4DQRA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqrA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqrA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqrA01
4QZ8A 2HHQA 8ICOA 1N6QA 1ZQIA 3ASMA 3UIQA 4FK0A 2J6SA 2YNIA 3QZ8A 1ZQEA 4ECZA 1ZQHA 5KGXA 3MEGA 4YP3A 8ICEA 2ZJ8A 2E6MA 5EWFA 2C2DA 1XI1A 5KFRA 3V7JA 3T3FA 4Z6DA 1ZQVA 1RILA 4PQUA 1S97A 4GXKA 4UB2A 3KHGA 2A1SA 2VA3A 5FDLA 1KFSA 1U49A 1TFRA 3CYMA 4DQQA 3PO4A 1CEZA 4KITB 4FJKA 2F8TA 5CYQA 3OYIA 3PUFA 1EETA 4FJIA 3PR5B 1C7YA 2IOCA 3TFRA 3CM6A 2XGQA 4H8KA 2BHNA 1ZQDA 4B9NA 2KZ3A 4F5QA 3RTVA 4YD2A 3TAPA 1O1WA 2GUIA 5KFMA 4CFCA 1RT5A 4JWMA 1ASVA 4LZGA 4G3IA 4HCBA 1RXWA 1ZQTA 3V6DA 4R8UA 4I2QA 3HSTB 1S76D 2XO7A 3NHGA 4QWAA 1ZQQA 3AVMA 3KK3A 2XHBA 5EWEA 4Q44A 3GV8B 3L2UA 7ICVA 5SWMA 3RJKA 3K5MA 5C24A 4HCCA 4PGQA 1L3UA 4LSNA 4BDYA 2HHSA 2KQ2A 4FJXA 3SQ1A 1LAWA 4KO0A 9ICJA 5J0PA 3VQDA 4O3QA 5L1IA 4PGXA 1HRHA 3OSNA 4LVSA 3KHLA 3V9UA 1N5YA 2W9CA 3TAFA 1I39A 1VSDA 2OZSA 1RZTA 1A77A 1BQMA 3KTQA 4M3RA 2IGIA 3C2MA 4IFYA 2O4GA 1KVAA 4ICLA 4CEDA 3SI8A 3QEXA 1NKBA 1SUQA 5DDYA 4K8XA 1DTTA 2F1JA 3NH1A 2OZMA 3S9HA 3C94A 1IH7A 4CHNA 1EP4A 4KV8A 1A76A 3V9XA 3KLHA 3DM2A 1ZQRA 3UXNA 2XCPA 3L3UA 4J2DA 2WONA 4KI6A 1BQNA 4IR9A 4FM1A 3RJGA 2FPLA 1TVAA 3ULDA 1J54A 3PMNA 1L3VA 3C5GA 4CJVA 3VN5A 3F73A 3M9NB 5J29A 1LW2A 5L1KA 2PXIA 4OKEA 5J2EA 2IS3A 4FM0A 3MEEA 2JEGA 5KT5A 2IBKA 4YVZA 4PA1A 2OWOA 1VSFA 3P1GA 3NF7A 4RQ0A 4QZDA 3RR7A 1SKSA 3PO5A 3MGHA 3PY8A 2OPSA 3ISNC 2R8HA 3C2KA 4CESA 4BXOA 4PHDA 3UXPA 4EZ9A 3L2WA 7ICUA 4PWDA 2VWKA 2KN7A 4DTPA 4M6WB 3M8SA 2FMPA 8ICFA 3K5NA 4PUOA 4ID5A 3V9SA 4R5PA 2MAXA 1JX4A 5DB8A 3GIKA 1HPZA 4QW9A 2AGOA 2R8IA 3FYHA 1HQEA 1AROP 5CHGA 3QINA 4RQ4A 2BQRA 4P4PA 3AO3A 2XRIA 3TR8A 3ZSOA 1JL1A 2ISOA 5EOZA 3B0YA 3DLKA 4FZXC 3L8BA 2P5OA 4X5VA 5HROA 3JPPA 2VG7A 4MQ3A 8ICMA 3EZ5A 4KLHA 1RYSA 3SQ4A 4TURA 2BANA 5DBBA 5D49A 5DQIA 5J2PA 3WNEA 3OYFA 2C2RA 1JLCA 1UT5A 4FK2A 3QEWA 2ZD1A 5KG3A 3QLHA 1NK9A 1LWCA 1NJXA 4KN4A 4F4KA 2DFLA 3C23A 1H38A 1S1WA 3VQ5A 2XY5A 4DFMA 3SUPA 1KEJA 2BCRA 4IBNA 4M2YA 1N48A 5CR0A 2VANA 4FS2A 2BCUA 4DMNA 4QZFA 3LP1A 3HW8A 2FMQA 2V4RA 1ZQKA 3WNGA 4B8AB 4DS4A 4E0DA 4IG3A 3LZJA 4GMJB 5IIKA 9ICLA 4DFJA 4I9QA 2DFFA 4ZHRA 4QWCA 2Z1JA 1XO1A 4KLQA 4J9OA 1REVA 4NLKA 5DLGA 1S0MA 4FZZA 1ZQNA 3SNNA 3C6UA 4W5OA 1JLFA 1T05A 4GXJA 5KFIA 4KMUA 4HUFA 3AVKA 3NF9A 3MXIA 1BIZA 4MFFA 4C8MA 1Q9YA 3AO1A 2KTQA 1PZNA 3HT3A 4M47A 4CF9A 3EWAA 4NLNA 5KFJA 4AHSA 3S3NA 4I29A 2LYHA 3VA0A 3Q8KA 4DQSA 4CECA 4CGJA 4GC6A 2BGWA 3TAQA 1FXXA 1ZBLA 4OPKA 1SL2A 4NY8A 1B43A 3S3MA 4NLZA 1XC9A 1JIHA 5J0XA 2PI4A 4GW6A 9ICGA 7ICSA 2KZMA 4ECXA 4LH4A 3SUOA 3AVFA 3GFKB 2BPCA 4O44A 2BCQA 3VQCA 2W42A 1ZQSA 3AVHA 2OPPA 1A5VA 4F2SA 2ZJAA 2HVIA 4CJFA 5J2QA 3ZT0A 4UB1A 1BPYA 5DQGA 4KAZA 1S1XA 1VSHA 2O4IA 2W8LA 2XGPA 2G8WA 1S0NA 4O5KA 4B9MA 3RR8A 4FLTA 3RH5A 1B92A 4DTRA 5KFWA 5J2HA 3SYZA 4FJLA 9ICXA 4GLXA 5HRSA 2UVWA 3BQ2A 3K5LA 3KK2A 4HTUA 3JPTA 1Z25A 3QESA 2VA2A 4F4ZA 4ELUA 4OVLA 3RRGA 2FLNA 4DL4A 1HJRA 3VQPA 3ZCMA 5KG4A 1WSEA 2P6UA 2Z1IA 2HHWA 4EEYA 1S1UA 3AA3A 1TV6A 4NM2A 3LPUA 3NH2A 3AUOA 3H7IA 1JL2A 4FLVA 2IC3A 1QHTA 3OYAA 1CXQA 4DL3A 1RPLA 9ICRA 2XY8A 5FRNA 1QSYA 4KHSA 3GILA 4I2AA 3ZDDA 1JMSA 3DLHA 5KRSA 4RW4A 3KLEA 1WSJA 1EXNA 4MFAA 3LDSA 3ZT4A 3D45A 2UVUA 1U9LA 2HHVA 3LK9A 5J0RA 1JXLA 5KFAA 5KG0A 3RJFA 3S3OA 4XRHA 9ICSA 1QLNA 3V7LA 9ICEA 7ICHA 2X6SA 3LAMA 3K58A 1KTQA 5J2MA 3TABA 4FW2A 4DTJA 1BPBA 4FJ9A 4I2EA 3VQEA 4O0IA 1MU2A 1ZQXA 1RT2A 1VK0A 8ICQA 2DFEA 1CLQA 3RMAA 4Y1CA 5L1JA 4M6WA 5DGBA 3PMLA 3IRXA 3KJVA 3BQ0A 2RKIA 4RT2A 3ZSWA 3QE9Y 4IDKA 4KLLA 1EKEA 4Z6FA 4FO6A 3SZ2A 3VQAA 4EP4A 3OHAA 5E41A 3OJSA 4DF8A 1LB2B 3U3GA 5DG7A 2LSNA 3VA3A 1YTAA 3NF6A 3H4BA 2ZUBA 3T5KA 7ICKA 3M8RA 3O3FA 3LANA 2XY6A 4Q43A 1ZQJA 4OKJA 5HHIA 9ICHA 5HNKA 3MFHA 4UQGA 3BQTA 2V9WA 3RJEA 1ZETA 3GV7B 3E01A 3P5JA 4CFDA 4UB5A 1IKVA 2PFPA 3OYNA 1RBSA 1ZQGA 1UOCA 1HUZA 1RTIA 5KFLA 5KFEA 3OVNA 4J9MA 2B5JA 5L1LA 1ZQWA 3N97B 1CZBA 4RQ3A 1S77D 2HB5A 3V9WA 4F91B 1C0TA 3AO5A 4DTXA 4DS5A 3Q8LA 4KLGA 2F1IA 2WTFA 8ICIA 5CZ2A 4YG2A 4QOZB 4NYFA 3H4DA 4FBTA 2D0CA 4B9SA 3H8WA 3GIJA 9ICIA 4OLBA 1R0AA 1RDCA 3RAXA 8ICKA 5CA7A 4W5TA 3OS0A 4KHQA 5IINA 5DK5A 5DB9A 3PW4A 4RU9A 5J1EA 5KT6A 4CJ5A 4F4YA 3TANA 4KLTA 1QSSA 1ZQPA 4CIFA 3ZDEA 3V6KA 1B9FA 4J2EA 3D0PA 1NOYA 4J9KA 1J5OA 2ATQA 4DSLA 8ICJA 4JRPA 4JRQA 3BJYA 2D5RA 1IO2A 3ZSXA 2MUTB 4O0JA 1LV5A 4F5PA 8ICXA 1JXBA 4DU4A 2OPRA 2W9BB 4KTQA 5KT3A 1WSIA 3HP9A 3H8JA 3MXMA 1FKPA 4UB4A 2BQUA 1UWBA 3GV5B 7ICJA 4TUQA 4R66A 1VRUA 9ICWA 3RH4A 1NJWA 5HP1A 5DKWA 1Q9XA 3PW7A 5JS1A 2AQ0A 5TZVA 4DQIA 4C8NA 3OYLA 3RMBA 4G1QA 3DRSA 3O4QA 4YR2A 4QZIA 3SV3A 8ICRA 3G0ZA 7ICLA 3T5LA 1ASUA 4NM1A 1DGSA 4DL2A 1NJZA 4CJ4A 1KVBA 4FLUA 4R64A 5HMMA 3T1AA 4F93B 1JLBA 4NLGA 3DLRA 5CZ1A 4YD1A 8ICUA 2X6NA 4CHZA 4I28A 4Q0BA 7ICIA 3MXJA 3RB3A 4PHAA 3SUNA 2EX3A 5KFYA 3V7KA 4B3OA 3HPOA 4Z4EA 2JEJA 3OSPA 8ICGA 3NTUA 1IKWA 4AHUA 3P83D 4B9VA 5J2NA 1YVUA 2AGQA 4RNOA 1C6VA 