1RYUA

Solution structure of the swi1 arid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI/SNF-related, matrix-associated, actin-dependent regulato
publication title Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ryuA00
2LI6A 1KN5A 1KKXA 1KQQA 1C20A 2JRZA 5CEHA 1IG6A 4LJXA 2RQ5A 2EQYA 2OEHA 2KK0A 2LM1A 2CXYA 2YQEA 2JXJA 5K4LA 2EH9A 1RYUA
chains in the Genus database with same CATH superfamily
1D9FA 1QH9A 3MR2A 4Z6CA 4Y2PA 2R18A 2B0CA 2CPRA 5KL1B 3D2SA 7ICVA 2EAMA 1QSSA 9ICBA 4US9A 4KLMA 1U45A 2ZIXA 1T3NA 3HKZF 5KFWA 8ICHA 3PSIA 1ZQBA 9ICXA 1NOMA 2JHDA 3C23A 4A8EA 3HP6A 3MR3A 4C7YA 2L5YA 4QZHA 3C2MA 4NLNA 2KOBA 4DOBA 3SI8A 1RPLA 3F2BA 2HOFA 2W9CB 2KSOA 2YMLA 3K1ZA 1ZOLA 4UAVA 2NRVA 2JEGA 1J2MA 2G0AA 1U49A 4UAYA 3D6JA 1ZQMA 1Q3UA 4P4MA 2VKQA 2YB4A 5IILA 1VDVA 1JI7A 8ICTA 3V7JA 7ICLA 4OD0A 5ALSA 3JPTA 4O3NA 2WB1C 4O3PA 5KFZA 1XO0A 3QUQA 4ECVA 5KFBA 3N97B 4RZRA 1ZYQA 4F5NA 3QUTA 4US8A 3OHAA 2AU0A 2AQ4A 3LVVA 5JTIA 1ED1A 2F44A 3IDWA 2A19A 2P6UA 3UMBA 3GV7B 3AU6A 4ED8A 3OTQA 4PZNA 2HHSA 3NVYA 3C29A 2W43A 2KKVA 4M47A 2IHMA 1M6YA 3PX6A 1Z4NA 5KFOA 4Q45A 4RNMA 3TI0A 4R8UA 2LKYA 5AI4A 2OCEA 3JPNA 4O0IA 4DL2A 4NL9C 3JPPA 1NJXA 3RBEA 3M7DA 1ZD3A 1TE2A 4M9GA 5HR7A 1WG8A 2VJ5A 2GLEA 3H8JA 4PHDA 5GTHU 1N61A 1WCLA 3BQ0A 3FYHA 3HKZC 2BZFA 8ICWA 4XQ8A 1PK3A 1SL0A 4PHEA 4IC9A 3GDXA 2IOFK 2ZTEA 5EE3A 2YB1A 3F2CA 1NK8A 4DS4A 3RR7A 2UVRA 3TADA 1JX4A 5AKZA 2WF8A 4KN7A 4BXOB 1WYGA 4EBCA 1NNLA 4BJQA 2ZIUA 1BNPA 3SV4A 4Q8FA 2D6FC 1K5OA 4C4RA 5L1MA 3GIMA 1VLBA 2HCFA 4KLHA 2FLLA 4RQ2A 1O08A 2W9BA 1KN5A 2DPIA 4DCCA 3THVA 2E8OA 2WF9A 1ZQOA 2H3VA 3AEVA 3F5EA 3KKAC 5HMMA 3D2QA 1L7NA 4U6PA 1A6SA 4Y2XA 3BS5B 4X5VA 2E8MA 5L1KA 1MQ3A 3H0LB 4I2EA 4UB1A 1BPYA 7ICFA 3C1YA 8ICAA 2D8CA 8ICUA 5KT6A 2KG5A 2ZXHA 3LWMA 3RJKA 3PW5A 4PGQA 3ZI4A 2B21A 3TACB 4KLUA 4QW8A 3K4GA 3C1ZA 4ICAA 2KJ5A 2JEIA 1TKDA 5DQGA 5AI5A 3OGUA 4P0PA 1DXSA 4NM1A 2NO4A 4J9SA 5J2KA 4BDPA 3PO5A 2WF7A 3NS1A 5J0XA 2WAQF 3J81j 3Q8LA 1PVPA 1ZQWA 3T3FA 1YZ6A 2LYHA 3ONNA 2UVUA 4NM2A 4IQWA 1T7PA 1V97A 2A1JA 5ALIA 4EZ9A 3M9MB 3BQ7A 5AIBA 3WKEA 3LWLA 7ICJA 1X42A 2GO7A 2EZXA 4DF4A 3QU9A 4C80A 5B66U 1XS9D 1CRXA 3WK6A 2KE7A 3FC4A 4UB4A 1Z19A 3EWAA 4QZFA 2ZIVB 5ALJA 2XY7A 2Z7JA 4C7ZA 9ICIA 2N1RA 7ICEA 1U4BA 2AHOB 3Q8PB 1SZHA 2WF5A 5KT2A 3ZDBA 2H3FA 3IHQB 4BGDA 4F4YA 2J6TA 2EQYA 4FZNA 3Q8MA 2W8LA 3PZPA 2AGOA 5ALNA 2Y1JA 2OWOA 3IP4B 2MSNA 5DKWA 2YN4A 2XGPA 2PMZF 2BQ3A 3BQ1A 3WKDA 3MBYA 1S0NA 4DLGA 5J8YC 5C0YA 5KFVA 4I2DA 3ZDEA 3H4BA 2DFLA 5AKKA 4UQGA 1PVRA 4YCXA 4IR1A 4ED0A 3EW9A 5HMLA 4DSEA 2EAOA 4YG2A 2BDUA 3T5HA 3RBDA 1NKBA 3M8SA 4EELA 2IBKA 2HHTA 1X40A 4M0AA 1UQVA 3I28A 3QX7A 4ED1A 3PX4A 2WAQC 3R9KA 1XSNA 2W04A 1N48A 5J2CA 2YX8A 3PO4A 4QWBA 3ORYA 1Z1VA 5KAFU 2LYAA 2PFNA 4F4XA 8ICPA 4YMNA 4ELVA 4NLZA 4C8OA 1KFDA 3HX0A 2KN7A 5AKJA 4ED2A 5ALQA 5DDMA 5AK4A 3F53A 1QQ6A 3K75D 2HVHA 4DFDA 3BS7A 3KZIU 3QU2A 1FEZA 1UPHA 9ICRA 8ICIA 5KG7A 2KK0A 2DUYA 2RRDA 7ICNA 3SD7A 4JUZA 1D8LA 2ZJ5A 4FZLA 3RAXA 4MFFA 4DL5A 2KP7A 5BOLA 3Q8QB 1TK5A 5KT4A 2NO5A 4QJFB 9ICGA 4FZMA 1ZQFA 2F2AB 3ISCA 3KZXA 5KAIU 3U26A 3BJYA 2B6GA 2OM6A 2LPEA 3AQEA 3WU2U 1S5LU 2JH1A 3PW0A 4C8MA 3RRGA 5HR6A 2W3RA 2CN1A 4GC6A 4F5RA 5KL8B 3C5FA 1B22A 2KMDA 3WK8A 5AK5A 2J6SA 4R64A 5AM0A 5KFGA 3WKBA 4F71A 2PMZC 5ALZA 3DEEA 2DF4B 2G08A 3PR4A 1LV5A 3QZ7A 7ICMA 2HHUA 3RJEA 4ZH4A 3NVVA 3M1YA 4LVSA 1F44A 1KSPA 5DG8A 3EZ5A 4OJLA 4YVZA 1L7PA 4OJ6A 2ODGA 3E58A 1Q3VA 1QQ5A 2E5SA 3LVWA 9ICAA 3ZDCA 1DGJA 4C4SA 2M0NA 3NGDA 4QZ8A 1SIJA 5AKXA 1SV0C 1L3VA 2PXIA 4RUAA 2EZYA 3OJUA 1SV4A 1OXJA 5IIOA 5ALDA 3RJJA 4I2JA 3HW8A 3FDSA 3A0HU 1U9LA 4RQ1A 1Q46A 5HHIA 3UPQA 2EH9A 2F77X 4ACOA 3PSTA 