1U45A

8oxoguanine at the pre-insertion site of the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u45A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u45A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u45A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u45A01
2ISPA 4B9SA 4OVLA 2I9GA 1ZQDA 3H4BA 1FK9A 4F4KA 4FJXA 2ITGA 1ZYQA 3PUFA 1S9GA 4M9JA 4ED6A 3VN5A 3V6DA 5IIIA 1ZQRA 2PXIA 2O4IA 4B8AB 1KVAA 4NXZA 2YKMA 5KFKA 1U9LA 1W0HA 3NE6A 3CYMA 3SV3A 1ZQPA 4DFMA 4YVZA 1KTQA 5DBAA 4RZRA 2W8LA 1UOCA 3KLFA 3ISBA 1BIZA 4QZ8A 3Q8QB 1L3TA 3ASMA 1HRHA 5KFYA 2HHQA 3PNCA 2BCVA 3HO1A 1RBSA 1WSIA 4BWMA 1T03A 3NH1A 2XY8A 3NF9A 5T7BA 3HX0A 4IFVA 4FJHA 1NOZA 4JRQA 2O4GA 4O3NA 3QETA 5I3UA 4DSEA 3EW9A 5J2EA 1TK0A 8ICKA 7ICIA 4M3RA 4DQPA 4FW1A 3RH6A 1SL1A 2PFQA 2Q3SA 3LP3A 4CHQA 1SZPA 1TFRA 4PA1A 4HUGA 1JLEA 2J6SA 4UAZA 4JK1A 4LSNA 4MQ3A 3IRXA 1WSEA 2YKNA 5BOLA 3HT3A 3K75D 4M3TA 3OYAA 4B08A 3T5JA 1D8LA 5CR0A 1RXVA 1RDBA 2HVHA 4DWIA 3OJUA 3UIQA 3C5FA 1EP4A 4N76A 4QCLA 3KLIA 4EYHB 3A2FA 3MAQA 1TVAA 4M0AA 4DFKA 4FM0A 2X6SA 4DF4A 3CM6A 5J2MA 3HM9A 4Z4GA 5KGXA 4XIUA 4FJ9A 2B5JA 3RMDA 5KFOA 1S9FA 4ECZA 4BDZA 4FK4A 4FK2A 4XA5A 1HNIA 4LSLA 3OYGA 1TAQA 4JV1A 3MEGA 4F4ZA 2KFZA 1ITGA 5K14A 4FLZA 1C0UA 2ALZA 4FLXA 1XHZA 4CF2A 4YD1A 4MFAA 4YCXA 1EKEA 1C1CA 4EYIB 5FRMA 3PY8A 3LK9A 4CEQA 1C0MA 3KLHA 5J2GA 4ZTJA 4XRHA 1RTDA 3H4DA 3Q8RB 3ZD9A 4LZGA 4JS5A 4M3YA 4PHEA 4CFDA 2BKEA 5J2DA 5C25A 1EXQA 5KFCA 5KG1A 4HHTA 5J0SA 3VQDA 3ORYA 4C8LA 4JV0A 2BANA 3QESA 3KLGA 5KFAA 2D5RA 1ZQZA 5CYQA 1BGXT 2VANA 1IO2A 1MQ3A 3UXNA 3S3OA 4K4GA 4E0DA 3O3HA 1NKCA 1S77D 9ICWA 4FM1A 3MGIA 2DTUA 5DQGA 4CFCA 4IRDA 4CIFA 2IS3A 1RDAA 3Q8PB 4KLEA 4FS2A 8ICGA 4XQ8A 5EU7A 2HB5A 4KTQA 2AQ4A 1ASVA 4P2HA 1HUZA 5CJ7A 3EZ5A 4Q8FA 4E7IA 3TR8A 3AVMA 4Q44A 3WNFA 3VQ9A 1BPBA 4W5OA 1D9FA 1TL1A 4W5TA 3JPNA 2UVRA 3AU2A 5KFNA 2XCPA 2B21A 2KTQA 1ZQSA 3G10A 3V7LA 2X6NA 1N6QA 2PFNA 4F93B 4QWBA 4B9TA 1S6PA 1JIHA 3LALA 3V1QA 3UXPA 5CYMA 2HNDA 3HP6A 4CJPA 4C8MA 4RQ2A 4RQ3A 4J9MA 4E7LA 5FRNA 1HMVA 4FXDA 1VK0A 4O0IA 3OYHA 2LSNA 3M9MB 3EWAA 3Q8MA 1BQMA 4KPYA 2UVWA 8ICRA 4I2IA 5J2AA 4ECQA 5F9LA 4PHPA 2ASJA 5DG9A 2FMPA 3DOKA 4LH5A 3GILA 4KLUA 1Y88A 4ELUA 4I2DA 1VSMA 3ZSOA 3HWTA 3LWMA 1U45A 1NK6A 1WCNA 4E89A 4F5RA 4PGYA 5KT7A 3V72A 2VG7A 1H38A 3VA3A 4IRCA 4LVSA 8ICSA 1S0MA 3EYZA 3PX0A 3HP9A 1ZQTA 1JLFA 2PYLA 3M8RA 4ELVA 7ICOA 2BR0A 3DOLA 1NK5A 1TK5A 4R8UB 4JLHA 5J0OA 2W9MA 8ICQA 3PMLA 1K6YA 2JGUA 2P1JA 3U3YA 1J54A 4ED8A 5KG4A 5CWRA 3OSNA 4Z6EA 3I8DA 1KLMA 4AHRA 1JKHA 3RAQA 5EWFA 5DB9A 4BE1A 1QQCA 5KFJA 3DM2A 5DK5A 4FLUA 3H40A 2HHVA 2WTFA 2YNIA 3NF6A 1NKEA 1X9SA 3CFRA 4E3SA 2P6UA 4XUSA 4RQ0A 2JEIA 5KFQA 2F96A 2XGPA 3NFAA 4QZGA 5SZTA 4YR2A 1RILA 3VQ4A 4QZHA 4PHDA 3MFHA 5J0WA 4FYDA 3AO5A 5KT5A 3C2LA 1NOYA 4DMNA 2C2RA 7ICMA 3OYFA 4I2JA 3OS2A 1C1BA 4DTRA 4M9HA 5HLFA 3JPPA 3C1ZA 3BGRA 4I9LA 3ETLA 3AV9A 2D0CA 2ZUDA 4LD0A 3K5NA 5KFZA 1LWFA 2PZSA 4E19A 3L2UA 4J2BA 4EZ9A 3S3MA 4J9QA 5IILA 8ICBA 4KN7A 3JYTA 1VSHA 2GBZA 4DU1A 4DO9A 3C23A 2IA6A 4CGIA 4PY5A 4CGDA 4IR9A 3JPRA 5JUMA 3V6HA 2KQ2A 1ASWA 3WNHA 3FYHA 4HUFA 1QTMA 1KRPA 4KLQA 2G8UA 4CHPA 4BACA 3RB3A 1T3NA 2R8HA 2JZBA 3ZSZA 5KFPA 2FBXA 3N97B 4O5BA 2XHBA 1FKOA 3I0RA 4CJQA 4CEBA 3PW2A 3VQAA 5DLGA 4DSJA 4FJ7A 4TQSA 3MABA 3MR5A 3L3UA 4PH5A 2KZ3A 1JMSA 2W9BB 4GXIA 4M9LA 4DL4A 1KDHA 4YXMA 3ISDA 4DU3A 1KLNA 1WAJA 5J2HA 3ZDEA 4NM1A 4K8ZA 5DBBA 5KTQA 3E2EA 9ICUA 5KG0A 4CJRA 3RJEA 3B0XA 2RPIA 4UAYA 3FFIA 1NJWA 2IDOA 2ZJ5A 4FO6A 4E1MA 4NCBA 7ICGA 4Q43A 2OZMA 4IQTA 1ZBHA 3ISNC 4GC6A 1TAUA 3QIPA 2KW4A 3ZSYA 5DGBA 4I2EA 4J2AA 4RUAA 4CJLA 4B3OA 2Q0ZX 2XY5A 4W5QA 3RAXA 1WNSA 4M42A 4M6WB 4DEZA 3OJSA 5DGAA 1NKBA 4DFPA 2G8KA 1RCHA 4M3UA 4UAWA 4CJEA 4H4MA 4O5KA 1B43A 1SKWA 1ZQFA 2GV9A 4CK1A 4KFBA 3BQ2A 1Q8IA 5DKWA 4MFBA 2IAJA 4CJUA 1VSLA 1S1WA 1A5VA 4H4OA 9ICQA 1EXNA 1WSHA 5KT2A 1K1QA 5J29A 4H8KA 3NAEA 1VRTA 2HW3A 1CXQA 3MFIA 1NK9A 4R8UA 3TFRA 1CUKA 2F1HA 7ICEA 4W5RA 3F73A 3CFPA 3OS1A 3QNNA 3VQ6A 2P51A 9ICCA 4KLOA 3QEIA 4QZ9A 5J0PA 1CEZA 4ECTA 5KG6A 4MEYA 5DB7A 3V1OA 5DG8A 2XO7A 4DOBA 1ZBFA 3NF8A 1C0TA 2BGGA 3HJFA 3GV5B 5DBCA 1NJXA 3ZT0A 3RJIA 1NK0A 1HUOA 4GVMA 3ZSRA 1XSNA 4TUPA 1ZBLA 3CFOA 3HK2A 1D9DA 4YR0A 3GIIA 1JLBA 3LPUA 2A1JB 3M8SA 4GLXA 2Z1GA 4KI4A 4NCAA 2BE2A 1RT5A 3EY1A 5J2NA 5FDLA 4O3OA 2ASLA 4YMMA 3VA0A 3P5JA 4DTJA 3DRSA 3AVKA 4O3QA 2G8VA 1V9PA 4YP3A 3SQ2A 4DTSA 1A76A 3AA2A 3ISCA 4RT2A 2BCRA 3SCXA 3SYZA 1AROP 3HYFA 1KSPA 3MR6A 3KHLA 4F5PA 3T1AA 2R7YA 4OKEA 5JS1A 3MEEA 1HNVA 2VG5A 4HTUA 1BQNA 4HCBA 3DRPA 3ZSWA 1ZQHA 1UT5A 5DB8A 3SI6A 3OYJA 4RQ5A 4OGEA 2F8TA 3MGHA 4DL2A 1Z00B 1JL2A 4DQRA 3KHHA 2ATLA 1SKSA 4O3SA 4AHVA 5KFFA 2ZD1A 2WOMA 3SUOA 5C24A 1S9EA 3B0YA 5L1IA 1IM4A 3KK3A 3MEDA 3U6FA 3NH2A 1ZQMA 3V7KA 3QNOA 4O55A 2DFEA 1KCFA 2ZQBA 2E6LA 4RPXA 1DTTA 4FJGA 4ECXA 1C7YA 8ICCA 3S3NA 5KFSA 1VSDA 2G8FA 5DMRA 1L3VA 3OS0A 4ID1A 2E4LA 3ZDBA 4CGJA 3DLEA 2W9AA 1NJZA 4GMJB 3RJHA 3C5GA 3V9XA 4J9OA 3MXMA 4DOCA 4M3XA 5KFDA 4O5EA 5BOMA 1B22A 