4P0QB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
334
structure length
284
Chain Sequence
NAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
total genus 82
structure length 284
sequence length 334
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0qB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0qB01
4BXOB 4P0PB 2ZIUA 2ZIVA 2ZIWB 2ZIXA 4M6WA 2ZIUB 2BGWA 2ZIVB 2BHNA 2JNWA 4P0QA 1J24A 2ZIXB 2M9MA 2A1IA 4M6WB 1J25A 4BXOA 4P0PA 4P0QB 2JPDA 2ZIWA 1J22A 1J23A
chains in the Genus database with same CATH superfamily
3BDPA 3ECCA 1IY9A 1YCDA 2ZP1A 3U7FB 3IKVA 2EHJA 4R8UA 3P0EA 2C9OA 1X7ZB 3Q41A 5T8KC 2BFMA 2POQX 1ZH6A 3HR4A 1F2VA 1PRYA 3DCJA 2X5KO 5LP6C 2DR2A 2B0CA 4PU0A 1PK1A 3EZYA 4BB5A 1DIBA 3ZK8A 2R97A 4IY1A 2O2CA 1T9ZA 4AG3A 2WUVA 1CETA 4TL6A 1XCMA 2I80A 3LUKA 4JVNA 1J1IA 1Q8KA 2VJYA 4XDYA 1T2FA 1KRPA 1VL1A 2I29A 1X8JA 2JIDA 3K5HA 1LSOA 4YR9A 2D8MA 1QIJA 4P4TA 2PRIA 4PPNA 1KVTA 2WZDA 4Q4HA 4RNDB 1N6HA 2RGAA 3V42A 1ZW1A 4DIFA 4R9VA 2D7JA 1OPXA 2FDRA 3KPWA 4KLZA 4Q6WA 3R9KA 1SBQA 2OHHA 2ZIZA 5JPIA 1U31A 3V6MA 3FHLA 3NW9A 2P5TB 5A03A 3LOQA 3OX3A 1UZAA 1FNNA 4F38A 2WFZA 3KPUA 2M1ZA 1XXHE 1EP3B 2PGLA 3V6KA 4YQWA 1KSFX 4Y1RB 3H6GA 4FMDB 5CIWA 2MMCA 4EHDA 2NVOA 1A8HA 2GZHA 4MUFA 3SYRA 2IYFA 1ITZA 3WL6A 1VHWA 3QOXA 1VPDA 2NV0A 2VIXA 4HGPA 1JHVA 3D4NA 1Z8NA 4RCYA 1ONOA 2Q9CA 4L76A 2P6UA 4N9WA 4RK6A 1IU9A 1GLVA 3CPSA 1MAUA 5FPYA 3LBAA 3RH5A 3FYCA 4GX2A 5KDLA 4F5PA 3KZNA 3AL3A 3JS5A 3N8DA 6REQA 1UDRA 2XYGA 2AX3A 2CFIA 1YT3A 4I4TB 2FMQA 4QSMA 3B53X 4X8HA 1CX9B 5KJFA 5DW3A 2PWPA 4CG2A 4P92A 5J2HA 2PY6A 4GWLA 4FFWA 5TV2A 1XZQA 3TEMA 1ENOA 4NBUA 4XX0B 1X3SA 4Q1DA 5DPMA 3CR7A 3FCCA 4ZJZA 3GZJA 2VBGA 2XYRA 2EFDB 3E9QA 1RBYA 1TU4A 5J58A 5JFTA 1V1RB 2O3JA 5SY6A 1SVNA 5ICGA 4X1YA 3FOZA 3E0QA 1HYBA 2H54A 3A2MA 4R68A 3H11A 4FS8A 3OQJA 3ZHZA 4CDGA 4L28A 3L1IA 4JC8A 3AUAA 1XMVA 1S10A 4EKYA 2P2ZA 5P8WA 5LOVB 2NTEA 3RJJA 2H6EA 3MTIA 4IRCA 3B6JA 4EJ2A 1S8OA 4KLAA 4I19A 2WD9A 3NHJA 4OXXA 4HNAB 4MWOA 1KO4A 3H65A 5BYJA 4J49A 2PL1A 4IXDA 4D9IA 3RC1A 3RGWS 4B3FX 2HLNA 2XF2A 1A9OA 4ZYLA 8ICMA 5DRTA 1X7WA 4QVKA 3GXOA 4KFRA 3UWPA 3JQFC 3M9OB 5H16A 2XQKA 2O2GA 2JIRA 1QXSA 3LX6A 3JAMA 3LBYA 2PQ0A 1V39A 2JR5A 5IMSA 4DV2B 2Z9DA 1UFOA 2K2QB 5IM5A 4QGFA 5BUSA 4NYJQ 4R0NA 1R27A 1TZKA 2Q99A 2XADA 4Z0PA 1L4MA 7ICNA 2Q4DA 5TPWB 4V3CA 3URMA 2PKQO 2JZNA 1H9CA 3DLPX 3QY9A 5H3HA 5ALUA 5DMXA 1MAHA 3SHOA 1QSSA 4KTQA 2GRAA 2GJAA 2D8CA 1RRVA 2P91A 3UV7A 4JA2A 4UBIA 1IM4A 1RSZA 2RGEA 4ZOEA 1SIUA 2XMBA 4YJHB 3JSAA 1GG2A 3G59A 2GWSA 4TQUS 5DHTA 2OP1A 2OQ2A 1Q19A 2WZBA 5JAMA 3I76A 2G76A 4NZPA 1JJIA 2E49A 1LB2B 2JFVA 3F5EA 4BMYA 1Y1RA 2P1DA 1YB1A 1SA0B 4RLSA 5KT2A 2XCRB 3A11A 2HYDA 2Y77A 4BFLA 4YR7A 2IUEA 1EFCA 4DXDA 2GF9A 5KWEA 1GTL1 1KQGA 4PN3A 1DI0A 4WJ3B 4QYXA 2RCYA 3NIBA 1X7YA 2EBFX 4GSYA 5ELMA 4OI4A 4PXAA 3HKEB 2NRVA 4OOEA 1NBMD 3IUMA 1CUAA 1HMYA 3H9JA 4NAHA 3AI3A 3CBQA 1KI6A 1TQ8A 3EODA 4Y2VA 2IDMA 3PO5A 3D7LA 3THYB 2CF5A 1AN0A 4ZCLA 3FMIA 4RW0A 1FFGA 1YS2X 2ZYIA 1E3MA 5F9FA 2ZS7A 3TX2A 2DBZA 4NY1A 1J7KA 3FXAA 2QRUA 1DTWA 4MR8A 2Q8QA 1A5ZA 3OF5A 1ISPA 4HTFB 3QFFA 5IVPA 1YD7A 5LJLA 4TTSA 1Z25A 3BZWA 4ZI2A 1TCCA 2P6RA 2OXCA 1BFKA 4OHOA 3CM0A 3WQRA 1RR6A 1IJFA 4W7HA 3QWFA 4URFA 4EQ6A 3OJSA 4JWKA 1G60A 3T9AA 3WGMA 2WEKA 2BM1A 3STWA 5HCIA 2VPTA 5HR6A 3V7NA 4IIGA 2BCSA 3WDLA 1QRDA 2R2GA 2XVZA 5TQ0B 2AW3A 4NECA 3PI7A 3JVDA 4KLTA 2XQVA 3TLYA 1JQEA 5CVEA 1UPTA 5ITSA 3KUXA 3IJPA 2PZJA 2D1SA 1RE1A 5JE8A 3HCAA 4BRUA 2N9UA 2QTTA 4QHYA 4NYMR 4YCJA 2BTQA 3OLQA 1IMOA 4YV2A 1L8LA 3KJZA 3RARA 2OMEA 2Y9MB 2EP7A 2HHQA 3QU9A 4EGCB 2ISSD 3R8FA 1I2BA 2QNIA 2FEWB 4QLOA 2WOJA 4RCVA 2QV7A 3P0RA 2J45A 3TI7A 3THSA 2E4YA 1LD3A 2RHDA 1DVRA 1H2BA 4MKGA 3GGGA 2AN5A 1G3UA 4EBBA 4L5CA 2XE6A 1U2GA 2NUPA 2HF7A 2WSSA 5DM4A 3AU8A 3HEMA 2YY6A 2HSGA 4ZVOA 4DV1B 1DCKA 1VA4A 3PGA1 1ETHA 1L8AA 3GRRA 1EK5A 1HZZA 2DQKA 4YRKA 3EQ9A 1A4UA 3IBCA 3G0IA 1NUSA 5AW5A 4MARA 1LK7A 4RHTA 3C1TA 4XDHA 4I3HA 4DFMA 2EH9A 4EG5A 1T29A 4TKUA 5HW0A 3AFIA 2B99A 4PPQA 3ZE7A 4MIYA 3P97A 2BFAA 2K8AA 2WIFA 3EZFA 2AE2A 3UAOA 2O8FA 4IRDA 4RS4A 4Q01A 4B6RA 2CDBA 1R37A 4UZEA 3EUEA 1WTCA 4LJ6A 1VE6A 1ZQMA 4HRAA 2DU8A 1DV1A 1JDZA 2QTRA 5DGTA 1CEQA 2QN7A 4NK5A 1C3EA 1LC0A 1XEXB 3NOOA 4E33A 3AEQB 5K20A 1FRFS 2I9GA 2O5CA 1H94A 3D0QA 2F67A 1SVWA 1PUIA 1XU9A 1Q3KA 5CYFA 1PGQA 3VPCA 2X6RA 1W0KD 2WMDA 4NJMA 2CUTA 2RH4A 2DPXA 4QEKA 3KHSA 1WLSA 4PGGA 3RH0A 2ISOA 3LKVA 4DFKA 4KQ1A 4IGKA 4C4RA 5TQ2B 3RYIA 5IIOA 1CUDA 3VAZA 5K3EA 2GN1A 2ECPA 3H1AA 3OETA 1RWPA 2ZI9A 1N2CA 3RSOA 3NAMA 4X24A 2W9MA 3HC7A 2GPNA 4QXRA 3AGQA 3PI6A 3FRJA 1WJGA 4BBZA 4R8LA 3X1KA 4LOKA 4OHRA 1L5NA 1N2IA 2YJNA 2J0QA 1KFTA 1TYDE 4RFLA 3U3ZA 2JFQA 3GX1A 4ZVSA 4JI0B 2O2HA 2ERXA 5EWLB 4PTLA 2QTMA 5ALSA 1FYFA 4ZRDA 2ZRGA 1L7DA 3W2GA 2VJMB 1QANA 1UIRA 2A92A 4OSEA 2PUDA 1XGKA 2X3YA 3UXYA 1QYXA 4JCCA 1PJ2A 5FB3A 3UA4A 1RKXA 1S4MA 1BKSB 1SCQA 1P45A 1RC8A 4DRZA 5JROA 4FFPA 1OD6A 4HYYA 1GO2A 4I4CA 1URPA 1NX9A 5LC1A 3WLAA 2ZU0C 5BOMA 3IV7A 3KKZA 5JXIA 