2F8KA

Sequence specific recognition of rna hairpins by the sam domain of vts1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
84
structure length
84
Chain Sequence
SSMNPKSLTDPKLLKNIPMWLKSLRLHKYSDALSGTPWIELIYLDDETLEKKGVLALGARRKLLKAFGIVIDYKERDLIDRSAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-R(*UP*AP*AP*UP*CP*UP*UP*UP*GP*AP*CP*AP*GP*AP*UP*U)-3'
publication title Sequence-specific recognition of RNA hairpins by the SAM domain of Vts1p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/ rna
total genus 32
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2005-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2f8kA00
4NJ8A 2E8OA 1PK3A 2E8PA 1PK1A 2Y9TA 4MHVA 1WWVA 1F0MA 2F3NA 3SENA 1RG6A 1V85A 2F44A 1OW5A 1B4FA 1KW4A 1PK1B 1X66A 2EAMA 2F8KA 2LPEA 1Z1VA 5F3XB 2B6GA 1LKYB 2DKXA 1COKA 2K4PA 2K60A 1UCVA 2E8NA 4NL9A 1SV4A 1LKYA 2QKQA 2JV3A 2DL0A 4RQNA 1OXJA 2QB0B 1V38A 4RQMA 2KSOB 1UQVA 4PZOA 3IDWA 4NL9C 2KE7A 5JTIA 5J8YC 2QB0A 3KKAC 4PZNA 3TADA 2KSOA 3H8MA 3HILA 2D8CA 3BS5B 2KMDA 5J8YA 2GLEA 2Y9UA 1SV0C 2QB1A 3KKAA 2D3DA 3BQ7A 2ESEA 5L1MA 3BS7A 1X9XA 2QARB 1SXEA 1SV0A 3BS5A 5KNIA 3K1RB 5JU5A 1SXDA 2E8MA 3TADC 2FE9A 2KG5A 1B0XA 2EAOA 1X40A 2YTUA 3TACB 2EANA 2QARA 1WWUA 4IS7A 1DXSA 1JI7A 5JRTA 2L5YA 2ES6A 2KIVA 2EAPA 3SEIA 2DKZA 2LMRA 1SGGA
chains in the Genus database with same CATH superfamily
2Y0SF 5L1LA 2XY7A 2YB1A 2BPGA 2F3NA 1KLNA 5T14A 1JROA 3PO4A 2F44A 1ZQDA 5ALLA 4UB1A 4RQ0A 4P4MA 5AHXA 4O5CA 4F4XA 4YXJA 3AN1A 5CWRA 3TARA 3LDAA 4IRDA 3BQ0A 4K4GA 1UCVA 2JXJA 5G5HA 4NL9A 2KOBA 4DL4A 5KT6A 3F2DA 1DRGA 4M47A 4PHDA 3L3FX 3WK8A 3Q8RB 2CN1A 2V9WA 1TE2A 2W3SA 2W11A 4J9KA 5AM1A 4XA5A 4TURA 4BWMA 4YFKA 2ZUDA 4IR1A 3LWLA 1ZQMA 1ZD3A 4KLHA 3ETLA 4J9PA 3TADA 3LVWA 3C2KA 3H8MA 1JUDA 3QX7A 1HUOA 2PFQA 1X6JA 3PR4A 2QB1A 2GH1A 3H8JA 2M9NA 4MEYA 2RP5A 3MGVA 3HT3A 5KT7A 4EEYA 5KFKA 4NLCA 4P0PB 3C5FA 1QQ7A 1X9WA 5J2HA 4F5QA 2WF6A 2XGQA 4RQ5A 5DBBA 3V6JA 4M9GA 9ICVA 1X6IA 4IQWA 2PFPA 1SB3C 4QW8A 2FDRA 5IIOA 4I2IA 4O3QA 2R8JA 2J6SA 1KFDA 2HBKA 2LMRA 4ECRA 5J0WA 5CP2A 4RQ2A 3JPQA 1F0MA 3C21A 3QYPA 1FEZA 1Z1BA 3KD3A 2QLTA 8ICQA 4C8OA 1ZQWA 4M9HA 1PK1B 3I28A 3NRZA 1XC9A 3C28A 4BX9C 1OUQA 2ZTEA 1NK5A 2JHDA 1LV5A 5ALIA 2IHNA 4TUSA 5KL8B 2HHTA 9ICBA 5DB9A 4FO6A 4DFPA 2HSZA 1LKYA 2QKQA 2AJQA 4BWJA 5KFJA 4UBCA 3TFRA 3WKDA 4DOCA 2ZUBA 2UVWA 7ICVA 1UA1A 1NK7A 2JGAA 2YMPA 1TK8A 3RJJA 4O3RA 4YR3A 5JTIA 2QB0A 2C2RA 1A0PA 4HYKA 9ICMA 9ICOA 5K4LA 3GFKB 5J2AA 4JWMA 5FP0A 4M9LA 2KSOA 4LVSA 2D8CA 5ALMA 4PGXA 5CRXA 4I2HA 3PZPA 3OSNA 2WF5A 1VLBA 5AKJA 2HBJA 3PW0A 2ZIUA 4M04A 1S0OA 4PHEA 5L9XA 2OH2A 4NLZA 1JN3A 2PFOA 3F5AA 5L1KA 5CB1A 1NK8A 1L3VA 4WJ3B 2JRZA 4BXOA 2HCFA 1NOMA 3QZ8A 1AQ6A 2KVCA 5AKHA 2EAPA 1X42A 7ICHA 2C2DA 1NJXA 1A76A 9ICTA 2WAQC 9ICIA 5AM4A 2YMLA 3MABA 4OJPA 2ODGA 1Z00B 4C8NA 3WKEA 2IA6A 4JWNA 5AIBA 4YMMA 1T3NA 1N60A 3NTUA 1HJPA 4GIBA 3M6KA 3PSTA 5J2GA 1FIQA 5EWEA 2W9CA 1VJ5A 4O3PA 1ZYQA 3F2BA 3S6JA 2MRLA 3RR8A 3JPPA 3C1ZA 1L3SA 4PL2A 1S97A 2NYVA 2VANA 4KTQA 3D2QA 5DB7A 4NV0A 1S10A 1ZD2P 3NASA 5AI5A 4M0AA 2J6UA 2K8CB 3PW4A 4C7YA 5KFZA 5DBCA 1RZTA 1DK3A 5KFPA 4QZBA 3SV4A 2CPRA 4DQSA 2KN7A 3HKZF 4DO9A 1NKEA 1SZPA 2EDUA 2W04A 4DQRA 2HHQA 4EX6A 1ZQRA 4DF4A 3K4GA 2KP7A 3WK9A 3TANA 5GTIU 2JEJA 4YP3A 1UT5A 2NO4A 3NVYA 1KDHA 3RAQA 4MF2A 3V7LA 5J0TA 3ZDCA 4QIWC 5DGAA 2MSNA 1ECWA 4EZ6A 4CF5A 4B9NA 5AI8A 5AKIA 1UPHA 2NV3A 4YCXA 5IIMA 1EXNA 1TFRA 5AM0A 1ZQTA 4NWIA 1YZ7A 2ZIWA 1BPEA 3F5EA 3E2EA 2KFZA 2E1EA 4QZCA 1KW4A 4EBDA 5DLGA 4C8KA 4DSFA 1Y88A 4QW9A 2KV2A 1N2XA 2ZJ8A 2HOIA 2WB1F 4DQQA 2OXOA 3ZDBA 4XRHA 2I6XA 2AXTU 4RQ7A 1D8YA 1Q8KA 9ICKA 4DFDA 3H40A 4C8MA 3KZXA 1TAQA 5AI6A 3HPOA 4F2SA 4KLEA 1ZQHA 1L3UA 4KLTA 4PH5A 4JK1A 1ZRMA 1A77A 3MFHA 2KE7A 3V6HA 4Z6EA 3O0FA 2AGPA 5EE1A 3KHGA 4F4WA 2FLPA 3JPOA 7ICGA 2YMMA 5F9NA 4KITB 2UVRA 1FFVA 5C5JA 2K8AA 1NJZA 2MUTB 2P66A 4R66A 3M8RA 4XUSA 1SZHA 2D3DA 2ESEA 3PO5A 1JRPA 5J2FA 4OJ5A 2XVTA 2PMZC 4J9QA 1B22A 1H38A 2Y1JA 2KFNA 4FZNA 2KG5A 1ZQZA 3SMVA 9ICQA 2YB4A 3FYHA 2DUYA 1U47A 9ICGA 