2F8KA

Sequence specific recognition of rna hairpins by the sam domain of vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
SSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*UP*AP*AP*UP*CP*UP*UP*UP*GP*AP*CP*AP*GP*AP*UP*U)-3'
publication title Sequence-specific recognition of RNA hairpins by the SAM domain of Vts1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/ rna
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f8kA00
4NJ8A 1X9XA 2DL0A 5JRTA 1WWVA 1F0MA 2QARA 2KMDA 4PZNA 1LKYA 1OXJA 5J8YA 4RQMA 3BS5A 2QB1A 2Y9UA 2KSOB 3BQ7A 3KKAC 5F3XB 1SV0A 2L5YA 2F3NA 2E8NA 2F8KA 3IDWA 1SGGA 2JV3A 2Y9TA 4NL9C 3H8MA 1PK3A 2D3DA 1V85A 1KW4A 4PZOA 2KSOA 2FE9A 2E8PA 1UCVA 2ESEA 3TACB 1COKA 4MHVA 2F44A 3SENA 2DKXA 2E8MA 5J8YC 2EAPA 4IS7A 2KE7A 1B4FA 3K1RB 4RQNA 3TADA 1Z1VA 1SV0C 2DKZA 2B6GA 1X40A 2LPEA 1JI7A 2KG5A 2EAMA 1V38A 2KIVA 2EANA 1X66A 3HILA 2EAOA 2ES6A 1PK1B 1OW5A 2QKQA 3KKAA 2K60A 1SV4A 1RG6A 2QB0B 2GLEA 5JU5A 1UQVA 3SEIA 4NL9A 5L1MA 2QARB 1LKYB 5KNIA 2E8OA 2D8CA 2K4PA 1PK1A 3TADC 3BS5B 1B0XA 1DXSA 2LMRA 1WWUA 5JTIA 2QB0A 1SXEA 1SXDA 2YTUA 3BS7A
chains in the Genus database with same CATH superfamily
3TAQA 1NOMA 4I2GA 2E5SA 2YQEA 1ZQDA 1JUDA 7ICOA 3FAHA 5CRXA 2KSOB 2PFOA 3QUTA 4O3PA 1S77D 3O0FA 2W9CA 3HPOA 1SV0A 5AKLA 3TI0A 2E8NA 4C7YA 3QU4A 7ICJA 4AP9A 1JROA 5GTIU 2DUYA 1FO4A 3PSPA 4CRXA 3MGHA 2AH5A 3RAXA 3SZ2A 4EZ9A 5B5EU 2K8BB 2BCSA 2Y1JA 1Q3UA 1NK4A 1JXEA 2XC9A 5HR7A 4I2IA 3PSTA 4GC7A 4UW9A 3IV6A 4C8MA 5KT7A 2HMXA 1HEKA 2GO7A 4P2HA 2E3TA 2H3ZA 2LI6A 1ZQZA 3ZD9A 4C4TA 3LVVA 3QUCA 5KG5A 8ICBA 1PVRA 4NY8A 3CW2C 1A77A 3PY8A 3JPTA 4QZBA 4CDGA 4DL7A 1NZBA 2ZG6A 1TVAA 5KFBA 1XO0A 5KFGA 4F5PA 2KHVA 5KFMA 2EAOA 3ISDA 4UQGA 5HHIA 1A76A 1C7YA 3C23A 2FMSA 5KAIU 1X9MA 1QSLA 3T3FA 7ICLA 1NZPA 3GDXA 1NJXA 3WK6A 4MFFA 5DGBA 4JWNA 2HVIA 5J0WA 9ICKA 3NRWA 2PKEA 2OEHA 1DXSA 1WWUA 4Q8FA 2M0NA 3GIJA 9ICFA 4RUCA 8ICHA 1U48A 5L1LA 5BOMA 1LKYA 5AK3A 2MSNA 3RH6A 1BPXA 2VKQA 1SL1A 4YMNA 5J0QA 2FLNA 2Y9UA 5AM2A 3NS1A 2NRTA 4NLGA 5J0OA 1XO1A 4M0AA 1PZNA 4I2HA 2EDUA 1S10A 5DKWA 2W43A 4M04A 1ZQMA 9ICAA 4MFCA 3UQ2A 1UCVA 4IRDA 5H2FU 2ISPA 9ICUA 2GOLA 3TANA 2H3FA 2KEYA 4UBCA 3MBYA 2I1QA 4NV0A 3QZ7A 3PW4A 2EAPA 1KQQA 4IS7A 1COOA 2XO7A 4Q8EA 1Z1VA 2R8GA 1VJ5A 2ZUCA 2DKZA 4Y2TA 1ZQSA 4F50A 1NKEA 5KT2A 4IRKA 3LYSA 2F77X 2KIVA 5KFQA 3G6XA 4PL2A 4EEYA 2BPFA 4EYHB 3BJYA 3V6HA 4Z6DA 3Q8QB 4YFKA 4RQ6A 3MR6A 1QTMA 9ICSA 2W8KA 5CHGA 1U9LA 3AN1A 5D46A 3SQIA 2XICA 2VA8A 2KKVA 2HHSA 3RJJA 3WKBA 4ED0A 4QZCA 4B9LA 3SAGA 1SL2A 2QB0A 4MF8A 1WG8A 1ZQYA 4OCZA 4UAZA 3WK7A 1BNPA 5JRTA 4F4XA 1IV8A 3M6ZA 4CNQA 1MC8A 4NWIA 3SI8A 4F91B 4JK1A 1KTQA 3C5GA 4KN7A 5KFYA 4Z6EA 3WKEA 4Y2PA 2HBLA 2IHMA 4TURA 8ICLA 3QX7A 1H38A 1NK6A 3B0YA 4O0IA 2KVCA 5AKZA 4RZRA 8ICEA 5KFTA 8ICIA 3SD7A 3QEAZ 5IIKA 5HMLA 1SWVA 4I2FA 5DQHA 1YZ6A 4P0QB 1D9DA 3UXNA 3KTQA 7ICRA 4DFJA 2HHXA 5ALWA 1ZQWA 5ALSA 8ICTA 2G5HB 2ZIWA 2LBOA 3QXGA 4F5NA 4DEZA 1L7MA 4K4IA 5AI0A 1Q8KA 4DOBA 5KFJA 3J81j 3S6JA 3OHBA 3SAHA 1DGJA 5AKEA 3UMGA 4P0PB 1DK3A 2EANA 3H7IA 2JEIA 3B0XA 2BPGA 2ES6A 5AICA 4EBEA 2C2DA 3KKAA 3ETLA 4ED6A 2AJQA 2GLEA 2CXYA 4KLHA 4UASA 4B9SA 2YB4A 1CUKA 5G5GA 2C2RA 4MEYA 5AI6A 3LK9A 1UT5A 3C1YA 5CJ7A 5ALTA 5AHXA 3FM9A 4ED2A 3NGDA 1ZQEA 2C2EA 2KK0A 9ICNA 4RQ4A 3RJEA 4QIWF 4XQ8A 3Q8MA 1X9XA 3H0RB 3UMCA 3WKCA 2A1AA 1TAQA 9ICOA 2KICA 1X42A 2HHQA 1S9FA 2WF9A 5J8YA 5J2GA 1ZQAA 3PMLA 1K1SA 3TQ1A 1LVHA 3QUBA 3PW7A 3EYZA 2UVUA 3PW2A 1JN3A 3WK8A 2OYYA 2FMQA 3TKAA 4M47A 1ZD2P 4JB3A 4DOCA 4Y2QA 3EUB2 1ED1A 5CA7A 8ICRA 5ALRA 4IL6U 1AQ6A 4OJOA 5AKYA 8ICVA 4KLUA 1ZQPA 1KLNA 3MFIA 2ESEA 1UPHA 1L7OA 3PW5A 3MGVA 4DO9A 2HBKA 4RQ5A 2LYBA 5J2BA 3SV4A 3WK4A 1HJPA 5KG1A 1ZQGA 2G0AA 3PO4A 4QIWC 4J9MA 2OXOA 1KSPA 3GQCA 3T5HA 4KX5A 2JZBB 1FEZA 4USAA 1D9FA 9ICQA 4GXJA 1SKSA 2F1IA 2HBMA 2YX8A 3H0LB 1JI7A 4JWMA 1KN5A 1XSLA 4ECTA 1NJZA 2OM6A 5KFZA 4C7ZA 3MR2A 1PK1B 4TUPA 5EE3A 2YB1A 4ELUA 2YMQA 4ECWA 2ZUDA 2ASJA 1L3VA 4BUGA 1ZQJA 4KLIA 3HKZC 1TFRA 3PX0A 2WTFA 3MGIA 2RQ5A 2N1RA 4PJ0U 