1RYUA

Solution structure of the swi1 arid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords SWI/SNF-related, matrix-associated, actin-dependent regulato
publication title Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ryuA00
2KK0A 2OEHA 2CXYA 2RQ5A 1C20A 2LI6A 2LM1A 1KQQA 5K4LA 4LJXA 1RYUA 1IG6A 2EH9A 2YQEA 2JRZA 2EQYA 2JXJA 1KKXA 1KN5A 5CEHA
chains in the Genus database with same CATH superfamily
2PFOA 2K4EA 3R9KA 1PZNA 1IIPA 3C1ZA 2B0CA 1KQQA 3B9JA 3NVYA 3ZI4A 1JN3A 2KOBA 2GH1A 3GIIA 3C28A 4UB6U 4RZRA 3QUCA 4FE3A 3BQTA 4RQ1A 3V6KA 4DL4A 3RJFA 2HHXA 1NOMA 2FMPA 1L7MA 2OHFA 7ICFA 4C8KA 2D3DA 1TK5A 5J2EA 2WB1C 3CYMA 5EWGA 3QZ8A 2AHOB 1Z00B 4CF3A 3EWAA 3KHRA 4O3OA 3IRUA 5J0PA 5IILA 2EH9A 2OXOA 3H4DA 3HP6A 3TKAA 2E5SA 5AK6A 1Q3UA 2QB0A 3MR3A 3GIJA 4BDPA 4J9QA 4E0DA 3NS1A 2NO5A 1LKYA 4F4KA 4NV0A 2OCEA 3E0FA 2NRWA 1WCLA 1TAUA 3GV8B 3LDAA 1L7OA 2W8KA 4Q8FA 2D8CA 4NM2A 3ZDCA 3KZIU 3LYSA 1QSYA 1J2NA 4NY8A 1KEJA 3RTVA 4ED7A 2DL0A 4NLGA 4ZOHC 5CHGA 3SAFA 4TQSA 1S5LU 2HSZA 5ALQA 5J29A 5B66U 1SXEA 1L3TA 4U7CA 3UMGA 5EWEA 1ZQRA 4DSJA 2QKQA 4C8NA 2MUTA 4YR0A 2B6GA 3E58A 4O3NA 3H8MA 4YXMA 2QLTA 4ED2A 4Y2VA 9ICUA 4DCCA 5D49A 4YMMA 5L1MA 3PX4A 2W3RA 4OJPA 4R65A 1NK8A 4RT3A 1N62A 2DFLA 3N7PD 3M1YA 4P0PA 2ASDA 4BJQA 1L8LA 3QU4A 3RH5A 1TE2A 1Q46A 4UB4A 9ICEA 1ZQUA 5ALFA 4DOAA 1XNSA 3QX7A 5JTIA 9ICJA 5AKEA 4ECVA 2KVSA 1KFDA 3EUB2 1T8EA 3QNMA 3RJHA 7ICIA 1DXSA 2JEJA 1U9LA 3SEIA 3IG5A 5ALTA 2BCVA 5IINA 5J0XA 3MABA 2L5YA 2GOLA 1KBUA 3C5FA 2ESEA 2G07A 1NJXA 1OW5A 5KT7A 5F9LA 5J0SA 4DS5A 7ICRA 1JMSA 2IOHA 4FFDA 4MEYA 4R66A 2JH7A 4F5OA 1FFVA 4PJ0U 3CRXA 2J6SA 5CJ7A 4KLDA 5F9NA 4J9OA 1Q8KA 2PXIA 2RHFA 3NVZA 3AUOA 4ED1A 1F44A 3JPTA 4DSFA 2F1IA 5JRTA 3ZDAA 5DG9A 2XY6A 3WKAA 1YT3A 4QWBA 1NNLA 3UQ2A 1V9PA 8ICRA 4EBEA 3TAQA 3HRDD 1ZQCA 3KKAC 4Y2UA 3PNCA 2AGQA 2XGQA 2PI4A 1HEKA 3SD7A 4DFPA 4IR1A 5J8YC 4C7YA 1S0NA 2G06A 2A1JA 4PHPA 2BPCA 4UATA 3AQEA 2KHQA 5AIBA 3V6HA 1UCVA 5D46A 2XY5A 3PW4A 3RJGA 1KSPA 3RR8A 3V7LA 2YMPA 3UQ0A 5DB7A 1KFSA 1L7NA 3PY8A 2ZJ5A 1VJ5A 4FBUA 5J0YA 1ZQXA 2DPJA 2PMZF 2HVHA 4DFKA 2XCAA 4US8A 1L5UA 2JMGA 3D2QA 4C8OA 1ZYQA 2ZXHA 2EANA 2O6KA 5DBAA 1COOA 2Y9TA 3BS5A 4Y2SA 4EYHB 3EYZA 2ZJ8A 4LZDA 5HR6A 4PPXA 5AK3A 4B9TA 5AI5A 5BOMA 3T79A 3I28A 3N28A 4DSKA 1ZD4A 2UVRA 4WJ3B 8ICPA 2GLEA 3RFAA 4DOCA 4UQGA 4P4OA 5AI8A 4DFJA 4XUSA 4DSEA 4I2GA 2ZTEA 3L3FX 4UB3A 4Y2YA 1TAMA 2I1QA 2ASLA 5ALDA 3C2MA 4I2BA 4DOBA 4UARA 3N7SC 2IOFA 1YZ7A 4DS4A 8ICCA 3ISDA 3EW9A 2ALZA 5E79U 1PK3A 4UAWA 9ICXA 3WKCA 3HILA 8ICVA 3PVXA 2EZXA 4QWCA 5J2BA 3M8SA 9ICWA 2V9WA 5H2FU 5KFLA 2VA2A 1SV4A 1SXDA 1JXEA 4ED0A 4JV0A 4JWMA 4F5PA 2YY6A 2CPRA 1NKBA 2HCFA 5KT5A 3PZPA 4XA5A 5DLGA 1HJPA 1Y88A 4Z6DA 2PFNA 4B9NA 4DL5A 4DL3A 2XC9A 2FPKA 1M6YA 2KVCA 3M9NB 2PKEA 2Z7JA 1SGGA 2CRXA 5AM1A 2KN7A 1HUOA 2P6UA 1NK6A 4F93B 1NI3A 1ZRNA 4DF8A 2CN1A 4RQ6A 1BPYA 5G5GA 4P2HA 1UPHA 1OXJA 4EZ6A 1L3UA 1PK1B 1UA0A 4OJ5A 2YX8A 4RQ3A 5AM2A 4YD1A 2OYYA 2KG5A 5KFBA 3Q8PB 3LWLA 2YMLA 4M2YA 5AKXA 1SL2A 1JXLA 2JZBA 3BDPA 4FBTA 2KICA 1S0OA 1DK2A 3WK7A 5DQHA 4M9GA 5AKJA 5KAIU 2K4IA 2Y0SF 2JEGA 2FPLA 3PX0A 9ICPA 4JB3A 5DB6A 2WHEA 1X6JA 7ICHA 9ICKA 2XICA 4XRHA 2ZTCA 3C2LA 4KLSA 8ICUA 4OO1J 3GILA 1ZQNA 2C2EA 3BQ1A 1JRPA 3UM9A 3HKZF 4IRKA 2W03A 2ZIUA 1FEZA 1XSLA 2Q0ZX 4QZDA 3LK9A 5J8YA 1T94A 4JK1A 5KG3A 2MA1A 2ZIWA 3WK4A 2IBKA 3EPGA 1PVPA 4K4IA 3RF9A 4OD0A 4QZEA 1V85A 1ZQLA 5KG5A 4TURA 7ICNA 1L7PA 8ICZA 5DB8A 5ALHA 1JX4A 1X9SA 2EAOA 4F8RA 2KJ8A 3QU7A 5EE3A 3OSPA 3L4PA 3A0HU 4EYIB 1XS9D 1S76D 4BXOB 3BQ2A 3Q8MA 2LM1A 3O0FA 1ZQYA 4YXJA 1ZD5A 4O3SA 4PL2A 5AICA 2K4PA 3SYZA 1N2XA 4Y2QA 2WF9A 4KN7A 2ATLA 4G9BA 2V4QA 1S77D 1PVRA 