4DQRA

Ternary complex of bacillus dna polymerase i large fragment e658a, dna duplex, and rctp (paired with dg of template) in presence of mn2+
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 203
structure length 580
sequence length 580
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4dqrA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4dqrA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dqrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dqrA01
4PUOA 9ICHA 3EY1A 4E7LA 3OHAA 1HJPA 1HMVA 3KD5E 4KHWA 3PR4A 4CF2A 4H8KA 2XRIA 2R8HA 1HYVA 4E3SA 3T5KA 4DU3A 2QK9A 5CZ2A 2HHVA 1YTUA 5KFFA 1C7YA 4O3RA 9ICIA 7ICLA 3OGUA 2YV0X 4Q8EA 4PA1A 3C2KA 4F2RA 1A5XA 5KT7A 4YMMA 1HYZA 1WAFA 3QEWA 5HMMA 4DSIA 9ICMA 1YT3A 2A1JA 3NFAA 4KREA 1T3NA 4J2AA 4RQ0A 2R7YA 4DFPA 1ZQRA 8ICQA 4I2AA 4O5EA 4RUCA 3Q8KA 4O44A 1TKTA 4FLTA 1ZQMA 4Q0BA 3Q8PB 1Q8IA 3U3GA 1ZQOA 3TR8A 4F93B 2BGGA 4CE9A 1VSEA 3SUQA 1BI4A 5J0RA 4IG3A 4Q5VA 4PHDA 1I39A 1RBRA 3V1QA 4KLUA 2NUBA 2V4QA 4DSLA 5J2DA 2W9CB 3T19A 4CJQA 3PY8A 3O3HA 3OYDA 4CHOA 1ZQVA 5IIJA 4G1QA 1RBTA 2ZJ8A 5CB1A 2LSNA 4JS5A 3B6PA 3HPHA 4GXKA 2ALZA 1RBUA 4GW6A 2Z1IA 4CF0A 2AJQA 5KG7A 1PZNA 3K2PA 1XSLA 7ICHA 4IKFA 2YKNA 4AHSA 5KFGA 3UXPA 3LPUA 4J9NA 5D4BA 4RQ2A 4QZ9A 3WNEA 3ZSWA 4Q44A 2HHWA 2P1JA 1RT4A 2IA6A 3THVA 3AVCA 3SJJA 2G8KA 3VN5A 2FMQA 4DFMA 3PW0A 3ZDEA 1BQNA 2J6TA 2O4IA 3ISBA 5JUMA 5CWRA 1KFSA 2X6NA 1CUKA 4XQ8A 4JRPA 3L8BA 5J0YA 4M9HA 2HMIA 5K14A 2HNDA 3E2EA 1RNHA 3ZSXA 5E41A 3O4NA 3SUNA 1DTTA 1RBVA 3L2VA 1S0OA 5DDMA 5J0XA 8ICKA 4XIUA 1T03A 8ICNA 1JLGA 3T5LA 4KHYA 4IBNA 4F91B 5L9XA 4RPXA 4O3PA 3HM9A 3TQ1A 4CGHA 4MFCA 4CEEA 1CXQA 5KFZA 4FO6A 3RMBA 4BDPA 4ZH4A 3MFHA 4QWCA 1C6VA 4JV2A 2XHBA 3M9NB 3RJHA 3KK1A 1ZQNA 3K5LA 4O3OA 3AO5A 4H4MA 2G8FA 4HUGA 3VQ8A 5DB6A 9ICUA 9ICEA 5DB8A 1C0TA 4DQPA 1CXUA 7ICRA 3HSTB 1HUZA 4FJKA 3GV7B 1RCHA 5HHHA 4H4OA 2OA8A 2AGQA 4ELVA 4KLEA 4AHTA 5L1LA 3TI0A 9ICSA 1IG9A 3D0PA 3KKSA 4M3YA 5KG1A 4O5BA 3RH4A 4E0DA 4JV0A 5KFIA 3KK3A 2BE2A 2DTUA 4F50A 3PW2A 1LW0A 1BPZA 3OS1A 4KLOA 5CP2A 5D49A 4L8RB 4FJ7A 1IKXA 1ZQZA 1EP4A 3L2RA 3L2WA 4DTXA 4F4YA 4CJ3A 4W5OA 2I1QA 4GXIA 2E4LA 1A5WA 3UQ2A 4FJ9A 1TFRA 1CEZA 5J2PA 1HRHA 4E1NA 2QKBA 4ED8A 3SI8A 3PX6A 2Q0ZX 3PMLA 4NY8A 4CESA 1VK0A 3I0RA 4I9LA 4J2BA 4FLWA 3TARA 3NGIA 1U04A 3V4IA 3RAXA 4FS2A 5C42A 1ZQAA 4FJMA 3ZT1A 1VSFA 3LK9A 4ELTA 1SZPA 8ICTA 4UQGA 4HTUA 9ICGA 1IM4A 3SV4A 3V7LA 4CJWA 2JEJA 4JLHA 2NRTA 2BQUA 3FFIA 3B0YA 4ED1A 4CGJA 5F9NA 4ED2A 3NF8A 3TWHA 4EZ9A 5DQGA 1X9SA 3RH5A 3AVBA 1NK5A 5HP4A 3CFPA 3DOKA 2VA8A 5J2KA 3ZT2A 1VSIA 2B21A 1U47A 2PYLA 4C8KA 5IIOA 4RQ8A 4F5PA 1ZQQA 1TV6A 2FBTA 2P5GA 3RAQA 3LANA 1BL3A 5J2IA 4DU1A 4CK2A 1XHZA 2XCAA 3MR3A 1ZQFA 2ATQA 2HB5A 3C5GA 4DWIA 5EWFA 1ZQCA 3JYTA 1X9MA 1TKXA 3V7JA 4Z4FA 4ID5A 5HLFA 4ZTJA 3QNOA 4Q8FA 4QCLA 4KN4A 3M9MB 1EETA 4CJTA 2P5OA 1D5AA 5KFKA 1Q9YA 4Y1CA 3BQ2A 3DMJA 4TURA 4KLLA 4CHZA 3AO3A 3RMAA 2FPLA 1TKZA 5IIKA 3ZCMA 4O4GA 7ICMA 3VQEA 3B0XA 3AA4A 3AO2A 3S3MA 4DQIA 2RPIA 4KLSA 2VWJA 4PGYA 4B9VA 3ZDBA 3U3YA 2BDPA 3SCXA 1SKWA 4KTQA 3ZSOA 3DLKA 1S1XA 2HVHA 1LAVA 2KN7A 5KFSA 1BQMA 1S9GA 3HX0A 3KHHA 3ULDA 3UQ0A 4KAZA 4QAGA 4DU4A 3MABA 3RMCA 4KLIA 3MXJA 4R63A 3NF6A 2V9WA 3F9KA 4E1MA 1XU4A 1UA1A 9ICQA 3RJKA 3AVHA 2C28A 4MQ3A 2OPSA 4FW2A 5KRSA 4R8UB 2OPRA 3RMDA 4J2DA 5KG3A 4F3OA 4IFVA 2C2DA 3RRGA 1LW2A 4IRDA 4M9JA 4I2HA 2QXFA 1S0MA 1ZQDA 5CZ1A 1U4BA 1B22A 4KN7A 4KB0A 5C5JA 4QZDA 2Z1GA 4GLXA 4ECQA 2XY8A 5KT2A 5DB9A 3DLEA 3HW8A 5HP1A 4CJFA 1LWEA 3V72A 4OGCA 4DF8A 4CF8A 4OPJA 5J2BA 3NF9A 1A76A 4FBTA 3NGYA 4PGQA 3MAQA 3LAMA 1SL0A 2FPKA 5TZVA 5J2AA 3NCIA 4QZFA 4JRQA 3AA5X 2IHMA 3MEEA 2HHQA 2Q3SA 3V6JA 4FLZA 4RW7A 1IO2A 3ISNC 3ZDDA 3KJVA 3AVLA 1S5JA 4DF4A 4LH5A 4DQRA 4QW9A 3CFRA 2ZUCA 3A2FA 4RW8A 5SWMA 1RBSA 2VG5A 4LSNA 4CFDA 1BIUA 4NLGA 4K4GA 3SZ2A 4FM0A 3RWUA 3KLHA 4BWJA 3OHBA 1WSEA 4GC7A 2FPMA 3PW5A 4B9LA 2GUIA 4CEZA 5DDYA 2QKKA 3GDXA 3OYMA 1SL2A 1IKYA 1QSYA 1NOZA 1GOCA 4E89A 4FJIA 1WAJA 2PY5A 1JLQA 1EX4A 4EBEA 4C8NA 4LSLA 5IIIA 3VQPA 3DM2A 4RT2A 3T5HA 2JEFA 1HNVA 5DQIA 5DBAA 3HVRA 1W9HA 2ATLA 2FBYA 3KTQA 4M41A 4ICLA 1ZJMA 4QZHA 1SKRA 1ASVA 3V6KA 4F4KA 3AO1A 4O0IA 1DTQA 3LALA 3QLHA 3OJSA 4I2EA 4DMNA 1YVUA 3DRPA 1VSJA 2FBVA 2FLLA 3M8QA 3F73A 4M42A 5KT3A 3PO4A 4YR3A 3CG7A 4DS5A 3O3GA 5DG7A 4NCGA 4UB2A 2HNZA 1HQEA 3Q8MA 3ISCA 3OSPA 3QNNA 2JZBB 4HVJA 3C1ZA 3DRRA 3AU2A 4YD2A 3MGHA 4DSEA 5EOZA 2DPJA 4MF8A 5HRNA 5KGXA 5HROA 4KHNA 2G8HA 4Z6FA 3N97B 5KFMA 4TSXA 3BGRA 4DL7A 4ZHRA 3BJYA 1EXNA 1ZBFA 3TAEA 8ICXA 3H08A 1ZQGA 3WNHA 1B92A 1B43A 2NRXA 1S10A 4CEBA 3PR5B 3OJUA 8ICBA 4TQRA 4P4MA 1LWFA 3JPTA 1TK5A 5C25A 2GV9A 4KRFA 1UOCA 2B4JA 4Q43A 3QE9Y 5I42A 3QZ8A 8ICIA 4YNQA 4QZ8A 3BQ0A 4ECVA 2XC9A 4M3UA 1DOQA 3UPQA 3HPOA 3LP0A 4XRHA 4TUSA 1QQCA 2KZMA 5D46A 4J9SA 5DLGA 9ICVA 4RQ1A 1BIZA 2ITGA 1S1WA 3GILA 4DL3A 3TANA 3OYHA 4X5VA 1FKPA 2BCQA 2NRWA 1LB2B 7ICEA 2BCVA 5J2JA 2KFNA 3V9XA 4MEXA 4CCHA 4EBDA 1NK6A 1L3VA 1D9DA 3VA3A 4ECSA 4I2BA 3AVNA 1VSHA 3N4MB 4B8AB 3QEIA 4FK0A 2J6UA 1HPZA 