2F8KA

Sequence specific recognition of rna hairpins by the sam domain of vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
SSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/ rna
molecule keywords 5'-R(*UP*AP*AP*UP*CP*UP*UP*UP*GP*AP*CP*AP*GP*AP*UP*U)-3'
publication title Sequence-specific recognition of RNA hairpins by the SAM domain of Vts1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f8kA00
2E8MA 4RQMA 5KNIA 1SXDA 1WWVA 2D8CA 1LKYB 1F0MA 5JTIA 1UCVA 2B6GA 1OW5A 2KSOA 5J8YA 3BS5A 3HILA 5JU5A 2EAOA 2QARB 1JI7A 4NL9A 3KKAA 3TACB 2F44A 3SEIA 1V38A 4RQNA 4IS7A 2QB0B 1V85A 2ES6A 1UQVA 2E8NA 5F3XB 2QARA 2EAPA 2ESEA 3BS7A 1B4FA 1PK1B 4NJ8A 5J8YC 2F8KA 2QB0A 3TADA 4NL9C 3SENA 1X66A 2DL0A 1X9XA 1SGGA 1LKYA 2JV3A 1WWUA 2K60A 2EANA 1SV0A 3BQ7A 1SXEA 1DXSA 2KE7A 2YTUA 2QKQA 5L1MA 3K1RB 2K4PA 1PK3A 2Y9UA 1COKA 1KW4A 3BS5B 3H8MA 3KKAC 2KG5A 4PZOA 1OXJA 5JRTA 1PK1A 1RG6A 2DKXA 2EAMA 2L5YA 2LPEA 2KIVA 1SV0C 1X40A 1SV4A 3IDWA 4MHVA 2FE9A 2GLEA 2QB1A 2LMRA 4PZNA 1B0XA 2F3NA 2KMDA 2D3DA 3TADC 2E8PA 2KSOB 1Z1VA 2DKZA 2Y9TA 2E8OA
chains in the Genus database with same CATH superfamily
4EELA 2DUYA 1IG6A 2WAQC 4KLEA 3H7IA 9ICTA 5KT6A 4FBTA 4O3SA 5DBAA 5DLGA 1SZPA 4Y2YA 1JRPA 8ICHA 3TACB 3SEIA 1F44A 4DL2A 2WF8A 1XS9D 1DGJA 5H2FU 1XO1A 2E5SA 1C7YA 1WG8A 1MQ3A 3PNCA 1X2IA 2HHQA 2YX8A 4KX5A 4EX7A 1QLNA 3JPTA 4FFDA 3LWMA 1K5OA 2UVUA 4XUSA 3IM1A 2OXOA 5EE1A 4C8LA 1ZQPA 1ZQVA 4FS1A 3AUOA 9ICCA 4TQRA 4RQ6A 3WKAA 5L1KA 3NVVA 4O3OA 8ICFA 5AM0A 1ZYQA 3H8JA 4DL4A 2B21A 3JPSA 3TANA 3EPIA 3LYSA 5HR7A 4QWAA 2Y9UA 1DK2A 4F8RA 3T3FA 3ZDAA 2PFPA 1CRXA 2Q0ZX 3H0LB 5L1LA 4GC7A 3HT3A 4QNLA 1X40A 3IDWA 3OJUA 1ZQOA 4CF3A 1LV5A 3NVZA 2PFQA 5IILA 4ED0A 1N56A 3WK6A 3D2QA 4UB6U 1PVRA 3C21A 2K8AA 4EX6A 5KFLA 2IOFA 4C7ZA 1NNLA 5KFNA 2XC9A 7ICLA 7ICSA 1WWVA 2D8CA 5AM5A 4HAIA 5EWEA 2G06A 1MC8A 3AU2A 3AU6A 4BXOA 2ZG6A 3AEVA 2KFZA 4PL1A 3ISDA 2XY6A 4PL2A 4TUQA 4NL9A 4KN4A 2VA3A 3EYZA 5KFWA 4DFKA 5IIJA 1JXEA 4P4OA 1RPLA 3AN1A 5KT7A 4RQNA 5AIAA 3TKAA 4BWJA 3HP6A 1NKBA 4JWMA 3ZDDA 8ICWA 4Q45A 5AKHA 2YMMA 3IG8A 2E3TA 4Z6CA 1PK1B 1UPHA 3F5EA 1SKSA 2KVSA 2JEJA 4RPXA 3AM9A 2E1EA 3SD7A 4NV0A 3LVVA 4QW8A 1X9XA 2LBOA 4DQIA 1N62A 1Q8KA 1QSSA 5J2AA 5KL8B 4J9SA 5KG1A 3FYHA 4EYHB 5EWGA 1BNOA 5ALTA 1BVSA 2FPMA 3KOOA 2LKYA 3ZDBA 7ICHA 1WYGA 5AI6A 1COKA 2WFAA 4CF4A 2IHNA 3UMGA 1ZQHA 4I2HA 4QZ8A 1D8BA 9ICIA 7ICKA 2AJQA 4IQWA 2KIWA 1D9FA 4Z6DA 3H40A 2BPFA 2ZXIA 3MFIA 3CP8A 4I2GA 4ACOA 3F2DA 5DKWA 1ZETA 2FDRA 2R8IA 1SL2A 5EE9A 2Y9TA 1UT5A 4OJ6A 2MSNA 4U6PA 3PSTA 4P2HA 5KFIA 3PX6A 4XRHA 1URJA 9ICJA 5AM4A 1MN8A 1HUOA 3QEAZ 5CB1A 5J8YA 5KG0A 5J2CA 1KFSA 3BS5A 5JU5A 2YB4A 5IINA 4A8EA 2JH1A 5CA7A 2Q4TA 4AYBF 5AKYA 2ODGA 1ZD4A 2A3VA 1SB3C 1ZOLA 4QZCA 3IG5A 3OHBA 4PGQA 1V85A 1U9LA 2KZ3A 1EXNA 9ICSA 4MEXA 2E8NA 1S0MA 4M0AA 3ZDCA 4M47A 1YZ6A 4M9HA 1SL0A 4OD0A 2V4QA 4DOAA 3TI0A 1Z3EB 1Z4OA 2ZXHA 1BPEA 2BGWA 3C23A 3C29A 2UVVA 2IHMA 1ZRMA 7ICPA 2RP5A 2A1JB 3CW2C 1ZJNA 2XVTA 4I2AA 2Y0SC 5TZVA 1SXEA 1VJ5A 2PMZC 2K8BB 1D9DA 1DK3A 5J29A 3EZ5A 5T14A 2KE7A 3Q8LA 2FMSA 4I28A 1TAUA 2K4PA 2F77X 5J2EA 5KG2A 4C8KA 1WUDA 3G6VA 1OXJA 1RYRA 2R8HA 3NRZA 2I9GA 3B0YA 4M9NA 4IQTA 3PVXA 2Z7JA 5DBCA 3NRWA 4O5EA 4TQSA 1RXWA 1N60A 4ED1A 4JUZA 3FDSA 2AH5A 1X6IA 3UMBA 2HSZA 4YFKA 4F5PA 4M6WB 2JGAA 3PR5B 3TFSA 2ZJ8A 2GWSA 4DFPA 2KSOA 5KFXA 5HMLA 3PW0A 4QZHA 4F71A 3N7SC 4O3NA 4YR2A 2P35A 3MR2A 2MUTB 2F44A 3GILA 3J81j 1KLNA 1Z00B 2A19A 3QUCA 4LZGA 7ICEA 3F53A 4IRCA 1IM4A 3M9NB 2OM6A 5J2FA 2BKEA 3EW9A 2JHDA 2G07A 4TUSA 2FMPA 4KLTA 2J6TA 3PW5A 5HP4A 2DL0A 5AK6A 3HW8A 3QU7A 5FP0A 4RT2A 3WK8A 4C8MA 1WWUA 3E58A 5KFVA 3ONNA 4PHPA 7ICTA 1QQ5A 5ALWA 4UB8U 4OJ5A 1TKDA 3V6KA 1TFRA 3LVWA 3QEBZ 2H3IA 2XI9A 3RAQA 4YVZA 2PI5A 8ICRA 2XCAA 4UAVA 3UXPA 8ICGA 1NK0A 4OO1J 8ICXA 5IIMA 4MEYA 2AU0A 4QIWF 5JRTA 1PK1A 5J0RA 1JROA 4EBDA 4YXJA 5J0SA 3GQCA 3PZPA 4I2BA 2BR0A 4QZIA 5HR6A 4UB2A 8ICVA 4K4HA 2ZJ5A 3K1ZA 2A1AA 1KRPA 4DFDA 4UAYA 8ICUA 4UATA 4KLQA 1OW5A 4ELUA 2XGQA 3QUBA 5F9NA 5KFZA 5ALUA 