1X42A

Crystal structure of a haloacid dehalogenase family protein (ph0459) from pyrococcus horikoshii ot3
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDFVGTLLSVEGEAKTHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPIRDIEEEVMRKLAEKYGFKYPENFWEIHLRMHQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PH0459
publication title Crystal structure of the probable haloacid dehalogenase PH0459 from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 85
structure length 230
sequence length 230
ec nomenclature ec 3.8.1.-:
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1x42A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1x42A01
2YMLA 5AK3A 3NALA 1VFPA 4HGQA 5AI5A 3QUQA 3AR4A 3ESQA 5AW8A 3UMBA 4J2TA 3I76A 4BX0A 4BKMA 3W5AA 4F72A 2HEGA 2YJ5A 4MWOA 2YFYA 1XP5A 3OTQA 1WVIA 1Z88A 2HX1A 3L8FA 1ZRMA 3UMGA 4L6CA 3PCTA 2HCFA 3B9RA 1WZCA 2FPUA 3SKXA 2PKEA 4J03A 1SWWA 1RKQA 2HF7A 3ZWKA 2EAUA 2I34A 2B8EA 2OBBA 5ALWA 1ZRNA 1J97A 2C4NA 2OYCA 4ZEXA 5AI4A 3NANA 1QYIA 5AW0A 1CR6A 1Y8AA 2CFTA 4KN8A 3N1UA 3SF0A 2WF7A 1AQ6A 3NIWA 5AVXA 3TLMA 5AVTA 4ZEWA 4BNDB 4IFTA 5AK6A 5AVZA 1TE2A 5ALKA 3GYGA 3MMZA 1QH9A 5AVSA 3R4CA 3R9KA 1QQ7A 1MH9A 2ZG6A 3AR7A 3FZQA 5AM5A 1ZD4A 3DV9A 4UW9A 1NNLA 2NYVA 2RB5A 4RESA 2WF9A 5ALOA 4CF5A 5AKJA 4IG4A 4UAUA 4DCCA 3DAOA 3U7HB 4E88A 3A1EA 1ZD3A 1ZD2P 5AK5A 2HDOA 2C8LA 2P11A 1VJ5A 3E58A 1RKVA 3PGLA 4AS2A 4EX6A 1YS9A 3CZ4A 4L57A 5AW3A 4YGYA 5AKGA 3QU5A 3WGVA 2JAWA 5AW1A 2ODAA 3NAMA 2R8YA 2B1QA 2C8KA 4YIKA 3L0BA 4BX3A 3KC2A 4CE6A 4EX7A 1L8LA 4OD0A 1NRWA 2FDRA 4F71A 3NRJA 2CN1A 3EWIA 5AW4A 5IT4A 5AI6A 2JAOA 2YMPA 2QYHA 3QNMA 3I28A 3KOOA 2BDUA 3J7TA 3AR6A 3U19A 5ALUA 1JUDA 2I7DA 1XPJA 5AESA 3WKAA 2YJ6A 3WK7A 2R8EA 4UATA 4GIBA 5AVVA 3L7YA 1KYTA 4KX5A 3QX7A 2IOHA 2JGAA 4HGPA 2B82A 3L1UA 3AR3A 1F5SA 1ZJJA 3QU7A 3QU9A 3WKEA 3BA6A 2GHTA 4BBJA 2JARA 3EF1A 2G80A 3FPBA 1LVHA 2WF6A 1YJ5A 3AR9A 3WK9A 3QUTA 1YMQA 4UARA 4Y2YA 2RAVA 5A3QA 2G07A 3SLRA 3L8GA 5AM0A 4CF4A 3ZVMA 4L6AA 1L8OA 1N8NA 4BEWA 2RARA 2R8XA 4Y2SA 4FYPA 3OCUA 4Y2UA 1LTQA 2ZOSA 3WKBA 1RLMA 4AP9A 4NAVA 3NASA 3NUQA 3CNHA 2YJ3A 4UU0A 2W43A 3OPXA 4PNHA 5AKKA 4FE3A 2QLTA 5AW6A 3W5DA 4BYGA 4UMDA 3I1YA 5ALNA 2Q5EA 3HLTA 5AKXA 3E8MA 3ZU6A 2OA0A 3N5KA 4BNDA 5ALFA 3EPRA 3U13A 3ED5A 4QQFA 3QLEA 1XVIA 4ZEVA 2YJ4A 2I55A 3S6JA 4G63A 3N28A 3ZX4A 1YDFA 5AVYA 3ESRA 4OCZA 2DQSA 2GO7A 2I33A 2YY6A 3L8EA 5AM3A 2C88A 2WFAA 5AW2A 5AK4A 2AGVA 1FEZA 1Z4OA 5ALMA 4OFZA 2ZBDA 1RRCA 3FVVA 2B1RA 3OCWA 3ET4A 3L8HA 2ZBFA 2FI1A 1RLTA 4UMEA 3M9LA 1Z5UA 2YBDA 5ALQA 2IOFA 2Q4RA 5AI8A 2HSZA 3M1YA 4BEVA 3WK4A 4UU1A 3W5CA 4UMFA 2CFRA 2G06A 4Y2TA 1TA0A 1Z4MA 1L7MA 3OCXA 1EK1A 1SU4A 2G0AA 5AM1A 3ZI4A 4KNWA 3KDPA 2PR7A 3L0CA 3QXGA 3IB6A 3UMCA 3QUCA 4UMVA 2AUTA 3QUBA 4XPZA 4HGNA 3FM9A 4EELA 3ZW7A 5AKEA 4BX2A 4DWOA 4C4SA 5AKZA 5AIAA 3QU2A 2P69A 5AI0A 2W4MA 3SKYA 4O8CA 4HYTA 1L7NA 2GFHA 5ALRA 5AW7A 5AVQA 5ALYA 1EK2A 3BWVA 3U7EB 3OCVA 4GXTA 2I54A 5E0OA 1N9KA 2ZXEA 2HOQA 5ALJA 1WPGA 3WK5A 1Z4JA 3U7GA 4Y2XA 2B30A 5ALEA 1ZOLA 1RQLA 5ALXA 1Z4LA 3DNPA 1SWVA 1TJ5A 1QQ6A 2WF8A 3F9RA 1IWOA 5AW9A 4UASA 3ET5A 4UM5A 2P9JA 2ZBGA 3N07A 2CFSA 4HGRA 1U02A 2GHQA 1T5TA 3EF0A 3FPSA 3ZTWA 3AR5A 3AR8A 1L6RA 3PDWA 4XE5A 4HAIA 3QU4A 4NABA 1U2SA 2I6XA 4I9FA 1ZS9A 2B0CA 2NO5A 3ZUPA 1Z4PX 2AH5A 2MU1A 5AVWA 1NF2A 3IRUA 1TJ3A 4C4TA 3ZWDA 5AI9A 5AKLA 3MPOA 2PQ0A 1U2TA 5ALIA 3QYPA 5FP0A 4FFDA 1VJRA 2FEAA 5AIBA 3PGVA 3A1CA 4UAVA 2P27A 3HYCA 2MU2A 4NFLA 1YV9A 4XOUA 3SHQA 5ALZA 3ZTYA 3OCZA 5A3SA 4HGOA 4CF3A 5AKHA 3N8GA 1U7OA 4YCLA 4B6JA 2B8JA 3A1DA 2D2VA 2C9MA 2HI0A 5AW5A 2O2XA 2FPWA 1RLOA 3B9BA 2AMYA 5AKIA 4Y2RA 5AVRA 1RMYA 1QQ5A 2WF5A 3B8EA 3QGMA 3MC1A 4Y3UA 5ALGA 2Q4TA 3KZXA 2EATA 1O03A 3AR2A 3RF6A 3L1VA 2MSNA 3DDHA 2HF2A 2RBKA 3W5BA 4YIHA 2WM8A 4JB3A 2ZBEA 5AHXA 5ALSA 4G9BA 3MN1A 1K1EA 1TJ4A 1Z4IA 3SMVA 3WGUA 1T9ZA 4OHFA 1RMQA 2G08A 4KYTA 1L7OA 4UM7A 5ALLA 4EEKA 3WKCA 2YMMA 4YCMA 1RMTA 3L5KA 1J8DA 3I6BA 4DFDA 1T5SA 4NV0A 3WK6A 4Y2QA 1Q92A 5ALDA 4YH1A 2JAUA 4NWIA 5ALHA 3WK8A 2BY4A 5AM2A 3VAYA 1S2OA 2YMQA 5JJBA 1ZD5A 4C4RA 1X42A 4KX3A 1RQNA 3L0YA 2VKQA 1O08A 1Z4KA 2FUEA 5IT0A 4Y2VA 2FUCA 4XQ0A 5T41A 3U26A 2X4DA 4EZEA 2NO4A 2O9JA 3E84A 1PW5A 3P96A 4Y2PA 1RKUA 3KBBA 2IYEA 1S8OA 3UM9A 2FPRA 4MUMA 5ALVA 4RETA 4KNVA 1YNSA 2EARA 2FPSA 3ZVLA 1RPZA 3E81A 2IOFK 2YN4A 1Z5GA 3ONNA 1Q91A 2BDEA 4JDPA 2GMWA 1U7PA 5A3RA 3K1ZA 5ALPA 2HO4A 2FPXA 3KD3A 5AM4A 1Z4QA 2WHEA 4Y2JA 2G1AA 3ZX5A 2G09A 3R09A 1Z4NA 1RDFA 3OCYA 4H1WA 2W11A 3RFUA 3WKDA 5AVUA 5IS2A 3D6JA 1CQZA 4QJBA 3SD7A 2R8ZA 3IJ5A 2OM6A 3FGOA 4YCNA 4I9GA 1L7PA 3ZVNA 2HHLA 4AS3A 1RC8A 4CNQA 5ALTA 1WR8A 4EENA 4DW8A 2IA5A 5AICA 5AKYA 3A3YA 3U7FB
chains in the Genus database with same CATH superfamily
