1SV4A

Crystal structure of yan-sam
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
QLPPSLPSDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKRLCLLTRADFGHRCPGAGDVLHNVLQMLIIESHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Ets DNA-binding protein pokkuri
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 22
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv4A00
2D3DA 5F3XB 2F3NA 2DKZA 3KKAC 1X40A 5L1MA 2JV3A 4RQMA 3SENA 5JTIA 2Y9TA 3TADC 5KNIA 1SV4A 2DKXA 2QB0B 2QKQA 1LKYB 3IDWA 4PZOA 1DXSA 2EANA 2Y9UA 2QARB 1Z1VA 5J8YC 1F0MA 1V38A 2E8NA 3BS5A 2ESEA 1RG6A 3KKAA 4NJ8A 2K4PA 2DL0A 1KW4A 2EAMA 2KSOB 2LMRA 3TADA 4NL9C 4NL9A 1V85A 1B4FA 1OXJA 2ES6A 1X9XA 1PK1A 3TACB 1X66A 1PK3A 5J8YA 3H8MA 2EAOA 1UCVA 2LPEA 1UQVA 5JRTA 2E8MA 2GLEA 2QB0A 2QB1A 1LKYA 3BS7A 1JI7A 1OW5A 1SGGA 2QARA 3HILA 1SXEA 2B6GA 2YTUA 2KG5A 2KMDA 2FE9A 2KIVA 3SEIA 3BQ7A 1SXDA 2F44A 2K60A 5JU5A 3K1RB 4MHVA 2KE7A 1SV0C 2EAPA 1SV0A 4IS7A 2E8PA 2KSOA 3BS5B 1WWVA 4RQNA 2F8KA 4PZNA 2D8CA 2E8OA 1B0XA 1COKA 2L5YA 1PK1B 1WWUA
chains in the Genus database with same CATH superfamily
5KG1A 5D46A 5IIJA 4IL6U 1PVRA 1TKDA 3KKAC 3L4PA 2J6UA 1QCKA 4P0QA 5ALVA 4ZOHC 2P66A 1TAUA 2MUTA 3E58A 2K8BB 4JUZA 5J0TA 4EBEA 2IA6A 3V6HA 2BDPA 2J6SA 2E1EA 4DOAA 2NRZA 1L7PA 4YXJA 2ESEA 3EYZA 2BCVA 5DG7A 3H8WA 2DPJA 1KW4A 2KOBA 3RR8A 1ZD2P 1SL0A 4NL9C 1FIQA 3V72A 4EZ6A 5EE9A 5ALXA 4F5OA 4DSEA 4FZLA 2KKVA 3QXGA 1N5WA 2KFZA 5KFKA 1WG8A 4QNLA 3CYMA 4EX6A 3E0FA 2HHUA 4DO9A 5IINA 3TAPA 1JUDA 5GTIU 5JRTA 2ZIVB 4LVSA 1L3TA 2LI6A 1ZQJA 4I28A 5KG3A 2NRWA 3PSPA 5KFGA 4UW9A 4Z6DA 3UMBA 5CR0A 4F93B 3H7IA 3N28A 4LJXA 3D2NA 2KTQA 4C7YA 2HI0A 4HYKA 2FMPA 3TARA 2CPRA 3RB6A 2EZYA 3LWLA 3NRWA 2G5HB 4OCZA 3GDXA 2AQ0A 5DGBA 5E79U 4F4ZA 5EE3A 4C8KA 2LYBA 3RB4A 4UARA 3RH4A 1BPBA 5KT6A 4RT3A 4M9NA 3I28A 3V7KA 2QB0B 5AIBA 3JPRA 4YR0A 8ICWA 3QEAZ 2QLTA 1KSPA 2Q0ZX 2P6RA 3ISCA 2Z7JA 3SR6A 4BX9C 1N60A 4Y2VA 4DSIA 5DBBA 2VJ4A 1TE2A 4DQPA 3IRUA 4GXJA 4J9QA 3PZPA 4Y2XA 3NRZA 7ICRA 1IV8A 3C29A 3PVXA 1NZBA 1HEKA 4ED1A 2KHQA 1QSYA 7ICOA 8ICZA 1X66A 2LBOA 3SV3A 4DQQA 1X9MA 4RZRA 5AK5A 2WF9A 3FDSA 9ICCA 9ICXA 5CHGA 3PSTA 2VKQA 2HHSA 4US9A 5KG6A 4BDPA 4J9OA 3T5KA 3HILA 3BJYA 7ICJA 5J2JA 4BWMA 2FE9A 3SEIA 4I2FA 1SXDA 2F1JA 2ODGA 3Q8QB 4MHVA 3RAQA 5AKEA 1MQ3A 4RU9A 3EUB2 3SYZA 5KT2A 1ZRNA 4TQSA 2PKEA 3QZ7A 1YT3A 3TANA 1ZQ1C 2KD1A 5AI6A 2H3ZA 5KFHA 5FP0A 2KNJA 1A77A 3HPOA 2I1QA 3KZXA 4UATA 3MR6A 2HHXA 3TKAA 3AL0B 2DKZA 5AI5A 9ICPA 2RDIA 1IXRA 4PL2A 3HW8A 3RB0A 4EZ9A 4DL2A 4RQ4A 2W54A 3OSNA 2M0NA 4DSLA 1JALA 3MFHA 4QZ8A 3QUQA 1ZQYA 3C2LA 5J2AA 5KL8B 2BR0A 4ELTA 1T7PA 2EQYA 3KKAA 3L3FX 3KHLA 4DF4A 4RQ8A 4JV2A 1ZD4A 2OYYA 2WB1C 4PGQA 1S0OA 4QZGA 4QZCA 3Q8SB 4B9UA 8ICFA 1UQVA 3RRHA 2JXJA 2EDUA 3M9NB 2IBKA 2BPFA 2RDJA 2IOFA 4UAYA 1J2MA 1K5OA 1PVQA 2MU2A 1VLBA 4DOCA 2EH9A 2XY7A 5KFEA 3MDCA 4MEXA 1U48A 4C4RA 3K1RB 5KFPA 3LVVA 3PW4A 1JXLA 2PFQA 5ALHA 5KFOA 1URJA 3U26A 1KDHA 2FDRA 1HJPA 2HHVA 3BS5B 2O6KA 8ICVA 3IG8A 4EENA 2W9MA 5KG7A 5AM2A 2H3IA 4FO6A 3PNCA 2ZIWA 3M1YA 2I5HA 4BXOA 2LM1A 5ALRA 4IQUA 3ISBA 4YMMA 2ZJ5A 4PGYA 2NRXA 2ISPA 7ICMA 1X40A 4YD2A 5L1MA 5IIOA 4QZIA 4YR2A 3OJUA 5A0LA 4XQ8A 2JV3A 1C20A 3MFIA 1S9FA 3H8JA 3AMZA 1AROP 4Y2QA 1SV4A 2FPMA 2WF5A 4DL4A 3GIKA 8ICCA 4QZFA 1HUZA 2LYAA 5J0XA 4GXKA 1ECWA 5F9LA 3D2SA 3QUTA 2RP5A 2FMSA 3OHAA 1ZQTA 1K1SA 2AQ4A 2R18A 1ZQDA 5TISU 1ZQWA 3GFKB 5BOMA 2MSNA 1B4FA 4ED6A 2DWQA 2KJ8A 1ZYQA 5BPCA 2FLNA 4J9LA 1O03A 3GIMA 2XI9A 5HHIA 4QW9A 2LPEA 3QU9A 5KFUA 4M9JA 2KVSA 1DRGA 3H8SA 4FS1A 4PJ0U 1L7OA 2W11A 2ISOA 3F5EA 2UVUA 4F4KA 4J9PA 4DFKA 3WKDA 2KIVA 4JWMA 5AI4A 2JEFA 3ONNA 2HHTA 2LM4A 3C21A 1S0VA 4KLEA 2RLTA 5ALOA 1DK2A 4F91B 3G6XA 4F4YA 1A76A 4NWIA 5AM1A 4C80A 2ZIXB 5J0YA 2AXTU 9ICSA 4DLGA 1ZQBA 5EE1A 8ICQA 4UB1A 3THVA 3SAFA 4F50A 4QZ9A 4O9MA 2F77X 5JTIA 1FFUA 5ALMA 3PW7A 2HSZA 2QKQA 8ICMA 1LKYB 4YQWA 3F2CA 4ECZA 1DXSA 4OJOA 2AU0A 5AKIA 1L7NA 4B9NA 3A0BU 2G06A 4UAVA 4DLEA 4TURA 2BPCA 2E8NA 3ZD9A 4DL7A 5ALJA 4DSFA 3V7LA 4KITB 