4P0QB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
334
structure length
284
Chain Sequence
NAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords Crossover junction endonuclease MUS81
total genus 82
structure length 284
sequence length 334
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0qB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0qB01
2ZIUA 2ZIUB 2BHNA 1J25A 2BGWA 2ZIWA 4M6WB 4M6WA 2JPDA 4BXOA 1J22A 2JNWA 2ZIVB 2ZIXB 4P0PA 4P0QA 2M9MA 4P0QB 4P0PB 1J23A 2ZIVA 2ZIXA 1J24A 4BXOB 2ZIWB 2A1IA
chains in the Genus database with same CATH superfamily
3HR4A 4PRLA 5G5GA 5K6AA 1PK7A 2ZUFA 3HV2A 5DDYA 1NJZA 3OM8A 1RMYA 2AI1A 3KV1A 4LDQA 4QUKA 4UUOA 3VTAA 3FUWA 1D6SA 4EMUA 1O6BA 2RAPA 3CX4A 3BZCA 3A06A 3M6WA 1P0PA 3JVVA 3PZBA 1SVNA 4YR0A 2XITA 2CFSA 2WIAA 3AKEA 4ZCRA 1P75A 2A67A 5C8ZA 3KQOA 4P86A 2EZZA 5FXMA 3WLRA 5CFZA 2HHXA 4JA0A 2A3VA 1BX1A 1Q74A 2L2QA 2VNJA 4OREX 5LLTA 3SSOA 3P0HA 2PMZF 4KWHA 4IJWA 5JYBA 3E8MA 1KMHA 2TSYB 3EA5A 3NEPX 4E2FA 4ZU3A 3R9KA 4DOBA 3RFAA 3N0XA 4TVSA 3AF1A 4JEIA 1Q1ZA 3VJKA 3HCCA 3VYVA 1QX4A 4P93A 4Q4JA 2EFYA 2H1OA 2ZTHA 3A3YA 3EGVA 1EWVA 1QZZA 1Y7HA 4MVCA 4NCJA 4ARBA 5CDTA 5EI5A 1N0IA 2EHJA 1TIPA 1GGVA 2D1RA 1Q46A 2P79A 4H60A 4FXPA 4ROSA 3TOSA 3OMXA 3HX0A 4LOKA 5LQMA 3FYHA 7ICPA 3L7DA 2RKBA 5GQSA 3LPMA 4ZAYA 1G2PA 3GGJA 2KKPA 3Q7EA 5E2IA 4YMGA 2OO7A 1G3MA 1J2YA 1NVWQ 1QIJA 2B0JA 3GV0A 3RAPR 5C81A 4Q4AA 1BQEA 2RAFA 2A84A 1C14A 2WPDA 2Q28A 3G2HA 1MZVA 2ZB4A 1AKNA 1IHYA 1HTWA 2KVSA 3GYBA 1L1RA 3HJNA 3D8TA 2VDJA 4KFTA 5FOSA 3O95A 3WFIA 1K1EA 1XDDA 4O3QA 4A0GA 1QPBA 3GFSA 2OP0A 5DP2A 2PKWA 2FK7A 2I03A 2VXYA 5IDVA 1AN0A 2N46A 6Q21A 3GV7B 4O4HB 2DU8A 1JECA 4DM4A 4W8HA 5EIXA 3NH6A 1ISPA 4ICAA 4GXJA 5GM1A 2VHEA 2GUWA 5KHLB 2W83A 3V4OA 2JIQA 4B74A 3Q9UA 5F77A 4B79A 4EABA 2PIDA 4EA8A 1IHXA 2C54A 5KVCA 1QTQA 4LJAA 4L07A 3L1VA 5EHNA 3WZMA 2RB4A 1L0BA 1F17A 2PS1A 2XUAA 3ZKWB 1JJ7A 4TS4A 1EA5A 1ZMXA 4B3RB 1G98A 3QVJA 5D1NA 4BBZA 4G25A 2IEZA 3PQ7A 4C0WA 1GOTA 2RDJA 1GSAA 2W42A 4RV9A 1JXOA 3V8RA 5T4BA 3NBQA 5BOSA 4M0UA 1NVUQ 1PX2A 1Z28A 3CHYA 1OWOA 3QF7A 2ZTSA 4HJXA 3RUAA 2A4KA 3MC1A 1F0YA 2A1IA 3VMFA 1TVAA 5DVZA 2ZGVA 1PJSA 2MSEB 3O4JA 4QBIA 1MEJA 2PUBA 5JS8A 2ZIUA 3OOHA 5BQ3A 4DF3A 1JEAA 1W87A 2RJOA 5AH0A 5GAJA 2GK4A 4RTOA 1DCFA 2EWWA 2QB1A 5ALZA 1E20A 3CT6A 4K6FA 4KLOA 1U9IA 1OFGA 1GRRA 2MSKA 2X13A 2YHIA 1YH3A 1ZSYA 1KI1A 1W30A 3JQ7A 3O26A 1JAHA 4PBTA 2GF2A 2Y3IA 3B7PA 4BO9A 1GG2A 2FPPB 3R9XA 4LY0A 5CH5A 2Q7XA 1JKJB 4Y6LA 1X1SA 3W5VA 4RFSA 1HXHA 2JJ1D 2ID4A 4FILA 1VHJA 1BMFA 1DKQA 1M1ZA 1BPXA 3OCVA 1IBRA 2GXQA 3CN9A 1LBTA 4IUBS 4S1WA 3PJFA 4X3OA 4ZOLA 1ULZA 3UMSA 3PVSA 1H2YA 1V9PA 3GHHA 1HR0B 2Q7OE 3WSVA 2FY8A 1R8JA 4X60A 5DB4A 3BF7A 3KOUA 3IKMB 7ADHA 2D5AA 5AK3A 1D2GA 2P9HA 2P0EA 5DOVA 3KU4A 5G4LA 3RJ5A 2XE7A 4PX3A 3RODA 3SF8A 4D3DA 4EYGA 1L5YA 3H16A 1GIAA 3EUAA 3OT1B 1C3LA 3ILYA 5I9SA 4Q48A 1S1MA 3LNTA 3OCJA 3SC6A 3ZDXB 3KQQA 3K9HA 5B7PA 4WD3A 2ZUCA 1X0XA 5TR9A 4NLCA 2K60A 3AW8A 3NTUA 1EB8A 2A9PA 2I2XB 5ILOA 1GFZA 4KQJA 2OMEA 1O8BA 4B9UA 4A36A 2PSSA 1TZBA 2DH6A 2MWMA 3IERA 3RJHA 3KOZA 3WRXC 1U1CA 2Z0MA 3GLHA 2GGSA 2KWIA 2JI9A 2BDPA 2QV7A 1E0AA 2BD0A 3GU3A 2WDPA 2OQVA 1Z4OA 1P2DA 1FFCA 1D5WA 3D0RA 2ZROA 4GVLA 2Y71A 2FR8A 1N2IA 1I4WA 3CX7A 3DOOA 3QE3A 1S0VA 5FI3A 3EXIB 3FVRA 4UBKA 1ZR2A 3B1XA 2AYYA 4GRIA 1KAHA 3LX8A 2H7VA 3RI3A 4NXZA 1Q1AA 3A9TA 2WRZA 3R7LA 1Z00B 3C5CA 3G0CA 2K8AA 3ZCSA 3QUAA 4JGGA 4UBMA 2Y1GA 4BNZA 1I30A 3TR6A 3ZD6A 4NYJR 1XD9A 1C20A 3NWOA 2IBSA 2ILTA 3I04A 1MA3A 1SG9A 1LKZA 1ODJA 1CQXA 1VLZA 3B6IA 4XX1A 5ILGA 4P0TA 1QDUA 3TAXA 3GC6A 5FH9A 3JQQA 5E1OA 5F3DA 3G1UA 1BVSA 2DBRA 1ISFA 2EERA 3RAGA 3UWPA 2Z5FA 3ZZ1A 3LT2A 2Y1IA 4CRWB 1MG5A 1SQ6A 3P0RA 1L3SA 2HOIA 1NW7A 1UK9A 2QJFA 2ISPA 1ODSA 1RCFA 2JCVA 3FSGD 4DYDA 3FDXA 1UADA 2WNHA 4YMUA 1OU0A 5EZYA 2B9EA 1KY5A 2LTAA 4I08A 2OXEA 2Q41A 2ZWPA 4A0RA 3TLGA 2B78A 2G07A 3CIFA 3IG8A 4TUYA 1TMOA 3IVGA 1V16B 3TZ6A 2FLVA 4EL0A 1QTIA 2XB8A 4IVRA 3UH1A 1QFJA 1WO8A 2XKBA 1E2EA 5G02A 4YR9A 2VPTA 5YASA 4BX0A 2QTVA 1RJDA 9ICMA 4IV8A 4N47A 5LIPA 2Y1OA 1EE2A 2HV9A 2HLPA 1NJ6A 4MDEA 4WOJA 4HAIA 4WGGA 3OKPA 3GEMA 1GPJA 1IULA 3L84A 2C22A 2R1UA 3UXEA 3OESA 5CB6A 5GTDA 4Y2RA 4U7TB 2XC9A 4G41A 1JMSA 1EK0A 2FK8A 3V7NA 2WSLA 2UVDA 3IB3A 4GOLD 3U9SA 5EKDA 2YHBA 3AP2A 4QPPA 2W55A 3OVMA 4MWCA 2O50A 4OO1J 3C29A 1ZBDA 1JKIA 4R2MA 1Y63A 3S28A 3KQNA 4BFTA 1ILEA 3DTVB 1P4SA 8ICGA 4HQKA 3TQSA 2F1JA 3ZKWA 3V46A 3R7DA 3JSXA 5LM3A 5T6MA 4IX1A 2QB0B 1KBOA 3RWMB 4N4AA 3SVZA 3BUSA 5FL7D 1TYEB 3HYTA 5JC8A 2Y9UA 2GEVA 1S2IA 2WVAA 2FFAA 2OXCA 3KKAA 3CX6A 1UKAA 4GXTA 5EMKA 2DWCA 4FFPA 2MSDB 4C4TA 1E4EB 3L4BA 5CURA 3W2HA 1YF3A 1P1BA 4RULA 5J2UF 1QKIA 3LVVA 4PAQA 4JKOA 3KJIA 1TRHA 2EGUA 4U3JA 3WX0A 3Q7IA 4LXIA 3N07A 3FOAA 2HPVA 3FROA 5J5CA 5IXYA 4URYR 5JJIA 1LPMA 3H3XA 3V1MA 1N5WA 1JXLA 1OILA 3GRRA 3GG9A 3C8UA 4AMVA 4LRYA 2VDQB 3KR2A 4XR9A 2D6FA 3W6NA 2AVDA 3C3MA 5KG3A 3L18A 1E1QD 4JI8B 3DT9A 3JQ9A 1DUSA 4Q1FA 4F4HA 3QBVA 3IAS6 2VJBA 3RVRA 2MSNA 3WLSA 