4P0QB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
334
structure length
284
Chain Sequence
b'NAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
total genus 82
structure length 284
sequence length 334
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0qB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0qB01
2BHNA 4P0PA 2M9MA 2ZIXB 4BXOB 2JNWA 2ZIWA 4P0PB 2ZIUA 1J25A 4M6WA 2ZIVA 4P0QA 2A1IA 2BGWA 1J24A 2ZIWB 2ZIXA 1J22A 1J23A 2ZIUB 4BXOA 4M6WB 2ZIVB 4P0QB 2JPDA
chains in the Genus database with same CATH superfamily
2KSOB 5CHEA 3ZNPA 3B7GA 1V11A 1BVYF 1R6BX 3C5FA 2FJ0A 2HHAA 3P94A 3IVAA 5IINA 2EEPA 1GTMA 4RPHA 1VM6A 2I3BA 4BBPA 3DP9A 2FSFA 2VDNB 1G2PA 4IVNA 4JT4A 4RK4A 1PGOA 2Q21A 1WXWA 3RS7A 3CKKA 3UUWA 2QD5A 4RF5A 3HA7A 3LY9A 1KDOA 1OZHA 5HS6A 1SVWA 1CZHA 4L8GA 4D46A 2FP3A 1N8KA 2P9GA 2DPLA 2JASA 3NTLA 1QX3A 4X92A 1CP2A 4EUHA 8ICXA 5K6AC 4B2IA 2EDUA 5JVDB 1AQUA 1ZVMA 1PR3A 1PT7A 3QFFA 1XL0A 3HPOA 3LC0A 4QGBA 4L9SA 3TO5A 5B36A 3TAPA 1W5FA 4NPCA 3QELA 1MPXA 1F6DA 1WOYA 3EF0A 1UR5A 2PDAA 4DPLA 5I7WA 4U2KA 3U0VA 1I4OA 4IJKA 3MGIA 1NVMB 3G89A 3ETLA 4TLCA 1ZH6A 3NGLA 3ZJ5A 1XC7A 2HHTA 4ZOBA 3BD9A 4C0KA 2HJHA 3IHTA 5F9HA 2PFPA 3W9BA 1B6GA 3Q8PB 1A4UA 5KNDD 3D3EA 3LFTA 3VDRA 3O8QA 5IVIA 2GSWA 5M29A 1I80A 3NTOA 5EP2A 5B7GA 4QATA 1S96A 3UK1A 3GGSA 3ISDA 2QZJA 2VYNA 3U40A 1JLLA 3K0BA 4MULA 3FHLA 4FDMA 3M6AA 5I8PA 2FUCA 4F2GA 3GA0A 3H5IA 4R0VA 4YO8A 4H3VA 4B2YA 5KG1A 1L8XA 1PGJA 2V4MA 3KOMA 4LY0A 5JWRA 1OB2A 2FPGA 5IYZF 2OCKA 4GDFA 4GWKA 1AK1A 5FPHA 3DVAA 3O4FA 4LRQA 2ZBDA 3DWFA 4PW0A 2CT8A 1AN9A 4O4IB 3RYCB 3JWJA 5EHQA 5C2JB 2NXCA 2RGBA 4RVFA 5AHWA 3ORQA 3V9AA 2BFDA 2XJ4A 2XI9A 1VMIA 1CZRA 4QO7A 1A9OA 4CTOA 3NV7A 3HYCA 1NR5A 4I6GA 4KMSA 2FLNA 2QMUA 1QOPB 4JQOA 3LM8A 1A8QA 3SLRA 1QP4A 2I6FA 5FWDA 4TT8A 4TSKA 3KYIB 1ISRA 3I1JA 4EYQA 1J2RA 4WJLA 2VAPA 4U7JA 1U3DA 1X7GA 2HH9A 1BDHA 5EMLA 3SBEA 2FRVA 1GSHA 4UM9D 3CG0A 2V0NA 2FSGA 2JFNA 5GZ6A 4EDFA 3CYMA 1YOVA 4MW2A 5JG7A 5IM4F 3GUZA 1G2IA 2Q8QA 1SHZA 3ILHA 2GMWA 3EVCA 4BO8A 1PJBA 3T7RA 3P4XA 2PX0A 2Y77A 3R8XA 1Z38A 3COVA 1W5SA 1PFYA 4R9SA 3LYSA 5DHRA 2E4UA 4V38A 4CWAA 5A4DA 1MO2A 2P2CA 3TWOA 1FRVA 2PLAA 3W9UA 3ROGA 3JAKB 4PH5A 1EFLA 2I1LA 1O87A 3LF2A 5TRTA 4CFZA 4IGFA 1I5EA 4BKOA 3UWKA 4C7VA 1MOSA 3SR3A 1FMFA 3GFQA 3FG9A 1TKCA 4IIYA 1YE3A 4CLEA 1DAGA 3D2AA 4C06A 4N5LA 4ZOLA 5JD3A 2OZKA 3BCUA 2H4WA 3V97A 1NV8A 2JAOA 1JIQA 3BXXA 4WFJA 3SZRA 3EPKA 2HDWA 2GXSA 4LWZA 5E3IA 4YP5A 1H4SA 3WXBA 3NFRA 4OXQA 1TEZA 2ZU0C 1KI4A 4REOA 2RHHA 4O5OA 2JZOA 2QRVB 5ILGA 3ZIUA 1L6RA 2O2CA 4RUAA 4FUQA 7ICUA 3H2JA 1UBRS 5HIMA 3F9RA 4JV0A 3JQBA 4I3FA 3TDMA 1YHNA 1RCTE 1R8JA 3OIVA 4M9ZA 1E0KA 4JYAB 4F7DA 2OHHA 1WTAA 1Q1EA 4HAVA 3NHZA 5E3JA 5ALFA 3K9GA 1XDDA 3HGTA 4TZTA 3WAGA 4RQ3A 1TK0A 2JCGA 4WHMA 4HMQA 4PCLA 4RTJA 1EGMB 1RWXA 2P9FA 5D84A 4FFNA 3BVPA 2YYAA 2P2ZA 3DMFA 4LDZA 1ACJA 2JFBA 4R1NA 1WKVA 4RPJA 2CFCA 2QTVB 1SUDA 4WINA 1E6KA 1KERA 1P60A 2C5FA 3S2UA 5TMEA 1IWBB 4H1VA 5P8WA 5JOQA 5J2BA 2NUBA 4LS3A 3VMMA 3OUUA 3MLBA 1S8NA 2PFKA 3AY3A 4F50A 3F97A 3LOUA 3O73A 3ADKA 4P38A 2P9YA 5JLAA 2YZNA 5EUCA 2KZZA 5EJ8A 5E9JA 2J67A 4YGYA 221PA 4AWAA 5AVJA 2V03A 4O4JB 3C2MA 4M9NA 8ICJA 3A4YA 1Z83A 5FHRA 1JEAA 1G21B 4BX3A 3OE7A 4MTCA 3ER9A 3IDWA 1GNQA 3EXHC 2RI1A 4N7BA 1OBCA 1NG9A 5B4UA 2QUJA 3HN6A 4BQOA 2BM8A 3D2LA 3HBLA 1P4RA 3FVWA 4OSOA 1Y1QA 1COOA 2EJVA 1J70A 2WYIA 4KQXA 3QKRA 2VYCA 1KZGB 1VTKA 4GP6A 4BKPA 2E55A 5AFSA 4E22A 2DPIA 1KNQA 4L76A 4FIDA 3AUFA 2D6FC 1FJHA 2O8FA 2A8YA 3M70A 4FNOA 3MJDA 4A36A 2DBZA 4JT9A 5FO1A 1JDVA 5T41A 3E9DA 4IOMA 1QGUA 2G1UA 1ZJZA 2HADA 3THWB 1XU7A 2H59A 1AZLA 1Z28A 4OA5A 2JHPA 3DZCA 3FPJA 2VA9A 4H1TA 1MJGA 2ZRPA 2NNWB 1DJMA 1CIJA 3TOCA 3L2OB 5K6RA 1HRDA 2Q3FA 1IXYA 1T1EA 5CFPA 2JLXA 1WDMA 1KO8A 3KLBA 1EK0A 3T06B 5EPUA 1YFJA 3ZU6A 4TMKA 2XQVA 5IJZA 3ZWXA 1G1AA 3PKZA 1UA0A 2E3JA 2EW2A 3VO2A 1S2NA 1NMZA 4BATA 5CB0A 2NPFA 5BT9A 3VOBA 4ZVPA 2QTHA 2H0AA 2O8DB 4EMSA 3SK0A 3VPXA 1MNAA 5JALA 2Q1TA 2I66A 2XBLA 5EESA 5KYNA 1NIJA 4HDSA 3KUCA 5HM6A 3OVMA 3KPYA 4TZ0A 3QVUA 4KIGA 1YRYE 2VBIA 4UE6A 4F85A 4HQOA 2IU6A 3ETJA 5DRTA 1Z7EA 3N39C 5DBFA 5E8RA 4I8DA 4WXMA 5JSZB 3FLEA 3K9FC 3EPGA 4B45A 2Y8EA 3H1TA 1C5KA 4IHQA 4LCEA 721PA 3R0XA 1L5NA 1WDWB 3I3OA 5LBIA 4ELTA 3AFMA 3PJRA 3PSHA 4JV5B 2PNFA 1SUIA 4MVJA 4MS4A 4JENA 1TK9A 2SKCA 4Q02A 3G68A 1RLMA 3FPSA 3JALA 3SF0A 2G77B 2WVAA 3CUEF 4RTKA 1T3HA 4NLKA 4LNUA 5LQDA 1KMQA 2QB0B 4CKWB 4LYAA 4FYVA 4G1FA 4AXXA 1P7PA 3OM9A 1XG5A 4FS8A 3O1LA 3UATA 3LKDA 1JAZA 1N8NA 3UENA 5K0NA 2IX3A 1ZXBA 1I2DA 2W42A 3QYPA 4OQMA 2RQ5A 3HDGA 4ZHQF 2DQ4A 4UEWA 1HO3A 4NULA 2AG1A 2I2AA 4RTNA 5DB7A 3LRXA 1QRSA 5E4FA 2Q3LA 2DUWA 3R8FA 2FPWA 4OXNA 4PG4A 5T7BA 4EF4A 2PX6A 2P78A 3PD1A 2QNBA 3E7WA 2PKRA 1EA5A 3FZYA 1CZOA 1V8BA 4C76A 4QU8A 3COWA 3T5BA 4C0WA 2Z2YA 1P1HA 3WFIA 3BCRA 1IM2A 3AJ9A 3WGYA 5AUPB 1G42A 1ZQJA 3LQRA 4NOJA 1TKAA 4Q43A 4YCLA 1QYWA 3ZY6A 4DA4A 3ZCPA 1ZIXA 4Z4GA 2E1EA 4ES6A 1QVWA 1TO6A 3QG1A 3E2PA 1FUIA 1U28C 3QU5A 5BOLA 1R18A 3OTQA 