4DQPA

Ternary complex of bacillus dna polymerase i large fragment, dna duplex, and ddctp (paired with dg of template)
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
580
structure length
576
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 199
structure length 576
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqpA01
3VQ6A 4PPXA 9ICRA 5DG9A 5DBBA 2I9GA 3E2EA 2I1QA 3HJFA 2HHXA 3CYMA 3M8SA 3EW9A 4CGHA 1YT3A 9ICLA 4O3NA 4RNNA 4CHQA 1RBVA 5KG4A 2NRZA 4UAZA 1QS4A 1L3SA 9ICGA 3QLHA 4YXJA 4CEZA 2GV9A 3AVCA 2BPGA 4DL3A 5KFWA 3EZ5A 4IRCA 4FM1A 4CESA 5J0WA 5CY4A 2FC0A 3N4MB 1Q8IA 3DRRA 3WNFA 2GBZA 3QIOA 4KKOA 3DLKA 3UIQA 2VG7A 4CF0A 4RNOA 3MR3A 1YVUA 3C1ZA 4BDPA 2H5XA 4KTWA 3OYLA 1QHTA 3RJJA 2PI4A 5J2QA 2IBKA 4DTOA 5HRNA 2XCPA 3MFIA 4FJ5A 8ICCA 8ICLA 2JEGA 4ICLA 4RUAA 3ZSWA 3C21A 1TK8A 1RDBA 4J9MA 4F5NA 3AVMA 4OJRA 2IMWP 2HHWA 4I2BA 3LALA 2KW4A 1RBUA 9ICKA 3QNOA 5IIMA 5FDLA 4CEAA 3Q8MA 1UA1A 1KFDA 3Q8LA 4OKJA 4FBUA 1RTHA 2RDIA 3MR6A 1CZ9A 4FW2A 4EYHB 3M9MB 3OS1A 4DMNA 2YNIA 9ICOA 4I2FA 1YTAA 5IINA 1LAVA 1N5YA 5HROA 3GFKB 3GIKA 4CGIA 5DBAA 1C6VA 3L3UA 1WCLA 3H8WA 4DTMA 2YV0X 3PUFA 4Z6DA 3ZT3A 2D5RA 1LAWA 1ZQRA 4YQWA 4MFFA 3IHQB 4MFBA 4CIFA 4QWDA 1XHXA 1Z00B 1SKWA 2HHUA 1K1QA 2VA8A 3V6KA 3SNNA 2AGPA 4HUFA 4E7LA 1Y97A 3NF7A 4XIUA 2ZTEA 5T7BA 2DPIA 4CGFA 5CJ7A 5KFPA 5KGXA 4FK4A 1NJZA 1RBRA 4FJXA 4UB5A 4CK1A 3IM1A 4JS4A 5J0YA 4Y1DA 4DS5A 3PW0A 4JWNA 3K2PA 4LY7A 4AHUA 4NLNA 4J9OA 3LP1A 3HL8A 3CFPA 4KMUA 3K57A 1KVCA 5KFEA 4KV8A 3ZDBA 2DY4A 5J2IA 4M2YA 5DGBA 2B4JA 4CEDA 2OA8A 3V1RA 2X6NA 3MAQA 3H4BA 5DK5A 1NOZA 4MFAA 4IRKA 4CF2A 1T4GA 4I7FA 4CEBA 2HHSA 1NK6A 1MQ2A 3SQ2A 4LSLA 2R7YA 5HBMA 4BE0A 4YMNA 9ICCA 3VQQA 3GV8B 3Q8QB 4HHTA 2KQ2A 1TVAA 3SUNA 4F2RA 3SPZA 1IO2A 1REVA 1JLAA 1HJRA 3ZSXA 5CWRA 1WSHA 4O9MA 1TGOA 2ZTDA 2WOMA 2XGPA 3EY1A 3AU6A 3UXOA 1XU4A 3LAKA 3K5OA 1D9DA 2Z1JA 1ZQMA 9ICEA 2YNFA 4DOAA 4MEXA 4ECWA 4YFKA 4M45A 5J2MA 4N47A 4R8UA 4F4ZA 4G1QA 3L8BA 4DSEA 4ID5A 1MU2A 3ZDCA 4PGQA 1NK4A 1ZJMA 1UWBA 5KFGA 1BPXA 4HUGA 2NRTA 2XRIA 3PV8A 3RH5A 1J53A 3KLIA 1C0UA 2VANA 4C8LA 4J9LA 2IA6A 2ATQA 1XSPA 4J9QA 5KTQA 3KK3A 5KG2A 3ISNC 5DBCA 3AVFA 4QZGA 4AHRA 4FJIA 2XY7A 2WONA 3O4QA 4UQGA 1RXWA 1LW0A 4LH5A 4JV2A 2GWSA 1LWCA 3RH4A 3VQ5A 5CYQA 5I42A 1U04A 2P5OA 3V4IA 1RZTA 3LPUA 1FXXA 2HMIA 4OPJA 8ICHA 3KHGA 1PZNA 2JGUA 4M3RA 9ICUA 2DFHA 1RDCA 2X78A 4DQIA 2PFOA 3AVNA 4ED7A 4H4MA 4NCGA 3PR5B 4RW4A 1CXUA 3RMAA 1XHZA 1HPZA 3AA4A 4RPZA 7ICSA 1HYVA 4CF1A 1SUQA 4B8CA 2XY8A 4FJ9A 1HNVA 4I2GA 3PNCA 4DFJA 4Z4EA 4K4IA 4M9NA 1ZQYA 4R5PA 2Q3SA 4CEFA 3O3FA 2HB5A 4BGDA 4GLXA 1FKOA 3HT3A 4FJ8A 3LAMA 2FMPA 3ZT4A 3OYJA 3RRGA 2FMQA 4O5EA 3RMDA 4BDYA 1BHLA 5DGAA 8ICQA 1BPDA 1A5WA 5DQGA 3A2FA 1FKPA 3ZDDA 1UOCA 4DL4A 2Z1IA 1JXBA 3L2RA 1QE1A 4KLTA 3MBYA 4CECA 1IM4A 4W5QA 4PHPA 4EZ6A 3N97B 2R8JA 8ICJA 4I2EA 4CGGA 2XY5A 4NYFA 2FLLA 1WNSA 5C24A 3HWTA 3Q8PB 3OYGA 2XO7A 1MQ3A 1KCFA 4CFBA 3LP3A 4F3TA 1RYRA 1KVBA 5KFTA 7ICLA 5DDYA 1Z25A 3NCIA 4OGCA 4DQPA 1C0TA 4RQ3A 2ZUCA 4F5RA 3RWUA 2IC3A 3V6HA 3F73A 5L1LA 4O5BA 4F4YA 1SKRA 3NHGA 3HXMA 2BPCA 3GV7B 3TFSA 3RJEA 1ZQKA 1NK0A 2IHNA 1NK5A 4TQSA 2BQRA 2FPMA 2J6TA 4PHAA 2D0CA 3AV9A 1LWEA 3RB0A 3ULDA 1SV5A 3NFAA 3WNEA 1DOQA 4OVLA 1U4BA 1X1PA 5DB8A 4IQTA 4IQVA 3LP0A 1WSJA 5BOLA 2I5JA 4W5TA 1RNHA 4QZEA 3F9KA 4IKFA 4M42A 3MEEA 5KFZA 3OYHA 1GOBA 7ICGA 9ICVA 1ZQWA 4DTUA 1XSNA 4ELUA 4RW9A 3TABA 3BQ0A 2FMSA 5HHHA 1XSLA 3B6PA 2BQUA 2AQ4A 5KFYA 4GC6A 1BIUA 4UBCA 9ICXA 3CM5A 4HUEA 4RQ0A 3BDPA 4QZHA 1BISA 4RQ7A 1S0MA 8ICXA 4YR2A 2WTFA 2LYHA 5HHIA 1RPLA 3QESA 5D4BA 3VQPA 2Z1HA 3OJSA 1S0OA 4FJGA 9ICBA 2F8TA 4PHDA 3K75D 8ICEA 3D0PA 1KLMA 1RBTA 3MR5A 8ICAA 4FVMA 3BQ2A 4RG8A 4J9KA 1HQUA 4FLYA 3T3FA 1W0HA 4HYKA 1W9HA 1U45A 4LD0A 8ICRA 2AGOA 4K8XA 4FS1A 3QEWA 3U6FA 4RW6A 3EWAA 1TK5A 4KHNA 3ZSOA 1N6QA 4DTRA 3AVLA 5IIIA 5DG7A 1RXVA 5KT4A 1D8LA 4DLGA 5KFLA 1JLBA 3V81A 4N41A 4RW8A 5KFNA 1J9AA 3EPIA 1TL1A 3KLHA 3C6TA 1V9PA 4UB3A 3NH2A 1C1CA 1UT5A 3B0XA 3C1YA 4BXOB 1TAQA 2XHBA 7ICFA 2X6SA 4BDZA 3KLEA 7ICPA 2DFEA 4R66A 3L2WA 4KI4A 3RMBA 4FJKA 1XS9D 3ZT0A 1MSWD 1T05A 2AJQA 4FLTA 2R8IA 1WSEA 1BIZA 4P4PA 4R63A 2KFNA 1RTDA 1Z00A 3RRHA 4W5NA 1I3AA 4E7IA 4TUQA 3WNHA 3OSNA 3SCXA 3M9NB 4B9UA 1QSYA 1UA0A 4KHSA 4KN7A 3V7LA 3PW4A 4F50A 4F4WA 2BCQA 5DG8A 2BR0A 9ICJA 3VQDA 3K59A 3T1AA 4YMMA 3QEAZ 1XC9A 4IFVA 4DSIA 3ZT1A 3HVRA 4DOBA 1ZQBA 4FLUA 4IR9A 4KLJA 3OY9A 5DB7A 1KFTA 4OPKA 4P4MA 2P5GA 4AHCA 3U3YA 1JN3A 1BPEA 3NBPA 3OYCA 4F5QA 2E6LA 3JYTA 3TI0A 3ZSZA 4TURA 5L9XA 4E7HA 4QZBA 3LDAA 3QETA 4M0AA 2UVVA 3QNNA 2A1JB 4I9QA 4FJMA 1BVSA 1HQEA 3MFHA 1IG9A 4CJRA 3ISDA 2VWKA 3IRXA 3MR2A 1ZQSA 2Y1JA 3CFRA 3Q8KA 3M8QA 1A76A 4QZ8A 8ICIA 3TR8A 5J0PA 2DFLA 3TAEA 4DO9A 8ICVA 1Z26A 1UT8A 4KHQA 3GQCA 4RUCA 2HVIA 3LK9A 4ID1A 3BJYA 1KFSA 2R8KA 2ASJA 3PO4A 1CZBA 3SJJA 3PX0A 4RW7A 3OS2A 4EBDA 3PMLA 4GC7A 4F5PA 3RAQA 4O3SA 1RTJA 3RJIA 2Q0ZX 1LV5A 1TVRA 3TANA 4KN4A 1Q9YA 2V9WA 3V6JA 3K5MA 1MC8A 4O3OA 4YD1A 4FLZA 3T5JA 4B8AB 4K4GA 1KEJA 3ZSYA 5KFIA 