4P0QB

Crystal structure of human mus81-eme1 in complex with 5'-flap dna
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
334
structure length
284
Chain Sequence
NAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRCVIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKTLQGFVTDITAKTAGKALSLVIVDQEKCFVSRVDAEEALVDLQLHTEAQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLNRVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRTSRRIGPELSRRIYLQMTTLQPHLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
molecule keywords Crossover junction endonuclease MUS81
total genus 82
structure length 284
sequence length 334
ec nomenclature ec 3.1.22.-:
pdb deposition date 2014-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02732 ERCC4 ERCC4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.670 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 4p0qB02
3.40.50.10130 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4p0qB01
2JPDA 4BXOA 2ZIVB 1J22A 2BGWA 2ZIUA 2A1IA 2ZIWB 2ZIUB 4P0PA 2ZIXA 4P0PB 4P0QA 4M6WB 2ZIVA 4P0QB 1J23A 2JNWA 2M9MA 1J25A 4BXOB 1J24A 2BHNA 4M6WA 2ZIXB 2ZIWA
chains in the Genus database with same CATH superfamily
3LUDA 2HA6A 4BV2A 2JFNA 4G8JA 3UM9A 4UB1A 2Y9TA 1RMQA 2HU7A 2MT9A 1OZAA 3FPLA 4NONA 5FV7A 4DQVA 1OREA 3E18A 3NJ4A 3IEMA 4QNMA 721PA 2H07A 1KC3A 4KFCA 4WXMA 5IBQA 1AZSC 3LWDA 1JAYA 1RRPA 2AR9A 2JH9A 2V3WA 2L19A 1U7UA 2XDAA 2WU8A 2GD6A 4PRYA 3OP1A 5C5CA 4A4DA 2IBTA 3TSWA 3DD1A 2WU1A 2DHQA 1N2XA 4HRXA 4NH0A 1C8KA 4B3FX 1WVIA 3I6BA 4CN8A 3LXXA 3ILHA 4L28A 3DLHA 2B21A 4WASA 4M9SA 1IEXA 2UYGA 4ZQHA 3RH4A 5LM3A 1R50A 4QUKA 4RZUA 4ROTA 3OA0A 4IDOA 3V1YA 4FOTA 2JC3A 4IH9A 5A5DA 5C2JB 6Q21A 4YJ2A 1WIWA 3HNPA 1JWLA 4IRMA 4PGYA 4G25A 3PXUA 1GOTA 1VMDA 1XQYA 2GRJA 4Q1FA 1QS0B 2LDBA 1PSWA 4ARZB 1E1KA 3O4GA 5EUCA 4FKMA 2OYRA 5JAMA 1XSNA 4CMAA 2JIDA 3LYUA 1H9BA 2QAIA 1W73A 2FPWA 3ZR4B 4B32A 1RDFA 1ZICA 3F5QA 4IH1A 4UU0A 3N76A 4HXYA 1T9ZA 4RELA 2GBGA 3S1AB 2D8CA 4EO7A 1N6KA 1RAAA 3VSBA 2WMDA 4RY0A 3IC5A 2Y1GA 3V8RA 1BA3A 1EVZA 4HAOA 1WWVA 5J0XA 2CFSA 1Z6ZA 2RB4A 3CNQS 4LC1A 4V02A 1KE1A 2FMUA 3QBTA 1P9NA 1UFRA 4CMBA 5EJ9A 4PW0A 1KRXA 3WTCA 4UCFA 2QRVA 3BK7A 4MS1A 3AN1A 5IZ4A 2ZUBA 3S1LA 1TEXA 1GTRA 3LPAA 3ELBA 4RK5A 5AOCA 4FLMA 2ZYHA 4NKRA 2MAXA 3PW5A 2JJYA 2Y3IA 1VIMA 3HCDA 2WDPA 4LNUB 2UUPA 4QXMA 3QPDA 2C59A 1P2BA 2CXQA 1P39A 2XVYA 4Y7CA 3NALA 1OASA 1CZLA 1O6GA 3D31A 3U3ZA 4DYVA 3IEPA 2Z5FA 4DSKA 3FROA 2I65A 4MRPA 4YT2A 1CUIA 2V74B 1FFAA 4GXNA 1FX0A 4KWTA 4BLOA 5KIAA 1XWWA 3MFQA 1CERA 1QH1B 2FPUA 4DR7B 1THGA 1R6XA 1ZOSA 2OV8A 2J6UA 3GDOA 3CEJA 2ASLA 2ONCA 4R63A 3H1AA 3UPDA 5T8KC 1R0LA 1YS4A 4WNCA 3D2AA 2W11A 5BSHA 2QW1A 1XEXA 1MN6A 2WC1A 2MJLA 5MGNA 2UUAB 3MWJA 2P30A 4N1AA 2ZYWX 1TAUA 2V98A 4RC9A 2HXYA 2YHIA 4H7JA 4F5OA 1XCBA 2I29A 3C3CA 3W3AH 1NUTA 1FFVA 3R6TA 1DP4A 3I5YA 1XA0A 1K98A 4C6SA 3HXMA 5HS4A 1ZYQA 4I5GA 3GNQA 5EN4A 2K4HA 2G77B 3GMSA 4OL9A 3RH6A 5AKEA 4XPIB 4YJDA 4OOFA 5JAQA 1OT5A 1JJFA 4Y2GA 4DIEA 4HDNA 5FPSA 3RVBA 5DEIA 2GBIA 3BXGA 4IO1A 4EL0A 3E23A 4OK6A 1VC2A 3PIRA 4YY3B 1Y6FA 3L9XA 2YCBA 3BGDA 3CIFA 3ROEA 2VXOA 2GA8A 3EZGA 1X9GA 4D2IA 4N12A 5FLXA 1TYCA 2IXFA 2LYAA 1M2HA 3VPFA 2D13A 1T9BA 3HV0A 2DSNA 4XRRA 4D9IA 1M6VB 4C05A 1WSDA 2BTEA 3PW0A 1TZBA 2V3CC 2O57A 1FOEB 4MGEA 2VT3A 3ONWA 4LXXA 4ZVVA 4AWAA 4D9MA 4JL8A 2CXTA 4DG5A 3E61A 3ZX5A 2XKKA 4G9GA 3ZTTA 2A9RA 3FPSA 4HXFB 1Q22A 4FONA 5JSFA 3HRDD 3HCBA 3ZJYA 2GFIA 3G1WA 4ZVKA 2C3OA 1G42A 3NWBA 3GMDA 4KXMA 3I6IA 2Q9BA 3THVA 1RBMA 2ISQA 4K40A 5A3JA 1N5IA 4GGMX 3EEYA 3VAYA 2XYVA 1OWNA 2UVRA 2OCLA 2BFBB 4UU1A 1NYQA 2IL1A 5ICGA 4GL2A 1XL1A 1UK7A 4XX1A 1ODKA 3IP8A 1H38A 5EI5A 5LMUB 1L6NA 1Q50A 8ICBA 3KB2A 1EB9A 4BXOB 3QWHA 4FWTA 2O05A 4OXQA 4ZDKA 4MRSA 2Q5OA 3RYIA 1XROA 3PY8A 4B3JA 1BG6A 1ELOA 3OIYA 2EV9A 4RMNA 1FYEA 4INAA 4LRSB 2G1JA 4Q4JB 5E2AA 2AG5A 2XUPA 3AI2A 2HGSA 4ETIA 3JQBA 1G19A 1PV2A 1YHYA 1KDYA 3ZCSA 2V7WA 2XDYA 4A26A 5G5HA 2O8NA 1KZGB 3FFBA 4UTPA 5IJWA 2JFQA 2WBLC 5KL8B 1D9DA 5D4BA 2J3KA 2YN2A 4GI2A 3DEEA 2C5SA 3PICA 3QU4A 1V26A 2PH5A 3EYWA 3O1JC 3OJLA 3F3KA 2PGJA 2CNWA 1EIZA 5FPTA 4HGOA 5LN1A 3EXAA 1N0VC 3MDCA 1CZKA 3PQ2A 1U8YA 3IPCA 4NJMB 4FBLA 4MR9A 2HHUA 3C8HA 4Q3EA 5J2TA 1LLDA 2ID7A 4AURA 4AZ3B 4Z9BA 4NFLA 3QEBZ 7ICRA 5KJFA 5B2EA 5ALLA 3CC8A 2VTKA 3LC2O 2BI8A 3T35A 3ZQUA 5B4UA 3HA5A 1IC6A 3EUWA 1KMQA 3OX3A 1XR3A 4RPKA 1ZVMA 2H2DA 3SEQA 3VNBA 5J2JA 1J21A 3KETA 3JWIA 5COBA 2RDJA 4IINA 4Y1FA 3RE1A 4O3PA 3GRVA 1CQXA 4GVLA 1XTBA 5A9SB 2PZMA 3DHEA 2YQZA 4FEGA 5JSHA 3KTAA 2O5RA 4XUGB 5HGJA 1UBCA 1N2JA 4WECA 3IT2A 2NO5A 5AUNB 1CF9A 3PC4A 4LX8A 4ZCQA 2IU4A 2BHNA 1MABB 3DB2A 1FQOA 1T36B 1Y7PA 1X80A 3I42A 3IUBA 4EHAA 2XQIA 4NI5A 2XO7A 4QOSA 4B71A 2I7DA 2HDOA 1KEZA 1GQYA 3QMWA 4LJSA 5AVOA 3AOGA 1AQYA 4YT8A 3AY7A 2H2HA 1JMSA 1KI2A 2QPAA 4MUKA 3SXUB 1RADA 2ZJ4A 3FSGA 1N8KA 4I28A 1RYHA 2IKQA 2X1LA 1CS0A 2CLSA 2VF4X 1L5NA 3T3HA 1C5KA 2C2WA 2WSYB 4H1TA 4EITA 5KEIA 2H18A 4JIGA 4JYPA 3GV0A 1CF2O 2C42A 1PN3A 4HHEA 4PLZA 1PF7E 1P2SA 4IOKA 5BO5A 4NM2A 1PZEA 3T7TA 3BN3A 4OYYA 2VKTA 1VMKA 2I03A 1XTTA 2FFRA 