3PW5A 3PW2A 3Q8KA 4QZ9A 4RU9A 5KG2A 4BX9C 8ICTA 2LHTA 1B43A 4DSLA 4P0QA 4QZBA 3V6JA 2J6UA 2H5XA 2KKVA 4X5VA 5L1IA 8ICNA 5CP2A 1X6IA 1D9DA 4AP9A 5AKGA 4UW9A 5KL1B 4QWEA 5DDYA 4UB1A 5J2IA 9ICFA 3GFKB 2K8AA 2KIWA 2LYAA 1ZQGA 1NZPA 3HX0A 5DG7A 5KFYA 5AK4A 3ZDDA 4C80A 2DF4B 2KIVA 2KSOA 4Y2JA 2HHSA 4ECXA 2JGAA 1F5SA 5IIJA 3QU9A 3QEAZ 4NM1A 8ICKA 1D8LA 1JI7A 5EE9A 1ZXIA 5ALKA 4KLFA 3QZ7A 3L5KA 2W7OA 4TUQA 2QB1A 4GXJA 5C0YA 4F3OA 9ICQA 3SV4A 5J0QA 4F50A 1DGJA 5KT3A 1ZQSA 3H0RB 5CA7A 2JEIA 2GWSA 2KK0A 4QIWF 2XY7A 3AL0B 2YTUA 3AEVA 2JHDA 4BWMA 2WF7A 2XVTA 5AKLA 4DL2A 5GTIU 2KJ5A 3JPOA 2MAXA 2NRVA 3ICXA 4YG2A 3H0LB 3KD3A 5HHIA 4F2SA 8ICEA 4USAA 1FO4A 4I2EA 2KE7A 4F4WA 4LVSA 2H3IA 1GO3F 2BHNA 2W9CB 4I27A 2UVWA 2QARB 4IL6U 4F5QA 3J81j 4DLGA 5J2JA 1UA1A 2XGPA 4DL7A 4KTQA 4KLLA 1QLNA 4ECWA 2PFQA 5IIKA 1QQ7A 4QW9A 2BR0A 3A0BU 1X2IA 3D2NA 4F5RA 4DLEA 3AM9A 5KG6A 4DQPA 4M9HA 4UBCA 2ZTDA 5KFOA 4ECSA 1NJZA 4ECTA 2EZYA 3U26A 3NUQA 1ZQPA 5AKYA 3PR4A 4FZNA 1NKCA 3RJIA 1RXWA 5DQIA 1RPLA 4ECQA 3PSTA 1QH9A 4GLXA 5A0LA 4R63A 5HR7A 4J9PA 3PO4A 4QJFB 2WAQF 2ZIXA 2OH2A 1C20A 1MN8A 4M6WB 2QB0B 4YVZA 1NK5A 1SV0A 3WK9A 1B0XA 2KFNA 1FIQA 4PGYA 1X66A 3VCBA 4RNNA 3Q8SB 4FS1A 3QXGA 5J0OA 5KFSA 5KFWA 4DQRA 9ICMA 1BVSA 5J2FA 2VJ5A 3K75D 5G5HA 5AKHA 4ED8A 5ALRA 4EZ9A 3RB4A 3ZDBA 4Z6EA 1BPBA 5DBBA 5AI9A 2F1JA 3BQ0A 1X9WA 5J0WA 2LMRA 4HYKA 2MSNA 2YMMA 5TISU 1EXNA 4NJ8A 3WU2U 2KNJA 2XO7A 4MHVA 2NRXA 4DF4A 2DQNB 1QQ5A 5JUMA 2ODGA 4KMUA 2BQ3A 7ICGA 2R18A 1ZQ1C 1MA7A 1ZQKA 4P0PB 3H7IA 5KFXA 2M0NA 1WWUA 5AI0A 2HW3A 4P4PA 2WFAA 2PMZC 4Y2XA 2DUYA 3TADA 3B0XA 4HAIA 2H3QA 4AYBF 3GV5B 4GXIA 2LYBA 4OJLA 3RRGA 3E2EA 1BPEA 3GDXA 4KLTA 4O9MA 5ALJA 1N61A 1ZRMA 3PX6A 4KLEA 3NVWA 1BGXT 4KLUA 2Y1JA 2F8KA 3ETLA 3EPIA 5J2CA 4DEZA 1BNPA 2HHTA 4F91B 3QE9Y 5J0TA 2AXTU 1KL9A 4K4GA 3ZDEA 2AH5A 1V38A 3B0YA 2W9BB 1JALA 2KJ9A 3T5LA 3QUBA 3OJSA 3RR7A 3BQ7A 3PSIA 5J2KA 4RPXA 4OCZA 4US9A 4B9LA 2W11A 4CE6A 3JPRA 2IHNA 1Z4OA 1T7PA 1J97A 3K4GA 2BCSA 4PH5A 3HT3A 5KT6A 1IXRA 1ZQFA 3ORYA 1H38A 1UT8A 4R64A 3Q8RB 2HI0A 5DGBA 3AU6A 3SI8A 3UXOA 1ZJMA 1JIHA 1BPDA 2B21A 4J9LA 3UPQA 2HBKA 1Q3VA 5J0UA 1T3QA 3LVWA 2KFZA 4QWDA 1NZBA 4IS7A 7ICMA 4JV1A 3PW7A 5KFMA 3MR6A 3ONNA 1SZHA 3N7RC 2ZUCA 4BUGA 2VKQA 2E8PA 1D8YA 4GXKA 4I2AA 1QSSA 2E1FA 1MQ2A 3ZD8A 1L6NA 8ICWA 2Y9UA 2XCPA 3MC1A 1RQNA 2OWOA 1S8OA 4R8UA 1TKDA 7ICLA 1JUDA 4O5EA 4ZH4A 2W55A 3Q8QB 4U6PA 2ZIVA 2P35A 3IM1A 2NV3A 1VDVA 2E3TA 4KMOB 2Y0SC 4XQ8A 2R8JA 2W04A 1RXVA 1ZOLA 9ICTA 2R8HA 4Q43A 1A6SA 3OHBA 1SKSA 5KFHA 2AU0A 1ZQMA 4Z6CA 2FJ6A 5EE1A 5KFTA 5IIMA 2BQUA 1A77A 3HKZC 7ICKA 2FDRA 2JV3A 2GO7A 2HBJA 5L9XA 1S0MA 2H3FA 1RYRA 1U4BA 1WWVA 1BNOA 2F1HA 1C7YA 2PI5A 5AM3A 3H40A 4YN4A 5DDMA 4CF5A 2HBMA 1X42A 2BGWA 3RJEA 3K1ZA 3SMVA 4PGXA 3UMCA 2HDOA 3OGUA 4YCXA 1J2MA 3MR2A 2RQ5A 1ZQAA 2E8MA 4A8EA 1NK7A 3SV3A 4BWJA 2N1RA 3G6YA 2IHMA 3KHLA 1XC9A 4EEKA 4DL6A 4B9MA 3RJKA 4J9KA 8ICIA 3MFIA 4ICAA 2F2AB 4EEYA 3T5KA 4GFJA 4RPZA 5J2HA 5ALPA 3OTQA 3H8WA 5K4LA 3WK6A 1PK1A 1WYGA 5KFRA 4MFAA 3IV6A 1DRGA 4C7ZA 3PW0A 4KLGA 5AHXA 1SWVA 4J9SA 1XSNA 4RQ8A 4RQ0A 4ELUA 8ICBA 4ECRA 3FM9A 4J9RA 1ZETA 3IN5A 1UT5A 5KT2A 4KLQA 4F71A 1N48A 1L3VA 4I2HA 2DBYA 4G3IA 4O5KA 1NK4A 5L1KA 5ALMA 4ECYA 3KKAA 4PL1A 3G6XA 2W9MA 1SWWA 4F4YA 2NRTA 5DKWA 2BCRA 2HHWA 3C29A 9ICAA 2ZXIA 3H8SA 2YB4A 4CCHA 4J9MA 4NLKA 1XWLA 2AGPA 3F2DA 4UAUA 3ZD9A 4M9JA 2K60A 5KT4A 3UXPA 2RRDA 5DG8A 4BGDA 3JPQA 4NLZA 2JEFA 4JUZA 1ZQZA 5ALOA 3C2KA 2KZZA 4QIWC 4I29A 5CR0A 5GTHU 3F53A 3NASA 3KFUF 3M9MB 5CEHA 2KEYA 2W54A 4CF4A 4GC7A 3HJEA 5KG7A 3WKDA 4ECUA 4PHDA 2EAPA 2FE9A 2KZMA 3RAQA 3T5JA 4UB5A 1QQ6A 1PUZA 2C2RA 2AQ0A 5AIAA 2I5HA 1Z19A 1DK3A 5KFZA 