1SV4A

Crystal structure of yan-sam
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
78
structure length
78
Chain Sequence
QLPPSLPSDPRLWSREDVLVFLRFCVREFDLPKLDFDLFQMNGKRLCLLTRADFGHRCPGAGDVLHNVLQMLIIESHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ets DNA-binding protein pokkuri
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 22
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv4A00
3BS7A 1OW5A 1SXEA 4IS7A 2B6GA 2KSOA 2ES6A 1OXJA 1LKYA 2F44A 4MHVA 4PZOA 1X40A 3SENA 5J8YA 2KE7A 2FE9A 4PZNA 2LMRA 2LPEA 2Y9UA 2EANA 4NJ8A 1JI7A 3BS5A 3KKAC 3BQ7A 2QB0A 1SGGA 3SEIA 1LKYB 1X9XA 2DKZA 5L1MA 2QB1A 2E8NA 2D3DA 1UCVA 1PK1A 2KIVA 2QKQA 1UQVA 2KMDA 2GLEA 2K60A 3BS5B 2QB0B 5JRTA 1V85A 4NL9C 4RQNA 2E8PA 2KSOB 2YTUA 3IDWA 2D8CA 3TADC 1X66A 2QARA 1WWUA 1SV0C 3KKAA 1SV4A 2EAPA 1PK1B 3HILA 3H8MA 2EAMA 2JV3A 1DXSA 1Z1VA 1WWVA 2K4PA 1B0XA 2E8MA 1F0MA 5F3XB 5KNIA 2L5YA 2ESEA 1SXDA 2F3NA 2DL0A 2E8OA 2QARB 5JTIA 3K1RB 1V38A 1B4FA 4NL9A 5J8YC 5JU5A 2F8KA 3TADA 1KW4A 1PK3A 2DKXA 1SV0A 2Y9TA 2EAOA 2KG5A 1RG6A 4RQMA 3TACB 1COKA
chains in the Genus database with same CATH superfamily
5J2EA 2ZJAA 1NJWA 3HJEA 4FO6A 9ICTA 3ICXA 3SAHA 2K8AA 5KT4A 1NK5A 5IILA 4USAA 4BXOB 5ALJA 2ZTEA 3OHBA 5J2HA 3WU2U 3EUB2 2VA8A 5TZVA 1RXVA 1PZNA 4DLEA 3C2MA 1X2IA 2FPLA 3T5JA 1MC8A 2OYYA 1XSLA 2RQ5A 3RBDA 9ICKA 2B0CA 4M9GA 2IOHA 4JMUA 5L1JA 5J0QA 1SB3C 2WTFA 4O3PA 4NLGA 1ZQGA 4UB6U 3F2BA 2QKQA 4EYHB 4O9MA 1NNLA 3WKDA 4R8UA 4KLMA 5CP2A 4IC9A 1XO0A 4ICAA 4KITB 5ALMA 4AYBF 3GILA 3HKZF 5DDMA 4O5KA 2F2AB 1D8BA 3MGIA 1RQNA 5ALVA 4DFMA 1ZQEA 4JWNA 3PX0A 4WJ3B 2OWOA 2I1QA 4US9A 1NJYA 2NRTA 1SXDA 4OJ5A 4I2CA 4M9HA 1ZQKA 1URJA 4UBCA 4US8A 4LZDA 3IG8A 3C5FA 3C1ZA 5JU5A 5DKWA 4KX3A 3CNHA 1B22A 5DBCA 4DOBA 2N1RA 3UQ2A 2KKVA 2KFNA 2A1JB 3PO4A 1RG6A 4PH5A 3F5EA 2V4RA 1KQQA 3KHRA 3PY8A 4GFJA 2DQNB 3AMZA 4F5NA 1ZRMA 3KBBA 4IS7A 4RT3A 2JR5A 2ZIUA 2ZUCA 4B9TA 4U7CA 1RYUA 4DSIA 1WCLA 4J9PA 2FE9A 1ZJMA 3RRGA 2PFOA 3KZXA 2NO4A 1ZQRA 2HDOA 1ZQXA 3WK7A 4Z6EA 1JI7A 1N5WA 2RLTA 5J0UA 3NVZA 7ICOA 1CRXA 5KFJA 5KG3A 5AKEA 4B9MA 2VJ5A 5ALTA 4C7YA 2JEJA 7ICVA 3IN5A 5AM2A 1BPYA 4F4WA 4YCXA 4QZHA 2P6UA 4XQ8A 2K8CB 4B9NA 5JRTA 4P0QA 4CF4A 3BDPA 3F5AA 3E2EA 2E1FA 4QW9A 2XY7A 4PJ0U 4BX9C 2EAPA 5AM5A 3JPOA 1ZD2P 3HILA 3UMCA 2R8JA 5KFCA 4G3IA 2CRXA 5ALLA 2HMXA 1ZQVA 5CWRA 3M8RA 4NV0A 4I2AA 4UBBA 1NK9A 2R18A 9ICEA 2VA3A 4B6JA 3A0BU 2NRXA 2MSNA 3I76A 1B4FA 4M6WB 3NRWA 3E0FA 3H0RB 4J9QA 3RJEA 3D2QA 1DK2A 1CUKA 4RQ6A 1T7PA 2JZBB 2ZTCA 3EW9A 1S0MA 9ICLA 2KSOA 2ZG6A 3RAQA 5KAFU 1LKYA 2M9NA 4EBDA 5D4BA 4P2HA 4EENA 1TAQA 2XC9A 4PGYA 3HX0A 2JXJA 2MUTA 2KZZA 8ICZA 4R65A 4M9NA 3FM9A 4QJFB 1PVQA 4DL2A 2JEFA 2R8HA 3F2DA 3WKBA 2G06A 2ZXIA 3ZDDA 2G07A 3GU3A 3B0YA 1O08A 1NZPA 3ETRA 3CP8A 1KTQA 2AHOB 1T3NA 2XICA 1ZJNA 5KL8B 2H3FA 5BOMA 4DS5A 4RQ7A 2XY6A 2W9BB 2BGWA 1S10A 1RQLA 1ZD3A 3PX6A 5AIBA 3T5LA 1SZPA 3GV8B 1OUQA 3V7KA 3RJGA 5C0YA 3D2SA 1PK1B 3KZIU 4I2EA 2H3QA 2KP7A 1JXLA 3PV8A 4XUSA 5AHXA 5HNKA 1MQ2A 3PNCA 1WWVA 9ICXA 2PI4A 3F2CA 5KFVA 2K4EA 3QUQA 5ALIA 3AU6A 1X6JA 4ED0A 8ICHA 5ALDA 4PHAA 4IR9A 2BQ3A 3OJSA 3OJUA 2VJ4A 2F8KA 1CEZA 4NY8A 4ACOA 8ICGA 2YY6A 9ICGA 4Y2PA 3PR5B 4C80A 3KD3A 4I2IA 4UAZA 3QZ8A 4FS2A 1K5OA 2W54A 3K1ZA 3TACB 2F1IA 2G09A 3ONNA 5J2FA 1F5SA 4M9JA 9ICMA 1L7PA 4C4TA 1ZOLA 5EE1A 4FE3A 3UMBA 4CE6A 1X6IA 3MR5A 5DB6A 3H7IA 4YXMA 2KK0A 2Y9UA 5DDYA 4PL2A 1TVAA 3N97B 3ORYA 3SEIA 3PSPA 3HPOA 1ZQLA 2FJ6A 3DDHA 3UQ0A 2W3RA 1VDVA 3ZD8A 5ALNA 5KFPA 2BQRA 5KG6A 1FO4A 4F4ZA 5EWFA 5HR7A 4ECUA 3AEVA 1TV9A 4ED2A 5EWGA 1U47A 1SL0A 2KMDA 1JUDA 3QNMA 1N56A 3FC4A 3T5HA 2KEYA 3G6XA 3RJFA 4KLSA 4J03A 5L1LA 3CYMA 4UB8U 4NM2A 1ZYQA 2ISPA 2NV3A 4YMOA 2KOBA 4I27A 4I2FA 2KVCA 5HP4A 4IRCA 4ECQA 2W9AA 7ICQA 4DSLA 1B0XA 2C28A 3LWMA 4PHDA 4CF5A 1NJXA 4I2BA 2QARB 1S76D 4J9SA 1MA7A 5J0SA 2G5HB 2JHDA 2RDIA 1JN3A 1KW4A 4DFDA 2AQ0A 4YQWA 1Z1BA 1SV0A 2DF4B 2VA2A 4KMUA 3U26A 1ZQNA 2A19A 4QZBA 2MU2A 3GV7B 1SXEA 3J81j 1DK3A 2Y1IA 1XU4A 2KFZA 1BPEA 2ZJ8A 4JV1A 3NVVA 4KMOB 5KT3A 8ICAA 