1X42A

Crystal structure of a haloacid dehalogenase family protein (ph0459) from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDFVGTLLSVEGEAKTHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPIRDIEEEVMRKLAEKYGFKYPENFWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH0459
publication title Crystal structure of the probable haloacid dehalogenase PH0459 from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 85
structure length 230
sequence length 230
ec nomenclature ec 3.8.1.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1x42A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1x42A01
3OCVA 3PCTA 3I6BA 4Y2RA 5ALNA 2CFRA 4EX6A 2YMMA 1YJ5A 4UARA 4BX3A 3FGOA 1LTQA 4UM7A 1RLMA 2W43A 5AVRA 4EENA 2GHQA 4Y2XA 3N07A 3L8HA 4I9GA 4O8CA 5AVXA 1Z4OA 3L1VA 3AR9A 1LVHA 4F71A 1QQ6A 5AIAA 4E88A 4C4RA 3NANA 2QLTA 2ZBFA 5AI8A 1CQZA 4CF3A 3P96A 2FUCA 5AK5A 2AUTA 3F9RA 2JGAA 3L8FA 2RAVA 4BX0A 1VFPA 3PGVA 2CN1A 3QU9A 2B30A 5A3SA 3AR2A 3ZX5A 2I34A 4XPZA 4UW9A 3ZX4A 4UM5A 1RQLA 5ALDA 2AH5A 4UMEA 2GO7A 2FEAA 3D6JA 3QUCA 3NIWA 3PGLA 5AVVA 4YCMA 2FPUA 4J2TA 2JAUA 5ALHA 4HAIA 3FZQA 4Y2VA 2P27A 3ZWKA 4C4SA 4UAVA 3SKXA 5AKXA 2YJ4A 3SLRA 3OCZA 3E8MA 2WF5A 3U13A 1QQ5A 5ALTA 4FE3A 1Z4IA 5ALRA 2HOQA 1Z4LA 2G0AA 4JDPA 2BY4A 3TLMA 2YMPA 1MH9A 4FYPA 3W5BA 2R8YA 1U2TA 5AKKA 3SMVA 2YN4A 2EAUA 2P11A 3BWVA 4Y2PA 3WKAA 5AM2A 5AW2A 3KBBA 3MC1A 4NABA 3U7GA 2YBDA 5AM5A 5AI0A 4DW8A 2G80A 1Z4KA 4KNVA 3L1UA 3L0YA 2VKQA 4HGOA 1S8OA 4CF4A 4OHFA 2DQSA 3W5DA 4AP9A 4HGNA 2ODAA 3EF1A 2PR7A 1U7PA 2HF7A 4F72A 1AQ6A 1VJRA 3L0BA 2PKEA 2YJ5A 1VJ5A 1ZRNA 1F5SA 4J03A 2HDOA 2O9JA 3L8GA 1L7PA 3QUBA 3QU5A 3RFUA 4UMDA 3WK9A 3U26A 2NYVA 4G63A 1N9KA 3DAOA 2G07A 5JJBA 2YY6A 5AM0A 4EELA 1L8LA 4QJBA 1RMYA 3RF6A 4Y2SA 5ALJA 3WK4A 1RKVA 3QLEA 4DWOA 3FM9A 1RKQA 4C4TA 1Z4PX 2ZG6A 5AVWA 2NO5A 5AK4A 4ZEXA 5AVZA 4Y2JA 3WK6A 3AR6A 1XPJA 2B1RA 5T41A 2R8EA 5ALOA 2I55A 1L7MA 2RB5A 3EF0A 3W5AA 2FPRA 4YH1A 4HGRA 1U2SA 4IG4A 1RMTA 1Q92A 4HGPA 4YCNA 2C88A 1TE2A 4OD0A 4OFZA 2QYHA 4OCZA 2C8LA 5ALXA 3ZTWA 5AVUA 4UASA 1ZS9A 1TJ3A 4NAVA 3E81A 3HYCA 1Z5UA 3QX7A 1RLOA 5AIBA 2YMLA 3J7TA 4YIKA 2IYEA 2YMQA 1Q91A 2WF7A 4CE6A 2OYCA 3ET4A 2WF9A 5ALFA 3M1YA 3B9RA 1ZD3A 4DFDA 2P9JA 1EK1A 3MN1A 5IS2A 3NASA 4H1WA 1TJ4A 2OM6A 3UMBA 4UAUA 2RBKA 4NV0A 1WR8A 4YIHA 3ZVLA 1XVIA 3WKCA 4L6CA 2WHEA 5ALQA 2CFTA 2FPSA 1IWOA 2HF2A 2X4DA 1T5TA 4PNHA 3QYPA 2HEGA 3M9LA 4B6JA 2ZBEA 1TJ5A 2I33A 4EX7A 1Z4NA 5AHXA 5AVSA 3CNHA 1ZJJA 3SKYA 1JUDA 3KOOA 4KYTA 3OCWA 5AW6A 3A1EA 2JARA 3N1UA 4XQ0A 1SU4A 3NALA 3ET5A 4ZEWA 3OPXA 5AESA 3ESQA 3N8GA 3DDHA 4YGYA 3IJ5A 3WK5A 2WFAA 2B1QA 4L57A 3I28A 4BBJA 3UM9A 3QU7A 2ZBGA 2ZBDA 5E0OA 5AKEA 2Q4TA 5AW4A 1RQNA 5AKYA 3A3YA 4Y2TA 4KX5A 4QQFA 4GIBA 3QUQA 3WGUA 1RC8A 3ZVMA 2YJ3A 2IOFA 3I76A 5ALVA 3R9KA 1NNLA 3QU4A 4UATA 4ZEVA 5AW3A 2W4MA 5AKIA 3DV9A 3ZWDA 1YS9A 5ALEA 1YNSA 3KZXA 1QYIA 3IB6A 1U02A 1FEZA 2WF8A 3A1CA 3PDWA 1WPGA 2HCFA 5AVQA 3ZVNA 3OCYA 4HGQA 5AVTA 5IT4A 2I6XA 1O03A 1L7NA 5ALUA 1ZOLA 2BDUA 5ALMA 5AI5A 4Y2YA 1S2OA 2EARA 5AW0A 3U19A 2JAWA 3WGVA 4BEWA 3E58A 5ALPA 5AM1A 4CNQA 1RPZA 4NFLA 3SD7A 3E84A 5FP0A 5AW9A 1L6RA 2HHLA 3AR3A 5AW7A 5AKHA 1RDFA 1ZD5A 4MWOA 3IRUA 3OTQA 2RARA 2I54A 2WF6A 1O08A 5IT0A 3WKDA 2WM8A 3CZ4A 5AVYA 2AGVA 2HI0A 1YV9A 4UMVA 3MPOA 5A3RA 3FPBA 5ALYA 3L7YA 3L8EA 4HYTA 4RETA 4BX2A 2MU2A 1SWVA 2R8ZA 5ALSA 4AS3A 4BKMA 3N28A 4Y3UA 4KX3A 2Q5EA 4IFTA 2YFYA 4BNDA 2D2VA 1YDFA 5AW5A 4MUMA 3I1YA 4UU1A 3BA6A 3U7HB 2G08A 4I9FA 3EPRA 1PW5A 1NF2A 1Z4QA 4XE5A 5ALIA 1J97A 1Z4MA 5AKJA 2G09A 3A1DA 2PQ0A 1U7OA 2W11A 5AM4A 2G06A 2FDRA 2MU1A 1X42A 1ZD2P 4JB3A 2HO4A 2GMWA 1L7OA 3ONNA 4KNWA 3KD3A 3GYGA 1EK2A 3NUQA 5ALZA 4BYGA 1N8NA 2BDEA 3UMGA 3R4CA 1Z5GA 2Q4RA 3NAMA 1K1EA 2MSNA 3W5CA 3EWIA 1RRCA 3FPSA 5ALWA 2OBBA 2EATA 2I7DA 1T5SA 3R09A 3ZI4A 1CR6A 1TA0A 2HX1A 2C4NA 3AR8A 2G1AA 1L8OA 3ZW7A 4GXTA 5AKLA 4G9BA 4EEKA 1RKUA 5A3QA 4YCLA 3QNMA 1RMQA 5AI6A 1NRWA 1QQ7A 2FI1A 4NWIA 2GFHA 3N5KA 2FUEA 4KN8A 3U7FB 2B0CA 5AKGA 2FPWA 4L6AA 3ESRA 1WZCA 4EZEA 4XOUA 5AM3A 1J8DA 5AKZA 3B9BA 3KDPA 2B8JA 2C9MA 4AS2A 4Y2QA 2ZOSA 3UMCA 2O2XA 2HSZA 5ALKA 3AR4A 3L5KA 3ZU6A 1YMQA 3AR5A 2R8XA 3SHQA 1WVIA 3QGMA 3HLTA 2AMYA 5AW8A 3U7EB 3WK8A 3QUTA 4UU0A 4BNDB 3AR7A 3B8EA 3QXGA 2B82A 5AI9A 3WKEA 2JAOA 3OCUA 3ZUPA 1RLTA 3ED5A 1Z4JA 3K1ZA 1Z88A 3FVVA 1ZD4A 5AK3A 4DCCA 3OCXA 2P69A 1Y8AA 4UMFA 3VAYA 5AW1A 4BEVA 1SWWA 3MMZA 4CF5A 2ZXEA 2YJ6A 3KC2A 5ALGA 3WKBA 2C8KA 2GHTA 1QH9A 5AK6A 3ZTYA 3DNPA 4Y2UA 1KYTA 2IOFK 5AI4A 5ALLA 2CFSA 3QU2A 5AICA 3S6JA 4FFDA 2FPXA 3NRJA 2OA0A 3WK7A 2IOHA 3SF0A 2B8EA 2NO4A 1XP5A 1ZRMA 1T9ZA 2IA5A 4RESA 3L0CA
chains in the Genus database with same CATH superfamily