4JMUA 5IIKA 5KFGA 2H3ZA 3NVYA 1T3QA 9ICVA 5DB6A 2EDUA 3MGVA 1A6SA 3QXGA 2ZIWA 1L3SA 4DSJA 5AKLA 4B9MA 3WKDA 1KL9A 2KJ5A 1NJXA 4I29A 4O5KA 3RJIA 4IS7A 5ALHA 2M0NA 4YR3A 3RJKA 3KZIU 1B4FA 4F5RA 3GFKB 2WF6A 4FZMA 3PX0A 2BCVA 2JEFA 1ZD3A 2W7PA 3H4DA 3H8SA 9ICKA 1NZPA 1ZQYA 1BNPA 4ECYA 2KJ9A 4R65A 4OJOA 8ICZA 3RB4A 2HDOA 2RDIA 4ED6A 3FM9A 2JEIA 3N4MB 1H38A 5E79U 5D49A 4ECVA 2FJ6A 3SR6A 4JV2A 3V7JA 2BCUA 5ALLA 5KFFA 8ICLA 3IHQB 2QKQA 4Y2RA 3K1RB 2KD1A 1L6NA 8ICMA 1ZD5A 5HNKA 1KFDA 1RM6C 4DQPA 3KTQA 2KG5A 1QCKA 3TFRA 4EBCA 2EAMA 1ZQIA 4YD2A 3S6JA 1S9FA 2LYAA 2UVRA 4RUCA 1L3VA 5DQIA 3OPXA 3QUTA 3EWAA 3BQ0A 4KLUA 4UAZA 2XY5A 5DB9A 4CRXA 2CXYA 1QH9A 2BCSA 5AI8A 4BWMA 2W54A 5ALEA 5KNIA 5KG3A 5AKKA 2H3VA 2CRXA 5ALGA 2WB1F 1BPDA 3D6JA 2ASDA 2DBYA 3LWLA 4RQ7A 2B6GA 4O3QA 2BQ3A 1L7MA 2OCEA 1L3UA 4YMNA 1A76A 2ZTEA 4F4XA 2R8JA 1ZQFA 1AROP 4DLEA 2XIDA 3BQTA 4FBUA 5J0XA 4IRKA 3RB3A 3T5HA 4P4PA 7ICOA 1AQ6A 1V38A 4NM1A 4QWBA 3NTUA 2NO5A 5F3XB 3WU2U 5ALRA 2AGQA 4TUPA 4ECXA 4QZ9A 4GIBA 2F1JA 1DOQA 1ZXIA 5KT5A 5L9XA 3AQEA 2ZUDA 1MA7A 4M6WA 3PMLA 1UA0A 2NV3A 4DQRA 2KNJA 5AK4A 2ZIVB 1PUZA 1N48A 2BDUA 3BQ7A 5DGAA 1SL1A 1P7DA 5AKGA 4C8OA 9ICBA 5KFOA 2YTUA 1N63A 4DSIA 2MUTA 4UB4A 1MSWD 5L1MA 1JN3A 3WK5A 1UA1A 1PK3A 5EE0A 1Z00A 2BQUA 4RQ0A 9ICQA 4M9GA 2BCQA 3TQ1A 3RB0A 9ICWA 1VLBA 2C2DA 5ALSA 3HRDD 3B0XA 2G0AA 2FI1A 3FAHA 2HW3A 3RBEA 1RXVA 4F4WA 1X42A 1KSPA 2J6SA 4J9OA 3CNHA 4KX3A 4K4IA 3RR7A 2KSOB 4KN7A 5D46A 2EH9A 1PVPA 2KOBA 4C7YA 5KFHA 2YY6A 4PHDA 3KD3A 1ZQDA 1O08A 5AI4A 4B9TA 3A0BU 2W9MA 2EAOA 4KLGA 4HYKA 2F8LA 4PGYA 4RPZA 4ECUA 1KQQA 4DOBA 3UM9A 4BUGA 4F91B 7ICGA 5KAIU 2NO4A 4IQUA 3H4BA 2HOFA 2IBKA 2BPCA 3KBBA 2HHVA 2JXJA 4YN4A 3ZI4A 3AMZA 7ICMA 2ASLA 3M9OB 1NK6A 3ETLA 3MBYA 4F5NA 5BOMA 3NGDA 4F5QA 2KN7A 1T3NA 2RDJA 3SI8A 3ZDEA 8ICEA 2JV3A 4BX9C 1ZQQA 7ICIA 1T94A 5DDMA 2XGPA 3GDXA 4O3PA 4EZ9A 2VIXA 3T5JA 3KZXA 4QWDA 1OUQA 1S97A 3BJYA 1ZRNA 1D8YA 1J2MA 4F72A 4UQGA 1NOMA 4BJQA 3UMCA 3PX4A 4U7CA 5KL1B 4FE3A 4O3MA 5CWRA 1YT3A 4PZOA 4RT3A 3D2SA 2LYBA 4B9NA 3M9MB 1DGSA 2DKXA 3NVWA 8ICQA 1ZQLA 3KHRA 1NK8A 5KFJA 2DPJA 7ICRA 4DL5A 4F3OA 2DF4B 3HKZF 2F2AB 2GLEA 1RQNA 4KLMA 4J9NA 3ETRA 4R63A 4F92B 1ZQCA 2D3DA 5BOLA 5DGBA 1TAQA 3UXOA 3RAXA 2ZIWB 1D8LA 4DL3A 2E8MA 4DSLA 3T79A 2KK0A 1UCVA 1IIPA 1CEZA 2W04A 2XICA 4ED3A 5C0YA 5KFSA 1JI7A 1Y88A 3U26A 2AGPA 3DV9A 2KV2A 4GLXA 3TAPA 2N1RA 3C5GA 2ES6A 3THVA 2QARA 2W7OA 3UXNA 2ESEA 5L1JA 2XY7A 2W9CB 9ICGA 5J0PA 4CNQA 4NJ8A 7ICVA 1PZNA 1NJWA 9ICNA 3EUB2 4NXZA 3ALRA 4LJXA 5KFQA 3SENA 2WTFA 3GV5B 4F93B 4ELVA 1Q3VA 3SYZA 4KMOB 4KLSA 1S10A 2FLNA 4KLIA 3E2EA 2FMQA 2KVCA 1V97A 4EBEA 2BZFA 5EOZA 4QW9A 1RYUA 5AKZA 1NK4A 2LYHA 5DDYA 2HHXA 2W9BB 4FZLA 4F2RA 1L8LA 5KFKA 3T5LA 2EQYA 2LPEA 2L5YA 1FO4A 2KIVA 1L8OA 4NLGA 5J2HA 2ISOA 4DLGA 1S0VA 1XSLA 9ICMA 1U4BA 3HPOA 3HJEA 4PZNA 4QZGA 5CEHA 4QZAA 4PHAA 5KFYA 1IV8A 2ZIVA 3K4GA 2DKZA 3FC4A 4YP3A 4GXKA 2BQRA 4KLFA 2GO7A 2P66A 4YG2A 4UB5A 4F50A 2W03A 2HMXA 5KFPA 4XA5A 4YMMA 4M2YA 2G09A 3JPOA 3RJGA 4YQWA 3UPQA 4DEZA 4NY8A 4Z6EA 3PO4A 5KG7A 9ICFA 3GV7B 4G3IA 1TK5A 4KMUA 4QIWC 1ZQWA 2HBMA 1ZJMA 2HBLA 5ALPA 3PW2A 1NZBA 1BPZA 4F5OA 4MFAA 4NLBA 1X9WA 2E1FA 2MU2A 3F2CA 3MABA 5CHGA 3RF9A 4C80A 5J2JA 1TK0A 4ED8A 4ELTA 5KT4A 4NLCA 2F1IA 1SIJA 5JUMA 4IL6U 5J2BA 3RH6A 3M8SA 5J2GA 8ICAA 1QSYA 2PMZF 4I2IA 3G6YA 2JZBA 7ICQA 2ZUCA 4AP9A 4EYIB 1BPXA 8ICTA 2IOFK 4QWEA 5ALKA 1L7OA 1ECWA 3C1YA 4Y2JA 4GFJA 3L4PA 1SV0C 9ICXA 4JK1A 1ZD2P 4RNNA 2QB1A 3TARA 2HI0A 1ED1A 4O9MA 4WJ3B 2E8PA 9ICAA 4GXJA 1LB2B 3WKBA 1A0PA 4YD1A 1S76D 5ALOA 1KKXA 4USAA 5CRXA 5DB8A 1LKYB 1FEZA 5KFUA 2IMWP 1Z4NA 1QQ7A 4Y2SA 2AXTU 2FPLA 2BDPA 1ZQSA 2OHFA 2QLTA 4RNMA 9ICOA 1IXRA 5AKEA 2C2RA 2CPRA 2NYVA 3OHAA 2WF7A 1O03A 3ISBA 5ALYA 2M9NA 2Y1JA 4P0QB 5AKXA 5ALJA 4Y2TA 2W9AA 5AKIA 8ICJA 2DFLA 2XO7A 2YMLA 5J0TA 9ICLA 4KLLA 3PW7A 1XC9A 5AICA 2WF9A 4PJ0U 3Q8RB 3HX0A 3WKEA 1T4GA 4ED2A 2K60A 1X9SA 3GIIA 3MFHA 3JPPA 2VA8A 1ZQGA 4I2CA 1XU4A 1DXSA 3E0FA 4RU9A 2V9WA 4DF8A 1B22A 2H3QA 4RPYA 4OJLA 5DQGA 1ZQKA 