4P4LA 4TL6A 3VX3A 1E1CB 4J9KA 4RQAA 1C2YA 1CFJA 5KJFA 1Q8KA 4QUAA 3EGCA 1Y33E 3ZOZA 2UVQA 4TSRA 3ZWKA 5D51S 1T8WA 3CEHA 5E3HA 4ZYZA 3E9CA 1AD2A 2W2TA 2CBGA 2W3SA 9ICRA 2YHBA 4BPRA 3FKSA 1DB3A 3PUJA 3TLMA 2OZLA 5TJ9A 3RRYA 2KSOB 1YCGA 4ZYUA 2QGFA 5EWMA 2MRLA 2XZTA 1UBEA 1J09A 2WU4A 4DEXA 1GARA 2SKCA 2IH2A 1YS9A 3NAMA 4XEUA 1R3UA 2QLBA 4WIAA 1AKVA 1GCGA 1G3MA 1GHTA 5LJIA 3IJRA 1BVRA 1JUDA 1II9A 1KVRA 3WQBA 1JBQA 5BSFA 3BAZA 2B82A 2E5SA 5LQAA 1VLHA 1C80A 4KMOB 3EEFA 2Z5VA 1P2VA 1A7AA 1A9QA 1B93A 5BNIA 3JQDA 4FONA 4EJMA 2QLTA 1IBLB 1F4PA 2W2KA 4E6EA 1FDVA 2E7ZA 1LLQA 3TI7A 3D6UA 4GZ3A 1EJBA 4MWZA 3UZUA 4NBKA 4JLBA 4S1NA 4MVYA 4XEHA 3FYSA 4G63A 1A2OA 1ZD1A 4JKYA 4KQ9A 2DQSA 1G3RA 3L77A 2GPAA 5FI5A 2PG3A 2AGVA 1Z4OA 3S27A 2ZATA 4YS6A 4U7FA 3ZN2A 3RTAA 2W6OA 5EAIA 4CCYA 2HSZA 3B6ZA 4LG1A 3EXFB 3PKJA 4YR9A 4FOPA 2G5PA 4YT5A 1PU2A 5JHGB 2IPOA 3C3BA 2DFNA 4UUPA 4YDSA 1Y1PA 4YYEA 4KLAA 2YFQA 3ILXA 3GXOA 2BDTA 3A1UA 1V6AA 2G9ZA 3BN3A 1X7YA 2PXHA 5JZOA 1I1QB 3U7EB 1A9YA 4LBVA 1WNFA 5TIIA 3BCUA 4YD1A 1A5SB 5ULLA 3BB3A 1WPGA 4IYRA 1RQLA 4PTLA 3T9BA 4OIFA 3TOXA 1WP9A 3LW7A 4GOLD 2OORA 3GT4A 3E3MA 3G9UA 2HBMA 4NLZA 1QGAA 2NO5A 2GEBA 3KQQA 1QJCA 1FB5A 3X1KA 4PW0A 3AM9A 1P0PA 2WZQA 4M0UA 5JECA 3JARA 4TRNA 3WNZA 2JFXA 4J49A 1HDXA 1JKJB 4XCVA 1B4FA 3CS3A 1MMFB 4C06A 1D4AA 2BFCA 3JQPA 3VC3A 4YK7A 2QZ9A 2K89A 5FKJA 2WTUA 5HFNA 4X61A 4QJ5A 6AT1A 4IGIA 2GHRA 2IQIA 2NG1A 1L9KA 2PTGA 2Z4RA 5JSFA 3D5QA 1YSCA 3PNLA 2HWUA 1ECGA 2OTCA 1NQWA 1DAEA 4RCZA 4JXZA 3K73O 4A5OA 5KTMA 4KRXA 1DJQA 4UBKA 3H04A 1ZBQA 2NU6B 1Y3AA 4WJLA 4KDFA 4B3RB 5F3XB 2ZJYA 4FGZA 4CKEA 5I4CA 3IQDB 4NJEB 3DWEX 4XIJA 3F46A 1WXEA 2FY8A 5HF9A 4MGHA 1BG6A 4BAUA 1WWVA 4NATA 1Z6AA 4KPYA 5EJIA 2XUDA 1ZI6A 2WAQF 4CLOA 4N39A 4DSLA 2Z08A 1ZNXA 3I5MA 1EQAA 4PZ0A 3A9WA 8ABPA 3EIXA 4MR9B 4CODB 2OHHA 1NV8A 3JYPA 3I45A 2DKXA 2VP3A 5IN5A 1AHIA 1VE6A 4XR4A 1ONOA 3OZFA 1FFAA 2V7UA 4QW8A 7ICSA 3PXXA 1B7GO 2CHGA 5BN4B 2Y9UA 1IPHA 2FKNA 1W4AA 4F3NA 4GOND 5C8DA 2XDQB 2VIXA 4IIVA 4LJRA 3HO8A 4BLVA 1L6IA 2H1RA 5DN6A 4B7UA 3GD7A 1LJUA 3D3QA 2YJZA 2GASA 2BJHA 4RESA 2QIPA 1QSYA 2FWMX 4DEZA 4EVQA 1YB5A 4CXMA 3I12A 3PGLA 1ZJ6A 3ESXA 3P2IA 3SBOA 4UTRA 3O8CA 4MKIA 5B4TA 4I3GA 4C8NA 2W2XA 2IBSA 3AMVA 4AO8A 1BXRA 2TS1A 1D8AA 4RJKA 1ZD8A 3CPEA 1SXQA 3F2IA 1FP1D 1C4KA 3NH6A 5IZCA 3HBAA 4GMHA 3HB5X 3QU7A 5JVDF 4TV9A 1JJ7A 5LXTB 2JDIA 1IHYA 2NVBA 3BREA 1MA3A 5IP5A 3VKVA 4O33A 3VH4A 2XUZA 1CS0B 4L6AA 3H9JA 2VOEA 3KKEA 1GRCA 2HU7A 4ED6A 3BMOA 3ZU5A 3W78A 3PW5A 2R8PA 2EX4A 2SICE 4O29A 5FFNA 3I1YA 1QVVA 1V1MB 4XIYA 3TIIA 2RHMA 1EVLA 2OA0A 3QFCA 3TRJA 4KOAA 3IAXA 3R9IA 1OU4A 4KFTA 3GFRA 2XY7A 1NYTA 2FHSA 4Q93A 4WBSA 3DT8A 3TQRA 4RK0A 1N2CB 1N1GA 2GK7A 2W9XA 3B70A 5AVOA 1IE3A 4HK4A 4GL2A 1PK9A 4U7DA 1P3JA 1GSHA 3GH1A 4RTOA 3OF5A 2ZS8A 4ZC1A 1AKRA 3WDSA 4MPDA 1SVOA 4G5SA 5DXFA 4PGYA 5ADHA 3WR5A 3VNVA 3WL8A 5KT4A 4WN9B 5EXXA 2HRZA 1V1RB 3JQ6A 3EJ6A 1KTVA 2EFCB 2F7SA 1ISIA 3KZMA 3NDJA 3FYDA 2EHDA 3ROFA 1JXQA 5DP1A 2ORED 1SVSA 2FA9A 3WWDA 2WVGA 5H5JA 1S76D 3B3GA 3VAZA 1E3DA 4UAGA 3DE3X 2EDAA 2O1XA 4DC1A 5FNVA 4F3KA 4E1VA 1T0IA 4YPOA 1EIZA 1WD7A 5LOVA 3CLRD 2GLEA 5IIIA 2QKYA 4KHZA 1JFTA 4FHZA 3RGGA 3MGVA 4N4AA 4DF4A 2WYVA 4DVJA 5BXYA 3P9QA 3G9ZA 3PSHA 5FDFA 4GSKA 3QG1A 2JZCA 4F5YA 3WB2A 1P5ZB 2UZ0A 3W7BA 3L1KA 121PA 3RKRA 1XJWA 5CMLA 2D2VA 3KKKA 2ZI9A 3MHTA 1O94C 1PK8A 3PZBA 4PBRA 5BN5B 4EJFA 3DTNA 3DMNA 3Q3HA 1N4DA 5KTNA 5DYYA 2GUWA 3BZBA 4GFJA 1O0SA 3L6CA 5F2KA 1XP8A 4OK3A 2DM6A 1VMIA 5B4VA 1J56A 5KQGA 1G17A 2XWPA 4BQNA 1N3BA 1NXOA 1CE8A 1QYVA 3K15A 1KJ9A 4KGVA 1EGAA 4ND1A 4ZYYA 1BFUA 3UAGA 4PPGA 3K0CC 3LUFA 4GRAA 3X1WA 2X8JB 2DJIA 1DAMA 2H3ZA 4YA6A 3HUTA 3KBBA 3RYHB 5LQRA 4I3HA 3V1YA 1NR1A 2QU8A 5CG1A 1DMRA 4MW1A 1MW8X 4L3OA 4J29A 1ZN2A 4PYJA 2A0YA 4OOFA 2H5JA 4E03A 1QE3A 4QEZA 3KD3A 4I2EA 1RZRD 3OO0A 5E7IA 1J2TA 4RIGA 4X6LA 5AYVA 1RYDA 2PMBA 1MO6A 1X6JA 4JJ6A 4G0MA 1FYDA 2HHLA 1JAZA 4KUGA 2XYRA 5EP1A 3EUFA 4QPDA 2HIGA 3MJTA 1JEYB 1TIPA 1MX5A 3NIDB 4BP3A 5CBPB 4QBTA 1SC1A 2G83A 2ACEA 1HRDA 1PP4A 3RUEA 5KFSA 2V7GA 1I94B 4HEA1 1AUXA 5CX1B 1E6KA 2DB3A 4OQXA 3O31A 2X0NA 2X0IA 3JSAA 2O19A 3JQAA 2P2LA 1W46A 4KQ6A 2DULA 4ND4A 5EWEA 1GDTA 1QMGA 3U3DA 4KO1S 1CQIB 3S5JA 4YUWA 4NK4A 2ZDHA 3RFXA 1CLEA 3M9XA 4ECEA 5EEHA 1L8LA 2FLNA 3ROXA 3NT2A 1XZDA 4KU4A 3PGXA 1HLPA 3RC1A 3SEIA 3R7WA 3KFUF 3KYBA 1F14A 3JWJA 3I42A 4CTKA 2OUIA 1SU8A 1GN8A 3JQRA 3QWAA 2VUUA 4Q3KA 1XLUA 2W37A 4IRMA 5E7MA 3I5XA 4NYIR 1S3GA 3W5DA 2KN7A 4IDCA 2JAHA 2LV8A 4S1WA 4B32A 2AE1A 3QEOA 5AKXA 4O2LA 3C39A 3L8ZA 2JMGA 2RH8A 4MCHA 4JX8A 3S7ZA 3WV5A 3TACB 3JQCA 2BSAA 5KFFA 4OAOA 4ND5A 4CWAA 2ZSFA 1P5JA 1VI5A 3LBAA 4CM4B 1Z5UA 3DWFA 4ADSG 4O25A 1HDRA 4ED2A 4PC2A 3W5CA 1ATIA 3TVTA 4IJWA 4ZOEA 1A0OA 4WK4B 2PLNA 2FUNB 1D8YA 3OUZA 5IWAB 5LP6B 3E03A 4RU9A 1VC2A 3UYKA 4BXOB 2MJLA 2YVUA 4BEBA 1KZ9A 4HLCA 2A30A 3I9FA 1DUIA 4AKHA 1SA0B 2ODPA 1MQ3A 3KE9A 4Q9NA 3KTDA 2HRCA 5KVQA 3UMFA 3OF3A 5F35A 3IUPA 4DLVA 1N2ZA 4GPBA 1O6GA 3DKRA 2OQVA 5KQMA 3M7IA 2ZJ7A 2PV0A 3PDWA 3FTFA 5B12A 1AURA 4ENPA 1Q12A 4LX0A 5C4MA 2ZE5A 2XDAA 3UFBA 3T41A 2NXEA 1D8BA 4LTNA 1FRNA 3PTLA 2AFIB 1SZDA 2YV1A 1B22A 2OAQ1 4IDGA 2O2GA 1LDYA 4YRAA 5KSWB 5F3DA 3VHQA 1G8KA 2E37A 4JITA 4DA7A 4ELTA 4E15A 2R65A 2MYTA 4J4HA 4MV7A 2NM0A 4F4CA 3RF6A 1E8MA 2V1UA 4NBRA 3EZXA 2QT9A 3P2EA 3IQIX 3LHDA 3Q7QA 4CIWA 5EJ6A 4QM6A 4FEAA 3LFTA 3GF4A 3L8MA 4IH9A 