4P0QB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
334
structure length
284
Chain Sequence
NAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Crossover junction endonuclease MUS81
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 284
sequence length 334
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0qB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0qB01
1J23A 1J24A 4M6WB 4M6WA 2ZIVB 2ZIVA 4P0PB 4P0PA 2JPDA 2ZIWB 2ZIWA 2BHNA 2M9MA 2A1IA 4BXOB 1J22A 4BXOA 2ZIUB 2ZIUA 2ZIXB 2ZIXA 2BGWA 4P0QB 4P0QA 1J25A 2JNWA
chains in the Genus database with same CATH superfamily
4IWXA 1KSHA 4ND6A 1I4EB 2NU9A 4LXTA 1CEQA 3ROEA 1YT3A 5IAAA 1CQIA 4ND7A 4DF4A 1LJLA 1XDDA 4J6FA 1U0GA 1F7VA 1NULA 4A6DA 4C6TA 5IVHA 3T5HA 5J0UA 1QLJA 5DQHA 4YMIA 3FUXA 1U02A 3U7FB 2PXHA 3GDXA 1ZH0A 3PWZA 1IRXA 4OKSA 1VMEA 5FPTA 1L8QA 3G2LA 2WKPA 4R71A 1U81A 1A9PA 4NARA 1G5PA 3QKWA 4YRDA 3CUKA 1SVMA 2WYOA 4HLUA 1P0FA 2W8KA 4EA9A 2QNBA 1Y9DA 5I01A 3GIKA 1P1CA 1XG5A 3IOMA 1V45E 2HCTA 3NRBA 4I9FA 1WUDA 5K2MA 2QX4A 2CXRA 3N6RA 3CWQA 2OMEA 4BVHA 3EK2A 1G8YA 4EYKA 1SR8A 2J33A 3PEUA 4HQ6A 3VYWA 4EW2A 3HDYA 2LR0A 1T5OA 3SEQA 1K2VN 3IQDB 2A1UA 2TSYB 4RT2A 2G25A 5HIKA 4NZMA 2BEUA 4JJ7A 5LA6B 1LDEA 4OH7A 4RD1A 4QDUA 2FLVA 3QKSA 3V32A 2E21A 3TDMA 4BV3A 2HA2A 3RAXA 3HFJA 4Y2XA 1SC1A 4WTOA 5IPFA 4EB6B 3B12A 3R09A 2PO5A 1F51E 3CPJB 1RBYA 2G5CA 3H9UA 4JI7B 3R44A 1SXQA 3KV1A 3PE3A 3B1YA 3UT5A 4DKJA 4NL4H 4Q9KA 1QQ7A 4MGYR 4KO4S 2QZJA 2EV9A 4RK4A 3SICE 3WLTA 4JEMA 3AOEA 4UHEA 1CCWA 5DPMA 5JMPA 1ZCJA 5KFIA 3TQIA 1CIVA 1G8PA 1ZM4A 4EUEA 4YEDA 4MKHA 8MHTA 2O3JA 4GUDA 2C4TA 2WYUA 3LKDA 3LWDA 2V4RA 3CISA 5SYAA 2I3GA 1WPQA 2XJ4A 3AGPA 1KH2A 1Q20A 4PLHA 3AYZB 1DXYA 1AQLA 4EG7A 3QE0A 4D96A 1A9ZA 2ZJ6A 1UFKA 2ONYA 4OF4A 5I48A 2O14A 5KNDA 1LV7A 1NQWA 1T3QA 4IEEA 1C9DB 1NRJB 4V24A 2QVXX 4P08A 2KZZA 1P8AA 3JQ6A 3KYDA 3TYXA 1XRPA 1QG2A 2AZ4A 1U7DA 3DVAB 3MTQA 1ULBA 3DDNA 2YHBA 2HHJA 3PEEA 5FI3A 2GYVA 2IYRA 3STXA 3LRPA 2VXYA 1R8XA 2NAPA 3VZPA 2VYNA 4OM8A 1F06A 1NP3A 1RVDA 2WIBA 1YONA 2D2XA 3S70A 5JALA 4P4LA 1JG1A 2FPPA 1TA9A 3AVQA 1UJ6A 4HXFB 1KYYA 3PYXA 1JEQA 4YRKA 3W3ZB 1O97D 1PUXA 1T4CB 1KL7A 1EVYA 3EXG2 2RDMA 2HCBA 1DOZA 2DJIA 3KLPX 4FJ0A 3H8WA 2IHKA 2Y99A 1XCOA 4UE3S 1Z5UA 2OZEA 4KLNA 4PVCA 2ZU6A 2FN4A 4GICA 3AY7A 2ZJAA 4INAA 2IVZA 3COSA 1ZUNB 3A2NA 4DL2A 2WVJA 3G2HA 3K6SA 2AOTB 2C9OA 2ZJBA 4K8OA 4X1OA 3ND5A 1GGKA 1Q3TA 2QVCA 2P69A 4HDAA 5BWNA 1DEXA 3OIYA 3BX1A 5JASA 2R8OA 2HMXA 2IIVA 2DHQA 4NYMQ 4KLHA 5K9ZA 1UJ2A 1SCIA 5CDHA 4CL0A 1CDOA 4K6HA 2AF3C 2DRIA 1A5TA 4LK3A 2YN2A 1EZZA 3GOHA 2N46A 1AO0A 1X7HA 4DIDA 3A3OA 4BLSA 3NI2A 2BGLA 1R0LA 3DOUA 5HF6A 4YR3A 2X0RA 1RJ9A 1SU8A 1IEXA 1KEEA 3S1AB 1UA1A 4BMOB 3CX3A 2GZDA 4ND4A 1TL7C 4LRYA 5DP2A 1YI0A 2QY9A 4L5YA 3ZNNA 4QUAA 2ZQYA 2Q2NA 1NP7A 5IF3A 4HTFA 4Q03A 4EHHA 5LIPA 3D4IA 4HRYA 3LC0A 2C42A 4OV6B 4DC1A 4FFDA 3OJOA 3Q8PB 3ZUPA 3OTIA 1T35A 9ICMA 1UMCA 3FDFA 1GTSA 8ICXA 5HK9A 3E23A 1K92A 1CG6A 1FVHA 1X2IA 2BDTA 5DIZA 2Z2XA 2XE4A 4YBRA 2EFJA 2HBJA 3UV3A 1LFAA 1Z37A 1J7JA 2WWFA 1CZKA 1MDFA 3T3PB 3RB3A 3F7OA 1C9JA 4G5YA 4HAVA 3H1TA 3OX4A 3JQRA 3KKKA 4HG2A 2LDBA 5M34A 3TJRA 5A4JA 1U28A 4FDVA 2JLBA 2AG5A 3WXBA 1KQQA 2KZ3A 5F2OA 3WGKA 5JO0A 3KOXA 1KTQA 4FW9A 4YRNA 1RC8A 3ZE7A 2N3ZA 3L0DA 3AEKB 4LHEA 2BSQA 3L79A 5F12A 1ID8A 2V65A 5DHRA 3GH3A 2GTPA 4ZRMA 1YGYA 2Z5LA 3M1AA 1XD9A 2JA2A 3FMPB 5FA5A 4UUOA 1T9GR 1J2UA 3NHYA 3OPQA 2P9EA 3BCUA 3HO8A 3EDOA 4F9GA 2JH7A 2ZRBA 3GIIA 5CIYA 1ADBA 3JATA 3VSEA 3H1EA 5D87A 1O89A 1ZEMA 2C28A 1CDZA 2QMZA 4ZJPA 1U11A 3GEDA 3PR2B 1FIUA 3WZ2A 4CM8A 4X1KA 4TZKA 4RSRA 3CF0A 1YR9A 4L5IA 2CHGA 3F2VA 4RHEA 1T2AA 3H0KA 5JG7A 3PUYA 3A4YA 1WHSA 3E5NA 1BDBA 2I1VB 1DGJA 5SY9A 1ZN8A 3MS4A 3RIXA 1FP7A 4B83A 5CLIA 3MFQA 5IX8A 3O4HA 4QYMA 1W48A 2JGAA 3OFND 3PPIA 1D07A 5J2EA 3NWOA 4YLEA 1K7EB 4OHVA 2VXCA 3IVXA 1U9YA 1JAXA 4BJHB 3UQYS 3I5YA 2WB1C 3K1ZA 4EYQA 3GD7A 2ORWA 4FLEA 2V4ZA 4Z5XA 2ZB7A 1HMYA 1I3OA 5DSTA 2H4JA 2XIJA 2QYSA 2R5WA 3GZTB 1JECA 1XO1A 5J1TB 5L1IA 3IGFA 3PEYA 4HDMA 4PAOA 3CEPB 1E96A 1UM9A 4QWMA 5FTMA 5T64A 1ZQPA 5IAEA 4B3RB 1SVUA 4WJ3B 4NL9C 2WG0A 2RGRA 3C3MA 2VP6A 3KSDO 2W2XA 3Q3HA 4QPCA 1WIWA 4DXHA 1XV5A 4KIWA 1H8HD 4EA6A 3OJEA 3G85A 1AZWA 2WLSA 2F76X 3KPUA 3DHYA 4L6CA 3GEBA 1A5AB 3RRXA 2FZ4A 3G6VA 1ZBDA 2GN1A 1DKLA 3UICA 5DDIP 3T7SA 3KAJA 4YXJA 2VJPA 1APBA 5IXYA 4MV8A 3PQCA 4WY5A 4ETNA 1W1UA 2CXPA 2K7FA 4ZYWA 2RONA 1E2DA 4RBNA 4YR2A 2IKSA 1GLGA 4MDEA 1AC5A 3ICOA 5FOWA 2CLCX 1IXKA 5T8KA 3CTPA 1ZM9A 1W36B 2IA5A 2YR0A 3L2OB 5IVIA 1H23A 2NV6A 5BW8A 4FYKA 1P4RA 2DWQA 3T4XA 2ONCA 4HZUA 3EEIA 1E3DA 4MIKA 4IRXA 2ZUSA 2QU8A 2AXTU 1HG1A 5DBBA 4MVJE 3FOFC 2ZT8A 5EKTA 4EWLA 4C2TA 4JFRA 4QARA 3UXEA 4B5LA 3S99A 1M0EA 1Z3IX 5EWGA 4PZOA 5KX5F 3Q7IA 3I4CA 2ZXEA 4X54A 1YL7A 1L4BA 4H4EA 4LC0A 3AUJB 2JIOA 4MGZR 4TLCA 5J2JA 3IEVA 3GFBA 1ID1A 4RNCA 1GPNA 2DBZA 3VA7A 3C85A 4R2XA 1YZUA 2O2ZA 1X9HA 3SY8A 5IIJA 3B1VA 4IM7A 2ZFUA 4I1PA 4RPJA 2DT5A 5DTQA 3MGBA 1NW6A 2HA4A 4JUBA 4F4ZA 3VZQA 3K0KA 1DCMA 5B3AA 