4DQPA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and ddctp (paired with dg of template)
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
580
structure length
576
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 199
structure length 576
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqpA01
3RRHA 3VQ8A 4Q5VA 1UA1A 1V9PA 3OYNA 5J2GA 2OYQA 3KD5E 5J2IA 1LW0A 8ICMA 3QEVA 4I2PA 1HRHA 1KSPA 1BCOA 4PGYA 2DFEA 2DFLA 4YP3A 4B3OA 2PZSA 3SQ1A 4CEDA 1TL1A 4BWJA 4OGEA 4KTZA 3UIQA 3NGZA 4RNNA 4PH5A 4DFPA 3L2UA 2BQ3A 1RPLA 3QZ7A 3SQ0A 4CFAA 2HVIA 3G6VA 4FK0A 3VQ9A 2P5GA 2PXIA 3QNNA 3KKSA 4CEEA 1IH7A 1G15A 3RRGA 3D0PA 4Z4IA 1RILA 5CA7A 4M3ZA 5CR0A 3PW4A 3BQTA 2BCRA 1T03A 1NJWA 1KFTA 3RBEA 1NKCA 4CJRA 1RBTA 4I2HA 4IQUA 1S0NA 2C2RA 3L2QA 2YHAA 1BPEA 4KHUA 4KLMA 4B9MA 3C94A 4NM1A 5DG9A 3NCIA 1U45A 3ZSOA 3HWTA 2PI5A 4ED7A 3Q8KA 4FZYA 1XHXA 4KLJA 4Q8EA 2XHBA 3OYCA 2IBKA 4PGQA 1VSIA 1WSIA 4GW6A 1ZQWA 2OWOA 4PHDA 1QLNA 4CFDA 3T19A 3WNFA 1UWBA 9ICBA 1ZYQA 5C42A 4F92B 4CFCA 4PHPA 3PR4A 1DGSA 1BIUA 2YNIA 9ICRA 2X6NA 1HUZA 5DGAA 2ATLA 4MFAA 2A1SA 2A1JA 3TI0A 4BXOB 2XGPA 2HHSA 4YCXA 1I3AA 3BGRA 3RBDA 2XC9A 3LZJA 2JEFA 4QZDA 4ZTJA 4Q0BA 8ICBA 4DF8A 2V4QA 3ZDAA 3ZSWA 4O3RA 1S5JA 1S97A 1SV5A 2FMPA 2OPQA 2ZUDA 5DDYA 1N5YA 5J0OA 1Z26A 4CHNA 3MDCA 3GV5B 1XWLA 4F5OA 1LV5A 5DB9A 4ECTA 3NAEA 4J2DA 3ZDCA 5J2NA 1Z00B 4YVZA 4DL7A 3NGDA 2BKEA 8ICOA 4NLNA 4XQ8A 1ZQIA 2KZMA 4JV0A 1COOA 4KITB 5J2AA 1L3SA 5KFEA 4P4MA 4I2GA 1B43A 4C8OA 4LSLA 1HJRA 1UOCA 2G8WA 3GV7B 2E6LA 2XY6A 3V4IA 3CM6A 1RYSA 4KFBA 3AVGA 1BL3A 1ZQGA 3QNOA 3PW5A 1HPZA 2J6UA 4EZ6A 4ED3A 3LP1A 3HO1A 4F4XA 8ICXA 1LAWA 4PGXA 5KFYA 3MR2A 3OYHA 1HMVA 3G6YA 5KT3A 7ICLA 3HSTB 1EETA 1ITGA 2JEJA 4CECA 3L8BA 9ICKA 4P2HA 4CF0A 4FLXA 3FYHA 3H40A 1RYRA 2VG5A 5DBBA 2Y1JA 5HROA 3RMAA 4J9PA 4KLIA 2W42A 3LDSA 1CUKA 1RTDA 1NK8A 1NOYA 4RPZA 5KFIA 1JX4A 2NRVA 4ECWA 2IHNA 5J0YA 3LZIA 2HHQA 1TFRA 4DSLA 2PFNA 3ZDEA 4DTNA 1X2IA 3MEGA 4KN7A 1N56A 3CQ8A 4ECYA 4CF2A 3AU2A 4ED1A 4UB2A 4XA5A 3V6KA 1HQEA 3RR8A 4DTUA 2ZJ8A 5E41A 4DMNA 2FBVA 4YFUA 3NF9A 1SKSA 3M8RA 1BQNA 3MR5A 1UT8A 1ZQRA 1T8EA 2FC0A 4IR1A 5J2DA 4QZFA 5BOLA 5DB7A 3HP6A 2X78A 1TKDA 2RPIA 4RW4A 4DU1A 1K1SA 4CJVA 4HYKA 1WN7A 3E01A 3K4GA 5CY4A 2IHMA 3KLFA 2BDPA 3PO5A 4KREA 3G6XA 4F3OA 3PMLA 1SZPA 3DOKA 2W9CA 1KFDA 3RWUA 2NRZA 2O4IA 4QAGA 5EWGA 1ZQKA 1U4BA 2UVWA 1ZBUA 5EU7A 3ZT0A 3K57A 1WSEA 5DQHA 3NE6A 4CIEA 5I3UA 1XSNA 4KLEA 2DFHA 3ZSVA 2XCAA 5KFNA 2J6SA 3QO9A 3SUQA 4DU3A 4O0IA 1PZNA 1ZQNA 4F5QA 3MBYA 4ED6A 2OA8A 2D0AA 2KFZA 3ULDA 1RBUA 4KLDA 5EWEA 4Y1CA 4B8CA 5IIMA 1WSJA 3AVCA 5DQGA 2P1JA 2HVHA 5J2HA 4C8LA 2YKMA 3ITHA 4DL5A 2W8KA 4I2AA 5J29A 4CGDA 1JKHA 3H7IA 4J9LA 2ASDA 3V9XA 3TAEA 1NKBA 1ZQAA 3K58A 3QEIA 4KB1A 1YT3A 4DLGA 1JXLA 3M8SA 3U6FA 1C0UA 3RMCA 4YXJA 1VSKA 4CJ4A 4CJLA 9ICWA 4I2QA 1TGOA 3T5LA 1BPBA 4O0JA 4AHSA 2E4LA 7ICPA 3DYAA 4FJIA 8ICLA 1KVBA 2I1QA 4DSEA 3K5NA 3H8JA 3DM2A 2RDIA 4CJSA 3JPTA 5HLFA 1RT7A 1NK5A 9ICJA 1IO2A 1ZQTA 5J0RA 1KLNA 4M9NA 3TR8A 3B0YA 2DPJA 1LAVA 3SCXA 1VSDA 3V72A 4KLLA 3JPNA 3P1GA 4NYNA 3C6TA 3KKRA 1ZBIA 4QZCA 1EKEA 2BCQA 5DK5A 2BGGA 4KKOA 4DTSA 4FBUA 3TANA 4G3IA 2YNHA 3K5MA 4CJPA 9ICVA 3SV3A 1B9FA 5KG1A 8ICTA 2O4GA 4JV2A 2FPMA 1TL3A 4Z4EA 4F4WA 8ICYA 4OLBA 2KN7A 2JZBB 3QLHA 4KPYA 4O5BA 1I39A 3SUPA 3O3FA 3V1QA 3P83D 1JLFA 4H8KA 5J0SA 4RQ4A 2R7YA 3L3UA 4FJ7A 4I2JA 4FCYA 2HB5A 3CM5A 3H4BA 3GV8B 1JLEA 3JPPA 3QESA 1X9SA 4HCCA 1U48A 4CHOA 4F3TA 1BCMA 3JPSA 2GV9A 4CE9A 2QK9A 2ZUBA 3DRSA 1U9LA 4O5EA 4QWAA 5J2EA 3AA4A 1MSWD 3MDAA 2PFPA 4J2AA 3LALA 1JXEA 5KFOA 3C5GA 3T5KA 9ICHA 3QIPA 4DFKA 3Q8MA 3HL8A 4CGGA 8ICPA 4IFYA 7ICEA 5IILA 1XC9A 4CK1A 1KFSA 2PYLA 4IR9A 1D8YA 1CZ9A 1BGXT 3ASMA 4MFFA 1NKEA 4M04A 1JL1A 4IG3A 2HHUA 2XRIA 4EP4A 3UQ2A 1TAQA 1CEZA 1SL2A 3PNCA 3OYJA 4M3RA 2DTUA 2FLLA 4FLYA 8ICIA 4I2FA 5FDLA 3SQ4A 3L2VA 4RPYA 4FW2A 1MU2A 3LPUA 9ICFA 3KK3A 2FMSA 4QZ9A 1FXXA 1L3UA 5IIIA 1W9HA 2P6RA 3DRRA 1RXVA 4AH9A 2JGUA 3UPQA 3HT3A 3AA3A 4CJ3A 2I9GA 3AVHA 1WSGA 4F4KA 3LDAA 3M9OB 5F9NA 3M9MB 4ECRA 4DL2A 1WCLA 4FO6A 2Y1IA 1S10A 3K2PA 4DTPA 4E7KA 2BGWA 4UAWA 1ZQBA 1BPXA 4YR2A 4DFMA 1O1WA 4RQ3A 1WAFA 4KLHA 2R8JA 4CJTA 5KFTA 3PY8A 3AVFA 4BDYA 2RN2A 4HTUA 3ISNC 2BCSA 1JLAA 3UXNA 2GWSA 3ZT2A 4CJEA 3RAQA 9ICSA 5J2MA 4L8RB 3LWMA 4DS4A 1TKTA 1KVCA 4IDKA 4O3OA 4CK3A 4HUGA 4CEOA 5DLGA 4EEYA 3DLBA 3QE9Y 4PQUA 1JLGA 1IG9A 2F1JA 4ED0A 4DFJA 4CHQA 4KLQA 3WNEA 3V9ZA 4FS1A 4IRKA 3O3HA 3IG1A 2YNGA 2QKKA 1RNHA 4KLUA 4ID1A 3T5HA 3QIOA 5IINA 4ECSA 3LWLA 8ICNA 4KV8A 1C0TA 1J5OA 3OYBA 1ZJNA 3V9SA 3C2LA 2H5XA 3RJKA 1RDBA 4CGIA 4JUZA 2WTFA 3OJSA 4FXDA 5HBMA 4M42A 3HVTA 1ZQYA 4Z6EA 2VANA 4CEFA 1ZQLA 5T7BA 3PW2A 2QKBA 4GC7A 1FKPA 5KT4A 4YXMA 4JWMA 4X5VA 1T4GA 4I9QA 2IAJA 5DBAA 2FBYA 4DLEA 3AVJA 3DLEA 2PFQA 2XGQA 8ICRA 4NCAA 1JIHA 3IRXA 2VWJA 1KLMA 4E7IA 4B9NA 5IIKA 3BDPA 3WNHA 5KT6A 4FK4A 3I8DA 3I0RA 3ZT4A 4TUSA 4DO9A 3OHAA 3CFOA 4TSXA 1BPYA 4F4ZA 2BE2A 1DLOA 3MFIA 4DQIA 3HXMA 1TK0A 5HNKA 1GOBA 5L1IA 4QWEA 2G8FA 8ICCA 