3QUQA 8ICOA 4M04A 1WG8A 4DFMA 4RNOA 4I2IA 4FS2A 5DQGA 2LBOA 3S6JA 2DKXA 2HOQA 5AKKA 5AM4A 4MF2A 4ACOA 3BS7A 4RPYA 3JPSA 5KFKA 8ICGA 1XO0A 2XI9A 3SR6A 3IP4B 2HHUA 2E8OA 4C8LA 4YMOA 1U47A 1X9MA 3RBEA 2C28A 5BOLA 5KFFA 3RB0A 4RNMA 9ICBA 3M8RA 5CRXA 8ICXA 4RQ2A 5F3XB 3FDSA 2RDJA 5ALEA 3CP8A 4K4HA 9ICNA 1WCNA 1VLBA 5HMMA 3BZCA 4Q8EA 5CB1A 4PHEA 4Y2PA 2VIXA 1WUDA 2WAQC 4RQ5A 5J2GA 1ED1A 1NK9A 1NKEA 4YQWA 9ICGA 2EQYA 3RH4A 7ICSA 3KBBA 1XO1A 5IIIA 1TV9A 3PR5B 5KFDA 3QU5A 2NO4A 3N97B 2ZUDA 1Z1BA 4DQIA 5IIOA 5DLFA 2K4HA 1IV8A 4C4SA 2VANA 3EZ5A 2UVUA 1ZQBA 5HP4A 4Q45A 3MFHA 5DGAA 4ELVA 4O3MA 2HHVA 3JPNA 4IQUA 3TAPA 5T14A 1X9XA 5AK5A 3MBYA 5ALLA 2KKPA 4RQMA 3PV8A 2HMXA 3RBDA 2VA8A 1BPXA 2I9GA 3ISBA 4DWIA 2HBLA 1N56A 2RDIA 3M6KA 2FMQA 2ZJAA 1RQLA 2QARA 1FFUA 4NL9C 3AN1A 5ALVA 2LPEA 4KX3A 3NGDA 2BCUA 4KLJA 1A76A 3PSFA 1HIWA 1Z1VA 1S9FA 1CRXA 1ZQJA 3F2BA 4UB8U 2ISOA 1SKWA 4AYBC 1UHUA 5AI4A 2LM4A 1Z00A 8ICHA 5KFPA 3OJUA 4ED6A 4EELA 4JMUA 4NLBA 5ALWA 3KTQA 2G5IB 1SL0A 1SIJA 5KFUA 3KHGA 2FPMA 2ZIXB 1A0PA 1LKYB 1N60A 1ZQTA 4I2FA 4TUPA 4TQRA 3K1RB 2H3ZA 1K5OA 4M6WA 2VJ4A 4IRCA 1LB2B 4P4MA 2WTFA 3NVVA 2ZG6A 4KX5A 3IG8A 2ZUBA 4CRXA 2F8LA 7ICEA 2KZ3A 3MGIA 1QSLA 3C21A 1CI4A 3WKBA 4EX6A 3UXNA 1V97A 4C4TA 4UBBA 4I2CA 4C8MA 2MUTB 4I2DA 4B9VA 9ICVA 4UB2A 4QWAA 1QCKA 4FZMA 3WK5A 2D6FC 3PMNA 3GQCA 3QUTA 1S10A 4O0IA 2AQ4A 1U48A 2BKEA 4UAVA 8ICQA 5J2AA 2KV2A 4KLMA 4OJOA 2PFPA 2IOFK 4C0ZA 9ICLA 5ALUA 7ICVA 4FZLA 1UQVA 3V72A 9ICOA 2EAMA 9ICHA 1QTMA 1P7DA 1ZQVA 2F44A 1URJA 5EWFA 4UAZA 4MFCA 3GIKA 4PZOA 3V7JA 3HPOA 4KLOA 3TACB 2WB1F 8ICLA 4UASA 3OSNA 7ICJA 4QZGA 2BZFA 4KLHA 3ETRA 5J2DA 4KLIA 1O03A 3SAHA 3PMLA 3KOOA 3M9OB 1RM6C 1N5XA 8ICFA 5L1JA 2J6TA 1N63A 4GC6A 4PGQA 5KG1A 3ED5A 2Y1IA 3SENA 3FC4A 3F2CA 5DB9A 4YFKA 2HHQA 3JPPA 5BPCA 2LYHA 2BDPA 4NWIA 1K1QA 4KN4A 2VA3A 7ICPA 2W9BA 4RQ4A 1HUZA 4IRDA 4YD2A 2I6XA 1ZQDA 3GIMA 2HVIA 2H3VA 2KP7A 2DKZA 2OM6A 5ALYA 2M9NA 4NL9A 4IQTA 4M0AA 9ICIA 1ZD3A 3ALRA 4QZIA 3UMBA 4F92B 1ZQQA 8ICAA 1B4FA 2A1JB 7ICUA 4KITB 1K1SA 2WF6A 4I28A 2W7PA 2W8LA 1S97A 9ICCA 4DO9A 2FMSA 4RUCA 1RZTA 4GIBA 4M47A 3TI0A 4PZNA 1TAQA 4IQVA 1AROP 3IHQB 2W9AA 4DSIA 2FLLA 1KW4A 4F2RA 2KHVA 5JU5A 1BPZA 4Y2TA 1DGSA 5HMLA 3G6VA 3D6JA 5DBCA 5FP0A 1TK0A 2WF5A 3BS5B 5HNKA 4IR9A 9ICSA 4NLCA 3CNHA 3LVVA 5AM0A 1B22A 4R8UB 1T4GA 3OHAA 4C4RA 1XU4A 3TARA 2CXYA 2ZIVB 4NXZA 2DGZA 2G5HB 2FI1A 3DEEA 2JH1A 2W43A 1SL1A 5TZVA 2XIDA 7ICTA 4J03A 5KG4A 2AJQA 2JXJA 4M9LA 4O5CA 2EDUA 1ZQWA 5L1LA 4Q44A 3F5EA 1SB3C 1OUQA 3HWTA 5KFQA 5KFIA 4B9SA 3I1YA 4F5NA 2E1EA 3NRWA 4Z6FA 3RB3A 3GV7B 2R8IA 4O3QA 4RT2A 4QZAA 4O3RA 4ED3A 3MGVA 2KTQA 3H4BA 1TVAA 2E8NA 2WF8A 3DDHA 2FLPA 3FAHA 3Q8LA 2NRZA 3HW8A 2OEHA 5KFGA 4RUAA 1MQ3A 1F0MA 2BDUA 4MFFA 3QYPA 8ICSA 1DOQA 1T3NA 4B9UA 1NJYA 3RH6A 4YR2A 3MDAA 1X40A 2A19A 2EZZA 1RDFA 4CGZA 5AKZA 4DQSA 4NLNA 1LVHA 1ZD2P 5ALIA 3GZFA 1ZQHA 5KAFU 3OPXA 1RYSA 1CEZA 4TUSA 2IMWP 2JRZA 2BCQA 3THVA 8ICMA 3MR5A 1KDHA 2JZBB 4YP3A 2BPGA 2UVVA 4QZHA 3T5HA 2KMDA 5J0RA 1AQ6A 3M6ZA 8ICJA 5KL8B 3SAGA 3RJJA 4UAYA 2K8BB 4MF8A 2R8GA 2P6RA 2YB1A 2P66A 3F5AA 3BZKA 1MC8A 2ZIUB 4FO6A 2BPFA 3H8JA 3T3FA 2ISPA 1CUKA 3NRZA 3WK8A 3SZ2A 3SQIA 1L8OA 2ZIWB 2RLTA 4OJ6A 2G08A 9ICRA 2YQEA 5ALXA 1JROA 2A3VA 3NTUA 1NK0A 5ALGA 2Q4TA 4QZFA 4RQ7A 2F77X 1TK8A 3MDCA 2RP5A 5KFVA 5KFCA 3AQFA 1Z3EB 4B6JA 3TQ1A 4J9NA 5B5EU 1KTQA 7ICOA 4BXOA 3TFRA 7ICQA 1SZPA 4ECZA 3CW2C 1SV0C 2ES6A 4DQQA 5KFAA 1ECWA 3PO5A 3AMZA 3VC8A 4EBDA 3TANA 3RAXA 1L3SA 3PSPA 4EENA 1IG6A 3AU2A 4F72A 1ZQEA 4IC9A 3KHHA 3C5GA 5AI6A 4PHAA 4P0QB 1ZJNA 5KFNA 1LV5A 1ZQIA 5ALNA 4YR3A 1N5WA 5HHHA 2C22A 1IM4A 1KFTA 2C2DA 2AGOA 5C5JA 2MU2A 3RRHA 1D8BA 2K89A 