3QETA 4MFBA 4XUSA 2XO7A 2F8TA 5CR0A 4EBCA 1XO1A 4KLQA 1QHTA 2G8IA 1N5YA 1DLOA 4NM2A 3V1OA 1QLNA 1RDCA 4IFYA 3ZD9A 5IINA 5J2GA 3C5FA 2AGOA 1TAUA 1Y88A 4M3TA 1BPXA 4NYFA 1KVBA 4CF1A 1ZQPA 3SPZA 3VQDA 5DBCA 3TAPA 2IOCA 3BQTA 1ZQKA 3ZD8A 4I28A 1FKOA 3MECA 4OKJA 1EKEA 2ZUDA 4RQ5A 5KG5A 1XSPA 4ECYA 5EWGA 4UBCA 1Y97A 2YHBA 1DGSA 3KKRA 4YN4A 4CEOA 5T7BA 4W5QA 3SUOA 3HL8A 4DTNA 4FLXA 5KFTA 3PW4A 2P6RA 8ICRA 5C24A 5HHIA 1ZQUA 5L1KA 4QWBA 4CEQA 3AA3A 1TL3A 4FZXC 4CJSA 7ICGA 8ICWA 5KFLA 2D0CA 4I2GA 4RQ7A 4CIFA 3H8JA 2X74A 4R8UA 4J9KA 3QIPA 4Y1DA 1WSGA 3K5NA 1RYRA 1BPYA 4YCXA 2IBKA 4HUEA 5KG4A 2DFEA 4HUFA 5KFUA 2F1HA 2IC3A 5FROA 5KFAA 3RB6A 9ICOA 5DG9A 4W5RA 3KLEA 4ED6A 5KTQA 2BKEA 2WOMA 7ICJA 7ICUA 4RUAA 4KLTA 1NK7A 2GBZA 3GV8B 4KLGA 4OKEA 4NLKA 3OYGA 3M9OB 1TVAA 1U9LA 2Z1JA 4KI4A 3V81A 4FJLA 8ICEA 2HHSA 4YFKA 1ZQLA 1ZBHA 8ICAA 3JPSA 4CERA 3ZSQA 4O3SA 4PWDA 3PNCA 4P4OA 3L3VA 9ICPA 4OLBA 3EZ5A 2IDOA 2MUTB 2R8JA 3E01A 4F4ZA 2Z1HA 1RT6A 3K58A 5J0SA 4ECRA 4PPXA 2ASLA 1ZQHA 3WNGA 4NLZA 4E7HA 3MDAA 1O1WA 2WONA 3TAFA 5DKWA 2AGPA 3TAGA 4KITB 5DG8A 2Y1IA 3VQ6A 4M6WB 3S3NA 3HWTA 1Z25A 4DOBA 4OGEA 4UB4A 3QINA 3TAMA 1RT7A 4QZCA 3T3FA 4DSJA 1ASUA 4UB1A 2I5JA 1HYSA 2FBXA 4KV8A 4KMUA 3V6HA 3PUFA 4DOCA 3OS0A 1HQUA 3Q8LA 2JGUA 3NDKA 5KFOA 3CM5A 4YR2A 3K57A 4B9TA 4EZ6A 5HRSA 9ICCA 1YTAA 3C95A 5J0WA 3RBDA 3RB3A 5KGWA 2ISPA 3VQ4A 2VANA 2IHNA 1N48A 1WSIA 5J0QA 3MR2A 4C8OA 1JMSA 7ICSA 2JZBA 7ICVA 4MEYA 5CJ7A 3VQAA 3PX0A 1XHXA 2ISOA 1U48A 4ED0A 1LWCA 3K59A 3ZSRA 1NJYA 3ALYA 4RPYA 3JPPA 4DQSA 3OS2A 3OYLA 5KT5A 1T7PA 2OPQA 3GIJA 1QS4A 4FJJA 4RNNA 2YNHA 3CM6A 4CFCA 2ZTCA 4KTWA 1IKWA 3IAYA 3H8WA 4DQQA 3AVAA 3O3FA 3G6VA 2KTQA 3DOLA 3MBYA 3KLFA 5J1EA 2B6AA 3S3OA 5KFNA 3OY9A 1BI4B 2UVRA 4KPYA 1LV5A 3CYMA 5KRTA 4CHNA 4KB1A 9ICNA 4QZIA 1MC8A 3Q8QB 4MFFA 1S0NA 5FRNA 2BQ3A 2RDJA 2W8KA 1JL1A 1NJXA 1KCFA 4CHYA 3SQ0A 1JKHA 4GXJA 1Z26A 4DFJA 1CLQA 3HYFA 1X1PA 9ICKA 3BQ1A 2X78A 3L3UA 4N76A 3LDSA 3C2LA 5KFRA 3V7KA 1A5VA 4LD0A 2IGIA 4O3NA 2YHAA 4BWMA 3GQCA 4OPKA 2BCRA 3IG1A 5DMRA 2VA3A 4FK4A 1Q9XA 9ICJA 4RNOA 1ZQTA 3OYNA 2W9CA 4I2FA 4IRKA 2ZJ5A 4F8RA 7ICNA 1GOAA 5KG2A 3I8DA 3HVTA 3ZSYA 4Z4IA 5KFXA 3ZSZA 3TABA 3AVMA 5KG6A 3D45A 5SZTA 4DLEA 3GFKB 1J54A 5KFQA 3FYHA 4CJUA 4M0AA 4LVSA 2C22A 4ED7A 3RRHA 2FLNA 4DO9A 4DS4A 1NK9A 4FZYA 3DLHA 1QE1A 2PYJA 1RPLA 5J0PA 3NF7A 4NM1A 2ZUBA 3H7IA 4BXOB 2OZMA 4M9NA 1NKBA 5KFEA 4QWEA 2OPPA 3MXIA 4O3QA 3EYZA 4CJLA 4FW1A 1ZQEA 4KLHA 1L3SA 3Q8RB 2HNYA 1WSHA 1N6QA 4K8XA 1RXWA 2BPFA 9ICLA 1XSNA 1BHLA 2G8VA 4I2JA 1RILA 1HNIA 1JXEA 1MU2A 1QSSA 1H38A 5JS2A 1W0HA 1TAQA 4ID1A 2DY4A 3IM1A 1UWBA 5CYQA 3KK2A 3QERA 4J9RA 3AO4A 4DTJA 2XCPA 2EHGA 4B9UA 3LPTA 1KRPA 4Z6DA 1HUOA 3RR8A 4AH9A 3PVXA 3L2QA 4RNMA 4I2IA 2PI5A 3MGIA 1ZYQA 1RXVA 2JEIA 2YNFA 3OYBA 4KLFA 2HHUA 4W5NA 4FS1A 9ICBA 4CJVA 3V9ZA 2PFQA 3PX4A 5CY4A 4KLDA 4NYNA 1FXXA 1VRUA 4CFBA 4PH5A 3OYCA 2F96A 1ASWA 1S1UA 4IQWA 3SQ2A 3KHLA 4QW8A 5J2NA 4RU9A 1KDHA 4YMOA 4KLJA 2RKIA 1SKSA 4RG8A 3HXMA 5CHGA 3GIKA 5KT4A 3DYAA 3MR6A 4IDKA 4LZDA 2MAXA 1NOYA 1NK0A 4ECZA 3ORYA 4IG0A 2KW4A 3AVJA 4R5PA 3C1YA 4G3IA 2HVIA 4UAYA 2D5RA 3UXNA 1TK0A 4RQ3A 3K4GA 3MXMA 1JIHA 1XC9A 3BDPA 3AVGA 9ICWA 2F8SA 2MUTA 4R65A 4CHPA 3ZT4A 3PV8A 4P2HA 2FMPA 4M3XA 3QEBZ 8ICZA 4IQUA 4YFUA 2P51A 1LAWA 4M45A 4N56A 2ASJA 2R8KA 8ICOA 4RW4A 3U6FA 1L3TA 3JPRA 3RH6A 3CFOA 4GC6A 4Z0UA 3UIQA 5KFBA 1KFDA 4DOAA 1JLBA 3RBEA 4DL4A 3RJGA 4M6WA 1KSPA 1S1TA 3LWLA 2JEGA 4YXMA 5KG0A 3HT3A 4C8MA 1RTJA 4OLAA 5J0UA 5JS1A 3V9WA 4FXDA 4TQSA 1AROP 2ZQBA 3KLGA 4TUPA 3GIIA 4RZRA 2ZTDA 3T1AA 4KHSA 3NGDA 1RDAA 3HK2A 4XA5A 2M9NA 2W8LA 4JV1A 1BPDA 4IR9A 3TFRA 5DK5A 4K8ZA 1JLEA 2G8WA 2PXIA 4CF9A 1G15A 1Z00B 3QEPA 2X6SA 2KQ2A 2Y1JA 1D8LA 1HJRA 4PHPA 1IH7A 1WCNA 1CZ9A 5DGAA 3SYZA 8ICVA 4QZGA 4F5NA 4IR1A 2A1RA 1ZQJA 1B9FA 1C1CA 4ELUA 1WNSA 4FLVA 1K1QA 3KHGA 5J2MA 3RB0A 1MQ3A 4CGFA 3ZDAA 5IILA 1RT1A 3HO1A 4I2DA 2D0AA 2OYQA 2F1IA 3NH1A 1RDDA 5DGBA 1MSWD 4YMNA 5KFYA 4C8LA 5KI6A 3G10A 3NBPA 5EWEA 1REVA 4FJXA 3SNNA 1S97A 5I3UA 4DTSA 2JLEA 4WE1A 3AVIA 4GVMA 4RW9A 1BCMA 3ETLA 2BPGA 4N5SA 1ZBLA 1NJZA 4O0JA 2DFFA 4ECWA 3H8SA 2ETJA 1ITGA 4PHAA 3QEXA 8ICYA 3GV5B 4YG2A 1KEJA 3JPNA 4AHCA 3DRSA 3NE6A 3RB4A 4NCBA 4HYKA 4K4HA 4CECA 4I2CA 2NRZA 4OKKA 4Z4EA 4B3OA 1KVCA 4BE2A 5CA7A 4BDZA 4I27A 1EXQA 5DBBA 1MQ2A 4CJPA 2AQ4A 3VQBA 4YD1A 4Z6EA 4FBUA 4LH4A 1X2IA 4HHTA 4JS4A 4FVMA 3UXOA 4YR0A 4KHQA 4M04A 4QZAA 1SV5A 2UVVA 5HRRA 3LP3A 4CFAA 3LDAA 4E19A 4DL2A 4KHUA 2BCUA 3EW9A 3IRXA 3PMNA 4IQTA 3LWMA 4ED3A 4FCYA 1UT8A 3I0SA 2RDIA 3M8SA 3P1GA 3M8PA 4YXJA 4PHEA 3HPGA 2BR0A 4CIGA 1BPEA 3QO9A 1S76D 1RZTA 3P83D 4P4PA 1ZJNA 3QIOA 3VQ7A 1RTDA 1ZQXA 4E7KA 4O9MA 2W9BB 4BXOA 3AU6A 4UAZA 3RJIA 1ZBIA 1JXLA 3IHQB 4YQWA 4EYIB 4FLUA 2W9MA 1K1SA 1UAXA 1VSKA 4CJKA 2UVWA 1SL1A 1F21A 1D8YA 5BOMA 4I2PA 3RJFA 4KLMA 4PQUA 1FK9A 3SI6A 1TKDA 1ZQYA 1COOA 1S9FA 4LY7A 4QZEA 9ICTA 3QZ7A 1JL2A 3VA0A 2KZ3A 1T8EA 3MEDA 5DQHA 1R0AA 3H4DA 4DEZA 4J9LA 5DLFA 8ICPA 4QZBA 4DTOA 4QWDA 1X9WA 4KI6A 5J2QA 1UA0A 3WNFA 4J9MA 