4DQPA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and ddctp (paired with dg of template)
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
580
structure length
576
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 199
structure length 576
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqpA01
4UBCA 8ICFA 4PPXA 2HNYA 1S6QA 4MF8A 4CESA 1A77A 2HHSA 2YHBA 4GW6A 3P83D 5C25A 1X9MA 3QEAZ 3SQ0A 1NOZA 2IMWP 4ED3A 8ICAA 3I8DA 2F1IA 9ICLA 1LWEA 4CF0A 3IG1A 2ZD1A 4IQWA 1NKEA 3SJJA 1SL1A 2NUBA 3UQ2A 4MEXA 3JPQA 2ZQBA 4NLZA 4PHDA 2G8HA 5HNKA 3Q8KA 4EP4A 3LWLA 3ZDDA 4AHVA 3AV9A 3HM9A 3OJSA 3NH0A 4AH9A 3QESA 4FLTA 2LYHA 5KFVA 4FLWA 3NH2A 1QTMA 3ZT0A 4UQGA 1VRTA 3KLHA 4QZIA 5DBBA 3H08A 1D8YA 4CIEA 1KFTA 1NJYA 4CEDA 1LB2B 3TAQA 3O4NA 1IXRA 4BWMA 4RPYA 1B92A 3LZIA 1Z25A 1O1WA 3KHGA 3HPOA 2YKMA 1N5YA 4P4MA 3PW7A 1WSIA 5KG5A 4QZ9A 4FZYA 3RR8A 3VQCA 2RKIA 3RH5A 3OGUA 3AVMA 4RU9A 3M9MB 4ECZA 1ZQLA 4B3OA 3P5JA 3NCIA 1S0VA 1EETA 3D45A 4AHSA 4RT2A 5KT4A 2C28A 2PZSA 2XCAA 1A76A 4RQ4A 3NE6A 2UVUA 5CYQA 5D4BA 4Z6FA 2RF2A 1WCNA 1TVRA 4E1NA 5EWFA 3JPTA 2F96A 1COOA 1BPBA 1RZTA 3THVA 4E3SA 2I9GA 4IFVA 4RQ8A 2YV0X 8ICVA 8ICCA 3V81A 1H38A 4JWNA 4BACA 3AA4A 3LK9A 3EW9A 1CLQA 5KG6A 4Y1DA 3NAEA 1C6VA 1JXLA 4Z6CA 2DPIA 1NK6A 4DL6A 3AO3A 4DTJA 3PW2A 3UPQA 2IBKA 1LWCA 3QEWA 1KSPA 2PI5A 1KVAA 3EZ5A 3MR2A 4IRDA 4DSLA 4QWCA 3A2FA 4MF2A 4KLSA 4YQWA 1XHXA 3BGRA 1CZBA 2IOCA 2W9BB 1HUOA 4I2GA 5KFHA 2R8HA 5IIKA 4M47A 2R8IA 3V9WA 2J6UA 4RW6A 1IH7A 4ED8A 1VSIA 8ICPA 1HJRA 1S5JA 4N5SA 1ZQHA 1RBSA 3AVLA 4TUPA 1MU2A 2PFNA 3JPRA 4R65A 5KFAA 3NBPA 5KFIA 3O3FA 4F5NA 4O5KA 2NRXA 4I2IA 5KFBA 5L1JA 1U4BA 2HHVA 2YNGA 3PVXA 4I2CA 3ZSQA 3SPZA 5C24A 2OWOA 3VQPA 3E2EA 1C1BA 3KHRA 3RB6A 4IKFA 4AHRA 4NLGA 4H4MA 4FJKA 4DO9A 9ICRA 1T7PA 2PFPA 5D3GA 3KIOA 2XY8A 3ZDEA 4FO6A 2ASLA 4F4YA 5KFPA 3RB4A 5J2IA 3HT3A 4ELUA 4I2DA 3H4BA 9ICCA 4KLFA 4CERA 1NKBA 2ETJA 5JUMA 4E1MA 3RJKA 3NF8A 4QWBA 5D49A 2IAJA 4NXZA 1NKCA 1TKXA 3C6UA 2JEGA 9ICKA 4FJNA 4F4ZA 3TAPA 3M8PA 1S6PA 4XUSA 1XO1A 3GFKB 1ZQAA 3S9HA 4AHTA 9ICGA 4E7HA 1HQUA 3T5HA 4J9OA 1BPDA 3PX4A 3RWUA 4BXOB 1FKPA 4IQTA 1HNVA 2FPMA 4M9LA 2VWKA 1ZQTA 3RRHA 5CP2A 4H8KA 3PX6A 1I3AA 4CF1A 3OYHA 3MBYA 1L5UA 1BPEA 4Z4FA 3V9SA 4OVLA 1IKXA 5CY4A 1UT8A 3GDXA 4CHPA 1T3NA 4FLUA 1RNHA 2FLNA 4F2RA 8ICYA 4J2AA 3VQ6A 4F93B 4O5CA 4DL4A 3N97B 1S9GA 4FM2A 2BR0A 1BCOA 2FMSA 1L3SA 4CEBA 4NCGA 4FK2A 4CJVA 7ICLA 1JL1A 5J0RA 1XSLA 2OZMA 1U48A 1N48A 3QZ8A 3M8SA 1RT7A 4NYNA 3V6JA 1G15A 4KI4A 1S0NA 5EWEA 4N41A 4IRKA 2H5XA 9ICXA 4CJRA 2IA6A 3V9XA 2JEJA 4Z0UA 2UVRA 4J2DA 1Q8IA 4MFFA 4DFMA 3PW5A 3AVHA 3DLGA 3B0XA 8ICLA 4JV0A 5J0WA 1S77D 1B9FA 4F3TA 2P5GA 4CECA 4M6WA 5IIIA 2HHQA 3HYFA 1ZQYA 1LAWA 4CGDA 4CJWA 4KHSA 8ICGA 1T05A 4E0DA 1NK4A 5DB6A 1RCHA 4UB1A 3AO2A 4O0JA 4DTPA 1RBUA 4QAGA 1Q9XA 2DY4A 3SI6A 4I2FA 3TFRA 4FZZA 4RNMA 3HJFA 4UAWA 2Y1IA 5KRTA 4I28A 2P51A 1D8LA 3S3NA 4F8RA 2LSNA 2BE2A 2E6MA 2D0BA 4FLVA 3AA2A 9ICQA 1B9DA 4GMJB 4CK3A 4TUSA 1HMVA 1RTIA 4N47A 4CJ5A 3C94A 3EPIA 3LALA 1Z3EB 4RQ2A 3P1GA 4RQ1A 9ICVA 9ICTA 3DLBA 2ZE2A 2FBVA 4FJLA 3GV5B 1QE1A 2HHXA 4PQUA 3OVNA 4M3XA 1J5OA 1T8EA 3AVKA 3AU6A 3V6DA 3OYMA 4M0AA 4JRQA 5J2QA 4KLJA 4ECVA 1C7YA 5BOMA 1B22A 2DTUA 5F9NA 4QW9A 3CFOA 4I2AA 3ORYA 1U47A 4CGGA 4GXJA 2BGGA 4M3WA 3OYCA 4F5OA 5CZ1A 5KFXA 1W9HA 1HYSA 4BXOA 3AVIA 4PGXA 5IIJA 2VA2A 4MFCA 4RQ5A 5DGBA 4DEZA 3CFRA 3QEIA 4ED7A 3JPPA 4CJLA 2UVVA 3UXNA 3OHBA 3NGYA 2D5RA 3L8BA 1NOMA 5DLFA 5J2AA 2XGQA 1NJZA 2PYJA 4I2QA 1X1PA 1JLCA 8ICIA 1WSFA 3V6HA 4M3RA 1TK8A 2HVHA 4F3OA 2D0AA 4DQQA 3EY1A 4KLIA 4HCCA 4IQUA 4MQ3A 1K1SA 4M3ZA 4RQ7A 2OA8A 3DRRA 3SI8A 1HYZA 1YT3A 2W9CB 1JLEA 4YR0A 1JL2A 2Q3SA 1YVUA 4FCYA 2NRZA 5L9XA 4RUCA 3VQDA 3DLKA 4FM0A 4BE0A 5KG3A 4DSFA 1B43A 4EBEA 4OPKA 3WNEA 2P6UA 3K4GA 4X5VA 3PY8A 3MXMA 1KCFA 1ZQRA 3AVJA 4KV8A 2RDIA 4NCAA 3AVBA 3V1OA 3M8QA 5DB7A 8ICHA 3VQ5A 3HX0A 1Y97A 4LH4A 7ICHA 3OHAA 2ZTDA 3DMJA 2VA8A 3IRXA 3V9ZA 4M42A 3IHQB 3ZT4A 4F4XA 3DM2A 4KLGA 5E41A 5KT7A 2KTQA 2JZBB 5KFKA 4PUOA 5JS2A 1RT4A 1RBTA 2PFQA 9ICUA 4KLLA 2BKEA 3PX0A 5L1KA 4JK1A 5F9LA 3CM6A 3D0PA 4F91B 4DL7A 5J2FA 5KFWA 3NH1A 1ASWA 3QEBZ 5CJ7A 1BPXA 3TAMA 5EOZA 4YD1A 4DL2A 4W5OA 5L1IA 1RPLA 4FK4A 4Q45A 4W5RA 1RT2A 4B9NA 4I2HA 3ISDA 4CIGA 3PNCA 1CUKA 3NFAA 4OKKA 3TAEA 4XRHA 4OPJA 1JN3A 7ICNA 4M3UA 1TKTA 3S3OA 5J2PA 4RQ3A 1U04A 1QLNA 5J2BA 2ZTEA 3SQ1A 4CFBA 5HP4A 2PYLA 1DGSA 4CIFA 4DFJA 3NDKA 1XS9D 2W9AA 5HP1A 5KFYA 2XY7A 4CGIA 5KFZA 1UA1A 1D5AA 4YMOA 2C2DA 1L3VA 4O9MA 1ZJNA 3AO1A 5DBAA 3H8JA 1ZQGA 3RJHA 4YXJA 4KLOA 3LDSA 5HMMA 7ICGA 3U3YA 2BPFA 4DTXA 3HSTB 3NGIA 4QWEA 1KTQA 5HRPA 3GIIA 4GXKA 1BIZA 3RBEA 1TAUA 5CA7A 4KHWA 3LP3A 3ZD9A 3ETLA 1X9WA 3TR8A 4M9GA 2ZJ8A 5HHIA 3L2RA 1HQEA 4PH5A 3T5KA 2G8WA 3T1AA 2P5OA 3AU2A 1Q9YA 4IDKA 3NGZA 1UA0A 8ICQA 2JGUA 2KN7A 3V7JA 4FJ5A 3JYTA 1RYRA 3Q8RB 1KFSA 3RJEA 4M45A 3ZT2A 3O3HA 1NK0A 1N56A 2RDJA 4CGJA 4HTUA 4R63A 5KFFA 1U9LA 3PW4A 4P4PA 3MGHA 3MDCA 1TAQA 4XQ8A 4LVSA 4J2EA 4Z4EA 2PY5A 1VSMA 3EWAA 1NK9A 