4DQRA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 203
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqrA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqrA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqrA01
4NLZA 3RBDA 3OGUA 5KT4A 2HHTA 2OPRA 4E19A 5KI6A 2R8IA 3MXJA 1JLBA 1HJRA 3OYMA 1MU2A 4I2FA 1ZBFA 4QZDA 2YHAA 1T03A 2F1HA 4E7JA 4KHNA 1BCOA 2O4IA 1QSSA 4DG1A 1KVAA 3L2WA 1NOYA 2IS3A 3MECA 3B0XA 1RTHA 3KKRA 1U04A 2LSNA 3OYKA 5J0YA 3O3GA 4RG8A 4NXZA 4TSXA 1S5JA 4FK2A 5KG6A 4O5KA 2F96A 4EBCA 4ED2A 3U3YA 4J9QA 3T1AA 9ICLA 1A77A 2HHUA 3GIIA 1RBRA 3HM9A 3HPOA 3HT3A 3G0ZA 4M0AA 2BCQA 4CFBA 4NCBA 4CEOA 4M3ZA 1A5WA 1T7PA 4KRFA 1C7YA 5TZVA 4MFAA 2OA8A 4BE1A 4ED3A 4P4OA 1TKZA 7ICTA 4KLGA 1UWBA 1QS4A 5BOLA 3C23A 1TAQA 4PGYA 5J0PA 3PR5B 4LSLA 3C1YA 1ZETA 1JXBA 5BOMA 4ICLA 2G8WA 3JPRA 5D46A 4P4MA 3M8RA 3TWHA 5KFLA 3KHGA 1SUQA 4F2RA 1S6QA 4W5OA 5HHHA 1RT5A 3O3FA 1UA1A 1BHLA 4O9MA 4DMNA 3AUOA 3JYTA 2YNFA 3DLBA 5CA7A 4HCBA 2FLPA 2BR0A 4B9NA 3AVHA 2C2RA 3VQ6A 3KHRA 3F73A 4IG0A 1TL1A 5KFJA 3QEVA 4FJ5A 5DG8A 3JSMA 1JXEA 3JPOA 2PI4A 3AVGA 1Z00A 4B9MA 1RNHA 3TAPA 1GOAA 4OKEA 4F4YA 5HMMA 1ZBLA 2IBKA 1RDBA 7ICIA 4DL3A 3ULDA 3JPTA 1RYRA 2UVUA 3V9WA 4O3SA 1ZBHA 1BIZA 1G15A 4FJKA 2BGGA 4LVSA 4E7IA 4F3OA 1NKEA 7ICNA 4TURA 3PO4A 2FBTA 7ICFA 4RW9A 4FLVA 4ID1A 1KFDA 2AQ0A 4YN4A 1LW2A 4M3YA 2IHNA 1HYSA 3AVNA 5DG7A 1S0VA 1SZPA 1SL1A 3H8SA 3N4MB 2KQ2A 4DSKA 4KTZA 1VK0A 4GVMA 2YKMA 3C95A 1IKXA 5KFSA 1XHZA 1TK5A 1JLCA 4CE9A 3QNOA 4HUGA 1RTDA 5J2KA 5KFKA 4YR0A 3RR7A 1RCHA 4ZH4A 4M04A 3Q8RB 2NRTA 3H4DA 2KTQA 1ZJMA 1IM4A 3QIPA 4TUQA 1UOCA 4F93B 5K14A 4Q44A 3C2LA 4CCHA 3JPPA 3MXIA 3V6DA 3THVA 1CZ9A 2PYLA 4KAZA 4YXJA 2R7YA 1ZQYA 4FW2A 1NJXA 3P83D 4BACA 4E89A 4F5NA 2W42A 4RZRA 2ASJA 3HL8A 2ALZA 4M9JA 3MFHA 4EBDA 2PFQA 2FLLA 5J2BA 3RMBA 1L5UA 5L9XA 1NOZA 3OYJA 1TAUA 5D49A 3HP9A 4CHPA 1XU4A 4I2HA 4ECZA 2VANA 1LW0A 4XUSA 1JIHA 3M9NB 5DKWA 5DQGA 4NLGA 4HVJA 4Z6CA 1NK6A 2X74A 1ZQOA 9ICPA 2OPQA 5DGBA 5KG0A 8ICCA 4CJ3A 4TQRA 4BDZA 2FLNA 1S6PA 4KN4A 1RZTA 4FJNA 1HPZA 1X9MA 4Z4IA 4M3XA 1S76D 4F4XA 3H08A 4DL4A 4RW6A 2ISPA 3NH1A 1ZYQA 3Q8PB 2BE2A 4Q0BA 8ICAA 3QEBZ 3QEWA 4ED8A 5J2FA 4RQ4A 3G10A 4J9OA 1VSJA 4UBCA 4N56A 3LP3A 4IG3A 3RJFA 4XQ8A 2BCUA 3P5JA 4MQ3A 1BPDA 3FDSA 3V81A 1T3NA 4E7HA 3S9HA 1T4GA 2BPCA 2XY7A 1SKWA 4MEYA 1U45A 4KKOA 3RRGA 3LWLA 4F8RA 8ICUA 4W5TA 4FJGA 2FPKA 4CECA 5KFOA 1RBVA 2ZUCA 5DLFA 3UIQA 1W0HA 4QW8A 3VA3A 9ICIA 3B6OA 4CJ4A 2PY5A 4CGGA 3T3FA 1ZQUA 4BXOB 1SKRA 4KB0A 3ITHA 4YR2A 2ZUDA 3PNCA 2FC0A 7ICEA 7ICKA 1BGXT 2LYHA 4XA5A 3QEPA 3Q8QB 1REVA 4QWDA 1LB2B 4O3QA 3MGHA 4ELUA 4O5EA 1KTQA 4M41A 1WCNA 3SUQA 3SJJA 4QZHA 7ICQA 4H4MA 3RB3A 4FK4A 4OGCA 2QK9A 2VA3A 1BIUA 4J9KA 4FJMA 4DF8A 1S10A 3HSTB 4CJKA 1TK8A 4Y1CA 1IG9A 1XC9A 3S3NA 2FMPA 2G8UA 5HP1A 7ICVA 5KG4A 4J9NA 4O3PA 4KLSA 3SPZA 1Z00B 3I0SA 4QZEA 4O3OA 1VSFA 3K58A 3B0YA 5DQHA 2RDIA 3VQ7A 1NOMA 3V1QA 3NBPA 2JGUA 3F9KA 4FZZA 3T19A 3OYHA 3DLEA 2ZE2A 2RKIA 4FLTA 2AJQA 5KFHA 1ASWA 5KG3A 3T5LA 3KK3A 2XY8A 4OKJA 4B8AB 4O0JA 2I9GA 4RQ7A 3ZSVA 3MDAA 2ZTEA 2KZMA 3ZSRA 5KFPA 3KD5E 3V7JA 3BQ1A 4RNMA 3QETA 3MFIA 2QKBA 4UAYA 1RT7A 1VSEA 3TABA 3M9OB 3MBYA 4G3IA 3C2MA 2AGQA 4FLXA 5KFCA 2OYQA 1RPLA 3ZSYA 4B8CA 4JV2A 2JEGA 3GV7B 1VSKA 4CJWA 3AU2A 3C5FA 5J29A 4O5BA 4TUPA 4DSIA 3OYNA 2BCRA 3SQ4A 2DY4A 3SQ0A 5J2MA 3RB6A 2PXIA 4CF8A 2VWKA 4AHUA 4QZ8A 4RNOA 2KZZA 1COOA 3VQDA 3BGRA 4DTSA 3ISCA 5CJ7A 5KTQA 3NF6A 8ICHA 5DBAA 3IHQB 4ZHRA 5HRRA 2J6SA 2JEFA 1RYSA 2X6SA 1SL0A 3RBEA 5EOZA 2Z1JA 4DSJA 4KITB 1ZQVA 2P6UA 3NCIA 2R8KA 4I9LA 5KG5A 1ZQFA 1LAVA 4R66A 3HXMA 3NAEA 5JS1A 2ZD1A 1C0TA 8ICEA 1S1XA 5HMLA 2V4RA 4DL5A 3OY9A 3IAYA 1TFRA 4CEZA 1S9GA 5I3UA 3MGIA 1ASUA 4H8KA 2E6LA 3AV9A 5DB8A 1U47A 5IILA 3VQ8A 5KRSA 1NK5A 4RPZA 4DSFA 2P1JA 4KLMA 5HRPA 4DQPA 7ICHA 4NCGA 3AU6A 5CZ1A 5KGWA 4KLIA 9ICVA 3Q8MA 3RJKA 5KFYA 9ICGA 8ICSA 3QO9A 4FLUA 3G6YA 3AO3A 4FS1A 1Z26A 4ZTFA 2W9MA 3ZD9A 1EKEA 2KW4A 4AHRA 4M3TA 3OS0A 1WCLA 3FFIA 2P6RA 1TL3A 1RT1A 2M9NA 3HP6A 4QZCA 2HNDA 9ICRA 4IFYA 1ZQCA 1KSPA 4Q45A 3GV8B 3DLKA 4CK2A 4ECTA 1A5XA 3EWAA 4F91B 1WNSA 4N76A 3PMNA 3GV5B 4YD1A 4KREA 4RQ0A 5KFZA 1ZQHA 3DYAA 4MFBA 5J2JA 4M9NA 4RQ1A 4CK3A 1WLJA 3V9ZA 1I3AA 3UXPA 4CJFA 4R63A 8ICOA 4J9RA 4CF9A 4JWMA 3WNHA 4CHQA 4ELTA 4RQ3A 4QWCA 1JKHA 2E6MA 4W5RA 3IRXA 3NTUA 3HVRA 1QLNA 8ICYA 3KK1A 5IIKA 5KT5A 2DTUA 5SWMA 4CHOA 4OLBA 3MDCA 2ZTCA 4Z6DA 2HHSA 4DEZA 4CJSA 3BDPA 3HYFA 1A76A 4EP5A 4IQTA 2P51A 3NGYA 2Y1IA 3VQQA 4M2YA 3SNNA 1C1AA 3RJJA 3RMCA 4XIUA 3OYFA 4NM1A 2GUIA 4JLHA 5CWRA 2ISOA 7ICUA 4BE0A 2G8KA 3RJGA 3SUOA 2XRIA 1HYZA 3P1GA 3LDSA 3LPTA 3TI0A 2BHNA 3U3GA 3IG1A 4CJLA 4E3SA 4KHYA 2A1RA 4IR1A 1X1PA 1LV5A 2VWJA 3S3MA 1NK0A 9ICNA 1Z3EB 1BISA 8ICTA 3RWUA 4NY8A 3VQBA 4ED0A 3AA5X 2FBXA 5DBBA 2NRZA 2NUBA 2A1JB 1PZNA 4DFKA 2G8FA 4KI4A 3OYLA 1NKBA 3T5KA 4CIFA 9ICMA 1HRHA 2DPIA 5IIMA 3ZD8A 3AVMA 4H4OA 1ZQIA 3OSNA 4ED1A 1VRUA 1WSHA 4F4ZA 4CJUA 4F4WA 3SPYA 2W8KA 4LD0A 3MR6A 5J0TA 9ICWA 5DGAA 3GIKA 1DOQA 