4ED2A 3F9KA 5DGBA 4ICLA 5J2JA 7ICOA 3EW9A 1IKVA 2W9MA 5KI6A 3KLHA 2B6AA 4B9TA 3TFRA 2AGQA 4N56A 1ZQZA 3KD1E 4MEXA 3AV9A 4FLZA 9ICQA 4EYIB 4FJ8A 3S3OA 3LK9A 4GVMA 4PPXA 4W5RA 1VK0A 3HYFA 1S77D 3VQ6A 5CYQA 3T5JA 4ED8A 1WSFA 3NH2A 4CF8A 3RB4A 4B9UA 1RDCA 1BI4A 2Q3SA 3S9HA 2W8LA 7ICQA 4C8NA 4F91B 5KFCA 4QZAA 4QZEA 4DTRA 3GQCA 5EOZA 4KLGA 1S9EA 3OS1A 4QWDA 4M3TA 3ZT1A 1L5UA 3KHGA 5C25A 5HMLA 1NOZA 2G8IA 1X1PA 1KCFA 5J2CA 1HYVA 4KMUA 5KRTA 4O3SA 3VQAA 4DTJA 1QQCA 2G8VA 4RNMA 3HX0A 1X9MA 2IDOA 2Z1GA 2F8TA 3WNGA 2B4JA 2DPIA 3T1AA 1RXWA 4KLOA 1RT3A 1KTQA 3HVRA 5HHHA 2F96A 1ZQOA 4M9JA 2KFNA 2R8IA 3AVBA 5KTQA 1VSLA 4JWNA 5J0QA 4FS2A 5KFPA 3LAMA 2DY4A 2ALZA 3TABA 4E7HA 4J2BA 2VWKA 4IFVA 2HMIA 1C1BA 4R8UB 1FKOA 5KFBA 3BQ2A 1NK0A 2OZSA 4IRCA 4DOBA 2ASJA 2QXFA 4DL6A 1T3NA 3SUNA 3RJHA 2X6SA 4XRHA 5DB8A 5EWFA 1D5AA 1CLQA 3T3FA 3K75D 4KLSA 4R5PA 1SKRA 7ICFA 5CZ2A 5L1LA 4TQSA 1C1AA 3SPZA 4EZ9A 4M45A 3DRPA 1IXRA 5J2FA 7ICNA 4ECUA 4B8AB 3S3MA 2F1HA 3AVKA 4CK2A 3MFHA 1Y88A 2ZJ5A 1JL2A 4M2YA 3SJJA 4ZHRA 1GOAA 3FDSA 4KTQA 4CCHA 4RQ1A 1QHTA 1SKWA 4E1NA 9ICMA 4OKEA 1R0AA 4F2SA 4LZDA 3H8SA 4GXIA 3Q8RB 1TV9A 3UXOA 3SI8A 2G8HA 4QCLA 2F1IA 4I28A 5KT5A 4O55A 3NDKA 3PX4A 2AGPA 4O5CA 3P5JA 4RG8A 4FLWA 3RAXA 1RDDA 1ZBLA 1RT6A 3AA2A 1TVRA 1B9DA 8ICHA 4QZHA 1RT4A 2WONA 1ZETA 2MUTB 4DEZA 1EXQA 9ICUA 5J1EA 4PWDA 3MABA 4UQGA 3NTUA 3VQPA 1S1TA 3H4DA 2P6UA 9ICXA 4RW9A 4PY5A 8ICVA 2G8UA 2VA3A 4NCGA 3M8PA 3KLIA 1HNVA 4CESA 4DSJA 7ICRA 3JPQA 5JS2A 5DDMA 4M6WB 1S6QA 3AA5X 4YFKA 4PHEA 4RQ8A 3DLHA 4IQWA 3JPOA 1UAXA 3OY9A 3AVLA 5FROA 3TAQA 4MF2A 3RB0A 4EBCA 4Z6CA 4JV1A 3TWHA 2ASLA 1KVAA 2RKIA 3RH4A 3N97B 5KG2A 9ICOA 1VSFA 4NYFA 3M9NB 1RDAA 4M41A 4FJXA 4NXZA 3VQ5A 3RR7A 5KGWA 1RBRA 1RBVA 3GILA 3VQCA 4KLFA 3LP2A 3HP9A 1HJPA 3ZDBA 3V6HA 1RTHA 1N6QA 1LWCA 1IM4A 1S76D 1RTIA 3OYEA 2ZUCA 4DS5A 1Z25A 4C8MA 4F93B 4XUSA 4KHNA 1GOCA 4YNQA 2D5RA 3HM9A 3V9WA 4CEAA 4TQRA 5CB1A 3DOLA 3GDXA 1SL1A 4CEBA 4DG1A 4J9SA 3GIJA 1ZQHA 7ICTA 5K14A 4FJ5A 2OZMA 1WLJA 3VN5A 3RJFA 3OS2A 1ZJMA 5DB6A 5JS1A 2HW3A 2I5JA 5DG7A 4Z6FA 2W9AA 4Z0UA 3MXJA 4CJFA 2ZD1A 3KLEA 4CHPA 4Q43A 4F5PA 1VSEA 4ZTFA 2V4RA 2IGIA 3F73A 4CJKA 8ICGA 3K59A 9ICEA 5FRMA 1TAUA 8ICJA 5CZ1A 5HRRA 2HHWA 2WOMA 4KTWA 4JRPA 4RU9A 4Z4CA 4LVSA 1NK6A 4KB0A 1BIZA 5KFSA 4HCBA 5L9XA 3ZDDA 4CGFA 5KFWA 3S3NA 1REVA 4QW8A 4BXOA 8ICUA 3NF6A 1SL0A 1BVSA 2HNYA 4IG0A 4RZRA 4MQ3A 4FM2A 4Z4GA 4ELUA 3VQ7A 4O3PA 3TAPA 4ZH4A 1S1XA 4ELVA 4PUOA 4O4GA 2C22A 3V9UA 2RF2A 3PW0A 4I9LA 2A1JB 4NLKA 5D46A 4QWBA 4RW8A 3RMDA 3OYIA 4LSNA 4E0DA 4KHYA 4DSIA 3PX0A 3QEAZ 3ZSRA 1LW2A 3SV4A 1ZQFA 3FFIA 3PUFA 2F8SA 3AO2A 4BDPA 4CJQA 1Z00A 3TQ1A 2BHNA 2IMWP 4BDZA 1WAJA 5KT2A 4CGHA 7ICKA 3VQDA 4TURA 5KRSA 4BE1A 4J9MA 1HNIA 4CGJA 4M3YA 4CJ5A 3L2WA 1XHZA 7ICHA 4AHTA 1J9AA 5CP2A 4Z6DA 4DL3A 4CEQA 1ASVA 3RH5A 4RQ2A 9ICCA 4KHSA 3MEDA 1XSLA 5TZVA 4FLTA 2HHXA 4OVLA 1NJZA 4HHTA 3LP3A 4BWMA 2JEGA 3AO1A 4B9SA 3DLRA 1TKZA 1TVAA 3LAKA 4F50A 4FLUA 2EX3A 4CIFA 5J0XA 4DWIA 2OPSA 3L2RA 1S1VA 1S9FA 4ELTA 2HNZA 3CFRA 1XS9D 2IA6A 2MAXA 1QTMA 4BE2A 3V7KA 1CXUA 4DTOA 1WNSA 4BACA 3G0ZA 1JMSA 1C7YA 1WSHA 3OYKA 1MC8A 1JN3A 1EX4A 3QZ8A 3PX6A 4ECQA 5J2QA 2UVVA 2UVUA 1Y97A 1IKYA 4W5OA 4KHWA 4LY7A 1S1UA 4I2EA 1F21A 1SUQA 3O4QA 2J6TA 4CEZA 8ICKA 2FLPA 4J9KA 1NOMA 4DSKA 2D0CA 1QSYA 4ECXA 5KFQA 2DFFA 5DBCA 3NGIA 3RH6A 4FW1A 3NH0A 3JYTA 1S0MA 3IS9A 5HRPA 4N47A 2YV0X 7ICSA 4K4IA 3V81A 4Q44A 1TKXA 4TUQA 4K8ZA 4JLHA 1NK7A 2IOCA 2BCUA 3V7LA 3MXMA 2LSNA 4UBBA 1NK9A 4NCBA 1RCHA 4XIUA 4J9RA 1YTAA 4M47A 5J2BA 4E7JA 4UB4A 5KFUA 3THVA 3H08A 3VA3A 3RB6A 5KFGA 1CXQA 4F4YA 2FPLA 4K4GA 3KJVA 3AVMA 5DMRA 1L3TA 4IQTA 3RTVA 3C6UA 4QZIA 4DU4A 3HJFA 1L3VA 4MEYA 4AHCA 4YD2A 4GXKA 1ZQPA 8ICEA 2AGOA 4JS4A 3SPYA 4M6WA 2XCPA 3V1RA 4YMNA 4GLXA 2ATQA 3EYZA 3NH1A 4RT2A 3BJYA 4JK1A 2GBZA 1C0MA 2YNFA 1A5WA 1UT5A 5KG0A 1ZQDA 3Q8QB 1TV6A 3HK2A 2PYJA 4RQ6A 1JLCA 3GFKB 4LH5A 3RJEA 4UAYA 4K8XA 3RJJA 9ICNA 1XU4A 5KT7A 5KFHA 1S9GA 3QEPA 2W9CB 3TAFA 4DQSA 4YMMA 2ISPA 2Z1IA 8ICFA 3B6PA 3O3GA 2XY5A 4YG2A 2E6MA 3ZSXA 1IKXA 3PO4A 4GMJB 4OKKA 4K4HA 1HYSA 1S1WA 3E2EA 5C5JA 1B92A 1ASWA 3C1ZA 4DQRA 2C2DA 7ICJA 1HYZA 3SQ2A 3KK2A 4O3NA 1QSLA 9ICIA 3OVNA 5HP4A 2R8KA 1XSPA 3A2FA 5J2KA 4M3UA 2D0BA 3ZSZA 3BQ1A 4FJMA 4KI6A 5J0WA 5KGXA 1TK8A 4QZBA 1TK5A 2P5OA 3KTQA 4P4OA 5DKWA 1ZQXA 3AVIA 3UQ0A 1N48A 1ZBHA 2P66A 5SWMA 4P4PA 1X9WA 2FLNA 2KZZA 3C1YA 4DSFA 4YR3A 9ICGA 3ZD9A 1A77A 4DTMA 3TAGA 4UBCA 1QE1A 3EPIA 5KFMA 3GIMA 2V9WA 3VQEA 4FZXC 1U49A 5F9LA 3DLGA 2IS3A 3RJIA 4KAZA 2BCVA 3PW7A 4M0AA 4FVMA 4E1MA 4GXJA 9ICTA 1KDHA 5HHIA 4FM1A 3L3VA 1QS4A 3SI6A 5CWRA 1XI1A 2JZBA 1K6YA 4IQVA 2LYHA 3SNNA 1EXNA 4NLGA 3ORYA 3RMBA 4KHQA 3ISCA 2NUBA 1D9FA 1Q9YA 2VA8A 4TUPA 4OLAA 4DOCA 3ETLA 4R64A 5CYMA 4RQ7A 4CHZA 3OYFA 1T05A 4LD0A 4FJJA 4OPJA 3HPGA 4ECZA 4AILC 5KFFA 2BANA 1BPDA 2BQRA 5CJ7A 4MFCA 3DLKA 3V6DA 3NHGA 4WE1A 1LB2B 4F2RA 1RT2A 1IKWA 1FK9A 3C5FA 3OSNA 2ZTDA 1YVUA 4H4OA 2W9BB 4F5NA 2X74A 2R8GA 3OYLA 1HUOA 2M9NA 3ZD8A 4I7FA 3ZSQA 2NRTA 