2F8KA

Sequence specific recognition of rna hairpins by the sam domain of vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
SSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sequence-specific recognition of RNA hairpins by the SAM domain of Vts1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/ rna
molecule keywords 5'-R(*UP*AP*AP*UP*CP*UP*UP*UP*GP*AP*CP*AP*GP*AP*UP*U)-3'
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f8kA00
1LKYA 1OW5A 1WWUA 1RG6A 2Y9TA 5KNIA 3BS5A 4RQNA 1B4FA 2LPEA 3HILA 2E8PA 2KE7A 1KW4A 2KSOB 2KMDA 2D3DA 1UCVA 2E8MA 1SV0A 3SENA 2DL0A 1JI7A 2EAMA 2ES6A 1SXDA 3KKAC 4NJ8A 5F3XB 1B0XA 1X66A 1SV4A 3BQ7A 1PK1A 1PK3A 3SEIA 2ESEA 4IS7A 1SXEA 2FE9A 3IDWA 1V38A 3H8MA 2F3NA 2QB0A 1SGGA 2KG5A 3K1RB 1PK1B 1Z1VA 5L1MA 1SV0C 2EAOA 2YTUA 2JV3A 5JTIA 2DKXA 3BS7A 3KKAA 1V85A 5J8YC 4PZNA 2GLEA 4PZOA 1F0MA 2E8OA 2F44A 2K4PA 3BS5B 1X40A 5JRTA 2QB0B 1LKYB 2QB1A 1UQVA 2F8KA 5J8YA 3TADA 2L5YA 1COKA 4RQMA 4NL9C 2K60A 2Y9UA 2D8CA 2B6GA 3TACB 2EANA 2KSOA 2QARA 1DXSA 2EAPA 3TADC 2KIVA 1X9XA 1WWVA 5JU5A 2LMRA 2QARB 4NL9A 4MHVA 2DKZA 2E8NA 1OXJA 2QKQA
chains in the Genus database with same CATH superfamily
2VJ4A 4ECRA 3MGIA 4F2RA 4YMOA 2E5SA 2LYBA 5DKWA 2FMPA 2E8PA 9ICLA 5EE0A 4C8OA 2KSOB 3JPQA 1FO4A 2KIWA 5L1IA 5HMMA 2YMLA 4ECUA 2K8BB 2WB1C 5DGBA 4NLZA 1AQ6A 2FI1A 2MUTB 3PSIA 4ACOA 2ZIXB 2YX8A 3PMNA 2LM1A 4ECTA 2EQYA 2A19A 4ED8A 1SXEA 4DFKA 5HHHA 1L7MA 4K4IA 2OH2A 3RJEA 4FBTA 3F53A 4J03A 4IQTA 2WAQC 1T3QA 2EAOA 2Y0SF 1S77D 4F3OA 4DL4A 1ZQLA 1U47A 3IN5A 9ICCA 3V7JA 5DG7A 5KT2A 3H8WA 3D2SA 4QIWF 5G5GA 1UA1A 1NKEA 4UBBA 4YN4A 3BZKA 2B21A 1LKYB 4O3QA 1UQVA 2JGAA 8ICMA 4FBUA 5J2CA 4J9NA 1NZPA 1ZJNA 3FC4A 2HMXA 1NK9A 5A0LA 3F2BA 1RYUA 1TVAA 4QZFA 8ICUA 2CXYA 3UMCA 3KHLA 4G3IA 4DQPA 1SWWA 4M6WA 3RAXA 4P0PA 4PJ0U 4EZ6A 3QZ7A 1ED1A 4DLGA 3BDPA 5IIKA 2YQEA 5AI0A 3PSFA 3WK8A 2IMWP 3QZ8A 2Y9TA 2RRDA 3AQFA 4OO1J 4P2HA 3SI8A 5BOLA 4TUPA 2EZYA 3M6ZA 4RT2A 5KFBA 3T79A 2G0AA 4ED2A 1HUZA 3Q8PB 2ZUDA 1X6JA 2VANA 2OHFA 3NVWA 5DB7A 2G07A 2OXOA 3HJEA 1SZPA 2J6UA 2AQ4A 4EBEA 3PSTA 4OJOA 2W43A 3MABA 2W04A 2A1JA 3ISDA 3H4DA 3OJUA 4F2SA 4O5EA 2KG5A 5ALPA 5ALYA 4F4XA 1ZQKA 1ZD4A 3VC8A 1L7OA 3MR6A 3GDXA 4UW9A 4EENA 5KFVA 4RQ3A 5AKKA 2ALZA 4GC6A 4RPZA 1UPHA 5JTIA 5KFKA 5D4BA 2KVCA 3KKAA 3JPRA 1A6SA 1V85A 1NJXA 2JH7A 3PSPA 1KN5A 4BJQA 2I9GA 4R66A 5DDYA 2C22A 1LB2B 2KVSA 4RQ8A 7ICQA 4QNLA 1JN3A 4RQMA 1NKCA 2D8CA 2FLPA 5CB1A 3KZIU 7ICHA 2ZXIA 8ICNA 3QU4A 2MUTA 4C0ZA 3M8RA 1ZQOA 5KT6A 5IIIA 2RDJA 2F77X 2JEJA 3M9NB 3PW0A 1BNOA 4BDPA 1Z00B 9ICOA 2BDUA 4J9RA 5AK4A 4I28A 3KBBA 3RFAA 2KJ9A 3ZD8A 4KLLA 4OJ5A 4PL1A 5KFXA 3SENA 2G5IB 8ICZA 3Q8KA 5J2AA 4DQIA 1X9WA 1ZQJA 2KK0A 3KTQA 1JXLA 9ICFA 2HHVA 1WYGA 2K89A 2F76X 3SEIA 3LWMA 4R8UA 2WF5A 3EW9A 1NKBA 1J2NA 1H38A 4XRHA 3L5KA 3ISCA 3HWTA 2HVIA 4Y2SA 2XI9A 4DL6A 5DG9A 2YMQA 2YN4A 5KFEA 1Q8KA 4UAZA 5J2JA 3BS7A 2JZBA 4KLOA 4JV0A 1UT8A 1MSWD 5ALJA 4WJ3B 2EZXA 2VJ5A 3QXGA 5EE9A 4BXOB 3CNHA 3NRWA 3KHGA 3RJKA 2QB0B 4QZCA 4BUGA 3JPOA 4Y2QA 2PXIA 1BPEA 4PHEA 2UVUA 1ZQEA 2K60A 3C1YA 1WG8A 2VIXA 2HHTA 4EYHB 1RDFA 5EE1A 4PHPA 1BNPA 4I2IA 3ALRA 3OTQA 3O0FA 3MR3A 1TK5A 4DQSA 3CRXA 4O3NA 5KFWA 4C7YA 3TFSA 2A1JB 4QWBA 4NLNA 3UMGA 4KITB 3E2EA 2WF6A 2AH5A 2PMZC 1RG6A 3N7SC 1TK0A 3H0RB 4BX9C 3V6HA 2BCRA 3GU3A 1FFUA 4JK1A 7ICOA 1NK0A 4R8UB 2ES6A 2BPFA 3WU2U 4F93B 4DL7A 4PHAA 2KD1A 2W9CB 4YCXA 1N61A 2KOBA 1LV5A 5J0PA 4I27A 3KOOA 4EELA 4KLQA 1V38A 3H8MA 2MU2A 3IP4B 5KFGA 2KFNA 2ODGA 5IIMA 9ICXA 1ECWA 3PW4A 4F5NA 2K8CB 2JRZA 2PI4A 9ICTA 1Z1VA 1O08A 4O3RA 4F5OA 5KG1A 2DKXA 2W11A 5ALWA 4Y2TA 1SL1A 1Z00A 3H4BA 3FAHA 2GLEA 5ALXA 4FO6A 2E8OA 3AU6A 3S6JA 5J2DA 4ECQA 1IIPA 3TFRA 2XGQA 1HJPA 5KFHA 4B9VA 5J8YA 2IBKA 4Q45A 4OJLA 3RBDA 2NRWA 8ICTA 3Q8RB 3F5AA 3ZDBA 4MHVA 4ED7A 4C8MA 5HP4A 3N7RC 3RR8A 5DB6A 2VA2A 2KFZA 3T5HA 5C0YA 5KTQA 1QTMA 4F4YA 5K4LA 4GIBA 1ZQGA 1WCNA 1S0NA 4RQ7A 1Z1BA 4JB3A 2BKEA 5ALOA 8ICRA 3NVVA 3LDAA 5KFTA 5CWRA 4DSKA 5KFNA 4M6WB 4MEYA 3R9KA 4NJ8A 2W9BB 4MFAA 2I5HA 3ORYA 