5C5JA 2XVTA 5KFRA 2VA2A 1X9XA 3CRXA 3RH5A 4QWAA 2C22A 3TI0A 4R65A 4KLGA 1L3SA 4ZH4A 3M7DA 5ALWA 1D8BA 4CDGA 2P35A 4BWJA 5KFCA 5AKYA 3SMVA 3RBDA 1SKSA 2BCSA 3QUCA 3ETLA 2QB1A 4RNOA 2ZUCA 4ED7A 1ZQRA 2QARA 5AKZA 3QX7A 2B6GA 2V9WA 1KFDA 1TVAA 2Y0SC 4RQ0A 1XSPA 4DL6A 3RF9A 1KLNA 9ICWA 4P4OA 4F71A 4E0DA 4M2YA 1X9WA 1RXVA 4DF8A 3PX0A 5KT7A 1QQ7A 2D8CA 4YFKA 5KFDA 3AQFA 5KT3A 5J0PA 4ED0A 4C8OA 3NS1A 1ZQNA 4RQ3A 5J2KA 2YN4A 3VCBA 4YP3A 2H5XA 1SB3C 2K4IA 4RUCA 2W9AA 4K4IA 5KFWA 8ICOA 4TUQA 8ICUA 1NK9A 2ZTDA 2W9BB 2H3VA 2CN1A 1Z1BA 2HCFA 1JX4A 4U7CA 5AM3A 1GO3F 1XNSA 3GV5B 2AHOB 1RG6A 8ICHA 4DOBA 2LHTA 3PY8A 3K75D 5G5GA 1N5XA 8ICTA 2F8LA 1TK8A 3UXPA 3C2KA 4B6JA 3LK9A 2YQEA 2W55A 1UT5A 4KLLA 1KFTA 1RDFA 2ATLA 1PK3A 3AN1A 2BKEA 1S0NA 3TFSA 3KFUF 2EAOA 3BQ2A 4O5CA 2W03A 2G09A 3BS7A 3NVYA 2K4HA 5DQGA 3RJIA 5ALQA 5B5EU 2ALZA 1F5SA 5CA7A 2F76X 4QZHA 9ICMA 4FBTA 5DB7A 4B9VA 2IHNA 2W3RA 5KT5A 5EWGA 1ZQFA 5KFLA 3UMGA 3GILA 1NK8A 1NJWA 3QZ8A 4KTQA 1SV0A 4Z6EA 9ICJA 5L1IA 2W7PA 4DWIA 1X6JA 2KEYA 2HBLA 8ICYA 4LZDA 2G08A 2KV2A 3ICXA 4US8A 3RB3A 3MBYA 1B0XA 4CRXA 4Q8FA 4AYBC 1NK6A 4CE6A 4NM2A 2DF4B 1NKBA 4GIBA 1A6SA 2ZIVA 2R8IA 5J2IA 1PVPA 2A19A 4DL5A 9ICRA 5KFAA 5KFMA 3SENA 1ZQCA 3LVWA 5KNIA 1S97A 4PL1A 4C0ZA 4I2EA 4IC9A 2R8KA 3MGHA 2WB1F 1JIHA 3ISDA 5IIMA 2ZIUB 2JEJA 4YMNA 7ICVA 3UMCA 5G5HA 1SL2A 4JV1A 1NI3A 3PV8A 1U47A 2BHNA 9ICTA 3SQIA 5HNKA 1D8LA 2YMMA 4Q8EA 1UHUA 5AKJA 5J2BA 4FZMA 2KSOB 1KBUA 3I76A 1L3UA 2PXIA 5DB6A 4XRHA 3K4GA 5J2FA 2B0CA 2JRZA 2FLPA 1K1QA 2XIDA 3UPQA 5KAFU 4F92B 1Q3VA 1MA7A 5IIIA 2VJ5A 2RRDA 4GFJA 3IN5A 4IRCA 2C2EA 2YX8A 5J2GA 5K4LA 8ICXA 3M6ZA 3GU3A 2QB0A 4ECXA 4ACOA 1SGGA 1QH9A 8ICKA 2W9CB 1QSSA 2F2AB 2XGPA 2PMZC 5J2HA 2CXYA 1X2IA 3EPIA 4DSJA 5KT4A 3OPXA 3CW2C 3JPTA 7ICKA 2ZXHA 2JZBB 1FEZA 1ZQGA 4Q43A 4I2HA 2KHVA 4C8NA 1X6IA 4YG2A 4A8EA 2VIXA 4O3RA 4DFMA 2AGPA 4JK1A 8ICLA 4ECWA 3C5FA 4F72A 4ELVA 2L5YA 1PK1B 5AI9A 2D6FC 5DQHA 4O3QA 3F2BA 4JV0A 1XWLA 3T5HA 3ZDCA 5HR7A 7ICTA 3RJEA 3WK9A 1ZETA 1RQLA 3N97B 4AP9A 7ICLA 1QSLA 2XO7A 2C2DA 3I1YA 5KFTA 3TQ1A 4O3NA 5AK6A 5F9NA 2E3TA 2W3SA 3C5GA 4O5KA 2XCAA 1UPHA 3H0MB 1BPDA 5J8YC 3NVVA 5KL1B 5DBCA 3M9OB 5CP2A 4M04A 4KLDA 3H0LB 2DGZA 1Q46A 4Z6FA 3MR2A 1U9LA 4KLHA 2EAMA 1BVSA 1ZQXA 9ICLA 4C8MA 8ICSA 1F44A 5JUMA 4K4HA 1JN3A 2KJ5A 3UM9A 2PFOA 3RJFA 2E5SA 4KLIA 3GV8B 5ALZA 3DDHA 1CUKA 5J0UA 3ZDEA 3M6KA 3G6YA 3BQ1A 4FS2A 4I2JA 2XC9A 2GO7A 2K8CB 2XY5A 4R66A 4Y2YA 4KX5A 2BPGA 2R8JA 4I2GA 2UVRA 4KLTA 3EWAA 4QWDA 3MR5A 2G5IB 2XCPA 4F5PA 3ED5A 4BJQA 2F44A 2VA8A 3WKCA 7ICSA 4NLGA 1DOQA 4RQ5A 4KLOA 5ALIA 3PO5A 3WK7A 2E8PA 1BGXT 5DLFA 5T14A 9ICQA 2W04A 5KFXA 4XUSA 2WF6A 3HX0A 5C0YA 3RTVA 8ICGA 3WK8A 4KLFA 4C8LA 4R8UB 1TV9A 3GIJA 3HT3A 1MSWD 1BPEA 2KVCA 3PW5A 1NZPA 1Z19A 4DQRA 4Y2JA 1T4GA 4B9TA 3IP4B 4RNNA 4I27A 2KKPA 3N7SC 4R8UA 5B66U 4NV0A 4J9RA 1Z00B 4Q45A 1CEZA 1T3QA 2ZTCA 5DB9A 3BS5A 9ICHA 3EZ5A 4RPXA 1JRPA 4WJ3B 1RQNA 4F5NA 3AEVA 2DPIA 1CRXA 1UA1A 1RYRA 2Y0SF 4IQWA 4MFCA 1OXJA 4EX7A 1Z00A 3CNHA 5ALUA 2BCRA 2YY6A 4OO1J 3V6KA 2VANA 3F5AA 1T8EA 3QU5A 5J29A 1TK5A 2JMGA 2B21A 3PX6A 3H0RB 5DGAA 1ZQLA 1MQ2A 1ED1A 2OM6A 4NLNA 1LVHA 4ECTA 1S8OA 1KL9A 5J2DA 4R64A 1KTQA 2EZXA 1SKRA 1UA0A 1ZQKA 2H3QA 1SL1A 2YTUA 2KG5A 7ICHA 2DBYA 4OJ6A 3WK4A 1U4BA 3WKAA 3ORYA 1C7YA 3H40A 4Y2SA 4F5QA 2AJQA 5EOZA 2BQUA 2KE7A 1SV0C 4KMOB 5KFJA 5J0WA 3C23A 2NRVA 2RHFA 3JPOA 2F8KA 3IHQB 4F8RA 1WCNA 2WF8A 1Y88A 4PZNA 2KK0A 1B43A 1XS9D 5DG9A 9ICIA 3KOOA 4FFDA 4DS4A 8ICEA 5F3XB 8ICBA 3MABA 2KZ3A 4DQIA 2XY6A 3RJKA 2ZG6A 5ALFA 4DFJA 1RYUA 1H38A 4O3OA 1NJXA 3N7PD 1SZHA 3CP8A 1Q3UA 3B0YA 5AK4A 3TFRA 3C2MA 2HBJA 1ZQHA 4OJPA 5KFBA 9ICUA 2OWOA 1J2NA 1X42A 5HP4A 1KN5A 2K4PA 4TQRA 2MA1A 4OJ5A 2A1AA 4KX3A 2DFLA 2ZIXA 2MRLA 4DEZA 1RXWA 9ICBA 3BDPA 2FMQA 1JROA 2HOQA 5J8YA 5KG4A 1EXNA 4M6WB 2ZJ8A 1N2XA 4PPXA 4MFFA 5EWEA 3Q8PB 3NASA 5D49A 1LKYA 7ICNA 2VA3A 2WAQC 4YN4A 1YZ7A 8ICIA 2K4EA 5AKLA 4AYBF 3T5LA 2F1IA 1HUOA 3PSFA 4KLQA 3RJGA 1DGSA 2JEIA 1L8LA 1D8YA 1MN8A 4PHEA 4CNQA 4C7ZA 1ZQMA 5AI8A 1V97A 