2ZJ5A 2ZQBA 3AVCA 1S1VA 5CYMA 5KFDA 2H5XA 1S10A 5DBAA 3B6PA 5CJ7A 4M9NA 4M3YA 4KTZA 3OGUA 1NKCA 3M8QA 1WAJA 2X78A 1BGXT 5IIMA 3ALYA 5EU7A 3V1QA 4HUEA 5CY4A 5L9XA 3MEDA 3UQ0A 3IG1A 1U47A 5C42A 4QZHA 4CHQA 2KZZA 8ICYA 1NOMA 4Z4GA 9ICAA 4QCLA 1LWEA 4EBCA 3ZDBA 1S9EA 1TKTA 4EBEA 4Z6CA 2Y1IA 4TQRA 4TQSA 3K57A 1C1AA 1XSNA 4FJ7A 3RBEA 3UPQA 4KHWA 1NK8A 3KIOA 3QIPA 4CCHA 4B9LA 2ITGA 2AU0A 8ICPA 3JSMA 3JPSA 1LAVA 3VQ6A 4YCXA 4I2IA 3VQ8A 3SV4A 4Y1DA 5DG8A 4N47A 2YNGA 4HVJA 2W9AA 1Q8IA 2FPKA 3TWHA 3I8DA 3ZD8A 2IAJA 4E1NA 4KHNA 3Q8PB 1UAXA 1TK8A 1ZQYA 8ICHA 8ICSA 3CFPA 4KLSA 4J9NA 2FMSA 2Z1HA 4ED3A 2JEFA 4KHYA 1V9PA 3HYFA 4FJHA 2P66A 7ICNA 5KG5A 4KLDA 1XS9D 5KTQA 4YFKA 1RNHA 4KREA 5DMRA 1COOA 2FBVA 1JLEA 3E2EA 3SCXA 1ASWA 4Q8FA 1C1CA 4IG0A 3DI6A 5KG7A 3OS2A 4CEQA 1D8YA 1U48A 2KFZA 3LWMA 4ECYA 4DQPA 4UAWA 3RMCA 4P4OA 1W0HA 8ICAA 1SZPA 2P1JA 4FLZA 4B9TA 2YV0X 2OYQA 8ICNA 1CXUA 1T7PA 2HHTA 1ZJMA 4E89A 4CJKA 7ICGA 4M9JA 5IIIA 3C6TA 1NK0A 4ECRA 4ECQA 4ZTJA 1X9MA 4I2JA 5KRTA 1BL3A 1ZQBA 2RF2A 9ICVA 3VQ4A 4UAZA 4RPZA 1SKWA 3MAQA 3ZSZA 4FLXA 2FBXA 4JLHA 4RZRA 2B6AA 4KLJA 3H8SA 3ISBA 1KFTA 4F8RA 4FJ5A 3HVRA 1TL1A 3GDXA 2Y1JA 2KW4A 1TAQA 2BR0A 4IQUA 2A1JB 3PW5A 3U6FA 4DU1A 2PYLA 3GIIA 5DLFA 4I2FA 3HPGA 1BCMA 3GQCA 3IHQB 3RBDA 2G8FA 4QZCA 3AVNA 8ICWA 1UA0A 1NK5A 2JZBB 4KB1A 4XA5A 1CZ9A 3FFIA 4W5RA 2F1HA 2NRWA 1KRPA 4RQ1A 1RBUA 1IKXA 1HYSA 2D0BA 5HRRA 3V72A 4ECUA 1XSLA 4C8KA 4KKOA 1J53A 3DRPA 2VG5A 4RQ5A 3C21A 3GIMA 1DTQA 5D4BA 1QS4A 9ICBA 4KLUA 1TV9A 1L5UA 4ECSA 4F2RA 5BPCA 3AO4A 3NH0A 1JKHA 2FC0A 4YNQA 4DTSA 5KT2A 1LW0A 2NRXA 3LDAA 3I0RA 5KFTA 4J9LA 5DQHA 4CEAA 5HRPA 2J6UA 3QEBZ 4CGFA 5HLFA 2W8KA 3Q8MA 1EX4A 4TSXA 9ICUA 1BCOA 1FK9A 4BE2A 4B9UA 4DTMA 1X2IA 3OYGA 3QIOA 3PR4A 1RBVA 2C28A 2KFNA 1C0UA 4FS1A 2NRVA 2NRZA 4CERA 2QXFA 1BVSA 1MSWD 4FZYA 4J2AA 3OYEA 2BKEA 1ZBUA 7ICPA 3RJJA 3KKRA 3ZDAA 4DL6A 3SPZA 1XHZA 1NK7A 3L2VA 1RT4A 3THVA 2PYJA 2JEIA 4QW8A 3UXOA 4CEEA 1KDHA 4ELTA 3O3HA 5JS2A 1TKZA 3LALA 4ELVA 4M42A 4CHOA 4FJMA 4CJSA 1KVCA 4H4OA 4KLFA 4O5BA 4I2BA 3TFSA 3C1ZA 4HYKA 3ZSYA 1JLQA 1WSGA 4B8CA 1ZQUA 4KLEA 3MR3A 2AGPA 2HHXA 2ZTCA 3G6YA 2DFHA 2RDJA 5IIOA 3PW0A 2JLEA 3HVTA 4Z0UA 3H40A 3T5JA 4CFAA 3ZDCA 7ICMA 1BI4B 4GVMA 1S0OA 1JXEA 3L3VA 2E4LA 4RUCA 1IKYA 2R8GA 3IS9A 3DOLA 1WCLA 4Z4HA 1BHLA 3JPOA 2HMIA 3CFRA 4HHTA 5KFXA 4I9LA 3TI0A 1VSLA 1RTDA 3IM1A 3ITHA 4FJJA 3DMJA 3HWTA 4ECVA 1VSEA 4RW8A 4R8UB 2FPMA 3OYJA 4IRDA 4E7JA 4NYNA 4F50A 5KFBA 1HNVA 4DSFA 1WNSA 1RYRA 2P5GA 3RB0A 4LSLA 2G8UA 1BPZA 2HHUA 1X1PA 2UVVA 3PNCA 3MECA 3NGDA 3C5FA 4ED1A 4CEBA 5HRNA 2BPGA 3ISDA 4CHPA 2QKKA 3JYTA 4CJTA 1S9FA 3AVBA 2DTUA 4QWDA 1ZQMA 3HXMA 1Y88A 3HM9A 7ICEA 4CGDA 4JV2A 4DTOA 3DLEA 2W9CB 5D3GA 5D46A 4MEXA 4ED0A 2XCAA 3TAEA 4BDPA 3EPIA 3DLBA 4CJ3A 3LP2A 2EHGA 4DTUA 4I2HA 4DO9A 4Z4FA 2M9NA 2NRTA 4FJNA 2P51A 4M3UA 1TKXA 3JPNA 5DG9A 3V1OA 4RPXA 2AQ4A 2A1JA 1WSFA 4RQ2A 3HX0A 2ZE2A 1HYZA 3B6OA 4FJ8A 3M8PA 1D5AA 7ICFA 4YXMA 3TARA 4E7LA 1RT1A 4PGYA 2VG6A 5KI6A 3KD5E 2OA8A 4KHUA 2IA6A 9ICNA 3KHRA 5KFUA 4PY5A 3TAGA 3A2FA 2JZBA 3C2LA 3NCIA 3NGYA 3LZIA 3L2RA 4UBCA 4JV0A 2J6TA 2W9MA 4Q45A 2HVHA 4ZH4A 2NUBA 1KCFA 9ICPA 5K14A 4ED7A 4CE9A 4MFBA 2PFQA 1VSJA 1CUKA 1B9DA 2PFOA 4JS5A 3OJUA 4DU3A 5DB6A 1MQ3A 2BCVA 4CK3A 4ECTA 4KPYA 4CF2A 4O3NA 4YQWA 1HYVA 4E19A 3QZ7A 5FROA 3PVXA 1HMVA 4O4GA 3DYAA 4HUGA 3BDPA 8ICLA 4J9RA 1NK6A 4LZDA 4NCGA 3T5HA 1DOQA 3EW9A 1HUOA 3F9KA 3KK1A 1K1QA 5DDMA 1UT8A 1DLOA 3DOKA 4N5SA 4B08A 2I5JA 4M3TA 2BPFA 4RUAA 3QEVA 4CHYA 1A5XA 1C1BA 5J2BA 3V81A 3AVIA 5DB7A 2HNZA 3C1YA 2HNDA 2IDOA 1S6PA 2VWJA 4M0AA 1T4GA 4FVMA 4CJQA 3MR2A 4UAYA 1MC8A 1FKOA 4O5CA 2HNYA 3ZSRA 3MFIA 1K1SA 4QZ9A 3NFAA 1X9WA 3TAMA 4DG1A 8ICBA 3MR6A 4R63A 4F5RA 1VSIA 4CIEA 5I42A 1S6QA 5KFZA 5J2JA 2DY4A 1JN3A 3LWLA 3BQ1A 4IRKA 2ZTEA 1UA1A 3EPGA 4C8LA 3RJHA 4FM2A 5KG2A 1D9FA 4Z4IA 1BIUA 1WCNA 5DGAA 3QEIA 4DTNA 4LD0A 5BOMA 1ZYQA 3G10A 2G8VA 4CJWA 4JK1A 4H4MA 3HL8A 4OPJA 4CF8A 3OYHA 1QTMA 5KFQA 1F21A 5F9NA 5J2IA 4OGCA 5CB1A 5HHHA 5C5JA 4RQ8A 3QEAZ 1ZQZA 3U3YA 1BI4A 4CJRA 3HO1A 5CP2A 3RMDA 2P6RA 4CIGA 4M45A 2FBTA 3T19A 1NOZA 1NJYA 5KFOA 4IRCA 3NBPA 8ICVA 5I3UA 4N41A 3BGRA 3C95A 4QWBA 1JLAA 4L8RB 3HJFA 2PZSA 3AU6A 1RT7A 1VSKA 3RRHA 5HP4A 1BPDA 3K75D 5KGWA 1RXVA 4BDZA 3JPQA 4XQ8A 4DOCA 1BISA 4M3ZA 1KSPA 4RW7A 9ICOA 4RW6A 1KFDA 3OYCA 4BWJA 5KT4A 1GOBA 9ICQA 4ZTFA 3V4IA 4E1MA 1WLJA 3SQ0A 3NE6A 3KD1E 4FW1A 4JS4A 4CEOA 2HW3A 1I3AA 4FK4A 2RPIA 1TVRA 1ITGA 4E7IA 4DOBA 1Z00B 3KKSA 3FDSA 4DLEA 3TQ1A 2YKNA 4EP5A 4E7KA 3SQ2A 4DOAA 4CJLA 4MEYA 1ZBHA 1G15A 3QNOA 1RDAA 4M9GA 3NDKA 1XHXA 2ASLA 2B4JA 4I2PA 2I1QA 4RG8A 4M3XA 3WNHA 3V9ZA 2GWSA 3QNNA 5KFGA 4NXZA 7ICTA 5KFCA 4PHEA 2ASDA 4TUPA 2XY7A 4EYIB 3JPRA 2BDPA 4IFVA 4DWIA 4M9LA 1ZQOA 5J0SA 1IG9A 4CGIA 2DPJA 4QZBA 1K6YA 3MABA 4MFCA 3EY1A 2UVRA 4K4IA 3EYZA 3DLGA 1QSLA 2R7YA 3MGIA 4DL7A 3ORYA 2A1RA 1WN7A 2YHAA 3SJJA 4LH5A 3LPTA 1NKEA 4O3OA 3VQQA 3OYDA 3PW2A 2Q0ZX 3Q8SB 4OJRA 3CG7A 4Z6EA 3KLIA 4FJGA 9ICFA 4ECWA 3CFOA 4CEZA 