3SCZA 3PNMA 5JTUA 4A23A 5KINB 1WABA 3DLHA 1A8QA 7ICKA 2YWHA 2IZ1A 2KHQA 3DVSX 4K03A 2E1FA 2IYLD 3ME5A 5C4GB 3C6QA 3MIZA 2QMYA 3LOPA 4NBLA 2Q4EA 3EASA 4JLWA 2ZBGA 2Y76A 1GT91 4IOMA 9ICXA 3RIGA 2Y9UA 3R5KA 4PLGA 1ORVA 2NO0A 4GP7A 1G21B 3NXKA 1H1LB 3M9LA 5CU7A 3RVBA 1YT5A 5E3IA 3UK7A 4XWYA 4YLYA 3DYIA 2F90A 3ZV4A 4O3MA 1SVLA 3GP8A 4UUPA 2XWSA 4KLRA 4WOJA 3REGA 4FCVA 1E62A 4PZYA 4BNMA 1HYGA 2CYCA 2AA3A 1Z25A 4C3VA 3P94A 2DPXA 3SWWA 5K01A 1FNDA 1KR5A 4F8JA 2CCKA 2A1AA 1F6DA 3QEMA 4Z4GA 2KLHA 5ILGA 2QTVB 3EMKA 4UTZA 5BPCA 4J1QA 4TYPA 2HRBA 2DPJA 3ZHCA 1AQNA 2B94A 2OPBA 3OQHA 4N41A 4MVJG 1N1EA 1SL0A 3V8NA 5JCJD 3HX0A 2OZLA 4QVGA 1ZRSA 4ZANA 4B7XA 4TV8A 1MN8A 4KRGA 3EDYA 1JA1A 1Y3IA 4GVLA 1XP5A 2OFFA 5KAPA 4DCNA 4YAUA 3RK0A 4LSMA 1Z4LA 2P5YA 2Y4NA 3OECA 1SY7A 2IWRA 3QXXA 1CRQA 1S5LU 1M1UA 2AQ0A 1OT3A 2CE7A 1C4XA 2XJ9A 4ZAWA 1GTRA 3AFNA 1QE3A 5FFNA 4IKEA 2KSOB 5AW3A 2XUQA 2JA1A 4MGEA 2OG1A 4Z4IA 1SZPA 2OZKA 2P2ZA 5JD3A 3EX7C 2PXXA 1EG2A 3I72A 8ICTA 4PV7A 3FYUC 3DMHA 2IV2X 2G9QA 1LRLA 2XGMA 5TARA 1EX7A 3OHBA 2Q3MA 2CHEA 4XWWA 3F9IA 2WJJA 1Q7TA 4IX1A 3PW5A 2PMFA 5KNDD 4L4SA 1L4HA 1YBFA 2XE8A 1J2EA 4RGVA 3I9JA 2XRZA 1XFAA 5C51B 4G4SP 3DMFA 3CU5A 1AB6A 2WJGA 5AESA 4JBGA 1E0AA 4R2HA 4A0HA 3QU5A 4K0RA 4AKIA 2CXQA 2QT9A 4QUEA 3A11A 1WMDA 4WEQA 1VP3A 5E4JA 4H77A 3JZIA 2VYND 2XYPA 2VTKA 4AZTA 3H7AA 4D9JA 1D9DA 1EDOA 3PFNA 4UD2A 2OYRA 1MXHA 3R40A 3U49A 4E5NA 4PPNA 2NX2A 3IA2A 2Z58A 3RHZA 4FOPA 4R4JA 2J7KA 3V72A 1B41A 1KSPA 1KAMA 2E6KA 2HYIC 5ALEA 1R4NB 5C1BA 4BLPA 2ID7A 1E18A 5CP8A 4RDCA 3BF7A 2A57A 3LFHA 3WB2A 3M7DA 3FTNA 5CB4F 1RP1A 4PGMA 1T3LA 4ID9A 1WZNA 1D2NA 4M0DA 4P7KA 5ALIA 1NZFA 1T4MA 2YN0A 5KTNA 4B3XA 3O8DA 3SS9X 2YHAA 1SB8A 2PSSA 4RIEA 3IXQA 1EHYA 2QXYA 3NYQA 4BJQA 3OLYA 3HS3A 1JEOA 3GYBA 3ER8A 1VYUA 3U7JA 1CNEA 1YDWA 2VJNA 3U4QA 3ESZA 2ZUFA 4LVUA 3IELA 2P4EA 3KKNA 5ALPA 4N39A 3H2SA 5JNVA 4R16A 4M76B 2QVYX 1C41A 2UYYA 1EWQA 3E58A 4FDLA 1F38A 3H1PA 1KFBB 2PLFA 2RD2A 1NQAO 4YAOA 1JR3E 1TV9A 3RFFA 3NYRA 2BLNA 1Q0UA 2IEIA 4TM8A 3IV6A 3T5CA 1USUA 3LWNA 3WYDA 2BUAA 3RVLA 1A4RA 3ONVA 1TJ5A 2WJHA 2QUBA 4GQBA 2ZGVA 1V9SA 3P9YA 2AC2A 2Z2IA 3O8QB 1GQ2A 3H4MA 4EATA 3T9AA 1Y8ZA 2MSKA 3M81A 1G4UR 5DGHA 2ICAA 1F2TA 4HOYA 2OOSA 1SCDA 3TZQA 3ZU5A 5KHOC 2GLUA 4B9VA 4JQOA 5KFUA 3CZ4A 3CLRC 2BZ0A 2J07A 2HGSA 3WK7A 2DWOA 3L4BA 1J49A 3ZJYA 1XRMA 2NGRA 4I2JA 1GQOA 3TFWA 2AYYA 1URPA 3LC7O 3STUA 2ZSFA 1U2GA 2PSHA 2QZZA 4LNAA 2R6FA 1EJ2A 3M1YA 2ZSJA 4I1SA 3RRMA 4MRMB 3THWB 3NV9A 4LJAA 3ZD8A 5K1ZA 4V0ME 3EXFB 1Z29A 2IDZA 1FE8A 1XEAA 3RWBA 5CDYA 1N1MA 2F67A 5F5XA 2FRDC 1TYDE 1ZJMA 5TT0A 5HDQA 3W0LB 5BR1A 1MVOA 5BQPA 2AX3A 3EEOA 1HG0A 1JHMA 1Z0AA 4FC6A 1E2PA 4G5RA 3BHNA 1BA2A 4KXYA 4YFVA 1FPQA 1TZBA 3PSTA 4W82A 4XIJA 4E2ZA 1PJAA 1IN5A 3ZJ5A 3T4UA 2Q99A 3NYWA 1UBOS 1KKMA 1XJ5A 4M89A 2R8GA 3O9VA 4HO1X 3OJWA 2YS7A 5HKLA 2GN6A 1U5CA 1IHYA 1EESA 1L6IA 4O4IB 2OB1A 2OWDA 3TZEA 1Z2PX 3VO2A 3HSYA 3FLEA 1KXJA 3P2IA 3D6TB 3RBXA 3EEBA 3UEOA 1ECLA 4JX8A 1O6FA 3SFVA 1FX0B 1M2EA 3RC7A 3TLBA 3HLKA 5FIUA 3VBEA 4DT1B 1U0SY 3IEKA 2WINI 3BDPA 4Q6BA 1NJFA 4C7JA 3SC4A 1QQBA 1AKWA 5GWXA 5JWRA 1Q6ZA 3D6JA 2PS3A 1IY9A 3O8BA 1MQ8B 2R1ZA 4CFSA 3K9GA 3DBHA 1SZDA 2DQYA 2VR1A 4YCMA 1T15A 1KYVA 2DY0A 1R0KA 5LB4A 3ZK9A 2OGZA 4FQ7A 2HA0A 3LT4A 3SD7A 3WL7A 5FYQA 3ZWDA 4I3GA 3SYKA 5EQDA 3R2JA 5F1KA 3A9RA 3NDIA 3K31A 1WL8A 3IAHA 4U3JA 3L0ZA 5CTJA 5MDHA 3BD6A 2X8JA 4URHA 2HIAA 3AF3A 4J9OA 1ZIOA 1X77A 4XWOA 4E51A 3BWBA 4N49A 4FOTA 5JYDA 3OJXA 1KO1A 1M2FA 3KHKA 1UDBA 3U9LA 4N48A 1XJQA 4ZKEA 1KMMA 1OQAA 3GROA 2WIJA 3UMGA 4R69A 3IJ5A 3HACA 1B73A 3HXPA 1G7SA 1L3BA 4KDRA 2J45A 5IYZB 2DTEA 4NBWA 2W7OA 3T1VA 2WAQC 7MDHA 1OD6A 3HJFA 4C6SA 1RAEA 2F43B 5HTKA 1LU9A 5IRCD 1NK5A 4ANFA 1KOLA 3QEKA 4I55A 1EBUA 1MB3A 3G9QA 3AEXA 5E6UB 4YT4A 3RYTC 5C8YB 2EARA 1NZPA 1VI6A 5F52A 3KTAA 1OWMA 1USWA 3EAFA 3DULA 2QLBA 3L92A 2GHTA 1KYTA 4LCEA 1SHZA 4MPRA 2NACA 4A6EA 4ENSA 5H1YA 5IT0A 3WK5A 4EA7A 2J3IA 1OGIA 2HWWA 1KF0A 4RIIA 4W5WA 5EPEA 4YREA 4HGRA 3X43A 4IVRA 5FTNA 4X3PA 1OW3B 1QS0B 4QJIA 1T8EA 4Q7EA 4Z8YA 2YWJA 3HC7A 3N0XA 3LMKA 4ED9A 2QBYA 4BQEA 5EKUA 4HNTA 3GRYA 3CJRA 4XEHA 2ZKLA 1YOBA 4YK7A 1JEJA 1MCZA 1FFHA 2H5XA 2DKXA 2ZRKA 1H6BA 2PXCA 2W42A 1IV8A 3MA0A 4ZZ1A 1YASA 3PICA 2WWHA 4AL4A 1DAIA 2SKEA 2CXOA 3OT1A 4EVRA 3UMSA 3HKEA 3EZYA 3RLIA 4LDQA 2LZ0A 4AUKA 5F9FA 1R18A 2JATA 2XE6A 5DDMA 5HZGA 4TKVA 1LF5A 3UC5A 5B58T 2QAGB 4LS3A 2VPQA 3AO0B 4HNRA 4MR7B 1U8TA 5BRJA 3KXIA 3GUUA 1M1NB 4HP8A 3VDRA 5HM6A 3QVGB 1E2KA 4UUMA 5IZCA 1ZXIA 3AHDA 3CVWA 2CHVA 3BE5A 4O3PA 2AQ4A 2Q1TA 1U2SA 3ZE6A 5B57C 4IFIA 4KE9A 4LTDA 2BCUA 2QM8A 1ORHA 2J4FA 4E1BA 2OV2A 4QICA 3NP7A 2FEMA 2WJVA 2IPXA 2IHMA 2Z3WA 5C4IA 5HDBB 4WNAA 5KT6A 4WN9B 5K3FA 2BHSA 3V2GA 3U62A 4KKVA 3LECA 3UAVA 3RIHA 4V0SA 5FUMA 2GJKA 3I6QA 3WXMA 2R85A 3QH4A 5CNMA 2PTHA 5B6PA 4HPJB 3RFUA 2CSUA 1ZQYA 1LA2A 2EZTA 3I09A 2Q4BA 3RJHA 5FHQA 4J0JA 3DXYA 3ROPA 2R60A 2I8LA 4CLDA 1XIVA 3I9MA 4N3NA 4XWTA 3M3DA 2WSMA 5IIKA 1KJJA 1B8OA 4EUKA 5C32A 4KKXB 3IQEA 3PXUA 3Q9SA 