5B5EU

Crystal structure analysis of photosystem ii complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b5eU01
5TISU 3A0BU 5GTIU 3A0HU 4UB8U 3WU2U 5H2FU 5KAIU 4IL6U 4UB6U 5B5EU 5GTHU 2AXTU 2DUYA 5KAFU 5E79U 3KZIU 1S5LU 5B66U 4PJ0U
chains in the Genus database with same CATH superfamily
3JPPA 2YMLA 5IIOA 3QXGA 4Y2JA 5J8YA 5DBBA 4RZRA 4R8UA 4JV1A 2KMDA 4F2RA 1PVPA 3NUQA 3C2MA 2CPRA 2F1HA 1F44A 4I2HA 1BPEA 4KN7A 3ZDDA 2ZIVB 3WK9A 5AM4A 2F8KA 1CRXA 9ICTA 4UB6U 1SZPA 3I28A 5J2HA 2WFAA 4KLOA 4IL6U 4OJ5A 1RG6A 1UA0A 2K4EA 4ED0A 2Y1IA 4F5NA 5HR7A 3L3FX 4QW9A 3K1ZA 4QWAA 3TI0A 4BWJA 1T7PA 1V85A 2KVSA 4UB1A 3Q8LA 1TAQA 2DBYA 3V6KA 1N5WA 4QZ8A 4DLEA 3L4PA 5DB7A 4GXIA 1O08A 5AI8A 3IG8A 4F5QA 3PR4A 4F5OA 2W04A 1NKBA 5AKYA 4ECVA 1NJXA 1A0PA 4M6WB 3KOOA 2RDIA 4F4YA 1IIPA 2G0AA 5ALZA 3V7JA 4DL3A 2KK0A 1BVSA 1KTQA 1NJWA 4OJPA 5AHXA 2XO7A 3QX7A 1L6NA 1N62A 3MGVA 3ETLA 3QE9Y 2J6UA 4RUCA 1P7DA 3G6XA 1PK1B 4B6JA 4RPYA 3ETRA 3TARA 4F72A 2AHOB 4O5EA 4UAZA 4GXKA 4XA5A 4TUQA 2JRZA 4KLHA 3FM9A 2LYBA 3UPQA 4M9HA 3T5HA 1S0VA 1S77D 5ALKA 4RNMA 1JXEA 3QYPA 4UB2A 1BPXA 4DOAA 2CRXA 1ZRMA 4QWBA 5AK4A 5KG0A 2ZUDA 5ALRA 2HHWA 5D49A 2W9BB 1JUDA 8ICBA 2HHSA 3A0BU 3PO4A 2JH7A 1B22A 4O3QA 9ICKA 2JZBB 7ICNA 3ZD8A 2ZIWB 2HVHA 4IS7A 3BQ0A 1Z4NA 3Q8PB 1TVAA 1JI7A 2QB1A 4MEYA 4J9SA 1JMSA 3VCBA 3UM9A 5EWGA 1QSYA 3PSPA 4R66A 7ICTA 2PI4A 2D8CA 2ATLA 4DQRA 3QUQA 2F8LA 5DBCA 3G6VA 3EYZA 4I2JA 4OO1J 2WF6A 1ZQFA 3SAFA 1ZD3A 3PY8A 4F93B 4B9MA 2Q4TA 3M9OB 8ICSA 1TK8A 4IR1A 4FBUA 3ZDBA 4RQ2A 2KP7A 5BPCA 4ECTA 1ZQSA 4LZGA 4U6PA 5J0XA 1L8OA 2AGQA 4M6WA 1TK5A 2HCFA 2KZZA 5KFKA 3ONNA 7ICKA 3NTUA 4F92B 1KEJA 2YY6A 2BGWA 3JPRA 1HIWA 5KG5A 4R63A 4P4OA 2JEGA 1DRGA 3EWAA 1JIHA 4J9PA 1ZQGA 5J2CA 4I2BA 1QLNA 4KLSA 1L5UA 3OPXA 3QZ8A 4YXJA 3OSPA 3TADC 1X9MA 4RPZA 4DL7A 3DDHA 1B43A 5CR0A 1RQLA 2EAPA 1NK5A 4DL4A 4JWNA 3THVA 3HKZC 1B0XA 4CF4A 1T8EA 1D9DA 3ZD9A 2H3ZA 9ICCA 4FFDA 2BPCA 3ICXA 4XRHA 4BX9C 5KFYA 1L3UA 4YN4A 2FLLA 3PW2A 1FEZA 2OYYA 5HR6A 1IM4A 4Z6FA 1VJ5A 1ZOLA 2LI6A 4NJ8A 1RM6C 4GC6A 5C5JA 3PZPA 1V9PA 5D46A 8ICWA 2RHFA 4YP3A 5KT5A 1KL9A 1TV9A 9ICLA 5AK3A 4IRKA 2ZTEA 4CDGA 7ICLA 1L7OA 9ICWA 2J6TA 3IN5A 9ICMA 4KLMA 3JPSA 5DDMA 1N60A 4EELA 7ICHA 4O0IA 2P6RA 2HBMA 1RXVA 4BGDA 4PHAA 2XIDA 5DQHA 2BDPA 2HW3A 1WG8A 2K8AA 2WAQC 2DFLA 2MA1A 3Q8QB 4P4MA 3EW9A 5ALHA 4MFFA 4DSIA 1SXEA 2PFOA 2C2DA 4KLQA 3NRWA 1A76A 2YMMA 4YD2A 1U48A 4UATA 3NVYA 5KFSA 4Y2RA 1ZQEA 5DQGA 1X66A 2JH1A 3M8SA 5J2BA 4M9GA 3ISDA 4O5KA 3WK4A 3WK6A 5F9LA 2G06A 9ICJA 1F5SA 3SEIA 2XGQA 3HKZF 4DFJA 2J6SA 1XSLA 1ECWA 2EAOA 4KTQA 7ICMA 2XGPA 3U26A 4CF3A 1ED1A 4PL1A 5AM0A 4EBDA 3PX4A 4F4WA 2D6FC 4XQ8A 2QB0A 3I76A 3Q8SB 1QCKA 3MFIA 7ICPA 4NLKA 4ACOA 4NY8A 5ALPA 5DGAA 1KKXA 1X9XA 2BQUA 3GIMA 3RJHA 5FP0A 1ZQCA 3AU6A 4MFCA 5JU5A 5ALJA 1T3QA 4TUPA 4DWIA 1F0MA 9ICPA 1S76D 2WF9A 2HOQA 1EXNA 2R8HA 4NLNA 5DG9A 2W03A 5ALYA 1KRPA 4B9SA 4FS2A 1NJYA 2G5HB 4NLGA 1S0OA 3RH5A 1NZPA 4F4KA 8ICNA 3QU2A 3ALRA 1SWVA 3UXNA 3UXPA 1ZQWA 5L1IA 1BGXT 3KKAA 2Y0SF 1YZ6A 1BPZA 3BZCA 1ZQMA 2B21A 4EZ6A 4OCZA 3H0RB 2JEFA 4CE6A 4MF2A 4M9LA 3J81j 2F3NA 4YCXA 2FLPA 4DLGA 4TQSA 8ICPA 2NRXA 5ALIA 3RR7A 2FPLA 3IDWA 1JRPA 5AKKA 1KN5A 1QTMA 1WYGA 4RNOA 8ICUA 4CNQA 3GU3A 1XNSA 5IIIA 5AM2A 5ALQA 2W11A 2K60A 2DQNB 3H8WA 5KFJA 2CXYA 4QZBA 4F71A 2AQ4A 4JWMA 3DEEA 5AK6A 4ICAA 2NRVA 1C7YA 2E8OA 5AKIA 1Z19A 4I2FA 5CEHA 4O3OA 1KW4A 1COOA 4KX3A 3RAXA 4ECRA 3MGHA 4KN4A 4EX6A 3RBEA 3WK7A 2R8GA 4EZ9A 4DQQA 1N5XA 4ELVA 1MN8A 3PW0A 2FE9A 2W43A 5EE9A 3RJJA 2NV3A 3QUTA 3LWLA 4ZOHC 2PFNA 1SB3C 8ICQA 2I5HA 3OHAA 4RQ8A 3GV7B 2C2EA 2ZXHA 5F9NA 2H5XA 4O5CA 3HPOA 1PVQA 4ECXA 3Q8MA 4RQNA 3V72A 