1U47A 3KHLA 4N5SA 9ICLA 1AROP 1JLBA 5IIJA 3TAMA 1B22A 5J2PA 1LWFA 3IAYA 4HVJA 2NRXA 3EZ5A 1ZQMA 2FBXA 3CYMA 5KG7A 1S6PA 3ISBA 4B08A 4YMOA 2OPRA 4E3SA 4H4MA 3U3YA 1ZQJA 2A1RA 4F8RA 2NRWA 3HPOA 1ZQVA 4M3XA 1VSJA 3EY1A 4FYDA 2ISOA 3ZT3A 4N41A 2VG6A 3MR3A 3PV8A 2G8KA 2B5JA 1VSMA 4JRQA 3O4NA 4YD1A 2R8HA 5L1JA 1W0HA 4E7LA 1DOQA 4Y1DA 4O44A 3AUOA 5KG5A 1ZQSA 3CG7A 2VA2A 2ZQBA 5HRSA 3EWAA 1ZQQA 4CIGA 4J9OA 2AQ0A 3Q8SB 3SUOA 1U04A 3EPGA 4UB3A 5HRNA 3D45A 1J54A 7ICIA 3AVAA 4CERA 4ECVA 5DG8A 3LANA 3MXIA 3QINA 1ZBFA 4LH4A 1A5XA 2HNDA 4Z4FA 5KFJA 3OS0A 3Q8LA 3JPRA 4RQ5A 5KFXA 7ICGA 3K5LA 4DOAA 5J0PA 1NK4A 2AJQA 3U3GA 4EBDA 2HHTA 1VSHA 3Q8PB 3B0XA 2ITGA 3OGUA 1C1CA 5KFVA 3PVXA 1UA0A 4JS5A 5KG3A 3AO3A 3VQ4A 5C24A 5KFKA 3ZCMA 4CF9A 1D8LA 1YTUA 3SZ2A 4AHVA 1Q8IA 3V7JA 1EP4A 2XY7A 4KN4A 4GC6A 4R65A 3RB3A 1BPZA 2AQ4A 8ICQA 2ZTCA 4PHAA 2VG7A 3OYGA 3TARA 4FJNA 5DLFA 1LWEA 4BE0A 1ASUA 2EHGA 4OKJA 4B9VA 7ICMA 3QEBZ 3IHQB 4EBEA 2FPKA 4FJGA 1RT1A 3QEXA 2XY8A 3KHRA 3ISDA 2IC3A 3G10A 4NLZA 5L1KA 4MFBA 1DTTA 5CHGA 1CZBA 1RBSA 3MR6A 2PY5A 1H38A 3VQBA 4Z4HA 1K1QA 1VRUA 4QZ8A 1ZQCA 4J9QA 4KI4A 5D49A 3HPHA 4YR0A 2ETJA 5KFDA 2PFOA 1HQUA 9ICPA 4O5KA 2UVRA 3RJGA 3DMJA 4OGCA 3PR5B 4IBNA 3OYMA 3CFPA 2P51A 1T7PA 4QOZB 5D4BA 4DF4A 3TFSA 4CHYA 4YQWA 1QSSA 5KFRA 4C8KA 2JLEA 1RTJA 4M3WA 4QWCA 3N4MB 3QETA 3OYDA 4RNOA 3NF8A 3V1OA 3UXPA 3AO4A 4W5QA 4YN4A 4M9GA 1BQMA 1BISA 1Z3EB 4FJ9A 2BPGA 3KIOA 5KFZA 1BI4B 1KRPA 5HMMA 4QZGA 4I2IA 4W5NA 4M9HA 4RPXA 3C23A 4DQPA 4I27A 4RW6A 1S0VA 4Q8FA 4AHRA 4CJUA 1S0OA 4F5RA 3QEWA 1A76A 4B9LA 3OHBA 3AO5A 4NM2A 2Z1JA 2Q0ZX 3V6JA 5J0UA 3AVNA 2FMQA 2AU0A 4FM0A 3HW8A 4EP5A 2XO7A 2JEIA 3AU6A 2RDJA 2ZTEA 2B21A 4MF8A 1BHLA 3PMNA 3OSPA 5KG4A 1ZQEA 2Z1HA 3GIIA 5D3GA 1KEJA 2HHVA 3C21A 2PI4A 5SZTA 1RT5A 3B6OA 4OJRA 1WCNA 2BPFA 8ICWA 4R8UA 4IRDA 4EYHB 4DTXA 4J9NA 2C28A 2W9BA 3I0SA 3QERA 5JUMA 8ICAA 3NFAA 3NF7A 3C2KA 3K5OA 4RUCA 1J53A 7ICUA 4I2DA 8ICZA 2KQ2A 3NBPA 1JXBA 5KG6A 1D9DA 4UB1A 4LZGA 2KW4A 3MECA 4RT3A 1MQ2A 3NGYA 4FJHA 3C2MA 3M8QA 4I2BA 1ZQUA 3IM1A 2FBTA 4KRFA 1A5VA 3MAQA 4BGDA 5J0TA 4FZZA 1C6VA 4UB5A 4DL4A 5I42A 3MEEA 3OJUA 5BPCA 4I2CA 2BQUA 4AHUA 1NJYA 4RW7A 4UAZA 4OPKA 2YKNA 4PA1A 5FRNA 3MGHA 4KO0A 3H8WA 4HUEA 1NJXA 4M9LA 4E19A 4QW9A 5BOMA 3KK1A 4E89A 2OPPA 2ZJAA 2KTQA 4CF1A 7ICVA 1RZTA 4G1QA 4IKFA 3DI6A 5HP1A 4FJKA 4FBTA 3OYAA 4R66A 4O9MA 2ZE2A 3LPTA 4NY8A 4CFBA 2YHBA 4DQQA 1VRTA 3VQQA 1JLQA 2MUTA 5KFAA 3KLGA 2C2EA 2GUIA 4FK2A 5IIOA 3LP0A 3SYZA 3KHHA 2KZ3A 3VA0A 4R63A 1XO1A 3JSMA 3BQ0A 5KFLA 4N76A 9ICAA 3ALYA 3C95A 1MQ3A 3ZSYA 4HUFA 2BR0A 3MGIA 5DQIA 4I29A 8ICSA 1Q9XA 4RUAA 4Q45A 4RQ0A 4KLTA 4J2EA 4FLVA 4O3QA 4W5TA 4FJLA 1DTQA 4CJWA 3GIKA 2BPCA 4ID5A
chains in the Genus database with same CATH superfamily
2GEMA 3VQ8A 2V69A 4LF4F 1M5SA 2VV5A 5J2GA 1VQ5S 2X3DA 4ZPDA 1LW0A 2WBRA 4I2PA 1YRUA 4C3LA 4WWSA 4PGYA 4B3OA 2PZSA 4RNHA 2DNPA 2M9KA 3IMQJ 4BWJA 2EAPA 4KTZA 1O13A 1JNZB 4PH5A 3LP2B 1FJGJ 2DGSA 4DFPA 3L2UA 3C8YA 2L3MA 3R6LB 1N2XA 2V34A 2W7OA 2CNNB 3BUZB 4FK0A 1LWCB 2F5GA 3VQ9A 4XAKA 2EFPA 3IAM9 3KKSA 5JU5A 2KE7A 1Y0HA 4UUWA 3BSNA 4JV5J 5EN1A 1S4FA 3CNHA 1NBWA 1G7CB 2GFFA 5AJ3J 2WTUA 1KEKA 2KSOB 2OKQA 3MN7A 1U1OA 3DOLB 2ZIUB 2DNKA 1NJWA 1VHFA 2E9ZA 2ZGZA 1IR1A 3WKBA 3ETOA 3Q22A 1V9OA 1AFIA 5AM3A 2QMXA 1S0NA 2CQIA 4B3MK 5DM6L 5B0DA 2EANA 4KLMA 3BS9A 3P49B 1QZ6A 1U45A 3KDOA 4TY8B 4ED7A 3EMTA 3Q8KA 1XIQA 4FZYA 4MT1A 4KLJA 1GNKA 5L9NA 1T9WA 2DGQA 2I5JB 4DJBA 5G0RA 3OYCA 1P6TA 1WSIA 4LF7F 3KLEB 4IQMA 3C65A 4PHDA 3CDWA 3MM7A 3D2FB 3I55N 9ICBA 4QYRA 4ES2A 5HR6A 5AQQA 2GAHC 4C4SA 1T3VA 3HKZD 4CFCA 1DGSA 2HWTA 2YNIA 2MGZA 2VBWA 2WOMB 3FE1A 2I1RA 4DV7K 4HACB 3NVYA 2MKSA 2ZOMA 1CQMA 1VJWA 3A8EA 3OL9A 1HFEL 4OZ0A 1TUUA 4YCXA 2DH8A 3EWGA 3FEXB 4ZTJA 8ICBA 1URNA 2V4QA 2AJ0A 2B7CB 1W7WA 1VQYA 4I0WA 2KYZA 4NXMJ 2OPQA 2QL5B 4RW8B 2ZUDA 1N32J 1X5TA 4WZQA 2R7XA 4CHNA 3LVVA 4YHHK 2CQ4A 4J2DA 3ZDCA 3LDOA 2KJVA 1RQLA 2HF3A 4YVZA 1QZ5A 4FNHA 2BKEA 3MPWA 1ZQIA 3MMAB 4KITB 2G4BA 1KD1O 2OD4A 1L3SA 5KFEA 2AT1B 4I2GA 2HDOA 2ROPA 1OY6A 1HJRA 4H0XB 3PKMA 3LGMA 3GV7B 3EUNA 4AXJA 2AP6A 1GT8A 3PW5A 1ZAVA 3CW2C 4KBOA 1VC5A 3LP1A 2MQPA 1HWUA 3VQTA 4M8LA 4PGXA 2OPSB 4OZJA 3R5AA 5KT3A 1Q82T 1V85A 2XG8A 1AXQA 3QT5A 1HLUA 1WG4A 4CF0A 4FLXA 2R42A 2VG5A 3WK9A 2HG4A 4QIFA 2Y1JA 5J2QB 2CJBA 3UVJA 5HROA 2DRAA 1FESA 2CDRB 3RMAA 2HFOA 5ADXH 1CUKA 5IM0B 1S1UB 3W5YA 1SUQB 1WBDA 1LKYB 1NSAA 5J0YA 4OHZA 3M30A 3B4MA 4PYAA 2Y1RI 1HR0K 1TMMA 3H1QA 3L3FX 3H0RB 1NPPA 2PFNA 4DTNA 5JVHL 2IMOA 1GXTA 3R7BB 1N56A 4QR2A 5LJWA 1FFWB 3CQ8A 1HLWA 3M8WA 3AU2A 4I6WA 4UB2A 2R7SA 3RR8A 3NMUA 4DTUA 2AX0A 3NGRA 3NF9A 5FPMA 3UD4P 4MKYA 2Y9UA 3M8RA 1H2TZ 2GIRA 2FJEB 3GYXB 3QPIA 1XMOJ 1IIPA 5J2DA 3KJVB 3H2VE 3BBFA 5BOLA 3TSQA 3CO9A 4ILMA 1MWZA 3ET6A 3P96A 4HKQA 1TKDA 4TXSA 5A8KA 5DM7Q 4DU1A 4OI4A 4FP9A 3O9QA 1GMVA 4DR2J 2KL8A 5AZJA 4JI2F 5GADI 4RJVA 3K4GA 1Q1KA 3IBFB 3UR0A 2OSRA 3CF5L 2D4WA 1LK5A 3G4SN 1YQHA 2QRRA 2YNFB 3C0BA 4CLSA 2NPFA 2YKAA 1U2VA 3QRQA 1GLLO 3M1VB 2D1CA 