3ISCA 4KI4A 4N76A 4DL5A 7ICRA 2ASJA 3AV9A 3Q8QB 3RAQA 5KT7A 1BPXA 4ID1A 4DFKA 1HNIA 4UBBA 4LY7A 4I2GA 4OLAA 3RB4A 4KLMA 4K8ZA 3HPHA 4DEZA 3AA2A 4KB0A 1QQCA 3ZT3A 5KFNA 4O5EA 1YTUA 2ZUCA 1RBTA 5KFFA 4YMMA 2MUTA 4OGEA 4W5QA 8ICCA 2ISPA 2W9BA 4Q5VA 4CK1A 5KFKA 2E6LA 1XWLA 1VRTA 5CWRA 5HBMA 4CFBA 5HMLA 1T3NA 5KFPA 2PI5A 2WOMA 4AHTA 4DSJA 5SZTA 4GXIA 3NGIA 4EZ6A 4IQVA 2VA8A 4CJUA 3L2QA 1C0MA 1TK0A 4QZAA 4J9PA 8ICTA 4DLGA 1RBRA 3MDAA 2XC9A 1SL1A 4ED8A 1SV5A 3MR5A 3ZSQA 4YFUA 4BE0A 3RB6A 1LWFA 3ZD9A 1Z26A 3OYKA 4QZGA 3OS1A 2C22A 4I2DA 5KG6A 2ETJA 4BWMA 4I27A 4YR3A 1A5WA 3QETA 5J0WA 4OKKA 1L3TA 2F8SA 4DQRA 4O3PA 4KN7A 4I7FA 4RNMA 5FRMA 2G8IA 2GBZA 1TAUA 3AU2A 4MF2A 3AVGA 1X9SA 2QKBA 3ZSVA 2YNHA 1U04A 4IQTA 2R8JA 3O3GA 4F5NA 4CGHA 3K2PA 3K4GA 5KFHA 3PV8A 2X74A 3H08A 4E3SA 1RTJA 9ICCA 1TKDA 1IM4A 2QK9A 4P4MA 4KLIA 3RWUA 1Y97A 3LAKA 2RN2A 1SL0A 3KLFA 4PHPA 2YHBA 5KFSA 3ZT1A 4EYHB 4RT3A 4RNNA 1S5JA 4FLWA 3I0SA 1RT6A 4CJPA 5J0UA 1WSHA 2GV9A 3N4MB 4M04A 4C8OA 4QWEA 2BCSA 4F4XA 4E7HA 3V6JA 1ZJNA 5EWGA 1RDDA 1TL3A 4MF8A 3M9MB 3M9OB 3OY9A 1SKRA 3B0XA 1ZQCA 9ICKA 3QEPA 2BQ3A 2JGUA 3AA4A 4AILC 3NGZA 4KTWA 2FBYA 4J9SA 1RDBA 1Z00A 2ALZA 1D9DA 3V6HA 1NK4A 1S1TA 1L3SA 3ETLA 5J2KA 4IQWA 4RW9A 4CEFA 4FCYA 3MDCA 4YMOA 5J0OA 4AHVA 4CF0A 4K4HA 2FLPA 2I9GA 3SPYA 4KLOA 5DBCA 3SI6A 1YT3A 3MBYA 3CM5A 3OYBA 4Z4CA 5J0QA 4NCBA 1ZQAA 3KLGA 3AA5X 4FBUA 4R65A 4Q8EA 4O55A 1Z3EB 3O4NA 4F5OA 4RPYA 3AVLA 1GOCA 4DSKA 4M3WA 1KLNA 4JUZA 4XIUA 2YKMA 4O9MA 1U45A 3UQ2A 5J0YA 3LP0A 2C2EA 2YNFA 3IAYA 1EXQA 4DF4A 5J2AA 1RTHA 1D8LA 3SUQA 4AHCA 1J9AA 5F9LA 2F96A 4UB3A 4AH9A 4CK2A 4CF1A 3G6VA 1S0VA 9ICMA 4NCAA 2G8KA 1T03A 1QE1A 1RT3A 2G8HA 3KHHA 5J2DA 4BACA 4P2HA 4J9QA 3Q8RB 2ZUDA 3LP3A 2DPIA 5KG1A 4WE1A 3NF8A 5J2GA 2ZTDA 3AVAA 3QERA 4M41A 4J2BA 2RDIA 7ICQA 4BGDA 4XUSA 4RQ7A 1XU4A 2V4QA 4YMNA 4F3TA 5KFVA 3K59A 1TGOA 1VSMA 4F4WA 2BE2A 4DSIA 3HK2A 4CGGA 2PY5A 2PFNA 1S9GA 1N56A 4FYDA 3VQ7A 3QO9A 1TK5A 5J2CA 2D0AA 4QAGA 4K4GA 1ZBFA 2IHMA 4CJEA 4PH5A 1BPEA 3WNFA 4IR1A 3OHBA 3V1RA 4KRFA 5BOLA 1MQ2A 2B21A 3PX6A 5T7BA 4N56A 3PX4A 7ICOA 4EBDA 4W5NA 4DSEA 1WAFA 3K5OA 3VQBA 2FLLA 3OYMA 4ED2A 5J0TA 2R8KA 4FXDA 4YN4A 3DRRA 4O3RA 3CQ8A 1IXRA 1HQUA 3ZT2A 8ICZA 3AO2A 4F92B 4FLYA 2BGGA 1XSPA 1U4BA 4RQ6A 2AJQA 3RJIA 3NAEA 4YR0A 5JUMA 1JLGA 1HJPA 2Q3SA 1ZQFA 1ZQLA 4BXOB 3RH6A 2ATLA 4JV1A 2IHNA 1W9HA 1ZBIA 4AHRA 1KLMA 4F3OA 4O3SA 1B22A 2Z1GA 4BE1A 3PX0A 4M9HA 4I2CA 4TUSA 4DFPA 4QZEA 3HP6A 5J2FA 1T8EA 2IMWP 4GC7A 9ICTA 3G6XA 1RCHA 4JWNA 1GOAA 3VQ9A 4IKFA 5IIJA 2OPQA 4YXJA 4ED6A 4PPXA 5IILA 5C25A 4KFBA 3AVJA
chains in the Genus database with same CATH superfamily
3Q2TC 4EO6A 2QLBB 1HNWK 5HROB 3LOUA 4PQAA 2A1BA 3ILOA 2FUG9 1O6XA 4NA3A 1X3NA 3ZX3A 3LPEA 4JI1K 3UIQA 4AXIA 2F8EX 3IAM9 1H3DA 5KL8B 1N34J 2YKOA 3QZ8A 4DN0A 1XERA 4TN2A 3CXCR 5KGXA 3MEGA 4FWNA 4YP3A 2ZJ8A 5ALQA 4TYBA 1IKXB 3V7JA 3T3FA 3LGNA 2WB1C 4PQUA 1RILA 1S97A 3T69A 4GXKA 3VERA 3U02A 4KC5A 4FXWA 2A1SA 3HKWA 2R2UA 3MURP 4ERDA 3HFZB 2RE2A 4KITB 4CLSA 1NDCA 4NEZA 1EETA 4HI2A 4EHUA 4YHHK 1DEJA 2O3DA 4IG3B 2QMWA 2Y1RI 2IOCA 2XGQA 4DI6A 4MLHA 1Q53A 2CPHA 3TAPA 2KKHA 4OI2A 1O1WA 1BHNA 4LRBA 5HLFB 4CFCA 3AA8A 5DO2A 4WF9Q 3DAWA 3CUNA 1VQLN 4JWMA 1ASVA 4LZGA 4OYMA 2RUSA 3J7ZO 2G09A 2BM1A 1BUXA 1J2VA 2DHHA 3MM7B 4UW2A 1RXWA 1ZQTA 3OLBA 4DV7J 4R8UA 3R7BB 1FA0A 1S76D 4X84A 5AK3A 1C0UB 3AVMA 5HATA 3KG4A 3KK3A 5ADXA 4Q44A 3W8PA 2PFDA 3MTKA 2UU9F 3K5MA 5SWMA 5AKJA 2ASOA 1G4CA 1UPMB 3A5OC 1U6BA 2ZIUA 5C24A 4PGQA 2Q43A 4H0YB 3SCKE 2XBPA 3SQOP 2KI2A 3ULEB 3VQDA 4O3QA 3TOQA 4K4SA 4IEEA 4CM0A 3THYB 3OSNA 3U9ZA 3E9LA 1IR0A 1UCVA 1N5YA 5BYSA 1I39A 3J7YU 2VOPA 2OZSA 4CDIA 1BQMA 3OPKA 1FRIA 2NXEA 1IWAA 4IFYA 2O4GA 1D1UA 5D4PA 5HR7A 4IWVA 4I6YA 3QEXA 3EO3A 1NKBA 3H5XA 3P49B 1SUQA 4OZ2A 1E6VA 3NH1A 5F2RA 2XHWA 1EP4A 5AQTA 1A76A 2WW4A 2RP5A 3KLHA 2ZJQQ 3V9XA 3DM2A 3Q8YA 2DRAA 3L3UA 1FDBA 1QQMA 2OO4A 4NX9A 1BQNA 2KG0A 2V5HG 1WWVA 3DOMA 1TV6B 2FPLA 3ULDA 3PMNA 2LA4A 1NXIA 4ZP8A 3H45C 3EXYA 1SB3C 3E58A 2HVEA 1O5JA 1X6IA 2JHDA 1JJCB 3SBTA 2KDOA 3M9NB 3I1YA 4RW4B 3TP2A 2J9EA 3G8TA 2K8BB 3BBBA 4ZS6A 4OKEA 2EAMA 3M2RB 3AHPA 2IS3A 2ADCA 2IBKA 4YVZA 2OWOA 3CCRS 2VFTA 1FJGK 1T9VA 3CW2C 4MH8A 3PY8A 2OPSA 4KHPK 2N82B 4CESA 2XTJP 2QARB 4LC9B 5CXTA 3L95X 4RTFD 1J97A 4U6PA 2KB2A 1ZA2B 4KHRA 4PWDA 3CMAS 2LYBA 2K2PA 1VC0A 1IBKJ 1WUDA 3DNCA 1Q5YA 3VVUA 8ICFA 1Q4RA 3R3LA 2RKIB 5GAEU 2MAXA 5DB8A 3GIKA 1F9HA 2R8IA 2J8SA 2E1YA 3QINA 3FSXA 1P9YA 4EENA 1PSDA 2QZ8A 3KXDA 2IJNA 5HROA 4IQXA 2AP1A 4AF1A 8ICMA 1RT1B 3H5YA 2VG6B 2Y9HA 1Q0NA 3H1VX 5DBBA 1SJ4P 5DQIA 2CQBA 3EKUA 2GJFA 1H7XA 3OBYA 1NK9A 4LVNP 1LWCA 1IKVB 5CD4H 1NJXA 3UVJB 4F4KA 1FRXA 2GUPA 3C23A 2N3LA 4CO2A 2EK6A 5BRDA 2XY5A 4W90B 3SUPA 1KEJA 4BRHA 2KRBA 2WUSA 2R2SA 3EGZA 2VANA 4FS2A 2P9SB 2QV6A 1QQ6A 1V3RA 1ZQKA 4DR2J 4B8AB 4HDHA 4IG3A 2P2CB 2HBKA 3LVVA 2UZAA 1XTZA 2E5IA 2ZJRL 3DYAB 4DFJA 2DFFA 3CERA 3T9NA 1XO1A 2EFPA 1VR6A 2WBMA 3LDOA 1JLFA 3UW1A 1EQMA 2HK3A 1RU1A 2QSWA 4GXJA 