1RYUA

Solution structure of the swi1 arid
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
120
structure length
120
Chain Sequence
b'SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI/SNF-related, matrix-associated, actin-dependent regulato
publication title Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2003-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01388 ARID ARID/BRIGHT DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 1ryuA00
1KN5A 1KQQA 2KK0A 2LM1A 2EQYA 2JXJA 2LI6A 2RQ5A 5K4LA 2YQEA 1IG6A 5CEHA 2EH9A 1RYUA 2CXYA 4LJXA 1C20A 2JRZA 2OEHA 1KKXA
chains in the Genus database with same CATH superfamily
4IRKA 2KK0A 2PI5A 1RG6A 2DBYA 2LPEA 4RQ7A 5EOZA 2I5HA 3RAQA 3QU7A 1Z00A 1HJPA 2CXYA 7ICPA 3CRXA 3KFUF 5AM3A 2KZZA 2ALZA 2GO7A 4M6WA 1ZQVA 4ZOHC 4TURA 2IMWP 4DFMA 2ZJ8A 4M2YA 3PMNA 1SKSA 4F93B 5DGBA 5ALWA 5J2JA 3G6YA 1DK2A 1L8LA 4F5PA 5J0RA 4PZOA 2R8IA 3KTQA 2KN7A 4QW8A 4I2IA 4R66A 2KJ9A 1C7YA 4IR9A 2QB0B 8ICXA 3V72A 5D4BA 2ZJ5A 1BGXT 2EAMA 3H8JA 3UMGA 1HEKA 1SB3C 2J6SA 3UQ0A 3JPOA 3F2CA 2P66A 3KBBA 2ZIVA 1KEJA 5KFFA 5J0UA 1ZQMA 4UB8U 5AICA 4C0ZA 3WK8A 5J2FA 3N7SC 2XGQA 2G5IB 3ZDBA 2K4HA 1IM4A 1ZQKA 4KLFA 4Y2VA 1MN8A 2HBKA 3V6HA 2ZG6A 4CF5A 2JMGA 4DSFA 1ED1A 4DL6A 1ECWA 2H3VA 5KT7A 1XU4A 2ODGA 5AI6A 3RBDA 3Q8KA 5KT4A 4GXJA 2KOBA 3ZI4A 3BDPA 2PI4A 3MFIA 2F44A 1SXDA 2F3NA 2HDOA 4XUSA 5J2DA 4ELVA 5KFYA 4R8UB 3ONNA 3FYHA 4PL2A 5DLFA 5KG7A 1V9PA 1S5LU 2V4RA 5ALNA 5IILA 2F1HA 3E58A 2JZBB 4I2JA 3EYZA 5C5JA 4K4HA 2WF7A 2L5YA 1QQ6A 1TFRA 3DV9A 1COOA 1S97A 9ICTA 3DDHA 3GV5B 3T5LA 3QE9Y 5KTQA 2UVUA 2G5HB 5ALVA 2C2RA 4OD0A 1ZQDA 1PVPA 1BPBA 2DKZA 2BCSA 8ICEA 3LWLA 1U9LA 5F9LA 4NLBA 4ECXA 2NRTA 2Y0SF 2WF8A 5KFMA 3NVWA 5ALDA 3VCBA 2KVCA 1JI7A 4PHDA 2B21A 4EBCA 3GV8B 3MFHA 3Q8QB 4ED1A 8ICJA 3RJJA 4PZNA 4HYKA 5DLGA 4C8KA 4QZDA 8ICAA 4UB5A 4IR1A 1QCKA 3OHAA 2ATLA 1UT8A 1RDFA 2YQEA 