3KVRA 4UFPA 5JALA 1U0FA 2YVQA 2P5YA 2NU9A 2V7UA 1XJWA 1PVDA 3HP7A 2P62A 2ABWA 3DEFA 1W47A 1LW7A 3HHPA 3QH4A 4P08A 3VUEA 5A5VA 5FWYB 3UMSA 4G1UC 1JXMA 4OOEA 2Y05A 2GPYA 2FMPA 4Q3DA 4GR9A 2O8EA 4BRSA 2GR9A 3R4VA 3CUUA 4JYBA 2GESA 4C7XA 4N0DA 3W7BA 4HUJA 1GV1A 3G6WA 4NK4A 1KBOA 2NXWA 4OLFA 3TZBA 2C4TA 4UPDA 2G36A 1Z4OA 3PX0A 3LE8A 4C4OA 3DHYA 4MOWA 3IB3A 3Q40A 5IAEA 1JHPA 4YRRA 4MW2A 1AKVA 3H19A 3RR7A 2I6TA 2CYCA 4NCBA 1USWA 4DLEA 2PN1A 4N3GA 1VCNA 2NWQA 5JSYA 2QI9C 1DMSA 1OIWA 1BA2A 2JJMA 1FB5A 1JDBB 4FYWA 1S2IA 4BMSA 4GC9A 1WF6A 4NMXB 2EJWA 4WZAA 1LU9A 4PM4A 1YC2A 3CUTA 4BKPA 3GT3A 2OCKA 1EK6A 1NXSA 3EXHA 4QIHA 4KLNA 1TQ4A 2JB9A 2PZJA 4LJAA 4QOHA 3SMQA 4F1JA 4B4DA 3W8DA 1A9ZA 1LBIA 2JIOA 1NW9B 4KZKA 3KEMA 4MS4B 2W04A 1SCAA 1T9GR 4LZGA 1ILWA 2JGRA 1TU4A 2MIIA 2QLMA 2BGIA 1ISIA 3E2MA 5FEMA 3ST7A 3CVYA 2PT7A 4GBMA 2XICA 2YXLA 3AF1A 3THOA 3VSAA 3KXKA 2IIPA 3LMKA 5BSUA 1FFGA 3NV9A 1U11A 1UP7A 1WDMA 1XDZA 3OU6A 4RYDA 4IOMA 4NR0A 3KKQA 1GYRA 1B6TA 4B9VA 2AYZA 5INTA 5LQAA 4FLFA 5J29A 4HTAA 5TQ0A 3QELA 2P0AA 2Q4TA 1E58A 2W58A 4LV8B 3ZWYA 2RCYA 3OFJA 2W2KA 1PUZA 4B9UA 1NDHA 1QH0A 1D1SA 1XHLA 3IQFA 4O59O 1H4TA 4OV6B 1VPWA 1BQ3A 2OMEA 2ZR9A 3H9BA 1XZIA 4KLHA 3K70C 2LPEA 3T7KA 4QTTB 1CEZA 2HSZA 1JRPA 2ZB4A 3FNFA 1MOQA 1RCUA 1ID8A 3I4LA 1UUFA 4HBGA 1X1QA 3A14A 4XM0A 1OX4A 3UAGA 2R8IA 5JY1A 1BE8A 1U4BA 3LZCA 4WEQA 4Y6LA 4DV2B 1UMDA 1ZMTA 1RYYA 3LQYA 4L72A 1V9CA 5K0CA 4HNTA 3WK6A 4C87A 2DB3A 3NUQA 3A37A 3E84A 4PGGA 2VSOA 5LXTF 2XZLA 3FC4A 1CV2A 1LLUA 1N57A 1O8CA 1W4ZA 2JEJA 1M2GA 5DB9A 2VJDA 3OQPA 4S1VA 4O4JA 4CCYA 4OXRA 2OSVA 4TLMB 5D1HA 3C3XA 1X7WA 3TI7A 4NAUA 1BGXT 3IR6A 3BA1A 2D1SA 2QI9F 1S2MA 1FS4A 2ZRPA 4N3CA 1HURA 2Y68A 1GGJA 2C3YA 4GMHA 1RYEA 3UYLA 3ZZUA 5JCOA 2QVYX 2V8OA 2WVHA 1BYIA 4MQLA 5F4ZA 1KYTA 3MJ4A 3R9WA 2ZJ6A 3EDCA 4NYMQ 1ETHA 1L7DA 3OUTA 4ITVA 3V4SA 3QENA 4P3PA 4E5KA 1CXZA 1U5BB 1Z56C 2FK8A 4ML3A 1UEIA 4OXXA 4ZU3A 2N75A 3UZUA 4C04A 4H17A 7ICOA 4ALIA 2J3JA 1Z0IA 2EBFX 3EIXA 3HXKA 1C8LA 1Z0DA 3ANXA 4WINA 3UFXB 1XEFA 3ZVKA 3D1JA 4P4LA 1CY2A 5CHEA 3DW1X 4IVNA 1CQIA 4RCYA 2Q3DA 1MA0A 2EU8A 2PXCA 4FGJA 4TT3D 1QU2A 2ZULA 3N1UA 4U6NA 5F5NA 4IIEA 1RXWA 1Z4NA 1D7OA 1GITA 2B4RO 2C0QA 3BCUA 1FP4B 1V48A 2PANA 5BSGA 1RRFA 1KJJA 1RJFA 2AX4A 2ISSD 4ZZ3A 1SZPA 3A05A 4KR3A 4B4OA 3R3YA 5AXBA 5EKUA 5IJAA 3TAXA 5BORA 4FZLA 1C9MA 5BN4B 1NXTA 4DA9A 3PQEA 3K70B 1GKLA 1LPSA 1SC3A 2HQSA 5CDYA 2GXUA 3A1DA 2KYRA 4AKTA 3PC2A 3G9QA 3OMXA 1HORA 3ER6A 4Z2YA 1SO8A 2JHCA 3VR1A 1YE5A 2EZXA 4I9FA 2AC7A 5HYVA 3DAGA 2D2EA 4TUYB 8ICEA 5IT5A 5JJLA 2I2FA 5DT9A 2OTCA 2XXAB 4MGYR 1PD0A 4RQAA 4XSGA 5KTMA 5HF8A 4PHDA 5DKWA 1AVTA 1GPAA 4QZAA 4UE2A 4XRHA 2HYDA 2LCQA 2M32A 5HUJA 2JFVA 5B58C 3PHBE 1REQA 2ZJBA 1QU3A 3DPIA 3JYQA 2WKPA 1DWOA 3CLUC 4EEKA 2QE7A 4M60A 4MPJA 1G8YA 4FS1A 4M0DA 3D4BA 4MVXA 1T0UA 2B8EA 4RLFA 4C4RA 2DPHA 1ZMBA 3BERA 3T4EA 1PS8A 2RSLA 3ZWBA 3C2KA 1FA9A 2QX4A 4PX3A 5LBUA 4CLRB 3DWFA 3U4IA 1QLWA 2WZBA 5BQ3A 1FC0A 4EZ6A 1ZOPA 2BHRA 1K92A 2Q50A 4MQ5A 3L7MA 1P0CA 4XYEA 3WGKA 4AJHA 4CQMD 3EAFA 4RVNA 5C81A 4PANA 2D2IA 5TIIA 4Q15A 1I6LA 3CUYA 4QBGB 3UMMA 2GLEA 1W25A 2WHXA 1PQYA 3K31A 4MPRA 2PZGA 4L4UA 4OY3A 4YN4A 1L4HA 3JU3A 4KVGA 5A4MS 1SU7A 3KAKA 4NATA 4BBZA 4ES6A 1ZL0A 4MF8A 2F3PA 4RVOA 5I9BA 4DR5B 4UARA 1YZQA 3I6ZA 3M3PA 1UKEA 5HKAA 4W5NA 1FRVA 1XSEA 3RS5A 1E9RA 1Q46A 2XMGA 3VO2A 4EFKA 5IFKA 1OH8A 1KZ6A 1WU8A 2FP4B 5DM60 4OLBA 2DEUA 3A6ZA 2CV1A 4GS5A 4GRAA 1Z19A 2VNSA 1AHPA 4EL5A 2IYUA 3OPYA 3LYHA 3VTKA 1SB9A 2CCJA 3N2NA 1XRPA 4H6XA 4BHTA 2M6SA 5K20A 4WN9A 2Z8XA 1Y6JA 1YRWA 3HSSA 1DWQA 1YS7A 3HN7A 4LJ5A 3LD9A 1E69A 3CZ9A 4PRZA 5A6SA 2B6GA 4XD7A 1Z8HA 5KYWB 3IAUA 1NDQA 1QKJA 3N2KB 2E2WA 3OZWA 3BKXA 4Q5IA 1OFUX 3L92A 4KFUA 1UBTS 5EUMA 1T3TA 2C9CA 4R1QA 5E8RA 3LP6A 4WA7A 3VZDA 5JCJD 3V8BA 2GQ0A 1J0DA 5GOTA 4CTMA 2E48A 1NG1A 1X3LA 2NUAA 2OK7A 4RSGA 2Q27A 3TW8A 1MOSA 5CCEA 1W2GA 4DNOA 3TI9A 2BKAA 1A9YA 1NVXQ 3K1YA 4C0ZA 1CJKC 3KWFA 3NIWA 5CA0F 2F77X 4MP3A 2ZYAA 4P3YA 1U9JA 3NYWA 4WK6A 2PKXA 3HYSA 3FB1A 1UWVA 4DSUA 4J16A 4E2YA 1EK0A 3VJRA 1DRVA 3LNCA 4D8WA 4DC1A 1S9FA 3MNFA 2R86A 1ZH6A 5THKA 4HYEA 3L6CA 4BFUA 4EHNA 5ESWA 1LVHA 3VU3A 2NZ8A 1N6PA 3SIXA 1BX3A 4UM7A 3I2KA 4ZPJA 3LT0A 3ESYA 4FZVA 2B3DA 2NU7A 1LH0A 1B41A 1TUIA 4DCJA 2DOKA 3RSSA 1T9HA 3LRTA 4DWIA 5CURA 1JDTA 5H82A 2FFBA 2GILA 3W34A 1OXVA 2QN1A 3AOEC 2XMRA 1FQJA 4IVQA 3NXSA 5D5PA 3S70A 2WTEA 1MUUA 1OPRA 1Q74A 3ZGVA 1Z15A 2BH2A 1GVNB 2XX3A 1N48A 1WB4A 2QUZA 4IGFA 4BAZA 3Q6MA 2ZWMA 1U3GA 1X94A 1AROP 2C3MA 5KT3A 3V6HA 3K94A 5G3ZA 3SBEA 4B33A 3LPDA 3E8SA 4UB5A 1N6OA 2BOVA 4P0QB 4Y0VA 3RUEA 4E5PA 3OESA 3QTLA 1OYYA 1UBSB 4J8PA 4UAGA 1JHMA 5D3MA 3EXFB 1ADYA 2R8ZA 3TRIA 4QNLA 5DHUA 5JR3A 2HQOA 2D7DA 3ZV5A 3WGVA 5FLEX 1HT1E 2G5GX 4MIYA 3DBRB 4BWJA 4RZ3A 3RYTC 4Z4QA 1PDOA 3QZUA 4LUCA 2LP4Y 1PKEA 4PYQA 1C2TA 5IAKA 2D3TA 5EWLB 2Y1IA 3K0AB 2EQAA 4IL6U 2JJ2D 2XSZA 4KTQA 1GL7A 2VBIA 3CEAA 3H5NA 3K35A 3MGKA 4FS8A 1I10A 4IX1A 4RJKA 2BFOA 3DDHA 4R1PA 2H4JA 3ZV7A 2VHUA 1T5TA 1I1OA 3C6BA 4J43A 4ZI7F 3AYZB 1H8HD 1T6YA 3VYRB 4F1WA 4KDFA 8ICAA 4P4PA 3GFGA 1BN7A 1T4DA 2XEXA 