4KOAA 4B09A 2FNAA 2ZAOA 1MC5A 1IVSA 2EWMA 2QSZA 3E5RA 4TN5A 1XPRA 3W5SA 1BIFA 4RA6A 2XV1A 2ENUA 1PQPA 2GLEA 3FDSA 1E7WA 1QHYA 2ATCA 1OYOA 4C05A 1FDOA 2AGPA 1A76A 1NK6A 4IMJB 3TLCA 1SQSA 1OCEA 1XJWA 1GTRA 4Q4AA 3K20A 4OXKA 1L7NA 4MUFA 2WU0A 1YZUA 2R8EA 1JMYA 1F8UA 4KDEA 4UNIA 3DULA 3MN1A 4H59A 3V4VB 4WFKA 5TPWA 3E9RA 2FR8C 4R31A 3L7OA 3VKFA 3KFLA 4AS3A 4CEIB 1RI1A 1QIKA 5DX0A 3BCHA 1YCFA 4K2AA 2IDJA 2B0CA 1ZK3A 1TC1A 3LBYA 1E3MA 4KUEA 2C84A 1IBLB 5AW9A 6NULA 1Z12A 4NDAA 3BEOA 2A3RA 4ALLA 2FZLA 1LF0A 3ICCA 5BR1A 3HNRA 4P7BA 5IZ4A 4XARA 2F4NA 2G5PA 3IMFA 5LU9A 2Q2QA 3NH6A 3IQZA 4RWEA 2XUQA 3QLUA 1M2VA 2GB4A 2K87A 1N2SA 1O57A 3RVNA 2GZMA 2M2IA 3F74A 4N9WA 2QZPA 2NAFA 4R63A 2X19A 3P97A 5BWLA 5DCYA 1YR7A 5AKXA 2OZLB 1MR3F 1JRPA 1YWGO 2OXRA 4Q1BA 1L4HA 1CEQA 3ETHA 2I33A 3LD9A 2CLCX 4EYOA 2RONA 2ZLBA 2NRWA 5EIXA 4Q7QA 2YMMA 4MOWA 3SM3A 1V25A 2XMQA 1KR2A 4MCJA 4PLFA 4M7PA 4TWBA 3NU1A 2HRQA 2FWRA 2JIPA 2J3KA 5E6UB 5CPFA 1VJGA 3MK31 1U9IA 2APJA 2I3AA 3GRFA 4B4OA 3M82A 2WTAA 4PN7A 4BMOB 5F12A 4OD0A 1VHQA 3LZCA 2JL1A 3PX2A 4DVGA 3GT7A 1GR0A 1PK7A 1GQRA 1UQTA 4J0EA 4RK0A 4A1FA 3W90A 5KFAA 3G0GA 4GDMA 4TXLA 1AQNA 3EUFA 2WHQA 4B6EA 1U80A 3M5PA 5FBLB 1NXXA 4C7XA 3L77A 2ISOA 4QBGB 4Z4QA 3EJWA 2JEZA 3HKZC 1FYWA 3B36A 2M6KA 4MR9A 1OD6A 1DC3A 3HPRA 4L5YA 2FQ1A 3KO8A 2I29A 1KFCB 3AUAA 2ONJA 2MSNA 2K7ZA 2BF7A 2C9CA 3A58B 3AFOA 1YR9A 1LNZA 2ZETA 3Q2OA 4G1MB 3KXKA 2GJAA 2HU2A 1IWPB 3VH3A 2PQMA 4IRUB 1XT6A 4PLTA 1T91A 2YXBA 2C0PA 5CX4A 1LXCA 4WKOA 4CT0A 3RSGA 2PSSA 4R3WA 5DN9A 1L3SA 4X8HA 1YBVA 4TKZA 2XRZA 1MAAA 2Z30A 1M72A 2PMZC 2EQ5A 4PO1A 4M21A 2UZ1B 2N0SA 5H3CA 2J6UA 2TYSB 4E15A 4LYEA 3KXIA 2PZMA 3M4JA 3QUCA 1F20A 3TJRA 3S44A 1DBWA 3RBZA 1FMJA 4UFPA 2GHQA 1TK2A 5F9NA 4C0LA 2HF8A 4O4LF 1RRMA 4MO2A 4RVDA 1NK7A 1A7JA 2W48A 3HQ4O 1Q7RA 1J1ZA 2XVYA 5B7PA 2L5YA 2C8LA 5L1KA 1E3LA 2WVJA 3E9ZA 1DVRA 3PUVA 5CR0A 1BNOA 3MVEA 1VYUA 3DLBA 2DTXA 4ZREA 4BKQA 2AFHA 2ZUWA 1SIJA 1CJTC 4NU6A 4QJIA 2C2YA 1QF7A 3JQ6A 5ALRA 2LTAA 3OWXA 2H51A 2XODA 5EYPA 3KHUA 3PNSA 2W6ID 5ITVA 3JAMA 3SHTA 2QVYX 5CLHA 2ZJ8A 4K87A 4S1VA 4AECA 4EDHA 2JG3A 2Z6UA 4L4XA 4MGHA 4Z3KA 5IEBA 5K51A 1DK3A 2BTQB 3SJ7A 2ZSBA 3KQKA 3TNLA 1KEEB 1CF2O 2YQZA 3KG2A 7ICEA 5E1MA 4ZKDA 3TEFA 1RBMA 1X1AA 2XYGA 3FCSB 4CIDA 2VKQA 2OOKA 2I4LA 1TZBA 2YNMD 4NH0A 4K6CA 4BVJA 3IA2A 1BOFA 3ANSA 4QYXA 3DKKA 3LE8A 5KYWB 1MD9A 1W8DA 1UJBA 3D9QX 4FTWA 2FSUA 2F8TA 5M5BA 3AX6A 4XDGA 4R51A 1YIOA 2YYYA 3I5AA 3RJMA 4KLSA 4B6FA 3BZWA 1E61A 2HK7A 1NKVA 2CMHA 3DV0A 4PFSA 3CRQA 3LT2A 2V96A 3UB3A 2ZIVA 1KDYA 1QR2A 5LNK1 4U3JB 4E5DA 5K0EA 3TTVA 3GP3A 5NLLA 2PA3A 1T3NA 1FXUA 1FPMA 2V3WA 5DK6A 5IAGA 3C23A 3CZ5A 4EUSA 3H2IA 1QHHA 5BMOA 3QKSB 1DBSA 4GPIB 1YQGA 2JCSA 1RAIA 3Q0IA 1Z6PA 2H7YA 1N2XA 2V7EA 3TDKA 4YCAA 1VE7A 1URPA 2FK7A 1T9GS 3R76A 3MTIA 1DP4A 5K3BA 1UCVA 1AD2A 1KSPA 3T5GA 1CUGA 1V1MB 4Q8FA 1RYEA 3RJEA 4BPRA 2V7QA 1QDUA 2NN3C 2PXAA 4RZ2A 1H1TA 2W70A 1SIBE 4XQGA 3KM0A 2DLCX 5BN4B 3FLMA 4FDVA 3PZBA 5B1DA 3K0FB 3RVJA 5D87A 2QK4A 2J7PA 2OG2A 3GIJA 1TQ2A 4Z6EA 4C4PA 1R9GA 2BR5A 1BKYA 3GP5A 1VCNA 1SA0A 4QOGA 3S8EA 2WU4A 1QHIA 2OGUA 4JJ8A 3GHHA 5G0WA 3PUHA 1D5WA 4KIFA 5K6TA 3PMLA 1DZIA 1IZZA 1E1RA 3NC0C 2CY0A 2O5EA 4BZPA 3KFVA 5G0VA 3OQVA 5KFQA 2HC9A 1L4MA 2VBGA 5E0OA 4AKTA 4D92A 1F3LA 2JGMA 3NVZA 5A6VA 1E9DA 1E2QA 1PS8A 1UKYA 1N7HA 1TOAA 4DYVA 4PC1A 5FL3A 3RPEA 3IDAA 5J2EA 4YASA 4ZT3A 1G9XA 3S2EA 2CB9A 2V54A 3DBHA 2BMVA 3H11B 5F9FA 1K7EB 1MQ2A 2LCFA 4IRCA 1WUTA 4DLPA 1RE0A 3ABIA 4BX0A 3PW0A 1ZD5A 2FY8A 4RQTA 1DIBA 2YWHA 2RG1A 3W2TA 2FW0A 1J33A 1G20E 4LRWA 2R1UA 5CCXA 3LQKA 1P17A 3QI2A 2BKEA 2WTNA 1CRWG 3UBTA 1YMUA 2V4ZA 1QYVA 2YMQA 2KNJA 4YCXA 3HBFA 4O4JF 2Z5GA 1F48A 1UPCA 5IT0A 3OKCA 2D1FA 4XQ9A 3MPOA 2B1RA 1FBNA 4ZTUB 2HBYA 3HMKA 2AOVA 2G80A 2FV8A 2I7TA 2COKA 4G0NA 2BJWA 3O8OB 5T64A 9ABPA 4YECA 3D3QA 1JROA 4ECEA 2VOEA 4Y1EA 2J3DA 5BMVA 3VR4D 3EQ7A 5K5EA 3SSMA 2QRZA 4GOKA 3ORFA 3LLSA 2OEPA 4LHYA 3PQ7A 4Y2SA 1S02A 3DL4A 4EY5A 4LC9A 1D9ZA 3F53A 5EINA 4NMXB 3IQFA 4EA8A 1AB5A 4AZWA 2PK3A 5BV0A 3M2TA 3IJPA 3L8CA 3FVRA 2IDKA 5JC8A 4N0MA 3VU3A 4F7WA 2B8JA 3MTJA 2KQUA 2XYPA 5TMBA 4DQDA 1ULBA 5JO0A 1HQCA 1WKCA 1RTTA 3N7RC 4H15A 3W5CA 1Z0DA 1IJBA 1QNLA 3KOWA 4C8NA 4AMZA 3VNAA 5JBQA 1PK1A 4DIMA 4Z3DA 4EOGA 2DVMA 1EG2A 3QU9A 2PWZA 4A2CA 3F6SA 3CE9A 1RHJA 2A4MA 4GX1A 4EZ9A 3A4TA 4B6JA 1QH8B 3CEPB 3SI8A 3QWHA 2PD4A 4UQOA 1TC2A 1W73A 4HADA 1ABEA 2PKXA 1SRRA 4LYGA 2IYNA 3OT4A 1V5EA 5HVNA 1WZEA 2GPTA 1NVVQ 3PQ2A 4QLAA 1ZA2A 4ESEA 3KOZA 4IJ6A 5CXXA 5HTKA 2VRWA 4UHFA 4IQTA 1JHZA 5IYZB 3WHKA 1GNLA 1IBRA 3OOHA 3TIXB 3ZIAD 3IE2A 2V7XA 1RQPA 2O3SA 4KTQA 4I1RA 1SK8A 4M8IA 1C1DA 2SBTA 2ZAIA 2ON6A 4Q18A 5AOVA 4KLFA 4QLBA 4HPJB 2OD2A 3FN4A 2D0PB 5ELMA 1AHPA 3PGMA 4BE4A 1QAOA 2ONYA 5KBYA 2P5TB 4XAQA 2RHMA 2IY8A 3A2LA 3TXYA 5T4EA 3FWYA 3OQ1A 3WGQA 2HF7A 3WSTA 3PU6A 2AX3A 1YHYA 5J2TF 4C7MA 2YHSA 2JHDA 5JWOA 4UM7A 3CZ9A 3AM4A 4G65A 3AXSA 2OYCA 3IP1A 5BSWA 1NLZA 3AIKA 4OOEA 4DGQA 5ALJA 2O8CB 4LC1A 4B8WA 4QRIA 3K9HA 5LDDC 2UZ4A 4AC9A 