4F1WA 3SZMA 3I9V1 5BT9A 1JXEA 4OBWA 4DJDC 3HV0A 3ZDDA 5TS3A 3Q0TA 1YB1A 2QJTA 3RW9A 2Z5LA 3GPCA 4GR4A 3PR4A 1FSZA 5A9SB 2V5VA 4RQTA 1SU6A 4US2R 2ZYHA 5ITSA 3A8TA 3PQ6A 3V4PB 4RVOA 5FBWB 2VTKA 2EBWA 3II6X 1XDDA 3PGJA 3T3HA 3SQNA 4Q4JA 3BBLA 1VZ2A 2HJWA 1KDYA 3TZKA 2QUZA 2J3LA 5CR0A 1H2XA 4A8JC 2W6ID 3NS1A 1IEXA 4EYGA 5G0VA 4AMGA 1ZSNA 1OMOA 2E9SA 4GD3Q 1U2EA 2NZUG 3OECA 5EMKA 3UPQA 3T12A 3AONB 3UC5A 1D4OA 3ER8A 3KAJA 4JEUA 3SJAA 1GQYA 5IIOA 1U0FA 2FWPA 4NEGA 3L7IA 4BKMA 3A9CA 7ICVA 4C0SA 3S81A 2B21A 2PSSA 2WFLA 1UPCA 1J99A 3EHEA 5EY5B 2C3PA 3T9CA 3ZHSA 1TQHA 4OJQA 3JQ8A 3VJMA 4KI7A 4MJ3A 3I1IA 4CIXA 1E66A 1YUNA 3F6PA 1U90A 1LD3A 3WLRA 3CIFA 4XSHA 4KIGA 4Q15A 4LXHA 4E88A 4TXHA 1FS6A 5TY0A 3EFOA 4OHYA 5HXAA 3E7DA 8ICKA 1X38A 2W6PA 1WXHA 4P92A 2E1PA 3THXA 2O0LA 3ZY2A 1Y4AE 3THOA 2QB0B 2CFCA 2EJWA 1IMOA 3C74A 4X1KA 4X6XA 2QX9A 5J5AA 3ZY6A 5AESA 3KZVA 3N8KA 1J1IA 1OV6A 3R5HA 1QGUB 3DEEA 3C2LA 4FCVA 8ICYA 1XAIA 4IUCS 5JNWA 3TDNA 4OQYA 5BYJA 2JI6A 2DY1A 1J2JA 3WWYA 1Z13A 1XPRA 5LMZA 3QUAA 1X77A 4BJ3A 4ZAFA 1HIWA 2B4AA 4C7XA 2IP2A 2P40A 2W4IA 4DDWA 4QZ9A 4CM9A 3I23A 5L3SB 1M2KA 3HEAA 3S4YA 4N18A 3WB1A 2QP3A 3CRZA 1E9CA 4TWJA 5BSKA 4QUEA 4DREA 1RW4A 1RP1A 5EMNA 5B6IA 5I4BA 3K31A 4UTZA 7ICQA 4KBGA 3DDCA 3FWNA 1RLTA 4V0QA 1ZC4A 5ALQA 1H5QA 1IIPA 2QJFA 4RELA 5KT3A 4ZOLA 4RY2A 4OJTA 4ZOBA 3A3KA 2DU8A 1TYDE 2AOXA 4WD3A 3OT5A 2Q7XA 3V8QA 3GLGB 3K70C 3BDPA 2AXQA 3HMKA 2D7CA 4UEWA 3FDZB 1QFYA 3H99A 4QREA 1U5BB 5DLPA 1DRJA 2JGIA 4GPTA 1SB9A 2BCRA 4H15A 3NWBA 5IJ0B 3JQQA 3PRKE 5MFZA 1H3EA 5FI0B 1UANA 2C2HA 1S97A 3FWPA 4ZDJA 4OVKA 3T3MB 3VVLA 4I5EA 4KQJA 4A6EA 3R0JA 3DHNA 2WJ6A 4R2MA 4E07A 1ZO8A 3C3JA 1PN3A 1XFDA 2QLLA 1QHYA 1K3TA 5FTLA 4TLBA 3IXQA 1NBAA 2RLTA 1V39A 3NBYC 5GV8A 1LPSA 1S0VA 2GFQA 3RGWS 3EGWA 3V6MA 1T5OA 2OLEA 4MLCA 5MN4A 4GWLA 3IQEA 3HP7A 4NFLA 3I2IA 3I6ZA 4HVLA 1WB9A 3QIVA 4CKXA 2Q9CA 2PSHA 1MFZA 2GWRA 4O4JF 1USIA 3GLKA 3Q1KA 1Y8RA 1I6LA 2ECFA 3D2SA 1G3QA 1IZ8A 4DXHA 3KHLA 4OHFA 4AT1A 4KYTA 4NM1A 3RRNA 5FUBA 5EG5A 2GWSA 3AHEA 3TFWA 4EEZA 2MINB 3INYA 3RAFC 3TTSA 3HVUA 1MIOA 4HB2A 5F77A 1AVTA 3TGPA 3ME5A 4R98A 2HMUA 5EJFA 1IUKA 2A9VA 4F8YA 1D6MA 1E5VA 3AUTA 1HEYA 1M73E 2C0PA 3R5SA 5HKKD 1JSCA 5CA7A 4EKNB 2YVKA 2D6FC 3OO1A 5FWXB 5KU7A 5LQUA 4LXGA 1WJGA 4GBED 2PXXA 4MEAA 4MV4A 4MMYB 2J3DA 1L5RA 2VBGA 3LRXA 3A3PA 3MAGA 2XMPA 1TT5A 5A0TA 4PHDA 1WKCA 3QX3A 3PUWA 4D9IA 1SVLA 4IW3B 4Q4DA 2IY8A 3MJHA 4F2SA 2FN7A 4FCTA 4WJKB 3C70A 1XD2B 4HFNA 1XU4A 3KKAC 3WHPA 5JATA 5LPNA 5FWYB 4FLMA 4Z1OA 5EE5B 1FLDA 2E8MA 3ZLTA 4RZIA 1YMVA 2G1JA 3IPYA 1UBUS 4ZEWA 1IH8A 4P31A 7ICEA 3PJGA 3U3RA 1UWVA 3M6XA 3OFVA 2H2HA 3CB2A 1GKUB 3BD8A 1PFVA 2AW3A 1Q11A 1BWRA 4C7MA 3QVVA 1H5NA 3PVZA 4WAUA 1L5MA 4WK2B 4BDSA 1EGVB 5BQ5A 3TNFA 2YWBA 2C98A 1PDOA 2QARA 4H16A 3MGKA 4M1OA 2YMPA 2PKYX 2X3FA 2XNHA 4YT8A 4PPXA 3JAKB 3A4VA 4IDNA 3WK7A 1EUDB 3C7KA 1BWPA 4J7XA 3PKZA 2XQGA 1A8UA 4N0EA 1H85A 1F5SA 3HCBA 2HZBA 4JWKA 3EZ9A 3E9RA 2DPJA 3E9NA 2CWWA 4CCSA 4KQIA 1GUAA 3BL5A 4Y2SA 2DX7A 3HB1A 3CJRA 1Y5NA 2QTHA 1UKVY 3UOAB 2ILTA 3TXXA 3V7FA 2OFXA 2RMKA 3PX0A 2ZIVA 2JAQA 1Q6YA 4M1MA 4TM8A 4UHFA 3HJAA 5C5EA 3H8VA 2ZT7A 3VO2A 3RB6A 1N0UA 1UWCA 3PXBA 1FFUA 4EDFA 3N28A 1C29B 4ERXA 4H3HB 3ROPA 2FH5B 2H5EA 2V54A 1LPBB 4QHSA 2ZAYA 4ME6A 5H3HA 4UNNA 4JJFA 1YZQA 3OZUA 1N6LA 3K20A 1HNXB 3LWLA 4NSNA 3NHAA 1P19A 1EWTA 1PTJA 2NV3A 5E38A 3OFND 1VLZA 4XA8A 3EVFA 1D8TA 3QQPA 1DJLA 1GNTA 5DNCA 2QM0A 5B3AA 4DC0A 3SEFA 3QXGA 1ZJMA 1JSZA 5K51A 1CD5A 4RQ2A 1DEHA 5LQDA 4E2FA 3PK0A 3RYIA 4BP9A 4R0NA 3SMQA 1C7IA 4XYGA 2XJ9A 3CX8A 2F1IA 5JXJA 1Q1ZA 4QNNA 1MOQA 2IP1A 3KEFA 1AGYA 1DDGA 1QLHA 3A6ZA 4IXWA 3WLMA 4JYZA 4Z4IA 1JU3A 1KPHA 2ZZNA 1EVEA 4K05A 4AZ3B 5JNRA 1KQQA 3D0RA 4RVSA 2QTRA 4HGRA 1MO5A 2K8AA 3L3BA 3GV5B 3G6XA 4H6XA 2FDCA 2AUNA 2DTXA 3ZH9B 4B4VA 4UB1A 2JASA 1U0NA 2QPTA 2I6XA 4O8ZA 4CEIA 2PGNA 3UWMA 4MAAA 3MWDB 1TF5A 2G0NA 2XB2A 3IEKA 5DYGA 2DGDA 2JW5A 3FZYA 4I5DA 2YZGA 1KEVA 4G41A 3DVRX 3IXMA 1ZVMA 4OHPA 2HKIA 1GCAA 3PUHA 5AOVA 1ZQCA 3E70C 2E8PA 1IRXA 3F1KA 5HIAA 4EBDA 3LT2A 9GPBA 4KWEA 2X8LA 4NCHA 3RVOA 4XUCA 2HY7A 3JTMA 4LHWA 5JD6A 2PZGA 3KKMA 421PA 1NBEA 1R3DA 3HXMA 5FYQA 3TFSA 4KODA 4AN4A 3GU3A 4RADA 4PGQA 4XIGS 5IBPA 5IBRA 1TFUA 2P3QA 4GQBA 4K6KA 4B0OA 1KEUA 1XLWA 4TS4A 4MP3A 4FFNA 3O3OB 4N82A 4ENQA 1J8QA 2ZRKA 2PCLA 2O2JA 4URHA 5E4JA 4PTZA 1FTGA 1XTIA 3PR2B 1HUZA 5SYAA 5IAAA 4TT3A 5BYBA 3LBHA 3A7DA 3Q3VA 1XJ0A 3HX0A 1QVAA 5AWFC 1OV4A 1MQSA 2WP0A 4G5YA 3UM9A 2IYXA 5EP2A 3WRYC 1L5KA 4MQ6A 1Q91A 4YFYA 1FSGA 2PWBA 3SSMA 1KEPA 1QZ3A 5KFGA 2C4HA 4ON9A 3AVWA 1BNCA 2YV2A 5FIUA 5CA0A 2VIIA 4M8KA 3TKAA 3L06A 1IONA 2DUJA 4PZEA 4WCFA 1SIWA 3CIOA 2IA5A 1ZZEA 3V7KA 1F1BA 2YYZA 5EJ9A 4W8GA 3K8YA 2ZJ3A 5I51A 2FN9A 2PT7A 5HOEA 2H18A 5DTMA 1XTPA 4BJQA 3DPIA 2R5NA 5C1BA 3ORRA 2F00A 3KPUA 4PZOA 2P1RA 3EGXB 4HGZA 3MAAC 1L7AA 1DOZA 3LC1O 1VIVA 1WWKA 4DXAA 1MQ8B 4TKVA 2VPXA 4Z6EA 2IQ5A 4U02A 4R40A 4W1QA 1DJPA 1V4BA 2K5UA 3HVJA 5KDLA 4JQSA 1RPLA 2OCAA 4ZC8A 4BU1A 3TL3A 1L4LA 3BGIA 3TFOA 2NTVA 2A1TR 5JS2A 4JWTA 4RPLA 3CH4B 