2BQ3A 4Y2YA 2R8KA 7ICMA 4UB2A 4ED0A 4QWCA 2ZUDA 2JEJA 1Q46A 1TK0A 7ICSA 3ORYA 2F1IA 5ALUA 2AXTU 4RZRA 4US8A 4KMUA 3Q8PB 4QZGA 1T3QA 2F76X 9ICNA 2XI9A 1NKCA 1X42A 4ACOA 3ED5A 3WKAA 2RQ5A 1S0NA 2KV2A 2K8CB 2HHWA 4DSIA 4CGZA 3UPQA 2F8LA 3V7JA 2AGQA 4QZIA 3HRDD 3BS5A 3PR5B 9ICCA 4GC6A 2JH1A 3F2DA 2QB1A 3SAGA 1PZNA 2EQYA 3UXOA 2NRVA 1AROP 4ICAA 3ISDA 4KLIA 1L6NA 1X2IA 4I2AA 3D6JA 1ZD2P 4O9MA 1NNLA 4PGXA 1L3SA 3QU4A 1MQ2A 5KFHA 3HX0A 2A19A 1S10A 2Y1JA 2KSOB 4NLGA 5D49A 4PH5A 4DOCA 3V7LA 5KNIA 2M9NA 5KFQA 2JGAA 1ZQ1C 3JPQA 4NLCA 4KLOA 3ZDEA 3UQ2A 4FO6A 9ICXA 2JXJA 2W9MA 3AUOA 1KFSA 1ZD4A 1JXLA 1NK4A 3SI8A 4KN7A 4UASA 1K1QA 3PW0A 4F4WA 4LJXA 2MA1A 4EYIB 4F5RA 1ZQCA 3IN5A 2IHNA 1JX4A 4JB3A 4BXOA 2FI1A 1Z1VA 5AKGA 2WF9A 4PGQA 1L3UA 3QZ8A 1S0OA 4NLKA 4KN4A 5AM2A 3NVZA 5J2EA 2C28A 5KFVA 3UM9A 2RP5A 3BQ0A 2Q0ZX 1SV0C 5KFJA 2KP7A 1NK7A 3QEAZ 2BR0A 4LZDA 5KFAA 3BQ2A 5ALGA 3BZCA 2DUYA 2HW3A 5AK6A 9ICKA 2JEIA 2LI6A 5ALZA 2XO7A 3TARA 1NK5A 4IQTA 5ALTA 5GTHU 4EBDA 2B0CA 2YN4A 4Y2SA 3HJEA 3JPPA 2NYVA 3EWAA 4JMUA 4YVZA 2BCRA 4Y2UA 4MFFA 4ECRA 4BUGA 3GV7B 2FE9A 4J9LA 4DF4A 9ICPA 4QWBA 5J0WA 9ICWA 1V85A 3T5HA 4UB6U 2JEGA 3TACB 3T5KA 1BNOA 1Q8KA 4CE6A 3UXNA 5AM1A 1KSPA 4DSKA 2P6RA 2E1EA 3B9JA 4LZGA 1UA1A 4M9LA 2VIXA 5DQHA 3RJFA 2K4PA 2YY6A 1SKRA 4M04A 5ALOA 4JV0A 5CRXA 4DL3A 2DGZA 1K1SA 5KT5A 2QARB 4OCZA 4YR3A 2LYBA 7ICNA 9ICQA 5J8YC 4KLQA 5ALRA 4F2RA 1JRPA 3H0MB 2BQUA 4C4RA 1SZHA 1DK3A 2ZIWB 5L9XA 1CUKA 3FAHA 2BQRA 4I27A 2DF4B 8ICCA 5DG7A 5DG8A 4UAWA 3N97B 4EENA 4K4IA 4I2FA 1SV0A 1J2NA 2D8CA 3M6KA 3CW2C 3NS1A 5L1IA 2OHFA 5AI4A 3N7PD 1ZQLA 1KW4A 1N5XA 2IBKA 2AH5A 4PGYA 2KZ3A 3TAPA 2PFOA 4Z6CA 2UVWA 3PVXA 5KFNA 1UPHA 3GDXA 4C8NA 3LYSA 3BQ7A 5KL1B 1WWUA 2YMQA 3QU2A 1X6JA 1SKWA 2G0AA 5J29A 3SV4A 2AHOB 4R64A 1DOQA 1ZOLA 2WF6A 4CRXA 3RRHA 2FJ6A 4USAA 3JPSA 1X40A 5L1MA 5T14A 2HOFA 3GU3A 5AK4A 7ICGA 1SWWA 4GIBA 1IXRA 2KNJA 7ICFA 