4DQRA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 203
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqrA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqrA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqrA01
2FC0A 3NH2A 3ZDEA 4YR0A 4DQIA 3AO1A 3V6KA 1RXVA 3PR5B 4O3NA 4B9SA 3M8PA 3SQ0A 3RH5A 1LWEA 4DF4A 1C1AA 4CGHA 4DS4A 8ICUA 3IG1A 3F9KA 5KFVA 4ECTA 1O1WA 4F5RA 3HYFA 4DG1A 3O3HA 3V9ZA 1T7PA 3RRHA 4IBNA 5J0SA 3HP6A 1WNSA 2DFFA 3ZSRA 1QSYA 1LW2A 2F8SA 5C25A 1RBTA 5KFCA 3TAMA 1Z00A 3VQPA 2XHBA 4Q5VA 4DTRA 3MFHA 5DLGA 2FBTA 1SZPA 3AVBA 2FMPA 5CYMA 3MEDA 3JPRA 4CEFA 4ELVA 5IIOA 4RQ4A 1ASUA 3DYAA 3ISDA 4LZGA 4EEYA 4QWAA 4KV8A 3FYHA 1TK0A 1D8YA 1XO1A 5DG8A 1GOCA 3ASMA 4NLZA 4XIUA 4JRQA 4KKOA 1W0HA 2VA2A 2RKIA 4ELTA 4FM2A 4FJJA 2G8FA 3I0RA 1U04A 3AA3A 3NFAA 4FLTA 3M8QA 5J2DA 3TAQA 1BQNA 3I0SA 3ZD8A 2Q0ZX 3Q8MA 1N48A 3TAEA 4M3TA 2PY5A 3JPQA 4OVLA 3GV8B 1EKEA 1RT5A 3V9WA 1ZQKA 3V9XA 5CJ7A 3MR2A 1NJWA 2YKMA 4Q43A 4OKEA 2P1JA 3B0XA 2W8KA 3BQ0A 5HMMA 2XC9A 2XO7A 1JX4A 2PI4A 1GOAA 3OSPA 3ZCMA 1SL1A 1FK9A 1A77A 1TFRA 2I5JA 5J2FA 5DB7A 3QLHA 2B4JA 1U49A 4YCXA 4B9VA 4KREA 4J9QA 2AQ4A 3DOKA 4N76A 1GOBA 4DOAA 1RYSA 1G15A 3KLIA 4CEDA 5J2PA 3PV8A 2A1JA 4LZDA 5KT3A 1K1QA 1U4BA 3Q8RB 1SKRA 1XI1A 5KG4A 2R8JA 4O44A 4DSIA 1NOMA 1IG9A 4HVJA 1CZBA 5J2AA 4FJKA 3D0PA 4FLXA 3EPGA 5KFZA 4OGEA 1ZQYA 3OYCA 9ICNA 1IH7A 3AV9A 4DMNA 3BJYA 3RJIA 4ED2A 3P1GA 3IHQB 1JLGA 2ZJ5A 1ZQDA 4R65A 3DMJA 4DSFA 4F4ZA 2VWKA 3H7IA 1LW0A 1IM4A 4CJVA 4Q0BA 4KB0A 3AA4A 1ZETA 3HX0A 2FPLA 1XSPA 1B22A 3LP0A 4DU3A 1IO2A 3MECA 3C6UA 4Z4FA 1U9LA 1RTJA 5KI6A 4NCBA 5DG9A 4PHDA 2JEIA 1Q8IA 3VQ8A 3H40A 2KFZA 1KLNA 2BDPA 3EYZA 1Y88A 2G8IA 1RILA 4NM2A 3C2KA 3NBPA 3U3GA 3ISNC 1B43A 1PZNA 1RT2A 3OHBA 2WTFA 3V1RA 1N56A 4J9SA 4DU1A 4M2YA 4DTMA 3M8RA 3ISCA 1SKWA 3C95A 3OSNA 2KQ2A 4JUZA 4CK1A 2C2DA 1S1VA 3EWAA 1T05A 4QZIA 1F21A 1WSFA 4PGQA 4FJ9A 3OJUA 1JLCA 4LSLA 2ZUCA 3L2UA 1YTUA 1IKWA 3RJKA 4JS5A 5D4BA 5KFTA 4M3ZA 2NRXA 1L3SA 9ICAA 3VQDA 3V6DA 3AVAA 4GMJB 2V9WA 3MXIA 2ZE2A 1S6PA 7ICQA 4R8UB 4MEXA 3NGDA 2BCSA 4B8AB 4CGGA 1TVRA 2EHGA 2FBXA 2M9NA 3NF8A 1S77D 4FJMA 3PUFA 3QEPA 1RXWA 4I2EA 2D0AA 3ZSYA 3K5NA 4EBEA 3UPQA 3VQ4A 8ICVA 2JEGA 4IKFA 3LAMA 3OS0A 1ZQPA 4BDZA 4BXOB 4KLTA 1CEZA 2Z1IA 3C5GA 4NLGA 2IBKA 4Z6CA 2MAXA 1HUOA 5KFWA 3S9HA 3QO9A 5J0WA 3CM5A 4NY8A 3V1OA 4Q8EA 7ICLA 1J9AA 3G6YA 4NLKA 4DLGA 3G6VA 1RT4A 4CJ3A 5IIJA 2ZUBA 3LZIA 2DTUA 4M0AA 3V6HA 4W5TA 1D9DA 5J29A 3HWTA 4YMMA 2FBVA 2GV9A 3ZT4A 1ITGA 4NXZA 4DQQA 1JL2A 1CUKA 3T5JA 3PW0A 1CLQA 2XGPA 8ICYA 2OYQA 5HP1A 5KRTA 4ZTFA 2VG6A 4IDKA 4BGDA 2E4LA 3ZDDA 8ICGA 3O4QA 4O0IA 5HHIA 1NK9A 4J9RA 1QSLA 4DO9A 1JL1A 4CJPA 3PVXA 4I2JA 1VSHA 3AVNA 4J9PA 4ECSA 2C22A 5L1KA 1NKCA 3HO1A 3T5HA 4H4MA 4DFJA 4DF8A 4KLOA 1KRPA 1SUQA 5HRNA 3OYEA 1KFSA 2FBYA 4DSEA 1KSPA 3KTQA 4J9NA 4KLIA 4CEAA 4I9QA 3MXMA 4FJ5A 2OZSA 2HW3A 3PW2A 5DGAA 4KLSA 2LYHA 9ICRA 4MFBA 4C8LA 4ICLA 4R64A 1NK8A 4CF8A 2X74A 3IRXA 1ZBIA 3NF9A 4J2DA 3QIPA 5JUMA 3ZDAA 4EP4A 4BE0A 1NOYA 5KG3A 1I39A 1X9SA 3WNHA 1I3AA 1HUZA 2AGPA 1LAWA 2FPMA 3RAXA 1RCHA 1JLFA 4N41A 4ED7A 1KVCA 5DB9A 4ED8A 2F1HA 1WSJA 4EYHB 4C8KA 3ALYA 4FLYA 2F1JA 7ICNA 4PPXA 1QHTA 1S1WA 2JEFA 3HVTA 4DSJA 4DFKA 3KHHA 5I42A 2ALZA 1X1PA 3K57A 1T03A 5KFAA 2PFPA 3JPSA 1T8EA 5EWEA 3AVCA 4CJ4A 7ICKA 5CA7A 9ICXA 4QZBA 3PY8A 2DPIA 7ICPA 2HNDA 3PMLA 4E3SA 3T5LA 4YFUA 4UAZA 3WNGA 4J2BA 4DQPA 8ICXA 1XHZA 1TV9A 5KFXA 5DBAA 1ZQRA 4RQ6A 3VQEA 3PW5A 4YXMA 3K2PA 4QW8A 2G8UA 4FS2A 4CHOA 4M47A 3F73A 5EWFA 1WSIA 3AO4A 1N6QA 4QAGA 3CG7A 3HP9A 3RAQA 5HRSA 3Q8SB 1VSKA 4J9KA 4FK4A 1A5XA 3N97B 4RW6A 9ICJA 3DLHA 2DFHA 1A5WA 9ICIA 1JIHA 3UXNA 1ZJMA 3OYLA 5CWRA 3K59A 4I2DA 4M04A 3JSMA 3SV4A 4UB3A 9ICOA 4UB4A 5HRPA 3NHGA 4O5KA 3KK3A 4M3XA 1Y97A 1D9FA 4YNQA 3VQ7A 5KFLA 5DQGA 3PO4A 1B92A 3QINA 2W9CB 4I2GA 3LP1A 3DI6A 3ZDCA 3AVJA 3KKRA 4Q44A 3V9UA 3QEAZ 3ZT1A 3LPTA 2J6UA 3KHRA 4LD0A 4JV2A 3GFKB 8ICRA 1ZQAA 5KG0A 1Z25A 4Y1DA 1BCMA 9ICVA 5DBBA 4AHCA 5BOLA 2Z1HA 1XU4A 3H8SA 5DDYA 4DTXA 2OWOA 3TWHA 4GW6A 3JPPA 4FJXA 1UT5A 1FKOA 3AA5X 2C2RA 3WNEA 1SV5A 5J2EA 3AVMA 2XY8A 1ZQIA 5D46A 1CZ9A 4M3RA 4W5RA 4TQSA 4FZYA 2XY5A 3QEBZ 1ZQZA 4QZ8A 5CHGA 2D0BA 4FZZA 4AH9A 2JZBA 3JYTA 4DL6A 1C0UA 4ZH4A 5J2GA 3RR8A 4AHTA 4CJFA 3RB4A 3LP2A 9ICBA 8ICOA 3C23A 3KHGA 8ICJA 2QK9A 5L1JA 1VK0A 5KFKA 3D45A 7ICTA 1LWCA 7ICJA 3VA3A 4KB1A 5KRSA 2ZQBA 5CZ2A 1W9HA 3V7JA 3SUNA 2DY4A 4KI6A 1NK6A 4UAWA 3M8SA 5CB1A 2QXFA 2VANA 2OPPA 3ZSXA 1NJZA 1LWFA 3GIMA 3GV7B 3GV5B 3MAQA 1B9FA 3NF6A 3V6JA 4N56A 1Z00B 4UB5A 4M9NA 4FM0A 3C2MA 8ICHA 3NDKA 4CEQA 1IXRA 3QZ7A 1S1TA 3EPIA 4B8CA 1K1SA 5J0UA 2I9GA 3RJEA 9ICCA 4J9MA 4OJRA 4TUPA 4RT3A 3SQ2A 3Q8KA 4DTOA 4Z4HA 2R7YA 1RBSA 2G8HA 2ZTCA 3OGUA 3JPOA 1KDHA 1D8LA 3HPGA 3AO2A 3TAGA 4CIEA 4DL3A 3M9NB 1CXQA 4E19A 4Q45A 2AGQA 4KHQA 2JEJA 4FJGA 4O0JA 1BISA 5KT6A 4Y1CA 2FLLA 1IKVA 3QEXA 2KN7A 4FS1A 3GIIA 4ID5A 4DS5A 3Q8QB 4CE9A 3UQ0A 4MFFA 3SI8A 1HRHA 3RMDA 4K4GA 2OPQA 5KG2A 7ICFA 2HVHA 5DB8A 4XRHA 7ICEA 