1U45A

8oxoguanine at the pre-insertion site of the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
b'AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u45A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u45A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u45A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u45A01
2P6UA 5SZTA 4O3RA 5DK5A 2BCUA 3ISBA 1AROP 2X74A 1LW0A 4KTQA 3OYDA 4DL4A 5HP4A 4UB3A 1HPZA 4R66A 3AVGA 4IDKA 2KFZA 7ICQA 3RAQA 2Y1IA 3MR2A 3AA2A 2P5OA 3MDCA 3AVNA 3ALYA 4DQPA 4KHWA 2VG7A 4CGJA 3TAMA 1S1XA 3H40A 2HHTA 2AQ4A 1IKWA 3OYKA 1BL3A 8ICCA 3AO4A 1SZPA 5EOZA 3BGRA 2JEIA 2IS3A 7ICUA 1NKEA 2KTQA 4O3OA 3AU6A 3ZT2A 3OYHA 4XRHA 4B3OA 3VQ8A 4F8RA 3C2MA 3MR5A 3RJGA 3Q8QB 2GUIA 1S9EA 4CFDA 5J0PA 3SZ2A 1HUZA 4L8RB 2ZD1A 2BCVA 2C2RA 3OYAA 1ASVA 4RPXA 2BCQA 4QZDA 3C94A 3C1YA 3V6JA 1U49A 3MXIA 5DGBA 2ZJAA 3M8PA 3PY8A 4IG0A 3MGIA 1VRTA 3RJKA 3ISCA 4BGDA 4FS2A 4AHRA 1WSIA 4FW2A 5DQHA 5F9NA 1EXNA 4FJ7A 1RTJA 1HYVA 1JLBA 5IIJA 3PX0A 3ETLA 4MF2A 3AO2A 2D5RA 1NK4A 4CFAA 3SUNA 4ZTFA 3LDAA 4QZCA 2BPGA 2DFFA 2XHBA 2Z1IA 4B9LA 3NAEA 3H4DA 4DSIA 3LZIA 4ECWA 1MQ2A 1V9PA 4FJ9A 4ECXA 7ICGA 2OWOA 3U6FA 2KZZA 1QSLA 2FBVA 4ECUA 3ZCMA 3QIOA 3B6PA 5HRRA 4KLDA 3IAYA 4DSFA 3HXMA 4DFMA 4CGGA 2YNGA 3OYIA 1TFRA 3VQAA 4IQVA 1IKXA 2LYHA 3PW5A 3ULDA 4DOAA 4FXDA 4R63A 2DFHA 4LY7A 3B0XA 3K75D 3PR5B 3F73A 4OLAA 5KG7A 4AHTA 1B43A 5KFEA 3HPOA 5KFIA 3RJHA 3WNHA 4JWMA 5L9XA 3TAPA 5HHHA 5CY4A 4QW9A 2IC3A 5FRMA 3QE9Y 2F8SA 4DU4A 3CM6A 4ECSA 2IHNA 1VSKA 1A77A 1XSLA 4NLNA 4C8NA 4CEBA 5KFQA 4PHAA 1ZQMA 4M9JA 5FROA 4YMMA 4FLVA 1XI1A 5HRSA 4QAGA 4PUOA 2EX3A 4N56A 5DBAA 3QEAZ 4CFCA 2DPJA 4ZH4A 4MFAA 3K57A 3SQ2A 3HT3A 1I3AA 4Z4HA 3DLRA 3EYZA 1X9MA 1K6YA 1BCOA 1RDAA 1WNSA 2J6TA 4Q8EA 3L2UA 1CZBA 3TR8A 3AA5X 1BPDA 5DLFA 4FZXC 4CCHA 4JV0A 4GVMA 1L3SA 3G0ZA 5J29A 1TV6A 1Y97A 3VN5A 4M41A 3GV7B 4G1QA 3H7IA 4P4PA 9ICLA 2ALZA 3KHHA 3HPGA 4FJGA 5EWGA 8ICLA 5KG0A 5KFNA 4OKJA 2IAJA 1S0MA 3CM5A 2R8IA 3V1RA 1SL0A 3G6XA 3IRXA 4AHVA 4F4WA 3AO1A 1ZBHA 3HL8A 5KFAA 4Z4CA 2JZBB 1RYSA 4M0AA 3VQ9A 2NRWA 2NUBA 2ISOA 4FZYA 1VSDA 5KT7A 1JX4A 7ICIA 3AU2A 1X1PA 2XY6A 4KN7A 3LP1A 5DB8A 5DB9A 2BANA 1BVSA 4B9TA 4EEYA 1EP4A 5FRNA 3NF7A 3RJEA 4DQSA 2RDIA 1HJPA 5J2QA 4E7LA 3H8WA 4EBEA 2XCAA 4HCCA 4J9MA 3MFIA 4MFCA 4CE9A 5KGWA 3EPGA 4DQQA 4QZIA 1SL1A 4M3XA 3N97B 3AVMA 2RKIA 3Q8SB 4KLIA 4CESA 3M8RA 4ED6A 4M3RA 4FJKA 3UPQA 4ELTA 4F5RA 4YMNA 1S9FA 1EETA 5DB7A 2VA2A 1WCLA 4JV2A 2JEJA 5JS1A 1JXLA 5KFMA 1SV5A 4I2QA 4M47A 1A5XA 1Y88A 5DBBA 1COOA 1S1WA 3RR7A 1YVUA 1RILA 3U3GA 5KT6A 4GXKA 1ZQTA 3PX6A 1ZQUA 3KLFA 3IG1A 3JSMA 4NLKA 4B9MA 3JPTA 2E6MA 4CHPA 2DTUA 1T7PA 1ZQVA 4KLOA 4E89A 2UVUA 1X2IA 3RH5A 2HNYA 4YR3A 1WSEA 1BIUA 3UXNA 4KI6A 3MEGA 4R65A 4CEAA 5KRTA 3OY9A 3S3NA 5KFSA 4BDZA 1LW2A 2HHWA 4JRPA 3SQ0A 4FBTA 3T5JA 3M8QA 3LALA 4HUGA 1ZQXA 4F4KA 4DS5A 4RQ7A 2E4LA 1DGSA 4UBCA 3TARA 2FPMA 3AVIA 3NF8A 3RMDA 1IKVA 4CGHA 4ZTJA 8ICVA 3QZ7A 4MFBA 3PW2A 1RBSA 2BCSA 4CEOA 4FJHA 4F50A 1Q8IA 1U48A 4OJRA 3V1OA 2OPRA 3RB3A 4ECRA 4KLTA 2PI4A 2RDJA 5KT3A 3V1QA 1LWEA 4CJTA 2XC9A 2D0AA 4KLEA 4RPZA 4QW8A 2JLEA 3L2RA 1SL2A 2HHVA 1FKOA 1IH7A 4DMNA 3NCIA 1N6QA 4CJWA 1ZJNA 1S76D 4GXIA 5JUMA 4CF1A 2GV9A 9ICGA 4MEXA 7ICMA 3K58A 4P2HA 1KFTA 3I0RA 4UAZA 4YCXA 1KVBA 3S3OA 4KREA 4IKFA 3FYHA 1BI4B 4G3IA 7ICFA 3QERA 1U04A 4QWCA 2F1IA 3NFAA 8ICUA 3NHGA 3V9XA 1NK8A 4J2DA 4RQ1A 4DEZA 4YMOA 4O44A 4DTSA 2DFLA 1RBVA 5IINA 3O4QA 1QS4A 1T4GA 3HP6A 2PFNA 2HHQA 4IQWA 4FJNA 1RBRA 1FK9A 7ICOA 3NGDA 4F4ZA 1QHTA 4AH9A 3KLHA 8ICKA 1JLAA 3V81A 3C23A 4AHCA 3DM2A 4RUAA 4BWJA 5J2BA 1J54A 4CGFA 5HBMA 2FBXA 2X6SA 3C5FA 1K1SA 3KK3A 4K8XA 5EU7A 3BQTA 4TUSA 2B4JA 1ZQIA 5J2HA 4QZEA 1MC8A 4OGCA 2XY5A 3SNNA 1JLEA 2GWSA 3SQ4A 4N47A 5EWEA 5J2DA 3ZT1A 2EHGA 4FCYA 4Z4IA 9ICTA 1RBUA 4FK0A 3OGUA 5KFBA 4UB1A 3RB6A 8ICRA 4RQ5A 4RQ6A 3KKRA 1Q9XA 3LPTA 2R8JA 3Q8PB 2BE2A 3I0SA 9ICFA 3SQ1A 2BPCA 3IM1A 3JPOA 3HP9A 4W5TA 5KG5A 7ICKA 3WNEA 4E1NA 8ICBA 4LZDA 5HNKA 1S1UA 3VQPA 4Q45A 5DBCA 4RQ8A 5C5JA 3C2KA 2G8FA 4KHSA 2NRVA 1KVAA 1S6PA 4ECZA 1WAFA 4O5BA 2F1HA 2X6NA 2P5GA 4GW6A 4DFKA 1NOYA 3OYBA 1S0OA 2X78A 5KFZA 3QETA 1RT6A 5D46A 1JN3A 4W5QA 5KT5A 5CHGA 2UVWA 4CJLA 5KG6A 7ICHA 4FM1A 3OYFA 3MFHA 1TVRA 4J9NA 1BPZA 3ZD9A 1O1WA 3LP3A 2FLPA 1S97A 1QSYA 4PQUA 2WONA 3V4IA 1A5VA 2OPSA 5D49A 3CFPA 3TQ1A 4KLHA 3V9ZA 3OS1A 1WLJA 4B8AB 1JIHA 3PVXA 2C2DA 3WNFA 5KFYA 4F3TA 2KZ3A 4I2JA 3AVAA 2ASLA 1Z00B 1XWLA 4ED8A 1TVAA 2XY8A 4DL5A 2B6AA 4YQWA 1WSGA 1ASUA 5CZ1A 4Z6CA 4CEEA 3KK2A 2BCRA 1ZQBA 4GMJB 2FPLA 4E7HA 1JLQA 3LWLA 4J9QA 1T3NA 5KFPA 4ED3A 4KRFA 4F93B 9ICQA 1GOCA 3E2EA 3AVHA 3A2FA 4O9MA 4M9HA 4WE1A 1RTHA 3QNNA 3T19A 3T3FA 2Z1JA 9ICWA 1ZQEA 2RN2A 2WTFA 4XA5A 5D3GA 5J2PA 2P51A 1IXRA 1TKDA 4BXOB 4EP5A 4Q0BA 4FJ8A 4B9VA 4YFKA 4KLGA 2QKKA 3V6DA 4R64A 2F1JA 4GC6A 3PO4A 2KQ2A 4W5OA 3GQCA 2ZE2A 2OA8A 3GIJA 2QKBA 8ICWA 4LVSA 3C6TA 3C21A 2HHXA 1NK5A 3P1GA 1U4BA 3GDXA 4DLGA 2YHBA 3JPPA 3P83D 4EBCA 2OYQA 1C1BA 4M42A 1QLNA 4QCLA 2AGPA 2DY4A 4UB2A 