3GGJA 2GDJA 2JS7A 2WUFA 4YMSA 5LC1A 4YC7A 4B6EA 2QG4A 3UWMA 3RJ9A 4QJ3A 3TG2A 5JPIA 4JKIA 4XASA 2ZSUA 3N3AC 4DCOA 4O4HB 3EBPA 2AOTB 3VQTA 3LQRA 4LRQA 2PSJA 3USZA 2P40A 1E99A 3SDZA 3EEFA 4YO7A 5IYZB 3RVMA 3TTVA 3VHXA 2WUEA 4UBBA 4EG0A 2WSSA 2NT4A 1II8A 3WLTA 4BC1A 3RAGA 1CR0A 3EPRA 3OUZA 3K2QA 2NACA 3RHFA 5JD4A 5CB8A 4D9JA 1NK5A 1DEXA 3MUEA 3ECAA 1XPUA 3LLVA 2ZRLA 2A59A 2CVOA 3IS3A 1CZNA 3VR5A 4B3MB 4D8TA 3MTGA 5DGCA 2XD9A 4H7FA 4HNGA 2Q5EA 3ITEA 4UUNA 2VBCA 1CYEA 3L7CA 3OMWA 1J23A 1RWKA 3GEIA 1ZJ6A 3L7JA 3NTUA 4PC7A 5BSKA 1R9GA 3AEQA 1VIDA 4YT4A 5I51A 5TPZD 2XUQA 2Y1KA 4QPNA 5I4IA 3D7KA 3NM5A 4OJTA 4U7FA 4WXHA 3DEKA 4WTOA 3ZUGA 4D25A 3RBDA 3NVKI 4BKOA 2GN0A 2FE1A 1KYQA 3I8XA 3I72A 1TT7A 4CLEA 3TQQA 2WYWA 4AG3A 5JDIA 1JIVA 2H3ZA 3NS1A 2Y0PA 1UMDB 4MV1A 5TQ0B 3UFBA 4OHPA 2OA0A 3TQSA 1XNRB 3R5XA 4MDYA 4DR2B 3AR2A 4MR8A 3WLMA 2AC4A 2BD0A 3VOBA 5CJJA 1E9EA 1J2RA 1U90A 5J2EA 2FUG6 2JFHA 2LCFA 2X4IA 4TL6A 4ARUA 1LI7A 1UBHS 2QTLA 1IZ7A 1ZI9A 4JK3A 2WIDA 3DLBA 3LCRA 4I46A 1E3LA 3VO8A 4DNXA 3DXXA 1Q44A 4LF8B 3V1MA 3RARA 2HRQA 2IXGA 1XYGA 3IQHX 4DSZA 2QV7A 2ZI7A 3AKCA 3Q3HA 4LMBA 3FOCA 2PSDA 4MPTA 3DMNA 1U9IA 1QORA 3QEKA 4QUAA 5BW5A 4F3OA 1V9SA 4IICA 3L4BA 3RUIA 4K9MA 5HGXA 1QPGA 1THTA 2C28A 1Z6YA 2JHGA 3I73A 5JSUA 1E5DA 5TMPA 1ZKMA 1ESDA 2VCYA 3GZ4A 4M0LA 3UG6A 3TMYA 1XDGA 3QSGA 4G81A 1I5RA 1U94A 2ID9A 4U6PA 4NZYA 2XCUA 4HADA 9ICBA 2ZEJA 1MSWD 4IEIA 1AQ6A 4A6DA 3NH6A 2QUKA 1JEQA 3SJBA 2RGXA 4NF2A 4AP5A 1G3MA 2XUDA 5BNFA 2FKAA 5F23A 4KBGA 3KKZA 1G6HA 1QKKA 3U3MA 3IURA 1ZQGA 3EQ8A 2H2AA 3NPMA 3QUTA 1NKSA 3ENWA 3P19A 3QF7A 3DPSA 3PXGA 3TTUA 1JAXA 1E3TA 2KSOB 5TS2A 5IRCD 4PBSA 1OHHA 3QX7A 3OZEA 5JEEA 5K0FA 4YJHA 3OKCA 4YGXB 3R0JA 2XCTB 4G5FA 3P9CA 3VR5D 2ATEA 4MUAA 2ZT5A 5CFMA 3TSYA 2FHPA 3C6KA 1WMSA 4GPTA 4MVJH 1C9KA 3HUFA 4I2BA 1B8UA 1N2CA 4MMZB 3RFAA 2L18A 3DVAA 2VDWA 3E9ZA 1JR3E 1X2BA 4KLZA 5CYOA 4BO0A 3QVXA 4UM5A 3RASA 4XYLA 3I61A 1EX7A 1N5LA 2FEOA 2VDPB 4JOBA 2IDKA 2MCFA 1LTQA 1XZEA 2RGWA 1GZVA 2PRJA 2HHTA 2XYQA 1U65A 4F84A 4X7BA 2PJDA 5J0RA 4H1UA 4QQKA 4XLTA 4LDZA 3QVUA 4A6PA 4O2AB 1ML4A 1WXEA 3HB1A 5HKBA 4U7PB 2XTJA 2EKPA 1WW8A 1RHQA 1TECE 3FNEA 4BFCA 3E27A 8AT1A 1OXJA 1RI1A 2L0XA 1H85A 1Z39A 2SICE 3OJCA 4IG9A 3OSPA 1L5SA 3A6DA 2OY0A 3P97A 1M6NA 2C92A 5EJ2A 2Q41A 2CV2A 4MVJF 4O2AF 5E7MA 3H40A 2X0NA 5CG2A 4LOAA 1XN1A 4DL9A 3E15A 1Y6RA 2CNBA 3D6MA 3SNKA 4GT1A 4HS9A 3CLRD 1HF3A 5IZCA 2J6IA 2BISA 3DXZA 1I6KA 2REBA 1RXVA 1KFTA 3GLTA 4J0DA 1T1JA 2NTEA 2RHRA 2P4SA 3EFOA 4M1KA 4E5SA 3OZSA 3L6OO 4OTZA 1XMOB 3SHFA 4JOCA 1SZDA 4CLRA 1SWVA 1INLA 2O3QA 1RQNA 2WQZA 1YZKA 3UXOA 3O2JA 1BVUA 1ZNYA 2HA0A 5TJ9A 5B6JA 2FWAA 4JXKA 1Z4KA 3JRNA 1BPDA 1SELA 1UBEA 1D8TA 3K05A 3OCJA 4MEJA 3TLCA 1GPYA 4ESOA 1YB4A 2IZOA 3G0GA 5DTJA 5I7UA 2XD4A 1F44A 2QROA 4TYPA 3ZNQA 3L8HA 4PFQA 2JBAA 4CQLB 4YXWA 1H1DA 3SC2A 4PVCA 2DR3A 4DL7A 4YR2A 4OKIA 1QAOA 1P60A 1JIXA 1RAFA 3U39A 1UPHA 5CHGA 3ZCRA 1JIUA 4B4UA 1AXEA 1T5BA 2Y1DA 3K9GA 4HRAA 1VJ0A 1FBTA 1TMGE 1H8ED 2BCJQ 1PFWA 2H16A 1K7CA 2KLHA 2RD2A 5CAEA 1HPLA 2N9UA 1IB0A 1UCFA 3NAGA 3JVEA 5BR7A 1NYLA 2V6BA 3TUZC 7MHTA 2R3SA 4GXJA 1VL5A 4L85A 4R1MA 1VYTA 3KJEA 3UV6A 4WGGA 5F78A 2VP2A 1LCIA 2OORC 2IPXA 3I5AA 4FZRA 3C45A 2P2CA 3UYKA 1OCEA 2QM0A 4EYKA 2E0IA 2BFDA 2NNLD 1X0XA 4TT3A 4V24A 4EZIA 1W36D 5HK9A 4EAQA 2OLKA 3BFJA 2WAMA 2QUIA 3Q72A 4WBSA 5ALXA 4BNIA 2D0DA 1EWKA 1H1LA 1MAWA 4R2KA 1USGA 1PFQA 3TW8B 1K89A 4Z6EA 1CRQA 1RPLA 2RCNA 4RHEA 4DF4A 3EZ9A 2P2SA 3C8UA 3ONFA 2WNIA 4IXNA 4CEJB 2IEIA 1USIA 2PT9A 3E3OA 2ZATA 3L6EA 3A25A 5DULA 4RGBA 4QPDA 2PT6A 2XT9A 3FTEA 3LBYA 2ENWA 2XMDA 2O7SA 3EVCA 4NJ8A 1K8RA 2BE9A 2ZIVB 1ONBA 2KJQA 3KJGA 4X93A 1IXZA 3AVPA 3ZQJA 3G88A 2BVNA 4UZEA 2VFAA 5TGTA 5FWXB 2IS6A 3E0QA 2VSYA 4GG1A 4LISA 3BK1A 4FDMA 4WDQA 2IY8A 2R8RA 1B8VA 2F62A 3BTVA 2Q0HA 4P0QA 5LZ4A 2GVNA 2PRKA 4PC6A 1JQDA 4G86A 4KACA 3U4HA 3BPSA 3ZC3A 1LDEA 4JEUA 3PHHA 3FMPB 1XT6A 1H69A 3E9RA 3ZBUA 2D6FC 4IS3A 2ZBQA 4Q7MB 3S2UA 5CDUA 3GJ0A 3LKBA 3SX2A 4O02B 4KQJA 1J1ZA 1RWMA 1P80A 1TK5A 1VP3A 3HJBA 1JPVA 2QMHA 4E22A 3AB8A 5L7TA 4IZOA 1N0UA 3OLVA 2ERYA 5C1PA 3OC0A 4HFJA 1TAHA 3KSMA 1NHGA 4TS9A 2I4OA 1YNSA 3SV3A 2A5JA 5HQ3B 3RFCA 4CF6A 2BDPA 4MQEA 1IIRA 3H7IA 4MI6A 4IUBS 5I5GA 4OHBA 3T9FA 4UTNA 5EIXA 4OVKA 3V8EA 3IAAA 3HGTA 1H8EA 1PP4A 3VNVA 2WWVD 4QUHA 4DOMA 4BFVA 3WYAA 1NF9A 2DFDA 2FZKA 3OLYA 1QK4A 4HWRA 2OBFA 2P4HX 1BNOA 1VA4A 1JG7A 1W88B 1BOFA 4FE4A 3YASA 3IBFA 4C3VA 2CXRA 3BICA 3AF2A 5LR6A 2C8KA 1F7VA 3R0IA 3TL3A 2ODBA 1QPZA 4K4GA 4B74A 2DYKA 1CUKA 2HK6A 1FSGA 3U7FB 1SXJD 4I3FA 3HBLA 2GK3A 4TWAA 3SQOA 1FTYA 1SB8A 1ZOLA 2QV0A 3MD9A 3F6PA 2AE2A 5JPCA 5AESA 1T3HA 4CRXA 4Z8XA 3SAJA 2PKWA 2BGRA 2IQ5A 1YTUA 4D0SA 3FFXA 2EF0A 3ZXUB 4KDRA 2W6ID 3NG1A 4BAGA 3N7PD 4GEGA 4GX2A 5J4LA 4F0JA 1DCTA 2VR1A 4P98A 1TK8A 4V3CA 3DOUA 3C23A 4EG5A 2FPPB 5AKZA 1II8B 1VJRA 4LECA 2FUG1 1WHSA 2CYBA 5DYTA 5JJKA 3M8SA 3A4LA 3ICQB 1SUIA 2VSFA 3A10A 2AW3A 3ZWMA 4YREA 4DN6A 5CM9C 2VSNA 5KX5B 4NPCA 3AVUA 1BXRA 1THZA 1ZUIA 2FZVA 1PZHA 2OPBA 2ZI6A 4CMHA 3QU9A 1FP7A 3WWCA 4A0FA 4EGCB 4D92A 3PEEA 1Y5LA 2BAGA 1KFJB 3A3OA 