4EITA 3L1UA 4I4TA 1MJHA 6GPBA 2C59A 2HJ9A 3VR4H 3QU4A 1WE2A 3Q3JB 4XQEA 3JXEA 3QE4A 5L9XA 4QTYA 2BCQA 2C2RA 1RADA 4RUKA 4U39A 2PUGA 4B6PA 3SQXA 1IM2A 3S68A 3T3HA 4B3HA 3EA4A 3QFFA 1IE3A 4EHLA 1DRJA 3DZJA 1Y3FE 1KI9A 3MBKA 2HHXA 2VHVA 4RSMA 3BEDA 4YMNA 2V7WA 1M5RA 2LKDA 1IBCA 5DKWA 3BMNA 3KB1A 1H5UA 3ZHZA 4RGBA 1UT8A 3PI6A 3I2HA 4I4NA 3EFHA 1P7VA 2SBTA 4MI9A 4D4IA 4UNPA 3UKJA 3N4MB 2O8BA 4TKMA 1T36B 3N2IA 3DJFA 4BFSA 4F5ZA 2B1JA 1YZ6A 1X7ZB 2GNOA 3Q6MA 4PO3X 4QWEA 4OP2A 2ZIUB 4YI3A 2NU8B 3T5MA 4M1TA 2VZ9A 1KO8A 2H4HA 5LP6A 3M4ZA 1TJNA 4KLUA 1F8UA 2X7HA 5K99A 4IIXA 3DOCA 4PANA 2YXDA 1KSGA 4PAGA 4FTWA 1IHXA 4M9RA 3UXMA 4PCLA 4MPDA 1JDZA 3WWYA 4HX5A 4JXKA 3FH0A 1ZQNA 1MPTA 2CV2A 3GPDG 3CP8A 4BCDA 4MW9A 3OFVA 3WHPA 3VH2A 5KAMA 3MINA 1JMSA 1HRDA 3GV5B 1S0UA 3GJSA 3DMRA 3TTXA 4B6JA 1URJA 1GPAA 4HNVA 1E8DA 5CLGA 4AXBA 2YJNA 5G0WA 2VJ5A 3EAGA 5EJMA 5ALKA 4X20A 1CVIA 5AKKA 4KQKA 1DAFA 1BKDR 3V1KA 5BW4A 3BB4A 1QVAA 1R8YA 3D6FA 4JXJA 4PHAA 3HJBA 1LBQA 3Q2IA 1FVOA 3VC3A 3TGLA 4B0OA 1DDGA 1OA1A 4AKTA 4RCYA 4N54A 4UNQA 1RWPA 2OFWA 3OM8A 2HHHB 2COKA 4UMVA 4YDSA 4MEYA 4CF5A 1JXMA 4B3BA 3TFQA 5KJCA 3ENZA 2W9BB 4PZ9A 3S2UA 1I3KA 2KW5A 5B4UA 3B2QA 2YH2A 1RLUA 4WASA 4XR4A 1KJQA 3VNBA 1T5SA 2BIFA 4JK3A 1N0IA 3ZH2A 3MAGA 1GCIA 3IVRA 1VL8A 4PLFA 2B2CA 1QV6A 3UKOA 4HWKA 3SN6A 1GA1A 3FD8A 4F3RA 5EIHA 3C3WA 1K7FB 1S0VA 2JHDA 1RI5A 4XYGA 5KQSA 2VA9A 2XGGA 1YU6A 3JYNA 4MP8A 1ISMA 1E6WA 5J2UF 2Y0PA 3AH8A 4MMXB 4ZCMA 1JDSA 1N5RA 3HKDB 2QA5A 1AUOA 1ZOLA 4JNKA 3K1YA 2XZTA 3KQVA 4ERNA 4EFLA 2XKBA 4AD8A 1Z7EA 5E6SA 2W2KB 1PD0A 2FB9A 3RUFA 2DBYA 1XELA 3WHKA 3N75A 4RD0A 5DRYA 1IXRC 1VSBA 4Z0HO 3I01M 3E7FA 4QXAA 3D6VA 3K15A 4IO1A 5SZHB 3HKBA 4X9XA 5C80A 5F1YA 4X84A 2D3TA 4NCAA 5I9BA 2XQIA 1GRQA 3NXSA 2GJ4A 4IR9A 3UB4A 4GLBA 3ALRA 3PDCA 2IY7A 5IHXA 3RYHB 3EPKA 5JEEA 1Q15A 4TUYF 1LD3A 3E9EA 4CKYA 2I2FA 3AF4A 2XZDA 3KR2A 1GSIA 3RSZA 4JBIA 1ZK4A 1EDBA 3NBMA 1ZJJA 4WH0A 4B3CA 1G5QA 5DCWA 5EZQA 3I9OA 1O03A 4G41A 4OJ5A 5AKJA 4XR9A 2NZVG 3GW8A 3CJQA 4I9HA 2XUZA 2J6HA 1XQVA 5KWVA 2EG9A 5K3OA 3FETA 3UHPA 1E3IA 3OCCA 2BPFA 3WLAA 3ANLA 1OLUA 2P0EA 3GA7A 4BVGA 2B78A 4UE6A 3OZDA 1L4FA 3MWLA 5DNDA 4MJ3A 2O0HA 2JFWA 3AJDA 1CJBA 2KP7A 3M6IA 3FFXA 4J9MA 3GBVA 3GEMA 4AI6A 3MBOA 5FOSA 4G1CA 1Z1BA 3EYWA 1JROA 1R5JA 1SRRA 2R6CA 3AGQA 2JEZA 3ONEA 5FWDA 1V85A 4ZCPA 5EHZA 3WA6A 2JR5A 1IRIA 2IE8A 3CWCA 2V97A 1NBIA 3FCOA 3U2QA 2IIBA 3NBZC 4Q7MB 1EUQA 2B99A 4D8TA 3BH7A 4ZVQA 2WE8A 1S8AA 4P34A 3STVA 3UATA 4IFBA 3M82A 2PFQA 2AFHA 3GJZA 1SQ0A 3JZMA 2PZ8A 4FGZA 4RFSA 4GI2A 4WKBA 3DEYX 2ZTEA 2XT9A 2WKQA 4C07A 4IQTA 4W1QA 3DDHA 2QSUA 2XKJE 3JASB 4QFMA 3RSHA 4DUYB 1DIGA 3PYLA 3L9XA 2D0OB 1NNUA 2WD7B 4LVOA 1SBHA 4ZC8A 1J8YF 4R68A 2PBZA 1LVHA 2LMRA 5CW1A 3KB8A 4TL6A 2FEOA 2JCSA 5JATA 5CDTA 1RRFA 2CT8A 1V8DA 4Z6DA 1WOMA 2BF4A 4N4AA 4U6SA 3HKZF 2AC7A 3CRW1 4C4PA 4RYLA 3NV7A 3ZDEA 2GK6A 1OXKB 4D4KA 1NONA 1A8PA 1WQ4A 1P0IA 5EP2A 3TNFA 5C31A 5BY2A 2WF7A 1FMFA 3BDVA 1FS5A 4GC5A 4GBJA 1XO0A 4QDKA 3ICWA 3ZBTA 2AK2A 3DSRA 3EG9A 5IKEA 1GXSB 1WD5A 3AR4A 3L02A 3W8NA 4BECA 2XUJA 2AHOA 4KOAA 3LWLA 4UPEA 4ZOQI 5FWAA 2WWIA 1D8BA 4EHDA 4D46A 2O8DA 3LM8A 3PLNA 4OGGA 3FCEA 5JCOC 3PXXA 2JLAA 1E4YA 3PDJA 2AJDA 1TIBA 3P4YA 5B2EA 1DTSA 1UPCA 1RIFA 4CCYB 1WS6A 3PR4A 1NBEA 4REQA 2Z56A 1OZGA 1KY5A 4UB3A 2YVAA 2D1SA 1IBLB 2HGZA 1JKJB 3PX3A 2QW8A 3T3OA 1BFDA 4PLZA 2I66A 3SBDA 2BHTA 2I8AA 3GEIA 1Z47A 1II8A 3KFLA 3SIXA 1W94A 3DEFA 3FB4A 3IEMA 1GPBA 3OH8A 3ZV5A 2OQIA 3S3TA 4KZKA 1EK5A 1UBLS 2XVYA 1E0DA 1WVMA 3LPAA 3PE6A 4LQCA 1KEZA 5AOVA 1KAEA 3C3YA 5JXGA 4HH1A 4KE6A 1NQUA 4CTKA 4ED2A 3L46A 1SXJA 3SZUA 1DFIA 1OC2A 4O02B 2ZLBA 4YYZA 4E30A 4NMWA 2P78A 4PHPA 2O0LA 5FEUA 3RSGA 3TTSA 1TQ4A 4YAIA 2F1IA 4XASA 3ESRA 1C8KA 4BNGA 3H1GA 2YKGA 2D00A 3HB7A 3PNKA 7ICFA 1JVSA 4IUCS 3ZCSA 1XEWX 1E3MA 3WQSB 5COBA 3P2EA 1LI5A 3FFWA 4Z54A 3FCXA 1CUUA 2GN4A 1ZBQA 1C20A 3ZKWA 1ZK2A 2J0SA 1YOVA 3AR5A 4AK9A 1YQ9A 2C2YA 4RY0A 1PK1A 2DUUA 3GF4A 1GZDA 1H0KA 4MWEA 4TURA 5BURA 4DQRA 4KXFB 3TANA 5SZJA 2H7VA 2D8CA 5FLYA 4OAQA 3DLTA 3Q8SB 1V5EA 3QSYA 2YJ5A 3H4DA 2DHDA 3D3NA 4YDRA 4LZJA 4D6XA 2IU6A 2EBWA 2QN2A 1MIOB 2YOHA 3OIGA 2XCQA 1JHAA 3H04A 2XECA 1EUYA 2ISOA 4IVPA 1YR2A 1ULTA 2EQAA 1WMFA 3L49A 3IHKA 1X0VA 1HDXA 1CNFA 1P29A 2AUMA 3ZIDA 1E3QA 3WKBA 1H93A 4JROA 2ZYTX 1VE5A 4WBNA 5EN4A 2Z4RA 5DTJA 4KAFA 3DO6A 1Y80A 3LAWA 5K0TA 2HSEA 3WIEA 2D2IA 1KPGA 3HNPA 4V1CB 1BWPA 4Q3CA 4JV2A 2L82A 2RH5A 1TKCA 1T1IA 2CWDA 4IIYA 3E8MA 5ALVA 1LDMA 4YP9A 1SCKA 3INRA 3QTLA 2BCJQ 1MT3A 3RUEA 4ZT2A 5KYXA 2BM9A 2QGZA 4OYYA 2P9CA 3SF0A 3VJRA 4IR7A 2AL7A 2G0AA 5CD9A 1PZXA 3QF4A 4NTZA 1GRCA 5ENVA 4L8FA 3II6X 4Q7JB 2ODPA 2ACKA 1NURA 2K8BB 2HJVA 3WKCA 3ZI0A 1JXOA 3U4IA 2YVUA 5AFSA 4UHFA 3LCMA 1NNLA 7ICPA 5F33A 1VL0A 5LWQA 4PC1A 4LJXA 2P3SA 1Z88A 2HA7A 4MEJA 1MUUA 2FVXA 1K4YA 1XF9A 4ZVNA 3FUUA 3S40A 3A0BU 2HXYA 3EIUA 1E32A 4I7EA 3EFOB 3OICA 1O96B 4PZUA 4GC7A 2NSJA 4TQSA 4JVMA 2UYHA 9ICFA 1U8XX 2VH1A 3DMYA 1P44A 2KK0A 5KQLA 3QE9Y 3KB6A 2OGWA 3IVMA 1LBIA 4P35A 1UADA 