5B5EU

Crystal structure analysis of photosystem ii complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b5eU01
5KAFU 5E79U 2AXTU 5H2FU 4UB8U 3A0HU 5KAIU 5GTHU 2DUYA 3A0BU 5B66U 3KZIU 4IL6U 1S5LU 4PJ0U 5TISU 5B5EU 3WU2U 4UB6U 5GTIU
chains in the Genus database with same CATH superfamily
3SAHA 1U49A 1VDVA 9ICKA 3NVVA 2VA2A 5DLFA 5IILA 3K75D 1XNSA 2AJQA 3VC8A 1L5UA 1FIQA 2HI0A 3NS1A 2QARB 4PGQA 4UB4A 4ZH4A 3LDAA 1PK1A 1Z1VA 1RYRA 1V85A 2K4PA 2GLEA 2I9GA 3KD3A 2LBOA 1SKSA 1HUOA 5GTIU 4TUPA 5HHHA 2VJ4A 3JPPA 5ALYA 2VKQA 2FMPA 2GO7A 4DO9A 2WF6A 4I2HA 1JIHA 1RYSA 1TKDA 3QE9Y 4F50A 3PSIA 2PMZC 1HEKA 3F53A 4Y2QA 7ICRA 4FS2A 3QZ8A 3NUQA 1UA1A 3QUBA 3ZDBA 3AN1A 2F1JA 4QZAA 3SV4A 3M8RA 4Y2XA 3NVWA 1S8OA 1ZQVA 4F2SA 2ZIXA 4DCCA 8ICUA 1A76A 4IR1A 5AK6A 2JR5A 4XA5A 2XIDA 4RPZA 7ICNA 2F77X 2QB0A 2KTQA 3NRWA 4QJFB 1B22A 2YMMA 2CPRA 2PI4A 3H4BA 1ECWA 1XSPA 1ZOLA 1RZTA 2HHSA 2W03A 5KFUA 1KW4A 1XC9A 1RYUA 5KFMA 4GC6A 5KG7A 4CNQA 1ZQ1C 1L3VA 5IINA 2VANA 1KFTA 5ALQA 2MA1A 4XUSA 1TAMA 2CN1A 8ICEA 4RQ8A 4ELUA 3ETLA 3D2NA 1CUKA 4F4KA 2ZXHA 3B0XA 1CRXA 1ZQDA 2H3QA 4I2DA 4P0PB 3C1ZA 1WYGA 4F5RA 3RRHA 1AROP 1S0OA 2Y0SF 4Q8EA 9ICNA 5TISU 3MC1A 4IC9A 2JEIA 3WKCA 3Q8LA 4RQ0A 1P7DA 4R8UB 3M9MB 3HX0A 4TUSA 3THVA 2FMSA 4F4XA 4I2JA 2KEYA 4F5PA 1L3SA 3RB6A 2WAQC 4ICAA 2ASLA 4PL2A 1KEJA 4UASA 1S0VA 3SV3A 2P6RA 3OGUA 2KN7A 5AM5A 5AICA 1SL2A 4BWJA 1ZYQA 1NK4A 1TAUA 4O5KA 1X9MA 5KG6A 2DBYA 1D8YA 2KHVA 4O5EA 3TADA 4J9NA 3RH4A 4DSJA 2WB1C 1XSNA 3WK5A 2YN4A 3IRUA 5G5HA 5JRTA 1ZQJA 2BCVA 4MF2A 2KNJA 1S0MA 2HCFA 3M9OB 3GIIA 8ICGA 2KMDA 5IIKA 2IHMA 5ALHA 4Q8FA 3F5AA 3MR6A 2KFZA 4RNOA 3RB3A 2P35A 4GXKA 4BUGA 4QZIA 2B0CA 5JTIA 1DRGA 2XGQA 3SI8A 2JRZA 2UVVA 4M9NA 4M9LA 4O5CA 3BS5B 3WK8A 2CRXA 2DWQA 3M6ZA 3ALRA 5AM1A 2HW3A 2KZZA 2FMQA 4NLKA 4KTQA 4M9HA 1X9WA 5DBBA 1V97A 5CHGA 1N5XA 2RDIA 1F5SA 5J2KA 1ZQSA 2B6GA 1ZQWA 3CNHA 2E3TA 2NRTA 4JV1A 8ICSA 5AKIA 3KKAC 2XY5A 1TK0A 2F8LA 4QWDA 3SENA 2DKZA 3H4DA 5D4BA 1ZD3A 2ZIVB 3BJYA 3GIMA 4F91B 1Q3VA 2KICA 4KX3A 8ICXA 1DXSA 3PSTA 1SXEA 3F2BA 1X6JA 4DL2A 2ZXIA 1U4BA 1ZQCA 5IIOA 4FZLA 2NO4A 3IM1A 2W55A 4RUAA 2BGWA 3NVYA 2O6KA 4NL9C 4YR3A 5KT2A 5KFSA 5F9LA 1COKA 1IV8A 3OJSA 1OUQA 2H3IA 3FAHA 4P0QB 5KFLA 1X6IA 1D9FA 1VJ5A 2OEHA 2EZZA 8ICZA 2ZTEA 2AGOA 2DPIA 5J0WA 4EZ6A 2VA3A 3F2DA 3RAXA 1K1QA 5KFFA 2BCSA 1BPDA 2PMZF 1QH9A 4FS1A 4RQ2A 1L8LA 2K8AA 2VIXA 5KAIU 4JB3A 1KN5A 3AU2A 4DFDA 2W11A 4O9MA 2HBLA 4I29A 5AIAA 5IIIA 5J2IA 2K4HA 3TAQA 5DBCA 4XQ8A 5EWEA 3LWLA 5KFNA 1MA7A 1JX4A 2EAPA 3QXGA 3QYPA 1QCKA 1LKYB 9ICVA 2WF7A 1V9PA 3QZ7A 9ICHA 7ICJA 5KG5A 9ICMA 5AK5A 5KT7A 1PVPA 3PX4A 4BDPA 1JXLA 4YG2A 5ALIA 3MBYA 5J0XA 4JMUA 1N61A 2N1RA 1KSPA 4JK1A 1MQ2A 2LI6A 4DSLA 4F71A 1NK0A 2NRZA 2KFNA 2MUTA 2C22A 4J9PA 2E5SA 4YR0A 5DQIA 5D49A 3ZDAA 4P4OA 1DK3A 1L6NA 2ATLA 2W54A 3V6KA 3D6JA 5DDYA 3DDHA 1QLNA 1OXJA 3UMBA 4G3IA 2IBKA 5AM3A 2IOHA 5KFRA 4ECSA 2RRDA 4ELTA 3C2MA 4Y2YA 8ICMA 1JALA 4YP3A 3PW2A 1SXDA 5AKYA 3MFIA 4YCXA 5AKXA 4NLGA 3FDSA 4F2RA 2A1AA 4C8NA 1WWVA 1UCVA 2P66A 3C28A 4B6JA 2WB1F 4J9OA 4ECUA 5J2BA 2H3FA 1ZD4A 9ICGA 2Y1JA 1S5LU 3C21A 2YY6A 2PFNA 2HHVA 1YZ6A 4P2HA 1EXNA 3KBBA 4ED7A 1SWWA 3NGDA 2F44A 3C2KA 5CJ7A 3HPOA 2A19A 2W9CB 5KFHA 5J0YA 4BGDA 2Y0SC 4HAIA 4FZNA 4BJQA 3SYZA 5ALRA 1XSLA 5KFEA 1C7YA 3T79A 5ALZA 1IIPA 5CP2A 1UA0A 4F5OA 3WK6A 8ICWA 4PHAA 3C1YA 1RDFA 5CR0A 2KJ5A 2IOFK 3UXOA 4OCZA 3RJKA 2YB4A 1PVRA 4B9SA 1QSYA 1JXEA 4TQRA 1X9XA 4Y2VA 1FO4A 1Z1BA 3PV8A 2Q0ZX 2YB1A 3H8WA 5BOMA 2YX8A 3U26A 3OTQA 1Z19A 2FE9A 1A0PA 3V6HA 1B43A 2ZJAA 1XWLA 4DL5A 1TAQA 2WTFA 3RBDA 5DQHA 3KHHA 2AH5A 1ZQXA 5IIJA 2J6TA 1X66A 1QQ5A 4OJLA 1URJA 1D8LA 3R9KA 3MDAA 