1AFJA 1UZDA 4EHUA 2W9CA 2GW8A 3J7ZO 1UJ5A 4Y28C 3CJ1A 2O4IA 4DUZF 3U8XA 4OHVA 2GC8A 1ZQKA 3G82B 3POTA 2UVWA 3P8BB 5EU7A 3ZETB 4OJ6A 5F8NA 2DNOA 2CXEA 4DV5F 1VQON 1XSNA 4KLEA 1UVNA 4FOEA 1Q5YA 5KFNA 3I4HX 2N4CA 4PHTX 4DU3A 4Y2QA 4F5QA 2QWNA 1IKXB 2OA8A 2F2AB 3GSIA 2D0AA 2PFUA 1WSJA 5IT9Y 5DZ7A 1J5EJ 4HL9A 2F9TA 5A2QU 3GFHA 1WOOA 3WUHA 5J29A 2R3VA 1DAXA 3V9XA 1BA1A 2VDHA 4KB1A 1ZOLA 2LBOA 3M8SA 2F7VA 3BSOA 1NSKL 2ZNYA 1VSKA 3RMCA 4QJVA 3JS6A 4Y2AA 3HULA 3TKAA 2DR8A 7ICPA 4XH1A 8ICLA 2I6WA 2JDJA 4EX7A 3DM2A 3CDAA 3JPTA 3DNCA 5HLFA 4LF1A 9ICJA 3CIPA 1IO2A 1VQ7N 4RWXA 3ZZPA 1RHUB 2DKZA 1KLNA 3KMQA 1K73T 1BO5O 2AHOB 2FE9A 3P45B 4ZVHA 1OVYA 2VQEJ 1VSDA 3V72A 2WW8A 8AT1B 1FEZA 2ZM6K 2EPIA 4K4VA 3CTRA 2CRLA 4LQ9A 3L7OA 4KKOA 4FBUA 3TANA 2LYAA 4FYWB 4CJPA 2OH2A 9ICVA 3SV3A 3P3DA 1CJVA 2H5IB 3AODA 3BREA 1N8RO 1B64A 2ZNZA 2MHNA 1FFUA 3KJFB 4Z4EA 2D3OR 8ICYA 2JZBB 2JHDA 2HF4A 4NOHA 4KBIA 1FFVA 3O3FA 1TL7B 3UI3A 3OLBA 3P83D 2R7YA 5LMUJ 3L3UA 4WF9L 4I2JA 2HQDA 2XI3A 3IR7B 4NLDA 4OYXA 2F76X 5CYMB 3GV8B 2FSNA 5HVFA 2K1RA 3BH6B 3TJAA 1IR2A 1IG8A 2HS3A 3DDNA 2Z57B 3UCGA 1IR0A 4TVAB 1BCMA 4CE9A 3MMBA 5ALNA 4ED4A 2BBEA 1WTFA 3EL2A 2WVDA 2HMIB 4O5EA 4QWAA 1CS4B 3AA4A 1MSWD 5ALVA 3D0GE 3TX0A 2LEBA 4WE1B 1RT2B 1KXPA 2GIFA 3T5KA 9ICHA 3QIPA 4LJMA 4DFKA 4XPEA 2QARB 3FZHA 1HNWF 4CGGA 4I7FB 4DFDA 1IBLK 5D4NA 1RXOB 2VFSA 2O8EB 1XC9A 4A61A 5AXNA 2ZJQL 1D8YA 1CZ9A 1JLBB 1BGXT 3TAMB 3KZIU 1N33K 2EAOA 2DNHA 1LKZA 2XRIA 2KG1A 3VR1A 1CEZA 5I9EB 2ZF5O 4M3RA 2FHJA 3L2VA 4RPYA 5A2QO 2GAGC 2B4OA 2QG9B 4FW2A 3GR0A 3QNWB 1FRJA 9ICFA 3R9KA 5IIIA 1W9HA 2P6RA 3KKAA 1RXVA 3EX7B 4AH9A 3SEIA 1MN8A 3I82A 3BSCA 2DRDA 2CQGA 3M9OB 2D7SA 4ECRA 4DL2A 3RUBL 4FO6A 2Y1IA 1S10A 3K2PA 4JN4A 4JI4K 3FNNA 3OXGA 3IWLA 1FX4A 3PJ9A 4Y2IA 3DN9A 2YWEA 4DV0K 3AVFA 3MUTP 3C7NA 4HTUA 1VHXA 2C1EB 1H73A 3B9JA 3TJ8A 4PRFA 1WHWA 3O6QA 4CJEA 9ICSA 5J2MA 2VBXA 4L8RB 1NZ8A 1V5VA 4DS4A 3VGKA 3E66A 1Q7YO 3HHKA 2GJFA 2QT7A 1LVHA 4O3OA 1U2RA 4KC5A 3BZKA 2EDUA 5JTIA 1ZM3A 1WC5A 4NCGB 4B3RF 4IOBA 4ID8A 4CHQA 4AL6A 4CTAB 4FS1A 3EDRB 2YX8A 4HT7A 3HDSA 4ID1A 4ECSA 4U7UD 4UASA 4LFBK 5I3PA 8ICNA 2VPXB 4MH8A 4KV8A 3SJHA 1C0TA 2H5XA 2HBZB 4H0TB 4CGIA 4ANCA 3IRUA 3MM5A 1BMQB 2DNZA 2V94A 2CZ9A 3OUYB 1Y5LB 4DUYK 4D3GA 5T7BA 2WSCC 4USJC 4FYXB 4R0EA 4JWMA 1X4CA 4B3TF 4I9QA 4FZNA 1E6YB 1ZH5A 3FKBA 3UKRB 3E58A 4OO1J 3PACA 3DLEA 4NYOA 2PFQA 2CPYA 1URJA 4K7QA 1KLMA 5IIKA 4FK4A 3TVZA 2HURA 4TSXA 1F6TA 3CFOA 3NGSA 2RRDA 2UV8A 4Z37A 2MXYA 2YWFA 4M63C 2B51A 4DQIA 3QWUA 1VBZA 4J03A 3A1YG 1G99A 2QV6A 5HNKA 2HGMA 4QWEA 1WF2A 2G8FA 3F9KA 1JCEA 5DGBA 1VRUB 3HHEA 2P9NB 3W9JA 5J2JA 4P6QA 1QQ5A 1TFYA 3IP4B 4F7VA 4NEZA 1KNZA 1T9XA 4YOEA 1ZQZA 5G5HA 2M88A 4YDDB 1NMNA 5IQQA 4PEOA 1ZD3A 4W5RA 2DNGA 1I51B 4M7XA 4JYAF 4BQLA 3T5JA 1WSFA 3NH2A 2XTJP 5JRTA 1BWEA 2Q3SA 3S9HA 3M7DA 9ATCB 2L9WA 4C8NA 5KFCA 5ETPA 1FCAA 3M6ZA 2FJVA 4DTRA 4DV6J 4YB6A 2ZC3A 5B09A 1K44A 1HWLA 1S9EA 5A8RA 2OMOA 2D6FC 4M3TA 1X31C 3AN1A 2MU2A 3Q23A 3KHGA 1C2PA 1NOZA 2GQCA 4O8KA 4RW6B 4CBWA 2JJ4D 1KL9A 2WAQC 3MPUB 4FF1A 4NL9A 4ZVUB 2VWBA 4P0PA 3TACB 1X9MA 1TUYA 2F8TA 1FIQA 3CMES 4OPAA 1KTQA 3D1QA 1ZD2P 2F96A 1ZQOA 2DXDA 2YQ3A 3ZZUA 3K9KA 1V38A 1ZTTA 4QU6A 3AVBA 1P8GA 1DQ9A 5AQWA 2HKEA 1MA9B 1VSLA 4JWNA 4H5NA 2UUCK 5KFPA 3LAMA 4CRXA 3QGGA 1H74A 1B4SA 4IZ9A 4O0NA 1C1BA 4NXNF 5GAGP 3PSTA 3QATA 5D4PA 1SJQA 4JEPA 3UM9A 4GO5X 1DBDA 2QXFA 2J9DE 2NREA 3B6BA 4B3MJ 2ALYB 5DB8A 5B5EU 1DGKN 5EWFA 1D5AA 4CF5A 4PJ0U 2W41A 1CLQA 3U1NA 3GP9A 4KLSA 2OP5A 2Q2RA 3GYGA 1FVSA 2ZOGA 4EZ9A 5J2FA 4GNIA 2WB1F 3S3MA 2F1HA 4CLFA 4CK2A 2CQHA 3JXOA 4CD3A 4Y0WA 4ZHRA 2BUNA 3MM8B 1O08A 4C4RA 1QHTA 4DV2J 1W2IA 2R7TA 3NVZA 4LZDA 1GX5A 4NRTA 2KKVA 3Q8RB 3R5GA 1ZXOA 5AKJA 3SI8A 4DV7J 2XZTB 4ZPVR 3I28A 3KK1B 2OPPB 4ZJQA 3GSDA 3VWSA 5AKEA 4O5CA 5HN0A 3RAXA 1TU0B 1ZBLA 1VHIA 2H3GX 4CO4A 1TVRA 4BHQA 2WFBA 5GIOA 1I1GA 1RT4A 4LIWA 5FPNA 2MUTB 1EJ7L 3HZEA 1XO0A 1MMLA 3DGPB 3QAEA 4WKRA 3LP0B 2RH3A 2P6UA 1VR6A 8ICVA 4YHHJ 4DSJA 4PYDA 7ICRA 4M6WB 3AA5X 3W2VA 2QW9A 2D1KA 4X65K 4IQWA 1FW6A 1U0HA 3C14A 3JPOA 3OY9A 5M1KA 3AVLA 4UAUA 4EBCA 5I3QA 1KVAA 3CCSS 3RH4A 1YITN 1FDAA 2GQ2A 9ICOA 1TUVA 3M9NB 2UUBF 1RDAA 3OR2B 2IVFB 1F60B 5KGWA 2ITMA 4J37A 1RBVA 4KAIA 3W8PA 4AL7A 4MHVA 2X1GA 1RTHA 2D3O1 1TL1B 2FZCB 2Q97A 1NUEA 1HKCA 1Z25A 4C8MA 4XUSA 1TZ0A 5AQYA 4IOAL 1Z6RA 4G65A 3HM9A 3MPYA 3V9WA 5CB1A 3GDXA 1QTNB 1BLUA 1SL1A 3KK2B 4IJAA 2ASOA 2L41A 1NGFA 4USAA 2RD5C 3MUMP 4DQ8A 4KB7A 5K14A 4FJ5A 3Q24A 2OZMA 1VQ9S 1K9MT 2ZWPA 1T03B 2ZH1A 1HR0J 5ALQA 3WQUA 4I69A 1VQLN 5E79U 2UU9F 1VJ5A 3CC4S 4Z0UA 3P5TL 4FF2A 4CJFA 1UCNA 2ZD1A 5AQSA 1D8BA 2XI9A 2XMAA 1SXLA 4DU8A 2QWOA 4BC7A 4F5PA 2KH9A 8ICGA 9ICEA 2BDUA 1T9TA 1TAUA 2K8GA 3NMAA 4Y2MA 1YZ6A 8ICJA 2BE9B 2X51A 2DH7A 5LMNJ 3EZWA 5CZ1A 3X3UA 5HRRA 1W2BM 4NLYA 2JC1A 4LVSA 4P2SA 4XTTA 3B8HA 4KB0A 1UWBB 5KFSA 5L9XA 1B0TA 3NF6A 2HRUA 3FZLA 4IG0A 4RZRA 4Z4GA 3VQ7A 4O3PA 3D2NA 5GAHU 2LDYA 1QAJA 4O4GA 2E1AA 3V9UA 4IC9A 3PW0A 2A1JB 2Q3PA 2MKYA 3FZMA 2OD6A 