1RYUA

Solution structure of the swi1 arid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI/SNF-related, matrix-associated, actin-dependent regulato
publication title Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ryuA00
1KN5A 1KQQA 4LJXA 1IG6A 2YQEA 2LI6A 2RQ5A 2EH9A 1RYUA 2KK0A 5K4LA 2LM1A 2JXJA 1C20A 1KKXA 5CEHA 2EQYA 2CXYA 2JRZA 2OEHA
chains in the Genus database with same CATH superfamily
1K1QA 1S0NA 5KG1A 5ALTA 2YQEA 1N60A 3MABA 4DLGA 4DFKA 4QZAA 3ISBA 4TUSA 2ZIWA 5CB1A 2OH2A 3GV5B 3HRDD 3RAXA 1U48A 2W04A 2KZ3A 2GO7A 4P0QB 4PL2A 2J6SA 3BS5A 4RNOA 5ALWA 1B22A 3TFSA 4RQNA 2XGPA 2BCRA 2BPCA 4FZLA 3N7SC 5DQGA 1CEZA 3WU2U 4F4XA 2A1JA 4YVZA 4IR1A 5KG5A 4KLJA 5DG7A 1S76D 4Y2RA 4Z6FA 5T14A 2FI1A 5HP4A 3JPRA 4DL6A 5HR6A 5KFBA 4OO1J 2W7OA 1EXNA 1IG6A 5AK5A 3QZ7A 4QW8A 4FBTA 2QARB 1HUOA 2ZTDA 9ICSA 1XU4A 5ALVA 5ALFA 4J9PA 8ICHA 1NK9A 9ICBA 1F5SA 2F8KA 4J9QA 5BPCA 1JROA 1ZQLA 1DOQA 3L5KA 5J8YA 2EZZA 1S97A 2YB4A 1TE2A 3ISCA 9ICWA 2ISPA 8ICYA 4K4HA 4NLZA 1P7DA 2W8KA 1C7YA 9ICPA 3RFAA 3T5LA 1ZETA 1HJPA 1S0VA 2KKPA 1JMSA 1MQ3A 9ICKA 7ICNA 1CI4A 1QQ5A 1IV8A 2CRXA 3NVWA 7ICIA 1ZOLA 4DSIA 1TAQA 1PK1B 1OUQA 2KJ9A 4RPZA 4F50A 3TARA 1ZQBA 1WUDA 5DG9A 3HJEA 2LMRA 3PW5A 1X9WA 5J8YC 2WTFA 1AROP 1D9DA 3JPSA 3QU2A 2P6UA 3THVA 4JMUA 2D6FC 3RJFA 4O0IA 2KP7A 4PPXA 2C2RA 4O3QA 4DFJA 2K60A 4YN4A 3MR2A 1BVSA 3QUBA 3UQ0A 2FPLA 2ZIUB 4YQWA 2XCPA 3C2KA 3ZDAA 5KAIU 3KOOA 4MHVA 2DKXA 3T3FA 2GWSA 3RJGA 5C5JA 9ICUA 2AQ0A 4F5QA 4EBDA 4DQPA 1MSWD 2KSOB 2W9BB 1Z1BA 1ZQOA 2BKEA 5KFYA 4CF5A 2H3VA 2FLPA 1DXSA 5CHGA 4MEYA 1DGSA 3UXNA 4BDPA 2FMQA 5ALDA 1AQ6A 4CDGA 3FC4A 4YCXA 2HBLA 2N1RA 3V6JA 2NO5A 5CWRA 3NGDA 4FFDA 2F76X 1KL9A 3T5KA 2W9CB 4ECZA 4MF8A 3D2QA 2BDUA 2XICA 5KFHA 1QCKA 2JV3A 5FP0A 1BNPA 1PVQA 1L7NA 2DF4B 4MFAA 1UPHA 2RHFA 3LWMA 3V6KA 8ICWA 1XS9D 4CNQA 2RDIA 3OJSA 9ICMA 4Z6CA 5K4LA 4F93B 2PFNA 5GTHU 4J9NA 3RH6A 2AGPA 5JUMA 5ALRA 5F3XB 4OD0A 5J0PA 2ASDA 1NKBA 2FPMA 4C80A 1BGXT 4KX3A 1V9PA 4M6WA 4Y2JA 3RR7A 2F1IA 5KFNA 1WYGA 4ECRA 9ICVA 3I1YA 2I1QA 3QYPA 5KFJA 4DSJA 4RQ7A 2ZIXA 5ALGA 3NVVA 2HOFA 3LVWA 5GTIU 3GIIA 2JEJA 2XC9A 1BPDA 4B9SA 4DS5A 1RM6C 1Q8KA 3WKAA 3IG5A 1A0PA 4OJLA 2HHQA 3G6YA 5ALIA 3GILA 3ZI4A 3KHGA 1KFDA 5AKEA 3N28A 5L1MA 4R64A 1ZQWA 1PVRA 4P0PA 1X2IA 2HHVA 5HHIA 5C0YA 4IRDA 8ICEA 2XY6A 3QU9A 1JN3A 1L3VA 3WKCA 3UQ2A 4Y2UA 8ICMA 2MUTB 8ICIA 5CA7A 1N2XA 2RRDA 2KOBA 3CRXA 4F5NA 4GC6A 3RAQA 9ICIA 4G9BA 1X9XA 2G5HB 5KG7A 2KHQA 2HCFA 3JPPA 3PR4A 2J6UA 4FO6A 3D6JA 1S77D 2Q4TA 4KLGA 3KTQA 3OJUA 2AJQA 3NTUA 3AMZA 5CP2A 5J0UA 1CRXA 3ZDCA 4EZ6A 3ZD8A 3BJYA 2YN4A 2XY5A 1SKRA 3AUOA 7ICRA 5AM0A 3K75D 3DV9A 3N7PD 1UQVA 3BQTA 1LV5A 1X9SA 1T7PA 2NYVA 1VDVA 3B9JA 4TUQA 1V97A 5AKLA 3ETRA 1RYSA 1ZD4A 2DBYA 4RQ3A 5AK6A 1WCNA 3QU5A 4ZOHC 3VC8A 4J9RA 7ICJA 3GFKB 4I2GA 3RH4A 2G07A 3HKZC 5KAFU 2QKQA 4ECWA 1T4GA 1BPZA 3CNHA 2ZIVB 4YR0A 5J0WA 1NK5A 3VCBA 2LYHA 1FIQA 3LDAA 4GXKA 1QH9A 4DWIA 2F2AB 1S0OA 4EYIB 2R8IA 3MR3A 1ZQTA 2JH1A 4O5CA 4K4GA 5AIAA 1SZPA 5J2AA 1UCVA 2YMQA 2HHTA 5J0XA 3V7KA 3F5EA 3UXPA 3PW0A 4KN4A 4IQTA 1YZ7A 3KKAA 5G5GA 4DL3A 3ISDA 3HT3A 4DFPA 3ORYA 4DQRA 4DOBA 4B9MA 5KG2A 4QZFA 2ZUBA 5HNKA 3OHAA 1L8OA 9ICOA 1D8BA 3C23A 5ALKA 4KITB 4ECTA 1SXDA 2XIDA 1QSYA 2GLEA 3AQEA 4YD1A 3SAFA 1PUZA 1UT5A 5AI6A 5IILA 5DBAA 1L3SA 3V7LA 4CF4A 3QE9Y 1SKSA 1ZQ1C 4GC7A 4C8MA 3ETLA 4I2CA 3TADA 4M9GA 5J0QA 2NV3A 4NLCA 4DL2A 3C21A 5ALZA 4A8EA 3L3FX 3KZXA 5CRXA 4YXJA 4P0QA 2ZXIA 2FMSA 2BZFA 5KFXA 3H40A 2I6XA 5J2CA 1WG8A 8ICGA 2R8HA 2JEGA 5DLGA 2LKYA 5KT3A 5KFLA 1YZ6A 1A6SA 2PFPA 2YMMA 3OHBA 2QB0B 2LM1A 2QLTA 2FPKA 5J2EA 3G6XA 3FM9A 3I28A 3WK4A 3SAHA 1PZNA 5DB8A 2EZYA 3TADC 2AGOA 1XO1A 