2FJ6A 1XO0A 2V4QA 3RAQA 4QWBA 3KFUF 1D8BA 4J9RA 3UMCA 5HMLA 4NY8A 5CB1A 2G09A 3N28A 2ZIWB 2QKQA 1X40A 2J6UA 1L7MA 1QSSA 3V6JA 3KHGA 3IP4B 3AMZA 2MU2A 5L1IA 2KZ3A 3RTVA 2I5HA 1ZRMA 4RQ5A 2ZIUB 2NO5A 3OPXA 4M6WA 4UARA 1ZXIA 4KITB 2LM1A 5AKZA 5KFGA 3N4MB 1T8EA 3K4GA 4ED3A 3E2EA 9ICLA 2PKEA 4UB2A 7ICUA 1KTQA 4PHEA 4F92B 5ALEA 4F5QA 4NM2A 4Y2JA 2QARA 3V72A 5HMMA 4LVSA 1S97A 2ISPA 3KKAA 2NRWA 5KG4A 4UAYA 2L5YA 2K89A 3HILA 3KHRA 2JGAA 4GFJA 5DDMA 1N48A 2KVCA 2AHOB 7ICLA 2XVTA 5AI9A 4ECXA 5ALNA 2WF8A 4EX7A 5J0PA 4DQQA 5D46A 5AI6A 1VLBA 1XO1A 4UAUA 2HBKA 4RPYA 3PVXA 1ZQZA 3BQTA 3C2LA 2W3RA 3RH5A 3WK4A 8ICIA 1ZD5A 1L8OA 2PI5A 1YT3A 3ORYA 4I27A 5KFBA 1RPLA 3LK9A 4CE6A 5KT5A 5HHIA 2LYAA 1SL0A 9ICEA 3F2CA 5FP0A 3RR7A 4RQ3A 2HHTA 4YMMA 4JV2A 2EDUA 4UBBA 3KZXA 3PY8A 4PHPA 4RU9A 4FBTA 3ED5A 3MR2A 3Q8SB 4DS4A 5J2FA 4UAVA 1RM6C 4M04A 2RLTA 4UAWA 1Q8KA 4PZOA 2BKEA 4C7YA 4DOAA 1MN8A 5HR6A 5KFWA 3QEBZ 2OWOA 2BZFA 2DFLA 5J8YA 3PO4A 4I2IA 3L4PA 1ZQPA 3AUOA 4K4IA 3AEVA 2XICA 2M9NA 7ICKA 2KP7A 2KK0A 5ALGA 3V7JA 3N7SC 4P0PA 4RUCA 1FEZA 4YMNA 2JEGA 4Y2TA 3M9NB 1QQ6A 2EH9A 4F4ZA 3N97B 3WKBA 4PGXA 4R8UA 1Z00A 5DGBA 5EE0A 4EYIB 2DUYA 3H0RB 5AKHA 1V38A 9ICJA 4C4SA 1SZHA 8ICNA 3ZD9A 3BQ1A 3MGVA 2Y9TA 3LYSA 4GXJA 4UW9A 4Q45A 2NRVA 3SQIA 3I76A 3OHAA 1ZQKA 2HBJA 1Z00B 2JH7A 1T4GA 5ALSA 1ZQOA 1MSWD 4EBEA 2MSNA 4I2BA 4MFAA 3PMNA 4DSFA 4C8OA 1ED1A 4C7ZA 4O3NA 1ZQTA 4C4TA 3SAFA 5AM0A 2HHXA 4KN4A 4OJPA 5J0RA 4MEYA 2G5IB 3RJEA 2GOLA 1L7NA 5J2GA 3QU7A 5DGAA 9ICIA 5KFTA 2D8CA 5KFAA 8ICYA 2GH1A 2KG5A 3QU9A 2GWSA 5ALXA 5L1MA 5DBAA 3QU5A 2R8IA 3RB4A 3BS5A 1JMSA 4DSEA 3GQCA 3JPTA 1Z4OA 2RDJA 4IQVA 3TARA 1JROA 2KE7A 2JH1A 1KLNA 3EYZA 5KFYA 5F9NA 7ICQA 1CI4A 1ZQEA 1ZD2P 3PSFA 4JV0A 4RNNA 2E8NA 4QWEA 3EWAA 4IR9A 4GLXA 3KZIU 3PZPA 2Q4TA 2V4RA 1KBUA 4YD2A 1N63A 2F2AB 4QZ8A 1D9DA 2IMWP 2ASJA 2JV3A 3PW5A 4GIBA 2K4EA 1A77A 1T94A 5H2FU 1MQ3A 3GIJA 3UPQA 2ZIVA 1KDHA 4EEKA 1MC8A 2JZBB 1SV4A 4J03A 4TURA 1L3UA 4O3QA 2FPKA 2HHUA 4DL4A 3FYHA 2FI1A 4I2EA 1NOMA 3HJEA 3H8SA 2ZJ8A 3DEEA 1ZJNA 3TFRA 3G6XA 5J0UA 2K4IA 3ISDA 4NJ8A 2KHQA 5EE9A 4EBDA 4EELA 5J2AA 4ED1A 2Z7JA 1BPXA 4J9MA 2HSZA 3HT3A 1NK5A 3TKAA 5KFCA 4P0QA 9ICFA 5KT3A 1NKEA 3UXNA 7ICEA 7ICIA 3T5KA 2KZMA 8ICHA 3M8SA 2ES6A 3GV7B 1SIJA 3C5FA 3HRDD 4R66A 1NZPA 4P4PA 4PZNA 2FDRA 2LHTA 2W8LA 4FZMA 3RFAA 4DL3A 2BDUA 4RQ1A 3ZI4A 4Q43A 1LB2B 2KSOB 4QWAA 3TFSA 1ZJMA 2C28A 2QLTA 4UB6U 1WCLA 5AKKA 1NI3A 2LM4A 1KFDA 3D2QA 4Y2RA 3UMGA 3CW2C 3G6VA 1LKYA 3WKEA 5DKWA 2BQ3A 1OW5A 4KLGA 1T7PA 3I28A 5TZVA 5KFXA 1NJYA 4NLBA 2LYBA 1BNPA 2CXYA 3MGIA 3WK7A 4HYKA 5KT6A 4KLTA 4J9SA 3LWMA 1TVAA 3Q8MA 5EE3A 4QWCA 2H3ZA 9ICUA 3H0MB 2I6XA 1QQ7A 3NRZA 2IA6A 2DGZA 2BHNA 2BPCA 1ZQNA 4EENA 4A8EA 4J9LA 4KLOA 3LVVA 2EZYA 1ZQFA 4UB5A 5J0OA 2MRLA 3RF9A 3AM9A 5AM4A 8ICLA 2BQUA 1TE2A 1UT5A 2FLPA 4RT2A 5KFIA 2ASDA 3M7DA 3MDCA 1FFVA 3QUCA 4KMUA 2EZXA 2R18A 4G9BA 4GC7A 4Z6CA 2W9AA 1ZQRA 2D3DA 2H5XA 2YQEA 3I1YA 4PHDA 4KLDA 1KRPA 1PUZA 2A1JB 4UB8U 3JPSA 5AI4A 5HNKA 4IS7A 2HOIA 3WKAA 3HWTA 1L7PA 9ICCA 1ZQLA 4O3SA 2ZUCA 2M0NA 4C0ZA 4AYBC 4U7CA 4ACOA 2OXOA 5ALVA 4EYHB 1SGGA 5J2CA 1F0MA 1NZBA 4Y2SA 5AKGA 2FLNA 1COOA 3RJGA 2G5HB 3ONNA 3Q8QB 5L1KA 5KNIA 3O0FA 3QU2A 4F4WA 1H38A 4YXMA 2W9CA 4ECRA 1WWUA 4IQWA 8ICPA 3D2SA 2PXIA 1RXWA 5AI0A 2D6FC 4GXIA 3GV5B 2YMQA 2W43A 2ESEA 4QZ9A 3ZD8A 3SAGA 1RXVA 2KKPA 5L9XA 4DF8A 4Z6DA 5E79U 3QUQA 4DLGA 5ALKA 3GZFA 3H8MA 2RQ5A 1KKXA 3BQ2A 3NVZA 3RJHA 4UAZA 3B0YA 1FFUA 2W9BB 7ICPA 4PJ0U 4ECQA 3FC4A 3JPOA 4RQ6A 1XU4A 5ALFA 3Q8PB 2KV2A 4BX9C 4ED8A 1ZQQA 2KD1A 9ICQA 3A0HU 2UVWA 2KJ8A 2PFPA 1O08A 5J29A 5HR7A 7ICSA 3QNMA 3WK9A 1ZQYA 4JWNA 2C2EA 2DPJA 4OD0A 