1RYUA

Solution structure of the swi1 arid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords SWI/SNF-related, matrix-associated, actin-dependent regulato
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ryuA00
1KKXA 5K4LA 2KK0A 2YQEA 5CEHA 1C20A 2OEHA 1RYUA 2LI6A 2JRZA 4LJXA 2EH9A 2LM1A 1IG6A 1KN5A 2JXJA 2RQ5A 2CXYA 2EQYA 1KQQA
chains in the Genus database with same CATH superfamily
1S9FA 8ICYA 4KLLA 2ZXIA 5KG3A 3Q8PB 4DL4A 4F5QA 1U45A 1ZQSA 2IA6A 4YXJA 2PFNA 4NLGA 1J2NA 2LM1A 1ZQPA 1C20A 4MHVA 1ZQIA 5KT7A 2WF7A 3ICXA 5F9NA 2ALZA 2VKQA 3NUQA 2NV3A 1SL2A 1HJPA 4PH5A 1JRPA 4JWNA 4ECZA 1KKXA 1N62A 1L3SA 2J6SA 5KNIA 2JGAA 2AJQA 1YT3A 1ZQ1C 4LJXA 1LKYA 3QUCA 5KFRA 4KLTA 4C8KA 3WK5A 4O0IA 2B6GA 2AGPA 5HMLA 1CUKA 1SXDA 4MFAA 4I2JA 3RR7A 3H8MA 2VA2A 4M9HA 4M9JA 4YR2A 3RRHA 2OH2A 2NRWA 3THVA 1IV8A 2GH1A 8ICEA 2AHOB 2G08A 4F4XA 1FFVA 2CXYA 3V6JA 4QZAA 4O3SA 4NL9C 2MSNA 2A3VA 2JR5A 4DF4A 2R8KA 5CWRA 4KLFA 4C80A 1UHUA 1PVQA 7ICTA 4KN4A 1UA0A 4EBEA 2NYVA 5EOZA 1S10A 3MC1A 5KFZA 3PX6A 5KFPA 3SMVA 3ALRA 5AKJA 2UVRA 5EE0A 4JB3A 5J2DA 3BQ7A 2YMLA 3NVWA 3OGUA 3PX4A 3F2DA 1ZQKA 2KNJA 2LMRA 3EPGA 2LKYA 1ZXIA 4A8EA 3RH5A 2RLTA 1ZQJA 4J9KA 1BPYA 4EYHB 3GV5B 2ZJAA 4UB4A 5L9XA 1WYGA 5AIBA 3RJGA 3AL0B 1ZQDA 3N4MB 5ALPA 3QNMA 8ICFA 2K8AA 3T5LA 5J2FA 2KIVA 2BQUA 4F91B 3SAGA 1Z1VA 3I1YA 4JV0A 2VA8A 3NRZA 2KZMA 4Q43A 3B9JA 4RQMA 4NLZA 1TV9A 3GV8B 4ECXA 4UW9A 2F8KA 5ALFA 4PZNA 5KFYA 4ECRA 1SV4A 4PL1A 2FJ6A 2LI6A 4I2FA 3I28A 3JPRA 1HIWA 4QZEA 2WF6A 1YZ6A 3VCBA 4U7CA 2C2RA 2FPLA 4KLHA 2ZUDA 4YN4A 1Z00B 1Z3EB 2ZTCA 4YCXA 4J9QA 1ZD3A 5DB6A 5A0LA 3G6VA 1QQ5A 3PO5A 3KFUF 9ICWA 1N5XA 2KSOB 1T4GA 3MGHA 4BUGA 3L3FX 2FMQA 2WAQC 3QX7A 5AKYA 4IC9A 4JWMA 1RYSA 2ZIXB 4UAZA 4GLXA 5DG8A 8ICIA 3HRDD 1JROA 5KFSA 1JN3A 2HVHA 3H8WA 2F1JA 4CGZA 1B0XA 1S0MA 2KEYA 2VIXA 4F72A 4FBTA 5AICA 4K4GA 1NK6A 3T3FA 3WKEA 4PL2A 3RAQA 4FBUA 5AKIA 3OJSA 5EWGA 1RYUA 4MFFA 5J2BA 3WKAA 2A1JB 4NLKA 4P0QB 5DB7A 5ALTA 4ECUA 3ETRA 3UMGA 4EX7A 1L3UA 1BGXT 4EELA 1Q3VA 2JEFA 4JK1A 3H0RB 3QE9Y 1TAUA 2XCPA 3WKCA 2KMDA 3IRUA 4KLSA 4FZNA 5T14A 4DOAA 2RRDA 2BDPA 4QWDA 1D8LA 5DQHA 2ZJ8A 3QU9A 2ZG6A 2HHVA 4ECTA 2ZXHA 2YMQA 4KMOB 3EUB2 4M47A 2WAQF 2HHQA 3TFRA 1SZHA 3M7DA 3F2CA 4C4RA 5JUMA 3E2EA 4PZOA 2BQRA 3GIJA 1Y88A 5KAIU 4DWIA 5ALXA 2GO7A 1QQ7A 1SWWA 1XC9A 1ZQGA 8ICTA 4YD1A 1QTMA 1RM6C 3M8SA 3GU3A 4AYBF 3WK8A 1K5OA 2YY6A 1DRGA 3GIKA 4RQ4A 3FC4A 3FAHA 4F4YA 1UCVA 1NK0A 2W54A 3F53A 5KT2A 4I2CA 4X5VA 1KEJA 4YXMA 2ZIUB 3C1YA 1MN8A 1EXNA 4NLBA 3HT3A 3KHGA 4DCCA 1COOA 1ZQHA 3NASA 5DG9A 4C8OA 2A1AA 1TKDA 5L1MA 3CW2C 2DBYA 3TI0A 3TARA 2W3SA 4DL5A 8ICLA 4ECYA 4CCHA 2W04A 1JX4A 7ICGA 2JH7A 1L8LA 5F9LA 1RQNA 4CF3A 5ALEA 1WG8A 3QU7A 4YVZA 8ICVA 4ED7A 1AROP 4P4PA 5ALIA 1UQVA 3N7PD 2VA3A 1X9WA 1P7DA 3F5EA 2HHWA 2VANA 3H8JA 4YMOA 4DSEA 4EZ9A 4I2HA 2LYAA 2O6KA 3IG5A 1S0OA 2NO4A 1L7PA 9ICJA 1QSYA 4RQ1A 1SL1A 3GZFA 4ZH4A 1OW5A 2H3ZA 1T3NA 3C2KA 2KFNA 4EYIB 3KZIU 3KHRA 4NM1A 4M6WB 5AHXA 5KT4A 1QSSA 2EAMA 5ALHA 2W9CB 5EWFA 5CEHA 1L8OA 4F5PA 4DSFA 2KK0A 9ICQA 4I2IA 1PK1A 3EPIA 9ICXA 4DS5A 3NTUA 4OJOA 5KFXA 3VC8A 2K89A 2KV2A 1SKWA 2ISPA 4Y2PA 2WHEA 2ISOA 5G5GA 3JPPA 5KG2A 5HR6A 2F1HA 5DBCA 2P35A 8ICXA 2XC9A 2KOBA 1NOMA 4QZHA 2KIWA 1OXJA 2JH1A 2JHDA 3IV6A 3UM9A 3BS7A 4QJFB 4U6PA 3QU5A 1RYRA 2FMSA 9ICCA 1GO3F 3RJEA 2Y9UA 3WK9A 1X9XA 1SKRA 2KKPA 5KFJA 2Y0SC 3H8SA 4CF5A 4C8MA 3D2NA 5AI9A 1ED1A 2I1QA 4IL6U 1T7PA 9ICAA 4E0DA 5AKZA 1JXEA 4J9SA 2JZBA 5F3XB 1QLNA 1WUDA 4F5RA 5IIMA 7ICJA 5DG7A 1B43A 2HBJA 2OCEA 2KZ3A 2IOFA 4J9OA 2E3TA 5DGBA 1WWVA 1JMSA 4M6WA 4R65A 4C4TA 2NRZA 3TAQA 8ICUA 1N60A 2QB0B 5G5HA 3PW2A 1FEZA 3T5JA 1QQ6A 4GFJA 2ZUBA 