4UW9A 5K4LA 3SZ2A 3H8MA 3JPRA 5AI5A 2KTQA 3MR3A 2W9CA 3MR5A 3G6XA 5EE3A 8ICNA 2YQEA 5J0QA 4JV0A 4RNOA 4MHVA 2FE9A 1QQ6A 4RQ3A 1LVHA 3PMNA 1L5UA 4J03A 4IQVA 2KKVA 4YMOA 2E8OA 5KAFU 4RQMA 2W3SA 4B9VA 4UARA 3IP4B 9ICHA 3R9KA 2W9BA 5J0UA 4Y2PA 3SV3A 4Q8FA 2QARB 3F2BA 1RQLA 2LHTA 4NWIA 4OCZA 4ZOHC 2W3RA 2P6UA 3DEEA 5KT2A 2UVWA 8ICYA 5HHHA 3A0HU 3Q8SB 1UQVA 3EPGA 2G08A 3QNMA 5G5GA 8ICBA 4DS4A 2EAPA 3UQ2A 4MF8A 4ECSA 2FPKA 4Q43A 2LI6A 5DQHA 1KFTA 1X6JA 3I1YA 3N7RC 4RQ8A 2I6XA 3SAGA 3UQ0A 3V6JA 4FO6A 2MA1A 5ALMA 4QJFB 5DB7A 1CUKA 1PVQA 4UAWA 8ICIA 4J9PA 1FFVA 1U49A 3RBDA 3H0RB 8ICPA 2AHOB 1T8EA 4F4KA 2HHSA 5J2KA 2ALZA 4NLNA 1NKEA 4CF5A 5CJ7A 2IOHA 2R8KA 3JPQA 2ZTDA 3IN5A 1SV4A 2HVIA 5KFMA 1CI4A 3OGUA 5C5JA 1ZQNA 3NUQA 2YMPA 1TVAA 2YMQA 4QZEA 4OJPA 1Q46A 4RQ1A 3TAQA 4B9UA 2K8CB 2O6KA 1L7NA 3RH4A 1ZQJA 3WK9A 1S0NA 4RUAA 4GC6A 2NRZA 2I1QA 1ZQBA 2DQNB 5IIIA 3OSPA 4JV1A 3QZ8A 2EZXA 1J2NA 5J0WA 3MGIA 2K4HA 1S0OA 1BGXT 4ZH4A 2VKQA 5DG9A 5AKJA 3QU9A 2ATLA 2PXIA 5ALVA 4MFFA 2ASJA 2JMGA 2W43A 3BZCA 2F8KA 1N5XA 1JMSA 4EEYA 2WAQF 5DG8A 1JALA 4NL9C 4BGDA 3HKZC 1LKYA 3C2KA 3QE9Y 4Y2UA 1ZQXA 2F1HA 2C28A 3QU4A 2EANA 2OYYA 3SAHA 2V4RA 1ZQZA 2JZBB 3GZFA 3C1ZA 2NRTA 5KFAA 5KG4A 3IV6A 2KEYA 1XWLA 4M04A 2YB1A 1KW4A 3CYMA 2GOLA 4P0QA 4ECTA 3CRXA 1GO3F 2JH7A 4IRDA 1N61A 5EWFA 2H5XA 4ECWA 2ZIUB 2KZMA 4G9BA 3KFUF 3BDPA 3I28A 5HHIA 3PSIA 4PGXA 4EENA 3OTQA 2DPIA 3KHGA 3RJFA 2H3FA 1SKWA 2OWOA 5ALNA 1UT8A 3IRUA 4AYBC 3WK4A 5AM1A 3GV8B 4J9KA 3RRGA 4M9LA 5CR0A 4PPXA 1KEJA 2JR5A 2ZIXB 3GU3A 3QUQA 4F4YA 4YCXA 5ALZA 4GXIA 2R18A 4O3RA 2B0CA 3LDAA 5KG5A 5G5HA 4C0ZA 5AHXA 5AI9A 4K4GA 4J9RA 1SZHA 2HCFA 4RQ2A 4R66A 4MF2A 4NLZA 4DL7A 1S77D 3V6HA 5J8YC 1RDFA 2PKEA 2QB0A 2KICA 2PFNA 1NK9A 3RTVA 2C2EA 2G5IB 1NJYA 7ICNA 2GH1A 4R8UB 3L3FX 7ICJA 3GIKA 1XO0A 5ALIA 4J9MA 2VJ5A 1V9PA 3V72A 3MR6A 3Q8MA 2BPGA 3Q8KA 2BHNA 2HHWA 4I2DA 3Q8QB 4KTQA 4KLOA 4NM2A 3SQIA 1M6YA 1FFUA 3GIJA 1U45A 2AQ0A 1U47A 1DRGA 1QTMA 5J0OA 5TISU 3VCBA 4KITB 3RR8A 3M7DA 1RG6A 4O0IA 2J6UA 3QYPA 5AI0A 4JB3A 1SWVA 1KDHA 8ICCA 3PV8A 2KMDA 9ICEA 3PR4A 4P0PB 2AQ4A 1ZQRA 3BQ1A 2OH2A 4QZFA 3RJEA 2PFOA 2R8GA 1TK8A 2P6RA 3KHHA 4RZRA 4PH5A 4F4ZA 1KBUA 2ISPA 3BQ2A 3D2NA 4FS2A 4DO9A 3WKCA 1RZTA 5KFBA 3DDHA 1Z1BA 3ICXA 3VC8A 1KN5A 2MAXA 3B9JA 1BPBA 1NK5A 2C22A 1ZQMA 4CCHA 3AL0B 3HWTA 4JWNA 2G5HB 4DWIA 2I5HA 2K4IA 1YZ7A 2KJ8A 1XSNA 4IC9A 5B5EU 1NK7A 5B66U 3Q8PB 4ECRA 1HIWA 2KHVA 8ICKA 2D6FC 4I2EA 1ZQAA 1L3TA 3V7KA 2K89A 3PY8A 3M6KA 4B9LA 1ZQ1C 5HMMA 3MGHA 2EZZA 2WHEA 5J2DA 5KG6A 4Y2QA 4CDGA 1N2XA 2RLTA 2DGZA 8ICOA 4LVSA 3MDAA 3ORYA 4Z6FA 3C2MA 1C20A 4R64A 5ALDA 2W8KA 9ICUA 1HEKA 4RQ5A 5AM3A 3N28A 1L7PA 5KFRA 1NJZA 2FLPA 1SWWA 4YXMA 3KKAC 4QWCA 5AIBA 2LM4A 2ZUBA 4J9LA 2DWQA 2HVHA 4I2FA 3O0FA 2NRWA 4J9QA 4DL6A 5KTQA 5J2IA 1B0XA 2KHQA 4C4RA 2W8LA 2KP7A 1FIQA 1K1QA 3RB6A 3TADC 4I2JA 3AQFA 2Y0SF 1Z1VA 2KKPA 2RRDA 1WCLA 4RQ4A 4UB1A 1SXDA 3WK7A 3KHLA 4ICAA 3RFAA 3M1YA 1F0MA 1TE2A 3NS1A 5JTIA 4QZDA 4DSEA 2HOIA 1ZQEA 3HILA 4KLDA 3ZD8A 3KKAA 4DQSA 3PSPA 4C8NA 4UB3A 1JX4A 3C28A 2ZIUA 1KTQA 7ICUA 1X9MA 2NRVA 1RYSA 1SKRA 5AM2A 4XQ8A 1Z19A 2PI4A 4EEKA 1JUDA 3TADA 2RHFA 5GTHU 1N5WA 1VDVA 5L1IA 4FZNA 4KLJA 1X66A 4YR0A 7ICFA 3RRHA 1J97A 1SGGA 3SV4A 4F2SA 2HHUA 4MFCA 4ECQA 2VJ4A 3PW4A 4UBBA 2ZIXA 1SV0A 2LM1A 3H0MB 4EZ6A 4NLKA 1BPYA 4Q8EA 4BDPA 5J0YA 1HJPA 5KT3A 4BXOB 3BZKA 1JIHA 2Y1IA 3I76A 4PHEA 1NI3A 1MQ2A 4TURA 3F5AA 4Q44A 1NKCA 4KLHA 1U48A 5CP2A 2JRZA 1T7PA 1Q3UA 3N7PD 3ZD9A 5IIOA 1COOA 4O5CA 2NRXA 1F5SA 4DSKA 3SMVA 2LMRA 4R8UA 5ALQA 5DLFA 2WB1C 5KFEA 4ED7A 4DF4A 1TV9A 2BCRA 2K4EA 3M6ZA 3ED5A 3V7LA 4DCCA 1ZQTA 4DSFA 2WF5A 3K75D 3NASA 9ICRA 4LZDA 2VANA 3M8RA 5KFCA 3LK9A 5BPCA 2HOQA 1TAMA 4DQQA 2ZJAA 5DBBA 3RJJA 1UHUA 2KZZA 3ISCA 4X5VA 5KFDA 1XSPA 3H8WA 4C4SA 3QZ7A 3T5KA 2QB0B 3QU2A 4DFMA 2W11A 3OJSA 2MRLA 2FLLA 4UAUA 3GIMA 2CN1A 4P0PA 3SAFA 3BS7A 9ICPA 3N97B 8ICSA 4US9A 5A0LA 3OSNA 4B9SA 5AK5A 1JXLA 5ALFA 4DFJA 1QSLA 3QX7A 3C5FA 3MDCA 4Y2XA 4P4MA 4C4TA 2XCPA 1S8OA 2ZTCA 3MC1A 5ALXA 4CE6A 5GTIU 4ECZA 3PO5A 1B43A 1WCNA 1K1SA 4E0DA 2RQ5A 1HUZA 3C2LA 4IR9A 5D4BA 2IA6A 2A1JA 5AK3A 2YN4A 2HHTA 4B6JA 2OEHA 1S5LU 3BS5B 4DOCA 3RH5A 4UASA 2HBJA 3JPNA 1ZQUA 4M9JA 5DG7A 4US8A 2EZYA 2KFNA 4QZBA 5KFTA 3L5KA 4CGZA 4DS5A 4I27A 2W55A 1A77A 2F3NA 4IR1A 3PSFA 1XNSA 2F76X 5F9LA 3RJHA 2AGOA 2JEGA 4UBCA 3QU5A 2VA2A 4Y2VA 2HBKA