3MR6A 3P0IA 1R50A 1A8SA 2IX9A 2OGUA 2XA1A 1UC4B 3WWOA 4IXMA 3SYZA 2AJ8A 3DS8A 5DFAA 4D81A 9ICLA 2HJSA 1MOQA 4H3HB 4AT1A 1TW2A 2AI3A 1MAVA 1DTEA 4X5VA 5GV7A 4CKWA 4S1OA 4RJTA 3KEQA 3OJUA 1VHQA 5EPUA 4GXJA 2QEQA 4CEJA 3SKYA 1TMKA 3JQPA 3ELWA 1JIUA 2V7EA 4KQHA 4US8A 1DCTA 2IHVA 1TF2A 1MA7A 1XZFA 2AVDA 5ALTA 1PDWA 1VGVA 2B5OA 1BKSB 4JB3A 1EINA 2A0KA 1YBAA 4GM0A 4MUAA 1I7DA 3UOGA 3ZV6A 5HVNA 3VKFA 3D9QX 5JCJA 3F6CA 3COYA 4PYLA 2JGMA 3LCCA 3V3KA 1DAGA 3PFIA 3AUSA 4PSUA 1Q44A 1OKKA 5DTIA 2AUTA 3GDWA 2CYBA 3LNTA 3I12A 3EZXA 1K0UA 3ZE2B 1KVSA 2XV1A 2RKBA 1QX3A 1NV9A 1ZD5A 3TQRA 4ED1A 3I6YA 1QBKC 4RTNA 4XTCS 4BLWA 3OZIA 1NBMA 1OXVA 1MQSA 4EYIB 4EGQA 3QVTA 4C3OB 2I8CA 2B69A 5T3UA 4ZV7A 3QITA 1XLUA 4GXIA 1JL3A 3QJYA 3S1SA 3ZWQA 4MEAA 2VDQB 3WOHA 5JMTA 2OA0A 2X5NA 4IDGA 3P9XA 3DXFA 3NUGA 2GCOA 5FPHA 1UM8A 3HCCA 4N47A 4NEHB 3KVRA 4WVLA 2WEKA 1R9JA 4CIWA 1KYWA 3LLSA 1SZJG 1JVNA 2F3PA 1SCBA 1AGPA 2H85A 3IOYA 1GNVA 2I6XA 2R751 1JW9B 4IIEA 1I2ZA 4PLWA 5HKKA 2DKNA 3VDQA 4MUHA 1KMHA 3OCJA 4NOJA 4QUDA 1TUBA 3COPA 2OQVA 1SEVA 4G63A 4C4SA 2JZNA 4CIYA 1K7SN 1GNLA 4TROA 3AHJA 4JA0A 3OZRA 4G86A 4LW8A 3GIMA 3CVUA 3BIXA 4JQCA 3WU2U 5HNKA 1ENPA 3S55A 4B47A 2BCEA 3F46A 2IYFA 4MVJP 4Z7JA 4BNDA 1HL3A 4BNUA 3QXHA 2PKYX 2QF7A 3RH5A 5I7AA 4B31A 5TF4A 3JYQA 2JHGA 3E8XA 3UAXA 4WZBE 3UMFA 3WOVA 4Y67A 2A35A 2C4HA 1OWPA 1SK9A 4WQMA 3JZDA 1YCGA 2Z5VA 4H0FA 2NZWA 1GU7A 3ZNPA 3A1NA 3WGTA 2GYUA 4R6XA 3AP1A 3DPSA 2RQ5A 5DBAA 3VM6A 2QZ4A 4F4UA 1GAXA 1KI2A 3L7YA 2ZJ7A 2Y0BA 2M1XA 3TZ6A 1BX3A 3AR7A 5EL0A 1UXJA 1QHXA 4RTMA 3K4PA 1U1IA 3K75D 3PW7A 2RGDA 4LE2A 1PVOA 3O93A 1K5HA 5DLDA 3OU7A 4CUZA 1BX0A 1N78A 5DVZA 5FWXA 1OI3A 3R9XA 3FUCA 4H7IA 3NIFB 1SXDA 1BYUA 2BVNA 1HV8A 3T7IA 1OI4A 1NQVA 5CYOA 5IC5A 2BEKA 3VPCA 5BVHA 3RAGA 3T61A 2C2BA 1GG5A 1QRTA 2ZETA 4M22A 1L7VC 3PENA 3N7UA 2KD1A 2WTUA 4NICA 2F1KA 3M6ZA 4FMDB 5JW6A 4M0UA 2Y0SF 2VHQA 4PZNA 3E9CA 5KOIA 1W29A 1P4HA 4KQJA 4IGKA 4O2AB 3WGYA 4XSVA 1PUZA 4DLUA 4GKKB 4ICAA 3AW8A 3EMBA 2AH5A 3P32A 1KDPA 1TNDA 1CFJA 4JLJA 4XYBA 4EYHB 3ROXA 2XCIA 5A0TA 4XVHA 2GWRA 4DFMA 1TYAE 4EM6A 1C1YA 4CV2A 1VE9A 5KJFA 3V6HA 1KOFA 1K06A 3D0RA 3L0IB 3AUAA 1KS9A 1MAHA 2JI4A 4IIJA 1V5WA 1V9PA 2CJWA 4IHJF 5CCEA 2H2IA 4HRAA 4ZQIA 4D2IA 1XWFA 4M55A 3T34A 1CUCA 2J8ZA 3ZXIA 1HZZA 5HG0A 4WZAA 3AB8A 5AW1A 3CUYA 5AUQA 1O9BA 5KTQA 3MLBA 1G3RA 5KTKA 1N0HA 4JOQA 2O1EA 1YZLA 4QSHA 1E9CA 4AZ3B 4GX0A 1EFDN 3HDTA 1GZUA 2WA1A 2IUEA 4JV5B 3D2CA 1BD4A 2G04A 2GD2A 4L02A 4WKGA 5FI1B 3I8XA 5J2GA 3MOGA 2AOWA 4F5EA 4QL3A 2V4UA 2H48A 4DCCA 6YASA 4NBTA 2PX0A 3PGMA 2LBOA 3SX2A 4O8CA 4OHXA 3S2YA 5CNIA 3F49S 3V2IA 4FYXA 5EJAA 4GQIA 3OQ1A 3HYSA 3CFYA 3M70A 1PR1A 2ZJOA 3S2IA 3G1UA 1X1DA 1R37A 1G9XA 2UUOA 2NU6B 2ODEA 2ZYUX 4H17A 2PKQP 4B4WA 1JG3A 1U4NA 4QDZA 5JIBA 5JQGF 2ZTHA 4DLTA 4J0QA 5KSWB 2KV2A 1HOXA 4HYTA 3CUVA 1Y5MA 4EKEA 2HBMA 4JYMA 1WY5A 2B4QA 4U1RA 3QY9A 3BIWA 1L7NA 5DCLA 1H4QA 5CGQB 1L5FA 5ALOA 1TM5E 2W9AA 4C0WA 4PTYA 1NF9A 2ODQA 4IS7A 2VPPA 3J7AC 3RF9A 3C5GA 4DV5B 3PLRA 5LYJA 3G8YA 2B4KA 4K26A 1OFTA 1P9RA 2Q3EA 2O7VA 5EXPA 2JGLA 2A9PA 3BMQB 5AI6A 1SXJD 4FN5A 1NC3A 4UEQA 3MYYA 4BO5A 4HUQA 4XYEA 4IH9A 1NW9B 1XNSA 4Z4HA 1WULS 4MINA 2CXSA 1O08A 2ISPA 1VG8A 1QSLA 1Y3BE 2E37A 4ZMRA 4PYIA 3RARA 3IV9A 3LC1O 1T13A 3OUTA 4RTOA 4AECA 2CE2X 4K3VA 2EW8A 1RPAA 2XWBF 3MJHA 2BSXA 5P21A 3R4VA 3VNVA 4M9JA 3PD7A 2O4CA 3TG2A 3CUEF 4LHYA 3X1DA 4FZLA 5ALUA 3PZPA 1QIJA 2HU2A 3GRFA 3IUPA 1RWKA 4CMHA 1ZONA 4I4IA 2Q29A 1JEEA 3FUWA 1JV2B 1YL6A 4EG6A 2R8IA 5ITVA 4MHOA 4RZRA 2R4TA 2BKAA 3KT6A 1PFKA 1EEHA 3TQSA 3VVCA 3FTPA 2PEYA 4K6GA 1J2TA 1TGYA 3P71T 2B2NA 1PWYE 1MO6A 1UKZA 4M86A 4ECUA 1IYZA 4MF8A 1JKFA 5ALZA 1OVGA 2FMXA 4MUNA 2QN6A 2HLPA 3EPGA 4CF7A 2JFFA 1QLWA 4AZWA 3RIYA 5JAPA 4YNBA 1LSSA 3NTOA 1I6LA 4DPKA 4Z53A 4CG2A 1Z00B 4QGHA 4CL8A 4HDNB 3CNEA 1E1MA 5D3ZA 4GDFA 1NLZA 3IJRA 1XXHA 3IE1A 3OO0A 3NDBB 1P45A 3IP4B 3OEHA 3IQIX 1SCUA 2P9JA 4WKOA 2REXB 5EP3A 4B7ZA 3X2SA 2BKXA 1BVRA 2O3SA 1YFJA 1YRLA 2Z1DA 1UKCA 2ZXIA 3UBMA 3O74A 3K5WA 5TRTA 4GM1A 5HZHA 2Q1WA 4KN5A 2LYBA 3KKOA 3UJ9A 4N03A 1NJSA 3PFHA 1Z0JA 4MULA 3IRVA 2A3RA 1CNMA 3DL0A 4DV6B 4LF9B 3OAAA 3LP6A 2CVFA 3REFA 4G09A 4Q4AA 2F59A 1J5EB 3TEFA 3KPJA 4CG0A 5JSUA 3HCWA 1YB7A 5DNYB 2A9VA 4K4GA 1C4WA 2BI7A 2VDVE 3QIAA 3DEHA 4M0FA 5BNIA 5JS6A 2NZXA 3RRFA 2OBMA 1ZQFA 2PFOA 3PWTA 1KO5A 2PIAA 4AJ2A 3R6DA 5AJXA 5BYKA 2HA3A 1NRWA 3VKWA 3PVZA 3BQ1A 4B4DA 3I3OA 4H1WA 5FLXA 4S1PA 1REQB 4AWXA 1CB0A 3NOVA 1W2GA 4DARA 4RMGA 5IMSA 5BNWA 1F8FA 4W6QA 3QEBZ 4IPTA 3ZJ4A 4WK2B 2DVMA 1ZSVA 3BS7A 2FUKA 2XUDA 3M6FA 3TOCA 2IH4A 5KTSA 1YZFA 1OKKD 2O8EB 4BS9A 1L2TA 2OYYA 2BQUA 2UVRA 1WCWA 3HXQA 2QX9A 2MMGA 3GRCA 2OHJA 3A1FA 1FTQA 4TTSA 1IBSA 4Y2YA 2FP3A 1NBMD 4INOA 3NETA 5DSZA 5KFZA 5ECGC 2RGEA 4FVTA 2HM7A 1TT5B 3M2PA 1R12A 3GNLA 1KVTA 3CZAA 3GILA 5EPOA 1K75A 3IHLA 5HQTA 1Q7CA 3RK4A 1QYVA 4KH1A 5FR1A 4B87A 1BCRB 3WC4A 2J6UA 3T6KA 3ZGNA 2V3CC 5DWVA 3B7WA 3F96A 4HGYA 4P4GA 1MGOA 5K51A 4Q9DA 3IL2A 3WV5A 5L40A 3NATA 4NESA 4BQQA 3C7AA 5AR1A 3FRIA 3EZLA 4B6EA 