5B5EU

Crystal structure analysis of photosystem ii complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b5eU01
3A0HU 5H2FU 5E79U 5B5EU 3WU2U 4UB8U 5GTIU 5TISU 5KAIU 4PJ0U 2DUYA 3KZIU 2AXTU 4UB6U 1S5LU 5KAFU 4IL6U 5B66U 5GTHU 3A0BU
chains in the Genus database with same CATH superfamily
1B4FA 3BZCA 1ZJMA 1SWWA 3D2QA 4O3SA 2R8KA 2KE7A 1WUDA 1RQNA 8ICZA 4F2SA 4QNLA 3IM1A 1UA1A 2FMSA 4I2AA 1MN8A 5EE1A 5IIKA 8ICUA 3BS5A 1HIWA 3UXPA 4KLLA 1SZHA 1UA0A 4O0IA 3FM9A 2P35A 5KFMA 4YR0A 1S0VA 1DK2A 5BOLA 4C4TA 4DFDA 1O08A 4MF8A 1FFUA 5DG8A 1T3QA 4Z6FA 5KFRA 4PHPA 2A1JA 1SGGA 4AP9A 5KFOA 1L3TA 2DFLA 3QX7A 1ZQBA 2N1RA 5KFSA 5L1MA 2KZ3A 1UCVA 1Y88A 4ECZA 2JXJA 3UXOA 1ZOLA 4M6WA 5DKWA 4DQPA 4ECUA 5DB7A 3JPTA 3N28A 1WYGA 4F93B 3Q8QB 8ICKA 1L3VA 3R9KA 2HOQA 3RTVA 5HMMA 1SL0A 4B9VA 4Y2UA 1KKXA 1SXDA 2H3VA 2Y9TA 4O3MA 8ICHA 5KT5A 4O3RA 1DOQA 2H3FA 3H4DA 4DQQA 1U47A 3LWLA 7ICKA 3RRGA 3ZI4A 1ZQYA 5ALEA 3BZKA 3AL0B 1F5SA 3TADA 4TQSA 3HKZC 2XGPA 1NK7A 5B66U 1JI7A 4QZEA 1ZRNA 3WKBA 5AK3A 5KFCA 5KG5A 3UM9A 4TUSA 2ZIWA 1RG6A 3PX6A 5KFYA 4QIWF 2QKQA 5KFPA 5IIJA 7ICLA 4CDGA 1XSNA 2EZZA 4M6WB 5J2AA 1L7MA 3AMZA 3T5HA 2HI0A 1XO1A 3BDPA 3RJHA 8ICXA 5DQIA 3IRUA 4FO6A 5KG1A 2PI5A 2QARA 4IQUA 3PR4A 1NNLA 1ZJNA 5JRTA 4F3OA 2BDPA 4KLOA 4Q45A 3Q8SB 4GC6A 2F8LA 2KOBA 1Z4OA 5GTIU 4I2EA 4KMUA 1RZTA 4I2CA 3K1RB 2GOLA 4MFAA 3WK7A 3ZDDA 3D2SA 5EOZA 5AICA 2ZIUB 4Z6DA 2D3DA 4B9SA 5ALMA 1ZQ1C 4Y2QA 5KFKA 3H0LB 4DSKA 3G6VA 2P66A 1A0PA 7ICRA 1V38A 4DL3A 2PXIA 5CA7A 4DSJA 2JMGA 3B9JA 4I2JA 4Y2RA 1D8YA 3AUOA 1L8OA 2DKXA 2PFQA 4F72A 4YXMA 3Q8KA 1ZQRA 2PI4A 3NTUA 5E79U 3C2MA 4PHEA 3TFSA 2YQEA 3E58A 3M9MB 1SIJA 3UMGA 2QARB 2RQ5A 2K89A 4OD0A 4GXIA 3MC1A 4I28A 4ELTA 5ALWA 1KQQA 5K4LA 5J0OA 3RJGA 5KT7A 4EBDA 4US9A 5AI6A 4F50A 1L5UA 5AKXA 4EZ9A 3MR2A 2W3RA 1KFDA 4M2YA 4DWIA 4I2IA 3GILA 2LPEA 5EWFA 4CRXA 3HWTA 4RQMA 2MAXA 4DFMA 1ZETA 3PSFA 3RJIA 5L1LA 9ICLA 4IQTA 3QE9Y 1KW4A 4DFPA 3ICXA 1JX4A 9ICCA 5AI0A 1FIQA 1NZPA 3WKAA 1TVAA 1O03A 2KSOA 1SKRA 3C21A 4FZNA 3RAQA 2B6GA 4X5VA 3QU4A 4J9KA 1TAQA 2HCFA 5T14A 4YP3A 2BPCA 4F5RA 2DQNB 1WWUA 4J9OA 1ZD3A 3K4GA 3I1YA 1ZQZA 1TK8A 1IV8A 1SWVA 2FLLA 3I76A 4NLGA 4C7ZA 1ED1A 2K4IA 4UB5A 1BNOA 4UB2A 2WTFA 3EYZA 3RBDA 2BPFA 2G5HB 1PUZA 2ZXHA 4OJLA 4DF8A 5J8YA 5AKKA 4Z6EA 3PY8A 3QUCA 1S5LU 3SD7A 2ZXIA 4FFDA 4DSIA 4JV2A 4KLIA 5J2CA 2VKQA 2MSNA 1A76A 1CRXA 3OJUA 3M9NB 2HHUA 1WWVA 4I2BA 2HBJA 2KJ5A 4TQRA 2YMQA 1VJ5A 5EE3A 2LKYA 3IG8A 5AKLA 1RM6C 4P0PA 4DO9A 3ETLA 2ZTEA 3S6JA 3ED5A 1IG6A 1TK0A 5ALJA 2V4QA 5AKHA 1SKWA 4GFJA 3SMVA 4Y2TA 4GLXA 4KLQA 1BGXT 5DG7A 1ZQPA 4ECWA 2G0AA 2W9BB 4GIBA 1TAMA 1NKCA 5KFVA 2K4PA 7ICIA 3QUTA 1Q8KA 2JH1A 3LWMA 2W9AA 4I29A 4UW9A 2JZBA 5DGBA 4NV0A 4BUGA 5L1IA 3HT3A 1L7PA 2KFZA 4RZRA 4US8A 4J9LA 5KFZA 4RNOA 1S9FA 2AXTU 4IL6U 2K8BB 2OEHA 3F5AA 8ICOA 2F1JA 4FS1A 3PVXA 1C7YA 4YMMA 1T7PA 1JXEA 5ALPA 4BJQA 1S10A 1SKSA 3MGIA 4YR2A 4EENA 5HHHA 4BWMA 4P0PB 5HR7A 5CEHA 4PZOA 3PW0A 8ICWA 2HHQA 1ZQAA 4R63A 2BCRA 3RAXA 2VA2A 8ICLA 2FPKA 2L5YA 4RT2A 4DS5A 4QWEA 2ZG6A 3DV9A 1X9WA 2F2AB 3FYHA 2JGAA 3ZD8A 5AM2A 4JUZA 5AKEA 3ZDAA 4K4IA 5KT3A 1QTMA 2F44A 2I1QA 2JZBB 1KN5A 4B9MA 2RHFA 4F5OA 4C8LA 2MU2A 1B22A 5J0XA 3ISBA 4O5KA 2EAOA 2KHVA 4EX6A 3T5LA 4ACOA 4QZ9A 4EYHB 4OJOA 2YN4A 5TISU 2XI9A 1UQVA 3CP8A 4KLTA 5D4BA 4Q8FA 1U48A 1F44A 4UQGA 1UT8A 3UQ0A 3O0FA 1N63A 1S76D 2G06A 1VLBA 5DLFA 5KFFA 3EZ5A 4F4WA 1Q3UA 4QZDA 3GV7B 3AEVA 4QZCA 1L8LA 4NLBA 1NKEA 2Y1JA 3JPSA 4NL9A 3KD3A 1X9SA 5FP0A 3HPOA 1S0OA 2YB1A 5ALIA 4JWNA 2HBKA 3C1YA 5D49A 4HYKA 2J6UA 3PSTA 4IR1A 2EH9A 1U45A 2NRWA 4MEXA 5G5HA 5AKGA 4EBCA 1MQ2A 1QSYA 3BQ0A 3HP6A 4CGZA 1NK4A 3PW5A 4UBCA 5DQGA 