1X42A

Crystal structure of a haloacid dehalogenase family protein (ph0459) from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDFVGTLLSVEGEAKTHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPIRDIEEEVMRKLAEKYGFKYPENFWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the probable haloacid dehalogenase PH0459 from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords hypothetical protein PH0459
total genus 85
structure length 230
sequence length 230
ec nomenclature ec 3.8.1.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1x42A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1x42A01
3U7GA 5AM2A 1CR6A 3NRJA 4B6JA 4BX0A 5A3QA 1ZD2P 3OCUA 3SHQA 1Z4NA 2B82A 4I9FA 3OCXA 5AVZA 2WM8A 2Q4RA 2IOHA 3CZ4A 5T41A 3W5AA 3CNHA 1YS9A 3ESRA 3KD3A 1Y8AA 1U02A 4G63A 4Y2RA 2EARA 5AW5A 3GYGA 5AICA 1VFPA 3MPOA 3ZX4A 1Q91A 1RMQA 3NANA 3AR2A 4DFDA 2FPRA 4KX5A 2WHEA 3KBBA 1RQNA 2QYHA 2C88A 2QLTA 5AKJA 4E88A 2YMMA 2ZOSA 5AI4A 4KX3A 2R8XA 5AW8A 3QNMA 5ALKA 3SLRA 2RBKA 1QQ5A 1WVIA 3ET4A 4J2TA 3FVVA 1ZD5A 4C4TA 1L7OA 3OCWA 4UARA 4Y2UA 3R4CA 5AKGA 4AS2A 4HAIA 3EPRA 2YJ6A 3ESQA 3WK4A 1YJ5A 1T5TA 3N28A 4EELA 5ALGA 4RETA 4EEKA 2JAWA 3FPBA 3PGLA 5ALDA 2G09A 3ZI4A 3I28A 1KYTA 5AKIA 3BWVA 4UMDA 3DNPA 3A1CA 1LVHA 4L6AA 4FFDA 5AI9A 3IJ5A 3L8FA 3NALA 2I6XA 4Y2QA 1XPJA 5FP0A 5IS2A 5ALWA 1QQ7A 2GHTA 2WF8A 5AM0A 1F5SA 1Z4LA 2AMYA 3J7TA 2WFAA 4GIBA 4UW9A 3KC2A 1TJ4A 2JAUA 3ED5A 3IRUA 1RMYA 3QX7A 2R8ZA 4YH1A 5ALNA 1ZRMA 3WKEA 3L8HA 4YCNA 2RARA 2O9JA 3WK7A 5AI6A 3A3YA 5AVRA 4UMEA 5E0OA 4OD0A 3EF0A 3OCZA 3R09A 3FPSA 1CQZA 4HYTA 5A3SA 4Y2SA 3M1YA 1WPGA 1T9ZA 2ZBFA 1ZJJA 2P27A 4JB3A 4HGOA 2DQSA 2ZBDA 5ALHA 2AGVA 3W5DA 5JJBA 5AM3A 4FYPA 1LTQA 1SWWA 4CF3A 4IFTA 5ALLA 4EX7A 3E84A 2YFYA 1RRCA 3AR4A 5AVSA 3MMZA 5ALOA 2BDEA 2G07A 2JARA 5AW9A 3N5KA 3VAYA 3U26A 2ZG6A 4GXTA 3U7EB 4JDPA 3QUTA 5AI0A 3U13A 5AIBA 3ZU6A 5AW2A 5AM5A 5AKKA 2C9MA 5ALTA 4YGYA 3I76A 4C4SA 3A1EA 5ALEA 4EZEA 4Y3UA 3W5BA 2I54A 3QUBA 1RKUA 3ZUPA 4O8CA 1Z4QA 4Y2VA 1Z4IA 1S2OA 1EK2A 2W43A 2FDRA 1QH9A 2FPSA 2OA0A 2FUEA 4G9BA 3FZQA 2C8LA 2X4DA 3BA6A 4I9GA 4Y2YA 1AQ6A 2HHLA 1L7NA 3UMGA 2FPXA 3QXGA 1YMQA 2B8EA 5AW0A 2IA5A 4HGQA 4QQFA 4ZEVA 3QLEA 2NO5A 5AW3A 5AIAA 4UU0A 5IT4A 4NAVA 4DWOA 1QQ6A 5ALUA 2B1RA 4BNDB 1SWVA 5AVUA 2EAUA 3I6BA 5AKYA 3M9LA 3P96A 3ZVLA 4AS3A 3ZWDA 4KN8A 1PW5A 3B8EA 2WF7A 3WGUA 3FGOA 1WZCA 2MSNA 1U2SA 2RAVA 2C8KA 3DDHA 2I55A 2B0CA 5ALFA 3HLTA 2FI1A 5AHXA 1YDFA 2CN1A 3E8MA 1NRWA 1N9KA 2G1AA 2YMQA 3QU4A 3OTQA 2D2VA 2Q5EA 3L0BA 3ZTYA 2ZBEA 3SKYA 4XPZA 3WKCA 4UM5A 4NFLA 2VKQA 2IYEA 4NV0A 2G80A 3N07A 3WK6A 5AW4A 3DAOA 5ALSA 1ZRNA 1S8OA 2EATA 3WK8A 3UMCA 2WF5A 3WGVA 3WK5A 2ODAA 1O03A 1FEZA 2PKEA 5ALXA 5AI5A 5AKHA 1L8LA 4MUMA 4EENA 2RB5A 1K1EA 4YIKA 4KYTA 4CF4A 1YNSA 3N8GA 1Z4KA 3RFUA 4YCMA 5AK6A 5AKEA 3IB6A 2GFHA 3ZW7A 3W5CA 4UAVA 3ET5A 2G06A 3AR5A 5AK3A 2HCFA 3L8EA 3PGVA 1ZS9A 3ZVNA 1Z88A 1Z4JA 4XQ0A 3MC1A 2YJ5A 4ZEXA 2HSZA 4F71A 4BKMA 2CFSA 4EX6A 2P11A 2C4NA 4NABA 3L1UA 2HO4A 3R9KA 1XP5A 3QUQA 5AI8A 3ZVMA 3L0YA 1O08A 3PCTA 3NASA 4XOUA 3I1YA 5AVYA 1EK1A 3B9RA 5AVTA 2NYVA 4FE3A 2Q4TA 2YBDA 1TE2A 4UAUA 4Y2PA 1T5SA 4CF5A 3SF0A 2YMLA 3NIWA 2GO7A 1JUDA 1RLTA 5ALRA 3OPXA 3ZWKA 4MWOA 1ZD3A 3A1DA 3TLMA 2WF9A 4BX3A 1SU4A 4OFZA 4RESA 5AW7A 4Y2TA 2JAOA 3OCYA 5ALIA 3S6JA 2I34A 2YJ4A 4BEVA 2AUTA 5AKXA 4HGNA 4KNWA 2P69A 3QU7A 1IWOA 5ALQA 2W4MA 3WKAA 3MN1A 4UU1A 4C4RA 1RC8A 2ZXEA 3U19A 4PNHA 5AKLA 4J03A 4Y2XA 3EWIA 3AR3A 5AW6A 4HGPA 5ALMA 3QU5A 5ALPA 5ALJA 4UMFA 1X42A 2BDUA 2HF2A 3B9BA 2HDOA 3QGMA 2ZBGA 3L0CA 5AW1A 2FUCA 2I7DA 2IOFA 2B8JA 1NNLA 2HF7A 2HOQA 2CFRA 3F9RA 3OCVA 5AVVA 1ZD4A 4BEWA 4H1WA 1QYIA 4BBJA 1L7MA 3HYCA 1Z5GA 4YCLA 5AVWA 3DV9A 2BY4A 3PDWA 3D6JA 2HX1A 4NWIA 2HI0A 1VJRA 2G08A 3WKBA 1RLOA 5ALVA 3SD7A 1YV9A 4XE5A 3ZTWA 4DW8A 1RPZA 4ZEWA 3WK9A 2FPWA 4Y2JA 1RMTA 3KOOA 2PR7A 3L1VA 1N8NA 3EF1A 2OBBA 2OYCA 3QU9A 1NF2A 1TA0A 3AR9A 1U7PA 2P9JA 1MH9A 5AM4A 4QJBA 3QUCA 5AVXA 2PQ0A 3N1UA 2B1QA 1RLMA 2W11A 1Z5UA 5AK5A 1RQLA 3QU2A 2MU1A 1L8OA 1U7OA 2CFTA 3FM9A 3SMVA 2HEGA 3L8GA 2FEAA 5AM1A 2YJ3A 3KDPA 2GMWA 3WKDA 1L7PA 3U7FB 1L6RA 4BNDA 4UMVA 3L7YA 2MU2A 4UASA 1RDFA 4L6CA 5AESA 3KZXA 4UATA 3AR8A 4UM7A 2NO4A 3L5KA 2FPUA 4DCCA 1Z4MA 2G0AA 3K1ZA 3NAMA 2R8EA 3AR7A 2JGAA 1XVIA 2GHQA 1J97A 4OHFA 5IT0A 3NUQA 2R8YA 2IOFK 5AK4A 3ZX5A 3UM9A 1ZOLA 5ALYA 4YIHA 1U2TA 4AP9A 1Q92A 4L57A 1WR8A 3AR6A 3UMBA 3RF6A 4CNQA 5ALZA 1Z4PX 4F72A 5AKZA 3E58A 2YMPA 2AH5A 4IG4A 1RKQA 3QYPA 2B30A 2YY6A 4OCZA 2O2XA 3U7HB 1Z4OA 1J8DA 1VJ5A 5AVQA 4BYGA 4HGRA 2WF6A 3E81A 4KNVA 1RKVA 2I33A 3ONNA 5A3RA 1TJ5A 2OM6A 4CE6A 1TJ3A 3SKXA 2YN4A 4BX2A
chains in the Genus database with same CATH superfamily