chains in the Genus database with same CATH topology
2E8MA 4RQMA 5KNIA 1SXDA 1WWVA 2D8CA 1LKYB 1F0MA 5JTIA 1UCVA 2B6GA 1OW5A 2KSOA 5J8YA 3BS5A 3HILA 5JU5A 2EAOA 2QARB 1JI7A 4NL9A 3KKAA 3TACB 2F44A 3SEIA 1V38A 4RQNA 4IS7A 2QB0B 1V85A 2ES6A 1UQVA 2E8NA 5F3XB 2QARA 2EAPA 2ESEA 3BS7A 1B4FA 1PK1B 4NJ8A 5J8YC 2F8KA 2QB0A 3TADA 4NL9C 3SENA 1X66A 2DL0A 1X9XA 1SGGA 1LKYA 2JV3A 1WWUA 2K60A 2EANA 1SV0A 3BQ7A 1SXEA 1DXSA 2KE7A 2YTUA 2QKQA 5L1MA 3K1RB 2K4PA 1PK3A 2Y9UA 1COKA 1KW4A 3BS5B 3H8MA 3KKAC 2KG5A 4PZOA 1OXJA 5JRTA 1PK1A 1RG6A 2DKXA 2EAMA 2L5YA 2LPEA 2KIVA 1SV0C 1X40A 1SV4A 3IDWA 4MHVA 2FE9A 2GLEA 2QB1A 2LMRA 4PZNA 1B0XA 2F3NA 2KMDA 2D3DA 3TADC 2E8PA 2KSOB 1Z1VA 2DKZA 2Y9TA 2E8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8M A;  4RQM A;  5KNI A;  1SXD A;  1WWV A;  2D8C A;  1LKY B;  1F0M A;  5JTI A;  1UCV A;  2B6G A;  1OW5 A;  2KSO A;  5J8Y A;  3BS5 A;  3HIL A;  5JU5 A;  2EAO A;  2QAR B;  1JI7 A;  4NL9 A;  3KKA A;  3TAC B;  2F44 A;  3SEI A;  1V38 A;  4RQN A;  4IS7 A;  2QB0 B;  1V85 A;  2ES6 A;  1UQV A;  2E8N A;  5F3X B;  2QAR A;  2EAP A;  2ESE A;  3BS7 A;  1B4F A;  1PK1 B;  4NJ8 A;  5J8Y C;  2F8K A;  2QB0 A;  3TAD A;  4NL9 C;  3SEN A;  1X66 A;  2DL0 A;  1X9X A;  1SGG A;  1LKY A;  2JV3 A;  1WWU A;  2K60 A;  2EAN A;  1SV0 A;  3BQ7 A;  1SXE A;  1DXS A;  2KE7 A;  2YTU A;  2QKQ A;  5L1M A;  3K1R B;  2K4P A;  1PK3 A;  2Y9U A;  1COK A;  1KW4 A;  3BS5 B;  3H8M A;  3KKA C;  2KG5 A;  4PZO A;  1OXJ A;  5JRT A;  1PK1 A;  1RG6 A;  2DKX A;  2EAM A;  2L5Y A;  2LPE A;  2KIV A;  1SV0 C;  1X40 A;  1SV4 A;  3IDW A;  4MHV A;  2FE9 A;  2GLE A;  2QB1 A;  2LMR A;  4PZN A;  1B0X A;  2F3N A;  2KMD A;  2D3D A;  3TAD C;  2E8P A;  2KSO B;  1Z1V A;  2DKZ A;  2Y9T A;  2E8O A; 
#chains in the Genus database with same CATH topology
 4EEL A;  2DUY A;  1IG6 A;  2WAQ C;  4KLE A;  3H7I A;  9ICT A;  5KT6 A;  4FBT A;  4O3S A;  5DBA A;  5DLG A;  1SZP A;  4Y2Y A;  1JRP A;  8ICH A;  3TAC B;  3SEI A;  1F44 A;  4DL2 A;  2WF8 A;  1XS9 D;  1DGJ A;  5H2F U;  1XO1 A;  2E5S A;  1C7Y A;  1WG8 A;  1MQ3 A;  3PNC A;  1X2I A;  2HHQ A;  2YX8 A;  4KX5 A;  4EX7 A;  1QLN A;  3JPT A;  4FFD A;  3LWM A;  1K5O A;  2UVU A;  4XUS A;  3IM1 A;  2OXO A;  5EE1 A;  4C8L A;  1ZQP A;  1ZQV A;  4FS1 A;  3AUO A;  9ICC A;  4TQR A;  4RQ6 A;  3WKA A;  5L1K A;  3NVV A;  4O3O A;  8ICF A;  5AM0 A;  1ZYQ A;  3H8J A;  4DL4 A;  2B21 A;  3JPS A;  3TAN A;  3EPI A;  3LYS A;  5HR7 A;  4QWA A;  2Y9U A;  1DK2 A;  4F8R A;  3T3F A;  3ZDA A;  2PFP A;  1CRX A;  2Q0Z X;  3H0L B;  5L1L A;  4GC7 A;  3HT3 A;  4QNL A;  1X40 A;  3IDW A;  3OJU A;  1ZQO A;  4CF3 A;  1LV5 A;  3NVZ A;  2PFQ A;  5IIL A;  4ED0 A;  1N56 A;  3WK6 A;  3D2Q A;  4UB6 U;  1PVR A;  3C21 A;  2K8A A;  4EX6 A;  5KFL A;  2IOF A;  4C7Z A;  1NNL A;  5KFN A;  2XC9 A;  7ICL A;  7ICS A;  1WWV A;  2D8C A;  5AM5 A;  4HAI A;  5EWE A;  2G06 A;  1MC8 A;  3AU2 A;  3AU6 A;  4BXO A;  2ZG6 A;  3AEV A;  2KFZ A;  4PL1 A;  3ISD A;  2XY6 A;  4PL2 A;  4TUQ A;  4NL9 A;  4KN4 A;  2VA3 A;  3EYZ A;  5KFW A;  4DFK A;  5IIJ A;  1JXE A;  4P4O A;  1RPL A;  3AN1 A;  5KT7 A;  4RQN A;  5AIA A;  3TKA A;  4BWJ A;  3HP6 A;  1NKB A;  4JWM A;  3ZDD A;  8ICW A;  4Q45 A;  5AKH A;  2YMM A;  3IG8 A;  2E3T A;  4Z6C A;  1PK1 B;  1UPH A;  3F5E A;  1SKS A;  2KVS A;  2JEJ A;  4RPX A;  3AM9 A;  2E1E A;  3SD7 A;  4NV0 A;  3LVV A;  4QW8 A;  1X9X A;  2LBO A;  4DQI A;  1N62 A;  1Q8K A;  1QSS A;  5J2A A;  5KL8 B;  4J9S A;  5KG1 A;  3FYH A;  4EYH B;  5EWG A;  1BNO A;  5ALT A;  1BVS A;  2FPM A;  3KOO A;  2LKY A;  3ZDB A;  7ICH A;  1WYG A;  5AI6 A;  1COK A;  2WFA A;  4CF4 A;  2IHN A;  3UMG A;  1ZQH A;  4I2H A;  4QZ8 A;  1D8B A;  9ICI A;  7ICK A;  