 2CJYB 4FJXA 1OYDA 3EWAA 4LBPA 4LSLB 2YKMA 2LCWA 1UZDA 1RTIA 4E1JA 1WJ9A 2QMWA 1IR1A 3CYMA 2DXDA 4JRPA 2R7QA 4HLBA 2GELA 4C23A 4UT4A 2IDLA 2BEFA 3IM9A 1YJNS 3CTRA 3JPQA 1N8RT 4KGVB 5B0BA 1FRLA 2QKBA 3JSYA 2DCUB 2LXIA 3BB5A 2FHKA 1XR5A 4IOCQ 3GZFA 1AB8A 2FPLA 5AQTA 5J2QB 1KCFA 4HDGA 3CDWA 1AZSA 1FNMA 4WFAQ 3VTIA 3F44A 3FFIA 3R97A 2M4MA 2O6KA 1ZQLA 1W2BM 3D2WA 4PY5A 3OYIA 5IOLA 2ALYB 2C3MA 3MGIA 3IGVA 3G8QA 1SC6A 2RH3A 5L1LA 1C0GA 5FPNA 3R6LB 1Q82T 4JYAJ 4USKA 4RR5A 3TAMB 3L5KA 2MQNA 2L5YA 4RNOA 4M5NA 4ANEA 1D9DA 1HWKA 2I38A 3R6MA 3EY1A 4EBDA 2VIXA 3TA2A 4ZDNA 3HKZF 4NXMJ 2R4FA 1JB0C 2RRBA 4X4VA 4KJIA 2MSTA 3TA1A 1RWPB 4IG0B 3SI8A 4TU9A 1QTMA 1RAHB 3M6GA 3NF7A 3BBBA 4C1NI 4M5HA 3HHLB 1HBUB 1IKXB 2JGAA 4BRLA 5A0LA 5EXWA 4X66F 5K9FA 3CJBA 3U6FA 5AJ3K 2UXBF 4NMXA 3D0PA 2BUPA 3PYDA 4CGFA 2R7SA 2DNHA 5IV3A 4F02A 3WKDA 2G5IB 5JUMA 1NNDA 2VQEJ 2CUYA 3WNGA 3W2VA 4LSLA 3ZSWA 4Z0UA 4KGXB 4CJWA 5JMNA 1FO1A 3G2XA 3E3XA 4BC5A 4DU4A 2BANB 4I2PB 1JMSA 1WOOA 2Y9UA 1XMBA 5GAHI 3OYBA 4NLVA 4AQYK 1C4AA 4B08A 5F8NA 1IN0A 3TZZA 3FBEA 3T1YJ 2MKKA 5BRFA 4PYAA 3NMRA 3FC9A 2ES6A 1S6QB 2DKOB 3KLGB 2PFPA 2AMCB 2GOLA 3DLGA 4HI2A 2HI0A 4P72A 3M5RA 5J2QA 1XI1A 1VLOA 2HAFA 4USHA 4K4UA 1IKYB 2W7OA 2BCVA 4H5TA 2RRAA 3ENQA 4BC7A 1PBAA 5DQHA 2V63A 1Q8BA 3M1YA 1C1AA 3MDQA 2IOHA 4ECRA 2RQMA 1RSCA 1ZM4A 3N7RC 2LMIA 4M3YA 4EO8A 2FSKA 2YX7A 3ATVA 4B9TA 2WVDA 3ZEUA 3EUB2 3NRBA 1TL5A 4CEBA 2DR9A 3C0BA 5IT9Y 5LMNF 2Y0SF 4BQZA 3OA9A 4NA2A 1NO8A 1L3TA 4NOHA 2WRMA 5D46A 1BA1A 3K57A 4DR2J 4IG0A 1FK9B 1AFJA 2R7RA 4O4GB 1WNSA 1XEZA 9ICBA 2XYGB 1FJCA 3ULEB 2IAJB 4QZBA 3HHLA 3NTUA 1IKXA 3L9ZA 3D1QA 5AK4A 5J1NA 2F7VA 5HQ8A 2WF5A 2O1PA 2XM3A 4JI2J 1KBRA 3KK1A 2DXEA 2NUHA 2BQRA 5M2UA 4NCBA 1OXJA 1YVNA 2YCHA 4K0KF 1VQ7N 4FXWA 2HBJA 2K7JA 1N34J 2MGZB 2HYIB 1T3OA 3E51A 1VSFA 2UUBK 4IOAQ 4UB4A 3HD2A 5EX3A 4O3NA 3M2UA 3ENVA 1TUUA 2FVCA 4OI0A 4DSFA 1ESVA 3E9LA 1S76D 1HIWA 4YN4A 5B09A 4I2PA 2QSFA 2Z2MA 4C4RA 2YQ3A 1MMDA 1K0TA 4F0KA 1S6QA 1MMNA 3UE2A 3KLGA 1TK8A 2B5JB 3VQTA 5M1NA 4KB7A 1WWHA 1ZC6A 2M3DA 1NSKL 5AQMA 3UQSA 1R0BG 2LLZA 2RHKA 4FYDA 3AVFA 3AAQA 4NLRA 5AK5A 3TQEA 1TK0A 1KBUA 3FK4A 1U09A 1JLAB 2HAIA 3UN3A 3I33A 5DB8A 4CLWA 1KLMB 3G82A 1S0VA 2CWXA 4X4SA 3ZDDA 2E5JA 3A5LC 4NB4A 2AXTU 3NS1A 2VU5A 3VAGA 3L4QA 3CJRA 2O01C 1X0PA 3HXMA 3LGNA 1VFJA 2CQ2A 2KKHA 3TR5A 5HQLA 5HRNA 1EJ7L 3O9RA 1JIHA 2MA1A 4NPOA 5AE2A 5AE1A 