3OJUA 3ASMA 5BOLA 3QEVA 5C42A 4QZDA 2B4JA 1LW2A 3MR5A 1RBVA 4JUZA 3UIQA 2V4RA 4N56A 3JPNA 3DLEA 4YR2A 4IG0A 1VSLA 2PFOA 3ZCMA 1S1VA 4DTNA 4TQRA 3JPSA 5J0TA 3H4DA 4I9LA 4QZEA 3AO5A 1NJXA 3OYJA 2IHMA 3ZSWA 3KHLA 3QERA 4KB0A 3S3MA 4DOAA 5HRSA 3OS2A 3MFHA 2Y1JA 3C5GA 4CF9A 5D46A 4FJJA 1MQ3A 2XHBA 2V4QA 2EHGA 3SYZA 4DQPA 1WN7A 5KGWA 1TV6A 4CJEA 3ISNC 1UT5A 4Z4CA 2DFFA 2YHAA 3KKRA 3BQ1A 2AGOA 7ICSA 4Q8EA 1RILA 2W8KA 4KLEA 1IO2A 4FW1A 4C8KA 3QETA 2GWSA 3SNNA 3V72A 4XA5A 2AU0A 4K8XA 4F4WA 3VQBA 2D0CA 5KFLA 1ITGA 4J9QA 5DG8A 3M9NB 4BDZA 4CJ4A 3HPHA 3H40A 4KHYA 1ZQVA 1S0MA 1XU4A 3F9KA 4KN7A 3I0RA 3VQ4A 1RBRA 1ZQMA 5DLGA 4Z4GA 8ICRA 3KK3A 3IM1A 4O3PA 4R8UA 3V7KA 3RTVA 4DS5A 2XRIA 7ICQA 3QO9A 4CHZA 4O3QA 4KLUA 5J29A 3HO1A 5HBMA 4FZXC 4KTQA 1S1XA 4UB5A 3K2PA 4C8MA 9ICHA 4P2HA 4I9QA 4I2EA 4M2YA 3RB3A 5CHGA 3HVRA 4KRFA 2G8VA 4ELVA 2W42A 2XY5A 4B8AB 5DKWA 8ICSA 2E4LA 4CJTA 4Z6EA 3O4QA 4E89A 4EZ9A 1ZETA 3ZT3A 3RBDA 4Y1CA 4GVMA 4K4HA 1X2IA 2OPQA 3VQEA 4QZCA 4J9PA 3RAXA 4O5BA 1KVBA 4DQSA 4PHPA 4JLHA 1QSLA 2ALZA 5DGAA 4DWIA 1NK8A 1RTDA 1ZQWA 3M8RA 3OYNA 2MUTB 4DF4A 2F8SA 5CB1A 4RUAA 3ULDA 1IM4A 2ZTCA 3CYMA 4CHQA 2YNIA 4DS4A 2DPJA 4DTMA 3RH4A 7ICFA 2P6RA 2C2RA 4M6WB 4P4OA 2X74A 3IS9A 3U3GA 4FS2A 5I3UA 3K5MA 5KFOA 4CK2A 1NK5A 4YFKA 8ICTA 1WNSA 4J9SA 4JV1A 3OYIA 1SV5A 1HNIA 4PHEA 3L2QA 1LW0A 3Q8LA 4EYHB 4WE1A 4ECSA 5KFGA 3WNHA 2FLLA 1REVA 2WTFA 4CE9A 2GV9A 2MAXA 1BQNA 4CJPA 4FJMA 3LZJA 1DTTA 2QKKA 3HK2A 3C1ZA 3RH6A 5KG1A 4OLBA 1T4GA 4RW4A 4FBUA 2R8GA 3AVGA 2FMPA 4K4GA 2OPSA 2IGIA 5J0OA 3SUOA 4IFYA 1MQ2A 4NLKA 3TQ1A 4I2JA 1MSWD 4RW7A 2FBTA 1I39A 4Z6DA 1J53A 1S76D 5FROA 4R5PA 1LAVA 4NLNA 3OS1A 4FJGA 1BHLA 3K5LA 5J0YA 4FJIA 3GV8B 4YMMA 1IKVA 2X6NA 3Q8MA 2AGPA 1L3UA 3PMNA 5HRRA 3MABA 2YKNA 2I1QA 4EEYA 3HL8A 2Z1GA 3Q8SB 4ECYA 1S97A 5FRNA 4LY7A 3UXPA 2FC0A 4E7JA 8ICUA 4Q44A 1BCMA 5KT6A 1KRPA 2ZUDA 2X6SA 3NTUA 5IIOA 3NF9A 1ZQBA 3E01A 1RT3A 3RJFA 4J9RA 2KFNA 3SV3A 1RT5A 1VSHA 5KGXA 2HHTA 3FDSA 3MGIA 2KZZA 5KRSA 3KTQA 4FS1A 3ZSXA 3CFPA 4KLQA 2VWJA 8ICNA 1S1UA 2G8UA 3RMDA 3QZ7A 2BPGA 1T03A 1S9FA 4LH5A 4UBBA 4DQRA 1WSJA 2NRTA 4FJXA 5KG7A 4W5QA 3PMLA 4UAYA 4PWDA 2BCUA 2KFZA 3RRGA 3H8SA 2IS3A 1KLNA 4DSEA 1Y88A 4KITB 1TL1A 3OYBA 4FLXA 2JEFA 3M9OB 4I2BA 4UB4A 4TQSA 4YFUA 1VSDA 3SQ2A 1ASVA 1VRUA 3LPUA 3ZDCA 1HUZA 3QE9Y 1RXWA 2BGWA 3QEPA 3QIOA 3G6XA 1S1WA 1VSJA 4HVJA 1ZQZA 2XC9A 4R8UB 3ZSOA 4YP3A 1IKYA 2OYQA 3PR5B 1CZ9A 4CJKA 4B08A 3GIKA 2HNZA 3HP9A 3AO4A 4ZH4A 3OYKA 4HHTA 2J6SA 3OYGA 3OSNA 4DQIA 2KZ3A 8ICBA 4M41A 3OSPA 2FBYA 1RDBA 4FBTA 3HPGA 7ICTA 3PO5A 5KFDA 1GOBA 1JLAA 3SUNA 3EPGA 1LWFA 4E19A 5KFSA 9ICOA 3KK2A 4ID5A 2ATQA 2Z1HA 1ZBLA 4J9LA 2BQUA 3FYHA 2BANA 4J9MA 4GXIA 4L8RB 1WAJA 2KQ2A 5J2DA 1ZQUA 8ICXA 1JKHA 4CHNA 4RNOA 5EWGA 5IIMA 4KFBA 2ISPA 2HHWA 1RDDA 3T19A 7ICJA 2XY6A 3BDPA 2W9MA 3WNFA 5KFRA 1HJPA 1RYSA 4ECQA 4IBNA 2GUIA 4JS4A 2RN2A 1BIUA 3TANA 4CFDA 5HMLA 4FK0A 3LP2A 4HUGA 1LV5A 1ZQDA 4QZAA 3OY9A 3C23A 4B9TA 4ED0A 2ASDA 3TI0A 4OLAA 1JLFA 1K1QA 3DYAA 2HHUA 1XC9A 5DG9A 3QIPA 4DFPA 1JXBA 4YR3A 4ZHRA 2Z1JA 3WNGA 5KFUA 3CG7A 1HYVA 2IC3A 4ECTA 1RT1A 4CF2A 3PO4A 2WONA 3HXMA 4RPXA 1NJWA 3AVFA 2NRVA 1BL3A 3DI6A 4CJFA 2W9BA 4PA1A 1DLOA 4CFAA 4EP5A 3VN5A 3PR4A 1X9SA 4O3SA 1PZNA 2HW3A 1JX4A 5DQGA 4QZ8A 4ECWA 1S1TA 4UB2A 4W5TA 1K6YA 3C95A 5DQIA 1AROP 2FLPA 4CEEA 5J2NA 3NGDA 4RNNA 1A5WA 1SKRA 5SWMA 4KLTA 3VQ8A 3MDAA 1VSEA 3F73A 4HCBA 4QOZB 3K75D 3SUPA 4KTZA 1XHZA 4KPYA 3RB0A 4FLZA 2W9CA 1EKEA 3C1YA 1HRHA 5KFJA 1C0MA 5DK5A 2NRWA 2BQRA 1TKZA 1RDCA 4C8NA 9ICWA 2J6TA 3V7LA 1W0HA 4QZGA 1R0AA 4DLGA 4KN4A 1ZQXA 3T5LA 4NYFA 1YTAA 4KTWA 2FPLA 2AQ4A 3VQAA 2PI4A 5KT2A 4LZDA 1C1CA 2B21A 2JEIA 8ICOA 3AA5X 5DDYA 7ICEA 4BGDA 4KB1A 3DOKA 1TVAA 1Z00A 4KMUA 4E7IA 1NK7A 2O4IA 1CXUA 3NF6A 4QWDA 3MR3A 3V1QA 1UAXA 1WSEA 2BCRA 2B6AA 1SKWA 2OPRA 2QXFA 1XI1A 4FJHA 4IG3A 4PGYA 4DTUA 3LAKA 5CYMA 5KFQA 2BDPA 1RT6A 4B9UA 4RQ0A 5BPCA 3QLHA 2DFHA 2JLEA 3CQ8A 4CEZA 4KI6A 4FXDA 4GC7A 3MR6A 4MFBA 5JS1A 1QS4A 2G8KA 4B9MA 1BVSA 4OGEA 2BHNA 4G1QA 2R8JA 1RXVA 3Q8PB 5EU7A 4XIUA 1J54A 1ZQCA 3LWMA 3SV4A 3VQ9A 4DSJA 4H4OA 3BQ2A 2DFLA 3GQCA 4FLYA 2Z1IA 3T3FA 3MFIA 1YTUA 2BQ3A 4BWJA 5KG4A 4NM2A 4O0IA 2VG7A 3OYLA 4M9HA 4O3OA 9ICIA 5CZ2A 4DTSA 1Z26A 8ICKA 1GOAA 3HVTA 3K57A 1JMSA 4ECUA 3C6TA 2I5JA 2C22A 4AILC 4J2BA 3ISCA 4DSIA 1JLGA 3MXJA 4BDYA 3ITHA 4J9NA 3ZDBA 5FDLA 4QWAA 2FBXA 5KFMA 3OYFA 4CF8A 3V6KA 4CHYA 1ZQEA 5C5JA 3JPOA 7ICKA 1ZQQA 5KT5A 1FKOA 3LP1A 2BPCA 5J0SA 1EXQA 4TSXA 2HMIA 4PGQA 3RMBA 1JXEA 5KFTA 3AVNA 4JRPA 1D9FA 4KREA 2QK9A 3KLEA 3FFIA 1ZQSA 3B6PA 3G0ZA 3V9UA 2X78A 1BPYA 9ICBA 4BE2A 1RTJA 4O44A 3G10A 4CK1A 3MEEA 4KO0A 4HUFA 2A1JB 7ICRA 4F5QA 3CM5A 3ZSRA 3OYDA 4TUQA 1ZQNA 1EXNA 1HPZA 1XSPA 5J2MA 2ZUBA 9ICEA 3VA3A 3MECA 3L2UA 4QZFA 2BCSA 4JS5A 1KLMA 3ISBA 8ICZA 1IKWA 2P66A 3TWHA 3DOLA 3GIMA 4N76A 2VG6A 4C8OA 5IINA 3ALYA 5KFNA 4UAZA 1TK5A 1VSFA 1UWBA 3JSMA 4IR9A 5KFCA 2C2EA 4CEAA 3KD1E 2AJQA 1Z00B 1QSSA 2A1SA 4ELTA 4Q0BA 5L1LA 1UOCA 1IG9A 3DLHA 2G8FA 3G6YA 2XO7A 