4NM1A 1DQSA 1OI3A 3EGDB 3DLHA 4N39A 5BSFA 3AERA 3KB2A 4JJAA 1D8TA 1SXEA 1JG6A 4Q03A 3USCS 3LGXA 1U49A 1OI7A 3QHPA 3W7VA 1GPMA 3DM9B 3AKZA 5ECWA 3EUB2 3N7PD 4P4OA 1JLRA 2EVWX 3BWMA 3FGZA 5C8YA 4K9NA 2OXRA 3TTTA 1P0PA 2JDIA 2QRVB 1T6XA 3R5JA 3WNZA 2EANA 2YHUA 3AP3A 4YK7A 3W9UA 1GPNA 5L1IA 3JVUA 3C16C 2LNDA 4IRMA 3JY6A 1JLKA 1EM6A 4DABA 7ICUA 2OHHA 5FPYA 2BI8A 2HB6A 4PHPA 1CJBA 2CXNA 1D0VA 2PRYA 3A0HU 2ZWIA 2OKCA 3MPOA 1Q91A 3C3YA 3I9FA 2RK3A 3QXJA 4XTCS 5C80A 3LT4A 4WUTA 3A06A 1VPEA 2PX0A 3A7DA 3HL4A 1M66A 3R9XA 3CLUC 3OT1B 2GZMA 1N0WA 2EJTA 5LD2B 2L5YA 4Z51A 2GCIA 3WV5A 4PYIA 3EXG2 5DTRA 4YP6A 2BSXA 2E6UX 4YREA 4C87A 3WNBA 2NACA 1GPLA 2OFOA 4BUGA 3MCVA 2O07A 4XD7A 4INZA 2B5OA 1QH8A 2VLIA 4CI0B 1C4WA 4FZJA 3NHAA 4Q4JB 5IG2A 4OUKX 3JASB 1CNFA 5KWSA 2IEGA 2WFZA 2DWUA 3OEED 3RREA 4BGVA 4RHTA 4ZOLB 1GDDA 2C9BA 3P4XA 4PHCA 5H82A 4J2TA 4ZYYA 2FZ4A 2AFIB 1IAQA 2JH1A 3PEVA 5ICFA 2GK3A 1S7GA 1P73A 2C2XA 1LBEA 2L42A 5H68A 2PPLA 4OHWA 5BXQC 4AJJA 1F4PA 4M4SA 4JV5B 4KXXA 3OZAA 3CLSD 4HAIA 4I27A 1OIXA 1Q3TA 2QN1A 3FJOA 1F8XA 1BHSA 3UO8B 4ZA2A 4LE1A 1YVDA 5EJ4A 2AXPA 1E3IA 3BXPA 3TW6A 4DCJA 1YQXA 3ND5A 3T3PB 5CA0F 5ICMA 1DIHA 1Z7EA 1JQ5A 5H4HA 1X7XB 4HFJA 3O8QA 1SFRA 1Y5IA 3LC1O 3E22A 3PX4A 3ZI4A 4HH0A 4EKNB 4ABYA 5DB4A 3F6RA 2YNMA 3KPJA 2XY6A 3PXUA 2HSGA 2QM8A 2CLDX 4HXGA 4R6XA 3OLWA 4U1RA 5DQGA 2JGLA 1RIFA 3AF4A 5KJEA 1IXYA 1LVHA 1TFUA 5JLJA 5I7VA 2CDNA 1SZJG 1X9WA 1FJ2A 5HKOA 1SXJE 3IKTA 5CGQB 4K6OA 3RWOA 3L04A 5CLJA 5BW6B 3HYRA 2OFXA 3A2LA 1E89A 1CS0A 3WP0A 1Y8QA 1Z4LA 3DUFB 1O3YA 3DE4X 1UJ2A 1MO3A 3N58A 3QF4B 4FHCA 2ID9A 4H3KB 1HUOA 1XWLA 4TTQA 4HNHA 2HL6A 4ENVA 1FUYB 4M53A 3ENZA 3SK0A 5HWSA 1BVHA 5IH3A 3SEZA 2C83A 2PFQA 3PC8A 3TRHA 5I01A 5F76A 3WSVA 5JZMA 1U5BB 3B1FA 1NVVQ 3KOZA 2K4IA 2BH9A 2FTKE 2O52A 3K4QA 3GAZA 3U7QB 5HCNA 2UYQA 3WP1B 2AN5A 2JLAA 3DZ8A 2FPPB 2AG8A 2VEOA 3T3NA 1A9XA 2OG1A 3E03A 5C7YA 5JCZA 5HR7A 1ZGCA 2IYVA 4AKSA 2IU4A 2NQ8A 3EVFA 4W5WA 4XWOA 4MV3A 4D9CA 4JVMA 2X0IA 5CM8B 1KDVA 2CW5A 3OU7A 3MFIA 1PL7A 3KVRA 3H0LB 3IJRA 4MQ4A 3UGJA 2I4MA 3WRYC 1BDHA 3B13B 4FOLA 5B1HA 2XNCA 3ILXA 4XSVA 2IXDA 2XMBA 1I4DD 4IFBA 4LISA 5FWAA 3WAKA 4CKBA 5HUHA 3A6PC 1M74A 4MEJA 1G7CA 2FLNA 2WAQC 1X7ZA 2H7VA 2PMBA 3HYLA 3I09A 3I6ZA 1C9MA 3FNGA 4FOTA 4L5JA 5L3VA 1DQPA 5JAUA 2CXSA 2DQYA 3NDJA 3NQ41 1JKMA 2EWMA 2O14A 4R1OA 4PPYA 1U8AA 2J48A 4ZMBA 4WLVA 2V6JA 1R64A 4BPBA 1NXTA 2XJ9A 5KTTA 4TZKA 5D85A 4EEYA 2GBCA 3USZA 3MTDA 1XYVA 3R8CA 4DSKA 1MNAA 3KHSA 5CM2Z 1E9VA 2KP7A 1K0UA 4F97A 4D80A 3SAJA 5M29A 5JXHA 1KY4A 5I7HA 3LNTA 4JUAA 2VANA 3QZ8A 1THMA 4X44A 3EG9B 4NY8A 3VPFA 1TO1E 2RG1A 2VK1A 3M5PA 4F9GA 2FDRA 4ALMA 4FB4A 2Q1SA 4CEIA 4RXTA 4FONA 2XQIA 1FDWA 5D4BA 1J7JA 1NBMD 3GLUA 5FJIA 4LMAA 2PZEA 3C6YA 3A6ZA 3AHDA 4GQBA 4LE2A 1E77A 2C61A 4I9GA 2H4WA 2V6BA 3GOQA 3OF3A 1FMTA 1M0TA 5JXGA 3TUJC 1K88A 3QY9A 3AM9A 9ICPA 2IV2X 1Y8CA 2VJQA 4X61A 3ZLUA 4M22A 4WZ6A 3BDPA 3JPSA 4TWAA 5A7HA 4NBKA 2ZM6B 1I5RA 1BS1A 3T1YB 3OPQA 2L2QA 4ACAA 4KLIA 3BHIA 1KAHA 1Y34E 2PZMA 2XMDA 4DWOA 1Q16A 4UBIA 4B2YA 4F3CA 5LMNB 3PJRA 3BZCA 7ICNA 2G1JA 1JTEA 1LX6A 2PI5A 4RFVA 1E1NA 2X6RA 4WZAB 5E3JA 4ZVLA 3K8ZA 1O95D 1QHSA 1P2GA 4PVCA 2E5WA 4NV3A 1WW2A 2CLIB 1FQJA 4JHLA 4O5OA 1DBRA 5H7XA 2Q41A 5DBFA 5U4XA 4CMGA 2HBKA 1BXRB 1DIOB 1NQ5A 4CTMA 5LYJB 3L0PA 3B2QA 2C5EA 4UU7A 5TQ0B 3VU0A 1LSUA 1ZHOA 2Z6UA 1EE2A 1J09A 1T2DA 5JQGB 1NYQA 3LDFA 1HNZB 5FBHA 4I2CA 4ECTA 1P6QA 3GFQA 5CUQA 1FJXA 3PLNA 3PXGA 3DVAB 1R7RA 2RRDA 4WVLA 4D9GA 3BXZA 3HLTA 1GTVA 1VMDA 4YI3A 5FV7A 4YV1A 1Z37A 5LUAA 2DKZA 1E5XA 5HBRA 3LXUX 1W75A 1JHUA 3EXIB 3V3KA 3OTHA 1E18A 5J2DA 3E7DA 1EGVB 1IZZA 1MC4A 4QXQA 2QPTA 2RHOA 1EWQA 1PQWA 1ZIXA 2C2ZA 2PH1A 4ZN6A 4RIIA 1NIJA 2MUTA 1LDNA 1K8QA 1QHNA 2F3TA 3BJMA 3WKCA 2FPOA 4Q4LA 3DWEX 3L77A 2F1JA 1GG9A 4NFLA 4B35A 3V2GA 4UHBA 2ZIUB 3SP1A 3N07A 2VA2A 2R751 3MCAA 1G59A 5CEJA 2GN2A 4XX1A 1KOLA 1RQGA 5HVNA 3A4TA 4YC7A 1BJRE 2O3UA 2IQIA 5DOVA 3V1LA 1JIQA 1YZKA 5JDIA 2W90A 3M6VA 2QPAA 4EHBA 4O02B 3Q2KA 1WTCA 3RJZA 4C0AC 3QYJA 2F6RA 4QTUB 1D7AA 4DARA 1BRTA 4HTAA 1O03A 3A36A 1MPTA 4RS4A 3PMLA 1OGIA 2J6TA 1G21B 1V96A 2YCLA 3VBEA 1L7RA 4MDYA 2ETXA 3JQ8B 5AKHA 3RS9A 2V5AA 1DAMA 2IEDA 3LLSA 5BSMA 4ZV9A 5LR6A 4FGUA 3VH2A 1KMQA 4TV9B 1KNQA 1OX5A 4L28A 4N9QA 5KTNA 2WB2A 4X62B 1H9CA 1SAYA 4DWJA 4DQQA 2QN8A 3ESYA 4O4HA 1KSGA 2PZJA 3BGWA 3IUBA 3M82A 4MCHA 4HB3A 2W2NA 5GGXA 5JAMA 2H4HA 5JY6A 4O4JA 1HLDA 1OD6A 1E9BA 3W8RA 4DL2A 2FRVA 3LUPA 4XIJA 2GPYA 3THWA 2ZW9A 1GNQA 3KXDA 4QUDA 4H7JA 2FGJA 2JD2A 2PH3A 3AF5A 10MHA 4MNTA 2LIVA 1XCLA 1K7YA 4NABA 4GW3A 3X1JA 3FMFA 2B37A 2V7PA 2HAEA 3TEFA 3K0FB 5LZ4A 3MD0A 1L5HA 2NUAB 1F0MA 1TPYA 1VBKA 3JATA 4BLQA 2PWPA 3EPHA 2EFHB 3I12A 2H0QA 2BFOA 1JDSA 3B9RA 2HLNA 1O58A 5EJIA 1SEVA 1FLDA 5JHGB 3NIBA 3ZE2B 1TX4B 3WA7A 1KXJA 2N75A 1D8BA 2H48A 3OD5A 3OPMA 5EOVA 2VDNB 3CRZA 3OZEA 3QNWA 3R77A 3D4LA 4WN9A 4V1CA 2VQEB 4U5QA 1UIMA 2CHQA 2PL1A 1DI0A 1SEPA 3NVWA 4JNCA 3VC7A 4BUJA 1J21A 4II7A 1PK3A 4K03A 5GAJA 2AG0A 2O8DB 1VHJA 3UT0A 3RJGA 3VYTB 1XQ1A 1MZVA 2A14A 5FBKA 1QRDA 3WJ1A 2C2RA 1ZK1A 2PCLA 4BVHA 2VJYA 4U9HS 3TLMA 4QLBA 1KN5A 3BBLA 5T4FA 2Z2KA 1FX0A 4NBWA 3EG9A 4I0WB 4TL6A 3PZPA 2AV6A 5EE5B 2DERA 1OU0A 3AOEA 2HSEA 1ZLXA 3TOCA 1ABEA 4KXMA 5KKAA 1JQBA 5I7UA 1GTRA 2EKPA 3I04A 3ZDAA 3LCUA 2X8BA 4GFJA 4KLQA 1GWNA 1Z2OX 3L5OA 3L9WA 4G4SO 3GPCA 3IQWA 4PSDA 1C9KA 5EYPA 2BFEA 4AMUA 2UUPA 2YASA 1QGDA 4NFYA 4ED9A 1KFDA 2YQZA 