4JUZA 5AK5A 5KTQA 5KFAA 3PVXA 2FDRA 4DQSA 3NVZA 4ZH4A 3MFHA 2KD1A 3GIKA 2ZIXB 3TQ1A 2YQEA 3ORYA 4F3OA 4C80A 1UT8A 4NWIA 3WKBA 4RQ1A 4UB5A 5ALNA 7ICJA 1DXSA 2OWOA 2AJQA 5J2DA 2ODGA 3PR5B 3QZ7A 2EH9A 1XO1A 4RPXA 1SGGA 4J9MA 4J03A 2JMGA 3RB0A 4UASA 3SR6A 2EANA 2W9CA 5ALFA 4Q43A 2JEIA 5KFOA 1Z00B 4I29A 4M9JA 3ZDEA 2E8NA 2H3QA 2ZG6A 1LV5A 4DFDA 4F4XA 4QWDA 4MHVA 1Y88A 2GH1A 3UQ2A 1DOQA 5DG7A 5KFRA 3UMBA 3WKAA 5GTHU 1XSPA 2XY6A 3H40A 5AM3A 3RB3A 1ZQRA 4BJQA 5HHIA 3EZ5A 4AP9A 1TKDA 2W7OA 2K4HA 1S5LU 1OW5A 4GLXA 4RQMA 1LKYB 3IG5A 3QU9A 4M47A 1NJZA 5AKJA 4HYKA 4BXOA 2BCQA 2UVRA 3AEVA 5L1MA 4QZIA 3QEAZ 4PL2A 3T5JA 2QKQA 4DL5A 1MQ3A 1LVHA 4IRCA 4YG2A 1ZYQA 1U9LA 1HJPA 1T3NA 3Q8RB 1A77A 2WF7A 4YR2A 1HEKA 2VJ5A 4NV0A 3MR3A 2DKXA 3PW4A 4AYBC 3AU2A 8ICLA 3RB4A 4GXJA 2DUYA 2NRTA 3QUBA 2I9GA 2WF5A 2HBJA 2KJ9A 2IOHA 4PZOA 4B9LA 2W9AA 4Q8FA 3PMLA 1PZNA 4QIWC 3JPNA 2K8BB 3F53A 4ECQA 1ZJMA 2ZTDA 2L5YA 5KT3A 1KFDA 3KTQA 4HAIA 4B9TA 1NZBA 3RJEA 2XC9A 3H4BA 3BJYA 3UMCA 1C20A 2NO5A 1X2IA 2WAQF 1A6SA 5ALLA 1ZQVA 4QZ9A 1CI4A 3HW8A 4J9LA 1NK7A 3K4GA 4Y2YA 4DO9A 4O3PA 5KAIU 2KJ8A 2PFQA 2HI0A 1KQQA 4J9KA 5CWRA 4UB8U 2ALZA 4KLDA 4DQIA 4DL2A 2LM1A 1V38A 4QZGA 4DOBA 5J0SA 1DK3A 3BS7A 4MF8A 4K4HA 4I27A 8ICGA 4FBTA 1BNPA 2KV2A 1SKWA 1ZQXA 4ED2A 4NL9A 5HNKA 5KFUA 1Q8KA 1YZ7A 8ICCA 2IHMA 2A1JB 2GLEA 3NRZA 4ELUA 3UMGA 5L1KA 3RR8A 3NVWA 8ICIA 5J0QA 1X40A 2LPEA 3E2EA 1UPHA 1ZETA 3BQ1A 1NI3A 2FPMA 2E5SA 3M7DA 1SL0A 2VIXA 1S97A 4PJ0U 4F5RA 4DFKA 3T5KA 5JRTA 2V4RA 1HUZA 5KG3A 5ALVA 1BNOA 4UBCA 4NM1A 4C4TA 2W3SA 1X9SA 1N48A 4Y2QA 4PHEA 4QIWF 2VA3A 2M0NA 3IHQB 3CRXA 2KHQA 2ZIUA 5KG6A 1DGSA 4Y2SA 1ZQJA 4UB3A 3IM1A 1LKYA 5EE0A 1UQVA 3PW7A 1L7MA 3RF9A 5DGBA 5IINA 4US8A 3PNCA 7ICFA 3KD3A 3GV8B 4RQ7A 5D4BA 3QUCA 4YMMA 4Z6DA 3GFKB 3NGDA 2PXIA 1WUDA 1OXJA 3WU2U 2F77X 5AM1A 5B5EU 2VANA 1N2XA 4DS4A 4EYIB 1JXLA 1S8OA 1SV0A 1B4FA 9ICRA 2HOFA 4UARA 1T4GA 2B6GA 4C7YA 2GWSA 4C8NA 2MUTB 1LB2B 5DDYA 3TAPA 2K8CB 2G09A 3KBBA 1FO4A 3G6YA 3ED5A 1Q3UA 1IG6A 4PGQA 3OGUA 1NNLA 3O0FA 4KLIA 2G08A 4BUGA 5DKWA 4F2SA 2XY7A 1PVRA 1SZHA 1J2NA 8ICAA 2Q0ZX 1RXWA 4NLCA 4DS5A 2GOLA 5F3XB 2ESEA 3H8JA 4IQTA 3C2KA 2JXJA 2OCEA 2YN4A 3A0HU 2KICA 3PMNA 2Y0SC 2K4PA 5J0WA 2I6XA 4C8LA 2AXTU 3V7KA 4ED3A 3N97B 2NO4A 4ECSA 4Y2TA 2YMPA 3RFAA 2D3DA 1FFVA 5KG4A 3ISBA 5G5GA 4O3NA 5ALDA 3I1YA 4ED8A 4QZAA 2HMXA 1RDFA 7ICOA 3MR2A 2NYVA 2ZIWA 5DG8A 4C8MA 2YTUA 2OH2A 1MSWD 8ICOA 4TQRA 1J2MA 2H3IA 1CUKA 4J9QA 4R8UB 3KKAC 1IV8A 2HSZA 3M6KA 4DF8A 5TZVA 3LVVA 3N7SC 4KMUA 3CW2C 4P2HA 1ZQUA 5KFZA 2ZTCA 1L3VA 5KFCA 2C22A 2LMRA 1S0MA 3DV9A 2V9WA 2UVWA 4M0AA 3QU5A 4NLZA 2MAXA 1S0NA 1NK0A 4KLFA 2IOFK 3EPGA 1U49A 4RU9A 3HWTA 5ALXA 2KKVA 1QSLA 2BQRA 3KHRA 1IXRA 1XSNA 2DGZA 5J0UA 1ZD2P 1ZQOA 3MGIA 4B9VA 4QW8A 3ISCA 5HMLA 5DQIA 2G07A 2HBKA 1ZQKA 3RJKA 1HUOA 1Z1BA 2QB0B 1U45A 5J0OA 4FO6A 8ICFA 2ZIUB 2FMQA 2HBLA 9ICUA 5KNIA 5G5HA 2E1EA 3QU7A 1J97A 4CCHA 3T5LA 1UHUA 2EZXA 1ZQAA 5L1LA 1K1SA 3PX0A 4UAYA 5KFDA 2Y9TA 5KFFA 1D8YA 3Q8KA 9ICIA 2KNJA 2HHVA 1QH9A 4UAUA 3RJGA 3PSTA 8ICZA 3BDPA 4P4PA 4RQ6A 5J2GA 4WJ3B 1AQ6A 4F91B 3CNHA 1D8BA 3F2BA 4R64A 2ISPA 2R8KA 1ZXIA 3BS5B 5CJ7A 3H0MB 3WKCA 5AKZA 4P0QB 4PPXA 1ZQNA 9ICBA 4FZNA 5AI9A 5AM5A 1AROP 3IP4B 3LK9A 9ICXA 3RB6A 3PSFA 3QEBZ 1WWUA 1VDVA 7ICUA 5J0PA 2W7PA 4QWEA 3H8SA 5AKHA 5ALOA 1MQ2A 8ICMA 4UW9A 5AI5A 3LVWA 3B0YA 3PV8A 3C28A 3V6HA 3IRUA 2AGPA 2E3TA 5J2FA 9ICAA 2A1JA 1Z00A 5AI0A 3C21A 2R8IA 4Y2PA 1XWLA 4YVZA 5ALTA 2WHEA 4ECZA 4IC9A 2XCAA 4UBBA 2KN7A 2G5IB 2HOIA 5J0RA 5JUMA 1ZJNA 1RYRA 4KLLA 2F2AB 2KTQA 3SMVA 5DB6A 1ZQLA 2E8PA 5AKGA 2LHTA 2KE7A 4EEKA 2F1IA 3D2NA 5AKXA 4RT3A 7ICRA 2W8LA 5L9XA 4OJ6A 