3ED1A 3DE4X 3GLIA 4B44A 5JMOA 1QP8A 3GRAA 4LRUA 2JKZA 3K8OE 3QHAA 1KBOA 1PR1A 3D7MA 1Z22A 4C1NA 3C0KA 5TF0A 4TTTS 1Z2OX 4YR2A 5GTDA 4BECA 3BDAA 3EXFA 2OGSA 4NYIQ 2BZSA 5D46A 2RDJA 1R6VA 4KXQA 1LFDB 4OA8A 5FTKA 3V3TA 1T2NA 4HAWA 4DSKA 3KR1A 4D9JA 2PY6A 1N5LA 3PLRA 3HFRA 1KVTA 3U9SA 1WMSA 2H5IA 3AHFA 2AGVA 1ZW6A 2WWRA 4XA8A 3ZWYA 3BWVA 5EMMA 4TYNA 2Y93A 3PIRA 2BGJA 2D1QA 5H0IA 3EEYA 3SHFA 4CDNA 3GN2A 2ZTDA 2Q6IA 1K5GA 4WZBE 1ZJJA 4ZO8A 2SHKA 3SZ3A 4LVUA 3E8MA 3WJ7A 3R3YA 3S70A 5JWHA 2H63A 4G81A 1JYSA 4ADSG 1X7XB 4R41A 1AHNA 4LJ6A 1THTA 1VPEA 1N1MA 2WKWA 3BJZA 3RAXA 4DZTA 5B3JC 4RLSA 2FFBA 4EJFA 5K4HA 5ECYA 1RZUA 1VMKA 2AJTA 2CYAA 3JVEA 3H6KA 4FOSA 5JNSA 4RSHA 2HF2A 1JTEA 3AOEC 3M34A 1TVKB 5EWJB 2B6NA 3U4QB 3AM1A 3I62A 4GGPA 1BGWA 3ZD9A 1VIAA 2UVPB 2PUAA 1G291 1HQDA 3ND8A 4DB4A 3CF0A 3FSGD 3EVZA 3NEPX 1WMBA 3NORA 4Q9LA 1CNFA 2GLTA 4EGAA 3OFND 1DADA 2H7CA 4GVLA 1EWRA 2B83A 3H0LB 1KDZA 3HKEA 2KPOA 1M6WA 3BX1A 1KWKA 2OVFA 2GZRA 2UUOA 2GYUA 2W04A 1X7HA 3L0ZA 3QQ5A 3H84A 1WBBA 3IAUA 4ER5A 4WDRA 4WNYA 2JBWA 2WTFA 3MTGA 1OBHA 4C88A 2RDMA 2AXNA 4TV9A 3DAHA 2JJ1D 1Z47A 3GFPA 4ODIA 3GLRA 1XU9A 5A3SA 1KJJA 1AS0A 2ORYA 1Y1LA 1Q1BA 2DL0A 2GA9A 3UJHA 1HPLA 3OE4A 4Y0NA 1K97A 1DV1A 2AF3C 2FPIB 4F86A 1PFGA 2W2VA 4X60A 1EGAA 5CAEB 4B2PA 4L28A 2PTGA 4R5HA 5JNTA 4OHPA 3KQPA 5KYGA 3E5HA 5MGNA 1MAUA 4FCWA 3DAYA 4RYDA 3BRCA 3FCAA 3T94A 3W05A 4WCFB 4Z1MA 2OQIA 3ADPA 4FDTA 1SR8A 4JR0A 4XIIA 3AY7A 2HHJA 3P0EA 2GXAA 1FTWA 3E6AA 1H42A 2X3UA 1PTKA 3X44A 1RACA 3QU7A 1TB4A 4FZ5A 3EIHA 2JFXA 3L6OO 3DOEA 2OAQ1 2E2WA 4OHOA 5FNVB 4MRSA 2F2TA 1NVBA 4HYYA 2IIQA 2WWYA 1WO8A 2A0WA 1XEXB 4U6PA 2BSAA 4P0PA 3BH0A 5H5JA 2H06A 1F1BA 4LZJA 4QOEA 3RU7A 4BP9A 5JPDA 1FYDA 3ZU2A 4Q3OA 1S77D 3H5NA 3BT7A 3GPIA 1CUZA 1G8SA 5D3MB 2GZ2A 3TEJA 2Y1FA 5C8XA 1LNSA 2PYDA 3ZNOA 2ZI9A 4QGAA 1X15A 4DS4A 5IBQA 5F3RA 4NS4A 4AF6A 5A6SA 4N4AA 1DWPA 1R6UA 2ZQZA 4S24A 4RQBA 1E1QD 1QRDA 2ODNA 1GCAA 4L02A 3NAMA 3WBKA 3DCIA 2ODTX 1NI4B 3JPNA 1RZ3A 1W96A 4CVNA 3UQYS 1Z56C 2DKZA 2IHYA 4HH0A 1M0SA 5A5VA 4Q4JA 1EM6A 4PZNA 1NX6A 2GN1A 3DBRA 3BRWD 2H1SA 3PXDA 4AT1A 1SU4A 1EVIA 3DDCA 5J2KA 3GJQA 3GP8A 2QMYA 4QM6A 4F0JA 2E8NA 5HKKD 1VCIA 5EOVA 4F8RA 3IG8A 2OV4A 1K6EA 1OVGA 1CSEE 2W7OA 2EAOA 2IOFK 2AQHA 3LX5A 4NCJA 3MFQA 2CYCA 2NSDA 3RVLA 3OQIA 2XVMA 4Z2YA 4Z1OA 4IDDA 2G82A 5FBQB 3VXKA 3TCXB 1NJXA 1FFXA 3LBFA 1REQB 1AGNA 1G3MA 4L8VA 1JI3A 3N9IA 2YS7A 4GVXA 1OILA 2WB1F 1X7ZA 2Q7OE 1VLZA 3WMFA 1JDJA 2I71A 3UYLA 2FXIA 2JA1A 3MCUA 4KR0A 3EDMA 1E5XA 3HYNA 2IOYA 3H5LA 2XQKA 3WB9A 2OCEA 4ZRNA 2JFOA 2OZEA 2I03A 4U2GA 2VTBB 1Y5LA 4Q9IA 4B9AA 5KYUB 2Z6AA 4YJ3A 2WG2A 2J48A 1VOTA 8ICVA 4EUEA 1AZWA 3GAZA 4GSKA 3RT1A 3RIGA 4JUIA 4XDZA 2IKQA 4TLDA 4ZHQB 3QOXA 2DOKA 5TQ2B 3LF1A 3AIOA 2JAPA 3LPCA 5CPBA 5LA6A 2C77A 3I64A 2R3SA 4BC1A 3SV4A 4BLSA 1I1HA 4QPZA 3MCTA 1V5GA 4TMWA 2PE5A 1YZ3A 3A2NA 4Z7OB 1USWA 3ND9A 1D1SA 4YTEA 4F4FA 5LP6A 1KOGA 3DAFA 3SQOA 3RREA 3ODGA 4OO1J 2ZR0A 3FW1A 4YN4A 4GE0A 1U2GA 2YOFA 3TI9A 2Y2UA 3BD6A 4FQ7A 3U4MA 1Y3BE 2PR7A 4JOBA 421PA 1G5FA 1PDWA 1Z0AA 1UPUA 5I51A 3JTMA 4E33A 2KK0A 3RSHA 4W63A 3BDIA 2X86A 2I6GA 4RNOA 7ICHA 3ETDA 2JH7A 2BGWA 3E3OA 2OGZA 3M33A 8ADHA 3RLIA 3A1SA 4QZEA 4ZALA 4KSCA 3P52A 1TRKA 3OZCA 4DRXB 3EG5A 4CEHA 4J7CA 2W2PA 5KT6A 1RVV1 4L4UA 3D3JA 2JLUA 1T1SA 4DMFA 1NE7A 4RQMA 2ORWA 4EKDA 1E3WA 2VAVA 4DNQA 1NWCA 1W19A 1ZD4A 2PSHA 2BCVA 2HCFA 2JKYA 1XSEA 4YXWD 2HX1A 2K89A 3HVKA 1IZYA 2UYQA 4IQ8A 4NE2A 2REOA 3TFRA 2YUIA 2QGZA 3KL4A 2W6QA 1WS6A 3RSQA 2DF4B 1XN1A 4C29A 3H40A 3NOVA 1H2ZA 5A9RA 1SNYA 2HIMA 1ZYUA 4UAZA 2FSVA 2ZTMA 1SJ9A 1JXQA 2Z3VA 2CHGA 4ICAA 3I4CA 2BFBB 3LLMA 1FFVA 1T2DA 3BWDD 1K88A 3A2KA 4IXNA 5CWRA 4TRRA 3DEAA 3E9EA 1KH3A 2OC9A 1GO3F 2AG5A 4L8LA 4DIBA 5C37A 5LXTB 2P41A 3NUGA 3CUSA 1CT9A 1UMCA 1EAYA 2ZM6B 3OQOA 1LS1A 5LQCA 2AR0A 4XRGA 4NL4H 3OT1A 3QWBA 3P5SA 3GCXA 3DTTA 2WWVD 5DGHA 3RFTA 1XJ5A 5IK2D 1C8LA 4IKOA 1M74A 3TTUA 2DXIA 4KYTA 5A9SA 3TQSA 4EJSC 3E22A 3SBXA 1NRXA 1PNOA 2EDCA 2PUHA 1B6TA 1UL1X 4OBXA 4HLUA 2Q1UA 1W34A 3B60A 2YV3A 2XUPA 4TUQA 1N7GA 3TAHA 1JI7A 2IP1A 4Q0MA 3GX1A 5KJEA 4X65B 4CQNA 5CJJA 3N0WA 4D25A 2EERA 1SUEA 2CL6X 3H87A 4U9IS 3ZR4B 4GMDA 4C0QC 3EGXA 4NAHA 3I2HA 3S8YA 4ECVA 4QDZA 1DU4A 4K9MA 4TVBA 5CFNA 1C1HA 1TJPB 3B51X 1OGIA 3BORA 4KR6A 1FU8A 1F0NA 3ACBA 1C3LA 3F5MA 5ALDA 1RXYA 3FCYA 2CVPA 1T15A 3UMBA 4DLNA 3GILA 5AESA 2OT3B 3FVVA 2EL9A 4K26A 3PMNA 1ZI8A 2XA9A 4GP9A 1J2NA 4P4SB 5LSAA 2B0JA 521PA 4QTXA 1B6RA 2BPOA 5EQJB 5EJ2A 4D0GA 1VSTA 1VHDA 2XMBA 3EF1A 2IYQA 2UXBB 1WHSB 1GARA 4CDRA 4BNLA 1QFYA 3I12A 5IKEA 4NCNA 4DIEA 2VOJA 3DKRA 4A0GA 4UOZA 5ALTA 2GYWA 1WUIS 2HM7A 3GLFA 3JATA 3V2GA 4DR3B 2ATLA 5DN6A 5EIBC 1SD5A 1TO2E 3BB3A 5T4FA 4JJZA 1YDWA 3U60B 2YN4A 1ZN9A 3BBLA 6PFKA 4FEYA 1PYGA 3EISA 4JVSB 3TJMA 1JWLA 2NUAB 3C3WA 3B78A 1VG8A 1JMSA 2LDBA 4KXWA 4HNHA 5F7XA 2JLZA 2FN4A 3R77A 4RA9A 5BV7A 2MR6A 5C8VA 1ZA1A 4JFRA 5KAFU 4ZOCA 4AZ3B 3GVPA 4DY6A 5L1IA 3ABOB 4UMEA 3E15A 4BNDA 2A14A 2GYVA 1BCSB 3VCBA 2H2IA 3AMVA 4O4LB 4GKAA 4ZVUA 