2F8KA

Sequence specific recognition of rna hairpins by the sam domain of vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
SSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Sequence-specific recognition of RNA hairpins by the SAM domain of Vts1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/ rna
molecule keywords 5'-R(*UP*AP*AP*UP*CP*UP*UP*UP*GP*AP*CP*AP*GP*AP*UP*U)-3'
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f8kA00
3TADA 3IDWA 2KSOB 5J8YC 1RG6A 5JU5A 1KW4A 2F3NA 2ESEA 3KKAA 1Z1VA 2FE9A 1DXSA 1B0XA 3TACB 5JTIA 5KNIA 2Y9TA 1SGGA 2EAOA 4PZNA 2DKXA 2E8PA 4RQMA 2EAMA 5L1MA 2B6GA 2DKZA 1SV4A 3SENA 2QARB 2QB0B 2F8KA 3SEIA 3TADC 1SV0A 2KSOA 4NJ8A 2K4PA 2Y9UA 3K1RB 3H8MA 1PK1B 2D3DA 3BS5A 4IS7A 4NL9A 1WWVA 3BS7A 2QARA 2QB0A 2JV3A 1PK1A 1B4FA 2DL0A 2EANA 3KKAC 1OXJA 1SV0C 2KG5A 2KE7A 1F0MA 2E8OA 1V38A 1OW5A 1X9XA 2KIVA 3BQ7A 1SXEA 2K60A 2KMDA 1WWUA 1V85A 4RQNA 1LKYB 2YTUA 2QB1A 1PK3A 2E8MA 3BS5B 2GLEA 5J8YA 4NL9C 4MHVA 2E8NA 2LMRA 1X66A 3HILA 5F3XB 1LKYA 2D8CA 5JRTA 1UCVA 1JI7A 1SXDA 2ES6A 1COKA 1UQVA 2F44A 2EAPA 2LPEA 1X40A 4PZOA 2QKQA 2L5YA
chains in the Genus database with same CATH superfamily
9ICRA 5CJ7A 1T8EA 1ZQTA 3HJEA 1QQ5A 4CE6A 2UVWA 5J0WA 3QU4A 1Z00A 2IOFK 5EE3A 3KHGA 4DCCA 3NGDA 5KFCA 3LVWA 2DUYA 5DG7A 1XSPA 1ZQRA 5KG0A 3PW7A 2F77X 3OHBA 4P4MA 3ZDBA 5ALJA 1TAMA 1S9FA 2HBKA 5HHIA 2H3VA 2QB0B 4M04A 1ZQBA 4O5CA 2ZIVB 3DDHA 4DOCA 2Y9UA 3MDAA 3PMNA 8ICSA 2KJ8A 5G5GA 1NK0A 4KX5A 3KFUF 4NL9A 2XICA 4UAWA 2RDIA 4C4SA 1ZQOA 3B0XA 1FEZA 3SAGA 3JPPA 1RQLA 2RLTA 4DFJA 4CF3A 1XO1A 4ED1A 1KFTA 3PZPA 4RQ4A 1Z3EB 4DL6A 4ICAA 3WKDA 2EZZA 2G5HB 3PSIA 5HP4A 9ICWA 2K60A 5BOLA 4FS1A 1MA7A 1T94A 1WG8A 5CWRA 7ICFA 9ICUA 5J2HA 1S97A 4O3SA 1C7YA 1ZQKA 4O9MA 4DSFA 3SQIA 4UARA 3RR8A 1ECWA 3G6XA 2FMSA 5ALEA 3HT3A 3QU2A 9ICMA 2BDUA 3TADA 4DFKA 1RYRA 4I2BA 2DBYA 1BPBA 1S0OA 2ESEA 4BWJA 2AGPA 5AKKA 4QWBA 1ZQNA 2BCRA 4PGQA 7ICUA 1NK5A 9ICPA 4R64A 5AM3A 2FPMA 1UT5A 4RQMA 1ZJMA 2JMGA 4YFKA 2HMXA 3WU2U 4J9KA 2H3ZA 5KT5A 2XC9A 3TADC 4B9VA 4ECRA 5AI0A 2JZBB 2OEHA 3RJEA 2ZTCA 7ICVA 2R18A 4KLSA 4RPXA 3RH6A 2WF9A 2R8KA 4YQWA 2F1HA 4DQPA 2NO4A 4JV2A 4MFAA 2M9NA 1U45A 1ZQDA 9ICOA 2KG5A 4OJ5A 2XGQA 4QWEA 1K1SA 3E2EA 2Y0SF 2HSZA 3PX0A 2I6XA 4F72A 2ZXHA 1L8OA 2UVRA 3MR3A 1QQ6A 1FIQA 1V85A 3RJFA 4RQNA 4P0PB 5J0SA 2OH2A 4I2IA 5C5JA 3EUB2 4XUSA 4PGYA 2PI4A 3ZI4A 2C2EA 4AP9A 2E8NA 3WKAA 2A1AA 3HP6A 1DRGA 2LMRA 4P0QA 1A76A 4O3NA 3ZD9A 2OXOA 4QZIA 2KKVA 3QZ7A 5JRTA 5L9XA 2HBMA 4C4TA 1KQQA 1SZHA 2YX8A 2GOLA 1Z19A 7ICQA 1MN8A 7ICHA 3V7LA 4DWIA 4UB4A 2KICA 3MFIA 5AI4A 1MQ3A 2LYBA 2J6TA 2ZUCA 5DGBA 2W9CA 4NV0A 8ICJA 5ALMA 2ATLA 2KKPA 1J97A 1U48A 1KLNA 5KNIA 5AKXA 4F5RA 1X9SA 1RZTA 5CHGA 1VJ5A 8ICQA 2BCSA 4M9NA 2IA6A 4B9SA 3AQFA 9ICHA 4M9LA 4UQGA 4IS7A 3JPRA 3VC8A 5J0XA 4Z6FA 3PVXA 4PHPA 4RT3A 4XQ8A 2XO7A 2W9MA 2YN4A 4QWDA 4M0AA 2HHVA 2W3SA 4ACOA 1KBUA 2E3TA 1L6NA 1ZQMA 3QEAZ 4KX3A 2NRVA 5KFBA 4EZ9A 3N28A 3UPQA 3ETLA 4Q44A 2VKQA 1ZQIA 4PPXA 5EWGA 2NRWA 2AGOA 4UATA 5KT6A 4O5KA 5ALRA 3KZXA 4QZ8A 4US9A 3KTQA 3LDAA 1SL0A 1ZXIA 1Z4OA 8ICXA 3RF9A 4Z6CA 3PW2A 5B5EU 1L7NA 5KFDA 1S5LU 5CR0A 2FI1A 1X66A 1XSLA 3PW0A 5IIJA 2V4QA 4OJOA 5FP0A 3RJKA 4DQSA 1VLBA 7ICKA 2I9GA 1NI3A 5HNKA 4YMOA 4GXJA 3WKCA 4J9QA 1ZQAA 4ELUA 3N4MB 1ZQGA 3OSNA 1SWVA 1NKCA 2OWOA 1SB3C 4EBEA 1TAQA 5CRXA 1S0NA 8ICVA 4QZAA 1Q3UA 4DSEA 5AKYA 2VA2A 3TAPA 3QZ8A 3GDXA 2P6UA 1QLNA 1ZD3A 5AK5A 4QWAA 1ZQSA 2DWQA 2OHFA 1A77A 1AQ6A 4KN4A 4DLEA 4I2EA 4MEYA 3S6JA 4Y2YA 2DKZA 3Q8MA 4IC9A 3SMVA 9ICQA 4KMUA 4PHAA 3FAHA 4KLUA 3QU5A 2XCAA 1LB2B 1S8OA 5CA7A 3EWAA 4O3QA 3MGIA 2W43A 3H8MA 3RTVA 4Y2JA 5DB9A 1PZNA 3SI8A 1ZQHA 4ELVA 2DQNB 2JEGA 2DL0A 2JR5A 5DB8A 2HOFA 3WK5A 1DOQA 8ICRA 5DQHA 3CYMA 4P4PA 4QZEA 7ICRA 2ZTEA 4GC6A 2KIVA 5IIIA 4FS2A 5KFGA 3J81j 1NOMA 3BQ2A 3WKBA 4QZDA 3EPGA 4O3RA 2KHQA 1WCLA 1JXLA 4UB6U 1PK3A 4LVSA 4O3OA 1P7DA 1DGJA 2HHSA 4OO1J 1YT3A 3ISDA 4US8A 3ORYA 1QSSA 4TQRA 4DF4A 3N97B 4F93B 4BJQA 5DG9A 3RBDA 3RR7A 2NRXA 2RRDA 3GV7B 2D8CA 3UQ0A 3UMBA 