4DS4A 4PHDA 4PGYA 4F5QA 3PNCA 2ZJAA 2ZIVA 1K1QA 3BS7A 4ED3A 2DPJA 4QZHA 1X6JA 2P35A 2KIWA 2W9BB 3JPNA 1OXJA 2ASLA 2ZTCA 1J97A 2FLLA 4M2YA 3HX0A 5EE0A 1HIWA 2LKYA 1MQ3A 7ICIA 8ICZA 1JIHA 2WB1F 4I2EA 5CP2A 1BPYA 2JV3A 4YXMA 3PR4A 1NKCA 3C5FA 3JPPA 9ICJA 2Q0ZX 1Z4OA 2D3DA 4F3OA 2G08A 5KT5A 2HOFA 2E8PA 5AKKA 2F44A 3T79A 2F8LA 2J6UA 1XSNA 1Q3VA 1KEJA 2KJ8A 3FDSA 3TARA 3PO5A 3TFRA 3F5EA 4YR2A 2A19A 3EZ5A 1TK8A 5ALJA 4B9UA 2PMZF 2KV2A 5KFDA 2W54A 5EE9A 2LYAA 2WF8A 2WB1C 4QJFB 2ZIUB 1QSSA 2XCPA 5IINA 4F5OA 3H0MB 3UPQA 3CRXA 2H3QA 3T5KA 3HWTA 5ALGA 2HHTA 5JU5A 4CF3A 1UQVA 3RF9A 2NRVA 2W03A 5KNIA 2FJ6A 5KFAA 3C1ZA 3SMVA 3HRDD 4O5KA 5AM0A 1SXDA 3ORYA 4DL3A 4B9MA 3AUOA 2EZZA 7ICTA 5AKIA 2HW3A 4YMMA 2VIXA 5L9XA 5A0LA 1KBUA 4K4HA 4DSEA 2RDIA 5IIMA 4DQPA 2I9GA 3FYHA 3RB0A 3ZDAA 5J0SA 2DFLA 1JX4A 2LM4A 4NL9C 3ZDDA 4C8KA 3H8MA 4KLEA 4YMOA 2OHFA 5KFXA 4F4WA 2ISOA 4YQWA 4ECVA 3RJGA 1TE2A 3NVWA 4RQ7A 5TZVA 2A3VA 3VC8A 2HSZA 3D2SA 5AM3A 2GWSA 1O03A 1B43A 2A1JA 4Z6CA 4DQQA 3K1RB 4RQNA 3CYMA 1J2NA 5DG7A 1SV0C 2IOFA 3D6JA 4BX9C 3JPSA 2NRXA 2H3IA 2AU0A 5KG6A 3RBEA 5DB8A 3RB4A 1IXRA 4DL4A 3L5KA 4RPZA 1NKBA 1ZQVA 2MUTA 2UVRA 4J9RA 1TK0A 4DL2A 3UMBA 1VDVA 2P66A 3OJUA 4RNOA 1RG6A 4OJPA 2BDPA 3GV5B 4KMUA 2K4PA 2KP7A 1DRGA 2HHWA 3C29A 1UA0A 4IQUA 2RHFA 1NK9A 2JMGA 4YR0A 3BZKA 1ZXIA 1QLNA 2ZXHA 4LVSA 1Y88A 3IP4B 3G6YA 4US8A 4YN4A 1WCLA 4KITB 1WWVA 1F0MA 2QARA 4ED8A 5D49A 2Y1IA 1S76D 2W3SA 1L8OA 3BS5A 1SZHA 5J2FA 3UM9A 3QEBZ 3GILA 1JMSA 4DLEA 2KKPA 1JALA 3K75D 2BKEA 1PUZA 4IR9A 1TAUA 4R8UB 3BQ0A 4TQRA 3ETRA 1IG6A 5KFWA 1SB3C 5J0UA 1T7PA 3KBBA 3TACB 3F2BA 5HR6A 4CF5A 5AI4A 2JRZA 1CRXA 1L5UA 2IA6A 3HP6A 1KFSA 1X6IA 3RRHA 2JR5A 2E8MA 3AL0B 4IR1A 2RLTA 1N5WA 3EWAA 3A0HU 4KLSA 3DEEA 1NK0A 4FZMA 2W7OA 3TADA 4DOAA 5E79U 4DF4A 3AEVA 2BQRA 3F53A 1FFUA 3DV9A 1K5OA 4PGXA 2G07A 2EAMA 2WF5A 2JEGA 2KNJA 4GLXA 4OJ6A 4CE6A 4BXOA 4FS2A 2QKQA 5KG7A 1MA7A 2K60A 3H8WA 3MABA 1ZQXA 3E2EA 5GTHU 2HOQA 5J2HA 1JRPA 4Y2RA 1JXLA 1BPDA 4B9VA 4FZNA 5DB9A 3F2DA 4JV2A 1SIJA 2OCEA 4M9JA 2NRWA 4CGZA 5KFNA 1T94A 5AIBA 2VJ4A 5KAFU 4AYBF 2F76X 3K1ZA 5ALHA 5AI5A 4QZ8A 1QQ6A 5KTQA 3NASA 1S0OA 4Q45A 4QZFA 2EQYA 2ODGA 4DS5A 1X9WA 5DQIA 3JPOA 1Z00A 2ZIXB 8ICGA 2BQUA 1ZQBA 4IQWA 3JPQA 2Y9TA 1P7DA 4ECSA 1YZ7A 2H3VA 2JGAA 4KLOA 2DPIA 1ZQFA 1PK3A 4DLGA 3M9OB 2FDRA 1L3SA 4O3QA 1BVSA 2AHOB 2KSOA 7ICHA 2R8KA 3GZFA 2ASDA 4Q44A 4O3MA 3F2CA 4MHVA 2YN4A 2AGQA 5KFIA 2MAXA 2MU2A 1ZQCA 4EYIB 1FFVA 4M6WB 1UA1A 5J29A 4EBCA 4YG2A 5DLGA 4KLTA 3QU9A 4AYBC 4B9NA 3QYPA 4ACOA 9ICMA 5KFPA 4JMUA 2ZIVB 2ATLA 2G5IB 3RBDA 5DB6A 3QNMA 1S0VA 3QU2A 1L3TA 3N28A 1ZQIA 3CNHA 4YD1A 1RYUA 9ICTA 2PFQA 3V6KA 4F8RA 5J0XA 4QZGA 2HHUA 4GFJA 1N62A 4IC9A 4NLBA 7ICMA 3EPGA 5EWGA 3M1YA 4MEXA 2KFNA 2R8HA 5EE1A 3C2LA 4F4KA 1VLBA 5ALFA 4GXIA 3HW8A 2E8OA 4ED7A 1ZYQA 3TFSA 1F5SA 2Y0SF 4J9SA 4P4MA 7ICFA 4B6JA 4P4OA 2W9AA 4Q43A 4F92B 3T5LA 4FS1A 2C22A 3WU2U 2QB1A 1B22A 3KKAC 5IIOA 4QWEA 4RT3A 5F3XB 3UQ0A 4ECUA 2VJ5A 1TKDA 1ZQTA 3H4DA 4J9KA 5C5JA 2G09A 3Q8PB 9ICXA 1WUDA 5FP0A 2FPKA 1S5LU 2DWQA 1RQLA 1X2IA 2HVHA 4HYKA 2PFPA 7ICKA 2Y0SC 2FI1A 2AQ4A 3BZCA 5J8YC 2V4RA 1HUOA 1N61A 2K4HA 5AKHA 1RYSA 5C0YA 2CPRA 3AMZA 4ELVA 4KLGA 3MR3A 1GO3F 2B6GA 1ZD3A 3F5AA 3PSIA 1N63A 4BJQA 4J03A 3IM1A 4ELTA 5KFLA 1ECWA 3H8JA 1RQNA 4O5CA 2PI4A 2XI9A 2AQ0A 3SV3A 3VCBA 4M9LA 2XCAA 1UT8A 3PMNA 4F2SA 2XY7A 3NVYA 3I28A 4DFKA 3THVA 2B21A 4KLQA 2K4IA 3OGUA 1T3NA 3M8SA 5J2DA 1S0MA 5KFOA 5AM4A 5KG2A 1U47A 4DF8A 4EX7A 2W9CB 3N7RC 4EEKA 5AKJA 2HOIA 2ZTDA 8ICKA 1BGXT 3ZI4A 1J2MA 4C8NA 3WK9A 5AKGA 3KZXA 5J2EA 4Y2VA 1NI3A 1M6YA 5DB7A 5DBBA 4DSIA 4NLNA 4G9BA 1NJWA 1EXNA 3RJKA 2DF4B 1ZQOA 5J0PA 2FE9A 1XNSA 4DL6A 4GIBA 1KRPA 4J9LA 1SL0A 4F5RA 3ONNA 4JV1A 3Q8LA 4A8EA 4UAUA 5L1KA 1U4BA 8ICOA 2I5HA 3NRZA 5CWRA 3ZDBA 4QWAA 3QU7A 4U7CA 4P0QA 3G6VA 4C4RA 5J0TA 1QQ5A 4GXKA 1QSYA 7ICVA 2LPEA 2R8IA 1D8YA 4ECRA 4OO1J 2KG5A 9ICIA 3ISCA 2BR0A 3HILA 3NUQA 3QU5A 4J9NA 3L3FX 3ZD8A 4O3SA 5KT3A 7ICPA 3D2NA 3GFKB 2HCFA 2LYHA 3V7KA 3SAFA 4EELA 5KFEA 4XUSA 1BNOA 