4FYDA 4LSNA 4O3SA 3BQ0A 1XSPA 4N76A 3HWTA 4CIGA 3GIIA 3OHBA 2ATLA 4KFBA 3OYJA 4M6WB 3PW4A 2J6SA 7ICLA 3QESA 1B9FA 4CHQA 4FS1A 4DS4A 3D45A 4H4OA 1ZQLA 4KLFA 3TAGA 1S6QA 3EPIA 8ICTA 4H4MA 2YKNA 1LB2B 4KPYA 1ZJMA 1ZYQA 5E41A 4O3PA 5HMMA 4CJRA 1RTDA 1ZQWA 1HYSA 3HSTB 3RB0A 3HW8A 1BISA 1TKZA 4BDYA 8ICYA 1UOCA 5KFGA 4RW7A 4DF8A 2O4IA 1GOBA 5J0SA 3K59A 3AV9A 5IIIA 2UVRA 3SUOA 3RMCA 7ICNA 3VQQA 2AU0A 2ASJA 1VRUA 4JS5A 4O0JA 5EWFA 1DOQA 1RZTA 3NF6A 5J2NA 3LPUA 4N41A 5TZVA 4W5RA 2JEFA 1BI4A 8ICMA 4KI4A 4TQSA 3RJJA 2OPQA 1T8EA 4CK1A 1NK9A 4FJJA 5KFKA 3S9HA 4M45A 5KFWA 3JYTA 4E19A 1RT5A 9ICHA 4QZ8A 1ZQYA 2XGQA 4NXZA 2V4QA 3KK1A 1JMSA 2KW4A 4MEYA 4BWMA 4Q43A 3VA0A 1S5JA 2VANA 4HHTA 5DG8A 3UQ0A 5I42A 1RDBA 2NRTA 4F3OA 4KLLA 1TAQA 2BGGA 3HVRA 5IIOA 4YP3A 5FDLA 4FJXA 4KTWA 3MR6A 1K1QA 3LAKA 7ICRA 4KHNA 5F9LA 4OGEA 3VQ5A 4E7JA 3QEWA 2A1SA 2BPFA 5KFLA 2KZMA 3F9KA 4J9OA 4KV8A 1EKEA 1VK0A 4KHUA 1TKXA 1UT8A 3RTVA 3LP2A 2PFOA 4CEZA 2G8HA 2MUTB 4Z6FA 2AQ0A 5KFFA 4N5SA 2ZTCA 3DLGA 2FPKA 4BE2A 2D0BA 3MECA 3PO5A 3AVCA 1S1TA 4DTXA 4CEFA 3NGZA 5KFUA 4RQ3A 3I8DA 9ICPA 1ZBFA 3B6OA 4B8CA 2XGPA 4Q44A 3FDSA 3O4NA 2NRXA 5J2IA 1BIZA 4P4OA 1XSNA 4ED7A 1C7YA 4HVJA 4F4YA 4QWEA 4DFPA 4B9UA 2OPPA 2PFPA 1ZQNA 1REVA 1ZQGA 3ZT0A 3L2WA 1XU4A 3KJVA 4DF4A 3RMAA 3CYMA 4F91B 4PGXA 4H8KA 3GILA 1XO1A 2M9NA 1CUKA 1ZQDA 5KG1A 1KCFA 2IHMA 5DGAA 4NY8A 1ZBLA 5DG9A 4ID1A 3L2QA 3DLEA 1SKWA 3GIKA 2C28A 4QZBA 4FK4A 4KLUA 3QO9A 1UWBA 4CJQA 2W42A 4ELVA 4I2EA 1RBTA 2HNDA 1UA0A 1S0VA 4IQTA 3AVFA 1VSIA 1Z25A 4RNMA 3G6VA 4LD0A 4DSJA 4JV1A 1KEJA 3C95A 3NGYA 2WOMA 1HUOA 3OVNA 4DTJA 4FLWA 3AUOA 2Z1HA 1VSFA 1NJWA 1S9GA 4Y1DA 5L1JA 4I2AA 5K14A 1DLOA 1EXQA 4CJUA 3PR4A 1R0AA 1KFSA 4DSKA 3HM9A 5KFTA 2BQRA 3AVJA 1TV9A 4B9NA 3LP0A 4QZAA 3ZT3A 9ICBA 3DLKA 1B22A 2V4RA 3SUPA 4TURA 4CEDA 4RNOA 1HQEA 2O4GA 4E7IA 4JLHA 4NCAA 5HROA 4IG3A 1ITGA 9ICKA 1VSHA 3Q8MA 3NH0A 5IIKA 4I2DA 3K2PA 4KHYA 3OJSA 3B0YA 4R8UB 4CJEA 2F96A 2LSNA 2ISPA 4J9RA 4I2PA 3NH2A 4TUQA 4DL2A 5J2GA 3RWUA 3DOKA 5HMLA 1LAWA 1BCMA 4I2GA 3SCXA 4O5EA 3IS9A 3HPHA 3ORYA 2KFNA 1TL1A 1WSHA 4BXOA 4PGYA 3LZJA 3KD1E 1TK8A 2FBTA 4NCGA 4IR9A 4OKEA 2BQ3A 4Z4FA 9ICSA 1RT1A 4ED1A 4QZFA 3ZSQA 4QZ9A 3RRGA 4F5OA 1JKHA 1VSLA 1QTMA 1DTTA 1WSJA 1W9HA 4C8KA 3LWMA 1JL1A 4KB1A 2JEGA 4DTNA 5J0QA 3UXPA 3AA3A 2YNFA 4YD2A 5BOLA 4RT3A 3EY1A 3ZSVA 3ZD8A 3S3MA 3ZSOA 2OZSA 2BQUA 3KLIA 4M6WA 1Q9YA 3MBYA 4DOBA 5CJ7A 2OZMA 2RPIA 4I27A 4YNQA 4TUPA 3P5JA 4YVZA 4C8MA 4UAYA 2ETJA 1IM4A 4CJKA 3OSPA 4C8OA 3KLGA 3KHLA 1S1VA 5KI6A 8ICIA 4RW8A 4ED0A 3UXOA 3MXJA 3KTQA 3N4MB 4MFFA 4I2FA 3SJJA 1ZBIA 1QQCA 5J2FA 4CF0A 3QEIA 4KB0A 1YTUA 2VA8A 5KFVA 3LK9A 1C1AA 5J0UA 1NOZA 1D9FA 1X9SA 1ZQPA 5J2MA 3RBDA 1S10A 4M2YA 4DU1A 2KN7A 1EX4A 3K5LA 3V9SA 3HX0A 4LH4A 4CHYA 1ZQSA 1D8YA 2A1RA 3LANA 2V9WA 4DLEA 3ASMA 4IQUA 4RU9A 1I39A 1S77D 4I2IA 5J2JA 1L5UA 4NM1A 1J53A 5DG7A 2PY5A 4EYIB 4KHQA 2HHUA 1RT7A 1U47A 3CFOA 4KAZA 2HVHA 1NKBA 5DLGA 4CK2A 2FBYA 3HK2A 4UBBA 4CHOA 5BPCA 3RMBA 1KTQA 4LZGA 1RT3A 4NLGA 2FMQA 1JLGA 3TWHA 4AILC 3PNCA 4ZHRA 3K5OA 4QOZB 1RTIA 1BGXT 3JPQA 3TAQA 2W9CB 1TGOA 3C6UA 4FJ5A 4J2BA 4F5PA 2Q0ZX 2ATQA 4I9QA 4YD1A 2MUTA 2QXFA 4DQRA 3L3VA 4HUFA 3TANA 5KFXA 1YTAA 2W9BB 9ICMA 2ZTEA 1XHZA 3AO3A 4OKKA 2H5XA 4IRKA 5DDMA 4RZRA 4ECYA 4I7FA 4NYFA 3OS2A 4NLZA 1D8LA 4QWDA 4CF8A 5KGXA 4CHZA 2G8VA 2JZBA 2MAXA 1D5AA 3MABA 1BPYA 1ZQKA 5KFDA 3MEDA 1CEZA 1KVCA 2R8KA 8ICJA 4CIFA 1SKRA 3ZSXA 1MU2A 3BQ2A 1ZQJA 1MSWD 2VG5A 3QIPA 4F5QA 4O55A 4DL3A 2FMSA 3H8SA 2ZUCA 3MGHA 3RH4A 3DRSA 8ICFA 4JS4A 5HRNA 3C5GA 1VSJA 4NM2A 5KFRA 3T5KA 5L1LA 3RB4A 5JS2A 4DOCA 1W0HA 2XY7A 3UIQA 4CHNA 5J0YA 8ICEA 4P4MA 3VQ7A 1HQUA 2IOCA 4XQ8A 3RJFA 9ICVA 1HNIA 3IHQB 3AVLA 3VQ4A 4O5CA 3THVA 3DRPA 3V7KA 3T1AA 2G8IA 3DI6A 1F21A 4J2AA 2ZJ8A 2YHAA 1A76A 1CXQA 5KRSA 2RF2A 2W8KA 5C25A 2R8GA 1WAJA 5J0RA 4QWAA 1TAUA 4YXJA 3TAEA 3PX4A 2BHNA 4ED2A 1MQ3A 3V72A 3PV8A 4DO9A 4DSEA 3Q8RB 8ICZA 1BQMA 4YR0A 3DLHA 2E6LA 2P1JA 4FLXA 3C2LA 4NYNA 2IMWP 3PUFA 4JUZA 3NE6A 4O3NA 4R8UA 3RRHA 2ZJ5A 4C8LA 1NJYA 4PHPA 1T03A 1LWCA 4FK2A 2XO7A 2ZTDA 4BACA 8ICOA 8ICPA 1JL2A 5KT4A 4CJFA 2ZUDA 3QEXA 4R5PA 5CWRA 5DQGA 9ICCA 5KT2A 3SI8A 3SYZA 4J9LA 1S0NA 4IRCA 2ZQBA 4FLYA 4MQ3A 4Z0UA 2P6RA 3QEPA 1JXBA 2I1QA 1SKSA 2IBKA 3ZDBA 2HMIA 4PGQA 4KLMA 8ICHA 1BQNA 4HCBA 3V9WA 1N48A 4KLSA 4YN4A 1KLNA 5CZ2A 2G8WA 3MR3A 4M3TA 1NKCA 4DFJA 1N5YA 4EBDA 4M9LA 1TK0A 1C6VA 2Y1JA 5T7BA 4M3ZA 4Q5VA 4ECVA 4CJ5A 3OYMA 3PW0A 3DRRA 3DLBA 1QSSA 1XC9A 1NJXA 4K8ZA 4E1MA 2FLNA 3VQEA 2DPIA 9ICEA 3ITHA 2PZSA 4DTUA 5C42A 4RUCA 4IRDA 4I2HA 3TAFA 2ZUBA 9ICOA 4M3UA 4M3WA 3AVKA 1HNVA 4I29A 1Z3EB 2B21A 1TK5A 4DSLA 4B9SA 1J9AA 4JK1A 4F2SA 2J6UA 5HRPA 2P66A 5HHIA 4CJ3A 4PH5A 1NJZA 3KHGA 1BPBA 4W5NA 8ICQA 1UT5A 4E3SA 4CJSA 3OYNA 3G10A 4EYHB 3V7LA 1C1CA 3EZ5A 1KDHA 1G15A 3V7JA 1PZNA 3EWAA 2A1JB 7ICSA 4I2CA 4I2BA 1LWFA 3NTUA 4E0DA 3T5LA 4K4GA 2C22A 2YKMA 1ASWA 1XHXA 4YG2A 3QLHA 1RCHA 4ELUA 4KITB 2IGIA 2NRZA 3V6HA 4I9LA 3GIMA 1RYRA 3U3YA 4CJ4A 3BJYA 4FLZA 4E7KA 4PHEA 5HP1A 