2A1JA 2FMQA 3GQCA 3HPOA 1S77D 1KKXA 5JU5A 3A0HU 2QKQA 2EH9A 5J0PA 4ZH4A 2MAXA 3KBBA 5J8YC 2W8KA 4ECUA 3IRUA 1JMSA 2BKEA 1KW4A 2WF8A 3AU6A 2IOHA 4OD0A 3QYPA 3PY8A 4TUQA 1X9MA 3UXNA 3H40A 1KFSA 4EX7A 4F5QA 3RJGA 4JV1A 3WK9A 4J9MA 5K4LA 2W03A 3F53A 4K4HA 4IRDA 1TV9A 1X42A 5KT4A 4U6PA 3RJIA 5AKZA 1XWLA 2JEFA 4YD2A 2C22A 2WAQC 5HR6A 1KSPA 1CRXA 7ICTA 1IV8A 1ZETA 2ZUDA 1WWVA 9ICNA 5L1KA 4Y2PA 3BS7A 2F1IA 3QUTA 3JPQA 2IHMA 3PX4A 4AYBF 4I2GA 1SV0C 2CXYA 4ED0A 1ZD4A 1N5WA 2W54A 2WHEA 4CF5A 1ZQLA 2WAQF 3V72A 1JN3A 3OGUA 4RPZA 3OPXA 3UQ2A 5AM4A 5EE9A 1RM6C 1U4BA 4ECQA 3NVVA 5G5HA 3QX7A 2ASDA 5AICA 5KFHA 4ELTA 4XA5A 3FYHA 5ALLA 3EZ5A 5KG4A 2Y1JA 3O0FA 4ZOHC 3LWMA 1ZJNA 4MFFA 3MABA 4I2JA 1L3TA 4JWNA 1NK6A 3I76A 4UW9A 5E79U 2ZXIA 2ASJA 4DSJA 1SL2A 1L7MA 3TQ1A 1NJZA 3RBEA 2W7PA 1O08A 2VA8A 2F8LA 3M7DA 1COKA 5AKGA 1NK9A 4NLBA 3MGVA 2ZIXB 3E58A 4KLOA 3C29A 5ALZA 5ALWA 2BPCA 1N2XA 1C20A 4DFDA 4RZRA 1KN5A 1V97A 5KFLA 1DXSA 1COOA 4GFJA 1L5UA 4JMUA 1XNSA 4UB8U 4C8OA 2DKXA 3SYZA 4ECXA 1XU4A 4P0QB 3AMZA 4BDPA 5J0RA 5ALTA 1HIWA 2F8KA 8ICBA 1X6IA 4Y2XA 4UBBA 2KSOA 3NS1A 2R8JA 2P66A 2AHOB 2ZTDA 1D8LA 5KFTA 5F9NA 3V6HA 5DLFA 2HBLA 3BS5A 1NZPA 1ZD2P 5DBBA 4QWCA 1PVRA 2BCQA 4NM2A 8ICKA 2ZUBA 2BHNA 3PW4A 4I2DA 2FPLA 3WK7A 2KZZA 4YMMA 4KLGA 2BDPA 1X9XA 9ICFA 5L1IA 4ED7A 5KFPA 4F4XA 4Z6EA 4KLQA 4F5OA 4RUAA 5KFVA 4QZBA 2Q0ZX 3MC1A 3GU3A 2P6RA 4I2AA 1L8LA 4XRHA 5DKWA 3BJYA 3K4GA 1QTMA 4KMOB 4KLTA 4RNMA 1TKDA 3QEBZ 4K4IA 2Y0SC 2XVTA 4WJ3B 3BQ0A 2MSNA 2NV3A 4X5VA 4G3IA 4EYIB 3SD7A 2YY6A 5ALDA 4RQ0A 2V9WA 5ALKA 2RHFA 5AI6A 2EAPA 3M9MB 1B0XA 4B9TA 2K8BB 3RRGA 3QUQA 4DL4A 2F3NA 4FZMA 2NO5A 4FBUA 1Z1VA 3NVZA 3QXGA 4C80A 2DGZA 5KFOA 1PVQA 4NM1A 3PR4A 5DLGA 3PX6A 1NK8A 2FJ6A 1ZQZA 3Q8LA 3Q8QB 3HKZC 5KFFA 8ICHA 1X9WA 3EPIA 3C2MA 3ISBA 4UBCA 1UA0A 4C8NA 2K89A 4YR2A 2K8AA 4PHDA 3RFAA 1UPHA 1SKWA 4BXOB 3MFHA 3FM9A 5KT7A 1CEZA 2B21A 1H38A 4FZLA 2WB1C 4F2SA 1HJPA 2KFZA 2ZJAA 4UB2A 3IN5A 3BQTA 1N48A 3RB0A 1N56A 3D2NA 4P4OA 9ICCA 5ALHA 5KG5A 2HVHA 2HHQA 1U9LA 1Z4NA 1GO3F 2N1RA 5IIKA 4QZ9A 3IG8A 1ZQXA 4GXIA 4EEYA 2C2RA 2KMDA 4EBCA 2HVIA 4EENA 4DQRA 2HCFA 2M0NA 3ONNA 2DF4B 5J8YA 3RB4A 4K4GA 2JEJA 2A1JB 9ICJA 5J0TA 5J2CA 5IIOA 1N60A 1KL9A 4JB3A 4QZFA 2BR0A 4CNQA 1PUZA 2W7OA 2DPIA 2UVUA 1LKYA 4YN4A 5KG2A 4I27A 1N62A 2AQ4A 1UCVA 1NK7A 2JEIA 4DL7A 4I2CA 4B9MA 4OJ6A 8ICPA 5DBAA 2YMLA 2LPEA 3TACB 4YP3A 1U49A 4Y2RA 3AM9A 1NNLA 1URJA 4O3PA 2C28A 1RG6A 1Q46A 5GTIU 5J2BA 4O0IA 1ZQEA 2ZIXA 1Z00B 3A0BU 2F2AB 3GFKB 5DQIA 9ICGA 5EE0A 5D46A 3T79A 1V9PA 1NJWA 4BUGA 2KZMA 2JRZA 5AM5A 2FDRA 4KITB 5CEHA 4I29A 5AM1A 4RUCA 3SEIA 8ICTA 3M6KA 1YZ7A 5HMMA 3D6JA 2D3DA 5KG1A 3R9KA 7ICOA 2YQEA 4ECTA 2ISOA 1X2IA 2PXIA 2OM6A 5AIAA 2B0CA 2G08A 5AIBA 1JUDA 2HW3A 3TAQA 2XI9A 3G6YA 4P0PA 3T5LA 3AU2A 2LYAA 3C23A 1ZYQA 2KFNA 3M8RA 5TISU 1D9FA 4Y2VA 1DK3A 2KV2A 5J0UA 3PSFA 2EZXA 4KLIA 1ZQUA 4IQTA 3RB6A 4ED2A 1RDFA 3GIIA 8ICLA 2KN7A 1SKRA 7ICMA 8ICZA 4UAZA 2VJ5A 5DB6A 2C2DA 3IDWA 2K4HA 1Z1BA 2KOBA 4RQ1A 1TVAA 2G09A 3RB3A 1NJXA 2O6KA 5KFAA 3L5KA 2XY7A 9ICIA 2IMWP 1ED1A 3LK9A 3WK4A 5AKEA 4DOAA 2W11A 7ICJA 4E0DA 3QU9A 3N7PD 5EOZA 3GILA 4GLXA 2ZIUA 4EZ6A 4MFCA 1BNOA 4F71A 4DSKA 5IINA 3T5HA 2FLNA 2BQ3A 4B9UA 3BZKA 3WK8A 3PR5B 2JV3A 2KNJA 4YD1A 3RAXA 4UAYA 5A0LA 4DS4A 3KKAC 5KFQA 3OSPA 2IOFA 2XGPA 2BCUA 2LKYA 2E8OA 4F4WA 2W9BB 4GXKA 1V38A 2YB1A 2D6FC 1IIPA 3KZIU 4M9HA 4QZGA 8ICIA 1FFVA 5TZVA 1ZRMA 1BPZA 2HHTA 1UT8A 4YMNA 1KRPA 3JPTA 1KTQA 2KK0A 5ALXA 1ZQJA 2MU2A 4F4YA 3BS5B 5KFKA 3K1ZA 1N63A 3H0LB 2LYHA 2WB1F 1BPXA 2ALZA 3QUBA 5AM2A 1N61A 4YG2A 2BPGA 1ZRNA 2HOQA 4UB5A 4F2RA 4KLJA 2GWSA 1WUDA 1UQVA 5ALQA 2ISPA 4M9GA 4DEZA 5B66U 1T4GA 3M6ZA 4UAVA 3MGHA 3V6JA 2XY6A 4DSIA 4NLZA 3IV6A 4C0ZA 4R8UB 3C1ZA 3NTUA 2AGQA 1SIJA 2KVCA 5DB7A 4Y2TA 4JK1A 1O03A 1B22A 3V7KA 5KG6A 2MA1A 1SV4A 3L3FX 4AYBC 2Y1IA 4CGZA 2ZIWA 8ICMA 2LM4A 2WF6A 3AQEA 2BPFA 1Q8KA 5KAFU 1K5OA 4KLFA 2HBJA 2F1JA 5IILA 3MR6A 4PGXA 4F91B 1ZQYA 1XC9A 2GO7A 4LJXA 4DQIA 4PL2A 3LVVA 1BNPA 4GIBA 4F5NA 4DFPA 2PFOA 2R8GA 1CI4A 5AK3A 