5J5AA 1MGOA 3AXTA 3BQNB 4D1YA 2QDKA 3UV6A 3SQXA 1SBTA 3B6JA 3V8QA 1RHRA 3RABA 4BVGA 4C5CA 1JA9A 1ZA2A 2B20A 1IK6A 1HZZC 7GPBA 2UAGA 5A5DA 4G1FA 3ZY5A 3K75D 4PXYA 5AKLA 1B6SA 2H7YA 2DFTA 3A6EA 3AU2A 3Q7QA 5C9ZA 3V4ZA 4ELTA 3KQPA 3PI6A 3QU5A 1W52X 1YR1A 1CXZA 3EYWA 1U3DA 3N6VA 3OBIA 1QQBA 1ZWLA 1MV8A 1HUQA 1GVHA 1Z28A 2CLLB 3IHWA 2BLLA 2I4TA 2LZ0A 5JMOA 1KEUA 3OHSX 5C1OA 5C1BA 5I7RA 5KT6A 2HA5A 4G4JA 5IJAA 5K0GA 1UC5B 1V6CA 5LKRA 2ZT7A 1QLJA 3QG5A 2C92A 1TYCA 4J9VA 4RZ3A 3RVDA 3U9SA 1X6IA 3OESA 4YAJA 1ZD4A 3H1TA 1ZJ6A 2WZCA 3C48A 3ZGOA 3NTUA 2A33A 2IODA 2WU1A 1H5UA 3OMWA 5KSOA 3R9XB 5COAA 3AEVA 2GPSA 2CUKA 3PSTA 1IZ8A 3D6JA 1VRWA 3D8HA 3G9UA 3W4KA 4ZZIA 1YBVA 4ER3A 4YLYA 3GV0A 4KIUA 4D3FA 2ZVDA 2RC5A 1UM9B 7ICHA 2R1VB 3Q8RB 1P77A 2WPDD 1DWOA 3AEQA 1J25A 4MW0A 3CCBA 3FN4A 3P20A 3LDUA 1E1YA 3MTJA 1QR2A 1XALA 1X7WA 4G5HA 2I8LA 4RL4A 3L0OA 4OJKA 3EF1A 5FIUA 4A6XA 3GCXA 3UJAA 1K7CA 2F48A 3FTFA 3WMGA 2EBUA 3ZI0A 2AOTA 4IHKA 2ES4A 4YVFA 1V8ZA 4O3RA 2VQ6A 3H0RB 1Y9AA 2GARA 5FA6A 1P9OA 2HUNA 4HX9A 1ORTA 1D2HA 4ZDWA 4BIIA 3FTDA 3NHRA 4HMQA 5LBUA 2YOFA 2ZI9A 5AVXA 3OUTA 5B3LA 4S12A 1FUKA 4UHHA 4C7KA 4ZHSA 2ZYVX 1R50A 5J58A 5CITA 5E9AA 4NP6A 3L4PA 2ZZKA 1RQLA 4DEZA 2D5AA 3Q3VA 3QX8A 3WDKA 4JYPA 4WFKA 5H02A 2Q5QA 3LPDA 1H42A 3NS1A 3DYBA 1IJKA 2A59A 3G0OA 4DJJA 1QDEA 3P9YA 4S04A 2O54A 2VDPB 1QOQB 2NZVG 1DXHA 2B9VA 5TEWA 5LFAA 1ECLA 3GILA 1ZEJA 1L7PA 2E3JA 3T9CA 4J7XA 3K2EA 4C8MA 1JG2A 1U0BB 2PXXA 3G7NA 3FTQA 2ASVA 3LBIA 3DOHA 3D4OA 4UATA 1RAAA 2QTNA 4HRVA 4UTOA 4EPYA 2E82A 3DDOA 1NFRA 1AKRA 3CF4G 4NVRA 2WJVA 4CTOA 4GPBA 4MROA 5EXPA 3L0IB 3J81k 2O5VA 1QKIA 3G6KA 3NU1A 1GNSA 5EJAA 1W48A 2P2ZA 5IDWA 1YZUA 3T5AA 2JI8A 3K0FA 4IXNA 5C81A 4ZHQF 3P45A 4MARA 4BDPA 1JEDA 2FYTA 4QZGA 2AX3A 3C4VA 4KLLA 1DIAA 2YHIA 3TXAA 4B80A 4YALA 5KFZA 4O0LA 3R7FA 2OV4A 2JVKA 3WTBA 3K0AA 1WR8A 4XRHA 1CW2B 1HNWB 2ASDA 1JE1A 1K7FB 1QLHA 1WLSA 1HI9A 1XCPA 2YIJA 4DLKA 3OJSA 4MX8A 4V1CB 4QG7A 1C9NA 2CEKA 2FP3A 2LM1A 3IT1A 1Z8DA 1JQKA 2NW6A 1RJWA 1ZK4A 2RLTA 2EJCA 4RPLA 3AFHA 4S1TA 3FUWA 5ITVA 2FJPA 3OQHA 1Z0IA 2Z83A 5DWQA 5TF0A 4MR9B 1C7QA 4NENB 2JGRA 2AYZA 4WAUA 5KFQA 3KHGA 1IB6A 4KR0A 1CD5A 4M55A 3UTDA 5CLIA 1Z6PA 3U09A 5AT1A 1JKXA 4D56A 1BFDA 3TLAA 2R8HA 5IDVA 2WJ3A 4HXEB 1DC4A 2LRHA 3NONA 4F85A 1VL0A 4JLDA 3AIOA 4D3SA 3DHWC 1V9CA 4NZMA 3S55A 4BFSA 1KHHA 2KSQA 5ES4B 1YVPA 3EE6A 3WYEA 4BNIA 3AKDA 1OBCA 3KVOA 3I2GA 4WOJA 4BN5A 5J29A 2CDRA 3UXOA 3RH5A 1T1GA 5TPZA 3TG2A 1MX9A 4QUIA 1GARA 2AIRA 3MWEB 2COEA 3ZY3A 3BWXA 4KQXA 1ISJA 2DR0A 3A4MA 4TLDA 2XHEA 2WSSA 3HDQA 3QJ5A 3FAHA 1V5FA 3ZU2A 4DR4B 3IT3A 2C5GA 3IKVA 1EJ0A 3PLRA 4FC6A 1RNLA 3V1YA 2CUZA 3THYB 1KI4A 5HHTA 2FJUA 4TXHA 4H1VA 4N12A 5AVZA 1AA9A 3U56A 2YVAA 5CP8A 2KJ5A 4G5FA 3IGFA 4I50F 5GJCA 4RMGA 1EA7A 2O7VA 3LO8A 4H77A 1NVWQ 4X95A 5H3CA 5CG1A 2PUBA 3Q85A 3DHEA 1KYQA 2RHHA 1XC9A 4HDNA 4ZV7A 4C0LA 2HCBA 5EQFA 4YXFA 4ZYVA 1J9ZA 2XZLA 2GAAA 1IXRA 1ZRHA 1G2OA 4IXMA 1NV9A 2I65A 4FYJA 4HADA 4L3OA 1ZNZA 3R7LA 3JPQA 2QE6A 2V7UA 4LVNA 1TZKA 5F1YA 1DFHA 1JVBA 1ZSVA 2HRBA 4C9BA 4E70A 3IBYA 2ZKIA 5EJMA 2WU4A 1NUSA 4R41A 2KJQA 4YJFA 3GEPA 1PDWA 1V2GA 2EIHA 3QQPA 1YJCA 4W6QA 1ZUIA 1L5WA 2YMMA 1T9AA 7ICMA 2GK6A 2HJRA 2ZOSA 3RCBA 1E6EA 2PMKA 1THTA 2R1VA 1TZMA 3IR7A 2OQIA 2P6MA 3Q2IA 1D6MA 2OQVA 3SLRA 1OASA 2JJ1A 3TVTA 3WNDA 3VZSA 1J23A 3KE9A 3RRZA 5F7XA 2OO3A 4NLZA 2BR3A 3RANA 1KO5A 1JIHA 1G98A 1T3LA 2RBEA 4MRSA 4K4IA 2HQSA 2IDKA 2YNMD 4JS0A 4BTEA 4RV5A 1JEOA 2HRDA 4L4SA 3GXBA 4P53A 4BP8A 4DSIA 2C0CA 4YJ2A 2H11A 1H38A 3MWKA 5LXTF 3SBDA 4G0VA 4V0NA 2NU7B 5F9NA 3LW8A 5BMVB 2X1HA 1NBWB 3KV1A 2BBSA 3X1WA 4DAOA 2WFLA 5KSWB 1OXTA 4E08A 4RCVA 1ENPA 1E98A 1QNFA 1W73A 3M7DA 1QZUA 2CLOB 2G70A 1EBFA 1I8TA 2D1QA 4NHOA 2QAIA 3WB1A 2XTNA 3AUTA 3VPGA 5B64A 3MNFA 2R8KA 4NDZA 4FOSA 1OIWA 3B36A 3MSCA 2JAXA 2HCRA 1P0MA 3M3PA 3UK7A 1BTOA 1N1DA 4E3WA 2VP6A 3ZK7A 4Q02A 4H35A 3EUFA 3Q0TA 5IWCA 4URHA 3HKDA 5I4CA 3K5PA 4XKJA 2D7CA 2W0SA 1RLUA 1Q14A 3N59A 4DMHA 4XVUA 4AJNA 4HDMB 5TY0A 3E23A 1YS4A 4BJ3A 1C7YA 1UBKS 1ZHFA 2VWGA 1F5SA 1B41A 2Y1EA 4XVQA 4PSCA 5BR4A 1R4MA 5HJ5A 2Y6UA 3Q3JB 4HS4A 5A9SB 1MG0A 5HYVA 1ZL0A 3DAPA 3RVLA 1KRWA 1AO3A 1OBFO 2MIIA 2DJ5A 3EB9A 4TKZA 1ZNQO 3HWX1 5EWEA 5J0UA 4AM8A 4NOLA 5JD4A 1O4VA 2XXAA 2VDVE 3JQBC 4GE3A 2Y66A 4RD0A 3AHGA 4ED2A 2AQ4A 1HE8B 4BMCA 1IXKA 1SXJB 3ELUA 3PDIB 2X5KO 1WHSB 1ZP6A 2QM3A 2O9JA 4BC1A 4PZPA 5TJHA 2VQSA 4Z6FA 3IKLA 2CXPA 2Q1UA 4PO1A 3UXHA 1P45A 2E3TA 3KELA 4OJOA 4P4MA 5SZKB 2PX2A 3B78A 4QODA 3VYSB 2FW1A 3OE7A 4TRMA 4BS9A 1P6UA 1H1DA 1I32A 4URYR 2F77X 2FKAA 4YBRA 5IARA 3U3RA 4D81A 5CVTA 2ADMA 4EYOA 2GK7A 2B99A 4LY3A 5EINA 3CRXA 2B4TO 5K6AA 3HP1A 3CONA 3RC3A 1TVMA 2FPIA 2HA6A 1HUZA 3B1ZA 4KMRA 4LJ6A 1YR7A 5IC6A 3U9LA 3IMGA 2FETA 5F7JA 2Q6TA 1UEIA 4YMHA 2LW7A 1DEOA 4NENA 1NAHA 4MAFA 5DH9A 3GRUA 4HL6A 3SJ7A 2OH2A 2R1TA 2I5PO 2ZI7A 4I4TF 1H65A 3QEKA 1TK2A 2BCUA 2EQ5A 2LGJA 4D8VA 2BKAA 3ECAA 3SS7X 5AQEA 3U4GA 1PF7E 1T6BY 2GAOA 3H13A 3JQAD 3L8MA 4LRUA 2YQEA 4F84A 1A4UA 2Q62A 5AVSA 1D4ZA 1F4LA 4QDXA 4R66A 1U2PA 5KFOA 4C5AA 