4DQRA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 203
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqrA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqrA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqrA01
2FBXA 2FLPA 1S1XA 3ZT4A 1S0NA 4FLWA 1H38A 1ZBFA 2JLEA 2KZ3A 1L3UA 4W5QA 3SI8A 4CJVA 5JS1A 2XGQA 5KFVA 2C2RA 2UVWA 4CHNA 3LPTA 1LWEA 3BQ0A 8ICEA 2ZD1A 4RPXA 1VSEA 2PFPA 3O3HA 3JYTA 1ZQXA 4FLZA 4C8KA 2XCAA 1RT3A 2ZUCA 1RTJA 1U9LA 7ICVA 1DTQA 3V9XA 4E19A 4Z4GA 3G6VA 5L1JA 4H4MA 5DGBA 1NK6A 1NK7A 5J0QA 5DLGA 1KRPA 3SV4A 3EPGA 3RBEA 5KTQA 3M8RA 4FJIA 7ICKA 5KRTA 2ATQA 4CECA 2ZQBA 3ZSVA 4CESA 9ICTA 4YFKA 4HCBA 4DF8A 1WLJA 4ED0A 1A5XA 4ED3A 2HHTA 2F96A 4CERA 4I9LA 3QEPA 3DLHA 1JLEA 1ZQRA 3TQ1A 4YNQA 4F5PA 2C2DA 4I2FA 4Z4CA 3NAEA 5D49A 4I2HA 4O3QA 1RBSA 5HMLA 4UBBA 5J2PA 4I2JA 5SZTA 3AV9A 2V4RA 4RQ4A 4MQ3A 4UB1A 4KLJA 2F1IA 4DQSA 4J9LA 5I3UA 4LH4A 1XHXA 3Q8QB 4CGGA 4M6WA 2C2EA 4DTNA 4OLBA 4M3TA 4I27A 4I2AA 4OJRA 4CHQA 5KG1A 4E7HA 2B5JA 1ZQBA 3AVGA 4RQ3A 8ICNA 1NOZA 2YNFA 3F73A 2DFEA 5CZ2A 4K8ZA 3OYFA 3OHBA 1FK9A 4Q8EA 4G3IA 1WNSA 5J0XA 1C1BA 1BQMA 3OY9A 4M9JA 3ZSWA 1C0UA 1HJRA 3TAQA 1SV5A 7ICHA 1QE1A 3VQ5A 4GLXA 1U49A 3K5MA 3DM2A 3OYNA 4OGEA 1R0AA 5HRNA 4EP4A 3AVKA 3MDCA 4DL4A 4R5PA 1X1PA 2Z1JA 8ICSA 1VSMA 1HQUA 2O4GA 3U3GA 3KLHA 1XC9A 3C5GA 3QEVA 1NJZA 1EX4A 2AU0A 3GILA 5IIMA 1J9AA 4OKJA 9ICVA 2B6AA 1J54A 4Q44A 2G8VA 3ZD9A 5KFYA 4PHAA 4MFCA 3ETLA 4DSFA 3LP0A 4DS5A 5J2KA 5KFRA 1RXWA 3C6TA 3SUQA 3AA3A 4F92B 4JRQA 1BPYA 4GXKA 4YR2A 1JLAA 4E7JA 4EYIB 4OKEA 1Z00A 3EW9A 1SKRA 1VSKA 2QK9A 2VANA 2OPQA 3KK3A 5E41A 3MFHA 5KT4A 4IRCA 4CGHA 1HNVA 4L8RB 3SZ2A 2X6NA 4DSEA 2FMSA 3ZSYA 4FS2A 4BACA 4CIEA 7ICFA 4LSLA 4J9QA 5J2MA 3V7JA 4C8OA 1ZQPA 3VA0A 3B6PA 2J6TA 3PR5B 3JPQA 2O4IA 1RT7A 3OVNA 2BCVA 4MEYA 4FBUA 3C23A 4BWJA 5KT2A 4B8CA 1IKVA 3OYIA 4RW4A 3LDSA 2A1JB 3GV8B 4RNOA 3RMDA 4O5BA 5J2BA 4IG3A 3ZT0A 4UAZA 1JKHA 4ECVA 3GIJA 3BQ2A 5CYQA 2IHMA 7ICEA 4IFVA 7ICQA 3C1ZA 4F4YA 3SQ1A 4PGYA 4YR3A 3CM6A 3V7KA 3C5FA 3ZSQA 1UOCA 3PX4A 4KI4A 9ICHA 8ICOA 2E4LA 2W8KA 1S6PA 7ICLA 4J2EA 1BPBA 5J2CA 1C1AA 4PPXA 1CZ9A 4EBDA 2FBYA 4KN4A 3TARA 1C1CA 2XY5A 3RH5A 4ZH4A 2G8WA 4PHDA 3QINA 4F5OA 4KLFA 1FKPA 3RJJA 4KLDA 3RB0A 2UVVA 1KLNA 2QXFA 3O3GA 3UQ0A 5KFHA 4JUZA 1ASVA 3WNEA 2R8JA 4ECYA 3AVAA 3DI6A 1S0VA 1RT4A 5EU7A 1B92A 3PW2A 4FJ9A 3IAYA 3FYHA 3IRXA 4E1NA 3VQ6A 4E3SA 5KT3A 1A76A 1HUOA 4I29A 2ZJ5A 4TQRA 1ZQGA 3PX6A 3RAQA 4JV2A 1L3TA 5J2NA 4O44A 5IIOA 4B9UA 4RZRA 2FMQA 4IQVA 1CXUA 3OYEA 4I2GA 1T03A 7ICPA 3SUOA 4BDZA 1G15A 1TL1A 1U45A 1KVAA 3S9HA 5DQIA 1SZPA 3K5OA 4RUAA 1CUKA 3D45A 2Q3SA 4KO0A 4MFAA 1LWCA 2PXIA 4CK2A 3DLGA 4I9QA 4FW1A 7ICNA 3QEIA 2IHNA 3VQDA 4DO9A 3PY8A 5J2EA 4FVMA 3B6OA 4AHUA 3KLEA 5DLFA 3LZJA 3UPQA 2NRWA 4F5RA 2BGGA 8ICAA 3CFPA 3RJIA 3AO5A 4DL2A 3V1RA 3PMNA 1N6QA 4MF2A 1DLOA 4CHZA 3L2WA 5F9LA 4EZ6A 4OVLA 3RB4A 3MR2A 1TK0A 4LVSA 2ALZA 3BQ1A 3UIQA 3RAXA 4I2PA 3NCIA 4ELVA 4M42A 4DLEA 4QZ8A 2C22A 1WSHA 4G1QA 1I3AA 4M9HA 1Q9YA 8ICZA 1SL0A 5DB6A 2BR0A 3ZT2A 1NK0A 3HPOA 3V6DA 1WAJA 3LWMA 8ICFA 4DFKA 3OJUA 5IILA 5DDYA 1BI4A 1V9PA 3M8PA 4I2BA 4YD2A 3NF7A 2M9NA 1B22A 1T8EA 4KPYA 4FLXA 4EEYA 3K75D 5FDLA 3Q8RB 4F4ZA 3PO5A 1LAVA 4K8XA 3KTQA 5SWMA 3TI0A 2J6SA 4YMOA 5DBCA 2WTFA 3DYAA 4N56A 4FJXA 1S0OA 1RDDA 2GBZA 3SPYA 3EZ5A 2NUBA 3EWAA 1S6QA 2KFNA 4CJEA 1T4GA 4Z6FA 1XSNA 3VQCA 2FBTA 4I2DA 3NF9A 1TVAA 2PZSA 4Q43A 3L2VA 5CA7A 1QS4A 2I1QA 1NK4A 3OJSA 2W9CB 3OYBA 5KFAA 7ICOA 3GV7B 5KFPA 5DMRA 1KFTA 4FW2A 5DQHA 1SL1A 3N97B 1BGXT 1DGSA 4CCHA 3MAQA 4CJTA 3C2MA 1Y88A 5KGXA 4RT2A 3QETA 3AVFA 4F8RA 4KLOA 2HMIA 2BQUA 4DG1A 2NRTA 2FBVA 3AO1A 4LD0A 4F50A 4CGIA 1D5AA 3I0RA 3LP3A 3G0ZA 1WAFA 3OYKA 5CJ7A 4B8AB 3UQ2A 3DRSA 4Q45A 3AA4A 2W9BB 4CHYA 4F2RA 1BQNA 4GW6A 3ISBA 3OS0A 4QWEA 5L1KA 4FJNA 1VRUA 3L2RA 2ZTDA 3ORYA 2BPGA 4CJUA 4KHNA 3SNNA 4CJWA 5TZVA 4KLEA 4DQQA 3SCXA 4YMNA 3Q8KA 1KEJA 4FZZA 3O3FA 2ZJ8A 3RRHA 2ASDA 1RNHA 5HROA 2XY7A 2W42A 4KAZA 5J0SA 5KT5A 9ICKA 1S5JA 1BHLA 4YN4A 3K2PA 4Z4FA 1JLQA 2NRZA 3AU2A 3RR7A 3PW5A 1RCHA 4QZCA 1TK8A 5C42A 3QEBZ 4LZDA 1X9WA 3NH2A 1IKYA 2FPKA 1BI4B 4KHYA 3TWHA 1VSDA 1ZBIA 8ICIA 3IM1A 8ICYA 3RR8A 8ICKA 2UVUA 4CEZA 5CB1A 2HNDA 3QEAZ 2PI5A 2KTQA 4DTXA 4DWIA 2OYQA 1JL1A 3SQ2A 8ICPA 2MUTA 7ICMA 2H5XA 1ZQFA 2Y1JA 1BIZA 3TAGA 5KFXA 5KFCA 1TAUA 2JZBA 5J0RA 1WCNA 2G8UA 5BOMA 1U04A 3ZT3A 8ICMA 4QZFA 1YVUA 1EKEA 3AO4A 3M8QA 4KLTA 4CEAA 2W8LA 2ZJAA 1COOA 2RKIA 3H7IA 2OZMA 4M3UA 4DSJA 4GXIA 2ETJA 5EWFA 3KHLA 3C2LA 4TSXA 5DG7A 1EETA 3AVIA 2IOCA 4DL5A 4NY8A 2X6SA 1RPLA 1RBTA 3SQ4A 4KLSA 1C7YA 1HQEA 3PUFA 5FROA 4JV0A 2BANA 4I2IA 4RPYA 3K59A 2ZTEA 2VG6A 4BXOB 4IDKA 3H4DA 3Q8MA 5KG4A 1ZBLA 3AU6A 2BCRA 4J9KA 3V9WA 2E6MA 3RMCA 3RJFA 5DG9A 4JWNA 1L5UA 3GV5B 8ICJA 1CXQA 3SUPA 2XY8A 4FZXC 1U4BA 5KFGA 1IKWA 3TFRA 1ZJMA 4XQ8A 1C0MA 1S76D 1VSJA 3SPZA 2VG5A 3ZDAA 3VQ9A 4ECRA 5KFKA 4K4HA 4NM1A 1LW0A 4KB0A 4PY5A 4CEDA 1HNIA 1W9HA 4YD1A 2P5GA 4DL6A 4CEFA 3NFAA 4CF9A 4RQ5A 1Z00B 2PFOA 2OZSA 2W9MA 