2KZMA 3OGUA 8ICBA 1DXSA 2ZG6A 1BNPA 3RJIA 1Z4OA 4B9UA 4IR9A 2XO7A 2KIVA 1L3TA 3H7IA 5J0XA 2GWSA 3EW9A 1IM4A 2JH7A 4OJOA 1PK1A 3KOOA 1S9FA 2WTFA 4P0QA 3QE9Y 1L5UA 1D8BA 2OYYA 1RG6A 2ZUCA 1D9DA 3LK9A 4OD0A 4CRXA 2DWQA 8ICRA 4RNNA 5KFUA 1OW5A 3G6XA 2EZXA 3G6VA 3RBEA 5AK5A 4ECYA 2FPLA 1XWLA 3RRHA 2KZ3A 4RQ4A 9ICPA 4QZEA 5BPCA 3KBBA 2F77X 3V7KA 4DL7A 2K8BB 2GOLA 2LYAA 1PVRA 1L6NA 2XY5A 4O3SA 8ICUA 2W9AA 4RQ3A 4EENA 3MGHA 5D4BA 4QZ8A 3T79A 4Z6CA 1DGJA 1OXJA 1SL1A 3E58A 4IRKA 2JZBA 4KLDA 5ALPA 4KLGA 5IIKA 3EYZA 1C20A 5KG3A 4I2EA 1ZJNA 3N7RC 4UW9A 1XU4A 4NLKA 5KFHA 1JXLA 1T7PA 2JH1A 1X2IA 3KKAC 5DQHA 5ALZA 2BPCA 4BJQA 4Q8EA 2ZIXB 4K4IA 3VC8A 5J8YA 4UB6U 3QUTA 3Q8SB 4O9MA 1X9MA 3SV3A 2A1JA 5KG2A 4I2JA 2RLTA 1SXEA 3MDCA 2LYBA 3QUBA 1ZQ1C 3N7PD 1N56A 2V4RA 2FE9A 5KFXA 4GLXA 5AKGA 5KAFU 4F4YA 4DSIA 3GIJA 2W9MA 2ZIVB 4KMUA 3ZDAA 4GXJA 4U7CA 2YN4A 8ICOA 1S0VA 4DSEA 3Q8QB 2ES6A 2B0CA 1PUZA 9ICHA 1Z00A 1Z3EB 2HBLA 4F5PA 4OCZA 1CRXA 4O5EA 1L7OA 2EZZA 5CEHA 1DK2A 2K89A 2ZXHA 1NZPA 2ZJ5A 4TUQA 3JPTA 3ISDA 1DOQA 3Q8MA 4US9A 3GDXA 2FMSA 2KZZA 1B4FA 1A6SA 1Z1VA 5KFIA 4KLJA 5DBAA 2IHMA 2Q0ZX 1KFTA 1ZQPA 4KLQA 5ALNA 4B9SA 3PX4A 4C7ZA 8ICJA 5ALGA 1TVAA 2VIXA 3AU6A 2JEFA 4UB4A 2DGZA 2KVSA 4KLSA 1Q46A 3HWTA 5AKKA 7ICRA 1RYSA 2Y1IA 3GILA 5G5GA 4RQ6A 3MR2A 2W54A 5J2DA 3V72A 4PZNA 1IV8A 2W03A 1QH9A 2A19A 3C2MA 4J9OA 4JB3A 1MQ3A 3ISCA 4DFKA 4BDPA 4P4OA 3PX0A 1SV0C 2H3VA 2WHEA 4I27A 4ED2A 3PX6A 5L1MA 2MAXA 3RB0A 2QARB 3PR5B 4LZDA 2ATLA 4UBBA 1TK0A 5JU5A 5HMLA 1B0XA 4JUZA 2YTUA 4Q44A 2JR5A 4J9SA 8ICGA 2FLLA 9ICLA 3Q8PB 5KTQA 3FM9A 1D9FA 1N63A 3K1ZA 5B5EU 5KG5A 4RPZA 3AUOA 2FMQA 3JPNA 3BQTA 4MF8A 2KJ8A 2WF8A 4DCCA 5KFFA 1NNLA 4NM2A 3DEEA 1WWVA 2CRXA 1BGXT 1ED1A 1U45A 2R18A 4QZAA 3QUQA 1RM6C 4M6WB 2PI5A 5HHIA 2R8GA 1CEZA 2PI4A 2B6GA 4Q8FA 4O0IA 1RPLA 3IG5A 1HUZA 3V6KA 3WU2U 3NRWA 4UAWA 2G5IB 4RQ1A 5AICA 5DG8A 4Y2QA 4CF3A 2UVVA 5CA7A 4QJFB 2AQ4A 3PSFA 1WUDA 2R8IA 3WK5A 4B9VA 1P7DA 4ECUA 4RUCA 1ZQSA 1JMSA 2FLNA 3RJEA 4B9LA 4F72A 1URJA 5KFMA 3PY8A 4EELA 5AI4A 2H5XA 2F1JA 1XNSA 3CW2C 3UQ0A 4PGQA 9ICUA 1BVSA 5AM3A 4ED0A 4X5VA 3C1YA 4M2YA 2W9BB 3ICXA 5KFLA 3GV5B 2KJ5A 4DSKA 4EZ9A 2E8MA 3RAXA 4F93B 3TACB 3CYMA 2RDJA 4O3MA 1WWUA 4DSJA 2BZFA 1BPZA 1N62A 4IRCA 3B0YA 3SZ2A 3G6YA 2YX8A 2DKZA 5KG4A 3UXNA 1NK6A 5ALYA 2YY6A 4NJ8A 3UXPA 1XO0A 4YMOA 4MFCA 4IQUA 1KFSA 1YZ6A 3QU9A 4DOAA 4DL5A 2BQUA 1SWWA 3PV8A 2E1FA 5IILA 1SKWA 4GXKA 1LB2B 4AP9A 5L1IA 3CP8A 3RJGA 3AL0B 3NGDA 5DDYA 5KFRA 5ALKA 1F44A 2WAQF 1KBUA 3IRUA 1ZQYA 4KX5A 2OM6A 5ALXA 1SV4A 3ZI4A 4I2CA 2DL0A 2B21A 4ED1A 4DF8A 2G06A 4R8UA 3TAPA 1ZQAA 4CDGA 1K1QA 4B9TA 2K4IA 2BQRA 5J29A 4KLFA 1U9LA 2BDPA 4ECXA 2BQ3A 4NLGA 2G5HB 4R64A 3SQIA 2JEGA 2H3ZA 4C8LA 3BS5B 4UAYA 4ELTA 2GLEA 1ZQFA 1ZOLA 4B6JA 4BUGA 5AKYA 3BQ7A 2KIWA 5AK3A 1ZXIA 1TV9A 2ZIVA 4FBTA 1ZJMA 3SAHA 5KNIA 1Z4NA 5C0YA 4Y2RA 2D6FC 2ISPA 4O3NA 5AKXA 5IIIA 3SAFA 4M9JA 2FPKA 2L5YA 1N48A 5AKEA 1S8OA 4IQVA 2V4QA 4F71A 1QTMA 4Z6FA 1NJYA 3OTQA 8ICVA 1JX4A 3H0RB 1SWVA 1ZQKA 4GXIA 1GO3F 2FI1A 3SENA 3IV6A 4QWEA 4QIWF 3M1YA 4QWBA 2HDOA 1BNOA 1XSLA 1JXEA 1S0NA 3ETRA 2EQYA 4KLMA 3RH6A 1WG8A 1L7PA 3T3FA 2DQNB 8ICLA 5AM2A 2ZJAA 2BHNA 5BOMA 2O6KA 3MGIA 4OJLA 4FZMA 2NRTA 4ECZA 2F76X 5KT2A 3SR6A 3FDSA 1QSSA 3N4MB 3AQEA 2KEYA 8ICAA 1V38A 4LJXA 7ICNA 3H8WA 2AGQA 2JEIA 5D46A 2XI9A 4J9LA 3IDWA 1U49A 2KD1A 4I2BA 3M9NB 1FFUA 5KFWA 4F5OA 2VA8A 3AMZA 4Y2JA 1S5LU 5KFAA 1ZQGA 5DB6A 5TZVA 1RXWA 2MU2A 5J2JA 4Y2SA 2LKYA 8ICSA 1ZQVA 4ECWA 1T3QA 4DFMA 3RB4A 3M8SA 5KFTA 9ICEA 3N7SC 1AROP 4P0PA 3MFIA 3JPRA 4RPXA 5ALSA 2JMGA 4J9NA 4LZGA 7ICMA 4ZOHC 2IOFK 4ED8A 2PMZF 2IOFA 4UB3A 5HR6A 3K75D 5ALTA 5DQGA 5EWGA 4UASA 1CUKA 2AHOB 4FFDA 5B66U 4C80A 4UAUA 3ORYA 2ASLA 3UPQA 2HOFA 2IBKA 4KMOB 5KL1B 2RHFA 2W55A 4EYHB 2ALZA 3OSPA 4NM1A 2HI0A 5TISU 3AEVA 3WKAA 4DOBA 3PMLA 1WYGA 3OJUA 1TAUA 5J2KA 2BCVA 2P6RA 5EE3A 1LKYB 3AQFA 3HX0A 1NK0A 2I1QA 4FE3A 4A8EA 3N97B 5JUMA 1NK9A 2LI6A 4KN4A 5KT3A 1MSWD 4I2GA 2QB0B 2C28A 4O5KA 2HVHA 3M9OB 1DGSA 4ECVA 2KSOB 4EBCA 3MBYA 3QUCA 4ICAA 3RJFA 8ICCA 1TKDA 