2OC4A 4QJ3A 4N65A 3DUFA 3KYDB 1KPIA 2P79A 4G56A 3STHA 3GH3A 4YAWA 2GQ0A 2OFXA 3QPWA 1QTNA 3RHFA 3AJEA 4ARCA 1QONA 4QWAA 2RGUA 3ANXA 4Z54A 1DKUA 3C98A 3EGIA 1UKEA 3T7JA 1QQBA 3PDHA 3OJXA 2GZHA 3A0RB 4RANA 1J0BA 2UXCB 5D3KA 1YAHA 2QDXA 4XUSA 2IYLD 5B2EA 2ZWAA 3R41A 1LEHA 4YBZA 5ERXA 5EWLB 3FPHA 3D81A 1ZIPA 4C9BA 5FLYA 4OI0A 4PC7A 4AURA 4AG3A 2AHRA 5D6OA 4XPIB 1DO2A 3TF5A 2FQWA 4MW6A 4X1OA 1FMCA 1M8GA 4E0DA 1N62A 1PJSA 2GK6A 2HA7A 3HZRA 1NLUA 3IERA 1U9YA 3OJUA 3NEAA 4NEHB 4BP1A 1P1JA 1QSYA 4G0OA 4I1IA 3AUUA 4KACA 1Q84A 3D1LA 4XA5A 4MAFA 4JBWA 5JR3A 2BEWA 3DZJA 3N2KB 3I09A 2ISCA 2QQEA 4W5JA 3EMVA 5GGXA 1U6IA 1PO7A 3GFKB 1D2AA 3KOOA 3KWLA 3ASYA 5IIOA 1FW6A 3MQ2A 3JASB 1L3IA 1R4MB 2BFEB 2E4YA 5KSYA 2XCRB 3MFIA 2B8WA 4KMOB 1N8SA 2RCNA 4OEHA 2VTEA 3Q0TA 2MR5A 1L5VA 1PGQA 2NUPB 1U9LA 5ALLA 1H2WA 4MQMA 4N6NA 6REQB 2ADMA 2OMKA 1NVXQ 2ESEA 4WBXC 3WDKA 1OT3A 2HIAA 1K0FA 3PNQA 1TECE 1T5HX 3BSSA 3PQ8A 2NU7B 1O6CA 2HLHA 1ZIOA 2VDVE 3F4BA 4F4ZA 1U8EA 1KJZA 4Q9HA 2WM8A 2QN6A 3RAJA 3PSPA 1IAQA 3QE0A 1PWEA 1NN5A 3ROXA 1TUIA 4ESHA 1DBQA 5AI0A 1Q6ZA 2ORIA 5KNCH 1XVVA 1O0SA 1JHMA 2OO5C 3T3NA 3SICE 3BQNB 5FPPA 4BLOA 1LNQA 3FD8A 3I6YA 1AJEA 3QX3A 1R9JA 1AN0A 4ER6A 3V4RA 5JYBA 2YIDA 2B8TA 1EUDA 1KDHA 2QG4A 4JLKA 2XGOA 2F62A 2IPAB 3DEHA 1R0CA 2WYHA 1D0IA 4OUKX 4BAGA 3H86A 4N03A 1UPBA 3M7DA 2PRJA 3ONVA 1ZJNA 1AIPA 3RRYA 1ZQKA 4LE1A 3AHIA 4IDAA 1ENPA 2VQ3A 1FP2A 4BTLA 1RI3A 3WDSA 4ZTBA 1DO0A 3L02A 2ZRJA 5M7EA 2W4QA 2PSJA 2VDOB 1E32A 2HIHA 3RBEA 4FBLA 3VVBA 5ALHA 1M5TA 3F8WA 13PKA 3QE4A 4JBHA 3HT3A 5DLFA 2IXEA 3NT5A 1WCLA 2EP8A 3K4HA 1GR1A 2ZM5A 4RQ0A 2EJCA 4TMFA 3Q8LA 3QVOA 1GQ2A 3PX7A 1SIWA 3WB1A 3CTPA 3SZGA 1NYRA 4BO1A 3GC6A 1U04A 2FEPA 3FDFA 4KI7A 4E6EA 4H3KB 1T25A 2OKCA 1KIFA 3UANA 1L5QA 3K9WA 4QXMA 5J9FA 2RGEA 4DNFA 4TM7A 4PYKA 1GXSB 1KBZA 4PBTA 1RP1A 2R1TB 4Q16A 4P7GA 1C29B 1H4QA 4OIMA 3C16C 1M54A 3C6QA 5M2QA 3QFCA 4M9GA 1PW7A 2FR1A 2KD1A 2P4UA 1JSRA 2GJ9A 3B2NA 3I2FA 2ZTLA 5AIBA 2V7TA 4ZYVA 2C2GA 2X5OA 1WQ3A 2YJ3A 3CEHA 3GB9A 1GZHB 1NBEA 3S28A 3IEXA 1BPBA 1R7RA 3ZDYB 5G1NA 4LY3A 4P4LA 1FW8A 2YBEA 2QP4A 2BDEA 4DS5A 4RIEA 3RS0A 1UAYA 5B1IA 4C6SA 2HTEA 4ZVRA 1L5OA 5FNVF 5BWOA 5IT5A 1FTNA 4I4TA 4HAYA 4FYWA 3HP1A 1N5RA 3TAXA 4CN8A 4WASA 4DIOA 2HVHA 2QL5A 3WLEA 3SC4A 4FB4A 5B57C 2X0KA 1U9JA 2UVDA 4NWIA 1I33A 3RQIA 4M4SA 1SV0A 3HUDA 3Q7QA 2QV7A 3VR6D 3A9VA 3IP5A 2XCLA 1ZDMA 3EFOB 1U8AA 1Y1SA 5EMKA 2Z57A 3NBAA 4Q7MB 2DHRA 4RH1A 2GAIA 4QL3A 4YYZA 4QNNA 1SG0A 5JMTA 4PZOA 1O8CA 3MT7A 3CZRA 1JAYA 4YRQA 2WHPA 1FDUA 3JY6A 5CG2A 5EUBA 2Z5FA 3FPEA 1OXSC 2YIMA 1J39A 2EZ8A 5M3BA 3PR3A 4U5QA 1YA4A 4UAUA 2H85A 2X0FA 1JGTA 1ATZA 1ZD1A 4DW8A 5U4QA 1RP7A 4BQNA 2X6RA 1SHUX 2EZYA 4D6YA 5G2OA 3WL8A 4B7UA 1X94A 4HJXA 4DIUA 1RQLA 5J2TB 4BUGA 5H02A 3I05A 4I2JA 4I28A 4UTNA 2DYKA 4DCCA 1SKSA 4O1HA 3KELA 4TKUB 3O5AA 3PY8A 3P9XA 1ECWA 3TR0A 4JJIA 3AKCA 2EF0A 2F77X 1HXHA 5U9CA 3MCWA 1JQ3A 5BN3B 2WINI 4NRDA 4ZDIA 4TTRA 4I9FA 5B6PA 2WB2A 2Z8XA 3R9XA 2WAAA 1CRXA 4DV0B 3ANLA 1NVKA 4TRJA 2I80A 4K46A 5DHSA 5J5CA 3V72A 3TLZA 5FBHA 2HU7A 4KXFB 1FUUA 3FC4A 1OXJA 1W46A 4F5OA 5REQA 1G6OA 2ZIGA 4P34A 1WMDA 3EMKA 4Q9DA 4YUXA 1IY1A 1QPZA 4A7PA 4XDYA 2ZXEA 4ZT7A 2HQSA 3AQIA 3CCCA 2V5VA 5IMSA 1FRNA 4GFDA 3NPMA 2RGYA 3DCNA 4EHHA 2L2QA 4R2LA 1QH1B 4E3WA 2NLOA 1W4CA 3I6ZA 1VJ0A 4Q6BA 1SKYE 1I4DD 4BMXA 1L5YA 2AFIA 1X8LA 1T4CB 3EHEA 1RQRA 4NCXA 3P4UA 1PR6A 3DC7A 1J0DA 4OI1A 3QKTA 4MRPA 4PYJA 5CTAA 5AVTA 4ML3A 1YS1X 2YVKA 3SEAA 4DHEA 2ZIUA 4HEJA 3TL6A 4MW1A 1INLA 1DQSA 4E0BA 3CBGA 5DBBA 1XQ1A 3R0QA 3BQMB 3TSAA 4K6HA 5HHTA 3HH8A 5FBZA 3PPWA 1RZRA 3IAFA 4LJLA 4B71A 2JLWA 3HY6A 4DIKA 2ZRGA 1ZCJA 1OXVA 2X8JA 1VL8A 4CCAA 4CKCA 2I2CA 3O75A 4N12A 3B53X 3ZV6A 2CDAA 1Z17A 3CLRD 4KYVA 1D2GA 4F6LA 4PCAA 5IT9A 5HCIA 5THXA 2YFKA 4R2JA 3S29A 4B32A 3HSSA 2IIPA 1SHLA 3Q3HA 4Q5IA 6YASA 2PUJA 3ZG6A 2IWRA 5DWQA 3NHPA 2XIDA 2REXB 2WZBA 4PZYA 3VPAA 4EI8A 4LXHA 5KI6A 5EKTA 1PYOA 4J0KA 4IY1A 5DQGA 3AU6A 4ZI5A 1AK2A 1V7CA 4PPQA 3P0IA 2Q46A 3NWBA 3GYGA 1JNXX 1VKZA 2RP5A 5JAMA 2FPSA 2A4KA 3SXJA 3KIPA 1C7EA 4TVKA 2XGGA 5CVTA 3H1PA 5LXTF 3L7NA 1NXOA 3UV3A 4X3OA 3EW7A 4URXR 3V6MA 1AQYA 4D9KA 7MDHA 5EJ6A 1EB9A 2HBRA 1PTJC 4UM9B 3HJBA 5LOVB 3V6HA 4CG1A 3WKBA 5SYNA 1F2TB 1R6AA 3T5KA 2KS6A 4M9XA 1W76A 4YP7A 2ATEA 1PJ3A 1YNOA 3H75A 3T7EA 1OFIA 4IEFB 5EJEA 3L93A 3AB3A 1GUDA 3A36A 4BQFA 2W90A 4EKNB 3PX4A 1IEXA 3RR2A 2FUKA 2EX0A 1G5IA 4XCQA 3LCCA 4PS1A 4LHZA 1RAHA 4QXQA 5BVHB 1E4YA 4Q3LA 2HA6A 4BEWA 2YWBA 4J03A 3L49A 1XRNA 1D1QA 1UM9A 4YP0A 3LY5A 1CUAA 1VLVA 4QWWA 4ZI2A 4KPGA 3K1JA 1BXRB 4X94A 5LZ2A 5LCXA 4I1PA 1XZJA 1TA0A 3C3AA 2NP6A 2JBAB 3I9V1 2ZRLA 1N5WA 2WQ7A 5KFSA 5HS4A 4J0FA 1O58A 4IWXA 4UTZA 4KRFA 1XZMA 1T26A 2D1RA 4QM7A 4D8YA 1ECCA 2GLUA 4GX2A 1BU8A 5DHPA 2SCUA 1OAOC 3UGQA 1OXTA 4D9GA 2FVYA 1Z6QA 2PUWA 4E14A 3V9PA 1OJ7A 1KYQA 3VU1A 1JAXA 4W5RA 2HJWA 5C3UA 2R25B 4J16A 3A3YA 1XTUA 1NNLA 4RQ1A 1DCFA 1SIOA 5BN1A 2AR9A 4C07A 4BZZA 3OCZA 5JRDS 1CZUA 4CG2A 2A86A 1JT9A 4YV1A 2ZB4A 1AB6A 4N49A 3ZXSA 1XZAA 1S89A 