5HKKD 4WCVA 2OBFA 2WDPA 3V46A 2IPAB 1DIHA 3PHHA 3FMFA 3RRNA 1NN0A 4PZAA 4M99A 5EYPA 3FWKA 3ERCA 4JY7A 3DWIA 2O20A 2Q1XA 4NP6A 2VF5X 3NBFA 4D57A 5IASA 2I9PA 4LQ4A 5KFTA 3E7WA 4G5SA 1K66A 1ODKA 1E5QA 2P9QA 4BMSA 3DTVB 4RF4A 3W77A 2FPUA 2DT8A 4Q9HA 1NYRA 1LEHA 4FNOA 2CKDA 3X2FA 1FF9A 3N7SC 2Z2KA 3TXAA 5LM3A 4C4TA 5T57A 4A2PA 4DDVA 3PB3A 2PZEA 2D1QA 2WHPB 2G36A 4L9RA 3FHTA 3GLIA 3WGZA 4OATA 4ENRA 3GJ6A 4YJ3B 4P58A 3P0FA 4P7FA 4JWKA 4NQZA 4IRCA 4Q3AA 3K0HA 1YTLA 3EVCA 4MGKR 3DMTA 2JNWA 2MCFA 2FX5A 1TK8A 5BOSB 1IAQA 1IQRA 2DG2A 2KKVA 4G23A 1MX5A 2CLOB 4UAVA 4R8KA 2GX6A 2XHEA 2WICA 5KDDA 4I1RA 2B0CA 1XVAA 3TW4A 2AI1A 3AWDA 3O84A 1QVZA 4NLBA 3TQHA 1HNXB 5BSTA 2WU3A 4OK3A 1RJEA 3HXKA 4JKYA 4FFLA 4IJUA 1UANA 3I28A 1QAQA 3HHEA 3C1TA 1QK3A 1RYDA 4WEOA 1ZMRA 5F3XB 5KNBA 2JLRA 1NY6A 1EVLA 3DTNA 1MR3F 1DE0A 3ASUA 1Z1VA 2Q5FA 2HW8A 2XY6A 4RU9A 4ZGGA 3N8IA 1QF7A 2B0JA 3G2IA 5A0LA 2O07A 5KVSA 3KRTA 2ZR8A 2OYCA 3O38A 4FHEA 2I78A 1O8CA 4ITVA 4D3YA 3O7WA 2C2DA 2JRCA 1SIJA 3FNQA 4F8EA 2C2XA 3WK9A 4RH3A 3V1YA 3EXHA 1K7YA 2HI0A 3AF6A 5IUKC 3TSCA 1NKSA 2PUWA 4J4HA 4B2YA 4QDXA 3KCNA 4O4JF 1ZJWA 4Y9SA 4KTVE 3EFEA 4D9CA 1R3DA 1YS9A 1M1YB 1B15A 4O5KA 4JVNA 5AKIA 1PWHA 1Z6TA 4ECXA 1ULHA 2WUWE 3H2HA 3I5MA 3V7YA 2H31A 3N3BC 4LJ6A 1PR4A 1H2AS 2PVSA 5BN5B 2PNJA 1CUXA 4KFTA 5BQ5A 1R0YA 2VPXA 1T9DA 4UHDA 2N1BA 3KZOA 1QNLA 5LMNB 1FTYA 5FNVA 2YHIA 5D6OA 2ACVA 3R5HA 3RS3A 5I4BA 1K6IA 2QMQA 3G5UA 3BZWA 4GZLA 1JBEA 4WA7A 2KVCA 1Z4MA 4U9HS 4BFUA 5HSGA 4OQXA 2JRLA 4TTVA 4MA5A 5GZ6A 1MOZA 2ZCUA 2QMEA 1FC0A 4UOEA 2O0MA 1GRNA 2XEDA 1AZTA 4N3BA 1K4MA 4G36A 2GTHA 1XVTA 1FLDA 1GL7A 3OX1A 5HUJA 5HGJA 3ZXXA 1Y8AA 3KJQA 1L5YA 2INGX 2BR3A 1WUHS 1IWOA 2D2VA 3AT1A 2JD1A 3L82B 4B73A 2CLEB 4RV9A 2HNKA 3I62A 4X60A 4G26A 5FULA 1P91A 4H27A 4B6OA 2OLKA 3G1TA 4OL9A 1QSYA 4Y6SA 5FBQB 2FR8A 3V48A 1XEWY 2G77B 3F6BX 2VCYA 5IILA 1JIQA 3AUOA 4IDEA 3B1ZA 1TCUA 4BJ6A 3KKQA 4PQYA 4OK5A 1MABA 3UAYA 2Q45A 3DQQA 5DEOA 5CFZA 4C08A 2VI5A 3GCZA 1OBCA 2H5JA 2WF5A 4IBOA 4P32A 3DV2A 1TF5A 3ENQA 2D5CA 2PD3A 2AJTA 2WSIA 3NMUF 5J4YA 3AHCA 1U9IA 2NVWA 3OOSA 4U7TB 4YCNA 4Q05A 3DB1A 1YDFA 1Y9JA 2VJMB 4IVNA 4UVGA 1OB5A 4NZ9A 2F48A 4DJJA 4KNVA 3FI0A 2QYHA 2QE6A 5GVRA 3ZE8A 5FJJA 1E20A 4JI4B 3SQNA 1GWNA 4QDTA 1G9SA 4TTQA 1NL3A 1OAAA 2FK8A 2ETXA 5A9SA 1JSZA 1VPTA 2QPTA 4ZT3A 2PSDA 4P31A 1GY8A 1ZWLA 4M7PA 3WICA 2FN8A 4DNPA 4MS3B 2UV8A 1G55A 1BNCA 2I3AA 1ETHA 4LF4B 2GPBA 2QGFA 5CR9A 4M2YA 3D7RA 3TADA 1S7CA 3HPRA 2NT3A 3KXPA 4GGMX 4X8OA 7ICMA 3HLTA 3STYA 3QPBA 2QN9A 4Y6GB 4KXNA 1TLFA 5J0OA 5JD5A 1Z0SA 2RB4A 3H2YA 3KHTA 1EWTA 3DTTA 4RQBA 4DSZA 2PQ2A 1SB9A 1E1KA 4Q9IA 4ZCTA 3BFPA 4I5IA 3GLGA 2ONKA 4G5FA 4DEXA 3ZE1B 2B4TO 1U7OA 3O0FA 3DB2A 2RCYA 1H2YA 2ZJFA 1CUSA 5IIMA 4ZALA 2WQ7A 2H08A 5F7XA 4R0NA 4QUKA 4EB0A 4W1SA 3VTAA 5CK5A 2BAGA 1X3LA 5KYUB 3QVSA 1Y4DE 2PMCA 3HJCA 4OGLA 4EZ9A 1U0BB 2BFEB 3BRCA 2KJQA 3F5EA 3DZIA 1ZY2A 1GTL1 5K05A 3DZHA 3OEHD 1KAQA 3OSPA 3FPSA 5ITSA 1ZESA 4J43A 4HB4A 4AVYA 5J2DA 2DPIA 3O8CA 1WB6A 2ZWPA 2BONA 1DC5A 2Z9CA 2OVFA 3DDZX 5F3DA 1GT6A 1QUFA 1HM5A 2XUKA 2JB9A 4EB8A 5B3KA 1J33A 3RFCA 4JLNA 1M5UA 3GXBA 2VYCA 4UZFA 1ZFNA 2EQ5A 1M6WA 1RZ3A 2IODA 4EW1A 2NV3A 1JKMA 3V6JA 1HTBA 8LDHA 5KOHB 8ICBA 4DILA 2FRVA 1OZAA 5EZ5A 3EDMA 4I9NA 3C4JA 5EZ6B 4JR1A 5LQMA 5FA6A 3OAAD 4DDUA 3FKSA 1EH5A 5KMGA 5JH7B 1UAYA 4TWJA 2EAPA 2NV0A 1OE0A 3RUPA 4HF7A 2VQDA 5JDCC 3ZU2A 4XVQA 2Q0QA 2N9UA 4TUQA 4BE9A 5HBRA 1Y7PA 4EPVA 4HK4A 4M47A 2YFQA 3FF4A 4HDKB 1OH8A 5AK0A 4AJ1A 4N0PA 1J4AA 1QFYA 2YTUA 1RAAA 1L5HB 3O3OB 1SQ6A 2IV3A 5GJVC 3H9JA 2V6BA 3E1SA 2VSFA 2JJ2A 3LNCA 1B1CA 2B98A 2Z6QA 4O6VA 1F12A 1SBTA 1DZ3A 4L4XA 2PJRA 4MAFA 2R25B 4GGPA 4ZVOA 3OSUA 4BQPA 2KZMA 4UULA 1RVV1 2QRZA 3ANXA 3DZBA 2EAUA 4CLOB 1GNTA 4JSRA 1QO0A 1NJWA 5CUQA 5GY7A 3JYHA 3O31A 1NVFA 2OCBA 3OFJA 1L6RA 4LRWA 5BMOA 5AKXA 3VOSA 5A2GA 4FB5A 2JGRA 1PX0A 3GBSA 2OZPA 1JH9A 2ZRPA 4NMHA 1S2GA 1WKCA 1DIAA 2C54A 2CFOA 4L8WB 2Y05A 2W6PA 2W0SA 5U4XA 3IMKA 2Y1JA 1T8YA 4XDYA 3C7TA 4PG8A 1JHZA 3W7BA 3NW9A 5TF0A 1K27A 2QRUA 1PSZA 3R0IA 3PGA1 1T2DA 1VGRA 4Z2YA 1FJ2A 4OBWA 1ORWA 2FQYA 4DGQA 3RTBA 4ZCQA 3K70D 3CXRA 2UVQA 1KBZA 4C2AA 2TMDA 3GEPA 3A6ZA 4UTPA 2J4DA 4KE7A 3D5QA 1ENOA 1V16B 2R6AA 3CH7A 1XRNA 5C37A 4O4HB 4IWNA 4HRXA 5TQ2A 3EN0A 4G0PA 1CZLA 5IBRA 3HDVA 2BKEA 1SPXA 1AKMA 2AEEA 1C7RA 7REQA 3I45A 3WNCA 4GMXA 1IPHA 4LGYA 5K3AA 1G0OA 1JAZA 1G5IA 4DRXA 4O3SA 2KX7A 4ENWA 3LKBA 5PNTA 3PGKA 2FW1A 4GNKA 2PTGA 1PTJA 1ZK3A 3ABSB 3ONFA 3H5VA 3AK4A 5K6AA 2ZBRA 4PGXA 3L8CA 5JXJA 2WJ4A 4DC9A 5I7RA 3GIWA 2YCBA 4EKIA 4UB4A 5TVKA 5IWAB 4NFLA 1AOXA 1NMXA 1GL9B 1KPHA 4R1MA 4UFNA 1TGVA 1GZ3A 3UYKA 4HWGA 2ZATA 4JR2A 1JTEA 4IF4A 4KSCA 1QNFA 4BL5A 5TC4A 1QTNA 4EYSA 2EEZA 4MV6A 1DX4A 1ZOOA 1HDRA 3KCQA 2YV5A 1V4VA 5CCBA 3NB0A 1ZVMA 1FB5A 3WQHA 3R5XA 1TVMA 4X1IA 1QAMA 1N2CA 1KZGB 5IM4A 1QMPA 1XTSA 2W6MA 1P61B 3JSAA 1Z9BA 2AT1A 3UXHA 5I7HA 3O92A 3GFSA 1ZQBA 1GUAA 4KK4A 1QIEA 1Z18A 3GRRA 2HHLA 3LV8A 2MSWA 2FFRA 5CA1A 3DZDA 3K6JA 5KNBD 4DZRA 4RJJA 1CQXA 3IAAA 2ZREA 2BJVA 