3DYAA 2BGWA 4B8CA 3OSPA 1LWCA 3QERA 3TAEA 4FK0A 4N5SA 1DTQA 3V9ZA 5DLFA 1QE1A 8ICYA 4N56A 3IS9A 3O4NA 4G1QA 4NY8A 4FJJA 4Y1CA 2G8HA 5CHGA 4AHTA 5HMMA 4C8NA 3PW5A 7ICHA 3B6OA 4RQ1A 4ECVA 2FBTA 4CJKA 1JLGA 3HPOA 4L8RB 3H08A 3PR5B 1TVRA 4IG3A 1IKWA 1DGSA 5KFTA 3QEBZ 2FPMA 3SUQA 5DG7A 9ICRA 4K4IA 2ASDA 4ECSA 4HYKA 9ICEA 4B9MA 4GW6A 2ZJ8A 4QWAA 1SKRA 2FPLA 3KLEA 1B9FA 5KRSA 1XSLA 5KFMA 4NCGA 1GOAA 4KTWA 3LWLA 3NBPA 4FLYA 1S0VA 2BPCA 4MFFA 3B6PA 3ZSQA 4TQRA 1QSLA 4IQWA 2ZTCA 1S76D 4EP4A 4ZTFA 4YXJA 4ELTA 5HRNA 4QAGA 4TSXA 1MC8A 3OYBA 5CA7A 9ICHA 3G0ZA 4Q8EA 3OYEA 1ZQKA 3TI0A 2D0BA 4AHUA 2C2DA 2BCQA 4P4OA 2FMSA 1YTAA 4CGHA 4YN4A 4AHSA 4I2GA 4B9VA 4J9LA 1RNHA 4OKJA 5KFBA 2OPSA 4C8OA 3ZDDA 3Q8SB 3OYLA 2HNZA 4ECRA 1F21A 3SZ2A 3D45A 1LAVA 4DS5A 2J6TA 1ZBIA 7ICTA 3AVIA 3C6TA 2Z1JA 1HQUA 4UB4A 4CJ5A 4JV2A 1LV5A 5IIJA 5HROA 4X5VA 4PWDA 2NRTA 1D5AA 3BJYA 4ID5A 3TABA 3T5KA 4CJFA 5J2FA 2G8IA 1RTIA 1XSPA 1RZTA 8ICVA 1DLOA 3JPTA 4YFKA 4RT3A 2BDPA 3ZSVA 1BCMA 3FDSA 3PW7A 5KFIA 1ZQGA 2VA3A 5KT3A 2HHTA 3I0SA 1L3SA 3S9HA 3IHQB 4GXKA 3PVXA 5HRPA 2V9WA 1ZQCA 4DLGA 1IKYA 3LDAA 2OPRA 1BIUA 4FBUA 3T3FA 3SUPA 1RTHA 4R5PA 3UPQA 4OGCA 3SPYA 1BL3A 4Y1DA 8ICHA 1ZQAA 4DTPA 3TQ1A 3KKSA 3GDXA 4CF9A 2HMIA 4M04A 3HPGA 3QEVA 2ISOA 3VQ7A 4J2EA 3LDSA 3ITHA 1T05A 2NRVA 1B9DA 3JPSA 4R63A 5HP1A 1U04A 4CF8A 1CZBA 5DB6A 4OPJA 3NGDA 1XS9D 1RT1A 4RQ6A 4R64A 4AILC 4RNNA 4DL5A 3NH0A 4WE1A 4I2FA 3T5HA 2EX3A 3BQTA 4AH9A 2PFOA 1SL2A 4DSLA 4M41A 1EX4A 3PO4A 4PGQA 3DRRA 1KFDA 5J0XA 1WCLA 4Z0UA 7ICJA 1WSGA 1S0NA 3ZT1A 3GV8B 2ETJA 2EHGA 4MEXA 1CXUA 4KLJA 1NOMA 1RXWA 2DPIA 4EBCA 2IGIA 4NLGA 4CFAA 4ED2A 3AVFA 4ICLA 3NCIA 4RPYA 2IBKA 3LP0A 1RYRA 1K1SA 2ZUBA 5J2BA 4IQVA 4ECUA 3JSMA 4KN4A 3M8PA 3L8BA 1HQEA 4DL6A 3WNEA 1SL0A 2FC0A 3OYDA 1REVA 4KLDA 2IMWP 3SV4A 5HP4A 1SUQA 3GQCA 2YHBA 4KHSA 3ULDA 4IQUA 2R8JA 2PYJA 4BXOB 1BVSA 4J9NA 1IXRA 5BPCA 4I2AA 4JS4A 5EWEA 3VQQA 1KVCA 2ZE2A 1X9WA 8ICJA 2X74A 2BPGA 7ICLA 7ICNA 3AVLA 3PX4A 4O3RA 3KTQA 4E7KA 4FJMA 3OHAA 4O3PA 4K4HA 3CQ8A 1D8YA 3RB6A 1L5UA 2I5JA 4CF1A 2X78A 3LPTA 4TUQA 1ZQXA 4N41A 2FLLA 1TKXA 4F3OA 3KD5E 1UA1A 1TK8A 8ICAA 4UB1A 2W8KA 3TAMA 4OLAA 4W5NA 3V9WA 1J5OA 2RN2A 4HVJA 1LW0A 1Q9YA 4RQ8A 3QEXA 3TAQA 3AA3A 3RR7A 3K59A 5HMLA 1S0OA 1S1XA 3QIOA 4YG2A 8ICNA 3RMAA 7ICFA 2OPQA 4IBNA 4UQGA 2HHSA 4PPXA 4CEFA 1WAFA 5CZ2A 1LWEA 4KHWA 1X2IA 4CIEA 3C1YA 1Z26A 2VA2A 4CEOA 3NGIA 1KVBA 3VQBA 2P5OA 3RWUA 1S1TA 1WLJA 4I28A 4E7HA 3RBDA 4I27A 4GXJA 4JWNA 2R8KA 1ZJNA 4FJNA 3KD1E 9ICVA 5E41A 2F1JA 4DS4A 3K5MA 3O4QA 2ATQA 1NK8A 2QK9A 4QZAA 5KGWA 4KMUA 1HJRA 3G6XA 3MDAA 5J2JA 3SQ0A 4M47A 5C5JA 1CZ9A 4FJ8A 4BE2A 3AVGA 3V4IA 3ZCMA 3HSTB 3L2VA 3T19A 3C21A 3AO2A 2AJQA 3K58A 1J53A 3JPOA 1JL1A 5J0YA 4DQSA 4C8KA 3NDKA 4F5OA 4CHNA 4J9PA 4J9RA 1TKDA 1A77A 4DSKA 1XO1A 4DTMA 4UBCA 4DOAA 4Z4FA 1JLQA 4I2QA 4KLGA 4LH4A 1ZQQA 1B92A 1MU2A 3KJVA 4CERA 3OYMA 4KB1A 1S5JA 4Z4EA 2FBYA 2E6MA 2HVIA 5HRRA 1A5WA 3D0PA 5IINA 3G6VA 1EETA 2G8WA 3Q8KA 4IG0A 4PUOA 5KG7A 2DPJA 5KRTA 4KLSA 4CEZA 2YNFA 3AVJA 2ZJAA 1I39A 5KFGA 9ICXA 1ZQBA 4I29A 3OVNA 5DQHA 4QOZB 4DQIA 1S1VA 4UB5A 5CP2A 3RB0A 4M2YA 3IAYA 1COOA 4JWMA 3MDCA 3AVCA 3OYCA 4BGDA 3JPQA 2MAXA 4KLIA 1HYVA 1RBUA 5L1JA 4YQWA 3RR8A 2WONA 4CFBA 1RT7A 2OZSA 4DTXA 1KFTA 5J2QA 3Q8LA 1NJYA 2B6AA 3EPGA 3RH5A 3GIMA 2Y1IA 2RKIA 8ICOA 4AHCA 1N48A 9ICIA 8ICIA 5C42A 2PY5A 3L2QA 4TUSA 1UT8A 9ICMA 2Z1IA 1VSIA 2Z1HA 1BCOA 3BQ0A 4DTOA 1ZQOA 2XCAA 1RBTA 4PHAA 4MFCA 4CK3A 4KHUA 3LAKA 4YMOA 4RG8A 5KG2A 2AU0A 3VQPA 5J2PA 2W42A 4BDPA 4IRKA 1JX4A 4M45A 1RT6A 1BI4B 3MR2A 1WSFA 4EP5A 1A5XA 3CG7A 3LAMA 1RDDA 5KFHA 5KI6A 8ICPA 3DLHA 2KN7A 3V7JA 2HHXA 4Z4IA 4Q5VA 1N5YA 4UBBA 2C22A 5L1KA 8ICXA 4ECYA 2R8GA 3QEAZ 5D3GA 4KHQA 5F9NA 4F2RA 1ZJMA 4FLWA 4UB3A 5L1LA 3PW4A 1DOQA 1RT4A 3OYNA 2W9BA 3THVA 4DLEA 3MBYA 1ASUA 4ED1A 4CE9A 4DG1A 4QZDA 1NK4A 4O4GA 4ED0A 1WN7A 4FLTA 5KFWA 7ICUA 2MUTB 4CHYA 4CJSA 5J2KA 1UWBA 1BPDA 4QW9A 4K8XA 5L9XA 3H8SA 3NTUA 1YVUA 3HXMA 9ICJA 4F8RA 4O0JA 5D46A 2JEFA 3QEWA 3N4MB 2BCSA 4NLKA 4FW2A 4RU9A 2HHUA 7ICSA 2RDIA 4TURA 4O5CA 4KLFA 3L3VA 4RQ4A 1JN3A 2JEJA 2QXFA 4CJWA 4RNOA 2P66A 2HNYA 1U47A 1ZQYA 5IIOA 3M9OB 3HL8A 4RQ7A 1U4BA 2Y1JA 3V6JA 3MXJA 4F50A 1Z25A 3ALYA 3AU6A 1NK7A 2BQUA 4M6WA 9ICBA 3AO4A 1RT2A 4IKFA 4PGXA 4KREA 2ZTDA 3QE9Y 1HYZA 3SUNA 3PW0A 3HW8A 4NM2A 4F4XA 1C1AA 5TZVA 5J1EA 2JEGA 5KG3A 1TL3A 5DQIA 3PMNA 4CHZA 8ICMA 3KK2A 1RBVA 3C94A 4RW9A 4KTZA 5J0TA 1R0AA 4F5QA 1T7PA 3LANA 4F91B 1JLCA 4JUZA 2V4RA 1RT3A 5KFEA 1TGOA 3UQ0A 4DFJA 9ICAA 3QZ7A 4QW8A 4OKKA 2GUIA 1ZQUA 1MQ2A 3LP1A 2DY4A 4GC7A 2BHNA 2XY6A 3M9NB 2J6UA 5J0UA 1U49A 2UVVA 4QZEA 3RJGA 5J2CA 5IIKA 9ICPA 2W9CB 4O44A 1TKTA 4F92B 1ZQLA 3DLRA 3H8JA 3P1GA 3L2RA 3K5LA 1XWLA 3LZJA 3H8WA 2NRWA 4F2SA 3ZDCA 2A1SA 3MXIA 2XGQA 3GIJA 4J2DA 4EEYA 5HNKA 4KAZA 4ZHRA 1N56A 2IC3A 1ZQNA 2FPKA 3GFKB 3DLKA 1IH7A 1X1PA 1WSJA 3CM5A 3OHBA 4QZCA 5HHIA 4LZDA 2C2EA 1Z3EB 3OGUA 2KZZA 3QEPA 4IFYA 1BPXA 2C28A 3T5LA 9ICOA 5KT6A 1FKPA 2A1JA 4Z6CA 3P83D 4IR1A 3VQ5A 2BQ3A 