3KD5E 3AVLA 2EX3A 4B9TA 4QAGA 4N5SA 1TFRA 3TANA 1XU4A 3EYZA 4CEEA 3IHQB 1KFDA 3KHGA 5EOZA 5DB9A 2F8TA 2P1JA 3PX0A 1QSYA 3V7LA 2F1JA 1RILA 4UAYA 4F4KA 4TUPA 3PMLA 1NKBA 4PHPA 3TFSA 2MUTB 4QW9A 2HW3A 4KLHA 3MEDA 3NTUA 1NJYA 4FJMA 5JUMA 3VQEA 1NKCA 1DTTA 3CG7A 3OYHA 4YVZA 4RQ6A 2RF2A 2BKEA 4IRKA 5KFLA 3Q8PB 3U3YA 3LZIA 3MDAA 4PA1A 4YFUA 4PGQA 2YNHA 5FRMA 4NYFA 1VSIA 5C5JA 3JSMA 5J2GA 4B9SA 4OLAA 3QIPA 1S10A 4TURA 4ED7A 9ICSA 4UB3A 1S9EA 3QEXA 2E6LA 1S97A 2Y1IA 3NGZA 2DPJA 3PO4A 3THVA 3HYFA 1ZBHA 4QZEA 1U48A 4J9NA 4WE1A 3AA2A 2QKKA 4I28A 3T5JA 3DMJA 3WNHA 4UBCA 4UB2A 4RW8A 3GIKA 3B0YA 4Z6DA 3ITHA 1LAWA 2YKNA 3SUNA 3ZSXA 1SL2A 3V1QA 4RQ8A 1ZQUA 3QZ7A 4ZTFA 4KHUA 5KFBA 1JMSA 4MEXA 2IMWP 1VRTA 4DU3A 3OSPA 4RNMA 3ISDA 2VWKA 4HCCA 1BPZA 4KHQA 8ICWA 5IIIA 4CEBA 4M41A 1IH7A 3RJEA 3KJVA 4NXZA 8ICBA 3TR8A 5CYMA 3ZDCA 1TKZA 2W9AA 3L3VA 5EWGA 5J2DA 3MXMA 2BQ3A 9ICOA 4Z4IA 1RDBA 3TAEA 4ECSA 1D8LA 2PYLA 3HW8A 3C21A 4CHPA 9ICMA 3MGHA 3GIMA 2P6RA 3K5LA 1RBVA 4M9NA 4R8UB 4C8NA 1RDAA 4AHSA 4DQIA 1BISA 5L1LA 4ID1A 4GXJA 5CWRA 4DQRA 4MFBA 4J9MA 4E7KA 2D0AA 2A1JA 1ZQQA 3MXJA 4NCBA 4FJGA 1EXQA 3QIOA 2HHSA 4HUGA 2HHVA 4KHWA 4M3WA 1ZQOA 4IR9A 3JPOA 4YR0A 1KFSA 1WSEA 1MU2A 4RQ2A 3NHGA 7ICTA 4O4GA 3CQ8A 2EHGA 1NJXA 3PW7A 1TGOA 3HL8A 4F91B 4CIGA 4FXDA 2YHBA 3MECA 3LDAA 2PY5A 4O3PA 4FCYA 1LWFA 1F21A 3HJFA 2RPIA 3U6FA 4CK1A 1S1TA 1XS9D 5KG2A 4F93B 2PI4A 5J2IA 5KFZA 1SUQA 2HB5A 1ZETA 4CGJA 7ICGA 4YP3A 3LK9A 4RQ0A 1JLFA 1BPEA 1RT2A 2HHXA 4CEQA 4N41A 1W0HA 3DRPA 4NCGA 1BCOA 3HP9A 4O0JA 2OPPA 4DTRA 3MR5A 4ELTA 5HRSA 4KHSA 1A5VA 2G8FA 5HHHA 4O5CA 3QE9Y 1XWLA 3OYGA 4CF0A 4IFYA 4FBTA 4IBNA 1AROP 1ASUA 1QTMA 5CHGA 3FDSA 3F9KA 3HWTA 2B21A 3ZT1A 4ECUA 2FLLA 4BE1A 2JEIA 3AVJA 3V6KA 5HHIA 8ICHA 4DMNA 3QNNA 3HX0A 4EBEA 3KLIA 1TL3A 3VQ7A 3NGYA 4R66A 3T5LA 3VQQA 1SKSA 1ZQIA 4FK4A 3MABA 3OYCA 4DSLA 3RJKA 2XRIA 5KRSA 4TUQA 4IR1A 4J9SA 1RT5A 1HUZA 2HHWA 3AVBA 1IG9A 2HVHA 4ED2A 4E0DA 4CJRA 1B9FA 3AVCA 9ICLA 2I5JA 3NDKA 3OS1A 4R8UA 4JWMA 9ICCA 1QHTA 1QQCA 4AILC 3HPHA 4K4GA 3GQCA 2XY6A 3Q8LA 1ITGA 2KQ2A 1NK8A 1NK5A 2NRXA 4HUEA 4YXJA 4XUSA 4DSKA 4DTUA 1D9FA 3ZSOA 4BGDA 4IQUA 4PHEA 4O3SA 4EYHB 2I9GA 4CFCA 1HYZA 4RT3A 3CM5A 4M6WB 1TVRA 4F4WA 1D8YA 2R8HA 3V1OA 3HVRA 2G8IA 3LAMA 3SV3A 1QSLA 4LH5A 4Q0BA 3K57A 2ZUDA 2OWOA 1SKWA 5J2AA 4E7IA 2IBKA 8ICTA 2Z1IA 2V9WA 3P83D 2JEGA 8ICUA 2DFHA 7ICUA 4XRHA 4ED6A 4FM2A 2D5RA 4GVMA 1T05A 4FJJA 2A1SA 4QZIA 1B9DA 2VA8A 3DRRA 3LWLA 4E7LA 4QZDA 4UAWA 3QLHA 2JEFA 3NBPA 3OHAA 4FJLA 2V4QA 4KKOA 1N56A 5HLFA 2YV0X 2YKMA 3PNCA 2F8SA 3RMBA 4KTZA 4F4XA 4ELUA 4OKKA 1S1VA 4RW6A 2W9BA 4RPZA 3VQPA 3N4MB 1L3SA 1UWBA 4B9NA 1QSSA 3RJHA 1JLBA 3RTVA 3JPTA 4BE2A 1JIHA 1WN7A 3T19A 1X2IA 4I2QA 4F5NA 4DOCA 5J1EA 4FLTA 3NH1A 4FLVA 4CF8A 1ZQEA 4CFDA 4FM0A 4BWMA 3TAPA 4NYNA 3NF8A 1CLQA 4CIFA 3OYAA 4CF2A 4QZAA 4C8LA 2RDJA 2X74A 3QNOA 5KI6A 3EPIA 4R63A 2P6UA 2R8IA 1JN3A 1RBRA 1UAXA 2Z1HA 3NH0A 4KITB 3FFIA 3E01A 3RH4A 4P4PA 4NM2A 1VSFA 3RWUA 3PR4A 2AGPA 4I2EA 5IIKA 3JPNA 1UA0A 3S3OA 4EZ9A 3S3NA 2IDOA 4DTOA 4YG2A 1RZTA 4AHRA 3NGDA 3AVHA 3QZ8A 2LYHA 3IS9A 3KHHA 3DOKA 3DLKA 3C6UA 4Q8FA 2IGIA 2WOMA 3CFOA 1ZQTA 4I2CA 3ISNC 4PUOA 3G6YA 4KTQA 4LY7A 4KN7A 1CZBA 1TV6A 4F5QA 4DTMA 5KG0A 1MSWD 1Z25A 2DPIA 1PZNA 2R7YA 2UVRA 1K1SA 4BE0A 8ICGA 1JLCA 5J2HA 4CJKA 3I0SA 4DU4A 3T5KA 2BE2A 3BGRA 1VSHA 1RBUA 3K4GA 4N47A 4EBCA 4FO6A 3V81A 5J0TA 3GIIA 4CJFA 4CF1A 2W9CA 4NLNA 2KFZA 5KG5A 3HK2A 2B4JA 3K58A 1T7PA 9ICFA 4M45A 4W5NA 3HPGA 5KFTA 4FZYA 4ECZA 4ICLA 1HJPA 3UXNA 5DBAA 4DQPA 1KVCA 4CE9A 5HP1A 1I39A 1BPXA 5KFWA 4FJ7A 3IG1A 4FLUA 4DL3A 1TKDA 3ASMA 4FK0A 1Q9XA 4M3YA 1YTUA 2QKBA 4H8KA 1WSGA 5DB8A 4IQWA 4PQUA 2KZZA 2IA6A 3NE6A 2XHBA 3ZDBA 3RMAA 2FMPA 4UB4A 5J0PA 3SQ0A 2JGUA 2Z1GA 3TAMA 3C2KA 1S1UA 1XHZA 4B08A 1K1QA 1XI1A 4X5VA 3PV8A 4KREA 3VQAA 2BHNA 3P1GA 4CJ3A 2OA8A 1Z3EB 5HBMA 2IS3A 3CYMA 2GV9A 3O4QA 3HP6A 3VQ4A 1LV5A 5D3GA 2LSNA 4O55A 1MQ3A 1TKTA 4OGCA 1ZQJA 2VA2A 4DS4A 3MFIA 1JL2A 4AHVA 4TUSA 1ZJNA 4KV8A 1RTDA 2KZMA 2ITGA 1NJWA 1ZQHA 9ICAA 4RQ7A 4HVJA 5EWEA 4HYKA 1RYRA 3WNFA 1ZQVA 1VK0A 4ECTA 5HRPA 4CK3A 4NCAA 4J2DA 5KT6A 4M2YA 4LZGA 4GC7A 3OSNA 3RRGA 4F2SA 9ICJA 2BCUA 1EP4A 1RDCA 2JZBB 1TAQA 2BPFA 5FRNA 1HPZA 3KLGA 4H4OA 2P5OA 1VSLA 3QESA 3T5HA 4YXMA 1XO1A 1IO2A 1O1WA 1Y97A 3C95A 2AGQA 5DKWA 2RN2A 4CJ4A 4GC6A 5KFFA 1Z26A 4JLHA 2ISOA 3WNGA 1QLNA 5J2JA 2G8HA 2DTUA 4CJLA 3LPUA 4CHOA 1KCFA 2HNZA 4M3ZA 3V9ZA 3KIOA 4RUCA 1FXXA 1LB2B 4IKFA 4HTUA 1JXEA 3MR3A 1X9MA 3OGUA 3SJJA 4FS1A 3H8JA 1C0TA 1JLGA 1KTQA 4MFFA 1TKXA 4DL7A 4FJ5A 4Y1CA 1ZQKA 2ASJA 5KFNA 3C94A 5K14A 8ICCA 4M0AA 4PWDA 4OPJA 3RJGA 4M9LA 4BXOA 2WONA 1IKXA 8ICVA 2PYJA 5DK5A 4QWDA 3ZD8A 5J0WA 4GMJB 8ICXA 1KLMA 8ICQA 1IM4A 4KFBA 3M9NB 2BPCA 2MAXA 4FK2A 4RG8A 1REVA 1K6YA 3LP1A 3RB3A 2FPMA 3AO3A 4IRDA 1RT1A 1TV9A 4RW7A 4JS5A 1A5WA 2KN7A 3RB6A 3QEWA 1WSFA 4KMUA 4QWCA 5KG7A 3LALA 3PW4A 4ED8A 1ZYQA 3ALYA 1UT5A 1ZQSA 3P5JA 2ZUBA 2FPLA 2VWJA 3OYMA 4O5EA 9ICXA 4DLGA 4KLLA 3AO2A 1B43A 4FM1A 4DTSA 1TK5A 