1GJRA 1XUOA 4YFVA 1G3MA 2PHZA 2QD1A 4LGYA 4I81A 2RHTA 4N3BA 4IIHA 5BWLA 4KO3S 5J0TA 1H05A 2XCIA 1QE5A 3LUDA 3KZVA 2QY9A 2E1FA 2OQ2A 3THSA 3SFZA 4HWPA 5JUWA 2AH5A 4ARAA 5AXCA 2DPIA 1BJKA 4HNHA 1VHLA 3O9ZA 1B15A 3K0CC 4BIIA 3OZSA 5L9XA 1N0IA 5IJXA 1KZ4A 2GPAA 1QCYA 1EP3B 2P4UA 5LB4A 1MV8A 5JNSA 2OCBA 1KVSA 3TXYA 2VSFA 3F71A 3VHRA 2GJ9A 2VJMB 3BE5A 2HF7A 4RPHA 2ZYGA 4EFKA 1YI8A 4R2MA 4NONA 4JV0A 5BQ3A 1DEHA 1T1RA 2QV0A 3NONA 1VL2A 3A4LA 2H4YA 5E3JA 2KKPA 2IDKA 4DSZA 4P2BA 2VUIB 1SVOA 1OFGA 2I29A 1WXXA 3SDZA 2BHSA 5LKAA 2IJGX 1TT5A 3WRXA 4GMKA 2KI5A 3ESBA 3ROPA 5JI2E 5A5VA 3CWQA 4J1TC 5LDGA 5CNKA 4GP7A 4CE6A 4XUCA 1MHTA 1COKA 1CLEA 2HSGA 3EDRA 3K96A 1Q0SA 2AC4A 3F9CA 3PKJA 3ORHA 4D4IA 1OT3A 1T3SA 3J81j 4JSRA 3GFBA 2AFIB 3LTNC 1WBDA 3K6SA 1FFXB 5I7VA 2IP4A 1JA0A 3A9TA 4Y18A 4NK5A 3EVTA 3PR4A 4QDKA 3GLGB 3ZCPA 2W9MA 4CEIA 1OW3B 4HVLA 1GTVA 4TMFA 1YU6A 2ZI4A 1DRUA 2V74B 3I2KA 4HZGA 5DF1A 3U4HA 4OSEA 1DKQA 1GDHA 3FNGA 3WHLA 4W63A 1PR9A 1LS6A 4GM4A 2Z6UA 1AMUA 4LVSA 2CNOA 3TI0A 2DY1A 4XH9B 1BVHA 1M6WA 2C4UA 1PWZA 3AHJA 1UM8A 4GM1A 4N82A 4TYWA 3KJZA 4GE0A 3KV1A 2WB2A 3V8MA 1UBMS 4BEWA 4B3XA 3VU3A 1U2ZA 1G6OA 3H1BA 2BEKA 1NA5A 1H2EA 2OK7A 4F46A 4IIFA 1GQFA 4DG9A 1JQDA 1IRXA 1QRRA 2E6UX 3OHPA 1ACLA 4JYMA 2GT1A 4CKZA 3M81A 1CDZA 4MUNA 1U2GA 3FB4A 4UZFA 1QS0A 3A0UA 1PNTA 3C8MA 4FWBA 7ICRA 4IBOA 2QRLA 5CFMA 4X5VA 4CLXA 5AKJA 3PY8A 4H1HA 4DSLA 2WHQA 4L8YA 3EG9A 3I0MA 4N7BA 1NW7A 3AONB 1UQVA 2HQBA 2YFHA 5IFKA 2XUOA 3RF9A 4S24A 1IEQA 3SU8A 1GFSA 2Q5CA 2C4NA 5ADWA 1RQXA 1LVGA 2R7LA 1NYTA 3NYIA 1QQ7A 4FOOA 4PO1A 4JOQA 2P35A 4BUZA 5IABA 1GM5A 1V8ZA 5FUYA 1RPNA 2GAOA 4AKEA 5CPFA 4ER7A 1TZ2A 4KYIB 1YZNA 2HSWA 1HXHA 2FQXA 1CB0A 2IUEA 4GOLD 5ICGA 1N2HA 5B3LA 1JHOA 1SXIA 3U7EB 1DXQA 3HJCA 1ZQGA 4LF8B 4I1UA 1WM1A 1P77A 4JZYA 4O4JF 1SWWA 1KETA 5B3AA 4L3OA 3DMTC 4E08A 4B4VA 3SX2A 4HNQA 2IF0A 3OPYA 4ECZA 4K9DA 1RIFA 5CB6A 1VRWA 4YMWA 3B6JA 1LV8A 2ATCA 1IEWA 2IHYA 3D1VA 3QLVA 4MK4A 5IM5A 4EENA 2NAPA 1KEEA 4E14A 1GPAA 2ZT6A 3AUSA 3VUEA 2EX0A 3ZCUA 1ZJ4A 7ICNA 4B46A 2RCYA 3RASA 2CL7X 2QLBA 1N5IA 1Z5OA 2GRUA 2RG1A 3E8SA 2HUNA 1C7ZA 3VAZA 3JWJA 3FMVA 3KHTA 5B6PA 3CLSC 1W35A 2Q46A 3AI1A 1JDBC 1DOAA 2B4RO 5ICSA 1Q44A 1Z39A 5CVUA 1FXWF 2BJVA 4RQ5A 1IOWA 2XZTA 2XVXA 4B3MB 1OUMA 1U0LA 1OYYA 5E1OA 4AD8A 3VTFA 1AF4A 4JZKA 3L0YA 4O2AB 4MHOA 3E53A 2OV2A 4NCBA 1AQ6A 1BFDA 1GU1A 4LYDA 1HUZA 1YZKA 4AW9A 1OD6A 3TFRA 1HE8B 5EERA 5DWVA 3SZMA 1KFDA 2Z30A 4JSYA 1H2RS 2W2LD 4XWWA 3VPHA 3NKLA 1EM8A 4F4YA 3TB4A 4LVCA 4O3NA 4DSJA 1WCYA 4GPZA 4QLBA 1TZMA 3E3AA 4IJ5A 3HMKA 3KKOA 2QOEA 2R60A 2PZLA 4UASA 1BX0A 1B0AA 3C7AA 9ICHA 1H65A 3V6MA 2IYAA 2OHVA 1YRQA 3EVBA 3RB0A 1FP6A 3IKMB 4OLAA 2F3QA 4QXAA 4HJRA 2CFTA 4UTRA 1UBTS 3PXDA 3LV8A 4Z7NB 2CBZA 2Q5JA 5A4IS 4CMAA 4S1VA 3HSKA 4EX7A 2HXSA 4CIYA 4HMQA 1GGJA 1HIWA 1E2UA 1WNTA 4A0GA 3AFNA 1SHZA 3OJCA 5K4AA 1W5AA 5JS6A 2R7AA 4KWCA 4QHYA 4HYKA 4QIHA 1W94A 1RQNA 2I1LA 2WLSA 3GDXA 4L50A 1QK5A 4ZT3A 3NJRA 3E0QA 4HDSB 2C5FA 5AKIA 1QCDA 2XIJA 1KJ9A 2WWFA 2G67A 3LWDA 5K3FB 2HFKA 3MXTA 3EOAI 2GHRA 1WEHA 3O8NA 5I5EA 2BRUC 4RULA 4CU5A 3HBMA 5AI5A 3VR5D 1XWFA 1T8PA 4FHCA 4JDUA 2ZRLA 5ALPA 3QY0A 2EEPA 2MTBA 2Q5LA 1TO1E 3D5EA 4HBZA 3Q6MA 2FUKA 3OTQA 3G2MA 2XZOA 2Y2UA 4I6GA 3BH0A 3STTA 4UCWA 1V7ZA 2W03A 3L7YA 4HYTA 3VDXA 1LCIA 4TL7A 3PLAE 4AQ7A 1RVV1 3V3KA 2RC6A 2B25A 4DC9A 2HIHA 2WAAA 4B7AA 3NHWA 3A1DA 5D5PA 5D49A 1HC7A 5BPHA 4HS9A 3HFJA 2OLJA 1BC5A 1E60A 2Y3IA 1MAVA 5IZCA 5IINA 3GY0A 5FTMA 2MSNA 1DRWA 3F8TA 4J9KA 3IUMA 2ERYA 4PHHA 1XTKA 9ICLA 3SSNA 4MVJI 5FI1B 4U5QA 3ZQ4A 1K6IA 1RM5A 1PRYA 3MUFA 1RMQA 4RSGA 3M70A 5KTNA 1UC8A 3U7FB 4BMXA 2IU3A 2I9GA 2W2NA 4EZEA 2ZUDA 2OWOA 4XFKA 4HWTA 1ZL2A 1HGXA 1CNFA 2UU9B 1UBCA 2VYFA 3D8NA 1DOHA 2GJKA 2OR3A 5JCOA 8ABPA 5C1OA 2QL9A 2Z8YA 3D2CA 2AU0A 2PL3A 2VP4A 1JR4A 4RXUA 3AK4A 3AJ9A 2QJRA 4C0BA 1H1TA 3KB2A 1F9EA 1T4CA 2DR2A 4DA7A 1OUQA 1KPGA 4NOLA 3M5PA 1KP3A 4IO0A 2OXCA 4EG8A 2FG5A 4HN9A 2OO5A 1H2AS 4QHTA 3F6EX 1TECE 2M32A 4KHZA 5SICE 3M8SA 1ZN8A 4XGQA 4EG4A 5I9BA 2K8BB 3OQVA 3A0BU 5DXJA 4MCIA 1NJFA 3QH4A 4O9MA 5EJ2A 3NBAA 4R05A 2WIKA 3PGLA 2XBUA 5KWIA 5DG8A 2CNKA 1CJVC 1OI3A 3QA9A 5LBUA 1C1HA 2IQ5A 3KLBA 3Q7RA 4EY8A 1DQYA 5C2JB 4YG2A 4V0QA 4MV4A 4AJ2A 2NUPB 2HADA 5CM8B 2VFAA 3F7MA 2NYAA 5K3BA 5BPCA 2HU7A 2EP8A 5CFRA 4US8A 4HGNA 3BRWD 3T4EA 5FWYB 1UAAA 1XTUA 2HU8A 2GCNA 3VR2D 1XZCA 2PRYA 1IVSA 1J2NA 1TUBA 4M1OA 4D97A 2MOKA 3SI7A 4NMXB 2FFQA 5LXTF 1F2VA 1N6HA 4O4LF 4BO5A 5DHAA 4YRLA 2Y71A 3NDPA 1KKLA 3OOEA 4CMHA 1OREA 4FNGA 4IS3A 1X7YB 5T41A 3HCCA 3SHVA 5CLFA 3D8SA 3TVTA 2J9ZB 3TTUA 1FMFA 5EE5B 2H11A 1EVJA 1UOEA 1QHHA 1G8FA 1YZUA 1XCJA 3R7BA 4IUYA 1X8KA 2GSWA 5JADA 1ZCAA 1V97A 5BOLA 4XIGS 5H68A 4DMKA 2I9KA 4I1RA 3BUSA 4CCWA 3M2TA 3R8CA 5DBGA 3MS4A 2G5GX 1IIRA 4ICAA 4DO9A 2BMEA 2CRXA 1SIUA 5JD4A 1JX6A 4BTLA 2RBKA 5GJCA 4WBNA 1NI4A 5J2UF 4ETWA 2XUPA 3WSVA 1Q77A 1G5PA 3W7BA 2IXAA 1TKCA 4Z6FA 1SVIA 3DLBA 2ZU6A 5KQGA 3BQNB 1D2RA 2PGAA 1CX9B 3TLJA 3IXLA 1GG8A 1Y98A 3HPOA 6ABPA 4WA7A 1DFGA 1UAGA 4B80A 2NP6A 4KSBA 4HRVA 2G7ZA 3FGNA 2WA1A 4C9BA 4XYEA 3KUKA 2WK1A 2FP4A 1GN9A 4OLHA 1CQIB 4RZUA 5A7GA 5KDOA 1LDBA 4UHHA 1CP3A 3MBKA 4BC0A 1E5LA 1YZYA 4ZYZA 1O6GA 4M1ZA 4A2PA 5J0OA 4M0KA 1NHGA 2W8BA 3B9JA 1DJNA 1AGXA 1O08A 1U31A 2Z3ZA 3OU7A 4J0FA 1CNMA 1CUSA 1H8ED 3LF2A 4MPTA 1Z45A 1M74A 2AKAB 2X0IA 1IE3A 1B4FA 5E79U 2Q2QA 4CKWB 4QT0A 1K6EA 2EZYA 5IJWA 4M38A 4EVQA 4ZQHA 1JFTA 