4Q0BA 3AA4A 4BE0A 4DTNA 2I1QA 2JZBB 4NYNA 3LZIA 4DSIA 4CJ3A 2GWSA 2QKBA 5DDYA 2RDJA 4F4WA 1QSYA 5FROA 1CLQA 1TV6A 4DL7A 4QWEA 4M3WA 3GIKA 4HCCA 3L2WA 1LB2B 8ICFA 1T4GA 1LAWA 4CCHA 5CY4A 4FZZA 1RBRA 2V4QA 1YT3A 1ZQEA 1BI4A 3RMBA 2IOCA 1GOCA 3AVHA 1BISA 4KLMA 4I2HA 4P4MA 8ICLA 1VSJA 3ZT4A 4DL3A 2FMQA 3HVTA 4QWCA 3NF7A 3KHGA 4I7FA 5J0RA 4IDKA 4I2CA 5HRSA 2P6RA 1Z00A 3RB4A 5KFVA 3GV7B 4HUEA 4J9SA 1HJPA 4PQUA 4CK2A 1IKVA 3SPZA 5CZ1A 1UA0A 2HHWA 3ZT3A 3NGYA 2MUTA 2YNHA 2RF2A 1I3AA 4J9KA 3C6UA 3TWHA 1ZBUA 9ICNA 4RUCA 4CJTA 4YD2A 4FJ5A 3SQ4A 4NLNA 4DQQA 3AUOA 2VA8A 5KFRA 3RJJA 3V9SA 7ICPA 4YR3A 1RPLA 5CB1A 1BHLA 1S6QA 8ICEA 3U3GA 3VQEA 4B9LA 3QLHA 1KFSA 2YV0X 2PFPA 3ZSXA 1W9HA 4CIGA 1MSWD 4EZ6A 1ZQIA 3ZD8A 2NRXA 1JXEA 1QHTA 4E7JA 2F1IA 5J0QA 2ZUCA 1FXXA 8ICZA 2IHNA 4MF2A 1VSKA 3TAPA 2OA8A 3K57A 2BPFA 1XU4A 1QS4A 2OYQA 5EOZA 1RDCA 1S10A 1SV5A 3DLBA 3DLGA 4KB0A 2JLEA 2P5GA 3C2MA 4DU4A 3RMCA 9ICGA 2XRIA 4ED7A 2BCUA 4NLZA 1HPZA 4FCYA 1UAXA 5IIMA 4Z4HA 2B4JA 3V6KA 4OLBA 4E1NA 4CECA 4OPKA 5KG5A 3DMJA 2D0AA 9ICSA 5DDMA 2DFHA 4FVMA 3OY9A 7ICQA 4JRPA 3O3GA 3PX6A 4ZH4A 4QWDA 5SWMA 3AVBA 4CF0A 3LP2A 4DTUA 1O1WA 5D49A 4YNQA 3RTVA 4Z6FA 4G3IA 2VG6A 4R65A 4YFUA 2PI5A 3TARA 3AVAA 4EBDA 4I9QA 4ED3A 1S97A 2W9CA 1XI1A 5J2IA 2VWKA 4M3ZA 1C6VA 4F3TA 3C95A 3SI8A 3QZ8A 4KRFA 4CJVA 4RW7A 9ICKA 2BQRA 1JXLA 4F4YA 2FLNA 3ZDAA 4KHNA 3KHRA 4R66A 1BPZA 4B9UA 2NRZA 3AO3A 1VSEA 2XC9A 3SNNA 3AA5X 2QKKA 1Q9XA 1G15A 7ICVA 4FLVA 3C2KA 3RRHA 3V81A 4KI6A 4KO0A 4M9GA 4QZIA 4QZBA 1Y97A 4CEAA 4KITB 4FJLA 1TV9A 3M8QA 4FM2A 3UQ2A 1ZQJA 4Z4CA 4Z6DA 7ICKA 2FLPA 1XHXA 2NUBA 1QLNA 3VQ8A 4RNMA 5KFLA 8ICUA 4O9MA 3HVRA 1LW2A 2FBVA 4DSFA 1T8EA 4RW4A 4FZYA 4F5NA 1L3UA 4KLTA 2A1RA 3RJFA 3IG1A 4FZXC 3NGZA 5HBMA 3NHGA 2AGPA 1GOBA 4QZFA 3E01A 3K2PA 3AO1A 3RBEA 4FJKA 3PV8A 4KLLA 3WNGA 4CESA 3UXOA 1BPEA 1JLAA 5HHHA 3DI6A 2AQ0A 4CJ4A 3H7IA 3TAFA 3AVNA 5I42A 3K4GA 8ICWA 3V9UA 2VWJA 1RTJA 5KFXA 4DF8A 3PR4A 5D4BA 3G6YA 8ICTA 4RW6A 1VSFA 5EWGA 3SQ1A 1U48A 1TKZA 3KIOA 4B9NA 1RYSA 2YHAA 3OYIA 4EBEA 5KFUA 3BQ1A 3KKRA 4RW8A 4CEDA 3RRGA 3SJJA 4YMNA 1IG9A 4KKOA 2F8SA 2R8IA 2ZTEA 3K5OA 3MR3A 3PO5A 4RPZA 2DFFA 2AGOA 3O3FA 9ICLA 2PI4A 4I2BA 4CEEA 4CGGA 4N47A 2AGQA 2OPPA 3BDPA 3QO9A 1YTUA 4FJIA 1ZETA 4FS1A 5KT4A 4UB2A 4M9NA 4CHOA 1KEJA 3HPHA 4P4PA 3RH4A 1HYSA 1QSSA 4BWJA 2XY7A 3RJKA 4Q45A 4LY7A 5JS2A 2H5XA 7ICRA 2OWOA 4CGFA 3OYKA 1JXBA 2KZMA 1S1UA 3V1RA 4NYFA 4KLHA 3F9KA 1BPYA 1ZQWA 3QINA 2LYHA 1IKXA 4KV8A 1PZNA 1VRUA 3MECA 1X9MA 3VQCA 4ECWA 4I2PA 4OJRA 4KHYA 3IM1A 3KK1A 4BXOA 2YNGA 2KFNA 3ZT2A 4FBTA 3TFSA 4MF8A 3TANA 2UVUA 3TAGA 1XC9A 9ICTA 4BDYA 1ZQVA 2IHMA 3EPIA 1J9AA 2DFLA 2M9NA 9ICFA
chains in the Genus database with same CATH superfamily
3CETA 1WC6A 5AQGA 1N5XA 1ZQDA 3H4BA 3S7RA 2ZIVA 2E9RX 3DXKB 4FJXA 1ZYQA 3QUTA 1S9GA 3KNAA 3D7EO 3D6TB 3WC0A 1J5EK 1N6QB 3O44A 1KL9A 1KVAA 1IBKK 2Y9TA 2C3PA 1PVPA 5KFKA 3OL6A 1DLOB 4URGA 1YBAA 1S5ZA 2FLOA 2OP5A 1KTQA 4JKEA 5CYMB 1UOCA 3I56S 1SKUB 4LFCK 1BIZA 3ASMA 2X7IA 3HO1A 3C14A 2BV3A 4ANDA 4BWMA 1T03A 3B4MA 2PKEA 3NH1A 2FHMA 5DJBA 5ALKA 5K5MA 3VOVA 5T7BA 4NL5A 2C3YA 4JRQA 3QETA 3EW9A 4M3RA 3G6ES 4P0QA 2XLKA 1VJQA 1RWOB 2PFQA 4G9BA 3KMQA 3LP3A 2GHVC 3AL0B 4B3TF 4CHQA 1TFRA 4PA1A 4DJBA 1SH2A 2P9UA 2CJAA 4JV5J 4ZP7A 4MQ3A 2A5XA 3BR9A 1NSPA 5BOLA 3HT3A 1OIAA 1Q7YT 1AZSB 4BVPA 3N9UC 4XAKA 1OH5A 2V7YA 4IO9Q 3GU0A 3QMLA 3E3XA 1PJ5A 1SV0C 3ENOA 4N76A 2GS8A 3MCOA 3EUNA 2K4PA 4P9SA 4EYHB 1SH0A 4NLTA 1XN9A 3MAQA 4M0AA 4DFKA 2GW8A 2K7JA 4FM0A 1FX2A 2X6SA 2R3VA 4LR9A 2N7CA 3HM9A 3ZEUB 5KGXA 5DM6L 3RMDA 4ECZA 4BCAA 4BDZA 4ETXA 1HNIA 2FHOB 3NGSA 3MEGA 2KE7A 1WHXA 4F4ZA 5ALHA 5K14A 2IJNA 4DR4K 4OI4A 1C0UA 2E1EA 2IDEA 5HR6A 4YD1A 4MFAA 4YCXA 4EI2A 1C1CA 4EYIB 1KP6A 1B0VA 4GO7X 2DHAA 4P72A 1HQ2A 1B4FA 1ZD4A 4LF8K 1I5OB 1Q8LA 2GHPA 4MYTA 1M90T 1OW5A 3TA1A 1KD1O 5G4DA 4DPOA 2QWRA 1C1BB 5AZIA 4LZGA 4M3YA 4PHEA 1LFPA 2KSOB 4FWKA 2BKEA 1BWFO 5C25A 1EXQA 1OPZA 4DU8A 3VEWA 1VQLS 2HBMA 3QESA 3B8AX 5CYQA 4DZ6A 3EZWA 1IO2A 1S3XA 4KPCA 4K4GA 3DKDA 5IWAJ 2ZWHA 2J9DA 3EKUA 4FM1A 3QXGA 1UJ6A 2EFGA 4IRDA 3KUHA 4CO2A 3Q8PB 1W2BR 2E5LK 2F2AB 3QFUA 4BGBA 4M95A 1COKA 1ASVA 4DV3J 4DUYJ 3HTVA 4ZVTB 5CJ7A 3EZ5A 3TAMB 4Q44A 2XSJA 3IWNC 1JRPA 3VQ9A 6FDRA 3Q7BA 3WNFA 4PXCA 1TL1A 4W5TA 1U6BA 3IKMA 3IO1A 2KH9A 2B21A 2KTQA 3H45C 1ZQSA 3VGMA 3PM9A 3V7LA 1XMQF 3BBCA 4S0MA 1MWQA 3J7YP 5ALRA 4B9TA 1S6PA 1M1KO 2V50A 4CE6A 3V1QA 1VGYA 2HNDA 3I5CA 4PG7A 4WU3A 4YUDA 4WFXA 1RCOB 3SDEB 2G06A 4E7LA 3TSPA 2LA4A 1HMVA 3PNIA 1P9QC 2CQIA 3QIPB 2A2DA 4B3OB 1X5SA 3M9MB 1WHVA 5LSRA 1RI7A 5C2GA 4AF1A 1TUYA 4BRNA 4ENOA 3THXB 2G13A 1Y88A 4Y2SA 4TU8A 3P3DA 3ZSOA 2PMZF 2KVCA 1DQAA 4DR1F 1YTYA 3WKBA 4FOEA 4I2QB 3WK9A 4K0KJ 2ZEJA 2DGSA 4LF5F 4MFBB 3T1HF 3OXLA 4ILHA 4IRCA 1IIPA 2FC9A 4LVSA 4AXIA 3HP9A 1IR1A 3T1YJ 2LYVA 4ELVA 2P6SA 3EM1A 3DOLA 3B9JA 2GJ2A 1AYEA 2W9MA 1YI2S 1K6YA 2IOFA 1DBDA 4ED8A 1J54A 2YB1A 3OSNA 3CHWA 2ES6A 1JKHA 3GONA 5AM2A 3RAQA 2JMGA 5EWFA 1OO0B 1HKBA 2EXUA 4X65K 3DM2A 5ALXA 