3S01A 4M7XA 2KVIA 3NVMA 4HUFA 3MM7A 2F8LA 4MFFA 3QSYB 4C8MA 3AOAA 3V81B 3AO1A 4L72B 1IWGA 3ENAA 1J5OB 4B3RJ 3FSIA 1PZNA 3HT3A 1XR7A 1QAYA 4M47A 1Q8BA 4LFBJ 1NGDA 5ITHA 4BR9A 3EWAA 2P8IA 5KFJA 1WEYA 1KEKA 2MU2A 4I29A 3D0IE 5D8HB 1N61A 4CGJA 3NS6A 2UXDK 4M63C 3TAQA 1Y7PA 4K8RA 1B43A 2XSJB 1IM6A 1Q7LB 3ULEA 1N62A 3MR7A 1F2HA 2AJ2A 3MM9B 3PKMA 4FWPA 2WW8A 1XC9A 1JIHA 4GW6A 1JWWA 1VQ4S 3L3CA 1TUYA 1YBUA 1V4TA 3NGTA 1YAGA 2M4MA 3PACA 3CULA 4C7QA 5THWA 1I1GA 2W42A 3WK4A 1NGIA 1ZQSA 5JVHL 2Y1LB 3M05A 1HR0F 4QR2A 1WG4A 1Y3JA 4H0VB 4CJFA 4DUYJ 4O23A 2HOFA 3NAIA 3FZ2A 5ALSA 1TUUA 1DK2A 1BPYA 3CDWA 1VSHA 4Q0BB 3ADAC 3BZCA 2E1ZA 3HSZA 3RH5A 3J80U 1YX2A 2B9EA 4KQZA 2GHWA 3R5AA 3Q83A 3BQ2A 2HHHF 1X3MA 3OHRA 4AE5A 1FFVA 3JPTA 1S7HA 4B3OB 4ELUA 4PZVA 3QQCD 3RRGA 3VQPA 3JSBA 4C48A 4E2FB 5KG4A 4WIIA 1F0XA 1WSEA 3MEKA 2F8HA 2XMUA 4EEYA 3AA3A 1TV6A 3NBPB 2JLGA 3NH2A 3CCSS 1R3NA 4DPWA 3ZC4A 1JL2A 1NH7A 1QHTA 4DFDA 4DL3A 3HHKA 4BRDA 4I2AA 2AH5A 2XICA 3ZI4A 4AFFA 3SCIE 4RW4A 4Y0WA 1Z05A 5B0CA 2G08A 1S48A 3SFUA 2FHMA 3ET6B 1IUJA 2XULA 3FMWA 3LDSA 3D45A 1FX2A 2CIMA 2UVUA 1RI7A 4YMEA 4RW7B 2QC3A 3LK9A 1LWEB 1JXLA 2QA1A 1OXJA 1RKJA 4ENOA 3DLLQ 4XRHA 9ICSA 1QLNA 2OI2A 2OD4A 5ETPA 1ZM2A 5ALXA 1TVRB 3MF5A 5D15A 2DFEA 4MLEA 1P9QC 4Y1CA 3RUBL 4U8YA 3U9DA 4JI3F 3O6WA 3PMLA 2HKEA 2J76E 3ZZPA 4L73A 2RKIA 3GLJA 2QWLA 1ZTWA 3D9BA 1KN6A 1EKEA 4FO6A 3SZ2A 1X4AA 2PDAA 2F7VA 3VQAA 2UU9K 3OJSA 1LB2B 3I28A 3F2CA 2OKQA 4HVZA 4NL5A 5LSLA 3LANA 4QIWD 3E9OA 1GEHA 3HVAA 9ICHA 5HNKA 1ZM4A 4P72A 3HLUA 4JKEA 3GV7B 2QE5A 1DGKN 4B3SJ 3DDIA 3VHQA 4CFDA 1TMMA 1IKVA 4ZP6A 2P9PB 2AA4A 1Q79A 5KFEA 3VF0B 2MKSA 5AHXA 2VPWB 4NLVA 5L1LA 1PK1A 3NRBA 1CZBA 1IQTA 4ZPBA 1O13A 3HSGA 4DS5A 2P9SA 4KLGA 4OYZA 3UM9A 2QIFA 1RAHB 3IWNC 2WTFA 5M2RA 3UMGA 4Y2QA 2HS0A 2ZZMA 1PO6A 3VENA 4FBTA 2EFQA 1BNPA 2YWHA 2HWTA 1VS3A 4X4RA 2JX2A 2XZWA 4C4RA 3HMJG 8ICKA 5CA7A 4US9A 5IINA 1F6TA 4B02A 4I0WA 4JI2F 4DR1J 3IRWP 2I7PA 3WEEB 2DVIA 3D0PA 1NOYA 1J5OA 2JVOA 5HVHA 2D5RA 5ALEA 5L9NA 1A6SA 1FRHA 2VCPA 2Y0SD 2YH0A 2ZHBA 4CBWA 2FLOA 5H9FJ 3R7NB 2GJIA 4B3MK 2J8AA 1VRTB 1OQ6A 3IDWA 2XSJA 1FKAF 5DKWA 1Q9XA 5B0BA 2F4FA 3MC1A 3C14B 4Y34A 3VAGA 1QVFR 2W6LA 4TY8A 4LQ3A 2HFNA 5AKEA 4O4RA 2GLEA 4FNIA 4X62J 5E7OB 3T5LA 1REGX 5AE3A 1T94A 3NCRA 1ASUA 4NM1A 2QX0A 3I76A 4FLUA 2KP7A 5F3XB 4URQU 4NLGA 1JLBA 3AQPA 4DU8A 3DLRA 5CZ1A 3O3LA 8ICUA 2JMGA 2X6NA 2OLWA 4CHZA 4I28A 4Q0BA 3BB5A 1VI7A 4UOHA 3W65A 4PKIA 4ZVQB 2KIWA 3O9UA 4I7FB 5KFYA 4OZNA 4FWLA 4B3OA 1N5WA 2QB1A 5K8OA 5AZJA 2BW7A 4UASA 4KB7A 3IKMA 3OV7A 3QRPA 3WXJA 2K60A 2ZJ5A 2ZQBA 2FPHX 3QGHA 2H5XA 2K4IA 1HKGA 3U4LA 3OGUA 2EANA 2M70A 2B9YA 1RT4B 1U02A 2BXJA 3LGHA 2VKZG 3KLFB 4CHQA 1TKZB 1LWEA 4JB3A 4EBCA 3ZDBA 4PG4A 5J8YA 4EBEA 1HD1A 4TQRA 2DNKA 2DHGA 3C16A 4DL0C 3RVCA 1XSNA 3BO4A 4H5RA 4KHWA 2W01A 4UAVA 2B43A 1LAVA 4C1NK 4ISFA 2K4PA 3VQ8A 1GLAG 4L3NA 3SMSA 3E1YA 4N47A 4HVJA 4RW9B 2C42A 1RWPB 2JFDA 1L8OA 4CZGA 1TK8A 3TU5A 3BSCA 3DOLB 5GAHU 2D6FC 2QTDA 4P9SA 1Q82O 3D2SA 2GO7A 2FMSA 1Y00A 1XR6A 4ED3A 1IBLJ 1RWNB 2HLUA 3RRKA 5KG5A 3IV6A 4C3LA 5C2FA 3QU5A 1VHIA 2P9GA 2FBVA 3E2EA 2HS4A 3CI5A 3DI6A 3DCAA 1U8SA 4KR0B 2OGUA 1U2RA 2P9PA 3GYGA 3TUIC 3IO1A 1HR0K 3OTBA 4LFAJ 4LSLB 3CJKA 1W0HA 4BR2A 2AZ3A 2RRAA 2L41A 2M2BA 1Z4UA 1QE1B 3JYTB 2IIHA 1RAIB 1WHVA 4ZVFA 4V19X 1MWKA 1H6KX 2HGMA 1U26A 1Q95G 4ZTJA 3NVZA 1YBTA 1ZZNA 1BL3A 3ENVA 5E84A 3QUBA 3EWGA 4UAZA 3GG1A 5KL1B 1SKWA 3E51A 3P38A 5B66U 1ATNA 2QWNA 4KLJA 1SWWA 4M5GA 2BE2B 1TL1A 2KW4A 4CRJA 2WHEA 3MOZA 4NLUA 2GAHC 5A2QY 4XH5A 2M0NA 3TJAA 4OHYA 3U6FA 3ENWA 3GIIA 5DLFA 3IHQB 3RBDA 2CPYA 2JOQA 3IBWA 5AQIA 2E1MC 4E1JA 5BREA 4WFYA 1KN5A 7AT1B 1NGFA 1X31C 5GAGI 4BRKA 4B6JA 5IT9Y 2EFNA 4OYXA 1KRPA 5CQGA 4JV5K 1X4CA 3NS1A 2D0BA 2LPEA 2DCLA 1XSLA 3C14A 4K0KK 1J53A 3DRPA 5D4BA 2XO6A 3D2QA 3K7RA 4MK8A 2CWXA 1TFYA 3CCVS 1JQGA 5AQXA 4JI3K 5BPCA 2NYHA 1WC3A 3FC9A 4AYBD 3NH0A 4YNQA 2LM4A 5KT2A 4DTSA 4CT8A 4U67L 4J9LA 2BJ9A 5DQHA 4CEAA 3BREA 2MZQA 2ZIXB 1VJ5A 3Q8MA 4TSXA 5HQ8A 9ICUA 1I5OB 3UCGA 2BKPA 1FK9A 1VLBA 4TYAA 4ZPVR 1RBVA 5AKLA 2ABYA 5K8PA 2W03A 3P5BP 1X5SA 1VQ6N 2HNZB 2HNDB 2QXFA 3GFXA 2ASYA 4RO0A 1UTAA 4LFCJ 1ZBUA 3RJJA 3QJPA 2VPZB 1WWUA 1VQ7N 2B7CB 3C15B 4U7BA 4Z37A 1NK7A 1RT4A 2K1RB 4DG1B 4LRAA 4EI2A 2JEIA 2J9DA 4QW8A 3B54A 4ELTA 1TKZA 1OYDA 2BJ7A 4CHOA 4YS2A 3BGUA 1QJHA 4QYZK 2AKWB 1KVCA 2MQPA 2G13A 1ZPVA 3L4PA 2NYVA 3UNGC 3TFSA 1KVKA 2A19A 1SH3A 2CPDA 5JMNA 2KLAA 2RU3A 3NLCA 1CJKA 5HAOA 3VAJA 4KLEA 5AKKA 3N4PA 5B08A 1XMQJ 3HHLD 5M1PA 1HPMA 2NXUA 1G6BA 3T5JA 7ICMA 3F56A 4PZOA 1VQ9N 3DOLA 1WCLA 3JSYA 1LFWA 2E2PA 4OYPA 1BHLA 3FE1A 3JPOA 1RT5B 2OJ3A 3CFRA 2WB1F 3W61A 3SDEB 4B1YB 3AB4B 3TI0A 5AQSA 3QT7A 5KAIU 3N7SC 5T41A 1JLAB 1RAAB 2KHDA 1E4GT 3V6DB 4I2QB 3OYJA 3J81O 4NYNA 4DOZA 3WHIA 2KNJA 1HNXF 2O1PA 5HQMA 5F8GA 3N9UC 5HI7A 1R8PA 1NZPA 3D6TB 3RB0A 4LSLA 2PBDA 2N1RA 1UEKA 3D4JA 1GH8A 4KO0B 2AX0A 2YKAA 3R9KA 3OR2B 1X0PA 2DWQA 2WB4A 3JYTA 4Y2VA 1U6FA 3AVBA 1ZQMA 3HM9A 1RACB 2HCFA 3FEYB 