1RYUA

Solution structure of the swi1 arid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords SWI/SNF-related, matrix-associated, actin-dependent regulato
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ryuA00
5K4LA 1KKXA 5CEHA 2JRZA 2JXJA 4LJXA 1C20A 1IG6A 2KK0A 2LM1A 2YQEA 1KQQA 2OEHA 2RQ5A 2LI6A 2EQYA 2EH9A 1RYUA 2CXYA 1KN5A
chains in the Genus database with same CATH superfamily
2ZJAA 5ALHA 3KHRA 4ED3A 3KKAC 4RQ8A 3UMGA 8ICUA 4P4OA 4DLEA 2ATLA 5EOZA 1X42A 3C5GA 4Q45A 4YG2A 2J6TA 5ALIA 1BPYA 4UBCA 4CDGA 3GIKA 3AMZA 1ED1A 4ACOA 5ALPA 4IC9A 2C2DA 3GIIA 4G9BA 3QX7A 4PPXA 4NWIA 2AGOA 3N7SC 1QSSA 2ZXHA 4RNMA 4CCHA 5J0XA 2LM4A 2YMPA 1ZQLA 2BQ3A 3WKAA 4ECRA 4B9MA 5DB6A 1JRPA 2OH2A 4YD1A 4BWJA 1ZQGA 4NLCA 3MGHA 4WJ3B 4RZRA 2V4QA 2N1RA 5CRXA 4F4ZA 5J2FA 2OYYA 3HJEA 5CWRA 2RDJA 3QU7A 2FPKA 2HHQA 3ZD8A 3CYMA 4J9RA 2W43A 2HBLA 3H4DA 2K8BB 3PSIA 3PSPA 8ICKA 4Y2YA 2QARB 3WKCA 4BXOB 4BDPA 5DDYA 3N97B 5KFDA 1X40A 1ZRMA 4UB1A 1X2IA 4UB8U 3TQ1A 5J0TA 4K4IA 3AEVA 2HOQA 4LVSA 3L5KA 2F1HA 1QQ7A 4J9PA 2YY6A 5KFIA 4NXZA 8ICNA 2DL0A 2W04A 1UA1A 4DFDA 4AP9A 5HMLA 4DOAA 3FDSA 3PY8A 3HRDD 4PJ0U 4CF4A 5J8YA 1WG8A 2KHQA 2FPMA 4UB6U 5KAIU 1J2MA 1IV8A 2VIXA 5K4LA 5L1MA 4QZGA 1KN5A 1FFUA 2DGZA 3MR6A 5EWFA 1IG6A 3HT3A 1RQNA 1ZRNA 2RHFA 4NLGA 4NLNA 2DF4B 2W8KA 2IOFK 4DWIA 8ICVA 1TAUA 2M9NA 3Q8LA 2R8HA 5DG9A 1RM6C 1F0MA 1JROA 4C0ZA 3GV5B 1PVRA 3CRXA 4R8UA 3H4BA 2HOFA 3UMCA 2ALZA 4BWMA 1QQ6A 5D4BA 2ZXIA 1ZD5A 2RRDA 2I6XA 5JU5A 3TACB 2HHWA 3G6YA 1V85A 2WTFA 1NK5A 3MGVA 5IILA 2VANA 5ALZA 3D2NA 1NK7A 1KRPA 9ICXA 2F8LA 3AU2A 3RTVA 4GLXA 2E1FA 4LZDA 7ICGA 4QNLA 5KT6A 5AIAA 9ICEA 4C4SA 3TADC 2KFNA 1TFRA 5ALGA 5CB1A 4FE3A 4KLIA 4R65A 4P0QA 4M6WB 2BQRA 1Z19A 4C80A 8ICXA 2WF9A 1D8BA 4UAYA 2YMQA 1QQ5A 4I2IA 2AGQA 2BDPA 4YR2A 7ICJA 4JWNA 3HPOA 3HW8A 3AQFA 2A1JA 2ZIXA 1SGGA 2CN1A 7ICQA 4ECXA 3IP4B 1UA0A 4RQ3A 1TK5A 4I2FA 4O3MA 2XVTA 4GC7A 5CEHA 4Y2PA 4UB5A 2HHXA 2GH1A 9ICFA 1ZQRA 3MR2A 5ALUA 1QSYA 4B9UA 4JWMA 5KFCA 1UPHA 4O5KA 4QZBA 7ICPA 5E79U 8ICIA 3NUQA 8ICRA 1ZJNA 3UXNA 2MA1A 1JI7A 2MU2A 5ALTA 2P35A 4DCCA 1KEJA 3KBBA 3SAGA 3KZXA 1CEZA 1BNOA 8ICOA 4QWBA 3HWTA 3EYZA 3KFUF 2E8MA 2A1AA 2KD1A 3ZI4A 3GIMA 3AQEA 1C7YA 1AROP 3NRZA 4EBEA 3WK9A 1ZQMA 3OSNA 5C5JA 1S77D 2BCQA 2QB0B 2KV2A 4FZMA 5ALOA 5J29A 1COOA 5DLGA 1N5XA 4F50A 5KL8B 1CUKA 3WK8A 3MC1A 4FBTA 3AM9A 1LKYB 4NM2A 1MC8A 5J2CA 1NKCA 2A19A 2DFLA 5KFEA 4EYIB 3IHQB 4QZ9A 5KFBA 3OPXA 2ZIWB 3G6VA 1KFTA 2Y9TA 3PZPA 4I29A 4O3RA 2FLPA 2L5YA 1Z3EB 5EE3A 2Y9UA 4RPYA 3CW2C 1NNLA 1KFSA 1PK3A 5KFKA 3C1ZA 5J0UA 4F2SA 2KKVA 2Y0SC 1UCVA 4EBCA 5L9XA 3SQIA 4QZCA 1WCLA 5AM1A 1U45A 2ZJ8A 5AM5A 8ICFA 5DGBA 1ZQCA 1VDVA 2HI0A 4MF8A 1N56A 5F3XB 4EBDA 3EUB2 3FAHA 4YMMA 2FMSA 1XC9A 4EZ6A 3ISDA 2EZXA 4YVZA 2LI6A 4KLHA 7ICEA 4UAUA 4F3OA 4O3QA 2RQ5A 1NZPA 1RYUA 1Q3UA 2C2RA 4DQIA 2G5IB 4DQQA 5AKIA 4QZAA 2BPCA 1OXJA 2KSOB 4OJOA 4RQ4A 4X5VA 9ICMA 2BZFA 2RP5A 2D8CA 4Y2TA 5KG1A 2BCUA 3FM9A 5DG7A 1NZBA 4DSJA 2HHVA 2E5SA 5HR7A 1FFVA 2D3DA 4JB3A 4RPZA 4IQTA 9ICHA 2IMWP 1SXDA 3M9MB 2LHTA 4KLQA 4EZ9A 4DQRA 5EE9A 3R9KA 2OEHA 4DF4A 1ZQYA 2XY6A 3F2BA 2H3FA 7ICMA 5AK4A 3JPSA 4O3SA 2QARA 5KNIA 3Q8RB 3ORYA 1FIQA 3ICXA 3NGDA 2BPFA 2V4RA 3EZ5A 4MF2A 5EE0A 1ZQVA 5DG8A 1HUOA 4MFAA 2AU0A 4AYBF 3V72A 3IG8A 4C4RA 5KT3A 2KVCA 3DV9A 3EWAA 5AKJA 2P6UA 1MQ2A 2WF8A 2YX8A 4YXMA 2ZTDA 3TARA 4ECYA 3H40A 2IHMA 3NVZA 1L7PA 1RDFA 2AH5A 4C8LA 1MQ3A 4KLTA 3F5EA 2F3NA 4YQWA 2W8LA 2Q4TA 3TAQA 1SV4A 2ESEA 2W9AA 2W55A 5DKWA 2JGAA 1S0MA 8ICHA 5DBCA 4O3OA 3FYHA 2NYVA 1S0OA 2LPEA 4ECZA 4NLBA 3RRHA 4KITB 5ALYA 1T3QA 2Q0ZX 1URJA 2CRXA 5ALEA 2BDUA 5AKEA 4DL3A 2KTQA 2BHNA 4UAVA 2BPGA 4M6WA 3VC8A 