3ZWAA 3KQUA 2PUCA 1Q7BA 1JMKC 1NW7A 2O5RA 4XYMA 2YHIA 2H4YA 8ICGA 1J7KA 2K2WA 1NPTO 1HE5A 1JXOA 4YP1A 1G5TA 4J2OA 1FBNA 4UU7A 1UQRA 1PZNA 3SYLA 3GLIA 4A8HA 2ST1A 3TOSA 1M2NA 1F20A 2UYOA 4XFDA 3ZI0A 3H5VA 2KBFA 2QVCA 5IAJA 3UPUA 1OWLA 1SURA 1SXGA 2H3HA 2R8XA 4HNGA 4FBGA 3EIWA 1VBNA 7GPBA 4KWTA 2VAXA 2IELA 8ICIA 5KC9A 4EQ6B 4ER5A 4Q8FA 4TUYF 2ZT6A 2KKVA 4BDPA 2ACKA 3C1TA 1M2FA 2Q4EA 3NX4A 3OT1A 2HA7A 1PL6A 5AM3A 2D3WA 2EZYA 4EB3A 5JR3A 3NVZA 1XZCA 4MCAA 3TM5A 3BDAA 5I8WA 1N56A 4WJ3B 3L5OA 4PG5A 1G5RA 5C7LO 2BQ3A 4MVJH 4EQZA 2GEJA 2IITA 2Q6IA 1NFRA 4GUAA 4HX2A 1SIBE 1DBPA 2X5XA 5C1IA 3BA1A 4QUHA 1RYEA 2KMLA 1LLDA 5TQVA 2LCQA 3G6WA 4PC1A 5M5BA 2GBFA 2PGIA 2L5YA 3FZNA 4U63A 1ORVA 3RR8A 1Y1KE 2LKCA 5G4LA 3GFTA 5KYWB 5KEIA 3IG8A 3H2ZA 1FL9A 5HX7A 2PS3A 1N5KA 4KIWA 4PCLA 3ZWMA 5DQHA 3CKKA 1Q83A 2X5NA 1UQTA 5FUVA 1YGPA 3EG9B 2FSGA 1OXUA 2ZZKA 1UH5A 4YMWA 4J0KA 1P9RA 3ZU4A 1TJ3A 3VR6A 4E2YA 3O75A 2VA8A 2QD3A 3VRHA 3N74A 3KJNA 4EHKA 4E5MA 2D5BA 1CUSA 2FW0A 3JV7A 2MMGA 1N5DA 3U1BA 1KO5A 3O9MA 3EK2A 4YX9A 3DT9A 4JKIA 4N0DA 3QVSA 2J9FB 2ZJZA 2HU2A 4R9RA 1AMNA 4RQ3A 4OL0A 3JALB 4O2AA 2GS9A 5KFWA 1E59A 2BDPA 1RYSA 3UJNA 4ARVA 3LYLA 4YR3A 1PQ4A 4JLWA 2QMQA 3RROA 3U16A 1ACLA 3DFZA 3OPVA 3DO8A 5FPPA 4A82A 1ISSA 2PL5A 4Q03A 3C1ZA 1TM7E 3CR7A 2CVHA 4X7RA 1T24A 3KJFA 4Q9JA 1UDXA 5DGIA 2BR5A 4II2A 4WLOA 2X8WA 1SCDA 4LXXA 4YDRA 1ZYUA 5JVDB 4L4UA 5YASA 4Q02A 1IBKB 4IR7A 3V6JA 1EQ2A 1A5ZA 3VR0A 3CHYA 1M34A 2W93A 4C07A 1V11A 2XNSA 2EXXA 1KK1A 2WC1A 4ED8A 2NIPA 1OHHD 1V96A 4R2XA 3E53A 3U4QA 3EARA 1EAMA 1AXEA 4BFWA 4QDTA 3ITEA 1WETA 4O4LA 4DJTA 3BL6A 3WISA 1RQRA 1UBRS 4O1IA 2BFOA 4MVJF 1HYGA 3FIUA 1L4MA 3LQQA 1X9XA 3LDAA 3IHQB 2QUAA 2ORIA 4U7WA 3FR8A 2DR3A 1C1HA 3R3YA 1GZSA 3DTYA 4IRDA 1ZRMA 3WRXA 1SQFA 2B7LA 5GVSA 4X24A 3L6RA 4CV0A 5LA6B 1NKTA 4MGIR 3UEOA 3QKIA 4N6OA 1RBZA 5AJYA 4ASUD 4FOLA 3OOHA 2WPDD 4J1SA 3IEPA 2DUUA 2P7IA 4DLYA 4UW9A 4KCGA 2BM8A 3VA7A 4NP6A 3WLOA 4MF2A 1PUJA 4IGKA 3C6XA 2HA6A 3LVVA 3RO7A 2Q3DA 4B85A 5J4HA 5B58C 3RJ5A 1JDUA 4BP8A 3PD7A 2NTJA 1P77A 3IAS6 4V38A 5DB4A 3MT9A 4JUDX 2WKQA 5PGMA 4ZOCA 2HSEA 1JDNA 2ZK7A 1LSSA 4KZKA 1AC5A 5IT5A 1ZI8A 2XMSA 1KJYA 3FSJX 4B45A 4JT4A 3NGXA 4I4TA 1HDIA 2WFZA 5CVJA 3KLNA 2HHCA 4LRUA 2O8BA 2I5PO 3OQPA 4MQFB 2I8CA 4G65A 4KREA 1BQEA 4HADA 5MN5A 3IN5A 4PYRA 1LV5A 1OPRA 4FYXA 1ZC3A 3QF7A 4DV5B 2A9OA 7ADHA 4I3FA 4HAWA 1QDEA 4HUJA 5EEGA 1DK2A 4C14A 2XEXA 3LZDA 1PGPA 1U2DC 2SCUB 1A8IA 1ZM9A 3L8EA 2B1JA 2WFAA 3A9RA 1DBSA 2FSVC 2V7QD 4ZREA 3ET4A 2B37A 4M9GA 4K8RB 2XE6A 2JCXA 5HF8A 2E4XA 1ZW1A 4KK3A 5EZ5A 1D04A 4GXNA 1C9MA 4B9MA 4RFLA 4JJZA 3N7AA 2CWDA 1WB4A 3OGUA 1JA0A 1G9SA 3QTLA 2Z43A 3KDPA 1FIQA 4ESOA 4P93A 1H5UA 3K7EA 2GD2A 3O4IA 4TOIA 1BFDA 1QE0A 4F8RA 1K6EA 3Q9LA 1BS1A 4ZODA 1L4HA 1G2PA 4BQQA 3GOQA 4DAOA 3KXPA 3LOUA 2JCSA 4BLSA 5CCXA 2WE8A 3KOXA 2PMFA 3I2HA 4BNZA 5C8YF 4DA4A 1P39A 2C5GA 4PAQA 1PGQA 1KVUA 3PITA 3VPBA 1WHTB 3SC2A 1IC6A 1FTNA 3RABA 1U2SA 1IPEA 4K7JA 2JBWA 1I3LA 3W2FA 1UPUA 4ZAZA 3FSGA 2XYVA 1U2TA 4MV1A 4YUAA 4ISBA 2WIBA 3WGQA 4NARA 2QYTA 4BV3A 1NW5A 1N63A 4F1JA 2F9LA 5ENZA 2F2TA 3RNOA 4F9TA 3QVWA 5IN4A 1DT3A 1DKQA 4Z54A 5AD1A 2VWQA 1PK7A 1U6JA 1AKNA 3EWSA 4TPKA 1RP7A 2O8FB 3BSFA 3TOCA 5AXBA 2F62A 1PJZA 2B83A 1CX9B 1XUOA 2CL0X 1J6UA 4HMPA 3BS5A 3LLSA 1U7HA 1WV0A 2MSNA 4F84A 3HV2A 4X85A 3DH0A 1ZAYA 4JB3A 5D3KA 3DEZA 4UD6A 3WQQA 2CEKA 1Y34E 3GILA 1KORA 1XKLA 2DUMA 4OLBA 1DQSA 3BFPA 3RUDA 2FOLA 1TTTA 4WTOA 3D8UA 4KI0A 1NC3A 3E22A 1RQNA 4AUNA 5TX7A 1VJ0A 1NT4A 1P2UA 2VHTA 3GJYA 3Q3JB 2W0SA 5DDIP 3CLSC 1FFXA 4PYIA 1MB3A 4C21A 3NONA 2E5FA 3TNDA 4GC5A 2NYUA 3K5WA 3K5IA 5F3RA 1IOLA 1VA5A 3PICA 1E98A 2XKAA 1H42A 3GUZA 1UWKA 2HO4A 4NG5A 2XUAA 1OFUA 1D1SA 1PCXA 5IS2A 3R8CA 3RJGA 4QTUB 3WYBA 4KE8A 3GMDA 3MR6A 4IR1A 2OH2A 2ZJ2A 3ETHA 5CCBA 5K03A 3MJDA 3NM6B 4LVCA 2AOUB 4MS1B 1WCXA 5FR2A 3N6VA 3H5RA 2HXYA 4AX8A 4CL8A 2B69A 4G1MB 4QPNA 3RS0A 4KXQA 2Z8XA 4MI1A 4P4SA 5BPHA 3PB3A 3NOOA 4FEEA 3FNEA 1DXYA 4GH5A 2EAUA 1IRIA 4X41A 5A62A 2AOTA 3LKVA 4HVTA 3DQPA 2R18A 3PMNA 3R4CA 3EAFA 3R9KA 4AICA 3HXOA 2OCXA 5FI1B 5H9VA 2O8DA 3O7WA 4D57A 3PSPA 4OJMX 1URPA 1RIIA 3G89A 3KTOA 4II7A 5AW1A 4BZZA 1J2YA 2UUAB 4OD0A 1PGNA 4WADA 2PEZA 4LJ9A 4NMLA 1EDDA 1J2EA 1U6IA 4RA9B 3IILA 3C3XA 2IOHA 1L5YA 1EYZA 4KVFA 4MINA 3QU9A 3NG1A 3HYNA 4X64B 3EA0A 4IDHA 5F7XA 3V2HA 3HJGA 2VPQA 3AR9A 2HK7A 2VHQA 3NC4A 3MWEB 2J4DA 5LDDC 1M76A 2Y71A 4EPVA 9MHTA 4HJRA 2JHAA 3DLAA 4YD2A 5EPEA 1ONNA 4I9HA 4GOXA 1FVOA 2F67A 4REQA 3E2PA 3B13B 4FR2A 2D8CA 4A2CA 1XYYA 3UMYA 1EIWA 4EG4A 3STWA 1L4KA 3EJWA 5CH5A 1WXFA 3GBPA 2VK1A 4Y9TA 3K9HA 1LSOA 3IIMA 4TMZA 4YCXA 4D82A 3MFYA 2WVJA 2LDBA 1S1MA 4L0CA 1O96B 3VJRA 3DEKA 1BE6A 4QU8A 1KO8A 4EI9A 4L7QA 4BOYA 5BYAA 1RRFA 4R8UA 4LJ6A 3EYZA 1UPXA 2HSDA 3PNPA 1ZOSA 2XTNA 1WDMA 3K94A 5IT9A 4FHCA 1E2JA 2ESRA 3TAQA 1U0OC 1LA2A 2GM5A 3FPEA 3B1FA 3RTVA 1NBIA 3VR5A 1FMJA 1NASA 1M1NB 5F52A 3K9BA 4I14A 4CLRA 2KNJA 2XT6A 4KXWA 1USGA 2G9VA 1PT5A 2QTMA 5ARDA 3FX2A 3F2DA 4IQWA 5C32A 1TX4B 1UDAA 4DWVA 2ASDA 3CPHA 1JH9A 4HPXB 4X9XA 4GOOD 4CIBA 