4Z6EA 3QERA 4DOAA 4ID5A 4BDPA 3EY1A 4M04A 2ASLA 9ICQA 5T7BA 2AJQA 3OYLA 4DTJA 4J2BA 1JX4A 3DLRA 4HHTA 4Z4HA 4P4OA 3RBDA 2BGWA 4O3OA 3JPPA 9ICIA 5CR0A 3ZCMA 1YTAA 1UT8A 4Z4EA 2DY4A 3I8DA 3H40A 3QO9A 2ZE2A 2AQ4A 1YT3A 4M9GA 7ICRA 3ZSZA 3MBYA 3DLEA 5DG8A 3KHRA 3AVNA 2OPRA 4QW8A 1BVSA 4QCLA 5J0UA 5L9XA 3UXPA 1Q8IA 4FLYA 4F3OA 5DBBA 4AHTA 3KK2A 3ZDDA 3M8SA 5DGAA 4RW9A 4TQSA 4QZHA 2VA3A 1ZBUA 2VG7A 1ZQYA 5CP2A 4HUFA 1T3NA 4C8MA 2GWSA 5HMMA 3ULDA 1MC8A 4N76A 5J29A 4FJ8A 2DFLA 2HVIA 1BL3A 2XCPA 4DOBA 3MGIA 4AH9A 5KFQA 3H8WA 1N48A 4KLQA 4CEOA 1ZQAA 2Q0ZX 4J9RA 4EP5A 4J9OA 2HNYA 5KFJA 4DTPA 5DB7A 4UQGA 1WSJA 2AQ0A 4CJSA 3AA5X 3MXIA 4FYDA 4KRFA 4I7FA 1KDHA 2A1RA 3C1YA 5KFSA 2IC3A 7ICJA 3T1AA 4QZBA 2IAJA 3L2UA 4QWAA 4KLIA 3DOLA 3MEGA 4KI6A 2BDPA 5CY4A 4RQ1A 1LW2A 3O4NA 2XGPA 1S9GA 5KT7A 4KLMA 3HO1A 4CJPA 4O3NA 3B0XA 3H08A 4P4MA 3BQTA 2JEJA 2PFQA 1J53A 3G10A 3CFRA 3V9UA 1NKEA 1UA1A 4BDYA 4KTWA 1ZQZA 4NLGA 2GUIA 4ZTJA 2P66A 4CGDA 4KLUA 4M47A 4KLGA 1ZQLA 4XA5A 4J9PA 4NLKA 3HM9A 4JS4A 3ISCA 5KG3A 1NOYA 3ZDEA 2PFNA 5BOLA 2NRVA 3GFKB 4DF4A 1WCLA 2DFFA 4QOZB 4CJ5A 4J2AA 1BIUA 1GOAA 4MF8A 4O3RA 2ISPA 4YCXA 5KFMA 2OPSA 2G8KA 3S3MA 2C28A 3OYJA 4PGXA 3L2QA 4DFMA 3LP2A 7ICSA 5HRRA 2AGOA 9ICUA 1HYVA 8ICRA 1JXBA 3KKRA 9ICPA 1BCMA 2D0BA 2XO7A 5KFDA 3NGIA 1CEZA 4W5OA 1JXLA 3RH6A 3V6JA 9ICGA 3G6XA 3LAKA 5D46A 5HP4A 3OYDA 9ICRA 4Z0UA 1XSPA 1ZQNA 9ICBA 3HXMA 4KB1A 4JK1A 2D0CA 3VN5A 5JS2A 2KW4A 3TAFA 1MQ2A 4ECWA 9ICEA 1U47A 1ZQCA 3SI6A 5I42A 3H4BA 1KSPA 3PVXA 4CGFA 9ICWA 1NOMA 1ZQWA 5IINA 5DDMA 3BDPA 1KVBA 3AVMA 1X9SA 4F3TA 1GOCA 4ECXA 1S1WA 4FJHA 4JRPA 1FKOA 1S77D 4UB5A 2X78A 4IQTA 4ZHRA 3D0PA 3ZSRA 4RNNA 4YMMA 2HHUA 4QZGA 3MEEA 3HSTB 1A77A 3V4IA 3HVTA 5J0YA 4JV1A 1S0MA 3K5NA 8ICLA 1J5OA 5KFUA 5J2QA 5KG6A 3L8BA 1RT6A 2FC0A 3VA3A 4M3XA 4B9MA 4P2HA 2HHQA 4DSIA 2P51A 4YQWA 3E2EA 4M3RA 3HT3A 9ICNA 5C25A 4W5TA 3L3UA 1N5YA 2BQRA 3DLBA 1L3VA 4B3OA 3KLFA 4B9LA 3A2FA 4CJQA 3AUOA 4K4IA 2YNGA 4O9MA 1XSLA 3JPRA 3V9SA 4B9VA 4O5KA 7ICIA 1BPDA 1DOQA 2R8GA 3M9MB 2YNIA 2BCSA 3JPSA 4PH5A 4ED1A 4CFBA 3UXOA 4R64A 4Y1DA 5J0OA 2BCQA 3VQ8A 3PW0A 3NF6A 4OPKA 4Z6CA 1IXRA 1RXVA 3OS2A 5C24A 2J6UA 4W5RA 5KGWA 3TABA 4FJKA 2YHAA 1WSIA 5CZ1A 3GDXA 5IIJA 2RDIA 1ZQMA 2R8KA 1HMVA 4LSNA 5HNKA 3KD1E 3VQBA 1C6VA 4E1MA 3Q8SB 2F1HA 3T3FA 4ECQA 1HRHA 3SYZA 1NK9A 5J2FA 3V6HA 3BJYA 4IG0A 3KKSA 3KK1A 5KFIA 2XC9A 4XIUA 4Q5VA 4AHCA 4NLZA 3H8SA 5L1IA 5BPCA 1HYSA 5F9NA 1ASWA 1ZQDA 3M9OB 3V72A 4DU1A 4DFJA 1S9FA 4CFAA 4QZ9A 4RU9A 1RTHA 1GOBA 1EXNA 3MR6A 4DEZA 5D4BA 1RTIA 5DQGA 5KFEA 4E89A 5KFOA 3LANA 4QWBA 2FLNA 4DFPA 4O0IA 2ZTCA 4R65A 2ATLA 1D9DA 1RYSA
chains in the Genus database with same CATH superfamily
2FBXA 4C4SA 2E1RA 3G4SS 2W3SA 1H38A 4CI0B 3BV8A 4CJVA 4WJ3B 5KFVA 4CHNA 2D41A 3SSSA 1LWEA 2V8PA 8ICEA 2YKOA 2R7WA 2M70A 3KMSA 3H5YA 2XMTA 3JYTA 1KAXA 1XMOJ 3M8PB 1HUXA 1RTJA 2BE9B 3HJEA 2D1KA 2CG8A 3EWGA 4E19A 2EANA 2JWLA 2VV5A 3G6VA 4JK8A 2AEJA 5M1KA 2WBRA 5C2FA 3M2RA 1N88A 2KO1A 2XMMA 3SV4A 2CQ2A 2FIUA 2C2ZB 4WK1A 5BJRA 5KTQA 3M8RA 4ZP7A 4JK9A 4P72A 1MMLA 3R8EA 3KLIB 2DNKA 2DGTA 4NXMK 2HQIA 5E5NA 4ZJOA 4CESA 2E9RX 4HCBA 2R2UA 4KAIA 4PZOA 3BGUA 3A0BU 4ED3A 4A8EA 5B08A 4C8YA 1ZQRA 3ZFVA 4Z4CA 4W4MA 3CNQP 3MN7A 2O8EB 4OYZA 4B3OB 3TTCA 4RQ4A 1UCNA 4XPCA 5K4LA 4J9LA 4X64K 2YN4A 5I3UA 3ZETA 3V6DB 4KE5A 4M6WA 4DTNA 3P5TL 4OLBA 4M3TA 4I27A 4EMDA 5AXKA 1O5JA 3W9HA 1YRTA 3AVGA 2IFXA 1ED1A 2X3DA 2CQBA 2MU2A 4EI2A 2YNFA 2DFEA 4CJ7A 2YHWA 3J7YI 2B4PA 2YKAA 3NVKA 4DR3K 1FK9A 2R3VA 3LUYA 4F7VA 3CW2C 3W2VA 1RWMB 3FQKA 4G3IA 5J0XA 1BQMA 2FDNA 3HKWA 4U9RA 1K8KB 2M2BA 4HTJA 5A8RA 1EZZB 7ICHA 1SV5A 1QE1A 4UTGA 3VQ5A 4B1ZA 4GLXA 5CA5A 1B0XA 3W5YA 2V8HA 4LF8F 2YX1A 2FXUA 3OL8A 2IOFK 2PEHA 4JKGB 4CLYA 3MDCA 4LRCA 4US9A 4WXWA 4ACOA 2JOQA 3CJ7A 2XMKA 2O4GA 4JYAK 3KLHA 3CULA 2P5VA 1TTHB 4QIVA 4DR7J 1HD0A 3NGKA 1TVRB 4IDHA 1V9OA 1BA0A 2ZE2B 3R2CJ 3CETA 3CC4N 2QKQA 1TR0A 2NUUG 3SBTA 2LMIA 3M6WA 4C3LA 1BY9A 2KXHA 5D8HB 2DWQA 1Z4OA 2QEXS 4OZ0A 2LKYA 4DS5A 5J2KA 2UUAF 2DNGA 4FF2A 2ZUGA 3WT0A 4GXKA 4OZJA 1M90T 1JLAA 1RGVA 1SKRA 2VFVA 4QIFA 3UDVA 4PXEA 1D0EA 2FUG9 4MO5A 1LCUA 2E5IA 3A1YG 4CLTA 1H2UX 2V8GA 4CGHA 1HNVA 2FMSA 2D8CA 4FS2A 2YTCA 5L38A 4CIEA 1E4FT 7ICFA 3AHPA 5LY3A 4AQYK 3C14A 3V7JA 2QXLA 1ZQPA 2YKMB 3PR5B 1W7AA 1YHQN 5GMKa 2GIQA 1R0BG 4ILMA 4FBUA 3HZ6A 2MSSA 2KNJA 4TNOA 3OYIA 1RM6C 3WU2U 3ENQA 3GV8B 5J2BA 2AJ2A 4RNHA 1GAOA 4DUYK 1UHUA 1AA1B 2Z2MA 3VEXA 4ECVA 3GIJA 1Q8KA 2UV8A 3PKMA 3WUHA 4GV6A 4CWBA 3CM6A 3V7KA 3C5FA 9ICHA 2CPFA 2LM4A 2YMLA 2E4LA 1CC7A 3DOMB 1C0FA 3ZLJA 2QSWA 1N62A 4B3MJ 2FJDB 2W8KA 3NGTA 3VMFB 1XC3A 1BPBA 4HEA9 5J2CA 5AI8A 2XYPB 2WK4A 3AM9A 4LF5F 3CCWA 1OWXA 2FBYA 1C1CA 4PPDA 5J2PB 1GT8A 4A57A 4YB6A 4RLEA 2UUCJ 1HKCA 2XY5A 3ITHB 4FVUA 1RU2A 1AZSA 3I31A 3QINA 4F5OA 1MN7A 2UVVA 4C98A 3ICXA 5KAFU 3CDBA 2EAPA 1F9EB 1G3OA 3UDLA 4AL7A 3H90A 5GAHU 2R8JA 2IBOA 6FDRA 3L4IA 4UF4A 5IWAK 3FYHA 2XHCA 2DF4B 4E3SA 5KT3A 1A76A 4I29A 1Y3KA 2NREA 5F8NA 4TQRA 1ZQGA 1LKYA 