4F93B 4ZTJA 4QZCA 3RJHA 3TABA 1ZQFA 4CJKA 3DLBA 1NKEA 4KLHA 2BE2A 4CHQA 1TKTA 2OA8A 4FVMA 2HVIA 1FKPA 4O4GA 1KVBA 8ICBA 2FMQA 4F91B 4I7FA 3CFRA 2A1JB 2IMWP 2OZMA 3THVA 4EYIB 4CIFA 4R5PA 1AROP 1VSMA 3ORYA 3T19A 2VA8A 3LDAA 4K8XA 5CY4A 1TKZA 2PFOA 4CGJA 1BI4B 4O5BA 4B3OA 1HJRA 1BIZA 4CFAA 1T4GA 3SZ2A 4B9TA 1BI4A 1X2IA 3AU2A 4M42A 4CIGA 3QERA 3TAFA 3O3FA 2G8VA 4XA5A 5DBCA 4UBCA 2FPKA 1RDDA 2IDOA 3Q8PB 2NUBA 2HHWA 4J9OA 4M6WB 4QZFA 4KLGA 3K4GA 3GQCA 3M9OB 3NGYA 3SNNA 4CECA 1C1CA 4KLUA 5EOZA 4M6WA 3LZJA 5KFSA 3CFOA 9ICLA 5DKWA 3LAKA 2BCUA 1HNVA 5J2QA 5DQIA 3B6PA 3H08A 4CHYA 1JXEA 3U3YA 5D3GA 2DPJA 1TL3A 3MEGA 4RPYA 2ZTDA 4E89A 4C8NA 4I2AA 8ICCA 3L2QA 5KG1A 1ZQVA 2NRVA 9ICGA 1TAQA 4FJLA 7ICGA 4I27A 2VG7A 4YFKA 4KHNA 1UA0A 4M9JA 3O4NA 3PX4A 9ICEA 4CGIA 4DWIA 4PY5A 3H8JA 4KLMA 1BIUA 1J5OA 4GC7A 4DFPA 3QNNA 2J6TA 2YHAA 2RN2A 1NJXA 5L1IA 4KFBA 5C24A 4PGXA 4OPJA 1DTQA 1A5VA 4YR2A 4HYKA 8ICIA 1QSSA 1NK7A 1EP4A 1HYZA 4Z4EA 1L3VA 3ZT2A 1ZQOA 2P5GA 1S76D 3C1ZA 5J0TA 2KTQA 2R8IA 2JGUA 4HCCA 4M41A 2ZUDA 4IRKA 1ASVA 4RQ0A 1S9EA 4YR3A 4YN4A 3OYFA 3RH4A 2OPRA 3B0YA 4CCHA 1HNIA 3OYAA 3AVHA 1JLQA 4KLDA 4C8OA 4QCLA 3NGZA 1ZQJA 1HPZA 3OY9A 1NOZA 2XCPA 1KEJA 4QWEA 4HUEA 5C5JA 1MQ2A 3NE6A 1S1XA 3HL8A 4CFBA 3UIQA 3T5KA 5DG7A 3SCXA 4OLAA 3E2EA 2W9BB 4YQWA 4B9LA 3DLGA 2V4QA 1U47A 2W9BA 1DTTA 3QEVA 1DGSA 3PMNA 4BWJA 2D0CA 4KLLA 2UVVA 4RW7A 7ICUA 3A2FA 3KJVA 3QNOA 3OVNA 4RUCA 3L8BA 4LH5A 5KT7A 4O9MA 1SL0A 3PR4A 3QZ8A 5J0OA 4ECXA 5KFGA 1SL2A 5J2IA 4IG3A 2D5RA 4KAZA 3MGHA 1VSDA 4M9LA 2H5XA 2NRTA 1S9FA 2RF2A 3P5JA 3RTVA 1S9GA 4AILC 3RJFA 4NYNA 1HQEA 3SYZA 4M3WA 1RBUA 2G8KA 3PX6A 4C8MA 1RTIA 4B9UA 4KTWA 3OYHA 5DDMA 1MSWD 1RTDA 4YD1A 1V9PA 2ZJAA 1ZQBA 3MGIA 3TFRA 2BR0A 4MFAA 4RW8A 3VQQA 4Z6EA 3ZT3A 1SKSA 1UT8A 4Q8FA 4JWNA 3RMCA 3QE9Y 4I2HA 5BOMA 9ICQA 1ZQCA 4F3TA 3SQ1A 3L3UA 4HTUA 1Z26A 3H4BA 3IAYA 4PH5A 4RW9A 1VSEA 2YKNA 3DRPA 2W8LA 3HM9A 2FMSA 4O3PA 4H8KA 4E7HA 1BPEA 4B08A 2BPCA 3RMAA 4L8RB 2LSNA 1WN7A 4XUSA 3OS1A 4FJHA 1ZQXA 2WONA 2HHQA 4P4MA 4CJTA 3DLKA 3KK1A 4P4PA 3S3OA 4I2IA 5J2MA 3E01A 3VQBA 4QZAA 3AO3A 3KKSA 3AVFA 2P6RA 2HHTA 3AVIA 5FRNA 3HW8A 4K4IA 4FLVA 5KFJA 4DL2A 4HUFA 4IFVA 3ULDA 2PYJA 3HVRA 2J6SA 1XHXA 1BCOA 1MC8A 3TARA 4CEEA 4AHUA 8ICQA 4LH4A 4I2FA 2UVWA 3M9MB 1BL3A 4RPXA 4DQSA 8ICTA 4AHSA 2F8TA 1TV6A 3BQTA 4RG8A 4KMUA 4DQRA 5KFRA 1HJPA 3HPHA 4DTJA 1ZQTA 2W9MA 3AO5A 5KT4A 3UXOA 2P66A 1S0OA 2KZZA 1EETA 2QKKA 4JRPA 4CGDA 4K4HA 4QWCA 2HHXA 2ASJA 4XQ8A 8ICFA 4AHRA 4NCAA 4MF8A 3SUOA 4HCBA 4O3RA 1RTHA 2NRZA 1VSLA 3BQ1A 4J2AA 4LSNA 4P2HA 2ETJA 2BCQA 5HBMA 3ISBA 3PX0A 2HMIA 3RR7A 1NK0A 3ZSVA 3RMBA 4QZDA 4AHVA 4ED0A 2X6SA 4W5QA 1UA1A 3KLEA 1B9DA 3ZD9A 4RQ1A 4BDYA 4R66A 1Q9XA 4FLWA 4CEOA 1ZQHA 4DSLA 4I2CA 4IRDA 1XWLA 3V4IA 5KG6A 3HPOA 3RJGA 4O3QA 4R63A 5J2BA 4RNMA 3DOLA 4F2SA 4KI4A 3SV3A 1S0NA 3VQ6A 4GLXA 2HB5A 1RPLA 1ZBLA 4TQRA 4ED1A 5BPCA 5KFMA 4CJQA 2IS3A 4YXJA 3LWLA 8ICSA 3P83D 3VQ9A 5KFQA 3DRSA 1A76A 1VRTA 4J9LA 1LAVA 4ECWA 5J2JA 2YNFA 4BACA 1TKDA 3GILA 1BQMA 5KFOA 2P51A 2XY6A 9ICHA 5CZ1A 3LDSA 4RUAA 5L1LA 2UVUA 8ICKA 2JZBB 5J0RA 1JLEA 4ECQA 3AUOA 3HK2A 4YVZA 3C6TA 3RJJA 4RNOA 3N4MB 3SUQA 3KLFA 3KK2A 3RH6A 2BCRA 4RQ7A 1BHLA 3EY1A 4MEYA 2VWJA 4UB1A 1C7YA 9ICTA 4CJEA 4FBUA 1JMSA 4FLUA 3ZDBA 3KLHA 2BHNA 5L9XA 4YD2A 3MXJA 4FBTA 4RQ5A 3MBYA 3CFPA 2HHUA 3VA0A 3QEWA 4CERA 3SPZA 2W9AA 5F9NA 1K6YA 4RW4A 1L5UA 4E0DA 9ICFA 4GC6A 1ZQMA 1D5AA 4CGFA 3LP3A 5J2KA 4RU9A 2BGWA 4CJLA 4Z6FA 2X78A 2X6NA 1UOCA 4JWMA 4KN7A 7ICSA 4B9NA 5C42A 2ISPA 2ZD1A 2BCVA 2MUTB 4IR9A 1TKXA 3C2LA 4FW1A 2BGGA 2V4RA 4QZEA 4CF9A 1RT6A 3LALA 4I2BA 9ICUA 4CHZA 2MUTA 4F4XA 3OYBA 4Z4IA 3C21A 3V1QA 1TVAA 5IIKA 4ZHRA 4JLHA 1HYVA 3RB6A 5D49A 4ECYA 3MFIA 4IFYA 2P5OA 1BVSA 3NF7A 4PQUA 4Z0UA 1KLMA 3WNFA 5F9LA 4CJ5A 3RB3A 1VSIA 4QW9A 3AVLA 4BE1A 2IA6A 4EZ6A 2RDJA 4DL4A 4P4OA 4DTUA 4OLBA 3CYMA 3AVKA 2B21A 3MDCA 2E6MA 3K5LA 4ELUA 4RQ2A 4KN4A 1EX4A 4J2EA 3ZT0A 5DQHA 3HT3A 3BQ2A 1ZQUA 3NH1A 4CFDA 4F4WA 3SI6A 2JLEA 1KFDA 1BPYA 4DEZA 4CF2A 3T1AA 4Z4GA 5J0XA 3JPTA 5KFBA 3MABA 1UWBA 5KT5A 2KW4A 3K5OA 4I9LA 4CF1A 4PGYA 2Q3SA 2Y1IA 8ICLA 1WLJA 4CEBA 3MR3A 3OYJA 5J0YA 5CP2A 1ZQLA 5CYQA 5KFPA 2XGQA 4YMOA 2DFEA 4FLZA 4LY7A 3NGIA 1EXQA 4QZ9A 3OYNA 1TAUA 3NCIA 3G6XA 5IIMA 3V7KA 1RBRA 4HHTA 9ICMA 4I28A 3KIOA 2BPGA 1EXNA 1WSEA 1JLBA 4DL7A 2R8GA 3RB0A 4DTSA 4WE1A 1HYSA 7ICHA 4QZHA 1XSLA 1DOQA 7ICRA 1J53A 4F5NA 2HHSA 4OKJA 2BQRA 3OYMA 4JV1A 5IINA 5I3UA 3H4DA 2OPSA 5J0QA 8ICZA 1NKBA 5J2HA 5CR0A 2R8KA 4K8ZA 4I29A 3CM6A 5DB6A 3VN5A 5KG7A 1RYRA 5KG5A 4PUOA 2PZSA 4F3OA 5KFUA 1NK4A 3Q8LA 4GXIA 4KO0A 1ASWA 4DTNA 3MR5A 2O4GA 1BPZA 1CXUA 4CK2A 4GVMA 1ZQWA 3AU6A 8ICWA 1S97A 4CK3A 3QEIA 4FJIA 2ATQA 3KD1E 3C1YA 1L3UA 4IR1A 8ICEA 4CJUA 2XCAA 3MDAA 3OYDA 3K58A 5EU7A 4G3IA 4DLEA 5KGWA 4KTZA 1BPXA 3QETA 1BPDA 5J1EA 1ZYQA 1JN3A 5EWGA 3C5FA 1COOA 4ECUA 3MEEA 3LWMA 1VSFA 2IHNA 2VG5A 4EBDA 3SJJA 4YG2A 2XRIA 5KFIA 4CJSA 4RQ8A 4CF0A 3V9SA 1YTAA 7ICMA 1U48A 4UB2A 4PA1A 4KHUA 4CHNA 3RBEA 1FXXA 4M3UA 