4I7FA 3SPYA 4EP4A 3AV9A 4B08A 3SQ1A 1TK8A 4K4IA 2PZSA 4CHQA 4ZTFA 1NKEA 2C2EA 9ICRA 4I9QA 1KLMA 4EEYA 4M9LA 2F1JA 4DL6A 9ICXA 1RT3A 4CJ4A 3LP2A 3SV3A 1D9FA 4JUZA 1V9PA 4RT3A 3HP6A 1I3AA 3NGZA 3C2MA 4FM1A 3V6DA 5J0TA 1C0UA 3DLGA 3HJFA 4AILC 3AA2A 1JN3A 4M3RA 1RTIA 3NHGA 1VSMA 3C6UA 4B9SA 3EWAA 5IIMA 4DTUA 2V4RA 4ECUA 7ICIA 3OVNA 1S0VA 4BACA 4R64A 3H4BA 5J2HA 4CK3A 4CEFA 1U49A 4BE1A 4NCAA 1Z3EB 1QSLA 1KVAA 4FK2A 4NLNA 3EPGA 5FRMA 3OSNA 4UB3A 2AU0A 1J53A 3PO5A 1IKVA 1QTMA 3ZT0A 3K75D 3G6YA 4O55A 2DFHA 4UAWA 4BE0A 4F2SA 1ZETA 1XWLA 3LP1A 4EP5A 4I29A 1C1BA 3KD1E 4DTMA 4FJ5A 2OZSA 2VG6A 3VQCA 4DTRA 2KZZA 3MR5A 1S6PA 4F92B 1WSFA 2B5JA 4FJNA 1U45A 1ZQSA 3MDCA 1S6QA 5BPCA 1JLFA 2R8GA 2PFOA 2ZE2A 1SUQA 5HMLA 2ZD1A 2A1JB 4MF2A 2ZJAA 4DFKA 1WCLA 4RPZA 4O5KA 8ICGA 2HHXA 2E6LA 4CEAA 5HBMA 2BANA 4J9OA 4FM2A 4FYDA 1K6YA 1ZQBA 3VQ5A 5J2FA 3G0ZA 3DLBA 1IXRA 8ICJA 2ZTEA 1NK8A 5DB7A 2BGWA 2IMWP 5KFJA 3RJJA 2VG7A 3LZIA 1L3UA 9ICAA 4Z4HA 4ECXA 3O4QA 4BGDA 2OWOA 4PY5A 1CZBA 3ZT3A 4CJ5A 4CJEA 3ITHA 4FJHA 4CK1A 5KFCA 1KFTA 1Z00A 2O4GA 3MFIA 1WN7A 1T4GA 2XY6A 3QEAZ 3C21A 3ISDA 1JLCA 4AHVA 2GWSA 1ZQIA 2YNIA 4F5RA 4KFBA 3ASMA 1TL1A 4E7IA 1NOMA 3T5JA 4LZGA 4DSFA 3C6TA 4OJRA 4DLGA 1VSDA 2W9AA 1WSJA 4RW6A 3CQ8A 2BHNA 1NK4A 4CIEA 7ICQA 3V1RA 5KFDA 2HW3A 4DTPA 1C0MA 2XGQA 1N56A 1A77A 3AUOA 4Z4CA 8ICFA 2XGPA 4F5OA 3V9UA 1TVRA 4EYHB 2A1SA 4I2QA 3C94A 3KIOA 3NAEA 2VA2A 3G6XA 3SQ4A 3IS9A 2RF2A 1S9EA 3AVFA 4YP3A 2FLPA 9ICFA 5KT6A 2J6SA 5FDLA 2PI4A 3AVKA 4FLYA 2DPIA 4AHUA 1L5UA 3K5OA 3QESA 3NH0A 8ICLA 4KO0A 1TGOA 2NRVA 2R8IA 3OYIA 1S1VA 4FJGA 2P6UA 3JPQA 8ICSA 3OYEA 2YNGA 4DSKA 2PFNA 3K5MA 4JWMA 5D3GA 4E7JA 1XI1A 1RT5A 1S77D 5BOLA 4O5CA 3H40A 4F3TA 1BCOA 2UVUA 4NXZA 3ZSVA 1NJWA 4Z6CA 4M47A 1KTQA 2XY7A 3SUPA 2KFZA 3KLIA 4UB5A 1JX4A 4J2EA 1TV9A 4QWAA 4DL5A 2E6MA 4KKOA 2BCSA 1J9AA 1GOBA 8ICCA 2C2RA 3TAQA 2EX3A 1UT5A 3OYFA 2I9GA 3VQQA 4YVZA 4OVLA 4B8CA 4Q45A 4F4XA 8ICHA 1BGXT 7ICPA 4JWNA 3TFSA 4J9QA 2PFPA 4CGIA 1J5OA 2WTFA 3DI6A 3VQ9A 1RTHA 4QOZB 2IAJA 3HP9A 3RTVA 5J0OA 1BPBA 5J2CA 2W9BA 2AQ0A 3KHRA 7ICOA 3OYAA 4M2YA 5HNKA 3RR7A 2ASDA 2H5XA 2YKMA 2DFLA 4BDYA 3RJEA 4F4WA 4CEDA 5J29A 3LAKA 3NTUA 1JLAA 4HCBA 1VSLA 8ICUA 3ZDCA 5KFPA 4CGGA 4J9PA 4AHRA 4JK1A 4RQ4A 1VRTA 4Z4GA 3L2UA 4HCCA 5F9LA 1BVSA 2VWKA 3FDSA 3LZJA 4RQ6A 4CGDA 1C1AA 3JSMA 4GMJB 4FZZA 5HRPA 2BPCA 4B9MA 4IRCA 4DG1A 7ICTA 4PGXA 4R66A 4M3WA 1WLJA 2IS3A 2FMSA 2D0BA 4IQVA 3C23A 5KFVA 4CJRA 2BQRA 2G8UA 1RT2A 1XS9D 2XY5A 4M9GA 3QEVA 5CYMA 2RN2A 1BISA 4W5TA 4UBBA 5L1JA 5J2EA 1KLNA 4TUQA 2HHTA 7ICKA 8ICMA 4B9NA 1RDBA 4KTZA 3M8RA 3S9HA 2LYHA 1T05A 5KFHA 1RYSA 3NH2A 1ZBUA 3DLRA 3MEGA 3EPIA 2FC0A 3PW7A 5L1IA 4N47A 3JPOA 4FJ8A 3B6OA 5EU7A 4N41A 1JXBA 3V9SA 2P66A 3OYKA 4F5QA 7ICFA 1B9DA 5KFWA 4ECTA 3OYJA 1ZQWA 4MFAA 2W42A 4M3ZA 3GIMA 1NKCA 3Q8SB 3P5JA
chains in the Genus database with same CATH superfamily
2O8CA 4PXEA 1WG1A 2D1KA 2F7VA 1O8BA 1QJHA 5FJ4A 3KD5E 4KHWA 1TYQB 1PCAA 3KLFB 2ZUAA 2K3IA 1HYVA 2GAGC 2DCLA 5F8HA 3IG8A 2HHVA 1CJUB 3V2UC 2EC0A 1YTUA 2P2CB 5KFFA 2E29A 2HS4A 3C8YA 4P2MA 4WU2A 9ICIA 2MZTA 4Q8EA 2HAIA 3WK7A 1VS3A 3HFVA 2E2QA 5KT7A 1HR0K 2KKHA 1U25A 3I8BA 4YMMA 3OT9A 1MWQA 1HYZA 1WAFA 4USMA 2N4DA 3DLLQ 3F2BA 2A1JA 1MWKA 5AICA 1IM6A 1T3NA 3AOCA 2CJXB 1A7GE 3GFYA 4J2AA 3KWIA 2R7YA 4DFPA 3D2EA 1ZQRA 8ICQA 3TEHB 2DO0A 1TKTA 4HHHA 3IV6A 4Q0BA 2CXYA 1Q8IA 2QA4S 2V6AA 2Q4TA 2AHOB 3TR8A 4F93B 4KHPJ 2VQFF 3H5YA 5JMNA 3ETOA 3P4IA 1VBKA 2JVOA 1JJ2R 1CJVB 2RQ5A 3CTRA 2VZ9A 6FDRA 1N5TA 3WKCA 4C4RA 3UDCA 1DGKN 3TSUA 5IIJA 4ACOA 2HFVA 2ZIXA 3CCZA 5GADI 3HPHA 2V63A 1VQ8N 4NXMF 5DM7L 3C29A 2VQFK 1AT1B 4WWSA 2AJQA 2YVSA 4O8UA 3OVBA 5EY4A 5KG7A 2OMOA 5ALQA 4WTOB 1W2IA 1Q0NA 2YKNA 4IKFA 3N0VA 5HQLA 2ZH8A 2K1RB 4XDDA 1V3ZA 3AQEA 4AT1B 4NWIA 4QZ9A 3WNEA 2V52B 3LL3A 1AXQA 2FDNA 3NCQA 3A5LC 5HP1B 2IA6A 5LJWA 2R7SA 4NXMK 3AVCA 1LWEB 3HKZF 2QE5A 1ZBSA 4CDIA 1DEJA 4BC9A 3NVZA 3FK4A 5GAEP 3DFEA 3I33A 2ZEJA 2O4IA 2EPIA 4FFDA 2V69A 4JRPA 5IT4A 3AA9A 4UAUA 4H5VA 4C1NI 3EUNA 3E2EA 1RNHA 1MWMA 1NHUA 2FZKB 3UE5A 3ZEUA 3NG8A 2D3UA 4DPYA 3SUNA 3L2VA 4A8XA 1S0OA 3ZLJA 4KHYA 4ZVEA 4F91B 5L9XA 4RPXA 2LM1A 3C28A 1ZXOA 3LDOA 1CXQA 5KFZA 1VAZA 4ZJLA 5DO2A 2JFKA 4ZH4A 1OH6A 4GO5X 5T7LA 3OLBA 4JV2A 4ZK7M 4A62A 4DR2J 2MKIA 1JLQB 1YKWA 4K4YA 5L8RC 2G07A 3Q89A 4CIOA 1T6DA 2QTDA 3ENQA 2F4VJ 4LBIA 5EX5A 3VPZA 1HNVB 3AO5A 4H4MA 4AXIA 3O6QA 9ICUA 1NSPA 1PVRA 5BYRA 2HBQB 5DB8A 3AN1A 4DQPA 4BRFA 3HSTB 4OX6A 5AKGA 3GFHA 5HHHA 3MCMA 4NLSA 5HJXA 4ZJQA 4OX8A 3QLHB 9ICSA 3D0PA 2LYAA 4M3YA 1C0GA 2BE2A 3OR1A 4P74A 3ZZTA 2QJ3A 4B6JA 1X4BA 1BPZA 3NAIA 3QXGA 4YOUA 4FJ7A 4DTXA 3CP8A 4Y65A 4PL2A 2E4LA 1VBYA 1ELOA 1IR2A 4FJ9A 2VOPA 1JLBB 1A9NB 5K9FA 4E1NA 2QKBA 3PEHA 2XMAA 2NXCA 2Y0SF 3RBXA 3PMLA 3I0RA 3PACA 3TP2A 4LF6F 4J2BA 2EC2A 4RUBA 3NGIA 1U04A 1LWFB 3X3UA 2H5JB 5G0RA 2B9WA 1ZQAA 1FA0A 4FJMA 5C25B 1S72S 2JGAA 2QWOA 2QLWA 3MPDA 1S8OA 4A47A 1SZPA 8ICTA 4UQGA 5E84A 4DV2F 1OYEA 3G9CA 2RB7A 4YB6A 4JI4J 2P5VA 3V7LA 4NEZA 5AKEA 3MM5A 2JEJA 2DHXA 2NYIA 3B0YA 