3BGRB 5IXUA 4LSNA 4E0DA 2RHQB 4PXEA 2QLTA 4KR0B 4DOZA 1NRKA 3QUBA 4KHYA 3PX0A 3EXYA 3ZSRA 1LW2A 3SV4A 5M1FA 1T05B 3AO2A 4CJQA 4ZVSB 4BLGA 1RACB 1SV5B 3BEXA 4JP8A 4CGHA 7ICKA 1SJFA 4TURA 3HSJA 4WPAA 4J9MA 1HNIA 5KRSA 7ICHA 1H98A 4AHTA 2O01C 2O8DA 4DCHA 2XNQA 1ASVA 3A5LC 3RH5A 2D9PA 5BYQA 3M2VA 3MEDA 1XSLA 3L4BC 5TZVA 2NUUG 1CG2A 1U7LA 3DXBA 3HOSA 4DHVA 2JEGA 2J5AA 3AO1A 3DLRA 1TKZA 3C15A 3LAKA 5SUHA 1F5BA 4BS2A 4FLUA 3SCIE 3G2XA 4KFBB 4CIFA 1FD2A 2QLXA 4X2BA 2ZBRA 1HPZB 4ZP9A 3CFRA 3U02A 2OTJN 4BE2A 5AK5A 3RG6A 3TZXA 1F2GA 3LA0A 4KHRA 1WSHA 3QZ8A 1CJUB 1HMVB 1WUDA 2UVUA 3MM6B 1IKYA 2ZHAA 4CLKA 2G9OA 1GFWB 4USMA 5AKLA 4I2EA 3D7EO 2ZM6J 2FLPA 2Y0SD 5DZ6A 3W5ZA 3CDUA 3ISZA 2E1ZA 2YPZA 4X4RA 5H1SQ 4ECXA 4J8FA 2LA6A 2F3NA 4LRAA 4FWMA 4K0KK 3RH6A 5CQGA 4FW1A 3UR3C 2BJ9A 3IS9A 4ZVGA 4CZGA 4X62F 1M90O 3ILLA 3OTOF 2XSFA 2VJVA 1V3ZA 3QBCA 4WCEL 2A2CA 4JLHA 1NK7A 2FJAB 2G2OA 1RAAB 5DDOC 1LNQA 4XIUA 2OANA 1YTAA 3B8AX 3JQKA 3D6JA 5J2BA 5KFUA 3THVA 4IH7A 4JI2K 3MEGB 3SCKE 4LFCF 1RJJA 1SJ4P 3G6EN 3KZXA 1HQEB 3OTEA 3M2UA 2QSFA 3C6UA 2J9EA 2HWHA 1L3VA 4MKBA 3N6LA 4NZ7A 4GXKA 3R9PA 2CKWA 4C0ZA 2HQ3A 2AGOA 1HI1A 4DUZK 5GADP 4YMEA 4YMNA 3IWNC 3U26A 3KOOA 4AP9A 1Q8KA 3GE9A 4K2XA 4DV5K 3KG1A 4I68A 1N5SA 1C0MA 4AYBF 2ES6A 1YJ7A 1UT5A 3O1WA 1TR0A 2VKQA 5AI8A 5F0XA 3HK2A 4WFNQ 1JLCA 2IBOA 4RO0A 2FC9A 2Z7JA 3SEOA 3MF5A 1PBAA 4CLTA 2F44A 4QS9A 1S6OA 1HKGA 1WC3A 3CXCM 3QEPA 1COKA 1N33J 4YMMA 3B6PA 2XY5A 3LDNA 3ZSXA 4OI3A 2WB1D 3UN3A 2CVIA 5ALHA 3R5CA 4K4HA 3JAMO 4RUBA 4E8UA 5F8MA 5ALTA 1KONA 1X4FA 3UN2A 4LF5F 2AXTU 1B92A 1TP7A 4DQRA 3BM7A 2HRYA 1HYZA 3C16A 1OYDA 1PYTA 2R8KA 2C2MB 3A2FA 3BGOP 1OH6A 2HSZA 1G1XA 2UUWA 5J0WA 5CABA 1KAXA 4JI4J 2G0AA 4JI1K 4QZBA 4DL0C 5AQMA 5HMZA 2KJWA 3DXSX 3IR5B 4P4OA 3LO3A 2U1AA 2E5GA 4GMKA 4DV0J 2IA0A 1WKKA 3THWA 2HEKA 1N48A 2FLNA 2KZZA 3C1YA 2P9EA 2F4VK 2MSTA 1A77A 2UXDF 2RQMA 4RQMA 2UUTA 1AW0A 1H1VA 2Z58B 3MMVA 1RT7B 3SBGA 1FNXH 5ETSA 3GIMA 4DR3K 1IJJA 5F9LA 3B4DA 2PMWA 3DLGA 3W66A 2QN6B 2IS3A 1HD1A 4K4WA 1TUWA 3PW7A 4Y00A 4FVMA 4MIBA 5F0WA 3C6TB 5K8MA 2ZBCA 4JKDA 1U8SA 1Q4RA 4LFBJ 4X66J 3NLCA 2VICA 2RHKA 2YNHB 4IQVA 1E6VB 2HIQA 3FBBA 2AJ4A 1FJEB 2GX8A 3CCES 4OX9F 4KHQA 4TY9A 2E1EA 2VA8A 2IYGA 4OLAA 4DUYJ 3EE9A 2BVZA 3RBZA 3EEQA 2LMIA 4OJ3A 1F1BB 4KH6A 4ILGB 4OPJA 2Q6CA 5HJYA 3SR6A 4CT8A 3CPWM 3DXKB 1HNWK 5M2PA 4YB5A 4NLRA 2BANA 1BPDA 1M5HA 5THWA 3BBCA 3GJSB 4FWSA 1JLEB 2AJFE 4TN2A 5FP0A 3NHGA 3G96A 1LB2B 3C5FA 3ZZ0A 3OSNA 5H1SV 4UB8U 1NLKL 1YLXA 3VGUA 3IRWP 2Q4TA 3EGNA 2RHSB 4MIWA 5LSRA 3TYTA 3ZSQA 2NRTA 4BRKA 2W55A 2LA4A 2P9UB 2D8CA 3HKWA 2M52A 1NGCA 5J2PA 3CERA 2NRXA 2VDIA 3RYLA 1XK8A 3DLLL 3GFZA 1LXNA 4YMOA 4X4SA 2OPRA 4E3SA 3FCWA 2ODGA 2Q0RA 3PRVA 1XQIA 3TA0A 3AEVA 2M5YA 1YTYA 4BRNA 2WB4A 3D66A 3HOTA 1ZQVA 4H54A 3H5XA 4M3XA 2ISOA 3ZT3A 4K5SA 4CYUB 2VG6A 4YY3K 1H7WA 2QIFA 1WG8A 3MR3A 3PV8A 2B5JA 3KKFA 1VSMA 2G0JA 4MK7A 1F3FA 5L1JA 2W4CA 1DOQA 3Q7BA 3S01A 3AMZA 1ELOA 1JUDA 1ZQQA 4KY3A 4J9OA 3SUOA 4B3RK 1U04A 4PG5A 1VQPN 3EPGA 2R7VA 3QU7A 1ZAWA 4C3KA 4ECVA 1JLQB 2RT3A 1X9JA 3CJKA 1YRXA 2DH9A 2K7JA 2CZ4A 3QINA 2YJEA 2FJXA 1SZHA 2V7ZA 4UZBA 4LH4A 1A5XA 3Q0AA 4WBFA 1JLAB 2XBPA 3Q8LA 1APSA 4RQ5A 4ITSA 2W6LA 3PSFA 4BRIA 4B9QA 5AI0A 2CPIA 3H20A 4IDKB 3U3GA 2CNOB 3W9IA 1HBMB 1N5QA 1VSHA 2MQOA 3MTJA 2ITGA 1R8CA 4KGZB 5KPRA 1Q86T 1C1CA 2YNGB 4JI7K 1LOTB 3AO3A 2MB0B 2B9WA 2VASA 1NB7A 4FSVA 3RU0A 5C24A 3ZCMA 4CF9A 3OBIA 1NBEB 3H5SA 1YTUA 1EP4A 2XY7A 3D2QA 7FDRA 4KN4A 3HVTB 4HWIA 4CVNE 2NLXA 5M2RA 3J8AA 1LWXA 2VG7A 3OYGA 4UQTA 1UMJA 2LHTA 4FJNA 3I31A 4BE0A 4OKJA 2GV1A 2MZ1A 5F8LA 3L3CA 2IAJB 1Y64A 3RAMA 3CRXA 4KIAA 3PG9A 4P72A 2YBVA 5RUBA 1DTTA 1IQTA 3MR6A 1HL6A 3AT1B 4X4TA 4JYAK 3VQBA 4Z4HA 1RWOB 4V19X 4NL5A 2I5HA 4KX5A 1O6XA 1X0PA 3FCHA 2BE2B 1RLDA 2VPYB 3SAGA 4TU8A 1WHYA 1HQUA 2KOBA 3KWMA 1N62A 5JVHQ 3RJGA 4ICLB 5LOQA 4OGCA 2EAMA 3OYMA 3UW1A 1T7PA 1VC6A 4G9BA 1M1GA 3ZEUB 1K8AO 3TFSA 4CHYA 4LRBA 4HHUA 1P1LA 2EK1A 1RTJA 3ZZZA 2HBQB 2UZAA 1PILA 2V8GA 3QETA 2M70A 1OIAA 2BH1A 4W5QA 3JTOA 2QLJB 2WVFA 3I6PA 3R7NB 1Z3EB 2K06A 2PMZD 2O8CB 2RSQA 1KRPA 2K4PA 4JHDB 1V5IB 2M3DA 2ZHBA 4WQ4C 4LJXA 4RPXA 4X65J 4JKGB 3CF5Q 2DNMA 1S0OA 1GEHA 4ZP6A 4F5RA 3GOIA 2ZUAA 2RS2A 1HIWA 2Z1JA 2LXIA 4ZVEA 3BPSP 4GVLA 3H8YA 4K4UA 2E88A 2JEIA 5FPEA 4NXNK 3AU6A 3S7RA 3CJ2A 3CUNA 3PMNA 4OPHA 5B0FA 1QD1A 5KG4A 2R2TA 2Z1HA 3FAHA 5D3GA 4BRHA 1RT3B 1FT8A 2MQLA 3C21A 3DDKA 3G87A 4QS8A 2W01A 4C97A 1R6YA 1QQOA 1R8PA 4CM0A 1VQMS 1WCNA 3KD3A 8ICWA 1ATSA 4J9NA 4QIWC 3TUIC 3I0SA 2KEYA 2H1YA 3QERA 5JUMA 3O1BA 1GLDG 1YF5L 3NFAA 1F9EB 4IFVB 3K5OA 4Y3CA 5K8OA 4RUCA 3F5EA 3O6WA 2V8HA 1FDDA 2FJ6A 2KW4A 2W1BA 1FKOB 3MECA 5AQHA 8RUCA 4DBQA 2CPZA 1L8LA 5C2GA 2QSWA 3C2MA 1YJNS 2YTCA 3IM1A 1S49A 1IBMF 3ZZTA 3CJ4A 1B4FA 1VYAA 1A5VA 3OPKA 5GAHI 3UD3P 4I2CA 4ZVOB 4R5PB 2AV5A 4OZ5A 5IT9O 3KNAA 3WX4A 4JI6K 3IA0A 1U1KA 5FPDA 3DRPB 2O8FB 4CF4A 3C6HA 5FRNA 5ALFA 5GAEP 3I5BA 1FRHA 1RWWB 1NJXA 2VOPA 3D7SB 4M9LA 5BOMA 3F9MA 4H0PA 1FE0A 4E1JA 4CF1A 2WBMA 5HP1A 