4RT2A 5DLFA 1TGOA 2C2EA 2ASDA 4NCGA 2IAJA 1S6QA 4E7KA 5DK5A 2ASLA 4MQ3A 3PNCA 4ED3A 3U6FA 2RDIA 2ZTEA 3QIOA 5FRMA 4KPYA 5FROA 1RZTA 1N5YA 4FK0A 2B6AA 3B6OA 3V72A 2KZ3A 4ED6A 4KTQA 4M3YA 4KLQA 5FDLA 5DGBA 1NK5A 5TZVA 3BDPA 3KLGA 4DTPA 7ICIA 4R8UA 5DMRA 3ZSQA 1RT7A 4BDPA 4DSKA 1ZQQA 1KCFA 3RWUA 4QZGA 1QQCA 1BPBA 4FO6A 4FJNA 2EX3A 3QESA 2B5JA 2A1SA 3RRGA 3GIJA 2KZMA 3ETLA 4O3SA 1DLOA 3FFIA 3NH0A 5E41A 4JV0A 3PO5A 4BXOA 4ID1A 4CJWA 1WCNA 4F4KA 1WAJA 2AU0A 2F1IA 3OYGA 4M45A 4FCYA 2AJQA 2GWSA 3BGRA 1X9WA 4N5SA 4UAYA 2ITGA 2ISOA 4KHSA 3ITHA 4PWDA 4MF2A 1REVA 1YVUA 4F4YA 1S10A 2IGIA 2O4IA 5J2NA 1Q9YA 2VA3A 3DRRA 3IS9A 3DLEA 3TR8A 4UBBA 1C6VA 3JPNA 3C94A 8ICNA 3KD5E 1TK5A 4CESA 3K5MA 2YNIA 5IILA 4E1NA 4RPZA 3S3NA 4O55A 4I2QA 4FZXC 1IKXA 3UXPA 4FYDA 3KHLA 2ATLA 2YHBA 5SWMA 8ICMA 3TANA 4FJ7A 4PHAA 2E6LA 4UQGA 3TFSA 3AVGA 1C0TA 1JKHA 5KFHA 2Y1JA 2BANA 4F50A 1ZQSA 2G8WA 3VQCA 1XS9D 4OGCA 4Z4CA 4ECVA 2GUIA 3L2VA 4GXKA 4JK1A 2HNYA 9ICPA 7ICVA 4O5EA 4KRFA 5IIIA 5HNKA 4DL5A 3ZSWA 4GXJA 3T3FA 4E1MA 1L3TA 3PW7A 1JXBA 4IG0A 4IQUA 1JXLA 2DFLA 1HQUA 1WSGA 2BKEA 1TK8A 4KHYA 3NTUA 4KITB 2UVRA 5HROA 4F5QA 1ZQGA 4KLFA 4EBCA 3LPUA 3AA2A 1KFTA 4NYFA 4E7LA 3S3MA 1KVAA 4EZ9A 3ZSOA 1ZQEA 5HMLA 9ICSA 4RNNA 2YNHA 4H4OA 3OYKA 3LANA 1XSNA 3OHAA 3OYIA 4O3OA 3TQ1A 2HHVA 1S0MA 3CQ8A 4W5NA 3G10A 4I2PA 3IM1A 7ICOA 3HXMA 2C28A 3SUPA 1UAXA 4IQVA 5KGXA 2W42A 2BPFA 4DU4A 1RDCA 2A1RA 1QLNA 1IKYA 4DOBA 1LB2B 1QTMA 4BWMA 1ZBUA 4FK2A 2PFQA 1RBVA 1TL1A 2WOMA 1X9MA 3TAPA 4YP3A 2FLNA 4KLEA 4CEZA 4QOZB 1BGXT 2P6UA 4F5PA 3DLRA 3VQAA 4E7JA 2FLPA 3L3VA 3I8DA 3EW9A 2BQUA 4X5VA 1RNHA 2PFNA 1S0VA 2PI5A 5JS2A 2NRWA 1LV5A 4B9MA 4IQTA 3GDXA 3G0ZA 4CFCA 4O5CA 3V81A 5KFYA 2GBZA 3O3GA 1RT1A 4BE2A 3HSTB 5KFFA 4TSXA 2F96A 5KFDA 2XY7A 1S1UA 3LK9A 5JS1A 3V7LA 4PHEA 2I1QA 4FW2A 1NJYA 3FDSA 2PYLA 3TI0A 4N47A 2YV0X 9ICKA 1ZJNA 5T7BA 1Z3EB 4F2RA 4M9HA 1S5JA 4F5OA 4NM1A 1JLAA 1RDAA 1QS4A 5J2CA 4RQ3A 3ZSZA 3OJSA 2AQ0A 5HHHA 4TUSA 3NAEA 4IQWA 2IC3A 1KTQA 1WCLA 2Z1JA 4HUGA 1VRUA 2QKBA 8ICPA 4Z6DA 2PXIA 2ZJ8A 3PW4A 4DOCA 4EP5A 1QE1A 2IOCA 1RDBA 3EZ5A 4YMNA 3UQ2A 4TURA 2KFNA 1T3NA 1ZBFA 1MU2A 3RBDA 4LVSA 4ECZA 1J54A 3L2RA 4FXDA 3K75D 1WAFA 2YNGA 4OPKA 4OKKA 2IHMA 4CHPA 1H38A 4M9GA 1HMVA 4KHWA 4DFMA 1ZQNA 2AGOA 4QWBA 4NLNA 3VQ5A 5KTQA 1WSHA 4FM1A 4F8RA 5HLFA 4W5OA 2W9CA 5SZTA 1C0MA 9ICWA 5KFEA 3SPYA 4QWDA 3GIKA 5KFNA 2HNZA 4MFCA 3DM2A 2BQ3A 1MQ3A 5KT2A 1R0AA 1RT3A 4FJ8A 4PHPA 1U45A 1XC9A 8ICAA 5HRRA 4E7IA 1VSJA 4KLJA 4CJRA 4IRCA 3HJFA 5HP4A 3MR6A 4ECRA 1C1BA 4RZRA 1ZBHA 2Z1GA 1YT3A 3OS2A 5J0PA 2R8HA 4F92B 3L2WA 4TUQA 3H8WA 4G1QA 3SQ4A 5K14A 4JS4A 2RPIA
chains in the Genus database with same CATH superfamily
4FL9A 1FJ7A 3NH2A 3ZDEA 4L75A 4DQIA 1PYTA 5EX3A 1IM6A 3PR5B 2VZ9A 2O8DA 1Q78A 1LWEA 2D69A 1YSJA 4DF4A 1ZD3A 2BV3A 2XMMA 1FVQA 4ES1A 5CXTA 5KNIA 2OTJN 1O1WA 3HYFA 4OFZA 3DV9A 5GADP 4OYZA 3O08A 2FDNA 3CPWR 4XPCA 1T7PA 2CPFA 1KEKA 1UFWA 2CPJA 4NLVA 3MF5A 4QIWF 1KD1T 4FNIA 5AQMA 2W55A 4LF9F 1K47A 1U26A 4BROA 3IP4B 4Y2TA 1C4CA 3QNMA 4Q5VA 3MEDB 2UUAF 3R1XA 4ZPCA 1N34F 3AVBA 2B4PA 3MEDA 1UVLA 2H3IA 4ZA1A 4PZNA 3GWCA 4BRDA 2M88A 4LZGA 2FY8A 1VCTA 4CLWA 3I0RB 2QWLA 4JRQA 1WI8A 2ILYA 2QLFB 3F44A 3I0RA 2V7YA 2WF9A 4H54A 1U04A 3VQSA 4FLTA 3L6QA 1R0CB 1U2VB 3TAEA 1U2VA 3TYTA 1ZQKA 2ASMA 5HK4A 2QL5B 2KFYA 2EPIA 1K9MT 4OKEA 4Q43A 5AKXA 1Z19A 2D4WA 1FK9B 2XO7A 1TFYA 5FLXY 4UOGA 1FK9A 1A77A 4RPFA 4LIRA 5EY4A 1NU0A 3M6ZA 5A76A 4LF7K 5A8WA 1U49A 2Q0UA 2KJ9A 4D3HA 2VKQA 1YI2S 2OPSB 4OI1A 1RYUA 3NRWA 5AK3A 1RYSA 3ZTPA 5F8JA 4PL7A 4B6JA 3KLIA 3S41A 3ZZYA 4CEDA 4DJBA 3JXUA 3IR7B 3W66A 1K1QA 3UMCA 3R3LA 1ZXOA 1NLVA 3GSIA 1HNWF 1NOMA 2AW0A 1O08A 2LPEA 2GV1A 2CRXA 1NCLA 4X4SA 2DXDA 4DL0C 4OV1A 4O0NA 3OXLA 2IOFK 1XJWB 3BEGB 3DMJB 2K7KA 4FYWB 1EZZB 3I32A 2BOAA 2ZJ5A 3DMJA 4WF9L 4DSFA 4F4ZA 1LW0A 4OLPA 5E26A 2O8FB 4CJVA 3A5NC 2EG1A 2I2YA 2WB1F 3MECB 1ZETA 3HX0A 2O8FA 1XSPA 3F9MA 1HIWA 3MECA 2GTDA 3WK9A 1NNDA 4PL1A 4MHVA 2EFNA 2FZKB 1IBKJ 5KI6A 1LXJA 2VG5B 4PHDA 2CG8A 2B4OA 1WG1A 3R9KA 3EYZA 2O67A 4NWBA 1IN0A 1R8PA 2G8IA 3AM9A 3G86A 2ZJPL 4H4KC 1KS2A 2PEHA 2Y1RI 3U3GA 3RGIA 3POTB 2G08A 3OHBA 4M5KA 5H9EJ 1N56A 3POTA 4PABA 4M2YA 4J5OA 1P1TA 2MPUA 4DPOA 4CK1A 4FJ9A 2VQEJ 3FAHA 4B1YB 3L2UA 1R31A 3J7AP 2D3O1 5D4BA 3NMRA 4M3ZA 3VQDA 3BBBA 5F8GA 2WW8A 3UO0A 4MEXA 2DT9A 1F9EB 1RT7B 4B8AB 1GMWD 1ZAWA 2J4RA 4CGGA 3C46A 2HQCA 2FBXA 4A5BA 3THYB 2VJUA 1S77D 2OP5A 3K5NA 2VOPA 2BRKA 1HWLA 2RRNA 3THYA 3UPQA 2B8QA 3X1LB 4IKFA 4BXOB 3ICXA 4ZVTB 3C5GA 4NLGA 2BH1A 1AFJA 1H2TZ 4OO1J 1VQOS 3N9UC 3RBZA 1QUVA 4DLGA 1OY6A 2EZXA 1U1MA 4CJ3A 4XEIA 4JOUA 2ZDOA 1X0FA 3LZIA 3V6HA 5GAHP 5J29A 3TJ8A 3GSDA 2GV9A 1EO1A 1WKLA 3EE3A 5HP1B 4JI7J 4CBWA 4NXZA 1VK3A 4QYRA 4DQQA 4M8LA 5CA5A 4Y2RA 1UPMB 1CUKA 4DR4J 1U1KA 1JL2A 1CLQA 1IKXB 5HP1A 4PG5A 4BC3A 4BGDA 2UXBF 5D4LA 2GH1A 1U8WA 5LXYA 4ISFA 3ZDDA 8ICGA 3OTQA 4H0TB 5D4OA 4J9PA 4NPOA 2C22A 2IDLA 2X51A 1SH0A 3T5HA 4OQJA 2FJXA 2ZDPA 1HWIA 1NZBA 1KFSA 1OWXA 1OY9A 2I8EA 