4X4UA 3EDQB 3RSEA 1X9SA 4X62J 4XTTA 5JXSA 3CFRA 2VPYB 4RQ0A 1JWWA 4HAIA 2UUAF 3BV8A 2O8EA 5SZTA 4HTJA 5AKHA 3EXCX 4QZHA 2R2SA 1N5VA 3EN9A 4KE5A 1N8RT 3BS5B 1MN7A 4DV2J 1WWUA 2ZIWB 1X8DA 5KT5A 3FCHA 3C2LA 4DMNA 2C2RA 1LXNA 3S6EA 3MMCB 4JI2J 3CGIA 4HL9A 3R9LA 4I9LA 3ETLA 4L75A 3AY9A 2DNKA 3K5NA 3MTJA 5ALNA 1Y5LB 4U67Q 4E19A 3ZZZA 8ICBA 1YQHA 3L7PA 2YPZA 2GBZA 4PYAA 4DU1A 2HFNA 2ABYA 2HFSA 4DR3J 2QLJB 3VF4A 1ZRMA 3V6HA 3U7JA 2RHKA 4HUFA 1QTMA 5H1SQ 2XNRA 1BQNB 4IOAQ 2P9EA 4BACA 1EQ0A 4QS8A 2JZBA 4NMXA 4CM0A 1EHWA 5BR9A 2XMWA 4ZVEA 4CJQA 4O8KA 4WPAA 3I9V9 3PW2A 1KONA 2F63A 1B3TA 2F8KA 3I5AA 1QY7A 2PA3A 3O9RA 4N8NA 1JMSA 1CI4A 1GO3F 4CH7A 4DR5F 4MT1A 4YXMA 3ISDA 2ZD1B 5ETQA 3VQSA 1O0PA 3J7ZT 3FAHA 2MKCA 2WZ1A 3ULHA 4K8ZA 3Q2TC 3M6KA 1F3FA 3J81O 1WTFA 2MKKA 1G1XA 3B0XA 1M1HA 3FFIA 4I56A 2ZJ5A 1Q95G 1VQ6N 4ICAA 4IC9A 2AV5A 1IBKF 2OZMA 3BKFA 3G71N 5C2FA 3ISNC 3ZX2A 1HW8A 1TAUA 4A2BA 2KW4A 3ZSYA 5DGBA 4RUAA 4LRBA 1P90A 1PJ6A 3C65A 4LFCF 1NH7A 1DTQB 1FRKA 3RAXA 3FZHA 4M42A 5JVHL 1D09B 3T41A 3M6UA 1RT2B 3CD6S 5DGAA 1K73T 4LF4J 1RCHA 4M3UA 1UHUA 4EFAC 2HOEA 3NUQA 1KNZA 3PSTA 1HHSA 2JWLA 2XQCA 2QA1A 1CJVA 3D0GE 3Q8YA 5B09A 3ZYYX 5DKWA 2IAJA 4MIWA 1SV0A 2JXJA 9ATCB 4P2SA 1X4HA 4NLPA 1VRTA 2VQEF 3BYRA 4HACB 3LP1B 3OTOJ 4LF9K 4R8UA 3TFRA 4TVAB 3FZMA 2WBNA 7ICEA 4W5RA 2GUPA 3CFPA 4M8LA 2R7RA 1XERA 2CPEA 4C0OC 9ICCA 3F56A 2N82B 2Y0SF 3VF6A 1EKRA 2HBZB 5HN0A 2CH5A 3JQKA 3IDHA 3BO3A 3FK4A 5KG6A 1QZ6A 2A3JA 5DG8A 2IRXA 1SJ4P 3HULA 3NF8A 1BNOA 2P8IA 4WXWA 3GV5B 4DV5F 1XQSC 4BC7A 1NK0A 3CIZA 5LSLA 4A5AA 2OPSB 1TYQB 3ZSRA 3ZTPA 3OV7A 5HL7L 1XSNA 4TUPA 3PRBA 3WKAA 1D9DA 3L95X 2D8CA 2HNZB 4YR0A 5JJBA 4J7CA 5GAHU 3E1YA 1OJ4A 1JLBA 2HKEA 1FKPB 5IQ6A 1CVJA 3MM6A 3EE9A 3C19A 4P75A 2F77X 2OAUA 3SQOP 1RT5A 2ZIUB 5AE2A 3BH6B 5FDLA 2ASLA 3JAMU 4BC5A 1XO0A 4OYZA 3P5JA 3CCEN 1V9PA 4YP3A 4OPHA 4RT2A 1RTIB 1GTHA 1R3NA 3ILOA 2Q1NA 1NSAA 5BRFA 2DR5A 2I8EA 2R7YA 1PK3A 5LSOA 2K4IA 3MEEA 1HNVA 2VG5A 4HTUA 1WKKA 4NA2A 2WCXA 3JAMY 4OX7A 3BQ7A 1UT5A 3QJJA 4K43A 4MO4A 4GKKF 4U7UD 5AQTA 4OGEA 3MGHA 2OPRB 1HI0P 4DL2A 3OPXA 3CJTA 1GLDG 4R5PB 2O1PA 1JL2A 1JCEA 1M5KC 2OD4A 1SKSA 4ETZA 5BXIA 1KEKA 5JLHA 1RAOA 2EFPA 5C24A 4BRMA 1S9EA 2RF2B 1IM4A 3T9ZA 1YVFA 2YQ3A 4A8MP 1ZTTA 5FPNA 1Q8KA 3CCUS 4NZ0A 2H3QA 1RWMB 4P7VA 4RPXA 1F1BB 5DRKA 8ICCA 3CCSS 3M05A 1DGKN 3OS0A 2OYYA 4ID1A 4CGJA 3DLEA 1RYUA 3UKRA 2W9AA 4GMJB 4A2AA 4J9OA 4O5EA 3PDNA 3RVCA 2KIVA 4XPEA 3SMVA 3CC2N 1AUSL 5ELZA 3SAFA 3IBWA 1XR7A 3L6QA 4Y2YA 4G1QA 4FJJA 2G8HA 3PYEA 3RU0A 5K8OA 2C3OA 3QRPA 3CO0P 3WK7A 2RVJA 3HPOA 4NOHA 3PR5B 1IKWA 2F4VK 2YQ0A 1VHFA 3QEBZ 5DG7A 1YJVA 2IJRA 3C29A 1ZS6A 3CT9A 2OFGX 4OHYA 1MMDA 2CH6A 4DR7J 3A8KA 2IPOB 5KFMA 3NRBA 1SUQB 1LNQA 4KTWA 3LWLA 1S0VA 4PZOA 1Y7PA 4TQRA 5HVFA 3B8HA 2C2ZB 2OIHA 5AKGA 5CRXA 4ELTA 4JI1K 2K8GA 2R7OA 2MKHA 2V4JA 3HOTA 4UOFA 4ED5A 3NOCA 3OBYA 2D0BA 5AQIA 4AHUA 4L74A 3OFFA 4P4OA 2FMSA 3GJQB 2ZKUA 1QUPA 2I38A 4YN4A 1U0HA 3K0SA 4X4TA 4K50A 4UOGA 2LM4A 3NGKA 4J9LA 4X66K 3NRWA 2CPXA 2GZOA 4JKAA 5EGYA 1Q7YO 3ZDDA 4LR8A 4C7ZA 3OYLA 3VAJA 4KC5A 3D45A 1LAVA 1VQNN 3D28A 3R9PA 3AVIA 2DR9A 2E88A 3H46O 1J5OB 1T9XA 4UB4A 2WW8A 2MQMA 2ZBCA 2E5JA 3MMAB 3HFZB 3TWZA 3BSNA 4JV2A 1RFQA 3NGRA 3CMAN 2W43A 1MLAA 1D5AA 1LW2B 4ZVPB 4ID5A 3IM8A 3PXGa 7AT1B 1DEJA 4PRFA 1KVKA 1RZTA 1Y0HA 5IC6B 4YFKA 4CD3A 2BDPA 2K4EA 5A2QO 3JTOA 3NVKA 1NDCA 4ZVSB 1X4BA 3KDNA 3FDSA 4P7TA 1UCVA 3GBTA 3OPKA 2UXBK 3W2VB 5CA5A 4GXKA 3DI6B 2XMVA 2ZVSA 2V9WA 3BB5A 2O8CB 1IKYA 3KZBA 2G08A 4B3TJ 2NREA 4OO1J 3UPQA 1ZQAA 2V0NA 4DTPA 1VQ4S 3KKSA 3S6JA 1O51A 2IRUA 2OFHX 1J97A 3HPGA 1BE4A 4RW6B 3VQ7A 2UU9F 5ADXH 2KT2A 2YB4A 4R63A 2HIYA 3LL3A 5HP1A 2W11A 1XC3A 2DEIA 3K2YA 3N6NA 4DFDA 2FC8A 4KKOB 5JICA 1RT1A 5C7PA 2EC2A 2BOPA 4RQ6A 3QU7A 4RNNA 2OEKA 4WE1A 3WXMB 4I2FA 2DKXA 2EX3A 2GAHC 4CT9A 5CYJA 1SB6A 4AH9A 4ID8A 4PUOB 2VC0A 1R8CA 4DSLA 4M41A 1EX4A 3DRRA 1B0XA 4Z0UA 3EGWB 5DDOC 4LSZB 1V3SA 3ZZPA 3GV8B 2QM1A 2ETJA 1S57A 2APOA 1KAZA 4KLJA 3GJTB 1ZZFA 1UW4A 5M2RA 4RL1A 4RPYA 1QAJA 1RYRA 3EEQA 1GQEA 4GVLA 3VERA 4IQVA 1GT8A 4KN4A 2HURA 1K44A 3C7NA 2VIHA 4CIOA 1SVDA 1RBOB 1R27B 2FC0A 5J2QB 1REVA 2IMWP 2QLWA 5HP4A 3GQCA 2RKIB 5JVHQ 3ULDA 2A6AA 2M8DB 5BPCA 3WC2A 4I2AA 1IVZA 4EK2A 2BA9A 2QMXA 1N4LA 3SQIA 2XSFA 1X9WA 8ICJA 2IHR1 2CRXA 7ICLA 7ICNA 2N3OA 4CNZA 5CAAA 2XMAA 3CDBA 1IBLK 2VQFJ 2MSTA 4FXVA 3O8WA 2ZIVB 3ZO7A 3RB6A 2I5JA 3CCRN 3I9ZA 2X78A 4CF1A 1S9GB 4ANEA 5AI9A 1SS6A 4IH7A 4AUKA 4V19J 3R2CJ 2A42A 3W65A 1UFLA 4NX9A 5CHCB 2VPZB 3EICA 5D3GB 1IV0A 4Q2LA 2W8KA 4OLAA 4W5NA 3V9WA 2ZH8A 2PMZC 2K1RB 2ZJQL 1GXTA 1XMQJ 1JALA 3EWGA 4RQ8A 3TAQA 3AA3A 5HMXA 1R6YA 5AI8A 1R43A 3K59A 3I5BA 4MJKA 4ZVUB 4LMZA 3A3PB 3JSRA 1UWBB 3QGPA 1HR0F 2KMDA 1C2PA 3AD9C 5ALSA 1KBUA 4IBNA 4CD1A 1WAFA 3VVUA 1LWEA 4KHWA 5C2DA 4YDXA 1FX4A 1H7WA 2D3UA 2EWHA 5F8HA 4A57A 1N8RO 2ASPA 5KQDA 5IM0A 3H20A 1S1TA 4I28A 1X66A 3PEHA 3MCNA 1ZJNA 4I69A 4P71A 3VAFA 3PKYA 5E41A 3VV2B 4DS4A 1RWKB 3K5MA 1V38A 4J9VA 5ALYA 2QK9A 3QAUA 4OJ3A 4IDHA 