1U45A

8oxoguanine at the pre-insertion site of the polymerase active site
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primer strand
publication title Error-prone replication of oxidatively damaged DNA by a high-fidelity DNA polymerase.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1u45A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1u45A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u45A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1u45A01
4UB4A 1UT8A 4CCHA 3AO3A 8ICWA 2ETJA 5KFZA 4DL7A 4QZIA 4GVMA 4O5EA 1TKTA 4YCXA 2MUTB 3ETLA 5KFRA 2X6SA 3OYMA 3PW7A 4KLTA 1TGOA 8ICFA 5KFVA 4TUSA 4MFCA 3NCIA 4M3WA 5IILA 1WSHA 4ED1A 2P6UA 2BPGA 4NM1A 3SJJA 1RT5A 3QETA 3V72A 4FLUA 4Q8EA 4R66A 5FROA 4R63A 3FFIA 2FMPA 2UVWA 2VA2A 3IG1A 3AVJA 3G6VA 3QEWA 2G8UA 5KFOA 3ZD9A 1LAWA 4FJMA 1BI4B 4Y1CA 2E4LA 4QZDA 3SI8A 2AJQA 2ZUBA 4E7KA 4J2BA 1J9AA 5KT7A 4KLJA 3L2WA 4KLEA 2O4GA 4LD0A 3NE6A 1ZQMA 4KLFA 3FYHA 4FLZA 5DG8A 3GV5B 4ZH4A 2VWKA 3NF7A 2A1RA 3SUOA 5KFBA 3SNNA 4RU9A 4E7LA 4ED3A 1NOZA 5J2FA 4CJRA 2HMIA 2NRWA 4DOAA 1ZQFA 1KTQA 2ZJ5A 1IKXA 5DB8A 3C2MA 1RDAA 1X1PA 3ITHA 3RB0A 2YHBA 4CHZA 4FJIA 3RJFA 3OSPA 4RG8A 2X6NA 3V9WA 4Z4IA 4BDYA 4FK4A 4LSNA 7ICQA 3ZD8A 4YXJA 3RJKA 4IG0A 1S76D 2W9BA 1VSDA 4HUEA 1YT3A 3LPTA 3TANA 1RILA 1X9SA 4CJEA 1VSKA 2R8GA 4M9HA 3TAFA 4RZRA 4IBNA 4DF8A 2XHBA 2G8KA 3AVKA 2FLPA 1CZ9A 4KREA 1ZQUA 1LWFA 3VQ7A 3G10A 3ZSZA 5J0RA 1RTIA 1MQ2A 7ICOA 1N56A 5KT2A 5CJ7A 3QEAZ 3VQ4A 4IR9A 3QZ7A 1ZQRA 4JRPA 5TZVA 3SZ2A 2W8LA 4OGEA 1MU2A 2C22A 1QE1A 1JL1A 3ZDCA 1BCOA 3ZDDA 4IQVA 1RDBA 4UB3A 2P1JA 4CGHA 3ZSRA 1L5UA 1LW2A 1XC9A 1KVCA 9ICQA 3ZT2A 4KTQA 4YQWA 3KLHA 4CFDA 2KQ2A 3OYBA 3M8PA 3MXIA 1NJWA 3V7JA 4CJKA 2R8KA 8ICAA 3PW0A 1DTQA 4CHQA 9ICBA 3IRXA 3L2VA 3SUNA 3MBYA 3AVIA 3HP9A 4B3OA 1XHZA 5KFIA 3MXJA 1CZBA 3Q8PB 3K5LA 2FPMA 2GV9A 1KVBA 4Z6FA 4OKJA 3GDXA 3DLEA 4GMJB 3LP2A 2MUTA 5CB1A 9ICRA 4R5PA 4DOCA 3OS1A 4KLMA 3CFRA 4Q5VA 5HRNA 4FJ8A 5J0XA 4CEQA 3GIMA 5L1JA 3OS2A 1K6YA 5J2MA 3VA3A 3EPIA 3T1AA 4CJWA 4KITB 2P51A 2WOMA 4UBCA 4PPXA 4GC7A 4Q45A 2KN7A 4FK2A 3Q8RB 4IDKA 5CYMA 5L1LA 3L2QA 3KKRA 2C28A 1VSFA 3D0PA 2RF2A 4J9LA 2OWOA 1BI4A 1RPLA 1ZQLA 3B6PA 3GFKB 3OVNA 1C1AA 4ELVA 1LV5A 4KLHA 4F93B 3C2LA 1RDDA 3DLKA 3A2FA 3LAMA 3NF8A 1DGSA 3H8WA 4RNNA 4RQ3A 2KTQA 1W9HA 1T4GA 3HK2A 2KFZA 4DO9A 2KZMA 4XA5A 1XU4A 4Z4FA 1BPDA 2OPPA 2C2DA 2OPQA 4JWMA 4F4WA 4F50A 1JXBA 3EWAA 3NAEA 4DSFA 1KLNA 4JWNA 2FBVA 4W5OA 8ICRA 4DQSA 2LYHA 4EZ6A 1D5AA 2RDJA 4PHPA 1ZYQA 3S9HA 4KLUA 3KJVA 3ZDEA 4ECZA 1JLEA 2AGOA 2HHSA 3NH1A 3M8RA 1S0NA 1D9DA 4KI6A 4M42A 5KG6A 3RR7A 3DMJA 3U6FA 1S9GA 4YR2A 3NHGA 3SI6A 1I39A 1WSIA 7ICMA 5J0QA 3SV3A 4EZ9A 3HSTB 5KFSA 1IH7A 3B0XA 2B6AA 7ICKA 4DL5A 4DSEA 1GOAA 3NGYA 4P4MA 1ZQXA 5JUMA 1WN7A 5KFWA 1EXNA 1EP4A 4CGDA 2IAJA 3LDSA 3Q8QB 3C1ZA 1A5XA 3SCXA 8ICOA 8ICNA 5DDYA 3SYZA 4KV8A 3HXMA 3C95A 4XQ8A 2X74A 3L2RA 2F8TA 2IHMA 1L3VA 1G15A 2WONA 2G8VA 2E6MA 1SKSA 5J2GA 3H7IA 4CIFA 1TK0A 2ZE2A 2O4IA 4FJ5A 1ZQNA 2BE2A 3E2EA 3K5MA 1ZQAA 1LWCA 1LB2B 1NOMA 3TAQA 1TAUA 3OYHA 4W5TA 4HTUA 4ED2A 4Z6CA 4JV2A 1J53A 4RUAA 3H8JA 4M41A 2JZBB 1JXEA 4GXKA 1S6QA 3DRPA 1EXQA 3JSMA 5J0TA 4EP4A 4TQSA 2PYJA 4KTWA 4DMNA 4O5BA 8ICCA 2JEJA 3AVNA 4MEYA 1BCMA 3N4MB 3V9ZA 3RJIA 2F8SA 4CHNA 2HW3A 3O3HA 2C2EA 4YXMA 5J2EA 4H4OA 4CGGA 1QLNA 1ZQDA 3G0ZA 3AU2A 1HNIA 5DKWA 1TKXA 4RQ7A 3VQ9A 2EHGA 3JYTA 1CLQA 4YFUA 1NKEA 4Z6DA 4M9JA 4RW9A 5FDLA 3RMCA 5KFDA 4HUGA 4NYNA 5EOZA 5DMRA 3ISDA 3HWTA 3VA0A 2NRTA 4O3SA 1D9FA 1S77D 5HP4A 3BQ2A 5KG2A 3U3GA 4ID1A 1NK7A 2FPKA 3AA2A 1Y88A 1ZQIA 2OYQA 3AVLA 2I9GA 2G8IA 3DI6A 1RTHA 1HUOA 4E0DA 3HVTA 1RT2A 2JLEA 2DFHA 5DQGA 1UOCA 2IC3A 1R0AA 4RQ1A 2J6UA 3NGDA 4F5NA 2Y1IA 5J0OA 3THVA 2VANA 1S0MA 3KHLA 5KG0A 4Q8FA 4YD2A 4FJJA 3EZ5A 4ED0A 2HHVA 4I9LA 4CEEA 3PX4A 3SQ4A 2KZ3A 3RB4A 4IQUA 3MDAA 1JKHA 4I28A 4IRKA 1JIHA 3ORYA 2G8WA 3M9MB 4FBTA 2XGQA 1N5YA 5J2DA 3RRHA 4FJ9A 1ZBUA 2P66A 4M2YA 4P4PA 4EEYA 4CE9A 1BISA 2ASLA 5KG4A 4CJVA 4M3XA 2P5GA 3MR2A 4CGJA 4KHQA 8ICBA 3AUOA 4L8RB 5HHIA 2QXFA 4DTUA 4N41A 4M3TA 5J0PA 4KB1A 4R8UB 1TFRA 4J9KA 4FM2A 2DY4A 3AVCA 9ICOA 5J2CA 4K4HA 4I2BA 2FLLA 1FKOA 5DLGA 1UA0A 4FS1A 3DLGA 4CF2A 9ICSA 2HNZA 3HT3A 4I2PA 4FLVA 2UVRA 9ICMA 1BL3A 3ALYA 2AGQA 5KT6A 1TVRA 1XO1A 4LZDA 4CEAA 2FBYA 1RT3A 1QSYA 4IQWA 3UIQA 3VQPA 4DLGA 3PX6A 1B22A 4DTOA 3BGRA 4QZ8A 2JZBA 3RH6A 1S1TA 4P4OA 1HUZA 4RPXA 4DQPA 1C6VA 5HHHA 2RN2A 5KFJA 5KGXA 3PO5A 3AO4A 3RAXA 3RB3A 1I3AA 4CJFA 2IHNA 4KB0A 2IA6A 3OYNA 7ICJA 2FBTA 4DTMA 3V4IA 2PY5A 4DFMA 5KFMA 5DB9A 1Q9XA 2FLNA 4CJPA 5HRPA 3SV4A 4FW2A 1NK4A 7ICFA 2I5JA 2J6SA 1RNHA 3K2PA 3G6YA 2UVUA 3P83D 9ICIA 4ECYA 4UAYA 2XY8A 5KFHA 3O4QA 5FRMA 2BQ3A 4BE0A 4DL2A 4FLWA 5I3UA 1TKZA 4M9NA 1KFDA 2Y1JA 3DRSA 3CM5A 4MFBA 3KHHA 4JS5A 4N5SA 1XWLA 4KPYA 4FZZA 3VQDA 3OYIA 1NOYA 4TUQA 4I2QA 4N47A 4QZ9A 4F4ZA 4Q43A 4NXZA 3JPTA 2XC9A 2KFNA 1D8LA 5EWEA 5J29A 4KLIA 5J0WA 5DBCA 3AA4A 3JPOA 4DFPA 2NRVA 1LWEA 4CJTA 5K14A 3C6UA 7ICLA 3H8SA 4NM2A 4DEZA 4CJSA 1KCFA 3UXOA 2BCSA 3MABA 5J0YA 