2D3ZA 2EANA 4ZOSA 3KTQA 3KUHA 3HSGA 4L72B 2P9LB 4KLIA 3E51A 4A8QA 2WBMA 1HQUB 4FJ5A 1IXKA 5E3AA 3H0PA 1VQPS 3CCEN 2HW3A 1V38A 2O8BB 3Q89A 2P9LA 5GMKa 1T6DA 2W3RA 2W6LA 2XNQA 1MWKA 1P1LA 4JKAA 4MO5A 3BSOA 1K44A 1ZBIA 5G4DA 2HWIA 4F26A 4BE0A 2R3VA 1JLFB 1I39A 4IOAL 4CQ1A 2IA0A 3CCVN 1N52B 1I3AA 1HUZA 2AGPA 3I76A 2Q43A 1JLFA 3DDNA 4JI5F 1NGAA 4N41A 4HVZA 4ED7A 2BA9A 5LT5A 2WF5A 1NB7A 1WSJA 1KAXA 1S1WB 2W4PA 3HVTB 2C3PA 2YTCA 1BG3A 1S1WA 2JEFA 3HVTA 3BS9A 4DFKA 2PFDA 5E3PA 3KHHA 5I42A 4NMLA 2KU7A 2LA4A 1YVFA 3UKUB 3K57A 1UPHA 4DCCA 2HKEA 4OZJA 3FZLA 2PFPA 3JPSA 2G0IA 4H5NA 2FJWA 2MGZB 3AVCA 3EJMA 4CJ4A 3VEOA 9ICXA 4QZBA 3BEXA 4MJKA 3KZXA 1GLDG 7ICPA 4H0XB 3F5EA 3PMLA 2DRBA 3T5LA 4YFUA 3VALA 1B4SA 1AA1B 1TV9A 2YKAA 1DURA 4LF9K 2CZ4A 1O0PA 1G4CA 5F8IA 3I1YA 2I1RA 3PKYA 4J8FA 1R0BG 2A6AA 1YVNA 1N5VA 2UUAK 2IVYA 2G8UA 2GLEA 1MMLA 3F73A 1WSIA 1ZD2P 1N6QA 3AO4A 3CMES 5ALVA 1X66A 1HLWA 4RWXA 4OHYA 1A5WA 9ICIA 4P2SA 1JIHA 2P9NB 2KT5A 1GLFO 1QAYA 1KN5A 2P9NA 4M04A 4CGZA 2X1BA 1VBXA 3D28A 2XMVA 4YB5A 3KK3B 4FWQA 4NEZA 2CQ3A 5IC4B 1HMVB 3NHGA 1ZTWA 4CBXA 4DR7K 4UARA 3KK3A 2XS7A 4DR3F 2ZBPA 1JUDA 5CEHA 4OYAA 1Y97A 1D9FA 3JS6A 4BVOA 1B92A 2L08A 1UQVA 4ZPTR 2Z30B 2RHSB 3E8OA 4L3KA 4DPWA 4EO6A 3NAIA 2VD3A 2KKHA 4JV2A 3DC2A 4KGKA 4X66J 3L3CA 5JRTA 4PG6A 1BCMA 4JV5J 4F7VA 1XU4A 2F1FA 3W3DA 4DTXA 1UCNA 5ETKA 4P0PA 4GW6A 4FJXA 4ATNA 5B0GA 4C1NK 2A19A 3VF4A 3KUGA 4CZFA 2G1DA 5J2EA 2XHCA 1HNWK 4FPAA 5E0OA 1YITS 2OYYA 4DZDA 2F3NA 3QEBZ 4F3MA 3JSYA 3CMQA 4FZZA 2VOOA 1K73T 5IQ6A 4AHTA 3ELHA 4YEAA 4A2BA 3RB4A 3T6JA 1RAHB 3HFKA 1LWCB 4P52A 2LU1A 3C23A 4P9SA 2VBXA 1BLUA 5L1JA 4PZVA 4JI2F 7ICTA 1LWCA 4A8SA 7ICJA 4KB1A 5KRSA 3QBCA 1W9HA 3HCXA 1N4LA 1I94J 2KK0A 4YDDB 1NK6A 4IOCQ 4UAWA 2AT1B 5CB1A 2OKQA 5D8HB 5C7PA 1M5KC 3N7PD 1NJZA 3GIMA 2OI2A 1HQ2A 1Z6RA 3TAMB 4N56A 4FM0A 1QHAA 3C2MA 1UJ5A 1EWRA 1P8ZA 1K1SA 1RK8A 2W2MP 4TUPA 5A0LA 1WHVA 2XM3A 3CTRA 1KC8T 4X4PA 1RBSA 2G8HA 1B3TA 3DXSX 4RX6A 4KE5A 1OMSA 5HMWA 2X3DA 3W2VB 3TAGA 1KNZA 3H1VX 4FWSA 2HDOA 2VYPA 3HKZF 4CTAA 1CXQA 3W2VA 4AQYF 4IQXA 2RUGA 2AGQA 1WBDA 2JEJA 1DQAA 2MY7A 4BGBA 4HTIA 3VTIA 1H2UX 2BE9B 3R7BB 1V97A 4M5DB 4JKHA 4OYWA 3GIIA 2NLXA 3Q8QB 4JI1F 4M5DA 3CCUN 1TUVA 2DHHA 1Z1BA 4LFCJ 1IVZA 1HRHA 4K4GA 2MQ8A 4QZVB 4PXCA 3OR1B 1QUPA 4GO7X 1ZPVA 4XRHA 5T7LB 4LF5F 2I5JB 5ALSA 2NYVA 1ZQFA 3OR1A 4FP9A 4I4BA 4KLHA 4CHQA 1O5JA 3NMAA 3D1HA 5EXWA 2OA8A 2OJ3A 3UM9A 4G1IA 4TXSA 3HOSA 2LLZA 3S6EA 2LM1A 2DKZA 4EYIB 1KC8O 4PR6A 2PFFB 1VSMA 4U6PA 2K4EA 1R8BA 1KQKA 2E1YA 3DHXA 5CY4A 2YHXA 1TKZA 4I1TA 4DHVA 4Z37A 1BI4B 2LMIA 4O5BA 1HJRA 1BIZA 2MKJA 1NMDA 3GJSB 2KICA 2VFUA 4OHVA 1BI4A 3TZWA 3AU2A 4ES3A 5LJ5Y 4CIGA 4UB6U 2E5SA 4XA5A 1Q5VA 1DGJA 2QA4N 3FJ2A 4WXOA 5L9NA 3CJ1A 2HZVA 1ITPA 2YWWA 3FZHA 4IUFA 2UXBK 2NUBA 4M6WB 4KLGA 3SNNA 4W90B 4KLUA 4M6WA 3LZJA 3EGZA 4DR4K 4LF8F 5KFSA 9ICLA 5GIPA 3LAKA 4A8KA 2BCUA 2HPUA 4ZJQA 4CHYA 4B3RJ 4RPYA 4E89A 4QPTA 1XNRJ 3C6AA 1NZPA 4EGLA 1F6TA 9ICGA 5E79U 3I55S 1WG4A 4OIXA 4C11A 4C98A 4KIAA 3K8WA 1VYAA 1YAGA 4JYAJ 3H8JA 3SAHA 1YRTA 2C3UA 1T05B 1U24A 4GC7A 1YJ9N 2ZXIA 2H51B 3VEXA 5HVGA 1L7NA 5L1IA 2EZZA 2UUBF 4PGXA 4UOHA 2YB4A 2F8LA 2DCUB 2Q66A 2R9LA 2B0GA 3KZBA 5CAAA 1WSRA 5AFUH 4OZNA 3ZT2A 1ZQOA 5D77A 3KLVA 3R27A 1E4GT 3I56N 2P5GA 4CVNE 1S76D 4GFJA 1U2FA 1VLOA 3C1ZA 2KTQA 4WJBA 3UB5A 1MW7A 1SC4B 4DUTA 4PXBA 5IS2A 1HNIB 2R2RA 4CP5A 1VQKN 2CVIA 1NGJA 1HNIA 4FN5A 3OYAA 2HYIB 2DEJA 2WFAA 4FPIA 4GKJJ 3I33A 3J7YP 4QCLA 4ENOA 5GAGI 3NGZA 5M1NA 3O2IA 1ACMB 5E7OB 1RE1B 4QWEA 2CZ9A 4HUEA 5C5JA 3DXMA 1EKRA 3U9DA 4YQWA 2JRZA 3W0LA 1U47A 2CPHA 1JCGA 2QRRA 3DHWC 2AYBA 3D9BA 1DGSA 4BWJA 3V4MA 2D0CA 3KJVB 2YB1A 1UP1A 4ED4A 4JK9A 4X64J 4BY9C 3KJVA 3K1RB 5ALZA 4P6QA 7FDRA 5KT7A 5F3TA 3MGJA 1RWMB 2C3OA 1XERA 2FTRA 3EVWA 2Z58B 1S9GB 4KAZA 2NLWA 5AI9A 5ETPA 1VSDA 4M9LA 4OJPA 2RF2A 3AGKA 4YOTA 3OLBA 3UWTA 1S9GA 4ZLLA 2GIFA 4WFXA 3N01A 5CCLA 4LRCA 1LWXA 4ETXA 1NGHA 4HH1A 2D3OR 3QAUA 1FX2A 3ZEUB 1JMTA 2KYXA 1MSWD 2G06A 5GTIU 3GZFA 1URRA 3ZEUA 4P2MA 4WTYA 1ZQBA 2BR0A 4RW8A 4MFAA 4USHA 4Z6EA 1GXLA 4DUYJ 3A3PB 4M7XA 1MWZA 3IGNA 4I2HA 4EI2A 1REGX 3B4MA 4TLQA 4QR2A 3Q86A 3BZKA 2E20A 1Z26A 3H4BA 3B4DA 3IDWA 1SVDA 5AK5A 3H7HB 4ZVSB 4ZVFA 3SAGA 1AYEA 1R3NA 4L8RB 3RMAA 2BPCA 1HNXJ 2LSNA 3RU0A 1WN7A 4JMUA 3A8JA 3W9JA 4E8UA 1ZQXA 2K8GA 5HL7Q 1ZA2B 5I9EB 3GFHA 5J2MA 4BR4A 3SEOA 2P6RA 1GAOA 1NGCA 4K4IA 5JMNA 4GVEA 5KFJA 5HQLA 2O8EA 5A8RB 4YOEA 2HWTA 4IFVA 3MI7X 4JI2K 4A8WA 3HVRA 4YUDA 3G6EN 1SXDA 5A8RA 3FEZA 5K4LA 1BCOA 2OLWA 1NSPA 5AQGA 4BRPA 3T1YJ 3QT7A 1TV6B 2BJDA 1JROA 2P9PA 4X62F 4RPXA 4UTGA 3FM9A 8ICTA 4B3SF 4AHSA 1TV6A 3DGPB 3T9ZA 4RG8A 4V1Ak 4UAUA 3CSKA 4KMUA 1PUZA 4Y6IA 3HPHA 3UE2A 1ZQTA 2IVMA 4MKAA 2W9MA 5HQ8A 5A2QO 1YGYA 1OY8A 1G7CB 4CGDA 4K4HA 4H0OA 4XQ8A 1VBKA 4C3KA 4MF8A 2HS0A 3U8XA 4J2AA 1Q3VA 2ETJA 2VB6A 2KRBA 2ILZA 4AQYK 4J9UE 2BW2A 3U9ZA 2E9TA 1YX2A 3ZSVA 3RMBA 1MROB 2X6SA 2LDYA 1UA1A 4WJ3B 5AZJA 1FWKA 3OBWA 3J80O 2F77X 3THPA 1MROA 2I0XA 2YKOA 1ZQHA 2MYFA 