3PMLA 2R8JA 4KLIA 5AK3A 3WU2U 1IM4A 2XCPA 1ZQHA 4PPXA 5KFPA 4I2CA 3SZ2A 2ZTCA 4ED6A 1LV5A 5KL1B 5CWRA 3OSNA 3RBEA 1HJPA 2F1HA 2ZIWA 2LMRA 4YD1A 3E0FA 4Z6FA 5EWGA 3PW4A 2G07A 1BVSA 3JPNA 2W04A 4O3PA 1S0NA 3RJFA 4I2AA 5ALPA 4M0AA 4UBCA 4KLJA 4Q44A 1B4FA 2ZIUA 2BQRA 8ICQA 5GTHU 1HIWA 9ICXA 2FPMA 3IN5A 3QEAZ 4KMOB 4DFJA 3AU6A 1WCNA 4NLCA 2VJ5A 3ZDCA 4I2FA 1U48A 1LVHA 1NJWA 5C5JA 3EUB2 8ICOA 4CCHA 1IXRA 5DG7A 1SWVA 3CRXA 5AIBA 4NWIA 3FM9A 2HBMA 5CEHA 2OHFA 2XI9A 1WUDA 4RPXA 5DG8A 1JI7A 2RHFA 3A0BU 3GIKA 4IRDA 2HDOA 4OJ6A 3H40A 4QZGA 4KLFA 4YQWA 3IV6A 4KLHA 4RQMA 2DL0A 1Q46A 1DK2A 4DF4A 2J6SA 1N2XA 3J81j 4DQSA 3L5KA 2P6UA 2AXTU 4PGYA 1ZQBA 2BCRA 7ICMA 1BPZA 4JWMA 2NV3A 2KKVA 1NNLA 1T3QA 2WFAA 4KLQA 4EBCA 3CP8A 3IHQB 5ALJA 5L1LA 2EANA 2PFOA 1A6SA 3HKZF 4KLLA 1YZ7A 2C2RA 5CA7A 4M2YA 2ALZA 1QTMA 4KLMA 5AM2A 3SD7A 5AK4A 4Z6EA 3H0LB 4FFDA 3F5EA 2BR0A 2LKYA 3BQ0A 3BQ7A 4NL9A 8ICTA 5EE1A 3Q8RB 4LZDA 5B5EU 4DL7A 4B9VA 4DOBA 5KFQA 2YMPA 4QZFA 1NKBA 1NK7A 7ICOA 3TACB 1UT8A 5K4LA 2XGPA 4K4HA 2XC9A 1PK1B 2MAXA 3PO5A 9ICTA 9ICOA 4RQ4A 2WF5A 2HVHA 4AYBF 4F5NA 2IHNA 4WJ3B 5JUMA 8ICJA 8ICAA 3GILA 5J0TA 3T5HA 3UM9A 3RJIA 3PW0A 1GO3F 1WG8A 2OYYA 4PL1A 3OHBA 2ZTDA 4DFMA 2LYHA 3QUTA 2ISOA 4US9A 2VA8A 5DB7A 4QW9A 4J9QA 4QNLA 2Y9UA 1K1SA 3KHLA 2K8BB 4F93B 8ICVA 5J0SA 4MFFA 4QZHA 5AKJA 1ZQIA 3K1ZA 2DF4B 3HP6A 3N7RC 2ZIXB 4DSIA 2AQ4A 4C8LA 4KX5A 2E1EA 1BNOA 8ICFA 4OJ5A 1J97A 3L3FX 2QB0B 4UATA 1S10A 2K60A 3SR6A 4B9NA 1UHUA 1SB3C 4UB1A 2FPLA 4DLEA 2IOFA 3KOOA 4C4RA 3UQ2A 1J2MA 1C20A 4XRHA 1Y88A 3DV9A 9ICAA 4O3MA 1JRPA 4E0DA 1NJZA 4IRCA 3EZ5A 3IG8A 4YR2A 2AU0A 3TANA 2G06A 4UQGA 3BZCA 2W9MA 2QB1A 5KG2A 4US8A 4B9MA 1BPEA 9ICBA 2AGPA 5ALTA 4F3OA 2E8MA 4NM1A 3MR3A 1B0XA 2R8HA 4Y2PA 5A0LA 3V7LA 1NKCA 2AGQA 2JMGA 3TI0A 1ZQAA 2XY7A 5L1JA 3PSPA 3TQ1A 3ICXA 3QU4A 4RQNA 3BZKA 3ETRA 2ZUDA 2XO7A 2JZBA 1PK3A 5J2JA 3ISCA 5DLGA 2ODGA 2ZJ5A 4JUZA 4F8RA 3JPQA 1SV0C 4EX6A 4C8KA 2NRXA 4B9TA 1Q3UA 2BCQA 2NYVA 1RQNA 4O0IA 2E1FA 4ECYA 2AQ0A 4ED2A 3EPGA 1NK6A 3ZDEA 1JUDA 5DQGA 5IIMA 8ICKA 3H7IA 2UVRA 4LJXA 4QIWC 4X5VA 3MR5A 4FO6A 2W7OA 4TQSA 1S77D 1PZNA 2HOFA 2BPFA 8ICRA 1JN3A 3TAPA 4IRKA 5J2EA 2EAMA 5AKEA 5AHXA 1KFSA 3GU3A 5KTQA 3RRGA 4O3OA 3AQEA 4MFCA 4KLUA 1L7OA 2KSOA 2XCAA 5EOZA 4DL6A 3N7PD 9ICSA 3EW9A 2OCEA 1K5OA 2F76X 1SZPA 1UQVA 4EZ9A 2F8KA 1CEZA 1U47A 1SKRA 2YTUA 5F3XB 5ALUA 4QZDA 3ISBA 2K8CB 3Q8KA 4DQIA 2E8OA 1X42A 4CF4A 4KN7A 2R8KA 4BXOA 1U45A 5KT4A 3BS7A 4R63A 3PX6A 2LPEA 3RB0A 2YMLA 4J9KA 4O3RA 4B9UA 5ALLA 3PR4A 1X9SA 3MABA 4YFKA 3E58A 4BXOB 3GV8B 3MFHA 7ICHA 4LZGA 4DEZA 4R64A 3VCBA 1IG6A 9ICRA 2DKXA 1T3NA 1ZQUA 4ELVA 5DB9A 3UQ0A 5AI5A 4QZEA 3KTQA 3OSPA 2HVIA 4RZRA 2KJ9A 2W3SA 3M6KA 5J8YC 3C5GA 4C8MA 1N62A 1Z3EB 4YN4A 4RNMA 1HUZA 4AP9A 4QZBA 3HKZC 4MEXA 2HMXA 4USAA 5CRXA 8ICBA 4MF8A 1Z4NA 2HOQA 1J2NA 3QX7A 2A1JA 3V7KA 2JEJA 4RT3A 4DFPA 5JU5A 5KFJA 4I28A 5KG1A 4ECZA 3K1RB 4M9JA 3G6YA 1SKWA 5KFVA 5BOLA 1X2IA 1RG6A 5KFDA 4P4MA 3SEIA 4NLZA 5AKLA 5KL8B 1NK9A 1PVQA 5B66U 4ECWA 4ZOHC 2A3VA 9ICPA 3RR8A 3GDXA 5C0YA 3BDPA 2BCUA 2Y1IA 4CF3A 2DQNB 5DG9A 5AI8A 5ALOA 4YXJA 1TV9A 3T3FA 1M6YA 2BPGA 2OH2A 2W7PA 2H3VA 4K4GA 5DB8A 2I1QA 4DQPA 4UB3A 1NK8A 1O03A 2WAQF 3TADC 3RJJA 4IL6U 5KFKA 1BPBA 2MUTB 2W9BA 2XY6A 3T5JA 4BWMA 3CYMA 2G0AA 4IQUA 3C23A 1NJXA 5ALDA 5ALWA 1AQ6A 4I2GA 3IG5A 3PW7A 5KG0A 4ECTA 3SMVA 3IDWA 2WHEA 4CRXA 5EWFA 7ICGA 5KG3A 1U9LA 1ZETA 4DOCA 1TK5A 4R65A 1ZQMA 4NLNA 4CGZA 2UVUA 4YVZA 1DGJA 4YMOA 2PFQA 4TUQA 2KOBA 2ZG6A 4ED0A 4DSKA 5G5GA 3AQFA 4Y2UA 1N60A 2RP5A 4QIWF 5KFZA 4CDGA 2HHQA 5T14A 4MHVA 3HW8A 3PX0A 4RQ7A 4CF5A 2G08A 2KIWA 3JPRA 1BGXT 4DS5A 3PR5B 4F4YA 1SL1A 2KIVA 2F1IA 