1X42A

Crystal structure of a haloacid dehalogenase family protein (ph0459) from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDFVGTLLSVEGEAKTHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPIRDIEEEVMRKLAEKYGFKYPENFWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords hypothetical protein PH0459
publication title Crystal structure of the probable haloacid dehalogenase PH0459 from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 85
structure length 230
sequence length 230
ec nomenclature ec 3.8.1.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1x42A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1x42A01
1RKVA 1RLOA 4HGNA 3L8HA 3W5BA 3B9RA 4Y2PA 3NANA 2RBKA 5AICA 3PGVA 2B8JA 1Z88A 1RLMA 4DWOA 1RMQA 4KYTA 2W11A 1NRWA 3WKAA 3FGOA 4UM7A 3WK8A 1TJ4A 2CFTA 2OBBA 4YCMA 2HDOA 5AKYA 4IG4A 2BY4A 3ZTWA 3N28A 3MPOA 4HYTA 2YBDA 4EELA 5AKIA 3ZX4A 2NO5A 3L0YA 1ZRMA 5AK5A 2EAUA 3NUQA 5ALOA 5AVXA 5A3RA 2AUTA 1RC8A 5AKLA 1WVIA 3F9RA 4CE6A 2ZG6A 1RQLA 3MMZA 4BKMA 5AW2A 3QX7A 5ALNA 2YJ4A 2YJ6A 3ONNA 3L8FA 3WKEA 4OD0A 5IT4A 5AI6A 2R8ZA 2VKQA 4Y2YA 3N1UA 5AM5A 1T5TA 4JB3A 3KC2A 4UMEA 5AVQA 4Y2XA 2G07A 3W5CA 4FYPA 4I9FA 2WF6A 3WGUA 4PNHA 1X42A 5ALTA 3SKYA 4H1WA 5AI4A 2OA0A 3FVVA 1VJ5A 5AVZA 1RLTA 5AIAA 2YMLA 5AKZA 2GHQA 2EATA 2Q4RA 3SF0A 3SD7A 1PW5A 2B1RA 5AI5A 1CR6A 5ALVA 2B1QA 5ALRA 3DV9A 2B8EA 4ZEXA 4Y2SA 2QLTA 2C8LA 4EENA 2I55A 2YJ3A 3OCXA 1YMQA 2OYCA 3OCVA 5AW1A 1U02A 5ALFA 3L1UA 4F71A 2PQ0A 4UMVA 3NALA 1U2TA 4Y2UA 4GXTA 1SWVA 2FPXA 4UATA 4OFZA 4NABA 3WK7A 1QQ5A 1L8OA 2C8KA 5AW6A 3WK4A 1U2SA 5AKGA 4KX3A 4CF4A 1IWOA 1U7OA 3AR8A 3ET5A 5ALHA 3UMBA 1QYIA 5JJBA 3AR4A 3L0CA 3QXGA 3SLRA 5AW9A 2WF9A 3QUTA 3QUBA 3KZXA 4NV0A 3D6JA 1TJ3A 3I6BA 5ALLA 1YJ5A 2AH5A 4F72A 4HGQA 4NFLA 3KD3A 3TLMA 1RRCA 4DCCA 2CFRA 4CF3A 2EARA 1WPGA 3OCWA 4UMDA 3ESQA 3J7TA 2O2XA 2MSNA 5AVYA 4UU0A 3WKCA 4CNQA 3PDWA 1N9KA 2FPRA 3K1ZA 2G06A 2W43A 3IRUA 1TJ5A 2ZBFA 3W5DA 1N8NA 2DQSA 3QUQA 2FPWA 4QJBA 1T5SA 3U7HB 3EF1A 1VFPA 4BX2A 4KN8A 2ZXEA 4B6JA 2HI0A 3NAMA 5AKXA 3FPBA 3M9LA 2JAOA 4E88A 3WK9A 5IS2A 1Q92A 5AK6A 3DAOA 5AKJA 4I9GA 1QQ7A 4C4SA 3ESRA 3U7EB 5AI9A 1AQ6A 2RB5A 2JAUA 2IOFK 4YCNA 3WKDA 3A1CA 1ZOLA 3CNHA 1K1EA 4EEKA 3WGVA 2FEAA 2B82A 2PKEA 4GIBA 2RAVA 2YFYA 3ZUPA 3ET4A 3OCUA 1T9ZA 1ZRNA 1EK2A 2G80A 5ALXA 2W4MA 5ALSA 2G1AA 2HCFA 4BX0A 4BBJA 2I6XA 5AHXA 2I7DA 3CZ4A 2I33A 2D2VA 4BEVA 2BDUA 2ODAA 3HYCA 3N07A 3L1VA 3VAYA 4UASA 4Y2QA 5AI8A 4YCLA 2I34A 5ALKA 4L57A 2ZBEA 1YV9A 5ALDA 1RPZA 3A1EA 5AESA 2YN4A 3M1YA 1ZD5A 1VJRA 3OCZA 4HGOA 1LTQA 4RESA 1Z5UA 3MC1A 3QYPA 1QH9A 3QUCA 2R8EA 1TE2A 3QNMA 4FFDA 2HF2A 1MH9A 3E81A 4AS3A 5AM1A 4IFTA 5AVUA 3E8MA 4UARA 4J03A 5AK4A 2Q5EA 1Q91A 3GYGA 4C4RA 4XE5A 1L6RA 1LVHA 5AVTA 4KX5A 2YMMA 2FDRA 3AR2A 1J97A 2AGVA 1F5SA 1ZS9A 2CFSA 4Y2RA 1ZD3A 3PGLA 4Y2JA 1O08A 3OCYA 2HEGA 3DDHA 1ZD4A 3KOOA 2FI1A 4QQFA 3L8GA 2AMYA 1CQZA 2CN1A 2QYHA 5FP0A 3I1YA 1QQ6A 1Y8AA 1Z4MA 3OPXA 4MUMA 2OM6A 3KBBA 2B30A 3AR6A 4YIHA 2WF5A 2GFHA 3L5KA 5ALMA 4BEWA 2WF8A 1JUDA 5ALJA 3AR5A 3ZWKA 3QGMA 4FE3A 5AK3A 4DW8A 1FEZA 3ZVMA 5A3QA 3QU2A 3S6JA 5AW7A 1O03A 4YH1A 1RDFA 4OCZA 5AM3A 1YS9A 5AKEA 3WKBA 4Y3UA 1S2OA 1Z4NA 2WHEA 2MU1A 4ZEWA 3NRJA 1S8OA 3L0BA 2HSZA 3ZWDA 5AVVA 5AVSA 2WF7A 2NO4A 2YMQA 3MN1A 2JARA 4MWOA 4EZEA 2P69A 1L7MA 4XOUA 1WR8A 5ALQA 1Z4OA 4YIKA 3EWIA 2FPSA 2FPUA 3AR3A 2I54A 2ZOSA 2YY6A 4UMFA 3QLEA 4YGYA 3UMCA 1Z4PX 4HAIA 4G9BA 5AKKA 5AKHA 3L8EA 1ZD2P 2C88A 4BX3A 2YJ5A 4UU1A 4UAUA 2FUCA 3U19A 5AVRA 1J8DA 4J2TA 5ALGA 4ZEVA 1RMYA 3L7YA 3U7GA 5AW0A 4O8CA 5ALIA 3I76A 1L8LA 3QU5A 2O9JA 3N5KA 4UW9A 2R8YA 3P96A 4NAVA 1U7PA 2HX1A 3ZX5A 4Y2TA 4Y2VA 3QU4A 5AIBA 2ZBDA 3FM9A 1Z4JA 2B0CA 3NIWA 2P11A 3UM9A 1Z4LA 4RETA 2C4NA 3HLTA 4AP9A 1TA0A 1Z4IA 2JGAA 3OTQA 1RMTA 3W5AA 1XPJA 2MU2A 2NYVA 3ZW7A 4KNVA 2WFAA 4HGRA 3SMVA 5AM0A 1RKQA 1NF2A 5AW3A 3U7FB 2C9MA 3ED5A 1ZJJA 5AW8A 5T41A 3ZVNA 5ALZA 1XP5A 4UM5A 3ZVLA 4DFDA 3ZU6A 4UAVA 3PCTA 2R8XA 5E0OA 4C4TA 3WK5A 3AR7A 4BYGA 4L6CA 2P27A 3IB6A 3R09A 3N8GA 4KNWA 1SWWA 4XQ0A 2YMPA 3KDPA 5AI0A 4JDPA 1YDFA 2Q4TA 3I28A 3E58A 2GO7A 1RKUA 2ZBGA 3FZQA 2WM8A 1SU4A 5IT0A 3WK6A 2P9JA 3A1DA 3RFUA 2RARA 2FUEA 3EF0A 3QU9A 4AS2A 5AM2A 5ALWA 3SKXA 4XPZA 2IA5A 4BNDA 3ZI4A 2IYEA 3DNPA 5AW5A 3SHQA 1EK1A 3U26A 3R4CA 1L7OA 1RQNA 2JAWA 4NWIA 5A3SA 3B9BA 2HF7A 3NASA 3A3YA 3E84A 3IJ5A 2HO4A 2G08A 2X4DA 3B8EA 4BNDB 2IOHA 1Z4QA 3FPSA 4CF5A 3BA6A 4EX6A 5AM4A 2G09A 1Z5GA 1KYTA 2GHTA 4OHFA 3QU7A 5AVWA 1NNLA 2PR7A 3EPRA 3U13A 5ALEA 4G63A 3AR9A 3BWVA 5ALUA 4EX7A 4HGPA 1L7PA 1WZCA 5ALYA 3ZTYA 1XVIA 3R9KA 4L6AA 1YNSA 2G0AA 2HHLA 2GMWA 2IOFA 3RF6A 5AW4A 1L7NA 3UMGA 1Z4KA 2HOQA 5ALPA 2BDEA
chains in the Genus database with same CATH superfamily