4P6QA 3PX6A 1CQMA 3CCLN 1NMNA 1L3TA 1RHKB 5IIOA 4B9UA 4O44A 2EVZA 2FMQA 3M30B 2P9NB 1UTAA 1U45A 4ES3A 3WXLA 3S9HA 1V3SA 1CUKA 4X84A 4GVEA 3BS9A 5MLCQ 2Q3SA 1W2BM 5D78A 3QFWA 4RL1A 1LWCA 3HULA 5EE9A 3NMUA 3DLGA 4I9QA 5BXIA 2IHNA 2MKCA 4DO9A 1FDNA 3PY8A 5J2EA 1T05B 3WXIA 4AHUA 2WSFC 3LZJA 4KX3A 3GB0A 2NRWA 1IG8A 1DZ5A 3AO5A 3PMNA 3BBFA 2YQ0A 2XQCA 4KBIA 4MF2A 4CHZA 5F9LA 4EZ6A 3UNYA 5HL7Q 3RB4A 3MR2A 4WCEL 4OHZA 1SKUB 1Q95G 1U1NA 2ALZA 3UIQA 4I2PA 3MK6A 3FVYA 4M42A 1EETB 2V2ZA 1TMMA 1S72N 1WC0A 1WEYA 1PILA 2OEMA 3BKUA 3IBWA 3M2VA 4IC9A 5ETOA 3T1HJ 3TNVA 4CD3A 2QWRA 2C3OA 4G1QA 3MM5A 2DVIA 1I3AA 1G7CB 5DB6A 3PHTA 4FYVB 2YPZA 1EX8A 3NOGA 4OYMA 1WAJA 2PFFB 5IILA 4MMOA 4DV0J 3M8PA 3KK1B 4YD2A 5AQWA 4A8MP 3IBCB 1DRZA 1G4CA 4KPYA 3MM8A 1VC0A 4FLXA 3AY9A 5FDLA 3Q8RB 4F4ZA 3PO5A 4I7FB 5E33A 2EEYA 2CN1A 3WBZA 4FYXB 3KTQA 2MQNA 2GC8A 4YMOA 2GLEA 2VBYA 4DCOB 4X4VA 2GBZA 2HOEA 1BNOA 4KRWA 2NQPA 2NUBA 3NNAA 5AQIA 2KFNA 5ETVA 4CJEA 1XSNA 3MPYA 3L7OA 3L2VA 1XMQK 1W97L 1NK4A 4XO0A 1Q78A 5KFAA 3OYBA 5CCMA 3GV7B 3LDPA 1VBXA 1M90O 1UL3A 3KUHA 3UKUA 1JLFB 1FFUA 1DGSA 1VQMS 2E1FA 2XO6A 2G07A 1RWVB 3HI0A 4CJTA 1I94K 4JI7K 4IZ9A 3ETRA 4P73A 2KHCA 1TFWA 4E2FB 4B3TJ 3OHRA 2HMIA 3FGVA 4LF5K 4P10A 2KI2A 4DXLA 3AO1A 4CGIA 3I0RA 3LP3A 3G0ZA 1RWOB 1WTFA 2E8NA 3DRSA 1HLWA 3SCJE 3AA4A 2W9BB 4NLQA 3AH6A 4F2RA 1QVFR 3GU3A 2KB2A 3OS0A 4G9BA 2CJQA 1T3QA 4YB5A 5AQFA 1DQ8A 4YOWA 5EE0A 3CEDA 2IVFB 5C7PA 4OMFG 3K5PA 3EUNA 2NCKL 3SNNA 4DQQA 4JI3J 2XM3A 4JI1K 2VIHA 1ILYA 3RRHA 2ASDA 1APSA 4UOFA 4CLFA 4WBFA 1OIAA 3CCQN 4Y2XA 4Z4FA 3TKAA 3M4XA 4KH4A 1HEKA 3THWB 5IXUA 3OBWA 2OSQA 4TXSA 1XIQA 2DNMA 2MZRA 2VFSA 5ALRA 8ICIA 3IM1A 8ICYA 5L9NA 3AMZA 4EGLA 4FF3A 1XK8A 4IOAL 5CB1A 3C16B 2HNDA 3F41A 4DWIA 2I6WA 5KPZA 4L74A 1JL1A 3SQ2A 1ZOLA 3TSUA 1NGAA 2H5XA 3PRVA 3B78A 3OTEA 2ZZTA 5KFCA 1TAUA 2MQOA 3ZT3A 3KOOA 4KLTA 5F8MA 2RKIA 5F8GA 2C2NA 4M3UA 4L75A 2MHEA 4BC4A 2ETJA 2P9PA 4K4ZA 3C2LA 3CCLS 4DL5A 2A0FB 2R7XA 4QS9A 1RPLA 3PRBA 3IAS9 3PUFA 5A8RB 2ASMA 4I2IA 2FY8A 2VG6A 5DM6L 2JL9A 3JAMO 2J4RA 1I51B 4BRGA 4DV5F 2VYPA 5KG4A 3M8WA 1ZBLA 3AU6A 1FI4A 2N7CA 4J9KA 1VQSA 1NDCA 4BC2A 3GV5B 1QQ7A 3FFIB 4DV4J 2BE2B 1CS4B 2XY8A 1UPPA 2K06A 3GJQB 4RQNA 3SMZA 5KFGA 4XQ8A 3HILA 3ZDAA 2W04A 1U6FA 3J7YU 2W6KA 5ALFA 3NKYA 2ZGYA 4NM1A 4LSZB 5AM3A 4BR4A 3H42A 2BJ8A 4LRFA 4MLEA 4K8RA 5AQKA 3SBGA 3TACB 2LU2A 4M7XA 4DL6A 1NH8A 2ACYA 5C10A 4PXBA 3NFAA 5DZ7A 4NE9C 4WTOB 3ED5A 5B0FA 2G9OA 4CYUB 3AVLA 1VQON 2MKYA 3HSGA 1RBOB 1HNZJ 1XU4A 4UUWA 3EYZA 4LSLB 3ISZA 3AARA 4B17A 1QAXA 4GVBA 2BJ3A 1NH7A 3O80A 4UAYA 2AD9A 1X5PA 4TUPA 2BJDA 1WWVA 1RT7B 2FJWA 1WI6A 3VQEA 3CG7A 5F3ZA 4RQ6A 2RF2A 3MM5B 4IRKA 1X42A 3NAIA 2Z57B 4DHVA 3MDAA 1X40A 1FKOB 3W2VB 4YFUA 2QYCA 2Q66A 3C6AA 5FRMA 3MWTA 3J81O 2FSJA 2M0NA 1VJQA 3QIPA 1RBLA 3LPEA 4ED7A 1FE0A 4XK8C 2GCFA 4YHHF 4Z2XA 1S97A 2ITMA 2GEMA 4A48A 1X4BA 3VHQA 2JH1A 3WIUA 2DPJA 3PO4A 3FQLA 1NU0A 3EUB2 4CZLA 5B0GA 4P74A 4PAAA 2CPYA 1XJWB 3HYFA 4QZEA 3B82A 4LBIA 4J9NA 4Y2YA 2RHQB 4FPBA 4EO6A 5JVGL 2NSBA 4ZVEA 4KC5A 1IJJA 3AA2A 3T5JA 2VWBA 3E66A 3VTHA 3DMJA 4UB2A 1OXJA 4P0QA 3B0YA 4NLVA 3C19A 3D54A 4RQ8A 4BHQA 2ZM6F 4ZTFA 1Z6RA 2ZZMA 1JMSA 3J80U 3BSCA 1TAMA 5AQHA 1VRTA 2ZH8A 3VAFA 4DU3A 1KQKA 3FBCA 1H7XA 3AXMA 3ISDA 5H9EJ 4B3SK 1BDGA 3QBCA 1C0UB 1NWKA 5IIIA 1UPHA 3RJEA 3KJVA 1KN6A 4NB4A 1WSVA 1TKZA 2YY6A 2CPDA 3R5AA 1UQVA 2ZDPA 3L3VA 5EY4A 2LKZA 3ILLA 3JQKA 5J2DA 2BQ3A 9ICOA 2MZSA 4DOZA 1B0PA 1D8LA 3C21A 9ICMA 4DPYA 2Q36A 3MGHA 5AKEA 3GIMA 2ASOA 1RDAA 4DQIA 4CO3A 4GXJA 3OFGA 3WHIA 1GLDG 4DQRA 1QH9A 3LM9A 2FE9A 5ETMA 2WSEC 4NCBA 3MXJA 2RIJA 1VLYA 2XSFA 2VJ4A 3JB9k 3TWZA 4USHA 3SENA 4M3WA 4IH7A 5CABA 3TTFA 2LA4A 1N6QB 3HKZD 2AYEA 4ZOSA 3FSIA 2KKZA 2KIVA 3JPOA 2V63A 4QS7A 4RQ2A 1UZHA 3NHGA 3DHWC 3SMPA 1NJXA 4RU2A 2K1RA 1NJIT 2BXJA 1HWLA 4CIGA 3MECA 3LDAA 2PY5A 1OY9A 4A8YA 4OX9J 1N32F 4NLDA 1S1TA 2ZIUB 5CXTA 4UB6U 3ZNUA 5ALSA 4KHPJ 3D3BJ 4ZVUB 2HHXA 4DR7F 4CEQA 1NUEA 1YBAA 4NCGA 2LA6A 2DHHA 2Q6CA 4LT6A 3HP9A 4O0JA 3AAWB 3MR5A 4ELTA 3FJ2A 3LGMA 4Y6IA 2VPXB 4H0YB 3OYGA 4FBTA 1VQYA 3IWXA 1AROP 3UMCA 1ASUA 1YIJN 1QTMA 5CHGA 3O0FA 2J5AA 4PL8A 3TP2A 2V6AA 2E8AA 4MYUA 1NDKA 4K5RA 4OI3A 4JI4F 1JNRB 2FLLA 2I8EA 3A5MC 8ICHA 3HX0A 3VEVA 4EBEA 3KLIA 3GTYX 5T41A 2E2OA 4J03A 4DKWA 1M0SA 3T7ZA 4FK4A 2OO4A 2R2RA 3MABA 3OYCA 5AZJB 4DSLA 2W6LA 3NWGA 5KRSA 4IR1A 1W26A 2HHWA 1HHQA 4CLPA 3KLFB 2LYAA 2HMXA 1F5CA 4Y2IA 3UE2A 3R5DA 1B9FA 1FFVA 2E1YA 3FR0A 3OS1A 5L46A 1YLXA 4R8UA 3I4PA 4CDIA 4JWMA 1QHTA 5ADZA 3GFHA 1S5ZA 2GJ2A 1T94A 1YJ9N 4MYTA 1YAGA 2MYFA 4JKGA 1U0HB 3THYA 2B7BB 4Y2RA 2LXUA 2NO4A 2NRXA 4A8KA 4HUEA 1R6YA 5ALTA 2APOA 1D8BA 3M1FA 3VZIA 4DTUA 1D9FA 4PHEA 4O3SA 1U2VA 4EYHB 3MPWA 2I9GA 4CFCA 3KG0A 3MM9B 1HYZA 4LVNP 4M6WB 4F4WA 3BH6B 1CJTB 1RAOA 1D8YA 3V1OA 3AD9C 3OLAA 1GMVA 3NG8A 2V5HG 3VQSA 1EKSA 3SV3A 1QSLA 2AZ3A 5EX3A 4UT4A 3K57A 2GHWA 2OWOA 1FFSB 1SKWA 3T6JA 3KLVA 4GKKF 3Q24A 4CIOA 2ZHOA 3J7AN 3SQIA 3ULHA 3O6QA 3HD1A 3F9MA 2JVOA 4WIIA 1LOTB 5ALJA 