2OPQA 3BPSP 3O9UA 3VQ5A 5B7WA 4W92B 1FK9A 2CJAA 1KOOA 2DBBA 4O4GA 3ULEA 4PHDA 3GJQB 1HNWK 3I5CA 2QWQA 4DI6A 3PHTA 3SMPA 3IMQJ 3QDKA 1Q8IA 1TUVA 4B3SJ 1Q81O 1MROA 4I0WA 5JS1A 4WU2A 3H7IA 2V94A 4H4MB 1RUSA 3D45A 2MGZA 3VGMA 2K8BB 4QZ9A 4KLOA 2V2ZA 1RLCL 2MHEA 1RGVA 1XNQF 1I5OB 3GJSB 2D8CA 2ATQA 1FVQA 1S4FA 2H65B 4JD2A 3LZIA 4J37A 2XO6A 5ALJA 3F5EA 2BX6A 4JI4F 3NE6A 5GMEA 1RBUA 1T02A 3OTBA 2MZQA 3BDEA 1IBMJ 1LFWA 1QTNB 2VDIA 2XB2D 4CLKA 5GADU 5DLGA 4B1UB 1PKUA 3GQCA 3HWTA 2UUCJ 1R43A 4DSIA 2WK4A 3B54A 4CH7A 2ASOA 2FF6A 2EANA 4PKGA 4P2XA 1N56A 5HHHA 4RT3A 1JLAA 1LW2B 3SBMA 3CNQP 3MMCA 5B5EU 5LMUF 2H3VA 1KLMA 3QRQA 2JJ4D 4OHXA 3FCHA 5D0EA 5FPMA 5HR6A 3FZLA 1GH8A 4CBUA 3PJ9A 2OJ3A 3VF0B 2W11A 5ETTA 1M1KT 5LJVA 3EX7B 4RJVA 3H90A 3R9KA 2H3IA 4IBNA 4AFFA 2DBYA 5G5GA 3SYZA 1HKGA 1QZ5A 3I9V9 3UVJB 2BCQA 2HF3A 3C5GA 5KFMA 3BGRB 1NJWA 4DCOB 2FVPA 4NLSA 3J7YP 4M9LA 3GMGA 3PO4A 3L3FX 3OVBA 1TFWA 3AO1A 3ZI4A 4U7CA 2ZJAA 3H8SA 3K1ZA 1FJ7A 2CRXA 3M7DA 3PRBA 4M63C 3SUNA 4OHVA 3KD5E 1X5PA 4OV1A 4ZIVA 1WG5A 2GHPA 4H4MA 5K8MA 4PH5A 5DBCA 3A0IX 1MNEA 4HVZA 4B3OB 5AXMA 5AKHA 1VSIA 5KPTA 3FBBA 4DV6F 2QB0B 3W3SA 1ZQTA 3ITHB 5DDYA 4C11B 4X64F 2ZWOA 2VCPA 4H4OB 3KJNB 3M1FA 3AA2A 4F50A 1R0CB 3EGVA 3OYLA 2EWHA 5KT6A 3V6HA 3NF6A 2HPUA 4B1ZA 4A2BA 2RMLA 3PFEA 1HBOA 1VLYA 4E19A 2XC9A 5AQIA 3SV4A 2DYAA 4FXDA 2VGMA 4EEKA 2P9KB 1N48A 1X4CA 1SIJA 3ZSQA 3RB3A 1VOMA 4I9LA 3JPTA 2EK1A 1F2HA 3G10A 5D0HA 4OZJA 2G08A 2HVZA 5GMDA 2A2DA 1S5JA 2HGMA 4JOUA 1S1WB 2D41A 2YNGB 3CCJN 1WC4A 4CGGA 3I5BA 7AT1B 1XO1A 4CIFA 3K58A 3JXUA 4A8YA 2BE2B 2FDNA 6FDRA 1RISA 3HP6A 2HNDB 2M5YA 4B3MF 4KB1A 5JJBA 1Z26A 5KFYA 3RZAA 1OH8A 3KD3A 2XI2A 3L3VA 2LVWA 2YMQA 1RT3B 1BDGA 3BGUA 3FLCO 2HIYA 4BE2A 1IWAA 1ZQUA 4L76A 2WONA 3TI0A 1BI4B 5AI5A 4YMNA 1Z2LA 1KQQA 1WUAA 2HNYB 2IYGA 3T9ZA 2HS4A 4RL1A 1YRUA 4UOHA 3U9DA 4Q8EA 1LNQA 3BGRA 3LPEA 3UDLA 3LK9A 1JCEA 4NLWA 3NMAA 3TFRA 2PMHA 1BQXA 3RG6A 4P2SA 1NPPA 4DR5F 2H3ZA 4X65K 3TUIC 3M6KA 3CHWA 4OX9K 2XMUA 3W8GA 2KHQA 2YWFA 1VRQC 3R9PA 1A7GE 1RCHA 2HS0A 1NKEA 4MQ3A 3VPZA 2CPXA 5DLFA 5JS2A 4AM6A 2QB0A 3F56A 3ITHA 4AM7A 4C11A 1NPKA 1VQNN 4CJVA 3M8SA 1K9MT 1V3SA 4TKTA 3AO4A 5AJ3J 3MM8B 3K9JA 4FYWB 3F5AA 4CCHA 3H0LB 3IR7B 5F8MA 5AKEA 4HCBA 1TYQB 1X31C 2HRYA 4PRFA 2BKOA 4CHZA 2MZSA 4BRPA 1EHWA 3QICA 3G6ES 4QR1A 2CGJA 5AK6A 2HHWA 4LF5J 3HBTA 1SXEA 4NI2B 5ALNA 9ICPA 3I31A 4NRTA 1S1WA 4AQYJ 1UVJA 