3HYFA 1UAXA 4LH5A 4GC7A 3WNGA 2PYJA 4ICLA 1LV5A 4F5NA 5J2AA 3UQ2A 1LAVA 5J1EA 3RH6A 1U45A 4M9NA 3SI6A 3MXMA 7ICTA 2PFQA 3MAQA 4O4GA 1CXUA 1HYZA 8ICSA 2FLLA 1RDCA 2C2EA 4FVMA 2W9CA 4XIUA 3VQDA 1RNHA 2B5JA 4OVLA 3V6KA 4PA1A 1QE1A 3H4BA 4PHDA 8ICAA 2W9BA 1X9WA 4F2RA 4GLXA 4BE0A 3M8SA 1A5WA 1BPXA 4YFUA 4AHUA 1BPEA 1KLMA 3GFKB 2YV0X 3DOLA 4TSXA 2AGOA 5J0TA 1L3UA 4ECQA 3C1ZA 1ZETA 1VSEA 4JRQA 1RPLA 1CLQA 3LDSA 4I28A 1RDDA 3VA3A 4RW6A 4DU3A 1CZ9A 2XRIA 3L8BA 2VA3A 4K4IA 1GOAA 2D0CA 4CGDA 3K5MA 3KKSA 3DMJA 1BHLA 1UA1A 3KIOA 4CF9A 1KRPA 3VQBA 3VQCA 8ICNA 2UVVA 3QNOA 3ISNC 4FLTA 5HLFA 5J2KA 4FZZA 4Z4EA 3MDAA 3O3GA 9ICNA 5KFOA 1ZBUA 4IFYA 2VWKA 3GV5B 4O5KA 4KLJA 2QK9A 3V9UA 1IG9A 2XCPA 4DTPA 1RXWA 4Z6EA 1Z00A 4CIEA 5CA7A 4FO6A 1KSPA 5J2EA 1HRHA 2W9AA 3JPSA 1HMVA 3SV4A 4DG1A 5KFHA 5CYQA 3H8JA 2Z1GA 3QEBZ 1NK7A 4PWDA 3T5HA 4CF2A 3OYGA 9ICJA 1IKYA 2BDPA 3OYEA 1JLFA 2FC0A 3LAMA 1ZQOA 4NCBA 5D4BA 5IIMA 4EZ9A 2AJQA 5J0XA 4RG8A 2HVIA 2VG6A 3CQ8A 3K4GA 4J9PA 3OSNA 4BE1A 4CGIA 2R8HA 3ZDDA 4B08A 3NGIA 4BDPA 2GBZA 3ZSRA 3CFRA 1C0TA 1L3TA 3O3FA 1J5OA 2DFEA 3FFIA 4HUEA 3H08A 3M9NB 1T05A 4FJMA 4QZHA 9ICIA 1C0UA 3JPRA 4HTUA 4K4HA 4OPKA 2PI5A 3OS0A 3KD5E 1FXXA 3G6YA 4KO0A 4KKOA 9ICRA 3TABA 4DQIA 5J0WA 4O0IA 4RW9A 3L3UA 4EZ6A 5DB6A 1XS9D 3SPYA 4HYKA 9ICAA 3HJFA 4RW4A 2IA6A 2HHSA 4KTZA 4CJVA 4DL6A 4CEQA 5BOMA 4F4XA 4J9SA 1ZQZA 1NK0A 2F8TA 2AGQA 4UQGA 2R7YA 5KTQA 4YR2A 3ZT4A 4MF8A 2G8UA 4DWIA 4FM2A 5DMRA 4FBUA 4RQ2A 4IFVA 5L1KA 3AA4A 3PW7A 3NH1A 4DL7A 4QWBA 5DQIA 3AVBA 5KG2A 3D0PA 4Z6DA 3ISDA 1NK6A 5CB1A 2Q3SA 4ECTA 2JGUA 7ICEA 1TKTA 3O3HA 4YXMA 4RQ4A 4QZGA 1WCNA 4IBNA 4M04A 3RAXA 1RXVA 4Q8FA 2BGWA 5SWMA 3BQ1A 3CG7A 2I9GA 4OPJA 3ZDCA 1H38A 1D9DA 4M3YA 5KFJA 4DTMA 1ZQAA 1YT3A 4RT2A 4Z4GA 3RBEA 3NBPA 1WSFA 4KMUA 1SUQA 4FM0A 3QEVA 4PPXA 3M9MB 1Z26A 3TFSA 3QINA 3TFRA 2PXIA 5CYMA 2FMPA 2ITGA 2HB5A 1L3VA 3GV8B 7ICJA 1HJRA 3OYLA 1ZQCA 1TL3A 3E01A 4CJPA 3PMLA 1C0MA 4JWNA 1FKPA 4CECA 3HVTA 7ICVA 5C24A 3KHRA 4M9GA 3K5NA 3NF9A 5DDYA 3M9OB 7ICPA 4CERA 3MEEA 2A1JA 5IILA 5I3UA 4FW1A 5KFCA 3SUQA 3Q8KA 4PY5A 3JPNA 5CR0A 1ZQHA 4DTOA 2VWJA 4KLQA 5KG3A 3OJUA 2W8LA 4RQ0A 1JXEA 3SPZA 4RNNA 4LSLA 4J2EA 1VSMA 2HNZA 4Y1CA 3HO1A 8ICGA 3VQ6A 3ZDEA 2BR0A 4UAWA 4J9KA 4FJIA 5KG4A 4GXJA 1KFDA 3ZSWA 3KLEA 5L1IA 2YNHA 4X5VA 3L2VA 5J2CA 2G8KA 4UB4A 1B9DA 1RT4A 3EW9A 1U9LA 3RR8A 3OYCA 4FLUA 2W9MA 1ZQQA 4CK3A 4XUSA 9ICUA 3AO5A 1B92A 1ZQFA 5DKWA 3Q8LA 9ICXA 3ZDAA 3QZ8A 1RT2A 4IR1A 1ZQRA 4ID5A 4F92B 5CP2A 4EP4A 4FJLA 4UB5A 4OLBA 4AHSA 4DTRA 2HW3A 5J0OA 2YNIA 2I5JA 1IO2A 4TQRA 2PYLA 3ZSYA 4CFBA 1JLCA 1N56A 3DYAA 8ICXA 3ZSZA 1WN7A 2ASDA 1DTQA 2BKEA 1NOMA 3SV3A 4KN4A 3NDKA 3RJIA 2IDOA 4RPYA 3OHAA 4O3QA 3BDPA 3PMNA 3TI0A
chains in the Genus database with same CATH superfamily
2OH2A 3WXJA 1EHWA 2F8LA 2F65A 2CGLA 3HHDA 2L48A 3ISBA 2EBGA 4ZVOB 3GG1A 1QAJA 3CCTA 3PRBA 3NMAA 1EWRA 1LW0A 3OYDA 3AJ1A 3TX8A 3QRPA 1SV5B 3PJXA 1U09A 2PC6A 3LH2S 5DO2A 4A61A 4E2FB 2Y1IA 5ETQA 3MR2A 5B08A 4QU7A 3PSIA 1HQEB 4DMZA 1Q86T 1K9MO 1OH6A 3IG1B 2GMJA 3IO1A 4Y2IA 2HNYB 1BL3A 8ICCA 2I7PA 1SZPA 1FKAF 1HNXF 1HBNA 3ZT2A 2J8AA 2RVJA 1YQHA 3R97A 1G7CB 4IEIA 4L8RB 2BE9B 2ZD1A 3OXFA 1XEZA 2C2RA 1GEHA 3KXDA 4CO5A 5JMNA 3SBGA 1ASVA 1IKVB 3K0JA 1W7AA 3HMJG 4MFBB 4DU8A 1BWEA 3V6JA 1LQ9A 5DGBA 2ZJAA 2QA4N 5DM6Q 4IG0A 1RM6C 3RJKA 5B0EA 1Y4ZB 4LR9A 1ELOA 2F7TA 4BRPA 4FPBA 2LPEA 4BUGA 1WSIA 4FW2A 4D3HA 5DQHA 4FJ7A 4HL9A 1FFWB 3MPDA 1JLBA 2AP6A 3PX0A 2ZG6A 3AO2A 2D5RA 2XSJB 1D8ZA 4CFAA 4TU8A 5HQ8A 3UDLA 3SUNA 2MTLA 2E5LF 3ZX3A 2WFAA 2V2KA 2R7QA 3E51A 3BZKA 4OJGA 1GLDG 2Z1IA 1NI3A 3UKUA 2QB1A 4DSIA 4ECWA 1K8KB 1V9PA 3OFEA 3I0RB 2OWOA 1WC3A 2H3EB 5HO4A 2KZZA 1Q86O 4ECUA 2DNHA 3H3OB 2E5LJ 1UL3A 2BKOA 3M6XA 2BUPA 3POTB 2KXNB 3AOBA 1TFRA 4IQVA 2LYHA 1PO6A 1FRIA 2OD4A 1TMMA 2DFHA 3TJ9A 4ACOA 5JVHQ 1P9YA 3OD2A 3K75D 1RP5A 3PR5B 2J0XA 4OLAA 1MMLA 2YQ3A 3VAMA 2YTUA 1LK7A 2LA6A 5KG7A 1GQEA 3SCIE 4NXMJ 1E6YA 3JAMU 4Y2PA 4WZQA 5L9XA 1Q46A 2F77X 2IC3A 2V8GA 4UT4A 5FRMA 3FZBA 4WFBL 1ICEB 1A77A 3TU5A 3EXYA 1FVQA 2FB0A 4OIXA 3KK3B 1EIYB 4YY3F 4C8NA 5KFQA 1ZOTA 4PHAA 4M9JA 1XI1A 5HRSA 5C2FA 4QAGA 2M8DB 2EX3A 3HD2A 3VERA 2NCKL 3W0LA 4CFCA 4NLXA 4ZH4A 3CDUA 4XPEA 1U6ZA 3DN9A 4MFAA 4WFBQ 2YHYA 3HT3A 5ETKA 1VS3A 4Z4HA 2HOFA 1M1KO 1N34F 2FVPA 2NV3A 1BCOA 3B8AX 2GJFA 3VETA 4NEYA 2F3JA 4DCOB 1UMJA 4CCHA 1FRKA 4LBPA 2XO6A 1L3SA 2NLWA 1GXTA 3HT0A 4M41A 4PG7A 1T0TV 4HAIA 3D1HA 4Y0FA 3ENBA 9ICLA 2ALZA 2YMLA 3KHHA 1N34J 1HR0F 3M2RA 5EWGA 8ICLA 4ALZA 2R8IA 3V1RA 1SL0A 2YWWA 2ASMA 3O08A 1KN5A 3P4UB 5KFAA 4FYXB 1UPMB 1QCKA 1P7DA 4E98A 3VQ9A 2YWKA 1HWUA 4NL9C 2ISOA 4FZYA 3GCXP 1XIQA 1N36F 2IVPA 1JX4A 2QO3A 2RRNA 2AT1B 4KN7A 2D6FC 4H5RA 4IOAL 2ATCB 1BVSA 2HBZB 1EP4A 3NF7A 4DQSA 2K7KA 2RDIA 2UP1A 2P9UB 2XBPA 4OZJA 1N36J 4EBEA 5JRTA 3LF0A 4YOEA 2F8MA 2XWYA 5AFUH 4MFCA 3CJ2A 4CE9A 4L3QA 4DQQA 4CZJA 5KNIA 4M3XA 3N97B 4P52A 2RKIA 1Z05A 4CESA 3M8RA 1IWAA 1K5OA 4L3NA 3DRPB 1HIYA 2DPNA 3SQGB 3ILJA 4F5RA 5C10A 3CCMS 4JV2A 4I67A 4CO4A 5JS1A 5HN0A 