3P83D 1DARA 2DFHA 4ZIVA 7ICUA 1U02A 3UM9A 1DK3A 4UARA 2VG7B 4BR5A 2X1FA 2E7VA 2D5RA 2DGWA 3WIVA 2QWPA 1HWJA 3J7Z5 3J7AP 4GVMA 2GV1A 3CJ5A 1T05A 4FJJA 2RMLA 3H5SA 4OLOA 4QZIA 4F36A 4E7LA 5ADXA 3QLHA 2R18A 3NBPA 4FJLA 4DMZA 1N56A 2YV0X 1B7YB 4P71A 2F8SA 3RMBA 4OJ5A 1TL4A 1ZZFA 3D0IE 4ELUA 3PFEA 1NBEB 1SB3C 4C2MA 2PT0A 4RW6A 4RPZA 1NM1A 3VQPA 2JLFA 1DQ9A 4YDUA 3N4MB 1L3SA 3R1LA 2R2TA 2Q43A 4BGAA 2HWHA 1QSSA 3RJHA 4DR4J 4DPUA 2DT9A 2K60A 3U26A 1J6ZA 1JIHA 4PYAA 3T19A 1WN7A 2W03A 1JLEB 2FC9A 3IV6A 3M1YA 5E26A 5IOLA 4CF8A 1WG4A 4CFDA 4CH1A 4FKXA 3VAHA 3W9IA 4NYNA 4CIFA 2V9KA 4QZAA 2A2DA 3VCDA 2V50A 4MKAA 2BW2A 1UETA 2VPZB 3BF1A 2YX6A 1N34K 3EPIA 1FRHA 2ZH1A 4WFZA 3MDFA 4HDHA 2Q0RA 3D2FB 1BQNB 4Y34A 2K8GA 2Z1HA 1C4CA 1T9VA 1VSFA 1FESA 2EKNA 2UUTA 3D7EO 2AGPA 4JKFA 1SQEA 2FVCA 4I2EA 4NL9A 1WC1A 4RW6B 3QT6A 2YMPA 1OYDA 3VV2B 4UAVA 1YGYA 3S3OA 2HHHJ 2VKZG 3ZZUA 1YJUA 2K2PA 2F8LA 2IDOA 2KT3A 3U1MA 3W64A 3MOJB 4ZLNA 2NS1B 3BGOP 4A8XA 3L7UA 1M1KT 2UU9F 3ZZYA 5AZJA 4JI0K 1FEEA 4P7VA 2AP1A 2RRBA 1MNEA 1WSRA 2XYGB 4WP9A 3L5KA 3UVJB 1FTRA 1RADB 4OO1J 5LXYA 2IGIA 1ZQTA 3DRRB 3G6YA 1RAIB 4F5QA 2ZIVA 3AA9A 5KG0A 3QT7A 2JRZA 2DPIA 4O4GB 2R7YA 2UVRA 3O9UA 4ETZA 1K73O 1YIJS 1S6QB 3BYPA 3T5KA 1WC4A 2BE2A 3ENHA 5BRHA 4X4QA 2HBKA 2V34A 2M9KA 3K1ZA 2PMZD 4FO6A 1RHJB 3GIIA 2XMAA 2OTLN 2F4FA 3A8IA 4CF1A 2W9CA 4NLNA 3DLLL 4CF4A 4UATA 4LR9A 4MJKA 4K42A 2E7WA 9ICFA 3EDRB 4M45A 2R42A 2RVJA 2HNZB 5KFTA 2WZ1A 4J91A 4UZBA 3HVWA 4ECZA 3NRZA 1X60A 3CJ4A 2YX7A 5HQLA 4ZVTB 1F1BB 4LFAF 2CPRA 3GLJA 5HP1A 1DK2A 5KFWA 1U1KA 2WOMB 4CD1A 2UZAA 4H8KA 2QKBA 4EENA 3EO3A 2H4YB 5DB8A 3BKFA 3NE6A 2HOIA 3I33A 3PYEA 2E5GA 3KNAA 4K0KF 1GLJO 5EXWA 5J0PA 5HLFB 5E3RA 3C2KA 4B08A 1Y3JA 4X5VA 3MXHP 3H46O 1RGIA 2BHNA 3U4LA 2GV9A 1Y4ZB 3ETOA 2MHNA 5D3GA 3QATA 4O55A 4L73A 3GFYA 3I56S 4ER8A 5CCLA 1KWMA 1ZQJA 2PA3A 4C23A 1UFWA 1D1UA 4IS7A 4DCCA 4L6V3 4M5DA 1R8PA 1R43A 3FM9A 2FJVA 1S6PB 2XHWA 1ZJNA 4KV8A 1RWKB 2KZMA 2HGNA 2NYIA 3LA0A 4RQ7A 1RA7A 4HVJA 1BD6A 2QZ8A 4IL6U 5IWAF 1VK0A 3BGLA 2DNZA 4A8WA 4CK3A 1RKIA 4J2DA 2F9JA 3L3CA 1WUAA 2K4HA 4J9VA 4GC7A 4DR7K 1P1LA 4F2SA 2OMOA 9ICJA 2DNLA 1RDCA 5EHHA 2BPFA 5FRNA 3KLGA 1H7WA 2IIRA 3H3NO 2B8PA 1VSLA 3SAGA 4Z94A 2CQIA 3T5HA 4YXMA 1UFKA 2YKNB 1Y97A 5KNIA 3KG1A 4CJ4A 3AAQA 3DXSX 4NI2A 3RG6A 2ZH5A 2J0XA 4JLHA 2ISOA 1JWWA 1YWXA 4DV2K 4CHOA 3K9JA 5AR0A 2HFOA 3KIOA 1IJFB 4P2MA 1JXEA 5ALVA 2IPOB 3I56N 3MR3A 2GO9A 3TX0A 1JLGA 1RT5B 1SWVA 4MFFA 4USWA 4Y1CA 1OO0B 5TISU 2BOPA 3EICA 4E1JA 4R0EA 3C94A 2CVIA 3DMJB 4PWDA 1JLQB 3I9V9 4DPWA 3J7ZO 4JHDB 1IM6A 2PYJA 2HDOA 3BS5A 1PUZA 1HL6A 1R27B 5J0WA 2DEIA 8ICXA 2IM3A 1KLMA 8ICQA 2B56A 2BPCA 4IO9Q 5DDRC 4FK2A 2QTDA 4RG8A 2PAVA 2LU1A 5JMVA 4Y2JA 4F3QA 1T3OA 4FWQA 3D6MB 3AO3A 1WSFA 4BVPA 1G2EA 4LFBK 1Y5LB 3QBXA 4CYUA 4C7ZA 1FFGB 1ZQSA 3FCVA 2D3O1 4LBHA 4X65K 3ILOA 1VQKN 9ICXA 2NR0A 1B43A 2RILA 3ZZOA 2JSXA 4A62A 1Q46A 3PACA 1ECWA 2GQCA 5BPMA 4KHRA 9ICQA 4FFDA 2EC0A 2G5HB 1SXDA 1RDRA 2ROGA 5I42B 4NLTA 4FNHA 1J27A 2V2QA 3D1OA 1WHWA 2V8VA 2DHAA 4JI8K 1EARA 3I8DA 3H40A 2CJYB 3QO9A 1XMOF 2RQMA 4DCHA 3CIPA 7ICRA 2JC1A 2OTLS 2KV2A 3IR6B 4RBVA 1FKPB 4HACB 2OPRA 2OPSB 4QCLA 2YWEA 1Q8IA 4JAXA 4F3OA 4F0HA 1AFJA 1FA0A 5DGAA 4KHMA 2P9PB 2YHYA 5B66U 1RP5A 2C2KB 2G4BA 5D0EA 1WYGA 5CP2A 4RQMA 4HUFA 1T3NA 1N52B 3ULDA 2CWXA 2XULA 1G1XA 4J7CA 5ALXA 5J29A 2BM0A 4FJ8A 2DFLA 4BLGA 5KFQA 5EGYA 1Z05A 4IOXA 2ASPA 3W9JA 4I6YA 1RACB 3H8WA 4NLCA 3MMAA 4CEOA 1ZQAA 1DHMA 4LF7F 4C11A 5IV4A 3QPIA 3CPWM 4OHYA 5DB7A 4UQGA 4CJSA 2O01C 3O44A 3CC7S 3UMBA 1D4XA 4R25A 2HAFA 2IAJA 3CC2S 4WQ5A 1FFWB 5IFMA 1SCJB 1SH0A 2N4DA 4NASA 3IAM9 2WHEA 1W2BR 3HHLA 2X1AA 4KI6A 5GIOA 2U1AA 4NLXA 1PK1B 2H3VA 3HCXA 3O4NA 2XGPA 4NLWA 5KT7A 4KLMA 2ZVIA 2FVRA 1GQEA 1L7PA 4CJPA 4O3NA 2VICA 1Q1KA 3TAMB 1S9EB 3E9LA 1J53A 3G10A 3CJSA 2E66A 1UA1A 4HHUA 4KBOA 2GUIA 4JEPA 3D6JA 1CJVB 2RQCA 2JWKA 5FJ4A 4XA5A 2HNDB 3ISCA 2CAJA 3B9JA 2KICA 2X1GA 2PFNA 2ODGA 2WSCC 2WUSA 1P9QC 5BOLA 4RW8B 2HNYB 5HMYA 3FMBA 2DFFA 4CJ5A 3ZEUB 3OVBA 2QN6B 4EUVA 1GLBG 2G8KA 2HG4A 2MQPA 2C28A 4HH1A 4ILHA 1ZA2B 1YJ9S 4UOCA 2A5XA 5HRRA 9ICUA 8ICRA 5AICA 9ICPA 2QMWA 1TKZB 5KFDA 4LFCF 1ATSA 4W5OA 3V6JA 2EFNA 4DUTA 2DYAA 3HSDA 3AODA 4H5RA 5BYSA 1FJGF 3HHNB 3QUBA 3OYDA 9ICRA 1SC1B 1XSPA 1ZQNA 2HF3A 2PEBA 9ICBA 1J5EJ 2IVNA 2YX8A 2FJAB 5JS2A 1SQGA 3TAFA 4ZN3A 3NS7B 4BG9A 4K2XA 2ZM6J 1CC8A 1X4DA 3R6GB 3GYGA 1ZQWA 3BDPA 1KVBA 4KPCA 2FVQA 4F3TA 2E1EA 2GMLA 2RSQA 4EEKA 4ECXA 1D09B 1JI7A 1S1WA 4FJHA 2HQCA 4JRPA 5IZHA 1OJ4A 2BZ2A 1U1RA 4QR0A 3CP8A 3B6BA 3ZSRA 3O4WA 3CDWA 1F5AA 2QA4S 2HHUA 2OEJA 3MEEA 2XVTA 3HSTB 5BRDA 2OXOA 3HVTA 3OFFA 2V8DA 2D3DA 2VFTA 5KFUA 1X5SA 3H25A 2UXDK 1JNZB 2FC0A 1CVJA 3CTRA 2LI6A 2P51A 2F7VA 2B43A 3OPXA 3ULEB 4M5JA 3FZ2A 1JCGA 2BVZA 2CJKA 3MD3A 3E01B 2DHSA 1DEJA 4O9MA 2CNLB 3JPRA 1XNQK 2CDRB 3LP1B 1DKGD 4PL2A 5GINA 3CO0P 1K44A 4PH5A 3QMQA 1VQKS 3SXLA 2FHJA 2F63A 2RF2B 4Y1DA 2BCQA 3HHLC 1N33F 1WWHA 4FWMA 2XI3A 4LMZA 2QL5B 2JWNA 4DV0K 4DR4K 1IXRA 1GK8A 