4KLGA 5J8YC 5DGAA 3LVVA 1U9LA 1QSLA 4QZ8A 2W7OA 2E1FA 1UA1A 5J0TA 3FYHA 4I29A 2W43A 1O03A 1Z4OA 4PPXA 4F4WA 5DLGA 1SL0A 3V7JA 1SKSA 4ECSA 3LDAA 4ECVA 1COKA 4B9VA 1NK8A 1KTQA 4RQ8A 9ICIA 2HCFA 1WCLA 3WK6A 2W3RA 2DKXA 5KTQA 2WTFA 3ZDBA 2Y0SF 3BQ0A 4BXOA 5IILA 1PK1B 3ZI4A 2KICA 2JRZA 5ALQA 3CP8A 3JPQA 4RZRA 1NJWA 5DB9A 3CYMA 3KD3A 1WCNA 1U47A 3D2SA 3L4PA 3WK7A 2OYYA 2KZZA 3QYPA 1VDVA 2DKZA 1FO4A 4OCZA 5J2KA 3IHQB 3QEBZ 4DLGA 4F2SA 1NJYA 2BCUA 3H7IA 4Z6EA 2AQ4A 2JMGA 1A77A 2H3QA 3RR8A 1DGSA 5AM0A 5C5JA 1Q46A 3BJYA 3AUOA 2N1RA 2D8CA 5KG1A 8ICKA 2YB1A 4CRXA 2EANA 2XO7A 4DQRA 3BQTA 2HHUA 3AN1A 1XSLA 3EYZA 4QW8A 4TURA 5ALNA 4CDGA 4ELVA 3SAHA 4M2YA 1U49A 4UATA 1ZETA 3I76A 4O3MA 3HWTA 2AGQA 3TADC 3RJJA 5AM3A 3QXGA 3JPSA 3L5KA 9ICUA 3U26A 2J6UA 3ED5A 1Z00A 3PSPA 4QWBA 3RBDA 1B4FA 4FS1A 4MEXA 5J8YA 1QH9A 2IOHA 2ASDA 1S76D 4RQ3A 2A1JA 5J29A 1MQ3A 2CN1A 4YMNA 2FI1A 4DFPA 1ZQLA 1F44A 3MDCA 1CI4A 4B6JA 2W11A 4OD0A 5JU5A 3PNCA 2MU2A 2BCRA 2W9MA 4Y2QA 4RT3A 4QZBA 2P66A 2HBLA 9ICMA 9ICSA 4O3OA 3ISCA 2QLTA 2B0CA 3MR2A 2DPIA 2K4EA 1BPXA 7ICFA 3AEVA 2KD1A 4JV2A 5B5EU 5TZVA 2PKEA 5IIIA 4YG2A 1NNLA 2DWQA 4EX6A 7ICIA 3OSNA 3G6YA 2WF8A 5IIKA 3SI8A 4F4ZA 1A76A 4DQIA 1PVRA 4J9MA 1RXWA 2PFQA 2WFAA 5AK3A 2Q0ZX 2R8IA 3WK4A 5B66U 5J2EA 3V7KA 4OJLA 2DF4B 2Y1IA 2JV3A 4O3PA 4AYBC 4FO6A 4MF2A 2EH9A 4NJ8A 3NVVA 4PGQA 1C7YA 3F5AA 5K4LA 2FDRA 5J0OA 2PMZF 5ALJA 1TAQA 1CEZA 8ICGA 3BS5B 4UB1A 3O0FA 4LZGA 1XO0A 1V97A 3IDWA 1TFRA 3B0XA 1AQ6A 3QUQA 4KLJA 4M9GA 3KHHA 5CHGA 1KFDA 2EDUA 4EBDA 1L7NA 2CPRA 4G9BA 1X9MA 5HMMA 2KSOA 1A6SA 2YX8A 3SV4A 1ZRNA 1RG6A 3C2LA 4DFKA 2W55A 4DOBA 3LWMA 1ZQUA 3QU4A 2F44A 5KG5A 3PW4A 1N48A 3V6HA 1DK3A 1ZQTA 4UB6U 1TVAA 2BHNA 4QZCA 1J2MA 2ZIVB 3LYSA 3Q8LA 3MABA 3N7RC 2KHQA 3N97B 3AM9A 3MGVA 2WF5A 4XQ8A 4BWJA 1ZQAA 2K4PA 4B9SA 2CRXA 1NK7A 4I2GA 5KG4A 1KBUA 4RNOA 4RNMA 1X2IA 3UPQA 4RPXA 4YQWA 1V9PA 2ZTEA 1XS9D 2EZYA 5AI0A 2KVCA 3SEIA 4P4MA 5IINA 5C0YA 4QZ9A 1ZQVA 1T8EA 3KHLA 5J2JA 3HX0A 3EZ5A 4DQPA 3UQ2A 4J9RA 2ASLA 4EEYA 2DFLA 3NRWA 2MRLA 5KFWA 1BPZA 1ZQBA 3PY8A 4PHPA 1KQQA 2NRTA 1MA7A 4RQ0A 5GTHU 3JPNA 5J0RA 5J0SA 3PO4A 4Z6FA 2Q4TA 5DLFA 7ICMA 2JXJA 4OO1J 2VJ5A 4XA5A 3PR5B 4Y2XA 4I28A 4RUAA 4B9UA 1ZQMA 5ALKA 2PFPA 4QW9A 1UPHA 1NKCA 2KJ9A 2XGPA 5JTIA 4IS7A 4O3NA 4GXIA 3ISDA 3D6JA 3ONNA 8ICQA 4RUCA 3T5HA 3GILA 4TUQA 2LHTA 3BQ2A 4C0ZA 2XY5A 1Z1BA 3BZKA 4CNQA 4EZ6A 3RJHA 5AM4A 4IQVA 4IQWA 5E79U 2WB1C 2QB1A 2C22A 4I2BA 4QZGA 9ICRA 3LK9A 2XI9A 4P0PB 8ICNA 1J97A 3QZ8A 1NKEA 2E5SA 4NY8A 1X6IA 4GXKA 4DQSA 2DPJA 1LB2B 2KTQA 1ZD4A 3G6XA 3RJIA 5KFHA 1LV5A 3GDXA 5AKLA 1IM4A 5J2AA 2QARB 2MA1A 3RJFA 2HI0A 4ZOHC 1HUOA 2P6RA 1VLBA 4RU9A 1PZNA 2R8JA 5KFEA 4DOCA 4J9PA 4I2AA 1ZQXA 3HILA 5J0UA 7ICOA 2ZIWA 5HHIA 4K4HA 1IIPA 2ZUCA 3Q8KA 3PW0A 5CRXA 4Q45A 2BGWA 3LWLA 3M6KA 1T94A 2E8MA 3EW9A 1SIJA 4F93B 2HMXA 2QKQA 4MEYA 2E8OA 4TUSA 3FM9A 9ICOA 4ICAA 4KLQA 2W9BA 3MR5A 4DEZA 4IRDA 1ZQOA 4IRCA 4R8UB 2GWSA 1H38A 5ALSA 1KW4A 2HOQA 2AQ0A 4UAVA 2RHFA 3Q8MA 3MDAA 3RJKA 1XU4A 5CP2A 4LVSA 5HR7A 2ZJ5A 1KFSA 1L7MA 1S77D 2AXTU 4UBBA 2K4HA 4RQ2A 1NK5A 4BXOB 4O3QA 4LZDA 1BVSA 5KAFU 4PJ0U 3MR6A 4O5EA 3IN5A 1O08A 9ICLA 4GIBA 5KT3A 4US9A 2J6TA 2BCQA 1IG6A 5HHHA 4Q8FA 4F5OA 5J0QA 3OHAA 4B9MA 4JUZA 2BCSA 3QEAZ 9ICNA 9ICPA 5J0WA 4K4IA 4DSIA 3HKZC 4ED6A 2V4RA 3TADA 4DO9A 1KDHA 1XSNA 1RXVA 2ZIXA 2H5XA 3R9KA 7ICNA 1SXEA 5BPCA 4KLMA 1T3QA 2ZIWB 1Q3UA 2KJ8A 3H4DA 3SYZA 2V4QA 5AK5A 7ICKA 2MAXA 1ZQWA 2FPMA 1ZQNA 3UXPA 4NV0A 2HSZA 5KFOA 4R66A 2XICA 4Z6CA 8ICBA 1RZTA 4DSLA 4QNLA 2KN7A 2QARA 2DGZA 2PI5A 3C2MA 1BPDA 2ZTDA 8ICHA 2G09A 4DSKA 5JRTA 1L3VA 1B22A 5J0YA 3JPTA 2OXOA 3ZD8A 3PV8A 2KE7A 1JIHA 2WF9A 4ACOA 2ES6A 