2PFOA 2ASJA 3I28A 3BQ7A 4QWDA 7ICJA 4C8KA 5CJ7A 3RRHA 4J9OA 2KN7A 4DQQA 5D49A 2BZFA 2RHFA 3K4GA 3T5JA 2R18A 1V97A 3SV3A 2FPMA 4NM1A 2C2RA 3B0XA 3IM1A 1NK7A 1RQNA 2YMMA 5ALHA 4YVZA 3N28A 4F92B 2V4RA 5KFYA 2H3ZA 3GIMA 4AYBF 5J0TA 2FMSA 4F71A 7ICIA 3V6JA 1SKWA 5JRTA 3RJIA 3PMLA 1JMSA 4DSIA 2E1EA 4FS1A 3PV8A 4KN7A 4US8A 1PVQA 2BPGA 3ZDCA 1BPZA 1RQLA 4P4OA 1SWVA 2KSOA 1NNLA 3GILA 1DXSA 5AM1A 3QU7A 3OHAA 3C5GA 1AROP 3LYSA 3SAHA 3SAFA 3V72A 4P0PB 5J0XA 3N7PD 5ALDA 1NK5A 3H8SA 2DUYA 4OCZA 2BCSA 9ICIA 4B9UA 5AKGA 2HHUA 1ZQ1C 1CRXA 4GXJA 4BWMA 3PO5A 5KFPA 1ZQZA 7ICSA 4C7ZA 2W9MA 4QZBA 2J6TA 2EDUA 2P6UA 2F1IA 2HI0A 3ZDEA 2ZUBA 3AL0B 3I1YA 5KT3A 1X9SA 1SV4A 4P4MA 4IRKA 2ZIUA 3L4PA 3D2QA 9ICBA 2Z7JA 3IRUA 5AKLA 2DGZA 3PW7A 4UB6U 1ZQHA 2DQNB 4XA5A 3OHBA 2C2EA 2G08A 2BPCA 2KEYA 3HPOA 2LM4A 3E58A 3UQ0A 2LYHA 3T3FA 9ICSA 2R8GA 2PFQA 1N48A 3HKZF 1S0VA 1U49A 1KTQA 2YB1A 5TZVA 1KFTA 1VLBA 1F44A 2BCVA 3CP8A 4I2CA 4Z6FA 1U48A 8ICCA 1SL0A 2IHMA 8ICEA 4QJFB 4UAYA 4KLHA 1F5SA 1RM6C 3G6VA 2M9NA 4DO9A 2JXJA 9ICVA 1XSNA 3AUOA 4DSFA 2NRTA 3K75D 4QWCA 3UMBA 1KFSA 2EANA 2QARA 3C28A 1L8LA 1S5LU 4F4ZA 2LBOA 1CI4A 5BPCA 4IC9A 1QQ7A 3FM9A 2ZJ5A 1BPDA 2KP7A 3MFIA 4K4GA 2VKQA 3PO4A 4CF5A 3BS5A 2I1QA 5AM2A 5L1KA 4DFJA 4KTQA 1QSSA 4PGXA 2ASDA 2XY7A 2KZZA 2E8MA 1TK8A 4IR9A 1KRPA 2CRXA 5AHXA 3TANA 3AN1A 2DWQA 5IINA 4HAIA 1PZNA 5F9NA 3RJJA 4O3OA 4Y2RA 5J29A 4O5CA 2FDRA 1T4GA 3MBYA 7ICPA 4J9MA 2KZMA 1OUQA 4UB2A 3HT3A 2LI6A 3H7IA 8ICJA 3G6YA 3NTUA 5CR0A 3EZ5A 4NLCA 2H3VA 2AXTU 1S0MA 2FLNA 3MFHA 4ECYA 4EBCA 1DRGA 4IRDA 1KKXA 3GV7B 5B5EU 3LVWA 3M7DA 3CYMA 1MA7A 1NK4A 1Q3UA 1QQ5A 2ZIWA 4RPYA 4CNQA 1ZQCA 4YD2A 5J2FA 4OD0A 4DWIA 2F8KA 1SKRA 4YR2A 2JEFA 4YMMA 1SKSA 1N5XA 3QUCA 3KZXA 3EPGA 4DF4A 2ZUCA 8ICIA 2IHNA 4CF3A 4PH5A 2KIVA 1QCKA 5KFCA 2UVVA 3B0YA 2MSNA 5ALNA 2CN1A 5ALMA 5DBCA 3J81j 4Y2VA 2QKQA 3NASA 1SIJA 3JPPA 4I2BA 4YG2A 1N62A 5KG7A 1OW5A 1WWUA 5C5JA 3PNCA 1CEZA 2NO4A 2W54A 4Z6EA 4RQNA 2ISPA 1BPBA 4UAVA 3NRZA 2KV2A 4CGZA 2W03A 2LYAA 5AK6A 2BQ3A 1X2IA 3C1ZA 4RQ2A 1NI3A 2D3DA 5CEHA 9ICQA 4C4TA 2R8KA 2EZZA 9ICPA 2EAMA 4ICAA 1NJWA 4BWJA 2EH9A 1RYSA 4GC7A 2WF9A 4O9MA 3WKDA 2KNJA 1J2MA 3BZCA 5FP0A 5KFDA 2DPJA 5AI4A 2Q4TA 4JWMA 1ZETA 1PK3A 1PK1A 4NLGA 5J0RA 1Z4OA 2BQUA 4NLKA 2JR5A 4KLUA 3PW5A 1IXRA 2FE9A 2QB0A 4UB4A 9ICKA 3Q8MA 3EPIA 1Z3EB 2F1HA 5J0WA 5AM5A 3RBEA 1SV0C 1UT5A 3GZFA 1KSPA 1Q46A 1N56A 4LZGA 4F91B 2J6SA 1CUKA 4IQUA 4FZNA 3BJYA 1ZQVA 2OWOA 1F0MA 1ZRMA 3AM9A 2OCEA 3BS5B 4GFJA 3QE9Y 5KG2A 3MC1A 4DQRA 3ETLA 1C20A 4NL9C 4DL2A 4C80A 4TUSA 2ZJ8A 7ICKA 7ICNA 4JWNA 2WF8A 1ZQTA 5ALGA 5AKXA 5JU5A 3PW2A 5L9XA 5J2HA 3JPNA 2DBYA 4NL9A 5GTIU 1Y88A 2JH1A 4RNOA 3ICXA 4TUQA 2XO7A 2W9CA 3C23A 2FPKA 4J9KA 5AKIA 2IOHA 4ELTA 4O3PA 4J9LA 1Z4NA 4DOBA 4NXZA 5ALSA 4EYIB 2RDIA 1S76D 3M9MB 1UCVA 2JHDA 5EWFA 3ONNA 1SV0A 5AM4A 4RT3A 2KHVA 4UQGA 2YY6A 2W9AA 4EX7A 5J0UA 3RB0A 2ZTEA 3AQEA 2I6XA 2Y0SC 1ZQWA 4YQWA 3GIIA 5AIAA 4RU9A 9ICMA 2W7PA 2JEGA 2C2DA 3GV5B 1XSPA 8ICSA 3RJHA 1S8OA 1L6NA 1ZQMA 2ASLA 2AQ0A 3RH4A 1FEZA 2XY5A 1N2XA 2FJ6A 8ICVA 5DBBA 5KG0A 4RUAA 4GXKA 2R8JA 4E0DA 1JIHA 7ICTA 7ICMA 1BVSA 2LHTA 4NV0A 4RUCA 3EWAA 2CPRA 4A8EA 2BCUA 5GTHU 1T7PA 3B9JA 1QQ6A 4PZOA 3DEEA 1L3VA 2WB1F 2NYVA 4I2FA 2QB1A 1RYRA 1JXEA 5AM0A 2LKYA 1KL9A 1T3NA 2K4HA 5DG8A 2Y9UA 4FFDA 2K8AA 4Y2PA 7ICFA 1L7NA 4YXMA 1N63A 1XO0A 4QW8A 5CRXA 8ICKA 4DCCA 4RZRA 1K1QA 5EOZA 1QSLA 4JV1A 1ZQSA 3BQTA 4M9NA 4KX5A 3H40A 4EBDA 5KFRA 4J9SA 3RH6A 4M9HA 2GH1A 1L3TA 1P7DA 4EZ9A 3WK7A 4CDGA 2GWSA 2DFLA 2IA6A 3NVZA 3WK9A 2E3TA 2KE7A 3E0FA 3RB4A 3PZPA 7ICLA 3Q8QB 3SAGA 9ICJA 3C21A 1JI7A 2GOLA 1S97A 1DGJA 3T5KA 2G06A 2P6RA 2JEIA 4UB8U 2ZXHA 1B0XA 4RNMA 1YZ6A 2W55A 5EWGA 3SQIA 3VCBA 4B9MA 2Q0ZX 3D2NA 4C8LA 4DF8A 5AKZA 4IS7A 3HX0A 3UXNA 4FZLA 1U45A 9ICEA 9ICWA 3D6JA 3NVYA 3HRDD 4F50A 8ICGA 5KFLA 3K1RB 4P0QA 3N97B 5J0QA 3WK6A 4RPXA 5KFIA 4G9BA 3H0MB 2UVRA 4ELUA 4Q8FA 3IHQB 2JMGA 2C28A 4PZNA 1EXNA 2R8HA 2F44A 2XCAA 1DK2A 1IG6A 2HBLA 3KFUF 2G09A 1J97A 4CE6A 2HCFA 1DOQA 4ED6A 2RP5A 1LVHA 4DLEA 