5B5EU

Crystal structure analysis of photosystem ii complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b5eU01
3A0HU 3A0BU 4IL6U 5B5EU 2DUYA 5B66U 2AXTU 3KZIU 4PJ0U 4UB6U 4UB8U 5GTHU 5KAIU 5E79U 1S5LU 5KAFU 3WU2U 5GTIU 5H2FU 5TISU
chains in the Genus database with same CATH superfamily
4RQ6A 3ZDDA 3MGHA 2FLNA 5H2FU 2Y9TA 2ES6A 1FO4A 1XC9A 4DL2A 3SENA 2AU0A 4QZFA 2F1HA 2DF4B 2H3IA 5EOZA 2PFNA 4ELTA 3PX6A 2UVVA 2OH2A 1A77A 4CF4A 2E8PA 4DOCA 1TFRA 4BUGA 5ALRA 2EAOA 2AXTU 4I2CA 2DKZA 8ICIA 4MHVA 4R8UB 5J2CA 2BR0A 4BDPA 7ICEA 4YR2A 1BPYA 3WK6A 1L7MA 1ZRNA 4XA5A 4RQ3A 2W7OA 4KITB 2KIVA 1U48A 4KLMA 1JI7A 1XSNA 1X9WA 2HCFA 5DQHA 5CHGA 2ZIUB 5DG8A 4ICAA 2Z7JA 8ICOA 3UQ2A 2QLTA 4Y2YA 4IRDA 2LHTA 5CR0A 2F44A 3MR5A 4KLLA 4J9MA 1L7OA 4ED7A 1Z1VA 3Q8LA 1U45A 4CDGA 5KAIU 1PK3A 3C1ZA 4RPXA 1ZQDA 3GV8B 3V7LA 3ED5A 2FI1A 3HT3A 2W9CA 8ICXA 4PH5A 4KX3A 3N7RC 4Z6CA 1XSLA 2W8KA 2K4PA 1VDVA 2LM4A 2YMLA 4PGYA 4QZHA 4NLGA 3PSPA 3RBEA 2DFLA 3LWMA 3WKDA 4KLHA 5DB6A 2PFQA 4ED6A 3RJKA 2KVCA 1IM4A 1KLNA 4GFJA 1M6YA 5AM1A 3BDPA 4ELUA 4CCHA 1RG6A 1RZTA 2NRZA 3IV6A 4UB2A 9ICNA 5AI6A 2UVRA 2K8BB 2P6UA 4QJFB 3NVWA 2HOIA 4I2BA 2ZXHA 3HILA 4GC7A 2ZIXB 2KKVA 9ICPA 4RUAA 1Z3EB 4QWBA 1QTMA 2W7PA 2OHFA 3T3FA 1SV0A 3H7IA 3G6YA 5J2JA 3WKBA 1S76D 3JPPA 2E5SA 2WB1F 1TK0A 1S77D 5L1JA 2AQ0A 2C2EA 1RQLA 4RQ0A 1ZQFA 3BZCA 2AH5A 9ICCA 2OYYA 3MC1A 4RT3A 3TQ1A 4R64A 4Q43A 2N1RA 2M0NA 2CPRA 5JU5A 5JTIA 5D4BA 3SAGA 3Q8PB 1DGJA 3FM9A 3QZ7A 2JZBA 2NRWA 4OO1J 3SR6A 3V7JA 4O3QA 4F5QA 3HX0A 4ECXA 4R63A 4Z6EA 7ICGA 3TARA 2EDUA 5KFLA 2K60A 5HHIA 3DEEA 3SAHA 4UAVA 2K89A 2IHMA 2W3SA 3ORYA 1ZQBA 1B0XA 1C20A 2A1JB 5AKZA 4QWEA 4F4WA 5ALLA 4B9LA 4GLXA 4U6PA 4O3MA 2RP5A 4PZOA 4DSLA 2BPGA 5DG7A 2HHTA 5ALIA 1X40A 5BPCA 4DL6A 3M1YA 1L5UA 5AKJA 3R9KA 1ECWA 2KMDA 3IG8A 4Y2RA 3TAQA 5AKHA 5F3XB 2KKPA 4BXOB 2R8HA 4TQRA 2W04A 2CXYA 4R66A 1PUZA 1ZQPA 5B5EU 2VKQA 3GFKB 1LKYB 3PSIA 1HIWA 4B9VA 4GC6A 1L3VA 1NK9A 3NVVA 1S9FA 3V6KA 3EUB2 1F44A 3E58A 3Q8RB 3HKZC 4DLGA 3HPOA 5DKWA 2VA2A 2AGOA 3TADC 4K4IA 1ZQGA 4I28A 2W9BA 3PMNA 2ASDA 7ICHA 2ASLA 5HR6A 5EE9A 2BPCA 3LK9A 2XIDA 2DGZA 4KLJA 3B9JA 3MR6A 2BQ3A 3IN5A 5KFRA 2IMWP 2J6TA 5IIJA 2JEGA 1UA1A 1U4BA 1SGGA 3RAQA 5HR7A 5ALGA 2HHUA 2YB4A 3BQTA 1D9FA 5EWGA 5BOLA 1X9XA 1KTQA 2B21A 5D49A 2DKXA 2LPEA 3WKCA 3RJJA 1WG8A 2RLTA 1SL2A 2YQEA 4OJLA 4ELVA 2LBOA 3RFAA 3T5JA 3FAHA 5IIMA 2W03A 3M8RA 1LKYA 2W3RA 4RQ7A 3MR3A 2YMPA 4KLSA 4EZ9A 2FPKA 4F50A 1V38A 3ALRA 7ICRA 3RJFA 3MGIA 1L7PA 1X42A 1Q46A 4PL1A 5HNKA 3JPQA 5KFQA 5KL8B 4J9LA 3VC8A 2E8MA 2HBMA 3OPXA 4F91B 4DL4A 3SQIA 5J2AA 3PW5A 4M2YA 5L1IA 4F5NA 2F1JA 3SYZA 4YD1A 1Z00A 3WK9A 3ZDEA 3TANA 1S0VA 3HJEA 5KFCA 1SL1A 5AM5A 3LYSA 3KTQA 2G06A 1BNOA 3LVWA 2YX8A 5KG3A 1YZ7A 4TQSA 7ICLA 4J03A 5KAFU 2JHDA 1MSWD 2QB0B 2W9MA 2P6RA 4QWCA 1RPLA 5C0YA 1XWLA 2H5XA 5KFMA 1NOMA 4JV1A 1NJYA 3F2BA 4OJPA 8ICAA 3TACB 3KHRA 2VIXA 4DL7A 4MFAA 2E8OA 4PHDA 1MQ3A 2VANA 4I29A 4F5OA 2V9WA 3C2KA 1QH9A 4USAA 1SXEA 5EE3A 4KLGA 1ZQNA 1UQVA 3GV7B 4CF3A 4P4PA 3RJGA 2ZXIA 4O5EA 5A0LA 4NWIA 2ZIVB 4KN4A 2ISOA 1FFUA 3IG5A 1Z4NA 5KG0A 3AQEA 4C8OA 1NKCA 3OHAA 3PX4A 3H0RB 4DSIA 8ICCA 3L5KA 4F4YA 3RJIA 2I6XA 1DXSA 3DDHA 2ZUDA 4NXZA 4OJ6A 4YR3A 4Y2XA 4ECSA 3MFIA 2A19A 3PW7A 5HP4A 1NJXA 3IRUA 5KFUA 4YD2A 2KG5A 2LKYA 4ED8A 4GIBA 3PR4A 2NRTA 2JH1A 4ED0A 4I2JA 4PHAA 1Y88A 3KBBA 2XGPA 1JXEA 3BS5B 2HHSA 1O08A 2LMRA 2F77X 4EZ6A 5HHHA 3GDXA 4US9A 1N61A 2FLPA 5KG5A 1ZQCA 5KG1A 5KFWA 5DB8A 1L6NA 3F2DA 2BGWA 4YCXA 2KZ3A 4DF8A 2DQNB 1IV8A 4P0QA 1ZETA 2AGPA 4B9MA 4I2GA 9ICBA 4DL5A 1Q3VA 3ETLA 2JGAA 4O9MA 4MEYA 4J9OA 4MF8A 3PO5A 2HW3A 2BPFA 2OXOA 4RQ5A 2JR5A 4QNLA 3K4GA 3E0FA 