1LB2B 2WB1C 4F2SA 1SB3C 4B9UA 4XA5A 1S0MA 2QARA 2W11A 1LKYB 3TFRA 4NV0A 3F53A 5EOZA 7ICKA 4HAIA 8ICVA 3PO4A 5DB6A 4C0ZA 5TISU 4DSLA 8ICRA 4QZDA 1FFVA 4RZRA 2ZG6A 1A77A 3HP6A 5AKHA 2JXJA 1L3UA 1D8LA 1Z4OA 2NRXA 4CF3A 5IIOA 4RQ5A 5ALNA 3EPGA 1ZJMA 5DB9A 4KTQA 1X6IA 2AHOB 3BQ7A 4FE3A 4LVSA 4QZBA 2IOHA 4ECSA 1ZQAA 1DGJA 4RT3A 3PY8A 1N61A 1PK1A 1SV4A 5A0LA 2Y0SC 3QX7A 2HHUA 4F4WA 5KL8B 5AIBA 1KKXA 2BQ3A 5IIMA 1SKWA 2YB1A 4ELVA 2F8LA 3N4MB 2IHMA 3SEIA 2ISOA 3DDHA 4O3NA 2BHNA 2HDOA 4QZEA 8ICLA 3GV8B 5DQHA 2W8LA 1Q3VA 2YMPA 2KJ5A 2VA8A 1NKEA 2K8AA 4O3RA 3B0XA 1JALA 3AQFA 1TK0A 4RNNA 3SD7A 7ICQA 4PGXA 3RTVA 3RRHA 1PK3A 4UB5A 3Q8KA 4QWBA 2ZIUA 3D2NA 1ED1A 2NRVA 2JH7A 4JUZA 5KNIA 5J2DA 5KTQA 1KW4A 2XY7A 1V38A 2AXTU 1NKCA 4UARA 1TFRA 3EPIA 4J9SA 2KSOA 5EWEA 1COKA 2W9BA 5ALOA 8ICFA 5AM1A 1XWLA 8ICOA 4Z6EA 5KT5A 5AM3A 1NJYA 3TANA 4Y2VA 3A0BU 3QNMA 3MBYA 1WWUA 2Y1IA 4UATA 2HBMA 3M1YA 1ECWA 4KX5A 5J0SA 2W9CA 1ZQUA 4QWDA 3TQ1A 2W7PA 2OWOA 4P2HA 2JZBB 2BCSA 8ICTA 2KFZA 2KHVA 1L6NA 4RUAA 1QLNA 2E8MA 2Q0ZX 4UBBA 3M6KA 5EE1A 3JPTA 4IQUA 5AKKA 5CJ7A 1TAUA 1MN8A 3T5HA 3A0HU 5KFDA 3MC1A 1NNLA 3PX6A 9ICLA 2ZXHA 5EWGA 1LVHA 4TURA 2RP5A 3UPQA 2LPEA 5E79U 2BQUA 3C5FA 4USAA 2R18A 1T3QA 2K89A 3WKBA 5D46A 4K4IA 3PO5A 3ZDEA 3KHLA 4JK1A 5ALYA 2KK0A 3QU4A 3SMVA 4B9VA 5KFAA 4NXZA 5J2HA 5AI5A 4RQ0A 5JRTA 3M9OB 1WWVA 2EAMA 4YMOA 1KQQA 2FLNA 3OSNA 4EEYA 3AU2A 2OXOA 1D9FA 4G3IA 4R65A 5AKGA 4MF2A 2W9MA 2AGQA 4BWJA 2C2EA 2ESEA 5KFQA 1U45A 1SL1A 4RQ1A 4I2FA 3CP8A 2FDRA 3EUB2 4F4KA 2P35A 2ES6A 5ALPA 5AM2A 3TAPA 1SL2A 2BCVA 2ZTEA 2KEYA 3LWLA 5DKWA 2HOQA 2MUTA 1UA1A 4NWIA 4UW9A 4KLLA 1C20A 3E0FA 2UVWA 4B9NA 4E0DA 3C29A 3H8SA 2ZJ5A 1BPYA 3LVVA 4EENA 2JR5A 3GZFA 1RYRA 5EE0A 2E3TA 2ZJ8A 5AKIA 4LZDA 2F77X 3PW7A 7ICHA 1TAMA 4P4PA 1Z19A 3BQ1A 7ICMA 4JV1A 4RQ8A 1UA0A 4P4MA 4TUPA 8ICZA 3RJHA 5KFKA 5J0OA 5AK3A 5DQIA 5HR7A 2HHWA 4PHPA 4TQRA 4DSEA 4X5VA 3RF9A 3NVYA 4IL6U 4PHDA 2YTUA 2KIWA 2HVHA 7ICFA 9ICTA 5AKXA 1Z00B 5AI4A 4KMOB 1ZQPA 2LM4A 3ZD9A 4ED7A 3H7IA 2ZIVA 3MGIA 1L7MA 2WF5A 3MGHA 4HYKA 5J0RA 4UB6U 4J9KA 3H0MB 4OJOA 3SAGA 3QU7A 5ALMA 3OGUA 1BPBA 2G08A 5KG6A 1X6JA 4BX9C 1ZRMA 5H2FU 5AICA 4ECQA 3RBEA 7ICGA 4Y2PA 2H5XA 2LYAA 2CXYA 4QWAA 3N97B 3M8SA 3WKEA 4ECXA 5AM5A 2BPFA 4AYBC 4ECYA 3RB0A 5J0YA 3OSPA 4ECVA 2E5SA 3DEEA 2UVRA 1RDFA 1L3TA 3UMGA 5IIKA 5DB7A 1CUKA 2MA1A 3WK5A 4F3OA 2J6TA 1HEKA 7ICTA 2BQRA 1NK6A 3M7DA 2NRWA 3GQCA 1NK7A 4YMNA 1HIWA 1U47A 3ONNA 3PSIA 2BR0A 5KT2A 4J9MA 1ZQDA 2MSNA 3OPXA 2PMZC 5J2FA 3WK9A 4O5EA 1S5LU 3PV8A 9ICQA 3ALRA 3F2BA 1BNOA 2XGQA 1T94A 3H8JA 1QQ6A 3ED5A 2DFLA 3C5GA 2E8OA 3AM9A 4FZNA 5F9NA 4M47A 5KFFA 3R9KA 3MDAA 1UHUA 4QZ8A 3C1YA 2LBOA 4DOAA 2H3FA 1GO3F 1XSNA 4QIWC 3QEBZ 1N56A 1KBUA 2QB0A 2MAXA 2PI4A 4YR3A 4ELTA 4PH5A 4DLEA 3V7JA 2KVCA 3PVXA 2ZTCA 1K5OA 2I9GA 4YFKA 5AKYA 2HHSA 3PW4A 4I2AA 2EAOA 1UT8A 2FE9A 2C2DA 8ICUA 1X9MA 4U6PA 8ICJA 1LKYA 2LI6A 4KLSA 4UAUA 1BPXA 1QSLA 7ICVA 3RJEA 2DUYA 1U4BA 4DOCA 4M9LA 3T5JA 4DFMA 4EZ9A 3RB6A 2WF8A 3BZKA 2RLTA 1TKDA 4R8UB 2IHNA 3SQIA 5L1KA 3ZDDA 1BPEA 4RUCA 2HVIA 2K4EA 1NJXA 2HBJA 4CRXA 4Q8EA 3KFUF 5DBCA 1NZBA 2CPRA 3LK9A 1QSSA 3BS7A 5L1IA 4NJ8A 4RQMA 2IA6A 4O9MA 2VIXA 5KFSA 2DWQA 5J2JA 1H38A 4ELUA 2BGWA 9ICXA 2WAQC 4RQ4A 3TI0A 4GFJA 1N63A 2AU0A 5L9XA 2DKZA 4UAZA 1VJ5A 3FDSA 5J0TA 2W55A 4I2HA 5KT4A 4O5KA 5KFWA 1RQLA 3QUCA 4KLDA 1FEZA 4ZH4A 2KIVA 3NASA 2YY6A 3PX4A 3V72A 2FJ6A 2VKQA 3PW2A 4C7YA 5HHHA 3Q8MA 2EZXA 5IIIA 1FO4A 3SZ2A 8ICCA 4ED2A 5DGBA 4GXJA 2DPIA 3KKAC 2AQ4A 2YMLA 4BUGA 4BJQA 2OCEA 2JGAA 2KN7A 8ICBA 4I28A 2A19A 2MU2A 5KFCA 2VANA 2AH5A 2W3RA 3O0FA 4F2RA 1DK3A 4C7ZA 4IC9A 4GIBA 3SV3A 4YG2A 3PX0A 4ECUA 2Y9UA 3TKAA 5DDYA 