2BQRA 2YMQA 3GU3A 1KRPA 4LZGA 2R8KA 2A1AA 1SKRA 4EBCA 3MGHA 2KD1A 1YZ6A 5KTQA 1Z4NA 2KSOB 5EOZA 2G0AA 2MRLA 3N4MB 2DWQA 3KZXA 4QZ8A 4EX7A 5KFEA 4QZCA 3DV9A 2FLNA 3C23A 3I76A 2NYVA 4JV2A 4Y2RA 3C1YA 5AM5A 1KKXA 3V7KA 3H0MB 4F4XA 3TADC 4QW8A 5KNIA 1ZQOA 1RG6A 4QNLA 3ISCA 5KFJA 2YN4A 2F3NA 1U49A 4RQNA 2HOFA 2W3SA 1O08A 3LWMA 3QU2A 1RYUA 2LKYA 2ASJA 1D9FA 2K8CB 4O3PA 3WKEA 4CNQA 4YMNA 3FYHA 4F4ZA 5AKIA 3QEBZ 4MEXA 2DPIA 1TFRA 2HOIA 5D4BA 5CWRA 8ICYA 5ALSA 3TFSA 4I2JA 1XSPA 2IA6A 2G09A 1PVQA 4JWNA 2LI6A 4CDGA 3M7DA 3RB6A 1MSWD 1S0VA 4M9NA 4ELTA 2JR5A 1U45A 3IDWA 5ALZA 4LJXA 3D2SA 4IQWA 4DFDA 2W9CA 1KLNA 5KG0A 2V4RA 1KN5A 5EE0A 3BJYA 2F76X 1COKA 1NJWA
chains in the Genus database with same CATH topology
2KK0A 2OEHA 2CXYA 2RQ5A 1C20A 2LI6A 2LM1A 1KQQA 5K4LA 4LJXA 1RYUA 1IG6A 2EH9A 2YQEA 2JRZA 2EQYA 2JXJA 1KKXA 1KN5A 5CEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KK0 A;  2OEH A;  2CXY A;  2RQ5 A;  1C20 A;  2LI6 A;  2LM1 A;  1KQQ A;  5K4L A;  4LJX A;  1RYU A;  1IG6 A;  2EH9 A;  2YQE A;  2JRZ A;  2EQY A;  2JXJ A;  1KKX A;  1KN5 A;  5CEH A; 
#chains in the Genus database with same CATH topology
 2PFO A;  2K4E A;  3R9K A;  1PZN A;  1IIP A;  3C1Z A;  2B0C A;  1KQQ A;  3B9J A;  3NVY A;  3ZI4 A;  1JN3 A;  2KOB A;  2GH1 A;  3GII A;  3C28 A;  4UB6 U;  4RZR A;  3QUC A;  4FE3 A;  3BQT A;  4RQ1 A;  3V6K A;  4DL4 A;  3RJF A;  2HHX A;  1NOM A;  2FMP A;  1L7M A;  2OHF A;  7ICF A;  4C8K A;  2D3D A;  1TK5 A;  5J2E A;  2WB1 C;  3CYM A;  5EWG A;  3QZ8 A;  2AHO B;  1Z00 B;  4CF3 A;  3EWA A;  3KHR A;  4O3O A;  3IRU A;  5J0P A;  5IIL A;  2EH9 A;  2OXO A;  3H4D A;  3HP6 A;  3TKA A;  2E5S A;  5AK6 A;  1Q3U A;  2QB0 A;  3MR3 A;  3GIJ A;  4BDP A;  4J9Q A;  4E0D A;  3NS1 A;  2NO5 A;  1LKY A;  4F4K A;  4NV0 A;  2OCE A;  3E0F A;  2NRW A;  1WCL A;  1TAU A;  3GV8 B;  3LDA A;  1L7O A;  2W8K A;  4Q8F A;  2D8C A;  4NM2 A;  3ZDC A;  3KZI U;  3LYS A;  1QSY A;  1J2N A;  4NY8 A;  1KEJ A;  3RTV A;  4ED7 A;  2DL0 A;  4NLG A;  4ZOH C;  5CHG A;  3SAF A;  4TQS A;  1S5L U;  2HSZ A;  5ALQ A;  5J29 A;  5B66 U;  1SXE A;  1L3T A;  4U7C A;  3UMG A;  5EWE A;  1ZQR A;  4DSJ A;  2QKQ A;  4C8N A;  2MUT A;  4YR0 A;  2B6G A;  3E58 A;  4O3N A;  3H8M A;  4YXM A;  2QLT A;  4ED2 A;  4Y2V A;  9ICU A;  4DCC A;  5D49 A;  4YMM A;  5L1M A;  3PX4 A;  2W3R A;  4OJP A;  4R65 A;  1NK8 A;  4RT3 A;  1N62 A;  2DFL A;  3N7P D;  3M1Y A;  4P0P A;  2ASD A;  4BJQ A;  1L8L A;  3QU4 A;  3RH5 A;  1TE2 A;  1Q46 A;  4UB4 A;  9ICE A;  1ZQU A;  5ALF A;  4DOA A;  1XNS A;  3QX7 A;  5JTI A;  9ICJ A;  5AKE A;  4ECV A;  2KVS A;  1KFD A;  3EUB 2;  1T8E A;  3QNM A;  3RJH A;  7ICI A;  1DXS A;  2JEJ A;  1U9L A;  3SEI A;  3IG5 A;  5ALT A;  2BCV A;  5IIN A;  5J0X A;  3MAB A;  2L5Y A;  2GOL A;  1KBU A;  3C5F A;  2ESE A;  2G07 A;  1NJX A;  1OW5 A;  5KT7 A;  5F9L A;  5J0S A;  4DS5 A;  7ICR A;  1JMS A;  2IOH A;  4FFD A;  4MEY A;  4R66 A;  2JH7 A;  4F5O A;  1FFV A;  4PJ0 U;  3CRX A;  2J6S A;  5CJ7 A;  4KLD A;  5F9N A;  4J9O A;  1Q8K A;  2PXI A;  2RHF A;  3NVZ A;  3AUO A;  4ED1 A;  1F44 A;  3JPT A;  4DSF A;  2F1I A;  5JRT A;  3ZDA A;  5DG9 A;  2XY6 A;  3WKA A;  1YT3 A;  4QWB A;  1NNL A;  3UQ2 A;  1V9P A;  8ICR A;  4EBE A;  3TAQ A;  3HRD D;  1ZQC A;  3KKA C;  4Y2U A;  3PNC A;  2AGQ A;  2XGQ A;  2PI4 A;  1HEK A;  3SD7 A;  4DFP A;  4IR1 A;  5J8Y C;  4C7Y A;  1S0N A;  2G06 A;  2A1J A;  4PHP A;  2BPC A;  4UAT A;  3AQE A;  2KHQ A;  5AIB A;  3V6H A;  1UCV A;  5D46 A;  2XY5 A;  3PW4 A;  3RJG A;  1KSP A;  3RR8 A;  3V7L A;  2YMP A;  3UQ0 A;  5DB7 A;  1KFS A;  1L7N A;  3PY8 A;  2ZJ5 A;  1VJ5 A;  4FBU A;  5J0Y A;  1ZQX A;  2DPJ A;  2PMZ F;  2HVH A;  4DFK