1TFRA 9ICWA 2E8PA 3B9JA 1S76D 4IQTA 5KFOA 4EEYA 4FBUA 4OJOA 2R8GA 5KAFU 2BDPA 1ZRNA 4FE3A 7ICVA 4M9GA 2HHWA 5J0QA 5J2DA 4B9LA 2OM6A 1S9FA 4F72A 3OJUA 3GFKB 2KVSA 3M1YA 4DWIA 2W8KA 1RQLA 4QZCA 5BPCA 5J2HA 3UXPA 1L3TA 1TK8A 3S6JA 1DGSA 2JHDA 1N56A 3RH6A 3C29A 4DQRA 3EPIA 1BPYA 5HP4A 1KQQA 5DB6A 3NTUA 4PH5A 3MGHA 2FLLA 1SV0A 3ZDDA 1UPHA 4U6PA 4KLEA 4NXZA 4KLSA 1XS9D 4M47A 1KL9A 2WF9A 4QW8A 1N5WA 3AL0B 2B21A 2F3NA 2V9WA 5ALMA 7ICTA 3T5LA 4C80A 4NV0A 3LVWA 7ICFA 1DOQA 1ZQGA 8ICCA 1QSLA 3PNCA 3NASA 4ECVA 4DFKA 2JEFA 2C2DA 1F44A 4OO1J 2ZUBA 2EAOA 3H8JA 3WKDA 4M6WB 2JXJA 2EQYA
chains in the Genus database with same CATH topology
5KAFU 5E79U 2AXTU 5H2FU 4UB8U 3A0HU 5KAIU 5GTHU 2DUYA 3A0BU 5B66U 3KZIU 4IL6U 1S5LU 4PJ0U 5TISU 5B5EU 3WU2U 4UB6U 5GTIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF U;  5E79 U;  2AXT U;  5H2F U;  4UB8 U;  3A0H U;  5KAI U;  5GTH U;  2DUY A;  3A0B U;  5B66 U;  3KZI U;  4IL6 U;  1S5L U;  4PJ0 U;  5TIS U;  5B5E U;  3WU2 U;  4UB6 U;  5GTI U; 
#chains in the Genus database with same CATH topology
 3SAH A;  1U49 A;  1VDV A;  9ICK A;  3NVV A;  2VA2 A;  5DLF A;  5IIL A;  3K75 D;  1XNS A;  2AJQ A;  3VC8 A;  1L5U A;  1FIQ A;  2HI0 A;  3NS1 A;  2QAR B;  4PGQ A;  4UB4 A;  4ZH4 A;  3LDA A;  1PK1 A;  1Z1V A;  1RYR A;  1V85 A;  2K4P A;  2GLE A;  2I9G A;  3KD3 A;  2LBO A;  1SKS A;  1HUO A;  5GTI U;  4TUP A;  5HHH A;  2VJ4 A;  3JPP A;  5ALY A;  2VKQ A;  2FMP A;  2GO7 A;  4DO9 A;  2WF6 A;  4I2H A;  1JIH A;  1RYS A;  1TKD A;  3QE9 Y;  4F50 A;  3PSI A;  2PMZ C;  1HEK A;  3F53 A;  4Y2Q A;  7ICR A;  4FS2 A;  3QZ8 A;  3NUQ A;  1UA1 A;  3QUB A;  3ZDB A;  3AN1 A;  2F1J A;  4QZA A;  3SV4 A;  3M8R A;  4Y2X A;  3NVW A;  1S8O A;  1ZQV A;  4F2S A;  2ZIX A;  4DCC A;  8ICU A;  1A76 A;  4IR1 A;  5AK6 A;  2JR5 A;  4XA5 A;  2XID A;  4RPZ A;  7ICN A;  2F77 X;  2QB0 A;  2KTQ A;  3NRW A;  4QJF B;  1B22 A;  2YMM A;  2CPR A;  2PI4 A;  3H4B A;  1ECW A;  1XSP A;  1ZOL A;  1RZT A;  2HHS A;  2W03 A;  5KFU A;  1KW4 A;  1XC9 A;  1RYU A;  5KFM A;  4GC6 A;  5KG7 A;  4CNQ A;  1ZQ1 C;  1L3V A;  5IIN A;  2VAN A;  1KFT A;  5ALQ A;  2MA1 A;  4XUS A;  1TAM A;  2CN1 A;  8ICE A;  4RQ8 A;  4ELU A;  3ETL A;  3D2N A;  1CUK A;  4F4K A;  2ZXH A;  3B0X A;  1CRX A;  1ZQD A;  2H3Q A;  4I2D A;  4P0P B;  3C1Z A;  1WYG A;  4F5R A;  3RRH A;  1ARO P;  1S0O A;  2Y0S F;  4Q8E A;  9ICN A;  5TIS U;  3MC1 A;  4IC9 A;  2JEI A;  3WKC A;  3Q8L A;  4RQ0 A;  1P7D A;  4R8U B;  3M9M B;  3HX0 A;  4TUS A;  3THV A;  2FMS A;  4F4X A;  4I2J A;  2KEY A;  4F5P A;  1L3S A;  3RB6 A;  2WAQ C;  4ICA A;  2ASL A;  4PL2 A;  1KEJ A;  4UAS A;  1S0V A;  3SV3 A;  2P6R A;  3OGU A;  2KN7 A;  5AM5 A;  5AIC A;  1SL2 A;  4BWJ A;  1ZYQ A;  1NK4 A;  1TAU A;  4O5K A;  1X9M A;  5KG6 A;  2DBY A;  1D8Y A;  2KHV A;  4O5E A;  3TAD A;  4J9N A;  3RH4 A;  4DSJ A;  2WB1 C;  1XSN A;  3WK5 A;  2YN4 A;  3IRU A;  5G5H A;  5JRT A;  1ZQJ A;  2BCV A;  4MF2 A;  2KNJ A;  1S0M A;  2HCF A;  3M9O B;  3GII A;  8ICG A;  2KMD A;  5IIK A;  2IHM A;  5ALH A;  4Q8F A;  3F5A A;  3MR6 A;  2KFZ A;  4RNO A;  3RB3 A;  2P35 A;  4GXK A;  4BUG A;  4QZI A;  2B0C A;  5JTI A;  1DRG A;  2XGQ A;  3SI8 A;  2JRZ A;  2UVV A;  4M9N A;  4M9L A;  4O5C A;  3BS5 B;  3WK8 A;  2CRX A;  2DWQ A;  3M6Z A;  3ALR A;  5AM1 A;  2HW3 A;  2KZZ A;  2FMQ A;  4NLK A;  4KTQ A;  4M9H A;  1X9W A;  5DBB A;  1V97 A;  5CHG A;  1N5X A;  2RDI A;  1F5S A;  5J2K A;  1ZQS A;  2B6G A;  1ZQW A;  3CNH A;  2E3T A;  2NRT A;  4JV1 A;  8ICS A;  5AKI A;  3KKA C;  2XY5 A;  1TK0 A;  2F8L A;  4QWD A;  3SEN A;  2DKZ A;  3H4D A;  5D4B A;  1ZD3 A;  2ZIV B;  3BJY A;  3GIM A;  4F91 B;  1Q3V A;  2KIC