2RE1A 5A6WA 2L08A 2ZGYA 1XN9A 1YJTA 1SB6A 2VODA 2ZE2A 2ASYA 4PKGA 3BF4A 5IT0A 1KVIA 1VRTA 1RU1A 3ILJA 5KFAA 5AZIA 3PYDA 1BA0A 4Y34A 4KH4A 1UAWA 2V8PA 4A5AA 2CFXA 5B66U 2EFQA 3TZYA 2HAFA 4WF9Q 1VDVA 1XO1A 1XR7A 2H3ZA 2KK0A 4N76A 9ICAA 3CDEA 4GY2B 5J1EB 3CCRS 4PWDB 2VYPA 4HUFA 1UVJA 5DQIA 1CULA 4I29A 5E3AA 1S1TB 4LT6A 1JALA 2RAQA 3TA2A 4A5BA 3VAMA 1Z1BA 4FLVA 1UP1A 4W5TA 1M1KO 4DUTA 1S6QB 2I9SA 3GIKA 2BPCA 4Q5VA 3OYNA 1V9PA 4M1KA 3KD5E 3D4JA 5FLXU 2ZJQQ 2RKIB 2GCFA 3GLJA 1NLVA 3SQOP 1ATNA 7AT1B 5HR7A 3CC7S 1EB0A 5K20B 2AYEA 2B0CA 2DFLA 2UXBF 2HVDA 4CEDA 3C28A 2P9SA 4OGEA 3UIQA 3NGZA 1N34K 3D6HB 4ZVFA 1RPLA 1PUZA 3HM8A 3G6VA 1RQNA 4K4SA 1N6QB 2PXIA 4BG9A 4CEEA 1G15A 4KGXB 1K0TA 2UU9K 1Z4NA 1QH9A 1RI7A 2O6KA 2CQBA 4M3ZA 3BQTA 2BCRA 2Z4PA 1CRXA 4F36A 1RAJA 2CG4A 3RBEA 2IVPA 4K0KJ 1NKCA 4CJRA 2YJFA 3G25A 3T1YF 5EX5A 2Z2ZA 1XERA 1HUXA 3A5OC 2C2RA 3L2QA 3J7Z5 3R2DJ 4JKHA 2IJRA 3H0LB 1S72S 4WQ5C 3C94A 5DG9A 3J80U 3MOZA 3ZSOA 3PJWA 3HWTA 1T9YA 4BGBA 2PI5A 3ILOA 3E9LA 1S5ZA 5EDWA 2XYPB 4JI2J 1UW4A 4USHA 2BJ1A 4WZMA 2K7KA 2QWQA 2XHBA 2IVYA 1JI7A 3VCBA 2IBKA 5HLFB 5E0OA 1FA0A 1J6ZA 4ZMMA 1ZQWA 1WJ9A 5IOLA 2HBYB 2L9NA 2X1AA 3T19A 1RABB 3WNFA 4IWVA 2EBGA 5C42A 2IDEA 2ZZTA 2CH6A 4GKKK 1BIUA 3D1HA 3ZFVA 2RRBA 4DUZJ 2F65A 4OX8A 5TISU 5DGAA 2NXCA 4OIXA 4X4QA 2ATLA 5CZVA 4DV5J 1I94F 5HMXA 2A1SA 1I6JA 3R1HA 1REVB 2V2VA 2HHSA 4IS7A 2AJ1A 2HNYB 2NR0A 1VAZA 8ATCB 3W3SA 1D09B 1S1XB 2XZWA 3J7AN 1NPKA 1GMWD 4A48A 2W2OP 1TYQA 4E2FB 3ZDAA 4OYIA 1FDNA 1S5JA 5J0OA 2DNLA 1MNEA 3DU6A 3MDCA 3VOVA 3NL0A 3GV5B 1XWLA 3TADA 1Y5NB 1SKUB 3NAEA 5J2NA 1Z00B 3EJMA 4P73A 2W43A 3NGDA 5BN9A 8ICOA 5AK6A 4FF4A 1K8KA 2KZMA 1W2BR 2V52B 1WOPA 4EFHA 3QYPA 1UOCA 4F3MA 2G8WA 3UMGA 5ETMA 1RYSA 1YZ7A 1XNRF 2ROGA 3QNOA 4WTOB 4OZNA 4ZVRB 1RWKB 3AARA 5KAIU 4JI1J 4L75A 2B4VA 2KT2A 1BWVA 3F44A 2P9KA 3DLJA 2XMMA 5KFYA 3MR2A 4Q2LA 2Z2MA 3DCAA 4H0YB 1KHWA 3G6YA 4IUFA 3GJTB 4OZ3A 4ZP8A 3ULHA 2QFIA 4PL2A 2F4VJ 1ITGA 1V3RA 3T41A 4P2HA 1BU6O 1RYRA 4DV1F 3OFGA 4BUGA 2PE8A 5C10A 4DR3J 3CPEA 4J9PA 5EX0A 1RTDA 1W25A 4YN3B 4RPZA 3U7JA 4LFCK 2NRVA 4ECWA 3SK3A 5KPZA 2WVCA 2C3MA 3LZIA 2KD1A 3GE1A 2HHQA 1NDLA 2HFSA 5LJ5Y 1WKLA 2KB2A 3ZDEA 3JYTB 1X2IA 2DPNA 2MHEA 4C48A 3V81B 1TKXB 2RVJA 6FDRA 4ED1A 2HOQA 2KLAA 3V6KA 1R8HA 2J76E 3F2BA 3SQGA 3THYA 3M1YA 2E5LF 1BQNA 2YMLA 1WUAA 3BKUA 5CA5A 4J9VA 5HVGA 1HNWJ 2MKCA 1Q5VA 2XLIA 2NRHA 3ZTOA 5DB7A 5DRKA 3ICLA 2ADBA 3R9LA 1RQ0A 1F5CA 3V4MA 2XS5A 2IOFA 1MDUB 2V6AA 3E01A 4D3HA 1SJ3P 5CY4A 3W8GA 2CRXA 2CQ3A 5AKHA 3PO5A 5D78A 4KREA 3G6XA 4LVOP 2KFYA 4F3OA 3PMLA 3DOKA 3RWUA 2NRZA 3QX7A 4LFAF 1T02A 2EZYA 1WSEA 3R7SB 5DQHA 4I64A 4YB1P 4CIEA 5I3UA 2P6SA 3ZSVA 1OH8A 4C11B 3MD1A 4YS2A 1YKWA 3QO9A 2VIXA 2W2PP 3BS7A 2YHYA 5F1XA 2RJZA 2H3FA 3IN5A 2KFZA 2C42A 4B8CA 3AVCA 3KK7A 2GA7A 1KP6A 4WFZA 2B43A 1HYSB 2AEMA 4YY3J 2P1JA 3FUYA 2HVHA 2YKMA 4FE3A 5DDPC 2W8KA 3KUEA 4OJGA 4I2AA 4Y2JA 3ZC4A 2RDDA 1NKBA 3J81j 1EHWA 4PKIA 3QEIA 4DLGA 5AM1A 1PVRA 4UF4A 4B3RJ 5T7LA 2A6OA 2K4EA 9ICWA 4I6YA 2AA4A 3O5BA 1TGOA 1BPBA 1RWPB 3MDQA 3K5NA 3CXCR 5LY3A 4CJSA 4K4TA 1VDHA 1MWMA 1P9YA 2E1CA 2P9LA 4NPOA 5AQJA 1PAEX 1ZQTA 5J0RA 2H3EB 2W54A 3TR8A 4OX9K 1T9VA 2HS4A 1AZSA 2HS0A 1P7DA 1LAVA 3MMCA 5L39A 4KLLA 2WFAA 3PXGa 3GL1A 1X5PA 1FWLA 2GMLA 1TL4A 2YX6A 3GZ7A 2K3IA 1SQEA 2BGGA 3NY0A 4DTSA 5E3CA 3EO3A 4EEKA 3OVSA 4KQZA 8ICTA 2O4GA 2YQ0A 3T9ZA 4JI7J 2OFHX 2WC9A 5CYJA 2FPMA 2HBRB 1AQ6A 6AT1B 1SI9A 5KQDA 4OLBA 3QLHA 1KBRA 4O5BA 2W04A 5LL6Z 3V1QA 4F67A 2NCKL 4OMFG 2PAVA 4FJ7A 2DO4A 3EE3A 4FCYA 2HB5A 2KT3A 3H4BA 4HAIA 3JPPA 1UKUA 1AYEA 2OAUA 3QESA 1SC1B 2EH9A 5ETOA 4LSZB 5L1MA 4IOAQ 1X66A 2ZG6A 3DGVA 1M5OC 4USUA 2RRAA 4CHOA 2KV2A 3JPSA 2G0IA 3KWIA 2XYHB 4BR2A 2IRUA 3UN5A 2ZUBA 3DRSA 4F26A 5ETVA 4WIIA 2FD2A 3DLKB 3V6DB 3M6XA 3MDAA 3VF0B 4JYAJ 5CR4A 4J2AA 1FK9B 3O0FA 5KFOA 2DNQA 2E3TA 4W90B 1RSCA 4H4OB 2E5SA 4FKXA 3Q8MA 3HL8A 1NHUA 2HSTA 4IFYA 2DQNB 1AUSL 4ETXA 5IILA 4CK1A 5AQGA 3K17A 3BV8A 3ASMA 1NKEA 4LC9B 1JL1A 2A18A 5GVQA 4DR7K 4EP4A 1GXLA 1TAQA 1SL2A 3OYJA 4MYUA 4K41A 1S6PB 2DTUA 2XZDB 2FLLA 4FLYA 4I2FA 1RWXB 5FDLA 4RU2A 1ZD4A 1MU2A 2FDRA 3CPWR 2FMSA 1FXXA 1L3UA 2HQIA 1SC6A 3DRRA 4X4NA 3UPQA 1HI8A 1N0VC 2NXEA 1WSGA 3LDAA 3MCAB 3J7YU 1V3SA 1QQ6A 2XB2D 3BN7A 3I56N 5GMKa 2HI0A 1C20A 4BRDA 1OY9A 4C1NI 2BGWA 4UAWA 4O44B 2GUPA 1BPXA 4YR2A 4DFMA 4RQ3A 1WAFA 5ELZA 2VZ9A 2R8JA 4CJTA 5KFTA 3HF5A 2F9DA 4ZITA 4JKEA 3C66A 2LQJA 2EBEA 2N3LA 3ZT2A 1C4AA 3KZBA 3VEOA 3LWMA 1FXDA 2PSZA 4O3MA 1Y10A 4CK3A 4CEOA 5DLGA 3D3BJ 4EEYA 1L7PA 1JLGA 1IG9A 2SXLA 3D6RA 2DTJA 1YIJN 4ALZA 4KLQA 4P2MA 1O8BA 3W3DA 3QSYB 3BGFA 3GBTA 4MN4C 4IRKA 1SJ1A 1FRLA 2FVQA 3IG1A 1RNHA 5IINA 4PG6A 1NGGA 3MAHA 2QWPA 2ZH2A 3OFHA 3CJ5A 1Q8BA 2LKYA 3PRDA 4PWUA 4ZOHC 1ZJNA 3V9SA 3TVKA 3CCUS 1RDBA 4JUZA 2WTFA 2CGKA 4FXDA 4KHMA 3CCTA 1HHSA 3CGIA 3S6JA 1X60A 5FIIA 2M2BA 1ITPA 4CEFA 3W64A 3UB5A 1HNXF 4L76A 3H0PA 3PZPA 4YXMA 3W7BA 1WELA 4WJ3B 1GMUA 3D68A 6FD1A 4KGMA 4GKJF 1FNOA 3TNVA 4JD2B 4DLEA 5AE1A 4LBHA 2CA9A 1UETA 