4DPOA 3OS2A 3W5XA 4LFBJ 3E51A 3WK9A 1K8KA 4I67A 5IIJA 2RDIA 2C1EB 4G1QB 1U0SA 4LSNA 3M6ZA 2MXYA 1G99A 1VQ8N 3KZXA 1GLFO 2Y9TA 2B4OA 2G5IB 3Q8SB 3DM2B 2EWSA 4DR3J 2IRYA 3T3FA 1HRHA 1UVJA 3ILJA 3BJYA 4IG0A 2Y0SF 5KFIA 3KBBA 4XIUA 4FXVA 2RT3A 4BGBA 3NGRA 3Q8YA 5L1IA 3AGRA 2RU3A 4AL5A 4B1XB 3GR0A 3V72A 4DFJA 4CFAA 3VF6A 4QZ9A 3MR6A 4DEZA 5D4BA 4YB1P 4JI5F 2IOHA 2OH2A 4BQLA 4IXCA 4QWBA 3T79A 5IC4B 2ZTCA 2EZYA 1H3DA 4BRLA 3EE9A 1NLKL 3TSQA 5CEHA 1VJWA 5C2GA 3C3LA 1S0NA 3IS9B 4NO7A 3WK7A 3NCRA 1RT1B 4UB8U 4DZDA 4FLWA 2HHHK 5EVZA 4IO1A 1FX2A 2GUPA 1V85A 2GIFA 4BX9C 1MN8A 1R8CA 3CJ1A 2OP5A 2ZD1A 3KJFB 3O3HA 2KRRA 1ZQXA 2F77X 4HH0A 1N5QA 2ZUCA 3D6RA 4MK8A 1U1PA 2JFDA 5AM5A 3MPUB 2KG5A 3MDQA 4DFDA 3V9XA 2HBYB 4QYRA 2GX9A 1NK6A 3C7NB 1UJ5A 1N33J 4RTFD 5J0QA 2BKNA 4J9UE 4OHWA 3VETA 3EPGA 2W4CA 3RBEA 4UUXA 1SZ2A 4FJIA 4QPTA 5KRTA 4LR7A 1Q0NA 2O8BA 1KLMB 4FL9A 1WHXA 2WHOA 3ZSVA 3F53A 4ZKAA 4KY3A 2WF7A 2ASYA 4YFKA 4UQTA 4DF8A 1WLJA 5AKZA 2W55A 2RRNA 1CLFA 1A5XA 1S1TB 2FHOB 2HHTA 4CERA 3DLHA 1VDVA 1JLAB 3TQ1A 3JTPA 2W3RA 1N34F 4GV3A 3QGHA 4NYPA 1H74A 1FHTA 2J76E 4CNYA 2O67A 1HA1A 1DGKN 4CNZA 2L9DA 5IQ6A 1K9MO 4KLJA 2KM8C 4I6MB 2AA4A 1Q7YT 2ZF5O 1CS4A 3WQPA 3N6LA 4I0WA 1XHXA 1NNLA 5LMNJ 4CGGA 4IOAQ 3CE8A 4I2AA 2JDJA 4OJRA 5KG1A 1SH3A 3WX8A 3W3SA 4FWLA 2B5JA 4NYOA 3T1YJ 4B3TF 1HNXJ 4IO8A 3F73A 2BX6A 2KKHA 3HBTA 4Z37A 1KQFB 1ROFA 3NL0A 4GO7X 3FZKA 1X4FA 3OVSA 1RZMA 1WNSA 3OY9A 4M9JA 1C0UA 1LXJA 4X62F 4WFXA 3D68A 1U49A 5BN9A 4FKYA 5JICA 3D2EA 3DLGB 3U9ZA 1SJ1A 2ZVSA 1X1PA 4AXIA 4U8VA 8ICSA 1KOHA 4YY3K 1WUDA 1Y5IB 1NJZA 3IFRA 4U7BA 4LF9K 3L9ZA 4I64A 2A1BA 1HIYA 9ICVA 5HAOA 2OKQA 3GG4A 1KD1T 2G8VA 3BPSP 3ZD9A 4C48A 1IG6A 2GZOA 2Q1NA 1V3RA 1RDFA 3O6WA 1VQ4N 3D0GE 4K4WA 1XO0A 4BR7A 5KFRA 1RXWA 3SUQA 4YOXA 4F92B 2RHFA 1WKLA 4FWOA 3H0RB 4OKEA 3B8AX 1Z00A 3EW9A 2D9OA 5IT9Y 1VRUB 2VANA 3EJMA 2OYYA 3KK3A 2LECA 5ETKA 5KT4A 4IRCA 2YMQA 3QGGA 3KDNA 3M2UB 4Y2CA 3ZSYA 1AB8A 3J81j 4XTTA 2R9LA 4MH8A 3H3OB 3G71N 4C8OA 3DJCA 6FD1A 3B6PA 1ZZNA 2J6TA 3JPQA 3QO9B 5CYJA 3AA8A 3QU7A 1RT7A 3OVNA 4MEYA 1F9HA 4TLRA 4BWJA 2QA1A 1YXQA 1JMTA 4B8CA 2VG5B 3ENVA 2DXDA 2A1JB 3O9SA 2H3ZA 3DV9A 1S12A 4RBUA 5CZXA 2ZUAA 4IG3A 5C12A 3FRYA 3ZT0A 1JKHA 1NCLA 5A0YA 4EO8A 3F2DA 5BR8K 1H2VZ 3BQ2A 5CYQA 2H3QA 4JKDA 2ZJRQ 2IHMA 7ICEA 4IFVA 2P6SA 2PA8D 4LF7K 2KYZA 4FF1A 4CT9A 4DV6J 3MAHA 3QBWA 5B0BA 3FCHA 2MDAA 1QTNB 4LJMA 2EG2A 7ICLA 2ZZNA 4J2EA 2A2CA 3ULEA 4ZLLA 1SIWB 4D3HA 4KN4A 2XSJA 1H1VA 3RYLA 1U2FA 2J8SA 5ALPA 1FKPA 2JRSA 1I1GA 5ALOA 3NNCA 3C6HA 1KLNA 5BR8J 3G71S 2QXFA 4GKJK 1EP4B 3UQ0A 1S1WB 3QDKA 1FEZA 4YY3J 3AVAA 1GLLO 2KJWA 5EU7A 3UW1A 4Y2UA 4FJ9A 4AYBD 4K4TA 3QMLA 3VQ6A 1LEOA 2LEAA 2I5HA 2EKYA 2LEBA 1Y00A 3AEVA 4JV2A 1TUWA 1ZOTA 2NXNA 5J2NA 2Y8WA 3VERA 1Q5YA 3KK3B 3PIOQ 3BO3A 1CXUA 2YWKA 4I2GA 3KOAA 7ICPA 1G15A 1WB9A 2HFUA 3UN5A 1IBLK 2R4FA 1SZPA 3K5OA 1HBUB 3LDOA 2DR8A 5I3QA 3IBPA 4MFAA 3M8YA 3JTNA 4CK2A 1FX4A 3CCEN 7ICNA 3QEIA 3VQDA 3L4PA 3KLEA 4I4BA 4F5RA 3U9DA 1RYUA 3FZMA 2GIRA 5JMNA 8ICAA 1WD6A 1E6YA 3V1RA 5LMNK 4X4UA 2GWKA 1HWUA 3L2WA 4CRXA 3TVZA 3RSEA 1QQ5A 2ZIWA 4LVSA 3RAXA 1BU6O 1B70B 4DR6J 3VQTA 4ZCIA 3EM1A 3N6MA 2NXEA 3IG8A 1UJ6A 3PYFA 1NG9A 3IO1A 1M5PC 1SJQA 2EFPA 2IDLA 8ICZA 1F9FA 4OHXA 3P38A 3W7BA 2D1CA 2KHDA 3ZT2A 2YH0A 4QU7A 4CO4A 1S59A 2Q0UA 3V6DA 5FD1A 4P75A 8ICFA 1RAGB 1AT1B 1KAZA 1UP1A 1BI4A 4I2BA 3KLGB 1ZD4A 3ICLA 1RDWX 4DB3A 3VGKA 4F25A 5MAOA 4KGMA 3TI0A 2HFVA 2WTFA 1I94F 3IRWP 4N56A 3Q2TC 1W2IA 4URSA 3EZ5A 1S6QA 4M5GA 2IA0A 1HNIB 4ITSA 2M5YA 1T4GA 2WF8A 2P9UB 2FBTA 3BKTA 3NUQA 5I4MA 2PZSA 4Q43A 1QS4A 4I6AA 2KLAA 1VJ5A 4KV8B 5AM0A 3OJSA 4BC7A 1VQPN 5GAEI 5KFPA 5DMRA 1KFTA 2HLTA 5ETQA 3NASA 2QC3A 4IKAA 3N97B 3M6VA 1EAYC 4TY9A 1NMDA 2W43A 2R7SA 3C2MA 3QUTA 2KHOA 3VAGA 3A8KA 3QETA 4KLOA 4RNFA 4WCEQ 3SQOP 4QU6A 2NRTA 2FBVA 2O8EA 2EH9A 4WQ4C 2UUWA 2H51B 3KNGA 5D0GA 1NZ8A 2HRYA 1WAFA 3MTKA 1PC5A 5CJ7A 3MMAB 1T3VA 2GW8A 4CHYA 4PABA 3TUPA 5AQXA 5L1KA 3CERA 3MHYA 1V97A 4C11B 9ATCB 4X62J 3L2RA 5B0DA 2XLJA 4FWSA 2VKQA 4CJUA 4KHNA 1P8ZA 4CZIA 4CJWA 3NGSA 3SCXA 4DZ6A 1BMQB 4FZZA 2W2QP 2ZJ8A 3J80O 1TL5A 1GX5A 2XY7A 3H7HB 2YWFA 1KBUA 4YN4A 4JI4J 3DOLB 3C0BA 4CRJA 3UDEA 1FT8A 4CO5A 2H3GX 4JKAA 1TK8A 3QEBZ 2DH7A 4LZDA 3MM6B 3NH2A 3IMXA 2FPKA 1BI4B 3FEYB 4KHYA 1RWPB 1VSDA 3VTIA 5M2UA 4CEZA 4DR1J 2PI5A 4DTXA 4CF3A 1N8RO 1YVNA 1LWXA 2OYQA 1V3ZA 5CYQB 2MUTA 1NPRA 4EX6A 7ICMA 1FDAA 4PRFA 1F3FA 1NSQA 3ZNJ1 5KFXA 5KL8B 2JZBA 1P6TA 1U2CA 5BOMA 2GX8A 2W25A 2FSKA 1EKEA 3AO4A 2HBMA 2ZHAA 3WKCA 3A5LC 1XNSA 2QMUB 1YJWS 3A4TA 2OZMA 2OANA 2M4MA 3A8EA 4GXIA 1JQGA 3KHLA 2N7YA 3AVIA 2VJ5A 3BR9A 2WVCA 1SV0C 1YI2N 4M5HA 3SQ4A 4DX5A 1HNWJ 3MTJA 4KLSA 1HQEA 2CVEA 5FROA 1VQLS 2WFAA 3K59A 2ZTEA 3PEHA 4N77A 5HMZA 3H4DA 2OPQB 4ZIWA 1PJ7A 2DNNA 2C3YA 1IKXB 1IKYB 4CP5A 2M88A 2XIDA 1KVIA 3RMCA 3BH7B 3MEDB 3SUPA 1YJVA 5LJ3Y 1HWIA 1SXEA 3TZWA 3TFRA 1ZJMA 1OYEA 1C0MA 2HBJA 3SPZA 4HACA 3BS5B 5LMUK 3IXQA 1Y0HA 4LR8A 3U1NA 3PIPQ 3PDNA 3R97A 3KK2B 4QIWF 4QIEA 