2RP5A 3RRHA 1RQNA 4B9UA 2BCRA 2E8MA 3JPQA 2XVTA 7ICGA 2ASLA 4ECUA 5A0LA 2O6KA 5KFHA 4O9MA 7ICVA 2VA2A 4RQ5A 8ICKA 3N7PD 1ZQIA 9ICFA 1T94A 1FFUA 3AQEA 5KFMA 3E0FA 5CB1A 2BKEA 4TURA 1KLNA 3WKEA 2DWQA 3OJSA 4IQWA 1X6JA 5KFLA 1SV0C 3FYHA 3JPOA 4P0PA 7ICEA 2RLTA 4DF4A 3AUOA 1L3TA 1Q3VA 2LYHA 5KT7A 2C28A 1L7PA 4EENA 3TADA 2GO7A 1COKA 1NK6A 1ZQTA 1CEZA 3TACB 3M1YA 8ICEA 2FLNA 2CN1A 5EE3A 2XCPA 2HHXA 2LKYA 1RYUA 1VLBA 4J9NA 1ZQDA 3M8RA 4IQUA 9ICSA 1Z1VA 4RQ4A 4LJXA 1QQ6A 3V7LA 4M9NA 5KG1A 2PMZC 3K75D 1Z3EB 2OM6A 9ICVA 5C0YA 5JTIA 4M04A 4DSEA 2N1RA 1PK3A 1K5OA 1UT5A 1NOMA 3R9KA 1NK9A 4QZFA 5IILA 2Y9UA 5KFQA 1SKRA 4OJOA 4UAWA 5KL8B 3F5AA 3WK5A 2NRZA 3AL0B 4NM2A 4EEYA 3UXOA 2IMWP 8ICTA 5CP2A 3UQ0A 5J2JA 2WF8A 1S10A 5KFWA 1K1QA 1PK1A 1XO0A 3HX0A 2BQ3A 4X5VA 1KSPA 4I2GA 2P6UA 5ALGA 2JGAA 2Z7JA 3C1YA 5J2EA 1GO3F 4CRXA 2ZUBA 4YQWA 5EWEA 1BPYA 1RYSA 2BCVA 3SENA 5KFVA 1TAUA 2DPJA 1N61A 3RH4A 3KZIU 1BPBA 2ZIXA 3EUB2 4QWCA 3LDAA 4USAA 5T14A 2KIWA 2HDOA 2BDUA 2PMZF 3NASA 1KBUA 4DSLA 5J8YC 1N56A 1H38A 3E58A 3M6ZA 2ASJA 3WK8A 5J0TA 2KZ3A 5DB8A 3N7RC 4YR3A 3C23A 1NKEA 4Q8EA 5KFNA 1SWWA 5E79U 1SIJA 3MBYA 2W54A 5KFGA 3F2DA 2W55A 4EBCA 3LWMA 3C1ZA 4RT2A 3LYSA 2ISOA 3F5EA 5KG2A 2LM4A 5K4LA 3GQCA 2HHTA 2VKQA 3SV4A 4M2YA 1URJA 2AU0A 2E1FA 4KLJA 4DSJA 7ICSA 3JPTA 2QARA 5KFXA 2K4IA 8ICVA 3B0XA 3NS1A 9ICNA 2IA6A 2KEYA 1SKSA 4P0PB 3MR6A 3HT3A 1O03A 3D6JA 8ICRA 2KKPA 4KLTA 4DSKA 4GFJA 1N63A 4FZMA 3VC8A 5ALUA 3C5GA 4ED7A 3PSIA 3PX6A 4JB3A 3RBDA 2RRDA 3C5FA 5DLFA 1FIQA 2FJ6A 2W9BA 1XS9D 2FMSA 3N4MB 2EAMA 5DLGA 3KZXA 3TANA 2KVCA 2VJ4A 2W8KA 2W9MA 3SZ2A 3SD7A 3SQIA 3TAQA 5CRXA 4NXZA 3MDAA 5J2IA 4E0DA 4KITB 4PGXA 3SV3A 2MUTA 4Z6EA 8ICXA 2P66A 3SI8A 4EX7A 4KLUA 4KX5A 4US9A 5DBAA 4PGYA 4G9BA 2BR0A 2ES6A 1TFRA 2AGOA 3D2QA 3HP6A 9ICQA 2F44A 7ICIA 5KAFU 2ZJ5A 2WTFA 4F5PA 2KOBA 4MFAA 3KHLA 3CP8A 5J0YA 2Y1JA 1XC9A 5ALSA 2LYAA 4IR9A 5KL1B 2YB4A 3T79A 9ICGA 2I1QA 2KHVA 4LVSA 2NRWA 4MEXA 4F8RA 2K89A 3AN1A 4QZEA 2DF4B 4LZDA 3RH6A 5KFEA 2KSOA 1JALA 4Q45A 4B9NA 3OHBA 2EZYA 2UVVA 3SAHA 3BS5A 2DKZA 3HRDD 1ZQZA 4Y2UA 5CA7A 4UAVA 4RQ0A 3FDSA 1KFTA 2F76X 2OHFA 4BWMA 5KG7A 5IIMA 2C2RA 1D8LA 3IV6A 1JN3A 5L1JA 1OUQA 4C8OA 1PUZA 2A1AA 3RAQA 1L3SA 5KFTA 4YFKA 3RTVA 3RJIA 1NKCA 1JX4A 2KFZA 3TFSA 2H3VA 1U47A 1X9WA 5ALWA 3M9NB 3B9JA 2OEHA 2ZIVA 4ED6A 2FPKA 5J2AA 4KLEA 1YT3A 5BOLA 1ZD4A 1RPLA 5KFPA 3GDXA 5DB9A 4CGZA 4PHDA 1D9FA 2KJ5A 1SL1A 2BCUA 4ELTA 2HHUA 4BDPA 1ZD5A 4DFPA 3CYMA 8ICYA 1SV4A 3FAHA 4QZHA 1M6YA 1MC8A 5AKEA 3MR5A 2XICA 4KMOB 4JV2A 5AIBA 4QZDA 2PFPA 2A19A 3PW5A 1S9FA 2KFNA 5TISU 4I2IA 1Z4OA 4FZLA 2MSNA 2B0CA 4I28A 1Q46A 3AM9A 3SAGA 2ZXIA 2ZJAA 5AICA 4RUAA 2UVUA 1RZTA 5KFIA 4C0ZA 2QARB 4PH5A 2W3RA 2WB1F 5AI4A 2XY5A 4YMOA 4JK1A 4IQVA 3MDCA 2XI9A 3K1RB 2RDJA 5GTIU 4BXOB 2QLTA 1U4BA 4GC7A 3H8MA 4DFMA 1TAMA 3N28A 4UB4A 4C7ZA 2JEJA 3ZDCA 1ZQHA 2YX8A 4F50A 1WCNA 1QQ5A 5KFBA 1ZQPA 4O3SA 2YB1A 2IOFA 2YMQA 4ECWA 2DPIA 4J9OA 2ASDA 3L5KA 5IIKA 4C4RA 2BPGA 3BZKA 4O3RA 1XU4A 2FI1A 4Z6CA 4EBEA 5AI6A 3ZI4A 1X42A 1ZQBA 2W9CB 4ECYA 2JHDA 3H4DA 4AYBF 4I2EA 3KHGA 5AIAA 5B66U 3M9MB 4YD1A 4K4IA 4R65A 3GILA 1KFSA 3C2LA 2H3FA 4GIBA 5EOZA 3GV5B 1KDHA 4YR0A 4I2AA 3TKAA 2F1JA 4PZNA 8ICJA 2AQ0A 4Y2XA 2BCSA 2R8JA 1DGJA 4OJLA 1ZQYA 2V4QA 3RRGA 2PI5A 2A3VA 4YXMA 1ZRNA 2JZBA 9ICOA 2MU2A 4RQ3A 3OJUA 3V6JA 2WB1C 5J29A 4K4GA 9ICEA 1BPDA 4DL6A 2EQYA 5HP4A 3AMZA 4FS1A 9ICHA 2IHNA 2PKEA 4YMNA 4PHPA 4I2DA 2AH5A 4QJFB 3MC1A 4NLBA 3KHHA 2HHQA 1ZQQA 1NK4A 1JROA 1QSSA 4A8EA 1UA1A 4C8KA 1V97A 5CHGA 4QZCA 2MRLA 1X6IA 1UCVA 4Q44A 2HVIA 4Y2VA 4DCCA 4DQPA 5EE1A 3TFRA 3S6JA 2RQ5A 2BHNA 4P0QA 5H2FU 2KZMA 3KFUF 1TE2A 2KIVA 1ZQ1C 4ED1A 