A;  4KX3 A;  8ICX A;  1DXS A;  3PST A;  1SXE A;  3F2B A;  1X6J A;  4DL2 A;  2ZXI A;  1U4B A;  1ZQC A;  5IIO A;  4FZL A;  2NO4 A;  3IM1 A;  2W55 A;  4RUA A;  2BGW A;  3NVY A;  2O6K A;  4NL9 C;  4YR3 A;  5KT2 A;  5KFS A;  5F9L A;  1COK A;  1IV8 A;  3OJS A;  1OUQ A;  2H3I A;  3FAH A;  4P0Q B;  5KFL A;  1X6I A;  1D9F A;  1VJ5 A;  2OEH A;  2EZZ A;  8ICZ A;  2ZTE A;  2AGO A;  2DPI A;  5J0W A;  4EZ6 A;  2VA3 A;  3F2D A;  3RAX A;  1K1Q A;  5KFF A;  2BCS A;  1BPD A;  2PMZ F;  1QH9 A;  4FS1 A;  4RQ2 A;  1L8L A;  2K8A A;  2VIX A;  5KAI U;  4JB3 A;  1KN5 A;  3AU2 A;  4DFD A;  2W11 A;  4O9M A;  2HBL A;  4I29 A;  5AIA A;  5III A;  5J2I A;  2K4H A;  3TAQ A;  5DBC A;  4XQ8 A;  5EWE A;  3LWL A;  5KFN A;  1MA7 A;  1JX4 A;  2EAP A;  3QXG A;  3QYP A;  1QCK A;  1LKY B;  9ICV A;  2WF7 A;  1V9P A;  3QZ7 A;  9ICH A;  7ICJ A;  5KG5 A;  9ICM A;  5AK5 A;  5KT7 A;  1PVP A;  3PX4 A;  4BDP A;  1JXL A;  4YG2 A;  5ALI A;  3MBY A;  5J0X A;  4JMU A;  1N61 A;  2N1R A;  1KSP A;  4JK1 A;  1MQ2 A;  2LI6 A;  4DSL A;  4F71 A;  1NK0 A;  2NRZ A;  2KFN A;  2MUT A;  2C22 A;  4J9P A;  2E5S A;  4YR0 A;  5DQI A;  5D49 A;  3ZDA A;  4P4O A;  1DK3 A;  1L6N A;  2ATL A;  2W54 A;  3V6K A;  3D6J A;  5DDY A;  3DDH A;  1QLN A;  1OXJ A;  3UMB A;  4G3I A;  2IBK A;  5AM3 A;  2IOH A;  5KFR A;  4ECS A;  2RRD A;  4ELT A;  3C2M A;  4Y2Y A;  8ICM A;  1JAL A;  4YP3 A;  3PW2 A;  1SXD A;  5AKY A;  3MFI A;  4YCX A;  5AKX A;  4NLG A;  3FDS A;  4F2R A;  2A1A A;  4C8N A;  1WWV A;  1UCV A;  2P66 A;  3C28 A;  4B6J A;  2WB1 F;  4J9O A;  4ECU A;  5J2B A;  2H3F A;  1ZD4 A;  9ICG A;  2Y1J A;  1S5L U;  3C21 A;  2YY6 A;  2PFN A;  2HHV A;  1YZ6 A;  4P2H A;  1EXN A;  3KBB A;  4ED7 A;  1SWW A;  3NGD A;  2F44 A;  3C2K A;  5CJ7 A;  3HPO A;  2A19 A;  2W9C B;  5KFH A;  5J0Y A;  4BGD A;  2Y0S C;  4HAI A;  4FZN A;  4BJQ A;  3SYZ A;  5ALR A;  1XSL A;  5KFE A;  1C7Y A;  3T79 A;  5ALZ A;  1IIP A;  5CP2 A;  1UA0 A;  4F5O A;  3WK6 A;  8ICW A;  4PHA A;  3C1Y A;  1RDF A;  5CR0 A;  2KJ5 A;  2IOF K;  3UXO A;  4OCZ A;  3RJK A;  2YB4 A;  1PVR A;  4B9S A;  1QSY A;  1JXE A;  4TQR A;  1X9X A;  4Y2V A;  1FO4 A;  1Z1B A;  3PV8 A;  2Q0Z X;  2YB1 A;  3H8W A;  5BOM A;  2YX8 A;  3U26 A;  3OTQ A;  1Z19 A;  2FE9 A;  1A0P A;  3V6H A;  1B43 A;  2ZJA A;  1XWL A;  4DL5 A;  1TAQ A;  2WTF A;  3RBD A;  5DQH A;  3KHH A;  2AH5 A;  1ZQX A;  5IIJ A;  2J6T A;  1X66 A;  1QQ5 A;  4OJL A;  1URJ A;  1D8L A;  3R9K A;  3MDA A;  2FJ6 A;  1XO0 A;  2V4Q A;  3RAQ A;  4QWB A;  3KFU F;  1D8B A;  4J9R A;  3UMC A;  5HML A;  4NY8 A;  5CB1 A;  2G09 A;  3N28 A;  2ZIW B;  2QKQ A;  1X40 A;  2J6U A;  1L7M A;  1QSS A;  3V6J A;  3KHG A;  3IP4 B;  3AMZ A;  2MU2 A;  5L1I A;  2KZ3 A;  3RTV A;  2I5H A;  1ZRM A;  4RQ5 A;  2ZIU B;  2NO5 A;  3OPX A;  4M6W A;  4UAR A;  1ZXI A;  4KIT B;  2LM1 A;  5AKZ A;  5KFG A;  3N4M B;  1T8E A;  3K4G A;  4ED3 A;  3E2E A;  9ICL A;  2PKE A;  4UB2 A;  7ICU A;  1KTQ A;  4PHE A;  4F92 B;  5ALE A;  4F5Q A;  4NM2 A;  4Y2J A;  2QAR A;  3V72 A;  5HMM A;  4LVS A;  1S97 A;  2ISP A;  3KKA A;  2NRW A;  5KG4 A;  4UAY A;  2L5Y A;  2K89 A;  3HIL A;  3KHR A;  2JGA A;  4GFJ A;  5DDM A;  1N48 A;  2KVC A;  2AHO B;  7ICL A;  2XVT A;  5AI9 A;  4ECX A;  5ALN A;  2WF8 A;  4EX7 A;  5J0P A;  4DQQ A;  5D46 A;  5AI6 A;  1VLB A;  1XO1 A;  4UAU A;  2HBK A;  4RPY A;  3PVX A;  1ZQZ A;  3BQT A;  3C2L A;  2W3R A;  3RH5 A;  3WK4 A;  8ICI A;  1ZD5 A;  1L8O A;  2PI5 A;  1YT3 A;  3ORY A;  4I27 A;  5KFB A;  1RPL A;  3LK9 A;  4CE6 A;  5KT5 A;  5HHI A;  2LYA A;  1SL0 A;  9ICE A;  3F2C A;  5FP0 A;  3RR7 A;  4RQ3 A;  2HHT A;  4YMM A;  4JV2 A;  2EDU A;  4UBB A;  3KZX A;  3PY8 A;  4PHP