4DQPA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and ddctp (paired with dg of template)
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
580
structure length
576
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 199
structure length 576
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqpA01
2FC0A 3OGUA 5DG7A 1BPBA 5DB9A 3DLHA 9ICUA 2HHWA 3NE6A 3SJJA 5J0UA 2JEJA 3G6VA 4L8RB 1EXNA 4F4XA 2P6UA 4RW7A 7ICUA 5DGAA 2A1SA 3T5KA 1S5JA 3KK3A 4IFYA 3ORYA 4KLDA 4ECXA 4QZGA 3L3VA 4CJSA 4F4YA 5CY4A 4CHNA 4K4HA 1MQ3A 4NLNA 4E7JA 4UB1A 1WSEA 3T5LA 1ZQYA 2FLLA 2Z1HA 4P4MA 5J2BA 1I39A 1XWLA 1TK0A 3ZT0A 4F4KA 2ZTDA 4I2PA 1HQEA 3RH5A 2EHGA 1ZQVA 3NGYA 4DU4A 3WNEA 3L2QA 8ICLA 4KLEA 4Z6DA 4B8AB 3C5GA 1SL2A 4ECYA 3SPZA 3KIOA 3K5LA 4CCHA 4O3NA 2E6LA 5KT3A 4IR1A 1YTUA 4YD2A 4J2DA 5KG5A 2E4LA 3C6UA 2IBKA 3DM2A 4KITB 2IHNA 3C23A 5DQIA 2F8TA 3MECA 2QKBA 3OJSA 8ICZA 1IKWA 2KZMA 4EBDA 4I2EA 7ICKA 1UWBA 3JPQA 1X9SA 4QZCA 4M0AA 3PVXA 1RYSA 3V9WA 5HRPA 3OSPA 4GW6A 4W5RA 1NJYA 1ZQKA 3MXMA 2C28A 8ICOA 3KKRA 3V72A 3MGIA 4J9RA 3K4GA 4J2BA 4ZTJA 3K58A 4F91B 7ICOA 4CE9A 4UAYA 1NK7A 3M9MB 3OYLA 4UAWA 5J2DA 3RMAA 3B0YA 3LPUA 5DGBA 4QW9A 3AO5A 9ICCA 3AO3A 4OGEA 3I8DA 4YR2A 5DG9A 2UVVA 2HHSA 3JPSA 5DB7A 8ICPA 3AU6A 4J9PA 3NTUA 2WTFA 3MGHA 2DTUA 4FCYA 3K5NA 4FJJA 1SKSA 3JYTA 4ELUA 1DLOA 4W5NA 2JEFA 3ISDA 3NH1A 1FKOA 4MFAA 1KVBA 1S1XA 2V4RA 3ZSRA 2Y1JA 3HM9A 4RQ3A 3AV9A 4H4MA 1NJXA 5J0QA 1PZNA 1MQ2A 3SUPA 4NM1A 4BE1A 4B9SA 3HP9A 4CHPA 4N47A 3PV8A 1JX4A 3LDAA 1KRPA 1YT3A 3M8SA 3TAEA 4O3SA 1IO2A 5KFEA 2QXFA 3GDXA 4I2GA 5IINA 3AVBA 1ZETA 4B08A 2HHXA 3ZT1A 1WSHA 1VSLA 4CHOA 4ED3A 2B21A 2C2DA 5D3GA 4N41A 4MEXA 4E7LA 1RBUA 5KT7A 3DYAA 5CZ2A 4I2FA 4DG1A 1DOQA 1B92A 4RQ4A 3MEGA 4FZYA 4KLTA 3MAQA 3KHRA 3TAMA 1LWCA 8ICJA 2W42A 4DO9A 2ZTEA 2XHBA 2I5JA 4KPYA 4ED6A 1I3AA 3QEWA 1WLJA 3ZSXA 3PMNA 5CWRA 3M9OB 1UA1A 8ICSA 3LAMA 1A5XA 3WNHA 2W8LA 4X5VA 2D0CA 3QZ8A 4GXIA 1ZQHA 3LP2A 5CA7A 3VQEA 4M9LA 3GV7B 1SL0A 4AH9A 7ICRA 5IIIA 4CHZA 4QZDA 2AJQA 3H8SA 3RB0A 2IHMA 3PX0A 3VQCA 4KV8A 3JPPA 4CF8A 1J54A 1KFSA 4YMNA 4FJKA 4B9MA 3V9SA 4OJRA 4MFCA 4GC6A 3N4MB 2XY5A 1QQCA 4ID1A 3S3NA 4TUQA 2BPGA 2X6SA 4Z4HA 4YP3A 4IQUA 4QZAA 2X6NA 1XSLA 1ZQQA 3QNOA 4B9LA 4FW1A 4F4ZA 5KFHA 1RT7A 2FBXA 2OPSA 4EYIB 1ZBFA 2KZ3A 4CGJA 4KLJA 2A1RA 4O0JA 3KTQA 3NGDA 4F8RA 3IRXA 3QLHA 1RXVA 3NFAA 2BKEA 2FPKA 4CJUA 1RT1A 5DKWA 3H8JA 1JLGA 4DSLA 4Q8EA 4YVZA 8ICTA 4FK2A 4R8UA 2YHAA 5KFAA 3K5OA 3H40A 4ECTA 1B9FA 4CEEA 4F5PA 4DTUA 4UBCA 4OKKA 4PWDA 4EP5A 3NHGA 1KVCA 4RQ1A 3OHBA 3PW5A 4M9GA 3O4QA 3NGZA 5J2EA 4RQ6A 4KREA 2O4GA 3TQ1A 2ZTCA 3T19A 1U45A 1NKEA 3S9HA 4ZTFA 5KFBA 3VQ9A 1EETA 1CLQA 4ED8A 3PNCA 2BCUA 3VQ6A 2RN2A 3TANA 4O5BA 4Q5VA 4FZXC 3IM1A 1SZPA 1BL3A 1ZQNA 3SQ2A 3LZJA 4HUGA 1RT3A 3CM5A 4BACA 1Q9YA 3HPOA 1XS9D 2LSNA 2ALZA 1S9GA 1WCNA 4CIEA 3IHQB 1MU2A 4DTMA 4Q0BA 4PY5A 4RPYA 1U04A 3T5JA 3QEBZ 1BIUA 4HHTA 3LWMA 2C2EA 4TQSA 5SWMA 8ICUA 5J0TA 3HO1A 1CXQA 5IIKA 5KFTA 4UQGA 4FLZA 4E3SA 2ZJAA 5DBCA 5JS2A 4CESA 1KCFA 4UB4A 1KDHA 3TARA 2P1JA 3RJJA 4FO6A 1NJZA 2XY6A 4M3WA 4ZHRA 5BOLA 9ICQA 3LAKA 3EPGA 1Q9XA 1O1WA 2DPJA 7ICHA 3DLKA 4DFPA 4F2RA 4C8OA 4JRQA 3SQ1A 1BHLA 4MF2A 3NF9A 3U3YA 4QZHA 1BPXA 1C0MA 3CFOA 4IFVA 3K2PA 3AO2A 1SKWA 3OSNA 3AVMA 2A1JB 5J0OA 5BPCA 3I0RA 2HMIA 3SNNA 3C95A 4FJMA 5BOMA 8ICGA 4DSJA 1RYRA 1HRHA 4FK4A 2RKIA 3QESA 4F5NA 4BXOB 4B3OA 9ICAA 4CGGA 2OA8A 3EZ5A 1U9LA 3OJUA 4Y1CA 4O5KA 3LZIA 4DL6A 4DTOA 1ZBHA 3KHLA 5KFFA 3C2LA 4IRCA 3CFPA 4FJHA 4AHTA 4DTRA 4QWDA 3MDCA 4F2SA 3L8BA 4B9UA 4I2AA 2FMPA 1KSPA 1SL1A 3T3FA 5CR0A 4QW8A 1VRUA 2BE2A 2P66A 1TFRA 2F1HA 4F5RA 4CJRA 5TZVA 1EX4A 5HRRA 2YNFA 2FBYA 4F3OA 4DQQA 4OPJA 5KFIA 2JLEA 5IIMA 4K8ZA 1WAJA 4M6WA 4RNNA 3H4BA 2KQ2A 2AQ0A 3ITHA 3TAPA 5SZTA 1S9EA 3SUNA 4H4OA 1RBVA 4CJ5A 4CJQA 3GIKA 2W9BB 1H38A 3PW0A 5CP2A 2BGGA 1BCOA 1MC8A 2IC3A 4R5PA 3ZCMA 4CJPA 4BWJA 3QE9Y 1JKHA 3L2UA 3GV5B 4BGDA 4KLMA 2R8IA 4M3ZA 4C8MA 8ICHA 5J2FA 4HUFA 3M8RA 2H5XA 1NK4A 2ZUDA 1ASVA 2ZE2A 4E19A 5E41A 5KFPA 3SI6A 1S1VA 5DMRA 4Z4CA 5IIOA 1S9FA 4QAGA 4G1QA 4EP4A 4FJ8A 2DFHA 2R8JA 3MR5A 4RNOA 3K59A 3H4DA 4M9JA 4I2JA 4PPXA 1KFTA 9ICIA 1QSSA 1Z00B 2GWSA 1D5AA 1RDDA 1R0AA 5J2MA 4CGDA 3PO4A 1UAXA 3U3GA 1B9DA 4O3RA 1RT4A 4IG3A 3OYAA 4PA1A 1X9WA 3GQCA 4CIGA 3HXMA 3EWAA 1W0HA 4HCBA 1BCMA 5KG0A 3RRHA 5I42A 4KHQA 1NOMA 4E7IA 1DGSA 3DRPA 3MR3A 5KG4A 3Q8PB 4LVSA 3V1OA 3AA3A 4JWNA 4CEAA 7ICJA 5CZ1A 4CFBA 4LY7A 4KLFA 2BPCA 4NCAA 8ICNA 3PR4A 4IG0A 4M3RA 4YG2A 2NRTA 3ZT4A 5KFGA 7ICPA 4KHUA 1TKTA 2HHUA 4N5SA 5KG1A 4CJVA 1CZ9A 4K4GA 4M9NA 4RT3A 1DTTA 4I28A 3DLRA 4CJ4A 2KW4A 5KGXA 1BI4A 1HPZA 5J0SA 4EZ6A 3RMBA 1LV5A 4O4GA 3DLEA 3CFRA 1ASUA 4XIUA 1JXBA 1HQUA 5J2HA 1ZQZA 2XO7A 8ICKA 3QEIA 4PH5A 1VSDA 3TAQA 4R64A 4F50A 4KHNA 3H7IA 1TK8A 4FJXA 3JPNA 3PW7A 4FLXA 4DOBA 3NH2A 3SUQA 1RBRA 2IS3A 2VG5A 5HRNA 2PYJA 1BQNA 4PGYA 2OYQA 3L2RA 1V9PA 1ZQOA 1CXUA 5EU7A 1ZBIA 4W5OA 1LW0A 1WSFA 5J1EA 3U6FA 5KFLA 9ICBA 3D45A 4LD0A 2PFOA 4BDZA 2BPFA 1CUKA 5KT5A 5KI6A 4HVJA 