2NRZA 4F5RA 3AU6A 3V6JA 4MF8A 3V6HA 2Z1JA 3ISBA 4DTJA 3ZDBA 1YTAA 1RYRA 4ZTFA 2RDIA 5KFTA 5L9XA 8ICVA 4CK3A 4XUSA 5J0SA 3KLEA 1A77A 4F4YA 1ITGA 1FK9A 1SUQA 1KFTA 4Z4HA 4MFAA 3OYDA 4KLOA 1CXUA 1VRUA 4UQGA 4YG2A 1ASUA 3MR6A 1VSIA 1VSJA 4RT2A 5SWMA 3IAYA 4R8UA 1KSPA 5CR0A 5DGAA 3VQBA 4I2FA 4HUFA 2UVVA 5HMLA 5KFCA 5KFXA 1T3NA 1JLBA 3NF6A 1GOBA 2BCVA 3RJHA 3HPGA 3OYJA 1J54A 4QW8A 1BIUA 5HROA 1X9WA 3HYFA 4R64A 5SZTA 1VK0A 1XSLA 1BPEA 3L8BA 1TVAA 5KG1A 1HJPA 1BPBA 3H4BA 4C8KA 4TUPA 3TR8A 1DOQA 3CG7A 4GXJA 3OSNA 4F2RA 3QEPA 2HHUA 3LAKA 1BPYA 4EBCA 1ZQKA 5HMMA 1XHXA 2NUBA 3Q8KA 4DOBA 3VQ8A 1U49A 5KI6A 3GV7B 4DTSA 5KFUA 2ISOA 1SKWA 1HYVA 8ICPA 3LPUA 1C1BA 4YFKA 2XY7A 5CHGA 5KFPA 2ISPA 3RJGA 2HVHA 4LZGA 4ICLA 3VQEA 4PGYA 1SL1A 4CF9A 2BGWA 4O3QA 1QTMA 1ZQOA 5CP2A 3JPPA 3QINA 4PHAA 3HP6A 3CFOA 5KG7A 1H38A 2BQRA 2A1JB 2FMSA 1HPZA 1VSLA 2PFNA 2ATQA 2OZMA 1ZQGA 4UAZA 4ECRA 4M47A 4CGIA 1S6PA 3AA3A 1RXVA 4RQ5A 3HPOA 5J2HA 3AVHA 4RW8A 3DLBA 1KFSA 4FK0A 2YKNA 2DFLA 1Z00B 2F1HA 4ED8A 4I27A 4NY8A 1U48A 2JEFA 4IFVA 4J9NA 4F92B 1SZPA 9ICKA 4YNQA 4TQRA 4DQQA 1JL2A 4FLYA 2Z1HA 4M3ZA 3NBPA 1RXWA 4BDZA 1BIZA 2H5XA 4OKEA 3ZSVA 4RW7A 2R8JA 1LW0A 4CIGA 4ECUA 4OPJA 4KI4A 4FM1A 4PWDA 4YP3A 4F5QA 3RRGA 1ZQVA 2D0CA 4Z6EA 4B9TA 3ZSQA 3I8DA 2AQ4A 4OLBA 3ZT4A 1IKVA 4K8ZA 8ICQA 1Y97A 3MGIA 1B9FA 8ICLA 3RR8A 1RZTA 5DDMA 3VN5A 2JGUA 3VQCA 4CEBA 1AROP 3OYLA 1VSHA 2R8IA 5IINA 3DM2A 4BE1A 4O3OA 5D49A 3IS9A 1NK6A 7ICNA 4OLAA 4J2DA 4RQ8A 1VRTA 1JMSA 4ELUA 3RBDA 4KRFA 3NGZA 4QWAA 4DS4A 3KK2A 3QLHA 3PVXA 9ICJA 1HRHA 4IKFA 4DL3A 3EPGA 1Q9YA 1N6QA 1Z26A 1KEJA 2ASDA 2ZTCA 4CFCA 4FLTA 3PW5A 3DLRA 4CHPA 2AU0A 2DFFA 4UB5A 3TARA 1S0OA 2AQ0A 2IMWP 4F5PA 7ICRA 2BANA 2HB5A 8ICTA 3TFRA 2KZZA 3HPHA 1U4BA 4FBUA 2P5OA 4M9GA 4AHVA 5BPCA 1V9PA 1JLGA 3AA5X 3B6OA 5KFGA 1EKEA 4FJNA 1D8YA 1U47A 4B8CA 3MAQA 2HVIA 3MEDA 1ZQHA 3RJJA 1JX4A 4XRHA 4O44A 4DWIA 2MAXA 4NLZA 4CJLA 3BQ1A 4IG3A 4DQIA 1FXXA 3D45A 1TAQA 2C2RA 2VA3A 5DG9A 2NRXA 4MFFA 3MXMA 3QIOA 2KW4A 3DRRA 2FMQA 4KLQA 4UAWA 2A1JA 1NK0A 1ZQEA 4JLHA 4KN7A 3AVBA 3ZT1A 4J9SA 1S10A 4E7JA 3PUFA 7ICUA 1T03A 4NCGA 3QESA 3QIPA 2R8HA 1T05A 3VQQA 2ATLA 3OYGA 3K59A 1RDCA 3JPSA 1Z00A 2B4JA 3ZT3A 1TV6A 3MFIA 3QERA 1ZQYA 5DB6A 4J9PA 4PHDA 4UBBA 4AILC 2QK9A 4YVZA 5JS1A 4BXOB 4ECVA 3T5LA 4AHUA 4RT3A 1KLMA 4C8LA 2HHWA 1VSMA 1WSGA 1T7PA 1QHTA 4E89A 4CK2A 5KFLA 3GQCA 3SUQA 4J2AA 2BHNA 5J2KA 5KFAA 1L3UA 1HMVA 3OHAA 9ICTA 4O3NA 3PMLA 1W0HA 3KD5E 4ELTA 4DSIA 4DTXA 3NGIA 4J9MA 4K8XA 4GC6A 3ZSOA 2D5RA 3OYEA 4KHNA 4CEOA 3VQAA 1U45A 3KHRA 3TAPA 2V4RA 2EX3A 3MGHA 5EU7A 4Q0BA 3JPNA 3MEGA 3MFHA 4M6WB 4E1NA 5HNKA 5DQIA 4I2HA 3AVMA 3CM6A 1EX4A 5HBMA 3VQ6A 5D3GA 4FCYA 1NJXA 4DTRA 2BCQA 4O0JA 4UB2A 5J2BA 2ZUCA 3V81A 1RT7A 1LAVA 3NH0A 2XGPA 4HYKA 4GLXA 4OPKA 8ICEA 4CFBA 4KMUA 2YNFA 1ZQJA 4Z4CA 3H4DA 4RPYA 4O5KA 3P1GA 4J2EA 5J2IA 2IS3A 4JS4A 1COOA 3AVFA 8ICHA 3LP0A 1QSSA 1X2IA 3SPYA 4KLDA 3TI0A 3E01A 1ZJNA 3C6TA 3NTUA 1ZQWA 4PUOA 4QW9A 3K4GA 4B08A 5C42A 1MQ3A 4DU3A 4B8AB 4PY5A 4RQ6A 2VWJA 4IRCA 7ICPA 1NJYA 9ICPA 2Q0ZX 2YNHA 4DG1A 5J1EA 1ZBLA 3LANA 7ICVA 1X9MA 2YKMA 1KRPA 3DYAA 4ID5A 1VSEA 1ZBFA 4FJGA 1C1CA 2PFPA 5KFFA 3PO4A 2XY5A 3PR4A 2Q3SA 4DSLA 4I2AA 1PZNA 1T8EA 2PZSA 3S3MA 2GUIA 4JUZA 3RAQA 1QSLA 2HHTA 4B9NA 5KFYA 2HNYA 4QZFA 5BOMA 5CWRA 3PX0A 2ZUDA 3TAGA 1A76A 1IO2A 1A5WA 5KFQA 2PYLA 2Z1IA 1BPZA 2FC0A 3KTQA 1IKWA 3LDAA 4Y1DA 1SV5A 4ECQA 3AO5A 5DB7A 1DLOA 1RYSA 4PGQA 3IM1A 8ICUA 4I29A 5DBBA 4DTPA 1ZQBA 3KIOA 3GV8B 3CYMA 4PA1A 5L1IA 1HQUA 3OYAA 3OS0A 4YMMA 2XRIA 1C0UA 3KHGA 4KLGA 3TAEA 3T5KA 3RMAA 5CA7A 4I7FA 4BXOA 3H40A 4JV1A 4FJKA 7ICHA 4CGFA 1XI1A 1NK8A 5DLFA 1ZETA 4RQ0A 2Z1GA 3LWMA 4E7HA 3UPQA 4YN4A 1S1VA 2D0BA 1RT6A 4KHSA 5KT4A 3C94A 9ICHA 4J9QA 5IIMA 4CEDA 5KT3A 1ZQQA 2ZQBA 1YVUA 4DL4A 4E3SA 1JLFA 5HRRA 4CHOA 4M6WA 4I9QA 4ECSA 3G6XA 3SPZA 3KLGA 2W9AA 3QEBZ 4CFAA 1ASWA 2FPLA 4CEZA 3NDKA 1TL3A 4NLNA 3S3OA 4QAGA 3FDSA 1BGXT 3OGUA 4BGDA 3LP3A 4DU4A 4C8NA 1CXQA 5KTQA 4DSJA 4FJXA 4GW6A 2ITGA 4QWCA 4LH4A 9ICGA 3KLIA 1RBUA 4HVJA 1XSNA 2G8FA 5D46A 4DSKA 2YV0X 4OJRA 5CYQA 3HO1A 3ZSYA 3KK1A 1U04A 5DG7A 4BWMA 1TL1A 4FYDA 4FJ7A 4KAZA 3Q8MA 4BWJA 3QNOA 1C0TA 4B9MA 4RPZA 4FZXC 2GBZA 1S1UA 4ED6A 5CY4A 2DPJA 3AO2A 9ICCA 3MR3A 2VG5A 1QQCA 3GIIA 2IBKA 3EYZA 4HCBA 1Z3EB 4KLSA 8ICSA 2W42A 9ICUA 4QZAA 1SL2A 4N56A 1A5VA 1MC8A 2PI5A 2BGGA 3C2KA 1RBTA 1WNSA 4N76A 2FBXA 4QZBA 2HHXA 4EP5A 3C5GA 1ZBIA 2ALZA 3NF9A 2BDPA 1HYSA 3PNCA 4MF2A 3Q8SB 4J9RA 4O4GA 4CJUA 4FS2A 4G1QA 1RCHA 4I2CA 5FRNA 3OYKA 1Q8IA 2IGIA 4KLLA 5J2QA 4PHEA 2RKIA 4K4IA 4X5VA 9ICVA 5EWGA 4IRDA 2VG6A 4TURA 3ASMA 3SQ1A 4BACA 1L3SA 5F9NA 4O9MA 3AVGA 3OY9A 3ZSXA 3DOKA 4KKOA 1JLCA 1KVAA 3RBEA 9ICFA 1RT1A 2ZTDA 4M3YA 4YR0A 3WNGA 1SL0A 4EYIB 4M0AA 4H8KA 5DK5A 4DFKA 1UA1A 1FKPA 4JRQA 3RMDA 4YR3A 2BCUA 5F9LA 5BOLA 4E7IA 1GOCA 5HLFA 3K57A 3ZSWA 3SQ0A 5HP1A 5KFNA 3ISCA 1RBRA 3V7KA 2HHQA 4H4MA 3OJSA 5J2PA 2GWSA 3UXNA 3QE9Y 5KRTA 3T5JA 2W8KA 4CF1A 3C1YA 5DGBA 5HRSA 3LP1A 4TSXA 4DLEA 4ECXA 2DFEA 3K58A 1UAXA 4O3RA 3JPRA 1TK8A 3VQ5A 