2CUZA 2XYRA 5KNBD 1F9AA 4F46A 1YZQA 2WT4A 4AYBF 1B6SA 3KKNA 1WPRA 2NO7A 5HZGA 4JX8A 3AJAA 2BFWA 3OF3A 4M04A 1BHSA 3BILA 1A0PA 4I50A 3CJQA 1J5XA 3UJCA 5CT9A 3VJKA 2R6FA 5TIIA 3P4YA 5JW6A 1FDTA 3KS9A 3Q6NA 5ALKA 4HH1A 4ACAA 4NOKA 2PT5A 3H4BA 1D07A 1SUFA 1WX1A 3TBFA 3G0HA 2A1UA 5BUCA 2O0KA 5ETJA 2O2SA 3OPNA 3TVTA 1Q1QA 3N53A 1UXKA 2CB0A 1PJQA 1S5PA 4IH4A 3E2MA 1JKXA 2A1TS 4R8SA 1V47A 2AG0A 4OGKA 2Q5JA 3TLBA 3QVLA 2QL7A 4DLVA 2I78A 1DG9A 1ZNQO 2JFPA 3HCEA 4F4JA 2LWIA 3DEIA 3M6XA 4I3HA 2AXTU 1LZKA 2R8IA 1Z9BA 4BVBA 1AGYA 1KY5A 2VF2A 1A9TA 2XJ9A 3FMPB 5HILA 1RJ9A 4W6QA 5JS8A 4NLNA 3T52A 2IHUA 1RKQA 5HSGA 4C08A 4DY4A 1LI7A 1PK3A 2DX7A 3GIKA 5AM4A 1PJ8A 3N2GB 2H0RA 5KTRA 2A88A 2ZVQX 1Q1NA 1Z5VA 2FN8A 5JLJA 2OCGA 2CZGA 3EEIA 4MIEA 1M0WA 1Q20A 4V24A 3PRJA 2WYUA 5FFFA 1KN5A 1SXJC 2RGRA 4LJ4A 4DJTA 3I34X 4EW2A 3VKVA 4XEUA 2R66A 1EDOA 3EAFA 2WY2D 1CUJA 3QMMA 4MRVA 3AWDA 4J1NA 1J8DA 3TADA 3A6ZA 3PC3A 4DYHA 3PUKA 5ICEA 3HO8A 4YBRA 4L9RA 3AFIA 4RT3A 5DRYA 2LPEA 1GGVA 16PKA 3RB0A 5B1HA 2IYZA 1NF2A 4GLJA 4FS3A 1TAHA 1S2OA 1JXEA 4AB1A 1ZYQA 2K4MA 3H3FA 5JI3E 5JD6A 3DBIA 4Q21A 4IS7A 1RAEA 1NKBA 5EFOA 3IAM6 5FB3A 3TI7A 4MVJI 1WXDA 5JY6A 2PQ6A 4LDJA 5MF6A 1X0XA 2PUEA 1T94A 4AP6A 5E0KB 2IHMA 3R5KA 1AKNA 5GJWC 2QVXX 3MT9A 1RHUA 1D9XA 2QRKA 4O2RA 2YHUA 5KYVA 4ZANA 5CK4A 4Q44A 3GK3A 2YQEA 4ME6A 5BPCA 4CCSA 2X5XA 3OEHD 3EBPA 5KVSA 5JRZA 4YV0A 1TQ4A 4RUKA 4KO1S 1A72A 1TVEA 2EW1A 5HKAA 1M1XB 2CUKA 4JYBA 1U0LA 1ZKDA 2NXJA 4QWBA 4R81A 2Z43A 2QTWB 3T5CA 1YR8A 1BFUA 3VZQA 1OIXA 2C0QA 2P6NA 5E9WA 5FWYA 1OZFA 2BMWA 3EFHA 2G5HB 3G2LA 3WMEA 4EPXA 2WJJA 3DM9B 4ACBA 4EK9A 4V0ME 2IEIA 1U2GC 1QIIA 1QLNA 4HDRB 5C8YA 2I91A 1SXJE 5EJGA 5IEJA 4K9NA 2IPOA 4E30A 2QI9F 2VZLA 2QX6A 4XYLA 3FTQA 1TYBE 5F2OA 3W79A 4YAEA 1MIOA 4DILA 1BDBA 2RLTA 3K0EA 5CIWA 1YJBA 4GNRA 1HKHA 1SOAA 1HG0A 4UQPA 3BWBA 5EQDA 2FPPA 2WUEA 2XUJA 4AYXA 3EGOA 4GBJA 2H1IA 2QX4A 1FQOA 1GG9A 1SMKA 5A4IS 3OTOB 2R86A 3UUEA 3PWKA 3ZVKA 4Y7CA 1GQFA 3BAZA 3PQDA 4J9LA 1KDTA 4MYSA 2CHVA 3IPAA 4GEGA 5BUSA 3FHCB 1NDUA 1Y4SA 2FZEA 4P4UA 1XMOB 3L7KA 4EIWA 2Y92A 4US0R 3FIJA 3SKXA 3CEMA 3ESZA 4PAGA 3RANA 3D7NA 1RT9A 1ENYA 2J8ZA 4BDTA 3OEED 5B6JA 2ZSKA 2NZVG 3SQIA 3EYAA 3LYHA 2WU1A 3MUOA 4NXZA 3TDNA 1VKHA 2WMYA 4RIIA 1SU8A 4QBHA 1Z06A 3BL5A 4RPIA 3S8MA 2PXHA 1DKRA 2FSVC 2Y1WA 1BVUA 4UNNA 3O4GA 2DT5A 3EIWA 2BLNA 5C34B 1Z5ZA 2YRXA 1F8FA 3H5VA 5DB8A 2HRDA 2PUBA 1W48A 4LGYA 3K4PA 3NETA 1SVSA 2C2WA 2HMAA 3ZE6A 1EUCB 2IUEA 1DJOA 5TT1A 2BJHA 1N4DA 4HPWA 2PANA 4KQJA 5AK3A 2Y0CA 1XXHB 3LA8A 3ZCTA 3TE6A 1NVTA 4G86A 1GRVA 1FIQA 3H17A 1GADO 4PYIA 3IUYA 3U4CA 1IY8A 2FMSA 4BX9A 4DM4A 3KUXA 1T9ZA 4LRSB 4E5VA 2UYCA 5SYMA 4LA4A 4PZEA 4IILA 3SFTA 4HLUC 4DMCA 3VPBA 1P4GA 2KN7A 2NO0A 5GOTA 3PE3A 1O95D 2AZDA 3VJLA 3AERB 2O1EA 3DBLB 5TLSA 5KYYA 1WSBA 5IHXA 5F2NA 4CQMA 2OSVA 4UBLA 4RZXA 8ICZA 3JR7A 4RPLA 1AHHA 3CH5A 2KSOA 4TXMA 4MX8A 3K3PA 4YR9A 4LOLA 2JK1A 1JQAA 3O84A 1YIAA 2XUKA 4MKHA 5ELXA 5KJCA 3UPUA 2O3JA 1F0PA 5EWFA 2QU8A 1DCTA 4RAOA 4YPFA 3TZKA 2PZEA 3CMCO 1E2BA 4MVJG 4LOAA 1CKEA 3WL3A 1ZN2A 3ODPA 1JQLB 3BXOA 2ZSJA 1NN0A 2WR8A 3CE6A 3VHLB 4TL8A 4OMUA 1Q1AA 1TF2A 2FG6C 5DKFA 1BO6A 4Q82A 4EVRA 4MYHA 4O2AF 2BHRA 4FFWA 1Z0KA 3G8AA 4PQGA 2AMVA 3I5XA 3R0IA 4ED9A 3VC8A 4L0MA 4B3JA 1I3CA 3FOCA 3GGJA 4OU5A 2YFHA 5KWIA 3F2BA 4KMMA 4BO4A 3SWWA 5DE3A 2FEWB 4NMLA 1LU9A 1G8AA 2MWMA 5C1OA 3GMDA 5JECA 1YU6A 1K3UB 1PJRA 3BF7A 2ZS7A 2P11A 2R68A 3AUYA 4HWRA 4EW1A 1X9HA 4JIGA 1CY1A 3ZWBA 1M10A 3GDHA 2C8VA 1AMUA 1BDMA 5C7LO 1BGVA 5HZMA 2V0CA 3RRBA 5C18A 3WKEA 2DWUA 2P5UA 1SOMA 5DGIA 2IOHA 3E3LA 3K0SA 4Z9AA 4TVSA 5I7VA 3Q72A 3KZXA 1IVYA 1KF0A 3HB9A 1V7ZA 2VYVA 4RENA 3HA2A 1Y5IA 3FOBA 3K0KA 3AGPA 1VGRA 4FPXA 2VANA 3AUTA 2RB4A 2XQIA 1EWKA 3AEYA 2KSQA 4KBFA 4NJMB 2PH7A 1SBNE 5M34A 4QO8A 1JG7A 2QUBA 3ZE1B 5BPFA 5DM70 3UPQA 3JYPA 1SCQA 2DUNA 4O4IA 9ICLA 3RYCA 3HMQA 1PAUA 4IWYA 4B9UA 3ETGA 1R00A 5FPKA 1FFWA 1GUYA 5IFLA 2DJ5A 3BQ7A 3KKZA 3ROZA 1PT6A 4OHWA 3ZWMA 1KP9A 4LHXA 5CJ7A 3HYSA 4QUBA 3TINA 4BTEA 3N58A 1MJNA 4DSEA 3ELDA 3P8ZA 2VT3A 1YCDA 3TQOA 4H27A 4BB5A 1CUKA 4DR5B 2H07A 1TJ5A 1N75A 3QTTA 1TZMA 4WOCA 5JBNA 1IG0A 2Z2JA 4RIGA 3KKOA 1PG5A 3FGPA 3G1TA 4R7TA 3R40A 5F9LA 1TDJA 4US8A 2DGZA 2EANA 4JQZA 4KRGA 2VNKA 1ZD8A 1U2RA 4RJTA 2ZDGA 2FWMX 4OYRA 4ZZ3A 5FTJA 2H16A 3CHYA 1HYBA 2B6HA 1Z18A 3MEQA 1T9AA 1KO4A 3N3BC 5TQ0B 4HY3A 1GRRA 1KVRA 2FWJA 4Z7QB 1RI5A 3ROTA 5DG7A 2XNDD 3KKEA 2UVWA 2PHZA 4PX9A 1JHVA 2BEVB 1E3IA 3JAKA 1WUDA 1YZHA 1PWXA 4KHZA 4P86A 1RD4A 4DLYA 2B82A 1OFUX 3PV8A 3UMRA 2KMDA 3FFWA 3HDHA 5AOBA 4MKGA 3C24A 3IOEA 3ZXIA 5FOTA 3TNFA 3WSWA 3IAEA 4WK0B 4XB1A 3L7JA 2AE1A 2Y0EA 3JD4A 4OL9A 2BV3A 4N0EA 2VNHA 1X9WA 3RS8A 4RV5A 4IHJA 2Q27A 4AJHA 1WV0A 1G7RA 4K4IA 3A4IA 2VHTA 2WAQF 4LHVA 3SQMA 2J6HA 1KZ9A 1UINA 1Z68A 1X87A 2XSZA 1JR6A 2BFMA 4HAZA 2EKZA 1CPYA 4HV4A 4M8SA 3IEKA 2ZVJA 3C5WP 2W8LA 4G5OA 1NVGA 1EBFA 1ZOIA 3JQBC 1SCUB 1JVSA 5LOVF 3DC2A 4YJGB 3WJ1A 1XB2A 4BNFA 4BQRA 3NCTA 2OAP1 2V6BA 3DFUA 3P9RA 2HD4A 2NU6A 2Q99A 1NQ5A 1EVEA 4OV6B 