2KSOB 7ICQA 3FC4A 4JV0A 5BOMA 2BPFA 4U7CA 1DK2A 4NL9C 3H7IA 3BQ7A 2JV3A 3GZFA 4I2CA 4O3MA 4FE3A 3QNMA 2FMPA 3F2CA 3BQ2A 5IIJA 1L7NA 3T3FA 4KLGA 1MA7A 2EZZA 2DL0A 3GIIA 3GIJA 1NK8A 4DSFA 3EPIA 4F4ZA 4OD0A 2LBOA 3QU4A 3C29A 2M9NA 4DEZA 4J9RA 1WCLA 2P35A 4CF5A 2EDUA 1WWVA 3OTQA 4C4SA 5KT6A 1TK0A 2OXOA 3SYZA 4QNLA 1SXDA 1QQ7A 5KT4A 3MABA 5J2KA 8ICHA 5KT2A 5EWFA 2VA8A 2ZJ8A 5ALMA 1SL2A 3HJEA 3RJFA 2KG5A 5AKLA 2ZUCA 1L8LA 3PO5A 5HMMA 3H0LB 3D2SA 4IRDA 3OSNA 3WKDA 4RNNA 4UQGA 3NVVA 5HHHA 3HILA 4EYHB 5ALEA 4XUSA 3ZDAA 2BZFA 4G3IA 4TUSA 3BQTA 2IBKA 2R18A 4DOCA 3AQFA 4JMUA 2JR5A
chains in the Genus database with same CATH topology
5TISU 3A0BU 5GTIU 3A0HU 4UB8U 3WU2U 5H2FU 5KAIU 4IL6U 4UB6U 5B5EU 5GTHU 2AXTU 2DUYA 5KAFU 5E79U 3KZIU 1S5LU 5B66U 4PJ0U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS U;  3A0B U;  5GTI U;  3A0H U;  4UB8 U;  3WU2 U;  5H2F U;  5KAI U;  4IL6 U;  4UB6 U;  5B5E U;  5GTH U;  2AXT U;  2DUY A;  5KAF U;  5E79 U;  3KZI U;  1S5L U;  5B66 U;  4PJ0 U; 
#chains in the Genus database with same CATH topology
 3JPP A;  2YML A;  5IIO A;  3QXG A;  4Y2J A;  5J8Y A;  5DBB A;  4RZR A;  4R8U A;  4JV1 A;  2KMD A;  4F2R A;  1PVP A;  3NUQ A;  3C2M A;  2CPR A;  2F1H A;  1F44 A;  4I2H A;  1BPE A;  4KN7 A;  3ZDD A;  2ZIV B;  3WK9 A;  5AM4 A;  2F8K A;  1CRX A;  9ICT A;  4UB6 U;  1SZP A;  3I28 A;  5J2H A;  2WFA A;  4KLO A;  4IL6 U;  4OJ5 A;  1RG6 A;  1UA0 A;  2K4E A;  4ED0 A;  2Y1I A;  4F5N A;  5HR7 A;  3L3F X;  4QW9 A;  3K1Z A;  4QWA A;  3TI0 A;  4BWJ A;  1T7P A;  1V85 A;  2KVS A;  4UB1 A;  3Q8L A;  1TAQ A;  2DBY A;  3V6K A;  1N5W A;  4QZ8 A;  4DLE A;  3L4P A;  5DB7 A;  4GXI A;  1O08 A;  5AI8 A;  3IG8 A;  4F5Q A;  3PR4 A;  4F5O A;  2W04 A;  1NKB A;  5AKY A;  4ECV A;  1NJX A;  1A0P A;  4M6W B;  3KOO A;  2RDI A;  4F4Y A;  1IIP A;  2G0A A;  5ALZ A;  3V7J A;  4DL3 A;  2KK0 A;  1BVS A;  1KTQ A;  1NJW A;  4OJP A;  5AHX A;  2XO7 A;  3QX7 A;  1L6N A;  1N62 A;  3MGV A;  3ETL A;  3QE9 Y;  2J6U A;  4RUC A;  1P7D A;  3G6X A;  1PK1 B;  4B6J A;  4RPY A;  3ETR A;  3TAR A;  4F72 A;  2AHO B;  4O5E A;  4UAZ A;  4GXK A;  4XA5 A;  4TUQ A;  2JRZ A;  4KLH A;  3FM9 A;  2LYB A;  3UPQ A;  4M9H A;  3T5H A;  1S0V A;  1S77 D;  5ALK A;  4RNM A;  1JXE A;  3QYP A;  4UB2 A;  1BPX A;  4DOA A;  2CRX A;  1ZRM A;  4QWB A;  5AK4 A;  5KG0 A;  2ZUD A;  5ALR A;  2HHW A;  5D49 A;  2W9B B;  1JUD A;  8ICB A;  2HHS A;  3A0B U;  3PO4 A;  2JH7 A;  1B22 A;  4O3Q A;  9ICK A;  2JZB B;  7ICN A;  3ZD8 A;  2ZIW B;  2HVH A;  4IS7 A;  3BQ0 A;  1Z4N A;  3Q8P B;  1TVA A;  1JI7 A;  2QB1 A;  4MEY A;  4J9S A;  1JMS A;  3VCB A;  3UM9 A;  5EWG A;  1QSY A;  3PSP A;  4R66 A;  7ICT A;  2PI4 A;  2D8C A;  2ATL A;  4DQR A;  3QUQ A;  2F8L A;  5DBC A;  3G6V A;  3EYZ A;  4I2J A;  4OO1 J;  2WF6 A;  1ZQF A;  3SAF A;  1ZD3 A;  3PY8 A;  4F93 B;  4B9M A;  2Q4T A;  3M9O B;  8ICS A;  1TK8 A;  4IR1 A;  4FBU A;  3ZDB A;  4RQ2 A;  2KP7 A;  5BPC A;  4ECT A;  1ZQS A;  4LZG A;  4U6P A;  5J0X A;  1L8O A;  2AGQ A;  4M6W A;  1TK5 A;  2HCF A;  2KZZ A;  5KFK A;  3ONN A;  7ICK A;  3NTU A;  4F92 B;  1KEJ A;  2YY6 A;  2BGW A;  3JPR A;  1HIW A;  5KG5 A;  4R63 A;  4P4O A;  2JEG A;  1DRG A;  3EWA A;  1JIH A;  4J9P A;  1ZQG A;  5J2C A;  4I2B A;  1QLN A;  4KLS A;  1L5U A;  3OPX A;  3QZ8 A;  4YXJ A;  3OSP A;  3TAD C;  1X9M A;  4RPZ A;  4DL7 A;  3DDH A;  1B43 A;  5CR0 A;  1RQL A;  2EAP A;  1NK5 A;  4DL4 A;  4JWN A;  3THV A;  3HKZ C;  1B0X A;  4CF4 A;  1T8E A;  1D9D A;  3ZD9 A;  2H3Z A;  9ICC A;  4FFD A;  2BPC A;  3ICX A;  4XRH A;  4BX9 C;  5KFY A;  1L3U A;  4YN4 A;  2FLL A;  3PW2 A;  1FEZ A;  2OYY A;  5HR6 A;  1IM4 A;  4Z6F A;  1VJ5 