3OYIA 1NJWA 4FLZA 4I2QA 2ASDA 3ZCMA 1BPXA 5HROA 1N5YA 3H8WA 2RPIA 3ISDA 1BI4A 3GIMA 3KJVA 4YD2A 1QHTA 5KFUA 2W9CB 1V9PA 1B9FA 4I2AA 4YNQA 3ZT1A 3NGIA 5J2IA 4ELVA 4UAZA 4IQVA 4FBTA 4OJRA 2VG6A 3UXNA 1L3UA 3OVNA 4KV8A 1JN3A 1EXQA 4AILC 4ECRA 1U48A 2XY6A 3SI8A 4DTRA 4DOAA 3KK2A 3C5GA 5D4BA 4UAWA 1RDAA 3G6XA 3PW5A 3LAKA 2DFFA 1ZQSA 4CEEA 3TAFA 4G1QA 4FVMA 2FBVA 4KPYA 1HUZA 3ZDBA 1ZQJA 4E7LA 4J2EA 3L2UA 1BPEA 5KFBA 4UB1A 3ASMA 2X78A 1S1TA 4KHUA 3BJYA 3AVIA 4CEQA 5C5JA 3PVXA 2HNYA 3MR5A 5F9LA 3RRHA 4M9HA 4B3OA 4P2HA 4KLEA 5CZ2A 4Z6EA 5FDLA 2BDPA 2ATLA 5DK5A 2WONA 1BPBA 4CFDA 3VQAA 4KLLA 2VG7A 4IFVA 4M42A 3DLGA 4NM2A 7ICSA 4I2EA 1Z25A 3QEIA 3H4BA 4DTUA 2HNZA 4HYKA 3LZJA 3M8SA 3I0RA 1SKSA 1T05A 1B92A 3IM1A 1XHXA 3SUNA 1XSPA 2IAJA 2PFPA 4RW7A 2BGWA 4FJLA 5CR0A 1NK8A 1CEZA 2D0BA 4DL7A 2HB5A 2YHBA 1NK9A 3TR8A 1TVRA 4AH9A 1J5OA 5BPCA 4Z4CA 5KRTA 3C94A 3QE9Y 4FO6A 1ZQPA 3ALYA 5DB6A 3KLFA 2IDOA 4I9QA 4E0DA 2W9BB 3K2PA 3ZDDA 4YFUA 4FS2A 1DTTA 3RMAA 3ORYA 1FKPA 3ZSOA 1ITGA 4K4IA 4UBBA 3HK2A 4DWIA 2GBZA 3KLGA 2PI5A 3V9UA 1SV5A 1NK4A 3ZDAA 5J2PA 7ICMA 3AVJA 3DLRA 3RJEA 2RF2A 3OJUA 1ZBUA 2ASLA 1O1WA 4KMUA 1LWCA 4FM2A 1NJZA 3NF9A 4LZGA 3PO5A 4RUCA 4CFCA 3AVBA 1TKDA 3SQ1A 4R8UB 2WTFA 2JZBA 3PR4A 3VQEA 3O4QA 3GILA 4OLAA 4KHSA 3U6FA 4J2BA 3QZ7A 4MFCA 3OHBA 2IHMA 2HHQA 4M3UA 1GOBA 5HNKA 1S0NA 3CFOA 4CIEA 4K4HA 4RPYA 8ICXA 4J2AA 9ICQA 5CHGA 4F3TA 3C2KA 4CJRA 3O3HA 5KT3A 3LDAA 2D5RA 3VA0A 4KI6A 4YP3A 4CJTA 1HUOA 1IO2A 9ICCA 4KLDA 4DQQA 4JRPA 3K5MA 2HHWA 4Z4EA 2F8TA 4QAGA 4BXOA 4HTUA 2JEJA 5KFVA 4ECSA 1MQ3A 5KGXA 1XI1A 4FZXC 2W9AA 4ECWA 4Z4HA 2OPPA 3K59A 2MAXA 3EY1A 3OYEA 5DBCA 1TKXA 4PGXA 3CFPA 4DOBA 3RB4A 2VG5A 8ICNA 3EPGA 4K8XA 2AQ4A 4AHTA 3OYGA 4DLEA 3TQ1A 3QERA 3ZSZA 4BDYA 4CF2A 2BQ3A 3AO2A 3LALA 1X9WA 4UB4A 1ZBIA 1HJPA 9ICOA 3AO1A 1NKCA 3TFSA 8ICBA 4DFPA 2G8IA 2YNGA 1L3SA 4I28A 3ZT0A 1XS9D 3RAXA 2P5OA 4O55A 1BCMA 1FK9A 3ETLA 4I7FA 3M9MB 4M45A 9ICHA 4CEFA 3C1ZA 3L8BA 4MEXA 9ICKA 5KFDA 4CF0A 2XHBA 3KLHA 4YCXA 5KFXA 4R64A 3CQ8A 2C2EA 4FM1A 2QXFA 5IIIA 4I2JA 1XSNA 4FXDA 3VQCA 1IKYA 2JZBB 1AROP 3HJFA 4ECYA 5EWEA 3L2RA 4F4KA 4RU9A 4BGDA 1J9AA 3QNNA 3E01A 1D8YA 3TFRA 3TARA 4O44A 7ICRA 3TAQA 3Q8LA 8ICLA 1ZQGA 1U49A 3DLHA 4BDPA 1HQEA 2W8LA 4E1NA 3AA2A 3AVLA 3NE6A 1CXQA 4TQSA 1ZQXA 1Q9XA 1H38A 4GXIA 3OJSA 3NF7A 5HBMA 4FLYA 8ICRA 3SI6A 1VSHA 4DU4A 2IC3A 3QEXA 4DTNA 2W9BA 3HPHA 3PW0A 4EZ9A 3TAGA 5CY4A 1IKWA 4QW9A 1EX4A 4F50A 4FJHA 3QLHA 3MEEA 4RQ5A 3SYZA 4DSLA 5J0RA 5DLGA 2KN7A 1QTMA 1SL2A 1JX4A 2PFOA 1B22A 3ZT2A 3K4GA 1BQNA 1C1CA 1C1BA 1K1QA 1S0OA 3A2FA 4KLJA 3RAQA 4CJVA 1IXRA 2BPGA 1TV9A 3ZDCA 1S97A 1KLNA 8ICQA 4QWBA 3CM5A 4K4GA 5KG2A 2FPMA 4CEDA 5SZTA 3UXOA 1MSWD 5FRMA 2HHXA 4LSNA 4HHTA 1L3TA 4QZFA 5KFTA 3RTVA 5DQIA 4X5VA 5HRSA 4C8LA 2Q0ZX 4XRHA 4BE2A 3O4NA 3WNEA 4PHDA 1S9EA 1YVUA 1B9DA 4KN7A 4M47A 1RT2A 4GC6A 4I29A 3C6TA 4C8KA 8ICWA 8ICGA 3TAMA 4DOCA 5HHIA 1DGSA 5F9NA 4DU3A 2I5JA 4B9TA 1XWLA 3HW8A 4EYHB 4F5PA 4KLHA 1WSEA 4Q5VA 1JLFA 1RXWA 2DPJA 9ICFA 2XGPA 4JWNA 9ICSA 3CG7A 4I2CA 4NLKA 3LK9A 4AHVA 5KFFA 5KT6A 2G8HA 3H7IA 4GLXA 3ZT4A 1ZQAA 1S1VA 1ZQZA 3V6HA 5EU7A 3LZIA 4N47A 4F5QA 4FJ9A 7ICGA 3BQ0A 1MQ2A 3OS2A 5J0UA 1N6QA 2XGQA 4W5NA 4HUEA 1ZQLA 1XO1A 4GXJA 3DOLA 4RQ6A 3DRSA 4E1MA 3LP1A 4ECXA 2DFLA 2V4QA 1S0MA 3EZ5A 4M3WA 4Y1DA 1UA0A 3MR3A 3QESA 2E4LA 3V7LA 1GOCA 5J2DA 3Q8SB 1RTIA 4BWMA 1DLOA 4CHYA 3BQ2A 3B6PA 2AGPA 4IRDA 2ZJAA 3RMDA 2HMIA 4ED7A 3MEGA 3V9SA 4PUOA 3MEDA 4PH5A 1ZQQA 1Y88A 3HO1A 1N56A 3K5NA 4J9MA 5IIJA 4MFFA 2XC9A 4DS4A 3PX0A 1BPZA 3QIOA 4KHQA 4NYNA 4F5RA 3DI6A 3QINA 3AVAA 3EPIA 4CIGA 3CFRA 4FJ8A 2AU0A 1KFSA 2GWSA 4KB1A 4M3RA 8ICJA 1RTJA 1YT3A 4UQGA 4YMOA 1QE1A 4IDKA 4F92B 1TGOA 3TAEA 5C24A 1RDDA 3BQTA 5J0XA 4O3NA 4DL6A 2X6NA 4FJ7A 5E41A 4ECQA 4DTOA 4Z4GA 4O0IA 1TK0A 4CJPA 3LAMA 3KIOA 5JUMA 4J9SA 4O3RA 2F8SA 1KRPA 2BQRA 3ZSQA 5KFQA 4JV1A 1K1SA 2HW3A 2Z1HA 4DSEA 1LWEA 2ZJ5A 4Q8EA 1C0MA 3ZT3A 3RH6A 3RB0A 1ZQTA 4YQWA 5J1EA 3GFKB 5DDYA 4KTQA 1EETA 9ICTA 2B4JA 2BQUA 4TUSA 1ZQKA 5L1IA 1ZQNA 2XCPA 5DMRA 4KLTA 3MAQA 2OPSA 4HCCA 2RDJA 5FROA 1QSYA 1RILA 1EXNA 3V1RA 4KHWA 1WAFA 2RN2A 3V72A 2DFEA 1ZJNA 1RT4A 1KFTA 1JLGA 2EX3A 1RT6A 3HPGA 2B5JA 4EZ6A 5KFAA 1DTQA 3PX6A 1I39A 3ZSWA 3H8JA 1VRTA 3SV3A 4YVZA 4RQ2A 4JS4A 8ICVA 3NFAA 3VQ5A 3LWMA 4UB2A 3PW2A 2YKNA 3E2EA 1S77D 1BPYA 5J2QA 1ZQBA 4KLQA 2QKKA 4CF1A 2BCSA 4PHPA 5HP4A 2I1QA 9ICEA 4KLUA 4FK0A 2ZJ8A 5J2CA 2YNIA 3K75D 4J9LA 4DFMA 1WSGA 4KLFA 3DMJA 4Q43A 4DQSA 1WSFA 1S1UA 4OGEA 4F2SA 1FXXA 1VSIA 4DQIA 3H40A 2KFNA 1J54A 1BVSA 3T5HA 8ICIA 1HYVA 2H5XA 2MUTB 5KFWA 2A1JA 4CGIA 3HVTA 3OYAA 3M8QA 4CJQA 4AHCA 4DF4A 4C8NA 1JXLA 4CFAA 5CP2A 4Z6FA 1Q8IA 4YMNA 1JLAA 2R8HA 2NRXA 1L3VA 3PY8A 3EYZA 3QEAZ 5EWFA 1FKOA 2ITGA 3DM2A 5KFEA 2Z1IA 4QZAA 3V6JA 3DRPA 3KD1E 2PZSA 4HUFA 1ZQRA 1X9SA 1JMSA 4CEAA 3SV4A 4E7KA 1NK7A 4PGQA 3K5LA 4FM0A 2BKEA 3OYCA 4CJ5A 3KKSA 1UAXA 4QCLA 1WN7A 4QZBA 3ISBA 4JRQA 5KT2A 2F1JA 1CUKA 1ZQEA 3VQ9A 4DQRA 4MF2A 2BPFA 3AVKA 1CLQA 4M6WB 3L3VA 4CEBA 3UQ0A 