2PI5A 1OW5A 3GV7B 5D4BA 2KICA 5EE9A 4QZ9A 2K4HA 1O03A 7ICOA 2XO7A 2ZJAA 2I5HA 1JX4A 3HWTA 4Q45A 1ZQFA 1ZQCA 5KFTA 1COOA 1MQ2A 3FYHA 1J97A 4C4RA 4FS1A 4I2BA 3NRWA 3JPQA 3HX0A 1KLNA 3UMCA 3G6VA 2C28A 4RNMA 1Y88A 4Y2YA 5KG0A 3E58A 8ICQA 3H8MA 2JZBA 1IXRA 2PKEA 3E2EA 2F1HA 4UAVA 1WCLA 2W54A 1KFSA 2VJ5A 1ZQEA 3IM1A 1RXVA 3HILA 5KFRA 4KLHA 3AEVA 5HMMA 4DCCA 5KG4A 1ZYQA 1ZQJA 4I2IA 2EAPA 4EBEA 4YXMA 1KFTA 9ICAA 4DL4A 3F2CA 4DQQA 2E8PA 1ZQHA 3L4PA 1ZXIA 1ZQYA 2W3SA 3BDPA 4I29A 2P66A 1ZJNA 5KT7A 2KTQA 2K8BB 5DDMA 2W9AA 5KFEA 4JV2A 1ZQIA 1IIPA 4NLNA 4DSFA 4KLIA 3BQ2A 2KV2A 4J03A 2IOFA 5AK4A 2WHEA 2R8GA 4DL7A 2H3QA 2IBKA 3H4DA 4Y2QA 3Q8QB 1RQNA 4O3PA 2L5YA 4C8KA 1DK2A 3KHHA 4BGDA 2KMDA 4KLMA 4QZCA 5BOMA 2EDUA 2RDJA 1Z1VA 2G5IB 1NJWA 1B0XA 3CYMA 3H4BA 2HBKA 4EX6A 2DQNB 4XUSA 1L5UA 1ZQGA 2OHFA 3PSPA 4F72A 2WF6A 5ALHA 3H0LB 4NLBA 2KVSA 3D2SA 1ZRNA 4UB4A 1KTQA 3SV4A 4F5OA 2KD1A 4ED6A 1KRPA 2W43A 3AN1A 3TAQA 4RU9A 4DF8A 2H3IA 1ZD3A 2UVUA 4DFDA 3H0RB 4UB2A 4F8RA 1URJA 2WB1F 4IQWA 4OJ6A 1RXWA 3AU6A 1DRGA 2V4RA 3SR6A 1JIHA 3KHRA 5AI0A 4MEXA 1Z00A 1L7OA 4BXOB 3Q8SB 3MR5A 1NK8A 4FZMA 2JEFA 4JWNA 1TK8A 2XVTA 4I2DA 2LHTA 2E1FA 2K4IA 1XO0A 1NI3A 2HHXA 1ZQSA 3GDXA 2ZUDA 4IR9A 4PL1A 2YX8A 2XCAA 3JPOA 5AI9A 3TACB 4MFCA 5DBBA 5CR0A 2O6KA 4YR2A 4M9NA 1K1SA 1ZQQA 4Y2SA 4UBCA 4KLEA 1NZPA 4O3SA 4DO9A 3KZIU 2F3NA 5EWFA 1X66A 3ZDBA 1MC8A 3PSFA 4DQSA 8ICNA 3KBBA 2OEHA 2Y0SF 1XSPA 7ICLA 2G06A 1S9FA 9ICRA 2JHDA 4PGQA 2UVVA 4EYHB 4FS2A 1B43A 3T79A 4DQIA 4QNLA 1Q3UA 4RT2A 4NM1A 1N5XA 2EQYA 2VA2A 3EZ5A 4Q43A 4R66A 2JRZA 3I76A 3LYSA 2G0AA 5ALUA 1ZQNA 2F1JA 5KL1B 3WK7A 1ZQZA 3GIKA 2ZIWB 3UXOA 2XI9A 4IS7A 3SENA 5KT6A 3N7RC 9ICFA 3KD3A 5KFGA 1KEJA 3WK6A 1L7PA 5TZVA 1M6YA 2A1AA 4LZGA 4MFFA 1TV9A 4CE6A 3V6HA 4YD2A 3BS5B 1KN5A 3QXGA 4XRHA 4CGZA 2E1EA 2FMPA 1NOMA 5ALXA 4F91B 4UAWA 3GIJA 2PFOA 4F71A 4FBUA 2A1JB 9ICEA 1ZQXA 2HOIA 4RQ2A 4O3OA 5CEHA 1NK4A 3WK8A 3QEAZ 4AP9A 3RRGA 3JPNA 3HPOA 4QW9A 1OXJA 4Z6DA 5L1JA 7ICUA 2IOFK 2HI0A 2ASLA 1J2MA 3M9NB 1F0MA 5JTIA 5ALEA 5J29A 2BPGA 1RZTA 4B9LA 1SL0A 2EH9A 2V9WA 4QZHA 8ICPA 3EYZA 1J2NA 5D49A 4B9TA 4R8UA 4NY8A 2D3DA 3IG8A 3SYZA 4U7CA 3WKDA 1N5WA 1XNSA 5ALJA 1PVPA 4F5PA 2RQ5A 5G5HA 1S10A 4RQ6A 3K1ZA 4KN7A 2Y9TA 3EW9A 2GOLA 3MGVA 4US9A 2LYBA 2K8CB 3GIMA 1Z3EB 5AKZA 4XQ8A 2VA3A 3UMBA 3IRUA 3F2DA 2OM6A 1S8OA 2M0NA 4EBCA 3M6ZA 4DEZA 4TQSA 2KJ8A 3QZ8A 1HUZA 8ICSA 4ED3A 1L8LA 1T3NA 3NUQA 5DG8A 2KE7A 2V4QA 7ICEA 4WJ3B 2ODGA 4US8A 4C8OA 2K4PA 4PGYA 4YP3A 1KSPA 9ICGA 4ICAA 3IP4B 2A3VA 2WFAA 5ALSA 4UB1A 5HMLA 3Q8RB 4M04A 4GXIA 4NL9A 8ICAA 5AM4A 4KLTA 2H3ZA 3PMLA 4JV0A 3RJJA 8ICKA 4J9LA 1Z4NA 3MFIA 9ICJA 2KG5A 2B0CA 4OJ5A 2OYYA 1QQ7A 2W03A 1XSLA 1RPLA 1N62A 3PR5B 3CW2C 1X42A 9ICNA 3IV6A 4O3MA 5DGAA 3U26A 4EEKA 4UB3A 4UASA 2HW3A 4OJPA 4NM2A 1T8EA 1O08A 2M9NA 1JRPA 4C8LA 3OTQA 4KLUA 3IHQB 4KLQA 4RPXA 4I2EA 2E8NA 4NL9C 2ASJA 2JEIA 3K1RB 4QZGA 3PMNA 2F44A 1U49A 1IM4A 2KNJA 3C28A 2NRZA 4Y2XA 2BCUA 3PSTA 4DSKA 4IQVA 4UAYA 4UQGA 3EWAA 5B66U 5F9LA 3GU3A 1ZD2P 4YMMA 1TK5A 1ZQRA 4R63A 2VJ4A 3FAHA 4C4TA 3H8WA 3M9MB 4M2YA 4B6JA 2B6GA 2CN1A 4KLFA 3S6JA 4M0AA 1YT3A 1U9LA 1SZHA 2NO4A 4NLGA 5L1LA 2FLLA 4F4ZA 2C22A 2QB1A 5AI8A 3PNCA 4DL5A 3NS1A 5KFZA 3IDWA 5J2BA 5AHXA 1FFUA 5JU5A 4PZNA 2KFNA 4M6WB 2IMWP 5BOLA 9ICHA 4F92B 4AYBF 1SWWA 4F5RA 4IRCA 2Z7JA 4PHEA 3AL0B 1SXEA 5B5EU 2ZIXB 1SGGA 5KFMA 4CCHA 3C2MA 4DS4A 2Y1JA 4DF4A 4NLKA 3B0YA 1SV0A 4EELA 2R8KA 2GH1A 5DLFA 2PMZF 3MDCA 1KDHA 1Q46A 4QWCA 2KZMA 1ZQKA 2JMGA 4RPYA 5EE3A 2G09A 2R8JA 2D8CA 1RG6A 4P0PB 2NRTA 5KFIA 4IRKA 1XC9A 1N48A 1SIJA 2PFQA 5KG3A 3Q8PB 1QTMA 1ZD5A 4QJFB 4F4YA 3RBDA 3RR8A 3PZPA 2HSZA 1ZQVA 3BZCA 3SI8A 4Q8FA 