4EZ6A 5EE0A 4KN4A 2WF6A 4UB5A 1K1SA 4MFAA 3SAHA 4YMOA 4O3MA 1UT8A 1QLNA 3WKCA 3GILA 4LZDA 1TAUA 3GIIA 4DFMA 9ICNA 4M6WA 2E3TA 3PW4A 2KEYA 1F0MA 1T94A 3RH5A 3AUOA 1LB2B 1ZQ1C 2JMGA 4PGXA 5AI6A 1PVQA 9ICHA 1WWUA 2F3NA 4EEYA 5AM5A 4RNOA 2W9BB 2ASJA 7ICUA 5A0LA 4F72A 3G6XA 4DF8A 4BUGA 1RYUA 3HILA 2Y0SF 5H2FU 1P7DA 4QWCA 2EANA 5KFJA 5HP4A 4UATA 4NWIA 1S10A 2OYYA 3SMVA 3G6VA 2K4HA 3K1RB 4ED7A 5J2GA 3T5JA 1DRGA 5J2DA 1TK0A 3JPRA 2KZ3A 4EX6A 1WUDA 1UCVA 2H3ZA 1OW5A 4ZOHC 4R63A 3UMCA 4P0PB 3OSPA 2XVTA 3UMGA 4C8NA 5ALWA 4GIBA 7ICPA 3DDHA 3C2KA 3ETLA 1RYRA 4KLTA 5CA7A 2KTQA 1NZPA 3JPOA 2DKXA 3SR6A 3SV3A 2AQ0A 3QZ8A 4DFJA 2FPKA 2BPGA 2ZUDA 1FIQA 5ALPA 4Z6FA 5AK6A 4FO6A 2A1JB 1X9WA 2K60A 4NXZA 2KJ8A 9ICUA 1N63A 1SKRA 4C0ZA 5J0RA 1A77A 1B43A 4QWEA 9ICOA 3IN5A 4O3QA 1KFTA 2JV3A 1YT3A 2DKZA 4QZCA 5KG1A 2BKEA 1JUDA 5KFYA 7ICKA 2Y1IA 2YMPA 1ZQZA 2NRWA 2ZTDA 4Z6EA 5IINA 7ICHA 3IM1A 2W7OA 3RF9A 8ICYA 4J9LA 4DL3A 2G06A 3E0FA 1GO3F 2K8CB 2W7PA 5CJ7A 1EXNA 2Y0SC 2R8JA 2DQNB 2LYBA 4PL1A 1ZQIA 1MA7A 3KHLA 3PW7A 9ICMA 5KFSA 3MDCA 4AYBF 2HHQA 3SAGA 5J0PA 2F76X 4M9JA 2G5IB 2VANA 3UQ2A 3V6JA 4EBEA 1VJ5A 4DFKA 3RB0A 4DWIA 2M9NA 4QZIA 5AICA 3CNHA 4F4ZA 1JRPA 4FFDA 3F2DA 4DL4A 5KNIA 5DG7A 8ICOA 1N2XA 1ZQTA 3KD3A 8ICKA 3AQFA 3B9JA 5DQHA 3M6ZA 2OH2A 2FDRA 8ICVA 1JN3A 4M2YA 3L3FX 4R66A 1KRPA 2HOIA 2Y9TA 4QZAA 1JXLA 1V9PA 4QNLA 4CDGA 4PGYA 2K89A 4C4TA 5KFFA 1T3QA 2ATLA 2V4QA 3EUB2 1Z4OA 3RTVA 2E1FA 9ICFA 4QIWF 4CF4A 3HT3A 3C28A 1ZQLA 4GXIA 5DB6A 2HHXA 5KFXA 3GIKA 2GH1A 4DQRA 2W03A 1L3SA 2HOQA 2NRTA 3KHRA 3HRDD 1L7MA 2KIWA 5KFHA 5KT5A 4KLFA 2ZIWB 4RQNA 2V9WA 8ICRA 8ICFA 2ZJ8A 5AKLA 4RT3A 4KX5A 5HHHA 1QSYA 1F5SA 5KFQA 4BWMA 1TK8A 2KD1A 1ZQPA 2C28A 1SXDA 2HI0A 3WKAA 4J9PA 2UVVA 2GOLA 4I29A 5DQIA 7ICIA 2RP5A 1ZQRA 4DS5A 3ZD9A 1NK6A 5D4BA 4ECYA 1J97A 4AYBC 5CB1A 4HYKA 2GWSA 4AP9A 2F8LA 4RQ5A 2KZZA 2BQRA 2R8HA 1QSLA 2BCUA 5J0OA 4KLOA 1BGXT 2FLNA 4RQ7A 2RDJA 1WCNA 1MSWD 3DV9A 3Q8KA 4KX3A 4YR0A 3O0FA 4PHPA 5KT3A 1ZD4A 5C5JA 3KFUF 1UA0A 4OJOA 2ALZA 4F93B 5KFCA 5J29A 1MQ2A 2JH7A 4ECSA 3QU7A 3QU4A 2MUTA 4I2CA 3LDAA 5AM4A 2KFZA 8ICNA 2R8IA 2F1IA 5EWEA 3GZFA 3C21A 3AMZA 5J2HA 3KHGA 2FPLA 8ICMA 2C22A 1ZQUA 4YR3A 3WK9A 5CWRA 1ZRNA 5BOMA 7ICSA 4DSLA 2IMWP 2LI6A 4DLEA 4QZ9A 4QIWC 4FS1A 4F5QA 4WJ3B 3TADC 1ZD2P 2DPJA 3GV5B 2W8KA 3PW2A 1RYSA 1X9SA 3OJSA 4M6WB 4F3OA 3L4PA 5JRTA 1JIHA 3ZDAA 4RUCA 2LM1A 4O5CA 4TQSA 5AM3A 4PPXA 4DL6A 2IOFA 4UB8U 1TAMA 4M9HA 2XI9A 2NRXA 3UXPA 1Z00A 4J9KA 8ICLA 5KG4A 4EX7A 1D9DA 2LM4A 2ZTCA 4ED6A 5ALGA 4F4WA 4TUSA 2E8PA 5L1JA 5E79U 3AN1A 4I28A 2NRZA 4NLGA 2MU2A 2QARA 5AK3A 1KQQA 5BPCA 2ZXIA 4NLBA 5AM1A 4YP3A 4J03A 4QZGA 3PNCA 2F1HA 5F3XB 4IQTA 2PFQA 2DBYA 4EBDA 5KFEA 2W54A 1FFUA 5G5HA 4USAA 1SKSA 1QQ7A 1SWVA 4RQ4A 3BQ2A 2LMRA 1RG6A 1MC8A 2HSZA 2ZUBA 5J2EA 1ZQVA 2HBMA 2P35A 7ICOA 5ALEA 2K8BB 3FAHA 3RB3A 4B9LA 1ZQSA 4FBTA 4B9SA 1IG6A 2RLTA 5DB8A 3N4MB 5AIAA 3KOOA 4RQ6A 2PKEA 3UM9A 2IHNA 5G5GA 8ICZA 4Y2YA 4MFCA 3G6YA 3RJGA 5B5EU 5KFUA 5DGAA 9ICKA 1OUQA 1HIWA 3RR8A 2JR5A 4ECQA 4FE3A 1HJPA 4OJPA 1KDHA 4B9TA 9ICEA 2ZIWA 1D8BA 4PHAA 5J0YA 5AHXA 4F8RA 3AU2A 3TKAA 4UB6U 5DBBA 4R65A 1SL2A 2AGQA 1S8OA 4O9MA 8ICSA 1FFVA 4Y2VA 5J2AA 1BPBA 5KFNA 4J9RA 4OJ5A 3TFSA 1KKXA 1HUOA 2XIDA 4M9LA 3VCBA 4QWDA 1NZBA 4CE6A 1N5XA 5EWFA 3BZCA 1NJZA 4J9QA 1ZQJA 4ECZA 3ISDA 1BPDA 5F9NA 1BNOA 2PFOA 3KHHA 5J0QA 4Y2TA 5KG0A 4GXJA 4I2IA 4UBCA 1XC9A 2E8NA 4YD2A 2Y9UA 5KFTA 3T5LA 3M6KA 5J0TA 3NVZA 2JRZA 3RFAA 4GXKA 1H38A 4CF3A 3M9OB 2A1AA 4M9NA 1L3TA 2W9AA 2EDUA 4UB3A 4EENA 5J2JA 3RJIA 9ICTA 4DSFA 2FPMA 4P0QA 4RPYA 2BHNA 3RB6A 2DGZA 4J9NA 2Q4TA 3BZKA 1ZJMA 1ZQKA 2RQ5A 5JU5A 3EYZA 5DB9A 2BR0A 1ZQGA 7ICRA 5KFMA 