1P7YA 4IOKA 2CHQA 4IHJA 5JAIA 8OHMA 3U7GA 1L1QA 1PS0A 1W5FA 4RQBA 1DAIA 2C8VA 2O0HA 3WO1A 3OWHA 3BKWA 1QOQB 2OV6A 3IBCA 1CFJA 1V8OA 4I9GA 4OBBA 3GJTA 2OA0A 1QKKA 4K4GA 1GL3A 2AK2A 1BA3A 1X14A 2IJGX 5JU5A 3L77A 5JLAA 4C5BA 2QD3A 3V2IA 2GD2A 1Z4NA 3MR6A 2J9RA 4B8YA 3TBFA 2QMQA 4Y1RA 5CFNA 1KP9A 3HSYA 3WKEA 1JG3A 2UZ1B 3LGSA 4CDNA 3HILA 1G2QA 4O4HF 2PXHA 3ZDCA 2V9CA 3VH3A 4MQMA 4LF8B 5DO9A 1OU4A 1LC0A 2OILA 5JUWA 3DC2A 1XQYA 2J7KA 3A6HA 2YXEA 1WNFA 3O7MA 1MV8A 4LVCA 4KZKA 4NZNA 5EERA 4CLXA 4UTPA 4QC2A 3VR1A 4BLRA 4KYUA 1IM5A 4AMGA 1PNVA 2CFRA 3OQIB 4B7CA 1KO1A 4BNHA 4W9NA 3VAYA 1EG7A 3IQFA 5KB3A 2GCEA 4TUYF 2WWIA 4FZLA 3U4QB 4Q6BA 1QCCA 2Q5IA 2A5LA 1V43A 4Q02A 5F7XA 1E63A 1UOEA 4WZBA 5KKNB 3J81A 1G63A 2G67A 3G8CA 1KH2A 3O2NA 1E8DA 1JF8A 3R23A 4M0AA 3EG9A 4L7VA 5D49A 2Y93A 3VPCA 5JCOC 1VIVA 3H4IA 1D1TA 1M10A 5LQRA 4DSJA 3FLBA 4J0QA 4INJA 3VR3A 1JA9A 5ALOA 1WF6A 2QTNA 5ED0A 2HMSA 2JFXA 1QF7A 1OVGA 5IYZA 1RRFA 4B7AA 4JV1A 1CJBA 5AXBA 3WTCA 1UT8A 3DEFA 4LEIA 4BNFA 3IPYA 4IR9A 1XZFA 3KTDA 521PA 1G5HA 1OROA 3RJJA 1TCUA 3F71A 4MLPA 3VOSA 2EANA 5JUMA 2CVHA 1YZKA 2DHEA 2Z98A 4UNPA 3N74A 4RK6A 2I6UA 3AG5A 3E7DA 2XWQA 3PCXA 4M1SA 2HU2A 4IMRA 3LRXA 4RTLA 4D74A 3AZPA 2XXAB 5AHXA 4J76A 2NV0A 3S27A 1NQVA 3DHYA 3Q7RA 3QFFA 3TIIA 3ZXIA 2JDIA 2YVAA 4ECVA 1DELA 1L7VC 1ONSA 1JN0A 1PNTA 2OQRA 2QK4A 2V3WA 1ZSNA 2VPPA 5DWQA 3SXUA 2QX6A 1UM9A 4F2DA 3ROPA 2IDJA 3NHKA 1E3LA 3WYGA 1FZQA 5IM4A 5IYZB 1Z00A 3ZQKA 3KL2A 3MVEA 1JQ5A 4CETA 5JECA 1DTWA 4GQIA 1GEGA 4FS3A 2RK4A 1QF9A 4RD3A 1A4RA 3L07A 5BSKA 1VJ0A 1Y9ZA 4PXAA 4ZGBA 2FMKA 4L72A 5K4HA 1AKRA 3PSIA 1LW6E 1X1BA 2GKOA 3VR5H 1LRJA 2IUEA 1E3JA 1G7RA 2HQ1A 3L1IA 2WSIA 3S68A 3TVYA 1IXKA 3NKVA 4XWAA 2Q3FA 2B1JA 1EJ0A 5DNEA 2F3SA 8ICHA 2ZUSA 1NATA 2RKOA 4E13A 4WI1A 1IEQA 3OQIA 3HWSA 1HDOA 2YMMA 3ZV5A 1ZVQA 4K8RB 3SC2B 1IG0A 2ZVDA 1HRDA 3RYTC 4EENA 1E99A 2XGPA 1Y4UA 4MWEA 4FEYA 2MOKA 2HQRA 3KELA 3H40A 4R8KA 3BDPA 4MUMA 2RFLA 1JXEA 4ZZIA 5F51A 4I14A 4NNPA 4D9MA 3FBWA 5IEJA 3M0EA 3R3ZA 1PD0A 5I45A 2NO1A 3A4VA 3JX9A 3HCRA 1J6UA 3E0XA 2ESEA 3HSSA 4CF4A 1YD7A 3WYFA 4YRLA 5JXJA 2FUCA 5CVEA 1ZQCA 3C16C 1G2OA 4MR9A 3VVBA 3WRWA 1PUZA 4P1ZA 1BX3A 4BQRA 1FYWA 4JJ7A 4NL4H 2Q49A 3MJTA 4IXMA 4AZ0B 1EESA 4PLPA 1B41A 1RM4A 3U1TA 2FOLA 3E0FA 2X7JA 1KNXA 5REQB 3SYKA 3ABSB 4UZFA 5JH7A 1FL9A 2H18A 3N0WA 4PAMA 2QL9A 1NRJB 1JKJA 1MRSA 1UDWA 3GCZA 3UMRA 3KPWA 3VGPA 2WFZA 4PO8A 5CEEA 3CTMA 1ACMA 1JE1A 4G1MB 1Y5NA 4LF9B 1ZH8A 1VPWA 2GFHA 1WCWA 1UA0A 4MPTA 3CUKA 1QTNA 5IH3A 3BM5A 3TUJC 4B7ZA 3P52A 4IIDA 4I1RA 5I9IA 4M1TA 4N82A 3NDBB 1BOFA 1RFLA 1Z5GA 1PVPA 3FUVA 1XK6A 2ZE8A 2JGKA 3T94A 2X22A 1PJ8A 2RH8A 3K9WA 2HUPA 1H5UA 2ODNA 4H1VA 3QY9A 3TGLA 2WJVA 2EARA 2AFIA 2HRRA 3ECAA 3F6CA 3PC7A 4R8LA 3INGA 4YG2A 3WBJA 5H4GA 1HT0A 1WXQA 5LMCA 2C99A 4DR1B 1NZFA 1V8FA 1GA1A 2X42A 3MCTA 4UULA 4Z5XA 3W3ZB 4FSHA 5FWAA 4GO1A 1G6KA 1H5NA 1A0PA 2O8EA 3DM5A 5BRAA 5KFUA 4GKJB 2IXAA 1MRNA 5BV0A 4TUQA 1PKEA 1YB5A 1W0JD 2AIRA 1OLSB 3GEGA 4REMA 1K1QA 3AC0A 4JLNA 4NPHA 4UEWA 1VCNA 2V4RA 4IIYA 4B6SA 4ZCSA 1YQUA 1NONA 3PQEA 3C15C 2I7CA 1I2AA 2WIKA 3ZYCA 1YZVA 3OUZA 3FCXA 1VDMA 3OZGA 3WP0A 3CLSD 4NONA 3PDWA 1I3KA 3QVWA 1CZKA 7ICUA 3LY5A 2QUAA 4B40A 2MJLA 1A5ZA 3H04A 4BKUA 1QQ6A 1SL1A 2Q4TA 1F38A 1MX5A 4UAZA 9ICFA 1TCAA 2CMGA 2ZJFA 4TKVB 5F78A 4EX6A 3SY8A 5GZ1A 4PPYA 4B3FX 2NU7B 3E2IA 5D46A 4R65A 2PLRA 4AW9A 3VZSA 1T9AA 1PYDA 2QI9C 2Y99A 1E1RD 3N6RA 4CMKA 2BGKA 3RC2A 1AUOA 3UJHA 1X1RA 1D8LA 1KFCB 1FF9A 2IHVA 3HL0A 1C8LA 3GLFE 4UAWA 3V7YA 2QTMA 3ODPA 4Z6KA 3A6ZA 3IVCA 4GE3A 1XO1A 4LHXA 1YVEI 3KDAA 4DF8A 3KZNA 4QGHA 3SJ7A 1J5EB 3BA1A 2Z6VA 1MQ2A 2AE1A 3G79A 4BHTA 4KITB 5FD8A 3K94A 1JG7A 3OIWA 3VH1A 5A4FS 3S1SA 4R1UA 1JEYA 2QJRA 4W1SA 5L3SB 3M7IA 3MCZA 2MRLA 3VBCA 4RLFA 4LXUA 3ZZMA 5JY6A 1H4SA 6LDHA 5DI3A 2O7VA 2MSLA 1SCAA 1TYZA 4N49A 3QE9Y 4DBZA 4F1WA 4MKHA 2F1RA 1IBSA 4QVKA 2ATXA 3KKOA 4V02A 3HY6A 1DJQA 1HQDA 3FVWA 4DA7A 1MGPA 1GGEA 4YXFA 1VSBA 2JJ2A 1F0KA 5A9TA 3WL3A 4ESEA 4WEQA 2XA1A 3PF8A 4MUJA 4JK1A 5LPNA 3PYLA 1J8MF 3GVIA 4TVBA 4M8LA 4K3UA 2AN4A 4FFBA 5DSZA 2CVOA 4U9UA 4UUAA 3SYNA 4EZIA 1ZQ1C 1E6EA 4EHHA 1G5FA 3I4LA 3WGLA 4DJTA 1DQNA 4WJLA 4REOA 2IF0A 1UJ6A 4AQDA 1UZMA 1XZKA 2YVQA 3B3QA 4M1WA 4O0MA 3WRYC 4BV9A 1NNI1 5CA1A 3SDBA 3WL5A 1HX7A 4PNHA 4UCQA 1KVRA 2W70A 5JZ9A 4FFVA 1C7IA 2BYTA 3K31A 1SRQA 1CUXA 2CL7X 4PHPA 1E66A 1NK5A 5H3CA 1N63A 2EFHB 2GKGA 3I01M 3EGDA 1U8FO 4DARA 4EUHA 4YX9A 3PL1A 2Q62A 4LRTB 4BFYA 2Q3JA 4UW9A 1RZ3A 4DMHA 5F4ZA 3VZQA 2Q1UA 3K4HA 3BCRA 1ULTA 1CUGA 4MULA 3WLHA 4RJLA 1N2SA 1GYRA 1OA1A 1L1FA 3SF8B 2HT6A 3KR1A 2P69A 1U8UA 5IJ9B 3P27A 2FWPA 4OGFA 4WN9A 4J6EA 3AM1A 4H0NA 1PK8A 2COUA 4WKPA 4MQBA 3O0FA 1VGRA 2WHXA 4YVFA 4D9IA 1Z7WA 5HEKA 3BMCB 1ARZA 1SPBS 5I7UA 2K8BB 2HLDD 4JLWA 3E5NA 1MU0A 4DUPA 2GRUA 2Q5CA 1DMRA 1E1CA 2NQ2C 4J4TA 4AKIA 1UKEA 4OVKA 2CKMA 2QB5A 3BTUA 1RYHA 2HO4A 4BN4A 1G66A 2FPPA 2WFMA 4NJ8A 1KZHA 2I8AA 4N54A 2X5XA 4W6QA 4E31A 3O84A 1GN9A 3PNPA 4C5AA 3LL4A 2IE8A 3T0IA 1L5QA 3R9IA 1QSYA 1ONNA 1CRLA 1WF3A 