3FSXA 1D8BA 4I2QA 4WE1B 2KKZA 1Y7PA 1COOA 4ZLLA 1RILA 5AXKA 5KT6A 4GXKA 3MDQA 1ZQTA 2DNMA 4M5GA 5D3GB 3PKYA 5J2PB 4U96A 3JSMA 5AK5A 4Q0BB 2EAPA 2KT5A 3JPTA 1T7PA 1WKKA 4E89A 1QJHA 3QXGA 4EK2A 4CO3A 2QLFB 3UXNA 1T44A 4CEAA 3ETOA 3R5DA 5KFSA 2RT3A 4BDZA 1LW2A 5EX3A 3L09A 4DR1K 5ALJA 2NO5A 1C1BB 2KVCA 4QPTA 4DV6K 1ZQXA 4F4KA 3PRDA 3R27A 4WTOB 5GAEI 1FF2A 5AI9A 4ZJQA 3N4PA 4PXEA 4FWOA 1QQ7A 4UARA 4Y2AA 1DGSA 2VWBA 4UBCA 1YBAA 5A76A 3T6BA 1RXOB 1CPZA 4I6MA 4LRAA 2LEBA 4CBWA 1VQ5S 3NF8A 4CZFA 1GT8A 4ZN1A 1JMTA 4FJHA 4F50A 1Q8IA 1RB0A 2Y1LB 2YKNB 4H4MB 3QYPA 4OJRA 3M6UA 5LJ3Y 3FQLA 3V1OA 4ECRA 3BZQA 2UXDK 5AJ3F 2PI4A 4ZS6A 3BSCA 3H42A 4CJTA 5AQVA 1KD1O 4FPRA 3ITHB 3NAIA 5IM0B 2HHVA 3HBTA 2KL8A 2V6AA 5IS2A 2KSOA 1Y0HA 4M5DA 1ZJNA 4NLUA 3BS5A 5AJ3J 1V6HA 4YB6A 1KFTA 4NLDA 4DR6F 4DV1J 4KREA 4B1UB 4PZVA 1U04A 5TKWA 2BXJA 2OPQB 2XI3A 1PSDA 2NSCA 3SDEA 3G71S 2VD3A 1Z1ZA 2YKOA 2VDHA 4DEZA 4A5BA 4YMOA 4ZA1A 3W63A 2K06A 2PGCA 1HBUA 1RBVA 1KAZA 2MMYA 2KG0A 4DR6J 3KK1B 1O03A 3LQVA 2HHQA 1TAMA 4ZIWA 3NGDA 2KVQE 1S99A 3C19A 1QHTA 4X62J 3BR9A 5J1NA 2EXUA 4FN5A 2K1RA 5FJ4A 3CJ7A 2IM0A 3V81A 3R5JB 3DM2A 2UUBK 2HEKA 2K2PA 4QIGA 3C7NA 2VQFF 2FBXA 3CCVN 1S79A 4WWSA 3UDEA 2KM8B 1MROB 4JI8K 2Y1RI 1TKXB 4PJ0U 4K0KJ 3A3OB 1XQIA 4YORA 3EMTA 2DNRA 4OGCA 2XY5A 1KONA 3VAKA 3DLGB 2VQFJ 3CSKA 3MECB 4U95A 4JHDA 4CD3A 2OCEA 4UB1A 2FXUA 2IYGA 1YI2S 3IUCA 3OTOF 4RQ6A 1IBLF 2R8JA 2ZDPA 2B5JB 4OHWA 2NREA 2BE2A 3I0SA 3J7YI 4L72B 5JU5A 2O6KA 3JPOA 7ICKA 1RABB 4OLOA 2ZXIA 3CC4S 4DV3F 2RE2A 4RQ8A 5C5JA 2G8FA 1IBLJ 1K0VA 2F1HA 3IG5A 3D1QA 2MZSA 4DFKA 5K5MA 4X64F 1NOYA 1SH0A 3OYBA 2W25A 4PR6A 2E1RA 1R59O 2QTDA 2X78A 3QETA 4FWQA 3GB0A 4DV3J 3UN3A 2UVWA 3FC4A 2QT7A 1CJVB 1X5OA 3CCJS 5AQKA 2A40A 3ZD9A 1O1WA 1QQ5A 2HNDB 3H0RB 4KGXB 2FPHX 1Z4OA 4X64J 3ENWA 1S97A 2KJ9A 3V4IA 3I1YA 3TQ1A 5T41A 4KLHA 3JB9k 2YX4A 3PVXA 2KYXA 5KFYA 4I2JA 1S9GB 3T9ZA 2ASLA 4IOXA 1Z00B 2KJ8A 1XWLA 3ZYYX 3Q7BA 2Q0UA 4DL5A 2B6AA 3OW2M 2NUHA 2K3IA 5AK6A 2J9EA 1LKYA 4KMOB 4E7HA 1JLQA 3LWLA 4K4SA 4ED3A 4KRFA 2N7CA 3UMBA 2W41A 1B64A 1CJKB 3A2FA 4O9MA 1G4CA 4UUXA 3CMES 3NNCA 1RTHA 3T19A 1ZQEA 2V8HA 2RN2A 2H5JB 4IJAA 2JNJA 1U02A 1E4GT 3D2NA 1IBKK 2P51A 1IXRA 1TKDA 4DFDA 3TJ8A 1NNEA 4USWA 3VTHA 4CNYA 3IBCB 4I6WA 3V6DA 4R64A 2F1JA 1JALA 4GC6A 1E6VA 3L9ZA 3QFPA 2ZE2A 4ZP7A 3O2IA 1QHAA 4KO0B 3W8GA 1WWVA 3ICLA 8ICWA 1WOOA 1SB6A 1C4CA 1NK5A 5AI6A 3JPPA 2BV3A 3P83D 4P6QA 1OVQA 2AEJA 2R7WA 4LSNA 1GLJO 4O3SA 2CPRA 3JTPA 1KOHA 1WBBA 2I6XA 3UN5A 3MN5A 3FBEA 2O1PA 2ZOMA 2Z2LA 3U27A 2A41A 1B9FA 1NSKL 2C3OA 3IFEA 1Z19A 3D45A 1QM9A 1ZQLA 4BQZA 4ZVUB 1N4LA 3TAGA 8ICTA 2BA9A 2QG9B 4J9VA 1WHWA 4KPYA 1RGVA 3EEQA 3K7RA 1J2MA 5AQTA 5KQ8A 4OHYA 4O3PA 2WF5A 4RW8B 2UUAF 1YVNA 2RILA 4CZKA 2ZXHA 3RB0A 1TKZA 3G87A 2P9SA 2RU3A 4RW7A 4A46A 2KMDA 1S7IA 5IIIA 4DQ8A 4URSA 2MSTA 2QA4G 2UUAJ 3OBIA 1VRUA 3N0VA 3LGNA 2EAMA 1U1LA 3VAGA 1UVNA 2XMAA 1SUQB 1RLCL 3AL0B 1Q5YA 1RZTA 1D09B 1PJ6A 3LPUA 3Q86A 1BI4A 1T02A 3EDRB 3UD5A 3RJJA 1T8EA 1RHUB 1F9FA 5KFKA 3GJRB 4PL8A 5KFWA 3HVWA 5F8LA 2WSEC 3IFRA 2DKOB 1JCEA 3CO0P 2MPUA 1N63A 1JMSA 4MEYA 4DV5K 4Q43A 2M88A 4DDFA 5LSOA 3C6AA 3D6RA 3P4IA 2VANA 1HWKA 4HHTA 3RAMA 2PO4A 3ZTQA 4JOUA 3KFWX 2NRTA 4KLLA 4GO5X 4YP3A 5FDLA 2WB1F 2LMIA 2PA3A 1K1QA 5E2QA 2IVOA 2VU5A 2X1AA 1EAYC 1O0PA 2XQCA 4OPHA 3C6UB 2A5XA 3F9KA 3O6QA 3D6FB 2SXLA 1X6JA 3LP2A 1UT8A 2ZUAA 1J2VA 2G8HA 3IG8A 2DB1A 1YJTA 2HPUA 3K2YA 1IJFB 2AQ0A 3M1YA 4N5SA 4YHHK 4BE2A 1J97A 1RFQA 4LF9F 1S1TA 3UNGC 1DT9A 5KFUA 1MN9A 4LRBA 4JI0J 3I8DA 1BWFO 4P72A 4B8CA 2B4VA 2XGPA 2LKYA 1E3MA 3OR2B 3C3LA 2HRYA 2HS0A 2IRUA 3OQ2A 3VGUA 4OQJA 3G82A 5D8HB 2F8HA 3FDSA 3O4NA 2NRXA 5J2IA 1UEVA 1WUDA 4LF9J 4UB8U 4DV0K 3DRXA 3MEDB 3TACB 4F4YA 3IN5A 1B70B 4JI3K 3BH7B 2CG4A 2KNJA 2E1EA 4V1Ak 1M90O 2VFVA 1XU4A 4DF4A 3HSJA 3QIPB 2ITMA 4JKDA 5E3CA 1NZPA 3RMAA 4WKYA 3CYMA 1HWIA 2DISA 2HOIA 3S41A 2M9NA 2V68A 3DRSB 5D6GA 3CXCM 4NY8A 1NGFA 1U0HB 4UTGA 4EELA 1ZBLA 5JJBA 3DLEA 3L2QA 3GIKA 4QZBA 4H03B 4KLUA 3TVKA 4DPXA 1HNZK 2B9EA 1UWBA 3HHNB 2EVZA 4FKXA 2W42A 3IMXA 2DNLA 3R6MA 1S0VA 4B3RK 4EO6A 2I0XA 3OTCA 3IR5B 3KNAA 4JV1A 4LF8K 3QFHA 3C95A 3NGYA 1F0MA 2FI1A 4DTJA 4USTA 5G0RA 5IV3A 2Z58B 5K14A 2F3NA 4WU2A 1EXQA 1XR6A 1NNDA 2YKPA 4DSKA 2Q3PA 1FJGK 4B9NA 3LP0A 3ZT3A 2QB0A 3TJAA 4KX5A 5AKXA 2QWRA 1FE4A 4E7IA 4Y2CA 3WXMB 4IG3A 3QUCA 5IIKA 1NG9A 4I2DA 1MA9B 4MYUA 4UATA 2XZWA 4NLVA 4KHYA 1T3QA 3GSIA 3B0YA 4R8UB 3T6JA 1VJQA 2A3VA 3OL8A 3IKMA 4I2PA 1B0PA 2BRKA 3U26A 5HATA 2VHGA 2O8DA 3DOKA 2XMUA 2MKSA 2C3UA 4PWWA 3SCXA 4OFZA 4CIOA 4XH1A 3UVJB 3ORYA 1OIAA 1TL1A 3E9OA 4BXOA 2DEJA 1ZD3A 3D6HB 2UUCK 4NCGA 1WF2A 3EE8A 1V85A 3D0GE 4Z4FA 1N52B 4HDGA 1RT1A 2QA2A 2OI2A 3NVYA 1MG7A 1CG2A 4Z7YA 1SB3C 3A3NB 2CJYB 5D0EA 1DTTA 1T3VA 2Y9HA 1WSJA 5T7LB 1ZXOA 2Z56B 1QQMA 4P2FA 2UZAA 4OYBA 3UXPA 3BKTA 3VC8A 4KYZA 3UKRB 3WUHA 3AA8A 1JLBB 2IY5B 2D0OA 2NNWA 3ZD8A 5ALMA 2YY3A 2OZSA 4M6WA 4C80A 3KNGA 4PABA 4DOBA 2HFNA 5ETLA 3D7EO 2RPIA 4I27A 2RHSB 4ISFA 2JLFA 1YBTA 2PMHA 4YNQA 2V69A 