2Y0BA 3LT5A 2ZIAA 2JCSA 5F98A 2XE6A 2JCXA 1CDZA 1V16A 3KUUA 4OBXA 1VIVA 5C8XA 1RYNA 1IVNA 5EINA 5DISB 3UB3A 4INJA 1U2DA 3EC7A 2FCAA 1REQA 2C20A 2Q2VA 3D3QA 1PEAA 3ZYCA 2B7CA 3ZBQA 5JYBA 3KYIB 2DPLA 2L82A 5EQFA 5E1BA 1AVTA 2OC9A 3D54D 3LUFA 4AUKA 4EDHA 3OX3A 3UW1A 1M6VA 3CUEF 4ZJZA 1DTWB 1QS0A 3OEEA 4YJDA 1EZZA 2WZQA 2DGDA 3V1UA 4PQGA 4BO5A 3M6ZA 3IO3A 4U9UA 1WX1A 2PKWA 1H4VB 1JR2A 4G3IA 4CLXA 1PJ4A 2CFRA 2Q9CA 3OMWA 5SY6A 2JA1A 4JR0A 3NKFA 2GUWA 2I1QA 4N18A 3UXPA 2HSJA 1J9GA 4QZ8A 4IIGA 3K1ZA 1YFKA 2ASLA 3RSOA 5HRUA 2CFIA 2DQSA 2IPAB 1NMXA 4BX2A 1KC3A 3EUFA 2WWGA 1W0JD 2VNIA 1JHZA 5TQ0A 1FFEA 2Q9BA 1CP3A 3A1TA 4R2LA 2CC2A 4EMTA 3IDWA 3IDZA 3JY6A 1E4EB 3L6CA 2DSNA 4RORA 2O8DA 4DLNA 4MR7B 4ADSG 1OWPA 5DBAA 1AN9A 4CMJA 1NLYA 4DPKA 5LVAA 4WA8A 1M34B 1W4RA 1M8FA 3M5DA 1YFZA 2H0AA 5AJUA 4DSKA 1CF2O 1D2AA 3AHHA 2R8GA 1QGAA 4E11A 5T67A 2J85A 4NYMQ 2YVKA 3E8MA 3USES 1PGJA 1T1EA 2QU8A 3WSVA 5AJWA 3WBFA 3O95A 5B64A 2VAPA 4RU9A 4ZOBA 3DBHB 3HGTA 3LPCA 1KO5A 4MRVA 1QF7A 1OUMA 3C8DA 4B4WA 4P1ZA 1CRXA 1GPLA 5E4TA 2FWMX 1X87A 2TSYB 1SL0A 3O1JC 4R3WA 5IDYA 2BE7A 1UADA 1IUOA 4TUYA 4BE7B 4D9KA 5FTMA 4AQ7A 1N36B 1LS6A 3A28A 1XMSA 1K0UA 1YS1X 3AR3A 2OESA 2VDRB 3DB1A 5CBPA 1LSJA 3KQNA 2Q8NA 4R0NA 5C4MA 2F48A 1HOXA 3FPCA 1Y8RB 1HFKA 3KFXA 5IVPA 4B74A 6PFKA 4GKVA 3Q4GA 2QF7A 2IZ6A 4EGCB 1S0NA 4Q5IA 2VA8A 3RVDA 2C5GA 5IJ0B 3V3TA 1TYAE 5A4IS 1OGIA 7ICUA 1B3RA 4IIJB 3S8EA 3C7AA 1HDEA 1UBOS 1KZ6A 3GIDA 2G6BA 3BL8A 2XB6A 2VO1A 2JHPA 4XQGA 3CLRC 1Y98A 2KE5A 3K7EA 3PTAA 1SCNE 2Q27A 4NI5A 3WDKA 3AG5A 4ZOLB 4DQVA 3L1IA 2BPOA 4UUMA 1V3TA 2A0FA 4N3GA 2IGBA 5BSWA 4BIIA 4LSWA 2PA3A 4YY3B 1QP0A 4LJ8A 2LTAA 4WEQA 2NUTA 3WBJA 1RM6C 2BFOA 3DDCA 4KIFA 4ZRNA 4OJOA 3BMOA 2B4TO 4X90A 2WB1F 3ID6C 5KG1A 3HEMA 3BIWA 1SVUA 4O2BA 3RJ9A 1JFFA 2AI3A 3AVQA 2X15A 5GGYA 1UBRS 2I62A 5FNZA 2WJ4A 3WV4A 1XN1A 3I52A 4ZCLA 5B4UA 2IITA 4C76A 4WOCA 3LHIA 4MRNA 2C94A 2IUFA 4Z3KA 4H6WA 2NP7A 3P71T 8ABPA 2ISPA 2P2YA 5EAIA 2WAYA 5DULA 1TAUA 4LY0A 2Q6OA 3V6KA 3K96A 3DHYA 3V42A 4Y0NA 5IH7A 1G38A 1AX9A 2ECOA 4MEBA 2MUTB 4JLWA 3ZR4B 5HKOA 2CYCA 1IM8A 4F8RA 1RR6A 1C7EA 2Q4RA 2HNBA 4QBTA 1U02A 2GXAA 4BMDA 3Q3IA 2MR6A 3GY0A 4QHSA 5SY4A 4OFZA 2XT9A 4OGLA 4MUEA 3HN2A 2PVSA 1VE6A 5L7WA 4M9CA 4E3ZA 3DL0A 1QORA 3CSUA 5HUJA 3UKDA 2X14A 1Y3AA 4I36A 1WQ4A 2DERA 5JBNA 5COAA 5B37A 1LQ2A 3R0XA 4PCUA 3C70A 2HQ1A 1DS6A 4S05A 3PWZA 1XZGA 2A0XA 2P2CA 1FMTA 5IDWA 4M9QA 1Z25A 1RBQA 1HETA 3SEIA 7ABPA 1T9ZA 3G6VA 3WA7A 2DC1A 3IP6A 1ZQBA 1FFXB 4EF6A 4BJ3A 1SL1A 3ZXUB 4ZI2A 1SPBS 2NTNA 1X9XA 3DONA 1TZCA 2I4RA 3TLZA 3AL3A 1CIVA 1RPZA 3V7LA 5BWBA 2KMLA 3ZXSA 4JMUA 4RKQA 4OXYA 3QEAZ 1GXSB 2WIBA 4UXJA 1IIBA 4V0LA 4ZGBA 3H9CA 4BJHB 4I14A 2WAQC 4DNXA 1CKEA 3IMKA 3CF0A 4AP6A 2O8NA 4NYJQ 1G8YA 3THYB 4L2IA 2HSEA 1XXHB 3FI9A 2FE9A 5K3CA 2GM5A 5JH7F 1NKTA 2ISSD 3L1HA 4NJEB 4N5LA 1TCVA 4BO9A 1DEOA 5F1KA 4PS1A 3D4IA 2GBFA 1RT9A 3FAZA 2P68A 4UUNA 2XOEA 3PW0A 1CYEA 2O59A 4D81A 2ICAA 2JDIA 3IQGX 3COSA 4FLEA 4XWKA 1UEJA 5E8JA 1WHSB 4YGYA 3COWA 3AYXB 3EFOB 3VYWA 2H5JA 4RY9A 2AU0A 3NHRA 3L6DA 3O83A 4HFMA 4KH1A 4ZDIA 3STYA 2X4GA 1U7PA 2GGSA 4EVSA 1GGJA 1PQPA 1XLVA 3M8RA 4N48A 3RNLA 1ZQQA 3PFNA 3NBKA 3LS2A 2QY6A 1ZXIA 2IFTA 3AI2A 3JD1A 3DLPX 1MIHA 2PMBA 2PJUA 4RNDB 3F5FA 5AR1A 3B6ZA 1HY3A 5BR8B 2DWOA 2QN8A 4ARAA 4S1TA 1T15A 4RMHA 4LZPA 2R8RA 4UB4A 4CWAA 1XHFA 3H5OA 4E5PA 5B3LA 3EE6A 3QU9A 4OB6A 4M9NA 1F4PA 4L9SA 2PKXA 2RHWA 1KFCB 1PJ3A 1ORWA 2I2XB 3WDSA 2F3TA 2FX5A 3QFHA 4MW0A 1KK0A 4MB0A 8ICYA 1JWAB 2JIPA 3AHEA 3PX4A 2A6PA 3RU7A 5EE0A 1OSNA 1RYYA 2R00A 3IMGA 4TMFA 5LCXA 2FMHA 3BFVA 4Y1FA 1QONA 1Z4KA 3PQ4A 1JEDA 1RLOA 2PO7A 2QTGA 3NANA 2QN9A 3I4CA 5JAHA 2V59A 1GTZA 2ZPAA 2JCBA 1ZQAA 2NAPA 2HMWA 4FEYA 2PT5A 4IIUA 5AVKA 5KJ1A 3K31A 3VBCA 3GLVA 1RWMA 4Z7OB 3ER8A 5A3RA 3K0FB 3HCNA 2V4MA 1PEYA 1WIWA 1NF9A 4DQ0A 1KFTA 3KJHA 5LQRA 2ZIVB 2VKQA 2VF4X 1KY5A 2Z95A 4RQMA 1VIYA 3W5CA 1Y6QA 1GKUB 1J33A 4OLJA 5C0YA 4WNCA 5J4LA 1YCDA 5ICEA 1DRGA 1P1RA 4M7WA 1J22A 2BQUA 4K9SA 2GPNA 4X00A 2FPXA 3V8MA 2BEWB 3B70A 1ZITA 4DFJA 4FHEA 1MX9A 1GQQA 4O8ZA 3UJPA 2OVFA 2VJCA 4QJ3A 1VL2A 1W36B 2JANA 4F96A 2O8CB 3HZRA 1X7YB 4JL5A 1ABFA 4WD3A 5J2TA 2CWDA 1DG3A 2IEDA 4MINA 4OX9Y 1L5UA 4RTNA 1TM7E 2ORIA 2O8FA 5LU9A 1OZAA 1I7DA 4A7PA 2XCQA 4GS5A 1E8MA 3ZE2B 2QT0A 4AIIA 2JDID 2X8BA 5A9RA 3EHEA 5BWOA 1XO0A 3WGVA 5DB7A 4EUKA 1TQHA 4E5KA 4DMUB 4OU4A 3H11B 5CB6A 1EP2B 1JQKA 1RVDA 4MWTA 4B31A 1XAGA 5JCOA 4JI8B 1DFHA 2OGZA 1SD1A 4OMUA 3CVWA 2YFHA 2HWYA 3AERB 3BF8A 1Y4AE 1IBMB 5T7BA 2C54A 3BIJA 4IDQA 5ADVA 1UINA 4E08A 2W2VA 5DIFA 1T0HB 1KFKB 2Q5JA 3MS4A 3D7MA 3GQBA 3P9RA 3WYNA 4D9NA 4PFKA 2W0MA 4URWR 1QE3A 4WESA 1CQZA 4ED8A 1ODCA 1X9IA 3OICA 1NUUA 4L8FA 2D62A 3DFZA 1AKUA 3UHPA 3L5KA 5H4GA 1USWA 1D7AA 2HA3A 1N2CA 1SV4A 4P9NA 1TEVA 3CBQA 2F43B 3ZKAA 1VYUA 2G77B 4FYXA 2N0SA 4PRLA 4LN1A 3LIIA 4ZQGA 2ZYRA 1RIFA 4ZVUA 1UKAA 1B76A 5DXJA 4ECVA 1SCJA 3BSFA 3DZGA 1WCLA 4WY5A 4CXMA 2A4MA 5H59A 3NVDA 3IAHA 5HR6A 1E69A 4E09A 3LKZA 3RV4A 1U8AA 4LISA 2YYZA 4G4SO 3TZ6A 3ZOZA 2DX7A 2I0FA 3TECE 5CJPA 4X0EA 3TN7A 1KAQA 4MYUA 1JV2B 1M6YA 4BZPA 2R96A 2IPXA 1V41E 2HK6A 3EUEA 2CSXA 2XWPA 1U2DC 2WJ6A 4N76A 5KINB 3MAAC 4BQSA 5JW6A 2ZI9A 1X9HA 1JI7A 4RTOA 3GFOA 4KZPA 2XUKA 3CRRA 3F67A 2JGNA 2W8KA 3R5HA 3FNQA 2CV2A 1BNOA 1MQ8B 1MPXA 1SC4A 3WSWA 5KFOA 4N82A 1UBCA 3LY9A 2B3DA 4BNDA 4D8WA 1MCZA 2DQZA 5BOVA 5T14A 3A2KA 1IHDA 1S1MA 3F3MA 