4DSEA 4I2EA 4RUAA 5ALFA 1NI3A 9ICQA 3DDHA 2E1EA 3GQCA 3ZDCA 4KLJA 2HW3A 3O0FA 2I1QA 5C0YA 3PR5B 3WK7A 2K8AA 4DL2A 3NS1A 1AQ6A 2JV3A 1L8OA 1TAQA 2FLLA 4RT2A 5KT7A 2JEGA 3RJEA 2PI4A 5BOLA 2E3TA 3PW2A 1NK0A 1JXLA 2HBJA 1N61A 1M6YA 4J9SA 5KG2A 4US8A 5AKGA 2JRZA 4NM1A 3BQTA 1SWVA 4GIBA 3JPQA 9ICUA 4P2HA 4YN4A 4UB3A 3Q8SB 4G3IA 1ZQNA 3RH4A 2KZZA 5KFWA 3RH5A 1V97A 5EWEA 2KJ8A 3JPTA 2KZMA 1TKDA 4DEZA 1XSLA 2H3QA 3AN1A 7ICUA 4OCZA 1L5UA 1XNSA 4RNOA 2LKYA 4I2BA 3IDWA 3RAQA 2QKQA 1ECWA 4YFKA 5L1IA 3B9JA 1ZQZA 4PZNA 3V7JA 3M6ZA 4ED0A 4BGDA 1IM4A 3CNHA 5DDMA 4O3NA 8ICBA 2E8PA 1NK4A 2DWQA 5KG6A 2YMMA 4YP3A 3UXOA 1B43A 4KX3A 4O5CA 2MRLA 1HIWA 5CA7A 4PH5A 4UB2A 4P4PA 1ZD2P 4TUSA 4NLKA 1NK8A 4RQ7A 1F5SA 4Y2JA 5KFPA 2KMDA 4RQMA 2F77X 4F5QA 2F8KA 4I2HA 2B0CA 2NRVA 1NK6A 7ICOA 5BOMA 1ZQHA 3BQ7A 5J8YC 4M04A 1ZQWA 3PVXA 5CJ7A 4QZEA 1ZQJA 1BGXT 3C5FA 2MUTB 3RB0A 2W9CA 4KX5A 3RR8A 5DBBA 4PZOA 4R66A 3KD3A 5GTIU 2LYBA 1J97A 4RUCA 4RQ2A 3KKAA 3C29A 5KFJA 5J0OA 4CE6A 3JPNA 2ODGA 1UT8A 3QNMA 3KTQA 3PW4A 3T5JA 2FI1A 3GU3A 3ONNA 4PL1A 2KNJA 5J2KA 2NV3A 4RQ1A 4DLGA 3NVYA 1XSPA 4ED2A 4P0QB 2CXYA 4E0DA 4R64A 9ICKA 3BZCA 1B0XA 5KT4A 4RU9A 2W11A 5AI9A 4DFPA 1ZQSA 3TFSA 4HYKA 5J0QA 4ED8A 3LWLA 3RJHA 2BKEA 4DS4A 3QYPA 1RYRA 4B6JA 3ZDBA 2ZTEA 1D9DA 7ICTA 1DRGA 4O5EA 2PMZC 3ALRA 4ECQA 3NRWA 2HBMA 3MDCA 2MUTA 2LYAA 3OGUA 1ZJMA 5AM0A 4FZLA 1T8EA 1Z4NA 2KKPA 5KFYA 4Y2VA 2DPJA 3SV3A 2JEIA 2KOBA 2AGPA 2HDOA 4M9GA 4OJ5A 2W3SA 5AKYA 3RAXA 4PHDA 5J0RA 1ZQOA 1SV0C 2Y1JA 2HSZA 3KHHA 2LBOA 3ZDDA 2QLTA 2OWOA 5KFLA 1SL2A 1OW5A 4C7ZA 5KFAA 2HHUA 4YD2A 4B9TA 4M9NA 3M9NB 4DS5A 3ISBA 3GFKB 2UVRA 4C8KA 3OSPA 2IOFA 4TUPA 2W7PA 4KLOA 9ICIA 3EW9A 3RBEA 5AM4A 2F2AB 5KFZA 1SWWA 1U4BA 4NL9C 2I5HA 4F5OA 8ICZA 1IXRA 4F5RA 4QZ8A 3C21A 3H0RB 4UBBA 1JN3A 2XIDA 2P66A 4QW8A 3RB6A 2JR5A 1K1QA 3GV7B 4M0AA 1ZQQA 7ICLA 4Y2QA 2B21A 1KL9A 1NJYA 4UAZA 4B9NA 3V7KA 5DLFA 2XI9A 3IV6A 5G5HA 2UVVA 1F44A 9ICPA 3JPOA 2KIVA 1Z1BA 1BPBA 2HBKA 2YMLA 4KLLA 3Q8QB 4DO9A 2KSOA 4YCXA 2KP7A 2WF5A 1HJPA 3PSTA 3S6JA 4Y2XA 1L3UA 8ICAA 3A0BU 3I1YA 5J2IA 2WF6A 4FZNA 9ICWA 4Z6FA 3OHAA 2HHSA 1ZXIA 3ED5A 3WKEA 2H3ZA 1RXWA 1X6JA 3M7DA 3TI0A 4C8MA 2WF7A 4J9QA 2NRXA 3C28A 1LB2B 1S8OA 2W3RA 5KFTA 4F71A 3SAHA 5J2JA 3HKZC 4DL5A 3NVVA 5F9LA 4ECSA 2DUYA 2YTUA 5HHIA 4Z6EA 3WKBA 2V9WA 1QLNA 5AKZA 2G07A 5CHGA 4PHPA 3SI8A 4DSIA 4J9KA 2K8CB 2PFPA 2JEFA 3KOOA 3IRUA 8ICGA 3F2DA 4Y2UA 2E8OA 5A0LA 3OTQA 1WWUA 5AI5A 3F2CA 8ICLA 4GXIA 4ELVA 2KK0A 4KLFA 2AQ4A 4JUZA 2FLNA 2K60A 3QU5A 2BCVA 1WCNA 2EZYA 3RB3A 1RXVA 5ALDA 1SKRA 1ZETA 4ED7A 3A0HU 4K4HA 4ED1A 2XY7A 4I2GA 3ETLA 1MN8A 1ZQEA 3V7LA 2K4IA 3BZKA 4KMUA 2IHNA 3D2SA 1NJWA 1L3SA 1SB3C 1JALA 2R18A 4RT3A 4MEXA 1OUQA 2FE9A 2DKZA 1YT3A 1L7MA 2VA2A 4DSKA 4Y2SA 4M47A 1L6NA 2MAXA 3JPPA 2BR0A 8ICEA 9ICSA 4DSFA 2JXJA 3N28A 3KZIU 2G5HB 1O03A 3PW5A 3UQ2A 2AHOB 3C23A 3M9OB 2Y0SF 3N4MB 3ZD9A 1NJXA 1V9PA 5F9NA 9ICGA 3QEBZ 1ZQIA 9ICRA 3UM9A 9ICVA 1U49A 1NKEA 4KLMA 3LK9A 3OHBA 4ECTA 3SENA 4JV0A 5IIIA 4F72A 5IIJA 2GLEA 3BS7A 1N63A 3I76A 2EQYA 2FJ6A 4YMNA 3EPIA 1QCKA 2E8NA 1FEZA 2K89A 3WK4A 2ZIUB 2W54A 4A8EA 3C2KA 9ICOA 3LDAA 1VLBA 3HP6A 2VKQA 4TURA 2J6UA 4RQ5A 3V6HA 2ZTCA 2HVHA 1X9WA 3H8JA 2EANA 4OO1J 8ICMA 4I27A 1U47A 3ETRA 5IIKA 8ICYA 4Q44A 5ALSA 1K1SA 2K4EA 3THVA 1SL1A 2D6FC 4TUQA 2WB1F 1QSLA 1ZQTA 4JK1A 3GZFA 4FS1A 5AI0A 9ICTA 3U26A 4HAIA 2JZBB 3VCBA 3T79A 5AM2A 2IA6A 3PSFA 3LVVA 1BNPA 4C8OA 3J81j 4Q8EA 1N48A 4JV2A 4BUGA 5CR0A 2GO7A 1RG6A 3RJJA 5AKHA 2DPIA 5DGAA 2AXTU 4OJ6A 3T5LA 1WWVA 2EZZA 3WKDA 1Z4OA 4P0PB 1L7NA 3M6KA 1JUDA 2H3VA 5ALMA 7ICIA 1N2XA 4B9LA 3F5AA 2BQUA 2Z7JA 5KFVA 4EEKA 5AKKA 4FS2A 3RJKA 1KTQA 2BCSA 8ICQA 3G6XA 