4TUPA 3P5JA 2O01C 3PHEA 2IOFA 4PYAA 2YTCA 3KLGA 1HNVB 1S1VA 2G9OA 3L4PA 4ED0A 2WMMA 1XR7A 3MCSA 3N4MB 1B7YB 3SJJA 4DX8H 4CF0A 3CTRA 3S6JA 2FUG9 4X4PA 5HMWA 1ZRMA 5ALSA 1NOZA 4M5JA 1X9SA 5J2MA 3S8SA 2YX6A 1CS4B 2VCPA 3VAJA 1EX4A 2RQ5A 3OTQA 3CCEN 3CB4A 1HBMA 4LH4A 5AQOA 3VWSA 1D8YA 3BN4A 1S8OA 4DKWA 3LANA 3AY9A 3UMGA 1T9VA 2B4UA 3EICA 1ZZNA 3QGIA 2YKMB 1RWXB 4LJXA 3SMVA 2HVZA 4I2IA 3F2KA 4P2MA 1N5WA 1J53A 5DG7A 2PY5A 1VGYA 4IZ9A 2XYPB 4KHQA 4X66K 4KAZA 4CK2A 4O0NA 3A3PB 3H2LA 1YJRA 5B0AA 3RU0A 3RMBA 1KTQA 1BU6O 4BR2A 3DKDA 5D0HA 1FDNA 3FLCO 3TWHA 2YKAA 4OMFG 4KHPF 4HH1A 2GAHC 3TAQA 1TGOA 4ZN3A 4J2BA 1HARA 2ATQA 3VEXA 3FZMA 4YD1A 3QGPA 4N7TA 4DQRA 4HTIA 3H20A 4KHPJ 2BZ2A 3MMJA 1U1RA 2ZTEA 2AZ1A 4OKKA 2K60A 1WHVA 1VHFA 1S6OA 2IJNA 4RWWA 1MWKA 2VFRA 4I7FA 2PSZA 4I6YA 5M1KA 4PQAA 1RHJB 1K44A 4OHXA 3HSCA 4RW6B 3KDNA 4CF8A 4WQ5C 4A2BA 4CHZA 2G8VA 2JZBA 4PRFA 2C2NA 3KBBA 1ZQKA 4N8OA 3THPA 1KKXA 2E66A 5GIOA 1BDGA 3QQCD 4JKGA 1IV8A 3D3BJ 3GJQB 1CRXA 3ONNA 1MU2A 3JS9A 1ZBSA 3NCRA 1GTEA 4MN4C 1UCVA 5HLFB 3TTDA 4FE3A 2GOLA 4RNHA 5ALIA 8ICFA 4H0TB 1VSJA 2IYIA 5L1LA 2PEHA 3A8KA 3IP4B 4CLWA 4DOCA 5H9EJ 5JS2A 1K8AO 2K4EA 3BBFA 3VHQA 1X4EA 1WC5A 2O5DA 4C4RA 3SSSA 5IOLA 2KXHA 2ZNZA 1IWGA 1HNIA 1RK8A 3VQ4A 4O5CA 1IBMK 4PWDB 2BKPA 4DV7K 3T1AA 3AHPA 3DI6A 3B78A 5AXMA 2N4DA 2C2OB 1XMOF 3FGUA 4J2AA 4NWIA 1ILYA 2RUGA 3IDWA 2W8KA 1TR0A 5C25A 5AIBA 2VBZA 2R8GA 2B51A 1A6LA 3N7RC 4BLGA 3NCPA 4C3KA 1RA7A 2BHNA 4MKVA 1NGCA 4BRFA 4DO9A 2QV6A 1F9EB 2ZGZA 1XMOJ 2B7CB 3Q8RB 3NRWA 5B0BA 4K25A 3DLHA 1RBOB 1X4AA 3C2LA 3M2UA 2H4WB 4CDIA 2O3DA 4PHPA 1RQLA 5TISU 1T03A 1LWCA 2ZBCA 5IWAK 2E9RX 4BACA 1BC6A 8ICOA 4KKOB 2HQFA 3HLUA 2WRMA 2ZUDA 3FZ2A 1ED1A 3QEXA 2FHMA 4LF7J 1SZ2A 2QI2A 1NRKA 3G6ES 4IRCA 1S0NA 2OTLS 4RW4B 2E1AA 2P6RA 1VQPN 4KR0B 2ZIXB 1BQNA 1JROA 4KLSA 4YN4A 1KLNA 2V2VA 4OYWA 2NS1B 4L3KA 3WIVA 4DXLA 1KQFB 4M3TA 4Y6IA 4JK9A 1C6VA 2Y1JA 3KMSA 4Q5VA 1Q7YO 3OYMA 3DRRA 4NASA 3JSRA 4K8ZA 4CBUA 2BJEA 2V2QA 3I55N 1SS6A 2NXNA 2DPIA 2YH1A 3PZPA 2KSOB 4M5DB 5C42A 2P9IA 2OKQA 5M2RA 4IRDA 1BUXA 1V3SA 2W2MP 3ZNUA 2ZUBA 4BQLA 9ICOA 5ALDA 3AVKA 1ZD4A 1TK5A 1YGYA 3MMBB 4CW7B 5AKEA 2DHXA 4ENOA 3R3LA 3WX4A 3EX7B 4PH5A 3KHGA 4W5NA 2IA0A 1UT5A 3TW0A 3G10A 4UUWA 2DR6A 3MI7X 3HVTB 1C1CA 5C24B 5D77A 2PFUA 3EZ5A 2F9WA 4MK8A 1G15A 3V7JA 4DCPB 2A1JB 4HACB 4ZDNA 3U1MA 4RTFD 2K1RB 2C22A 1ASWA 1XHXA 3CCQS 3QLHA 2QLBB 1NDKA 4KITB 3CXCR 2IGIA 2NRZA 1WKLA 1SXEA 3U3YA 2HNZB 4CJ4A 4DPWA 5AQLA 3L7PA 5CABA 1OSDA 4IXCA 3AY0A 1QVGR 3NG8A 3ET6A 4BREA 4F5NA 1CULA 3KLEB 3UQ2A 3WX8A 1LAVA 2VQEK 1SPBP 4Z37A 1GTHA 2DNZA 1BLUA 2BABA 1RT4B 1XK8A 3ZXWA 2BE2B 5ETTA 3O4WA 5C0YA 3UWTA 3VQDA 2NPFA 4Y3CA 4QR0A 3BH6B 3V6KA 4OVLA 1FX2A 4F02A 1U8WA 1RT2B 1QQNA 4RU2A 1F9HA 4ID5B 1X9WA 2WFBA 4YDUC 4YFUA 4OX9K 2JLGA 2YV0X 3FR0A 4FXWA 4TSXA 2AGOA 4RWXA 3MCPA 4FL9A 2EC2A 1RPLA 2CNLB 3TUPA 2W4DA 4DU3A 1CZ9A 2OELA 1GOAA 3DYAB 4CGDA 3K5MA 1U6FA 3HJVA 3AD8C 1KVIA 2HAFA 3KKSA 3DMJA 1V9OA 3MAAA 1KRPA 5FPEA 1F2GA 3V4IB 3MCOA 1X4CA 3HZGA 4FLTA 4FZZA 1HQ2A 3Q8VA 1ZBUA 4IFYA 3MN9A 1RG6A 2CUYA 4O5KA 2XCPA 4ES3A 3A0HU 2LQBA 1RXWA 1BWVA 3DNCA 5ALTA 2HFVA 2DUYA 4DUZF 3J80Y 1TL4A 1VIOA 4JD2B 3D66A 5J2EA 5CRXA 1G6BA 2QKQA 1HMVA 4NLQA 2K7JA 2KJVA 5CYQA 2CPEA 1R8AA 3T5HA 4CF2A 4DUZJ 9ICJA 4KC5A 4H4KA 3TAMB 4B1XB 4AL6A 3F2BA 1IKYA 3P6YC 1IKWB 2LQ9A 3LAMA 2HSZA 2AJQA 2CADA 2P9LA 3JQJA 4MIBA 4RG8A 2EQYA 2GV1A 5A8WA 3CQ8A 2RQKA 3ULHA 1S49A 4BE1A 1TP7A 2CAJA 2R8HA 2Q0RA 3NGIA 2GBZA 4X4VA 2G09A 2OIHA 5CD4H 2ABYA 2PMWA 2FJEB 4ZIVA 4BRQA 3D28A 4RBTA 3H08A 2P9KA 3IA0A 2IVFB 1ACMB 3JPRA 2KHQA 1AUSL 2G13A 2DNKA 3CDBA 2NZTA 3SAFA 3BBCA 2GGPA 1TL7B 1VQ5N 4QIWC 3TABA 1SV4A 5AI4A 4RW9A 3LPYA 4LSNB 3IBWA 4O3MA 2OHDA 3R8EA 3HJFA 5F0WA 2HHSA 3DGPB 1JUDA 4KTZA 4YOTA 4OO1J 3EVMA 2M5YA 1NK0A 2AGQA 1FERA 3D68A 1P27B 3GMGA 3SQIA 1JI7A 5DMRA 3PFEA 1IG8A 1D0EA 3PW7A 4LQ9A 4ICAA 3NH1A 3PEHA 5DQIA 3AVBA 3LTOA 4AXJA 4Z6DA 2BMBA 2JGUA 7ICEA 1QD1A 3UFCX 4ZJOA 4QZGA 1U7LA 2YNGB 4Q8FA 5HMZA 2Y8YA 4HT5A 3DHWC 3ZDCA 1H72C 4CD1A 1HIWA 1ZQAA 4PCQA 1HFEL 3E9PA 3O9TA 3I9V9 3VGMA 2KVSA 3O6WA 2CQBA 3CCWA 4OX6A 2KJWA 2I6WA 3QINA 1QUPA 2HVDA 5CYMA 3KJQB 2FMPA 5ETVA 2ZJPL 4BRGA 1L3VA 1SC3B 3OYLA 4JWNA 2MY8A 4CNZA 4CECA 1FD8A 2VIHA 2LHTA 2LA4A 3WIUA 4M9GA 5DDYA 1RAIB 4PL2A 3EUB2 2D3OR 1FEHA 1FT8A 1FO4A 2J9CA 4DR1F 3R1XA 5FDLB 1DFDA 2HSEB 1ESVA 3MURP 2R7UA 2J7UA 5ELZA 4RCHA 2YWFA 2QYGA 3W8PA 4DTOA 2VWJA 2V34A 1RHQB 2DNYA 4C3LA 3OJUA 4LFCK 3EKSA 3FKBA 3SPZA 4GVEA 2HGLA 1LWXA 1NZBA 3ZDEA 2QMWA 4DHYA 4FJIA 5KG4A 1TV6B 2QW9A 1VQSA 2ZH6A 3ZSWA 3HKZC 4IUFA 3AQOA 3CC4N 2DH9A 3L2VA 4OI4A 2J9DE 2XZTB 2Q79A 2ZC4A 2LM4A 1YHQN 5AQMA 4Y2XA 2UXDF 3I28A 3IRXB 3RVCA 4FLUA 2W9MA 2QLWA 1MMNA 3QJLA 3QBXA 1U1QA 3MEKA 3AO5A 3J81O 4XEIA 5F1XA 5LL6Z 1VQNN 5HVGA 1VC6A 3CCJN 3QAUA 2UXDJ 3DCAA 2HHPA 3LP1B 1S22A 4OLBA 4MJKA 3NVWA 2BANB 1Q81O 2HW3A 2I5JA 3TZZA 3QICA 2D9PA 1GFWB 3P49B 5ADXH 3ZSYA 4QS7A 3OPXA 3G86A 2YN4A 4K4YA 3D0HE 3FJ2A 3Q2SC 3ZSZA 5EX0A 4H0VB 5B8HA 1NOMA 4CJ7A 