2AJQ A;  4IQW A;  2KIW A;  1D9F A;  4Z6D A;  3H40 A;  2BPF A;  2ZXI A;  3MFI A;  3CP8 A;  4I2G A;  4ACO A;  3F2D A;  5DKW A;  1ZET A;  2FDR A;  2R8I A;  1SL2 A;  5EE9 A;  2Y9T A;  1UT5 A;  4OJ6 A;  2MSN A;  4U6P A;  3PST A;  4P2H A;  5KFI A;  3PX6 A;  4XRH A;  1URJ A;  9ICJ A;  5AM4 A;  1MN8 A;  1HUO A;  3QEA Z;  5CB1 A;  5J8Y A;  5KG0 A;  5J2C A;  1KFS A;  3BS5 A;  5JU5 A;  2YB4 A;  5IIN A;  4A8E A;  2JH1 A;  5CA7 A;  2Q4T A;  4AYB F;  5AKY A;  2ODG A;  1ZD4 A;  2A3V A;  1SB3 C;  1ZOL A;  4QZC A;  3IG5 A;  3OHB A;  4PGQ A;  1V85 A;  1U9L A;  2KZ3 A;  1EXN A;  9ICS A;  4MEX A;  2E8N A;  1S0M A;  4M0A A;  3ZDC A;  4M47 A;  1YZ6 A;  4M9H A;  1SL0 A;  4OD0 A;  2V4Q A;  4DOA A;  3TI0 A;  1Z3E B;  1Z4O A;  2ZXH A;  1BPE A;  2BGW A;  3C23 A;  3C29 A;  2UVV A;  2IHM A;  1ZRM A;  7ICP A;  2RP5 A;  2A1J B;  3CW2 C;  1ZJN A;  2XVT A;  4I2A A;  2Y0S C;  5TZV A;  1SXE A;  1VJ5 A;  2PMZ C;  2K8B B;  1D9D A;  1DK3 A;  5J29 A;  3EZ5 A;  5T14 A;  2KE7 A;  3Q8L A;  2FMS A;  4I28 A;  1TAU A;  2K4P A;  2F77 X;  5J2E A;  5KG2 A;  4C8K A;  1WUD A;  3G6V A;  1OXJ A;  1RYR A;  2R8H A;  3NRZ A;  2I9G A;  3B0Y A;  4M9N A;  4IQT A;  3PVX A;  2Z7J A;  5DBC A;  3NRW A;  4O5E A;  4TQS A;  1RXW A;  1N60 A;  4ED1 A;  4JUZ A;  3FDS A;  2AH5 A;  1X6I A;  3UMB A;  2HSZ A;  4YFK A;  4F5P A;  4M6W B;  2JGA A;  3PR5 B;  3TFS A;  2ZJ8 A;  2GWS A;  4DFP A;  2KSO A;  5KFX A;  5HML A;  3PW0 A;  4QZH A;  4F71 A;  3N7S C;  4O3N A;  4YR2 A;  2P35 A;  3MR2 A;  2MUT B;  2F44 A;  3GIL A;  3J81 j;  1KLN A;  1Z00 B;  2A19 A;  3QUC A;  4LZG A;  7ICE A;  3F53 A;  4IRC A;  1IM4 A;  3M9N B;  2OM6 A;  5J2F A;  2BKE A;  3EW9 A;  2JHD A;  2G07 A;  4TUS A;  2FMP A;  4KLT A;  2J6T A;  3PW5 A;  5HP4 A;  2DL0 A;  5AK6 A;  3HW8 A;  3QU7 A;  5FP0 A;  4RT2 A;  3WK8 A;  4C8M A;  1WWU A;  3E58 A;  5KFV A;  3ONN A;  4PHP A;  7ICT A;  1QQ5 A;  5ALW A;  4UB8 U;  4OJ5 A;  1TKD A;  3V6K A;  1TFR A;  3LVW A;  3QEB Z;  2H3I A;  2XI9 A;  3RAQ A;  4YVZ A;  2PI5 A;  8ICR A;  2XCA A;  4UAV A;  3UXP A;  8ICG A;  1NK0 A;  4OO1 J;  8ICX A;  5IIM A;  4MEY A;  2AU0 A;  4QIW F;  5JRT A;  1PK1 A;  5J0R A;  1JRO A;  4EBD A;  4YXJ A;  5J0S A;  3GQC A;  3PZP A;  4I2B A;  2BR0 A;  4QZI A;  5HR6 A;  4UB2 A;  8ICV A;  4K4H A;  2ZJ5 A;  3K1Z A;  2A1A A;  1KRP A;  4DFD A;  4UAY A;  8ICU A;  4UAT A;  4KLQ A;  1OW5 A;  4ELU A;  2XGQ A;  3QUB A;  5F9N A;  5KFZ A;  5ALU A;  4JMU A;  5IIK A;  5KFG A;  2H3Z A;  3NVY A;  1T3Q A;  9ICV A;  5DB6 A;  2EDU A;  3MGV A;  1A6S A;  3QXG A;  2ZIW A;  1L3S A;  4DSJ A;  5AKL A;  4B9M A;  3WKD A;  1KL9 A;  2KJ5 A;  1NJX A;  4I29 A;  4O5K A;  3RJI A;  4IS7 A;  5ALH A;  2M0N A;  4YR3 A;  3RJK A;  3KZI U;  1B4F A;  4F5R A;  3GFK B;  2WF6 A;  4FZM A;  3PX0 A;  2BCV A;  2JEF A;  1ZD3 A;  2W7P A;  3H4D A;  3H8S A;  9ICK A;  1NZP A;  1ZQY A;  1BNP A;  4ECY A;  2KJ9 A;  4R65 A;  4OJO A;  8ICZ A;  3RB4 A;  2HDO A;  2RDI A;  4ED6 A;  3FM9 A;  2JEI A;  3N4M B;  1H38 A;  5E79 U;  5D49 A;  4ECV A;  2FJ6 A;  3SR6 A;  4JV2 A;  3V7J A;  2BCU A;  5ALL A;  5KFF A;  8ICL A;  3IHQ B;  2QKQ A;  4Y2R A;  3K1R B;  2KD1 A;  1L6N A;  8ICM A;  1ZD5 A;  5HNK A;  1KFD A;  1RM6 C;  4DQP A;  3KTQ A;  2KG5 A;  1QCK A;  3TFR A;  4EBC A;  2EAM A;  1ZQI A;  4YD2 A;  3S6J A;  1S9F A;  2LYA A;  2UVR A;  4RUC A;  1L3V A;  5DQI A;  3OPX A;  3QUT A;  3EWA A;  3BQ0 A;  4KLU A;  4UAZ A;  2XY5 A;  5DB9 A;  4CRX A;  2CXY A;  1QH9 A;  2BCS A;  5AI8 A;  4BWM A;  2W54 A;  5ALE A;  5KNI A;  5KG3 A;  5AKK A;  2H3V A;  2CRX A;  5ALG A;  2WB1 F;  1BPD A;  3D6J A;  2ASD A;  2DBY A;  3LWL A;  4RQ7 A;  2B6G A;  4O3Q A;  2BQ3 A;  1L7M A;  2OCE A;  1L3U A;  4YMN A;  1A76 A;  2ZTE A;  4F4X A;  2R8J A;  1ZQF A;  1ARO P;  4DLE A;  2XID A;  3BQT A;  4FBU A;  5J0X A;  4IRK A;  3RB3 A;  3T5H A;  4P4P A;  7ICO A;  1AQ6 A;  1V38 A;  4NM1 A;  4QWB A;  3NTU A;  2NO5 A;  5F3X B;  3WU2 U;  5ALR A;  2AGQ A;  4TUP A;  4ECX A;  4QZ9 A;  4GIB A;  2F1J A;  1DOQ A;  1ZXI A;  5KT5 A;  5L9X A;  3AQE A;  2ZUD A;  