4ED1A 1NK4A 2M9NA 4NLNA 5J2GA 3S6JA 3SR6A 3V72A 4BGDA 1TK8A 1KN5A 4DFDA 5L1LA 5DDMA 3RB4A 2FLNA 3A0BU 1Z4NA 2Y1JA 1UT5A 2BPCA 2XGQA 5KFAA 4YMMA 1SV0C 3C23A 2KP7A 1N63A 8ICWA 5KT5A 4ELUA 3HJEA 2UVUA 4Y2JA 5KL1B 3AQEA 2C2DA 3OTQA 2OEHA 3C1ZA 1FIQA 1ZQQA 1Z19A 3H4BA 1N56A 1D8YA 2F3NA 3UMBA 4RQ7A 4F92B 3KTQA 2F77X 1U4BA 4F71A 9ICFA 2BPGA 1XNSA 2BPFA 2K8BB 2UVVA 2PI4A 3RB6A 2FMPA 2W9BB 3M9NB 5KFUA 5KFMA 1S0NA 2HBMA 1WWUA 4O5CA 4R64A 1PUZA 5CA7A 4ECQA 4I27A 3OJUA 4F50A 3RTVA 2HHTA 4EENA 1ZQZA 1PK3A 2EZZA 2LPEA 2BR0A 2AH5A 4QIWC 2HHSA 2LYHA 4FE3A 4PHAA 3M9OB 1KRPA 1KL9A 2HOIA 4CF4A 5KFVA 2BZFA 5ALRA 1SWVA 4B9TA 4Y2SA 4WJ3B 3BQ1A 1NJZA 3RBEA 5KFGA 2UVWA 4OJ5A 5ALZA 4F2RA 4DF8A 2NRVA 4KLEA 1XWLA 1DGJA 5DB8A 8ICJA 4KN7A 2LM4A 3M6ZA 4KMUA 5CR0A 4YD2A 4F8RA 1IXRA 5TISU 3SZ2A 2YB4A 9ICKA 4F5NA 3PMNA 3PSIA 3UXNA 4KLIA 2JZBB 1NJXA 2MUTB 2H3VA 8ICPA 4UB5A 2AU0A 2E1EA 1D9DA 5J2HA 1LVHA 3D2QA 2F76X 3PX0A 1RQLA 4US8A 2W03A 3MFHA 3PSFA 3MBYA 3QUTA 1K1SA 3QZ7A 4JV1A 4NL9A 1XO1A 2HBKA 1PVPA 2B21A 1HEKA 4RT2A 3BS5A 1X66A 5EE1A 1A0PA 1ZQCA 4BDPA 1ZOLA 4Y2YA 2EQYA 5ALLA 5AKEA 4M0AA 2DQNB 5ALMA 4UB3A 5AKHA 2K8CB 3OHBA 3NVZA 7ICLA 2JEJA 9ICEA 2G5IB 3Q8SB 2L5YA 1S5LU 5J0XA 5ALUA 3HPOA 2HOFA 4Y2TA 4MF8A 4G3IA 7ICUA 4CE6A 4KX3A 1KFTA 4NXZA 5D49A 2EAOA 4ED3A 4HYKA 3RAXA 5AK4A 4QWEA 3RRGA 2XCAA 1SZPA 2JEIA 1D9FA 9ICVA 2R18A 3CNHA 5CJ7A 3RB3A 3RH4A 1TAMA 4MFCA 3C5FA 2V9WA 3H0LB 2YN4A 2YMPA 1F0MA 1F5SA 2YMMA 4QWAA 4C8LA 3C28A 5EE3A 4Q8EA 4Y2UA 1OUQA 2FE9A 2K60A 8ICCA 4USAA 5AI8A 3PSTA 3KKAA 1S97A 4KLUA 4O3RA 5IIJA 3C21A 2H3FA 2ASJA 1VJ5A 4UQGA 3GIIA 2HW3A 3PW5A 3Q8QB 3FDSA 4UASA 5BOLA 3M1YA 3ZDEA 1ZQRA 1RDFA 2RDJA 1NZPA 4UB8U 5DDYA 4ECWA 3PVXA 3RB0A 3HW8A 3T79A 1JUDA 3IM1A 2EZXA 2W9CA 4I2DA 3C5GA 3AQFA 3UMCA 1K1QA 4C7ZA 4QZDA 3IG8A 3V7LA 1SV0A 5FP0A 3TAPA 2LBOA 4YR0A 4RPZA 2I9GA 3H40A 3ZDDA 2F8LA 4AP9A 3DDHA 5AI5A 2G5HB 3DV9A 5DQIA 2G06A 1XSPA 5EE9A 5DKWA 3WU2U 5DQGA 4P2HA 1N61A 4RNNA 1UT8A 3SENA 3T5KA 3H0MB 4KX5A 5KFIA 4QIWF 2OHFA 1MQ2A 5D46A 2OWOA 1DXSA 5H2FU 4DL2A 2Y9TA 4IR1A 4KITB 2MUTA 1X40A 3GFKB 4PHEA 2OM6A 4J9LA 3AU6A 4FS2A 3AMZA 3M9MB 2AGOA 2R8HA 2NO5A 2VJ4A 4RQ5A 4GC6A 8ICZA 2W8KA 3RF9A 5J2IA 1TE2A 4BJQA 9ICBA 3DEEA 4YP3A 1TK5A 3RFAA 2BKEA 2IOFK 5L1IA 1S0VA 4DQQA 3PW7A 3EWAA 4Y2VA 4HAIA 1L6NA 4UAUA 1U48A 3ZD9A 1JI7A 3K1RB 2KHVA 5KG7A 2FLPA 3GQCA 5AM2A 1X42A 5KFDA 2XY7A 4DL3A 5AM5A 3ISBA 1BNPA 4J9NA 1QCKA 3PZPA 4TQRA 1L3TA 7ICHA 3PMLA 4DFJA 7ICVA 5GTIU 1ZD2P 1SB3C 3KZXA 4PGYA 4DSJA 4QZFA 2E8NA 3HKZF 4IR9A 2PXIA 1BPEA 3F2BA 1DK2A 4ED8A 4KTQA 3UQ0A 2BQ3A 2LYBA 1KLNA 5HP4A 4ED0A 3TFSA 3N7SC 2XIDA 5KFLA 3SV3A 5EWEA 4PGXA 1CRXA 4KLOA 4PHDA 5AM1A 4JMUA 2YTUA 4IRKA 3KBBA 1N2XA 4B9NA 3GV7B 5ALDA 1JXLA 4F3OA 4ED2A 2G0AA 3BZCA 8ICAA 2KG5A 3TQ1A 4DLEA 3V6KA 3K1ZA 5L1JA 1Q8KA 3A0HU 2HHXA 2BDUA 5AK6A 4Z6DA 1NKBA 1KSPA 3WKDA 1TK0A 5KFFA 4OJPA 4UBCA 3LVWA 2H3IA 4Y2RA 4RQ6A 1YZ7A 3E0FA 1X9SA 3BDPA 3SD7A 4M9NA 4RQNA 2KJ5A 7ICQA 3QU2A 4DL6A 2ATLA 2JEGA 5KFNA 4UARA 4TQSA 2IHNA 1JALA 2RQ5A 4C7YA 1BPBA 4XRHA 3ZDAA 1ZQYA 2ZIUA 2ZIVA 4UAWA 4QZIA 5ALVA 5AI4A 3GIMA 4C8NA 4XUSA 2IHMA 4YFKA 3CRXA 2HVIA 2M0NA 1ZQEA 1NZBA 5KFCA 5J2CA 4B9LA 5ALYA 2FPKA 1NI3A 3QUBA 2KFZA 4YR3A 4EEKA 2RDIA 4NLCA 4R8UA 2DL0A 4GXJA 2NRXA 4Q44A 4P0PA 4O9MA 1X6JA 5AIAA 2W8LA 3RH6A 1ZJMA 4IQTA 5DBAA 9ICTA 1ZQFA 1FFUA 3B0YA 7ICSA 5KT6A 3PR4A 2EAPA 3OSPA 3K4GA 3J81j 5KFKA 5CB1A 5KL8B 3IP4B 2IBKA 1SGGA 1ECWA 8ICOA 1S8OA 7ICPA 1URJA 2C2EA 3MR3A 4M04A 2QB0A 2E8PA 3AU2A 2BCVA 9ICGA 2KVSA 2W9AA 2GLEA 1RPLA 3M8RA 4EBCA 2C28A 4NWIA 2R8GA 5AI6A 3E58A 4J03A 3MFIA 3OPXA 1ZYQA 4NM2A 5D4BA 3K75D 4KLDA 2I5HA 5AKKA 5AKGA 4UB2A 3MGIA 2K4IA 