4UB5A 4US9A 2BR0A 8ICOA 1XNSA 1TV9A 5J0OA 4F5RA 2AGQA 3V7KA 1HIWA 1X9XA 4ECXA 1XU4A 3JPTA 2QARB 5HNKA 4PPXA 4KLJA 4DOCA 4I2EA 5AKEA 2XC9A 5KFUA 5J2BA 4QW9A 2OM6A 3ZD9A 4KLSA 4QZIA 2PFNA 2ZIUB 4MFCA 3WKCA 8ICAA 3V7LA 8ICFA 5AKJA 5KFFA 2LPEA 1C7YA 3QYPA 3HILA 5DQIA 3A0HU 4LZDA 2A1AA 2HHSA 1L3UA 4M2YA 3PY8A 2HBJA 1WUDA 1SXDA 3MR5A 1D8YA 3DDHA 1K5OA 5ALFA 4TQRA 5J2EA 3N4MB 4Y2JA 4YXJA 2BCQA 3HW8A 3Q8LA 4F8RA 5DLFA 5DGAA 4EX6A 3TI0A 3C2MA 1SB3C 2F3NA 3LVVA 3BQ0A 3NUQA 4C4RA 4XUSA 3RTVA 4Y2XA 3MGHA 4KLDA 2XICA 3QU9A 3PX0A 5B66U 1HUOA 5KFQA 3SMVA 4UAWA 5KFOA 2YMPA 3IG8A 1FIQA 4Q43A 1WCLA 2DF4B 1KDHA 5ALQA 1D9FA 4EEYA 5ALKA 4F4KA 1ZQPA 5KG3A 2KICA 2XIDA 1GO3F 2XGPA 4MEXA 5ALZA 2XCPA 2W8KA 2B6GA 4KMUA 4KLIA 5H2FU 5KFSA 1KEJA 4OJPA 4UASA 4FE3A 1TE2A 4J9QA 4DS5A 1TAUA 2DKZA 2E8NA 4ZOHC 4ECSA 1TKDA 4KX3A 5CA7A 4QWAA 3ZI4A 1L5UA 3BQ1A 3WK4A 5KG4A 4OJ6A 3LK9A 2HSZA 1B4FA 4ED1A 3SV4A 4YP3A 2AU0A 5D46A 1PUZA 5DQGA 2DL0A 1ZQFA 2BDPA 3RRGA 4RQ4A 2D6FC 1NOMA 2F1JA 2FMQA 5DB9A 5KT5A 1X66A 3WK5A 3SZ2A 4F72A 3EYZA 5J0SA 4B9SA 4MF2A 3PR5B 2P66A 3F2DA 1ZQIA 3THVA 7ICVA 2W9BA 3OPXA 1FFVA 3EUB2 4LJXA 2UVWA 3FYHA 2Y1JA 4KLMA 4KMOB 3V6KA 2H5XA 9ICHA 1JX4A 4M04A 2AHOB 8ICLA 7ICRA 4R63A 1ZQDA 5F9LA 4DSLA 1M6YA 5CHGA 5AI5A 2YTUA 4RQ5A 1X9MA 2F8LA 8ICXA 4NWIA 3GQCA 2WTFA 5AKHA 3GIKA 4R64A 2HOIA 3IG5A 9ICGA 2W3SA 2ZIVB 5HR7A 4DS4A 4M9JA 8ICQA 4YR3A 3QUQA 3F2CA 3T5LA 5AKYA 2PKEA 5ALVA 1ZQRA 3TACB 3M9OB 3M6KA 2BGWA 5DLGA 3RJGA 3TADC 3MGVA 1WWVA 1JROA 2LMRA 4MF8A 4PGQA 1A77A 1X42A 3SYZA 2OYYA 3TKAA 1RXWA 2HOQA 2RQ5A 4QIWC 5AM3A 3UM9A 3TQ1A 1LKYA 1TAQA 4DL3A 2W7OA 2PMZF 3PVXA 4BGDA 4RQ1A 1MC8A 3PX4A 2K4IA 1N60A 2XVTA 5AI8A 4NLBA 4Q44A 2HOFA 2KMDA 3ZDAA 4DFMA 4X5VA 2IOFA 7ICEA 4TURA 5HHIA 4J9PA 5KG5A 1XC9A 4O0IA 1S0OA 1JALA 1B22A 2W3RA 3MDCA 1ZD3A 2PI5A 4QZHA 4YMNA 4QZ8A 4DFPA 4ECVA 3M8SA 3A0BU 8ICHA 3QU2A 4XQ8A 1Q3VA 2KTQA 3C2KA 1YZ7A 2XY6A 8ICPA 1SGGA 5DDMA 4DFDA 4PGYA 5T14A 1YT3A 4USAA 3Q8SB 1PVRA 5L1LA 9ICRA 1ZQXA 3HKZC 3AU2A 2E1FA 3GIJA 4Y2YA 1DGSA 1L7PA 2AJQA 2AGPA 2K4EA 5KT7A 2NRVA 4M9LA 4RQ0A 3OJSA 1X40A 4M47A 1S10A 2F2AB 1HEKA 1U9LA 2WFAA 5IILA 3RB6A 2L5YA 5AIBA 3L3FX 9ICAA 4YR0A 3KHRA 1X6IA 1QH9A 4EEKA 1NJZA 1K1SA 4UAUA 4LVSA 3QX7A 2HHWA 4M0AA 4YFKA 3KHHA 5BOMA 4ZH4A 5KFZA 2RLTA 2KHQA 2ZIXA 2VA8A 3F5EA 5ALTA 5EWEA 4ECZA 3OGUA 5KNIA 3GV8B 2KKVA 1XS9D 4F5PA 4I2AA 2IOFK 2HW3A 1XWLA 2N1RA 5ALLA 3TAPA 5JUMA 5AI6A 2W8LA 4ED0A 2BQRA 1NK8A 4CCHA 5F3XB 1ZQBA 1U4BA 3QNMA 5KT4A 1MN8A 3UXPA 3SR6A 1ZD2P 3JPSA 5HR6A 4F4WA 4U7CA 3ZDDA 2NRZA 1QSYA 4O3SA 4Z6CA 3IV6A 1UHUA 3C29A 4Z6DA 1RZTA 1ZYQA 3DV9A 2DPIA 2KZ3A 4NM2A 5AICA 5E79U 3QUTA 3AMZA 3CW2C 8ICWA 2YB4A 5KAFU 1TFRA 4QZDA 4CF4A 2MA1A 3C5FA 3MR2A 4PHDA 4B9LA 2P35A 1S9FA 2GO7A 1ZQNA 1ZQQA 3GFKB 3PR4A 1A76A 1COKA 4I2JA 2G5HB 1QLNA 8ICYA 2ZIWB 4CRXA 3ISBA 1KBUA 5J2IA 4R65A 4QZ9A 5KAIU 2QLTA 3I76A 3OSPA 4FS2A 1RXVA 2R8IA 3SD7A 2KJ8A 3RR7A 5KL1B 5KFAA 1KLNA 2ZG6A 3RJFA 5J0YA 3ETRA 1N5WA 1SZHA 5HMLA 1JUDA 1KW4A 4YD1A 1D9DA 4O5KA 1KQQA 3PX6A 4RNNA 3RH5A 3WKEA 1COOA 4UB1A 2B0CA 1BPYA 1ZQUA 2H3QA 4C8NA 3UQ2A 5IIJA 4IQVA 5ALIA 3TAQA 2WF7A 4RQ6A 3QUBA 4QZAA 2ESEA 2HHQA 4KLTA 3QEAZ 5G5HA 4HYKA 4KLGA 1ZXIA 4PL2A 1UA0A 4IL6U 2HDOA 2HBKA 4I2DA 2WHEA 1PK1B 1ZOLA 2FLLA 2H3FA 2ZTDA 5CP2A 4I29A 2Y1IA 4MFFA 5L1MA 2HHXA 2NO5A 2M0NA 1ZJMA 1PVPA 2JV3A 3OSNA 4UATA 4K4HA 5DQHA 1XO1A 7ICUA 1ZQYA 2A3VA 3UPQA 5J2KA 2HBMA 3QEBZ 2K4PA 3WKAA 3M1YA 4QZGA 4I2GA 4UBCA 4AYBC 3LWLA 1O03A 1T94A 4ELVA 3NS1A 3U26A 5DBAA 1JRPA 4GLXA 4NY8A 1T8EA 1NJYA 1IV8A 2ZTCA 5ALUA 9ICUA 2EAPA 5KL8B 1VJ5A 1L8OA 4JMUA 3H0LB 1NZBA 4ED3A 4F5QA 2V9WA 1TAMA 2ZIVA 1L3SA 1URJA 2PFPA 3AEVA 3KD3A 1D8LA 3HP6A 4Q8EA 4GXIA 4KN4A 5IIOA 4ECWA 5KFMA 3RAQA 2WAQF 5ALRA 1A0PA 2V4QA 2KJ5A 2ATLA 4TQSA 5L1JA 3MDAA 3KKAC 1V9PA 1VDVA 1RPLA 5DB8A 5AI9A 2JZBB 3ED5A 3UXOA 4C4SA 1NK6A 4DSEA 1MQ3A 5J2GA 3BQ2A 4QWEA 4P4PA 4BXOA 3QU5A 1ZQAA 3IDWA 1IM4A 3RB3A 3NGDA 4DOAA 3K1ZA 4DL5A 2KKPA 3WKBA 5EE3A 5TISU 5KFJA 4JV2A 5AK5A 2NV3A 2H3IA 1BGXT 5KG6A 1ZRNA 4UARA 4QZEA 2FPLA 4DEZA 8ICBA 5AK3A 4B9NA 5J8YC 2VA3A 1Z19A 4U6PA 4IR1A 4IRCA 4KLEA 4O3MA 2O6KA 3H8JA 3RF9A 3TADA 9ICNA 4B9TA 2HVHA 7ICGA 4Y2UA 3C2LA 4P0QB 1BPXA 4JUZA 2ZJAA 1XSLA 1DK3A 2OEHA 4I2HA 1B43A 1ZD5A 2ISOA 2AGOA 3TARA 4AP9A 4KLFA 2BHNA 4UB3A 2MAXA 1MQ2A 2MRLA 4IQWA 1KFDA 5ALEA 1OXJA 3G6XA 1D8BA 4B6JA 2NRXA 4M9GA 3FDSA 4FZMA 1SL2A 4DSJA