9ICSA 4MFFA 3KHLA 4DLGA 4CNQA 4CCHA 3BJYA 2E3TA 1O08A 2H3FA 4PHPA 8ICZA 5L1JA 1ZQXA 8ICMA 2ZIUB 2HMXA 3MDAA 3RB6A 2XIDA 4TQRA 3EPIA 7ICJA 3I76A 4Z6DA 4QZFA 1S0MA 3BS7A 4C4TA 4OJ6A 2K4EA 2ISOA 3ALRA 1TK5A 4PL1A 3KHRA 4BXOB 8ICWA 3WKBA 9ICWA 4KN7A 1J2MA 4KLUA 4DL2A 4RT2A 1KSPA 3ZDDA 2C22A 2W7OA 3T5KA 3HJEA 5H2FU 1F5SA 2OHFA 4YD2A 3PNCA 3ISBA 3L5KA 1ZQEA 4CGZA 4YR2A 4RUAA 5DG7A 2XC9A 2A1AA 2DPJA 4ACOA 1SGGA 5KT5A 4IC9A 3SAGA 2HVIA 5KFOA 3GV8B 4NXZA 8ICXA 2BGWA 7ICSA 3J81j 3LWMA 5KG7A 3RBDA 1V85A 1KN5A 2W9CB 4QZHA 1ZQLA 1J2NA 5GTHU 4MFAA 3H0LB 5HR7A 4YXMA 2FPMA 1MA7A 2DKXA 2NRVA 2LM1A 3FAHA 3ZDEA 3PVXA 1JALA 2VJ5A 2BCRA 1Q3UA 1ZQIA 7ICKA 5J0SA 4K4HA 3KTQA 2GO7A 8ICNA 2W8KA 1X9SA 4AYBC 2P6UA 5ALUA 4RNOA 3OPXA 1ZQJA 2LYHA 3UXOA 1NI3A 9ICXA 3IM1A 1L7MA 1KKXA 5DDMA 2G0AA 3WK7A 1MC8A 8ICYA 1WCNA 4DEZA 1RXVA 1HEKA 2W43A 4IL6U 5KFSA 2HW3A 2DBYA 2OCEA 5KFDA 9ICFA 4F3OA 4GC6A 2XCAA 3M6ZA 1QLNA 2Y9UA 4KX3A 3PW2A 2KKVA 2BKEA 4P2HA 4I29A 5KFYA 3WK6A 5AI9A 3C5GA 3GIKA 4YR0A 4FBUA 2LM4A 2Y0SC 7ICTA 1T94A 1NK4A 1IG6A 5ALHA 9ICAA 2XCPA 1BPXA 5AIAA 3IG8A 3QU2A 5ALEA 3QEAZ 3F2CA 1JI7A 2VKQA 3KFUF 4Y2VA 1ZRNA 4CE6A 2E5SA 4ELUA 5HHHA 1B43A 4ECTA 2ZIWB 3I1YA 3A0HU 3NUQA 2E8PA 4EYIB 4MHVA 1COOA 4YG2A 4YD1A 3QEBZ 3RF9A 4DWIA 1MN8A 5AK6A 4F4KA 2FJ6A 2MA1A 4UQGA 2RRDA 4QZIA 3C29A 4P4PA 4I2FA 1X66A 2F8KA 1XSNA 3ONNA 2HHXA 1SL0A 4G3IA 5HP4A 3TFSA 5ALDA 2M0NA 3T5LA 5EE0A 4ELVA 1COKA 3CNHA 4NLBA 4QWCA 1RYUA 4RU9A 3GIMA 2AQ0A 2JV3A 4UAZA 1ZQBA 2H3QA 4XQ8A 3Q8KA 5KFVA 3SYZA 5ALRA 4RQMA 4EX7A 2VA2A 2Q4TA 3NVVA 2BPFA 2VA3A 4UB2A 1JIHA 4PGYA 4JV2A 1M6YA 1UHUA 4YMNA 3L4PA 4RNMA 4TUPA 4Y2XA 2AU0A 3D2SA 3R9KA 4UARA 2HHWA 5J2EA 2MUTA 2YMQA 2KJ9A 5KFEA 1SXDA 4RZRA 2EAOA 5F9LA 1X40A 3MR6A 7ICPA 2Z7JA 2YQEA 5KG0A 2HBMA 3E0FA 1SKRA 5ALWA 1ZQCA 2NRZA 1ZQQA 4PJ0U 3MR3A 4P0QB 1N5WA 2LBOA 3SEIA 4KLLA 2N1RA 3KHHA 4J9RA 2C2EA 1ZD5A 5DQIA 4YN4A 2Y9TA 3U26A 2RQ5A 2ASDA 2HHUA 3H4BA 3UQ2A 4DFJA 4Y2YA 5E79U 3RR7A 4EBEA 2KK0A 3RH4A 5J0OA 5KAIU 3OHAA 2EAMA 2LPEA 2G09A 3A0BU 3IHQB 1NZBA 2WF9A 5ALFA 3NVWA 1TAMA 8ICPA 4MEXA 2K60A 2JZBB 3PMNA 5CJ7A 3WKCA 8ICEA 2E8NA 3EWAA 1ZD4A 5ALVA 3GQCA 4RQNA 1SKSA 3RJHA 4Y2TA 5AK4A 2PKEA 3IN5A 5KFCA 4Y2PA 2IOHA 1S77D 5IINA 4FS2A 3QXGA 5J8YC 2A1JB 5ALOA 1RYRA 2XICA 3RFAA 3OHBA 3QU5A 2VJ4A 1S76D 3HRDD 3KKAA 4F5NA 1C7YA 4F91B 9ICJA 3H0MB 3QZ7A 2ZIXA 4F2RA 5J2IA 4QWAA 4F8RA 1ZQOA 4F4ZA 2HHVA 2F1IA 2EANA 3PSIA 1Z19A 1RQNA 3B9JA 5J0PA 5J2CA 4PHAA 5IIJA 1V97A 3UMGA 1QQ5A 2OWOA 5ALQA 5J0UA 2DFLA 5A0LA 4DQPA 7ICOA 2KKPA 1L8OA 3M9MB 8ICIA 2E8OA 3QU7A 4OO1J 2WFAA 1XS9D 1U48A 2A3VA 1O03A 2J6TA 1ZQNA 1NKBA 2KTQA 2BDUA 3D2NA 7ICLA 4QZ9A 1CI4A 1V9PA 5F3XB 1PZNA 4R63A 4Y2UA 1KEJA 1SIJA 4TQSA 5AM5A 3C2LA 2ASJA 1LVHA 1T4GA 1Q3VA 1KQQA 5D49A 1MQ2A 2BR0A 3HKZC 1FO4A 1PVPA 5CHGA 4DS5A 3RH5A 1ZQUA 5KG6A 4KLOA 4QZGA 2W7PA 4R65A 2F2AB 1BPYA 4PZOA 2KICA 5KFQA 4NL9C 2DPIA 1BPDA 3SD7A 1L8LA 4KLIA 2R8KA 3N28A 4USAA 3BDPA 3BQ1A 4US8A 3BZCA 7ICIA 4PPXA 4HAIA 4DQIA 4BGDA 1UT8A 5AKZA 1SV0A 4Q43A 3C23A 3K1RB 1RDFA 3TADC 2F1HA 3M7DA 1QCKA 1L7NA 2G08A 2W3RA 2QARA 4RQ8A 1D8LA 4ECQA 1K1SA 3GZFA 5DGBA 4DLEA 3D6JA 4IQTA 4JMUA 3H4DA 4UB8U 5DG9A 3ZD9A 5AI0A 1K5OA 2WB1C 3ED5A 2PXIA 3DDHA 3OJSA 2DF4B 2HOQA 3UMCA 2ZXIA 1N61A 1PVQA 3RJKA 3HW8A 4ED7A 2FMPA 2UVUA 5CR0A 3MR5A 2EH9A 3FC4A 1NJWA 4F5RA 4FS1A 1U4BA 4JV1A 4ED3A 2XY6A 4C0ZA 2K4PA 4M6WA 5J0YA 2KHVA 5EOZA 1QSYA 1WCLA 2AH5A 3H8SA 3QU4A 3RB3A 2I9GA 3GIIA 3VCBA 8ICHA 5KFNA 1NKCA 9ICCA 3BQ2A 5KT4A 4UATA 4NY8A 3BZKA 3T5JA 5AKLA 3NVZA 1RQLA 2WF7A 2G07A 2PFNA 2F8LA 4GFJA 4RT3A 3RTVA 2H3IA 3MC1A 4J03A 1QSLA 3HILA 2KMDA 2NO5A 1UA0A 4O3OA 2EZYA 2ZTCA 3WK4A 2RDIA 1X9XA 2NRXA 8ICFA 1ZETA 2BCSA 3B0XA 4GC7A 4ECSA 2R8HA 1N5XA 3LYSA 2W9BA 2W8LA 2BCUA 1KTQA 3T5HA 2KHQA 4IS7A 1KL9A 5JRTA 4DS4A 4QNLA 5DKWA 7ICUA 3UMBA 2OEHA 3GV7B 5J2BA 4ZH4A 3TAQA 4UB5A 1PK3A 3UM9A 4CF4A 3PW7A 3Q8LA 3DV9A 4UAVA 4G9BA 2LHTA 2HHSA 4B9MA 9ICRA 3CRXA 1J97A 1T8EA 3RRGA 5DB8A 4DL6A 3LVVA 3PW5A 1KRPA 4C4RA 7ICEA 4DSLA 5EE9A 4I28A 4R8UB 1XO1A 4EEKA 4ED6A 1SL2A 2ZTDA 3AM9A 7ICFA 4Q45A 1VDVA 4FZLA 4QZDA 5J0RA 5J0QA 4I2AA 2IMWP 4YVZA 3KZIU 3SI8A 7ICQA 3EUB2 3TQ1A 4C4SA 4QWDA 4DL3A 1UQVA 3V7JA 5HMMA 1YT3A 3NS1A 8ICKA 4YQWA 1IIPA 1HIWA 4NLNA 4U6PA 4E0DA 4JV0A 3HP6A 5BOLA 2K4HA 5KFGA 3TKAA 2AGOA 2BCQA 5HNKA 3JPSA 3GU3A 4F92B 9ICNA 4AYBF 4F50A 3THVA 8ICTA 3EZ5A 2NRWA 3QNMA 2CXYA 3BS5A 4I2DA 5DLFA 5KFBA 1BPBA 1IXRA 3F53A 5ALJA 4J9MA 3EPGA 1QQ6A 1XSPA 5EWFA 5KG1A 2I5HA 4M9NA 3IP4B 2KNJA 3TI0A 3PSPA 4RPYA 2P35A 3AU2A 3ZD8A 2XGPA