4M9LA 2ZTDA 3G6YA 3BJYA 1L7MA 2XIDA 3T3FA 4DSJA 4Q44A 1XSPA 4RQ4A 5KFIA 1Z4NA 1LVHA 1N63A 1NOMA 3BS5A 3KKAC 4UB4A 4UQGA 3T5KA 5B5EU 2DPIA 2H3ZA 1RXWA 1M6YA 5KFBA 2WF5A 4NLBA 2JGAA 1NK7A 1ZQWA 3SV4A 1NKBA 8ICRA 7ICNA 4OCZA 5J0YA 4IRDA 4OJOA 2J6SA 2UVUA 2E8PA 3IDWA 2XVTA 3N7SC 1TK8A 3ZDAA 1LB2B 1QSSA 3LYSA 5DGAA 3HRDD 5ALGA 1UHUA 4FZNA 4P0PB 3OSNA 5K4LA 2AGOA 4R8UB 1ZQOA 5AI8A 5J2KA 3H4BA 4RQ1A 3SZ2A 1F0MA 8ICXA 4JUZA 2E8OA 2ZUDA 1K1QA 5JTIA 2MA1A 1ZQHA 2W7OA 3Q8LA 4NL9A 1IG6A 3NRZA 4Y2XA 3BQ0A 2PMZC 3KOOA 1ZQYA 4DOCA 8ICMA 5F9NA 3UMGA 2FPMA 2IOFK 4P4OA 2BHNA 5KT6A 2C22A 4YR3A 3BQ1A 3NASA 4PGQA 1JALA 3H40A 4DS4A 9ICJA 1PUZA 4P4PA 2KKPA 4K4HA 4YG2A 3NS1A 4QZGA 4KLEA 4QNLA 1L7NA 2OH2A 2YB4A 5C5JA 2NRZA 2FPKA 3RBEA 5GTIU 3MABA 3BQ2A 3MFIA 4DOAA 4OO1J 4QWDA 7ICIA 3LDAA 5G5GA 3LVWA 4RNNA 1V9PA 2ZIUB 4DL7A 4ED1A 1NK6A 2BDUA 1SGGA 2RRDA 3IM1A 1DOQA 3M8SA 3M9NB 4ELVA 4C8MA 2W43A 1CI4A 2HSZA 5E79U 4KLJA 3M6KA 5H2FU 5CR0A 3LWLA 2YMPA 1NZBA 7ICSA 2NO5A 1NK4A 2HHSA 2V4QA 3NVYA 1NK0A 4IQVA 4FBTA 1J2NA 1S97A 7ICUA 5IIKA 2WAQC 4O3RA 1O03A 4KLLA 1TAUA 7ICPA 1HUOA 3PR4A 2HOQA 1KFDA 4NLZA 4IQWA 4IL6U 1GO3F 3C21A 4KLTA 4XRHA 3V7LA 4O3SA 3JPSA 3PSTA 2R8GA 1L3VA 2EQYA 4YN4A 2DWQA 2OXOA 7ICJA 3QZ7A 4P0QB 2PFPA 4TQSA 1TAMA 2XCAA 2PMZF 5KFLA 2AXTU 5ALRA 2C2DA 4UAVA 4EYIB 3SAGA 8ICCA 1QLNA 3UXOA 2IHMA 2W7PA 8ICWA 1Q3UA 3IG5A 2BCSA 4EZ9A 9ICHA 3LK9A 4Y2SA 3RB0A 2Q4TA 2IBKA 1NI3A 2WF9A 4X5VA 3SYZA 1SWWA 1X9WA 2Y0SC 1DRGA 1DGSA 2LHTA 2BKEA 2F1JA 4IR1A 3NVWA 3D2NA 3MR2A 3AQEA 1YZ6A 3QUCA 1B43A 9ICQA 5L9XA 3PMLA 1MQ3A 4F72A 5KFXA 1SL2A 1TKDA 1KFTA 1Z00B 2ALZA 3IRUA 3MR3A 1D9DA 1NK8A 5KFNA 1LKYB 3RR7A 3AL0B 5KG7A 5AKJA 2ZIVB 2HBKA 2P6RA 3AUOA 3FYHA 4RT2A 1HEKA 3PSFA 2HBLA 4C4RA 2MUTB 1KN5A 3DV9A 5ALKA 1XWLA 5ALSA 4C7ZA 3JPPA 5KFZA 5BOLA 3PMNA 5AKYA 4TUQA 9ICWA 1QQ5A 5KFMA 3GZFA 3M7DA 2WAQF 2YMMA 4F3OA 4GXIA 4IRKA 4UAWA 4KLIA 5AKZA 4F71A 8ICFA 1FFVA 2H3IA 4PGXA 9ICAA 3JPRA 5AK6A 4Y2YA 2WF6A 4Z6FA 3V72A 2AGQA 5JUMA 4NM1A 3B0XA 1SKSA 2EZXA 4ECVA 1T94A 5CRXA 1WUDA 2KJ9A 5CB1A 2ESEA 4CRXA 2I6XA 4Y2UA 1RYSA 2CN1A 4DL5A 5GTHU 5AK5A 2DUYA 4GIBA 5ALHA 1XO1A 4K4GA 2EDUA 3WKAA 5L1IA 3JPQA 3SR6A 1SL1A 8ICPA 2BPCA 5EOZA 3L5KA 4HAIA 5J2CA 1JXEA 4I2HA 2Y0SF 2FMPA 3AQFA 2BCUA 4LZGA 2IA6A 3IV6A 1ECWA 2KZMA 3PW7A 3RTVA 2YMQA 3EPGA 5DQHA 4YD2A 4KLGA 5L1KA 2R8KA 5J8YA 1BNOA 5KAIU 3KFUF 4PZNA 1NKEA 5AM4A 2PFQA 3SV3A 3KHGA 4MEYA 2E5SA 1U4BA 3QU5A 2DGZA 2ZXHA 2BCRA 1KEJA 4F5PA 4M04A 4BUGA 2KVSA 5DGBA 4B9VA 3S6JA 5B66U 1BPBA 1RPLA 9ICUA 4B9SA 5T14A 5DB9A 3C2LA 2LYAA 2DFLA 4O3NA 3NGDA 2BR0A 4EEKA 5HHHA 1WWUA 1JRPA 4NLCA 3E58A 5DLGA 1TE2A 2KNJA 3V6KA 2ASLA 3UXPA 2HCFA 2EAMA 1Q8KA 4DEZA 5DB7A 2CPRA 3A0HU 9ICBA 5CHGA 5ALZA 2E8MA 3RJKA 2AU0A 2DL0A 8ICNA 2PI5A 3BZKA 3RH4A 2J6UA 4ECYA 1ZQTA 3Q8SB 4R66A 4JK1A 3OSPA 3SI8A 1H38A 5KFWA 2HBMA 3RH5A 2J6TA 1BPXA 1XC9A 1AQ6A 5IIOA 2DBYA 2KTQA 1PVRA 3TI0A 2WF8A 4YD1A 7ICRA 3GIIA 9ICVA 2G08A 2HI0A 3TFRA 1RM6C 5KFQA 3L3FX 4FFDA 4B9LA 1X40A 1IXRA 2KHQA 5J2IA 3Q8RB 5KT7A 4KLHA 1XS9D 5J0WA 3ZI4A 1U49A 5J2AA 3OPXA 1L5UA 3N7RC 3L4PA 4QZIA 2H5XA 2KV2A 5DBAA 3C29A 2YB1A 2OEHA 4M6WA 3OHAA 1ZQPA 1ZQMA 1ZQQA 3R9KA 2QLTA 2I5HA 1KSPA 2LBOA 7ICTA 2KIVA 1ZD4A 2NYVA 3B9JA 3RRHA 4J9KA 1FEZA 5CA7A 2JZBA 7ICHA 4Q8EA 2RDJA 3BS5B 3TFSA 2LM4A 2PFNA 5AI4A 4CF3A 3EWAA 4ELUA 4BJQA 5J0RA 1SV0C 3I28A 1ZQUA 3AM9A 1HIWA 3DEEA 2W9CA 3Q8PB 5J0XA 4J9RA 3C2KA 1BNPA 3QEBZ 1VJ5A 5EE0A 5F3XB 1HJPA 1L6NA 1X9SA 4BDPA 7ICGA 4F8RA 2PXIA 2FLLA 3O0FA 1KDHA 4QWBA 3WK4A 5DLFA 2W8KA 4YFKA 3CW2C 3TADA 2PKEA 5AM3A 4RQ3A 4GLXA 1MN8A 5KFHA 5J0PA 5J2JA 5FP0A 2GH1A 3FDSA 2A3VA 1PVPA 3UXNA 1WYGA 1JX4A 3MR6A 3BS7A 1BPDA 4UASA 3QUBA 4DL6A 1OXJA 9ICFA 1ZQFA 1S8OA 2UVVA 8ICYA 2Z7JA 5CEHA 3FAHA 1S0NA 8ICEA 5KFFA 4DQIA 3ISBA 5KFAA 5DB8A 4ED7A 1SWVA 5DQIA 3ZD9A 1WG8A 3GDXA 2JEGA 1ZQ1C 4JB3A 3JPTA 3RB6A 4JV0A 1ZQIA 4F5QA 4DQSA 3QU4A 5J2BA 3WKEA 4RUAA 1Z4OA 2IHNA 3PW4A 4UATA 1T4GA 3PX4A 1S77D 4NL9C 4DQPA 1ZETA 4DO9A 1QSLA 1A6SA 4KLOA 3ALRA 2FMQA 4AP9A 3GFKB 