A;  2XCA A;  4US8 A;  1L5U A;  2JMG A;  3D2Q A;  4C8O A;  1ZYQ A;  2ZXH A;  2EAN A;  2O6K A;  5DBA A;  1COO A;  2Y9T A;  3BS5 A;  4Y2S A;  4EYH B;  3EYZ A;  2ZJ8 A;  4LZD A;  5HR6 A;  4PPX A;  5AK3 A;  4B9T A;  5AI5 A;  5BOM A;  3T79 A;  3I28 A;  3N28 A;  4DSK A;  1ZD4 A;  2UVR A;  4WJ3 B;  8ICP A;  2GLE A;  3RFA A;  4DOC A;  4UQG A;  4P4O A;  5AI8 A;  4DFJ A;  4XUS A;  4DSE A;  4I2G A;  2ZTE A;  3L3F X;  4UB3 A;  4Y2Y A;  1TAM A;  2I1Q A;  2ASL A;  5ALD A;  3C2M A;  4I2B A;  4DOB A;  4UAR A;  3N7S C;  2IOF A;  1YZ7 A;  4DS4 A;  8ICC A;  3ISD A;  3EW9 A;  2ALZ A;  5E79 U;  1PK3 A;  4UAW A;  9ICX A;  3WKC A;  3HIL A;  8ICV A;  3PVX A;  2EZX A;  4QWC A;  5J2B A;  3M8S A;  9ICW A;  2V9W A;  5H2F U;  5KFL A;  2VA2 A;  1SV4 A;  1SXD A;  1JXE A;  4ED0 A;  4JV0 A;  4JWM A;  4F5P A;  2YY6 A;  2CPR A;  1NKB A;  2HCF A;  5KT5 A;  3PZP A;  4XA5 A;  5DLG A;  1HJP A;  1Y88 A;  4Z6D A;  2PFN A;  4B9N A;  4DL5 A;  4DL3 A;  2XC9 A;  2FPK A;  1M6Y A;  2KVC A;  3M9N B;  2PKE A;  2Z7J A;  1SGG A;  2CRX A;  5AM1 A;  2KN7 A;  1HUO A;  2P6U A;  1NK6 A;  4F93 B;  1NI3 A;  1ZRN A;  4DF8 A;  2CN1 A;  4RQ6 A;  1BPY A;  5G5G A;  4P2H A;  1UPH A;  1OXJ A;  4EZ6 A;  1L3U A;  1PK1 B;  1UA0 A;  4OJ5 A;  2YX8 A;  4RQ3 A;  5AM2 A;  4YD1 A;  2OYY A;  2KG5 A;  5KFB A;  3Q8P B;  3LWL A;  2YML A;  4M2Y A;  5AKX A;  1SL2 A;  1JXL A;  2JZB A;  3BDP A;  4FBT A;  2KIC A;  1S0O A;  1DK2 A;  3WK7 A;  5DQH A;  4M9G A;  5AKJ A;  5KAI U;  2K4I A;  2Y0S F;  2JEG A;  2FPL A;  3PX0 A;  9ICP A;  4JB3 A;  5DB6 A;  2WHE A;  1X6J A;  7ICH A;  9ICK A;  2XIC A;  4XRH A;  2ZTC A;  3C2L A;  4KLS A;  8ICU A;  4OO1 J;  3GIL A;  1ZQN A;  2C2E A;  3BQ1 A;  1JRP A;  3UM9 A;  3HKZ F;  4IRK A;  2W03 A;  2ZIU A;  1FEZ A;  1XSL A;  2Q0Z X;  4QZD A;  3LK9 A;  5J8Y A;  1T94 A;  4JK1 A;  5KG3 A;  2MA1 A;  2ZIW A;  3WK4 A;  2IBK A;  3EPG A;  1PVP A;  4K4I A;  3RF9 A;  4OD0 A;  4QZE A;  1V85 A;  1ZQL A;  5KG5 A;  4TUR A;  7ICN A;  1L7P A;  8ICZ A;  5DB8 A;  5ALH A;  1JX4 A;  1X9S A;  2EAO A;  4F8R A;  2KJ8 A;  3QU7 A;  5EE3 A;  3OSP A;  3L4P A;  3A0H U;  4EYI B;  1XS9 D;  1S76 D;  4BXO B;  3BQ2 A;  3Q8M A;  2LM1 A;  3O0F A;  1ZQY A;  4YXJ A;  1ZD5 A;  4O3S A;  4PL2 A;  5AIC A;  2K4P A;  3SYZ A;  1N2X A;  4Y2Q A;  2WF9 A;  4KN7 A;  2ATL A;  4G9B A;  2V4Q A;  1S77 D;  1PVR A;  3PW5 A;  3PW2 A;  3Q8K A;  4QZ9 A;  4RU9 A;  5KG2 A;  4BX9 C;  8ICT A;  2LHT A;  1B43 A;  4DSL A;  4P0Q A;  4QZB A;  3V6J A;  2J6U A;  2H5X A;  2KKV A;  4X5V A;  5L1I A;  8ICN A;  5CP2 A;  1X6I A;  1D9D A;  4AP9 A;  5AKG A;  4UW9 A;  5KL1 B;  4QWE A;  5DDY A;  4UB1 A;  5J2I A;  9ICF A;  3GFK B;  2K8A A;  2KIW A;  2LYA A;  1ZQG A;  1NZP A;  3HX0 A;  5DG7 A;  5KFY A;  5AK4 A;  3ZDD A;  4C80 A;  2DF4 B;  2KIV A;  2KSO A;  4Y2J A;  2HHS A;  4ECX A;  2JGA A;  1F5S A;  5IIJ A;  3QU9 A;  3QEA Z;  4NM1 A;  8ICK A;  1D8L A;  1JI7 A;  5EE9 A;  1ZXI A;  5ALK A;  4KLF A;  3QZ7 A;  3L5K A;  2W7O A;  4TUQ A;  2QB1 A;  4GXJ A;  5C0Y A;  4F3O A;  9ICQ A;  3SV4 A;  5J0Q A;  4F50 A;  1DGJ A;  5KT3 A;  1ZQS A;  3H0R B;  5CA7 A;  2JEI A;  2GWS A;  2KK0 A;  4QIW F;  2XY7 A;  3AL0 B;  2YTU A;  3AEV A;  2JHD A;  4BWM A;  2WF7 A;  2XVT A;  5AKL A;  4DL2 A;  5GTI U;  2KJ5 A;  3JPO A;  2MAX A;  2NRV A;  3ICX A;  4YG2 A;  3H0L B;  3KD3 A;  5HHI A;  4F2S A;  8ICE A;  4USA A;  1FO4 A;  4I2E A;  2KE7 A;  4F4W A;  4LVS A;  2H3I A;  1GO3 F;  2BHN A;  2W9C B;  4I27 A;  2UVW A;  2QAR B;  4IL6 U;  4F5Q A;  3J81 j;  4DLG A;  5J2J A;  1UA1 A;  2XGP A;  4DL7 A;  4KTQ A;  4KLL A;  1QLN A;  4ECW A;  2PFQ A;  5IIK A;  1QQ7 A;  4QW9 A;  2BR0 A;  3A0B U;  1X2I A;  3D2N A;  4F5R A;  4DLE