1QH9A 1ZRMA 3N7SC 3SEIA 4UAWA 4UBBA 3D2QA 3MR5A 4P0PA 1LKYB 5HMMA 5IILA 5J2JA 2NV3A 2LMRA 3KHGA 1X9SA 5HNKA 1SKWA 3WKDA 2KMDA 4PZNA 4I28A 3AQEA 4DSLA 2VA2A 3JPRA 4UB1A 9ICEA 1KFTA 2JEFA 1ZQRA 2K8CB 4EX6A 5CEHA 5AM1A 4UB4A 1URJA 2BQ3A 4DFDA 3NVZA 2F1JA 2JHDA 5J0YA 3KZIU 4F71A 4PGQA 2PMZC 1QQ7A 2FLPA 3OSNA 3E0FA 1WCNA 4F2RA 1RXVA 1ZD4A 5G5HA 1BPBA 5ALEA 4WJ3B 2KOBA 1D8LA 5ALUA 1PVPA 2W9MA 1NNLA 2XVTA 2DGZA 4QWDA 1V9PA 1V97A 3IRUA 5ALNA 4DCCA 4DWIA 5HP4A 1ZETA 3DDHA 8ICJA 5J2IA 2K8AA 4QW9A 4NM1A 4QZIA 1BPEA 5DBCA 3N4MB 1Z3EB 3QUQA 5KL8B 4DFPA 3BQ1A 4DQSA 5KFSA 4QWBA 3MDAA 4FBTA 1KKXA 4GC6A 4DQIA 1X66A 4KLDA 2JZBA 4ZOHC 3LVWA 4O5EA 3I76A 1BPZA 3U26A 4ECZA 7ICSA 5L1IA 1SV4A 5KFUA 2QB0B 1TK5A 4CF4A 5DG9A 8ICYA 4RNNA 2OWOA 4O3OA 5JUMA 4UB5A 4IRCA 5J2CA 1PK1A 3OTQA 3AU2A 1B0XA 1ZQKA 4F72A 4NLKA 3C28A 4QZ9A 3M8RA 1S97A 4FZLA 2PFNA 4Z6FA 3V6JA 3PVXA 3PX6A 1RZTA 4F4ZA 5KG0A 5ALPA 1Z1BA 2MA1A 4O3NA 3V72A 3ICXA 1T3QA 5KG4A 2L5YA 2K4EA 1KFDA 4C4SA 3LDAA 5CR0A 2W9BA 2J6TA 1ZQHA 5T14A 1XWLA 2ZIWB 3EPIA 5BPCA 5AK6A 4DFMA 3PX4A 1RPLA 3AU6A 1L3UA 1MQ2A 1RYRA 4DSFA 5KFRA 4Y2JA 2B0CA 2E1EA 1XSPA 3NVVA 4PHAA 2XY6A 2UVWA 2JEJA 2P6UA 1Q46A 5EWEA 1ZQ1C 1TV9A 4OJ5A 4YVZA 5KFFA 2H5XA 3KD3A 2ZUBA 2W8LA 3C2KA 4PL1A 8ICFA 3GV8B 2NO4A 4US9A 2RP5A 4G3IA 2O6KA 1ZQUA 4QNLA 3UXPA 3ISBA 3T5JA 1V38A 3A0BU 5DQGA 4DSKA 2W3RA 4TUQA 1S0NA 2RDJA 2QLTA 1CI4A 2KVSA 1N2XA 4UATA 3RRGA 4IQVA 2ZIUA 3B9JA 5AIAA 2VANA 9ICVA 2FMPA 2W55A 2BCRA 3QE9Y 2WAQF 5KFHA 3TADC 4ED1A 2CN1A 4RPYA 3I1YA 3RJFA 3H8SA 4UAVA 4R64A 4FO6A 4QWCA 3N97B 2WFAA 2FPLA 5DDMA 1TAMA 1ZJNA 2KTQA 9ICGA 1KDHA 4UB8U 4KMOB 3FC4A 1N48A 1NK8A 4C0ZA 4RUAA 5EWFA 3RJHA 3BQ7A 1N5XA 2ZTEA 4NM2A 4YD2A 3GIIA 2BCUA 1PVQA 1ZD5A 4RPXA 4R66A 1XS9D 1DGSA 5D4BA 4EZ6A 3KHHA 1L7PA 2K89A 8ICMA 3L4PA 7ICNA 1IM4A 9ICHA 2WF7A 4EENA 5KT4A 2WAQC 4EBDA 2BCVA 5DGAA 3SYZA 1IIPA 3MDCA 3GV7B 1N56A 2E1FA 3QZ8A 5DG8A 4MFAA 2YMLA 1L8LA 2HBJA 3AM9A 2ZJ5A 4PHEA 5AKXA 4YXJA 1RXWA 4XRHA 3K4GA 4M9HA 5ALDA 3EW9A 2R8JA 5KFKA 2YMMA 4IQTA 4Y2UA 9ICRA 1A6SA 1X40A 2VA3A 3C2MA 3KFUF 2EZXA 1LV5A 1MN8A 1N60A 3RTVA 1SKRA 3V7JA 2JH7A 4PHPA 4BWJA 4ICAA 4R65A 2BPCA 5BOLA 4FFDA 4RQ3A 4TQSA 4QW8A 2KZMA 3MC1A 3AQFA 1L6NA 4MF2A 7ICEA 1ZJMA 1DOQA 1UHUA 4OD0A 4I2AA 3H40A 1YT3A 5KG3A 3KHLA 4NJ8A 3BQTA 4LZDA 2JXJA 3KOOA 2YY6A 5J2KA 3Q8RB 4JUZA 3BQ2A 1HUZA 4XA5A 5ALMA 2NO5A 1D8BA 3OHAA 3PW0A 4UARA 2KZ3A 2PXIA 1RDFA 3IDWA 3BDPA 5J0RA 4I2DA 3RR8A 1NK5A 2PI5A 1V85A 4KTQA 5DLFA 5F9LA 5DBAA 3ZDCA 1COKA 4UB6U 4BGDA 5ALZA 1RM6C 5IIJA 1T4GA 2XGPA 1OUQA 9ICPA 2WF6A 4HAIA 5IIIA 3MFHA 4FBUA 1SWWA 4QZAA 2AGPA 4RQ1A 4R8UA 3HT3A 2HHVA 4C8LA 3RH5A 4TUSA 2W04A 3ED5A 3N7PD 3SR6A 5ALLA 2FPMA 2BDUA 1XC9A 4YCXA 2ZXIA 2NYVA 2M9NA 5KFCA 4I27A 4M9GA 8ICAA 3GU3A 1OW5A 4C8OA 4NXZA 4M9NA 2C28A 2V9WA 3PSFA 2KJ9A 1XU4A 3HJEA 5ALVA 4UB2A 2XY5A 2WHEA 3GIMA 1A0PA 1Z4NA 4KLFA 5L1MA 8ICXA 1U45A 3M9NB 2YMPA 2AXTU 2G06A 2OH2A 4YR3A 2Q4TA 4KLMA 5AK5A 4DQRA 5KFVA 2J6SA 2BZFA 4DL5A 1S8OA 2YTUA 2DL0A 2KD1A 4O9MA 4KLJA 3RH4A 1F44A 3Q8SB 9ICCA 5AI9A 4RQMA 3HKZF 5AK4A 4DSJA 8ICPA 4QZEA 3Q8KA 4UAYA 4U6PA 2HDOA 2F3NA 2HI0A 4J9PA 2F8KA 5ALXA 1KL9A 1SGGA 4LJXA 1L7NA 3E58A 4OJLA 3KHRA 5TISU 3TAPA 3PZPA 3RR7A 5ALIA 8ICNA 4CCHA 2A1JB 4PZOA 2BCQA 2W7PA 2EZYA 4RU9A 8ICQA 3ZDEA 2KJ5A 2ZIXA 5J2AA 4P4PA 3SENA 1DK2A 1ZRNA 5CB1A 2F1HA 2LHTA 7ICUA 3M7DA 3RAQA 2P6RA 4ECQA 5AM5A 4I2BA 4Y2YA 3RFAA 3PV8A 1B4FA 4ECXA 3GIKA 2MUTB 2DQNB 2W11A 4M6WA 4RT2A 2F2AB 2ALZA 1ZQLA 4I2CA 2IMWP 4X5VA 8ICUA 4ZH4A 3V7LA 1ZQQA 4BDPA 3M9MB 2I6XA 1CEZA 2GH1A 4BWMA 5ALYA 8ICWA 4F4YA 4R63A 2XIDA 4NLZA 8ICCA 4ECYA 2QARB 4E0DA 2D6FC 9ICWA 2AGOA 2IOFK 4LZGA 3BS5B 5ALKA 5JTIA 3RJIA 1SXEA 2DKXA 5AI8A 4F93B 4Y2SA 5K4LA 4RNMA 3NTUA 4PH5A 3M6KA 1Z19A 2LM1A 4Y2XA 2IHNA 1ZOLA 3UXOA 4KN4A 9ICLA 2IBKA 1ZQNA 1LB2B 4QZDA 2KZZA 5ALQA 2DBYA 2JH1A 1QCKA 5DDYA 1C20A 2NRZA 2KHQA 4PPXA 4UB3A 5ALOA 4RQ8A 3RB3A 4I2JA 8ICSA 2R18A 1KW4A 4FE3A 2UVVA 4J9OA 2Z7JA 5F9NA 5EOZA 9ICBA 4B9TA 4KLLA 1NK7A 1T8EA 4YP3A 3LWLA 2CRXA 1SZPA 2RRDA 7ICQA 4KX3A 4C80A 2KE7A 5B66U 3PR5B 2XGQA 2EH9A 3OPXA 3IG8A 4BXOB 1FIQA 2ZJ8A 1NJYA 3IHQB 2KN7A 3RB6A 3H4BA 2BGWA 4O3RA 3R9KA 3LWMA 5KL1B 1MSWD 2BHNA 3C21A 4J9QA 1WYGA 3WKAA 4NLCA 4JV0A 5KT6A 4I29A 2KFZA 5L1JA 3IG5A 2IOHA 4K4GA 2MRLA 4RQ0A 1AROP 1U49A 5HHHA 3OSPA 2V4QA 3CP8A 7ICGA 4NL9A 2D8CA 1O08A 4RQ2A 3OJSA 3WK5A 3IN5A 3ALRA 1Z00B