1VE7A 2QZSA 2MU1A 5REQB 3M6KA 1KARA 4IPTA 4Z49A 4OP3A 3EMKA 1Q6YA 4PSAA 1LV7A 1I4OA 3C3DA 5DLFA 5DNAA 4XVQA 1QO0D 3HACA 3B3AA 4L5BA 1RIIA 3OFNA 1E32A 2CCKA 4JXJA 2P2YA 5ITSA 1Y1QA 3Q6IA 2DFVA 1X38A 1B14A 1ZD8A 2CXPA 3LDGA 5JFGA 1SVMA 1D8AA 5L4NA 1PJ3A 5IIMA 5DN9A 2JEZA 2JFNA 2ADMA 3ECCA 4ZREA 3AM9A 3CRMA 4F3NA 3AINA 2RJOA 2OLEA 3U56A 3EZXA 3TFSA 1PV4A 4AL4A 1ZNWA 1YNOA 4JU8A 1CUVA 5BQFA 3NBUA 3ICWA 1J56A 4BNLA 3EEFA 3M6XA 1RAGA 5LQMA 1JECA 1QQ6A 2FRVA 4DL4A 3TD9A 3BQTA 4B87A 1ZOSA 4KJZA 3H3FA 3G59A 3F9RA 3STHA 3D1LA 3SX0A 2J07A 2BKEA 2PX6A 4BO0A 2O1XA 3S40A 5BN3A 3V1YA 1YVEI 1X94A 2BHTA 3FNFA 5EJ8A 3LI2A 3ZGLA 3FZQA 7ICKA 4DCOA 3VR3D 1G60A 3BFVA 2HB6A 4J1SA 1XTJA 3CUKA 2OKCA 4HTFB 9ICQA 2AXTU 1CQJB 4LVNA 4K2HA 3AEVA 4QZAA 1QO9A 4GGPA 1UK7A 4U00A 3MJSA 1A8QA 4HLCA 1DAEA 2HBZA 4GUAA 3VU9B 4I55A 3N4MB 3OZ7A 2G1JA 3CX3A 2GM5A 3MOSA 1A4RA 4OOFA 5IBCA 4V03A 2HK8A 5JBIA 4X3OA 5IHPA 2VF8A 4YR3A 4JY7A 5IXYA 3C1TA 2YZNA 3DT6A 4OJLA 3QLUA 2F4NA 2VP5A 2TRSB 3ZQUA 4TUSA 3QFFA 3GDHA 4K6HA 1FLAA 3F67A 2PGJA 3ZGYA 4YCAA 4ZH4A 4N9QA 3RUEA 2YNMA 1OILA 4N47A 2BBOA 3W5AA 3FDXA 5F5NA 8ICWA 1QYXA 1C8KA 1ZSYA 1A77A 2BCUA 1O6ZA 1WCLA 3F96A 3MMPA 4RGYA 4YT2A 2Z98A 1P4HA 3HKDB 3FWPA 1T4BA 3OOYA 3WLJA 3ZHUA 3N53A 3H11B 2WLTA 4H0CA 2ZAYA 1YUNA 3DAGA 4FR0A 4YIHA 3WSTA 5KC8A 5E4JA 4H35A 2V4RA 1BDMA 4LX0A 2JFYA 3DDUA 5KG7A 3JPPA 1QIJA 2FSUA 1A69A 3EA4A 4P4GA 2ZIZA 5ARDA 3UQZA 2XWQA 3A1EA 1J7KA 4GVXA 4D42A 3HP1A 4C04A 1VDZA 3ICCA 1HR0B 5IAJA 5HRCA 1S2NA 5JT1A 3KLNA 4KXYA 1CJCA 2ZBDA 1C14A 5IASA 3PR5B 3UUWA 2Z7JA 1Q1EA 1YB1A 5HIAA 1C9YA 1Q1ZA 2CJYA 4IM7A 2DY0A 2M1XA 4Q9AA 3L6EA 3AI2A 2RGWA 2XUFA 2JLSA 2WF8A 5FA5A 1WB9A 2J7KA 2HBMA 4DSNA 5LYJF 2WP8J 1S8NA 2B7LA 4FC6A 1TMKA 2NV2B 3M8RA 1NY6A 2VXBA 4H08A 5A05A 3N6XA 1BQ3A 3EY9A 5BN5B 5AW7A 1J06A 6CHYA 3ZD6A 1PQPA 5J2HA 4OHBA 4KLHA 1NVXQ 5BOSB 1UKAA 2PTHA 2JD1A 2V3CC 8ICTA 5BN4B 5EQFA 2ONZA 1PDVA 4H15A 3DEEA 1NQAO 2WJJA 4Q8FA 1YU9A 3QA3E 4QBGB 3HGQA 1KMHA 3G85A 2I2WA 3F3SA 1CZLA 2XB8A 3Q6NA 3QKIA 4Q02A 2OBFA 3K30A 3KTDA 4EB3A 2AYYA 4HEA1 1HKHA 2KHVA 4CLHA 1IDOA 3GIMA 1NVGA 4GI7A 2BCRA 1TM5E 4ZAYA 2XI4A 1EUYA 2X40A 4BWYA 3FKJA 3Q7EA 1UQRA 2EX4A 4NLNA 3L7JA 9ABPA 2YYYA 3SP1A 2W9CB 3LT1A 4LMAA 3E05A 2R4UA 3GLTA 4WNCA 2O0HA 1NU6A 2AQ8A 3FMOB 1W5SA 1K5DA 1HDEA 4RQAA 2WYOA 4HDRA 2H16A 3QIVA 4IIJB 3ADBA 2O2GA 3OKFA 5BVGA 5IVIA 4I1VA 4MVJF 2ONJA 4Q48A 3ZJUA 3K1ZA 5ECGC 4MWGA 2XC9A 1ZUWA 2Y9UA 4YP9A 4PR3A 1JMYA 3UTCA 1KKXA 5GQSA 1ZMXA 3HV2A 2VOEA 2IOHA 4RESA 3G2PA 3K9WA 2BONA 1M2GA 2XDAA 5L1LA 3OZEA 4C2BA 2RHOA 4PX3A 3CG4A 1ULTA 3HJGA 3HZZA 2X0JA 4AUKA 2VAXA 3PF8A 2NX2A 1ZQJA 1B6SA 4GBED 2HFJA 2HA3A 1XXLA 3B1YA 1LPAB 2BZSA 1E2PA 4LFBB 4M6WA 4INPA 4V0NA 1R8SA 4TGLA 3OCZA 3RQIA 5HHIA 4C2UA 2VP0A 4TQSA 3T1TA 1BE1A 2W6IA 1QIDA 4GGOA 2JG3A 3GL9A 3DS8A 1E6LA 1U1DA 4BX8A 1CBUA 1FTWA 4NTZA 1JG1A 1E1KA 3UN1A 3KU4A 3UKOA 1R5BA 3UWSA 2YWFA 4LG1A 1TQ8A 4B35A 1VZ2A 4GZ3A 3SQDA 4GPTA 4NK4A 1F51E 3HWSA 2D8AA 5DK6A 8OHMA 2NVOA 4UULA 4HHEA 4G0UA 1J9EA 4E12A 4N76A 4LJ5A 4L8GA 1NJ5A 2H1SA 4HT3B 2KNJA 3OA2A 4RQNA 2OCYC 3T12A 5D2CA 4DSKA 4LBVA 3WGJA 4DJAA 3GCDA 5DG7A 5ALOA 4KGDA 1A8HA 1T5HX 3EHEA 7ICUA 1Z33A 4KQ9A 3CN7A 1Y9ZA 3KXIA 3VOBA 3GNTA 3FDZB 1E1LA 3QWBA 1RWOA 1NVKA 2GARA 1P4RA 2OHXA 3HJTA 5JIBA 3I34X 1P7YA 2WAQF 1XKTA 4ND2A 1GCUA 2D4AA 5FPKA 2CXUA 1WV1A 3HA7A 2YXBA 1ZZEA 1XVIA 3S3TA 3WU2U 1XOIA 1GRVA 5KTSA 3UT0A 4F3KA 2VTKA 2GTPA 3SQOA 3CA8A 5IK2A 3IAM6 5J0YA 1OB5A 1FY2A 2VYNA 1Z47A 3ND6A 2GBFA 2VA2A 2ZB2A 3O4RA 4MMXB 1GCOA 4JLPA 4HR7A 4GZMA 4OUDB 3QQPA 1MC8A 3T3OA 1X2EA 4F1WA 4A15A 4NV1A 3NVYA 3B51X 2BTQB 1E79A 3COPA 1M2FA 3U7QB 3HY3A 3STWA 5F3XB 3ZJ4A 3MDAA 3R5KA 2XTMA 1BX3A 5ALMA 1F2DA 4HQKA 4UE2A 5HK8A 5AW0A 2H7CA 3JAMA 1O94C 4QZHA 5I48A 4TLAA 3HUEA 1ZJNA 3CWCA 3GT0A 4D9KA 3KYCA 4MLZA 1OVGA 3N70A 4X95A 2BI4A 2AR7A 1HG1A 2I54A 4UPEA 1X9HA 4FDTA 1FDIA 421PA 3KIPA 1Q7EA 2ZJ6A 3C15C 2PZMA 2A30A 2PX8A 5LLSA 3P4YA 4AS3A 2WJWA 4I4LA 5EIXA 2DR3A 1P2VA 2ARKA 2QD2A 4E70A 3OPNA 4Q01A 4O3PA 2HRRA 2VP9A 3O4FA 1P0MA 4PHPA 3WB2A 1NVVR 3FR7A 3EWIA 4I9HA 3K72B 2XCQA 1RU3A 3GMIA 2HBQA 3TNYA 4G0YA 3PENA 1WP4A 4PRLA 1JHDA 1IEXA 4CMEA 4M1QA 3B9QA 1NG9A 2E5WA 2VNIA 3Q12A 5F2EA 4WLOA 5D51S 4F9EA 3HXLA 4D57A 4DL7A 3PQEA 3UMCA 3F1KA 5DKWA 1OH5A 2PD6A 3NAZA 2BVNA 1Z22A 3L6DA 3KL4A 1SU8A 4N3CA 1CS4C 5KYKA 3L02A 4N0EA 4DCPA 3KAQA 1M1YE 3V7YA 3RWBA 3QXJA 4NBTA 1KQGA 8ICFA 2HSEA 5HRUA 1ZQOA 1XD8A 4Q4HA 4RVGA 4QG3A 2H4ZA 4IV5A 4RENA 3S6JA 2OA0A 2BGLA 3R44A 1OPXA 4YRNA 4QA9A 3TEMA 1A98A 4I29A 1MXFA 3NMUF 3L82B 5F5XA 3SC4A 4E13A 5KOHA 4H7DA 4DPLA 5K0GA 2PUHA 3KJNA 4J3JA 3HZRA 4XVRA 2NZWA 2QLFA 4OAPA 1QFZA 2UZ1B 2Z1MA 1Z7WA 4MGYR 3I1JA 1J8QA 3U4DA 5HZHA 3LK9A 2EKQA 1AHNA 4NYMQ 4HDOB 1H2FA 1IWBB 2P9HA 4L28A 1YKSA 3O8DA 4YALA 3IE0A 1U9CA 5ULLA 1QTQA 4GI1A 4AMBA 2HO5A 4UJ5A 4EHHA 1S3SA 5EEHA 3P9KA 5FAXA 4ED9A 3HM9A 3A6LA 5AI0A 1D4FA 4R84A 1CZUA 4B4OA 3IP1A 4GR4A 4X8MA 1RWBA 2FP3A 3D31A 3IL2A 1T5OA 5A9TA 1SEVA 2QN6A 3FRIA 3NVMB 4XIFA 2XZDA 2YY6A 4OJPA 4NNJA 2NYUA 4RTJA 3MWEA 1P1RA 