4DFKA 2B4JA 3EYZA 1J9AA 3ZT3A 4FJNA 3G0ZA 1XHXA 3L2VA 4UB5A 3SI8A 1ITGA 3ZDCA 8ICEA 1IKXA 4KLQA 3JSMA 1RDBA 4DFJA 3AO1A 2KTQA 1IXRA 3PY8A 1TV6A 3LK9A 2OWOA 3MR6A 1HMVA 4I9QA 3MR2A 1K1SA 4F92B 1S0MA 4FBTA 1SV5A 1S0OA 2W9CA 3PX6A 5KFCA 3ZSVA 1KFDA 3KK1A 2AGQA 1YVUA 1JXEA 4B9NA 4FW2A 3HSTB 4J9NA 1T3NA 8ICAA 1BPYA 1WSGA 5DDYA 3TWHA 4KLGA 3HT3A 3THVA 3Q8MA 3QEVA 1VSMA 2ASLA 5KRSA 3LP1A 5F9NA 1ZBUA 1ZQEA 1S0VA 1JMSA 3LALA 4C8KA 4Q45A 2DY4A 1TAQA 5DQHA 2IGIA 2P5GA 3ISNC 3V9UA 1S1UA 3C2MA 3GIIA 4O5CA 2BHNA 4DSEA 1EXQA 4PHDA 1NK0A 4O9MA 5KFSA 2MUTA 1ZJNA 1NK9A 4RUAA 4PGQA 3ETLA 2XCAA 2PI4A 4DTSA 4OLBA 1ZBLA 3JPRA 3PX4A 3BQ2A 1QLNA 5KT2A 4HYKA 2BANA 4H8KA 4FM1A 2ETJA 1XI1A 4DL7A 4TSXA 3QINA 5J2QA 4CGIA 1ZYQA 2BCRA 3A2FA 1W9HA 4GMJB 2BCVA 2J6SA 3V81A 3NCIA 4M3TA 4DOCA 3RJEA 3ZSWA 1X2IA 3TI0A 2G8HA 9ICVA 4QOZB 4TUPA 4RG8A 1QSYA 2XRIA 4K4IA 4BWMA 1TVAA 4QWEA 3H08A 3DLBA 3G10A 4FM2A 5KFDA 3N97B 5KFOA 1TL3A 1GOAA 1RPLA 2G8IA 2EX3A 3QEAZ 2G8UA 3RJKA 7ICQA 3TABA 4UBBA 5DLFA 1CZBA 4RW6A 4QWAA 3IAYA 4Q44A 5JUMA 4YN4A 3Q8QB 3M9NB 2WONA 3O3HA 4I2IA 4I9LA 2LYHA 1ZQRA 4DQIA 3SV3A 2VWKA 4RUCA 2YNHA 1D8LA 1JLBA 3AVNA 3SV4A 1AROP 4DTNA 2DPIA 4CJ3A 4KHSA 3BQTA 3OYMA 4JV0A 3TAFA 3T5HA 1ZQFA 4IRKA 4YR0A 5C24A 2BR0A 2UVRA 5K14A 4ELTA 4KAZA 1ZQGA 1VSFA 5CB1A 4E1NA 4I29A 2F96A 3LPTA 3VQ8A 4CFDA 4CGFA 5DQGA 2G8WA 4NYFA 4LH4A 2Q3SA 2ZD1A 1TV9A 2Z1GA 5HP4A 4RPXA 9ICRA 4RW8A 4PQUA 4HTUA 5FRNA 4KRFA 3HK2A 4FVMA 2KFNA 2PFQA 4FJIA 3MEDA 1T4GA 2ZUBA 1JLQA 1C0UA 3ALYA 3C21A 4PUOA 5J0WA 3C5FA 3KLGA 1NJWA 3NAEA 3EY1A 3ZDEA 2ISOA 3ZDAA 4LZGA 5J2JA 1MSWD 2DFEA 1WSJA 4MFFA 4DOAA 4GLXA 1VSKA 5F9LA 4Z4EA 2HHVA 1VSHA 4WE1A 1WCLA 4CFAA 3VQ7A 3AVLA 4BE0A 3QZ7A 5HROA 1TVRA 4Y1DA 3KKSA 4MF8A 4J9KA 3K5MA 5D46A 3MFIA 1NKBA 3G6YA 4I2CA 4ED7A 4B8CA 4IQTA 1N6QA 1IKVA 4LZDA 5EOZA 2OPRA 3RBEA 4KO0A 4YMOA 4F5OA 4B9VA 2YNGA 3ULDA 8ICXA 4DLGA 2X78A 4RU9A 1IKYA 2ASDA 1NKCA 2JEGA 4ED1A 3RAQA 3CG7A 4AHRA 4MEYA 3HW8A 1KVAA 4J9SA 3V4IA 2GBZA 4RNMA 1J5OA 8ICIA 1XU4A 1S6PA 5KFZA 2ZQBA 4E7HA 4ECZA 1D9FA 5KFNA 3QEPA 4FJLA 2GUIA 3RR8A 4CGHA 4DL3A 4CEZA 2C22A 4R66A 4IQVA 2BCQA 3UXNA 3O4NA 5DDMA 1VRTA 4QZFA 4ED2A 9ICOA 1SUQA 2VA2A 4QCLA 1GOCA 4DL2A 3KLEA 4OKJA 4LH5A 3E01A 4Z6EA 3HX0A 5KG2A 3RB3A 2HB5A 4O3OA 1XHZA 4KI4A 4FJGA 4KN4A 4R8UB 3E2EA 2IDOA 5FDLA 2GV9A 4KTWA 3UIQA 2QKKA 5KFYA 2JZBA 1JIHA 5J2GA 4CEDA 8ICWA 4KHYA 4ECVA 4ELVA 1KLMA 2HNZA 3QIOA 3OYKA 1EKEA 1BPEA 4EYHB 2B5JA 1ZQLA 4J9MA 4DS4A 3OHAA 2HHTA 4J2EA 3DI6A 1ZQIA 4CJFA 3AVAA 3K57A 1S1WA 3HPHA 1HYSA 2JEIA 3AO4A 2V9WA 3PMLA 1C1AA 3SQ0A 2NRXA 2OZMA 5L1KA 3WNFA 4NCBA 4F4WA 4RQ8A 2BQRA 1RBTA 1KTQA 2VWJA 4FXDA 3AA5X 4YCXA 4OGCA 2HNDA 2ATLA 2V4QA 1IM4A 2NRVA 9ICLA 4FYDA 5HP1A 3OY9A 4LSNA 5KFKA 2XCPA 1VSIA 4PHAA 2F8SA 5KFQA 9ICFA 1RZTA 2IAJA 3M8QA 3CQ8A 4KB0A 2ASJA 1TKZA 1T7PA 4AILC 5C25A 4DL5A 3ZT2A 2F1JA 4FS2A 3QIPA 3V1RA 9ICNA 3HVTA 2P51A 3MXJA 1HJPA 4I27A 3HL8A 4R65A 1BVSA 3RB6A 2D0BA 3HVRA 2W9AA 4Q43A 4IDKA 3NGIA 4CK1A 3KD1E 3RJIA 5CYMA 2BQUA 3ZD8A 1BISA 3GIJA 1L5UA 4DTPA 2VANA 5FRMA 3KLIA 3AUOA 1T03A 4CJWA 2BCSA 5J0PA 5DB8A 3V6HA 1TL1A 1NOZA 3ZDDA 5KFMA 2VG6A 3P5JA 1BIZA 1RTIA 4XA5A 5KG6A 4F5QA 3I0SA 2DFLA 5DBBA 3OYGA 3SYZA 4RQ2A 4I2QA 4CEFA 3SCXA 3AVFA 1JLAA 4MFBA 4YR3A 4EEYA 3ZDBA 4CF0A 5IILA 4QWBA 5DLGA 1JXLA 1B22A 2Y1IA 4KI6A 4FLVA 4CFCA 3RMDA 5J29A 2Z1IA 1BPDA 4EBEA 2YV0X 4YMMA 2RF2A 2PXIA 7ICVA 3TFSA 1NOYA 5KGWA 3KLFA 4RZRA 8ICVA 4QZEA 2BQ3A 2X74A 4JV1A 1VSJA 3AVKA 4UB3A 2WOMA 3LP3A 5HNKA 2ATQA 2VG7A 3ZSYA 1QSLA 3AVIA 2ISPA 4AHCA 3RWUA 2FPLA 4FZZA 4ED0A 4BE2A 4M04A 2HNYA 4Z4IA 4C8NA 4M6WB 5DB6A 3V6KA 4P2HA 1DTQA 4I2BA 4IKFA 4KKOA 1C1BA 3VQAA 5KRTA 4JWMA 2PY5A 3B0XA 2R7YA 3ISBA 4DWIA 3VA0A 3WNGA 2HVIA 1S10A 5EWGA 3UPQA 4BDYA 1D8YA 1K6YA 4ID5A 5L1LA 4DF4A 2VA8A 5DG8A 3DMJA 2RPIA 4RPZA 5CYQA 5KFUA 1RXWA 4JK1A 1ZQXA 1C1CA 3Q8SB 4Z4FA 3V7KA 4EBCA 3UXOA 5KFVA 1RCHA 3HYFA 3OS2A 2XY7A 1CEZA 3OYJA 4E7KA 3HJFA 3VQDA 1QS4A 5HHIA 1HYZA 3VQQA 3MEEA 1J53A 4CF1A 3VQ4A 4R63A 3QNNA 1Z3EB 3RAXA 2PFNA 5KFXA 4IQWA 4CEOA 1JL1A 3OVNA 3P1GA 3QERA 4O55A 4K8XA 1IG9A 1U47A 3QETA 3IG1A 4Z4GA 5I3UA 3HP6A 4W5TA 3TAGA 4I2HA 4Z6CA 4F3TA 1XSNA 3L3UA 4J9LA 3OYCA 4O0IA 4N76A 2PZSA 1TAUA 3RB4A 4YQWA 4TUSA 3DLGA 4KMUA 4HCCA 1LWEA 2XC9A 3LP0A 4I2DA 2P6RA 4DSIA 4CF9A 3BDPA 1RTDA 2PYLA 7ICNA 1RILA 4ZH4A 3VQ5A 1LAWA 8ICRA 3QEXA 1TKDA 4O3PA 9ICHA 4M3UA 4ECUA 4QZ8A 5CHGA 1ASWA 4CK3A 4RQ0A 3PW2A 3C1ZA 2RDJA 3M8PA 2G8KA 1VSEA 4DS5A 2RDIA 1BI4B 3VQBA 3NF6A 8ICBA 5L1IA 1Q8IA 2NRWA 1F21A 1QTMA 1U48A 3UQ0A 7ICIA 1XSPA 2NUBA 1RTJA 2FPMA 5KT4A 3C2KA 3AA2A 4M3YA 1S76D 4CERA 4FJ7A 5J2IA 4NLGA 2E6MA 4AHUA 4UB2A 1N56A 8ICQA 4CF2A 4CEQA 4QWCA 3TFRA 4M9HA 1ZQUA 5KG7A 4FLYA 3VN5A 1ZQSA 5IIJA 4YXJA 4PHPA 1ZQPA 4CHQA 1XO1A 3GV8B 2W8KA 3FFIA 3GIMA 3KD5E 1RDCA 3B6PA 1D9DA 2MAXA 1ZQWA 3VA3A 3K75D 2O4IA 1HNVA 2D5RA 3VQPA 1HJRA 4ICLA 7ICTA 1VK0A 5HMMA 3AVHA 4QZ9A 4G3IA 3MXIA 4KN7A 4CJEA 3AVCA 1T05A 4M2YA 1TK5A 1U49A 9ICWA 1K1QA 2NRZA 1BPZA 3RH6A 3HPGA 2P5OA 