4DQPA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and ddctp (paired with dg of template)
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
580
structure length
576
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 199
structure length 576
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqpA01
3SQ4A 2KTQA 1GOBA 5J0WA 3O3GA 3E2EA 5KT6A 1BCOA 1X1PA 8ICSA 1HQUA 4BWMA 4Z4EA 4QWBA 3Q8SB 4IRKA 4I7FA 1HYZA 4DL4A 4EP4A 3S3MA 4IDKA 4KHWA 4CEOA 4MEYA 3U6FA 2JLEA 2KN7A 1NK0A 1ASUA 2V4QA 3SQ2A 5DKWA 3VQ9A 2BANA 9ICNA 5J0TA 3I0RA 1U47A 1JXLA 5J0XA 1RTJA 3ZCMA 3TQ1A 4M3ZA 2PI5A 3LK9A 2D0CA 2XCAA 1S1XA 4F4WA 5DQGA 3ZDDA 4DWIA 3AO2A 5JS1A 3QEXA 4KTQA 4OPKA 3SCXA 3PO4A 4HUGA 2QKKA 4CJFA 3RJHA 2BQ3A 3CYMA 3LP3A 1S0NA 3RJGA 3NAEA 4ELVA 2IHNA 1A5XA 4CF8A 4KI4A 5FROA 1BI4A 3ALYA 4MQ3A 3RH4A 1SUQA 3DI6A 4BDYA 3T5JA 3I8DA 4Z4IA 3KLEA 2RF2A 3BGRA 1SL0A 1U45A 3OYBA 3DRPA 3DLGA 4JS5A 1VSEA 3AA2A 5C25A 1LWCA 3VQ7A 5KFZA 5D46A 4DFPA 1ZQGA 4QZEA 4KLDA 2HNZA 1YVUA 5J2CA 4CEAA 1LV5A 4DS4A 1RT7A 3M9MB 3K5OA 1X2IA 4MF8A 3GV5B 4DF8A 9ICXA 1SV5A 3NGDA 2XY7A 5CY4A 3KTQA 4EBEA 4DOCA 3CM6A 3PW7A 2F96A 1J54A 3BQ1A 4JV2A 2R8IA 1QTMA 4YR3A 3TAPA 3MGHA 3TARA 8ICOA 4DQIA 1IXRA 5J2BA 5IIMA 4NLZA 2YNHA 2NRTA 2NRVA 3SV3A 1TV6A 4DQQA 3RTVA 4P2HA 4HUEA 4YXMA 3M8SA 2G8FA 4YMNA 4LH5A 1XSNA 2YHBA 4HUFA 1DGSA 5DB8A 3G10A 4RQ0A 5C5JA 3SUOA 1BPXA 3RR7A 1EETA 4CJKA 3TWHA 4DF4A 5HHIA 2BPGA 3CM5A 3V81A 4RU9A 1MQ3A 4NM1A 5K14A 2PFQA 4IKFA 4CJ4A 3WNEA 5D49A 5J2PA 2UVRA 2XY5A 1BIUA 3QEWA 5KFIA 5KFRA 3KHGA 1S5JA 4KLHA 3NE6A 1ZQHA 5J2IA 1MC8A 4KLUA 9ICWA 3LZJA 3UXNA 3GIJA 7ICQA 1ZYQA 4BE2A 1QSSA 2QKBA 1IKVA 4KO0A 1KLMA 3LZIA 1SKRA 4M2YA 3KHLA 3C2MA 4CJ3A 4BDPA 2PY5A 3LP2A 4FZZA 3TAFA 7ICFA 4E7LA 3MXIA 4OGEA 1KTQA 2OZSA 4CJTA 1Q8IA 3OYEA 4KB1A 4F4KA 3AO5A 3PX0A 2W42A 2PYJA 3TI0A 3HW8A 4O3PA 1FXXA 1VSDA 2QK9A 2KFZA 1T7PA 4TUQA 4FO6A 3CQ8A 4QZFA 4XIUA 4AHSA 9ICFA 4Q43A 3DOLA 3NF6A 2FPMA 4MFBA 4B9VA 3G0ZA 1EX4A 5KG3A 4NLGA 1ZBFA 4RT3A 3WNHA 2JGUA 5KT2A 7ICTA 4J9MA 4I2HA 3RJJA 2P5GA 3VQ6A 4I2GA 3C5FA 4FJLA 3SI8A 5J2HA 4AHRA 2R8JA 3MDAA 4F3OA 1JKHA 3KLHA 4XUSA 3ORYA 3V9SA 4M9GA 1RILA 3PY8A 1D8LA 1U4BA 1GOAA 5KFUA 3EWAA 4JV1A 5HP4A 5CZ1A 2BGWA 4R8UB 1KLNA 3KD5E 1ZQBA 3ZT0A 1RBTA 2PFOA 1ZQXA 2ASDA 1Y97A 7ICPA 4UB4A 3CFOA 4NCAA 9ICRA 1ZBUA 3ZD9A 5IIKA 4B9MA 1S0VA 3ZSQA 2G8UA 4CJWA 4PGQA 4ED1A 5IIIA 1RT1A 1ZBHA 2NRZA 1B43A 4F4YA 3MFHA 1BQNA 4R63A 3NHGA 4YG2A 2HHVA 4LVSA 2BQRA 2W9CB 8ICWA 5KG1A 3JPRA 3MR3A 3DLKA 4LH4A 3AV9A 3OJUA 2Z1JA 1ZQWA 4KLIA 1K1QA 3TR8A 3AVLA 2B21A 4JWNA 5C42A 5KT4A 2O4IA 1CLQA 4ECYA 2IHMA 3AO1A 1IM4A 1YTAA 4P4PA 3NH2A 4KREA 4ECWA 3NH0A 5KFBA 4FLXA 8ICCA 4DEZA 1C1AA 3VQAA 4QZ9A 4KITB 2J6UA 3V1QA 2V9WA 2HHWA 2OPSA 4DLGA 3B0XA 5TZVA 3VQQA 1ITGA 3NH1A 3RBEA 1Z26A 3KK2A 3AVBA 2OA8A 3OHBA 3NF8A 1F21A 3FFIA 4TQSA 4J9LA 4CJUA 4CIEA 3OYCA 4UB5A 4CERA 2G8WA 5DB7A 4UBCA 3RJIA 1C7YA 7ICKA 1MQ2A 4UB2A 1WNSA 1XHZA 4W5OA 3MR2A 5KG6A 1KFTA 2EX3A 4IR1A 4F2RA 4Q44A 2OZMA 3ZSXA 4IQUA 4M41A 2HHUA 4CEDA 2HHQA 1NK9A 3K4GA 2ASLA 3H7IA 3UQ0A 4CJ5A 3NF9A 4ED8A 4GVMA 1RXVA 3C5GA 4J9QA 2YKNA 1TK0A 2XC9A 4CGFA 3ITHA 3AVNA 4PHDA 3SJJA 4RNNA 4CGHA 3AU2A 4R8UA 1QSYA 3SYZA 2X6SA 3PVXA 2P6RA 4CGJA 1BQMA 4FLUA 3BQTA 3B6OA 3L8BA 3QINA 4E89A 4E1MA 1J53A 2VG7A 3V9XA 2XGPA 3H4BA 4W5RA 3KIOA 4B3OA 4EZ6A 2FLLA 2IBKA 1D9DA 1JLEA 5KFWA 1HJRA 4KN7A 3RB6A 5KG7A 5KG4A 1YTUA 4M3UA 4ECZA 1EKEA 3NGYA 1U49A 3KJVA 2FBXA 3QERA 3HX0A 2W9CA 3U3GA 3VA0A 2BCQA 1NK7A 3OVNA 4FVMA 7ICHA 5KFJA 3JSMA 5J1EA 1LB2B 1SZPA 4CHQA 2KFNA 3HYFA 1ZQYA 8ICAA 4I2FA 1HUZA 4C8NA 5EWGA 1ZQRA 4AHCA 4CHPA 3ULDA 3JPQA 5KFEA 3V72A 1XC9A 3GILA 3NTUA 3OYNA 8ICBA 4DTUA 5KFMA 4O55A 4FXDA 4CHOA 1WLJA 3VN5A 5FDLA 5CP2A 3ASMA 2WTFA 3PR4A 3AVAA 9ICOA 3AVHA 2ASJA 3QZ7A 1S6PA 3WNGA 4KLJA 2DPIA 1UWBA 4QZAA 5KTQA 7ICMA 4N76A 3V6HA 4AH9A 3CFPA 3GIIA 4TSXA 3K57A 3H8JA 3BJYA 3B0YA 1TAUA 5CYMA 3D0PA 4KHUA 4I29A 4J9NA 4Z4HA 3V6KA 3DLBA 3ZT4A 1RT2A 4PUOA 3RAQA 3ZSYA 1KCFA 4HCBA 4AHUA 1ZETA 1V9PA 4KV8A 3F9KA 4DG1A 4Z6EA 4JLHA 4E7KA 1RTIA 3OS0A 5KFFA 3O3FA 1U48A 3ZT3A 1DLOA 2RDIA 4IQTA 3RB0A 4PHPA 3VQEA 1N6QA 2KZMA 4FJ5A 1UOCA 1JL1A 4XRHA 1HNVA 4DL5A 1S0MA 3LALA 3FYHA 4DU3A 4CK3A 9ICIA 4CJPA 4FS1A 2G8VA 1KVAA 3AUOA 3IAYA 1ASVA 4NYFA 4C8LA 4CCHA 3SPYA 4I2CA 1HYVA 2HNYA 2JZBB 4F5NA 4QZIA 5DDMA 1HJPA 4FM0A 1JMSA 3HJFA 2FLPA 2IC3A 2Z1IA 1VSMA 3P1GA 5CWRA 4DTRA 5DGBA 1EP4A 4KLLA 2Z1HA 1ZQQA 4GW6A 3L3VA 1RBSA 2C2DA 3MEDA 2JEIA 4GXIA 2HB5A 3OYGA 2BPCA 3MBYA 5BOLA 8ICQA 5J2DA 2JEJA 1IO2A 4QWDA 4NCGA 4CF2A 4O3RA 8ICKA 3ZDBA 5EOZA 3N4MB 1JN3A 1GOCA 3BDPA 2IS3A 4KKOA 1LW0A 4LSNA 3P5JA 1KEJA 4GC7A 4UAZA 4YN4A 3DLEA 1XU4A 1ZQTA 5J2NA 4MFCA 3K75D 2QXFA 4KB0A 3AVMA 5HRNA 4KHNA 3HWTA 1RDDA 2HNDA 4ECQA 4DSKA 3G6XA 3V9ZA 3E01A 3V7JA 4ECTA 2LSNA 1J5OA 4YMMA 4FLWA 1W0HA 3ZT1A 5J0SA 2GBZA 1RYSA 3MABA 3LP1A 2VG5A 2ZQBA 2ITGA 3AVIA 4CJQA 3V6DA 4F3TA 5D3GA 1N56A 1NJXA 1BPYA 4PHEA 3RJKA 4KN4A 3U3YA 3HT3A 2VA8A 1DTQA 4LSLA 4CFDA 4W5QA 4DTPA 