4OCZA 4ED1A 3RB3A 2HMXA 1SV0C 4QIWF 4ACOA 5IINA 2BCQA 2MRLA 4KMUA 2P6RA 1B4FA 2ATLA 4LJXA 4EX7A 2DL0A 3RB4A 4KLOA 3ICXA 1TVAA 2DGZA 3RJIA 4ED8A 4ED0A 2KKVA 1ZQMA 7ICPA 3NRZA 4Q44A 3J81j 5KFVA 1SWVA 5J2GA 3HKZF 1MA7A 4BXOA 2ALZA 4M9JA 4QZIA 5J2KA 3IN5A 1NJZA 1F44A 1JXEA 4QWEA 2WF9A 4I2JA 3MR6A 1X40A 3F5AA 5KFUA 2WF7A 4PJ0U 1NK0A 4P4OA 3K4GA 4BWMA 4C8NA 1RYUA 1JXLA 3UM9A 4J9OA 5ALQA 2WAQF 5ALLA 2BDPA 5J2IA 2KZZA 2EANA 3QUTA 4Y2TA 1V85A 3M8RA 1JUDA 3BQ0A 3RJKA 1VLBA 1JI7A 4JWMA 2DPJA 4PHAA 3Q8LA 2B21A 3HW8A 3NVZA 2ZUCA 4C4SA 4GLXA 2PXIA 4PZOA 4UB8U 4I27A 9ICCA 1D8YA 8ICXA 1A76A 4JB3A 3MFHA 3C2LA 7ICSA 5IIJA 4M9HA 3RH5A 5KFPA 3C1ZA 3QUQA 5AKJA 5KFOA
chains in the Genus database with same CATH topology
1KN5A 1KQQA 4LJXA 1IG6A 2YQEA 2LI6A 2RQ5A 2EH9A 1RYUA 2KK0A 5K4LA 2LM1A 2JXJA 1C20A 1KKXA 5CEHA 2EQYA 2CXYA 2JRZA 2OEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  1KQQ A;  4LJX A;  1IG6 A;  2YQE A;  2LI6 A;  2RQ5 A;  2EH9 A;  1RYU A;  2KK0 A;  5K4L A;  2LM1 A;  2JXJ A;  1C20 A;  1KKX A;  5CEH A;  2EQY A;  2CXY A;  2JRZ A;  2OEH A; 
#chains in the Genus database with same CATH topology
 1K1Q A;  1S0N A;  5KG1 A;  5ALT A;  2YQE A;  1N60 A;  3MAB A;  4DLG A;  4DFK A;  4QZA A;  3ISB A;  4TUS A;  2ZIW A;  5CB1 A;  2OH2 A;  3GV5 B;  3HRD D;  3RAX A;  1U48 A;  2W04 A;  2KZ3 A;  2GO7 A;  4P0Q B;  4PL2 A;  2J6S A;  3BS5 A;  4RNO A;  5ALW A;  1B22 A;  3TFS A;  4RQN A;  2XGP A;  2BCR A;  2BPC A;  4FZL A;  3N7S C;  5DQG A;  1CEZ A;  3WU2 U;  4F4X A;  2A1J A;  4YVZ A;  4IR1 A;  5KG5 A;  4KLJ A;  5DG7 A;  1S76 D;  4Y2R A;  4Z6F A;  5T14 A;  2FI1 A;  5HP4 A;  3JPR A;  4DL6 A;  5HR6 A;  5KFB A;  4OO1 J;  2W7O A;  1EXN A;  1IG6 A;  5AK5 A;  3QZ7 A;  4QW8 A;  4FBT A;  2QAR B;  1HUO A;  2ZTD A;  9ICS A;  1XU4 A;  5ALV A;  5ALF A;  4J9P A;  8ICH A;  1NK9 A;  9ICB A;  1F5S A;  2F8K A;  4J9Q A;  5BPC A;  1JRO A;  1ZQL A;  1DOQ A;  3L5K A;  5J8Y A;  2EZZ A;  1S97 A;  2YB4 A;  1TE2 A;  3ISC A;  9ICW A;  2ISP A;  8ICY A;  4K4H A;  4NLZ A;  1P7D A;  2W8K A;  1C7Y A;  9ICP A;  3RFA A;  3T5L A;  1ZET A;  1HJP A;  1S0V A;  2KKP A;  1JMS A;  1MQ3 A;  9ICK A;  7ICN A;  1CI4 A;  1QQ5 A;  1IV8 A;  2CRX A;  3NVW A;  7ICI A;  1ZOL A;  4DSI A;  1TAQ A;  1PK1 B;  1OUQ A;  2KJ9 A;  4RPZ A;  4F50 A;  3TAR A;  1ZQB A;  1WUD A;  5DG9 A;  3HJE A;  2LMR A;  3PW5 A;  1X9W A;  5J8Y C;  2WTF A;  1ARO P;  1D9D A;  3JPS A;  3QU2 A;  2P6U A;  3THV A;  4JMU A;  2D6F C;  3RJF A;  4O0I A;  2KP7 A;  4PPX A;  2C2R A;  4O3Q A;  4DFJ A;  2K60 A;  4YN4 A;  3MR2 A;  1BVS A;  3QUB A;  3UQ0 A;  2FPL A;  2ZIU B;  4YQW A;  2XCP A;  3C2K A;  3ZDA A;  5KAI U;  3KOO A;  4MHV A;  2DKX A;  3T3F A;  2GWS A;  3RJG A;  5C5J A;  9ICU A;  2AQ0 A;  4F5Q A;  4EBD A;  4DQP A;  1MSW D;  2KSO B;  2W9B B;  1Z1B A;  1ZQO A;  2BKE A;  5KFY A;  4CF5 A;  2H3V A;  2FLP A;  1DXS A;  5CHG A;  4MEY A;  1DGS A;  3UXN A;  4BDP A;  2FMQ A;  5ALD A;  1AQ6 A;  4CDG A;  3FC4 A;  4YCX A;  2HBL A;  2N1R A;  3V6J A;  2NO5 A;  5CWR A;  3NGD A;  4FFD A;  2F76 X;  1KL9 A;  3T5K A;  2W9C B;  4ECZ A;  4MF8 A;  3D2Q A;  2BDU A;  2XIC A;  5KFH A;  1QCK A;  2JV3 A;  5FP0 A;  1BNP A;  1PVQ A;  1L7N A;  2DF4 B;  4MFA A;  1UPH A;  2RHF A;  3LWM A;  3V6K A;  8ICW A;  1XS9 D;  4CNQ A;  2RDI A;  3OJS A;  9ICM A;  4Z6C A;  5K4L A;  4F93 B;  2PFN A;  5GTH U;  4J9N A;  3RH6 A;  2AGP A;  5JUM A;  5ALR A;  5F3X B;  4OD0 A;  5J0P A;  2ASD A;  1NKB A;  2FPM A;  4C80 A;  1BGX T;  4KX3 A;  1V9P A;  4M6W A;  4Y2J A;  3RR7 A;  2F1I A;  5KFN A;  1WYG A;  4ECR A;  9ICV A;  3I1Y A;  2I1Q A;  3QYP A;  5KFJ A;  4DSJ A;  4RQ7 A;  2ZIX A;  5ALG A;  3NVV A;  2HOF A;  3LVW