2RRDA 1L5WA 2X77A 1L5HB 3DW1X 9ICTA 2VHEA 5FAKA 1SHLA 5THKA 3DEJA 5AH0A 4JOCA 3QKRA 3C6KA 4NAHA 4RQ6A 3I6QA 3LYHA 5DQGA 4WKBA 3UAXA 1M1YA 4AX4A 2FZ5A 5FBWB 3PTZA 3HVKA 1Y7PA 2AC2A 2QTLA 6YASA 2VZ8A 4GFDA 3ZTWA 1SQ6A 4A4DA 5K6RA 3K2QA 3CNBA 1YDGA 2MINB 5T8KC 1C14A 5C5DA 1T1SA 4YRRA 2GAFA 3GLIA 1KO4A 4V3CA 3LVRE 4E0BA 3UCFA 1OH8A 1BQEA 1A2QA 1JLRA 4RIIA 2Y1EA 3OPYB 5DI3B 2EFGA 1CS0B 3WE7A 2HJGA 5AW1A 1ZUNB 4IH1A 3GMIA 4HEA1 1GT91 4JEHA 1AGNA 1FVXA 1EJ6A 4NABA 4ITVA 3A26A 2ZIWB 2J6CA 1G8SA 1XDUA 1MVOA 5A06A 3E9EA 4XEHA 5AW9A 5T57A 2E6UX 1YA8A 3MS7A 2ID9A 3THXA 4D1YA 5EHZA 1P2BA 3U3KA 5KFSA 3VU9B 4F1KA 1ABEA 5DT2A 5LYJF 5E6SB 2G4CA 721PA 3D1VA 1XTVA 2RP5A 3UV3A 5IAAA 1UMDB 2DLDA 2N75A 1KW4A 2G06A 4DR5B 2KHVA 4KVGA 1G9TA 1BXGA 1X7WA 5KI6A 1XZNA 4MKGA 2QN1A 2BP7B 2BMJA 4B2LA 4EG6A 1OYOA 3D3KA 4XUEA 2OCAA 1CQWA 2HI0A 3SENA 2GK4A 5CH3A 4EVQA 3K9BA 2ZUDA 4KLFA 2ESEA 5FBQB 1JWBB 2RB5A 7ICNA 2WIKA 3G79A 2UKDA 3GT7A 2V6IA 4HLDA 2JC3A 2QX9A 1KMHA 4NBWA 3RS7A 4BFWA 2ZB7A 4RJTA 4DMMA 5EN4A 1Y5RA 3HKCB 3C98A 4OP2A 3FOBA 5AESA 4MLZA 3A10A 3Q9LA 3IQDB 1U94A 1UBHS 1LPOA 4H77A 1WW3A 3QYPA 1GU0A 2IGTA 3HJFA 1U3WA 4HH3C 4PHTA 9ICMA 2R1VA 1K7XB 3G82C 3KAKA 4YG2A 1G64A 4L8WB 3RVNA 4G25A 3AFOA 3DBIA 1KQOA 3ISDA 2FSIA 2Z6AA 4RYDA 4RUCA 1M8KA 3CX6A 4TS1A 1YJCA 2AXTU 3R23A 1INLA 3PNSA 1J1IA 3RRGA 3SKVA 3WX0A 3I5YA 3ZWKA 2WM3A 4DQXA 1H6DA 4AKTA 1NDUA 1UANA 4F4YA 2F8SA 3WB2A 1E4VA 4RLHA 4EHKA 3UYKA 1ATIA 3WGHA 1CLUA 1CZHA 5KFWA 4QREA 5L3QB 4OXKA 1SXIA 2HF9A 3D8SA 4FZ3A 3VH2A 4XOUA 4DJAA 2AGPA 5A6SB 5F52A 1RHRA 4G84A 1STOA 3PYMA 3FSEA 1JH9A 2VA2A 1E99A 3QPAA 2PGIA 2HW8A 4GSKA 2OBNA 4NCJA 4ZARA 4XPIA 1W8DA 1OX4A 1ZDMA 1FL9A 5I4IA 1YGYA 1YQUA 5EA2A 3SYLA 4GG1A 4IUCS 4MQUA 2ZT8A 5CYGA 2LIVA 2ZT5A 4NZNA 4RQ0A 1XPJA 3QMPA 2I2DA 1OVGA 1Z74A 3KZNA 4BE4A 4EW3A 1DCFA 3KEQA 3MCTA 2G82A 2QL5A 1NXXA 1CU1A 4YRJA 4ZJPA 3B0XA 1DOHA 2ILTA 5J0YA 4Q93A 5I9BA 5KT7A 2PNJA 1E98A 5CLLA 4QOHA 4B7ZA 1QM5A 4QVGA 2X8WA 2GK3A 3NWOA 4ZZ1A 2XCRB 3IPLA 2PEYA 3U31A 4TWBA 3EF0A 1ZVVA 1RPAA 1QIFA 5I5GA 5BSVA 4R05A 4X71A 1VE1A 5C5IA 1H0HA 1XN4A 4E0DA 3P52A 4O4LA 4CIBA 1ATZA 2ZB2A 8ICBA 4DDVA 1NTRA 2QQGA 4EEYA 3MLEA 3KKOA 1HTWA 1BPXA 3COVA 5FCDA 5FBLB 2Y0SC 1FC0A 1MAWA 5BN1A 3A9UA 4IRKA 5E79U 3CLTD 5JCZA 1XVIA 4BKUA 3MB5A 4RZQA 4HQKA 3QZ8A 3W6OA 1ITZA 1QJ4A 4DJDC 3USZA 4POOA 1LEHA 5T6MA 1I5EA 4V2UA 2G0TA 3E4DA 1BWSA 3Q8PB 4BFYA 3RAPR 1S2GA 3CTMA 2HDOA 4ZPJA 1ABBA 4WINA 1YBFA 1FSGA 3L0YA 1GARA 4HKTA 2XRMA 5AVXA 4GZ3A 4DEVA 2OBFA 3H9JA 5B6JA 2XQKA 4NCKA 2W3SA 4QDZA 5EUBA 2VS1A 4NU5A 3NQ41 4J9VA 4TLLB 3CRQA 2WUWE 1C29B 3PE3A 2E4WA 4U7DA 2BPFA 1Q1EA 3SYTA 5KT4A 3PS9A 2HWUA 1OLUA 3KKLA 5HF6A 2RK4A 2AEEA 2XC9A 1NW9B 1Q57A 1ADCA 4Y6SA 1Q11A 4UATA 1W35A 4PSAA 4W63A 4UAJA 1YJ8A 1S8NA 2OM2A 3GCGA 1M6VB 3MFHA 4D4HA 2GCIA 3WNVA 4OJYA 4ZDKA 1H1DA 1NNEA 2OL4A 3JR3A 2JKVA 5KDOA 3R3VA 3H5RA 3DE6X 4N7BA 4TVOA 4D9JA 2AJ8A 4M2LA 1N8NA 4ZO4A 2CCJA 2EOAA 3GBSA 4S2EA 2XUDA 1J8YF 3PJRA 3PBKA 4N5HX 4C7BA 4CFSA 1EUCA 1Z0JA 2X7JA 4PWYA 5I7VA 4B09A 5C35A 5TQ0B 1GTL1 1GL6A 4FNGA 1DGSA 1DDIA 2V0NA 4QVKA 1U3GA 5JDCA 2HQSA 4BNHA 1ZM4A 4I9UA 3W6ZA 4OIFA 3LE8A 4ZOAA 1KH2A 4BTLA 3HG7A 2O8DB 1CRPA 2HSWA 5AUQA 4YNBA 5GONA 3H5AA 2IVZA 3BK1A 2YXPX 1KAGA 2QENA 1VTKA 4LTNA 4ARZB 3NDBB 4FLFA 4BXOA 3NBFA 5AM1A 3RK1A 1RWXA 4CLDA 2XODA 4KLIA 1TVEA 3UKOA 4TYNA 4KX5A 3IELA 4ZT4A 1DVRA 3SHWA 4ZO8A 3NC1C 4E12A 1GAEO 3OPYI 1UZAA 3PIRA 1YRBA 2BM0A 1CY7A 1IC6A 1NTOA 1KBOA 1EMDA 3MMNA 4W9NA 2JH8A 4B80A 4XSGA 2XCAA 9ICKA 3THWA 4UNNA 1XRLA 1L5MA 4JWTA 4FNOA 4TMYA 1XQ6A 3BWDD 4P7KA 5AM3A 4LJKA 1XMXA 5LP6C 1NUHA 3D64A 3LYLA 4ZYVA 4MQEA 2ZJ4A 1YB7A 3I1JA 4Q9DA 1TIPA 3WYEA 3UUGA 1MG5A 3C5GA 2EFCB 1MO6A 4QPJC 3KCQA 3D2SA 3U3MA 2E4UA 2DLCX 5DTQA 3ZGVA 2EKDA 1NP7A 4Q24A 3Q3EA 5CBPB 1NRXA 4NY1A 5BWLA 1XRPA 1E58A 3J81j 2IZ7A 4IQUA 4NV3A 2P30A 4RSRA 4WH0A 2WM2A 3I2IA 3SHFA 4KXWA 3TJMA 4EHIA 5LMNB 3PD7A 2AF3C 1CQPA 3I6YA 4U39A 3JQDA 3FMFA 2FLNA 1NNUA 4NENA 3DLIA 2XDQA 3HU3A 1FFWA 5JJ5A 1T9DA 1T25A 5IF9A 5KYGA 1JSXA 3UHOA 3QIAA 4TM7A 3ONVA 2J4CA 4JENA 2CUNA 4I55A 4J7XA 5CDFE 1DIHA 3ZD7A 3FWPA 1FX1A 3T5BA 4FYJA 4F9TA 4HAXA 3LY5A 5KSOA 3WU2U 1G8HA 3KR2A 2PSHA 5KAIU 4A0GA 1EK1A 2XE4A 4L3WA 5FR2A 1ZISA 4F04A 2E4VA 3S1SA 1HDRA 2QBYA 3T52A 2OILA 4JKYA 1PGPA 3VPCA 3ENZA 1VRWA 2XDAA 3O8OB 2NUTB 4IIDA 2W8LA 2O2DA 2W93A 4WVLA 3AF0A 5ESWA 5CFLA 2SICE 1DAOA 4IDAA 3G6KA 1GR0A 5D7NA 2XV1A 1JU3A 5K0SA 2GKGA 4DL4A 4MS3A 1IPFA 2I8LA 1KL9A 1JFFB 4TMZA 1HTBA 4GKAA 4RK6A 5EJGA 3EA0A 3RVMA 2W55A 2EU8A 3F98A 1XZCA 1BHO1 5FXMA 2EAUA 4J9MA 5KL8B 5EVCA 4B3HA 1P8AA 1H23A 1PUXA 1NKBA 5B1SA 5LQDA 1ECGA 4O6VA 4NR0A 3N1UA 3K9WA 1XTQA 1DINA 3I34X 3ROPA 4CV3A 4X5OA 4UCQA 1UJ6A 5DHSA 2GJ4A 5AVZA 1VE3A 3TOSA 4F86A 2BKAA 3M81A 4UQGA 4EPTA 4RZSA 1VA4A 5EERA 2VK8A 3QMWA 2NIPA 1Z5VA 2DBRA 1T9HA 1EB8A 4TKZA 3RH5A 2BKXA 1QU2A 4PXYA 4EI9A 2D2XA 5H7XA 3JQEA 3AQFA 5IZ4A 4V0OA 4CF3A 4RQ4A 2VPYA 3KJGA 2AK3A 1RNLA 1SG9A 2Z09A 4JVNA 3LMKA 2W2MA 4WGGA 4GMDA 1K6MA 4KI0A 4LWOA 3DL4A 3R6LA 2PUHA 3W9YA 1GKYA 5IASA 3F97A 