3CW2C 3CYMA 1BPZA 5ALXA 2YTUA 1AQ6A 4G3IA 1NJWA 1SZPA 4TQRA 2E1EA 4FS2A 3MGHA 3RRHA 4B9UA 2AGPA 2FMSA 4PJ0U 1Y88A 2FMQA 2YMQA 2JZBA 3TFRA 1X9MA 4KLJA 5AI0A 1K1QA 1IV8A 3QXGA 2QB1A 3V72A 2ZG6A 2ZJAA 1XO1A 5L1IA 2XY5A 1L8OA 2DWQA 2AJQA 9ICLA 1ZQYA 4QZBA 1KEJA 2FJ6A 3E2EA 3CRXA 2FE9A 5J2IA 2O6KA 4DSKA 4NY8A 2KVSA 4F92B 3SZ2A 5CRXA 3N7SC 3SEIA 1O03A 2WFAA 4KLQA 1SXEA 3MGVA 2PI5A 4IRKA 2BCRA 4IS7A 9ICSA 4MEXA 1NK4A 2ES6A 2QKQA 4JV1A 2LBOA 2KKPA 3PV8A 2VA2A 4OCZA 3V6HA 4QW9A 2MUTB 3OHBA 4K4GA 7ICTA 2MA1A 1CEZA 4IRCA 3WK4A 4YFKA 2KVCA 2YY6A 1N62A 2C2DA 3RAQA 8ICCA 1Z3EB 2DL0A 4B9VA 1CI4A 4NLKA 5AKGA 3ZD8A 1KLNA 4KITB 4CCHA 4RQMA 5ALHA 3QU5A 1XSLA 1SGGA 4NL9A 4C8LA 4ED3A 4PL2A 1KW4A 3LK9A 1ZJNA 5KG2A 3QEAZ 1S77D 1T4GA 1L6NA 2XC9A 2RDIA 1Z00B 1SKWA 4U7CA 4K4IA 4B9NA 2XO7A 4UASA 3N28A 5KFAA 5GTIU 5D49A 1ZQDA 4NJ8A 1TFRA 2QARB 3SYZA 2BQUA 5AI8A 1DGSA 4YD1A 3GQCA 4ECRA 3I76A 2R8KA 2XY6A 7ICQA 5JUMA 5EOZA 2KHQA 4UARA 2HMXA 4IQVA 4XUSA 2VIXA 2KJ9A 1ZETA 2C2EA 1RM6C 3PVXA 3H8MA 3IRUA 3LYSA 5CEHA 4EYHB 3H7IA 3KKAA 3H40A 1L8LA 2JGAA 3B0YA 4UAZA 3MFIA 3TQ1A 4CRXA 1ZXIA 4TUPA 4I2FA 4E0DA 4JWNA 4DOAA 5KTQA 5DG9A 4BX9C 5EE9A 1TV9A 4I2GA 4P4PA 5J0UA 4CNQA 4K4HA 1NK9A 1PZNA 1LVHA 4Y2SA 1ZQQA 9ICQA 5HNKA 1RXWA 2WHEA 4ECXA 2UVWA 1PK1A 9ICJA 2VA3A 2H5XA 4O5EA 1S76D 2BDPA 4F91B 3AL0B 5K4LA 3HWTA 4ELTA 1JMSA 5D46A 1J2NA 1HUZA 1BVSA 5IIKA 2XCAA 4UW9A 5J2FA 2HBJA 3HJEA 2HBKA 4TUQA 1V38A 4F2SA 4HAIA 5EWGA 4IL6U 2AXTU 1ZQXA 1JALA 4OO1J 1NK7A 9ICWA 3MR5A 4F4KA 8ICEA 1X2IA 5DBAA 4LZGA 5KFRA 2H3QA 4I2HA 4RPZA 3OPXA 4DQIA 1L5UA 4KLGA 3RJFA 4KLSA 4DSIA 2OHFA 2XICA 4EYIB 1S9FA 1SWWA 2EZZA 5IIMA 5DBCA 1JROA 2JXJA 2WTFA 4P2HA 3M9NB 5F9LA 2BCSA 4F5PA 3RB4A 1SB3C 4LJXA 3PSPA 1RZTA 4Y2RA 3IV6A 5IIIA 1WWVA 5ALFA 3A0BU 8ICGA 5IIJA 5L1LA 5KFPA 5J2BA 5TISU 2P66A 5AI9A 2ASDA 9ICCA 3F5AA 4KLEA 3ED5A 4M04A 4GC7A 1URJA 2HHWA 5J8YA 5T14A 1CUKA 1ECWA 2F8KA 1S0MA 1LKYA 4P0QB 1B0XA 4PZOA 1N5WA 5ALOA 3GU3A 4QZDA 3H0RB 1V85A 3BQTA 1NK5A 1T8EA 4F50A 2ZUCA 1X9XA 4DOCA 1RXVA 1RDFA 1KBUA 2QB0A 1NKCA 8ICBA 3SENA 4XA5A 1IM4A 4IR9A 2KV2A 3CP8A 1X6IA 1UT5A 1C20A 3RH6A 2RHFA 3IG8A 4GFJA 4GLXA 2I1QA 2G09A 5AKIA 3Q8RB 3ETRA 1TVAA 2BPFA 4Q43A 2IOHA 3H4DA 4J9MA 1IIPA 3M8RA 8ICQA 2JEJA 3TAPA 4TURA 4FBUA 3V7KA 3H8WA 2Q0ZX 1ZQEA 3RJHA 3MABA 3OSNA 2VA8A 2JZBB 2KFNA 4RT2A 4C8KA 2OXOA 1S97A 1S0OA 2IA6A 4JMUA 2W9CA 2BPCA 3MFHA 4YR2A 1MN8A 1KFSA 4RNNA 1IXRA 3GIJA 1DOQA 1FO4A 1B4FA 2W55A 3S6JA 3MR6A 5J0WA 4J9OA 5EE1A 3FM9A 4XRHA 1COOA 3B0XA 1N56A 1ZQAA 5DLFA 4DQPA 1S0VA 3UQ0A 2YMMA 2A3VA 2VJ4A 3QEBZ 4UBBA 4YXMA 4P4OA 5KG5A 4PH5A 4Y2JA 4DFPA 4I27A 3TAQA 5ALVA 2QLTA 2NYVA 2BCVA 4RQ0A 4B9MA 5ALMA 4G9BA 4RPXA 1KTQA 2PFPA 2AH5A 2F1JA 1A76A 4MHVA 1PUZA 3JPQA 1L3UA 1SV0A 4RQ3A 4B6JA 4Q44A 1ZQNA 4QWAA 4KLIA 2NV3A 4JK1A 3EPGA 3PR5B 3PSFA 2HHVA 5AKEA 3D2NA 2ZIXB 8ICXA 5DLGA 5L9XA 3TANA 2KZMA 3N7RC 2BCQA 4MEYA 4DO9A 3C5GA 1QCKA 2KNJA 5AKHA 1QTMA 2W3SA 4JV2A 4ELUA 4UB2A 2I6XA 1Q8KA 2KSOB 4YXJA 4F2RA 3JPSA 4KLLA 4UAWA 4DEZA 4BXOA 8ICJA 3PY8A 2MRLA 1X66A 2I5HA 2D3DA 3PMNA 3SQIA 2FMPA 3VC8A 2K8AA 1C7YA 1COKA 5CHGA 2ISOA 3MC1A 1NKEA 3HPOA 1RQNA 5KG3A 4JB3A 3WK7A 4QZEA 2YQEA 2PI4A 3PX0A 3V7LA 4I2AA 3KTQA 3BS5A 3NUQA 4O3OA 2KHVA 1D8YA 3GFKB 5ALLA 1ZQHA 5ALUA 7ICGA 4ECWA 2HDOA 5KG6A 4Y2QA 4JV0A 1BPEA 4YMMA 3ISBA 1XWLA 4CGZA 2ASLA 4O3SA 2CRXA 3ICXA 4ECTA 9ICPA 2LHTA 4CF5A 1XU4A 1ZD5A 4DSJA 2C2RA 2I9GA 2JEFA 2R8GA 1PK1B 2G07A 1UHUA 4ECUA 5ALKA 4YQWA 4R8UB 9ICVA 2V4RA 2KICA 3L5KA 1UA1A 1L7OA 4JWMA 5ALYA 5CP2A 1X6JA 5KFIA 4KMOB 2CXYA 2KIVA 4EEKA 2XCPA 3TARA 2ESEA 1SL1A 1YZ7A 1DK2A 1A0PA 1U48A 3MGIA 4O3RA 3ZDDA 2EAPA 5DB7A 5TZVA 1NJYA 2HVIA 4MF8A 