4JQZA 3JPOA 2GEJA 3W2FA 2VNKA 4UHDA 3DKRA 3RHTA 4XA8A 3RVOA 3AG5A 3R3UA 5HMMA 1PZEA 2IF2A 4TUQA 5FXMA 4KE6A 1YJAA 4RTQA 2BQRA 3JR7A 4EJMA 1F7VA 4FOOA 4I2JA 3PIIA 4OVKA 4UNPA 4A15A 2PZKA 2IGBA 1U63A 3SJUA 1HFKA 1W4ZA 3WYAA 4DQPA 4B4DA 4NLGA 3IAXA 4ID9A 4OSPA 4BLVA 4F45A 1N36B 1Z0DA 1IN1A 2ACWA 2HO5A 2O8NA 4RKRA 1MQ9A 3UW3A 4R83A 1GLVA 4D2IA 5B3JC 1EUQA 9MHTA 5U9CA 2CCGA 1ZQXA 4EDFA 3UT5A 1CRPA 1NVDA 2J0EA 2OCPA 1H6CA 1D8LA 4R2HA 3RVBA 3DW1X 4Y2YA 4PC2A 3B6EA 2ONKA 5HR6A 5K3EA 2M1XA 1TQ6A 2YWXA 2I2XB 4LYGA 1KQQA 4QVKA 4S05A 1I94B 2OZLA 2XLBA 1ZOOA 5DWDA 2CJWB 3GH3A 2AXQA 4E5VA 4ZAXA 1NJZA 5HGXA 5DDYA 1C0IA 4WH0A 2XZPA 4QQFA 3VKHA 1ONPA 2F76X 1PT7A 3QLEA 1LC0A 3ICWA 4W9RA 3LRPA 3NUGA 4KZKA 2FE9A 4G3IA 1ZEMA 2LR0A 3HN7A 3NGLA 4DJAA 1COZA 4NAVA 4DPMA 1QQ6A 5KFHA 1SL0A 3PE4A 1IOVA 5L3RA 3HUDA 4F4DA 1EFVB 3A6JA 3L6DA 3I6BA 3ORRA 4HAUA 5EHNA 3T6KA 1I2AA 3V3TA 5JAPA 1QGUB 1KE1A 2BZSA 2C20A 3P96A 4B87A 1MO5A 4HEQA 2ZUDA 2JANA 2ODNA 1V85A 4G5QA 3KQSA 2TMKA 7ICSA 1RI3A 4PX9A 2RGDA 2GTHA 1JAYA 2DFKB 3B8EA 3O5AA 1JSCA 1PYGA 3UENA 2GPWA 2YS6A 1H22A 4YCXA 3OTGA 4CUKA 4Z6DA 1L4HA 4ZTBA 3WQQA 4U7DA 5H5JA 5J2TA 4UBOA 4ZOEA 3MS7A 2EKZA 4UB5A 4NECA 4NK5A 4BRUA 4PQFA 2IS4A 2HDWA 2DUWA 3A10A 4C7JA 3V6LA 3BRSA 3AL0C 1UMBB 1PR6A 3F98A 1QRTA 4K9SA 4PGHA 2O2DA 2DFNA 2EX0A 3G9XA 4C5BA 1FXUA 4JI7B 4ILEA 2OFFA 3REQB 1NJGA 2AYXA 2BV3A 8OHMA 4TMZA 3TDMA 5TV2A 3M3DA 3BQ9A 1QZXA 4IL5A 4MS3B 2BFFB 4K7JA 3ZNNA 3QU4A 1N2JA 3EVGA 4IDFA 4F9FA 4D4KA 4H7KA 1H3EA 2PFNA 1HZZA 1QFXA 3LFTA 5ER6A 3PV0A 1C3JA 3I6IA 4KLHA 5CB6A 1Y1QA 3OJ0A 1AZLA 3WA6A 4Y1GA 4BRSA 3JQQA 2G80A 3MELA 4UULA 4URVR 2FXIA 2R11A 2JKVA 2W5UA 5FWYA 3UUGA 2QY6A 3C3BA 5KT4A 2E55A 4G84A 4OK5A 3ANSA 3BAFA 1XD2A 1XL1A 5I3ZA 4A8PA 4XD7D 4L0MA 3UJCA 1WHTA 1XLTC 3HKCA 2QTTA 1KRXA 1ZFNA 3GLHA 3CTPA 4IZHA 4TRRA 2A7XA 1RAGA 2YFQA 5E79U 3W6OA 1E79A 1N8TA 3AOEC 3GZFA 2NO0A 3IQZA 5D3QA 1B2LA 821PA 1C80A 3D5QA 1FLAA 3PA8A 3QVOA 4K46A 4N5IX 1ZO8A 2D1SA 3FVTA 4RKWA 5E6SA 3OLYA 4Z0TA 2N47A 3SYKA 4D9JA 1MNQA 2C1ZA 3FXAA 2ZE8A 3CB4A 5JYDA 3AU6A 1LA2A 5JZVA 5JDCC 5CA1A 3FOCA 3HXKA 4PWZA 4DEVA 1MAAA 5IIIA 3TQOA 3OECA 2VP5A 3AL2A 1IG6A 1KAMA 5DV9A 4CLEA 2ZYSA 2AN4A 1ZGHA 3D2NA 4PR3A 1ZXBA 1IPHA 1M72A 3C6QA 3ADCA 4UC0A 5HF5A 4DQ0A 2J46A 1M6VA 2I6UA 2Q2WA 3CNQS 3EQ6A 4GMKA 4J43A 1X9XA 1WM1A 1I4TD 4P4SB 3NNNA 1KBOA 3GLFE 5LPNA 1H9BA 4DSEA 4PLTA 1L7DA 5AUPB 1R6BX 4WNAA 4V03A 5CLGA 4O25A 3NVYA 3ZHOA 3I1YA 5LQSA 2FSPA 2CF5A 1E62A 5CPFA 4LF7B 2PO7A 5FUMA 2G5HB 1MOPA 1LS1A 1TQ8A 3M7IA 3LUCA 5BOSB 3OE7D 5CT9A 1XWIA 2R60A 3E61A 3A05A 1ZLYA 4HXFB 2O3RA 3HPRA 4LECA 4R8LA 2KWIA 2PTHA 2F00A 1OB5A 5JVDA 1X7XA 2FJ0A 4X7PA 2AQ0A 1DE0A 3PRJA 4HN2A 1W88A 1VCOA 3O1IC 2GO7A 4WX2B 3EZ6A 3BDVA 4DV3B 2HA7A 2I1LA 4D41A 1WMEA 1L2TA 4F5OA 3BZKA 4LK2A 5DYWA 1EZZA 1XB2A 2ZLBA 2QVZX 2ZREA 2ZVJA 3I5AA 3LG2A 4H7HA 4NBLA 1Y6QA 1HNXB 4CEIB 4KUEA 4F3RA 1A5BB 1CQPA 4MULA 1W2GA 3LWMA 1YK0A 2H2GA 2J4FA 1LTKA 4QPPA 2Q5OA 3BB1A 3C2QA 3VO2A 4YMUA 3NT4A 1XKLA 5D51S 4R63A 3TD6A 4AY6A 3OCYA 3AL0B 4CDNA 4RPYA 3HH8A 3EIXA 3HKEA 1MF7A 1MMFB 4D6YA 3C7CB 3SICE 1IL0A 3F5AA 2Y71A 3N2YA 1TJPB 2JBAA 2W4QA 2QRGA 3RYHB 1J49A 4CQJA 1JDNA 1S77D 2CUTA 4KQ1A 4M3NA 1E8NA 4OJNA 5JYCA 1E61A 4BQSA 4M1YA 3W7AA 3CVVA 3J81j 3WGKA 3ESCA 4M2YA 3ZIDA 4DF8A 2CNLA 1X9SA 5KTOA 1JAIA 3JQ9C 4MB0A 8ICGA 4RH0A 3CJQA 3IH5A 2V9CA 2P0EA 5TARA 3HDTA 4EY3A 1MAVA 1N6LA 3IBCA 1Z0KA 3ICQB 1NBEA 3M81A 3LX6A 1P9NA 1GA4A 3PE6A 1U65A 1VGRA 2ZS7A 3VVLA 1WY7A 4K0RA 4BWJA 4CN9A 1HH4A 5KAIU 1DWUA 4FMCB 4X7MA 1B0XA 1C14A 1MVOA 3AUXA 4UB4A 3KJFA 4EW2A 1EFPA 2P78A 4X6YA 2EDUA 1JX4A 5DCUA 5BVGB 1I5EA 4IUBS 4U6SA 4ZAZA 3ZHVA 3RUAA 2GN0A 3E1GA 5AHRA 5HM6A 5JCOA 5L7WA 3AM1A 1VPDA 4GOJA 1YK1A 4MGYR 4HFRA 4AYTA 4C6TA 2Q3JA 2O57A 2XJ4A 3DVAA 5J0SA 4UHJA 4ZMRA 1NDHA 3HNRA 3KK0A 4P93A 2IX3A 2QU8A 2OYSA 2CE7A 5DP2A 5A6SB 4QYWA 2FUKA 2Q7DA 4AZ3A 5B30A 3Q7RA 4B9UA 3LVQE 1N2OA 3OFNA 1RJFA 1U1FA 3NBKA 2LE0A 4TMWA 2X2PA 2D0IA 4RQ2A 3MR3A 1KI7A 2PTGA 3PDWA 4L08A 5EJ7A 3BFJA 2JFNA 3FWHA 1U9LA 1YQDA 4EARA 5A5EA 4PBRA 4BO7A 3UWPA 3RRXA 4WJKB 1RLOA 1P61B 3URKA 9ICNA 2E4XA 2Y27A 1GP2A 1WCYA 5CJPA 3JQFC 1F2DA 1AKWA 1H6AA 1YQUA 1YJXA 5DLYA 2PX4A 3HABA 2XITA 1RAFA 5G0WA 1ZJZA 3T1OA 5DLQC 4UDXX 5IMSA 2VDQB 1K4MA 1M1ZA 3BPSA 1BX3A 3E8SA 5FTKA 1FTWA 1RCTE 2HIAA 5DM60 2V4UA 2UUAB 2UUOA 2Z4TA 2BQ3A 5DGTA 2XT6A 2XWPA 1U0RA 2OY0A 4MQEB 4ML3A 4ANFA 2FMIA 4WASA 3GAAA 3HBAA 1OZFA 1F4VA 2WWXA 3DEKA 2VC2B 4KQ9A 1JHZA 1KJZA 5AP9A 3RKRA 1IVYA 5JROA 5KNDA 4MA4A 3H4MA 4PW0A 4O5CA 1NUPA 1T3GA 1QO0D 4I6GA 3CW2A 5HE8A 1H85A 3WLRA 3ZNQA 2J9YB 4F6RB 1SCQA 1T5BA 4TS3A 4YPOA 5AJXA 1QGYA 1NR7A 4TMXA 4TWZA 4FFBA 5IHPA 4UUAA 4WHMA 4BJ6A 1L6RA 1ZAYA 4M6WA 1H1LB 2OB2A 4ECYA 4KKXB 1A69A 2E21A 3CSSA 2QDXA 2QT0A 1OFUA 3LGSA 3WBJA 4K6FA 4PC7A 2DOKA 3PNYA 4F7DA 1ZH8A 2ZYWX 3ETDA 4JT2A 3REGA 2R97A 1JDZA 1CR0A 3HWWA 3EYZA 1DAKA 3PSFA 3U7IA 1JMSA 1PHPA 8ICXA 2GZAA 1U2GC 3HPOA 1ZQFA 1BFKA 1CE8A 4JIGA 3RRYA 1A0PA 1WG8A 3SR4A 3KKMA 3FNQA 3U31A 2RK6A 5AK4A 1AQIA 3F6EX 4LAFA 3TSZA 3LT2A 