3Q7BA 3H20A 3PY8A 4ZVGA 1ACMB 2BE2A 4P74A 5IWAF 2PEBA 1G99A 2LBOA 1JLCB 2HHVA 4DV5K 5DBBA 3I1YA 4KLTA 3CO0P 1S1UA 3QFPA 4CO2A 4Y2MA 3O4QA 3V9SA 4RG8A 1RT3A 4PAAA 5LL6d 3AAWB 3KWIA 4TLQA 1L7OA 4UASA 4F3OA 3BKFA 2Z2ZA 1BI4A 1SIZA 1PO6A 3R6GB 4I6YA 2JMGA 2HNYA 1OUQA 3RRGA 4NLBA 3OFEA 2D4WA 5F3ZA 2A10A 3CCJS 2BQUA 1FFSB 4Y2XA 5TKYA 1CLQA 2OSRA 4I2CA 4A5BA 3CD7A 1RE1B 3QJJA 4Z4GA 2DGWA 1JK9B 2Z57B 2VHGA 4BE0A 2KG0A 1UAXA 5M1FA 2VIHA 2WVFA 1VJWA 2YHXA 4JI8K 1X1PA 5AQLA 3PW0A 1NZAA 1CI4A 5C5JA 1PYSB 2XZDB 3D6HB 3Q8UA 3PX0A 1RDAA 1SQGA 2HHPA 4RPZA 5KPZA 5KG5A 3K5MA 1VSJA 3Q86A 4MFCA 1AYEA 3AQPA 3HOSA 3C7NA 1T44A 4K4HA 1IBKF 3O08A 3MM8A 3ELHA 4FK4A 4Y2TA 4FJIA 1CJUB 2HNZB 2VDHA 2NPIA 4DHVA 5CWRA 2UUBJ 2NRZA 2M0NA 3KKAA 1ZETA 1NB7A 1XO0A 4FLYA 4CI6A 1KOHA 4IYQA 1SC1B 5F8HA 1CUKA 1B7YB 2HOQA 3CEDA 4MF8A 4ZPDA 1JCFA 3SQ2A 3PM9A 1RWOB 3CCWA 4MEYA 2GWSA 3QETA 3NWGA 3S01A 3DU5A 4JI7F 4A8FA 1J2VA 3BQTA 4FDFA 3IRUA 1JLCA 3UXOA 1FCAA 4Y00A 5F2RA 3VZHA 2E5HA 3WX8A 2RHFA 1N2XA 3MGVA 4Z4HA 8ICRA 3P5TL 2H51B 4F2RA 5FJ4A 1RXOB 4ZVSB 2IY5B 2ZOGA 3NNHA 1IBLK 4TUSA 2OM6A 2GTDA 3VGUA 4B3TF 1U6FA 3NOCA 2F5GA 5JVHQ 1ZBLA 2R7XA 5EX5A 4PL1A 4HH0A 1RG6A 1VQ9S 2EC0A 2Q43A 1RT2B 1V4SA 2GQQA 3LANA 2GMJA 1X7VA 4IO9Q 2XS2A 4LIRA 2VFSA 5DQGA 2KSOA 1WF1A 1ULRA 3IBFB 3HL8A 1F0XA 2BUNA 3ZYYX 2RF2B 3EE8A 1HEKA 2PD1A 4YDUA 1HRHA 3D6TB 3VAKA 4FWPA 4HTUA 2LECA 5ALMA 1NSQA 3CDEA 2OYYA 4DL0C 4WP3A 2MQMA 4MKAA 1T9YA 5FRMA 2AQ4A 1NHUA 1HNWJ 2IM2A 3MR6A 4K4IA 2HBMA 2HG4A 3M7VA 4IFYB 2M8DB 5BOMA 2V9KA 2HNZA 3AO2A 3OYMA 1KFDA 1TKTA 1URNA 2B3TB 2YH0A 5EN1A 5AKIA 2VA2A 4OHYA 2JH7A 5GTHU 4R65A 2PIIA 4N77A 4P75A 4Q2MA 1U04A 3KFUF 2Z2YB 1BWEA 1CZ9A 4LREA 3I87A 2DL0A 2AF6A 1CC7A 3ADAC 5LL6Z 3L2VA 3T7ZA 1EXNA 3BH7B 3DOLB 1FFGB 4M2YA 3S1TA 1HJRA 2MKJA 5FDLB 5KTQA 2PFNA 3O4NA 2ZD1B 4LH5A 4CK3A 1C1BB 1YZ6A 2JRZA 3MM9B 5HP4A 5FIIA 4ID5B 4IQVA 2P9PB 1NU4A 4GC6A 3VEZA 5LOQA 5AM3A 4JWMA 2ZQBA 2OGUA 3GIRA 5ALLA 1O08A 2VBYA 4OI4A 2P6SA 4NLDA 3DC2A 1PG5B 3OBYA 4J9UE 2QA1A 6AT1B 1R59O 4KGZB 4ZOHC 3AY9A 4PGYA 3F5TA 2PA8D 1LAWA 3I0RB 4F3MA 1O51A 2FJDB 1RT2A 4WTOB 2NO5A 2B0CA 4CO4A 1I94F 4JKAA 3GCXP 2GVZB 1L7MA 3MURP 5LT5A 1VK3A 1FTCA 4OI6A 2KHOA 2RF2A 5AE3A 4DUZK 2LPEA 2B8QA 4C4WA 2N4CA 2JNJA 4J8FA 4OX6A 4K4GA 1KQGB 1ZQJA 2OZSA 4CLLA 2QA4G 4UATA 3PEHA 3OY9A 3KJQB 3WX4A 3BO2A 4KHPJ 2HFZA 4QWAA 2EAPA 5CCMA 2K7KA 4KPCA 2VWKA 3C6HA 