5ALYA 8ICFA 2HDOA 5AI4A 2ZIWA 4X5VA 4FZLA 5KFPA 3QU4A 3H0LB 2MUTA 3GIKA 5AKLA 2WF8A 5AKKA 1NK0A 2RHFA 3QU2A 5KFHA 3WK7A 2NV3A 2ATLA 1ZQXA 4G9BA 1RYUA 2DUYA 4PGQA 4RNNA 4RU9A 1KQQA 2YMMA 2NRVA 4F5RA 4PL2A 4F72A 2F8LA 3OJSA 3CP8A 3Q8MA 4IL6U 2JMGA 1PVRA 3H4DA 5KL1B 1SKWA 4M04A 2EZXA 2IOFK 5ALWA 2E1EA 3TI0A 2ZUBA 3U26A 3BZKA 2PMZC 4DQIA 2KZMA 2UVWA 5AKYA 1NZBA 5KFSA 2JZBB 5AM2A 2QB0A 5J0UA 4F2SA 2RQ5A 2O6KA 4KMUA 3ISCA 3F5EA 2HHWA 3MABA 3SD7A 1KEJA 3Q8QB 4FBTA 8ICNA 5J0YA 1NI3A 3MBYA 3KFUF 4B9SA 2EH9A 1UPHA 3OSNA 1O03A 4JK1A 4UB1A 4O3SA 2XI9A 3M7DA 1ZQEA 2JV3A 3C23A 4EBCA 5KT7A 9ICQA 1T3QA 2C2RA 3ISDA 4F4ZA 5KNIA 3QUBA 4CE6A 5KFKA 1D8YA 4DWIA 5IINA 2KP7A 1TVAA 1KN5A 4BWMA 5AK6A 4DL3A 2GO7A 5DB7A 9ICTA 2FPLA 5IIOA 4DOBA 5KFTA 4C8KA 9ICHA 5AKXA 4FBUA 8ICQA 2ZTCA 4M0AA 2ASJA 7ICJA 4I27A 3ZDCA 2PI4A 3UXPA 2K8CB 4US8A 2EQYA 4NJ8A 1XSPA 1S10A 1NK6A 1ZQSA 2XC9A 5KFYA 1Q8KA 2FE9A 1RDFA 1N2XA 3F5AA 2JH7A 2XY6A 1SZHA 1N56A 1BPXA 3PSTA 3LDAA 3UMGA 2Y1IA 3N28A 4YQWA 3BS7A 3SV4A 4Y2VA 2YY6A 1PVQA 5ALHA 5CWRA 4UAWA 2L5YA 3I76A 1DOQA 5L9XA 4F93B 3AL0B 1QLNA 1NZPA 2ZIVA 2F8KA 4I2IA 4M6WA 5AKEA 2QARA 3PX0A 2PI5A 2IBKA 1FEZA 3TADA 1JROA 3PW4A 1EXNA 3AMZA 1QQ6A 2KOBA 3UM9A 4Y2SA 1ZD5A 5J2GA 3FDSA 1TK5A 5KG6A 4B6JA 8ICJA 1MN8A 1IG6A 4FS1A 1SWWA 4J9PA 2BHNA 3MFHA 3RJEA 2ALZA 5J2HA 2HMXA 4KTQA 3WK4A 3HRDD 2A3VA 2KSOB 4FS2A 2W55A 3D2NA 2F76X 2D8CA 3JPTA 3ZD9A 2W9CB 4PHEA 1ZQVA 3TKAA 3WK5A 5TZVA 3V7KA 1JUDA 4QZEA 1D9DA 1L3TA 1S0OA 1SWVA 4DFKA 1SV4A 4F4KA 3PVXA 2DBYA 4B9NA 4QW9A 4CF5A 3HP6A 4I2AA 4UB8U 8ICKA 5E79U 2QARB 4IQVA 4F2RA 2HHVA 2H3VA 5ALEA 3PY8A 1V9PA 3CYMA 3PV8A 9ICMA 4UATA 2MSNA 4NM2A 3M9NB 4A8EA 3PNCA 2XY5A 4PHPA 3CRXA 8ICRA 3FC4A 2KHQA 3RB3A 4YP3A 2HSZA 2MUTB 1BNPA 2ZIXA 1L3UA 2Y0SC 5CJ7A 1H38A 2NO4A 4TUPA 1TAUA 3ICXA 1MQ2A 4DS4A 1ZQTA 4KLFA 4LVSA 5KG4A 4M47A 2VJ5A 2E1FA 5KT3A 1KKXA 1CRXA 5B66U 4NL9C 2FDRA 1HEKA 1U49A 1DK3A 2KZZA 2F3NA 2MAXA 2XY7A 4WJ3B 3KHLA 4NY8A 4Y2QA 4J9NA 2RDIA 2Q0ZX 1Z00B 1JX4A 2JEJA 5AM4A 7ICFA 1OUQA 2K4IA 3PR5B 8ICWA 4F8RA 4Y2JA 2FMPA 3AU2A 2AQ4A 2GWSA 4KX5A 4YMMA 4UB3A 9ICAA 3T5LA 3KKAC 1N5XA 2CN1A 3M6KA 4OD0A 4JV2A 3OGUA 3D2SA 5GTIU 1NJZA 1IXRA 1RYRA 3JPSA 2XVTA 1KRPA 2H3ZA 3EZ5A 1JIHA 4BWJA 2KFZA 4UQGA 4DQQA 5J0WA 2XGQA 1ZQHA 4K4GA 4UB5A 2XICA 4IS7A 3QYPA 4O3OA 4MF2A 4EBEA 2UVUA 4C7YA 2EZYA 5ALSA 1N60A 2KK0A 1ZJNA 1CUKA 5DQIA 1PZNA 1COOA 1TAMA 4I2DA 3T5KA 5G5HA 3TAPA 3THVA 2IOHA 5DBBA 2XCPA 1QQ5A 4PJ0U 4DFDA 1SKRA 2G09A 1ZQAA 4KLQA 4DFPA 1XS9D 4C80A 1N62A 2OM6A 1ZQWA 3ETRA 2BKEA 3UXNA 3RH5A 2FMSA 4ECTA 3RF9A 3IHQB 4QZIA 3JPNA 4OCZA 3B0XA 5CP2A 5DG9A 4BGDA 5KTQA 5J2DA 3UMBA 9ICSA 3RR7A 1ZQQA 3RBDA 1S0NA 4QZGA 1UA0A 2I9GA 2LYAA 9ICGA 4IR9A 1HUOA 1PVPA 4JV0A 4J9KA 3C21A 4I2EA 5ALMA 3I1YA 2PFOA 7ICVA 2KSOA 2PFPA 3D6JA 2PKEA 3GILA 5HMLA 4C8LA 4O3RA 1F0MA 4KLOA 3SEIA 5J0XA 4F4XA 4FZMA 2ESEA 5KFVA 2BDPA 3AU6A 1YZ6A 3H40A 4IRKA 2G0AA 1ZQYA 4YVZA 1BPZA 4O3NA 5IIIA 1SXDA 4C8NA 1V85A 5J29A 3PZPA 3KHHA 3QXGA 4FO6A 4TUSA 2ZJAA 2LI6A 2BCUA 3N4MB 5J2BA 1KW4A 2J6UA 1ZD3A 5ALDA 3M8SA 9ICXA 1UHUA 4EYHB 1S97A 4G3IA 2IOFA 2WAQF 3QU9A 3GU3A 4DQPA 2C22A 1TV9A 1URJA 4YFKA 2BDUA 1WWVA 1T3NA 4QZDA 4Q45A 5AI5A 3RH4A 4IQTA 5ALQA 3C5FA 5DLFA 5IILA 4CNQA 4DEZA 1HUZA 2GLEA 4B9TA 2A1JA 4YN4A 3BQ7A 2GH1A 1ZQJA 3ZDBA 4GXIA 4ACOA 2OCEA 7ICTA 2NO5A 1RXVA 4RQ1A 1ZQUA 3EPGA 1V97A 2KVSA 5BOMA 1NK7A 2HHXA 2KTQA 1QSYA 5DBAA 2BZFA 3QU5A 4RNOA 4QIWF 1ZQKA 1ED1A 2DL0A 3JPOA 3OSPA 4Q8FA 1FIQA 4OJ5A 3G6XA 2K4HA 4KLDA 2RRDA 3RB0A 3OTQA 4M9HA 4JWMA 1MA7A 4NLKA 3H8JA 2WAQC 3EW9A 2W9BB 2KJ9A 3N7PD 2JEIA 5AICA 9ICRA 9ICVA 2F2AB 5ALUA 4DFJA 1QSSA 5J2FA 1N63A 4J9QA 