2P6UA 8ICMA 5KG0A 5J0PA 1ZRMA 4P0QA 3SAFA 2RP5A 8ICSA 7ICEA 3ETLA 9ICHA 3ORYA 3SQIA 4P4OA 5HNKA 7ICRA 1DOQA 5DBBA 4FZMA 3NGDA 1M6YA 3ZDCA 2PFOA 1HUZA 2WB1F 5KFBA 2D6FC 1BNOA 2ODGA 5ALWA 2I6XA 5ALOA 4DFMA 3WKBA 2XVTA 2XY6A 2G07A 5KFQA 3TACB 4TUPA 3TANA 4DS4A 4IQUA 1D8BA 2ESEA 5ALGA 4UAYA 3NS1A 2KKVA 4FZLA 2Z7JA 1MC8A 4O5KA 2PMZC 5IIOA 4BX9C 4C4SA 2IMWP 3KOOA 1ZD5A 4FFDA 3N28A 3TKAA 2FLLA 2F1IA 1V38A 2HDOA 5KFTA 3HP6A 1N5WA 5AKXA 4RPYA 5KG6A 4DL7A 4OJ6A 1NK9A 2D3DA 4ELTA 4F4KA 1L5UA 1MSWD 3JPOA 8ICRA 3C29A 4GC7A 4QWCA 1L7OA 4M9LA 3UXOA 5BOMA 4BWMA 3KKAC 3Q8RB 2A19A 5L1KA 3NVYA 4I2EA 1V85A 1ZJNA 2GOLA 2YQEA 1LKYB 4R63A 2F2AB 2DUYA 2W7PA
chains in the Genus database with same CATH topology
1KKXA 5K4LA 2KK0A 2YQEA 5CEHA 1C20A 2OEHA 1RYUA 2LI6A 2JRZA 4LJXA 2EH9A 2LM1A 1IG6A 1KN5A 2JXJA 2RQ5A 2CXYA 2EQYA 1KQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKX A;  5K4L A;  2KK0 A;  2YQE A;  5CEH A;  1C20 A;  2OEH A;  1RYU A;  2LI6 A;  2JRZ A;  4LJX A;  2EH9 A;  2LM1 A;  1IG6 A;  1KN5 A;  2JXJ A;  2RQ5 A;  2CXY A;  2EQY A;  1KQQ A; 
#chains in the Genus database with same CATH topology
 1S9F A;  8ICY A;  4KLL A;  2ZXI A;  5KG3 A;  3Q8P B;  4DL4 A;  4F5Q A;  1U45 A;  1ZQS A;  2IA6 A;  4YXJ A;  2PFN A;  4NLG A;  1J2N A;  2LM1 A;  1ZQP A;  1C20 A;  4MHV A;  1ZQI A;  5KT7 A;  2WF7 A;  3ICX A;  5F9N A;  2ALZ A;  2VKQ A;  3NUQ A;  2NV3 A;  1SL2 A;  1HJP A;  4PH5 A;  1JRP A;  4JWN A;  4ECZ A;  1KKX A;  1N62 A;  1L3S A;  2J6S A;  5KNI A;  2JGA A;  2AJQ A;  1YT3 A;  1ZQ1 C;  4LJX A;  1LKY A;  3QUC A;  5KFR A;  4KLT A;  4C8K A;  3WK5 A;  4O0I A;  2B6G A;  2AGP A;  5HML A;  1CUK A;  1SXD A;  4MFA A;  4I2J A;  3RR7 A;  3H8M A;  2VA2 A;  4M9H A;  4M9J A;  4YR2 A;  3RRH A;  2OH2 A;  2NRW A;  3THV A;  1IV8 A;  2GH1 A;  8ICE A;  2AHO B;  2G08 A;  4F4X A;  1FFV A;  2CXY A;  3V6J A;  4QZA A;  4O3S A;  4NL9 C;  2MSN A;  2A3V A;  2JR5 A;  4DF4 A;  2R8K A;  5CWR A;  4KLF A;  4C80 A;  1UHU A;  1PVQ A;  7ICT A;  4KN4 A;  1UA0 A;  4EBE A;  2NYV A;  5EOZ A;  1S10 A;  3MC1 A;  5KFZ A;  3PX6 A;  5KFP A;  3SMV A;  3ALR A;  5AKJ A;  2UVR A;  5EE0 A;  4JB3 A;  5J2D A;  3BQ7 A;  2YML A;  3NVW A;  3OGU A;  3PX4 A;  3F2D A;  1ZQK A;  2KNJ A;  2LMR A;  3EPG A;  2LKY A;  1ZXI A;  4A8E A;  3RH5 A;  2RLT A;  1ZQJ A;  4J9K A;  1BPY A;  4EYH B;  3GV5 B;  2ZJA A;  4UB4 A;  5L9X A;  1WYG A;  5AIB A;  3RJG A;  3AL0 B;  1ZQD A;  3N4M B;  5ALP A;  3QNM A;  8ICF A;  2K8A A;  3T5L A;  5J2F A;  2KIV A;  2BQU A;  4F91 B;  3SAG A;  1Z1V A;  3I1Y A;  4JV0 A;  2VA8 A;  3NRZ A;  2KZM A;  4Q43 A;  3B9J A;  4RQM A;  4NLZ A;  1TV9 A;  3GV8 B;  4ECX A;  4UW9 A;  2F8K A;  5ALF A;  4PZN A;  5KFY A;  4ECR A;  1SV4 A;  4PL1 A;  2FJ6 A;  2LI6 A;  4I2F A;  3I28 A;  3JPR A;  1HIW A;  4QZE A;  2WF6 A;  1YZ6 A;  3VCB A;  4U7C A;  2C2R A;  2FPL A;  4KLH A;  2ZUD A;  4YN4 A;  1Z00 B;  1Z3E B;  2ZTC A;  4YCX A;  4J9Q A;  1ZD3 A;  5DB6 A;  5A0L A;  3G6V A;  1QQ5 A;  3PO5 A;  3KFU F;  9ICW A;  1N5X A;  2KSO B;  1T4G A;  3MGH A;  4BUG A;  3L3F X;  2FMQ A;  2WAQ C;  3QX7 A;  5AKY A;  4IC9 A;  4JWM A;  1RYS A;  2ZIX B;  4UAZ A;  4GLX A;  5DG8 A;  8ICI A;  3HRD D;  1JRO A;  5KFS A;  1JN3 A;  2HVH A;  3H8W A;  2F1J A;  4CGZ A;  1B0X A;  1S0M A;  2KEY A;  2VIX A;  4F72 A;  4FBT A;  5AIC A;  4K4G A;  1NK6 A;  3T3F A;  3WKE A;  4PL2 A;  3RAQ A;  4FBU A;  5AKI A;  3OJS A;  5EWG A;  1RYU A;  4MFF A;  5J2B A;  3WKA A;  2A1J B;  4NLK A;  4P0Q B;  5DB7 A;  5ALT A;  4ECU A;  3ETR A;  3UMG A;  4EX7 A;  1L3U A;  1BGX T;  4EEL A;  1Q3V A;  2JEF A;  4JK1 A;  3H0R B;  3QE9 Y;  1TAU A;  2XCP A;  3WKC A;  2KMD A;  3IRU A;  4KLS A;  4FZN