A;  4RU9 A;  4FBT A;  3ED5 A;  3MR2 A;  3Q8S B;  4DS4 A;  5J2F A;  4UAV A;  1RM6 C;  4M04 A;  2RLT A;  4UAW A;  1Q8K A;  4PZO A;  2BKE A;  4C7Y A;  4DOA A;  1MN8 A;  5HR6 A;  5KFW A;  3QEB Z;  2OWO A;  2BZF A;  2DFL A;  5J8Y A;  3PO4 A;  4I2I A;  3L4P A;  1ZQP A;  3AUO A;  4K4I A;  3AEV A;  2XIC A;  2M9N A;  7ICK A;  2KP7 A;  2KK0 A;  5ALG A;  3V7J A;  3N7S C;  4P0P A;  4RUC A;  1FEZ A;  4YMN A;  2JEG A;  4Y2T A;  3M9N B;  1QQ6 A;  2EH9 A;  4F4Z A;  3N97 B;  3WKB A;  4PGX A;  4R8U A;  1Z00 A;  5DGB A;  5EE0 A;  4EYI B;  2DUY A;  3H0R B;  5AKH A;  1V38 A;  9ICJ A;  4C4S A;  1SZH A;  8ICN A;  3ZD9 A;  3BQ1 A;  3MGV A;  2Y9T A;  3LYS A;  4GXJ A;  4UW9 A;  4Q45 A;  2NRV A;  3SQI A;  3I76 A;  3OHA A;  1ZQK A;  2HBJ A;  1Z00 B;  2JH7 A;  1T4G A;  5ALS A;  1ZQO A;  1MSW D;  4EBE A;  2MSN A;  4I2B A;  4MFA A;  3PMN A;  4DSF A;  4C8O A;  1ED1 A;  4C7Z A;  4O3N A;  1ZQT A;  4C4T A;  3SAF A;  5AM0 A;  2HHX A;  4KN4 A;  4OJP A;  5J0R A;  4MEY A;  2G5I B;  3RJE A;  2GOL A;  1L7N A;  5J2G A;  3QU7 A;  5DGA A;  9ICI A;  5KFT A;  2D8C A;  5KFA A;  8ICY A;  2GH1 A;  2KG5 A;  3QU9 A;  2GWS A;  5ALX A;  5L1M A;  5DBA A;  3QU5 A;  2R8I A;  3RB4 A;  3BS5 A;  1JMS A;  4DSE A;  3GQC A;  3JPT A;  1Z4O A;  2RDJ A;  4IQV A;  3TAR A;  1JRO A;  2KE7 A;  2JH1 A;  1KLN A;  3EYZ A;  5KFY A;  5F9N A;  7ICQ A;  1CI4 A;  1ZQE A;  1ZD2 P;  3PSF A;  4JV0 A;  4RNN A;  2E8N A;  4QWE A;  3EWA A;  4IR9 A;  4GLX A;  3KZI U;  3PZP A;  2Q4T A;  2V4R A;  1KBU A;  4YD2 A;  1N63 A;  2F2A B;  4QZ8 A;  1D9D A;  2IMW P;  2ASJ A;  2JV3 A;  3PW5 A;  4GIB A;  2K4E A;  1A77 A;  1T94 A;  5H2F U;  1MQ3 A;  3GIJ A;  3UPQ A;  2ZIV A;  1KDH A;  4EEK A;  1MC8 A;  2JZB B;  1SV4 A;  4J03 A;  4TUR A;  1L3U A;  4O3Q A;  2FPK A;  2HHU A;  4DL4 A;  3FYH A;  2FI1 A;  4I2E A;  1NOM A;  3HJE A;  3H8S A;  2ZJ8 A;  3DEE A;  1ZJN A;  3TFR A;  3G6X A;  5J0U A;  2K4I A;  3ISD A;  4NJ8 A;  2KHQ A;  5EE9 A;  4EBD A;  4EEL A;  5J2A A;  4ED1 A;  2Z7J A;  1BPX A;  4J9M A;  2HSZ A;  3HT3 A;  1NK5 A;  3TKA A;  5KFC A;  4P0Q A;  9ICF A;  5KT3 A;  1NKE A;  3UXN A;  7ICE A;  7ICI A;  3T5K A;  2KZM A;  8ICH A;  3M8S A;  2ES6 A;  3GV7 B;  1SIJ A;  3C5F A;  3HRD D;  4R66 A;  1NZP A;  4P4P A;  4PZN A;  2FDR A;  2LHT A;  2W8L A;  4FZM A;  3RFA A;  4DL3 A;  2BDU A;  4RQ1 A;  3ZI4 A;  4Q43 A;  1LB2 B;  2KSO B;  4QWA A;  3TFS A;  1ZJM A;  2C28 A;  2QLT A;  4UB6 U;  1WCL A;  5AKK A;  1NI3 A;  2LM4 A;  1KFD A;  3D2Q A;  4Y2R A;  3UMG A;  3CW2 C;  3G6V A;  1LKY A;  3WKE A;  5DKW A;  2BQ3 A;  1OW5 A;  4KLG A;  1T7P A;  3I28 A;  5TZV A;  5KFX A;  1NJY A;  4NLB A;  2LYB A;  1BNP A;  2CXY A;  3MGI A;  3WK7 A;  4HYK A;  5KT6 A;  4KLT A;  4J9S A;  3LWM A;  1TVA A;  3Q8M A;  5EE3 A;  4QWC A;  2H3Z A;  9ICU A;  3H0M B;  2I6X A;  1QQ7 A;  3NRZ A;  2IA6 A;  2DGZ A;  2BHN A;  2BPC A;  1ZQN A;  4EEN A;  4A8E A;  4J9L A;  4KLO A;  3LVV A;  2EZY A;  1ZQF A;  4UB5 A;  5J0O A;  2MRL A;  3RF9 A;  3AM9 A;  5AM4 A;  8ICL A;  2BQU A;  1TE2 A;  1UT5 A;  2FLP A;  4RT2 A;  5KFI A;  2ASD A;  3M7D A;  3MDC A;  1FFV A;  3QUC A;  4KMU A;  2EZX A;  2R18 A;  4G9B A;  4GC7 A;  4Z6C A;  2W9A A;  1ZQR A;  2D3D A;  2H5X A;  2YQE A;  3I1Y A;  4PHD A;  4KLD A;  1KRP A;  1PUZ A;  2A1J B;  4UB8 U;  3JPS A;  5AI4 A;  5HNK A;  4IS7 A;  2HOI A;  3WKA A;  3HWT A;  1L7P A;  9ICC A;  1ZQL A;  4O3S A;  2ZUC A;  2M0N A;  4C0Z A;  4AYB C;  4U7C A;  4ACO A;  2OXO A;  5ALV A;  4EYH B;  1SGG A;  5J2C A;  1F0M A;  1NZB A;  4Y2S A;  5AKG A;  2FLN A;  1COO A;  3RJG A;  2G5H B;  3ONN A;  3Q8Q B;  5L1K A;  5KNI A;  3O0F A;  3QU2 A;  4F4W A;  1H38 A;  4YXM A;  2W9C A;  4ECR A;  