2ZJ5A 1Q3UA 1FFVA 4ECUA 3QUCA 4C0ZA 5J0RA 3SI8A 1ZRMA 3JPRA 3H4BA 4IR1A 1DGSA 4P0QB 1LB2B 1KFSA 4M6WB 5KG7A 1RQNA 2NRXA 1NKBA 3M9OB 1P7DA 2DPJA 4QIWC 4NLBA 5HMMA 1S8OA 1UT8A 1D8BA 2W8LA 5KG2A 8ICVA 3C5GA 3QZ8A 1MC8A 1C7YA 7ICSA 1DK2A 3LVVA 3GIMA 1OW5A 2W54A 1NK5A 1AROP 1U47A 2B0CA 5J0SA 3ZI4A 8ICYA 5KFJA 5J0OA 4Z6FA 3BS5A 3ONNA 4RPYA 4KMOB 3N97B 7ICKA 4HYKA 2K4EA 4KLEA 3PSFA 1X6IA 4EX7A 5IIKA 4UW9A 3VCBA 5CEHA 8ICSA 1ZD4A 5ALXA 1RYSA 4IQWA 9ICJA 4RUCA 1ZXIA 4UAZA 2AHOB 7ICIA 2P66A 9ICUA 2YMQA 4RZRA 4RPZA 3A0HU 2BCQA 1X9MA 3K1ZA 3F53A 8ICPA 1WCLA 4F5PA 5J2EA 1ZYQA 4ECRA 4JUZA 2V4QA 1B4FA 4UARA 4ECQA 5KFEA 1RXWA 4YXMA 4Y2PA 2FJ6A 2D6FC 4BXOA 5ALTA 1J97A 4UAUA 5ALNA 3RTVA 5EE0A 4P4OA 3AN1A 1B43A 2R8KA 3QU7A 1JALA 3BQ2A 1K5OA 3NVZA 4RQMA 3RRGA 3T79A 2MRLA 1VJ5A 3KZXA 1NNLA 4AYBF 5AI9A 3KKAA 1WUDA 3GZFA 4M9NA 1BPBA 5J2KA 5L1KA 5KFXA 2FMQA 1SIJA 5J2IA 2EZZA 3G6VA 4YG2A 5J8YC 5KFBA 3CW2C 4NLZA 5KFNA 3WKEA 3KHGA 9ICKA 3Q8KA 2P35A 4ZH4A 5CB1A 7ICOA 5K4LA 5J0PA 3EYZA 5ALKA 2JRZA 3DV9A 3H8MA 4QWAA 4M9JA 3V72A 2Y0SF 4DSEA 5J0TA 1XO0A 2LYHA 2W43A 1CI4A 5AM3A 4NL9A 4PGXA 4BJQA 1L8OA 3WKAA 4F71A 3PMLA 4O3PA 4F3OA 2C28A 1X2IA 5FP0A 3A0BU 4U7CA 5KT6A 2G5HB 1SKSA 4HAIA 4ZOHC 2QB1A 5AI0A 1QQ7A 3AM9A 2D3DA 4KN7A 3QUQA 4JWNA 4BX9C 4M9GA 1ZQ1C 2F1IA 2MA1A 2H3FA 5AI8A 3PW0A 3BQ0A 1VLBA 5CRXA 1L3SA 1L7NA 3QNMA 1ZOLA 5ALVA 1ZJMA 2HOFA 3MGVA 2DWQA 3PW2A 4C4TA 4J9RA 3L4PA 1IIPA 2WTFA 2HBJA 2HBKA 4DS5A 2MU2A 4KLUA 3RB4A 4P0PA 5EE1A 9ICOA 3T5HA 8ICMA 1JMSA 3C1YA 2H3QA 5JRTA 3S6JA 1D8LA 5ALZA 4CGZA 1S5LU 2BCRA 4TUQA 2ZIWB 4DQSA 4P4MA 4YMNA 4EENA 4P2HA 1YT3A 3H8SA 3V6HA 3NGDA 2ZG6A 5CA7A 3WU2U 1X6JA 4XRHA 4UBCA 2WF5A 2G08A 5KFIA 1TKDA 4YMOA 4Z6DA 4RQ8A 1K1SA 4QZAA 5AIBA 4O5CA 5DGBA 4MFFA 1J2MA 3KZIU 3NRZA 4DSFA 7ICPA 9ICWA 3I28A 4PZNA 4LZDA 3LWLA 2R8JA 4GXJA 1KSPA 8ICGA 5DQGA 2KEYA 3H8WA 2KICA 1WWUA 5DGAA 4NLNA 3F2CA 1BGXT 4RT2A 2KNJA 2WF7A 3KOOA 4R8UA 5KFGA 4DSKA 8ICBA 2Y9UA 2B6GA 5AKGA 8ICEA 1Z1BA 2XO7A 2HHQA 1UCVA 3V6JA 2W11A 4E0DA 5KFAA 2PXIA 1TE2A 4B9UA 3IDWA 4Q8EA 2AJQA 3ZDAA 1SZPA 4Y2UA 9ICIA 4OJOA 2JEFA 5ALJA 4LJXA 1SL0A 2EAMA 3TFSA 1N5WA 3O0FA 8ICUA 2AGQA 4NM1A 2BQUA 7ICNA 9ICLA 3NUQA 4K4HA 3RJHA 3RH6A 5TISU 2NYVA 4FE3A 4QZBA 1Z19A 1X9SA 1ZQRA 4LZGA 3SMVA 1JXLA 4DSJA 5J0QA 1BVSA 3AUOA 4CRXA 1ZQLA 2HVHA 4O5KA 2HOQA 3OJUA 2KFNA 2EANA 5AHXA 3ZD8A 4QZ8A 3EWAA 4YR0A 5AK4A 1T4GA 2PMZF 2BCSA 1KBUA 4DF4A 2IHNA 2KD1A 2YB1A 5JUMA 4DOAA 1ZQIA 5EWEA 5ALFA 3UXOA 4ECVA 5C5JA 3RR8A 1PK1B 1UT5A 1KDHA 5AIAA 2KJ8A 2E3TA 3MR2A 2HVIA 4J9SA 2R8IA 3RB6A 1CEZA 1TK8A 2K8AA 1SB3C 2ODGA 2EAPA 4O0IA 3NRWA 5L1MA 7ICQA 4UASA 4IRCA 4I2FA 4ED2A 5KFOA 3QEBZ 4DQRA 1B22A 3AQFA 3UPQA 4QZCA 5AK5A 4UAYA 3C2MA 2M9NA 2VA8A 3BQ1A 3UMCA 3AEVA 2HBLA 8ICZA 3KD3A 4XQ8A 2W9AA 3SV3A 3NTUA 3M9MB 2R18A 2WF9A 5D46A 5L1LA 4EELA 1WCNA 3SAFA 2OEHA 1HJPA 1ZQOA 4QZ9A 2DPIA 3SZ2A 4FFDA 4I2HA 3FYHA 3E2EA 2FPMA 3QX7A 2KHVA 4TURA 3NS1A 4RNMA 5KFFA 8ICHA 1T7PA 1PK1A 5EWFA 3C29A 1K1QA 2VA3A 3PO4A 5GTHU 4DLEA 2FLLA 4YXJA 8ICTA 1KL9A 3UQ0A 2C2DA 5F9NA 5KT2A 4UB4A 2KJ5A 2E8NA 2A1AA 4P0PB 2Y1JA 5G5GA 3M6ZA 4C4RA 5KT5A 4RQ4A 7ICMA 1S0MA 2ZUCA 3C28A 4KLIA 2LYBA 2V4RA 1NK4A 3ISBA 1A0PA 4ECYA 1TAQA 1QCKA 4Y2TA 2I5HA 3BJYA 4RQNA 4ECWA 1ZQZA 1Z4OA 1XNSA 1J2NA 3HWTA 2JXJA 3MDAA 3GQCA 2XCAA 4ECZA 3TFRA 5KT4A 4GXKA 1JRPA 1XO1A 2WF6A 4Q44A 3J81j 3RRHA 5AM0A 4R65A 3EPIA 2HI0A 3GV5B 4JMUA 3K1RB 2BCVA 2ZTDA 5DB9A 3QE9Y 1BPEA 2KV2A 2G5IB 3D2QA 4EYIB 7ICUA 1T94A 2GOLA 2BQRA 3RAXA 4DFMA 3HKZF 3Q8SB 4AYBC 1T8EA 2WHEA 2RDJA 1JN3A 3IP4B 1NJWA 5KFDA 4C7ZA 2KIWA 3GIIA 1X66A 3NASA 3QEAZ 2YTUA 3QUTA 4QWDA 1NK8A 4IC9A 1ZQMA 9ICEA 5DDMA 9ICFA 