4TKTA 3IM9A 4LF6K 3LP0B 1UFKA 2JWNA 1QAXA 4IOCQ 4K4XA 3CJ9A 1FJGF 5AM3A 5AQFA 1T9XA 1L8OA 1WC1A 4OYWA 4IL6U 4WP3A 1NMNA 3N7RC 2VCPA 2IJNA 5AE2A 3LANA 2G5HB 1AB8A 1OH8A 4CK2A 1XHZA 1M6YA 2FSNA 1FJGK 3MR3A 2FJEB 4B3TJ 2FE9A 2AZ3A 5GIPA 4C80A 4YDUA 5A0LA 5EE0A 4Z4FA 5HLFA 4FP9A 4QPXA 1RTZA 1U1KA 1ZTWA 4KN4A 4QYZK 4FKYA 2RS2A 4CJTA 2BRKA 2PN6A 1D5AA 4IFYB 5KFKA 3DMJA 2BOPA 2F7TA 4TURA 2KXNB 2CH5A 1NU4A 2DGQA 3BO4A 1HBNA 3ZCMA 4DV3F 3DJCA 5IWAJ 1K8AO 3KYLA 2CJAA 1IBKF 1SKWA 2Q43A 5E3AA 4DUZF 1Y00A 4DR1J 2RH3A 3R1HA 4OYXA 1NH8A 3WK6A 1S1XA 2RRAA 2KD1A 2YMQA 2P9LA 1XNQJ 4FOIA 3A8YA 1BQMA 3HSDA 2Z2ZA 3HX0A 3KHHA 1HA1A 2W11A 5C24B 1GLAG 4DV3K 1XMQJ 1CULA 4KLIA 3M2RB 2YHYA 3MXJA 5JU5A 2V9WA 1IBKK 2MY8A 3F9KA 1U09A 1EQMA 3GG1A 4JKBA 2GVZA 3MURP 3AVHA 4DUZK 5KRSA 3K8WA 2OPRA 3QO9B 3UN3A 1V5IB 3CCVN 4DKWA 4MN4C 4JHDA 2R7OA 3U02A 3UPFA 4M9JA 2KU7A 1U4BA 2DR8A 5L9NA 1FRLA 1HNZF 2XY8A 2E7WA 1HHTP 4A5AA 2Q0UA 2WOMB 4ANDA 3V72A 1NI3A 3AT1B 4WXWA 1SV0C 3QNMA 4OPJA 5J2BA 4O3MA 1PVQA 3OXGA 4BGBA 1IR0A 3VAGA 1SL0A 3NCIA 1NSKL 4QZFA 5A0YB 2HBYB 1R7IA 3L09A 3L4BC 1RA7A 1HNZK 3QYYA 1U6ZA 1ZM3A 2XSJB 4PWDB 4FLZA 1HBOB 3EN9A 2ZF5O 4WJBA 3ISNC 4WU3A 3DXKA 3G8TA 2B0GA 4QW9A 5KOWA 2HBRB 3MCPA 3CMES 3A2FA 1RBSA 1Y10A 2VUGA 4LSNA 4CFDA 1WSEA 3LP2B 3PW5A 2QKKA 3GDXA 4P9SA 2Z2LA 2PFFB 1UVMA 3M1VA 2E8PA 2EKYA 3HHEA 2VONA 1IKYA 5GTIU 1NOZA 2PY5A 4OHYA 3TA2A 3MF5A 4U6PA 3LDLA 1HBUA 3CC2S 1QD1A 2ZM6J 1NGJA 1NB2A 5IIIA 1SB3C 3VQPA 2KOBA 2E8NA 2JEFA 4H0XB 3FSYA 4ZCMA 1T02A 5DBAA 3AXKA 3AY9A 4P0PB 4KYZA 3C7NB 1W9HA 3KTQA 3R9PA 2I5JB 1HYSB 1CG2A 2V68A 4M41A 4ID8A 2GHWA 4ICLA 1ZJMA 4FPBA 4KV8B 1ASVA 1OH5A 3RF9A 3V6KA 5KPTA 4L73A 2CJ9A 2XLJA 4LF4J 2ASOA 8ATCB 4BJQA 3AO1A 4DX6A 1NGFA 4FE3A 3DRPA 3OL6A 1VSJA 2FLLA 4TYBA 4C98A 1NG9A 3PCOB 3PO4A 4P75A 5AQVA 2CRLA 3CG7A 4DS5A 3O3GA 1HQEA 3Q8MA 3D66A 3QNNA 3CRXA 2JZBB 4HVJA 3I28A 3C1ZA 1N2XA 4CO1A 5EOZA 1T95A 5HRNA 2B5JB 1VLOA 2OM6A 3L7UA 4Z6FA 3NEKA 4CBUA 4DI6A 2RQCA 1SC6A 3BGRA 3UM9A 1HFEL 3CULA 1F9HA 1EXNA 5AQSA 3TAEA 8ICXA 1ZQGA 3WNHA 2Y1LB 2XMWA 3IMXA 2NRXA 4HDHA 3H1VX 5AKIA 1GXLA 3IP0A 3VGVA 1Q16B 1WG5A 3MDQA 3TZWA 2GV9A 1UWAA 3JAMY 4O23A 1XEZA 4Q43A 3BGFA 5I42A 2H3VA 3BF4A 3LUYA 3G6EN 3QZ8A 1XR7A 3H98A 3FEYB 1YJWN 4ZN3A 1RBOB 1UEKA 3HPOA 5M1OA 1C2PA 1OYDA 3CPWR 4TUSA 1D4XA 3OTBA 1QQCA 2LDYA 3S7RA 4J9SA 9ICVA 2HLTA 3BBFA 3OYHA 2F2AB 4EELA 3IWNC 4YOEA 1MA7A 4OHZA 1J5EJ 1Z1VA 5BR8K 1BO5O 1HPMA 3E58A 4CNQA 4MEXA 4CCHA 4P2SA 1OY9A 2QA2A 1D9DA 1S99A 3D1QA 2DF4B 3KWGA 1UFWA 3AVNA 1JUDA 3K17A 5C7PA 4JV5F 3N4WA 3OHRA 2CDQA 1ZD2P 2R7VA 4MFBA 4PZVA 4XUSA 1ITPA 4PKHA 2QGFB 2VQEF 1QHTA 5ELZA 1N5YA 4WZQA 1NEEA 4XDCA 2YN4A 3V1OA 4JKGB 5J2GA 2AGOA 4IOCL 1WB9A 4JV5K 1Y88A 5FLXO 1BHNA 2LKYA 1U1MA 2HFOA 4RO0A 3GE1A 3MUTP 1IN0A 2ILZA 1ZQPA 4L76A 1FX2A 2HNYB 1VIXA 2VQEK 5DBCA 2IOCA 3DDIA 1FKOA 1MU2B 4OKJA 1EKEA 2ZUDA 2M7SA 2KT3A 4UBCA 1NDPA 2YHBA 2A5XA 4A8YA 4YN4A 4H4KA 5T7BA 1WBBA 3D7SB 2HIYA 4DTNA 1AZSA 3PW4A 2P6RA 8ICRA 3ZZOA 1NAQA 4L74A 3T41A 1PYTA 4WZMA 2V94A 1TL3A 2ZBCA 3CT9A 8ICWA 5KFLA 2P6SA 4I2GA 5LT5A 4RQ7A 5IS2A 3HZGA 2FJXA 2X74A 2YNFB 3QIPA 5D15A 3K5NA 1WSGA 1RYRA 1BPYA 3OFHA 5KG4A 1O13A 4OX9F 4P0QB 4N7TA 5A2QU 3QT7A 4LT6A 2F1HA 2IC3A 5DDPC 3VESA 2Z2MA 5FROA 3P3DA 3R5BA 1XMOJ 1S1UB 3EDRB 2YKMB 3K7RA 3PKMA 2HHPA 2GEMA 2H1YA 3QGIA 3KLEA 1U2FA 3QUTA 1T9VA 2MTLA 1VQPN 3THWB 7ICUA 1T3QA 2IVNA 3O1WA 2OUGA 2GBZA 3MXHP 4OX9K 3WC2A 5M1KA 5AZJB 5D4OA 3FEZA 1TVAA 2Z1JA 4KI4A 4FJLA 2ZGYA 4LBHA 4I6MA 3R5DA 4Y2XA 3A0IX 8ICAA 1EAYC 3JPSA 4M5HA 5HATA 4F72A 2E1ZA 4P4OA 9ICPA 1X3MA 4OLBA 3EVMA 5ALNA 1PJ5A 2VV5A 2HKEA 3E01A 1WYGA 1X31C 3BPSP 3PIPL 2DR5A 4YDXA 1X5TA 1RT6A 3R6MA 3OQ2A 3BGLA 3OR2A 4ECRA 2H5EA 2BJ7A 3MTJA 4MYUA 1U1QA 4DV5F 4I68A 2ZH2A 2G2ZA 5F3ZA 3HTVA 2YJFA 4OV6A 4IEEA 2YQEA 2CN1A 3DXMA 3MDAA 2OANA 2WONA 2W43A 5L38A 5DKWA 2GIFA 2AGPA 2W40A 3D6JA 3GCWP 2B8PA 3VQ6A 1S1TB 1V38A 2JDJA 4DCHA 2HRTA 3HWTA 1N5SA 1Q5YA 2QWQA 4F25A 4DOBA 3IFRA 2RUGA 3HHLB 5B0FA 5FPEA 2RU3A 2V8VA 5JMVA 4DV5K 3NMUA 4NXNF 3C3LA 2ROEA 5BJRA 3ZI4A 2D74B 1LFPA 4USAA 4KMUA 5TKWA 4J5OA 3TACB 3PUFA 2DGXA 4FYXB 3WBZA 3QFUA 1FESA 1NGDA 3ZX2A 2UUCF 5B08A 4B9TA 5ALRA 5HRSA 4NXNK 3RB3A 1JLEB 1T9YA 3SQGB 3VQ4A 2IHNA 2UUBJ 1WSIA 5J0QA 3CMQA 4NV0A 1VC5A 2X3GA 4YORA 4H54A 2ACMA 2VFVA 2RHKA 1MMLA 1WDDA 5AXKA 4MEYA 1JNRB 3GBTA 3VQAA 3PX0A 3IRUA 4RBVA 1U48A 3VF2A 2UUCK 4YOWA 4O5FA 3WKDA 3Q83A 1NJYA 2V50A 3I76A 2E5HA 2JXJA 3OS2A 3OYLA 2MKCA 2EKNA 3NGUA 1CBKA 4CZIA 2N3LA 4LUBA 1UPPA 1IKWA 2WF7A 4V19J 1VQ6N 4DR5J 4WQ4A 3AVAA 4JYAJ 2KKPA 2KTQA 3DOLA 5HO4A 4EIAA 5LSOA 2B6AA 2L3MA 1ZD4A 1BI4B 2OFGX 4CHNA 1P90A 9ICNA 1S0NA 5ETTA 2E1CA 3L4IA 4BC4A 3CJ0A 1NJIO 1KCFA 3SQ0A 3U1MA 3DNCA 3FMWA 4PABA 2MY7A 4Y2JA 2YKPA 3T1HF 2DITA 5I3QA 1GLEG 3OV7A 5IQQA 2EAOA 3BKFA 3N5BA 3LGHA 3ZZZA 3UKUB 3VAIA 3C2LA 1E6YB 4G6VB 4LD0A 1NU0A 2VODA 4MTPA 4JI6F 4QR0A 3IG1A 3CJSA 2VA3A 2XYGB 4KE5A 1Q9XA 5HSPA 3UMGA 3T1HK 4DV6J 4USUA 3OYNA 3MM8A 4DV0F 1WTBA 1UHUA 2F65A 1GOAA 4C7ZA 3I8DA 3ZSYA 1BWVA 