chains in the Genus database with same CATH topology
4NJ8A 1X9XA 2DL0A 5JRTA 1WWVA 1F0MA 2QARA 2KMDA 4PZNA 1LKYA 1OXJA 5J8YA 4RQMA 3BS5A 2QB1A 2Y9UA 2KSOB 3BQ7A 3KKAC 5F3XB 1SV0A 2L5YA 2F3NA 2E8NA 2F8KA 3IDWA 1SGGA 2JV3A 2Y9TA 4NL9C 3H8MA 1PK3A 2D3DA 1V85A 1KW4A 4PZOA 2KSOA 2FE9A 2E8PA 1UCVA 2ESEA 3TACB 1COKA 4MHVA 2F44A 3SENA 2DKXA 2E8MA 5J8YC 2EAPA 4IS7A 2KE7A 1B4FA 3K1RB 4RQNA 3TADA 1Z1VA 1SV0C 2DKZA 2B6GA 1X40A 2LPEA 1JI7A 2KG5A 2EAMA 1V38A 2KIVA 2EANA 1X66A 3HILA 2EAOA 2ES6A 1PK1B 1OW5A 2QKQA 3KKAA 2K60A 1SV4A 1RG6A 2QB0B 2GLEA 5JU5A 1UQVA 3SEIA 4NL9A 5L1MA 2QARB 1LKYB 5KNIA 2E8OA 2D8CA 2K4PA 1PK1A 3TADC 3BS5B 1B0XA 1DXSA 2LMRA 1WWUA 5JTIA 2QB0A 1SXEA 1SXDA 2YTUA 3BS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  1X9X A;  2DL0 A;  5JRT A;  1WWV A;  1F0M A;  2QAR A;  2KMD A;  4PZN A;  1LKY A;  1OXJ A;  5J8Y A;  4RQM A;  3BS5 A;  2QB1 A;  2Y9U A;  2KSO B;  3BQ7 A;  3KKA C;  5F3X B;  1SV0 A;  2L5Y A;  2F3N A;  2E8N A;  2F8K A;  3IDW A;  1SGG A;  2JV3 A;  2Y9T A;  4NL9 C;  3H8M A;  1PK3 A;  2D3D A;  1V85 A;  1KW4 A;  4PZO A;  2KSO A;  2FE9 A;  2E8P A;  1UCV A;  2ESE A;  3TAC B;  1COK A;  4MHV A;  2F44 A;  3SEN A;  2DKX A;  2E8M A;  5J8Y C;  2EAP A;  4IS7 A;  2KE7 A;  1B4F A;  3K1R B;  4RQN A;  3TAD A;  1Z1V A;  1SV0 C;  2DKZ A;  2B6G A;  1X40 A;  2LPE A;  1JI7 A;  2KG5 A;  2EAM A;  1V38 A;  2KIV A;  2EAN A;  1X66 A;  3HIL A;  2EAO A;  2ES6 A;  1PK1 B;  1OW5 A;  2QKQ A;  3KKA A;  2K60 A;  1SV4 A;  1RG6 A;  2QB0 B;  2GLE A;  5JU5 A;  1UQV A;  3SEI A;  4NL9 A;  5L1M A;  2QAR B;  1LKY B;  5KNI A;  2E8O A;  2D8C A;  2K4P A;  1PK1 A;  3TAD C;  3BS5 B;  1B0X A;  1DXS A;  2LMR A;  1WWU A;  5JTI A;  2QB0 A;  1SXE A;  1SXD A;  2YTU A;  3BS7 A; 
#chains in the Genus database with same CATH topology
 3TAQ A;  1NOM A;  4I2G A;  2E5S A;  2YQE A;  1ZQD A;  1JUD A;  7ICO A;  3FAH A;  5CRX A;  2KSO B;  2PFO A;  3QUT A;  4O3P A;  1S77 D;  3O0F A;  2W9C A;  3HPO A;  1SV0 A;  5AKL A;  3TI0 A;  2E8N A;  4C7Y A;  3QU4 A;  7ICJ A;  4AP9 A;  1JRO A;  5GTI U;  2DUY A;  1FO4 A;  3PSP A;  4CRX A;  3MGH A;  2AH5 A;  3RAX A;  3SZ2 A;  4EZ9 A;  5B5E U;  2K8B B;  2BCS A;  2Y1J A;  1Q3U A;  1NK4 A;  1JXE A;  2XC9 A;  5HR7 A;  4I2I A;  3PST A;  4GC7 A;  4UW9 A;  3IV6 A;  4C8M A;  5KT7 A;  2HMX A;  1HEK A;  2GO7 A;  4P2H A;  2E3T A;  2H3Z A;  2LI6 A;  1ZQZ A;  3ZD9 A;  4C4T A;  3LVV A;  3QUC A;  5KG5 A;  8ICB A;  1PVR A;  4NY8 A;  3CW2 C;  1A77 A;  3PY8 A;  3JPT A;  4QZB A;  4CDG A;  4DL7 A;  1NZB A;  2ZG6 A;  1TVA A;  5KFB A;  1XO0 A;  5KFG A;  4F5P A;  2KHV A;  5KFM A;  2EAO A;  3ISD A;  4UQG A;  5HHI A;  1A76 A;  1C7Y A;  3C23 A;  2FMS A;  5KAI U;  1X9M A;  1QSL A;  3T3F A;  7ICL A;  1NZP A;  3GDX A;  1NJX A;  3WK6 A;  4MFF A;  5DGB A;  4JWN A;  2HVI A;  5J0W A;  9ICK A;  3NRW A;  2PKE A;  2OEH A;  1DXS A;  1WWU A;  4Q8F A;  2M0N A;  3GIJ A;  9ICF A;  4RUC A;  8ICH A;  1U48 A;  5L1L A;  5BOM A;  1LKY A;  5AK3 A;  2MSN A;  3RH6 A;  1BPX A;  2VKQ A;  1SL1 A;  4YMN A;  5J0Q A;  2FLN A;  2Y9U A;  5AM2 A;  3NS1 A;  2NRT A;  4NLG A;  5J0O A;  1XO1 A;  4M0A A;  1PZN A;  4I2H A;  2EDU A;  1S10 A;  5DKW A;  2W43 A;  4M04 A;  1ZQM A;  9ICA A;  4MFC A;  3UQ2 A;  1UCV A;  4IRD A;  5H2F U;  2ISP A;  9ICU A;  2GOL A;  3TAN A;  2H3F A;  2KEY A;  4UBC A;  3MBY A;  2I1Q A;  4NV0 A;  3QZ7 A;  3PW4 A;  2EAP A;  1KQQ A;  4IS7 A;  1COO A;  2XO7 A;  4Q8E A;  1Z1V A;  2R8G A;  1VJ5 A;  2ZUC A;  2DKZ A;  4Y2T A;  1ZQS A;  4F50 A;  1NKE A;  5KT2 A;  4IRK A;  3LYS A;  2F77 X;  2KIV A;  5KFQ A;  3G6X A;  4PL2 A;  4EEY A;  2BPF A;  4EYH B;  3BJY A;  3V6H A;  4Z6D A;  3Q8Q B;  4YFK A;  4RQ6 A;  