3N3AC 3W1VA 3PENA 3ZV3A 4RJTA 3ADDA 5J2GA 2G80A 2GPJA 4ZU1X 5A7FA 4FYIA 4EUSA 3UHFA 2CXQA 5DT9A 9ICNA 3D8HA 4DZZA 3OTOB 2ZRMA 3QOXA 2CN1A 1FFYA 3LX6A 2AD1A 2D0OB 1QQTA 1F2TB 1R6TA 3KDSE 1R0LA 4IUCS 1NAIA 1NE2A 4J0CA 3AUUA 4X84A 5CMLA 2X1LA 2PJZA 3BMNA 3L8ZA 1Q12A 1EK1A 5KFXA 2WJWA 4LMAA 4TRMA 1PVRA 3DAPA 3IKVA 3UAOA 4US1R 1GV0A 1H0RA 1S7CA 3MG9A 3RJEA 1C3OB 1KDPA 3PXEA 4CBVA 3LDAA 2X86A 3ZXSA 4UXJA 2VRWA 3IVMA 4ECZA 3IIMA 1DIHA 1SD5A 3UYKA 5AVRA 2KP7A 2VZEA 4S04A 1B6TA 1J2NA 2YN0A 8ICQA 2KHVA 4NK5A 4A26A 1CUJA 2O8CB 4PYLA 4PY2A 4FC6A 3CXUA 3SLRA 2BPGA 1MB0A 3C3YA 3CVUA 3LQ1A 4MV1A 4WLNA 3DA8A 1OOEA 4TVOA 2GZ3A 7ICIA 2JAPA 4HG2A 4M3NA 2NNLD 4XM2A 3ETLA 3D2CA 5CM9C 3S4YA 2Y2UA 3BDVA 3TGPA 2OZVA 1TKBA 2GHIA 4RDCA 1M1YE 5KVSA 1BS1A 1PE0A 3BHIA 1EP9A 2AOVA 2ETVA 4OJPA 2PXCA 3NIBA 4EA7A 2FYTA 3E9ZA 2CJXA 3AOEA 3QF4A 1BMDA 4FBGA 5HKKD 4X64B 4F4WA 1I1HA 3EUB2 3DZCA 2GBGA 2GPWA 2CW5A 2W6ID 4L0QA 5HIJA 1QZ3A 3ESQA 4F96A 4IDAA 1H2BA 2GHQA 4EG0A 4NICA 1CU1A 1USIA 5MGBA 4X54A 1U48A 3H9JA 3SXPA 5ITVA 4S05A 1J00A 3KQSA 5BWOA 5BO5A 3IEMA 2PZFA 3QYFA 2LCQA 1T8TA 3LQRA 4G0MA 4CG0A 2POQX 4R1LA 4C08A 4YRMA 4O5AA 3SC3A 4OATA 4N7JA 1JEQA 2ZXHA 1LLUA 3PICA 3WG9A 3E53A 4BVKA 3CT4A 1H22A 2GEUA 1E5TA 1P9LA 3JATA 5IAOA 1YZLA 1E89A 3VC8A 3EZFA 4OX9Y 3WQSB 2WINI 2X9VA 3OCCA 2C5BA 1JYFA 4X94A 4Z7JA 1U8XX 4IHJF 4E5DA 1NMQA 2RGBA 1SCQA 5IVIA 2PMWB 4OJ5A 1T9DA 2J85A 4YRTA 1RHRA 5IDYA 4XARA 3DLAA 4HTFB 3HCBA 1Z16A 1G9XA 4AYWA 1M74A 5DB6A 3K0BA 1PK3A 3C4VA 4ZXPA 1ZQLA 3C3XA 1JGTA 4G1UC 4BLOA 1ZVMA 2NVUA 1W4ZA 4BQPA 3ICQB 4M04A 2E1FA 2VOJA 2C29D 1KFKB 3K2EA 1N92A 4KOAA 1K5PA 2YUIA 3DE2X 4V3BA 2XCIA 2B37A 1IOWA 1I5RA 1NX6A 1ZJYA 4TGLA 5E1DA 2XY4A 3AHCA 5M5BA 3Q1LA 2FFRA 3HB4X 1J5PA 1GYPA 2J0UB 4DJFC 1Y8RB 4UTVA 2B35A 2P4EA 5KJ6A 2VCEA 2IYRA 1N62A 3ZW8A 2WV7A 1SVSA 5F73A 2R8JA 3DZGA 1V85A 4FCWA 4F92B 2RBGA 2GN8A 3DLCA 3EPJA 3U3ZA 1GTL1 2PFGA 4QULA 5E4JA 5IBQA 3PA8A 1B76A 1N5RA 4K8OA 2J6TA 5A71A 4BQIA 1GQOA 5FNVF 2JJYA 4J0JA 3TFQA 2GLTA 1LS6A 4MV9A 2Z43A 4XD7A 4YB8A 1SVWA 3VAZA 7REQB 4CF3A 5KT7A 4RO0A 4MXDA 2IWRA 3LPDA 1HLDA 3REGA 1GAXA 1ZETA 3BRQA 3CQ9A 4J0IA 2W7PA 1JHRA 4IS3A 2V7GA 3P9YA 4YLYA 2WTEA 1Q1GA 3O83A 2CD9A 4CW7A 2DLDA 2B8WA 4DSTA 5KU1A 5TNXA 4GIBA 4FFLA 2Q0HA 5BN3A 1Q2UA 1MC8A 3IBGA 1Z5OA 3AFNA 3RUCA 2YOFA 3U37A 4BVGA 2GZMA 4NV0A 2ISQA 4FNGA 3FZYA 1XIVA 2ZRBA 2WB1F 1CQWA 4B3TB 4XQCA 3LV8A 4MVJD 2KMLA 2I1LA 1FVOA 1N9KA 2WMDA 1P6XA 3N2KA 2NX2A 1UIRA 4D6XA 3PG5A 4EHFA 3GFVA 3T3FA 1YOVB 4TWZA 3V4VB 3VMMA 4RANA 3GJ4A 2DTEA 4I0WB 1KOJA 4ITVA 2OD9A 1ZQEA 2PLWA 3BSWA 3I12A 4RSMA 4W99A 4FNOA 1ML4A 3ERCA 1KQFA 2KPOA 3TKLA 5D87A 1V3UA 4LNUB 4XDGA 3TTVA 3ZOZA 2YJ6A 1NX9A 1V9CA 2A9QA 2O2DA 4TYPA 3KIPA 3HYCA 4DAOA 2HRBA 4NY8A 4DLPA 1U0BB 1B00A 3B85A 4K4HA 2XVXA 3JATB 3COZA 2IYWA 2DBYA 1UC5B 1IV8A 1X1AA 2QY6A 5B58T 2HD4A 4E51A 5AVUA 1K4YA 1V71A 5I7EA 1MNQA 5K8CA 2H2IA 1JEQB 3E7XA 2LZ0A 2A0UA 5DLEA 4DB4A 1QOPB 2A0WA 4RQ2A 1RAAA 4AUNA 5DIFA 3Q8MA 2H06A 3O4IA 3AF4A 3FYCA 3OFVA 3PUYA 3QTBA 4TS9A 1QVVA 4URFA 5TGDA 3TINA 2YJ5A 1VL5A 1FIQA 3T7IA 3M33A 4COKA 1KP3A 4PNZA 3IKTA 4B48A 1Y8QA 2I7TA 3OKFA 3KKLA 2G70A 4TMWA 2H1FA 5LKAA 2YIDA 2F1KA 3DGFC 2B21A 1GGJA 5C0OE 1TGVA 1U5BA 2WW8A 3F6SA 4MAFA 1JG4A 3UO8B 1L4NA 3STHA 5EJIA 1OFIA 4MDHA 3VSEA 5JH7B 1PJ4A 3IDZA 3F53A 2FAXA 4DZRA 4PE5B 2R0QC 3DDCA 1QZXA 4M89A 3K1RB 4PG5A 2NUAA 2QF7A 3A4IA 1H2XA 4BRSA 1J90A 1NE7A 4IS2A 2I7VA 2R8EA 1WIWA 3WYAA 3JQ6A 1A9XB 3D2NA 1UWKA 3ILVA 2RI1A 4UVEA 5B4UA 4IZOA 3LYUA 2PBFA 2RHCA 4YBRA 2FF5A 3D8UA 4NLNA 5M3BA 3MS2A 5LZ7A 1ZNXA 4FZRA 2QSUA 3ZQ4A 2Q50A 4G0QA 5EZ6B 3PRKE 3FTNA 2GLUA 2ZSFA 1GCIA 4YCAA 4FHEA 2E4UA 2DBZA 1S9FA 2K4EA 3CLUC 4DCNA 4J9RA 1JQBA 1Y81A 5G0WA 1DTEA 4G5YA 1ZQNA 3IB6A 3I6MA 4C8KA 1IAQA 4MV5A 3UV7A 1HDRA 4YV0A 1UBNA 1ZGGA 2BEVB 3GDXA 2NTYC 3R5XA 1PQWA 2XHZA 2AXEA 3FIJA 4H1TA 5GOTA 3WIVA 1EA7A 2CD7A 1NR7A 1O4WA 2UUCB 3ZDBA 1BFUA 4N01A 1GRQA 1HORA 1AGPA 3II6X 4A0SA 3JCZA 3EC7A 3PFHA 1UT6A 1V0JA 1LJ8A 1ZXIA 1VBFA 3AR8A 3N0VA 4IZIA 2BEUA 4PPFA 2VF8A 4D3FA 3ZWYA 2ZKIA 1R00A 2BJHA 5FO0A 2XQFA 2HA6A 4YGXB 3T52A 5JJ5A 4ER6A 4N7MA 1XA4A 4MRAA 2Q99A 3JR3A 1YDGA 1NXTA 3K53A 3M6ZA 1U1GA 4KXUA 4XUDA 3ETEA 5EA2A 4YRQA 4DLVA 2EJBA 4CIBA 3VO2A 2C4NA 3W34A 4MYTA 1ATIA 4A1FA 5A3VA 3I32A 4QUJA 1ZMOA 1DE0A 3DTTA 3F5MA 4C4AA 3FWNA 2HKIA 3K0EA 3OSZA 2O3SA 4N5DA 4O1HA 1BJRE 4C05A 2MA1A 4GOXA 1IN6A 1M2EA 1RRPA 1XUOA 3B38A 3PQ2A 3ICXA 2FJ0A 2QW1A 4HN4B 4QNNA 4ENVA 1AE1A 1FFDA 2GTPA 4PQFA 5KSWB 3D5EA 3AKZA 4ZC8A 3RRBA 5CB1A 3JD4A 3LVQE 4HB3A 2FRVA 4K1XA 1NOIA 2JIZA 3CY6A 4H3VA 2UVRA 4Z99A 3WNVA 4R9UC 5FDFA 5LQCA 2XMDA 1BX0A 1JHXA 1KEKA 3OE7A 5ANRB 1Z0JA 5HHIA 2NXWA 2FP3A 5K0LA 1UFKA 2WOOA 2V6JA 1XFAA 1OFTA 5KWVA 1RAHA 4RDIA 5I9BA 3G0IA 3WK5A 5J59A 2VK8A 3OP1A 1MAUA 3IP5A 4L5JA 4MARA 3H11B 3AVQA 1GL7A 1UMBA 5IBCA 3HU2A 4Q7QA 3ZN2A 3HKBB 3RUIA 3L0OA 1KJQA 3ABOB 4ZYYA 3COSA 2VIXA 5DQHA 2IZ6A 2XUOA 1AK9A 1U7UA 3IPLA 4M0PA 3ZX5A 4FFBB 4HLUC 3OGUA 3OZXA 4JEUA 5IVHA 3LHKA 3N28A 2R6AA 2AJLI 