chains in the Genus database with same CATH topology
4NJ8A 2E8OA 1PK3A 2E8PA 1PK1A 2Y9TA 4MHVA 1WWVA 1F0MA 2F3NA 3SENA 1RG6A 1V85A 2F44A 1OW5A 1B4FA 1KW4A 1PK1B 1X66A 2EAMA 2F8KA 2LPEA 1Z1VA 5F3XB 2B6GA 1LKYB 2DKXA 1COKA 2K4PA 2K60A 1UCVA 2E8NA 4NL9A 1SV4A 1LKYA 2QKQA 2JV3A 2DL0A 4RQNA 1OXJA 2QB0B 1V38A 4RQMA 2KSOB 1UQVA 4PZOA 3IDWA 4NL9C 2KE7A 5JTIA 5J8YC 2QB0A 3KKAC 4PZNA 3TADA 2KSOA 3H8MA 3HILA 2D8CA 3BS5B 2KMDA 5J8YA 2GLEA 2Y9UA 1SV0C 2QB1A 3KKAA 2D3DA 3BQ7A 2ESEA 5L1MA 3BS7A 1X9XA 2QARB 1SXEA 1SV0A 3BS5A 5KNIA 3K1RB 5JU5A 1SXDA 2E8MA 3TADC 2FE9A 2KG5A 1B0XA 2EAOA 1X40A 2YTUA 3TACB 2EANA 2QARA 1WWUA 4IS7A 1DXSA 1JI7A 5JRTA 2L5YA 2ES6A 2KIVA 2EAPA 3SEIA 2DKZA 2LMRA 1SGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  2E8O A;  1PK3 A;  2E8P A;  1PK1 A;  2Y9T A;  4MHV A;  1WWV A;  1F0M A;  2F3N A;  3SEN A;  1RG6 A;  1V85 A;  2F44 A;  1OW5 A;  1B4F A;  1KW4 A;  1PK1 B;  1X66 A;  2EAM A;  2F8K A;  2LPE A;  1Z1V A;  5F3X B;  2B6G A;  1LKY B;  2DKX A;  1COK A;  2K4P A;  2K60 A;  1UCV A;  2E8N A;  4NL9 A;  1SV4 A;  1LKY A;  2QKQ A;  2JV3 A;  2DL0 A;  4RQN A;  1OXJ A;  2QB0 B;  1V38 A;  4RQM A;  2KSO B;  1UQV A;  4PZO A;  3IDW A;  4NL9 C;  2KE7 A;  5JTI A;  5J8Y C;  2QB0 A;  3KKA C;  4PZN A;  3TAD A;  2KSO A;  3H8M A;  3HIL A;  2D8C A;  3BS5 B;  2KMD A;  5J8Y A;  2GLE A;  2Y9U A;  1SV0 C;  2QB1 A;  3KKA A;  2D3D A;  3BQ7 A;  2ESE A;  5L1M A;  3BS7 A;  1X9X A;  2QAR B;  1SXE A;  1SV0 A;  3BS5 A;  5KNI A;  3K1R B;  5JU5 A;  1SXD A;  2E8M A;  3TAD C;  2FE9 A;  2KG5 A;  1B0X A;  2EAO A;  1X40 A;  2YTU A;  3TAC B;  2EAN A;  2QAR A;  1WWU A;  4IS7 A;  1DXS A;  1JI7 A;  5JRT A;  2L5Y A;  2ES6 A;  2KIV A;  2EAP A;  3SEI A;  2DKZ A;  2LMR A;  1SGG A; 
#chains in the Genus database with same CATH topology
 2Y0S F;  5L1L A;  2XY7 A;  2YB1 A;  2BPG A;  2F3N A;  1KLN A;  5T14 A;  1JRO A;  3PO4 A;  2F44 A;  1ZQD A;  5ALL A;  4UB1 A;  4RQ0 A;  4P4M A;  5AHX A;  4O5C A;  4F4X A;  4YXJ A;  3AN1 A;  5CWR A;  3TAR A;  3LDA A;  4IRD A;  3BQ0 A;  4K4G A;  1UCV A;  2JXJ A;  5G5H A;  4NL9 A;  2KOB A;  4DL4 A;  5KT6 A;  3F2D A;  1DRG A;  4M47 A;  4PHD A;  3L3F X;  3WK8 A;  3Q8R B;  2CN1 A;  2V9W A;  1TE2 A;  2W3S A;  2W11 A;  4J9K A;  5AM1 A;  4XA5 A;  4TUR A;  4BWM A;  4YFK A;  2ZUD A;  4IR1 A;  3LWL A;  1ZQM A;  1ZD3 A;  4KLH A;  3ETL A;  4J9P A;  3TAD A;  3LVW A;  3C2K A;  3H8M A;  1JUD A;  3QX7 A;  1HUO A;  2PFQ A;  1X6J A;  3PR4 A;  2QB1 A;  2GH1 A;  3H8J A;  2M9N A;  4MEY A;  2RP5 A;  3MGV A;  3HT3 A;  5KT7 A;  4EEY A;  5KFK A;  4NLC A;  4P0P B;  3C5F A;  1QQ7 A;  1X9W A;  5J2H A;  4F5Q A;  2WF6 A;  2XGQ A;  4RQ5 A;  5DBB A;  3V6J A;  4M9G A;  9ICV A;  1X6I A;  4IQW A;  2PFP A;  1SB3 C;  4QW8 A;  2FDR A;  5IIO A;  4I2I A;  4O3Q A;  2R8J A;  2J6S A;  1KFD A;  2HBK A;  2LMR A;  4ECR A;  5J0W A;  5CP2 A;  4RQ2 A;  3JPQ A;  1F0M A;  3C21 A;  3QYP A;  1FEZ A;  1Z1B A;  3KD3 A;  2QLT A;  8ICQ A;  4C8O A;  1ZQW A;  4M9H A;  1PK1 B;  3I28 A;  3NRZ A;  1XC9 A;  3C28 A;  4BX9 C;  1OUQ A;  2ZTE A;  1NK5 A;  2JHD A;  1LV5 A;  5ALI A;  2IHN A;  4TUS A;  5KL8 B;  2HHT A;  9ICB A;  5DB9 A;  4FO6 A;  4DFP A;  2HSZ A;  1LKY A;  2QKQ A;  2AJQ A;  4BWJ A;  5KFJ A;  4UBC A;  3TFR A;  3WKD A;  4DOC A;  2ZUB A;  2UVW A;  7ICV A;  1UA1 A;  1NK7 A;  2JGA A;  2YMP A;  1TK8 A;  3RJJ A;  4O3R A;  4YR3 A;  5JTI A;  2QB0 A;  2C2R A;  1A0P A;  4HYK A;  9ICM A;  9ICO A;  5K4L A;  3GFK B;  5J2A A;  4JWM A;  5FP0 A;  4M9L A;  2KSO A;  4LVS A;  2D8C A;  5ALM A;  4PGX A;  5CRX A;  4I2H A;  3PZP A;  