chains in the Genus database with same CATH topology
1LKYA 1OW5A 1WWUA 1RG6A 2Y9TA 5KNIA 3BS5A 4RQNA 1B4FA 2LPEA 3HILA 2E8PA 2KE7A 1KW4A 2KSOB 2KMDA 2D3DA 1UCVA 2E8MA 1SV0A 3SENA 2DL0A 1JI7A 2EAMA 2ES6A 1SXDA 3KKAC 4NJ8A 5F3XB 1B0XA 1X66A 1SV4A 3BQ7A 1PK1A 1PK3A 3SEIA 2ESEA 4IS7A 1SXEA 2FE9A 3IDWA 1V38A 3H8MA 2F3NA 2QB0A 1SGGA 2KG5A 3K1RB 1PK1B 1Z1VA 5L1MA 1SV0C 2EAOA 2YTUA 2JV3A 5JTIA 2DKXA 3BS7A 3KKAA 1V85A 5J8YC 4PZNA 2GLEA 4PZOA 1F0MA 2E8OA 2F44A 2K4PA 3BS5B 1X40A 5JRTA 2QB0B 1LKYB 2QB1A 1UQVA 2F8KA 5J8YA 3TADA 2L5YA 1COKA 4RQMA 4NL9C 2K60A 2Y9UA 2D8CA 2B6GA 3TACB 2EANA 2KSOA 2QARA 1DXSA 2EAPA 3TADC 2KIVA 1X9XA 1WWVA 5JU5A 2LMRA 2QARB 4NL9A 4MHVA 2DKZA 2E8NA 1OXJA 2QKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY A;  1OW5 A;  1WWU A;  1RG6 A;  2Y9T A;  5KNI A;  3BS5 A;  4RQN A;  1B4F A;  2LPE A;  3HIL A;  2E8P A;  2KE7 A;  1KW4 A;  2KSO B;  2KMD A;  2D3D A;  1UCV A;  2E8M A;  1SV0 A;  3SEN A;  2DL0 A;  1JI7 A;  2EAM A;  2ES6 A;  1SXD A;  3KKA C;  4NJ8 A;  5F3X B;  1B0X A;  1X66 A;  1SV4 A;  3BQ7 A;  1PK1 A;  1PK3 A;  3SEI A;  2ESE A;  4IS7 A;  1SXE A;  2FE9 A;  3IDW A;  1V38 A;  3H8M A;  2F3N A;  2QB0 A;  1SGG A;  2KG5 A;  3K1R B;  1PK1 B;  1Z1V A;  5L1M A;  1SV0 C;  2EAO A;  2YTU A;  2JV3 A;  5JTI A;  2DKX A;  3BS7 A;  3KKA A;  1V85 A;  5J8Y C;  4PZN A;  2GLE A;  4PZO A;  1F0M A;  2E8O A;  2F44 A;  2K4P A;  3BS5 B;  1X40 A;  5JRT A;  2QB0 B;  1LKY B;  2QB1 A;  1UQV A;  2F8K A;  5J8Y A;  3TAD A;  2L5Y A;  1COK A;  4RQM A;  4NL9 C;  2K60 A;  2Y9U A;  2D8C A;  2B6G A;  3TAC B;  2EAN A;  2KSO A;  2QAR A;  1DXS A;  2EAP A;  3TAD C;  2KIV A;  1X9X A;  1WWV A;  5JU5 A;  2LMR A;  2QAR B;  4NL9 A;  4MHV A;  2DKZ A;  2E8N A;  1OXJ A;  2QKQ A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  4ECR A;  3MGI A;  4F2R A;  4YMO A;  2E5S A;  2LYB A;  5DKW A;  2FMP A;  2E8P A;  9ICL A;  5EE0 A;  4C8O A;  2KSO B;  3JPQ A;  1FO4 A;  2KIW A;  5L1I A;  5HMM A;  2YML A;  4ECU A;  2K8B B;  2WB1 C;  5DGB A;  4NLZ A;  1AQ6 A;  2FI1 A;  2MUT B;  3PSI A;  4ACO A;  2ZIX B;  2YX8 A;  3PMN A;  2LM1 A;  4ECT A;  2EQY A;  2A19 A;  4ED8 A;  1SXE A;  4DFK A;  5HHH A;  1L7M A;  4K4I A;  2OH2 A;  3RJE A;  4FBT A;  3F53 A;  4J03 A;  4IQT A;  2WAQ C;  1T3Q A;  2EAO A;  2Y0S F;  1S77 D;  4F3O A;  4DL4 A;  1ZQL A;  1U47 A;  3IN5 A;  9ICC A;  3V7J A;  5DG7 A;  5KT2 A;  3H8W A;  3D2S A;  4QIW F;  5G5G A;  1UA1 A;  1NKE A;  4UBB A;  4YN4 A;  3BZK A;  2B21 A;  1LKY B;  4O3Q A;  1UQV A;  2JGA A;  8ICM A;  4FBU A;  5J2C A;  4J9N A;  1NZP A;  1ZJN A;  3FC4 A;  2HMX A;  1NK9 A;  5A0L A;  3F2B A;  1RYU A;  1TVA A;  4QZF A;  8ICU A;  2CXY A;  3UMC A;  3KHL A;  4G3I A;  4DQP A;  1SWW A;  4M6W A;  3RAX A;  4P0P A;  4PJ0 U;  4EZ6 A;  3QZ7 A;  1ED1 A;  4DLG A;  3BDP A;  5IIK A;  2YQE A;  5AI0 A;  3PSF A;  3WK8 A;  2IMW P;  3QZ8 A;  2Y9T A;  2RRD A;  3AQF A;  4OO1 J;  4P2H A;  3SI8 A;  5BOL A;  4TUP A;  2EZY A;  3M6Z A;  4RT2 A;  5KFB A;  3T79 A;  2G0A A;  4ED2 A;  1HUZ A;  3Q8P B;  2ZUD A;  1X6J A;  2VAN A;  2OHF A;  3NVW A;  5DB7 A;  2G07 A;  2OXO A;  3HJE A;  1SZP A;  2J6U A;  2AQ4 A;  4EBE A;  3PST A;  4OJO A;  2W43 A;  3MAB A;  2W04 A;  2A1J A;  3ISD A;  3H4D A;  3OJU A;  4F2S A;  4O5E A;  2KG5 A;  5ALP A;  5ALY A;  4F4X A;  1ZQK A;  1ZD4 A;  3VC8 A;  1L7O A;  3MR6 A;  3GDX A;  4UW9 A;  4EEN A;  5KFV A;  4RQ3 A;  5AKK A;  2ALZ A;  4GC6 A;  4RPZ A;  1UPH A;  5JTI A;  5KFK A;  5D4B A;  2KVC A;  3KKA A;  3JPR A;  1A6S A;  1V85 A;  1NJX A;  2JH7 A;  3PSP A;  1KN5 A;  4BJQ A;  2I9G A;  4R66 A;  5DDY A;  2C22 A;  1LB2 B;  2KVS A;  4RQ8 A;  7ICQ A;  4QNL A;  1JN3 A;  4RQM A;  1NKC A;  