1U3FA 2P77A 3ROKA 4PBTA 4PZNA 1Z29A 1DIHA 3M83A 4Y2JA 4MV5A 3VC1A 3RAFC 1KIMA 8ICHA 5G02A 3EIHA 4G1VA 3P9RA 4UXIA 2A7QA 1L4MA 8ICGA 4MYUA 2J3HA 1OV4A 2I78A 4HQNA 5FX2A 1OBVA 1DBRA 4R3UC 3HCEA 5EHZA 4B6PA 5FUMA 2ZJFA 3RC2A 4FMCF 3UAGA 2I87A 3GP3A 4MGKR 2H1OA 1B6TA 1ZD9A 3PR3A 4R8UA 4AMYA 3C5GA 1ARZA 2YXLA 3CX6A 3NGLA 4XYBA 4J0CA 1GSIA 4IQ0A 2E5LB 5TQ0B 3G9XA 1GUBA 1JIUA 4PY2A 1Z17A 4ZO8A 3EUEA 1EFUA 1D8YA 5JY1A 5KYUA 2OQRA 3E7WA 5ILQA 2RFLA 5TGZA 3NR2A 3TIFA 3JW8A 2NUAA 5CT6A 3A25A 3TO5A 1RCUA 4X60A 1C9MA 5JH7B 3STUA 3KEMA 3SYZA 5E1DA 4UTXA 2PXAA 4OXKA 4XM1A 2FF7A 4QDXA 2HGSA 4WCDA 5AHOA 2H51A 4R1TA 2HJWA 4CJXA 1Y4UA 3ENNA 3HB9A 1DTSA 3AHIA 4MVYA 1YD7A 4OGGA 1EVZA 1XTRA 3N2IA 3AMVA 4WQMA 4DLAA 5HOQA 1TCCA 1IMOA 4M98A 2CJFA 2HAEA 2VWQA 2YW9A 2JA1A 3D7SA 4MUMA 4XCQA 4M0AA 2A8YA 2RHRA 2GCEA 1Z7YA 5EXDA 2X19A 3LUAA 1WXGA 5KFJA 4G3XA 3AM4A 1MKYA 2G1PA 1NDUA 4FXPA 3OLZA 3G2QA 4DQUA 5F78A 3BXHA 1PK9A 3EH1A 3NYWA 4P8RA 4CQMA 4M9UA 2JIOA 7ICJA 1GGHA 2VJLA 1U0SY 3KOYA 5AKLA 4AUNA 4OYHA 4MKGA 2GGSA 3KQLA 2IXFA 1PG5A 4WKOA 1HFEL 5DNYB 1JPJA 1VBMA 4JENA 5HKBA 3U62A 1R6AA 2R8XA 2IHNA 3TINA 1P45A 4MFCA 2HNAA 2NVUA 3IULA 5EL0A 5FBKA 5HFJA 4QYMA 3A10A 1F4VA 4U3JA 4O08A 2PLAA 2VAPA 4ZFNA 2AI3A 1PJZA 4QZFA 2GHTA 2J5KA 5FFFA 6YASA 1Q0LA 4M7PA 1IB0A 1CZRA 2DFDA 1CUUA 4UB5A 1FW6A 3NC0C 3EXAA 4G23A 3OCVA 2XLCA 2PEYA 5TGTA 1ZD1A 2HJVA 4IZ6A 3SCZA 3EXFB 3QVXA 2AVDA 4D4LA 3UXYA 3CUEF 4RY8A 3GELA 1SG6A 2FE4A 4U02A 4JP5A 4W1QA 4R8KA 3BJMA 3ETGA 4KVZA 4B6OA 1R0KA 1E2QA 1S2IA 4A36A 1KI3A 3OFND 1BW9A 1UKEA 1GNTA 2GO7A 1YJQA 5K0NA 4TVKA 1TAMA 3KPYA 2EW2A 1OBCA 2IUFA 3AYZB 5EIBD 2BKVA 4O3MA 1JDNA 3U0BA 4RJJA 4KLCA 1ZEMA 1OLXA 3JYQA 3SEFA 2C7OA 5CYPA 3U4QB 3T41A 1VG8A 4IQGA 3KE9A 1O0BA 3QPVA 4NCIA 3OF3A 2QN8A 3TW8B 8ICVA 1SVKA 5KWSA 3EFBA 2I2FA 5EFOA 4O3QA 1YR8A 5AM0A 4XWGA 2Y1KA 4LJSA 4S2EA 1SPXA 4R71A 4ZEXA 3TFWA 2GM4A 4DVGA 5THKA 3O4GA 1VI6A 1JHPA 1A9XA 1TEZA 5JU5A 3IT3A 3NDRA 2LPEA 4GRAA 2C5AA 4ZODA 3PX2A 5ALXA 3PTAA 2WRZA 1ADYA 5DLGA 1ZINA 2MSEB 2KOBA 3PIRA 4LZGA 4EZIA 4JI0B 3A1SA 4CL8A 2VWPA 4Z1MA 1ZC3A 4GWLA 1UR5A 4G5QA 1CUCA 4A6DA 1PAUA 1L5HB 1ZQBA 1FLNA 4NBSA 2CDRA 1DDOA 4Q9NA 1Q46A 5ADHA 3AEUB 3RJHA 4Z4GA 5AVSA 1H4VB 4XQ0A 2ZCUA 3ZNPA 4PC7A 4QODA 1GGNA 2KLBA 2P7HA 1C0KA 4YCBA 2YIVX 3AKEA 3D6TB 4KFSA 4P0PA 2DKFA 3LU1A 3ZK8A 4EUFA 2QTHA 2YNMD 2E5SA 1OKKA 2PSFA 5K1ZA 2ZR0A 1XMPA 2Z04A 4WIAA 3RU2A 1O5TA 5FI3A 1VXOA 3RC8A 3E0XA 1SIBE 3FH0A 4C21A 1CZHA 3AQFA 2J46A 2WKRA 5AVQA 4BO3A 3KFLA 1GN8A 4HY3A 1E2LA 2XVAA 2ZVQX 4KQFA 3NEYA 2Q7DA 4Q7JB 2BDUA 4P58A 1OXKB 5HP4A 4F0JA 3VV3A 3PXCX 4ZT7A 3Q85A 1OXBB 5ITZB 5EZYB 3ZE6A 2FFJA 2YV5A 3ZNNA 3RBVA 2B35A 4PXYA 2ASJA 4TLBA 3I09A 1M72A 2GA9A 2JATA 5BYKA 3IKTA 1A0PA 2PI5A 1B7GO 4BB0A 5JSZB 1I1OA 3CZ4A 1U4NA 4IHJF 2ZYIA 3MBYA 3KVOA 1KFBB 4WY2A 1RWQA 1NXPA 2VSYA 8ADHA 5JD5A 2PKRA 1Q21A 4XASA 3H2YA 4IJWA 1E3SA 1O0CA 3S2ZA 3WLTA 3ONNA 4UUBA 4AY5A 1RWXA 4W7HA 3AU6A 2PFOA 1UZMA 1WXIA 4QEZA 3Q3HA 1H6CA 1ZQDA 4K9PA 2ZYWX 4L4UA 1KVUA 1W8IA 3PPIA 1U6IA 3DYBA 4C6SA 1R50A 3ZIDA 2HBJA 2FI1A 3ZHBA 4EMUA 1ZWLA 4FYXA 2F7SA 5AKGA 2C3YA 2JFUA 2BBTA 4D0SA 4DM3A 1KFCB 3L4BC 621PA 3LYAA 3FY4A 3PP8A 4JYBA 3O8BA 4M1MA 4H27A 5A4FS 5JVDF 4N3NA 1PT6A 2REOA 4KLZA 1S5LU 2YS6A 1BJRE 3H4DA 4MTLA 2QDKA 4HQ6A 2XNCA 4KLLA 3IJPA 5K05A 1NLUA 2PYDA 5C1DA 4QDOA 5A6SA 5DCLA 3U6BA 2HBKA 2V7WA 1XHEA 1RPLA 3FC4A 4F92B 1B8PA 2B8EA 1YO6A 1IXKA 1THTA 2IPLA 1NVBA 3IFSA 4QXPA 3DHVA 1GU0A 1FK8A 1B2LA 3N0VA 3I9V1 3HADA 1PS9A 2CUZA 2ASDA 1E3WB 2X2EA 4E5VA 3MUEA 3RR2A 4WRRA 4F5QA 3DOCA 5IYZF 1Z36A 4JNCA 3V42A 3KKKA 3SLGA 2AG1A 1DTWB 3BZKA 4R5MA 1R12A 2RAVA 2YB1A 3L3FX 3L0OA 2WIDA 3OIDA 1Z7BA 1TYCA 4ECVA 1OE0A 2VJYA 3AVOA 5KSWB 4GZLA 1HYQA 1HPLA 3L7AA 2GPNA 4JLWA 3MWGA 3LUCA 4MPRA 5IDVA 2ZRJA 1YDMA 3G5UA 4LY3A 3RSOA 4AO7A 1JLKA 1JNYA 3EVEA 1LSUA 2CBXA 1W0KA 3CX7A 4C89A 3ROGA 1UPAA 3GN1A 2C3OA 2P6UA 4J43A 5I9NA 4M7OA 5I7AA 1H0HA 4K40A 1V5GA 1CJSA 5FHQA 1MPXA 4M8LA 4US9A 2QKQA 4PO3X 4QSMA 3QUBA 5GONB 3RFUA 3K75D 4JX9A 2F1HA 4MWEA 5FPTA 3D3KA 4FGSA 4DUZB 4Q43A 1CJMA 2ATIA 1CRPA 3FM9A 3JX9A 3V3TA 1DQPA 1RE0A 2YY5A 1M76A 1JKJB 4ZI3A 2PD3A 1A0OA 3K94A 1P44A 4YCSA 5KTTA 4BNMA 3DQPA 1QV6A 3C28A 2DUUA 1IZYA 4EI8A 3GZ4A 2IYPA 3FRJA 2KBFA 4WN3A 4YO7A 4C08A 3HJAA 1SL1A 1UBOS 3TI9A 2W6ID 3F5FA 1DFIA 4AMGA 2TMKA 3CVOA 2QR5A 1FB5A 2RRDA 1U3TA 2PZGA 5TJ9A 5ENDA 3V7FA 4WPGA 4XQGA 1PIWA 1PFWA 1JWAB 4ECAA 2FPSA 1HRKA 2HF2A 3USCS 2HEGA 4UHBA 4JHXA 4IRDA 4LXXA 4L2IA 4V0KA 4UDYX 4ME6A 2IH5A 3KP1A 1ZUHA 1VE9A 4AX8A 2HTFA 3D2AA 3IEXA 3O83A 3NVAA 3CN9A 3IO5A 3VQTA 4ZJYA 2QJTA 2DJ5A 1SURA 2RGCA 5ALVA 1PQWA 3OE1A 3DFMA 1GL3A 3IT0A 2C7QA 1YNSA 3IXMA 3PPWA 4ZOQI 3IV6A 2HCFA 2J67A 3KOUA 1IIPA 3GA5A 4MWSA 1JT2A 4OOEA 4CMKA 1JDZA 4DL6A 4FOLA 1LBIA 3HKBA 3VJMA 1H6BA 3T5CA 3AN1A 1XZGA 4HDMA 4H31A 3PNPA 3R9WA 1IQPA 1TAGA 1G1MA 2AD5A 3H17A 3WNDA 3URKA 4X20B 2FVXA 2LUOA 1PNOA 3AU8A 4ENUA 1G19A 7ICSA 3K0AA 3CH4B 4CZ2A 3M6LA 3PO5A 3O5AA 3FETA 1FP2A 3RAEC 3CJQA 4F96A 1WABA 3QK7A 1BPDA 3IURA 1D8TA 3ODGA 4TZ6A 2HVHA 