4DTOA 2W9CB 2XS7A 4F26A 3MDQA 3I5CA 3MHYA 2MZSA 5BRFA 2J7KA 1CJUA 4OX6A 1GAOA 3EN9A 3W2WB 1YVFA 4IKAA 3MX2A 4OYOA 3BH6B 5ALIA 4TNOA 2EHGA 4Z4FA 2O8FA 4FJNA 1RHMB 1YI2N 1TKXA 5DG9A 2EBGA 3V1OA 2NZ4A 4NLCA 1FRLA 1KVIA 4DV4F 1RHRB 4PR6A 3M8PA 3TKAA 1D5AA 4E7LA 2C3PA 3M30B 1RAOA 2HBYB 2KK0A 5KI6A 4KHUA 1IXKA 2O6KA 1UPPA 5KFUA 4PY5A 3TAGA 2DR7A 3DV9A 2OXOA 2GH1A 3UDVA 3NGYA 3T1YF 1N0UA 1OJ4A 1PKUA 2J6TA 3OL6A 3LVWA 1VK3A 2LHTA 4ZH4A 4ED5A 3WXKA 5A2QO 5K14A 1HI1A 2OEMA 2GHPA 4MFBA 3G82B 2PFOA 4WFAQ 2H3VA 2V2KA 4NL9C 2R7VA 4IFEA 2GOLA 3ENOA 4CF2A 3LO3A 3O80A 1U09A 3FCWA 3P96A 4WFBL 4FWKA 3D0GE 5IT9O 4NXMF 3BKUA 3BDPA 4W92B 3IG5A 4UATA 3I32A 2C2MB 3T5HA 1OSDA 1M1KO 1HUOA 2ZIXA 1UT8A 5AQUA 1DLOA 3DOKA 2BRKA 4HAIA 4IH6A 4M3TA 1A7GE 2YTUA 2BPFA 2CG4A 2DR6A 2XIDA 4JHDA 2HNZA 3SIPB 2HNDA 3ETOA 2VWJA 2EZXA 4CNYA 4FVMA 2IRUA 2HHPA 4CP5A 2DXDA 2P9NA 3D1OA 3KNAA 3C15A 5AKZA 2P9IB 2KIVA 2K1RA 3TAMA 3G4SN 4DG1A 5GTIU 3MR6A 4BRGA 2JV3A 3VQSA 4OL8A 3W9IA 4F25A 5J2JA 3BEGB 1CQNA 4FWOA 2WOMB 4KGVB 1E4FT 3JQMA 2FTRA 1V38A 1H0HB 3RJHA 2DNZA 5LL6Z 4WFNL 4C3KA 1D9FA 2EZZA 2BKOA 1XIQA 2YBVA 5DGAA 1XNSA 2U1AA 4DTNA 3NEKA 5BOMA 1LWFB 2R7RA 5ALVA 4JK1A 2A2CA 2UUAJ 4WFNQ 5LMNK 4EHTA 2KH9A 1N5TA 5BYQA 2A40A 4MKBA 3MK6A 2RHSB 2LXFA 1ZQZA 2CNKB 3A0HU 4CJRA 3A5NC 4M45A 3TQEA 1NJYA 2H3FA 4IRCA 4ZA1A 3MWPA 3RW7A 1YIJN 3SDEA 2F7TA 1JLAA 1TAMA 4L8RB 5D4NA 1FTRA 5AQYA 4MMOA 3ILJA 4JP8A 2DNLA 1XNQF 3C0BA 4WQ5A 1RXVA 2WF7A 3JPQA 1DZ5A 4M3ZA 1UQVA 2C2ZB 3QAUA 3AN1A 3I55S 2ZF5O 4ZVGA 1KFDA 4OYBA 3QFUA 4ANDA 2ZH7A 3OYCA 4OMFG 2MLZA 4PKDB 2CZVC 1GOBA 9ICQA 2M52A 3L7PA 4ZP9A 1HI8A 1X40A 3NE6A 4FW1A 4ZKAA 2E1CA 1FO1A 1KC8T 2HGNA 4TXSA 3FDSA 4DLEA 3ISND 2FVCA 5CZVA 2WRMA 4FWRA 1LEOA 3QGPA 3BH7B 3WT0A 4DOAA 3T1HJ 1QQNA 2KSOB 5IWAF 4XDCA 2W25A 1NDKA 3M7VA 3ZTOA 3H42A 2I1QA 5IV4A 1CJVA 3I96A 4RG8A 3L6QA 3D3CJ 2YWEA 1BWFO 2GVDA 3JTPA 1LK5A 3V9ZA 2VGMA 3QNNA 3H5SA 7ICTA 5KFCA 4PHEA 2VQEF 5HMWA 3IFEA 2YWGA 3JPRA 4X4UA 4DWIA 2LEPA 1VDHA 4M9LA 3HZGA 2YMPA 4MO5A 4ZDNA 1ZQOA 3LDPA 5J0SA 3BKTA 4NLYA 4MO4A 4JK8A 1OH7A 3ILLA 4LF9K 2DPJA 1RWWB 4DR6F 1IBMK 1X8DA 1K6YA 2IC3B 3MABA 1B99A 4JI5J 3G82A 3M6XA 3EYZA 4IQMA 3K2YA 2A1RA 3KLEB 4HWIA 5AJ3J 3J7YI 5BR8F 3UKRB 3OYDA 4OZ0A 1PYOB 3CEDA 3OL7A 2Q0ZX 1K44A 4LF5F 4LR7A 4FJGA 4JYAF 1RHJB 1RHKB 1PAUB 9ICFA 4Y6IA 4ZITA 1KBUA 1BDGA 3ISCA 1Z2LA 4N76A 2D3DA 2ASJA 4HKQA 3VESA 4K4XA 4ID1A 3QSIA 4DFKA 4LY7A 3ID6A 1FD8A 4OLAA 3I31A 2ZH3A 3RB4A 4K8ZA 3HPHA 1M5VC 3CMES 4M94A 1T3VA 3UO0A 4O5EA 1YTUA 3VETA 1S4FA 2G2YA 3SFGA 2K7KA 4IDKB 5HVGA 8ICCA 2H9ZA 1JUDA 1TUGB 1KXPA 2DH9A 1L7NA 1XWLA 2P9IA 2FVQA 4HT7A 5F8NA 4WYBA 2Z4PA 5HMLA 1T3NA 5KFPA 2VBWA 3EM1A 2WOMA 3CMQA 4DSJA 5SZTA 4GXIA 5AFUH 2VA8A 4CJUA 3E01B 3L2QA 3OTOK 3UCZP 2D69A 4DLGA 4A2BA 3H7HB 4ZK7M 4BHQA 1RTIB 3H6EA 3JXUA 4YFUA 3IM9A 5HN0A 3SENA 1LWFA 2UUBF 1Z26A 3OYKA 3FLCO 2C22A 5KG6A 2DBBA 3ZTSA 4HH0A 3I5BA 4Y2PA 1VQ8S 4X66J 2KJ9A 5E3QA 4DV4K 4FPIA 1L3TA 2F8SA 4RNMA 5GAEI 5FRMA 1KLMB 2G8IA 4DPYA 3TZYA 1TAUA 4RQMA 5CE3A 4MF2A 2GQQA 2ZWHA 4JK9A 5EUHA 1ZM3A 3AL0B 3QYPA 1ESVA 2K89A 2R8JA 3MN7A 3K2PA 2D0OA 5J1EB 2X3GA 1FI4A 5ALOA 4V19J 3QMQA 1Z6RA 3H08A 4ZPDA 1IM4A 1RAEB 3RBXA 2QK9A 3LAKA 5ALGA 2VPYB 2RN2A 4JOUA 1SL0A 2CNNB 3A1YG 5KFSA 2D3O1 5FJ4A 2QMUB 4RT3A 4RNNA 5AK4A 1ZD4A 2F9JA 5J0UA 3CJ7A 2E7XA 2MJNA 1XNRF 4NXMK 4EGLA 1ZA1B 1SKRA 5ETMA 3K17A 2JGUA 4TU9A 3NGZA 3UR0A 3CD0A 1RDBA 3E3XA 2RHFA 5CYQB 4B1UB 4DR5F 4IQWA 4CEFA 1KR4A 2EKNA 4YMOA 2J0QD 3CCUN 2KMDA 5DBCA 3AFGA 3SI6A 1M90O 1WC5A 1N5QA 3MBYA 2G0CA 3OYBA 4CVNE 2A2DA 2LLZA 2IM3A 2OANA 1EQ0A 4PAAA 3FFKB 1QD1A 4Q8EA 1SQGA 4IXCA 3SXLA 3MMBB 2I5HA 2JWKA 4UARA 4C9DA 4RPYA 3AVLA 4FWSA 4OV6A 4M3WA 3CC2S 9RUBA 1AUDA 5J2NB 2E20A 1T9YA 3NNAA 2F4VF 4FDFA 1FESA 1S1VB 4ISGA 1T11A 1EQYA 3QU4A 2C2EA 3VZIA 2BVZA 3CWJA 2D74B 5C0YA 2G07A 1D8LA 2HRUA 4WP8A 1I3OB 3M2VA 2PSZA 3M8QB 2ZH4A 4ZOHC 4UB3A 2F96A 4YY3J 3RW6A 3WK5A 4CF1A 2XMAA 3QIDA 9ICMA 1WEXA 5AQLA 1X4EA 4K41A 4ZPAA 2GTDA 3FK4A 2ZUDA 3LP3A 2DPIA 1L3KA 1ULRA 5ALTA 3NF8A 1NI3A 1TKTB 1YHQN 4RCHA 2XEXA 4ZVOB 1Y5IB 2LQ9A 4J2BA 4TY9A 3T9ZA 3SAGA 2V4QA 2HFSA 3QIPB 3JSMB 1X60A 1N36F 4F0KA 4ICLB 2CPJA 1PJ6A 4UAUA 1V6HA 3VQ7A 1DTTB 2YNGB 3QO9A 4OHZA 2OUGA 2YI1A 5J2CA 2D0AA 4XTTA 2E9RX 1IR2A 1ZBFA 1CJTB 4CJEA 1XNQK 4P71A 3WBZA 3KVGA 3F0NA 4ZCLA 3D7SB 2EQYA 5KAFU 1RTZA 3FBBA 3V1RA 1NU0A 3O8WA 4DUZK 2DNPA 1YXQA 4K42A 3DEEA 2WMMA 2OIHA 5T7BA 2VHGA 4V19S 2VJUA 3PYEA 4DXLA 3DGPA 4KX5A 3NVKA 2FLLA 4NLWA 3OYMA 3B6BA 2P9KB 5HQLA 5A0LA 5B0DA 4O3RA 1IXRA 4CJ7A 2JRZA 1HQUA 8ICZA 3AO2A 4JI6J 2DGVA 4CI0B 5IWAK 1U4BA 1TL5A 3RJIA 4J7CA 4L6V3 1ZQFA 1ZQLA 1DKGD 3FRYA 1NM1A 1V4SA 4BXOB 2ATLA 1RJJA 4Y00A 4Y28C 4PYDA 3R1XA 4X65F 3L3FX 1FDNA 1KLMA 3IFRA 4O3SA 4JI4F 3WXLA 4BE1A 4M9HA 2VQEK 4NLOA 3Q24A 4I2CA 2IOFA 5ALPA 3KMSA 3HFKA 2MRLA 4V1Ak 4GC7A 3G6XA 2OH2A 3JS9A 4QIWC 3K0JA 1GOAA 2Q6BA 4LRDA 2OPQA 4DR6K 4YXJA 4ED6A 4PPXA 5IILA 1HNZF 3LM9A 4KFBA 4QZ8A 3R5BA 3A13A 4CQ1A 4BGBA 1KQSM 