4BDPA 2DFEA 8ICWA 3H8WA 4OKJA 5HHHA 7ICUA 9ICJA 2IHNA 1BGXT 9ICAA 3DRSA 2UVWA 7ICVA 2GBZA 3AVAA 2WOMA 4ECRA 1ZJMA 5DB8A 4TURA 7ICOA 1C0TA 3LANA 4FJ9A 4QZHA 4B8CA 3QNNA 7ICMA 1JLBA 4LZGA 3ZDAA 4BE1A 1ZYQA 5CR0A 5I42A 1TKDA 2HVIA 5FRMA 4ID1A 2PXIA 1ZBHA 2R8KA 3DLRA 3BJYA 2ATLA 1ZQKA 4AHCA 5J1EA 4RT3A 1D9DA 2M9NA 5J2CA 4Q43A 3UQ0A 1BQMA 4DF8A 4M3TA 4FVMA 3VQQA 5J2KA 3L2VA 3NHGA 2BCQA 2KZMA 2VA3A 2B5JA 4M3YA 4HUEA 1FK9A 4F2SA 4Q8FA 1NOYA 3SUQA 4GC6A 3VQ7A 4CGFA 3OYAA 3VA0A 4KLDA 5J2GA 4QZBA 4DTRA 4YNQA 4KAZA 5KG2A 4DU4A 4KHQA 2A1RA 5J2EA 2XCPA 3RMAA 4CEFA 3C21A 4NY8A 4CJSA 3KJVA 2ZJAA 1SKSA 4DG1A 2HB5A 2OZSA 4CGHA 3BQTA 5DBCA 4KHUA 3LDAA 4M9JA 4I27A 3QEXA 1KFDA 2Q0ZX 3AUOA 4YVZA 1ZBFA 3TAGA 3MXIA 4RQ6A 1ZQFA 1TFRA 3ZSVA 3RJJA 1WLJA 3TFSA 3ZSYA 4ED2A 1GOCA 3AVCA 1U45A 2F8TA 8ICJA 1RTHA 4ECXA 4DU3A 4LSNA 2AGQA 2RPIA 4HYKA 5IILA 3Q8QB 1SZPA 4FM1A 3SCXA 4IQVA 2E6LA 5K14A 3C2MA 3T5JA 5T7BA 3B0YA 4K4IA 4DL3A 5SZTA 4C8LA 2YNHA 4E7KA 5HLFA 4PHAA 4YG2A 9ICNA 3DRPA 4CJUA 3LPTA 3K5OA 2MUTA 1ZBUA 5HRNA 4AHUA 3K59A 5HROA 4FJ7A 4B9SA 1XWLA 4F92B 3RJGA 4FJ8A 1BISA 3ZT1A 3L3UA 5DMRA 3ZD8A 1C1AA 4O55A 4KKOA 2EX3A 2YNFA 3PUFA 4RW8A 1A5VA 3LAMA 4EBCA 2JZBA 5J0XA 4YD2A 3KK1A 4FYDA 4OKEA 4O5EA 4LD0A 4MFAA 4M04A 3SQ4A 4J9KA 2BCVA 2FMQA 2QKBA 1CXQA 1KVCA 1JIHA 3MEGA 2F1HA 4CEQA 1TK0A 4B9LA 1ZQIA 2ITGA 1U49A 9ICFA 4PY5A 3NF7A 3LP0A 2A1JA 1TV9A 3GV7B 3HWTA 4IR1A 1MC8A 4RW9A 4O3RA 4CFCA 4F5RA 4DL5A 1DOQA 3KLIA 4ICLA 1SL2A 1CEZA 4Z4IA 1V9PA 3PV8A 4OGCA 4ED6A 5J0UA 4EYIB 2V9WA 4KHNA 3ZSZA 2FPKA 3RAQA 1XSNA 4NM1A 2O4GA 1N6QA 3L3VA 1S10A 1JLQA 4QCLA 1C0UA 3IAYA 4K8ZA 4DMNA 1ASUA 3KD5E 4KLHA 1QHTA 4YMNA 1QQCA 3C2LA 1ZQJA 3AA3A 9ICSA 2XGPA 4ED1A 5DG7A 3U6FA 3GIJA 1ZBIA 4MEYA 4G3IA 7ICPA 4W5NA 4UB3A 3K5NA 3N4MB 4EBDA 3KKSA 1TGOA 1QSYA 4DOBA 1EP4A 5J2JA 1TL3A 4KLMA 1A5XA 2R7YA 1S9EA 5KI6A 3QINA 1WCLA 1L3TA 4NCBA 3KLGA 3K58A 3C2KA 4O3NA 4Q5VA 3MEDA 4R64A 4I2PA 4YN4A 3OS0A 5J2HA 1FXXA 4OJRA 4DTOA 1BI4A 3TABA 3PW0A 3H7IA 4RG8A 2OPPA 3QNOA 3V1RA 3GILA 4IRCA 4CJ3A 5CWRA 4DU1A 4JWMA 5DB9A 4DOCA 3O3GA 4EZ6A 4CEOA 3L2WA 1DTQA 4YCXA 5TZVA 5KTQA 1WSHA 4ZTFA 3HP6A 2KW4A 7ICIA 1S0OA 1WAFA 5KG0A 1ZQOA 4YXMA 5KT3A 1SUQA 2W8LA 3KLFA 1F21A 4QW8A 4DLEA 8ICEA 3V4IA 4E7LA 3SZ2A 3RJIA 3RR7A 3C5FA 2F1JA 2ZJ5A 5DDMA 4M9NA 3KHHA 5KFEA 1VSKA 4F50A 4RPZA 2HNDA 1J9AA 1EX4A 8ICMA 1WSGA 3EYZA 4O4GA 2IDOA 9ICPA 4CJQA 2VANA 2AQ0A 1ZQPA 4B9VA 4LSLA 3SPYA 4DSKA 4CCHA 5J0QA 2VG5A 1VK0A 1RDAA 1KEJA 3UXOA 5J0PA 3G6VA 2P1JA 4DFKA 1BPZA 3TAFA 1KDHA 4F4KA 2ASJA 4ZTJA 2ZUCA 4JV2A 4R66A 4FW2A 9ICMA 4Z4HA 1SL0A 3TARA 3I0SA 4CHOA 4GLXA 3B6OA 1BI4B 2G8IA 4I29A 4I7FA 3HW8A 3MAQA 3BQ0A 3OYEA 4F5PA 4RZRA 2ISOA 5DQHA 3RMCA
chains in the Genus database with same CATH superfamily
5FPNA 4UBCA 2KXHA 4CESA 3L9ZA 2YKOA 3PIOQ 2QGFB 5AQOA 2HHSA 5G0RB 3TW0A 2YWKA 3VGKA 1U2VA 4C8ZA 2F1IA 4OZ3A 3IG1A 4FVCA 5HQLA 2RRNA 1VYAA 3FQKA 3JPQA 2PSZA 3ENVA 4PHDA 1X8DA 3K89A 5HNKA 3Q8KA 1VHIA 4EP4A 2LEAA 2LQ5A 3DXBA 3GWCA 4OZ0A 1RDWX 1WKLA 4WFNL 3NH0A 4AH9A 3QESA 4HHJA 4CNYA 2LYHA 3J7A1 2W6LA 5KFVA 3BN7A 2DNPA 3DMJB 1N2XA 1VRTA 3PJ9A 1M90T 4QZIA 1NJYA 1N52B 1Z2LA 2YTCA 4BWMA 2O5DA 3LZIA 3CGIA 1O1WA 3PACA 2YKMA 1N5YA 2HF3A 4KR0B 4P4MA 5KG5A 3MK6A 1CS4A 3DI6B 2ZWHA 1OSCA 4XEIA 2DISA 1O51A 4Z7YA 4CZKA 1IBKK 3UE2A 2B4VA 1EETA 1DLOB 1Q7YO 2C28A 4ZPVR 2XCAA 1A76A 2V34A 2IDEA 2F8EX 1HJOA 4OZJA 1TVRA 1XQIA 3AARA 4E1NA 1N8RO 3JPTA 2F96A 2AZ1A 1RZTA 1HWLA 4ZLNA 2QMWA 2E5SA 1CLFA 1PSDA 1L7NA 2XZTB 4K4WA 4W92B 1QJHA 3LL3A 3EW9A 2OLWA 1CLQA 3GZFA 2ZBRA 1C6VA 4P7VA 2DO0A 2R2RA 4FKXA 5K8PA 2D9OA 1EHWA 2LKYA 4C11B 1S48A 1KSPA 2J4RA 4K4UA 1KVAA 4ZA1A 2KP7A 3EZ5A 4IRDA 4H4KC 1YJTA 2HZCA 5LXYA 8RUCA 3A13A 2OHFA 5AKZA 3FZBA 2VJ4A 1CZBA 2IOCA 1M1HA 4X4RA 4DV6K 4M47A 2RQCA 4TNOA 1VSIA 3MCAB 2KE7A 2G07A 1G99A 3AVLA 4NEZA 1MU2A 3MM8B 2HBJA 2LEBA 3H2UB 1YJ9N 3NBPA 2RKIB 5KAFU 4C48A 1XBWA 3LM2A 1GTEA 2I2YA 3G6EN 2FF6A 5EHHA 5BRDA 4AHRA 4NLGA 1V5VA 4FJKA 2ZIXA 4DO9A 2PFPA 5D3GA 4FO6A 1ELOA 3SFUA 1Q7YT 5J2IA 2KVIA 3MDFA 3NP5A 3HT3A 4GVBB 4BCAA 4ELUA 3MN9A 4KLFA 5JVHQ 1C0GA 2D8CA 3ZTSA 1Z19A 4KJIA 1QE1B 5D49A 1B7FA 3DRRB 2RE2A 4TYBA 4ETZA 1YTYA 3GU0A 2P9PB 3P4IA 2HBQB 3UE5A 2RE1A 4H4OB 3GFKB 5IZHA 3S9HA 3WK4A 3QMQA 2DGWA 9ICGA 3T5HA 5FLXU 1HR0J 2DR7A 4BXOB 5BRFA 2CPHA 4IQTA 2R4FA 1ZQTA 2HURA 2QLWA 2VICA 2H3GX 4CF1A 1T03B 5T41A 3ZZOA 5LMUK 1HHTP 2WVDA 1QZ5A 3PG9A 1U1OA 1LFWA 1RT6B 5CY4A 1S59A 1UT8A 1N5QA 4JV5K 2XMUA 4CHPA 1T3NA 1V3ZA 1OIAA 3QAEA 1RWWB 2WB4A 4DPUA 4O5CA 4DL4A 3N97B 1PK1B 4FM2A 1FFGB 3OLBA 2FLOA 2DIVA 1Q0NA 4OCZA 2FMSA 4O3MA 1WBBA 4YHHK 5IOLA 5ADXA 1XSLA 1XNSA 4ZJQA 1F1BB 4MHVA 3TNVA 3QJPA 4AD6A 1AW0A 2AA4A 4A8KA 1ECWA 4LR9A 3H0RB 1S0NA 1RDFA 2XZWA 1R8PA 3DDNA 3MECB 2J8AA 2H5XA 2CNLB 4L75A 4DR6F 4OJ5A 4JI7J 2R18A 4LSZB 4XDDA 1SAZA 2HHHK 4C7ZA 1AUDA 1JB0C 3PW5A 3I1YA 3B0XA 3QO9B 4BG9A 5AKYA 2BE7D 1HR0F 3UMCA 2K4IA 4M6WA 2ZM6K 4NWIA 2K8AA 4CGDA 4CJWA 3NCPA 3KK2B 2W2QP 1RWPB 2KOBA 1ZRMA 1Q95G 4PKIA 1XK8A 4E0DA 