5KFFA 2F44A 3SAFA 3UMBA 3GIJA 2ASJA 2K4PA 1DOQA 4GFJA 3QUQA 2C2EA 5KTQA 4PHEA 1WYGA 4LZGA 2WFAA 2KE7A 4Q43A 2A3VA 4F5PA 1LKYA 1A0PA 4DQSA 1XU4A 3LYSA 2W9BA 4P0PA 2ZIVB 5KFRA 4RQ6A 5KAFU 3MABA 4IR9A 2PFNA 2ZIWA 4I2AA 4F4XA 3UPQA 3PX4A 2VJ5A 4M9JA 3QXGA 5ALJA 5KG5A 5KFHA 8ICJA 3MFIA 1C20A 5DQHA 5J2HA 1S10A 4JV1A 2PFQA 2JZBA 2ZIVA 3M1YA 5B66U 4EENA 4F91B 4KN7A 2ZUCA 4ELUA 5AIBA 3C1YA 1Z00A 3QZ8A 4QWCA 3MR3A 1GO3F 4U6PA 1SKWA 4O9MA 4GXKA 5AM3A 4YR3A 1NOMA 3B0XA 1HEKA 2F1JA 2GOLA 1YZ7A 2KJ5A 1DXSA 4FFDA 1Q46A 3WU2U 2XCAA 3TADA 3C2MA 4IQVA 4QJFB 2JMGA 3BJYA 3MR5A 1Y88A 3E0FA 4YMOA 5B5EU 1ZD4A 3QU4A 5HP4A 4GXJA 2DBYA 2LMRA 1PVQA 1JMSA 2WAQF 2OHFA 2K4HA 3OJSA 4NV0A 5KL1B 7ICKA 1CRXA 3RRGA 1SZPA 4BJQA 3L3FX 5DB7A 4YXJA 4OD0A 3PW0A 5H2FU 3BDPA 4DQPA 4Q8FA 5KFMA 3QUCA 1MSWD 2G08A 2OXOA 3ISCA 7ICFA 4BX9C 4R63A 4U7CA 4DL7A 4RQNA 4UASA 4J9OA 8ICTA 2OCEA 4DFJA 2QB1A 3HKZF 4NL9A 2H3IA 1ZQKA 3FC4A 5HHHA 2W9CB 5JUMA 2FPLA 1SXEA 4UB4A 2JH1A 1UQVA 5BPCA 2XGPA 1TK8A 5J2EA 3BQ2A 3PV8A 2WB1C 1BPZA 1SIJA 1X66A 5TZVA 3Q8KA 3KHLA 1T7PA 2KICA 3BQ0A 2OM6A 2W9MA 5DB9A 2XO7A 5ALKA 4UARA 2XCPA 3OJUA 3PW7A 2EAOA 4J9NA 2FDRA 3KHGA 4KLDA 1TV9A 3K1RB 1VJ5A 1L3VA 2I9GA 1RPLA 1ZQUA 3H8MA 5KG3A 3LWMA 2KHVA 4M9LA 3T5HA 4YR0A 1SKSA 3RR7A 3WK6A 1ZQXA 4C7YA 4KMOB 5J0PA 2H5XA 3NASA 1J2NA 4R8UB 3RB4A 1V38A 1L3TA 2CPRA 3L4PA 1N60A 1WUDA 3K75D 3PR4A 1Z1VA 4RNNA 4F4YA 1SL0A 3NVWA 3E58A 2C22A 4DF8A 1A76A 9ICCA 5AKLA 5L1JA 1U9LA 2KIWA 5DQGA 7ICSA 5KFOA 4IR1A 4ICAA 2FMQA 1P7DA 5KG4A 4ZOHC 2HCFA 2ISOA 1XSNA 5JRTA 3TFRA 4M2YA 3PX6A 2VA8A 2ZUBA 2O6KA 5CP2A 2G09A 2AQ0A 9ICJA 4ECUA 3K1ZA 4CNQA 2W7OA 3EPGA 1ZQ1C 3TANA 4J03A 1TK0A 1KSPA 4PGYA 4RPXA 4USAA 2Y1IA 4I28A 1L7OA 4UQGA 4ED6A 1DK3A 1XS9D 2PKEA 4C8NA 5ALWA 3RF9A 2VJ4A 5KG0A 3C2LA 1PK1B 4TQSA 3I28A 2ZIUA 3QUTA 4DL6A 2F76X 5AHXA 4PGQA 3SMVA 2G0AA 2WHEA 3SZ2A 4ECWA 4OJPA 2DQNB 1UT5A 4I2JA 3PMNA 2BCRA 1DK2A 2XICA 5ALNA 1ZOLA 2KZ3A 3PNCA 4BXOA 4P4MA 4LJXA 5J0WA 5J2BA 3Q8MA 5KFSA 4UW9A 5KFUA 3MDAA 5T14A 4Z6DA 4ELTA 2KFZA 4RQ0A 2BGWA 4F93B 1TAMA 1XWLA 4IRCA 1A6SA 2HHTA 3T5KA 4KN4A 2KN7A 3H0MB 3RH6A 1SZHA 2ZG6A 1NKBA 2GWSA 1B22A 1T3NA 1RYSA 3B0YA 4XQ8A 3H0LB 5KT5A 2IOHA 1L8LA 2EH9A 2WAQC 4F92B 3RJIA 4QZIA 4CRXA 2R8KA 1PVPA 4O3PA 3HILA 3PO4A 2ASLA 4DSLA 9ICNA 7ICNA 1U48A 2B6GA 4NY8A 5AK3A 1N62A 2NO4A 3F53A 7ICHA 5GTHU 4QIWF 8ICSA 4UAWA 4DFMA 4Z6CA 2HOIA 1UHUA 2ZUDA 1X9MA 3RJFA 1SV0A 3QEAZ 5FP0A 3T3FA 3JPRA 2YQEA 4GC6A 5AK6A 4F5NA 5D49A 2NRWA 4MHVA 1ZD3A 4ECVA 2R8IA 1ZQBA 1LVHA 3IM1A 1DGSA 2XY5A 1YZ6A 3ZDEA 2HMXA 1TE2A 1KLNA 4DL4A 2PFOA 9ICAA 3M8SA 1LV5A 2AJQA 4QW9A 1DGJA 3GDXA 5KFNA 1IIPA 4F8RA 1H38A 3BQ1A 3RJGA 5J2GA 1S76D 3M8RA 2EDUA 1S0VA 2F1IA 2NO5A 5KFGA 1FO4A 2ISPA 4DOBA 5ALVA 5L1LA 1XO1A 3V6KA 4QWEA 4CGZA 1TVAA 2C28A 5J0YA 3GV8B 5AK5A 1MA7A 9ICBA 1S0NA 1KBUA 3MFHA 5DB8A 4M9HA 3N7PD 2UVUA 4J9LA 2QB0A 5IINA 4QWAA 1EXNA 5HNKA 2KEYA 1N5WA 2ASDA 1BPXA 5JTIA 5AICA 2EAMA 3BS5A 1JX4A 4UATA 5EWGA 4FO6A 5KG7A 3NTUA 3MBYA 3IG5A 3K4GA 1JIHA 1B4FA 2UVWA 1Q8KA 3MGIA 1RQLA 2FMPA 8ICPA 1S9FA 4IQUA 4EX6A 5IIOA 3SD7A 2JEJA 1KDHA 4MFCA 4EELA 2W03A 3QU2A 1HUZA 5AI6A 1S5LU 3D6JA 1X9SA 2LYHA 4XA5A 2YB4A 4NLZA 3H8WA 2NRZA 5HMMA 3SR6A 1ZQFA 2PMZF 3SYZA 2XC9A 4DFKA 1BVSA 2A1JB 2ZIXB 2RLTA 4QWDA 2RDIA 5IIMA 3PX0A 5J2AA 5KFQA 4B9VA 1Z00B 1Q3VA 4K4GA 4KLUA 3TKAA 5J2DA 1PZNA 2J6SA 4KLGA 1ZQDA 5L1KA 5J0SA 3N7RC 4I2DA 2HVIA 4FBUA 1QH9A 5EE1A 3PMLA 3E2EA 1XO0A 5ALRA 3SV4A 4F4KA 3H7IA 4B9SA 2M0NA 4CF3A 2VA3A 4AYBC 2JHDA 1JXEA 1BPDA 1T94A 2YB1A 1S97A 5KT2A 5HR6A 2W9BB 4IQWA 4NJ8A 3BS5B 3AU6A 4IL6U 5AKXA 4XUSA 4F2RA 4QIWC 1X9XA 2YN4A 3UQ0A 2IBKA 7ICVA 3QUBA 4IRDA 3D2QA 2ZJ5A 1KKXA 