1MA7 A;  4M6W A;  3PML A;  1UA0 A;  2NV3 A;  4DQR A;  2KNJ A;  5AK4 A;  2ZIV B;  1PUZ A;  1N48 A;  2BDU A;  3BQ7 A;  5DGA A;  1SL1 A;  1P7D A;  5AKG A;  4C8O A;  9ICB A;  5KFO A;  2YTU A;  1N63 A;  4DSI A;  2MUT A;  4UB4 A;  1MSW D;  5L1M A;  1JN3 A;  3WK5 A;  1UA1 A;  1PK3 A;  5EE0 A;  1Z00 A;  2BQU A;  4RQ0 A;  9ICQ A;  4M9G A;  2BCQ A;  3TQ1 A;  3RB0 A;  9ICW A;  1VLB A;  2C2D A;  5ALS A;  3HRD D;  3B0X A;  2G0A A;  2FI1 A;  3FAH A;  2HW3 A;  3RBE A;  1RXV A;  4F4W A;  1X42 A;  1KSP A;  2J6S A;  4J9O A;  3CNH A;  4KX3 A;  4K4I A;  3RR7 A;  2KSO B;  4KN7 A;  5D46 A;  2EH9 A;  1PVP A;  2KOB A;  4C7Y A;  5KFH A;  2YY6 A;  4PHD A;  3KD3 A;  1ZQD A;  1O08 A;  5AI4 A;  4B9T A;  3A0B U;  2W9M A;  2EAO A;  4KLG A;  4HYK A;  2F8L A;  4PGY A;  4RPZ A;  4ECU A;  1KQQ A;  4DOB A;  3UM9 A;  4BUG A;  4F91 B;  7ICG A;  5KAI U;  2NO4 A;  4IQU A;  3H4B A;  2HOF A;  2IBK A;  2BPC A;  3KBB A;  2HHV A;  2JXJ A;  4YN4 A;  3ZI4 A;  3AMZ A;  7ICM A;  2ASL A;  3M9O B;  1NK6 A;  3ETL A;  3MBY A;  4F5N A;  5BOM A;  3NGD A;  4F5Q A;  2KN7 A;  1T3N A;  2RDJ A;  3SI8 A;  3ZDE A;  8ICE A;  2JV3 A;  4BX9 C;  1ZQQ A;  7ICI A;  1T94 A;  5DDM A;  2XGP A;  3GDX A;  4O3P A;  4EZ9 A;  2VIX A;  3T5J A;  3KZX A;  4QWD A;  1OUQ A;  1S97 A;  3BJY A;  1ZRN A;  1D8Y A;  1J2M A;  4F72 A;  4UQG A;  1NOM A;  4BJQ A;  3UMC A;  3PX4 A;  4U7C A;  5KL1 B;  4FE3 A;  4O3M A;  5CWR A;  1YT3 A;  4PZO A;  4RT3 A;  3D2S A;  2LYB A;  4B9N A;  3M9M B;  1DGS A;  2DKX A;  3NVW A;  8ICQ A;  1ZQL A;  3KHR A;  1NK8 A;  5KFJ A;  2DPJ A;  7ICR A;  4DL5 A;  4F3O A;  2DF4 B;  3HKZ F;  2F2A B;  2GLE A;  1RQN A;  4KLM A;  4J9N A;  3ETR A;  4R63 A;  4F92 B;  1ZQC A;  2D3D A;  5BOL A;  5DGB A;  1TAQ A;  3UXO A;  3RAX A;  2ZIW B;  1D8L A;  4DL3 A;  2E8M A;  4DSL A;  3T79 A;  2KK0 A;  1UCV A;  1IIP A;  1CEZ A;  2W04 A;  2XIC A;  4ED3 A;  5C0Y A;  5KFS A;  1JI7 A;  1Y88 A;  3U26 A;  2AGP A;  3DV9 A;  2KV2 A;  4GLX A;  3TAP A;  2N1R A;  3C5G A;  2ES6 A;  3THV A;  2QAR A;  2W7O A;  3UXN A;  2ESE A;  5L1J A;  2XY7 A;  2W9C B;  9ICG A;  5J0P A;  4CNQ A;  4NJ8 A;  7ICV A;  1PZN A;  1NJW A;  9ICN A;  3EUB 2;  4NXZ A;  3ALR A;  4LJX A;  5KFQ A;  3SEN A;  2WTF A;  3GV5 B;  4F93 B;  4ELV A;  1Q3V A;  3SYZ A;  4KMO B;  4KLS A;  1S10 A;  2FLN A;  4KLI A;  3E2E A;  2FMQ A;  2KVC A;  1V97 A;  4EBE A;  2BZF A;  5EOZ A;  4QW9 A;  1RYU A;  5AKZ A;  1NK4 A;  2LYH A;  5DDY A;  2HHX A;  2W9B B;  4FZL A;  4F2R A;  1L8L A;  5KFK A;  3T5L A;  2EQY A;  2LPE A;  2L5Y A;  1FO4 A;  2KIV A;  1L8O A;  4NLG A;  5J2H A;  2ISO A;  4DLG A;  1S0V A;  1XSL A;  9ICM A;  1U4B A;  3HPO A;  3HJE A;  4PZN A;  4QZG A;  5CEH A;  4QZA A;  4PHA A;  5KFY A;  1IV8 A;  2ZIV A;  3K4G A;  2DKZ A;  3FC4 A;  4YP3 A;  4GXK A;  2BQR A;  4KLF A;  2GO7 A;  2P66 A;  4YG2 A;  4UB5 A;  4F50 A;  2W03 A;  2HMX A;  5KFP A;  4XA5 A;  4YMM A;  4M2Y A;  2G09 A;  3JPO A;  3RJG A;  4YQW A;  3UPQ A;  4DEZ A;  4NY8 A;  4Z6E A;  3PO4 A;  5KG7 A;  9ICF A;  3GV7 B;  4G3I A;  1TK5 A;  4KMU A;  4QIW C;  1ZQW A;  2HBM A;  1ZJM A;  2HBL A;  5ALP A;  3PW2 A;  1NZB A;  1BPZ A;  4F5O A;  4MFA A;  4NLB A;  1X9W A;  2E1F A;  2MU2 A;  3F2C A;  3MAB A;  5CHG A;  3RF9 A;  4C80 A;  5J2J A;  1TK0 A;  4ED8 A;  4ELT A;  5KT4 A;  4NLC A;  2F1I A;  1SIJ A;  5JUM A;  4IL6 U;  5J2B A;  3RH6 A;  3M8S A;  5J2G A;  8ICA A;  1QSY A;  2PMZ F;  4I2I A;  3G6Y A;  2JZB A;  7ICQ A;  2ZUC A;  4AP9 A;  4EYI B;  1BPX A;  8ICT A;  2IOF K;  4QWE A;  5ALK A;  1L7O A;  1ECW A;  3C1Y A;  4Y2J A;  4GFJ A;  3L4P A;  1SV0 C;  9ICX A;  4JK1 A;  1ZD2 P;  4RNN A;  2QB1 A;  3TAR A;  2HI0 A;  1ED1 A;  4O9M A;  4WJ3 B;  2E8P A;  9ICA A;  4GXJ A;  1LB2 B;  3WKB A;  1A0P A;  4YD1 A;  1S76 D;  5ALO A;  1KKX A;  4USA A;  5CRX A;  5DB8 A;  1LKY B;  1FEZ A;  5KFU A;  2IMW P;  1Z4N A;  1QQ7 A;  4Y2S A;  2AXT U;  2FPL A;  2BDP A;  1ZQS A;  2OHF A;  2QLT A;  4RNM A;  9ICO A;  1IXR A;  5AKE A;  2C2R A;  2CPR A;  2NYV A;  3OHA A;  2WF7 A;  1O03 A;  3ISB A;  5ALY A;  2M9N A;  