4ECQA 2PFNA 4PGQA 1JRPA 3LVWA 5DBCA 2F1HA 3Q8PB 2HHWA 5DBAA 2H3IA 5KFTA 4ECXA 5F9NA 2EZXA 4USAA 3PMLA 2NYVA 1Z3EB 5DDMA 2OM6A 4KLGA 2JR5A 4DSFA 2VA8A 1ZQQA 2BHNA 4IC9A 5TZVA 1FFVA 3T79A 2Q4TA 3A0HU 8ICCA 3BQ7A 4QW9A 5BPCA 2RP5A 9ICBA 4J9NA 1X66A 4P4PA 5AI5A 3C1ZA 2BCQA 4UB4A 2NRVA 4QWAA 2HBMA 3NGDA 2F77X 1S0NA 1BPBA 4YCXA 4K4HA 1AROP 3U26A 4EZ6A 3L5KA 5KG3A 5KFAA 3C29A 1U9LA 4EEYA 5ALFA 4F92B 3T3FA 4M04A 5J0PA 1HUOA 5CRXA 3WKDA 2E8NA 2EANA 4F5PA 3CRXA 4IRDA 4KLFA 3OJSA 2F3NA 2DBYA 4NLKA 5CHGA 2JEJA 1ZQVA 2YTUA 1JIHA 3IG5A 2WF9A 4C0ZA 1FO4A 2DPJA 2WF6A 5KFLA 2H5XA 1IIPA 4CCHA 8ICTA 3GIMA 3C5GA 8ICQA 2RDJA 3DDHA 1CEZA 3LYSA 3FC4A 3M6KA 3TANA 3AN1A 4ZOHC 5IIMA 1ZQLA 2OXOA 2OCEA 4J9PA 5ALLA 4F8RA 5J2IA 4OO1J 1PK1B 4QZ8A 3M7DA 9ICQA 3TQ1A 2ZJAA 1V97A 3WKEA 4ED6A 2WB1C 1QCKA 5DB6A 1H38A 2IMWP 4ZH4A 3PSIA 4O5CA 3OGUA 5J2FA 5AHXA 4KLSA 4I2GA 1N2XA 1ZQKA 4Y2JA 2HHVA 4RQNA 4F91B 3SV4A 1B43A 1K5OA 2G5IB 3BS5B 3V72A 1NOMA 3T5JA 1RQLA 2K60A 1T4GA 4Q44A 1U49A 8ICFA 2K8AA 1BPZA 2FE9A 1Z1BA 2WB1F 1BPDA 2KIWA 3ISDA 1ZQIA 4R65A 9ICHA 2I9GA 2A1JB 3PZPA 1ZYQA 4AYBC 1URJA 4DLEA 4DL4A 4J9MA 3WU2U 4IR9A 2GH1A 1X6IA 1ZQXA 3PR5B 3OTQA 4KN4A 2BCVA 3PSPA 4QZFA 2BGWA 3F2BA 4P4OA 2HSZA 1DK3A 4Y2VA 3PMNA 3OSNA 2CPRA 1NKBA 4PPXA 1COKA 3QU7A 2QB0A 3KZXA 5A0LA 2LBOA 3HKZF 2W8KA 1D8LA 3UMCA 5ALSA 1N48A 1PVPA 2BQRA 1MSWD 3L3FX 1ZD5A 1SZPA 1ZQOA 4RT3A 1Z00A 4C8NA 2ZTCA 5KFWA 1XO0A 4CNQA 4EBEA 3Q8RB 1NK0A 1NJWA 2EZYA 2DGZA 2MRLA 4K4GA 1TKDA 1S8OA 4C4RA 2IHMA 3SENA 4A8EA 3NS1A 4EELA 2KJ8A 4B9LA 5J29A 1D9FA 1KFTA 2KG5A 4UAYA 4PGYA 4O3OA 5EE9A 8ICBA 4RQ8A 3MFIA 4IS7A 5AI8A 3HW8A 2ZIWB 2OH2A 7ICPA 3BQTA 1ZD2P 3F5EA 3OHBA 7ICNA 1SV0C 5F9LA 2DKZA 3ALRA 1LV5A 7ICJA 4QZIA 1X9MA 2AJQA 3KHGA 1DRGA 2EQYA 5L1JA 3TAQA 1BPEA 5EWGA 4KLMA 5KFXA 4QZGA 1RXWA 3PO4A 5KAFU 4DCCA 5J2DA 4RPYA 8ICGA 5KT4A 3GV8B 2QB0B 4RQ1A 3PW7A 4RQ3A 2W3SA 7ICMA 3EPGA 3RB0A 3BS7A 2E5SA 3ETRA 3QEAZ 1Z00B 2OYYA 2PFOA 4P0QA 2KTQA 3GFKB 1KEJA 3K75D 3NVVA 4BX9C 2M0NA 3IN5A 1CI4A 1L7OA 1KSPA 1JXLA 2A19A 4G9BA 1YZ6A 5CB1A 4DQRA 1MC8A 4OJ6A 4NWIA 4RQ2A 2NO4A 3H8WA 4YVZA 2AU0A 2LYAA 2K4EA 3E2EA 2V4RA 5KFQA 4ED1A 3GDXA 5J2KA 3B0XA 5IIIA 9ICJA 1ZQEA 7ICOA 5ALQA 4LZGA 2F1IA 8ICPA 2BPGA 5AK5A 1ZD4A 2RLTA 2C2EA 5KFUA 3RB4A 4HAIA 9ICWA 2XVTA 1ZQDA 2PMZC 4TURA 1HUZA 4FE3A 4KX3A 2ATLA 4R66A 4JB3A 4Y2PA 2Q0ZX 1DGSA 1P7DA 2JEFA 3LDAA 2UVWA 4U6PA 3HILA 2FI1A 4CF4A 4FZMA 4CE6A 2BCUA 3SQIA 2HOIA 2P6UA 1XWLA 2JV3A 3IV6A 2E3TA 2XCAA 3Q8LA 2B21A 2XC9A 3GZFA 3G6XA 4KTQA 1NJXA 4I27A 5KG0A 4PHDA 2WAQC 3MGVA 1V9PA 1N60A 2PMZF 2KSOB 2KZZA 4J9RA 4DL2A 4MFCA 5J0WA 2VJ5A 4DFJA 5D46A 2BCSA 4B9NA 1ZQJA 1RYRA 2GO7A 4PJ0U 3RR8A 3H40A 2IBKA 2ODGA 2KZMA 4Y2YA 9ICRA 2C22A 2KIVA 4FS2A 1PZNA 5ALHA 1UT5A 1X9XA 5ALDA 4JV0A 1FEZA 3V6KA 2B0CA 1TV9A 4RUAA 4BDPA 2IOFK 5G5GA 4R8UA 5F3XB 4LJXA 1QSSA 2DUYA 5JTIA 2FMPA 2ISOA 3G6YA 4RPXA 4C8OA 2R8IA 3HRDD 1SL2A 3UQ2A 2FPMA 2YMLA 4BXOA 2KNJA 3NVWA 1KFSA 1UPHA 2HVHA 3GIKA 8ICRA 8ICEA 2VANA 5ALRA 4O3NA 5IILA 5AKZA 4UAZA 3BJYA 3GIIA 2R8GA 2XCPA 3PX0A 2Y0SC 4NL9C 3N7SC 1NI3A 3MR5A 2HVIA 3E0FA 1KLNA 1QQ5A 3AM9A 3L4PA 4Q8EA 4JK1A 1N61A 8ICAA 4QWBA 4M9LA 7ICEA 2K8CB 3DEEA 1PVRA 3V7KA 3IDWA 5HHIA 1S97A 2PFPA 4R8UB 1ZQUA 1X2IA 2FPLA 2BQUA 4F5QA 2ZUDA 3QU9A 2J6TA 5KFNA 1A6SA 1BNPA 5AI4A 4QZAA 1T8EA 4PGXA 4CF5A 3BQ1A 4Y2SA 7ICGA 3D6JA 1RYUA 1X42A 4XRHA 4ECRA 2IOFA 2LHTA 4MEYA 3KKAA 3BQ2A 3TACB 5H2FU 1L3SA 2KEYA 3NVYA 2ISPA 4BGDA 8ICSA 4UB8U 5AM3A 7ICSA 4F4XA 1D8BA 3N4MB 1ZQCA 1RYSA 1RPLA 5HNKA 1LKYA 2XIDA 4F4YA 2ZJ8A 2FMQA 4YQWA 1JROA 5AIBA 2HDOA 4KLEA 9ICPA 2WF7A 4RQ4A 4DEZA 1JALA 4PL2A 3AU2A 8ICYA 3T5KA 4I2HA 1NK5A 