1HLUA 4PY5A 4CEDA 3TA2A 3US5A 1NNDA 3IM9A 4OV1A 5AK6A 3CD7A 4WFYA 1U09A 2P5GA 3HZEA 1RTJB 1XNQJ 4CF9A 4RQ5A 2CRLA 2OZSA 4AT1B 3KD5E 3A8JA 2NPFA 5AZIA 5IM0B 3ILIA 4WQ4A 3B4DA 5E2QA 3UN3A 2HQGA 2WC9A 3TANA 4ZDNA 2YQ1A 3PTWA 5IV3A 2Y1RI 3KHGA 2F9DA 2F8TA 1YRUA 3PX0A 1QSYA 1RILA 4LF6F 1S1UB 4PHPA 3TFSA 2MUTB 2KVQE 3MEDA 4Z7CA 1NJYA 2KH9A 3CD0A 3RBXA 1DTTA 4IO9L 2FPHX 3BP8A 4CZMA 3LZIA 2N82B 3Q7BA 4QYZK 1VSIA 3JSMA 1I3OB 3LF0A 2YB1A 4B9SA 2ZH2A 4OLAA 2QW9A 5CYMB 4IFVB 1S10A 3FAHA 1CULB 4TURA 2HQ3A 1GX6A 3K0JA 5FPEA 5AE2A 1M5SA 3H20A 3B8HA 1S9EA 2N4CA 4LF2A 4EX7A 2Y1IA 3DN9A 2VQEF 2K4EA 2MKHA 4PUOB 3I5CA 2DD8S 4P2XA 4A8SA 5M1FA 3QICA 3DDHA 5D4LA 3VGMA 1BNPA 1ZBHA 3R8YA 1O03A 4WE1A 1U0HA 2JXJA 1FWPA 2QA2A 4I28A 1VHIA 1SXLA 3WNHA 4UBCA 2W7AA 2ZJPQ 4ID5B 5DRKA 1KEKA 2YKNA 4BQZA 4NOHA 3V1QA 1VQNN 5CHIA 4KHUA 5KFBA 1RHMB 4MEXA 1MLAA 1VHXA 4BBYA 2VWKA 4HCCA 1AQ6A 2OMLA 8ICWA 4PZNA 4ILJA 2HSZA 1IH7A 4CO1A 3GWCA 5M1NA 4C8ZA 2QIFA 2HI0A 3CRXA 2UXBJ 3PLAA 4ATNA 5EWGA 1N5YB 4Z4IA 1RDBA 1QVFM 1WACA 1BOTO 2PYLA 2LBOA 2NZTA 4O4RA 3UKRB 2Y0SD 3W8PA 2Q31A 4DV1J 5AI0A 1RT3B 4R8UB 3UI3A 2B9EA 2KFYA 5G0RA 2LHTA 3POTA 4AYBC 3CSKA 2A1JA 4FJGA 1EXQA 4ZPTR 2E7XA 2GHPA 4J37A 2HHSA 4TU9A 1FXLA 5B0AA 2A3JA 5AQVA 3QRRA 2NLXA 3HM8A 5FLXU 3MM7B 2ZOFA 2RRDA 3L3FX 2BJEA 1KFSA 4DV3K 7ICTA 3SEOA 4FE3A 2DKZA 4O4GA 3Q22A 3CQ8A 3HL8A 3V4IB 3CQYA 2YHBA 1X4AA 4O3PA 4CZHA 3M2UA 2VQEJ 3TA0A 2P9UA 2DKXA 2RPIA 2CZ4A 4TU8A 3CMAS 1IBMK 1XS9D 5KG2A 2QA4G 1FK9B 5J2IA 5KFZA 2GAHC 1SUQA 4JMUA 2KHQA 1Q16B 5ETPA 3S6EA 1JLFA 3CCSN 4N41A 2DGVA 1W0HA 4DV5K 1XNQF 1HBUA 4U96A 1WI8A 1O0PA 1YJWN 4DTRA 1A5VA 2G8FA 3VGVA 5HHHA 4O5CA 3UD3P 4IFYA 4NLPA 3ID8A 2F8HA 1P27B 2P9KB 1L7MA 2KK0A 3W5ZA 2FLOA 2Y8YA 3M7VA 5D77A 1OQ3A 3ZT1A 4ECUA 5F3TA 8AT1B 4PYDA 4OPAA 2YX4A 2RS2A 2AX1A 3QNNA 1TL3A 4Y28C 1ATNA 4R66A 1X9JA 2UYTA 2NYHA 3VOVA 3T5LA 4CO0A 4C4WA 2O8BB 2XMVA 1HKAA 4KIAA 3A3OB 4DX7A 1SJFA 1OH5A 3VWSA 1M5HA 1NBWA 2RH3A 1RT5A 1HUZA 2LYBA 2HVHA 1JXVA 4CJRA 3H0MB 5LSLA 2VOOA 2WAQD 3VESA 3VR1A 3M6XA 3MAAB 3TU5A 3NDKA 3SCKE 4AILC 4JKBA 5D6GA 3HPHA 2AZ1A 2JHDA 2XZTB 1IKVB 5IQQA 4DV3F 2Z56B 4A61A 3I0SB 4YXJA 3EGZA 4DSKA 2G06A 3DLEB 4BGDA 1ZD3A 2MSTA 3PHEA 3FC9A 4PKHA 1CJUA 2FYXA 4LF1A 4RT3A 3CM5A 2WB1D 2H3IA 1UVKA 1SVDA 2VU5A 2ZWPA 1S57A 1GMWA 1Y10A 4MTPA 3IWLA 4A46A 1J97A 4Q0BA 4K4SA 3OV7A 4QPXA 2ZUDA 5ALWA 1VK3A 2QX0A 4DCJB 2VFUA 3QSYB 3I6PA 4ZCMA 1NI3A 2OSRA 3MMJA 1B3TA 4WP3A 3MN6A 2IBKA 1IQTA 2Z1IA 2GGPA 4NZ6A 2H5IB 2JEGA 8ICUA 4DJBA 4K2JA 2A6OA 3NS6A 4NZ0A 2HS3A 4AXJA 2A1SA 3O5BA 1JCEA 2QLFB 2CGLA 3MN9A 4RPFA 1CBKA 2HWTA 1B9DA 2VA8A 3L95X 3LWLA 4LIRA 1RHQB 4EK2A 3D9BA 3QFPA 4QZDA 4UAWA 4LC9B 4GKJF 1VMBA 2V4QA 1R0AB 3PNCA 3IC1A 1XQSC 2ZNYA 3K7RA 4TN2A 2DQNB 4PKDB 3AOAA 2IM0A 1CQNA 3HSJA 1H0HB 4F02A 5F1XA 1EWRA 4XEIA 4JI3F 3D6FB 3MOZA 4DV6K 4OX8A 4Y00A 1JLBA 3H0PA 2ZXHA 2OEHA 4GVLA 2V69A 4UY8O 1AFIA 2FZCB 4W90B 4WJBA 2E3TA 2O3DA 3P31A 3HKZC 1I6JA 4JV5F 2HSTA 5F41A 4DOCA 4FLTA 3NH1A 4YORA 4NJ8A 3NEKA 4BWMA 3AT1B 3HHLD 4FP9A 1CLQA 3OYAA 4C8LA 2RDJA 3EXYA 3QNOA 2MKJA 3MCNA 3DYAB 1PYSB 5CE3A 2IOFA 4R63A 2R8IA 4BRDA 2RRAA 4CZJA 1RBRA 3ETMA 3NH0A 1VQPS 3WXKA 3FFIA 3E01A 3RH4A 3DKDA 4NM2A 2HK2A 2YNGB 1T02A 2BJ1A 5AJ3F 1WF0A 1OH7A 3MUTP 1GMUA 2ZWOA 2O6KA 3CF5Q 5D3GB 3TVYA 3ENWA 2A6AA 2RQKA 4ID8A 1HNXK 2E5HA 3E1YA 1RTHB 5EX5A 2KJ5A 1WWUA 2E8OA 3KKFA 5A0YB 4TU7A 2W4DA 2CGJA 1RZTA 4NWIA 2B51A 1S7HA 1SC6A 3NGDA 2LYHA 3CI5A 4EHTA 2WB1F 1C0TB 3KHHA 3DLKA 1JB0C 2WOMA 3AJ2A 4PUOA 5AXNA 3QAUA 2HPUA 3MZIA 4KN7A 1TV6A 5CR4A 1R0CB 1J5EK 5KOXA 4PWUA 2LQ8A 5CZVA 3WEEB 3CVKA 4RWXA 2DRAA 3BGRA 1VSHA 3MCAB 3K4GA 2AEMA 4BRKA 2RKIB 5ALUA 3V81A 5KG5A 3G8QA 2B4JA 1WC6A 5H2FU 1TMJA 2ZKUA 2CQ4A 4W5NA 5FP0A 3UKUB 2GMHA 2HVDA 1WKJA 2HURA 3JQMA 3SK3A 1J5OB 3VGLA 1LFPA 1HJPA 4JNEA 4JI0F 4JOUA 1KVCA 4CBUA 1BPXA 4NRUA 4JYAJ 2HWIA 3BSNA 1ZQ1C 4M3YA 1Q9XA 4P2FA 1YTUA 3C14B 1BQMB 4H0VB 4PQUA 4IQWA 3KYLA 4RBTA 5A2QY 2W11A 2FF6A 2XHBA 3RMAA 2FMPA 3KWGA 3RW6A 2JGUA 3FZLA 4DI6A 2E1ZA 3TAMA 4CLWA 3GG0A 4LFCJ 2HBRB 3PSTA 5D15A 1S1UA 1K1QA 3C66A 3I0RB 3VQAA 2A1AA 3N4PA 3P1GA 1KQSM 4ES1A 3CYMA 1ZBTA 2MGZA 5AQRA 3ISND 1HPMA 1NLVA 2Q4TA 3C6TB 4LF8K 5G5HA 3BS7A 1R8HA 2YVSA 3QGPA 2VA2A 3M6UA 4EFAC 3ZX3A 2DNOA 2AMCB 2R7VA 1JL2A 4IEEA 4AHVA 3CO9A 2MLYA 2VPYB 1DURA 1NJWA 2ITGA 9ICAA 1VQ9S 4WXOA 1E6VA 4HYKA 1NGDA 2D7SA 4X4SA 4UW2A 4QR1A 3L4QA 4ECTA 5HRPA 2B7CB 3ZZRA 2V51B 4ZS6A 1X31C 2HYIB 4OD0A 5KT6A 3CUNA 2RHKA 3KZBA 3OSNA 2F5GA 2IMOA 1VIXA 3ELHA 1EP4A 1TAQA 2JJ4D 1YJNN 3F2BA 3KJNB 2P5OA 3QESA 4DR2F 1Q86O 2A6MA 3TZZA 2CJXB 1IO2A 1O1WA 4WFBL 2KSOB 4DN0A 3Q83A 4GC6A 2G1DA 5J2JA 1GFWB 1K0TA 4CJLA 1KQQA 2K8CB 3EVWA 3RGIA 1KCFA 1HQEB 4JK7A 4KGXB 4RWTA 3FSXA 5EN1A 1EIYB 4RUCA 3HHKA 1BQXA 2CPHA 4O44B 3J80Y 4KR0B 1AUSL 4HTUA 2WW8A 4G65A 3DWLA 2HHHF 4QNLA 3WC0A 3O1LA 4PG5A 3PSPA 4GVBB 2P9NA 4FS1A 3SJJA 2AYGA 1KTQA 3JYTB 2D3ZA 3LYSA 3IDHA 4FJ5A 1ZQKA 4CLUA 5KFNA 1T0TV 1BE4A 1WKKA 2WONA 3UO0A 2DGXA 1RT2B 3DRYA 1RQNA 