5KGWA 1ZM9A 1HJRA 1BY9A 5J2JA 4HT7A 2HFOA 1E6YB 3AVGA 3ZCMA 4NLDA 2KK0A 3BSCA 3L2VA 2DGWA 2ZC3A 3JPOA 5J0YA 4LF5J 4DQSA 3IR6B 5HR7A 1CULA 3T1HJ 2Y3YA 2GWJA 3BUZB 3ZTRA 4F5OA 1F3VA 1JQGA 4CHNA 1TKDA 1VRQC 4X64K 5F1XA 4UBCA 4B3RJ 4DOAA 1TL3B 2E8MA 2LXUA 1JNZB 3LM9A 5A8WA 3H42A 1B92A 2CQBA 1MU2A 1UJ4A 3KJVA 5B0CA 4NLUA 4M5HA 2COLA 1KOHA 1J2VA 3TVYA 1S5JA 1PG5B 2Z2LA 3RW7A 2FBYA 1UZHA 4QPTA 3MEGB 2E6MA 2HVIA 1SJRA 2NXUA 1A5WA 4WF9L 1RAGB 2CG8A 1VLYA 4AL5A 1UMJA 2MXYA 3Q8KA 2NRRA 2E8PA 2E5GA 5AKEA 3G8TA 4K2JA 4CEZA 3MCPA 3AVJA 2ZJAA 3H98A 5AK3A 1DT9A 2AH5A 1U2RA 1I39A 3HZEA 4UOCA 3J7ZO 5ETPA 5AE3A 1MN8A 3OVNA 4V1Ak 3R7BB 3EXYA 2EAOA 2RQ5A 4DQIA 3O6QA 2OTJN 5C25B 3RB0A 4G1PA 5AQRA 4W4MA 2XS2A 1SIJA 1COOA 2CQPA 4JWMA 1LXJA 2ZWOA 4BGDA 3BY5A 2E1FA 3D2EB 2JDJA 5AKJA 1ACMB 4K41A 3E66A 5AI4A 4ATNA 4NI2B 5L1JA 4CFBA 1RT7A 3SCIE 3M2VA 2GLEA 1NJYA 4DR6F 3GIMA 2Y1IA 4USMA 1GAOA 3C15B 4ISGA 4BVOA 4OZLA 3ENHA 5AM1A 7FDRA 1NEEA 3CPWR 5AHXA 5LMNK 4WQ5C 1K73O 3VENA 3O1LA 3MMVA 1XMOK 2W04A 1ZBTA 2AU0A 4U8YA 5J2PA 5D15A 5D0HA 1T9TA 4KSEB 3MD3A 2X1BA 1JX4A 1TL1B 2VIXA 3M6VA 3CCWA 1W2IA 1HBUA 2FDNA 4U95A 4PKDB 3MR2A 3BGUA 3NG8A 1WSFA 1CG2A 2RQKA 3FSIA 1RDDA 5KFHA 5KI6A 8ICPA 3R7SB 1XIQA 4IEEA 4UBBA 3C16A 4ECYA 2R8GA 1NMNA 2QI2A 1FTCA 3SMSA 2WVDA 4F2RA 1ZJMA 2W9BA 4OJGA 3R1XA 2W24A 4KBOA 3DDHA 1RDWX 2AIRB 5G5HA 2EFNA 2P9LB 1WDTA 4CHYA 2OSQA 5J2KA 5GTIU 4I1TA 1IM6A 1BPDA 5BN9A 3THYA 1IBKJ 1YK9A 3I33A 4FVUA 4YOUA 3HXMA 3TPQA 4F8RA 5JVGL 4NLKA 4FW2A 4LFCJ 4CBXA 2AXTU 1SBRA 4E1JA 3EZOA 3NVYA 4C8ZA 7ICSA 1JJ2M 2Y0SC 4RNOA 1BU6O 1BHNA 2GO8A 2HNYA 3HSCA 5IIOA 4ISFA 3A8EA 4PG4A 2J7UA 3V6JA 3MXJA 5H9EK 1APSA 3MM8A 2DR8A 2PGCA 3DOLB 4USTA 3RG6A 4MK7A 1YJNS 3HW8A 4KT0C 4NXMK 1C1AA 5J1EA 2E2NA 1FJGK 4UW9A 5DQIA 2BJEA 1VC0A 4CHZA 1RBVA 2E20A 3QB0A 2D1CA 1R0AA 1T7PA 3LANA 4F91B 4JUZA 2RDDA 4HVZA 4LFBK 4DR2K 4YDDB 4C4WA 2AYGA 4WFBL 1MQ2A 2X51A 1FDNA 3HILA 4GC7A 2O8EB 2VG6B 4QR1A 5J0UA 3WKCA 3QNWB 3NCPA 4NJ8A 5HI7A 4GVBA 4DPUA 3AQOA 3HZ6A 5J2CA 1NMEB 4DV5J 3HLUA 2H3IA 1OS5A 3DLRA 4ZLJA 4NLYA 3L2RA 4Z7YA 4LUBA 1LQ9A 3W63A 5GMDA 3GIJA 2HZCA 2V8GA 4J2DA 2W4PA 1N56A 4LBHA 4DR4J 1ZQNA 1W97L 2BUNA 3GFKB 1AB8A 4ACOA 4URSA 2VUGA 4LZDA 2F8LA 4LF8J 1Z3EB 1Q5VA 4IFYA 4OX9F 2NZCA 2C3MA 4BRIA 3WQPA 2CWXA 2A1JA 1RQNA 5FIIA 2RRBA 3L3FX 4BE0A 2JZBB 1AFIA 2LFVA 1B0TA 4IH6A 3CRXA 3W61A 2JGAA 5FROA 3GIKA 4DXLA 2GC8A 2NUHA 1R8BA 8ICFA 1T4GA 3WDOA 1Q86T 4XEIA 1ZOLA 2CPIA 2DF4B 1RGIA 4GKKJ 4XH5A 5FJ4A 4P52A 2E5LJ 2UXCK 4WFNL 4I2HA 1IBLF 1VSJA 5DDRC 3POTB 3MX2A 1F5AA 3AHPA 4DL3A 2FMQA 3HVTA 2YHYA 1VQYA 3D2NA 1M5PC 4BG8A 3P6YC 2I6WA 4I2CA 1WF2A 5B0FA 3U9DA 5CE3A 3FFIB 3ZZOA 1Q3UA 1Z00A 2BACA 3GV7B 4CLYA 2GCFA 3M32A 3GFXA 1RU2A 2H5IB 4RLEA 4PQUA 2XNQA 3JAMO 3QT6A 1TZ0A 1UA0A 2JHEA 4C1NI 3F5AA 3A12A 4YHHF 1HI8A 2IM2A 2YNHA 3DOMA 3OFHA 3WEEB 2R7XA 1NM1A 5AI5A 5AK6A 3F5TA 2EZZA 4NE9C 4NLNA 2CPYA 2N7YA 3V9SA 7ICPA 4H5WA 4U7CA 5CB1A 8ICEA 4B9LA 1CC7A 2YV0X 3ZNJ1 3SQGA 2YH0A 1W9HA 4LJMA 1MSWD 1T9WA 3EGZA 3D2WA 1ZQIA 3D7SB 2QW9A 1JXEA 3LDPA 1Q16B 1QVGM 3VGTA 1FXXA 2IAJB 1ILYA 4K8RA 2OYQA 4IOCL 4PJ0U 3TSUA 2W4DA 3Q7CA 1VRTB 3C3LA 1S10A 1SV5A 3DLBA 3QO9B 3DLGA 4KB0A 1S7IA 2KKHA 2JR5A 1O08A 3WKEA 2B56A 3GTYX 3RAMA 4CLFA 3GYXB 2JX2A 4FPIA 5GMKa 3AN1A 2RE2A 1ZH5A 1SWWA 2HLTA 4OPKA 3TRGA 2MTLA 1HWIA 1VQ6S 3I1YA 3CVKA 2Z56B 4DV7F 3DMJA 5DDMA 1S1UB 3G71S 3OY9A 7ICQA 1HNXK 4X64F 4ZH4A 3FJ2A 1G99A 2HFZA 5ADXA 1IKXB 1I6JA 3D6MB 3QSYB 5KPTA 2M0NA 3MM5B 2YNGB 1OY6A 2HRUA 1OH7A 2HS3A 3UMCA 3WX8A 4ED3A 1IR2A 3OVBA 2W9CA 1XI1A 4X4PA 2VWKA 2NYVA 1BWEA 1TFWA 4KRFA 4CJVA 9ICKA 3HD2A 3MM6B 4F4YA 1M5HA 2Z4PA 1QTNB 3KHRA 1BPZA 2XHCA 4B9UA 2QE5A 2EZXA 5ALLA 2L5YA 3CO9A 3SNNA 1G15A 4WQ4C 4MDAA 3C2KA 3D3CJ 2J4RA 2KJ9A 1NRKA 3F9MA 4M9GA 2MQLA 2Z58B 4JI7F 2HDOA 3D6RA 2MSSA 2MU2A 1Y97A 3ZZ0A 4FM2A 3E0FA 3KLFB 7ICKA 2FLPA 3MEEB 2YHWA 3O1WA 3QBCA 4QBUA 4WFAL 2XULA 3VZIA 4RNMA 8ICUA 3DV9A 1F0MA 2P9IA 4FZYA 2PO4A 2QFIA 3KWGA 4BR0A 2A1RA 3RJFA 1UWAA 2G9OA 4FZXC 4KH0B 2VHGA 1FO4A 3NHGA 5I3UB 2VPXB 1IBMF 4BRFA 3RBEA 2QLBB 4FJKA 2WF9A 5C24B 4UY85 4AQYF 2Q4TA 2P9NA 2HOQA 5HHHA 4CJ4A 3M4XA 3N79A 2NLWA 1K8KB 5CR4A 3AVNA 3NGTA 5I42A 2E7WA 2HEKA 3A5NC 3TACB 3VAIA 4TKTA 1FIQA 2YKNB 2VWJA 4PL1A 3UKRB 2OHFA 2AWZA 3CCES 2UU9J 2IIRA 4G6VB 4BRHA 4DF8A 2EKYA 3W9HA 4UQTA 4JK8A 3Q24A 2W25A 2QLTA 1U1PA 4A8SA 3OYIA 1RYSA 5KFUA 2V8PA 3U1MA 3ZZTA 1NG9A 3BQ1A 4CEDA 2FSKA 3U1NA 2WF6A 2EH9A 3F53A 1Z1VA 2ZTEA 3H5SA 3OTEA 5A8KB 1LWXA 1SGGA 1KQSR 2XI3A 2AEMA 4RPZA 1L7OA 9ICLA 2PI4A 4BC4A 1FD8A 1YJTA 2IOFK 4LRAA 3U02A 1EQYA 4N47A 4EGLA 1JJHA 3UDLA 2OPPA 4RCHA 4NMLA 1WYGA 4FZMA 3BDPA 1SC1B 1DRZA 5E3QA 5M1OA 2XS7A 4FS1A 2U2FA 5EHHA 1NHVA 4YOYA 4CHOA 1U1QA 4P4PA 2JHDA 2I6XA 3TA2A 3PSIA 1HYSA 4AP9A 4BS2A 4TNOA 1SV4A 2AMCB 3PYGA 2YX8A 4FDFA 4LY7A 2O3DA 7ICRA 1WG5A 1DURA 2GWKA 2V4JB 3IG8A 2B51A 3H0RB 2KZMA 3VQTA 1HIWA 3ENQA 2OEHA 2FVPA 4KLHA 3F9KA 3VETA 3FRZA 1LK5A 5F0UA 4HDHA 1GLFO 1WKJA 4LF9J 4A8OA 3IM1A 5HVHA 1SWVA 1FJCA 