3ITHA 4CIGA 2ZD1A 4IQUA 2VA3A 5C42A 5KRTA 3OYFA 1LB2B 2ISPA 5D3GA 1ZQOA 5DMRA 1UAXA 4IBNA 3OYMA 2ALZA 2IOCA 1I39A 1DTQA 2X74A 2P66A 4CJ4A 4PHEA 5IIJA 1QSLA 3T19A 4FZYA 1RTIA 4M3ZA 4J9RA 3ZSRA 2UVRA 4QZDA 2BE2A 4O0JA 4DTSA 1S97A 4ECQA 2BANA 1K1SA 1BGXT 1NJWA 4J2EA 3MEGA 4DSLA 4KI6A 9ICNA 2IS3A 3VN5A 1ZQQA 3VQ8A 2VG5A 4HVJA 4UAYA 2Y1IA 3DRPA 3O3HA 4KO0A 2F1HA 4FM0A 1SKSA 5KG6A 2FBYA 1CLQA 4I2CA 5EWFA 2FBVA 1NK9A 3PW2A 4C8OA 5J2NA 3RB4A 5KG1A 1RT1A 1A5VA 3SV4A 1FK9A 4NM2A 3TAQA 1J54A 2JEJA 2FPKA 4MEYA 2J6SA 4CERA 2P6UA 3RJFA 1EXNA 1ASVA 3BGRA 1ZQEA 3O3GA 1HJPA 7ICVA 4EBCA 2Z1GA 2ISOA 4ZTFA 4DSFA 1JL1A 5KFCA 2FPLA 5KFKA 4ECSA 3BQTA 3IG1A 3AO2A 3CQ8A 4L8RB 3U3GA 4ZH4A 5DKWA 4CF9A 2PI5A 2OWOA 3SYZA 3ISCA 5CHGA 3L2QA 4YD2A 2KZMA 1JLGA 1IH7A 2M9NA 2ZJ8A 1NKBA 4E7KA 5KFRA 1HYZA 1S6QA 2HNYA 2KTQA 1JIHA 1Q9XA 5J1EA 2G8UA 4RZRA 1Z3EB 4KB0A 3AA5X 4YCXA 2UVUA 7ICMA 1IKYA 1EXQA 4Z4CA 4EZ9A 4BE2A 2DTUA 2IAJA 4F4KA 3NDKA 3OS0A 5KFHA 4QW8A 3QEIA 1S0VA 1S5JA 8ICUA 5JS2A 4FLVA 5KFJA 3H4DA 2HW3A 1BL3A 3EYZA 3M9OB 2HHQA 5J0RA 4KREA 4FS2A 3GIIA 3CG7A 1N48A 4Z6CA 3KHRA 2W9MA 5KFFA 4GVMA 4ZHRA 2A1SA 3QIPA 4IG3A 4QZFA 4ZTJA 5C5JA 2O4GA 4CJPA 4FW1A 4EYIB 3K5NA 1ASWA 4R64A 3RJGA 2QK9A 4Z4HA 4M9GA 1EKEA 4Q8FA 4KLLA 4O0IA 2V4QA 5CZ2A 4DFKA 2ZJ5A 3RR8A 5FROA 3FDSA 4MF8A 2NUBA 4NLKA 4DQSA 1ITGA 3RH6A 3OYBA 5J2PA 2KFZA 4EEYA 4B9LA 4KLDA 3DLHA 2RKIA 4C8NA 1IKWA 5E41A 1WN7A 1H38A 3V9WA 2XY6A 3EPGA 1ZQTA 3KHLA 4G3IA 3G0ZA 3KD5E 1HUOA 8ICTA 1RT2A 3NGDA 5I3UA 1VSJA 2ITGA 5SWMA 4NLZA 2AQ0A 5KI6A 4M41A 1YTUA 3V9ZA 5D46A 4FZZA 3MABA 3GIMA 2J6UA 4M9LA 3HM9A 4Q8EA 4CJKA 1RT6A 1KRPA 4GXJA 4CJFA 5HMLA 3S9HA 5KG3A 4B9VA 1XWLA 2PYJA 4PWDA 3NH0A 3TAMA 4IRDA 3MGHA 3S3NA 1B9FA 3LWMA 4DWIA 4M3UA 4PH5A 4KLOA 4QWCA 2ASLA 1NKCA 3RTVA 1TKZA 2HHTA 3KLFA 5KFDA 4RQ4A 2EX3A 2OPSA 1CXQA 4CK3A 3JPOA 3K5LA 4KITB 4AHSA 3H08A 4BXOA 1F21A 3VA0A 4TUSA 4CJ3A 3V9SA 4F91B 4XA5A 2NRVA 2XGQA 5J2CA 3NTUA 4KRFA 3LPTA 3KHHA 4DG1A 2KN7A 1G15A 4LVSA 1T03A 4QW9A 4MFCA 2ASDA 4HTUA 3RJHA 2B21A 3OYDA 4CJSA 5IIKA 4E89A 5JS1A 4CJ5A 4YMOA 3JPQA 1WLJA 2D0BA 1XO1A 3DLBA 1TL3A 4NCBA 2FLPA 3NF6A 4JS5A 4I2PA 1WCNA 4DLEA 1KLNA 1C1AA 1S1TA 8ICOA 1NJYA 1BQMA 4P4OA 3V7KA 2G8IA 2EHGA 3UXPA 4FJHA 2HNZA 2G8VA 2G8FA 4O44A 3L2UA 4E1NA 2A1JA 2BGGA 1ZQIA 4FZXC 3ETLA 2OPRA 1RILA 5J2KA 2VG6A 3G6XA 1GOAA 2HVHA 4ED6A 4RPYA 5HRPA 1B22A 2BKEA 4NLGA 4KLEA 1ZQZA 2BCSA 1VSFA 3UPQA 3V7JA 2RN2A 4IG0A 1HYSA 2PXIA 4AILC 1ZQLA 1IKXA 3QEXA 4CJQA 1IXRA 1S1WA 1VSKA 1ZQHA 4FJLA 3PX4A 4FXDA 3AVHA 1B43A 3GV5B 3ORYA 4DF8A 3VQAA 4OLAA 4CHOA 5IILA 4O3PA 3OSPA 4QZCA 5F9LA 3SI6A 9ICSA 4FCYA 2YNGA 3TAPA 3VQEA 1ZBIA 3PR4A 4IQWA 2V4RA 8ICSA 2LSNA 3AA3A 3RBEA 4E0DA 1TKTA 1VSDA 9ICAA 4M9HA 2PY5A 4AHVA 2RF2A 2YKNA 5DLGA 4JLHA 4DU3A 3DLGA 4O3QA 3SUQA 3OJUA 4KTZA 3GIJA 4CGDA 4KLFA 5HRSA 4BACA 3NGZA 4Q5VA 2NRXA 5KFMA 5DB9A 2W9BA 3LANA 2OPPA 3JSMA 4YVZA 4I2IA 1BPZA 3D45A 4KHWA 1U49A 4ED8A 4RQ8A 4QOZB 3NF8A 3ZDAA 5C25A 3RB6A 1RT4A 1SL1A 3DMJA 4N76A 3RB3A 4W5RA 3TAFA 3V9UA 4CGJA 4YFUA 4BE1A 3MGIA 1S1VA 3QZ7A 3P5JA 3MECA 3AVIA 5BOMA 4YR3A 1TKXA 9ICHA 3T5HA 2G8KA 4CEOA 5J2DA 4OKKA 3TAGA 4NCAA 5J2FA 4PQUA 4FYDA 1S9FA 3UQ2A 1NKEA 2W9CB 3ZDEA 7ICRA 3Q8SB 3OGUA 1J5OA 5L1JA 4JUZA 4O4GA 3NF9A 4JRPA 4QAGA 3DI6A 4GXIA 2YNHA 4F2SA 3AUOA 1GOCA 5J2GA 1S9GA 2PYLA 2QKBA 4CJEA 3VQ4A 3OYNA 4NXZA 2RDJA 1NK7A 4J9SA 4DS4A 4KB1A 2FLNA 1ZQFA 2ZTCA 5CYMA 2W8LA 1S10A 4RPXA 3SV3A 4KHYA 4RT3A 2C2EA 1L3TA 1ZBFA 3MXIA 1CEZA 3LZIA 4M47A 3AVJA 1ZETA 1S0NA 1L3UA 5KT2A 3E01A 4TQRA 1S76D 3KKSA 4CJTA 2G8WA 4DU4A 4DEZA 2BDPA 1C1BA 3C5FA 3KD1E 5KT7A 2R8GA 3IS9A 3MXJA 3T5LA 4FO6A 4ECVA 1NK8A 1ZQVA 4KLIA 1BQNA 3PX6A 4J9NA 4ED1A 4M9JA 4UB2A 5J0UA 1ZBHA 2PFQA 3H7IA 1QQCA 3NE6A 3NGIA 3GDXA 3SQ1A 2KZ3A 3DLEA 4QZ9A 4ECTA 3WNGA 4KFBA 4FLXA 4KLSA 4GW6A 2D0AA 3QEVA 3S3OA 2MAXA 1ZQNA 5J0XA 4IR1A 5J0OA 4YP3A 3KKRA 2BCUA 1T7PA 4I27A 3GILA 3HPHA 5L1IA 4RQ5A 2VWJA 3SQ4A 1JX4A 3HPOA 3PW5A 2YHAA 1ZQDA 1T3NA 5KFOA 4XUSA 4RNMA 4PUOA 5KFBA 1D8YA 4FJNA 3H8JA 3RR7A 4OKEA 1ZQGA 5EWGA 5DQHA 4J2DA 5J2HA 2G8HA 1WSGA 4ELTA 3AVAA 4F92B 3UXNA 2JZBA 3DOKA 2C2RA 1QSSA 1S1XA 3PVXA 2W9BB 4BWMA 2R8HA 4DQRA 2BCVA 4KLQA 1B9DA 4YG2A 3AO4A 1KTQA 3C6UA 1SZPA 1RT7A 1TV9A 1NOYA 3NGYA 4B08A 5DB6A 4X5VA 3PMNA 4CJUA 3NAEA 3TWHA 3AO3A 1X2IA 1VSLA 1VSHA 2UVWA 4ED3A 4PGXA 5KGWA 3K58A 4UAWA 3MDAA 4RQ2A 3KIOA 4IDKA 4B9TA 4K4HA 4PY5A 3AVBA 4M6WB 2OYQA 4NYNA 3VQCA 1COOA 4K8ZA 1WSIA 4N56A 5L1KA 1N56A 4JRQA 5J2JA 1HNIA 5D49A 4EP4A 3TQ1A 4AH9A 3C23A 8ICWA 3V9XA 9ICPA 1DLOA 4DL7A 4Q45A 9ICQA 7ICTA 5CR0A 3ZD8A 4NY8A 3ZSVA 4JK1A 3JPNA 4XQ8A 4CF8A 4DSKA 3ZCMA 4LZGA 3LWLA 4Y1CA 3L3VA 2W42A 4CCHA 5HP4A 2QXFA 4UB4A 1BI4B 4O5CA 1D9FA 2YHBA 1NJXA 3PY8A 5J2AA 2NRWA 4DL5A 2IGIA 1TV6A 4GXKA 2PFNA 4DOCA 3TARA 2MUTB 1EP4A 4KLUA 3FYHA 4ECUA 1D5AA 4I2HA 5SZTA 3DM2A 2FBXA 7ICQA 3KJVA 7ICIA 4CHZA 2HHVA 4CHNA 1ZQPA 2ETJA 3DLRA 4RQ6A 3QEBZ 4F4XA 8ICZA 4Z4GA 4W5OA 3CFOA 3UQ0A 4KTQA 3VA3A 3PW7A 8ICPA 4ED2A 4ED0A 3CM6A 1KDHA 3HO1A 