2G0AA 3PX4A 2CRXA 4J9MA 2K89A 4RQNA 9ICFA 3EPGA 2OCEA 5KFVA 4X5VA 2WHEA 5ALTA 5CEHA 1WUDA 2I6XA 1P7DA 2YMLA 4P0PB 1XO1A 2F3NA 1OUQA 2KJ9A 5DG8A 2NV3A 3DV9A 3RJHA 3V7JA 3AU6A 1PUZA 2HBKA 2Y9TA 3TADC 3AU2A 2PI5A 1RZTA 5AIAA 4I2AA 8ICAA 2EANA 5KFZA 4QZBA 3UXOA 2Q4TA 4BGDA 3N7RC 1F0MA 4YMOA 5KFYA 1T94A 5GTHU 4Y2PA 4MF2A 5H2FU 1FFVA 2PFNA 9ICEA 1XC9A 5KFIA 5CJ7A 5DDMA 1MC8A 4G3IA 2PI4A 4U6PA 5J2CA 2PMZF 4Q44A 1A0PA 4CF3A 1QLNA 2EZZA 3SZ2A 4C4TA 5J0OA 4RQ6A 5AM4A 3PSIA 7ICPA 3HKZC 3NGDA 5IILA 4FZNA 5EWFA 4HAIA 9ICNA 7ICEA 3IG5A 4PH5A 4QIWC 1ZQOA 1LB2B 2W9BA 5AKHA 1L8OA 3AUOA 4P0QB 2ZUBA 3QNMA 3QE9Y 3H4DA 2MUTB 4GC7A 1SXEA 5L1JA 5KG5A 4ECQA 3WK5A 5ALNA 4ECUA 2P6UA 2ZJAA 4PHAA 3JPPA 4K4GA 4UB3A 4DFDA 1BPXA 1BPZA 2G07A 3RFAA 4KN7A 4QWCA 1ZOLA 1SZPA 1TAQA 1L5UA 1ZQAA 3R9KA 4ED2A 3Q8KA 3GZFA 4UASA 3JPNA 2OEHA 2FPLA 4TUPA 2W43A 5AI0A 2IHMA 8ICRA 4O0IA 4J9KA 3QUBA 5J0RA 1COKA 2H3FA 4MF8A 1WWUA 2D3DA 1S0MA 3RJJA 1J97A 4GLXA 4DFPA 5L1LA 4F3OA 4KN4A 1ZQIA 4O3SA 2GWSA 4QWBA 4Y2UA 4UBBA 4EEKA 3IDWA 2E1FA 3JPSA 4G9BA 7ICFA 2AGOA 1JXEA 5KG0A 4UB4A 3GV7B 1XO0A 1KEJA 2A1JB 2HDOA 5ALGA 2GOLA 1NJYA 2R8HA 4YCXA 2HHWA 2IOHA 1NK4A 4F5RA 1N62A 4IR1A 2LMRA 3WU2U 9ICOA 3RH6A 1RPLA 3IV6A 1D9DA 3ALRA 3HWTA 2A1JA 4YXMA 3QU4A 1COOA 4EEYA 3WKEA 1ZQEA 2BGWA 1LV5A 1U49A 1BNOA 4J9NA 1UCVA 2HMXA 5HHHA 1ZD5A 5KFQA 5HR6A 2FLLA 1QQ6A 3SAHA 2GLEA 4B9LA 1SWVA 7ICQA 3ZDAA 3NVWA 2ZIUA 2C28A 4ECSA 2HVIA 3M9MB 4DQSA 4I2BA 2JH7A 1RYSA 2HHQA 2EAPA 2KSOA 3SD7A 1T3NA 1TFRA 5HMMA 2JH1A 1TK0A 5CB1A 2N1RA 1IIPA 4QZAA 3N4MB 2ASLA 1ZQQA 3UXNA 2KP7A 1ZQPA 1NKCA 2XGQA 5ALEA 4KLMA 1L6NA 1YZ6A 3HRDD 4NXZA 4RPZA 4QZEA 2DKXA 3NUQA 4I29A 4NLBA 4B9SA 2W9CA 5KG2A 3QEBZ 4PZOA 4RNMA 3QU7A 2BCQA 4O5EA 3VC8A 4IQVA 1NK7A 1ZQUA 3PMNA 2WTFA 2BQ3A 2JZBA 1V38A 4EYIB 3NVZA 4KMUA 4MEYA 3DEEA 4NJ8A 2FI1A 4F4WA 4M0AA 4R63A 4NLCA 4UB6U 3KHRA 3RBEA 1U45A 3TADA 5D4BA 1V85A 2ES6A 1PK1A 5L9XA 2I9GA 2V4QA 3WKBA 5AM0A 3H8MA 5ALPA 1NJZA 4O3MA 4QWEA 1ZQSA 3T3FA 4P4PA 1JI7A 3QU2A 4OJLA 1ZJNA 4UAUA 5DDYA 4QZDA 5ALKA 2UVWA 2KMDA 1M6YA 3GIIA 3PMLA 2K60A 3E2EA 4XA5A 4CF4A 4O3PA 3A0HU 3SAGA 1Z3EB 5AKKA 1VJ5A 2WFAA 4RQ1A 4MFAA 2C2RA 4PGXA 4GC6A 1KFSA 3V6JA 5KAIU 3HP6A 1SWWA 3PW2A 3PO4A 5KTQA 1XSLA 4RPYA 4EBDA 5ALYA 4F4XA 2BZFA 3OHBA 9ICKA 4RT2A 4CGZA 1UT8A 1S5LU 3FYHA 3BQ0A 2Y9UA 4DL3A 3OSPA 3D6JA 4UBCA 3Q8LA 3T79A 5AHXA 4Z6CA 1SIJA 4UAZA 4P2HA 5TZVA 5DBAA 4YD1A 4GXIA 2WAQF 5EE0A 3PR4A 2OH2A 2HW3A 1HIWA 3MC1A 3KHHA 4OD0A 2YMQA 4NL9A 1AQ6A 2ZIWB 1KQQA 3SV4A 3EW9A 2IMWP 3C1ZA 3ETRA 4BXOB 4BUGA 3BZCA 3AQEA 3B0XA 2HOIA 1IM4A 2FPKA 3KZIU 3KHGA 4ECRA 3D2QA 7ICGA 2ZXIA 2E8MA 2JR5A 2XICA 2JHDA 3LYSA 1ZRMA 2M9NA 1L7MA 3GQCA 4ECVA 2Y1JA 2KN7A 9ICGA 4UB8U 5DKWA 1ZQZA 5JU5A 2W8LA 3F53A 1BPYA 4NLZA 4IS7A 5DB8A 2NYVA 4RQ7A 1S10A 4Y2TA 1NK5A 3RAXA 3OGUA 3ZD8A 1BNPA 4J03A 1S76D 1NOMA 2KIWA 5AKGA 4NY8A 1N56A 3T5JA 2PFPA 1ZD3A 2DQNB 1SKWA 2YMPA 4RQ2A 5KFNA 1ZJMA 4YVZA 2BQRA 5IIKA 4RQMA 4UAWA 1ZQVA 4M9GA 4NM1A 3FAHA 5KFFA 5CRXA 2YB1A 5AM5A 1N61A 1WYGA 2KZMA 3HKZF 4M47A 5AK3A 1XSNA 1Z1VA 2GH1A 2NRTA 5ALLA 2LYHA 3KTQA 4M9LA 2ZUDA 4QIWF 2BCUA 4PHDA 1DGJA 3UQ2A 2WF7A 3K1ZA 3ZI4A 4IR9A 1IG6A 1B22A 7ICUA 2F1HA 3ZDDA 2ZTEA 3KD3A 2BDUA 4DS5A 2DL0A 2IOFK 2W7OA 2NO4A 1TAMA 5CWRA 3TACB 4ED3A 3Q8RB 1NKEA 2HOFA 3HJEA 2YB4A 2Y1IA 8ICPA 2KZZA 2OXOA 5J0QA 3Q8MA 3O0FA 2NO5A 2HBMA 4NLKA 1X9SA 2KICA 3L5KA 1JMSA 2ASJA 3PW0A 2AH5A 5L1KA 1D9FA 3M8SA 2ASDA 2KFNA 3IM1A 4KLSA 3FM9A 3OTQA 4CF5A 3AM9A 3S6JA 1S77D 1Z4NA 3BQ7A 5ALSA 4EELA 3C28A 3F2DA 4ED8A 4YR3A 4I2CA 4UB5A 2HVHA 3MR3A 3KBBA 4ECYA 2V4RA 2LKYA 3WK6A 5KFSA 2UVVA 4UQGA 4FBUA 7ICIA 4DCCA 4Y2RA 8ICJA 4USAA 1Z4OA 2A3VA 4TUSA 4M6WA 3BQTA 3RR7A 3FC4A 4JB3A 8ICNA 4RUAA 1ZXIA 3QYPA 3C1YA 5DQIA 4EBCA 3MGVA 5ALDA 3ZDBA 3M8RA 4FE3A 1CI4A 3TAQA 2DUYA 1KRPA 2QARB 4IQTA 1RM6C 4QW8A 1Q8KA 2J6TA 2K8AA 4ICAA 1QTMA 2JEGA 4IRKA 3NTUA 2FJ6A 1KKXA 1FO4A 4F2SA 3J81j 4PHPA 1XU4A 3OJSA 2R8GA 9ICVA 1WCLA 1PZNA 1NNLA 1L3VA 3LDAA 3H4BA 5BOLA 2MAXA 5AICA 3PR5B 4P0PA 1DK3A 4B9MA 4M9HA 4EYHB 9ICAA 2RQ5A 5DLGA 5HMLA 3JPQA 3MDAA 1N63A 4ELUA 2OHFA 3SI8A 1VDVA 3B9JA 2JGAA 1O08A 4JMUA 3LWMA 4I2DA 3BZKA 4DSKA 1OW5A 3RRGA 4CCHA 4LZGA 1N48A 5J2EA 2W8KA 4P4MA 4I2IA 4QJFB 5AKXA 4F2RA 4C4SA 3MGIA 1WWVA 1V9PA 4UB2A 4JWNA 3UQ0A 1NK0A 4J9SA 3G6VA 4KLUA 2E8OA 4KLJA 4IRDA 1QQ5A 5J0SA 2AGQA