4EEYA 4KLEA 1BPEA 1D8LA 5ALQA 4US9A 4QZDA 9ICLA 3DEEA 2KVSA 8ICWA 3LVWA 4DOCA 1O08A 1NJZA 2MSNA 8ICCA 2DKXA 1CI4A 4IRKA 4F4WA 5KFXA 1D8YA 4Y2RA 3UXPA 3AUOA 1PUZA 5DBAA 4PL2A 1D9FA 1T4GA 4QZHA 1ZQAA 4C4TA 5TISU 3H8SA 4JMUA 4ZH4A 1QTMA 7ICRA 2PXIA 3HX0A 3GILA 1K5OA 1RZTA 4OJLA 3WK5A 4MFFA 5AI4A 1PK1A 5ALXA 3IN5A 2PI5A 2LM1A 4KLSA 4TQRA 1NK9A 2JH7A 2R8GA 2G06A 4XRHA 1ZQPA 4IS7A 2P6RA 3SEIA 1KQQA 3V6JA 3RFAA 3PO5A 3CP8A 4EYHB 4EX7A 5DQIA 3TAPA 3AL0B 3ZDAA 4MEYA 4KTQA 3QU9A 2KJ9A 2ES6A 3Q8PB 2EAPA 4QZFA 4J9MA 1KW4A 1X6IA 5G5GA 3QZ7A 4CF5A 2XGQA 3RBDA 2NRTA 1ZYQA 4PHAA 1A77A 1COKA 5D46A 5ALLA 2R8JA 4PGXA 4O0IA 2KG5A 3QE9Y 5AI8A 4I2CA 1KFDA
chains in the Genus database with same CATH topology
5K4LA 1KKXA 5CEHA 2JRZA 2JXJA 4LJXA 1C20A 1IG6A 2KK0A 2LM1A 2YQEA 1KQQA 2OEHA 2RQ5A 2LI6A 2EQYA 2EH9A 1RYUA 2CXYA 1KN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K4L A;  1KKX A;  5CEH A;  2JRZ A;  2JXJ A;  4LJX A;  1C20 A;  1IG6 A;  2KK0 A;  2LM1 A;  2YQE A;  1KQQ A;  2OEH A;  2RQ5 A;  2LI6 A;  2EQY A;  2EH9 A;  1RYU A;  2CXY A;  1KN5 A; 
#chains in the Genus database with same CATH topology
 2ZJA A;  5ALH A;  3KHR A;  4ED3 A;  3KKA C;  4RQ8 A;  3UMG A;  8ICU A;  4P4O A;  4DLE A;  2ATL A;  5EOZ A;  1X42 A;  3C5G A;  4Q45 A;  4YG2 A;  2J6T A;  5ALI A;  1BPY A;  4UBC A;  4CDG A;  3GIK A;  3AMZ A;  1ED1 A;  4ACO A;  5ALP A;  4IC9 A;  2C2D A;  3GII A;  4G9B A;  3QX7 A;  4PPX A;  4NWI A;  2AGO A;  3N7S C;  1QSS A;  2ZXH A;  4RNM A;  4CCH A;  5J0X A;  2LM4 A;  2YMP A;  1ZQL A;  2BQ3 A;  3WKA A;  4ECR A;  4B9M A;  5DB6 A;  1JRP A;  2OH2 A;  4YD1 A;  4BWJ A;  1ZQG A;  4NLC A;  3MGH A;  4WJ3 B;  4RZR A;  2V4Q A;  2N1R A;  5CRX A;  4F4Z A;  5J2F A;  2OYY A;  3HJE A;  5CWR A;  2RDJ A;  3QU7 A;  2FPK A;  2HHQ A;  3ZD8 A;  3CYM A;  4J9R A;  2W43 A;  2HBL A;  3H4D A;  2K8B B;  3PSI A;  3PSP A;  8ICK A;  4Y2Y A;  2QAR B;  3WKC A;  4BXO B;  4BDP A;  5DDY A;  3N97 B;  5KFD A;  1X40 A;  1ZRM A;  4UB1 A;  1X2I A;  4UB8 U;  3TQ1 A;  5J0T A;  4K4I A;  3AEV A;  2HOQ A;  4LVS A;  3L5K A;  2F1H A;  1QQ7 A;  4J9P A;  2YY6 A;  5KFI A;  4NXZ A;  8ICN A;  2DL0 A;  2W04 A;  1UA1 A;  4DFD A;  4AP9 A;  5HML A;  4DOA A;  3FDS A;  3PY8 A;  3HRD D;  4PJ0 U;  4CF4 A;  5J8Y A;  1WG8 A;  2KHQ A;  2FPM A;  4UB6 U;  5KAI U;  1J2M A;  1IV8 A;  2VIX A;  5K4L A;  5L1M A;  4QZG A;  1KN5 A;  1FFU A;  2DGZ A;  3MR6 A;  5EWF A;  1IG6 A;  3HT3 A;  1RQN A;  1ZRN A;  2RHF A;  4NLG A;  4NLN A;  2DF4 B;  2W8K A;  2IOF K;  4DWI A;  8ICV A;  1TAU A;  2M9N A;  3Q8L A;  2R8H A;  5DG9 A;  1RM6 C;  1F0M A;  1JRO A;  4C0Z A;  3GV5 B;  1PVR A;  3CRX A;  4R8U A;  3H4B A;  2HOF A;  3UMC A;  2ALZ A;  4BWM A;  1QQ6 A;  5D4B A;  2ZXI A;  1ZD5 A;  2RRD A;  2I6X A;  5JU5 A;  3TAC B;  2HHW A;  3G6Y A;  1V85 A;  2WTF A;  1NK5 A;  3MGV A;  5IIL A;  2VAN A;  5ALZ A;  3D2N A;  1NK7 A;  1KRP A;  9ICX A;  2F8L A;  3AU2 A;  3RTV A;  4GLX A;  2E1F A;  4LZD A;  7ICG A;  4QNL A;  5KT6 A;  5AIA A;  9ICE A;  4C4S A;  3TAD C;  2KFN A;  1TFR A;  5ALG A;  5CB1 A;  4FE3 A;  4KLI A;  4R65 A;  4P0Q A;  4M6W B;  2BQR A;  1Z19 A;  4C80 A;  8ICX A;  2WF9 A;  1D8B A;  4UAY A;  2YMQ A;  1QQ5 A;  4I2I A;  2AGQ A;  2BDP A;  4YR2 A;  7ICJ A;  4JWN A;  3HPO A;  3HW8 A;  3AQF A;  2A1J A;  2ZIX A;  1SGG A;  2CN1 A;  7ICQ A;  4ECX A;  3IP4 B;  1UA0 A;  4RQ3 A;  1TK5 A;  4I2F A;  4O3M A;  2XVT A;  4GC7 A;  5CEH A;  4Y2P A;  4UB5 A;  2HHX A;  2GH1 A;  9ICF A;  1ZQR A;  3MR2 A;  5ALU A;  1QSY A;  4B9U A;  4JWM A;  5KFC A;  1UPH A;  4O5K A;  4QZB A;  7ICP A;  5E79 U;  8ICI A;  3NUQ A;  8ICR A;  1ZJN A;  3UXN A;  2MA1 A;  1JI7 A;  2MU2 A;  5ALT A;  2P35 