1ZRMA 3H0MB 3SAFA 4RU9A 3QE9Y 1XSPA 3NRWA 4NV0A 1JXEA 2K4IA 3UXOA 4KMUA 4UAUA 5FP0A 1ZQCA 4Y2UA 2BGWA 1KL9A 1XNSA 2XGQA 3ALRA 3Q8SB 1DK3A 5ALRA 2P6RA 2ZIUB 5KFDA 4IRDA 2MAXA 4DL7A 2W9MA 4KLDA 3T5KA 3I1YA 1HEKA 3QNMA 5AKYA 1Z1BA 2ZIVA 3NTUA 5J0SA 3N7PD 5DDYA 3WK5A 5KFLA 3GV8B 4I2BA 1NI3A 3AM9A 2FI1A 3NASA 2HW3A 3T79A 2H3IA 4DQSA 4O5KA 5CR0A 3RH4A 1TAQA 4DQQA 5AM2A 3PMLA 3QYPA 3MDAA 2WB1F 5DGBA 5KT7A 1AROP 4NLCA 2HBLA 3QUBA 5ALTA 2K4EA 3BDPA 3IG5A 4YN4A 2W11A 2OEHA 3V6KA 4Q8EA 2G5HB 2K4PA 4F5OA 4BWJA 1LKYB 4KTQA 1U47A 5KFKA 3NRZA 3C2LA 3UXNA 2J6UA 3NVWA 4Z6DA 2ISPA 4MF2A 3QUCA 2QB0B 4IQUA 1N60A 3EPIA 1NK0A 3KBBA 4RQ8A 1BPXA 2FLPA 1RQLA 3H8SA
chains in the Genus database with same CATH topology
2LI6A 1KN5A 1KKXA 1KQQA 1C20A 2JRZA 5CEHA 1IG6A 4LJXA 2RQ5A 2EQYA 2OEHA 2KK0A 2LM1A 2CXYA 2YQEA 2JXJA 5K4LA 2EH9A 1RYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LI6 A;  1KN5 A;  1KKX A;  1KQQ A;  1C20 A;  2JRZ A;  5CEH A;  1IG6 A;  4LJX A;  2RQ5 A;  2EQY A;  2OEH A;  2KK0 A;  2LM1 A;  2CXY A;  2YQE A;  2JXJ A;  5K4L A;  2EH9 A;  1RYU A; 
#chains in the Genus database with same CATH topology
 1D9F A;  1QH9 A;  3MR2 A;  4Z6C A;  4Y2P A;  2R18 A;  2B0C A;  2CPR A;  5KL1 B;  3D2S A;  7ICV A;  2EAM A;  1QSS A;  9ICB A;  4US9 A;  4KLM A;  1U45 A;  2ZIX A;  1T3N A;  3HKZ F;  5KFW A;  8ICH A;  3PSI A;  1ZQB A;  9ICX A;  1NOM A;  2JHD A;  3C23 A;  4A8E A;  3HP6 A;  3MR3 A;  4C7Y A;  2L5Y A;  4QZH A;  3C2M A;  4NLN A;  2KOB A;  4DOB A;  3SI8 A;  1RPL A;  3F2B A;  2HOF A;  2W9C B;  2KSO A;  2YML A;  3K1Z A;  1ZOL A;  4UAV A;  2NRV A;  2JEG A;  1J2M A;  2G0A A;  1U49 A;  4UAY A;  3D6J A;  1ZQM A;  1Q3U A;  4P4M A;  2VKQ A;  2YB4 A;  5IIL A;  1VDV A;  1JI7 A;  8ICT A;  3V7J A;  7ICL A;  4OD0 A;  5ALS A;  3JPT A;  4O3N A;  2WB1 C;  4O3P A;  5KFZ A;  1XO0 A;  3QUQ A;  4ECV A;  5KFB A;  3N97 B;  4RZR A;  1ZYQ A;  4F5N A;  3QUT A;  4US8 A;  3OHA A;  2AU0 A;  2AQ4 A;  3LVV A;  5JTI A;  1ED1 A;  2F44 A;  3IDW A;  2A19 A;  2P6U A;  3UMB A;  3GV7 B;  3AU6 A;  4ED8 A;  3OTQ A;  4PZN A;  2HHS A;  3NVY A;  3C29 A;  2W43 A;  2KKV A;  4M47 A;  2IHM A;  1M6Y A;  3PX6 A;  1Z4N A;  5KFO A;  4Q45 A;  4RNM A;  3TI0 A;  4R8U A;  2LKY A;  5AI4 A;  2OCE A;  3JPN A;  4O0I A;  4DL2 A;  4NL9 C;  3JPP A;  1NJX A;  3RBE A;  3M7D A;  1ZD3 A;  1TE2 A;  4M9G A;  5HR7 A;  1WG8 A;  2VJ5 A;  2GLE A;  3H8J A;  4PHD A;  5GTH U;  1N61 A;  1WCL A;  3BQ0 A;  3FYH A;  3HKZ C;  2BZF A;  8ICW A;  4XQ8 A;  1PK3 A;  1SL0 A;  4PHE A;  4IC9 A;  3GDX A;  2IOF K;  2ZTE A;  5EE3 A;  2YB1 A;  3F2C A;  1NK8 A;  4DS4 A;  3RR7 A;  2UVR A;  3TAD A;  1JX4 A;  5AKZ A;  2WF8 A;  4KN7 A;  4BXO B;  1WYG A;  4EBC A;  1NNL A;  4BJQ A;  2ZIU A;  1BNP A;  3SV4 A;  4Q8F A;  2D6F C;  1K5O A;  4C4R A;  5L1M A;  3GIM A;  1VLB A;  2HCF A;  4KLH A;  2FLL A;  4RQ2 A;  1O08 A;  2W9B A;  1KN5 A;  2DPI A;  4DCC A;  3THV A;  2E8O A;  2WF9 A;  1ZQO A;  2H3V A;  3AEV A;  3F5E A;  3KKA C;  5HMM A;  3D2Q A;  1L7N A;  4U6P A;  1A6S A;  4Y2X A;  3BS5 B;  4X5V A;  2E8M A;  5L1K A;  1MQ3 A;  3H0L B;  4I2E A;  4UB1 A;  1BPY A;  7ICF A;  3C1Y A;  8ICA A;  2D8C A;  8ICU A;  5KT6 A;  2KG5 A;  2ZXH A;  3LWM A;  3RJK A;  3PW5 A;  4PGQ A;  3ZI4 A;  2B21 A;  3TAC B;  4KLU A;  4QW8 A;  3K4G A;  3C1Z A;  4ICA A;  2KJ5 A;  2JEI A;  1TKD A;  5DQG A;  5AI5 A;  3OGU A;  4P0P A;  1DXS A;  4NM1 A;  2NO4 A;  4J9S A;  5J2K A;  4BDP A;  3PO5 A;  2WF7 A;  3NS1 A;  5J0X A;  2WAQ F;  3J81 j;  3Q8L A;  1PVP A;  1ZQW A;  3T3F A;  1YZ6 A;  2LYH A;  3ONN A;  2UVU A;  4NM2 A;  4IQW A;  1T7P A;  1V97 A;  2A1J A;  5ALI A;  4EZ9 A;  3M9M B;  3BQ7 A;  5AIB A;  3WKE A;  