3OSN A;  2WF5 A;  1VLB A;  5AKJ A;  2HBJ A;  3PW0 A;  2ZIU A;  4M04 A;  1S0O A;  4PHE A;  5L9X A;  2OH2 A;  4NLZ A;  1JN3 A;  2PFO A;  3F5A A;  5L1K A;  5CB1 A;  1NK8 A;  1L3V A;  4WJ3 B;  2JRZ A;  4BXO A;  2HCF A;  1NOM A;  3QZ8 A;  1AQ6 A;  2KVC A;  5AKH A;  2EAP A;  1X42 A;  7ICH A;  2C2D A;  1NJX A;  1A76 A;  9ICT A;  2WAQ C;  9ICI A;  5AM4 A;  2YML A;  3MAB A;  4OJP A;  2ODG A;  1Z00 B;  4C8N A;  3WKE A;  2IA6 A;  4JWN A;  5AIB A;  4YMM A;  1T3N A;  1N60 A;  3NTU A;  1HJP A;  4GIB A;  3M6K A;  3PST A;  5J2G A;  1FIQ A;  5EWE A;  2W9C A;  1VJ5 A;  4O3P A;  1ZYQ A;  3F2B A;  3S6J A;  2MRL A;  3RR8 A;  3JPP A;  3C1Z A;  1L3S A;  4PL2 A;  1S97 A;  2NYV A;  2VAN A;  4KTQ A;  3D2Q A;  5DB7 A;  4NV0 A;  1S10 A;  1ZD2 P;  3NAS A;  5AI5 A;  4M0A A;  2J6U A;  2K8C B;  3PW4 A;  4C7Y A;  5KFZ A;  5DBC A;  1RZT A;  1DK3 A;  5KFP A;  4QZB A;  3SV4 A;  2CPR A;  4DQS A;  2KN7 A;  3HKZ F;  4DO9 A;  1NKE A;  1SZP A;  2EDU A;  2W04 A;  4DQR A;  2HHQ A;  4EX6 A;  1ZQR A;  4DF4 A;  3K4G A;  2KP7 A;  3WK9 A;  3TAN A;  5GTI U;  2JEJ A;  4YP3 A;  1UT5 A;  2NO4 A;  3NVY A;  1KDH A;  3RAQ A;  4MF2 A;  3V7L A;  5J0T A;  3ZDC A;  4QIW C;  5DGA A;  2MSN A;  1ECW A;  4EZ6 A;  4CF5 A;  4B9N A;  5AI8 A;  5AKI A;  1UPH A;  2NV3 A;  4YCX A;  5IIM A;  1EXN A;  1TFR A;  5AM0 A;  1ZQT A;  4NWI A;  1YZ7 A;  2ZIW A;  1BPE A;  3F5E A;  3E2E A;  2KFZ A;  2E1E A;  4QZC A;  1KW4 A;  4EBD A;  5DLG A;  4C8K A;  4DSF A;  1Y88 A;  4QW9 A;  2KV2 A;  1N2X A;  2ZJ8 A;  2HOI A;  2WB1 F;  4DQQ A;  2OXO A;  3ZDB A;  4XRH A;  2I6X A;  2AXT U;  4RQ7 A;  1D8Y A;  1Q8K A;  9ICK A;  4DFD A;  3H40 A;  4C8M A;  3KZX A;  1TAQ A;  5AI6 A;  3HPO A;  4F2S A;  4KLE A;  1ZQH A;  1L3U A;  4KLT A;  4PH5 A;  4JK1 A;  1ZRM A;  1A77 A;  3MFH A;  2KE7 A;  3V6H A;  4Z6E A;  3O0F A;  2AGP A;  5EE1 A;  3KHG A;  4F4W A;  2FLP A;  3JPO A;  7ICG A;  2YMM A;  5F9N A;  4KIT B;  2UVR A;  1FFV A;  5C5J A;  2K8A A;  1NJZ A;  2MUT B;  2P66 A;  4R66 A;  3M8R A;  4XUS A;  1SZH A;  2D3D A;  2ESE A;  3PO5 A;  1JRP A;  5J2F A;  4OJ5 A;  2XVT A;  2PMZ C;  4J9Q A;  1B22 A;  1H38 A;  2Y1J A;  2KFN A;  4FZN A;  2KG5 A;  1ZQZ A;  3SMV A;  9ICQ A;  2YB4 A;  3FYH A;  2DUY A;  1U47 A;  9ICG A;  2KZM A;  3OGU A;  8ICB A;  1DXS A;  2ZG6 A;  1BNP A;  3RJI A;  1Z4O A;  4B9U A;  4IR9 A;  2XO7 A;  2KIV A;  1L3T A;  3H7I A;  5J0X A;  2GWS A;  3EW9 A;  1IM4 A;  2JH7 A;  4OJO A;  1PK1 A;  3KOO A;  1S9F A;  2WTF A;  4P0Q A;  3QE9 Y;  1L5U A;  1D8B A;  2OYY A;  1RG6 A;  2ZUC A;  1D9D A;  3LK9 A;  4OD0 A;  4CRX A;  2DWQ A;  8ICR A;  4RNN A;  5KFU A;  1OW5 A;  3G6X A;  2EZX A;  3G6V A;  3RBE A;  5AK5 A;  4ECY A;  2FPL A;  1XWL A;  3RRH A;  2KZ3 A;  4RQ4 A;  9ICP A;  4QZE A;  5BPC A;  3KBB A;  2F77 X;  3V7K A;  4DL7 A;  2K8B B;  2GOL A;  2LYA A;  1PVR A;  1L6N A;  2XY5 A;  4O3S A;  8ICU A;  2W9A A;  4RQ3 A;  4EEN A;  3MGH A;  5D4B A;  4QZ8 A;  3T79 A;  4Z6C A;  1DGJ A;  1OXJ A;  1SL1 A;  3E58 A;  4IRK A;  2JZB A;  4KLD A;  5ALP A;  4KLG A;  5IIK A;  3EYZ A;  1C20 A;  5KG3 A;  4I2E A;  1ZJN A;  3N7R C;  4UW9 A;  1XU4 A;  4NLK A;  5KFH A;  1JXL A;  1T7P A;  2JH1 A;  1X2I A;  3KKA C;  5DQH A;  5ALZ A;  2BPC A;  4BJQ A;  4Q8E A;  2ZIX B;  4K4I A;  3VC8 A;  5J8Y A;  4UB6 U;  3QUT A;  3Q8S B;  4O9M A;  1X9M A;  3SV3 A;  2A1J A;  5KG2 A;  4I2J A;  2RLT A;  1SXE A;  3MDC A;  2LYB A;  3QUB A;  1ZQ1 C;  3N7P D;  1N56 A;  2V4R A;  2FE9 A;  5KFX A;  4GLX A;  5AKG A;  5KAF U;  4F4Y A;  4DSI A;  3GIJ A;  2W9M A;  2ZIV B;  4KMU A;  3ZDA A;  4GXJ A;  4U7C A;  2YN4 A;  8ICO A;  1S0V A;  4DSE A;  3Q8Q B;  2ES6 A;  2B0C A;  1PUZ A;  9ICH A;  1Z00 A;  1Z3E B;  2HBL A;  4F5P A;  4OCZ A;  1CRX A;  4O5E A;  1L7O A;  2EZZ A;  5CEH A;  1DK2 A;  2K89 A;  2ZXH A;  1NZP A;  2ZJ5 A;  4TUQ A;  3JPT A;  3ISD A;  1DOQ A;  3Q8M A;  4US9 A;  3GDX A;  2FMS A;  2KZZ A;  1B4F A;  1A6S A;  1Z1V A;  5KFI A;  4KLJ A;  5DBA A;  2IHM A;  2Q0Z X;  1KFT A;  1ZQP A;  4KLQ A;  5ALN A;  4B9S A;  3PX4 A;  4C7Z A;  8ICJ A;  5ALG A;  1TVA A;  2VIX A;  3AU6 A;  