3C2LA 4MEXA 4XUSA 3L3FX 1N48A 4PPXA 2KE7A 3NVYA 1AQ6A 5ALOA 4F92B 1WYGA 2ZJ8A 4RQ2A 4EBDA 2IA6A 1DRGA 1KFDA 1F5SA 4UB6U 4AP9A 5ALPA 4QW8A 2R8GA 2LM1A 1QSLA 1NKEA 3N7SC 1BPDA 5AK3A 4EX6A 4IQUA 2ZTEA 4KLTA 3H0MB 4MFCA 2VJ4A 2J6SA 2WFAA 2G07A 3HW8A 1RM6C 2I1QA 5AKIA 3CNHA 1COKA 3K75D 3WK8A 4NLCA 3IM1A 8ICLA 1ZD2P 4M9LA 2Q4TA 1A6SA 4JB3A 5DLGA 3GIJA 4C8MA 4FZNA 5F9LA 3OHBA 3B0YA 2ISPA 4ED1A 1XU4A 5KFZA 2ZIUA 2CRXA 5T14A 1GO3F 4NV0A 4EEKA 2KN7A 1SV0C 4DCCA 3MDCA 4EEYA 4UBBA 4DO9A 2YN4A 1KFTA 5DBCA 1OXJA 2WB1C 4C4SA 5J8YA 1LV5A 2QKQA 5DDYA 1LVHA 4ED3A 1L8LA 1A76A 2OWOA 1U9LA
chains in the Genus database with same CATH topology
3A0HU 3A0BU 4IL6U 5B5EU 2DUYA 5B66U 2AXTU 3KZIU 4PJ0U 4UB6U 4UB8U 5GTHU 5KAIU 5E79U 1S5LU 5KAFU 3WU2U 5GTIU 5H2FU 5TISU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H U;  3A0B U;  4IL6 U;  5B5E U;  2DUY A;  5B66 U;  2AXT U;  3KZI U;  4PJ0 U;  4UB6 U;  4UB8 U;  5GTH U;  5KAI U;  5E79 U;  1S5L U;  5KAF U;  3WU2 U;  5GTI U;  5H2F U;  5TIS U; 
#chains in the Genus database with same CATH topology
 4RQ6 A;  3ZDD A;  3MGH A;  2FLN A;  5H2F U;  2Y9T A;  2ES6 A;  1FO4 A;  1XC9 A;  4DL2 A;  3SEN A;  2AU0 A;  4QZF A;  2F1H A;  2DF4 B;  2H3I A;  5EOZ A;  2PFN A;  4ELT A;  3PX6 A;  2UVV A;  2OH2 A;  1A77 A;  4CF4 A;  2E8P A;  4DOC A;  1TFR A;  4BUG A;  5ALR A;  2EAO A;  2AXT U;  4I2C A;  2DKZ A;  8ICI A;  4MHV A;  4R8U B;  5J2C A;  2BR0 A;  4BDP A;  7ICE A;  4YR2 A;  1BPY A;  3WK6 A;  1L7M A;  1ZRN A;  4XA5 A;  4RQ3 A;  2W7O A;  4KIT B;  2KIV A;  1U48 A;  4KLM A;  1JI7 A;  1XSN A;  1X9W A;  2HCF A;  5DQH A;  5CHG A;  2ZIU B;  5DG8 A;  4ICA A;  2Z7J A;  8ICO A;  3UQ2 A;  2QLT A;  4Y2Y A;  4IRD A;  2LHT A;  5CR0 A;  2F44 A;  3MR5 A;  4KLL A;  4J9M A;  1L7O A;  4ED7 A;  1Z1V A;  3Q8L A;  1U45 A;  4CDG A;  5KAI U;  1PK3 A;  3C1Z A;  4RPX A;  1ZQD A;  3GV8 B;  3V7L A;  3ED5 A;  2FI1 A;  3HT3 A;  2W9C A;  8ICX A;  4PH5 A;  4KX3 A;  3N7R C;  4Z6C A;  1XSL A;  2W8K A;  2K4P A;  1VDV A;  2LM4 A;  2YML A;  4PGY A;  4QZH A;  4NLG A;  3PSP A;  3RBE A;  2DFL A;  3LWM A;  3WKD A;  4KLH A;  5DB6 A;  2PFQ A;  4ED6 A;  3RJK A;  2KVC A;  1IM4 A;  1KLN A;  4GFJ A;  1M6Y A;  5AM1 A;  3BDP A;  4ELU A;  4CCH A;  1RG6 A;  1RZT A;  2NRZ A;  3IV6 A;  4UB2 A;  9ICN A;  5AI6 A;  2UVR A;  2K8B B;  2P6U A;  4QJF B;  3NVW A;  2HOI A;  4I2B A;  2ZXH A;  3HIL A;  4GC7 A;  2ZIX B;  2KKV A;  9ICP A;  4RUA A;  1Z3E B;  4QWB A;  1QTM A;  2W7P A;  2OHF A;  3T3F A;  1SV0 A;  3H7I A;  3G6Y A;  5J2J A;  3WKB A;  1S76 D;  3JPP A;  2E5S A;  2WB1 F;  1TK0 A;  1S77 D;  5L1J A;  2AQ0 A;  2C2E A;  1RQL A;  4RQ0 A;  1ZQF A;  3BZC A;  2AH5 A;  9ICC A;  2OYY A;  3MC1 A;  4RT3 A;  3TQ1 A;  4R64 A;  4Q43 A;  2N1R A;  2M0N A;  2CPR A;  5JU5 A;  5JTI A;  5D4B A;  3SAG A;  3Q8P B;  1DGJ A;  3FM9 A;  3QZ7 A;  2JZB A;  2NRW A;  4OO1 J;  3SR6 A;  3V7J A;  4O3Q A;  4F5Q A;  3HX0 A;  4ECX A;  4R63 A;  4Z6E A;  7ICG A;  3TAR A;  2EDU A;  5KFL A;  2K60 A;  5HHI A;  3DEE A;  3SAH A;  4UAV A;  2K89 A;  2IHM A;  2W3S A;  3ORY A;  1ZQB A;  1B0X A;  1C20 A;  2A1J B;  5AKZ A;  4QWE A;  4F4W A;  5ALL A;  4B9L A;  4GLX A;  4U6P A;  4O3M A;  2RP5 A;  4PZO A;  4DSL A;  2BPG A;  5DG7 A;  2HHT A;  5ALI A;  1X40 A;  5BPC A;  4DL6 A;  3M1Y A;  1L5U A;  5AKJ A;  3R9K A;  1ECW A;  2KMD A;  3IG8 A;  4Y2R A;  3TAQ A;  5AKH A;  5F3X B;  2KKP A;  4BXO B;  2R8H A;  4TQR A;  2W04 A;  2CXY A;  4R66 A;  1PUZ A;  1ZQP A;  5B5E U;  2VKQ A;  3GFK B;  1LKY B;  3PSI A;  1HIW A;  4B9V A;  4GC6 A;  1L3V A;  1NK9 A;  3NVV A;  1S9F A;  3V6K A;  3EUB 2;  1F44 A;  3E58 A;  3Q8R B;  3HKZ C;  4DLG A;  3HPO A;  5DKW