1H74A 4MK9A 3GFZA 3CJ9A 2CQ3A 3IMXA 1RBUA 4QAGA 2GVDB 2DY4A 4ZVRB 3SI6A 3NGKA 3JSYA 3HJFA 3CD7A 4I28A 3WUHA 3S3NA 4LF9K 1WF0A 1DFDA 2R9LA 3CCMS 4FXWA 1SIZA 3DRSB 4G6VB 4E2FB 2ROEA 3MD3A 3FZLA 3CC2N 2CKWA 3DXSX 4CK3A 3HSGA 4N47A 1HMVA 1NSPA 4CJ5A 3C94A 4QR2A 3P1GA 2B56A 9ICTA 9ICVA 1YI2N 3TJ8A 3LP2B 3ETRA 5ALJA 5AZIA 4FJLA 4LMZA 1MMNA 4I68A 2BJDA 5LT5A 2HHXA 2I0XA 3ILOA 3OVNA 1J27A 2Z0GA 5J2QA 1IWGA 4ECVA 2FJVA 3VGMA 1X5PA 5F0XA 4CLWA 4UF4A 1FEEA 1XTZA 3CFOA 3R1HA 4I2AA 5B0AA 2VC1A 2QWOA 4GXJA 2YQ0A 3MEDB 4BR0A 4LVNP 2LQJA 4I6MB 4F5OA 5CZ1A 5KFXA 3BSCA 5LM7E 1NBWA 2W6KA 2XNRA 2VA2A 1URJA 4CI6A 2F9WA 5DGBA 4DEZA 3CFRA 4ED7A 3JPPA 1T05B 2F9TA 3OHBA 4ZPTR 2D5RA 3HOTA 3U26A 3R6LB 3GJRB 4A5BA 5J2AA 2ZH9A 2H9ZA 2MZQA 4F04B 3AOBA 2PYJA 2JRSA 3KXDA 3A5OC 4B1VA 4I2QA 4NASA 4NWBA 1LW2B 1PAEX 2H51B 4M3RA 3FEXB 2D0AA 1RLDA 2J0WA 1S79A 1RHRB 1JLBB 2XWYA 1RUSA 1Z2ZA 3N6LA 4K4XA 3PZPA 4RQ7A 2OA8A 2IAJB 2WAQC 1ULRA 1TKXB 4IDKB 3HVWA 4Z94A 4YR0A 3IRWP 1JL2A 1BQXA 1YVUA 4DR1J 1CJUB 2OANA 4RUCA 1HWIA 3VALA 2QA4S 3PSPA 2LVWA 4OZNA 4OFZA 2MQOA 5F0WA 5IS2A 3H7HB 1YVFA 2P6UA 2VL1A 4B3SJ 3PY8A 1KCFA 2A1BA 3DGVA 1ZQRA 1NNDA 4PG8A 3QUCA 1TUGB 3AVJA 3BEGB 5DB7A 4NLPA 3VVUA 3CO0P 1HBOB 1WEXA 4LH4A 5A6PA 3O9SA 2DNQA 2VA8A 3IRXA 1HNZK 1KBUA 4Y2QA 2HBLA 3PTWA 4CO2A 2GA7A 2YKPA 1UKUA 3UKRB 5E41A 4JN4A 2KTQA 4AT1B 2P9SB 3QLHB 3VQSA 4ZVSB 1WEZA 1RT4A 4PHTX 3QFWA 2R2SA 1Y10A 1WI8A 3PX0A 2IRXA 4JK1A 1J5EK 1BDGA 4JI0F 4FKYA 2A40A 1NXIA 3QEBZ 1O6XA 3QUTA 1U1NA 2D41A 3TAMA 4QS8A 2DT9A 4K2XA 4YD1A 5AKXA 3K9JA 1HQEB 4WKRA 4W5OA 1HI8A 4Y3CA 3OLAA 2UUBK 4MLHA 2ZJPL 3ISDA 3UVJA 1Z05A 3PNCA 2VG7B 1CUKA 3NFAA 4OKKA 1KAZA 5M1NA 1JN3A 3BDEA 5J2PA 1U04A 5DDOC 3SQ1A 1SS6A 5FP0A 3NDKA 1HNWK 2V2VA 1Q82O 5J2QB 1FWLA 3SFGA 4WQ4A 5HP1A 3CC4N 3M8WA 1I5OB 1T44A 4YY3J 5AQWA 4YMOA 4O9MA 2CG8A 3F9MA 3AO1A 3W1YC 3H8JA 1KW4A 4YXJA 2KJ8A 4KLOA 4P2XA 1HW8A 5F3ZA 2JH1A 1FKOB 1MWQA 1KTQA 2NZCA 2ZEJA 2K7JA 3THTA 3RBEA 1TAUA 4V19J 2RAQA 4B3TK 3TR8A 2JJ4D 3BO2A 3JXUA 4NLUA 2CWKA 2B6GA 2P5OA 4F3MA 2JGAA 3PKYA 3DXKB 4RW4B 2KSOB 4AFFA 1N36J 3AAQA 3U27A 4CZCA 4DV5F 4LF1A 2W24A 4JI6F 4FSVA 5I42B 1B3TA 1HARA 4L76A 4JKAA 5F8IA 1KFSA 5AKGA 3ENBA 5AQHA 3V4IB 1N56A 4UQTA 4CQ1A 4CNZA 4QYZJ 4R63A 2G09A 1U9LA 3F2KA 1TU0B 1FFVA 4ISEA 4LVSA 4TY8A 4J2EA 1FRXA 3EJMA 5AKHA 2O01C 3OUYA 2RMLA 1U7LA 2F5GA 5D0RA 2ZNYA 2Y8YA 5GAHP 1X4HA 4K0KJ 4ILRA 3CQXA 2KM8C 3HZ6A 2V0NA 2V4RA 5GIOA 1HKGA 1Q81O 1FKPB 4IG0A 1RAJA 4WJ3B 4OYOA 3N6MA 3IM8A 1TR0A 4DTNA 4OJLA 4TQRA 5J2NB 4BRFA 1VI7A 3QIDA 3M7VA 3H4DA 2WOMB 4FWLA 4QZEA 4N8NA 3WIVA 3ZSWA 4DOAA 3OS2A 1WTFA 4AQYK 3CCQN 2N7YA 1VCTA 3W2WB 3MDQA 1WN7A 4HTLA 2DNNA 4CJEA 3QMLA 1WB9A 3ISNC 4JHDA 3AL0B 2QLJB 1MG7A 1NCLA 1CRXA 2YHAA 3MPYA 2W8KA 2QJ3A 4KLEA 3MF5A 1OW5A 4FW1A 1HD1A 4PG5A 4XA5A 3D67A 3WKDA 1RLCL 3C66A 1O8BA 4I1TA 5KFLA 2YNIB 4RBVA 1TTHB 2ZUGA 2WFBA 4N77A 2UXCF 3SEIA 1S0MA 4WYBA 4NV0A 4N8OA 2JOQA 3PKMA 1IBMK 3THYB 3PYEA 3RW7A 3IM1A 3G8TA 4R8UA 1W2IA 3V7KA 3VGLA 4X64F 4KHMA 2OGUA 1BQNB 3HO1A 1YGYA 5HBMA 2XTJP 4PPZA 3RRKA 9ICHA 2DB1A 1LKYB 5CHGA 2VC0A 2W42A 4KGZB 5DKWA 4CJTA 3OR1A 2MHEA 3C7NA 2PAVA 3SMZA 1HWKA 3EWGA 1LWFB 3ZT3A 5ETVA 3VEZA 1U6FA 4ID5B 4KIAA 1X2IA 5FIIA 4EEKA 4QZCA 1E6YB 4O5BA 4DQSA 2BE2B 1QSLA 3S6JA 5LMNK 1JUDA 1OS5A 3HHEA 1K8KB 2YNHB 4XH1A 2E29A 2EKNA 3M8RA 4U7UK 2VIXA 3ZX0A 3ULDA 5I3QA 5K8OA 3PRBA 4YDUC 2DPJA 4DTMA 2FJ6A 4NZ0A 2GX8A 7ICFA 3EXYA 1IG8A 2P6RA 2XMVA 3VWSA 1NLKL 3IMQJ 4P4OA 2X74A 2P9IB 2FZGB 4FS2A 3I0RB 1NK5A 1LWXA 3OTOK 1ZM2A 3ZC4A 3PSTA 4B3TJ 2DXEA 4J9SA 3HJEA 3PSFA 2MQPA 1SV5A 3QT8A 1HNIA 1LVHA 2KDOA 1C4CA 4EYHB 1RCXB 1VQMS 1REVA 4NJ8A 2WTFA 1VBKA 5B0BA 1U1QA 2XYPB 3QGIA 1B4SA 2J9EA 2UP1A 4IXCA 2ZC4A 1Y64A 4IDHA 4LF5K 2R7OA 2QKKA 4ZP9A 2B0GA 3EO3A 2G06A 1FERA 3L7OA 3AVGA 4BBYA 3FFIB 5J0OA 4IFYA 3KMQA 3D6TB 4MO5A 5B66U 1I94J 1MSWD 1UJ6A 2XS7A 1LNQA 4M8LA 2E5LF 1I6JA 1D8BA 4WU3A 1JALA 3OS1A 2W4PA 1BHLA 4AQYF 2D3O1 2XLJA 5D4NA 1L3UA 4I4BA 3MABA 3FKBA 4EEYA 3IA0A 5C12A 4C6AA 2F3NA 1GMUA 3Q23A 4IFEA 2FPHX 5HK4A 3P49B 3UXPA 2FC0A 4E7JA 3MM7B 1VC0A 3CEDA 2G2ZA 5HMZA 1M5KC 3W9JA 4OYBA 3HLUA 3E01A 1GMWA 2DKZA 1S6PB 3MMVA 4B3RK 3ISZA 3J7ZT 1Z6RA 1RT5A 2PD1A 1P90A 2GAGC 3THYA 3H3OB 3RG6A 2KZZA 4DV0F 3DFEA 1N33K 4FS1A 4UB8U 2VKQA 4PXEA 2VWJA 4KHPK 1S1UA 2G8UA 4R25A 5EX5A 3RMDA 3M32B 2FF3B 2EFGA 3QZ7A 4JKDA 2IOFK 1S9FA 3OV7A 4DQRA 4HLBA 3W9HA 3IBFB 4FJXA 3Q89A 2XIDA 2GQQA 2RNEA 4PWDA 3RRGA 1C0TB 5ALOA 1UETA 4ILHA 2H3IA 4Q2MA 4RU2A 2KRRA 1IKXB 3EDRB 4KITB 4A8YA 4JKFA 4KFBB 1FVSA 4UY85 1JJ4A 2QC3A 4KMOB 1U2FA 2IVPA 2H4WB 2QA2A 1KQQA 3LPUA 3O9QA 2E44A 3A8YA 3QEPA 1T0TV 5AK5A 1M5HA 2MLYA 2C3YA 4ZVGA 4M95A 5HMXA 4OHYA 3ID6A 2WBMA 4TLRA 3O1WA 4IS7A 2FZCB 2DHSA 3PR5B 5K4LA 3O6WA 3IG8A 1R59O 1V9OA 1WC4A 2NXJA 4NLSA 1OVYA 2F63A 4PAAA 3VGSA 1S72N 4ZH4A 2RB7A 2KZ3A 3ONNA 5E3AA 1B70B 4P0PB 3FGUA 2H3EB 1NGIA 1VQKS 4PQAA 3HSJA 3HPGA 7ICTA 1B0PA 1OPIA 5CCLA 1LK7A 4X64K 2H54B 1JLAA 5T7LA 2W41A 3MWPA 5EDWA 4JI4J 3W8GA 4WFNQ 5L1MA 2P8IA 