5IINA 2ETJA 3NGIA 3PX4A 5JS2A 1CXUA 3V4IA 1D5AA 3L3UA 1RTDA 5KG5A 4N41A 4KLOA 3TAEA 2AJQA 1TKXA 4PH5A 2AGOA 4YNQA 3T5KA 1O1WA 2YNFA 2B4JA 4UQGA 3L2UA 5J0YA 1RBVA 4RZRA 3T5LA 1TVRA 3MAQA 2F1HA 3Q8KA 2J6SA 4UB1A 4RUAA 9ICTA 1Z00B 1JIHA 4LD0A 5HP1A 2FPKA 5DBBA 2ISOA 1PZNA 2JZBA 2P1JA 1WSFA 4N5SA 3K5LA 5J2MA 1RCHA 1YT3A 3QNOA 1B9DA 4NLKA 3K5NA 4M3XA 1S0OA 1WSIA 4CJLA 5CJ7A 9ICEA 4JRPA 2KW4A 4TURA 4F92B 4IBNA 4K4IA 2FBTA 5L1LA 1RDBA 7ICVA 4KTWA 1BVSA 5BPCA 5F9LA 4CEBA 3QZ8A 5KFNA 3L2WA 3OHAA 3JPOA 2W9AA 1TFRA 1ZBLA 5KFLA 2C28A 4W5TA 4Y1DA 5DLFA 1LW2A 5D4BA 3H4DA 3RH6A 4QZGA 2B6AA 2HMIA 1BGXT 3NBPA 4CGDA 4P4OA 4NY8A 4UAYA 2Q3SA 4IFYA 4RW8A 4CFCA 5DQHA 2HVIA 4I9LA 9ICGA 9ICQA 4YXJA 1L5UA 4HTUA 5KFGA 4GC6A 4I27A 4H4MA 1Z25A 3UPQA 2IMWP 4PHAA 8ICUA 1K6YA 1Q9YA 3M8QA 3O4QA 1JLAA 3D45A 2XO7A 3HXMA 1NK6A 3T19A 2HVHA 5HNKA 3HPHA 2C22A 4X5VA 4CHYA 1RT5A 1NK5A 3T1AA 4KLGA 3GIMA 1VRUA 8ICNA 2DTUA 4RW7A 7ICNA 2VA2A 1XSPA 2Y1JA 1WSHA 4LZGA 1QSLA 4O9MA 1ZQLA 4QZHA 3C1ZA 1G15A 4Q5VA 5KRSA 3G6VA 5HLFA 4KI6A 2P5OA 4CIGA 4DU1A 7ICOA 4CEEA 4FLVA 4YMOA 4FJ9A 1ZQEA 2VANA 2W9BB 3SUQA 4OPJA 1NK4A 8ICIA 4DSFA 4RQ7A 2ATLA 3AO3A 3LWMA 5KFDA 1K1SA 4DFMA 3OYHA 1Z00A 1LAVA 5IILA 4OKKA 3AO4A 3TAGA 5KRTA 4YD1A 3TANA 4B9SA 1QE1A 1KFDA 4HHTA 8ICMA 2FMPA 4MFAA 1H38A 1WAJA 1ZQIA 4TUSA 5HRPA 2DFHA 4QAGA 1JXBA 3LPUA 1VSHA 5FRMA 3EZ5A 8ICVA 3C94A 3LPTA 4Z6CA 5KT3A 2FMQA 3DLRA 8ICTA 1IKWA 2E6LA 1ZQJA 5KFTA 4E0DA 4HCCA 1D9FA 1B9FA 2UVWA 1ZJNA 4I9QA 5DBAA 5DQIA 2VA3A 3C2KA 3ISNC 4ECXA 4Q8EA 3OYKA 1L3SA 3RMBA 4FBUA 4CE9A 4XQ8A 4NM2A 4TUPA 1SKSA 2IOCA 4B8AB 3SNNA 1Z3EB 2UVUA 4RQ3A 1S97A 1WAFA 5KFQA 4QWAA 2I5JA 4IFVA 3HO1A 5E41A 1ZQAA 3ISDA 5DK5A 3MEGA 1S1UA 3THVA 3GIKA 1KFSA 4PQUA 5L1KA 9ICJA 1QS4A 3IG1A 1T4GA 1RXWA 3DM2A 7ICSA 3V6JA 4BE0A 2AQ0A 1BIZA 2G8IA 2VWJA 5J2KA 4QZDA 4RQ6A 1T8EA 4YFUA 4DTMA 4FLZA 1D8YA 4CJRA 3TAMA 1A77A 4KLQA 1FKOA 4ECSA 4DL7A 3M9OB 3PW5A 3PNCA 3WNFA 7ICRA 4BE1A 4ECRA 3JPNA 4DQRA 2HHTA 1BISA 4CESA 4M45A 1T03A 3OJSA 5KFXA 2DFEA 4G3IA 1IH7A 5KFSA 2UVVA 1ZQVA 4MEXA 4F5OA 5J0UA 4O3NA 4OKEA 5DGAA 4RQ8A 1TK8A 1TKTA 4CEQA 3NDKA 1ZQSA 5HMMA 4ED7A 1HRHA 4JV0A 5KFAA 4Q45A 3OSPA 1COOA 3B6PA 1WCNA 4CF0A 4OLBA 5HBMA 2FC0A 1KRPA 2ZE2A 5HRRA 4FJXA 3ISCA 4IR9A 3HK2A 5KGWA 4F5RA 2ZD1A 2XRIA 3VQ4A 4Z0UA 4AILC 1U9LA 2YKMA 3JYTA 4I2JA 4TQRA 3TFRA 3VQPA 4KLEA 4I2AA 9ICPA 5IIOA 3H8WA 2R7YA 1DTTA 4UBBA 4RNMA 3ETLA 1BPDA 4RPXA 2JEFA 4FBTA 4N47A 4F91B 1NKEA 4O4GA 2BE2A 4N56A 4FYDA 2DY4A 1RPLA 9ICKA 1UT5A 3JPTA 2DPJA 4OVLA 4OGCA 4CF1A 4DL2A 2E4LA 1XS9D 3OYLA 3VA3A 2YHAA 3C21A 4J9KA 2ZTEA 4B9TA 3MXJA 4K8XA 4KRFA 4ED2A 2RDJA 3PW2A 1LAWA 4ED3A 1MSWD 1NJZA 1NJWA 4KLMA 2R8KA 3TABA 4QW8A 1TK5A 1BHLA 1JLQA 4DQSA 4J9OA 3C23A 2VG6A 3RWUA 1X9WA 5HRSA 4ID5A 5KI6A 3VQBA 1S9EA 4CFBA 2YNGA 2V4RA 1ZQUA 1JLGA 3SUPA 5J29A 4R64A 2XCPA 2ZTDA 4YP3A 1A76A 3VQDA 1REVA 3QEIA 4M9NA 4FJJA 4J2DA 2P6UA 7ICIA 1BI4B 4RPYA 3HVTA 4OKJA 2W8KA 3AA5X 4R66A 3N97B 5J2FA 1N48A 3KD1E 3RJEA 4IG3A 3V7LA 3OGUA 3MDCA 4I2BA 4I2DA 3EPIA 3AU6A 1C1BA 2D0BA 4FJMA 4FLYA 5DBCA 4OJRA 4DFKA 4FS2A 1KVCA 3O4NA 1EXNA 5KFYA 1HMVA 4FCYA 1U04A 4CJSA 4MFFA 4E7JA 3PO5A 4DTJA 3DRRA 2ZTCA 3VQ8A 1WSJA 1S77D 8ICPA 1MU2A 4FJ7A 1ZQCA 4JS4A 2AQ4A 3RRHA 3VQCA 5SWMA 4F4ZA 5J2EA 3OYDA 2XY8A 2XY6A 5J0RA 2O4GA 4KHSA 4F5PA 4YR0A 4ED6A 5CZ2A 3ZSRA 3KHRA 4M3TA 2ZUCA 4E3SA 3QEBZ 4G1QA 4QWCA 4O3SA 1QLNA 3CFRA 3QIOA 4PA1A 5DG8A 3KLIA 2GV9A 4M6WB 2A1SA 7ICGA 4FJ8A 3H40A 1BL3A 3S3OA 4O0JA 1T3NA 7ICJA 4O0IA 3LAMA 4EBDA 4K8ZA 3PV8A 4RW6A 5CA7A 3HP9A 5FRNA 1X9SA 5DMRA 1KDHA 1ZQPA 5CYQA 1CEZA 3M8PA 5L1IA 5KG0A 3M9NB 9ICAA 4O3OA 4J2BA 3AA3A 1JXEA 4O44A 2RPIA 2BDPA 1EXQA 4CHNA 5HROA 8ICRA 4DSJA 1KVBA 4GLXA 3S3NA 1C0UA 3GQCA 2ZUBA 3V1OA 4J9PA 3HSTB 4J2AA 4M3RA 5CR0A 3OS1A 4CEFA 3OYAA 2FPLA 3JPPA 3NCIA 2BPFA 7ICEA 2PXIA 4Z4GA 3K5MA 1NOMA 1FKPA 9ICHA 3ZSOA 4CJEA 3AVJA 2X78A 4Y1CA 4RT2A 4DQPA 4AHTA 4J2EA 4RQ1A 4KLFA 4E19A 4M9LA 1N5YA 1FK9A 1VSFA 2FMSA 3QLHA 2HW3A 1RYRA 3H8SA 4GXJA 2IGIA 2F1IA 4KPYA 4I2QA 4BXOB 1QQCA 4FK0A 3LANA 2XHBA 3SQ1A 2RN2A 2AGQA 3RBDA 4RG8A 2GUIA 1HPZA 3OYJA 4QWEA 3NGZA 5DG9A 1WCLA 3UXPA 1ZQDA 4DL6A 1VK0A 1RZTA 2NRXA 3EYZA 4M3WA 4FJIA 3LWLA 5KGXA 3S9HA 4LY7A 3F73A 1CXQA 1RDAA 5KFHA 1RBRA 3MECA 1NKBA 1ZQMA 4M42A 3LDAA 2JEGA 4YR2A 5CHGA 2BCRA 4M3YA 3V9WA 1JLFA 4IG0A 1TGOA 4RQ4A 1LWFA 3I0SA 3L2VA 3OSNA 4ID1A 9ICVA 1B92A 3SPZA 4YFKA 7ICLA 4F2SA 4HVJA 2IA6A 1S1VA 3QNNA 4M6WA 1XHXA 4F8RA 3LP0A 2MAXA 1VSKA 4JK1A 1TKZA 4WE1A 3T5HA 4B9UA 1NOYA 1BPEA 4F4XA 1B22A 3QO9A 2NRWA 4Z4FA 4DOAA 1NK8A 5KT7A 4C8MA 2BCUA 3M8RA 1ZQNA 3OYIA 4BDZA 2BGGA 5DG7A 4O3QA 1WSEA 5C24A 3PMNA 4RNOA 1Y88A 3EW9A 3Q8QB 1RBUA 5HHHA 4I2EA 3TAQA 3SZ2A 3G6YA 4DTOA 1VRTA 2OWOA 1XSLA 2RKIA 1JLBA 3IRXA 3HM9A 3PX6A 2W8LA 3Q8RB 4NLNA 1HQEA 2X74A 4FW2A 3OS2A 2YNIA 5CB1A 1BPZA 3Q8PB 4DTSA 3V9UA 3IS9A 3GDXA 3KLFA 1UA0A 3KHHA 4M9JA 3V7KA 1VSJA 3OYFA 4O5BA 1UT8A 3PW4A 1DOQA 5J2QA 4B8CA 8ICFA 2FLNA 2KZZA 4KAZA 4CJVA 1ZJMA 4M0AA 4R65A 3BQ0A 3DOKA 5DB6A 