4DSLA 1SH2A 1BC6A 2JRSA 3OPKA 1FXRA 1XWLA 3TADC 3RJGA 3DI6B 4LSZB 4R63A 5J2BA 4RNMA 1RDWX 2QMUB 4LF5K 4M1KA 4X65F 1DBDA 3VQ6A 5LJWA 1PAEX 3N4PA 4ED1A 2B43A 1FRMA 3QWUA 3OQ2A 4AT1B 5J1NA 1W2BM 3TA1A 4DX6A 4DR6J 4CO2A 1VRTB 2O01C 4IOCL 1KQGB 2IM1A 8ICSA 3P83D 3VQ9A 1Y4ZB 5KFQA 2KJWA 2AV5A 3DRSA 2XI2A 1VRTA 2H3GX 3MEKA 1MA9B 3CC4N 3AOAA 2QWOA 3KKAA 2YNFA 3BF4A 2VFVA 1G3OA 1LKYB 2RS8A 2GC8A 2XY6A 4R79A 1JLEB 2YJEA 4RUAA 3SBGA 4UB8U 3KLFB 4DV3J 3KK2B 1JLEA 2P9KB 2OHFA 4FKYA 1OVYA 1DT9A 3KLFA 2J7UA 3R6MA 5DDQC 3KK2A 2BCRA 4RQ7A 1NAQA 3KLHB 3MM5A 2P9KA 2VWJA 4Q2MA 1C7YA 4RWWA 1AQ6A 2F2AB 5SUHA 3ZDBA 1GLBG 3KLHA 4C23A 2LVWA 4ZN3A 2HHUA 3ENWA 2E7WA 2W9AA 4R25A 1BWFO 2GQCA 3EN9A 4LFAK 4OYPA 3KXDA 4LF6J 4LF8K 5DJBA 2WAQF 2BGWA 1FNMA 1ZD5A 1LWFB 1VQ8S 1MWYA 7ICSA 2IM0A 2Y9HA 2MUTB 4ID8A 4FW1A 3C2LA 3F2BA 1FKAF 2CPRA 1Q8BA 2VJ5A 2MUTA 2WF6A 4F4XA 1A6LA 4LJMA 5IIKA 4ZHRA 4JLHA 3MM7A 2RS2A 1HYVA 5AXLA 1YZ7A 1TR0A 1U1LA 3FC9A 3NF7A 3TP2A 1IQTA 1K0VA 2H48B 3TUPA 2CQBA 1H98A 2K89A 2W01A 1IV0A 4BE1A 3EGNA 4JI0F 2UUBK 4J7CA 3R5BA 3GE9A 4P4OA 5A8KB 1YQHA 4Z7YA 4Y2AA 2WZ1A 1CSJA 1EAYC 2I6XA 5AQLA 5A8KA 1ZA1B 1NRKA 3MDCA 1YBAA 2B7CB 2V2ZA 1SB3C 1KONA 3Q8UA 1Y10A 4KN4A 1EX4A 3KMSA 3BQ2A 1ZQUA 3UKRB 4F4WA 3NWRA 1UWBB 3IBFB 4DEZA 3H45C 3DU6A 4CF2A 1UZDA 4QS9A 3UKRA 4Z4GA 1NDCA 2BE2B 1UWBA 2QN6B 5KT5A 2KW4A 5ALGA 3M32B 1GLLO 5TKYA 2B4UA 4PGYA 5J8YC 2Y1IA 1WLJA 2IRYA 1TL7A 5CYQB 3M32A 3MR3A 4H5RA 3OYJA 5J0YA 3WKCA 3NASA 3E3XA 3D2SA 3FKBA 4R5PB 5CYQA 5KFPA 1HFEL 4YMOA 2CNNB 4FLZA 1BD6A 1FERA 4QZ9A 5AI8A 3M4XA 2CUYA 4QYZK 3S01A 1Q53A 1RBRA 3OBIA 4YHHJ 3EVMA 4ZIVA 4I28A 1HYSB 3Q2TC 3VGMA 2E8NA 4Q7AA 5GAGU 5AKYA 4HAIA 2EFQA 1HYSA 3JSBA 1XSLA 1DOQA 5KAIU 1J53A 3CULA 3MGVA 4K25A 1IBCB 5ITHA 2F40A 3OYMA 2G5IB 3H4DA 3CGIA 5C10A 1RBAA 4HACB 3CXCR 4TN2A 2R8KA 4WYLA 1HPMA 4BG9A 4I29A 1HKAA 5CYJA 5KG7A 2RRDA 5F1XA 1RA7A 1BNOA 4RO0A 4F3OA 3GPAA 1NK4A 3Q8LA 1RUSA 1ASWA 3D67A 4A59A 4YOUA 4OZ0A 5HI7A 4CK2A 4JEPA 4GVMA 3MX5A 4JI8F 4YOWA 3KD1E 3C1YA 3GR0A 1IBMJ 3K9JA 2VG7B 4C8YA 2VIXA 4V19S 2Y9UA 2DK2A 4DLEA 1Q81T 4KTZA 1QCKA 2UV8G 5C15A 3QETA 2NXCA 1HHTP 2QWPA 2W03A 1ZYQA 3CJTA 2HOIA 5EWGA 3C5FA 1HBMB 4FO0A 3LWMA 1DTQB 3SJJA 3FZFA 3WDOA 1HBMA 4XPEA 4CF0A 7ICMA 4H0PA 3IRWP 4CH7A 4UB2A 1FFWB 3RBEA 3LW5C 4CF4A 3EUNA 2KVSA 2ADCA 3ZZUA 3SQOP 2ZJQQ 5KQDA 3QDKA 2HCFA 1RXOB 4AP9A 5AKGA 4M5LA 3R1HA 3QU4A 4NCGA 2DHAA 3QX7A 4TYAA 4ED3A 4F04B 4XDCA 2RDIA 1YTYA 5ETLA 2CQ4A 4KPYA 1HPZB 4LQ3A 3PSFA 4ZCKA 1RWWB 5AI0A 4Z7CA 3B6OA 3V72A 3WQTA 5JXSA 4M3YA 2OTLS 4CZHA 2D3DA 4KLQA 1NK5A 1JNZB 3BDPA 4PKIA 1Q81O 1VQMS 3JQJA 2R2TA 4JI3J 4ER8A 1ZQQA 4ZCIA 2BUPA 5BRHA 2CDRB 1QVGM 4X84A 5D6GA 3CC2S 1B7FA 2AXTU 3RRGA 2E7VA 3ETLA 1PJ6A 4K4XA 2K3IA 3NH0A 4OI4A 3C65A 3UQSA 1BWVA 2WBNA 2MB0B 4RW7B 1HBNB 2F1IA 1RHJB 3ITHB 2M0NA 1JJCB 3OYGA 2GWSA 2J7WA 1X9WA 4BG8A 4N5SA 2ITGA 2ISOA 1HBNA 4WQ5A 3TTCA 2XWYA 3ITHA 5J2NB 4IDHA 2IVPA 4IG3B 3DRRB 1UCVA 1WELA 3N6LA 4ZVRB 2IGIA 5J2NA 1Q9YA 1GEHA 3DRRA 3DXKA 3DLEA 2L3MA 3TR8A 3HHLD 3C94A 3RYLA 2B9WA 1R8CA 4FXVA 5HR6A 1IJFB 2K8BB 3M8ZA 3S8SA 4E1NA 4RPZA 5HL7L 2RQ5A 3MMBB 3JQKA 3BR8A 1H74A 2QWQA 3SMSA 4J91A 2QIFA 3MMBA 1RTDB 2YHBA 4NLYA 3HSCA 2XO6A 1SIJA 2ZIXB 2E6LA 3AVGA 2ZIXA 2FI1A 2QM1A 2Y1JA 2G8WA 2UU9J 2CKWA 2DBYA 4CRXA 2HNYB 1XS9D 2DKOB 3R6LB 4LR8A 4P10A 2HNYA 9ICPA 1SJQA 3K89A 2WVDA 3QT8A 2XNRA 3T3FA 4NO7A 3CJ4A 1SQGA 1ZZFA 3PW7A 1ZM3A 3HHEA 1JXBA 4IQUA 3RW6A 2E7XA 3HKZC 3MCMA 1TK8A 2QT7A 4KHYA 3NTUA 1FWPA 2UZAA 5HROA 2XG8A 1T44A 2B51A 2MKYA 4KT0C 5IM0B 3QBXA 4EZ9A 1RAOA 3TSUA 3UI3A 3ZSOA 3ZTQA 2VASA 1UPPA 2A2CA 3UDVA 4EX6A 2OFHX 1SGGA 2ZITA 3IP0A 3G10A 7ICOA 1TP7A 3M7VA 3HXMA 3LGMA 4IQVA 4UZBA 2HSTA 4URSA 4WFBQ 4IZ9A 2FF6A 2A1RA 2ZBRA 4CZLA 2WOMB 2VPYB 3OW2R 4IO9Q 4EK2A 2RJZA 1QTMA 1ZBUA 2N4CA 1RBVA 7AT1B 1N88A 2WOMA 1TL1A 5ALYA 2MZQA 1ZXIA 2FLNA 2AJ4A 1RWOB 4KLEA 4OYMA 1U1PA 1BGXT 3DLRA 4E7JA 1H72C 5D0RA 1X3MA 3EW9A 2BQUA 5IT9Y 4YDUA 2I38A 3CW2C 1S0VA 2KYZA 3WC2A 3K2YA 4C0ZA 3GDXA 4CLSA 5AHXA 3H0LB 3TA0A 3V81A 2NRRA 3IDHA 3WIVA 4NL9A 3O3GA 2QLJB 3VAMA 4IQMA 4DV1K 4LSNB 2BZ2A 5KFDA 4NYZA 2XY7A 2OTJS 1VLYA 3LK9A 1IR1A 3D2NA 2HWHA 4JI0K 3OTCA 4FW2A 1NJYA 1PSDA 3L09A 1DRZA 1WHWA 4ZCMA 1RWNB 1N63A 2RH3A 1Z3EB 1S5JA 4NM1A 2E88A 1YWXA 5J2CA 4RQ3A 2PE8A 3ZSZA 3OJSA 4CO5A 1KKXA 3D4JA 4DOZA 4DXLA 4O8KA 4KHPF 4KH1B 1F9HA 3U1LA 4RR5A 4FZNA 3MWTA 2ZNZA 3DOLB 1OXJA 8ICPA 2PXIA 2ZJ8A 1RHKB 1QE1A 3A1YG 1RDBA 2VBZA 3CIZA 5BJRA 5H2FU 3UQ2A 4TURA 2KFNA 3U7JA 1T3NA 4BC2A 2Q31A 5C0YA 1RAJA 2IDEA 4OMFG 2YNGB 2WCXA 1J54A 5K5MA 1MDUB 2RDDA 2YNGA 4OKKA 1H38A 4M9GA 4A47A 4NB4A 4ILGB 2JVRA 2BJEA 1KW4A 3I4PA 3OR2B 3ZO7A 2ZBIA 5KTQA 1WSHA 2WVFA 4FM1A 4E1JA 2W9CA 4C97A 2V4JB 2CH5A 1GMVA 3OR2A 3OVSA 4NL5A 3WK7A 3A13A 3VAKA 1R6VA 4CZEA 2V4JA 4PQAA 4OZ5A 3WIUA 3MMVA 2BQ3A 4URGA 2EWHA 1W2IA 3TJAA 4X66F 2HRYA 3J81U 4H0YB 4IL6U 4JK8A 8ICAA 4KY3A 3HZ6A 1TMJA 3C14A 1ZOTA 1EHWA 4CJRA 2BRLA 4BREA 1U6BA 1GLCG 3R8YA 3ENVA 1VLBA 4ECRA 3TOQA 3D6TB 3FBBA 