A;  5GTI U;  3GII A;  2JEJ A;  2XC9 A;  1BPD A;  4B9S A;  4DS5 A;  1RM6 C;  1Q8K A;  3WKA A;  3IG5 A;  1A0P A;  4OJL A;  2HHQ A;  3G6Y A;  5ALI A;  3GIL A;  3ZI4 A;  3KHG A;  1KFD A;  5AKE A;  3N28 A;  5L1M A;  4R64 A;  1ZQW A;  1PVR A;  4P0P A;  1X2I A;  2HHV A;  5HHI A;  5C0Y A;  4IRD A;  8ICE A;  2XY6 A;  3QU9 A;  1JN3 A;  1L3V A;  3WKC A;  3UQ2 A;  4Y2U A;  8ICM A;  2MUT B;  8ICI A;  5CA7 A;  1N2X A;  2RRD A;  2KOB A;  3CRX A;  4F5N A;  4GC6 A;  3RAQ A;  9ICI A;  4G9B A;  1X9X A;  2G5H B;  5KG7 A;  2KHQ A;  2HCF A;  3JPP A;  3PR4 A;  2J6U A;  4FO6 A;  3D6J A;  1S77 D;  2Q4T A;  4KLG A;  3KTQ A;  3OJU A;  2AJQ A;  3NTU A;  3AMZ A;  5CP2 A;  5J0U A;  1CRX A;  3ZDC A;  4EZ6 A;  3ZD8 A;  3BJY A;  2YN4 A;  2XY5 A;  1SKR A;  3AUO A;  7ICR A;  5AM0 A;  3K75 D;  3DV9 A;  3N7P D;  1UQV A;  3BQT A;  1LV5 A;  1X9S A;  1T7P A;  2NYV A;  1VDV A;  3B9J A;  4TUQ A;  1V97 A;  5AKL A;  3ETR A;  1RYS A;  1ZD4 A;  2DBY A;  4RQ3 A;  5AK6 A;  1WCN A;  3QU5 A;  4ZOH C;  3VC8 A;  4J9R A;  7ICJ A;  3GFK B;  4I2G A;  3RH4 A;  2G07 A;  3HKZ C;  5KAF U;  2QKQ A;  4ECW A;  1T4G A;  1BPZ A;  3CNH A;  2ZIV B;  4YR0 A;  5J0W A;  1NK5 A;  3VCB A;  2LYH A;  1FIQ A;  3LDA A;  4GXK A;  1QH9 A;  4DWI A;  2F2A B;  1S0O A;  4EYI B;  2R8I A;  3MR3 A;  1ZQT A;  2JH1 A;  4O5C A;  4K4G A;  5AIA A;  1SZP A;  5J2A A;  1UCV A;  2YMQ A;  2HHT A;  5J0X A;  3V7K A;  3F5E A;  3UXP A;  3PW0 A;  4KN4 A;  4IQT A;  1YZ7 A;  3KKA A;  5G5G A;  4DL3 A;  3ISD A;  3HT3 A;  4DFP A;  3ORY A;  4DQR A;  4DOB A;  4B9M A;  5KG2 A;  4QZF A;  2ZUB A;  5HNK A;  3OHA A;  1L8O A;  9ICO A;  1D8B A;  3C23 A;  5ALK A;  4KIT B;  4ECT A;  1SXD A;  2XID A;  1QSY A;  2GLE A;  3AQE A;  4YD1 A;  3SAF A;  1PUZ A;  1UT5 A;  5AI6 A;  5IIL A;  5DBA A;  1L3S A;  3V7L A;  4CF4 A;  3QE9 Y;  1SKS A;  1ZQ1 C;  4GC7 A;  4C8M A;  3ETL A;  4I2C A;  3TAD A;  4M9G A;  5J0Q A;  2NV3 A;  4NLC A;  4DL2 A;  3C21 A;  5ALZ A;  4A8E A;  3L3F X;  3KZX A;  5CRX A;  4YXJ A;  4P0Q A;  2ZXI A;  2FMS A;  2BZF A;  5KFX A;  3H40 A;  2I6X A;  5J2C A;  1WG8 A;  8ICG A;  2R8H A;  2JEG A;  5DLG A;  2LKY A;  5KT3 A;  5KFL A;  1YZ6 A;  1A6S A;  2PFP A;  2YMM A;  3OHB A;  2QB0 B;  2LM1 A;  2QLT A;  2FPK A;  5J2E A;  3G6X A;  3FM9 A;  3I28 A;  3WK4 A;  3SAH A;  1PZN A;  5DB8 A;  2EZY A;  3TAD C;  2AGO A;  1XO1 A;  1LB2 B;  2WB1 C;  4F2S A;  1SB3 C;  4B9U A;  4XA5 A;  1S0M A;  2QAR A;  2W11 A;  1LKY B;  3TFR A;  4NV0 A;  3F53 A;  5EOZ A;  7ICK A;  4HAI A;  8ICV A;  3PO4 A;  5DB6 A;  4C0Z A;  5TIS U;  4DSL A;  8ICR A;  4QZD A;  1FFV A;  4RZR A;  2ZG6 A;  1A77 A;  3HP6 A;  5AKH A;  2JXJ A;  1L3U A;  1D8L A;  1Z4O A;  2NRX A;  4CF3 A;  5IIO A;  4RQ5 A;  5ALN A;  3EPG A;  1ZJM A;  5DB9 A;  4KTQ A;  1X6I A;  2AHO B;  3BQ7 A;  4FE3 A;  4LVS A;  4QZB A;  2IOH A;  4ECS A;  1ZQA A;  1DGJ A;  4RT3 A;  3PY8 A;  1N61 A;  1PK1 A;  1SV4 A;  5A0L A;  2Y0S C;  3QX7 A;  2HHU A;  4F4W A;  5KL8 B;  5AIB A;  1KKX A;  2BQ3 A;  5IIM A;  1SKW A;  2YB1 A;  4ELV A;  2F8L A;  3N4M B;  2IHM A;  3SEI A;  2ISO A;  3DDH A;  4O3N A;  2BHN A;  2HDO A;  4QZE A;  8ICL A;  3GV8 B;  5DQH A;  2W8L A;  1Q3V A;  2YMP A;  2KJ5 A;  2VA8 A;  1NKE A;  2K8A A;  4O3R A;  3B0X A;  1JAL A;  3AQF A;  1TK0 A;  4RNN A;  3SD7 A;  7ICQ A;  4PGX A;  3RTV A;  3RRH A;  1PK3 A;  4UB5 A;  3Q8K A;  4QWB A;  2ZIU A;  3D2N A;  1ED1 A;  2NRV A;  2JH7 A;  4JUZ A;  5KNI A;  5J2D A;  5KTQ A;  1KW4 A;  2XY7 A;  1V38 A;  2AXT U;  1NKC A;  4UAR A;  1TFR A;  3EPI A;  4J9S A;  2KSO A;  5EWE A;  1COK A;  2W9B A;  5ALO A;  8ICF A;  5AM1 A;  1XWL A;  8ICO A;  4Z6E A;  5KT5 A;  5AM3 A;  1NJY A;  3TAN A;  4Y2V A;  3A0B U;  