4UY8O 2WC9A 3BM7A 3X1LB 4UZBA 3I82A 2AW0A 4BG9A 4WPAA 2J6SA 1Z2ZA 1RBOB 4OI0A 2QWMA 4DB3A 3QLHB 2FHKA 5I4MA 2MY7A 4KJIA 2E6MA 2P9CA 3TACB 2DRDA 4QPTA 5EWFA 1VQNN 4JYAK 2E1AA 1RISA 1S1WB 1RA7A 3PSTA 3CNHA 3KHGA 1CZAN 2I1RA 3AH6A 1WHXA 4BR7A 2PEBA 3OPXA 1HWIA 1CEZA 2JSXA 5CYQA 3NUQA 1UCNA 4A8FA 3PUFA 2CN1A 3EX7B 1FE4A 2FQQB 3CM6A 4BC9A 2HQCA 2CG8A 2JRSA 4G65A 1WG8A 1LKZA 4HH1A 2W4PA 1O0PA 5KFMA 1T05B 4EX7A 4RKUC 1B64A 2G9OA 1KQFB 4GKJJ 1N4LA 1VC5A 1HX1A 3MMBA 3PHTA 2Y0SC 3FBCA 4DJBA 2XO7A 2G1HA 1J2MA 4NMLA 3QJJA 3M3ZA 4DPOA 4OZ5A 1YGYA 2XHBA 1HA1A 5EY4A 2CJYB 5FLXY 1YJ9S 4CWBA 4OI3A 3L2UA 7ICVA 1FFUA 2VQFF 5IM0B 1RADB 4HCCA 4BDYA 1ZBTA 4AXJA 3FQLA 1E6YB 4IO9Q 1URNA 3MPDA 2UUBK 1LAWA 3NG8A 5L1IA 2M0GB 5D4LA 4ER8A 1VC6A 4DV3K 2NQPA 1HRHA 3C2PA 1TYQB 4I69A 4X64K 2NREA 3JSRA 4DDFA 4ZOSA 3M6VA 1YRUA 2E9TA 1NEEA 2X3DA 2BUPA 2UP1A 1H73A 3TZXA 4M3RA 2IGIA 3KD3A 4IZ9A 3TJ8A 1YWXA 2LEBA 2GX9A 2QYGA 1FF2A 3H3NO 2HHHJ 4ICLA 3EJMA 1S1XB 4AL7A 2M3DA 2HAFA 3QU2A 5HR6A 2N4DA 4XEIA 5I9EB 5DDYA 1DTTA 4M8LA 4C1NI 2UXBF 2V63A 4OHXA 4J2DA 4KI6A 2J7WA 3IS9B 1RAJA 4K2XA 5F3TA 4IR9A 2LDYA 2M7SA 2W4DA 2V8PA 5ALZA 5E26A 1TL4A 2BUNA 3PYFA 4BRMA 1TVAA 2JFKA 3AAPA 3FRZA 4H4KC 2CRXA 1YJVA 4ZCIA 2CJBA 2GX8A 4M1KA 1NPRA 3F73A 3T79A 3F2KA 3AD7C 2P9KA 4I4BA 2Y3YA 4WYLA 1VAZA 5LMUK 3KWMA 1EKSA 4FM0A 3MEEA 3P3DA 4LT6A 1V85A 2ZOGA 3P1GA 3U1LA 3BSNA 3GOIA 4AD6A 1SKSA 4CD1A 3PO5A 4FZLA 3C2KA 2MYFA 2P6SA 5J2MB 2FVSA 4BXOA 4UB6U 3ZXWA 3D7EO 4CIOA 4J5OA 3AMZA 4GVBB 3L2WA 7ICUA 3PNIA 3H0PA 1O08A 2CGKA 2HPUA 5BN9A 4TU8A 5D3GB 2XMKA 5H9EJ 1SC6A 2VV5A 3P39A 2KN7A 1QDUB 3NNHA 3O9RA 1PJ7A 4A46A 1URJA 2MLXA 2V8DA 4ID5A 4R5PA 4LF6J 1JX4A 1RZMA 1OW5A 3QATA 2UUWA 2WVCA 3LP2B 2RHQB 1U1PA 2AGOA 2RDDA 3FYHA 2YQ3A 2F4VK 4P4PA 5AM3A 3UN5A 4MK9A 5EOZA 3DLKA 3KKAC 3M32B 4FZXC 4USUA 4CH7A 3L8BA 1DJ0A 2CADA 5ETLA 2QL9B 1Q18A 3CJ4A 3EZ5A 4KLHA 5GAHP 3SQ4A 3MTJA 1QUVA 2GMHA 2KICA 3OYFA 5KQ8A 1UT5A 4K4UA 1N33F 1L6NA 1BLUA 2V7YA 1PGZA 5KG3A 3QLHA 2UXCF 1NGJA 3ZTRA 4TVAB 1XMOJ 1RB0A 3R8EA 4BVPA 1H38A 3NMUA 1S1WA 3CHWA 1ZOLA 2WF5A 3VQ5A 3PHEA 4WIQA 1L8LA 3N28A 2CRLA 4LR8A 4KBIA 1C0TB 2VKQA 3VR1A 4MIWA 3BYRA 1N48A 5CR0A 1N36K 2HBJA 4QZFA 3LP1A 2HAIA 3HW8A 1KL9A 3WKEA 4UUXA 1UZHA 2VD3A 4DS4A 4E0DA 1VLOA 3US5A 3CCES 1U2VA 2DJWA 4I9QA 3PSIA 3BQ7A 4NCGB 1UETA 4KLQA 5A8RB 4J9OA 4JI2J 4NLKA 4OZLA 1UJ4A 3CT9A 1T05A 3LF0A 4TKTA 5KFIA 2OP5A 3SSRA 2ZNYA 1NPPA 1UEUA 3AOBA 3P4UB 4Y2CA 4BY9C 4C97A 1R6VA 3ISZA 1X0FA 4NLNA 1VK8A 3CCRN 4AHSA 3S3NA 2LYHA 2WHOA 2MB0B 3JAMY 5IM0A 4DQSA 4CECA 1FKOB 2BGWA 4PL8A 3S1TA 1E6YA 2HNYB 4OPKA 1SL2A 4NY8A 4G1PA 1I94F 4P2MA 4E98A 1TUWA 3F53A 5D0EA 4AYBC 3CMAN 2KZMA 3SUOA 3AVFA 2BPCA 2PFFB 3EDRB 1TYQA 3UMCA 4X65K 5KNIA 5FLXO 3SMZA 3QU7A 3AGKA 1A5VA 4F2SA 4FZNA 1GO3F 3CC4S 3O4WA 4OX9F 4UB1A 4KAZA 1N60A 5B8HA 1S1XA 2O4IA 4AM6A 2XGPA 3IWLA 1U1MA 2EZYA 4O5KA 4B9MA 3RR8A 3LUYA 2LMRA 4DTRA 1FE0A 1R0BG 3SYZA 3DGVA 2OEHA 1OVYA 5ELZA 2UVWA 3UNYA 4FZMA 1Z25A 1V5IB 4F4ZA 3W63A 2POKA 2B7BB 1HJRA 3A3NB 3MPUB 1IKWB 3C3LA 3VALA 5H2FU 2HHWA 1B0TA 1S1UA 1XQSC 3LPUA 4BS2A 3AUOA 3VAMA 5I3UB 1NH8A 1S79A 5BYRA 1QAXA 4I64A 2F77X 3DU5A 4GMKA 4O8KA 9ICRA 4O0NA 1QSYA 2EFOA 1NSPA 1NMNA 3ZDDA 5GINA 5AR0A 4Y65A 3IG1B 4YB6A 4CLZA 4HHUA 3ZT4A 2VDIA 4NA2A 2ZM6K 2A6AA 4CM2A 2PEHA 3M1VB 5J0RA 4RPFA 4WQ4C 4EUVA 3RJFA 1WKLA 3FZMA 3TSUA 3W2VB 4JKGB 3V7LA 3HHLC 3O1LA 3CJAA 1KTQA 3ONNA 5J2MA 2C1EB 4DTJA 4RJVA 3EEQA 1K8KB 3IGNA 1N32J 1FXRA 1XN9A 2VGNA 2HZAA 4ZVEA 5DGBA 3VEYA 3BQ0A 3IRUA 1FJCA 4MKYA 2E5GA 3ZSWA 5HJXA 2V2QA 4KLLA 4Z6FA 4CBUA 2OHDA 4EP4A 3OHAA 5E41A 4DF8A 2G1DA 1Q81T 3U3GA 1EX8A 4NJ8A 2RS8A 5DG7A 2IYIA 1MWQA 1UP1A 1WOQA 3T5KA 3O3FA 4CZMA 2XY6A 4OKJA 4WK3A 5HHIA 4O5FA 3MFHA 1HKCA 2B51A 4DR7J 3BQTA 3J7Z5 2XZTB 3RJEA 4IG0B 2MTLA 4UB5A 3Q89A 3OYNA 2F65A 1Q3UA 1NJIT 1NSQA 4B3TK 1U25A 1JCFA 3MMAB 2V69A 2CH6A 1NG9A 1CS4B 5KFLA 4JI0K 4NXNF 4J9MA 3N97B 1NGEA 1S77D 1BXNA 2YTCA 4F91B 3V9WA 1C0TA 3MAHA 5GADU 2NS1B 1JALA 2XVTA 2F1IA 2VDHA 8ICIA 1IJFB 1WHYA 1FWPA 3H4DA 2UXBK 1GLFO 1VJWA 1YJWS 2RF2B 3CCSN 1FJ7A 5KPRA 5T14A 3CNQP 5A8RA 3K0SA 3H98A 1RDCA 3UDEA 2JXJA 4W5TA 2JH3A 5A8KB 3NKYA 2IRYA 3PW4A 4ILRA 4RU9A 2ASMA 4KLTA 1ZQPA 1FTCA 3W9HA 2PN6A 3GTYX 3V6KA 4DSLA 1RDFA 4JRQA 5GMEA 5ETTA 1R31A 3BJYA 1KNZA 1J5EJ 1NBWA 2OSQA 2E1FA 3R5DA 1Y64A 4BC4A 4O0JA 3R3TA 3M6UA 4NLDA 3VF4A 2W04A 1CULB 4KTQA 5KT3A 2OTLS 1WSIA 4KGMA 3HP9A 3MXMA 3GIRA 4C4TA 2W2MP 4UB4A 2BQUA 2J0WA 1MWYA 3DFEA 3GV5B 4TUQA 4R66A 3NGKA 3B8AX 2F3JA 4L74A 4A8WA 3PW7A 1IVZA 3OYLA 3RMBA 4G1QA 1SIJA 2MKJA 3FJ2A 2GV1A 3SV3A 4QZIA 8ICRA 1IJEB 2VG5B 3TX8A 2FDRA 4ZCMA 2CQIA 1DTQB 5F41A 1PVRA 4C6AA 1LK7A 3JAMO 1JKHB 4NZ7A 1B0PA 3T1AA 4F93B 4OPAA 2O8DA 5I3PA 2Q1NA 1Z4NA 1SQEA 2X51A 1M6YA 4CE6A 7ICIA 5AQGA 5A76A 3RB3A 2WTUA 1NLKL 2GS8A 3CB4A 4LF7K 4DX5A 3MM8B 4UF4A 2EX3A 1VQ5S 3QWPA 3HPOA 4ZVUB 2JEJA 3QAEA 8ICGA 3IN5A 1IKWA 2GQ2A 5E5NA 5IC6B 4B9VA 2YNHB 1SV0C 1N33K 5LY3A 1C6VA 3AVCA 1M5SA 4WZQA 2C2NA 5KFDA 3DRYA 