4WZAE 2BR5A 3GXBA 4I5FA 4E2ZA 4PZ9A 1CVLA 1YSCA 3D3NA 3OAAD 4KWHA 1L5KA 2HCRA 2QTAA 4KPUA 3RM3A 3S29A 1CY6A 3H11B 5IF9A 2CL6X 2NVBA 2FPGB 5J4YA 3FTNA 4DNQA 4IDQA 2BM8A 2J0QA 2OWOA 3TTXA 3ORQA 4LIPD 5ED0A 4HLUA 1DBIA 1KEPA 1Q14A 2X9QA 4MRNA 3JR3A 1R6TA 3GFQA 3DTVD 1E3SA 4YWJA 4CU2A 3COVA 4JUAA 3HWX1 5DNYB 4GPEA 1F6WA 1JQAA 1WEHA 5CA0B 4N76A 2HAEA 1KQ3A 2ZW9A 3P4UA 5DQHA 1T29A 3B78A 7ICPA 1T3QA 2JANA 3IP1A 2KICA 2P5SA 4FR2A 1KL9A 2F3SA 2G0AA 5AW3A 1PZFA 4QQFA 2B8TA 2RHLA 4KMSA 2VDUE 3ENKA 4QXPA 4I3HA 3ELDA 3C5CA 3VJLA 1V5EA 1MNQA 1Y8CA 4O4IA 1PQPA 3BMQA 2AGOA 4DIKA 4GMDA 2RMKA 1TC2A 3EIQA 3TTWA 5C8VA 2GCPA 4MJ3A 2A4KA 2QT9A 4PIPA 1SKBA 3FTCA 3I4FA 3FR7A 3TN7A 2P67A 4WLVA 1ZJNA 2XNJA 1EFCA 5AI8A 2XE4A 1AUPA 1OAOC 1ZCJA 2ZS8A 3B2NA 1XCOA 2WWHA 3DT9A 3DVQX 1U49A 1PWYE 3LKDA 3FXAA 1BQEA 2NOAA 4WLOA 1YDWA 4TV8A 4IMPA 3GG2A 5E7IA 3WWPA 3T1TA 2XA9A 2HSEA 1B1CA 4JJ7A 2XUOA 3RIEA 1UH5A 1GPH1 1X86B 1H1TA 2QQEA 5BQXA 2E4UA 3K1AB 5JO0A 4E03A 4F46A 3BS7A 2O9JA 3CN7A 3PMNA 3HCRA 2IHYA 4H7HA 2G8NA 1NBEA 3AYXB 3HKEA 2FMIA 3HVUA 3ORHA 4JSTA 4X65B 4AY4A 5KB3A 3SYNA 4JWMA 2WHPB 4TYQA 5L53A 5JS1A 1ZP6A 3VDXA 1N6LA 1CY0A 1NXVA 3PSHA 4G8CA 4RCVA 3ZGXA 4H27A 4WLUA 2HI0A 1D2NA 1G18A 1ZIOA 4HP8A 1U0BB 3BXFA 1EFKA 4RLSA 4NU0A 5DDYA 5JU6A 2QRNA 1SBQA 3GWGA 2YJ5A 3W7AA 1P5HA 1Z73A 4NL4H 4M7RA 1I80A 4OFZA 2F8LA 3RRNA 1ADFA 1YRYE 2LM1A 2BKEA 1NNUA 3LDUA 2O06A 3QIVA 4XQ9A 3ZBQA 5LLTA 4H6PA 1E18A 5K0NA 2XMZA 5C32A 1U3DA 2WJVA 1P9OA 3GJ7A 1L4KA 4FCVA 3QHQA 4O63O 1Y37A 1E32A 4AW9A 2GJ4A 3JPYA 4HYQA 3GLUA 4RMHA 3OY2A 4ALJA 3SM3A 3RJGA 4IJKA 2B78A 5ALYA 1U04A 3LUBA 4FGSA 4G5HA 1S2NA 4JB8A 5EFOA 3CRXA 5CDTA 1DO2A 2AXEA 2X8WA 3D2CA 4WXEA 6NULA 3WWDA 1WMFA 5ICSA 2BFWA 2EEZA 1R4MA 2IPNA 2VL7A 2DFLA 4TSKA 3ORSA 3K9NA 4J1SA 2UXCB 2H4FA 1EFVB 4I2NA 3PE4A 3BFPA 2PYZA 1IL0A 1EUDA 2QL7A 4CQMB 1SAYA 1V11A 2VQFB 3NMUF 1QVZA 2VPTA 4KX5A 2Q6TA 4MWEA 5BMOA 3P52A 2JV3A 2L5YA 2MINA 4OSPA 5KKNB 1E3WB 1QAMA 2VF5X 4J9OA 2AOUA 1MDBA 1OGIA 3H2YA 5ESRA 3G9ZA 1KJZA 3LXUX 1R5BA 4BGUA 1P18A 4AJNA 4G0WA 4KJZA 1ES9A 3ONDA 3A9VA 1DOQA 4Q9IA 4F3CA 4AZVA 2PUJA 5DSTA 4DQLA 3A06A 3MAAC 4MINA 5J43A 2NZ2A 3EVGA 4UKDA 5AI6A 3VGPA 3GDXA 3JWPA 1DX9A 1Q17A 1Z0AA 2GN4A 2NZUG 2KOBA 4QDTA 1ZK2A 5JWRA 1USUA 3QVJA 3IEUA 3TLXA 4JXJA 1L2TA 4A9AA 3ORRA 2BCUA 7GPBA 1SOMA 4PHTA 1DJPA 2D1TA 1YZTA 5BWNA 2B5WA 4WK0B 4PO1A 1YFLA 3L0YA 4E07A 3IJPA 1FDSA 2ZSDA 4I1YA 5JZBA 1U0OC 5F98A 3TPCA 5IVPA 4UB4A 3NDIA 1LVUA 4HN2A 2Z2JA 1ZEMA 2F3NA 4ND1A 2PXHA 3ZHOA 4BLTA 5JT1A 1PUIA 1PTJA 4Y1EA 2OXOA 2JJQA 2I5HA 8ICVA 2FU5C 4RTJA 1P4GA 1O95C 2C3UA 2H8KA 3QVKA 4MAAA 5D84A 2HO5A 3DMYA 3SF0A 7ICKA 3MCWA 5CT4A 1DHRA 2GTPA 4IUCS 2G09A 2HPZA 3DPUA 3KHUA 2FPRA 1VLLA 5EIHA 5K0ZA 3ZHUA 4BCDA 3GRFA 4PICA 4EP1A 2J5KA 1LB1B 3OICA 3QKSA 4U4AA 4B47A 3I39X 3K5WA 4RA6B 3OPXA 5LD2C 2XF2A 3PX7A 3RNLA 2ZG6A 3D0KA 3NBXX 4M7WA 5FRDA 3T5PA 2ZT8A 4XUSA 2SBTA 2DSTA 5B4TA 3BRSA 5BV1A 1EGAA 4ZMBA 2BFDB 2B4KA 1I9GA 2JIRA 3B20A 3KS9A 4J0QA 1CFJA 4G8DA 5IFLA 1Y9AA 3NGDA 3PF9A 2ZUEA 5I9IA 3BIXA 4AI6A 5LOVA 2YV3A 2I4NA 1GPUA 1E6EA 1JF8A 4HFNA 1W0JD 4D99A 3CSUA 4ED0A 3D4LA 3OD1A 2DE0X 2GM5A 1NN3A 1G8GA 2WJ3A 4IJQA 4IV5A 4M9UA 3VR2A 3ZZMA 1V8PA 2E49A 1PTJC 1EP9A 1RLIA 1DKNA 1OYOA 1JA0A 1OOEA 3BILA 4HLNA 3RIGA 2WTNA 1ZQYA 4UAUA 2PM8A 3K5PA 3RK0A 4ENWA 1V97A 1MC8A 2I2BA 2B1JA 1F2UB 1JR4A 1OLSB 2R8OA 2VDMB 2W2PA 4RANA 4XXHA 5CIWA 3UMBA 2X4DA 2HD4A 4O3QA 3FVVA 5J8YC 3TIIA 4CR8A 1MABA 3TCXB 2IU3A 1I3KA 4UTXA 3OT5A 4BJ1A 3I0NA 1IRXA 2X8AA 2FPOA 4NS1A 4EA9A 4RQ8A 4DLUA 3H5LA 1UF9A 1A2BA 4LJ8A 1JSZA 1S7CA 3SXUA 1XLUA 2JLXA 4AP6A 1E2UA 1M6HA 3AILA 2HJWA 3KFLA 4PLCA 1XVAA 4N6NA 4RPZA 8ICZA 2ZXFA 4KE6A 4K46A 3SPXA 4TQRA 1DINA 4G23A 6CHYA 1OX5A 3I3OA 4IGAA 4A15A 3I28A 4F92B 1ZONA 3KJIA 4RGQA 3DM9B 3K6SB 4GIBA 2GOLA 1XWIA 3HCOA 3ZZNA 1A9PA 2CB9A 1PZXA 4PLFA 1V9LA 4NC9A 2OV2A 3EQZA 2B94A 4FLEA 1OZHA 3A4TA 2ZIAA 4X60A 3IDWA 3ZNOA 4ZAVA 3FNQA 3FI0A 4JHXA 4MGKR 2X0RA 2F1HA 2WKQA 1WB5A 3DYBA 2A7XA 2GNPA 3S1SA 1TA9A 2QM7A 3TCKA 4HATA 2PFNA 2X3YA 3GY0A 4N01A 4OXKA 4TMFA 3RRFA 2ZSEA 2W8LA 2XUHA 3N7AA 1QX4A 1UT6A 4JDUA 4O6VA 5HZMA 4TXMA 1U2ZA 3G0OA 2XI9A 2QZZA 3CHYA 4CBVA 4RFLA 4XVCA 2R6CA 3I37X 4ND6A 3MGBA 3EULA 4RF2A 5F3WB 4UCWA 2VQEB 2HTFA 2PMKA 1P2VA 4EO4A 5HMMA 1E9VA 5JH7A 1YDEA 3DTYA 5DBEX 1Y8QA 3FGPA 4RVHA 2XGGA 1GPWB 4GOMD 2Z83A 5IC4A 4RTMA 5JDIC 4DWVA 8GPBA 1FU8A 4S1TA 3SIRA 4YAUA 1ZRSA 2C2OA 3RS7A 4B46A 3EPJA 4D3FA 4LN1A 4OGFA 3HNRA 1D1QA 3KDPA 2LIVA 4RZHA 4RGVA 1SNYA 2FPPA 3E7XA 1AD2A 3U7QB 4YRDA 3L6RA 3HCFA 5LCXA 5TNXA 4B44A 2G4LA 3K0CC 4TM7A 4P7BA 5ECWA 4NDAA 1TKBA 1PR6A 2O7QA 2WM8A 5G4LA 5K3FB 4BX2A 5LMCA 3AF6A 2WYHA 5HR6A 4BL5A 5AUOB 1NVGA 1JZTA 3BRQA 1JA1A 4MR7B 1CSEE 4C03A 4C3OB 2I2DA 1X8JA 2EAMA 5I7SA 1YZGA 2MSWA 3A2NA 3RSHA 3N70A 4GX1A 2OFXA 1JDBC 4JC0A 4RS4A 3U7JA 2JA1A 3TGLA 4B45A 1L5YA 5AVJA 2NSDA 4DAOA 4E5MA 4ARCA 2VXCA 3O6VA 1Z0JA 1SHTX 2IK8A 3MC1A 3GB9A 4NZPA 5CYPA 2W42A 4G5RA 3V6KA 1UWLA 2ZTHA 5F12A 4DQXA 2CJWA 3I04M 3RNOA 4F7DA 4FZMA 2DFNA 4HD8A 1SKYB 1TCAA 2NU8A 4A92A 5I8PA 5DGXA 2PLWA 4ZANA 3LW7A 3CYMA 