A;  1ZOL A;  2LI6 A;  4NJ8 A;  1RM6 C;  4GC6 A;  5C5J A;  3PZP A;  1V9P A;  5D46 A;  8ICW A;  2RHF A;  4YP3 A;  5KT5 A;  1KL9 A;  1TV9 A;  9ICL A;  5AK3 A;  4IRK A;  2ZTE A;  4CDG A;  7ICL A;  1L7O A;  9ICW A;  2J6T A;  3IN5 A;  9ICM A;  4KLM A;  3JPS A;  5DDM A;  1N60 A;  4EEL A;  7ICH A;  4O0I A;  2P6R A;  2HBM A;  1RXV A;  4BGD A;  4PHA A;  2XID A;  5DQH A;  2BDP A;  2HW3 A;  1WG8 A;  2K8A A;  2WAQ C;  2DFL A;  2MA1 A;  3Q8Q B;  4P4M A;  3EW9 A;  5ALH A;  4MFF A;  4DSI A;  1SXE A;  2PFO A;  2C2D A;  4KLQ A;  3NRW A;  1A76 A;  2YMM A;  4YD2 A;  1U48 A;  4UAT A;  3NVY A;  5KFS A;  4Y2R A;  1ZQE A;  5DQG A;  1X66 A;  2JH1 A;  3M8S A;  5J2B A;  4M9G A;  3ISD A;  4O5K A;  3WK4 A;  3WK6 A;  5F9L A;  2G06 A;  9ICJ A;  1F5S A;  3SEI A;  2XGQ A;  3HKZ F;  4DFJ A;  2J6S A;  1XSL A;  1ECW A;  2EAO A;  4KTQ A;  7ICM A;  2XGP A;  3U26 A;  4CF3 A;  1ED1 A;  4PL1 A;  5AM0 A;  4EBD A;  3PX4 A;  4F4W A;  2D6F C;  4XQ8 A;  2QB0 A;  3I76 A;  3Q8S B;  1QCK A;  3MFI A;  7ICP A;  4NLK A;  4ACO A;  4NY8 A;  5ALP A;  5DGA A;  1KKX A;  1X9X A;  2BQU A;  3GIM A;  3RJH A;  5FP0 A;  1ZQC A;  3AU6 A;  4MFC A;  5JU5 A;  5ALJ A;  1T3Q A;  4TUP A;  4DWI A;  1F0M A;  9ICP A;  1S76 D;  2WF9 A;  2HOQ A;  1EXN A;  2R8H A;  4NLN A;  5DG9 A;  2W03 A;  5ALY A;  1KRP A;  4B9S A;  4FS2 A;  1NJY A;  2G5H B;  4NLG A;  1S0O A;  3RH5 A;  1NZP A;  4F4K A;  8ICN A;  3QU2 A;  3ALR A;  1SWV A;  3UXN A;  3UXP A;  1ZQW A;  5L1I A;  1BGX T;  3KKA A;  2Y0S F;  1YZ6 A;  1BPZ A;  3BZC A;  1ZQM A;  2B21 A;  4EZ6 A;  4OCZ A;  3H0R B;  2JEF A;  4CE6 A;  4MF2 A;  4M9L A;  3J81 j;  2F3N A;  4YCX A;  2FLP A;  4DLG A;  4TQS A;  8ICP A;  2NRX A;  5ALI A;  3RR7 A;  2FPL A;  3IDW A;  1JRP A;  5AKK A;  1KN5 A;  1QTM A;  1WYG A;  4RNO A;  8ICU A;  4CNQ A;  3GU3 A;  1XNS A;  5III A;  5AM2 A;  5ALQ A;  2W11 A;  2K60 A;  2DQN B;  3H8W A;  5KFJ A;  2CXY A;  4QZB A;  4F71 A;  2AQ4 A;  4JWM A;  3DEE A;  5AK6 A;  4ICA A;  2NRV A;  1C7Y A;  2E8O A;  5AKI A;  1Z19 A;  4I2F A;  5CEH A;  4O3O A;  1KW4 A;  1COO A;  4KX3 A;  3RAX A;  4ECR A;  3MGH A;  4KN4 A;  4EX6 A;  3RBE A;  3WK7 A;  2R8G A;  4EZ9 A;  4DQQ A;  1N5X A;  4ELV A;  1MN8 A;  3PW0 A;  2FE9 A;  2W43 A;  5EE9 A;  3RJJ A;  2NV3 A;  3QUT A;  3LWL A;  4ZOH C;  2PFN A;  1SB3 C;  8ICQ A;  2I5H A;  3OHA A;  4RQ8 A;  3GV7 B;  2C2E A;  2ZXH A;  5F9N A;  2H5X A;  4O5C A;  3HPO A;  1PVQ A;  4ECX A;  3Q8M A;  4RQN A;  3V72 A;  4JUZ A;  5AK5 A;  5KTQ A;  5KFA A;  3PVX A;  2FDR A;  4DQS A;  3NVZ A;  4ZH4 A;  3MFH A;  2KD1 A;  3GIK A;  2ZIX B;  3TQ1 A;  2YQE A;  3ORY A;  4F3O A;  4C80 A;  1UT8 A;  4NWI A;  3WKB A;  4RQ1 A;  4UB5 A;  5ALN A;  7ICJ A;  1DXS A;  2OWO A;  2AJQ A;  5J2D A;  2ODG A;  3PR5 B;  3QZ7 A;  2EH9 A;  1XO1 A;  4RPX A;  1SGG A;  4J9M A;  4J03 A;  2JMG A;  3RB0 A;  4UAS A;  3SR6 A;  2EAN A;  2W9C A;  5ALF A;  4Q43 A;  2JEI A;  5KFO A;  1Z00 B;  4I29 A;  4M9J A;  3ZDE A;  2E8N A;  2H3Q A;  2ZG6 A;  1LV5 A;  4DFD A;  4F4X A;  4QWD A;  4MHV A;  1Y88 A;  2GH1 A;  3UQ2 A;  1DOQ A;  5DG7 A;  5KFR A;  3UMB A;  3WKA A;  5GTH U;  1XSP A;  2XY6 A;  3H40 A;  5AM3 A;  3RB3 A;  1ZQR A;  4BJQ A;  5HHI A;  3EZ5 A;  4AP9 A;  1TKD A;  2W7O A;  2K4H A;  1S5L U;  1OW5 A;  4GLX A;  4RQM A;  1LKY B;  3IG5 A;  3QU9 A;  4M47 A;  1NJZ A;  5AKJ A;  4HYK A;  4BXO A;  2BCQ A;  2UVR A;  3AEV A;  5L1M A;  4QZI A;  3QEA Z;  4PL2 A;  3T5J A;  2QKQ A;  4DL5 A;  1MQ3 A;  1LVH A;  4IRC A;  4YG2 A;  1ZYQ A;  1U9L A;  1HJP A;  1T3N A;  3Q8R B;  1A77 A;  2WF7 A;  4YR2 A;  1HEK A;  2VJ5 A;  4NV0 A;  3MR3 A;  2DKX A;  3PW4 A;  4AYB C;  3AU2 A;  8ICL A;  3RB4 A;  4GXJ A;  2DUY A;  