4DSKA 3IWXA 2DXFA 4IFYA 3QEAZ 2MQLA 3D3CJ 5AQGA 1T0TV 5E26A 1RQNA 5EX0A 2AJ1A 3VQAA 1RXVA 4MLEA 2W4DA 2DB1A 2EZYA 1GOCA 2XGQA 3FE1A 2I7NA 1LOUA 2HK2A 2E1ZA 2DR7A 2OLWA 5KAKA 1U1MA 1Y10A 5FPEA 1IR2A 3KK2B 1RU2A 3DOLA 4RCHA 3MTKA 5A6PA 2X51A 1HYSA 4TN2A 1YT3A 1HJPA 1QD1A 5A8RA 3OW2M 4KITB 2ZD1A 4RT2A 4ED0A 4R64A 1C1BA 4TU7A 4E89A 2R8HA 8ICJA 1IIPA 2E7VA 1Y3KA 3MM9A 4CF8A 2G8WA 3HHNB 1RHQB 3JTOA 4CBXA 2A18A 2ZJRL 2X78A 3MXJA 5HRPA 4NLGA 2P9PA 4A62A 3IP4B 2AX0A 3PSIA 4PZOA 4ECUA 4WKRA 4NXNK 2AJFE 3GOIA 5AM0A 2KI2A 3BGLA 3QYYA 5IQ6A 2FHMA 1FWLA 4M3XA 4RO0A 3CJQA 2KO1A 4WQ5C 1GTHA 2QWRA 3V6DB 3UMGA 3PIOL 4KX3A 2BRKA 3CCLN 2JWKA 2AH5A 1C2PA 3TEGA 5DG9A 5B0AA 1LWCB 2CQ4A 4CLSA 1NG9A 1VDVA 1RA6A 3VV2B 4DTPA 1XWLA 2QWPA 1I39A 4KH4A 3NL0A 2Z2LA 1DTTB 1HD0A 4CHOA 1SPBP 3KD1E 2ZM6F 4WQ4A 4P0PB 1HUZA 8ICUA 3OV7A 4CHPA 1XERA 3KUEA 1JLFB 4CF9A 2BYCA 2YPYA 2V6AA 4X65J 1OPIA 4W5QA 1XUPO 4CZLA 8ICZA 4OX9J 1HR0J 1LFPA 1YKWA 4E7LA 4FS2A 2JVOA 5D49A 4KIAA 3AN1A 1XK8A 1QSLA 1RB0A 4K4XA 3BP8A 3CC7N 1SB6A 4FJ7A 1G6BA 1U25A 2QYCA 2XHBA 5AKKA 3C29A 3ULDA 3ZCMA 2FYXA 1BE4A 4CW7B 2OA8A 4FP9A 5AQZA 1BO5O 4WYWA 3KK2A 3MCNA 2MZTA 4RNMA 1SQEA 4H8KA 3O3FA 3QGPA 4K4ZA 2NRHA 1YSJA 4DPTA 1S6PB 1XR6A 4A46A 4P2HA 3V4MA 3OTOF 5LXYA 5IT4A 3HULA 3SCLE 4PG5A 1KQFB 4XH5A 1X3MA 4RQNA 5J2HA 3L09A 5BYSA 2IM0A 4ZPTR 3UM9A 1GTEA 2BCRA 2KG1A 4DV7F 1JLEB 1BQNB 3V6JA 3V1QA 3WK5A 3NFAA 4YDXA 4DTXA 4KN4A 2GIFA 1SZ2A 4EHTA 4DV5J 5KFHA 4NWBA 4BHQA 2WB1D 4NJ8A 5ALWA 2EHGA 1G3OA 3U3GA 2WF7A 2LU1A 4FZXC 9ICMA 4MF2A 2IVYA 1VGYA 2DIUA 1S22A 2FQQB 4QZAA 4FFDA 3Q2TC 3G71S 1DTTA 2W3SA 2MJNA 3H4BA 4K5SA 4ZVTB 4WWSA 4UB8U 1FJGF 3QEVA 3GYXB 5KFLA 3DXKB 3FSXA 5KFTA 1NMDA 1IUJA 1RTZA 1JLFA 1I6JA 4CEAA 4FS1A 7ICFA 1Q53A 3TX8A 2BJ8A 1GXTA 4LRCA 4JI8J 5JVGQ 1BIZA 2DGSA 4URGA 3N79A 1KAZA 1YBUA 3BKTA 4EP4A 4M1KA 4CZJA 1KEJA 2F8KA 1J2NA 3T19A 2FF3B 1Y11A 4ILJA 3MBYA 1WI6A 1WSIA 4K25A 4D3HA 2DT9A 1JJCB 4KBIA 4PG8A 4JI1F 1MWYA 4JV5K 2HBKA 3DI6B 3W63A 1RCXB 3KWMA 2V2QA 3G86A 3QERA 3MUMP 3BSAA 3CCVN 3SAFA 4B9UA 1X4AA 1M1GA 1NGHA 4X4NA 1NK4A 4J9KA 2KRBA 3NCRA 3LPYA 4CM0A 4OZLA 5CD4A 1FXDA 8ICOA 4KC5A 4H0OA 4N7TA 1JLEA 2GV9A 4KX5A 4C0OC 5HVGA 2NYHA 3ZZYA 3MEDB 2HHHK 1T95A 2ZTCA 2ZZNA 1NU0A 1FIQA 1V5IB 1CXUA 4FWOA 3THVA 4OPAA 1LK7A 3U9ZA 2QLWA 3A0BU 1WEYA 1LWFA 5CA7A 3EZ5A 1VC6A 4JV0A 1HPZB 4LF6F 4M3RA 3CIPA 3H42A 1RA7A 3F9MA 2XY6A 1PGZA 3IDHA 