chains in the Genus database with same CATH topology
2D3DA 5F3XB 2F3NA 2DKZA 3KKAC 1X40A 5L1MA 2JV3A 4RQMA 3SENA 5JTIA 2Y9TA 3TADC 5KNIA 1SV4A 2DKXA 2QB0B 2QKQA 1LKYB 3IDWA 4PZOA 1DXSA 2EANA 2Y9UA 2QARB 1Z1VA 5J8YC 1F0MA 1V38A 2E8NA 3BS5A 2ESEA 1RG6A 3KKAA 4NJ8A 2K4PA 2DL0A 1KW4A 2EAMA 2KSOB 2LMRA 3TADA 4NL9C 4NL9A 1V85A 1B4FA 1OXJA 2ES6A 1X9XA 1PK1A 3TACB 1X66A 1PK3A 5J8YA 3H8MA 2EAOA 1UCVA 2LPEA 1UQVA 5JRTA 2E8MA 2GLEA 2QB0A 2QB1A 1LKYA 3BS7A 1JI7A 1OW5A 1SGGA 2QARA 3HILA 1SXEA 2B6GA 2YTUA 2KG5A 2KMDA 2FE9A 2KIVA 3SEIA 3BQ7A 1SXDA 2F44A 2K60A 5JU5A 3K1RB 4MHVA 2KE7A 1SV0C 2EAPA 1SV0A 4IS7A 2E8PA 2KSOA 3BS5B 1WWVA 4RQNA 2F8KA 4PZNA 2D8CA 2E8OA 1B0XA 1COKA 2L5YA 1PK1B 1WWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D3D A;  5F3X B;  2F3N A;  2DKZ A;  3KKA C;  1X40 A;  5L1M A;  2JV3 A;  4RQM A;  3SEN A;  5JTI A;  2Y9T A;  3TAD C;  5KNI A;  1SV4 A;  2DKX A;  2QB0 B;  2QKQ A;  1LKY B;  3IDW A;  4PZO A;  1DXS A;  2EAN A;  2Y9U A;  2QAR B;  1Z1V A;  5J8Y C;  1F0M A;  1V38 A;  2E8N A;  3BS5 A;  2ESE A;  1RG6 A;  3KKA A;  4NJ8 A;  2K4P A;  2DL0 A;  1KW4 A;  2EAM A;  2KSO B;  2LMR A;  3TAD A;  4NL9 C;  4NL9 A;  1V85 A;  1B4F A;  1OXJ A;  2ES6 A;  1X9X A;  1PK1 A;  3TAC B;  1X66 A;  1PK3 A;  5J8Y A;  3H8M A;  2EAO A;  1UCV A;  2LPE A;  1UQV A;  5JRT A;  2E8M A;  2GLE A;  2QB0 A;  2QB1 A;  1LKY A;  3BS7 A;  1JI7 A;  1OW5 A;  1SGG A;  2QAR A;  3HIL A;  1SXE A;  2B6G A;  2YTU A;  2KG5 A;  2KMD A;  2FE9 A;  2KIV A;  3SEI A;  3BQ7 A;  1SXD A;  2F44 A;  2K60 A;  5JU5 A;  3K1R B;  4MHV A;  2KE7 A;  1SV0 C;  2EAP A;  1SV0 A;  4IS7 A;  2E8P A;  2KSO A;  3BS5 B;  1WWV A;  4RQN A;  2F8K A;  4PZN A;  2D8C A;  2E8O A;  1B0X A;  1COK A;  2L5Y A;  1PK1 B;  1WWU A; 
#chains in the Genus database with same CATH topology
 5KG1 A;  5D46 A;  5IIJ A;  4IL6 U;  1PVR A;  1TKD A;  3KKA C;  3L4P A;  2J6U A;  1QCK A;  4P0Q A;  5ALV A;  4ZOH C;  2P66 A;  1TAU A;  2MUT A;  3E58 A;  2K8B B;  4JUZ A;  5J0T A;  4EBE A;  2IA6 A;  3V6H A;  2BDP A;  2J6S A;  2E1E A;  4DOA A;  2NRZ A;  1L7P A;  4YXJ A;  2ESE A;  3EYZ A;  2BCV A;  5DG7 A;  3H8W A;  2DPJ A;  1KW4 A;  2KOB A;  3RR8 A;  1ZD2 P;  1SL0 A;  4NL9 C;  1FIQ A;  3V72 A;  4EZ6 A;  5EE9 A;  5ALX A;  4F5O A;  4DSE A;  4FZL A;  2KKV A;  3QXG A;  1N5W A;  2KFZ A;  5KFK A;  1WG8 A;  4QNL A;  3CYM A;  4EX6 A;  3E0F A;  2HHU A;  4DO9 A;  5IIN A;  3TAP A;  1JUD A;  5GTI U;  5JRT A;  2ZIV B;  4LVS A;  1L3T A;  2LI6 A;  1ZQJ A;  4I28 A;  5KG3 A;  2NRW A;  3PSP A;  5KFG A;  4UW9 A;  4Z6D A;  3UMB A;  5CR0 A;  4F93 B;  3H7I A;  3N28 A;  4LJX A;  3D2N A;  2KTQ A;  4C7Y A;  2HI0 A;  4HYK A;  2FMP A;  3TAR A;  2CPR A;  3RB6 A;  2EZY A;  3LWL A;  3NRW A;  2G5H B;  4OCZ A;  3GDX A;  2AQ0 A;  5DGB A;  5E79 U;  4F4Z A;  5EE3 A;  4C8K A;  2LYB A;  3RB4 A;  4UAR A;  3RH4 A;  1BPB A;  5KT6 A;  4RT3 A;  4M9N A;  3I28 A;  3V7K A;  2QB0 B;  5AIB A;  3JPR A;  4YR0 A;  8ICW A;  3QEA Z;  2QLT A;  1KSP A;  2Q0Z X;  2P6R A;  3ISC A;  2Z7J A;  3SR6 A;  4BX9 C;  1N60 A;  4Y2V A;  4DSI A;  5DBB A;  2VJ4 A;  1TE2 A;  4DQP A;  3IRU A;  4GXJ A;  4J9Q A;  3PZP A;  4Y2X A;  3NRZ A;  7ICR A;  1IV8 A;  3C29 A;  3PVX A;  1NZB A;  1HEK A;  4ED1 A;  2KHQ A;  1QSY A;  7ICO A;  8ICZ A;  1X66 A;  2LBO A;  3SV3 A;  4DQQ A;  1X9M A;  4RZR A;  5AK5 A;  2WF9 A;  3FDS A;  9ICC A;  9ICX A;  5CHG A;  3PST A;  2VKQ A;  2HHS A;  4US9 A;  5KG6 A;  4BDP A;  4J9O A;  3T5K A;  3HIL A;  3BJY A;  7ICJ A;  5J2J A;  4BWM A;  2FE9 A;  3SEI A;  4I2F A;  1SXD A;  2F1J A;  2ODG A;  3Q8Q B;  4MHV A;  3RAQ A;  5AKE A;  1MQ3 A;  4RU9 A;  3EUB 2;  3SYZ A;  5KT2 A;  1ZRN A;  4TQS A;  2PKE A;  3QZ7 A;  1YT3 A;  3TAN A;  1ZQ1 C;  2KD1 