3VHQA 2JH7A 1ZBLA 2GGPA 3NAIA 2RS8A 3M05A 2BMBA 1CPZA 5EE3A 2CAJA 2HZVA 1K0VA 1Q4RA 1MMDA 3C29A 2NYHA 1Q7LB 1R31A 2NO5A 2KQ2A 2FGCA 4DHVA 5JVGL 5HQ8A 1R7IA 2BJ3A 5EWGA 1HKBA 3OTOJ 3WK9A 1R0BG 2OAUA 4TVAB 1RDDA 4PG6A 3BDPA 3CF5L 1YHQN 3FGVA 3O9RA 4EO6A 3NS1A 3LYSA 2W9MA 5AQKA 4WIQA 5AXKA 2RU3A 5E3CA 4ECQA 5HL7Q 2OFGX 2GUIA 1BIUA 5DETA 1EB0A 3TANA 2EWSA 4CFDA 2OELA 5ETRA 4FK0A 4B1XB 2YWHA 1ZQDA 4QZAA 3C23A 1Q46A 4K0KF 3I5BA 1RABB 4UOFA 2QT7A 4ED0A 3TI0A 4OHVA 1RAHB 3IBPA 3DYAA 2HHUA 1M6YA 4CWBA 3QIPA 5FPEA 1R3NA 2CWXA 3CWJA 4ZHRA 2IJFA 2P9EA 5AQVA 3FBCA 3G71N 2VOOA 3R27A 1XNQK 4CF2A 2K8GA 3B4DA 3HXMA 1BA1A 3WXJA 1NJWA 2NRVA 4CD1A 4B3OB 3J80O 4BRIA 1K9MT 4PA1A 3MTJA 4EP5A 4O3SA 3D1QA 3C28A 1DQ9A 4QZ8A 4RX6A 4ECWA 4TU8A 1MU2B 4P9SA 1P27B 3B78A 2WAQD 5DQIA 2KM8B 3NY0A 1ZM3A 4F0HA 3KYLA 4PXCA 3R7SB 3A0BU 1R8BA 2HIYA 4OO1J 3V81B 2AJ1A 2EKYA 1TUUA 4CF3A 5BN8A 1RSCA 5KAKA 3UN5A 2QKQA 2ASPA 2W9CA 3ENHA 3VC8A 1DQ8A 5F3XB 4CM0A 4Z7CA 2NRWA 1N8RT 2Z58B 2HHHJ 4G1PA 3IO1A 1ZD3A 1W0HA 5IT0A 1BO5O 3FEZA 2Y0SC 4HI1A 4KN4A 4ZCIA 2JL9A 5B7WA 3EZOA 2B21A 1Z4NA 3PIPL 1ZC6A 4NPOA 5DDYA 7ICEA 2Y0BB 5HSPA 4KT0C 4NYOA 2EPIA 4RNHA 1Q3VA 5JLFA 4BC5A 4QJVA 4DR2K 1S49A 4KMUA 4E7IA 1PUZA 3FMBA 2O4IA 3NF6A 3TADA 4QWDA 1HQ2A 4K4TA 1F5SA 5AQYA 1Y3KA 2QXFA 2MRLA 5JVHL 1XI1A 1VQOS 1H7XA 2BYCA 5KFQA 4W90B 3OTBA 1YDLA 5AI9A 3J7AP 3D0HE 2HMIB 5BPCA 2E8NA 2JLEA 2DFHA 2CGKA 2IRYA 4KI6A 3TTDA 3A8EA 1H98A 4MFBA 1PG5B 5JS1A 1OPZA 4ZPWR 2KHQA 4OGEA 2XMTA 4G1QA 2R8JA 1RXVA 3E9LA 3Q8PB 4XIUA 3HZGA 1J54A 3ATUA 3I96A 3CCLN 2YX6A 1BC6A 2DFLA 2YPZA 3GQCA 4JI0K 1P1LA 5AZJB 3EE8A 3CCUS 4NM2A 4USWA 4M9HA 4O3OA 1WORA 1VQNS 5CZ2A 5CCMA 2XSFA 3UD4P 3THWA 4DTSA 8ICKA 1RHQB 2HQFA 3M8YA 3IS9B 4KE5A 4ZVQB 3BF4A 2KMDA 2MKJA 4FWRA 1JMSA 4ECUA 2MQNA 4OYZA 4AILC 2DRBA 1PBUA 4HVZA 3MXJA 5GIPA 2QFJA 5FDLA 2Q0UA 1HLUA 1JJ2M 2FBXA 6AT1B 5MLCV 2G0CA 1G4CA 3V6KA 4TXSA 4X66F 1UHUA 5KT5A 1EXQA 2YMQA 1A7GE 3RJMB 1TL7B 2A19A 1JXEA 3FZFA 2WW4A 4JRPA 2PMZC 3N4PA 4JAXA 3KLEA 4QZVB 1U1MA 3TACB 3B6PA 6FDRA 1AUSL 1T3VA 2X78A 5ETLA 2AEFA 3C15B 9ICBA 2HS0A 2WBNA 1P9YA 4I67A 3EICA 1VFJA 2A1JB 4CO1A 1S3XA 2E88A 1YG0A 2ODGA 4JI3J 4DR7J 4KBOA 2M2BA 3ZSRA 1B64A 1T6CA 1HPZA 3LOUA 5J2MA 2ZUBA 2CADA 1UL3A 1FXRA 1W26A 1YJNN 3HVAA 2I8EA 2BCSA 2RS2A 2DUYA 3VCDA 3ISBA 3ATVA 3L09A 5BPNA 3CB4A 3WXKA 3GIMA 2NNWA 1N88A 5IINA 1TK5A 1VSFA 3CSKA 4BC9A 5CAAA 2AH5A 4LVOP 5KFCA 4F7VA 5EX0A 3KD1E 3NCQA 3CD5A 1FF2A 3J7AN 4DR3F 5AT1B 3M2VA 3T1HJ 4WXOA 2MTLA 3G6YA 3MM5B 4BDPA 3L4BC 3QJLA 2A1AA 4ZVOB 2VFTA 1QAJA 8ICWA 4OKJA 3LP1B 5DZ7A 1URNA 4OI0A 2IHNA 9ICAA 3DRSA 1YRUA 3H5XA 2UVWA 2GBZA 2YTUA 2IM2A 3SSRA 4KH5A 4QZHA 3D68A 4B8CA 5H9EJ 1HL6A 1JLBA 1QVFM 3ZDAA 2Q6CA 4JI5K 1TKDA 4EENA 1IR2A 1A9NB 2FD2A 1WEYA 4ID1A 2NREA 2R8KA 4DB3A 2ATLA 3KVGA 4AHCA 5J1EA 4OYXA 2M9NA 4JYAK 1KP6A 2Z2MA 4OYIA 3VQQA 2AV5A 1VIOA 3L2VA 4WFAQ 1K73O 3EUNA 3BSOA 2L9NA 2VA3A 1GO3F 2ZXHA 3QBWA 7AT1B 2KXFA 5J8YA 4NXMF 1RISA 4Q8FA 2DEIA 4OD0A 4GC6A 3FZKA 4OX8A 4IG3B 4Y28C 3ZXWA 4RL1A 4KLDA 4KRWA 3A4TA 5CYMB 3W61A 1AYEA 4DTRA 1MROB 2YWEA 1NGAA 4X4QA 2V67A 2OTLS 1NJIT 4EMDA 5J2EA 2XCPA 4P0QB 5DM6Q 3UKUA 1IVZA 4WCEL 4CEFA 3RMAA 3NVYA 1S12A 2F40A 2E2PA 5AK3A 4A46A 1YI2S 4NY8A 2ZJAA 4DG1A 4BRHA 5HJYA 3BQTA 2XLIA 3L4PA 3D2FA 2Q0ZX 3TAGA 1FEZA 1RA7A 3R5JB 2UZAA 1TMMA 3PIPQ 3CVKA 3VOVA 4K5SA 3BUZB 1P1TA 3AVCA 5H1SQ 2VWBA 1WWUA 4DV0J 4DU3A 4LSNA 2RPIA 2CPDA 3BH7B 3PRVA 5D8HB 3O1BA 3SQGB 4Y2AA 2E6LA 3FSXA 2LCWA 4K4IA 2XM3A 5HLFA 4A8MP 4PHAA 2WC9A 3ED5A 3DRPA 4HT7A 4CJUA 3MM9B 2UXDF 2GVZB 4Y65A 1ZBUA 3K59A 5HROA 2HRTA 2BJ7A 4CJ7A 3PXGa 1PC5A 3ET6B 2YQEA 3R3LA 2YB4A 3ZT1A 4URGA 3ZD8A 1FTCA 4ZMMA 1FD2A 1PYSB 4DOZA 3UKRA 1LW0B 2JZBA 1ZA1B 3PFEA 1HWUA 3AT1B 5I9EB 4OKEA 3CDWA 4LD0A 2MZTA 1C4AA 4I2PB 2FMQA 4JI2F 4JI6J 2LXFA 3MEGA 4CEQA 1H0HB 3MGJA 2QWRA 4HH0A 4B9LA 1WG1A 3KJNB 4UT4A 3MCNA 4BRMA 3VEXA 4K0KK 5CE3A 1HBUA 2HNYB 5HR6A 1Q86T 3H5YA 3WKCA 1S6QB 4OX9F 1FO4A 2HOEA 3FCWA 2NSBA 2JWLA 4F5RA 3G6ES 1U1RA 3OD2A 3TRGA 2WBRA 5D0GA 3MD1A 1OO0B 1NPPA 1V9PA 3J80U 2IBOA 1GFWB 3TQEA 2V9WA 3RAQA 4H0PA 3L3VA 2MQMA 3TKAA 2DGVA 4BROA 1FNXH 1UFWA 3T1HK 2V6AA 2J7WA 4K8ZA 3D2NA 1XMBA 4QBUA 4IUFA 5BYQA 2OFHX 3U1MA 3JYTB 3WKAA 3OTEA 1R0AB 4YMNA 3UMBA 4BC7A 3CHWA 3GCWP 5M1FA 5DG7A 1EWQA 2V51B 3BYRA 5DS7A 2HAIA 4G3IA 4W5NA 2H3VA 2G2YA 4EBDA 1Q82T 5AFUA 1IV0A 1EP4A 1S9EA 5KI6A 1DRGA 4RPFA 1L3TA 5CXTA 5EE1A 4D3GA 4O3NA 3C2KA 1R8AA 5MLCQ 4HTIA 1NPKA 1UVJA 3DKDA 2DKOB 4K5RA 4I6AA 2KKZA 4CW7B 2OPPA 4EI2A 5ALKA 2NPIA 3V1RA 1WDTA 3HJVA 5DB9A 3O3GA 1DTQA 4YCXA 4KGKA 3BH6B 2CJYB 2WF6A 5HN0A 3K0JA 5KTQA 4YB1P 2Q31A 4JOUA 2L41A 1S0OA 4LRBA 3HMJG 2HI0A 1V3SA 2FGOA 2Y8WA 5KT3A 1SUQA 2B5JB 2ES6A 4JNEA 4PKHA 2PC6A 1J5OB 3V4IA 2LI6A 2V7YA 3RJIA 1V4SA 3RR7A 3C5FA 1HBNB 5DDMA 3CCES 3I28A 4M5LA 5KFEA 3ULEA 4RPZA 2M4MA 8ICMA 3FBFA 3MMCA 1OH5A 3EYZA 4BJQA 1FCAA 2GVZA 9ICPA 4CJQA 2VANA 2AQ0A 3SPYA 3MCMA 2HBKA 4LFBK 1YX2A 1BXNA 3P3DA 4Y2KA 1BA0A 3UXOA 4ZK7M 5J0PA 2P1JA 2HSEB 4B3SF 