2UU9F 4BXOB 1J6ZA 3GIMA 4QR0A 3NNAA 1FI4A 4CF1A 3DXKA 4PG4A 5ALXA 2I1RA 3X1LB 4H4KC 2A1SA 3OL8A 3QJPA 5AM1A 3AVJA 1BUXA 1FNXH 3WKEA 3RR7A 3R2DJ 1OY8A 1N61A 2ZUDA 5BR8F 2EXUA 3ICLA 5HO4A 4PHTX 2F4VK 5IIIA 3OR2B 3N4MB 1CEZA 3R5GA 1TKZB 2G8VA 1VHXA 4PPZA 3SFGA 4JK7A 2V7YA 2BM1A 4QZFA 3QRPA 1ZQNA 5J2IA 4Y2IA 3CDBA 3N7PD 2P2CB 3DXMB 2MKCA 5BRDA 1FKPB 3DN9A 2CPIA 3WNHA 4HR2A 3A8JA 2OFGX 2AHOB 5DM7L 3ONNA 1D09B 1YRXA 1P7DA 1KFSA 3VCDA 4EIAA 1UETA 3Q8SB 1XN9A 3T5HA 1X8DA 2ZUCA 3R7BB 3KOAA 3DI6A 4PXDA 3MCMA 2C2ZB 4WIQA 2EBEA 2PFOA 1SI9A 4ZPAA 4CEFA 4B8CA 3CC4S 2VOPA 1NZ8A 3D5MA 4Q2LA 4AHSA 1O5JA 2V7ZA 2PMZC 5J0QA 2ROGA 3HPHA 2ALZA 1GMWD 3H5UA 2KJ5A 2LQ5A 5AQFA 4ILRA 5AM4A 2DGUA 3WU2U 1DQAA 2WB4A 3MEDA 2AJQA 3UXPA 2HBZB 2VJVA 4KHYA 4K42A 1HNIA 2DNYA 4XUSA 2BCUA 1HBNB 1VQ5S 2F8HA 2OPPB 5GAGU 4DX8H 2ZF5O 3A1YG 2JOQA 1GLFO 5K20B 1YJWS 3JAMU 2E6MA 8ICVA 2JL9A 1LV5A 1HPZA 3Q2SC 3E66A 1KD1T 3QNNA 5AT1B 3BYPA 3V1RA 2GO8A 2KKVA 4KHWA 1U1PA 1BHLA 2KT3A 5ITHA 2V8GA 2ZE2B 9ICSA 4EBCA 4ECZA 5B0FA 3S3MA 2VQFK 3VQEA 2OH2A 3IAS9 2NXUA 1RT7B 1VBXA 1ILYA 4MYUA 3AY0A 2ZEJA 3JXOA 1FJEB 2OUGA 1N5WA 4OYIA 2FVRA 3OR2A 2PZSA 4KLLA 1TKZA 1V3RA 2F8TA 1HARA 1TVRA 4AH9A 1YJRA 3V9XA 3OXLA 1RHJB 1VSLA 4NYOA 5L39A 2B4JA 3DXMA 3EE9A 4GV6A 4ZVPB 4DU3A 2OYQA 2E8NA 5E41A 3N6LA 4F4KA 5C42A 3NRWA 5DJBA 1XR7A 2F9WA 3CIMA 2YJEA 3KK7A 3CC2N 1K47A 3NY0A 1NMEB 3CFRA 2VC0A 1SJQA 4FLWA 4DX6A 1MLAA 3V7LA 5CYQB 1S1XA 4OIXA 4FVCA 3Q23A 2NRWA 4KAIA 4NYZA 1KAYA 1N36K 1DT9A 3LUYA 5A6WA 1DAXA 1SJ1A 4JI6K 4A8XA 4F91B 3QWUA 1WACA 1TR0A 1FD8A 3T5KA 5J0XA 2NXNA 5J0UA 5MAOA 2NREA 5GAEP 5HMZA 5KT3A 4M7YA 2R7TA 1NDCA 1VQ8N 5IINA 1UQVA 2NZTA 2WTUA 5DK5A 4NXNJ 3HFVA 5I4MA 5CCLA 2OWOA 3PEJA 1W25A 4IG3B 3SENA 4DFPA 1O13A 4DR7F 4YMMA 3BSCA 2QI2A 2VB6A 1NBEB 4H0PA 1FT8A 3VF6A 1H0HB 1KS2A 2B7CB 3P3DA 1WSGA 1HW9A 2P9SB 2K4HA 1KTQA 3JSBA 1GT8A 2P9LA 3HHDA 3VC8A 1VCTA 4LFAK 3VERA 3ISNC 4LR9A 3V7KA 4DFDA 3MPVA 2D6FC 2VKQA 3PSTA 4JK9A 2QKKA 4UY8T 3KHYA 2GVDB 4DV4K 4DDFA 3CO9A 5C24B 2Q3PA 1ZJNA 2YX4A 1WI8A 4WFNL 3QBCA 3V5RA 2GCFA 4DOBA 3QATA 5TKWA 1YZ7A 3C2LA 1K1QA 3MTJA 1H1VA 3RUBL 3RJEA 4LBIA 1U26A 1WHXA 2IOCA 1BGXT 5CZXA 1T4GA 5KOXA 1UEUA 3M32B 4AYBC 5L1KA 3NF9A 4F93B 4LF4F 4PJ0U 4F5PA 1HNZK 3PNIA 8ICCA 4YHHJ 4EX7A 3NP5A 4HWIA 1HD1A 3VQ9A 3J80U 4GMKA 3RJKA 4QZEA 2HOIA 4IJNA 5J0WA 4LJMA 4B17A 4I29A 3CFPA 2FXUA 1L5UA 4JI5F 4DQSA 5FPDA 