3IGVA 2DY1A 3KK1A 5JMNA 4BXOA 3OW2R 4DR2F 1NNDA 3ZT2A 1Q7LB 3UW1A 3TANA 2KU7A 5E26A 3C2PA 3TAGA 3HHLD 5GIPA 2V5HG 1BMQB 3CJRA 4AL7A 4QIWF 2JRSA 1J9AA 2DFLA 9ICFA 5AKYA 2ISPA 4DCCA 4OVLA 2I9GA 4A48A 1WI6A 1RWXB 4LVNP 4ED6A 3MAHA 3V6DA 4OZ1A 1ZQRA 1QJHA 2O4IA 1LKZA 3LDOA 2O8BA 2QWNA 3SV3A 2FZGB 5DBAA 4RZRA 2W8LA 3QGIA 2QZ8A 1UETA 1HR0J 3H2VE 1HRHA 1WEYA 4C7QA 3MCMA 4R79A 3UCZP 2FYXA 1SC6A 4CLLA 1N34K 4RWWA 1BQMB 3FE1A 3E58A 3VTHA 1IKYB 4OYIA 1TL4A 5ETVA 3NF9A 2QKQA 3HX0A 4IFVA 3FBFA 2A19A 3AARA 1NOZA 3MN7A 4I4BA 2BJ7A 3CJCA 7ICIA 4QOTA 4DQPA 2FI1A 4FW1A 1ITPA 4CQ1A 5F3ZA 4Y00A 1VQNS 2LQJA 4YB5A 2J6SA 2YJEA 1ZTWA 5C2CA 3TUPA 4OYBA 1UKUA 3IRXA 1WSEA 1V4TA 4CO1A 3CMAS 1K0TA 1S6UA 1EX8A 1O03A 2R7UA 3W8GA 5CR0A 1RXVA 3JSYA 1RDBA 1CQNA 4KGXB 2WB1F 3UIQA 4WE1B 1EP4A 3N5FA 5I3QA 2F1FA 3HSJA 3KLIA 1HBNA 2JH7A 1AFJA 4J37A 5LJWA 3VPZA 1KW4A 2ATCB 2LI6A 4DF4A 4FWNA 1ZD2P 5L1MA 4X84A 2B5JA 4FK4A 2Q6CA 4FK2A 2ZH4A 3QU2A 2GJIA 2QLXA 1SQFA 2D6FC 1GMWD 3SSRA 2NSBA 4FLXA 1NHUA 1PAUB 4CF2A 5GINA 2EFVA 1WC4A 2AYEA 2VJVA 4F72A 4I6MA 3Q83A 1C0MA 5J2GA 4ZTJA 3MOZA 3JQMA 5HK4A 2D41A 4XRHA 5BR8F 1RTDA 1REVB 2EFQA 2KG0A 4K4WA 4C8YA 3ZD9A 4EWTA 4JS5A 3RRKA 3DHXA 1DQ9A 1O13A 4UAVA 3HSDA 1EB0A 1WC5A 1YSJA 2F4VJ 3VQDA 1PBAA 3KNGA 4DV3K 2VKQA 2BANA 1GLJO 3KLGA 2V2QA 3PACA 2HBJA 4NYOA 3JTPA 4CZFA 4E0DA 3O3HA 4DV4K 4BQZA 9ICWA 3MGIA 4JI5K 2R18A 1BD6A 3O0FA 4CLZA 4CIFA 1HD1A 4M1KA 4FWPA 4K4XA 5IT0A 4FS2A 2GGPA 5IQQA 1DXSA 3WIVA 8ICGA 4JI1J 3G6EN 2G09A 2YMMA 2HB5A 4P2HA 4CDIA 4ZVHA 3O1BA 3UVJA 4WQ4A 4CI6A 2MZTA 4Q8FA 1IJJA 1Q5YA 3TR8A 3HD1A 3FNNA 2OGUA 3R5CA 1FFWB 4YMEA 3DXKA 5C15A 2YY6A 2GVZB 4X66J 1KS2A 5LOQA 1N6QA 2PFNA 1OQ3A 2NXNA 2ADBA 2DIVA 3LALA 2YVSA 1SI9A 3LOUA 1XNQF 5CYMA 4CJPA 2HI0A 4RQ2A 4RQ3A 1FF2A 1A7GE 4FXDA 1N2XA 3OYHA 2AHOB 1ZPVA 3S01A 2RHSB 4JI3K 3EWAA 3Q8MA 4KPYA 2UVWA 2PE8A 5AJ3F 4I2IA 4USVA 5EE9A 4ECQA 5F9LA 4PHPA 4WP3A 3N01A 1TR0A 2FMPA 3BBFA 2X1FA 3SR6A 3OT9A 4ELUA 2V2KA 1CULB 2UXBJ 1VSMA 5AQKA 4JKGA 1WCNA 4BQLA 2WMMA 3MEKA 3FRYA 1KQQA 3PG9A 4DCOB 4PGYA 1I94K 3JQJA 2VG7A 1H38A 1CLFA 3VA3A 4H4OB 3AXKA 5AQVA 1UEUA 8ICSA 3LVWA 3EYZA 3SSQA 1QD1A 1JLFA 2PYLA 4UZCA 5LL6Z 4KAIA 1IWAA 2IM1A 1NK5A 1R7IA 2Q36A 5AIBA 2QT7A 3MXHP 3QFPA 2HCFA 1N5QA 1S12A 2D3OR 2JGUA 3U3YA 1WF0A 3MM7B 1X4EA 1Q86O 3T6JA 1K9MO 4GY2B 4NV0A 3ZEUA 1VMBA 4OI2A 5DK5A 3H40A 5AQPA 3NF6A 1NKEA 1FFSB 4TYBA 5LT5A 4JI2K 4E3SA 3NWRA 2JEIA 5KFQA 2F96A 4RWXA 1RILA 1ATNA 1U1OA 3A5MC 2CWKA 4K4TA 2Q2RA 2CNNB 3D1HA 3EX7B 1U1LA 5HQ8A 4CJ7A 2A6MA 7ICMA 4K4SA 3M2VB 4ZDNA 1AUDA 1C1BA 3JPPA 2KSOA 3C1ZA 2BE2B 1RLCL 4FKYA 1ECWA 1QUVA 3PJ9A 4FPBA 3CD0A 5KFZA 4J2BA 5DDPC 4NLQA 2Y8YA 3S3MA 4C1NK 1RHUB 2B9YA 4OZJA 3O9UA 2BE7D 1YRTA 4HTIA 4OQJA 4WIQA 4CGIA 4PY5A 2W01A 1X6IA 4N7TA 5GVQA 1FERA 2KKVA 4IR9A 2XB2D 3WNHA 3FYHA 2FGOA 1HBUB 4BROA 3NS1A 4CW7B 2B9WA 4KLQA 1T3NA 1RE1B 2D0PA 4BREA 1H2TZ 2FBXA 5G5GA 4CEBA 5DLGA 2OTJS 4BR7A 4DSJA 1TL5A 4C3LA 1IBLJ 4TQSA 2B8QA 4PH5A 2PA8D 2R2UA 2W9BB 5J1NA 4K4UA 2BH1A 3R8YA 3MM9A 1KDHA 4ILJA 2H65B 2VV5A 2LXFA 3OL7A 1KLNA 1TTHB 1WAJA 3ZC4A 3ZDEA 5KTQA 9ICUA 3AT1B 3THYB 4TY9A 4CJRA 3RZAA 5CQGA 5MLCQ 2KOBA 3GFYA 2Y8WA 2RPIA 4UAYA 2XYPB 2IDOA 3P45B 4NCBA 1PSDA 2QLFB 3ENAA 1WWHA 1X5TA 4WYWA 3O08A 9RUBA 2KJ8A 4IQTA 2B9EA 2FTRA 2Q31A 3QIPA 3DYAB 4HKQA 1J6ZA 4B3OA 2HQ3A 4NLCA 3GL1A 1WNSA 1YVNA 2EW9A 3VMFB 3IS9B 4ZVGA 3THXA 2WAQC 1NGEA 2H51B 1NKBA 4IEIA 2G8KA 4UAWA 2RLTA 3A8JA 3Q0AA 3KKAC 2E3TA 4DV6F 1JLGB 3M1VA 4O5KA 1B43A 3W2WB 1TVRB 1ZQFA 5AXMA 3CJ4A 1CJTA 2YQ1A 4KYZA 4MFBA 3WU2U 4TU7A 4CJUA 1VSLA 1A5VA 1WTBA 5J29A 3BF4A 3HKZC 3D4JA 3O5TB 4H5NA 1HD0A 3KLEB 2HW3A 1X4FA 2HIQA 1GFWB 4DV7J 2F1HA 3ALRA 5F3TA 5EOYA 3EGNA 3OS1A 3PIPQ 3KUGA 3QNNA 4GVBB 5DM7L 2CZVC 4X64J 2IDLA 2H5EA 4KLOA 1FXRA 1KVJA 5GAGP 1D8ZA 3BO2A 1L7MA 5J0PA 1CEZA 2YH1A 2AF6A 3NKYA 3V1OA 2XO7A 1TL7B 4NB4A 1C0TA 2BGGA 3HJFA 4L73A 4H0TB 1I1GA 3ADAC 1NB2A 1HJOA 3KBBA 3ZLJA 1ELOA 2BW2A 2V68A 4LIRA 1V3RA 2YY3A 1YJ9N 1ZBLA 2KDOA 3BS5A 5FPDA 2ZIWA 4WYBA 1S4EA 2RUSA 1GLCG 2ZITA 2CYYA 3GIIA 3VVTA 2ZM6K 4OD0A 3UM9A 3LPUA 3C6TB 1HWUA 1RA6A 2NPIA 2A1JB 3L0QA 3M8SA 2VB6A 4RNFA 3MMCA 1PO6A 1Y64A 2GV1A 4J9UE 2W03A 5FP0A 1SJQA 4JI4F 2XI9A 2C2MB 3DDKA 1FW6A 3MAAB 1K5OA 3WUHA 4L6V3 1V9OA 3T7ZA 3N0VA 1V85A 2GH1A 4DTJA 1NGBA 2QG9B 4DTSA 3AA2A 3FLCO 3UD3P 4Z37A 2O67A 3SCXA 3SYZA 1AROP 4K2XA 5E33A 2FSJA 2CPRA 4HTLA 3OD2A 2OD6A 4OKEA 5JS1A 1BQNA 3S41A 2GFFA 5M1KA 4HCBA 4DV4F 2KL8A 1ZQHA 2VBZA 2DGQA 3HVTB 5DB8A 5LMNJ 1IBMJ 3MK6A 3JSBA 1WC1A 1PAEX 2QA4N 1Z00B 3FKBA 4JP8A 3M32B 1YX2A 3KHHA 2ATLA 4PQUB 3H7HB 4AHVA 1NGDA 3UCUP 1C4CA 2YWEA 2ZD1A 5ALPA 3MMJA 4O4RA 4ZVRB 3GG0A 3DOMB 5L1IA 2ASMA 4MO5A 3KK3A 2HMIB 2HSZA 4KH4A 3IWXA 3J80U 2MHNA 4H03B 2VASA 2UUCF 5E3AA 2ZQBA 1WBBA 5HQMA 4LFAK 5EX0A 3GE1A 4AT1B 3LDNA 5KFSA 3D0IE 1VSDA 5DMRA 1L3VA 2CQ3A 2RHQB 3ZDBA 3SQGB 4OX6A 1NJZA 4K42A 2DNQA 5K8NA 4DX5A 3MXMA 4DOCA 1BLUA 2HS0A 1F5BA 4YN3B 1B22A 2CA9A 1VDVA 1X4AA 3J80Y 5GADP 4FK0A 3BO4A 1DTQA 1G3OA 3V9ZA 1NSKL 