A;  4DCC A;  1KEJ A;  3KBB A;  3SAG A;  3KZX A;  1CEZ A;  1BNO A;  8ICO A;  4QWB A;  3HWT A;  3EYZ A;  3KFU F;  2E8M A;  2A1A A;  2KD1 A;  3ZI4 A;  3GIM A;  3AQE A;  1C7Y A;  1ARO P;  3NRZ A;  4EBE A;  3WK9 A;  1ZQM A;  3OSN A;  5C5J A;  1S77 D;  2BCQ A;  2QB0 B;  2KV2 A;  4FZM A;  5ALO A;  5J29 A;  1COO A;  5DLG A;  1N5X A;  4F50 A;  5KL8 B;  1CUK A;  3WK8 A;  3MC1 A;  4FBT A;  3AM9 A;  1LKY B;  4NM2 A;  1MC8 A;  5J2C A;  1NKC A;  2A19 A;  2DFL A;  5KFE A;  4EYI B;  3IHQ B;  4QZ9 A;  5KFB A;  3OPX A;  2ZIW B;  3G6V A;  1KFT A;  2Y9T A;  3PZP A;  4I29 A;  4O3R A;  2FLP A;  2L5Y A;  1Z3E B;  5EE3 A;  2Y9U A;  4RPY A;  3CW2 C;  1NNL A;  1KFS A;  1PK3 A;  5KFK A;  3C1Z A;  5J0U A;  4F2S A;  2KKV A;  2Y0S C;  1UCV A;  4EBC A;  5L9X A;  3SQI A;  4QZC A;  1WCL A;  5AM1 A;  1U45 A;  2ZJ8 A;  5AM5 A;  8ICF A;  5DGB A;  1ZQC A;  1VDV A;  2HI0 A;  4MF8 A;  1N56 A;  5F3X B;  4EBD A;  3EUB 2;  3FAH A;  4YMM A;  2FMS A;  1XC9 A;  4EZ6 A;  3ISD A;  2EZX A;  4YVZ A;  2LI6 A;  4KLH A;  7ICE A;  4UAU A;  4F3O A;  4O3Q A;  2RQ5 A;  1NZP A;  1RYU A;  1Q3U A;  2C2R A;  4DQI A;  2G5I B;  4DQQ A;  5AKI A;  4QZA A;  2BPC A;  1OXJ A;  2KSO B;  4OJO A;  4RQ4 A;  4X5V A;  9ICM A;  2BZF A;  2RP5 A;  2D8C A;  4Y2T A;  5KG1 A;  2BCU A;  3FM9 A;  5DG7 A;  1NZB A;  4DSJ A;  2HHV A;  2E5S A;  5HR7 A;  1FFV A;  2D3D A;  4JB3 A;  4RPZ A;  4IQT A;  9ICH A;  2IMW P;  1SXD A;  3M9M B;  2LHT A;  4KLQ A;  4EZ9 A;  4DQR A;  5EE9 A;  3R9K A;  2OEH A;  4DF4 A;  1ZQY A;  2XY6 A;  3F2B A;  2H3F A;  7ICM A;  5AK4 A;  3JPS A;  4O3S A;  2QAR A;  5KNI A;  3Q8R B;  3ORY A;  1FIQ A;  3ICX A;  3NGD A;  2BPF A;  2V4R A;  3EZ5 A;  4MF2 A;  5EE0 A;  1ZQV A;  5DG8 A;  1HUO A;  4MFA A;  2AU0 A;  4AYB F;  3V72 A;  3IG8 A;  4C4R A;  5KT3 A;  2KVC A;  3DV9 A;  3EWA A;  5AKJ A;  2P6U A;  1MQ2 A;  2WF8 A;  2YX8 A;  4YXM A;  2ZTD A;  3TAR A;  4ECY A;  3H40 A;  2IHM A;  3NVZ A;  1L7P A;  1RDF A;  2AH5 A;  4C8L A;  1MQ3 A;  4KLT A;  3F5E A;  2F3N A;  4YQW A;  2W8L A;  2Q4T A;  3TAQ A;  1SV4 A;  2ESE A;  2W9A A;  2W55 A;  5DKW A;  2JGA A;  1S0M A;  8ICH A;  5DBC A;  4O3O A;  3FYH A;  2NYV A;  1S0O A;  2LPE A;  4ECZ A;  4NLB A;  3RRH A;  4KIT B;  5ALY A;  1T3Q A;  2Q0Z X;  1URJ A;  2CRX A;  5ALE A;  2BDU A;  5AKE A;  4DL3 A;  2KTQ A;  2BHN A;  4UAV A;  2BPG A;  4M6W A;  3VC8 A;  4DSE A;  4I2E A;  4RUA A;  5ALF A;  1NI3 A;  9ICQ A;  3DDH A;  2E1E A;  3GQC A;  3ZDC A;  4KLJ A;  2HW3 A;  3O0F A;  2I1Q A;  5C0Y A;  3PR5 B;  3WK7 A;  2K8A A;  4DL2 A;  3NS1 A;  1AQ6 A;  2JV3 A;  1L8O A;  1TAQ A;  2FLL A;  4RT2 A;  5KT7 A;  2JEG A;  3RJE A;  2PI4 A;  5BOL A;  2E3T A;  3PW2 A;  1NK0 A;  1JXL A;  2HBJ A;  1N61 A;  1M6Y A;  4J9S A;  5KG2 A;  4US8 A;  5AKG A;  2JRZ A;  4NM1 A;  3BQT A;  1SWV A;  4GIB A;  3JPQ A;  9ICU A;  4P2H A;  4YN4 A;  4UB3 A;  3Q8S B;  4G3I A;  1ZQN A;  3RH4 A;  2KZZ A;  5KFW A;  3RH5 A;  1V97 A;  5EWE A;  2KJ8 A;  3JPT A;  2KZM A;  1TKD A;  4DEZ A;  1XSL A;  2H3Q A;  3AN1 A;  7ICU A;  4OCZ A;  1L5U A;  1XNS A;  4RNO A;  2LKY A;  4I2B A;  3IDW A;  3RAQ A;  2QKQ A;  1ECW A;  4YFK A;  5L1I A;  3B9J A;  1ZQZ A;  4PZN A;  3V7J A;  3M6Z A;  4ED0 A;  4BGD A;  1IM4 A;  3CNH A;  5DDM A;  4O3N A;  8ICB A;  2E8P A;  1NK4 A;  2DWQ A;  5KG6 A;  2YMM A;  4YP3 A;  3UXO A;  1B43 A;  4KX3 A;  4O5C A;  2MRL A;  1HIW A;  5CA7 A;  4PH5 A;  4UB2 A;  4P4P A;  1ZD2 P;  4TUS A;  4NLK A;  1NK8 A;  4RQ7 A;  1F5S A;  4Y2J A;  5KFP A;  2KMD A;  4RQM A;  2F77 X;  4F5Q A;  2F8K A;  4I2H A;  2B0C A;  2NRV A;  1NK6 A;  7ICO A;  5BOM A;  1ZQH A;  3BQ7 A;  5J8Y C;  4M04 A;  1ZQW A;  3PVX A;  5CJ7 A;  4QZE A;  1ZQJ A;  1BGX T;  3C5F