2NRT A;  3QUB A;  2I9G A;  2WF5 A;  2HBJ A;  2KJ9 A;  2IOH A;  4PZO A;  4B9L A;  2W9A A;  4Q8F A;  3PML A;  1PZN A;  4QIW C;  3JPN A;  2K8B B;  3F53 A;  4ECQ A;  1ZJM A;  2ZTD A;  2L5Y A;  5KT3 A;  1KFD A;  3KTQ A;  4HAI A;  4B9T A;  1NZB A;  3RJE A;  2XC9 A;  3H4B A;  3BJY A;  3UMC A;  1C20 A;  2NO5 A;  1X2I A;  2WAQ F;  1A6S A;  5ALL A;  1ZQV A;  4QZ9 A;  1CI4 A;  3HW8 A;  4J9L A;  1NK7 A;  3K4G A;  4Y2Y A;  4DO9 A;  4O3P A;  5KAI U;  2KJ8 A;  2PFQ A;  2HI0 A;  1KQQ A;  4J9K A;  5CWR A;  4UB8 U;  2ALZ A;  4KLD A;  4DQI A;  4DL2 A;  2LM1 A;  1V38 A;  4QZG A;  4DOB A;  5J0S A;  1DK3 A;  3BS7 A;  4MF8 A;  4K4H A;  4I27 A;  8ICG A;  4FBT A;  1BNP A;  2KV2 A;  1SKW A;  1ZQX A;  4ED2 A;  4NL9 A;  5HNK A;  5KFU A;  1Q8K A;  1YZ7 A;  8ICC A;  2IHM A;  2A1J B;  2GLE A;  3NRZ A;  4ELU A;  3UMG A;  5L1K A;  3RR8 A;  3NVW A;  8ICI A;  5J0Q A;  1X40 A;  2LPE A;  3E2E A;  1UPH A;  1ZET A;  3BQ1 A;  1NI3 A;  2FPM A;  2E5S A;  3M7D A;  1SL0 A;  2VIX A;  1S97 A;  4PJ0 U;  4F5R A;  4DFK A;  3T5K A;  5JRT A;  2V4R A;  1HUZ A;  5KG3 A;  5ALV A;  1BNO A;  4UBC A;  4NM1 A;  4C4T A;  2W3S A;  1X9S A;  1N48 A;  4Y2Q A;  4PHE A;  4QIW F;  2VA3 A;  2M0N A;  3IHQ B;  3CRX A;  2KHQ A;  2ZIU A;  5KG6 A;  1DGS A;  4Y2S A;  1ZQJ A;  4UB3 A;  3IM1 A;  1LKY A;  5EE0 A;  1UQV A;  3PW7 A;  1L7M A;  3RF9 A;  5DGB A;  5IIN A;  4US8 A;  3PNC A;  7ICF A;  3KD3 A;  3GV8 B;  4RQ7 A;  5D4B A;  3QUC A;  4YMM A;  4Z6D A;  3GFK B;  3NGD A;  2PXI A;  1WUD A;  1OXJ A;  3WU2 U;  2F77 X;  5AM1 A;  5B5E U;  2VAN A;  1N2X A;  4DS4 A;  4EYI B;  1JXL A;  1S8O A;  1SV0 A;  1B4F A;  9ICR A;  2HOF A;  4UAR A;  1T4G A;  2B6G A;  4C7Y A;  2GWS A;  4C8N A;  2MUT B;  1LB2 B;  5DDY A;  3TAP A;  2K8C B;  2G09 A;  3KBB A;  1FO4 A;  3G6Y A;  3ED5 A;  1Q3U A;  1IG6 A;  4PGQ A;  3OGU A;  1NNL A;  3O0F A;  4KLI A;  2G08 A;  4BUG A;  5DKW A;  4F2S A;  2XY7 A;  1PVR A;  1SZH A;  1J2N A;  8ICA A;  2Q0Z X;  1RXW A;  4NLC A;  4DS5 A;  2GOL A;  5F3X B;  2ESE A;  3H8J A;  4IQT A;  3C2K A;  2JXJ A;  2OCE A;  2YN4 A;  3A0H U;  2KIC A;  3PMN A;  2Y0S C;  2K4P A;  5J0W A;  2I6X A;  4C8L A;  2AXT U;  3V7K A;  4ED3 A;  3N97 B;  2NO4 A;  4ECS A;  4Y2T A;  2YMP A;  3RFA A;  2D3D A;  1FFV A;  5KG4 A;  3ISB A;  5G5G A;  4O3N A;  5ALD A;  3I1Y A;  4ED8 A;  4QZA A;  2HMX A;  1RDF A;  7ICO A;  3MR2 A;  2NYV A;  2ZIW A;  5DG8 A;  4C8M A;  2YTU A;  2OH2 A;  1MSW D;  8ICO A;  4TQR A;  1J2M A;  2H3I A;  1CUK A;  4J9Q A;  4R8U B;  3KKA C;  1IV8 A;  2HSZ A;  3M6K A;  4DF8 A;  5TZV A;  3LVV A;  3N7S C;  4KMU A;  3CW2 C;  4P2H A;  1ZQU A;  5KFZ A;  2ZTC A;  1L3V A;  5KFC A;  2C22 A;  2LMR A;  1S0M A;  3DV9 A;  2V9W A;  2UVW A;  4M0A A;  3QU5 A;  4NLZ A;  2MAX A;  1S0N A;  1NK0 A;  4KLF A;  2IOF K;  3EPG A;  1U49 A;  4RU9 A;  3HWT A;  5ALX A;  2KKV A;  1QSL A;  2BQR A;  3KHR A;  1IXR A;  1XSN A;  2DGZ A;  5J0U A;  1ZD2 P;  1ZQO A;  3MGI A;  4B9V A;  4QW8 A;  3ISC A;  5HML A;  5DQI A;  2G07 A;  2HBK A;  1ZQK A;  3RJK A;  1HUO A;  1Z1B A;  2QB0 B;  1U45 A;  5J0O A;  4FO6 A;  8ICF A;  2ZIU B;  2FMQ A;  2HBL A;  9ICU A;  5KNI A;  5G5H A;  2E1E A;  3QU7 A;  1J97 A;  4CCH A;  3T5L A;  1UHU A;  2EZX A;  1ZQA A;  5L1L A;  1K1S A;  3PX0 A;  4UAY A;  5KFD A;  2Y9T A;  5KFF A;  1D8Y A;  3Q8K A;  9ICI A;  2KNJ A;  2HHV A;  1QH9 A;  4UAU A;  3RJG A;  3PST A;  8ICZ A;  3BDP A;  4P4P A;  4RQ6 A;  5J2G A;  4WJ3 B;  1AQ6 A;  4F91 B;  3CNH A;  1D8B A;  3F2B A;  4R64 A;  2ISP A;  2R8K A;  1ZXI A;  3BS5 B;  5CJ7 A;  3H0M B;  3WKC A;  5AKZ A;  4P0Q B;  4PPX A;  1ZQN A;  9ICB A;  4FZN A;  5AI9 A;  5AM5 A;  1ARO P;  3IP4 B;  3LK9 A;  9ICX A;  