4GUAA 4EELA 3JPOA 4MRMB 4RHXA 3F67A 3BD8A 1ZK0A 2BCVA 4PCUA 4TTQA 5L9XA 4MTCA 4OM7A 1A97A 1VHDA 4Y2YA 1IM5A 3RC2A 4LJ7A 5JATA 2C0PA 3OTOB 1NY6A 1O54A 1FXWA 2DHRA 2IF2A 4JHLA 4LBYA 3RYHA 1AKEA 4Z1MD 5AW6A 1XLTC 1D7AA 3NHSA 4W6ZA 2GAJA 1JQKA 3BM5A 1GQRA 4KQ1A 3P9QA 1JLHA 3K0CA 2GCOA 4P5DA 2W2LA 3IB6A 1ISRA 3MT8A 4RSRA 5IMBA 3W6PA 7REQA 5BRJA 1LPPA 5IDXA 1Q1NA 5A4JA 4CKEA 4QUIA 4PYLA 2K4EA 2LKDA 4PFJA 5DBGA 5KFLA 1Z88A 3B9RA 1SWWA 2E87A 3W2TA 3WNBA 1EAYA 2I3ZA 3KSUA 1P44A 2ECQA 3HGQA 5KPDA 3N7UA 3UATA 3THYB 2BIFA 3LC1O 1GN9A 1UC5B 1VECA 3D8UA 2VZLA 3FNHA 5F2EA 4AMUA 4ECXA 4HB2A 3QE2A 4OFBA 3QI2A 3HBJA 4J0EA 2J07A 2KW5A 4HAVA 4ND8A 2JGAA 2QXTA 2BMJA 3IHKA 4FPXA 3AM5A 2FFAA 4U0JA 4YLGA 5MHTA 4TKUA 3MERA 3S8EA 2XWBF 4R2JA 2WKRA 3U3RA 1CETA 2ZCJA 4AKEA 2GXQA 3U9TA 4RPYA 2P3SA 2CXOA 4Z1OA 3D0QA 4U9UA 4Q4AB 2VUTA 4A8JC 1BE1A 2J09A 3AKZA 4RD3A 4D3YA 5CU7A 1F12A 2XNCA 4ENQA 3SAHA 1VGRA 1BHQ1 4YFYA 1Z7BA 4CYMA 3E5MA 2VA3A 4PSDA 2YJTD 5LYJF 1GL3A 4OL0A 2WLSA 3JPTA 2RP5A 3GUUA 3IDOA 3DL4A 4QX6A 5L1KA 2MTBA 1MB3A 2EFJA 2IW1A 2UV8A 3HVIA 2G1PA 2PGLA 3NOQA 1XMIA 4JEIA 2M0NA 4LXQA 4L22A 3SX0A 3O7MA 4J1NA 1YAHA 2PIAA 5FTMA 4QOIA 4BO6A 3E9CA 3KJXA 3TB6A 2CV0A 5LMNB 2VT2A 1P9RA 1HRKA 2XGSA 3GZJA 4QPPA 3CR3C 4F4CA 4C7OA 5F9LA 3R2JA 2QN3A 4IWXA 1TYDE 2I2XB 3EOZA 3PQ5A 3OAAA 5KSOA 4I81A 4I9NA 4J6FA 2XUFA 1TJNA 5EWJA 5CP8A 3II6X 4BFSA 3BQ1A 4C2TA 3L40A 4TPKA 5AW9A 3E53A 2VJ4A 4XZ3A 2J9FA 4LXIA 1SBZA 5ALKA 1U7XA 1UJ5A 1ZI8A 2WUGA 4ZO9A 5CFQA 2EGUA 2GBPA 1VHWA 2HU8A 3E22A 1RBYA 5EKDA 5FAXA 5LQRA 1CVIA 4IW3B 3LY7A 4MCHA 4BVAA 1F9EA 5DXJA 1TUBB 2YQEA 3D5QA 3HR4A 1GPMA 2DPMA 4GZ5A 1YL7A 2JHFA 4J0CA 4ZT3A 4FMCB 4UB8U 1YDGA 2A3RA 2GKSA 2WIBA 4LZJA 4OHUA 2VATA 1U0JA 1TJYA 4DPKA 3WKAA 4Z0TA 4PYJA 3DKKA 1ORRA 4Z3OA 4GE3A 2Q2QA 1THMA 3U37A 5IKEA 1M2KA 5KZMB 5J47A 3BS5A 5DLFA 1PW7A 2QD5A 1RWBA 4WHMA 4DLPA 2OHIA 5KQGA 4AKGA 4GI7A 1EXMA 5F2OA 3UV3A 3RU2A 4IIFA 5CBPA 3ROKA 3VXKA 1QRAA 2O59A 2GO1A 2IXBA 2YYAA 1KVQA 2CLEB 2XODA 1G5RA 2EJTA 3W4IA 2WJJA 2ZP1A 4EZEA 1HLPA 2X0IA 1YOVB 1UJCA 1XVIA 1GCIA 3NCHA 5JS6A 1WZEA 5FT9A 3BB3A 2UVWA 3KK0A 2N3ZA 1ODJA 1PFUA 1V5FA 3MA0A 1GAWA 3DHWC 3EK2A 4NBKA 1QHSA 3AZPA 2NXCA 3GR6A 1D8LA 3RV4A 2IC5A 4EBEA 4G0NA 1B0AA 2O7NA 1I9CA 2A14A 2Q4OA 2Z2IA 3MTAA 4P32A 4ENRA 1SCUA 2XTZA 4JXZA 3P5BA 4G85A 4HZUB 3GC6A 2BM1A 3A2MA 4MQFA 4ARAA 4WBNB 4Q44A 4LGMA 2BUAA 1JU4A 3ESDA 2C78A 2H9YA 2LI6A 1M1XB 3G5UA 3OX1A 4JLDA 1C30B 1CRXA 1LDNA 1XMJA 1RPNA 3ADOA 4CIWA 3WB0A 3CPSA 2ONZA 2HY7A 1P1KA 4NENA 2NUAB 4G41A 2G1AA 2Q62A 5JTIA 4B3RB 1CY1A 2BCSA 1ZM3A 3O1LA 5K8LA 1QFZA 1G0NA 1J56A 2W2VA 2ET6A 5AM3A 3EYAA 4L51A 4PG4A 5KJCA 4QNRA 1YRAA 3C4VA 1ZQSA 3UMYA 1HT3A 2J6TA 3MILA 1SD5A 3VGJA 1G38A 3HFSA 3QE9Y 4CLDA 2R00C 2QUBA 1FUIA 1GKUB 3KYCA 1UMBB 3N7SC 4E0DA 5A1TA 2I76A 3OLZA 1QOQB 3SVTA 1BO6A 3ZK7A 1I7DA 2P1ZA 1D0IA 3PW2A 2H2WA 1ZEJA 2OHGA 1EQAA 4M0UA 4HNHA 3QZ8A 5NULA 4RLHA 4C2AA 4KQFA 4GKVA 1LPMA 1Q0ZA 2OCXA 3IUJA 3VMFA 4EWLA 3N0VA 4I2EA 1WE2A 3FKQA 3WQRA 3CR7A 3V4VB 3V8VA 4AKHA 1B43A 4ECWA 2D06A 3LIIA 4NNJA 2G5HB 2P9ZA 4ECZA 4I1IA 3A11A 3WYDA 1SD2A 4LHZA 5D3MB 5IKOA 4CDGA 1ZD8A 3SZMA 3RC9A 5ERGB 2WP0A 4QBTA 3T41A 4AUEA 3SI8A 2IPMA 2YYZA 4GP9A 4WOCA 1ECCA 5DYNA 4V1CB 3IP3A 4NHEA 1RWWA 4J3JA 4C6RA 4YV0A 2A9OA 4OHZA 1NJ8A 4OO1J 3AB7A 1FYVA 1CCWA 3OF5A 5EXDA 4C9BA 2DL0A 2G70A 1Z8FA 1R0RE 5KJ6A 4XOIA 5EIBD 3WGIA 3LHSA 4UUQA 2PUAA 3VNQA 4BEWA 3UAWA 1XCMA 3IPXA 2BMFA 1YMUA 2YS7A 2C5BA 3R23A 1FPQA 1LJLA 1NI4B 2J30A 1LJUA 2AN1A 2VH2A 4FSDA 2BEJA 4TV9A 4BVLA 5DSZA 2CDBA 4CKYA 4GVXA 5KYYB 3BFKA 3QBJA 1U8XX 3KKNA 4FZ5A 1B0ZA 1MBZA 1JG2A 1SCDA 1QYIA 5BWLA 3A1FA 5I3CA 4OQ4A 5HPYB 4D79A 3TARA 2E3TA 1WCWA 1NQOA 4F3KA 3L8FA 3ACDA 2AF4C 1L4YA 4B4KA 1NFRA 3EAQA 4DEYA 4F8RA 1QIIA 3N8NA 5K4AA 1XQWA 1H2EA 2DPGA 2R7LA 2P4EA 3NWOA 4F2PA 5KX5F 4EI2A 2V5VA 1ORIA 2G0TA 4HDQB 4EJFA 5SICE 1ORHA 2IS2A 1PJRA 1DKPA 1XLVA 3EPPA 1Q6YA 5HHHA 4H1VA 4L8FA 3UA3A 3T1NA 2PQ0A 4PINA 3HUEA 4U2EA 3GIMA 4OXNA 3HWSA 3H2GA 2I9GA 5GVRA 2V4QA 3AQ4A 3GA0A 3G02A 4YFVA 4TURA 1I0ZA 1U02A 2ANBA 3ESCA 5GV8A 7YASA 2X3FA 4FYKA 4IJ6A 2DXIA 2LYHA 3NVYA 4F5PA 3ZWAA 2VHWA 2PQMA 1P1IA 4MW4A 2WB2A 3WP0A 5JD5A 3IIMA 4LY3A 2A0XA 2W37A 4BVHA 3B6JA 3E9YA 2R62A 3WB1A 4C6TB 1F2TB 4G3XA 4M1TA 2QJWA 3K15A 3OECA 2J31A 4NOLA 1NVKA 2E82A 3TXYA 3WNVA 4CKBB 4KLAA 4DQKA 4KR6A 2FSHA 2ZAIA 3OFNA 1BRTA 4L5IA 4ECEA 2OQRA 5ENVA 4B2LA 3LHKA 4PZLA 1WXFA 4U9HS 3LVQE 1TIPA 4MWBA 3IR7A 5KG0A 1BEUB 1G20B 2DQ4A 4PZPA 2R85A 2FPKA 3ZGNA 5J0YA 3KTDA 5LB2A 2PWAA 4M9CA 1SXGA 4AQYB 5K03A 5KFXA 2NU8B 5K0JA 5IM4A 3UWOA 2C4NA 4B9AA 4S05A 3K0KA 2GLUA 2L69A 2ZT7A 1XTUA 1G291 1JB9A 2JLBA 1NT4A 3EEBA 2R4TA 3IPYA 4P83A 1GG8A 1Y9EA 2KQUA 4KQWA 1E7QA 4LSZA 3TG8A 5GJVC 4IJVA 4PAOA 3P4YA 2CXHA 3NO4A 3IM1A 4IIJF 1DPGA 2HNAA 4UPVA 1YA6A 1I5EA 2VPXA 3R0QA 4MMYB 3NNDA 2QN7A 2H5IA 2PRYA 5SY4A 3V7WA 4DLGA 3FBWA 3KD2A 3RJTA 5T7BA 4M6WB 2BCRA 2BPGA 4PNPA 1GZ5A 3RYFA 3U49A 4HAXA 3P27A 5DLEA 1QGOA 1OHHD 3OWXA 1YRBA 5DN6A 2W0SA 3M6KA 1RQRA 2KX7A 1SOVA 1MQ9A 2OZVA 2QZPA 4TQGA 4EG6A 1SV0C 3BB4A 3DCJA 4KGZA 1N2IA 2AQHA 