A;  5AI6 A;  2H3Z A;  5KFH A;  5FP0 A;  2KNJ A;  1A77 A;  3HPO A;  2I1Q A;  3KZX A;  4UAT A;  3MR6 A;  2HHX A;  3TKA A;  3AL0 B;  2DKZ A;  5AI5 A;  9ICP A;  2RDI A;  1IXR A;  4PL2 A;  3HW8 A;  3RB0 A;  4EZ9 A;  4DL2 A;  4RQ4 A;  2W54 A;  3OSN A;  2M0N A;  4DSL A;  1JAL A;  3MFH A;  4QZ8 A;  3QUQ A;  1ZQY A;  3C2L A;  5J2A A;  5KL8 B;  2BR0 A;  4ELT A;  1T7P A;  2EQY A;  3KKA A;  3L3F X;  3KHL A;  4DF4 A;  4RQ8 A;  4JV2 A;  1ZD4 A;  2OYY A;  2WB1 C;  4PGQ A;  1S0O A;  4QZG A;  4QZC A;  3Q8S B;  4B9U A;  8ICF A;  1UQV A;  3RRH A;  2JXJ A;  2EDU A;  3M9N B;  2IBK A;  2BPF A;  2RDJ A;  2IOF A;  4UAY A;  1J2M A;  1K5O A;  1PVQ A;  2MU2 A;  1VLB A;  4DOC A;  2EH9 A;  2XY7 A;  5KFE A;  3MDC A;  4MEX A;  1U48 A;  4C4R A;  3K1R B;  5KFP A;  3LVV A;  3PW4 A;  1JXL A;  2PFQ A;  5ALH A;  5KFO A;  1URJ A;  3U26 A;  1KDH A;  2FDR A;  1HJP A;  2HHV A;  3BS5 B;  2O6K A;  8ICV A;  3IG8 A;  4EEN A;  2W9M A;  5KG7 A;  5AM2 A;  2H3I A;  4FO6 A;  3PNC A;  2ZIW A;  3M1Y A;  2I5H A;  4BXO A;  2LM1 A;  5ALR A;  4IQU A;  3ISB A;  4YMM A;  2ZJ5 A;  4PGY A;  2NRX A;  2ISP A;  7ICM A;  1X40 A;  4YD2 A;  5L1M A;  5IIO A;  4QZI A;  4YR2 A;  3OJU A;  5A0L A;  4XQ8 A;  2JV3 A;  1C20 A;  3MFI A;  1S9F A;  3H8J A;  3AMZ A;  1ARO P;  4Y2Q A;  1SV4 A;  2FPM A;  2WF5 A;  4DL4 A;  3GIK A;  8ICC A;  4QZF A;  1HUZ A;  2LYA A;  5J0X A;  4GXK A;  1ECW A;  5F9L A;  3D2S A;  3QUT A;  2RP5 A;  2FMS A;  3OHA A;  1ZQT A;  1K1S A;  2AQ4 A;  2R18 A;  1ZQD A;  5TIS U;  1ZQW A;  3GFK B;  5BOM A;  2MSN A;  1B4F A;  4ED6 A;  2DWQ A;  2KJ8 A;  1ZYQ A;  5BPC A;  2FLN A;  4J9L A;  1O03 A;  3GIM A;  2XI9 A;  5HHI A;  4QW9 A;  2LPE A;  3QU9 A;  5KFU A;  4M9J A;  2KVS A;  1DRG A;  3H8S A;  4FS1 A;  4PJ0 U;  1L7O A;  2W11 A;  2ISO A;  3F5E A;  2UVU A;  4F4K A;  4J9P A;  4DFK A;  3WKD A;  2KIV A;  4JWM A;  5AI4 A;  2JEF A;  3ONN A;  2HHT A;  2LM4 A;  3C21 A;  1S0V A;  4KLE A;  2RLT A;  5ALO A;  1DK2 A;  4F91 B;  3G6X A;  4F4Y A;  1A76 A;  4NWI A;  5AM1 A;  4C80 A;  2ZIX B;  5J0Y A;  2AXT U;  9ICS A;  4DLG A;  1ZQB A;  5EE1 A;  8ICQ A;  4UB1 A;  3THV A;  3SAF A;  4F50 A;  4QZ9 A;  4O9M A;  2F77 X;  5JTI A;  1FFU A;  5ALM A;  3PW7 A;  2HSZ A;  2QKQ A;  8ICM A;  1LKY B;  4YQW A;  3F2C A;  4ECZ A;  1DXS A;  4OJO A;  2AU0 A;  5AKI A;  1L7N A;  4B9N A;  3A0B U;  2G06 A;  4UAV A;  4DLE A;  4TUR A;  2BPC A;  2E8N A;  3ZD9 A;  4DL7 A;  5ALJ A;  4DSF A;  3V7L A;  4KIT B;  5C5J A;  2XVT A;  5KFR A;  2VA2 A;  1X9X A;  3CRX A;  3RH5 A;  4QWA A;  2C22 A;  3TI0 A;  4R65 A;  4KLG A;  1L3S A;  4ZH4 A;  3M7D A;  5ALW A;  1D8B A;  4CDG A;  2P35 A;  4BWJ A;  5KFC A;  5AKY A;  3SMV A;  3RBD A;  1SKS A;  2BCS A;  3QUC A;  3ETL A;  2QB1 A;  4RNO A;  2ZUC A;  4ED7 A;  1ZQR A;  2QAR A;  5AKZ A;  3QX7 A;  2B6G A;  2V9W A;  1KFD A;  1TVA A;  2Y0S C;  4RQ0 A;  1XSP A;  4DL6 A;  3RF9 A;  1KLN A;  9ICW A;  4P4O A;  4F71 A;  4E0D A;  4M2Y A;  1X9W A;  1RXV A;  4DF8 A;  3PX0 A;  5KT7 A;  1QQ7 A;  2D8C A;  4YFK A;  5KFD A;  3AQF A;  5KT3 A;  5J0P A;  4ED0 A;  4C8O A;  3NS1 A;  1ZQN A;  4RQ3 A;  5J2K A;  2YN4 A;  3VCB A;  4YP3 A;  2H5X A;  1SB3 C;  2K4I A;  4RUC A;  2W9A A;  4K4I A;  5KFW A;  8ICO A;  4TUQ A;  8ICU A;  1NK9 A;  2ZTD A;  2W9B B;  2H3V A;  2CN1 A;  1Z1B A;  2HCF A;  1JX4 A;  4U7C A;  5AM3 A;  1GO3 F;  1XNS A;  3GV5 B;  2AHO B;  1RG6 A;  8ICH A;  4DOB A;  2LHT A;  3PY8 A;  3K75 D;  5G5G A;  1N5X A;  8ICT A;  2F8L A;  1TK8 A;  3UXP A;  3C2K A;  4B6J A;  3LK9 A;  2YQE A;  2W55 A;  1UT5 A;  4KLL A;  1KFT A;  1RDF A;  2ATL A;  1PK3 A;  3AN1 A;  2BKE A;  1S0N A;  3TFS A;  3KFU F;  2EAO A;  3BQ2 A;  4O5C A;  2W03 A;  2G09 A;  3BS7 A;  3NVY A;  2K4H A;  5DQG A;  3RJI A;  5ALQ A;  5B5E U;  2ALZ A;  1F5S A;  5CA7 A;  2F76 X;  4QZH A;  9ICM A;  4FBT A;  5DB7 A;  4B9V A;  2IHN A;  2W3R A;  5KT5 A;  5EWG A;  1ZQF A;  5KFL A;  3UMG A;  3GIL A;  1NK8 A;  1NJW A;  3QZ8 A;  4KTQ A;  1SV0 A;  4Z6E A;  9ICJ A;  5L1I A;  2W7P A;  4DWI A;  1X6J A;  2KEY A;  2HBL A;  8ICY A;  