3RB6 A;  3PSF A;  3QEB Z;  1WWU A;  1VDV A;  7ICU A;  5J0P A;  2W7P A;  4QWE A;  3H8S A;  5AKH A;  5ALO A;  1MQ2 A;  8ICM A;  4UW9 A;  5AI5 A;  3LVW A;  3B0Y A;  3PV8 A;  3C28 A;  3V6H A;  3IRU A;  2AGP A;  2E3T A;  5J2F A;  9ICA A;  2A1J A;  1Z00 A;  5AI0 A;  3C21 A;  2R8I A;  4Y2P A;  1XWL A;  4YVZ A;  5ALT A;  2WHE A;  4ECZ A;  4IC9 A;  2XCA A;  4UBB A;  2KN7 A;  2G5I B;  2HOI A;  5J0R A;  5JUM A;  1ZJN A;  1RYR A;  4KLL A;  2F2A B;  2KTQ A;  3SMV A;  5DB6 A;  1ZQL A;  2E8P A;  5AKG A;  2LHT A;  2KE7 A;  4EEK A;  2F1I A;  3D2N A;  5AKX A;  4RT3 A;  7ICR A;  2W8L A;  5L9X A;  4OJ6 A;  2RP5 A;  3RRH A;  1RQN A;  4B9U A;  2BCR A;  2E8M A;  3JPQ A;  2XVT A;  7ICG A;  2ASL A;  4ECU A;  5A0L A;  2O6K A;  5KFH A;  4O9M A;  7ICV A;  2VA2 A;  4RQ5 A;  8ICK A;  3N7P D;  1ZQI A;  9ICF A;  1T94 A;  1FFU A;  3AQE A;  5KFM A;  3E0F A;  5CB1 A;  2BKE A;  4TUR A;  1KLN A;  3WKE A;  2DWQ A;  3OJS A;  4IQW A;  1X6J A;  5KFL A;  1SV0 C;  3FYH A;  3JPO A;  4P0P A;  7ICE A;  2RLT A;  4DF4 A;  3AUO A;  1L3T A;  1Q3V A;  2LYH A;  5KT7 A;  2C28 A;  1L7P A;  4EEN A;  3TAD A;  2GO7 A;  1COK A;  1NK6 A;  1ZQT A;  1CEZ A;  3TAC B;  3M1Y A;  8ICE A;  2FLN A;  2CN1 A;  5EE3 A;  2XCP A;  2HHX A;  2LKY A;  1RYU A;  1VLB A;  4J9N A;  1ZQD A;  3M8R A;  4IQU A;  9ICS A;  1Z1V A;  4RQ4 A;  4LJX A;  1QQ6 A;  3V7L A;  4M9N A;  5KG1 A;  2PMZ C;  3K75 D;  1Z3E B;  2OM6 A;  9ICV A;  5C0Y A;  5JTI A;  4M04 A;  4DSE A;  2N1R A;  1PK3 A;  1K5O A;  1UT5 A;  1NOM A;  3R9K A;  1NK9 A;  4QZF A;  5IIL A;  2Y9U A;  5KFQ A;  1SKR A;  4OJO A;  4UAW A;  5KL8 B;  3F5A A;  3WK5 A;  2NRZ A;  3AL0 B;  4NM2 A;  4EEY A;  3UXO A;  2IMW P;  8ICT A;  5CP2 A;  3UQ0 A;  5J2J A;  2WF8 A;  1S10 A;  5KFW A;  1K1Q A;  1PK1 A;  1XO0 A;  3HX0 A;  2BQ3 A;  4X5V A;  1KSP A;  4I2G A;  2P6U A;  5ALG A;  2JGA A;  2Z7J A;  3C1Y A;  5J2E A;  1GO3 F;  4CRX A;  2ZUB A;  4YQW A;  5EWE A;  1BPY A;  1RYS A;  2BCV A;  3SEN A;  5KFV A;  1TAU A;  2DPJ A;  1N61 A;  3RH4 A;  3KZI U;  1BPB A;  2ZIX A;  3EUB 2;  4QWC A;  3LDA A;  4USA A;  5T14 A;  2KIW A;  2HDO A;  2BDU A;  2PMZ F;  3NAS A;  1KBU A;  4DSL A;  5J8Y C;  1N56 A;  1H38 A;  3E58 A;  3M6Z A;  2ASJ A;  3WK8 A;  5J0T A;  2KZ3 A;  5DB8 A;  3N7R C;  4YR3 A;  3C23 A;  1NKE A;  4Q8E A;  5KFN A;  1SWW A;  5E79 U;  1SIJ A;  3MBY A;  2W54 A;  5KFG A;  3F2D A;  2W55 A;  4EBC A;  3LWM A;  3C1Z A;  4RT2 A;  3LYS A;  2ISO A;  3F5E A;  5KG2 A;  2LM4 A;  5K4L A;  3GQC A;  2HHT A;  2VKQ A;  3SV4 A;  4M2Y A;  1URJ A;  2AU0 A;  2E1F A;  4KLJ A;  4DSJ A;  7ICS A;  3JPT A;  2QAR A;  5KFX A;  2K4I A;  8ICV A;  3B0X A;  3NS1 A;  9ICN A;  2IA6 A;  2KEY A;  1SKS A;  4P0P B;  3MR6 A;  3HT3 A;  1O03 A;  3D6J A;  8ICR A;  2KKP A;  4KLT A;  4DSK A;  4GFJ A;  1N63 A;  4FZM A;  3VC8 A;  5ALU A;  3C5G A;  4ED7 A;  3PSI A;  3PX6 A;  4JB3 A;  3RBD A;  2RRD A;  3C5F A;  5DLF A;  1FIQ A;  2FJ6 A;  2W9B A;  1XS9 D;  2FMS A;  3N4M B;  2EAM A;  5DLG A;  3KZX A;  3TAN A;  2KVC A;  2VJ4 A;  2W8K A;  2W9M A;  3SZ2 A;  3SD7 A;  3SQI A;  3TAQ A;  5CRX A;  4NXZ A;  3MDA A;  5J2I A;  4E0D A;  4KIT B;  4PGX A;  3SV3 A;  2MUT A;  4Z6E A;  8ICX A;  2P66 A;  3SI8 A;  4EX7 A;  4KLU A;  4KX5 A;  4US9 A;  5DBA A;  4PGY A;  4G9B A;  2BR0 A;  2ES6 A;  1TFR A;  2AGO A;  3D2Q A;  3HP6 A;  9ICQ A;  2F44 A;  7ICI A;  5KAF U;  2ZJ5 A;  2WTF A;  4F5P A;  2KOB A;  4MFA A;  3KHL A;  3CP8 A;  5J0Y A;  2Y1J A;  1XC9 A;  5ALS A;  2LYA A;  4IR9 A;  5KL1 B;  2YB4 A;  3T79 A;  9ICG A;  2I1Q A;  2KHV A;  4LVS A;  2NRW A;  4MEX A;  4F8R A;  2K89 A;  3AN1 A;  4QZE A;  2DF4 B;  4LZD A;  3RH6 A;  5KFE A;  2KSO A;  1JAL A;  4Q45 