3NJ4A 2H5LA 1SIOA 1NNSA 2ZXUA 1ZQIA 1S2IA 2ODTX 5ALZA 5A3SA 2I4OA 3WBJA 4B6JA 4HEQA 1UOQA 1WUYA 4CKBA 1U11A 4XCXA 3A70A 2ZULA 3MIZA 5BMVF 2AEJA 2P30A 4DC9A 3JVVA 1T0JB 4RPIA 1CP3A 4YBRA 2HPZA 2ZITA 4OGFA 2JEYA 2J59A 2I9KA 2Q62A 3I8XA 3MWKA 3QLVC 2QA5A 3I6MA 4LV8B 4ZZ0A 1OR8A 2OQ2A 4JEMA 1NBOA 4ATNA 1P9NA 1I4WA 3ALRA 5BYKA 1BE8A 3T5LA 2RHRA 4P3PA 3GV8B 3DZHA 1YA6A 3HR7A 1JWAB 2VR1A 4TLEA 1EGMB 1FE8A 1BEUB 4M9JA 1Z18A 2RHFA 2EW2A 2X7HA 2ZWVA 4ECVA 2Q28A 1I2CA 3L1JA 2NWQA 4TLCA 3FUTA 1BPDA 3G79A 1FNDA 4I99A 1OAAA 4F60A 5DNVA 2IGTA 1VCNA 3MJ4A 2EG5A 4M38A 1FJ2A 3K4PA 4D9JA 1NAIA 3OTQA 1IK6A 1E4YA 3JQGA 5DBHX 5BOSA 4PQFA 1JH8A 4Z51A 1H9AA 1CR6A 2V4UA 3SIPA 3RCBA 3QWHA 1CQPA 3MIIA 4K4IA 1T8PA 3RK1A 1MV5A 5JALA 4R8MA 2EG9A 3P0JA 1N2JA 4BJ6A 2WDPA 1YHZA 5LVAA 4BGDA 1ZD3A 2WOJA 1RKVA 2EP5A 1JJFA 1E4OA 5K9ZA 4H60A 2WYWA 1SV0A 2R8YA 3CEJA 3ESCA 2FR1A 4J16C 5IX8A 2QYHA 2L2QA 2I2FA 1CCWA 2ZJ5A 1QLWA 1WXWA 5LSAA 4NTZA 1V85A 4B6GA 1H2YA 4EG3A 1KBOA 4P0QA 2DTDA 2LE0A 5HQJA 2PWPA 3ZW9A 1EFVB 4YMNA 2VDRB 3D6HA 3K6RA 5KFMA 4UJ5A 1J5PA 1XZBA 2Q9AA 3OJXA 1YH3A 1U8YA 4RK5A 4TKUA 1VYTA 3LO5A 3AUAA 3WS7A 5REQB 2JLZA 4QQFA 1H2WA 2ZBPA 2H5XA 3QKTA 4X3PA 3EX7C 1SKAA 3GEGA 4TYMA 1G7SA 4YJGB 1SG9A 2YV5A 3C28A 4AY6A 1O95D 2EFDB 2FR0A 3GLVA 3D7RA 1CUFA 1P7CA 1KR5A 4MWDA 2W55A 5G4KA 2VYCA 3K4GA 4DR7B 2AG0A 2K4EA 3SQDA 4DVGA 2X23A 3QEMA 4Y2TA 3JR7A 2WMDA 1RYBA 4M9UA 3U4MA 1ZL2A 3T06B 1JT2A 1KKUA 4R2HA 2PJRA 4FZNA 1TF7A 3L93A 1Z8FA 4EDHA 3GWGA 1FW6A 4RNOA 2FP3A 2CUKA 2IS6A 3SE0A 3A9VA 1V6CA 3AFMA 4P33A 3MYRA 4O2BA 5KB3A 5JCZA 3GJXC 1KZ7B 2H4WA 1HTWA 4L5IA 4R83A 4PG7A 3A14A 4A6DA 4HPJB 3GVIA 1HM5A 1H2HA 8ATCA 3K1TA 3DR3A 1RRMA 1VCMA 1LDNA 4XOIA 3ZOKA 4L28A 3CC8A 4TV8F 1UKYA 7ICOA 4GGMX 5DHUA 3PFWO 4F4IA 1CVRA 3AVOA 4JEHA 2GETA 3V4SA 4AB1A 2J3IA 1EUCB 3EPIA 2CL6X 2QD2A 4DIKA 5E1DA 4NICA 1GL6A 3DOUA 1IIRA 3IP1A 5JBIA 1X8JA 4QU5A 2PWAA 1TKRA 5AUOB 5JJIA 4GT1A 1GPJA 2VWPA 3OEEA 4M1KA 2K4PA 3AUOA 3P2OA 3L4KA 1Y9JA 3IT2A 3IKMB 4LAFA 4XAQA 1HEIA 1YAJA 3SE7A 3F98A 1DX4A 2WP8J 2CXNA 1T1RA 1BDIA 1Z8HA 3N86A 1M5TA 2YOGA 4URXR 3MVEA 1SB3C 2YMMA 1SCUA 3JVIA 1TZ2A 3V8MA 5A0LA 1ZICA 4F38A 2VL7A 4UOZA 3V4RA 1XTSA 3DEAA 2EBHX 3W3AD 4U2CA 1OASA 1SFRA 1CQJA 4E5VA 3H97A 1EGHA 3HJTA 5JS1A 5E6SA 3WSTA 4ZQBA 3GG2A 1R4AA 1Y3FE 5KTRA 4NH4A 3DCNA 3GRZA 1ONBA 1DK3A 1Z1VA 4FXPA 4IIJA 1SCIA 4KXFB 3FRJA 4EA9A 3LP5A 4LPKA 1LQUA 4IX9A 1KSJA 4ER0A 5J2KA 2EKBA 1A1VA 2EGGA 1ZCFA 2BHSA 1UC5B 1OY1A 3G13A 3WWZA 4CQLA 3VYSB 5IEJA 3R8FA 2DBZA 3RVBA 4EZIA 4FS1A 4QDJA 4LDQA 2QD1A 2Z8YM 4L2IA 4M9QA 2VAMA 2NO0A 2BMFA 4MW5A 4YQEA 4RV5A 3GY0A 4P6VF 2QN1A 3ODPA 2BPFA 5COAA 2XD9A 1FJGB 2AL7A 2DUWA 4ZAGA 3G68A 3FMIA 1UZMA 2W9AA 1RXYA 4TT3D 2QLJA 2L82A 4R1MA 3OICA 3OM9A 1YIDA 4F7WA 2BHLA 4GZ6A 1GILA 5BUQA 4Z1MA 1GT91 2AJCA 4AS2A 3AUFA 1G5FA 5CEEA 4LY0A 1H9BA 4GXIA 2VDLB 2XZDA 2A14A 4TYQA 5L3QA 3DQZA 2ISPA 3SIXA 3KZKA 4S0ZA 4AFNA 4JV1A 4OMFG 4U7CA 1XRQA 3FMVA 3UA3A 2WJWA 3FJYA 2J3EA 4BO8A 5DX0A 4I50B 3JYQA 2H3VA 5KAMA 1ZJJA 4LQCA 4DLXA 5HR7A 1CERA 2ZJ6A 4E5UA 3LMKA 5CCDA 1H4QA 2OL4A 5A3QA 5J2DA 2UVPA 4OSOA 4CF4A 1JEAA 4RF5A 1IK4A 3KSBC 3EVDA 4G0UA 2BW0A 4OJKA 4D8VA 4PAMA 3A28A 1OZ0A 4KH0A 5CDTA 4PSVA 3CUVA 4DS3A 4Q8EA 3DBRB 4X8OA 3N3BC 3OE7A 3OCCA 1E89A 3ELDA 2Y1GA 3L4JA 2CSUA 2Q0HA 3ORSA 3RK4A 4G5HA 2FPIA 3HZZA 3AHFA 5TGTA 1MRZA 4QZDA 5ECWA 1JZQA 2BSXA 3INRA 1N5MA 4DUGA 4YRCA 4EBBA 3UT5A 3ORQA 1A71A 1ZETA 5KAFU 3FCEA 1I6KA 1WSAA 4FMCB 3RKSA 4S1VA 1R6UA 1Y89A 1U9IC 1CUGA 4Z4EA 1RXCA 1KEWA 1ZQXA 4KPEC 1J9EA 4CETA 3OLYA 4CI0B 1XQ1A 4LVNA 3LOPA 4DWOA 2FZCA 2BTEA 1LDBA 3KL2A 4UPDA 4M21A 1SHKA 3WWCA 4KMMA 4HG2A 1HLDA 4I19A 5FBKA 4QZFA 4OQMA 4QA9A 3TKYA 1JA9A 3QVMA 2ZIUB 4CTOA 2P2ZA 4BE4A 2KICA 3RJMA 2IXGA 1ZXLA 4JJ4A 1L1QA 5ICMA 2DC1A 1Q0RA 5F5NA 4C0JA 4Z6KA 3HR4A 4EF5A 1EXNA 3JD4A 1DAOA 1XJCA 2PLWA 3T5BA 2V45A 2Y0DA 1MEEA 4DS5A 1KJWA 3VR2A 5D3ZA 5L4LA 1Z00A 4PSUA 1IV8A 2V6IA 2WWXA 3N3AC 1CZUA 3JPSA 3T61A 3U4GA 4K87A 4EYOA 2H5IA 1XXHE 1MJFA 2XE4A 5HQTA 1NG9A 4B6FA 4I2DA 4Y3UA 3JZFA 4TX1A 4MDFA 1PS0A 1DFGA 3N2EA 4DQQA 4OUDA 2GF0A 3T7CA 2ASVA 3JAWB 3RUPA 4AY5A 1U4SA 2X40A 3OX4A 2AUMA 3H1AA 1ZXIA 1LI7A 3OH8A 3UAWA 1P17A 2JFHA 3BFXA 1NJ2A 4OYLA 5L9XA 3VC2A 4ACAA 2K87A 4YRDA 3C5FA 2NU8A 3JWHA 4RQ1A 4KX3A 2X86A 2XOKA 3TLGB 4AY4A 2HYIC 1SD2A 4EKDA 3UJ6A 4MUMA 4M53A 1YBVA 2WB1C 1WQ3A 4YT4A 1GG9A 4CZ2A 1VHWA 1K8XB 1Z7YA 1FXUA 5IM4A 2L17A 4QZBA 1BKDR 1TKAA 2EZ4A 5F51A 3KPVA 3TR6A 1GGFA 2NN3C 1RXUA 5EN4A 1C4XA 2HFKA 2O6KA 4O4HB 3C8UA 1NW3A 2DH5A 1KE2A 3P9ZA 1CJTC 2ZSJA 1IU9A 1SOVA 4IMRA 3K35A 4JEIA 1XZPA 4MX8A 1CZHA 2TMYA 1HE4A 2BGWA 4W6ZA 2BV3A 2WTFA 2PO7A 3KB1A 2V0NA 4BNDB 4QVGA 4R01A 2BKEA 3GEEA 5AKJA 2QAGB 4EAAA 2G4LA 2PDAA 2YHAA 3VNSA 4L57A 2F9FA 3KT0A 1F0PA 2F3RA 3KQHA 2AMVA 4Q7KA 1JG2A 2RGNC 1HE2A 3EQ8A 4XFKA 3U5TA 2ZT8A 2IBTA 3QLUC 4KAXA 2WKPA 2CMKA 4HZIA 4NS4A 3C2MA 2XX3A 4AWAA 1Q74A 2A0KA 1CVIA 3OZRA 2VDKB 3RU9A 4KLSA 1AZLA 1HKHA 3DE4X 1XVTA 2IU4A 1GGHA 5DLGA 3R23A 1DRUA 4LHSA 4K0RA 2ZTEA 1GY8A 2HBLA 5D01A 5BW8A 1RU3A 5JBQA 5DHTA 