2F8HA 1XIQA 4F4KA 3HTVA 2KN4A 3O2IA 5AICA 2KG1A 3IWNC 3N6NA 3TARA 2EI5A 3I0SA 4M5GA 5FJ4A 4GLXA 5HBMB 1BI4B 4I29A 3KNAA 3C19A 3H45C 2BOPA 1GLJO 3HW8A 3BQ0A 3BS5A 3IAS9 1GXLA 2WSEC 5DQHA 4DCJB 5FLXY 3TUIC 1D8ZA 3MOZA 5ELZA 8ICFA 3VR1A 1S6QA 1A77A 2YHBA 4GW6A 4F72A 1QAYA 4LF5J 1CJTB 2CNKB 5CRXA 5AQIA 2BJ8A 3SQ0A 1WHVA 2IMWP 4ED3A 2HAFA 2VB6A 2YKAA 3W5XA 3I8DA 3L7UA 4OJOA 5DJBA 2W04A 4AP9A 2ZD1A 3H0LB 4IYQA 1S9GB 1NKEA 4JK8A 3KLFB 3H1VX 3AB2B 2RHQB 4RUHA 5AQTA 3SSQA 3KK7A 2Q6BA 2V63A 3HM9A 4F67A 4NLDA 4C11A 1YITS 2KKVA 4FLTA 3NS5A 1VQLN 3CC2S 3NH2A 1NH7A 2LU1A 3ZT0A 1SWVA 4GV9A 1VS3A 4EK2A 1UAWA 1U1LA 3H08A 4RCHA 1RT7B 1D8YA 2OUGA 5U47A 1NSKL 2VQFJ 4JK7A 3TAQA 1IXRA 2IC3B 4RPYA 4FOIA 6FD1A 1B92A 1NZBA 5CHCB 1Z25A 3KHGA 3MM8A 4G9BA 1KKXA 3PW7A 2CYYA 4QZ9A 3DN9A 3WK8A 3RH5A 2GUPA 3CCLS 4NE9C 2OEJA 3D45A 5KT4A 2PZSA 2W43A 2OO4A 2VZ9A 3C15A 2UVUA 5CYQA 4Y6IA 3FZMA 2LA4A 2EG1A 2OPQB 4W98A 1XMQK 2VHGA 5EWFA 3R5AA 1YKWA 3MUMP 5CD4H 1NZ8A 4RQ8A 2YV0X 8ICVA 4PL1A 4BVOA 2IVFB 3V81A 1H38A 4O0NA 1VLYA 1N5SA 4Z6CA 3G82B 3HHLD 3AB4B 2DPIA 1NK6A 4DL6A 3GOIA 2IBKA 3QEWA 2D0PA 3MR2A 4DSLA 4NLXA 5EE9A 5DRKA 4QWCA 4MF2A 1ZXOA 3JAMU 4Y2XA 1VRTB 2IRUA 2ITMA 3NG8A 1N5WA 1HUOA 4I2GA 5KFHA 5M1QA 5IIKA 5CABA 3V9WA 1C1CB 1X6JA 3W8PA 1HJRA 2FC9A 1S5JA 1ZQHA 5KNIA 2ROPA 1RBSA 4PZVA 4TUPA 2YKMB 1N5YB 2XLKA 5KFAA 3EZWA 3WQPA 2BKOA 2JZ5A 1OYEA 5KFBA 1P6TA 2YNGA 1F3FA 2FJBB 1S1UB 3I87A 4CBUA 3BF1A 1Q8BA 1RAEB 2AXTU 3KHRA 3RB6A 1YQHA 3G25A 4IKFA 2GHWA 2HPUA 4MN4C 2KU7A 2EFPA 4H4MA 4RNFA 4FYWB 3AODA 3KIOA 2YKNB 2XY8A 3ZDEA 2CG4A 5ALXA 2ASLA 4F4YA 5KFPA 4K2JA 4LFBJ 1MWKA 4JI8J 5G4DA 1TFWA 2A3ZA 3H4BA 5D4PA 4G9ZA 4UAVA 2QXLA 2WK4A 4IOXA 5JUMA 2YN4A 1TP7A 2ALYB 4QWBA 3HRGA 4NXZA 1NKCA 2VFUA 2XMAA 1S4FA 4GVEA 3TA2A 9ICKA 4FJNA 5ETQA 2N82B 3EZUA 3M8PA 1S6PA 2FJEB 3M1VB 2ZBPA 4E7HA 3ZZYA 2LDYA 4U8VA 1BPDA 3BGLA 3PX4A 3RWUA 5KOXA 1HNVA 2V68A 4A4JA 3HVTB 1N5XA 3SQIA 4OX6A 1D09B 3PX6A 5IWAK 1WBDA 2IYGA 5LOQA 4WJBA 1BPEA 3DHXA 4OVLA 3CCUN 2W1BA 3UWTA 4FWNA 3GDXA 4JB8B 4HT5A 3DLLL 3N7SC 3ZTOA 2E8AA 3CJ4A 4J2AA 3QFPA 3UR3C 3CJ8A 5FDLB 4Y00A 3DM2B 5AE1A 3Q83A 2K1RA 3NCRA 2Y0SD 3R6MA 2BR0A 5CQGA 2B43A 1L3SA 1SJFA 4JI5F 2W7OA 3OFHA 7ICLA 1JL1A 4USIA 3EDQB 1WF1A 3WT0A 5HVHA 5E2QA 1KC8O 2OZMA 5EE0A 3I32A 1VBYA 2KJWA 2ZIUA 5DZ6A 3MM9A 3QZ8A 1RGVA 2CJBA 1X31C 4KI4A 2WSCC 3FC4A 4XTTA 1H2TZ 3TEGA 3RVCA 4KO0B 4WFBQ 4IRKA 1SC3B 9ICXA 3QT7A 3IBCB 4A8SA 3K1RB 3V9XA 1X4DA 2MPUA 2UVRA 3ALRA 3A1YG 2YWGA 1H2VZ 3AVHA 2QN6B 4AL5A 8ICLA 4JV0A 3P4UB 4A8WA 2BRKA 3T1YF 4U67Q 4I6MA 1N5VA 1J2VA 1QQMA 4ZVUB 4CECA 2A2DA 5IIIA 2HHQA 4Z2XA 1CULB 1ZQYA 3CE8A 3HYFA 4PKGA 1KHWA 4WWSA 2QEXN 4DQ8A 1RBLA 5TKWA 1CC8A 1U0HA 2M70A 3GFYA 1T05A 5DB6A 1RCHA 1HR0K 2AKWB 2DGSA 1TL3B 4O0JA 1EQYA 1PC4A 2MGZB 2CRXA 4B1YB 3MAAB 4IH5A 4JI1J 3F2BA 4FZZA 5HL7L 3NGTA 4UAWA 3G4SS 1RDRA 4X66J 3J7YI 3AXKA 3A0IX 3M2UA 3I76A 4Y0WA 1RE1B 1YXQA 4F8RA 2LSNA 4BVPA 1X6IA 1NRKA 2BE2A 3BGUA 1BU6O 2E6MA 1APSA 3MUTP 1MA7A 2NUHA 1SVDA 3AA2A 1ZAXA 4TUSA 1RTIA 3EPIA 3CCQS 2M9KA 4CTAA 4RQ1A 1ZD2P 3QFHA 1REGX 3PLAA 4BC2A 2FBVA 1GLCG 3GV5B 3UCUP 2HVDA 5K20B 2DGOA 1T8EA 3AVKA 5AK4A 3AU6A 1J97A 3OYMA 4M0AA 5SUHA 1U8SA 2DTUA 4NI2B 5F9NA 3R7NB 3F0NA 1Z1ZA 2DHGA 5IV4A 4CH1A 5JTIA 4WQ4C 4KC5A 4JKHA 4MYTA 3B9JA 4M3WA 3I5AA 3OYCA 1W9HA 1IBMF 1S1TB 4MAKA 1ZZFA 3G71S 2RRAA 1HNVB 4DV7J 1X9JA 2I9SA 3HFKA 3CD6N 4CJLA 4CZFA 2LXUA 2EG2A 1J6ZA 1W97L 1N54B 1QAXA 2YPYA 1X1PA 4ZVHA 3NS7B 3DXMB 1O03A 4QR0A 4KLIA 2FHOB 4HAIA 3D7SB 4P0QA 2W3RA 2OP5A 1RYUA 3M6XA 5A0YA 3SI8A 3TUJC 1HYZA 1VQLS 2OSQA 4X4NA 5AM4A 2Q3SA 1QVFR 3QBCA 4FFDA 4LT6A 2C3PA 5L9XA 1TL1B 3VQDA 3MMAA 2E8OA 3W5YA 3IUCA 4BE0A 5KG3A 4DSFA 3QFUA 1HFEL 1DURA 3W2WA 4DV4J 3P8BB 5IM0B 2KHVA 4KHPF 3MXMA 5M1OA 4NCAA 2HCFA 1VQ9N 2LHTA 2YY6A 3NMAA 2MHNA 5KL8B 2C42A 2F7VA 3QYYA 1FA0A 2MKSA 2ZTDA 4J37A 2HNZB 4LF7F 1X42A 3V9ZA 2OPRB 3IHQB 3ZT4A 5C0YA 3W66A 1ZRNA 2E1FA 2HGNA 2Y0SF 4IOCL 2SXLA 2CIMA 4NLWA 2EANA 5KFKA 1XN9A 4CZIA 4GMKA 4K50A 2Q3PA 2KXNB 5L1KA 3CM6A 3D0PA 2I38A 4DL7A 3VZIA 1PVRA 1ASWA 5CJ7A 3C14B 1BPXA 2ZD1B 3MEGB 1LOUA 2AHOB 5EOZA 3M2RB 4UUWA 4F71A 1NG9A 4DL2A 2L9DA 1LKYA 2KKPA 1T9VA 2V50A 4FK4A 1VISA 4M5IA 3H2VE 4I2HA 3CJRA 1IKYB 3JQMA 4ZVFA 3N4QA 3R2DJ 4DU8A 3TAEA 4DI6A 3BSNA 4CZJA 4TU9A 4M3UA 4DKWA 1TKTA 1YBTA 3CCWA 4MLEA 2ZJRQ 5J2BA 2BJ9A 2ZTEA 1IQZA 5J2MB 1HPZB 5I4MA 1ZBTA 3I6PA 4CIFA 1G1XA 4R0EA 1HX1A 1RM6C 1NMNA 2I6WA 5KFZA 3Q22A 4X4OA 1D5AA 2C2DA 1VQNN 4QIWF 3TSUA 2OXOA 1JI7A 3MN5A 1RWVB 4CYUA 3QAUA 5A8RB 3IWLA 1DXSA 2XHWA 2ZJQL 5C2CA 1TMJA 2WUSA 1SZHA 1KEKA 4LUBA 2BPFA 2J9CA 3GPAA 3UNGC 1S9EB 1S6OA 2CDRB 3GIIA 4AM7A 4ZVTB 2XMMA 4KHWA 4CZLA 3WK5A 3ZD9A 2VBWA 2ZJ8A 1HNZF 4FNIA 1PK3A 2HRUA 4PH5A 3T5KA 1ITPA 2G8WA 4Y2JA 2ZVSA 4U67L 4FL9A 1DTQB 3NNHA 2JGUA 4AM6A 3CQYA 1RCOB 4CF5A 1SXDA 3D0IE 3CDAA 1NK0A 4X65F 2RDJA 2B9YA 3OL6A 4HTUA 4ZHRB 3S7RA 3M8ZA 4NRUA 1COKA 1KVKA 3Q8UA 3SAFA 3MAHA 1VSMA 1NK9A 4HTJA 3VEOA 2FY1A 3Q86A 4NA3A 1HNXK 3ASMA 5BOLA 1Y5NB 2D3ZA 