3ZCMA 3QO9A 5CZ1A 9ICAA 2F1JA 3EW9A 3QEIA 4O3PA 4YD1A 4FLXA 8ICZA 5IIKA 1N48A 2IOCA 3MR5A 4F91B 4GXIA 5KG3A 2QKKA 1RTJA 5J2NA 1IKYA 4CERA 1BHLA 3S3NA 3RH4A 3TFSA 2A1SA 2OPSA 3V9SA 4CF0A 9ICEA 4NYFA 4QWBA 2V4QA 4ECTA 4JV0A 3L3UA 3RWUA 4RUCA 4NCAA 1ZBHA 3M9NB 4B9LA 4ZHRA 2E6LA 2VA8A 4DTNA 2BPFA 3BDPA 1REVA 3GIKA 1ZQTA 4R65A 3MDCA 4DU1A 4CF8A 1CEZA 3WNEA 3KLFA 4WE1A 3PMNA 5I42A 1JLAA 2DPIA 8ICJA 1WCLA 4O0IA 3OHBA 1HQEA 4OGCA 4EBEA 4AHTA 1WLJA 3SQ2A 1ZQSA 1WSJA 2VG7A 2BQUA 3BQ0A 4ZTJA 4AH9A 7ICIA 2G8HA 5KFKA 3AVAA 5J0UA 2ZJAA 4LVSA 4DQRA 1CUKA 2F1IA 4B9UA 3RTVA 2D0AA 3AO1A 2HNDA 3PW4A 4PH5A 4C8OA 3V1QA 1HJRA 4EBDA 1BPXA 4F4KA 3L3VA 1B92A 3QEXA 1NK5A 3V9UA 3CFPA 8ICIA 4XIUA 4CJQA 1WSFA 1S9EA 3UQ0A 4RNOA 4F2SA 3V6KA 3LWLA 2V9WA 3CQ8A 1O1WA 1HNVA 4FJLA 3TQ1A 3F9KA 3PW2A 4IR1A 3K5OA 2RPIA 3HX0A 2XY6A 1RT4A 4LH5A 3M9OB 1C7YA 1TKDA 1S1WA 3O4NA 3K75D 4FXDA 4M3RA 4HHTA 1ZJMA 3WNFA 5E41A 4FZYA 5KGWA 4J9OA 4I2GA 4G3IA 4PGXA 2JEIA 2P6RA 4DL6A 4QOZB 1NKCA 1J5OA 2F96A 3LK9A 7ICEA 3MECA 4O5CA 3ZDAA 2AGPA 5KG5A 9ICLA 3AV9A 3DOLA 2BCRA 8ICYA 1S0VA 3H08A 4NLKA 3N97B 2XCAA 4FM0A 1ZQZA 3HJFA 5IIIA 3F73A 1KDHA 3LZJA 4IFYA 5DQHA 4ECWA 5T7BA 5C25A 4KTZA 4KFBA 4BE2A 3OJUA 4OVLA 5D4BA 4KHWA 2M9NA 1IG9A 4C8MA 3HM9A 1ZQPA 3UQ2A 2PFQA 7ICGA 3O3FA 4UB1A 3QZ8A 1RBVA 5KRSA 4ED7A 4YMOA 2J6TA 1Z25A 2DTUA 4CJ4A 1IM4A 9ICNA 2YNIA 4RQ2A 3TABA 1UWBA 2XCPA 3DLHA 3V7LA 1U9LA 2ASJA 4RQ4A 4QZGA 3QEVA 4FJHA 2W9CB 1S97A 3RJEA 3ULDA 4FVMA 3MEEA 1B43A 2PFOA 4F5OA 5IIOA 4QZCA 3M8QA 4Z4EA 4B9SA 2ZD1A 4F3OA 4KHYA 4KHUA 2PI4A 3LALA 4LSLA 3BJYA 2BR0A 3V1RA 3IHQB 4Z0UA 3I0RA 4NLGA 4AHSA 4W5RA 2I1QA 4YMNA 3GIJA 2OZSA 4E1MA 4M3UA 3QNNA 1WAFA 1RTDA 3HL8A 4RW6A 4MQ3A 4DF4A 3OYCA 1RBSA 2W9MA 1NK9A 4F3TA 1QS4A 4F8RA 3HW8A 5J2AA 3RB6A 2IDOA 2YNGA 4CK1A 4RW4A 4K4GA 4I2DA 1L3TA 3NH2A 1JN3A 4CJ3A 7ICSA 4QWEA 4NCBA 2ZTEA 4KN4A 2X78A 3JPQA 1XSPA 3L2UA 3B0YA 3KD1E 3RMBA 7ICTA 5KT5A 1WSEA 4CHYA 1S5JA 1BQNA 2XO7A 4CJ5A 5IIJA 2OA8A 3K5NA 2JEGA 3UXPA 5C5JA 3T19A 8ICMA 4F4XA 1NKBA 1NJZA 5C24A 4QCLA 4W5QA 3Q8LA 1B9DA 1ASVA 2ZJ8A 4JK1A 4I2EA 3EY1A 8ICXA 4AHCA 4QZHA 3C5FA 4DS5A 1HYZA 1TV9A 3U3YA 3PY8A 4QWDA 3O3GA 1F21A 2PXIA 3P5JA 3V6DA 3V1OA 1JLQA 3WNHA 8ICKA 1TK5A 4M45A 4HCCA 5DBAA 1S9FA 4B9VA 2OPRA 3RH5A 4Z4GA 2R7YA 1XS9D 3OYFA 1S1XA 3KK3A 4M9LA 4Q44A 3GILA 4DFJA 1JXLA 3T5HA 1SKRA 5EWFA 1WAJA 3T3FA 2B21A 4OKKA 1EETA 2W9BB 1IXRA 1BQMA 4I2IA 4EYHB 3LZIA 4CEFA 1MSWD 1C0MA 3ISNC 2BPCA 4KO0A 3PR5B 1DTTA 4I2JA 8ICGA 4FO6A 4AHRA 5KFEA 4PQUA 1WCNA 4CIEA 3TWHA 3M8SA 3NFAA 4RNMA 1BVSA 5CZ2A 1UT5A 2QKBA 3SUPA 4O55A 1K1SA 3C21A 3TAMA 5L1KA 5JS2A 9ICXA 3HVRA 4LY7A 4W5NA 2BKEA 4IQTA 3KKSA 2YHAA 2W9CA 1K1QA 3PV8A 4CECA 2WTFA 4MEXA 4CESA 4M04A 1ZQCA 4P2HA 3BQTA 3I0SA 2LSNA 2B5JA 3V9XA 4QZEA 4FW1A 3C23A 3ZT0A 5J2JA 4BDPA 9ICWA 4E19A 1YTUA
chains in the Genus database with same CATH superfamily
3PYEA 3IRXB 4UB4A 4JI4F 3AO3A 4KJIA 2ETJA 2QL7B 3MCAB 4OMFG 4YOEA 4QZIA 3HSJA 4CYUB 5ALUA 3LP2B 5CQGA 1QDUB 3GFZA 2WW8A 4GVBA 3PW7A 4KLTA 1TGOA 1IVZA 3I4HX 5A8KB 4JB3A 1N88A 1CI4A 3CC7N 4GKKJ 1CLFA 1F3VA 3IG5A 1Q46A 5AKZA 2BPGA 5F8IA 3QETA 3ED5A 1GXUA 3FFIA 2UVWA 2CH5A 3THYA 2LECA 2E4LA 3SI8A 1RZMA 2AJQA 5ALFA 3UDLA 2O4GA 2V51B 1ZQMA 1CS4A 2ZGZA 5T41A 4FLZA 2VQFJ 2HI0A 2VWKA 4PG7A 4PHTX 4A8WA 3DLKB 1SV0A 1RFQA 2UUCK 2VC0A 4JKGB 4S0MA 3J8AA 3SFUA 2HMIA 3N6LA 1KTQA 2ZJ5A 1IKXA 2DH8A 5DB8A 2PEHA 4CT9A 3G8TA 5AI8A 2FF6A 2YHBA 4JD2B 3GZFA 4WXOA 1W7AA 1FFUA 4FJIA 3MMAA 3BZKA 2ADCA 1KQGB 1FD8A 2W6KA 4X65F 2HQCA 2JC1A 3V9WA 3BREA 1IG8A 3BZCA 4QR2A 4DR2J 3I96A 4LSNA 4PRFA 4IG0A 2GWKA 2W9BA 1JLEB 4ZS6A 4HUEA 2D3UA 5CYJA 4QIWD 1FWKA 2U1AA 3TANA 4QIWF 3BGFA 1LFWA 2R8GA 3TAFA 1YJWN 3DMJB 1S9GB 4IBNA 4DF8A 1EJ7L 2XHBA 3AVKA 3TZXA 3G10A 3TUZC 1ZD4A 1SBRA 1PJ7A 3QEAZ 1R8BA 1RAEB 4IR9A 3G25A 1DARA 2DGZA 5TZVA 3SZ2A 4LFBF 2W8LA 1MU2A 1R89A 1HKCA 3ZDCA 4DCHA 1RDBA 1HNXK 2MDAA 2A3JA 3ZSRA 1IQTA 1L5UA 2IAJB 3PYDA 1X8DA 2Q6BA 2MLXA 3PJXA 2QARB 4P2FA 3KLHA 4CFDA 5AQUA 1IQZA 1NJWA 3HT0A 1MN9A 4USTA 5AQJA 1F44A 4C8ZA 2DTJA 9ICBA 1V3RA 5EOYA 3L2VA 2Q66A 2VH7A 1J5EJ 3TX8A 5ELZA 2GV9A 3DLEA 5M2PA 2YWWA 1XR6A 2GTDA 9ICRA 1FVQA 4W90B 4DOCA 3OS1A 1SC6A 2D0PA 4KLMA 3CDAA 4K0KF 2HSZA 3EVOA 1Q5VA 3MM8A 4BC3A 2MSNA 2A19A 4PL8A 5J2MA 1QZ6A 4Y2JA 3T1AA 4CJWA 4KITB 4FK2A 4IDKA 3NMAA 3JSMB 4E1JA 2FTRA 2AJ2A 4IFEA 3WHIA 1KDNA 4DHYA 1RPLA 2DR5A 3KDNA 4OZ0A 2YY6A 3E3XA 1GLJO 3M32A 3OVNA 2V50A 1GLEG 1T9WA 3PG9A 1C1AA 4B02A 1LV5A 1FO4A 3VEVA 5AKJA 3C2LA 1MG7A 1NRKA 3JYTB 3CXCM 3O8WA 3LAMA 2W43A 5AZIA 2CQ2A 3O9QA 4K2JA 2W3SA 1W9HA 1T4GA 3P45B 3AHPA 5BN9A 3FRYA 2ZH9A 1RHKB 4GV9A 3GTYX 4Z4FA 1BPDA 1BC6A 2F77X 4K42A 2K4HA 5KQ8A 4F4WA 1OUQA 1YRTA 3DI6B 5AI9A 2CPRA 1P27B 4DSFA 3QUCA 3G87A 8ICRA 5CH7B 2AT1B 2JRSA 1NZAA 4EZ6A 1D5AA 1SIWB 2RDJA 4OJOA 2ZHBA 3ETRA 5DO2A 1U0HB 2KHQA 4WKYA 3KJVA 4ECZA 1HWLA 1OSCA 2HHSA 3M8RA 1W2BR 1S0NA 1D9DA 2UUAF 2R9LA 1WSIA 4NLYA 4EZ9A 2D6FC 2JL9A 3A5MC 1M5SA 1IR2A 1KQFB 1IH7A 1IUJA 4OX9K 1GOAA 3AGRA 3HFKA 2VF3A 1ZQXA 1EXNA 1A7GE 