A;  3AM9 A;  5KG6 A;  4DQP A;  4M9H A;  4UBC A;  2ZTD A;  5KFO A;  4ECS A;  1NJZ A;  4ECT A;  2EZY A;  3U26 A;  3NUQ A;  1ZQP A;  5AKY A;  3PR4 A;  4FZN A;  1NKC A;  3RJI A;  1RXW A;  5DQI A;  1RPL A;  4ECQ A;  3PST A;  1QH9 A;  4GLX A;  5A0L A;  4R63 A;  5HR7 A;  4J9P A;  3PO4 A;  4QJF B;  2WAQ F;  2ZIX A;  2OH2 A;  1C20 A;  1MN8 A;  4M6W B;  2QB0 B;  4YVZ A;  1NK5 A;  1SV0 A;  3WK9 A;  1B0X A;  2KFN A;  1FIQ A;  4PGY A;  1X66 A;  3VCB A;  4RNN A;  3Q8S B;  4FS1 A;  3QXG A;  5J0O A;  5KFS A;  5KFW A;  4DQR A;  9ICM A;  1BVS A;  5J2F A;  2VJ5 A;  3K75 D;  5G5H A;  5AKH A;  4ED8 A;  5ALR A;  4EZ9 A;  3RB4 A;  3ZDB A;  4Z6E A;  1BPB A;  5DBB A;  5AI9 A;  2F1J A;  3BQ0 A;  1X9W A;  5J0W A;  2LMR A;  4HYK A;  2MSN A;  2YMM A;  5TIS U;  1EXN A;  4NJ8 A;  3WU2 U;  2KNJ A;  2XO7 A;  4MHV A;  2NRX A;  4DF4 A;  2DQN B;  1QQ5 A;  5JUM A;  2ODG A;  4KMU A;  2BQ3 A;  7ICG A;  2R18 A;  1ZQ1 C;  1MA7 A;  1ZQK A;  4P0P B;  3H7I A;  5KFX A;  2M0N A;  1WWU A;  5AI0 A;  2HW3 A;  4P4P A;  2WFA A;  2PMZ C;  4Y2X A;  2DUY A;  3TAD A;  3B0X A;  4HAI A;  2H3Q A;  4AYB F;  3GV5 B;  4GXI A;  2LYB A;  4OJL A;  3RRG A;  3E2E A;  1BPE A;  3GDX A;  4KLT A;  4O9M A;  5ALJ A;  1N61 A;  1ZRM A;  3PX6 A;  4KLE A;  3NVW A;  1BGX T;  4KLU A;  2Y1J A;  2F8K A;  3ETL A;  3EPI A;  5J2C A;  4DEZ A;  1BNP A;  2HHT A;  4F91 B;  3QE9 Y;  5J0T A;  2AXT U;  1KL9 A;  4K4G A;  3ZDE A;  2AH5 A;  1V38 A;  3B0Y A;  2W9B B;  1JAL A;  2KJ9 A;  3T5L A;  3QUB A;  3OJS A;  3RR7 A;  3BQ7 A;  3PSI A;  5J2K A;  4RPX A;  4OCZ A;  4US9 A;  4B9L A;  2W11 A;  4CE6 A;  3JPR A;  2IHN A;  1Z4O A;  1T7P A;  1J97 A;  3K4G A;  2BCS A;  4PH5 A;  3HT3 A;  5KT6 A;  1IXR A;  1ZQF A;  3ORY A;  1H38 A;  1UT8 A;  4R64 A;  3Q8R B;  2HI0 A;  5DGB A;  3AU6 A;  3SI8 A;  3UXO A;  1ZJM A;  1JIH A;  1BPD A;  2B21 A;  4J9L A;  3UPQ A;  2HBK A;  1Q3V A;  5J0U A;  1T3Q A;  3LVW A;  2KFZ A;  4QWD A;  1NZB A;  4IS7 A;  7ICM A;  4JV1 A;  3PW7 A;  5KFM A;  3MR6 A;  3ONN A;  1SZH A;  3N7R C;  2ZUC A;  4BUG A;  2VKQ A;  2E8P A;  1D8Y A;  4GXK A;  4I2A A;  1QSS A;  2E1F A;  1MQ2 A;  3ZD8 A;  1L6N A;  8ICW A;  2Y9U A;  2XCP A;  3MC1 A;  1RQN A;  2OWO A;  1S8O A;  4R8U A;  1TKD A;  7ICL A;  1JUD A;  4O5E A;  4ZH4 A;  2W55 A;  3Q8Q B;  4U6P A;  2ZIV A;  2P35 A;  3IM1 A;  2NV3 A;  1VDV A;  2E3T A;  4KMO B;  2Y0S C;  4XQ8 A;  2R8J A;  2W04 A;  1RXV A;  1ZOL A;  9ICT A;  2R8H A;  4Q43 A;  1A6S A;  3OHB A;  1SKS A;  5KFH A;  2AU0 A;  1ZQM A;  4Z6C A;  2FJ6 A;  5EE1 A;  5KFT A;  5IIM A;  2BQU A;  1A77 A;  3HKZ C;  7ICK A;  2FDR A;  2JV3 A;  2GO7 A;  2HBJ A;  5L9X A;  1S0M A;  2H3F A;  1RYR A;  1U4B A;  1WWV A;  1BNO A;  2F1H A;  1C7Y A;  2PI5 A;  5AM3 A;  3H40 A;  4YN4 A;  5DDM A;  4CF5 A;  2HBM A;  1X42 A;  2BGW A;  3RJE A;  3K1Z A;  3SMV A;  4PGX A;  3UMC A;  2HDO A;  3OGU A;  4YCX A;  1J2M A;  3MR2 A;  2RQ5 A;  1ZQA A;  2E8M A;  4A8E A;  1NK7 A;  3SV3 A;  4BWJ A;  2N1R A;  3G6Y A;  2IHM A;  3KHL A;  1XC9 A;  4EEK A;  4DL6 A;  4B9M A;  3RJK A;  4J9K A;  8ICI A;  3MFI A;  4ICA A;  2F2A B;  4EEY A;  3T5K A;  4GFJ A;  4RPZ A;  5J2H A;  5ALP A;  3OTQ A;  3H8W A;  5K4L A;  3WK6 A;  1PK1 A;  1WYG A;  5KFR A;  4MFA A;  3IV6 A;  1DRG A;  4C7Z A;  3PW0 A;  4KLG A;  5AHX A;  1SWV A;  4J9S A;  1XSN A;  4RQ8 A;  4RQ0 A;  4ELU A;  8ICB A;  4ECR A;  3FM9 A;  4J9R A;  1ZET A;  3IN5 A;  1UT5 A;  5KT2 A;  4KLQ A;  4F71 A;  1N48 A;  1L3V A;  4I2H A;  2DBY A;  4G3I A;  4O5K A;  1NK4 A;  5L1K A;  5ALM A;  4ECY A;  3KKA A;  4PL1 A;  3G6X A;  2W9M A;  1SWW A;  4F4Y A;  2NRT A;  5DKW A;  2BCR A;  2HHW A;  3C29 A;  9ICA A;  2ZXI A;  3H8S A;  2YB4 A;  4CCH A;  4J9M