5DETA 1TAMA 2LM1A 2JWNA 4Y1CA 5F2RA 4IOBA 3ELHA 5CHGA 4AHTA 4C8NA 4FWOA 4PKIA 3DLGB 4ALZA 4IXCA 2YWGA 4ECVA 2YQEA 3KJFB 4W98A 4CJKA 4IO8A 2BABA 4IG3A 1REGX 2GX9A 1DGSA 5KFTA 1Y5NB 4W90B 2V63A 4FF1A 4QIWC 9ICRA 3BYPA 4FE3A 2ASDA 1H3DA 5H9EJ 4ECSA 2LHTA 9ICEA 2VOOA 2O8FB 2FPLA 3WKDA 1RDFA 2AKWB 2FIUA 5EE1A 2WUSA 3QBWA 4UARA 2ZDOA 5KRSA 4NCGA 1PCAA 4MFFA 2KIWA 5EXWA 2QXLA 2BM1A 1YZ6A 2QSWA 3BF1A 4TSXA 2ZE2B 3OYBA 3AQEA 3G0ZA 3R8EA 1ZQKA 2BKOA 4NWBA 5HJXA 2C2DA 2BCQA 4LFBJ 2JC1A 4DR2J 4CGHA 3H8MA 4W92B 3VZHA 4AHSA 4BG9A 3BP8A 2OPSA 1TYQA 4OFZA 5IOLA 1RWWB 1RWPB 3CE8A 2HNZA 2FXUA 1TKXB 2LLZA 1YITN 4DS5A 3OR1B 2B7BB 4CZLA 3Q89A 3P8BB 4JMUA 5E5NA 3CCUN 1HQUA 2YMLA 3QNMA 1RDRA 2HHHF 2ZIUA 2VODA 5IIJA 5BYSA 2MB0B 4B3MF 5F8NA 4X5VA 4QU6A 3BJYA 4CZGA 1ROFA 2FHKA 4IO9L 3LYSA 5AK4A 2Q1LA 3N4WA 2E2PA 3TKAA 2NUUG 5D0RA 1RTIA 1XSPA 3WXJA 2E1PA 4B3TK 8ICVA 2UUWA 3ZSVA 2OUGA 2WB1C 3I76A 1NNEA 5I3PA 5KFIA 2VA3A 5HATA 4FNIA 3WK4A 1L3SA 4OJHA 2RU9A 2P9NB 4IS7A 3PVXA 2VGMA 4PPZA 1X4GA 2J9CA 3UR0A 2OPRA 1X9XA 2BDUA 4FBUA 3SUPA 4R5PA 3V4IB 4OGCA 2JH1A 3OL9A 8ICHA 2LEBA 3TQ1A 3PEJA 4U8VA 2UXCJ 4UW2A 3GDXA 1ZA1B 2YHXA 2ACYA 2K4HA 3O8MA 5C0YA 3NLCA 4U6PA 3ITHA 1T3OA 2NRVA 3TR5A 1Q82T 2AJ0A 2BJ9A 2M7SA 3WXKA 3G8SA 3VGLA 2K06A 1U04A 4LQ3A 5DB6A 3IV6A 2C2KB 2XMJA 3F2DA 1HX1A 4DL5A 3NH0A 1EETB 3T5HA 4IQXA 4A4JA 2Q6BA 2H3ZA 1SL2A 1CBKA 3KKAA 3DU5A 3D6HB 7ICJA 4CZHA 1DY3A 2VPWB 2HS4A 3DXSX 2V8HA 1UFKA 1F44A 4NLVA 1N36F 4BUGA 1HYSB 4EBCA 4KQZA 3KVGA 5J2BA 3AY0A 1UVJA 2PBDA 4F25A 3L8BA 4CNYA 5ETRA 4WP9A 3MN6A 5AKXA 1SL0A 1VIOA 3OYDA 2B6AB 2K8CB 3SV4A 1Q79A 1SUQA 1WG8A 2R42A 2PIIA 4KHSA 2R8JA 3FVYA 4BXOB 1BVSA 1IXRA 2D9PA 3VAKA 4ZIWA 4JS4A 4UOHA 1KVCA 3E9PA 4JNEA 3N7PD 3FFKB 4ZK7M 2BPGA 4DPYA 3B4DA 3PX4A 1HNXJ 1YHQN 2ZHBA 5K20B 5AKLA 4QS7A 3O9SA 3CW2C 1U6FA 1YJUA 1L5UA 1RT6B 3IRUA 2J9DE 3W5XA 3SLCA 4LF7F 2YKAA 2AX1A 2D3O1 2W54A 1AA1B 1UA1A 1IBCB 1P7DA 5K8MA 2GTDA 3HDSA 4CZJA 1J5OA 3VF2A 2E5SA 3KLVA 3MMAA 1AT1B 4CF4A 2HK2A 3QEXA 2ZM6F 3CF5Q 4DG1B 3AM9A 1NZPA 2HWIA 1S1XA 3D2FA 4HI2A 3CCMN 4YG2A 1DGJA 3RMAA 1UEKA 7ICFA 3EL2A 2D7SA 2DRBA 2GHWA 1ZD5A 2NRHA 4OJ5A 4CEFA 1RISA 3HCXA 4DR1K 7FD1A 1X2IA 2J8AA 4N77A 5JLFA 1CS4B 4FYVB 4CEOA 2P5OA 3MD1A 3IFEA 1RBLA 3T1HK 4CO5A 2D1KA 3AQFA 3D2SA 3RBDA 3W2VA 4GXJA 1W7AA 2X1GA 3KD1E 9ICVA 3LTOA 5HJYA 3A3OB 1SC3B 2EWSA 4QZAA 1NBEB 2O8CA 1N0VC 4ZP6A 5C5JA 2FJDB 1C0FA 3UDEA 3HSTB 2KEYA 2H48B 4ES2A 3AO2A 2AJQA 3K58A 4PQAA 4YB7A 3NNHA 3K1ZA 2UV8A 1TMJA 2A41A 2WVCA 1GLAG 5KPRA 3KLIB 2OANA 1A77A 4RBUA 3LO3A 3RUBL 1VS3A 3NOGA 3K9JA 1EO1A 4LH4A 2UUAK 2V67A 2P6TA 3MCSA 2LEPA 2X3DA 4GMKA 1GXUA 3OYMA 1JLCB 4OI1A 2ZWPA 1CC8A 4KB1A 4Z4EA 3G87A 1HBOB 1NGJA 1A6LA 2DH8A 2VKZG 1SZ2A 3AA8A 4JI6F 3D0PA 3THTA 5IINA 2H3FA 3G6VA 3AAPA 2G8WA 3CDWA 4CLUA 4IG0A 3R7NB 4PUOA 1LFWA 4K5RA 1FHTA 2DPJA 4I6MB 5HMWA 2YNFA 1NZ8A 1N54B 5AQMA 1Q78A 1OH8A 1QVFM 4IOAL 2HAFA 1RTDB 3SAGA 5KFGA 2G0IA 2ITMA 3CWJA 1ZQBA 3BSOA 1E6VA 1JJ2R 4ZOHC 2F7VA 4QOZB 3GB0A 4M2YA 2CXEA 2C3UA 1FFUA 3NVVA 4IO1A 4KLIA 4DV1F 2A2CA 1HYVA 1NBWA 3HI9A 3RR8A 1CJKB 4FVCA 3CNHA 1OMSA 5J2QA 4BRLA 3EPGA 1XR5A 3ETRA 2RKIA 5A8RB 2M4MA 5TKYA 2QWQA 8ICOA 2W2MP 3OA9A 4Q0BB 9ICIA 8ICIA 5C42A 2GGPB 3L2QA 1U6ZA 1UT8A 9ICMA 2Z1IA 2Z1HA 3M6XA 2VFUA 4FYWB 3B6BA 2MZQA 3PYFA 4I64A 4DTOA 3QJLA 4DR5K 5HAOA 1RBTA 4GNIA 4CK3A 2LU2A 1VOMA 3LAKA 2LQBA 3M30A 2ZF5O 3OUYA 5IV4A 3NASA 3MX5A 5A2QY 1BI4B 1H2UX 2ZNZA 1JJ4A 4WKYA 2QL9B 1A5XA 3V4MA 3DLHA 1YUWA 3LGNA 4JB8B 4DUZF 1U09A 3OTQA 4WFZA 2OJ3A 2B0GA 1VQ8S 2C22A 1UTAA 8ICXA 4IDKB 5LMUF 5D3GA 4KHQA 3FGVA 5F9NA 5L1LA 3KUEA 2K1RA 3EE8A 3US5A 2CPJA 3OYNA 4DLEA 3MBYA 4ED1A 4CE9A 2N4DA 1NSQA 1NK4A 4WP8A 2AP6A 2MUTB 1KQSM 3A0HU 4KB7A 4CJSA 1UWBA 1WC3A 5DS7A 3TJAA 4YOWA 2HF3A 5F8LA 3N7SC 3NTUA 2BX6A 4QIVA 1YVUA 1FE4A 3HFKA 2AJ2A 4Z7CA 5L9NA 3QEWA 4DCPB 3CJ9A 3N4MB 3HT0A 2F4FA 2NZ4A 2D4WA 2QRRA 1IXKA 3QLHB 2Z8QA 4JKGB 4RU9A 2HHUA 2D74B 4RQ4A 3D1OA 4CJWA 2VQEK 2CDRB 4G9ZA 4H54A 1N34J 2F3JA 1U47A 5JTIA 2KKZA 2VG7B 3HL8A 1U4BA 2B43A 5AZJA 2Y1JA 1PJ7A 3PFOA 4YY3F 4F50A 1E6YA 1O5JA 1JLFB 3AU6A 1NK7A 2JLGA 2BQUA 9ICBA 3O6WA 4DB3A 4KH1B 3UQSA 4PGXA 2W3SA 3OQ2A 3SUNA 4G65A 1HPZB 3OW2M 1B64A 4MLHA 2DGUA 2JEGA 1TL3A 2GIRA 3SJHA 4DV5K 2CQ1A 2CQCA 4F5QA 1JJCB 3SEOA 3AAQA 2V4RA 3WK5A 5KFEA 1WOPA 2MZ1A 3WXIA 3LP2B 4ZCIA 4OKKA 2AA4A 4US9A 4Y28C 1JCFA 1OYDA 2XY6A 1GLLO 3AFGA 3UE5A 1M0SA 3IR5B 3D3BJ 1U0SA 3J7A1 3GFZA 4JD2B 3D2QA 5E7OB 4L76A 2H3GX 2HZAA 2YPYA 4R0JA 1MN9A 2Z30B 3CC7S 1XWLA 1WKLA 2GIFA 3ZDCA 3M2UB 2P9SB 5AM0A 1FRLA 2XI2A 1NNLA 4EEYA 4MAKA 4NEZA 3VTIA 1LKYB 5GAHP 4KAZA 4ZHRA 1X40A 4Y34A 2IC3A 2ZOMA 1QVGR 3ZX0A 2PEHA 1X1PA 4RR5A 3TX0A 4ZLLA 4A8KA 4NL9C 2CJKA 4OHZA 3D2EA 4EX7A 5HHIA 2HBLA 1WB9A 1H98A 3LH2S 4NI2A 2EZYA 1YJRA 1BPXA 2GO9A 9ICOA 1OWXA 4QIEA 3DLLQ 3FQKA 4IR1A 1C4AA 3C15A 3VQ5A 4GKKK 1RWNB 2DY9A 2NZTA 2OCEA 2AD9A 3AA4A 4NYNA 1V5VA 2NPFA 3DEEA 4Y2VA 4CJ3A 2GWSA 4JK7A 2RDJA 4F4WA 4Y2QA 1CLQA 2W7OA 4I0WA 1KC8O 3CJ0A 2VKRA 2XWYA 2RQ4A 