4IR1A 4UB1A 3ALRA 5AI8A 5ALGA 3Q8RB 4DOBA 5J2IA 2P35A 2E8MA 4IQWA 2YMPA 3WKEA 4BGDA 4BWMA 4RQ6A 2ZJ8A 3DV9A 3SAHA 5J2DA 4MHVA 8ICOA 1IXRA 3D2QA 4QIWF 2HDOA 2BQRA 1S76D 3TFRA 1J2NA 5KFMA 4RQ2A 2FLPA 4IL6U 1X40A 1T3NA 4FFDA 1JROA 2AJQA 2KTQA 2KSOB 1L7OA 3H4DA 2PMZC 3L4PA 2KZ3A 3FC4A 3NRWA 5AHXA 5AKJA 1HUZA 3ISCA 7ICSA 4QIWC 2WTFA 3V7JA 3GIJA 2J6SA 5AK6A 2PFPA 2RDJA 4PZNA 1ZQCA 2W04A 4HYKA 4QZCA 5L1MA 3ED5A 4DQQA 3C1YA 1NZBA 4DLGA 1N5XA 4YXMA 1ZOLA 1AROP 3IG5A 3PV8A 3CW2C 5J2AA 2I1QA 1SKSA 4J9PA 1WYGA 4DO9A 2QB0A 1XO0A 3BDPA 4IRKA 4KLEA 9ICEA 9ICTA 2KE7A 3PSTA 4ED6A 5J2EA 1T7PA 8ICCA 1S0VA 2W8LA 2KEYA 2HOIA 1JALA 4RU9A 2G0AA 2XY5A 3ICXA 3KHLA 3CP8A 3AEVA 3KHHA 1S0MA 5BOMA 4Q8EA 3UXOA 2OYYA 2JH1A 3UMCA 1F5SA 4CCHA 3KOOA 3ZDAA 1IG6A 3OTQA 3C2LA 3PW5A 8ICWA 4F50A 4J03A 3OJUA 1M6YA 5DDYA 2FMPA 3U26A 2KIWA 1SXDA 2G5IB 3HKZF 1A0PA 4JUZA 2HI0A 3KD3A 4DL5A 2H5XA 5KFSA 4EEKA 4NLCA 3THVA 4KN7A 4Y2SA 2K4IA 9ICSA 4F8RA 3H0MB 2XIDA 3CNHA 4I2FA 3QUCA 1OUQA 3M9OB 4ED8A 5ALFA 8ICAA 4C7YA 2B6GA 2ZJ5A 4NLGA 5ALNA 3SENA 4TURA 3Q8PB 4F4ZA 4EX6A 4J9LA 4NJ8A 2K8CB 4F3OA 2VJ4A 7ICLA 4DS5A 1QQ7A 2NRZA 2H3QA 3QE9Y 1ZQ1C 3T5KA 4Q43A 3BZCA 4OCZA 2E5SA 4BX9C 9ICVA 4BXOA 3C5FA 4J9OA 4C8MA 4HAIA 4F4KA 5KAIU 2XCPA 3C28A 5ALOA 5IIMA 1XSNA 1OW5A 4IRCA 2FLLA 1EXNA 1UA1A 5T14A 5AKIA 4I28A 2DPJA 2RP5A 1L3VA 1ZQPA 3FDSA 1WWUA 7ICNA 2QB1A 5AKLA 1ZQFA 8ICFA 3JPOA 2EDUA 2GLEA 8ICYA 2E1FA 1JXEA 4NL9C 4QZHA 2YMMA 2G07A 1D8YA 5AI5A 4B6JA 3K75D 5F3XB 5KG7A 5EWEA 4QNLA 4QJFB 1ZQWA 4M6WB 4FZNA 5DBCA 2UVVA 4TUPA 1BVSA 4P2HA 5ALIA 1L3UA 5H2FU 4QW8A 1PVPA 1Y88A 3AN1A 4RQ7A 2MUTB 2W9CB 4NWIA 4JV0A 4IQVA 4KLHA 5JUMA 4C8KA 4O3MA 1FO4A 2JZBA 2A3VA 4MF8A 3Q8KA 2KJ5A 1QH9A 1RYUA 3PSPA 3SZ2A 4Y2QA 2QARB 5J0YA 4RQ8A 5KFIA 3MR2A 4FO6A 4YR3A 8ICNA 5ALYA 5AM0A 2EQYA 4DL3A 5KFYA 1FFUA 4DSLA 2CPRA 4QW9A 2RQ5A 5KL1B 1TAUA 2GH1A 2JXJA 3CRXA 4NLNA 1B4FA 4ED3A 3GIMA 5CP2A 2HHUA 1JIHA 1QSYA 4OJPA 3F2CA 1F0MA 3SV4A 2NRTA 3E0FA 4ECZA 2AH5A 1F44A 4CDGA 3PO5A 2BGWA 3QU7A 2WF5A 4KTQA 1MC8A 3B9JA 4PL1A 5ALVA 3MR5A 3F2BA 2YTUA 2W9AA 3C5GA 5KT3A 2ZIWB 2OCEA 2J6UA 2AQ0A 3I1YA 3N7SC 2CN1A 3ETRA 1HUOA 1CUKA 4B9LA 5GTHU 1KEJA 3T5JA 3I28A 3EYZA 4RPYA 2G06A 1JRPA 2W55A 3F5AA 1JI7A 3N7RC 3IM1A 2F44A 4MEXA 2BQUA 3VCBA 4C7ZA 4J9NA 3H8SA 4NY8A 4LZGA 3H4BA 1SL1A 4RNNA 7ICIA 3OJSA 3KKAA 4B9NA 2IHNA 3UM9A 4C8LA 5DQGA 4M9JA 2A19A 4ECWA 2KP7A 2WFAA 4UB3A 2Y9TA 5KFEA 5J0OA 4DF8A 2CRXA 4ECYA 4DL2A 3JPNA 1SZPA 3M8SA 3NVWA 3ZDDA 3HRDD 5EE1A 3GV8B 3NASA 2VIXA 3H8WA 2NYVA 2FPKA 8ICUA 3TFSA 1TK8A 1ZD5A 3K1RB 2R8IA 9ICXA 3SV3A 2PI5A 4PJ0U 1LV5A 4ECSA 2V4RA 2VA3A 2ZIUB 5DGAA 4KLLA 2WF7A 1OXJA 2ZIVA 1WCNA 5KFZA 5KFRA 3M1YA 3JPSA 3RH4A 4NLKA 8ICGA 3HW8A 3IP4B 5KFNA 1NK4A 2PKEA 4Y2UA 3UXPA 3RJJA 3BQ7A 2HHXA 5J2FA 1SXEA 1TE2A 4GC7A 1SWWA 9ICAA 5HR7A 1LVHA 1QSLA 3GV5B 1RQNA 2ODGA 9ICKA 1TK5A 8ICEA 1RYSA 3BQ1A 4Z6DA 3PO4A 2LI6A 1L3SA 1TFRA 3NVYA 3OHAA 1BPEA 3HILA 2IBKA 1L7PA 4EBDA 4Q8FA 5D4BA 4EELA 4CRXA 4R63A 3MDCA 2ZG6A 2BZFA 2LBOA 2MRLA 3LWLA 9ICBA 4PZOA 1J2MA 3PNCA 5J2JA 2L5YA 4UASA 3AL0B 4O5EA 1ZQQA 5L1LA 3C21A 1K1QA 1TK0A 7ICEA 4M2YA 2I5HA 4EYHB 3F5EA 2DFLA 2H3FA 5DG8A 3C2KA 4FBTA 7ICGA 3B0YA 5JTIA 4KLMA 2LM1A 5KT2A 2EAOA 2KVSA 3V6KA 5DDMA 5J0QA 4M47A 4TQSA 4DFMA 4CF4A 2KJ9A 4U7CA 3ZDEA 3SAFA 2K4PA 4YR0A 3TARA 3RAQA 3GIKA 1RPLA 5AKHA 2JGAA 2QARA 4YCXA 3TI0A 1PK1A 2Q4TA 2AU0A 2E1EA 4USAA 2LHTA 3RJHA 1D9DA 1NKBA 1T3QA 3LYSA 4PH5A 1NJYA 5HHHA 1A6SA 1UHUA 1DGSA 4A8EA 5KTQA 3ZDCA 1KFDA 3HX0A 5AI9A 1KDHA 5J2KA 1LKYB 3AUOA 4R66A 5KL8B 2PFNA 4C4RA 1NKEA 2JHDA 3KHRA 4IQUA 4Q45A 1RXWA 2KHVA 2Z7JA 2PMZF 4F92B 2R8HA 1VDVA 2YMQA 4NXZA 5BPCA 4RQ3A 3ZD8A 5KFXA 5KFUA 3PMLA 1DK2A 1MQ2A 3T3FA 4R8UA 5F9LA 4R65A 5EWFA 4J9SA 5KG3A 1U47A 1BPYA 4G9BA 1S10A 2FE9A 4KLDA 2EZYA 3WK6A 3GZFA 5C0YA 2AXTU 2W3RA 3F2DA 1SGGA 2KD1A 4TUSA 1BPDA 4RQ5A 2E8PA 3G6VA 1RXVA 2EAMA 2H3IA 1IM4A 4ECVA 3UMGA 9ICLA 4PHEA 1Q3VA 1SV0A 2F76X 2VANA 3H0RB 4F5PA 4YVZA 1PK1B 3Q8SB 5D49A 5J29A 5ALUA 1BGXT 2K4EA 4MF2A 3QNMA 4UAUA 3TKAA 3M9NB 2BCVA 2EANA 5HMLA 4RT2A 2PFQA 4JWMA 4YXJA 3EW9A 1XS9D 2JH7A 1QCKA 2YB4A 3D2SA 5AK4A 2W9BA 2QLTA 5ALSA 3HWTA 1YZ6A 2HHWA 7ICPA 5ALPA 4FE3A 3NRZA 5CB1A 3DEEA 3SR6A 1ZQVA 1X6JA 5L1JA 1D8BA 1JX4A 4M6WA 1MSWD 4J9RA 4OJLA 1HEKA 3H7IA 3MBYA 3TANA 3IHQB 4I2HA 3H8JA 3RH5A 5J2GA 1B43A 4IR9A 2ASLA 3NUQA 2ES6A 3RRHA 2MUTA 4RNOA 4LZDA 5KFWA 5KFJA