3QNM A;  3MBY A;  1WWU A;  2Y1I A;  4UAT A;  2HBM A;  3M1Y A;  1ECW A;  4KX5 A;  5J0S A;  2W9C A;  1ZQU A;  4QWD A;  3TQ1 A;  2W7P A;  2OWO A;  4P2H A;  2JZB B;  2BCS A;  8ICT A;  2KFZ A;  2KHV A;  1L6N A;  4RUA A;  1QLN A;  2E8M A;  2Q0Z X;  4UBB A;  3M6K A;  5EE1 A;  3JPT A;  4IQU A;  5AKK A;  5CJ7 A;  1TAU A;  1MN8 A;  3T5H A;  3A0H U;  5KFD A;  3MC1 A;  1NNL A;  3PX6 A;  9ICL A;  2ZXH A;  5EWG A;  1LVH A;  4TUR A;  2RP5 A;  3UPQ A;  2LPE A;  5E79 U;  2BQU A;  3C5F A;  4USA A;  2R18 A;  1T3Q A;  2K89 A;  3WKB A;  5D46 A;  4K4I A;  3PO5 A;  3ZDE A;  3KHL A;  4JK1 A;  5ALY A;  2KK0 A;  3QU4 A;  3SMV A;  4B9V A;  5KFA A;  4NXZ A;  5J2H A;  5AI5 A;  4RQ0 A;  5JRT A;  3M9O B;  1WWV A;  2EAM A;  4YMO A;  1KQQ A;  2FLN A;  3OSN A;  4EEY A;  3AU2 A;  2OXO A;  1D9F A;  4G3I A;  4R65 A;  5AKG A;  4MF2 A;  2W9M A;  2AGQ A;  4BWJ A;  2C2E A;  2ESE A;  5KFQ A;  1U45 A;  1SL1 A;  4RQ1 A;  4I2F A;  3CP8 A;  2FDR A;  3EUB 2;  4F4K A;  2P35 A;  2ES6 A;  5ALP A;  5AM2 A;  3TAP A;  1SL2 A;  2BCV A;  2ZTE A;  2KEY A;  3LWL A;  5DKW A;  2HOQ A;  2MUT A;  1UA1 A;  4NWI A;  4UW9 A;  4KLL A;  1C20 A;  3E0F A;  2UVW A;  4B9N A;  4E0D A;  3C29 A;  3H8S A;  2ZJ5 A;  1BPY A;  3LVV A;  4EEN A;  2JR5 A;  3GZF A;  1RYR A;  5EE0 A;  2E3T A;  2ZJ8 A;  5AKI A;  4LZD A;  2F77 X;  3PW7 A;  7ICH A;  1TAM A;  4P4P A;  1Z19 A;  3BQ1 A;  7ICM A;  4JV1 A;  4RQ8 A;  1UA0 A;  4P4M A;  4TUP A;  8ICZ A;  3RJH A;  5KFK A;  5J0O A;  5AK3 A;  5DQI A;  5HR7 A;  2HHW A;  4PHP A;  4TQR A;  4DSE A;  4X5V A;  3RF9 A;  3NVY A;  4IL6 U;  4PHD A;  2YTU A;  2KIW A;  2HVH A;  7ICF A;  9ICT A;  5AKX A;  1Z00 B;  5AI4 A;  4KMO B;  1ZQP A;  2LM4 A;  3ZD9 A;  4ED7 A;  3H7I A;  2ZIV A;  3MGI A;  1L7M A;  2WF5 A;  3MGH A;  4HYK A;  5J0R A;  4UB6 U;  4J9K A;  3H0M B;  4OJO A;  3SAG A;  3QU7 A;  5ALM A;  3OGU A;  1BPB A;  2G08 A;  5KG6 A;  1X6J A;  4BX9 C;  1ZRM A;  5H2F U;  5AIC A;  4ECQ A;  3RBE A;  7ICG A;  4Y2P A;  2H5X A;  2LYA A;  2CXY A;  4QWA A;  3N97 B;  3M8S A;  3WKE A;  4ECX A;  5AM5 A;  2BPF A;  4AYB C;  4ECY A;  3RB0 A;  5J0Y A;  3OSP A;  4ECV A;  2E5S A;  3DEE A;  2UVR A;  1RDF A;  1L3T A;  3UMG A;  5IIK A;  5DB7 A;  1CUK A;  2MA1 A;  3WK5 A;  4F3O A;  2J6T A;  1HEK A;  7ICT A;  2BQR A;  1NK6 A;  3M7D A;  2NRW A;  3GQC A;  1NK7 A;  4YMN A;  1HIW A;  1U47 A;  3ONN A;  3PSI A;  2BR0 A;  5KT2 A;  4J9M A;  1ZQD A;  2MSN A;  3OPX A;  2PMZ C;  5J2F A;  3WK9 A;  4O5E A;  1S5L U;  3PV8 A;  9ICQ A;  3ALR A;  3F2B A;  1BNO A;  2XGQ A;  1T94 A;  3H8J A;  1QQ6 A;  3ED5 A;  2DFL A;  3C5G A;  2E8O A;  3AM9 A;  4FZN A;  5F9N A;  4M47 A;  5KFF A;  3R9K A;  3MDA A;  1UHU A;  4QZ8 A;  3C1Y A;  2LBO A;  4DOA A;  2H3F A;  1GO3 F;  1XSN A;  4QIW C;  3QEB Z;  1N56 A;  1KBU A;  2QB0 A;  2MAX A;  2PI4 A;  4YR3 A;  4ELT A;  4PH5 A;  4DLE A;  3V7J A;  2KVC A;  3PVX A;  2ZTC A;  1K5O A;  2I9G A;  4YFK A;  5AKY A;  2HHS A;  3PW4 A;  4I2A A;  2EAO A;  1UT8 A;  2FE9 A;  2C2D A;  8ICU A;  1X9M A;  4U6P A;  8ICJ A;  1LKY A;  2LI6 A;  4KLS A;  4UAU A;  1BPX A;  1QSL A;  7ICV A;  3RJE A;  2DUY A;  1U4B A;  4DOC A;  4M9L A;  3T5J A;  4DFM A;  4EZ9 A;  3RB6 A;  2WF8 A;  3BZK A;  2RLT A;  1TKD A;  4R8U B;  2IHN A;  3SQI A;  5L1K A;  3ZDD A;  1BPE A;  4RUC A;  2HVI A;  2K4E A;  1NJX A;  2HBJ A;  4CRX A;  4Q8E A;  3KFU F;  5DBC A;  1NZB A;  2CPR A;  3LK9 A;  1QSS A;  3BS7 A;  5L1I A;  4NJ8 A;  4RQM A;  2IA6 A;  4O9M A;  2VIX A;  5KFS A;  2DWQ A;  5J2J A;  1H38 A;  4ELU A;  2BGW A;  9ICX A;  2WAQ C;  4RQ4 A;  3TI0 A;  4GFJ A;  1N63 A;  2AU0 A;  5L9X A;  2DKZ A;  4UAZ A;  1VJ5 A;  3FDS A;  5J0T A;  2W55 A;  4I2H A;  5KT4 A;  4O5K A;  