4BNVA 4JFAA 1RRFA 2VJLA 3UF0A 4TQSA 3JPWA 2QTVA 4GXTA 2RJ3A 4O08A 4KNYA 1NQTA 1P5FA 5B1EA 5CDSA 3V2HA 4LZZA 5I9LA 2MSKA 4O0MA 1N3LA 2VK1A 1Z6YA 3ECAA 1H23A 2WU8A 4NCIA 4K9DA 1E9BA 4N8DA 1NNUA 1TM1E 4EY3A 2E5SA 1OA0A 5FOQA 1FFGA 1DGQA 1W88B 1ULSA 1DO8A 4YI5A 4Y2YA 1XTQA 3DNFA 4NJ8A 1H65A 1IM5A 5B12A 1ONSA 1G21A 5K3EA 5ICCA 1SKWA 3K0AB 1B14A 2I3GA 5HXAA 4IMIB 1Z4LA 5DU2A 3CUUA 2GRAA 3C6KA 4GFJA 1Q7CA 1NUQA 5C1BA 3OLWA 5AVKA 1J8QA 4M1EA 5DM1A 2DERA 3S40A 1USIA 1KY2A 4WI1A 5GOZA 1CXZA 1G6Q1 2ZR8A 3WYGA 5ES3A 3SC3A 2WSYB 3MJFA 2PJZA 4NPAA 3B6JA 2EKPA 4BB0A 1ICEA 3INGA 3MOIA 3RSCA 2D3WA 3PNPA 1N5KA 3PW2A 1H2XA 1KMHB 3WXMA 4DC1A 2W55A 4DDHA 5KVAA 3C3CA 2IY7A 1U8ZA 5TS3A 3H18A 2AZMA 4V03A 1Y3HA 4MUEA 2Q3JA 1DQPA 4MW9A 3GLHE 2CFIA 1BYIA 4MI6A 3THWA 4MUAA 1E2EA 3DAOA 3K9QO 5E6SB 5L95A 1V1RB 3N8GA 3G49A 4ZDWA 3TRFA 2JLQA 2AK3A 1B76A 5IPFA 2CDRA 3RJHA 3ZE7A 2KJQA 3KAJA 4YROA 3QMPA 5CYFA 2OPBA 1H4VB 4B3SB 3GEPA 4RO0A 1Z00B 1OBOA 1Q0UA 2RH9B 1SD1A 3G82C 4GZ6A 5G02A 4Q6WA 2G5IB 1GO2A 3TPFA 4DZRA 2FMPA 2PGAA 3NHLA 3G2NA 1T9DA 1GZ6A 3F5SA 3T99A 3RROA 2KMLA 1E3JA 3FB1A 2A92A 5LLSA 5KMGB 2WJIA 4C5AA 2O8DA 4G8DA 3OHSX 4KITB 9ICRA 2K2WA 3AUSA 3HCAA 3ZDFA 4WJZA 4HTFB 3WQRA 1R15A 1ODTC 4A0RA 4BO9A 1ZOLA 3FKSA 3DYIA 1LQUA 4HOYA 4Y2TA 4MMYB 2VK2A 1XVTA 5U1PA 4V0OA 2UAGA 5G1PA 1KYIA 2Y4OA 1C1YA 1HNXB 4MKRA 1RWPA 3P2IA 1I6LA 4TMXA 1OSNA 4ZC8A 3GIMA 1E7QA 3C5HA 1JIJA 5JJ5A 3G2PA 1ND6A 1H94A 4QOIA 5TISU 4DL2A 4IL6U 2OWOA 3ZV7A 4XR9A 4JH0A 3MGHA 4YRRA 1MN8A 2ES4A 1OGJA 1KFEB 4MUBA 1QBGA 1ZQCA 3AJDA 4G26A 5KNDH 4DQIA 3QX7A 1QHEA 1KRXA 2DU8A 5DWDA 4I2IA 5JNVA 1AGRA 3TG8A 1CK4A 1XROA 2QB0A 8OHMA 2H7XA 4CKWA 1L7BA 4FINA 4XWGA 3G1WA 4JCCA 4EEZA 4OG2A 2CJYA 2VQFB 7ADHA 4PTYA 1GFZA 3T3FA 4MI9A 5AT1A 1XA3A 1Z37A 4IDEA 4GOOD 1G8GA 3HCRA 3RG8A 2A3VA 3UV7A 2LPMA 3U4HA 3TGWA 2W9AA 1VKRA 5D5PA 2IITA 3FDXA 3F3MA 4TROA 3QK7A 4N3CA 2IXFA 1E6LA 3VTAA 2NVUB 3B5EA 1LLFA 1TAUA 2YJ4A 4S1OA 5SZIA 3W34A 1Z0JA 1DEXA 4IRKA 3V48A 1FUKA 1WKBA 1F0KA 3PWZA 3WKAA 1MO3A 3AXTA 1VBNA 1HOTA 2ICAA 3D8BA 4BLWA 1A5SB 4B3DA 1Y8QA 3G0IA 4BMSA 4ER3A 4WKCA 3RWMB 3MIIA 1Z6AA 3R6TA 4CQJA 2IRWA 3PL5A 1LQTA 4WADA 1NW5A 3CRVA 3FCEA 4HCJA 5AW0A 4QNMA 5BWCA 1L3VA 1NOKA 3ANTA 4UQGA 3O8DA 3IELA 1LLUA 5C7IO 4LF4B 1DE0A 4YQFA 4CLOB 2I4IA 5KOYA 4HX9A 4EH1A 4G4GA 1K92A 5HBRA 4YJFB 3RF9A 3Q7EA 3K96A 4LOHA 3HWTA 1LC0A 4S2UA 4MVJE 2G63A 3TQIA 2E6UX 4CF4A 2XMGA 4Y1RB 3VTKA 4EHBA 1XDGA 3FRIA 2VUHB 1JV2B 5C80A 4CKBB 2GCIA 3UAXA 3ADDA 3ESXA 5IWAB 5JZOA 3AHCA 3HXTA 3TQCA 5J1TB 2RARA 4JR1A 1ZQDA 5J3JA 1QU2A 3UMJA 4X8LA 4FS2A 3UICA 1S9FA 1ESDA 4EFMA 1L7PA 3QIVA 4DR1B 2NZXA 3HWWA 4IS2A 3VTZA 2X14A 1G7TA 1GG8A 1DK2A 1Z26A 4Q1EA 1VRCA 4KC0A 4Z5XA 4UUQA 1CR6A 3ENWA 1XDSA 1SC3A 3C45A 2Q9CA 3NRCA 1RJDA 2NU8B 3LVWA 4OJPA 4EBCA 5K7SA 2K4EA 5JEEA 4ED6A 3OZTA 4IHAA 1NXWA 4W5OA 1EGVB 4YLEA 3ILXA 1CUWA 5EKSA 1NQUA 3QLUC 3PA8A 1P18A 1MLDA 5BO5A 5JXIA 3H9JA 1D7OA 3E5NA 2VC2B 3HK2A 1GUFA 5KFDA 3FF1A 3EPIA 2QQ0A 4RDCA 2VIIA 3VOAA 2OZLA 2Z2XA 5IKMA 4CT4B 4F4UA 3SF8B 3MR2A 3VC3A 1CB0A 3DSRA 2V3CC 3U16A 3GFBA 2R4UA 3V46A 5ALNA 1RXWA 5CNKA 4RZ3A 2VF4X 3SXPA 4MS3B 4GI2A 2I6TA 2HREA 3CNOA 2CF5A 4DUZB 4AKGA 3C8MA 4DCMA 3NPAA 1U9IC 3URKA 1W0JD 3R3HA 4L5AA 4LVNA 2ZRCA 3H8VA 3EQ8A 5LQSA 1A9RA 1FU7A 3HB1A 4RORA 4W1PA 2FOLA 4NBSA 1D8BA 2YX8A 1X1BA 1XJCA 4HNUA 2G04A 1UDCA 3FTEA 3E81A 2WWXA 2ZSFA 4H0NA 3CRMA 3ZVNA 2XCQA 1U0FA 2G0NA 4FYXA 5KPDA 4FMCB 3ROQA 3VU8A 5GINE 5F73A 8ICPA 1FNBA 5EGSA 2ZBRA 1OI7A 3IXMA 5GWXA 2XGPA 4HHEA 5EE5B 3TW4A 3BWCA 1CVRA 2WUDA 5IVKA 4Z0PA 2B4RO 3CZAA 3HS3A 2BC9A 4MV4A 3UJ7A 1BEZA 1E8MA 4M9SA 3HADA 4LE2A 4PG7A 4YONB 5FFMA 8MHTA 4ATNA 1Q0RA 3Q2IA 2AUNA 3GJ0A 3U44B 1YZFA 2QTAA 2HCRA 4MWOA 3JQRA 3HNOA 2ZFUA 1D1TA 2L19A 3DXYA 2MYUA 1BKSB 3N0XA 1ILWA 3E9CA 5KWVA 3PG5A 2C4NA 1A1VA 2ZIXB 3OP4A 1THMA 2RHTA 4B9TA 5DISB 1ZI6A 1RMTA 4ZI7A 2G5TA 3ENNA 1Y3IA 3ENQA 1O6GA 2DT8A 3I9LA 1P62B 4IDCA 3NAGA 4TXHA 3L9XA 4DMRA 2UZ1A 1Q0SA 3B3QA 4R3NA 3QA3E 1U3CA 3FVTA 2FPOA 3SZLA 1GHTA 4K6MA 3ZW9A 4NPHA 1JE1A 4QZVA 3IIKA 2RHFA 1KRPA 3U7HB 4WTOA 1J6UA 4IUCS 1Q50A 4AULA 5A06A 5SICE 1Z3CA 5AH0A 1Y8AA 3R7AA 5TGTA 4FQ5A 1SPXA 1G98A 4H6PA 1QG4A 2VRCA 4ZKEA 3JPSA 4FX5A 3DWIA 5A03A 4NLLA 1N9ZA 1B7GO 5KPJA 5FI1B 3E03A 3I01M 2O5VA 4S1WA 1Z63A 3LUHA 2ZREA 3PHLA 3FPAA 2BUAA 1XSLA 2IVZA 4V2UA 3NV9A 5E2AA 3PYLA 4QZIA 4LQ4A 2BTQA 3RU2A 4DFJA 5IDWA 1IVNA 3Q11A 1KEEA 4WXRA 1JR3D 1PRYA 2A0XA 1ZETA 1SCBA 5KTOA 2H2AA 4JBLA 3DL7A 1KKUA 1MQ3A 1QF6A 3VFDA 3PZPA 1DRWA 4IIHA 3VC1A 2H92A 7AT1A 2QWXA 4HNSA 4F5YA 3NC4A 1JQEA 1X7WB 3O2SB 2JGIA 4MH0R 5IH3A 1L9KA 1MTZA 3FOZA 4BNIA 1GNVA 1F6WA 3S0JA 3AK4A 1ARZA 7ICJA 5AKLA 4GIBA 3BQTA 4BWMA 4JP5A 3NDPA 5DYIA 3V7WA 3RRHA 3RTGA 4D9EA 4UE2A 4C0XA 3A4NA 3W2HA 2VT2A 2H1VA 3SYNA 2SECE 4RHFA 1VFPA 4IEEA 4ZZ0A 1Y34E 1CERA 3M6ZA 4P3XA 4LHEA 3PITA 1GL6A 4GMKA 5HWSA 3JQ7A 5I4CA 3QKSA 2QQ5A 4NX2A 4K0KB 1YZVA 1RKUA 2AFHE 3JD3A 8ICUA 1OX6A 2CLDX 5L6LB 4IJWA 4LDAA 3TJZA 1AXEA 3CN7A 1Z6GA 3GV8B 3MM4A 1MH9A 2ZGVA 