1FK9A 9ICXA 3CYMA 2FBTA 4JRPA 3H8WA 3V7LA 3AVJA 4FLWA 2OPPA 2C2RA 3AU2A 2YKMA 1RT5A 1XC9A 4M45A 1SKRA 1L3VA 1A76A 4DMNA 4XRHA 3GFKB 1QE1A 3C94A 4CHYA 2W9CB 5J2AA 4KLIA 4MQ3A 3ISCA 4YFKA 4TURA 3S3MA 2D0AA 4FJ9A 3BGRA 4RQ5A 5KT6A 1N5YA 4M42A 1TKXA 4DEZA 1A5VA 3UXPA 1L3TA 4GXKA 3B6OA 1RNHA 3DOKA 3G6XA 2KZZA 3Q8RB 5KG3A 1ZQBA 2Z1JA 5EWEA 4UAZA 5HHHA 4Q8FA 4O44A 4OPKA 4NLZA 7ICFA 3V7JA 1LB2B 4PGXA 1HUOA 5HRSA 4KTZA 7ICEA 2ITGA 3RH4A 3LWLA 4ECQA 2PFPA 4DQSA 4B9TA 5FROA 3ZSOA 4JV2A 4P4OA 3GILA 1G15A 2YKNA 1C7YA 1ZQAA 4P4PA 2MUTB 1ZJMA 3NF7A 4ECRA 7ICMA 1JN3A 4OKEA 1NK8A 1ZQJA 5KFWA 4KLUA 7ICLA 2HVHA 4O3QA 1L3SA 3PO5A 2IMWP 4DTJA 4AHVA 4RW9A 3OYIA 2FLNA 5J0XA 3S3OA 4E89A 4YD1A 1FKPA 1Y97A 3ASMA 4TQRA 2UVUA 9ICPA 1BQMA 3LANA 4XQ8A 3OS0A 3RJHA 3C6TA 3NDKA 3FDSA 3RTVA 1LWFA 4BDPA 4GXJA 2A1JA 4CJLA 1S0NA 4JS5A 1S6QA 5J2NA 8ICMA 4NYNA 3SPYA 4PHEA 2B6AA 5HMLA 4NY8A 1T8EA 4DU3A 1JL2A 1QHTA 3KK2A 2XGQA 5CJ7A 4BXOA 1ZQTA 3EPIA 2YNIA 1RT6A 4GVMA 5J0YA 4HUEA 4W5QA 2M9NA 2ZUCA 9ICJA 4CK2A 2BDPA 2R8HA 4XUSA 5J2KA 4I7FA 9ICKA 4KLHA 7ICSA 3V1QA 5HBMA 1WSIA 3OYHA 4CIFA 3D0PA 1Z26A 4JLHA 3RBDA 4NLKA 4DF8A 1Z25A 1ZQDA 1WNSA 5J0RA 3EW9A 4FBUA 1LW2A 4DQPA 1L3UA 4M41A 4CJKA 3HWTA 2AGOA 2HW3A 4DU1A 3Q8KA 4IRDA 4NXZA 4OVLA 4RQ7A 1UOCA 3KHHA 4ECWA 4F93B 1HUZA 1RT2A 4C8LA 4EZ9A 3NF8A 4NCGA 4CJTA 2FLPA 1RTHA 3DOLA 4LSLA 2KFZA 4J9QA 1COOA 1FXXA 3RJGA 8ICYA 2Q0ZX 2W9BA 3BJYA 3OYNA 1S97A 4QZIA 4DQRA 3RJFA 5EWFA 2AGPA 3OYEA 4KFBA 1TGOA 3PR5B 3SZ2A 1ZQCA 2OZSA 1UT5A 2IA6A 4KLOA 1C0TA 1A77A 3MABA 4DL4A 2XGPA 4KTQA 2AU0A 2AQ4A 2FMQA 4IR9A 3ZD9A 3IS9A 2YHBA 5KFRA 1A5WA 2W9MA 5J2CA 2R8GA 2QK9A 4DSKA 4Z0UA 4OLAA 1GOBA 2ZJ8A 5L9XA 3DRSA 3MFHA 4NM2A 3KLHA 4GC7A 1X9MA 2J6TA 5KFJA 1UT8A 3V9ZA 4CECA 5JS1A 1Z00A 1NK6A 2VA3A 3NH0A 2UVWA 4E1MA 4QZBA 5L1JA 1UA0A 4KHWA 3JPOA 2R8KA 5T7BA 4Z6FA 2DFFA 4YFUA 3RRGA 3KJVA 2I1QA 1BGXT 4N56A 4M3XA 2J6UA 4DLEA 3T1AA 1C6VA 4RW4A 3OYFA 3PW4A 4FS1A 1S1TA 2ZJ5A 2I9GA 1JLFA 1KEJA 4DTXA 1X1PA 1IH7A 3MBYA 3JPTA 2XY8A 3ZSQA 3QO9A 2G8FA 3OS1A 5D49A 4ECSA 3TR8A 8ICFA 1YTAA 4RT2A 4KLSA 3RMCA 1EP4A 3OYDA 2JGUA 4YXMA 2FBVA 3FYHA 9ICGA 5C42A 3V6DA 5KTQA 4E0DA 3Q8LA 1KLNA 3LDSA 2FMSA 4FK0A 9ICTA 4IBNA 5DK5A 3P83D 2BGWA 3BQ1A 9ICMA 4DFMA 7ICGA 4J2AA 5C5JA 3O3GA 2PI5A 1HNIA 3KHGA 9ICEA 5HLFA 3RR7A 4FLUA 3F73A 3UQ2A 1RBSA 3V6JA 8ICCA 4AHSA 2OPQA 4KLLA 4M47A 5D4BA 2KN7A 4O5EA 3MDAA 1WN7A 4FM0A 4YNQA 2HHQA 1REVA 1WAFA 1ZQMA 3PUFA 1U4BA 5J2PA 2JZBB 1Y88A 3C1YA 2G8VA 3SQ4A 3AA4A 4JS4A 3CM6A 1B43A 3SUOA 1NK5A 3O3FA 3L2WA 2IOCA 4FJ5A 3F9KA 3ZSZA 4JUZA 4FLTA 9ICSA 3DRRA 1N48A 4DSFA 3BQ0A 1HYVA 4CEBA 1JLCA 1S77D 2F1IA 4J9OA 3OYBA 3NBPA 3V9XA 3AVGA 1RDAA 4KB1A 1JLEA 5DBAA 1LAVA
chains in the Genus database with same CATH superfamily
5DG7A 1CRXA 2EKNA 4NL9A 9ICUA 2ZBIA 4DV4F 3MMCB 2P9LA 3NE6A 2JRSA 4WFYA 1VBKA 2HNDB 2GVZA 4RW7A 2CVIA 2IIHA 7ICUA 5DGAA 1HX1A 1X4CA 5HP1B 3VVUA 4LSNB 2JMGA 4EFAC 3L3VA 4CJSA 4F4YA 2FHJD 2IAJB 3VQTA 4GY2B 1N32F 2BABA 3M8QB 2P6TA 1ZA2B 1QCKA 1MQ3A 4OZ2A 3AD8C 2Z1HA 4KB7A 4P4MA 3PIPL 4QYZJ 4K25A 3ZT0A 3QWUA 5D77A 3HVTB 4I2PA 4KHPJ 1NPKA 4ISEA 4Z2XA 1IR0A 3NGYA 1N88A 4KHRA 5C2GA 4BC4A 2Q6BA 4DV3K 2X7IA 4O3NA 5KT3A 1YTUA 2EZXA 2I5HA 2CZ9A 4YD2A 4P10A 4J2DA 5KG5A 3UN5A 3C6UA 4DUTA 4Y2QA 4L75A 1IBKK 4ZPVR 1HBOA 2DQNB 1UJ6A 2W7OA 1ZRMA 1ZOTA 3B82A 8ICZA 1IKWA 1T3VA 4I2EA 1IQTA 3JPQA 3MK6A 4M0AA 4ILRA 2E5JA 5AI6A 4C9DA 2Q31A 3V9WA 5HRPA 4KGZB 4W5RA 2DCLA 2H5IB 1ZQKA 3MXMA 1FX4A 3MGIA 1LFWA 1T9XA 2VUGA 4LIWA 3K4GA 3GYXB 4CE9A 3W2WB 1EQ0A 4Y2AA 3IBCB 3MM6A 4UAWA 5J2DA 2YKOA 1NWKA 2YJFA 5DGBA 4QW9A 3AO3A 4OGEA 3I8DA 2M0NA 3A5NC 4LF5J 1Q0NA 1C1BB 2XSFA 3JPSA 3T9ZA 4E8UA 5AZJB 2CZ4A 2IBOA 1K8KA 3NTUA 2WTFA 2K4IA 2ZBPA 3FM9A 2LI6A 4ELUA 1DLOA 3NH1A 3ISDA 1KVBA 4CO3A 2V4RA 2KT5A 3IG8A 3QXGA 4FO0A 3DMJB 1NJXA 3UDLA 3VF6A 3SUPA 4NM1A 4BE1A 4B9SA 1JCEA 3ATVA 3PV8A 1JX4A 4BR5A 4HDHA 3QUQA 1TAMA 1ZETA 4B08A 1WSHA 4K2XA 4ENOA 1NBEB 2Q4TA 5M2UA 2B21A 3C2PA 4V1Ak 4QS7A 3L3FX 1SQFA 4GVEA 5ETRA 2GHPA 3US5A 4MEXA 2IVYA 3PSTA 4E7LA 5KT7A 2HGMA 4DG1A 2WSFC 2Z0GA 3IG1B 1VQON 5I3UB 3QT7A 4HWIA 3D67A 1HNZF 4FZYA 4ZMMA 3OR2A 3KHRA 2CVEA 1NCLA 1HNWJ 2H3QA 4NA1A 2MKJA 2GTDA 1MN9A 2XHBA 3OL9A 4L76A 2HBJA 2RQMA 2KLAA 4ED6A 1XNSA 3D2FB 3QEWA 3ZEUA 3QU5A 5CA5A 4CW7B 1KL9A 3CF5L 4CT8A 1RTDB 5ALFA 5AKJA 1VHXA 2R7WA 4KC5A 2W8LA 4OL8A 1UZHA 1ZQHA 2W2QP 2OH2A 1PG5B 3GFYA 1KDNA 7ICRA 4CHZA 3M8PB 4QZDA 2LU2A 4ZVRB 6FD1A 3PX0A 1JJHA 2P9SB 4CF8A 1KFSA 2K2PA 3M05A 4LRAA 1VQNS 3DGPB 2ZG6A 2O8DA 1Q46A 3M5RA 1OWXA 1HR0F 3FBFA 4OJRA 4X2BA 4MFCA 3JS6A 3PEJA 3TEHB 4TUQA 3BS5A 3VEXA 4YP3A 4RTFD 4FW1A 2DXFA 2FSJA 2YJEA 3D0IE 1N61A 1RK8A 2GX8A 3FFIB 4OZ1A 5ITHA 2FBXA 4BRHA 5LL6Z 4ETZA 4A5BA 3T1YF 4CI0B 5GAGI 2CQCA 2A1RA 4LF9F 1RDRA 4MYTA 1GX6A 1RXVA 3NFAA 1WOOA 5D3GB 1HNWF 5HJXA 4DSLA 3FRYA 1T05B 5KFAA 2HSZA 3L09A 2JVRA 3H40A 1WD6A 1VQ7S 2E1PA 5D78A 2B43A 3ZLJA 2OAUA 5J2EA 2WVDA 4DBQA 4USWA 1U45A 3KXDA 1LWCB 2BRLA 2CQ2A 2HPUA 3GFZA 3I6PA 5AQIA 5F3TA 5KFBA 