4FJXA 4PA1A 2IOCA 3NF8A 1WSIA 2B21A 7ICPA 2PFNA 4RT2A 1CXUA 1VSMA 4DU1A 4GW6A 7ICOA 5KFRA 3NDKA 4UB3A 4IRKA 1ZQWA 4CGFA 1KDHA 4OPKA 3GQCA 4IRCA 4PHEA 2A1SA 1BQMA 4KLOA 4CK1A 2OZSA 3UQ2A 4DS5A 1W9HA 4I2DA 4KFBA 9ICAA 1YTAA 3ZDEA 2HVHA 7ICJA 4YXMA 2P66A 5L1JA 3WNGA 4I2BA 1D5AA 4W5QA 3LANA 2P5GA 4QZIA 1RBUA 2IMWP 3SZ2A 3DOKA 5KFGA 5DB7A 1S9FA 3OYBA 7ICLA 4C8OA 4QWAA 3RH5A 5KFMA 5DG9A 3AA4A 3N97B 5T7BA 3M8PA 4KTWA 2V9WA 3KHLA 3TANA 4DTXA 2Z1GA 1A5VA 1KVCA 3OYDA 2PYJA 1KVBA 2YNHA 4DLGA 3KTQA 4RW4A 4N41A 5DB9A 4UB5A 1QSLA 2FPLA 1ZQMA 2JEIA 1EP4A 4GMJB 1TVAA 1BL3A 3GDXA 5CB1A 3GIJA 4M9GA 5HLFA 2J6TA 1HQUA 3JPSA 5KG1A 4O4GA 5J2NA 4JK1A 1N48A 5HRNA 4R5PA 2O4GA 3EW9A 4B9VA 3K5OA 4Z0UA 4DTJA 2DFHA 4GXKA 3OS1A 4RUAA 2HHVA 1T8EA 5J0WA 3AO4A 2FBYA 3VQPA 5D3GA 3NH2A 5KFNA 2JLEA 3UPQA 4JS5A 1KEJA 1UT5A 3PX4A 4ECUA 5C42A 3LP2A 5J2AA 4RPXA 2XCAA 4JV0A 4B08A 3D0PA 2GV9A 4PHAA 4FLWA 2KFZA 3PV8A 2HVIA 4QZ9A 3MR2A 2D0AA 5KG7A 2MUTA 5C25A 2FMQA 5CYQA 2F1IA 5J2HA 2R8JA 4O5CA 2ATQA 3LP0A 4KO0A 3RH4A 2R8GA 3KLEA 3NHGA 2ZUBA 3PUFA 3C21A 5L1KA 4B9SA 4LH4A 5IINA 8ICZA 1K6YA 4Q8FA 4FZYA 3SUPA 8ICPA 2EHGA 5JS2A 2C28A 4CGHA 4NYFA 3PW7A 4C8MA 1VSDA 4RW8A 2OZMA 1X2IA 3NH0A 2UVVA 5KT7A 3RR8A 3C6UA 4WE1A 3VQ4A 4Z4FA 4K8ZA 2YV0X 3Q8KA 4CGDA 1R0AA 5KFIA 4CESA 4DTMA 3SCXA 3G6VA 4B9UA 4YFKA 4AHSA 3QZ8A 3IS9A 1U4BA 2IA6A 3KLIA 4DFJA 5J0QA 4P4PA 5DDMA 2G8VA 1D9DA 1TV6A 2ZQBA 4RQ8A 1J53A 4M6WA 3ISNC 3MABA 1RXVA 4OPJA 1WAJA 1Q9YA 4NLNA 3AVCA 2VA2A 4LY7A 4ZTJA 1TKTA 8ICKA 2ZTDA 1JL1A 1XSLA 3AVFA 2OWOA 4IQWA 2WOMA 5CYMA 3L2QA 3AO5A 2W9CA 1QQCA 3PW4A 4CERA 4NCAA 2XY5A 4MF8A 1CZBA 1BI4B 1UT8A 1WSJA 2C2DA 2BCVA 1JLQA 1B43A 2J6UA 1LWFA 4ECVA 2KZ3A 2Y1JA 2ETJA 3ZSXA 1D9FA 3I8DA 4F5OA 4YMMA 9ICUA 3V1OA 1JL2A 4IKFA 3AA3A 4LZDA 4M9LA 4EBEA 4ID5A 4L8RB 9ICBA 3NGZA 4PQUA 2D0CA 4OKKA 4PY5A 4N5SA 4PWDA 4EEYA 2Q3SA 4I2IA 3K57A 1HMVA 4FJJA 4OVLA 4LH5A 3HX0A 5I42A 3S3OA 2B6AA 3L3UA 3OHAA 4FW1A 1HNIA 1VSLA 3JPNA 4EP4A 5EWGA 4B9LA 4FBUA 4I2PA 2C22A 4RNNA 3D45A 3T5JA 4I2GA 4CJEA 3V7KA 5J0SA 4IBNA 4IQUA 1D8LA 4CHZA 1KLMA 1JLEA 4QOZB 3JPQA 1U9LA 3VN5A 4GC7A 4I27A 3NGDA 1IKVA 4YG2A 9ICJA 3DRRA 3CM6A 5J2EA 4J2DA 4DO9A 4DTPA 1ASVA 3PMLA 4FJIA 3WNFA 2IGIA 1IH7A 1Y97A 3CYMA 3SQ2A 1ZQDA 4CHNA 2AGOA 4PPXA 4QZGA 3V6KA 4YR3A 4ED6A 3RJIA 4QWEA 1MC8A 1NJYA 2FMSA 2UVWA 1S1WA 2VA8A 1HNVA 5L1LA 1RBTA 5J0OA 2BANA 5IIOA 4EYIB 4JUZA 5J2GA 1RBSA 4IR9A 3HWTA 3FYHA 9ICXA 4R8UA 2NRWA 4BWJA 4RT3A 2UVRA 1YTUA 4J9PA 2XO7A 4CGJA 4R65A 1RT3A 1F21A 4FCYA 3V9XA 3L2VA 3KHHA 8ICFA 2NRVA 5FRNA 3OSPA 3LPUA 1LAWA 1C6VA 1RDCA 3V4IA 3RJHA 3MXMA 1C0UA 8ICMA 4DL2A 4FYDA 1KCFA
chains in the Genus database with same CATH superfamily
3RBDA 4DR2J 1HBMA 4MMOA 5GMKa 1YITS 2OPRA 2CNOB 2QFJA 3MXJA 2BM0A 3TOQA 1WHYA 1HJRA 3NVKA 2RQ5A 2YNGB 4QZDA 2W43A 2F1HA 4E7JA 2UXBK 4MYUA 1CRXA 3QT7A 4I6YA 1M1KT 3I56N 2O4IA 1QSSA 2WF5A 3QT6A 3MECA 5IM0A 3CVKA 3SMSA 1RTHA 5EOYA 4BR9A 3KKRA 1PJ6A 2J9EA 1GO3F 2W2QP 3OYKA 2EFOA 1QHAA 3UNYA 1CULB 3NWGA 1PYOB 4OI2A 1X4BA 4TN2A 2CQHA 5DJBA 2F96A 4EBCA 4ED2A 2OJ3A 3NNAA 1QQOA 4J9QA 3U3YA 3T1AA 3W5YA 4B1ZA 2KP7A 3SFUA 3VEWA 4DV3J 5A2QU 5IM0B 4YDUC 3GIIA 2HK3A 5B0GA 2I7PA 1BD6A 3ZZZA 2EVZA 3HT3A 4IZ9A 3G0ZA 2WB1C 2BCQA 2P9PB 4Y2UA 4CFBA 2FJEB 3TSPA 4CEOA 3W2WB 4BCAA 3CC7N 1O13A 1C7YA 2OA8A 3ET6A 3DLKB 4KLGA 3W3DA 4BJQA 2CPFA 2H5JB 3ID8A 3C23A 2WBNA 3DGPA 5E0OA 2VODA 3D4JA 2WK4A 5BOMA 3KJFB 4KHPJ 1VJ5A 2HFUA 3MMBA 4EU0A 2YCHA 3L4IA 3TWHA 3MMVA 2VJ4A 4F2RA 3ZZ0A 5GIOA 3O3FA 1UA1A 1BHLA 4NCGB 3AAQA 2FLPA 2BR0A 1QZ6A 1BHNA 1L7PA 1JJCB 4LVOP 3KJVB 1ZTTA 4N8OA 3RRKA 1IBKJ 2NYIA 4BC7A 4ITSA 4LRDA 2W03A 3AVGA 3F0NA 4B9MA 1LEOA 1GOAA 2CJXB 1VRQC 2Y8YA 4F4YA 3U1NA 3CC7S 4Z94A 1VC5A 1ZBLA 1MLAA 1NWKA 2MU2A 4FZMA 2V5HG 3MMAA 3H42A 3V9WA 3F2BA 4O3SA 2K1RB 4MH8A 2BGGA 4LVSA 3NRBA 7ICNA 3PO4A 1FFUA 1N5VA 4RW9A 4FLVA 4ID1A 3G71N 4YN4A 1LW2A 3MMCA 2IHNA 2IRYA 3WKEA 2NYVA 3D66A 4KGMA 4U7BA 2DBYA 4WFYA 4F36A 5B5EU 2XMKA 1SL1A 2VG7B 3BEGB 3KWIA 1X42A 2MRLA 3IDHA 4JV5K 4CM0A 3N4MB 2ZM6F 4B1XB 1ATNA 2KQ2A 4X64K 2R7RA 1XHZA 3DLLL 1Y3JA 2LEBA 1VQ6S 1UVIA 3MEEB 1RABB 1RTDA 3VERA 1KQKA 4ZH4A 1NJIT 4M04A 3Q8RB 2OEJA 3UKUB 4X4PA 4G1QB 2R2UA 2KVQE 3GZFA 4C0ZA 4F93B 4A8YA 4Q44A 4M8LA 3C2LA 3AJ1A 3KK2B 3EZWA 3MXIA 3KUEA 4DN0A 1HW8A 5BRDA 2D7SA 3P83D 4BACA 1EP4B 3ELHA 2W42A 5C24B 1FTCA 2ASJA 2UYTA 1IV8A 2XZWA 4ZVSB 3MFHA 2PFQA 3KDNA 1OO0B 4JKAA 5J2BA 1BNOA 3FFKB 4X62F 1E6VB 2KD1A 5D49A 3HP9A 4CHPA 1XU4A 4JYAJ 2VANA 1LW0A 4ED5A 4KHPF 4HVJA 4Z6CA 2LDIA 2DXEA 2OPQA 3IO1A 1FD2A 4TQRA 2BZFA 4IOXA 1NG9A 4KN4A 5HP1B 1Y64A 2EANA 3DXBA 1HPZA 2P9KA 1YIJS 2QFIA 1S76D 1VQ5S 3H08A 1ZBTA 4RW6A 2FHOB 3DXMB 4ED8A 3DDIA 1CC8A 4J9OA 1DTTB 4ERDA 3IXQA 1CJUA 4LF6J 4N56A 3I76A 4IG3A 1W26A 4IUFA 1PYTA 1Z19A 2JWNA 3TRGA 5GINA 3I55N 5GAGI 3TEGA 1T4GA 2BPCA 2ALYB 2XY7A 2YNHB 3T7ZA 1U45A 5LMNK 4LSNB 2F9DA 1YTYA 1FJEB 4CECA 1KQGB 1RBVA 5KAFU 2ZUCA 4C8YA 2FJBB 9ICIA 1R8AA 2BJ9A 4CJ4A 1DHMA 1FRMA 1KC8T 5F0WA 1ZQUA 1SKRA 