1WWU A;  4IQW A;  8ICP A;  3D2S A;  2PXI A;  1RXW A;  5AI0 A;  2D6F C;  4GXI A;  3GV5 B;  2YMQ A;  2W43 A;  2ESE A;  4QZ9 A;  3ZD8 A;  3SAG A;  1RXV A;  2KKP A;  5L9X A;  4DF8 A;  4Z6D A;  5E79 U;  3QUQ A;  4DLG A;  5ALK A;  3GZF A;  3H8M A;  2RQ5 A;  1KKX A;  3BQ2 A;  3NVZ A;  3RJH A;  4UAZ A;  3B0Y A;  1FFU A;  2W9B B;  7ICP A;  4PJ0 U;  4ECQ A;  3FC4 A;  3JPO A;  4RQ6 A;  1XU4 A;  5ALF A;  3Q8P B;  2KV2 A;  4BX9 C;  4ED8 A;  1ZQQ A;  2KD1 A;  9ICQ A;  3A0H U;  2UVW A;  2KJ8 A;  2PFP A;  1O08 A;  5J29 A;  5HR7 A;  7ICS A;  3QNM A;  3WK9 A;  1ZQY A;  4JWN A;  2C2E A;  2DPJ A;  4OD0 A;  3PML A;  2R8J A;  4KLI A;  5AK3 A;  3WU2 U;  1IM4 A;  2XCP A;  1ZQH A;  4PPX A;  5KFP A;  4I2C A;  3SZ2 A;  2ZTC A;  4ED6 A;  1LV5 A;  5KL1 B;  5CWR A;  3OSN A;  3RBE A;  1HJP A;  2F1H A;  2ZIW A;  2LMR A;  4YD1 A;  3E0F A;  4Z6F A;  5EWG A;  3PW4 A;  2G07 A;  1BVS A;  3JPN A;  2W04 A;  4O3P A;  1S0N A;  3RJF A;  4I2A A;  5ALP A;  4M0A A;  4UBC A;  4KLJ A;  4Q44 A;  1B4F A;  2ZIU A;  2BQR A;  8ICQ A;  5GTH U;  1HIW A;  9ICX A;  2FPM A;  3IN5 A;  3QEA Z;  4KMO B;  4DFJ A;  3AU6 A;  1WCN A;  4NLC A;  2VJ5 A;  3ZDC A;  4I2F A;  1U48 A;  1LVH A;  1NJW A;  5C5J A;  3EUB 2;  8ICO A;  4CCH A;  1IXR A;  5DG7 A;  1SWV A;  3CRX A;  5AIB A;  4NWI A;  3FM9 A;  2HBM A;  5CEH A;  2OHF A;  2XI9 A;  1WUD A;  4RPX A;  5DG8 A;  1JI7 A;  2RHF A;  3A0B U;  3GIK A;  4IRD A;  2HDO A;  4OJ6 A;  3H40 A;  4QZG A;  4KLF A;  4YQW A;  3IV6 A;  4KLH A;  4RQM A;  2DL0 A;  1Q46 A;  1DK2 A;  4DF4 A;  2J6S A;  1N2X A;  3J81 j;  4DQS A;  3L5K A;  2P6U A;  2AXT U;  4PGY A;  1ZQB A;  2BCR A;  7ICM A;  1BPZ A;  4JWM A;  2NV3 A;  2KKV A;  1NNL A;  1T3Q A;  2WFA A;  4KLQ A;  4EBC A;  3CP8 A;  3IHQ B;  5ALJ A;  5L1L A;  2EAN A;  2PFO A;  1A6S A;  3HKZ F;  4KLL A;  1YZ7 A;  2C2R A;  5CA7 A;  4M2Y A;  2ALZ A;  1QTM A;  4KLM A;  5AM2 A;  3SD7 A;  5AK4 A;  4Z6E A;  3H0L B;  4FFD A;  3F5E A;  2BR0 A;  2LKY A;  3BQ0 A;  3BQ7 A;  4NL9 A;  8ICT A;  5EE1 A;  3Q8R B;  4LZD A;  5B5E U;  4DL7 A;  4B9V A;  4DOB A;  5KFQ A;  2YMP A;  4QZF A;  1NKB A;  1NK7 A;  7ICO A;  3TAC B;  1UT8 A;  5K4L A;  2XGP A;  4K4H A;  2XC9 A;  1PK1 B;  2MAX A;  3PO5 A;  9ICT A;  9ICO A;  4RQ4 A;  2WF5 A;  2HVH A;  4AYB F;  4F5N A;  2IHN A;  4WJ3 B;  5JUM A;  8ICJ A;  8ICA A;  3GIL A;  5J0T A;  3T5H A;  3UM9 A;  3RJI A;  3PW0 A;  1GO3 F;  1WG8 A;  2OYY A;  4PL1 A;  3OHB A;  2ZTD A;  4DFM A;  2LYH A;  3QUT A;  2ISO A;  4US9 A;  2VA8 A;  5DB7 A;  4QW9 A;  4J9Q A;  4QNL A;  2Y9U A;  1K1S A;  3KHL A;  2K8B B;  4F93 B;  8ICV A;  5J0S A;  4MFF A;  4QZH A;  5AKJ A;  1ZQI A;  3K1Z A;  2DF4 B;  3HP6 A;  3N7R C;  2ZIX B;  4DSI A;  2AQ4 A;  4C8L A;  4KX5 A;  2E1E A;  1BNO A;  8ICF A;  4OJ5 A;  1J97 A;  3L3F X;  2QB0 B;  4UAT A;  1S10 A;  2K60 A;  3SR6 A;  4B9N A;  1UHU A;  1SB3 C;  4UB1 A;  2FPL A;  4DLE A;  2IOF A;  3KOO A;  4C4R A;  3UQ2 A;  1J2M A;  1C20 A;  4XRH A;  1Y88 A;  3DV9 A;  9ICA A;  4O3M A;  1JRP A;  4E0D A;  1NJZ A;  4IRC A;  3EZ5 A;  3IG8 A;  4YR2 A;  2AU0 A;  3TAN A;  2G06 A;  4UQG A;  3BZC A;  2W9M A;  2QB1 A;  5KG2 A;  4US8 A;  4B9M A;  1BPE A;  9ICB A;  2AGP A;  5ALT A;  4F3O A;  2E8M A;  4NM1 A;  3MR3 A;  1B0X A;  2R8H A;  4Y2P A;  5A0L A;  3V7L A;  1NKC A;  2AGQ A;  2JMG A;  3TI0 A;  1ZQA A;  2XY7 A;  5L1J A;  3PSP A;  3TQ1 A;  3ICX A;  3QU4 A;  4RQN A;  3BZK A;  3ETR A;  2ZUD A;  2XO7 A;  2JZB A;  1PK3 A;  5J2J A;  3ISC A;  5DLG A;  2ODG A;  2ZJ5 A;  4JUZ A;  4F8R A;  3JPQ A;  1SV0 C;  4EX6 A;  4C8K A;  2NRX A;  4B9T A;  1Q3U A;  2BCQ A;  2NYV A;  1RQN A;  4O0I A;  2E1F A;  4ECY A;  2AQ0 A;  4ED2 A;  3EPG A;  1NK6 