3NDKA 1MN7A 3RJIA 4O3QA 2XMTA 4OCZA 3TX0A 2H51B 4BGBA 4NLSA 5EVZA 2ZH5A 2IM1A 5K14B 4U9RA 3LDQA 3MMCA 2UUBF 3AD7C 1AROP 3QFWA 3ZTPA 2RAQA 4DL4A 5MAOA 4UB3A 1HPZA 4R66A 2NXJA 3SIPB 3A4TA 4JI8F 3LP0B 4MTPA 2P5OA 1RWWB 1SH3A 4QIWD 4K50A 3MDCA 2XMVA 3KLFB 2QN6B 5K8PA 4BR9A 2UUBJ 4NXMK 4KHWA 2VG7A 2JC1A 3TUJC 1N8RO 3TUIC 1JNZB 2EWSA 2AQ4A 2DCLA 4CNQA 4JI8J 1PC5A 3BGRA 2WVDA 4A8FA 4I2PB 3BUZB 3MEGB 1ITPA 2CJKA 1NKEA 3DOKB 4WK3A 3EZOA 4O3OA 3T69A 3VEOA 1NJIT 3EO3A 5HSPA 4WZMA 3AU6A 1YITN 4XRHA 4B3OA 1ZPVA 2RQCA 1Y9OA 2XG8A 4RQNA 2YBVA 4FWLA 4JKHA 1S9EA 4GMKA 2FJAB 1RQNA 3OBYA 3SR6A 2FJVA 3O1WA 4U7UK 1ZBTA 4QU6A 4RPXA 5K8MA 2CQ0A 4LVNP 3NVZA 3MXIA 3MGVA 2HOEA 2J7WA 4PPDA 4M5LA 3ISCA 5GAHU 4BGDA 8ATCB 4FS2A 4AHRA 3GZFA 5F9NA 5ALWA 1EXNA 1QH9A 5IIJA 1LWEB 1N61A 1TYQB 4QJVA 1NK4A 2EFGA 2I2YA 2QA4S 4FVUA 3A13A 2FD2A 2BJ1A 2XHBA 5IT9O 4B9LA 3NAEA 3H98A 1MQ2A 5FPNA 1GLEG 2GJ2A 4P0QA 4ECXA 7ICGA 1X66A 3U6FA 2FBVA 2ZWHA 5ALHA 3QIOA 3B6PA 2ZH8A 3IAYA 2OGUA 1WDTA 3C46A 4FVCA 1Z1VA 3OYIA 3CDEA 1SIJA 4O5FA 2I5HA 4BR4A 3PW5A 5J2MB 4DOAA 4X4OA 2A18A 4FXDA 4R63A 3EJMA 1R27B 4LY7A 3KWIA 1ZAWA 2DGQA 3BF3A 2H65B 2ACYA 3MWBA 1B43A 5KFIA 3RJHA 4RR5A 5AZIA 5AI0A 3KLHB 3HKZD 3TAPA 3G96A 1PVPA 2GHPA 4C48A 2FJDB 2H1YA 1IBKF 4JYAK 4F0KA 2F8SA 4DU4A 2OMLA 5HBMB 1WC1A 3WKCA 4NLNA 4IYQA 1FNMA 4C2MA 1ZD5A 3CJKB 3J81U 4FLVA 4YMMA 5GVQA 3H2VE 2HQCA 1AZSA 3J7ZO 4N56A 1IJJA 1IJEB 3H5YA 5EE1A 4NA3A 1IBKJ 2DPJA 2E8MA 1VYAA 3AN1A 4P71A 5EN1A 2A0FB 1KN6A 4WF9L 3I5BA 3K57A 3SQ2A 2AH5A 3W62A 3EYZA 1K6YA 4PL1A 4JMUA 2J6TA 3L2UA 1CZBA 5A0LA 1CQMA 3AA5X 1BPDA 4JV0A 2ZH7A 1Y97A 1Y64A 3GV7B 4G1QA 2QLXA 3CETA 4WPAA 3H7IA 4YDDB 2GEMA 5HOOA 3KOAA 5K8OA 3NGUA 1T9WA 3RF9A 5KG0A 4OKJA 2IAJA 1S6PB 4WTYA 3K1RB 1SXDA 2AX1A 4KH1B 4USUA 2U2FA 2ZBPA 2WVFA 1OS5A 4OJPA 2AMCB 4F4WA 3AO1A 1ZBHA 2K4PA 3OHRA 1WI8A 4Z4CA 4KT0C 2JZBB 5AQHA 4R25A 4M0AA 2B7BB 1F60B 2NUBA 3P39A 1BXNA 3IWLA 2WUSA 4BRDA 4XH4A 4JKGB 3EE3A 7ICIA 3UM9A 1YKWA 1X1PA 5D0RA 2XY6A 3LOUA 5JVGL 2M52A 2G0IA 3HULA 1V5IB 2OPSB 4B9TA 2YWGA 4ILGB 2CDQA 3HZEA 1PK1A 2D69A 3S7RA 2FZGB 3QUQA 3GFHA 2AXTU 5J2QA 4E7LA 3H8WA 5F0XA 1Q8BA 2LU2A 4JKCA 2UXCK 2CXYA 4J9MA 3GWCA 5KGWA 2IDEA 2XB2D 3EPGA 1SL1A 5JVGQ 2O8FA 1HNIB 4CLFA 2LXFA 4DR5J 4M3RA 3J8AA 2AEFA 1XR5A 4DV1K 3SEIA 2CNKB 2PEBA 3F5AA 5A2QY 1O13A 2VFTA 4LBHA 1S9FA 4IWVA 2ALYB 4H0YB 4K4WA 2VA2A 1WCLA 5C25B 3GYGA 2OUGA 2B3TB 3PSFA 1SV5A 2EG2A 4JKAA 4GV3A 2E1FA 1Y88A 1S1WA 1LOTB 3NEKA 3IG1A 4X62K 4YHHF 3M2UB 2FSKA 2E6MA 1NGGA 2H3QA 4CHPA 5KOWA 1X2IA 4QYZJ 2V2ZA 1EARA 2HNYA 4YR3A 1WSEA 5LMNK 5AE1A 4TYBA 2VJUA 2R4FA 4R65A 2LQJA 2RMLA 5KRTA 3DC2A 3HD1A 4ZCIA 3UMCA 1HI0P 5IT9U 4K0KK 4YHHJ 4JRPA 3SQ0A 5CR4A 4FBTA 2MKIA 3T5JA 4B3MK 3M8QA 2RSQA 4DV0F 1S7HA 3SSQA 1HWLA 3LPEA 3JS6A 4JI3F 1ZOLA 4ZPCA 3J7AP 3CF5L 2FJBB 4DS5A 4OI0A 2R2UA 5AKYA 4RQ7A 2EFQA 2E4LA 3QU4A 2IIHA 2V0NA 2MLYA 2MZTA 4CLKA 2W2PP 5L46A 4XH5A 3RMDA 1IKVA 1WDDA 4JI3J 4CGHA 8ICVA 3QZ7A 4MFBA 4DJBA 3MX5A 3DAWA 4DU7A 1U48A 1HNZF 1H3DA 4WYBA 2KJ5A 4KGKA 3CF5Q 4MH8A 1IN0A 2X1BA 2CPJA 4L73A 5AQGA 2LBOA 3ICXA 2FZKB 1LVHA 4B3RF 1RTDB 2W04A 4KLTA 4U6PA 4LF8F 3M3ZA 3V1QA 2ZH3A 1WOSA 5GADI 2JLEA 3L2RA 1HNZJ 1IH7A 1X4HA 2E5SA 4GXIA 4B3RJ 2GV9A 1UW4A 1KXPA 4MEXA 1K8KA 7ICMA 4LF8J 3K58A 1FFGB 3I0RA 3D6TB 2HZCA 3CJRA 2MKJA 1FJGF 3GFXA 3FYHA 1RLDA 4FPAA 2KHOA 3POTA 1WHXA 1KBRA 2Q66A 1RT5B 1PC4A 5EHHA 4BC2A 4WFNL 1VQON 1FJGJ 4FWRA 2PFNA 2JSXA 4JKBA 1AYEA 1ZD2P 2RDDA 4H5WA 4MDBA 2KLAA 5I42B 2D4WA 4AH9A 4J5OA 3VF4A 4Y2YA 1F6TA 3OT9A 1UCNA 5AI8A 5A8RB 4JEPA 2UUCF 4BWJA 1P9QC 1B3TA 4U7UD 1J54A 2X6SA 3KK3A 3N6MA 5BRDA 4KV8B 5EU7A 3BQTA 4TUSA 4QR1A 4QZEA 1T95A 5FLXO 1AT1B 2GWKA 2HBQB 3P5TL 3SNNA 2E9TA 2GWSA 2ZEJA 1JJCB 2UUCJ 2MQMA 4V19X 4P7TA 2FSJA 4Z4IA 4I64A 1IQZA 1VOMA 4NA1A 3CCVS 1NMEB 1W2IA 3CJ4A 3VEYA 2BKNA 3ULEA 8ICRA 4RQ5A 4WCEQ 5LSRA 4P74A 1HUXA 2BTFA 2NXCA 4OD0A 1H7XA 1RACB 3AB4B 3LGMA 3T41A 4UOGA 5LSLA 2VICA 1P8GA 4FPIA 3SQ1A 4Y00A 3ENVA 1UETA 5EE3A 5KG5A 2KT3A 3VESA 4F04B 4LZDA 5HNKA 2OPPB 4Q45A 5DBCA 4FP9A 1XMQK 2GMLA 2NRVA 4ECZA 4O5BA 1WB9A 2X6NA 5GMKa 2P5GA 4GW6A 1NO8A 2QJ3A 2BJ3A 2BW2A 3MPWA 4AL5A 1GLLO 5D46A 3CUNA 1M5SA 1JN3A 4KB7A 5CHGA 4HI1A 3NMRA 4FM1A 3QO9B 5AT1B 2ZJRQ 3DMJB 2HQDA 1K73O 5D4OA 3CCSS 2YMPA 2FLPA 4PQUA 2WONA 2Y9TA 1A5VA 2OXOA 8AT1B 5AKHA 5D49A 3AQFA 3CFPA 2WOMB 3OS1A 4B8AB 4CM2A 2KU7A 2EWHA 2P9UA 1KQKA 4E8UA 2LU1A 4UZBA 3AVAA 2C1EB 4ATNA 2ZWOA 2JFDA 3EXCX 1DLOB 2VGNA 3UDVA 1R0AB 4EX6A 5D78A 2PT0A 2H3FA 4YQWA 3JQMA 1WSGA 3I56S 1NDLA 4X66F 2Y0BB 3EGVA 5AM4A 2FJWA 4CEEA 3DLKB 5L8RC 4GMJB 2FPLA 3SQGA 1IKYB 3PIPQ 4J9QA 1I3OB 5KFPA 3C6HA 4F93B 5BREA 2Y8WA 4BR7A 4GVLA 3HCXA 3E2EA 4FKYA 4IO9L 4X66J 2KK0A 2XHCA 4WE1A 3QNNA 2PN6A 5LXYA 4BVOA 9ICWA 2GVDB 4OV6A 3BS9A 4N77A 5D3GA 2PBDA 3R6GB 5J2PA 2IDLA 4Q0BA 4YFKA 3ZEUB 3NOGA 3H1QA 3WK4A 4IO9Q 3GG4A 4GVBB 4W5OA 3GQCA 1HHTP 5KAFU 4OJOA 3I5CA 4LVSA 1UVMA 4PKGA 3NCQA 3C21A 4KE5A 4RW9B 2OYQA 2R42A 3UCUP 1C1BA 1QLNA 3W5XA 2ZHAA 2AGPA 4V19S 2YNFB 1MA7A 