2B30A 1TK2A 2A1TS 1J8FA 2P6PA 3K0HA 1Z4PX 1T8EA 1CQWA 1I7LA 2ZZMA 3PUKA 4X63A 2F48A 5LB4A 3IMKA 1WUYA 2OHHA 3H1FA 4BQOA 3F53A 1ZIYA 4Q00A 3LYLA 4NX2A 1HDIA 4TLAA 5AMXA 1PV4A 1YK1A 9MHTA 4LX0A 2A67A 3ICWA 1QAQA 3V7UA 1M8JA 3I09A 1WUTA 4B7XA 4C8NA 2CLLB 4KLJA 1RM0A 2V3VA 3OPNA 3WMWA 4KWIA 2DWQA 4AMBA 1TM5E 2XY6A 4N7JA 5CGQB 1PYDA 1WQ1R 2CUKA 3I53A 4HVAA 3KLPX 2H1VA 5J9FA 1KQFA 4BOYA 2NPIA 4W1SA 3UXNA 2HLPA 2IF0A 1KHTA 4KFSA 5JISA 5DT2A 1NQAO 2NU6A 4LKOA 3LBFA 1GHTA 4M76B 4J3FA 1TJPB 4YCCA 2IJGX 2ZDHA 5L4NA 1HZJA 2KMLA 3Q5EA 3HB0A 3AFIA 4QVIA 3GT0A 1Q0TA 2I6QA 3AVOA 3OVMA 3JATA 1E9CA 3PQ7A 1DRJA 5EYPB 2AG0A 3D7NA 3GLGA 4HL6A 2NO4A 1Q7BA 2VRCA 3PR2B 3HJGA 1PAUA 1YJ8A 1N0WA 3WICA 1GPNA 4C0XA 3UAZA 5ICCA 2OR3A 2IEZA 3A32A 1ZUHA 1WO8A 3GJRA 4OI2A 5ENZA 4RJ2A 3F6SA 1I7SB 3VC2A 1WMEA 3BMCB 1ED1A 2JFBA 2GHIA 1GDHA 3CT6A 1P1JA 5JNLA 1T9KA 3THWA 2D1YA 1DADA 2VN8A 1KAOA 4ZXPA 4EF6A 1GPBA 2YIVX 3T61A 4BP9A 3L7LA 4HJRA 1TRKA 1AGNA 4J9VA 5DV9A 5AQ1A 5KTPA 3IAM1 4C20A 3B12A 3C2LA 3N2YA 1XRSB 5EHQA 2P4UA 1YBMA 3FYUB 4QUBA 4WZBB 1Z37A 2UZ3A 2VSQA 3KWJA 1BH6A 1FSFA 3CO5A 3KNZA 5AUQA 1EINA 4ZV9A 4C0LA 1IG0A 4EARA 5KVQA 1J90A 1E1DA 2NYRA 2R7NA 2JAOA 3BGVA 4TUSA 2QGNA 3UH0A 1LKYA 4Q66C 3I9NA 4R2XA 3WZMA 3CNLA 1V7QA 2DCUA 5CYFA 4YAJA 2W5UA 5DN6D 3QPAA 2PFOA 3CEMA 1V45E 3DV2A 3O7WA 2C1EA 1N25A 4ENUA 1IVYA 4LA4A 1VP9A 1ZQBA 2PGOA 3V80A 1YR2A 2NYVA 5EXPA 2MWMA 1H65A 1SIOA 4S1PA 5CRIA 2XUGA 3GRAA 4X97A 2FCAA 4OJPA 4MWTA 1LFDB 4U6SA 4UDYX 1XI2A 4NYJR 5CH5A 1OBHA 1GUAA 1Q19A 1E79D 1LA2A 3R5HA 2NN3C 4NVRA 3TNLA 4YCLA 2W55A 3GHYA 1OF1A 3IG5A 5J2TF 1JE1A 3ZY2A 5BOMA 4UHEA 4ER6A 2CCKA 4LJRA 4F04A 3ABSB 5J0PA 1IUOA 2VTDA 4MSUA 4P8RA 4PRLA 3HBNA 1X1DA 2F64A 3TMAA 3L8MA 2OFWA 4JLSA 1FP6A 4S3MA 5FTNA 1N2HA 3DGEC 4DMLA 3BS5B 3VZRA 5I7HA 1LV7A 1Y6QA 4GRDA 2GF2A 2J6CA 3PFCA 1QIJA 4Q4JA 4REOA 4PAGA 2IYPA 4NTZA 2DGDA 4A3SA 5HW0A 2VJAA 1G4HA 2EFYA 3FVWA 3DLPX 4C89A 5HE9A 3N7RC 2R1UA 3F5FA 3EHEA 4Z7NB 1MC5A 4AZ3A 5K4GA 1RQ2A 1Y4DE 2ZK7A 1A6SA 1GNQA 1M0WA 3K6RA 3AM3A 3RAEC 4YA6A 5BSVA 3FKSD 5JHHB 3E7FA 4Z4IA 1EZ4A 3RJMA 1S0MA 4PO8A 1W2WB 3PJEA 3BXPA 1UPCA 1RKQA 1U9ZA 5LUBA 1ZNXA 4HFRA 2BM9A 1NNEA 3K1RB 1S0OA 4CLHA 1UBGA 2ZVQX 1AUQA 3N05A 4Q43A 1KZ4A 4M8KA 1UXOA 4R2WA 4EDFA 5HR5A 3PSTA 4RY8A 4RWZA 2J67A 5FUVA 4EENA 4FFMA 4HAZA 4W1QA 4DTIA 2PGXA 3H6HA 4HWTA 2N1RA 3JZIA 4U5XA 3RTDA 5H9WA 2ZIVA 3Q2IA 4RY9A 3RC3A 1K08A 5BWOA 1J5XA 1IHYA 2OCYC 4N6GA 4RD0A 4B9MA 2XPCA 3L0BA 1O9HA 4YB8A 2WHYA 2ZQ5A 4E1BA 2HBKA 4D3DA 4KHPB 3VAZA 2H92A 4BEVA 1C80A 1Y5IA 2D4AA 4C14A 5DQIA 4OU5A 3JQ7B 2W03A 4BU0A 1N3BA 4DCCA 1CJMA 1FUKA 1YO6A 2WAYA 1B7GO 3KLBA 4NV1A 3IKVA 1ULBA 5MF6A 1XN4A 5EGSA 4RO0A 4HPJB 4Q21A 4IMJB 1QLJA 1X9XA 1WNTA 3BFXA 2VI5A 4LSGA 4YALA 5KFIA 2HLDA 3V7FA 4POAA 4PZOA 4R40A 1SXHA 1KGDA 4F8EA 1GCUA 2BUBA 1YBAA 3DMTA 3OQVA 4EB6A 3D59A 3AESA 1QIKA 5TSDA 1FX0B 2OB2A 4PPNA 2FEAA 2HKIA 3IKJA 2Q2OA 4E33A 4LE0A 4JWTA 4N18A 4H3SA 3VPDA 4DQIA 3WHKA 3PNQA 4BKUA 3IAS1 3JYPA 1CS0B 4IYJA 1X7ZA 3COJA 1NV9A 4UD2A 4HEJA 3AL0B 3KUKA 2JLSA 3IP7A 2ACVA 2WI8A 3NYIA 3MAJA 4BQSA 5EMKA 4EY6A 4R0MA 1O94D 5ETJA 5LQUA 1I2MA 2Z9DA 1DXQA 3KP1A 4U39A 3IEKA 4DS4A 4KLTA 3FCAA 2M6KA 1K97A 2C9BA 2ESRA 1AF4A 2QB0A 1QOPB 1YL5A 4LHXA 5DISB 1G20E 5LA6B 3UWSA 3VPXA 2XXBA 3UAVA 1R0SA 5EJGA 1ISPA 2YFHA 4WW0A 4CMIB 1PE0A 1YVEI 3HWTA 5JXGA 1EESA 1X39A 4EZ9A 1AKWA 3JVUA 3FB4A 1SR8A 1SXJA 2DJ5A 2BMWA 2HIGA 3PKJA 3RKSA 4A1OA 3KZCA 5BV7A 3CLSC 4B83A 3ANYB 1H8HA 5ADVA 3I6YA 2OVFA 3HP1A 1MIHA 7ICEA 4URVR 4Q4CA 1PS9A 3FPCA 2HWYA 2ZQZA 4WZAB 2ICAA 2UYCA 1NI5A 4NCAA 1QDUA 3KOZA 3T5CA 4YCJA 1GG9A 1K88A 2RGGA 2HMVA 1WTCA 2O2SA 4KQ9A 3KZKA 4WFKA 1WHSB 3AF3A 4HDSB 4WH0A 4GU5A 2CNOA 1ZIDA 3S7TA 9GPBA 1S3IA 1JDVA 4UASA 1NX6A 4DSLA 1EH5A 1BPBA 4ZVRA 5I01A 5LKAA 3IT1A 1DAMA 1ZWLA 4C6TA 3F6RA 4GSYA 3H0MB 1W8DA 5KFHA 2BEKA 2PX4A 2XDQA 2XCAA 4FOLA 4IHAA 1XHFA 1P77A 3GQCA 2CBGA 2I99A 4J49A 2ECOA 1YJ5A 2BH9A 3QOWA 1NC1A 1T9DA 2KVCA 4LV5B 1YF3A 4K9OA 3T3MB 3MBYA 1XTQA 2GJSA 5GWXA 1NPDA 1AGPA 4HWSA 1ESCA 4UJ3A 1S0NA 2YWFA 3GLHA 4RKFA 5EEHA 4MW0A 5E79U 2FW8A 2HF7A 5DG9A 2P79A 3D4IA 3TIXB 5C52B 4ZI7B 5HCUA 4C30A 1O4WA 2VANA 2C0CA 1TLTA 3LOPA 2D2XA 2BMVA 5EE0A 3FOBA 1NONA 4AYBC 2V03A 121PA 3BIOA 1KI8A 1R15A 2REOA 4P81A 4EGQA 2FUKA 3O8LA 3PFNA 2EGGA 2RLTA 4B1FA 4FBUA 4CFYA 4HQFA 1CBUA 4MQMA 3V4ZA 1QGDA 4HWPA 4RKYA 3W5AA 3A9WA 3ULKA 3SBOA 1HI9A 3FVQA 4R05A 3MWLA 1VE7A 1I4WA 3B5EA 4EI8A 4LJ9A 1UXIA 5FUMA 4ZTZB 3RSZA 4C0BA 3HU5A 2R6HA 1C4WA 4MA0A 4TRNA 2XOKA 3DMRA 4RORA 2Z9CA 2IHTA 4NYJQ 2BEUB 1X1CA 2RI1A 4QLAA 4F4DA 1Z45A 1WCIA 2KIWA 3M1LA 1N77A 2ZIXB 1A9QA 2J7PD 2UUOA 3DBIA 4N7BA 1YZLA 5FWNA 2F3UA 5FR1A 1WX1A 2IXEA 3FCSB 2BPFA 3RYFB 5CEHA 3QE3A 4E5DA 4PPQA 2VA9A 2FP3A 5CLQA 1QDEA 5B1DA 3CUWA 4ENVA 1UBLS 3NEJA 3DDCA 2JFWA 4HBZA 1WM1A 4HTFB 4RPHA 1XQ1A 2DBVO 1DUSA 2Y9MB 2NO1A 5JNUA 3IE1A 2WU4A 4XVUA 5KFJA 4B8ZA 2HU2A 3NT5A 1XZJA 5A3VA 9ABPA 5B57C 4EJ2A 4L0CA 4TWRA 1R8QA 1Q0RA 2EWWA 2GLTA 2R6DA 3GEMA 5B66U 3F2VA 3HI6A 1NXOA 2RGEA 1NJXA 2E5WA 3Q11A 2B69A 4NG5A 3O0FA 4NEHB 4Y6OA 5GTIU 3R5SA 1MHTA 2WV7A 