3D2BA 4AN0A 4HB2A 3AL3A 3LP8A 3SQWA 2ZT7A 2R7MA 2PL9A 3KNZA 4EF5A 1REQA 3T35A 2KZZA 4V0OA 1E79D 2G3YA 4YP0A 2K7ZA 4B9EA 1SG0A 2QVLA 1G42A 1XSEA 4RSMA 3T5GA 1W48A 3PFWO 2HVIA 5C3UA 4W1RA 3UXPA 3KWMA 5BSVA 3PHJA 1LQ2A 1OC2A 2OV3A 4IMJB 1B8NA 4P33A 5BMOA 4YXFA 2O2SA 2GAJA 4FFMA 4UHDA 1QCCA 3RBDA 1ISMA 5COAA 4E22A 1BRMA 4AZ3B 5ELLA 1C80A 2VT2A 5DEOA 2H07A 2R8RA 1UOQA 3ROFA 4XTCS 4QECA 2NU9A 1RJEA 3KLMX 4IRUB 3CVXA 4GOND 2PT5A 1HA3A 4NAHA 5CFPA 1GRQA 3MT8A 4NF2A 4BO1A 4TVBA 2ZUEA 4UVIA 1WXEA 2WJVA 4TSFA 1OH8A 4MV3A 1OX5A 5CLHA 4UARA 3LKBA 4V2UA 5JO9A 5HM6A 2JHCA 3A58B 2CD9A 4M0FA 1QZ3A 3N07A 1FUIA 1KVTA 3BXFA 1PYGA 3KHLA 3R0XA 7GPBA 3CMCO 3S4YA 1ZGHA 3QZ7A 1FS5A 4E0BA 3FCXA 2HV9A 1XSLA 1J6UA 1ZO8A 3G2KA 2V0CA 2X42A 4PLZA 3GZTB 3JAWA 1GUDA 2HT6A 3NOXA 4WLEA 3J81A 3AJRA 2WF5A 1T8EA 1ECLA 3GLIB 3EJ6A 3RVJA 4WFQA 1H4QA 4HLUC 5K3AA 2AN4A 1TCAA 4H16A 3HSYA 4EM6A 4KRGA 2P41A 3RJFA 1S8OA 2R8BA 1BOFA 1QGUB 4I8IA 2OBNA 2Q3FA 2RHMA 3OPQA 5K8CA 3DBLA 3HJHA 1ND5A 3VGJA 5G0TA 3UAZA 4YRSA 3ZEAA 1GYPA 1C7RA 1Z75A 1N8TA 3DDCA 3F6CA 1XNQB 1PNVA 2ZP1A 2I3GA 4FFBB 2DCUA 3MAAC 4ARUA 4HAZA 1JXLA 4HPXB 4GT1A 2PXHA 2X23A 4TUYA 3CBQA 4NAVA 3OLXA 4RM3A 3OZTA 5BSUA 1Z7GA 3KVNA 3SPXA 1WUYA 2PGLA 1NQXA 3BB1A 1UFRA 4IVRA 1MQ9A 2OYSA 4UNSA 3FFTA 2C2OA 4BWGA 3ZDAA 1RXVA 2K60A 3EGXA 3N0TA 1S97A 3DL7A 1AQYA 3HJBA 3BHIA 5JS7A 4PTLA 4MW9A 3DE1X 5I8PA 1JEDA 1OWMA 4DAEA 4R7TA 3RYHB 4IAOA 1GQ2A 3W90A 2WFAA 2AWNA 2H9IA 1WQ3A 2H3QA 4TOIA 2NG1A 3GPLA 3HWRA 5BR4A 4FGWA 4GIBA 4D7AA 5CA0F 3O47A 4KIGA 2AOVA 3G9QA 2I6TA 2W2KA 4RZ3A 2VH1A 5A4DA 4OHCA 3ZE7A 4BCBA 5G1PA 3OO0A 1ZA1A 4JOBA 4ID9A 1Z8NA 1X7WB 3UGKA 4O4IF 4KUGA 4MIYA 1Z00B 1RE1A 2EARA 2CJXA 1OQAA 7ICGA 1G63A 1YRYE 3UJPA 3O74A 3WYGA 1ZGGA 3EQ9A 4RANA 3UTDA 1YL7A 2CXTA 5BNWA 1NK5A 2VP2A 3M4XA 2ICAA 5KFWA 4KKVA 1M34B 1KC1A 5A4JA 5JMOA 3LM8A 3OJEA 1QIMA 1H0RA 2BBWA 2ZE5A 4C6TB 1U2DC 5IW8A 4YMSA 5JMTA 4LJYA 1SC9A 5EHNA 4EFLA 4ZAWA 4QW8A 4IHKA 2Y6VA 3BGIA 2OGUA 2DPHA 5CNJA 3U31A 2ZRKA 5K3DA 1OXVA 3VVBA 1Y4SA 1EK2A 4KPEC 3JAKB 4G56A 2WJ3A 3H7AA 4D0LB 4DV1B 3M4ZA 5TEWA 3JV7A 1WTCA 1KORA 3H16A 5EWLA 2KE7A 4RHFA 3NTOA 1ZH8A 3AUUA 3SZGA 1OTXA 3N5KA 2XQGA 4FP9A 1VLHA 4I3GA 1P5JA 4EUHA 4FGZA 4G1FA 2KSQA 3RYIA 4CIXA 1IZ9A 2W3SA 3JQGB 2OZKA 4BX9C 4BQIA 4GX1A 1YMQA 3AR5A 1N2SA 1V2GA 3JWEA 3ACDA 1JVBA 4HH1A 5KTOA 4GICA 3EZNA 4DUYB 4DJ5X 4K05A 2IYWA 4FFWA 3QUTA 1Q0ZA 5E9QA 3DV2A 4OA5A 1G2IA 5D7NA 3RBAA 3MDCA 2GJ4A 3JQ9C 4NE9A 1U0FA 3E9RA 1SCDA 1G21B 2F43B 2WZBA 2QIPA 3A37A 5FH9A 1RBQA 2AZ4A 1D03A 1UMCB 3GCXA 4EO9A 1GAQA 3ILSA 2MUTA 5LL6P 2IA5A 2H48A 2FWAA 2KICA 4UZSA 4F5ZA 4DNOA 4A0SA 2VZLA 2ISSD 4DIMA 1F8UA 5K4GA 4CV0A 1WDTA 4CQMD 2EZZA 3VPGA 5HF9A 1NN3A 2UYOA 5AI8A 1O6FA 7MDHA 4K8OA 3FHLA 1DWPA 1KQOA 4B6EA 1J5EB 1NJXA 2LW7A 4E4RA 2GN0A 4EGFA 4W9NA 3ZOZA 5JZSA 3CZQA 3G79A 2IY9A 4D3SA 3T9BA 1WULS 1MBZA 4LK3A 1GIAA 2BOVA 3DV0B 1SULA 1JFLA 3IJEB 1RYRA 1ZIYA 3A9RA 3TM4A 3WIDA 1HNZB 1ICEA 3FVTA 5AOVA 3SGLA 2P2SA 1IN1A 4JMUA 1XQ6A 3AY0A 4A8HA 4AWAA 3TARA 3ASZA 3T7DA 5G2OA 4ZVOA 1ECWA 2AL7A 5ES3A 5JCXA 3X1XA 5TS3A 3EA5A 3ML1A 1ATZA 5IUJC 4XA8A 1T13A 4BMOB 3H2HA 1LI5A 3OP4A 1P3JA 3DWFA 3D8BA 1PG2A 2CK3A 3OMWA 3NATA 1XSNA 4Q0MA 1LNSA 4WKCA 4MR8A 2HQRA 3B3FA 3VO2A 4CPDA 2HA4A 1X8JA 2G0TA 4BQFA 1FX0B 5FCDA 4XW2A 4QM7A 1YB6A 1KJWA 4YJ2F 2ID8A 4KMOB 5DDMA 1NYQA 2IHTA 4MRRA 2PUEA 4JJ4A 5HS6A 3PUXA 1NOJA 2BC9A 1QH8B 1VB5A 1V4NA 1W93A 3LX4A 1BEZA 1II8A 3H0KA 2O8EB 3T9FA 3HFGA 3MMSA 4X65B 2GOLA 4FI3C 2D54A 1SQSA 2ZULA 3ZYZA 3RB8A 3D4PA 2IEDA 4IF6A 3PX7A 3D8RA 1M2EA 2QU7A 4B44A 3SYNA 3KQUA 3KQQA 1ZHOA 4GYJA 4UD2A 3RBXA 3HVJA 3VPCA 3AFHA 4HADA 1ML3A 3CB4A 1PWXA 1SV0A 3G89A 3M9LA 2WAQC 2JH9A 1JI0A 3NFYA 2QSJA 4IY1A 1QUEA 1H5QA 1WQ1R 3KPJA 1KZHA 1JV2B 9ICIA 4XX0B 1ZM7A 1AO0A 1LTHR 4O1MA 3L9WA 3BRSA 4AYXA 3GFKB 3E4CA 2GEFA 1RC1A 3GT3A 4LOLA 3DYIA 4G89A 1JSLA 4FKMA 5EJEA 1NW6A 1M1UA 2GZ1A 1YBAA 2CFCA 2R2AA 1V35A 2GBPA 2XHEA 3U6KA 3PVZA 2AEMA 2GKGA 5JBNA 3KS9A 1JLSA 2ZPAA 2YYZA 4LJ7A 1GPDG 1U81A 4B81A 3EUWA 4FBUA 3R0VA 4AKGA 2J7PA 3O0TA 4JMPA 5BURA 2XX3A 4HOYA 3TLYA 2O0JA 1YA4A 4GX0A 3DMHA 3A04A 3V80A 3OE4A 5ALYA 5LP6A 5LWHA 3WWYA 4QLOA 1KI6A 4QBFA 5C32A 5JUMA 3HXTA 1D6MA 4IH9A 5K0SA 3WGMA 1UP6A 1PU2A 3HDGA 1IK4A 3WS7A 3KVYA 2ERXA 2W6PA 3DULA 1N7JA 3LA6A 2FSSA 1EJ6A 3RLFA 5L3SB 3UHFA 3KAPA 1KOJA 3ZE8A 1IXRA 5KYTA 2C97A 2INGX 1A72A 3KYDB 3CVYA 5H82A 1FDOA 1CE8B 4JI7B 2OK8A 1UMBB 1BHSA 2P5UA 1J8DA 4L72A 5KNLA 1Q5PA 2DTDA 2NUTA 4MPDA 4MYRA 4IXWA 1M1YA 3H5RA 1SXPA 3NFRA 4KPUA 2E37A 1TKRA 5DCWA 1L8XA 2IEYA 2IV2X 4M22A 4OH7A 1YS6A 4PZUA 1OXSC 3D6FA 4BVBA 2BFCB 1TT7A 1ZMRA 2O8FA 1ODIA 2UUAB 4L9WA 2AZMA 2AX4A 3MCTA 3MQ4A 3HBFA 3IBSA 4EX6A 4BLVA 1T5IA 1RLMA 4RXMA 4EBDA 4ZARA 1GG2A 5JC8A 2PX0A 3R8XA 2KS6A 1MH1A 1L8QA 2ZJYA 1NLMA 4B47A 3STXA 5HQ3B 1Y6RA 4KBGA 2VQSA 4LDQA 2HJ9A 5BYBA 1OYVA 5ALDA 3CLTC 2JGFA 2F64A 1G3RA 4CFYA 1K6MA 4Y1RB 4LMPA 3AESB 1Z82A 3BJRA 4WT7A 4M0EA 1CZKA 3AY3A 4R1OA 4X9XA 3AI3A 2HJGA 1MRSA 4I7EA 1WDLA 2XE8A 2G80A 4NJEA 4PF1A 4F2RA 4B2PA 2ZB3A 1JW9B 3RAGA 