3EZUA 3FRZA 2DNZA 1R0CB 3QJPA 1HQ2A 2XMVA 2FIUA 4XA5A 3RAMA 2WONB 2MZJA 7AT1B 5IQ6A 3CQXA 7ICQA 5GMEA 2ZOFA 4FK4A 4OGCA 3LH2S 3W8GA 2VA3A 4LF2A 5F3ZA 2E5LJ 4JD2A 4FJMA 2E2OA 1MG7A 3QB0A 4TXSA 3CO9A 2E88A 2KKHA 4CJKA 1XNQK 1IG9A 1CQNA 4UUXA 4BRCA 4MDAA 3S3NA 2FMPA 2G8UA 5KG4A 2LXFA 4NLXA 1YSJA 2HQCA 3HF5A 2G09A 2L48A 3LQVA 4IQXA 3VESA 4O3OA 3K58A 4PXDA 2FZCB 2VV5A 1NOMA 3CCJS 2R7XA 7FDRA 3IAM9 3T19A 3HHLD 3DLEA 2G9OA 4KH5A 4ISGA 1JMTA 4ISFA 2ZH5A 3M1YA 3MDFA 3T1YK 1ASWA 3B4DA 3N7RC 3DMJB 1KEKA 4RQ7A 3MDAA 3G96A 3ZLJA 3BQ1A 2CJAA 3J7A1 1SPBP 4JI2J 1Q81T 3MFIA 4H5TA 1G6BA 2EG2A 4UAYA 3M9OB 4EGLA 3KLGB 4B1WB 3N5BA 5KFCA 1A0OB 5IWAJ 3VVUA 4ETXA 3DRRB 1DT9A 4AM7A 3BREA 1FKOB 1MWKA 1S6UA 5AJ3F 3ILOA 4MLEA 4Y3CA 4PKDB 5EE3A 4QPXA 3SQ4A 2B5JB 3SQ0A 3C2PA 1P8ZA 1IVZA 2VWKA 1WBBA 4USKA 1VRUB 1KVKA 3VQDA 4I1TA 3ISCA 3J8AA 4OX9K 3NF6A 1DEJA 3ENOA 2J6SA 2AWZA 2JEFA 2E7WA 2IVNA 3KHYA 3VGKA 1R31A 4QYRA 4JI7K 5EOZA 2Z1JA 2X51A 2ERRA 2O3DA 2AEJA 1SB3C 5F0UA 4F71A 2LVWA 1ZQFA 1PILA 3NAEA 4ZPWR 3ET6B 3WKBA 1AYEA 1UJ6A 5SUHA 2KH9A 1VDHA 3TPQA 5AK4A 2FVRA 2V4RA 3UNGC 4ZOHC 3UDLA 1U8SA 1TL4A 4CEZA 3MGIA 2HIYA 3AJ2A 2L41A 2VU5A 2ZIUA 5DB8A 1FNOA 1PCAA 2P9NB 5AHXA 1KQQA 4YS2A 3ZETA 2XSFA 2JX2A 4QIVA 4DSFA 4A8SA 5L39A 1UW9A 5LJ3Y 1RAEB 2P1JA 4FWOA 3SD7A 4DQPA 7ICHA 5AFUA 4FWMA 3U4LA 3HHLB 1OH7A 3Q8MA 3D6MB 4F0MA 5KFYA 1CJTA 1T44A 4GKKK 2YMMA 2QW9A 3AO3A 4FS1A 3G9CA 4ZTFA 4M5JA 3FSIA 3ZD9A 3M7VA 1ZAWA 2AT1B 2P6RA 2MJNA 1RT1A 1FW6A 9ICRA 2HFOA 1A5XA 1N88A 1S57A 3DOKB 3KDOA 2GW8A 4LFCK 4HEA9 2NPIA 2W01A 3FBFA 2YHXA 4YD1A 4RQ0A 4M5KA 4E1JA 1ZQHA 4MFBA 2F76X 4GMKA 4M9NA 4RQ1A 2DIVA 4CK3A 3QT8A 1IQTA 3FGUA 2FDNA 2RAQA 3ZZRA 3V9ZA 4C97A 2AKWB 5A8KB 2NR0A 3A0BU 1KN5A 3H98A 8ICOA 4J9RA 3WNHA 4QWCA 1JKHA 5EDWA 3R2DJ 4W5RA 2W41A 3NTUA 3GE1A 1QLNA 3MMJA 3EDQB 3KK1A 2ZH6A 4MO4A 1IJJA 5HVFA 1T05B 2DPNA 3I0RB 4Y0FA 4Z6DA 4JI5F 2GZOA 2IRXA 5I4MA 4EP5A 1VJWA 2FDRA 5ETMA 3AOCA 2KMDA 3NGYA 1OUQA 2Y1IA 5AQMA 3RMCA 2ADCA 2QO3A 4Z2XA 3LDOA 5G5HA 3I9ZA 2VGMA 4LFBJ 7ICUA 1P1LA 3LW5C 1NMNA 2W3RA 2LM4A 3D3CJ 3SUOA 2XRIA 2WF7A 1FJGK 4YOYA 1KP6A 2CJKA 2P9UB 1RSCA 4CJLA 4E3SA 2A1RA 3CJ1A 1JLAB 2VWJA 3P31A 1BISA 1UWAA 2MA1A 1E6YA 2FSNA 4ED0A 4KH0B 2FBXA 1XBWA 3Q2SC 4A4JA 2G8FA 5GAGP 2A40A 4I68A 9ICMA 4KGXB 3Q22A 1HYSB 4HDHA 4H54A 3ZZYA 1L6NA 5ALDA 2V9KA 5FDLB 4DKWA 4YY3J 1VRUA 3BGOP 5BR8J 2J8AA 3EUB2 3TKAA 1Q5VA 2WVFA 1JLFB 4DR6J 2VYPA 1IBKK 2VD3A 3GIKA 3OYIA 3GR0A 2CQ4A 4JYAK 5FLXU 4V19X 2ASDA 4HI2A 3C6TB 2K3KA 3MCSA 1BPXA 4JK9A 5CQGA 3BS5A 2FUG9 5AKJA 2KDOA 2RPIA 2D1CA 3FUYA 1FVQA 1ZH5A 4YD2A 4BVOA 1B9FA 1TVRB 4JI1J 3WXMB 3MM6B 3WEEA 1TL7B 1WWUA 3R8EA 2DO4A 2QI2A 1F3VA 2XWXA 2C3UA 5IWAK 5BPLA 2MPUA 2MMYA 1AZSB 3WK8A 1S12A 3EVWA 4KV8A 5GAEI 3JXOA 1JN3A 4B6JA 4HR2A 4PWUA 4CLZA 5HQMA 5IZHA 2XY6A 2UP1A 2J0XA 1HI8A 4IYQA 3D2EB 4KMOB 4IFVB 4DTRA 4JKEA 2QL5B 4WK3A 3KKFA 1N32K 4FZNA 1RDAA 4DCCA 5AKLA 3G6XA 1RA6A 3R1HA 1TUVA 4Q2MA 5LMUJ 3LAKA 2XI2A 2Z2LA 2ZNZA 3TAFA 2JLFA 2FSKA 2FBVA 2UXBF 2FHKA 2P9LB 2ZJRL 4E7LA 4QS7A 2E1MC 4UB1A 2UXDK 3ASMA 1H7WA 3PG9A 2YWGA 5C5JA 4FP9A 4Y2PA 5F9LA 2B9EA 1PAEX 5F8GA 2OTJN 4P2HA 4CI0B 3GOIA 4KLEA 2KNJA 4H4OB 4KH1B 2WONA 4CFDA 2K06A 2CQPA 3R5JB 3NG8A 4C11B 2UUAJ 3CCVN 3D7SB 3IBFB 2VF3A 3I55S 1Z25A 3VGTA 4DTUA 3M8SA 2HYIB 2ODGA 3MUVP 1R8BA 2Y9HA 4ZOSA 2L9NA 4IH7A 3TTDA 3QU5A 4F04B 3C29A 3UE2A 1B0VA 3TR5A 5CR0A 1EO1A 1CEZA 4NASA 4DL7A 1B7FA 3B4MA 1NK9A 5E84A 3TR8A 4AH9A 3BF3A 2C2ZB 4QPTA 5BPCA 2VJVA 3K2YA 5A8RB 3C94A 5BRHA 5EVZA 4FO6A 1ZQPA 3ALYA 5DB6A 2IDOA 4I9QA 2HWTA 3EGZA 1DTTA 3J81U 1ITGA 4XDDA 3G6EN 4ZP8A 2GO8A 4CQ1A 2GBZA 4JKGA 3OL9A 3RFAA 4WFXA 4KYZA 4LF1A 1UMJA 2M8DB 4JI2F 4KC5A 2P9KB 3UWTA 6AT1B 4LIWA 2YNFB 4KMUA 2ZJRQ 1GLEG 3ZZUA 3NF9A 3BF4A 3AVBA 1HL6A 5F8JA 2IFXA 4EENA 5K8NA 2JZBA 2D3DA 1TKXB 3PKYA 4L73A 5AI5A 2ZUGA 3QZ7A 2GWJA 2IHMA 5HOOA 1GOBA 1RTHB 3JAMU 2R42A 2RF2B 3HRDD 3CFOA 3THTA 3RGIA 4PZVA 1H72C 1ELOA 3VA0A 2D5RA 3TADC 4KI6A 4CJTA 5KNIA 1HUOA 4KPCA 9ICCA 1TR0A 4DQQA 2DNQA 3Q8VA 1KDNA 4U95A 2QSWA 4QAGA 1CS4A 3GJRB 3K17A 1F1BB 4ECSA 5LMUF 2CRXA 3EM1A 3CNHA 4FZXC 2QYCA 2DR6A 5A76A 4JK7A 3K59A 2MAXA 2QLBB 3OYEA 5DBCA 3P45B 4B3RK 2F3NA 1ATRA 4YHHJ 1P90A 2Z2MA 4OHYA 8ICNA 3ULEA 4H0VB 2WAQC 4CBXA 2RRBA 4LF6F 3LDPA 3OVAA 2BQ3A 3LALA 3QUQA 4Z7YA 9ICOA 2GHPA 4P0QA 4DFPA 2HBRB 4YHHK 5AM0A 2G8IA 2BJ3A 4HHHA 1XS9D 3UW1A 4DPXA 3OUYA 4CNYA 2PEBA 3L7PA 1FK9A 1BCMA 3ETLA 2QWMA 1X4AA 9ICHA 1ZXOA 3PFOA 1TYQB 3GFZA 1JJ4A 3CJ0A 2KFYA 4CF0A 2MKIA 4YCXA 5KFXA 3CQ8A 5G4DA 2QXFA 5BR8F 2RUSA 3P38A 2RD5C 3CCZA 2YKQA 1IKYA 2HHHF 3BGFA 4ECYA 2H3QA 2D8CA 2KSOA 1B0PA 3QNNA 3E01A 2WSCC 2CPRA 1PUZA 2ROEA 3TAQA 3Q8LA 8ICLA 3H20A 2D3OR 2E20A 2VOPA 2KT3A 1SC1B 1WSRA 3QBXA 4BDPA 2V94A 3QSIA 1KHVA 1XERA 3AA2A 4TQSA 1H7XA 3ILIA 1ZQXA 2EZZA 5LY3A 4GXIA 2OPSB 3OJSA 5ALLA 1F60B 4XH5A 1NCLA 2C3YA 4DU4A 5A8WB 4PZOA 2IC3A 4BRDA 4EZ9A 1U1LA 5AE2A 3BZCA 4BRMA 3M30A 4DR4F 3QXGA 3HHEA 3BBBA 1EX4A 4YB5A 2E2PA 2F7VA 3QLHA 2ZD1B 4UOCA 3IP0A 