2CDQA 1XNQK 2EAOA 5E3PA 2YWHA 3RUBL 2BM1A 3HSGA 1IJEB 5DDQC 1KR4A 8ICNA 1HW9A 3C16B 2UV8A 3R5BA 1YJTA 4KV8A 1ZM3A 4M5DA 3QU7A 2RRNA 1PC4A 3IMQJ 3MMCA 1L3VA 1FKOB 1BO5O 2HOQA 3SBGA 2E6MA 1SKSA 2WC9A 2HNZB 1H73A 2LHTA 1TK0A 4GKJK 3M1FA 1S1XB 2D41A 4FJ5A 1ZQNA 4LRCA 2E88A 3K5MA 4NLRA 1LWCA 3R5CA 3C6HA 5AQTA 1TAUA 4OYXA 4W5TA 3DGPB 3CCRN 4JV2A 4DPOA 1SV0C 1JXEA 3DXMA 4EAHD 2E5GA 2EC0A 1EXQA 1BMQB 1UP1A 4FZNA 1NU0A 2DO0A 3THTA 4X4PA 1F9FA 1R3NA 1BCMA 3N4MB 2CVIA 2PT0A 2UXCK 1YJ9S 1B4SA 3ET6B 4H4OA 3A0IX 3R97A 1OMSA 2BOPA 1XMQK 5ALXA 1HNIA 2W3RA 4RQ7A 1CLQA 4YFUA 4BR7A 1B70B 3RMCA 2I5JB 1NMDA 3CF5Q 5DMRA 4I68A 2RHSB 3VA0A 2NRTA 4O3SA 1D9FA 4JI2K 5I3UB 5AM0A 2B0CA 1UFKA 3DRSB 1NK7A 1N54B 2FPKA 3AA2A 1WEXA 2Q79A 1SC1B 4KSEB 3ILLA 4OI4A 1HI8A 2UUCF 3HSDA 4X84A 3C6AA 3Q22A 1RTHA 1RWUA 4E0DA 2HRYA 4OHZA 2CJXB 3ADAC 3UDEA 2JLEA 5E3AA 2H4YB 3PKMA 2Y1IA 1NXIA 3ZTPA 2AYGA 2VANA 2K2PA 2HBJA 1U1KA 4DV0K 2VC1A 4NYPA 1Q86O 4FJJA 3BKFA 3HHLA 4I6MA 1JNZB 2EWSA 5G0RB 1KS2A 4A59A 1VLBA 3O6WA 4DUZJ 2FJDB 4OPAA 1R6VA 3CO9A 4NLXA 1E6VA 1RAIB 4DV2K 3TUPA 4IQUA 2PEBA 2G0JA 1JKHA 1OY6A 4FNIA 5D0HA 4IOAQ 4FBTA 1SQFA 4I0WA 5A8RA 3KLEB 4MYTA 1FK9B 1SUQB 2DKXA 4NOHA 2IRYA 5KG4A 3J7A1 4M3XA 3MR2A 4A8QA 4CGJA 2FY1A 1NGCA 3NS7B 4L8RB 2CIMA 5AM1A 4KB1A 1TFRA 2W40A 1CJVA 3M05A 3SAHA 2AF6A 1SH3A 4A8OA 3R27A 1HNXF 1LOUA 2ZM6K 1F9HA 4FS1A 3DLGA 4HEA9 1HI0P 3RF9A 2CYYA 4FNHA 4I2PA 1R8HA 1BL3A 5HROB 3M30B 4KH1B 1XO1A 4LZDA 1BNPA 2FBYA 1QSYA 5CAAA 3MM7B 3M3ZA 2NRHA 4KHPJ 3O3LA 4H0OA 4QZ8A 5LM7E 3H2LA 2QFJA 4BG8A 2O5DA 2BBEA 2ZBQA 5B09A 1S1TA 4P4OA 3O9UA 2G06A 4RPXA 5CABA 2DKOB 2KICA 2M9KA 1I6JA 1C6VA 2BW7A 3UNYA 2RN2A 3OR1B 3DLJA 4QIGA 1Y5IB 2CQ4A 3RBXA 4AE5A 1W97L 4USKA 3SSSA 3RAXA 4CJFA 1N60A 2ZOFA 2FBTA 1Q4RA 2HRTA 4IZ9A 2J9DA 4I6YA 2PY5A 1AZSA 3I32A 3WKAA 2JC0A 4CJPA 5HRPA 5AXLA 5CA5A 1RNHA 2QX0A 1N33K 4UAYA 5FRMA 3RRKA 1TKZA 4AL7A 4M9NA 1FT8A 1KFDA 2DISA 4DR5J 1FJCA 2CPJA 3H20A 4RW8B 3GU0A 3IGVA 2UU9J 4IH7A 3RW7A 2GJ2A 2G4BA 4I2QA 1X5SA 1JXVA 3QSIA 2IVPA 2QW9A 4NXZA 3JPTA 2XC9A 5B0CA 2F4VJ 4WFAL 4R5PB 5EWEA 4W98A 5AQZA 4WBFA 3VAKA 5J0WA 1R0BG 3T1YJ 5DBCA 3IA0A 3AA4A 4DFPA 2OSRA 4UB8U 2NRVA 1LWEA 3GE9A 2MYFA 3SBTA 3MC1A 2WF7A 3CF5L 1HR0J 5K14A 3C6UA 1WOQA 4HKQA 5AKHA 7ICLA 3NBPB 3CQYA 1YWXA 3OVSA 3DGVA 3PHTA 1KCFA 4BRPA 3RJMB 3MABA 3KBBA 5IC4B 1LW0B 3PEJA 4ES2A 4K2XA 2O1PA 4MF8A 2NYVA 1GLBG 4DV5J 4DTJA 3ZDBA 1RWKB 5KFTA 5DDRC 1TQLA 2EFPA 4XUSA 4KGZB 1FFSB 4F4YA 2XMJA 4YDXA 1KFTA 4Z4HA 1VQYA 4V19J 4HI2A 2UUBK 4JYAK 1Q16B 4LF5J 4K4SA 2K89A 4OX9F 1IKVB 3JXOA 2R2RA 1ASUA 3HF5A 1VSIA 2GV1A 5FPDA 1SJQA 1VQNN 3IM8A 3JXUA 2XMVA 1P8GA 5DGAA 3VQBA 3NCQA 5HMXA 3IS9B 4C4RA 3UD3P 2OPQB 1ZA1B 3NF6A 1GOBA 5J1NA 2BCVA 3RJHA 3AB4B 3MCPA 3HFVA 4QW8A 4IOAL 1X9WA 3KK2B 1ED1A 1HD0A 1RJJA 4R64A 3TP2A 1N6QB 3G71S 2R2UA 3EZUA 1TVAA 3WKCA 4GKJF 1XTZA 4C8KA 1EKSA 4BVPA 4H4KA 3G96A 2EFQA 1S22A 1D3WA 1ZQKA 4WIQA 4BQZA 1XHXA 1WTFA 3VQ8A 1U49A 1JLGB 3GV7B 2E9TA 2DHGA 3OXFA 5KFUA 2E1RA 4ZPBA 3KFWX 3MEDB 1UCVA 3LPUA 5LSLA 4NI2B 2HK2A 2XY7A 5KFPA 2ISPA 1YITS 4QS9A 3L3FX 3W62A 4IG3B 4ICLA 5BR8J 3HKZC 1SL1A 2BGWA 1BA1A 3ZNUA 3I55S 3QINA 2UXCF 1H38A 2BQRA 4RBUA 4FZVA 2A1JB 4DMZA 3KG4A 5LJ3Y 5IV4A 3CDWA 1XMQF 4U7CA 2ATQA 3HHLC 1ZQGA 5ETKA 4CGIA 4M47A 4K4TA 1S6PA 2CAJA 3KZIU 2X1AA 2HGMA 2YTUA 3EZOA 3EE8A 3IFRA 1T9XA 5M1NA 4UARA 2IOFK 5AJ3J 2YKNA 2DFLA 2CPHA 3AAQA 4JI2F 5AKXA 1H98A 1TV6B 1PK1A 3QNWB 4J9NA 3JB9k 5KOXA 3I33A 1YI2N 2QWPA 3R7NB 2WF6A 4DQQA 5FPNA 3GJSB 4KX5A 2LMIA 1PJ5A 1RXWA 5LMUJ 4BDZA 1U8SA 5ALQA 2H5XA 1RA6A 2KJ9A 4DV0F 3EM1A 2R7QA 4WK3A 1Q0NA 2B4OA 4RW7A 2CPFA 3Q24A 1OH6A 3RRGA 1TUGB 3OTOF 5B8HA 4Q0BB 3PNIA 4DV2F 3CCUN 4ID8A 3A5OC 5C2CA 4DV4J 3WQTA 2ZBIA 1NM2A 8ICQA 1WSRA 1B9FA 4FKYA 3D7EO 3RR8A 1RZTA 2A3VA 2JGUA 1NG9A 4M5KA 2LXFA 1GMVA 1YJRA 5GIOA 3NLCA 1RT7B 2HMPA 1GK8A 2HIYA 3N7SC 2F7VA 4OX6A 4OLAA 4U96A 4J2DA 2QB0B 3AJDA 2X3DA 3R2CJ 2VODA 2VUGA 4ELUA 2MZTA 3RBDA 4KRFA 4D3HA 4QWAA 3H46O 2LQ5A 1HRHA 2WB4A 2HF4A 5AKKA 1NH8A 4EU0A 2ASDA 1Z26A 2Q97A 1SB3C 3C6TB 2CJKA 4CFCA 1VBYA 2KN4A 4CHPA 5ALYA 2DFFA 1OKJA 1K8KA 5C42B 4OV1A 4F5PA 7ICRA 1QY7A 1X5PA 2BANA 2HB5A 4CLKA 4P0QA 2P5OA 4FO0A 1WDTA 4M9GA 1JJHA 2MKKA 1QQMA 1V9PA 1N32J 1F5SA 2RE1A 2D7SA 4CI6A 2YKMB 1HNWK 4ID5B 1D8YA 1ZQHA 3RJJA 4MN4C 1JX4A 1Z19A 1RE1B 1J97A 3HM8A 4O44A 2ZC4A 4NLZA 3GOIA 1TUVA 1VQ9N 4OZ2A 2CG8A 2O8BA 4CLLA 4G1IA 3DRRA 1YDLA 1RAOA 4OJ6A 1BD6A 3TWZA 4KN7A 4Y6IA 3AN1A 1SV5B 3AVBA 3QGHA 3CJSA 3H0PA 2WTUA 5GTIU 1M1KT 2JFKA 1D4XA 4WFYA 5ADXA 4J9VA 5JVHL 1N33F 4JKBA 2ESEA 1QTNB 4F4AA 3U9DA 3RAMA 1Z00A 3KOOA 1LXJA 2P5VA 2B4JA 4OI6A 1TL4A 4FE3A 3A12A 3MFIA 2KOBA 3ZNJ1 1C0UB 4PHDA 4UBBA 4USAA 4HAIA 3CERA 2HRUA 2ZFHA 1F6TA 3SCLE 2EBGA 2FVCA 4C8LA 1KLMA 1OYEA 5FLXY 4FYVB 1TUWA 1QHTA 1DT9A 5BYQA 2QLXA 4CK2A 2F5GA 3SUQA 2CNOB 1RT6B 2BHNA 3T79A 2YMPA 1L3UA 1HMVA 1NSKL 4O3NA 4PJ0U 3U8XA 4TN2A 3QU9A 2P9EA 4DTXA 2J0WA 2YX7A 3CCTA 1MA7A 4CEOA 2YH1A 3VQAA 4ETXA 4ETZA 3HZ6A 4C7QA 3JPNA 3DHWC 4ILJA 3MFHA 3ENWA 2JLFA 4GV3A 