5FUVA 4PGFA 1YL5A 3JCZA 3T1YB 2QRJA 2X0JA 1SHUX 5KX5B 5B2FA 1B1AA 3B9RA 1EMDA 1S77D 5AK4A 1WY7A 1UEIA 3OWHA 3QXJA 2FPIA 4QA9A 2BFBB 2AGQA 5A02A 3FPGA 3IA7A 1TM7E 5F4ZA 5KSPA 4P33A 2GXAA 4KMOA 5TPWB 2ZDQA 5CVVA 4D92A 2IS1A 3OCYA 1YZHA 4XFKA 4R41A 1WXGA 4CVNA 5CVDA 3BICA 1IVYA 3HP7A 5FO0A 3LHIA 4J49A 3GRVA 4O2BB 4TLDA 1DBWA 3GT0A 3GUCA 2HPHA 3KSRA 1WLSA 2X8BA 2A5YB 3NWBA 5FR2A 4R63A 1PVQA 3E2MA 1AHHA 4FBMA 2OCYC 3AKCA 3K0CC 2I4MA 2XIDA 3TL3A 3AUXA 4ZK2A 3REQB 4DSJA 4YRIA 3DT9A 4PAMA 2TMKA 4YXMA 4AJPA 3GAAA 1H4SA 3GPIA 3PW4A 2JZBB 2PU7A 5I47A 1FDSA 1TKRA 2OTCA 1G20A 4ZO4A 4QQNA 3V1TC 1RW4A 3KU4A 1DUIA 2R6ZA 3D2SA 2GXSA 2W8BA 1WZ2A 2FGKA 3KSUA 4I5EA 4RA9A 1OF1A 5SYNA 1ZW1A 4BDSA 1AJEA 3EUAA 4N9WA 2JFOA 2IYQA 1Y6JA 3WGJA 3OURA 1C4OA 4JJ8A 4F3YA 3MCAA 5D1HA 1E4VA 4YR9A 1QQAA 4WY2A 4BP3A 1ZGJA 2HT1A 1K9SA 4BY9E 4TSFA 4C0ZA 5KZMB 4UFPA 4HL6A 3LDHA 1BH2A 4JOSA 4JUFA 4DREA 3A4VA 3FSJX 3ETLA 3P9SA 5JDIA 3EBLA 1B26A 4UEWA 4UVDA 4CQJA 2VF2A 5LBUA 2X9NA 3M6MD 2GJ9A 2HO4A 5ULLA 3R8CA 2A1TS 1CERA 4JNCA 1ORTA 5K0EA 4H7HA 2V7XA 3RRGA 2WTEA 2XLCA 3IFSA 2JI6A 1SQFA 1C9YA 1GUBA 1SHTX 1YB6A 2I1LA 4O4LB 2H0RA 3SDBA 1H2WA 4C2UA 1RE0A 4H0CA 3SP1A 5TLSA 3ZS8A 5JAIA 4AJNA 2E1EA 5AXDA 5IKMA 1DNPA 4DVGA 2FPGA 2V5VA 4ZOLA 2ORED 1NVWQ 5AOBA 4M6WB 1ZGGA 4AXXA 3DDSA 4KPUB 4S0XA 5KNLA 4HXEB 3VV2A 3HP4A 2RHLA 4DCMA 2LWIA 1MIHA 4ITRC 4BKRA 5E2AA 1VJ1A 5ED0A 1ZOSA 3X44A 4JUAA 3IBSA 2FETA 3E82A 1U9JA 2GD1O 3OE4A 4DCVA 3JQ8A 4BV9A 3KKAC 2KM1A 5KYTA 3R7SA 1T6ZA 1XYVA 4YY3B 2J5QA 1KPIA 5A7GA 5NLLA 1SD2A 3PEFA 4N1AA 1E2BA 1IFXA 1UFRA 3G1WA 4HMOA 3A9WA 1HLDA 2ZJ8A 3WGMA 4BO1A 1T4BA 3LQYA 5JC1A 5JECA 2C5LA 4FLMA 3FHJA 3ZCQA 2GBGA 4BC0A 1IC6A 1FRFS 4I9GA 2B2XA 3O73A 4WBNF 3PD1A 5HRUA 3FTEA 5BSMA 1XMJA 2AG6A 1RD4A 1YHZA 3GVPA 1PYOA 5DZSA 1ONNA 4KWTA 1OLXB 4XOIA 4V2UA 2PUJA 3IVCA 2RBEA 5HR6A 5AUOB 3PEWA 3AKZA 4DQQA 4YCJA 1VPEA 1X7XA 3WQRA 4BMNA 1XWIA 1TTPB 3CGWA 3FF1A 3O8OB 2F62A 2ISQA 5KVQA 5DEIA 1PWXA 5DQIA 3EXEB 3F67A 3IAEA 3RSCA 5CB4B 4E07A 2WQZA 5J2TB 1KC3A 5KREA 1CUVA 5IC4A 5BSGA 3HCRA 2ZWMA 2J32A 2H4YA 4G0VA 2R7NA 5J40A 1JIHA 3I04A 3IODA 1YE5A 4YUWA 3AG6A 5A7HA 3TLYA 4II7A 1HA3A 4R54A 1E9BA 2OWEA 3TSWA 5HCIA 1Z4JA 4M8IA 4FZVA 4DHEA 3VMFA 4CWAA 4KQMA 4ZCIA 3HDGA 2WPDA 4M1YA 2IIQA 4XDGA 5LUAA 1NI3A 1T5BA 4TX1A 1DBSA 1IQUA 2IYXA 2ACWA 2YJZA 4NXZA 2ZTLA 1U0HC 8ICPA 1YI8A 5PGMA 2ADFA 4LYHA 8ICYA 4CU5A 5KEIA 4COOA 1VPDA 1VHLA 2JLXA 1I7SB 4DQLA 4MF2A 1H42A 2ZIWA 3UJCA 3AUUA 5K2OA 2Y8EA 5TS3A 2XRMA 3CRMA 1G98A 2IMWP 3QK7A 1V7QA 2O2GA 4FFRA 1UBMS 1NQ5A 1WQ3A 8ICEA 1SXPA 1KC1A 1W4CA 1VJ0A 3Q9UA 4ZAYA 2QTBA 4C6HA 1FLNA 2IHYA 2D7CA 5EJ8A 3FKSD 2IV7A 1CY4A 4IUBS 2JS7A 1UC9A 3PNPA 1DTWA 1HYEA 3JSXA 1ZQCA 1MG5A 3ORQA 2VBFA 2CKMA 1I2CA 1PSDA 2IYVA 1IH8A 1TM3E 4D80A 4KFSA 4JMPA 3DVLA 1XHEA 5DG8A 5IKOA 3UUGA 3GI1A 3KEMA 3U3XA 1GILA 3WI7A 3ADPA 2OFXA 1KWKA 4MQLA 2A6PA 3QVVA 5L3SB 3D0OA 4HPXB 2VIIA 4J91A 1BXRA 3D64A 1VJDA 2JFVA 9ICEA 4Z0TA 1GR0A 4NAUA 3N07A 5GVSA 3RWMB 1PJQA 1I7NA 2JJ2D 4J1TC 3VDXA 3HVIA 2GD6A 4NULA 4KO8A 1Z2AA 1F2DA 1AROP 4ZQHA 3GVHA 4WV3A 1OLOA 4J94A 4D1YA 1L8AA 4MGIR 2VBCA 3CRQA 3L8HA 1G8HA 1TQ8A 1Q6YA 2RC5A 5E8JA 1Q50A 1HDOA 8ICOA 2HDNB 1FA9A 2ZVQX 4RPHA 2IYTA 5C5EA 1QO0D 5DYGA 4BKOA 5BWLA 2HF9A 3RHTA 2H8KA 1R0RE 2ESEA 1PYGA 3GR6A 4OHUA 3I6IA 4R8UA 1ST2A 3WTCA 3DE4X 3LL4A 2WOOA 4M0EA 3MCUA 5EOVA 4C87A 1CUFA 1DRGA 1T3ZA 2AEMA 2PQ6A 3R76A 1X86B 4GOOD 3KSBC 1DWUA 3L77A 4DXDA 3SEZA 2QRNA 4FEYA 4UQOA 2JGEA 5EJ6A 4I1OA 2VDKB 1RWQA 1ZPDA 2WC1A 4ZQBA 1LPSA 2E8OA 5IVKA 3LVBA 4M4SA 5C5IA 1JNYA 4HEA6 1D04A 1EB9A 4TT8A 4LXGA 4OQPA 4G2NA 3KLNA 3FRHA 2OESA 3WYNA 4DMHA 5LN1A 4FNAA 4KLSA 2QP3A 1Z62A 3L6UA 3RKUA 2QVZX 1XMVA 1J90A 1GZVA 4OVKA 4DV7B 2FHSA 4U5QA 1QK4A 2G8LA 1YQGA 5CVJA 4F2WA 4HH0A 5M29A 4DDKA 3UH0A 2H1HA 4HFNA 4W5QA 3ZXUB 3NDPA 4S1TA 2UVPB 5E4FA 3VR5H 5J0RA 2PXAA 3V3TA 2QLJA 2BBWA 1AF4A 1CZOA 1CE8A 2PH3A 3Q3EA 3FC4A 2C3PA 1E0JA 3N0TA 2Y93A 1GEEA 4JB2A 5KFHA 1KSFX 2J9ZB 4YG2A 5ALWA 3THRA 5KL8B 3X1KA 4P8RA 4N6GA 2H2WA 3N7PD 1I32A 1XALA 3VJLA 3AZOA 4IF6A 3ANTA 3MF4A 1WB9A 1P6QA 1I3LA 1O6BA 3L6DA 2DSNA 3BMOA 2HSDA 1NC1A 1BQ4A 3JW8A 2X4LA 3E6AA 3F5DA 3Q85A 1N3YA 1D5WA 2OSVA 4YO8A 3SBEA 3E1GA 4K9QA 4RVSA 1GTG1 3S28A 4BN0A 1LVUA 5AW5A 3NJ4A 1C9KA 1OZHA 4ZEVA 1VLVA 4C30A 5IJ9B 4PC7A 4GLXA 3T0IA 2XDYA 4LHVA 4IIJF 4IJVA 3GNQA 1N33B 3DKRA 3GCGA 4I36A 1R9MA 5FV7A 3K7EA 4J03A 3SV4A 1MW8X 2KJ5A 4F4CA 5FOXA 2CNWA 1JAIA 5I7WA 1E1CA 2X5XA 4HATA 2CL5A 2FPSA 3GC6A 1H2RS 1Q1NA 3QLUC 5KVAA 1VKRA 2FUNB 3V9PA 3NTRA 1RXYA 3A1DA 2FWNA 3AI7A 4TTPA 1ZUIA 4AUMA 2OOKA 2VDOB 1SVKA 4XWAA 1PZGA 5LZ5A 1W88B 4US9A 4B9AA 3ABOB 1GGJA 4FYVA 3KFVA 4KG7A 3D4OA 5IN4A 4L51A 4KQGA 3HP6A 2J0VA 1PEDA 3CKMA 5HJ7A 4U7WA 3JARB 2BMJA 4RK1A 4BRWA 1ZU4A 1E8NA 4RMJA 2J5XA 3BVPA 4IINA 3C6XA 4EJ0A 2BE7A 4I2GA 4A91A 1PNOA 4UXIA 1G42A 1U0EA 5F23A 3OQIB 2RGNC 4UXJA 4BIIA 1MQ9A 4TSFD 3OF3A 3NTXA 4ILKA 2NYUA 1A6SA 2BBTA 4LVSA 5H16A 3ZWAA 2YYSA 4KYVA 4XLLA 5JVDA 4IGEA 5DK6A 4A2QA 3SSAA 5T3YA 2NUAB 1S2IA 