2D8C A;  2FLP A;  5CB1 A;  3KZI U;  7ICH A;  2ZXI A;  8ICN A;  3QU4 A;  2MUT A;  4C0Z A;  3M8R A;  1ZQO A;  5KT6 A;  5III A;  2RDJ A;  2F77 X;  2JEJ A;  3M9N B;  3PW0 A;  1BNO A;  4BDP A;  1Z00 B;  9ICO A;  2BDU A;  4J9R A;  5AK4 A;  4I28 A;  3KBB A;  3RFA A;  2KJ9 A;  3ZD8 A;  4KLL A;  4OJ5 A;  4PL1 A;  5KFX A;  3SEN A;  2G5I B;  8ICZ A;  3Q8K A;  5J2A A;  4DQI A;  1X9W A;  1ZQJ A;  2KK0 A;  3KTQ A;  1JXL A;  9ICF A;  2HHV A;  1WYG A;  2K89 A;  2F76 X;  3SEI A;  3LWM A;  4R8U A;  2WF5 A;  3EW9 A;  1NKB A;  1J2N A;  1H38 A;  4XRH A;  3L5K A;  3ISC A;  3HWT A;  2HVI A;  4Y2S A;  2XI9 A;  4DL6 A;  5DG9 A;  2YMQ A;  2YN4 A;  5KFE A;  1Q8K A;  4UAZ A;  5J2J A;  3BS7 A;  2JZB A;  4KLO A;  4JV0 A;  1UT8 A;  1MSW D;  5ALJ A;  4WJ3 B;  2EZX A;  2VJ5 A;  3QXG A;  5EE9 A;  4BXO B;  3CNH A;  3NRW A;  3KHG A;  3RJK A;  2QB0 B;  4QZC A;  4BUG A;  3JPO A;  4Y2Q A;  2PXI A;  1BPE A;  4PHE A;  2UVU A;  1ZQE A;  2K60 A;  3C1Y A;  1WG8 A;  2VIX A;  2HHT A;  4EYH B;  1RDF A;  5EE1 A;  4PHP A;  1BNP A;  4I2I A;  3ALR A;  3OTQ A;  3O0F A;  3MR3 A;  1TK5 A;  4DQS A;  3CRX A;  4O3N A;  5KFW A;  4C7Y A;  3TFS A;  2A1J B;  4QWB A;  4NLN A;  3UMG A;  4KIT B;  3E2E A;  2WF6 A;  2AH5 A;  2PMZ C;  1RG6 A;  3N7S C;  1TK0 A;  3H0R B;  4BX9 C;  3V6H A;  2BCR A;  3GU3 A;  1FFU A;  4JK1 A;  7ICO A;  1NK0 A;  4R8U B;  2ES6 A;  2BPF A;  3WU2 U;  4F93 B;  4DL7 A;  4PHA A;  2KD1 A;  2W9C B;  4YCX A;  1N61 A;  2KOB A;  1LV5 A;  5J0P A;  4I27 A;  3KOO A;  4EEL A;  4KLQ A;  1V38 A;  3H8M A;  2MU2 A;  3IP4 B;  5KFG A;  2KFN A;  2ODG A;  5IIM A;  9ICX A;  1ECW A;  3PW4 A;  4F5N A;  2K8C B;  2JRZ A;  2PI4 A;  9ICT A;  1Z1V A;  1O08 A;  4O3R A;  4F5O A;  5KG1 A;  2DKX A;  2W11 A;  5ALW A;  4Y2T A;  1SL1 A;  1Z00 A;  3H4B A;  3FAH A;  2GLE A;  5ALX A;  4FO6 A;  2E8O A;  3AU6 A;  3S6J A;  5J2D A;  4ECQ A;  1IIP A;  3TFR A;  2XGQ A;  1HJP A;  5KFH A;  4B9V A;  5J8Y A;  2IBK A;  4Q45 A;  4OJL A;  3RBD A;  2NRW A;  8ICT A;  3Q8R B;  3F5A A;  3ZDB A;  4MHV A;  4ED7 A;  4C8M A;  5HP4 A;  3N7R C;  3RR8 A;  5DB6 A;  2VA2 A;  2KFZ A;  3T5H A;  5C0Y A;  5KTQ A;  1QTM A;  4F4Y A;  5K4L A;  4GIB A;  1ZQG A;  1WCN A;  1S0N A;  4RQ7 A;  1Z1B A;  4JB3 A;  2BKE A;  5ALO A;  8ICR A;  3NVV A;  3LDA A;  5KFT A;  5CWR A;  4DSK A;  5KFN A;  4M6W B;  4MEY A;  3R9K A;  4NJ8 A;  2W9B B;  4MFA A;  2I5H A;  3ORY A;  2PFO A;  2ASJ A;  3I28 A;  3BQ7 A;  4QWD A;  7ICJ A;  4C8K A;  5CJ7 A;  3RRH A;  4J9O A;  2KN7 A;  4DQQ A;  5D49 A;  2BZF A;  2RHF A;  3K4G A;  3T5J A;  2R18 A;  1V97 A;  3SV3 A;  2FPM A;  4NM1 A;  2C2R A;  3B0X A;  3IM1 A;  1NK7 A;  1RQN A;  2YMM A;  5ALH A;  4YVZ A;  3N28 A;  4F92 B;  2V4R A;  5KFY A;  2H3Z A;  3GIM A;  4AYB F;  5J0T A;  2FMS A;  4F71 A;  7ICI A;  3V6J A;  1SKW A;  5JRT A;  3RJI A;  3PML A;  1JMS A;  4DSI A;  2E1E A;  4FS1 A;  3PV8 A;  4KN7 A;  4US8 A;  1PVQ A;  2BPG A;  3ZDC A;  1BPZ A;  1RQL A;  4P4O A;  1SWV A;  2KSO A;  1NNL A;  3GIL A;  1DXS A;  5AM1 A;  3QU7 A;  3OHA A;  3C5G A;  1ARO P;  3LYS A;  3SAH A;  3SAF A;  3V72 A;  4P0P B;  5J0X A;  3N7P D;  5ALD A;  1NK5 A;  3H8S A;  2DUY A;  4OCZ A;  2BCS A;  9ICI A;  4B9U A;  5AKG A;  2HHU A;  1ZQ1 C;  1CRX A;  4GXJ A;  4BWM A;  3PO5 A;  5KFP A;  1ZQZ A;  7ICS A;  4C7Z A;  2W9M A;  4QZB A;  2J6T A;  2EDU A;  2P6U A;  2F1I A;  2HI0 A;  3ZDE A;  2ZUB A;  3AL0 B;  3I1Y A;  5KT3 A;  1X9S A;  1SV4 A;  4P4M A;  4IRK A;  2ZIU A;  3L4P A;  3D2Q A;  9ICB A;  2Z7J A;  3IRU A;  5AKL A;  2DGZ A;  3PW7 A;  4UB6 U;  1ZQH A;  2DQN B;  4XA5 A;  3OHB A;  2C2E A;  2G08 A;  2BPC A;  2KEY A;  3HPO A;  2LM4 A;  3E58 A;  3UQ0 A;  2LYH A;  3T3F A;  9ICS A;  2R8G A;  2PFQ A;  1N48 A;  3HKZ F;  1S0V A;  1U49 A;  1KTQ A;  2YB1 A;  5TZV A;  1KFT A;  1VLB A;  1F44 A;  2BCV A;  3CP8 A;  4I2C A;  4Z6F A;  1U48 A;  8ICC A;  1SL0 A;  2IHM A;  8ICE A;  4QJF B;  4UAY A;  4KLH A;  1F5S A;  1RM6 C;  3G6V A;  2M9N A;  4DO9 A;  2JXJ A;  9ICV A;  1XSN A;  3AUO A;  4DSF A;  2NRT A;  3K75 D;  4QWC A;  3UMB A;  