A;  2VA2 A;  2AGO A;  3TAD C;  4K4I A;  1ZQG A;  4I28 A;  2W9B A;  3PMN A;  2ASD A;  7ICH A;  2ASL A;  5HR6 A;  5EE9 A;  2BPC A;  3LK9 A;  2XID A;  2DGZ A;  4KLJ A;  3B9J A;  3MR6 A;  2BQ3 A;  3IN5 A;  5KFR A;  2IMW P;  2J6T A;  5IIJ A;  2JEG A;  1UA1 A;  1U4B A;  1SGG A;  3RAQ A;  5HR7 A;  5ALG A;  2HHU A;  2YB4 A;  3BQT A;  1D9F A;  5EWG A;  5BOL A;  1X9X A;  1KTQ A;  2B21 A;  5D49 A;  2DKX A;  2LPE A;  3WKC A;  3RJJ A;  1WG8 A;  2RLT A;  1SL2 A;  2YQE A;  4OJL A;  4ELV A;  2LBO A;  3RFA A;  3T5J A;  3FAH A;  5IIM A;  2W03 A;  3M8R A;  1LKY A;  2W3R A;  4RQ7 A;  3MR3 A;  2YMP A;  4KLS A;  4EZ9 A;  2FPK A;  4F50 A;  1V38 A;  3ALR A;  7ICR A;  3RJF A;  3MGI A;  1L7P A;  1X42 A;  1Q46 A;  4PL1 A;  5HNK A;  3JPQ A;  5KFQ A;  5KL8 B;  4J9L A;  3VC8 A;  2E8M A;  2HBM A;  3OPX A;  4F91 B;  4DL4 A;  3SQI A;  5J2A A;  3PW5 A;  4M2Y A;  5L1I A;  4F5N A;  2F1J A;  3SYZ A;  4YD1 A;  1Z00 A;  3WK9 A;  3ZDE A;  3TAN A;  1S0V A;  3HJE A;  5KFC A;  1SL1 A;  5AM5 A;  3LYS A;  3KTQ A;  2G06 A;  1BNO A;  3LVW A;  2YX8 A;  5KG3 A;  1YZ7 A;  4TQS A;  7ICL A;  4J03 A;  5KAF U;  2JHD A;  1MSW D;  2QB0 B;  2W9M A;  2P6R A;  4QWC A;  1RPL A;  5C0Y A;  1XWL A;  2H5X A;  5KFM A;  1NOM A;  4JV1 A;  1NJY A;  3F2B A;  4OJP A;  8ICA A;  3TAC B;  3KHR A;  2VIX A;  4DL7 A;  4MFA A;  2E8O A;  4PHD A;  1MQ3 A;  2VAN A;  4I29 A;  4F5O A;  2V9W A;  3C2K A;  1QH9 A;  4USA A;  1SXE A;  5EE3 A;  4KLG A;  1ZQN A;  1UQV A;  3GV7 B;  4CF3 A;  4P4P A;  3RJG A;  2ZXI A;  4O5E A;  5A0L A;  4NWI A;  2ZIV B;  4KN4 A;  2ISO A;  1FFU A;  3IG5 A;  1Z4N A;  5KG0 A;  3AQE A;  4C8O A;  1NKC A;  3OHA A;  3PX4 A;  3H0R B;  4DSI A;  8ICC A;  3L5K A;  4F4Y A;  3RJI A;  2I6X A;  1DXS A;  3DDH A;  2ZUD A;  4NXZ A;  4OJ6 A;  4YR3 A;  4Y2X A;  4ECS A;  3MFI A;  2A19 A;  3PW7 A;  5HP4 A;  1NJX A;  3IRU A;  5KFU A;  4YD2 A;  2KG5 A;  2LKY A;  4ED8 A;  4GIB A;  3PR4 A;  2NRT A;  2JH1 A;  4ED0 A;  4I2J A;  4PHA A;  1Y88 A;  3KBB A;  2XGP A;  1JXE A;  3BS5 B;  2HHS A;  1O08 A;  2LMR A;  2F77 X;  4EZ6 A;  5HHH A;  3GDX A;  4US9 A;  1N61 A;  2FLP A;  5KG5 A;  1ZQC A;  5KG1 A;  5KFW A;  5DB8 A;  1L6N A;  3F2D A;  2BGW A;  4YCX A;  2KZ3 A;  4DF8 A;  2DQN B;  1IV8 A;  4P0Q A;  1ZET A;  2AGP A;  4B9M A;  4I2G A;  9ICB A;  4DL5 A;  1Q3V A;  3ETL A;  2JGA A;  4O9M A;  4MEY A;  4J9O A;  4MF8 A;  3PO5 A;  2HW3 A;  2BPF A;  2OXO A;  4RQ5 A;  2JR5 A;  4QNL A;  3K4G A;  3E0F A;  5ALY A;  8ICF A;  2HDO A;  5AI4 A;  2ZIW A;  4X5V A;  4FZL A;  5KFP A;  3QU4 A;  3H0L B;  2MUT A;  3GIK A;  5AKL A;  2WF8 A;  5AKK A;  1NK0 A;  2RHF A;  3QU2 A;  5KFH A;  3WK7 A;  2NV3 A;  2ATL A;  1ZQX A;  4G9B A;  1RYU A;  2DUY A;  4PGQ A;  4RNN A;  4RU9 A;  1KQQ A;  2YMM A;  2NRV A;  4F5R A;  4PL2 A;  4F72 A;  2F8L A;  3OJS A;  3CP8 A;  3Q8M A;  4IL6 U;  2JMG A;  1PVR A;  3H4D A;  5KL1 B;  1SKW A;  4M04 A;  2EZX A;  2IOF K;  5ALW A;  2E1E A;  3TI0 A;  2ZUB A;  3U26 A;  3BZK A;  2PMZ C;  4DQI A;  2KZM A;  2UVW A;  5AKY A;  1NZB A;  5KFS A;  2JZB B;  5AM2 A;  2QB0 A;  5J0U A;  4F2S A;  2RQ5 A;  2O6K A;  4KMU A;  3ISC A;  3F5E A;  2HHW A;  3MAB A;  3SD7 A;  1KEJ A;  3Q8Q B;  4FBT A;  8ICN A;  5J0Y A;  1NI3 A;  3MBY A;  3KFU F;  4B9S A;  2EH9 A;  1UPH A;  3OSN A;  1O03 A;  4JK1 A;  4UB1 A;  4O3S A;  2XI9 A;  3M7D A;  1ZQE A;  2JV3 A;  3C23 A;  4EBC A;  5KT7 A;  9ICQ A;  1T3Q A;  2C2R A;  3ISD A;  4F4Z A;  5KNI A;  3QUB A;  4CE6 A;  5KFK A;  1D8Y A;  4DWI A;  5IIN A;  2KP7 A;  1TVA A;  1KN5 A;  4BWM A;  5AK6 A;  4DL3 A;  2GO7 A;  5DB7 A;  9ICT A;  2FPL A;  5IIO A;  4DOB A;  5KFT A;  4C8K A;  9ICH A;  5AKX A;  4FBU A;  8ICQ A;  2ZTC A;  