3VKFA 3EHEA 3SZLA 5U1PA 1DWPA 2O19A 4QDOA 3H0KA 3VYTB 4L8LA 4AQDA 3SLKA 2ZJ7A 1H1LB 1KAOA 4DA8A 1HWYA 4NZMA 1G9SA 4E46A 4Z99A 3GJYA 4EUSA 3ON5A 3KIPA 4OUDA 3SC6A 4X41A 1U49A 3M4XA 4IILA 2ZAMA 4MYTA 4XI9A 4RENA 1E1KA 1L5HB 3AR5A 5CLHA 3ZH2A 3DCNA 4BGVA 1N8TA 2L17A 3C3BA 4LOJA 4Y30A 2H8GA 1P8JA 4OPMA 4LBYA 4WOCA 4YCAA 1KMCA 1MAAA 2OEHA 4ER5A 1KMNA 9ICVA 4L02A 5B4VA 1G63A 1NJFA 2F9LA 7MHTA 3U7JA 2Y1IA 1C7ZA 4YRLA 3N70A 4RA9A 3OZGA 4ZEVA 3SI7A 4ZVRA 2C9CA 2H2FA 5SV2A 1A3CA 3LRTA 4AZTA 4GDFA 3EXG1 3P26A 2H5XA 2BD0A 4RK4A 4MF8A 3WRYA 1YRBA 1KVUA 3IG5A 4ZGBA 1FFBA 2JFOA 4CBVA 4DSTA 4M21A 3INNA 1F7UA 4IPTA 1ODTC 4DFPA 2IXEA 2PGDA 4RLHA 4P93A 2WJVA 1OZHA 4M4SA 1RJ9B 2O50A 1M75A 1YB5A 3SQOA 1TJNA 4EMBA 3IDWA 5BWBA 1OFIA 1UEXC 2VZ9A 4KXMA 4LHEA 2CD7A 2B30A 2O8BA 3INYA 1ADBA 2NUAB 1HUOA 2OO5A 1Z34A 4L5AA 3LP8A 2B6GA 3EA4A 3H87A 2N75A 1QFXA 4BMVA 3CXUA 2ZYWX 3NBYC 4F86A 4BX0A 2MTBA 3GH3A 3OT5A 5LQDA 3MT8A 3N6VA 5FQNA 5THKA 2UZAA 3L8DA 4HYEA 3FDXA 3ETLA 2O0KA 3PVCA 4LOLA 3ISJA 1PCXA 4BNJA 1QHIA 4J0JA 2V0CA 3IAS1 1OXXK 1D8LA 4ACAA 5DH9A 5GINE 2NPIA 3FI0A 4F3RA 3N2KA 4K86A 1GAXA 3DS8A 4JSRA 1N4AA 5A2GA 3PUHA 4UCWA 2QKYA 1QRUA 2IS4A 5FA8A 4KX3A 3CPEA 1FX0A 4OP1A 1R0SA 5BUCA 4EPYA 3MLAA 4JELA 4WLVA 1FL9A 1BH2A 2AZMA 3T9CA 2OCEA 2F8MA 4RMNA 2XVXA 4HDSA 2B7BA 4MUIA 1XWLA 4OB8A 4U63A 4HDCA 3I9V1 4DLKA 2P3QA 1TA4A 3OWXA 3OI7A 3VZBA 2DT5A 3IBTA 1WPQA 4UHDA 1X9IA 2GKGA 2E8NA 2J6SA 1A7JA 2EX1A 1VSVA 1RWXA 5E3IA 5K4AA 2NIPA 4DLTA 3OHPA 4UOQA 1F8YA 1DXYA 1PYOA 1RG6A 4X0EA 3O0DA 1G20B 1MABA 1XNGA 4DA0A 3OQNA 1PJLA 4M36A 5J1SB 4F97A 1N2XA 1VJDA 1YMUA 2HA4A 4FONA 3HA2A 1MOZA 2I8AA 1NJSA 5JSZA 2AFHE 5CA0F 1U02A 3K0FB 3TRDA 5C5CA 5C3MA 5AM4A 3U4MA 3W3AA 4P08A 4JU8A 4B7XA 1V9PA 2AXPA 2Y4OA 4W5JA 1AA6A 1WZCA 3A32A 4FDUA 5EI5A 3VJLA 4WFIA 4UAWA 2W6JD 4Q48A 4IDEA 5B3AA 3LHDA 4P5DA 4S1VA 5LYJB 3Q11A 5IDVA 2JLXA 2VH2A 3P96A 4OJNA 1BC5A 3OZRA 2H06A 1I5RA 1PK8A 4ARIA 1X80A 5GOZA 2JK1A 3IFSA 4FYWA 3RYFA 2BAGA 4UM5A 4CIVA 3Q8KA 5KX5F 4FZRA 3KYDA 4BNHA 1DJLA 1S1MA 1PGNA 5L53A 4MVJE 5KS2A 3QNWA 2GGSA 2VF2A 3UG7A 2A58A 4JVLA 1UPHA 2XOXA 4AL4A 1RLTA 2I3ZA 4E13A 2PJDA 3S40A 1U3UA 4R63A 3MBOA 4EB6B 4TWIA 2VATA 2ZI7A 4BP9A 4ESEA 3MGHA 5SYNA 1CUJA 4ND4A 2WPDA 1YB7A 5IU6A 3P9CA 4FWTA 1R74A 5A5VA 4MYDA 3RVDA 1FUYB 1X2IA 4EPVA 1QIIA 1CK4A 5A3JA 1M2VB 3KQWA 2XH8A 1YJQA 4QNMA 4NLGA 4FWBA 3OSZA 3WLQA 4ZAXA 1YUNA 1QE3A 1PW7A 2QD4A 3W1VA 4KQKA 1TTQB 3AEVA 4QU8A 4FUQA 5IKEA 1O96B 4PGAA 5C7OO 3QZ7A 3V2UA 1GJRA 1CQXA 2F9FA 2HHVA 4MUAA 4IIHA 2OQRA 4RLFA 4FOSA 4A2QA 1TVKA 5GTHU 5IIMA 2FFRA 4UULA 4TKVA 2X19A 3KOMA 3L92A 1R8QA 4FEEA 2ZZMA 1VE9A 1R8YA 2J9RA 1SR8A 5KMGB 1IEVA 1DG9A 1GLGA 3NBZC 4D8WA 1AKRA 1S2OA 4CHTA 3JPSA 2CLEB 1P7ZA 4YEDA 1JLSA 5JZMA 4U2BA 2DT8A 2QRQA 2HU5A 4ZJPA 4GX5A 1TYAE 2ZYAA 2XDAA 1SBNE 4FO6A 2J09A 2JH7A 4K4IA 3KRTA 1UC8A 5EQJB 1AT1A 4PONA 4G41A 1S2NA 1NW9B 4DJEC 3G1TA 3DT9A 3RUHA 4QODA 2YRWA 4CCYB 4L27A 1YJBA 2FOIA 2OWEA 1YCFA 5J4HA 4A03A 2AUMA 5E79U 1GPAA 3D5EA 3AF0A 3QW4B 4HKTA 4LJKA 2W8ZA 1J2TA 1GL7A 3FNRA 4QWAA 2ZKLA 1IRIA 4WK0B 2BKAA 3E27A 4I9NA 5KKNB 1Y8CA 1BA2A 4NCKA 1Z35A 2RHLA 2G1PA 3UFXA 3RG8A 4GLLA 3WMXA 3IRVA 3T5HA 5HXAA 1SG9A 4UVEA 1C9MA 2PPLA 5EQTA 1OLXA 5EWGA 1VIDA 1O95D 3MJDA 3B85A 5CFRA 3WG9A 1CY4A 4MGHA 3J81k 3V9PA 4ESOA 3B1XA 3VO1A 2H4FA 2XECA 1ZNWA 1T5HX 1NVXQ 3MTAA 4TTTS 3BB3A 2PQ2A 3S8YA 1Y98A 1B00A 3SXPA 2MJLA 4JT9A 1CR4A 1JJ7A 1M1ZA 5AJVB 4ASUA 3BMCA 1X9MA 4UTOA 1JEYA 1SU7A 2IOQA 5BV7A 4RGVA 4E2XA 1KO5A 1NUHA 1OXVA 4KE7A 4PGMA 4L9WA 4P4MA 2XBLA 2VHQA 2ZATA 4GXTA 1RLOA 1M0WA 3F9IA 4TTAA 2ZGVA 4CYMA 3WMRA 1V2GA 4EG7A 3HJRA 3V2GA 4DN6A 2I8LA 5DB9A 2R8JA 4GM4A 2B21A 2H2DA 1Z68A 3JPRA 3W2IA 1JMSA 3ET4A 1X1SA 1V5IA 1KY5A 2PZ8A 4H7KA 3LK7A 3AHEA 2IV2X 1ABFA 2VDWB 2BGTA 3GLHA 3KLNA 2CNWD 3FZNA 2M6LA 4A36A 2H59A 2BGRA 2FJUA 4ZARA 1CY7A 5EXSA 1JXLA 3GYBA 3R74A 4RUAA 1YHZA 4UVDA 3ER9A 1J8QA 3L9WA 4KQWA 1ODLA 2ZJAA 1ACMA 5ALJA 3U4QA 3VDQA 4B80A 3LUAA 3EXHA 4EYSA 2WF8A 2HA7A 4RANA 3HKDB 3M3DA 1BKDR 4FE4A 5JALA 2JLYA 1DNPA 2NX2A 5J2UF 5J2EA 4KAAA 2ZYTX 1FRVA 3IYLW 3FF4A 2FWPA 1IBLB 1JDTA 5D3ZA 3KKQA 4S12A 2IXBA 1OPRA 1GVNB 1SCKA 3OTHA 4H27A 1Z5PA 4TQSA 4A0HA 4EKIA 4KQGA 2ZI3A 3EQ6A 3A6DA 4NZZA 4HZUB 3GJXC 2I0FA 3GFRA 3JYHA 2DXIA 3L8ZA 4XAQA 4HWTA 4V0QA 4HGOA 4JY7A 1FDIA 1FP4A 3BIWA 4XM2A 5EJ2A 4TS9A 3BD6A 4BFXA 5HGJA 2J6BA 2R11A 4RXTA 1T43A 1SD5A 3HGMA 2R0QC 1NF3A 1UJCA 3VU0A 3MPUA 2CLCX 2LP4Y 3U0VA 3USCS 4KLUA 1W88A 1D5WA 3QU4A 5EMHA 2HQSA 4INAA 4K88A 1VBNA 1U8TA 4DQDA 1EVEA 3I8OA 1PL7A 2ZRNA 3PJGA 5AUOB 4PJ0U 3HFSA 2NVUB 2I9KA 2RBKA 3NVWA 1CE8B 1ORVA 5AH0A 1D09A 2P78A 1NSTA 1O95C 3ZE9A 4JGBA 4JT4A 2ZDGA 4Q9IA 3AKEA 4BKRA 2R5FA 4OK3A 5G5GA 3PITA 4URVR 3F4LA 1NJ8A 4KHZA 1ZINA 5E9WA 3WLIA 1EYZA 3ENNA 4GAEA 5CH8A 5AJYA 3F8WA 3RB8A 1C3VA 1EG2A 3T1TA 4PR0A 3ER8A 1CJBA 2TYSB 1YK1A 4URHA 1LFAA 4HUTA 1UBRS 1H2HA 3ZHSA 2OXOA 2CK3A 3M6ZA 2LWIA 1CB7A 1OU0A 4O4IB 4IGIA 2EKPA 5HIJA 3WJAA 1VMIA 3ZJUA 4N1AA 3L5OA 4XQ8A 2ACEA 5AW0A 3MHTA 1IN6A 