2HBLA 3PDIA 4I28A 1VE1A 1YB1A 4H27A 3SYRA 3FZGA 2X42A 4TZTA 1U9IC 3HQ4O 4MAMA 4F4WA 1GQRA 1I30A 2BELA 4A3SA 3W2HA 3K0BA 1RCUA 5EIBD 3C3WA 3MWLA 1SUDA 3AL3A 4HFNA 4CMEA 3LQFA 3OEYA 4I14A 3DFIA 3SS8A 4WLEA 1M34B 5EZYB 2JFPA 5KS2A 2WABA 2FMXA 1QHHB 4M9NA 1DX6A 3CUKA 3Q8XB 1DCMA 2ZWOA 3N05A 4RIGA 3SIXA 4ZT7A 4J3FA 1U81A 3TIGA 3H11B 3HJHA 3NM4A 4I2HA 1R6XA 1TK9A 1T0IA 2JIQA 3F5EA 1QRAA 1G5HA 2D0PB 3DVQX 3I3SR 1FFBA 3JVDA 1UADA 2OPHA 1GPKA 4EG6A 4N47A 4MCJA 2NSYA 4DMFA 1B8OA 1JR3D 1AZWA 2OZKA 4YPVA 2N1MA 1L3UA 1ACJA 1VC2A 3PO5A 1AKMA 4HQ6A 1O0CA 1SZHA 1ULSA 4B9TA 1LNQA 5SZIA 5K8CA 4EHLA 4JA0A 1VLHA 5ERGB 2HLDA 4ZT6A 2ORYA 2ENUA 2G6BA 5EP2A 3GJ0A 3G6XA 2ZYRA 2Q5JA 5JNTA 3DP7A 5D3MA 1M0WA 1N2BA 1ZMTA 1A95A 1PL8A 2DL0A 3D8NA 4P34A 3SKXA 5CM9C 1U8TA 2YQ5A 1ZW1A 2NYUA 2WUDA 3I9V1 4IH4A 2YN4A 3TZQA 3VM6A 4DDKA 1OJLA 2AA3A 3THXB 1UT6A 3NRJA 1ID8A 4Y7DA 2YNMC 1Z6QA 3L8DA 5JXIA 4OAOA 1UPBA 1GL7A 3ENKA 5GADl 3WGLA 4K4HA 1E64A 4IAOA 2GDZA 1XK6A 3KHHA 4HH1A 2O8CA 5IYZF 2YS7A 1EG2A 1C4XA 2A8YA 5LLDA 2IOHA 4B7UA 4D26A 1H5NA 4X1IB 3IV7A 5LIRA 2ZIZA 4Z4IA 4KL8S 2NT3A 3DZDA 2JHGA 2WAQF 3ZHUA 2H2HA 4CM4A 4HWRA 4X92A 3OOYA 1EHCA 2CMHA 1ESMA 5IIJA 5TQ2B 1N2CA 2NUPB 2GM9A 1IBMB 5KHLB 3I9NA 3I52A 1TYDE 1W29A 2Q07A 4KN4A 2XOKA 4PLGA 5JCXA 4DFDA 4KYVA 1ZI8A 1BCSB 1WJGA 2B4KA 2CVFA 3E0QA 5B1EA 1RAHA 4EGFA 1LDMA 3MJEA 4KLNA 4YXMA 1M1NA 2BGRA 2VSXA 2Y3IA 3IQGX 4NX2A 2K2QB 2OQRA 3P2YA 4DHWA 4YAGA 3FPFA 3JVVA 1VLVA 4FYXA 1DEHA 1DGSA 2VWHA 2F8LA 5DKWA 1U7TA 3NHBA 5K0ZA 1VL1A 3F5SA 1HORA 3GAFA 3H1EA 4IOLA 1IN4A 4GRIA 4GVLA 4LN1A 4OGGA 1AHIA 1SQSA 2REXB 4R3NA 2ZTSA 1ZSYA 4WNCA 5AR1A 1DG3A 2OFWA 3KZMA 4YAOA 3AVXA 1L6NA 3T38A 1Y0BA 3FUTA 4UARA 4RD4A 4EPRA 3GA0A 2Z56A 3DBLB 1M2NA 1W5BA 1CDZA 2CMGA 2EDCA 2IEZA 3LVFO 4HI0E 4I1SA 5JSYA 3BD9A 2UU9B 3KQTA 4CLHA 4MKHA 3EVBA 4MV0A 4OHXA 1NK5A 1YJ5A 3IIJA 4IRXA 2IYQA 4EELA 1NVFA 1F12A 4ZYLA 1DOAA 3OHAA 4MV5A 4PZAA 5ALDA 2A3VA 1WTAA 2VDOB 3E5MA 3IMFA 4D9FA 3IDWA 4NZZA 1GNPA 3N6RA 5CA1F 3MSXA 4MS3A 1KJNA 1NJ5A 1QVVA 2IUEA 5DRYA 5DGBA 4TL7A 1HWYA 2PUAA 4LDRA 3AVVA 2W71A 2C94A 3IAUA 1MB3A 2ZS8A 5T4EA 3SBXA 1KMMA 5AI9A 4FFBB 4K88A 3Q9UA 1GCGA 1DADA 4B7XA 4OK3A 3TAQA 2CD7A 5KL8B 1T8EA 4I1RA 2O0MA 1P3Y1 1DK3A 2H51A 2GR9A 3RV4A 5KFCA 1B8UA 4WDRA 1EFUA 2MJLA 5KNDD 5IAOA 3OH8A 2P4UA 3LWZA 2UZIR 4J1TC 1PVVA 3CH7A 5DTEA 3BG5A 1PS0A 4WW0A 3DEEA 4XM2A 1Z38A 3N75A 2ZJ6A 5KTMA 1L5QA 4Y1RA 1VE9A 3I23A 2RE8A 3BB3A 1O77A 3QX7A 1JX6A 2CMFA 1F06A 1QXSA 3K9NA 2I3ZA 2F7SA 2YHIB 2X1LA 4PU0A 4YR0A 3L8HA 3N7UA 3RJFA 4N6OA 1B43A 1ZYQA 3CISA 3L4BA 5H83A 4G67A 3A3YA 1J99A 3IDQA 3HM9A 1T0PA 2X8LA 3H4IA 2HHXA 3PQ8A 4FCVA 3V2IA 2IF0A 3MR6A 1A6SA 3WZLA 4BZQA 2LHTA 2XKAA 3VR5D 1EWRA 1F6WA 2W3RA 1KH1A 2OKGA 4IGKA 2PUWA 5EWLA 3CVYA 4KHZA 4G1VA 3E3NA 4WJ3B 3I53A 4Q44A 1CQZA 2PAFA 3KKPA 4HYTA 4R01A 3LQYA 4S1NA 2BGTA 2CLFB 2W9BB 3I61A 4GPD1 4K9DA 5HDBB 1G6OA 4AXXA 1CUHA 1KJWA 3EGXA 1JN0A 2WTUA 5JJKA 2Z8XA 2EGHA 1Q7BA 2DQSA 4HGOA 2R62A 2A0XA 5JPIA 4OXRA 4ZEMA 1D9FA 4PRYA 4NZPA 1LBQA 3KJGA 4FYPA 3AF6A 4LNUB 4WXPA 2R25B 2EL7A 1U9ZA 1T2NA 2F59A 2QMUA 3RB4A 1XWFA 2V7VA 2PKRA 4UAJA 5FO1A 3TQTA 4CLRA 5EUMA 5I47A 1D8AA 2ZB7A 2X2FA 3T3HA 4UHEA 3C5CA 3EQ9A 1KFEB 2Q0SA 3O0TA 4JVNA 1TPZA 3KJZA 4R0NA 5F73A 2ZUFA 4B3GA 3N8IA 5FFFA 5CIWA 3ONFA 4I36A 4O4JF 3LVRE 1ZCAA 4PE5B 4YJHB 4Q3LA 3M6LA 3THXA 1J1UA 4JD5A 4Q9JA 1JE0A 3TM5A 4UEOA 1Z6GA 2Q0ZX 4Y2VA 1XZDA 1S2OA 4BMPB 2GPAA 3TZ6A 2W43A 5CAEA 3HA2A 5CJ2A 4JXZA 1XRSB 4OH1A 3KHRA 1QF7A 5LZ7A 5AUNB 1DK2A 1Y5LA 2WRZA 1PL0A 3TTUA 3TX2A 5BVHB 2PLAA 3RRNA 3SCZA 5EIEA 3OTOB 1JBEA 3FTPA 3TTYA 1UANA 2EWWA 4CHTA 3O26A 1GUYA 1WCLA 1E9AA 2FPXA 2XOXA 2PSFA 1SV0C 1A3CA 1T2VA 5D87A 2EWVA 3RYHA 3VJLA 4MK4A 4MQLA 4H4EA 4RPXA 2ZT8A 3NOQA 4PO9A 3ILYA 1Y5RA 3ZYZA 4QZEA 3NWPA 1ES9A 4PLCA 4MXDA 2FFJA 3PDCA 2BEKA 3D4BA 4IGEA 4OYYA 3BK2A 2GS9A 4L3VA 2X4IA 5JD6A 4RTPA 4KLDA 2JZNA 1GTG1 3LU1A 1AV6A 2IIBA 2XR1A 4LRQA 4ZI5A 4ZV4A 1FIQA 3NPAA 2QWXA 3LYUA 2V3WA 1IBRA 4HPWA 1OH5A 1X7YA 4BO8A 4GZ5A 1K9VF 2JZOA 4YCBA 4QT0A 2LCIA 3H8VA 5B58C 1EVZA 1MFZA 4LUCA 3VA7A 1AQNA 4G8DA 3JYNA 4D4HA 3MJCA 3SC3A 5E8RA 1IHYA 3BTVA 3RIHA 4MS1B 4AAYA 5DLGA 4QDKA 1X87A 3N0WA 2FSGA 2DPHA 3JATB 4YPFA 3EEOA 4MRAA 2MYPA 3CRNA 2RAVA 2WT8A 2PAAA 4MWEA 5B2FA 2Q6KA 2QQGA 3E0FA 3D2QA 3K16A 4H17A 1SUFA 2HIMA 2RONA 2TECE 3PFFA 1CZLA 1IHUA 3VC1A 3OFKA 3ZHXA 1SC6A 4DA6A 3BL6A 3O3OB 1C1HA 3DMPA 1T91A 7ICOA 2W6QA 2MSEB 2PFGA 4KV7A 4F5PA 1NSYA 5DBBA 3PSHA 3VC3A 3DD1A 1IEWA 1X7GA 2BMAA 1CRXA 2BCGY 3UAGA 3WL4A 5LJLA 2O0KA 4D9MA 5JHHB 5HBGA 4XPZA 1XHLA 2HIGA 4UTPA 5ILGA 1UZMA 3K5HA 1H2YA 1BMFA 1NN3A 1UFQA 3II6X 5FBQB 3L84A 2C4KA 3G68A 4OB7A 4UZEA 2ZJAA 1NJ8A 3DLBA 1JHYA 2GPBA 1OLOA 4JA2A 2F9FA 4KFTA 4DXDA 2Z9BA 4DLSA 3RAQA 1ILWA 1XCJA 2Y1CA 3I0ZA 4LOAA 3QK7A 5JQWA 2QP4A 5B1SA 1OXVA 2CDAA 3AVTA 3R9WA 2CNDA 2WF5A 4JITA 3GRAA 4CR7A 4RSHA 1OIVA 5L7TA 4RULA 1XEWX 1LKZA 3OMLA 3SPXA 3ZY4A 3MUFA 4RS3A 2FZWA 4CCAA 1W0KD 3UCXA 2FSUA 2J45A 1NPDA 2VJCA 3T7RA 5CFZA 3STYA 1GUBA 2AKAB 3V7WA 3EASA 4F3NA 4L51A 3NRWA 2N9UA 