2BKOA 1LVHA 1YT3A 3FCHA 2JXJA 5J0PA 1RABB 4G1QB 1VRQC 4F92B 2XMTA 3L2WA 1VIOA 2YTUA 3H8WA 2PGCA 4DX5A 1QAIA 4G1QA 4QBUA 1CJKB 5DETA 3M8PB 3GU0A 3H2LA 3ILIA 3QSIA 1O6XA 1F0XA 2XULA 4JI8K 3V6KA 4O3NA 3M6UA 3M8PA 1U0HB 3F2DA 4DS4A 2PIIA 4DV2J 1U0HA 4FXWA 5KFVA 4ECTA 4JK7A 4F5RA 3J7ZT 4CI6A 1I94F 3A8KA 2QYGA 1RCXB 2ZIWB 1N33J 2ZWPA 3PIOQ 3RRHA 1YF5L 4CE6A 3ZETA 2CJ9A 1WNSA 2DGZA 1AT1B 3CMEN 3PEHA 2F8SA 4K0KK 3MMCA 1BNPA 3G25A 1FEHA 2XHBA 3CCQS 5CYMB 3BYPA 1K8KB 4DTRA 3A4TA 5BR8J 3IUCA 1SZPA 4IC9A 3DYAB 2AF6A 2FMPA 3KD3A 5CYMA 1K8KA 3O80A 4CEFA 2DITA 2DCLA 4WU2A 3M5RA 1WOSA 4CZJA 3DYAA 3ISDA 2LXUA 2WB4A 4EEYA 4KV8A 2H5IB 1D8YA 1RISA 2ZHAA 3UCUP 1O8BA 2FJEB 1U2CA 2QB0B 2A3VA 4Y2CA 1PAUB 1NGIA 5FIIA 2VIHA 3NFAA 1BXNA 1WG5A 5J2DA 2JMGA 2Y0SF 3HHNB 2R4FA 3Q8MA 1P7DA 4M3TA 4OVLA 1EKEA 3VEWA 1RT5A 3V9XA 5CJ7A 4USKA 3MR2A 2YKMA 1KAYA 3K5PA 2P1JA 2W8KA 5HMMA 1JX4A 5ALQA 4O8UA 2GJ2A 3ZCMA 1SL1A 1M0SA 4ANCA 3MM8B 3BZCA 1HKGA 5J2FA 1JNRB 3AQEA 5DB7A 3QLHA 3MM8A 5C2DA 3DOKB 2UYTA 5EUHA 2BJ8A 2J0QD 1CC8A 3DOKA 1GOBA 1YITN 5DRKA 5JICA 4O5FA 3PV8A 3BN7A 1MWQA 4LZDA 3JTOA 3JB9k 3ISZA 4OYOA 5ADXH 2FB0A 1XI1A 3IXQA 5CCMA 1PIEA 3MN7A 5D4PA 4HVJA 1SKUB 1CZBA 3Q0AA 4FWLA 1WD6A 4NXMJ 1FE0A 2XYGB 4FJKA 4FLXA 3EPGA 5KFZA 1ZBSA 1WJ9A 4ACOA 2DO0A 5AKLA 9ICNA 2J9DE 3NEKA 4F3QA 1IH7A 2ZJQL 3ZTSA 2ZZTA 4Y0WA 4KRWA 3IHQB 1ZQDA 1XMOF 2GIQA 2CQ1A 3UVJB 2VWKA 3CHWA 3H7IA 4F0HA 4KB0A 2FSJA 4CZIA 8AT1B 3UVJA 1U25A 4B17A 2CJXB 1LOUA 2YX7A 3T41A 2QMXA 2WF7A 4EIAA 3DOMB 3SJHA 5AQPA 2PAVA 5DG9A 3DOMA 2Q6CA 2JEIA 4B3RF 3VQ8A 3CD6S 2HS4A 3LVWA 1RT2B 1XR5A 3QRQA 4JKGB 1I3OB 2A18A 1B43A 1MG7A 2MMYA 1PZNA 4PL2A 1RT2A 2XHWA 3ADAC 4JKGA 4DU1A 3PSIA 1N32K 5MLCV 1RQ0A 3M8RA 3ISCA 4DV6J 4JYAF 1OH7A 3OSNA 3CJ3A 2KQ2A 3R9LA 1S1VA 3CCES 4J03A 4QZIA 2CJQA 4PGQA 1WSFA 3OJUA 3MUMP 3M7DA 5AJ3F 1S72S 3CD5A 4NA2A 1JK9B 2ZUCA 2YKPA 3IFEA 1HNZJ 4BC7A 2V52B 3LF0A 2ITMA 1X9XA 1KVJA 2AJFE 2LQ9A 2MQPA 2A5XA 1FJGJ 2JC0A 2DB1A 2PSZA 4IYQA 3EX7B 3C7NB 7ICQA 4R8UB 2IM3A 1YJUA 4HTJA 2ZWOA 2EHGA 3RVCA 2JWLA 2M9NA 4HL9A 3NF8A 1LCUA 3SQIA 1X5TA 3CDUA 4U7CA 2K60A 2D9OA 2UXCF 5CD4H 3QAEA 2D0AA 3ZSYA 5LMNK 5AQIA 2X3GA 3CCMN 8ICVA 1SV0C 2HSZA 1MN9A 3LAMA 4WZMA 3HFZB 5J1PA 3QO9B 4H0VB 4Z6CA 2MAXA 1HUOA 4H03B 5KFWA 3S9HA 3QO9A 5J0WA 1RT4B 4NY8A 3V1OA 4Q8EA 7ICLA 2NSCA 4PWDB 1NWKA 3G6YA 1X0PA 1NSKL 4NLKA 1RT4A 2RHFA 2CNOB 3E0FA 3LTOA 1FESA 1HWUA 2DTUA 1WUDA 1HHQA 4DPUA 3HJEA 4YMMA 3ZT4A 2P9EA 2EKYA 1ITGA 1HR0J 2WF8A 3HX9A 3AJ2A 2LMRA 2XGPA 2FJVA 3O9QA 4I2QB 5H1SV 4IDKB 4K43A 2ADBA 3TX0A 2VG6A 4IDKA 2DYAA 2MSSA 1NU4A 4JNEA 2GHVC 4Y0FA 2WAQC 3O4QA 1WUUA 2DEIA 4OHWA 2BANB 4DO9A 1Q8LA 3FK4A 2HQ3A 3K8VA 4I2JA 4DV5F 2CJKA 3AVNA 4GRSA 1P90A 5L1KA 5KAKA 5AM2A 4DFJA 3I55N 4KLOA 5HRNA 4WFBL 3OYEA 4IO9L 3N6MA 4JP8A 4DSEA 3OVBA 1KSPA 4DPYA 5AQHA 2A10A 1WC1A 3KOAA 4LRFA 1XUPO 3PW2A 3VZHA 2P2CB 4KLSA 1NM2A 2FIUA 4C8LA 3IRXB 4ICLA 1C4AA 4B3MF 2KG0A 2EDUA 5JTIA 5AE3A 2Q2RA 4CF8A 5AKIA 3IRXA 3W65A 2H9ZA 2VPZB 2HHHJ 3QIPA 1F5AA 5E2QA 1FDBA 3ZDAA 2OEKA 3VF6A 3IG5A 1WKKA 2QLTA 3WNHA 4DUZJ 4GKKF 4IEIA 3NVKA 1LAWA 1HNXF 3RAXA 3SCIE 1V9OA 1KVCA 2F1HA 3BKTA 4NV0A 3GDQA 3QT6A 3ALYA 4FLYA 1YRUA 7ICNA 3RZAA 3WKEA 3CJ0A 1QHTA 5G5GA 3M05A 3CI5A 4DV0F 1RQNA 4DSJA 1B64A 4WKRA 3N79A 1KQSR 2ALZA 1X1PA 3MPUB 3IWLA 2YPZA 4K5RA 3H8MA 3MK6A 5I3PA 2HBMA 2PT0A 3IN5A 3T1YF 3AAWB 1EB0A 2HNDA 3RAMA 1EIYB 3WNGA 4J2BA 8ICXA 3EWGA 1ZQRA 3NGUA 2P6TA 4LR9A 1UVJA 4ED5A 1WC6A 2A3ZA 2E1CA 2CPEA 1DQ8A 1JLAB 1RWPB 2WK4A 4FS2A 4M47A 1N33K 1B0XA 4CJ7A 5EWFA 4OX9K 4QAGA 5FLXU 5HRSA 3Q8SB 4CYUA 1VSKA 4U95A 1VIXA 4KGXB 1Y5IB 9ICJA 2M8HA 3WQPA 4KH0B 4BRGA 3PHTA 2FJDB 1KTVA 3QUBA 4BRMA 1SQFA 3K59A 2QA2A 5JU5A 4M5NA 4EUVA 3TWZA 2Z0GA 4LF2A 1SS6A 3MAAB 5HRPA 4P2XA 4C0BA 5HMZA 1FJCA 1YIJS 3DXBA 4M3XA 2PA3A 4ZITA 2WUSA 4YNQA 4JHDB 3MPYA 4MIAA 2KXFA 3CCUS 2J6UA 2HNZB 3IMQJ 5DZ6A 3KHRA 1F60B 3EKSA 3DM2B 3DKDA 4OJHA 2G0JA 1NGFA 4OZ3A 5ETNA 4OHZA 4FWNA 3PIOL 4Y1DA 3QJLA 3SSSA 2Z1HA 4EHTA 1NLKL 1XQSC 3KWIA 2OWOA 3TWHA 4PKDB 3JPPA 2P9SB 2C2RA 3WNEA 3AVMA 5M1OA 2XY8A 2EFOA 3HHKA 4W5RA 4AUKA 1C0UB 4TQSA 4FZYA 2XY5A 4QZ8A 5CHGA 4AH9A 4DL6A 1C0UA 3RR8A 4G9BA 3LM2A 2NZCA 2ROEA 9ICBA 1OQ6A 4L6V3 2DVIA 2W2QP 3KHGA 8ICJA 3FNNA 2GMLA 2EAMA 3ILLA 2EFGA 2O6KA 3VA3A 2ZQBA 1F1BB 3UN3A 2QA4S 3SUNA 2DY4A 3Q23A 2OPPB 1ESVA 4MKVA 1WEXA 2MLYA 3MUVP 2OPPA 4MK9A 2R7TA 5AXKA 1VQ5S 3GV7B 2XB2D 1LQ9A 2MHNA 3CNHA 1B9FA 3V6JA 1Z00B 1FRIA 3KDNA 4CEQA 1S1TA 1DFDA 1TUGB 2I9GA 9ICCA 2ZWHA 4J9MA 1ZZNA 1RSCA 2A40A 3SQ2A 3Q8KA 3NGTA 4L3NA 2MSNA 2CRLA 4Z4HA 2IOHA 1TE2A 3NGKA 3OGUA 3JPOA 1KDHA 5AI6A 3MDFA 3QFHA 2W11A 4ANDA 3BM7A 1EQ0A 5ALWA 1RGVA 4DL3A 2ASOA 3M9NB 1QQNA 2M5YA 4E19A 1OYDA 2F4VJ 1BQNB 4FJGA 4AXIA 4O0JA 3H0RB 3J7Z5 2MKIA 1YJ9S 1Q86T 4AYBD 4X4TA 4FS1A 1DEJA 4NZ6A 3UQ0A 4TU9A 2XI9A 3HHLC 3R97A 3SI8A 3RMDA 1S4FA 3PJXA 1QVFR 7ICEA 2FUG9 3T69A 3TABA 2YMLA 3PKMA 1VHXA 4Z94A 3QFUA 2UXCK 4LR7A 1DZ5A 4I7FB 3E66A 1UETA 5GAGP 4FVMA 1R6YA 1FKPA 1KVBA 2D6FC 