3QE9Y 5L9XA 1BPBA 4Z6FA 4DO9A 1SL2A 2I1QA 4RPZA 3RJFA 2HHXA 4W5NA 1R0AA 3H08A 4L8RB 4PGYA 4I2PA 4BXOA 1ZQKA 4QW9A 4FK2A 2ISPA 2C2RA 3AVCA 2KZ3A 4JWMA 3QEPA 4BACA 9ICCA 4FJGA 4EBCA 2ZJ5A 3VQ5A 1CZBA 3QESA 3ZD8A 2IDOA 4DSLA 4BWJA 3NFAA 5EWEA 4FJKA 4QZCA 5EWFA 2PFNA 4FK4A 4ECUA 4B9LA 3MFIA 2GWSA 5KFVA 5DDYA 5EU7A 3OYMA 4ECVA 3RR8A 3DLHA 3NF7A 1J9AA 4Z4CA 1JX4A 4NCBA 4F5QA 4EEYA 3DRSA 4FJHA 1I39A 5I3UA 4M47A 1LWEA 4DU4A 2I9GA 2YV0X 1HYSA 4ICLA 2D0AA 2AGPA 2AU0A 1C0MA 3C2LA 8ICJA 4P4MA 4ZH4A 9ICSA 3RMAA 5J2GA 3ZDAA 2MUTB 4CGGA 4DS5A 1ZQOA 1L3TA 4PPXA 4CGIA 4DOBA 4B9NA 3ZT2A 4I2IA 3FDSA 4FW1A 3HPOA 1L3VA 2OPQA 4ZTFA 3RB3A 3AA4A 4CECA 9ICBA 4E7HA 3K58A 2ZJ8A 7ICUA 2ATQA 2Z1GA 1AROP 4FZXC 1S9GA 1S10A 4NXZA 3P83D 1IKYA 3IM1A 2BKEA 5J2AA 4LZDA 3V1RA 4ZTJA 4QCLA 4Z6DA 4KLSA 2OPRA 2XGQA 3HPGA 3KKRA 1SL1A 4CK1A 5F9NA 1TKDA 2KQ2A 4M04A 4ED0A 4F50A 4CK2A 4IRCA 3KK3A 3HP6A 2W9MA 2BCSA 2BCVA 2NUBA 2ZUDA 5I42A 4IQWA 2VWKA 3AVKA 5DB9A 1RT3A 4EYHB 3RRGA 3PUFA 3ZSZA 1ZQZA 3ZSVA 1S6QA 1C1CA 2D5RA 3RAXA 8ICXA 2FBVA 3Q8LA 1XO1A 4FM2A 3UXOA 4NYNA 4PY5A 3ISBA 2EHGA 3A2FA 3O3HA 2PI4A 4Q8FA 3TFSA 1TV9A 3ZDEA 3L2RA 1ASWA 2LYHA 3PW0A 1XWLA 3AVFA 9ICLA 3JPSA 3QETA 2PFPA 4J9SA 3K59A 2C2EA 4DTNA 1TL3A 1VSLA 4B08A 4F93B 2PYLA 4H4OA 3C6UA 3KKSA 2PZSA 4PGXA 2FBYA 2F1JA 3Q8MA 1WSGA 4JRQA 4O5CA 5IIJA 4YD2A 4MF2A 3GV8B 5KFKA 2ZJAA 3CG7A 3L2QA 4E1NA 4IQVA 5BOMA 4DLEA 3BQ2A 3GV7B 4KHYA 1ZBIA 2W9BA 2B5JA 4GMJB 2H5XA 5KT5A 4GXKA 3EY1A 4RUCA 5T7BA 1Q9XA 1S76D 4I28A 4DL3A 5HMLA 3SQ0A 3T3FA 1A5VA 4CEZA 1TL1A 4IRDA 1KSPA 3MGIA 1A5WA 3RMDA 1S9FA 2A1RA 2E6MA 3MXMA 2A1JB 4DMNA 4KMUA 1JLCA 2WOMA 3UIQA 3IHQB 5J0QA 3RH5A 9ICUA 1IKXA 1HNIA 4KLTA 4EZ9A 1VSIA 5J2JA 3HVRA 4RW4A 2MUTA 4FZYA 3EPGA 3K2PA 1CUKA 5KG2A 5KFPA 2J6TA 4RQ2A 1XI1A 4K4GA 1QHTA 3KLGA 1T05A 5KFOA 2HHSA 4ZHRA 2R8GA 4ELUA 2M9NA 2R8HA 4KTZA 3QIPA 3MR5A 4OLAA 2BQUA 3AVGA 8ICZA 1NOZA 4XA5A 3OY9A 8ICYA 3PR5B 1I3AA 1W9HA 3KK1A 4RQ5A 4DSIA 4EP5A 3QEVA 8ICGA 5SZTA 3C95A 1RDCA 1RTHA 3DYAA 3MEEA 2DFFA 4Q0BA 1L3UA 3SUNA 4YCXA 4JUZA 3LDSA 1BCMA 1X9MA 1WN7A 4FLTA 4QZBA 1TVAA 3C1YA 1IG9A 4EYIB 2P66A 2BHNA 4CF9A 5J0PA 3UQ2A 1SKWA 4O5KA 1RT6A 1UA1A 4KFBA 3PMLA 4E7IA 5KFCA 4DFJA 4KHQA 2ALZA 4YQWA 4O5EA 4DTXA 3HL8A 4J9RA 3SV4A 3SI6A 2IAJA 3RB4A 1NJYA 5DLGA 4M9HA 2OPPA 4RW9A 2BR0A 4UAWA 4ELTA 1ZQFA 4K4HA 4CIFA 2F8TA 4C8KA 4AHVA 4QOZB 4YVZA 1RNHA 1JL2A 2DFLA 8ICHA 1RT4A 4PWDA 3RMCA 4H8KA 2F8SA 3C6TA 1C6VA 3GFKB 3ZSWA 2X6NA 1TAQA 4CFAA 3QEAZ 9ICMA 8ICLA 3LAKA 5JUMA 4DSEA 2OYQA 2Q0ZX 4HYKA 5L1JA 5J0OA 4BGDA 2G8KA 1UAXA 4FM1A 1C0TA 3ZDCA 1S1TA 4CHZA 4R5PA 2G8HA 4QZ8A 4UB3A 1CZ9A 2WONA 2P51A 8ICEA 2Y1IA 4FJNA 1HUOA 3DMJA 2A1JA 1NKCA 4C8OA 3MR6A 1S1WA
chains in the Genus database with same CATH superfamily
4DV3K 4JI4J 2COLA 3CUNA 2ACYA 1YBUA 2MKKA 4LF4F 3BREA 4YB6A 4BWMA 4ID8A 3MXHP 2XO6A 5K14B 2OANA 2XMUA 1LK5A 4MEYA 3UR0A 1QY7A 1BUXA 4DPWA 3SQ2A 4OYXA 1X5OA 3R1HA 5DKWA 1VLBA 3DRYA 3W5XA 5AR0A 4NB4A 1MLAA 3TQ1A 3IMQJ 4LQ9A 4ISFA 2DGOA 1W2BR 5E3QA 1M1KO 2XCAA 1BD6A 3UVJA 4GKKJ 2CJ9A 1NNLA 4F4WA 2LEPA 3KUEA 4HH1A 1HKBA 3VEOA 2DNHA 3PM9A 4KO0B 5JS1A 2IFXA 5F8LA 1A9NB 3QEXA 1RHQB 3WXIA 3G87A 2GFFA 4QU7A 1FFSB 2OMOA 3LP2B 2E7XA 1FFUA 3Q24A 4QIWF 5KQDA 3CYMA 5GIOA 2BEFA 1EQYA 2IHNA 1A5XA 4CF8A 1ATRA 3HSGA 1HBUA 4USVA 3RH4A 1K44A 4LREA 3I8DA 1CJKA 1RWVB 2K2PA 2P9KA 2RF2A 1U45A 2AKWB 1KAYA 3DRPA 3OR1A 3QBCA 1VSEA 4YHHF 3VQ7A 3MCOA 4NLCA 1M5OC 4QZEA 1NMEB 4BRHA 4NLPA 5J2CA 5B0BA 1RT7A 1JKHB 2D41A 3KLHB 2RHFA 3VEYA 3F44A 5FPEA 3A0IX 2VF3A 4CZMA 3AOAA 1UCNA 3GV5B 2QB0A 4DF8A 9ICXA 4ALZA 3VVTA 3CM6A 2XI9A 6AT1B 2ZH4A 4BRNA 2R8IA 1QTMA 3BO2A 4UOHA 4YR3A 1ZD4A 3C65A 3TARA 2C3MA 2C2OB 2VPYB 4JI5J 5KAIU 3U1MA 5ETLA 3T1YK 4HUEA 4YXMA 3M8SA 5F0WA 2XZDB 2XMAA 4JNEA 3IBCB 2G8FA 3H25A 4DZDA 3J81U 4YMNA 1RAHB 4LH5A 2ZEJA 3UFCX 5LSRA 1BPXA 3RR7A 1URRA 1EETA 4DF4A 4RBVA 2PFQA 1TL7A 2P6TA 4UATA 4UUXA 2WHOA 4PZNA 1X4CA 3GL1A 2G2ZA 2ZKUA 5CD4H 1WWVA 3WNEA 3ATVA 5J2PA 2XY5A 2ESEA 2ADBA 1U6FA 2D3DA 4KLHA 1ZQHA 1HBOB 4TU8A 4LR7A 4JI2K 1WI6A 9ICWA 5TKYA 5AI0A 4V19J 3UXNA 3H2VE 3CJQA 3VEXA 1KAZA 3LZIA 2O8CB 1CJUB 3C2MA 1CC7A 2PY5A 5K9FA 1IBLK 4FZZA 4CNQA 4E7LA 2LYBA 3UKRA 4CJTA 4XO0A 2DR9A 1Q8IA 4F4KA 2VJUA 3PX0A 2PYJA 4K7QA 4PWWA 3ALRA 5G0RA 2VASA 1N34K 2KFZA 1S57A 4FO6A 4CLKA 4QZFA 4XIUA 5JVHQ 9ICFA 2YMPA 1OQ6A 4NASA 2G4BA 4BQLA 3M6KA 1VC5A 2FPMA 2BM1A 3WK8A 3G0ZA 2CYYA 4NXMF 4ZJLA 5IQ6A 3NASA 3A5OC 2LBOA 3PFEA 4J9MA 4B9QA 3VQ6A 4Q2LA 4FJLA 2HIQA 1HNXJ 3SI8A 5J2HA 2E5JA 2R8JA 3U9DA 2MGZA 4XUSA 3ORYA 4M9GA 4WJBA 1RILA 2KU7A 1V4SA 2DNQA 2KN4A 4ICAA 5KFUA 3BGFA 1YQHA 1VQ4S 4DR4K 1LCUA 3M2RA 1G6BA 4ZLLA 1KLNA 2E5SA 3HZEA 1ZRMA 4KHMA 1Y97A 3M05A 1ZBUA 3ZD9A 4B1ZA 4CJWA 1OIAA 1IVZA 1WKKA 2OEKA 5AKYA 1YJVA 4WFZA 1RT1A 3AGRA 1O51A 4N77A 5AQPA 3I5AA 5D77A 1JLEB 4DV0K 2A42A 1JWWA 3CCQS 2HHVA 2H3ZA 3WZ0A 4WQ5A 4LVSA 3KJVB 2BQRA 1OQ3A 3DLKA 2W4CA 3GZ7A 3OJUA 3TVKA 3JSMB 4Y2UA 1K1QA 3X1LB 2F1FA 6FD1A 4UB8U 2QN6B 2CDRB 4KY3A 3AO1A 4P4PA 3QJLA 