3MR6 A;  1QTM A;  9ICS A;  2W8K A;  5CHG A;  1U9L A;  3AN1 A;  5D46 A;  3SQI A;  2XIC A;  2VA8 A;  2KKV A;  2HHS A;  3RJJ A;  3WKB A;  4ED0 A;  4QZC A;  4B9L A;  3SAG A;  1SL2 A;  2QB0 A;  4MF8 A;  1WG8 A;  1ZQY A;  4OCZ A;  4UAZ A;  3WK7 A;  1BNP A;  5JRT A;  4F4X A;  1IV8 A;  3M6Z A;  4CNQ A;  1MC8 A;  4NWI A;  3SI8 A;  4F91 B;  4JK1 A;  1KTQ A;  3C5G A;  4KN7 A;  5KFY A;  4Z6E A;  3WKE A;  4Y2P A;  2HBL A;  2IHM A;  4TUR A;  8ICL A;  3QX7 A;  1H38 A;  1NK6 A;  3B0Y A;  4O0I A;  2KVC A;  5AKZ A;  4RZR A;  8ICE A;  5KFT A;  8ICI A;  3SD7 A;  3QEA Z;  5IIK A;  5HML A;  1SWV A;  4I2F A;  5DQH A;  1YZ6 A;  4P0Q B;  1D9D A;  3UXN A;  3KTQ A;  7ICR A;  4DFJ A;  2HHX A;  5ALW A;  1ZQW A;  5ALS A;  8ICT A;  2G5H B;  2ZIW A;  2LBO A;  3QXG A;  4F5N A;  4DEZ A;  1L7M A;  4K4I A;  5AI0 A;  1Q8K A;  4DOB A;  5KFJ A;  3J81 j;  3S6J A;  3OHB A;  3SAH A;  1DGJ A;  5AKE A;  3UMG A;  4P0P B;  1DK3 A;  2EAN A;  3H7I A;  2JEI A;  3B0X A;  2BPG A;  2ES6 A;  5AIC A;  4EBE A;  2C2D A;  3KKA A;  3ETL A;  4ED6 A;  2AJQ A;  2GLE A;  2CXY A;  4KLH A;  4UAS A;  4B9S A;  2YB4 A;  1CUK A;  5G5G A;  2C2R A;  4MEY A;  5AI6 A;  3LK9 A;  1UT5 A;  3C1Y A;  5CJ7 A;  5ALT A;  5AHX A;  3FM9 A;  4ED2 A;  3NGD A;  1ZQE A;  2C2E A;  2KK0 A;  9ICN A;  4RQ4 A;  3RJE A;  4QIW F;  4XQ8 A;  3Q8M A;  1X9X A;  3H0R B;  3UMC A;  3WKC A;  2A1A A;  1TAQ A;  9ICO A;  2KIC A;  1X42 A;  2HHQ A;  1S9F A;  2WF9 A;  5J8Y A;  5J2G A;  1ZQA A;  3PML A;  1K1S A;  3TQ1 A;  1LVH A;  3QUB A;  3PW7 A;  3EYZ A;  2UVU A;  3PW2 A;  1JN3 A;  3WK8 A;  2OYY A;  2FMQ A;  3TKA A;  4M47 A;  1ZD2 P;  4JB3 A;  4DOC A;  4Y2Q A;  3EUB 2;  1ED1 A;  5CA7 A;  8ICR A;  5ALR A;  4IL6 U;  1AQ6 A;  4OJO A;  5AKY A;  8ICV A;  4KLU A;  1ZQP A;  1KLN A;  3MFI A;  2ESE A;  1UPH A;  1L7O A;  3PW5 A;  3MGV A;  4DO9 A;  2HBK A;  4RQ5 A;  2LYB A;  5J2B A;  3SV4 A;  3WK4 A;  1HJP A;  5KG1 A;  1ZQG A;  2G0A A;  3PO4 A;  4QIW C;  4J9M A;  2OXO A;  1KSP A;  3GQC A;  3T5H A;  4KX5 A;  2JZB B;  1FEZ A;  4USA A;  1D9F A;  9ICQ A;  4GXJ A;  1SKS A;  2F1I A;  2HBM A;  2YX8 A;  3H0L B;  1JI7 A;  4JWM A;  1KN5 A;  1XSL A;  4ECT A;  1NJZ A;  2OM6 A;  5KFZ A;  4C7Z A;  3MR2 A;  1PK1 B;  4TUP A;  5EE3 A;  2YB1 A;  4ELU A;  2YMQ A;  4ECW A;  2ZUD A;  2ASJ A;  1L3V A;  4BUG A;  1ZQJ A;  4KLI A;  3HKZ C;  1TFR A;  3PX0 A;  2WTF A;  3MGI A;  2RQ5 A;  2N1R A;  4PJ0 U;  4DS4 A;  4PHD A;  4PGY A;  4F5Q A;  3PNC A;  2ZJA A;  2ZIV A;  1K1Q A;  3BS7 A;  4ED3 A;  2DPJ A;  4QZH A;  1X6J A;  2P35 A;  2KIW A;  2W9B B;  3JPN A;  1OXJ A;  2ASL A;  2ZTC A;  1J97 A;  2FLL A;  4M2Y A;  3HX0 A;  5EE0 A;  1HIW A;  2LKY A;  1MQ3 A;  7ICI A;  8ICZ A;  1JIH A;  2WB1 F;  4I2E A;  5CP2 A;  1BPY A;  2JV3 A;  4YXM A;  3PR4 A;  1NKC A;  3C5F A;  3JPP A;  9ICJ A;  2Q0Z X;  1Z4O A;  2D3D A;  4F3O A;  2G08 A;  5KT5 A;  2HOF A;  2E8P A;  5AKK A;  2F44 A;  3T79 A;  2F8L A;  2J6U A;  1XSN A;  1Q3V A;  1KEJ A;  2KJ8 A;  3FDS A;  3TAR A;  3PO5 A;  3TFR A;  3F5E A;  4YR2 A;  2A19 A;  3EZ5 A;  1TK8 A;  5ALJ A;  4B9U A;  2PMZ F;  2KV2 A;  5KFD A;  2W54 A;  5EE9 A;  2LYA A;  2WF8 A;  2WB1 C;  4QJF B;  2ZIU B;  1QSS A;  2XCP A;  5IIN A;  4F5O A;  3H0M B;  3UPQ A;  3CRX A;  2H3Q A;  3T5K A;  3HWT A;  5ALG A;  2HHT A;  5JU5 A;  4CF3 A;  1UQV A;  3RF9 A;  2NRV A;  2W03 A;  5KNI A;  2FJ6 A;  5KFA A;  3C1Z A;  3SMV A;  3HRD D;  4O5K A;  5AM0 A;  1SXD A;  3ORY A;  4DL3 A;  4B9M A;  3AUO A;  2EZZ A;  7ICT A;  5AKI A;  2HW3 A;  4YMM A;  2VIX A;  5L9X A;  5A0L A;  1KBU A;  4K4H A;  4DSE A;  2RDI A;  5IIM A;  4DQP A;  2I9G A;  3FYH A;  3RB0 A;  3ZDA A;  5J0S A;  2DFL A;  1JX4 A;  2LM4 A;  4NL9 C;  3ZDD A;  4C8K A;  3H8M A;  4KLE A;  4YMO A;  2OHF A;  5KFX A;  4F4W A;  2ISO A;  4YQW A;  4ECV A;  3RJG A;  1TE2 A;  3NVW A;  4RQ7 A;  5TZV A;  2A3V A;  3VC8 A;  2HSZ A;  3D2S A;  5AM3 A;  2GWS A;  1O03 A;  1B43 A;  2A1J A;  4Z6C A;  4DQQ A;  3K1R B;  4RQN A;  3CYM A;  1J2N A;  5DG7 A;  1SV0 C;  2IOF A;  3D6J A;  4BX9 C;  3JPS A;  2NRX A;  