1IG6A 1SBRA 1S10A 5DBAA 1HQ2A 1RWXB 4M3YA 1RGVA 3POTA 5EU7A 3ALYA 3GG0A 4DUTA 3J8AA 5HJYA 4A8OA 5CY4A 5L9XA 5B7WA 1HI0P 2DH7A 3IG1A 3B9JA 1QY7A 2ZH8A 1U47A 2SXLA 3OVSA 2MQMA 3KDNA 4X4OA 2KZZA 3W3SA 1NOMA 2HWIA 4QCLA 3IXQA 3QNWB 3UQSA 2Q31A 3OXLA 1TTHB 3TX0A 3UFCX 2ZH1A 3OW2R 3W2VA 4ES3A 3UDLA 3D6JA 3HSJA 1TL3B 1NK8A 4B9LA 8ICPA 1K8KA 2X1AA 3JPSA 4KH5A 1Q8KA 1BA0A 4I2IA 2VWBA 4WKRA 3SV4A 5DG8A 2BJDA 4QBUA 1JJ2R 1VGYA 5C15A 1ZQ1C 2OFGX 3VWSA 3PJ9A 5LSOA 2FPKA 3TWHA 3P8BB 2FGCA 2IAJA 5MLCV 3KWGA 2Z8QA 4KX3A 1UAXA 1QVGM 3DXKB 3MMCA 1ZQYA 4CO3A 2Q0RA 2Z1HA 4DPXA 3KLGB 2HMIB 5AKXA 2JEFA 1UVMA 1V9PA 3HYFA 4DV2K 3D2FA 1IJJA 1HNXJ 2B6GA 2H54B 5KTQA 3ITHB 1U2CA 3DMJB 1D4XA 7FDRA 1COOA 4RBVA 1WACA 3TADA 5D6GA 1ASWA 4IG0A 2JC1A 2YKMB 3AY9A 1D8YA 1HNVB 2KFZA 5BPMA 4XPCA 5AK5A 1XUPO 4F36A 4ECYA 3TZWA 2LBOA 4DQPA 1WUUA 4K7QA 3CJBA 5DETA 2KVCA 1RTHB 1ZZFA 1MLAA 4P4OA 3F2BA 1O03A 1NGHA 3MPVA 2HQIA 2E5LF 4DV1J 4OX9K 3MECB 3IR5B 4DHYA 8ICAA 1SZPA 8ICNA 1SIWB 2GVZA 5AE2A 5ALNA 4XO0A 2ZGZA 3V4MA 2ZVSA 1VQPS 2UV8G 4M9JA 5IIIA 1NK0A 3DLEB 2DCUB 1QZ5A 2RS2A 2O8BA 1X9MA 1APSA 5KRTA 4JD2A 1L7MA 2NNWA 3ATUA 2RF2A 3BS5B 2V8GA 2DIUA 3MAQA 3E0FA 4FLXA 2IVMA 4JLHA 4YOUA 5A8KA 3N0VA 1KFTA 4YDUA 1XBWA 2PIIA 4K2JA 3BS7A 2Y1JA 1TAQA 2BR0A 4DCHA 1R8CA 3GSDA 2ZE2B 5IT4A 5AM5A 1EB0A 4P2XA 1WHWA 1XQIA 3PYDA 2EFVA 4DU1A 2PYLA 3VQTA 2AJ1A 2I0XA 3T1YJ 1OWXA 2XS2A 3GQCA 2G0AA 3IR6B 5D0GA 2EFGA 8ICWA 2JZBB 4EMDA 4KB1A 1CULA 2IHR1 1M5OC 4ATNA 1HJOA 1Q7YT 2F1HA 2NRWA 4ILGB 5IV3A 1EZZB 5HRRA 5DZ7A 4OJLA 1N34F 2X1FA 4KMOB 4C8KA 2P6TA 4KKOA 4H0OA 2VG5A 4J03A 4ZPWR 3AARA 3KNGA 1DTQA 1QS4A 1V3SA 3DRRB 2CXYA 4Z7YA 3LW5C 4BR0A 1Z1BA 2LQ8A 3CF5L 1L5UA 4F2RA 3OR1B 1JKHA 4JI8J 1P90A 1LW0A 4JKCA 2CFXA 3KZIU 3LL3A 5HRPA 4WKYA 3QEBZ 2YWFA 2Z56B 4MIAA 2LCWA 5DZ6A 3CD6S 1WC1A 4HI1A 3GCXP 1BCOA 2XB2D 2XI2A 3CPWR 4DTMA 1WC6A 3OYGA 3CD7A 2KFNA 4IL6U 1OO0B 4ZPCA 2YH1A 4CERA 4FZYA 4J2AA 3OYEA 1BNOA 5ALMA 2W7OA 2UUCK 2RQ5A 1DK3A 3D2EB 4NXNK 4UW9A 3ZDAA 2ZG6A 1XHZA 3L2VA 3CPWM 3THVA 2PYJA 2HEKA 5I42B 2LEAA 3S6JA 4UOGA 1QQOA 4DR3K 2RRDA 4PWWA 2MZRA 3NVWA 4ELVA 4M42A 4FJMA 4CJSA 4KLFA 4QIWF 3O9QA 4I2BA 1GXLA 1JNRB 2BJEA 2VFSA 1YJRA 3H2LA 3FKBA 4DV0K 5EXWA 1MA7A 1JLQA 4OYAA 1ZQUA 3PZPA 2BMBA 3NWRA 2ZTCA 3GMGA 2RH3A 4AQYK 4ZN3A 2E1PA 1OYEA 2NR0A 2HZVA 1JXEA 3HJVA 3DXKA 2E4LA 1IKYA 4BC3A 2ZC3A 4KGZB 4Z4HA 1N54B 3R1LA 2HMIA 3DHXA 4HHTA 5AXKA 8RUCA 5KFXA 4P2FA 1NGAA 5EE3A 3W60A 4YB5A 4EIAA 3BGRB 1VSLA 1U1KA 2HMXA 3ITHA 4K4WA 3DMJA 3HWTA 2HIQA 4R8UB 2FPMA 4IRDA 4PABA 4E7JA 3VAIA 2APOA 1RQ0A 1NDPA 4NASA 3KK3B 5AIAA 2JVRA 1L7OA 1HNVA 4DSFA 2MQNA 1S5LU 4JN4A 2E5JA 2VL1A 2G8UA 1BPZA 2A5XA 2HHUA 2UVVA 1HUXA 3PNCA 3MECA 4CNZA 4NPOA 1T9UA 2F9WA 2Q79A 4CLTA 3K8WA 5BR9A 2Y0SF 2HFUA 2VB6A 1S9FA 1YJNS 3IR7B 7ICEA 4CO4A 3M1FA 3DLEA 2BBEA 4MEXA 4WTYA 4J91A 4BDPA 1ATSA 3U1MA 1WI8A 1X5PA 4M5DA 4DR4J 3BS5A 3CPEA 4USVA 1BQMB 3QT8A 2A18A 5CZXA 3H2VE 4IFYB 4DO9A 5G0RA 2NRTA 3QMLA 2P51A 3M2UA 3HRGA 2R42A 4RPXA 2ZE2A 1SUQB 1U6ZA 3EVWA 3B6OA 4FJ8A 2PMZD 1X4BA 7ICFA 4PYAA 2DGTA 4YXMA 3TARA 1E6VB 3C7NB 4PGYA 5KOWA 4LJMA 3KD5E 9ICNA 3KLHB 5M2PA 3DM2B 3ZNJ1 5HL7L 2O8CA 4DR6J 2LXIA 5D0HA 2JZBA 3V2UC 3C2LA 1HW9A 2GIRA 2GCFA 4ITSA 3DOMB 4UBCA 5HL7Q 4C3MA 5BR8J 3F2DA 4QIEA 3GU3A 4C4SA 4ED7A 4JKDA 4DV6J 3SLCA 2BKNA 4Z94A 2H4YB 3SEIA 1VSJA 3WK8A 3OJUA 4LF5J 4DU3A 4CF3A 1GX5A 3OLAA 1YITS 2DKZA 4XH4A 5M1QA 4WFXA 4EFAC 3O9TA 4E19A 2CPFA 3D66A 2FB0A 3PVXA 3WK9A 3PEJA 3QGGA 4HUGA 1WD6A 3UE5A 1DFDA 2XI9A 4J9RA 1NK6A 3BF3A 4DR2F 1DOQA 5DDRC 3KK1A 1K1QA 4B08A 2I5JA 4WP3A 1U1RA 2HQ3A 3LDNA 4LF4K 1HNIB 2BE7D 4PWDB 3FEXB 3QEVA 3MPWA 2ZUGA 3HD2A 4AP9A 4CLKA 3O44A 4N7TA 3C1YA 2MQ8A 2IDOA 1S6PA 4OI1A 4M0AA 3UDCA 3MR2A 1WTFA 3EGVA 4B3RF 3Q7BA 5ETSA 3D2EA 1UAWA 3BGOP 4O5CA 4LFBF 3ZSRA 2HOIA 2DNMA 3NFAA 2E5LK 5I42A 1S6QA 2DY4A 1JN3A 2ODGA 1F9FA 3BQ1A 4IRKA 3VGSA 1UA1A 4NLTA 3EPGA 2E7WA 4USMA 2FGOA 2QL7B 2Z2YB 3DDHA 1LWCB 3NRWA 2ADBA 2CPRA 4Y2MA 4Z4IA 4BREA 4IJAA 4OJ5A 1BIUA 1DARA 2V67A 3QEIA 2O01C 2HZCA 4BJQA 1S6UA 4CJWA 4H4MA 4CF8A 3OYHA 5LT5A 1QTMA 5J2IA 2CUYA 5C5JA 4RQ8A 3H0MB 5F0UA 2HMPA 3CXCM 2QSFA 4WF9L 1R27B 1TL7B 2RQMA 1H7WA 2P6RA 4OHWA 5KPTA 2HK2A 2DNQA 3TUJC 5KFOA 1HHSA 3PSFA 1CLFA 2XYHB 1GFWB 3MZIA 1DURA 1JLFB 4N41A 2JL9A 3BGRA 3ZZZA 2P35A 2L48A 4QWBA 1QM9A 5LSRA 1N34K 2DKXA 1NHUA 4IOAL 1VMBA 4B17A 2RRNA 2HF4A 2CJQA 2NPIA 1NM2A 1WOPA 4XQ8A 4DOCA 1K0VA 4LF8J 1BISA 1XNRJ 2D9OA 2CPXA 4RW6A 5CABA 2KOBA 5IC4B 2AJFE 4IOAQ 2AMCB 2WFBA 4CLPA 1WOSA 2AHOB 5BPNA 4BWJA 3JQKA 5KT4A 4K25A 4ZTFA 3ULHA 5JRTA 3EUNA 4JS4A 4CEOA 3SK3A 4FK4A 5K8MA 2MZTA 4DR5J 2G0JA 2ZBIA 3MUVP 2NV3A 5JMVA 2QG9B 4E7IA 4NRTA 5DDOC 3KKSA 2EAOA 2UUTA 1PVPA 1S1TB 3A3PB 1M5PC 3SQ2A 5AI4A 2GEMA 4M5LA 1COKA 2W3SA 4OJ1A 3NY0A 3NDKA 2ZJQL 3BBCA 4I2PA 4DV7K 3ZFVA 4P0QA 4A57A 2M5YA 5JTIA 4ZPTR 2CNLB 3C7NA 3W62A 4OLPA 3HVWA 2ASDA 1YZ7A 3BYPA 2XY7A 2XNQA 2LDIA 3ZNUA 4N77A 1HKBA 1IG9A 4DMZA 2VODA 2PO4A 3G2XA 2B4VA 2YNFB 2B8QA 6AT1B 4MFCA 