4JI6J 1JIHA 3IRXA 1VLBA 3DEEA 3BDPA 5KT6A 4NE9C 2HHHF 2A0FB 4TUSA 4CH0S 1AUDA 1BPYA 1DLOA 1RT1B 4ZPBA 3GG1A 2IC3B 4UZCA 1DHMA 1GOBA 5DETA 4ED2A 3U27A 2HHPA 7ICOA 4RBUA 4WCEQ 2QB0B 2B6AA 3N7RC 3THPA 2I6XA 2JSXA 4UT4A 9ICQA 4EYIB 4A8FA 3LK9A 4L72B 1VK0A 4AYBC 3DMJB 2WHEA 3VQ6A 5CYQA 2EKYA 1NNEA 4ED8A 1UPPA 4AFFA 1NDKA 1KVJA 1NCLA 1YHQS 2XMTA 2G06A 4U6PA 5A8WA 4QZAA 1GMWA 3DOMB 1BQMB 5JMNA 4X4PA 4ISEA 3I55S 3P5BP 4GVEA 3WQTA 3IG8A 3BPDA 5J8YA 1EIYB 3WKCA 3UNYA 4NLBA 3WKEA 1V4TA 3LTOA 1X1PA 1YG0A 4LF8F 2M0GB 1RAGB 2B9XA 2OEMA 3VQAA 2DL0A 5AQKA 2E9RX 2G8VA 4RNMA 2ACYA 5CD4H 2JH7A 2FF3B 3ETMA 2Z1GA 4CIOA 5CRXA 1RLCL 3NEKA 4PPZA 3FMWA 2PKEA 2ZOFA 5HHHA 2GVDA 2KFNA 2EZZA 1N34J 5KTQA 4JI5F 3VEXA 2JVOA 1A6SA 4A8YA 2V5HG 2K8BB 2ALZA 2RLTA 3OLAA 1SCJB 3GDQA 4NZ0A 1NJIO 2UU9J 2LPEA 3UO0A 4I6MB 2KU7A 5ETKA 1FO4A 2R7UA 3BQ2A 1NK0A 3NWGA 3EN9A 4IRCA 4DOBA 2AMCB 4HTJA 2ASJA 4ISFA 4ICAA 2QE5A 1RKJA 3MPVA 3U9ZA 5IQ6A 3N7SC 1T3NA 3NBPB 1QQNA 4XRHA 1ZPVA 1F0XA 4WP8A 4E98A 4NLSA 2H3IA 1FRXA 3NNCA 5A0YB 7ICFA 1C1AA 4M7YA 2I2YA 4M45A 4ISGA 3IFRA 1IXRA 3CCVN 7ICNA 4B8AB 3ADAC 3IP0A 3AVKA 5BXIA 2OJ3A 3MFHA 1GLAG 2ZJ5A 1T0TV 1MLAA 2P9IB 5I42B 1GOAA 2R7QA 4AM7A 2CJAA 1SKWA 9ICMA 2V0NA 4GKKJ 4GXIA 4YOYA 3UXOA 4KO0B 3THXB 2G8HA 1X5OA 2F1IA 4KSEB 5ALYA 4I28A 1EQYA 1B99A 3I5AA 1SQKA 3ENAA 2ZDPA 3M5RA 4FLWA 5AJ3F 1RDDA 4FWLA 4P7TA 1RT6A 5LXRA 3N9UC 5KOXA 3FK4A 3PYEA 2DHSA 4PL1A 2G0CA 3SIPB 2WONA 1ZETA 1Z1ZA 3ICXA 3OTDA 4DEZA 1EXQA 1MA7A 3KLGB 4UQGA 5KAKA 3DXMB 5K8NA 3NTUA 3VQPA 4TU9A 9ICXA 4RW9A 4OHYA 3QAUA 3KLIA 3JSMB 1HNVA 4PQAA 1SH0A 5GINA 3SBMA 5L8RC 3CCSN 5DDMA 5I4MA 4PHEA 4RQ8A 1S5LU 3HKZF 3DLHA 3FLCO 2FVCA 3RB0A 3N6MA 4JV1A 3TWHA 2ASLA 4FZVA 1DTQB 4EX6A 2GJIA 3CQYA 4M5MA 3S8SA 4FYYB 4ID5B 1C0GA 2EC2A 3G4SS 1WEXA 4CBXA 4M41A 2KRBA 3DLLQ 2LM1A 4FJXA 3ZZRA 1RBRA 1T3QA 3VQCA 4KLFA 3LP2A 3Q8VA 2XQCA 4OLOA 3J7YP 1HJPA 2DBYA 3V6HA 2NQPA 1LWCA 1IM4A 1L3KA 2ZUCA 4K43A 4Y2YA 4IOCL 1SV4A 4C0HA 2IRYA 2DR5A 2D5RA 5HAOA 4CEAA 3QRPA 3DOLA 2ZIUA 2VC0A 5IWAF 5AQIA 4CEBA 1SIWB 5C12A 4DG1A 4J9SA 4LFCJ 1YBAA 3FBFA 1WC4A 2B9EA 1OYEA 3LW5C 1J2MA 3IR6B 3OS2A 1ZJMA 2GO8A 5DB6A 4TY8A 4WU3A 5JS1A 5IC4B 2HW3A 2I5JA 5DG7A 3H3OB 4Z6FA 2W9AA 3M32A 4TU7A 3THWB 4DR1F 3KLEA 3I76A 5AQTA 2PDAA 4Q43A 3WKDA 1VSEA 2IGIA 3CD6S 5CH7B 1WG1A 3D2FA 1EAYC 3E1YA 1W97L 5H9EK 2WOMA 4KTWA 4JRPA 4HACA 3W63A 3TJ9A 1MN9A 2DT9A 4HCBA 1PVQA 4CGFA 5KFWA 3CCJN 1BVSA 1SH2A 1T6DA 3HBTA 3VQSA 2D3UA 1OH5A 4ZH4A 2VD3A 3PIOL 4ELVA 2KHOA 2C22A 1N60A 4U95A 1WOSA 3MCOA 4RW8A 3RMDA 2DNNA 4Y0FA 3IC1A 3OPXA 1HKBA 4Q0BB 2A5XA 1ED1A 5ALGA 1ZQFA 3ULEB 2VIHA 2UP1A 3TQ1A 1CPZA 2VFRA 1ZC6A 1BY9A 1ZRNA 2MQ8A 1XNRK 4CGJA 1N5YB 2ILZA 3L2WA 3MMAA 4BY9C 4ZVTB 3WC2A 1YK9A 2YHWA 3BO4A 3F2KA 2EEYA 2FPHX 2XNRA 3WXMB 5CP2A 1KTVA 4CEQA 1BNOA 3DHWC 1GTHA 4RQ2A 1KR4A 3ZI4A 4MK9A 3W5XA 4KYZA 2HHXA 4TYBA 1XMOF 1KKXA 2RQCA 2CPDA 4C8ZA 2K3KA 3BF1A 3PFEA 1NJZA 1CJKB 1IBCB 2OCEA 3LP3A 2KNJA 2JLGA 4B9SA 2X3GA 1WYGA 3ZNJ1 5DJBA 2NPIA 3UE2A 4DV1K 3V4IB 5E3QA 3UD5A 5J0XA 2O8BB 1FWPA 4Y2KA 2OPSA 3PLAA 1S9FA 5IZHA 4ELTA 3SXLA 1VK8A 3HJVA 1XS9D 2MAXA 4JI8F 1QTMA 1TFWA 3R2CJ 2F3JA 1EX4A 3PX6A 4ECQA 3H98A 2LQ5A 4I56A 5J2QA 2F8EX 5U47A 2FJWA 5LXYA 1Y97A 2FVPA 4W5OA 1EETB 5IM0A 5B7WA 1S1UA 4OX9J 2FVRA 1SUQA 1LKYA 2FC8A 2CPHA 2J6TA 8ICKA 2QTWA 3RGIA 2NZCA 2ZH7A 1NOMA 4DSKA 3CCZA 2D0CA 3OL7A 2LFVA 1QSYA 3F2CA 2E5LK 3FC4A 1J2NA 5KFQA 2DFFA 3H59A 3H0MB 4HVZA 4N47A 3H46O 1F5SA 2IOCA 4G1IA 3MXMA 3IXQA 2LSNA 3MPDA 1RCHA 3CJKB 4J9RA 3CETA 4X4VA 1Z19A 4OI1A 1R43A 5DS7A 3D3CJ 5KFGA 3MCMA 1JJ4A 4F4YA 4WFXA 2MY8A 2FPLA 4K4GA 2HCFA 3ALRA 3KJVA 3AVMA 3AOCA 2E2QA 1RTZA 2HGLA 5HMWA 5A76A 2IVMA 3RTVA 1XUPO 3TSUA 2KJ9A 2PMHA 4DU4A 3HJFA 4MEYA 4AHCA 1PO6A 2WF5A 4OV1A 4H0OA 3SPYA 2XCPA 4PL8A 2DKXA 1KC8T 4K4ZA 1VQSA 2Z2YB 4JK1A 2E2OA 3OD2A 2MJNA 3O8MA 2YNFA 4RW4B 1A5WA 2ESEA 2YI1A 5CZXA 2ZC4A 3M1VA 4JI3J 2VQEF 3LUYA 3MX2A 3Q8QB 4JK9A 4C4TA 3KLFB 3G82A 2WF7A 2YN4A 4K8XA 4CQ1A 3RJJA 5KT7A 3VALA 5AE3A 2J0SD 3TUJC 2Z2LA 2JRZA 4LF9K 4ZJLA 1L8OA 2E8AA 4EMDA 4DR7J 2Z1IA 8ICFA 2N7YA 4YG2A 2ROEA 4FO0A 1IKXA 3Q86A 1F9HA 3PO4A 4BC3A 4GMJB 3U9DA 1VBXA 4LF6J 4DX5A 3L4PA 4A8MP 2XS7A 5C5JA 1ASWA 2FGCA 5K8PA 4IYQA 3SQ2A 5TKWA 4O3NA 1QSLA 1DTTB 4Y2PA 1RFQA 3OVNA 5HP4A 3AJ1A 4LVNP 1XSPA 1WWUA 3AOBA 3ITHB 3AFGA 4OYOA 5KGXA 4MAKA 2V9KA 1JKHB 1UQVA 2E7XA 2P5OA 3LQVA 4Y2SA 4O8UA 4DX8H 5DKWA 1ZQXA 4I2QB 1UWAA 5JLHA 4CNQA 9ICGA 3DYAB 2DXEA 3TAGA 1HQ2A 2NRRA 2BKOA 2UUAF 3NNHA 3SFGA 4FZXC 3VQEA 1KQQA 3D5MA 3RJIA 4KAZA 2BCVA 1RWMB 1T9UA 3HSDA 2QKQA 3Q7CA 4M0AA 3L9ZA 2M8DB 5HHIA 3OQ2A 4FM1A 4G1PA 1XI1A 1PC4A 4GVBB 2JZBA 3CCLS 3F41A 2H54B 4FWKA 3VERA 4NLGA 3ORYA 1TL7A 3ISCA 2MTLA 3NAIA 3VAGA 1TL3B 3ETLA 1BE4A 5CYMA 4RQ7A 5T41A 3OYFA 1FXLA 5HSPA 5KFFA 3CC2N 1JLFB 3CJ8A 2YX4A 4WXOA 3JSBA 5ALSA 4IJNA 1CS4A 3R1LA 3CCMN 4O23A 4WE1A 1RT2A 1IKWA 1G6BA 3OHRA 3KJNB 2ZKUA 2QARA 3ID6A 1HUOA 4EFAC 2M9NA 2YKQA 4I7FA 1BG3A 2OLWA 1ECWA 1U47A 2QA4G 5AKXA 5H9FK 2JV3A 4J7CA 2YMPA 