5F8LA 5KFXA 3TABA 5B66U 1FFGB 4DLEA 1J54A 3ZZYA 4G1PA 2CWKA 4CJUA 3VGTA 2C22A 4JI6K 4XO0A 4DO9A 3IWLA 2AH5A 3QQCD 4YY3F 2P9KA 4QIWF 1QE1A 3DLHA 3M2VA 2MB0B 2ZIWB 4GVLA 3LA0A 3M05A 4DV0K 2OZMA 5KFEA 3HSCA 1WOPA 2OPPA 3W64A 4O3QA 4EO6A 4FPAA 4CJLA 2FZGB 5M1FA 3Q8RB 4LVNP 1UCNA 9ICLA 1BHLA 2I7PA 4YY3K 2E1RA 3AHPA 3CJ4A 1TAQA 4JI1J 5AHXA 2DY4A 3C14A 1UWBA 3QERA 1R8HA 2BDUA 2E1EA 4J9RA 4I7FB 2HBMA 5B7WA 4M63C 1DK3A 2VIXA 2GGPB 1SS6A 3O9UA 3ETRA 1Y9OA 3LPTA 3CMAN 1HUOA 4AH9A 4DU8A 2PI5A 4GKKJ 1KLMB 1RXVA 2XYHB 2WFBA 3QSYB 4UOCA 2GHVC 2HHUA 4W5NA 2KP7A 4CJVA 1RBLA 3TKAA 1C0UB 1KAYA 1QZ5A 3R97A 1BUPA 2DNHA 2C1EB 3D0IE 4H0OA 4C7QA 1RTIB 2BH1A 3C6UB 3TU5A 4JI0F 1BOTO 3M2UA 4QW8A 2AYBA 2W3RA 3EKUA 4NLCA 4DR7J 2X7IA 4V19X 1WHWA 5AM5A 4RG8A 3U9DA 5CHGA 3P8BB 2N7CA 2RRDA 1GO3F 2KSOB 1GTHA 4HI2A 4K2XA 2MAXA 1JROA 3CJRA 3KG1A 3CCTA 3QBWA 1IKVB 4ECZA 3ORYA 4IG0A 1R0CB 3CD6N 1HWIA 2M2BA 4JI0K 3MXMA 1JIHA 3BDPA 4DHVA 4OI3A 2MUTA 1U1OA 2O5DA 2B56A 2CG8A 2VD3A 5HK4A 2P9UA 2CRXA 4GVEA 4CHPA 3FZLA 3MCAB 1D9AA 4E8UA 4M3XA 4OJLA 4HR2A 4IQUA 2KLAA 5E79U 1KQGB 2ATCB 2J8SA 4BR7A 2ZGZA 2ASJA 5MLCV 1R8PA 1FVQA 3U6FA 5K8NA 2LECA 1Z19A 2RIJA 2W7AA 1K73O 2RLTA 4OYIA 3R8EA 2HDOA 3MK6A 4M6WA 1KSPA 2IJRA 2XMVA 5KG0A 2DGVA 1WF1A 5H9EJ 1RTJA 3G6ES 2G2OA 2EFNA 1SVDA 2BANB 2E1FA 1OKJA 4PHTX 4B3RJ 5ALVA 2QARA 5ETKA 3TUJC 3KLGA 3FBCA 1FE4A 1QQNA 3VALA 3I55S 2ZTDA 5ALTA 1F60B 1RDAA 1U1PA 4FPIA 3W60A 1RAGB 3CCQN 3L7OA 2NXJA 2QEXS 1YJRA 2HQCA 4JK8A 3A0BU 4JNEA 3L3CA 3CB4A 3R3TA 4K41A 5BRHA 5AQLA 1GQEA 4JI2F 2G0IA 2KQ2A 1S6UA 1U26A 3NMRA 1L6NA 1HJRA 1NJIT 2KV2A 4KRWA 2BVZA 3I96A 4KFBB 5DGAA 3SYZA 4FL9A 4M8LA 4F5NA 2EFVA 1AW0A 4IO9Q 4F04B 4MO5A 2A1RA 5THWA 3EGWB 2DTJA 2P9NB 1C1CA 4ELUA 2OD4A 5J2MA 3RB0A 4CGFA 5IZHA 2VBWA 1X6JA 4JI2K 5DM6Q 3K9KA 1RT1A 2DNOA 3W2VB 2D0AA 2OYQA 1RDDA 5D0GA 2O67A 5EWEA 1F5BA 1NGBA 3IAM9 3VZIA 5I3UA 2CNLB 4A2AA 4Q2MA 2FJBB 3IS9B 3J80Y 3LOUA 3AVIA 2BPGA 3QFHA 4N5SA 1EHWA 3HKZC 3AD9C 1NJZA 1ZBLA 3W2WB 1X4CA 2ETJA 4PHAA 5LM7E 8ICYA 1KEJA 2OPSB 5HMYA 1Y5LB 2VBXA 4BREA 3JPNA 2E1MC 3NE6A 1FTRA 4I2CA 3ISND 4B3OA 2O8EB 1EARA 4I27A 1MQ2A 4PG8A 3Q8UA 4MKVA 2CQ2A 4AYBF 3L5KA 2F1FA 4FVMA 2G0AA 1T0TV 3KLIB 1BC6A 4KHQA 4HH1A 3U9ZA 3CSKA 3LP3A 4CFAA 3PYDA 4QS9A 1KTVA 4E19A 2GMLA 4USWA 5HL7L 2XLKA 4UTGA 1N5XA 3IRXA 2MLYA 4P72A 2MZ1A 2H65B 3I0SA 4L72B 2RDIA 2P9GA 2BR0A 1UFLA 4YOYA 3MEEB 3TTCA 1S76D 3QU9A 1VQMN 1VQPS 4P4PA 2O01C 4FZMA 3KJVB 1BD6A 1RTDA 3MOJB 1ZQXA 3WK9A 2CXEA 3RBZA 1KN6A 4E7KA 4CI0B 4US9A 4DFDA 2A0FB 4PR6A 4KPCA 4BRDA 3IHQB 3OVAA 4DR3J 4FLUA 2H51B 1SC3B 3CXCR 4ZCLA 4DDFA 4I2PA 2ZIVB 4C4TA 4KLMA 4PQUA 4USVA 5ALPA 1ZQYA 4KAIA 3H8MA 3NOCA 4BS2A 2DR7A 3C2PA 3CCMN 2NXUA 2E8OA 3VA0A 2KZ3A 3MEDA 2MU2A 1R0AA 1VRTB 4DEZA 2CJBA 5IV4A 4LSLB 5GMDA 4QZBA 4QWDA 3N9UC 1UA0A 1RWMB 2MEWA 4J9MA 4ILLA 1SV0A 3OTOF 1RWXB 2W6KA 2PZSA 3AQOA 3GWCA 1VDVA 4ZTFA 1NKEA 3KUEA 4U9RA 2C2EA 4ANCA 3WKBA 3HSZA 2PO4A 4M9LA 4BR0A 2G1HA 1DJ0A 3MN7A 2AX0A 1M5VC 3EEQA 3EL2A 5GINA 1ZOLA 5FD1A 1RHRB 2C2MB 2ZZNA 3HP6A 3CCLN 3DLGA 1FTCA 3P96A 3OTOK 4M3RA 2HNZB 2CAJA 4DUTA 3CJTA 3MEGB 5IIMA 2V4RA 2BJ3A 2LCWA 2AV5A 4ECUA 7ICIA 4DX5A 2G13A 4CEFA 1K73T 4WPAA 1QSLA 2ABYA 1IBMJ 1IV8A 1ROFA 2D41A 3ULHA 2KYXA 1YHQN 4CW7B 2V8DA 4CD1A 3H3OB 1X4DA 2GUPA 1XIQA 1KKHA 4J7CA 3G6YA 4ZVQB 2O8CB 1KEKA 2CZ4A 4DR6J 4UUWA 2CWXA 2DFHA 4UAWA 3HCXA 1KAXA 3PZPA 2EZYA 2WVEA 2E7XA 3GG0A 1VC0A 4QNLA 4HTJA 1ZTTA 4WKYA 3ZX0A 1VR6A 1L3KA 2QWMA 2JLFA 1T44A 1GLLO 3J81U 2IVOA 5CZVA 1PAEX 4DTRA 2KZZA 3MR5A 2B9YA 1S6PA 5F0UA 5EX3A 3WXIA 1KD1O 3MDCA 2ZE2A 2ILYA 1SUQA 2A1JB 3P6YC 5F3TA 3TR5A 2JLGA 2CADA 4IH5A 2BUPA 4OMFG 3D2EB 3O1BA 4RKUC 4CEAA 3CGIA 3M7DA 3ZTOA 4NLWA 2EZXA 3IO1A 3TUIC 3P49B 1FW6A 1PK1A 4LBPA 2CPRA 4OPHA 1FXDA 3VQ5A 5AI8A 5J2FA 3G0ZA 3HSGA 8ICJA 4C3KA 1QHAA 3SMZA 2ZTEA 5IT0A 4WBFA 1QUVA 4PJ0U 2IMWP 1NZBA 1FDDA 2AEFA 1YRXA 2PFUA 3O4QA 1N36J 1CZBA 3FQLA 2IYGA 2ZIXB 2YWEA 2EFPA 1QAYA 1KFTA 2CKWA 1Z00A 4UASA 3EE8A 5HMWA 2AP6A 2I5HA 2DH9A 1WN7A 4PL1A 4BC3A 1T4GA 3QEAZ 5LMUK 4ISEA 2YKNB 3VCBA 4CLYA 3ISDA 4AHVA 1TMMA 3QPIA 1ZQIA 2DT9A 1X40A 3ASMA 1NGIA 1NOMA 4F3QA 1HBMA 5D0EA 1DBDA 3DHXA 4CZMA 1ZZFA 1VSDA 1WSJA 5ETSA 2CPJA 3GR1A 2QL7B 1NK4A 2QLBB 3CJ8A 7ICQA 3PJXA 2NRHA 2E5LJ 4YDDB 3LVVA 2FC8A 1WEXA 1JWWA 2GX8A 2BJEA 4NLYA 4ILGB 3W5XA 4OJPA 4RCHA 1TVRA 2MGZA 4EYHB 4I2QA 5LSRA 3SQ4A 4FYWB 2RF2A 9ICFA 1Q53A 3ZEUB 2KICA 8ICLA 2AKWB 4QS7A 2QXLA 1DKGD 4ANEA 3K1RB 2BOAA 1S1VA 1M1KO 3JPQA 8ICSA 3OYEA 2X1FA 2YNGA 3CCRS 2KJ9A 2APOA 1E6VA 3UD5A 3D4JA 1LFWA 4OD0A 1S77D 1BCOA 3CMAS 1HNZJ 5KPRA 3D6MB 1HD1A 3PFOA 4YB5A 5T7LB 1T3OA 3FUYA 4LR9A 3NOGA 4OCZA 1X5SA 1X8DA 3H5SA 5AKYA 3SUPA 1FRJA 3H0LB 4UB5A 1BDGA 5LMNF 5BXIA 2H3IA 4J2EA 4QWAA 4DL5A 4H4MB 4MK9A 3LM9A 1X4AA 4K50A 5DM6L 2ACYA 1J9AA 5KNIA 1GOBA 2C2RA 3KHYA 1MROA 3VQQA 4YVZA 1OIAA 2CJQA 1IWAA 2EANA 8ICHA 7ICPA 3M8WA 4JWNA 3BR9A 3QMQA 2PFPA 3AQPA 3DU6A 2BKOA 4UOFA 4NLQA 3SCKE 5LMNK 2BE2B 3OR1B 4JI5J 3O4WA 4NO7A 2Z57B 5F41A 3NVMA 3U7JA 7ICOA 2WAQF 3OYAA 