4GV6A 3PYFA 3VPZA 2QI2A 2H3QA 2FMQA 5AQUA 1KKHA 2NZTA 4I7FA 5J2PB 2A1JB 2AH5A 2OZMA 2KHOA 2HBZB 1AROP 4NLSA 3CB4A 3ORYA 5KPTA 1NPPA 1S3XA 1RKIA 4FE3A 4FKXA 2PFOA 3CIPA 3UR3C 4CGJA 1KXPA 4NWIA 4CFAA 4PPDA 2F4FA 1SI9A 1X2IA 3BPSP 3HJVA 2MQMA 3UNYA 3TAFA 1HD1A 3O3FA 2EVZA 5LMUK 2G8VA 2LKZA 1B0TA 3DN9A 1KVKA 2CN1A 2FPKA 1RDDA 1VC0A 4PZOA 1FEEA 2MQLA 5AT1B 5H9FK 4EEKA 4QZFA 3MD1A 1YG0A 2HI0A 3K4GA 4J37A 3V2UC 1HNVB 2QGFB 4DV5K 5AKHA 5EOZA 3CFOA 4USWA 3MM6B 1HNVA 4DI6A 5DQIA 3B6PA 3C28A 3H08A 2Z4PA 4MKBA 3OUYA 3GCXP 1TAMA 2OSRA 1ZQVA 2NRVA 1Q46A 3JAMY 5M2UA 4YFKA 4KPCA 1VS3A 3OD2A 1F3VA 4NLUA 4DWIA 4PY5A 4ZIWA 5CHIA 4B3MK 2YQ1A 3JS9A 1BIUA 4KFBB 3J7A1 1BU6O 1JLCB 3M1VB 4M5GA 1NJXA 3DDIA 4KFBA 2AJ2A 2E44A 5KL1B 2F7TA 3M1VA 2KMDA 4HYKA 4NLTA 4GKKK 1EP4A 4NASA 1B0PA 3UR0A 4Z4EA 5AI5A 1L3VA 1CC7A 2ZE2B 1S6PB 3P8BB 4KR0B 3VQTA 4LVOP 5J0TA 2XIDA 2HG4A 2ZUDA 2ZH1A 2DNGA 4IRKA 2D9PA 4RQ0A 3QWPA 1ZTTA 1ASVA 4DV0K 2QEXS 4YR3A 8ATCB 3GLJA 3RH4A 2ZKTA 3B0YA 2H3ZA 2P6SA 1M5VC 1WOQA 4LF7J 1HW8A 2N7YA 3W9HA 3LDLA 3CCWA 4KH5A 2LQ5A 4A2AA 3HI0A 3NE6A 3HL8A 2QMWA 4CFBA 3UIQA 3O9UA 3E2EA 2YMMA 1E4FT 4EHUA 1DTTB 4LF4F 4CM0A 3HHDA 3SSQA 1XN9A 1RHRB 4RQMA 1DTTA 3PMNA 2HGMA 5AQZA 4ILLA 2JNJA 4PWWA 4U7BA 4K41A 3OTOF 7ICUA 1L7MA 1SL0A 4ILJA 3SFGA 5J0OA 4ECXA 1SL2A 5J2IA 2D5RA 1VC6A 2HAFA 3EL2A 3VETA 3MGHA 1FF2A 5F2RA 2Q1LA 2HBJA 3ZLJA 4ZP9A 3ALRA 1U09A 2HAIA 1HQEA 3L3FX 3SYZA 1UEVA 1XEZA 1RM6C 1N62A 1RBUA 3CP8A 4M3WA 4C8MA 4KTWA 3PJ9A 2K1RB 4OD0A 2E8AA 5JJBA 2ZJAA 1QZ5A 2EBGA 4PG4A 5F3XB 4WPAA 2ZH9A 4CD3A 3VQQA 5BRFA 2B3TB 2FHOB 1SKSA 2BJ7A 4JWNA 4FOEA 3O3LA 4MFBB 1FFUA 3CC7N 5BOMA 9ICQA 1XC3A 4TU7A 4F3TA 3D2EB 3SQ1A 2N7CA 2YX6A 4P7VA 4HI1A 4PH5A 4RW9A 4CLLA 4UF4A 1H7WA 3NXZA 3QATA 2FZCB 3PDNA 1PJ7A 3F2KA 2W8LA 3HM9A 3J7AN 1KOHA 4O3PA 3B54A 2E2NA 2G0AA 3OS1A 2DO4A 2HOQA 2NCKL 2UXDF 3D0GE 3U26A 3H42A 2HHQA 4CJTA 3LL3A 2KDOA 2QZ8A 4HT5A 4P4PA 3S3OA 3ENBA 3E01A 2DNNA 3AO3A 3KKSA 3KK7A 4M5HA 1VQ9N 3HW8A 4IFEA 3QXGA 1T03B 1NGDA 5AKEA 4DL2A 1VQMN 2CQIA 1XHXA 2HFNA 2DKXA 1YKWA 8ICQA 4LH4A 4I2FA 2QL9B 1BL3A 2I7NA 4PJ0U 4GY2B 3N28A 5LOQA 2BABA 3BQTA 3M6VA 2FSKA 4RUHA 3ISND 3OA9A 1JJ4A 5KFRA 3BGLA 4C4RA 1HJPA 4KQZA 4DTJA 4N7TA 3AJDA 3AO5A 5KT4A 4JI4F 3UXOA 2P66A 5GAHI 4C4WA 2KZZA 4BJQA 3CWJA 4Y2IA 4FWPA 2BDUA 2EK6A 3NS7B 5AM0A 1RTHB 2DH9A 2HHXA 1U2RA 3MX2A 3SUOA 4HCBA 4WTOB 1RTHA 2CJYB 3AD9C 1IBLF 1VSLA 3BQ1A 2V0NA 2W2OP 5LY3A 3C16A 2BCQA 5HBMA 2RQ4A 2VQFF 3CJ9A 4OPHA 3PX0A 5AK4A 3RR7A 3GBTA 4CDGA 3N5FA 3OL8A 5B0FA 3NVVA 4ED0A 3HDSA 3ZZRA 2O3DA 3KLEA 3FCVA 1IG8A 4RQ1A 3VEYA 4BDYA 3CMAN 3V4IB 3UPFA 1Q9XA 3U02A 5BPLA 1QQMA 3V4IA 3HPOA 2BMBA 1TL4A 3UDEA 3LP1B 4CDIA 1D3WA 2MRLA 1RBLA 2AZ3A 2YY6A 3G87A 2LECA 4I67A 3TTDA 3BO2A 4M95A 3WT0A 4US8A 2GHWA 3QU9A 2CJAA 1ZBLA 2J0XA 4F36A 2ERRA 4XTTA 5K8OA 4DCOB 2LFVA 4CJQA 2KI2A 1U7LA 4OJGA 2NV3A 1VQ4S 2XI3A 2BXJA 4NLRA 5AQXA 3BO4A 1KP6A 1N5QA 1L6NA 5RUBA 1TKDA 3HSJA 3EUB2 2DJWA 4L74A 2GAHC 2AYGA 9ICHA 2G9OA 3G8SA 3UFCX 4GNIA 5L1LA 2JZBB 3AQFA 4ECQA 3AUOA 3RJJA 4P75A 2MQNA 1HX1A 2LHTA 3FZMA 1SB6A 4ZPWR 1T9VA 3RH6A 1BHLA 3EY1A 3FZKA 4MH8A 2BW7A 2Z8QA 4FLUA 4RCHA 3AN1A 4YD2A 3MXJA 4RQ5A 4C6AA 1MMNA 4RW4B 3CFPA 4BR2A 3VA0A 2AJ0A 2DNOA 4OJOA 3QEWA 4CERA 5F9NA 2NXNA 4RW4A 1RDRA 2XVTA 1L5UA 9ICFA 1ZQMA 4CGFA 2M2BA 2DRDA 2NPFA 1MMDA 5C42B 4CJLA 4I68A 3R5JB 4QIWD 2X6NA 3I5AA 1M90T 1BWEA 5C42A 2ISPA 3O1WA 2ZD1A 1NEEA 3NP5A 4LF9J 5E3RA 4IR9A 2BGGA 1VC5A 3LALA 4I2BA 2PMZD 3OYBA 3V1QA 1TVAA 2KP7A 2LEAA 2UUAJ 1H7XA 5HVFA 3RB6A 1KLMB 3LA0A 1AXQA 1RLCL 2DD8S 2HGNA 1BVSA 3SBTA 5EDWA 1KLMA 3RRKA 1XQIA 4NXNF 4CJ5A 2I5HA 2QSFA 5ETOA 3RG6A 2ZBQA 3AVLA 2E66A 4EZ6A 4QIFA 2RDJA 4FWKA 4DL4A 5AXNA 2PMZF 2IPOB 4DTUA 4US9A 1X4BA 4OLBA 2NQPA 3SMVA 2F3JA 4ID5B 2B21A 2E6MA 1VI7A 4ELUA 2QFIA 4DR7J 4ZVOB 1RWVB 3ZT0A 1VQLS 2YJFA 1OW5A 1UTAA 2M4MA 1KFDA 1BPYA 1J5EF 3ETRA 1ZQ1C 3B78A 2FY1A 3JPTA 3IBWA 1NPKA 1SJ3P 4I9LA 1RA6A 4LUBA 4CF1A 3VGVA 1ZOLA 8ICLA 3M8WA 1CPZA 4CEBA 2XS5A 3DLJA 2FJAB 4C8ZA 3IWNC 5CP2A 2WHOA 1ZQLA 4UOFA 5C12A 5I4MA 1OYEA 4U8YA 3NGIA 3G8TA 2BVZA 4UW9A 1JLBB 4TKTA 5ETVA 4MLHA 4I64A 5G0RB 3V7KA 2QXLA 1KD1O 1UHUA 4HHTA 4LF4K 3KIOA 3TTFA 1JLBA 2VKZG 4DL7A 5G0RA 1HNWJ 4NMXA 4DTSA 2PC6A 7ICHA 4QZHA 5CZXA 1S22A 2ES6A 7ICRA 5B0EA 4F5NA 2MKCA 5AZIB 3FRZA 2BQRA 1UJ4A 3OTOK 4JV1A 2OPSA 2E1AA 2Z2YB 4CBUA 3TVYA 5AZIA 1NKBA 3M1FA 5J2HA 2WB1D 3CCZA 4U96A 3CM6A 1X4HA 5ETSA 3CNQP 2RRAA 4IKAA 5L46A 2ZM6K 4NX9A 4DTNA 5J2QB 3MR5A 2M7SA 2W3SA 1CXUA 5IXUA 3MEGB 3B8HA 8ICWA 1K9MO 2XS2A 2EFVA 1L3UA 2H5JB 2NYIA 3GZ7A 4DR2F 2D7SA 2RU3A 1PVRA 3ET6B 5CRXA 2NXJA 1WYGA 4PPZA 2IY5B 4B1VA 3CCQN 3CEDA 2WHEA 5ALUA 1BPDA 3MEEB 4K4TA 3F53A 3AA9A 1YZ6A 2QA4G 3MEEA 2IHNA 2VG5A 4YG2A 1N36F 2XRIA 3GP9A 1S79A 4RQ8A 1Y0HA 1FRHA 4B1UB 4NEYA 4DFDA 1R43A 2GGPB 2WTUA 2AP1A 4PA1A 2KKVA 1FXXA 1Z05A 3W1YC 2UXDK 2W43A 3W64A 2GGPA 2F9TA 4M3UA 1GQEA 4RT2A 5DLFA 2IAJB 1TGOA 4BC5A 5BYRA 3SENA 1S9EB 4FYYB 2RILA 2IAJA 2QV6A 1LOTB 5IV3A 3PNCA 2B6AB 1HNZF 