3QE9Y 7ICKA 1KSPA 2YKMA 4QCLA 4CK2A 1ZBUA 5CB1A 1BPYA 1AROP 2O4IA 4J2BA 1RDDA 2PZSA 3HX0A 4NM1A 4HCBA 3AVGA 1S1UA 1JLFA 3HVTA 3V1OA 5J0SA 1BCOA 1VSIA 2OPQA 2B5JA 2JEIA 3AA2A 5KFSA 4CFDA 1DTTA 1L5UA 1JLEA 5FRMA 3TFRA 5EU7A 3H40A 2ATLA 1JLCA 3OYEA 1BCMA 3IAYA 3OYIA 4E7JA 1TAUA 3C2KA 2JEFA 4JV1A 2VA2A 4CJVA 4FK2A 2ZUBA 4C8MA 1A77A 1L3VA 1ZJNA 3PO5A 1RDAA 4E3SA 4M3WA 2PFPA 3S3MA 3QZ8A 3JPRA 4LZDA 3RAXA 2F1JA 3V72A 1JMSA 1JL2A 4KLGA 2JZBB 4CJLA 3SPYA 5KFVA 8ICBA 5BPCA 1U48A 3HPGA 5KFUA 5J2BA 3ISBA 1TFRA 1X9WA 4B9MA 3P1GA 2A1RA 1SL2A 4BWJA 4XRHA 5DDMA 1JXEA 1JKHA 5CP2A 1ZQJA 1HMVA 3L2VA 4WE1A 4DL2A 4YXMA 5KG0A 3BQ1A 4B9NA 3AO5A 3G10A 1R0AA 3DYAA 3JPTA 3HYFA 4I2QA 2XCAA 3JPSA 4CHYA 5KG5A 4I29A 3HP9A 3K4GA 2E4LA 2P51A 4CFAA 2BQ3A 4OLBA 5J0QA 4I2JA 4DL6A 5HP1A 1SL0A 4FJ7A 3SUOA 4ECRA 5KRSA 5J0TA 1ZQAA 4JV0A 4FBTA 4UBBA 3KLGA 3ZD9A 5FRNA 3C94A 3MDCA 2FBTA 1ZBLA 4RT2A 5DQIA 5KG7A 5HNKA 8ICNA 3KK1A 2W9CA 4ECZA 8ICKA 4Q44A 7ICEA 2OZSA 1ASUA 3C2MA 4C8KA 3G6VA 9ICTA 1ZQCA 1C0MA 1BPBA 4FLWA 4M04A 4GMJB 1QTMA 4B3OA 1O1WA 3QO9A 1X9SA 1VRTA 3VQ7A 4HCCA 3OHAA 5CZ1A 4KHUA 3C95A 2AU0A 3KTQA 3C2LA 3MXMA 1WAFA 3SZ2A 3QERA 1VSMA 7ICUA 4PGYA 3ZT2A 2BPFA 2DFFA 3DOLA 4DFMA 3LDSA 3FFIA 1ZQXA 1VSEA 4Z4IA 2JLEA 4KAZA 4E19A 4Z6EA 4Z6FA 3M8RA 2ZUDA 2ZJAA 2AGQA 4LSNA 4DTNA 1Y88A 4FM2A 4YN4A 4QWBA 4MF2A 2P1JA 2XC9A 3I0RA 4DTJA 4I2DA 5KT5A 1RT3A 3C5GA 5TZVA 4TSXA 4DTXA 3LP2A 4QZIA 4I28A 3RMCA 1U9LA 2HNDA 4H4OA 5HLFA 4ECXA 4OGEA 4Z0UA 4CJWA 4CFCA 2ZE2A 3V1QA 2RPIA 3AVKA 4F5OA 3SI8A 3NH1A 1U47A 2ZQBA 4B9SA 4MQ3A 3Q8RB 3HK2A 3QINA 3RBDA 8ICFA 4Q0BA 4YNQA 4FJJA 4R8UB 1C7YA 8ICYA 4DTPA 4O55A 4DQQA 1K6YA 5DLFA 1XI1A 2F1IA 4EBEA 1RT5A 4PA1A 1TKDA 1EX4A 2B6AA 2BHNA 2OZMA 5KFQA 4IFYA 4J2AA 1JXLA 1S6PA 7ICOA 4H8KA 1LWFA 1ZQUA 4TUPA 2GUIA 2P6RA 5EWEA 4LH4A 5HMMA 4N5SA 2DPJA 4KPYA 3KK2A 2W9AA 1HRHA 3HP6A 5K14A 4ECYA 2QKKA 3H8SA 7ICJA 4J9PA 9ICFA 1S77D 4F3OA 1B92A 5KT3A 1JLQA 1VK0A 1RYSA 1X9MA 3DRSA 1ZYQA 2C2DA 4O3RA 4CHPA 1VRUA 5IIOA 3JPPA 4E1MA 1QLNA 4R65A 3THVA 3ASMA 4CIEA 2C22A 4CE9A 1DGSA 9ICMA 1RCHA 4Q43A 4P2HA 3B6OA 4O5KA 4I9LA 3V6DA 3B0YA 2BCRA 4M6WA 4M3YA 2F8SA 4AHTA 2C28A 1RBSA 1T8EA 5KT6A 2BGWA 3RJKA 4RU9A 1S9EA 1LW2A 3LZJA 2IHMA 1A5XA 4Z4FA 3ZSQA 8ICGA 4CEQA 4YR0A 3QEPA 1EETA 3AO1A 4EP5A 5KFXA 7ICHA 1WAJA 2IDOA 1CUKA 4DF4A 4JWMA 1TK0A 3OYKA 1HUZA 1KVAA 5KFAA 3VQBA 4FK0A 8ICMA 4DFPA 2E6MA 5CA7A 9ICIA 2KZZA 1BI4A 4RQ1A 3OYAA 5F9NA 7ICNA 3P83D 4M3XA 3M8PA 4KLMA 4UB1A 3MEDA 3T5KA 2MUTA 5J2EA 4M3TA 1WSFA 9ICWA 2F96A 1NOMA 4QWAA 3OVNA 4KLHA 4QZAA 3G6YA 3O4NA 1IKVA 5HRRA 4F93B 5JUMA 3AU2A 3HW8A 4DSJA 3VQ9A 3ALYA 3I0SA 4I2AA 5J29A 5EOZA 3HSTB 4ELVA 3SUPA 4QWEA 2W8KA 4DU1A 4F8RA 3OHBA 3I8DA 3SQ0A 4CEEA
chains in the Genus database with same CATH superfamily
4N77A 1DQAA 4DPOA 4DXLA 5M1FA 1EKSA 2NZTA 2DYAA 5DG9A 3ULHA 1M90T 4WU3A 3O9RA 5B0GA 4ID8A 3HJFA 1HNXJ 2QWNA 2HHXA 1SV5B 1RISA 3EUNA 3D6JA 3CYMA 6AT1B 3M8SA 5AQUA 3LP0B 1EZZB 5K8PA 3QLHA 4UAZA 1D0EA 1WWVA 1HBNB 3BKTA 3THWB 2BE9B 5FIIA 2K60A 4PG6A 1IUJA 1FI4A 3CQYA 2BPGA 1OPZA 1WKJA 4DL3A 4IRCA 1W26A 4FM1A 1Q8IA 3T9NA 3WNFA 2DH8A 3CF5L 2L08A 2FVSA 3QYPA 3LGNA 1YVUA 5GAEP 1H2UX 3C1ZA 4BRAA 3OYLA 1QHTA 2PI4A 2IBKA 5HRNA 3OW2R 5AQFA 1VR6A 4EENA 4IJNA 4JI2J 3ZSWA 3GG4A 3C21A 4NLOA 1TK8A 2EK6A 1YVFA 5AQZA 3MCMA 3DV9A 1N34J 3EVOA 5K5MA 3LDNA 3LALA 4DCPB 4DV1K 4XDCA 3Q8MA 2CJAA 4FW2A 3BM7A 1VK8A 4DMNA 1JLBB 2AKWB 3L3CA 3SMSA 1UJ6A 4I2FA 2V2QA 4RW8B 5ALUA 1LAVA 2HK2A 2QB1A 2VDHA 3V6DB 2VKZG 3GIKA 4CGIA 3KLHB 1LKYA 3H8WA 4CVNE 2YV0X 3PUFA 1C1CB 2GLEA 2FJBB 1CLFA 1F3FA 3I9ZA 2GIQA 1ZQRA 4TLQA 1UCNA 3KLEB 1N5WA 2ITMA 3VEVA 3MC1A 3NWGA 4MFBA 4RBUA 1IQZA 2LU1A 1IBMK 4USTA 1RTDB 1Z00B 3MAAB 4X4QA 4CE6A 3SNNA 2GWJA 2AGPA 3PRDA 2ZJPL 3BSNA 3NF7A 4XIUA 1HNWK 4PXEA 2ZTEA 5T7BA 2DPIA 4FK4A 5CJ7A 2ZNZA 3CVKA 1NJZA 5B7WA 2MB0B 4RL1A 5GIOA 3PIOL 5A8WA 5AHXA 2RRNA 5J0YA 4G6VB 1KHWA 2VIHA 5AXLA 2E8NA 4DS5A 2BOAA 4KSEB 4LY7A 4YOWA 2DNZA 4EFAC 3EZWA 4J9OA 4OHVA 3HL8A 3CFPA 5D15A 2KKPA 4I4BA 3FR0A 2CGKA 1PJ7A 3DWLA 4JHDB 5E2QA 4G9BA 3PYFA 4DR1K 4TY8A 2LQ5A 5J2IA 4M2YA 5DGBA 2OA8A 3IC1A 1HHQA 1CQMA 1HQEB 2B4OA 3MAHA 3VVTA 4DHYA 1J2MA 5JLFA 1V5IB 4K0KF 2QKQA 4MFAA 1AW0A 5B08A 4U6PA 3AJDA 3M8QB 1PKUA 5HBMA 1GMWA 1XMOK 4WFAL 2B8QA 4DV0F 3Q8QB 4DV3K 2KQ2A 1TVAA 2OMOA 4CYUA 4UY85 3ZSXA 2LMRA 3LDOA 4O9MA 1LXNA 1TGOA 3OTBA 4MDAA 3BF4A 2XGPA 2ZH8A 3OW2M 2FC8A 3AU6A 1PK3A 3K5OA 4LFBJ 3C6AA 2P9IB 2Z1JA 3N4PA 1SV4A 3DDNA 5KAIU 5J2MA 1VAZA 2E8OA 4P7VA 4M5JA 4LFCJ 1M5HA 4DSEA 1RUSA 1MU2A 4ID5A 4OL8A 5EOYA 2CGLA 1LNQA 1UWBA 4WFBL 4EHUA 1BPXA 2VJ4A 2B7BB 2XRIA 3PV8A 5A0YA 3CPWR 2J9DE 4J9QA 4ICLB 5KTQA 4U7BA 3CCLS 3ISNC 4WBFA 5DBCA 3BH6B 2MY8A 5KNIA 2EVZA 5LSOA 3H8MA 2QTDA 4AHRA 1VBXA 2AJ1A 4FJIA 2WONA 3O4QA 4UQGA 2CZ4A 1GTHA 4PEOA 3C46A 2VD3A 2X1BA 3KDNA 3MMAB 1DTQB 4JV2A 4KHRA 4MO4A 3RH4A 2FJDB 1T9YA 3EVMA 3VQ5A 3PYGA 3HULA 4NI2B 1U04A 3AY9A 4DPTA 2BE2B 2OO4A 1RZTA 1X4DA 1FXXA 4OPJA 3J7YI 8ICHA 3TO8A 2YI1A 4QIEA 3HZGA 1RDCA 4DQIA 