3LWL A;  7ICJ A;  1X42 A;  2GO7 A;  2EZX A;  4DF4 A;  3QU9 A;  4C80 A;  5B66 U;  1XS9 D;  1CRX A;  3WK6 A;  2KE7 A;  3FC4 A;  4UB4 A;  1Z19 A;  3EWA A;  4QZF A;  2ZIV B;  5ALJ A;  2XY7 A;  2Z7J A;  4C7Z A;  9ICI A;  2N1R A;  7ICE A;  1U4B A;  2AHO B;  3Q8P B;  1SZH A;  2WF5 A;  5KT2 A;  3ZDB A;  2H3F A;  3IHQ B;  4BGD A;  4F4Y A;  2J6T A;  2EQY A;  4FZN A;  3Q8M A;  2W8L A;  3PZP A;  2AGO A;  5ALN A;  2Y1J A;  2OWO A;  3IP4 B;  2MSN A;  5DKW A;  2YN4 A;  2XGP A;  2PMZ F;  2BQ3 A;  3BQ1 A;  3WKD A;  3MBY A;  1S0N A;  4DLG A;  5J8Y C;  5C0Y A;  5KFV A;  4I2D A;  3ZDE A;  3H4B A;  2DFL A;  5AKK A;  4UQG A;  1PVR A;  4YCX A;  4IR1 A;  4ED0 A;  3EW9 A;  5HML A;  4DSE A;  2EAO A;  4YG2 A;  2BDU A;  3T5H A;  3RBD A;  1NKB A;  3M8S A;  4EEL A;  2IBK A;  2HHT A;  1X40 A;  4M0A A;  1UQV A;  3I28 A;  3QX7 A;  4ED1 A;  3PX4 A;  2WAQ C;  3R9K A;  1XSN A;  2W04 A;  1N48 A;  5J2C A;  2YX8 A;  3PO4 A;  4QWB A;  3ORY A;  1Z1V A;  5KAF U;  2LYA A;  2PFN A;  4F4X A;  8ICP A;  4YMN A;  4ELV A;  4NLZ A;  4C8O A;  1KFD A;  3HX0 A;  2KN7 A;  5AKJ A;  4ED2 A;  5ALQ A;  5DDM A;  5AK4 A;  3F53 A;  1QQ6 A;  3K75 D;  2HVH A;  4DFD A;  3BS7 A;  3KZI U;  3QU2 A;  1FEZ A;  1UPH A;  9ICR A;  8ICI A;  5KG7 A;  2KK0 A;  2DUY A;  2RRD A;  7ICN A;  3SD7 A;  4JUZ A;  1D8L A;  2ZJ5 A;  4FZL A;  3RAX A;  4MFF A;  4DL5 A;  2KP7 A;  5BOL A;  3Q8Q B;  1TK5 A;  5KT4 A;  2NO5 A;  4QJF B;  9ICG A;  4FZM A;  1ZQF A;  2F2A B;  3ISC A;  3KZX A;  5KAI U;  3U26 A;  3BJY A;  2B6G A;  2OM6 A;  2LPE A;  3AQE A;  3WU2 U;  1S5L U;  2JH1 A;  3PW0 A;  4C8M A;  3RRG A;  5HR6 A;  2W3R A;  2CN1 A;  4GC6 A;  4F5R A;  5KL8 B;  3C5F A;  1B22 A;  2KMD A;  3WK8 A;  5AK5 A;  2J6S A;  4R64 A;  5AM0 A;  5KFG A;  3WKB A;  4F71 A;  2PMZ C;  5ALZ A;  3DEE A;  2DF4 B;  2G08 A;  3PR4 A;  1LV5 A;  3QZ7 A;  7ICM A;  2HHU A;  3RJE A;  4ZH4 A;  3NVV A;  3M1Y A;  4LVS A;  1F44 A;  1KSP A;  5DG8 A;  3EZ5 A;  4OJL A;  4YVZ A;  1L7P A;  4OJ6 A;  2ODG A;  3E58 A;  1Q3V A;  1QQ5 A;  2E5S A;  3LVW A;  9ICA A;  3ZDC A;  1DGJ A;  4C4S A;  2M0N A;  3NGD A;  4QZ8 A;  1SIJ A;  5AKX A;  1SV0 C;  1L3V A;  2PXI A;  4RUA A;  2EZY A;  3OJU A;  1SV4 A;  1OXJ A;  5IIO A;  5ALD A;  3RJJ A;  4I2J A;  3HW8 A;  3FDS A;  3A0H U;  1U9L A;  4RQ1 A;  1Q46 A;  5HHI A;  3UPQ A;  2EH9 A;  2F77 X;  4ACO A;  3PST A;  4EZ6 A;  5EE0 A;  4KN4 A;  2WF6 A;  4UB5 A;  1K1S A;  4MFA A;  3SAH A;  4YMO A;  4O3M A;  1UT8 A;  1QLN A;  3WKC A;  3GIL A;  4LZD A;  1TAU A;  3GII A;  4DFM A;  9ICN A;  4M6W A;  2E3T A;  3PW4 A;  2KEY A;  1F0M A;  1T94 A;  3RH5 A;  3AUO A;  1LB2 B;  1ZQ1 C;  2JMG A;  4PGX A;  5AI6 A;  1PVQ A;  9ICH A;  1WWU A;  2F3N A;  4EEY A;  5AM5 A;  4RNO A;  2W9B B;  2ASJ A;  7ICU A;  5A0L A;  4F72 A;  3G6X A;  4DF8 A;  4BUG A;  1RYU A;  3HIL A;  2Y0S F;  5H2F U;  1P7D A;  4QWC A;  2EAN A;  5KFJ A;  5HP4 A;  4UAT A;  4NWI A;  1S10 A;  2OYY A;  3SMV A;  3G6V A;  2K4H A;  3K1R B;  4ED7 A;  5J2G A;  3T5J A;  1DRG A;  5J2D A;  1TK0 A;  3JPR A;  2KZ3 A;  4EX6 A;  1WUD A;  1UCV A;  2H3Z A;  1OW5 A;  4ZOH C;  4R63 A;  3UMC A;  4P0P B;  3OSP A;  2XVT A;  3UMG A;  4C8N A;  5ALW A;  4GIB A;  7ICP A;  3DDH A;  3C2K A;  3ETL A;  1RYR A;  4KLT A;  5CA7 A;  2KTQ A;  1NZP A;  3JPO A;  2DKX A;  3SR6 A;  3SV3 A;  2AQ0 A;  3QZ8 A;  4DFJ A;  2FPK A;  2BPG A;  2ZUD A;  1FIQ A;  5ALP A;  4Z6F A;  5AK6 A;  4FO6 A;  2A1J B;  1X9W A;  2K60 A;  4NXZ A;  2KJ8 A;  9ICU A;  1N63 A;  1SKR A;  4C0Z A;  5J0R A;  1A77 A;  1B43 A;  4QWE A;  9ICO A;  3IN5 A;  4O3Q A;  1KFT A;  2JV3 A;  1YT3 A;  2DKZ A;  4QZC A;  5KG1 A;  2BKE A;  1JUD A;  5KFY A;  7ICK A;  2Y1I A;  2YMP A;  1ZQZ A;  