3CCQS 5FPEA 2XWXA 3LDQA 3AVMA 1ELOA 1MA9B 1NJXA 4DTRA 5ETSA 2QWOA 1K5OA 5J2BA 2V8HA 1YBTA 1A9NB 4H4KC 1SQEA 2UUBF 4JYAF 5D4PA 1EKRA 5JJBA 1S72N 2YNFA 4ER8A 4XK8C 3VZHA 3H4DA 4RPYA 4O5KA 3UVJA 4HT7A 4C3MA 3PIPQ 1UEUA 4CIOA 1WF1A 3AVFA 1S3XA 3FMBA 4OX8A 4KLDA 2E2PA 2YWGA 1HIYA 3TUIC 4CO4A 1IXKA 4ZJLA 2XMUA 3VGUA 3MUMP 5CRXA 2N7CA 2RHKA 4ZPTR 4QW9A 1NGDA 1VQSA 1C0TB 3GU3A 2RRDA 4UY8O 5IT9U 4DG1A 1ZBLA 2NLWA 7ICVA 4ZVHA 1X9MA 3POTB 1RWVB 2VG5B 2FSKA 3PCOB 2NXCA 4OLPA 2BKOA 4FJGA 3GSIA 1RACB 4JI7K 4FVUA 2DEIA 2XY5A 1W26A 3PR4A 2CPYA 2BX6A 2E1ZA 2Q3SA 2WSCC 3S41A 1PZNA 1T8EA 3EUB2 4USUA 3M2RB 4JUZA 4NASA 3RAQA 4A8YA 1NGBA 3T9NA 4ZCMA 3NVZA 2O8EA 2K1RB 2HNYA 4QZFA 4LFCK 1W25A 2PYLA 3H2UB 2YMLA 1BPZA 5EXWA 4Y1DA 2ZJRQ 4RX6A 2VFTA 1WHVA 1DLOA 3MK6A 8ICUA 4PPZA 2HMXA 1ZQBA 4G1QB 5ALEA 3KIOA 4ISEA 1G7CB 4PA1A 4C80A 4C23A 3OS0A 3FBBA 1TZ0A 2XYGB 3QQCD 3HDSA 2LM4A 3KHGA 4KLGA 2IVYA 3RMAA 4BXOA 5F41A 4AYBC 2F8MA 4JV1A 2UUAJ 3PSPA 1F60B 1NK8A 1Q7YT 1ZETA 3LWMA 1RYUA 5FJ4A 4ENOA 3C94A 3IMXA 3KUHA 4ISFA 2W2OP 1ZQQA 3ILOA 4R0EA 1BDGA 2OEHA 1JLFA 4E3SA 2DITA 2JZ5A 3VHQA 3G8QA 4I9QA 5B0FA 2MQLA 3UCGA 2RUGA 4Y2SA 3KLGA 2QO3A 3QEBZ 4FF4A 1ATNA 4CFAA 5KL8B 2FPLA 4LF4K 3DXBA 1TL3A 4M5MA 1O51A 4QAGA 3R5JB 4CO3A 3OGUA 2W2QP 3SMPA 3CCVN 4DSJA 3FBEA 3H1VX 4X66J 2GGPA 3KLIA 3QO9B 3CCSS 1LQ9A 3HO1A 2GOLA 4OCZA 1UPHA 5DG7A 4FJ7A 3WDOA 4IDHA 3KFUF 1VHIA 2WVEA 4FZXC 1S1UA 3T9ZA 1RTJB 4IOCQ 1OY8A 4CZHA 1ZAWA 2ZEJA 1U1RA 2LEPA 1TYQA 4LIRA 2V69A 1QQOA 2HVZA 2OPSB 3PIPL 1YJNN 4OL8A 1Z1BA 1HNWF 2CG4A 3PJWA 5A6WA 1FESA 3P96A 2FBXA 2WAQD 2QG9B 3BUZB 2Y9TA 1UTAA 4FF1A 4KH5A 4DX6A 1HYSA 3LH2S 4MF2A 2FHOB 3CCZA 2K8BB 2IVMA 3TVKA 4O4GA 5AKYA 4FS2A 4JMUA 1NNEA 1REGX 2OO4A 5A0LA 4JI5J 3FEXB 1PCAA 2APOA 1RCHA 5FRNA 2XLKA 5LXYA 1JRPA 4HL9A 4X5VA 1F5BA 1Q95G 2DK2A 2HNDB 2C2ZB 3AOAA 3H0LB 3SQ1A 2ZBPA 4BACA 1UL3A 2QA4S 1NMEB 2A2DA 4KKOA 4NRTA 4IEIA 3RBEA 3M1VA 2ZJRL 3SQGA 4IOXA 4RQNA 1SL0A 1IV8A 3CJBA 1F5AA 4QS8A 2BH1A 2W2NP 2K4EA 5DK5A 2X7IA 1UA1A 1FKPA 3RMDA 1L7MA 3WT0A 2HBYB 1GOCA 3NNAA 5HLFA 3K57A 2V8PA 2NSCA 5AQNA 1N34K 2F3JA 1N5QA 5HP1A 1UFWA 3V7KA 1RK8A 4PL2A 3R8EA 4CZKA 5J2PA 2H3VA 4KR0B 4MO4A 1NNLA 3UXNA 1LXNA 1QQ7A 3THXA 2CN1A 5IXUA 2ABYA 3T5JA 2QC3A 3US5A 4WZQA 2W8KA 3MPDA 1T03B 1Z4UA 1VQ4S 3MN6A 5DGBA 3ETOA 2Y0SC 2Z2ZA 3DKDA 3LP1A 3WXIA 3K58A 1J5OB 1WWVA 3SXLA 1T3VA 3CMAS 4CD1A 3HHEA 4DN0A 1XIQA 2CQGA 2ILYA 1KD1T 1VRQC 2F1JA 4ZIVA 4EENA 3EW9A 3ZFVA 4FLXA 4BC7A 1E6YB 2A5XA 2J0QD 5M1QA 4F91B 3AA8A 2V34A 2H54B 3QATA 4CYUA 1APSA 3QBXA 1IJJA 1OWXA 2QKKA 4H5TA 4CERA 3OR2B 1B0XA 2G08A 2M88A 1YVNA 3UB5A 3PACA 2XVTA 2MQ8A 3TFSA 2A1SA 1X7VA 3AJ2A 3CCWA 5J8YA 1WG4A 4I67A 3TTDA 3RWUA 4RUCA 2VPWB 2XYHB 3WX4A 2ZIXA 1R8AA 1ZBHA 4B9LA 4JK8A 3R5AA 3QB0A 2CH6A 3D6MB 2LQJA 4JI7F 1ZQTA 3MDCA 3HSZA 4CF8A 4YHHK 1IBKJ 1Q3VA 3S7RA 1X6IA 3WQUA 1L7NA 4WE1A 4O0IA 2J9DE 2QA1A 1URJA 1HQEA 4OGCA 1XERA 2AJFE 2XMTA 4C97A 4AHTA 1DEJA 1RHJB 3PSTA 4LFCF 1ZQSA 4UUXA 3MEEB 3F56A 5IWAJ 4PZOA 1N0UA 3D6HB 1XR5A 2ZD1B 3CD0A 2MTLA 2W4DA 4AH9A 3CT9A 3HI0A 4JKGA 3WK6A 5J0UA 4BR9A 1HWIA 1Q5YA 2CQCA 2FZCB 2F9DA 1CUKA 2F1IA 2DR6A 2I1RA 2HFOA 2P9CA 3WK8A 3RTVA 1HHTP 4C8OA 4K4WA 4ZJQA 4CF3A 2YCHA 3BPDA 1HJRA 1WBBA 3DU6A 1BPXA 2B4PA 3J7ZT 4CQ1A 3L3VA 1EQ0A 3U26A 1NSPA 3I56S 3V9UA 2DNMA 4XIUA 1C4CA 1S9EA 4EFHA 1R7IA 3UQ0A 4DV1J 5B66U 4WKRA 3KK7A 1GTHA 2RT3A 3LWLA 3A5NC 4C0ZA 4BJQA 3CQ8A 2E1YA 5ADXH 2I5HA 1KHVA 1HNVA 3CP8A 3LDLA 4J9UE 3UDVA 4Z94A 4MMOA 4Y2MA 5THWA 1U26A 4OX9J 2RPIA 1RT4A 2A0FB 4LH5A 2MPUA 1S1WA 2P9SB 3U9ZA 2C3UA 4NWBA 3VC8A 4FXDA 4M3RA 5C24B 1XNQJ 1CJKB 3MPYA 4NZ6A 1I1GA 3HHNB 1JALA 2NRRA 3GJTB 3TYTA 3MD1A 2G1HA 4PG8A 3A8EA 4LF4F 1AXQA 1YBUA 1JNRB 1TUUA 2D3DA 2D3ZA 4OZ5A 3LGHA 3OXGA 4IWVA 5AKGA 3H3OB 3JTOA 1OPIA 4P7TA 5L38A 4O5CA 1KEKA 3MURP 2OH2A 3NEKA 3NS1A 2MZJA 4IH6A 2BCRA 1TL5A 1S0VA 3N97B 1VC0A 4FM0A 1VQLN 1UVJA 4LFAK 1MMNA 1FA0A 4YDUA 2ZDPA 4N8OA 5T7BA 2E5IA 3Q83A 3VENA 1EIYB 1TMJA 3K8VA 3FGVA 1C4AA 2L9DA 3F41A 2I7PA 1YQHA 3DOMB 1DTTB 2LQBA 2ZVSA 4ATNA 3CPWM 1ZAVA 3UQ2A 2PFQA 3J80O 2HHHJ 3CCQN 2W4CA 4UB1A 4KX3A 2H3IA 5KRSA 2J6TA 5AK6A 2IRUA 2YNIA 3TAMB 3RVCA 3TABA 3B8AX 3DLHA 3V7LA 4CWBA 1B0VA 1G6BA 4QZGA 1NBWA 3I9V9 3QEVA 1Y3JA 2QSWA 2DGOA 3RJEA 1A6LA 2OKQA 1B43A 2IJRA 4IO9Q 4U9RA 1MWMA 3M6ZA 2MKJA 5ETOA 4F5OA 3HKWA 5F8JA 4B9SA 2O6KA 1JK9B 3I0SB 2B5JB 2QLTA 1EARA 3DXKB 4Z0UA 5AQWA 4NLGA 1MN8A 3H1QA 4W5RA 4ZJOA 1Z6RA 4YB6A 3PEHA 5ALIA 3EKSA 5LSOA 1VI7A 1TP7A 3L95X 3LVWA 5G4DA 4USHA 4RW6A 2Y9UA 2NPIA 2IVOA 2W9MA 2YB1A 1QS4A 2K7KA 4DV0J 2O01C 3AJ1A 5J2AA 3C28A 3RB6A 2YNGA 3CCJN 3W8GA 2EK6A 4K4GA 3FSXA 3NH2A 1HUXA 3JSRA 3H5YA 2ZTEA 2X78A 3I5CA 3KDOA 4XDDA 5L46A 2QE5A 3KD1E 1WSEA 3FFIB 2HDOA 3UO0A 4CJ5A 3THYB 1QAIA 2WF5A 2FVPA 5C5JA 3CJCA 1RB0A 3SMZA 2HS4A 1NJZA 1HBUA 3ICLA 1FRKA 2XZDB 4X64J 1CS4B 1SWWA 4XH5A 2ZJ8A 3EY1A 1N34F 4AHCA 4JOUA 4QZHA 1U1OA 4QWDA 1ZOTA 3O3GA 1F21A 3WKEA 2HMIB 1CRXA 4OHWA 3ZZZA 2ZM6J 3IKMA 1IBMK 1IKXB 2ZBCA 8ICKA 4M45A 5J8YC 4HCCA 2KRBA 1QHAA 3KG0A 1XMOK 