4FDFA 9ICLA 1AROP 1JLBA 3TAMA 4HVJA 3EZ5A 1RZMA 2CVEA 2CPJA 1QAYA 3S6EA 5KG7A 3ISBA 2D9OA 3U3YA 5AT1B 3RW6A 4IG3B 3PFOA 2A1RA 2OXOA 1M5KC 2NRWA 2VQFF 2HAIA 3GPAA 2DGTA 4BR0A 4FYDA 5C2CA 1RDWX 3QFPA 2CPEA 3KK3B 3TSPA 4JRQA 3O4NA 4UUXA 4V1Ak 1WI8A 2FGOA 3KMSA 1ZQSA 1BUXA 2E1PA 5HVHA 2QJ3A 3FGVA 1RHJB 1VBYA 2DWQA 4ZN1A 5AIAA 1RKIA 3D45A 4K4XA 1VC0A 7ICIA 1J54A 2V51B 1ZOTA 4ZVPB 4WK1A 2ZITA 3H1VX 4C7ZA 2GZOA 4DR5F 4ZCKA 1KBUA 1ZBFA 2YH0A 2RRNA 2HNDA 1NXIA 2AF6A 3IFEA 3OS0A 4XK8C 3FZBA 3AGRA 7ICGA 4CTAA 5AQPA 1TKTB 1LFPA 1DK3A 1RBLA 2ZEJA 4QJFB 2GQQA 4EBDA 1U1LA 1RUSA 2NSCA 4PQUB 1YJWN 3Q8PB 3B0XA 1DQAA 1CLFA 5AQZA 4GKJK 4HLBA 4B3SK 5KG3A 2W3SA 1UEUA 2LQ9A 3OUYA 3H2UB 4L6V3 1SIZA 1T95A 1J5OB 1LXJA 3HJEA 4IEEA 1D8LA 1E4FT 1YITS 1Q7LB 2HHHK 3D0IE 1RA6A 1HBOB 4PWWA 5HBMB 2AIRB 3UKRA 4GC6A 3RB3A 1BPZA 3C2PA 3LDQA 4PHAA 3D6TB 4AM6A 2KXNB 4NB4A 1IBKK 1KAYA 2JXJA 2HBKA 3GB0A 1FKPB 1FX2A 1IWGA 5DLFA 4GV3A 3L7PA 3QEBZ 1KQFB 5BPNA 3IHQB 4EBEA 4CZHA 4JKBA 2VKZG 3SAHA 3HFZB 4KGKA 3QEXA 2XY8A 2B4PA 3ISDA 3D6MB 2DVIA 1CZBA 4KX3A 3BB5A 1K1QA 1U6FA 1VRUA 2P9NA 1O5JA 4QZ8A 3M2RB 3I0RB 2XVTA 3ZTQA 3EDQB 2A6MA 3TEGA 3EM1A 1Q81O 4QIGA 4YR0A 2ETJA 2PFOA 4UY8O 3H5UA 4Y6IA 9ICPA 2UVRA 1YI2S 4CBUA 4P2XA 2J0WA 2MZSA 1IKVB 2P51A 4M5DB 3FVYA 3MN5A 1O03A 4NA1A 3Q2TC 4H5TA 1VQLS 4MDAA 2UXCK 2JLEA 1RHMB 4QQBA 2IIHA 2AP1A 3QFWA 4M3WA 2LM4A 1Y9OA 5D0GA 2UV8G 3QMLA 3V1OA 3HHLA 3UXPA 3WT0A 5GAGU 1GK8A 1PCAA 5IV3A 4LF8K 4M9GA 4OJ5A 1BISA 2OTLN 2CPFA 5KFZA 1BI4B 3KNGA 2QXLA 4W5NA 4X64K 2HIYA 3KFWX 1NU4A 2CUYA 4M9HA 4I27A 4RW6A 1S0VA 3KWGA 1KQSM 4Q8FA 4AHRA 4CJUA 4CO3A 4JI5K 1A76A 4B9LA 3NAHA 1IWAA 1TUGB 4DV2F 3AO5A 2Q0ZX 1OO0B 2P9PB 5J0UA 4Y65A 5C25B 3AVNA 4F25A 1U2FA 4DV7F 2DR6A 1PGZA 4JK8A 2MA1A 4EP5A 3HMJG 3E9OA 2EG2A 2ZTEA 1RG6A 3EVMA 2BOPA 3JQJA 2WK4A 3CVKA 1ZQEA 2QM1A 1Q46A 1SVDA 1KEJA 2HHVA 2E44A 2PI4A 3B6OA 4C7YA 3DU5A 2RE2A 1NGAA 4KJIA 4USVA 4DTXA 1HBUB 2W9BA 2CWXA 3O08A 4ER8A 2XWYA 2Z8QA 4U7CA 3I5CA 4YHHF 3QU9A 5D15A 7ICUA 2D3ZA 2KQ2A 5KG6A 1D9DA 2ZIXB 4GV9A 2HOFA 4RT3A 1SXDA 5BRFA 2W7PA 5HQMA 1NU0A 3CT9A 1P8ZA 1JMTA 3KOAA 4I2BA 1ZQUA 4JB3A 3GFXA 2KG5A 1CQNA 2BJ3A 2FBTA 4KRFA 2QEXS 3OXFA 3MAQA 1IV8A 2MJUA 1NHKL 2BUPA 5J0TA 1BUPA 3VENA 2KIWA 1TAMA 3MM8A 3BO2A 5BPCA 2J4RA 2OTJS 1VIXA 4NLXA 1WBBA 1ZZFA 4PA1A 3NKYA 2VC1A 3NGKA 2MKJA 3MGHA 1KD1T 5H9EJ 3H8WA 1IM6A 1XMQJ 4HUEA 2VJ5A 1N54B 2ZXHA 4E19A 4QW9A 1FI4A 2ZWHA 3KK1A 4IH6A 2OPPA 2KTQA 1RB0A 2JFDA 3DHXA 1OPIA 1R0AB 3OR1B 3FM9A 3K1RB 4FBTA 3OYAA 1NH7A 4O9MA 3LPTA 1OY8A 5C7PA 2DEJA 3CJRA 4DR4K 4DQQA 4FXWA 3S1TA 2MUTA 3W65A 4AE5A 5KL1B 2ZH5A 3IMXA 3DGPA 3CCRN 4ZIWA 2GUIA 4NV0A 4FK2A 3LP0A 2AZ1A 3CMAS 3K1ZA 2JX2A 4A8XA 3SYZA 1KOOA 2LXFA 4CDIA 3THYB 4R63A 1BQNB 4MO5A 4BR9A 2JC0A 3BQ0A 3C95A 1MQ3A 2IRXA 3G6ES 4G6VB 3HSCA 4A2AA 1XNRJ 3MGIA 3HLUA 2PFDA 3T6JA 2MEWA 4RUAA 4K8RA 5AKKA 4Q45A 3M8PB 1N5VA 3VAJA 4RQ0A 4KLTA 1SAZA 1DARA 1XNSA 4RWWA 5DDQC 3GU0A 2W2NP 4LR8A 2MZTA 3UMCA 1UA1A 5LMNF 1X3MA 3KG4A 4QOTA 3F5AA 2YCHA 3OR2A 3UNGC 3AHPA 3W9HA 5J2IA 3JTPA 8ICMA 4DV1J 1BCOA 2CYYA 1OUQA 5IWAK 1H3DA 1MROB 1YAGA 4QIEA 4YP3A 3D67A 2MLYA 3SQ1A 3A8YA 1TL1A 3LM9A 2KYXA 4XO0A 2ABYA 5I3UB 4EU0A 4ZPCA 5IC6B 3RSEB 3SQ0A 2KVCA 3QNNA 4KRWA 2E1RA 1IH7A 4CZMA 1DGJA 4Z4IA 4DR1K 2FY1A 3VTIA 3PW4A 2VH7A 5F0UA 1T03A 2E5LJ 2YVSA 1M5VC 4U8VA 3U1MA 1RBTA 4I2HA 3J7ZT 4C0OC 2YHAA 1BPEA 3FSXA 4KHUA 4CT9A 3EVWA 4NM1A 5F3ZA 3AAPA 4MMOA 2HVZA 2KVQE 4Z94A 3WX8A 4IH5A 2YWHA 2IVOA 3FC9A 4DN9A 1XHXA 1HHTP 4Q8EA 3HHLC 2ACMA 1VSIA 3SQIA 2KM8C 1C0FA 3CULA 4IXCA 2OWOA 5AR0A 3QUTA 1U1MA 1X3NA 4IOXA 1UWBA 1N52B 2LDIA 1AZSB 1B0XA 2KJ8A 1RHQB 1WEYA 1NMEB 1U2CA 3ONNA 9ICRA 2X6NA 3TW0A 1KKHA 3CO0P 4KT0C 3ETRA 2Y0SF 3LOUA 3KXDA 5F2RA 2A1JA 1VQNN 4BXOB 3KJQB 2BYCA 4URSA 2U2FA 3LGNA 1EARA 3BGRA 3GG0A 2EVZA 5D4OA 1VQ8S 2HK3A 2JEFA 4QZDA 2ZM6F 4DF8A 1ESVA 2OSQA 4PUOB 2VJUA 1FEHA 2RF2B 2HQGA 3NRZA 2FZGB 1CC8A 1RDFA 4O3RA 5E33A 1SV5A 4B1VA 1MW7A 2GELA 1XMOK 5ALIA 5DDYA 3JS9A 4LF9J 2KHDA 3N7PD 4F5OA 2BMBA 4H4KA 4C8YA 3FFIB 1LV5A 4KHPK 1OW5A 1M0SA 4P0QB 4DL7A 4OCZA 1OMSA 3VV2B 3NRBA 1GO3F 1RM6C 2CIMA 4JI8K 2ADCA 2GO9A 3VGMA 4PPDA 4CNYA 4C8OA 4MKAA 1N8RT 1FVQA 2XY6A 3CM6A 4KFBA 2DKOB 3D9BA 3ZZYA 1OJ4A 5BPLA 1BL3A 1ZQGA 3HFVA 1HPZA 3NS6A 5CE3A 2J6UA 4P9SA 2OEHA 2E7WA 4Q7AA 4BCAA 4ED3A 2IOHA 1YX2A 3HO1A 5GADU 1LAWA 4EUVA 3LPYA 1CJUA 2K8AA 1OQ3A 2ZIVA 1B7YB 1IV0A 3OYHA 1HMVA 2HNZB 3MM6A 1HI0P 7ICLA 1W26A 2JEJA 9ICKA 2LECA 2V8VA 3FYHA 3VVTA 1TELA 4PKHA 1NSPA 1N33F 3VESA 2X7IA 4KLIA 3KKAC 1DJ0A 4M5LA 5AFUA 3LDSA 1NK8A 2NZ4A 4YDUA 5AKYA 2MQMA 1PC5A 2V2KA 1GLEG 2IHNA 2LEPA 1TFRA 2YY3A 5BR8F 4DSLA 4ZLLA 4C3MA 1OVQA 1RGIA 4A8QA 4F02A 4CI6A 1X6JA 3MEGA 2GWKA 2GHVC 2J9CA 2GLEA 4XA5A 5G4DA 3HTVA 1HQEA 2ZJ8A 5E41A 2GO7A 3CJAA 4YFUA 4JI4F 4USIA 1UZHA 1UT8A 1ZQRA 3M6WA 1NH8A 3R5BA 2E2NA 3HSGA 3UKUB 3VF2A 1X4AA 1N63A 3PSIA 3FBEA 4QZFA 3QNMA 2FC0A 4LF4K 4V19J 2Z56B 1JLGB 3HP6A 1JRPA 5AKIA 2RB7A 2BA9A 3RRKA 2J8AA 4HYKA 2DNRA 3MXHP 2CNKB 4MKVA 2M7SA 2VJ4