3BQ7A 3VQ9A 1EETA 4JV5J 1CLQA 2RN2A 3GLJA 4A48A 1FFGB 1YI2S 4Q5VA 3L0QA 4CM0A 5B0CA 2WBNA 4OCZA 4R0JA 2L9NA 4O5FA 4D3HA 1ZQNA 1EO1A 3P5TL 2ATCB 1K5OA 1Z6RA 3LZJA 3FZHA 1HUXA 2LSNA 4O44B 2F4VK 1MU2A 4Q0BA 2IJNA 1U04A 3T5JA 1QUPA 2L08A 3GJSB 4HHTA 3LWMA 2C2EA 1OY8A 1M5SA 4TQSA 2VD3A 2KVSA 5SWMA 2GVDA 5IIKA 1SXDA 2EAMA 1J5EJ 4FLZA 4E3SA 5I3QA 4B1XB 2HS3A 2W04A 1RBLA 2XI9A 3MMBB 4JB3A 2JVOA 2XICA 3BF3A 2B8QA 3LGHA 4YN3B 1R27B 3TARA 1XERA 1IJFB 2XY6A 4OD0A 1RAOA 4M3WA 3LAKA 2NYVA 1ZZFA 4K4YA 2VBZA 1PJ6A 1SC1B 2XMVA 4RKUC 3NNHA 2YQ1A 2DPJA 2IPOB 1O1WA 3ATUA 5ETLA 2OHFA 2E7XA 4JNEA 2A6MA 3MWTA 3IXQA 3UN2A 4C8OA 3SQ1A 3QFPA 1SIJA 2EZZA 4Y34A 4DR3F 3KJQB 4YHHK 1TMJA 4X66F 2P9IA 4IFVA 3QRPA 3K2PA 2PDAA 1KN6A 4ZVSB 1SKWA 3OSNA 2V9KA 2R3VA 3I0RA 2APOA 5J2NB 2J0QD 1NZPA 3NEKA 1FRXA 2B6AB 3BKUA 3PKMA 2YNIB 4CGGA 3EVOA 3EZ5A 4WIQA 1U9LA 1WWHA 3EM1A 2W3SA 4AT1B 2NNWA 1WC0A 2EAPA 1FE0A 4MT1A 3DLLL 4FJHA 2WW8A 2DEJA 5HBMB 3I55S 1U2VA 4DTRA 4QWDA 3MDCA 4F2SA 3TTDA 5D6GA 2FMPA 1SL1A 4CLLA 4JI3K 2EWHA 3GL1A 3CP8A 4FN5A 3T79A 2F1HA 1LW2B 3VAIA 3QBCA 1VR6A 3WKDA 2YNFA 1UVMA 2CPYA 2Q0UA 1Y5IB 5IIMA 4J8FA 4M6WA 4RNNA 3HOSA 2PMHA 3IWXA 3ISND 3H4BA 3QQCD 3AODA 3ENHA 1RT2B 3KMQA 2CXEA 3ITHA 1K73O 5SZTA 3SUNA 3DOLB 2CXYA 2NV3A 4GMKA 4LSLB 4H4OA 3TX8A 1R8AA 2JGAA 4DV5J 2BGGA 3EJMA 3U4LA 4PKDB 3EUB2 4UUWA 1VQYA 2PMZD 5AQUA 4G9BA 2ALYB 4P72A 1C0TB 3NVKA 3M2UB 4M3ZA 4C8MA 8ICHA 5J2FA 4IJAA 2ZIWA 1VHFA 3ZZOA 4E19A 5E41A 5JVGL 1S1VA 2DVIA 2VONA 4Z4CA 3CJQA 4C7ZA 2HAIA 1S9FA 1QVGM 1V3SA 3CRXA 5GAGP 4TU9A 1NGCA 4A59A 2ROEA 4I2JA 4PYDA 1YJ9N 2YX6A 4MJKA 5ADZA 2GWSA 2HMXA 2M8HA 4LBIA 5J2MA 3PEHA 5B0FA 3TUPA 4TVAB 2F8MA 3OXLA 4DR7F 1Y7PA 3U3GA 5IOLA 1V3RA 1YTYA 2DGTA 2R7SA 4PA1A 3KJVB 3GQCA 1QQMA 3EWAA 1W0HA 2KV2A 1RAGB 2D3O1 5KG0A 4RW4B 5I42A 4WP8A 4ILHA 3L9ZA 1NOMA 1SS6A 4E7IA 1WHYA 1X6IA 2OFHX 2WC9A 1RBAA 3DRPA 1GXUA 4PL2A 4JI4F 3A0BU 1C2PA 5IS2A 3Q8PB 3KVGA 3QO9B 4K5SA 1E6VB 2OANA 4OLOA 4Y28C 5B8HA 2MQPA 2B9YA 3M32B 1UAWA 1Z4UA 4F3MA 1GLJO 4QR1A 2AZ3A 3IWNC 4M3RA 2P9NB 5D0GA 5KFGA 3OXFA 4KHUA 5AQOA 2F65A 1FA0A 1CZ9A 5FPMA 4B3MJ 1PK1A 2BJ8A 2HGNA 3V6DB 5LJVA 3HZGA 4I28A 2DKOB 2IVNA 1XMOF 4K7QA 5KGXA 3FQKA 2NPFA 1BI4A 2A1AA 1HPZA 4EZ6A 4DV1F 3P4UB 1CVJA 5J2HA 3CCTA 1ZQZA 5HLFB 8ICKA 4UARA 2KRRA 3MCPA 2XHWA 3CJCA 4ZVOB 4K5RA 1FD2A 2BZ2A 4O23A 1SIWB 2VPWB 3H7IA 3QAEA 2CYYA 3I32A 1F0XA 1BQXA 2FHJA 5EDWA 1X4EA 1UP1A 3VGSA 1KOOA 4FF3A 2RHSB 2VG5A 1RBRA 1ZBSA 4ZP7A 3EWGA 3L2RA 1V9PA 1CXUA 1N5SA 5AM2A 4W5OA 4JKEA 4X64F 3RVCA 9ICBA 3VEVA 4ES3A 3KWGA 4LD0A 2BPFA 4DQ8A 2A19A 5KT5A 4EI2A 3BZQA 4DFKA 2B4JA 4FJNA 3ZZRA 5ETOA 3L2VA 1BMQB 4UB5A 1ITGA 1IKXA 3F2BA 4LF6K 3KJFB 3QRRA 4DFJA 2EFNA 1NNDA 3AOBA 1V97A 3HHEA 4UZCA 2DNPA 2NREA 1VHIA 1SV5A 3FC9A 1X60A 3M1VB 2M0GB 5AXLA 1FF2A 2DNZA 2RMLA 4LFAF 1WKJA 3KK1A 3EE8A 2Y0SD 4J9NA 3J7YU 3CCSN 3BH7B 2OTLN 3KK3B 4KLGA 4NOHA 1Q8KA 3THVA 1FI4A 3VAFA 2HHPA 4IOXA 4IOBA 1SZ2A 4BHQA 2LECA 2DITA 5C7PA 4PG5A 3LALA 5AKIA 9ATCB 4DN0A 1DTTB 3QMQA 2DY4A 3R8YA 2AEJA 4Y2UA 3ETRA 2WVEA 2M4MA 4O4GB 3ENQA 4JI5F 4DSEA 4YDXA 4USTA 2M9KA 3SMZA 4O9MA 3AOCA 3ENWA 4F7VA 2ZOGA 4Y2RA 3CPWM 3ONQA 3AXKA 1U6BA 3SCJE 3U1NA 3CGIA 3QWPA 3DM2B 2HS4A 5KT2A 4HYKA 4QQBA 1R89A 4JI6F 4IO9L 3ZTRA 4FM1A 1ZXOA 1XI1A 5AQZA 1B70B 5BYQA 2UP1A 1W9HA 5J8YC 2H3GX 3W66A 1UQVA 3NCIA 3RJEA 1UWBB 4AFFA 3TI0A 4WFAQ 1RB0A 4NRUA 1QSYA 2XRIA 4FWOA 1MWMA 4K4IA 3A8YA 3DLBA 2EZYA 4FM2A 3U9DA 1TL3A 3NVZA 3JTNA 2KJWA 2E5LF 2G8IA 2EX3A 3RJKA 2QLWA 1C4AA 4QWAA 1TYQA 1T3OA 4Q44A 4QPXA 5F8JA 4YN4A 2YWEA 1U1PA 3O3HA 4I2IA 3NVMA 5AHXA 3VGTA 3SMPA 2HFVA 1T95A 2YNHA 1D8LA 1JLBA 3O1LA 4YOVA 4DTNA 4XK8C 4JV0A 1ZQFA 3JS9A 2UU9F 4ELTA 4KAZA 3BS9A 2YB4A 3DXBA 4E1NA 4I29A 4OZ5A 3VQ8A 5DM7Q 4QJVA 4CFDA 4CGFA 2WF5A 4ACOA 2H4YB 3K9JA 2G8WA 1ZH5A 4NYFA 1QQ5A 5AZIA 3ZYYX 2F8HA 4IYQA 4N7TA 3GTYX 2Z1GA 4LMZA 1F9EB 3E51A 2MEWA 2DB1A 1H6KX 1JUDA 3R6LB 3BSNA 5CR4A 1FEZA 1N5XA 2N3OA 3HK2A 2KFNA 4JI0F 3B4DA 3M6VA 3GYGA 2PFQA 1M1HA 1VS3A 1C0UA 2FVCA 3ALYA 3C21A 3ZDEA 4ITSA 5M1KA 1MSWD 3CWJA 2DFEA 3WKAA 3QSIA 1F9HA 2E9ZA 1FRKA 1VC0A 2LM1A 3PIPQ 4Z4EA 2UXCF 5AE1A 4CFAA 3MEGB 5AQNA 4XH4A 4DPUA 4BE0A 3NS1A 4OHXA 5HROA 4B3SF 1WHXA 2VPXB 3DXKA 2G9OA 2RE1A 3MFIA 2MHEA 4OJHA 3G6YA 3WEEB 4B8CA 4IQTA 2MZ1A 1IKVA 4TYAA 3LPYA 5EOZA 4QU7A 4LFCF 3RBEA 1H7XA 4KO0A 4K43A 1HW8A 2DPNA 2YHXA 3MAAB 3A5MC 4KBOA 1NGEA 2Q1NA 2VZ9A 2YNGA 1KP6A 3ULDA 5L39A 2X78A 3M6GA 3VCBA 3TX0A 1Q18A 1N34J 4KV8B 1SGGA 2JEGA 1WELA 3RAQA 1S4EA 4FVUA 4MEYA 2HBLA 3HW8A 1NEEA 3V4IA 1GMUA 1O8BA 4RNMA 1J5OA 1Q7YT 1F44A 3CEDA 5JTIA 2KKVA 4E7HA 3QT8A 1Q5VA 2JNJA 4FJLA 3QEPA 3QJJA 3RR8A 4BC9A 4CGHA 1B4FA 5AI8A 3THYB 3MCNA 5K4LA 1NH7A 3PKYA 3O4NA 1V5VA 1Y10A 3ISZA 3MCSA 2AJFE 3KZXA 3ILOA 1SUQA 5H9EK 4GVBA 1GOCA 1RT7B 3E01A 4I4BA 4Z6EA 3RB3A 1JB0C 3D6HB 3MEDB 1XHZA 3IRXB 3Q8YA 3S01A 2WB1C 3B8HA 3FLCO 2R7QA 4FJGA 1QVFR 4KN4A 4R8UB 3QUBA 2BRKA 2VQEF 5FDLA 2ZVSA 4V19X 2GV9A 2XNQA 3U7JA 4KTWA 2Y8YA 1JIHA 3WC2A 3CCUN 4UOCA 3J7YI 4NLWA 