4LZD A;  2G08 A;  2KV2 A;  3ICX A;  4US8 A;  3RB3 A;  3MBY A;  1B0X A;  4CRX A;  4Q8F A;  4AYB C;  1NK6 A;  4CE6 A;  4NM2 A;  2DF4 B;  1NKB A;  4GIB A;  1A6S A;  2ZIV A;  2R8I A;  5J2I A;  1PVP A;  2A19 A;  4DL5 A;  9ICR A;  5KFA A;  5KFM A;  3SEN A;  1ZQC A;  3LVW A;  5KNI A;  1S97 A;  4PL1 A;  4C0Z A;  4I2E A;  4IC9 A;  2R8K A;  3MGH A;  2WB1 F;  1JIH A;  3ISD A;  5IIM A;  2ZIU B;  2JEJ A;  4YMN A;  7ICV A;  3UMC A;  5G5H A;  1SL2 A;  4JV1 A;  1NI3 A;  3PV8 A;  1U47 A;  2BHN A;  9ICT A;  3SQI A;  5HNK A;  1D8L A;  2YMM A;  4Q8E A;  1UHU A;  5AKJ A;  5J2B A;  4FZM A;  2KSO B;  1KBU A;  3I76 A;  1L3U A;  2PXI A;  5DB6 A;  4XRH A;  3K4G A;  5J2F A;  2B0C A;  2JRZ A;  2FLP A;  1K1Q A;  2XID A;  3UPQ A;  5KAF U;  4F92 B;  1Q3V A;  1MA7 A;  5III A;  2VJ5 A;  2RRD A;  4GFJ A;  3IN5 A;  4IRC A;  2C2E A;  2YX8 A;  5J2G A;  5K4L A;  8ICX A;  3M6Z A;  3GU3 A;  2QB0 A;  4ECX A;  4ACO A;  1SGG A;  1QH9 A;  8ICK A;  2W9C B;  1QSS A;  2F2A B;  2XGP A;  2PMZ C;  5J2H A;  2CXY A;  1X2I A;  3EPI A;  4DSJ A;  5KT4 A;  3OPX A;  3CW2 C;  3JPT A;  7ICK A;  2ZXH A;  2JZB B;  1FEZ A;  1ZQG A;  4Q43 A;  4I2H A;  2KHV A;  4C8N A;  1X6I A;  4YG2 A;  4A8E A;  2VIX A;  4O3R A;  4DFM A;  2AGP A;  4JK1 A;  8ICL A;  4ECW A;  3C5F A;  4F72 A;  4ELV A;  2L5Y A;  1PK1 B;  5AI9 A;  2D6F C;  5DQH A;  4O3Q A;  3F2B A;  4JV0 A;  1XWL A;  3T5H A;  3ZDC A;  5HR7 A;  7ICT A;  3RJE A;  3WK9 A;  1ZET A;  1RQL A;  3N97 B;  4AP9 A;  7ICL A;  1QSL A;  2XO7 A;  2C2D A;  3I1Y A;  5KFT A;  3TQ1 A;  4O3N A;  5AK6 A;  5F9N A;  2E3T A;  2W3S A;  3C5G A;  4O5K A;  2XCA A;  1UPH A;  3H0M B;  1BPD A;  5J8Y C;  3NVV A;  5KL1 B;  5DBC A;  3M9O B;  5CP2 A;  4M04 A;  4KLD A;  3H0L B;  2DGZ A;  1Q46 A;  4Z6F A;  3MR2 A;  1U9L A;  4KLH A;  2EAM A;  1BVS A;  1ZQX A;  9ICL A;  4C8M A;  8ICS A;  1F44 A;  5JUM A;  4K4H A;  1JN3 A;  2KJ5 A;  3UM9 A;  2PFO A;  3RJF A;  2E5S A;  4KLI A;  3GV8 B;  5ALZ A;  3DDH A;  1CUK A;  5J0U A;  3ZDE A;  3M6K A;  3G6Y A;  3BQ1 A;  4FS2 A;  4I2J A;  2XC9 A;  2GO7 A;  2K8C B;  2XY5 A;  4R66 A;  4Y2Y A;  4KX5 A;  2BPG A;  2R8J A;  4I2G A;  2UVR A;  4KLT A;  3EWA A;  4QWD A;  3MR5 A;  2G5I B;  2XCP A;  4F5P A;  3ED5 A;  4BJQ A;  2F44 A;  2VA8 A;  3WKC A;  7ICS A;  4NLG A;  1DOQ A;  4RQ5 A;  4KLO A;  5ALI A;  3PO5 A;  3WK7 A;  2E8P A;  1BGX T;  5DLF A;  5T14 A;  9ICQ A;  2W04 A;  5KFX A;  4XUS A;  2WF6 A;  3HX0 A;  5C0Y A;  3RTV A;  8ICG A;  3WK8 A;  4KLF A;  4C8L A;  4R8U B;  1TV9 A;  3GIJ A;  3HT3 A;  1MSW D;  1BPE A;  2KVC A;  3PW5 A;  1NZP A;  1Z19 A;  4DQR A;  4Y2J A;  1T4G A;  4B9T A;  3IP4 B;  4RNN A;  4I27 A;  2KKP A;  3N7S C;  4R8U A;  5B66 U;  4NV0 A;  4J9R A;  1Z00 B;  4Q45 A;  1CEZ A;  1T3Q A;  2ZTC A;  5DB9 A;  3BS5 A;  9ICH A;  3EZ5 A;  4RPX A;  1JRP A;  4WJ3 B;  1RQN A;  4F5N A;  3AEV A;  2DPI A;  1CRX A;  1UA1 A;  1RYR A;  2Y0S F;  4IQW A;  4MFC A;  1OXJ A;  4EX7 A;  1Z00 A;  3CNH A;  5ALU A;  2BCR A;  2YY6 A;  4OO1 J;  3V6K A;  2VAN A;  3F5A A;  1T8E A;  3QU5 A;  5J29 A;  1TK5 A;  2JMG A;  2B21 A;  3PX6 A;  3H0R B;  5DGA A;  1ZQL A;  1MQ2 A;  1ED1 A;  2OM6 A;  4NLN A;  1LVH A;  4ECT A;  1S8O A;  1KL9 A;  5J2D A;  4R64 A;  1KTQ A;  2EZX A;  1SKR A;  1UA0 A;  1ZQK A;  2H3Q A;  1SL1 A;  2YTU A;  2KG5 A;  7ICH A;  2DBY A;  4OJ6 A;  3WK4 A;  1U4B A;  3WKA A;  3ORY A;  1C7Y A;  3H40 A;  4Y2S A;  4F5Q A;  2AJQ A;  5EOZ A;  2BQU A;  2KE7 A;  1SV0 C;  4KMO B;  5KFJ A;  5J0W A;  3C23 A;  2NRV A;  2RHF A;  3JPO A;  2F8K A;  3IHQ B;  4F8R A;  1WCN A;  2WF8 A;  1Y88 A;  4PZN A;  2KK0 A;  1B43 A;  1XS9 D;  5DG9 A;  9ICI A;  3KOO A;  4FFD A;  4DS4 A;  8ICE A;  5F3X B;  8ICB A;  3MAB A;  2KZ3 A;  4DQI A;  2XY6 A;  3RJK A;  2ZG6 A;  5ALF A;  4DFJ A;  1RYU A;  1H38 A;  4O3O A;  1NJX A;  3N7P D;  1SZH A;  3CP8 A;  1Q3U A;  3B0Y A;  5AK4 A;  3TFR A;  3C2M A;  2HBJ A;  1ZQH A;  4OJP A;  5KFB A;  9ICU A;  2OWO A;  1J2N A;  1X42 A;  5HP4 A;  1KN5 A;  2K4P A;  4TQR A;  2MA1 A;  4OJ5 A;  2A1A A;  4KX3 A;  2DFL A;  2ZIX