4FYDA 2BEFA 3BQ0A 4N76A 2HQIA 4P2SA 4CLUA 3D2FB 4JI0K 4UF4A 3OFGA 3OYJA 1RHRB 1X7VA 5BR8K 2ZM6F 4DS4A 4KLFA 2DIVA 2CYYA 1QAIA 3EPIA 1FNXH 1X40A 2KXFA 4H4MA 2YKNA 1V38A 3UE2A 4JN4A 8RUCA 1CC7A 1ZJMA 5HMMA 2QFIA 2ZM6J 1ZQWA 1YJ7A 1TU0B 4HI2A 3VAHA 3HSTB 3HW8A 4BDYA 3GJTB 2KIWA 3OTDA 1UPHA 1IBMF 4DV7F 4DF8A 3UQSA 5IM0A 4N8NA 2MJNA 5J0SA 3MWTA 3U1LA 1YIJN 2B43A 7ICNA 4FWSA 3MM9B 2AU0A 1RWVB 2Z30B 1YRXA 5EWFA 2H5IB 4UY8O 3CDWA 2Q6CA 4Y2VA 1DOQA 1IBMJ 1S4FA 5FLXU 3NF6A 4DV7J 4N41A 5AI5A 2LKZA 4G1IA 5CYMB 2JEFA 5BXIA 2ROGA 8ICMA 3CC2N 5DRKA 4KI4A 2OPQA 4CK1A 2FHJA 4A8YA 1XQSC 5MLCV 5FPMA 3I9ZA 3S9HA 4LVOP 3OBWA 4E19A 9ICHA 5IC4B 2HG4A 1Q0NA 2V4QA 3KK1A 4BWMA 3VA0A 5IWAF 1S5JA 2X3DA 4K5RA 5DG8A 1QVFM 2DEIA 1QZ5A 5ALXA 2IIRA 2BGGA 2GZOA 3QSIA 1JLGB 2L08A 3MR6A 4ZVFA 1GLBG 3PSTA 4DV4J 1RDRA 4ZHRB 4MIAA 7ICRA 2BJ7A 1HD0A 3VQ5A 1RTIB 5ALNA 5IWAJ 3TQEA 2A1SA 3O80A 1OMSA 4PAAA 1RWPB 2KZMA 1JJ4A 1OPZA 1HI8A 1EKEA 3UD4P 1TKXA 2PFOA 4CEZA 3N79A 3D67A 4Z6FA 3F2CA 3DLGA 2FPKA 3MECA 3U1NA 2IM2A 2CJ9A 2ZFHA 4DTXA 2WBNA 4LRFA 2ZJQQ 4RQ3A 9ICPA 2MZRA 3B6OA 1JCFA 1RA6A 4RWTA 4R0EA 4GKJJ 1J5EF 4Q44A 2FIUA 2AV5A 2WB1C 3NGKA 1N5TA 1C7YA 2EAOA 1QTNB 4NMLA 3B4DA 4QWEA 4C7QA 4B9UA 5ALVA 3E1YA 3TEGA 3BF1A 4B02A 2QL5B 2F4VK 3CJ8A 2VG5B 1J5EJ 4YOUA 3EGZA 3CCRN 3QJPA 1CUKA 1AFIA 4V19J 1KCFA 5DGAA 2A10A 2VBWA 2XLJA 2C28A 3AD9C 2MJUA 2MQ8A 1URJA 3P3DA 4LIWA 5GTHU 2CWKA 1X3NA 1CJTA 5GAGP 4I2EA 1M5KC 2A6AA 2HNDA 1HQUB 1ZC6A 3AVFA 4F0HA 1L7PA 4RNMA 3G6VA 4DSJA 2LYVA 2HRUA 1KEJA 3FC9A 3AOAA 3OVNA 1JK9B 2WAQF 4X4QA 1VQ7N 4Y28C 2R7RA 1S9GA 2ZIVB 3GR0A 2CDRB 2OD6A 2AYEA 4DZDA 3VOVA 2RF2B 2WZ1A 3PR4A 1KFSA 1JWWA 5ALLA 3AOCA 4JB3A 3HM9A 1GLFO 5HL7L 5KFTA 4MDAA 2BQRA 4UQTA 1C0GA 4OZLA 2AF6A 4YUDA 3SUPA 4TURA 4GV9A 4CEDA 2QRRA 2O4GA 2KI2A 4NCAA 1BQMB 2I7NA 2VQEF 2HURA 3DDNA 3LO3A 3NH0A 4Y2MA 2ZBQA 4CJEA 1EWQA 2F96A 5HL7Q 1CJKA 1YRUA 4USMA 3U4LA 4J9RA 3NH2A 4TUQA 2EFPA 1ATNA 1BNOA 1Q53A 2R2TA 4C6AA 3MHYA 4R5PB 1G99A 4O5EA 4TKTA 2DNOA 3HFVA 4NOHA 4R79A 3I8BA 1TK8A 2EK1A 3ZETA 2FBTA 4OX9F 1A0PA 1HEKA 4IR9A 1GMUA 2X7IA 2BQ3A 1YJVA 9ICSA 2GQ2A 2HMIB 4ED1A 4C11B 2W3SA 4F5OA 3JAMY 2V4JB 1VSLA 1QTMA 1W9HA 5B0GA 3RGIA 4OX9J 4DTNA 4KHPK 2XYGB 1MW7A 3WK6A 1T94A 5BOLA 3M6VA 2D1KA 5DETA 2P35A 1RZMA 4LC9B 1J27A 3OFHA 4ER8A 3UE5A 4A8SA 1R0BG 1R0CB 3CDAA 2WF9A 2IVYA 4CLYA 2OZMA 2MYFA 3HRDD 5CD4A 4IOCL 1SGGA 4FF1A 1MDUB 3MN6A 3V2UC 4C8MA 1WUAA 1IM4A 4CJKA 2JR5A 2CPXA 4C4WA 2MA1A 4GKKK 3K9KA 4RW8A 3MXJA 3KTQA 3NP5A 3ZC4A 1ZBIA 5J2FA 1B0VA 3BF4A 3AJ2A 1Q82O 3PYGA 4KB0A 1TTHB 1R8CA 1AUDA 4K4VA 2VA8A 3AMZA 4JI2F 3LK9A 2ZGYA 1C1AA 1D9FA 2DRBA 4NLBA 2DRDA 5B0FA 1S10A 4M2YA 1EKRA 4IEEA 1H2UX 3IDHA 3V9SA 3HSGA 2KV2A 4H0PA 2NYIA 4CHYA 2MXYA 2RJZA 2A1RA 1GAOA 4JI2J 2VKQA 4J90A 1KC8T 2XMJA 1D1UA 4BROA 2V9WA 1I39A 1N60A 5AQNA 3NL0A 4JBCA 3M6GA 2GHVC 4G1PA 3CCES 4WIQA 1UEUA 5HP1B 1H74A 1PJ5A 4XK8C 2NYHA 2HVHA 1NKBA 2WB1D 4C97A 4PEOA 5J1EB 2FMQA 2WTUA 1F0XA 3C14B 2RP5A 3EZUA 1Y5NB 3B82A 4QOZB 4FWKA 2G2OA 3EVOA 3IM9A 2CGJA 3C6UA 1RU2A 3MM7A 4I9QA 3CJ9A 4LSZB 2CZVC 2YB1A 4LREA 1QE1B 4K8RA 3QB0A 1XNQJ 4OPAA 3FM9A 1K9MT 1XHZA 3ZZ0A 3AO3A 2WHOA 2APOA 4CT8A 3CULA 4LF7K 2F40A 3DOLB 4RZRA 5DJBA 3OR2A 1IR2A 5BYSA 4NYFA 4QWDA 3IV6A 4A59A 5J8YC 5GAGU 3MEDA 1KVCA 1VK3A 1YK9A 1NAQA 4NZ7A 4FZVA 4CIFA 1SKRA 3ZSXA 3BQ2A 4OYPA 3K0SA 1MSWD 3RUBL 5F8IA 3QIPA 2HYIB 4F5QA 1X4GA 3W3DA 2ZUCA 3MGHA 5J2QB 3DRSA 1NZ8A 1W97L 1U0HA 3V4MA 2O8BB 4C7ZA 1VQ8S 2Z2ZA 3G8TA 5HQLA 5JMVA 2BH1A 3FSIA 3UR3C 2MLXA 3VQ7A 2O8FB 1WWUA 4ILRA 1N62A 3FEYB 4XQ8A 3IHQB 3F9MA 3THVA 4B1WB 1RQ0A 4I4BA 1YVFA 2FLOA 1JLFB 4I56A 3H6EA 3TWZA 1C20A 3MN7A 5KRSA 4LFCF 4IS7A 1WAJA 2G5HB 1S1WB 1TAUA 4YXJA 2AP1A 1QY7A 3TAEA 3PX4A 2ADCA 1VJWA 4ED2A 3KDOA 1RAHB 1RDWX 4GV6A 2JH7A 1UPPA 3W64A 1F2HA 2GA7A 4CRJA 2L9DA 1Q8LA 3WKDA 2HBRB 3MM8B 3A1YG 1TUYA 3AGRA 4LFCJ 2E6LA 2P1JA 4FWNA 4FLXA 1T05B 1VC0A 3NE6A 4R8UA 3RRHA 1NJYA 3A0BU 1RYUA 3G9CA 4FK2A 2XO7A 5ETSA 2ZTDA 1APSA 5E33A 1YX2A 4A8MP 3M8QB 5DM6L 1HX1A 3UVJA 2A3JA 5DQGA 9ICCA 1WOPA 2RE1A 4DV2K 5DDQC 2ZQBA 4O23A 2HZAA 4B3SJ 1RWNB 3QEPA 5GAHI 3VEZA 2MB0B 3MR7A 2MSSA 3HI0A 8ICHA 3GLJA 4ANCA 1N48A 4QYRA 4ES1A 2AW0A 2BJDA 1DQ9A 5T7LA 3MR3A 1KAXA 2CJAA 4IFVB 1NKCA 4MKAA 4MK9A 3M30A 2QGFB 3ALRA 1QVFR 4M3ZA 1T3OA 1VQPS 5GAEP 1COKA 3PHTA 1JNRB 3UKRA 1M1KT 2AA4A 2P9NB 1TKTB 3THWA 3SFGA 3D0IE 9ICEA 1SBRA 2JL9A 3A8IA 1VQ9N 4DR7K 3RG6A 3SCLE 3NY0A 5ETMA 4EENA 5JVHL 2AZ3A 1AW0A 2YX7A 1HNVA 4I29A 1Z3EB 2KKHA 3I55S 4DSLA 1J9AA 1HHQA 3THYB 3CIMA 1FRLA 3BREA 5F8GA 3F5EA 1U1PA 4NXMF 3IBFB 5HHIA 4CJ3A 2IVNA 4CDGA 1HLWA 2CZ9A 1BPBA 3RSEB 1YG0A 3K5PA 2RUSA 1P1LA 5E5NA 2DHHA 1CS4A 1KAYA 3KUHA 2HMXA 3ZZUA 3FVYA 4IDHA 3EWAA 7ICSA 5I3UB 4I2BA 3NTUA 2GVZB 4E0DA 3EL2A 4K4GA 2YKMA 4LFAK 4DUZK 4UOCA 4X4NA 3TUZC 4A4JA 3NNAA 4IOBA 4LSLB 3CJCA 3PCOB 1WACA 1FO1A 4NO7A 2D0PA 2CNNB 4GC7A 1YZ7A 2RS8A 1YZ6A 1V4SA 4KIAA 3RH6A 4NL9A 3MXMA 3VVTA 1TE2A 2MQPA 2BBEA 3ULEB 4PG6A 3OXLA 8ICSA 4M63C 4C9DA 1RDCA 4FVMA 2OTJS 5LJVA 