4UARA 1ZYQA 5DBCA 4J9SA 4F3OA 1S8OA 3MR2A 2A1JA 4YMMA 1KN5A 2W11A 1LB2B 2CPRA 1ZQAA 3F5EA 4O3RA 4I29A 5KFKA 2W3SA 2VJ5A 4Y2PA 2P35A 1T94A 3ICXA 5IIOA 4U7CA 2FPMA 3QX7A 3AN1A 2W9CA 5KAFU 5KAIU 3WKEA 3I28A 2FPKA 7ICKA 2ZIXA 5CP2A 2BPFA 3WK7A 5J8YA 4JUZA 3TANA 4UAYA 3QU5A 3RH5A 5AK3A 2DPIA 2ZXHA 3I76A 2AU0A 3UMCA 2I6XA 3ZD8A 4EX7A 3SENA 4J9RA 5DG9A 5ALKA 1ZQBA 7ICUA 4KLLA 5B66U 2OEHA 4KLMA 2DWQA 5AI9A 4E0DA 8ICBA 5EWFA 1X6IA 9ICRA 3PO4A 4DEZA 3MC1A 8ICOA 4CF3A 4GFJA 2H3FA 2XY6A 1KFTA 5ALXA 3KZIU 4B9UA 4DQPA 4Q44A 2AGPA 1NK8A 4K4GA 3I1YA 4Z6FA 3RR7A 1TV9A 3RH4A 2YMPA 4EYHB 2R18A 1WG8A 3K1ZA 1Z4NA 3HPOA 1ZQIA 5ALYA 3GIJA 4ECSA 8ICTA 2GOLA 2EZXA 3RF9A 5HMLA 2DL0A 3FDSA 1H38A 4O3MA 5ALQA 4XQ8A 1T3NA 5J0QA 3C5FA 1JALA 2EANA 4CCHA 5KG5A 3PX4A 2IHMA 1L7MA 1N60A 2XVTA 4RNNA 4EEKA 4O3OA 2LM1A 2H3IA 2P6UA 4QWEA 3H7IA 4P0QA 2GWSA 1FO4A 4O3NA 5BOLA 3SAHA 4F71A 7ICQA 4US9A 3H40A 5JUMA 5KFEA 3RJHA 1KTQA 2BZFA 4I2BA 5DBBA 3JPRA 4RQ5A 4DFPA 4UB4A 1LKYA 1RXVA 4G9BA 3U26A 3WK9A 4YXJA 3NGDA 5KT2A 1V97A 1T8EA 5KFWA 5BOMA 2BPCA 2HCFA 1NKEA 5AHXA 3IP4B 2C2DA 1FFVA 4YCXA 1L7NA 3B0YA 2KG5A 2PKEA 4C7ZA 4F4ZA 3MGIA 2XICA 5HNKA 3H0LB 1ZQFA 4FS1A 2ASDA 5GTIU 3RB0A 1TE2A 3RJIA 2BCVA 3H4DA 1S77D 1ZQNA 3OHBA 5ALEA 4ECWA 5KFRA 3RB4A 1L5UA 5HP4A 5KFLA 1L3TA 5KG4A 4RU9A 5ALHA 4UAZA 7ICTA 1X9XA 2K4IA 8ICLA 4NY8A 1VJ5A 1QSLA 4ECZA 5KG2A 5C0YA 4QIWF 2BDUA 4QJFB 4QNLA 5AI5A 2YTUA 2EAPA 1TAMA 1TVAA 1QLNA 1A0PA 2KE7A 1O03A 1D8BA 3SAFA 5EE1A 3A0BU 3CP8A 3V6KA 2HBLA 1BVSA 4KMOB 4QWDA 1WWVA 2G06A 3OSNA 4C7YA 1T4GA 3Q8SB 8ICVA 3G6VA 3PV8A 2H5XA 4J9NA 4Y2QA 1TAUA 4IQUA 3UMBA 5AI8A 5J0XA 2NV3A 5AKYA 2BKEA 1ZQQA 3HW8A 4EX6A 4ECVA 2JHDA 2A1AA 4P0PB 4FZNA 2E8MA 1ZJMA 4NJ8A 3B0XA 1NKBA 1D9DA 4LVSA 2W9BB 1NJWA 9ICVA 3HILA 3H0RB 2KZMA 2Y9UA 3N4MB 3TADC 4RNOA 4EELA 4Y2RA 1PVRA 2EZYA 3F5AA 3BS7A 1NK6A 2F8KA 3MR5A 1UQVA 1PK1A 3GQCA 5KFDA 2W8KA 1CI4A 