3IYLW 4KSCA 1U8TA 2IXTA 1RACA 3LQQA 4J03A 2BBSA 2F3NA 3PW0A 1L5YA 1CDEA 1SU6A 2BGTA 2PRSA 2FR8C 4YWHA 3PICA 2BI7A 4ZQFA 3CT4A 3MGGA 2FOLA 2BH9A 2OFWA 3LVFO 4YRQA 2B98A 2BPGA 3K5WA 1ZAYA 3FNRA 2BJWA 4FM9A 3V6KA 1FIQA 2BCSA 4G81A 1SK8A 4XZ3A 3EGDB 3UNXA 1GEGA 5KSPA 4JP8A 2DWPA 3F3MA 1WMBA 4N5MA 1HI9A 4MFFA 2WTEA 4AZ0B 2XMGA 3C24A 3J7TA 4XWYA 4PHEA 1AQLA 1Z6GA 4E32A 5C18A 1SKMA 4NI5A 7AT1A 5CW2A 3RAXA 2PSEA 1W0KD 4LGVA 2OM6A 1M66A 2AXNA 1LSOA 3O94A 1ISGA 3JQ7B 2VZ9A 1FJ2A 1KEWA 5HJ5A 2ZJOA 4X94A 4ZYYA 3ZD7A 1JG6A 5CCDA 3LIPA 1EGHA 4UJ3A 1P2BA 3SVTA 5JTTA 3OM1A 3VYRB 3V6JA 2YHUA 3WAKA 3R6GA 4TKLA 4FMDF 4R65A 3KJIA 3DE0X 5MGBA 3NAGA 7ICMA 1N7GA 5JAHA 3WGUA 1LW6E 4EITA 4OU5A 1BHQ1 4YJDA 4RC9A 2ZDGA 5D4BA 3RKUA 2AB0A 1E3TA 3NVKI 4TWBA 5JXHA 2HHSA 4OI2A 5KINB 3MELA 5B55A 3EY4A 1JFFB 2W37A 4IIGA 5AM1A 4F8JA 5J47A 2B0JA 2PV7A 2X5NA 4IV8A 2B61A 3WIBA 2OORA 3LP5A 2WF6A 1EWRA 4XFJA 5EIFA 1YB2A 2X14A 1SKSA 4W5JA 2VK4A 1E3MA 4NENB 3QVGB 4D3FA 4RMIA 3SIPA 4NMLA 3MYRA 3EPRA 3CEHA 1XG5A 3LKDA 2O14A 1YBMA 5TQ2A 1ZBDA 3FPGA 1P7VA 3RJJA 1KI2A 3L0SA 3ON5A 4BKUA 4EGCB 4F4WA 3SV4A 3EUAA 2H3VA 5JQGA 2Q0QA 4TPKA 5FNVA 4BRSA 1UJCA 4PLCA 4FYVA 5CUQA 1MG5A 2QN3A 2GFHA 4TZ0A 4A5OA 5KMGB 2B0CA 3VC8A 3LT4A 2QR2A 2B6GA 3ESRA 1FFSA 4G5OA 3MTBA 4PHTA 4XM0A 4MLPA 2EWWA 2AN5A 4YP6A 1Y6ZA 4I4TF 3DXZA 2ZWPA 3N8KA 4MR7A 3FIUA 4B3JA 1XRJA 1A27A 3PWKA 3TZ6A 3FCUB 4FQ5A 1E77A 2Q4BA 3HYTA 3TK1A 1KZ7B 1MIOB 4F7DA 1D04A 5F12A 2GF2A 2CYAA 4DBLE 4O29A 3QXXA 4UMFA 4RKQA 1WXHA 4M49A 4RNNA 1HUQA 2RIRA 4GR5A 1HMYA 3VKGA 1V3QE 5C8XA 4EQ6B 3N74A 2YR0A 4FI3F 4YRAA 1DAPA 4JQSA 4OUKX 1JG4A 1FNSA 2FPPA 1GQRA 4BB9A 3W7AA 3HCAA 5AJYA 3D0KA 4Z3DA 4IJVA 1ICIA 4A5SA 3TLGB 2I4LA 3JY6A 4DL9A 3M5DA 1D5WA 3NETA 1CUJA 4ZOEA 1OOEA 2QB0A 2F76X 5KU1A 3EZYA 5F9HA 1IB6A 1AKTA 2FSHA 1GADO 4LJLA 3MSXA 2JIMA 3RK0A 3SKXA 3MINB 4DA8A 4FE3A 1PR0A 3LLUA 2P75A 1RYEA 3PPVA 4B4KA 4NABA 1J90A 4RDHA 1WE2A 2DWOA 2WV7A 1NJYA 5A71A 5EP2A 1AZTA 3PUKA 3Q11A 3IKLA 4JV2A 2CNWA 1ABEA 2GZAA 2G9NA 5EJGA 2A57A 1QCZA 1Z83A 5EP3A 1O54A 2WU4A 3WK9A 5ER6A 4DANA 1BPXA 3HRIA 4DCGA 4QWDA 2ZUFA 4ND3A 2FPMA 3U3XA 3A0HU 4R1NA 5JWRA 2WEKA 3VC2A 5L6MB 4Y6LA 4C7ZA 3QV1A 1P0CA 1UBNA 2QPLA 4WW0A 2GD0A 3CW2A 2V8OA 4G0NA 2XNSA 4RHCA 3GIWA 4GC6A 4LXHA 4CL3A 1XELA 1KMMA 5KT5A 3INTA 3KUCA 3KUDA 3OOJA 2NXWA 1UXKA 4KO4S 3STYA 5HKKA 4GOMD 3TQIA 2XNJA 1Y37A 4K0KB 3L40A 4K4GA 4IQUA 4RZSA 1E1NA 2XAUA 4B6JA 1EJBA 1PLKA 1LSSA 2CLFB 4I1IA 4J75A 1QX3A 1FVXA 3HU3A 5KYYA 1BXKA 1CF9A 2Q62A 1JRPA 4PYQA 3IH5A 3NXKA 3AVYA 2XZLA 4OREX 3DVSX 3IJ5A 2Q4OA 1V16A 3PWSA 2OAEA 1E1RA 2C95A 1PT7A 4CU2A 3CXRA 2Q1SA 4NH0A 2W4MA 5FTLA 2Y0EA 1KC3A 1YS9A 1N2CB 3TBHA 2E9SA 4E7PA 4QTUB 1WMFA 2C57A 2O48X 2CVZA 5G40A 4UQOA 1DAKA 1W88A 4B3BA 1UMDA 2QXUA 4K86A 5DP1A 4YACA 1E1QA 5L95A 3ZHXA 1DJMA 3JZDA 3H0MB 3D6NB 2AQIA 4FDVA 2XD9A 5EKTA 3M6WA 4RBNA 2BLLA 5SZHB 3T7TA 4ITUA 2J87A 3ELBA 1D2NA 2VVTA 3VA7A 1SO8A 4FUQA 2IEAA 4KQEA 2I4TA 1OB2A 3K1RB 3ZDQA 5HPYB 4V39A 3K1YA 3VDNB 4D8WA 4CEIB 2XTZA 5J2TA 1AH2A 3EEIA 4ZI2A 1KDHA 3Q9LA 1JYEA 4QJIA 4C7MA 4ILEA 4DG8A 1OVMA 5EJIA 1Z4QA 3P0RA 1YDHA 3W9YA 1NK4A 2WOOA 3UJ8A 3I6ZA 2ZTCA 1Z13A 4JKOA 5HNKA 4I5EA 1H4TA 2B99A 1NBME 2ZKIA 2UZ4A 1XU4A 1IN4A 2V7QA 2XODA 3BGOS 1SQFA 3RK4A 5ALWA 4JVSB 1H1LA 1QIFA 4IUDS 4S05A 4RAOA 2IHKA 4W99A 3M82A 5DTQA 1YFJA 3ZYCA 3W8EA 4OVKA 3BWYA 5AKZA 1D0SA 2B8JA 5FR1A 3UB4A 2QMUA 2HSZA 3PNOA 1YCFA 1T4DA 1UHUA 4O5OA 4HDCA 1GNRA 3VSBA 4LPSA 2FMSA 3PQDA 4PZAA 2DQZA 2GCGA 4C0SA 3F47A 4YAWA 2QL7A 3C45A 3NI2A 2RGRA 1VLVA 2FW9A 4GF5A 1Y6QA 2P8JA 1NI5A 4N8SA 4BRWA 4P7BA 3ADCA 4PCAA 4URZR 2VT6A 2O19A 5DQIA 3EG9B 4NP6A 3G13A 2YWHA 4RF2A 5BP7A 4TSRA 2UVVA 5HM8A 5LQDA 3SEZA 3AP1A 1VKRA 2DB3A 1MB0A 1T6YA 4YCDA 3E35A 5CDFE 4L22A 5LOVF 2HF9A 4F85A 1GKKA 3GGSA 1PL8A 1YDWA 2CMHA 3SC2B 2I9PA 4D43A 2I1WA 3D6JA 3D54D 2OXTA 3SC6A 1TF2A 2IYZA 1NXXA 4NZPA 2FPKA 2CJPA 2PFKA 2N9UA 3KSAC 2WYHA 4NZYA 1RI5A 4TLCA 4HEHA 3ZD8A 4Q7MB 1LW7A 5CURA 4LRQA 1R4NA 4HS4A 5EKSA 4QU0A 1EESA 3V00A 4DR1B 1AM4D 3DB2A 1ZLXA 2GZRA 2NO9A 3W8NA 2WWWA 2VH2A 3K9BA 4DYHA 5B64A 1KEEB 1E66A 2LPMA 4MUEA 1O58A 3U26A 3QWIA 4EW3A 1U7XA 1G6Q1 3OZGA 1T5LA 1DGJA 1R1DA 3QW2A 5TR9A 1RYMA 3ZNOA 4NFSA 2X1VA 4RZXA 4F4UA 3N2NA 1Y88A 4YNBA 1M0SA 4IG4A 5JMPA 3U9TA 4TV8F 3ZE0B 1AA9A 5BWMA 3SF8B 1V5WA 2Y9MB 2WF7A 3GG9A 2VDOB 1DBIA 2IL1A 4P4LA 2OE2A 3DE5X 5CG2A 1H0SA 2OZEA 3LOPA 2J09A 5FWAA 3FFAA 4DGSA 3GUVA 3BEOA 1XU9A 1R6DA 4ALIA 1BE6A 3SN6A 4IRMA 2O8CA 3A7EA 3VTAA 3N76A 2QN2A 2DSTA 4D80A 2I33A 3KV3O 1B3RA 4RPCA 3JQQA 4TWZA 4YN3A 1XQVA 2C7RA 1MQAA 4M54A 2ZXIA 5JDIA 3TIGA 1E9EA 2OHHA 4JI1B 4J2OA 4AK9A 5LZ2A 2PK3A 4Y8VA 1F6BA 1PFQA 1TAUA 3VSDA 2I2XB 5CBKA 2MSCB 1E8DA 4L9SA 5EIHA 2PGDA 3EWAA 5EC8A 4KLGA 5J59A 5IC5A 4DSIA 2OECA 3BX1A 1N77A 1E64A 3TIIA 4ZOLF 3MRTA 3BIOA 4MW1A 4QZDA 1QF6A 4GBGA 2HHLA 3EEOA 3IRUA 3L84A 2OZVA 1ZIXA 2LHTA 3ZIUA 3W5SA 3I64A 5H5JA 4IIUA 1XCPA 1FFVA 3QWFA 2H1CA 3VYSB 4BMNA 4ATNA 3DW3X 4NBUA 3W8DA 5BXQC 2QW8A 4WBXC 1YIAA 4HVTA 1SVUA 3EGCA 3RWOA 4PNEA 4CLOA 4MUBA 2PX3A 