A;  4B9N A;  3OHB A;  2EZY A;  2UVV A;  3SAH A;  3BS5 A;  2DKZ A;  3HRD D;  1ZQZ A;  4Y2U A;  5CA7 A;  4UAV A;  4RQ0 A;  3FDS A;  1KFT A;  2F76 X;  2OHF A;  4BWM A;  5KG7 A;  5IIM A;  2C2R A;  1D8L A;  3IV6 A;  1JN3 A;  5L1J A;  1OUQ A;  4C8O A;  1PUZ A;  2A1A A;  3RAQ A;  1L3S A;  5KFT A;  4YFK A;  3RTV A;  3RJI A;  1NKC A;  1JX4 A;  2KFZ A;  3TFS A;  2H3V A;  1U47 A;  1X9W A;  5ALW A;  3M9N B;  3B9J A;  2OEH A;  2ZIV A;  4ED6 A;  2FPK A;  5J2A A;  4KLE A;  1YT3 A;  5BOL A;  1ZD4 A;  1RPL A;  5KFP A;  3GDX A;  5DB9 A;  4CGZ A;  4PHD A;  1D9F A;  2KJ5 A;  1SL1 A;  2BCU A;  4ELT A;  2HHU A;  4BDP A;  1ZD5 A;  4DFP A;  3CYM A;  8ICY A;  1SV4 A;  3FAH A;  4QZH A;  1M6Y A;  1MC8 A;  5AKE A;  3MR5 A;  2XIC A;  4KMO B;  4JV2 A;  5AIB A;  4QZD A;  2PFP A;  2A19 A;  3PW5 A;  1S9F A;  2KFN A;  5TIS U;  4I2I A;  1Z4O A;  4FZL A;  2MSN A;  2B0C A;  4I28 A;  1Q46 A;  3AM9 A;  3SAG A;  2ZXI A;  2ZJA A;  5AIC A;  4RUA A;  2UVU A;  1RZT A;  5KFI A;  4C0Z A;  2QAR B;  4PH5 A;  2W3R A;  2WB1 F;  5AI4 A;  2XY5 A;  4YMO A;  4JK1 A;  4IQV A;  3MDC A;  2XI9 A;  3K1R B;  2RDJ A;  5GTI U;  4BXO B;  2QLT A;  1U4B A;  4GC7 A;  3H8M A;  4DFM A;  1TAM A;  3N28 A;  4UB4 A;  4C7Z A;  2JEJ A;  3ZDC A;  1ZQH A;  2YX8 A;  4F50 A;  1WCN A;  1QQ5 A;  5KFB A;  1ZQP A;  4O3S A;  2YB1 A;  2IOF A;  2YMQ A;  4ECW A;  2DPI A;  4J9O A;  2ASD A;  3L5K A;  5IIK A;  4C4R A;  2BPG A;  3BZK A;  4O3R A;  1XU4 A;  2FI1 A;  4Z6C A;  4EBE A;  5AI6 A;  3ZI4 A;  1X42 A;  1ZQB A;  2W9C B;  4ECY A;  2JHD A;  3H4D A;  4AYB F;  4I2E A;  3KHG A;  5AIA A;  5B66 U;  3M9M B;  4YD1 A;  4K4I A;  4R65 A;  3GIL A;  1KFS A;  3C2L A;  2H3F A;  4GIB A;  5EOZ A;  3GV5 B;  1KDH A;  4YR0 A;  4I2A A;  3TKA A;  2F1J A;  4PZN A;  8ICJ A;  2AQ0 A;  4Y2X A;  2BCS A;  2R8J A;  1DGJ A;  4OJL A;  1ZQY A;  2V4Q A;  3RRG A;  2PI5 A;  2A3V A;  4YXM A;  1ZRN A;  2JZB A;  9ICO A;  2MU2 A;  4RQ3 A;  3OJU A;  3V6J A;  2WB1 C;  5J29 A;  4K4G A;  9ICE A;  1BPD A;  4DL6 A;  2EQY A;  5HP4 A;  3AMZ A;  4FS1 A;  9ICH A;  2IHN A;  2PKE A;  4YMN A;  4PHP A;  4I2D A;  2AH5 A;  4QJF B;  3MC1 A;  4NLB A;  3KHH A;  2HHQ A;  1ZQQ A;  1NK4 A;  1JRO A;  1QSS A;  4A8E A;  1UA1 A;  4C8K A;  1V97 A;  5CHG A;  4QZC A;  2MRL A;  1X6I A;  1UCV A;  4Q44 A;  2HVI A;  4Y2V A;  4DCC A;  4DQP A;  5EE1 A;  3TFR A;  3S6J A;  2RQ5 A;  2BHN A;  4P0Q A;  5H2F U;  2KZM A;  3KFU F;  1TE2 A;  2KIV A;  1ZQ1 C;  4ED1 A;  2KSO B;  7ICQ A;  3FC4 A;  4JV0 A;  5BOM A;  2BPF A;  4U7C A;  1DK2 A;  4NL9 C;  3H7I A;  3BQ7 A;  2JV3 A;  3GZF A;  4I2C A;  4O3M A;  4FE3 A;  3QNM A;  2FMP A;  3F2C A;  3BQ2 A;  5IIJ A;  1L7N A;  3T3F A;  4KLG A;  1MA7 A;  2EZZ A;  2DL0 A;  3GII A;  3GIJ A;  1NK8 A;  4DSF A;  3EPI A;  4F4Z A;  4OD0 A;  2LBO A;  3QU4 A;  3C29 A;  2M9N A;  4DEZ A;  4J9R A;  1WCL A;  2P35 A;  4CF5 A;  2EDU A;  1WWV A;  3OTQ A;  4C4S A;  5KT6 A;  1TK0 A;  2OXO A;  3SYZ A;  4QNL A;  1SXD A;  1QQ7 A;  5KT4 A;  3MAB A;  5J2K A;  8ICH A;  5KT2 A;  5EWF A;  2VA8 A;  2ZJ8 A;  5ALM A;  1SL2 A;  3HJE A;  3RJF A;  2KG5 A;  5AKL A;  2ZUC A;  1L8L A;  3PO5 A;  5HMM A;  3H0L B;  3D2S A;  4IRD A;  3OSN A;  3WKD A;  4RNN A;  4UQG A;  3NVV A;  5HHH A;  3HIL A;  4EYH B;  5ALE A;  4XUS A;  3ZDA A;  2BZF A;  4G3I A;  4TUS A;  3BQT A;  2IBK A;  2R18 A;  4DOC A;  3AQF A;  4JMU A;  2JR5 A; 
#chains in the Genus database with same CATH homology
 5TIS U;  3A0B U;  5GTI U;  3A0H U;  4UB8 U;  3WU2 U;  5H2F U;  5KAI U;  4IL6 U;  4UB6 U;  5B5E U;  5GTH U;  2AXT U;  2DUY A;  5KAF U;  5E79 U;  3KZI U;  1S5L U;  5B66 U;  4PJ0 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...