A;  3ZDE A;  1JUD A;  5DQG A;  5IIM A;  8ICK A;  3H7I A;  2UVR A;  4LJX A;  4QIW C;  4X5V A;  3MR5 A;  4FO6 A;  2W7O A;  4TQS A;  1S77 D;  1PZN A;  2HOF A;  2BPF A;  8ICR A;  1JN3 A;  3TAP A;  4IRK A;  5J2E A;  2EAM A;  5AKE A;  5AHX A;  1KFS A;  3GU3 A;  5KTQ A;  3RRG A;  4O3O A;  3AQE A;  4MFC A;  4KLU A;  1L7O A;  2KSO A;  2XCA A;  5EOZ A;  4DL6 A;  3N7P D;  9ICS A;  3EW9 A;  2OCE A;  1K5O A;  2F76 X;  1SZP A;  1UQV A;  4EZ9 A;  2F8K A;  1CEZ A;  1U47 A;  1SKR A;  2YTU A;  5F3X B;  5ALU A;  4QZD A;  3ISB A;  2K8C B;  3Q8K A;  4DQI A;  2E8O A;  1X42 A;  4CF4 A;  4KN7 A;  2R8K A;  4BXO A;  1U45 A;  5KT4 A;  3BS7 A;  4R63 A;  3PX6 A;  2LPE A;  3RB0 A;  2YML A;  4J9K A;  4O3R A;  4B9U A;  5ALL A;  3PR4 A;  1X9S A;  3MAB A;  4YFK A;  3E58 A;  4BXO B;  3GV8 B;  3MFH A;  7ICH A;  4LZG A;  4DEZ A;  4R64 A;  3VCB A;  1IG6 A;  9ICR A;  2DKX A;  1T3N A;  1ZQU A;  4ELV A;  5DB9 A;  3UQ0 A;  5AI5 A;  4QZE A;  3KTQ A;  3OSP A;  2HVI A;  4RZR A;  2KJ9 A;  2W3S A;  3M6K A;  5J8Y C;  3C5G A;  4C8M A;  1N62 A;  1Z3E B;  4YN4 A;  4RNM A;  1HUZ A;  4AP9 A;  4QZB A;  3HKZ C;  4MEX A;  2HMX A;  4USA A;  5CRX A;  8ICB A;  4MF8 A;  1Z4N A;  2HOQ A;  1J2N A;  3QX7 A;  2A1J A;  3V7K A;  2JEJ A;  4RT3 A;  4DFP A;  5JU5 A;  5KFJ A;  4I28 A;  5KG1 A;  4ECZ A;  3K1R B;  4M9J A;  3G6Y A;  1SKW A;  5KFV A;  5BOL A;  1X2I A;  1RG6 A;  5KFD A;  4P4M A;  3SEI A;  4NLZ A;  5AKL A;  5KL8 B;  1NK9 A;  1PVQ A;  5B66 U;  4ECW A;  4ZOH C;  2A3V A;  9ICP A;  3RR8 A;  3GDX A;  5C0Y A;  3BDP A;  2BCU A;  2Y1I A;  4CF3 A;  2DQN B;  5DG9 A;  5AI8 A;  5ALO A;  4YXJ A;  1TV9 A;  3T3F A;  1M6Y A;  2BPG A;  2OH2 A;  2W7P A;  2H3V A;  4K4G A;  5DB8 A;  2I1Q A;  4DQP A;  4UB3 A;  1NK8 A;  1O03 A;  2WAQ F;  3TAD C;  3RJJ A;  4IL6 U;  5KFK A;  1BPB A;  2MUT B;  2W9B A;  2XY6 A;  3T5J A;  4BWM A;  3CYM A;  2G0A A;  4IQU A;  3C23 A;  1NJX A;  5ALD A;  5ALW A;  1AQ6 A;  4I2G A;  3IG5 A;  3PW7 A;  5KG0 A;  4ECT A;  3SMV A;  3IDW A;  2WHE A;  4CRX A;  5EWF A;  7ICG A;  5KG3 A;  1U9L A;  1ZET A;  4DOC A;  1TK5 A;  4R65 A;  1ZQM A;  4NLN A;  4CGZ A;  2UVU A;  4YVZ A;  1DGJ A;  4YMO A;  2PFQ A;  4TUQ A;  2KOB A;  2ZG6 A;  4ED0 A;  4DSK A;  5G5G A;  3AQF A;  4Y2U A;  1N60 A;  2RP5 A;  4QIW F;  5KFZ A;  4CDG A;  2HHQ A;  5T14 A;  4MHV A;  3HW8 A;  3PX0 A;  4RQ7 A;  4CF5 A;  2G08 A;  2KIW A;  3JPR A;  1BGX T;  4DS5 A;  3PR5 B;  4F4Y A;  1SL1 A;  2KIV A;  2F1I A;  1TFR A;  9ICW A;  2E8P A;  3B9J A;  1S76 D;  4IQT A;  5KFO A;  4EEY A;  4FBU A;  4OJO A;  2R8G A;  5KAF U;  2BDP A;  1ZRN A;  4FE3 A;  7ICV A;  4M9G A;  2HHW A;  5J0Q A;  5J2D A;  4B9L A;  2OM6 A;  1S9F A;  4F72 A;  3OJU A;  3GFK B;  2KVS A;  3M1Y A;  4DWI A;  2W8K A;  1RQL A;  4QZC A;  5BPC A;  5J2H A;  3UXP A;  1L3T A;  1TK8 A;  3S6J A;  1DGS A;  2JHD A;  1N56 A;  3RH6 A;  3C29 A;  4DQR A;  3EPI A;  1BPY A;  5HP4 A;  1KQQ A;  5DB6 A;  3NTU A;  4PH5 A;  3MGH A;  2FLL A;  1SV0 A;  3ZDD A;  1UPH A;  4U6P A;  4KLE A;  4NXZ A;  4KLS A;  1XS9 D;  4M47 A;  1KL9 A;  2WF9 A;  4QW8 A;  1N5W A;  3AL0 B;  2B21 A;  2F3N A;  2V9W A;  5ALM A;  7ICT A;  3T5L A;  4C80 A;  4NV0 A;  3LVW A;  7ICF A;  1DOQ A;  1ZQG A;  8ICC A;  1QSL A;  3PNC A;  3NAS A;  4ECV A;  4DFK A;  2JEF A;  2C2D A;  1F44 A;  4OO1 J;  2ZUB A;  2EAO A;  3H8J A;  3WKD A;  4M6W B;  2JXJ A;  2EQY A; 
#chains in the Genus database with same CATH homology
 5KAF U;  5E79 U;  2AXT U;  5H2F U;  4UB8 U;  3A0H U;  5KAI U;  5GTH U;  2DUY A;  3A0B U;  5B66 U;  3KZI U;  4IL6 U;  1S5L U;  4PJ0 U;  5TIS U;  5B5E U;  3WU2 U;  4UB6 U;  5GTI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...