A;  2MUT B;  3RB0 A;  2W9C A;  4KX5 A;  3RR8 A;  5DBB A;  4PZO A;  4R66 A;  3KD3 A;  5GTI U;  2LYB A;  1J97 A;  4RUC A;  4RQ2 A;  3KKA A;  3C29 A;  5KFJ A;  5J0O A;  4CE6 A;  3JPN A;  2ODG A;  1UT8 A;  3QNM A;  3KTQ A;  3PW4 A;  3T5J A;  2FI1 A;  3GU3 A;  3ONN A;  4PL1 A;  2KNJ A;  5J2K A;  2NV3 A;  4RQ1 A;  4DLG A;  3NVY A;  1XSP A;  4ED2 A;  4P0Q B;  2CXY A;  4E0D A;  4R64 A;  9ICK A;  3BZC A;  1B0X A;  5KT4 A;  4RU9 A;  2W11 A;  5AI9 A;  4DFP A;  1ZQS A;  3TFS A;  4HYK A;  5J0Q A;  4ED8 A;  3LWL A;  3RJH A;  2BKE A;  4DS4 A;  3QYP A;  1RYR A;  4B6J A;  3ZDB A;  2ZTE A;  1D9D A;  7ICT A;  1DRG A;  4O5E A;  2PMZ C;  3ALR A;  4ECQ A;  3NRW A;  2HBM A;  3MDC A;  2MUT A;  2LYA A;  3OGU A;  1ZJM A;  5AM0 A;  4FZL A;  1T8E A;  1Z4N A;  2KKP A;  5KFY A;  4Y2V A;  2DPJ A;  3SV3 A;  2JEI A;  2KOB A;  2AGP A;  2HDO A;  4M9G A;  4OJ5 A;  2W3S A;  5AKY A;  3RAX A;  4PHD A;  5J0R A;  1ZQO A;  1SV0 C;  2Y1J A;  2HSZ A;  3KHH A;  2LBO A;  3ZDD A;  2QLT A;  2OWO A;  5KFL A;  1SL2 A;  1OW5 A;  4C7Z A;  5KFA A;  2HHU A;  4YD2 A;  4B9T A;  4M9N A;  3M9N B;  4DS5 A;  3ISB A;  3GFK B;  2UVR A;  4C8K A;  3OSP A;  2IOF A;  4TUP A;  2W7P A;  4KLO A;  9ICI A;  3EW9 A;  3RBE A;  5AM4 A;  2F2A B;  5KFZ A;  1SWW A;  1U4B A;  4NL9 C;  2I5H A;  4F5O A;  8ICZ A;  1IXR A;  4F5R A;  4QZ8 A;  3C21 A;  3H0R B;  4UBB A;  1JN3 A;  2XID A;  2P66 A;  4QW8 A;  3RB6 A;  2JR5 A;  1K1Q A;  3GV7 B;  4M0A A;  1ZQQ A;  7ICL A;  4Y2Q A;  2B21 A;  1KL9 A;  1NJY A;  4UAZ A;  4B9N A;  3V7K A;  5DLF A;  2XI9 A;  3IV6 A;  5G5H A;  2UVV A;  1F44 A;  9ICP A;  3JPO A;  2KIV A;  1Z1B A;  1BPB A;  2HBK A;  2YML A;  4KLL A;  3Q8Q B;  4DO9 A;  2KSO A;  4YCX A;  2KP7 A;  2WF5 A;  1HJP A;  3PST A;  3S6J A;  4Y2X A;  1L3U A;  8ICA A;  3A0B U;  3I1Y A;  5J2I A;  2WF6 A;  4FZN A;  9ICW A;  4Z6F A;  3OHA A;  2HHS A;  1ZXI A;  3ED5 A;  3WKE A;  2H3Z A;  1RXW A;  1X6J A;  3M7D A;  3TI0 A;  4C8M A;  2WF7 A;  4J9Q A;  2NRX A;  3C28 A;  1LB2 B;  1S8O A;  2W3R A;  5KFT A;  4F71 A;  3SAH A;  5J2J A;  3HKZ C;  4DL5 A;  3NVV A;  5F9L A;  4ECS A;  2DUY A;  2YTU A;  5HHI A;  4Z6E A;  3WKB A;  2V9W A;  1QLN A;  5AKZ A;  2G07 A;  5CHG A;  4PHP A;  3SI8 A;  4DSI A;  4J9K A;  2K8C B;  2PFP A;  2JEF A;  3KOO A;  3IRU A;  8ICG A;  3F2D A;  4Y2U A;  2E8O A;  5A0L A;  3OTQ A;  1WWU A;  5AI5 A;  3F2C A;  8ICL A;  4GXI A;  4ELV A;  2KK0 A;  4KLF A;  2AQ4 A;  4JUZ A;  2FLN A;  2K60 A;  3QU5 A;  2BCV A;  1WCN A;  2EZY A;  3RB3 A;  1RXV A;  5ALD A;  1SKR A;  1ZET A;  4ED7 A;  3A0H U;  4K4H A;  4ED1 A;  2XY7 A;  4I2G A;  3ETL A;  1MN8 A;  1ZQE A;  3V7L A;  2K4I A;  3BZK A;  4KMU A;  2IHN A;  3D2S A;  1NJW A;  1L3S A;  1SB3 C;  1JAL A;  2R18 A;  4RT3 A;  4MEX A;  1OUQ A;  2FE9 A;  2DKZ A;  1YT3 A;  1L7M A;  2VA2 A;  4DSK A;  4Y2S A;  4M47 A;  1L6N A;  2MAX A;  3JPP A;  2BR0 A;  8ICE A;  9ICS A;  4DSF A;  2JXJ A;  3N28 A;  3KZI U;  2G5H B;  1O03 A;  3PW5 A;  3UQ2 A;  2AHO B;  3C23 A;  3M9O B;  2Y0S F;  3N4M B;  3ZD9 A;  1NJX A;  1V9P A;  5F9N A;  9ICG A;  3QEB Z;  1ZQI A;  9ICR A;  3UM9 A;  9ICV A;  1U49 A;  1NKE A;  4KLM A;  3LK9 A;  3OHB A;  4ECT A;  3SEN A;  4JV0 A;  5III A;  4F72 A;  5IIJ A;  2GLE A;  3BS7 A;  1N63 A;  3I76 A;  2EQY A;  2FJ6 A;  4YMN A;  3EPI A;  1QCK A;  2E8N A;  1FEZ A;  2K89 A;  3WK4 A;  2ZIU B;  2W54 A;  4A8E A;  3C2K A;  9ICO A;  3LDA A;  1VLB A;  3HP6 A;  2VKQ A;  4TUR A;  2J6U A;  4RQ5 A;  3V6H A;  2ZTC A;  2HVH A;  1X9W A;  3H8J A;  2EAN A;  4OO1 J;  8ICM A;  4I27 A;  1U47 A;  3ETR A;  5IIK A;  8ICY A;  4Q44 A;  5ALS A;  1K1S A;  2K4E A;  3THV A;  1SL1 A;  2D6F C;  4TUQ A;  2WB1 F;  1QSL A;  1ZQT A;  