4M0A A;  2ASJ A;  7ICJ A;  4I27 A;  3ZDC A;  2PI4 A;  3UXP A;  2K8C B;  4US8 A;  2EQY A;  4NJ8 A;  1XSP A;  1S10 A;  1NK6 A;  1ZQS A;  2XC9 A;  5KFY A;  1Q8K A;  2FE9 A;  1RDF A;  1N2X A;  3F5A A;  2JH7 A;  2XY6 A;  1SZH A;  1N56 A;  1BPX A;  3PST A;  3LDA A;  3UMG A;  2Y1I A;  3N28 A;  4YQW A;  3BS7 A;  3SV4 A;  4Y2V A;  2YY6 A;  1PVQ A;  5ALH A;  5CWR A;  4UAW A;  2L5Y A;  3I76 A;  1DOQ A;  5L9X A;  4F93 B;  3AL0 B;  1QLN A;  1NZP A;  2ZIV A;  2F8K A;  4I2I A;  4M6W A;  5AKE A;  2QAR A;  3PX0 A;  2PI5 A;  2IBK A;  1FEZ A;  3TAD A;  1JRO A;  3PW4 A;  1EXN A;  3AMZ A;  1QQ6 A;  2KOB A;  3UM9 A;  4Y2S A;  1ZD5 A;  5J2G A;  3FDS A;  1TK5 A;  5KG6 A;  4B6J A;  8ICJ A;  1MN8 A;  1IG6 A;  4FS1 A;  1SWW A;  4J9P A;  2BHN A;  3MFH A;  3RJE A;  2ALZ A;  5J2H A;  2HMX A;  4KTQ A;  3WK4 A;  3HRD D;  2A3V A;  2KSO B;  4FS2 A;  2W55 A;  3D2N A;  2F76 X;  2D8C A;  3JPT A;  3ZD9 A;  2W9C B;  4PHE A;  1ZQV A;  3TKA A;  3WK5 A;  5TZV A;  3V7K A;  1JUD A;  4QZE A;  1D9D A;  1L3T A;  1S0O A;  1SWV A;  4DFK A;  1SV4 A;  4F4K A;  3PVX A;  2DBY A;  4B9N A;  4QW9 A;  4CF5 A;  3HP6 A;  4I2A A;  4UB8 U;  8ICK A;  5E79 U;  2QAR B;  4IQV A;  4F2R A;  2HHV A;  2H3V A;  5ALE A;  3PY8 A;  1V9P A;  3CYM A;  3PV8 A;  9ICM A;  4UAT A;  2MSN A;  4NM2 A;  3M9N B;  4A8E A;  3PNC A;  2XY5 A;  4PHP A;  3CRX A;  8ICR A;  3FC4 A;  2KHQ A;  3RB3 A;  4YP3 A;  2HSZ A;  2MUT B;  1BNP A;  2ZIX A;  1L3U A;  2Y0S C;  5CJ7 A;  1H38 A;  2NO4 A;  4TUP A;  1TAU A;  3ICX A;  1MQ2 A;  4DS4 A;  1ZQT A;  4KLF A;  4LVS A;  5KG4 A;  4M47 A;  2VJ5 A;  2E1F A;  5KT3 A;  1KKX A;  1CRX A;  5B66 U;  4NL9 C;  2FDR A;  1HEK A;  1U49 A;  1DK3 A;  2KZZ A;  2F3N A;  2MAX A;  2XY7 A;  4WJ3 B;  3KHL A;  4NY8 A;  4Y2Q A;  4J9N A;  2RDI A;  2Q0Z X;  1Z00 B;  1JX4 A;  2JEJ A;  5AM4 A;  7ICF A;  1OUQ A;  2K4I A;  3PR5 B;  8ICW A;  4F8R A;  4Y2J A;  2FMP A;  3AU2 A;  2AQ4 A;  2GWS A;  4KX5 A;  4YMM A;  4UB3 A;  9ICA A;  3T5L A;  3KKA C;  1N5X A;  2CN1 A;  3M6K A;  4OD0 A;  4JV2 A;  3OGU A;  3D2S A;  5GTI U;  1NJZ A;  1IXR A;  1RYR A;  3JPS A;  2XVT A;  1KRP A;  2H3Z A;  3EZ5 A;  1JIH A;  4BWJ A;  2KFZ A;  4UQG A;  4DQQ A;  5J0W A;  2XGQ A;  1ZQH A;  4K4G A;  4UB5 A;  2XIC A;  4IS7 A;  3QYP A;  4O3O A;  4MF2 A;  4EBE A;  2UVU A;  4C7Y A;  2EZY A;  5ALS A;  1N60 A;  2KK0 A;  1ZJN A;  1CUK A;  5DQI A;  1PZN A;  1COO A;  1TAM A;  4I2D A;  3T5K A;  5G5H A;  3TAP A;  3THV A;  2IOH A;  5DBB A;  2XCP A;  1QQ5 A;  4PJ0 U;  4DFD A;  1SKR A;  2G09 A;  1ZQA A;  4KLQ A;  4DFP A;  1XS9 D;  4C80 A;  1N62 A;  2OM6 A;  1ZQW A;  3ETR A;  2BKE A;  3UXN A;  3RH5 A;  2FMS A;  4ECT A;  3RF9 A;  3IHQ B;  4QZI A;  3JPN A;  4OCZ A;  3B0X A;  5CP2 A;  5DG9 A;  4BGD A;  5KTQ A;  5J2D A;  3UMB A;  9ICS A;  3RR7 A;  1ZQQ A;  3RBD A;  1S0N A;  4QZG A;  1UA0 A;  2I9G A;  2LYA A;  9ICG A;  4IR9 A;  1HUO A;  1PVP A;  4JV0 A;  4J9K A;  3C21 A;  4I2E A;  5ALM A;  3I1Y A;  2PFO A;  7ICV A;  2KSO A;  2PFP A;  3D6J A;  2PKE A;  3GIL A;  5HML A;  4C8L A;  4O3R A;  1F0M A;  4KLO A;  3SEI A;  5J0X A;  4F4X A;  4FZM A;  2ESE A;  5KFV A;  2BDP A;  3AU6 A;  1YZ6 A;  3H40 A;  4IRK A;  2G0A A;  1ZQY A;  4YVZ A;  1BPZ A;  4O3N A;  5III A;  1SXD A;  4C8N A;  1V85 A;  5J29 A;  3PZP A;  3KHH A;  3QXG A;  4FO6 A;  4TUS A;  2ZJA A;  2LI6 A;  2BCU A;  3N4M B;  5J2B A;  1KW4 A;  2J6U A;  1ZD3 A;  5ALD A;  3M8S A;  9ICX A;  1UHU A;  4EYH B;  1S97 A;  4G3I A;  2IOF A;  2WAQ F;  3QU9 A;  3GU3 A;  4DQP A;  2C22 A;  1TV9 A;  1URJ A;  4YFK A;  2BDU A;  1WWV A;  1T3N A;  4QZD A;  4Q45 A;  5AI5 A;  3RH4 A;  4IQT A;  5ALQ A;  3C5F A;  5DLF A;  5IIL A;  4CNQ A;  