4RX6A 1FIQA 5J0RA 4RWXA 5DLGA 1KQSR 3EL2A 2APOA 1BQNA 2D74B 1Q7YO 3A2FA 2ZH3A 2BPGA 1TV9A 3ITHB 2IM3A 8ICQA 4NMXA 1VHIA 3QRQA 4C4SA 1HPMA 4I64A 4MAKA 1QE1B 2P5VA 3SXLA 1BQNB 3ULHA 2MYFA 3TX8A 1B4SA 4OYPA 1UFKA 2HURA 4OYXA 2CRLA 5ADZA 2F8MA 4C8LA 5BPNA 4PHDA 4ZN3A 4KN7A 3CC4N 3FMWA 1RT2A 2EQYA 4CF4A 4Y65A 8ICGA 3VF6A 5F9NA 5LMUK 4DU3A 1I94J 5M1OA 2AMCB 1WSEA 1RXWA 4RTFD 2XGPA 3Q8UA 9ICSA 5ALSA 4C6AA 4OX6A 4I2CA 1XMQF 2IJRA 2IJNA 3BS9A 5KFFA 3Q8YA 3H7IA 4GLXA 2VASA 2UUCF 1RAJA 3J81O 5DDQC 1JK9B 5AIBA 5EU7A 3CETA 1XTZA 2R2TA 4L3NA 1MQ2A 3OS2A 1ZA1B 4P72A 1XO1A 1FFGB 3N79A 1XIQA 1DAXA 4CYUB 2NREA 3ZNUA 2DFLA 1EX8A 3EZ5A 4A8EA 4CVNE 1UWBB 5L46A 4YDXA 5M1KA 3CJRA 2MQQA 3TZWA 2E4LA 1HBOB 3V7LA 3Q8SB 4K4UA 3TZZA 3OFGA 5CZXA 1DLOA 4X4UA 4DR7F 2RLTA 3BQ2A 5BR8K 3PIPL 3ZO7A 2E44A 3D0HE 1U7LA 5BREA 4ED7A 2WZ1A 3A5OC 1U1RA 1UP1A 2EFQA 2YQEA 1ZQQA 4ZVGA 1SQEA 2X1FA 2BRLA 1N56A 3BO3A 1ED1A 4ANEA 4U7UD 5C10A 3G82B 2XC9A 3THWB 1BPZA 1M90O 4PJ0U 4F5RA 2XYGB 3AVAA 3AD9C 5T41A 1CPZA 1FI4A 3CFRA 4A59A 3T6BA 2AU0A 2IAJB 1KFSA 4AQYK 8ICJA 1VOMA 4YMOA 5JU5A 4WU2A 4DUYF 4O5FA 4IDKA 4NI2A 2EEYA 3BQTA 2RE1A 3BBCA 4O3NA 5T14A 4FJ7A 1VQMS 5E41A 4ECQA 1DRZA 1VQLS 3HHDA 2BOAA 4O0IA 5DM6L 2DR9A 3KIOA 4O3RA 2F8SA 1VQ8N 5K14B 3HKWA 2IYGA 1B0TA 1YJNN 4PG4A 4R5PB 4UOGA 2KU7A 4EHUA 4Q8EA 4GKJF 2AYEA 3BUZB 3LVVA 3HI0A 4CRJA 1EQ0A 1DK3A 4XPCA 2AYGA 4O8UA 2CQIA 1S5ZA 3EN9A 4TUSA 4KR0B 1JLCB 2XCPA 3MZIA 4KLTA 4CI6A 4HCCA 4LFBK 1OH8A 5LMNJ 2R2RA 1VHXA 1ZPVA 3QU2A 5AKKA 5HK4A 3H5XA 3OW2R 3KKAC 3UMCA 1ZBSA 3H0MB 2CWXA 1FXDA 3IG8A 4OIXA 2FJVA 2Q1NA 3A8JA 2QA4N 3HPGA 3W62A 3PDNA 1NU0A 2MKCA 1DTQA 2E1PA 3PX6A 2YMLA 2PMZD 4NEZA 1VRTA 2ZC3A 3M8YA 1SH0A 5AQTA 3ZTQA 3QMLA 3N6NA 1XMOF 3PYEA 3CIZA 1WF0A 3IFRA 1XMOJ 3I28A 1S77D 4FL9A 4A8OA 1ZQBA 3MTJA 2MEWA 4GVEA 4CF1A 3VGUA 9ICEA 1V9OA 2P6SA 1WSFA 4OGEA 3TUJC 3HHKA 4NL9A 3OA9A 1SUQB 1HYVA 2H5XA 3VGMA 1UHUA 1N33J 2B0CA 3HFKA 2A1JA 2I5HA 1DBDA 3HVTA 4ICLB 3OYAA 1M1KO 2FJWA 5GAHI 2A6AA 1KXPA 5ALUA 4KX3A 5J2MB 3CJ8A 4DF4A 1J5EK 3O3LA 4MKBA 2BX6A 1RE1B 5A0YA 2GVDA 2VBZA 2LMRA 4DV0F 2NRXA 2J9CA 4EIAA 3QEAZ 3JQMA 1NSQA 4GVLA 2A10A 2OHFA 4WQ4A 3DRPA 3VQSA 3KD1E 1U6FA 2W4DA 4LF5J 2PZSA 1IIPA 1REVB 3U9ZA 1ZQRA 1U1PA 1JMSA 2QA4G 2ZXIA 1UTAA 3SV4A 1G2EA 4E7KA 1NK7A 3SK3A 5JXSA 2BKEA 4WXOA 5BPMA 3ZZPA 4JRQA 4NI2B 1T02A 2C2MB 3DXKB 5MLCV 5FP0A 1X3NA 1SJ4P 3L3VA 1REGX 5ALHA 3C8YA 2B21A 5ETVA 4MO5A 3PYDA 3POTB 3OL7A 1H2UX 5KFRA 2F4FA 4NLRA 2NLWA 3SQGA 2FF6A 4K2JA 2OKQA 4M5LA 4GKJK 4IRCA 4O0NA 1UVJA 1IR1A 3QYYA 5E79U 1TKZB 4YOUA 1W9HA 9ICAA 3CJSA 4Y2AA 1D8ZA 3OT9A 2HVHA 3A8KA 3MPVA 1JLBB 2P66A 3R9PA 3WNGA 4FOEA 4NA2A 5AICA 2Y3YA 2A41A 2R7OA 3IGVA 5AQHA 5KFGA 2FHJA 3MC1A 3VF4A 2QKQA 5ETPA 2O66A 3KK3B 4BRKA 3VAMA 3EWGA 3B6BA 3N97B 3EXYA 4KTWA 4UARA 2VBWA 4MKYA 4PYAA 3M05A 2F7TA 1DQ9A 1GMVA 1FEHA 3T6JA 4LF8F 1T0TV 3EX7B 1WF1A 2GV1A 1TVAA 4X66J 4UT4A 2GQCA 1X4GA 4M9GA 3GIJA 3IBWA 1HQUA 1M5HA 3JPSA 3NVMA 1Y9OA 1Y00A 1WWVA 2VC0A 2W6KA 5ETQA 2F4VJ 3OLBA 3KOAA 4OJOA 4R5PA 4J9UE 4Z0UA 4UUWA 2DFHA 4GXKA 1M5VC 1S6OA 4JI7J 3AJDA 4P52A 3NH2A 5KFNA 1AW0A 2HIQA 4JS5A 1KEJA 1UT5A 2CNLB 1RCOB 1KLMB 1E3MA 5IT9U 4IDKB 3H1QA 3UKRB 2E5LK 1PKUA 3NAIA 2GMJA 3OD2A 2HVIA 3MR2A 5T7LB 5B0EA 3HZ6A 4MIAA 3GTYX 1KC8O 5CAAA 4KO0A 2R8GA 5B0BA 5E33A 1RWVB 5L1KA 4B9SA 1FE4A 1K6YA 5EGYA 8ICPA 4WYLA 4DZDA 5ADXH 5JS2A 4JK8A 4CGHA 4Y2IA 4OHWA 1VSDA 2ES6A 4DHVA 1N54B 1Q8LA 1NGFA 3KD3A 2I7NA 2UVVA 4US8A 5KT7A 3RR8A 4ZMMA 2YV0X 4JI0F 4M63C 1B70B 4CGDA 3TUZC 4DR6F 1PVPA 4JI4J 2ZHBA 3QZ8A 3IS9A 1U4BA 1U25A 1CJTB 2ZBRA 5J0QA 4P4PA 2GMHA 5DDMA 3JAMO 1YRTA 2G8VA 1D9DA 3H3OB 1TV6A 2FC8A 2QWOA 1OYDA 5AXMA 1J53A 4M6WA 5DDOC 2IVPA 1K73O 3M1FA 3S8SA 2GIRA 2J9DA 3L9ZA 3A5NC 2QXLA 3SCIE 3Q86A 4C2MA 2VA2A 1F5CA 3E0FA 1G3OA 4CO5A 3UCUP 5D0RA 1XSLA 4P74A 4IQWA 4BROA 3AO5A 4LF9F 3UCZP 4CERA 3AH6A 3CXCM 4HH0A 1BI4B 2BCVA 1Q78A 3QIDA 1ITPA 1OY8A 2AP1A 4M5DB 2J6UA 2W1BA 2MQMA 3MEKA 2AA4A 3ZYYX 4OYOA 2ETJA 2D3O1 3ZSXA 1HKAA 5LJ5Y 4C7ZA 1Q16B 3M32A 3NNCA 1JL2A 3V1OA 2MQ8A 2HQ3A 4PPDA 3H25A 4EBEA 1L8OA 2VOOA 4M5DA 4M7YA 1OWXA 4FPIA 3GLJA 1GEHA 4DQ8A 2Q97A 3D1OA 4BC5A 2KIWA 3FSYA 4FF1A 5AQFA 2B6AA 4WIIA 4B3TF 1SV4A 4FXWA 4XAKA 2QSFA 1VSLA 3OFEA 1N63A 3A8YA 2ZKUA 4DFDA 3M2UB 1A6LA 3I82A 2LEPA 1NAQA 5HMYA 4JI1F 4EO6A 1QUVA 3A5MC 2I6XA 2DYAA 3AGKA 1VQMN 3MUMP 4I27A 2BA9A 4DUZF 9ICJA 1HD1A 3DRRA 2KVSA 2PN6A 3CM6A 5J2EA 3AARA 2PIIA 1H2VZ 4PUOB 4JKHA 1IH7A 1ZQDA 1Z1BA 3TADA 3R5CA 3V6KA 1J2MA 1X9XA 1WG5A 3QFUA 2I0XA 3CPEA 3G25A 4QWEA 1MC8A 2GVZA 3B8HA 4U6PA 3Q89A 4QR0A 2VA8A 2XSJA 1HKGA 1HKBA 5IXUA 2IHR1 1UCNA 1RDFA 5IIOA 4EYIB 2AJ2A 4QIEA 3I4HX 3CD7A 2JOQA 2Z2ZA 2W7OA 3FYHA 3NRWA 2EAPA 2Y0SF 1YI2N 4Q2LA 1X4HA 2KVCA 2B4UA 2CVEA 3QDKA 3TA1A 5ALMA 4RT3A 2UVRA 1YTUA 4QIWF 1IKYB 4CGJA 3V9XA 3ILJA 3KHHA 2MZ1A 3A8EA 1QDUB 2K4HA 2EC2A 2CPEA 3W5XA 1C6VA 4GNIA 1RDCA 3V4IA 2E7VA 1QAXA 4QR1A 1XNRK 3CT9A 4K41A 4LF4J 5ALRA 4NLZA 3IG1B 3J81Y 3BSOA 5EXWA 5KT4A 2DGOA 2HHTA 3V6DB 3D6RA 