4ELVA 1KLMA 5D0EA 1WG4A 1GXTA 2IYGA 4NLBA 2Y8WA 3R7SB 4FWSA 3CUNA 1R43A 4EYHB 1IBLF 1PVPA 1ZQLA 1S6UA 4OLPA 4RJVA 4IOAL 3ICXA 2IFXA 3D0GE 2QL5B 2DNLA 3O5BA 3DI6A 1ZQIA 4CJFA 3CCQS 4CTAA 4AYBF 1RT3B 5DDQC 3BB5A 2V9WA 4OHYA 3PMLA 4F4WA 3VGKA 4OZ0A 3MMCA 4UB8U 4S0MA 3ZZPA 3AA5X 4YCXA 4OGCA 1VI7A 3AQEA 2HNDA 2NRVA 2G13A 2UUAK 9ICLA 1EX8A 5HP1A 4LSNA 5KFKA 4LVNP 2ZWOA 3IP0A 2DO4A 2IAJA 3WIVA 2E66A 3M8QA 4NWIA 3VGMA 3EGWB 3OFEA 4JB8B 3ZT2A 2O66A 1Q3VA 9ICNA 4H0VB 3HVTA 3CCVS 2PN6A 1HJPA 1JJ2M 3CJ2A 4I27A 5AQLA 3IAM9 3HL8A 3RB6A 3NVWA 2WF8A 5AQJA 3AMZA 2HDOA 4CK1A 3G87A 5CYMA 2BQUA 3ZD8A 3EXYA 5M1QA 3VAMA 3HFVA 2VKRA 3TYTA 4J03A 4IOCL 3TW0A 3K0JA 4WPAA 3H5YA 5J0PA 4C3LA 3BM7A 3LQVA 1XC3A 4D3GA 1R7IA 4XA5A 1TUWA 4F5QA 2DFLA 1FKAF 5EX3A 1M1KO 2MQMA 1S5ZA 2HFZA 4B3OB 1JLAA 2GV1A 4EEYA 3ZDBA 1JCGA 5IILA 3CC7N 3OBIA 2Y1IA 2E2NA 5TKWA 1O5JA 1HARA 1A6SA 3VR1A 5J29A 2YX7A 4JK9A 3J7AN 4YMMA 4PEOA 1S12A 3TFSA 5KGWA 3O1WA 1YRUA 3D6TB 3JAMU 2B7BB 1VSJA 3SCLE 2EFGA 4JI7F 3BN4A 3ZSYA 1YF5L 2HQFA 4EIAA 2NXUA 3AQOA 3AVIA 2ISPA 2AH5A 2FPLA 2UXDJ 3H5XA 2ZXIA 3W2WA 4Z4IA 2IVPA 2RHQB 3TA0A 2LQBA 4KH0B 4IO1A 3C28A 5ALTA 2AYGA 3U02A 5HQMA 1S9EB 5M2RA 4X4UA 2K4PA 1C1BA 4DU8A 2F8KA 1NDPA 4DR6J 3Q86A 2RVJA 4TLRA 5AZJA 4JWMA 4UUXA 1R31A 3FC4A 4DR5K 4C4RA 4DWIA 4LVOP 4ZP9A 1S10A 5EWGA 3TJAA 4BDYA 3I5AA 4NL5A 3UN3A 1K6YA 3ILLA 5L1LA 3Q83A 2VICA 2VA8A 2XIDA 3DMJA 1K47A 2MKHA 1WOQA 2RPIA 4RPZA 5KFUA 1ZQXA 2NPIA 1UVLA 4CRJA 1LKYB 4EBCA 5KPZA 2IM3A 3TJ9A 1RCHA 3TUIC 3NS5A 4RBVA 4AF1A 4M63C 3OS2A 3G4SS 1I94K 2XS7A 3JTOA 1HKGA 2HZAA 3QB0A 1HBMB 2ZJRL 5HHIA 4M7XA 1HYZA 2B4VA 3BUZB 3EGZA 3NAHA 1V4SA 2YQ3A 5EX5A 3DRYA 1TUUA 4WQ5A 4C7YA 1AYEA 4CEOA 1JL1A 5D0HA 1ZXIA 2FE9A 3CPWR 2OEMA 3OW2M 4YUDA 1RUSA 2OHDA 4JYAJ 3Q22A 3J7YP 2BJ9A 4C8YA 4C4SA 4EO6A 3QGIA 2IM2A 3TEGA 3IG1A 5ALPA 5I3UA 1YJRA 3EO3A 4ZLNA 2QA4S 3AB2B 4BRIA 3MOZA 2YX1A 5AQWA 2HEKA 3SIPB 1U7LA 5CZVA 1NLKL 3JTPA 5BRFA 2GMLA 1X40A 5ALQA 1FFVA 3RB4A 1XNRF 3HKWA 3D2FA 4ZP8A 1KKHA 2RB7A 4AUKA 4KMUA 1F1BB 5EE3A 2QG9B 4CF9A 1H72C 3NOGA 1RTDA 7ICNA 4P75A 2CJAA 3AXMA 2HNYB 1SZHA 4IG0B 1ULRA 3VQ5A 3QEXA 1YJWS 4O3PA 5F8HA 2ZDOA 4PZNA 4EX7A 1B0TA 5IXUA 4RQ0A 1CC7A 1WC3A 2E1RA 3M8PA 4KKOB 2G8KA 2H51B 3ID6A 3OTCA 2P9SA 2PGCA 5L1IA 2RUGA 2B9WA 3TVKA 3T6BA 3DLEB 7ICIA 3DGPA 3N01A 5CHCB 4OYOA 2NUBA 2A3VA 3DLLQ 5K8MA 1HQUB 3NWGA 3C2KA 3AA2A 4M3YA 1S72N 2ZOMA 2O8BB 1YJUA 5J2IA 4QWCA 3C29A 2G08A 2RH3A 1RAAB 3NUQA 2E8PA 3M2RB 4O3MA 1SIZA 5ALIA 4PKIA 1H74A 3FFIA 3F5TA 3UD4P 3B6PA 1D9DA 3EMTA 3D7EO 4BG8A 3EKSA 2ZIXB 2LA6A 1SH0A 1WC5A 4QZ9A 3NRWA 1RM6C 4KN7A 1VISA 1T05A 4M2YA 2LDIA 1TK5A 1U49A 2ODGA 2HHHF 3SENA 1A6LA 3QATA 2P5OA 1F9FA 2FBTA 4PABA 4JRPA 3JSMB 4FLWA 1RAJA 1BOTO 4RNFA 2MGZB 3HSZA 1WC4A 5AXKA 3QGGA 4LF2A 4XRHA 5HMYA 2KH9A 4CHYA 2W9CB 2KFYA 2F3JA 5L9NA 3BGOP 4KLIA 1NB7A 4YFKA 1FFUA 2D0AA 2R7UA 4FJ9A 3IDWA 3F5AA 5KT6A 3PG9A 1DJ0A 2G5HB 4Y2IA 2CJ9A 5H9FK 1RNHA 4FPAA 2KZZA 1VQ6S 1UPMB 1YITS 2WZ1A 4O44A 4DR1K 5LXYA 2FB0A 1U1RA 3V7JA 1FJGF 2EDUA 1RAHB 1HUOA 2YWKA 1T94A 1PBUA 3RH4A 2VGNA 3CJ8A 4DQSA 4B9TA 4J91A 5FROA 3ZSOA 4JV2A 2NUHA 3T6JA 1C7YA 4HEA9 1ZQAA 3SJHA 2MUTB 2EFOA 3MMBA 4ECRA 3J7ZO 2MB0B 1JN3A 2KM8C 2H3IA 5JJBA 1NK8A 4KIAA 3QUCA 1VQMS 4FF1A 1GTEA 2CUYA 3N7SC 1L3SA 3T1HK 2F9TA 4DV2K 4G6VB 4DTJA 3O9QA 2PT0A 5J0XA 1N5QA 5G5HA 3DDIA 3A5LC 1PJ5A 4TQRA 3LANA 1V6HA 3V81B 1T6CA 2ZZNA 2DR6A 3RTVA 4GXJA 1O08A 5BJRA 3BR9A 1ZBTA 1S0NA 5J2NA 4NYNA 4GO5X 3WQUA 2B6AA 4NY8A 5EY4A 1JL2A 4Z7CA 1QHTA 1LXJA 5CJ7A 4MKVA 2YNIA 4GVMA 4BRDA 1N5WA 1FRIA 3KHYA 1YZ6A 1ZAWA 2ZUCA 1JNRB 4CZHA 4PR6A 3CCES 4YOWA 3KUGA 2D7SA 7ICSA 5HBMA 3OYHA 3IR5B 1KBRA 2V4JB 3D0PA 1X9XA 3AH6A 4JLHA 4R79A 4NLKA 3NGSA 1VBXA 5HQLA 5A0YB 1O51A 2JXJA 1LW2A 5LSLA 4DV3F 5E33A 4CJKA 4B1VA 3B6BA 2KRBA 2ES6A 1WG1A 2LEBA 1SC4B 3Q8KA 4OVLA 2ZWPA 1UOCA 4OX7A 5HL7L 1RT2A 2KT2A 2FLPA 1IBKF 2P9PB 3DOLA 4JHDA 3WK7A 3CDEA 4LSLA 4DUYJ 1RCOB 3R9KA 3TNVA 1COOA 4RW8B 2AKWB 3PYFA 4PQUB 3RJGA 1G1XA 1WORA 5BN9A 3NMRA 4OPHA 2Z2YB 2WFBA 1Z05A 3H3NO 4Y2SA 2E20A 2OZSA 4KLOA 1C0TA 3MABA 1RP5A 2LKZA 3NVYA 3H5SA 2DF4B 1WTFA 2DCUB 3H25A 3KOOA 4P74A 4QYZK 3O9RA 2FMQA 2YPZA 3QYPA 2LXFA 2YHBA 2WF6A 1A5WA 2OM6A 2D1CA 1CSJA 3CMAN 2MKKA 4Z0UA 1GOBA 4NZ7A 1KOHA 2EBEA 4A8WA 1HLWA 3HRDD 4YDDB 4GC7A 2QARB 3FZMA 4AXIA 2M2BA 4EU0A 4NLSA 3CCRS 2BX6A 3PFOA 4KH5A 3KFWX 1TVRB 2F1FA 4WKYA 1JJ2R 4E1MA 4LBPA 1UA0A 2AW0A 4KHWA 5HI7A 5LY3A 3MR7A 3JPOA 1FT8A 2ILYA 2HWTA 4KQZA 4Z6FA 2Z56B 3W7BA 4ZVGA 1LK5A 3RRGA 4EELA 2PA3A 3KJVA 4ANCA 1N6QB 2MZRA 1BGXT 2XMAA 4DLEA 5GAEU 3EEQA 3ZZYA 4DV0J 1L7MA 4RW4A 3T1AA 2OPRB 4MK8A 3CJ1A 1M5KC 4IO9Q 3TSPA 3RUBL 3CCMS 3WK6A 2XY8A 1OH8A 3ZSQA 1IKYB 3P4IA 3OBWA 3QO9A 2ZH3A 5EE0A 3DWLA 1EZZB 1E6VA 3ZTOA 5B0GA 3RSEB 4HTJA 3RFAA 3E9PA 3I1YA 4EGLA 4PHTX 3M32A 2Q97A 2FSKA 2CGKA 2P9NA 4H5TA 1Q16B 4Y0WA 1T6DA 1BLUA 3V6DA 1NSQA 3AT1B 2E8NA 3IFEA 4LF5K 3Q8LA 3LDSA 2DHAA 1WEZA 2FMSA 4FK0A 4IBNA 3P83D 1K44A 1E3MA 2GC8A 1QAXA 3R6GB 2BGWA 3O3LA 2DXEA 3BQ1A 4H5VA 