2JEF A;  4UB4 A;  2DGZ A;  2KVS A;  4KLS A;  1Q46 A;  3HWT A;  5AKK A;  7ICR A;  1RYS A;  2Y1I A;  3GIL A;  5G5G A;  4RQ6 A;  3MR2 A;  2W54 A;  5J2D A;  3V72 A;  4PZN A;  1IV8 A;  2W03 A;  1QH9 A;  2A19 A;  3C2M A;  4J9O A;  4JB3 A;  1MQ3 A;  3ISC A;  4DFK A;  4BDP A;  4P4O A;  3PX0 A;  1SV0 C;  2H3V A;  2WHE A;  4I27 A;  4ED2 A;  3PX6 A;  5L1M A;  2MAX A;  3RB0 A;  2QAR B;  3PR5 B;  4LZD A;  2ATL A;  4UBB A;  1TK0 A;  5JU5 A;  5HML A;  1B0X A;  4JUZ A;  2YTU A;  4Q44 A;  2JR5 A;  4J9S A;  8ICG A;  2FLL A;  9ICL A;  3Q8P B;  5KTQ A;  3FM9 A;  1D9F A;  1N63 A;  3K1Z A;  5B5E U;  5KG5 A;  4RPZ A;  3AUO A;  2FMQ A;  3JPN A;  3BQT A;  4MF8 A;  2KJ8 A;  2WF8 A;  4DCC A;  5KFF A;  1NNL A;  4NM2 A;  3DEE A;  1WWV A;  2CRX A;  1BGX T;  1ED1 A;  1U45 A;  2R18 A;  4QZA A;  3QUQ A;  1RM6 C;  4M6W B;  2PI5 A;  5HHI A;  2R8G A;  1CEZ A;  2PI4 A;  2B6G A;  4Q8F A;  4O0I A;  1RPL A;  3IG5 A;  1HUZ A;  3V6K A;  3WU2 U;  3NRW A;  4UAW A;  2G5I B;  4RQ1 A;  5AIC A;  5DG8 A;  4Y2Q A;  4CF3 A;  2UVV A;  5CA7 A;  4QJF B;  2AQ4 A;  3PSF A;  1WUD A;  2R8I A;  3WK5 A;  4B9V A;  1P7D A;  4ECU A;  4RUC A;  1ZQS A;  1JMS A;  2FLN A;  3RJE A;  4B9L A;  4F72 A;  1URJ A;  5KFM A;  3PY8 A;  4EEL A;  5AI4 A;  2H5X A;  2F1J A;  1XNS A;  3CW2 C;  3UQ0 A;  4PGQ A;  9ICU A;  1BVS A;  5AM3 A;  4ED0 A;  4X5V A;  3C1Y A;  4M2Y A;  2W9B B;  3ICX A;  5KFL A;  3GV5 B;  2KJ5 A;  4DSK A;  4EZ9 A;  2E8M A;  3RAX A;  4F93 B;  3TAC B;  3CYM A;  2RDJ A;  4O3M A;  1WWU A;  4DSJ A;  2BZF A;  1BPZ A;  1N62 A;  4IRC A;  3B0Y A;  3SZ2 A;  3G6Y A;  2YX8 A;  2DKZ A;  5KG4 A;  3UXN A;  1NK6 A;  5ALY A;  2YY6 A;  4NJ8 A;  3UXP A;  1XO0 A;  4YMO A;  4MFC A;  4IQU A;  1KFS A;  1YZ6 A;  3QU9 A;  4DOA A;  4DL5 A;  2BQU A;  1SWW A;  3PV8 A;  2E1F A;  5IIL A;  1SKW A;  4GXK A;  1LB2 B;  4AP9 A;  5L1I A;  3CP8 A;  3RJG A;  3AL0 B;  3NGD A;  5DDY A;  5KFR A;  5ALK A;  1F44 A;  2WAQ F;  1KBU A;  3IRU A;  1ZQY A;  4KX5 A;  2OM6 A;  5ALX A;  1SV4 A;  3ZI4 A;  4I2C A;  2DL0 A;  2B21 A;  4ED1 A;  4DF8 A;  2G06 A;  4R8U A;  3TAP A;  1ZQA A;  4CDG A;  1K1Q A;  4B9T A;  2K4I A;  2BQR A;  5J29 A;  4KLF A;  1U9L A;  2BDP A;  4ECX A;  2BQ3 A;  4NLG A;  2G5H B;  4R64 A;  3SQI A;  2JEG A;  2H3Z A;  4C8L A;  3BS5 B;  4UAY A;  4ELT A;  2GLE A;  1ZQF A;  1ZOL A;  4B6J A;  4BUG A;  5AKY A;  3BQ7 A;  2KIW A;  5AK3 A;  1ZXI A;  1TV9 A;  2ZIV A;  4FBT A;  1ZJM A;  3SAH A;  5KNI A;  1Z4N A;  5C0Y A;  4Y2R A;  2D6F C;  2ISP A;  4O3N A;  5AKX A;  5III A;  3SAF A;  4M9J A;  2FPK A;  2L5Y A;  1N48 A;  5AKE A;  1S8O A;  4IQV A;  2V4Q A;  4F71 A;  1QTM A;  4Z6F A;  1NJY A;  3OTQ A;  8ICV A;  1JX4 A;  3H0R B;  1SWV A;  1ZQK A;  4GXI A;  1GO3 F;  2FI1 A;  3SEN A;  3IV6 A;  4QWE A;  4QIW F;  3M1Y A;  4QWB A;  2HDO A;  1BNO A;  1XSL A;  1JXE A;  1S0N A;  3ETR A;  2EQY A;  4KLM A;  3RH6 A;  1WG8 A;  1L7P A;  3T3F A;  2DQN B;  8ICL A;  5AM2 A;  2ZJA A;  2BHN A;  5BOM A;  2O6K A;  3MGI A;  4OJL A;  4FZM A;  2NRT A;  4ECZ A;  2F76 X;  5KT2 A;  3SR6 A;  3FDS A;  1QSS A;  3N4M B;  3AQE A;  2KEY A;  8ICA A;  1V38 A;  4LJX A;  7ICN A;  3H8W A;  2AGQ A;  2JEI A;  5D46 A;  2XI9 A;  4J9L A;  3IDW A;  1U49 A;  2KD1 A;  4I2B A;  3M9N B;  1FFU A;  5KFW A;  4F5O A;  2VA8 A;  3AMZ A;  4Y2J A;  1S5L U;  5KFA A;  1ZQG A;  5DB6 A;  5TZV A;  1RXW A;  2MU2 A;  5J2J A;  4Y2S A;  2LKY A;  8ICS A;  1ZQV A;  4ECW A;  1T3Q A;  4DFM A;  3RB4 A;  3M8S A;  5KFT A;  9ICE A;  3N7S C;  1ARO P;  4P0P A;  3MFI A;  3JPR A;  4RPX A;  5ALS A;  2JMG A;  4J9N A;  4LZG A;  7ICM A;  4ZOH C;  2IOF K;  4ED8 A;  2PMZ F;  2IOF A;  4UB3 A;  5HR6 A;  3K75 D;  5ALT A;  5DQG A;  5EWG A;  4UAS A;  1CUK A;  2AHO B;  4FFD A;  5B66 U;  4C80 A;  4UAU A;  3ORY A;  2ASL A;  3UPQ A;  2HOF A;  2IBK A;  4KMO B;  5KL1 B;  2RHF A;  2W55 A;  4EYH B;  2ALZ A;  3OSP A;  4NM1 A;  2HI0 A;  5TIS U;  3AEV A;  3WKA A;  4DOB A;  3PML A;  1WYG A;  3OJU A;  1TAU A;  5J2K A;  2BCV A;  2P6R A;  5EE3 A;  1LKY B;  3AQF A;  3HX0 A;  1NK0 A;  2I1Q A;  4FE3 A;  4A8E A;  3N97 