7ICHA 3OSPA 4LZDA 3PV8A 2BR0A 2VA3A 3C28A 9ICVA 2ZIVA 2NRTA 3SAGA 2AGQA 4NLCA 3B0YA 9ICKA 1IXRA 1KL9A 4C80A 3MFHA 2UVUA 4KN7A 1L3UA 4XQ8A 3GV5B 4I2DA 4UARA 1ZXIA 3VC8A 1EXNA 1SB3C 4UB6U 1L6NA 3LVVA 2W04A 2F76X 3MDCA 1ZQNA 9ICSA 5KG4A 5J0RA 2R8HA 3I28A 3RH4A 1TE2A 4B6JA 4P2HA 2NO5A 1J2NA 1NK9A 2W54A 1U4BA 4ELUA 1ZQWA 4C8KA 4M9NA 4C8MA 4OJPA 5AM5A 1LKYB 2KJ9A 2ZTDA 2C28A 1UHUA 3KTQA 3ONNA 3TFRA 1QQ7A 4JV1A 2YY6A 2ESEA 3TAPA 5AM0A 5CWRA 2ZJ5A 3QXGA 2KMDA 1KTQA 1BVSA 4DS4A 2LYBA 2KHQA 2G07A 4TUPA 4JWMA 3K1ZA 1SV4A 2R18A 1ZQSA 4ECTA 5DDYA 2P6RA 5DLGA 2C2DA 4KLHA 3ZDBA 3N7PD 5AKIA 1XU4A 5HR6A 4U7CA 1MQ3A 3QYPA 2D8CA 4TUQA 4DF4A 1LB2B 1ZQGA 4KLUA 5J0UA 3TADC 2W55A 2W03A 2NRXA 4YFKA 1M6YA 5CJ7A 5KG7A 3QZ7A 3EUB2 2LI6A 4F71A 2JH7A 3GQCA 4O9MA 1AQ6A 3TI0A 5KFBA 5KT2A 3RFAA 4YN4A 5J2BA 2RDIA 3KBBA 3RJKA 3WK4A 4RQ6A 4M9JA 1YZ7A 4O5EA 2VIXA 3MGHA 3LK9A 1B0XA 4QWCA 7ICVA 1PVQA 2VJ4A 5AI9A 5KAIU 1XC9A 1K1SA 2YX8A 5DGAA 3RRHA 2HHSA 3JPPA 1ZRMA 2YMMA 3C2KA 1GO3F 4ED2A 4RQ5A 5L9XA 5CP2A 1HEKA 4F5NA 2F8KA 4YD1A 5ALUA 5J0SA 4M0AA 5ALYA 2KFNA 4J9SA 2AHOB 2E8OA 2EAMA 4ED3A 1OW5A 2YB4A 4NM1A 2KVCA 4F4KA 2GLEA 2AGPA 3H0MB 2JEGA 1N62A 4QIWC 3AQFA 2MA1A 2LMRA 4KMOB 2ZIUA 3KHLA 4YD2A 5HMLA 8ICNA 4DOAA 2XY5A 4DL5A 2LM4A 1ECWA 5EWEA 1XSLA 1YT3A 2LYHA 3M1YA 1S77D 2O6KA 2ALZA 3KOOA 5DG9A 4ED0A 4IQWA 9ICUA 5KFJA 2CRXA 9ICFA 2I6XA 4OCZA 4GXJA 1XSPA 5ALXA 3SV3A 2KN7A 3SAFA 5J0YA 1DXSA 2DF4B 4AYBF 4UASA 2NRZA 4ECVA 8ICMA 3EWAA 2FDRA 2Z7JA 1WG8A 2A3VA 2EAPA 4PHAA 4Z6CA 4DSEA 2ASJA 1LVHA 3N97B 1T3NA 5KG2A 2IHNA 5L1KA 4B9TA 2KKPA 4B9UA 1TK5A 1Z19A 3WK6A 2OWOA 5C5JA 3NRZA 2UVVA 4QW8A 5ALVA 5AM1A 2V9WA 2Y9UA 3PNCA 3OHAA 5CR0A 3JPQA 1SL1A 9ICTA 4ICAA 3CNHA 4ED8A 2KP7A 2BDUA 2HW3A 4KX5A 2W7PA 3GU3A 2WHEA 2DL0A 4YXJA 2J6SA 1X6JA 2E1EA 5J8YC 2WFAA 3C23A 3A0BU 4NXZA 9ICIA 9ICGA 4C4SA 3TARA 5BOMA 4DSLA 1QLNA 1IM4A 2ES6A 2UVRA 5AK4A 3H4BA 4FBUA 1XNSA 3WK5A 4RNNA 3KZIU 2HOFA 4O3PA 1NK6A 5J2EA 4F2RA 3IHQB 8ICJA 3IP4B 2DWQA 1KRPA 4NJ8A 3AU6A 2W9MA 2IA6A 1DGJA 4YR3A 3Q8MA 1Z1VA 3NASA 4R64A 1TAUA 4C7YA 1J2MA 3AQEA 3FAHA 1S0MA 5KFIA 2R8JA 9ICXA 5DB8A 3H7IA 2W9CA 4UB1A 2XICA 4DOBA 1Q46A 2HBLA 4PZNA 4MHVA 1WCNA 7ICUA 4KITB 2RRDA 3RJFA 3GIJA 3D2NA 4YMOA 5IIOA 2KD1A 2W9BA 1PK3A 5ALZA 1SV0A 1TFRA 4P0QB 3HJEA 2XY6A 1ZQHA 3QNMA 3KFUF 5ALOA 2PKEA 9ICMA 5JU5A 2AH5A 2H3QA 4ECSA 4DOCA 2WF5A 1RDFA 3CYMA 1D9DA 2Y1IA 2FLNA 5KTQA 2XY7A 1NJYA 1NK8A 2ZUCA 3F2DA 4XUSA 1QQ6A 2G09A 2C2RA 1MA7A 4G3IA 1F0MA 1KDHA 2GWSA 2KV2A 7ICQA 2CN1A 2W9CB 4QZHA 3RBEA 3SEIA 1ZQMA 4YG2A 4ECYA 5J2GA 2W11A 4WJ3B 3V7LA 7ICFA 1QSLA 1NZBA 3ISCA 2KKVA 5JUMA 4EEKA 4P4MA 2WAQF 3C5FA 1ZQFA 5AM4A 4EYIB 5J0TA 3J81j 2BQ3A 5EE0A 2XO7A 3RR7A 3EPIA 4I2FA 3N7RC 4QWDA 3MDAA 3ZDEA 3SAHA 3QZ8A 3QUQA 5KFGA 2I5HA 3SI8A 2MUTA 3ORYA 3KKAC 3MR6A 4KLDA 3NVZA 2HMXA 1T94A 9ICNA 3MABA 3RF9A 3V6HA 9ICEA 5AK6A 5KNIA 3PW2A 9ICOA 3H0RB 4YMNA 2FJ6A 5J0QA 3RB6A 4RQ7A 3WKCA 1JUDA 3ZD9A 1RXVA 5DBBA 2D6FC 5ALGA 4XA5A 5J2JA 5AKYA 3KHHA 4DQIA 5B5EU 4QJFB 1ZQTA 2AQ0A 3HX0A 2NV3A 4FZLA 4ED7A 4ELVA 2ZIXA 1VDVA 1Q3VA 4DL7A 2IOHA 4MFFA 2KK0A 1CUKA 3V6JA 3SYZA 1JN3A 2ASLA 5GTHU 3JPNA 4J03A 4DFKA 3OPXA 3RH5A 3M9OB 4Q43A 3QU5A 4MF2A 5ALNA 3H8MA 9ICAA 3FDSA 3SR6A 1A77A 2W8LA 5ALTA 1N5XA 2Y0SF 2JRZA 2MUTB 3H8SA 2BZFA 1HJPA 4Y2XA 3JPRA 3RJEA 2H3ZA 1KBUA 4BXOB 3RJJA 3QUBA 1N56A 4UATA 2W7OA 5ALKA 1SXEA 7ICTA 5AKJA 4NY8A 3QEBZ 2XGQA 3NUQA 4J9QA 5KL8B 1Z4NA 8ICIA 2M9NA 2AQ4A 3KHRA 4FBTA 2BKEA 2JEIA 5HP4A 4RU9A 2ZIXB 4BWJA 3RB3A 4DQSA 4M9GA 5KL1B 2E8PA 4RPZA 3WK8A 4QZBA 5DB9A 2A1AA 2E8MA 4CF3A 3F53A 3CW2C 3UXNA 4GXKA 2QB1A 1COOA 3TKAA 4UAWA 2EDUA 5DQHA 1OXJA 2FLPA 2KVSA 