4DEZ A;  1HUZ A;  2GLE A;  4B9T A;  2A1J A;  4YN4 A;  3BQ7 A;  2GH1 A;  1ZQJ A;  3ZDB A;  4GXI A;  4ACO A;  2OCE A;  7ICT A;  2NO5 A;  1RXV A;  4RQ1 A;  1ZQU A;  3EPG A;  1V97 A;  2KVS A;  5BOM A;  1NK7 A;  2HHX A;  2KTQ A;  1QSY A;  5DBA A;  2BZF A;  3QU5 A;  4RNO A;  4QIW F;  1ZQK A;  1ED1 A;  2DL0 A;  3JPO A;  3OSP A;  4Q8F A;  1FIQ A;  4OJ5 A;  3G6X A;  2K4H A;  4KLD A;  2RRD A;  3RB0 A;  3OTQ A;  4M9H A;  4JWM A;  1MA7 A;  4NLK A;  3H8J A;  2WAQ C;  3EW9 A;  2W9B B;  2KJ9 A;  3N7P D;  2JEI A;  5AIC A;  9ICR A;  9ICV A;  2F2A B;  5ALU A;  4DFJ A;  1QSS A;  5J2F A;  1N63 A;  4J9Q A;  2ZJ5 A;  1Q3U A;  1FFV A;  4ECU A;  3QUC A;  4C0Z A;  5J0R A;  3SI8 A;  1ZRM A;  3JPR A;  3H4B A;  4IR1 A;  1DGS A;  4P0Q B;  1LB2 B;  1KFS A;  4M6W B;  5KG7 A;  1RQN A;  2NRX A;  1NKB A;  3M9O B;  1P7D A;  2DPJ A;  4QIW C;  4NLB A;  5HMM A;  1S8O A;  1UT8 A;  1D8B A;  2W8L A;  5KG2 A;  8ICV A;  3C5G A;  3QZ8 A;  1MC8 A;  1C7Y A;  7ICS A;  1DK2 A;  3LVV A;  3GIM A;  1OW5 A;  2W54 A;  1NK5 A;  1ARO P;  1U47 A;  2B0C A;  5J0S A;  3ZI4 A;  8ICY A;  5KFJ A;  5J0O A;  4Z6F A;  3BS5 A;  3ONN A;  4RPY A;  4KMO B;  3N97 B;  7ICK A;  4HYK A;  2K4E A;  4KLE A;  3PSF A;  1X6I A;  4EX7 A;  5IIK A;  4UW9 A;  3VCB A;  5CEH A;  8ICS A;  1ZD4 A;  5ALX A;  1RYS A;  4IQW A;  9ICJ A;  4RUC A;  1ZXI A;  4UAZ A;  2AHO B;  7ICI A;  2P66 A;  9ICU A;  2YMQ A;  4RZR A;  4RPZ A;  3A0H U;  2BCQ A;  1X9M A;  3K1Z A;  3F53 A;  8ICP A;  1WCL A;  4F5P A;  5J2E A;  1ZYQ A;  4ECR A;  4JUZ A;  2V4Q A;  1B4F A;  4UAR A;  4ECQ A;  5KFE A;  1RXW A;  4YXM A;  4Y2P A;  2FJ6 A;  2D6F C;  4BXO A;  5ALT A;  1J97 A;  4UAU A;  5ALN A;  3RTV A;  5EE0 A;  4P4O A;  3AN1 A;  1B43 A;  2R8K A;  3QU7 A;  1JAL A;  3BQ2 A;  1K5O A;  3NVZ A;  4RQM A;  3RRG A;  3T79 A;  2MRL A;  1VJ5 A;  3KZX A;  1NNL A;  4AYB F;  5AI9 A;  3KKA A;  1WUD A;  3GZF A;  4M9N A;  1BPB A;  5J2K A;  5L1K A;  5KFX A;  2FMQ A;  1SIJ A;  5J2I A;  2EZZ A;  3G6V A;  4YG2 A;  5J8Y C;  5KFB A;  3CW2 C;  4NLZ A;  5KFN A;  3WKE A;  3KHG A;  9ICK A;  3Q8K A;  2P35 A;  4ZH4 A;  5CB1 A;  7ICO A;  5K4L A;  5J0P A;  3EYZ A;  5ALK A;  2JRZ A;  3DV9 A;  3H8M A;  4QWA A;  4M9J A;  3V72 A;  2Y0S F;  4DSE A;  5J0T A;  1XO0 A;  2LYH A;  2W43 A;  1CI4 A;  5AM3 A;  4NL9 A;  4PGX A;  4BJQ A;  1L8O A;  3WKA A;  4F71 A;  3PML A;  4O3P A;  4F3O A;  2C28 A;  1X2I A;  5FP0 A;  3A0B U;  4U7C A;  5KT6 A;  2G5H B;  1SKS A;  4HAI A;  4ZOH C;  2QB1 A;  5AI0 A;  1QQ7 A;  3AM9 A;  2D3D A;  4KN7 A;  3QUQ A;  4JWN A;  4BX9 C;  4M9G A;  1ZQ1 C;  2F1I A;  2MA1 A;  2H3F A;  5AI8 A;  3PW0 A;  3BQ0 A;  1VLB A;  5CRX A;  1L3S A;  1L7N A;  3QNM A;  1ZOL A;  5ALV A;  1ZJM A;  2HOF A;  3MGV A;  2DWQ A;  3PW2 A;  4C4T A;  4J9R A;  3L4P A;  1IIP A;  2WTF A;  2HBJ A;  2HBK A;  4DS5 A;  2MU2 A;  4KLU A;  3RB4 A;  4P0P A;  5EE1 A;  9ICO A;  3T5H A;  8ICM A;  1JMS A;  3C1Y A;  2H3Q A;  5JRT A;  3S6J A;  1D8L A;  5ALZ A;  4CGZ A;  1S5L U;  2BCR A;  4TUQ A;  2ZIW B;  4DQS A;  4P4M A;  4YMN A;  4EEN A;  4P2H A;  1YT3 A;  3H8S A;  3V6H A;  3NGD A;  2ZG6 A;  5CA7 A;  3WU2 U;  1X6J A;  4XRH A;  4UBC A;  2WF5 A;  2G08 A;  5KFI A;  1TKD A;  4YMO A;  4Z6D A;  4RQ8 A;  1K1S A;  4QZA A;  5AIB A;  4O5C A;  5DGB A;  4MFF A;  1J2M A;  3KZI U;  3NRZ A;  4DSF A;  7ICP A;  9ICW A;  3I28 A;  4PZN A;  4LZD A;  3LWL A;  2R8J A;  4GXJ A;  1KSP A;  8ICG A;  5DQG A;  2KEY A;  3H8W A;  2KIC A;  1WWU A;  5DGA A;  4NLN A;  3F2C A;  1BGX T;  4RT2 A;  2KNJ A;  2WF7 A;  3KOO A;  4R8U A;  5KFG A;  4DSK A;  8ICB A;  2Y9U A;  2B6G A;  5AKG A;  8ICE A;  1Z1B A;  2XO7 A;  2HHQ A;  1UCV A;  3V6J A;  2W11 A;  4E0D