2MRLA 4Z6DA 9ICIA 1ED1A 1DGJA 1HUZA 1Z1VA 3AU2A 4RPYA 2Q0ZX 1A0PA 2E3TA 5F9LA 1RYRA 1ZQCA 4GXKA 2KIWA 4J9NA 1ZQAA 3ISDA 2HVHA 4RNMA 4BWJA 2VIXA 2KICA 1ZQJA 2FI1A 3HT3A 4IQTA 4ZH4A 4R64A 2JH1A 1FIQA 2KG5A 5AKLA 5KT5A 3K4GA 1EXNA 5DG9A 4CCHA 5AI6A 3Q8QB 1KL9A 5AK4A 3VCBA 3C5GA 4KLFA 3ZDBA 1L3TA 8ICIA 4E0DA 3HP6A 4PZOA 3M9MB 4J9LA 4Y2QA 2LYHA 4F93B 2VANA 5AM1A 3RJIA 4A8EA 2ZIXA 3SD7A 3JPNA 2EANA 3PW5A 2NRVA 2D6FC 2GO7A 4ELTA 4YP3A 5AKGA 1UT8A 1KKXA 5AKIA 5DG7A 2OCEA 4K4IA 4F4XA 3TANA 2FMSA 3MGHA 4PHPA 1UQVA 2GWSA 1N5XA 2XGPA 3TARA 1L3SA 4RNOA 2YTUA 2D8CA 3C1YA 5ALFA 1ZXIA 1S9FA 1SV4A 5KFYA 1UPHA 2I9GA 4QZ9A 3ETLA 2K4HA 4RUCA 3KHLA 2VKQA 1J2MA 5KFOA 4UB3A 1SIJA 4JWMA 1SKWA 2W3SA 3IHQB 4PHEA 2F8LA 5KNIA 2FDRA 4I2GA 2F3NA 2KHVA 4O3MA 2P35A 2Y1JA 3MGVA 8ICQA 2ASJA 3OTQA 3PW2A 2XGQA 2HHWA 4RQ8A 1ZQSA 3UPQA 2DKXA 2F1HA 2Y9TA 4ED8A 1JIHA 4YR0A 1Z3EB 4F4YA 8ICLA 4GC7A 5CJ7A 4DQQA 1QCKA 4OJLA 2W55A 2B6GA 3RH6A 1NKCA 4QZDA 4QWEA 5ALOA 2F44A 3KHHA 2K8BB 3M6ZA 2KD1A 3SENA 4LVSA 4P0PA 9ICSA 4J9MA 4O3OA 2HHTA 2WB1C 2WFAA 3MDAA 3QUTA 4NJ8A 2KN7A 2RHFA 3WK9A 4UW9A 3BQ7A 2QB0A 4DQRA 3QYPA 4OD0A 2DKZA 5L1MA 2QB1A 4DLGA 1ZQBA 2HVIA 3M9OB 1L7OA 4MEXA 1N61A 5KFDA 2ZIWA 2BCQA 2RP5A 1Q46A 4TUPA 1JROA 1UA1A 1ZD5A 2KSOB 4DCCA 3MFHA 4QIWC 2W04A 4IQUA 4UARA 3VC8A 2BPFA 4KN7A 3EYZA 2V9WA 3RR8A 2HOIA 4Q43A 4DSFA 1TK5A 1N48A 1XNSA 5AK3A 3SAFA 4MFAA 4YVZA 1DXSA 3WK5A 4OJ6A 1RZTA 3BQTA 2IMWP 1J97A 2K4PA 1LV5A 4Y2RA 3C23A 3V6HA 4ECWA 4RZRA 4R63A 4EZ6A 2AQ4A 5J8YC 3LVVA 2H3VA 2ZJ5A 4YR2A 4EELA 4BXOA 5J2GA 9ICCA 2ATLA 1X42A 4QZAA 4DSEA 4G9BA 1TK0A 3H8JA 5EE9A 7ICMA 4O5EA 2GOLA 4MF2A 2JH7A 3THVA 2F77X 2P66A 5AKXA 3PVXA 5DQGA 4HYKA 3H4DA 3GIJA 2G5IB 3GIKA 5KTQA 3I1YA 3WK6A 2AJQA 8ICVA 2WB1F 3M1YA 2XY5A 1VLBA 4UAUA 4UB1A 2EZZA 2W03A 4QZCA 1NJZA 2KJ8A 3GQCA 4C4SA 5AM0A 2G0AA 5J29A 4NXZA 3QU7A 2E8NA 2HBJA 5KFTA 3QE9Y 3EZ5A 4RQ0A 1XSNA 5EE3A 8ICSA 3SMVA 5HMMA 5KFEA 5KFGA 5TISU 4DF4A 1SZHA 1V97A 1A76A 2GLEA 2K60A 4QIWF 2HHQA 2BDPA 3BZCA 3ZDCA 4GC6A 5EWEA 5IIJA 1TFRA 5KFUA 4FBUA 2YQEA 5ALQA 4QWAA 4CNQA 5DG8A 1BGXT 2EH9A 5J2DA 5A0LA 4PL1A 2JV3A 2XO7A 4ED3A 2YN4A 4C0ZA 4FS1A 2MAXA 4GXJA 3NUQA 1Y88A 4M2YA 2A1JA 1QQ6A 5KT2A 1L8OA 4YXJA 5BPCA 1Z00A 4DL4A 3MC1A 4FZMA 2WHEA 1COOA 4M0AA 4FZLA 3OGUA 2A1AA 2ZIVA 2ZUBA 5IIMA 1PK3A 5AI0A 2W9CB 2KJ5A 5AIAA 1QSYA 8ICBA 2W11A 1FFUA 5ALEA 5KG0A 8ICUA 7ICEA 3SQIA 1K1SA 3ZDEA 1BVSA 5ALPA 3RJJA 4DWIA 4NLKA 4EEYA 1QH9A 2ES6A 1IIPA 4TURA 2AH5A 2K89A 5AI5A 3RF9A 3MDCA 5AKHA 4B9UA 2BCVA 4F4KA 1JMSA 1S0OA 2HHUA 2LMRA 4ZOHC 3RFAA 2LPEA 4NWIA 8ICOA 4C8OA 5DBBA 1ZRNA 4KLDA 2UVWA 1UA0A 4UB5A 3GIMA 1X9XA 1U9LA 5KG2A 4KTQA 3H0MB 4UAYA 4Q8FA 1RDFA 2W9MA 1QTMA 1S5LU 4NLNA 4M47A 1F44A 4ED6A 2BQUA 2C2EA 1C20A 1V85A 4QZFA 4ECRA 3D6JA 8ICJA 5G5HA 3UM9A 3TADC 5J0TA 4TQRA 1QQ7A 3GV5B 4CGZA 4BGDA 4O3QA 4P4MA 1D9FA 1KFSA 3ISCA 2OHFA 3RB3A 4ECSA 3ED5A 2JMGA 2OM6A 9ICPA 2LI6A 2C2RA 4F2RA 2NRWA 3N28A 4I28A 3K1RB 1V38A 3QU9A 1N2XA 2BPGA 5ALWA 4Y2TA 4OJPA 5ALXA 1N60A 2FLPA 4RQ5A 1SKRA 4MFFA 2JEIA 4KLUA 3HW8A 4LJXA 3KTQA 1AROP 1OW5A 3WK8A 2HW3A 5KFSA 3C28A 3QEAZ 2ISOA 4PPXA 4MHVA 3V7JA 4DFJA 3Q8KA 2HHVA 3MBYA 3K75D 7ICLA 2LKYA 9ICRA 3H0LB 3TQ1A 5D46A 4RPZA 8ICKA 2W9BA 2ASDA 2E1EA 4MFCA 7ICKA 1WCNA 3QXGA 1Z19A 3V6JA 4C8KA 4F92B 4QWCA 2D3DA 4KLQA 5HHIA 1PK1A 3WKCA 2ODGA 3TAQA 1U45A 4C8NA 2ZIXB 3PO5A 3PSIA 3N7PD 2LYBA 1Q3VA 5KFKA 2O6KA 4F5OA 2FLNA 4O5CA 1P7DA 3PW0A 2DPJA 1X66A 4QZEA 4EBEA 7ICFA 4ECTA 4QZ8A 5KL1B 2WF7A 3RJHA 3H8MA 5HMLA 4Y2JA 5KG1A 4UB2A 1IV8A 5AICA 3RB4A 1MSWD 1ZQZA 4DL3A 4C8LA 4I29A 3H8WA 5D49A 3G6VA 1L3UA 4ECZA 5AI9A 2YX8A 3TKAA 4YMMA 2IOFA 1X9MA 4RQMA 2R8IA 3N4MB 1ZQDA 4DFKA 1COKA 2B21A 4QW8A 2M0NA 4DSKA 4JV2A 2K4IA 4F50A 4O0IA 4F5RA 3PZPA 4F91B 1A77A 3T79A 1D8LA 2KE7A 3QX7A 2XCPA 2HOFA 4RQ2A 4EX7A 1C7YA 3RAXA 1KBUA 1YT3A 5AKKA 4RU9A 1BPZA 1T8EA 4YMNA 2XI9A 1S0VA 4Y2VA 4KN4A 4Q45A 4CDGA 4EBCA 5HR6A 1UCVA 3CRXA 4I2DA 5KG4A 4J9OA 1KRPA 3F53A 4MF8A 5J0OA 3NTUA 1U48A 3IP4B 1YZ7A 2BZFA 1IM4A 5ALYA 2LM1A 4TUSA 2QB0B 4F2SA 3HWTA 4RQNA 2F76X 4EX6A 9ICOA 1KLNA 9ICNA 2QARA 4DFPA 4BWMA 2YMLA 1T3QA 3KKAA 4DF8A 3TAPA 8ICTA 4AYBC 2CXYA 4Z6CA 3HKZC 5KFRA 2UVRA 1N62A 4KX5A 5IIIA 3EPIA 4I2JA 2ZIWB 2AGPA 4RPXA 5ALUA 2L5YA 2W8LA 4XA5A 2JRZA 2HHXA 1D8YA 3Q8MA 3QU2A 5KG5A 5IINA 4ECXA 2EZYA 2EAOA 1UT5A 3H8SA 1L8LA 3AN1A 4U6PA 2KZ3A