4XQEA 2K4HA 3BXHA 1X80A 4I6JA 4X93A 1WHTA 2EGHA 1U2DA 1UWVA 3T3HA 3V9AA 4OJTA 2R18A 3NBZC 3OIVA 1QJCA 1S2GA 2TMKA 4KXYA 4DIEA 2B36A 1QIFA 2C9ZA 2ZT6A 1I3OA 2AJQA 1NP3A 1X74A 2PFOA 1E7QA 3RJKA 2O3QA 3G0OA 2Y1FA 3DUFA 2KFNA 5L3ZA 3WLFA 3UH0A 2ARKA 4L50A 2I6FA 2FXVA 4JP5A 5EFZA 1FNMA 1BU5A 3FYSA 1G6HA 4CHGA 2VYQA 3U48A 2OO5C 2KW5A 4GC5A 3TXYA 3ZWNA 2JHCA 4KDFA 2HRCA 1XF1A 4YI5A 1EMDA 1N1DA 5UKDA 3TCXB 1ZVJA 4Z1MD 3DCYA 4AKHA 3QX9A 3AR2A 3DV0B 3P45A 2GTHA 5ELXA 2BUCA 2X8WA 5IDXA 2ZU6A 3KV3O 4J2TA 1NURA 1T9GR 3TADA 3M3DA 3KZMA 1VCHA 3LPCA 1X9HA 2NU7A 2R751 3I23A 3P9SA 4YNBA 3BC1A 2BW0A 3D1JA 2VIIA 3OP4A 4E1AA 4N0DA 2B1RA 3RUDA 3PSFA 4U6PA 5IVDA 4RD2A 4G9BA 4LS3A 4Y67A 1GRCA 1PJCA 1FU7A 4UMVA 3WMFA 5J0YA 2EQBA 4DN6A 2X41A 3VX3A 3OA0A 1VZ3A 4L8WB 4BO8A 2HJ9A 2W9AA 5FUVA 4CM8B 5MFZA 1FK8A 4S1TA 2IPAB 2HV8A 5C53B 2RQ5A 4DR7B 3VRHA 3EIEA 4GPIB 3TECE 2HJHA 1BN7A 2PSFA 4C22A 5BQPA 2RD2A 5I51A 1B3BA 1M2KA 2C9DA 2WICA 3TW4A 2XCOA 4C0AC 2IRWA 4JHXA 2LKDA 2JJQA 3GFFA 3D1VA 4L73A 5CA1F 3U4DA 5HRAA 1OIXA 3FWZA 3KC2A 4MS3A 2FX5A 4KUHA 4B09A 4UREA 4ILKA 2FQWA 5ALRA 3QXXA 4RETA 4ZAGA 1UPXA 3HJAA 4DBLC 2VPXA 3UA3A 5EVCA 1MVLA 1PG2A 2KJ5A 3R5TA 4FYPA 4AY6A 1JDJA 3FOCA 3Q3EA 4WA8A 5LMZA 3EX7C 1XTTA 4TTVA 2ES4A 5L45A 4W1QA 1BHQ1 1YE5A 4JJIA 2Y6UA 3R3JA 2Z95A 3JPWA 1E4YA 2XMZA 1ZNWA 2W6IA 3HLTA 4A2CA 4RZHA 3DZIA 5JRDS 4I8IA 1KE2A 2JMGA 4WGFA 4B85A 2IBKA 2QTTA 3EXG1 3PIIA 2EV9A 1KQQA 1E2UA 4FHGA 3CW9A 5KFFA 4QO8A 4F9FA 1ABEA 2VH2A 2YUTA 1O9BA 1AQIA 2F8KA 2P9BA 1RBQA 4P5DA 4PANA 4PGHA 3O1LA 2ECFA 4RK1A 2NN3C 1ZR4A 2O2GA 1ZQHA 2GWSA 2W3SA 2P0AA 2W8BB 1DQZA 3T1QA 5IJ0B 4R6WA 1TEZA 4F56A 3LLVA 1FSSA 1F8GA 1ECLA 1NVTA 4KQHA 4O25A 1JSCA 5J2CA 3RSLA 2MT9A 1OV6A 1SEVA 2DYKA 2BE7A 2IELA 4GOMD 4KFRA 4ZVOA 3A6EA 5TEWA 1R16A 3CF2A 1PX0A 7ICJA 4WDQA 3KAKA 2WDZA 4FC7A 5K0GA 1P2UA 3AEUB 4IOMA 5F3XB 2VF7A 4EIWA 2QROA 3UGJA 1V9LA 1OBFO 1QIHA 1NN1A 1D4FA 5F4BA 2PL3A 2F3TA 4DJJA 4CG3A 5D8DA 4JL5A 3DMPA 2LDXA 1EXDA 5A0LA 1PVOA 4OJNA 4DIOA 2GAOA 2O9JA 1X66A 1VIYA 1SKWA 4UARA 1N57A 3KL4A 5DYGA 1NYLA 2EFJA 3UT5B 5IN4A 5BUSA 4RENA 1UK8A 1V11A 5DHPA 3G0DA 2OORA 1NFQA 3AM9A 4MPJA 4R01A 4TSFA 3L5OA 1Q17A 3ZWWA 5HM8A 3IQDB 4OUKX 2GLEA 3RBDA 1JPNA 4O6VA 4WH0A 1VSUA 1HURA 2MAXA 2H51A 3CLHA 3OJWA 3RHFA 4BTEA 5I9LA 1TXGA 3OPXA 2JFVA 5LP6F 5EJ9A 4G0XA 4P22A 4PQRA 2MIIA 5IW8A 2RGGA 3WWYA 1ONBA 4W8OA 4JY7A 3NTRA 3MJFA 1QGED 4LHWA 1A76A 1FRNA 4ECRA 2CNNA 2RG7A 1LSJA 3Q72A 4TTRA 2PU5A 4LJXA 3F7NA 1GSOA 1EG2A 2HRZA 2J6UA 2NM0A 3TLEA 3GEIA 3OAAD 4AZ3A 1II0A 2F8MA 1A5AB 3H1TA 1QBGA 3BB3A 2PA3A 4JI2B 1TAGA 2YWEA 4QWAA 3EZ7A 5CVJA 3K73O 4AVYA 4PH5A 2BF7A 3SVLA 1N1EA 3G5LA 1W581 5ALIA 2BCJQ 2JAXA 3KUXA 3RVMA 1FRVA 3TDKA 3L6EA 1BS9A 4P7GA 4BNVA 2AMLA 5C1PA 1F14A 2W7TA 2VA3A 1XVLA 4ZJZA 5L3SA 1KC3A 1PQ4A 2WJZB 1GTVA 2AZTA 2C78A 2HF2A 5AJYA 4Q15A 1G64A 2O8FB 2RSLA 1ORDA 1EDOA 2QVBA 1WMBA 1GEEA 1Q7BA 3OLWA 5HFJA 5JRTA 1R9GA 1YMUA 2FE4A 4MW0A 2NZ8A 2JGMA 2GEKA 3A0HU 1OXSC 4MDFA 2ASDA 4YR7A 4YXWD 1P7WA 1ZU4A 4RH1A 4ARCA 5KQMA 2Z2ZA 1YBAA 4WY5A 4JC8A 2V45A 3WLLA 2BR3A 2XQKA 3PS9A 3N0TA 5IX8A 2IPLA 2DF8A 3N2GA 4F5EA 4LJ5A 3GCWA 4CNQA 3EPKA 3ZU2A 1T4DA 2XI4A 1P0QA 3V4ZA 1L7BA 4PHTA 2C28A 3IULA 1T36A 2BEUB 3CBQA 3LUGA 4HDNB 1AV6A 1XI2A 2VOEA 3I8SA 4WE3A 4ZJPA 5KJCA 1XN1A 1TI7A 2KFZA 1PT5A 3HA2A 4UEJA 4YAUA 1Y6RA 2ZIUB 3F3MA 3WGTA 3DPSA 5KQLA 4ESVA 4DDMA 1CJTC 5AKKA 2NT3A 2R7NA 3N3BC 1XCBA 3PVZA 4HNGA 5C1IA 3RTVA 2GLXA 3PKIA 1G8FA 5AM4A 4RT2A 4IV5A 3HUUA 4Y1GA 2V1XA 4B3MB 1N2CE 2Y2VA 7AT1A 1C8KA 1Z0ZA 5HYVA 2O8EB 3VSCA 2FPLA 1KAOA 4BL5A 1F8UA 2H00A 1EXNA 4BGIA 3RTGA 1PGQA 4WXEA 1ZIOA 3GNLA 1ECJA 3GP5A 3W2EA 1YQQA 1E6CA 1KFEB 4LYDA 5E6SB 1URJA 4LBWA 3EN0A 3U3JA 3QV1A 1TZCA 1A27A 3BTSA 3QLTA 1ZHOA 4DDUA 2FQYA 1JFSA 1S3IA 2A9VA 3EC2A 4RXTA 5CFLA 1A9XA 4H6PA 5GY7A 4ZO7A 4DWIA 1P19A 1PEAA 1EUDB 4KMMA 2H5EA 1CUKA 1N2CB 4F97A 3MGKA 3MB5A 1YONA 3L8GA 2DCUA 3C3WA 2FB9A 2ZETA 3IPRA 1Z08A 3KOXA 2CDAA 2VYVA 1VPVA 4KN6A 4XUEA 1UINA 4FYYA 1YS7A 4Q1EA 4C7BA 1EZZA 3B51X 3B1YA 3NDRA 3UJ8A 1UFOA 2CHEA 1UC4B 2PKQP 3EMDA 2VP4A 4LFCB 4A2PA 2OFFA 2CDBA 5AKIA 4NU8X 4AJOA 2EGGA 5EIBC 1PGOA 3P2MA 1FU4A 3PQ6A 2DTDA 4NVRA 4QVGA 1WUIS 4CMAA 3I0NA 1A1SA 1P7VA 2OVFA 4Q19A 3VC3A 1T94A 2O14A 4Q3DA 3MDCA 2FLWA 1JPUA 4ISCA 2J59A 1TW2A 2GEDA 1H8ED 2B7BA 1DL5A 4BKMA 4EUEA 3FI9A 4QZEA 1W36C 2C2RA 1CYEA 2BGWA 1RACA 2DFTA 2Q8NA 2KEYA 2ISCA 1KBUA 2PT9A 2JBHA 2QPTA 3CN7A 3GT4A 4AROA 5LZ4A 2OCPA 2KN7A 2WKQA 3V6MA 1Y1TA 2XNSA 4BGDA 1QB8A 1SMKA 3VPFA 4YREA 4Q7LA 2WIFA 2HCJB 3TUIC 4EW1A 3A1DA 3V8QA 1N78A 4TVKA 1GDHA 3PEWA 4TZ6A 3FZNA 1EEXB 2DC1A 4TLCA 3THSA 3MFHA 4C89A 5DN6A 5CXUA 2VAWA 5D5HA 2CL0X 1X77A 4AICA 4UM5A 5L7YA 2HWWA 4DCMA 4YUAA 4YJ2B 4H4EA 2CK3A 1K6XA 1LQTA 3ENNA 3LPLA 4ZDIA 1OXBB 4EJ0A 2LV8A 4RFLA 4GR5A 1RNLA 5EESA 5B3LA 4GP6A 1UBTS 3HM9A 2IH2A 1R4NB 3DPIA 3DE5X 4NFHA 5BPFA 3RB6A 4K6OA 3CVVA 4OAOA 2V96A 3LT0A 4UQLA 3WNCA 2C88A 5BRNA 1W85A 2QX8A 4M53A 4EY3A 1GUAA 1Z0IA 3L8YA 4KE6A 5EXEA 3MXTA 2RGNC 4I3GA 5KIAA 2QU7A 