2DUYA 3TVYA 3OYMA 1MMNA 1T03A 2VQEK 1ZM9A 3SMVA 1NOYA 3CCQS 5M2PA 3DN9A 3IMQJ 2J8SA 1HQUB 2RE2A 2VKRA 4L6V3 5LXRA 4BC4A 3H0LB 1FT8A 2A42A 2IOFK 4OZ5A 4IJAA 4TSXA 3SAHA 4OL8A 2WB1F 4X62J 2QB0B 2EW9A 5GAEU 1GTHA 4DU7A 4US9A 2EKYA 4L74A 2ZGZA 4O5KA 3FZMA 4H5VA 2YH0A 3GONA 2JSXA 1A77A 1CS4B 2HHUA 3KJQB 1FXRA 4LRBA 4NEYA 3BN4A 3HM9A 3HPOA 1NPKA 1SWVA 3KJNB 3VMFB 4M0AA 3AXMA 4NCBA 1HPZB 4M3ZA 4CBWA 1GTEA 2P2CB 3CTRA 3D54A 3Q0AA 4KRFA 3FZKA 5HMWA 1I3OB 1VQ7N 1PBAA 1R89A 4FO0A 5M1QA 3D7EO 2YX4A 1TKZA 5DDPC 2UXBJ 2CJ9A 1TAQA 4WFBQ 3FMBA 5HJYA 1DTQB 3B8AX 1GNKA 2LQBA 2V6AA 3G2XA 3D2EA 2G8WA 3ZX2A 5EX0A 3QU7A 4KE5A 5D46A 3KMSA 4P4MA 3ZNJ1 3KHGA 2LA6A 3FCHA 4W5OA 2XTJP 3GCXP 1SJFA 1TU0B 3JYTA 2YNFA 3MN9A 3ALRA 1IBMF 5CA7A 2KG0A 5FJ4A 3S1TA 5AKHA 2LQ5A 1SXEA 3AVHA 1JNRB 3MAAB 1NRKA 3VQ6A 3UD4P 5AK3A 1F9FA 1VMBA 1K73T 2UXDF 3QX7A 4A48A 5JMNA 4IOCQ 1URNA 5KFJA 3QEVA 3HHNB 1JXEA 2PI4A 3DRPB 1RNHA 4TY8B 5H2FU 5HMMA 5EY4A 2IBKA 1RDBA 7ICIA 4OO1J 4DL3A 3JPTA 1JLQB 1RYRA 4ED4A 2DGQA 4OI6A 1G15A 1TE2A 5B0DA 4DU8A 3NOCA 4FKYA 5J8YA 1NPRA 7ICFA 1L7NA 2V2QA 1KFDA 1PJ7A 1HYSA 4M3YA 3VGLA 1VBXA 1R59O 2LHTA 4XDCA 5F3XB 4GY2B 2OMOA 2YX1A 4EMDA 4UAUA 1HD0A 1WUUA 4DSKA 1OJ4A 2NXEA 3FQLA 1HLUA 1GMWA 5KFSA 2QGFB 2HPUA 1FJGJ 3C7NB 2KHVA 5LL6Z 4K43A 3ZEUA 5KFKA 3SDEA 2ZF5O 2CPJA 2ZZTA 3MPUB 5M1PA 3HSCA 3W9JA 2NRTA 1U8WA 2KTQA 1ZJMA 1RACB 2DRAA 5ETLA 2FJ6A 1IM4A 3QIPA 3OXFA 1TP7A 1T03B 1UOCA 3TNVA 5CH7B 4ZVQB 2HVZA 2H9ZA 4CCHA 2HZVA 1MMLA 1ZS6A 3V6DA 3IWNC 2OEMA 2ACMA 1CZ9A 4LQ3A 4KAZA 4K5RA 4FPBA 1HBOA 4RQNA 4JI8J 2COLA 3CCUS 4E89A 4XK8C 2ALZA 4M9JA 4ER8A 4LR9A 4TYAA 2FLLA 2YQ3A 1CVJA 3WHIA 4MN4C 3RMBA 5L9XA 1RB0A 3UFCX 4DPOA 1RAHB 1JKHB 4XUSA 5DQGA 1OPIA 4DV2K 1NK6A 2X74A 1ZQOA 1IJFB 2B0GA 1D4XA 5DGBA 1X5PA 2FLNA 1NM1A 1S6PA 4NL5A 3HJEA 3GYGA 4BS2A 4WJ3B 4YY3K 2GVZB 4JB3A 3J7ZT 2VH7A 1JUDA 3CCMN 3Q23A 2P35A 1ZYQA 4ZJOA 1KTVA 3QEBZ 3G10A 3JB9k 1RT1B 3AN1A 3LM2A 4OHVA 3T69A 2HI0A 3RJFA 1P27B 5GAHU 2NQPA 5LL6d 3P5JA 4FKXA 1QVFM 4MQ3A 5CYQB 4B3MK 4FVUA 4ID8A 1KVIA 2GEMA 3FDSA 2CADA 3TO8A 3LP1B 4E7HA 4N7TA 1P6TA 2QT7A 3O0FA 2OD6A 2FXUA 1C4AA 1VYAA 1GXLA 3HHLA 1IM6A 1F2HA 1NH7A 5KFOA 1F44A 1UEKA 3M6XA 4NXNF 2OM6A 2J0QD 3UIQA 3M8PB 1WUDA 2F1FA 1W0HA 5AI4A 3IRXB 4QW8A 2XULA 2A3JA 3VA3A 3B6OA 4JV5J 3KKAA 1DY3A 3T3FA 1W2BR 2RRDA 4BXOB 3CD0A 3JQJA 3ITHA 4YR2A 4JP8A 4FWNA 2P9NA 2CQ0A 7ICKA 3JAMY 3QAEA 1KBUA 3Q8QB 1I6JA 4O3QA 1ZD3A 3CDEA 3R2CJ 1KTQA 1WCNA 1XMBA 1R3NA 2R7QA 4H4MA 2LM1A 3RB3A 3MD1A 1FEEA 3PYGA 2V0NA 4MIWA 4HWIA 4ZIVA 3L7UA 1BIUA 4J9KA 2BYCA 3HSTB 4JKDA 3UB5A 7ICVA 4N8NA 4O3PA 2HMXA 2ZUAA 1LXNA 1Z00B 3SPZA 4CO1A 3THXB 3HD2A 4IEIA 2QB1A 3IWXA 5DQHA 3OPXA 2I9SA 2XB2D 1N33F 2QLWA 4JI4K 2AJQA 4WYWA 5KG3A 3T5LA 4CT8A 1QQ6A 1YDLA 4OKJA 1OY6A 2I9GA 1UKUA 3ZSVA 2OANA 3W64A 2YI1A 3QYPA 3QETA 1KQSM 3U02A 2M88A 3J81j 2EBGA 2HBMA 2BJ8A 1GLBG 3UR0A 2OYQA 5DETA 3ZSYA 3ISZA 3EE3A 5ALTA 1H6KX 2GHVC 3QGIA 3DM2B 2YX8A 3VENA 3J7YU 1X7VA 4P6QA 4KQZA 4TUPA 3RU0A 4DSIA 3OYNA 2BCRA 3Q7BA 2DY4A 4FOIA 3RB6A 2F3JA 4OJGA 3RSEB 4K7QA 4WCEL 2KZZA 1COOA 1IBMJ 1GK8A 1NHKL 1GAOA 4DTSA 5CJ7A 2YKPA 2ZWOA 4WP3A 4IOBA 3VGVA 1FWPA 2Y9TA 1RYSA 2CJQA 2X6SA 4H5RA 2EFGA 3BGRB 3UN5A 5E5NA 4B3SK 2QIFA 4F9OA 4DSJA 4KITB 5HO4A 2N82B 2LYAA 2R8KA 3VAHA 3BSNA 5KG5A 2F4VK 3NGRA 3V4MA 5AQQA 2KG5A 3O1BA 2ZD1A 2P9IB 1XNRJ 3WDOA 1NBWA 4Y2JA 4CLSA 1TELA 1J5EJ 2JR5A 1UPHA 4CH7A 4OV1A 3BGLA 1NO8A 4H8KA 2E6LA 1M1HA 2E5LF 3AHPA 1ZA2B 5CYMB 2Z2YB 4KHMA 3AV9A 4R25A 3H6EA 3HFZB 5ETRA 4EO8A 1NK5A 5KAKA 4RPZA 1A7GE 4KLMA 1R43A 1UETA 3IA0A 5HRPA 4LF4K 1KWMA 2QYGA 3FZHA 3W3SA 1W7WA 2FVQA 4WTYA 2MZTA 2ZVIA 3MR7A 3DOMA 4BY9C 2OPPB 3D6JA 4DX5A 2KSOB 1GLCG 2J7UA 3QO9A 1Y3KA 2KKZA 4RL1A 3HOTA 3C0BA 3AEVA 1UEVA 4EI2A 2PKEA 1HBUA 4QZCA 4H5NA 4IFYA 4WTOB 4DG1B 4P2XA 5AQXA 4Q45A 4QBUA 2HMIB 2RNEA 3D6FB 2YXLA 3CCMS 4CNQA 3PMNA 3WC2A 2PMZC 3C6AA 1OQ3A 2FJDB 2YPYA 5IS2A 3VQTA 3OV7A 3QUTA 2EK6A 3TVZA 2R7TA 1WC4A 1IKVB 1I3AA 3UXPA 3BPDA 4CJFA 4OX8A 1ZZNA 4CF9A 1FWLA 1U2RA 4JWMA 2HAFA 1S8OA 4RQ3A 1UQVA 2K8BB 2HAIA 4OV6A 1G4CA 2SXLA 3N6LA 4C4RA 1RU1A 5IIKA 1C0GA 1OMSA 2FTRA 4BGBA 3MDCA 4EX7A 4OLBA 1NGAA 3D2FA 2BW7A 4QU7A 2HHSA 5A2QY 4GKKJ 2VDHA 1J6ZA 5J1EB 2V2VA 3MWBA 2Z7JA 2P51A 4DV6K 2XMJA 3VQQA 2NO4A 3I9V9 4PAAA 1OQ6A 4MKVA 4K4VA 3U8XA 2EWHA 2LQJA 3D6TB 4HTLA 5TKYA 3UKUA 2G8KA 1LVHA 1HYZA 1YJ7A 3LDSA 1XK8A 3LPTA 2E5JA 1S4FA 1U1OA 4KHYA 3BDEA 2CPHA 1XUPO 1QVGM 1NHVA 3E9OA 3S3MA 2MQNA 4C48A 2UXDJ 2WVEA 2R7WA 1SZ2A 3RWUA 3VQBA 2IM1A 1GLFO 1N0VC 2VHGA 4X4TA 4LF6K 2A1JB 2DGTA 4WF9L 1NKBA 1BE4A 4EFHA 2C2KB 1RAAB 4J90A 2ZH4A 4ZCKA 2BABA 1HRHA 1WEYA 1HBNB 2LU1A 1OKJA 3H7HB 1ZQIA 2HSZA 4ED1A 2W24A 2RHQB 1U26A 4F4WA 4CTAB 2ASYA 2W8KA 4OYWA 3QWPA 3DU6A 2DNYA 3HCXA 2EC0A 3PIPQ 1FVSA 3ZCMA 3FQKA 2BMBA 2EFPA 3KJVA 2B51A 3NMUA 1V9PA 4I2AA 3DOMB 5D6GA 3NGIA 5J2IA 4OJRA 2PMHA 2BE9B 3LVWA 3CCUN 3AM9A 3OVNA 3CE8A 1LFWA 4K4YA 4ECRA 2H3EB 3QUBA 1B7YB 2MLZA 2PEHA 2VFRA 2KN4A 2R7VA 1FDDA 3SI8A 3A3PB 4F0HA 