1L7XA 3N53A 4PC1A 4R1TA 2G9RA 1J0DA 2HDNB 3GDGA 5AOVA 1K27A 1TVKA 3I5MA 5IPFA 2CBGA 5J0WA 3QKWA 2YJZA 1XLWA 4PYNA 1TK3A 4JI4B 4BPBA 3G0OA 1E61A 4RNNA 3P9KA 2PKEA 3IXQA 2A7XA 3EVGA 3DAYA 3O26A 4KH0A 3C24A 4JWMA 4RDIA 3QOWA 4MW5A 2HFKA 4IIVA 2BTOA 2XLBA 2P65A 3KQQA 5ES3A 1N7HA 3O3NB 3HXMA 2JF0A 4DSEA 5CFNA 4RD0A 2H4XA 1LS1A 1P0FA 4I6JA 2Z57A 4M9SA 3BCSA 4RIEA 4EYQA 2GASA 2HGZA 5F12A 3CLRD 2XCIA 1J97A 2IS6A 1GQFA 2K7FA 4E2WA 2AGVA 2ZJ8A 4DRXA 5DPMA 2GZSA 1DAFA 4QVIA 2YVQA 5KJFA 5IZCC 2FHPA 3C5WP 3ROGA 3H0KA 3BDPA 1XTSA 4B8ZA 9ICUA 4ZPXA 3HWRA 2HU7A 3IEMA 1Q3KA 2BR4A 4RQ1A 2EFHB 1XTTA 4ACOA 2O8EA 3ZDZB 4MCHA 2BHRA 4AYTA 3ZVMA 4L0MA 3BJRA 5A5FA 4V0RA 2X2PA 2JV3A 4II2A 3IQZA 2HJRA 1WB9A 3WKBA 1SN7A 2QTBA 2WHYA 1RBZA 4JUBA 4ZEWA 1VE9A 4IIHA 1JJFA 3TFWA 2YJTD 1Z28A 1H3FA 2RD2A 4QZVA 1B16A 3DO6A 2UU9B 4L22A 1Q19A 3C8MA 3RDPA 1TKDA 3JQBC 3V7YA 1X9SA 2PY6A 3RADC 1EIZA 2YRWA 2B4KA 3ZLJA 3CF6R 3E22A 4L0DA 5KQRA 2RH4A 1WBBA 3DXFA 1WCYA 4ZEVA 4W7IA 1FRNA 3BQ2A 5DE3A 4FBUA 1DQZA 2G72A 3JYNA 5DI9A 3W04A 2PJRA 1EVYA 2G9UA 4RQUA 3WYFA 3RS8A 5TJ9A 3D8NA 1ZOSA 4I9HA 1Z4IA 1AUXA 1VIDA 3CKKA 1NC1A 1OBOA 1MQ3A 1B8UA 3GLIE 4TZTA 3BULA 1OWLA 4XM2A 2ZWVA 2FFAA 2O2ZA 5HOEA 4LVNA 4OHVA 5K4GA 3FFAA 4RVSA 1Z15A 4YRTA 2FN9A 1ZMRA 1GPUA 2HADA 3IOCA 4TL9A 4BMVA 3ETNA 4L0CA 4DV3B 4OB8A 4Z6DA 3PVCA 2NXWA 3MNFA 4RSHA 5F2OA 4FB5A 1Q1AA 2JI4A 3O4FA 4B79A 2A2ZA 1XWWA 3L93A 4Q9NA 3W8EA 5ITWA 2V7BA 1KJZA 4RPKA 5JLAA 3AKEA 2ZVQX 5J5CA 2OWDA 3A6FA 1VLLA 5J0OA 4G0UA 1JIUA 5HP4A 2EZ4A 2Z3ZA 4QLOA 4BAZA 2FOIA 1IATA 3VAAA 4Y1RA 5DNCA 2KV2A 3SSMA 1UM9A 2JJMA 3A0HU 2QP9X 1LQTA 3HXTA 4N01A 2QJFA 5H16A 4XEUA 1H2XA 3RI3A 3INGA 1J23A 3U5ZB 1XRSB 4JVSB 3Q5GA 3T99A 4K2AA 1A7KA 2EZ9A 3WL8A 4TQGA 2FETA 1EM6A 2GOLA 2W6OA 2IUUA 2DQ4A 2YZ7A 3RH0A 3UAZA 2QTMA 5IH3A 2D1TA 2VJLA 1HT2E 3ADBA 4N1AA 3DE2X 4C0SA 1VJ5A 5LQJA 3WAJA 5ADHA 2GHRA 3A4IA 3MCZA 4C4ZA 1YMQA 1UZLA 5JO0A 3ND8A 4HSEA 4XB1A 5KT5A 4OJ6A 4PHDA 2V7UA 3MAGA 1SWVA 4JDUA 3ICVA 5CB0A 1LPPA 3IBTA 3ET5A 3HNRA 1ZH0A 1WCV1 4KCGA 1DGJA 2SKEA 3WJAA 4HGQA 1NM5A 5HF5A 5GIPE 5JWOA 1ZJWA 2X19A 2EX1A 2JB9A 3F1KA 3H75A 4RGYA 1W59A 1SKAA 4O0IA 3A32A 1MH1A 4UBJA 1NBEA 2FSGA 2A94A 1JXLA 5HEKA 3VNAA 5J2TB 2PX6A 3WQBA 4B6JA 1UJ2A 4QBIA 3FYUC 1WDLA 3G88A 3WMFA 3TL6A 9ICSA 2HEIA 1SZJG 2O8FB 1G8PA 4RT2A 1X19A 4MDEA 4V0ME 1FIQA 4RWZA 1V1JA 4HAOA 3VJLA 3R7AA 1B3BA 2IY8A 2YFYA 2B9EA 1A50B 2Y4NA 5HR5A 3OJFA 4GX1A 1KJ9A 3IAXA 1AQJA 1I3OA 3RBZA 4MOWA 2DFTA 1HE2A 5AI8A 1L7DA 2ZE7A 1Y7HA 4HLCA 4IKEA 4DIMA 2PFQA 5KC9A 3D7SA 2ZRMA 4OHZA 3MT8A 1A5AB 4ODIA 2O5EA 1BDHA 4CG0A 2PUBA 4ND8B 2YASA 3FPEA 1MG0A 3HO1A 1VJ0A 2AG5A 2AN4A 3TARA 4MYHA 1QU3A 1JG2A 3WWDA 4JLAA 1IM5A 1YB6A 3F6RA 1JJVA 4OJNA 3KT3A 3BWYA 4WESB 1R5JA 1U45A 2D2EA 3TRIA 2BI4A 2YV4A 3DT6A 3P2KA 4JP3A 1C8VB 4H31A 3LKVA 2WJHA 2XITA 4PGXA 1N2CB 3OECA 4KLZA 2KQUA 2A1IA 2R4TA 5TE9A 1ZD1A 1W94A 2W2TA 4IDDA 3QVKA 2EG5A 3PGMA 3ZQKA 3PEWA 3W2EA 4B47A 3L6BA 1DOZA 2D1RA 3EWIA 3K0SA 2YY6A 1KWKA 2A5FA 1G17A 3KWMA 2XMPA 1I3CA 1JDUA 2J31A 3VC2A 2WLSA 4XUDA 4M7PA 1NA5A 1SA0A 3QFTA 1G6HA 4B0PA 5EXTA 2VJOA 3OJWA 1Q7TA 1Z7GA 2Q1UA 1G7SA 4HGRA 3GJRA 3KE8A 3JAKA 2V6GA 4GM1A 1Z6YA 4AXXA 4KE8A 5ALZA 4Z2YA 5EP3A 4UM5A 2B8NA 5T3UA 2BMFA 3KR1A 1BAPA 2Z8YA 4MICA 4UZEA 3O1IC 4MHSA 5EZQA 1YR7A 2D4AA 2WYOA 3HYLA 1ADYA 3CNEA 3PNPA 1YQ9A 5EJMA 2P9BA 9ICBA 5K0FA 2XBMA 2WILA 2XKJE 1H2BA 3HY6A 4ZYZA 4BNDB 3UQ2A 2JHAA 4UM9B 2FXVA 3QU7A 1SUWA 1B0UA 3SZ3A 4WY2A 3KR9A 3KLBA 4C6SA 1OX5A 2WBLC 1UBKS 5B6PA 2YWJA 2O06A 1E20A 4INZA 4BDPA 3TRKA 5F73A 4C22A 3UIEA 1H1TA 4RIHA 3SC2A 4MROA 1GPKA 2NRZA 4REOA 1OXSC 3NIFB 3ZDBA 2Q2OA 3ONFA 2G5TA 4CW7A 3B5IA 1MO5A 1D5CA 3SGLA 4A03A 1CEZA 1TM2A 1M1YB 1S89A 4UREA 1R64A 2OAP1 2VUHB 4GOXA 5T8KA 1WKVA 2Q4OA 3C16C 2P2LA 4J0JA 3H9BA 1DQPA 1Z7EA 5JDCC 2YUTA 2EJUA 1CHDA 4UNRA 2R8ZA 4AUMA 4IGAA 1NVKA 1CJBA 1SKUA 3EEYA 1KDPA 4LDPA 3ND9A 3S1AB 1QLJA 3U7JA 3AK4A 4YXWA 2CL5A 4I2DA 2GLTA 4NVRA 1MQ9A 1T0UA 5JZSA 5J2IA 3LY8A 3W7BA 2R4QA 2XICA 5FBKA 4OGGA 3X1WA 3U60B 5ERGB 2V9ZA 4CF4A 1Z8FA 5KG3A 4QRHA 1OT5A 5KQPA 1SCAA 2PLRA 5ICFA 3MTQA 1Y4SA 3L4SO 1NLZA 1EI9A 3AP2A 4K6OA 4RUKA 1ECPA 1CUBA 3RVPA 4ZYXA 1UBSB 3THXB 2F9FA 3KKNA 4W9NC 4JYPA 1K8XB 5A4MS 4UCXA 1HEUA 2ZBFA 1L4YA 4I5EA 4K7JA 1T5SA 2AKEA 1HWYA 3QPWA 4Z86A 2NM0A 1BXGB 1X7WB 4EK9A 2BFEB 2R6ZA 1N8SA 3EY4A 4M1WA 1ZN7A 1BN6A 5BV0A 2HTFA 4G5SA 3S29A 4RJJA 1M33A 4GI2A 1N6KA 1XI2A 2DZDA 1AK9A 2NYAA 2GJ8A 5KWSA 1DC8A 4C04A 1KMHB 3VAYA 3VH1A 1NQXA 3E23A 1KI6B 2ANCA 1RADA 3EW7A 3H5NA 4BLSA 3JU3A 5GJVC 3HJNA 3RREA 3C1ZA 1UFVA 3IIIA 1T1IA 4KLCA 3PZPA 3WNDA 4WZAE 1NAIA 4ZZ2A 3NAGA 1IQUA 2C4TA 4G0NA 4IAOA 1QVAA 4RENA 4HNUA 3MRSA 4DRYA 2VYNA 3E4CA 4QQFA 4K26A 2CN1A 1QQ6A 4D3DA 1PUIA 3HDQA 5F5XA 5TY0A 2F1KA 4KVAA 4LKOA 1GP2A 2X5NA 1LTHR 3OEED 2OAEA 1QK3A 1F2TA 4N12A 3LXMA 2I78A 3ZHOA 3PRJA 1YZKA 4O4HA 1W29A 5A3JA 4DZTA 4IRCA 1PEKE 1JFRA 2W9BB 3UHFA 2R6FA 5DO9A 4RVFA 3KJEA 2IUYA 1M2WA 1NKVA 5F35A 2R60A 3R7DA 1B2RA 1BOOA 4D9BA 3N2YA 4AULA 3E5NA 2C7OA 1Y1SA 4C4YA 1C80A 4J1NA 5HDQA 4YJ2F 