chains in the Genus database with same CATH topology
3TADA 3IDWA 2KSOB 5J8YC 1RG6A 5JU5A 1KW4A 2F3NA 2ESEA 3KKAA 1Z1VA 2FE9A 1DXSA 1B0XA 3TACB 5JTIA 5KNIA 2Y9TA 1SGGA 2EAOA 4PZNA 2DKXA 2E8PA 4RQMA 2EAMA 5L1MA 2B6GA 2DKZA 1SV4A 3SENA 2QARB 2QB0B 2F8KA 3SEIA 3TADC 1SV0A 2KSOA 4NJ8A 2K4PA 2Y9UA 3K1RB 3H8MA 1PK1B 2D3DA 3BS5A 4IS7A 4NL9A 1WWVA 3BS7A 2QARA 2QB0A 2JV3A 1PK1A 1B4FA 2DL0A 2EANA 3KKAC 1OXJA 1SV0C 2KG5A 2KE7A 1F0MA 2E8OA 1V38A 1OW5A 1X9XA 2KIVA 3BQ7A 1SXEA 2K60A 2KMDA 1WWUA 1V85A 4RQNA 1LKYB 2YTUA 2QB1A 1PK3A 2E8MA 3BS5B 2GLEA 5J8YA 4NL9C 4MHVA 2E8NA 2LMRA 1X66A 3HILA 5F3XB 1LKYA 2D8CA 5JRTA 1UCVA 1JI7A 1SXDA 2ES6A 1COKA 1UQVA 2F44A 2EAPA 2LPEA 1X40A 4PZOA 2QKQA 2L5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD A;  3IDW A;  2KSO B;  5J8Y C;  1RG6 A;  5JU5 A;  1KW4 A;  2F3N A;  2ESE A;  3KKA A;  1Z1V A;  2FE9 A;  1DXS A;  1B0X A;  3TAC B;  5JTI A;  5KNI A;  2Y9T A;  1SGG A;  2EAO A;  4PZN A;  2DKX A;  2E8P A;  4RQM A;  2EAM A;  5L1M A;  2B6G A;  2DKZ A;  1SV4 A;  3SEN A;  2QAR B;  2QB0 B;  2F8K A;  3SEI A;  3TAD C;  1SV0 A;  2KSO A;  4NJ8 A;  2K4P A;  2Y9U A;  3K1R B;  3H8M A;  1PK1 B;  2D3D A;  3BS5 A;  4IS7 A;  4NL9 A;  1WWV A;  3BS7 A;  2QAR A;  2QB0 A;  2JV3 A;  1PK1 A;  1B4F A;  2DL0 A;  2EAN A;  3KKA C;  1OXJ A;  1SV0 C;  2KG5 A;  2KE7 A;  1F0M A;  2E8O A;  1V38 A;  1OW5 A;  1X9X A;  2KIV A;  3BQ7 A;  1SXE A;  2K60 A;  2KMD A;  1WWU A;  1V85 A;  4RQN A;  1LKY B;  2YTU A;  2QB1 A;  1PK3 A;  2E8M A;  3BS5 B;  2GLE A;  5J8Y A;  4NL9 C;  4MHV A;  2E8N A;  2LMR A;  1X66 A;  3HIL A;  5F3X B;  1LKY A;  2D8C A;  5JRT A;  1UCV A;  1JI7 A;  1SXD A;  2ES6 A;  1COK A;  1UQV A;  2F44 A;  2EAP A;  2LPE A;  1X40 A;  4PZO A;  2QKQ A;  2L5Y A; 
#chains in the Genus database with same CATH topology
 9ICR A;  5CJ7 A;  1T8E A;  1ZQT A;  3HJE A;  1QQ5 A;  4CE6 A;  2UVW A;  5J0W A;  3QU4 A;  1Z00 A;  2IOF K;  5EE3 A;  3KHG A;  4DCC A;  3NGD A;  5KFC A;  3LVW A;  2DUY A;  5DG7 A;  1XSP A;  1ZQR A;  5KG0 A;  3PW7 A;  2F77 X;  3OHB A;  4P4M A;  3ZDB A;  5ALJ A;  1TAM A;  1S9F A;  2HBK A;  5HHI A;  2H3V A;  2QB0 B;  4M04 A;  1ZQB A;  4O5C A;  2ZIV B;  3DDH A;  4DOC A;  2Y9U A;  3MDA A;  3PMN A;  8ICS A;  2KJ8 A;  5G5G A;  1NK0 A;  4KX5 A;  3KFU F;  4NL9 A;  2XIC A;  4UAW A;  2RDI A;  4C4S A;  1ZQO A;  3B0X A;  1FEZ A;  3SAG A;  3JPP A;  1RQL A;  2RLT A;  4DFJ A;  4CF3 A;  1XO1 A;  4ED1 A;  1KFT A;  3PZP A;  4RQ4 A;  1Z3E B;  4DL6 A;  4ICA A;  3WKD A;  2EZZ A;  2G5H B;  3PSI A;  5HP4 A;  9ICW A;  2K60 A;  5BOL A;  4FS1 A;  1MA7 A;  1T94 A;  1WG8 A;  5CWR A;  7ICF A;  9ICU A;  5J2H A;  1S97 A;  4O3S A;  1C7Y A;  1ZQK A;  4O9M A;  4DSF A;  3SQI A;  4UAR A;  3RR8 A;  1ECW A;  3G6X A;  2FMS A;  5ALE A;  3HT3 A;  3QU2 A;  9ICM A;  2BDU A;  3TAD A;  4DFK A;  1RYR A;  4I2B A;  2DBY A;  1BPB A;  1S0O A;  2ESE A;  4BWJ A;  2AGP A;  5AKK A;  4QWB A;  1ZQN A;  2BCR A;  4PGQ A;  7ICU A;  1NK5 A;  9ICP A;  4R64 A;  5AM3 A;  2FPM A;  1UT5 A;  4RQM A;  1ZJM A;  2JMG A;  4YFK A;  2HMX A;  3WU2 U;  4J9K A;  2H3Z A;  5KT5 A;  2XC9 A;  3TAD C;  4B9V A;  4ECR A;  5AI0 A;  2JZB B;  2OEH A;  3RJE A;  2ZTC A;  7ICV A;  2R18 A;  4KLS A;  4RPX A;  3RH6 A;  2WF9 A;  2R8K A;  4YQW A;  2F1H A;  4DQP A;  2NO4 A;  4JV2 A;  4MFA A;  2M9N A;  1U45 A;  1ZQD A;  9ICO A;  2KG5 A;  4OJ5 A;  2XGQ A;  4QWE A;  1K1S A;  3E2E A;  2Y0S F;  2HSZ A;  3PX0 A;  2I6X A;  4F72 A;  2ZXH A;  1L8O A;  2UVR A;  3MR3 A;  1QQ6 A;  1FIQ A;  1V85 A;  3RJF A;  4RQN A;  4P0P B;  5J0S A;  2OH2 A;  4I2I A;  5C5J A;  3EUB 2;  4XUS A;  4PGY A;  2PI4 A;  3ZI4 A;  2C2E A;  4AP9 A;  2E8N A;  3WKA A;  2A1A A;  3HP6 A;  1DRG