4B3SF 3M8ZA 2UVRA 3R2CJ 4ZJQA 2DYAA 3DLGA 2R7YA 3MGIA 4DL7A 3SJJA 4KHMA 3LPTA 1NKEA 2F9TA 3PW2A 4EWTA 3Q8SB 4EX6A 4B3MF 3BSOA 1JCGA 1S57A 2W11A 1WF0A 3U27A 4UZCA 3W9JA 4F71A 3PJXA 2E2NA 1P1LA 1WEZA 3BPSP 3VPZA 5ALLA 7ICRA 1UHUA 2HFZA 3AV9A 5KT7A 1V9OA 1Q5VA 4Z7CA 1HNIA 3VAFA 2LU2A 2AYGA 2AYBA 2MZ1A 1U7LA 3AB2B 4GNIA 3AA2A 2DGSA 1YTYA 1QQCA 3CJ9A 3GSIA 3LTOA 5CHIA 2ZUCA 2VUGA 3VGLA 3I55N 2MUTA 4M5NA 2YJEA 4DR1F 4MN4C 1VQOS 5FD1A 2CPEA 2W9BA 4GFJA 4CK1A 5KFKA 1W7AA 1NU4A 3WC0A 1NGBA 1K9MT 4AHTA 4ETXA 2K06A 1LOTB 5F1XA 2XG8A 1C0MA 5ALJA 1KQQA 4QZAA 5DDPC 2HOQA 1PBUA 5C2CA 3MDAA 2V0NA 2XC9A 1SL1A 4ED8A 4G9BA 5ADXH 1KC8O 3ZSQA 1K73T 2IA0A 1PK1B 4YEAA 4ZLNA 4X65J 2C3YA 3OS1A 3P5TL 4JI4J 1JLGB 3K1RB 5J8YC 1D9AA 1IBKK 2CQPA 2ZDOA 1A5WA 2DPNA 3L4IA 3WZ0A 5J0WA 1EO1A 2ZXIA 2DNRA 3D67A 5B5EU 1VBKA 1UEVA 1TL7A 4FPAA 3OL9A 4NV0A 3U26A 1T9TA 5K4LA 2ZBCA 3AU2A 3A8KA 2HLTA 1KHWA 2MXYA 1EJ7L 3HF5A 1X9SA 4JNEA 1RDWX 2NLWA 3PKYA 1HNZJ 3ZSVA 3JTOA 1VISA 2FJXA 2YWWA 1RDUA 3O3GA 4F5NA 2N7CA 4CGHA 1SAZA 2ZUAA 3M7DA 5KFHA 5C25B 4ZJLA 1RTJA 4DV5J 3VAKA 3KKFA 2QEXS 4KLIA 2AEFA 3OTQA 1N6QB 4WXOA 3D3BJ 2HRYA 2Q2RA 1PCAA 5AQWA 4YDXA 4EYHB 1LCUA 4NLRA 3I0SA 1RT6A 3VCDA 2GV9A 1FIQA 1FDDA 2IJFA 3V6JA 4E7HA 2FIUA 3ZZ0A 5EWGA 4LR9A 1RDDA 4ID8A 3OY9A 4DR2K 3B0XA 2DK2A 1NSKL 2HWHA 5CHCB 2QJ3A 3A8JA 3QEPA 2BQ3A 3AA4A 4AILC 3QUQA 3CMEN 4TY8B 4KTWA 2FBYA 2ALZA 4WWSA 3FEZA 1S1TA 1L3SA 4BLGA 3SAFA 1OKJA 3CJ5A 5J0OA 3Q8UA 4K4HA 3ID8A 1HLWA 1JLBB 2E2OA 4CYUA 1WG5A 1YT3A 3EXCX 5J0QA 2CPIA 4EFHA 4B3RK 5L39A 4BR5A 4LFBK 2DNOA 4QOTA 4KT0C 3O4NA 2OHFA 4GIBA 4BR4A 4F5OA 4XAKA 2H5EA 3PG9A 3SMVA 2FI1A 3I87A 5TKYA 2JR5A 4OJHA 1U1QA 2VQFJ 1IBLF 5AZJB 1MDUB 3FUYA 2HBLA 2DBYA 4JUZA 4O9MA 1U45A 2IY5B 3UQ2A 2F1FA 5EE9A 2EKYA 4B1ZA 3IAYA 2YNFA 2D7SA 4WFZA 2DY1A 4LSNB 2ZIVB 3SUQA 1X42A 2VBZA 3S7RA 4CZKA 3QT6A 1VQ8N 4IO1A 2WAQD 5GMDA 1S0VA 4BCAA 3DLLL 2G8KA 4IUFA 1T03A 3VMFB 4LFAF 2G8HA 2KXFA 1TELA 4DUYK 5J2DA 3N01A 2HF3A 4P2HA 4P52A 5KG1A 2I38A 1FNOA 5IT0A 5JLFA 3C16B 4ZVRB 4JV5F 2LYVA 7ICQA 3CQYA 4BGDA 4USTA 4LMZA 5T7LB 4K0KF 1MMDA 4F3TA 5KFVA 1TGOA 2L5YA 3HRDD 3C65A 4F4WA 2DNGA 1KOHA 4CGGA 3CJ0A 3I56S 3EICA 3I9V9 2PFNA 1S9GA 3D68A 1N56A 3LDLA 4FYDA 4K4ZA 1PC4A 3L9ZA 1FRMA 4J8FA 1TK5A 1P7DA 4WXWA 5H1SQ 3H0RB 2G2ZA 3SBGA 4QAGA 3K89A 4DCPB 4K4GA 3AEVA 2HSZA 1KWMA 2OEKA 1BPEA 4YB1P 3HJEA 1RWKB 4IR1A 2ALYB 4KRFA 4Y2SA 1CC8A 2NUUG 1MQ2A 3CJ8A 4LUBA 2IJRA 7ICOA 1WAFA 2MJUA 2HS3A 3K5OA 5B0FA 4RBUA 4ED2A 1SC4B 1N5XA 5J0TA 3EUB2 2MSTA 2YX1A 3CSKA 2XLIA 3DI6B 1UFLA 4U7UD 1BWEA 3ZT2A 5ALKA 3CCZA 1F3FA 1D8BA 2A3VA 2NSBA 2YHXA 4LF2A 3CJKB 4BUGA 2YWKA 2BGGA 1XSPA 2AJQA 2QGFB 1ZTTA 1JLGA 1BG3A 2G5IB 3CQXA 1FERA 3M8WA 1YG0A 4LIRA 4FKXA 1ZBIA 1W9HA 2E7VA 3CC2N 3D1QA 3H46O 4TUSA 4DFPA 2F3NA 4QZEA 1T8EA 3THXB 2IMWP 2A6OA 4FXVA 4PUOB 2A6MA 4FVUA 1FVSA 3BF4A 4JWNA 3M6GA 1HQEB 5IIJA 1TL1B 5ETVA 4PXCA 1Q86T 5C25A 4F3QA 2HHQA 4B3SK 4GKKJ 5GIOA 1RHUB 4C7YA 3K5PA 1N6QA 3TZZA 2UXCJ 1T3QA 2CQ1A 4Y0FA 1ZQIA 3ZO7A 4YOEA 1SXEA 3ASMA 4GV9A 4FK0A 2CA9A 2YNIA 2DT9A 2ZD1B 1B3TA 2GGPA 1ZQEA 4ECZA 3OTCA 2D3UA 8ICEA 3KMQA 5KFRA 3W7BA 2J7UA 2PA3A 3RJMB 2VA3A 1YLXA 3DRPB 5D0RA 1ZS6A 2H4WB 3CYMA 3MGVA 3PO4A 2F8TA 5AQJA 1FFSB 3OYIA 5ALDA 4FP9A 1W2BR 3C6HA 3PR5B 1C7YA 2YX6A 4AUKA 3FVYA 1VQKS 1V97A 1LQ9A 1F2GA 2BHNA 5GADP 1S72S 4CTAB 1VQMS 4B9NA 1WF1A 1GMVA 2ROGA 4DR1K 1IR1A 3RTVA 2GUIA 1QVFM 2JC0A 1T02A 3THPA 1FHTA 2AYMA 2I2YA 2KM8C 2DITA 1FK9B 4S0MA 4HCBA 4IJNA 3T7ZA 2X1GA 4R0EA 2BOPA 3CCQS 1IBCB 5H9FK 3KUHA 2MKKA 3G71S 2DGXA 1YVNA 4QWAA 1FEZA 1ZQQA 2KN4A 4FZVA 1URRA 4H5VA 5EWEA 1I94J 5DS7A 1OPIA 4C7ZA 3RJKA 4BRCA 3C8YA 3GYXB 4LSNA 2ZIVA 2HHSA 5F0XA 4X62K 3SQ1A 5SUHA 1WELA 9ICJA 5J0PA 3P31A 4ZVHA 3VEZA 4C0OC 2B4UA 3CIZA 4LVSA 4CBXA 4RUBA 5ETKA 3W3DA 3V9UA 3D6RA 3A8YA 4FL9A 3CD5A 1GTEA 1RZTA 4MHVA 1IIPA 2O5DA 1A77A 2IMOA 5T7LA 1CQMA 4JK7A 1KVAA 4GV3A 3ICXA 1CJKB 2ROPA 2O66A 2LVWA 1SJRA 2JLFA 2H3IA 3TPQA 1IH7A 4N8NA 3MM6A 3ONQA 3C46A 3NS5A 2EEYA 5C7PA 4YDDB 1FWLA 3RJGA 2DUYA 2QLTA 3MCOA 4H5TA 2W2PP 2BTFA 1J54A 1L3VA 1YDLA 3VN5A 2ZJPQ 3SMPA 2KVSA 2LI6A 3ETMA 4QS8A 1GXTA 5J29A 5L1KA 3OBWA 4Y2AA 5J2EA 4PA1A 1VSFA 1PIEA 5IQQA 2JH7A 2ZC4A 4QZDA 3N5BA 3MN6A 1IN0A 3M6WA 4KGKA 3NS7B 2QT7A 3MGHA 2W2QP 2BJ1A 2QWPA 3MXHP 2H3EB 2HOEA 1NWKA 4G1IA 4PHDA 4FN5A 1MU2B 2BE9B 3Q23A 4US8A 1PC5A 3Q7CA 3BS9A 1GT8A 1K5OA 1OS5A 1CJUB 3THXA 2FMPA 3KJVB 1YJ9N 4CNQA 3K5NA 4PUOA 4Y2XA 2KM8B 1IBLK 3IMQJ 3BV8A 5LMNF 4CD3A 1HPZA 4QW9A 1HQEA 4JBCA 4FF2A 3AO3A 2XRIA 2O8FB 5AICA 3HKZD 4QQBA 3RG6A 2ISOA 1TKXB 2A41A 3B0YA 2VU5A 3RGIA 2MKIA 3M8PB 4X5VA 3JPPA 2VG7A 4MQ3A 3NOGA 5KQDA 4FO0A 1H74A 3CP8A 5J2PA 3ZZYA 4LFAK 3PJWA 3MMJA 3WNEA 3BN4A 2CAJA 5AXNA 1JLCA 5HMXA 2ZXHA 2ZD1A 2KHOA 5LJ3Y 3J81U 2BDUA 1RCOB 4KN4A 2DFLA 1BWVA 4BQZA 5JU5A 4WQ5C 2K8AA 1S22A 2B5JB 5K14B 4BRQA 2I6XA 3CETA 4DFMA 1GTHA 2OMOA 2X7IA 4MFBB 2CVEA 1RU2A 4DMNA 4RNHA 1OH6A 1ED1A 4K4YA 2FMQA 2ZH2A 3WNGA 1TUVA 2ESEA 3QRRA 5IIKA 9ICLA 4CTAA <