4M2YA 4ZVGA 2OD6A 3KJNB 3VAJA 5AKJA 3Q7CA 4C9DA 1P9QC 2F77X 1KS2A 3CD6S 2NV3A 3WUHA 3NVWA 4X62F 1DRGA 4F4WA 4A8QA 4CEDA 2HBZB 4IH7A 8ICUA 2BRLA 4P71A 5AE1A 4CO5A 4KX5A 2B3TB 2J9CA 4Z7YA 2QLFB 2GX9A 1GLCG 2I7NA 4AHRA 5AQOA 3E1YA 4XH1A 1FEZA 3KKAC 4RQ4A 4Z4GA 2IA0A 3FDSA 4PKDB 4CGDA 4DX7A 1JJ2M 1KQFB 4PCQA 3JSMA 3GCXP 4MIBA 4X62K 3PYFA 2WUSA 3IAS9 2BPCA 3M6ZA 4IRCA 5G0RB 2GW8A 3AODA 4DG1A 4FVUA 3WK8A 2AJ2A 3LPEA 4DPUA 1LVHA 4CJRA 2UUTA 1RT2A 4NZ7A 4K25A 2RN2A 2RE1A 3CUNA 3B9JA 1NO8A 2HI0A 2RVJA 5AQXA 3K0SA 2OGUA 2PFDA 1T05A 5KFHA 1QY7A 1AQ6A 4AM6A 2K89A 5C15A 2FC9A 2W2NP 4JAXA 2MMYA 2VFUA 4N41A 3ULEA 2ZKTA 8RUCA 3MOZA 4ECTA 3OYJA 1W2BR 4X65F 2J76E 1NKCA 3D6HB 3HMJG 2HSEB 4WXOA 2YX4A 2EBGA 1U02A 4E7LA 3OHAA 5AKLA 4H8KA 2XRIA 2R8HA 3T5KA 1AUDA 5BR8J 3CIMA 5HLFB 2QK9A 2ES6A 4BUGA 5CZ2A 4J9UE 2MLXA 1YJNN 3VHQA 3SCIE 7ICLA 2YV0X 4F2RA 3O9SA 3DMJB 1T9WA 5KQ8A 3QEWA 1JCGA 1YT3A 4DSIA 1B3TA 3NFAA 1HBNB 2QX0A 4KREA 4B9QA 4TLRA 4UY8T 2O8DA 3QX7A 4O5EA 3Q8KA 4IOAQ 1N5QA 4HWIA 4E2FB 2KKVA 2YI1A 4ICAA 4WFYA 2XZTB 2H3GX 3CJCA 1U0SA 1T6CA 2BYCA 4BR2A 1NSQA 1S1XB 3SUQA 4IG3A 5J0RA 4Q5VA 2IM1A 1SIWB 1BQMB 3FZFA 5EVZA 4B1VA 2FD2A 2W9CB 3T19A 3J7YI 1RU1A 1ACMB 3HVTB 3UFCX 2FY1A 1CULB 4ES1A 4CHOA 2YQ0A 5E3RA 4G1QA 2VQEJ 4JS5A 1RG6A 3CIPA 2CQPA 1X4EA 2UXBJ 1RBUA 2GVZB 1OSDA 4CF0A 2OPRB 4V1Ak 3SFUA 1Z1BA 4FWPA 4JHDB 5ALLA 2A6MA 2RHFA 2W4PA 1B7YB 1XSLA 3K2PA 2Z7JA 2J9DA 2GH1A 2EH9A 4AHSA 1KQQA 2HURA 1NGEA 3ZSWA 1M1KT 2YY6A 4AFFA 4Q44A 3CCUN 1RT4A 3R2DJ 4AF1A 4Y2KA 3G4SN 3CC7N 4OQJA 2AZ1A 1EIYB 4BQZA 4DFMA 2DO4A 2P6TA 4EGLA 1BQNA 2OLWA 2IJFA 1VQLN 2Q2RA 3ISBA 5CWRA 1KFSA 2RP5A 1CUKA 4XQ8A 2FDRA 3OBWA 1KQKA 3L8BA 5J0YA 4M9HA 3KK2B 4DB3A 4NRUA 3O4NA 3DXKB 5I9EB 3CCMS 2Q36A 2BJDA 3W3DA 2RRBA 2A19A 3D2WA 4B3MJ 3JTNA 1CSJA 8ICKA 5J0XA 4XIUA 1T03A 5AKKA 3T5LA 4J37A 3H3NO 4IBNA 4XPCA 4LSNB 2ASPA 4US8A 1FJCA 7AT1B 3DRYA 3ILIA 3HM9A 4CGHA 2LLZA 1IKYB 4BDPA 1G99A 2F9WA 3MFHA 2R2RA 1C6VA 3SEOA 3A8JA 1RI7A 1HBUB 3FZ2A 4I1TA 4FWKA 3FE1A 1IJFB 3CCLS 3LVWA 2RKIB 2G8FA 2OSRA 1VHIA 5HVFA 2F4VF 1TL7A 4ICLB 5CD4H 2XTJP 4EAHD 1C0TA 3IR7B 4I56A 1SV4A 4K59A 1U2CA 3GV7B 1HKGA 1VQON 4AHTA 5L1LA 3TI0A 4PPZA 4M63A 5A6WA 1RWWB 1EZZB 4CF4A 2I38A 4M95A 5CQGA 1NM2A 4XEIA 4ZIWA 2N3OA 1A6LA 1YHQS 3OS1A 3LO3A 5CP2A 1HQEB 2ADCA 2F4VK 3DDNA 3R1LA 1ZQZA 1R27B 3L2WA 2G08A 3ZC4A 4Z37A 5GAGI 1SWWA 2XBPA 2I1QA 4GXIA 1Q1KA 3H25A 3HZEA 2XNRA 2YH0A 1TFRA 1CEZA 5J2PA 1ATRA 4Y2VA 1GFWB 2IM3A 3BGRB 1FFWB 2NUUG 4WFAQ 4C8YA 2MPUA 2RRNA 3J80U 2DHAA 3I5BA 2V9KA 1VK0A 4BG9A 2KO1A 1FFSB 4NLRA 4FLWA 3TARA 3V4IA 5CRXA 3I1YA 4FWRA 3RAXA 2Q1LA 3UB5A 3ZT1A 2UUCJ 1SZ2A 2F76X 3L6QA 3NCRA 1IM4A 4JKEA 1FERA 2ZOGA 4CJWA 3FFIA 4KJIA 4ED1A 4JI4F 1B99A 2RHQB 3TWHA 5EXWA 4DCCA 3AVBA 2W25A 3CFPA 4WF9L 3TZXA 5D0HA 1JALA 1YG0A 1EB0A 2VDHA 2YMPA 4H0VB 4CP5A 1KC8O 2VA8A 2DD8S 2B21A 3KNAA 3HKZD 5IIOA 2P5GA 3J81O 3TQEA 2GJ2A 1HI1A 4EX7A 2ROGA 2EDUA 2YKQA 4JI4K 1BL3A 5J2IA 2E3TA 2ZNZA 5B0DA 1NDCA 1HW9A 3OPKA 1NRKA 3ZXWA 5AKXA 1H6KX 5EWFA 1ZQCA 3JYTA 3NNHA 1TKXA 3CVKA 4MFBB 4B3TF 1KBRA 4ID5A 1I6JA 3D1OA 2Q97A 1S7IA 2VJVA 1N5YB 4J91A 4Q8FA 3M9MB 3FCVA 2P5OA 3GU3A 1SIJA 1Q9YA 3QUCA 3LQVA 2K8BB 1FJEB 3AO3A 3D5MA 2W01A 2OFHX 2EXUA 4NL5A 2WRMA 4EK2A 4B3TK 2A6AA 3D2FA 4O4GA 7ICMA 2P9SA 3VQEA 1NBEB 4DN9A 4OI2A 3AA4A 2D0OA 4KH4A 5BPLA 4ZLJA 1N34F 4FWOA 4QIWC 5IWAF 3ZSOA 2YKOA 3DAWA 3DLKA 2PA8D 2FJDB 4XPEA 5C2CA 2Y0BB 1YI2S 1LAVA 1S9GA 1SV5B 3Q22A 1AZSB 2CGJA 3WK5A 4DR1F 1BMQB 3UQ0A 4RJVA 4KAZA 4QAGA 1LOTB 3MABA 1XNQF 1CLFA 4YOVA 3RMCA 2L9NA 2QLJB 1TL3B 3ONQA 1N34K 1SCJB 4NLXA 2FHMA 5IWAK 1XMQF 1UA1A 2OAUA 2AP1A 2ZBIA 5M2RA 5GADU 2E7VA 4MQ3A 1XK8A 3RMDA 1HEKA 3QIPB 3LF0A 1B4FA 4A8WA 3RRGA 1LW2A 1OVQA 2QXFA 4DR1K 2CFXA 2EEYA 1XNQK 5G4DA 5CZ1A 1B22A 4KB0A 3B78A 2HFSA 4ECQA 3DLEA 5DB9A 2NYVA 5AFUA 1XMQK 3ZFVA 1RWPB 4BGAA 4IOAL 3EJMA 4HTIA 4ZKAA 2KL8A 2JHEA 2WVDA 1H72C 1A76A 4FBTA 3R8YA 3O0FA 3QMLA 3MAQA 3LAMA 5J2AA 2ZBRA 4JRQA 3IGVA 4Y2IA 3WQTA 3M32B 2B0CA 3AA5X 3HT0A 2IHMA 1Q82O 4ZVPB 2L9WA 2AYGA 3V6JA 4ZVOB 4RW7A 2E5SA 3ZDDA 3E01B 3NGRA 1S5JA 4DF4A 3B4MA 3ZZRA 4C0BA 1Q78A 4CE6A 1RT6B 4LH5A 3CPWM 3CFRA 3OR2B 4F4AA 3W7BA 2NS1B 4RW8A 1WELA 5LXYA 4BR9A 1BIUA 4CWBA 4FM0A 3SZ2A 4BWJA 2DNQA 4GC7A 1QQOA 2GUIA 4CEZA 4JB3A 4MH8A 2LEAA 2WONB 2FVSA 3CW2C 1FE0A 2F63A 1NPKA 1EQ0A 1UZHA 4U8YA 2ZHAA 2R7XA 4E89A 3DGVA 1WAJA 4FJIA 5FLXY 4BRIA 1EX4A 4C8NA 3QB0A 5ALYA 1IQZA 2U1AA 3MM9A 2A42A 3HFZB 2ZM6F 1OUQA 2ATLA 2FBYA 3MX5A 4A46A 2KKZA 3IG5A 3W65A 2JSXA 5AM4A 4O0IA 1DTQA 3Q0AA 4BRPA 3DXSX 3LALA 4EHTA 3ZX3A 1RDFA 4I2EA 4LF4F 3F73A 1SJ4P 3P5BP 2XVTA 2RQ4A 2GO9A 4RNHA 4TU9A 3GP9A 5AQNA 1W26A 3G2XA 2ZM6K 2HEKA 4GV6A 1RSCA 3ISCA 4IWVA 1P1TA 2F5GA 2WW8A 3OSPA 1LOUA 3SAFA 4DCOB 4YD2A 4DSEA 1Q81O 5ETRA 3JSRA 5HROA 3CHWA 3N97B 4LF4K 1RM6C 2ZD1B 1YJNS 1KC8T 3H08A 3MN6A 1OXJA 3F53A 1IKWB 2QN6B 4MK7A 1M90T 4IQXA 4CEBA 2D7SA 5AI5A 2GJFA 2ZKUA 3JPTA 3DOLB 1FXLA 2B6AB 3LDQA 3IXQA 4IH6A 4KH0B 4B17A 2B4JA 3M30A 3SXLA 1FCAA 4CGZA 2J0SD 4ECVA 2LM4A 4OZ3A 