5KFW A;  1RQL A;  3QUC A;  4KLD A;  1FEZ A;  4ZH4 A;  2KIV A;  3NAS A;  2YY6 A;  3PX4 A;  3V72 A;  2FJ6 A;  2VKQ A;  3PW2 A;  4C7Y A;  5HHH A;  3Q8M A;  2EZX A;  5III A;  1FO4 A;  3SZ2 A;  8ICC A;  4ED2 A;  5DGB A;  4GXJ A;  2DPI A;  3KKA C;  2AQ4 A;  2YML A;  4BUG A;  4BJQ A;  2OCE A;  2JGA A;  2KN7 A;  8ICB A;  4I28 A;  2A19 A;  2MU2 A;  5KFC A;  2VAN A;  2AH5 A;  2W3R A;  3O0F A;  4F2R A;  1DK3 A;  4C7Z A;  4IC9 A;  4GIB A;  3SV3 A;  4YG2 A;  3PX0 A;  4ECU A;  2Y9U A;  3TKA A;  5DDY A;  2PI5 A;  1OW5 A;  3GV7 B;  5D4B A;  2KIC A;  5EE9 A;  4QZ9 A;  2K4H A;  1O03 A;  7ICO A;  2XO7 A;  2ZJA A;  2I5H A;  1JX4 A;  3HWT A;  4Q45 A;  1ZQF A;  1ZQC A;  5KFT A;  1COO A;  1MQ2 A;  3FYH A;  1J97 A;  4C4R A;  4FS1 A;  4I2B A;  3NRW A;  3JPQ A;  3HX0 A;  1KLN A;  3UMC A;  3G6V A;  2C28 A;  4RNM A;  1Y88 A;  4Y2Y A;  5KG0 A;  3E58 A;  8ICQ A;  3H8M A;  2JZB A;  1IXR A;  2PKE A;  3E2E A;  2F1H A;  4UAV A;  1WCL A;  2W54 A;  1KFS A;  2VJ5 A;  1ZQE A;  3IM1 A;  1RXV A;  3HIL A;  5KFR A;  4KLH A;  3AEV A;  5HMM A;  4DCC A;  5KG4 A;  1ZYQ A;  1ZQJ A;  4I2I A;  2EAP A;  4EBE A;  4YXM A;  1KFT A;  9ICA A;  4DL4 A;  3F2C A;  4DQQ A;  2E8P A;  1ZQH A;  3L4P A;  1ZXI A;  1ZQY A;  2W3S A;  3BDP A;  4I29 A;  2P66 A;  1ZJN A;  5KT7 A;  2KTQ A;  2K8B B;  5DDM A;  2W9A A;  5KFE A;  4JV2 A;  1ZQI A;  1IIP A;  4NLN A;  4DSF A;  4KLI A;  3BQ2 A;  2KV2 A;  4J03 A;  2IOF A;  5AK4 A;  2WHE A;  2R8G A;  4DL7 A;  2H3Q A;  2IBK A;  3H4D A;  4Y2Q A;  3Q8Q B;  1RQN A;  4O3P A;  2L5Y A;  4C8K A;  1DK2 A;  3KHH A;  4BGD A;  2KMD A;  4KLM A;  4QZC A;  5BOM A;  2EDU A;  2RDJ A;  1Z1V A;  2G5I B;  1NJW A;  1B0X A;  3CYM A;  3H4B A;  2HBK A;  4EX6 A;  2DQN B;  4XUS A;  1L5U A;  1ZQG A;  2OHF A;  3PSP A;  4F72 A;  2WF6 A;  5ALH A;  3H0L B;  4NLB A;  2KVS A;  3D2S A;  1ZRN A;  4UB4 A;  1KTQ A;  3SV4 A;  4F5O A;  2KD1 A;  4ED6 A;  1KRP A;  2W43 A;  3AN1 A;  3TAQ A;  4RU9 A;  4DF8 A;  2H3I A;  1ZD3 A;  2UVU A;  4DFD A;  3H0R B;  4UB2 A;  4F8R A;  1URJ A;  2WB1 F;  4IQW A;  4OJ6 A;  1RXW A;  3AU6 A;  1DRG A;  2V4R A;  3SR6 A;  1JIH A;  3KHR A;  5AI0 A;  4MEX A;  1Z00 A;  1L7O A;  4BXO B;  3Q8S B;  3MR5 A;  1NK8 A;  4FZM A;  2JEF A;  4JWN A;  1TK8 A;  2XVT A;  4I2D A;  2LHT A;  2E1F A;  2K4I A;  1XO0 A;  1NI3 A;  2HHX A;  1ZQS A;  3GDX A;  2ZUD A;  4IR9 A;  4PL1 A;  2YX8 A;  2XCA A;  3JPO A;  5AI9 A;  3TAC B;  4MFC A;  5DBB A;  5CR0 A;  2O6K A;  4YR2 A;  4M9N A;  1K1S A;  1ZQQ A;  4Y2S A;  4UBC A;  4KLE A;  1NZP A;  4O3S A;  4DO9 A;  3KZI U;  2F3N A;  5EWF A;  1X66 A;  3ZDB A;  1MC8 A;  3PSF A;  4DQS A;  8ICN A;  3KBB A;  2OEH A;  2Y0S F;  1XSP A;  7ICL A;  2G06 A;  1S9F A;  9ICR A;  2JHD A;  4PGQ A;  2UVV A;  4EYH B;  4FS2 A;  1B43 A;  3T79 A;  4DQI A;  4QNL A;  1Q3U A;  4RT2 A;  4NM1 A;  1N5X A;  2EQY A;  2VA2 A;  3EZ5 A;  4Q43 A;  4R66 A;  2JRZ A;  3I76 A;  3LYS A;  2G0A A;  5ALU A;  1ZQN A;  2F1J A;  5KL1 B;  3WK7 A;  1ZQZ A;  3GIK A;  2ZIW B;  3UXO A;  2XI9 A;  4IS7 A;  3SEN A;  5KT6 A;  3N7R C;  9ICF A;  3KD3 A;  5KFG A;  1KEJ A;  3WK6 A;  1L7P A;  5TZV A;  1M6Y A;  2A1A A;  4LZG A;  4MFF A;  1TV9 A;  4CE6 A;  3V6H A;  4YD2 A;  3BS5 B;  1KN5 A;  3QXG A;  4XRH A;  4CGZ A;  2E1E A;  2FMP A;  1NOM A;  5ALX A;  4F91 B;  4UAW A;  3GIJ A;  2PFO A;  4F71 A;  4FBU A;  2A1J B;  9ICE A;  1ZQX A;  2HOI A;  4RQ2 A;  4O3O A;  5CEH A;  1NK4 A;  3WK8 A;  3QEA Z;  4AP9 A;  3RRG A;  3JPN A;  3HPO A;  4QW9 A;  1OXJ A;  4Z6D A;  5L1J A;  7ICU A;  2IOF K;  2HI0 A;  2ASL A;  1J2M A;  3M9N B;  1F0M A;  5JTI A;  5ALE A;  5J29 A;  2BPG A;  1RZT A;  4B9L A;  1SL0 A;  2EH9 A;  2V9W A;  4QZH A;  8ICP A;  3EYZ A;  