1BHO1 1IN7A 5BR4A 2JS7A 2IWRA 2ATLA 1UMCA 4B9UA 1GNRA 1BCRB 5I3ZA 4ZICA 3Q5GA 3A9SA 1V5EA 4LS3A 3DWIA 2PKQO 1RQ7A 3ITNA 2ZBFA 5ER6A 4TMWA 2BFEB 1RAGA 2YY5A 2CJWA 5B1DA 4NLLA 2ZGVA 2QD5A 1IEWA 3JQ7B 4TQSA 4RLQA 2ZYRA 2WWGA 3RH6A 5LQCA 4EAQA 1L7NA 3WWPA 4I2BA 4RF3A 1E6LA 2O3SA 4TURA 3RDPA 1TVKB 1GRRA 1HKUA 4ARSA 1XD9A 3X1YA 1KW4A 2C20A 4ZGBA 2DECA 1Z4LA 4UBIA 1OBFO 2QBYB 4BS9A 3F7NA 1T0HB 4EGJA 1H3FA 4H7FA 2NT3A 3N07A 5J0YA 2RAPA 2V7XA 2BKAA 4LKOA 2FCRA 1E9DA 2PD3A 1VLQA 1ILWA 1XQ9A 3ZUPA 2JIMA 3NM4A 4NG4A 5A0FA 2C7RA 5C51B 3D6NB 1KOJA 4W82A 2HF9A 4QTXA 4XUGB 2Z0MA 3COVA 4L95C 1YVRA 5JWRA 3C3EA 4WFKA 3VPFA 3TOVA 2PNJA 4HAOA 2HMWA 4HLQB 2LM1A 3G2HA 3N5CA 2VK8A 2PZMA 3DUWA 2IEIA 3CFYA 1FFGA 3BDVA 1BN6A 2IDKA 1PZMA 3MINA 3PQ5A 1N6RA 3V7LA 2DF4B 4X6UA 1D5WA 2FSUA 4GO1A 1E0AA 1C1DB 4RZSA 2PQ2A 2QSZA 2RBKA 3W5BA 3Q9NA 3ABSB 5F64A 2MYPA 4Y0NA 3LVWA 1SXPA 3WGZA 4X1YB 4QQNA 2BEWB 3T99A 3A26A 3WK6A 1Q92A 3IERA 1BKYA 4RXMA 4DF8A 3BD9A 5I9SA 4QYIA 3PUXA 4QASA 4HDMB 1NURA 1RYYA 5DXAA 3W34A 1JAXA 1PDVA 1RACA 2EX1A 2O9JA 3E84A 3SDZA 1QUFA 1JX4A 3NEJA 4J0JA 1IZYA 3G5UA 4F8JA 4R1SA 1M2EA 4L4ZA 1I9GA 2H2AA 3AX6A 3HKCA 1VJCA 4ENTA 5FLXA 4G3XA 4CQMA 2FDXA 3SF8A 3FSGD 4PAOA 3ZV5A 5EUCA 2VT7A 3TBFA 3BQNB 3A06A 1ISMA 4LWOA 1NYRA 4ZVMA 5EGNA 1KRXA 2V5UA 1QRDA 4CMCA 2J6SA 1IM5A 2R6DA 3CZ5A 1LDEA 3K0SA 2FE4A 2A1UB 2IYQA 3HGQA 4QPJC 5A5DA 3Q7TA 4R8KA 2PZEA 1WRBA 3FKSD 2WB1F 1Q19A 3MR2A 5FYDA 3DOOA 1IXKA 1Y5MA 2LHTA 4JB8A 2MR5A 2ZAIA 1B0PA 1CR4A 1GNSA 1TTPB 3UUWA 2WNSA 4EY6A 1JB9A 4BKRA 2FW7A 1J9GA 1T91A 1WB5A 2F44A 1WU7A 1R16A 4N3NA 2ZJ0A 3ESYA 1DAHA 1QHXA 3EZ5A 5CXSA 4CMJA 1ORHA 1ZCBA 3HYTA 1W4CA 3NWOA 4LSWA 2D59A 4QWAA 2IH5A 1XX6A 2O0MA 1P29A 3B6KA 1AQUA 4PPQA 5K0ZA 3AEKA 3ID6C 4G07A 1XEWY 4JP5A 1I8TA 1QIFA 3QEKA 2GCNA 5FWNA 5FEUA 4KXNA 5BSMA 2P4HX 3QNUA 1QGYA 3EZYA 4HQFA 1UXGA 3WVNA 4U2GA 3PX2A 4FVTA 2P3OA 4ILEA 4MEBA 1NVFA 3GBSA 4QC2A 1XZEA 2NYRA 1ND5A 5EQJB 4EFNA 3QE3A 4IV0A 2P6OA 1KBZA 3IURA 2JJYA 4AP6A 1SVUA 4NXMB 1Q3UA 4B5LA 5DW3A 3OMWA 3GQBB 1XMXA 4B48A 1HI9A 4GPIB 1ZK2A 3ZQ4A 1PW7A 4PZCA 5ANRB 2C7GA 5AOCA 2PUEA 5DGDA 3B3QA 1A96A 2OY0A 4BATA 5D8DA 4FKMA 2DWOA 5J2UA 4F93B 4OI2A 1OBOA 2EIHA 3IP8A 1I5EA 3AFHA 1NI4A 4EUNA 1FCJA 1MH1A 2HQRA 1ZH2A 4OJYA 1KRWA 3ZI4A 2GBPA 3N7UA 5TGDA 3KLOA 4DLGA 4GKAA 3VVCA 5J2TA 3VCBA 4KR6A 4LZGA 1VKRA 3KAPA 5MHTA 5EJ8A 3CRMA 3PFIA 4P5DA 4F06A 1FX0B 2HGSA 5H8WA 5B7PA 3WA7A 4PG8A 2H1WA 4D25A 3EDRA 3C5CA 5NULA 1RAIA 2WZCA 1PFWA 3AIOA 4DL7A 5IULC 2HLDA 1YHYA 1LRLA 2BTQA 3AIKA 4PWZA 3B60A 1EH5A 4EM6A 3U80A 2ZRDA 3ANMA 2G4VA 3PU6A 4NABA 3TARA 3GQCA 2WHPA 4DDHA 2JLAA 3W1EA 2Y4NA 3T5MA 3GRRA 1W5EA 1MPXA 2Z98A 4Y6PA 2AFHE 3QFSA 4A8TA 1E7WA 2ZIEA 1UHUA 1JG6A 4M7RA 1KOLA 2NTEA 5JYDA 4BKPA 1L5FA 2Z57A 2IF2A 1P2BA 1S5PA 4MB0A 1YZNA 4FB4A 7REQB 1YS1X 4I81A 2GJAA 5JWHA 2P41A 3IDAA 4Q4AB 3BQ9A 4KGXA 4Y2RA 3GPLA 3KJZA 1SBCA 4OJLA 5CJJA 1NMSA 1Z4IA 1JI0A 1SXJC 1VSTA 3BSYA 3AKEA 1QHHA 3TK1A 2GUGA 1PT9A 3HBJA 4HTAA 3AEQA 4A0RA 3FBGA 4RAQA 5IDVA 3FPAA 3LYAA 5E79U 3GOHA 2C9ZA 1NUSA 2UUOA 1OFUX 5ICCA 4IQUA 2VTBB 1RKUA 3LE8A 3DR5A 4HDRB 2BJWA 4GNRA 1M6EX 3ZIUA 3C0KA 1JHPA 2H48A 1OYOA 5BQ3A 3ZE1B 2F3TA 3LXXA 3JX9A 1AJEA 1YFZA 4DQDA 2E0IA 1YUBA 1NU8A 3NCTA 4OBBA 1AKQA 4GLBA 4FR0A 4HAZA 1CQZA 1RWBA 2C78A 4ERNA 4W7IA 1O5TA 3OIYA 2A1IA 2MSKA 4LN1A 2Y1OA 1Z2DA 2JF0A 1X1RA 4KO4S 3OZBA 1CDDA 3QK7A 3V8BA 2IYYA 2P0EA 3HBLA 1W5SA 5KFQA 5KHAA 2UYCA 3Q6NA 3VOSA 4LMBA 2FPUA 2WHQA 2HF7A 1DTSA 2KP7A 2OPBA 5DN6D 1HSZA 4D0SA 3H9CA 4AI6A 1A9XB 5IYZA 1RRVA 2IS4A 3VZDA 1KO7A 5T3YA 3TRFA 5DDYA 5JG7A 2MAXA 2LKYA 2GWHA 3GFKB 1ZQYA 4ZIRB 4RPHA 1GGEA 4RFSB 4D74A 3AVTA 4ALMA 3DMHA 2QP4A 5ES3A 1K92A 2Q1WA 1LTHR 2ZRGA 5MFPA 3DTVB 3E0FA 1T3GA 4WLFA 2V9CA 1HV8A 4YNBA 3UKDA 4GDFA 4QXQA 1Z12A 4I2JA 1J42A 4P32A 2JDID 2FSIA 3ESZA 4H9GA 2UVUA 4Q01A 4Q44A 2Q07A 3A2MA 4G4IA 5K99A 3DC7A 3F3YA 4WECA 3UGJA 2XNJA 1ZQTA 4GX1A 1E1CA 4NBTA 4IHJF 4EHJA 3DV2A 3X44A 1AK9A 4OQEA 3R7BA 3OX2A 1IHXA 1K5PA 5CTAA 3LW8A 1F06A 4BYGA 3AUJB 3KO8A 1ITZA 3FD8A 3RI3A 2G9QA 2C9BA 3PFKA 5BMVB 2ZANA 2BFBB 2KSOA 2FUKA 4YP7A 1A2BA 1T25A 2FGJA 5FFMA 1YA8A 3HNRA 4KQHA 4GM0A 1Q3VA 4RKYA 3GC6A 2C4KA 1R5NA 4HBGA 3U37A 4TQUS 2PRZA 4PS1A 1TI7A 2QQGA 1WMAA 3LYSA 1G16A 4D43A 1CYEA 3L4BA 2BUCA 1JS1X 1E5TA 1K0FA 3O92A 4F3YA 5CNJA 4INZA 5KNIA 1YTLA 2OP0A 3PI6A 1T13A 4XVQA 5KTOA 2BUAA 2ISCA 4K9NA 4KMOA 4B73A 5E1OA 2F3PA 3NUZA 1Y4UA 3N2YA 3QSYA 2PSDA 1Z8DA 5CVTA 2XR1A 3DVQX 4BN5A 4MFFA 1CDOA 2HPVA 2QTFA 4R51A 3RG8A 4FGKA 1G18A 1ST3A 1K98A 3LKDA 3HNPA 3AR5A 2B6NA 4LF5B 3I83A 4K6OA 1UBFA 5LIPA 2JC3A 4RHCA 1EK0A 3ICCA 4IBOA 1O9HA 3RM3A 4LECA 1E99A 1ECFA 4AYTA 3WA6A 3M6ZA 1EBBA 4F04A 4NV3A 3ETNA 1U80A 2GM3A 4C2AA 2MU2A 1SCKA 2VHXA 1Z0SA 5K3SA 2PN1A 3EXFA 4XGKA 5IIKA 4TLMB 1T4GA 2QJRA 1JDZA 1W1UA 3OIGA 2E4VA 5KTSA 2SECE 1VBKA 4R41A 4G9BA 1RR6A 1XN4A 4ZU1X 1L4GA 2IY9A 1YVUA 3HPQA 4E11A 5CB6A 4UZSA 3ZCTA 1U3VA 3VAAA 4R9SA 4LKRA 4TWBA 4RL4A 1V8BA 2WK1A 1YJXA 1TA4A 4ZTUB 3K2BA 1QCKA 2G4CA 4FU0A 5G40A 1HQYE 1LFDB 2Q4BA 2PR2A 5LYJF 2IHZA 3O47A 