A;  2MRL A;  4DEZ A;  1RXW A;  9ICB A;  3BDP A;  2FMQ A;  1JRO A;  2HOQ A;  5J8Y A;  5KG4 A;  1EXN A;  4M6W B;  2ZJ8 A;  1N2X A;  4PPX A;  4MFF A;  5EWE A;  3Q8P B;  3NAS A;  5D49 A;  1LKY A;  7ICN A;  2VA3 A;  2WAQ C;  4YN4 A;  1YZ7 A;  8ICI A;  2K4E A;  5AKL A;  4AYB F;  3T5L A;  2F1I A;  1HUO A;  3PSF A;  4KLQ A;  3RJG A;  1DGS A;  2JEI A;  1L8L A;  1D8Y A;  1MN8 A;  4PHE A;  4CNQ A;  4C7Z A;  1ZQM A;  5AI8 A;  1V97 A;  2G0A A;  3PX4 A;  2CRX A;  4J9M A;  2K89 A;  4RQN A;  9ICF A;  3EPG A;  2OCE A;  5KFV A;  4X5V A;  2WHE A;  5ALT A;  5CEH A;  1WUD A;  2I6X A;  1P7D A;  2YML A;  4P0P B;  1XO1 A;  2F3N A;  1OUQ A;  2KJ9 A;  5DG8 A;  2NV3 A;  3DV9 A;  3RJH A;  3V7J A;  3AU6 A;  1PUZ A;  2HBK A;  2Y9T A;  3TAD C;  3AU2 A;  2PI5 A;  1RZT A;  5AIA A;  4I2A A;  8ICA A;  2EAN A;  5KFZ A;  4QZB A;  3UXO A;  2Q4T A;  4BGD A;  3N7R C;  1F0M A;  4YMO A;  5KFY A;  1T94 A;  5GTH U;  4Y2P A;  4MF2 A;  5H2F U;  1FFV A;  2PFN A;  9ICE A;  1XC9 A;  5KFI A;  5CJ7 A;  5DDM A;  1MC8 A;  4G3I A;  2PI4 A;  4U6P A;  5J2C A;  2PMZ F;  4Q44 A;  1A0P A;  4CF3 A;  1QLN A;  2EZZ A;  3SZ2 A;  4C4T A;  5J0O A;  4RQ6 A;  5AM4 A;  3PSI A;  7ICP A;  3HKZ C;  3NGD A;  5IIL A;  4FZN A;  5EWF A;  4HAI A;  9ICN A;  7ICE A;  3IG5 A;  4PH5 A;  4QIW C;  1ZQO A;  1LB2 B;  2W9B A;  5AKH A;  1L8O A;  3AUO A;  4P0Q B;  2ZUB A;  3QNM A;  3QE9 Y;  3H4D A;  2MUT B;  4GC7 A;  1SXE A;  5L1J A;  5KG5 A;  4ECQ A;  3WK5 A;  5ALN A;  4ECU A;  2P6U A;  2ZJA A;  4PHA A;  3JPP A;  4K4G A;  4UB3 A;  4DFD A;  1BPX A;  1BPZ A;  2G07 A;  3RFA A;  4KN7 A;  4QWC A;  1ZOL A;  1SZP A;  1TAQ A;  1L5U A;  1ZQA A;  3R9K A;  4ED2 A;  3Q8K A;  3GZF A;  4UAS A;  3JPN A;  2OEH A;  2FPL A;  4TUP A;  2W43 A;  5AI0 A;  2IHM A;  8ICR A;  4O0I A;  4J9K A;  3QUB A;  5J0R A;  1COK A;  2H3F A;  4MF8 A;  1WWU A;  2D3D A;  1S0M A;  3RJJ A;  1J97 A;  4GLX A;  4DFP A;  5L1L A;  4F3O A;  4KN4 A;  1ZQI A;  4O3S A;  2GWS A;  4QWB A;  4Y2U A;  4UBB A;  4EEK A;  3IDW A;  2E1F A;  3JPS A;  4G9B A;  7ICF A;  2AGO A;  1JXE A;  5KG0 A;  4UB4 A;  3GV7 B;  1XO0 A;  1KEJ A;  2A1J B;  2HDO A;  5ALG A;  2GOL A;  1NJY A;  2R8H A;  4YCX A;  2HHW A;  2IOH A;  1NK4 A;  4F5R A;  1N62 A;  4IR1 A;  2LMR A;  3WU2 U;  9ICO A;  3RH6 A;  1RPL A;  3IV6 A;  1D9D A;  3ALR A;  3HWT A;  2A1J A;  4YXM A;  3QU4 A;  1COO A;  4EEY A;  3WKE A;  1ZQE A;  2BGW A;  1LV5 A;  1U49 A;  1BNO A;  4J9N A;  1UCV A;  2HMX A;  5HHH A;  1ZD5 A;  5KFQ A;  5HR6 A;  2FLL A;  1QQ6 A;  3SAH A;  2GLE A;  4B9L A;  1SWV A;  7ICQ A;  3ZDA A;  3NVW A;  2ZIU A;  2C28 A;  4ECS A;  2HVI A;  3M9M B;  4DQS A;  4I2B A;  2JH7 A;  1RYS A;  2HHQ A;  2EAP A;  2KSO A;  3SD7 A;  1T3N A;  1TFR A;  5HMM A;  2JH1 A;  1TK0 A;  5CB1 A;  2N1R A;  1IIP A;  4QZA A;  3N4M B;  2ASL A;  1ZQQ A;  3UXN A;  2KP7 A;  1ZQP A;  1NKC A;  2XGQ A;  5ALE A;  4KLM A;  1L6N A;  1YZ6 A;  3HRD D;  4NXZ A;  4RPZ A;  4QZE A;  2DKX A;  3NUQ A;  4I29 A;  4NLB A;  4B9S A;  2W9C A;  5KG2 A;  3QEB Z;  4PZO A;  4RNM A;  3QU7 A;  2BCQ A;  4O5E A;  3VC8 A;  4IQV A;  1NK7 A;  1ZQU A;  3PMN A;  2WTF A;  2BQ3 A;  2JZB A;  1V38 A;  4EYI B;  3NVZ A;  4KMU A;  4MEY A;  3DEE A;  4NJ8 A;  2FI1 A;  4F4W A;  4M0A A;  4R63 A;  4NLC A;  4UB6 U;  3KHR A;  3RBE A;  1U45 A;  3TAD A;  5D4B A;  1V85 A;  2ES6 A;  1PK1 A;  5L9X A;  2I9G A;  2V4Q A;  3WKB A;  5AM0 A;  3H8M A;  5ALP A;  1NJZ A;  4O3M A;  4QWE A;  1ZQS A;  3T3F A;  4P4P A;  1JI7 A;  3QU2 A;  4OJL A;  1ZJN A;  4UAU A;  5DDY A;  4QZD A;  5ALK A;  2UVW A;  2KMD A;  1M6Y A;  3GII A;  3PML A;  2K60 A;  3E2E A;  4XA5 A;  4CF4 A;  4O3P A;  3A0H U;  3SAG A;  1Z3E B;  5AKK A;  1VJ5 A;  2WFA A;  4RQ1 A;  4MFA A;  2C2R A;  4PGX A;  4GC6 A;  1KFS A;  3V6J A;  5KAI U;  3HP6 A;  1SWW A;  3PW2 A;  3PO4 A;  5KTQ A;  1XSL A;  4RPY A;  4EBD A;  5ALY A;  4F4X A;  2BZF A;  3OHB A;  9ICK A;  4RT2 A;  4CGZ A;  1UT8 A;  1S5L U;  3FYH A;  3BQ0 A;  2Y9U A;  4DL3 A;  3OSP A;  3D6J A;  4UBC A;  3Q8L A;  3T79 A;  5AHX A;  4Z6C A;  1SIJ A;  