chains in the Genus database with same CATH topology
3BS7A 1OW5A 1SXEA 4IS7A 2B6GA 2KSOA 2ES6A 1OXJA 1LKYA 2F44A 4MHVA 4PZOA 1X40A 3SENA 5J8YA 2KE7A 2FE9A 4PZNA 2LMRA 2LPEA 2Y9UA 2EANA 4NJ8A 1JI7A 3BS5A 3KKAC 3BQ7A 2QB0A 1SGGA 3SEIA 1LKYB 1X9XA 2DKZA 5L1MA 2QB1A 2E8NA 2D3DA 1UCVA 1PK1A 2KIVA 2QKQA 1UQVA 2KMDA 2GLEA 2K60A 3BS5B 2QB0B 5JRTA 1V85A 4NL9C 4RQNA 2E8PA 2KSOB 2YTUA 3IDWA 2D8CA 3TADC 1X66A 2QARA 1WWUA 1SV0C 3KKAA 1SV4A 2EAPA 1PK1B 3HILA 3H8MA 2EAMA 2JV3A 1DXSA 1Z1VA 1WWVA 2K4PA 1B0XA 2E8MA 1F0MA 5F3XB 5KNIA 2L5YA 2ESEA 1SXDA 2F3NA 2DL0A 2E8OA 2QARB 5JTIA 3K1RB 1V38A 1B4FA 4NL9A 5J8YC 5JU5A 2F8KA 3TADA 1KW4A 1PK3A 2DKXA 1SV0A 2Y9TA 2EAOA 2KG5A 1RG6A 4RQMA 3TACB 1COKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS7 A;  1OW5 A;  1SXE A;  4IS7 A;  2B6G A;  2KSO A;  2ES6 A;  1OXJ A;  1LKY A;  2F44 A;  4MHV A;  4PZO A;  1X40 A;  3SEN A;  5J8Y A;  2KE7 A;  2FE9 A;  4PZN A;  2LMR A;  2LPE A;  2Y9U A;  2EAN A;  4NJ8 A;  1JI7 A;  3BS5 A;  3KKA C;  3BQ7 A;  2QB0 A;  1SGG A;  3SEI A;  1LKY B;  1X9X A;  2DKZ A;  5L1M A;  2QB1 A;  2E8N A;  2D3D A;  1UCV A;  1PK1 A;  2KIV A;  2QKQ A;  1UQV A;  2KMD A;  2GLE A;  2K60 A;  3BS5 B;  2QB0 B;  5JRT A;  1V85 A;  4NL9 C;  4RQN A;  2E8P A;  2KSO B;  2YTU A;  3IDW A;  2D8C A;  3TAD C;  1X66 A;  2QAR A;  1WWU A;  1SV0 C;  3KKA A;  1SV4 A;  2EAP A;  1PK1 B;  3HIL A;  3H8M A;  2EAM A;  2JV3 A;  1DXS A;  1Z1V A;  1WWV A;  2K4P A;  1B0X A;  2E8M A;  1F0M A;  5F3X B;  5KNI A;  2L5Y A;  2ESE A;  1SXD A;  2F3N A;  2DL0 A;  2E8O A;  2QAR B;  5JTI A;  3K1R B;  1V38 A;  1B4F A;  4NL9 A;  5J8Y C;  5JU5 A;  2F8K A;  3TAD A;  1KW4 A;  1PK3 A;  2DKX A;  1SV0 A;  2Y9T A;  2EAO A;  2KG5 A;  1RG6 A;  4RQM A;  3TAC B;  1COK A; 
#chains in the Genus database with same CATH topology
 5J2E A;  2ZJA A;  1NJW A;  3HJE A;  4FO6 A;  9ICT A;  3ICX A;  3SAH A;  2K8A A;  5KT4 A;  1NK5 A;  5IIL A;  4USA A;  4BXO B;  5ALJ A;  2ZTE A;  3OHB A;  5J2H A;  3WU2 U;  3EUB 2;  2VA8 A;  5TZV A;  1RXV A;  1PZN A;  4DLE A;  3C2M A;  1X2I A;  2FPL A;  3T5J A;  1MC8 A;  2OYY A;  1XSL A;  2RQ5 A;  3RBD A;  9ICK A;  2B0C A;  4M9G A;  2IOH A;  4JMU A;  5L1J A;  5J0Q A;  1SB3 C;  2WTF A;  4O3P A;  4NLG A;  1ZQG A;  4UB6 U;  3F2B A;  2QKQ A;  4EYH B;  4O9M A;  1NNL A;  3WKD A;  4R8U A;  4KLM A;  5CP2 A;  4IC9 A;  1XO0 A;  4ICA A;  4KIT B;  5ALM A;  4AYB F;  3GIL A;  3HKZ F;  5DDM A;  4O5K A;  2F2A B;  1D8B A;  3MGI A;  1RQN A;  5ALV A;  4DFM A;  1ZQE A;  4JWN A;  3PX0 A;  4WJ3 B;  2OWO A;  2I1Q A;  4US9 A;  1NJY A;  2NRT A;  1SXD A;  4OJ5 A;  4I2C A;  4M9H A;  1ZQK A;  1URJ A;  4UBC A;  4US8 A;  4LZD A;  3IG8 A;  3C5F A;  3C1Z A;  5JU5 A;  5DKW A;  4KX3 A;  3CNH A;  1B22 A;  5DBC A;  4DOB A;  2N1R A;  3UQ2 A;  2KKV A;  2KFN A;  2A1J B;  3PO4 A;  1RG6 A;  4PH5 A;  3F5E A;  2V4R A;  1KQQ A;  3KHR A;  3PY8 A;  4GFJ A;  2DQN B;  3AMZ A;  4F5N A;  1ZRM A;  3KBB A;  4IS7 A;  4RT3 A;  2JR5 A;  2ZIU A;  2ZUC A;  4B9T A;  4U7C A;  1RYU A;  4DSI A;  1WCL A;  4J9P A;  2FE9 A;  1ZJM A;  3RRG A;  2PFO A;  3KZX A;  2NO4 A;  1ZQR A;  2HDO A;  1ZQX A;  3WK7 A;  4Z6E A;  1JI7 A;  1N5W A;  2RLT A;  5J0U A;  3NVZ A;  7ICO A;  1CRX A;  5KFJ A;  5KG3 A;  5AKE A;  4B9M A;  2VJ5 A;  5ALT A;  4C7Y A;  2JEJ A;  7ICV A;  3IN5 A;  5AM2 A;  1BPY A;  4F4W A;  4YCX A;  4QZH A;  2P6U A;  4XQ8 A;  2K8C B;  4B9N A;  5JRT A;  4P0Q A;  4CF4 A;  3BDP A;  3F5A A;  3E2E A;  2E1F A;  4QW9 A;  2XY7 A;  4PJ0 U;  4BX9 C;  2EAP A;  5AM5 A;  3JPO A;  1ZD2 P;  3HIL A;  3UMC A;  2R8J A;  5KFC A;  4G3I A;  2CRX A;  5ALL A;  2HMX A;  1ZQV A;  5CWR A;  3M8R A;  4NV0 A;  4I2A A;  4UBB A;  1NK9 A;  2R18 A;  9ICE A;  2VA3 A;  4B6J