1RDWX 3N5BA 2WAQC 3PNCA 2DGZA 5BR9A 3DXBA 1B70B 1NK9A 3FQKA 4OJGA 4DOZA 1NHKL 1PILA 4OL8A 4CEOA 5JMVA 2FLLA 2G2ZA 1F5BA 4IDKB 3TZWA 4CP5A 5HL7L 1FKOB 2P9SA 5A8WB 3QESA 1UP1A 2V67A 3D6FB 2P9UB 1WC5A 2F1JA 5HHIA 1N32K 2ZXIA 3TTDA 4LF8F 4RBUA 3Q8RB 3NXZA 3QZ7A 1IXRA 2VKRA 1OO0B 1VISA 2GZOA 1SVDA 3NHGA 2V8VA 2ZJPL 2GVDA 5CD4H 2HURA 4WFZA 2ZC4A 1UWBB 3LP1B 3QT7A 4OLAA 7ICTA 3G6VA 3QYPA 4DMZA 2IGIA 4ELTA 1KKHA 2MQ8A 4N8OA 2DIVA 2BDUA 2FLPA 3KWGA 2YTUA 2VFRA 4BG9A 5DDOC 2F1IA 2BE7D 2D3ZA 2BZFA 2EFGA 5ELZA 3UCGA 4I9QA 1JXLA 4ZP9A 1HUXA 1AROP 5GAEI 3ZNJ1 4IO8A 4WIIA 1A0OB 1BQMB 3M32A 5F8GA 4HL9A 3A4TA 3DXSX 5G4DA 1Z05A 2H3EB 2VA8A 3VGTA 1G1XA 1S7HA 1NJIT 3HJEA 3BSNA 4JV5J 4BE1A 4FNIA 4I2QA 3ZT0A 4J5OA 2FTRA 5ADXA 3ISZA 5J2DA 2WVEA 1HNXK 1MA7A 4LVOP 3SSRA 2GUIA 1ZOLA 4FZLA 2PT0A 3QT6A 3WZ0A 2WSCC 1FDDA 1RT4B 3KJVB 3GV7B 1QVFR 3AMZA 3D28A 3CJ2A 2HHHJ 1NGAA 4QZCA 4HCCA 1VQ4S 1AW0A 2ZIXB 1WKKA 1RGIA 2WHEA 5IT0A 5FLXY 4DPUA 4IDKA 3VAIA 2ZJQL 3D2SA 4MHVA 4ISFA 4Y28C 2KM8C 4U7UD 3G6YA 1ITPA 3R5DA 2P9UA 3I82A 3U7JA 5KI6A 4O8KA 3KNGA 3HOTA 1XQSC 3C5FA 4LSNB 5HAOA 3KNAA 1QLNA 2CFXA 3MWPA 4X84A 3UKRB 2CPEA 4OZ0A 4IRCA 2I9SA 5M2PA 2O8EB 2AEFA 2MDAA 1VQPS 5E33A 3RMCA 1UWBA 1UA1A 3LP1A 5KFZA 3A8IA 4ZJLA 4O5KA 3EZWA 1Q7YO 2XTJP 4JI3K 2D0OA 2XWYA 4DR6F 5KFSA 3TQ1A 3WK7A 2E8AA 1VQLS 4JV1A 4DR1F 3V81B 3W61A 1OQ6A 5CZ2A 5KQ8A 4YS2A 1JXEA 3R9LA 4MFBB 4TSXA 4KLHA 3A5OC 2F4VJ 1NOMA 1IG8A 9ICKA 3TX0A 1Q9XA 2LYAA 4ZN3A 3NVVA 5HMWA 3OXGA 1BQMA 1ZD2P 4PKHA 3C66A 2FLOA 4FVMA 3TUZC 4CF0A 1ZQRA 2IDOA 1B3TA 1DLOA 4WYLA 1U02A 4PR6A 2V68A 3VQPA 4OFZA 3PX6A 1X9WA 3MXHP 2IIRA 2LYBA 4CEZA 3JS6A 3QEPA 3UIQA 4USJC 3D6MB 4K4TA 3DOKB 1IKWA 4OX7A 1YRTA 3QQCD 1T7PA 1N63A 4AHVA 3KHLA 4IKFA 5LJ3Y 1OWXA 3KDNA 4ZVQB 4K2JA 4AF1A 3EYZA 3BF1A 1ZQGA 2GMLA 3A12A 3H5SA 1TMMA 4JBCA 1SL0A 4YUDA 1RT4A 1OVQA 3J7ZO 3PKMA 4OKJA 1GFWB 1ZM2A 4CGIA 4RW4B 2ZIXA 1YTUA 1RHKB 5HRSA 1YBAA 2ZZTA 2G8IA 1ZXOA 5IT9U 4B1WB 4FJ9A 1R8HA 2ZZMA 4X2BA 2KEYA 4BC2A 2XNQA 4MAKA 3KBBA 3O44A 1WHYA 3BQ1A 4O5BA 1UJ4A 3L2UA 3WKCA 4LSNA 5EY4A 4X62K 3C28A 2CQCA 2O8EA 4CD3A 5DKWA 2RRDA 1NGIA 2LFVA 5L1IA 4B9LA 4BRAA 3DRXA 1YHQN 1HWIA 2VF3A 1XMQK 1WOPA 3KIOA 2GS8A 1CS4B 3V81A 2YQEA 1S72S 4NLKA 4IRKA 5C12A 3IP0A 2PAVA 1VS3A 2YKQA 2FUG9 1RXWA 3AVNA 3NAIA 1PJ6A 4UAYA 3PVXA 4BRGA 1COOA 7ICKA 4H54A 2O8FB 1ASUA 3EUNA 1XC9A 1QAJA 4XPCA 1CPZA 4F4XA 2YWEA 4FYYB 3MMVA 