3AMZA 3CETA 1XS9D 1T95A 1AA1B 3MMAB 2ZDOA 1S1XA 4DFJA 4X4SA 3NS5A 3T5HA 3IAS9 3CJTA 4LSNB 1CSJA 4OKKA 4Y2YA 4IG0B 2W9BB 1S4EA 4EYHB 3E9PA 2R4FA 2BPCA 1VBZA 4I2JA 3NAIA 4RLEA 3TSQA 2PE8A 1DZ5A 5AHXA 3NFAA 2H1YA 3SK3A 4RNMA 1WDDA 3SUPA 3CTRA 5AI5A 2AV5A 4CH1A 3ZTSA 1MU2B 3HVRA 3E66A 4W5NA 2G5HB 2BKEA 1WACA 2VKQA 4WIIA 2EDUA 3VGTA 1CQMA 4MJKA 3PV8A 1KW4A 4YHHF 1XNRK 2QI2A 4CESA 4JHDB 3VOVA 2IOFA 3KLHB 2LSNA 5C2DA 3ZT0A 2B9WA 1YTUA 2CQ3A 2HBRB 4UT4A 1K0VA 3ZEUA 1T9TA 1RAJA 2FY8A 4GVMA 3DLEB 4O5EA 3X3UA 5FP0A 2FGCA 3MM6A 1R8CA 5KOWA 5KFRA 2X6SA 2QT7A 4Q2LA 1HW8A 1CPZA 2DNKA 5KFVA 4TUSA 1KTVA 4DX7A 4MFCA 2PIIA 3NCIA 4IO9L 3MM8B 2ZC3A 1OW5A 2F2AB 5J2MB 1RT5A 4GKKK 1K73O 3V72A 5GMDA 5FROA 3PSIA 4R63A 3O5BA 3JSBA 5IM0A 3FZBA 2VA2A 3IG1A 2O3DA 2AXTU 2L08A 3QEWA 2ASMA 2G8UA 4I56A 3I28A 2XM3A 2DNOA 5E5NA 2ZUBA 2KNJA 4J2BA 3M32B 4JYAJ 4M63C 4CW7B 2CQIA 5BRHA 4KLFA 3GV5B 1R31A 3NRWA 2A1RA 1UFLA 4YDUC 5KFBA 1VCTA 2R7SA 3SNNA 2G09A 5IC6B 2HSEB 5AZIB 4PABA 3IFEA 2GQ2A 5J2FA 5D15A 4DR3K 1SXLA 2NRWA 3EKUA 4DOAA 5ALSA 2KE7A 4YOUA 4F67A 1NM1A 2XIDA 4WZMA 3DHXA 1G3OA 3RB0A 2QA4G 2LI6A 3Q7BA 4CVNE 3RJFA 1B64A 3EDQB 5AM3A 5E7OB 1WOOA 1N8RO 2ITMA 4RG8A 3ZETA 2NUUG 2DVIA 4CLWA 3TVYA 4BDYA 2FJ6A 3KJVB 2AYBA 2B8QA 2PBDA 3ZD8A 4YXJA 3RJKA 4R25A 2LEBA 4DR2K 2WZ1A 1VSDA 3E0FA 5AK3A 1H2UX 5KNIA 1YT3A 3LPTA 2CPXA 3FZHA 1X9SA 2LQ9A 5CE3A 2F40A 3G4SN 4RZRA 2GH1A 1WG5A 1OS5A 2KIVA 1NDKA 5ETMA 1RHRB 1ZQUA 1PJ6A 5F8NA 1LWFA 1NPRA 3ZX3A 2F3NA 5F0UA 1CULA 1N56A 2P9UA 5CJ7A 4PPDA 2R2SA 1JUDA 2VV5A 1VDVA 4ZPWR 3QZ7A 1ZQRA 5I3QA 4DV7F 4OGEA 1M5KC 1F3FA 2C3PA 1UVMA 4C4WA 1BCOA 2IM2A 3P8BB 1X4HA 2P1JA 1VGYA 2B4VA 1RABB 4F72A 4KTQA 1OYDA 2FSJA 4JV5K 3OYBA 4M5DB 3MXIA 2D8CA 4OQJA 2IPOB 4ILGB 2R8KA 8ICAA 3MMCB 4BROA 1KQSR 5LJWA 4YORA 4QU6A 2ZUGA 4B3OA 1XHZA 3MXJA 4HHUA 3K89A 3Q8PB 3K5LA 1Y10A 1ZD3A 2FPMA 4OJPA 3N5FA 3MEKA 3DXSX 1ZZFA 2OTLS 2ZWOA 1LWCB 4GMJB 3O0FA 3ISND 2Z57B 2MUTA 4USVA 1HQ2A 4R5PA 3NNHA 1YIJS 4Q5VA 5HRNA 3OBWA 4CEQA 3QFHA 1S5LU 5HI7A 5ALRA 1K6YA 4LRAA 2D1CA 3VA3A 3EPIA 4JP8A 3DXMB 2N4DA 5HATA 1FRIA 4UBCA 4CO2A 1RQLA 2KN7A 4Y2KA 3VEYA 2FZGB 5CYMA 3CUNA 3UNGC 3HULA 4GO5X 1LKYA 3NMUA 3MI7X 1M5PC 2PC6A 2RF2A 3WKBA 4J9LA 3T41A 1Q81T 1SJ3P 2KP7A 1BI4A 1T6DA 4H0XB 2VYPA 4H4OB 4JNEA 3OFGA 4IH5A 1HNIB 3IBWA 3UKRA 4KLHA 4WFNQ 3L7OA 5LY3A 3ATUA 5AQPA 1YX2A 1H6KX 3RFAA 2IA0A 4NRUA 4RQ3A 3GCXP 2KTQA 3NASA 2R42A 2KFZA 3MXHP 4DN9A 1Y3KA 2OPQA 1RTHB 3NAEA 2JOQA 1TU0B 1NJIT 3R2DJ 2FBVA 1WOSA 1IBMF 4CBWA 2V2QA 2KG0A 4P2MA 4GVLA 4F04B 4XTTA 3S01A 1XMOF 2PN6A 4KGXB 1VQ8N 3S9HA 2GW8A 2WSFC 2AJ4A 2FJXA 1WI6A 2WB1C 3HHLB 1ZBSA 3CMES 4PYAA 4I6MB 4M42A 3ENQA 5EX3A 2R2TA 1LK5A 3U6FA 4RWTA 4C2MA 4YR2A 5AQMA 3MCSA 4JKFA 5J0QA 3SV3A 1E6VB 1JKHB 2B6AA 2EZZA 2FUG9 4BR2A 2P9KA 4DL5A 2VONA 5EX5A 4YS2A 4RWWA 2LYVA 2KKHA 5A8RB 1F2HA 2E66A 1WN7A 5KFWA 4FWPA 1EP4A 2F8KA 4CGDA 4R0JA 3C1ZA 2YB4A 3O1LA 1CJVB 3FGUA 2BUPA 3HXMA 4RR5A 3C95A 1GLAG 2OSQA 3L2RA 2F8TA 1EO1A 2IHMA 3W9IA 3HD2A 1G15A 4JKEA 1XNRF 2G8VA 3DLGB 3H7IA 2P6SA 4I2PB 5K8PA 2ZE2A 2R3VA 1LB2B 2QGFB 3H42A 2CXYA 3TAQA 1OQ3A 4ED2A 1J53A 4LREA 1VC6A 2VOPA 5AM5A 3MTJA 5AM4A 2VICA 4LF6J 4FWLA 1S1TB 2EKYA 4GXKA 3DRPA 3GZ7A 2YX6A 4TQSA 2CZ9A 2AJ1A 2EFGA 4JI8J 3TZZA 3MCOA 2JR5A 2XI9A 4DMNA 3IN5A 2JEJA 8ICCA 5H9EK 3AVNA 4MEYA 1P8ZA 4GKKF 3RJIA 5BPLA 5DM6Q 2ZH3A 2C2EA 4YXMA 1FNMA 3DWLA 2B7CB 1AZSB 4UF4A 3AU2A 2AH5A 3IG8A 3VQ9A 2EHGA 5M2UA 4Z6DA 4M9JA 2KHVA 4HUGA 4HDGA 5EOZA 2Z58B 3ISDA 5AK4A 4I1TA 1S77D 5HP4A 1ZM9A 1KL9A 4ANEA 1TKZB 2E8AA 5BREA 4WTYA 5KG2A 3U3GA 4ID1A 2WAQC 3UW1A 1WEYA 2A10A 5A0YA 2DHHA 4CLTA 4DR3F 4CM2A 2P6TA 4I2QB 3HVTA 1FX2A 2GFFA 4B1VA 3VPZA 2IC3A 1U2CA 1TE2A 4B3SK 1ZPWX 2J6UA 4RO0A 5AR0A 3D2WA 3W9JA 5J0OA 4WFNL 3KHLA 1FEHA 1LWEB 4WFZA 4YD2A 4OZJA 5K14B 3C6UB 4WYLA 1U8WA 4DBQA 1ZRMA 3M6WA 5EVZA 2ZZMA 3JTNA 2ZXIA 3IM9A 4DR2F 3MGVA 1AUSL 3A8JA 4IRKA 2G8WA 1U2RA 1UJ4A 4CJ7A 3M9MB 1O8BA 4ED4A 3C19A 5D8HB 4M2YA 3EVMA 4WJBA 4W4MA 4BRLA 4CE9A 1BISA 2ASLA 3IO1A 5L39A 2GJFA 2N7YA 4X4UA 1HLWA 4CJVA 4MHVA 2M0NA 1O5JA 3D66A 2YQ3A 4NL5A 1RWPB 2RE2A 1M0SA 2P5GA 4KHQA 2XBPA 4M3TA 4N41A 5HHIA 2QXFA 4CLUA 3FZ2A 2KKZA 4FM2A 2YPYA 4CBXA 4GFJA 4K4HA 5DM7Q 4PKHA 2CQPA 1UA0A 3UCZP 3FBFA 9ICSA 1QAJA 1PSDA 9ICMA 2AGQA 5KT6A 1TVRA 2GMLA 4P2XA 2V2ZA 1BWFO 2V68A 4B1UB 1RT3A 3A3PB 4DLGA 3NUQA 3PX6A 3NVKA 3BGRA 3BSNA 2GWJA 2ZG6A 4M5LA 2MSTA 2BJDA 4EX6A 3T6BA 2JZBA 4I69A 4KHPK 3RH6A 4FYXB 5K5MA 1UKUA 3ZZRA 2HIQA 4BG9A 2BZ2A 5HL7Q 1ZBTA 1GQEA 3J81O 5HHHA 4YOYA 2PD1A 2YTCA 4K5SA 3NKYA 2HAFA 4LBHA 3PO5A 2P8IA 1I3AA 4KB0A 4F3QA 2H65B 2VKRA 4ICLB 3CCMN 3V4IA 5K8MA 2OUGA 2XTJP 4HACA 4MTPA 2LLZA 3OW2M 4LF4J 3I4PA 2RS8A 4FWMA 3SV4A 3GG1A 2ACYA 1VQKS 2J6SA 4L73A 1KAXA 2GJIA 1KQKA 3H25A 1QAXA 2XY8A 2DGWA 2RB7A 5ETNA 2BQ3A 1DHMA 4DL2A 3HMJG 1S6PB 3KHHA 4V19X 3FJ2A 4JS5A 4X62J 2ZVIA 4FZZA 5IFMA 2XS7A 2YKNB 2X51A 2WBRA 4OZ3A 4N47A 4QZ9A 4PXCA 5DM6L 1E3MA 4Q43A 1PK1B 2G13A 3HOTA 2KFNA 2UU9K 1D8LA 2BRLA 1SJFA 3HTVA 3DCAA 4CE6A 2QTDA 2F4VK 5AT1B 4NO7A 