1PBNA 3GPCA 3HCNA 3UAZA 1IHYA 5I3CA 4TWZA 1M7GA 2ZWAA 1XRJA 1E0JA 4M0MA 3EYWA 3QBJA 3OZIA 1WNFA 1Y63A 2PBRA 1M83A 3VMMA 3LFUA 3T1NA 5EWMA 3L4SO 2HPAA 4O59O 3NHLA 3GEHA 1ZQVA 3D81A 1JLHA 1GA1A 1W2GA 3BJEA 5EOVA 3I83A 4EVRA 1KY2A 1XDUA 4NOKA 1IAQA 2C7RA 4NEQA 4V39A 4M3NA 1LBHA 3NU1A 2C7PA 3EA0A 1NJGA 2YWGA 2QQ5A 3A4TA 5F7JA 4MO2A 3BE5A 1PR4A 3CLKA 1M2WA 4F5OA 1QIKA 4R2HA 4RVSA 1AK9A 5EVCA 2QMUA 2W2TA 4FFVA 3WADA 4K3VA 4HGQA 3NO4A 5D7BA 4OHBA 3LG2A 3DMGA 2B1QA 1YZFA 1BWPA 3EW9A 3SXJA 5CA0A 3ZXSA 4GRIA 1GWNA 3X1DA 4KJXA 2N0SA 3QEKA 1GUAA 3C15C 3RRXA 3CEHA 2Z58A 3JD3A 1J8DA 4PSDA 4BMZA 4HHEA 2WG0A 1EFHA 4OGFA 4M0PA 2MCFA 1XG5A 2C2RA 2BZGA 1R4ZA 5ILQA 4JUBA 2VJQA 2DJ5A 2PYIA 1RYDA 5KX5A 1EXNA 5BOSB 4H7PA 2O7RA 3OAAA 1HFJA 2X8JB 3IE1A 5JZBA 2QTCA 2B8NA 4F3OA 4XCQA 3SFVA 1SIBE 4ZYXA 3M7IA 3MQ4A 3FPFA 3HUDA 4MVJM 6ABPA 1PTJC 2X2PA 2VBFA 2CBXA 3ZV6A 3TOXA 1U1CA 3P7MA 2WQ7A 2C92A 2IEZA 1U8EA 1YL7A 3ZDZB 1KEEA 2QAGA 1NE7A 2NN3C 5DG8A 2YFKA 5JADA 4F60A 4F4YA 2EZXA 1WKVA 2QG4A 2HFKA 1U7PA 2QK4A 4ZPJA 1XX6A 1PLKA 1B14A 3HRHA 2XA1A 3K92A 1BO6A 1J0CA 3T1OA 5CBPB 3MR5A 3M6WA 1XDDA 4EMSA 4EFLA 3FPSA 3ELWA 1Q15A 4IVQA 4PZZA 3RB4A 2A4KA 4TN1A 4ONEA 1CS0A 1YVPA 1IZ8A 5LVAA 4YLYA 2FH5B 2WTAA 1IEWA 1IZYA 1PEKE 1YVEI 2E85A 3NHKA 4QXAA 1JI0A 4BNYA 4R83A 1BQ3A 1HPLA 2WOOA 4IO1A 5JCJD 2LV8A 3TKYA 2KTQA 1L4LA 4HLUA 3NHYA 3UT5A 1UOEA 1E8DA 2PYZA 1Z22A 4DVJA 2WB1F 2X7JA 2C20A 1I33A 2F3TA 4CN8A 4AYBF 4PHFA 1KRWA 5AXAA 2GO7A 4BUZA 3ZDFA 3QSYA 4BO7A 2A9RA 4DA4A 5AHXA 3FGOA 1M6VA 3ESBA 1UMCA 2L0XA 4R4JA 2X23A 5JS8A 1W85B 4QT0A 5ITVA 1LTQA 3GBVA 1BVUA 1EWKA 1XUOA 1QFZA 2PL5A 3WL5A 1NFRA 5K5EA 4DJAA 4F3TA 2DP4E 3DLHA 2JCSA 1H4SA 1PVDA 3WIBA 5CITA 3HY3A 2IPNA 1YS1X 4B85A 3UO8B 3X2FA 3UV6A 1IG3A 1P5JA 4UJ5A 4IDCA 3I1YA 2KM1A 3U09A 4DAOA 2K4MA 1JI7A 4QWEA 1JXAA 4DIBA 5DZSA 4O5CA 1Z2AA 4YIKA 1UFVA 4UASA 2NQ8A 1M8PA 4ND7A 3RYHB 5L4NA 3K9LA 4UBMA 1W4AA 1G8JA 3VR3A 4FGZA 3WLOA 3UYKA 4L6AA 3W5UA 1ZIOA 5LN1A 3DZDA 1I24A 3OBBA 3HN6A 1ZL2A 8AT1A 3QPAA 4E7OA 4GWGA 3DEAA 3IAEA 4BV8A 3RCBA 4J4HA 3DCYA 3NV7A 1C30B 3CVOA 5JH7B 1KDPA 4GXIA 1PTKA 1YU6A 3OZWA 4EKNB 3GLGE 4JDUA 3HXOA 4G2NA 1XC7A 1JG6A 5KG7A 4ECWA 1AF7A 5BPCA 2WU8A 3FZEA 1L4EA 5K6TA 4GLXA 1GV1A 1VCIA 3ZZNA 4MUYA 3PUIA 3ZWCA 1X1DA 3UJBA 3N7SC 4P5EA 1PDOA 2UXCB 1I9GA 2II6A 3BFPA 3KJEA 4UHFA 4TLCA 2H51A 3I6BA 4NJOA 3D6MA 4L7VA 2O6HA 5I9SA 4PZAA 5EJAA 3TZKA 1U2DC 3FWHA 5KZMB 2I2DA 1P9NA 2VYVA 1I4DD 4AYWA 1KFCB 2HY7A 4ND3A 1RWBA 5EYPB 5HKKA 2R1TA 2B36A 3DE6X 1Q0LA 2QHXA 3KSDO 5FOWA 3K9CA 4RZ3A 1LPPA 3ZWWA 2BGUA 4AUNA 3T06B 1P0PA 1ADJA 1EPUA 5DSTA 3GLTA 4CM6A 3R4VA 4WH0A 3OPMA 4LIPD 3ZLBA 3PGLA 4YRTA 1T9KA 2PX8A 2YWXA 2Y0CA 4G4SP 4ZT6A 5F1OA 1N2OA 1YS9A 1IUOA 1OLSB 4YP3A 1HBJA 3Q9SA 4LXYA 3HP1A 5BNFA 5BSUA 3IDQA 2ZSFA 3N3AC 3QVGA 1NF2A 4R2WA 4M9ZA 2E3JA 4O8ZA 4PRKA 4I2NA 4TKMA 4BRWA 2XZPA 2GPJA 2REQA 2I7XA 2FAXA 1SKWA 2W6MA 2OE2A 1MT0A 2O57A 2JIPA 3DBVO 3IA7A 4MVWA 1VSTA 4JAVC 4HPJB 7ICVA 4L22A 3GQBA 4QTTB 1E2QA 4N5LA 4CMCA 5EESA 2G36A 4C5CA 4Y6GB 2OLEA 3QPBA 1WE2A 2Q46A 1J23A 2AN1A 3TDKA 4EDFA 2KBEA 3GT4A 4OJTA 4MRPA 2H0QA 4JP5A 4BVAA 1ZITA 4BNWA 2CJWB 1QO7A 1OYVA 2I6UA 2VP2A 1N2JA 2GK3A 3DEZA 2H1IA 3G5LA 3H4VA 1XKTA 2HADA 1C9EA 5EP2A 3L1VA 1HLFA 2REXB 9ICTA 3C1UA 5GV7A 1QV6A 2BMJA 5HA5A 2JIZD 3DMRA 3QEMB 4FDVA 5E6RB 2VWQA 4OIMA 5IJ0B 1JKMA 2NRWA 2E1RA 2ERCA 2A5DA 5BT9A 1MO2A 4M9QA 1GN8A 3K6KA 2AA3A 5I9IA 4IKPA 1Y7TA 1ID8A 3K0AA 2X4GA 2CFTA 2I6SA 1JFFB 2LXNA 2XEDA 4GWKA 4C30A 5KCMA 5KJ6A 1ZSNA 1OGIA 1IXZA 1Y5MA 5GIPE 1J0DA 4UAJA 3KQNA 4ND2A 1EX9A 5CHEA 1ZZGA 3GDFA 5CXQA 1JH9A 3DKRA 1JN0A 5ITWA 4DV6B 2V9WA 4X1IA 3EPIA 2IHBA 4MMXB 1MEEA 1BE8A 5BQOA 1SHLA 3RBAA 1UXOA 4CNBA 4YX9A 1SCBA 1D2EA 5KVCA 5GJBA 3V1MA 4DILA 3NYRA 4PZOA 4MKXA 3RJEA 3HYCA 3OZEA 4DL9A 3I42A 2FA9A 2IIPA 1G2PA 1NPYA 1H1TA 1NASA 3KL4A 1DBWA 2BMFA 4KQMA 3WR5A 5AHWA 5JWRA 1UXHA 3TL3A 3BE8A 3SYLA 4CUJA 1HNWB 1BN7A 5F5LA 4BE9A 2OPHA 2JEGA 1XYYA 2HSJA 1Y81A 4WNAA 3HBFA 1K0FA 4YCNA 5CU7A 5A7FA 4CEJA 1XJQA 4EARA 3U3DA 1G0NA 4AJIA 5FP0A 1MRZA 1GTVA 5ULLA 1TZJA 4TXHA 1XFDA 3ABRB 3HJUA 1G5TA 3AB3A 1XP5A 3TL2A 3D59A 4WTOA 1RAIA 4JL6A 1KAHA 2X0KA 4MVJI 4QDTA 1Q91A 2GM4A 5SY9A 3PW0A 3W6OA 2JD0A 1M34A 4K03A 2B4TO 2TRSB 2EZ4A 3JZMA 3L8MA 5JRZA 4LYEA 4KG7A 3UPTA 2G0AA 1Q17A 3KJIA 4P7GA 5BQFA 4N39A 4G5GA 2YFYA 2Z3VA 3L2OB 4OBEA 4JQCA 4LNAA 5L95A 2XCLA 3C7DB 5IULC 4WNCA 1ZN7A 4LYHA 1UBOS 1L4HA 2D5AA 1S8AA 1UK6A 1DQSA 4QBGB 4UNSA 3IX7A 3KKAA 5C35A 5LZ5A 3SYMA 2BGLA 4OQLA 4HN9A 1ODKA 1AJEA 1RKQA 2A7QA 5LQCA 2A9OA 4ECZA 4ADSG 3PRYA 4P83A 2XUKA 1XEWY 1DSSG 1C1DB 4C4ZA 4CE6A 4WA8A 3DT6A 5ALXA 3OA2A 5F33A 3BQ7A 3PSPA 2BFEA 4KK3A 3U16A 1N75A 1BH6A 3U81A 1SZJG 1OGYA 5JHGB 1QZUA 4Z1MA 3GEEA 4E5MA 2OGUA 4QU9A 4EENA 1G7TA 1PDVA 5IUJC 5AXDA 4LEIA 3DCIA 3RS0A 2GPAA 2O2EA 4PGHA 3MTEA 3KQSA 4MWDA 4CZ2A 2QIOA 5B7PA 3BHIA 2UKDA 4DLPA 5TQJA 4U7GA 5HUHA 1Q77A 3KLOA 2KW5A 4LYJA 4M0UA 3PY8A 1U3FA 4JLSA 5J0SA 4TYPA 2FJ6A 4UAYA 2OORC 2QZJA 2AMLA 1DU4A 1VGVA 4OXNA 4UNRA 4JJ6A 