A;  5T14 A;  4DOA A;  2RRD A;  2BDP A;  4QWD A;  1D8L A;  5DQH A;  2ZJ8 A;  3QU9 A;  2ZG6 A;  2HHV A;  4ECT A;  2ZXH A;  2YMQ A;  4KMO B;  3EUB 2;  4M47 A;  2WAQ F;  2HHQ A;  3TFR A;  1SZH A;  3M7D A;  3F2C A;  4C4R A;  5JUM A;  3E2E A;  4PZO A;  2BQR A;  3GIJ A;  1Y88 A;  5KAI U;  4DWI A;  5ALX A;  2GO7 A;  1QQ7 A;  1SWW A;  1XC9 A;  1ZQG A;  8ICT A;  4YD1 A;  1QTM A;  1RM6 C;  3M8S A;  3GU3 A;  4AYB F;  3WK8 A;  1K5O A;  2YY6 A;  1DRG A;  3GIK A;  4RQ4 A;  3FC4 A;  3FAH A;  4F4Y A;  1UCV A;  1NK0 A;  2W54 A;  3F53 A;  5KT2 A;  4I2C A;  4X5V A;  1KEJ A;  4YXM A;  2ZIU B;  3C1Y A;  1MN8 A;  1EXN A;  4NLB A;  3HT3 A;  3KHG A;  4DCC A;  1COO A;  1ZQH A;  3NAS A;  5DG9 A;  4C8O A;  2A1A A;  1TKD A;  5L1M A;  3CW2 C;  2DBY A;  3TI0 A;  3TAR A;  2W3S A;  4DL5 A;  8ICL A;  4ECY A;  4CCH A;  2W04 A;  1JX4 A;  7ICG A;  2JH7 A;  1L8L A;  5F9L A;  1RQN A;  4CF3 A;  5ALE A;  1WG8 A;  3QU7 A;  4YVZ A;  8ICV A;  4ED7 A;  1ARO P;  4P4P A;  5ALI A;  1UQV A;  3N7P D;  2VA3 A;  1X9W A;  1P7D A;  3F5E A;  2HHW A;  2VAN A;  3H8J A;  4YMO A;  4DSE A;  4EZ9 A;  4I2H A;  2LYA A;  2O6K A;  3IG5 A;  1S0O A;  2NO4 A;  1L7P A;  9ICJ A;  1QSY A;  4RQ1 A;  1SL1 A;  3GZF A;  4ZH4 A;  1OW5 A;  2H3Z A;  1T3N A;  3C2K A;  2KFN A;  4EYI B;  3KZI U;  3KHR A;  4NM1 A;  4M6W B;  5AHX A;  5KT4 A;  1QSS A;  2EAM A;  5ALH A;  2W9C B;  5EWF A;  5CEH A;  1L8O A;  4F5P A;  4DSF A;  2KK0 A;  9ICQ A;  4I2I A;  1PK1 A;  3EPI A;  9ICX A;  4DS5 A;  3NTU A;  4OJO A;  5KFX A;  3VC8 A;  2K89 A;  2KV2 A;  1SKW A;  2ISP A;  4Y2P A;  2WHE A;  2ISO A;  5G5G A;  3JPP A;  5KG2 A;  5HR6 A;  2F1H A;  5DBC A;  2P35 A;  8ICX A;  2XC9 A;  2KOB A;  1NOM A;  4QZH A;  2KIW A;  1OXJ A;  2JH1 A;  2JHD A;  3IV6 A;  3UM9 A;  3BS7 A;  4QJF B;  4U6P A;  3QU5 A;  1RYR A;  2FMS A;  9ICC A;  1GO3 F;  3RJE A;  2Y9U A;  3WK9 A;  1X9X A;  1SKR A;  2KKP A;  5KFJ A;  2Y0S C;  3H8S A;  4CF5 A;  4C8M A;  3D2N A;  5AI9 A;  1ED1 A;  2I1Q A;  4IL6 U;  1T7P A;  9ICA A;  4E0D A;  5AKZ A;  1JXE A;  4J9S A;  2JZB A;  5F3X B;  1QLN A;  1WUD A;  4F5R A;  5IIM A;  7ICJ A;  5DG7 A;  1B43 A;  2HBJ A;  2OCE A;  2KZ3 A;  2IOF A;  4J9O A;  2E3T A;  5DGB A;  1WWV A;  1JMS A;  4M6W A;  4R65 A;  4C4T A;  2NRZ A;  3TAQ A;  8ICU A;  1N60 A;  2QB0 B;  5G5H A;  3PW2 A;  1FEZ A;  3T5J A;  1QQ6 A;  4GFJ A;  2ZUB A;  4KLG A;  5J8Y C;  5DGA A;  3LVV A;  1U9L A;  1QSL A;  4QZ8 A;  2W7O A;  2E1F A;  1UA1 A;  5J0T A;  3FYH A;  4I29 A;  2W43 A;  1O03 A;  1Z4O A;  4PPX A;  4F4W A;  5DLG A;  1SL0 A;  3V7J A;  1SKS A;  4ECS A;  3LDA A;  4ECV A;  1COK A;  4B9V A;  1NK8 A;  1KTQ A;  4RQ8 A;  9ICI A;  2HCF A;  1WCL A;  3WK6 A;  2W3R A;  2DKX A;  5KTQ A;  2WTF A;  3ZDB A;  2Y0S F;  3BQ0 A;  4BXO A;  5IIL A;  1PK1 B;  3ZI4 A;  2KIC A;  2JRZ A;  5ALQ A;  3CP8 A;  3JPQ A;  4RZR A;  1NJW A;  5DB9 A;  3CYM A;  3KD3 A;  1WCN A;  1U47 A;  3D2S A;  3L4P A;  3WK7 A;  2OYY A;  2KZZ A;  3QYP A;  1VDV A;  2DKZ A;  1FO4 A;  4OCZ A;  5J2K A;  3IHQ B;  3QEB Z;  4DLG A;  4F2S A;  1NJY A;  2BCU A;  3H7I A;  4Z6E A;  2AQ4 A;  2JMG A;  1A77 A;  2H3Q A;  3RR8 A;  1DGS A;  5AM0 A;  5C5J A;  1Q46 A;  3BJY A;  3AUO A;  2N1R A;  2D8C A;  5KG1 A;  8ICK A;  2YB1 A;  4CRX A;  2EAN A;  2XO7 A;  4DQR A;  3BQT A;  2HHU A;  3AN1 A;  1XSL A;  3EYZ A;  4QW8 A;  4TUR A;  5ALN A;  4CDG A;  4ELV A;  3SAH A;  4M2Y A;  1U49 A;  4UAT A;  1ZET A;  3I76 A;  4O3M A;  3HWT A;  2AGQ A;  3TAD C;  3RJJ A;  5AM3 A;  3QXG A;  3JPS A;  3L5K A;  9ICU A;  3U26 A;  2J6U A;  3ED5 A;  1Z00 A;  3PSP A;  4QWB A;  3RBD A;  1B4F A;  4FS1 A;  4MEX A;  5J8Y A;  1QH9 A;  2IOH A;  2ASD A;  1S76 D;  4RQ3 A;  2A1J A;  5J29 