2NRW A;  2ZTD A;  4Z6E A;  5IIN A;  7ICH A;  3IM1 A;  2W7O A;  3RF9 A;  8ICY A;  4J9L A;  4DL3 A;  2G06 A;  3E0F A;  1GO3 F;  2K8C B;  2W7P A;  5CJ7 A;  1EXN A;  2Y0S C;  2R8J A;  2DQN B;  2LYB A;  4PL1 A;  1ZQI A;  1MA7 A;  3KHL A;  3PW7 A;  9ICM A;  5KFS A;  3MDC A;  4AYB F;  2HHQ A;  3SAG A;  5J0P A;  2F76 X;  4M9J A;  2G5I B;  2VAN A;  3UQ2 A;  3V6J A;  4EBE A;  1VJ5 A;  4DFK A;  3RB0 A;  4DWI A;  2M9N A;  4QZI A;  5AIC A;  3CNH A;  4F4Z A;  1JRP A;  4FFD A;  3F2D A;  4DL4 A;  5KNI A;  5DG7 A;  8ICO A;  1N2X A;  1ZQT A;  3KD3 A;  8ICK A;  3AQF A;  3B9J A;  5DQH A;  3M6Z A;  2OH2 A;  2FDR A;  8ICV A;  1JN3 A;  4M2Y A;  3L3F X;  4R66 A;  1KRP A;  2HOI A;  2Y9T A;  4QZA A;  1JXL A;  1V9P A;  4QNL A;  4CDG A;  4PGY A;  2K89 A;  4C4T A;  5KFF A;  1T3Q A;  2ATL A;  2V4Q A;  3EUB 2;  1Z4O A;  3RTV A;  2E1F A;  9ICF A;  4QIW F;  4CF4 A;  3HT3 A;  3C28 A;  1ZQL A;  4GXI A;  5DB6 A;  2HHX A;  5KFX A;  3GIK A;  2GH1 A;  4DQR A;  2W03 A;  1L3S A;  2HOQ A;  2NRT A;  3KHR A;  3HRD D;  1L7M A;  2KIW A;  5KFH A;  5KT5 A;  4KLF A;  2ZIW B;  4RQN A;  2V9W A;  8ICR A;  8ICF A;  2ZJ8 A;  5AKL A;  4RT3 A;  4KX5 A;  5HHH A;  1QSY A;  1F5S A;  5KFQ A;  4BWM A;  1TK8 A;  2KD1 A;  1ZQP A;  2C28 A;  1SXD A;  2HI0 A;  3WKA A;  4J9P A;  2UVV A;  2GOL A;  4I29 A;  5DQI A;  7ICI A;  2RP5 A;  1ZQR A;  4DS5 A;  3ZD9 A;  1NK6 A;  5D4B A;  4ECY A;  1J97 A;  4AYB C;  5CB1 A;  4HYK A;  2GWS A;  4AP9 A;  2F8L A;  4RQ5 A;  2KZZ A;  2BQR A;  2R8H A;  1QSL A;  2BCU A;  5J0O A;  4KLO A;  1BGX T;  2FLN A;  4RQ7 A;  2RDJ A;  1WCN A;  1MSW D;  3DV9 A;  3Q8K A;  4KX3 A;  4YR0 A;  3O0F A;  4PHP A;  5KT3 A;  1ZD4 A;  5C5J A;  3KFU F;  1UA0 A;  4OJO A;  2ALZ A;  4F93 B;  5KFC A;  5J29 A;  1MQ2 A;  2JH7 A;  4ECS A;  3QU7 A;  3QU4 A;  2MUT A;  4I2C A;  3LDA A;  5AM4 A;  2KFZ A;  8ICN A;  2R8I A;  2F1I A;  5EWE A;  3GZF A;  3C21 A;  3AMZ A;  5J2H A;  3KHG A;  2FPL A;  8ICM A;  2C22 A;  1ZQU A;  4YR3 A;  3WK9 A;  5CWR A;  1ZRN A;  5BOM A;  7ICS A;  4DSL A;  2IMW P;  2LI6 A;  4DLE A;  4QZ9 A;  4QIW C;  4FS1 A;  4F5Q A;  4WJ3 B;  3TAD C;  1ZD2 P;  2DPJ A;  3GV5 B;  2W8K A;  3PW2 A;  1RYS A;  1X9S A;  3OJS A;  4M6W B;  4F3O A;  3L4P A;  5JRT A;  1JIH A;  3ZDA A;  4RUC A;  2LM1 A;  4O5C A;  4TQS A;  5AM3 A;  4PPX A;  4DL6 A;  2IOF A;  4UB8 U;  1TAM A;  4M9H A;  2XI9 A;  2NRX A;  3UXP A;  1Z00 A;  4J9K A;  8ICL A;  5KG4 A;  4EX7 A;  1D9D A;  2LM4 A;  2ZTC A;  4ED6 A;  5ALG A;  4F4W A;  4TUS A;  2E8P A;  5L1J A;  5E79 U;  3AN1 A;  4I28 A;  2NRZ A;  4NLG A;  2MU2 A;  2QAR A;  5AK3 A;  1KQQ A;  5BPC A;  2ZXI A;  4NLB A;  5AM1 A;  4YP3 A;  4J03 A;  4QZG A;  3PNC A;  2F1H A;  5F3X B;  4IQT A;  2PFQ A;  2DBY A;  4EBD A;  5KFE A;  2W54 A;  1FFU A;  5G5H A;  4USA A;  1SKS A;  1QQ7 A;  1SWV A;  4RQ4 A;  3BQ2 A;  2LMR A;  1RG6 A;  1MC8 A;  2HSZ A;  2ZUB A;  5J2E A;  1ZQV A;  2HBM A;  2P35 A;  7ICO A;  5ALE A;  2K8B B;  3FAH A;  3RB3 A;  4B9L A;  1ZQS A;  4FBT A;  4B9S A;  1IG6 A;  2RLT A;  5DB8 A;  3N4M B;  5AIA A;  3KOO A;  4RQ6 A;  2PKE A;  3UM9 A;  2IHN A;  5G5G A;  8ICZ A;  4Y2Y A;  4MFC A;  3G6Y A;  3RJG A;  5B5E U;  5KFU A;  5DGA A;  9ICK A;  1OUQ A;  1HIW A;  3RR8 A;  2JR5 A;  4ECQ A;  4FE3 A;  1HJP A;  4OJP A;  1KDH A;  4B9T A;  9ICE A;  2ZIW A;  1D8B A;  4PHA A;  5J0Y A;  5AHX A;  4F8R A;  3AU2 A;  3TKA A;  4UB6 U;  5DBB A;  4R65 A;  1SL2 A;  2AGQ A;  1S8O A;  4O9M A;  8ICS A;  1FFV A;  4Y2V A;  5J2A A;  1BPB A;  5KFN A;  4J9R A;  4OJ5 A;  3TFS A;  1KKX A;  1HUO A;  2XID A;  4M9L A;  3VCB A;  4QWD A;  1NZB A;  4CE6 A;  1N5X A;  5EWF A;  3BZC A;  1NJZ A;  4J9Q A;  1ZQJ A;  4ECZ A;  3ISD A;  1BPD A;  