2FLWA 5ITZB 5IVIA 1G55A 3TH5A 3WLPA 2P2LA 1Z5NA 3SHFA 5ENZA 1S02A 3QQPA 4HI0E 3E61A 2H7YA 4U0JA 1G7CA 4W5RA 4OMDA 1KJNA 4Z6DA 3C7CB 2ZSHA 2O14A 5KFNA 3P5SA 2DVMA 4NFYA 1KQQA 1NTOA 2QUAA 4FYVA 3ZV3A 1TUBA 5A0TA 5FUXA 2YTZA 1CRWG 3C3JA 1A7UA 2Y1KA 3W8NA 4PG5A 1IY0A 2NTVA 3HQ4O 1TVAA 1P6QA 3KYJB 2ZRHA 4ZT7A 5JANA 4UFPA 2PV0A 2WJWA 1ZD5A 2CZGA 3M49A 3BJIC 1RXVA 3O7MA 1AUPA 3IAAA 4OQEA 2JF0A 2GCNA 4LXIA 5ERXA 3O1JC 1TLTA 5AXBA 4OBXA 3V7KA 1VOTA 3ABIA 3RJ9A 1SB9A 4OJPA 4RFSA 3WJ2A 4BE4A 4YAGA 3MMPA 3G6WA 4J1TC 2WQZA 3FKJA 1JF8A 1BROA 3B7WA 3C8HA 2QTAA 1QR2A 2EG9A 2RBGA 4F3NA 3D6NB 3TAUA 3AXSA 3KSBC 3NC0C 1Z39A 5EGNA 1Y8QA 2HQOA 3EWSA 3O1LA 2PMZC 3DH0A 3SHVA 1DWQA 1O9GA 4U2GA 1AXEA 2YRXA 2PS3A 4QDZA 3LLVA 2GPTA 3DTNA 3DUFA 3B78A 4ENTA 3OFND 1NYLA 3GA7A 2AQ0A 2F17A 3ROMA 3QI7A 2D3TA 3O95A 3E15A 4G5RA 2QTLA 2YHAA 4US8A 3N7UA 2QN8A 3CTMA 2GN8A 4G23A 3K9NA 3ILXA 2YH2A 5F3DA 4UUMA 4WLEA 2QB0B 1UDWA 4CEHB 3M6MD 1YMVA 3IVAA 4X71A 3GP8A 4N82A 3KTAB 4HEHA 4OKNA 1P3Y1 4KOEC 1WCIA 8LDHA 4NH0A 1V11B 4AYXA 3H86A 5BRNA 4A0SA 4JBIA 3QNUA 3EGIA 3HXKA 1KKXA 3VOSA 3WK8A 4CVNA 4PHDA 3L4JA 4HX5A 3MYYA 2AUTA 2ID8A 2EXXA 4GXKA 1WHTA 1JJVA 3LDUA 4A10A 4ITRC 2FNAA 3L7JA 5ELLA 3S0JA 3NTRA 3BCHA 1X1CA 9ICNA 1IPHA 2IWRA 3CIFA 4YK7A 3IXQA 3H2KA 1Z47A 1GADO 3TADC 2XMZA 4R7GA 4MO9A 2BEVB 1C8BA 1NJXA 5EHNA 3EIXA 2BMAA 2X0JA 4RTSA 2YCLA 1NVMB 3LNCA 3GQCA 2EQ5A 3L49A 2NZUG 1SKRA 3GEPA 3UOAB 2CFCA 1BNOA 3EC1A 3JQ7B 1QH0A 3DLBA 4EZIA 2W5UA 1R0KA 4Z1OA 2B5OA 3L1JA 1S2MA 3R9XA 2VSNA 5H8WA 1U9CA 5JHHB 3E3LA 3KHTA 2Z4TA 4RBNA 5JARA 4KXWA 5FF9A 2YFQA 4MP6A 4KREA 3JD4A 4R2IA 4YPVA 4QLAA 1DKMA 5KFOA 2IPMA 1WMAA 2VSYA 1DDOA 3OLYA 4ZDIA 3P0JA 2FFBA 3BWBA 1JX6A 3TAQA 1RAGA 2IYXA 2PH1A 1XMJA 2NYUA 4YB8A 2DWPA 2ZPUA 4YMMA 3RQIA 3W2HA 2DHDA 3EGEA 2WILA 4FHEA 2IQIA 1SCUB 1Y89A 3QWHA 1PR3A 3U40A 4GZ6A 3PEYA 2NPOA 4CQJA 5DG7A 2P1ZA 2MSCB 3CEJA 4ARCA 5DB4A 5KFRA 5HDBB 2PVCA 4JL8A 4RAQA 3KVOA 2BUBA 2OCLA 3VR4H 4WZ6A 2Z5FA 3G9XA 4OKSA 1WWVA 1C3JA 3GROA 2PGJA 3ANTA 2GAOA 4DSLA 1TM4E 2JLUA 1ZQFA 2PSEA 2PR2A 3FVQA 5FTMA 3H1TA 2W0SA 2XA9A 3C5VA 4P4SA 1Y3CE 3DEYX 3WK4A 1RT9A 3HKZF 1R9JA 1NMXA 2HREA 5FT9A 1FY2A 4L08A 4JP1A 2JEOA 3WYGA 2ZRCA 1QX3A 3LE8A 2ASDA 5IAKA 2JDID 1P17A 2P9TA 1GTZA 2QX9A 2YOFA 3DVAA 5DKFA 4A6EA 1N25A 1G21B 4KN8A 4FFLA 3IOBA 3TIXB 5JY1A 3HJCA 1IJBA 3MJRA 4M53A 1US8B 2Q6TA 4UTRA 5JOQA 2P68A 3ND7A 3A9WA 4O5OA 3X1JA 1Z56C 2X8BA 4FFOA 2C0PA 3HHEA 5J2TF 5EE1A 1KBZA 2ZEJA 3V97A 3ZVMA 4P0QA 4KUEA 4OH1A 3OTIA 3S7TA 2EANA 3QA9A 1LS6A 3T79A 4WDRA 5FYDA 1Z4QA 5E4YA 3HM2A 5C3UA 3PEVA 5LQUA 3TGWA 3CURA 3ROZA 3LDHA 3KEGA 3IMFA 4L8GA 4FFBB 2KZZA 2L18A 2RDIA 3OIWA 3CMCO 4ZO4A 4INOA 4BWFB 3RU7A 4HGRA 5JEDA 4X1OA 4JP3A 2PKYX 2VPXA 1W5EA 4IH9A 3VKVA 3T3OA 2Q6OA 5T3UA 2SKCA 3ZLTA 3NVYA 4I5FA 1N5OX 4NBKA 4W5NA 1QOQB 4B6PA 3G13A 2PRSA 4UE3S 2E2WA 1P9WA 2FV8A 1R6UA 2KG5A 1N62A 4UM9B 3GWZA 3KOOA 1XZFA 5D01A 4RZUA 3L7AA 5SZIA 5DLYA 2HH9A 3AG6A 2FZEA 4N0EA 3PNSA 4CIYA 2A4MA 1YHNA 1CVIA 2UYOA 3LXUX 1MZVA 1SURA 4K9LA 3FKQA 4Y0AA 2BCVA 4K9SA 3O8BA 1J0EA 3DV0A 1QYDA 2QE7D 3DL4A 1SUDA 4PV7A 2JKZA 4KTVE 1SC4A 1MR3F 1G4HA 2GA9A 2CUKA 3EVZA 5F2NA 2N1BA 1ZR2A 3S1LA 1NR7A 3ECAA 2B4AA 4DCNA 5J8YC 4F93B 1SL2A 2D1RA 4TT3A 1F44A 4J0GA 3TVTA 3T61A 1OI2A 4O3QA 2OM2A 3SU8A 2VA3A 3LLSA 5FWXA 3S55A 2GF0A 1FMJA 1M8JA 3UWKA 1RPZA 2OYYA 2N46A 2C3UA 2ZTCA 3KDSE 4H6WA 2GD6A 3E1KA 3DZKA 4RX1A 4KQXA 5A0FA 4HGNA 4QU0A 3SZ3A 4F2DA 2KV2A 2VA2A 4M22A 1SV0C 4Y6PA 2XTNA 5JJ5A 1TK5A 1P4SA 1ZOSA 2HBMA 5DIFA 3WHIA 3SSNA 4R8KA 1XNRB 4M9HA 1JYSA 4K6HA 1CP3A 3ELBA 5WRFA 1W96A 3FJOA 4N7JA 1H2FA 2I7DA 3WRXA 1TO2E 2VQSA 4OM8A 1I6MA 3VR5A 5ISMA 1ECPA 4V38A 3GD5A 4A5OA 3NDBB 3RS7A 1QCZA 2R47A 3ZOKA 5DN9A 1D2AA 3DOJA 3LOUA 1UWCA 3U7QB 2BUCA 1UINA 5K1ZA 4JYZA 4ZGGA 3SX2A 4PGXA 4ILEA 5CXUA 3M8KA 2X15A 4M9RA 1EWYA 1N9GB 1GNSA 3H5RA 3FSGD 4OQ4A 4HAIA 3KQQA 2WFLA 5E0OA 2XEXA 5CVCA 3H9BA 1TTTA 2VEOA 4AF6A 1U99A 4FP9A 1R0WA 3HVJA 1GFSA 4RNOA 4D3ZA 5E1OA 4RTPA 4WXPA 2PM8A 4YHBA 3IOMA 2G5HB 4AWAA 2KIVA 3HSSA 4XUEA 4BP1A 1NV9A 3TTSA 3ZCXA 5EA2A 3OPYA 3E5RA 1PW5A 3C6BA 3Q7RA 2P4HX 1A76A 5INTA 1Y9AA 1H6CA 2E6UX 4EGAA 3RVRA 3N7RC 5KT6A 2D59A 4KYTA 2FWBA 4FZMA 3JVUA 3F2BA 3BWCA 4R6XA 3Q15C 2HRQA 1GPUA 5LR6A 3ZHVA 4NDNE 1I10A 2AZ4A 2G72A 1HDEA 3EVTA 2PQMA 1CF9A 3FUUA 4G36A 1P77A 5JECA 3HR7A 2V74B 1I3KA 1NN5A 1FTQA 3U31A 1NI3A 5T4HA 5TT0A 1PAUA 4QWMA 3ZQUA 5K6AA 4A8TA 2R7KA 2WWXA 4PCVA 3TZ6A 4AWBA 4HVTA 1NK5A 1Y1PA 3EMVA 4KBYA 4FW8A 3AXTA 4KR6A 5IC6A 5KCZA 4AY3A 3P27A 3RREA 3IKLA 2EQYA 4HVCA 1W5BA 4BTVA 1JT9A 2DERA 4LHVA 5KQMA 4ZZ3A 3MRSA 4ZT5A 4WCFC 3GGSA 5ALGA 2D6FC 2OXRA 4FNMA 1POXA 1B8UA 2FVYA 4QWCA 3S99A 4E5YA 4WGGA 1JG3A 4Q12A 2JJ1A 4EFKA 4BZXA 4Q4DA 4D3DA 3ZU6A 5AXCA 2YRFA 3NUGA 1RTKA 3BTUA 4BFVA 2H65A 3F97A 4PX5A 4ECAA 3B3GA 2SICE 1UDCA 5HF6A 2VRWA 4S1PA 4ZO8A 1P0MA 4B9EA 4EF4A 1BX0A 4IQ0A 3FVTA 4L51A 1DX6A 5LYYA 1MC4A 1PF7E 1R6TA 1VKJA 4F7WA 5I4IA 4PEVA 2H1VA 2AOTA 1L3VA 1CJSA 1I4LD 5K0TA 3V80A 2D2VA 1UBHS 3JPWA 3ZWMA 