A;  1MQ3 A;  2CN1 A;  4YMN A;  2FI1 A;  4DFP A;  1ZQL A;  1F44 A;  3MDC A;  1CI4 A;  4B6J A;  2W11 A;  4OD0 A;  5JU5 A;  3PNC A;  2MU2 A;  2BCR A;  2W9M A;  4Y2Q A;  4RT3 A;  4QZB A;  2P66 A;  2HBL A;  9ICM A;  9ICS A;  4O3O A;  3ISC A;  2QLT A;  2B0C A;  3MR2 A;  2DPI A;  2K4E A;  1BPX A;  7ICF A;  3AEV A;  2KD1 A;  4JV2 A;  5B5E U;  5TZV A;  2PKE A;  5III A;  4YG2 A;  1NNL A;  2DWQ A;  4EX6 A;  7ICI A;  3OSN A;  3G6Y A;  2WF8 A;  5IIK A;  3SI8 A;  4F4Z A;  1A76 A;  4DQI A;  1PVR A;  4J9M A;  1RXW A;  2PFQ A;  2WFA A;  5AK3 A;  2Q0Z X;  2R8I A;  3WK4 A;  5B66 U;  5J2E A;  3V7K A;  4OJL A;  2DF4 B;  2Y1I A;  2JV3 A;  4O3P A;  4AYB C;  4FO6 A;  4MF2 A;  2EH9 A;  4NJ8 A;  3NVV A;  4PGQ A;  1C7Y A;  3F5A A;  5K4L A;  2FDR A;  5J0O A;  2PMZ F;  5ALJ A;  1TAQ A;  1CEZ A;  8ICG A;  3BS5 B;  4UB1 A;  3O0F A;  4LZG A;  1XO0 A;  1V97 A;  3IDW A;  1TFR A;  3B0X A;  1AQ6 A;  3QUQ A;  4KLJ A;  4M9G A;  3KHH A;  5CHG A;  1KFD A;  2EDU A;  4EBD A;  1L7N A;  2CPR A;  4G9B A;  1X9M A;  5HMM A;  2KSO A;  1A6S A;  2YX8 A;  3SV4 A;  1ZRN A;  1RG6 A;  3C2L A;  4DFK A;  2W55 A;  4DOB A;  3LWM A;  1ZQU A;  3QU4 A;  2F44 A;  5KG5 A;  3PW4 A;  1N48 A;  3V6H A;  1DK3 A;  1ZQT A;  4UB6 U;  1TVA A;  2BHN A;  4QZC A;  1J2M A;  2ZIV B;  3LYS A;  3Q8L A;  3MAB A;  3N7R C;  2KHQ A;  3N97 B;  3AM9 A;  3MGV A;  2WF5 A;  4XQ8 A;  4BWJ A;  1ZQA A;  2K4P A;  4B9S A;  2CRX A;  1NK7 A;  4I2G A;  5KG4 A;  1KBU A;  4RNO A;  4RNM A;  1X2I A;  3UPQ A;  4RPX A;  4YQW A;  1V9P A;  2ZTE A;  1XS9 D;  2EZY A;  5AI0 A;  2KVC A;  3SEI A;  4P4M A;  5IIN A;  5C0Y A;  4QZ9 A;  1ZQV A;  1T8E A;  3KHL A;  5J2J A;  3HX0 A;  3EZ5 A;  4DQP A;  3UQ2 A;  4J9R A;  2ASL A;  4EEY A;  2DFL A;  3NRW A;  2MRL A;  5KFW A;  1BPZ A;  1ZQB A;  3PY8 A;  4PHP A;  1KQQ A;  2NRT A;  1MA7 A;  4RQ0 A;  5GTH U;  3JPN A;  5J0R A;  5J0S A;  3PO4 A;  4Z6F A;  2Q4T A;  5DLF A;  7ICM A;  2JXJ A;  4OO1 J;  2VJ5 A;  4XA5 A;  3PR5 B;  4Y2X A;  4I28 A;  4RUA A;  4B9U A;  1ZQM A;  5ALK A;  2PFP A;  4QW9 A;  1UPH A;  1NKC A;  2KJ9 A;  2XGP A;  5JTI A;  4IS7 A;  4O3N A;  4GXI A;  3ISD A;  3D6J A;  3ONN A;  8ICQ A;  4RUC A;  3T5H A;  3GIL A;  4TUQ A;  2LHT A;  3BQ2 A;  4C0Z A;  2XY5 A;  1Z1B A;  3BZK A;  4CNQ A;  4EZ6 A;  3RJH A;  5AM4 A;  4IQV A;  4IQW A;  5E79 U;  2WB1 C;  2QB1 A;  2C22 A;  4I2B A;  4QZG A;  9ICR A;  3LK9 A;  2XI9 A;  4P0P B;  8ICN A;  1J97 A;  3QZ8 A;  1NKE A;  2E5S A;  4NY8 A;  1X6I A;  4GXK A;  4DQS A;  2DPJ A;  1LB2 B;  2KTQ A;  1ZD4 A;  3G6X A;  3RJI A;  5KFH A;  1LV5 A;  3GDX A;  5AKL A;  1IM4 A;  5J2A A;  2QAR B;  2MA1 A;  3RJF A;  2HI0 A;  4ZOH C;  1HUO A;  2P6R A;  1VLB A;  4RU9 A;  1PZN A;  2R8J A;  5KFE A;  4DOC A;  4J9P A;  4I2A A;  1ZQX A;  3HIL A;  5J0U A;  7ICO A;  2ZIW A;  5HHI A;  4K4H A;  1IIP A;  2ZUC A;  3Q8K A;  3PW0 A;  5CRX A;  4Q45 A;  2BGW A;  3LWL A;  3M6K A;  1T94 A;  2E8M A;  3EW9 A;  1SIJ A;  4F93 B;  2HMX A;  2QKQ A;  4MEY A;  2E8O A;  4TUS A;  3FM9 A;  9ICO A;  4ICA A;  4KLQ A;  2W9B A;  3MR5 A;  4DEZ A;  4IRD A;  1ZQO A;  4IRC A;  4R8U B;  2GWS A;  1H38 A;  5ALS A;  1KW4 A;  2HOQ A;  2AQ0 A;  4UAV A;  2RHF A;  3Q8M A;  3MDA A;  3RJK A;  1XU4 A;  5CP2 A;  4LVS A;  5HR7 A;  2ZJ5 A;  1KFS A;  1L7M A;  1S77 D;  2AXT U;  4UBB A;  2K4H A;  4RQ2 A;  1NK5 A;  4BXO B;  4O3Q A;  4LZD A;  1BVS A;  5KAF U;  4PJ0 U;  3MR6 A;  4O5E A;  3IN5 A;  1O08 A;  9ICL A;  4GIB A;  5KT3 A;  4US9 A;  2J6T A;  2BCQ A;  1IG6 A;  5HHH A;  4Q8F A;  4F5O A;  5J0Q A;  3OHA A;  4B9M A;  4JUZ A;  2BCS A;  3QEA Z;  9ICN A;  9ICP A;  5J0W A;  4K4I A;  4DSI A;  3HKZ C;  4ED6 A;  2V4R A;  3TAD A;  4DO9 A;  1KDH A;  