3BTUA 4U0JA 3CCBA 3UK7A 2KJQA 1B6GA 3BSSA 5EXXA 4ECSA 1SOWA 3ANTA 1K7CA 3U60B 1W4ZA 4EEKA 3FI9A 2JFQA 3GGPA 5GIPE 4WCVA 4DEYA 4KN8A 1EZZA 2MIIA 1G9SA 1Q95A 3NEJA 1S4QA 4RLSA 1CI4A 4YRMA 2IXGA 1G4UR 2QPAA 4A8JA 2J7PD 2UZ0A 3L8CA 1IHPA 3NT5A 1JJFA 5IH3A 1X9IA 1LDEA 2OCAA 3UWMA 2ZI6A 5AVJA 3OKPA 1LPSA 3B8EA 2CLKB 4JFRA 3CLKA 5BSRA 3OQ1A 4LSMA 2VWGA 1A5ZA 3I3SR 1LLFA 2ORED 3CLUD 4RWEA 1LF0A 4U0KA 1W36C 3ELUA 2QX4A 1SC6A 1XZDA 4XQ8A 5ALLA 2R8JA 1ECGA 3HJUA 5KNIA 2VBFA 5GINE 3NTRA 4AZVA 5M5BA 3PCTA 2PLNA 3I6BA 3T5BA 2QUHA 5GVRA 2RH9B 1OLSB 3FYCA 2EX1A 5BW8A 3TG8A 3RR7A 1KERA 1C7YA 1JFVA 2OD9A 4OBXA 4KQ6A 1XK6A 2WG0A 3SC3A 4BO2A 3REQA 1K4YA 4QJFB 2PH7A 1QKJA 4ZHQB 2DFNA 5CFLA 1ADBA 3Q3VA 3GBVA 1V6AA 2WSMA 2Z83A 2ALZA 1BHO1 2QXYA 5ITWA 3QHPA 1Z0KA 5KTYA 5AKXA 3UV3A 5K0ZA 1R7RA 1CJBA 3KX2A 4CMJA 5FEUA 1HEKA 2Y05A 5TMEA 1MOSA 4Y2PA 2WTMA 4DEXA 3GO4A 4PHAA 5KOIA 2OSVA 2OQIA 3PC6A 5EUBA 3PQ2A 1CUBA 4RJIA 4G26A 2GXAA 2ZJ4A 2BMAA 5CB8A 4CF4A 2GZDA 5LNK6 4W5OA 1VL5A 2K4HA 1K08A 1MJ5A 5C7IO 2Q6VA 1P1HA 1W87A 3FD8A 1XTSA 2X4LA 2CEAA 3NAQA 3ZWOA 3S2SA 1ZRNA 1XHFA 3BJYA 1MC4A 1JP7A 2IYOA 1TO2E 4CCHA 3OZFA 3BDIA 3R9XA 5D3MB 1NVAA 2C1XA 3WK4A 2NYRA 1JEQB 2KMLA 1A50B 4Z2AA 4F4DA 1SXJC 2CLCX 3BQ7A 2WZQA 5CH8A 3NP9A 2VUHB 4ONEA 5I4CA 3AJAA 3L5OA 1CDDA 3OLCX 1ZQWA 2FFBA 5IP5A 4I5IA 3EPJA 3O03A 4ROSA 2D6FA 2YFQA 4C7OB 1VLQA 2PKQP 5GVSA 1RXIA 2LI6A 4QGHA 3SK0A 4AICA 3IV9A 1SHTX 3UMMA 3P19A 5JRTA 5F1OA 2KKVA 2X9GA 1CS0A 5T6BA 3VZPA 4DLPA 4R8MA 1ZU4A 3E6AA 3VYUB 3EIEA 1NONA 4QELA 4YXMA 2JJ8A 3N1UA 4QPCA 3G0GA 3FYDA 5KCMA 3GGCA 1CYDA 1J2EA 4CMBA 2XY7A 5AKEA 5KREA 1IG6A 3GLFE 1MJFA 3QE0A 2DWUA 5DTJA 1ADGA 2ODBA 1Q57A 2HA6A 1QHHB 1R9JA 5H3HA 2P79A 5JXWA 3JD4A 2BSXA 1E4EB 3MTJA 3G3EA 1LBSA 1E7QA 1JXMA 3F78A 2QORA 5DLEA 5FOXA 3H9CA 4OTZA 3E1SA 4BVHA 4WBNB 1NI4B 2X6QA 5A7FA 3CW9A 3SJCA 4DSFA 1N5DA 4V0LA 1VXRA 1EHCA 3RH6A 2C98A 3RJIA 1QVRA 2YYAA 1YV9A 4REQA 1NHWA 1E2NA 4JMLA 4RETA 3EYZA 3FX2A 3W5JA 1SL2A 3NORA 4P0QB 4RJ2A 1Y3HA 3B9PA 3HUTA 3OZUA 1CZOA 3V4SA 4DIDA 4M21A 4EFDA 2XXAA 1JIXA 2HXYA 2AF3C 4C5AA 2Q3MA 4BOYA 3M2PA 4JWKA 3LGXA 2GJ8A 1N2BA 5D85A 4ELUA 2QTZA 3T9CA 1AF7A 2UYGA 2VHVA 3LC2O 4EZ9A 1NFQA 3E9QA 2BFDB 2RDJA 3AC0A 4JLUA 4U9IS 3IP4B 2J9FA 2ETXA 3KZKA 1NOKA 3QM1A 1CCWA 2FQQA 2W93A 3QP9A 1PJCA 1EK0A 3DC2A 4B7CA 2P4QA 3DUWA 3ZC3A 4LWQA 1VLLA 1N7HA 1TF7A 1GNLA 2YWCA 4WADA 5CVEA 2EFJA 1A6SA 4E5SA 4BLOA 3QBJA 1K9VF 3OQPA 2WJPA 3AKCA 1NZBA 1E96A 3MCUA 1V3VA 1BS1A 1K0UA 2ZETA 3T0FA 4XYGA 3B1KA 1XMJA 1L3BA 3D5TA 1PFVA 1WHSA 3TLKA 5G5GA 3LC7O 1BQ4A 3L7DA 2EKDA 1JSRA 1NP6A 3E3MA 3RTEA 1Q0TA 1FFDA 3SZOA 3ENKA 2HSJA 5DWQA 3RTVA 4OQDA 1ORTA 2IE0A 5JDCC 5DIFA 1PNQA 1NULA 4ECRA 2Q41A 4ZAFA 1QYCA 4CF3A 1JG3A 1QLNA 5JS8A 4MLDA 4R63A 1DOQA 1GGMA 2XF2A 1E3EA 2CDAA 1II0A 4XB6B 2ERCA 2V9CA 4JU9A 1VYHA 4D8UA 4Q4CA 5D46A 4F2PA 2MMCA 1DB3A 1M54A 2YJ4A 5DCYA 2DHDA 3M6ZA 4N40A 4PAGA 3CYFA 4EGQA 2YMPA 3WHPA 4IQVA 4DQVA 1TRKA 3H3JA 2FWJA 4EMBA 1A04A 4LXYA 1A8UA 3HCPA 2GYUA 3JYHA 5C1IA 2IGBA 2VRWA 1CF4A 4DJJA 3NH6A 5TVGA 4CLRA 4KXNA 3DFFA 1T3ZA 2X2PA 1ZNYA 3F97A 2GK3A 5KQPA 2NYVA 1VCNA 3FR8A 5K01A 1YOBA 5TF4A 3G0BA 1ENZA 4N7JA 3EGIA 2D3TA 2RH8A 5TMBA 3ASYA 13PKA 4PRKA 5BN3B 2VTBA 1F1JA 3GPIA 1ZL0A 3WK6A 1RAHA 4HMPA 1HDRA 1U94A 3F5QA 5H9WA 4GPD1 4XQEA 3QG1A 3IOMA 3WL3A 4GC7A 3B5JA 2AJCA 1EE2A 3BDVA 3E81A 3ST7A 1ZN7A 2NXEA 3IJRA 1GPWB 5IK2D 4LMBA 4YJ3F 2K8AA 1WY5A 2VYND 3WNZA 1W6RA 4NAUA 3F49S 5C8YA 1FJGB 1U0NA 5T7BA 5E8RA 2QTCA 4O25A 1VIAA 1EGQA 2Q5QA 4L6CA 1V7PC 2QRJA 3AFOA 4HNTA 1GUFA 2XEDA 4DV3B 1TVAA 3WFZA 3VV2A 5DI3B 2O0KA 5G5HA 3UKDA 1HT1E 1L5MA 1HFJA 4FOTA 1E89A 5F64A 3AM3A 2BFBA 2YQEA 5AKYA 4A3SA 2ZZMA 3M1AA 4B45A 4WGGA 4C05A 4F06A 4KI0A 2JA2A 4KKXB 2WKQA 3OFVA 3AUFA 4IJKA 1GTRA 3V4OA 2C2HA 4Q1BA 1JJIA 1T9GR 4ZT5A 4LE0A 2WICA 1OH7A 2EZ9A 3H19A 5BSGA 4RVUA 1A5AB 4U2CA 2VNSA 4Q1CA 4CLEA 3QYJA 5J4VA 5HKKD 5I7RA 4YRGA 4QBHA 2KSOA 4ARBA 1GGFA 3DEHA 4Q6WA 5K6AA 3VTZA 1P1IA 4H7HA 3G8CA 4B1FA 2FPGA 1T5DX 3DKRA 3AGQA 4DGQA 2QY6A 2PMCA 4YV1A 3WSWA 2R8ZA 2DERA 1KIFA 4DS3A 5E6RB 4Q1DA 4YASA 2FN4A 1AVTA 3C43A 3NEAA 2JHAA 4ZV9A 3HVKA 4QATA 3MTAA 5FL3A 3WVNA 3O93A 1NF2A 1K8RA 1TIBA 1FNCA 1IFXA 2OEPA 3NTQA 2G06A 2I8CA 1E1RD 2Z43A 2GMWA 1E3LA 7ICQA 3SAHA 4QYIA 2GETA 1Y6JA 3CVVA 2QX6A 3FPSA 3LW8A 2OG1A 4TS3A 1WXDA 2QT0A 3GF4A 4ER0A 1YIOA 4UTPA 3ILVA 3QFSA 3SAJA 4ECYA 2O5VA 4DSOA 1PV2A 2WDPA 1CULC 2P68A 1XCOA 3TADA 3PHGA 3T1OA 3PPXA 1P8JA 3P94A 4MV6A 1Z18A 3EDCA 5CTAA 4Y9RA 2OG2A 1E8MA 4C0QC 4MI6A 2OHFA 3IEMA 2VBGA 2VNHA 4IIDA 5KT6A 1WB6A 5HVNA 1WAMA 2LVBA 3TRIA 2DMRA 3KCQA 2JCYA 1HEIA 1RHJA 2FX5A 3JVDA 3K73O 2FSIA 3SF0A 3DOJA 4B76A 4L3VA 2HTEA 5IEBA 5EKUA 2IYVA 4PBRA 1J9GA 1O3YA 3OG9A 1S77D 2VF5X 4TT3A 1M1NA 1JFSA 1XU7A 4Z7OB 2IGTA 5F9LA 4O3FA 4MITA 3PNCA 4RTRA 2BSAA 1RYNA 4EO7A 5FQOA 3OZXA 5K20A 3EXHA 3F6SA 3PYXA 1R4MA 2F8TA 5KUTA 1DTEA 3QUCA 1JTVA 1QFMA 1V38A 2NMVA 5BVGB 3HV0A 1J2RA 4H9GA 5D00A 4ZZ1A 2FUG6 2JLCA 2CYCA 4W8GA 4H0NA 3IUSA 5FWNA 4U39A 4C01A 5BSEA 1JAYA 5CB4F 1K68A 5AW2A 3BIWA 3V4ZA 