5F77A 4KE9A 3NBFA 4MIOA 1VSUA 1P2SA 2WA2A 3E3NA 3L4EA 4E70A 3WGHA 2BH9A 4P0PA 1CRLA 1QMPA 4C0XA 1C7JA 4AWXA 1T3GA 5DT2A 3CN9A 3PHGA 1MH1A 4KW7A 3PGMA 3TL6A 4MB0A 5IT5A 2IYNA 5C1BA 5DHAA 3VR4D 3RRBA 3SEFA 1BX3A 3T3HA 1WMFA 4RJ2A 1RABA 5BUZA 4BMXA 4N5IX 4Y0VA 1ZD8A 3JAKA 3CLUD 5JO9A 4FYIA 3V2HA 2V5UA 2QN2A 5I4KA 5KG0A 2MSWA 3T3IA 1K1EA 4NENB 2O52A 4CMIB 4J9LA 5C5IA 3F2VA 3CZ5A 2BF4A 3ESYA 3OJOA 3C3AA 2KJ8A 3GO4A 3LIIA 4QGHA 4PYLA 4L15A 4U7CA 3UENA 2I3DA 5IJ9B 2R60A 2X6TA 2BT4A 1XQVA 4EGQA 3I9OA 2DFDA 3C48A 1KK2A 2IEAA 3W5AA 4D2IA 5IFKA 4IFIA 3SEAA 2SECE 4D0GA 5JXHA 2XQJA 1XCJA 1CEZA 4C0SA 3Q88A 3HL0A 3T34A 2IP4A 5CA7A 4UCQA 4M9NA 2HSEA 1MO3A 3KB1A 1L5UA 3IAFA 4ZQFA 3ZD7A 1YXMA 3K71B 2FPGB 5LMZA 1H69A 1LPAB 4OK5A 1C14A 4Z7QB 3LDGA 2XKJE 3V8EA 3GRAA 5JAOA 1FU8A 4O4LB 4QZVA 5LZ2A 4EABA 2ZUEA 4CEIB 1IL0A 1DOQA 1G6HA 1D6NA 1ND6A 2KSQA 3EYAA 3NJ8A 2R62A 2CZQA 3C5FA 2VQ6A 4CV1A 4IC9A 4BYGA 4KKXB 4KDEA 2XIDA 4FE3A 2ENWA 4UE6A 3MQFA 2HSDA 3QEOA 3BH6A 3TTTA 3BJZA 3WP1B 2CJFA 4NCHA 5J2TA 1DAKA 1OYWA 1XA4A 1MORA 5JBNA 2YWFA 5FV7A 1EXWA 4OGKA 4WUVA 5A0LA 4D7AA 3LUGA 4NBSA 3QJ5A 5BSMA 4UFOA 3I5YA 1DHTA 4YAKA 5ESXA 3EISA 2Z95A 1E6UA 5KL1B 4AF7A 4J9OA 3FYDA 1H65A 4Y98A 1YDFA 3M82A 4KWTA 2VJDA 5AI8A 3W9BA 3IR7A 3ZJTA 3AHFA 1II8B 4PPYA 4DDHA 2Y27A 2VG8A 3AF3A 3QV2A 3NGXA 4ID9A 5KYYA 1XRNA 3GK3A 2JBAA 3GPIA 3WFIA 2D2XA 3GB9A 4HX2A 4MV8A 3J81j 5HIKA 1CQZA 5DLPA 3VU8A 3OTGA 3E0XA 2XO7A 2I3GA 1BMFA 4BXOB 3IBSA 2ZZNA 4FYHA 1WXDA 5FTKA 4B8ZA 3DV9A 5KAPA 3PZRA 2WP0A 4IMPA 4YAUA 1EAMA 4ES6A 2YBDA 5AUNB 1Z0UA 7ICIA 1LV7A 2ICAA 3A9TA 5A71A 1S0NA 3JATA 1NFFA 1ST3A 5KFXA 2IZ7A 4WT7A 1KXZA 4C04A 5GWXA 3BHJA 3IDAA 4X1YB 1T10A 1OASA 3G8AA 1FFUA 1HKHA 1EK1A 3H11B 4R66A 3D6UA 1TTPB 3CLUC 1J2YA 5CFPA 3GEGA 3RIGA 4AUMA 5BY2A 3IHWA 3ACCA 5J0PA 4J7UA 5ABPA 3ZW9A 1E3SA 5KI6A 4NE2A 1MXFA 4R8RA 2C5BA 1WW2A 3VZSA 3HDYA 4IGAA 1U1GA 3NANA 4XFJA 2ZT8A 4GE3A 2C0CA 3JZDA 2LDBA 2ZXHA 3GZTB 2ZJFA 4KVFA 4JOSA 4KVGA 1B6RA 3SM9A 4TWRA 4JOCA 2G9UA 1K3FA 1PZMA 5D1HA 1QDLB 1ZK2A 2Y1GA 2FWNA 4WKBA 4X5VA 1FS6A 2ZRFA 3QEAZ 1K66A 4GQBA 2F2AB 3X3HA 1HLDA 3PNKA 3QVJA 1E9EA 3EFEA 4Y2YA 5JTIA 1AS3A 5IS2A 2DTDA 1PZNA 1T5DX 1T3TA 2VNJA 5FPSA 1OZGA 4EITA 1B3RA 3SYKA 3SPXA 3TZBA 1E3WA 1NVWQ 1C9YA 4P9NA 1RS0A 1QE5A 4F4XA 2IF0A 4M1SA 4YN4A 5C80A 2G1JA 3UKJA 3HJAA 3P9KA 1DFIA 5CFNA 4N3CA 3GNLA 4YRDA 1ZUHA 2Z2XA 2ZWOA 4P3PA 2DAPA 8ICZA 5FJJA 2ZJBA 4O2AB 1YI1A 2HHTA 1CUKA 1ZVQA 3CNNA 1T94A 1Z63A 4BLTA 4P3NA 1SG6A 3CO5A 4U8HA 5JWHA 3RRMA 3OKCA 1QHSA 2ZI4A 3WGUA 3LNTA 4UMVA 4FFDA 1XQ6A 3WO0A 3VJRA 4DMCA 1EA7A 3AWIA 1P5FA 1ZD1A 2QZ9A 2INGX 5KG5A 3E7PA 5HCUA 4NM2A 4M9GA 1K7CA 4F91B 3PGKA 3L7LA 1MA3A 3TVYA 4KK4A 3BBLA 1DMRA 3A36A 2IW3A 3A6LA 3JQRA 1RPLA 4RM3A 1L4NA 4YI5A 2AZDA 3QXHA 3MGIA 1IQUA 5CB0A 1XQXA 2C95A 4O1HA 3P8ZA 3P2IA 2FB9A 5U4QA 3GOHA 3WNQA 4F2HA 3R8XA 2FQYA 4JUCA 3OFSA 4ARZA 2I6GA 1P2FA 4BNVA 3HVHA 1GZSA 5EXDA 1ZIDA 2EFCB 3KZIU 3FYSA 4R40A 5F9NA 3EGDB 4HQKA 1W6RA 2BFOA 1PK9A 2C7BA 2Y8EA 3JWHA 5IINA 3Q3JB 4FGUA 3BWEA 2PX0A 4JYBA 4S35A 1CR2A 1I7PA 1NW3A 1YMQA 2JGDB 3PU6A 5B3KA 4A8JA 1VRCA 5HHTA 1L7RA 3SGLA 4KI7A 4OB7A 2KD1A 1N5JA 1AH2A 2C61A 4LBWA 5CIQA 2V58A 4QFDA 3ZEAA 3RSSA 1AQ6A 2RG7A 3SJBA 5CW1A 2PWZA 4PL1A 2C94A 4TKLA 5KFCA 5T6BA 4R9NA 1S96A 3TKLA 4TUPA 1MN8A 1ONBA 2Z83A 3JQ9C 5LZ4A 8ICOA 3MB8A 3AR4A 2YB1A 4GW3A 5LQSA 3GAMA 1ZN9A 2QRMA 1AO0A 1RYNA 4G37A 1Q16A 1HDOA 1X7HA 4X7PA 4OL9A 4UATA 3EVCA 4MVYA 1OHHA 1I2MA 2KVCA 2P5UA 2QRLA 1N5KA 2Z43A 1JB9A 1R1DA 3ZCRA 3X1YA 3RTGA 1U3WA 3HWX1 5ALLA 1O7JA 4W4TA 3QKUA 4DKJA 3ZWOA 4YO7A 4P38A 1NW8A 1W4ZA 1JFRA 5GP1A 3VOAA 4U7FA 2CWDA 1E58A 1H2ZA 3DHVA 4NDZA 1PJZA 4BAZA 1GEEA 3M9NB 1SO8A 5E7QA 1CHDA 5K0SA 3F7NA 3BC1A 4GR4A 1L4GA 3MM4A 1Z26A 3PX6A 2WYWA 4EJSA 4QDUA 5BMVF 3K75D 2E18A 2PWBA 1J0XO 1QH1A 1N4DA 1PL0A 2DPYA 5TQVA 4H7DA 1JZTA 4ZDWA 3IUPA 8ICPA 3SICE 5TARA 1JDVA 2A0YA 3EOZA 3OC6A 3RS8A 2AOUB 3LBNA 3D6JA 6YASA 1B73A 5DB6A 1QAQA 1K9SA 1VECA 3OOYA 4LX8A 1VKNA 3NM5A 3ZXIA 2P40A 3DR3A 3HB9A 4JLOA 2ODEA 1PT6A 4MAAA 2HXYA 1DK2A 2KKVA 1E9RA 3TRIA 2Y92A 3GFGA 4N12A 2DL0A 2GS9A 5L9AA 4ZHQF 5CM8B 1SPBS 2XPCA 4ZI7B 4GOLD 4CIBA 5ADVA 1JVNA 3CH6A 1ULBA 1JUDA 9MHTA 3N2EA 5I7SA 5L3QA 2IOFA 4BGDA 1KTIA 2WJ6A 1IK4A 3MG9A 4IQUA 4PTZA 1Y7LA 5A4AA 4HF7A 2PNJA 1EFAA 3PR5B 2XLCA 2FOXA 5FAXA 1RWMA 3KOYA 5JRTA 3B9PA 3HW8A 2CSXA 2D62A 2H07A 4WKOA 2ZIFA 4RMIA 1Q21A 3AKDA 3TEFA 3SJZA 1S3GA 3QVWA 3OFJA 3QFSA 1TX4B 3FPEA 1J8FA 1WTAA 3NDJA 1L8OA 5L7TA 4NOJA 5K0ZA 1GITA 3L1UA 4R2XA 3SDBA 1NBEA 4HVLA 3U7HB 3DW3X 3IPCA 1DAHA 1E2DA 3DMPA 5IUNC 4YMIA 1B26A 2DUJA 3CC8A 3O47A 3QVUA 2PH3A 3I53A 3IT1A 3UHPA 1YZ7A 2W2XA 1JAZA 3ZE2B 1GAJA 3CGWA 4TMZA 5I47A 4FKBA 1ARZA 3QLJA 2CVZA 4WXMA 3JPOA 2LGJA 4JXKA 2EU8A 4NP6A 2Z5VA 1N3YA 4P98A 2FR0A 1J5PA 4ESHA 1CY6A 3A4IA 4GM1A 4F50A 3E8MA 1KJ9A 5EWEA 2EW1A 2QLJA 1T8UA 3BMNB 1N7IA 5DLEA 2Z2IA 1XD2A 3MFIA 3EEFA 3B6ZA 1XK7A 2F1OA 1F6DA 4O08A 3NUZA 1RYSA 4G2TA 1BJRE 1JXEA 2O1EA 2VF7A 2ZQ5A 4I2VA 4JB2A 1IY8A 1OUMA 4EKDA 