1TEZA 2E89A 3PCXA 2ATLA 4Q6WA 1W7AA 1ZMRA 1CJMA 4KGDA 4PYKA 1JB1A 1WUJS 5CDHA 3IP4B 4GRAA 4TV9F 3Q7SA 3IB6A 2QJOA 4KMMA 3ZW7A 4EI8A 1E2FA 3WLEA 3A6KA 4WJZA 2KX7A 3PGVA 3SDZA 2ZXUA 1HDEA 3HR7A 3V7LA 1Z4JA 1FDRA 3K3PA 2Q3FA 2RHWA 2YJ5A 2HGSA 3QUSA 1X9IA 4KR6A 4M9GA 1P0FA 1XDGA 1CPYA 5HHHA 4FD3A 4F11A 5IWAB 4DDTA 1VCMA 3O2NA 2XQFA 1V5WA 5NLLA 3UJ3X 2AWNA 1NGSA 1DCTA 1LB1B 2HOFA 1VKOA 3OQ1A 2WT4A 1HQKA 2O2IA 3WISA 5C4MA 1V7ZA 2OVBA 3H2GA 4CQNA 3B89A 1BS9A 1DJNA 3CQ9A 1NQAO 4II3A 2RK4A 4JEUA 5CEHA 4PAWA 3MA0A 4NMMA 3JPRA 2ATIA 2YBDA 3WC4A 1EK0A 2HF8A 5DNDA 3I2YX 3SF0A 1G19A 2B8NA 1UXJA 1NI4B 3NIWA 2DTEA 4DHEA 5EUCA 2I7TA 1RLTA 2I22A 5DIFA 5EZYA 5I5GA 1QG4A 3OPXA 3WIDA 4JT4A 1ULZA 2RG7A 4B17A 1GPH1 5GIOE 4DWIA 4LVUA 1VMKA 3JWGA 5EUQB 3JVIA 3PCRB 1VP3A 3M83A 1RJDA 4NONA 2HJGA 2YZMA 3KZNA 4OTZA 4NPHA 3GRKA 5AJHA 2FOLA 3ZHCA 5IJWA 2Q2VA 1WEHA 4NU0A 4MW7A 3EQ7A 1Q83A 2ZJ0A 3NTLA 2BM9A 1HT2E 4PBSA 4O3SA 4JMLA 1ULAA 5KX5A 1E1RA 3KO8A 3AI3A 2F3RA 3QLJA 3QU7A 4K5QA 4JYCA 4UAGA 4FIZA 4KLEA 4CIVA 4KBFA 1DXYA 2CL5A 4C6RA 4HVCA 3B3QA 3DYIA 2MR6A 2A0WA 3JS5A 4R7ZA 3UHJA 1US8B 1XAGA 3ADOA 5EZQA 2PNJA 1NBAA 4BP1A 3FFAA 4ILKA 2GCPA 3VGPA 4BU1A 1CP3A 2X40A 1ZQLA 2GVDC 3E5RA 8ICLA 4I2BA 8ICPA 3PXAA 3E7FA 3GCWA 4U3JA 1Z3CA 1ZJ5A 4YX9A 1B8NA 3GUVA 2BJHA 5EJEA 4EYSA 1PV4A 2ALZA 2WD8A 1NW5A 3ANMA 3TI7A 1ZH2A 3PQ5A 3WMRA 5CJ7A 1E1LA 1VJGA 3QI2A 2ZZNA 1X42A 1C4KA 2YWEA 3WWDA 3Q15C 4Q48A 2C5HA 1SUSA 4X1IA 1QHYA 4LJYA 1S3FA 1TECE 2MYNA 4KPUB 1H0RA 4AX8A 1PSDA 3EIUA 3VTAA 1ARZA 2BKEA 1SKYE 4MI3A 2J6UA 4Z54A 4X85A 3C8UA 4KYIB 3AUUA 2R8OA 3RH0A 3QBEA 4BEWA 4R0MA 2A9VA 3H8MA 2NWQA 4AMBA 3FI0A 3CGWA 3M6XA 3DCJA 1JEQB 3DV9A 1SXHA 3LP6A 4JH0A 1BCSA 1Z5NA 4ZQCB 5KFUA 4PHDA 3ZCSA 3N8KA 1FSPA 5LP6C 2NRZA 1MA0A 3BZWA 1MDBA 3B5JA 3DV0A 1R0ZA 4HUJA 4OOFA 2UVVA 3BXGA 3AFIA 1M6WA 4GX1A 3K1YA 4KQCA 3NKLA 2J3QA 4GMFA 2QL6A 4ZZ3A 1A2KC 2CC2A 5ITZA 4TQUS 2XB9A 4PZLA 3CH5A 1Z7GA 1VYUA 1XTIA 3BMQB 1WL8A 3HJNA 4QOHA 5EWMA 4ZYWA 2BQUA 3QU9A 2WWTA 2N3ZA 1SVOA 1UA1A 2QAJA 1YU9A 2P9JA 3VFDA 2WLTA 1KOFA 2GN1A 3L7KA 3O91A 5EGNA 4MI1A 4A1FA 3T7IA 2B1QA 3WWZA 4R2IA 4UEJA 1P4AA 4MR7B 1EEXB 4D98A 5BR8B 4B6PA 2EX4A 5FPKA 1U7OA 3R9IA 3GIDA 1CUDA 3BFXA 3BZBA 2V7BA 1WO8A 4M8NE 5E7QA 4ZJYA 2FEWB 3U5ZB 1X2BA 3H9GA 3G0CA 1G6Q1 5I9MA 4Z6EA 1WYGA 1JI7A 3RT7A 1AGNA 5DLPA 4OX9Y 2FDXA 3L4JA 5F2EA 4G86A 3RS2A 3U7FB 1UZNA 1VFNA 2BFBB 2ZR9A 3EOBI 1EFVA 4P0TA 2C03A 4UMVA 1E3DA 4TXLA 3T7DA 4I4IA 3CBGA 2BFAA 3QELA 5JCJD 1LEHA 3I45A 3K8YA 4L6CA 2XZOA 2I4RA 2EBFX 1MX1A 4C4OA 2VHUA 1SZCA 4TSKA 4DL9A 2X86A 4BWFB 2Z8YM 4R54A 5LL6P 2KVSA 2GFQA 1E99A 4TTIA 5JNWA 2CNNA 3EFHA 3AR7A 4UM9B 1IPEA 2W9AA 3T34A 3AESB 4XX0B 1FJGB 2Q5CA 1BHQ1 1CUIA 3DO6A 3SHWA 3QMMA 2QTVB 4D0RA 2WWYA 5KFKA 2YIDA 2IOFK 1O9HA 2ORWA 1EQAA 2VTVA 3R3SA 5EJ9A 4WT7A 1TKCA 2VZEA 3HBNA 3DW3X 3KLBA 2ZUWA 4X0EA 2PD3A 2HCTA 4H16A 3C3PA 2KHQA 1D0IA 1RYEA 1U2TA 2K2WA 3GB9A 1GG2A 4MICA 4BNWA 2FMFA 3QA3E 4H4DA 3C5WP 3QITA 5I9LA 4AJLA 4WACA 1DJQA 3RF6A 2JFQA 3GA7A 1ZBDA 3OM1A 4JFAA 3VSBA 5FAKA 3D6VA 1WUTA 1QRUA 1Y3IA 2QLFA 4KVFA 4G0OA 3IAHA 2ZUVA 2ZIWA 2ZBQA 3PC6A 4GXQA 4QUJA 4DRXA 3DOCA 4IBOA 4O0IA 1DO2A 1YOVA 3HRIA 4IZ6A 4MLZA 2AR9A 3G2PA 4Z86A 2MR5A 2AOUA 3D8UA 3HKEB 3GCDA 3GROA 2XIJA 5DNYB 1BFUA 1IE3A 2AOTB 2PHZA 2QX7A 2ZJ8A 4I5DA 3BTUA 1MJNA 1JFFA 1KL9A 3VSDA 3IAS6 2BZFA 1RKVA 2O8BA 1VG0B 3GVHA 1B7GO 2AB0A 5TT1A 1GV1A 1XXHA 3HSYA 2WFLB 3JD4A 4OBWA 4DYHA 1LC3A 2QMZA 3USES 2OV3A 3QFTA 5TDHA 4C4AA 5J4KA 3UJ7A 2Y0CA 5D3KA 1Z6XA 2B6HA 3BEOA 3DC7A 3UCFA 4CVNA 2F2AB 3F7TA 4DSZA 2HWUA 2PANA 3VSAA 4PZUA 4G5YA 1GZ7A 1AQLA 1F2TA 1M2GA 2KE5A 3TFRA 4UCXA 1IYZA 2JCSA 1RWNA 5LU8A 1R4AA 3Q3CA 1W8IA 1ZD2P 4IIGA 4Q00A 4YJHA 3S27A 2A92A 3SHQA 4MUFA 1IY2A 1R3UA 4O4JB 4BAUA 2PGLA 3LYSA 3FI9A 5DBOA 4IX1A 4QM7A 3EVZA 5H3HA 2FSSA 1C0PA 2VAPA 3DOFA 1SY7A 3UQYS 3LUDA 5L6MB 1FBNA 3PPYA 2R87A 4UVHA 4DADA 1WZEA 3AEUB 4CMJA 4UHFA 2XNHA 1VSUA 4BDTA 3MQ2A 4JCOA 3W5AA 1U31A 5A9SA 3KB1A 1DU4A 1PKXA 1JDUA 3F6BX 4C6TB 5KTSA 1T35A 1E2QA 2A9RA 4Y2RA 2NYRA 1FTSA 1PJSA 3A9UA 3F97A 1ZM4A 3HXLA 4MQFB 5DYIA 3O0DA 2NUTA 3V55A 4CG3A 1MD9A 1E58A 1GYPA 5AICA 3ONVA 4AU1A 1L4FA 5KQGA 3T7AA 1KVQA 1WSAA 4ECZA 1NWHA 3DOOA 1VI2A 4G65A 1SL2A 3A3PA 2AJ8A 4FQ7A 5JJCA 3T15A 1BMQA 3NGXA 3B1JA 2QRMA 3OHMA 5KG7A 1N9GB 1TLTA 2R6DA 3B1XA 5KVAA 1W47A 4P4GA 1NBMA 3UHPA 1NRIA 3CUYA 1Z08A 5HFNA 2B6GA 2AJBA 2Q0QA 1W0JA 5DBHX 5AW8A 3EBOA 1ZD1A 1MEJA 4G0XA 2RBKA 3QFCA 1YDWA 1CY7A 1KJ9A 3TBFA 2V65A 5IIMA 1A5SB 1VZ3A 1GQFA 5LLSA 2K4PA 4DNQA 3SV4A 1I3KA 4KRFA 3HNPA 1E59A 4LYYA 3AQIA 2UV8A 4ED7A 1Y63A 4RQAA 4ZVPA 5K4GA 2C2DA 1ULHA 2BSAA 4B8WA 5KYWB 3OD1A 2IA6A 4OGWA 1JWLA 1B73A 2Y9PB 3RJIA 1DEKA 3H1PA 4EUEA 3IVRA 3E15A 5A9TA 1R4NB 5KTQA 4D8XA 3K9GA 2BDTA 4HB4A 4X5VA 3ZS8A 5GTIU 1JSLA 2WYVA 2OEPA 3MEQA 3DEYX 1WMAA 2A1JA 1SXIA 4IDAA 2E9SA 5HKKA 2P3OA 3C6ZA 3BT7A 4AJ1A 2ZQZA 3FX2A 3IUSA 2YVUA 4PGYA 1Y4AE 1K66A 1HTTA 2VJLA 4OYHA 1X1QA 4I66A 3S5JA 1TMOA 1CEYA 4QZCA 2XNJA 4EI2A 4I6EA 4IQUA 3V8NA 4A36A 3JWHA 3PNPA 2X4LA 1T8PA 1B0UA 1Y89A 