3L2WA 3IG1B 3L5KA 4X4SA 4DV4J 2XM3A 2Z2ZA 3A5OC 1URNA 2XO6A 4JI5J 5CY4A 3MM9B 1RCXB 1T94A 1YT3A 2VZ9A 1ZQEA 1NB7A 3LVVA 3RMBA 3PRDA 1N62A 5EN1A 1GOCA 1BISA 4B1ZA 4KGMA 4JI0F 1NJIT 2E7XA 1BG3A 1PC5A 3NF7A 3VAMA 4ITSA 3NY0A 1YJNN 1HKAA 4FXWA 1GK8A 4Y2IA 1WSVA 4KHPF 2AJ4A 5DDQC 3NCQA 5KFVA 4FYYB 4J9SA 4M5LA 1RTJB 2KHCA 4CK2A 1SQKA 3SPZA 4DHYA 3ZT3A 2HHWA 2EAPA 2MKYA 1HNZK 4Y2MA 5MLCV 2WF7A 2P9LA 1I3AA 3TWHA 4FZLA 4RUCA 2BEFA 4YOXA 4FJ5A 2PSZA 2V8VA 1KDNA 2JOQA 4DQQA 3AUOA 1TKZB 2UZAA 1NUEA 5BPMA 1X4DA 3KYLA 3QSIA 4YR3A 2ZJRQ 3VQEA 3TEGA 2HF4A 1WNEA 5ALFA 3M1VB 1RZMA 3ZSXA 2W55A 3ISND 2PC6A 3ZD8A 4JI3J 1FNMA 1CJTB 2HG4A 5J0QA 2OEJA 3IBPA 2IY5B 4MF2A 3CDUA 2OA8A 1XU4A 1ZC6A 1J2MA 1B0PA 4B1XB 2I2YA 2ESEA 4HHJA 3ENBA 3OXGA 3J80O 2KB2A 3C2MA 3FSYA 4DU4A 3QFHA 2BCUA 4LQ9A 1UAXA 3QT8A 3RFAA 4Z4HA 4RUBA 2MY7A 2A3VA 3VEVA 3V6KA 4OLBA 4FPRA 2P2CB 4E1NA 1I94J 2MLXA 4PXDA 2ILYA 3CCQN 4JRPA 4O3MA 4QWDA 1C0TB 1X60A 2P5VA 4IOXA 5D49A 3RTVA 2LA6A 2QWOA 3CCTA 3Q23A 2G1DA 2DL0A 2VG6A 3IDWA 4R65A 3OTDA 4OHXA 5SUHA 2P9CA 3TARA 1HARA 3PCOB 4YS2A 2FJXA 5T14A 1SC4B 2DNGA 5J2IA 4HH1A 1Y3JA 4OZ5A 2LECA 3C95A 2C1EB 4PXBA 3G8QA 2Y0BB 4C0HA 3M8YA 2G2ZA 1P1LA 4R66A 2NRZA 1T6CA 1FK9B 1SJ1A 3FR0A 1Q82O 4H0YB 7ICVA 4RTFD 3ILIA 4OMFG 4FWSA 3TA0A 4FLVA 2V9KA 3RRHA 3OTBA 4RX6A 2BM0A 4KO0A 3F41A 3W3SA 4QZIA 2WHOA 4LF6K 4PG8A 2RP5A 2YKMB 4JB3A 1TP7A 2ZH5A 2OLWA 4QZBA 3J7AN 4B3MJ 4CEAA 1QQ6A 2F9JA 4KITB 4FJLA 1TV9A 3M8QA 2IBOA 1KQKA 4YOTA 1ZQJA 5ALEA 4LREA 4Z4CA 2DISA 4Z6DA 3GJRB 3UB5A 1RUSA 2E7VA 2ZOGA 1RHKB 3I82A 2KHDA 5BN8A 3VQ8A 2MQQA 4O9MA 3P38A 3HVRA 2R7VA 3M8WA 2E8AA 2P35A 4CI0B 4DSFA 4RW4A 1KTVA 2KYXA 4KLTA 4NLBA 2XMUA 4FF4A 3NGZA 5HBMA 3DRXA 1YJ9S 1GOBA 3I55S 2YMPA 4FYXB 3EO3A 3K2PA 2AEFA 2UU9K 3PV8A 3WNGA 4CESA 3KK3B 1DHMA 4AYBC 5KPZA 4WTYA 1BPEA 3POTA 1JLEB 3BGFA 4WIIA 2RRDA 2HWHA 3K4GA 2XICA 4M5DA 2KO1A 3THPA 1FNOA 2CZ4A 1B99A 3CJ8A 2IVNA 1ZPWX 2ZFHA 1CZAN 3PR4A 5D4BA 3WEEA 3J7AP 1VSFA 5GIOA 4P74A 3FBCA 2E2OA 4B9NA 2YHAA 4EBEA 1SCJB 3H1QA 3KD3A 3KKRA 5ALTA 3I96A 4EU0A 3RRGA 4QPXA 4YMNA 3D67A 8AT1B 4MIBA 1A6SA 1IG9A 3UR3C 1FJ7A 4IG3B 3MR3A 2QA4S 2DFFA 2AGOA 3O3FA 3ILLA 3QX7A 1FI4A 4CEEA 3EE3A 1QQNA 5KOWA 2XIDA 3KLHB 2AGQA 1VQMN 1W26A 5IC4B 3QO9A 1YTUA 1ZETA 3AB2B 5ALZA 4NCGB 1H7XA 5T7LB 1KEJA 3HPHA 4QYRA 3RH4A 3IP4B 4K4YA 3G96A 1X5PA 4BWJA 2PFUA 5JS2A 1EARA 2HYIB 2P9PA 4F4AA 1S1UA 4CWBA 4NYFA 1ZQWA 1N88A 1KN6A 2ZBIA 1N5WA 1IKXA 2W2NP 4KV8A 5AXNA 5AFUH 1VRUA 3MECA 4ZPVR 1X9MA 3VQCA 3I4PA 4ECWA 4OJRA 4KHYA 2F9DA 3CMEN 5BPLA 1H74A 1HHQA 4A8WA 1QH9A 1WI8A 3MM5A 2YNGA 2KFNA 3BZKA 4UY8T 1SAZA 1SJ3P 1UQVA 2ZBQA 4ILMA 3WQUA 4MF8A 2A6OA 3GDQA 1SXDA 1U7LA 9ICTA 3A8IA 2A10A 2NCKL 1HQUB 4B9SA 2B4UA 3M7DA 4UUXA 4NL9A 1HR0K 1OQ6A 1NGIA 4DUYF 4F4KA 2OELA 4NRTA 2ITGA 4BR5A 2H54B 1EKSA 3PUFA 2WK4A 4M9JA 4M5NA 3VN5A 2YCHA 3TW0A 5AXKA 1YBUA 3LF0A 1PVRA 4H4KC 4B8AB 4A47A 1HPMA 2ZM6J 1U9LA 4DFMA 2CJXB 4UATA 5B7WA 2N1RA 1EIYB 2QB0B 3KLFA 4CP5A 3GCXP 5EX5A 3QDKA 4C80A 4QZ8A 3Q8QB 3W9IA 2ZJPQ 2ASOA 2V52B 4CZEA 3PNCA 2BCVA 5THWA 3M1FA 1D1UA 3CJSA 4TU9A 4CZKA 2XY8A 3GFHA 4FJHA 3ZETB 5L39A 1UCNA 3DOKB 2O4GA 4O3NA 5I3UA 4DSEA 2QA2A 5J2EA 3K9KA 2E44A 2OSRA 1VC5A 3RH6A 2NXCA 1DAXA 3U8XA 1YITS 3AQPA 1K8AO 2CPHA 4KBIA 4HUGA 2KFYA 5AK5A 2KI2A 4DBQA 3FEXB 1K8KA 4UAZA 3HFVA 4QZVB 3ITHB 5CABA 4JK1A 2A40A 2W7AA 3N28A 5HQLA 3H25A 4F3QA 2YKNA 4ZJLA 3OXFA 1D0EA 5B8HA 3G4SN 4M3TA 3OYAA 2ZDPA 3OFEA 4CLTA 3T5JA 3M6WA 2E1CA 3MDFA 4DWIA 4J91A 2B4OA 1N52B 2QJ3A 3ETOA 3E51A 4KHRA 1TVAA 2QSFA 3WT0A 2OM6A 5IS2A 1HNZF 2XVTA 4B1UB 5L46A 4LFAJ 4MN4C 3FBBA 4FJ9A 1FKAF 5KFOA 4A46A 1X3MA 4XA5A 1TAQA 4JV1A 3FZ2A 2KFZA 4FLZA 1HWJA 5A8KA 4B3SF 2ALZA 3QRRA 4DU7A 4Y2RA 4CO4A 4KY3A 1C20A 4DR6K 1PVQA 4Y65A 2ZZTA 5DO2A 2W2OP 3QT7A 2N4CA 2W40A 2F3NA 3ATVA 2XYGB 2E8OA 4DV0K 2HGNA 3CERA 2R7QA 3AODA 1R6VA 2F40A 1PYTA 4KR0B 1VJ5A 3VALA 5FLXU 4DV2F 3FMBA 1NZBA 2FVQA 3NGUA 1XQIA 3D0HE 4RBTA 4NLOA 3CCVS 2R9LA 2YI1A 3GJSB 4DV1J 2DKZA 2PFFB 1L8OA 5KG1A 2EG2A 3MUMP 4HHTA 1F60B 4C8LA 2G4BA 3RW6A 3CJ1A 4JV0A 4A8QA 2XZWA 1SXEA 1BGXT 1MQ3A 3IXQA 3UXNA 5H9FK 2ZH6A 3GLJA 1NKCA 1S77D 3ET6A 3H90A 2JFDA 5DQGA 4CFCA 1RDAA 4DR3F 1UW9A 1RJJA 4XQ8A 1XNRK 2G07A 3IR7B 3NVMA 2OMOA 3TP2A 2O01C 2HFVA 3VF0B 1HUZA 2BKPA 3ICXA 5AQXA 4E7IA 2V51B 3AVMA 2HAIA 1BPBA 5D0EA 5E3PA 3QUQA 3UPFA 5AM4A 2Y1LB 1B7YB 3JPNA 4H0XB 2UVRA 2LMIA 1S1XB 3D2FB 3WIUA 3ILJA 1L7PA 3G10A 4LF2A 2FDRA 2X6NA 2MPUA 2ZNYA 4QWBA 1RB0A 1JIHA 4F02A 2NSCA 4B17A 5I9EB 3UXPA 2DQNB 1ZD3A 5C10A 4C8MA 2PMZD 4XH4A 1X0PA 2GOLA 2G0JA 4OZNA 4LF6F 2LQ5A 4OZ3A 4FN5A 4PAAA 1VK0A 1OSDA 3BDEA 4OHWA 3W64A 3MDQA 4HHHA 1M90O 1UPPA 3LPEA 1S5LU 1YHQS 1BQMA 3JXOA 2CPZA 8ICRA 5J2AA 2DRDA 1JI7A 5CD4H 3SXLA 8RUCA 4F9OA 2EKNA 3A8YA 1MWKA 5DG9A 3O9TA 3GILA 5HANA 2DBBA 4ZLPA 1Z2ZA 3R6MA 3QICA 5LJ5Y 1XNSA 4H4MB 4AL6A 3HI0A 3HWTA 3LWMA 2Z0GA 1KHWA 3KG1A 1TUVA 3B54A 2E8NA 4KFBB 4F5RA 1KBRA 3W3DA 5CCLA 2DGZA 4LF4F 3V72A 4UTGA 1FA0A 3H5XA 1S0MA 3PX0A 3CCMS 1UVLA 2Q3PA 3M8RA