1J97A 4RUCA 3MR3A 3PO5A 1WCLA 2ZUBA 4PH5A 4NLZA 5KT6A 1JMSA 5KFEA 4IRCA 3C2LA 4M9HA 4IQVA 3WK9A 4DLGA 3NRWA 3V7JA 4UAVA 3H8JA 2AGOA 4OJ5A 5AIAA 4DL6A 4KLJA 2CXYA 2OHFA 4F4ZA 5C0YA 3SZ2A 4LVSA 1OUQA 4O3QA 3UMBA 1BPXA 2JHDA 4EX7A 2YMPA 5KFHA 4IRKA 2W43A 5KFDA 2K4HA 1N5WA 4RNMA 3M8SA 4M47A 4NLNA 3ZDCA 4UBBA 3M6ZA 2ASDA 3QU2A 3PW4A 1K1QA 1V85A 3UPQA 2KICA 1BPYA 4GC7A 3THVA 1XS9D 2LM1A 3M8RA 5KG6A 1L7NA 3PX4A 1PK1A 2E1FA 3EW9A 3MBYA 4JMUA 3F2CA 3RH6A 2HHTA 3VCBA 4NM2A 4UAUA 5IINA 2HHXA 2ZIVB 5J2HA 2G08A 1C20A 1NJZA 8ICVA 2DPIA 2QLTA 4UB3A 4E0DA 4PL1A 1X40A 4RQ0A 2WF8A 1QH9A 3JPOA
chains in the Genus database with same CATH topology
3A0HU 5H2FU 5E79U 5B5EU 3WU2U 4UB8U 5GTIU 5TISU 5KAIU 4PJ0U 2DUYA 3KZIU 2AXTU 4UB6U 1S5LU 5KAFU 4IL6U 5B66U 5GTHU 3A0BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  5H2F U;  5E79 U;  5B5E U;  3WU2 U;  4UB8 U;  5GTI U;  5TIS U;  5KAI U;  4PJ0 U;  2DUY A;  3KZI U;  2AXT U;  4UB6 U;  1S5L U;  5KAF U;  4IL6 U;  5B66 U;  5GTH U;  3A0B U; 
#chains in the Genus database with same CATH topology
 1B4F A;  3BZC A;  1ZJM A;  1SWW A;  3D2Q A;  4O3S A;  2R8K A;  2KE7 A;  1WUD A;  1RQN A;  8ICZ A;  4F2S A;  4QNL A;  3IM1 A;  1UA1 A;  2FMS A;  4I2A A;  1MN8 A;  5EE1 A;  5IIK A;  8ICU A;  3BS5 A;  1HIW A;  3UXP A;  4KLL A;  1SZH A;  1UA0 A;  4O0I A;  3FM9 A;  2P35 A;  5KFM A;  4YR0 A;  1S0V A;  1DK2 A;  5BOL A;  4C4T A;  4DFD A;  1O08 A;  4MF8 A;  1FFU A;  5DG8 A;  1T3Q A;  4Z6F A;  5KFR A;  4PHP A;  2A1J A;  1SGG A;  4AP9 A;  5KFO A;  1L3T A;  2DFL A;  3QX7 A;  1ZQB A;  2N1R A;  5KFS A;  5L1M A;  2KZ3 A;  1UCV A;  1Y88 A;  4ECZ A;  2JXJ A;  3UXO A;  1ZOL A;  4M6W A;  5DKW A;  4DQP A;  4ECU A;  5DB7 A;  3JPT A;  3N28 A;  1WYG A;  4F93 B;  3Q8Q B;  8ICK A;  1L3V A;  3R9K A;  2HOQ A;  3RTV A;  5HMM A;  1SL0 A;  4B9V A;  4Y2U A;  1KKX A;  1SXD A;  2H3V A;  2Y9T A;  4O3M A;  8ICH A;  5KT5 A;  4O3R A;  1DOQ A;  2H3F A;  3H4D A;  4DQQ A;  1U47 A;  3LWL A;  7ICK A;  3RRG A;  3ZI4 A;  1ZQY A;  5ALE A;  3BZK A;  3AL0 B;  1F5S A;  3TAD A;  4TQS A;  3HKZ C;  2XGP A;  1NK7 A;  5B66 U;  1JI7 A;  4QZE A;  1ZRN A;  3WKB A;  5AK3 A;  5KFC A;  5KG5 A;  3UM9 A;  4TUS A;  2ZIW A;  1RG6 A;  3PX6 A;  5KFY A;  4QIW F;  2QKQ A;  5KFP A;  5IIJ A;  7ICL A;  4CDG A;  1XSN A;  2EZZ A;  4M6W B;  5J2A A;  1L7M A;  3AMZ A;  3T5H A;  2HI0 A;  1XO1 A;  3BDP A;  3RJH A;  8ICX A;  5DQI A;  3IRU A;  4FO6 A;  5KG1 A;  2PI5 A;  2QAR A;  4IQU A;  3PR4 A;  1NNL A;  1ZJN A;  5JRT A;  4F3O A;  2BDP A;  4KLO A;  4Q45 A;  3Q8S B;  4GC6 A;  2F8L A;  2KOB A;  1Z4O A;  5GTI U;  4I2E A;  4KMU A;  1RZT A;  4I2C A;  3K1R B;  2GOL A;  4MFA A;  3WK7 A;  3ZDD A;  3D2S A;  5EOZ A;  5AIC A;  2ZIU B;  4Z6D A;  2D3D A;  4B9S A;  5ALM A;  1ZQ1 C;  4Y2Q A;  5KFK A;  3H0L B;  4DSK A;  3G6V A;  2P66 A;  1A0P A;  7ICR A;  1V38 A;  4DL3 A;  2PXI A;  5CA7 A;  4DSJ A;  2JMG A;  3B9J A;  4I2J A;  4Y2R A;  1D8Y A;  3AUO A;  1L8O A;  2DKX A;  2PFQ A;  4F72 A;  4YXM A;  3Q8K A;  1ZQR A;  2PI4 A;  3NTU A;  5E79 U;  3C2M A;  4PHE A;  3TFS A;  2YQE A;  3E58 A;  3M9M B;  1SIJ A;  3UMG A;  2QAR B;  2RQ5 A;  2K89 A;  4OD0 A;  4GXI A;  3MC1 A;  4I28 A;  4ELT A;  5ALW A;  1KQQ A;  5K4L A;  5J0O A;  3RJG A;  5KT7 A;  4EBD A;  4US9 A;  5AI6 A;  4F50 A;  1L5U A;  5AKX A;  4EZ9 A;  3MR2 A;  2W3R A;  1KFD A;  4M2Y A;  4DWI A;  4I2I A;  3GIL A;  2LPE A;  5EWF A;  4CRX A;  3HWT A;  4RQM A;  2MAX A;  4DFM A;  1ZET A;  3PSF A;  3RJI A;  5L1L A;  9ICL A;  4IQT A;  3QE9 Y;  1KW4 A;  4DFP A;  3ICX A;  1JX4 A;  9ICC A;  5AI0 A;  1FIQ A;  1NZP A;  3WKA A;  1TVA A;  1O03 A;  2KSO A;  1SKR A;  3C21 A;  4FZN