1BSVA 4DQSA 2BEWB 5FP0A 2GBIA 2JJMA 2O7SA 1DUVG 4FI3F 5DHFA 5IF3A 5IS2A 4QVIA 4C1NA 2WF8A 1AS2A 3QTBA 5CYPA 3LL7A 1LCIA 5E4YA 1QH0A 1AHPA 2PM8A 5K09A 3HILA 3ZKAA 1K9SA 4OLAA 1NE2A 4IS3A 5THQA 4EMTA 3I9V6 4JU8A 4EHKA 1NKCA 2CJWA 4M9XA 3RHFA 4AG3A 4B7AA 3UA4A 3KYBA 3MM4A 4GAEA 2QUJA 4KWHA 4DV1B 1O6ZA 3VISA 2ZCJA 4HO1X 2VHWA 3D8TA 1QR6A 1PT6A 2ODEA 3GUCA 4DILA 9ICGA 3H86A 1UBTS 2RARA 3DULA 2ETVA 1K7XB 3WK7A 3OE4A 4L0QA 2JJ2D 4GZ6A 4O2AF 1BVUA 2IU0A 3W90A 3ISJA 2QUIA 3BD8A 4WI1A 4NSNA 4N03A 5FWDA 2Y1XA 5HSGA 1CYEA 3A04A 3DC2A 1G0NA 5LYYA 4BTLA 3KTAB 1KI1A 1AMNA 3PUHA 4V24A 4DM3A 4KQIA 3I32A 3H87A 5HS6A 4XQEA 2C5AA 2B0JA 4O4IB 4YMLA 5HZHA 5GVRA 2M98A 3R8XA 3FOWA 1XEAA 4HB0A 3TYXA 1ZJJA 2JGFA 3ML1A 3PZRA 2O1EA 4FK8A 3I5MA 1T1SA 4RNOA 1N8KA 4MYUA 5DX0A 1M1YE 1W30A 3EYAA 3HVHA 5JH7B 2JHAA 2W48A 4DZRA 2XQKA 2YH2A 2PY6A 2R6CA 3WGZA 4RHYA 2CXYA 2BDEA 2G07A 2IOQA 2Q3HA 3KWFA 3OE1A 4PC6A 1B6GA 2EFEB 3EXEB 3SIWA 5I4KA 2IVFA 5DZSA 2PLNA 1UDXA 4YXJA 3OO1A 4KQ6A 4JDPA 1WCNA 3HXOA 3C7DB 4A8HA 2I3AA 4J2OA 3WB2A 5BY2A 1GAEO 2G3YA 5EERA 3I76A 3A1EA 4K9OA 1OYVA 1OWPA 1RWVA 4WN3A 3I0MA 4ZANA 1JXMA 2W6NA 4QW8A 1CUYA 3KKLA 3W3AA 2ZPAA 3U4HA 2FMSA 1NMXA 4DQLA 3ZGVA 3AY0A 4Q9IA 5TISU 8ICCA 2RKOA 4JP1A 5ERXA 3Q9NA 3UJ6A 5K0FA 3INNA 3O95A 4Z5XA 1EB8A 2FUEA 1E66A 2VQ3A 4DVGA 3IOYA 3UXNA 3FZQA 4EP1A 4HRXA 2BRUC 7ICQA 1CC1S 1WMSA 3CFYA 1EHIA 1FTGA 1NQUA 2QEQA 4WXEA 5CT6A 4EVIA 2J59A 4B5KA 2Q46A 3GZNA 3A6LA 2JEZA 4KN9S 2PYDA 4REQB 5ITZB 4YD1A 4DG5A 2IP2A 1RZTA 1PK8A 2KVCA 3LZ6A 4ITRC 2W6OA 3U3XA 3ZCPA 5J2JA 1BVRA 4M46A 2RHRA 4PNPA 1A5TA 3PQ6A 3E2MA 4JJ7A 1RQ7A 1V1MA 2FRXA 2H1VA 5AIAA 1HYEA 1Z6YA 2IHKA 2VUHB 3CXUA 1PJ2A 1TYBE 1C7IA 1VKHA 3IODA 4OB6A 3UK1A 2BW0A 4F5EA 4E12A 2LMRA 1EP2B 4AZSA 2FN8A 2AD1A 3ICPA 4R1SA 2G5PA 1RXVA 1FYVA 5LA6F 2VDKB 2HBZA 4QDUA 2B25A 1A9PA 5CPBA 5BSWA 3ROPA 4ZOLA 3RJEA 2FPIB 3V1UA 1OBOA 2FWMX 2CLHB 1NP6A 3UTCA 1NN5A 3W34A 1NG1A 2JCBA 2NT4A 2A1UB 3CKKA 1UMCA 1V6AA 5BOMA 1U8XX 3PQFA 2HH9A 1E0JA 2POQX 4HSGA 3TUZC 4LIPD 2NU9B 1ESCA 4DFJA 1PR3A 1T8RA 3G2LA 3F4LA 4FN4A 4E22A 2I9KA 1BE8A 3NEPX 1I6KA 2IDJA 4EG4A 4M9ZA 4L9WA 4FWBA 4F1JA 4I8XA 2ORIA 1XJCA 3CY6A 2FHSA 1UK7A 4GKAA 5BSUA 1JLMA 1CZOA 3WGNA 4B4UA 4HWGA 5JVDB 4RIEA 2WQ6A 2G1AA 3KFXA 1O94A 2ID4A 2XSZD 4MW2A 3SOZA 2UYOA 1O2DA 1N3IA 3FYDA 5ECGC 3B60A 1NLUA 2H57A 2UZ3A 3BMOA 2FR0A 3D7NA 4M7OA 4D92A 1SOWA 4EGCB 5FNVA 1Z1VA 1YT5A 3WK6A 1G4HA 1N2SA 3JYOA 3LK6A 4HF7A 5FHRA 4YDSA 2WYHA 3BJZA 1GRQA 2C7RA 4TUYA 4M0MA 2OYRA 1VI6A 3PXDA 2UXDB 3UMCA 5C8VA 4JDUA 4JJZA 3ZCRA 1W35A 4ZVSA 1IAVA 4ZZ0A 2JBAB 2APJA 1NASA 3QF7A 3ZQUA 4EL0A 1RSZA 2Y0SF 1A77A 1W85B 3HSKA 3RSFA 1VKJA 4RX1A 5CHEA 1PIWA 1KL7A 2GNOA 5KKNB 2JI4A 2DBQA 3CLTC 3K30A 1E1QA 2CHGA 1IM2A 4GZ3A 4QEZA 5K8LA 3FWNA 2W8KA 4B4WA 4CLOB 4F12A 3RYCB 2VRNA 2YR0A 4OQEA 5IZ4A 1PJZA 2WNSA 3PUIA 1YZGA 2P8JA 2YJNA 1N3YA 2FSHA 1UA0A 2JHDA 3OY2A 3GK3A 1Y42X 1P7DA 1GIAA 4UAVA 2XF8A 4QOFA 3RQIA 3WXMA 3QKSB 4DR1B 1N9ZA 4R9NA 5C34B 1T5DX 1G6KA 2E7ZA 1NZJA 4YN4A 2ZE6A 1MKYA 3DTNA 3PNVA 2HYDA 4PSUA 4CKCB 1XPRA 5A62A 3TG8A 4ZRDA 3FLAA 3T4UA 4OGKA 4HMPA 4CKWA 4H1HA 2L17A 2P11A 3TMKA 1Q0RA 3RODA 5KTPA 4IUYA 3HUTA 5D5HA 4ZCSA 4B2IA 2QTGA 1KKXA 4O08A 3GFKB 1HRKA 3ORQA 3GVPA 1QHFA 4PGQA 1E3LA 3HGMA 3P2EA 3RSLA 3KSAC 4RD3A 3L82B 3A3KA 1K27A 3AJEA 1TUGA 3M8RA 1I6MA 3BE6A 3H7AA 2G82A 2YXPX 3PYXA 3V00A 4A0SA 1JXLA 4LMPA 3MGKA 3ZVRA 2ZI5A 3HN2A 4G0PA 3KUUA 5ESXA 1T9KA 2EEPA 1J90A 4B6SA 5A9RA 4DV6B 1VB3A 3E4DA 4BZPA 1XLWA 1AMUA 2YMLA 4Y9UA 3SE7A 2A57A 1JJVA 1FVXA 1K6XA 1KDRA 3MQFA 4MKGA 3HVJA 4QU0A 4R31A 1JUDA 4RKYA 3RSCA 1XCMA 2BGLA 5J4VA 5G4KA 2W2LD 4ND8A 2Y67A 4E13A 1FFUA 3ME5A 4DRXB 2GLUA 1T4CB 1ZITA 4YCAA 3PNKA 2VF7A 3GI1A 4OLFA 4Z4CA 1J00A 2I7VA 1OW3B 3E0XA 4FC7A 1F9EA 4I2DA 1MO6A 2D8MA 4M21A 2ATCA 2F4NA 3H1AA 3JYPA 4R51A 4ZQBA 4KJZA 4D5EA 1OXSC 4WADA 3IA2A 5DTQA 3U4QA 2YJ4A 4BEVA 1L5VA 4N8DA 4DCGA 3AFNA 3QNUA 2XXAB 3GDXA 3U7JA 4XEUA 4WK6A 1R8SA 3K71B 4D45A 4ENQA 4AY5A 4ED3A 1EHYA 2WSSD 4DCMA 1IHOA 1MORA 2BGMA 2GWHA 2I66A 3BMNA 3S3TA 2Q8PA 1TF2A 2PUDA 5BV8A 5FLXA 1GILA 1OC2A 1JEAA 3A1FA 5AVJA 3CG0A 1W19A 1XN4A 4JKYA 3F3SA 4COOA 4RZRA 3EBPA 2V96A 3R3WA 1K6JA 5BRJA 1PVOA 2NYAA 3D0OA 5CDYA 4GSKA 4L15A 2LPMA 3TW8A 5LBIA 4CMEC 4DLXA 3U40A 1LPBB 1Z5VA 1B4FA 3D1JA 4RH1A 3X1MA 4C3OB 1P39A 4FZVA 1YE5A 2EEZA 3GH1A 3CSDA 1BGVA 3L7IA 1LW6E 3LY5A 4ARSA 1BHJA 2P68A 1XU9A 4Y67A 3ZPXA 3W8DA 2REQB 5FUVA 5J2UB 4YLGA 1NX6A 3QPCA 2JFVA 3C8HA 5DBEX 4P4SA 2ESRA 4N8EA 4DR6B 3C3CA 3R0VA 1NZFA 1OFUX 2H4FA 2VHCA 2WHRA 2W6ID 3PIDA 5E7IA 4FE7A 4BNLA 1P2FA 4KFCA 3RYIA 3U6KA 3GO4A 2CFRA 2VP9A 2WP8J 2ASJA 1YUMA 1Z83A 2OBLA 1YFKA 1K97A 5KYYA 2QENA 1JHRA 2WB1C 4IMPA 9LDBA 4LY0A 1HEYA 2RGCA 3VR4A 3CW9A 3X44A 3LCRA 2XECA 1Z35A 4U0JA 4YMGA 4DA4A 1QO7A 1NJXA 3Q6MA 4Q4HB 4TVSA 4NQRA 2FPKA 1WF6A 3TRKA 2W8BA 4F3OA 2WWVD 1BKSB 2JC3A 2CSXA 1TAQA 3OE5A 3OZFA 1YKSA 3GNLA 3NBMA 2EZ9A 4J7AA 2BGUA 1D9XA 2Y1FA 4G5OA 4NZNA 4W6ZA 3A1WA 3L1VA 4RVFA 5EMJA 1P80A 3DTTA 4JU9A 4PIMA 2XYHA 1NYRA 2D06A 4RIFA 1XDSA 2QB5A 3VYUB 