2H3I A;  2AU0 A;  5KG6 A;  3RBE A;  5DB8 A;  3RB4 A;  1IXR A;  4DL4 A;  3L5K A;  4RPZ A;  1NKB A;  1ZQV A;  2MUT A;  2UVR A;  4J9R A;  1TK0 A;  4DL2 A;  3UMB A;  1VDV A;  2P66 A;  3OJU A;  4RNO A;  1RG6 A;  4OJP A;  2BDP A;  3GV5 B;  4KMU A;  2K4P A;  2KP7 A;  1DRG A;  2HHW A;  3C29 A;  1UA0 A;  4IQU A;  2RHF A;  1NK9 A;  2JMG A;  4YR0 A;  3BZK A;  1ZXI A;  1QLN A;  2ZXH A;  4LVS A;  1Y88 A;  3IP4 B;  3G6Y A;  4US8 A;  4YN4 A;  1WCL A;  4KIT B;  1WWV A;  1F0M A;  2QAR A;  4ED8 A;  5D49 A;  2Y1I A;  1S76 D;  2W3S A;  1L8O A;  3BS5 A;  1SZH A;  5J2F A;  3UM9 A;  3QEB Z;  3GIL A;  1JMS A;  4DLE A;  2KKP A;  1JAL A;  3K75 D;  2BKE A;  1PUZ A;  4IR9 A;  1TAU A;  4R8U B;  3BQ0 A;  4TQR A;  3ETR A;  1IG6 A;  5KFW A;  1SB3 C;  5J0U A;  1T7P A;  3KBB A;  3TAC B;  3F2B A;  5HR6 A;  4CF5 A;  5AI4 A;  2JRZ A;  1CRX A;  1L5U A;  2IA6 A;  3HP6 A;  1KFS A;  1X6I A;  3RRH A;  2JR5 A;  2E8M A;  3AL0 B;  4IR1 A;  2RLT A;  1N5W A;  3EWA A;  3A0H U;  4KLS A;  3DEE A;  1NK0 A;  4FZM A;  2W7O A;  3TAD A;  4DOA A;  5E79 U;  4DF4 A;  3AEV A;  2BQR A;  3F53 A;  1FFU A;  3DV9 A;  1K5O A;  4PGX A;  2G07 A;  2EAM A;  2WF5 A;  2JEG A;  2KNJ A;  4GLX A;  4OJ6 A;  4CE6 A;  4BXO A;  4FS2 A;  2QKQ A;  5KG7 A;  1MA7 A;  2K60 A;  3H8W A;  3MAB A;  1ZQX A;  3E2E A;  5GTH U;  2HOQ A;  5J2H A;  1JRP A;  4Y2R A;  1JXL A;  1BPD A;  4B9V A;  4FZN A;  5DB9 A;  3F2D A;  4JV2 A;  1SIJ A;  2OCE A;  4M9J A;  2NRW A;  4CGZ A;  5KFN A;  1T94 A;  5AIB A;  2VJ4 A;  5KAF U;  4AYB F;  2F76 X;  3K1Z A;  5ALH A;  5AI5 A;  4QZ8 A;  1QQ6 A;  5KTQ A;  3NAS A;  1S0O A;  4Q45 A;  4QZF A;  2EQY A;  2ODG A;  4DS5 A;  1X9W A;  5DQI A;  3JPO A;  1Z00 A;  2ZIX B;  8ICG A;  2BQU A;  1ZQB A;  4IQW A;  3JPQ A;  2Y9T A;  1P7D A;  4ECS A;  1YZ7 A;  2H3V A;  2JGA A;  4KLO A;  2DPI A;  1ZQF A;  1PK3 A;  4DLG A;  3M9O B;  2FDR A;  1L3S A;  4O3Q A;  1BVS A;  2AHO B;  2KSO A;  7ICH A;  2R8K A;  3GZF A;  2ASD A;  4Q44 A;  4O3M A;  3F2C A;  4MHV A;  2YN4 A;  2AGQ A;  5KFI A;  2MAX A;  2MU2 A;  1ZQC A;  4EYI B;  1FFV A;  4M6W B;  1UA1 A;  5J29 A;  4EBC A;  4YG2 A;  5DLG A;  4KLT A;  3QU9 A;  4AYB C;  4B9N A;  3QYP A;  4ACO A;  9ICM A;  5KFP A;  4JMU A;  2ZIV B;  2ATL A;  2G5I B;  3RBD A;  5DB6 A;  3QNM A;  1S0V A;  3QU2 A;  1L3T A;  3N28 A;  1ZQI A;  3CNH A;  4YD1 A;  1RYU A;  9ICT A;  2PFQ A;  3V6K A;  4F8R A;  5J0X A;  4QZG A;  2HHU A;  4GFJ A;  1N62 A;  4IC9 A;  4NLB A;  7ICM A;  3EPG A;  5EWG A;  3M1Y A;  4MEX A;  2KFN A;  2R8H A;  5EE1 A;  3C2L A;  4F4K A;  1VLB A;  5ALF A;  4GXI A;  3HW8 A;  2E8O A;  4ED7 A;  1ZYQ A;  3TFS A;  1F5S A;  2Y0S F;  4J9S A;  4P4M A;  7ICF A;  4B6J A;  4P4O A;  2W9A A;  4Q43 A;  4F92 B;  3T5L A;  4FS1 A;  2C22 A;  3WU2 U;  2QB1 A;  1B22 A;  3KKA C;  5IIO A;  4QWE A;  4RT3 A;  5F3X B;  3UQ0 A;  4ECU A;  2VJ5 A;  1TKD A;  1ZQT A;  3H4D A;  4J9K A;  5C5J A;  2G09 A;  3Q8P B;  9ICX A;  1WUD A;  5FP0 A;  2FPK A;  1S5L U;  2DWQ A;  1RQL A;  1X2I A;  2HVH A;  4HYK A;  2PFP A;  7ICK A;  2Y0S C;  2FI1 A;  2AQ4 A;  3BZC A;  5J8Y C;  2V4R A;  1HUO A;  1N61 A;  2K4H A;  5AKH A;  1RYS A;  5C0Y A;  2CPR A;  3AMZ A;  4ELV A;  4KLG A;  3MR3 A;  1GO3 F;  2B6G A;  1ZD3 A;  3F5A A;  3PSI A;  1N63 A;  4BJQ A;  4J03 A;  3IM1 A;  4ELT A;  5KFL A;  1ECW A;  3H8J A;  1RQN A;  4O5C A;  2PI4 A;  2XI9 A;  2AQ0 A;  3SV3 A;  3VCB A;  4M9L A;  2XCA A;  1UT8 A;  3PMN A;  4F2S A;  2XY7 A;  3NVY A;  3I28 A;  4DFK A;  3THV A;  2B21 A;  4KLQ A;  2K4I A;  3OGU A;  1T3N A;  3M8S A;  5J2D A;  1S0M A;  5KFO A;  5AM4 A;  5KG2 A;  1U47 A;  4DF8 A;  4EX7 A;  2W9C B;  3N7R C;  4EEK A;  5AKJ A;  2HOI A;  2ZTD A;  8ICK A;  1BGX T;  3ZI4 A;  1J2M A;  4C8N A;  3WK9 A;  5AKG A;  3KZX A;  5J2E A;  4Y2V A;  1NI3 A;  1M6Y A;  5DB7 A;  5DBB A;  4DSI A;  4NLN A;  4G9B A;  1NJW A;  1EXN A;  3RJK A;  2DF4 B;  1ZQO A;  5J0P A;  2FE9 A;  1XNS A;  4DL6 A;  4GIB A;  1KRP A;  4J9L A;  1SL0 A;  4F5R A;  3ONN A;  4JV1 A;  3Q8L A;  4A8E A;  4UAU A;  5L1K A;  1U4B A;  8ICO A;  2I5H A;  3NRZ A;  5CWR A;  3ZDB A;  4QWA A;  3QU7 A;  4U7C A;  4P0Q A;  3G6V A;  4C4R A;  5J0T A;  1QQ5 A;  4GXK A;  1QSY A;  7ICV A;  2LPE A;  2R8I A;  1D8Y A;  4ECR A;  4OO1 J;  2KG5 A;  9ICI A;  3ISC A;  2BR0 A;  3HIL A;  3NUQ A;  3QU5 A;  4J9N A;  3L3F X;  3ZD8 A;  4O3S A;  5KT3 A;  7ICP A;  3D2N A;  3GFK B;  2HCF A;  2LYH A;  3V7K A;  3SAF A;  4EEL A;  5KFE A;  4XUS A;  1BNO A;  1QH9 A;  1ZRM A;  3N7S C;  3SEI A;  4UAW A;  4UBB A;  3D2Q A;  3MR5 A;  4P0P A;  1LKY B;  5HMM A;  5IIL A;  5J2J A;  2NV3 A;  2LMR A;  3KHG A;  1X9S A;  5HNK A;  1SKW A;  3WKD A;  2KMD A;  4PZN A;  4I28 A;  3AQE A;  4DSL A;  2VA2 A;  3JPR A;  4UB1 A;  9ICE A;  1KFT A;  2JEF A;  1ZQR A;  2K8C B;  4EX6 A;  5CEH A;  5AM1 A;  4UB4 A;  1URJ A;  2BQ3 A;  4DFD A;  3NVZ A;  2F1J A;  2JHD A;  5J0Y A;  3KZI U;  4F71 A;  4PGQ A;  2PMZ C;  1QQ7 A;  2FLP A;  3OSN A;  3E0F A;  1WCN A;  4F2R A;  1RXV A;  1ZD4 A;  5G5H A;  1BPB A;  5ALE A;  4WJ3 B;  2KOB A;  1D8L A;  5ALU A;  1PVP A;  2W9M A;  1NNL A;  2XVT A;  2DGZ A;  4QWD A;  1V9P A;  1V97 A;  3IRU A;  5ALN A;  4DCC A;  4DWI A;  5HP4 A;  1ZET A;  3DDH A;  8ICJ A;  5J2I A;  2K8A A;  4QW9 A;  4NM1 A;  4QZI A;  1BPE A;  5DBC A;  3N4M B;  1Z3E B;  3QUQ A;  5KL8 B;  4DFP A;  3BQ1 A;  4DQS A;  5KFS A;  4QWB A;  3MDA A;  4FBT A;  1KKX A;  4GC6 A;  4DQI A;  1X66 A;  4KLD A;  2JZB A;  4ZOH C;  3LVW A;  4O5E A;  3I76 A;  1BPZ A;  3U26 A;  4ECZ A;  7ICS A;  5L1I A;  1SV4 A;  5KFU A;  2QB0 B;  1TK5 A;  4CF4 A;  5DG9 A;  8ICY A;  4RNN A;  2OWO A;  4O3O A;  5JUM A;  4UB5 A;  4IRC A;  5J2C A;  1PK1 A;  3OTQ A;  3AU2 A;  1B0X A;  1ZQK A;  4F72 A;  4NLK A;  3C28 A;  4QZ9 A;  3M8R A;  1S97 A;  4FZL A;  2PFN A;  4Z6F A;  3V6J A;  3PVX A;  3PX6 A;  1RZT A;  4F4Z A;  5KG0 A;  5ALP A;  1Z1B A;  2MA1 A;  4O3N A;  3V72 A;  3ICX A;  1T3Q A;  5KG4 A;  2L5Y A;  2K4E A;  1KFD A;  4C4S A;  3LDA A;  5CR0 A;  2W9B A;  2J6T A;  1ZQH A;  5T14 A;  1XWL A;  2ZIW B;  3EPI A;  5BPC A;  5AK6 A;  4DFM A;  3PX4 A;  1RPL A;  3AU6 A;  1L3U A;  1MQ2 A;  1RYR A;  4DSF A;  5KFR A;  4Y2J A;  2B0C A;  2E1E A;  1XSP A;  3NVV A;  4PHA A;  2XY6 A;  2UVW A;  2JEJ A;  2P6U A;  1Q46 A;  5EWE A;  1ZQ1 C;  1TV9 A;  4OJ5 A;  4YVZ A;  5KFF A;  2H5X A;  3KD3 A;  2ZUB A;  2W8L A;  3C2K A;  4PL1 A;  8ICF A;  3GV8 B;  2NO4 A;  4US9 A;  2RP5 A;  4G3I A;  2O6K A;  1ZQU A;  4QNL A;  3UXP A;  3ISB A;  3T5J A;  1V38 A;  3A0B U;  5DQG A;  4DSK A;  2W3R A;  4TUQ A;  1S0N A;  2RDJ A;  2QLT A;  1CI4 A;  2KVS A;  1N2X A;  4UAT A;  3RRG A;  4IQV A;  2ZIU A;  3B9J A;  5AIA A;  2VAN A;  9ICV A;  2FMP A;  2W55 A;  2BCR A;  3QE9 Y;  2WAQ F;  5KFH A;  3TAD C;  4ED1 A;  2CN1 A;  4RPY A;  3I1Y A;  3RJF A;  3H8S A;  4UAV A;  4R64 A;  4FO6 A;  4QWC A;  3N97 B;  2WFA A;  2FPL A;  5DDM A;  1TAM A;  1ZJN A;  2KTQ A;  9ICG A;  1KDH A;  4UB8 U;  4KMO B;  3FC4 A;  1N48 A;  1NK8 A;  4C0Z A;  4RUA A;  5EWF A;  3RJH A;  3BQ7 A;  1N5X A;  2ZTE A;  4NM2 A;  4YD2 A;  3GII A;  2BCU A;  1PVQ A;  1ZD5 A;  4RPX A;  4R66 A;  1XS9 D;  1DGS A;  5D4B A;  4EZ6 A;  3KHH A;  1L7P A;  2K89 A;  8ICM A;  3L4P A;  7ICN A;  1IM4 A;  9ICH A;  2WF7 A;  4EEN A;  5KT4 A;  2WAQ C;  4EBD A;  2BCV A;  5DGA A;  3SYZ A;  1IIP A;  3MDC A;  3GV7 B;  1N56 A;  2E1F A;  3QZ8 A;  5DG8 A;  4MFA A;  2YML A;  1L8L A;  2HBJ A;  3AM9 A;  2ZJ5 A;  4PHE A;  5AKX A;  4YXJ A;  1RXW A;  4XRH A;  3K4G A;  4M9H A;  5ALD A;  3EW9 A;  2R8J A;  5KFK A;  2YMM A;  4IQT A;  4Y2U A;  9ICR A;  1A6S A;  1X40 A;  2VA3 A;  3C2M A;  3KFU F;  2EZX A;  1LV5 A;  1MN8 A;  1N60 A;  3RTV A;  1SKR A;  3V7J A;  2JH7 A;  4PHP A;  4BWJ A;  4ICA A;  4R65 A;  2BPC A;  5BOL A;  4FFD A;  4RQ3 A;  4TQS A;  4QW8 A;  2KZM A;  3MC1 A;  3AQF A;  1L6N A;  4MF2 A;  7ICE A;  1ZJM A;  1DOQ A;  1UHU A;  4OD0 A;  4I2A A;  3H40 A;  1YT3 A;  5KG3 A;  3KHL A;  4NJ8 A;  3BQT A;  4LZD A;  2JXJ A;  3KOO A;  2YY6 A;  5J2K A;  3Q8R B;  4JUZ A;  3BQ2 A;  1HUZ A;  4XA5 A;  5ALM A;  2NO5 A;  1D8B A;  3OHA A;  3PW0 A;  4UAR A;  2KZ3 A;  2PXI A;  1RDF A;  3IDW