2J0SD 1XQSC 3ZYYX 2PFOA 3RUBL 3DRPB 2ZKUA 2XULA 2FUG9 3C2PA 1GMUA 2NS1B 5HMWA 3S7RA 3SAHA 2D1CA 1DZ5A 4B8CA 4FJ9A 1N36F 1RT1B 2KNJA 2W04A 3CP8A 3WC2A 5DETA 1C4CA 1ZQYA 1DJ0A 1ZXIA 4JK9A 4JI1K 4BGDA 4YOTA 1FKOA 4HHUA 3BS7A 3TEGA 3BGRB 2FMPA 3ZT4A 2QL5B 3IR7B 3OFEA 8ICQA 2JRSA 4WFZA 1A5WA 3EZUA 5FPEA 4UT4A 1QE1A 2ZG6A 3UMCA 4FWNA 1DGKN 3CMEN 2E1RA 7AT1B 1FHTA 3N97B 3WQPA 5HVHA 1OWXA 8ICJA 4I2EA 1Q8LA 1OYDA 1FD2A 1GTEA 1LWXA 4JKFA 4USVA 2VODA 3HWTA 5AM1A 3DXKB 2XO7A 1MQ3A 2HGMA 4MKVA 1Z25A 3HOTA 3NCIA 1BMQB 2D9OA 3PYEA 3CI5A 1IKYB 2IC3A 4JOUA 3LDLA 1YIJN 4FF2A 1KD1O 3CGIA 1SKRA 3GV7B 2W6LA 2HQ3A 4LF9F 4TQSA 3TSQA 4ZP8A 4FWPA 2QN6B 3K17A 1LWEA 2KG0A 2WFBA 1DOQA 3C15B 5DB8A 4CLWA 3CPWM 1WSJA 2I5JA 2JFDA 3ZX0A 4QZEA 3F9KA 4IKFA 2FZCB 3MEEA 2XZWA 3OYHA 4IG3B 4Y2VA 1GOBA 2A10A 7ICGA 3HILA 4DV7J 4U95A 2VFTA 2OTJS 2HHHJ 2KXHA 1DXSA 1Z4NA 2HDOA 1N4LA 2KEYA 2HFZA 4UUWA 5AJ3F 9ICXA 4HUEA 1H74A 1UCVA 3ZTSA 4QZHA 3Q86A 1BISA 4RQ7A 1JCFA 4U8VA 5HHIA 2LYHA 1C0UB 3UWTA 3R5GA 5E0OA 1O0PA 1S0OA 1NZPA 1ZD2P 2F4VF 4AE5A 4DPYA 4US9A 8ICEA 4GV6A 1RBTA 4IFEA 1TUYA 5IT9U 3D2FB 4RG8A 2RLTA 4WF9Q 3T3FA 2YKAA 4HYKA 2G5IB 4UQTA 2I7NA 2VICA 8ICRA 3DC2A 2W7AA 5E84A 1PO6A 1GLBG 4Y2UA 3A8YA 3U6FA 2QWMA 1RT6B 2O8BA 3EWAA 4GV3A 4C2MA 3NVZA 3N6MA 4ZLLA 1N6QA 2UXDJ 5DG7A 1VLBA 4WXOA 1T3QA 4KGZB 4LFAK 5AI9A 4ZS6A 1VMBA 4E8UA 3D9BA 4NCGB 1FRHA 3ISND 4AUKA 3TAMB 5BRHA 2V2KA 3GMGA 1JCGA 1AFIA 3R27A 2YJFA 1I94J 5M2PA 1YBTA 1FT8A 1NGFA 3O4WA 1KEKA 3C6TA 4UB3A 1Q82O 2AJ0A 2O6KA 4P52A 3B0XA 3MPYA 1TAQA 4XO0A 4BDZA 2X6SA 4CLTA 3RMBA 2YX7A 4FJKA 1LOUA 4PG4A 3WUHA 2FF6A 4CLPA 4P4PA 2KFNA 3H5XA 3I4HX 4W5NA 1R27B 2VU5A 1I3AA 3SCXA 1VBZA 1VI7A 2G0JA 4U8YA 4CRJA 1QSYA 4KHSA 2H3ZA 4MHVA 2O8DB 3H98A 4OI3A 3SMVA 2BR0A 3J7AP 1VRQC 3G82A 1N34F 3T1AA 4YMMA 2KG5A 3B8AX 2XLJA 4X84A 4QR0A 2GHVC 4DOBA 3IGNA 1RAJA 1G4CA 4FLUA 4I2PB 2EANA 3DRXA 1HUXA 2KHDA 1S1TB 3KMQA 2YB1A 4P4MA 3U3YA 3NBPA 2E6LA 3TI0A 5L9XA 1WD6A 3PFEA 3F2BA 2V7ZA 1HR0K 3C14B 4O44B 4ISEA 4W98A 1O8BA 2UVVA 2PMHA 2EFVA 4RWWA 2VQEK 1BVSA 3JSYA 1DAXA 1SC6A 4CJRA 2FTRA 5A8KA 1ZQSA 2AJ4A 2VG6B 2NZ4A 5FP0A 3CCQS 2JC0A 3OBIA 3Q8KA 2ZIVA 1A76A 3IAS9 3O1BA 3MPVA 2GZOA 4HH1A 2DFLA 3TAEA 4DO9A 3CJ9A 3AA9A 1R8BA 4JKCA 1YJUA 5A2QU 2YKPA 4K4VA 2D8CA 4FOIA 3LK9A 1D8BA 4IG0B 4EO8A 1OVYA 5B0AA 4BG9A 4CRXA 2HF3A 3SBGA 3THPA 3AH6A 3PX0A 4XK8C 5IQ6A 2LMIA 4RW7A 1SIZA 2W4DA 2CAJA 5A76A 3PMLA 1OH6A 4CBXA 1NCLA 4ILRA 2RS2A 1UETA 3SCIE 2HRYA 5LXRA 2V9WA 4DV4K 2G0CA 1KLMB 3G6EN 4ZVUB 3T5JA 1F0XA 4B8AB 4LRBA 2EFOA 2DXFA 1K9MO 1H2TZ 5KFIA 3ITHA 2C3YA 4AQYF 1T94A 3E8OA 5C42A 2ASYA 3BZKA 1FRIA 3U9DA 4NMXA 2ISPA 2YKNB 3THXB 4CQ1A 1K8AT 3NL0A 3UFCX 1F5BA 1I39A 2P66A 5BXIA 4CJ4A 4X64J 3AARA 2CDRB 1RTIA 5GTHU 4B3TK 2UVRA 1ITPA 1SV0A 4B1UB 2OPPB 4ECQA 2BANA 4WIIA 4HKQA 1NJWA 2DT9A 1QH9A 1PVRA 3MEGA 4KI6A 3VQ8A 2OLWA 4UAYA 2JHDA 2ZFHA 2Y1IA 2ZVIA 2XI2A 2O67A 2F1HA 4FM0A 3W65A 4KHPJ 1AXQA 1CLQA 2J76E 1SH0A 2B9XA 5EWFA 2FBVA 1AUDA 1PYSB 4C8OA 2KIVA 2LYAA 5KG1A 1A0OB 3SEIA 1A5VA 3SV4A 4NM2A 1J54A 2ES6A 4CZFA 2EK1A 3BN7A 4I64A 2J6SA 3VETA 2AA4A 1WI8A 3H5UA 2UUAJ 1MROB 4PQUB 3WU2U 4OYMA 3NVMA 3O3GA 5BYRA 2Z1GA 1PAEX 2MTLA 4FF1A 4MK7A 1T9VA 3M6VA 4DSFA 2BJ8A 3CO9A 4ZVOB 1J5OB 1JL1A 5B0FA 4M95A 1U0HA 3DI6B 3AO2A 5ETVA 1G6BA 3EDQB 3P45B 4J03A 2Z4PA 1S99A 4IH6A 4OZ2A 4L8RB 3U3GA 4ZH4A 4HHHA 5DKWA 1MW7A 1WC1A 2AEFA 4UB8U 3G96A 3Q2TC 2B43A 3UN5A 4MYUA 3R1LA 4YD2A 1JLGA 2DTJA 3JXOA 1IH7A 2M9NA 4E7KA 5KFRA 1HYZA 2HNYA 1Q9XA 2JNJA 3FCWA 1MLAA 1VQ4S 2BJDA 1XR5A 1NZAA 2GQQA 4YCXA 2UVUA 3THYA 7ICMA 1EXQA 2DTUA 1GT8A 3QPIA 3J7ZO 5KFHA 1E6YA 2FHJA 1NGGA 3JB9k 3NCPA 4X4PA 3C19A 4F67A 8ICUA 4FLVA 3H4DA 1C1BB 4BRDA 3RBZA 3CJKA 4P71A 4XEIA 2EBEA 1YJ9S 2I5HA 4CF5A 1NGBA 1BQNB 4Z6CA 2M4MA 5ALRA 2H65B 2A1SA 1BNOA 4ZTJA 2AH5A 1DK2A 3P4UB 2O4GA 2P9UB 2NYVA 3PZPA 4EYIB 3W2VA 1NGIA 3RJGA 2V6AA 2K8AA 4KFBB 4M9GA 1SVDA 4KLLA 3MOJB 4O0IA 4CI6A 3KWIA 4DFKA 2ZJ5A 1R0BG 2Q31A 2MQMA 1ITGA 1BWVA 2P9LB 3PYDA 5DDQC 3OYBA 1T6CA 4B9LA 2ZOGA 4NYPA 5C12A 1LEOA 5G0RA 5E79U 4C8NA 3NKYA 3ULEB 2XY6A 4BROA 2DNQA 2ZD1B 3KHLA 2I2YA 4LSZB 1RT2A 5AKZA 3EICA 5KI6A 2RP5A 5EXWA 4BBYA 1YTUA 3V9ZA 2OUGA 3JS6A 3MABA 2A5XA 4UY8O 4C7ZA 2A3VA 4Q8EA 2VH7A 4O4RA 3BGLA 3Q24A 2RIJA 1TL7A 4KBIA 5KG3A 4JYAJ 1RT7B 2ZZMA 2L9WA 2PYJA 4PWDA 3RSEB 4IRDA 2DGWA 3CJ0A 5H9EK 2ZZNA 4DWIA 2DEIA 2W3RA 1VQ8S 2HHHF 4CDIA 3NGRA 1TKZA 2HHTA 2YHXA 4CK3A 3GB0A 1TELA 4IDKB 2GS8A 3D67A 1RCOB 1U0SA 2VOOA 2H54B 1UVKA 3V9SA 1IBLK 2XGQA 5IT0A 3MWPA 4LR9A 4CLKA 1FJCA 4DG1A 3MGVA 1T03A 4QW9A 1GEHA 2BJ9A 1L8OA 1FDAA 2CPIA 2ASDA 2DQNB 5AK4A 2E29A 3PKMA 4BRCA 3MM6B 1RQLA 2WSFC 4USKA 5DJBA 3T79A 3D2NA 1Y7PA 2ZC3A 2ATCB 2HBLA 4DR4K 4NRUA 1VHXA 3OLAA 2MZJA 3A5NC 3AAPA 1VQ9S 1C1AA 2ZIXA 2WW8A 4FPBA 1BQMA 3FAHA 2LFVA 4L76A 2DY9A 2DIVA 3DM2B 4FJHA 3EDRB 2HNZA 5LL6Z 1I94F 2A1JA 2BGGA 3ETMA 4JI4K 4M5GA 1PYOB 2OPRA 2ZBRA 1BU6O 3ENWA 4KE5A 3G6XA 4P0QB 4IOBA 3CIZA 2KE7A 1B22A 4CO3A 2BRKA 1WOSA 4YOUA 3TADA 4O5FA 3UPQA 3KG0A 2IVYA 4ZP6A 2G07A 5TKYA 1S1UB 3M1VA 1JLFB 3HVTB 2E20A 2XMKA 2GO7A 2AIRB 2ZUGA 4OI6A 3VAHA 1KAZA 2KJ9A 2K3KA 2W41A 1VQ7N 4UZBA 4WP8A 3AVHA 5AQWA 2ZF5O 2B56A 2HHPA 1B43A 3ORYA 4DF8A 3R5JB 3VQAA 4Y34A 3D1OA 2NZCA 4DZ6A 2BE7D 5ALMA 4Y28C 4QZCA 1DURA 9ICSA 2YNGA 1ZBIA 4YOXA 3PR4A 2HBKA 3A8IA 2V4RA 8ICSA 4YY3J 3AA3A 3RBEA 3CD6S 4E0DA 1VSDA 9ICAA 4KT0C 2YMLA 2ZJRL 5F8NA 4PWUA 3DLGA 3SUQA 2HQGA 1GQEA 1ZM4A 3CMAS 1WELA 4KLFA 4PL7A 4R0EA 4ED5A 5HRSA 5GMEA 3TZXA 3NGZA 3HKZF 1Y9OA 2Y3YA 3D45A 3H25A 1X9JA 4ED8A 1FVQA 4WE1B 4IJAA 2BABA 4FWRA 3NF8A 5C25A 3R6GB 3UDVA 2FHKA 1R0AB 4F71A 3KLFB 2OPSB 1PBAA 3GDQA 1FWPA 2OANA 3WK6A 5D78A 1XC3A 1OIAA 3FZ2A 1HBOB 2YX4A 3D3CJ 1S1VA 2C2NA 4PJ0U 1K73T 2PA3A 4YR3A 9ICHA 1Z1BA 4JKEA 3MN7A 1P9YA 3CJBA 3TAGA 2CWKA 4K7QA 4H5NA 2VUGA 3KK1B 4LF8J 1ZRMA 3GZ7A 1N5XA 1FXLA 5L1JA 2A41A 2V34A 2HVEA 4JD2B 4NLWA 2AW0A 4JI6K 4GXIA 2YNHA 4F2SA 1GOCA 2JV3A 2P6SA 2DF4B 1PUZA 3CXCM 2QKBA 2KYXA 5IZHA 1VIOA 1N88A 3N6LA 3VQ4A 1BD6A 5HK4A 3MM7A 1CC8A 2XSJA 2QWPA 3KUGA 4PZOA 4NXZA 2RDJA 1A6LA 2WB1C 2FLNA 2ZTCA 3CWJA 4DHVA 3ID6A 4C4SA 2W8LA 4RPXA 3SV3A 3S6JA 1PILA 1VDHA 5CXTA 3M30A 2LPEA 2KXNB 4M94A 3I1YA 3I0RB 4ZIWA 4BRNA 1XIQA 4CLZA 4B1VA 2R8GA 2CPZA 4Z7YA 3IS9A 3RBXA 2HBJA 3VAGA 3LP2B 4FWMA 2G5HB 1DQ9A 3KKFA 4JI0F 4F26A 4J9NA 4M9JA 4K41A 4OHXA 5J0UA 2CQCA 3K5PA 2HMPA 3E51A 4LR7A 3H7IA 5ALEA 1BY9A 2V94A 2QWLA 1ZD4A 3GDXA 3SQ1A 1PSDA 4MIBA 3DLEA 3BP8A 2RU9A 4KLSA 4X4TA 2M5YA 3CJ8A 2H4YB 2YTCA 2AZ1A 2JJ4D 2D0AA 1ZM3A 3QEVA 5J0XA 4IR1A 3NCQA 5J0OA 3M32A 3AQOA 5M1NA 4PG7A 2YTUA 2UUTA 1RHKB 2E9RX 3GILA 2BZ2A 4DBQA 1VQMN 3BYRA 3LPEA 1OY9A 2VWJA 4IFYB 3GR1A 4YOVA 3HPOA 4DR2J 1S6PB 4YMEA 1ZQDA 2Y0BB 3I55S 4CLUA 5KPRA 1TE2A 2FIUA 2HBZB 4QZVB 2GNKA 5KFBA 4FJNA 3H8JA 3RR7A 3QBXA 5EWGA 1YITN 5A8RB 3H46O 4J2DA 4RO0A 3DXBA 2JZBA 4OI1A 1S1XA 3NMUA 4BWMA 2V0NA 3OUYA 4KLQA 2BCVA 2L9NA 3Q23A 4YG2A 2LHTA 4WCEQ 1J5EF 1NLKL 3C6UA 2ZIWA 3MM9B 4NLRA 4CJUA 2N3OA 5D0EA 2JLFA 3ZZRA 2AJFE 2LKYA 5KGWA 3K58A 3C6HA 5AM5A 4TYAA 3GJRB 1SAZA 5ALHA 3MDQA 3JQMA 3KIOA 4K4HA 4PY5A 3AVBA 3M2VA 3VQCA 1TKXB 4C48A 5MAOA 5HI7A 5L1KA 3HSZA 1N56A 1RWKB 3S41A 4EP4A 4AH9A 8ICWA 3V9XA 2DR6A 9ICPA 1DLOA 2ZH2A 4DL7A 1CBKA 4Q45A 1YWXA 4X4NA 5CR0A 3HZEA 4C7YA 4PWWA 4PZVA 2MGZA 4O23A 1EETB 1I1GA 3ZSVA 5CHCB 3DHXA 3JPNA 4DSKA 3ZCMA 1U6ZA 2GO8A 3CT9A 5HP4A 1TTHB 4UB4A 1BI4B 3GYXB 2OCEA 4ZVSB 4DJBA 1RLDA 4LQ3A 2YKOA 5HMZA 2NRWA 4DL5A 2KJWA 3P3DA 4A59A 5BJRA 3M8PB 3HHKA 2MUTB 3QUTA 4KLUA 5LMNK 3OBYA 3FYHA 4ECUA 2RE1A 2RH3A 1D5AA 1R8HA 4DX7A 2P9NB 2FBXA 7ICQA 3KJVA 5A6WA 4CHZA 2PMWA 1RWPB 4B3SJ 3ZZPA 4E98A 4ZVPB 2FJXA 1QQMA 3DLRA 3Q8YA 4QU7A 3QEBZ 8ICZA 5J1PA 4W5OA 1IR2A 1RHUB 3HHDA 1TQLA 3NXZA 1M1KT 8ICPA 2GVZB 3ZETB 3SQGB 3P96A 3D2EB 3R5CA 3MOZA 4CZLA 1D09B 1T3VA 4ANDA 2WB1D 4N8OA 1CULA 1TL5A 1CPZA 1BPYA 4M5LA 2KV2A 2AEJA 1Q7LB 2EPIA 4JI5F 3WC0A 2IRUA 2NQPA 1U2FA 4NA2A 3MPUB 2DIUA 4FWKA 3HHLA 4WJBA 2OPQA 2B5JA 2RQMA 3W1YC 2EFNA 2KO1A 4WYWA 1KAYA 1JLEA 4R25A 3H40A 2ATLA 3KJQB 5AQJA 1S6OA 3VGLA 5AQXA 1BCMA 2RRDA 2XS7A 2VG7B 2ZH9A 2KOBA 3C2KA 1TAUA 4R79A 1CJUA 2XI3A 4E3SA 4M3WA 4XH1A 1FEZA 3W8GA 3IXQA 2PFPA 4B3MF 3I5AA 5K8NA 3A3PB 4JBCA 3H1VX 2F1JA 3BGOP 2V8GA 4KLGA 2E88A 2BKOA 1S22A 4CJLA 2HOQA 5KFVA 2BJEA 3IP4B 8ICBA 2GFFA 2ZM6J 2HKEA 5J2BA 1EHWA 3P5BP 2KRBA 3OTOK 3P1GA 3TACB 3OPKA 3D28A 4P74A 4P2FA 5IC4B 4XRHA 5FDLB 1X6JA 2AP6A 1JXEA 3QU2A 1KC8O 4PYDA 4PL2A 3AT1B 3CCUS 5K8MA 5DM6Q 1YJWS 1VJ5A 4DCJB 2YNIB 3AO5A 3CC7N 3HYFA 2MQ8A 5HROB 2QLFB 4I29A 3CCSN 2KSOB 5J0QA 2XWYA 2VBXA 5HP1A 1RWXB 3HSCA 3NS1A 4UBBA 1G2EA 5F8LA 4NXNK 3C94A 3TSUA 3R97A 5DQIA 2E66A 2W9CA 8ICKA 5DDRC 7ICEA 3IMQJ 1ASUA 1C0MA 2V4JA 3E0FA 5T14A 1VRTA 4DPUA 2VPWB 3VQ7A 4K0KK 3F5TA 5CZ1A 4KHUA 3C95A 2AU0A 3KTQA 5GADU 2QWRA 1WAFA 1ZPVA 4DV0K 1QVGM 3O9QA 3IFEA 2E1ZA 1MN9A 3HJVA 2BPFA 2A42A 3CC2N 3POTB 3H0PA 1VQOS 3LP1B 3MX2A 5AM2A 1GLAG 4Y2KA 1ZQXA 1VSEA 2AEMA 4KAZA 4E19A 4Z6FA 2XZTB 2ZUDA 2GELA 3HBTA 2V8PA 1Y64A 2CG4A 4LSNA 5AE1A 4DTNA 3BR9A 4DR5J 1CJTB 3J8AA 3F41A 3WIUA 3I96A 1ECWA 3AQFA 1ZM9A 4QWBA 2QYCA 4GO7X 3QNMA 3PSFA 3ZFVA 1RT3A 3C5GA 2WHOA 2UUCJ 1QAYA 4TSXA 1U1PA 1X42A 2QLBB 4LSLB 5I3QA 2Q3PA 3WBZA 3DOMA 1W2BR 3RMCA 5EY4A 4ECXA 4OGEA 4PPZA 4LRFA 2WOMB 3A5MC 1F5AA 4CLYA 1GLDG 4YOEA 5DM7Q 4IEIA 2UXCJ 4LUBA 4B9SA 3MCSA 4MQ3A 4UTGA 4H0OA 8ICFA 5KL1B 4Q0BA 3KVGA 2RQKA 4QQBA 4YNQA 5HATA 4R8UB 2WW4A 4DTPA 1IR1A 3MMVA 4BRLA 1Y11A 4DQQA 1GNKA 4HT7A 2OZMA 3NUQA 6FD1A 4A8YA 4J2AA 3KLIB 1LWFA 2HURA 3A5OC 4TUPA 5JJBA 1NDKA 2GTDA 2QSFA 2CQ1A 4LH4A 4LF5J 4N5SA 5CH7B 4KPYA 2LQJA 3CRXA 3OTEA 1N36K 3HP6A 2R7UA 2HSTA 4TYBA 1MNEA 5IT9Y 1HKGA 2QKKA 1NGCA 3H8SA 2ZH7A 4CT9A 7ICJA 9ICFA 4F3OA 5IXUA 3KK7A 4CZGA 2P2CB 1MA9B 4ZN3A 4I68A 3GCXP 1VRUA 5IIOA 3A13A 4YB1P 3H3NO 3ASMA 4E2FB 2C22A 9ICMA 3CJ7A 3CNHA 3C16B 4RW4B 4O5KA 1SJ1A 2F8SA 1HPZB 2WF8A 4AHTA 2F9TA 1WHXA 2W03A 3M4XA 2WK4A 2BGWA 3IUCA 1HNVB 3QGIA 1NNLA 4GKJK 3KZBA 1S9EA 2QO3A 1KDNA 2E2NA 1F60B 2DH9A 4DR2F 3KZXA 1DRZA 1RE1B 5ETTA 4EP5A 1BA0A 