2KZ3A 1P61B 8ATCA 3BJRA 5CD9A 3EEQA 5TC4A 3KHSA 4IO0A 2EXXA 2YYSA 3IP1A 4R1SA 1TEVA 3SJAA 5C8VA 7ICRA 2V7BA 5BQXA 3DXXA 1SXPA 3TF5A 5TQ2A 5KSOA 4W9RA 2VG8A 2FKNA 2GUGA 2C7VA 3UK7A 3VNSA 4YPVA 2WU4A 2QJOA 5BV1A 2A9FA 3H1AA 4ALIA 4E3WA 1VE1A 3GLQA 3I6QA 1JG6A 3MF4A 4TV9F 3RHSA 4B4UA 1SG6A 4BNNA 4WKBA 3PBKA 4IYJA 4DQKA 4FS1A 1UJNA 3PX2A 4HB4A 3RRXA 4II3A 5G0UA 1MB2A 1ZICA 3D3QA 7REQA 4AM8A 4R51A 2YHSA 2Q6VA 4KLAA 1TPZA 4ENQA 1FRZA 1OH8A 3L02A 3NOOA 2O2ZA 3RW9A 1M7GA 1X70A 4NBKA 1XMJA 3LWZA 2VP9A 4IZ6A 5HX7A 5LMUB 3PC3A 5JEDA 1O7JA 5BN5B 1U99A 3FYUB 3SHOA 2CV2A 1LSUA 3FHJA 4LDPA 3DMRA 1BVUA 1SCIA 4BB5A 1U4BA 5A1JA 1VJCA 5KI6A 4QUHA 2QPOA 5L9XA 3EFHA 3VVMA 3I5MA 4IJKA 3ROGA 4B33A 1EYZA 3LLUA 4ATNA 3EA4A 2II6A 1P8JA 3CZQA 3E84A 1V35A 3KB1A 1A69A 2GEBA 3UPQA 2BGMA 2JLQA 3FAHA 2HHQA 3RSOA 1BE8A 1TFUA 1V5EA 1TT7A 1BVYF 2CHUA 3NKFA 5IKPA 4BQQA 5AK0A 4HTFA 3CNHA 1F44A 2Z3ZA 3R3WA 1MMFB 2K8CB 3WU2U 1X9MA 1DBWA 4IHKA 1V9SA 1KKUA 4IFIA 4MR8A 4NZ9A 1JQLB 3FZQA 4Q9JA 5IUKC 5LXTF 3GW8A 2O23A 3CPEA 2GXUA 2P2NA 3KVOA 4CKBA 1XZLA 1XQVA 4ZOEA 4B7UA 3KYCB 1KGDA 3F9CA 2QM3A 3O8OB 1R0RE 2GHRA 2I80A 4N18A 4Z7QB 2ATVA 4P3KA 1WM1A 3DMGA 3OZAA 4LXQA 3QFCA 1N56A 3I58A 2OPHA 4I19A 3FI0A 1C9NA 1Q0QA 1WVGA 2A5JA 2BZ1A 3LHFA 1RPJA 3QNWA 2W6NA 3I1JA 2ODAA 5HQ3A 2RBKA 2NXCA 3OCYA 3OQMA 1JLMA 4V39A 5E1MA 2IZZA 3UEOA 4BU1A 5TGTA 2BJWA 2JK1A 3DW3X 5ADUS 2X2FA 4RGVA 4ZV4A 5EPEA 3ESZA 5I7FA 2Y1EA 1CJSA 5DB7A 1TCVA 1CQJB 1UXHA 1TYDE 4PHFA 3NTVA 4FQ5A 1P5ZB 4DMLA 4HAYA 2YY6A 3FPGA 4GP9A 2KOBA 1LJLA 3K3PA 1T9KA 3AY3A 2NTJA 4J3FA 4TZKA 4Q00A 4BO5A 3KZVA 4BGEA 1M6EX 4AY5A 1ZIYA 5C7LO 2J0QA 2VSYA 2OZLA 4PGXA 4CLEA 3N8NA 4Y2JA 3H4VA 2O8DB 4WZAA 2DZDA 1L7NA 5EZYF 2ETXA 5I8PA 4I1YA 5HHTA 3UNXA 3VO8A 2I9KA 3SS9X 2XEXA 3AFMA 1EUDA 2H1WA 3CM0A 2C77A 1ZH0A 3ZHYA 4HGZA 1B4DA 4DTCA 4MVJM 1IZ7A 4ICIA 1TCCA 1UPBA 2P1ZA 4GNRA 1MT0A 1O5OA 1SCKA 3DMNA 4OUDB 1VLVA 1UCVA 4OKNA 3RIGA 4B76A 3RWBA 5EJ8A 5HNKA 1L7QA 1X7GA 2YYAA 3AI3A 4JUAA 4LBVA 3KPYA 1EVZA 1WXWA 3WO0A 1YB6A 1G9SA 3EGOA 1WZEA 4DFKA 9ICHA 4FFOA 5EP4A 2P30A 2SECE 2FZGA 1RRCA 1OI3A 1GQFA 4QNRA 4XKJA 5COQA 3MLBA 2EQYA 1TD1A 3BD8A 2A1AA 2H5XA 3HXPA 4MV7A 4JIMA 3CNNA 3OQVA 2FPIA 5DM0A 4DW8A 3BMNB 2P9TA 5ERGB 2E1EA 1NW4A 1NBMD 4MQ5A 3T1NA 3M3HA 4NOKA 4NU5A 3QU2A 2IU3A 2OXOA 4MP6A 2FWIA 3V80A 5KX5A 2BCQA 3B1ZA 8GPBA 4TLMB 1WUTA 3VR3D 5GJBA 3LFUA 4DGQA 5JJKA 1MVOA 2C3OA 3T5TA 1F20A 1YR7A 3NH9A 4DG8A 3KZXA 5L53A 1M2FA 4X61A 3O0TA 2LWIA 1IIPA 1A96A 2KX7A 2AEFA 3DDWA 4MWSA 2CLSA 3GUVA 5FT9A 2J5RA 2BBSA 3VKHA 3F2CA 5K51A 1Z2OX 2VO1A 2NZXA 2R79A 3AY6A 4B6RA 3CEJA 3EEIA 2OH2A 1Y42X 2PHZA 1VHLA 2QIPA 3U3KA 1QMGA 1Y8AA 4UM9B 1QX3A 5CBPA 3MELA 3OHAA 1A7UA 2XD4A 1XA0A 4KXVA 5F3WB 1VBNA 3DVRX 1CZOA 4WN9B 4BO2A 5BV8A 3QEAZ 3FCEA 4UDOA 3WYBA 4QXOA 5KL8B 3P9XA 4CVNA 2BBTA 1ZAYA 1I6WA 2ZRQA 1DBIA 1DAFA 1SUEA 3AYZB 2OKCA 4JUBA 2OYYA 4M83A 4MI3A 4QPJC 5CM8B 3ZV7A 1V47A 4WVLA 5AOCA 4CGYA 2BH9A 2WJ6A 4MGIR 1QIIA 4D02A 5C0YA 5HF9A 1AOXA 2BI8A 5DASA 2DY0A 5EUQB 3EBPA 5FOQA 2AHOB 2FPKA 3AONB 1M2JA 2W2OA 4ZYLA 1KAMA 4P9NA 4F2GA 1DXOA 2PVCA 3DM9B 4LXXA 5DX8A 3CVWA 1SFRA 2I4RA 3FWPA 4OKSA 1A7JA 1GZVA 3RJ9A 4DT1A 1NNEA 2PEZA 2UUPA 1JR3E 5KQPA 3RABA 3RVPA 1YV9A 3UGQA 5T7BA 5EZ5A 1ZQJA 5EIAA 3LDHA 4K1LA 4MGYR 3EZNA 3OE1A 2PM8A 6GPBA 1NNSA 1QVZA 1Z63A 1YRWA 4AKEA 1T4CB 3LCRA 3DD5A 2DVMA 3MLEA 5HMLA 1J9GA 2B3DA 3OM1A 4RABA 3PPWA 4LCEA 4WXRA 3G7NA 2XV1A 3G5MA 4I6GA 5BN1A 4RQTA 4MIYA 1OYOA 2RARA 4UQPA 3CVXA 1A9OA 2VDNB 5JE8A 3N1UA 1Y6QA 1KVUA 2EX1A 2VSQA 3TQTA 3PJGA 2FSGA 3MR5A 4AX4A 2DQYA 3AVWA 7YASA 1W76A 3W5CA 1AO0A 1WNTA 3ESDA 4V0NA 3IAFA 1K6IA 4DC1A 3D4PA 3SG0A 3W06A 1YA8A 3KYBA 4LZOA 3UQ0A 1JEYB 1LB1B 4CF5A 1DEHA 4IDFA 1I2MA 1OJ7A 1R6DA 2FRXA 1I3NA 4R2WA 4RA6B 4V0QA 3OTGA 1PN3A 2IYUA 4JAVC 4HB2A 1USVA 3PCTA 4BUCA 4LHSA 4DILA 2EKBA 2W8ZA 3H9GA 3PUJA 1X9GA 3U3RA 1CF9A 4YMNA 4AO7A 2W90A 4ZZ0A 1X8LA 1SD2A 2EZUA 3GJ6A 4OHPA 5IJ0A 1KERA 4RTSA 1A2KC 1S76D 1O94D 4MHOA 4KP7A 3U60B 4GKAA 4WCDA 1XDBA 1E2QA 3KFLA 4I3FA 4P3NA 5C3MA 3I6BA 4Y9SA 3KPVA 5CYOA 1T5OA 4Y6RA 4O8ZA 3WLKX 2H8GA 1NWCA 4TZ0A 2HC9A 4YRDA 4J9NA 3UN1A 821PA 4NG5A 1SXIA 5F35A 5AFSA 9ABPA 1K97A 1FFUA 2EJCA 1KI4A 4LGYA 1L7OA 3EVZA 2OWEA 3ZHQA 4A0QA 3MD9A 2CNWD 1PLKA 1ZJ6A 1JILA 3TD9A 5AD1A 3UMMA 2DETA 4IIJA 4DS5A 3JD0A 3EGWA 3JYHA 4FFNA 3EVNA 4DG9A 3K72B 4NLLA 1BHJA 1B0XA 5CJPA 4MUFA 4Z4FA 2QIOA 5D3MB 4B2LA 1T2FA 5BOSB 1WMSA 4D82A 3IV9A 1UPUA 1DI0A 1WWKA 2HLDA 1F12A 2DFNA 1F2UB 1PFKA 2FF7A 1N3BA 2WD7B 2WILA 1GLGA 5E7QA 5CDFA 3ZHUA 1PNOA 2WJPA 1RT9A 1UBUS 3C8DA 2DX7A 1XNRB 2B4AA 2PX0A 2VSNA 3L04A 4LCJA 4NBNA 4YROA 4MQ4A 2HCFA 5DHAA 5TZVA 2B4RO 2VUIB 2W2VA 2IHTA 2B8JA 3H83A 4KOEC 3ZGOA 2KICA 3L7LA 3G68A 2V4UA 2JCBA 2KLBA 2XVZA 1Q0LA 1YHYA 2CVQA 1WA5A 2OP1A 3AOEC 2IK8A 5IYZF 2I3GA 4KR7A 4WECA 4LWQA 4OHYA 3BQ1A 5JARA 3TZCA 5A3RA 3TI7A 1PWEA 5G3ZA 3FJOA 5CNIA 4AU1A 2XMPA 2QXUA 1VHWA 1EB9A 1SCBA 4F84A 2ALZA 3B6MA 5KT6A 2PFQA 1M1YB 3GRVA 3LYLA 4OQDA 1BG6A 2OY0A 3RG2A 1YC2A 3R1IA 2ZLBA 4YXJA 