A;  3BDP A;  5J0R A;  4I2D A;  3RR8 A;  1NK5 A;  2PI5 A;  1V85 A;  4KTQ A;  5DLF A;  5F9L A;  5DBA A;  3ZDC A;  1COK A;  4UB6 U;  4BGD A;  5ALZ A;  1RM6 C;  5IIJ A;  1T4G A;  2XGP A;  1OUQ A;  9ICP A;  2WF6 A;  4HAI A;  5III A;  3MFH A;  4FBU A;  1SWW A;  4QZA A;  2AGP A;  4RQ1 A;  4R8U A;  3HT3 A;  2HHV A;  4C8L A;  3RH5 A;  4TUS A;  2W04 A;  3ED5 A;  3N7P D;  3SR6 A;  5ALL A;  2FPM A;  2BDU A;  1XC9 A;  4YCX A;  2ZXI A;  2NYV A;  2M9N A;  5KFC A;  4I27 A;  4M9G A;  8ICA A;  3GU3 A;  1OW5 A;  4C8O A;  4NXZ A;  4M9N A;  2C28 A;  2V9W A;  3PSF A;  2KJ9 A;  1XU4 A;  3HJE A;  5ALV A;  4UB2 A;  2XY5 A;  2WHE A;  3GIM A;  1A0P A;  1Z4N A;  4KLF A;  5L1M A;  8ICX A;  1U45 A;  3M9N B;  2YMP A;  2AXT U;  2G06 A;  2OH2 A;  4YR3 A;  2Q4T A;  4KLM A;  5AK5 A;  4DQR A;  5KFV A;  2J6S A;  2BZF A;  4DL5 A;  1S8O A;  2YTU A;  2DL0 A;  2KD1 A;  4O9M A;  4KLJ A;  3RH4 A;  1F44 A;  3Q8S B;  9ICC A;  5AI9 A;  4RQM A;  3HKZ F;  5AK4 A;  4DSJ A;  8ICP A;  4QZE A;  3Q8K A;  4UAY A;  4U6P A;  2HDO A;  2F3N A;  2HI0 A;  4J9P A;  2F8K A;  5ALX A;  1KL9 A;  1SGG A;  4LJX A;  1L7N A;  3E58 A;  4OJL A;  3KHR A;  5TIS U;  3TAP A;  3PZP A;  3RR7 A;  5ALI A;  8ICN A;  4CCH A;  2A1J B;  4PZO A;  2BCQ A;  2W7P A;  2EZY A;  4RU9 A;  8ICQ A;  3ZDE A;  2KJ5 A;  2ZIX A;  5J2A A;  4P4P A;  3SEN A;  1DK2 A;  1ZRN A;  5CB1 A;  2F1H A;  2LHT A;  7ICU A;  3M7D A;  3RAQ A;  2P6R A;  4ECQ A;  5AM5 A;  4I2B A;  4Y2Y A;  3RFA A;  3PV8 A;  1B4F A;  4ECX A;  3GIK A;  2MUT B;  2DQN B;  2W11 A;  4M6W A;  4RT2 A;  2F2A B;  2ALZ A;  1ZQL A;  4I2C A;  2IMW P;  4X5V A;  8ICU A;  4ZH4 A;  3V7L A;  1ZQQ A;  4BDP A;  3M9M B;  2I6X A;  1CEZ A;  2GH1 A;  4BWM A;  5ALY A;  8ICW A;  4F4Y A;  4R63 A;  2XID A;  4NLZ A;  8ICC A;  4ECY A;  2QAR B;  4E0D A;  2D6F C;  9ICW A;  2AGO A;  2IOF K;  4LZG A;  3BS5 B;  5ALK A;  5JTI A;  3RJI A;  1SXE A;  2DKX A;  5AI8 A;  4F93 B;  4Y2S A;  5K4L A;  4RNM A;  3NTU A;  4PH5 A;  3M6K A;  1Z19 A;  2LM1 A;  4Y2X A;  2IHN A;  1ZOL A;  3UXO A;  4KN4 A;  9ICL A;  2IBK A;  1ZQN A;  1LB2 B;  4QZD A;  2KZZ A;  5ALQ A;  2DBY A;  2JH1 A;  1QCK A;  5DDY A;  1C20 A;  2NRZ A;  2KHQ A;  4PPX A;  4UB3 A;  5ALO A;  4RQ8 A;  3RB3 A;  4I2J A;  8ICS A;  2R18 A;  1KW4 A;  4FE3 A;  2UVV A;  4J9O A;  2Z7J A;  5F9N A;  5EOZ A;  9ICB A;  4B9T A;  4KLL A;  1NK7 A;  1T8E A;  4YP3 A;  3LWL A;  2CRX A;  1SZP A;  2RRD A;  7ICQ A;  4KX3 A;  4C80 A;  2KE7 A;  5B66 U;  3PR5 B;  2XGQ A;  2EH9 A;  3OPX A;  3IG8 A;  4BXO B;  1FIQ A;  2ZJ8 A;  1NJY A;  3IHQ B;  2KN7 A;  3RB6 A;  3H4B A;  2BGW A;  4O3R A;  3R9K A;  3LWM A;  5KL1 B;  1MSW D;  2BHN A;  3C21 A;  4J9Q A;  1WYG A;  3WKA A;  4NLC A;  4JV0 A;  5KT6 A;  4I29 A;  2KFZ A;  5L1J A;  3IG5 A;  2IOH A;  4K4G A;  2MRL A;  4RQ0 A;  1ARO P;  1U49 A;  5HHH A;  3OSP A;  2V4Q A;  3CP8 A;  7ICG A;  4NL9 A;  2D8C A;  1O08 A;  4RQ2 A;  3OJS A;  3WK5 A;  3IN5 A;  3ALR A;  1Z00 B; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  1X9X A;  2DL0 A;  5JRT A;  1WWV A;  1F0M A;  2QAR A;  2KMD A;  4PZN A;  1LKY A;  1OXJ A;  5J8Y A;  4RQM A;  3BS5 A;  2QB1 A;  2Y9U A;  2KSO B;  3BQ7 A;  3KKA C;  5F3X B;  1SV0 A;  2L5Y A;  2F3N A;  2E8N A;  2F8K A;  3IDW A;  1SGG A;  2JV3 A;  2Y9T A;  4NL9 C;  3H8M A;  1PK3 A;  2D3D A;  1V85 A;  1KW4 A;  4PZO A;  2KSO A;  2FE9 A;  2E8P A;  1UCV A;  2ESE A;  3TAC B;  1COK A;  4MHV A;  2F44 A;  3SEN A;  2DKX A;  2E8M A;  5J8Y C;  2EAP A;  4IS7 A;  2KE7 A;  1B4F A;  3K1R B;  4RQN A;  3TAD A;  1Z1V A;  1SV0 C;  2DKZ A;  2B6G A;  1X40 A;  2LPE A;  1JI7 A;  2KG5 A;  2EAM A;  1V38 A;  2KIV A;  2EAN A;  1X66 A;  3HIL A;  2EAO A;  2ES6 A;  1PK1 B;  1OW5 A;  2QKQ A;  3KKA A;  2K60 A;  1SV4 A;  1RG6 A;  2QB0 B;  2GLE A;  5JU5 A;  1UQV A;  3SEI A;  4NL9 A;  5L1M A;  2QAR B;  1LKY B;  5KNI A;  2E8O A;  2D8C A;  2K4P A;  1PK1 A;  3TAD C;  3BS5 B;  1B0X A;  1DXS A;  2LMR A;  1WWU A;  5JTI A;  2QB0 A;  1SXE A;  1SXD A;  2YTU A;  3BS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...