4JK1 A;  3GZF A;  4FS1 A;  5AI0 A;  9ICT A;  3U26 A;  4HAI A;  2JZB B;  3VCB A;  3T79 A;  5AM2 A;  2IA6 A;  3PSF A;  3LVV A;  1BNP A;  4C8O A;  3J81 j;  4Q8E A;  1N48 A;  4JV2 A;  4BUG A;  5CR0 A;  2GO7 A;  1RG6 A;  3RJJ A;  5AKH A;  2DPI A;  5DGA A;  2AXT U;  4OJ6 A;  3T5L A;  1WWV A;  2EZZ A;  3WKD A;  1Z4O A;  4P0P B;  1L7N A;  3M6K A;  1JUD A;  2H3V A;  5ALM A;  7ICI A;  1N2X A;  4B9L A;  3F5A A;  2BQU A;  2Z7J A;  5KFV A;  4EEK A;  5AKK A;  4FS2 A;  3RJK A;  1KTQ A;  2BCS A;  8ICQ A;  3G6X A;  5KFF A;  2F44 A;  3SAF A;  3UMB A;  3GIJ A;  2ASJ A;  2K4P A;  1DOQ A;  4GFJ A;  3QUQ A;  2C2E A;  5KTQ A;  4PHE A;  1WYG A;  4LZG A;  2WFA A;  2KE7 A;  4Q43 A;  2A3V A;  4F5P A;  1LKY A;  1A0P A;  4DQS A;  1XU4 A;  3LYS A;  2W9B A;  4P0P A;  2ZIV B;  5KFR A;  4RQ6 A;  5KAF U;  3MAB A;  4IR9 A;  2PFN A;  2ZIW A;  4I2A A;  4F4X A;  3UPQ A;  3PX4 A;  2VJ5 A;  4M9J A;  3QXG A;  5ALJ A;  5KG5 A;  5KFH A;  8ICJ A;  3MFI A;  1C20 A;  5DQH A;  5J2H A;  1S10 A;  4JV1 A;  2PFQ A;  2JZB A;  2ZIV A;  3M1Y A;  5B66 U;  4EEN A;  4F91 B;  4KN7 A;  2ZUC A;  4ELU A;  5AIB A;  3C1Y A;  1Z00 A;  3QZ8 A;  4QWC A;  3MR3 A;  1GO3 F;  4U6P A;  1SKW A;  4O9M A;  4GXK A;  5AM3 A;  4YR3 A;  1NOM A;  3B0X A;  1HEK A;  2F1J A;  2GOL A;  1YZ7 A;  2KJ5 A;  1DXS A;  4FFD A;  1Q46 A;  3WU2 U;  2XCA A;  3TAD A;  3C2M A;  4IQV A;  4QJF B;  2JMG A;  3BJY A;  3MR5 A;  1Y88 A;  3E0F A;  4YMO A;  5B5E U;  1ZD4 A;  3QU4 A;  5HP4 A;  4GXJ A;  2DBY A;  2LMR A;  1PVQ A;  1JMS A;  2WAQ F;  2OHF A;  2K4H A;  3OJS A;  4NV0 A;  5KL1 B;  7ICK A;  1CRX A;  3RRG A;  1SZP A;  4BJQ A;  3L3F X;  5DB7 A;  4YXJ A;  4OD0 A;  3PW0 A;  5H2F U;  3BDP A;  4DQP A;  4Q8F A;  5KFM A;  3QUC A;  1MSW D;  2G08 A;  2OXO A;  3ISC A;  7ICF A;  4BX9 C;  4R63 A;  4U7C A;  4DL7 A;  4RQN A;  4UAS A;  4J9O A;  8ICT A;  2OCE A;  4DFJ A;  2QB1 A;  3HKZ F;  4NL9 A;  2H3I A;  1ZQK A;  3FC4 A;  5HHH A;  2W9C B;  5JUM A;  2FPL A;  1SXE A;  4UB4 A;  2JH1 A;  1UQV A;  5BPC A;  2XGP A;  1TK8 A;  5J2E A;  3BQ2 A;  3PV8 A;  2WB1 C;  1BPZ A;  1SIJ A;  1X66 A;  5TZV A;  3Q8K A;  3KHL A;  1T7P A;  2KIC A;  3BQ0 A;  2OM6 A;  2W9M A;  5DB9 A;  2XO7 A;  5ALK A;  4UAR A;  2XCP A;  3OJU A;  3PW7 A;  2EAO A;  4J9N A;  2FDR A;  3KHG A;  4KLD A;  1TV9 A;  3K1R B;  1VJ5 A;  1L3V A;  2I9G A;  1RPL A;  1ZQU A;  3H8M A;  5KG3 A;  3LWM A;  2KHV A;  4M9L A;  3T5H A;  4YR0 A;  1SKS A;  3RR7 A;  3WK6 A;  1ZQX A;  4C7Y A;  4KMO B;  5J0P A;  2H5X A;  3NAS A;  1J2N A;  4R8U B;  3RB4 A;  1V38 A;  1L3T A;  2CPR A;  3L4P A;  1N60 A;  1WUD A;  3K75 D;  3PR4 A;  1Z1V A;  4RNN A;  4F4Y A;  1SL0 A;  3NVW A;  3E58 A;  2C22 A;  4DF8 A;  1A76 A;  9ICC A;  5AKL A;  5L1J A;  1U9L A;  2KIW A;  5DQG A;  7ICS A;  5KFO A;  4IR1 A;  4ICA A;  2FMQ A;  1P7D A;  5KG4 A;  4ZOH C;  2HCF A;  2ISO A;  1XSN A;  5JRT A;  3TFR A;  4M2Y A;  3PX6 A;  2VA8 A;  2ZUB A;  2O6K A;  5CP2 A;  2G09 A;  2AQ0 A;  9ICJ A;  4ECU A;  3K1Z A;  4CNQ A;  2W7O A;  3EPG A;  1ZQ1 C;  3TAN A;  4J03 A;  1TK0 A;  1KSP A;  4PGY A;  4RPX A;  4USA A;  2Y1I A;  4I28 A;  1L7O A;  4UQG A;  4ED6 A;  1DK3 A;  1XS9 D;  2PKE A;  4C8N A;  5ALW A;  3RF9 A;  2VJ4 A;  5KG0 A;  3C2L A;  1PK1 B;  4TQS A;  3I28 A;  2ZIU A;  3QUT A;  4DL6 A;  2F76 X;  5AHX A;  4PGQ A;  3SMV A;  2G0A A;  2WHE A;  3SZ2 A;  4ECW A;  4OJP A;  2DQN B;  1UT5 A;  4I2J A;  3PMN A;  2BCR A;  1DK2 A;  2XIC A;  5ALN A;  1ZOL A;  2KZ3 A;  3PNC A;  4BXO A;  4P4M A;  4LJX A;  5J0W A;  5J2B A;  3Q8M A;  5KFS A;  4UW9 A;  5KFU A;  3MDA A;  5T14 A;  4Z6D A;  4ELT A;  2KFZ A;  4RQ0 A;  2BGW A;  4F93 B;  1TAM A;  1XWL A;  4IRC A;  1A6S A;  2HHT A;  3T5K A;  