4WTOB 4KREA 4ECWA 3ZZOA 3NH0A 4FO0A 1AA1B 2FY8A 1C1AA 3VQAA 5A8KA 2LMRA 2MTLA 5LM7E 3V1QA 3PJ9A 1U1PA 4TN2A 3ID6A 1F9HA 3CNHA 3QU4A 4USJC 3KZBA 3AODA 1ITGA 3NH1A 5B5EU 2YX8A 3KKFA 4CRXA 3NNCA 2KOBA 3WQUA 4FZLA 1M5HA 2B8QA 4FZMA 4ANCA 4OL8A 3MM9B 2R7VA 3P6YC 4HDHA 1YJTA 3FFIA 4X4QA 4J9LA 1RE1B 2GMLA 3R5AA 1NAQA 3E9PA 2K8AA 3SMPA 4CJUA 3GIRA 4UZBA 1QZ5A 1X5PA 3D28A 5FLXY 4P7TA 4PUOB 5DB7A 4UBCA 2DCLA 2QWMA 4UB2A 3AQOA 1LK7A 4NLQA 3MR2A 5KG6A 5IM0B 4DG1B 2E7VA 3GYXB 3ZSXA 2V8GA 4FYVB 2M8DB 4M41A 4CEDA 2HHQA 2VOPA 2B51A 2X1GA 3J80U 1CBKA 4NLTA 3NF9A 1NGAA 4J9QA 2CQBA 3ITHA 4MHVA 4RNNA 3M2VA 1ILYA 4CGHA 4C9DA 2XLKA 1QSYA 2O1PA 1W2IA 2P6RA 3SSQA 5AM4A 4B3SK 2H3EB 1FJEB 2VV5A 2V8DA 3V9XA 5HJXA 2WSFC 3EE3A 1QJHA 3IR5B 1D9DA 1KD1T 3VGTA 4ATNA 3RB6A 4CO5A 5DRKA 1YTUA 3FZBA 3P31A 3NGYA 1QVGM 1U49A 1UW4A 5D15A 2W9CA 1GX5A 2GVZB 3M3ZA 1T94A 1EP4B 3CC7N 7ICHA 1RCOB 5J1EA 3ENHA 1IBLF 5B08A 2DBYA 4P9SA 2RNEA 2CAJA 2KFNA 2DTJA 1UFKA 1CZAN 1D1UA 1JXVA 4OD0A 3OUYA 8ICAA 1VQSA 1J6ZA 4WFAL 1WG5A 3THWA 3LVWA 2NPIA 2ASPA 3W2VB 3EUB2 2KXFA 1ZQRA 1HNZJ 4CHPA 1XC9A 4K4ZA 4OX8A 3J8AA 3Q22A 1LW0B 3WKEA 1Y11A 4QJFB 4FVUA 4I0WA 5FDLA 3M8PB 1S72S 4ANEA 2MKIA 2ZJRL 4HI1A 3AVAA 3AVHA 4CH7A 3G25A 2ASJA 1FHTA 5J2NB 3SK3A 5K8NA 2UUBJ 2MKYA 4KLJA 2E88A 5J1NA 7ICMA 4N76A 1DZ5A 1VBZA 3M7VA 4CTAB 4AH9A 4TSXA 2KIWA 3H8JA 3E8OA 4QOTA 3L7PA 3K0SA 3LH2S 2KKHA 2V4JB 3D0PA 2VU5A 1V3ZA 5IT4A 4I29A 4Z4HA 3LP1B 4NEYA 1RT2A 3V6DB 1QM9A 2VFVA 1U26A 3DNCA 1PO6A 2EK1A 5CEHA 3OL6A 4HCBA 1ZETA 1S72N 3JQKA 4KV8A 3F9KA 2CGKA 4Z6EA 1VFJA 4JLHA 1L8LA 2CQHA 3MF5A 4EX6A 1RTIA 4ES1A 2VBXA 4GIBA 2ZC3A 3C14A 4IQTA 1NWKA 1N6QA 3PSPA 1HWUA 3V4IB 5DO2A 2Q97A 3SAHA 4B3TK 4XRHA 1HNVA 4DL5A 1XJWB 2MQOA 4DU3A 4X84A 4CK3A 1C2PA 1Z19A 9ICIA 3M6UA 4DCJB 4CJPA 4FS1A 3H0RB 2J8SA 4U67L 3D0GE 3IAYA 2QLBB 1ASVA 1OH8A 2O01C 4DV7F 4C8LA 3HILA 2ADCA 2HNYA 1HYVA 2JZBB 4Y2RA 4CO2A 3AQPA 2WAQD 1HJPA 3MX2A 4OI2A 4I68A 4Y34A 3HJFA 5ALIA 2FLPA 1WSRA 1VSMA 3GSDA 3CMAN 4NLYA 4DTRA 2O8EA 5DGBA 4KLLA 3QAUA 5EX0A 2IRXA 3TR5A 3I31A 4GXIA 2BH1A 4YS2A 4X65J 1FKAF 3MBYA 5BOLA 5AKHA 2FZCB 8ICQA 2JEJA 1X4DA 4NCGA 1PCAA 4O3RA 8ICKA 1WF2A 4QNLA 5EOZA 3N4MB 1HQ2A 1JN3A 1OSDA 3NRWA 4HR2A 2JWKA 3BDPA 2P9SB 4KKOA 1N36K 2EQYA 3K1ZA 3P5JA 4LC9B 1MWZA 2B6AB 3DLEA 2IM1A 4DR6J 1DAXA 1ZQTA 1TZ0A 3MX5A 4DX8H 2E1MC 5HMXA 3K75D 3BH6B 1RHKB 3AVMA 4BRAA 4KB0A 1RDDA 1QCKA 2HNDA 4DSKA 4YUDA 2J9CA 1GMUA 1X5SA 2W7PA 1J5OA 4ACOA 4CDIA 2KM8B 2QWRA 5F3XB 4FLWA 4KQZA 4H4MB 4P0PB 1NGDA 1X4GA 3QYPA 1JLAB 1XC3A 2BZFA 1CJVB 3AVIA 5D3GA 1RT5B 4KGVB 4KX3A 2ROEA 2KICA 4PHEA 2W24A 3N7RC 5HR7A 5AI8A 5ADZA 1DTQA 4B3SF 4RW7B 2D3UA 2Z30B 4W5QA 2ETJA 2RH3A 1R27B 2G1HA 3H6EA 3K2YA 1AB8A 1O0PA 2KKVA 3L3UA 5KG5A 1YITS 1R8AA 2A2CA 4PH5A 1M5KC 4RQNA 3DU5A 4ES2A 2YNFA 2EI5A 1UKUA 1KN6A 3QT8A 3T5LA 2F1HA 3Q8KA 4LQ3A 2M0GB 4WFNQ 5GAEP 1Z00B 2WVCA 5H1SV 2EVZA 2FPKA 3MMBA 3MMCA 2ISOA 3OTOJ 3O1LA 2W11A 4N5SA 2BKOA 3CD6S 5J2MA 3NGKA 4J9UE 2C3PA 2RS8A 2QWOA 1OVQA 3BKTA 2EZZA 2C3OA 2LLZA 3HSZA 3K5NA 1LOUA 4TY9A 3CJKB 2CPZA 1YITN 1GMVA 4FWKA 1BO5O 1YSJA 3MMAB 4JRPA 2KW4A 1L7OA 1R43A 4XTTA 2RJZA 4LT6A 4DDFA 5CABA 1IBMK 2JDJA 3WT0A 1C4AA 3QGPA 2J7KA 3L3CA 1MMDA 2D9PA 5HK4A 3L2WA 2W9AA 2KJ5A 1ZBLA 1F5SA 4J37A 4WXOA 4CZCA 5DLFA 1UZHA 3QRPA 2K1RA 4LR8A 4LFCJ 3RH6A 2WZ1A 3HSDA 5FPDA 4QZGA 4IQMA 2EANA 3NBPA 2I5JB 5LOQA 3VZHA 4GV3A 4P4OA 2R2SA 2J0WA 4NY8A 4BR0A 3MEGB 4CFCA 4IOAL 3WKCA 2HVIA 1S5LU 4I9LA 2IOFA 2X3DA 3MK6A 1JB0C 3DM2B 4KX5A 2QLWA 2ZH3A 3CC4N 5F8JA 2IMWP 1NDPA 3F2CA 2ZH2A 3EX7B 3HPHA 4DCHA 2KB2A 3T1AA 1T03B 2E8OA 3GIMA 2UUCJ 3QRQA 1UJ5A 3SQGA 2E5LJ 1WSHA 4MLHA 3CPWM 3ATUA 3CIZA 1JMTA 1FNXH 1VQOS 1Z2ZA 1G15A 3T1HJ 5ETKA 3BPSP 2UXDK 4KGZB 3IFRA 3VERA 5KOWA 4L3QA 4YMOA 5M1KA 2GX9A 1FJ7A 2W9BB 3SUQA 4RQ7A 4EIAA 1Z4OA 1HIWA 2M7SA 4DFMA 1K1SA 3ZZTA 2W2MP 2F44A 3M6GA 2OUGA 3JYTB 2WF9A 4TLQA 3TANA 5D4LA 2GMHA 1DTTB 1GMWD 3X3UA 2KMDA 1VQON 4IO1A 1N36F 1GLAG 4CLPA 3WXKA 1X3NA 4P74A 3IP0A 1NCLA 1JXBA 4GV6A 1VSHA 5FRMA 4J03A 3C94A 5FPNA 4Z6CA 3L95X 2FMQA 1SPBP 4QYZJ 1FJGF 2LA4A 1Q16B 1P1LA 8ICTA 1PAEX 1CJTB 1ZQJA 4HCCA 1B9FA 1RACB 5LT5A 1ZJNA 3WHIA 3ZETB 2F3NA 4I9QA 5DBAA 2AW0A 4BRCA 5DQIA 4W98A 1M90O 4ECXA 1UEKA 4FBUA 3RMBA 2LEAA 3IP4B 2CJYB 2VG6B 3DYAB 4TUPA 2WVFA 1RBOB 1ZRNA 2GA7A 2WW8A 1S9EB 2W43A 2YNGB 1WAFA 4V19S 3OTQA 3HO1A 2EBGA 1JUDA 4K0KK 3D6MB 3PIOQ 4MDBA 2DPNA 3CMQA 4ZCMA 1RXWA 4ZOHC 7ICSA 1JCGA 2ZBRA 4L73A 3DXMA 5D8HB 2VODA 3HVTB 2GGPB 3CCZA 1BIZA 5J2KA 1YWXA 1D8YA 4CJRA 1A77A 4KLQA 7ICRA 4WP9A 4BE1A 1BISA 3NS1A 3R5JB 5EX3A 1GEHA 3IKMA 4CESA 5JTIA 3PYEA 3P3DA 2LYAA 1F1BB 1ZAWA 1NPPA 1B4SA 4AP9A 2Q31A 2RHKA 2DK2A 3DLLL 1M6YA 4QPXA 3SLCA 4CEQA 4JI4F 1MU2B 4E8UA 2EW9A 4ED7A 3OSPA 2IVFB 1VQKS 2NXUA 3J7ZT 1WCNA 4U6PA 3BR9A 4CF0A 4C3LA 4CGZA 4B3RJ 4P71A 4JI0K 1CS4B 2D0OA 3BP8A 2HIYA 1M1HA 2DT9A 3LDOA 1VI7A 3LO3A 3HK2A 4EO8A 5KGWA 3ZEUB 4IYQA 4F5RA 5AXMA 1ED1A 3ET6A 2A41A 1FWLA 2EXUA 1DRGA 3TFRA 4I2AA 3RRKA 1GXTA 4UBBA 3J7Z5 4U8YA 3FBFA 