4DTIA 1ZCFA 4KW7A 3G6VA 3GK3A 3WXBA 4N3AA 3KKNA 1Q7BA 3IBGA 4QC2A 3ZS9A 3GUCA 3JZFA 3L18A 2O9JA 2IH2A 5SYMA 3H2KA 1H42A 3OMXA 2VQFB 1F6WA 2FAXA 3MT0A 3TSCA 1N62A 3CLRC 4P3XA 3VHXA 2FFHA 4MV1A 2NLOA 3MGBA 3C5CA 5HUQA 2RP5A 4FYMA 3LKZA 2O59A 3C8ZA 4KLRA 4D9JA 2I3BA 4U2GA 1MZVA 3ONFA 3KSBC 1MORA 1WXQA 3Q3IA 1IZ0A 3BEDA 5P21A 2QE6A 4I8XA 5G4KA 2FMIA 3PXBA 3GFTA 4F4FA 4X41A 2B78A 5C52B 2R25B 4O2BA 1YQQA 3CW8X 5DEIA 2Z6VA 1U9JA 2C58A 3NIDB 1A4UA 4PC3A 1HK7A 1A4XA 3DLIA 4G86A 4UB6U 1PT5A 4HXGA 3EXIB 2P3OA 2IW1A 1P4GA 3CM0A 1YGPA 2NZJA 3TYXA 1I30A 3MJRA 1MJNA 2G5CA 5KFGA 1ZY2A 4WZBE 4CODB 1GLNA 4G0XA 1SJ9A 2JJ2A 1E4OA 3O92A 3OIVA 3ABSB 4YLYA 3HPRA 3EPGA 3JD1A 3TMAA 3UM9A 1ZIDA 4EBFA 3PL5A 3I9JA 5IMSA 3LWZA 1GPNA 5TIIA 4RHEA 5KL8B 2IV3A 4TKMA 1W4RA 4L76A 3JD0A 4C4XA 1UZNA 1KJ8A 3SZ2A 2O6HA 3DAHA 1ZUNA 3QXCA 4I50A 4TV9A 4QFBA 5IULC 4DL3A 5EWMA 5H7XA 1J39A 3C87A 4LYYA 3GFPA 4HWRA 1L6RA 4F2DA 1IPFA 3JWPA 4MWOA 4URHA 1O97D 1YVRA 5A1TA 3H5WA 4NX2A 2XCOA 2WWXA 3F2BA 4DARA 4C76A 4JUDX 5DYGA 3SDBA 4RH0A 3GHYA 4NLBA 4PPYA 3Q5EA 4IIEA 3T34A 2DX7A 2R00C 1DX9A 5JYEA 2XNKA 3DUFA 2VR1A 3RANA 3C1UA 2QZZA 4ZDKA 3U4IA 1WV0A 4CHGA 2JB9A 3UOAB 2ZQYA 3R5XA 3MWYW 4O5EA 2H00A 2C9ZA 4DV7B 4C4PA 4C22A 2ATVA 2MSKA 1YHZA 1R74A 5LA6B 3ETRA 1I8TA 3KYCB 2EIXA 5TXGA 5JARA 1EEXB 3BL6A 4BNXA 4OO3A 3KDSE 5HR5A 1UKZA 2PS9A 3S0JA 4LE1A 3OCUA 3RM3A 1Z4JA 4BV9A 1IZ8A 3C3PA 1T9KA 3I1IA 3WKBA 1X6IA 5HEKA 3R74A 3KPWA 1NURA 2XOXA 3ZTYA 1IRIA 3RS4A 2AE2A 2JVIA 3OUZA 1EQUA 2PPLA 3GP8A 4DM7A 2GYYA 2NO4A 4K9SA 3BQ0A 2A1TS 2WZCA 1XZMA 3A31A 4X7BA 3FVWA 3LGSA 3N6RA 4P0TA 2UYHA 2EANA 3O8RA 3D7KA 4WZAB 4F86A 1KKMA 3FWZA 3R3UA 5AJWA 4M7WA 4WUVA 2PKQO 4C8OA 3EODA 4BX0A 5MN5A 1V45E 3NP7A 2PYIA 3MRVA 5G1NA 2NV6A 3Q1LA 1F60A 4D46A 2C9DA 1FFEA 1V9CA 3D4OA 1G6KA 2EFEB 2UVDA 2JKZA 4R3WA 3KQVA 1B26A 2JJ1A 2WYWA 1C1DA 1G4AE 2EYQA 1ZM2A 2WM2A 1JQ3A 5ICEA 3CF0A 3IPLA 4Q4HB 4GKJB 1X14A 1NKTA 3B85A 2ZDQA 3GIKA 1UZUA 4PYLA 4JBXA 4MGHA 1H0KA 4MVJH 3C4QA 4WY8A 5KOHB 1ODSA 3VZSA 2QARB 4Z9FA 1YQXA 2GCPA 4A6EA 1VJ5A 1EVIA 1C0PA 4J9RA 1MSWD 3PL1A 4EBEA 2A9PA 5COBA 2CUNA 1JHAA 4G4IA 4ENSA 4B2LA 5C1BA 1I3CA 1WHTA 4L5YA 4Z1MD 2H2IA 1CF2O 1YQTA 3W6OA 4RTQA 4QNNA 3NWJA 4QRDA 3GMSA 1IAQA 2PAAA 4WFIA 1RKXA 4PEVA 2J4CA 3A1VA 4CVNA 4PLFA 3W4KA 4GNKA 4XD2A 4YAOA 1UKVY 4I2JA 2ECQA 3LCMA 1SQ6A 1Z6AA 3NG1A 5EWFA 3PW5A 1Q1NA 3PQCA 1LDMA 2W8ZA 3PNKA 1OKKD 1O6BA 4PONA 4HO1X 1PVOA 3GLUA 4TM7A 2EP7A 4FWIB 1NXTA 3GIDA 2D59A 5B1EA 2GXQA 1AV6A 3MWEB 2NU6A 1MLDA 5EXPA 3WMXA 2DPMA 3I5UA 2ZWIA 1QVVA 3I5MA 3JPSA 3IGFA 1SD2A 4OQFA 2HLHA 2F00A 8ICEA 5E2AA 1AN9A 3RREA 5HZMA 2PUGA 5TX7A 4BZZA 4XCVA 4M55A 5I4KA 1G18A 1GZUA 4HGQA 1JEEA 1XQ1A 2Q9BA 1EA7A 4IL5A 2RKWA 4R1MA 2BEWB 1GCAA 4AZTA 4LQDA 2PT6A 3RHFA 1SNYA 3H42B 5TZVA 2FPLA 4UPDA 4TS1A 1EBBA 3LHIA 1M6NA 1U9IC 3BORA 1MN8A 2ZU0C 1AGYA 4XLTA 3B5EA 2XT9A 4KFUA 5B37A 2NRWA 4HFMA 3KFUF 3N28A 2QM7A 4X1IA 1NJ8A 4F2SA 2HIAA 4N0DA 2CZQA 1Q16A 4G1EB 721PA 1E2BA 1PW5A 5KYUB 5F1YA 2GJSA 1Z6PA 4R68A 4KNWA 3KD3A 1ZCZA 2GWSA 3CG0A 2NUAB 3S7TA 3B82A 4Y1GA 1L3IA 1SKUA 2P5TB 2QTVA 3NB0A 2NTJA 2BF4A 2HWXA 4DV0B 3ZI4A 3A6EA 1WEKA 2D00A 1GZ7A 2HWUA 5A3QA 4MH0R 1D5CA 2GB4A 3DNMA 3ETJA 4RABA 3BHNA 4LDRA 3PE3A 3QKSA 4W7SA 1WZCA 3H04A 3IEKA 4E46A 2IELA 4WKPA 1SCKA 4LX8A 3ER6A 4V38A 4DF3A 1KK1A 2FEMA 5BYJA 4C7JA 1NKVA 1RHMA 4KFCA 5HCUA 1SCQA 3U2QA 3SHQA 5TGDA 1CR4A 3RH0A 3LLMA 2C5GA 3DEZA 2ZVJA 3R7DA 3T3IA 1JSXA 4BV2A 3HKEA 2P62A 1BKYA 5GGXA 3RYFA 2NXNA 2DUMA 2RGYA 1JIJA 3RJEA 1R2QA 2DQNB 1WS6A 2PBFA 4BNKA 2PWZA 2HRBA 3ICEA 3K6RA 2AC7A 4PHDA 2FK8A 1KAMA 4CQMB 2DPJA 1V8DA 1NV8A 3PE6A 2ZTHA 3FMPB 2JGLA 5L7TA 2RGGA 2JW5A 1ISPA 2C4VA 2H9YA 1W6UA 4A8TA 1KJNA 3EGWA 4DREA 3RV3A 2FUCA 3H6KA 3GAZA 1MD9A 1MJHA 1HE5A 2VWHA 3DT9A 2B4TO 4EP1A 1PEAA 2O57A 4XPZA 4URWR 4DXDA 1CZNA 2AMVA 1ADCA 4ZI7A 6GPBA 4ITRC 2P91A 4Q1AA 2WHYA 2AT1A 1OR8A 3LQYA 3WYAA 3PXAA 1Z5ZA 1ORVA 4NOJA 1Z4LA 1IHYA 1PJLA 2FY8A 3RH5A 5FBRB 5LP1A 1QIKA 5IILA 4P3KA 1J1ZA 4PH5A 1I2DA 4OXNA 1P6QA 1NBAA 3E18A 4DA4A 5I6DA 3TD2A 5BUZA 2FQ1A 2CMKA 3RD5A 4FDUA 1ZGJA 4MEAA 5JATA 1FFYA 5ALJA 2J1LA 4MQUA 4HWSA 3FLAA 4BWVA 2J9YB 1HL7A 1THZA 3D7LA 1BEUB 3RS0A 5JU6A 2ZI3A 1XKQA 3WIUA 4DFMA 4OFZA 4TTRA 1TK0A 1E9RA 5K99A 2H9AA 3UJ6A 1CY7A 1MX3A 2AW3A 1O8CA 4JS0A 2WF9A 1OLXB 2YB4A 5L3QA 1F8YA 1RP1A 2HH9A 2NZVG 2E5FA 3KSUA 4L07A 2WHEA 5CDTA 2QSZA 5JHHB 3T7IA 5AD1A 2RK4A 1VQ1A 3IA7A 5FYDA 4M4SA 1VMKA 1OW5A 5CITA 1OA0A 4RD3A 2ZKLA 1U7ZA 4YGYA 2QGNA 4H1UA 4V0ME 2NU8A 1GNPA 3ITNA 5E1MA 1NFRA 3TVYA 1U8XX 2JLXA 3D2QA 3BCHA 4ZVKA 4OEHA 2Z4SA 1K3UB 3DE6X 3O90A 5B12A 2XWJI 1T36A 3C4VA 3BK2A 1U02A 3PZBA 1ZYQA 4NPAA 4WINA 1K7XB 2C4TA 3U3JA 1FVHA 1MAAA 2JIQA 5HR6A 4S04A 1YZFA 2PIDA 2J0UA 2GZMA 3E23A 3CSSA 4PGHA 4M1WA 2Q1YA 2FMPA 4RNOA 1QONA 5LJLA 1L0BA 1A9PA 2WZDA 1WSDA 1NSYA 2WKPA 3U0VA 2HLNA 4DMUB 1IG3A 4K6FA 1EXDA 5FOWA 2ISPA 3MWDA 1L1FA 3ORYA 2G9VA 3Q8SB 1F3OA 4NL4H 5CLIA 3UXMA 3HYLA 4C0KA 3BERA 2AD1A 3B6KA 1RAIA 3A3NA 1QG2A 3OOHA 4WMLA 1JN3A 1FQKA 2PQ0A 1AXEA 3F7OA 1PVVA 4R8VA 3DZDA