1XSN A;  1RXV A;  2ZIX A;  2H5X A;  3R9K A;  7ICN A;  1SXE A;  5BPC A;  4KLM A;  1T3Q A;  2ZIW B;  1Q3U A;  2KJ8 A;  3H4D A;  3SYZ A;  2V4Q A;  5AK5 A;  7ICK A;  2MAX A;  1ZQW A;  2FPM A;  1ZQN A;  3UXP A;  4NV0 A;  2HSZ A;  5KFO A;  4R66 A;  2XIC A;  4Z6C A;  8ICB A;  1RZT A;  4DSL A;  4QNL A;  2KN7 A;  2QAR A;  2DGZ A;  2PI5 A;  3C2M A;  1BPD A;  2ZTD A;  8ICH A;  2G09 A;  4DSK A;  5JRT A;  1L3V A;  1B22 A;  5J0Y A;  3JPT A;  2OXO A;  3ZD8 A;  3PV8 A;  2KE7 A;  1JIH A;  2WF9 A;  4ACO A;  2ES6 A;  4ED1 A;  1NK4 A;  2M9N A;  4NLN A;  5J2G A;  3S6J A;  3SR6 A;  3V72 A;  4BGD A;  1TK8 A;  1KN5 A;  4DFD A;  5L1L A;  5DDM A;  3RB4 A;  2FLN A;  3A0B U;  1Z4N A;  2Y1J A;  1UT5 A;  2BPC A;  2XGQ A;  5KFA A;  4YMM A;  1SV0 C;  3C23 A;  2KP7 A;  1N63 A;  8ICW A;  5KT5 A;  4ELU A;  3HJE A;  2UVU A;  4Y2J A;  5KL1 B;  3AQE A;  2C2D A;  3OTQ A;  2OEH A;  3C1Z A;  1FIQ A;  1ZQQ A;  1Z19 A;  3H4B A;  1N56 A;  1D8Y A;  2F3N A;  3UMB A;  4RQ7 A;  4F92 B;  3KTQ A;  2F77 X;  1U4B A;  4F71 A;  9ICF A;  2BPG A;  1XNS A;  2BPF A;  2K8B B;  2UVV A;  2PI4 A;  3RB6 A;  2FMP A;  2W9B B;  3M9N B;  5KFU A;  5KFM A;  1S0N A;  2HBM A;  1WWU A;  4O5C A;  4R64 A;  1PUZ A;  5CA7 A;  4ECQ A;  4I27 A;  3OJU A;  4F50 A;  3RTV A;  2HHT A;  4EEN A;  1ZQZ A;  1PK3 A;  2EZZ A;  2LPE A;  2BR0 A;  2AH5 A;  4QIW C;  2HHS A;  2LYH A;  4FE3 A;  4PHA A;  3M9O B;  1KRP A;  1KL9 A;  2HOI A;  4CF4 A;  5KFV A;  2BZF A;  5ALR A;  1SWV A;  4B9T A;  4Y2S A;  4WJ3 B;  3BQ1 A;  1NJZ A;  3RBE A;  5KFG A;  2UVW A;  4OJ5 A;  5ALZ A;  4F2R A;  4DF8 A;  2NRV A;  4KLE A;  1XWL A;  1DGJ A;  5DB8 A;  8ICJ A;  4KN7 A;  2LM4 A;  3M6Z A;  4KMU A;  5CR0 A;  4YD2 A;  4F8R A;  1IXR A;  5TIS U;  3SZ2 A;  2YB4 A;  9ICK A;  4F5N A;  3PMN A;  3PSI A;  3UXN A;  4KLI A;  2JZB B;  1NJX A;  2MUT B;  2H3V A;  8ICP A;  4UB5 A;  2AU0 A;  2E1E A;  1D9D A;  5J2H A;  1LVH A;  3D2Q A;  2F76 X;  3PX0 A;  1RQL A;  4US8 A;  2W03 A;  3MFH A;  3PSF A;  3MBY A;  3QUT A;  1K1S A;  3QZ7 A;  4JV1 A;  4NL9 A;  1XO1 A;  2HBK A;  1PVP A;  2B21 A;  1HEK A;  4RT2 A;  3BS5 A;  1X66 A;  5EE1 A;  1A0P A;  1ZQC A;  4BDP A;  1ZOL A;  4Y2Y A;  2EQY A;  5ALL A;  5AKE A;  4M0A A;  2DQN B;  5ALM A;  4UB3 A;  5AKH A;  2K8C B;  3OHB A;  3NVZ A;  7ICL A;  2JEJ A;  9ICE A;  2G5I B;  3Q8S B;  2L5Y A;  1S5L U;  5J0X A;  5ALU A;  3HPO A;  2HOF A;  4Y2T A;  4MF8 A;  4G3I A;  7ICU A;  4CE6 A;  4KX3 A;  1KFT A;  4NXZ A;  5D49 A;  2EAO A;  4ED3 A;  4HYK A;  3RAX A;  5AK4 A;  4QWE A;  3RRG A;  2XCA A;  1SZP A;  2JEI A;  1D9F A;  9ICV A;  2R18 A;  3CNH A;  5CJ7 A;  3RB3 A;  3RH4 A;  1TAM A;  4MFC A;  3C5F A;  2V9W A;  3H0L B;  2YN4 A;  2YMP A;  1F0M A;  1F5S A;  2YMM A;  4QWA A;  4C8L A;  3C28 A;  5EE3 A;  4Q8E A;  4Y2U A;  1OUQ A;  2FE9 A;  2K60 A;  8ICC A;  4USA A;  5AI8 A;  3PST A;  3KKA A;  1S97 A;  4KLU A;  4O3R A;  5IIJ A;  3C21 A;  2H3F A;  2ASJ A;  1VJ5 A;  4UQG A;  3GII A;  2HW3 A;  3PW5 A;  3Q8Q B;  3FDS A;  4UAS A;  5BOL A;  3M1Y A;  3ZDE A;  1ZQR A;  1RDF A;  2RDJ A;  1NZP A;  4UB8 U;  5DDY A;  4ECW A;  3PVX A;  3RB0 A;  3HW8 A;  3T79 A;  1JUD A;  3IM1 A;  2EZX A;  2W9C A;  4I2D A;  3C5G A;  3AQF A;  3UMC A;  1K1Q A;  4C7Z A;  4QZD A;  3IG8 A;  3V7L A;  1SV0 A;  5FP0 A;  3TAP A;  2LBO A;  4YR0 A;  4RPZ A;  2I9G A;  3H40 A;  3ZDD A;  2F8L A;  4AP9 A;  3DDH A;  5AI5 A;  2G5H B;  3DV9 A;  5DQI A;  2G06 A;  1XSP A;  5EE9 A;  5DKW A;  3WU2 U;  5DQG A;  4P2H A;  1N61 A;  4RNN A;  1UT8 A;  3SEN A;  3T5K A;  3H0M B;  4KX5 A;  5KFI A;  4QIW F;  2OHF A;  1MQ2 A;  5D46 A;  2OWO A;  1DXS A;  5H2F U;  4DL2 A;  2Y9T A;  4IR1 A;  4KIT B;  2MUT A;  1X40 A;  3GFK B;  