4A1OA 2BFPA 5F98A 4S0ZA 3FZEA 3QI7A 1LBSA 1P31A 1J8QA 3FWYA 2PT9A 3DE5X 4Q3OA 4D97A 1U28A 3ZBQA 1JSRA 4LI0A 1RC0A 1V3TA 3R0ZA 1GQOA 2CGEA 1NK8A 5DT2A 1RLMA 3LFHA 1EFRA 2ZB2A 1JKJB 3MOSA 4CCSA 3SC6A 3R20A 1TUBB 4NL4H 1QFZA 3KPWA 3VHQA 5IKPA 1ZCBA 1NVBA 4A82A 4CKEA 3BQ0A 2CVOA 2Q9BA 1Y88A 3KTQA 2Z7JA 2J9FA 1LPAB 2QYOA 1LI5A 5AM1A 2Z8YA 3CEAA 3GJTA 2X0EA 2C7QA 1KMIY 2YJ3A 3VJRA 2ZRNA 3A1SA 2WMNB 4XGQA 4ERNA 1LBTA 1FFDA 3PPXA 1AROP 3K70C 3MUEA 4W9NC 4LSGA 2QD3A 1TM2A 8ICYA 1JWAB 2X7HA 5K8TA 3LNCA 3MXTA 3X2FA 3UGQA 2YC4C 5T6BA 4EG7A 2JW5A 2NLOA 5IP5A 1EGQA 3PE3A 1NJSA 2C2BA 4HR7A 2QAGB 4ECVA 2DWCA 3A9CA 3CGGA 3CUEF 1NRJB 3H99A 1QLWA 1GFZA 2AMFA 3CF0A 5H81A 4C0BA 1DKOA 3RFXA 4DR5B 2NZ2A 2QV0A 3G17A 1RPAA 4MEBA 2G36A 2KMLA 2XUIA 3CZMA 1UEXC 1E1QD 2EYQA 2VH2A 4FT4A 5D1NA 2FSIA 3PC3A 5AXCA 1OKKD 1EWTA 3F7OA 1GAXA 1JZQA 2IIQA 2XUQA 3ZXIA 3FUXA 5HGJA 2O1SA 1T5HX 3C29A 2PZFA 3ESXA 5EFOA 1R15A 1FOEB 2ZSIA 3VDRA 4C3VA 2RSLA 4WESA 1PG0A 3AHFA 1BX1A 2ZDQA 4ENWA 2H5JA 1Z2DA 4JQOA 4BECA 4M8KA 4JGBA 4PGMA 4D8UA 5KFDA 2Y0PA 4PYNA 5CR0A 2HJHA 1YB6A 3RIMA 1A7UA 1J2UA 2GNPA 1JQLB 3VU9A 1WOMA 1SCJA 2HF9A 4OSEA 1K5PA 1JLLA 3VR2A 2YMPA 4CL0A 3SZUA 4LGMA 5A2GA 4ZKDA 4B73A 1GZ6A 2F1OA 1TFRA 1YZQA 2PYZA 3JRWA 4X8LA 3U1TA 3SQNA 1VBMA 3UYLA 1CU1A 3DR3A 3P2JA 3L7OA 2YY6A 1Y6FA 1NURA 3ALRA 4MQ5A 2PGJA 3VDNB 1L1RA 3DVSX 1OT5A 4J4BA 3MTIA 4PX3A 3ELDA 4ZQHA 3GLHB 3SC4A 4C21A 4PCUA 1AH2A 1JS1X 1HOTA 4N5DA 4CM5A 1IG3A 2F64A 3U4QB 4LFAB 3DBOB 3ZJVA 3GJ8A 2ATXA 2H59A 4I2VA 2Y68A 1FSFA 1A04A 4EZ6A 1PNOA 3A1VA 3EIEA 4YFKA 3KIPA 1XJ5A 4ECWA 2KG5A 2JLZA 1N7GA 3HWRA 5JT1A 3ND6A 2VDWA 3ABIA 1KEPA 2JIRA 3F49S 5BR7A 1EGAA 2DY1A 1DRVA 1XRMA 3W8NA 4F8EA 4G1BA 5IINA 2LYHA 4BWYA 1W36C 4CEHB 4DIEA 4EUHA 4FYHA 5DN9A 2OAEA 4I9FA 1BU8A 1ZNYA 1UAYA 2HHTA 2AQIA 3F5QA 4ZCLA 4IIJF 4O4HB 2D4AA 2LDBA 5AJTA 1VG8A 1VDVA 3PBKA 1VKRA 4BVFA 3EMBA 5I7FA 4QM6A 3UGKA 3L8YA 3CN9A 1XZHA 1XO1A 4J0FA 3HXPA 1CIJA 1J5XA 3HZOA 1W4LA 3ZDXB 1KARA 2CBZA 2BMJA 4KC0A 4YQWA 1I0IA 3PR1A 4Q7LA 2PUHA 3BS5A 1WBDA 1A72A 2QRLA 5JG7A 1OLSA 2CZQA 1RBMA 1HDIA 3ZX4A 4M36A 1XQWA 3WG9A 4EABA 1Q21A 1RMQA 1JEQA 3D3NA 1YQ9A 3NV7A 1E5DA 3MDCA 4WFIA 4X1YA 4KB5A 4HQFA 5IW8A 5CRIA 5EZ6B 3TZBA 5EP4A 3R6WA 1NVGA 4ALLA 5GIPE 5IZCC 4N40A 4G9EA 3GLGA 3S44A 1ZESA 4BV2A 1EWVA 3BQ7A 2J07A 3PFKA 3G8DA 2V9ZA 4KGXA 4FYIA 2SKCA 3ESAA 3TLKA 4GKBA 4IINA 6NULA 1L4NA 5T3YA 5CJJA 3O7MA 3H11A 5HQTA 1FO4A 3DDUA 3UXEA 2R65A 4OBEA 2H7XA 5KOHA 5KOJA 4C4TA 3B5EA 4JJKA 2C04A 3PC8C 1XTZA 1O97D 1PYOA 1SOUA 1TTHA 1DAOA 4JV2A 1VMAA 2C2HA 2WILA 2ECKA 1XLTA 2WWIA 5AKGA 2P67A 3AM4A 3LWDA 3U4IA 1J8VA 4ITVA 3VBCA 2F3SA 3PRHA 3R6LA 3M6UA 4DA7A 3D2SA 3B8HA 3R0IA 4V38A 1ZM9A 4RT2A 3WK4A 3M1IA 4MWCA 5B37A 4AFNA 1YRYE 4RLQA 3N28A 2QPOA 5A5GA 1KOGA 2O19A 2GXSA 3TQHA 1E3MA 1ST3A 4PSAA 2G09A 4FZ5A 1TUBA 5SY9A 2HBQA 3G88A 1GEGA 2ZSHA 1BCRA 3U61B 1U3CA 1W5FA 3BXEA 1L4LA 4KITB 3BWVA 2MYTA 2LD4A 3HGQA 3N3AC 4XCVA 1RU3A 1ZAKA 3G2NA 3V9AA 4BQRA 3KCNA 4NXMB 3Q7IA 2CEAA 2KE7A 3FTNA 3RIEA 3OHBA 1AQYA 2PDAA 1OYOA 3GXOA 3ND9A 5ULLA 4Q15A 1D1PA 2VP3A 4TWJA 5ALWA 4TQSA 2EHDA 4GT1A 5AM0A 1EI9A 3VAZA 3WL5A 3KETA 5BVHA 4H7DA 1HL7A 1Q44A 3SHTA 1A1SA 1NLMA 1AT1A 2K7ZA 2HMUA 3BCSA 3OSUA 2VFAA 4S1OA 5DCYA 1K1SA 1TJ4A 4L5YA 1A8HA 1I3CA 4CMBA 5LXTB 2H85A 2PGNA 2XDQA 5DVZA 2E1PA 3E27A 3Q40A 4PQRA 4ND5A 2FHPA 4WUVA 4CLOA 1IZ7A 1Q15A 4EO4A 3H5NA 5IT5A 1DXOA 1USUA 4LOIA 1PJCA 1Q3VA 4EBCA 1NUAA 4X1OA 4FBTA 1U6JA 2QP3A 4UMEA 4HOYA 1QGAA 3W2GA 1LXCA 1PU2A 2EKDA 2W8ZA 2WOOA 3RB6A 3GAMA 3NYIA 4DIMA 1RI2A 4LF8B 3ZD9A 5EAIA 1O94C 3GUUA 1CJTC 3C5GA 4UKDA 4XYEA 4L7VA 1QQAA 5A3SA 4IWYA 2DU8A 3C6BA 3FFTA 2P5TB 4Q9AA 4M99A 5CEFA 4L95C 1TC2A 1HGXA 2ZBDA 4TROA 2FUNB 4M49A 1B2RA 1T8YA 4U8HA 4Y9SA 1FDUA 4NS4A 4GBJA 3ROEA 5I4IA 5JIBA 4UUMA 1JFTA 4B3HA 1SWWA 2DC1A 2XCUA 3BRWA 4MFAA 4JBWA 4OMUA 4CCWA 4PYQA 1IC6A 3NVAA 2PLWA 3STWA 1YB2A 2IW1A 4COKA 2R8BA 1LY1A 2BEVB 3HO6A 2ZRDA 4GMGA 5CLFA 3G2MA 4PS1A 2ZRQA 3WLAA 5DTJA 5AW2A 3U13A 2VUSA 3AN1A 2EKQA 2C4VA 2JH9A 1F2TB 1KBQA 4M0KA 4YT2A 5ALTA 2PUJA 2X4GA 2XE8A 4C4SA 1A5ZA 1NVUQ 2BM1A 3BILA 4QE3A 2WNHA 2AUNA 2CLKB 4Y3UA 1C50A 1N5DA 3L02A 2ODBA 3L0ZA 2AXTU 1FZTA 4Z9BA 4Q43A 3TFSA 4HRAA 3LWBA 4OGLA 4RVDA 1Z2PX 4ND8B 2CJFA 2D5CA 1JQAA 1Z0UA 3WIOA 3NAGA 4P0PA 2QTRA 1ZOIA 4YRBA 5BW8A 5C8YB 1DC5A 1MHPA 5BMOA 7ADHA 2G67A 3AGPA 1HDZA 5D6NA 3OQMA 3KHUA 2UVPB 4P3YA 4E33A 3V7KA 3CZRA 3ELBA 1N92A 3HCNA 2P2NA 3KSDO 4H60A 2J6IA 2XMGA 3QVWA 1RYSA 5GV8A 3STVA 2ECPA 1ML4A 2VJKA 3HVRA 1U80A 4C01A 5F7OA 2IZ7A 3ZU5A 2RGYA 2I7CA 5AW0A 2IZ5A 4HGQA 2IXGA 4TMTA 3GC6A 2ZETA 4CFYA 4ETIA 7ICIA 1JJIA 1OFTA 1K4YA 2CYBA 2I76A 4HDSB 2VSFA 4CNBA 1QFSA 4CQLA 5AW3A 1GSHA 1GRCA 1PN3A 1EVLA 3RNOA 4N8SA 2RMKA 2EH9A 2WIDA 5DXFA 5J0QA 4BQNA 1J20A 4GXJA 2Y1OA 4BNDB 1YTLA 3CUUA 1FP1D 1WAMA 9ICEA 4DCOA 1SCKA 4JV0A 5SV2A 1WVGA 2WJIA 2OP0A 2YXLA 4R84A 1GSOA 3GRFA 3LGAA 4CM8A 4IQWA 1YZHA 4FNMA 4MUYA 4IZIA 2FW8A 2W7TA 4OXYA 3Q98A 4XM0A 3JQBA 2OCBA 5CDSA 1SV0A 4RJKA 2Z57A 3WHKA 4L75A 3SI8A 4RGVA 1CUAA 4WA8A 3FGOA 2BCEA