2Y1J A;  4P0Q B;  5AKX A;  5ALJ A;  4Y2T A;  2W9A A;  5AKI A;  8ICJ A;  2DFL A;  2XO7 A;  2YML A;  5J0T A;  9ICL A;  4KLL A;  3PW7 A;  1XC9 A;  5AIC A;  2WF9 A;  4PJ0 U;  3Q8R B;  3HX0 A;  3WKE A;  1T4G A;  4ED2 A;  2K60 A;  1X9S A;  3GII A;  3MFH A;  3JPP A;  2VA8 A;  1ZQG A;  4I2C A;  1XU4 A;  1DXS A;  3E0F A;  4RU9 A;  2V9W A;  4DF8 A;  1B22 A;  2H3Q A;  4RPY A;  4OJL A;  5DQG A;  1ZQK A;  4UW9 A;  5K4L A;  3SZ2 A;  3H8M A;  3JPR A;  5AI5 A;  2KTQ A;  3MR3 A;  2W9C A;  3MR5 A;  3G6X A;  5EE3 A;  8ICN A;  2YQE A;  5J0Q A;  4JV0 A;  4RNO A;  4MHV A;  2FE9 A;  1QQ6 A;  4RQ3 A;  1LVH A;  3PMN A;  1L5U A;  4J03 A;  4IQV A;  2KKV A;  4YMO A;  2E8O A;  5KAF U;  4RQM A;  2W3S A;  4B9V A;  4UAR A;  3IP4 B;  9ICH A;  3R9K A;  2W9B A;  5J0U A;  4Y2P A;  3SV3 A;  4Q8F A;  2QAR B;  3F2B A;  1RQL A;  2LHT A;  4NWI A;  4OCZ A;  4ZOH C;  2W3R A;  2P6U A;  3DEE A;  5KT2 A;  2UVW A;  8ICY A;  5HHH A;  3A0H U;  3Q8S B;  1UQV A;  3EPG A;  2G08 A;  3QNM A;  5G5G A;  8ICB A;  4DS4 A;  2EAP A;  3UQ2 A;  4MF8 A;  4ECS A;  2FPK A;  4Q43 A;  2LI6 A;  5DQH A;  1KFT A;  1X6J A;  3I1Y A;  3N7R C;  4RQ8 A;  2I6X A;  3SAG A;  3UQ0 A;  3V6J A;  4FO6 A;  2MA1 A;  5ALM A;  4QJF B;  5DB7 A;  1CUK A;  1PVQ A;  4UAW A;  8ICI A;  4J9P A;  1FFV A;  1U49 A;  3RBD A;  3H0R B;  8ICP A;  2AHO B;  1T8E A;  4F4K A;  2HHS A;  5J2K A;  2ALZ A;  4NLN A;  1NKE A;  4CF5 A;  5CJ7 A;  2IOH A;  2R8K A;  3JPQ A;  2ZTD A;  3IN5 A;  1SV4 A;  2HVI A;  5KFM A;  1CI4 A;  3OGU A;  5C5J A;  1ZQN A;  3NUQ A;  2YMP A;  1TVA A;  2YMQ A;  4QZE A;  4OJP A;  1Q46 A;  4RQ1 A;  3TAQ A;  4B9U A;  2K8C B;  2O6K A;  1L7N A;  3RH4 A;  1ZQJ A;  3WK9 A;  1S0N A;  4RUA A;  4GC6 A;  2NRZ A;  2I1Q A;  1ZQB A;  2DQN B;  5III A;  3OSP A;  4JV1 A;  3QZ8 A;  2EZX A;  1J2N A;  5J0W A;  3MGI A;  2K4H A;  1S0O A;  1BGX T;  4ZH4 A;  2VKQ A;  5DG9 A;  5AKJ A;  3QU9 A;  2ATL A;  2PXI A;  5ALV A;  4MFF A;  2ASJ A;  2JMG A;  2W43 A;  3BZC A;  2F8K A;  1N5X A;  1JMS A;  4EEY A;  2WAQ F;  5DG8 A;  1JAL A;  4NL9 C;  4BGD A;  3HKZ C;  1LKY A;  3C2K A;  3QE9 Y;  4Y2U A;  1ZQX A;  2F1H A;  2C28 A;  3QU4 A;  2EAN A;  2OYY A;  3SAH A;  2V4R A;  1ZQZ A;  2JZB B;  3GZF A;  3C1Z A;  2NRT A;  5KFA A;  5KG4 A;  3IV6 A;  2KEY A;  1XWL A;  4M04 A;  2YB1 A;  1KW4 A;  3CYM A;  2GOL A;  4P0Q A;  4ECT A;  3CRX A;  1GO3 F;  2JH7 A;  4IRD A;  1N61 A;  5EWF A;  2H5X A;  4ECW A;  2ZIU B;  2KZM A;  4G9B A;  3KFU F;  3BDP A;  3I28 A;  5HHI A;  3PSI A;  4PGX A;  4EEN A;  3OTQ A;  2DPI A;  3KHG A;  3RJF A;  2H3F A;  1SKW A;  2OWO A;  5ALN A;  1UT8 A;  3IRU A;  4AYB C;  3WK4 A;  5AM1 A;  3GV8 B;  4J9K A;  3RRG A;  4M9L A;  5CR0 A;  4PPX A;  1KEJ A;  2JR5 A;  2ZIX B;  3GU3 A;  3QUQ A;  4F4Y A;  4YCX A;  5ALZ A;  4GXI A;  2R18 A;  4O3R A;  2B0C A;  3LDA A;  5KG5 A;  5G5H A;  4C0Z A;  5AHX A;  5AI9 A;  4K4G A;  4J9R A;  1SZH A;  2HCF A;  4RQ2 A;  4R66 A;  4MF2 A;  4NLZ A;  4DL7 A;  1S77 D;  3V6H A;  5J8Y C;  1RDF A;  2PKE A;  2QB0 A;  2KIC A;  2PFN A;  1NK9 A;  3RTV A;  2C2E A;  2G5I B;  1NJY A;  7ICN A;  2GH1 A;  4R8U B;  3L3F X;  7ICJ A;  3GIK A;  1XO0 A;  5ALI A;  4J9M A;  2VJ5 A;  1V9P A;  3V72 A;  3MR6 A;  3Q8M A;  2BPG A;  3Q8K A;  2BHN A;  2HHW A;  4I2D A;  3Q8Q B;  4KTQ A;  4KLO A;  4NM2 A;  3SQI A;  1M6Y A;  1FFU A;  3GIJ A;  1U45 A;  2AQ0 A;  1U47 A;  1DRG A;  1QTM A;  5J0O A;  5TIS U;  3VCB A;  4KIT B;  3RR8 A;  3M7D A;  1RG6 A;  4O0I A;  2J6U A;  3QYP A;  5AI0 A;  4JB3 A;  1SWV A;  1KDH A;  8ICC A;  3PV8 A;  2KMD A;  9ICE A;  3PR4 A;  4P0P B;  2AQ4 A;  1ZQR A;  3BQ1 A;  2OH2 A;  4QZF A;  3RJE A;  2PFO A;  2R8G A;  1TK8 A;  2P6R A;  3KHH A;  4RZR A;  4PH5 A;  4F4Z A;  1KBU A;  2ISP A;  3BQ2 A;  3D2N A;  4FS2 A;  4DO9 A;  3WKC A;  1RZT A;  5KFB A;  3DDH A;  1Z1B A;  3ICX A;  3VC8 A;  1KN5 A;  2MAX A;  3B9J A;  1BPB A;  1NK5 A;  2C22 A;  1ZQM A;  4CCH A;  3AL0 B;  3HWT A;  4JWN A;  2G5H B;  4DWI A;  2I5H A;  2K4I A;  1YZ7 A;  2KJ8 A;  1XSN A;  4IC9 A;  5B5E U;  1NK7 A;  5B66 U;  3Q8P B;  