4PHE A;  2OM6 A;  4J9L A;  3AU6 A;  4FS2 A;  3AMZ A;  3M9M B;  2AGO A;  2R8H A;  2NO5 A;  2VJ4 A;  4RQ5 A;  4GC6 A;  8ICZ A;  2W8K A;  3RF9 A;  5J2I A;  1TE2 A;  4BJQ A;  9ICB A;  3DEE A;  4YP3 A;  1TK5 A;  3RFA A;  2BKE A;  2IOF K;  5L1I A;  1S0V A;  4DQQ A;  3PW7 A;  3EWA A;  4Y2V A;  4HAI A;  1L6N A;  4UAU A;  1U48 A;  3ZD9 A;  1JI7 A;  3K1R B;  2KHV A;  5KG7 A;  2FLP A;  3GQC A;  5AM2 A;  1X42 A;  5KFD A;  2XY7 A;  4DL3 A;  5AM5 A;  3ISB A;  1BNP A;  4J9N A;  1QCK A;  3PZP A;  4TQR A;  1L3T A;  7ICH A;  3PML A;  4DFJ A;  7ICV A;  5GTI U;  1ZD2 P;  1SB3 C;  3KZX A;  4PGY A;  4DSJ A;  4QZF A;  2E8N A;  3HKZ F;  4IR9 A;  2PXI A;  1BPE A;  3F2B A;  1DK2 A;  4ED8 A;  4KTQ A;  3UQ0 A;  2BQ3 A;  2LYB A;  1KLN A;  5HP4 A;  4ED0 A;  3TFS A;  3N7S C;  2XID A;  5KFL A;  3SV3 A;  5EWE A;  4PGX A;  1CRX A;  4KLO A;  4PHD A;  5AM1 A;  4JMU A;  2YTU A;  4IRK A;  3KBB A;  1N2X A;  4B9N A;  3GV7 B;  5ALD A;  1JXL A;  4F3O A;  4ED2 A;  2G0A A;  3BZC A;  8ICA A;  2KG5 A;  3TQ1 A;  4DLE A;  3V6K A;  3K1Z A;  5L1J A;  1Q8K A;  3A0H U;  2HHX A;  2BDU A;  5AK6 A;  4Z6D A;  1NKB A;  1KSP A;  3WKD A;  1TK0 A;  5KFF A;  4OJP A;  4UBC A;  3LVW A;  2H3I A;  4Y2R A;  4RQ6 A;  1YZ7 A;  3E0F A;  1X9S A;  3BDP A;  3SD7 A;  4M9N A;  4RQN A;  2KJ5 A;  7ICQ A;  3QU2 A;  4DL6 A;  2ATL A;  2JEG A;  5KFN A;  4UAR A;  4TQS A;  2IHN A;  1JAL A;  2RQ5 A;  4C7Y A;  1BPB A;  4XRH A;  3ZDA A;  1ZQY A;  2ZIU A;  2ZIV A;  4UAW A;  4QZI A;  5ALV A;  5AI4 A;  3GIM A;  4C8N A;  4XUS A;  2IHM A;  4YFK A;  3CRX A;  2HVI A;  2M0N A;  1ZQE A;  1NZB A;  5KFC A;  5J2C A;  4B9L A;  5ALY A;  2FPK A;  1NI3 A;  3QUB A;  2KFZ A;  4YR3 A;  4EEK A;  2RDI A;  4NLC A;  4R8U A;  2DL0 A;  4GXJ A;  2NRX A;  4Q44 A;  4P0P A;  4O9M A;  1X6J A;  5AIA A;  2W8L A;  3RH6 A;  1ZJM A;  4IQT A;  5DBA A;  9ICT A;  1ZQF A;  1FFU A;  3B0Y A;  7ICS A;  5KT6 A;  3PR4 A;  2EAP A;  3OSP A;  3K4G A;  3J81 j;  5KFK A;  5CB1 A;  5KL8 B;  3IP4 B;  2IBK A;  1SGG A;  1ECW A;  8ICO A;  1S8O A;  7ICP A;  1URJ A;  2C2E A;  3MR3 A;  4M04 A;  2QB0 A;  2E8P A;  3AU2 A;  2BCV A;  9ICG A;  2KVS A;  2W9A A;  2GLE A;  1RPL A;  3M8R A;  4EBC A;  2C28 A;  4NWI A;  2R8G A;  5AI6 A;  3E58 A;  4J03 A;  3MFI A;  3OPX A;  1ZYQ A;  4NM2 A;  5D4B A;  3K75 D;  4KLD A;  2I5H A;  5AKK A;  5AKG A;  4UB2 A;  3MGI A;  2K4I A;  2P6U A;  8ICM A;  5KG0 A;  5J0P A;  1ZRM A;  4P0Q A;  3SAF A;  2RP5 A;  8ICS A;  7ICE A;  3ETL A;  9ICH A;  3ORY A;  3SQI A;  4P4O A;  5HNK A;  7ICR A;  1DOQ A;  5DBB A;  4FZM A;  3NGD A;  1M6Y A;  3ZDC A;  2PFO A;  1HUZ A;  2WB1 F;  5KFB A;  2D6F C;  1BNO A;  2ODG A;  5ALW A;  2I6X A;  5ALO A;  4DFM A;  3WKB A;  2XVT A;  2XY6 A;  2G07 A;  5KFQ A;  3TAC B;  4TUP A;  3TAN A;  4DS4 A;  4IQU A;  1D8B A;  2ESE A;  5ALG A;  4UAY A;  3NS1 A;  2KKV A;  4FZL A;  2Z7J A;  1MC8 A;  4O5K A;  2PMZ C;  5IIO A;  4BX9 C;  4C4S A;  2IMW P;  3KOO A;  1ZD5 A;  4FFD A;  3N28 A;  3TKA A;  2FLL A;  2F1I A;  1V38 A;  2HDO A;  5KFT A;  3HP6 A;  1N5W A;  5AKX A;  4RPY A;  5KG6 A;  4DL7 A;  4OJ6 A;  1NK9 A;  2D3D A;  4ELT A;  4F4K A;  1L5U A;  1MSW D;  3JPO A;  8ICR A;  3C29 A;  4GC7 A;  4QWC A;  1L7O A;  4M9L A;  3UXO A;  5BOM A;  4BWM A;  3KKA C;  3Q8R B;  2A19 A;  5L1K A;  3NVY A;  4I2E A;  1V85 A;  1ZJN A;  2GOL A;  2YQE A;  1LKY B;  4R63 A;  2F2A B;  2DUY A;  2W7P A; 
#chains in the Genus database with same CATH homology
 1KKX A;  5K4L A;  2KK0 A;  2YQE A;  5CEH A;  1C20 A;  2OEH A;  1RYU A;  2LI6 A;  2JRZ A;  4LJX A;  2EH9 A;  2LM1 A;  1IG6 A;  1KN5 A;  2JXJ A;  2RQ5 A;  2CXY A;  2EQY A;  1KQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...