3JVDA 1JBEA 1P6XA 3MCAA 5IXJA 5J58A 1OJLA 1GSAA 2HL6A 2FW6A 2GF2A 3ZDAA 3TQQA 3H2JA 2RQ5A 5J0SA 1EFDN 4IVNA 2H7CA 4YAWA 4HLUA 4JU8A 2PL9A 2C92A 5CDFA 5JWOA 4LMRA 1KXJA 2EFHB 3TTXA 1YI1A 3LP8A 2C8JA 4A36A 1JKJA 3MWFA 1WEKA 1B23P 1KMQA 2R8ZA 2W6ZA 1QTQA 2E4UA 3VSEA 5EKSA 4K28A 3AEUB 3EFBA 4QWCA 2GXUA 4B79A 5HHIA 4FCCA 3UTDA 1V3QE 4Q3BA 5T4FA 4TWIA 3PLAE 5EE3A 4KFUA 1UAGA 2NPFA 3JQAD 2XCRB 5JCOC 1KP2A 2NZYA 3KXDA 4HAXA 1EX7A 2NU6A 3MB5A 4A73A 4O3QA 1KL7A 1WSDA 4MA4A 3E4CA 4PM4A 3MMZA 2C94A 1Z2PX 3BYZA 4BVEA 4DSOA 3G7SA 4NJEA 2AX3A 3IMCA 1BPYA 1U5AA 5A4AA 1GL3A 3G9XA 3GZTB 1NWHA 4Q4LA 4W8OA 3R76A 4NX2A 2ZVJA 3WZLA 2HSWA 2B98A 4FE4A 4RJLA 4FWTA 4A4DA 3UXOA 4OO1J 1GCOA 1I2MA 4A91A 3CEAA 4UBNA 1O9GA 3A6GA 3V72A 1CYDA 4O5AA 3NDRA 2NXWA 3HXLA 1LBTA 2W0MA 4HRAA 3TYXA 1TQ6A 4MR9A 2OYSA 2FG7C 1I0LA 4D4IA 1Q14A 3QOYA 3P94A 2VJAA 4AJ4A 4D26A 2ONZA 4ZRNA 1YT5A 4V39A 4CUJA 5JBNA 2IH4A 4AM8A 3VQTA 1S8AA 3R6TA 3K53A 2NUPB 3KFLA 5BN4A 4YCJA 3SQIA 3FCXA 2FLLA 1S8NA 5BW4A 2XDQA 1ULUA 2ADFA 4MGEA 1ISPA 4LW8A 4WLUA 2W70A 2IMWP 1SG6A 4H1TA 1R0BA 2GO7A 4C08A 3OWHA 1U49A 2J30A 2M0NA 4JBGA 1OW5A 1YWGO 3EIEA 1YK1A 2BM1A 2YBDA 4CYMA 1SELA 5HUQA 3VYRB 5EI5A 2Q4RA 1P1KA 3HBFA 2JFNA 1Z17A 1Z1BA 4RQ6A 2X5JO 2G0AA 4DFKA 4Z0TA 1IEQA 4PU0A 1DOAA 1VPLA 1KSHA 2A92A 5A1TA 1LKZA 2QTVB 1H1TA 3U49A 3DXYA 4QICA 4DSAA 4V3BA 7ICRA 2K8CB 4RT3A 5KHOC 2I7TA 2IOQA 3W0LB 4R1TA 3VVMA 1HMYA 3E9EA 4BMCA 2GK6A 2HIMA 1U0HC 1CS0A 2OWEA 4OYYA 4K6CA 4M9XA 4GGPA 5DGBA 3B12A 3M5PA 3Q5DA 4AKTA 3FYHA 1V1MA 4BMXA 1FYWA 2IVFA 1ZQOA 1ZS9A 3RU7A 1TVCA 2GJKA 1WZIA 2X58A 4XSVA 2IEYA 3H84A 2XUQA 3ZWDA 1N2CA 3IUJA 4DUGD 3AQIA 3RB0A 2ZIGA 3IAM1 2VJPA 1GKLA 2K7FA 4FFLA 3PLNA 3UAVA 1W5TA 5K4HA 2X0DA 3TO5A 3H9GA 4Q1CA 4DUPA 1XTUA 3KHUA 4UTVA 4QUKA 4HWSA 4WN9A 4NZNA 1V1RA 1J90A 4OP1A 4DA8A 5BWLA 5H4HA 3V1TC 3NNDA 3ENNA 4IJVA 4TS1A 1WQ1R 3BRSA 2ZRBA 1K9VF 1S4MA 2IYRA 1YQEA 5G53C 2C4MA 4W99A 2IPXA 1YKFA 4N41A 4DNOA 3URKA 2R2AA 1MGOA 3MSXA 5JEEA 3MGGA 4Q1DA 4M1TA 4MQEB 4FLFA 1MEOA 3K8OE 2C95A 2IKSA 4PO9A 4FI3C 1Z5GA 4PZ9A 4H17A 3I61A 1NK7A 1G8MA 4PFJA 3IMKA 4JDPA 3FUCA 2PU7A 1U2PA 1YDGA 2NQTA 3HDQA 1ZLYA 2Y1JA 4BL5A 4JNCA 4GLXA 2VYNA 1Z0FA 1W2HA 2OCPA 4IIHA 3A3YA 2Y66A 2IJGX 3N0XA 4RGVA 4WY5A 5BN5A 1JEQB 4MKGA 3RRJA 3SV4A 1P0MA 4HGQA 2EAPA 3PHGA 2W6CX 1NVWQ 5FADA 1Y1LA 3KKPA 2EIXA 4RX1A 4MV5A 2M2IA 3KEOA 4BMOB 1IB6A 3OVMA 3U3ZA 3TS1A 1SK8A 1S1CA 1QYIA 1KN5A 3RRFA 2VQ6A 2LYBA 3PEFA 3U44B 4WZAB 4JWNA 2OUKA 2NAFA 3A4MA 4R84A 5B1IA 2X2PA 1ECBA 1XSLA 2ZDGA 1ILEA 2OXFA 2BSQA 2X8JA 4M0EA 2IXDA 1KAGA 3A6EA 4HDSB 4KQWA 3P71T 3T5CA 3RYHA 3W5IA 1C0KA 8ICMA 5FLEX 4YGYA 1Y4ZA 3QU5A 4PGMA 3MCUA 2NVOA 4UFPA 4IJKA 2XQIA 2ZBRA 3O5AA 2ZJAA 5AMXA 3DG9A 1Z15A 1KIAA 2OXEA 3NAZA 2PBZA 3UGKA 3SVTA 3VZCA 1M2VB 3VO8A 4TZKA 2NV6A 4X93A 3QI7A 3VNRA 5JPCA 3BK1A 2WF6A 1GGNA 4JAVC 1JEYA 5CBPA 5KDOA 1R6VA 5G3ZA 2IPNA 4Y2UA 2ZJOA 2V7TA 4Z8XA 4CM9D 1I7SB 3FTQA 4WKCA 1VRWA 5LDHA 1YT3A 3RD5A 1NRXA 2DMRA 5CX1A 5JS8A 1ZQEA 3JD1A 4HVAA 1GVHA 2GNAA 2XB4A 4WWHA 3TSWA 3FCUB 4DKXA 1Q1NA 3KRTA 2YWCA 3CJQA 2LM4A 3NT5A 1VGRA 3ZX4A 2H3FA 5A0VA 1EZ1A 4BY9E 1G3UA 1CQIA 2YY6A 2N46A 4HYKA 4NBUA 4OFZA 4PIMA 4H6WA 1C8LA 3FVVA 2Q41A 2I7XA 1IJBA 4JJKA 1G8FA 2LZ0A 2XCOA 3BMQB 4QQRA 4BO0A 1JE0A 3OZEA 1N5LA 2FW9A 2ZYDA 3GT3A 5EWLB 3T3EA 1TLFA 3PSFA 2CHFA 5KWJA 3M49A 3AXTA 2RCNA 4ZT2A 1MC4A 1AKWA 2H54A 2W3RA 1P62B 2HQOA 2J8ZA 3PP8A 1E2MA 1OFIA 3PEUA 3FI9A 3WHLA 4HQLA 5JXWA 3TE6A 4AAYA 4YJDA 3S99A 4FEYA 3KALA 4F4FA 2OV8A 1ZVJA 1Y5LA 3DXFA 2OMKA 4I29A 4DQSA 7ICPA 3CGGA 1VDMA 1MZVA 3IAFA 5EYPB 1ORDA 3DOEA 4A2WA 5DYTA 5CYPA 4UAJA 2P3LA 3KOUA 5EWGA 5L95A 3W5VA 9ICUA 4CM4A 3P4UA 2P2YA 3A1CA 2HHJA 3B7PA 4D80A 4MW6A 3V4OA 1SVNA 1RAFA 3A1DA 4ABTA 2CLHB 3GUUA 1RI1A 2VBFA 3NVAA 2R6ZA 1NVMB 1DTWB 3Q6IA 5AOBA 3GNLA 3MC1A 3AKDA 5LP6A 4CF7A 1Q1AA 2O8NA 1T2FA 3WGUA 4BXOA 4TKLA 4UM7A 1T5LA 2HLHA 4KLQA 4KYVA 5IXYA 5BWMA 4YRJA 4B35A 3E6AA 3LQKA 1SA0A 1ZQUA 4BFVA 5ELXA 1YZLA 2Z6VA 3ZZNA 1YS2X 5I8PA 2RIRA 5DSZA 1QBKC 3QZ8A 1U99A 4EB0A 4KHPB 2PX4A 3M5WA 5TGZA 4CN9A 1QB7A 5FLKA 3B7GA 1VLJA 5KFXA 5CFQA 3PRHA 4B34A 3NHSA 5J4LA 1V7ZA 3OD5A 3RC8A 1QIGA 2RKWA 3KTFA 2AFIA 1Z4NA 2XMBA 1C1XB 4BQFA 5EHZA 1GUFA 1T8RA 3K2IA 4QZAA 5KKNB 3FYUC 1ZGBA 3QE2A 1HYEA 1G6HA 3VZQA 2HIHA 1U0JA 4KSCA 3EGEA 3DAGA 4CGZA 2YJ5A 3P2JA 1DEOA 3W4KA 4TYNA 4QFBA 4O4JB 2FFAA 2I6FA 1TVMA 2EP7A 1RTTA 3SXPA 1HE1C 1TIBA 4ZVSA 1AZWA 1FS5A 3LUKA 3PNQA 2FRDA 1HXHA 2CBZA 4AK9A 4ETNA 3ISJA 5A9SA 4EOGA 2GO1A 4WXPA 3JYLA 1JR3A 3O93A 5C1DA 1JIJA 4JBYA 3NHJA 3ETEA 4Z4HA 5KCMA 4NE7A 1JMSA 3H4VA 1EX6A 2HCJB 4FC7A 1IVSA 3KOZA 1RKXA 2EC5A 1JZTA 4MVJG 4ZVLA 5AI6A 1E1LA 3AU8A 3VKFA 2VDQB 1RAHA 1I1HA 1UM9B 3CUWA 3ETDA 1GQRA 2VYVA 4ZV4A 3L1UA 5JXIA 2AXNA 3BSSA 2Y1IA 4NL4H 3FPBA 1ZUIA 3GLHB 3U3XA 3ZVMA 3V9PA 4J0FA 2AFRA 1USUA 1XNQB 4GP9A 2OB1A 4UQPA 5ICEA 4JBNA 3W2GA 3LF2A 1VSQA 1PK1B 1E7MA 2GCIA 1N6IA 2LCIA 1IJEA 5IDYA 4D4LA 4DFJA 2RGCA 3WU2U 5LZ4A 1XF1A 3CLKA 4TZTA 3NYIA 2ZPTX 5LUBA 3T95A 1M1XB 1MPTA 2GBCA 1ONSA 1E0SA 3FVRA 1QO0A 1XZJA 2GK4A 2HF8A 