4ABYA 3M0EA 4OKNA 3OQJA 3TACB 4MQFA 2MSLA 3OURA 1F8UA 2ATEA 5BVHB 1VCMA 2XT6A 4KPUA 4UPVA 1AO3A 2CXPA 1R9GA 4GOLD 4OX9B 3HSSA 2OCBA 4KXMA 2FW6A 2RAUA 1JDTA 4LGCA 5KYUA 3SQMA 2GWSA 4YXWD 1A4XA 1DB3A 1NZFA 2QD3A 3SICE 1RI5A 2ACEA 3C6ZA 4CCAA 1DCMA 1T9BA 3T06B 1L7OA 4KKVA 4DANA 3HBNA 4PAGA 5D3QA 4HNAA 4DDKA 4CYMA 2QI9F 3RUAA 4DHEA 3G8YA 3AVOA 4B82A 3M6KA 1FDTA 5FWYA 3R9KA 2C9ZA 2YOFA 1G5PA 1YZUA 2XGSA 4HB3A 3ADKA 3NOVA 3BTOA 2G9QA 2W9MA 1OTHA 4O4JF 2ERCA 1J06A 3AT1A 4PYQA 3V1LA 3SBDA 1Z33A 1VHLA 1VLHA 4HDCA 1TGVA 2EWMA 1VMDA 3PIDA 2BFDB 3Q7EA 3PC2A 3DE1X 3OFVA 3NONA 3C87A 5K0NA 2QJOA 2YIMA 2GFIA 4E5MA 2JLQA 4M8KA 3V8BA 3ZTTA 3H2IA 1DBVO 2Z4RA 1SUBA 1U7XA 2PWBA 5F3XB 3NFYA 4P0PA 2G28A 1B73A 4U00A 4WDQA 1GGFA 4LF5B 4KMSA 3L06A 1P62B 1CK4A 3SVTA 4ED7A 2BKEA 1BS1A 1A8IA 2NUBA 4QZFA 4C4XA 3HFSA 4M04A 3OLWA 1OLUB 4IJMA 4JYAB 5HM8A 3FYSA 2IIVA 2HK8A 2F76X 2PH3A 3LC1O 2E21A 2ZBUA 3L0CA 2W42A 2VYND 4LWPA 4XGKA 4UAZA 1ZM7A 1XB2A 3DEEA 2M2IA 3UBTA 4KGVA 2PX5A 1UP4A 2KN7A 4U0JA 2WWIA 5EE3A 3T5LA 1V37A 3WLSA 3V4RA 3H2HA 4JHLA 1J07A 1YZ6A 3R40A 3SJZA 3ZDAA 1E2MA 4DSLA 1U5CA 4BTEA 3R3XA 1N2BA 2C59A 1C7IA 1DV2A 4O2AA 4FYYA 5FI3A 4FU0A 3H2BA 2YWDA 5GGXA 3AF5A 4LYDA 5CFQA 1Y81A 2W4MA 3ITEA 3JPYA 1I4OA 5HIMA 1X8XA 2ATXA 4ZV4A 2YWCA 3C7CB 3C3KA 3VHRA 5GONB 4XYLA 3QUCA 4R1UA 4OI1A 5TPWB 3REQA 4Q43A 2Q5EA 4RU1A 3R0ZA 5HFAA 4TZ0A 3SHTA 3NNNA 1E66A 1ZHHA 5HKKA 4EGSA 3Q8QB 3PT5A 8ICHA 2EYUA 2IZ0A 4CT0A 1GA6A 5IBPA 4HLNA 3ZDRA 2R5WA 1TFUA 4DCNA 4PHGA 4JP5A 2D3WA 2K2WA 4ZT6A 5CDUA 1ZCAA 5C3UA 4Q00A 4CHTA 1PIWA 5F5NA 4GO1A 1FVOA 3F5EA 3GH3A 4RHUA 4LC9A 4X8LA 2WKRA 3AZOA 5D8DA 2G88A 5LP6A 5EOZA 2JZBA 5JIBA 3THWB 1C7ZA 1LKYA 3OZSA 5FPHA 4BQQA 2IHVA 4LJ4A 4IKOA 1ZK2A 2ZSKA 3FDZB 3MPUA 4HB0A 4MQEB 4ZYUA 3CHYA 5T4FA 4ZAZA 1KSPA 4BB6A 4QO8A 4G9BA 3CRXA 4JT8A 5FWXA 1KZGB 4CF6A 3NC0C 5HILA 5J2JA 3OPMA 3LUCA 2MA1A 3R6GA 1LLCA 4WY8A 2IMWP 1I80A 4GOOD 2VCHA 1Z29A 1WDWB 1FDOA 1P1HA 1M5TA 1NXQA 1OH7A 1XZEA 4MIKA 2R8BA 2GO1A 4PG6A 2XRZA 2P7HA 1HDZA 1W5TA 2GWHA 1TLTA 3T94A 3QPDA 4RA9B 1MVLA 1XYYA 4LYAA 4MV8A 3D6TB 4L16A 4PF1A 2PT9A 1P2FA 1ZVKA 4V0KA 2EZTA 4AZVA 2IPMA 4NENB 1DIAA 4OV6B 2XDQB 1YHYA 1ZYUA 3RBXA 4C8OA 4RS3A 1SWWA 1EDDA 3QYAA 2OD9A 3LF2A 3C2LA 1KMQA 2DH6A 1X39A 1NVEA 4RPLA 5BNZA 1SCDA 3OX2A 3TW8A 1I2MA 1XDWA 3RFUA 3A1DA 3NH9A 5CDFA 1HA3A 4K9MA 5EJ2A 3EG9B 4OAOA 4B1FA 1V4VA 1UC4B 3HKZF 2Y05A 4PXAA 1FLDA 2QTVA 4L5JA 4ROTA 1FFSA 1DXQA 2I4NA 3ICWA 2C92A 1R9MA 1WSBA 3PLRA 1NM5C 1N0UA 2QBYB 3I8OA 3EGEA 1Z5OA 2IYXA 4U2EA 2EIXA 2PIAA 2XUZA 2PGLA 1JAHA 2Z1MA 4MS3B 4QDTA 1DHRA 4CDMA 4YUVA 3WKAA 2OCIA 2OENG 3AEUA 1KYWA 2B94A 1NMQA 1RHUA 2VQFB 3P7MA 4JT2A 2DBZA 3E0XA 4ZQIA 3W2GA 2AXEA 3GNLA 1HLGA 4F2RA 3BS5A 5KAMA 4FCVA 1WRBA 4X94A 1K7YA 3NWBA 4C0WA 1SO8A 3PFWO 3SM3A 1OU0A 2ZCVA 5AI4A 3ZIDA 1F2DA 2JFBA 2YMLA 1KPGA 3SD7A 3ZJUA 5BOSB 5ALFA 3DFUA 3GRVA 4QFDA 2VDOB 4DR3B 4NJ8A 1D8AA 3IQFA 3KV3O 2J3IA 5HKKD 1L3TA 4FDTA 1XC9A 3KD2A 4F4JA 3IIKA 5DN6A 5EMHA 3WQRA 3IT0A 2Y67A 3ZWAA 2C2KA 2AYXA 4HZGA 4F72A 3MCAA 1NVTA 1N0VC 3EQ6A 2R5FA 5BYAA 1E1LA 2EH9A 4QZBA 5AWFC 2RE8A 2YY7A 4WADA 2QEQA 3IE0A 3VKVA 2EDCA 3MABA 4RPHA 1RLJA 1P2TA 5CM2Z 1FYXA 3NETA 5DOZA 4PZ9A 4ONEA 3T5MA 2QQFA 1O0CA 5CA1A 3PITA 1WY5A 4KKXB 3TI7A 2WP0A 4EYEA 3AGQA 3GJ3A 2R1UA 3EUAA 4MW2A 3EZYA 3S2FA 3HNPA 3VR2A 4K87A 2ZJYA 2XZOA 1T8SA 5SZIA 5KG7A 2PMDA 5CJJA 4N8DA 4OKIA 3URKA 1RPJA 2ODAA 4TTTS 5CB4F 3KZOA 1YVEI 3AU9A 3AUOA 4L57A 1U2RA 2OXFA 2J6TA 4AB1A 4C43A 5FOXA 4ZAWA 3Q8RB 3K75D 2IYTA 4GVXA 1J0EA 1A77A 4N0EA 3LPDA 5G0VA 3THOA 4AFNA 1P5HA 4Q3DA 4AJ2A 4RA6A 5IZCA 5FTLA 3NVKI 4NZPA 2Z3VA 2XCUA 4WNAA 1EESA 3PGLA 4U6QA 4AMZA 2IW3A 1ISGA 3B1FA 1BS2A 3K8QA 3RSFA 4CDRA 4DRXB 4RPCA 2ZIUA 4MYDA 4XTRA 3QKTA 2QT1A 3Q3CA 4YPFA 1VL0A 4M9JA 3W3ZB 7MHTA 4TKLA 3QLJA 2OB1A 3N05A 1KOFA 4AKGA 2NTEA 4FEGA 2XYHA 2YX1A 3OZFA 2O8EB 3ZY2A 5CT6A 3ZZTA 2ORED 3PL5A 3ZY5A 3WYBA 3SBOA 3OMLA 4WCFC 2K4HA 5IN4A 1R0RE 3JQBA 3PUJA 2FTKE 1DZIA 3STUA 4EZEA 4F8EA 1KETA 2Q41A 4LMPA 4RHFA 4XA5A 5IN5A 4ZMBA 3RYCB 1U0FA 3EEBA 2MYUA 4DYHA 3QELA 2M98A 3D4PA 1SBIA 3B1ZA 4J2TA 1TCCA 3E22B 1DTSA 2R8YA 1HGXA 4LTMA 1YQEA 3NIWA 3NP9A 4I2FA 5K4HA 1GYPA 2YBEA 1DO2A 1PGOA 5C1OA 4LBVA 4DSOA 2VJPA 3M9MB 1XF1A 9ICAA 3SVZA 3ISBA 3KSDO 2XUOA 1E5QA 1GCAA 4LHSA 2PGAA 1FU4A 3WK5A 2P67A 5CH5A 4YLEA 5B53A 4Z8YA 3D7RA 2E5LB 2Q7OE 4BLWA 1KP9A 4R2JA 4Q1DA 3WLLA 3DMFA 4II3A 2R7MA 2B61A 1Y7IA 4AG5A 4P4LA 2CXOA 4G85A 3KYDA 4IX9A 4N8EA 3D6AA 9ICXA 1TGYA 4KITB 3BEDA 1NE7A 1RRFA 3E84A 5DN6D 4RIFA 1BX1A 2NUAA 1FJHA 1D2MA 3H1FA 4CF5A 2K6GA 1WMAA 3QXXA 5AM4A 3IA7A 4TXLA 3D4LA 4R4JA 4FFSA 1SXPA 4OF4A 2Y66A 4BUJA 4D0GA 3H1AA 5CAEA 1U4BA 4ACAA 4G6ZA 3TMAA 1BHQ1 4OM8A 2K4EA 2IKQA 4A15A 3VZPA 3H1TA 1TC1A 5CK5A 2HLDA 2AHOA 2ODTX 3SBEA 5H80A 5CK4A 3A2MA 5TEVA 1A5TA 2C7RA 1CUXA 2FUG1 2KICA 2BKUA 3HKEA 4IIYA 1UM9B 3FWHA 4YAJA 1SKSA 5MDHA 1E2JA 3IAFA 2IHBA 1C3LA 1ZPDA 1Z9BA 1BU5A 3GAAA 5IU6A 2BR0A 4OUDA 3VR2D 5C5CA 4RHTA 3UOGA 2HQOA 4OHRA 3OO1A 3QP9A 1L5LA 3TW6A 1TAGA 5D01A 1F6WA 3FNGA 4UAGA 3GFPA 3HJBA 3RW9A 