2OL4A 3A1SA 5LYJF 3TJZA 1GITA 4DQUA 2PYZA 5F78A 1B6TA 5ICSA 4UU7A 2ZBUA 1U3TA 5EIBC 1PR6A 3B8EA 2V6JA 5BV8A 1SRQA 3WLIA 2MTBA 4XW2A 2EW2A 1ZQEA 2PYDA 1TEZA 1IJBA 4TKUA 4NPHA 2RGGA 4OXNA 5DK4A 3T4EA 1DJOA 3HDJA 2X76A 2JZCA 4P9NA 1E2UA 1ZCFA 5F2KA 4RY9A 1QH0A 1H69A 1J9GA 5BV1A 1KZ1A 4ED8A 4FI3C 4IZOA 4F2SA 4NDZA 3MN1A 1KA9H 3ZLTA 4B8WA 4GI1A 1TTHA 3AFOA 3OZCA 5BN3B 4JT4A 3CGGA 2FSIA 1VJCA 3CZPA 2RE8A 4M1QA 1NK7A 3NHBA 4M9LA 2VDWA 5KO2A 3SI7A 5BV0A 2C4WA 3OESA 5NULA 2OUKA 4HQNA 1N1DA 1SUPA 2NADA 4JJAA 1DKMA 2H7YA 5CB1A 4MWZA 5JRDS 3A28A 2YTZA 2JBWA 1HEKA 4ZPXA 5LNK6 1QO9A 4JL8A 1JHDA 1R9NA 5KFGA 1CZNA 1KDRA 2Q4OA 3OCXA 3GCWA 4B3IA 4NOKA 5DM0A 1U48A 1NN1A 4FLFA 1ARZA 1IHOA 1A2BA 5K0ZA 5FWYA 5KFRA 1EK0A 4ROTA 3UNXA 3MELA 2FOIA 4IJQA 4C76A 3R0VA 2Q0ZX 1U1GA 3QEJA 4L8YA 3CM0A 4HDOB 4JLOA 5IH7A 1H38A 4Q9NA 3WA7A 5TVGA 4HVTA 2R1VA 3WLLA 4NNPA 4F4IA 3TIVA 2Y66A 1T3TA 2IYUA 2KB0A 1EM8B 2C57A 4XQGA 4FIDA 4TN1A 2GZHA 1YI1A 4Q01A 1I9CA 5KYVA 3ORFA 1WRBA 4WXPA 1IPFA 5ECDA 4OSEA 1HUOA 3TR5A 4WFIA 5AVYA 1ZNYA 3VX4A 7ICGA 1PJZA 1U0OC 3SR0A 1T2VA 4UNIA 5EZYA 1HNWB 2ZR7A 1XDSA 4YR7A 4EFNA 4C0XA 3O4RA 3V7LA 4US0R 4UHCA 3EGOA 4ZKDA 4ZTBA 2F2TA 2IHNA 4YRRA 1WV0A 3LHFA 3MTDA 1ZQAA 1MX3A 5HQ3A 3M89A 4OQNA 3IP5A 3RC2A 2H1OA 1PK8A 4RHYA 4P4NA 2JGNA 2OQRA 4MITA 5KYWA 1DRUA 5E8RA 1GGMA 3SU8A 2WPDD 4ENQA 5EHXA 3L7OA 1ETUA 4XRGA 2Q6IA 4RETA 3UHOA 6ABPA 3E22B 2PUDA 3CRRA 1BMFA 5J2UB 2PZBA 2VP4A 1F5NA 3EPPA 4JLKA 3BS5B 4NJEA 3MWYW 1PJ2A 4ZGWA 2WABA 4DANA 2C4VA 5C3UA 2YC4C 4D43A 4IKPA 4PXSA 1AKYA 1FTGA 3GFFA 2ZPAA 4J3NA 4UTVA 1G7CA 1FSSA 3KO8A 3UCEA 3ZHOA 2C5GA 2V6FA 5THXA 3ZY2A 1YE3A 3G2PA 4Y6OA 2ZYHA 2E8MA 3MWEB 3KWLA 1WCIA 3UWDA 1GGFA 1XRQA 4CETA 5IARA 1A77A 1GAEO 2RLTA 2G72A 3V4PB 7MHTA 3CB4A 2P30A 4F56A 2OMKA 4TV8F 1ACLA 1A98A 1Q1EA 2I6UA 4BNZA 2PGDA 4DSUA 3IUYA 3RG8A 3ABQB 1WMSA 2PZGA 1MH1A 1G6HA 4AW9A 3Q8RB 4HEHA 2AKYA 5CTAA 5KYYB 3PNLA 4C8KA 1B42A 1VB5A 4WGGA 3WO0A 5HFAA 3QXCA 4UAZA 4FYYA 4NFYA 1HDIA 5LLSA 2FF7A 2V3WA 1SC6A 2O2HA 1AD2A 3HN7A 4MB0A 3CIOA 3NTVA 3D6HA 4YXFA 2C3OA 3AF5A 1K6JA 2ID8A 2QLFA 4KGZA 4HVCA 4LBVA 1QX4A 3W4IA 4B80A 4R2KA 5DNEA 2FNAA 4CKEA 4K9DA 5CT6A 2ZXUA 2P5SA 4DG9A 4FW8A 4DZZA 2J59A 3W9BA 1U1EA 4JFAA 5FRDA 2PJDA 5MGNA 1MDBA 5M2QA 2F7SA 2QVLA 4EEKA 5U9CA 3TBHA 2A9OA 1N2GA 2RHHA 4JLUA 4BGDA 2H3HA 4L9WA 3WLOA 4A82A 1DOHA 3RDPA 2XMBA 1NMQA 2EW1A 3TTWA 2PBFA 1PUIA 5HR5A 2YXEA 1AUXA 2RH9B 4KLTA 4NPAA 1YS1X 4XDHA 5J0YA 1ODJA 4YA6A 3RNLA 1RXUA 2C2KA 3PNYA 3GYGA 4BZPA 1QONA 4C7VA 3NIGB 4ARZA 3GCDA 4UUNA 1KO7A 3OY2A 3RC9A 3AN1A 2ZJ2A 1E5XA 3LY9A 4H7DA 3O1LA 2JI7A 4OJYA 1M5TA 4MQMA 2JFXA 2FF5A 3V1NA 3OP1A 1FMLA 1ZNQO 1YE8A 4FJ2A 2LI6A 4I50A 2GAJA 1YIAA 3U56A 3OZFA 4OI1A 1IM8A 4Q1CA 4MTCA 3WMRA 4O3QA 1V8ZA 3W8RA 2IIPA 3BREA 1RCUA 3GRPA 1UJBA 4UHKA 4IW3B 1CDDA 1VLHA 1EQAA 4CIAA 2H7XA 4PFKA 2HEGA 5CCDA 1PWZA 3JPOA 3C15C 2IH5A 4N5MA 2BTQB 4E4RA 2BPOA 1DK2A 3UVEA 4FGKA 4OG2A 4XGQA 4EHFA 2Q2VA 3WVNA 5KWSA 3AMZA 3WYFA 4KDCA 5CIQA 2Q9CA 5EJ9A 4IUDS 5GZ1A 1RLIA 2VDPB 4U2KA 3WJ1A 5FLEX 1YMVA 2WIAA 4OJOA 1X15A 4XLTA 4M54A 2RJ3A 2ZJZA 3HXTA 5JLAA 4CCWA 3VCBA 2Z5FA 3PUZA 3HXOA 1WW8A 2H0QA 2G08A 2XB2A 3W2FA 1P5JA 3PL1A 2CLIB 4L9AA 3VU8A 2EBUA 2JCXA 4UPDA 4EQ6B 3K2EA 2NYRA 2W37A 3N8NA 3HEBA 1RM6C 2JCYA 2G7MC 3UYLA 5CITA 4YJGB 4BAZA 3J80A 1E63A 2OD7A 2Q8PA 3EPHA 4OP3A 5KT4A 5ECWA 3SVZA 2ORYA 3QPVA 2V55B 1P9NA 1HFKA 4F0JA 2E4ZA 4DJ5X 2RK3A 3SM9A 2RAUA 3V33A 2CEAA 4E70A 1YTUA 1PNVA 2MHCA 2DBQA 2C7GA 3K4GA 3UWSA 2ZIVA 2CNWD 3RK1A 1NWCA 1LZLA 1CIJA 4BNXA 3BZCA 3FVQA 3K0AA 4G5GA 4KQFA 1IJEA 1MRZA 1S10A 1Z7WA 1N77A 3JD4A 4PFJA 4K9SA 3K92A 1B8NA 5AVKA 1ZIDA 3V4OA 2VA8A 3N70A 4RCZA 2JFUA 3KAKA 1S97A 2DB3A 3TM5A 4DFPA 2ZQ5A 2WY2D 1SCAA 1CU1A 4G9EA 3WL4A 3CONA 3A1CA 1IEVA 3R9WA 3CNQS 4AP9A 4NXMB 3GA0A 2FLPA 1HDYA 2V9PA 1YFLA 5DHPA 1KIFA 4HDRA 2F1OA 2H1CA 4NE7A 4QPPA 5JY1A 1UEJA 1YKSA 2Q6OA 2NO1A 1KI6B 3NT2A 3W34A 3MSCA 1T5TA 1JKXA 2Q2QA 5CPBA 1U0LA 3VOTA 4G5QA 4U7HA 3X1YA 3E1KA 2Q7XA 1YA6A 4QYXA 1Y1PA 1RCTE 1I6WA 5D8DA 4YXWD 3SJZA 3NEJA 4LBYA 3DDWA 1V8PA 2AV6A 4XIGS 3CEAA 1M2VB 3HA5A 3IMGA 4RIFA 1BA3A 2D1RA 9ICHA 4H6WA 2ZDGA 5LD2C 3JQ7A 4WCFA 5HHHA 5K0NA 4O29A 1E6LA 1JHPA 4YGXB 3TQOA 3OZAA 2FSSA 4QD3A 2R2AA 2Z2JA 2ZSEA 3GQBA 3EDQA 4DR2B 3HNRA 4DWJA 2DTDA 2FFAA 3ESQA 2E5LB 5EMNA 4TMYA 3HCBA 1YH3A 4X95A 3QOYA 1UKBA 2C8KA 3NUQA 2SCUA 2XF8A 2RHTA 1JLKA 4AF8A 1V39A 1JILA 3FDZB 4TOIA 5E4YA 1E3WB 2RBKA 3PUVA 2WIKA 1IWPB 1GNQA 4ZVPA 5THQA 4QM7A 1L5GB 1KBQA 1THMA 5H7XA 4Y6QA 2EAMA 3ST7A 4I55F 4C7OA 3HYRA 1O0SA 3QJGA 3FJOA 3WKDA 2IUTA 1XD2A 2W9MA 2PX6A 4DQDA 4MV0A 4TYMA 3LC2O 3RS9A 4XGIA 3SXUA 3HCFA 3B1XA 1WQ1R 2HPVA 2G82A 1SQ5A 4YMOA 5JNSA 4HS9A 1SC3A 2PU5A 4Y1RB 1OYWA 1V4BA 5IHPA 3Q7PA 3G2JA 3ZQ6A 2A86A 2TS1A 5JXWA 3ZN2A 4J7CA 1VIYA 3T3FA 4BWVA 5KG5A 1A7UA 2GSDA 3CHYA 3BB3A 3Q1LA 1EWRA 4KUGA 1J06A 3G8CA 2JI9A 1ZZEA 1CUIA 2PUFA 1WMAA 2AMJA 3KUUA 3ZQ4A 4YHBA 5BYAA 3N2LA 4TPKA 3CVVA 3RYCB 4DJFC 3IAM6 3AU8A 3T3MB 4HRVA 3EPIA 4WJZA 3IMCA 1NBHA 2RK4A 3WFZA 4UU0A 