3C16C 5FBHA 1TC2A 3CWQA 1HT2E 4OFWA 2P35A 5C46F 2PVSA 3GVCA 1SUSA 3VRHA 4IWXA 5LNK1 1JLLA 2FZKA 4GECA 4NJEA 2YASA 5EE5B 3IELA 2PI4A 1C41A 5U4XA 3BOSA 3BXEA 5ALWA 3EH1A 1LWNA 4OUDB 3ZWPA 2V5AA 3H40A 1NU8A 4FIDA 1CYDA 4PBRA 1QKJA 3FWYA 3H75A 3UJ7A 4L57A 2XBMA 2BI8A 5KU7A 3Q2OA 4I6EA 1OIXA 3TLCA 3K4GA 5EWJA 8ICQA 4KXFB 4PHHA 4QBTA 3BSWA 2IL1A 1XTUA 2IODA 5JSFA 5L51A 4LWOA 1KJZA 2JFFA 2E0IA 3GRVA 1TAMA 2JFYA 1JHYA 1UEIA 2QX4A 4DA7A 3K0CA 3R3YA 3IAM1 4UE2A 4JC0A 3D7MA 1JYEA 3R3XA 4LA4A 2M6SA 1PG5A 1F12A 1WDMA 1QGED 2NYRA 3AM9A 3FJYA 3G8CA 1GHTA 2W04A 1T1JA 3VO8A 3K4PA 4UQOA 2W70A 1KE1A 3IP1A 4OI1A 3L6UA 2IYTA 4I6JA 4W82A 3EMKA 3OT1A 1VIMA 1ZONA 1GL9B 2EKLA 3TSOA 3VPDA 1K0UA 1XRLA 1SU4A 4LC1A 1S89A 2P0YA 1TD1A 3ZKWA 1QHNA 1THZA 1ODCA 3JR7A 3KKMA 1J09A 2R48A 5C53B 2ES4A 4XWGA 4IGFA 1FB5A 1EB8A 1XI2A 1F8XA 5EY5B 4C6TB 3H3FA 2LDXA 5EMLA 2XWPA 3ST7A 4M0LA 2FU5C 5B1YA 4Y2TA 4XARA 3U3OA 2E8PA 1O6GA 3F3MA 1D8BA 3TJZA 4EPWA 3PPVA 4HP8A 4IIDA 4KAXA 1PVRA 2XNCA 2ID4A 3KYCB 1W581 5EJ6A 5FBWB 3STUA 1UOQA 3LPLA 3LPDA 2PT5A 3UG6A 3VHLB 4NJ8A 4F3YA 5TS3A 1CR0A 1TEVA 3PO4A 3C87A 3ZWXA 5CP2A 5AT1A 2ZSAA 3V6LA 5JISA 4X3PA 3GCGA 1AUQA 5HBRA 2KFNA 4Q6BA 3ORRA 5EG5A 3K6SA 2C88A 3AESA 1XTBA 2FG6C 2IGTA 3D6HA 1SQSA 5JCOA 4F6CA 1FX0B 3RLIA 2DPGA 3T35A 5C18A 2O8EB 5REQB 4PRLA 3OPNA 4MGYR 5J2UA 1JECA 3LXMA 4LSMA 2PJZA 3EXG2 4UXHA 4AUKA 2OZLB 4EATA 1F8GA 4KR2A 1LDNA 5L3VA 4LNUA 4QASA 2C8LA 2OV1A 4LSGA 4EA6A 3I34X 3MDCA 5ALHA 5AI0A 1NXQA 4DJDC 2ZQYA 4H7FA 1SZHA 4ZZ1A 2Y99A 4KWEA 3H1FA 2I1WA 3JYQA 5BPFA 3BHNA 3HCBA 1VCOA 5C1IA 3UMBA 3C1ZA 3EZ2A 1HA3A 3NHFA 1ZVVA 5EE9A 4U2FA 1HX7A 1Y4UA 3I12A 4UHCA 2J3EA 1D2RA 2P2YA 4A2WA 2PK3A 3A27A 4Q1VA 3R3ZA 5CHGA 1LNQA 4X8LA 2Q4RA 3P9XA 4C0ZA 3FB4A 3T9DA 1UQVA 5JSZB 4DJJA 3ZBQA 3CSSA 4PG8A 3ZVLA 4DCSA 1DIGA 4X65B 1VJGA 1ZQBA 3RIEA 2J5KA 2QVZX 2JGKA 5BURA 4CV3A 4LJ5A 3I2IA 2CHEA 2D8AA 3BQNB 4KXNA 1T2NA 4IAOA 4I27A 3IVRA 1VMEA 4YVFA 5TE9A 3O8NA 3LSYA 5L1IA 3GZNA 2B9EA 7ICUA 1RRCA 2TECE 5EUQB 5GGYA 4PGQA 1IAVA 5C52B 2AG1A 1ZA1A 2FSSA 1XBTA 3G2KA 2Z1NA 4O5KA 1ILWA 4CKYA 13PKA 3LF2A 2DBRA 4GXRA 3KLPX 4BO5A 1U04A 1P5RA 5DTRA 9ABPA 4MI9A 3H6HA 3BM5A 3PIRA 3FNGA 1KZHA 2PHZA 3G7UA 4F6RB 1V1MB 2PFSA 1CFZA 3WL3A 2CHQA 2P2NA 3FCXA 5KT4A 4NZOA 1U7OA 4YAIA 3ZD6A 2A86A 3BEOA 1T8WA 4RS3A 3UB3A 4JUAA 5KFJA 4GF5A 5TJHA 3DG9A 3GLRA 5KDDA 1QO0D 3R24A 4F11A 5EZQA 1R4MB 5I8WA 5EJMA 5GVRA 3A6PC 2HJ9A 4DC1A 2Q5HA 3DE2X 1H4QA 2YS6A 1M1UA 3NHPA 3E9DA 4QC2A 3BGSA 1W9HA 1TO1E 2AE1A 1RYBA 1HNXB 3VR6H 4V1CB 3A4VA 3FWKA 4PAOA 4PHCA 3N2GB 4JBXA 4WLFA 5T3YA 1N63A 3N2ZB 4K6MA 2X9NA 4EYOA 4X97A 1LBIA 5K3FA 3AR9A 1R6BX 2YTUA 4B3TB 4M7RA 3V7YA 2RK3A 4ZHQA 1BW9B 3M81A 4CODB 1L3TA 4HPWA 1LI7A 1MF7A 3GFBA 4U3JB 3ZCVA 5F2EA 4X7BA 3AQ4A 3HN2A 2IEGA 3C6KA 2XRFA 3VSBA 3RK4A 4UU7A 1GDTA 1Y8ZA 2ZUVA 1P9LA 3DOFA 2WD7A 1I4TD 1SXJB 1VLZA 2AHOA 5ALKA 2ZI6A 4NE7A 2D4HA 2ZIWA 4CJXA 4PR3A 3MCVA 5FWAA 4H0CA 3F9CA 4WBNF 5B58C 2P11A 3NWOA 1HEKA 4YMWA 4AF8A 2NU6A 3MMSA 2EKQA 1HRDA 4PHGA 5EIHA 2FZCA 5DXFA 5L4SA 4ZREA 3KOZA 4LV8B 4II3A 2O1XA 5FULA 1ISFA 5AW4A 3JVVA 4BX3A 3GIKA 3F73A 4YMNA 2EEZA 3E70C 4TXNA 2BFBA 5CB1A 4UQPA 3E05A 4Q7JB 3LIPA 3CUWA 3VVMA 1XRPA 1NHGA 3I58A 5H2FU 1QRRA 5JDCC 1WBBA 3O90A 4FR5A 3KJGA 3TQTA 4G1BA 1U81A 2ORED 2WDPA 4Y9TA 3ND8A 3LQ2A 2C28A 1K4MA 1N3BA 5AHOA 1OB5A 4IWYA 3MR2A 4G26A 2NV6A 2ZTMA 5TX7A 3DOCA 2J3LA 2OQIA 1TIBA 4Z4IA 1KGSA 1U8UA 2CL5A 1EM6A 2VPPA 1RVDA 5CX4A 2X2OA 4K6FA 3BL6A 3GIIA 4D46A 1V8FA 1HDGO 4KDRA 2XE4A 1JHDA 3T9EA 5F21A 4L9AA 5BWOA 1AHIA 2YQZA 2AGPA 2BFDB 1UM9A 2QYTA 3NIGB 5TF0A 3MBYA 4F56A 3U4IA 4JKOA 2P62A 1FFAA 4QNNA 1ZLYA 2NUTA 3TJMA 1DUIA 1A9YA 1G20E 3RLFA 2P2GA 2HEGA 4NNPA 1OC4A 7ICEA 3PTAA 4LVSA 1VG8A 4CCAA 1HSZA 3RJFA 1PR0A 1CR1A 4JLMA 2H85A 3F3YA 3V5NA 3H2JA 1IVSA 2R1VB 4B79A 1Z8HA 3KAQA 2F59A 3BF7A 1NWHA 4KQIA 4HXGA 3U3KA 4IH1A 3FDJA 2PV7A 4CKWB 4I9HA 1NP7A 4TM8A 4WQMA 3PX4A 1E79D 1RKVA 3NBUA 3CNQS 2XTJA 5K8LA 1RTTA 1YQ9A 4L3VA 5THQA 2ADMA 3I01M 2QLFA 4TSKA 1TNDA 3A3KA 3SHTA 1ZJ6A 4QDKA 4CU2A 5KVVA 1KH2A 2CCJA 5BR8B 2GO1A 1BE6A 3WGQA 4ILKA 4LF8B 1JQ3A 4YRPA 4HRVA 2H1HA 2UZIR 3AR3A 3EJWA 2C7VA 3HKCB 5BW4A 3G0GA 3GFOA 4PAGA 2EQAA 2C2XA 3RWBA 4DF3A 3GIWA 2P4UA 1KYQA 1NLUA 5KFDA 4C7JA 2AZTA 5DHFA 5D1NA 5B1DA 2PJRA 1EX6A 1XRRA 3EFHA 1B0ZA 1WMDA 1OLOA 4GMFA 1W5SA 3EIUA 4UEJA 4YASA 2W2LA 1UZUA 5HK9A 4CG1A 1IN8A 1WA5A 2LE0A 2P9CA 3Q1KA 1QTIA 3RW9A 1WNTA 2QG9A 3IPRA 1MDBA 3W8DA 3HYRA 8ABPA 3I73A 3TXXA 5TR9A 2OB2A 1RMTA 4LYYA 3I5AA 2PLAA 4U7HA 3MGVA 4PLHA 3SYZA 5DN6D 4G84A 1WKCA 3AJ9A 3FMOB 5FLKA 4U6NA 1P2DA 2HK9A 3MFQA 2J6IA 3CISA 2C8KA 1YH3A 5JO0A 1KK3A 1V8PA 4X85A 5JAQA 2CL7X 4F3CA 1L0BA 1K5OA 2PEYA 1QVWA 3ZLJA 4BWGA 2QNRA 1Y80A 2I03A 1NHWA 5KVQA 4RQNA 3AU9A 1W34A 3F74A 3BXOA 4UC0A 1Q46A 3EQ7A 5A4FS 1ZCJA 2ZJ8A 4C0WA 3H2ZA 3GYGA 1V25A 4CM8A 4G86A 4L75A 1T3QA 5K8TA 1YULA 5J0XA 2GLEA 4N9QA 1T8PA 3V32A 2ZJ5A 3QYJA 3TO5A 1LZKA 2H3HA 1TRHA 2F2TA 1Y8AA 3MOSA 2C4HA 4LDRA 3UKDA 3CPJB 2CBGA 4O2BF 4CMAA 4D43A 2AU0A 