A;  3A0B U;  2NRX A;  2MSN A;  3I76 A;  1B4F A;  4M6W B;  3NRW A;  3E0F A;  3H0R B;  4J9Q A;  3RJE A;  3D2Q A;  1DK2 A;  1CUK A;  4RQ6 A;  1T7P A;  2JZB B;  2ZTC A;  3EW9 A;  1S0M A;  9ICL A;  2KSO A;  2ZG6 A;  3RAQ A;  5KAF U;  1LKY A;  2M9N A;  4EBD A;  5D4B A;  4P2H A;  4EEN A;  1TAQ A;  2XC9 A;  4PGY A;  3HX0 A;  2JXJ A;  2MUT A;  2KZZ A;  8ICZ A;  4R65 A;  4M9N A;  3FM9 A;  4QJF B;  1PVQ A;  4DL2 A;  2JEF A;  2R8H A;  3F2D A;  3WKB A;  2G06 A;  2ZXI A;  3ZDD A;  2G07 A;  3GU3 A;  3B0Y A;  1O08 A;  1NZP A;  3ETR A;  3CP8 A;  1KTQ A;  2AHO B;  1T3N A;  2XIC A;  1ZJN A;  5KL8 B;  2H3F A;  5BOM A;  4DS5 A;  4RQ7 A;  2XY6 A;  2W9B B;  2BGW A;  1S10 A;  1RQL A;  1ZD3 A;  3PX6 A;  5AIB A;  3T5L A;  1SZP A;  3GV8 B;  1OUQ A;  3V7K A;  3RJG A;  5C0Y A;  3D2S A;  1PK1 B;  3KZI U;  4I2E A;  2H3Q A;  2KP7 A;  1JXL A;  3PV8 A;  4XUS A;  5AHX A;  5HNK A;  1MQ2 A;  3PNC A;  1WWV A;  9ICX A;  2PI4 A;  3F2C A;  5KFV A;  2K4E A;  3QUQ A;  5ALI A;  3AU6 A;  1X6J A;  4ED0 A;  8ICH A;  5ALD A;  4PHA A;  4IR9 A;  2BQ3 A;  3OJS A;  3OJU A;  2VJ4 A;  2F8K A;  1CEZ A;  4NY8 A;  4ACO A;  8ICG A;  2YY6 A;  9ICG A;  4Y2P A;  3PR5 B;  4C80 A;  3KD3 A;  4I2I A;  4UAZ A;  3QZ8 A;  4FS2 A;  1K5O A;  2W54 A;  3K1Z A;  3TAC B;  2F1I A;  2G09 A;  3ONN A;  5J2F A;  1F5S A;  4M9J A;  9ICM A;  1L7P A;  4C4T A;  1ZOL A;  5EE1 A;  4FE3 A;  3UMB A;  4CE6 A;  1X6I A;  3MR5 A;  5DB6 A;  3H7I A;  4YXM A;  2KK0 A;  2Y9U A;  5DDY A;  4PL2 A;  1TVA A;  3N97 B;  3ORY A;  3SEI A;  3PSP A;  3HPO A;  1ZQL A;  2FJ6 A;  3DDH A;  3UQ0 A;  2W3R A;  1VDV A;  3ZD8 A;  5ALN A;  5KFP A;  2BQR A;  5KG6 A;  1FO4 A;  4F4Z A;  5EWF A;  5HR7 A;  4ECU A;  3AEV A;  1TV9 A;  4ED2 A;  5EWG A;  1U47 A;  1SL0 A;  2KMD A;  1JUD A;  3QNM A;  1N56 A;  3FC4 A;  3T5H A;  2KEY A;  3G6X A;  3RJF A;  4KLS A;  4J03 A;  5L1L A;  3CYM A;  4UB8 U;  4NM2 A;  1ZYQ A;  2ISP A;  2NV3 A;  4YMO A;  2KOB A;  4I27 A;  4I2F A;  2KVC A;  5HP4 A;  4IRC A;  4ECQ A;  2W9A A;  7ICQ A;  4DSL A;  1B0X A;  2C28 A;  3LWM A;  4PHD A;  4CF5 A;  1NJX A;  4I2B A;  2QAR B;  1S76 D;  4J9S A;  1MA7 A;  5J0S A;  2G5H B;  2JHD A;  2RDI A;  1JN3 A;  1KW4 A;  4DFD A;  2AQ0 A;  4YQW A;  1Z1B A;  1SV0 A;  2DF4 B;  2VA2 A;  4KMU A;  3U26 A;  1ZQN A;  2A19 A;  4QZB A;  2MU2 A;  3GV7 B;  1SXE A;  3J81 j;  1DK3 A;  2Y1I A;  1XU4 A;  2KFZ A;  1BPE A;  2ZJ8 A;  4JV1 A;  3NVV A;  4KMO B;  5KT3 A;  8ICA A;  4M9L A;  2ZTD A;  3G6Y A;  3BJY A;  1L7M A;  2XID A;  3T3F A;  4DSJ A;  4Q44 A;  1XSP A;  4RQ4 A;  5KFI A;  1Z4N A;  1LVH A;  1N63 A;  1NOM A;  3BS5 A;  3KKA C;  4UB4 A;  4UQG A;  3T5K A;  5B5E U;  2DPI A;  2H3Z A;  1RXW A;  1M6Y A;  5KFB A;  2WF5 A;  4NLB A;  2JGA A;  1NK7 A;  1ZQW A;  3SV4 A;  1NKB A;  8ICR A;  7ICN A;  4OCZ A;  5J0Y A;  4IRD A;  4OJO A;  2J6S A;  2UVU A;  2E8P A;  3IDW A;  2XVT A;  3N7S C;  1TK8 A;  3ZDA A;  1LB2 B;  1QSS A;  3LYS A;  5DGA A;  3HRD D;  5ALG A;  1UHU A;  4FZN A;  4P0P B;  3OSN A;  5K4L A;  2AGO A;  4R8U B;  1ZQO A;  5AI8 A;  5J2K A;  3H4B A;  4RQ1 A;  3SZ2 A;  1F0M A;  8ICX A;  4JUZ A;  2E8O A;  2ZUD A;  1K1Q A;  5JTI A;  2MA1 A;  1ZQH A;  2W7O A;  3Q8L A;  4NL9 A;  1IG6 A;  3NRZ A;  4Y2X A;  3BQ0 A;  2PMZ C;  3KOO A;  1ZQY A;  4DOC A;  8ICM A;  5F9N A;  3UMG A;  2FPM A;  2IOF K;  4P4O A;  2BHN A;  5KT6 A;  2C22 A;  4YR3 A;  3BQ1 A;  3NAS A;  4PGQ A;  1JAL A;  3H40 A;  4DS4 A;  9ICJ A;  1PUZ A;  4P4P A;  2KKP A;  4K4H A;  4YG2 A;  3NS1 A;  4QZG A;  4KLE A;  4QNL A;  1L7N A;  2OH2 A;  2YB4 A;  5C5J A;  2NRZ A;  2FPK A;  3RBE A;  5GTI U;  3MAB A;  3BQ2 A;  3MFI A;  4DOA A;  4OO1 J;  4QWD A;  7ICI A;  3LDA A;  5G5G A;  3LVW A;  4RNN A;  1V9P A;  2ZIU B;  4DL7 A;  4ED1 A;  1NK6 A;  2BDU A;  1SGG A;  2RRD A;  3IM1 A;  1DOQ A;  3M8S A;  3M9N B;  4ELV A;  4C8M A;  2W43 A;  1CI4 A;  2HSZ A;  5E79 U;  4KLJ A;  3M6K A;  5H2F U;  5CR0 A;  3LWL A;  2YMP A;  1NZB A;  7ICS A;  2NO5 A;  1NK4 A;  2HHS A;  2V4Q A;  3NVY A;  1NK0 A;  4IQV A;  4FBT A;  1J2N A;  1S97 A;  7ICU