1KFS A;  2EAN A;  2QAR A;  3C28 A;  1L8L A;  1S5L U;  4F4Z A;  2LBO A;  1CI4 A;  5BPC A;  4IC9 A;  1QQ7 A;  3FM9 A;  2ZJ5 A;  1BPD A;  2KP7 A;  3MFI A;  4K4G A;  2VKQ A;  3PO4 A;  4CF5 A;  3BS5 A;  2I1Q A;  5AM2 A;  5L1K A;  4DFJ A;  4KTQ A;  1QSS A;  4PGX A;  2ASD A;  2XY7 A;  2KZZ A;  2E8M A;  1TK8 A;  4IR9 A;  1KRP A;  2CRX A;  5AHX A;  3TAN A;  3AN1 A;  2DWQ A;  5IIN A;  4HAI A;  1PZN A;  5F9N A;  3RJJ A;  4O3O A;  4Y2R A;  5J29 A;  4O5C A;  2FDR A;  1T4G A;  3MBY A;  7ICP A;  4J9M A;  2KZM A;  1OUQ A;  4UB2 A;  3HT3 A;  2LI6 A;  3H7I A;  8ICJ A;  3G6Y A;  3NTU A;  5CR0 A;  3EZ5 A;  4NLC A;  2H3V A;  2AXT U;  1S0M A;  2FLN A;  3MFH A;  4ECY A;  4EBC A;  1DRG A;  4IRD A;  1KKX A;  3GV7 B;  5B5E U;  3LVW A;  3M7D A;  3CYM A;  1MA7 A;  1NK4 A;  1Q3U A;  1QQ5 A;  2ZIW A;  4RPY A;  4CNQ A;  1ZQC A;  4YD2 A;  5J2F A;  4OD0 A;  4DWI A;  2F8K A;  1SKR A;  4YR2 A;  2JEF A;  4YMM A;  1SKS A;  1N5X A;  3QUC A;  3KZX A;  3EPG A;  4DF4 A;  2ZUC A;  8ICI A;  2IHN A;  4CF3 A;  4PH5 A;  2KIV A;  1QCK A;  5KFC A;  2UVV A;  3B0Y A;  2MSN A;  5ALN A;  2CN1 A;  5ALM A;  5DBC A;  3J81 j;  4Y2V A;  2QKQ A;  3NAS A;  1SIJ A;  3JPP A;  4I2B A;  4YG2 A;  1N62 A;  5KG7 A;  1OW5 A;  1WWU A;  5C5J A;  3PNC A;  1CEZ A;  2NO4 A;  2W54 A;  4Z6E A;  4RQN A;  2ISP A;  1BPB A;  4UAV A;  3NRZ A;  2KV2 A;  4CGZ A;  2W03 A;  2LYA A;  5AK6 A;  2BQ3 A;  1X2I A;  3C1Z A;  4RQ2 A;  1NI3 A;  2D3D A;  5CEH A;  9ICQ A;  4C4T A;  2R8K A;  2EZZ A;  9ICP A;  2EAM A;  4ICA A;  1NJW A;  4BWJ A;  2EH9 A;  1RYS A;  4GC7 A;  2WF9 A;  4O9M A;  3WKD A;  2KNJ A;  1J2M A;  3BZC A;  5FP0 A;  5KFD A;  2DPJ A;  5AI4 A;  2Q4T A;  4JWM A;  1ZET A;  1PK3 A;  1PK1 A;  4NLG A;  5J0R A;  1Z4O A;  2BQU A;  4NLK A;  2JR5 A;  4KLU A;  3PW5 A;  1IXR A;  2FE9 A;  2QB0 A;  4UB4 A;  9ICK A;  3Q8M A;  3EPI A;  1Z3E B;  2F1H A;  5J0W A;  5AM5 A;  3RBE A;  1SV0 C;  1UT5 A;  3GZF A;  1KSP A;  1Q46 A;  1N56 A;  4LZG A;  4F91 B;  2J6S A;  1CUK A;  4IQU A;  4FZN A;  3BJY A;  1ZQV A;  2OWO A;  1F0M A;  1ZRM A;  3AM9 A;  2OCE A;  3BS5 B;  4GFJ A;  3QE9 Y;  5KG2 A;  3MC1 A;  4DQR A;  3ETL A;  1C20 A;  4NL9 C;  4DL2 A;  4C80 A;  4TUS A;  2ZJ8 A;  7ICK A;  7ICN A;  4JWN A;  2WF8 A;  1ZQT A;  5ALG A;  5AKX A;  5JU5 A;  3PW2 A;  5L9X A;  5J2H A;  3JPN A;  2DBY A;  4NL9 A;  5GTI U;  1Y88 A;  2JH1 A;  4RNO A;  3ICX A;  4TUQ A;  2XO7 A;  2W9C A;  3C23 A;  2FPK A;  4J9K A;  5AKI A;  2IOH A;  4ELT A;  4O3P A;  4J9L A;  1Z4N A;  4DOB A;  4NXZ A;  5ALS A;  4EYI B;  2RDI A;  1S76 D;  3M9M B;  1UCV A;  2JHD A;  5EWF A;  3ONN A;  1SV0 A;  5AM4 A;  4RT3 A;  2KHV A;  4UQG A;  2YY6 A;  2W9A A;  4EX7 A;  5J0U A;  3RB0 A;  2ZTE A;  3AQE A;  2I6X A;  2Y0S C;  1ZQW A;  4YQW A;  3GII A;  5AIA A;  4RU9 A;  9ICM A;  2W7P A;  2JEG A;  2C2D A;  3GV5 B;  1XSP A;  8ICS A;  3RJH A;  1S8O A;  1L6N A;  1ZQM A;  2ASL A;  2AQ0 A;  3RH4 A;  1FEZ A;  2XY5 A;  1N2X A;  2FJ6 A;  8ICV A;  5DBB A;  5KG0 A;  4RUA A;  4GXK A;  2R8J A;  4E0D A;  1JIH A;  7ICT A;  7ICM A;  1BVS A;  2LHT A;  4NV0 A;  4RUC A;  3EWA A;  2CPR A;  4A8E A;  2BCU A;  5GTH U;  1T7P A;  3B9J A;  1QQ6 A;  4PZO A;  3DEE A;  1L3V A;  2WB1 F;  2NYV A;  4I2F A;  2QB1 A;  1RYR A;  1JXE A;  5AM0 A;  2LKY A;  1KL9 A;  1T3N A;  2K4H A;  5DG8 A;  2Y9U A;  4FFD A;  2K8A A;  4Y2P A;  7ICF A;  1L7N A;  4YXM A;  1N63 A;  1XO0 A;  4QW8 A;  5CRX A;  8ICK A;  4DCC A;  4RZR A;  1K1Q A;  5EOZ A;  1QSL A;  4JV1 A;  1ZQS A;  3BQT A;  4M9N A;  4KX5 A;  3H40 A;  4EBD A;  5KFR A;  4J9S A;  3RH6 A;  4M9H A;  2GH1 A;  1L3T A;  1P7D A;  4EZ9 A;  3WK7 A;  4CDG A;  2GWS A;  2DFL A;  2IA6 A;  3NVZ A;  3WK9 A;  2E3T A;  2KE7 A;  3E0F A;  3RB4 A;  3PZP A;  7ICL A;  3Q8Q B;  3SAG A;  9ICJ A;  3C21 A;  1JI7 A;  2GOL A;  1S97 A;  1DGJ A;  3T5K A;  2G06 A;  2P6R A;  2JEI A;  4UB8 U;  2ZXH A;  1B0X A;  4RNM A;  1YZ6 A;  2W55 A;  5EWG A;  3SQI A;  3VCB A;  4B9M A;  2Q0Z X;  3D2N A;  4C8L A;  4DF8 A;  5AKZ A;  4IS7 A;  3HX0 A;  3UXN A;  4FZL A;  1U45 A;  9ICE A;  9ICW