3CJ3A 4DOAA 1TUUA 1VS3A 3KK2A 3C5GA 4LFAK 1E6YB 2XMAA 3DGPB 4NA1A 3PW5A 2DFFA 1HIWA 2V8DA 2DGXA 1YZ6A 4G1QA 4FVMA 5AKZA 1KW4A 1HUZA 3ZDBA 5RUBA 4J2EA 3L2UA 1IKWB 2RQKA 2X78A 3AVIA 2HNYA 1WG8A 1BO5O 2GIFA 4LF5K 4CTAA 4A8KA 3OR2B 1U02A 2JNJA 3QAUA 4FPAA 3VQAA 2WOMB 3UO0A 4QNLA 2HQGA 2VG7A 1X31C 4IFVA 3DLGA 2E1AA 1FERA 3F41A 3LA0A 4I2EA 2K8CB 3H4BA 3TTCA 4WIQA 3QFWA 4YHHF 4F72A 3I0RA 3GG4A 4K2XA 1VQNS 1SKSA 1T05A 1FXLA 3IM1A 1HNWF 1WG1A 2KRRA 1KVJA 1ACMB 1XHXA 3SUNA 2IAJA 2PFPA 2BGWA 4FJLA 2J5AA 2V63A 1ESVA 1COKA 5GMDA 2YHBA 2B6GA 1SI9A 1TVRA 2ACYA 5C2CA 4W98A 2UUBJ 2MKKA 3DJCA 2OEKA 5KRTA 2IY5B 3O08A 2JWKA 2RQ4A 1PSDA 1Q95G 3TW0A 2IVMA 2W9BB 3K2PA 3ZDDA 1X6IA 4FYXB 2CGLA 4AP9A 5F41A 2DRDA 3B82A 3ZSOA 2QV6A 3M2RB 4UBBA 3CRXA 4KGKA 3V9UA 3VR1A 1SV5A 1Y0HA 1BU6O 5J2PA 3HILA 2B8QA 1RT6B 2JGAA 1DLOB 4LREA 5ETSA 2DISA 5BXIA 2ASLA 1Z4UA 1WC3A 2GX9A 2CQCA 4DCJB 4OZ3A 1NJZA 2G4BA 4LZGA 3ENBA 4RUCA 1TKDA 1M1GA 3M6VA 2IVYA 4R8UB 3FZBA 4I6AA 4WQ5A 4CYUA 5M1FA 3NWRA 4YOXA 1YWXA 3O4QA 3VQEA 2X7IA 2QA1A 2O67A 3ZFVA 4KHSA 2BUPA 1LKYB 2B9XA 2HRUA 3OHBA 2RS8A 3NL0A 2HHQA 4ACOA 2PDAA 5HNKA 2RHSB 5IFMA 3WXLA 4DMZA 3R3TA 4JMUA 3CP8A 4K4HA 2K4IA 1GXUA 3VOVA 9ICQA 2C2NA 3CIMA 2C3OA 3C2KA 2VKQA 3K9JA 2UU9J 4CJRA 2ZIUB 5KT3A 2MY7A 4YP3A 1M0SA 5F8IA 2DR7A 2KJ9A 4KLDA 2QTDA 2LECA 4Z4EA 2F8TA 4BXOA 4JI3F 1YBUA 4OLPA 1NGHA 5KGXA 1LKYA 3IUCA 5FD1A 4A2BA 2OPPA 2ZHOA 2YPZA 2OSQA 3EY1A 4CO2A 3EICA 3CFPA 4NL9C 3BPSP 3C16B 2XLIA 2VC1A 3RB4A 3C15A 2VG5A 1SQKA 3NGKA 1V4SA 5K9FA 3VAJA 2AQ4A 1OSDA 1NMEB 1CLFA 4CZMA 3ZSZA 3FK4A 3MECB 4PG5A 4CF2A 1X9WA 3OTCA 1ZBIA 3VTIA 1RWUA 1EIYB 3F53A 2YNGA 1L3SA 2CG4A 4LF5F 1XNQF 1IR0A 2OPRB 4I7FA 5KOWA 3M9MB 3N4WA 4DV7F 3HKZD 3C1ZA 1VBKA 3BQ7A 4MEXA 2MSTA 3CJ4A 2EFVA 2RU9A 5G0RB 2DHGA 2PE8A 3IN5A 4DUZJ 4BGAA 2XHBA 3KLHA 4R64A 2C2EA 3FE1A 2IC3B 1QVFR 4ZCIA 4FM1A 1EWRA 1XSNA 2I6WA 4PG6A 4IO9L 4OX7A 2M70A 3FBBA 2AXTU 2O8EA 3HJFA 1UVNA 1IV0A 4X4QA 1PC5A 4I2PB 4RU9A 2PT0A 3N9UC 3RZAA 2FB0A 1FX4A 4O44A 4JAXA 1JJ2R 1RT5B 1ZQGA 1U49A 1FF2A 3KG1A 3DLHA 1HQEA 2W8LA 5ALXA 3NE6A 2PMWA 2ZBIA 3RSEA 5AKXA 5K8MA 2PSZA 4FLYA 4NLBA 8ICRA 3SI6A 1VSHA 1H74A 2QL7B 3ENWA 3WC0A 4DTNA 1VQ8S 2OFGX 5B0FA 2KG1A 3TAGA 3PHEA 4U96A 1WC1A 1IKWA 3LDQA 3CF5L 2NZ4A 1LWEB 4F50A 3NVZA 3L09A 4DSLA 1YLXA 1FK9B 2KN7A 1PVRA 3K4GA 2LYVA 2FJAB 4LBHA 1C1BA 4P0QB 4P10A 1IG6A 2DHSA 5FPNA 3RAQA 1WDDA 2BBEA 3VZIA 5MAOA 2V8HA 2CDRB 3GSDA 2C3PA 3U27A 3BZQA 5KG2A 4CEDA 5SZTA 4DX8H 3UXOA 3H3NO 1MSWD 5FRMA 5DZ7A 2DL0A 4LSNA 1L3TA 2ITMA 2QMUB 2AYBA 5HRSA 4BE2A 3HVAA 4JB8B 2FY8A 2R2SA 1B9DA 4GC6A 4NLQA 4DOCA 3EXCX 1LWFB 2YY6A 4B9TA 2I5JA 4AL6A 4CE6A 2YX7A 4Q5VA 3I56S 1FKAF 5ADXA 3ETRA 4NLKA 1AT1B 3LK9A 4MLHA 2ZGYA 1FA0A 4PXBA 3BKFA 2KB2A 3G8TA 2HOEA 3NASA 2HBKA 7ICGA 1YI2S 3BQ0A 4JI2K 1N32F 2XGQA 4X4VA 4W5NA 3RYLA 5M2RA 1E6VA 4BR7A 3DRSA 5IT9O 1O08A 3LP1A 4ECXA 5CEHA 3MN6A 4PKIA 3QESA 2QTWA 2Q1LA 2A1AA 3IR7B 3IWLA 2WF9A 4MIBA 5J2DA 2BJ7A 1RTIA 4WE1B 1RXOB 2ADBA 3KNAA 2QC3A 1Y7PA 3BO4A 4JI8K 4PQAA 2ZJAA 3CMES 1CC7A 1A9NB 3UD5A 4CT9A 4LUBA 3V9SA 2HGLA 3AT1B 1Y88A 2ZZNA 3HO1A 2QE5A 5IIJA 3PM9A 4KHQA 1VLYA 4I6WA 3AA9A 3QINA 1HNWK 3EPIA 1VQSA 1WHWA 4KB1A 4M3RA 1YT3A 4ILHA 1K9MO 3LGHA 1FRXA 4UQGA 1DFDA 1S3XA 3WQTA 4F92B 4ZCMA 3GP9A 2IVFB 2CZ4A 4DL6A 2XMWA 2X6NA 4FZLA 2FGCA 5DM6Q 2DRBA 2O6KA 3OVSA 1WTBA 2OMLA 5HN0A 2MHEA 2IBOA 1YHQN 4K25A 2HW3A 1MN8A 1X5OA 4CO3A 1LWEA 2ZJ5A 3ZT3A 1U0SA 3RH6A 5F3TA 2HBJA 3RB0A 3SDEB 1URRA 1T11A 2P9LA 4LF4F 4NLWA 1BOTO 1ROFA 3M6GA 3KUHA 3TU5A 3QO9B 4J8FA 2RDJA 4DR3J 4DR5J 1EXNA 3PJXA 1WOOA 3M7DA 4HLBA 1ZJNA 4RO0A 3WQPA 4ZLPA 1SQFA 2JXJA 2HHPA 2QA4S 3KFUF 3W66A 5LSLA 1HHQA 3M8WA 4H0XB 1TL7A 1I39A 3BKUA 3ZSWA 4IH6A 1OH6A 2EPIA 2M8HA 1VQKS 1VISA 2HOFA 3CCSS 4B3SF 8ICVA 3BS5B 2I5JB 1WEZA 3KNGA 4UB2A 3OVBA 3VZHA 3PW2A 5CXTA 1NDCA 2YKNA 3GIRA 4KY3A 5IWAF 1N36J 3LM9A 3M3ZA 3CIPA 3T79A 3QSYB 4P7TA 4UQTA 4P2FA 4WFAL 1VK3A 4RW7B 5AQUA 1JCGA 2K60A 3GCWP 3LGMA 5IOLA 2I1QA 2DH9A 2YNIA 2YWHA 3BO2A 5LSRA 3JYTB 3IR5B 3VAGA 2QARB 4F2SA 1FXXA 1VSIA 2ZG6A 2KFNA 1J54A 3T5HA 8ICIA 1H73A 3OFFA 3C15B 2F8KA 3U1MA 2DNGA 3QFHA 4PWWA 1RQ0A 2NNWA 5C25B 4USHA 4PKHA 1CULA 1O03A 2LKYA 1VQOS 2E66A 2PC6A 2ESEA 1VGYA 2ZBCA 1RKJA 2I8EA 3GDQA 5ALZA 5AQVA 5ALPA 5ELZA 2UUWA 4CFAA 5CP2A 4KGZB 4K59A 1Q8IA 1KD1T 1JLAA 2UUAK 3T9NA 2JC0A 2MDAA 2UXCF 2H3VA 5EE9A 5FPEA 3DM2A 4PEOA 1FO4A 5IQQA 5KFEA 2Z1IA 3SMPA 3V6JA 4URQU 4NLDA 2POKA 5GVQA 3IBCB 1FDAA 4CEAA 2HLTA 4PGQA 3QJLA 3KKSA 4B3TK 1YRXA 4ZLJA 4QZBA 1T6CA 1BA1A 2F1JA 4DQRA 4UAVA 3AVKA 1CLQA 1S1UB 4M6WB 1ZAXA 4O44B 4FJXA 4PA1A 2M3DA 3NF8A 7ICPA 4NXNJ 4RT2A 2ZIWB 4DU1A 3WU2U 5D4OA 2RDDA 7ICOA 3CSKA 3D1QA 1RADB 5AQYA 4C9DA 3D0GE 3RVCA 4GV9A 1FWKA 3MN7A 3M6WA 2L9DA 5LOQA 2A1SA 3GG1A 4KHPK 1U0HB 2YQ1A 2H3GX 2OZSA 3UQ2A 2NUHA 1XMQJ 4U7CA 2GH1A 4DV5J 3ZDEA 1TZ0A 3W9HA 9ATCB 3EDRB 1D3WA 1T3OA 1WEXA 4BLGA 4I2BA 3TX0A 2KEYA 2P5GA 4QZIA 3QRRA 1IBLF 1I94K 2JDJA 4K4SA 3DOKA 3CWJA 5DB7A 1X8DA 3QMQA 4W4MA 3OYBA 4KFBB 