A;  2LMR A;  4P0Q A;  1A76 A;  4O3N A;  3ZD9 A;  2OXO A;  4QZI A;  2KKV A;  3QZ7 A;  5JRT A;  5L9X A;  2HBM A;  4C4T A;  1KQQ A;  1SZH A;  2YX8 A;  2GOL A;  1Z19 A;  7ICQ A;  1MN8 A;  7ICH A;  3V7L A;  4DWI A;  4UB4 A;  2KIC A;  3MFI A;  5AI4 A;  1MQ3 A;  2LYB A;  2J6T A;  2ZUC A;  5DGB A;  2W9C A;  4NV0 A;  8ICJ A;  5ALM A;  2ATL A;  2KKP A;  1J97 A;  1U48 A;  1KLN A;  5KNI A;  5AKX A;  4F5R A;  1X9S A;  1RZT A;  5CHG A;  1VJ5 A;  8ICQ A;  2BCS A;  4M9N A;  2IA6 A;  4B9S A;  3AQF A;  9ICH A;  4M9L A;  4UQG A;  4IS7 A;  3JPR A;  3VC8 A;  5J0X A;  4Z6F A;  3PVX A;  4PHP A;  4RT3 A;  4XQ8 A;  2XO7 A;  2W9M A;  2YN4 A;  4QWD A;  4M0A A;  2HHV A;  2W3S A;  4ACO A;  1KBU A;  2E3T A;  1L6N A;  1ZQM A;  3QEA Z;  4KX3 A;  2NRV A;  5KFB A;  4EZ9 A;  3N28 A;  3UPQ A;  3ETL A;  4Q44 A;  2VKQ A;  1ZQI A;  4PPX A;  5EWG A;  2NRW A;  2AGO A;  4UAT A;  5KT6 A;  4O5K A;  5ALR A;  3KZX A;  4QZ8 A;  4US9 A;  3KTQ A;  3LDA A;  1SL0 A;  1ZXI A;  1Z4O A;  8ICX A;  3RF9 A;  4Z6C A;  3PW2 A;  5B5E U;  1L7N A;  5KFD A;  1S5L U;  5CR0 A;  2FI1 A;  1X66 A;  1XSL A;  3PW0 A;  5IIJ A;  2V4Q A;  4OJO A;  5FP0 A;  3RJK A;  4DQS A;  1VLB A;  7ICK A;  2I9G A;  1NI3 A;  5HNK A;  4YMO A;  4GXJ A;  3WKC A;  4J9Q A;  1ZQA A;  4ELU A;  3N4M B;  1ZQG A;  3OSN A;  1SWV A;  1NKC A;  2OWO A;  1SB3 C;  4EBE A;  1TAQ A;  5CRX A;  1S0N A;  8ICV A;  4QZA A;  1Q3U A;  4DSE A;  5AKY A;  2VA2 A;  3TAP A;  3QZ8 A;  3GDX A;  2P6U A;  1QLN A;  1ZD3 A;  5AK5 A;  4QWA A;  1ZQS A;  2DWQ A;  2OHF A;  1A77 A;  1AQ6 A;  4KN4 A;  4DLE A;  4I2E A;  4MEY A;  3S6J A;  4Y2Y A;  2DKZ A;  3Q8M A;  4IC9 A;  3SMV A;  9ICQ A;  4KMU A;  4PHA A;  3FAH A;  4KLU A;  3QU5 A;  2XCA A;  1LB2 B;  1S8O A;  5CA7 A;  3EWA A;  4O3Q A;  3MGI A;  2W43 A;  3H8M A;  3RTV A;  4Y2J A;  5DB9 A;  1PZN A;  3SI8 A;  1ZQH A;  4ELV A;  2DQN B;  2JEG A;  2DL0 A;  2JR5 A;  5DB8 A;  2HOF A;  3WK5 A;  1DOQ A;  8ICR A;  5DQH A;  3CYM A;  4P4P A;  4QZE A;  7ICR A;  2ZTE A;  4GC6 A;  2KIV A;  5III A;  4FS2 A;  5KFG A;  3J81 j;  1NOM A;  3BQ2 A;  3WKB A;  4QZD A;  3EPG A;  4O3R A;  2KHQ A;  1WCL A;  1JXL A;  4UB6 U;  1PK3 A;  4LVS A;  4O3O A;  1P7D A;  1DGJ A;  2HHS A;  4OO1 J;  1YT3 A;  3ISD A;  4US8 A;  3ORY A;  1QSS A;  4TQR A;  4DF4 A;  3N97 B;  4F93 B;  4BJQ A;  5DG9 A;  3RBD A;  3RR7 A;  2NRX A;  2RRD A;  3GV7 B;  2D8C A;  3UQ0 A;  3UMB A;  2A1J A;  2FMQ A;  3GQC A;  3HPO A;  1S77 D;  1KKX A;  5JU5 A;  3A0H U;  2QKQ A;  2EH9 A;  5J0P A;  4ZH4 A;  2MAX A;  3KBB A;  5J8Y C;  2W8K A;  4ECU A;  3IRU A;  1JMS A;  2BKE A;  1KW4 A;  2WF8 A;  3AU6 A;  2IOH A;  4OD0 A;  3QYP A;  3PY8 A;  4TUQ A;  1X9M A;  3UXN A;  3H40 A;  1KFS A;  4EX7 A;  4F5Q A;  3RJG A;  4JV1 A;  3WK9 A;  4J9M A;  5K4L A;  2W03 A;  3F53 A;  4K4H A;  4IRD A;  1TV9 A;  1X42 A;  5KT4 A;  4U6P A;  3RJI A;  5AKZ A;  1XWL A;  2JEF A;  4YD2 A;  2C22 A;  2WAQ C;  5HR6 A;  1KSP A;  1CRX A;  7ICT A;  1IV8 A;  1ZET A;  2ZUD A;  1WWV A;  9ICN A;  5L1K A;  4Y2P A;  3BS7 A;  2F1I A;  3QUT A;  3JPQ A;  2IHM A;  3PX4 A;  4AYB F;  4I2G A;  1SV0 C;  2CXY A;  4ED0 A;  1ZD4 A;  1N5W A;  2W54 A;  2WHE A;  4CF5 A;  1ZQL A;  2WAQ F;  3V72 A;  1JN3 A;  3OGU A;  4RPZ A;  3OPX A;  3UQ2 A;  5AM4 A;  5EE9 A;  1RM6 C;  1U4B A;  4ECQ A;  3NVV A;  5G5H A;  3QX7 A;  2ASD A;  5AIC A;  5KFH A;  4ELT A;  4XA5 A;  3FYH A;  5ALL A;  3EZ5 A;  5KG4 A;  2Y1J A;  3O0F A;  4ZOH C;  3LWM A;  1ZJN A;  4MFF A;  3MAB A;  4I2J A;  1L3T A;  4JWN A;  1NK6 A;  3I76 A;  4UW9 A;  5E79 U;  2ZXI A;  2ASJ A;  4DSJ A;  1SL2 A;  1L7M A;  3TQ1 A;  1NJZ A;  3RBE A;  2W7P A;  1O08 A;  2VA8 A;  2F8L A;  3M7D A;  1COK A;  5AKG A;  1NK9 A;  4NLB A;  3MGV A;  2ZIX B;  3E58 A;  4KLO A;  3C29 A;  5ALZ A;  5ALW A;  2BPC A;  1N2X A;  1C20 A;  4DFD A;  4RZR A;  1KN5 A;  1V97 A;  5KFL A;  1DXS A;  1COO A;  4GFJ A;  1L5U A;  4JMU A;  1XNS A;  4UB8 U;  4C8O A;  2DKX A;  3SYZ A;  4ECX A;  1XU4 A;  4P0Q B;  3AMZ A;  4BDP A;  5J0R A;  5ALT A;  1HIW A;  2F8K A;  8ICB A;  1X6I A;  4Y2X