4O4IA 5JBQA 2GM3A 2B8EA 4I2CA 4IDCA 4UEQA 1IXYA 1SZDA 2ZRAA 3NC4A 3AOGA 1WKCA 3L6OO 4DS5A 3SV4A 2H65A 1LX7A 4FW8A 5HPYB 3ZQ6A 1YO6A 2XZPA 2OT3B 1ZP6A 4ANFA 1YAJA 4EYKA 1YU6A 1T2VA 1H5UA 2X6RA 1QAOA 3KZ1E 2ZEJA 3E48A 3O9ZA 2QUIA 2V6FA 3SJBA 3UEOA 5EFOA 3FYUA 4NP6A 4FINA 3C97A 3L7IA 1BDJA 4B40A 4Y67A 1UBMS 2K60A 5KTNA 2GYYA 1DI0A 2VUIB 4YREA 4KJZA 4M1YA 1AQ6A 1HT0A 5IRCD 4NV1A 3NYQA 4WJ3B 1W5BA 2Z9CA 2RAVA 4V0MA 1V11A 4M21A 4EMUA 2IZOA 4WOPA 3HL0A 4DNPA 3TCXB 4QUKA 9ATCA 1W96A 1H0RA 3C4JA 1KY4A 4E5UA 2KIWA 1P31A 1L5KA 5TGZA 5BQXA 1L4KA 3NTQA 3U48A 5DKFA 2GB4A 1NW3A 2KKVA 3KVNA 3QW4B 5AQ1A 2P4QA 4CL8A 4M38A 5LQCA 1ZU5A 2QRLA 3G6YA 3PTLA 3VISA 3C4QA 1LX6A 1BGVA 4TKUB 2WWTA 4LF7B 1N6NA 3FVWA 3VH4A 3ZS9A 3DCIA 3GV0A 2CHQA 3BHJA 5DP1A 2ADFA 4JT4A 3QA9A 4BEWA 2W03A 2X0DA 5K0ZA 4RLFA 3N2EA 7ICGA 4Q9LA 2CUKA 4DABA 3ES9A 3EZ2A 1VYHA 1US8A 3AF3A 2PZGA 1E7SA 2Y1LA 5F9NA 5C8VA 2A9JA 4B17A 1KA9H 2HPHA 3K1RB 5EL0A 2CNDA 3RFCA 1ZW1A 2F3RA 1ADGA 5A3VA 2NO1A 5M5BA 2O4CA 4CN9A 4NCAA 4BNVA 4E14A 3JVEA 3H19A 2QN7A 4GC9A 1XJ0A 4FEAA 5IXYA 3QLEA 4D9IA 4RFSA 4JBLA 4ZOCA 2OPHA 3PUZA 2HLDD 3GMDA 3Q2IA 1RWPA 1QQTA 1N1DA 1WDKA 3LQ4A 1Q20A 1M0SA 3W90A 2WB1C 3ZPXA 3DKVA 3TADC 4L08A 1KF0A 3KFUF 1TQDA 1V16B 1XZPA 5BMOA 1ISHA 2UUCB 4GXRA 2WNHA 3JSAA 3OOHA 3FMPB 1YBMA 1IN1A 1XV5A 3GUZA 1REQB 3UZUA 3M1IA 3JAKB 5CW1A 1HDGO 4D44A 1OWMA 4MUIA 2F62A 3DOUA 3NOQA 3OLZA 2WTXA 4BB9A 1X66A 4P22A 5G5HA 4WN9A 5KVAA 4G8JA 5DDYA 2RDMA 4ZMSA 4XB2A 5LBTA 4DMHA 3VX3A 5ILQA 2KIVA 4O3QA 3U26A 1U6IA 5K3SA 3EYWA 2HO4A 4EF4A 1QS0B 1UPXA 4BLRA 4ECYA 4Q6WA 1VKRA 3CBGA 1DAEA 2PVPA 2BGNA 2H9AA 2OZKA 1BDBA 2F8LA 5IAGA 1D8TA 2DQKA 3OQBA 3INYA 1XIVA 4R66A 4E22A 4EA6A 3SC2B 3H9GA 2C96A 2YS7A 3OCJA 3GZJA 1HEKA 4GL4A 4DV4B 2Y2UA 2O7SA 5HBRA 3KBOA 4PG5A 3LYUA 4UBCA 2ZAMA 3PEFA 4J0DA 4JD5A 3G0GA 4IQGA 2B69A 4P5PA 3DP7A 4WBXC 1JHRA 2MSCB 1CUSA 3PXGA 3AUXA 3G02A 4JSYA 3WGUA 1S96A 4DIFA 2ECFA 1N6HA 2UYYA 2Z04A 1QYXA 2H4JA 2Z1NA 4HQFA 2YL2A 2N46A 1HYGA 1UODA 3KSUA 1MRSA 2DQNB 4CGYA 2O3UA 1VLJA 2H3HA 2R85A 1SMKA 1WP9A 3NHLA 4HDMA 5C81A 2EKLA 4EQZA 4IH9A 4P93A 4NOMA 4JOSA 3RB4A 4HF7A 5BPCA 1K7CA 4MV0A 3AM9A 2IBTA 4DHWA 3OZRA 4OAPA 3G7SA 3L3BA 3F6YA 2YCBA 4MWZA 2IZ5A 5DG8A 2Z4SA 4OGKA 1TCBA 5IC6A 4K9OA 5JS1A 1QK4A 3IE2A 4MVCA 3T1HB 2DKFA 5SV2A 5CDTA 2DUUA 1ZC4A 1WXIA 1BPZA 4RQAA 1QRUA 1V85A 4FYHA 1K5OA 2AG6A 1PT5A 4I9GA 1NUPA 2BGGA 4TUYB 4D25A 1KVTA 1GQ2A 4DLXA 2FN8A 4HN9A 3W78A 1OJ7A 5ESXA 2X9LA 3GEGA 5FLEX 2XTZA 4BWVA 1KFEB 1TU3A 5CIYA 5EP2A 3PUYA 2UVWA 1Y6ZA 3PJGA 2HO5A 1KSHA 1IY2A 4JLPA 2CDRA 3BMXA 1Q0PA 3IX7A 3MC1A 1RM5A 4IDEA 2YDXA 1UDBA 4LNUA 3LSYA 3O7WA 2Q50A 3G0CA 4H1VA 3SWWA 5JAZA 4AROA 4WZAA 5IMSA 3RAEC 4JIMA 3P4UA 4CV0A 5ELXA 5EZYF 3T7CA 3K6KA 1NNSA 4EUEA 5IANA 5LLSA 4PN7A 1ZGHA 4YHHB 2PVCA 1NQ5A 5JFTA 2ZR0A 3FKJA 3KXPA 4BDTA 1SBNE 2Z2XA 4L5CA 3RO7A 4TXJA 1H38A 4UJ5A 1Q7RA 1W5FA 2DWPA 3N7TA 4R7TA 3B52X 4LG1A 1F2TB 3LK6A 5CT4A 4X6LA 4RV9A 2WM9B 5JY1A 5G4KA 1XQ1A 4O4HB 3BMOB 4GICA 2QQEA 1BPYA 3MB8A 4D3ZA 4O2BB 1AKVA 3WB9A 3WRVA 2G7MC 4A6XA 4FMCB 3PFFA 4MDYA 3DAPA 4L75A 3TFSA 3P96A 3U4GA 2AVNA 1RYZA 1L3BA 3M70A 4OOEA 2I29A 3D8TA 4EO9A 4FFRA 1TF2A 3V7FA 5ELLA 4W8OA 2BJHA 1RG6A 2F8KA 4MQFB 2VWHA 4DCSA 1DIBA 3HI6A 4C7KA 4W5OA 1AF7A 3EASA 4GWLA 4BYGA 4O33A 2P6PA 5BOLA 1A04A 4QPNA 1ZK4A 3C6YA 4XIIA 1I4EB 4NBSA 3RJGA 3L8MA 4F1WA 3EVAA 4DC9A 5ANRB 4M8NE 2FUEA 2B3TA 4C0AC 2ZDHA 4O2LA 1W4AA 5ISMA 2I2AA 2QTNA 2LKCA 1MIOA 4MVJE 3DNPA 5D51S 4JBIA 1SBHA 2FEWB 4DMRA 3ZHYA 3O4HA 5KAFU 1RFLA 1XK7A 3MGKA 4HNAB 4GPBA 4EF5A 1EGAA 5HS6A 1UXJA 2HJ9A 2I2FA 4DYDA 1N5LA 2ZE8A 4G9EA 3RH4A 1DL5A 5FWYB 2A35A 1K7SN 4L1KA 1XJWA 3KZKA 1NWHA 1B8PA 2ECPA 1WLSA 4N7MA 1FIUA 2B83A 3C1UA 5K3FA 3PEYA 1R6UA 2JIOA 4EFDA 1IB0A 4PINA 4OTZA 3QJYA 2C61A 2VBIA 5B30A 4ZCMA 3GB9A 3IFSA 1N33B 1SUSA 4C06A 1EDBA 2BH9A 1X8LA 1VHJA 3N76A 1U1CA 4OEHA 4KLDA 2Y92A 3KC2A 1NU6A 1RQRA 1TL7C 1NOMA 3JRWA 1JKIA 4W82A 4H1WA 3T7SA 1J09A 4B35A 4P0PB 1PFGA 2O7QA 1EQ2A 2Q9UA 1SVWA 3G6XA 4GH5A 4YT8A 2HV9A 2PD3A 5JYEA 2C5SA 1LI7A 3FI0A 2ZROA 4YRKA 2LPEA 3B82A 3P9SA 2KSOA 4Q4HA 4NECA 4I1YA 3F4LA 1IE3A 1E1DA 5SY9A 1GA1A 1TTQB 1UK6A 2QWXA 1KI2A 3NTRA 5JT1A 3PC7A 2P6MA 2EARA 4L2IB 3H16A 4N49A 1RZ3A 3ZN2A 2FR8C 2Q0ZX 1G5IA 1DBRA 2C31A 1G2IA 3EPLA 5J2UF 1Z3IX 5IAKA 1FYEA 5IAJA 4P3OA 5A5VA 1R15A 2YUIA 3BF7A 2WINI 1OYWA 3PSHA 2BFWA 2W8BA 1QDEA 4PRYA 1UFOA 1U99A 2GRUA 3PFKA 1ZN9A 4O2AB 3LZCA 4O3OA 1A2BA 1LW7A 4YRCA 1IUPA 1HQKA 3HYCA 2XUAA 3L49A 1XPRA 2LBPA 1OQAA 4MAMA 1G3UA 4WT7A 3KIPA 4NXMB 1U5BA 3T1TA 4U6NA 2P2GA 2J41A 4MTLA 4FZNA 1JMVA 3HACA 3IXMA 4N3AA 3MOSA 4QZAA 1FMCA 3K0CC 3VNSA 1XKLA 3MBIA 4KGZA 2Z4TA 5DYTA 4WLFA 4BMNA 3QTBA 4BEJA 1WDTA 1KBZA 4LJXA 3EZNA 3M6LA 2OGTA 4ILKA 3TZEA 2P40A 4LZLA 2JGLA 1QP8A 8ICFA 1JQBA 3VVBA 4C30A 2LVBA 2ESRA 2X86A 4AK9A 1X14A 4AJOA 5L1KA 4HUJA 2PO5A 1X9GA 3IXLA 3P20A 3EDCA 5LP6B 2ODEA 4J0CA 4EGAA 1DFGA 4F9EA 2W98A 3HVIA 3IVMA 2JAQA 3FCCA 3TZQA 2JZBB 5HUHA 1ECCA 6NULA 4M0PA 1LKYB 1M66A 1HNNA 2Q1XA 3UJ7A 4HQRA 4MUAA 3CUUA 2ZSIA 3G2PA 1NBWB 2C88A 