5F9N A;  1BNO A;  2PFO A;  3KHH A;  5J0Q A;  4Y2T A;  5KG0 A;  4GXJ A;  4I2I A;  4UBC A;  1XC9 A;  2E8N A;  4YD2 A;  2Y9U A;  5KFT A;  3T5L A;  3M6K A;  5J0T A;  3NVZ A;  2JRZ A;  3RFA A;  4GXK A;  1H38 A;  4CF3 A;  3M9O B;  2A1A A;  4M9N A;  1L3T A;  2W9A A;  2EDU A;  4UB3 A;  4EEN A;  5J2J A;  3RJI A;  9ICT A;  4DSF A;  2FPM A;  4P0Q A;  4RPY A;  2BHN A;  3RB6 A;  2DGZ A;  4J9N A;  2Q4T A;  3BZK A;  1ZJM A;  1ZQK A;  2RQ5 A;  5JU5 A;  3EYZ A;  5DB9 A;  2BR0 A;  1ZQG A;  7ICR A;  5KFM A;  3CW2 C;  3CYM A;  1BPZ A;  5ALX A;  2YTU A;  1AQ6 A;  4G3I A;  1NJW A;  1SZP A;  4TQR A;  2E1E A;  4FS2 A;  3MGH A;  3RRH A;  4B9U A;  2AGP A;  2FMS A;  4PJ0 U;  1Y88 A;  2FMQ A;  2YMQ A;  2JZB A;  3TFR A;  1X9M A;  4KLJ A;  5AI0 A;  1K1Q A;  1IV8 A;  3QXG A;  2QB1 A;  3V72 A;  2ZG6 A;  2ZJA A;  1XO1 A;  5L1I A;  2XY5 A;  1L8O A;  2DWQ A;  2AJQ A;  9ICL A;  1ZQY A;  4QZB A;  1KEJ A;  2FJ6 A;  3E2E A;  3CRX A;  2FE9 A;  5J2I A;  2O6K A;  4DSK A;  4NY8 A;  2KVS A;  4F92 B;  3SZ2 A;  5CRX A;  3N7S C;  3SEI A;  1O03 A;  2WFA A;  4KLQ A;  1SXE A;  3MGV A;  2PI5 A;  4IRK A;  2BCR A;  4IS7 A;  9ICS A;  4MEX A;  1NK4 A;  2ES6 A;  2QKQ A;  4JV1 A;  2LBO A;  2KKP A;  3PV8 A;  2VA2 A;  4OCZ A;  3V6H A;  4QW9 A;  2MUT B;  3OHB A;  4K4G A;  7ICT A;  2MA1 A;  1CEZ A;  4IRC A;  3WK4 A;  4YFK A;  2KVC A;  2YY6 A;  1N62 A;  2C2D A;  3RAQ A;  8ICC A;  1Z3E B;  2DL0 A;  4B9V A;  1CI4 A;  4NLK A;  5AKG A;  3ZD8 A;  1KLN A;  4KIT B;  4CCH A;  4RQM A;  5ALH A;  3QU5 A;  1XSL A;  1SGG A;  4NL9 A;  4C8L A;  4ED3 A;  4PL2 A;  1KW4 A;  3LK9 A;  1ZJN A;  5KG2 A;  3QEA Z;  1S77 D;  1T4G A;  1L6N A;  2XC9 A;  2RDI A;  1Z00 B;  1SKW A;  4U7C A;  4K4I A;  4B9N A;  2XO7 A;  4UAS A;  3N28 A;  5KFA A;  5GTI U;  5D49 A;  1ZQD A;  4NJ8 A;  1TFR A;  2QAR B;  3SYZ A;  2BQU A;  5AI8 A;  1DGS A;  4YD1 A;  3GQC A;  4ECR A;  3I76 A;  2R8K A;  2XY6 A;  7ICQ A;  5JUM A;  5EOZ A;  2KHQ A;  4UAR A;  2HMX A;  4IQV A;  4XUS A;  2VIX A;  2KJ9 A;  1ZET A;  2C2E A;  1RM6 C;  3PVX A;  3H8M A;  3IRU A;  3LYS A;  5CEH A;  4EYH B;  3H7I A;  3KKA A;  3H40 A;  1L8L A;  2JGA A;  3B0Y A;  4UAZ A;  3MFI A;  3TQ1 A;  4CRX A;  1ZXI A;  4TUP A;  4I2F A;  4E0D A;  4JWN A;  4DOA A;  5KTQ A;  5DG9 A;  4BX9 C;  5EE9 A;  1TV9 A;  4I2G A;  4P4P A;  5J0U A;  4CNQ A;  4K4H A;  1NK9 A;  1PZN A;  1LVH A;  4Y2S A;  1ZQQ A;  9ICQ A;  5HNK A;  1RXW A;  2WHE A;  4ECX A;  2UVW A;  1PK1 A;  9ICJ A;  2VA3 A;  2H5X A;  4O5E A;  1S76 D;  2BDP A;  4F91 B;  3AL0 B;  5K4L A;  3HWT A;  4ELT A;  1JMS A;  5D46 A;  1J2N A;  1HUZ A;  1BVS A;  5IIK A;  2XCA A;  4UW9 A;  5J2F A;  2HBJ A;  3HJE A;  2HBK A;  4TUQ A;  1V38 A;  4F2S A;  4HAI A;  5EWG A;  4IL6 U;  2AXT U;  1ZQX A;  1JAL A;  4OO1 J;  1NK7 A;  9ICW A;  3MR5 A;  4F4K A;  8ICE A;  1X2I A;  5DBA A;  4LZG A;  5KFR A;  2H3Q A;  4I2H A;  4RPZ A;  3OPX A;  4DQI A;  1L5U A;  4KLG A;  3RJF A;  4KLS A;  4DSI A;  2OHF A;  2XIC A;  4EYI B;  1S9F A;  1SWW A;  2EZZ A;  5IIM A;  5DBC A;  1JRO A;  2JXJ A;  2WTF A;  4P2H A;  3M9N B;  5F9L A;  2BCS A;  4F5P A;  3RB4 A;  1SB3 C;  4LJX A;  3PSP A;  1RZT A;  4Y2R A;  3IV6 A;  5III A;  1WWV A;  5ALF A;  3A0B U;  8ICG A;  5IIJ A;  5L1L A;  5KFP A;  5J2B A;  5TIS U;  2P66 A;  5AI9 A;  2ASD A;  9ICC A;  3F5A A;  4KLE A;  3ED5 A;  4M04 A;  4GC7 A;  1URJ A;  2HHW A;  5J8Y A;  5T14 A;  1CUK A;  1ECW A;  2F8K A;  1S0M A;  1LKY A;  4P0Q B;  1B0X A;  4PZO A;  1N5W A;  5ALO A;  3GU3 A;  4QZD A;  3H0R B;  1V85 A;  3BQT A;  1NK5 A;  1T8E A;  4F50 A;  2ZUC A;  1X9X A;  4DOC A;  1RXV A;  1RDF A;  1KBU A;  2QB0 A;  1NKC A;  8ICB A;  3SEN A;  4XA5 A;  1IM4 A;  4IR9 A;  2KV2 