5C42A 4QZDA 3G8SA 1LW2A 4A8FA 2QRRA 2AYGA 1RBVA 4ZLLA 2B4PA 2FJDB 3UIQA 1JCEA 1XERA 3DLEA 2J7KA 4JI2K 2FZKB 2QWNA 1UVIA 2PFOA 3ZCMA 4DPOA 4DHYA 1MROA 2DYAA 4LFCJ 5J0TA 4OYAA 3GMGA 4I9LA 3AO5A 5AKKA 2KLAA 2IHMA 2V4JA 1LXJA 3W3DA 3ISND 1GLDG 3D1HA 3QERA 3K7RA 3CPWM 5HRSA 3S3MA 2MJUA 4F36A 2Y1JA 2QZ8A 2OSRA 2YXLA 3R9LA 4USAA 4H0OA 3IG5A 1K73T 4DG1B 4WK3A 2XHBA 1XMQF 5AI6A 3RSEB 1FT8A 4PL8A 3CPWR 2BDUA 1TV6A 4I6YA 1UZHA 1L7OA 3DJCA 1ED1A 3VV2B 3BPDA 3KFWX 4KV8B 2DFFA 4DV1K 2EDUA 1WSRA 2KSOA 4NX9A 5ALDA 2V2KA 4IOAQ 4Q8EA 1J2NA 3PDNA 3ZTQA 3DRYA 2BJ1A 1VHXA 3KJQB 2W55A 2GO7A 3M8PB 1S8OA 4OI3A 1RTDB 1JK9B 3AY9A 3SNNA 2E66A 3VQBA 3W65A 1JROA 3BN4A 1ITGA 4ICAA 5DG8A 2G4BA 4C23A 3EGNA 4BDZA 4CJ4A 1X7VA 4ISFA 3N0VA 1XU4A 2O8BA 3I0RA 2E5GA 4WZQA 1ZQMA 5DLGA 4Z4GA 2MJNA 2IM3A 3HSDA 1SJRA 3NGUA 3TX8A 3NUQA 2F9DA 4DS5A 3OBIA 1DGJA 7ICQA 3E9PA 3QO9A 2RJZA 1R8HA 1REVB 1S7IA 3TJ9A 5J29A 3DOMB 3CCSN 1SPBP 2CQ2A 3HD2A 1R6VA 4C8MA 3OPKA 4I9QA 4I2EA 2A5XA 4M2YA 3WXIA 1HEKA 2GNKA 3M6VA 3D2FB 2CZ4A 5KPTA 4AYBD 3O4QA 1N60A 4IEIA 4DPTA 4E89A 1JLAB 5E5NA 5T7LB 3SDEB 3O0FA 1ZA2B 3D28A 2HQDA 5ETTA 4Y1CA 2ZM6F 4EELA 4ZN3A 3VQEA 1X5OA 1HA1A 1FO1A 4QPTA 4LF4F 4PHPA 3R5BA 4PCQA 4JLHA 1L7MA 5E84A 1R43A 2FE9A 1X66A 1HHSA 1M1KO 3ETMA 4ALZA 3QXGA 2X3DA 1B99A 3L6QA 4RUAA 4CHQA 1DGKN 2YNIA 4DS4A 1NMDA 3S1TA 4EFHA 4A48A 4FWOA 2B8PA 2C2RA 4H0VB 2N4CA 4Y2VA 4DV3K 5I3UA 3ZX2A 5KFOA 1KQSM 1RP5A 4GNIA 4FYVB 4YFKA 3KWMA 5L46A 4JB3A 2J0SD 4JV1A 3GYXB 1L7PA 2PN6A 2AJ4A 1RWNB 3MCSA 3L2QA 1LW0A 1WHYA 4OPHA 2AWZA 1D0EA 3W64A 1HWJA 3A5LC 2FLLA 1BQNA 5E79U 4FJMA 3LZJA 2C3MA 4JKGB 1T9YA 1GXTA 3HK2A 3C1ZA 5JMVA 3RH6A 5F8NA 4RW4A 2R8GA 2IGIA 4JI7K 2XSJB 3QU9A 4PXBA 3SUOA 4NLKA 4WYLA 5HR7A 4I2JA 1FIQA 3CETA 2FBTA 4X62K 4Z6DA 2ZE2B 2W4CA 4CLUA 4KGVB 4R5PA 1K5OA 4OIXA 5BR9A 5J0YA 2KHCA 4FJIA 3GV8B 4YMMA 2AGPA 2BTFA 4DR4J 5HRRA 2YKNA 2HVZA 4C4WA 3Q8SB 4FWSA 1OH8A 2XI3A 4ECYA 4ZPCA 3GG1A 4Q44A 1BCMA 2E1ZA 3F53A 4U7UD 3DNCA 4S0MA 5IIOA 2HWHA 3NF9A 1RT3A 4MMOA 4J9RA 4IG0B 4WKYA 1SB3C 2KFNA 3SV3A 4R79A 2D9PA 2HHTA 5M2RA 4L73A 1QZ6A 4EHTA 1VQ4N 2EXUA 2CPFA 3UDEA 3CI5A 3EKUA 3MI7X 4DR5K 2EVZA 5JXSA 1MMLA 1YJWN 3PFOA 1XMQJ 4UBBA 4ILMA 1C1BB 3KUHA 1TUWA 5KG7A 3GSDA 2BUNA 4W5QA 3BY5A 4UOHA 2LPEA 1JLEB 2VPYB 3E66A 5D3GB 2KFZA 1H72C 3Q8YA 4K7QA 2DBYA 1IBCB 3M1YA 5HANA 1BG3A 3H8SA 1KLNA 1WG5A 4CI0B 1QH9A 3WC2A 4FLXA 2JEFA 3M9OB 2LM4A 4I2BA 1LCUA 1WC1A 4TQSA 4YFUA 2MZRA 1VSDA 1E6VB 2F4VJ 2QARB 2BKPA 1DT9A 3THXB 3KOOA 1F0XA 5AKEA 2QB0B 5D0EA 1OQ6A 4HVJA 4DR4F 2XC9A 1D1UA 4O4RA 4RR5A 3U7JA 2YH0A 3QT5A 4R8UB 3ZSOA 2GJFA 1CZ9A 4CJKA 3GIKA 1SQEA 2HNZA 5FPMA 3R5GA 4X4SA 3VAJA 3CJSA 1OXJA 4FOEA 2J6SA 3OYGA 3OSNA 4DQIA 4HHUA 8ICBA 3ZZZA 4DN0A 1ZOLA 2C2ZB 5EGYA 4FBTA 4DV2F 4YDXA 3PO5A 3S41A 3DLGB 1LWFA 4E19A 1IN0A 9ICOA 2Y9TA 2RUSA 4IOAL 3U9DA 3UNYA 1E4FT 3QUQA 3FM9A 2Z1HA 5F8HA 3I55N 2ZIWA 3FYHA 3ICLA 4GXIA 2ZHOA 3MPDA 4L8RB 2BV3A 3CJQA 1UFLA 2F1FA 1JKHA 4YMEA 3RBXA 4KFBA 1AFJA 4NXMK 4ES3A 2K8CB 4H0TB 3SQGA 7ICJA 4OJ3A 1OUQA 2V8GA 3MOJB 1HJPA 4IBNA 4JS4A 1KQGB 1IBKF 2K4HA 4HUGA 1LV5A 3Q2SC 3LVVA 1WF2A 2ZVIA 1JWWA 3R8EA 1XC9A 5IWAJ 2YI1A 4DFPA 4ZJLA 3E0FA 1HYVA 3VF4A 4ECTA 1RT1A 2MZSA 3A3OB 1NEEA 4X62J 1BNPA 4RPXA 1JLGB 2ZC3A 1RAIB 4AXIA 1SV0C 1Q78A 1DLOA 4CFAA 2JRZA 3VN5A 4RW6B 4P2SA 2HW3A 3HILA 1JX4A 2LA6A 2M0GB 1SJ4P 1X4EA 2QG9B 4FF4A 1KVIA 1S1TA 2D1CA 1I3OB 2ZXIA 1K6YA 2R7SA 2A3VA 1AROP 4I69A 1JLCB 5J2NA 2DR6A 5K8NA 2RHKA 1HNWJ 1VSEA 2KT3A 4FZLA 1Q18A 2Q66A 2KIWA 1UEVA 3SUPA 3QQCD 2RD5C 5AI5A 4KTZA 5DO2A 3D2EA 3NVKA 2ZBIA 1XHZA 2KB2A 3AQPA 3DXMA 4ZKAA 3UDCA 4FLZA 1HRHA 3E9OA 2DRAA 5KFJA 3OVAA 1CJVA 1N33J 1C0MA 3IR6B 4CLSA 1D3WA 1RDCA 1VHFA 4M5KA 2X3GA 2J6TA 3NWRA 2C1EB 4QZGA 1R0AA 1RT5B 3HKZF 4NYFA 2FPLA 1T95A 1U25A 4CH0S 3TYTA 2KKHA 3B8AX 1YIJS 3DYAB 5CEHA 1NAQA 2JEIA 8ICOA 4G1IA 2MKIA 2ZNZA 1F5BA 1VQMN 1RKIA 3DOKA 4IWVA 2ZUAA 5BR8F 3MX2A 2UXBJ 3KNGA 4Q2LA 1N4LA 2PFFB 4L3KA 3TSQA 4DR5F 1B4FA 4Y2PA 2AD9A 3QGGA 4B02A 2DHHA 2HZAA 1B7YB 2PMZD 1SKWA 3FRZA 2OPRA 2RSQA 2EK6A 4FJHA 4IG3A 4PGYA 1RT4B 1GEHA 3GR0A 5CYMA 1VJWA 3NMUA 3NVWA 2BANB 1N63A 2P9KA 4RQ0A 2V8VA 2PEBA 4FXDA 4H54A 3THPA 3TAMB 5BJRA 3QICA 1IWAA 5EU7A 5ETSA 3M6WA 3SV4A 1FJCA 1BQMB 3VQ9A 5KL1B 3BQ2A 1PGZA 4DV5J 5B0EA 4EX7A 1N61A 3T3FA 2BQ3A 3CP8A 3QNWB 5KG4A 4FWMA 3MHYA 5JVGQ 4YOEA 2CPJA 3IRXB 3DLLQ 2QX0A 4ISGA 2L08A 9ATCB 3LVWA 3VGTA 3M7DA 1GOAA 3K57A 3ZX3A 2GGPB 2OI2A 2B9EA 2DGUA 4NXMJ 3C6TA 1RT1B 3FUYA 1VQ7N 3AA8A 3DRPB 3ISCA 4DSIA 1JLGA 2P9LA 3H90A 4F4AA 2HVEA 3ITHA 3M2VB 3CJ1A 3ZDBA 1HKCA 3VZHA 3D2QA 2JH3A 2VASA 4A57A 5KFMA 3MM5A 3K17A 1FNMA 2ILYA 3QUBA 2I6XA 5F1XA 1FKOA 3R1XA 4RW8B 4Y2YA 1FX2A 2HMIA 4UB6U 1KAXA 4DR2F 5KFTA 2Q4TA 1IBMJ 1LWEB 4LF8K 1GAOA 2HSZA 3F2CA 3MGVA 2A18A 4CK1A 3MEEA 7ICRA 2VONA 3CM5A 3OYDA 4TUQA 2CUYA 2IY5B 5ALQA 1Q3UA 4QZFA 2Z2LA 2GO9A 3KOAA 3QBXA 2O8CA 2O8EA 3ENOA 4ZLPA 2E8MA 1IKWA 4UW2A 3DOLA 4A8QA 2G0AA 1YBAA 4CLYA 1B0XA 3NGSA 4CZMA 4C8OA 1ZPVA 5LJVA 3DGPB 5L8RC 4LF4J 3TSPA 3ALYA 