A;  3D6J A;  3NVY A;  3HRD D;  4F50 A;  8ICG A;  5KFL A;  3K1R B;  4P0Q A;  3N97 B;  5J0Q A;  3WK6 A;  4RPX A;  5KFI A;  4G9B A;  3H0M B;  2UVR A;  4ELU A;  4Q8F A;  3IHQ B;  2JMG A;  2C28 A;  4PZN A;  1EXN A;  2R8H A;  2F44 A;  2XCA A;  1DK2 A;  1IG6 A;  2HBL A;  3KFU F;  2G09 A;  1J97 A;  4CE6 A;  2HCF A;  1DOQ A;  4ED6 A;  2RP5 A;  1LVH A;  4DLE A;  4UB5 A;  4US9 A;  2BR0 A;  8ICO A;  1XNS A;  1TV9 A;  5J0O A;  4F5R A;  2AGQ A;  3V7K A;  1HIW A;  1X9X A;  4ECX A;  1XU4 A;  3JPT A;  2QAR B;  5HNK A;  4PPX A;  4KLJ A;  4DOC A;  4I2E A;  5AKE A;  2XC9 A;  5KFU A;  5J2B A;  4QW9 A;  2OM6 A;  3ZD9 A;  4KLS A;  4QZI A;  2PFN A;  2ZIU B;  4MFC A;  3WKC A;  8ICA A;  3V7L A;  8ICF A;  5AKJ A;  5KFF A;  2LPE A;  1C7Y A;  3QYP A;  3HIL A;  5DQI A;  3A0H U;  4LZD A;  2A1A A;  2HHS A;  1L3U A;  4M2Y A;  3PY8 A;  2HBJ A;  1WUD A;  1SXD A;  3MR5 A;  1D8Y A;  3DDH A;  1K5O A;  5ALF A;  4TQR A;  5J2E A;  3N4M B;  4Y2J A;  4YXJ A;  2BCQ A;  3HW8 A;  3Q8L A;  4F8R A;  5DLF A;  5DGA A;  4EX6 A;  3TI0 A;  3C2M A;  1SB3 C;  2F3N A;  3LVV A;  3BQ0 A;  3NUQ A;  4C4R A;  4XUS A;  3RTV A;  4Y2X A;  3MGH A;  4KLD A;  2XIC A;  3QU9 A;  3PX0 A;  5B66 U;  1HUO A;  5KFQ A;  3SMV A;  4UAW A;  5KFO A;  2YMP A;  3IG8 A;  1FIQ A;  4Q43 A;  1WCL A;  2DF4 B;  1KDH A;  5ALQ A;  1D9F A;  4EEY A;  5ALK A;  4F4K A;  1ZQP A;  5KG3 A;  2KIC A;  2XID A;  1GO3 F;  2XGP A;  4MEX A;  5ALZ A;  2XCP A;  2W8K A;  2B6G A;  4KMU A;  4KLI A;  5H2F U;  5KFS A;  1KEJ A;  4OJP A;  4UAS A;  4FE3 A;  1TE2 A;  4J9Q A;  4DS5 A;  1TAU A;  2DKZ A;  2E8N A;  4ZOH C;  4ECS A;  1TKD A;  4KX3 A;  5CA7 A;  4QWA A;  3ZI4 A;  1L5U A;  3BQ1 A;  3WK4 A;  5KG4 A;  4OJ6 A;  3LK9 A;  2HSZ A;  1B4F A;  4ED1 A;  3SV4 A;  4YP3 A;  2AU0 A;  5D46 A;  1PUZ A;  5DQG A;  2DL0 A;  1ZQF A;  2BDP A;  3RRG A;  4RQ4 A;  2D6F C;  1NOM A;  2F1J A;  2FMQ A;  5DB9 A;  5KT5 A;  1X66 A;  3WK5 A;  3SZ2 A;  4F72 A;  3EYZ A;  5J0S A;  4B9S A;  4MF2 A;  3PR5 B;  2P66 A;  3F2D A;  1ZQI A;  3THV A;  7ICV A;  2W9B A;  3OPX A;  1FFV A;  3EUB 2;  4LJX A;  2UVW A;  3FYH A;  2Y1J A;  4KLM A;  4KMO B;  3V6K A;  2H5X A;  9ICH A;  1JX4 A;  4M04 A;  2AHO B;  8ICL A;  7ICR A;  4R63 A;  1ZQD A;  5F9L A;  4DSL A;  1M6Y A;  5CHG A;  5AI5 A;  2YTU A;  4RQ5 A;  1X9M A;  2F8L A;  8ICX A;  4NWI A;  3GQC A;  2WTF A;  5AKH A;  3GIK A;  4R64 A;  2HOI A;  3IG5 A;  9ICG A;  2W3S A;  2ZIV B;  5HR7 A;  4DS4 A;  4M9J A;  8ICQ A;  4YR3 A;  3QUQ A;  3F2C A;  3T5L A;  5AKY A;  2PKE A;  5ALV A;  1ZQR A;  3TAC B;  3M9O B;  3M6K A;  2BGW A;  5DLG A;  3RJG A;  3TAD C;  3MGV A;  1WWV A;  1JRO A;  2LMR A;  4MF8 A;  4PGQ A;  1A77 A;  1X42 A;  3SYZ A;  2OYY A;  3TKA A;  1RXW A;  2HOQ A;  2RQ5 A;  4QIW C;  5AM3 A;  3UM9 A;  3TQ1 A;  1LKY A;  1TAQ A;  4DL3 A;  2W7O A;  2PMZ F;  3PVX A;  4BGD A;  4RQ1 A;  1MC8 A;  3PX4 A;  2K4I A;  1N60 A;  2XVT A;  5AI8 A;  4NLB A;  4Q44 A;  2HOF A;  2KMD A;  3ZDA A;  4DFM A;  4X5V A;  2IOF A;  7ICE A;  4TUR A;  5HHI A;  4J9P A;  5KG5 A;  1XC9 A;  4O0I A;  1S0O A;  1JAL A;  1B22 A;  2W3R A;  3MDC A;  1ZD3 A;  2PI5 A;  4QZH A;  4YMN A;  4QZ8 A;  4DFP A;  4ECV A;  3M8S A;  3A0B U;  8ICH A;  3QU2 A;  4XQ8 A;  1Q3V A;  2KTQ A;  3C2K A;  1YZ7 A;  2XY6 A;  8ICP A;  1SGG A;  5DDM A;  4DFD A;  4PGY A;  5T14 A;  1YT3 A;  4USA A;  3Q8S B;  1PVR A;  5L1L A;  9ICR A;  1ZQX A;  3HKZ C;  3AU2 A;  2E1F A;  3GIJ A;  4Y2Y A;  1DGS A;  1L7P A;  2AJQ A;  2AGP A;  2K4E A;  5KT7 A;  2NRV A;  4M9L A;  4RQ0 A;  3OJS A;  1X40 A;  4M47 A;  1S10 A;  2F2A B;  1HEK A;  1U9L A;  2WFA A;  5IIL A;  3RB6 A;  2L5Y A;  5AIB A;  3L3F X;  9ICA A;  4YR0 A;  3KHR A;  1X6I A;  1QH9 A;  4EEK A;  1NJZ A;  1K1S A;  4UAU A;  4LVS A;  3QX7 A;  2HHW A;  4M0A A;  4YFK A;  3KHH A;  5BOM A;  4ZH4 A;  5KFZ A;  2RLT A;  2KHQ A;  2ZIX A;  2VA8 A;  3F5E A;  5ALT A;  5EWE A;  4ECZ A;  3OGU A;  5KNI A;  3GV8 B;  2KKV A;  1XS9 D;  4F5P A;  4I2A A;  2IOF K;  2HW3 A;  1XWL A;  2N1R A;  5ALL A;  3TAP A;  5JUM A;  5AI6 A;  2W8L A;  4ED0 