3L4IA 2UXBK 4PA1A 3MM6B 3H4BA 4ZLJA 3HHKA 4R0JA 2WF8A 4GLXA 2F9DA 3GBTA 4AHUA 5F2RA 2E2OA 5J0TA 2YNIB 4WP3A 1L3KA 3J7YP 4I28A 3VA3A 3QYYA 4RW6A 2P9GA 1JLCB 2VBYA 3AAQA 3C28A 2VA3A 2D0CA 3GP9A 1VDVA 1FFUA 4WP9A 4CF9A 4PQUB 2HF4A 1M5OC 2WONB 3VQBA 8ICNA 5BN9A 3VQCA 3OLAA 2H54B 5A0YB 1W26A 5HLFA 3A8EA 5J2KA 3EWGA 5KFOA 2ILYA 1LFWA 4CLPA 2DR8A 1WEYA 2OMOA 2CJXB 3HILA 4JYAF 2PIIA 4NLWA 3PXGa 3T1YK 5BPLA 4UZCA 3GSDA 3R9KA 2D7SA 2CXEA 1HRHA 2W9AA 3M2VB 3JPSA 1PBUA 1NHVA 1X6IA 2GC8A 4DB3A 2E8NA 4PG5A 5KFHA 3IR6B 1RHKB 3WC2A 1NK7A 2DO4A 3T9NA 1QAXA 3I32A 2WC9A 4JYAJ 4F9OA 1Q95G 4PWDA 2Z4PA 1WORA 3TO8A 3OYGA 1KD1T 1HBOB 1S1XB 2FC0A 4NCBA 3WK5A 2DT9A 2E1CA 1SWVA 4FYYB 2H3GX 2LM1A 2A1BA 3DLJA 2DRAA 3ZSRA 3CFRA 2MRLA 1ZXIA 2K89A 1V4TA 5I4MA 1L3TA 2E1MC 4OI1A 1FDDA 5DDRC 1ATSA 2DCUB 2LMRA 3JTNA 3CD7A 2QMUB 4FYVB 3CT9A 9ICIA 2NPIA 1C0UA 1NBEB 3V5RA 4HTUA 4IL6U 2AJFE 2HBJA 2J8SA 4KKOA 5AKKA 4TNOA 3QU7A 9ICRA 2EFOA 1NGBA 3M8PB 4DQIA 3MMAB 5GAEU 1FW6A 4ZOSA 3L3UA 1VRTB 4EZ6A 4PG8A 2LQ8A 1WSRA 2ZKUA 1XS9D 3SPYA 4RW4A 3ELHA 3EM1A 3O1BA 3LDLA 1RWKB 1N54B 4K2JA 4CEQA 3KG1A 1ZQZA 2ZIXA 3CP8A 2R7YA 3Q7CA 2OAUA 4K43A 4JI6J 2OO4A 4MF8A 2G8UA 4Y2JA 4DWIA 2UXCF 4FM2A 3TVYA 4I69A 5AZJB 3KKAC 4RQ2A 2KB2A 3C16B 4DL7A 4ZCMA 4QWBA 4RLEA 1OJ4A 5KG2A 2YY6A 5ITHA 3ISDA 2Q3SA 5CB1A 4ECTA 4NZ6A 1XBWA 3LVWA 5EGYA 3O3HA 4OI2A 1NMNA 4YXMA 4RQ4A 4DV1F 1XTZA 1WCNA 2UXCJ 4ZJLA 2B9WA 3RAXA 2BGWA 1NHUA 3BQ1A 3CPEA 3BS7A 2I9GA 3D2EB 4M3YA 2FSNA 1NHKL 4ETZA 4RT2A 1J6ZA 2DR5A 3RBEA 3CJAA 1N5SA 3MMBA 3G8SA 3TFRA 2DGZA 3GV8B 3SK3A 1L8LA 5DZ7A 2HZVA 1R31A 4CVNE 4X62F 1TL3A 4CJPA 4FWMA 1C0MA 5CQGA 3HF5A 1LK5A 3VAFA 3QBWA 5L1MA 1S57A 5LMNF 3HVTA 5C24A 3OR1B 4Z2XA 3MF5A 3NF9A 1RAEB 4PUOB 4M94A 1AA1B 5KAIU 3ETMA 4CERA 3DHXA 1H2TZ 2WB4A 4CLZA 2A1JA 4K0KF 4HACA 4KX3A 2H48B 4FW1A 5KFCA 3R3TA 3SUQA 3Q8KA 4B3MF 4QNLA 2M2BA 5GTIU 2VC1A 2AIRB 5LMNJ 4KLQA 3K89A 2B4OA 1KP6A 1JXEA 4F0MA 1WNEA 3W2VB 1BG3A 1OYEA 2HNZA 1RWUA 4B3MJ 1KFDA 3AARA 1U1NA 3KLEA 2P9PB 1TUVA 1FHTA 4H5TA 2ZC3A 2G1DA 3OL9A 3Q24A 2HDOA 4JI4K 4UB4A 2WW4A 1RT4A 1U9LA 1UZDA 2W24A 4CZCA 3M8WA 1N33K 3W2WB 4CK3A 3P8BB 1B92A 2J76E 1YTYA 1O51A 9ICXA 5AE2A 1RT2A 3CIPA 1NM2A 4M5IA 3S6EA 3QIDA 4ID5A 2DNGA 2X1FA 1YHQS 3CCSN 4AHSA 4ES2A 1IO2A 3CD6S 1FEZA 3O5BA 4GY2B 5CZVA 2FF6A 4CFBA 4A62A 1VQNS 3MD1A 4OI6A 4BVPA 3DYAA 1RDFA 8ICXA 2ES6A 1CJTB 2P6SA 2YQ1A 3GFYA 1TMJA 2XLKA 3SV3A 1SC4B 1K47A 3DJCA 2LYAA 4CM0A 4MT1A 3OHAA 3I56N 2FDNA 2KG5A 3TI0A 2W2QP 5F8HA 3NLCA 2P6UA 5SZTA 3OXGA 1CJUB 2MKCA 2IRXA 4DR4K 1EETB 5BRFA 2BCUA 2Z7JA 1NCLA 2HOQA 3QSYB 4JD2A 4J8FA 3KG4A 7ICQA 2MGZB 2Z0GA 5AQQA 2B8QA 3GONA 1YJNS 3AVNA 3ALYA 3CRXA 1FWKA 3E8OA 3BO4A 1ECWA 4CGJA 3TAMA 2Y0SF 4HDHA 2HHTA 2LXUA 1IKWA 3M6KA 1LCUA 1T6DA 4CLSA 3AO4A 2VPZB 7ICUA 4ZMMA 4B1VA 4IO1A 3W66A 2HIYA 2KTQA 2ZHBA 3OYHA 4ZVQB 3HKWA 4PL7A 3VQ8A 3ZETB 3MR5A 2KDOA 3RJGA 4I1TA 4CFDA 1XMQF 2CPDA 5J0PA 3SZ2A 2HK2A 1SCJB 2BCVA 3PM9A 3OYAA 3BZCA 3U8XA 1NWKA 1YITS 2BCQA 1TL7A 4X2BA 3C94A 3C1YA 1U49A 4QJFB 2N3OA 1XMQJ 3MGIA 1R6VA 3HZ6A 4JI5K 4QBUA 4L75A 4CRXA 1D9AA 4QPXA 3CCLS 2OFHX 2JRZA 5F0UA 3DGPA 2KT2A 1RTJA 2VGMA 4MF2A 1L7OA 2RQMA 3FAHA 3LDAA 2VPYB 2KKVA 1FD2A 2DFFA 1N6QB 4EHUA 1KQSM 3IXQA 3H4DA 4LF4K 2ASYA 2O66A 3NVMA 4FJ9A 1I94K 3J7Z5 5ALQA 2ZH4A 1HJOA 2NRRA 4CLLA 4KH4A 5AICA 4U7BA 1QSLA 1F5AA 3UW1A 3N4WA 5IC6B 5ALGA 4RBVA 3HXMA 4CGGA 2YNGA 4KGMA 3VQAA 3CI5A 2DTJA 4O44B 1TFWA 3ULDA 3TA0A 5F41A 1BA1A 1S3XA 2F8KA 2W6LA 1OSCA 3F56A 3F73A 1GXUA 1X4DA 2VB6A 3RBXA 3TTFA 1M90T 1FK9B 4AHTA 3HPOA 4LT6A 4DR5K 3WNHA 2VKRA 4LMZA 5IQQA 4QW9A 1ZAVA 4AUKA 4CT9A 1Q79A 2D8CA 1VQYA 3DGVA 3VZIA 3CM6A 4ECSA 2CPHA 3DXMB 1VSKA 3KD3A 3UO0A 4CZHA 3PEJA 2JWLA 2MZQA 1ZQMA 1BQXA 3Q8YA 3NS6A 1NLVA 1JLEB 2ILZA 2PKEA 3TA1A 1IG6A 3M8YA 5HR6A 3MPUB 4NEZA 4FWPA 4M7YA 1I3AA 5B09A 1X9MA 2DR7A 4IC9A 1RDAA 1IIPA 4JI0F 4QYZK 1EB0A 3SXLA 3TR8A 2F5GA 3MM7B 5DLFA 2G0AA 5BR8F 4GVMA 3G0ZA 1TV6A 3VN5A 2OEMA 3C66A 5L39A 1LXJA 3PFOA 2DR9A 2IJFA 4FJGA 1QDUB 5KFNA 1UVKA 3KYLA 4OJ3A 5BR8J 3G6XA 3IRXA 4AHVA 3VF0B 3K8WA 1DXSA 4F67A 2A6OA 2QWPA 4XAKA 5THWA 1RT6B 2P2CB 2E29A 1RUSA 3H3NO 1Z6RA 3AU2A 5K8NA 3CQXA 2EC0A 3LP1A 1ZZFA 2FGOA 2BANA 1U0SA 4EEYA 5FRNA 2VFUA 3N01A 4LJMA 1HJPA 3PJWA 4FF2A 3WT0A 3M8ZA 1CZAN 3M32B 4OZ3A 1NU0A 4JNEA 2U1AA 3CC7S 1MMDA 3BDEA 4DPTA 4FZLA 4ZP9A 2HS3A 3JSBA 2GQCA 3IGNA 1NUEA 3AVMA 2B0GA 4KLIA 2ASPA 3KK2B 1HL6A 3AQPA 2A2CA 1V5VA 4KBOA 2OEHA 4ELTA 2XM3A 3QFUA 4YMNA 4FF4A 1A9NB 1ZM9A 5DB7A 1VQ4N 5E3RA 4TYAA 1QQOA 1JXLA 4GFJA 5KFMA 4CQ1A 2QLTA 4M47A 4NI2B 1OVYA 4Y0WA 1YVUA 3RR7A 3GIRA 2DH8A 2FJXA 4WYWA 3BKUA 5D15A 2B8PA 1PCAA 3KLFA 5BPMA 1ZQVA 1DQ8A 4KLOA 1Q7LB 4GIBA 2ZOFA 3MEGA 3NS7B 2GJIA 3O9UA 2QC3A 5HJYA 2HHWA 3C6TB 1N5VA 1F3FA 4QS9A 3LALA 4AYBF 5AR0A 3A5OC 1X5PA 3VAIA 1R8PA 3QPIA 2F4VF 1SQEA 4U7CA 1RWOB 2IVMA 4KFBB 2WBRA 5U47A 1NPPA 4C1NK 1RBLA 2ZH2A 2JDJA 3TARA 4BC4A 2FPMA 4H4OB 3WEEA 1S6QB 4KAIA 5AKGA 3PW2A 1RBSA 3W5YA 3T7ZA 4CEOA 1HA1A 3M30B 4OYAA 2F4VJ 4O8UA 3DEEA 2QX0A 2OPRA