A;  5IIK A;  2WAQ C;  4O3R A;  1O03 A;  4KLL A;  1TAU A;  7ICP A;  1HUO A;  3PR4 A;  2HOQ A;  1KFD A;  4NLZ A;  4IQW A;  4IL6 U;  1GO3 F;  3C21 A;  4KLT A;  4XRH A;  3V7L A;  4O3S A;  3JPS A;  3PST A;  2R8G A;  1L3V A;  2EQY A;  4YN4 A;  2DWQ A;  2OXO A;  7ICJ A;  3QZ7 A;  4P0Q B;  2PFP A;  4TQS A;  1TAM A;  2XCA A;  2PMZ F;  5KFL A;  2AXT U;  5ALR A;  2C2D A;  4UAV A;  4EYI B;  3SAG A;  8ICC A;  1QLN A;  3UXO A;  2IHM A;  2W7P A;  8ICW A;  1Q3U A;  3IG5 A;  2BCS A;  4EZ9 A;  9ICH A;  3LK9 A;  4Y2S A;  3RB0 A;  2Q4T A;  2IBK A;  1NI3 A;  2WF9 A;  4X5V A;  3SYZ A;  1SWW A;  1X9W A;  2Y0S C;  1DRG A;  1DGS A;  2LHT A;  2BKE A;  2F1J A;  4IR1 A;  3NVW A;  3D2N A;  3MR2 A;  3AQE A;  1YZ6 A;  3QUC A;  1B43 A;  9ICQ A;  5L9X A;  3PML A;  1MQ3 A;  4F72 A;  5KFX A;  1SL2 A;  1TKD A;  1KFT A;  1Z00 B;  2ALZ A;  3IRU A;  3MR3 A;  1D9D A;  1NK8 A;  5KFN A;  1LKY B;  3RR7 A;  3AL0 B;  5KG7 A;  5AKJ A;  2ZIV B;  2HBK A;  2P6R A;  3AUO A;  3FYH A;  4RT2 A;  1HEK A;  3PSF A;  2HBL A;  4C4R A;  2MUT B;  1KN5 A;  3DV9 A;  5ALK A;  1XWL A;  5ALS A;  4C7Z A;  3JPP A;  5KFZ A;  5BOL A;  3PMN A;  5AKY A;  4TUQ A;  9ICW A;  1QQ5 A;  5KFM A;  3GZF A;  3M7D A;  2WAQ F;  2YMM A;  4F3O A;  4GXI A;  4IRK A;  4UAW A;  4KLI A;  5AKZ A;  4F71 A;  8ICF A;  1FFV A;  2H3I A;  4PGX A;  9ICA A;  3JPR A;  5AK6 A;  4Y2Y A;  2WF6 A;  4Z6F A;  3V72 A;  2AGQ A;  5JUM A;  4NM1 A;  3B0X A;  1SKS A;  2EZX A;  4ECV A;  1T94 A;  5CRX A;  1WUD A;  2KJ9 A;  5CB1 A;  2ESE A;  4CRX A;  2I6X A;  4Y2U A;  1RYS A;  2CN1 A;  4DL5 A;  5GTH U;  5AK5 A;  2DUY A;  4GIB A;  5ALH A;  1XO1 A;  4K4G A;  2EDU A;  3WKA A;  5L1I A;  3JPQ A;  3SR6 A;  1SL1 A;  8ICP A;  2BPC A;  5EOZ A;  3L5K A;  4HAI A;  5J2C A;  1JXE A;  4I2H A;  2Y0S F;  2FMP A;  3AQF A;  2BCU A;  4LZG A;  2IA6 A;  3IV6 A;  1ECW A;  2KZM A;  3PW7 A;  3RTV A;  2YMQ A;  3EPG A;  5DQH A;  4YD2 A;  4KLG A;  5L1K A;  2R8K A;  5J8Y A;  1BNO A;  5KAI U;  3KFU F;  4PZN A;  1NKE A;  5AM4 A;  2PFQ A;  3SV3 A;  3KHG A;  4MEY A;  2E5S A;  1U4B A;  3QU5 A;  2DGZ A;  2ZXH A;  2BCR A;  1KEJ A;  4F5P A;  4M04 A;  4BUG A;  2KVS A;  5DGB A;  4B9V A;  3S6J A;  5B66 U;  1BPB A;  1RPL A;  9ICU A;  4B9S A;  5T14 A;  5DB9 A;  3C2L A;  2LYA A;  2DFL A;  4O3N A;  3NGD A;  2BR0 A;  4EEK A;  5HHH A;  1WWU A;  1JRP A;  4NLC A;  3E58 A;  5DLG A;  1TE2 A;  2KNJ A;  3V6K A;  2ASL A;  3UXP A;  2HCF A;  2EAM A;  1Q8K A;  4DEZ A;  5DB7 A;  2CPR A;  3A0H U;  9ICB A;  5CHG A;  5ALZ A;  2E8M A;  3RJK A;  2AU0 A;  2DL0 A;  8ICN A;  2PI5 A;  3BZK A;  3RH4 A;  2J6U A;  4ECY A;  1ZQT A;  3Q8S B;  4R66 A;  4JK1 A;  3OSP A;  3SI8 A;  1H38 A;  5KFW A;  2HBM A;  3RH5 A;  2J6T A;  1BPX A;  1XC9 A;  1AQ6 A;  5IIO A;  2DBY A;  2KTQ A;  1PVR A;  3TI0 A;  2WF8 A;  4YD1 A;  7ICR A;  3GII A;  9ICV A;  2G08 A;  2HI0 A;  3TFR A;  1RM6 C;  5KFQ A;  3L3F X;  4FFD A;  4B9L A;  1X40 A;  1IXR A;  2KHQ A;  5J2I A;  3Q8R B;  5KT7 A;  4KLH A;  1XS9 D;  5J0W A;  3ZI4 A;  1U49 A;  5J2A A;  3OPX A;  1L5U A;  3N7R C;  3L4P A;  4QZI A;  2H5X A;  2KV2 A;  5DBA A;  3C29 A;  2YB1 A;  2OEH A;  4M6W A;  3OHA A;  1ZQP A;  1ZQM A;  1ZQQ A;  3R9K A;  2QLT A;  2I5H A;  1KSP A;  2LBO A;  7ICT A;  2KIV A;  1ZD4 A;  2NYV A;  3B9J A;  3RRH A;  4J9K A;  1FEZ A;  5CA7 A;  2JZB A;  7ICH A;  4Q8E A;  2RDJ A;  3BS5 B;  3TFS A;  2LM4 A;  2PFN A;  5AI4 A;  4CF3 A;  3EWA A;  4ELU A;  4BJQ A;  5J0R A;  1SV0 C;  3I28 A;  1ZQU A;  3AM9 A;  1HIW A;  3DEE A;  2W9C A;  3Q8P B;  5J0X A;  4J9R A;  3C2K A;  1BNP A;  3QEB Z;  1VJ5 A;  5EE0 A;  5F3X B;  1HJP A;  1L6N A;  1X9S A;  4BDP A;  7ICG A;  4F8R A;  2PXI A;  2FLL A;  3O0F A;  1KDH A;  4QWB A;  3WK4 A;  5DLF A;  2W8K A;  4YFK A;  3CW2 C;  3TAD A;  2PKE A;  5AM3 A;  4RQ3 A;  4GLX A;  1MN8 A;  5KFH A;  5J0P A;  5J2J A;  5FP0 A;  2GH1 A;  3FDS A;  2A3V A;  1PVP A;  3UXN A;  1WYG A;  1JX4 A;  3MR6 A;  3BS7 A;  1BPD A;  4UAS A;  3QUB A;  4DL6 A;  1OXJ A;  9ICF A;  1ZQF A;  1S8O A;  2UVV A;  8ICY A;  2Z7J A;  5CEH A;  