A;  3RAQ A;  2B6G A;  4X5V A;  3QU4 A;  4J9K A;  1TAQ A;  2HCF A;  5T14 A;  4YP3 A;  2BPC A;  4F5R A;  2DQN B;  1WWU A;  4J9O A;  1ZD3 A;  3K4G A;  3I1Y A;  1ZQZ A;  1TK8 A;  1IV8 A;  1SWV A;  2FLL A;  3I76 A;  4NLG A;  4C7Z A;  1ED1 A;  2K4I A;  4UB5 A;  1BNO A;  4UB2 A;  2WTF A;  3EYZ A;  3RBD A;  2BPF A;  2G5H B;  1PUZ A;  2ZXH A;  4OJL A;  4DF8 A;  5J8Y A;  5AKK A;  4Z6E A;  3PY8 A;  3QUC A;  1S5L U;  3SD7 A;  2ZXI A;  4FFD A;  4DSI A;  4JV2 A;  4KLI A;  5J2C A;  2VKQ A;  2MSN A;  1A76 A;  1CRX A;  3OJU A;  3M9N B;  2HHU A;  1WWV A;  4I2B A;  2HBJ A;  2KJ5 A;  4TQR A;  2YMQ A;  1VJ5 A;  5EE3 A;  2LKY A;  3IG8 A;  5AKL A;  1RM6 C;  4P0P A;  4DO9 A;  3ETL A;  2ZTE A;  3S6J A;  3ED5 A;  1IG6 A;  1TK0 A;  5ALJ A;  2V4Q A;  5AKH A;  1SKW A;  4GFJ A;  3SMV A;  4Y2T A;  4GLX A;  4KLQ A;  1BGX T;  5DG7 A;  1ZQP A;  4ECW A;  2G0A A;  2W9B B;  4GIB A;  1TAM A;  1NKC A;  5KFV A;  2K4P A;  7ICI A;  3QUT A;  1Q8K A;  2JH1 A;  3LWM A;  2W9A A;  4I29 A;  4UW9 A;  2JZB A;  5DGB A;  4NV0 A;  4BUG A;  5L1I A;  3HT3 A;  1L7P A;  2KFZ A;  4RZR A;  4US8 A;  4J9L A;  5KFZ A;  4RNO A;  1S9F A;  2AXT U;  4IL6 U;  2K8B B;  2OEH A;  3F5A A;  8ICO A;  2F1J A;  4FS1 A;  3PVX A;  1C7Y A;  4YMM A;  1T7P A;  1JXE A;  5ALP A;  4BJQ A;  1S10 A;  1SKS A;  3MGI A;  4YR2 A;  4EEN A;  5HHH A;  4BWM A;  4P0P B;  5HR7 A;  5CEH A;  4PZO A;  3PW0 A;  8ICW A;  2HHQ A;  1ZQA A;  4R63 A;  2BCR A;  3RAX A;  2VA2 A;  8ICL A;  2FPK A;  2L5Y A;  4RT2 A;  4DS5 A;  4QWE A;  2ZG6 A;  3DV9 A;  1X9W A;  2F2A B;  3FYH A;  2JGA A;  3ZD8 A;  5AM2 A;  4JUZ A;  5AKE A;  3ZDA A;  4K4I A;  5KT3 A;  1QTM A;  2F44 A;  2I1Q A;  2JZB B;  1KN5 A;  4B9M A;  2RHF A;  4F5O A;  4C8L A;  2MU2 A;  1B22 A;  5J0X A;  3ISB A;  4O5K A;  2EAO A;  2KHV A;  4EX6 A;  3T5L A;  4ACO A;  4QZ9 A;  4EYH B;  4OJO A;  2YN4 A;  5TIS U;  2XI9 A;  1UQV A;  3CP8 A;  4KLT A;  5D4B A;  4Q8F A;  1U48 A;  1F44 A;  4UQG A;  1UT8 A;  3UQ0 A;  3O0F A;  1N63 A;  1S76 D;  2G06 A;  1VLB A;  5DLF A;  5KFF A;  3EZ5 A;  4F4W A;  1Q3U A;  4QZD A;  3GV7 B;  3AEV A;  4QZC A;  1L8L A;  4NLB A;  1NKE A;  2Y1J A;  3JPS A;  4NL9 A;  3KD3 A;  1X9S A;  5FP0 A;  3HPO A;  1S0O A;  2YB1 A;  5ALI A;  4JWN A;  2HBK A;  3C1Y A;  5D49 A;  4HYK A;  2J6U A;  3PST A;  4IR1 A;  2EH9 A;  1U45 A;  2NRW A;  4MEX A;  5G5H A;  5AKG A;  4EBC A;  1MQ2 A;  1QSY A;  3BQ0 A;  3HP6 A;  4CGZ A;  1NK4 A;  3PW5 A;  4UBC A;  5DQG A;  4ECQ A;  2PFN A;  4PGQ A;  1JRP A;  3LVW A;  5DBC A;  2F1H A;  3Q8P B;  2HHW A;  5DBA A;  2H3I A;  5KFT A;  4ECX A;  5F9N A;  2EZX A;  4USA A;  3PML A;  2NYV A;  1Z3E B;  5DDM A;  2OM6 A;  4KLG A;  2JR5 A;  4DSF A;  2VA8 A;  1ZQQ A;  2BHN A;  4IC9 A;  5TZV A;  1FFV A;  3T79 A;  2Q4T A;  3A0H U;  8ICC A;  3BQ7 A;  4QW9 A;  5BPC A;  2RP5 A;  9ICB A;  4J9N A;  1X66 A;  4P4P A;  5AI5 A;  3C1Z A;  2BCQ A;  4UB4 A;  2NRV A;  4QWA A;  2HBM A;  3NGD A;  2F77 X;  1S0N A;  1BPB A;  4YCX A;  4K4H A;  1ARO P;  3U26 A;  4EZ6 A;  3L5K A;  5KG3 A;  5KFA A;  3C29 A;  1U9L A;  4EEY A;  5ALF A;  4F92 B;  3T3F A;  4M04 A;  5J0P A;  1HUO A;  5CRX A;  3WKD A;  2E8N A;  2EAN A;  4F5P A;  3CRX A;  4IRD A;  4KLF A;  3OJS A;  2F3N A;  2DBY A;  4NLK A;  5CHG A;  2JEJ A;  1ZQV A;  2YTU A;  1JIH A;  3IG5 A;  2WF9 A;  4C0Z A;  1FO4 A;  2DPJ A;  2WF6 A;  5KFL A;  2H5X A;  1IIP A;  4CCH A;  8ICT A;  3GIM A;  3C5G A;  8ICQ A;  2RDJ A;  3DDH A;  1CEZ A;  3LYS A;  3FC4 A;  3M6K A;  3TAN A;  3AN1 A;  4ZOH C;  5IIM A;  1ZQL A;  2OXO A;  2OCE A;  4J9P A;  5ALL A;  4F8R A;  5J2I A;  4OO1 J;  1PK1 B;  4QZ8 A;  3M7D A;  9ICQ A;  3TQ1 A;  2ZJA A;  1V97 A;  3WKE A;  4ED6 A;  