4BMZA 1V1MA 4L4YA 1JEOA 4O33A 4F2PA 2RGGA 2YZ7A 3RYFB 1CS0B 1RQXA 3Q85A 4NCBA 3G79A 7ICNA 3C8UA 5BN4A 4L6AA 4BLUA 3K0FA 5H16A 3HP7A 5TNXA 4J7UA 4ARSA 4NY8A 1WTCA 4HMOA 1DRGA 3HV0A 1AQIA 3EMDA 3OIYA 4G0QA 5KNCA 1H6AA 2KVCA 1NUPA 1SL0A 4DL7A 4XWWA 3I4FA 2Z2IA 4LDQA 2JIZA 4CIAA 3KE8A 3CONA 3T7AA 4NENB 3ZGXA 2HHQA 3AY6A 3OCJA 2SKEA 1XAIA 1J7KA 3RHZA 3B1FA 2X7XA 1I4EB 4ECUA 2PJRA 3VGJA 4DR6B 5DNYB 5JZBA 1K8XB 2P2GA 3F6YA 3F3SA 2OFPA 4PO3X 1T8PA 2B1JA 4HSEA 2PJDA 2QD3A 5FOSA 1KETA 1YBAA 1NR7A 3LIPA 3MUNA 4FEAA 3F71A 2LR0A 1T6YA 3GCDA 3H11A 3W8DA 1QC5B 7ICIA 4FFMA 5ISMA 5DNEA 3UHOA 4NNJA 3HKDB 4Z9BA 2HMUA 2EBHX 4HVCA 1DQNA 1XQ9A 2JFVA 3AKDA 4HUTA 4LJYA 4F9GA 3HUEA 1ZMXA 1O03A 1BXKA 3R0VA 3SS7X 2GPYA 1QQTA 4YQWA 1W85B 1GYRA 2OVBA 2C8JA 1RJFA 1NR1A 2FJPA 3WL4A 1HY3A 3G0CA 4KXYA 3CLSC 4RD1A 2PO7A 3F49S 1OPRA 2R8RA 3WHLA 1RHMA 3PGXA 5DXJA 3JTEA 1VI2A 1WVGA 4GZMA 2WOOA 3E1KA 2JH3A 1YO6A 1FFAA 1HDEA 2AH5A 4NICA 4ZCSA 3O8OA 3LYAA 4J3FA 3G2JA 2PV7A 2H1WA 3MMXA 3PA6A 3EEBA 1CHDA 3TQHA 1F9EA 3KLOA 2X8WA 2D0DA 3OSUA 2X41A 3O74A 3ZZ0A 2N47A 1U2DA 3C87A 3CW2A 4FZJA 4LFCB 4KFSA 4G6ZA 5DVZA 1TZJA 7ICOA 1Y5NA 2WVGA 1EAMA 5GZ3A 4B83A 9ICCA 1DAIA 5GIPE 4O2AB 1R8XA 3LOPA 3U4DA 2G4VA 1W1WA 2ZT8A 1D4FA 1WEKA 3OWHA 1O97D 4DTIA 2A9QA 4G24A 1CQIB 4HWTA 4MQFB 4FC7A 5HIIA 2XE6A 2DH5A 1R9MA 1R4NA 3LNTA 4KQ6A 5K99A 2VUIB 3EOZA 4EEXA 2Y1CA 1QM5A 4D81A 5ARCA 2GJ4A 4QEDA 1OYVA 3W78A 2EF1A 3GLKA 4AFNA 1YIDA 3FKQA 3R5XA 5IKXA 2C07A 3TUJC 1KGSA 3ESRA 1WAMA 4OQDA 3AWIA 4XVHA 4J76A 4KXMA 1I7QB 4DR4B 3NDJA 3QTBA 3ZGNA 4G37A 2OILA 1HKUA 4A27A 3MABA 3TLGB 3M6WA 1LPSA 1RRKA 4JWNA 4ZD6A 1V8PA 2ZB7A 4ZYZA 3K2BA 1DB3A 5IYZA 3UKDA 2R6GA 4GXQA 3NBMA 2HW3A 3KBOA 1ZQSA 4CE6A 4H4CA 1J00A 5C5CA 5A0LA 2PAAA 1WNFA 2QT0A 3PFHA 3N2YA 2CLFB 1OAAA 2NSHA 2EX4A 2XY7A 3PQ3A 3L1IA 5AIAA 2CL5A 2H4FA 4WOKA 4G9EA 2W2LA 1P3Y1 3FAHA 3BWMA 1N1EA 1EFRD 3VZDA 2OBFA 2GTHA 2WUWE 2WQ6A 2XE7A 2BD0A 4NVRA 2K7FA 4JXJA 4W5WA 2PRSA 2BWJA 1V38A 3L7BA 2O8CA 4N8EA 3COYA 3ISTA 3WZLA 1W35A 4N7JA 1P5HA 3IHQB 4OHRA 3L4BA 1QRTA 1TFRA 5I5EA 4OJMX 4GMXA 5IM4A 2W37A 4MUXA 4GPEA 1KEUA 4KQEA 4GECA 1OX4A 5ADHA 4FYHA 1B26A 4J90A 2PZFA 4CL3A 4GX0A 1YRQA 2ERXA 1G3RA 4L5CA 3DLIA 4ISCA 4XYGA 4QSMA 5FKJA 1Y9JA 1QGZA 2JGJA 3MDAA 4PXSA 3FUWA 4XM0A 2NZ2A 2OUKA 3KPWA 4FWBA 2OHOA 4AKIA 2NVBA 1VP3A 4AAYA 3VVCA 2FG5A 3B2QA 5HOQA 3EVGA 4PAMA 2WSSA 5AVZA 2ARKA 4F6RB 1AV6A 2W9XA 4TKLA 1UKAA 1F5SA 2PGLA 1C4KA 1RDFA 1PVVA 4PPXA 4B9NA 3SJCA 1QV6A 2X8BA 4RWZA 4Q48A 3QFHA 2QN7A 1XRJA 2B21A 3BTVA 2FAXA 4J8PA 2B7LA 1X7XA 2NZ8A 1B23P 1GA6A 4P54A 4DT1A 2J0UB 2VRBA 4KYUA 1SCAA 2Z58A 4CI0B 2C1XA 3A7DA 1B1CA 4WY5A 4TT3A 5ICSA 5CNIA 2QX9A 5HRAA 3V1KA 5J23A 5CHYA 3QUSA 1FNNA 4OJ6A 4FOTA 5FPSA 1PL7A 4JSTA 4Z0TA 2Q6KA 1WCWA 4A2PA 4HRXA 4D8VA 1DWOA 2HV9A 2M6SA 4TMVA 1NIPA 3U4QA 1IEQA 3TSZA 2B30A 1Y4UA 4I1VA 2EYQA 2UVPA 4M38A 5FHQA 5SZJA 1ZVKA 4AL4A 3GLIE 3DYVA 4B80A 4YV7A 2VJ5A 2YQ5A 1GKKA 3N8NA 3L4JA 2G36A 3A6HA 4BQPA 3A10A 4A82A 8ABPA 5C52B 3L0IB 1BROA 3WGVA 4LF6B 2ZTHA 4S1NA 1Y8CA 3W5VA 3GJ4A 3PF9A 2KLBA 2XGMA 1TQ8A 1C8KA 4JZKA 3NHJA 4HUQA 2O2GA 1A95A 1L5GB 1ZZEA 4W99A 1ZN7A 2BCSA 1II9A 1ZQUA 5J5VA 2FCRA 2LXNA 4LSWA 3P9QA 1XAHA 1ZQLA 2GKGA 3W6NA 2DY1A 5CB4B 1RQNA 3HR8A 3E2EA 3C1OA 3GFRA 1N2CB 3C6YA 5KQRA 1QKJA 4LF5B 2XCTB 1QGOA 2JIQA 2Z95A 3PQ4A 3U9TA 3ZWVA 3CVUA 2FPIA 3ZHSA 1M1NA 1V4NA 1RI4A 1OFUA 1XWIA 1VKNA 1P2VA 1R0RE 4JLOA 4BFUA 4F3CA 1KI6B 3TMYA 3O3OB 3GPLA 5C0OE 4ETNA 4QOJA 2GRUA 5BP7A 1T5IA 4RHYA 4UZEA 5LZ7A 1EIWA 1ZMBA 1N4AA 4N5IX 3MR3A 1ZQAA 2VPYA 5E3HA 5FBVB 2KJ9A 3KVYA 4NBVA 2E3TA 1NASA 3D5TA 3I32A 4Y1FA 2OQVA 1H66A 4K88A 3TBHA 1GCUA 4ZQHA 1TAMA 1BSVA 5JV5A 1R8SA 5A4FS 1OBVA 3ZQKA 2OV6A 2WMNB 5DV9A 2XWJI 4DLUA 4DMKA 3NHKA 4B74A 2JFZA 1THGA 2IQ5A 4UC0A 1N2IA 2SNIE 5A3VA 1RWOA 4GC5A 1T24A 3N4MB 5DQIA 3C28A 2XDYA 2LGJA 4RKFA 3CO5A 1PEAA 1XEXA 1UXOA 3FI9A 1BEEA 1TVMA 1HTBA 3B1VA 4RVGA 5K1ZA 3KTAA 1I0LA 3SN6A 3RHTA 3P26A 2WABA 4LTDA 2UYHA 3MFHA 1OKKA 1VBKA 1XAJA 4DJFC 4XIFA 1FOEB 2XPCA 8ICMA 1FP4A 1SGGA 1Y9ZA 2P27A 5DG8A 3AL2A 3C5CA 2E4ZA 1WOMA 3QBDA 1M76A 1X7DA 2E0IA 4FMCF 2EATA 1EGQA 2Q3DA 4M1OA 1NI4A 3WWPA 4H6VA 1AS2A 2YB1A 3VR4H 3ZK9A 3KVRA 2YWJA 3HCBA 4KFTA 2JPDA 3PHCA 3SZOA 3UXHA 1COKA 2Y99A 4KXLA 4ILEA 4YRGA 1H5UA 1T7PA 3AETB 3D2SA 2YWEA 1JHYA 5AVWA 2ST1A 3H0CA 2OCLA 1G64A 1RJEA 2PRKA 4BGEA 2IEAA 2WW8A 1CS4C 2FFAA 4FJ1A 5DSZA 5A1TA 3EVNA 4HDKB 3QEOA 1AKYA 4ZOAA 3S2YA 2I9KA 1SWVA 4H1WA 1E66A 2DWOA 3I0NA 1MBZA 1NULA 2H3IA 4QODA 2CVZA 3IQHX 4HATA 1B16A 1REQA 1KYXA 1G4HA 2WFLB 2QYTA 2EFHB 2X0IA 1M2OB 1MO4A 2YJGA 1WLYA 3FUUA 5MFZA 3CSSA 4J91A 3E0QA 4PGMA 1UBHS 3QXXA 3CPHA 1QGDA 1Z82A 9MHTA 2ASLA 5HFJA 1XMIA 2VTVA 2F3RA 3GFSA 2H3EA 3MXOA 3QA9A 2JLBA 4YFYA 3PYMA 3QFTA 1ST2A 1BQ3A 4H4EA 3C1YA 3RUDA 3GAMA 1ECPA 2Y1KA 4ETWA 3RH6A 4XR4A 2OM6A 4RT2A 4J29A 2BBOA 1IU9A 1ZM7A 1UJ4A 4EABA 5L7YA 2WKQA 5EHGA 4YXJA 4ZHQA 4B2LA 5TQ2A 4TVOA 3VA7A 1XCLA 1F14A 1YRAA 3GHYA 4PZUA 1AKRA 1P2DA 3RAFC 4EUFA 4XASA 3RVQA 1MF7A 4DJ5X 4LFBB 