9ICMA 3H2LA 4DFMA 7ICGA 3O3GA 2PI5A 3E0FA 4JBCA 2HFSA 5HLFA 1BE4A 2BM1A 3OPKA 1BD6A 4F3QA 1X4FA 1NLVA 3V6JA 8ICCA 1VOMA 3CD0A 4DHYA 2KN7A 1JNZB 2E5SA 3NASA 3ED5A 4FM0A 4YNQA 2HHQA 3BS7A 2MMYA 1ZQMA 3PUFA 2XEXA 2JZBB 3C1YA 1HD0A 1BC6A 4DL0C 1SV0A 2QO3A 4LFBK 3W65A 4ZLLA 1HKBA 3AA4A 3GOIA 4IEIA 3SUOA 5K8NA 5AM1A 1SJRA 4LT6A 4MYUA 2IOCA 3OTOF 4JUZA 3MWPA 9ICSA 1IN0A 5F8LA 2G2YA 4F36A 4DSFA 2B5JB 1F2GA 1DT9A 1WDTA 3BQ0A 4O4RA 3P45B 1RWMB 1SI9A 4J9OA 4KB1A 1SJQA 4BLGA 3UVJB 1S1WB 1HYSB 1LAVA 3OGUA 2PAVA 3R9PA 1KC8T 3QPIA 1XN9A 4M5IA 2WB4A 3M1VA 2XLJA 2Q3PA 3D2EB 4P0QB 4F4XA 1TUYA 1VQ4N 5F3ZA 5A8RB 2C3OA 4FZNA 3L7OA 4A8YA 1S5JA 4C48A 1X0FA 2MY8A 3KK3A 3ORYA 2O5DA 1U0HB 4CZKA 1YJNN 4QZGA 4PWUA 1ZD5A 2XYHB 1FNOA 4MIBA 4JI8J 3PLAA 3MPWA 5F1XA 5AKHA 4NLNA 4E7JA 1WSEA 1RSCA 1RXOB 5C25B 1U1OA 5J2BA 2WFAA 1WG5A 2HLTA 2ZTDA 1M1GA 3RH5A 4I6YA 4UZBA 1ZQVA 3ZX2A 8ICLA 4AL6A 1AFJA 4EEKA 4B8AB 2C2OB 1HNIB 4ECYA 4IDKB 4CCHA 1YVNA 4YHHJ 1D3WA 2R2TA 1Q3UA 2C2NA 2GQCA 4C4WA 1S6OA 2UXBF 2KHVA 5ADXA 3DM2A 2NSBA 4KITB 5LSOA 2RRDA 2EXUA 2IHNA 2MJUA 5AQXA 3R97A 3I0SB 3KZIU 1RDWX 1WI6A 2MKYA 1QDUB 2GIQA 2WCXA 1NRKA 2EC2A 1ZAXA 3FKBA 2KZMA 2ZIUA 4EBDA 2GGPB 1KQFB 1UWBA 2F4VF 4QZCA 2EEYA 3HTVA 2A2CA 2RF2B 1PUZA 2BACA 4GW6A 1VFJA 3W63A 2J0XA 3KLFB 8ICOA 4IQMA 3V72A 4JI3J 2RIJA 4RUBA 2WOMB 4J2BA 4ZTJA 2RRNA 3K58A 2FF6A 5BRDA 2V52B 5KNIA 2FLOA 3HHKA 3B0YA 3UCGA 2Z58B 4JV5K 2UUCJ 1DTQB 3WC0A 2GVZB 4RW7B 4M5GA 4YR2A 1R8HA 2VFVA 3CJKB 2HHSA 3SMSA 3CE8A 5DB7A 2Q2RA 2I6XA 3K5NA 2QTWA 5IC6B 2Q1LA 4PG7A 1LXNA 1SKSA 3JYTA 4IOAQ 3G6EN 2JEFA 4YHHF 1S1XA 2CPIA 2Y1JA 4ID5B 3R5DA 2JH1A 1MN7A 3R3TA 5CYQB 3Q24A 1J5EK 1C1CB 2V2KA 3UR0A 2EK1A 5HVGA 1OPZA 4Y6IA 4O3SA 5KFEA 1NNLA 4I2GA 1X4AA 2XWYA 2HHXA 1SXLA 2BOPA 1VSLA 4CHOA 4ED3A 1K0VA 3CERA 5ALZA 3CQYA 4ZVHA 6AT1B 3ET6B 2ZM6J 5F8IA 1HBOB 3A13A 1FJCA 3JSYA 4JI3F 2MQOA 4UATA 3WT0A 1X3NA 3ZTSA 1Q82T 5CZ2A 1NGGA 4I2FA 4EAHD 4NLXA 5HR7A 4ZKAA 3G8SA 3LO3A 5F8GA 2LDYA 3MEGA 2HOFA 3HHLA 4YS2A 5LM7E 3NOCA 5A6WA 4KLTA 4L73A 2DWQA 3MAQA 3JAMO 8ICJA 2V94A 3FBEA 2HOEA 2CA9A 4KBIA 1JWWA 2Y9HA 1I3AA 1WLJA 1F6TA 3PMNA 5CWRA 3WEEA 3M9OB 4UTGA 4IOCQ 1UA1A 4QR0A 4FNHA 4QS8A 1H2UX 2V67A 3WNHA 5EXWA 4X5VA 1PCAA 2NCKL 2PFDA 2MLZA 4MKAA 4MAKA 4M9LA 3MAAA 3BKTA 3THXA 2B7CB 3IAS9 3ENAA 2V7ZA 1FXLA 2E1MC 3RB0A 2NUUG 3DFEA 4KV8A 3VESA 5I9EB 1XMQK 3CJRA 3ALRA 1KVJA 3LGNA 3FFKB 3NGKA 3F2CA 4U96A 4MKBA 3R5CA 4GC6A 3N4MB 2XY5A 4ID1A 1RQNA 4OI0A 3S3NA 4XAKA 2BPGA 3J7A1 3THYA 2XQCA 3OFGA 4M7YA 1XSLA 1ZQQA 1DFDA 3MUTP 2RQ5A 2KU7A 3AAPA 4EO8A 2KEYA 5A8KB 3N7RC 5KL8B 4A8EA 1Y9OA 1RT7A 4DV5K 1U02A 4U67L 1G6BA 2CQ1A 1MN8A 2XWXA 2I2YA 4K59A 4WYBA 4X62K 3TOQA 1Y3JA 4BY9C 3KTQA 3IRXA 3WKCA 3BP8A 5DKWA 3BEXA 4FK2A 8ICTA 4R8UA 2YHAA 2HOQA 3H0LB 1D09B 2CGLA 4ECTA 3AQFA 4OKKA 2YCHA 4EP5A 2VC1A 4LF6J 4M9GA 3PW5A 2QV6A 2VL1A 3NGZA 2YKMB 2YTCA 3T19A 1YAGA 3VTIA 3VEWA 4ZTFA 2ZBCA 4QIFA 1AUSL 1CJVB 3F5EA 2LXUA 2ROGA 2KJ9A 2BCUA 4WTYA 2FVQA 3CO0P 2GEMA 4ICAA 1L3KA 1KC8O 1N5YB 1LKZA 1TKXB 5GVQA 2A10A 4NLDA 3VAGA 1ECWA 2FC8A 3R5BA 5LMUK 1RT3A 3CM5A 1Q9YA 2VYPA 3HPOA 2LP4A 4NXNK 4ZJOA 1BIUA 2NXCA 1BA1A 5HAOA 5J0TA 3C3LA 3HO1A 1UZDA 3D2NA 5KFTA 3TO8A 2F44A 2VQFJ 1Z1VA 4U7UD 3HFZB 1O03A 5DBCA 4CESA 4FOEA 3BH6B 3CCJN 1KCFA 4JI2F 5CQGA 2ZC4A 2DRAA 3BS5B 4USIA 1S7HA 4B3MK 5G4DA 4NB4A 4I1TA 5BOLA 4FYWB 7ICHA 1Q78A 2BA9A 2HK2A 4F2RA 4LF6F 4B1YB 2M5YA 2HQGA 1A0PA 2Z8QA 1C0MA 3CFOA 4DUZF 1ZM3A 4A2BA 1WEXA 4Y3CA 2LYBA 1W2IA 2M7SA 5LMNJ 2A1JB 1DK3A 5KOXA 3SNNA 4NRTA 1S6QB 8ICGA 3MD1A 2QIFA 4KE5A 1RYRA 2ZH2A 1NBWA 4FK4A 1N36J 4E2FB 3EKUA 2E9RX 2YTUA 4B3OA 4F0HA 2QLBB 2ZH7A 1NGHA 2LFVA 3OJUA 2AP1A 4DL6A 2ACYA 5CHIA 1SJ3P 3KHLA 1D8ZA 4A4JA 1EETB 2KVQE 4B3TK 3IBWA 3A8KA 1QAIA 4U7CA 3L8BA 4Q7AA 4PKGA 3DU5A 4CQ1A 1NJIT 1X0PA 2XZDB 1KSPA 2P66A 4LJMA 3RZAA 4OJ3A 2WF7A 2V6AA 1EX4A 3N4PA 2FBYA 3HLUA 4P2SA 2YH0A 4TY9A 1MU2B 4DQQA 4OPJA 3TTFA 1BNPA 3OVSA 4K8ZA 1WAJA 4CZMA 3DU6A 1PAUB 1SPBP 3ONNA 4CD3A 4ANEA 2W2OP 2AQ0A 3TAPA 1S9EA 3PIOL 2LQ5A 3GWCA 1OUQA 1RBVA 4CJ5A 2DNHA 1TU0B 4CJQA 3GIKA 3E1YA 5GIOA 3AGRA 4CZGA 1M5HA 1BCOA 1MC8A 4KFBB 2IC3A 1ZAVA 3R2CJ 4H0TB 3ZCMA 4BWJA 2F9JA 4GV9A 4IH7A 3QE9Y 1U2CA 3L2UA 4Y2JA 1T9WA 2OYYA 4KLMA 2R8IA 3QFWA 3PSIA 1NK4A 3LA0A 1ASVA 1H0HB 1LKYA 3LVVA 4KPCA 5HVFA 2QXLA 1KVKA 4G1QA 2AYMA 5GTIU 4FJ8A 4H0PA 3IFRA 2GHVC 3O80A 4RNOA 3H4DA 4M9JA 2HWIA 1KFTA 3JQKA 5IWAK 1QSSA 1HBMA 3ZTQA 2BH1A 3OPXA 3DXMB 4CGDA 5AI9A 1Q82O 3W5XA 1H2VZ 2BXJA 2JLFA 1FD8A 2CPHA 3H8MA 2HOIA 3UPFA 3N5FA 3W9JA 4CIGA 3FSYA 3W2VB 3GZ7A 4OJLA 3QFHA 3HKZC 1VBZA 1DRZA 3FRZA 1DGSA 2OI2A 3AEVA 3N4WA 3UDCA 4LVSA 3V1OA 3AA3A 2FGCA 3FZFA 3VCDA 2R7TA 4DOZA 3SBGA 1UPPA 4KLFA 4NASA 8ICNA 3PR4A 4IG0A 1WF2A 2BE9B 4PZOA 7ICPA 3ZX0A 2A42A 4EENA 4CLTA 3IV6A 4TY8B 4RT3A 1QH9A 3IUCA 4YORA 2KW4A 4QIWC 4FWNA 3W61A 2NRHA 5AE2A 1QM9A 2CADA 1LV5A 5HR6A 1Y11A 5H9EJ 2C3PA 3DLEA 3D28A 1ASUA 5JVHL 3WHIA 1BO5O 1JXBA 4C1NK 1HQUA 2WAQC 5CEHA 4ZPBA 1J2NA 4YMEA 4R64A 2O8BA 4IS7A 3C8YA 4RR5A 