3NCTA 4H7HA 4MDYA 1GPUA 2NQ8A 2LYHA 5BOLA 1E8NA 2XVMA 4XGNA 4KVAA 4TLAA 1SXGA 4XTRA 1BPZA 4OFZA 2NMVA 4L16A 2X3UA 3NHRA 3L5KA 1E6UA 2OK8A 2QYHA 3BICA 4ELUA 2H92A 3EZLA 4WACA 2WFLB 2Q8QA 1PGNA 2P67A 4G26A 5FUMA 1U1IA 5BSRA 2VQEB 3NMUF 2MR5A 3LG2A 3GLIB 2RJNA 2X4DA 2C7BA 1ADGA 1IOLA 3T0FA 5JZVA 1UZUA 1Z47A 2Q29A 1MPTA 3EY9A 4PO1A 3T0GA 4C2BA 4KQKA 5H9WA 1G59A 1IZ8A 1ESZA 1OI4A 1WSAA 2YVKA 4I50B 4LYHA 3OF2A 2RJ3A 1SCDA 4HKTA 1O0BA 3AR5A 1HDZA 1YBFA 2AF4C 2FWRA 4J0GA 2O2SA 4O2BF 3BTVA 4PLGA 5TPWB 2VF5X 3ZQJA 2KVCA 4H1HA 4J3JA 3DO5A 1P4RA 1YAHA 4PGFA 3ZGZA 3CIOA 4J0HA 2J6SA 3SZMA 5FI1B 3GDWA 3FWKA 1L9XA 3ML1A 4N3NA 3UWOA 3JY6A 2I9GA 5TQJA 4DUZB 3A9SA 1PV1A 1SUBA 5E1BA 4V1CI 1Q7EA 5KFYA 2A5YB 4DF4A 3PUXA 4HSEA 4QE3A 4K0KB 1PJ2A 4CR8A 2D13A 3QVLA 4CKEA 3LHSA 1DX6A 3KXLA 1CNFA 2ENUA 2VBGA 3PGXA 4PQEA 5HF8A 2GESA 1W6RA 4F3NA 4DANA 3THYA 1QV7A 2AS0A 4I29A 1AKTA 2GDZA 3C3AA 4TYMA 5EHGA 3NIWA 1GPYA 5E79U 1NY5A 3ZZTA 4ZI7B 4BC1A 3K7EA 1LWNA 3LP5A 4WZ6A 5HQJA 4EJMA 5BQFA 1LDEA 5KFGA 1VKJA 4CPDA 1VM6A 2DPYA 1TK8A 1O5IA 2VDLB 2BGIA 2XE4A 2FDRA 3HDYA 3KEMA 2GOYA 3E3NA 4F4CA 4M0FA 5I6DA 3NNNA 3MTQA 2VJDA 2E5WA 2YFKA 4FDAA 1JI7A 5DM60 5K0NA 3SXJA 3TNLA 3O3CA 2A6PA 1YCFA 2IZ5A 1BWSA 1P7ZA 3B3FA 1P62B 1LI4A 5JJLA 3BJMA 4P31A 5HKOA 1H3FA 1O9GA 3ESBA 3OLZA 4JODA 3SS8A 4U2GA 3FUUA 3G59A 4LZPA 5DU2A 3TSYA 4C0KA 2OYRA 2E85A 1V7PC 1F6WA 4OJKA 4YAKA 3OETA 1PJZA 5IT9A 4BEVA 1IN4A 2B9VA 3ROMA 4QBHA 2J4FA 2LE0A 1POXA 1OLUA 5ALLA 3CNOA 3RSHA 5LNK1 1U3VA 1Y37A 3AEXA 4BP1A 3GIKA 4Q3OA 3UCEA 2LP4Y 3HP1A 4KACA 1EE1A 3AUYA 1O0CA 3STWA 4HZGA 3IVXA 5E7IA 2R62A 1Y9EA 3BG5A 2WTXA 1FUIA 4XRRA 5DBIA 3S2YA 4FN4A 4EP1A 5H8WA 1V8BA 4QWBA 1O4VA 2GCPA 3DE4X 3ZK9A 2D7DA 2NZUG 3OCXA 2IDKA 1FLNA 2CF5A 1NW6A 3QWHA 2X77A 2QL5A 1W49A 3BWDD 4O3FA 2ZTCA 4ABTA 2OKGA 2ZBQA 1XJ0A 2N1MA 5P8WA 3IE1A 1XMPA 1UBKS 3CRNA 1AZWA 2B6NA 3E61A 4Q05A 4XOUA 1CLEA 3GFBA 2HA0A 3LOPA 2GA8A 4ROTA 1ZOLA 4D0RA 4B9MA 1PJ3A 4UB3A 1UBRS 1ZM4A 3IIIA 3AWIA 3S99A 5IAAA 3I76A 2FI1A 4I27A 2ISSD 5CTAA 1XWIA 3QK7A 2JA2A 5L8VA 2R5FA 1KAEA 3K2BA 3LS2A 2YWDA 1KS9A 3PJEA 4ZI2A 4Z3OA 4CMJA 1SIUA 4UE3S 2D74A 3E9CA 1RMQA 1KORA 4KO4S 2E5LB 5B7GA 2E4VA 3SQLA 5DYTA 2YJNA 4F7WA 1JHPA 4B4WA 3C7AA 1C4KA 2XWSA 3EHEA 1N5DA 3OM0A 3T99A 4F2HA 1D03A 5ICEA 2WWTA 3W5SA 4AP9A 5JS6A 1LU9A 2VTBB 5ICGA 3EIFA 3FHCB 4H4CA 3O2QB 3DMYA 4TMZA 4TQAA 2CPRA 2AXPA 1MO3A 1EFUA 2LKYA 4LYEA 4MW9A 4R2HA 4B4KA 1SOMA 4EEKA 2DSNA 2ZP1A 4XJTA 1Y9JA 1T7PA 3F6YA 3PDJA 3ANTA 1X42A 1UFQA 1VA5A 1VI2A 2PLNA 1S0UA 3WBBA 3LQ4A 1PR5A 2MR6A 1GJRA 4NBUA 5LDHA 2VP2A 1SM4A 4CN9A 2OZEA 4AIIA 1K3UB 4M99A 5ALFA 4R8MA 5D3ZA 4BMPB 4Z3DA 3UCFA 2ZIWA 2A1TS 1CNMA 1HFKA 1NHWA 2EIHA 1A7KA 2QJTA 4AXBA 1K5GA 2DUYA 2AG0A 1NXPA 4XB1A 4DBLE 5JHGB 5CVVA 2V7VA 2W2LD 3BAZA 2YV1A 1RQGA 1W2GA 4WPGA 1CHDA 2LR0A 1P7PA 5L1MA 4HV4A 2IYSA 3F1KA 3LA6A 4R31A 2GCGA 3R7WA 4DWOA 4ZVMA 4KE7A 1K8RA 2HHWA 1IE3A 3BE6A 4U63A 2E1RA 1RDFA 3ORYA 2I4LA 5IT0A 3DJFA 4ZODA 4JBLA 3BT7A 3HN6A 3JV7A 4KV9A 3MBKA 4YCDA 1KL7A 3SDSA 2FLLA 4UOQA 4AN4A 4EECA 1V4BA 2O3JA 2ZQYA 4WOKA 2C0CA 4LVOA 4NMWA 5I9MA 1CZHA 3ZLUA 4MQFB 5KYXB 2QD4A 4RJKA 3HVHA 2PYZA 3ET4A 4H35A 5JRJA 3K8ZA 1IBMB 3SVTA 4FMCB 1KN5A 4EDHA 4ZHQF 2YQEA 3T3IA 2FP4A 2OLEA 1GY8A 4K2AA 1JTVA 5IMBA 5KFLA 4F7DA 2EF0A 2NW6A 2QN7A 4Q45A 1JNYA 1QHEA 1ITZA 3BQ7A 3ZDAA 3CX3A 3GFRA 3RS7A 4D1YA 4XA5A 5JAZA 1U7XA 4UZSA 5HDBB 3LBAA 1E60A 4AYBF 1HM5A 1NL3A 2RHMA 4GE0A 2X0JA 5DK4A 1QWSA 5BUQA 2QTAA 1U63A 1HEKA 3QI2A 4KH1A 2PWAA 2HSWA 3AFHA 4LE2A 3VC7A 2JLVA 5F1OA 1M33A 2BRUA 3ZV4A 4NM1A 3TCKA 5DNUA 2QLMA 1RCTE 5KVAA 1ECBA 2CFOA 2VYND 3TLBA 2OHFA 1KPGA 4IQWA 2X15A 1RI2A 4PGGA 3N2EA 5EEGA 3O8RA 4MKFA 1OE0A 1XCOA 3OPMA 4G81A 4E21A 4EVRA 3R3VA 1OKKD 5KVVA 2IKSA 5HOQA 4ZWNA 5LQJA 4D79A 1SBNE 3PV8A 2CJWA 2Q4RA 2P2GA 2GK3A 4IIEA 3VPDA 3KOOA 5KJFA 4X45A 4KXXA 1ID8A 4HB0A 5ALYA 3CPSA 1E9BA 2ZBRA 2QX7A 4NBVA 2BQRA 2YN2A 3V33A 3MFYA 5HR5A 2NACA 1KOGA 2ZB8A 3EQ2A 4ZI7A 2HHSA 3LTEA 5F7OA 1L6RA 4ZOHC 1MX3A 3CZ5A 5DXJA 3GZNB 1M2WA 4HNQA 3OTHA 3I5UA 4KLRA 1Q44A 2C3MA 2LBOA 3R5KA 2D2XA 4TQGA 4YDHB 4JT9A 5H7XA 4Q3CA 4PYRA 3CG0A 1FE8A 4ZV7A 4YUYA 2O2HA 4ZYUA 2FN4A 1VJTA 3VU1A 2DQKA 1N6KA 2WJ3A 4O2BB 5IUJC 4ZYVA 4WCFC 2Q6KA 5JJBA 2H63A 4HS4A 1DKUA 3KYIB 1ZIDA 4RVHA 1HTTA 1VPTA 4N0QA 5F33A 2P40A 3LBNA 3V42A 1Q1EA 3V8VA 3VNRA 4DR5B 4RPCA 1ZQIA 3WGQA 5CR0A 3HRKA 3CLVA 4NBLA 1EH5A 1VQ1A 1V41E 3Q8PB 4DCPA 1ZSVA 4IIGA 2C7QA 2PXIA 2ZOSA 4Q9DA 4Y18A 4UPVA 3NS1A 5AXCA 2ZWVA 5T4HA 4KL8S 1AS2A 1VC2A 1D8BA 1ZMBA 2FUEA 1CEZA 4HAVA 4MITA 5DTRA 2HJVA 4EG1A 5ITZB 2JGRA 4A7PA 5KDOA 3DT6A 3FG9A 5AUOB 5CDUA 3QKRA 5K8VA 3FYUC 4OOEA 1Z25A 1P2VA 2C59A 1USGA 2YFHA 3KKZA 3GGDA 3WNQA 4W5HA 4A15A 7ICMA 1FXSA 1Q0UA 1T5IA 4IH1A 1Q0TA 4ZI7F 2IH5A 1YRAA 3C85A 4HGYA 4UPDA 4AG3A 1I4DD 3VNVA 2ECPA 5JCOA 2XDYA 1NW3A 4UBCA 2GJ9A 2QT9A 4P4TA 4E09A 1IB0A 4G5RA 4PHCA 4DWWA 4DYVA 4DLTA 2QQGA 1BA2A 2B8TA 4NCIA 2YRXA 1ZQRA 4GVPA 4OA5A 4UJ5A 5FR2A 1PLLA 3THRA 4D4IA 5JOQA 4FR5A 4RHFA 2QARB 1DRUA 2JCXA 3P94A 