1J2N A;  5D49 A;  4B9T A;  4R8U A;  4NY8 A;  2D3D A;  3IG8 A;  3SYZ A;  4U7C A;  3WKD A;  1N5W A;  1XNS A;  5ALJ A;  1PVP A;  4F5P A;  2RQ5 A;  5G5H A;  1S10 A;  4RQ6 A;  3K1Z A;  4KN7 A;  2Y9T A;  3EW9 A;  2GOL A;  3MGV A;  4US9 A;  2LYB A;  2K8C B;  3GIM A;  1Z3E B;  5AKZ A;  4XQ8 A;  2VA3 A;  3UMB A;  3IRU A;  3F2D A;  2OM6 A;  1S8O A;  2M0N A;  4EBC A;  3M6Z A;  4DEZ A;  4TQS A;  2KJ8 A;  3QZ8 A;  1HUZ A;  8ICS A;  4ED3 A;  1L8L A;  1T3N A;  3NUQ A;  5DG8 A;  2KE7 A;  2V4Q A;  7ICE A;  4WJ3 B;  2ODG A;  4US8 A;  4C8O A;  2K4P A;  4PGY A;  4YP3 A;  1KSP A;  9ICG A;  4ICA A;  3IP4 B;  2A3V A;  2WFA A;  5ALS A;  4UB1 A;  5HML A;  3Q8R B;  4M04 A;  4GXI A;  4NL9 A;  8ICA A;  5AM4 A;  4KLT A;  2H3Z A;  3PML A;  4JV0 A;  3RJJ A;  8ICK A;  4J9L A;  1Z4N A;  3MFI A;  9ICJ A;  2KG5 A;  2B0C A;  4OJ5 A;  2OYY A;  1QQ7 A;  2W03 A;  1XSL A;  1RPL A;  1N62 A;  3PR5 B;  3CW2 C;  1X42 A;  9ICN A;  3IV6 A;  4O3M A;  5DGA A;  3U26 A;  4EEK A;  4UB3 A;  4UAS A;  2HW3 A;  4OJP A;  4NM2 A;  1T8E A;  1O08 A;  2M9N A;  1JRP A;  4C8L A;  3OTQ A;  4KLU A;  3IHQ B;  4KLQ A;  4RPX A;  4I2E A;  2E8N A;  4NL9 C;  2ASJ A;  2JEI A;  3K1R B;  4QZG A;  3PMN A;  2F44 A;  1U49 A;  1IM4 A;  2KNJ A;  3C28 A;  2NRZ A;  4Y2X A;  2BCU A;  3PST A;  4DSK A;  4IQV A;  4UAY A;  4UQG A;  3EWA A;  5B66 U;  5F9L A;  3GU3 A;  1ZD2 P;  4YMM A;  1TK5 A;  1ZQR A;  4R63 A;  2VJ4 A;  3FAH A;  4C4T A;  3H8W A;  3M9M B;  4M2Y A;  4B6J A;  2B6G A;  2CN1 A;  4KLF A;  3S6J A;  4M0A A;  1YT3 A;  1U9L A;  1SZH A;  2NO4 A;  4NLG A;  5L1L A;  2FLL A;  4F4Z A;  2C22 A;  2QB1 A;  5AI8 A;  3PNC A;  4DL5 A;  3NS1 A;  5KFZ A;  3IDW A;  5J2B A;  5AHX A;  1FFU A;  5JU5 A;  4PZN A;  2KFN A;  4M6W B;  2IMW P;  5BOL A;  9ICH A;  4F92 B;  4AYB F;  1SWW A;  4F5R A;  4IRC A;  2Z7J A;  4PHE A;  3AL0 B;  1SXE A;  5B5E U;  2ZIX B;  1SGG A;  5KFM A;  4CCH A;  3C2M A;  4DS4 A;  2Y1J A;  4DF4 A;  4NLK A;  3B0Y A;  1SV0 A;  4EEL A;  2R8K A;  2GH1 A;  5DLF A;  2PMZ F;  3MDC A;  1KDH A;  1Q46 A;  4QWC A;  2KZM A;  1ZQK A;  2JMG A;  4RPY A;  5EE3 A;  2G09 A;  2R8J A;  2D8C A;  1RG6 A;  4P0P B;  2NRT A;  5KFI A;  4IRK A;  1XC9 A;  1N48 A;  1SIJ A;  2PFQ A;  5KG3 A;  3Q8P B;  1QTM A;  1ZD5 A;  4QJF B;  4F4Y A;  3RBD A;  3RR8 A;  3PZP A;  2HSZ A;  1ZQV A;  3BZC A;  3SI8 A;  4Q8F A;  4OCZ A;  4ED1 A;  3RB3 A;  2HMX A;  1SV0 C;  4QIW F;  4ACO A;  5IIN A;  2BCQ A;  2MRL A;  4KMU A;  2P6R A;  1B4F A;  2ATL A;  4LJX A;  4EX7 A;  2DL0 A;  3RB4 A;  4KLO A;  3ICX A;  1TVA A;  2DGZ A;  3RJI A;  4ED8 A;  4ED0 A;  2KKV A;  1ZQM A;  7ICP A;  3NRZ A;  4Q44 A;  3J81 j;  5KFV A;  1SWV A;  5J2G A;  3HKZ F;  1MA7 A;  4BXO A;  2ALZ A;  4M9J A;  4QZI A;  5J2K A;  3IN5 A;  1NJZ A;  1F44 A;  1JXE A;  4QWE A;  2WF9 A;  4I2J A;  3MR6 A;  1X40 A;  3F5A A;  5KFU A;  2WF7 A;  4PJ0 U;  1NK0 A;  4P4O A;  3K4G A;  4BWM A;  4C8N A;  1RYU A;  1JXL A;  3UM9 A;  4J9O A;  5ALQ A;  2WAQ F;  5ALL A;  2BDP A;  5J2I A;  2KZZ A;  2EAN A;  3QUT A;  4Y2T A;  1V85 A;  3M8R A;  1JUD A;  3BQ0 A;  3RJK A;  1VLB A;  1JI7 A;  4JWM A;  2DPJ A;  4PHA A;  3Q8L A;  2B21 A;  3HW8 A;  3NVZ A;  2ZUC A;  4C4S A;  4GLX A;  2PXI A;  4PZO A;  4UB8 U;  4I27 A;  9ICC A;  1D8Y A;  8ICX A;  1A76 A;  4JB3 A;  3MFH A;  3C2L A;  7ICS A;  5IIJ A;  4M9H A;  3RH5 A;  5KFP A;  3C1Z A;  3QUQ A;  5AKJ A;  5KFO A; 
#chains in the Genus database with same CATH homology
 1KN5 A;  1KQQ A;  4LJX A;  1IG6 A;  2YQE A;  2LI6 A;  2RQ5 A;  2EH9 A;  1RYU A;  2KK0 A;  5K4L A;  2LM1 A;  2JXJ A;  1C20 A;  1KKX A;  5CEH A;  2EQY A;  2CXY A;  2JRZ A;  2OEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...