2P9GA 3U19A 2AR7A 3GGPA 4KVFA 3RS9A 1JHPA 2VRNA 5FWXB 5F3WB 4F2GA 1AHIA 1OA1A 1YC5A 5LKRA 1AURA 4XGNA 2YXNA 5BVGA 3I0MA 1TA0A 3U4HA 1ID1A 5DM2A 3W5AA 1ORRA 4BNFA 4KQKA 821PA 3INNA 5MN6A 4FT2A 3GV7B 2WIDA 4GPAA 1T2UA 1H9CA 5KS2A 4BMCA 1A7JA 3A36A 4MFAA 1BN7A 3RSSA 2XB2A 3ZV4A 3NTUA 4ALIA 2GK7A 4DCVA 2K89A 2GBGA 2GO7A 1BVRA 1KFJB 5KFLA 1GUBA 5U1PA 5HKAA 4WK0B 3W9BA 3SF8A 4XPZA 5DF1A 3TW8B 3P2IA 3NWPA 4GI7A 1E3MA 3WGOA 4IQ0A 3GEPA 4NLGA 1E3LA 4YT4A 2QTVB 3RFVA 3EFHA 1XMVA 1KO1A 4ZCTA 5IUJC 2GH1A 4DF8A 4OHUA 1E59A 1KWGA 3Q9SA 2PAFA 1JR3A 5B6IA 4XYEA 1P29A 1GV1A 3OETA 4LHYA 5B1DA 3RFXA 1CEXA 4YALA 4D3FA 4DA6A 4FBGA 2ZTSA 3AU2A 3E7DA 4N03A 4Z4FA 2DSTA 3I30X 4OHXA 4YCMA 2VPTA 1TLFA 3WWPA 3ZU5A 3N28A 5IJZA 2IJGX 3EZLA 4N9WA 3AEUB 4K9LA 2Y0EA 4GBMA 3QFSA 4NARA 2VHCA 1B42A 4C21A 4RF4A 4MH0R 5ENDA 1G4UR 4QUEA 3BS5B 4NC9A 4XD7A 4EY7A 2BE9A 3HYNA 2D5IA 2C9DA 4IXDA 3DMTA 1KQQA 4JI3B 2PH1A 3MSCA 4RK7A 2VSOA 5AO9A 5T4BA 4A1FA 3KUCA 3T3HA 5DHAA 4ZYYA 3FRHA 4G89A 4GXTA 4UVHA 3FRIA 3ENWA 2CNOA 2RCYA 1ZVMA 2OB2A 1MHTA 2OZLA 3GQBB 4RQ8A 2Q1YA 3U39A 5T4EA 4PICA 4RAOA 5HQTA 1X7DA 3GH1A 3HB5X 1E6EA 1SC9A 4Q9KA 4PFSA 1DNPA 2V6JA 3BD6A 4O3FA 5MFZA 3VPDA 5BV2P 3OZUA 3PPWA 3QHPA 3UHJA 1MB4A 1VFPA 1MN6A 4E4TA 2CV1A 5AKXA 4CI9A 5G4LA 4Y9TA 1JX4A 4CUKA 3NEJA 3IOBA 5LXTA 1PSZA 1UP7A 2E6KA 5CA1B 3O84A 3AIKA 1JI3A 3PYLA 1BFKA 2J3KA 4YP1A 3HB4X 4RO0A 3QOFA 4A8JC 3EOZA 3EXG1 3U4QA 1F8YA 1O95C 4K8OA 2IS2A 4AMUA 3PU6A 4KRGA 5HA5A 2CNLA 1C9NA 4EB0A 1XZDA 3HM9A 1CC1S 1OLOA 1E9FA 1U11A 4CQMA 3GR6A 2CNWA 2IP4A 3LC0A 4LDJA 3GNTA 3EUB2 4RA6B 1AF4A 1FK8A 3TGWA 3BD8A 1M0TA 3GJ7A 3VZDA 4L9AA 4NSNA 4X63A 4WNAB 2D0OB 3O8RA 4U6PA 3AR6A 4CKEA 3CC8A 2CVQA 2ZIUB 3OZCA 4GZ6A 4KLGA 4FBTA 5CP8A 4O5CA 1LPNA 4YR7A 3RRYA 4WCFA 4JN6B 2FFHA 5MN4A 5KWVA 3KHSA 3WADA 4Q03A 5EIOA 3ELBA 2BPCA 3GVXA 3T3NA 2E5WA 4YONB 2VSNA 2PBFA 1QGZA 4B6SA 1AN0A 3IIMA 4EIWA 1JR3D 2R751 3OM9A 3WXMA 4LXXA 1GQOA 4LK2A 3ZHTA 5CU7A 3QKRB 4B9LA 2H2IA 5CRIA 2VZ9A 4AJLA 2Y1FA 2W58A 3QELB 1LC3A 5CDGA 2A1JA 3VU1A 2HHTA 1Z08A 3S4YA 2QJWA 4IQFA 2DBQA 1QK5A 4BFXA 1H65A 3T5AA 3ZD9A 3U09A 4N3NA 3PX2A 1LVUA 4WQMA 3G9XA 4H4EA 5L1JA 1TO1E 2W2LA 4IMJB 1ZIXA 4LZOA 5D87A 4C0KA 3FHCB 1FDVA 3DCYA 3TZHA 1QH1A 3GLIB 2PFKA 4XD7D 5DRYA 1JDBC 3IOEA 1RKUA 4FILA 4FONA 4QZEA 2D1YA 5EJ7A 3MGAA 3PKZA 1N48A 2PYIA 5KYNA 4RXUA 4YPVA 3GJSA 4J76A 2IA5A 4EL0A 1Q0RA 4P36A 4PYRA 3KYDB 2XTMA 4UU7A 3LUKA 4RMJA 2EBWA 3T9FA 2XGGA 1HDYA 3BMNA 2UYOA 4F06A 3OZIA 1CT9A 3O5AA 4PYOA 3L0ZA 2XWJI 4B45A 4YUXA 2FH5B 3TFOA 3BDAA 3LFUA 3JZAA 5CAEB 2VDNB 2HW3A 1E6LA 2D5AA 1SCBA 2V7QA 2AHOB 2RSLA 1YTLA 4N0QA 5BV8A 5L1LA 1FF9A 3PGA1 1JR6A 4BGVA 4ZI7F 4F97A 2B25A 4RPIA 3HKEB 4XYBA 3UV7A 3T7KA 4P4SA 4I1RA 4EI8A 3NIBA 4DIKA 1IAVA 4PXSA 4BWGA 1WOMA 1AKEA 2IEGA 3VI4B 5AKZA 3WMGA 5JY6A 4MXDA 5G2OA 5HIKA 1IOWA 1VBNA 4ZEXA 4D8TA 1NQWA 5K4LA 4NDNE 2MWMA 3WL5A 3DXZA 1E9EA 4CQMD 1J2EA 2CNWD 1J1UA 4Q7JB 2R1VB 5HFJA 4G41A 2WMOB 2EBHX 3Q10A 1JA9A 1CW2B 4GLLA 3VSCA 3M6FA 4D42A 2ZXIA 4EMSA 5HHTA 1AK2A 4ITRC 4JAVC 5FA6A 3A14A 4ECZA 4NYIR 4HDQB 3J81A 2J48A 2HBYA 5IIOA 2ZRKA 5FX2A 2Q7XA 3IOYA 1YK0A 4K9QA 4XGIA 3GD7A 5LZ2A 4MEYA 2XVMA 2W5UA 3FYUB 4QPCA 3TDKA 4S04A 1ZQIA 2Y1KA 1Y8ZA 4EATA 2DAPA 2VXBA 5G1NA 3QE2A 1UOPA 1GSHA 2V5UA 3QKIA 4MMYB 1JXQA 5GZ6A 1DXSA 4JR1A 1V11B 2BMEA 1L3IA 1K8ZB 2ECQA 3N07A 4TLCA 4XPIB 4I1VA 4ZVNA 2HA2A 1OX4B 1NMYA 2J46A 4M6WA 4P0TA 4DL7A 1XMQB 1GSIA 4M60A 3N8HA 3MS2A 3MTAA 3GUUA 2W2LD 4LRTB 4QIHA 4J07A 5IWCA 3MGBA 1GLNA 5KYVA 4BNLA 4GNRA 2NPOA 1M6EX 1UKVY 1RZRA 4E13A 3T1OA 3DDHA 4PLWA 1SXDA 1NJXA 1KDVA 1AKRA 3KBBA 4UB8U 3CVUA 2KPOA 3M34A 2RGYA 4DR1B 2E4ZA 1ZSNA 3BHIA 1FS6A 5KAPA 3AUFA 3HYRA 5CXXA 3W5HA 3HP4A 1VI5A 4EZ9A 3AIMA 1XDBA 2Q2WA 4PC2A 2Q3LA 2HSZA 4O4LB 4UTNA 4I1IA 2YIJA 1V95A 1XZMA 1R3UA 3JD2A 4R1OA 1I7PA 4ZTZB 1T1GA 3LGAA 5KOYA 1TPZA 1RU3A 1HOTA 1DDOA 4O02B 3EF3A 3DS8A 3TADA 4GOKA 4FZ5A 4RFSB 4D8YA 3R0QA 3FJOA 4NESA 2V7QD 3VU3A 3RIEA 2WDZA 3VPSA 2IHZA 3QVXA 4YUWA 4RGVA 5DB4A 1FPMA 2Z9BA 1U9CA 2C00A 4OQZA 3RIYA 1E6MA 2JIBA 4RW0A 3TKAA 1YC2A 3EXG2 1AUOA 2R6GA 2VQ6A 2G83A 3H5TA 3NVAA 5JAQA 1QZZA 2R8OA 4B4VA 3TTVA 2D74A 3L7BA 5DSZA 5IG2A 3H97A 3TJZA 3LP6A 3ZCPA 1Y1KE 2HDHA 3QH4A 4AF7A 4J2HA 3BJZA 1CUYA 5AFSA 1FNMA 3TTSA 1Z35A 3DPUA 4M1TA 5C8YF 1BU8A 2ZULA 2ZYAA 4WN9B 2P2ZA 3O2QB 3KOWA 4KHPB 4EYIB 1TJYA 1D4ZA 1HE8B 1D6MA 3ANMA 1XD9A 1M2KA 2ZYUX 4C8KA 2DY1A 4RFLA 4Q3OA 1E63A 2VXYA 1Q50A 1B43A 2YHUA 3BAFA 3D2AA 4ZGWA 3KXDA 5CBKA 4Z7JA 4G3XA 3KKMA 4JNKA 5FBHA 2DPYA 4E94A 5LD2C 5DGBA 1LBQA 3PQ2A 4Y9DA 4E1BA 1T35A 4OXQA 2L2QA 1EUCB 2F3PA 3EVBA 5HX7A 4N47A 1BQ3A 2SKCA 2VTEA 4GC5A 2LKYA 3K15A 2C42A 4RKWA 3JQ6A 2XB4A 4D3XA 4PNZA 3OJUA 3U2QA 4NLCA 1T5OA 3DYIA 2BCJQ 3IVGA 4Q47A 3OLYA 2D1FA 1G2PA 4YP7A 3COPA 4B7CA 3AJ8A 3HU2A 5LQUA 4BXOB 1P1IA 4CMIA 2Q3EA 4HDMB 3LUHA 1X1QA 1KFDA 1RZRD 4QHYA 1NPYA 4IUYA 1CJVC 1D9FA 1ZR4A 2SCUA 4O08A 4DA4A 2NSJA 3V4OA 3KD3A 4JUCA 3IKLA 1WXQA 5JV5A 2R0QC 1H2AS 3UXHA 3H83A 5FORA 3ZCVA 3LFHA 1VLBA 2B4QA 3PDWA 1KNXA 2YCLA 4JLOA 3OM8A 2AQIA 1I6MA 