2OYCA 2GASA 3L3FX 3RRGA 3JTEA 3V7FA 3PX0A 4DF4A 1GQQA 1K5PA 1T9GS 3P9ZA 3DNMA 1L5MA 3UXNA 1B23P 1D4AA 2CXXA 1IYZA 4CDMA 2VJKA 4Y7CA 2BZSA 5J5CA 2H92A 3K1ZA 3KR1A 4YS6A 4UNPA 4EHBA 2FG5A 3OX1A 3SVTA 2BFNA 3C1OA 1JWLA 4DRXA 5AM2A 4AS3A 3ZD9A 3I32A 5LQMA 1CVRA 4EG3A 2CMGA 2V6BA 1CVLA 3LTEA 5AKZA 2P9FA 1FRQA 1WEHA 4H1HA 4LGVA 2Y3IA 3OKPA 4PXSA 2FN9A 3NHSA 3SAHA 1Q20A 5IEBA 1QFSA 3D4LA 3UXOA 3P4XA 4MAMA 2LYAA 1QDEA 3RAJA 2IH2A 3TDMA 1CQJB 5F73A 1DUSA 3JW8A 4IHAA 4RIEA 1HT1E 2EAPA 3O84A 4ICIA 5CVJA 2X9LA 3LTNC 2RRDA 1UWLA 2QAGB 4F72A 2XTZA 3FYUA 3ZWDA 5F9HA 4RQUA 2IX9A 4M9JA 1E64A 4ENUA 1W49A 3LP5A 3D0OA 3BRSA 1NDHA 2GEUA 3LXXA 2FLLA 3E8XA 2Z2KA 1EWQA 5JRDS 3ETNA 4AQ7A 1BWQA 3DE3X 1KETA 2GCOA 2PN1A 5FPKA 2Q6VA 1ZYUA 1CS0B 3PW2A 1ZMBA 3JQAA 5KBYA 5G4KB 2A9FA 2FLNA 2OTCA 3MLBA 1VPWA 4C4PA 3BD8A 2V97A 4IDFA 3PHHA 1MKYA 1XO1A 4F6LA 2P9GA 5JD5A 4DR7B 3GCDA 1U9JA 4N40A 2JEFA 4RQ6A 5ICCA 2NNWB 3NUQA 1E9SA 1BSVA 3O4GA 3RVJA 4NBNA 1I13A 3W5DA 2ON6A 3EG5A 4B40A 4BN5A 3OA0A 3AZQA 3PTLA 2VXBA 1JMYA 2W3SA 5A06A 1XVLA 1AB5A 3U0BA 1RXEA 2QORA 3TKAA 4XFKA 4B4OA 1CUWA 2WU1A 4WBNA 1BXGB 3NHWA 3A70A 4DS3A 5DB8A 1GFWA 3RE1A 1PV2A 1M6YA 3BAFA 4C7ZA 3CW2C 1UADA 2ZE7A 4MVJP 1ENYA 3W2EA 1I0ZA 1QIGA 4H7HA 4MCHA 3COPA 1V41E 1KFDA 3ORHA 3E4DA 5H68A 3MJFA 4H7EA 2CLIB 2KEYA 4AP6A 1QLHA 3V4RA 4POOA 3CEPB 1V9SA 5HM8A 3QX7A 4YJ2B 1NYRA 1IXRA 3DFUA 3NVMB 2JH8A 4KGVA 2VP0A 2HDWA 2E4XA 4WXHA 2HCTA 2HMWA 1NJZA 2P7HA 4HDNB 4XW2A 4D5EA 5PGMA 1FS4A 3BICA 4KMMA 1E7QA 1SC3A 3CZCA 2F9MA 4PLWA 2XUGA 4DMFA 5H82A 4RSMA 5EJ4A 2AXNA 1VLJA 4URZR 1NVVR 3GRPA 4NRDA 5TGTA 5KEIA 1UZLA 1PNQA 2ODPA 2QPAA 2YHIB 3S2FA 5EFOA 3QPUA 5K0NA 4ZOQI 4YJGB 4QO7A 5NLLA 5DLDA 1ADFA 4GLBA 1XA0A 3TRFA 3IP8A 3IJEB 1HY3A 2QRVA 3ZZ1A 3FFBA 3GC6A 2IA5A 3VJKA 4IDQA 1GCAA 2J9FB 3RRNA 2BI7A 2HBKA 1II9A 2ZJ6A 4XIGS 3ESXA 1JGTA 4QGAA 4TVBA 2XQGA 3K35A 4B7ZA 4UM9D 2XY4A 1ODFA 2JGNA 5I7FA 2HXGA 4R9SA 5ALYA 4UQGA 2VK8A 3M7DA 2GDZA 5JCPA 3C98A 2QDKA 4GNKA 2NOAA 1X6VA 2AX4A 1TM3E 4CT0A 1LRLA 1H85A 3FX2A 1F2UA 2H17A 3FMPB 3SSOA 1TJ3A 1XS9D 2DQZA 4H3HB 3KSRA 2WF6A 1V16B 2OBMA 4LWZA 4JQOA 1C1XA 3Q3EA 3UQ2A 2G9NA 4KE8A 4R31A 2FPIA 2AFIA 4P7KA 4R84A 4RPGA 5AW6A 3HYTA 2ERYA 2XNKA 3FPBA 1T25A 1OAKA 1QAOA 3VU9A 1ZIYA 2ZUDA 3PQCA 3V33A 4MEXA 3OCWA 1U2RA 3LHIA 5EHGA 1D9DA 4L4ZA 4OA5A 5IK2A 1V35A 1COKA 1BHSA 2Q0ZX 2G80A 3GUVA 2J9XB 1M76A 2XBUA 3OE7A 9ICUA 3M6VA 5I5GA 2RB4A 3QFCA 4ZQCB 2XHEA 4OXIA 4GS5A 2QP9X 4DMMA 3W5BA 4WJKB 3LHFA 4YV1A 4GSKA 5A4IS 1LBSA 4B73A 2VXYA 2XMQA 3WGYA 1PQPA 2VTKA 1B8VA 1A5AB 3OQIA 1DWUA 4M49A 3KVRA 5LJIA 1GA6A 2WJHA 5F2KA 1FDSA 4MJLA 5K8CA 4B45A 2AT1A 1LDEA 5KFYA 1T4BA 3E9ZA 1UZMA 2AN4A 4D1YA 3BX1A 1LQTA 2ZAGA 3QBEA 4YFVA 2FEXA 4EIWA 5K3BA 2MSLA 3BL8A 4PFQA 3FPGA 1SVKA 4QZEA 2OHXA 1Q2XA 1W6UA 4R41A 2W2KB 4KPUA 3UUWA 2UVUA 1BZYA 3N7AA 4PRZA 3IM1A 3OKFA 1AQLA 2A88A 1RPJA 3H8VA 3IDOA 4NCAA 4UZSA 2VUSA 3WWCA 5AIBA 3NG1A 1ZQHA 2O0HA 1FFVA 2MU1A 2QDXA 2Z4SA 4TMKA 4O4JB 1RE0A 1C3OB 5F5XA 3G7SA 1VJCA 4FILA 4X1IB 3MT0A 3L7NA 4ED1A 3IR5A 3ILHA 1K98A 2OOSA 4GI5A 3V3KA 3TLGA 1XAGA 5GMOA 1E7SA 1WZIA 4WY2A 5IHXA 2GESA 4YYEA 4GVLA 3AU2A 2C5GA 2WNHA 3BRCA 1A82A 4GZMA 3LW7A 3IAXA 3N2LA 2AEJA 3OE4A 4R71A 2MINB 1IZ0A 2IK8A 4KPGA 3GN2A 1QHHA 4MV9A 4YP0A 2VYNA 3SMQA 3WGLA 2DYKA 2IYQA 4GZ5A 1DT3A 1MNQA 2IHUA 3N53A 3P2JA 3VR2D 4C76A 2I4TA 3MS2A 3D4PA 3HO8A 3VBCA 2QS9A 5AOVA 3RVLA 4DLBA 5AKHA 3FF1A 3UK1A 1EUCA 1SQFA 3QU2A 5A9RA 3DWFA 3AW9A 5HOQA 4Q9DA 4I9FA 3PJFA 2FPPB 1Q50A 2HW8A 2HEIA 2QARA 3TPZA 2IYYA 1VKZA 3DXXA 4D9JA 2FLVA 2WMNB 3SHWA 3NKVA 3UJAA 4XB6B 2W9BB 3CH7A 1RJFA 4P7JA 2QPLA 5D5HA 1XALA 3R0IA 5IF9A 4XPZA 3KQPA 3PW4A 2UVWA 1HDYA 4YRNA 2VWHA 3T52A 1YBVA 3RRFA 3OTOB 4YRZA 2G71A 4K1XA 7REQA 1JG7A 3I2JA 3ML1A 4OAQA 3WA7A 4WESA 4H1WA 3FPLA 1YC5A 2NP7A 4L50A 4KFCA 5JNVA 5BYAA 4TLLB 2I71A 1TCUA 2KB0A 4BTEA 2JJ2A 3L07A 3EZLA 4I14A 2V5VA 1EP9A 4R8UB 4LY3A 1UP4A 2Q5OA 3BIFA 4NL9A 4F2PA 1BMDA 4F8RA 2PLWA 4MV0A 3NP7A 1PR2A 3ODGA 2H1SA 4QBKA 4BFTA 1JB1A 1XR3A 2AFVA 1GOTA 1PK1B 3Q9LA 3CX7A 1XF9A 3H4TA 2C4KA 1EIWA 1KL7A 2QGNA 5DULA 4EYKA 1ZQGA 5GPBA 1GT6A 2KE5A 5CJPA 9ICIA 1R4NA 2WWYA 1YCGA 2GK6A 1UPAA 2D0DA 1EFDN 1E2KA 3OM1A 4BL5A 3Q8SB 1K6EA 4GPEA 4IIBA 4QLBA 2ID7A 1JEOA 4OQDA 2E82A 5F35A 4YTEA 1RRFA 2E5LB 1EK6A 4MWSA 4Q4HB 5TVKA 1Q7BA 1SXGA 4BWYA 4FJ0A 3SQIA 1HNZB 3AFGA 1IBMB 4RACA 7ICKA 2IVZA 4QUBA 1L1FA 4BJHB 1CJKC 5ALOA 3BCUA 3QXSA 5LKAA 2DSTA 4KDCA 2FXIA 4PC7A 4PO1A 2I9PA 5JQWA 2DBQA 3JQPA 3MWDA 4LYGA 2DR3A 5ECYA 2K87A 3OZVA 1E1QD 1K8XB 4RGYA 3O9MA 2KP7A 5IDXA 2JB9A 3GVIA 4RD3A 2PR7A 3DJFA 4FOTA 3ABOB 1FDVA 4KMSA 1CF2O 1O89A 1I0IA 1Q1QA 3ITDA 4UPVA 3QTBA 5KG3A 3UIEA 1USIA 3D8SA 1L5FA 1UOPA 1D4ZA 1F5SA 2OECA 1N5MA 1UODA 5IIJA 2H2HA 2V6IA 3EVBA 3U13A 2JRZA 2RG1A 1M1NA 4ER0A 4MW5A 4DUYB 3KXPA 4QYIA 4JH0A 1J2RA 5T7BA 2EIHA 4G4SO 2XODA 3PWTA 2FUG1 4NCNA 3TK1A 3WWOA 6REQB 3O31A 2GSDA 5JJLA 3AHCA 3UMSA 1XTKA 1PLLA 1TUBB 1RXWA 2MSEB 1VHLA 1GTG1 4N3AA 1MIHA 4MGEA 3C3DA 1G9TA 3EWAA 4PY2A 4TYYA 2E3TA 