A;  4NLK A;  1XWL A;  2AGP A;  3F2D A;  4UAU A;  3ZD9 A;  4M9J A;  2K60 A;  5KT4 A;  3UXP A;  2RRD A;  5DG8 A;  4BGD A;  3JPQ A;  4NLZ A;  2JEF A;  4JUZ A;  1ZQZ A;  5ALO A;  3C2K A;  2KZZ A;  4QIW C;  4I29 A;  5CR0 A;  5GTH U;  3F53 A;  3NAS A;  3KFU F;  3M9M B;  5CEH A;  2KEY A;  2W54 A;  4CF4 A;  4GC7 A;  3HJE A;  5KG7 A;  3WKD A;  4ECU A;  4PHD A;  2EAP A;  2FE9 A;  2KZM A;  3RAQ A;  3T5J A;  4UB5 A;  1QQ6 A;  1PUZ A;  2C2R A;  2AQ0 A;  5AIA A;  2I5H A;  1Z19 A;  1DK3 A;  5KFZ A;  3QUQ A;  8ICO A;  4M04 A;  1WG8 A;  4DFM A;  4RNO A;  4I2I A;  4FS2 A;  5DQG A;  2LBO A;  3S6J A;  2DKX A;  2HOQ A;  5AKK A;  5AM4 A;  4MF2 A;  4ACO A;  3BS7 A;  4RPY A;  3JPS A;  5KFK A;  8ICG A;  1XO0 A;  2XI9 A;  3SR6 A;  3IP4 B;  2HHU A;  2E8O A;  4C8L A;  4YMO A;  1U47 A;  1X9M A;  3RBE A;  2C28 A;  5BOL A;  5KFF A;  3RB0 A;  4RNM A;  9ICB A;  3M8R A;  5CRX A;  8ICX A;  4RQ2 A;  5F3X B;  3FDS A;  2RDJ A;  5ALE A;  3CP8 A;  4K4H A;  9ICN A;  1WCN A;  1VLB A;  5HMM A;  3BZC A;  4Q8E A;  5CB1 A;  4PHE A;  4Y2P A;  2VIX A;  1WUD A;  2WAQ C;  4RQ5 A;  5J2G A;  1ED1 A;  1NK9 A;  1NKE A;  4YQW A;  9ICG A;  2EQY A;  3RH4 A;  7ICS A;  3KBB A;  1XO1 A;  5III A;  1TV9 A;  3PR5 B;  5KFD A;  3QU5 A;  2NO4 A;  3N97 B;  2ZUD A;  1Z1B A;  4DQI A;  5IIO A;  5DLF A;  2K4H A;  1IV8 A;  4C4S A;  2VAN A;  3EZ5 A;  2UVU A;  1ZQB A;  5HP4 A;  4Q45 A;  3MFH A;  5DGA A;  4ELV A;  4O3M A;  2HHV A;  3JPN A;  4IQU A;  3TAP A;  5T14 A;  1X9X A;  5AK5 A;  3MBY A;  5ALL A;  2KKP A;  4RQM A;  3PV8 A;  2HMX A;  3RBD A;  2VA8 A;  1BPX A;  2I9G A;  3ISB A;  4DWI A;  2HBL A;  1N56 A;  2RDI A;  3M6K A;  2FMQ A;  2ZJA A;  1RQL A;  2QAR A;  1FFU A;  4NL9 C;  3AN1 A;  5ALV A;  2LPE A;  4KX3 A;  3NGD A;  2BCU A;  4KLJ A;  1A76 A;  3PSF A;  1HIW A;  1Z1V A;  1S9F A;  1CRX A;  1ZQJ A;  3F2B A;  4UB8 U;  2ISO A;  1SKW A;  4AYB C;  1UHU A;  5AI4 A;  2LM4 A;  1Z00 A;  8ICH A;  5KFP A;  3OJU A;  4ED6 A;  4EEL A;  4JMU A;  4NLB A;  5ALW A;  3KTQ A;  2G5I B;  1SL0 A;  1SIJ A;  5KFU A;  3KHG A;  2FPM A;  2ZIX B;  1A0P A;  1LKY B;  1N60 A;  1ZQT A;  4I2F A;  4TUP A;  4TQR A;  3K1R B;  2H3Z A;  1K5O A;  4M6W A;  2VJ4 A;  4IRC A;  1LB2 B;  4P4M A;  2WTF A;  3NVV A;  2ZG6 A;  4KX5 A;  3IG8 A;  2ZUB A;  4CRX A;  2F8L A;  7ICE A;  2KZ3 A;  3MGI A;  1QSL A;  3C21 A;  1CI4 A;  3WKB A;  4EX6 A;  3UXN A;  1V97 A;  4C4T A;  4UBB A;  4I2C A;  4C8M A;  2MUT B;  4I2D A;  4B9V A;  9ICV A;  4UB2 A;  4QWA A;  1QCK A;  4FZM A;  3WK5 A;  2D6F C;  3PMN A;  3GQC A;  3QUT A;  1S10 A;  4O0I A;  2AQ4 A;  1U48 A;  2BKE A;  4UAV A;  8ICQ A;  5J2A A;  2KV2 A;  4KLM A;  4OJO A;  2PFP A;  2IOF K;  4C0Z A;  9ICL A;  5ALU A;  7ICV A;  4FZL A;  1UQV A;  3V72 A;  9ICO A;  2EAM A;  9ICH A;  1QTM A;  1P7D A;  1ZQV A;  2F44 A;  1URJ A;  5EWF A;  4UAZ A;  4MFC A;  3GIK A;  4PZO A;  3V7J A;  3HPO A;  4KLO A;  3TAC B;  2WB1 F;  8ICL A;  4UAS A;  3OSN A;  7ICJ A;  4QZG A;  2BZF A;  4KLH A;  3ETR A;  5J2D A;  4KLI A;  1O03 A;  3SAH A;  3PML A;  3KOO A;  3M9O B;  1RM6 C;  1N5X A;  8ICF A;  5L1J A;  2J6T A;  1N63 A;  4GC6 A;  4PGQ A;  5KG1 A;  3ED5 A;  2Y1I A;  3SEN A;  3FC4 A;  3F2C A;  5DB9 A;  4YFK A;  2HHQ A;  3JPP A;  5BPC A;  2LYH A;  2BDP A;  4NWI A;  1K1Q A;  4KN4 A;  2VA3 A;  7ICP A;  2W9B A;  4RQ4 A;  1HUZ A;  4IRD A;  4YD2 A;  2I6X A;  1ZQD A;  3GIM A;  2HVI A;  2H3V A;  2KP7 A;  2DKZ A;  2OM6 A;  5ALY A;  2M9N A;  4NL9 A;  4IQT A;  4M0A A;  9ICI A;  1ZD3 A;  3ALR A;  4QZI A;  3UMB A;  4F92 B;  1ZQQ A;  8ICA A;  1B4F A;  2A1J B;  7ICU A;  4KIT B;  1K1S A;  2WF6 A;  4I28 A;  2W7P A;  2W8L A;  1S97 A;  9ICC A;  4DO9 A;  2FMS A;  4RUC A;  1RZT