B;  5JUM A;  1NK9 A;  2LI6 A;  4KN4 A;  5KT3 A;  1MSW D;  4I2G A;  2QB0 B;  2C28 A;  4O5K A;  2HVH A;  3M9O B;  1DGS A;  4ECV A;  2KSO B;  4EBC A;  3MBY A;  3QUC A;  4ICA A;  3RJF A;  8ICC A;  1TKD A;  9ICS A;  4MFF A;  3KHL A;  4DLG A;  4CNQ A;  4CCH A;  3BJY A;  2E3T A;  1O08 A;  2H3F A;  4PHP A;  8ICZ A;  5L1J A;  1ZQX A;  8ICM A;  2ZIU B;  2HMX A;  3MDA A;  3RB6 A;  2XID A;  4TQR A;  3EPI A;  7ICJ A;  3I76 A;  4Z6D A;  4QZF A;  1S0M A;  3BS7 A;  4C4T A;  4OJ6 A;  2K4E A;  2ISO A;  3ALR A;  1TK5 A;  4PL1 A;  3KHR A;  4BXO B;  8ICW A;  3WKB A;  9ICW A;  4KN7 A;  1J2M A;  4KLU A;  4DL2 A;  4RT2 A;  1KSP A;  3ZDD A;  2C22 A;  2W7O A;  3T5K A;  3HJE A;  5H2F U;  1F5S A;  2OHF A;  4YD2 A;  3PNC A;  3ISB A;  3L5K A;  1ZQE A;  4CGZ A;  4YR2 A;  4RUA A;  5DG7 A;  2XC9 A;  2A1A A;  2DPJ A;  4ACO A;  1SGG A;  5KT5 A;  4IC9 A;  3SAG A;  2HVI A;  5KFO A;  3GV8 B;  4NXZ A;  8ICX A;  2BGW A;  7ICS A;  3J81 j;  3LWM A;  5KG7 A;  3RBD A;  1V85 A;  1KN5 A;  2W9C B;  4QZH A;  1ZQL A;  1J2N A;  5GTH U;  4MFA A;  3H0L B;  5HR7 A;  4YXM A;  2FPM A;  1MA7 A;  2DKX A;  2NRV A;  2LM1 A;  3FAH A;  3ZDE A;  3PVX A;  1JAL A;  2VJ5 A;  2BCR A;  1Q3U A;  1ZQI A;  7ICK A;  5J0S A;  4K4H A;  3KTQ A;  2GO7 A;  8ICN A;  2W8K A;  1X9S A;  4AYB C;  2P6U A;  5ALU A;  4RNO A;  3OPX A;  1ZQJ A;  2LYH A;  3UXO A;  1NI3 A;  9ICX A;  3IM1 A;  1L7M A;  1KKX A;  5DDM A;  2G0A A;  3WK7 A;  1MC8 A;  8ICY A;  1WCN A;  4DEZ A;  1RXV A;  1HEK A;  2W43 A;  4IL6 U;  5KFS A;  2HW3 A;  2DBY A;  2OCE A;  5KFD A;  9ICF A;  4F3O A;  4GC6 A;  2XCA A;  3M6Z A;  1QLN A;  2Y9U A;  4KX3 A;  3PW2 A;  2KKV A;  2BKE A;  4P2H A;  4I29 A;  5KFY A;  3WK6 A;  5AI9 A;  3C5G A;  3GIK A;  4YR0 A;  4FBU A;  2LM4 A;  2Y0S C;  7ICT A;  1T94 A;  1NK4 A;  1IG6 A;  5ALH A;  9ICA A;  2XCP A;  1BPX A;  5AIA A;  3IG8 A;  3QU2 A;  5ALE A;  3QEA Z;  3F2C A;  1JI7 A;  2VKQ A;  3KFU F;  4Y2V A;  1ZRN A;  4CE6 A;  2E5S A;  4ELU A;  5HHH A;  1B43 A;  4ECT A;  2ZIW B;  3I1Y A;  3A0H U;  3NUQ A;  2E8P A;  4EYI B;  4MHV A;  1COO A;  4YG2 A;  4YD1 A;  3QEB Z;  3RF9 A;  4DWI A;  1MN8 A;  5AK6 A;  4F4K A;  2FJ6 A;  2MA1 A;  4UQG A;  2RRD A;  4QZI A;  3C29 A;  4P4P A;  4I2F A;  1X66 A;  2F8K A;  1XSN A;  3ONN A;  2HHX A;  1SL0 A;  4G3I A;  5HP4 A;  3TFS A;  5ALD A;  2M0N A;  3T5L A;  5EE0 A;  4ELV A;  1COK A;  3CNH A;  4NLB A;  4QWC A;  1RYU A;  4RU9 A;  3GIM A;  2AQ0 A;  2JV3 A;  4UAZ A;  1ZQB A;  2H3Q A;  4XQ8 A;  3Q8K A;  5KFV A;  3SYZ A;  5ALR A;  4RQM A;  4EX7 A;  2VA2 A;  2Q4T A;  3NVV A;  2BPF A;  2VA3 A;  4UB2 A;  1JIH A;  4PGY A;  4JV2 A;  1M6Y A;  1UHU A;  4YMN A;  3L4P A;  4RNM A;  4TUP A;  4Y2X A;  2AU0 A;  3D2S A;  3R9K A;  4UAR A;  2HHW A;  5J2E A;  2MUT A;  2YMQ A;  2KJ9 A;  5KFE A;  1SXD A;  4RZR A;  2EAO A;  5F9L A;  1X40 A;  3MR6 A;  7ICP A;  2Z7J A;  2YQE A;  5KG0 A;  2HBM A;  3E0F A;  1SKR A;  5ALW A;  1ZQC A;  2NRZ A;  1ZQQ A;  4PJ0 U;  3MR3 A;  4P0Q B;  1N5W A;  2LBO A;  3SEI A;  4KLL A;  2N1R A;  3KHH A;  4J9R A;  2C2E A;  1ZD5 A;  5DQI A;  4YN4 A;  2Y9T A;  3U26 A;  2RQ5 A;  2ASD A;  2HHU A;  3H4B A;  3UQ2 A;  4DFJ A;  4Y2Y A;  5E79 U;  3RR7 A;  4EBE A;  2KK0 A;  3RH4 A;  5J0O A;  5KAI U;  3OHA A;  2EAM A;  2LPE A;  2G09 A;  3A0B U;  3IHQ B;  1NZB A;  2WF9 A;  5ALF A;  3NVW A;  1TAM A;  8ICP A;  4MEX A;  2K60 A;  2JZB B;  3PMN A;  5CJ7 A;  3WKC A;  8ICE A;  2E8N A;  3EWA A;  1ZD4 A;  5ALV A;  3GQC A;  4RQN A;  1SKS A;  3RJH A;  4Y2T A;  5AK4 A;  2PKE A;  3IN5 A;  5KFC A;  4Y2P A;  2IOH A;  1S77 D;  5IIN A;  4FS2 A;  3QXG A;  5J8Y C;  2A1J B;  5ALO A;  1RYR A;  2XIC A;  3RFA A;  3OHB A;  3QU5 A;  2VJ4 A;  1S76 D;  3HRD D;  3KKA A;  4F5N A;  1C7Y A;  4F91 B;  9ICJ A;  3H0M B;  3QZ7 A;  2ZIX A;  4F2R A;  5J2I A;  4QWA A;  4F8R A;  1ZQO A;  4F4Z A;  2HHV A;  2F1I A;  2EAN A;  3PSI A;  1Z19 A;  1RQN A;  3B9J A;  5J0P A;  5J2C A;  4PHA A;  5IIJ A;  1V97 A;  3UMG A;  1QQ5 A;  2OWO A;  5ALQ A;  5J0U A;  2DFL A;  5A0L A;  4DQP A;  7ICO A;  2KKP A;  1L8O A;  3M9M B;  8ICI A;  2E8O