4UAZ A;  4P2H A;  5TZV A;  5DBA A;  4YD1 A;  4GXI A;  2WAQ F;  5EE0 A;  3PR4 A;  2OH2 A;  2HW3 A;  1HIW A;  3MC1 A;  3KHH A;  4OD0 A;  2YMQ A;  4NL9 A;  1AQ6 A;  2ZIW B;  1KQQ A;  3SV4 A;  3EW9 A;  2IMW P;  3C1Z A;  3ETR A;  4BXO B;  4BUG A;  3BZC A;  3AQE A;  3B0X A;  2HOI A;  1IM4 A;  2FPK A;  3KZI U;  3KHG A;  4ECR A;  3D2Q A;  7ICG A;  2ZXI A;  2E8M A;  2JR5 A;  2XIC A;  2JHD A;  3LYS A;  1ZRM A;  2M9N A;  1L7M A;  3GQC A;  4ECV A;  2Y1J A;  2KN7 A;  9ICG A;  4UB8 U;  5DKW A;  1ZQZ A;  5JU5 A;  2W8L A;  3F53 A;  1BPY A;  4NLZ A;  4IS7 A;  5DB8 A;  2NYV A;  4RQ7 A;  1S10 A;  4Y2T A;  1NK5 A;  3RAX A;  3OGU A;  3ZD8 A;  1BNP A;  4J03 A;  1S76 D;  1NOM A;  2KIW A;  5AKG A;  4NY8 A;  1N56 A;  3T5J A;  2PFP A;  1ZD3 A;  2DQN B;  1SKW A;  2YMP A;  4RQ2 A;  5KFN A;  1ZJM A;  4YVZ A;  2BQR A;  5IIK A;  4RQM A;  4UAW A;  1ZQV A;  4M9G A;  4NM1 A;  3FAH A;  5KFF A;  5CRX A;  2YB1 A;  5AM5 A;  1N61 A;  1WYG A;  2KZM A;  3HKZ F;  4M47 A;  5AK3 A;  1XSN A;  1Z1V A;  2GH1 A;  2NRT A;  5ALL A;  2LYH A;  3KTQ A;  4M9L A;  2ZUD A;  4QIW F;  2BCU A;  4PHD A;  1DGJ A;  3UQ2 A;  2WF7 A;  3K1Z A;  3ZI4 A;  4IR9 A;  1IG6 A;  1B22 A;  7ICU A;  2F1H A;  3ZDD A;  2ZTE A;  3KD3 A;  2BDU A;  4DS5 A;  2DL0 A;  2IOF K;  2W7O A;  2NO4 A;  1TAM A;  5CWR A;  3TAC B;  4ED3 A;  3Q8R B;  1NKE A;  2HOF A;  3HJE A;  2YB4 A;  2Y1I A;  8ICP A;  2KZZ A;  2OXO A;  5J0Q A;  3Q8M A;  3O0F A;  2NO5 A;  2HBM A;  4NLK A;  1X9S A;  2KIC A;  3L5K A;  1JMS A;  2ASJ A;  3PW0 A;  2AH5 A;  5L1K A;  1D9F A;  3M8S A;  2ASD A;  2KFN A;  3IM1 A;  4KLS A;  3FM9 A;  3OTQ A;  4CF5 A;  3AM9 A;  3S6J A;  1S77 D;  1Z4N A;  3BQ7 A;  5ALS A;  4EEL A;  3C28 A;  3F2D A;  4ED8 A;  4YR3 A;  4I2C A;  4UB5 A;  2HVH A;  3MR3 A;  3KBB A;  4ECY A;  2V4R A;  2LKY A;  3WK6 A;  5KFS A;  2UVV A;  4UQG A;  4FBU A;  7ICI A;  4DCC A;  4Y2R A;  8ICJ A;  4USA A;  1Z4O A;  2A3V A;  4TUS A;  4M6W A;  3BQT A;  3RR7 A;  3FC4 A;  4JB3 A;  8ICN A;  4RUA A;  1ZXI A;  3QYP A;  3C1Y A;  5DQI A;  4EBC A;  3MGV A;  5ALD A;  3ZDB A;  3M8R A;  4FE3 A;  1CI4 A;  3TAQ A;  2DUY A;  1KRP A;  2QAR B;  4IQT A;  1RM6 C;  4QW8 A;  1Q8K A;  2J6T A;  2K8A A;  4ICA A;  1QTM A;  2JEG A;  4IRK A;  3NTU A;  2FJ6 A;  1KKX A;  1FO4 A;  4F2S A;  3J81 j;  4PHP A;  1XU4 A;  3OJS A;  2R8G A;  9ICV A;  1WCL A;  1PZN A;  1NNL A;  1L3V A;  3LDA A;  3H4B A;  5BOL A;  2MAX A;  5AIC A;  3PR5 B;  4P0P A;  1DK3 A;  4B9M A;  4M9H A;  4EYH B;  9ICA A;  2RQ5 A;  5DLG A;  5HML A;  3JPQ A;  3MDA A;  1N63 A;  4ELU A;  2OHF A;  3SI8 A;  1VDV A;  3B9J A;  2JGA A;  1O08 A;  4JMU A;  3LWM A;  4I2D A;  3BZK A;  4DSK A;  1OW5 A;  3RRG A;  4CCH A;  4LZG A;  1N48 A;  5J2E A;  2W8K A;  4P4M A;  4I2I A;  4QJF B;  5AKX A;  4F2R A;  4C4S A;  3MGI A;  1WWV A;  1V9P A;  4UB2 A;  4JWN A;  3UQ0 A;  1NK0 A;  4J9S A;  3G6V A;  4KLU A;  2E8O A;  4KLJ A;  4IRD A;  1QQ5 A;  5J0S A;  2AGQ A; 
#chains in the Genus database with same CATH homology
 2D3D A;  5F3X B;  2F3N A;  2DKZ A;  3KKA C;  1X40 A;  5L1M A;  2JV3 A;  4RQM A;  3SEN A;  5JTI A;  2Y9T A;  3TAD C;  5KNI A;  1SV4 A;  2DKX A;  2QB0 B;  2QKQ A;  1LKY B;  3IDW A;  4PZO A;  1DXS A;  2EAN A;  2Y9U A;  2QAR B;  1Z1V A;  5J8Y C;  1F0M A;  1V38 A;  2E8N A;  3BS5 A;  2ESE A;  1RG6 A;  3KKA A;  4NJ8 A;  2K4P A;  2DL0 A;  1KW4 A;  2EAM A;  2KSO B;  2LMR A;  3TAD A;  4NL9 C;  4NL9 A;  1V85 A;  1B4F A;  1OXJ A;  2ES6 A;  1X9X A;  1PK1 A;  3TAC B;  1X66 A;  1PK3 A;  5J8Y A;  3H8M A;  2EAO A;  1UCV A;  2LPE A;  1UQV A;  5JRT A;  2E8M A;  2GLE A;  2QB0 A;  2QB1 A;  1LKY A;  3BS7 A;  1JI7 A;  1OW5 A;  1SGG A;  2QAR A;  3HIL A;  1SXE A;  2B6G A;  2YTU A;  2KG5 A;  2KMD A;  2FE9 A;  2KIV A;  3SEI A;  3BQ7 A;  1SXD A;  2F44 A;  2K60 A;  5JU5 A;  3K1R B;  4MHV A;  2KE7 A;  1SV0 C;  2EAP A;  1SV0 A;  4IS7 A;  2E8P A;  2KSO A;  3BS5 B;  1WWV A;  4RQN A;  2F8K A;  4PZN A;  2D8C A;  2E8O A;  1B0X A;  1COK A;  2L5Y A;  1PK1 B;  1WWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...