5KFXA 7ICHA 2KL8A 2LEBA 4LF7J 2KT2A 4Y2TA 4TU8A 3OYKA 3UKUA 4IO9Q 3LPYA 2I6WA 3A0HU 4GMKA 1Z1VA 1F9EB 3OYAA 5F9NA 3K1ZA 2N7CA 2E5LJ 4ZJQA 4DV5K 3BDEA 5KOXA 2E5SA 1DK3A 4Y3CA 4KLMA 4WKRA 1W2BM 1WSFA 9ICWA 5F3TA 5LY3A 2XWXA 3LGHA 2G0IA 1V3SA 3HHNB 3CD0A 1T3OA 2QX0A 4NPOA 4TLRA 2WTUA 2ZWOA 1Q3UA 1U2RA 2RDDA 1FJEB 1JROA 2N1RA 2QMUB 3L7OA 5AQLA 3N4WA 3I0SA 1U2CA 1K47A 3JSRA 3OHBA 1UVJA 4CBUA 1Y5LB 1HNWF 2IRYA 2CIMA 2NXUA 5KL8B 1KBUA 4L75A 3KD3A 4DX8H 3B54A 4ZPTR 1IV0A 1S6UA 1QDUB 4O3NA 4RNNA 1RBVA 1L3SA 3PEJA 3BBFA 3I28A 1UFWA 3AVCA 1HBUB 3CIPA 1PCAA 2ZBCA 3KJNB 4Y2XA 1R3NA 4TKTA 5A2QY 4F3QA 3DN9A 2LDIA 5J0WA 4ZCMA 1HNXK 5U47A 3DRRA 2WVEA 3FVYA 2ZJQQ 3DLKA 3O9UA 1J97A 4HDHA 4DOZA 4RNOA 5AE3A 4LJMA 4B3SF 3RGIA 5J2QA 2UU9J 4HR2A 2BYCA 4RCHA 2O8CA 3N0VA 4PG5A 3IDHA 3VALA 3M2RA 3MFIA 3VGSA 4A8OA 4DV3F 8ICCA 4IOXA 1VLYA 2H5EA 2W4CA 4F5NA 3AVMA 1U02A 4OJRA 3UN2A 1WTFA 2DUYA 5E33A 1VQPN 4I2BA 3UN3A 2KW4A 9ICKA 1PAUB 4RW6B 3K0SA 4CEAA 3N4QA 1PK1A 2HQCA 4LBPA 1UA1A 3X1LB 4YOYA 4FBUA 1VS3A 1YHQN 4K4WA 1CZ9A 2LA6A 4FXWA 1TMMA 4JI2K 3V81B 2XTJP 4CLSA 9ICOA 5AZJB 3DLLL 1YTAA 5IINA 4PXDA 3NLCA 1Y0HA 4RKUC 4CZCA 2KB2A 3A8KA 1N34K 1U25A 5DBAA 1C6VA 4BLGA 4U67Q 5JVHQ 2QT7A 2V63A 4Z6DA 3ZT3A 1ROFA 4Y2QA 1X40A 2ZHAA 2QEXS 3W2WA 3IHQB 3DCAA 1VC0A 4QIWF 1VLOA 4QWDA 1YQHA 5IOLA 1K1QA 4UF4A 3H8YA 4ANEA 4TNOA 5LM7E 4FNIA 2QA4S 3CDBA 1G1XA 2JOQA 3ICLA 4CGFA 4ZA1A 3CMES 2ZM6F 3OL9A 2Y1LB 2MQQA 5ETSA 4BGBA 1CJVA 1FX4A 5DDPC 4Y1DA 3I31A 4NA1A 3BEXA 1TUUA 1WJ9A 4JWNA 2CQ2A 4NLNA 1RG6A 2G13A 3WEEB 1JI7A 2Y9HA 3VHQA 4URSA 1YIJS 4CF3A 1TFYA 4KV8A 3CEDA 2QARB 3V1RA 3MAQA 5AXKA 2PMZF 4QYZJ 2EAPA 3UCUP 4IL6U 3IRXB 1T4GA 4I7FA 4YB5A 1EQ0A 2HHSA 4ZVQB 5LJWA 4JI8J 1MQ2A 3QQCD 2R7YA 1SB3C 2DCUB 1XMQJ 4YMNA 2PKEA 2J9CA 2BKNA 3MUVP 4HHTA 2QG9B 3SUNA 1JLAA 5T7LB 1WSHA 4DZDA 2ZTDA 2CXYA 1HI0P 4XH4A 3MMCA 2CNOB 5AQKA 3UXOA 3KXDA 2Q6CA 2E5JA 3LAKA 4QJVA 2HBMA 9ICEA 2YNFA 4DOAA 4ECWA 4YFKA 2EKNA 3QRPA 2HBQB 3F2DA 3EGWB 3WK7A 1RTJB 1WC6A 3AAQA 1ZJMA 2FY1A 2NRTA 4IC9A 1SJQA 1ATNA 4LQ9A 1AYEA 5I3PA 9ATCB 1JQGA 2BBEA 3D6RA 4IOAL 3HTVA 4DU8A 1F6TA 1DBDA 4OZ0A 3BO4A 1OSDA 4LFCK 5D3GB 3CCVS 4O3MA 4J91A 5HANA 2D3DA 5EUHA 2XY7A 1ZZNA 2UUCF 1NLVA 5HR6A 1VFJA 3H2VE 2X51A 1NM2A 2GWSA 1LWCA 2HIYA 1GO3F 2KN4A 3A0BU 3CSKA 3QBWA 4MLEA 1VHIA 2GIRA 5BREA 5ETOA 3KHGA 2WVDA 4C0HA 4Y6IA 1Q46A 3AOCA 1UWAA 2JGUA 1HX1A 2UXCF 3AVNA 4ED7A 4C1NI 4H4MA 1GLEG 1B0PA 1ZZFA 2ZIUA 2D3O1 1XHZA 4RPZA 3R9LA 4CF1A 3NVKA 1SUQA 2XHCA 5AM0A 1Q18A 3NGKA 1FK9B 3S01A 4I2GA 4DFJA 2ASOA 5JMNA 5LXYA 4M9NA 3UR0A 1HA1A 4R5PA 3O3FA 2XBPA 3CCRS 2PT0A 4Y2AA 2HBRB 1MMNA 3R8YA 2EEYA 1Z2ZA 5JMVA 3RRGA 4Z7CA 4O5EA 1BHLA 5AKJA 5DGAA 1BPDA 1QVFM 1I5OB 5ALIA 3VGKA 2LKZA 1UOCA 2RHKA 3MM8A 1SH2A 1H73A 1U1QA 4KLTA 2I0XA 4EZ6A 1LK7A 1GFWB 2H51B 4MAKA 2LXFA 3D2QA 4KR0B 2FLLA 4CGZA 3HVWA 2AWZA 5C24A 1FW6A 4LF6J 3OYGA 2K3IA 1F2HA 4F3TA 3QT5A 4OGCA 4DQPA 4RTFD 4MO5A 2FZKB 4F5RA 2DITA 5HMXA 4OYZA 2IIHA 3F73A 3EXYA 4O5BA 3US5A 5CR4A 1SWVA 3RJEA 1NK0A 2DNNA 2EW9A 1NK5A 3SSRA 2PO4A 3L95X 5AQOA 2FPMA 4ER8A 3QU7A 3CULA 1CS4A 4I0WA 4K2JA 2D0CA 1YLXA 4WQ5C 5AK3A 1SV5A 4OVLA 4IQTA 4IQVA 3D6TB 3LP0A 4DR3J 4W5TA 2Z30B 2B51A 4ZHRB 3QIPB 1HBNA 3THWA 3J7A1 2V68A 1YX2A 1FJGJ 4DCCA 2E5LF 3TABA 3BQ0A 3B6PA 1OH7A 3AN1A 2AQ4A 1TL4A 2FD2A 1A7GE 5KFYA 4GC6A 1HR0F 4UBCA 1YJRA 4F0MA 3CJ2A 2VQEF 2VYPA 4LR8A 3UE5A 5J2PB 5TISU 1X5OA 4DV7K 2RKIB 4PHDA 4UOFA 5LMUJ 3NWRA 4C0BA 1A6SA 2P9KB 2FSNA 2HHHK 8ICAA 4FVMA 2WONB 1N60A 3ZZYA 4Q2LA 2HQIA 4LD0A 4KGKA 5BPLA 2LI6A 1U09A 2DRDA 3QYYA 1NG9A 4FS1A 1U6FA 3NCRA 2LU2A 3D3BJ 3RW7A 2NV3A 3CC4S 4DR6J 3AVLA 3O08A 5IIIA 2W2PP 5E3AA 1RXVA 2LBOA 4ANCA 5BYSA 1JLBA 2HVZA 5AQRA 4N41A 5ADXA 4RW8A 5KFNA 4QS8A 1J9AA 1WOOA 2R9LA 3EPIA 4HI1A 1TL1A 3KLHA 1OW5A 3NH2A 1C1CA 4C3LA 1RDWX 1UT5A 4OX9J 2QLXA 3NNHA 4MIAA 4LF4J 4BXOB 4KGXB 2XHBA 4F4AA 4GVLA 3KLEA 4R66A 4LT6A 4LIRA 4CO0A 3CJQA 3ZT0A 1MSWD 3QT8A 3UW1A 2ZOMA 1Z05A 3D1QA 3A0IX 3VZHA 4R63A 1RTDA 2UU9F 1Z00A 3MAAA 2J7WA 1I94K 1HNZJ 2KVCA 3AQEA 4TUQA 1NGHA 3OSNA 5DZ6A 5BPMA 4B9UA 4KN7A 1RB0A 3V7LA 3PW4A 1KQGB 1WOPA 9ICJA 4X62J 3VQDA 3SLCA 1WKLA 2G4BA 5AKIA 2WUSA 4DSIA 3EUB2 1TL3B 3VEWA 1L6NA 3GG1A 4XTTA 5ETMA 1O5JA 3ADAC 3K9JA 3SFGA 1JN3A 1BPEA 3LM2A 3JYTA 4TURA 3EWGA 4JHDA 3P49B 2UV8A 4E7HA 4QZBA 2ZZTA 4FZMA 5ALLA 2W11A 3HI0A 2WBNA 2K8GA 3QNNA 5B0EA 1UAWA 2OEKA 4BRKA 1RGIA 4I9QA 1HQEA 3EKSA 1IG9A 1ZRNA 2GMHA 2VWKA 2P6TA 2ZXIA 1S12A 3IA0A 3M8QA 2W01A 3AOBA 3M8YA 4OO1J 8ICVA 1UT8A 5BR8J 2EZXA 1N8RT 1NBWA 5AI4A 3GQCA 4RUCA 1WDDA 4Y2PA 4ID1A 4AYBF 2MMYA 1HYSB 2P9IA 1KFSA 2ASJA 1X6IA 1S1WB 3WZ0A 3MWBA 1EQMA 5EVZA 1S4FA 2BDUA 2NXEA 3M2UB 5IWAJ 3QNWB 2HCFA 4O3SA 5C10A 1KQQA 2QJ3A 2FPHX 1ILYA 3G8SA 3J7YP 4KN4A 4A8MP 3H0LB 4BR0A 4EUVA 1HHTP 4YD1A 5LSLA 4FLZA 2BM1A 1FFGB 3OXFA 1QQ6A 1P1LA 2F1FA 1F9FA 3GTYX 2A3ZA 3QRQA 3ZSYA 1YKWA 3SQIA 1TKTB 3AHPA 4BRIA 2VA3A 1PBUA 4RLEA 4WWSA 5GVQA 2DRBA 3SSQA 2RF2B 3OYMA 1NNDA 4BC4A 3MI7X 3MMAA 2O8BB 1DTQA 1XMQF 2YMPA 1QSLA 3DXSX 