A;  4GIB A;  4M47 A;  3TI0 A;  4PZN A;  1TAQ A;  4IQV A;  1ARO P;  3IHQ B;  2W9A A;  4DSI A;  2FLL A;  1KW4 A;  4F2R A;  2KHV A;  5JU5 A;  1BPZ A;  4Y2T A;  1DGS A;  5HML A;  3G6V A;  3D6J A;  5DBC A;  5FP0 A;  1TK0 A;  2WF5 A;  3BS5 B;  5HNK A;  4IR9 A;  9ICS A;  4NLC A;  3CNH A;  3LVV A;  5AM0 A;  1B22 A;  4R8U B;  1T4G A;  3OHA A;  4C4R A;  1XU4 A;  3TAR A;  2CXY A;  2ZIV B;  4NXZ A;  2DGZ A;  2G5H B;  2FI1 A;  3DEE A;  2JH1 A;  2W43 A;  1SL1 A;  5TZV A;  2XID A;  7ICT A;  4J03 A;  5KG4 A;  2AJQ A;  2JXJ A;  4M9L A;  4O5C A;  2EDU A;  1ZQW A;  5L1L A;  4Q44 A;  3F5E A;  1SB3 C;  1OUQ A;  3HWT A;  5KFQ A;  5KFI A;  4B9S A;  3I1Y A;  4F5N A;  2E1E A;  3NRW A;  4Z6F A;  3RB3 A;  3GV7 B;  2R8I A;  4O3Q A;  4RT2 A;  4QZA A;  4O3R A;  4ED3 A;  3MGV A;  2KTQ A;  3H4B A;  1TVA A;  2E8N A;  2WF8 A;  3DDH A;  2FLP A;  3FAH A;  3Q8L A;  2NRZ A;  3HW8 A;  2OEH A;  5KFG A;  4RUA A;  1MQ3 A;  1F0M A;  2BDU A;  4MFF A;  3QYP A;  8ICS A;  1DOQ A;  1T3N A;  4B9U A;  1NJY A;  3RH6 A;  4YR2 A;  3MDA A;  1X40 A;  2A19 A;  2EZZ A;  1RDF A;  4CGZ A;  5AKZ A;  4DQS A;  4NLN A;  1LVH A;  1ZD2 P;  5ALI A;  3GZF A;  1ZQH A;  5KAF U;  3OPX A;  1RYS A;  1CEZ A;  4TUS A;  2IMW P;  2JRZ A;  2BCQ A;  3THV A;  8ICM A;  3MR5 A;  1KDH A;  2JZB B;  4YP3 A;  2BPG A;  2UVV A;  4QZH A;  3T5H A;  2KMD A;  5J0R A;  1AQ6 A;  3M6Z A;  8ICJ A;  5KL8 B;  3SAG A;  3RJJ A;  4UAY A;  2K8B B;  4MF8 A;  2R8G A;  2P6R A;  2YB1 A;  2P66 A;  3F5A A;  3BZK A;  1MC8 A;  2ZIU B;  4FO6 A;  2BPF A;  3H8J A;  3T3F A;  2ISP A;  1CUK A;  3NRZ A;  3WK8 A;  3SZ2 A;  3SQI A;  1L8O A;  2ZIW B;  2RLT A;  4OJ6 A;  2G08 A;  9ICR A;  2YQE A;  5ALX A;  1JRO A;  2A3V A;  3NTU A;  1NK0 A;  5ALG A;  2Q4T A;  4QZF A;  4RQ7 A;  2F77 X;  1TK8 A;  3MDC A;  2RP5 A;  5KFV A;  5KFC A;  3AQF A;  1Z3E B;  4B6J A;  3TQ1 A;  4J9N A;  5B5E U;  1KTQ A;  7ICO A;  4BXO A;  3TFR A;  7ICQ A;  1SZP A;  4ECZ A;  3CW2 C;  1SV0 C;  2ES6 A;  4DQQ A;  5KFA A;  1ECW A;  3PO5 A;  3AMZ A;  3VC8 A;  4EBD A;  3TAN A;  3RAX A;  1L3S A;  3PSP A;  4EEN A;  1IG6 A;  3AU2 A;  4F72 A;  1ZQE A;  4IC9 A;  3KHH A;  3C5G A;  5AI6 A;  4PHA A;  4P0Q B;  1ZJN A;  5KFN A;  1LV5 A;  1ZQI A;  5ALN A;  4YR3 A;  1N5W A;  5HHH A;  2C22 A;  1IM4 A;  1KFT A;  2C2D A;  2AGO A;  5C5J A;  2MU2 A;  3RRH A;  1D8B A;  2K89 A;  2BQR A;  2YMQ A;  3GU3 A;  1KRP A;  4LZG A;  2R8K A;  2A1A A;  1SKR A;  4EBC A;  3MGH A;  2KD1 A;  1YZ6 A;  5KTQ A;  1Z4N A;  2KSO B;  5EOZ A;  2G0A A;  2MRL A;  3N4M B;  2DWQ A;  3KZX A;  4QZ8 A;  4EX7 A;  5KFE A;  4QZC A;  3DV9 A;  2FLN A;  3C23 A;  3I76 A;  2NYV A;  4JV2 A;  4Y2R A;  3C1Y A;  5AM5 A;  1KKX A;  3V7K A;  3H0M B;  4F4X A;  3TAD C;  4QW8 A;  5KNI A;  1ZQO A;  1RG6 A;  4QNL A;  3ISC A;  5KFJ A;  2YN4 A;  2F3N A;  1U49 A;  4RQN A;  2HOF A;  2W3S A;  1O08 A;  3LWM A;  3QU2 A;  1RYU A;  2LKY A;  2ASJ A;  1D9F A;  2K8C B;  4O3P A;  3WKE A;  4CNQ A;  4YMN A;  3FYH A;  4F4Z A;  5AKI A;  3QEB Z;  4MEX A;  2DPI A;  1TFR A;  2HOI A;  5D4B A;  5CWR A;  8ICY A;  5ALS A;  3TFS A;  4I2J A;  1XSP A;  2IA6 A;  2G09 A;  1PVQ A;  4JWN A;  2LI6 A;  4CDG A;  3M7D A;  3RB6 A;  1MSW D;  1S0V A;  4M9N A;  4ELT A;  2JR5 A;  1U45 A;  3IDW A;  5ALZ A;  4LJX A;  3D2S A;  4IQW A;  4DFD A;  2W9C A;  1KLN A;  5KG0 A;  2V4R A;  1KN5 A;  5EE0 A;  3BJY A;  2F76 X;  1COK A;  1NJW A; 
#chains in the Genus database with same CATH homology
 2KK0 A;  2OEH A;  2CXY A;  2RQ5 A;  1C20 A;  2LI6 A;  2LM1 A;  1KQQ A;  5K4L A;  4LJX A;  1RYU A;  1IG6 A;  2EH9 A;  2YQE A;  2JRZ A;  2EQY A;  2JXJ A;  1KKX A;  1KN5 A;  5CEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...