3C7CB 2R60A 2ISOA 5LUBA 3L6BA 1GQQA 1Z12A 2X5JO 3A6LA 4PAOA 5BORA 2FZEA 2SCUB 2G0TA 4O0LA 3C3BA 5EGSA 5F2NA 1M2OB 1JDTA 3JZMA 4JL8A 3AIKA 3H7AA 5BQ5A 1XX6A 4Q12A 1C7QA 4JJZA 3H2ZA 4P98A 3ZDRA 4IQGA 4E7PA 4ZEVA 5FNZA 1DGSA 1RM0A 1UODA 3GVXA 4PWYA 4YTEA 5TXGA 1TT5B 1XYVA 2B25A 3A1VA 1DC7A 5LJLA 3OOYA 5B4TA 1U3DA 4KXFB 4ZARA 2QMEA 3ZEAA 5IKMA 1O1YA 1Z36A 4F3OA 1Z0AA 3AVOA 4R2IA 1YZFA 3U9LA 3X43A 1T15A 2AI2A 1B2LA 2C1EA 4QRHA 4RV4A 5DBHX 1WB4A 1X2IA 2CLLB 2FSHA 4ON9A 5ER9A 5EWJA 3LK7A 4DMCA 4PQYA 1CUIA 4EYKA 3RYCA 4MVYA 5JSZA 1JTEA 4HPWA 1SB9A 4E08A 1BPYA 1Z6QA 3AO0B 3PWTA 2BGRA 2EBWA 3HLKA 8ICIA 1ZG3A 1Z2DA 2V5AA 1A6SA 2VPIA 1T5BA 2VRNA 2ZRHA 3G2IA 4QLAA 5ENDA 4HUTA 1U7TA 3OUTA 5HM6A 3TZLA 1WHSB 4RKWA 5A4AA 2R1VB 2RP5A 2ZR8A 2AFIB 4RAOA 2PT5A 2VAVA 1RLMA 2A57A 4E88A 4YUVA 4FTWA 5KSZA 3H4BA 4K2HA 4Z49A 4I9UA 3MBYA 1GQRA 5COBA 3RIEA 2F9FA 4E6EA 3QKSA 3P32A 3IEVA 5J2EA 1MFPA 4NC9A 5E9JA 4O8CA 5BR1A 5HXAA 1R4ZA 2R6HA 3LBHA 3P0JA 4L5IA 3S7ZA 3SJUA 3U62A 8ABPA 3HH8A 1P77A 4HH3C 2O2IA 1O9HA 2E18A 4RY0A 2XSZD 4XW2A 3A1EA 1SCNE 4OXKA 7ICKA 2JS7A 3KVYA 3LH5A 3TLGB 1L8OA 4R16A 2O2CA 4IVNA 2DH5A 3HR7A 4JBYA 1Q15A 3T7DA 4B8ZA 3HKCB 5B4VA 8ICCA 2CMKA 1J1UA 2OBYA 1G5IA 1TEHA 2BF4A 4RQ8A 1BPEA 2H1CA 2G9UA 2QQFA 2YJ4A 3K16A 4V2IA 3WQBA 4I9NA 4DHEA 3K6SB 4V0OA 2WWHA 1I2CA 3E9NA 2XRMA 1SV4A 3RIHA 1QS0A 2WTUA 4AMZA 4OK6A 2QLNA 1V8ZA 1OAAA 1EX9A 1EGVB 2BISA 3LWBA 4L5YA 1J8DA 1HDEA 1ORRA 2CDCA 5J43A 2VHXA 1UXKA 2BHTA 2FMPA 2CL6X 3WMGA 3JPYA 3IH5A 4DZTA 1XFDA 3K4GA 2Z30A 2Z3WA 4N5LA 5CEJA 4EGJA 2HHHB 1E9EA 4F5OA 1R8XA 1UZLA 2PO5A 4E5PA 3AU2A 1QC5B 1QK5A 4CKWA 1EFAA 3T15A 3EWAA 3ACBA 3AG6A 2W98A 3GFGA 3A0RB 3QEOA 5HCUA 3WP1B 3OPYA 1T2UA 1P2BA 3GJQA 2QM0A 1K6EA 1LZKA 2VJ5A 1ZQPA 3NEAA 4HL6A 1SQ5A 2P4QA 3URMA 9LDTA 5JY1A 2XBLA 4L6IA 4TL9A 3B2QA 4W9MC 4EAAA 1K8YB 2W7OA 1BAPA 3BULA 4AF6A 3ABZA 3EIOA 2YKGA 1CS4C 1ST3A 1JL3A 4L78A 2JLXA 3K09C 4ZOLF 1YVRA 1UKCA 5D01A 5KAMA 4C4YA 4D43A 5JDIA 3ZD7A 2WLTA 3PY8A 4AMYA 1SCUA 4NJEA 4KIUA 1KH1A 3B1KA 4GXIA 3T7CA 2NYRA 1HWYA 2LCIA 3TM5A 2X9LA 5FRDA 9ATCA 1QVWA 5E38A 3DV2A 3H1FA 1GPMA 2WFAA 1X8KA 2J5QA 3MABA 2JCYA 4UUPA 4FGWA 5AUPB 3GJYA 3I64A 4JYZA 1XVTA 2HN9A 3S1AB 3SU8A 4NCHA 1QR2A 3A0BU 2J08A 3D54D 2AF3C 4ML3A 4PSVA 5EYPA 5LXTA 3IA2A 4W5TA 1UBSB 1I7LA 1YIAA 4OLHA 1EM6A 2ECOA 1S9DA 3GCDA 3V3KA 2IUSA 2VQDA 4NNOA 3B2NA 3QKTA 4QSHA 1XJCA 2ONJA 4UUMA 1QP7A 1TNDA 3DTNA 1Z17A 4FE7A 4M36A 1KKMA 2Q0ZX 1Z6TA 4QYTA 3IM1A 4FI3F 4XE5A 2GILA 2BSXA 4PV7A 2ZJOA 3OAAA 4E5SA 1O5TA 4E03A 3UBMA 4KUEA 4R7TA 1IYZA 3CB4A 5A2GA 2A94A 1YT3A 1S77D 3MMPA 3TAQA 1V5GA 1QCZA 3C3DA 2YHIB 3VR6A 2PKCA 3BSYA 3KWFA 4Q3EA 4RQ3A 3I42A 4B4VA 5LZ9A 3I4CA 3A11A 3KUKA 2IBTA 1MORA 5C46F 4NPAA 1V95A 5KX5B 2JHPA 4KSCA 2H4FA 4ITUA 4X6XA 1ZOOA 1RAFA 1NVGA 2AJBA 16PKA 3ONWA 5DNAA 3E70C 4Q37A 3A6DA 1X9XA 5L51A 2ID8A 1ZCFA 1SXJD 4YR2A 3U13A 2W5UA 4B46A 1DKOA 2CC2A 3C48A 5HZKA 2PUGA 4QZHA 3HKDA 2EL7A 1F9EA 1PFVA 1RYBA 4DLBA 2YWCA 2OB2A 3TTYA 4X0EA 2J0VA 4NCNA 1XQ1A 2Z5VA 1NVBA 3HK2A 4JXZA 3MLAA 5BSWA 4KMUA 1JDNA 5FYDA 4LOJA 3L7AA 3NVYA 4DA8A 1W9MA 2MSWA 3E82A 1J24A 4D8XA 4NH4A 1UJ2A 1QHYA 1H8HD 1WXGA 2ATCA 1GP2A 1X7YA 4WUVA 3HB0A 5P21A 3ZTTA 4EA6A 4FOPA 1Q6ZA 4Z7OB 3SMVA 3GLRA 3WYNA 4F21A 4WW0A 2JGLA 1RBYA 2WM3A 4YCXA 4F4KA 1DSSG 1GZUA 2QMHA 2Q0XA 1MJFA 3BXGA 3KO8A 1DVRA 3P7MA 4IPTA 1ULBA 4KDCA 3TNFA 4BNDB 4DNPA 5A9RA 1NXVA 3F4BA 4U7CA 1PLJA 1ENYA 1UXGA 2TMYA 4X97A 1H3NA 4LW8A 5C8DA 5J0PA 3FFXA 3H05A 2BELA 4KQIA 1D07A 3T7RA 3V00A 4AK9A 2ZUUA 1MH1A 2HVHA 1H4QA 1S2MA 3CU5A 3IURA 3O4VA 1EDEA 3IDQA 3ZE2B 3ZIAA 2FQQA 3GEBA 1BCRA 1ZQ9A 3UPTA 2I7DA 2Y27A 4ECAA 1R3DA 3CYMA 1V37A 8ICRA 2UYHA 2Y05A 1MSWD 3RTBA 8LDHA 1ZUD1 5EXSA 1R6BX 4YMSA 3NAGA 3W6PA 3FE2A 3MBIA 2C07A 4C7XA 2XCSB 3SM3A 1FCJA 3NDPA 4S3MA 4PVCA 3OHMA 4XJXA 3JWIA 1ZIXA 3D2SA 4B4DA 2GM3A 3B5JA 3NFYA 3F90A 1IH8A 4WXMA 4KLHA 1PZEA 4QU9A 4F5DA 4B83A 1RRKA 2PWBA 2YOGA 5EXDA 5EWMA 2Q2VA 1M73E 3GMIA 1XJWA 4RH0A 2BDEA 2HBQA 3WIEA 5AW8A 1P2GA 5GV8A 1WRBA 5I5EA 3C3CA 3OD1A 4J1TA 4GC6A 3MJEA 4B3JA 1LBHA 3Q7QA 5KFIA 5KQGA 2VYVD 4I1OA 1JMVA 4FCVA 4MGEA 1N3YA 2HDOA 2VSXA 3IP9A 4MVJA 3TQOA 5A05A 4Y2HA 4IIFA 2DERA 5KDDA 1WZUA 1Z9BA 1VL8A 2QM7A 2V3VA 1Y6GA 2QNBA 3RV3A 4H7KA 3VDNB 5KWJA 3H7IA 1Y80A 1ZVKA 4HAOA 5JMOA 5TGZA 2OECA 2P11A 1HG1A 3OFSA 3OOJA 4ID3A 4EJSB 2BGGA 2PWZA 4YV2A 2H1VA 4MUEA 4PW0A 4G07A 4DQ0A 3INTA 3V7UA 5CK5A 3ONEA 3FTQA 4YO7A 4JEMA 4XSGA 3UJ3X 4FB5A 3UB2A 3NHJA 4RLQA 2OV1A 4G86A 1KYIA 4HNAB 5KYTA 2WM9B 2WSSD 1HGXA 3FHOA 3TWOA 4W1PA 2F4NA 4DA4A 1FMLA 2AXNA 2JIBA 5ALSA 3RR8A 2C42A 2HK8A 3PMLA 5B3JA 1UP6A 2R25B 2XNJA 3K96A 3W9UA 4NP6A 4ZCIA 2IS4A 3PGVA 2F2AB 2V55B 2FW8A 3PP8A 4R3NA 4FE3A 1YI0A 1T3ZA 3ORFA 4NCAA 3IE0A 4NV1A 5KYYA 5EZYB 1U28A 4ZHQA 5D7NA 1GNSA 4DY6A 2NT4A 3RF6A 3BRWA 4LZLA 3M4YA 3LO8A 3VC1A 4DUGD 5JNUA 3EVAA 4J07A 3LU1A 4UB2A 1N6HA 2HQSA 4Q3LA 1SGGA 1PHPA 4RNMA 1JFFB 1ESNA 4OHZA 4YCMA 5A6SA 1UDBA 3I01A 5KG5A 5EWFA 4WJKB 2G77B 4JSTA 4OHKA 3PLAE 5K5EA 4PL2A 1OXJA 3R6GA 1EFKA 