5AQLA 3HHLC 4JI1K 4F91B 1NKEA 2HOFA 2HZVA 2YI1A 1F60B 3J7YU 3AJDA 2AXTU 1IQZA 1F0MA 1FRXA 3TNVA 1E6VA 1VQKN 2DPJA 4IC9A 3SEIA 5A2QO 4PG8A 2YMQA 1U1LA 3EXCX 3L9ZA 4K8XA 2VC0A 3OT9A 2Q0RA 2HF3A 4KRFA 3MM6B 5CYQB 4ED2A 2RDJA 2OLWA 4LR9A 4MO5A 1NJWA 3C0BA 4KLMA 1WELA 3TABA 3D6RA 1TK5A 3A8YA 2CKWA 1BHLA 1JLQA 1U2FA 2RD5C 2VZ9A 4FWNA 4DQSA 4CZGA 3B4DA 3GFHA 1X9WA 5ALLA 3VGLA 2I0XA 2E1ZA 2V4RA 4OI4A 3SUPA 1KVJA 3R6MA 3VHQA 5JXSA 3G8QA 5AQSA 1N32J 3DHXA 1VRQC 2DITA 3RVCA 4C4TA 3KOAA 4MKVA 1I6JA 4DCCA 1I5OB 4XH5A 2P6UA 4OYAA 1BI4B 4CF4A 4RCHA 4OKJA 2W8KA 1N5YB 1FK9B 4TNOA 1QUVA 3QLHB 4K5RA 3RU0A 2UXDF 4BRMA 5J2FA 3RJEA 1S22A 3H5XA 1LFWA 5IV4A 3EPIA 5IFMA 1C1BA 2DNZA 4K41A 3QJPA 3MD3A 1X8DA 2ZHAA 5DBCA 4OJRA 1WB9A 5LXRA 4FS2A 4JI5F 5JLFA 1SJ1A 2N4CA 3D68A 1U04A 4NPOA 4MFFA 3ZNUA 3AH6A 4DR7J 4DTJA 3BSNA 3VQ8A 3S6EA 2HG4A 5FIIA 4JS4A 3TA1A 2AQ4A 1YIJS 2CJXB 4IOCQ 5B8HA 5J2EA 4KAIA 2GIFA 3KMQA 2O4GA 4OJPA 4ED6A 3NGUA 3WQPA 3ZSRA 4M3TA 5ALRA 2JFKA 3C15A 4OYMA 4I6MA 3NLCA 1JLFB 1MW7A 1ZA1B 1SC3B 4O3SA 3Q0AA 2HOEA 2Z56B 1FRJA 3CFRA 5D0HA 5E3AA 5JMNA 3CERA 2GV9A 1QD1A 3DDNA 2KJWA 2A1SA 1EX8A 3I87A 1X4BA 2D1KA 4WJ3B 4JKAA 3I76A 4DV1J 3I96A 4O0JA 2UP1A 4K4YA 2ROPA 4EBDA 4RW6A 3CF5Q 3HP9A 5FRNA 1RAJA 5EUHA 3WKBA 2KKPA 4MYUA 4WYLA 2OH2A 4ZCIA 2YH0A 3M8PA 3K0JA 3FBBA 2RKIB 3RW7A 1S79A 1JXEA 2V68A 2RPIA 3SAFA 5IWAJ 4CHNA 5HROA 2O8DA 2Z57B 1KVBA 2H3VA 4QIGA 2VQFK 4YDUC 3IS9B 5ALHA 4WIQA 3HSTB 4Y2YA 1DFDA 3VCDA 2DNLA 3JPPA 1QAXA 2PXIA 2NQPA 1NOMA 1FKPA 1E6YA 3DOKB 3FQLA 1U0SA 3DHWC 1QQNA 4AHTA 2FJDB 1HARA 3W7BA 3RSEB 4M9LA 5AQHA 1KKXA 1PYOB 2HW3A 4GXJA 1P90A 2IGIA 4KPYA 5GAHP 4BXOB 1QQCA 4ZITA 3LANA 4NA2A 1J2MA 3G8SA 5FD1A 3AQEA 1FWKA 2CQ0A 4KMOB 4N8OA 4RG8A 2NXEA 3CVKA 2F4VK 3G8TA 3OYJA 1U2RA 5DG9A 5D4PA 4DN0A 2XYPB 4QIVA 2HVZA 2NRXA 5AQIA 4M3WA 3CO9A 3GONA 2WFBA 4LY7A 5I3UB 5GAGI 1RLCL 5A8WB 1SAZA 3O2IA 3LDNA 1X42A 5KFHA 1LWEB 1HYSB 5AHXA 4ICLB 4USUA 2ZOFA 2JEGA 4P0QA 1Y3JA 5HMZA 4A61A 1Y5LB 2R7TA 3V9WA 1HA1A 3ILJA 1TGOA 3UNGC 1XNRJ 2CQ4A 4ID1A 4L74A 2ZM6J 3CCSN 1WOSA 4F2SA 4HVJA 2OD6A 2ZZTA 4W92B 4F8RA 3LP0A 3CIMA 1ZPWX 2MAXA 1D09B 1TKZA 3T5HA 3LGHA 1NOYA 4YB5A 3C29A 4Z4FA 3MPYA 3ETRA 4DPUA 1S9GB 5AKJA 4DOAA 3CT9A 4M94A 3GU3A 3RJMB 1IKYB 3TEGA 3TA2A 5KT7A 4UAUA 3N4PA 4C8MA 3CIPA 2PIIA 2GHVC 3FLCO 1CSJA 4Y65A 3R9KA 4ZCLA 5HHHA 2X1AA 2E1PA 4TY8A 3B8AX 1VRTA 5AK6A 2Z8QA 2RRAA 3Q8RB 3L7OA 5CHCB 4O8KA 3WK5A 4LBHA 4DTSA 3MM7B 2MQMA 1U09A 2MLYA 3KHHA 2WBNA 2BJ7A 2KRBA 4IUFA 3A0HU 2JJ4D 4B8CA 2QWLA 1IV0A 4OX9J 1RABB 4USKA 2KXNB 1VBXA 4R65A 2DIUA 2CDQA 3BQ0A 3NVMA 2A19A 3CJ5A 4L3NA 4I56A 2IVNA 2KO1A 4Z6FA 4DO9A 2HRTA 3W3SA 4RPZA 3RJFA 4F67A 4W5NA 3IWXA 2P9LA 2AEJA 3D2EA 2VQEK 3QEPA 9ICCA 5ETRA 4H4OB 2ZJ5A 3ZD8A 4DSLA 4LF6J 4FJKA 4BROA 1N33K 3R6LB 3J7ZO 2BBEA 5F2RA 2X51A 1F5BA 3TU5A 3W8GA 1VQYA 3RR8A 1NG9A 1L8OA 2B5JB 4ZP6A 1J9AA 4BJQA 2DNGA 1P7DA 4Z4CA 1JX4A 4F5QA 3HHDA 1WG1A 3IWNC 3NS5A 4LFAK 5AE1A 2IBOA 4NA1A 2E29A 4DU4A 2D0AA 2PEBA 3H5YA 2GIQA 2LM4A 2AGPA 2AU0A 3JS9A 3TVZA 1C0MA 3HZ6A 1Q8LA 8ICJA 1HNIB 3HHLA 1X60A 4H0XB 3HI9A 4C7QA 5EX5A 2MUTB 4CGGA 1SGGA 4I69A 4PPXA 4CGIA 5F41A 4DOBA 3KKAC 2HBRB 4FW1A 3BO3A 4FVCA 1L3VA 3KLGB 1IWGA 3OW2M 4ZHRB 4KT0C 4ZTFA 4CH1A 3AA4A 1YRXA 4CECA 2VQFF 2FZKB 3CULA 2QKQA 2ZJ8A 3MM5B 5AZJB 2ATQA 3E0FA 3A3NB 2GNKA 3P83D 5E3PA 2G06A 1WBBA 5J1PA 3V1RA 4QCLA 3P45B 4Z6DA 5F1XA 2OPRA 3QFPA 4Y2JA 1X4EA 2EC2A 2B4UA 5FPMA 4M04A 3OVSA 2BCVA 5I42A 3ENOA 1RT3A 3RRGA 3ZSZA 3RUBL 1IBCB 3QIDA 1S6QA 3RAXA 4KFBB 8ICXA 2FBVA 4FM2A 3FKBA 2F4VF 3A2FA 4OHWA 4WU2A 5IT9U 3L2RA 4X64J 2LYHA 1XWLA 3LGMA 9ICLA 4K43A 3EKSA 2XB2D 1AYEA 1N8RO 1E4FT 1FA0A 1UVKA 4X66J 2ZBQA 4DUYJ 2DGUA 2NLXA 1TL3A 2ZWPA 4HT7A 2BOAA 4ZCKA 4CZIA 1RHRB 3HHNB 2FBYA 3C6TB 2F1JA 3Q8MA 2VBZA 1UZDA 4CDGA 4YD2A 4MF2A 4K4UA 2O6KA 3T41A 5HAOA 3FSXA 3C6AA 2ZH9A 2MHNA 3UM9A 1ZC6A 6FDRA 3AA8A 3BQ2A 4PZOA 3GV7B 2W9BA 1FI4A 2E66A 1WWHA 3CJ8A 5FLXO 1S1TB 1JROA 1RJJA 2QI2A 4LF5K 2BYCA 2WONB 3LL3A 3HTVA 4AD6A 1X66A 2CJQA 3SR6A 2E6MA 1JLCA 2XG8A 4O5FA 7FDRA 3UIQA 3BS5A 5J0QA 1D4XA 3G4SN 1IKXA 2AJ4A 1OWXA 1HQUB 4K4TA 2DRBA 2YTCA 5KFPA 4BC4A 5HVFA 8RUCA 1QHTA 2X1BA 4M5KA 2XULA 3SMSA 3MEKA 4DR6F 4KTZA 1YZ7A 4MK9A 4BG8A 4EWTA 2LDIA 2BTFA 4C6AA 4IQXA 3E1YA 1ZXIA 3I0RB 3KK1A 2JLFA 4RQ5A 2Q43A 1TYQB 2Y8YA 1WC3A 5SZTA 2Z2LA 3C95A 3QNWB 2YWFA 3DYAA 5EE1A 2Q4TA 3OW2R 1F0XA 1FRKA 4JUZA 1XN9A 1TUVA 1BCMA 2AA4A 1X9MA 2CXEA 3AN1A 2RDDA 1PVQA 1WN7A 1RXOB 3C1YA 2CVIA 4YY3J 1DK3A 4QIFA 1XMQK 5DS7A 1T3QA 5ALYA 2VQEF 4MIBA 4CF9A 1Q78A 5ADXA 4O5KA 3VENA 1J27A 2DWQA 2RIJA 3DXKA 1TFYA 1N33F 1MWMA 2HF4A 2DGTA 2FJVA 2MKSA 4KHQA 3O5BA 3KLEB 2ALZA 4A8SA 2V8HA 3MUTP 1RWNB 3W9JA 2WAQF 1YLXA 3SV4A 4WKRA 1RP5A 4IOXA 1OY6A 3F0NA 1UVLA 1LWCB 4U9RA 2EFGA 2VPWB 1WORA 4Y2TA 4LSZB 4M9HA 2DR8A 4RW9A 4ZVGA 4LFBJ 2BR0A 4N7TA 4LFAF 4P2MA 3ZZZA 2F8TA 4CM0A 4AHVA 4QOZB 1PC4A 8ICHA 1D9AA 2EFPA 2F8SA 1C6VA 3OTOF 4CFAA 3OPXA 2VPXB 3FR0A 5C15A 3PJXA 2OM6A 1U25A 2YJFA 1YDLA 1FVSA 2OYQA 1RTDB 1HI8A 