4MITA 4TV8B 3Q9LA 1E4YA 4UZFA 1FS6A 3BCSA 3CO0S 3E9EA 3HU2A 4M04A 3WQQA 4A5SA 3AR4A 3R09A 4KSBA 3INRA 2ALZA 5ALOA 3I9MA 4DMMA 4E7OA 2G0NA 4C43A 5JQGB 4QM7A 3HKEB 3CVUA 4OCZA 4EBCA 1MMFB 4LWZA 4I29A 4JBNA 3X44A 4LTMA 1G8AA 1E4EA 3JQGA 1J0BA 1JEAA 1ESEA 1O7JA 2DC1A 3BMOA 3RLIA 2GEFA 4L95C 3T1QA 5KVCA 4TRJA 3F78A 4S1WA 1E2IA 3O91A 5B6IA 4RS3A 4R8UA 1KFSA 1LY1A 2V4UA 1L5WA 4HDKB 1XK7A 5DHTA 1KZHA 3L01A 4GQBA 1UT5A 4Z0HO 5A4DA 4MLPA 3T5AA 3PR5B 4DWWA 1D2EA 4Q03A 3LA6A 4C2UA 1REQB 9ICSA 5HSGA 1WQ4A 4BLQA 5LP6A 5ALGA 2I1VB 1WXWA 2QARA 1FLNA 2QX9A 1GUFA 2XHZA 4JLKA 4WZBA 3HU1A 1DQZA 4PQGA 5A7HA 4PPYA 3DNFA 3CKMA 2AHOA 4MW5A 1RABA 1M67A 1RWOA 1FE8A 2AK2A 4DSTA 4ZREA 5A5EA 2VS1A 3DQQA 2QW0X 1Z00A 4G5SA 4NMWA 5I5EA 4EPTA 2CN1A 1SEVA 4UM9D 3KYBA 5KFDA 5EP3A 4CUJA 1T8SA 2ZXHA 3O92A 3RU3A 4IQ0A 3ZWNA 4FOSA 4M0KA 4N3NA 4L4YA 3ROGA 2I6SA 2ZAGA 4CL0A 4LG1A 4ZOLB 3ICCA 3ZHYA 3HLYA 5HX7A 3RIYA 4BNDB 5JDCA 1IYZA 3IBCA 2B25A 3H99A 4ND5A 3LY5A 3R41A 3T7JA 1NW4A 4DJEC 1PL0A 1HEYA 2VP0A 5CVJA 3E3LA 3FCYA 4XGRA 5ARCA 3T9CA 1H23A 1MKYA 3FWZA 1ENZA 1KS9A 4Q9KA 5IC6A 4KRFA 4I2HA 4K9RA 4NCNA 4R31A 1AXGA 2LM4A 4X45A 2ZUTA 2C8VA 5JAHA 1FK8A 3PX3A 1OI2A 2PWZA 4QOFA 4TMWA 4KNYA 2JH1A 1JAHA 1W2HA 1KIMA 1E2NA 2H17A 3HVRA 1R12A 3Q8SB 2GA9A 2H00A 4FVTA 4X54A 1EHCA 2YINC 2B7LA 3A8TA 3BORA 1PJ4A 1RKXA 2Z4SA 3CF0A 3Q87B 1VJCA 4NSNA 1FYXA 4RUKA 2ORIA 4PGFA 1KEEA 4ZT5A 1KR2A 1MC4A 1TK3A 3JQFA 4K9QA 4RA6A 4QIWC 4MVJI 1NQUA 2PU5A 4BGIA 1YZNA 2Y0EA 5FH9A 3AHEA 1V41E 4RTRA 3MOIA 2VNHA 3NIGB 1VZ2A 3T5GA 1J99A 4W8GA 1VI2A 2I6FA 2KWIA 3KL2A 1S96A 2OBYA 1NVTA 3MWDB 3ZPXA 2WKWA 3RWBA 4B4WA 5JECA 4AZTA 4NHOA 1CRWG 2P9BA 4FFRA 4XJXA 5EPOA 5ITVA 3CR8A 2OCPA 2ZU6A 2EYUA 2P2GA 3FOZA 1VSVA 4QPJC 1U2TA 3UICA 3EIWA 3K1TA 3U16A 1G2QA 3H8MA 4COKA 1W5EA 2VBGA 2RONA 3KTFA 3K3PA 3LPCA 1O6BA 1Z35A 2FOLA 2OWEA 2PMWB 4HDMA 1DEKA 4CCYB 1F2UA 2XNHA 2DPLA 2UZ1B 2FQWA 3ABIA 1OPXA 2PR7A 3CGGA 3RFXA 5FFNA 2XR1A 3CIOA 2WJ6A 4UEJA 4WKOA 3CVOA 3B1WA 2NQ2C 5CFOA 2AJLI 3PGMA 3EVTA 5KVSA 2ZUVA 4W5OA 3GP8A 1JTVA 2CSUA 3BJZA 3GFVA 4PBTA 1CRLA 4WE3A 3ZGYA 5JWOA 1JR6A 1F2DA 4YN3A 3WBBA 1HE2A 1ONSA 5BR1A 1IXRC 4ESEA 2DZDA 1UDCA 5KNCD 2K4IA 3O26A 3U3KA 4EG7A 4MFAA 1C7YA 3LDHA 1J9ZA 3DP9A 1IXSB 1Y34E 4WXPA 3BWEA 2CK3D 3T3PB 4YJGA 2VTBA 4JXXA 1Z6QA 2VUIB 4CM4A 5LXTB 4B80A 3UJ3X 1BXKA 1JV2B 5DNVA 3OT1B 3QFFA 4V2UA 3UNXA 4ZVTA 4QYIA 1NZJA 5DM2A 4UW9A 2GDZA 4JOSA 1WMBA 1WUIS 3H2ZA 3HEBA 4RKQA 2BJVA 1XRRA 1U2DC 4YCBA 1FUEA 1TYAE 1HKHA 2ZVJA 3A9SA 3ILXA 4POOA 4C2BA 4X24A 3PR1A 3M8KA 1XU4A 4FFPA 4OSOA 1BW9A 4DLVA 3OM0A 3COYA 1DFIA 1P7YA 3WLQA 2LW7A 2R7MA 5T6BA 2FRDC 3B9JA 4IGIA 5E4YA 4J0GA 3QW2A 4R66A 1P2DA 2EAPA 2ERXA 2PBFA 1POXA 1GA6A 2HREA 3KB1A 3M5PA 5DO9A 3J81A 3GEDA 4MFCA 4L6IA 1WEKA 5C5EA 4P3KA 2BEVB 3T1YB 4KQIA 4UTOA 3AW8A 4PRKA 4YLEA 2ZRBA 5DI9A 5L3SB 4U2FA 3O8OA 2I7XA 1AA6A 2OCBA 3QHPA 4TTJA 1WSWA 3HJUA 1HNXB 3VR5H 4PPXA 1JN0A 2X0EA 1N4DA 3TDKA 5IH7A 2IOQA 1UFVA 1ATIA 4MVJD 1BMQA 3B3AA 4CM8B 1A9XA 3T3OA 3B3FA 3UTCA 1CIJA 3QXHA 2HA2A 1NNSA 3H0CA 5FPYA 2QD3A 2ZBGA 2V7XA 2VNKA 4BNHA 1PR9A 3J7TA 3O82A 1D4ZA 3ICEA 1XVLA 2VCHA 2DAPA 4QUGA 2K60A 5JH7B 1W5FA 3LOUA 1OH5A 4J4TA 1BKDR 4IWYA 4IF4A 4D9KA 3IBSA 3TANA 1IZYA 2HRCA 2QE7D 3GN2A 3OEEA 2A94A 3OG9A 2EIXA 5J5AA 5SYMA 4C08A 4AJEA 5CD9A 3GLHB 4B9NA 2P2DA 4JS0A 4AULA 1NR1A 3L77A 3AEKA 3MHPA 4WIAA 3P9KA 3K0EA 4IXTA 1E8DA 4H0NA 4MHTA 1FMJA 4UBJA 1GSIA 5A0TA 5TF4A 3WK9A 1NE2A 5DYWA 3MAGA 521PA 1RRCA 1ZPDA 3IULA 3NT4A 6AT1A 4PHHA 1ZQEA 1OWPA 1PG5A 1WW3A 4PLGA 3T9BA 3E9QA 5AICA 4BFTA 3L4PA 3KHRA 1OROA 5JZSA 1BCSA 4AJ1A 1A69A 1GTG1 3JALB 3L7KA 1YZUA 3S2IA 5A2GA 2WIAA 3LX6A 3BMNA 1GTZA 2R4QA 3IYLW 4JUBA 4Z7QB 5C1OA 1J6UA 2ZIWB 1SCIA 1L4NA 2CMDA 1XQXA 1Y89A 2VQ6A 2QX6A 3DBVO 4PCLA 2CDNA 3VU0A 1SVOA 3BXHA 1NTRA 4QBHA 5C51B 1LNSA 3HN6A 1WBJB 1ZQPA 1L5QA 2XH8A 4IDGA 4UOZA 1UR5A 1CU1A 2D5BA 5F51A 3DOIA 1MX1A 3F6CA 1B15A 1V3QE 1ZKDA 1P3JA 3H2HA 3IIEA 3STWA 3W2IA 1Y1QA 4QXAA 8ICOA 1GRQA 2RH8A 5KBYA 1T5HX 2WTFA 1YE8A 1LS1A 1S97A 4NLKA 2GCOB 4X8HA 2XOXA 4ZAYA 3DTVA 1N32B 1Z0FA 3PTLA 4Q7JB 2LHTA 2R5WA 2R6GA 5J3JA 1GQ2A 3ADKA 2DETA 2GXSA 5TQ2A 1Q7TA 4XIYA 3DTTA 2HX1A 3SVLA 3QX9A 2O1XA 1LBQA 1Y9JA 1JI0A 3DDUA 1KY3A 1V16B 2W6QA 3L1IA 3DA8A 2ZIXA 2XIJA 1D2HA 3HACA 4HDAA 4LDPA 3WP1B 3U1BA 2XCSB 2C2MA 3AMVA 2ZYIA 2LMRA 1C41A 1EZ1A 1NK8A 2HT6A 4IKOA 4N82A 4O1IA 4XJTA 1BFUA 2WFZA 3AM4A 2KFZA 1I14A 1CDEA 1MGOA 1RLUA 5DWQA 3ZE9A 5U4QA 3S2SA 7REQB 1VKHA 4FC6A 2G9NA 1XZGA 3T5DA 3KPYA 4BQEA 4MKIA 5CCDA 4GAEA 5GP1A 4BN5A 3AZQA 2AKEA 3ZKWA 1NJYA 1PWHA 3FTFA 2CMFA 3GJSA 2FWRA 3EPKA 4J07A 1P6XA 1UJBA 2Z2XA 1MJGA 4BV3A 2VWQA 4YXFA 1Z5GA 4INJA 1ZQQA 2G7MC 4E21A 1YR9A 1EAMA 4PYIA 1CNMA 3TE7A 2WJIA 2Y9UA 3DVAB 3I1JA 4LOHA 3ZU3A 2ZANA 1T4CA 1K9VF 3I9LA 5CW1A 3Q6IA 1WKCA 5DASA 2HSWA 3H4TA 1E1YA 3Q9NA 3QFSA 4O1HA 3T34A 1Q77A 1KARA 1AS2A 4WT7A 4MVJM 3L18A 3FJ1A 9ICLA 4QXOA 1HG0A 4WCFC 3MT9A 2H63A 3P94A 4FMBB 3RG8A 4AKSA 7MDHA 4JLWA 5JQGA 3IEXA 1ZOOA 4KHZA 4ZOQI 1BS9A 5G40A 3NBYC 4CQNA 1NBMA 3EC7A 2UUCB 3W79A 2Q3FA 2ERCA 3GV7B 5ULLA 2ZR8A 3SYLA 2J0VA 4H6WA 