2GQCA 2AIRB 4CNZA 4CLZA 2JC0A 1YAGA 3CC4N 2Q79A 2KZMA 1BIZA 1LCUA 1UEVA 3TANA 4X5VA 3WXLA 1F1BB 2VBZA 2O8BA 1TL1B 4ES3A 2KFNA 1KXPA 1J5EF 4WFAL 3MWTA 2A3VA 3IG1B 3DXBA 3VA3A 2Q6CA 3R7BB 1S59A 3F44A 4NYPA 3P31A 2B51A 4RLEA 1VSHA 3U1LA 2N82B 2NXNA 3QEIA 3D54A 3RUBL 3QETA 4C48A 1NHVA 4ZPTR 4FOEA 2XO7A 2P9CA 1P6TA 3CCUS 5CR0A 2J7KA 1XO1A 1TL4A 1J5EK 2G8IA 1GXUA 1DLOA 4AYBC 2VGNA 5A8WA 2P9KB 3K9JA 2R9LA 1QLNA 4OJ3A 3OD2A 1KQSR 3RFAA 3BEGB 1LK7A 5ALKA 1U2VA 1QZ6A 1VQNN 1BPXA 3ZTQA 1KVBA 2PMZF 3WIVA 5B0BA 5KQDA 3QFPA 3T7ZA 1TTHB 2DH8A 4USKA 3VQDA 4DUYJ 5FIIA 3KFWX 1BQXA 2N4CA 5LL6Z 2F8MA 4OV1A 2VC0A 4ECYA 2BUNA 4Y34A 5CA5A 3G25A 2YWKA 3H7HB 1AFJA 3C14B 4KHRA 3RRKA 2H48B 1UWBB 4FLXA 5KFTA 4ZP9A 3L9ZA 2NZCA 4A61A 2KHVA 4CH0S 1RYUA 3D2SA 1T9UA 5IM0A 1OY6A 4QWBA 4CEQA 4ALZA 3B8HA 3I9ZA 7ICGA 4WP9A 1AFIA 1B70B 2P9PA 1HWJA 2FJWA 3A8KA 1WUAA 3GJRB 3H8JA 4CIFA 1FF2A 3DI6B 4Y1DA 5JVHQ 2MLZA 3MMCA 4HUEA 2OEJA 1ATSA 1M1HA 4RBTA 1NUEA 4FXWA 1VC6A 5AZIA 1R6YA 3M3ZA 1H2TZ 4CD3A 5KFAA 3CJKA 3AJDA 1DARA 1BWEA 2W3SA 5BR9A 3M2UB 3F9MA 2K8AA 4LF8J 4UY85 3HILA 1CS4A 5F8GA 1VBXA 2CYYA 4OKEA 2GELA 1HQ2A 4Y2UA 1R89A 1U9LA 1FKAF 1PJ6A 1XBWA 3AA8A 5CEHA 3V81A 2ZVSA 1YBUA 8ICEA 2HHSA 4YFKA 4L3NA 3TJ9A 2M88A 5F3XB 1I94K 4CERA 4LRCA 1R59O 2VPXB 1SQEA 4EMDA 2MUTB 5KAIU 2R8JA 3BZKA 2GLEA 1W7AA 3K58A 3ILLA 4AUKA 3DWLA 2BKPA 2V34A 1Q7YO 3UCZP 2WCXA 4A57A 2I9SA 4E7HA 5CYMB 3H2VE 1O1WA 3CWJA 5DG8A 3CO9A 3EKSA 2J7WA 4M6WB 1RTJB 1QQ5A 1WNEA 2B4OA 2KHOA 2CVIA 3BN7A 4DQ8A 1Q81T 4DCPB 1CC7A 4LIRA 4BC5A 3T3FA 2QARB 4DSJA 1RAEB 2ZDOA 4UB1A 5JTIA 3KLGB 2C2NA 5HQ8A 3KKAA 1N0UA 2FBXA 5GMKa 4C0ZA 2W04A 2ZH4A 3BY5A 3LYSA 1HQUA 2JGUA 1X3NA 4YR2A 3K57A 2OMLA 4CNYA 9ICCA 5LJ5Y 5J0WA 2YX6A 2V67A 5ALZA 1JRPA 1N48A 3A5MC 3NXZA 3MR2A 1RQ0A 7ICSA 3EUB2 3PHTA 2A2CA 2KN4A 2UUBF 5CJ7A 1CQNA 4CO3A 2DRAA 2QKQA 4NMLA 1XHXA 4ED0A 4LC9B 3IBWA 1LWCA 1Y3JA 3K59A 3ZSRA 3S6JA 3ALYA 3JPPA 4DQSA 3UD4P 1SJQA 1DRZA 3NGKA 2G06A 5KT5A 1T7PA 2OPQA 4M5KA 1C1CB 2YNHA 5J2MB 1U6BA 3FKBA 4LFAJ 1MN8A 4FZVA 3O08A 2K2PA 3H8WA 1RT1B 2UUBK 5HVGA 3KFUF 3G6VA 5LMUJ 3KLFA 1YJUA 4DR5F 2UVRA 4JYAF 2P9IA 5IFMA 4ZN1A 5I3UB 1YIJS 4KB1A 4B1XB 2W8KA 2KE7A 1O03A 1CZAN 1NJXA 2QLTA 4LIWA 4GXJA 1CJTA 3SQIA 5FP0A 2GV1A 1K9MT 3HYFA 4DZ6A 4DR5K 1X1PA 9ICKA 4JYAK 2YPYA 2X78A 3L3UA 3KZXA 4B3OB 4N76A 3HHDA 5KFRA 1O0PA 1A5VA 2QG9B 3CETA 3G8SA 2W2QP 2YHAA 4PXCA 4BWMA 3UR0A 4C7YA 5GTHU 4OPKA 4J90A 3SR6A 1FO1A 4KQZA 1IVZA 3KZBA 1CJVA 3JSYA 5GAHU 2C2ZB 2EWHA 7ICNA 2LQ5A 2MHEA 2V51B 4OJOA 3ZSZA 3K2YA 4DV6F 3IRXB 3AVMA 5KG6A 4JI8F 3TVYA 5SZTA 2XZDB 2HCFA 2NNWA 3I0SB 3A13A 4CLTA 3ZNUA 4GKJJ 3C16A 4OHXA 2LMRA 4IYQA 4FZYA 1RTDB 3NF7A 4DV7J 4M9NA 1QCKA 4QWEA 4DV6K 1TFWA 4JI8K 1VISA 4I2PB 2UP1A 4PQUB 2CH6A 4KLHA 1DXSA 1WSHA 1N6QA 2FUG9 1VOMA 1WF0A 1HNIA 2X1BA 3D6FB 3MEDB 2CNOB 4WYWA 3Q8VA 3DDKA 3I9V9 1G2EA 3HI0A 2DHSA 1C4CA 1R0AB 2GO7A 3D6RA 2K7KA 3SK3A 2WAQC 2UUAJ 1TUUA 3BH7B 4C11A 3BV8A 3IM1A 2AYEA 4JI1F 5CYQA 2DXEA 4DTJA 2XCPA 2B7CB 2EHGA 3MCNA 4M5MA 1Q5VA 4Z6DA 3PVXA 1Z4NA 2OH2A 2HZCA 4Z7CA 3MEKA 4LF9J 3ENHA 1ZYQA 4H4OB 5KOXA 1B7FA 2DGZA 4ZVRB 2JEIA 4GKKF 4KLFA 3KMSA 2XMTA 4ZVHA 3VGLA 4JI1K 3V9ZA 2KT2A 4OYPA 3DLGB 4NYNA 2F3NA 1FXXA 2PBDA 4PH5A 3E51A 1UTAA 1Q7YT 1ASWA 2R3VA 2E2NA 4IQWA 3SQ2A 3UO0A 3FBBA 2C3MA 5IQ6A 2QSWA 4JN4A 1WI8A 3VQTA 5FPDA 3KHLA 4Y2AA 1YK9A 1SJ1A 4RU9A 4OO1J 1KDHA 2MA1A 4YMOA 4KLJA 1HARA 4MKAA 4GKKK 4K4WA 5KT4A 3MR6A 4LZDA 4C4SA 4UAVA 2J9DE 2DB1A 4DR7F 1YJ7A 3FMBA 5CAAA 1NOYA 4JKFA 2BJ8A 3W66A 3AVJA 1URJA 4G3IA 4ZCIA 2D5RA 9ICWA 3NKYA 2AX1A 2GAHC 4JD2A 2FZCB 3ZT4A 4IC9A 1QQ7A 1ZD3A 4P2XA 2IDLA 1N5WA 3R2CJ 4DR7K 4M45A 2KI2A 4N56A 4BR4A 4X4RA 3AARA 1YF5L 5JVHL 4RW4A 1S6PB 3CFOA 4ZMMA 3CI5A 1KFDA 1JLBA 3P38A 2ZE2B 1SUQB 3KWMA 4YXMA 3HT3A 3FRZA 3DOKB 4OLAA 2M9KA 2YKAA 3FBFA 5J1NA 2IYIA 5J0UA 1TV6B 1V5VA 3V9WA 4FXDA 3PYEA 1PK1B 1ZBTA 3AAQA 4B3RF 3H6EA 3T1AA 4OHWA 4KHSA 2NXEA 5ADZA 1NXIA 4KY3A 1BWFO 3HK2A 4R79A 2DNRA 1ZRMA 4QIWD 1HKCA 2YQ3A 5H9EK 2FXUA 2G8WA 4XAKA 4ZLPA 2PXIA 1Z00B 2VOOA 5C12A 3TUZC 2X6SA 2B4UA 4B3RK 3OW2R 2AMCB 1EETB 3NS7B 4EX6A 4LQ3A 3R6GB 3DV9A 1IH7A 2BTFA 4QZGA 1HBMB 1VK8A 1ZQJA 2Z2YB 1WNSA 3NL0A 3M6XA 1YITN 2A41A 2H54B 4NLPA 5C0YA 4NYOA 3S41A 4NLBA 1VQNS 4C4WA 3C6HA 2DNMA 1RZMA 1JNZB 4C8LA 4X4OA 3W62A 3G10A 3NBPA 4R0JA 3W9JA 1REVA 1KKXA 1TVRB 3SNNA 1S97A 4I2QB 4TLQA 1HKAA 4BRNA 4DTSA 1N5VA 2JLEA 3MPWA 4TU7A 2RF2B 3FSXA 2MKJA 5AQTA 4RW9A 5FLXU 3ETLA 3PM9A 1SI9A 2VU5A 4O0JA 4ER8A 3NRWA 2CQ3A 3H8SA 4PZOA 2G1DA 1ITGA 1UMJA 1GLJO 1S1VB 2DL0A 3AM9A 3QJPA 4KGZB 2LBOA 1E6VB 3UKRA 4CECA 4OKKA 1FXRA 4IFVB 1Q3VA 1BA0A 2GVDA 4L3KA 3PEJA 5ADXA 3VQBA 2OCEA 4FBUA 4HHTA 3MAAA 3UXOA 1VJWA 4YR0A 4M04A 2Y1RI 2UVVA 1WC3A 2UXCJ 4W4MA 3LDAA 2I0XA 4ISFA 2VYPA 1OPZA 2Y3YA 4DL2A 3M2RA 3MM7A 2WC9A 1RLCL 1BA1A 2BCUA 1MROB 2HQFA 4IQTA 2R2UA 3LWMA 4EI2A 4FCYA 1ZRNA 2KT5A 4KR0B 3MWBA 2Y9HA 3M8PA 4PHEA 3OTQA 3ET6A 3ZTRA 2OTLN 3I31A 3QO9A 4DMZA 4M5GA 1ZA1B 1S6OA 3VQ7A 3QIOA 2LMIA 4WIQA 3JTPA 2NR0A 3AJ2A 4HACA 4BXOA 1RFQA 