4CLYA 4TY9A 4UZBA 4JYAF 2Q31A 2MLYA 3A0HU 4PZVA 2M2BA 1QQ5A 3BM7A 4HHUA 5KFDA 3BH6B 3QT8A 3PUFA 3FSYA 4NXMF 2WBRA 4LF7K 3DOKA 3ILJA 2XMAA 2QLXA 3W60A 4XA5A 2OPRB 4ZJQA 9ICHA 3D2EA 4JRQA 2BGGA 3CGIA 1YWXA 2ZTDA 2XSFA 3C23A 4FJ8A 2DY9A 2Z1GA 3IAM9 3GFZA 2PI4A 1RDRA 3CJ4A 1N36J 4OYWA 5KFVA 3P45B 4QAGA 5GMKa 3HCXA 1HHQA 2PFFB 3W66A 4JI6J 3HSTB 3ZTSA 4C8YA 2W2OP 9ICNA 4OLOA 1U1RA 2NPFA 1TAUA 3ISCA 2WUSA 2EQYA 1EARA 3QU5A 1YTAA 4FLXA 3QBWA 1COKA 1H3DA 2VQEF 2HQCA 1WTBA 1V5VA 5KFCA 2FC9A 4FWLA 2R8IA 2ZUGA 2A6OA 3BZCA 3QINA 1S8OA 3RBZA 2OD6A 1Y0HA 3DRSA 1TL1B 4OYBA 2LI6A 1U8SA 2HMIB 3OYNA 1Q3VA 2IHNA 3T1YF 2UUAK 2K3KA 1GLLO 3BF3A 3P83D 4ZN1A 1LWEB 2XG8A 5AZJB 4F04B 1PAUB 1QCKA 3NVKA 1M5KC 5D4LA 4LFAJ 4PHEA 1CS4A 2A3VA 3OQ2A 3WQPA 4FJHA 4NYNA 3PMNA 2BJ9A 1FDBA 4MLHA 1Q1KA 3K2PA 2O8FA 4DV4J 2ZKTA 5DB7A 4CRJA 4CD1A 3DAWA 4C8OA 1MQ3A 3G6XA 3MGJA 1ZYQA 1LXJA 3KLHB 3NGUA 3DM2B 4LRBA 1RZMA 3E8OA 3H5XA 4FJMA 4OJ3A 5KOWA 3TW0A 4UBCA 4M3TA 1WTFA 3KLEB 1K8AT 2XQCA 1WG8A 1D5AA 1NGGA 2F2AB 2OPRA 4DR2F 3D0HE 2ZH8A 1EWQA 1Y00A 1DHMA 4R66A 2IFXA 4FCYA 2N4DA 3T5LA 1KC8O 3NWRA 3UNGC 4H0XB 4TVAB 4USMA 3KYLA 1KHWA 1YIJN 1TKDA 4PCQA 2ZIUB 2DGOA 2OHFA 3S6JA 4AHCA 2XICA 5JU5A 4BRFA 3TVKA 1N34F 2DNNA 4OJ1A 1GLJO 4XRHA 1SH3A 3WXKA 4FPRA 4ZVRB 5E3PA 5CYJA 1PK1A 3KZXA 2HVEA 4YOXA 3BDPA 3THWA 2DHAA 9ICRA 2KE7A 1S9EB 4B3RK 3BYRA 2KT2A 3GV8B 2P9IB 4BWJA 3FZ2A 1TL1A 1AQ6A 4KFBA 3HP9A 2CA9A 2HMIA 2GBZA 2Z1JA 2G0CA 2E5GA 2YKOA 3HSJA 4ED4A 3OHRA 3NGYA 1BPBA 3CIZA 5IM0B 2W42A 5AZJA 3FZBA 1YG0A 1N32J 5E3QA 2JZBB 1VQOS 3VGLA 3ATUA 3GR0A 3MEEB 4C2MA 4DTUA 2IOFK 1ZM3A 3IA0A 5ADXH 1V97A 5EUHA 4X4OA 2LHTA 2MLZA 4O8UA 5KFKA 1RWXB 2UP1A 4F7VA 1JJHA 2XVTA 1DEJA 4JUZA 4RPYA 3V9WA 4KE5A 3J7A1 3MN5A 2EFQA 3DM2A 1NKCA 1HUOA 2F76X 5J0PA 3AA9A 4DZ6A 1FD2A 3W8PA 2RILA 3C8YA 4I67A 1U1OA 2ZIVB 3RMDA 2AYMA 4IZ9A 5F8JA 3L4IA 1OY6A 1FDAA 4PHAA 3PW4A 3R3TA 4QZGA 4V1Ak 3QU4A 4CGZA 5CAAA 3BZKA 4QYZJ 1VQMS 2LM1A 1BPXA 2XO7A 1SJFA 2J9CA 2D0CA 2VG6B 2ZIUA 4A8KA 4B3SF 1NGEA 4OJPA 2MB0B 2AU0A 1MSWD 2A6MA 1SS6A 2E1CA 2XNRA 3TR8A 3EWGA 3CMAN 2E3TA 3PIOQ 4UARA 2DWQA 4JNEA 1HNXJ 1VR6A 3FAHA 4TUPA 4Y34A 3H45C 3QNWB 1S9EA 1IVZA 2JVRA 2E9TA 2W4CA 2P9IA 2W54A 4I2HA 1RAIB 4RUHA 5KFIA 4QNLA 4YG2A 3F2BA 4GXKA 3AVIA 5EGYA 3I55S 1K8KA 5HJYA 1SIWB 5IZHA 2D0BA 5ALVA 2YNIB 4ZVHA 2M52A 4CJRA 3TNVA 5D0GA 4E98A 5IM0A 4V19J 1IBMF 4PL2A 3OJUA 1WWVA 