2FPHX 1QQNA 2KYXA 2OELA 3HKZF 1WDDA 3WKEA 4FJXA 3HZEA 2MPUA 4DOBA 3DNCA 3M2RA 3SUQA 3NCQA 3S41A 5HRNA 2PYJA 4PGYA 2OYQA 1RDFA 4CH1A 5HL7Q 1ZBIA 4NEZA 2YWWA 4CLFA 4WK3A 4JI1K 2ZIXA 4LF1A 4OI6A 5J1EA 3KNGA 2BJ3A 2KICA 1WOSA 3CCSS 2NZCA 2PFOA 3GSIA 1CUKA 3ZNJ1 4QJFB 1DK2A 2AZ1A 1J9AA 3N0VA 3ZT3A 1MW7A 3G0ZA 3OUYB 1IUJA 3V2UC 5FIIA 3SI8A 3NBPB 8ICEA 5GMKa 3JSMA 2MY7A 3AO1A 4IWVA 1IXRA 3PY8A 3LK9A 3ULEB 2MGZA 1QJHA 2OWOA 3M8WA 3MR6A 4DZDA 2NO5A 3DXSX 1K1SA 4FBTA 2KMDA 1YVFA 2W9CA 2WAQF 4M5KA 3PX6A 1DQ8A 5CE3A 4BC2A 5KFCA 1KFDA 3AA8A 1X3MA 4B9NA 1NMNA 8ICAA 1T0TV 1BPYA 3H0PA 4A8KA 3FCHA 2K8GA 2J9DE 2QJ3A 4OIXA 2R7OA 3P31A 3CO9A 1GLDG 1L7OA 5BN8A 3Q8MA 3QEVA 1FEEA 2ASLA 4DR2J 2ASMA 5AT1B 2YMMA 1JMSA 3AM9A 4WIIA 1PIEA 4ZPCA 5DQHA 2IGIA 2P5GA 1N34K 2QKQA 3WXLA 1TL4A 1FTCA 3O0FA 4RWXA 3C2MA 4PAAA 2ZJPQ 2BHNA 4FKXA 2JX2A 1EXQA 3IDHA 4PHDA 3T9NA 1ELOA 2MUTA 1WUAA 4RUAA 2WB1D 3W62A 1JXVA 4Y0FA 1R8BA 2EC0A 4DTSA 3QJLA 2B6GA 3C14B 2NR0A 1QLNA 5ALGA 2KM8B 5JLHA 1SQGA 4HLBA 4H8KA 4N77A 2ETJA 3MECB 3CD6S 3QINA 4DB3A 1ZYQA 3A2FA 1ZTTA 2BCVA 1OY9A 3V81A 3CIZA 1Z1BA 4C3KA 4DOCA 1QUVA 2G8HA 1YRXA 4QOZB 2GQQA 1HW9A 3ZETB 3ETMA 1HNXJ 1TVAA 3MCMA 4QWEA 3H08A 5AKZA 1RG6A 1YBAA 1XNQK 3SMVA 5CRXA 2UUAF 4RUHA 5KFDA 2EAOA 3M2VB 1VJWA 1Y64A 2ITMA 2G8UA 7ICQA 4IDHA 3TABA 4UBBA 3ZO7A 4DV6F 5A8WB 3IAYA 2HFNA 4HI2A 2CRXA 3M9NB 2E1YA 4B17A 4OZ3A 2JL9A 4EK2A 3GR1A 3OFHA 5AJ3K 1VC5A 3IN5A 4RUCA 2W6LA 3FSIA 3L7PA 2V4JA 1AROP 2F8LA 3KBBA 2X3GA 2XULA 4OJ6A 3TAFA 1TL7B 5A0YA 2J4RA 4YR0A 5BR9A 3D7SB 1P9YA 2UVRA 1ZQGA 4US8A 2DK2A 4BR2A 1RU2A 1RHJB 3LPTA 2CN1A 1HBNB 3GB0A 2C1EB 2VFSA 2LEPA 3Q7CA 4B1ZA 2Q3SA 2PA8D 4LRFA 3EZUA 3A1YG 1SH3A 3PRDA 4ZCIA 2P9PA 2GLEA 1VJQA 4RW8A 4DI6A 3H1QA 4PQUA 2OIHA 2HI0A 3NGUA 3C0BA 3I56S 1I94J 5FRNA 1WBBA 1VQNN 5AM0A 4R25A 3PYGA 4PUOA 3C5FA 2GO9A 2JR5A 4HACB 1NJWA 3EY1A 2ISOA 4LZGA 4KAIA 1RI7A 3VZHA 4UOFA 4X84A 3LM9A 1T9TA 5AR0A 4ZN3A 3DYAB 5F9LA 3D3BJ 2EWSA 2HHVA 1VSHA 2G2OA 3NKYA 2QARA 3VEYA 4ES2A 3VQ7A 1UFLA 4FFDA 3QGHA 1NSAA 4NO7A 3IBPA 1XUPO 3KG4A 3TAMB 1FE4A 2UUBK 1TVRA 1SXEA 4LF7J 5F0XA 4WF9L 2LPEA 1UFKA 2B9XA 4MF8A 4DMZA 4OMFG 4CP5A 6FDRA 2W25A 4J9KA 3K5MA 1ED1A 2G5IB 2K89A 2DHSA 4ED7A 1N6QA 4DCPB 5E84A 4ILMA 1XR6A 4DR5F 3V5RA 3O9UA 1VQ7N 2OPRA 5A0LA 4K4XA 1EIYB 2VJVA 4CH7A 5AI0A 4CZLA 1UEKA 3EXCX 3UD3P 2XNRA 1OQ6A 3U9ZA 1IKYA 1NKCA 2FYXA 4ED1A 5JU5A 3RSEA 4AHRA 1MWYA 4Y2VA 2M8DB 2X1GA 4J9SA 3UKUB 4O0NA 3TUZC 8ICIA 1XU4A 4RL1A 3CD7A 2GH1A 4AQYJ 2YI1A 1YI2N 5KFZA 4OHWA 4GKKJ 4M8LA 2KK0A 3WBZA 4CEZA 4FF4A 1QHAA 2E5HA 4CO0A 4DR6K 4P9SA 4J5OA 2VA2A 5ELZA 2CPDA 4MIWA 2XO6A 2B4UA 1Y00A 2XI2A 1H1VA 4OKJA 4LH5A 3CC4S 4PRFA 3HX0A 1KQQA 5KG2A 1P8ZA 3QLHB 4JK8A 3KJNB 1RT1B 3BEGB 1JLGB 2G0JA 4G65A 3E2EA 3GSDA 1X5SA 2FC9A 5EGYA 2W3RA 4PWDB 2DL0A 3HHLC 2QKKA 5DRKA 4HL9A 2HQIA 2JZBA 3CDBA 4CEDA 1O6XA 2PFFB 5IFMA 5ALHA 5E2QA 1UJ5A 3AHPA 3QIOA 1XR5A 1EKEA 3A0HU 4X4OA 2QWMA 2B5JA 2Q79A 2PO4A 4DS4A 3GCWP 2HHTA 2N7CA 4JYAK 4OYMA 3UVJA 1S1WA 3HPHA 1HYSA 1IR1A 2V8VA 1L6NA 3RRKA 4KO0B 1S9GB 5L1KA 3WNFA 4RQ8A 2BQRA 1KTQA 3MN5A 4NXMJ 5TISU 3PYEA 3OFFA 3D2EA 4P0QA 3B8AX 1OSCA 5A8RA 1IV8A 4JKAA 1U0HA 4PHAA 3I55N 4ZS6A 4K42A 1RZTA 3MOJB 3CTRA 4CF4A 3TRGA 1RWXB 3R5JB 5C25A 4DL5A 1HEKA 2CQIA 1NI3A 4TXSA 4AD6A 2F1JA 2AX0A 2RUSA 3V1RA 4OJ5A 2D9PA 2AYEA 1N5VA 3AAWB 5IQQA 4GV6A 3DLKB 3KKAC 1NZAA 4GVBB 4DV7J 3CC7S 1X4HA 4K50A 2W9AA 2MZTA 4HHHA 4IDKA 3EZWA 3KD1E 3RJIA 1BISA 1L5UA 4DTPA 5HATA 2VANA 4I68A 4LBHA 1N2XA 5DB8A 3VOVA 1KW4A 3ZDDA 2HMIB 3IR7B 2D3ZA 3I0SA 4RQ2A 1NM2A 1HWKA 4HH0A 4X65F 1K8AO 5ALDA 4CEFA 3AVFA 5EN1A 4W90B 2CQ4A 3H46O 3SFGA 3WXMB 4RPFA 2GGPA 4DPOA 5DLGA 4DR1F 2DISA 1UL3A 4W4MA 1Y5NB 5J8YA 2G07A 4EBEA 1I6JA 2KSOB 4CZEA 2RF2A 4U67Q 7ICVA 4WKRA 2CIMA 1PVQA 2FHKA 4TN2A 3KLFA 2KHCA 3AJ2A 5HVHA 4BCAA 4WJ3B 4PKHA 5AQHA 3BSCA 3Q8VA 3UKRA 4FSVA 2X74A 3QYYA 3FEXB 4JV1A 2QLXA 4M5DB 2E1EA 3HBTA 2WOMA 3LP3A 1VRUB 4P0PB 2BE2B 2OKQA 2QYGA 3UE2A 4UY8T 5B08A 4FZZA 4ED0A 5EX0A 4M04A 4BE2A 2DIUA 1N0UA 1TFWA 4NPOA 2W01A 5DB6A 1GO3F 2G2ZA 1DTQA 3J80U 2RT3A 3ID8A 3B9JA 2QLJB 3CJKA 3T1HF 1KTVA 4DV2F 3RW6A 3TTCA 4CLPA 1NMEB 2PY5A 5HQ8A 2XTJP 4P52A 4R5PB 2JV3A 3DRXA 2ZH4A 1JKHB 4C80A 5CXTA 4H0OA 2DO0A 3UPQA 1D8YA 3ZZTA 4ID5A 1D4XA 2E8MA 3NGRA 3J81Y 3IWLA 5A76A 2YWFA 1ZM4A 5CYQA 1C1CA 2ZE2B 4Z4FA 3V7KA 1V3ZA 5AKEA 4J7CA 2MU2A 4ISFA 4HT7A 4GFJA 5CYMB 4E7KA 3HSJA 1ZM9A 3IM9A 3VQ4A 2HG4A 3QNNA 1NSKL 3C7NB 2P9GA 3ET6A 5ALMA 4XEIA 1WUUA 2GNKA 2KD1A 5ALWA 4RQMA 4IG3B 2I0XA 3OVNA 5BR8J 5HO4A 3M6WA 4LF4J 1JLAB 1MNEA 1IG9A 1U47A 1ICEB 5LJ5Y 5KAFU 2W2PP 4I2HA 3CULA 1EAYC 1FRLA 4BRQA 2ZGZA 4DR3K 4RLEA 2KKZA 4J9LA 4IJNA 1FFWB 4O0IA 1MG7A 3ZZZA 1KQSM 1GLLO 4L74A 1UHUA 1NM1A 3BO3A 4YQWA 2WVBA 3D2QA 2PBDA 2FY8A 4URSA 1VQ8N 4V19J 2HBRB 2CNKB 4DSIA 3BGFA 2VFRA 2DNRA 5AICA 4B3RJ 3BBCA 2VJUA 2ZC3A 2CH6A 4M3UA 4ECUA 1TKTB 4QZ8A 3VAKA 1ZS6A 3A4TA 4KHPF 5C0YA 3R5GA 2KNJA 3L4QA 2K7JA 3GE1A 2NRWA 5AK6A 1QTMA 1K73T 4K0KJ 1XSPA 2V8GA 3HI9A 2M52A 5KT4A 2WK4A 