5KKAA 4WKCA 4JV0A 1LTKA 2QE7A 2Y71A 2GS9A 5MN6A 3ZI7A 1DO2A 3IIMA 1TZMA 1TKAA 3FNGA 4DSNA 3R3UA 5JZVA 5JFTA 4IL6U 2PZFA 4Y2VA 3I4LA 2IRWA 1NWHA 2VJDA 1C9MA 3WLPA 3V1MA 4E2YA 4Z51A 1D9FA 3TSOA 3BWXA 4ALIA 1S8FA 4BGIA 3QPUA 2VJQA 1SU6A 2NSDA 1P3DA 1PZHA 2QX7A 3CNOA 1H1DA 3ZDDA 2ATXA 1DKRA 4R81A 3M4YA 2FMFA 5JCPA 4U9IS 4XA8A 3I6MA 3CMMA 5HE9A 4NX2A 3K8ZA 5HA5A 5JMOA 1UFVA 3G2KA 4MUXA 3TINA 2W8ZA 2FMKA 1XZGA 1QV7A 1FY2A 4DLXA 4HAIA 2RGYA 2PV7A 5DXJA 2R7MA 1VL2A 2VP3A 4RPGA 4GL2A 1BMFD 3SX0A 2APJA 3QYPA 3RH0A 1Q92A 2B4YA 5K4LA 4MHTA 4GD3Q 4BYGA 1KI8A 1JQJC 1IG0A 2HT6A 3WB1A 2PKEA 2MMCA 1NK9A 3HY6A 4CTMA 5DYIA 2XI4A 1V7ZA 3GUYA 5C1PA 3KQLA 1TAGA 1N2EA 2WM2A 3E3LA 3NFYA 4UNRA 3NLLA 3RS0A 2DCUA 2VDMB 1VKZA 3ZHSA 1YS6A 1KQFA 1COKA 5ICGA 1MO4A 4CM3A 4I4TF 4CMAA 5IS2A 4JJIA 1ZL0A 3KUCA 1EE1A 3L3BA 4Z4FA 1WNFA 4QIHA 1BXGB 2C2HA 4X97A 4MW1A 4EFDA 5AW7A 1SCQA 1IN4A 1CRWG 3I37X 2J6SA 1WUYA 2AB0A 3Q8WA 4CKBB 1PHPA 4RKWA 4DIMA 1QKIA 2XHZA 4NHEA 3UGQA 4I81A 4KODA 2VJKA 4Z9YA 2YNMA 3LXUX 2XOXA 2PFKA 5JRZA 3BQ9A 1B16A 2GESA 1EP9A 1E7WA 1HSZA 2QJWA 2QUAA 3VI4B 2KNJA 1J5XA 2ZKIA 4I99A 3CLUC 4GZ3A 3C0KA 1TZ2A 2WWXA 5H82A 3GQCA 1KDYA 2IX3A 3T79A 1C80A 5DB9A 4DL6A 4F1JA 4HDSB 1WXWA 4MEXA 4YB8A 1RC0A 1AHNA 3DAPA 3H1BA 4J0HA 2H1RA 1OZ0A 1SU7A 4BO2A 4BZQA 1XKXA 2PX4A 2NXWA 5D5QA 5LP6F 3DMNA 4Q3DA 4GLJA 1BROA 2BJWA 5CRIA 4MQUA 2ZXFA 2ZWAA 4ERXA 4L2IA 3MBYA 1QM5A 2GZ2A 1XL1A 3TQFA 3CLSD 4ER3A 4WT7A 3RKSA 3RR7A 4BEBA 4RNNA 3DHWC 1Y3AA 1Z36A 2MWMA 4IHJB 4AKEA 3FPJA 1VFPA 1SXJE 3P1JA 4DIKA 4NIMA 2WTXA 4G56A 1GUDA 4RV5A 9ICNA 3DJYA 1P6XA 3VZBA 3ISCA 1USVA 1I2MA 3S1LA 3PO5A 5EI5A 4NJMA 4RVCA 1HDZA 9ICTA 3LFUA 3THXA 2FFHA 3PNVA 3UWMA 3O94A 4I8DA 3B51X 2A7XA 1DB3A 2FHPA 5KVVA 3E70C 1NVMB 4Q02A 4EF5A 4DL4A 1R6AA 2VUSA 5BR7A 1RPJA 3TFSA 4HFMA 5IFKA 2YINC 3LLVA 2PT5A 5DO9A 3BFJA 5IM4F 3M0EA 3X1XA 3VYRB 4YAFA 1IONA 1FSZA 1R0ZA 1ZQJA 2PT7A 2R84A 2AZDA 3GGSA 4K5QA 3AM1A 4DPLA 4P5PA 3GLRA 1KFKB 2RFLA 1NMYA 4NBSA 1XZCA 2YICA 3B78A 5CA1F 3A25A 3L7AA 2JI8A 1QDLB 3AM3A 4XGNA 5I9LA 5J63A 5A04A 4NCIA 4F5PA 2O8FB 3P9RA 1EU1A 5LDDC 5AK3A 2ZSAA 4PNHA 3VFDA 5EHNA 1L3SA 3ELDA 5JQGB 4YAJA 4B75A 1PLKA 3DAOA 2O2JA 4RL4A 3SAJA 2QROA 1N34B 4BOYA 3OQJA 4TYYA 2JASA 4BB5A 4NU0A 1PT8A 4A26A 3SFTA 1V41E 4X63A 1FU8A 1N5LA 1G8SA 4OL0A 3DC7A 4IICA 2A1JB 2FSHA 1H3FA 5IABA 1JI3A 3C43A 1UBUS 1W1IA 3FJYA 4Q1BA 4BKUA 4BWGA 1ZX1A 3FZNA 1G4HA 2NTNA 4E4YA 1NRIA 2FEAA 1NN5A 4UTOA 3TE6A 2ZT5A 2VHCA 2R79A 2PV0A 2P6MA 3PGVA 3IPXA 4GSLA 1DU4A 2HJWA 4QIWF 4IRKA 2BMEA 5U1PA 3I76A 5CDFA 4OH1A 2Z30A 2QDXA 1ZXBA 4FD2A 1DXQA 4F5OA 5CLJA 1PV2A 4EEYA 3KELA 1B14A 2P0AA 3M8KA 5I9TA 4AQYB 2QXTA 1HT1E 3VISA 3BUSA 3C7DB 4TMWA 2ZITA 1IUPA 3C8HA 1NZJA 3MVEA 3V4FA 2O9JA 5ALHA 1YNOA 2R8JA 1LBSA 4E32A 4KLLA 4XFJA 2RHDA 4OQYA 3HVUA 1Q12A 5H3HA 3DD1A 1DHTA 1L4EA 2O06A 3TD6A 3AM9A 4J3JA 1DELA 3G0GA 5G4KB 1Z5OA 2ZI9A 2QZ9A 1LWNA 2BC9A 2KQUA 1QH1B 4EI9A 3D3KA 3RIEA 3K0FB 3SOZA 3UXOA 3K35A 4C2BA 4IDFA 3IT1A 2VWGA 1VZ2A 1JLLB 1RYZA 3DHEA 2ADMA 4P86A 3JPSA 2R8ZA 3TB6A 1T8WA 2O0KA 4WZBB 4JLVA 4E46A 3PZBA 4EGAA 4QXQA 5DJ5A 1LLCA 1RYEA 2OSBA 3ZDCA 4CCSA 4ZOLF 1T6BY 3HWRA 3ZVLA 2ZIXA 2BPGA 5CWRA 4I2EA 2JAWA 2ZWOA 5DHAA 2WWYA 1NBME 2H3ZA 1K8QA 5M5BA 5DU2A 2CLDX 5FHRA 4K46A 1T9CA 4M1MA 2NLOA 2DHRA 4Z86A 3SQWA 1X19A 1D4ZA 1W5AA 2J9GA 5EKDA 1W581 4RQ0A 3O0TA 3VC7A 5B7GA 3K1TA 4BVEA 2IXFA 1ATZA 4KV7A 3U61B 3R3WA 3ELUA 1E2JA 2JL1A 2ZVPX 2X3FA 2QT0A 1EFVA 4MRRA 4UASA 3ICEA 3E27A 5IT4A 4IEFB 1I1NA 3EUWA 2CNLA 3ITNA 3DEJA 3N2GA 4JQZA 3NRJA 3QX9A 4EEXA 4XSHA 1N7GA 2CDAA 4C0JA 1LDNA 4NWIA 3N87A 4R83A 4A8HA 3MUOA 2E87A 4TVBA 3GGOA 4LXYA 3AZPA 3E61A 1USGA 1LPAB 3VR0A 4L5JA 1VCOA 3B36A 1QIMA 2XDQB 1ISRA 1CKEA 1EFKA 2VJCA 4U7DA 1Z3CA 1AQUA 5TEVA 3RE1A 1O0CA 3E5MA 1CR1A 2GUWA 4Q48A 4PGGA 2NU7A 3L8YA 3PXEA 8OHMA 5JFGA 2BR4A 3STWA 1N0WA 1PQUA 3H97A 3IR7A 1NJ2A 3IO3A 2EKPA 2P65A 5LUBA 4ER7A 5A3SA 1SH7A 5FQOA 3WP1B 2Q0SA 3RHSA 1XTVA 5LMZA 4RFLA 4RM3A 4LNUB 3OPXA 1X70A 1SOVA 3A36A 2JGIA 1G8FA 3V8VA 1DWOA 3DMDA 1K5PA 1V1RA 5A3JA 3HE3A 1N9KA 4TMKA 5HBGA 2QB5A 2Y1LA 4ETMA 1LQTA 1TK5A 3RVPA 5ADVA 3V42A 5ESDA 1AM4D 3AI2A 2QE7D 1W36C 2J3KA 4PZPA 3CSDA 3D3JA 4WLEA 3D1VA 1TMYA 3OJLA 1NHWA 5A03A 3M6XA 2JAQA 3ER9A 3TTVA 3GFKB 4PHHA 2QIPA 5D3MA 3B0YA 4EENA 2J9RA 4HNHA 1WWVA 1OC4A 1XMPA 1IZ7A 1SVNA 3RC8A 4BO3A 9ICRA 3T1OA 3NWJA 5AW8A 3KQMA 4MW2A 3MD9A 3EA0A 1RYYA 2VUUA 4ECSA 3K9NA 4D8UA 3LY5A 4PG6A 2DPGA 1VM6A 3ZK7A 3W5VA 1ZC3A 1R8JA 3IP6A 5ADUS 2UZ1B 1AVTA 4CQLB 3FPFA 5GJCA 1E59A 4DEVA 5LDGA 4BRZA 1OUQA 2WMYA 3ICXA 2YXLA 1W4LA 4P3OA 3FZQA 5AJWA 4A0FA 3HP1A 3MM4A 4IKOA 4LZNA 1D9XA 1IBRA 2P6PA 4ZYVA 4WJKB 3EJWA 1LPMA 1HQDA 1QGOA 4UDNA 2HO5A 4ARVA 3OEEA 1BW9B 1E3SA 1KJNA 2EQBA 2DUWA 2AGOA 3TNJA 1QWOA 5BT8A 4DWOA 4AKHA 2D5IA 4KWEA 1A4UA 4ND5A 1JUDA 3CPHA 4WUTA 2UVUA 4F3OA 1R4MB 1X7WB 4C80A 5JPIA 4V0QA 3GJ8A 3UFXB 3UJAA 1B8VA 4ALKA 4OJMX 1VSUA 3O2QB 1IM4A 2J4CA 3QM1A 2GLTA 4WZAE 3K8YA 4GBMA 4J8PA 3ET5A 1W46A 4NEQA 2MYNA 1COWA 1XTKA 3W2IA 2X22A 2ZBFA