4WLUA 2GJAA 2IHKA 3GLFA 1TMKA 4XVCA 4KNYA 2O8BB 4KR0A 4QZGA 4MGKR 3UAZA 1X7XB 5AVXA 1ENZA 1QGZA 1XPOA 1W5EA 1PNRA 5DHFA 1CUHA 1DS6A 1JLRA 5IEBA 3VPBA 5D5PA 2ATEA 5CLFA 3L6UA 4DSNA 1ZQKA 2Z4RA 2EJUA 3QVGA 4BX9C 1NJ1A 4PX9A 4REQA 1F9AA 1B6GA 3FB4A 3WLNA 1D5CA 3FMPB 4KWIA 3MQ2A 2XTJA 4EYQA 3LYHA 1GYQA 3IDWA 1SB3C 1P1JA 1X6VA 2GD0A 2YW9A 2ZB7A 4B6FA 2OEHA 1Y7PA 1ZJJA 3KHUA 4I4TA 4Q9LA 1KK1A 1R4NA 2M6LA 3VDQA 3MTDA 4XM1A 1IEWA 1FY2A 2OBLA 3IDSA 1MG0A 4OP1A 5BURA 1B74A 4YAGA 2W2MA 3S8EA 4Q7JB 4U2EA 3WHIA 4KLIA 3GLHB 3NCHA 1I10A 4KVZA 1U7ZA 3LLSA 3T95A 4ZCMA 4K26A 4P84A 2E1PA 5J0OA 1PSDA 2AJ8A 1XHLA 2JATA 1K2VN 1MOPA 1OTXA 5EPUA 2IOQA 5C7IO 5KYKA 2NUBA 2P3LA 4JB0A 3L4SO 2FJPA 3EDMA 3P9IA 4RPJA 1KEEA 2JH9A 3FNHA 2UZ1A 5CCDA 1A9PA 4ZVQA 2D1FA 2IYZA 2NTNA 2YWXA 1YZTA 1BD4A 2BHSA 2H7CA 3GGOA 3PNKA 4QQKA 2HPHA 4IJMA 3IAEA 4JQCA 4WY2A 1BKYA 5BVGB 4NDNE 5EWMB 1Q3VA 3LKBA 1QRDA 4QXQA 2Y4NA 3L3BA 5FPKA 2G6TA 5DSTA 2C2ZA 2Q27A 4MIKA 5GADl 2XIDA 3U4IA 4XX0B 3KWJA 2LW7A 3X2SA 2VHZA 1VYHA 1JBEA 1KSJA 4NBRA 4F2RA 4ZVVA 1KR5A 1UOQA 2EFGA 1OGJA 2XB9A 3GT3A 1Q7CA 3L2OB 3OY2A 2QP3A 2KSQA 4ZOCA 5EL0A 4R63A 3WYDA 3AKYA 5LDGA 2ZG6A 4N03A 5HR7A 4HYYA 3K71B 1HTBA 4FXOA 4LNHA 4MEJA 2LYBA 2OCYC 1GD1O 3BDAA 3RH5A 1XTPA 1RAGA 1GCUA 3MJCA 1WD7A 1UOOA 2D54A 1MQ8B 3MPUA 5DWVA 3EUWA 1GDDA 4FB4A 2MTBA 4TZTA 4DDWA 5ESWA 1OXTA 2J6IA 3TTWA 3ANLA 4QDOA 1QO0D 5G0TA 3OSPA 5AJVB 4GPBA 5EUBA 1H8EA 3THXB 2PUFA 1IM8A 1KFSA 5T6BA 2ZRGA 2ZREA 2GARA 3TVTA 4TQSA 1I32A 3HKEA 4JFAA 1MQAA 1ZD2P 3K20A 1HIWA 3GT0A 4O2AB 5HP4A 3QWFA 2QPAA 1FZTA 4EPRA 1CVRA 3C98A 1LFAA 2WMOB 3GJSA 5BMVB 2PFPA 1BYIA 1VDZA 5D4BA 1CUEA 1B6SA 1LLCA 3AB7A 4Y0NA 4MEBA 4B87A 1VG8A 4HDMA 4EL5A 1WUHS 2SBTA 5INTA 2CE7A 3VR5D 2VATA 4L2IB 4KE8A 2BMJA 4X7PA 5J9FA 3QUTA 4HDMB 1U6JA 1G0OA 1IHDA 1SB8A 2WU1A 3BGWA 3DNFA 4MVJH 3FX2A 3I5AA 3JQBA 5EWJB 3SFTA 4P32A 1GXSA 5IJ9A 4DXDA 3BSFA 1N32B 5D3MA 2V97A 3JAKA 1YVDA 1BE6A 4XCVA 1X6IA 2NRTA 1NQTA 2NUTB 3RC8A 4BN5A 1GAJA 3C97A 1SXJB 1KQNA 1FOEB 5FWDA 4GZLA 3UUFA 4CEHB 3KVVA 1RKUA 5HF6A 1MGOA 4JBXA 2Z9BA 3VR0A 1GO2A 3T35A 3L0SA 1MJNA 3BWBA 4AECA 1AHHA 4NCBA 1A2OA 4P4NA 2C4WA 1CULC 2XNKA 4ERXA 4L4UA 1Z2PX 2N47A 4TXLA 2XODA 1YA4A 1V8DA 3I2KA 2JEFA 2POCA 3DCJA 4WFIA 1Q0PA 4WN3A 5DCWA 1D6NA 5JO0A 4M1MA 3AHHA 3AEVA 1I36A 3FPLA 2CZCA 3PJDA 5IK2D 5FFMA 2ZYWX 3A70A 4CIVA 5K8IA 8ICTA 1RWXA 2A0XA 4WBNB 3Q3HA 2C58A 1NV9A 3H2JA 2ZRKA 2P3QA 5GTHU 2LYAA 3EMKA 3O47A 3WS7A 5EE0A 2HQOA 4WKNA 3UOAB 3PX7A 5A0TA 2PWYA 2X4GA 1OF1A 1NPTO 5CX4A 2WQ6A 2R8HA 2ZRNA 5KOHA 2REBA 1L7AA 4W1RA 1H2ZA 3FW1A 4C8LA 2OBXA 3RS0A 4RQ4A 1RE1A 2BGJA 1T3TA 3QU9A 4JP2A 4AY3A 1KEEB 3F3KA 4BNUA 5IJZA 3W5DA 4J7CA 3NJRA 2J3DA 3VTFA 3GAFA 1OW3B 1XMIA 2RG1A 3ZE0B 2JFFA 3PVXA 3IR6A 4LA4A 4R1OA 2IU0A 3NOXA 1M6HA 5FOVA 4QJ3A 5ISMA 3D7SA 2JLAA 4EW6A 1WV0A 3L93A 2OYCA 1KF0A 2IZ0A 1S2DA 1ISMA 1QGUB 2VP3A 2XMRA 1H94A 1IHPA 8ICNA 5D3KA 4A1OA 4EMBA 1I7SB 3QZ8A 3UQ2A 4BEBA 3DE1X 3WBFA 3VDMA 3V8EA 1L5GB 3NBAA 2WE8A 4CU2A 3BSSA 4EO9A 3B48A 1MC4A 1N4AA 5IFKA 3SAFA 2E55A 3AR9A 4ZZ3A 2ZFUA 2XYVA 1TVKB 4CEIB 3BOSA 3VR6H 3AINA 2QD2A 4GRDA 3RHTA 1XOIA 2RE8A 3EISA 2FEXA 2W4MA 2C2MA 1MB3A 1W1IA 2VANA 2ZPTX 4O3OA 3ETCA 3HCPA 5F1KA 3Q3IA 3TBHA 1SUPA 1RI4A 4AAYA 4HPJB 7ABPA 3IMFA 3W9BA 4D4MA 3FM9A 1B0ZA 2DPIA 1YI1A 4ZCLA 3PR1A 2J3LA 4LY6A 1XJ5A 1UDCA 4C2TA 4JELA 1ZN7A 3PWSA 4I66A 4MUKA 4KR2A 5KOIA 1ADBA 4Q9AA 5LZ8A 3PX0A 2V6IA 3PW2A 5DHTA 2EJTA 1YCDA 1ZCAA 3EEFA 3HKCA 1EFVB 4I2DA 1A97A 1C50A 2EBHX 2WBLC 2DUUA 3C2LA 2QUJA 2A1UA 2XUIA 4OSOA 1F7VA 2E48A 2XXJA 1SC4A 4IXWA 1PR9A 2R6JA 3RAEC 1XLTC 5DRTA 3CTPA 3KJGA 2ZCJA 2ZTLA 2JAQA 1HDCA 1HC7A 2UVPB 3LDUA 1QR6A 1E8MA 1OUMA 4M9HA 4HNAA 4A8PA 3EXAA 3Q88A 2OGTA 1Z6PA 4I2BA 1QV9A 3A6GA 2AD5A 1SXJA 3HYNA 2F1IA 5EJEA 4P33A 2KHQA 1GILA 3ZJTA 3CVOA 2D5CA 4RW0A 5BUCA 3IHQB 1QUEA 1CUFA 3BORA 4DSLA 1WQ3A 2IE0A 3CUSA 3NHYA 2IQIA 4MSUA 1BVRA 4OGLA 4BIIA 4GWGA 4EF4A 3H1PA 4QZIA 1G3UA 2KMDA 3WAJA 1XF9A 3PEUA 4CMGA 1U4SA 5C7YA 1QYWA 3L0IB 2R6ZA 3ZWXA 2I87A 3W04A 4ZZ2A 3NHWA 5A5GA 3K6JA 1FLAA 2K6GA 3OFND 3RVBA 3TYXA 1H1DA 1Z37A 1MOQA 2H4WA 1KZ9A 2QDXA 2QTZA 3IUSA 3MYRA 3OMWA 4J43A 3STXA 3ISCA 4M9LA 2QDKA 3KKNA 2WWGA 5JFOA 4JUZA 2P90A 3HCAA 3SZ2A 3NXKA 3ORRA 3QOWA 4O4JB 3SKYA 2E7ZA 3M1AA 2OXFA 5EHZA 3G85A 4B6EA 2VSOA 3LK6A 3C8ZA 2A7QA 4I2JA 4JVSB 5JFGA 1NJFA 2CDNA 1A5SB 2CUTA 4G1CA 2H7YA 3AEKA 1U81A 2HI0A 2WJHA 4NNJA 5F5LA 1D1PA 3Q12A 5J2DA 2GM4A 3TKAA 2V0NA 5IHXA 1OC4A 3ALRA 3DEIA 1RWNA 4E4TA 4RD4A 2YB4A 1GPDG 4DLEA 3DW1X 3JVIA 4ZAXA 4ARAA 5K0CA 4ETWA 3IP7A 4DQQA 1MTZA 4KAFA 1JRLA 1U6KA 3A3OA 3UY4A 3NI2A 3ZI7A 2FPSA 5DYIA 5H4HA 5JXHA 3R75A 2PZMA 1PWXA 3LVFO 3NATA 4TQRA 3EPHA 2HBJA 4E94A 1A8QA 3A1NA 3BE5A 4JV5B 1IEXA 5F2EA 1OBCA 3HVIA 4PHAA 4MWDA 4QASA 2XDAA 1UPFA 1S1CA 1UPAA 3E18A 1J0EA 3SFVA 1OB2A 2PAFA 4CN8A 1UDXA 5T4FA 5TDHA 4QWWA 4EITA 5I8WA 1Z3IX 4EPTA 1H05A 3A4YA 3HCFA 4K6HA 2ZIFA 3UB4A 4WJZA 4CYMA 2ZJ8A 4IGAA 2HXGA 1IQUA 1OXMA 2ZJZA 4XDHA 3PCRB 3T5GA 4DL9A 5C31A 3C1TA 1OFUX 4MYHA 5C18A 1