A;  4UBB A;  2KSO A;  3NS1 A;  2R8J A;  2P66 A;  2AHO B;  2ZTD A;  1D8L A;  5KFT A;  5F9N A;  3V6H A;  5DLF A;  2HBL A;  3BS5 A;  1NZP A;  1ZD2 P;  5DBB A;  4QWC A;  1PVR A;  2BCQ A;  4NM2 A;  8ICK A;  2ZUB A;  2BHN A;  3PW4 A;  4I2D A;  2FPL A;  3WK7 A;  2KZZ A;  4YMM A;  4KLG A;  2BDP A;  1X9X A;  9ICF A;  5L1I A;  4ED7 A;  5KFP A;  4F4X A;  4Z6E A;  4KLQ A;  4F5O A;  4RUA A;  5KFV A;  4QZB A;  2Q0Z X;  3MC1 A;  3GU3 A;  2P6R A;  4I2A A;  1L8L A;  4XRH A;  5DKW A;  3BJY A;  3K4G A;  1QTM A;  4KMO B;  4KLT A;  4RNM A;  1TKD A;  3QEB Z;  4K4I A;  2Y0S C;  2XVT A;  4WJ3 B;  3BQ0 A;  2MSN A;  2NV3 A;  4X5V A;  4G3I A;  4EYI B;  3SD7 A;  2YY6 A;  5ALD A;  4RQ0 A;  2V9W A;  5ALK A;  2RHF A;  5AI6 A;  2EAP A;  3M9M B;  1B0X A;  4B9T A;  2K8B B;  3RRG A;  3QUQ A;  4DL4 A;  2F3N A;  4FZM A;  2NO5 A;  4FBU A;  1Z1V A;  3NVZ A;  3QXG A;  4C80 A;  2DGZ A;  5KFO A;  1PVQ A;  4NM1 A;  3PR4 A;  5DLG A;  3PX6 A;  1NK8 A;  2FJ6 A;  1ZQZ A;  3Q8L A;  3Q8Q B;  3HKZ C;  5KFF A;  8ICH A;  1X9W A;  3EPI A;  3C2M A;  3ISB A;  4UBC A;  1UA0 A;  4C8N A;  2K89 A;  4YR2 A;  2K8A A;  4PHD A;  3RFA A;  1UPH A;  1SKW A;  4BXO B;  3MFH A;  3FM9 A;  5KT7 A;  1CEZ A;  2B21 A;  1H38 A;  4FZL A;  2WB1 C;  4F2S A;  1HJP A;  2KFZ A;  2ZJA A;  4UB2 A;  3IN5 A;  3BQT A;  1N48 A;  3RB0 A;  1N56 A;  3D2N A;  4P4O A;  9ICC A;  5ALH A;  5KG5 A;  2HVH A;  2HHQ A;  1U9L A;  1Z4N A;  1GO3 F;  2N1R A;  5IIK A;  4QZ9 A;  3IG8 A;  1ZQX A;  4GXI A;  4EEY A;  2C2R A;  2KMD A;  4EBC A;  2HVI A;  4EEN A;  4DQR A;  2HCF A;  2M0N A;  3ONN A;  2DF4 B;  5J8Y A;  3RB4 A;  4K4G A;  2JEJ A;  2A1J B;  9ICJ A;  5J0T A;  5J2C A;  5IIO A;  1N60 A;  1KL9 A;  4JB3 A;  4QZF A;  2BR0 A;  4CNQ A;  1PUZ A;  2W7O A;  2DPI A;  2UVU A;  1LKY A;  4YN4 A;  5KG2 A;  4I27 A;  1N62 A;  2AQ4 A;  1UCV A;  1NK7 A;  2JEI A;  4DL7 A;  4I2C A;  4B9M A;  4OJ6 A;  8ICP A;  5DBA A;  2YML A;  2LPE A;  3TAC B;  4YP3 A;  1U49 A;  4Y2R A;  3AM9 A;  1NNL A;  1URJ A;  4O3P A;  2C28 A;  1RG6 A;  1Q46 A;  5GTI U;  5J2B A;  4O0I A;  1ZQE A;  2ZIX A;  1Z00 B;  3A0B U;  2F2A B;  3GFK B;  5DQI A;  9ICG A;  5EE0 A;  5D46 A;  3T79 A;  1V9P A;  1NJW A;  4BUG A;  2KZM A;  2JRZ A;  5AM5 A;  2FDR A;  4KIT B;  5CEH A;  4I29 A;  5AM1 A;  4RUC A;  3SEI A;  8ICT A;  3M6K A;  1YZ7 A;  5HMM A;  3D6J A;  2D3D A;  5KG1 A;  3R9K A;  7ICO A;  2YQE A;  4ECT A;  2ISO A;  1X2I A;  2PXI A;  2OM6 A;  5AIA A;  2B0C A;  2G08 A;  5AIB A;  1JUD A;  2HW3 A;  3TAQ A;  2XI9 A;  3G6Y A;  4P0P A;  3T5L A;  3AU2 A;  2LYA A;  3C23 A;  1ZYQ A;  2KFN A;  3M8R A;  5TIS U;  1D9F A;  4Y2V A;  1DK3 A;  2KV2 A;  5J0U A;  3PSF A;  2EZX A;  4KLI A;  1ZQU A;  4IQT A;  3RB6 A;  4ED2 A;  1RDF A;  3GII A;  8ICL A;  2KN7 A;  1SKR A;  7ICM A;  8ICZ A;  4UAZ A;  2VJ5 A;  5DB6 A;  2C2D A;  3IDW A;  2K4H A;  1Z1B A;  2KOB A;  4RQ1 A;  1TVA A;  2G09 A;  3RB3 A;  1NJX A;  2O6K A;  5KFA A;  3L5K A;  2XY7 A;  9ICI A;  2IMW P;  1ED1 A;  3LK9 A;  3WK4 A;  5AKE A;  4DOA A;  2W11 A;  7ICJ A;  4E0D A;  3QU9 A;  3N7P D;  5EOZ A;  3GIL A;  4GLX A;  2ZIU A;  4EZ6 A;  4MFC A;  1BNO A;  4F71 A;  4DSK A;  5IIN A;  3T5H A;  2FLN A;  2BQ3 A;  4B9U A;  3BZK A;  3WK8 A;  3PR5 B;  2JV3 A;  2KNJ A;  4YD1 A;  3RAX A;  4UAY A;  5A0L A;  4DS4 A;  3KKA C;  5KFQ A;  3OSP A;  2IOF A;  2XGP A;  2BCU A;  2LKY A;  2E8O A;  4F4W A;  2W9B B;  4GXK A;  1V38 A;  2YB1 A;  2D6F C;  1IIP A;  3KZI U;  4M9H A;  4QZG A;  8ICI A;  1FFV A;  5TZV A;  1ZRM A;  1BPZ A;  2HHT A;  1UT8 A;  4YMN A;  1KRP A;  3JPT A;  1KTQ A;  2KK0 A;  5ALX A;  1ZQJ A;  2MU2 A;  4F4Y A;  3BS5 B;  5KFK A;  3K1Z A;  1N63 A;  3H0L B;  2LYH A;  2WB1 F;  1BPX A;  2ALZ A;  3QUB A;  5AM2 A;  1N61 A;  4YG2 A;  2BPG A;  1ZRN A;  2HOQ A;  4UB5 A;  4F2R A;  4KLJ A;  2GWS A;  1WUD A;  1UQV A;  5ALQ A;  2ISP A;  4M9G A;  4DEZ A;  5B66 U;  1T4G A;  3M6Z A;  4UAV A;  3MGH A;  3V6J A;  2XY6 A;  4DSI A;  4NLZ A;  3IV6 A;  4C0Z A;  4R8U B;  3C1Z A;  3NTU A;  2AGQ A;  1SIJ A;  2KVC A;  5DB7 A;  4Y2T A;  4JK1 A;  