4JI6B 3SBDA 1NVBA 1GNVA 4KQ6A 1VYVA 2DLCX 1AKNA 3BDIA 4KXLA 1KVSA 2DQ4A 5GM1A 1DC3A 3OY2A 2XUIA 2NTNA 4YP5A 1YWGO 2VZLA 4RFSB 3WK5A 4J91A 2CLMB 2C8JA 4WJZA 4NK4A 4OCZA 4JI1B 4KXVA 3V8PA 2WWVD 2DWUA 4F2SA 3UMYA 1ENPA 3WGGA 5C7YA 2AEFA 1RVV1 3AIMA 1FF9A 4RKYA 4ZEWA 4DDWA 3DL7A 4PYIA 1Y8QB 4YV0A 3PL1A 4EVQA 1B4DA 1RPAA 1ZIXA 1NU6A 3EVEA 2V4MA 1X7WB 4B31A 4HEQA 4QUJA 3JPQA 5I01A 2I7VA 4GGOA 3TB4A 2Z1DA 4AY2A 2VPQA 3OZAA 1PJAA 1TXGA 3O2QB 1IONA 2XMSA 4H6XA 1YFJA 3ZGVA 3GOQA 9ICSA 1OTXA 1HFKA 4QOEA 4BWMA 1SOAA 3WS7A 4Q93A 2IPAB 1Z16A 2YWEA 2Z0MA 1R0BA 2D5LA 1JSRA 4Z8YA 3UUEA 4BS9A 1W2HA 4Z0TA 1HO3A 3KXDA 3KTQA 2G5CA 4GE0A 3R9WA 4UD6A 1RWWA 3DF9A 3IPYA 3M4JA 2LR0A 1ZUD1 1CDEA 4KIJA 4M8IA 2QMZA 4BB6A 4MKHA 2BM8A 2C2ZA 2FMTA 1R8JA 5BOLA 1AO3A 4ODIA 3DDUA 4QEDA 4CM3A 2I62A 5C1OA 5H1YA 3AUTA 2PS1A 4EY6A 2P69A 1JDPA 1G19A 1X7YB 5AW8A 3P2OA 3VHXA 1QS0A 1UPFA 2IUYA 4I3GA 1U0LA 1V9LA 4K9NA 1KI6B 2PWAA 2YMLA 4B6FA 1ND5A 3SBOA 4Z49A 3OU6A 2JAQA 3OZUA 5B58T 1N6RA 4HRXA 3EEOA 4GGMX 3M1YA 4QUGA 3LX5A 1DTWB 1FP2A 4CM1A 4MR8B 3GJ3A 4PQGA 1ELOA 4DCGA 5DQGA 4ND8A 1JIJA 3DBHA 3PF8A 4YP1A 1U9YA 5DGXA 3N97B 4V3BA 4EQ6B 4MZDA 2UZ3A 1DEXA 5I8PA 4N03A 2HRBA 4AXXA 5JS1A 5FTWA 4DA6A 1V95A 1LX7A 4KN6A 1C9DB 4E1AA 5HYVA 1RYYA 3RSQA 1I7QB 4QECA 4Z6FA 2YOHA 3LPNA 3OUZA 4JJZA 1V97A 3U17A 1GDHA 5JV5A 3I4CA 3MWYW 2AJDA 3M33A 5JXWA 4DUGD 3PPXA 4YUXA 1RAFA 3PQDA 4RE6A 5JDIA 5I9TA 4FEYA 4KTTE 3RUIA 4AT1A 3DDZX 3Q4GA 1ZQRA 4I66A 1QTMA 4TYQA 5HFNA 5JWOA 3OCZA 3NDRA 3I6QA 2A67A 2BTQB 3G9TA 4OHKA 4R51A 4I2FA 1L4BA 3UJDA 2JAWA 1GM5A 1SD2A 1XU7A 2ALJA 1XPJA 1W1WA 1P8AA 1ZJZA 2R6R1 5C81A 4F5WA 3WL4A 4ZMSA 5JD6A 3NT4A 1GGNA 5CFZA 4C2AA 1B6GA 1E6WA 2VJCA 1RQNA 3NATA 3NHAA 3K5IA 5E6UA 1R6XA 1OMOA 1Z75A 1VXRA 1AQYA 2LYHA 4BEVA 2Z08A 3FYTA 3DVAB 4P3YA 1RM3A 2DPHA 1SB3C 2NLOA 1ZBQA 2GTIA 3OHMA 3SM3A 4Y2SA 5EJ8A 3QX3A 3DTVA 1HYHA 1TYZA 2NUPB 1IG6A 2ZRIA 3AIIA 4TV8F 2CPRA 1WVMA 4HAXA 5AWFC 4LV5B 1BXRA 4A23A 4KV9A 1WP9A 2GJKA 4D0NA 3VKHA 1JIQA 5A5DA 2OILA 4IICA 4PVDA 3OHAA 2FFQA 2ZJ1A 4V0OA 5AUPB 2HK7A 4DMKA 4C6SA 3FWZA 3NEAA 1UT8A 4TKUB 4K3UA 4HH4A 5ICFA 4DS5A 2VHUA 1ZWLA 2Q3FA 2KX7A 4X63A 3PX2A 1WD7A 4MB2A 2O8FB 4TLBA 2X22A 5B37A 3CYFA 2WP8J 3R7LA 2GZSA 2GRJA 1F20A 4F7DA 3JCZA 1T34A 2WSMA 1ECCA 2B1GA 1U7TA 2HWUA 4URXR 4UEQA 2XAUA 2P5SA 3SAFA 4LPSA 1X7XA 4RELA 4KE6A 5L3SA 2H3IA 5CG1A 3EY9A 3VJMA 1OA1A 1UEJA 3PT9A 3A6FA 3VC3A 2QLMA 4NJMB 4P0TA 4E2WA 5FL7D 2YFHA 3WQQA 4MRSA 2HX1A 4IIXA 2ZBRA 3TDNA 2VDRB 1OSNA 5CXSA 3GCXA 4DF8A 4BU1A 5IC5A 3RYIB 3KL2A 4PQRA 3GWGA 3CZ9A 1N2CB 2Q5EA 3D4BA 1AMOA 2ATCA 3EPJA 2AZXA 4RQ3A 4RJJA 3A1VA 3VCBA 1E3EA 3DV0B 4MEAA 1IXKA 4O63O 2Z98A 4PLYA 5FLYA 5HHIA 1YUBA 3MJ4A 3C39A 1XOIA 1XEAA 4TV9F 3STYA 2G63A 1HDRA 2PIAA 4HUQA 2DLDA 3EZXA 3ASZA 2P0EA 2GHQA 1DRWA 4HFMA 4LXGA 4LJ4A 4PYNA 4HGYA 4N49A 2HK6A 4EZEA 3D2NA 1AGXA 3FZYA 4OQFA 5FYQA 2H3QA 1BWRA 3SN6A 4Z2YA 1NLFA 3DMNA 4RC9A 4IS7A 3RVNA 3KZKA 3JPTA 4CMJA 2WE7A 5G5HA 2ZYHA 1EDDA 2J30A 5BT8A 3T7TA 5BNIA 1MJ5A 4UBKA 4WCVA 4PYJA 2AQKA 2V7QA 5G3ZA 1U2EA 4XJXA 4JX9A 2GHRA 2UVRA 3RYTC 3DP7A 4IXWA 4C4AA 2JJYA 2B4KA 5J2IA 4E4TA 4OJMX 3MINA 3I0MA 2QL7A 4FBTA 3SV4A 4HAWA 5B36A 1HQDA 4AICA 2C4TA 4F4IA 4NC9A 2OYRA 3PC2A 2AC7A 1RC0A 2E1EA 3IUYA 1Q0PA 3ZWQA 5EQDA 4EO4A 4PZYA 1N1MA 4OO1J 1CTQA 2DHQA 5TMDA 2E1PA 3ESDA 5DYYA 2P9BA 3AV3A 1IJEA 3T5AA 2IU6A 1OX6A 1T1RA 4S1OA 3LCCA 2OUIA 1YBAA 1YZVA 4EJ6A 1CQWA 1SV4A 4ETIA 1VE7A 1L4YA 4YQYA 4X00A 1C3LA 1CUGA 2Y0SF 4L7QA 4RA9B 1H5NA 2ORWA 1U1IA 2D2IA 1HDCA 4O4HF 1FQKA 4RPIA 5HK8A 3AUFA 1NY6A 3CXRA 3DPIA 4DSOA 2WNIA 2ZSJA 1HE8B 3NB0A 2A5FA 3NJ4A 1U9IA 3VKUA 1C3XA 1DC5A 4YGYA 3HB1A 3SY8A 2PFGA 1DBSA 3QU7A 1YHYA 1P7WA 4FMCB 2DPJA 1UFKA 3IV6A 3DM9B 4B48A 4UB6U 4DEYA 3D8TA 3GHHA 4QUDA 3RHSA 3MERA 1LUAA 3COWA 4UPEA 4GL2A 4WWHA 2O8BB 2B69A 2I2FA 3GY0A 2WWWA 3U3RA 2WF9A 1X1EA 2OCGA 1G21E 4S1TA 3IP5A 2YJZA 1NYQA 4KPFC 4AK9A 3E9RA 2FJ0A 3HFJA 8MHTA 3OEHD 4B2YA 4Q16A 2JAXA 3ZU2A 1ECJA 2FFHA 4GPZA 4PW0A 3DHEA 3TZCA 5BYBA 3GNSA 4G65A 2HCRA 4KNVA 5TEVA 1WV0A 4DSEA 3GG9A 4P36A 2O3SA 3CRNA 2OD7A 3N2KB 1OR8A 4WASA 4PYKA 1ZU5A 1TAHA 5CNMA 1JALA 1G8GA 4M9SA 4JSTA 2YMMA 4LQCA 5LP1A 5JPCA 1NN0A 5K0FA 4HDSB 2Z5GA 3Q3VA 2R1UA 1E0AA 3QK7A 3DA8A 4F46A 3VH2A 3BBPA 3NEYA 1R15A 1UKCA 2RIRA 5CDUA 4X3OA 1ZXIA 2WUDA 3SR4A 4R81A 2FK8A 2DCUA 1D03A 4J9RA 3OZFA 5CK5A 1D2MA 3F4KA 3O6VA 5K3DA 3WLMA 2OFWA 4QHSA 1Z5OA 1KZ9A 1V6AA 2FRDC 3ANNA 2GD1O 3U4GA 4W9NC 1MABB 3O8LA 3CUVA 2PKCA 4A0FA 4GD3Q 2B9VA 5CYGA 2ZDHA 2C2HA 2VYQA 4B76A 1JDNA 4G0PA 2FSGA 2C2DA 4JD5A 4X62B 1JEAA 2C59A 3F6PA 2PRJA 2HO5A 4G0VA 3RNOA 2GN9A 5AM1A 3D1LA 2VHCA 5GTDA 5ALQA 5L6MB 4FOLA 5KSZA 4IVRA 3JVIA 4AU1A 2JPDA 2VJBA 1OIWA 3IB6A 3E18A 1H2EA 3FNFA 4CCSA 2Y0PA 2QI9F 2QRGA 3JQGA 4DBZA 2NVBA 1X80B 1QCCA 3RYFB 5JVDF 4MH0R 3B6MA 1ULUA 3KYDB 3NBMA 4I8DA 1F9EA 2DUUA 1SUBA 5T64A 3TOZA 2X5OA 3TANA 3N8IA 4PFJA 1WQ1R 1C0PA 2ROQA 1EGAA 3GJRA 2BOVA 1AXGA 3SNKA 2Y05A 5AKLA 1HGXA 2X5XA 1Z6ZA 1SUCA 2XD9A 5IZCC 1ENZA 1PR1A 1LKZA 3K70B