3FAH A;  1S0N A;  8ICE A;  5KFF A;  4DQI A;  3ISB A;  5KFA A;  5DB8 A;  4ED7 A;  1SWV A;  5DQI A;  3ZD9 A;  1WG8 A;  3GDX A;  2JEG A;  1ZQ1 C;  4JB3 A;  3JPT A;  3RB6 A;  4JV0 A;  1ZQI A;  4F5Q A;  4DQS A;  3QU4 A;  5J2B A;  3WKE A;  4RUA A;  1Z4O A;  2IHN A;  3PW4 A;  4UAT A;  1T4G A;  3PX4 A;  1S77 D;  4NL9 C;  4DQP A;  1ZET A;  4DO9 A;  1QSL A;  1A6S A;  4KLO A;  3ALR A;  2FMQ A;  4AP9 A;  3GFK B;  2MRL A;  4Z6D A;  9ICI A;  1ED1 A;  1DGJ A;  1HUZ A;  1Z1V A;  3AU2 A;  4RPY A;  2Q0Z X;  1A0P A;  2E3T A;  5F9L A;  1RYR A;  1ZQC A;  4GXK A;  2KIW A;  4J9N A;  1ZQA A;  3ISD A;  2HVH A;  4RNM A;  4BWJ A;  2VIX A;  2KIC A;  1ZQJ A;  2FI1 A;  3HT3 A;  4IQT A;  4ZH4 A;  4R64 A;  2JH1 A;  1FIQ A;  2KG5 A;  5AKL A;  5KT5 A;  3K4G A;  1EXN A;  5DG9 A;  4CCH A;  5AI6 A;  3Q8Q B;  1KL9 A;  5AK4 A;  3VCB A;  3C5G A;  4KLF A;  3ZDB A;  1L3T A;  8ICI A;  4E0D A;  3HP6 A;  4PZO A;  3M9M B;  4J9L A;  4Y2Q A;  2LYH A;  4F93 B;  2VAN A;  5AM1 A;  3RJI A;  4A8E A;  2ZIX A;  3SD7 A;  3JPN A;  2EAN A;  3PW5 A;  2NRV A;  2D6F C;  2GO7 A;  4ELT A;  4YP3 A;  5AKG A;  1UT8 A;  1KKX A;  5AKI A;  5DG7 A;  2OCE A;  4K4I A;  4F4X A;  3TAN A;  2FMS A;  3MGH A;  4PHP A;  1UQV A;  2GWS A;  1N5X A;  2XGP A;  3TAR A;  1L3S A;  4RNO A;  2YTU A;  2D8C A;  3C1Y A;  5ALF A;  1ZXI A;  1S9F A;  1SV4 A;  5KFY A;  1UPH A;  2I9G A;  4QZ9 A;  3ETL A;  2K4H A;  4RUC A;  3KHL A;  2VKQ A;  1J2M A;  5KFO A;  4UB3 A;  1SIJ A;  4JWM A;  1SKW A;  2W3S A;  3IHQ B;  4PHE A;  2F8L A;  5KNI A;  2FDR A;  4I2G A;  2F3N A;  2KHV A;  4O3M A;  2P35 A;  2Y1J A;  3MGV A;  8ICQ A;  2ASJ A;  3OTQ A;  3PW2 A;  2XGQ A;  2HHW A;  4RQ8 A;  1ZQS A;  3UPQ A;  2DKX A;  2F1H A;  2Y9T A;  4ED8 A;  1JIH A;  4YR0 A;  1Z3E B;  4F4Y A;  8ICL A;  4GC7 A;  5CJ7 A;  4DQQ A;  1QCK A;  4OJL A;  2W55 A;  2B6G A;  3RH6 A;  1NKC A;  4QZD A;  4QWE A;  5ALO A;  2F44 A;  3KHH A;  2K8B B;  3M6Z A;  2KD1 A;  3SEN A;  4LVS A;  4P0P A;  9ICS A;  4J9M A;  4O3O A;  2HHT A;  2WB1 C;  2WFA A;  3MDA A;  3QUT A;  4NJ8 A;  2KN7 A;  2RHF A;  3WK9 A;  4UW9 A;  3BQ7 A;  2QB0 A;  4DQR A;  3QYP A;  4OD0 A;  2DKZ A;  5L1M A;  2QB1 A;  4DLG A;  1ZQB A;  2HVI A;  3M9O B;  1L7O A;  4MEX A;  1N61 A;  5KFD A;  2ZIW A;  2BCQ A;  2RP5 A;  1Q46 A;  4TUP A;  1JRO A;  1UA1 A;  1ZD5 A;  2KSO B;  4DCC A;  3MFH A;  4QIW C;  2W04 A;  4IQU A;  4UAR A;  3VC8 A;  2BPF A;  4KN7 A;  3EYZ A;  2V9W A;  3RR8 A;  2HOI A;  4Q43 A;  4DSF A;  1TK5 A;  1N48 A;  1XNS A;  5AK3 A;  3SAF A;  4MFA A;  4YVZ A;  1DXS A;  3WK5 A;  4OJ6 A;  1RZT A;  3BQT A;  2IMW P;  1J97 A;  2K4P A;  1LV5 A;  4Y2R A;  3C23 A;  3V6H A;  4ECW A;  4RZR A;  4R63 A;  4EZ6 A;  2AQ4 A;  5J8Y C;  3LVV A;  2H3V A;  2ZJ5 A;  4YR2 A;  4EEL A;  4BXO A;  5J2G A;  9ICC A;  2ATL A;  1X42 A;  4QZA A;  4DSE A;  4G9B A;  1TK0 A;  3H8J A;  5EE9 A;  7ICM A;  4O5E A;  2GOL A;  4MF2 A;  2JH7 A;  3THV A;  2F77 X;  2P66 A;  5AKX A;  3PVX A;  5DQG A;  4HYK A;  3H4D A;  3GIJ A;  2G5I B;  3GIK A;  5KTQ A;  3I1Y A;  3WK6 A;  2AJQ A;  8ICV A;  2WB1 F;  3M1Y A;  2XY5 A;  1VLB A;  4UAU A;  4UB1 A;  2EZZ A;  2W03 A;  4QZC A;  1NJZ A;  2KJ8 A;  3GQC A;  4C4S A;  5AM0 A;  2G0A A;  5J29 A;  4NXZ A;  3QU7 A;  2E8N A;  2HBJ A;  5KFT A;  3QE9 Y;  3EZ5 A;  4RQ0 A;  1XSN A;  5EE3 A;  8ICS A;  3SMV A;  5HMM A;  5KFE A;  5KFG A;  5TIS U;  4DF4 A;  1SZH A;  1V97 A;  1A76 A;  2GLE A;  2K60 A;  4QIW F;  2HHQ A;  2BDP A;  3BZC A;  3ZDC A;  4GC6 A;  5EWE A;  5IIJ A;  1TFR A;  5KFU A;  4FBU A;  2YQE A;  5ALQ A;  4QWA A;  4CNQ A;  5DG8 A;  1BGX T;  2EH9 A;  5J2D A;  5A0L A;  4PL1 A;  2JV3 A;  2XO7 A;  4ED3 A;  2YN4 A;  4C0Z A;  4FS1 A;  2MAX A;  4GXJ A;  3NUQ A;  1Y88 A;  4M2Y A;  2A1J A;  1QQ6 A;  5KT2 A;  1L8O A;  4YXJ A;  5BPC A;  1Z00 A;  4DL4 A;  3MC1 A;  4FZM A;  2WHE A;  1COO A;  4M0A A;  4FZL A;  3OGU A;  2A1A A;  2ZIV A;  2ZUB A;  5IIM A;  1PK3 A;  5AI0 A;  2W9C B;  2KJ5 A;  5AIA A;  1QSY A;  8ICB A;  2W11 A;  1FFU A;  5ALE A;  5KG0 A;  8ICU A;  7ICE A;  3SQI A;  1K1S A;  