1KQQA 2Q0ZX 5L1JA 2JC1A 5J0OA 4PPZA 2NRHA 3HKZC 3THPA 2XHWA 1VQPS 3HKWA 4OHZA 1SQEA 4FM1A 1C0TA 4R5PA 5B7WA 2Z2MA 2P51A 8ICEA 3P8BB 3N6MA 3HI0A 3C28A 1S3XA 4FJNA 2A1JA 3D2NA 3OTDA 3MR6A 2KTQA 3BQ7A 1W7AA 3SENA 1GOBA 3MN5A 3FAHA 4KC5A 2JH3A 3O3GA 4J90A 3ZTRA 2QTWA 1BCOA 1X1PA 2OTLN 3T9NA 2RHQB 2P9UA 3EDQB 3OBWA 4QWBA 3ID8A 4I7FA 2P9NB 2G2YA 1HYZA 4FKYA 4CEOA 3TP2A 1R8BA 4P10A 2JLEA 1VQPN 2G5HB 5ETSA 2KN7A 4CT9A 4A47A 2FZGB 3KD3A 5BPLA 3JTNA 2AJ1A 2ZF5O 4NO7A 2BANA 1U47A 5J0XA 4M3ZA 2KJVA 2I7PA 3UQSA 3LK9A 3KG0A 2D0CA 2GVDA 1S1XA 1RAEB 2VIXA 2K7KA 1ZOTA 3ZDDA 1RU2A 1GMWA 3IXQA 4NLSA 1FIQA 1W26A 2OEJA 4ITSA 1NEEA 3VC8A 1A6LA 2QKKA 3RJHA 3IM8A 3UD5A 2MYFA 5ALUA 5HQ8A 1S0NA 3MN9A 4JYAJ 1C0FA 5T14A 4FE3A 4FWSA 5FROA 1BI4A 1Q81O 4FWLA 3HRDD 3IBPA 2KG1A 1WF0A 2B0GA 1SUQA 3DI6A 2DKZA 2NZ4A 5E2QA 3BGRA 1HR0J 2MZJA 5AXLA 2M70A 1K8AO 3M1FA 4JS5A 4EX7A 4EELA 5C25A 3M8QB 4J9VA 2WB1C 1X4HA 1P8GA 5KFZA 4DFPA 4QR0A 5ETQA 3BEGB 3PNIA 2JLGA 4AXJA 1YVUA 1Y7PA 3PSFA 1LV5A 3BBFA 2CZVC 2CZ9A 4J91A 4MF8A 1KBRA 1SVDA 4URQU 1SV5A 4GO7X 3NGDA 4EBEA 3VEVA 2VGMA 2F96A 1J54A 1ZM4A 3PHTA 2Q36A 3QDKA 1J2VA 3VF6A 2C3YA 1IXRA 4WF9L 2NRVA 3GB0A 3SV3A 4DQQA 1VQ9N 1H74A 3M8YA 5HR6A 1RHJB 5AQVA 4KHRA 5GMEA 3N7PD 1XSNA 4HUFA 5L8RC 2QB1A 5DB8A 2HOIA 3FRYA 4O3MA 4F0KA 5C5JA 3ICLA 3SUOA 2Y0SD 1RBAA 2KV2A 5HHIA 4G6VB 3JQJA 3V81A 4RU9A 1MQ3A 4NM1A 1NPRA 1QVFR 1W25A 4CJ4A 2RMLA 3QEWA 2UVRA 1XMQF 3MDQA 1KQFB 4EENA 2H3GX 3ZC4A 1TMMA 3B82A 4DR5J 5J2IA 4R0JA 4JKBA 3E9OA 4KGXB 2IM0A 5RUBA 4BE2A 4PKIA 4DV6K 1IKVA 4LF4J 2QKBA 1KLMA 1SKRA 2M2BA 1A0PA 1P6TA 4ED4A 4ZVHA 7ICFA 3KK2B 3MXIA 3JS6A 2AYGA 3K5PA 2NSBA 1WUUA 5DDOC 4OI0A 5LMNJ 3OYEA 1BWFO 1RSCA 4KB1A 2IJFA 1S1UB 2W42A 3PCOB 3TI0A 2YN4A 3HW8A 3D66A 1FXXA 3CCLN 2QK9A 1T7PA 1ZM3A 4PL8A 4CZEA 4NXNK 2YKAA 5KPZA 3R5BA 3CW2C 3DOLA 1LQ9A 3NF6A 4MFBA 4O4RA 2HS0A 1EX4A 1AW0A 1ZBFA 4RT3A 3WNHA 1WWUA 4NYPA 3A13A 3PYDA 1VQMN 3P96A 3QJJA 4ZP9A 4ZVPB 4KHPJ 3L4PA 4I2HA 3RJJA 3JAMY 3M30A 4AHRA 3MDAA 3THXB 2R7SA 3Q2TC 3CJCA 2D9OA 2GOLA 3JB9k 4MKAA 3EWAA 4JV1A 4M5DB 3GPAA 2VJ4A 1ATNA 1NXIA 3TZZA 1Q3UA 3C19A 4E98A 1KONA 4WZMA 4R79A 2PFOA 2XNQA 4YHHJ 1ZQXA 1BQMB 5CZVA 4NCAA 1S0VA 3ZSQA 4HI2A 3D3CJ 4B3OB 4A8QA 3H42A 4ED1A 5IIIA 1ZBHA 2GH1A 1S12A 2YWEA 2JGAA 1BA1A 1UETA 2ATCB 3MFHA 2I1RA 2J9DE 4R63A 1RWOB 3NHGA 2P2CB 1T0TV 3N7SC 2FDRA 8ICWA 4DV2J 3MR3A 5E3CA 4LH4A 2YWKA 1HNWK 1X0PA 2H1YA 2UXBJ 2Z1JA 1ZQWA 2EEYA 1RWMB 3MWTA 4CD3A 3V2UC 2B21A 3AVLA 5JU5A 4ZPDA 5C42A 5KT4A 3F2DA 1SCJB 1N5TA 2XTJP 3FZLA 1YTAA 4DQ8A 1ZAVA 2R4FA 1WBDA 2C2MB 1N32F 4HTJA 5F0UA 2KSOA 4KITB 2J6UA 3ILOA 1F9EB 1PSDA 2CPDA 2HHWA 2ZH8A 1RG6A 1RKIA 2CVEA 2OPSA 1V9OA 5IV3A 2BMBA 2W40A 1XMOK 2I6XA 5TZVA 3VAKA 1UWBB 2I7NA 3MCPA 4OHYA 4Y28C 2B9YA 1S7IA 3AVBA 1JLGB 4NI2A 4NWBA 2YX1A 3CCUS 3R3TA 1UFLA 1V97A 2H48B 3SDEA 2YTUA 3OYCA 3D9BA 4UB5A 4WPAA 1T6DA 4CQ1A 3ENAA 4FN5A 1VQ6S 3RJIA 2R7QA 4BC7A 3VQSA 4DB3A 2ZHOA 3FZMA 4OFZA 4QU6A 3PEHA 2G0IA 2CQ3A 4LRBA 1P9QC 4IQUA 3QU2A 2LCWA 1DLOB 3CCVN 3CO0P 2LMIA 3H7IA 3C2PA 4ED8A 1VQ8S 4FZNA 3TTFA 1HLUA 2YKNA 2XC9A 4LRDA 4CGFA 4ILJA 4US9A 3AVNA 2IDEA 3NG8A 2OXOA 2KHVA 1YXQA 3BZKA 3BR8A 3MCMA 3MCNA 4YB7A 4K50A 4N8NA 4R8UA 3H98A 1JNRB 4CGJA 3HM8A 3TPQA 2KT3A 4E89A 2VG7A 2XGPA 2QL5B 3ISND 3KIOA 1NUEA 2MJNA 3A5MC 3D0IE 2E2OA 1B0XA 4MK8A 2F77X 2IBKA 1SZ2A 2RQCA 4DXLA 4Y2IA 5CCLA 1M5PC 1HJRA 4DV3J 4ECZA 1EKEA 2FJWA 5T7LB 4JN4A 3U3GA 5AICA 3HBTA 3FQKA 1A7GE 1DGJA 5AQRA 1H0HB 2B9XA 4JI3K 1LB2B 3MEDB 3D54A 1Q0NA 1RQNA 3ULEA 2CGLA 3BBBA 2UUTA 4I2FA 1HUZA 5CXTA 1Q8BA 1SH3A 4NZ0A 1TFWA 3OA9A 3CDAA 3PYGA 2XSJA 3HRGA 3GILA 3OYNA 4DTUA 5CAAA 5KFMA 4UQTA 4LSNB 1ZPVA 3ONQA 2NNWA 4NXNF 3FCVA 5CP2A 2LYVA 4F0HA 3PR4A 1S6PA 2C2ZB 5JLHA 2A3VA 4W4MA 5ALNA 3QUBA 3EE8A 1C0UB 2CJAA 4B3MK 2MA1A 5DM7L 4NL9A 3CFPA 4YOXA 2Q66A 4DU8A 2KVQE 3E01B 3Q8UA 5JMVA 3PRVA 1PUZA 2ZITA 1YVFA 2K3IA 5CYMA 4Y00A 1NSKL 4IH6A 4KHUA 1QUPA 3V6KA 2V52B 3ZT4A 3HHEA 4H5NA 1Z2LA 1KCFA 4WFBQ 2K89A 4AHUA 1EHWA 1L7PA 4G1IA 4BC5A 5GINA 2WF5A 5GADI 3OS0A 2EG1A 3M32B 3O6WA 1V4TA 1V85A 1S4FA 2GAGC 4PHPA 3VQEA 2HURA 3LYSA 4L75A 2MKCA 2FUG9 3R7NB 4NX9A 1TKXB 3B78A 1S0MA 4CNZA 1YJ9S 4CLSA 2F8HA 1WOQA 2D6FC 3ZFVA 2RUSA 3QSYB 1RWPB 2G8VA 4CP5A 1HNWF 3U1LA 1NZAA 1WI8A 1JK9B 4CF3A 2YQ1A 2MLXA 4CCHA 3SPYA 3OHRA 5HP1B 2VUGA 1MROA 1K8KA 3T1YJ 4QZIA 3QWPA 4FPRA 1YHQN 1HIYA 5DDMA 3WC2A 1M0SA 3W5YA 3UMCA 4BQZA 4OLOA 3R9PA 1MA7A 3FZKA 2IC3A 5CWRA 2P9PB 1VC0A 3FGVA 1YJ9N 1FTRA 1RADB 2NR0A 4TU7A 3CQXA 2OP5A 3N4WA 3N4QA 3OYGA 1WHVA 3MD1A 3U26A 3DGPB 1B7FA 4CYUB 5J2DA 1IO2A 1R3NA 3QU7A 5C10A 2WVEA 4JI2J 3PIPQ 1TUUA 4OJ3A 3AFGA 3H45C 2KL8A 5F8MA 4DN9A 4UAZA 2HMIB 3E66A 1HWKA 1VC6A 3MPUB 3VAJA 2Y0SC 4MFCA 1HHQA 2IA0A 2QXFA 1IBLJ 4U7CA 3HWTA 3R2CJ 3POTA 4DJBA 4ECTA 2HSTA 1NGIA 4YMMA 4LF6F 1T3OA 2G0CA 1IJFB 2QMUB 5J0SA 1N34J 1J97A 2KHQA 3GG0A 2GBZA 1RYSA 2H51B 1IG8A 1CQMA 3OR2B 2VG5A 3UKUB 2ZQBA 4PL1A 4CJQA 5AI5A 1NB2A 3RJKA 3HT3A 1VRUB 2H9ZA 2V2ZA 4ZLPA 4LSLA 1SJQA 4Z37A 4YDDB 3PX4A 