2VASA 1NWKA 4EYIB 2W9MA 5F2RA 3R27A 1K1SA 1EQYA 2IOFK 2EAPA 1D8YA 5BOMA 3HDSA 1FK9A 3T6JA 3J81j 4DR3F 4IXCA 1COOA 1S9FA 4LY7A 3E0FA 1VLYA 3MZIA 3AH6A 4B1UB 3H4DA 2IVFB 2ROPA 3SENA 8ICPA 1NPPA 3S6EA 3DM2B 5CCLA 3CCJS 5J2QA 2CG4A 3WNFA 1IXKA 2BW7A 3JSMB 2WHEA 1UL3A 1RLDA 2E1PA 4DR3K 4DG1B 4CHQA 2QB1A 9ICRA 2OI2A 2B8QA 3W5ZA 4DL6A 2XYPB 3OUYB 4WQ5C 9ICXA 5LY3A 1U7LA 2L08A 3LP2A 3CF5Q 3GU0A 1D9FA 3M8QB 1V9PA 4RT3A 3J7A1 3NGZA 4FM1A 3C2MA 2R7TA 3PDNA 4ZDNA 1M5OC 2Q0RA 1SXDA 2RMLA 3AA2A 1JN3A 3MMAA 4ISGA 2W7PA 1PUZA 1T05B 4B9SA 4MDBA 2HWIA 3EWAA 4DTUA 3W63A 3DRRB 2LQJA 3CIZA 3D68A 3H8YA 1U49A 4ZS6A 3O9QA 1QVGM 2ZVIA 4CLUA 3ULEB 2P35A 2H3ZA 1TQLA 5EE3A 3EPGA 1D3WA 2C3OA 4ZHRB 4UB3A 1J53A 3THTA 1IBMF 3N5FA 3WU2U 1QTMA 3ZT0A 2H4YB 4GVBB 1JK9B 3G8QA 4AL5A 4F2SA 3FGUA 1XWLA 4DR6F 3LP1A 1C1BA 5L46A 3IN5A 3VQCA 1YBTA 4C23A 1IBMK 4OIXA 5ETMA 1WSFA 2B5JA 5AJ3K 1S6QA 2XI9A 1JLFA 4JB8B 2Z0GA 2R8GA 2R7QA 2OIHA 3AB4B 1U6FA 2JWKA 4AYBD 1S1WB 2HBJA 2ZJAA 2FJAB 2HAFA 4DR6K 4RPZA 1FI4A 2O8DB 2HHXA 1HNXJ 5HBMA 4CZKA 1MLAA 3EMTA 4HL9A 5F1XA 4FM2A 1ZQBA 1YVFA 4DPTA 3KOAA 4HKQA 3FJ2A 3P4UB 4FZNA 9ICAA 4ECXA 3QBXA 3FGVA 2PMWA 1B0VA 4G1QB 4BGDA 4PY5A 1D0EA 4CJ5A 3ITHA 4KB7A 4FJHA 4CK1A 2H3QA 3AOBA 1V9OA 4USTA 3MFIA 4MMOA 1N36F 3JXUA 2V2QA 1YSJA 2Y8YA 1UW4A 3H1QA 5B0GA 3NNAA 2YPZA 3C21A 1X7VA 2DGTA 2MZJA 1F5AA 2GWSA 2QWLA 2LU2A 1P8ZA 1HD0A 4E7IA 3KXDA 1P9YA 1REGX 5AQGA 3SLCA 4BCAA 4DSFA 4YHHJ 3H5XA 1N34J 1RT4B 4UW9A 5AQUA 4RW6A 3CQ8A 4ZOHC 4UQTA 2E9RX 5RUBA 2NYHA 2BHNA 2ADBA 1N36K 3SJHA 2BM1A 2YX1A 5HQMA 3MECB 1IR1A 2CQ1A 2HW3A 4DTPA 3VAHA 5ADXH 1BQNB 2LP4A 2NPFA 2WF5A 2E5LF 4Y3CA 1Q79A 3V4MA 8ICFA 4F5OA 3V9UA 2WBNA 1X42A 4Y0WA 3KIOA 4GO7X 1NB7A 4X66J 4I6AA 2MQQA 3UW1A 5FDLA 5KT6A 4L6V3 2YWWA 3UQSA 3PIPQ 1PILA 1SIZA 4FLYA 4AHUA 5M1PA 3NH0A 1T03B 3OTCA 4KO0A 2GQQA 4V19S 2EBEA 2R8IA 4FJGA 2RU9A 1XMBA 1WWVA 1VQ4S 1N8RO 3K5MA 2D3ZA 2E5LK 4X4VA 3O3LA 3C15A 1RT5A 5GAEI 2IVMA 3KZIU 4O5CA 4NXZA 1D09B 3RAMA 3OBIA 1HUXA 2MQ8A 4IUFA 4M47A 1RUSA 2GC8A 3VEOA 4CT9A 1JX4A 1W2BM 5LOQA 2NQPA 2JFDA 3E66A 2E6MA 3VEZA 2I1RA 4KKOA 2A2DA 2GTDA 2K4IA 8ICCA 1TL7B 3TAQA 3U8XA 2HLUA 1YBAA 2FHJD 4OVLA 4B8CA 4F4XA 1DQAA 3TFSA 2VJ5A 1J5OA 3ZNJ1 3VQ9A 1RTHA 3BREA 3FCHA 4QOZB 1F9FA 1YQHA 3ICLA 5J2CA 1Q46A 3GYGA 2W9BA 5HNKA 4LF7F 2H5XA 4JI5F 2MSTA 2YKMA 2DFLA 3DRXA 2FYXA 2MZQA 4PXDA 4CZGA 1WHXA 4BDYA 3RJEA 3LAKA 3TX8A 1KOHA 3FZMA 3TVZA 5J2PB 1RDUA 4J9PA 3BYPA 4JK1A 3EVWA 4A8MP 3UDLA 3PIOL 3L2UA 4HCCA 1HWUA 3C6AA 2VWKA 4QPTA 4RQ6A 2CPIA 4LF7K 4JI5K 4NL9C 3SDEA 3TAMB 3ZO7A 3V4IB 1S49A 1UVNA 1WC4A 4PGXA 4R66A 4M3WA 1WLJA 4JK9A 4ED4A 4JKDA 3RSEA 5KFVA 5AI9A 2E9ZA 2BQRA 3JXOA 2XY5A 1RWUA 4DN0A 1BISA 4UBBA 3CCWA 3FFIB 1S5ZA 4MKYA 2D9PA 1N63A 2F9JA 2HGMA 1J2MA 4KTZA 2AEJA 3MTKA 5E33A 1RYSA 3NH2A 2RAQA 1Y7PA 1ZBUA 3DLRA 5CR4A 2EG1A 1F5SA 5L1IA 1ZM9A 2E66A 2P66A 3OYKA 2BA9A 4F5QA 7ICFA 1B9DA 5KFWA 3K1ZA 1ZQWA 4MFAA 1LXNA 3WQUA 1RWVB 4LRBA 3Q8SB 4DZDA 1OO0B 9ICHA 3EY1A 2UUWA 1P7DA 1HJPA 5BRDA 1Q8KA 4USJC 4U96A 3JYTB 3UD3P 1Q86T 3GJQB 2BZ2A 3SQGA 2Y9TA 4ID5B 3BQ7A 3G82A 3UR3C 3W8GA 4D3GA 1YITS 3WX4A 4O3RA 3IBFB 1OJ4A 4EHUA 1HW8A 3CF5L 5BR8F 5LJ3Y 2L41A 1C4AA 1RB0A 4PA1A 3GJTB 3VZHA 3C2KA 1SJ3P 4X2BA 1OVYA 1NZPA 4B3SJ 2LXUA 1TL5A 4CTAB 3BS5A 4R0EA 2A1AA 3I55N 3X1LB 3D2FB 4O4GB 4FYVB 2P9SB 2KJ5A 2DIVA 4OI0A 2KM8C 3EGNA 2BE9B 2AYMA 4RUCA 2QEXN 4O44A 3KKFA 4LRAA 3D3BJ 4XH5A 3OL8A 1ZQMA 4FLTA 3RYLA 3Q8PB 1ZQOA 2OP5A 3DLKB 2BGGA 1BI4A 1JCFA 1V85A 2HHHJ 1RBRA 3V1QA 1S9GB 4CYUA 2NUBA 2V4QA 2PMZC 4DSLA 2WVFA 3GLJA 3ZETA 5J2DA 1WORA 1PC4A 3IMQJ 4CJQA 1BNOA 2ASMA 4M5LA 2G5IB 5AI0A 3OYDA 2R4FA 3BSNA 2FHKA 4M1KA 5EX0A 3VF0B 1XJWB 4K4TA 3EX7B 2ZH3A 3NWRA 1RBTA 2WAQD 5F0WA 5IXUA 3B6PA 4GXKA 2ZDPA 4GW6A 1EX8A 4U67Q 1WEZA 3GMGA 2Z1IA 2DKZA 4JMUA 3FZHA 1RK8A 2Y8WA 1PZNA 1FX4A 2UXBF 3CDWA 1LW2B 7ICHA 2DNKA 3EE3A 2E9TA 4Y0FA 5KFGA 3UXPA 4J9NA 1YZ6A 2J0QD 4RQ2A 3FRYA 1UJ5A 4ZVUB 2P1JA 3VQSA 1N8RT 3DLEB 2OTLS 2JVRA 1RQLA 4FF2A 5J1PA 3SJJA 2YJEA 2MDAA 2DH7A 3J81Y 2G09A 5IC4B 1ZC6A 3CJ3A 2UXBK 3DGPA 3KVGA 3ZDEA 3GOIA 2ZBPA 1LKYA 2J6TA 3MCOA 4ILMA 3A5OC 2NREA 2F8LA 5JUMA 2X6NA 3AMZA 3Q2SC 3RGIA 3EZUA 4RW7B 2RNEA 3Q8YA 4YS2A 1N54B 2XI3A 2MQNA 5DRKA 3UVJA 1DTTA 5JRTA 4OFZA 5MAOA 3L0QA 3NVYA 4RW8B 1JLGA 4F7VA 3N01A 2LPEA 4AL7A 4B3MF 1YJ9S 2N7YA 4CVNE 3M5RA 4FWLA 1RHJB 5B09A 1NDLA 4O3PA 2DNLA 3TQ1A 4MFCA 3ZZUA 4CEEA 4OZNA 3CQYA 1I94J 4FO6A 3RMBA 2LEPA 1VQ5S 4QWCA 4F0MA 1RP5A 1XQIA 3OFGA 4CZLA 1ZOTA 4HHJA 2XHBA 2ZWPA 5ALWA 3RJHA 1ZQNA 2DWQA 4O3OA 4M94A 4B3MK 4A59A 4HUGA 2GFFA 3VQ8A 2EI5A 1YUWA 2QIFA 4M5JA 1Y11A 2DGSA 3IRWP 7ICRA 1HUZA 3LTOA 2HWHA 2OA8A 1DTQB 4ELVA 2D4WA 1IG9A 4OYOA 3TSPA 1ZS6A 1Q18A 5KG1A 4O5BA 3RH4A 4E0DA 2CPFA 4JV0A 5KFIA 1MW7A 3KK3A 4F50A 3PW2A 3M6UA 3CEDA 3V5RA 4KLOA 3I4HX 4L8RB 3JQKA 3PHEA 5ALFA 1K8KA 4W5OA 2BJ1A 4DPWA 3SMVA 3BSCA 4DHYA 1HRHA 5ITHA 2KSOA 5LSLA 5BN9A 3SI8A 3PX6A 2Q0ZX 1RWOB 4NY8A 4S0MA 2FSKA 4CESA 3TOQA 4G9ZA 1RGIA 2OO4A 4I9LA 1YZ7A 3HSJA 1PAUB 2MSNA 2FY8A 2COLA 5CCMA 4FS2A