2AB0A 1JKJA 1JPUA 2RGUA 2BONA 3DMGA 3NVMB 1D0VA 4KNVA 4RTPA 1TVMA 3FSGD 4LYHA 2G6TA 1Z7YA 3KZXA 2C1XA 2QG9A 4I2DA 1Q3UA 1E1RA 2QZ4A 3NBQA 4DDKA 1B3RA 3L0PA 2AHOB 4AY6A 4BE9A 4BY9E 3RHZA 4JI8B 2X5JO 1HX7A 1GP2A 2QQ5A 5C4MA 3TLMA 1KTIA 5HM6A 1MAUA 3QJ5A 2KG5A 1VCHA 2R96A 2W71A 2XKBA 4I8XA 5E3JA 4ZHQB 3SAFA 2OO5C 4IDEA 5AFSA 3CW8X 2FGJA 5JCXA 2C2RA 1IXYA 3GEEA 3DQPA 5KFEA 5DE3A 2ZE6A 4YRPA 2AMLA 4R2MA 2ZTDA 3RS2A 5EWFA 3ADCA 1RG6A 1XJQA 3MJDA 3ZE8A 1WCNA 3BQTA 3E82A 4HEHA 2QTVB 3QKRB 3S44A 2RHMA 1L1QA 2V4MA 5EJ4A 3IPAA 1MRNA 4J4BA 4WZBE 4ZICA 1BSVA 1A4RA 4YR3A 3BFVA 1TA4A 2XY4A 4ME6A 5D6OA 3GW8A 2E4ZA 2HZ7A 4US2R 3JS5A 5J0OA 3WWYA 4BDTA 4G01B 1KJYA 2O1EA 3H8VA 1KMNA 4GSLA 4PZEA 1V47A 1EWTA 2XQVA 4NMLA 8ICIA 2HO4A 4Q9JA 4YRMA 2AJQA 2CVHA 4X3OA 1EDZA 2V9WA 1J7JA 4DIMA 1U0LA 4P53A 1XC7A 2QLTA 1DWPA 2L17A 5EUQB 3H1BA 4P86A 3UOWA 3ISVA 3WK5A 3S2FA 3EVDA 2P9QA 2VHZA 2J5BA 4ZO8A 4FB4A 4RTNA 1NRJB 3C5GA 1LZLA 3PVCA 3CKLA 5KDDA 3ZHXA 1NVUQ 2RAUA 2AR7A 1ONNA 4IXDA 2YV5A 1U2DA 3BS4A 1DC5A 1WZNA 1I2BA 1CJSA 1HEUA 1LF0A 1SD1A 4Z6CA 3CP8A 2X9GA 3BD6A 3PR3A 2JIBA 5EWMB 5TJHA 4F2HA 1JSCA 4U7HA 2IS1A 1TJ4A 1AQIA 5GINE 3T0IA 5DRYA 2NW6A 1I3NA 4K0KB 1DBWA 3ILYA 4MRMA 3FGOA 3AU6A 1BOOA 3PDIA 1BYUA 4YRCA 3AMZA 3MGVA 2DHDA 2JH3A 4NZOA 4QGBA 5KYXB 4LF7B 4MUGA 3BH7A 5DIZA 4RQ4A 3OOWA 3UA4A 1PJAA 2GUWA 2RGNA 1V1JA 1PIWA 3PIIA 3Q3GE 5T67A 4ED9A 2ZTUA 4I4TB 2G72A 1X2EA 3HLTA 4Y0AA 1C9JA 2WM3A 3K8ZA 2OXIA 1BD4A 2FFQA 1XCJA 1WTAA 2I54A 3WIEA 1MTZA 4NBUA 1XZLA 2HB6A 5EP2A 4D81A 3I1YA 4TXHA 1VXRA 3CMCO 3ET4A 4IZ6A 3PJFA 2FVXA 2A1TR 1R74A 2EERA 1X80B 3GUHA 2CWWA 3OT1A 3A7DA 4G2NA 5JCPA 4XOUA 5AK6A 1VDMA 2X8JA 3R7BA 1NVBA 2B4QA 4NOJA 3U7GA 2QBYA 1L5GB 4CM9A 2JH7A 3B3GA 3TZLA 2JCVA 1CJTC 4JWKA 2ZKLA 3HP4A 5AHXA 2IE8A 3MD0A 2V1XA 3PBKA 4L3WA 4TMTA 5K3CA 3C70A 4ZAWA 3M9NB 4RTLA 1KEUA 1M7BA 3HU3A 3HYLA 4KLMA 4TKVA 4YJHB 2W2TA 1U4NA 1WNFA 4DEXA 3BT7A 1QZ3A 2P9CA 4WCVA 1ZH8A 4YDQA 3KSDO 4CT5A 1TDJA 3W90A 5JJCA 2QF7A 3ESBA 3E05A 4MJXA 3WMGA 3WYNA 4LTDA 5M29A 2VYQA 4LGCA 5AOVA 3T3NA 2YN0A 2HQRA 3QOYA 4Z86A 4YRAA 1S0VA 2AR0A 1X9WA 1HWYA 3DFUA 4KN5A 2PI4A 2GN2A 1YA4A 3OCYA 4D97A 1OI4A 5MN4A 1COZA 3HFRA 3JSXA 1KETA 2XCOA 2PKEA 1VKZA 4R6XA 3RSLA 4A5OA 4ZGWA 4P4NA 3ZG6A 3OZRA 3HPQA 1QVRA 3I2GA 4BNLA 2XGQA 1WMDA 1W4LA 5TB5A 4BNWA 4DV7B 5FNVA 3AEXA 2EFGA 2QRJA 2YY5A 1X38A 2RHCA 2WM2A 2J08A 3D4PA 1DDOA 1XF9A 4F6CA 4K9SA 1ZD4A 5LZ9A 3LUHA 2G7ZA 4AJPA 1WA5A 1IK4A 4MV8A 4P4MA 1UFKA 2XE6A 5L7YA 4PZZA 1E2BA 3ICPA 1RJGA 3OPMA 1X92A 3W9YA 3ROMA 2B2CA 3CB2A 3W1EA 5L3VA 4Q7KA 1DXOA 2B5OA 4LJYA 4EG1A 3HY3A 3RWMB 1C8BA 3UKOA 1HYQA 3Q7SA 3L0ZA 4QGSA 4REMA 2ZYUX 3P9RA 3U9SA 2XCRB 2DG2A 2ECPA 4XCQA 5JC8A 1NRIA 1JHAA 3QKUA 2ON6A 1XB2A 3BZKA 2FF7A 3D5TA 2WD7B 3JAKA 4QJFB 1SXJE 3I1IA 4RQ6A 2FW7A 4RXUA 4TV9F 5J1SB 2AG6A 3IX7A 2WK1A 2AOWA 3P20A 3K20A 3UOGA 4D4JA 1CK4A 2BY4A 2WWWA 3A3KA 4HR7A 3JPRA 4OJLA 4URHA 1O5OA 2PKCA 1ONPA 3I2IA 3H1GA 3LGAA 1PUXA 3LQ2A 1Z7EA 5B7GA 5A05A 1P72A 2O2EA 1TD1A 2OO7A 2X86A 3QVTA 2F2TA 2GMWA 4JT8A 1NASA 5LMZA 3V55A 4BX8A 5K45A 3HMKA 1H93A 4UREA 2AH5A 2HL6A 4JP3A 2GWSA 4UQLA 3HADA 4HNVA 1ZW1A 3PNLA 4DJDC 4U7TB 3K8OE 5BVHA 1I6WA 3GEGA 5KHLB 1SGGA 4MB6A 2W2OA 4F5QA 5JVDF 3KEGA 2C00A 3TRFA 2JLQA 2XCLA 3NCTA 3M81A 2C2EA 2QLNA 4DBLC 5BN5B 3DB1A 1XU9A 3IE2A 3OA2A 5CAEB 3D3QA 1ZO8A 3L79A 1UDAA 4QWDA 1CZOA 3W77A 4RVCA 1BKSB 4WCFA 1Y8AA 5GTHU 2XIDA 1DNPA 3SV4A 5DKFA 3A6LA 1W49A 2DPIA 3PK0A 3SU8A 2DWPA 1S3GA 5ALWA 4LHYA 1ZQRA 3AG5A 3CSSA 4D43A 3N74A 5KAFU 1V16A 2CXNA 3ZVMA 3ZLJA 4EW2A 3SI7A 1VIYA 4M0PA 2MU2A 2XMSA 3W78A 2VNJA 4NU6A 1H94A 1TL7C 1X1TA 4N48A 2NMVA 3L1JA 3A27A 5KOJA 5CNMA 1EBUA 4F3RA 4O4JB 4B0PA 4RAQA 5EIFA 4DCPA 2HHAA 4BZQA 2B1QA 2QLFA 1X70A 4JL5A 1RXUA 1KE2A 2FWPA 3UENA 2ORWA 2AFHB 4DJ5X 4AO8A 2P0YA 3BH6A 4EY7A 4HCJA 1YR8A 1OFUA 3G2PA 4ECQA 1T3NA 3LWMA 3PITA 2XDWA 1SPXA 2FZCA 1K3UB 1OJ7A 4GMGA 4UBNA 4GYKA 1NZPA 1IAQA 1LDMA 3RGWS 3SJUA 3VYSB 4DT1A 4FB5A 1IWPB 3AUKA 2A1UA 2E1RA 2H3IA 4HN4B 2HOFA 3WIDA 1RTKA 4PV7A 4B5KA 4Z5XA 2W54A 4MGZR 1ZHFA 3GLQA 5DB6A 2R0QC 2IYOA 4FOOA 5E7JA 3UCFA 3R7FA 5CG1A 4KX3A 2JEYA 2EYQA 4GOXA 1U9IC 1BCRB 4JA2A 3WX0A 4DMCA 4DB2A 2I8LA 4D0NA 2G71A 3WLAA 1FFBA 4GDFA 2UZ4A 1ULZA 3X1KA 1CX9B 1E7MA 2H6EA 1OA1A 1NN1A 1KMCA 1Q91A 2Y2VA 5K3DA 1Z68A 1Z18A 1FFDA 3REGA 3VPHA 5KT6A 1EFDN 3EVEA 4AICA 4JP2A 3GLFA 3ZXSA 3GA7A 4DPMA 1PX2A 1QUFA 1XRLA 5KFAA 1XOIA 4JITA 1ACLA 4P31A 4UBKA 4U00A 4J7CA 3URMA 4OQPA 3O8CA 2NXEA 4D8UA 4Q3LA 3EH2A 3MYRA 3P2OA 4KUGA 4I9HA 1K75A 4X8LA 1XPJA 4Q7QA 1UPAA 3H1PA 2KNJA 2A6PA 3OETA 4WERA 1UXHA 1GPKA 5EERA 5EINA 4YRGA 2ASEA 1QX3A 2GYVA 4TTIA 3BF7A 2XUAA 5L45A 1NXPA 4WLNA 2B1GA 1HYBA 1GAXA 1D07A 2VG8A 4YD1A 3GL9A 4F56A 3W5UA 1DT5A 3RT9A 1ADBA 2X4LA 1T0PA 2HHLA 3M4JA 4BMZA 1RE0A 3AONB 5JAOA 1DELA 5FX2A 1NFFA 1DGJA 4QSMA 3HZHA 4B17A 2ILTA 2E21A 1QBGA 3H6KA 1IEVA 4KDEA 4MVCA 5DLPA 3P7MA 2A84A 5DBOA 1G8MA 2GGSA 2I78A 1ZUNB 2R2AA 4IFTA 1H2BA 4ND7A 4EGJA 1YQQA 3EPLA 2B6NA 2BW0A 4CGYA 4TWBA 5IVIA 3FE2A 3CGWA 1XIVA 3H5OA 2Q1XA 3W1WA 5JS8A 1OMOA 2A9VA 2FN9A 2CNKA 1E2GA 1LKZA 2NVUA 4