3DCYA 4KWHA 3OX3A 4MQLA 1EK6A 1I1OA 3A11A 4R1TA 2BIFA 2F9FA 2J9XB 5TY0A 3R20A 1NOMA 5LP6C 1Q83A 2X0EA 3ZOKA 2W6PA 1AO0A 2ENWA 4PGAA 2B20A 4Q34A 1FLNA 4IF4A 1ODSA 4DPKA 1ISJA 3E7DA 3EASA 4W1SA 1L7EA 3AF2A 2NTJA 3DHYA 3GUUA 1JT2A 4HDMB 1B3BA 3IAS1 2O7VA 4DIDA 2HRZA 2J3QA 4X1KA 1YQ9A 5CK5A 4FGKA 4MKXA 1JAHA 4JBYA 3LCVB 4O1MA 2QTCA 2NSJA 2PEZA 3FPBA 1TCVA 4DRXA 4X0EA 4KN9S 4H35A 5LQAA 5BYKA 1ZQ1A 2WWFA 4BNTA 2HNKA 4BO6A 2G09A 2CCGA 3HU3A 4UHEA 5IJ9B 5CVVA 4HKTA 4BKUA 5KFFA 4FBMA 2W03A 1U1IA 1ZQWA 1T8TA 4QEZA 2VJDA 4Q7JB 1H93A 2JD2A 4DOAA 4WUTA 1NUAA 4X8MA 3K2EA 1SXGA 4ZV7A 4ETIA 2RGCA 1IJKA 3LQ2A 1U7XA 2NPIA 5H59A 3ZQ6A 4F4HA 1ECBA 1NHWA 2FHSA 1NK0A 3L04A 1L5UA 4IZOA 4XUCA 1Z74A 2CMFA 5DBIA 4TWJA 3S2IA 1K86A 4KYIB 1MQSA 4HLCA 1QIGA 2MTBA 5DB9A 3FPCA 2BFBA 3Q7RA 3HN7A 4C20A 4XUDA 2IS4A 1FXWF 2CBZA 1QMPA 1NK5A 4U39A 5AXDA 4Z6KA 3QFRA 3L07A 2UYGA 4IRXA 3NWOA 1LTKA 4ZGBA 2K8AA 4D98A 1NW6A 2YIJA 2H4HA 3FTCA 1R8YA 1FRQA 5NULA 1CETA 2IDZA 4R84A 4PWYA 1DGSA 3R7NA 4D44A 3O8RA 1HFKA 1VRVA 3LXUX 4G4SP 4HB4A 1RABA 3GJXC 5AVRA 2P9ZA 3EFBA 1O96B 2ERCA 3AL3A 1YK0A 4RHCA 3SPXA 5I47A 3OAAA 5CCEA 1TMOA 4PHTA 2H17A 1S0MA 3I28A 4EUKA 4LJSA 5I9MA 4ZCPA 1QZXA 3QNUA 3SQLA 4YUWA 3MC1A 2J3JA 1TKRA 1PV4A 1NVVR 1CY2A 2WEKA 2XCAA 3R3VA 1W36C 4P9NA 4IQ4A 1EJBA 4PZAA 5L4LA 1B73A 1LBIA 3O47A 4OQ4A 1MUUA 2EC5A 3IN5A 4WOBA 1LSSA 3EZNA 5FI5A 4R0MA 3LBIA 1C9YA 2ZJ6A 5K0GA 1N9GB 4M0PA 2ZBEA 3MRVA 4LDNA 1ZJWA 3IP7A 4KLCA 1BTOA 1A7UA 1QH0A 2O19A 2VPQA 1F51E 1W0KA 3N6RA 1TEXA 2Y67A 2PBRA 1E79A 3UGJA 1P4SA 2GO7A 4C5CA 2KM1A 1F44A 4DXHA 2R5FA 5IN5A 5L3SB 3C1TA 4LYFA 4P4SA 3ZE2B 1M0TA 2QZZA 4N6GA 1OH7A 4I2DA 2IH2A 1G6KA 3GDGA 1I2MA 1ISMA 1YS6A 5A4MS 5FI0B 3C1ZA 5JVDA 4MWDA 1NPYA 1O94D 4CUZA 2AN3A 4MLDA 4X1YB 2JAWA 5G5GA 3OZVA 2FE1A 2FKNA 5KFTA 1XDBA 3FH0A 2FI1A 3BQ1A 4B31A 3G0DA 4NYIR 3LDFA 1VPWA 2ZJ3A 4DL5A 2QXYA 3MCZA 4D3XA 3OZBA 3OZFA 4DFMA 1QIJA 4MSUA 1R5BA 2NUAA 3MTAA 4OREX 3DEZA 4OMFG 1W5BA 2R8KA 5JCJA 5DM4A 1ACLA 3LV8A 5IDXA 3QXGA 4BFYA 1WB6A 3RB6A 1E18A 1AROP 4RMNA 3AW8A 1TU0A 1AF7A 3A9RA 4Y0VA 1BCSA 1YS7A 5LUBA 1WNTA 1SVKA 2RSLA 1ADFA 4O4LA 3U0BA 1K5OA 4GYJA 5IJWA 4LEIA 3K94A 1RPTA 4L0QA 5EIWA 3V55A 4I5IA 2ZS9A 4Y1GA 2BHTA 2FGJA 4B48A 3EGCA 2G9ZA 5AOAA 1EEXB 1HT3A 1YR6A 3ZTTA 5I7RA 1XF9A 4UDYX 1ADCA 4RXMA 4C1BA 3VKWA 2G88A 5A4JA 1M7HA 1CUVA 3QXHA 1S8OA 5CH3A 1Y6JA 3G2QA 2A5FA 2AZTA 4YG2A 3PFNA 2LDXA 3JZFA 4D4GA 1IATA 4FLEA 4ERXA 1P29A 1KBQA 3IGFA 2VDQB 3WBFA 5EWLA 3U3XA 2C5AA 5CDHA 3TGPA 3EVFA 1HURA 5EWGA 4XPIA 3M89A 1OI4A 3IDZA 1KC3A 4G01B 4K9QA 4L0CA 3GLFE 1TJ3A 2X4LA 3NHWA 2VWQA 3UOGA 1ISPA 4UMFA 1KQNA 3L6EA 2PL3A 2PM8A 1RYBA 1VHWA 5IBCA 4F1KA 3THRA 3I2IA 4M37A 5AHXA 2QR2A 4C78A 3A0BU 4KR9A 4I4LA 1RE1A 5CRIA 3RUIA 2WHXA 3TUIC 1UJ6A 2J6TA 1K1QA 3WL7A 2IS1A 1SGWA 2Y9UA 3N2KA 3PNOA 3W9SA 1RRPA 2O0MA 1TM7E 2XUIA 5L3ZA 4DCGA 5JSQA 3NKLA 3KLNA 4I2NA 2B1IA 3FSRA 3JASA 2RDIA 2BCEA 1R4MA 3GJ6A 2X40A 2BFEA 1EI9A 2Q49A 4KMOA 3KZNA 4U7PB 4ALMA 2CCJA 2BPGA 1PUZA 3NHMA 3JPQA 2NUPA 2DQKA 3WIBA 4JWKA 4KX3A 5C51B 3KJIA 3Q12A 3OETA 5J8YA 3IXQA 1C7ZA 1IUPA 3WKCA 4UTXA 2VPWA 1WABA 4RHUA 2F64A 4Z86A 4Y6GB 2AJDA 2BKUA 2VZ8A 4R40A 2Y6VA 4EMBA 1F0MA 2I1WA 3AG5A 3PPXA 4HWSA 4EPRA 2KG5A 3GROA 3EC2A 3K73O 5B5SA 3LDUA 4Y2VA 5EXPA 1DC5A 2JGLA 2R00A 2HDNB 2GPJA 5AW3A 4PPYA 2YXDA 2QRVA 4CM1A 2Y1JA 4EHAA 5KTMA 3LFUA 2VO1A 1DQZA 2B98A 2YS6A 3VDMA 1CI4A 1QLJA 1U7PA 1UFVA 5EXDA 2EFCB 2JFYA 2RK3A 4XTCS 5AI9A 4FXPA 2BBSA 4JEHA 2HU8A 1U0OC 1HMYA 3C7TA 3DE0X 3W8RA 1GDHA 1C3EA 4CYMA 4WLOA 5FOXA 1JKJB 4EGSA 3RSZA 3PE6A 3FROA 2Q5FA 2IODA 1BWQA 1GLVA 3Q7IA 2OCAA 4F3RA 2Q8NA 2P2YA 4Z51A 2EQAA 1O89A 4PYRA 3DLPX 3WGTA 4I2BA 3WQSB 1EVQA 4KQGA 3GG2A 2G8LA 4QOFA 2Q4EA 3F4KA 1P19A 1ULHA 4YACA 2DQZA 3HBJA 5CB4F 1NKTA 1O5OA 2OHFA 3V2IA 1C8BA 2ANCA 1KVSA 2WP0A 4K40A 1KO1A 4O4JA 4XQ8A 1JEQB 1B0XA 4EGCB 2YJ5A 5BW6B 2NO4A 1JF8A 1KJ8A 1GXSA 2R1TA 1QFXA 4BDSA 4G2TA 3L0YA 3M6UA 1UF9A 4R8LA 1PJZA 4RU9A 4YDSA 3B6KA 1LPMA 1X1SA 4BFWA 4JGBA 4L3WA 2V6JA 4UM8B 5C0YA 3D4IA 2C94A 3LPLA 3AKEA 9ICSA 4RGYA 3MLEA 4X00A 4O5KA 2WUVA 3ES9A 4MWZA 4RK5A 2HT1A 4YREA 1A5AB 6ABPA 5E1DA 4I3GA 4MUNA 4MV7A 2VJ4A 4D41A 2RKBA 3LVVA 3NYQA 5G4LA 3CS3A 1AOXA 3RCBA 1NBMD 1L4BA 1Z7GA 3H65A 1E3DA 4M47A 1N1DA 4WBNB 4OGLA 2XQGA 4CHGA 3SX4A 4GNKA 4DE5A 5ALPA 3HVUA 4RPXA 1DEOA 3GDXA 3QITA 3G0OA 5JZMA 2GN6A 4HQ6A 1IN5A 1WB9A 4BLTA 1T0PA 3V00A 8ICAA 3OZWA 3EGWA 3RAQA 4BZXA 3D3WB 4HBZA 4FFOA 1T1IA 5FUYA 3DL2A 1SV0C 1XKXA 3EFOA 3EWAA 1OW3B 2BBWA 3GDFA 1JXOA 3HDYA 4K03A 2XZLA 1JE0A 3PDIB 3FNIA 3JPRA 3NBQA 1ZR4A 2PL1A 2BFPA 4MMZB 5DYWA 2PCLA 3QKIA 3D4NA 4BN4A 1D8LA 2O9JA 1B8NA 2VJCA 1Z6ZA 5IC5A 4BV9A 2H18A 1XZBA 8GPBA 4MKFA 1DQYA 4WGFA 1L7RA 4RF3A 2GM4A 5IAEA 2HEGA 3RU9A 5IAOA 5LZ9A 2R1VB 3ESQA 1S2MA 3IV7A 3N76A 2YJTD 2VPZA 3DMPA 3I42A 1I7NA 5JAUA 1U6KA 2A7XA 5J2TA 3GUHA 4YMGA 1IHXA 3R2JA 3G6XA 3CYFA 5JSZA 4BTVA 2NP7A 5DK4A 1LRJA 3VR2A 2WJPA 3D6UA 4TKUA 1MRSA 3R3SA 3CZMA 3B8HA 2HA0A 1O7JA 4IGAA 1TTPB 1IFXA 3ROMA 5IC4A 5HKBA 1K2WA