4KN4 A;  2KN7 A;  3H0M B;  3RH6 A;  1SZH A;  2ZG6 A;  1NKB A;  2GWS A;  1B22 A;  1T3N A;  1RYS A;  3B0Y A;  4XQ8 A;  3H0L B;  5KT5 A;  2IOH A;  1L8L A;  2EH9 A;  2WAQ C;  4F92 B;  3RJI A;  4QZI A;  4CRX A;  2R8K A;  1PVP A;  4O3P A;  3HIL A;  3PO4 A;  2ASL A;  4DSL A;  9ICN A;  7ICN A;  1U48 A;  2B6G A;  4NY8 A;  5AK3 A;  1N62 A;  2NO4 A;  3F53 A;  7ICH A;  5GTH U;  4QIW F;  8ICS A;  4UAW A;  4DFM A;  4Z6C A;  2HOI A;  1UHU A;  2ZUD A;  1X9M A;  3RJF A;  1SV0 A;  3QEA Z;  5FP0 A;  3T3F A;  3JPR A;  2YQE A;  4GC6 A;  5AK6 A;  4F5N A;  5D49 A;  2NRW A;  4MHV A;  1ZD3 A;  4ECV A;  2R8I A;  1ZQB A;  1LVH A;  3IM1 A;  1DGS A;  2XY5 A;  1YZ6 A;  3ZDE A;  2HMX A;  1TE2 A;  1KLN A;  4DL4 A;  2PFO A;  9ICA A;  3M8S A;  1LV5 A;  2AJQ A;  4QW9 A;  1DGJ A;  3GDX A;  5KFN A;  1IIP A;  4F8R A;  1H38 A;  3BQ1 A;  3RJG A;  5J2G A;  1S76 D;  3M8R A;  2EDU A;  1S0V A;  2F1I A;  2NO5 A;  5KFG A;  1FO4 A;  2ISP A;  4DOB A;  5ALV A;  5L1L A;  1XO1 A;  3V6K A;  4QWE A;  4CGZ A;  1TVA A;  2C28 A;  5J0Y A;  3GV8 B;  5AK5 A;  1MA7 A;  9ICB A;  1S0N A;  1KBU A;  3MFH A;  5DB8 A;  4M9H A;  3N7P D;  2UVU A;  4J9L A;  2QB0 A;  5IIN A;  4QWA A;  1EXN A;  5HNK A;  2KEY A;  1N5W A;  2ASD A;  1BPX A;  5JTI A;  5AIC A;  2EAM A;  3BS5 A;  1JX4 A;  4UAT A;  5EWG A;  4FO6 A;  5KG7 A;  3NTU A;  3MBY A;  3IG5 A;  3K4G A;  1JIH A;  1B4F A;  2UVW A;  1Q8K A;  3MGI A;  1RQL A;  2FMP A;  8ICP A;  1S9F A;  4IQU A;  4EX6 A;  5IIO A;  3SD7 A;  2JEJ A;  1KDH A;  4MFC A;  4EEL A;  2W03 A;  3QU2 A;  1HUZ A;  5AI6 A;  1S5L U;  3D6J A;  1X9S A;  2LYH A;  4XA5 A;  2YB4 A;  4NLZ A;  3H8W A;  2NRZ A;  5HMM A;  3SR6 A;  1ZQF A;  2PMZ F;  3SYZ A;  2XC9 A;  4DFK A;  1BVS A;  2A1J B;  2ZIX B;  2RLT A;  4QWD A;  2RDI A;  5IIM A;  3PX0 A;  5J2A A;  5KFQ A;  4B9V A;  1Z00 B;  1Q3V A;  4K4G A;  4KLU A;  3TKA A;  5J2D A;  1PZN A;  2J6S A;  4KLG A;  1ZQD A;  5L1K A;  5J0S A;  3N7R C;  4I2D A;  2HVI A;  4FBU A;  1QH9 A;  5EE1 A;  3PML A;  3E2E A;  1XO0 A;  5ALR A;  3SV4 A;  4F4K A;  3H7I A;  4B9S A;  2M0N A;  4CF3 A;  2VA3 A;  4AYB C;  2JHD A;  1JXE A;  1BPD A;  1T94 A;  2YB1 A;  1S97 A;  5KT2 A;  5HR6 A;  2W9B B;  4IQW A;  4NJ8 A;  3BS5 B;  3AU6 A;  4IL6 U;  5AKX A;  4XUS A;  4F2R A;  4QIW C;  1X9X A;  2YN4 A;  3UQ0 A;  2IBK A;  7ICV A;  3QUB A;  4IRD A;  3D2Q A;  2ZJ5 A;  1KKX A;  4EEY A;  4KLE A;  1BPE A;  1D8L A;  5ALQ A;  4US9 A;  4QZD A;  9ICL A;  3DEE A;  2KVS A;  8ICW A;  3LVW A;  4DOC A;  1O08 A;  1NJZ A;  2MSN A;  8ICC A;  2DKX A;  1CI4 A;  4IRK A;  4F4W A;  5KFX A;  1D8Y A;  4Y2R A;  3UXP A;  3AUO A;  1PUZ A;  5DBA A;  4PL2 A;  1D9F A;  1T4G A;  4QZH A;  1ZQA A;  4C4T A;  5TIS U;  3H8S A;  4JMU A;  4ZH4 A;  1QTM A;  7ICR A;  2PXI A;  3HX0 A;  3GIL A;  1K5O A;  1RZT A;  4OJL A;  3WK5 A;  4MFF A;  5AI4 A;  1PK1 A;  5ALX A;  3IN5 A;  2PI5 A;  2LM1 A;  4KLS A;  4TQR A;  1NK9 A;  2JH7 A;  2R8G A;  2G06 A;  4XRH A;  1ZQP A;  4IS7 A;  2P6R A;  3SEI A;  1KQQ A;  3V6J A;  3RFA A;  3PO5 A;  3CP8 A;  4EYH B;  4EX7 A;  5DQI A;  3TAP A;  3AL0 B;  3ZDA A;  4MEY A;  4KTQ A;  3QU9 A;  2KJ9 A;  2ES6 A;  3Q8P B;  2EAP A;  4QZF A;  4J9M A;  1KW4 A;  1X6I A;  5G5G A;  3QZ7 A;  4CF5 A;  2XGQ A;  3RBD A;  2NRT A;  1ZYQ A;  4PHA A;  1A77 A;  1COK A;  5D46 A;  5ALL A;  2R8J A;  4PGX A;  4O0I A;  2KG5 A;  3QE9 Y;  5AI8 A;  4I2C A;  1KFD A; 
#chains in the Genus database with same CATH homology
 5K4L A;  1KKX A;  5CEH A;  2JRZ A;  2JXJ A;  4LJX A;  1C20 A;  1IG6 A;  2KK0 A;  2LM1 A;  2YQE A;  1KQQ A;  2OEH A;  2RQ5 A;  2LI6 A;  2EQY A;  2EH9 A;  1RYU A;  2CXY A;  1KN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...