3ZDE A;  1BVS A;  5ALP A;  3RJJ A;  4DWI A;  4NLK A;  4EEY A;  1QH9 A;  2ES6 A;  1IIP A;  4TUR A;  2AH5 A;  2K89 A;  5AI5 A;  3RF9 A;  3MDC A;  5AKH A;  4B9U A;  2BCV A;  4F4K A;  1JMS A;  1S0O A;  2HHU A;  2LMR A;  4ZOH C;  3RFA A;  2LPE A;  4NWI A;  8ICO A;  4C8O A;  5DBB A;  1ZRN A;  4KLD A;  2UVW A;  1UA0 A;  4UB5 A;  3GIM A;  1X9X A;  1U9L A;  5KG2 A;  4KTQ A;  3H0M B;  4UAY A;  4Q8F A;  1RDF A;  2W9M A;  1QTM A;  1S5L U;  4NLN A;  4M47 A;  1F44 A;  4ED6 A;  2BQU A;  2C2E A;  1C20 A;  1V85 A;  4QZF A;  4ECR A;  3D6J A;  8ICJ A;  5G5H A;  3UM9 A;  3TAD C;  5J0T A;  4TQR A;  1QQ7 A;  3GV5 B;  4CGZ A;  4BGD A;  4O3Q A;  4P4M A;  1D9F A;  1KFS A;  3ISC A;  2OHF A;  3RB3 A;  4ECS A;  3ED5 A;  2JMG A;  2OM6 A;  9ICP A;  2LI6 A;  2C2R A;  4F2R A;  2NRW A;  3N28 A;  4I28 A;  3K1R B;  1V38 A;  3QU9 A;  1N2X A;  2BPG A;  5ALW A;  4Y2T A;  4OJP A;  5ALX A;  1N60 A;  2FLP A;  4RQ5 A;  1SKR A;  4MFF A;  2JEI A;  4KLU A;  3HW8 A;  4LJX A;  3KTQ A;  1ARO P;  1OW5 A;  3WK8 A;  2HW3 A;  5KFS A;  3C28 A;  3QEA Z;  2ISO A;  4PPX A;  4MHV A;  3V7J A;  4DFJ A;  3Q8K A;  2HHV A;  3MBY A;  3K75 D;  7ICL A;  2LKY A;  9ICR A;  3H0L B;  3TQ1 A;  5D46 A;  4RPZ A;  8ICK A;  2W9B A;  2ASD A;  2E1E A;  4MFC A;  7ICK A;  1WCN A;  3QXG A;  1Z19 A;  3V6J A;  4C8K A;  4F92 B;  4QWC A;  2D3D A;  4KLQ A;  5HHI A;  1PK1 A;  3WKC A;  2ODG A;  3TAQ A;  1U45 A;  4C8N A;  2ZIX B;  3PO5 A;  3PSI A;  3N7P D;  2LYB A;  1Q3V A;  5KFK A;  2O6K A;  4F5O A;  2FLN A;  4O5C A;  1P7D A;  3PW0 A;  2DPJ A;  1X66 A;  4QZE A;  4EBE A;  7ICF A;  4ECT A;  4QZ8 A;  5KL1 B;  2WF7 A;  3RJH A;  3H8M A;  5HML A;  4Y2J A;  5KG1 A;  4UB2 A;  1IV8 A;  5AIC A;  3RB4 A;  1MSW D;  1ZQZ A;  4DL3 A;  4C8L A;  4I29 A;  3H8W A;  5D49 A;  3G6V A;  1L3U A;  4ECZ A;  5AI9 A;  2YX8 A;  3TKA A;  4YMM A;  2IOF A;  1X9M A;  4RQM A;  2R8I A;  3N4M B;  1ZQD A;  4DFK A;  1COK A;  2B21 A;  4QW8 A;  2M0N A;  4DSK A;  4JV2 A;  2K4I A;  4F50 A;  4O0I A;  4F5R A;  3PZP A;  4F91 B;  1A77 A;  3T79 A;  1D8L A;  2KE7 A;  3QX7 A;  2XCP A;  2HOF A;  4RQ2 A;  4EX7 A;  1C7Y A;  3RAX A;  1KBU A;  1YT3 A;  5AKK A;  4RU9 A;  1BPZ A;  1T8E A;  4YMN A;  2XI9 A;  1S0V A;  4Y2V A;  4KN4 A;  4Q45 A;  4CDG A;  4EBC A;  5HR6 A;  1UCV A;  3CRX A;  4I2D A;  5KG4 A;  4J9O A;  1KRP A;  3F53 A;  4MF8 A;  5J0O A;  3NTU A;  1U48 A;  3IP4 B;  1YZ7 A;  2BZF A;  1IM4 A;  5ALY A;  2LM1 A;  4TUS A;  2QB0 B;  4F2S A;  3HWT A;  4RQN A;  2F76 X;  4EX6 A;  9ICO A;  1KLN A;  9ICN A;  2QAR A;  4DFP A;  4BWM A;  2YML A;  1T3Q A;  3KKA A;  4DF8 A;  3TAP A;  8ICT A;  4AYB C;  2CXY A;  4Z6C A;  3HKZ C;  5KFR A;  2UVR A;  1N62 A;  4KX5 A;  5III A;  3EPI A;  4I2J A;  2ZIW B;  2AGP A;  4RPX A;  5ALU A;  2L5Y A;  2W8L A;  4XA5 A;  2JRZ A;  2HHX A;  1D8Y A;  3Q8M A;  3QU2 A;  5KG5 A;  5IIN A;  4ECX A;  2EZY A;  2EAO A;  1UT5 A;  3H8S A;  1L8L A;  3AN1 A;  4U6P A;  2KZ3 A; 
#chains in the Genus database with same CATH homology
 3BS7 A;  1OW5 A;  1SXE A;  4IS7 A;  2B6G A;  2KSO A;  2ES6 A;  1OXJ A;  1LKY A;  2F44 A;  4MHV A;  4PZO A;  1X40 A;  3SEN A;  5J8Y A;  2KE7 A;  2FE9 A;  4PZN A;  2LMR A;  2LPE A;  2Y9U A;  2EAN A;  4NJ8 A;  1JI7 A;  3BS5 A;  3KKA C;  3BQ7 A;  2QB0 A;  1SGG A;  3SEI A;  1LKY B;  1X9X A;  2DKZ A;  5L1M A;  2QB1 A;  2E8N A;  2D3D A;  1UCV A;  1PK1 A;  2KIV A;  2QKQ A;  1UQV A;  2KMD A;  2GLE A;  2K60 A;  3BS5 B;  2QB0 B;  5JRT A;  1V85 A;  4NL9 C;  4RQN A;  2E8P A;  2KSO B;  2YTU A;  3IDW A;  2D8C A;  3TAD C;  1X66 A;  2QAR A;  1WWU A;  1SV0 C;  3KKA A;  1SV4 A;  2EAP A;  1PK1 B;  3HIL A;  3H8M A;  2EAM A;  2JV3 A;  1DXS A;  1Z1V A;  1WWV A;  2K4P A;  1B0X A;  2E8M A;  1F0M A;  5F3X B;  5KNI A;  2L5Y A;  2ESE A;  1SXD A;  2F3N A;  2DL0 A;  2E8O A;  2QAR B;  5JTI A;  3K1R B;  1V38 A;  1B4F A;  4NL9 A;  5J8Y C;  5JU5 A;  2F8K A;  3TAD A;  1KW4 A;  1PK3 A;  2DKX A;  1SV0 A;  2Y9T A;  2EAO A;  2KG5 A;  1RG6 A;  4RQM A;  3TAC B;  1COK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...