1RKJA 4BRGA 4QS7A 1UWBA 4JI0J 2UXDJ 2APOA 1C0FA 4CEAA 4JYAF 1SJ1A 4GKKF 3CJ7A 4Q0BA 5L1LA 1QM9A 1UOCA 2ZH4A 2NPFA 5AM2A 3LGHA 2JNJA 5B09A 5EX3A 1EKRA 3AD7C 2EZYA 4PG4A 2EFQA 3SD7A 3BZCA 3M2UB 3DLEB 4PEOA 2DFEA 5B0CA 4UY8O 1A0OB 2QLBB 2B4OA 2OM6A 4LR8A 1QHAA 2GQ2A 2FJXA 3BF3A 3TTCA 2V8DA 4A61A 3DXKA 7ICOA 2VJ5A 2AYEA 4P75A 1O08A 4DBQA 1RTIB 2XNQA 3QNNA 2GWKA 3P6YC 1RA6A 2UXBK 2MU2A 4DR2J 3HRDD 2GEMA 3ZI4A 3WK6A 4K4ZA 4C0ZA 3O1LA 3HKZC 3BJYA 3CNQP 2UUAF 1HBMA 4NZ7A 1U6ZA 3RYLA 2I1RA 3CJCA 4M3TA 4FVMA 5J2KA 2BM1A 3NHGA 2BCQA 4DPWA 3CMEN 1NI3A 3CO9A 3H5UA 2B5JA 4M3YA 5IT9U 4LFAF 4JI1F 4XH4A 2A6AA 2OCEA 3D7EO 4GKKK 2DCUB 5ALIA 3VA0A 5J2GA 4QZBA 3LDNA 4KAZA 3I9V9 5A8KB 5ALHA 2A1RA 2VV5A 3JSRA 2X1AA 1QVGR 4ZIVA 3C21A 2G9OA 2NXUA 1E6VA 2XYHB 4CGHA 4B1ZA 2ZWOA 3DOMA 4OI1A 4L72B 4CZHA 4KHUA 1OY9A 3M3ZA 4YVZA 1ZBFA 1ZQFA 2J9DA 4ES2A 3EGWB 3TFSA 3ZSYA 4ED2A 5B5EU 1H73A 4PZNA 2WHOA 1RJJA 8ICJA 2EC2A 1M1GA 2OHDA 3DLKB 2Q1NA 4FF3A 3M2RA 4ZLJA 4IOCQ 2B4UA 3WZ0A 3D2WA 1AXQA 5K14A 3T5JA 4A8EA 4CP5A 1SWWA 3ZZUA 4C8LA 2YNHA 4E7KA 3UCGA 3W5ZA 3M1VA 5B8HA 3GFXA 2V5HG 3CULA 3T9ZA 3A5MC 4Y2MA 4ITSA 1UEKA 3HI0A 2YHWA 1GLAG 4NA1A 3K5OA 4H0YB 5HRNA 4B9SA 4F92B 1TAMA 5AM5A 4JD2A 4OLPA 1V5IB 4JKBA 1BISA 3OL8A 2P9SA 3L3UA 5DMRA 3JSMB 2JXJA 1NM2A 1HNIB 4LIRA 1JCFA 5L39A 4KKOA 2DPNA 4ED4A 2HBRB 2FVRA 4YD2A 5A2QY 2CPIA 4MFAA 1MWZA 3SQ4A 4IQXA 4OX9J 2NZTA 2UXCK 1CXQA 1KVCA 2CQHA 2CN1A 1JIHA 2CGLA 3OXLA 2CZVC 2H3FA 5AI0A 4DV1J 1DTTB 2PE8A 2ITGA 2RQ4A 1U49A 9ICFA 4P52A 3LP0A 2AW0A 3HWTA 4JI2J 1VQ8N 4NRTA 3RZAA 4RW9A 2NYVA 4IQMA 5JU5A 4ICLA 5GAEU 4MTPA 4C4TA 2ZDPA 1SL2A 3KLVA 2M52A 1CEZA 4Y2IA 1NDKA 3DC2A 3ZSZA 4NM1A 2O4GA 1F5AA 2EZZA 1C0UA 3AGRA 2V9KA 1ASUA 4US8A 1G3OA 2F76X 2EEYA 5F3TA 1WC5A 3MN7A 3ZETA 4YOVA 1DAXA 2HDOA 1VK3A 3GIJA 2CQ1A 2HMPA 1KQSR 3L4QA 3VF6A 1ZBIA 4CLFA 4UUXA 1NSAA 3EUB2 3C65A 1TGOA 3HI9A 2EAPA 4PZOA 4WF9L 2E1MC 2LBOA 1TL3A 4ZPDA 3QINA 1WCLA 1NHVA 2VPZB 2EAMA 4NCBA 2ZH3A 2M5YA 3I4PA 4NMLA 3CJ5A 2BVZA 3K58A 3A8JA 4R64A 4I2PA 2BZFA 3OS0A 5J2HA 3MTKA 2W2OP 2VOPA 2DNRA 1BI4A 5TISU 5GADU 1QDUB 3DHWC 4RG8A 3BS5B 4P72A 4UTGA 1XO0A 4CO3A 3GILA 1WELA 4DU1A 1X0PA 4CEOA 3L2WA 4M63A 4DV1F 1YF5L 4LBIA 3VAMA 1YSJA 1WSHA 1CJTA 3LDLA 3QU4A 2KW4A 1FDBA 2AF6A 1V85A 7ICIA 2LKZA 3TX0A 5AKIA 1UVMA 4USHA 4YY3F 2CQ4A 1NB7A 1QVGM 3KLFA 5ALYA 4QW8A 8ICEA 3GJSB 4E7LA 3SZ2A 2KHOA 2MZ1A 3VAKA 2HFNA 2UUBF 2FJAB 1UVNA 4C9DA 3R1LA 2QE5A 1LFPA 3PYDA 2XULA 2NLWA 5ALNA 1EZZB 2GELA 1J9AA 2IVNA 3GG0A 1WSGA 3L3FX 4O4GA 2IDOA 4DX7A 4RQNA 4LSLA 1ZQPA 4B9VA 1FEHA 3HSZA 1BE4A 1N0VC 3C6UB 1RDAA 3LO3A 2ASJA 1Y4ZB 4ZTJA 3D0GE 4R66A 3CC7S 1S1VB 9ICMA 1URRA 3V2UC 3L7PA 2RU9A 4Z4HA 4PWDB 1SL0A 4CO4A 2V4JB 1F2HA 4C4RA 2KVSA 1FTRA 2C2MB 3CC4S 4LF6F 2OPPB 3AQFA 1P9QC 3IP0A 5F8GA 3RMCA 3RSEA 4J90A 2RP5A 4YHHF 1FRJA 2R7VA 4ZP6A 1KR4A 4WPAA 2OH2A 5CYJA 3EN9A 2G5IB 3P83D 4I64A 5C25A 8ICAA 2HS3A 1T02A 4MJKA 9ICLA 3BR8A 5L9NA 1X5SA 5HROB 3SJJA 1SL1A 3UQ2A 3PJWA 2ZQBA 1IXKA 3MCOA 3S6EA 5F8JA 3G9CA 2GMLA 3ZDDA 4OX9K 3AV9A 5CD4A 5HVGA 1SQFA 1X4AA 4ZJOA 4FLWA 3KUEA 2N3OA 1QTMA 3BKUA 2EC0A 2QLXA 4P0PA 3BGRB 4YB5A 5IC4B 2JLGA 3JB9k 2N4DA 4K8RA 1CSJA 1VIXA 4CIEA 1KFTA 4CEDA 1LB2B 3O4NA 2OTLN 2E8PA 2ZITA 1UFKA 1IR1A 1FWKA 5K5MA 3HPOA 4WIIA 1WSIA 3RR8A 3VQCA 3SMVA 1NGHA 2VQEK 3V5RA 5AQGA 3OGUA 2CPXA 3AVMA 2F4VK 4QIWD 1NUEA 3PNIA 2HHPA 4Z37A 4NYPA 1EQ0A 3TO8A 3P5JA 3NCIA 3CCRN 1S0VA 4RT2A 2E2NA 4RQ4A 1FJGF 2P9CA 3U4LA 3OW2M 2RF2A 1WCNA 2CPRA 4DN9A 3DAWA 3AFGA 3MPVA 2KT2A 3P38A 1COOA 1XNRJ 4ER8A 3THVA 3ZZ0A 1NJIO 3WU2U 3ICXA 8ICCA 4BACA 3C6AA 5KG6A 1NNEA 1JXLA 2QMUB 4X84A 4CLLA 3EVWA 4EFAC 2Z4PA 3DGPA 2RHSB 1H2UX 3QIPB 4DTJA 3RF9A 3UPQA 5GAGU 1LWCA 1SGGA 2PI5A 2NRRA 1SH0A 1P8GA 3MMJA 5AJ3K 3LF0A 3VGUA 2E5LK 4ZN1A 1XHXA 3KLHB 4M5DA 4X4UA 2W9BB 2R8HA 2YX1A 2R8IA 4FPIA 1IH7A 4ED8A 4NL9C 8ICPA 1F9FA 2DHXA 4N5SA 3IR7B 1MW7A 2C2NA 1SQKA 2PFNA 2JC0A 3K5PA 3P5BP 4DV6F 4NI2A 5KFIA 2GVDA 4F5NA 4O5KA 2L9WA 1UMJA 1DZ5A 1EX8A 1HHQA 3L0QA 1NHUA 3WK7A 2EFNA 1W2BM 5C24A 3UD5A 3NRZA 3VQPA 1PVPA 1C1BA 3HF5A 3OXFA 3UN2A 1BUXA 5IT9O 4Y2RA 1F0MA 3FQLA 9ICRA 3MM6B 3OTDA 4BC3A 2RIJA 4LQ3A 1RGIA 2GX9A 1WACA 2W2PP 4P7TA 2LP4A 4FWPA 3EKSA 3CJ0A 4BC4A 4QIEA 9ICCA 2IIRA 4CERA 1EQMA 3QU2A 2VBYA 2Z8QA 3RJKA 3E01B 4IH6A 2OTJS 3BQ7A 4NLBA 2QB0A 2JEGA 2V2QA 4F4ZA 5LSOA 3TAPA 3IAM9 1XR5A 4XUSA 2RDDA 1XO1A 1ZQAA 2DJWA 3BGFA 3U8XA 5C42B 1RBOB 4AHTA 2MA1A 2ZH1A 2DNOA 4J9OA 1WKKA 3ELHA 3NVZA 4NO7A 3KDNA 4M9LA 2VWKA 3CJBA 2EBEA 5LMNJ 3N7RC 3RRHA 4LC9B 5CP2A 2BABA 2CQDA 3GYNA 4H8KA 3OYHA 4Q7AA 4CVNE 4ZCLA 2W54A 1HPMA 1L5UA 4Z4FA 1KBRA 1IKXA 3SBTA 1ROFA 2H65B 5GAEP 1HIYA 2FUG9 3M30B 3OA9A 4HKQA 2FLNA 4F2RA 1J5EF 2XS5A 1YJNS 4MFBB 2BACA 2O6KA 1YJVA 2EWHA 3DRXA 2IM1A 1S9GA 5J1NA 1NGBA 2ZIWB 4WQ5C 3CCEN 5C15A 2O8FA 1BCOA 1S1WB 3IN5A 2P9NB 1A6LA 4CJVA 4RO0A 2GJ2A 2BM0A 1YBUA 3UPFA 3PSIA 1DK2A 3T69A 1WHWA 4O44B 2ASOA 3ZEUB 2B0CA 2D74B 1G7CB 3M8SA 2A3JA 1RT7A 2P6SA 4CT8A 3V6JA 1G15A 4EWTA 2DNYA 2Q0RA 1YJWS 5C2FA