A;  3CP8 A;  1X6I A;  1UT5 A;  1C20 A;  3RH6 A;  2RHF A;  3IG8 A;  4GFJ A;  4GLX A;  2I1Q A;  2G09 A;  5AKI A;  3Q8R B;  3ETR A;  1TVA A;  2BPF A;  4Q43 A;  2IOH A;  3H4D A;  4J9M A;  1IIP A;  3M8R A;  8ICQ A;  2JEJ A;  3TAP A;  4TUR A;  4FBU A;  3V7K A;  3H8W A;  2Q0Z X;  1ZQE A;  3RJH A;  3MAB A;  3OSN A;  2VA8 A;  2JZB B;  2KFN A;  4RT2 A;  4C8K A;  2OXO A;  1S97 A;  1S0O A;  2IA6 A;  4JMU A;  2W9C A;  2BPC A;  3MFH A;  4YR2 A;  1MN8 A;  1KFS A;  4RNN A;  1IXR A;  3GIJ A;  1DOQ A;  1FO4 A;  1B4F A;  2W55 A;  3S6J A;  3MR6 A;  5J0W A;  4J9O A;  5EE1 A;  3FM9 A;  4XRH A;  1COO A;  3B0X A;  1N56 A;  1ZQA A;  5DLF A;  4DQP A;  1S0V A;  3UQ0 A;  2YMM A;  2A3V A;  2VJ4 A;  3QEB Z;  4UBB A;  4YXM A;  4P4O A;  5KG5 A;  4PH5 A;  4Y2J A;  4DFP A;  4I27 A;  3TAQ A;  5ALV A;  2QLT A;  2NYV A;  2BCV A;  4RQ0 A;  4B9M A;  5ALM A;  4G9B A;  4RPX A;  1KTQ A;  2PFP A;  2AH5 A;  2F1J A;  1A76 A;  4MHV A;  1PUZ A;  3JPQ A;  1L3U A;  1SV0 A;  4RQ3 A;  4B6J A;  4Q44 A;  1ZQN A;  4QWA A;  4KLI A;  2NV3 A;  4JK1 A;  3EPG A;  3PR5 B;  3PSF A;  2HHV A;  5AKE A;  3D2N A;  2ZIX B;  8ICX A;  5DLG A;  5L9X A;  3TAN A;  2KZM A;  3N7R C;  2BCQ A;  4MEY A;  4DO9 A;  3C5G A;  1QCK A;  2KNJ A;  5AKH A;  1QTM A;  2W3S A;  4JV2 A;  4ELU A;  4UB2 A;  2I6X A;  1Q8K A;  2KSO B;  4YXJ A;  4F2R A;  3JPS A;  4KLL A;  4UAW A;  4DEZ A;  4BXO A;  8ICJ A;  3PY8 A;  2MRL A;  1X66 A;  2I5H A;  2D3D A;  3PMN A;  3SQI A;  2FMP A;  3VC8 A;  2K8A A;  1C7Y A;  1COK A;  5CHG A;  2ISO A;  3MC1 A;  1NKE A;  3HPO A;  1RQN A;  5KG3 A;  4JB3 A;  3WK7 A;  4QZE A;  2YQE A;  2PI4 A;  3PX0 A;  3V7L A;  4I2A A;  3KTQ A;  3BS5 A;  3NUQ A;  4O3O A;  2KHV A;  1D8Y A;  3GFK B;  5ALL A;  1ZQH A;  5ALU A;  7ICG A;  4ECW A;  2HDO A;  5KG6 A;  4Y2Q A;  4JV0 A;  1BPE A;  4YMM A;  3ISB A;  1XWL A;  4CGZ A;  2ASL A;  4O3S A;  2CRX A;  3ICX A;  4ECT A;  9ICP A;  2LHT A;  4CF5 A;  1XU4 A;  1ZD5 A;  4DSJ A;  2C2R A;  2I9G A;  2JEF A;  2R8G A;  1PK1 B;  2G07 A;  1UHU A;  4ECU A;  5ALK A;  4YQW A;  4R8U B;  9ICV A;  2V4R A;  2KIC A;  3L5K A;  1UA1 A;  1L7O A;  4JWM A;  5ALY A;  5CP2 A;  1X6J A;  5KFI A;  4KMO B;  2CXY A;  2KIV A;  4EEK A;  2XCP A;  3TAR A;  2ESE A;  1SL1 A;  1YZ7 A;  1DK2 A;  1A0P A;  1U48 A;  3MGI A;  4O3R A;  3ZDD A;  2EAP A;  5DB7 A;  5TZV A;  1NJY A;  2HVI A;  4MF8 A;  1ZRM A;  3H0M B;  3SAF A;  4RU9 A;  3QE9 Y;  1XSP A;  3NRW A;  4NV0 A;  1JXE A;  2K4I A;  3UXO A;  4KMU A;  4UAU A;  5FP0 A;  1ZQC A;  4Y2U A;  2BGW A;  1KL9 A;  1XNS A;  2XGQ A;  3ALR A;  3Q8S B;  1DK3 A;  5ALR A;  2P6R A;  2ZIU B;  5KFD A;  4IRD A;  2MAX A;  4DL7 A;  2W9M A;  4KLD A;  3T5K A;  3I1Y A;  1HEK A;  3QNM A;  5AKY A;  1Z1B A;  2ZIV A;  3NTU A;  5J0S A;  3N7P D;  5DDY A;  3WK5 A;  5KFL A;  3GV8 B;  4I2B A;  1NI3 A;  3AM9 A;  2FI1 A;  3NAS A;  2HW3 A;  3T79 A;  2H3I A;  4DQS A;  4O5K A;  5CR0 A;  3RH4 A;  1TAQ A;  4DQQ A;  5AM2 A;  3PML A;  3QYP A;  3MDA A;  2WB1 F;  5DGB A;  5KT7 A;  1ARO P;  4NLC A;  2HBL A;  3QUB A;  5ALT A;  2K4E A;  3BDP A;  3IG5 A;  4YN4 A;  2W11 A;  2OEH A;  3V6K A;  4Q8E A;  2G5H B;  2K4P A;  4F5O A;  4BWJ A;  1LKY B;  4KTQ A;  1U47 A;  5KFK A;  3NRZ A;  3C2L A;  3UXN A;  2J6U A;  3NVW A;  4Z6D A;  2ISP A;  4MF2 A;  3QUC A;  2QB0 B;  4IQU A;  1N60 A;  3EPI A;  1NK0 A;  3KBB A;  4RQ8 A;  1BPX A;  2FLP A;  1RQL A;  3H8S A; 
#chains in the Genus database with same CATH homology
 2LI6 A;  1KN5 A;  1KKX A;  1KQQ A;  1C20 A;  2JRZ A;  5CEH A;  1IG6 A;  4LJX A;  2RQ5 A;  2EQY A;  2OEH A;  2KK0 A;  2LM1 A;  2CXY A;  2YQE A;  2JXJ A;  5K4L A;  2EH9 A;  1RYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...