5CHIA 4DR1K 2NYVA 7AT1B 1D5AA 3CCES 3J7YP 2N1RA 5HLFB 1RTDA 2CA9A 3TAEA 1EZZB 4LF1A 1O1WA 1VS3A 2B4JA 2K7JA 5HOOA 4DR4J 1KBUA 2FC9A 2JNJA 3GG1A 2EK6A 3L09A 2FSNA 5M1QA 1TVRA 1YF5L 3MAQA 2BE7D 4JI3F 4CZFA 4RUAA 3J81j 2DKOB 2CG4A 2FXUA 4LD0A 2HAIA 2VBWA 2JXJA 1QE1B 1NNDA 2Z58B 3O80A 4BRGA 4DV0J 3QNOA 2G5IB 4OZ1A 4I6YA 3CCEN 4M3XA 1PGZA 3O4WA 4CO0A 1WSIA 3NKYA 1OS5A 4F92B 4RJVA 2H4WB 4IBNA 1NU0A 4K4IA 3OFHA 2LDYA 2FBTA 1R8CA 4MKBA 4B3MF 5E26A 3B9JA 2ZC4A 1U0HA 5A0YB 4KTWA 1BVSA 2FDNA 4CEBA 4RNFA 1FDAA 4UB6U 3JPOA 5F3TA 1SXDA 2HFZA 3T6BA 2YKPA 2ASMA 4W5TA 3SMVA 1LW2A 5ALTA 3QXGA 5AQTA 1UMJA 1BGXT 4F04B 1OH5A 5AM0A 4DX5A 2AZ1A 4ZPTR 4IFYA 4RW8A 1N5SA 3TJ9A 4PQUB 2VGNA 1W7WA 2LQBA 3EZOA 2V94A 3PSTA 3IG1B 1C1CB 4HTUA 1L5UA 4X4NA 2ZIXB 3MUMP 2GJFA 1HKCA 4I27A 4P2FA 4Y2AA 4CW7B 2M5YA 2OKQA 5EY4A 4PHAA 8ICUA 4J5OA 2JVRA 3M8QA 1N61A 4JB3A 2BE9B 2XO7A 2HVHA 5HJYA 5K8MA 1HHSA 5CQGA 2KDOA 4CHYA 2GELA 3MCSA 2ZJQL 1U6BA 5DZ7A 2XZTB 2VL1A 8ICNA 4B6JA 3W3DA 5ADXH 3JXUA 5ALKA 4O9MA 2CPHA 4K4WA 4D3GA 1CPZA 4UY8O 1TKTB 2DRDA 1X7VA 4XEIA 4Q5VA 5KRSA 3G6VA 2BRLA 2MHEA 3BGUA 4KI6A 2P5OA 3N6NA 3SFUA 2JMGA 4FPIA 4FJ9A 1ZQEA 2VANA 5HBMB 3TADA 8ICIA 1MA9B 2ATLA 3MPWA 3OYHA 4B3SJ 2JSXA 2O8BA 2D1CA 5IILA 2BJDA 3O08A 4PZVA 2YKMB 5AQQA 5C2FA 3C16B 1LFPA 3IG5A 3F5TA 2OTJS 4IEEA 1B99A 2MKJA 3SJHA 4PXBA 4HHTA 4DX7A 2G07A 3LM2A 1G4CA 1H38A 1WAJA 1ZQIA 5HRPA 5GTHU 4C4RA 4KH6A 4IDHA 3HD1A 3T79A 3EZ5A 3LPTA 3S6JA 4A8EA 5KT3A 1FFGB 5HQLA 1IKWA 4C4WA 3MR7A 5KFTA 4AE5A 1APSA 2GX8A 2WF6A 2BJEA 2IMOA 2MSTA 2MQNA 3WEEB 4DPOA 2VA3A 1PIEA 1F9FA 3ISNC 2OTJN 2K60A 1JJ4A 2C42A 1YX2A 2P6SA 1SH0A 4NM2A 4CLUA 3MM8B 4B8AB 4ID5B 3ENWA 2L48A 2UVUA 4RQ3A 2EH9A 3FRZA 3LTOA 2VOOA 3KFWX 2D7SA 2GMJA 1NZPA 3THYB 1BLUA 1IWAA 2D4WA 1S1UA 3THVA 1REVB 2HKEA 4UASA 9ICJA 1VYAA 2HQFA 4DR1F 2DVIA 1K0TA 3V6JA 1RISA 2AHOB 2AQ0A 4PYDA 2VWJA 4RQ6A 4YOVA 4LF7K 2HRUA 1FKOA 1Z4UA 3PNCA 2W2NP 3E3XA 3VALA 2H3FA 2HHTA 1SS6A 5AXKA 1SXLA 3CDEA 4BLGA 2D3O1 5KFXA 3P39A 2NO4A 3MWPA 4G3IA 1WG4A 1IH7A 1ZQVA 2KE7A 3KMSA 1YJNS 4RQ8A 8AT1B 1UVIA 4WXWA 5AI9A 4B3TJ 1KN5A 4JKCA 1TTHB 4JV0A 5KFAA 4Q45A 5A8RB 5EE9A 1KKHA 3TA0A 4MKYA 3MWBA 2ZE2A 1T9VA 3W66A 1X9JA 2QWNA 2HOQA 2ZKTA 2QL9B 1Z1VA 5F3ZA 2ZD1A 2XRIA 3HOSA 4G1QB 2ZH6A 2IRYA 3VQPA 1NDLA 4FWRA 4KLEA 4JEPA 2OEMA 4EEKA 3W61A 1FEHA 1BPDA 3KLIB 1SXEA 4RPXA 4FBTA 1YJNN 1RAGB 2L9WA 3GCXP 3ZZPA 2FJEB 2HFNA 4O4GA 2BE2A 1SB6A 1HI0P 3BEXA 3O9QA 1VJWA 3SBTA 2DY4A 1RPLA 9ICKA 3GBTA 1U02A 2H5JB 3WX4A 3Q7BA 4OGCA 4CF1A 5AIBA 2E4LA 5M1NA 4AT1B 1U6ZA 1ULRA 5I3QA 2YHAA 2FJAB 2XI3A 2VWBA 3NMAA 2ZTEA 1T9WA 4MIAA 3W62A 2RE2A 5LY3A 4JYAF 3H8MA 4JKEA 4ED3A 2YBVA 1WNEA 4A2BA 3F5EA 4QW8A 1Q1KA 3A5LC 4WU3A 4FNHA 1FDNA 1N36J 5H9FK 2I5HA 5HRSA 3CTRA 1SC4B 3MAAB 2ZDOA 4CFBA 2ZOGA 1JLGA 1H73A 4LF9K 4HACA 1MN8A 2G0AA 2XCPA 3I9ZA 1QZ6A 3GR1A 4ILGB 3I56N 3NVKA 3W9HA 4AUKA 2W2QP 3GFXA 4M9NA 4J2DA 1ICEB 2KP7A 3W0LA 1EWRA 3N97B 4AYBD 3EUNA 3A8EA 1PK1A 3IA0A 4IG3A 4I2QB 3V7LA 3VAFA 5BJRA 2YX4A 4ZVFA 2RS2A 3DOMA 2D0BA 4FLYA 5HQMA 3PSIA 4IO9Q 2ZWHA 1KVCA 1HMVA 4FCYA 2ABYA 3DRXA 1HHTP 3UB5A 3D0HE 4CJSA 2ZIUB 4E7JA 2HK2A 3PO5A 2WVDA 3DRRA 3AXKA 4PRFA 1OYEA 3G82B 4FJ7A 1TAMA 1XK8A 3NCPA 2K8GA 3VQCA 3TX0A 5SWMA 1CULA 2CPFA 3QGGA 5I4MA 2XY6A 1QDUB 1S4EA 5J0RA 4MIWA 4YR0A 4KBOA 1TV6B 1UPPA 4E3SA 3DJCA 2BZ2A 2WK4A 5DZ6A 3OTCA 4DR5F 1KVKA 4TYAA 2QA4S 2VJ5A 2W01A 3QIOA 2NYIA 4PA1A 3ZLJA 1L7NA 1RDRA 4M6WB 4ZDNA 2WUSA 2FGOA 3O1WA 7ICGA 2F63A 4WE1B 1KQSR 3H40A 2EFNA 4KSEB 1P8ZA 5AKGA 1S7HA 3QO9B 1QQ6A 5SUHA 4O0IA 4P72A 3LAMA 3PV8A 1IBMJ 2QZ8A 3R3LA 2G13A 4KH0B 3TSQA 5DMRA 4KB7A 3GMGA 1KHVA 1LWXA 3SCKE 5LMNF 5M1FA 5KG0A 1JLBB 1HWLA 2ES6A 1H1VA 4GY2B 4O44A 3AA3A 4ISEA 1UWAA 2QA4N 1EXQA 4LF7F 3GTYX 1D8ZA 5AZIA 4GLXA 1C0UA 1HQEB 4JKGB 1Y5IB 1ACMB 3OBYA 2GQCA 3KLFB 1SJFA 1VHXA 2YCHA 1HWIA 4CEFA 3FEYB 1UEVA 3OS1A 1XNQK 2H65B 4OI6A 4JHDB 3NCIA 7ICEA 5J2QB 4KHPF 3DGVA 4F36A 3VETA 4C23A 1NZ8A 5ETOA 1HD1A 4Y1CA 3ADAC 2HPUA 1RK8A 3L4IA 2BOPA 4RQ1A 4KLFA 1EQ0A 1R6YA 2ZIVA 4A8FA 4H0PA 5BYQA 2XHBA 3J7A1 2FI1A 4PHTX 5LSLA 5F8IA 1FD8A 1LXNA 2RN2A 3ZX0A 1NBEB 1NSAA 1EWQA 4AQYK 3D3BJ 3QGHA 1HPZA 4DPXA 4QWEA 1KS2A 1T9YA 3Q23A 3IUCA 1WCLA 1NLVA 2CH6A 1T9UA 1ZQDA 4QIWD 4YORA 1FX4A 5HANA 4C0ZA 4ZIVA 2UXDJ 3O8MA 3BZCA 3DRSB 4DV2F 2HWTA 2DH8A 1O5JA 2ZJPQ 2LPEA 2UXBF 4C11A 2GQ2A 2OCEA 1RBRA 3MECA 3CCMS 4IS7A 2HMPA 5B0FA 3D2WA 4M42A 3BM7A 1Q7YT 4YR2A 2CRXA 1BNOA 4OIXA 4IG0A 1BQNB 3LQVA 4JI6K 4RQ4A 2AEMA 3I0SA 2X1FA 4BVOA 4LMZA 3GLJA 3SPZA 3I4HX 4Z7YA 2I8EA 1S1VA 1HKGA 1XHXA 5L39A 2JR5A 3RAMA 2OPQB 4JK1A 4K59A 2V2VA 3F56A 4OJGA 2RILA 2NRWA 4LF9F 3W9IA 3QUQA 1XUPO 1NK8A 4HDGA 2BCUA 3M8RA 1ZQNA 3OYIA 2QT7A 3M4XA 3CCMN 5F8GA 5DG7A 4O3QA 2Y9HA 5C24A 4M8LA 3EW9A 1I94K 3TAQA 3GYGA 3SZ2A 2L08A 5IXUA 4DTOA 2OWOA 4BRDA 3MAHA 4OJLA 2IIRA 4PEOA 2JRSA 2W8LA 3DXBA 4RKUC 4NLNA 2HQCA 3BBCA 1NI3A 2YNIA 2DGXA 3Q8PB 1N52B 1GK8A 3BSCA 4Z7CA 2B0CA 5JVGL 4M9JA 1ZZNA 3U8XA 3OYFA 1IIPA 4K0KJ 4H5TA 4O5BA 2HWHA 1DOQA 1ZA2B 4U95A 