1XDDA 4YMOA 2I2WA 5REQA 3FLBA 5JH7A 2I1LA 1W73A 2EXXA 3VQTA 4KTVE 3B9PA 2VK4A 2JAPA 4U9IS 2IHUA 2EKPA 1M8JA 1BYUA 1UWVA 3DBOB 5JJIA 3ENQA 3F5QA 1QZTA 1WO8A 5BSRA 3L4KA 4G07A 1KOLA 3TNJA 2G5PA 3LL4A 3VC7A 2IDMA 1XDZA 2I33A 4E3WA 1JYSA 4NKRA 3JRXA 1OXMA 1O54A 5CLJA 2BKLA 4KIWA 5KFGA 3E1GA 5E4JA 2J9GA 4A6PA 2CE2X 2K7ZA 1F9EA 4DL3A 5AVTA 5CDYA 3GWGA 4LNUB 3IUJA 1XKXA 1VM6A 1W93A 3P4XA 3PRYA 2D7DA 1C0EA 5A9TA 4ZZIA 3TLGA 1LDGA 3L0IB 2KJQA 1KBQA 1CV2A 4NULA 1W2HA 3C3WA 4WZAB 3L9WA 1QF9A 3AQ4A 2QYOA 1LDMA 1KPIA 4M0EA 4I55B 2AFIA 4I1OA 3A4YA 1V7PC 2PL3A 1VSTA 1F3OA 3RRHA 4I6EA 2GN6A 5IVDA 4A2QA 5GPBA 3HFRA 3R3SA 5JU5A 5H3CA 4W9RA 1DJPA 4QWAA 4C0ZA 2XOXA 2H00A 1RYEA 1NX9A 3CR7A 5BN3A 3F9CA 1SUCA 1JN3A 2HSDA 3I01M 3OEYA 5I7RA 4FWTA 1JR3E 1WPXA 1GAQA 4R7GA 1EK0A 2V7GA 2M1ZA 4Z9YA 2JHGA 1EFRA 3PY8A 2Q0HA 1OYYA 1QBGA 3EIHA 3FBGA 4HJXA 2RGEA 3CE9A 4K2HA 4ND1A 5J40A 1R3DA 1JDPA 1IXSB 4HGZA 4HJRA 4LRYA 3TE7A 4BAUA 4EFMA 2MAXA 4PPNA 1JDVA 5FUYA 4MWGA 2PZJA 1ZQKA 1N9ZA 4J9QA 4KNVA 5JWRA 1IY1A 3RQIA 2Y8EA 2IYQA 1IL0A 4F6LA 1ACJA 4TS9A 4YP6A 2WSYB 2C29D 3RGGA 3AB8A 1ZYQA 2H0QA 5KFNA 1Q74A 3DC7A 1ZAYA 2FX3A 2ZP1A 4E30A 4YPOA 4BNKA 4XR9A 3DMTC 3RS4A 1P4HA 3H2SA 4YCAA 4UBMA 8ICXA 5K99A 2NZWA 3MHPA 1X86B 1W19A 3DE0X 4ENUA 5A3SA 4F5WA 3AESA 5L3SA 4MVJA 4P81A 3THVA 1I1OA 1E18A 1MIOB 2WHXA 4AYBC 4TQAA 4EX6A 2QJTA 1C3XA 4CJXA 3QFCA 1FRQA 3GC6A 1JDSA 3U13A 3UQ0A 4LYEA 3GCZA 1A27A 3EEFA 4ZVPA 5DHFA 3MD9A 3BZCA 3AY7A 5ETJA 2QTRA 5DHPA 3CW9A 1OROA 4PC6A 4KOEC 3GJQA 4DSNA 3PNMA 2XCLA 4OYLA 3R3HA 2WPDA 4ESEA 4EAQA 1TVKB 5IM4F 2NO5A 1U9LA 1AE1A 3P9PA 5K3FB 3T4UA 3LCJA 5J4KA 1Z82A 4QXPA 3AHJA 1JPJA 2CBXA 4LV8B 4K4HA 5ICGA 3T3GA 2WB4A 3SQDA 5B7QA 1FSZA 2VK2A 3C7KA 4BNNA 4ZVMA 3S2UA 2VIXA 4AI6A 1Y88A 2GNOA 4EYHB 2VFAA 1J2RA 2RHOA 4ETWA 3RPEA 4DVGA 2X22A 3HI4A 5JD3A 5I7FA 1NK7A 4WVFA 4URUR 5BQFA 1ZVJA 5EVJA 2OCXA 5GM2A 2DPIA 4NFSA 1B4DA 2WE7A 2Z6VA 3FWNA 1C3EA 2FFQA 1JPUA 3PFBA 1TJNA 1P7CA 3SZMA 2KSOB 1YXMA 4NBVA 4Q4HB 3QUBA 1BG6A 4P53A 4OYRA 2IBKA 2FR8A 1YUNA 2B9VA 1NK4A 5C46F 4R54A 4CIWA 3K2BA 5CVUA 1EP3B 3T3MB 4PJ0U 1LLDA 3ZWWA 2ZI6A 3IT2A 2WAOA 4DUZB 1IN6A 3RSHA 2QN3A 1MW9X 1NXOA 4INPA 3KAJA 1ISFA 3P4YA 2NZUG 1V96A 4HX9A 4CEIA 4GQAA 2CEKA 2BZ1A 2CLKB 2R97A 3UMVA 1K8YB 3A1CA 2IHJA 5CEHA 1Y82A 3TANA 1RAHA 2PWPA 4YK7A 1KERA 1EFRD 2C5LA 3JQCA 2AMVA 4UUOA 1MOQA 3QM1A 5CFRA 3T4XA 2C99A 4WACA 3FLEA 2O0LA 2YN4A 3C28A 4LBZA 3EZXA 5HKLA 1N2XA 4RK4A 4QWEA 1PO7A 1QH9A 4U1RA 3K0CA 3R7WA 1U5BB 5BNIA 3EDOA 1DQNA 2I3DA 4DJEC 3E03A 1B6TA 3DMYA 2C97A 2J3MA 3ZWVA 3WP1B 4UQLA 4PHHA 1EX6A 3A6ZA 3N8IA 3L01A 4HH1A 3K4HA 3MWLA 4ED0A 4QOGA 3O3CA 3AU8A 1KAEA 2IWRA 3KB6A 5DGIA 1WE2A 4DB4A 1XC7A 4B2PA 5IYZA 4C7JA 1S0MA 2HRBA 4MVJD 3V1KA 3DJFA 4KC0A 4KN9S 1PG5A 3Q88A 3HWWA 4MUHA 1SOVA 1D04A 3FUWA 4EPXA 2O0MA 3KKPA 3L40A 5CVEA 4DPMA 3P9IA 2ZB3A 3Q85A 2PSJA 1J24A 3PWSA 5K6TA 4KP7A 2JCGA 2JASA 4Y1RB 2JGIA 1DAGA 2WPDD 4E51A 2O7VA 1LKZA 3EEOA 1X0XA 3FR8A 4G0VA 4EG3A 1NW7A 2JEYA 1S97A 1CDOA 3L7OA 2EP5A 3ZW7A 3TQCA 4FMPA 2IY9A 2W22A 4PGAA 1IU9A 1DADA 5AW3A 3ZU4A 1RRKA 2DPHA 2YYYA 4HRAA 2BEKA 3LO5A 3KKZA 4DUGA 2OG2A 2WOJA 3ZLVA 1ZRHA 4BP3A 4FE7A 5I6DA 5LLTA 1XCPA 2WP8J 2REOA 4XQ9A 1JJAA 1MC8A 3U3OA 5M29A 3EMBA 3P2JA 4QGHA 3E82A 4WKNA 3RWBA 3CX4A 1OGJA 3ZVRA 1RQ7A 2YWHA 3F5DA 3SX4A 2LM1A 2GF0A 4MRMA 1LDYA 1ODFA 3EMDA 3WGQA 4PCAA 3DMRA 1ZMOA 1YRQA 4GP9A 2VC2B 1FLVA 1K2VN 4LDNA 2FW8A 4PQEA 3WLEA 3LA8A 4BNXA 1ONBA 4QRDA 1VFNA 4AZSA 1E7MA 1G16A 1DK2A 5LYJA 5KHLB 1Q7CA 3RT9A 1E1MA 1TZBA 1YT3A 5IC5A 2EFEB 1G6KA 5LJLA 2GCEA 1NQVA 4RE5A 3LDFA 3HY3A 1HDCA 2HXGA 4IOMA 1SHTX 4TTJA 4MGIR 5GJWC 3WO1A 2X0IA 3VZQA 3UH1A 2FW1A 2BM8A 1I4LD 4US0R 4LYFA 2E5FA 3U3DA 2YJ4A 5E2IA 1CY2A 1USIA 1XKTA 4PZUA 1KTQA 5LBUA 4B3MB 2B20A 4DV7B 5IWAB 4Y0AA 2MR5A 2ZE6A 1P77A 1IJBA 1WZIA 4BNZA 1E2LA 1RLTA 3MWGA 4WXHA 3MTJA 1ZRSA 3PX0A 2JMGA 4W7HA 2BUCA 7ICVA 1J2MA 1L5GB 5DK4A 3ECSA 3HWX1 4Q1AA 1PSDA 4AL4A 4WLNA 1M2OA 2XI9A 1GT6A 1ZK1A 5KKCA 5ULLA 3TI9A 4KLJA 1M6HA 2FPOA 3WK4A 2QXUA 2ERXA 2BGLA 3KHLA 2XQGA 3LGXA 3KELA 2JLBA 1CETA 4PPFA 2O2HA 3KHUA 4MLDA 3RSLA 2OZLB 3QBTA 4ZYTA 4B83A 2OHXA 1KKXA 4Z3OA 4HZIA 4I9NA 4GRIA 4BZWA 4QKQA 3W5DA 4KJXA 3CPHA 3EEQA 3NKVA 2GZ1A 3EF1A 1MFPA 4ZGGA 1ZIOA 1P7WA 1E2UA 3RVQA 3GLUA 3FOEC 3ABSB 3WK9A 5JAUA 3E9RA 1HM5A 1P0PA 2BZSA 4OK6A 1Y4DE 2HREA 5JXJA 3WXBA 3KL4A 4A8JA 4FQ7A 5DGCA 3ZUPA 3Q6IA 2GPYA 5EQDA 5L4SA 1HQYE 3H2ZA 3FDFA 5LXTB 1O95A 3V97A 3B1KA 3NEPX 2I4TA 3KKEA 1VL1A 3U5TA 4Q9HA 4TV9F 1X15A 5CJ7A 3KT8A 2BGWA 1PFYA 1TT5A 2WTAA 5LQKA 3U4QB 4MRAA 1SA0B 1W9HA 3RC7A 4OOFA 2HF2A 3QNMA 2Z2ZA 2QU7A 3AEVA 2DY0A 1T3TA 3GFBA 1SG6A 2QTWB 4COOA 4CQMB 4Y7CA 4DUGD 3IKTA 1BIFA 1G291 1NONA 1IZYA 4MV3A 2WIJA 3C15C 4E5VA 1Z22A 1GV0A 2W4IA 1P73A 4O1IA 5KQSA 2ONCA 4OL0A 4BU1A 3OJLA 1I13A 1W4CA 4HMQA 5DNDA 1H94A 4ZDWA 1FQOA 4CKEB 5IAEA 2HIMA 2YXBA 5FWNA 1T3LA 1SKRA 1LZLA 2C4KA 2D3TA 4P8RA 1G1AA 4WCFB 5CCEA 5IBQA 1J21A 3FFTA 5BSEA 3CPJB 2H7XA 1WR8A 4PLPA 3R41A 2I54A 1Y7LA 3H6KA 1FRZA 3FROA 2UV8A 2PXCA 3BRCA 5BY2A 4O5OA 2LM4A 2PYDA