4JI6F 3G4SS 5FROA 1RZTA 4CNYA 2Z57B 1T11A 4WBFA 2B6AA 1N54B 2XMUA 2KZ3A 4ED6A 3VENA 2ZKUA 2RIJA 2UV8A 1K0TA 2FSNA 3PXGa 1S1XB 5TZVA 1OQ3A 1QD1A 7ICIA 1RT7A 3DEEA 4BDPA 5E3CA 1KCFA 3BKUA 4QZGA 4FO6A 4ITSA 3TQEA 3QESA 3D68A 4JI4K 2G5HB 5E3QA 2KZMA 4F72A 4CM2A 4O3SA 1SWWA 1IWGA 5E41A 3PO5A 4BXOA 3P5BP 3LDQA 1ZAXA 4UAYA 2HZCA 4OHXA 4UY8T 4Y2PA 2UXBJ 2XYPB 1IBLK 3I9V9 1YVUA 2VQFK 5GAHU 2R7VA 4OI0A 3FSYA 1C6VA 2N82B 1U6ZA 1UFKA 1JCFA 4FZLA 2H65B 1HR0F 4MYTA 3LQVA 1P9QC 3S3NA 2AP6A 1QJHA 3BB5A 1IKXA 3UXPA 4M63A 1TYQB 3M6GA 3KHLA 2NPIA 4RUBA 5SWMA 4USJC 3TANA 3J81O 4AM6A 1C0TB 1YJNS 2KHCA 2W41A 4LFBF 4UQGA 1TYQA 2FHJA 5BREA 3VTHA 1C0TA 4KX3A 3A8IA 4E98A 4DN0A 5KFHA 2MZTA 2YMQA 3NVMA 3VQCA 2XZDB 1GLAG 3CD6N 4OGCA 2YWEA 3HSDA 4Z4CA 2GUIA 3C66A 3L2VA 1V5VA 4JK1A 7ICVA 4LJXA 1U02A 2GO8A 3P6YC 2CXYA 4DL5A 1NXIA 4GXJA 2ZHBA 1YJVA 4E1MA 1L3TA 2OIHA 9RUBA 3FMWA 3CUNA 1RU2A 7FD1A 1NHUA 2HFVA 2MHEA 2H4WB 1HQUA 1S72N 2HS3A 1WSGA 5KOXA 3KZIU 1KQQA 4JI5J 2O8BA 3L7UA 5B5EU 4KITB 3M2UB 2IIRA 3ZX2A 3LPUA 4MK8A 5HMYA 3M2UA 3AA2A 2ODGA 3H98A 3PFEA 1ZM9A 4W4MA 4DX7A 2KG1A 4YOYA 3ENQA 5E33A 3KJNB 1ZQEA 5HMLA 5T14A 3OYKA 4LRAA 4I2PB 1XSNA 3OHAA 2DXFA 2HHVA 4NLPA 3FUYA 3CQ8A 1VR6A 4I2PA 2CPDA 3IM1A 4V19X 4B1ZA 3THTA 2XMWA 1BA1A 3SUPA 3J7YI 3K17A 1YHQS 1VOMA 4BRCA 2F9DA 3MUTP 4Y3CA 1QLNA 3QICA 3MMJA 3OTEA 1LB2B 4BWMA 4FK2A 3TUZC 1QQ5A 2KJ5A 4AYBC 2G1HA 2E5GA 2JDJA 5HQMA 1X9MA 2ZH2A 1RAFB 4QOZB 4F5PA 2DPNA 3VQAA 3BBCA 4QQBA 2FLPA 2ZUAA 3I8DA 2RQMA 5BPNA 3EE9A 3UKUA 1ELOA 5CZVA 1FJEB 2V2QA 3P39A 5JS2A 2NRWA 2N3LA 3CPEA 1LV5A 2MGZA 4IQTA 3G0ZA 2LQJA 5KFYA 2O1PA 4BE2A 4USMA 3HSTB 4WXWA 1S1UB 4NXNK 2HRTA 2F96A 2AEFA 4XH4A 2ACMA 1S1UA 1I51B 2M0GB 4PHEA 3G9CA 2FVSA 1WG8A 3TI0A 1FDAA 2XWXA 1WC3A 1X3NA 1N34K 4F2RA 2Z2LA 3AY0A 2LXIA 1TUUA 2APOA 2AQ0A 2DTJA 2HFZA 2R7RA 2VGMA 2ZIVB 2DNZA 4DR3J 2KG5A 4IQWA 1VGYA 1KTQA 1WCLA 3HFVA 2Z1JA 3HRDD 3NVWA 2ZIVA 4QNLA 3PW4A 4DOCA 3TZXA 2IOCA 3H3OB 3HVWA 2WBRA 2G07A 1ZBFA 4HR2A 1UWAA 4RNHA 3R2DJ 3AFGA 3NL0A 5B0CA 3RBDA 3DRXA 4HDHA 4LVSA 3S1TA 4WIQA 4FXDA 2A6MA 1WAFA 2XLJA 4ZVUB 1HMVA 5AR0A 4KHWA 5LSOA 4DR1F 2H3EB 4QWBA 3PRBA 5AE2A 4ZLPA 9ICWA 1PK3A 5EX0A 4YY3F 2YWKA 2OD4A 4ES2A 2ZC3A 3GIKA 4AFFA 1R59O 1CJUB 1RAGB 3CJAA 4X4OA 1RP5A 2CQPA 2WVBA 1NH7A 3X3UA 1CJUA 2J9EA 1X6JA 3K0SA 4DX8H 3Q24A 2ZH8A 1Q95G 4DN9A 4KLJA 4IRCA 3THWB 3HJFA 3WXIA 1FNOA 3KBBA 4O4RA 4JI2J 1R89A 3THWA 3CCRS 4CD1A 3LUYA 3CJKB 2R8HA 3NMUA 5K20B 5AIBA 2ZUGA 3IV6A 3CJKA 2V67A 1FD2A 1QQ6A 3QGGA 1TU0B 1XNQF 1I1GA 2BM0A 1PILA 2V2VA 2FC0A 2UUCF 1RT6B 3IG1B 5JMVA 3I5CA 3NG8A 3K1ZA 3SQ0A 3TZYA 1PCAA 2V9KA 1C1AA 1LKZA 3IG1A 4ERDA 3F9KA 3PM9A 4DR2K 4IFYB 3OL6A 3WXJA 2V5HG 1M1KT 3NNHA 4PQUB 1WTFA 1CJVB 2KXHA 2GWJA 5L38A 5HAOA 3A12A 3O3HA 2CADA 3V9ZA 1G6BA 4IBNA 1CJVA 3HKZD 1PKUA 3HP6A 2VGNA 2DFFA 2JWKA 1QSYA 5MLCQ 4AQYJ 2YWGA 1Y5LB 4KH4A 1KBUA 3OXFA 1N36K 1RTZA 5KFCA 3TAMA 4A61A 3VQPA 4WP9A 3ED5A 3NRZA 4WFYA 1PYOB 1ICEB 2P35A 2AKWB 2HF4A 4PYAA 2J9CA 1KDNA 4KGMA 4RQ4A 4CF3A 4KKOB 2V6AA 3FYHA 3BZQA 1XO1A 5DG8A 1K73O 3PYGA 4FYVB 2FDRA 4KKOA 4LF5J 4D3GA 1QDUB 2VA2A 1YIJN 2MEWA 3I0SB 1NG9A 2G8FA 1KAZA 3PYDA 4NA3A 1HBUB 3U4LA 3I0SA 4IH6A 2HZAA 4FVCA 4A57A 2PY5A 3B6BA 1HBUA 4M94A 5B08A 1NJWA 3NOCA 3BS5B 5B0BA 3BQ0A 2XC9A 3IO1A 3BS5A 2PI4A 5T7LA 4U7UK 2RT3A 2I5JA 2R7SA 3VAFA 3NAHA 4H5TA 2EW9A 4OJLA 2B4JA 4YCXA 4KREA 2VHGA 1XMQF 2AQ4A 2YX4A 4N76A 3O6WA 1G15A 1B70B 2LBOA 2BUNA 3KKAC 1RZMA 3CCMS 2A41A 5IFMA 5H1SQ 4O44B 1VJQA 1U4BA 1SKRA 2Q3PA 2L9NA 5KG4A 3WC0A 2OAUA 2R8JA 4O44A 4DSIA 2YMPA 2MJNA 4FWOA 3TA2A 1IG9A 4LFAJ 2W2NP 4AF1A 4MIBA 1TUYA 4LF8J 3ZTOA 4OGEA 3L7PA 4LVNP 1JLGB 3OYCA 1HL6A 3CF5Q 2P9UB 4DMNA 1T9WA 3LVVA 4ED2A 1FRXA 1MN7A 3KUEA 1QTNB 1JLGA 4R65A 2FYXA 2P9UA 4LFBK 5ALTA 3LP0B 5ALEA 1ZM4A 1VQ5N 3R7NB 2DGSA 3KWMA 3QJJA 3AA4A 3C6UB 2CWKA 3ULEB 3UMGA 3LP0A 4I56A 2CNLB 1IO2A 3C6UA 4KHMA 3BQ7A 5AIAA 3ULEA 4Z4FA 1V3ZA 1U9LA 1VBZA 2HBLA 2NUHA 4NCBA 4B9QA 1Q8IA 3CCTA 1Z1VA 4DV4F 3VVTA 2UUBJ 1Y88A 1NH8A 3CT9A 4BRIA 4PAAA 4NM2A 3C2KA 2JFDA 2DR8A 2V2KA 3ISNC 2VL1A 1SV4A 2WTFA 3V1RA 4J9SA 1DRGA 5M2PA 3H8YA 5GAEP 1SKWA 2C2DA 4LSLB 1T05A 1S6QB 5IT9U 1FTRA 4LSLA 1XTZA 1IKWB 4URQU 4FF4A 1X4EA 1YTUA 3G2XA 1N5YB 1IKWA 3RJKA 3V6DB 4JS5A 4JI5K 5KFTA 2NRXA 1U1OA 4EFAC 9ICAA 2JX2A 3V6DA 4BRHA 1CRXA 1KQSM 2VPXB 3NGDA 5FLXO 2BCSA 3LPEA 2GJIA 3TNVA 4QYZJ 2B5JB 2DIVA 4FJMA 1RAIB 3PUFA 1RXWA 3W61A 5D15A 2OGUA 3VQ4A 4I6MB 1HKBA 4PKGA 1ZQPA 2MKHA 4BDZA 2X1AA 5IT0A 2Z1IA 3J7YU 3DU5A 2IBKA 4I6MA 1CQNA 1YK9A 1J9AA 3GYXB 3N5BA 3IG8A 3O9SA 4CLKA 3G6VA 5IIJA 3F0NA 1F2HA 4IO1A 1D9DA 4W5TA 2F8KA 1URNA 4DV7F 2HIYA 1L8OA 3HWTA 1GFWB 2HLTA 5BN8A 3GTYX 3H59A 2IJFA 2F5GA 4H5WA 9ATCB 4HKQA 2FC8A 3JXOA 3T5JA 8ICYA 2OYQA 2B7BB 4IO8A 3Q7BA 4DR5F 2VCPA 3NNCA 4ZTFA 3OVAA 1IR0A 1N5SA 4RBVA 2F76X 3MWPA 1M1GA 4LBHA 4Y2KA 1GXUA 5HHIA 1Y9OA 4BGAA 2Z56B 4WCEQ 4CJPA 1DARA 2X1FA 3PVXA 1GLJO 1VSHA 1LK5A 2RUSA 3FZ2A 4ECSA 1T9XA 1SUQB 2VDHA 2DGUA 3CCSS 2D3UA 4DF8A 1D09B 1EQMA 1SUQA