5U47A 5KQ8A 4C8OA 4KO0B 3RH5A 1RT4B 5KFMA 3US5A 1BQMB 5ALKA 1U2FA 3AA4A 4GO7X 2NZTA 3AFGA 2K3IA 3M8PA 4C0BA 4BRAA 3KHLA 2RKIB 2HSTA 1RDWX 4AL7A 1DXSA 3C16A 4H4KA 1APSA 1KVCA 2Z1GA 3OYDA 1KVBA 1RLCL 5AI6A 4RW4A 3AD8C 4OJ1A 4UZBA 2YTUA 1BQXA 5DB9A 1QSLA 2FPLA 4GMJB 1LWCB 3BB5A 1BL3A 1NGGA 5GTIU 5CB1A 3F5AA 1FCAA 1H3DA 1U1NA 3VEVA 4O4GA 5BRFA 2QWNA 5HRNA 3VF0B 1Q1KA 2OFHX 1RI7A 4B9VA 2VPZB 1IN0A 4JI7F 2GUPA 1H2TZ 2NRRA 2HHVA 1T8EA 2FBYA 3H2LA 4AD6A 4RQMA 3UPQA 1BDGA 1L7MA 2F4VF 1D0EA 3PX4A 1K44A 4QYZJ 1XN9A 4DV0J 4IQMA 4OX9J 5J2AA 4RPXA 1AA1B 2K8GA 4ZN1A 4DV4F 4ZP6A 2FI1A 2I2YA 3JS6A 2KFZA 5B09A 4K5SA 2YWEA 5AKYA 2HG4A 2DGVA 2OLWA 3VWSA 4R0EA 3V81B 2MUTA 4FZVA 4BVPA 4UASA 2FMQA 4NYPA 5J2HA 2ATQA 2J4RA 5AI0A 2CQ2A 4NLUA 3NS6A 3PUFA 4Q7AA 4LH4A 3TJ9A 5IINA 8ICZA 4LRCA 1LOUA 2CXEA 3CJQA 1J27A 2C28A 4X2BA 3PW7A 3E3XA 5HVGA 1YAGA 3KVGA 1X2IA 3O44A 3M2RA 2QL9B 5AZIA 3VQ4A 4HTJA 3ZTSA 1WD6A 4CESA 1Q3UA 4B9UA 3SQGB 5ALWA 2ZBQA 2U1AA 1P1TA 3QRPA 3OTOK 3PRDA 4HAIA 3POTA 2KHCA 2H4WB 2ZQBA 5IT0A 4CRXA 3DXKA 1U6ZA 4E8UA 1RXVA 2IRUA 4OPJA 1WAJA 5BJRA 4NLNA 4USVA 2ZIVA 1R7IA 4ZTJA 1TKTA 3CEDA 4U67L 2ZTDA 1JL1A 3CC2S 3AVFA 2WOMA 5AQWA 3L2QA 4WCEQ 4OJ6A 4ENOA 1RWWB 4M94A 2W9CA 5H1SV 1QQCA 3OR2A 4NCAA 1JLQA 2E5SA 2BJEA 3QNWB 3ILLA 4ECVA 4PXCA 2G08A 2Y1JA 3D2QA 1K8AT 4DV7J 1D9FA 1D9AA 3W61A 4F5OA 1X9JA 2CIMA 3AMZA 9ICUA 4IKFA 2EI5A 1WYGA 4LZDA 4IXCA 2E8NA 4JKFA 2RP5A 2XBPA 9ICBA 4A8XA 1S72S 1NLVA 4OKKA 4WKYA 4PY5A 4N5SA 3MAAA 4C0HA 4PWDA 3AGRA 2A3ZA 3M2VB 2CH5A 2Q3SA 3O6QA 1JRPA 3HFVA 2GTDA 4FJJA 3HX0A 5I42A 4RCHA 3L3UA 5AE1A 3SJHA 1NMDA 2Y8WA 3QNMA 3JPNA 4EP4A 5EWGA 1T3QA 4FBUA 3HHLC 2C22A 3D45A 2B56A 1NGCA 3MWTA 2E5GA 3CC2N 2HHHK 2G5HB 2VBYA 3A1YG 3V7KA 5J0SA 3KLIB 2LA4A 1KLMA 1JLEA 4QOZB 3BBFA 3IC1A 3JPQA 2IM0A 3OTDA 3THYA 5FPDA 3UVJA 2OHDA 2MLXA 3FZFA 1IKVA 1Q7YT 2BJ1A 4I6MB 4FYYB 1AXQA 1ASVA 2KT5A 1IQZA 3C6UB 3D6HB 1VRTB 2X1AA 4DL0C 3FGVA 3PMLA 1TL1B 2IGIA 2HVEA 1Y97A 3IG5A 3WK6A 3U26A 3C46A 3TWZA 1SXDA 1RDRA 3RJIA 1YJRA 5GADU 5CR4A 3WKAA 3LTOA 3HJVA 2FMSA 2YWFA 2B9WA 2HGNA 4FYVB 1HBUB 3DV9A 1X6JA 2L5YA 5L1LA 2KJ8A 1RBTA 2BANA 4JUZA 4ZVPB 3DXSX 3Q2TC 4O23A 5AKEA 2JMGA 3HWTA 3CMAS 2H65B 3MCPA 2NRWA 1V3SA 1YQHA 2XO7A 4JI3K 4R65A 5F0XA 1VQON 4Y34A 1TAMA 2DO0A 1G1XA 8ICFA 3H5SA 5FRNA 3OSPA 4Y2KA 5H9EK 3MXMA 4WU3A 4DR7K 1VHFA 2ZC4A 3PKMA 4DL2A 2PBDA 2MKJA 3OGUA 3JTOA 2R18A 5DZ6A 1JROA 4I67A 3CCRN 4PG8A 4CWBA 2UZAA 2R8IA 5KI6A 1JLBA 3MURP 4CNZA 2GJFA 4I2FA 2O1PA 1VK8A 4H5WA 2YHAA 1QQ5A 1SC3B 1BCOA 5IT9Y 3FVYA 2M5YA 4MK7A 3L2WA 1PJ5A 2IS3A 3B0XA 4RUBA 4FXVA 4OJ5A 4L76A 5CRXA 3V4IB 1U04A 3W63A 3EVMA 3SSQA 5AQIA 5J0YA 2PA8D 1C2PA 4NXZA 3D2FB 4TLRA 4FK2A 2FQQB 1T9WA 5KG6A 5JVGL 2AF6A 4FWRA 3THWA 4HTIA 1CBKA 9ICLA 2XSJB 1RBRA 1RZMA 1U2VA 4RW9B 1C1CB 1TFYA 4RLEA 2WFAA 4UY8T 4OYAA 1A5WA 3VVTA 5GIPA 2Y0SD 1T7PA 1FKPB 4K4XA 4HT7A 3E51A 1T9VA 1RAGB 4BE1A 4ED3A 4P4OA 1UWBA 2ATCB 1QS4A 5ALQA 5BOLA 1J5OB 4OJ3A 1V3ZA 2KO1A 3PR5B 3M2UA 5HBMB 4LSLA 3C1YA 1ZETA 1JXBA 3HVTB 4ICLA 3N5FA 2VQFK 2W2NP 1ZPWX 1Q82O 1WF2A 2MXYA 1ULRA 1SUQA 1FFWB 1S6QA 4CDIA 2CA9A 5K4LA 5HHHA 4M1KA 2V8VA 5IV3A 4O9MA 4DMNA 4MTPA 4OJLA 3BV8A 1WDTA 4B9NA 2HLUA 1OSCA 3KHRA 2Q31A 3ICXA 1TL1A 5KL1B 5F8LA 4FJ5A 5DG8A 4QIWD 5AJ3J 2KJ5A 3H8YA 5KPRA 1Z00A 3HZEA 5AZIB 4OKEA 2YB4A 3N7PD 4L3KA 3THYB 2A3VA 4J03A 3V5RA 4DJBA 2W6LA 1VIOA 1K8KA 3IBPA 3NVYA 4C3MA 5E26A 3CXCR 1ZBHA 1BIZA 4FJKA 1S4EA 3DEEA 1NHUA 2EK1A 2FBTA 2OTJS 4Z37A 3O9TA 1UPPA 2FSJA 2O8FA 4BG9A 1FNMA 3D28A 1M5SA 1S0VA 2HRTA 1SZPA 3H8SA 2KM8C 3PNIA 3E8OA 4I0WA 2BXJA 3NBPB 2ZOMA 2YKMA 3C95A 3PLAA 1IKXA 1JLCA 4CE9A 4NXMK 4HUGA 3K1ZA 3GBTA 3P96A 3W5ZA 3RR7A 1KAYA 1RHKB 1QD1A 1WWHA 3ZX0A 3H4DA 4DR4J 2BE7D 1XEZA 3D3BJ 1WHVA 4TVAB 3H59A 1KBRA 1OIAA 2L9WA 5K14A 3EO3A 2UXCK 3JPPA 3U1LA 4OYZA 3KMQA 2ZZMA 3MAHA 1IWAA 4YY3F 2KJWA 5B66U 4BRGA 4HVZA 4YXJA 1ZQYA 2M7SA 4LMZA 4GKKF 4BRIA 2CQBA 4WKRA 2BM1A 4RZRA 4EBDA 1VQ4N 3MCAB 1HI1A 4CP5A 1FRHA 1L5UA 5T7LA 2EAMA 1NOZA 3FBEA 1KN6A 3OYJA 1TAUA 3FKBA 4Y2XA 5BN8A 1ECWA 3MM7A 2FPHX 4I2HA 4RR5A 1JIHA 1DZ5A 4B1VA 4DHYA 2Y0BB 3ID6A 4CZGA 2XI3A 4ZP9A 9ICPA 2UUTA 3THXA 1HA1A 5KG0A 8ICCA 4CJ3A 2KHQA 2OAUA 1TYQA 1RWKB 4EEKA 4Y2SA 5HATA 3MCNA 5D77A 1WI8A 4M3XA 4CO4A 2A6OA 4F4XA 2YB1A 1YXQA 3Q8PB 1RHRB 4Q0BA 8ICAA 5AQSA 1C20A 4ZPDA 3QEWA 4DV1F 4DR2F 4DDFA 4LQ9A 1HX1A 4UBCA 3MCMA 2FD2A 4XQ8A 2BCUA 2HDOA 5AT1B 5CCLA 5JRTA 3ZEUB 1BPDA 3NMRA 3V81A 2JL9A 3UMBA 1NBEB 3S9HA 1SKWA 5LSOA 3OHRA 4F8RA 8ICUA 4W5TA 4FJGA 2HBQB 2N4DA 1DARA 1IR2A 4R79A 2WVDA 2VPXB 2PY5A 5HJXA 4CGGA 3CPWM 1HNZF 2UUAF 1RA7A 3DRXA 2VIHA 2FC0A 1BGXT 2LYHA 4QWDA 3MGHA 4ELUA 4O5EA 1ZD4A 3MPYA 4KH4A 3SJJA 4QZHA 3W2VB 2QK9A 4USUA 3HX9A 1TK8A 4Y1CA 3MOJB 4J9NA 1RT2B 4KLSA 2E9RX 2N7CA 2B7BB 1FE0A 4QZEA 4YDDB 1VQ9N 3B0YA 1RAIB 4RW4B 2GO9A 2HS0A 3VQ7A 3WXKA 3V1QA 3NBPA 3F9KA 4FZZA 5C2FA 3OYHA 2ZE2A 3K5PA 2RKIA 4UATA 2DXDA 4ZHRB 4JKCA 4FLTA 1GXTA 2P9SB 2VQFF 2DY9A 4B8AB 5DO2A 3CDWA 3ZSRA 1QTNB 3D2SA 2C42A 3V7JA 5ALVA