4AUKA 3I5YA 4UFNA 3M9LA 3MUOA 4RQ8A 2Y67A 4LVSA 1F7UA 2K4HA 4HHEA 4OHVA 3RE1A 2QB0A 2PLRA 1XLTC 2VDMB 1TAGA 1Q0TA 2PUBA 3GMSA 4NULA 4UHBA 5CT4A 3C1AA 1U2ZA 1QGUA 2RG1A 4C4SA 3KG2A 2CJXA 1XTVA 4M7WA 3JAMA 1GQQA 1GZ7A 1W6UA 1N2EA 4X6YA 4YP6A 1A4IA 4N01A 3IVCA 4KDEA 3ZCRA 4NCNA 3ZWBA 3KEQA 4NBNA 1RHJA 3IT0A 3K6SB 2OEHA 3UQ2A 2J0UB 4ZCSA 2B35A 3I73A 3IKTA 2V6GA 2D1QA 3U9TA 1USVA 3PO5A 1SZCA 4HNSA 5DB7A 2JVIA 1OYYA 4R66A 4C0BA 5L3SA 3RJIA 4R4JA 1B2RA 5AVWA 5HKLA 3IUMA 1E9SA 4ONEA 3NP7A 4CJXA 2QXUA 5AKLA 1HC7A 3A4NA 1G2IA 5CFNA 4PYQA 5CP2A 3BRWA 5K45A 1BPXA 5HCIA 4DRYA 1UBHS 4B3JA 2OHGA 4BVJA 5FUWA 3EZNA 2B4YA 3UB2A 3GLGA 2ZRLA 3UTCA 1P31A 5E9JA 2AT1A 3FDZA 4D6XA 1U5BA 3BX1A 3WSVA 1K3FA 4KPFC 1MHPA 1SH7A 3JD2A 1NZDA 2DY0A 4DMUB 2AQIA 3VC7A 1BROA 3C98A 1YZKA 5DB8A 3G7UA 3PPXA 2PRIA 5IJ0A 1CV2A 4IQVA 1NIJA 2Z95A 3I30X 3N2NA 2QAJA 1TM1E 3DBLB 1DQPA 1FXWF 2XMGA 3AERB 4M8IA 3HFJA 1DZIA 2D0IA 1NT2A 3HG7A 5K6RA 4R2WA 4DE5A 2OV4A 2H51A 3OKFA 4MUGA 1P1FA 4L08A 4C22A 1J7JA 1BJKA 3K70B 5KYNA 2X0JA 3ZIAA 1PJRA 3LL4A 1HETA 5JTIA 4I1YA 3IYLW 1TYAE 3O9VA 1YZTA 4BTLA 5KYTA 5L4NA 5EIXA 2A9PA 2GAFA 2RGAA 3U4HA 1QM5A 4MLDA 4DG8A 3GRPA 4DG5A 3I4CA 4K9RA 1BJRE 2IGBA 4DKJA 2PUHA 3CW8X 2WR8A 3NVVA 1V4VA 4QUIA 2AIRA 2MSDB 3NXSA 2MINA 2XTAA 5F2OA 2VJDA 1P4AA 3R7DA 2EFGA 4KLZA 3SR0A 2G0TA 4DCPA 1WOYA 1ZMXA 5CYFA 5KZMB 5JZBA 1NVXQ 3C3PA 4HDNB 2KQUA 2GPYA 1OBCA 4D6YA 2WYHA 2OFFA 3BXZA 1A95A 5JD3A 4LCJA 4EX7A 1MAVA 5FWXA 1TRHA 3KM0A 3M8KA 3MYYA 2EDUA 4GQAA 3E48A 1JPVA 5J8YC 3E4DA 3H5TA 3TMAA 5AVVA 3B85A 1L5HB 1M1YB 3UUFA 1MT0A 4V0ME 4CEJB 2ORYA 3VR4H 4CU2A 3G2QA 1DAFA 1XD2A 5D85A 1RLMA 4K1XA 3N4MB 1D6NA 4MUHA 2IW3A 1Z5PA 5AW6A 4CM3A 4ZVUA 5FWYA 1NC1A 4JOCA 3HLTA 3PR1A 3ONFA 1KERA 1Q2UA 3PYLA 4IDAA 2GZ3A 1MENA 3G5LA 1QZZA 2QRQA 2LIVA 1YVPA 3L0IB 4CMKA 3UMVA 2QROA 1HR0B 3LSYA 4NCKA 3MWGA 1QIMA 3T0FA 3L79A 2HJVA 4FZ5A 4LF9B 4R71A 3R3UA 3OIWA 4NQRA 4J6EA 1ISFA 3IV7A 2X42A 3F49S 4QELA 3CA8A 3WLEA 1KSPA 4I2IA 5JPIA 1G59A 4UU1A 4C7VA 4ZCMA 4Z9AA 5TNXA 2GKSA 4XYBA 3RVKA 5ELLA 1EK1A 4LISA 5U4XA 2PUJA 4F8EA 4QIWC 1U8XX 3JAKA 1PR9A 1EUDA 3IFSA 1KFBB 5I5EA 1D09A 2WZBA 1GNQA 2BFMA 3WDMA 3RBEA 3WLPA 2PXAA 2QT0A 4JJGA 1VMEA 4N54A 4C7ZA 1ZQJA 3IS3A 3NRCA 3AL3A 3L6OO 3RARA 1BGXT 1OZFA 2IUYA 5TPWA 3OJFA 3HJNA 4FX2A 2BYTA 4E7PA 4G1VA 1VMDA 4BLQA 1Q17A 2A5JA 3VR6D 3EAQA 3ZU3A 3QMMA 4PONA 3HHEA 4H7EA 2OGSA 3FE2A 4LSZA 4TZ0A 1MOSA 2XC9A 2ACWA 1Y5RA 5EJMA 1NXTA 2D7DA 3EMKA 5L3VA 4TUYB 3KCNA 3KTAB 2E2WA 3R3XA 4O4IF 2RH9B 3M1IA 3PC3A 4J9RA 1DDOA 3BORA 3ZTYA 4RNMA 2EKDA 4JHLA 1BDBA 1I32A 2PKQP 2E1FA 2CE2X 1XDWA 1W5FA 4LZOA 3VXKA 1PJTA 8ICSA 1DWUA 4QYXA 1J5XA 5JS6A 3KYCB 2EKQA 2X2OA 4FQ7A 4QGAA 1EFCA 5IU6A 2W04A 1WSBA 3RJEA 3VYWA 5KJ1A 4KLLA 4Q19A 5FULA 1JDBC 4YASA 1A4XA 2P8SA 4D4KA 1E20A 2EWMA 1MG5A 4U8HA 4XWTA 3JQ9C 2ZZMA 1SKMA 4AZ3A 5DBCA 1XD8A 2BRUA 3MS2A 5FA6A 3BSWA 1I7NA 4R5MA 3REFA 2FZGA 1PJ2A 1R0WA 1NTOA 3PC6A 3DZ8A 3BKXA 3GAMA 4QRIA 4LYGA 3MWDA 2Q3FA 1GRQA 5T4HA 2IDMA 3QOXA 3LF1A 4MQBA 4F6RB 4JHXA 2DSNA 2W98A 4CCAA 1Z4QA 2DWQA 4MS4B 4ROSA 4EJ6A 2E5LB 3HWSA 3B1KA 4G97A 4K3VA 1ZGCA 1VDZA 4HX5A 1MAHA 1X2BA 2KE7A 2ZSAA 4DNFA 1JX6A 3SDSA 5JFOA 3X1JA 4M9NA 2Y0BA 2J4FA 5AT1A 1EDOA 4Z3KA 2OG2A 2Q7DA 2R9VA 1BMDA 3HACA 4OLFA 1TB4A 1KI7A 2VA3A 1TADA 3TDMA 5JJKA 1VDVA 1XWWA 5IHXA 2HHXA 4KR0A 1P3DA 2CSXA 5A4FS 2XKJE 5IC5A 1EVIA 3G9QA 4CV1A 4AWBA 4TUQA 5IJ9B 5KG6A 1SO8A 1TZCA 1W96A 4CKCB 3W1WA 5HJ5A 2ETVA 1OH8A 3TZCA 4YBZA 5EZSA 1A8SA 4BNIA 3NUGA 3RH5A 5KNBA 2ZE7A 3P9SA 3Q2OA 5KSZA 2UU9B 4P3XA 3I9MA 3IQWA 5EXPA 5G1NA 1A2QA 4PRLA 4Y9RA 1EJ6A 1PK3A 2I2BA 4U7JA 2K6GA 4URZR 4LZZA 2RGRA 1VA4A 1FQWA 1N5JA 4NJ8A 2J67A 2PZBA 4UATA 4DCGA 5A5GA 1NR5A 1MA7A 3RJZA 4M0PA 4EHHA 1RLUA 3H0EA 1AB5A 1TTQB 2FMPA 1TC2A 1Q1BA 4U8GA 3ESAA 5JFGA 1AX9A 4HR7A 3IUBA 3KLMX 4FB5A 4AY2A 3EGXA 4IR9A 4KFSA 3BQ1A 3L4PA 2XO7A 2WLTA 4WFQA 4OBEA 5M04A 1W88B 2JHPA 1YQTA 4KAAA 1L3SA 1UT5A 3E2MA 1BDMA 1FYEA 3CURA 2PRJA 2GEUA 1ML3A 2IS2A 1XTBA 1G2OA 1OLSB 1IIBA 2WBLC 3ZCPA 2OBFA 3GGDA 3IHTA 4IC9A 1EG2A 3PXAA 4LPSA 3C3CA 4HWTA 1EFRA 4CMAA 1KZGB 2ADMA 4XVUA 2I6UA 3OPQA 3WAJA 5KOYA 4UDOA 4TT8A 5B3KA 4ZMSA 5AM1A 2VZLA 3ZGNA 4QDOA 2PSEA 1INLA 2GCEA 1PZEA 3D3KA 1FSSA 5LYJB 5AKEA 3RAGA 4TQRA 2DTEA 3HEMA 2V6JA 5F9MA 4HYTA 3R9XB 3GIWA 1I7PA 3CUEF 3TD2A 1UOPA 2GSDA 4F4UA 3OZSA 2W6JA 5ALXA 3GLFE 3DVLA 2ZE8A 3LHKA 4NC9A 2GYVA 4EQ6A 4M7OA 3SQMA 3BJEA 3FPSA 2A86A 3BXGA 1KKMA 2W2VA 3REGA 3PS9A 4RSMA 4NIMA 1P74A 4C78A 3PD1A 4C3ZA 4DIEA 3PFFA 3BXFA 1XAHA 4MGYR 5ALIA 4Z49A 4BZXA 3PVCA 1JIKA 3VDMA 1WCNA 3WRWA 1I0ZA 5C5JA 4CG3A 3ND7A 4I2NA 4KLMA 5TF0A 1AMUA 2BWJA 3QFHA 2Z2IA 4HEHA 3ZU2A 2VQDA 2R1VB 3FROA 1I4TD 2JGKA 5JW6A 3IAAA 4EJSC 5J0OA 2ECQA 1YZ6A 2C31A 2Y6UA 4KWHA 4I2HA 3NTQA 4YCMA 4UTNA 4I5FA 1UEIA 3M6MD 5EJAA 3KAKA 1N7JA 4EVSA 1TL7C 4QTYA 3OJ0A 3SICE 5KYWA 5FQOA 1KSGA 3WLNA 4MAFA 4XGRA 4J9MA 2AN3A 3EPLA 1JR6A 4DMRA 4TVSA 2GZAA 5C8YB 3EG9A 3NJ8A 4KQMA 2MSCB 3NBFA 2F48A 1NHGA 3QX9A 2FPSA 5LD2C 2HRBA 4QIHA 4EG5A 3ONNA 3W6UA 3KTQA 1GXSB 4I2FA 2ODWA 1BVHA 1NVEA