A;  2BQR A;  1NK8 A;  4CCH A;  5F3X B;  1ZQB A;  1U4B A;  3QNM A;  5KT4 A;  1MN8 A;  3UXP A;  3SR6 A;  1ZD2 P;  3JPS A;  5HR6 A;  4F4W A;  4U7C A;  3ZDD A;  2NRZ A;  1QSY A;  4O3S A;  4Z6C A;  3IV6 A;  1UHU A;  3C29 A;  4Z6D A;  1RZT A;  1ZYQ A;  3DV9 A;  2DPI A;  2KZ3 A;  4NM2 A;  5AIC A;  5E79 U;  3QUT A;  3AMZ A;  3CW2 C;  8ICW A;  2YB4 A;  5KAF U;  1TFR A;  4QZD A;  4CF4 A;  2MA1 A;  3C5F A;  3MR2 A;  4PHD A;  4B9L A;  2P35 A;  1S9F A;  2GO7 A;  1ZQN A;  1ZQQ A;  3GFK B;  3PR4 A;  1A76 A;  1COK A;  4I2J A;  2G5H B;  1QLN A;  8ICY A;  2ZIW B;  4CRX A;  3ISB A;  1KBU A;  5J2I A;  4R65 A;  4QZ9 A;  5KAI U;  2QLT A;  3I76 A;  3OSP A;  4FS2 A;  1RXV A;  2R8I A;  3SD7 A;  2KJ8 A;  3RR7 A;  5KL1 B;  5KFA A;  1KLN A;  2ZG6 A;  3RJF A;  5J0Y A;  3ETR A;  1N5W A;  1SZH A;  5HML A;  1JUD A;  1KW4 A;  4YD1 A;  1D9D A;  4O5K A;  1KQQ A;  3PX6 A;  4RNN A;  3RH5 A;  3WKE A;  1COO A;  4UB1 A;  2B0C A;  1BPY A;  1ZQU A;  2H3Q A;  4C8N A;  3UQ2 A;  5IIJ A;  4IQV A;  5ALI A;  3TAQ A;  2WF7 A;  4RQ6 A;  3QUB A;  4QZA A;  2ESE A;  2HHQ A;  4KLT A;  3QEA Z;  5G5H A;  4HYK A;  4KLG A;  1ZXI A;  4PL2 A;  1UA0 A;  4IL6 U;  2HDO A;  2HBK A;  4I2D A;  2WHE A;  1PK1 B;  1ZOL A;  2FLL A;  2H3F A;  2ZTD A;  5CP2 A;  4I29 A;  2Y1I A;  4MFF A;  5L1M A;  2HHX A;  2NO5 A;  2M0N A;  1ZJM A;  1PVP A;  2JV3 A;  3OSN A;  4UAT A;  4K4H A;  5DQH A;  1XO1 A;  7ICU A;  1ZQY A;  2A3V A;  3UPQ A;  5J2K A;  2HBM A;  3QEB Z;  2K4P A;  3WKA A;  3M1Y A;  4QZG A;  4I2G A;  4UBC A;  4AYB C;  3LWL A;  1O03 A;  1T94 A;  4ELV A;  3NS1 A;  3U26 A;  5DBA A;  1JRP A;  4GLX A;  4NY8 A;  1T8E A;  1NJY A;  1IV8 A;  2ZTC A;  5ALU A;  9ICU A;  2EAP A;  5KL8 B;  1VJ5 A;  1L8O A;  4JMU A;  3H0L B;  1NZB A;  4ED3 A;  4F5Q A;  2V9W A;  1TAM A;  2ZIV A;  1L3S A;  1URJ A;  2PFP A;  3AEV A;  3KD3 A;  1D8L A;  3HP6 A;  4Q8E A;  4GXI A;  4KN4 A;  5IIO A;  4ECW A;  5KFM A;  3RAQ A;  2WAQ F;  5ALR A;  1A0P A;  2V4Q A;  2KJ5 A;  2ATL A;  4TQS A;  5L1J A;  3MDA A;  3KKA C;  1V9P A;  1VDV A;  1RPL A;  5DB8 A;  5AI9 A;  2JZB B;  3ED5 A;  3UXO A;  4C4S A;  1NK6 A;  4DSE A;  1MQ3 A;  5J2G A;  3BQ2 A;  4QWE A;  4P4P A;  4BXO A;  3QU5 A;  1ZQA A;  3IDW A;  1IM4 A;  3RB3 A;  3NGD A;  4DOA A;  3K1Z A;  4DL5 A;  2KKP A;  3WKB A;  5EE3 A;  5TIS U;  5KFJ A;  4JV2 A;  5AK5 A;  2NV3 A;  2H3I A;  1BGX T;  5KG6 A;  1ZRN A;  4UAR A;  4QZE A;  2FPL A;  4DEZ A;  8ICB A;  5AK3 A;  4B9N A;  5J8Y C;  2VA3 A;  1Z19 A;  4U6P A;  4IR1 A;  4IRC A;  4KLE A;  4O3M A;  2O6K A;  3H8J A;  3RF9 A;  3TAD A;  9ICN A;  4B9T A;  2HVH A;  7ICG A;  4Y2U A;  3C2L A;  4P0Q B;  1BPX A;  4JUZ A;  2ZJA A;  1XSL A;  1DK3 A;  2OEH A;  4I2H A;  1B43 A;  1ZD5 A;  2ISO A;  2AGO A;  3TAR A;  4AP9 A;  4KLF A;  2BHN A;  4UB3 A;  2MAX A;  1MQ2 A;  2MRL A;  4IQW A;  1KFD A;  5ALE A;  1OXJ A;  3G6X A;  1D8B A;  4B6J A;  2NRX A;  4M9G A;  3FDS A;  4FZM A;  1SL2 A;  4DSJ A; 
#chains in the Genus database with same CATH homology
 1LKY A;  1OW5 A;  1WWU A;  1RG6 A;  2Y9T A;  5KNI A;  3BS5 A;  4RQN A;  1B4F A;  2LPE A;  3HIL A;  2E8P A;  2KE7 A;  1KW4 A;  2KSO B;  2KMD A;  2D3D A;  1UCV A;  2E8M A;  1SV0 A;  3SEN A;  2DL0 A;  1JI7 A;  2EAM A;  2ES6 A;  1SXD A;  3KKA C;  4NJ8 A;  5F3X B;  1B0X A;  1X66 A;  1SV4 A;  3BQ7 A;  1PK1 A;  1PK3 A;  3SEI A;  2ESE A;  4IS7 A;  1SXE A;  2FE9 A;  3IDW A;  1V38 A;  3H8M A;  2F3N A;  2QB0 A;  1SGG A;  2KG5 A;  3K1R B;  1PK1 B;  1Z1V A;  5L1M A;  1SV0 C;  2EAO A;  2YTU A;  2JV3 A;  5JTI A;  2DKX A;  3BS7 A;  3KKA A;  1V85 A;  5J8Y C;  4PZN A;  2GLE A;  4PZO A;  1F0M A;  2E8O A;  2F44 A;  2K4P A;  3BS5 B;  1X40 A;  5JRT A;  2QB0 B;  1LKY B;  2QB1 A;  1UQV A;  2F8K A;  5J8Y A;  3TAD A;  2L5Y A;  1COK A;  4RQM A;  4NL9 C;  2K60 A;  2Y9U A;  2D8C A;  2B6G A;  3TAC B;  2EAN A;  2KSO A;  2QAR A;  1DXS A;  2EAP A;  3TAD C;  2KIV A;  1X9X A;  1WWV A;  5JU5 A;  2LMR A;  2QAR B;  4NL9 A;  4MHV A;  2DKZ A;  2E8N A;  1OXJ A;  2QKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...