1A77A 4M47A 4YMOA 2XGPA 1COKA 1NZPA 1SV4A 3HT3A 3T79A 1A6SA 1RZTA 5FP0A 2ZIUB 1KL9A 1YZ7A 2WB1C 8ICSA 2A1JB 3AL0B 2NRZA 4KLDA 4UBCA 2KFNA 4O3PA 4P4OA 1RQNA 3PW5A 2E8NA 7ICHA 2XCAA 3EPGA 3LK9A 1RXWA 2E1FA 4ZH4A 1GO3F 4RQ3A 5EE9A 5ALLA 4KX3A 2PFQA 2KD1A 4B6JA 3M9OB 4DF8A 1B0XA 2KJ8A 4RPZA 4KLHA 7ICIA 3G6XA 2FMQA 4MEYA 2HBMA 1D8YA 7ICRA 4A8EA 5DQIA 4ED6A 1ZQPA 4KLTA 4FS2A 5L1LA 2E8PA 2F77X 2HHTA 2FDRA 3EZ5A 8ICYA 2MUTB 4ED8A 2EH9A 4GC7A 3L3FX 5AIAA 2HOQA 5J0TA 3DEEA 8ICPA 1ZQZA 4DL7A 4F92B 4RQ2A 4C8MA 1SL1A 1ZQGA 4DWIA 4M9NA 8ICFA 2NRWA 3R9KA 1Z1BA 3F2BA 3K75D 2XY5A 4DLEA 1HIWA 3TADA 4F5OA 1ZQRA 1L7PA 3SEIA 3IG5A 5AM5A 3HP6A 1LVHA 4OO1J 3F53A 3KKAC 4QZEA 4YD2A 4EZ9A 3C21A 4QZFA 3SD7A 4KLSA 5CR0A 3AEVA 3C29A 1SL2A 2D6FC 4RQ1A 1BPDA 4I2HA 4FFDA 4BWMA 2C22A 5AKIA 3M9MB 1Z00B 3PY8A 3HWTA 2XY7A 4UATA 3RJEA 5KG6A 5JU5A 4PJ0U 5AI0A 4RQ8A 4DQRA 2HHUA 5AKKA 3IHQB 3KZXA 2FPLA 2OXOA 4MFCA 4P0QB 4ECTA 4ECUA 4M6WB 4UB1A 2RHFA 3SMVA 8ICNA 4RPYA 1P7DA 5DB7A 1XO0A 3RFAA 2BCUA 5ALJA 4F4KA 2HHQA 2KTQA 3QU9A 4BJQA 2AGOA 1F5SA 4JV1A 2HOIA 5CHGA 4I2EA 3LWMA 3GIIA 3MGHA 3FC4A 2RDIA 4PHEA 5KFTA 3ZDDA 9ICHA 4F8RA 4GXKA 4Y2JA 3KHRA 5AIBA 2QB0A 1ZJNA 2ZIVB 3K4GA 5AKLA 2HVIA 4DOBA 4YXMA 1URJA 4RUAA 2ASLA 5J0OA 4O5CA 3ISBA 2VANA 4PHPA 1U45A 4HAIA 3PSTA 2MRLA 1N61A 4TUSA 3QUQA 2N1RA 1NZBA 4UQGA 1SL0A 5F3XB 3LVWA 3LVVA 9ICGA 3S6JA 2ZJAA 2OH2A 2K8AA 2ES6A 2JH7A 8ICRA 3KKAA 3NTUA 4QIWC 3PO5A 7ICJA 5JRTA 2HMXA 5EWGA 1ZQJA 2E5SA 2IA6A 1B43A 4OJPA 1OW5A 2I1QA 3T3FA 1MQ3A 3RJKA 8ICHA 1JIHA 1O08A 1S76D 5J2CA 4QWAA 4XRHA 4C4SA 4Q43A 4RQNA 1UCVA 1DGSA 2WFAA 1UA0A 2W7OA 4M9GA 2EZZA 2GLEA 4R8UA 3C2KA 1Q3UA 3TQ1A 5HHHA 1ZXIA 3H8SA 2R8JA 1WUDA 4OJ6A 1U49A 3EPIA 3IV6A 3PW2A 2LMRA 4I28A 4MHVA 2CRXA 5DB6A 2JZBA 2ISOA 1K5OA 1IG6A 1X66A 1JXEA 3FM9A 3MR6A 5IIMA 9ICUA 1QQ7A 2HI0A 4QZAA 5G5HA 3PNCA 2LKYA 1D9FA 4I2DA 4G3IA 1SGGA 9ICFA 5HR7A 1TK5A 1OXJA 