4FWMA 2OELA 1S59A 2PC6A 4B1VA 1ZJMA 4CJVA 4KAZA 1I51B 2DKXA 1H2VZ 4GVBA 5L9XA 3U02A 3C6HA 1NJIT 3NXZA 1SL2A 2I1QA 3PRBA 1G2EA 2HHXA 1R0AA 4I2PA 4QR2A 5AK5A 1ZQKA 4OHXA 2C2RA 5L38A 2E2NA 2KZ3A 5EOYA 1YJRA 4FJGA 4E1JA 2MQLA 3C6UB 4OYWA 4EBCA 2ILYA 1SZHA 1M1GA 2HYIB 2IDOA 2NZTA 2F9WA 4BWJA 5EWEA 5EWFA 2PFNA 4ECUA 5ALGA 3MFIA 3UPFA 2H5IB 5HO4A 3M2UB 3OYMA 2DGQA 4DV3F 3DLHA 2HGLA 1URNA 3HVWA 4BRLA 3AY0A 3AEVA 1OPIA 1TL1B 3CCRS 1OKJA 4M47A 1MMNA 2UUAK 2M88A 4JI0J 1HBNB 1OO0B 2FJ6A 5C7PA 4M7YA 3C2LA 4P4MA 3TUIC 9ICSA 3WK7A 1PJ7A 2BV3A 3RMAA 1XR7A 5J2GA 3JAMO 5ALXA 4ZPBA 4RW4B 3ZDAA 4MJKA 5BYSA 5A0LA 3KDOA 3ZT2A 2P9GA 4I2IA 4JI1J 3HPOA 4NE9C 3GJRB 3QBWA 3ZZYA 3EEQA 3M7DA 3RB3A 4AL7A 9ICBA 4X4RA 1VQ4N 2N4DA 4FKXA 1AROP 1B4FA 1UP1A 4ETZA 3CCRN 1XNQF 5AKEA 4WWSA 1AZSB 4ZTJA 1WG8A 2FHOB 3CRXA 3FEXB 4OI3A 4Q0BB 4CK1A 1TKDA 4OJHA 3FSYA 3CCQN 2PN6A 4BR7A 2EZYA 4IRCA 3KK3A 3HP6A 2W9MA 4NLRA 3D2FA 1VBKA 3AVKA 2ZG6A 5DB9A 1U2VB 3UDLA 3PUFA 3R97A 1C1CA 2Y9TA 1RT6B 3KYLA 4O0NA 4L6V3 4W90B 4AQYF 5DJBA 3EXYA 4BVPA 5H9EK 2YMMA 1OUQA 1OSCA 5JVGQ 2DHXA 4NYNA 4PY5A 2EHGA 4PXEA 3O3HA 3MGJA 3NOCA 2XQCA 3ZDEA 4U8VA 4FOIA 2HFSA 3I32A 1ZBTA 3LPYA 1KXPA 3AVFA 1S49A 3JPSA 3VF4A 4MYTA 2G09A 2UV8G 2P9IB 2MQ8A 3A0BU 4ZN1A 1RT4B 3I28A 4NEZA 1NH8A 1WSGA 2VICA 5IIJA 2MY7A 3T1YF 5ELZA 4JI6F 3L2QA 4E1NA 1WHXA 5BOMA 4DLEA 4H0YB 2MEWA 4KHYA 3THTA 2H5XA 1R6VA 1Y00A 5A2QU 3VAIA 2YQ0A 4X4VA 5T7BA 3OLBA 3EY1A 1Q9XA 4I28A 1BC6A 4DMZA 1R31A 1FVQA 4CEZA 2R42A 4AYBC 4IRDA 1A5WA 1U1QA 2IPOB 3RMDA 4ILRA 3MXMA 4KMUA 2WOMA 1S1WB 3ZZUA 2LA6A 2MMYA 1PJ6A 2FF3B 2E5IA 5GAEI 4JKHA 4EZ9A 1I94F 3F5AA 2C2NA 4X62K 3SCLE 2V51B 3HVRA 2R2UA 3UR3C 3FJ2A 4FZYA 3EPGA 4PYAA 4JI2F 4A2AA 3K2PA 4FNIA 5KG2A 2DH9A 5FJ4A 1NGJA 4C80A 4CO1A 1T05A 5KFOA 2HHSA 2R8GA 2QARA 3QIPA 4YN3B 1URJA 3AVGA 4DHYA 1Z1BA 4ZLNA 1N5XA 3PR5B 4KJIA 1MMLA 4EP5A 1RWWB 3UVJB 4ZOSA 1RTHA 2O8FA 1IQTA 2MSSA 4WK1A 1FT8A 2IVOA 1N34F 3LDSA 3KJNB 1V38A 2DO4A 2RQMA 2VQFJ 2P66A 2BHNA 3TUPA 1RDFA 1M90T 2AD9A 4I6WA 3ENQA 3TO8A 1RHUB 4DUZK 3V4MA 4M63C 3M1VA 4CZJA 5AI6A 1VBYA 4E7IA 1HBUB 5KFCA 4JBCA 4DFJA 1CJKB 2HMXA 2P9KB 2RF2B 4GV9A 1C20A 2DO0A 1VQNS 3HL8A 3DRPB 3OR1B 2IAJA 3WK4A 3RB4A 3Q7CA 2OPPA 4DR4F 2HVDA 4CBWA 1T11A 4K4HA 3PJWA 1JJHA 2UUAF 3W2WA 4C8KA 1SC1B 4YVZA 2HGNA 1RT7B 5D0GA 3A8IA 4PWDA 4OV1A 4WFYA 2F4VJ 3HHLD 1TAQA 9ICMA 2QB0B 8ICLA 2YX7A 5A8RA 3LAKA 5JUMA 4DV0F 1UTAA 4H5RA 4V19X 3FZFA 1VQNN 2CUYA 2GHPA 3OFGA 1RGIA 2IOHA 4RR5A 1Q7YO 4K4XA 2G8KA 1GLJO 1U24A 1UAXA 4ZVOB 4ZKAA 4CHZA 2OYYA 2G8HA 4AM7A 1CZ9A 4DZ6A 1DXSA 2QA4G 5E7OB 2OSQA 4Q2MA 4JD2B 4ZPWR 3DMJA 4K2JA 3N9UC 3SXLA 3DDKA 1HUXA 1XQSC 5J0WA 5J8YC 4OV6A 2FPHX 3CB4A 3E2EA 3W63A 3BGOP 3C46A 2BKPA 2P9CA 1EETB 3HT0A 2MQQA 8ICSA 2FYXA 5AJ3K 4Z4EA 1LKYA 1TL7B 2R2TA 3GDQA 1NGFA 5LXYA 1Z4NA 4EP4A 3S3MA 4IDKA 4KHWA 4QIWC 2DCUB 4AF1A 4CF5A 3UNYA 5J2PB 3EM1A 1ASUA 2BABA 3GFYA 4ZMMA 4CM2A 2QW9A 1HWJA 1JXLA 1RTJA 1XERA 2YKQA 2DHSA 3EGNA 3ZCMA 5MAOA 2PI5A 1Y4ZB 1EKRA 1BNPA 3PXGa 5CZXA 1RI7A 4DWIA 3QX7A 4FF1A 3AO2A 4JKFA 3R1XA 4WFAQ 4XDDA 1FEZA 3PACA 3SCXA 3PO4A 5BRFA 2B3TB 3A8JA 2VIHA 2ERRA 3LP3A 3AOBA 3UKRB 2ZJRQ 3H7HB 5AQGA 4ELVA 4WYBA 1NJIO 5G0RB 2FE9A 2XS2A 4BR5A 3C7NA 4BDYA 3T5JA 4Z4IA 4OJ5A 4F02A 1FWPA 2PE8A 3PRDA 2W6KA 2V67A 3U4LA 4V1Ak 3DLGA 3AA2A 2EWHA 3G6ES 2QC3A 2J5AA 3D6HB 5AE3A 4XH4A 5AKKA 5D0RA 4B1UB 3I5CA 2E1RA 2BJ8A 1WEZA 2IM3A 4KLDA 2HNZA 2WB4A 2VQEJ 1O03A 3ZTSA 1BY9A 1OY9A 5KL1B 2MGZB 1A6SA 1T9TA 1N33J 3M9MB 2HHHK 4M5JA 2PBDA 1X2IA 1P1TA 2CPRA 4X62F 3M2RB 3KTQA 3PW7A 5AQNA 3GR0A 4JP8A 3AAPA 4JV2A 5ALSA 2AYMA 3TAPA 2WCXA 3MGHA 1U8SA 1NLKL 3IO1A 1Q18A 4LFAJ 5J2BA 5IIMA 2YNHA 3KUGA 2NRTA 3FMWA 1TV6A 3RTVA 4P2HA 1RT1B 1VDVA 4FZVA 1GXUA 1R0CB 1T9XA 4U67Q 1M5SA 2JL9A 2PA8D 2WRMA 1XIQA 3J81Y 2QA2A 3O44A 2WVBA 3R8YA 2LECA 1JCFA 3G10A 2RQKA 4RQ0A 2IOFK 1RAIB 2A6MA 1IXKA 1REGX 3DLKB 4CH0S 2VFSA 4CJKA 3TWHA 4WP8A 3H1QA 2XLIA 5K14A 2JFDA 2FQQB 4IKFA 2RRNA 3I8BA 3AJ1A 2RRDA 2HDOA 5D49A 1VQ5S 5HATA 3WKAA 4QS8A 5KFIA 1VIOA 3IDWA 1S5JA 4NYZA 4OJ1A 3NE6A 4DUZF 3CHWA 2HFOA 2J9DA 5L1MA 1N5VA 1MC8A 2Y1LB 1RHMB 4KLUA 3RBZA 2RB7A 5A8KB 1SQKA 3K9KA 3LZJA 2IY5B 3GIJA 2HBYB 1ZYQA 1NDKA 2DEIA 4KO0A 1U2CA 1X4AA 4A8KA 4M2YA 3CD6N 3KHLA 4CJ3A 3D7SB 4BDPA 2FGCA 4C97A 1BE4A 3LP2A 4K2XA 1DY3A 2CFXA 3TAFA 1PBUA 2CQPA 2EFOA 2V8PA 1KTQA 2NUHA 3LW5C 5LMUK 2DH7A 1WD6A 5HVHA 3AO5A 1K47A 2R7OA 4AFFA 2QG9B 3ENBA 4C98A 4TUQA 1B0PA 1N63A 3HSCA 3CQ8A 4Q43A 4B3TF 4B9VA 2BJ1A 3I55S 4MO4A 3BS7A 3TAMB 1T44A 2JVOA 3UE2A 5KT2A 3MOJB 3A8KA 3K9JA 2P5GA 4I2GA 4BCAA 2RQ5A 1FE0A 2W7AA 1JKHA 3KLHA 4BGBA 3ITHB 1WEXA 2VKQA 3PY8A 1D8LA 4C8YA 3M2VB 1GOAA 4YOWA 4GKJK 2GV1A 1Q8KA 5IOLA 5CZ1A 3WXJA 5AJ3F 3H3NO 2BGWA 1RM6C 3IGNA 3DAWA 4HTIA 1ZQBA 3ZT0A 4G1PA 1J2NA 2LU1A 2ASDA 3SD7A 4ENOA 4UB4A 9ICRA 1LOTB 1YUWA 2G8UA 4LF5J 2J76E 3QFHA 2ZGYA 1BQNA 3HCXA 3M8WA 1WEYA 4K4VA 1U1KA 2XWXA 3MZIA 2W9CB 1RB0A 1FRHA 5KG1A 2W41A 5E84A 1JCEA 3EVWA 2MZSA 5LL6Z 1I3OB 2VC1A 4H5WA 2ZBIA 4KLIA 5J1EB 3J7AN