1Q1KA 1IBKJ 1QTNB 1WEZA 4A47A 1KAXA 4J9RA 3R1HA 3TRGA 2BE2A 2R7RA 1K1SA 3OTCA 2QV6A 4M8LA 4DSLA 4GVBB 4CO4A 1ZQQA 4DUZJ 3QJJA 3E66A 4BRMA 3DRPA 4FF4A 3O3HA 2VFUA 3HD2A 2XMAA 5ALNA 5KG6A 2FBYA 1LKZA 1RT4B 4X64K 3G71S 1RA7A 2KHCA 3IG5A 1EIYB 1NK9A 2MZTA 4BR5A 1RT1A 4MKYA 1R89A 3MECB 2JEJA 2FPKA 2FDRA 2B4PA 4KHMA 4CERA 3RJFA 3D6MB 1ASVA 3JAMO 3BGRA 1ZQEA 5GAHI 4KHPK 4EWTA 4EBCA 2ISOA 4KH1B 3FQLA 5KFCA 3KOAA 2DCLA 3G82B 4OV6A 1O13A 3NVYA 2FJVA 2IBOA 2WHEA 2YBVA 2DNYA 3IRUA 2IA0A 1ACMB 2RHSB 1T9XA 2PI5A 3P39A 2OWOA 1Q7YO 5B66U 1FRKA 1XMOJ 1FDDA 4RPFA 3M6UA 2WRMA 1XNSA 2XO6A 1BA1A 3DXKA 1WI6A 1SBRA 2MXYA 1MWMA 5J1EA 1KL9A 2JX2A 5E5NA 4RZRA 1SQKA 1Z3EB 5ALZA 2YWKA 1EARA 1HWKA 1IKYA 4BE2A 4EZ9A 5E26A 2XMMA 1D3WA 3MN6A 2DK2A 3OS0A 3VTIA 2RQ4A 3G4SN 3UM9A 1R6VA 3T1HJ 3J81O 1S0VA 1S5JA 1FFVA 4KX5A 2HW3A 1BL3A 4C11B 1YBAA 2C42A 3M9OB 2HHQA 5J0RA 4KREA 4FS2A 1NB2A 3C15A 1CQNA 2L41A 2CPFA 3KHRA 1BC6A 5JU5A 4EU0A 3G9CA 1IJJA 4IG3A 2E1AA 3A4TA 3GFXA 1ASWA 3OQ2A 1X4BA 2KFYA 2LA4A 1GMVA 3SCLE 1EKEA 4Q8FA 4X66J 4ERDA 2Q1LA 3FDSA 2LLZA 1J5EK 4NLVA 4JI4F 4MF8A 2NUBA 4FPIA 3MTKA 3RH6A 1R8PA 2KFZA 1UW9A 3KFUF 1ZD5A 5E41A 1Z6RA 2I1RA 3EPGA 1FXDA 1ZQTA 4G3IA 3G0ZA 5C42B 1HUOA 3D2FA 3DKDA 1LFPA 3EJMA 2AQ0A 2XMJA 3HKZC 4ZMMA 2GWKA 4M5DB 3GFHA 5IV3A 3T1YJ 1FE0A 1RT6A 2CQDA 3O5TB 1WUUA 3QAEA 4GXJA 2CQPA 5HMLA 1JRPA 4WF9L 1J2NA 2DR9A 1PYTA 4OCZA 1OQ3A 4NL9A 1N62A 4B9VA 2Q4TA 1RYUA 3TAMA 4EO6A 3NH0A 3S3NA 2O01C 1FFWB 5L9NA 4KLOA 1NKCA 1FJGF 2DGXA 1R7IA 4DI6A 4A8XA 4NOHA 4USUA 2IM3A 1DFDA 1FA0A 3MUTP 1ED1A 2R7SA 4CH0S 1F21A 4JYAK 1F5CA 4XA5A 1AB8A 2ZH1A 1HNIB 2ZBIA 3I87A 1RXOB 4PABA 1HI8A 1S8OA 3P6YC 2DGQA 5LMUF 3BY5A 3FCVA 3W7BA 1G15A 2N7YA 2BJ7A 5IV4A 3RW6A 1GXLA 5HMYA 2YQ0A 1NGAA 2P5VA 2X7IA 4DUYF 3EM1A 2B21A 1C0FA 4CJSA 2FSKA 1YVNA 4CJ5A 3FUYA 3TPQA 3ISZA 4KX3A 2YX1A 4W90B 3MTJA 3CNQP 3WIVA 4I2PA 1WCNA 1KLNA 1TV6B 2V8VA 2JR5A 3C8YA 1WF2A 1S1TA 8ICOA 4OZNA 3ENBA 1NJYA 2Q2RA 2FHOB 3ZZ0A 4V19X 1EP4B 1AQ6A 1OSCA 4FP9A 4QU6A 4P4OA 2G8IA 3F5EA 1GMWD 3CCMS 1WHYA 3C14A 2G8VA 2G8FA 4O44A 4E1NA 1V4TA 4NLXA 2OIHA 5H1SQ 1BDGA 3ETLA 1BUPA 4OX9F 2VG6A 1PGZA 3RJMB 1MMLA 1GOAA 3UB5A 1UVIA 2HZAA 2H48B 4ED6A 4RPYA 5AI5A 5ALDA 5HRPA 3AAWB 1ZQZA 3R5DA 3VGVA 1WACA 4FVUA 3ZZZA 2CPYA 4FXVA 4B3MK 9RUBA 1VSFA 2PA8D 2D3ZA 2RN2A 2CJXB 3C66A 4IG0A 1UZHA 2ALYB 4WFNQ 3BV8A 4X62F 1VSKA 1Z1ZA 2E1CA 3L4PA 4DR7J 3W9HA 4FXDA 2G9OA 2ZBQA 4OHWA 4CHOA 1MN8A 3J81j 3OSPA 2W40A 2WAQC 5IM0A 3SI6A 3OVAA 2IJFA 3VQEA 1YITS 1RT2B 1F9HA 3P38A 2OYYA 4OX7A 4Y2SA 4M9HA 1M1HA 2PY5A 1RQNA 3G8QA 2YKNA 4RJVA 2Z57B 4DU3A 4HTIA 1M1KO 4O3QA 3THXA 1F1BB 3PACA 3FQKA 2EH9A 2ZWPA 2M0GB 2KI2A 4CGDA 5CCMA 4FFDA 4L6V3 4J7CA 1YJTA 3WK5A 5AI8A 1RKJA 5LJ5Y 4BACA 4MMOA 5DB9A 2W9BA 3FBBA 5BR8F 4YY3K 2OPPA 2EAMA 1CZAN 4YVZA 1JKHB 1KWMA 1AFJA 1T9WA 1U49A 2HS0A 1S49A 1V5VA 4JI7J 4OJLA 1SIJA 3HKZD 3I6PA 3RB6A 3IO1A 3DYAB 2YHWA 1SL1A 3O2IA 4I2QB 5KPZA 3TAFA 4QIGA 2W2NP 1ZBTA 2OD4A 2MKKA 3BSOA 3CTRA 3IR6B 2EXUA 2G8KA 3TUIC 1RWVB 2BV3A 5J2DA 5AQYA 1MROA 3VR1A 4JI3J 5J2FA 4PQUA 2H3EB 1S9FA 3UQ2A 1COKA 2CN1A 5AXMA 1YRUA 3OGUA 2DHHA 1J5OA 5AQMA 3W9JA 3C28A 3D0IE 2W25A 1XR6A 2VONA 3DI6A 3QO9B 4C3KA 4F72A 3AUOA 5J2GA 3DJCA 2WVFA 1V97A 2LM4A 3Q83A 1FVSA 4P72A 2ZIXB 3KWGA 3WXLA 3R2DJ 1RBOB 2QC3A 5HQMA 1LOTB 1Z19A 1E4FT 2C1EB 2AP1A 4AP9A 4DS4A 2M9KA 3RVCA 1BE4A 3EGNA 2GMJA 1ZQFA 4ZVGA 1PVQA 3EXCX 4DUZF 1QAJA 4C8YA 4KMOB 3A12A 1ZD3A 3WT0A 3MXIA 3LZIA 4M47A 3AVJA 1ZETA 4OI2A 4F0HA 1L3UA 1SKUB 2W1BA 2HEKA 1S76D 3KKSA 4CJTA 2F3JA 4DU4A 3HRGA 1O6XA 3E58A 1C1BA 4ZOSA 1RZMA 5ALXA 2K06A 3DGPB 1X4CA 5ALKA 5EX3A 4KLIA 1BQNA 3PX6A 3F0NA 1AT1B 4H4OB 2GUPA 1NGDA 4UB2A 5EN1A 3PHTA 4QS9A 1UEVA 2DVIA 2P9UA 1QQCA 5LMNF 1SV0C 3WNGA 4KFBA 2EFQA 4YB7A 4Y0WA 3MPWA 4GW6A 1FKAF 1Y5IB 3S3OA 2MAXA 1I6JA 1H2VZ 3KKRA 2P9LA 1T7PA 2FI1A 2I8EA 2B6AB 4RQ5A 4A2AA 3SQ4A 3ULEA 2YHAA 4YDUA 1T3NA 1WWUA 3ED5A 3HFZB 4KC5A 2F4FA 2E9TA 5HO4A 1X4AA 4EHTA 2PIIA 4F3MA 1C4AA 4L3KA 2IVPA 3CCTA 3K7RA 5J2HA 2G8HA 2DNMA 4OQJA 4ES2A 3KK2B 2G2ZA 4USWA 2KK0A 2WSCC 2P35A 4PHTX 4EK2A 1SJFA 2WAQD 4DR2K 4WPAA 1KTQA 3ZTRA 1SZPA 2AXTU 1RT7A 3CC7S 3DRSB 2Y0SC 5DB6A 2C2MB 2ILYA 3NAEA 1Q79A 3RSEA 4Y2CA 3AO3A 1X2IA 4JAXA 3FE1A 3DDKA 1YJVA 1EQYA 3MDAA 1KD1T 1VDVA 4RQ2A 4IDKA 2H3QA 4QPTA 2OYQA 4I69A 1BUXA 3C7NB 3NRZA 2D9PA 1Q81O 5DDOC 4N56A 5FPDA 4FO0A 1KOOA 3I56S 5B0BA 3C23A 4FN5A 3MN9A 4FL9A 1JB0C 9ICQA 7ICTA 2O3DA 3VAKA 3J7Z5 3OTOF 4JK1A 4XQ8A 5AQVA 3BYPA 4CF8A 2O8FB 3MM6A 1EWRA 5EX0A 3N79A 3L3VA 1FEHA 3CC2S 3O44A 3TJ9A 1NJXA 2PE8A 2W54A 5JLHA 2CQGA 4GXKA 2PFNA 4DOCA 3TARA 5BPNA 5BN8A 4A8KA 3UDLA 2EZZA 4I2HA 5SZTA 3DM2A 4LBIA 1RU2A 2HHVA 5GTIU 1IKVB 3KLVA 2UXBJ 4I67A 3V4MA 4NXNF 2Q0RA 2RD5C 5DS7A 4ZIVA 1KW4A 1Y10A 2H3GX 4WFYA 5GAEU 1XEZA 4FWQA 1F0MA 3UQ0A 3OHRA 1NMNA 3L4BC 2R2SA 4C80A 3VA3A 3PW7A 4P0QA 1OUQA 2R7XA 2H5JB 3ZTQA 2ZDPA 2WVBA 1K0VA 2Y1RI 4Y00A 3W5YA 5K4LA 3BEGB 1KSPA 1S48A 1D4XA 4B3SK 3OFHA 3ZTPA 3N28A 1XJWB 4CK2A 2LEPA 3OR1B 1TAMA 4J2BA 1RDDA 