1O03 A;  1B22 A;  3V7K A;  5KG6 A;  2MA1 A;  1SV4 A;  3L3F X;  4AYB C;  2Y1I A;  4CGZ A;  2ZIW A;  8ICM A;  2LM4 A;  2WF6 A;  3AQE A;  2BPF A;  1Q8K A;  5KAF U;  1K5O A;  4KLF A;  2HBJ A;  2F1J A;  5IIL A;  3MR6 A;  4PGX A;  4F91 B;  1ZQY A;  1XC9 A;  2GO7 A;  4LJX A;  4DQI A;  4PL2 A;  3LVV A;  1BNP A;  4GIB A;  4F5N A;  4DFP A;  2PFO A;  2R8G A;  1CI4 A;  5AK3 A;  4IR1 A;  4UB1 A;  3ALR A;  5AI8 A;  5ALG A;  3Q8R B;  4DOB A;  5J2I A;  2P35 A;  2E8M A;  4IQW A;  2YMP A;  3WKE A;  4BGD A;  4BWM A;  4RQ6 A;  2ZJ8 A;  3DV9 A;  3SAH A;  5J2D A;  4MHV A;  8ICO A;  1IXR A;  3D2Q A;  4QIW F;  2HDO A;  2BQR A;  1S76 D;  3TFR A;  1J2N A;  5KFM A;  4RQ2 A;  2FLP A;  4IL6 U;  1X40 A;  1T3N A;  4FFD A;  1JRO A;  2AJQ A;  2KTQ A;  2KSO B;  1L7O A;  3H4D A;  2PMZ C;  3L4P A;  2KZ3 A;  3FC4 A;  3NRW A;  5AHX A;  5AKJ A;  1HUZ A;  3ISC A;  7ICS A;  4QIW C;  2WTF A;  3V7J A;  3GIJ A;  2J6S A;  5AK6 A;  2PFP A;  2RDJ A;  4PZN A;  1ZQC A;  2W04 A;  4HYK A;  4QZC A;  5L1M A;  3ED5 A;  4DQQ A;  3C1Y A;  1NZB A;  4DLG A;  1N5X A;  4YXM A;  1ZOL A;  1ARO P;  3IG5 A;  3PV8 A;  3CW2 C;  5J2A A;  2I1Q A;  1SKS A;  4J9P A;  1WYG A;  4DO9 A;  2QB0 A;  1XO0 A;  3BDP A;  4IRK A;  4KLE A;  9ICE A;  9ICT A;  2KE7 A;  3PST A;  4ED6 A;  5J2E A;  1T7P A;  8ICC A;  1S0V A;  2W8L A;  2KEY A;  2HOI A;  1JAL A;  4RU9 A;  2G0A A;  2XY5 A;  3ICX A;  3KHL A;  3CP8 A;  3AEV A;  3KHH A;  1S0M A;  5BOM A;  4Q8E A;  3UXO A;  2OYY A;  2JH1 A;  3UMC A;  1F5S A;  4CCH A;  3KOO A;  3ZDA A;  1IG6 A;  3OTQ A;  3C2L A;  3PW5 A;  8ICW A;  4F50 A;  4J03 A;  3OJU A;  1M6Y A;  5DDY A;  2FMP A;  3U26 A;  2KIW A;  1SXD A;  2G5I B;  3HKZ F;  1A0P A;  4JUZ A;  2HI0 A;  3KD3 A;  4DL5 A;  2H5X A;  5KFS A;  4EEK A;  4NLC A;  3THV A;  4KN7 A;  4Y2S A;  2K4I A;  9ICS A;  4F8R A;  3H0M B;  2XID A;  3CNH A;  4I2F A;  3QUC A;  1OUQ A;  3M9O B;  4ED8 A;  5ALF A;  8ICA A;  4C7Y A;  2B6G A;  2ZJ5 A;  4NLG A;  5ALN A;  3SEN A;  4TUR A;  3Q8P B;  4F4Z A;  4EX6 A;  4J9L A;  4NJ8 A;  2K8C B;  4F3O A;  2VJ4 A;  7ICL A;  4DS5 A;  1QQ7 A;  2NRZ A;  2H3Q A;  3QE9 Y;  1ZQ1 C;  3T5K A;  4Q43 A;  3BZC A;  4OCZ A;  2E5S A;  4BX9 C;  9ICV A;  4BXO A;  3C5F A;  4J9O A;  4C8M A;  4HAI A;  4F4K A;  5KAI U;  2XCP A;  3C28 A;  5ALO A;  5IIM A;  1XSN A;  1OW5 A;  4IRC A;  2FLL A;  1EXN A;  1UA1 A;  5T14 A;  5AKI A;  4I28 A;  2DPJ A;  2RP5 A;  1L3V A;  1ZQP A;  3FDS A;  1WWU A;  7ICN A;  2QB1 A;  5AKL A;  1ZQF A;  8ICF A;  3JPO A;  2EDU A;  2GLE A;  8ICY A;  2E1F A;  1JXE A;  4NL9 C;  4QZH A;  2YMM A;  2G07 A;  1D8Y A;  5AI5 A;  4B6J A;  3K75 D;  5F3X B;  5KG7 A;  5EWE A;  4QNL A;  4QJF B;  1ZQW A;  4M6W B;  4FZN A;  5DBC A;  2UVV A;  4TUP A;  1BVS A;  4P2H A;  5ALI A;  1L3U A;  5H2F U;  4QW8 A;  1PVP A;  1Y88 A;  3AN1 A;  4RQ7 A;  2MUT B;  2W9C B;  4NWI A;  4JV0 A;  4IQV A;  4KLH A;  5JUM A;  4C8K A;  4O3M A;  1FO4 A;  2JZB A;  2A3V A;  4MF8 A;  3Q8K A;  2KJ5 A;  1QH9 A;  1RYU A;  3PSP A;  3SZ2 A;  4Y2Q A;  2QAR B;  5J0Y A;  4RQ8 A;  5KFI A;  3MR2 A;  4FO6 A;  4YR3 A;  8ICN A;  5ALY A;  5AM0 A;  2EQY A;  4DL3 A;  5KFY A;  1FFU A;  4DSL A;  2CPR A;  4QW9 A;  2RQ5 A;  5KL1 B;  1TAU A;  2GH1 A;  2JXJ A;  3CRX A;  4NLN A;  1B4F A;  4ED3 A;  3GIM A;  5CP2 A;  2HHU A;  1JIH A;  1QSY A;  4OJP A;  3F2C A;  1F0M A;  3SV4 A;  2NRT A;  3E0F A;  4ECZ A;  2AH5 A;  1F44 A;  4CDG A;  3PO5 A;  2BGW A;  3QU7 A;  2WF5 A;  4KTQ A;  1MC8 A;  3B9J A;  4PL1 A;  5ALV A;  3MR5 A;  3F2B A;  2YTU A;  2W9A A;  3C5G A;  5KT3 A;  2ZIW B;  2OCE A;  2J6U A;  2AQ0 A;  3I1Y A;  3N7S C;  2CN1 A;  3ETR A;  1HUO A;  1CUK A;  4B9L A;  5GTH U;  1KEJ A;  3T5J A;  3I28 A;  3EYZ A;  4RPY A;  2G06 A;  1JRP A;  2W55 A;  3F5A A;  1JI7 A;  3N7R C;  3IM1 A;  2F44 A;  4MEX A;  2BQU A;  3VCB A;  4C7Z A;  4J9N A;  3H8S A;  4NY8 A;  4LZG A;  3H4B A;  1SL1 A;  4RNN A;  7ICI A;  3OJS A;  3KKA A;  4B9N A;  2IHN A;  3UM9 A;  4C8L A;  5DQG A;  4M9J A;  2A19 A;  4ECW A;  2KP7 A;  2WFA A;  4UB3 A;  2Y9T A;  5KFE A;  5J0O A;  4DF8 