2WB1 C;  1QCK A;  5DB6 A;  1H38 A;  2IMW P;  4ZH4 A;  3PSI A;  4O5C A;  3OGU A;  5J2F A;  5AHX A;  4KLS A;  4I2G A;  1N2X A;  1ZQK A;  4Y2J A;  2HHV A;  4RQN A;  4F91 B;  3SV4 A;  1B43 A;  1K5O A;  2G5I B;  3BS5 B;  3V72 A;  1NOM A;  3T5J A;  1RQL A;  2K60 A;  1T4G A;  4Q44 A;  1U49 A;  8ICF A;  2K8A A;  1BPZ A;  2FE9 A;  1Z1B A;  2WB1 F;  1BPD A;  2KIW A;  3ISD A;  1ZQI A;  4R65 A;  9ICH A;  2I9G A;  2A1J B;  3PZP A;  1ZYQ A;  4AYB C;  1URJ A;  4DLE A;  4DL4 A;  4J9M A;  3WU2 U;  4IR9 A;  2GH1 A;  1X6I A;  1ZQX A;  3PR5 B;  3OTQ A;  4KN4 A;  2BCV A;  3PSP A;  4QZF A;  2BGW A;  3F2B A;  4P4O A;  2HSZ A;  1DK3 A;  4Y2V A;  3PMN A;  3OSN A;  2CPR A;  1NKB A;  4PPX A;  1COK A;  3QU7 A;  2QB0 A;  3KZX A;  5A0L A;  2LBO A;  3HKZ F;  2W8K A;  1D8L A;  3UMC A;  5ALS A;  1N48 A;  1PVP A;  2BQR A;  1MSW D;  3L3F X;  1ZD5 A;  1SZP A;  1ZQO A;  4RT3 A;  1Z00 A;  4C8N A;  2ZTC A;  5KFW A;  1XO0 A;  4CNQ A;  4EBE A;  3Q8R B;  1NK0 A;  1NJW A;  2EZY A;  2DGZ A;  2MRL A;  4K4G A;  1TKD A;  1S8O A;  4C4R A;  2IHM A;  3SEN A;  4A8E A;  3NS1 A;  4EEL A;  2KJ8 A;  4B9L A;  5J29 A;  1D9F A;  1KFT A;  2KG5 A;  4UAY A;  4PGY A;  4O3O A;  5EE9 A;  8ICB A;  4RQ8 A;  3MFI A;  4IS7 A;  5AI8 A;  3HW8 A;  2ZIW B;  2OH2 A;  7ICP A;  3BQT A;  1ZD2 P;  3F5E A;  3OHB A;  7ICN A;  1SV0 C;  5F9L A;  2DKZ A;  3ALR A;  1LV5 A;  7ICJ A;  4QZI A;  1X9M A;  2AJQ A;  3KHG A;  1DRG A;  2EQY A;  5L1J A;  3TAQ A;  1BPE A;  5EWG A;  4KLM A;  5KFX A;  4QZG A;  1RXW A;  3PO4 A;  5KAF U;  4DCC A;  5J2D A;  4RPY A;  8ICG A;  5KT4 A;  3GV8 B;  2QB0 B;  4RQ1 A;  3PW7 A;  4RQ3 A;  2W3S A;  7ICM A;  3EPG A;  3RB0 A;  3BS7 A;  2E5S A;  3ETR A;  3QEA Z;  1Z00 B;  2OYY A;  2PFO A;  4P0Q A;  2KTQ A;  3GFK B;  1KEJ A;  3K75 D;  3NVV A;  4BX9 C;  2M0N A;  3IN5 A;  1CI4 A;  1L7O A;  1KSP A;  1JXL A;  2A19 A;  4G9B A;  1YZ6 A;  5CB1 A;  4DQR A;  1MC8 A;  4OJ6 A;  4NWI A;  4RQ2 A;  2NO4 A;  3H8W A;  4YVZ A;  2AU0 A;  2LYA A;  2K4E A;  3E2E A;  2V4R A;  5KFQ A;  4ED1 A;  3GDX A;  5J2K A;  3B0X A;  5III A;  9ICJ A;  1ZQE A;  7ICO A;  5ALQ A;  4LZG A;  2F1I A;  8ICP A;  2BPG A;  5AK5 A;  1ZD4 A;  2RLT A;  2C2E A;  5KFU A;  3RB4 A;  4HAI A;  9ICW A;  2XVT A;  1ZQD A;  2PMZ C;  4TUR A;  1HUZ A;  4FE3 A;  4KX3 A;  2ATL A;  4R66 A;  4JB3 A;  4Y2P A;  2Q0Z X;  1DGS A;  1P7D A;  2JEF A;  3LDA A;  2UVW A;  4U6P A;  3HIL A;  2FI1 A;  4CF4 A;  4FZM A;  4CE6 A;  2BCU A;  3SQI A;  2HOI A;  2P6U A;  1XWL A;  2JV3 A;  3IV6 A;  2E3T A;  2XCA A;  3Q8L A;  2B21 A;  2XC9 A;  3GZF A;  3G6X A;  4KTQ A;  1NJX A;  4I27 A;  5KG0 A;  4PHD A;  2WAQ C;  3MGV A;  1V9P A;  1N60 A;  2PMZ F;  2KSO B;  2KZZ A;  4J9R A;  4DL2 A;  4MFC A;  5J0W A;  2VJ5 A;  4DFJ A;  5D46 A;  2BCS A;  4B9N A;  1ZQJ A;  1RYR A;  2GO7 A;  4PJ0 U;  3RR8 A;  3H40 A;  2IBK A;  2ODG A;  2KZM A;  4Y2Y A;  9ICR A;  2C22 A;  2KIV A;  4FS2 A;  1PZN A;  5ALH A;  1UT5 A;  1X9X A;  5ALD A;  4JV0 A;  1FEZ A;  3V6K A;  2B0C A;  1TV9 A;  4RUA A;  4BDP A;  2IOF K;  5G5G A;  4R8U A;  5F3X B;  4LJX A;  1QSS A;  2DUY A;  5JTI A;  2FMP A;  2ISO A;  3G6Y A;  4RPX A;  4C8O A;  2R8I A;  3HRD D;  1SL2 A;  3UQ2 A;  2FPM A;  2YML A;  4BXO A;  2KNJ A;  3NVW A;  1KFS A;  1UPH A;  2HVH A;  3GIK A;  8ICR A;  8ICE A;  2VAN A;  5ALR A;  4O3N A;  5IIL A;  5AKZ A;  4UAZ A;  3BJY A;  3GII A;  2R8G A;  2XCP A;  3PX0 A;  2Y0S C;  4NL9 C;  3N7S C;  1NI3 A;  3MR5 A;  2HVI A;  3E0F A;  1KLN A;  1QQ5 A;  3AM9 A;  3L4P A;  4Q8E A;  4JK1 A;  1N61 A;  8ICA A;  4QWB A;  4M9L A;  7ICE A;  2K8C B;  3DEE A;  1PVR A;  3V7K A;  3IDW A;  5HHI A;  1S97 A;  2PFP A;  4R8U B;  1ZQU A;  1X2I A;  