1LOUA 1S76D 4CERA 2DGQA 4FJ7A 4NLGA 5B0DA 2YHYA 4DUYK 3MN6A 2G0IA 1ZQSA 4YXJA 1ZQPA 5A8KA 2ZDPA 1BQNB 4U9RA 4LRCA 4LFBJ 3TVZA 2MAXA 2E3TA 1ZQWA 3PIOQ 5BRHA 3H0MB 3MTKA 1VK0A 3GG4A 2WBRA 1F0MA 3AVHA 3DHWC 4XPCA 2W40A 3AVCA 3WQTA 4FWMA 3TZXA 1YGYA 3CJ4A 4HAIA 1OVQA 4PL1A 9ICWA 1K1QA 1FVQA 3RH6A 3HPGA 2RHFA 3OL8A 2JHDA 9ICXA 3H8WA 3AVJA 5MLCV 1QY7A 2F76X 3AU2A 4IFEA 2YKMA 2BEFA 4M45A 1A76A 1KAZA 2HFUA 5C2CA 3J81U 1J6ZA 3CI5A 5EVZA 1YUWA 5J2AA 2BJ1A 3GU3A 1NGAA 1CJVA 2KYZA 4LF5F 4CGZA 1IBCB 3ISCA 4TURA 2XMJA 1N5YA 4M42A 1TKXA 4XDCA 2FI1A 3B6OA 4DV0K 3G6XA 1FXDA 4CIOA 3NY0A 4YOEA 3J81j 4UAZA 1U6FA 5KOWA 4UT4A 1GNKA 3BF1A 3AGKA 4OPKA 4Y2PA 4NLZA 2C2KB 4ZVUB 1LB2B 2U1AA 1ZM2A 3UI3A 1HI0P 4KTZA 7ICEA 4NLTA 1GX5A 4LR7A 1YXQA 2D41A 3D2WA 4HDGA 1G15A 1B7YB 1WEYA 4P4PA 2OUGA 4MIAA 1ZJMA 3OQ2A 1YQHA 3SQGB 1DXSA 1WF1A 3CJ5A 7ICLA 2AIRB 3HDSA 3ZZUA 3AOAA 4USMA 2J76E 3WXKA 4NMXA 3HJEA 5ALYA 2R9LA 4E89A 3CQXA 1A9NB 4ZCMA 2MLXA 3ASMA 2IHR1 4DR4J 2P6SA 5AKLA 1X5TA 1Y0HA 2OEJA 4ZCLA 3RJHA 3OT9A 4FZVA 2LU1A 4NI2B 4BDPA 2LEAA 1PC4A 2OP5A 5JVHQ 4WU2A 2A1JA 3M8ZA 5MAOA 4CJLA 1SC6A 1QZ6A 1S6QA 5E3CA 2WUSA 4BRCA 5HMLA 4DU3A 5HMWA 2XGQA 2YY6A 1ZQTA 3EPIA 2YMPA 1AXQA 2EW9A 4FKYA 2DNKA 3SDEB 4HUEA 4X64K 2KVIA 4XUSA 1Q86T 1NZ8A 1DHMA 4RBTA 1YIJS 3V1QA 3HX9A 1WSIA 4UY8O 4ZIWA 3RBDA 1ZQDA 1R8PA 5C24B 4OX6A 5J0RA 3EW9A 4XH1A 2ZEJA 2CPXA 3CNQP 2XG8A 4URGA 1LWXA 1VQ5S 3HM8A 4NXZA 2ZD1B 3T69A 1XJWB 4EZ9A 3KG1A 2K1RB 3CC2N 1NB2A 4J9QA 3F2DA 1U2FA 3OYNA 1U24A 5EWFA 4KFBA 5E3RA 1TGOA 1IXKA 1RBOB 1ZQCA 2RQCA 3BY5A 4JI8K 2V50A 1A77A 1JLQB 3Q2TC 2HQCA 4DL4A 4YOXA 2XGPA 1NG9A 4KTQA 3JXOA 2AU0A 1MDUB 2AQ4A 5KQ8A 4IR9A 3AB4B 4C0BA 2A6AA 2VJ5A 2QK9A 3W5YA 2ZJ8A 2F7TA 3HT0A 3BREA 4WE1B 3R1LA 1M6YA 2Y0SF 5KFJA 1YSJA 1UT8A 1CQMA 3V9ZA 4CECA 2V63A 2VKQA 4M63A 3MXHP 2J5AA 3S8SA 3DXMA 4JV5F 3NH0A 2RD5C 2UVWA 2CDQA 2BMBA 2WVFA 2BJEA 4J9UE 2BVZA 4OV1A 4ZVEA 1N60A 4RNHA 2R8KA 2K06A 3I5CA 1J2MA 5E26A 1YBUA 1VQSA 4YFUA 2JWNA 2CNNB 2DHGA 3G82B 2H3EB 4MDBA 2CJBA 4FS1A 3W2VA 5HSPA 2LMIA 2I9GA 3TP2A 2HMPA 1X1PA 1Q8LA 4M94A 2PC6A 2UZAA 3THPA 4OI4A 1HHQA 3NAIA 4AL7A 3JPTA 1PSDA 3OS1A 1J5EF 3BN7A 2HIQA 1XMQJ 1PYSB 2BJ7A 4A8MP 4TNOA 3RW7A 3OYDA 1S6PB 1AUDA 2FBVA 1R59O 2E9TA 1UETA 4TY8A 1KD1T 1QAYA 2UUCK 3NP5A 4H54A 5GTHU 1KLNA 4JHDB 3F44A 2DNQA 9ICTA 2LXIA 4EWTA 5F2RA 4YOUA 1FRHA 4M95A 4J2AA 2UU9K 8RUCA 3GE9A 4X62J 4KH6A 3F73A 1NSPA 4DCHA 2ZVIA 5FPNA 4H03B 3A12A 2FJAB 4O5EA 3MDAA 1WN7A 5FPDA 2JZ5A 1WAFA 3K89A 3WX8A 1U4BA 4NX9A 1UVIA 2OLWA 5G5GA 1XIQA 4HHJA 3THWA 2D74B 1UCNA 2A3JA 2QRRA 1RU1A 4ANDA 2B3TB 4BX9C 4NA2A 2HNZB 4OYWA 3P38A 2WBMA 2VBYA 1BNOA 4F26A 4PG4A 3CT9A 2ZM6K 1YJNS 1HYVA 3OUYA 1S77D 3EN9A 3OYBA 3NBPA 5CD4A 3V9XA 1VQPN 5LMUJ 4FWQA 3ULEA 2H1YA 2FC0A 4DDFA 1BPBA 4NXNJ 4OX9K 3DLHA 2UXCK 2JOQA 1T02A 1WF0A 1T9YA 3KD3A 3BDEA 4F67A 5AI5A 2HHWA 3SEOA 5J0UA 2HURA 2J0WA 1EWRA 3G6VA 4OYXA 1EXNA 2P6UA 2KHQA 2MKIA 3BR8A 5AI4A 4DU7A 2QB0B 1Z2ZA 4KLDA 4ECXA 1KVIA 4XH5A 2QE5A 2AEMA 1FNMA 4DV5F 4WF9Q 1RHKB 5CY4A 1NAQA 1AA1B 4K4HA 2HYIB 4UB1A 2F63A 3POTB 1ZQYA 3SD7A 1OXJA 3C6HA 3MM8A 1M5OC 4PL8A 2QA4G 3W9IA 1I39A 4H4KC 1XWLA 3QIPB 4F4KA 3FQLA 3N6NA 2WW4A 4DU4A 1MLAA 4XTTA 3WNEA 4BRMA 3C5GA 2OXOA 2QWOA 1IWGA 3K5LA 3KIOA 2HGLA 1HFEL 2J9EA 2AYBA 2E6LA 2SXLA 2I6WA 2QWLA 1KHWA 2YKPA 3GJTB 3KLIB 3GIRA 4ED4A 3C14A 3F9MA 2HVEA 2IBKA 2FGOA 2A18A 2VG6B 3C23A 1KWMA 5ALRA 1DURA 4C3MA 1OSDA 3MECA 5E7OB 3OJSA 1W7AA 4Q2LA 3GZFA 2VPYB 7ICKA 3SSRA 3W1YC 1X9SA 3G4SN 4B3TJ 4Y00A 3H45C 3VV2B 3ZETA 1NJYA 3KKRA 4J90A 5JXSA 2CRLA 4J9RA 3M2VA 5J1NA 2Y1RI 2VG7B 3FEZA 5C12A 1NXIA 1Q86O 5A8WA 1F5AA 1KAXA 2QEXS 4QR2A 2KP7A 3OYLA 1OY6A 4B3MF 3RMAA 3LPUA 3AO5A 9ICCA 2N1RA 5G0RB 4KRWA 2QA4N 4YOTA 3AY9A 4WU3A 2W54A 4OV6A 3FGUA 2AJ2A 1TL7A 3AU6A 2E1CA 5BREA 3MGHA 2DTUA 3UCUP 2FZKB 4FJJA 3NGTA 2VDHA 2L9DA 2OTJS 2ZH8A 2D3DA 2E1AA 1HBNA 1MMDA 4MFAA 3D6RA 3HM9A 2OGUA 3SAGA 5L1MA 1SJ1A 1YJWN 4FPIA 5J0QA 2QMXA 3O8WA 1MQ2A 2VQFK 2I7PA 4I69A 4CHPA 1U09A 1XR7A 2WHEA 3DDHA 1UVKA 1UCVA 1P8GA 1YT3A 3M8SA 4U95A 1IO2A 5GIPA 2ZNZA 3AVBA 5HK4A 3ZT1A 5IWAJ 2HS0A 4BRGA 1PKUA 3GYNA 1DZ5A 4ZA1A 3RGIA 2C2DA 2GELA 4HACA 2D3OR 1RAFB 1WI8A 1BWFO 2CJYB 4K8RA 5HN0A 2GAHC 1HJOA 1RBUA 3DYAA 3MM9B 1JK9B 5KAKA 2ZIUB 1M1KT 1SWVA 4RQ4A 3Q23A 4PCQA 5EUHA 1H3DA 3TAMA 3BBBA 2RRAA 2W42A 1FCAA 2ZTEA 5LMNK 4AP9A 2F77X 3P3DA 1OJ4A 2XMWA 2FQQB 3DLGB 2BBEA 2YBVA 3ZSXA 1LWEB 3LP0B 1N36K 5CZXA 2VASA 3EZOA 5CD4H 4MLEA 3FK4A 8ICSA 1A5XA 3KNAA 2HZVA 3PRVA 4WBFA 5AQRA 2D0CA 3J80O 1X4GA 1P9QC 2CQHA 3S7RA 2O8CB 5CA7A 3VQEA 1GK8A 4G1IA 5D4OA 4WFZA 1SL0A 4KGVB 1GH8A 4DX5A 4AH9A 4DZ6A 4OQJA 2VH7A 4I0WA 2IHMA 4RCHA 3R2DJ 1J54A 4CF3A 4MMOA 2KVCA 1IG6A 3UMGA 4CLZA 3UKUA 2QC3A 1PGZA 1JRPA 2LYAA 1KD1O 3MUVP 3JYTB 1HBUA 1NU0A 1QQCA 1S1XB 5IWAF 2MSTA 4HR2A 3P6YC 4Z7YA 4IC9A 1U26A 5M1OA 4Z4HA 4OZJA 4IQUA 1VQ6N 2IRXA 1YITN 4ERDA 4CZCA 2XLIA 4A57A 2E7WA 4B9LA 2XHCA 1IBMJ 4GO7X 4F4ZA 2KIWA 3D5MA 2ZZTA 2OPSA 5ETQA 4JI1J 2GO8A 3UE5A 4EYIB 2DRBA 2ZWHA 3M8Y