A;  2CRX A;  4ECY A;  4DL2 A;  3JPN A;  1SZP A;  3M8S A;  3NVW A;  3ZDD A;  3HRD D;  5EE1 A;  3GV8 B;  3NAS A;  2VIX A;  3H8W A;  2NYV A;  2FPK A;  8ICU A;  3TFS A;  1TK8 A;  1ZD5 A;  3K1R B;  2R8I A;  9ICX A;  3SV3 A;  2PI5 A;  4PJ0 U;  1LV5 A;  4ECS A;  2V4R A;  2VA3 A;  2ZIU B;  5DGA A;  4KLL A;  2WF7 A;  1OXJ A;  2ZIV A;  1WCN A;  5KFZ A;  5KFR A;  3M1Y A;  3JPS A;  3RH4 A;  4NLK A;  8ICG A;  3HW8 A;  3IP4 B;  5KFN A;  1NK4 A;  2PKE A;  4Y2U A;  3UXP A;  3RJJ A;  3BQ7 A;  2HHX A;  5J2F A;  1SXE A;  1TE2 A;  4GC7 A;  1SWW A;  9ICA A;  5HR7 A;  1LVH A;  1QSL A;  3GV5 B;  1RQN A;  2ODG A;  9ICK A;  1TK5 A;  8ICE A;  1RYS A;  3BQ1 A;  4Z6D A;  3PO4 A;  2LI6 A;  1L3S A;  1TFR A;  3NVY A;  3OHA A;  1BPE A;  3HIL A;  2IBK A;  1L7P A;  4EBD A;  4Q8F A;  5D4B A;  4EEL A;  4CRX A;  4R63 A;  3MDC A;  2ZG6 A;  2BZF A;  2LBO A;  2MRL A;  3LWL A;  9ICB A;  4PZO A;  1J2M A;  3PNC A;  5J2J A;  2L5Y A;  4UAS A;  3AL0 B;  4O5E A;  1ZQQ A;  5L1L A;  3C21 A;  1K1Q A;  1TK0 A;  7ICE A;  4M2Y A;  2I5H A;  4EYH B;  3F5E A;  2DFL A;  2H3F A;  5DG8 A;  3C2K A;  4FBT A;  7ICG A;  3B0Y A;  5JTI A;  4KLM A;  2LM1 A;  5KT2 A;  2EAO A;  2KVS A;  3V6K A;  5DDM A;  5J0Q A;  4M47 A;  4TQS A;  4DFM A;  4CF4 A;  2KJ9 A;  4U7C A;  3ZDE A;  3SAF A;  2K4P A;  4YR0 A;  3TAR A;  3RAQ A;  3GIK A;  1RPL A;  5AKH A;  2JGA A;  2QAR A;  4YCX A;  3TI0 A;  1PK1 A;  2Q4T A;  2AU0 A;  2E1E A;  4USA A;  2LHT A;  3RJH A;  1D9D A;  1NKB A;  1T3Q A;  3LYS A;  4PH5 A;  1NJY A;  5HHH A;  1A6S A;  1UHU A;  1DGS A;  4A8E A;  5KTQ A;  3ZDC A;  1KFD A;  3HX0 A;  5AI9 A;  1KDH A;  5J2K A;  1LKY B;  3AUO A;  4R66 A;  5KL8 B;  2PFN A;  4C4R A;  1NKE A;  2JHD A;  3KHR A;  4IQU A;  4Q45 A;  1RXW A;  2KHV A;  2Z7J A;  2PMZ F;  4F92 B;  2R8H A;  1VDV A;  2YMQ A;  4NXZ A;  5BPC A;  4RQ3 A;  3ZD8 A;  5KFX A;  5KFU A;  3PML A;  1DK2 A;  1MQ2 A;  3T3F A;  4R8U A;  5F9L A;  4R65 A;  5EWF A;  4J9S A;  5KG3 A;  1U47 A;  1BPY A;  4G9B A;  1S10 A;  2FE9 A;  4KLD A;  2EZY A;  3WK6 A;  3GZF A;  5C0Y A;  2AXT U;  2W3R A;  3F2D A;  1SGG A;  2KD1 A;  4TUS A;  1BPD A;  4RQ5 A;  2E8P A;  3G6V A;  1RXV A;  2EAM A;  2H3I A;  1IM4 A;  4ECV A;  3UMG A;  9ICL A;  4PHE A;  1Q3V A;  1SV0 A;  2F76 X;  2VAN A;  3H0R B;  4F5P A;  4YVZ A;  1PK1 B;  3Q8S B;  5D49 A;  5J29 A;  5ALU A;  1BGX T;  2K4E A;  4MF2 A;  3QNM A;  4UAU A;  3TKA A;  3M9N B;  2BCV A;  2EAN A;  5HML A;  4RT2 A;  2PFQ A;  4JWM A;  4YXJ A;  3EW9 A;  1XS9 D;  2JH7 A;  1QCK A;  2YB4 A;  3D2S A;  5AK4 A;  2W9B A;  2QLT A;  5ALS A;  3HWT A;  1YZ6 A;  2HHW A;  7ICP A;  5ALP A;  4FE3 A;  3NRZ A;  5CB1 A;  3DEE A;  3SR6 A;  1ZQV A;  1X6J A;  5L1J A;  1D8B A;  1JX4 A;  4M6W A;  1MSW D;  4J9R A;  4OJL A;  1HEK A;  3H7I A;  3MBY A;  3TAN A;  3IHQ B;  4I2H A;  3H8J A;  3RH5 A;  5J2G A;  1B43 A;  4IR9 A;  2ASL A;  3NUQ A;  2ES6 A;  3RRH A;  2MUT A;  4RNO A;  4LZD A;  5KFW A;  5KFJ A; 
#chains in the Genus database with same CATH homology
 3TAD A;  3IDW A;  2KSO B;  5J8Y C;  1RG6 A;  5JU5 A;  1KW4 A;  2F3N A;  2ESE A;  3KKA A;  1Z1V A;  2FE9 A;  1DXS A;  1B0X A;  3TAC B;  5JTI A;  5KNI A;  2Y9T A;  1SGG A;  2EAO A;  4PZN A;  2DKX A;  2E8P A;  4RQM A;  2EAM A;  5L1M A;  2B6G A;  2DKZ A;  1SV4 A;  3SEN A;  2QAR B;  2QB0 B;  2F8K A;  3SEI A;  3TAD C;  1SV0 A;  2KSO A;  4NJ8 A;  2K4P A;  2Y9U A;  3K1R B;  3H8M A;  1PK1 B;  2D3D A;  3BS5 A;  4IS7 A;  4NL9 A;  1WWV A;  3BS7 A;  2QAR A;  2QB0 A;  2JV3 A;  1PK1 A;  1B4F A;  2DL0 A;  2EAN A;  3KKA C;  1OXJ A;  1SV0 C;  2KG5 A;  2KE7 A;  1F0M A;  2E8O A;  1V38 A;  1OW5 A;  1X9X A;  2KIV A;  3BQ7 A;  1SXE A;  2K60 A;  2KMD A;  1WWU A;  1V85 A;  4RQN A;  1LKY B;  2YTU A;  2QB1 A;  1PK3 A;  2E8M A;  3BS5 B;  2GLE A;  5J8Y A;  4NL9 C;  4MHV A;  2E8N A;  2LMR A;  1X66 A;  3HIL A;  5F3X B;  1LKY A;  2D8C A;  5JRT A;  1UCV A;  1JI7 A;  1SXD A;  2ES6 A;  1COK A;  1UQV A;  2F44 A;  2EAP A;  2LPE A;  1X40 A;  4PZO A;  2QKQ A;  2L5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...