2G8FA 4X4UA 3MEEA 2UUCF 3M8PA 2LQ8A 3QLHA 5AQOA 5JRTA 3MD1A 2BJDA 3DU6A 2D3UA 4OZ1A 4JKCA 4EHUA 1CJTB 3TADA 1QSSA 2Z4PA 3N7SC 3ZZRA 2APOA 4BVOA 1C20A 1A5XA 1TUGB 1YJUA 2HS3A 2CPFA 5B08A 3MUTP 3P1GA 1QQ7A 3AQEA 2BZ2A 3OL9A 2CVIA 1EKSA 1KRPA 2RQ4A 2FC0A 5GINA 5AIBA 3ID8A 4KGMA 2MAXA 3SAHA 3HKZC 3SBGA 1FEZA 3GCWP 4KRFA 3CI5A 4GFJA 2YX1A 3H6EA 2QMXA 3RF9A 1ZQVA 2GLEA 4BC9A 2PI5A 2ZHBA 1C7YA 2M0GB 4WZMA 1U47A 1EKRA 3OXFA 4I6MB 4QS8A 1RBOB 2H4YB 3R5JB 4LF1A 4QZVB 4KREA 3FNNA 1VMBA 4ZPCA 2I5HA 1KXPA 2ZTEA 4FWSA 4FPBA 2R2SA 1UVIA 2FBTA 1RWVB 3CCRS 2VG6A 7ICNA 4DR4K 4FJLA 2BABA 2RQ5A 3M8YA 3PSPA 2WCXA 3WT0A 4BGBA 2JR5A 4FVUA 4BWMA 2GGPB 2WC9A 1XNRF 1MG7A 1SUQB 4ZPWR 4NLOA 1BISA 1OIAA 3KFWX 1B0XA 4TY8B 2UXDK 5E84A 4MDAA 4OLPA 1YLXA 3DYAB 2WMMA 1HW8A 4FZYA 1CSJA 4YOEA 2MZJA 2CVEA 2YNIA 3N6MA 5B0EA 1R3NA 1LQ9A 4K4WA 4MIBA 1QQNA 2RDDA 4MDBA 3GB0A 1WF0A 1T03A 3AGRA 1WN7A 1U45A 2H5JB 1KEKA 2I6WA 5J2JA 5E3RA 5F8LA 3RAQA 2MTLA 3QIDA 1GO3F 2A1BA 3DV9A 1BMQB 3EKSA 3CB4A 2E2OA 3KVGA 2QL7B 5CYMA 4NLZA 8ICFA 3FC4A 3TEHB 1CJTA 2E1PA 3CJKB 1XMQJ 2NNWA 3CRXA 2UVUA 1SB3C 3G4SN 2JEGA 2OFHX 2ZBQA 4E7KA 3QB0A 4ZVEA 1K73O 2C2OB 2FZGB 1WBBA 1J27A 2KZ3A 4KLMA 5J1PA 3VQ7A 2W9CB 1HHSA 5D3GA 4XH1A 2D7SA 3KTQA 5BPNA 4M5LA 3NVYA 2FGOA 3RJMB 2Y0SC 2J9DE 1UT8A 3BS9A 2X3DA 1OW5A 3N5FA 3LH2S 4F4ZA 3OR1A 1DARA 2WF6A 3DJCA 4H5VA 4CJPA 4NMLA 3IS9B 1AFIA 2D3OR 2Q1NA 1B0PA 2XMWA 3K75D 1BG3A 3FEZA 2KNJA 3MN9A 1CULB 4P6QA 4LF7J 3AL0B 5D15A 5LMUJ 2WVBA 2DFHA 2CQDA 1X5SA 3I4PA 1ZQYA 3MGHA 3AJ2A 2ZJ8A 1SCJB 4WXWA 2B6AA 1S9GB 3EKUA 2QN6B 2XEXA 3SSQA 4U95A 1S59A 4TY8A 2XIDA 1HBMB 4RQ7A 3DYAA 1I94K 2KU7A 3TO8A 2K3IA 3QIPA 5AJ3F 2NYVA 2N7CA 1B7FA 4PGQA 3CM6A 2G8HA 3SEOA 3TTFA 4QYRA 4TNOA 3EDQB 4GY2B 3QX7A 3KOOA 2IVNA 3DHWC 5F0XA 4ED3A 2F96A 3CF5L 2UYTA 4CERA 3P5JA 1SZPA 1R8CA 1RAOA 3LDOA 3SJHA 5G5HA 4I69A 3VAJA 3MC1A 2VBWA 1X42A 3IWNC 5K8OA 1LOTB 4AQYF 5HVHA 3HVTB 1SKRA 2UUAJ 3ET6B 2AT1B 4P9SA 5ALPA 2DTUA 2ZGZA 3CJKA 3N97B 2B6GA 3Q8LA 4FSVA 1TAQA 2FIUA 2VANA 3CCQN 1KAXA 3RBDA 3F9KA 4FM0A 1WEZA 4PPDA 2W9CA 1WCNA 2BW2A 4FZZA 3JAMY 1A0PA 3FDSA 5ALGA 3ZD8A 3TKAA 4KQZA 2NQPA 5DM7Q 1M5VC 3M8QA 3ONQA 3EGWB 5CHGA 1IXKA 4MT1A 5J1EB 3VEOA 3IS9A 1V85A 3GIJA 1WC0A 1RBVA 2CNKB 3AB4B 1H7XA 4YORA 1IO2A 2YVSA 2CQGA 1ASWA 2GUPA 2BXJA 5J2KA 4P52A 3EE3A 2E7WA 3C95A 1CULA 3MM6A 5I3QA 2NZCA 1OSDA 1T9XA 4KHUA 1EO1A 4WF9L 4CDGA 1S9GA 4U9RA