A;  5KFA A;  2PXI A;  1TE2 A;  4B9U A;  3IDW A;  4Q8E A;  2AJQ A;  3ZDA A;  1SZP A;  4Y2U A;  9ICI A;  4OJO A;  2JEF A;  5ALJ A;  4LJX A;  1SL0 A;  2EAM A;  3TFS A;  1N5W A;  3O0F A;  8ICU A;  2AGQ A;  4NM1 A;  2BQU A;  7ICN A;  9ICL A;  3NUQ A;  4K4H A;  3RJH A;  3RH6 A;  5TIS U;  2NYV A;  4FE3 A;  4QZB A;  1Z19 A;  1X9S A;  1ZQR A;  4LZG A;  3SMV A;  1JXL A;  4DSJ A;  5J0Q A;  1BVS A;  3AUO A;  4CRX A;  1ZQL A;  2HVH A;  4O5K A;  2HOQ A;  3OJU A;  2KFN A;  2EAN A;  5AHX A;  3ZD8 A;  4QZ8 A;  3EWA A;  4YR0 A;  5AK4 A;  1T4G A;  2PMZ F;  2BCS A;  1KBU A;  4DF4 A;  2IHN A;  2KD1 A;  2YB1 A;  5JUM A;  4DOA A;  1ZQI A;  5EWE A;  5ALF A;  3UXO A;  4ECV A;  5C5J A;  3RR8 A;  1PK1 B;  1UT5 A;  1KDH A;  5AIA A;  2KJ8 A;  2E3T A;  3MR2 A;  2HVI A;  4J9S A;  2R8I A;  3RB6 A;  1CEZ A;  1TK8 A;  2K8A A;  1SB3 C;  2ODG A;  2EAP A;  4O0I A;  3NRW A;  5L1M A;  7ICQ A;  4UAS A;  4IRC A;  4I2F A;  4ED2 A;  5KFO A;  3QEB Z;  4DQR A;  1B22 A;  3AQF A;  3UPQ A;  4QZC A;  5AK5 A;  4UAY A;  3C2M A;  2M9N A;  2VA8 A;  3BQ1 A;  3UMC A;  3AEV A;  2HBL A;  8ICZ A;  3KD3 A;  4XQ8 A;  2W9A A;  3SV3 A;  3NTU A;  3M9M B;  2R18 A;  2WF9 A;  5D46 A;  5L1L A;  4EEL A;  1WCN A;  3SAF A;  2OEH A;  1HJP A;  1ZQO A;  4QZ9 A;  2DPI A;  3SZ2 A;  4FFD A;  4I2H A;  3FYH A;  3E2E A;  2FPM A;  3QX7 A;  2KHV A;  4TUR A;  3NS1 A;  4RNM A;  5KFF A;  8ICH A;  1T7P A;  1PK1 A;  5EWF A;  3C29 A;  1K1Q A;  2VA3 A;  3PO4 A;  5GTH U;  4DLE A;  2FLL A;  4YXJ A;  8ICT A;  1KL9 A;  3UQ0 A;  2C2D A;  5F9N A;  5KT2 A;  4UB4 A;  2KJ5 A;  2E8N A;  2A1A A;  4P0P B;  2Y1J A;  5G5G A;  3M6Z A;  4C4R A;  5KT5 A;  4RQ4 A;  7ICM A;  1S0M A;  2ZUC A;  3C28 A;  4KLI A;  2LYB A;  2V4R A;  1NK4 A;  3ISB A;  1A0P A;  4ECY A;  1TAQ A;  1QCK A;  4Y2T A;  2I5H A;  3BJY A;  4RQN A;  4ECW A;  1ZQZ A;  1Z4O A;  1XNS A;  1J2N A;  3HWT A;  2JXJ A;  3MDA A;  3GQC A;  2XCA A;  4ECZ A;  3TFR A;  5KT4 A;  4GXK A;  1JRP A;  1XO1 A;  2WF6 A;  4Q44 A;  3J81 j;  3RRH A;  5AM0 A;  4R65 A;  3EPI A;  2HI0 A;  3GV5 B;  4JMU A;  3K1R B;  2BCV A;  2ZTD A;  5DB9 A;  3QE9 Y;  1BPE A;  2KV2 A;  2G5I B;  3D2Q A;  4EYI B;  7ICU A;  1T94 A;  2GOL A;  2BQR A;  3RAX A;  4DFM A;  3HKZ F;  3Q8S B;  4AYB C;  1T8E A;  2WHE A;  2RDJ A;  1JN3 A;  3IP4 B;  1NJW A;  5KFD A;  4C7Z A;  2KIW A;  3GII A;  1X66 A;  3NAS A;  3QEA Z;  2YTU A;  3QUT A;  4QWD A;  1NK8 A;  4IC9 A;  1ZQM A;  9ICE A;  5DDM A;  9ICF A;  3C2L A;  4MEX A;  4XUS A;  3L3F X;  1N48 A;  4PPX A;  2KE7 A;  3NVY A;  1AQ6 A;  5ALO A;  4F92 B;  1WYG A;  2ZJ8 A;  4RQ2 A;  4EBD A;  2IA6 A;  1DRG A;  1KFD A;  1F5S A;  4UB6 U;  4AP9 A;  5ALP A;  4QW8 A;  2R8G A;  2LM1 A;  1QSL A;  1NKE A;  3N7S C;  1BPD A;  5AK3 A;  4EX6 A;  4IQU A;  2ZTE A;  4KLT A;  3H0M B;  4MFC A;  2VJ4 A;  2J6S A;  2WFA A;  2G07 A;  3HW8 A;  1RM6 C;  2I1Q A;  5AKI A;  3CNH A;  1COK A;  3K75 D;  3WK8 A;  4NLC A;  3IM1 A;  8ICL A;  1ZD2 P;  4M9L A;  2Q4T A;  1A6S A;  4JB3 A;  5DLG A;  3GIJ A;  4C8M A;  4FZN A;  5F9L A;  3OHB A;  3B0Y A;  2ISP A;  4ED1 A;  1XU4 A;  5KFZ A;  2ZIU A;  2CRX A;  5T14 A;  1GO3 F;  4NV0 A;  4EEK A;  2KN7 A;  1SV0 C;  4DCC A;  3MDC A;  4EEY A;  4UBB A;  4DO9 A;  2YN4 A;  1KFT A;  5DBC A;  1OXJ A;  2WB1 C;  4C4S A;  5J8Y A;  1LV5 A;  2QKQ A;  5DDY A;  1LVH A;  4ED3 A;  1L8L A;  1A76 A;  2OWO A;  1U9L A; 
#chains in the Genus database with same CATH homology
 3A0H U;  3A0B U;  4IL6 U;  5B5E U;  2DUY A;  5B66 U;  2AXT U;  3KZI U;  4PJ0 U;  4UB6 U;  4UB8 U;  5GTH U;  5KAI U;  5E79 U;  1S5L U;  5KAF U;  3WU2 U;  5GTI U;  5H2F U;  5TIS U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...