1NZ8A 3KNGA 3IR5B 4CLPA 2BE7D 1WELA 2FC9A 3H8SA 1X4CA 1RG6A 4NLUA 5H9FK 3W63A 1IR0A 1RGVA 4C11A 1HR0K 1G1XA 4CJSA 3UXOA 3FUYA 5HJXA 5J0YA 2XSFA 2NRZA 4RW7B 3LW5C 2KU7A 1X31C 2A1BA 3CC7S 3V6HA 4EMDA 3ISBA 2P9IA 2KXNB 4ZPCA 4C0BA 4ZTFA 4CK3A 8ICVA 3SDEA 4DV5K 1A77A 2K06A 3F5AA 4KLOA 2K1RA 4UQGA 3ILJA 3FM9A 2D9PA 1VSJA 4CZFA 3B4MA 4KGVB 5SWMA 4R8UA 4LR9A 2DQNB 4LF5K 1VIOA 2XYPB 1NO8A 5M2RA 2KHCA 2UVVA 5HMLA 5KFCA 5KFXA 3MD3A 3CRXA 4QYZJ 2QZ8A 2O66A 2CQ0A 1S6OA 4DPTA 1BIUA 4W92B 3I8BA 3W3SA 2MEWA 2B9EA 3M2VA 2GIFA 3HVWA 3QRPA 2GZOA 1ZH5A 1OJ4A 1BPBA 1K8KB 4TUPA 3I76A 2OANA 5AICA 3AGKA 3OSNA 5CHCB 3QEPA 1UEKA 3X1LB 4P0QB 1BPYA 1FFVA 4DOBA 6FD1A 2VPYB 5DM7L 2QYGA 1QVFR 1HPMA 1SPBP 1SKWA 1WF0A 3PFEA 1HYVA 4OJGA 4E2FB 2G2ZA 5AI6A 2WVCA 1FE4A 3JAMO 4O44B 3J7YI 4HVZA 2W25A 2DGUA 1YHQS 3VQTA 4PGYA 1YJWS 4CF9A 4O4RA 1WWUA 4O3QA 3SD7A 2O8BB 5CP2A 3JPPA 4PHAA 3DRRB 5KG7A 1HPZA 1FDBA 1YJUA 5A2QO 2GS8A 2OZMA 5HL7L 5B0GA 2IY5B 4ZVFA 1NZPA 5J2HA 4U8VA 1PAEX 2RD5C 2D4WA 5EE1A 3ULHA 1Z00B 1X9XA 1FF2A 4I27A 2VJUA 1U48A 1FJGJ 5AJ3K 1BHNA 2HSTA 3MAAA 2VFUA 3OV7A 9ICKA 2HWTA 4YNQA 2W01A 1KLMB 1H2VZ 1JL2A 3VF2A 4YUDA 2Z1HA 5ALZA 1LNQA 3AB2B 4B3SF 1HMVB 1KWMA 5C7PA 2R8JA 4CIGA 1NZBA 4TYBA 2ZNZA 4KI4A 3FQKA 4H0YB 4FM1A 3HJEA 4MIBA 4PWDA 4YP3A 4F5QA 2NQPA 3OQ2A 3R3TA 3IDHA 3VERA 1ZQVA 2D0CA 1FHTA 2WBNA 3ZSQA 2Q1NA 1BE4A 4PZNA 2Q1LA 2H5JB 1S48A 2AQ4A 2MKSA 1M5HA 1FXLA 4OLBA 5DZ6A 4JI0K 1SZHA 4X4VA 8ICLA 4DV4K 5T7LA 2WF9A 3VQCA 2HLUA 5AQKA 3FR0A 4BVOA 1Z4OA 2R8IA 4CGZA 3DM2A 2KG1A 2EFVA 3UQSA 7ICNA 4OFZA 2B0GA 1VRTA 3QWPA 1K9MT 2YNFB 2PDAA 3TRGA 4MLEA 3QJPA 3ILIA 3B6BA 4FOIA 3QLHA 3PVXA 2OEMA 3BKUA 4WCEQ 4DL3A 3EPGA 4K5RA 2FJWA 4J5OA 1KEJA 3ZTQA 4H5VA 3DLRA 3SLCA 4UB5A 3TARA 1S0OA 1NGFA 1NWKA 4DX5A 5KPRA 8ICTA 2GAGC 3TFRA 1U4BA 4FBUA 4ZA1A 4BC9A 4EUVA 3ZZUA 4AHVA 5BPCA 4DG1B 3Q2SC 1V5IB 3B6OA 2BM0A 5KFGA 2AW0A 4FJNA 1U47A 1N32K 3W2WA 2LYBA 2VD3A 4KHPF 4XRHA 4OYBA 3J80Y 1OH5A 4FP9A 2ZBRA 4L3NA 1H3DA 3BQ1A 4DQIA 3D45A 4TKTA 2C2RA 4YB7A 5DG9A 2NRXA 4Y65A 3TX0A 3O8MA 2O8EB 2M2BA 2HNYB 3QIOA 4JAXA 5KAIU 2E1CA 1ZQEA 3N6MA 4JLHA 3ZT1A 1EWQA 1DLOB 2XS5A 4OIXA 3PZPA 3FC4A 7ICUA 1T03A 3QESA 3SBMA 1FEZA 4CF5A 4TY9A 3OYGA 2FVQA 4M8LA 1RDCA 2VBWA 4DFDA 1UWAA 3P49B 1GFWB 2ZIUB 5JU5A 3E51A 2QEXN 4DPWA 4NLWA 3BO3A 2JHEA 2Z7JA 4N8NA 4LFAJ 4BXOB 3UM9A 4OD0A 2PA3A 3SENA 4UATA 3K0SA 3WQPA 2FB0A 4ILMA 4CZMA 1PIEA 2UU9F 1DY3A 3UN3A 4U95A 3T69A 1RLDA 3K1ZA 1VQ5N 4J2AA 3AD8C 2JVOA 2ASPA 3FCHA 4UOFA 2UXDJ 1J27A 2F4VF 2K60A 9ICTA 2KLAA 3HKZD 3KD5E 3VESA 3HKZF 4DSIA 2R18A 3CCRS 2K8CB 3NGIA 4K8XA 5M1OA 3ZSOA 2D5RA 4KHNA 3WK7A 3KHRA 1JLFB 1UQVA 2YMQA 1HR0F 4A8FA 1KBRA 5EU7A 3HLUA 3MEGA 5HO4A 4XEIA 1FDDA 4OYMA 4OHXA 4F25A 5DQIA 3CM6A 3HHLD 3TO8A 3KLGB 1X40A 4L74A 4EHUA 3V5RA 4C0OC 2E20A 2BCQA 5F3ZA 2MKYA 3FC9A 4DV5F 3OD2A 5ALDA 4O8UA 2JV3A 4HYKA 1P7DA 3R3LA 3UCUP 4CFBA 2DXDA 3VMFB 4LF5F 5J2IA 2GGPB 3KLIB 3KVGA 3HFZB 4OJ3A 4CZIA 3HSCA 3E9OA 3SPYA 3G82A 3E01A 3NTUA 1FW6A 3BBFA 1HI1A 2RAQA 3K4GA 2BEFA 1MQ3A 4PY5A 4RQ6A 3F0NA 3HX9A 1N63A 4IRCA 1J2NA 1NGEA 3AQEA 5CCLA 1S1UB 5ETQA 5AQGA 4KGMA 3GJRB 3WXLA 1KRPA 3DYAA 1E4GT 1TYQB 4OYIA 2V94A 1ZBFA 1C1CA 2PFPA 1RWOB 2BZFA 4DSLA 1URRA 4WCEL 4DV6K 1BWEA 4NA1A 1XK8A 5B0BA 4C6AA 2HHTA 2RDDA 3H6EA 2GMJA 3PHEA 1UPPA 3TAGA 5KFQA 3CEDA 2DNPA 2X1BA 4UY85 3EE9A 3D68A 2FC0A 1IKWA 2K4PA 4ECQA 1HYSB 5D0RA 5BR8F 4O4GB 4PGQA 1UJ5A 3S6EA 4I29A 1I5OB 5DBBA 1B7YB 4DTPA 4OJ1A 2C1EB 2ZZTA 4J03A 5L1IA 5IQ6A 1K8AO 1HQUA 1SB6A 2AJ0A 4M7YA 4YMMA 1Z2LA 1XMOJ 1J2MA 2E5JA 1B4FA 1J6ZA 4WWSA 1Z05A 4NPOA 2JX2A 3T5KA 3MOZA 5CA7A 4I7FA 3QRQA 5AKEA 3QU5A 1UHUA 3H40A 1D09B 4M95A 4FJKA 4CGFA 1JROA 4YMEA 2AIRB 4KKOB 2VB6A 2Z1GA 4MIAA 5AJ3F 4E7HA 5HMYA 3M1VB 5JXSA 3SQGB 3CIZA 3EXYA 3CE8A 2FJAB 9ICHA 5A6PA 2QB1A 5IIMA 1FKPB 3N28A 5B7WA 3ENOA 1GLDG 2B3TB 3QJLA 4M6WA 5HLFB 4ECSA 1GLLO 2RQ5A 3P6YC 3VGLA 1XR7A 3D3CJ 5HP1B 4Y2PA 2NUHA 2ZJQL 1V6HA 2W7AA 2BRKA 5J2PB 3FDSA 3THXB 1KONA 1XNRJ 3LP3A 2BW2A 1UMJA 1CXQA 2QM1A 5AM2A 2BACA 3M8ZA 5IS2A 4JI0F 4GW6A 4UTGA 3LP1B 3QNMA 4DV4F 2ITGA 4QWCA 4RL1A 3BH6B 2JSXA 1GX5A 2G8FA 3NWGA 4ZVOB 4IFVB 4PXBA 4X66K 3DXKA 2KT5A 5D46A 4Y2UA 1BLUA 3KWMA 3ZSYA 2JH7A 4BWMA 1TL1A 1HHSA 3WX8A 2DY1A 1XQSC 4KAZA 4BWJA 5ADZA 3PFOA 2Q31A 4EK2A 4DPXA 2F63A 4ED6A 1DK3A 2DPJA 5E84A 1HNZK 3MR3A 1IBLK 1IWGA 1Q3UA 4CDIA 1QQCA 3CJ9A 3WKDA 4LQ9A 3KMQA 1YRUA 3VWSA 4OYPA 1Z3EB 4ILLA 2IYIA 4L3KA 8ICSA 5B08A 4WU3A 1MWZA 1WC1A 4QIVA 3ONQA 1SL2A 2ZIXB 4WF9Q 5M1KA 4N56A 3CULA 2DGSA 1N32F 3C2KA 1UCNA 4N76A 1Z2ZA 1WBDA 4EP5A 1PVRA 3HOSA 4CBUA 3FZKA 1ZBIA 4C7YA 3CJ4A 4ZCKA 4WE1B 2EW9A 3QAEA 2BDPA 1HQEB 2F1FA 3HCXA 2C3MA 3AFGA 1M6YA 3CCEN 4C1NK 2DNGA 4DR3J 4CNQA 1ZTWA 3ZYYX 3H59A 4A8EA 3SFGA 1LOTB 1Q82T 2YWFA 2DNZA 1W7WA 1WUUA 2J5AA 4JI5K 2RKIA 1VQNS 4K4IA 4C9DA 2Q6CA 2G0IA 3C7NA 1Q53A 1T6CA 3B8HA 3RZAA 1HWKA 1XEZA 3IBFB 4MLHA 5F9NA 5GVQA 2NS1B 1XN9A 2RQMA 4GVEA 3AVGA 2QN6B 5AKIA 2ZTDA 2LDIA 4YR0A 1S9EB 3M6KA 1G4CA 5MLCV 2NXUA 3KOAA 4M0AA 1CJTA 1S99A 1YGYA 1YHQN 1HNVB 2H51B 