A;  3QU7 A;  4OO1 J;  2WFA A;  1XS9 D;  1U48 A;  2A3V A;  1O03 A;  2J6T A;  1ZQN A;  1NKB A;  2KTQ A;  2BDU A;  3D2N A;  7ICL A;  4QZ9 A;  1CI4 A;  1V9P A;  5F3X B;  1PZN A;  4R63 A;  4Y2U A;  1KEJ A;  1SIJ A;  4TQS A;  5AM5 A;  3C2L A;  2ASJ A;  1LVH A;  1T4G A;  1Q3V A;  1KQQ A;  5D49 A;  1MQ2 A;  2BR0 A;  3HKZ C;  1FO4 A;  1PVP A;  5CHG A;  4DS5 A;  3RH5 A;  1ZQU A;  5KG6 A;  4KLO A;  4QZG A;  2W7P A;  4R65 A;  2F2A B;  1BPY A;  4PZO A;  2KIC A;  5KFQ A;  4NL9 C;  2DPI A;  1BPD A;  3SD7 A;  1L8L A;  4KLI A;  2R8K A;  3N28 A;  4USA A;  3BDP A;  3BQ1 A;  4US8 A;  3BZC A;  7ICI A;  4PPX A;  4HAI A;  4DQI A;  4BGD A;  1UT8 A;  5AKZ A;  1SV0 A;  4Q43 A;  3C23 A;  3K1R B;  1RDF A;  3TAD C;  2F1H A;  3M7D A;  1QCK A;  1L7N A;  2G08 A;  2W3R A;  2QAR A;  4RQ8 A;  1D8L A;  4ECQ A;  1K1S A;  3GZF A;  5DGB A;  4DLE A;  3D6J A;  4IQT A;  4JMU A;  3H4D A;  4UB8 U;  5DG9 A;  3ZD9 A;  5AI0 A;  1K5O A;  2WB1 C;  3ED5 A;  2PXI A;  3DDH A;  3OJS A;  2DF4 B;  2HOQ A;  3UMC A;  2ZXI A;  1N61 A;  1PVQ A;  3RJK A;  3HW8 A;  4ED7 A;  2FMP A;  2UVU A;  5CR0 A;  3MR5 A;  2EH9 A;  3FC4 A;  1NJW A;  4F5R A;  4FS1 A;  1U4B A;  4JV1 A;  4ED3 A;  2XY6 A;  4C0Z A;  2K4P A;  4M6W A;  5J0Y A;  2KHV A;  5EOZ A;  1QSY A;  1WCL A;  2AH5 A;  3H8S A;  3QU4 A;  3RB3 A;  2I9G A;  3GII A;  3VCB A;  8ICH A;  5KFN A;  1NKC A;  9ICC A;  3BQ2 A;  5KT4 A;  4UAT A;  4NY8 A;  3BZK A;  3T5J A;  5AKL A;  3NVZ A;  1RQL A;  2WF7 A;  2G07 A;  2PFN A;  2F8L A;  4GFJ A;  4RT3 A;  3RTV A;  2H3I A;  3MC1 A;  4J03 A;  1QSL A;  3HIL A;  2KMD A;  2NO5 A;  1UA0 A;  4O3O A;  2EZY A;  2ZTC A;  3WK4 A;  2RDI A;  1X9X A;  2NRX A;  8ICF A;  1ZET A;  2BCS A;  3B0X A;  4GC7 A;  4ECS A;  2R8H A;  1N5X A;  3LYS A;  2W9B A;  2W8L A;  2BCU A;  1KTQ A;  3T5H A;  2KHQ A;  4IS7 A;  1KL9 A;  5JRT A;  4DS4 A;  4QNL A;  5DKW A;  7ICU A;  3UMB A;  2OEH A;  3GV7 B;  5J2B A;  4ZH4 A;  3TAQ A;  4UB5 A;  1PK3 A;  3UM9 A;  4CF4 A;  3PW7 A;  3Q8L A;  3DV9 A;  4UAV A;  4G9B A;  2LHT A;  2HHS A;  4B9M A;  9ICR A;  3CRX A;  1J97 A;  1T8E A;  3RRG A;  5DB8 A;  4DL6 A;  3LVV A;  3PW5 A;  1KRP A;  4C4R A;  7ICE A;  4DSL A;  5EE9 A;  4I28 A;  4R8U B;  1XO1 A;  4EEK A;  4ED6 A;  1SL2 A;  2ZTD A;  3AM9 A;  7ICF A;  4Q45 A;  1VDV A;  4FZL A;  4QZD A;  5J0R A;  5J0Q A;  4I2A A;  2IMW P;  4YVZ A;  3KZI U;  3SI8 A;  7ICQ A;  3EUB 2;  3TQ1 A;  4C4S A;  4QWD A;  4DL3 A;  1UQV A;  3V7J A;  5HMM A;  1YT3 A;  3NS1 A;  8ICK A;  4YQW A;  1IIP A;  1HIW A;  4NLN A;  4U6P A;  4E0D A;  4JV0 A;  3HP6 A;  5BOL A;  2K4H A;  5KFG A;  3TKA A;  2AGO A;  2BCQ A;  5HNK A;  3JPS A;  3GU3 A;  4F92 B;  9ICN A;  4AYB F;  4F50 A;  3THV A;  8ICT A;  3EZ5 A;  2NRW A;  3QNM A;  2CXY A;  3BS5 A;  4I2D A;  5DLF A;  5KFB A;  1BPB A;  1IXR A;  3F53 A;  5ALJ A;  4J9M A;  3EPG A;  1QQ6 A;  1XSP A;  5EWF A;  5KG1 A;  2I5H A;  4M9N A;  3IP4 B;  2KNJ A;  3TI0 A;  3PSP A;  4RPY A;  2P35 A;  3AU2 A;  3ZD8 A;  2XGP A; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  2E8O A;  1PK3 A;  2E8P A;  1PK1 A;  2Y9T A;  4MHV A;  1WWV A;  1F0M A;  2F3N A;  3SEN A;  1RG6 A;  1V85 A;  2F44 A;  1OW5 A;  1B4F A;  1KW4 A;  1PK1 B;  1X66 A;  2EAM A;  2F8K A;  2LPE A;  1Z1V A;  5F3X B;  2B6G A;  1LKY B;  2DKX A;  1COK A;  2K4P A;  2K60 A;  1UCV A;  2E8N A;  4NL9 A;  1SV4 A;  1LKY A;  2QKQ A;  2JV3 A;  2DL0 A;  4RQN A;  1OXJ A;  2QB0 B;  1V38 A;  4RQM A;  2KSO B;  1UQV A;  4PZO A;  3IDW A;  4NL9 C;  2KE7 A;  5JTI A;  5J8Y C;  2QB0 A;  3KKA C;  4PZN A;  3TAD A;  2KSO A;  3H8M A;  3HIL A;  2D8C A;  3BS5 B;  2KMD A;  5J8Y A;  2GLE A;  2Y9U A;  1SV0 C;  2QB1 A;  3KKA A;  2D3D A;  3BQ7 A;  2ESE A;  5L1M A;  3BS7 A;  1X9X A;  2QAR B;  1SXE A;  1SV0 A;  3BS5 A;  5KNI A;  3K1R B;  5JU5 A;  1SXD A;  2E8M A;  3TAD C;  2FE9 A;  2KG5 A;  1B0X A;  2EAO A;  1X40 A;  2YTU A;  3TAC B;  2EAN A;  2QAR A;  1WWU A;  4IS7 A;  1DXS A;  1JI7 A;  5JRT A;  2L5Y A;  2ES6 A;  2KIV A;  2EAP A;  3SEI A;  2DKZ A;  2LMR A;  1SGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...