2FPL A;  2BQU A;  4F5Q A;  2ZUD A;  3QU9 A;  2J6T A;  5KFN A;  1A6S A;  1BNP A;  5AI4 A;  4QZA A;  1T8E A;  4PGX A;  4CF5 A;  3BQ1 A;  4Y2S A;  7ICG A;  3D6J A;  1RYU A;  1X42 A;  4XRH A;  4ECR A;  2IOF A;  2LHT A;  4MEY A;  3KKA A;  3BQ2 A;  3TAC B;  5H2F U;  1L3S A;  2KEY A;  3NVY A;  2ISP A;  4BGD A;  8ICS A;  4UB8 U;  5AM3 A;  7ICS A;  4F4X A;  1D8B A;  3N4M B;  1ZQC A;  1RYS A;  1RPL A;  5HNK A;  1LKY A;  2XID A;  4F4Y A;  2ZJ8 A;  2FMQ A;  4YQW A;  1JRO A;  5AIB A;  2HDO A;  4KLE A;  9ICP A;  2WF7 A;  4RQ4 A;  4DEZ A;  1JAL A;  4PL2 A;  3AU2 A;  8ICY A;  3T5K A;  4I2H A;  1NK5 A;  7ICH A;  3OSP A;  4LZD A;  3PV8 A;  2BR0 A;  2VA3 A;  3C28 A;  9ICV A;  2ZIV A;  2NRT A;  3SAG A;  2AGQ A;  4NLC A;  3B0Y A;  9ICK A;  1IXR A;  1KL9 A;  4C80 A;  3MFH A;  2UVU A;  4KN7 A;  1L3U A;  4XQ8 A;  3GV5 B;  4I2D A;  4UAR A;  1ZXI A;  3VC8 A;  1EXN A;  1SB3 C;  4UB6 U;  1L6N A;  3LVV A;  2W04 A;  2F76 X;  3MDC A;  1ZQN A;  9ICS A;  5KG4 A;  5J0R A;  2R8H A;  3I28 A;  3RH4 A;  1TE2 A;  4B6J A;  4P2H A;  2NO5 A;  1J2N A;  1NK9 A;  2W54 A;  1U4B A;  4ELU A;  1ZQW A;  4C8K A;  4M9N A;  4C8M A;  4OJP A;  5AM5 A;  1LKY B;  2KJ9 A;  2ZTD A;  2C28 A;  1UHU A;  3KTQ A;  3ONN A;  3TFR A;  1QQ7 A;  4JV1 A;  2YY6 A;  2ESE A;  3TAP A;  5AM0 A;  5CWR A;  2ZJ5 A;  3QXG A;  2KMD A;  1KTQ A;  1BVS A;  4DS4 A;  2LYB A;  2KHQ A;  2G07 A;  4TUP A;  4JWM A;  3K1Z A;  1SV4 A;  2R18 A;  1ZQS A;  4ECT A;  5DDY A;  2P6R A;  5DLG A;  2C2D A;  4KLH A;  3ZDB A;  3N7P D;  5AKI A;  1XU4 A;  5HR6 A;  4U7C A;  1MQ3 A;  3QYP A;  2D8C A;  4TUQ A;  4DF4 A;  1LB2 B;  1ZQG A;  4KLU A;  5J0U A;  3TAD C;  2W55 A;  2W03 A;  2NRX A;  4YFK A;  1M6Y A;  5CJ7 A;  5KG7 A;  3QZ7 A;  3EUB 2;  2LI6 A;  4F71 A;  2JH7 A;  3GQC A;  4O9M A;  1AQ6 A;  3TI0 A;  5KFB A;  5KT2 A;  3RFA A;  4YN4 A;  5J2B A;  2RDI A;  3KBB A;  3RJK A;  3WK4 A;  4RQ6 A;  4M9J A;  1YZ7 A;  4O5E A;  2VIX A;  3MGH A;  3LK9 A;  1B0X A;  4QWC A;  7ICV A;  1PVQ A;  2VJ4 A;  5AI9 A;  5KAI U;  1XC9 A;  1K1S A;  2YX8 A;  5DGA A;  3RRH A;  2HHS A;  3JPP A;  1ZRM A;  2YMM A;  3C2K A;  1GO3 F;  4ED2 A;  4RQ5 A;  5L9X A;  5CP2 A;  1HEK A;  4F5N A;  2F8K A;  4YD1 A;  5ALU A;  5J0S A;  4M0A A;  5ALY A;  2KFN A;  4J9S A;  2AHO B;  2E8O A;  2EAM A;  4ED3 A;  1OW5 A;  2YB4 A;  4NM1 A;  2KVC A;  4F4K A;  2GLE A;  2AGP A;  3H0M B;  2JEG A;  1N62 A;  4QIW C;  3AQF A;  2MA1 A;  2LMR A;  4KMO B;  2ZIU A;  3KHL A;  4YD2 A;  5HML A;  8ICN A;  4DOA A;  2XY5 A;  4DL5 A;  2LM4 A;  1ECW A;  5EWE A;  1XSL A;  1YT3 A;  2LYH A;  3M1Y A;  1S77 D;  2O6K A;  2ALZ A;  3KOO A;  5DG9 A;  4ED0 A;  4IQW A;  9ICU A;  5KFJ A;  2CRX A;  9ICF A;  2I6X A;  4OCZ A;  4GXJ A;  1XSP A;  5ALX A;  3SV3 A;  2KN7 A;  3SAF A;  5J0Y A;  1DXS A;  2DF4 B;  4AYB F;  4UAS A;  2NRZ A;  4ECV A;  8ICM A;  3EWA A;  2FDR A;  2Z7J A;  1WG8 A;  2A3V A;  2EAP A;  4PHA A;  4Z6C A;  4DSE A;  2ASJ A;  1LVH A;  3N97 B;  1T3N A;  5KG2 A;  2IHN A;  5L1K A;  4B9T A;  2KKP A;  4B9U A;  1TK5 A;  1Z19 A;  3WK6 A;  2OWO A;  5C5J A;  3NRZ A;  2UVV A;  4QW8 A;  5ALV A;  5AM1 A;  2V9W A;  2Y9U A;  3PNC A;  3OHA A;  5CR0 A;  3JPQ A;  1SL1 A;  9ICT A;  4ICA A;  3CNH A;  4ED8 A;  2KP7 A;  2BDU A;  2HW3 A;  4KX5 A;  2W7P A;  3GU3 A;  2WHE A;  2DL0 A;  4YXJ A;  2J6S A;  1X6J A;  2E1E A;  5J8Y C;  2WFA A;  3C23 A;  3A0B U;  4NXZ A;  9ICI A;  9ICG A;  4C4S A;  3TAR A;  5BOM A;  4DSL A;  1QLN A;  1IM4 A;  2ES6 A;  2UVR A;  5AK4 A;  3H4B A;  4FBU A;  1XNS A;  3WK5 A;  4RNN A;  3KZI U;  2HOF A;  4O3P A;  1NK6 A;  5J2E A;  4F2R A;  3IHQ B;  8ICJ A;  3IP4 B;  2DWQ A;  1KRP A;  4NJ8 A;  3AU6 A;  2W9M A;  2IA6 