4ECR A;  1HIW A;  2KHV A;  8ICK A;  2D6F C;  4I2E A;  1ZQA A;  1L3T A;  3V7K A;  2K89 A;  3PY8 A;  3M6K A;  4B9L A;  1ZQ1 C;  5HMM A;  3MGH A;  2EZZ A;  2WHE A;  5J2D A;  5KG6 A;  4Y2Q A;  4CDG A;  1N2X A;  2RLT A;  2DGZ A;  8ICO A;  4LVS A;  3MDA A;  3ORY A;  4Z6F A;  3C2M A;  1C20 A;  4R64 A;  5ALD A;  2W8K A;  9ICU A;  1HEK A;  4RQ5 A;  5AM3 A;  3N28 A;  1L7P A;  5KFR A;  1NJZ A;  2FLP A;  1SWW A;  4YXM A;  3KKA C;  4QWC A;  5AIB A;  2LM4 A;  2ZUB A;  4J9L A;  2DWQ A;  2HVH A;  4I2F A;  3O0F A;  2NRW A;  4J9Q A;  4DL6 A;  5KTQ A;  5J2I A;  1B0X A;  2KHQ A;  4C4R A;  2W8L A;  2KP7 A;  1FIQ A;  1K1Q A;  3RB6 A;  3TAD C;  4I2J A;  3AQF A;  2Y0S F;  1Z1V A;  2KKP A;  2RRD A;  1WCL A;  4RQ4 A;  4UB1 A;  1SXD A;  3WK7 A;  3KHL A;  4ICA A;  3RFA A;  3M1Y A;  1F0M A;  1TE2 A;  3NS1 A;  5JTI A;  4QZD A;  4DSE A;  2HOI A;  1ZQE A;  3HIL A;  4KLD A;  3ZD8 A;  3KKA A;  4DQS A;  3PSP A;  4C8N A;  4UB3 A;  1JX4 A;  3C28 A;  2ZIU A;  1KTQ A;  7ICU A;  1X9M A;  2NRV A;  1RYS A;  1SKR A;  5AM2 A;  4XQ8 A;  1Z19 A;  2PI4 A;  4EEK A;  1JUD A;  3TAD A;  2RHF A;  5GTH U;  1N5W A;  1VDV A;  5L1I A;  4FZN A;  4KLJ A;  1X66 A;  4YR0 A;  7ICF A;  3RRH A;  1J97 A;  1SGG A;  3SV4 A;  4F2S A;  2HHU A;  4MFC A;  4ECQ A;  2VJ4 A;  3PW4 A;  4UBB A;  2ZIX A;  1SV0 A;  2LM1 A;  3H0M B;  4EZ6 A;  4NLK A;  1BPY A;  4Q8E A;  4BDP A;  5J0Y A;  1HJP A;  5KT3 A;  4BXO B;  3BZK A;  1JIH A;  2Y1I A;  3I76 A;  4PHE A;  1NI3 A;  1MQ2 A;  4TUR A;  3F5A A;  4Q44 A;  1NKC A;  4KLH A;  1U48 A;  5CP2 A;  2JRZ A;  1T7P A;  1Q3U A;  3N7P D;  3ZD9 A;  5IIO A;  1COO A;  4O5C A;  2NRX A;  1F5S A;  4DSK A;  3SMV A;  2LMR A;  4R8U A;  5ALQ A;  5DLF A;  2WB1 C;  5KFE A;  4ED7 A;  4DF4 A;  1TV9 A;  2BCR A;  2K4E A;  3M6Z A;  3ED5 A;  3V7L A;  4DCC A;  1ZQT A;  4DSF A;  2WF5 A;  3K75 D;  3NAS A;  9ICR A;  4LZD A;  2VAN A;  3M8R A;  5KFC A;  3LK9 A;  5BPC A;  2HOQ A;  1TAM A;  4DQQ A;  2ZJA A;  5DBB A;  3RJJ A;  1UHU A;  2KZZ A;  3ISC A;  4X5V A;  5KFD A;  1XSP A;  3H8W A;  4C4S A;  3QZ7 A;  3T5K A;  2QB0 B;  3QU2 A;  4DFM A;  2W11 A;  3OJS A;  2MRL A;  2FLL A;  4UAU A;  3GIM A;  2CN1 A;  4P0P A;  3SAF A;  3BS7 A;  9ICP A;  3N97 B;  8ICS A;  4US9 A;  5A0L A;  3OSN A;  4B9S A;  5AK5 A;  1JXL A;  5ALF A;  4DFJ A;  1QSL A;  3QX7 A;  3C5F A;  3MDC A;  4Y2X A;  4P4M A;  4C4T A;  2XCP A;  1S8O A;  2ZTC A;  3MC1 A;  5ALX A;  4CE6 A;  5GTI U;  4ECZ A;  3PO5 A;  1B43 A;  1WCN A;  1K1S A;  4E0D A;  2RQ5 A;  1HUZ A;  3C2L A;  4IR9 A;  5D4B A;  2IA6 A;  2A1J A;  5AK3 A;  2YN4 A;  2HHT A;  4B6J A;  2OEH A;  1S5L U;  3BS5 B;  4DOC A;  3RH5 A;  4UAS A;  2HBJ A;  3JPN A;  1ZQU A;  4M9J A;  5DG7 A;  4US8 A;  2EZY A;  2KFN A;  4QZB A;  5KFT A;  3L5K A;  4CGZ A;  4DS5 A;  4I27 A;  2W55 A;  1A77 A;  2F3N A;  4IR1 A;  3PSF A;  1XNS A;  2F76 X;  5F9L A;  3RJH A;  2AGO A;  2JEG A;  4UBC A;  3QU5 A;  2VA2 A;  4Y2V A;  2HBK A; 
#chains in the Genus database with same CATH homology
 2E8M A;  4RQM A;  5KNI A;  1SXD A;  1WWV A;  2D8C A;  1LKY B;  1F0M A;  5JTI A;  1UCV A;  2B6G A;  1OW5 A;  2KSO A;  5J8Y A;  3BS5 A;  3HIL A;  5JU5 A;  2EAO A;  2QAR B;  1JI7 A;  4NL9 A;  3KKA A;  3TAC B;  2F44 A;  3SEI A;  1V38 A;  4RQN A;  4IS7 A;  2QB0 B;  1V85 A;  2ES6 A;  1UQV A;  2E8N A;  5F3X B;  2QAR A;  2EAP A;  2ESE A;  3BS7 A;  1B4F A;  1PK1 B;  4NJ8 A;  5J8Y C;  2F8K A;  2QB0 A;  3TAD A;  4NL9 C;  3SEN A;  1X66 A;  2DL0 A;  1X9X A;  1SGG A;  1LKY A;  2JV3 A;  1WWU A;  2K60 A;  2EAN A;  1SV0 A;  3BQ7 A;  1SXE A;  1DXS A;  2KE7 A;  2YTU A;  2QKQ A;  5L1M A;  3K1R B;  2K4P A;  1PK3 A;  2Y9U A;  1COK A;  1KW4 A;  3BS5 B;  3H8M A;  3KKA C;  2KG5 A;  4PZO A;  1OXJ A;  5JRT A;  1PK1 A;  1RG6 A;  2DKX A;  2EAM A;  2L5Y A;  2LPE A;  2KIV A;  1SV0 C;  1X40 A;  1SV4 A;  3IDW A;  4MHV A;  2FE9 A;  2GLE A;  2QB1 A;  2LMR A;  4PZN A;  1B0X A;  2F3N A;  2KMD A;  2D3D A;  3TAD C;  2E8P A;  2KSO B;  1Z1V A;  2DKZ A;  2Y9T A;  2E8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...