2KIWA 1NHKL 5BOLA 1PK3A 4LR7A 3G9CA 3O9TA 1KAYA 1RT4B 1SVDA 5BPNA 1S1WB 2QTWA 1ACMB 2HHQA 4BUGA 2F8EX 4H4MA 3NVMA 2GO9A 2QMUB 1QCKA 4GMKA 2AZ1A 2C2OB 4CF1A 3RG6A 2KT3A 2G2OA 2J0XA 5I4MA 4JV5J 1N5XA 3H0RB 4TSXA 1U0SA 3IGNA 2XZTB 4JHDA 2KB2A 1QVGM 4KC5A 4AYBD 4AYBF 3SIPB 4M5NA 1TK8A 1WG8A 3VQ5A 5CZ1A 3D28A 4YD1A 1VJ5A 5ALJA 4AP9A 3M6UA 2IOCA 3NRBA 3HHKA 1RAFB 3MR5A 3A8KA 5KG3A 4JN4A 1RQ0A 1FI4A 1BHLA 1QJHA 2VIXA 2R7VA 2EG2A 4CF0A 9ICEA 4NYFA 2WFAA 1YI2S 1RADB 1L8OA 3L3UA 5ALNA 4USMA 4LF9K 4NLOA 4FPBA 2V8VA 4WFBQ 1REVA 3DU5A 5D3GB 4R65A 3TKAA 2YNIB 1OIAA 4YY3K 3PMNA 1Y0HA 5I42A 2DPIA 2MKCA 3M6XA 1WCLA 3OHBA 2V63A 1H7XA 1IBKK 1HX1A 1WLJA 3CCUS 3LGMA 1WSJA 1S57A 2VG7A 2BQUA 2POKA 5FIIA 1WG1A 3G6EN 4Y2VA 4QIFA 2YMMA 7ICIA 2O8DA 3TPQA 2Y3YA 4LVSA 2WF8A 5IWAK 3MM9B 3NCRA 2L41A 2E1MC 3N0VA 1HEKA 2D0AA 2ZWPA 3LDNA 4PH5A 1MMDA 3V1QA 4NV0A 4OZNA 3D3BJ 2LP4A 5GIPA 1B92A 3KLVA 4RW6B 3QEXA 3CFPA 2W04A 3N4PA 4A8MP 1YJVA 4F2SA 1OSDA 2YNGB 4K4UA 2AP6A 3BYRA 2V9WA 4QR1A 3QGGA 3THPA 2IMOA 3AQPA 4CT8A 2DF4B 3WU2U 4DV1K 2Q0RA 3QAUA 1O1WA 2NZTA 4JI6J 4FJLA 2OD6A 3F9KA 1ROFA 2MJNA 4IR1A 1NI3A 4ZVTB 3M9OB 2JJ4D 3D1HA 3O4NA 2PFUA 2E5LJ 1HBUB 4HI1A 4H54A 3J81j 2HBKA 2VL1A 1RWMB 5E41A 8RUCA 1X5OA 4J9OA 3GLJA 1GX6A 1VQ9S 1MWYA 1KVJA 4LC9B 2P6RA 4CLYA 2EK1A 3EGNA 5LSRA 1SXDA 2F96A 7ICEA 3H8YA 2E1AA 2AGPA 9ICLA 3CPEA 3AV9A 3DOLA 3DFEA 5GAEP 2HBMA 2CZ4A 4NLKA 2J9CA 2XCAA 2WSEC 3HJFA 3I5AA 4X66F 3LZJA 2WHEA 1WKLA 1JCEA 4ECWA 1JCGA 4KFBA 4BE2A 1VHFA 2I2YA 3DRYA 2ZGYA 3CJ5A 4OVLA 3KHYA 1NDCA 2M9NA 1IG9A 3U1MA 2MB0B 2ROPA 1V4TA 3DRXA 3NXZA 1HNZF 5CZVA 5H9EJ 4V19S 3QZ8A 2RIJA 3VAIA 5C2GA 4ED7A 4YMOA 1GTEA 1KVIA 2DTUA 3E8OA 4CJ4A 2HHHK 3CO0P 4TLRA 2YJEA 4F0MA 4P7VA 2Y0SD 1U9LA 2Y0SF 3Q8VA 1O0PA 1HIWA 1S97A 4OJ5A 4NLBA 3ULDA 4FVMA 5HAOA 2MLZA 3OTEA 2VBXA 5IIOA 1F5CA 4KHYA 4KHUA 2PI4A 4LSLA 4JBCA 2E2NA 3QX7A 1HBNB 2BR0A 3IHQB 4FWNA 1K44A 2Y1RI 5DDOC 4DPYA 4CO5A 2I1QA 4YMNA 4AD6A 3NNCA 2HGNA 2OZSA 3ZEUB 1S72S 4JI5F 3IP4B 1RTDA 4B3SJ 3EGZA 4DF4A 3MM6B 4EIAA 4F3TA 3B82A 3LGNA 4F8RA 3HW8A 2IDOA 1WC5A 4I2DA 2QWQA 4ES1A 2MRLA 3UN2A 1JN3A 4CJ3A 7ICSA 3NCPA 5KL1B 2KEYA 2YKAA 1ZOLA 3VAFA 4CO1A 3JPQA 1XSPA 3L2UA 1RT5B 4RNFA 3J81Y 3WUHA 1N62A 4EO6A 2KJ5A 3TTFA 1S5JA 3CW2C 4AL6A 5IM0B 4NXNJ 3IG1B 1AQ6A 3GE1A 1M90O 2OA8A 3UXPA 3N01A 8ICMA 2DGVA 4Y2CA 3FK4A 1EQYA 4F4XA 1NKBA 2HAIA 3I9ZA 3S6JA 2D69A 3HD1A 3Q8LA 1KC8T 2GLEA 2F76X 3PYFA 3C5FA 1HYZA 4X64K 2KJWA 3U3YA 5L8RC 1ATRA 2B7BB 3OXLA 2PXIA 2XMMA 3V1OA 1JLQA 3WNHA 2RQKA 1C0FA 3QFPA 2DD8S 1SJ4P 4NEYA 7FD1A 2ES6A 3W64A 4M5IA 1S9FA 2OPRA 3RH5A 4X4OA 3BSCA 4P72A 3Q7CA 3O9SA 3SEIA 3SCIE 3U1LA 2V52B 3MAHA 3WK4A 3ZETB 3GILA 1F9EB 3SJHA 1T0TV 5DZ7A 3D2FA 1SKRA 3AOCA 4FZLA 4EHTA 5F8MA 1RKIA 2P9PA 2Z56B 2CJ9A 3LZIA 4CEFA 1C0MA 4IUFA 6AT1B 3VAGA 8ICGA 3IC1A 1KBUA 4AHRA 1WCNA 4TYAA 2LU2A 1LWFB 5CZ2A 2XG8A 3W61A 4QR0A 3W5XA 1CULB 2FYXA 2P9UB 3C21A 1V3SA 2HKEA 3A3OB 2L48A 4LF9F 5JS2A 3BN7A 2KM8C 5GTHU 2VQEJ 3BQ7A 4IQTA 3KKSA 2A2CA 2W9CA 1K1QA 3R9LA 2WTFA 2EFOA 3JQMA 1TELA 4K4YA 4YY3F 1ZQCA 2KI2A 1ZXIA 1IBKF 4JI3K 3RBZA 3RSEA 1NEEA 3DDHA 4E19A 9ICWA 2PFDA 2R7UA 3KMSA 3SAGA 1DGKN 1UZDA 3D9BA 3THWA 1VIXA 4A46A 1UT8A 4CCHA 4B3OB 3CCVS 1J2VA 8ICWA 3V4MA 3IRWP 3QGIA 4DL7A 5IWAF 3ALRA 4AXIA 4DR7K 5H1SV 4YCXA 2MUTB 3ETLA 2V7YA 1GT8A 8ICFA 4CTAA 1GMUA 1VQ6N 2CNLB 4M3WA 5IILA 1FKAF 5C2FA 1WSHA 4ED1A 2P6UA 3H5XA 4EEKA 5H9FJ 1YZ7A 5TKWA 2AWZA 3LUYA 4FLUA 4R66A 1C2PA 5M1PA 5CYMB 3WEEA 2FMPA 4EO8A 3JAMY 3FSIA 3VEXA 1LKYB 3D5MA 1Z1ZA 2YKQA 3MR7A 3FEYB 1K47A 4QIEA 4DV1F 2RF2B 2KJ8A 4UW2A 1MWKA 4LSZB 4FJMA 3BYPA 3KLFB 1BI4B 4QZDA 2CADA 3UE2A 2F9TA 3CDUA 5KT7A 5C15A 4KLEA 4F36A 4LD0A 2DR9A 3NE6A 2XICA 3CDBA 1YJNS 3FYHA 5DG8A 4MH8A 5KQDA 3UKRB 4FOEA 3SUOA 3C2PA 5A2QY 3D6RA 1C20A 4ZKAA 2Q36A 2N3LA 3TZWA 1ZQFA 7FDRA 2KRRA 1RDAA 1XNQF 1X1PA 3O6QA 2GHPA 3ITHA 4KQZA 3QGPA 3U27A 4TU9A 3UD4P 3FQLA 4TU8A 3CJ3A 1PYSB 2GMHA 1ZM2A 2X6NA 2GQCA 1PUZA 4JKHA 4NA2A 3KWGA 6FDRA 5MLCQ 1S76D 4U6PA 3H5UA 4Y0FA 2XNRA 8AT1B 3BO4A 3VF4A 3AAWB 5ITHA 1RILA 4CJEA 1VSKA 2CDRB 5HJYA 1NGIA 1H72C 2G8KA 1CZ9A 1FVSA 4A57A 2FE9A 4E8UA 2B6AB 1MROA 2COLA 1YAGA 3ZSZA 5J0RA 1RTIA 1VQMN 5GINA 5KT2A 5AQQA 2P9KB 3VQ4A 3NVWA 3R1XA 1WEZA 2PA8D 4P9SA 2ZKTA 3RU0A 1QE1A 1JL1A 4P73A 4IQVA 1EP4B 4LQ3A 4UB3A 4PCQA 2HHHF 4ZPAA 3M7VA 1LW2A 1KVCA 3ZT2A 1TTHB 2KQ2A 4NXMJ 2FHJA 2RQCA 4CJKA 2HVEA 3PW0A 3CJ2A 3SUNA 3MBYA 3AVIA 2YVSA 4H0PA 1YLXA 2ZE2B 2EZXA 3F2BA 3NOCA 2I7NA 2OAUA 4ZCIA 5CB1A 2KFYA 3CFRA 4UASA 1RAHB 3J7Z5 4FWKA 5J0XA 2H3FA 5L1JA 1SV4A 3OS2A 4C3LA 1P9QC 1RUSA 1ZC6A 3TOQA 2WOMA 2P51A 4AT1B 4Q45A 3DRPB 3Q8RB 3GWCA 5L1LA 3C15A 3A4TA 2C28A 1VSFA 2E7WA 1WUAA 4XO0A 4ZIWA 3LTOA 2K8GA 3QT5A 1ZQLA 1PO6A 3B6PA 3GFKB 5I3PA 4MDBA 3ZO7A 5F0XA 3B78A 2ZUAA 4ELVA 1R8PA 4JI0J 2YY3A 2JGAA 1T9VA 4F93B 3GG0A 1RDDA 3A2FA 4DB3A 3C0BA 4GY2B 2G07A 3H8WA 1IG6A 1NB7A 2ZIVA 4DO9A 2AKWB 4XA5A 2MKHA 3A5LC 2HFSA 2OPPA 2DIVA 4X64F 3CC2N 1T3QA 5A0YB 4JWMA 2PMZC 1JXBA 4F50A 4O3MA 2O8FA 3EWAA 2RRAA 5F1XA 4B3RJ 4ZITA