A;  1DGJ A;  4YR3 A;  3Q8M A;  1Z1V A;  3NAS A;  4R64 A;  1TAU A;  4C7Y A;  1J2M A;  3AQE A;  3FAH A;  1S0M A;  5KFI A;  2R8J A;  9ICX A;  5DB8 A;  3H7I A;  2W9C A;  4UB1 A;  2XIC A;  4DOB A;  1Q46 A;  2HBL A;  4PZN A;  4MHV A;  1WCN A;  7ICU A;  4KIT B;  2RRD A;  3RJF A;  3GIJ A;  3D2N A;  4YMO A;  5IIO A;  2KD1 A;  2W9B A;  1PK3 A;  5ALZ A;  1SV0 A;  1TFR A;  4P0Q B;  3HJE A;  2XY6 A;  1ZQH A;  3QNM A;  3KFU F;  5ALO A;  2PKE A;  9ICM A;  5JU5 A;  2AH5 A;  2H3Q A;  4ECS A;  4DOC A;  2WF5 A;  1RDF A;  3CYM A;  1D9D A;  2Y1I A;  2FLN A;  5KTQ A;  2XY7 A;  1NJY A;  1NK8 A;  2ZUC A;  3F2D A;  4XUS A;  1QQ6 A;  2G09 A;  2C2R A;  1MA7 A;  4G3I A;  1F0M A;  1KDH A;  2GWS A;  2KV2 A;  7ICQ A;  2CN1 A;  2W9C B;  4QZH A;  3RBE A;  3SEI A;  1ZQM A;  4YG2 A;  4ECY A;  5J2G A;  2W11 A;  4WJ3 B;  3V7L A;  7ICF A;  1QSL A;  1NZB A;  3ISC A;  2KKV A;  5JUM A;  4EEK A;  4P4M A;  2WAQ F;  3C5F A;  1ZQF A;  5AM4 A;  4EYI B;  5J0T A;  3J81 j;  2BQ3 A;  5EE0 A;  2XO7 A;  3RR7 A;  3EPI A;  4I2F A;  3N7R C;  4QWD A;  3MDA A;  3ZDE A;  3SAH A;  3QZ8 A;  3QUQ A;  5KFG A;  2I5H A;  3SI8 A;  2MUT A;  3ORY A;  3KKA C;  3MR6 A;  4KLD A;  3NVZ A;  2HMX A;  1T94 A;  9ICN A;  3MAB A;  3RF9 A;  3V6H A;  9ICE A;  5AK6 A;  5KNI A;  3PW2 A;  9ICO A;  3H0R B;  4YMN A;  2FJ6 A;  5J0Q A;  3RB6 A;  4RQ7 A;  3WKC A;  1JUD A;  3ZD9 A;  1RXV A;  5DBB A;  2D6F C;  5ALG A;  4XA5 A;  5J2J A;  5AKY A;  3KHH A;  4DQI A;  5B5E U;  4QJF B;  1ZQT A;  2AQ0 A;  3HX0 A;  2NV3 A;  4FZL A;  4ED7 A;  4ELV A;  2ZIX A;  1VDV A;  1Q3V A;  4DL7 A;  2IOH A;  4MFF A;  2KK0 A;  1CUK A;  3V6J A;  3SYZ A;  1JN3 A;  2ASL A;  5GTH U;  3JPN A;  4J03 A;  4DFK A;  3OPX A;  3RH5 A;  3M9O B;  4Q43 A;  3QU5 A;  4MF2 A;  5ALN A;  3H8M A;  9ICA A;  3FDS A;  3SR6 A;  1A77 A;  2W8L A;  5ALT A;  1N5X A;  2Y0S F;  2JRZ A;  2MUT B;  3H8S A;  2BZF A;  1HJP A;  4Y2X A;  3JPR A;  3RJE A;  2H3Z A;  1KBU A;  4BXO B;  3RJJ A;  3QUB A;  1N56 A;  4UAT A;  2W7O A;  5ALK A;  1SXE A;  7ICT A;  5AKJ A;  4NY8 A;  3QEB Z;  2XGQ A;  3NUQ A;  4J9Q A;  5KL8 B;  1Z4N A;  8ICI A;  2M9N A;  2AQ4 A;  3KHR A;  4FBT A;  2BKE A;  2JEI A;  5HP4 A;  4RU9 A;  2ZIX B;  4BWJ A;  3RB3 A;  4DQS A;  4M9G A;  5KL1 B;  2E8P A;  4RPZ A;  3WK8 A;  4QZB A;  5DB9 A;  2A1A A;  2E8M A;  4CF3 A;  3F53 A;  3CW2 C;  3UXN A;  4GXK A;  2QB1 A;  1COO A;  3TKA A;  4UAW A;  2EDU A;  5DQH A;  1OXJ A;  2FLP A;  2KVS A;  1J97 A;  4RUC A;  3MR3 A;  3PO5 A;  1WCL A;  2ZUB A;  4PH5 A;  4NLZ A;  5KT6 A;  1JMS A;  5KFE A;  4IRC A;  3C2L A;  4M9H A;  4IQV A;  3WK9 A;  4DLG A;  3NRW A;  3V7J A;  4UAV A;  3H8J A;  2AGO A;  4OJ5 A;  5AIA A;  4DL6 A;  4KLJ A;  2CXY A;  2OHF A;  4F4Z A;  5C0Y A;  3SZ2 A;  4LVS A;  1OUQ A;  4O3Q A;  3UMB A;  1BPX A;  2JHD A;  4EX7 A;  2YMP A;  5KFH A;  4IRK A;  2W43 A;  5KFD A;  2K4H A;  1N5W A;  4RNM A;  3M8S A;  4M47 A;  4NLN A;  3ZDC A;  4UBB A;  3M6Z A;  2ASD A;  3QU2 A;  3PW4 A;  1K1Q A;  1V85 A;  3UPQ A;  2KIC A;  1BPY A;  4GC7 A;  3THV A;  1XS9 D;  2LM1 A;  3M8R A;  5KG6 A;  1L7N A;  3PX4 A;  1PK1 A;  2E1F A;  3EW9 A;  3MBY A;  4JMU A;  3F2C A;  3RH6 A;  2HHT A;  3VCB A;  4NM2 A;  4UAU A;  5IIN A;  2HHX A;  2ZIV B;  5J2H A;  2G08 A;  1C20 A;  1NJZ A;  8ICV A;  2DPI A;  2QLT A;  4UB3 A;  4E0D A;  4PL1 A;  1X40 A;  4RQ0 A;  2WF8 A;  1QH9 A;  3JPO A; 
#chains in the Genus database with same CATH homology
 3A0H U;  5H2F U;  5E79 U;  5B5E U;  3WU2 U;  4UB8 U;  5GTI U;  5TIS U;  5KAI U;  4PJ0 U;  2DUY A;  3KZI U;  2AXT U;  4UB6 U;  1S5L U;  5KAF U;  4IL6 U;  5B66 U;  5GTH U;  3A0B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...