1EB0A 4KB7A 1JLCB 2E5JA 2O8CB 3NOCA 4GMJB 1VRQC 3HDSA 3CJRA 4FDFA 3BDEA 4KFBA 4MIBA 2MAXA 2KSOA 5AQTA 2MZQA 5B0EA 5GTIU 1VQNS 3T6BA 1V6HA 2JHEA 3P49B 1CJTA 1M1GA 3TRGA 2E29A 4JS5A 2O5DA 3QEWA 1HKBA 3ZZPA 5JJBA 2OAUA 3LALA 3PW4A 4K41A 1ZYQA 1VS3A 2KYXA 3NGUA 4NXNF 2I7PA 3DDIA 2ZEJA 1UT5A 3P5JA 2BJ9A 2FPLA 4JN4A 4X64F 2Y3YA 3OYMA 2HK3A 4DLGA 1FRKA 1Y11A 1ZM2A 1VQ5N 2DGOA 1VI7A 2F7TA 3RAMA 3QERA 2FGOA 4IOBA 1JJ4A 5T7BA 2KVIA 2AJQA 3BO4A 4J2BA 3FEZA 1QVGR 2UV8G 5GADP 3DLRA 2UXBK 4O3OA 3GSIA 3I1YA 3ZTPA 5HMWA 1MA7A 3Q89A 3VVTA 1BG3A 3JPPA 9ICIA 3ZZTA 1DLOB 1HIWA 4H0PA 1YTAA 1UT8A 2PIIA 2ZE2A 1YT3A 4Z7YA 3I28A 2MGZB 5DM7Q 4M9GA 4XH5A 2EW9A 5JVHQ 4WFAQ 2I7NA 3KHRA 2KJ8A 2WB1C 2FF3B 1VDHA 1HNWF 1ZAWA 4FZVA 3UXPA 5EX0A 4Y2AA 5DBBA 3R9LA 1FRXA 3M8SA 3EVOA 1TV6B 2P9IB 4RW9A 3PIOL 4DU7A 1SS6A 3RJMB 1SV5B 1W7WA 2GWSA 3ATUA 3O8MA 2CQCA 2J0QD 1CJVA 4OJ3A 2DTJA 5HATA 2CA9A 3OPKA 1BL3A 2XCPA 1NB7A 2LP4A 2K8AA 5H9EK 4BRHA 3KFWX 3CJ0A 2P6TA 3AOCA 4C3KA 3NAHA 4IJAA 3CDAA 4J9RA 4DTPA 1CJKB 1ESVA 1SI9A 3QXGA 4KRFA 4I7FA 2QSFA 1UMJA 2A19A 5KFSA 1SWWA 2IC3A 5F0UA 3T1AA 3R1HA 4CDGA 5LMUF 5AQMA 4ANEA 4KGZB 1V5IB 3CCRS 3QYYA 4RQ1A 3QIPB 1RAAB 3QQCD 2DISA 2I5JB 2QFJA 3THWA 2F65A 1Q82T 1VAZA 3CCVN 4U7CA 2MQMA 2K4PA 2JEJA 2PFQA 3HX9A 5HR6A 4U95A 2RUGA 2NSCA 4BDYA 1VLOA 1ZQZA 4KTWA 4WZQA 4KLUA 4M47A 1H6KX 1ZQLA 2H5EA 1YJNS 5HOOA 4Q2LA 3CJQA 3DLLQ 1QQNA 4ZVRB 4AM6A 1NOYA 1NHKL 3HJVA 2GVDB 2HGLA 1RSCA 1FEHA 2F2AB 4OI6A 3EGVA 4M5MA 2LLZA 2H9ZA 1WHYA 2K3IA 4FYYB 4B3SJ 4P0QB 4LF6J 3JXUA 2Z30B 1JKHB 2OFHX 5AQOA 1BIUA 2YJFA 5AXLA 2H3FA 3IRUA 1GOAA 4MF8A 2ISPA 1LW0B 5KFMA 2OPSA 3H5XA 5FDLB 2E5LJ 3THXB 4TLQA 4PGXA 1UWBB 2WVDA 3OTDA 4LJXA 3VGUA 3BEGB 3FBEA 4K4UA 2IJNA 7ICSA 2YPYA 1JXBA 2FZGB 2ZIWB 3KKRA 2MSNA 3I87A 3V5RA 2XO7A 5HVHA 1YJ7A 2P2CB 3RH6A 3G6XA 2GO8A 3LAKA 4CI6A 3HLUA 4F71A 5HP4A 1KNZA 4JK1A 2D0CA 3OL9A 4ZP9A 5E3AA 1WOPA 4WFBQ 1U47A 5I42A 3H4BA 1MMNA 1KSPA 3KWMA 5DDMA 4ED4A 2VASA 1NO8A 4KH0B 1X9SA 1OPZA 1QAJA 3OTQA 2Y1LB 2I38A 4C7QA 1FKOA 3SDEA 4B02A 2J7UA 4JKHA 1NJIO 2BV3A 4UB5A 1NDPA 3D0PA 4YMMA 5CQGA 3D4JA 4QZGA 5A6WA 2YWGA 1QQMA 1A77A 3FKBA 3BSAA 1ZM4A 4O8UA 5IT9U 1S0MA 8ICLA 1J5OA 4DV7F 2VG6B 3L8BA 3C28A 4X66F 3VA3A 4YQWA 2MLXA 4CM2A 4M3RA 3HT3A 9ICNA 1LWCB 4W5TA 3L3UA 4B3OA 3WXMB 2CPZA 4FYWB 4N8NA 3HSCA 3KLFA 3GOIA 1N34J 2O66A 3BPDA 3CDUA 5EUHA 3LM2A 1VC6A 4B3MF 4GY2B 4O5KA 3MEKA 4QQBA 3ENOA 4Y2PA 1NM2A 2EAOA 4ED1A 4CFBA 4WWSA 2VKRA 1U6BA 3GZFA 4WP8A 2GQ2A 1T6DA 4GKJJ 1VQ5S 2OTJN 1M5OC 2E8PA 1OY6A 1NB2A 1HQ2A 2QE5A 4OYXA 3PW0A 1SC3B 3NF6A 3FCWA 4Z6CA 2VODA 2CDQA 2J6UA 3N7RC 5KGWA 5JU5A 4FJKA 3AN1A 2DIUA 1WSIA 5CZ1A 3GDXA 4RW4B 1ZQMA 2R8KA 5HNKA 5ALEA 3VQBA 1G6BA 2DNPA 4E1MA 1E6VB 5K5MA 2ZIXB 4K5SA 2QB0B 5F8HA 4FZLA 2F1HA 3DLJA 5FPNA 2QV6A 3SYZA 3V6HA 4WU2A 5DJBA 2OIHA 2XC9A 4IH5A 1R3NA 4JI6J 4Q5VA 3PFOA 5ETNA 4AHCA 2F44A 3CHWA 1WC3A 5JVGQ 5F9NA 4DUYJ 3QLHB 3LH2S 2YNIB 2R7UA 3PXGa 1S9FA 2PGCA 1RHRB 1EQMA 3KHYA 5DQGA 2RLTA 5KFEA 2P9IA 3WK5A 3NS5A 3QUQA 4FZNA 4NMLA 2EBGA 4OX9F 1N32J 4M95A 4O0IA 2ATLA 2HIYA 4BG8A 1R59O 4BVOA 2WVEA 5L39A 4RW7B 2DNQA 1EQ0A 3CMES 1ZBFA 2KZ3A 1L3UA 4WKRA 1Z2ZA 3E0FA 1L8LA 3SSRA 4FSVA 3IKMA 1PSDA 3BQ0A 1F2HA 3DNCA 3TR5A 5B5EU 2GWJA 4C8KA 2XCAA 3CIMA 2H4WB 3OR2A 3MMCB 4USIA 5GAHI 1CJKA 1U9LA 5J1PA 2Q1LA 1DTQA 1WTBA 3EKSA 3OUYB 2KOBA 3HFZB 4IWVA 1LVHA 3K8VA 4Z4GA 1AXQA 5K14B 5L1JA 1NZBA 7FDRA 5DGBA 3EMTA 1NK7A 2FGCA 2HIQA 4XPEA 1KRPA 2CPEA 7ICKA 2ZITA 4P9SA 2ATQA 3E3XA 4CECA 2ZQBA 4M5IA 4LFAK 2LYVA 9ICTA 1N60A 4V19J 4ED0A 4YEAA 4YS2A 1RJJA 3LGNA 1ZPWX 2W24A 1Q86T 2F96A 4DR5J 2XZDB 2ZBIA 3QEPA 2NZCA 3CB4A 4LF5J 5C42B 1K5OA 3UR0A 4YNQA 1UPMB 2VBZA 2WVBA 1NGHA 4F5PA 2C2DA 3NAEA 5D49A 1R8AA 1HBMA 1RT6B 3DRPB 2F4VF 5AQSA 3MCOA 4O3QA 4UBBA 2KMDA 3IMQJ 3IGNA 3KUEA 4I2JA 2NO5A 5EE3A 2YHXA 2L5YA 3UVJA 3UQSA 3QJJA 3AV9A 1X6JA 1BLUA 4DQSA 1N33K 3GFZA 3FGUA 4PQAA 2EK6A 4P7TA 3TJAA 1BWVA 3DXMB 4OYBA 1S6OA 3POTB 1WOSA 2PKEA 1VQ6S 1B99A 3O2IA 4RQ3A 8ICNA 3MGVA 5J8YA 3MM8B 4LBPA 1QJHA 3PJ9A 1Z19A 4K8ZA 5C15A 3CNHA 3OHBA 4AE5A 4OI0A 4DX8H 3TEHB 4HR2A 2HZAA 3N9UC 3DU6A 5JLHA 4PG7A 4Q8EA 4NZ7A 3W2WA 1X4GA 1C1BA 2ESEA 3R5GA 3ZSWA 1HJRA 2BANB 3TJ8A 3QNWB 3TAQA 1GTHA 4BRFA 1XEZA 3N7SC 3DM2A 4WYBA 1TE2A 4OGEA 3G8TA 1R0AA 5HRNA 4EP4A 2QWMA 4R5PA 2WB4A 1K8AO 2HVZA 5IWAJ 1QZ6A 1FWLA 3OW2R 3ENAA 3ZTQA 1E6YB 1U1OA 3OTBA 4QYZJ 3RF9A 1XC9A 3C5GA 3U3GA 3QEVA 4KGVB 2AU0A 2HFNA 3GILA 3RRKA 4LUBA 1WOOA 5IIMA 3JS6A 4OKJA 3F2CA 2MTLA 2LEPA 1ZD2P 3QJLA 5KFYA 1UKUA 4MFCA 3VZHA 3ETLA 4DSFA 3UNGC 2F40A 3LP0A 4BRMA 3C6TA 1X4HA 3AA3A 4B1UB 4JRQA 1BPYA 1FWKA 3JQJA 4QIGA 1TU0B 2VUGA 2LPEA 2QK9A 5AFUA 2OPQA 2MJUA 5E41A 3MFHA 1T9UA 4L8RB 3LW5C 3SZ2A 2X6NA 3A5OC 1NHVA 1XNRJ 3N4QA 4BACA 2VCPA 3QU5A 5M1OA 5ALNA 5A8KA 3L6QA 3I5BA 3I76A 4USTA 3TADA 2NZ4A 3VA0A 1WUUA 3IG1B 2D3UA 1AW0A 4LFCK 3J81U 2BCVA 2B3TB 2D3OR 3CCSS 3AQEA 3AD8C 2W7OA 4ZPCA 5KT2A 1IKVA 5ALIA 2AJFE 4RW4A 3LDSA 2RD5C 4RNOA 2HKEA 1PJ6A 4FVCA 4DV4F 4O5BA 3EX7B 1EHWA