2RUSA 4HCBA 2KIWA 1DHMA 1S1UA 2V67A 2RU3A 3DLEB 5F3XB 3B78A 1JLFA 3HVTA 1FE4A 1XMBA 3V1OA 3L6QA 3TNVA 1S59A 5J0SA 1Q82T 4NZ6A 1OH8A 2KKVA 5KFSA 4HI2A 4CO5A 3DDIA 3OYEA 3RRKA 4EIAA 4KH4A 4KKOB 5JXSA 4CM0A 2XLKA 5J8YA 2KVQE 3OXGA 4CJVA 2Q43A 3NAHA 3V5RA 4FK2A 4C8MA 1L3VA 3PO5A 1ZJNA 1FO1A 4L74A 4BVOA 5LSRA 1Q8KA 4WZQA 3AL0B 4JB8B 4LZDA 5D4OA 3V72A 1JMSA 2GVDB 4C4WA 2JZBB 4XAKA 2A1AA 1NSQA 3OUYB 5KFUA 5KAKA 3OTDA 5L46A 4BS2A 4OV1A 3F2CA 2WMMA 1H6KX 2KKHA 4BR2A 2FVPA 4B9MA 2A1RA 1SL2A 4BWJA 5DDMA 2YHYA 2F8HA 2VQFJ 1WBDA 4G65A 2DKZA 3QUQA 5CP2A 2F40A 1YSJA 1RTHB 3L2VA 4WE1A 4OZJA 2LQBA 4YXMA 4L3QA 4B9NA 1R0AA 5HL7Q 3OL6A 2ZM6K 1FNOA 2DY1A 1N5YB 4BR9A 2XCAA 2YQEA 3LTOA 5KG5A 3K4GA 3A3NB 1PJ5A 2BQ3A 4OLBA 1HBOA 4I2JA 4DL6A 5J1NA 3TYTA 1SL0A 5KRSA 5A0LA 4JV0A 5AE2A 1FNXH 3CJSA 4K4UA 2Y0SD 5B09A 4CTAB 2A0FB 3PXGa 5HN0A 2DEJA 3KK1A 1RWUA 3M1YA 2JGAA 3KNAA 4B1WB 3AMZA 4C8KA 5CABA 5AQTA 4JD2A 5ETQA 3GYNA 2FJWA 1NPRA 1TUWA 3EZOA 2F9WA 3F2KA 4HCCA 2V2ZA 3OHAA 3TADC 3C2LA 4OZ5A 3MXMA 1NSAA 2K89A 4K59A 3QERA 3WHIA 3SD7A 1IWAA 1NM1A 3O6QA 1UL3A 4QJFB 7ICUA 3ZT2A 2DFFA 2FHJD 5D8HB 1EO1A 2JLEA 2CQIA 3NP5A 4Z6EA 1K9MT 3BH7B 3MR7A 3AGRA 2ZJAA 2M7SA 5GMDA 5KPTA 4GKJF 4B6JA 3VAJA 2AGQA 2CH5A 2AX1A 2KT3A 2GCFA 4FM2A 1LVHA 1VQ4N 3GU3A 3ZEUB 3I0RA 4YB6A 2UV8G 4I2DA 3THTA 3UD3P 4DDFA 2QZ8A 1P6TA 2ZC4A 3FBEA 3LP2A 4M5NA 4JMUA 4QYRA 2HNDA 4DR5K 2DH7A 3O0FA 4DV5F 4FSVA 1REVB 4Z0UA 4OYXA 3V1QA 3PSPA 2QE5A 2PAVA 1JCEA 4F5OA 1RCXB 2OM6A 4NMLA 4P0PB 3RAMA 2OPQB 3MM5B 1SI9A 2UUCK 3QATA 2KJ8A 5K8OA 1JMTA 1GK8A 1OVQA 3RBDA 1JLEB 4KJIA 1ESVA 1C7YA 4G1QB 2MKYA 4O55A 4U7UD 2NR0A 5DLFA 1K6YA 5KQ8A 4O8UA 3IRWP 4PA1A 5D77A 2BHNA 4IFYA 4URQU 1JXLA 2ROPA 1S6PA 7ICOA 1SC4B 2UXCK 2MRLA 1XO0A 2KVSA 1B4FA 2P6RA 5GADI 5EWEA 5A8RA 3KK3B 1VQPS 1WWHA 2G2YA 1H3DA 4C1NK 4EMDA 1EWQA 4JKGB 5B8HA 1YHQS 4ECYA 1LW0B 3O6WA 3VPZA 4J9PA 1S77D 5KT3A 3KWMA 1NEEA 2V8HA 5CYQB 2J0XA 3MGJA 2FF3B 4JN4A 5AICA 3MM9A 1ZYQA 2C2DA 2E5HA 1HNXF 3V4IB 2BKPA 4CD1A 2HMIB 4LF5K 1IJFB 4E1MA 3FM9A 3THVA 1V3RA 3DU5A 4CE9A 1J27A 2VL1A 3J7ZT 2X3DA 4Q43A 1VQ8N 1RHJB 2CH6A 5HP1B 1W25A 3FRYA 4WCEL 3B0YA 5H2FU 3WQUA 1RBSA 3ZZUA 1U2VA 3IAM9 2BVZA 3QUBA 3VF0B 3ATVA 2DGSA 2IHMA 1A5XA 2CG8A 5FPNA 2NNWA 1UZDA 2VFSA 3QFWA 8ICGA 4YR0A 1EETA 4GKKJ 4AF1A 1WAJA 3CCJS 2Q6BA 1VRTB 3M6XA 4DF4A 4JWMA 1TK0A 3N5BA 2K8BB 2E6MA 5CA7A 1BI4A 1C2PA 4JI2F 3OL7A 2R7OA 3I5CA 4M3XA 4BRPA 2YWHA 3M8PA 4UB1A 1W7WA 3T5KA 2MUTA 1RAEB 3K1RB 4M3TA 4P7TA 2F96A 4LF7K 4KLHA 2P9NA 3VV2B 4QZAA 4USMA 2A6MA 3DXMB 3M3ZA 4JNEA 4PXCA 2GJ2A 5F0XA 5JUMA 2E5LK 5TKWA 2XG8A 3VQ9A 3IMXA 1C0TB 2XYHB 1YG0A 4UY8T 3HSTB 4ELVA 5JTIA 1JNZB 1RDUA 3WK8A 3DRYA 2QI2A 2YXLA 2GVZA 3QFUA 3SQ0A 1S7HA 4LRCA 3SQGA 3SK3A 3D2EA 2VJUA 5DBBA 2I9GA 2I1QA 1Z2LA 5L1MA 5ALSA 1RAOA 4RX6A 2PDAA 3I9V9 1BQXA 1M5OC 4IO8A 3EW9A 4CGHA 3EL2A 2GA7A 9ICLA 3NNCA 3BS5B 9ICGA 4YXJA 4KIAA 4CI0B 3LDQA 4IZ9A 3D68A 5H1SV 4RW9B 1DY3A 4A61A 2O66A 2FC9A 3A1YG 1HW8A 5KFWA 5GAHU 5FPMA 3J7AN 4RQMA 4CESA 5CY4A 4OZLA 3MHYA 3R6MA 1U1LA 5E3CA 4DV6J 2VG7A 4CF0A 3BN4A 2GH1A 4J5OA 3M5RA 3MR3A 2K1RB 2H5XA 4ZCKA 3CE8A 3L9ZA 3Q22A 8ICLA 3U1NA 1HQUB 2ERRA 4RUAA 1TUGB 2PEHA 4B1YB 4J9MA 2IMWP 2HHWA 2IDEA 4A2BA 3ZTOA 4CNZA 1RBUA 2UU9K 1X5PA 5F41A 5IIMA 5FDLA 4NXMJ 2DNLA 3Q8LA 3CJ3A 4JV5J 2G0AA 2RRBA 1B0TA 3MR6A 3M8ZA 3ENHA 3M9MB 2R2RA 3OS1A 2YNIA 3MXHP 1TYQB 2E2QA 1MWZA 4A48A 1HWUA 1S7IA 3UCZP 3MN5A 5HROA 1OH5A 4LFBF 2ROGA 2KSOA 3L3UA 1WCLA 3UKRB 2VPZB 4OJ1A 1WEXA 4P6QA 3GG0A 2XLIA 1LAWA 1RJJA 1RWOB 4YQWA 4ISFA 4LFCF 5DM6L 1N0VC 2QWOA 1E6VB 3SBMA 1T05B 3K8WA 4K50A 3CERA 3BREA 2DNOA 4KY3A 2FLOA 3C29A 2CA9A 2VA8A 1YF5L 2XB2D 2B0GA 4WYBA 1NH8A 1Q3VA 1Y97A 2IYIA 3QSYB 1RADB 3QBCA 3HSJA 1N32J 5KFPA 5KGXA 1RBRA 4FJXA 4IXCA 2CPRA 1QUPA 2Y9UA 3IM1A 4JS4A 5FJ4A 3R3LA 2MDAA 2QB0B 1Q78A 3PW0A 1T9UA 1SGGA 4AHUA 3POTA 2YN4A 2VQFF 3LP1A 3HHLC 2FVRA 2VC0A 2CZVC 4CZHA 4KMUA 3IBCB 5JVGQ 1KVCA 3FRZA 4C9DA 5AZIB 5KFEA 3ID8A 1A9NB 3IP0A 1V9OA 1RAIB 2WB1F 2DY4A 2PGCA 4V19J 3Q0AA 1OS5A 2X6NA 3FZFA 3H4BA 5DK5A 2E5IA 1KQFB 2QGFB 2L9DA 4IRKA 3PNIA 1NK6A 2LVWA 4LSLA 1T9TA 2EZYA 2YVSA 3PLAA 4F2RA 1HJRA 5BR9A 2YMMA 3U9ZA 2CKWA 2HBYB 4LVNP 2WOMA 4QYZK 1VISA 1NZBA 3EY1A 3RYLA 1VQ5S 3BQ7A 4NLPA 1XU4A 2F5GA 1T44A 1D9DA 2HWHA 1ZQMA 4JI8K 1CC7A 2IPOB 1Q86O 1XMQK 3EX7B 3TUPA 2EQYA 4QIFA 4RBVA 4JP8A 3AXKA 1FRLA 4N47A 2Z2YB 4R8UA 1D1UA 3TU5A 3LM9A 4HTJA 3ZDCA 1NK4A 3R5BA 2PD1A 2YKQA 3OL8A 5KFGA 4HUGA 5I9EB 3VCBA 3WKCA 4DV2J 5DM7L 3RH5A 3KLIA 4ZKAA 2VANA 1JJ2R 2CNLB 4ES1A 5EE1A 3QDKA 3RFAA 2FVCA 4OJ6A 3TUZC 4BRFA 2P9SB 5MLCQ 2JSXA 2XMTA 5KG2A 3QRRA 2JHEA 2CGJA 2H3VA 5F2RA 4USHA 3TKAA 4FWOA 3CCWA 2DHGA 1XTZA 1G99A 2E7VA 2I9SA 4LH5A 2GQ2A 2IM1A 1PK1B 4HDGA 4ZPVR 3LQVA 1H7XA 5I42A 1W7AA 4H03B 3KJFB 1X4EA 5HQLA 2KG1A 1M0SA 2XI9A 3G8TA 2IOHA 5GMKa 1N61A 1UW4A 3CJTA 2GO9A 4ZCIA 3DAWA 2J4RA 1NJIO 1PZNA 4M3RA 1PG5B 9ICUA 2DFHA 3R7NB 3KYLA 4ZJOA 4KO0B 4ITSA 4DV7F 4RW4A 1CXUA 4ISGA 4H0XB 1HPZA 3AA4A 2NREA 3F44A 1HYVA 1TP7A 5J2NB 2RUGA