3M8SA 1ZETA 3PW4A 4J9MA 3KOOA 4YR2A 4DSEA 2KMDA 2F1JA 4KTQA 3PX6A 4AP9A 2YMLA 4IRCA 3WK5A 4R63A 2WB1F 4EZ6A 1KQQA 4ELUA 3AM9A 3AU6A 1QQ5A 2ASJA 1BPXA 1Z4OA 3QXGA 2H3QA 2XCPA 4I2GA 1N5WA 5DQGA 4FBUA 1YZ6A 4QW9A 3H8MA 3QUBA 4IS7A 1WCNA 2OM6A 2HBJA 3CNHA 2FLLA 2LHTA 1NJYA 4C80A 3PW7A 3BS5B 3RJGA 2FMPA 2J6UA 1FIQA 5IIKA 3MDAA 1BPYA 4DLGA 1U47A 3QNMA 1QSSA 1FEZA 3GIKA 5AM0A 1XSLA 3ZDCA 1JN3A 9ICJA 5KT6A 1ZQHA 2KFZA 2E8OA 3E0FA 4DSJA 1NK0A 5TISU 3NRWA 4QZ9A 5CEHA 1UHUA 4MF2A 3H8WA 2BGWA 4KLUA 4Y2XA 4RUCA 3PSFA 3RBEA 4RT2A 2KSOA 2KKVA 4RQ4A 4Z6DA 5B5EU 2ZXIA 7ICLA 4FE3A 4YD1A 1HUZA 2KJ5A 3PSIA 3K1RB 2NO4A 2KEYA 4BXOB 4GLXA 1ZRMA 4P4MA 4F72A 1KLNA 1Z19A 4Q8EA 2DKXA 2IOFA 3C28A 3JPNA 3GILA 4F4XA 2UVVA 1J2MA 2W8LA 4RQMA 1T7PA 4O5EA 2FMSA 4UAUA 4IQVA 4DSLA 1PUZA 2CN1A 4X5VA 4C8LA 1CEZA 4TQSA 3RRGA 3OJSA 5AK5A 5J2IA 1MA7A 2KIVA 1DXSA 1Q3VA 1BPZA 4JV2A 2FLPA 2ISPA 4RPXA 1JUDA 1BPEA 2D3DA 2BPGA 8ICIA 5AKJA 1UT5A 2PMZF 4ECYA 3SZ2A 4RNMA 2BHNA 5G5GA 4OJ5A 1LV5A 4F4YA 5HR6A 3V6JA 1RM6C 2W3RA 5KFUA 2HHSA 4DFJA 4RQ6A 1XO1A 5F9NA 4PL1A 4J9PA 1XSPA 2AQ0A 4JWMA 2K60A 4KLEA 5EE3A 4O5KA 2Y1IA 2PXIA 5KFIA 4P4PA 1QH9A 8ICWA 4TUQA 4YG2A 4KX5A 1U4BA 2OCEA 3SYZA 1XWLA 4ELTA 4F2SA 2VKQA 1PK3A 3RB3A 1SZPA 5KFGA 2IOFK 1S0MA 3LDAA 1JROA 4QZCA 3N28A 2YMMA 3Q8MA 2B6GA 4IC9A 4DFDA 3GZFA 4O0IA 4MEXA 1SWVA 1VDVA 2QKQA 2QARA 2ZTCA 8ICQA 2VJ4A 1S0VA 3GFKB 3PMLA 4DQQA 2QLTA 5IIIA 3OGUA 1NJZA 2K89A 3TAQA 4B9VA 4B9SA 2ZIWA 1WCLA 5J2HA 3HKZC 4RQ0A 3V7KA 4MF8A 3BQTA 2XC9A 5BPCA 1DGJA 2JRZA 3AQFA 2RLTA 1XS9D 1XSNA 3ETRA 3M9NB 4Q45A 1TK8A 4J9KA 5EWEA 1B22A 1V38A 1U48A 2ESEA 2EAOA 4IL6U 5IINA 2DQNB 3NUQA 3MR3A 5KFXA 5KFCA 2JEFA 4QZ8A 2MSNA 1B4FA 1ZD5A 3SV3A 4ECQA 3QUCA 2R8HA 4PPXA 5DKWA 9ICIA 5J2AA 1L7OA 4MFAA 4U6PA 3M6ZA 2WAQF 4Q8FA 5DDMA 5DGAA 3O0FA 4CDGA 5ALIA 3VC8A 3QUTA 1X9WA 1N2XA 1N62A 5CA7A 5JTIA 1A76A 3EW9A 4F5QA 5KFOA 3Q8RB 3OSPA 2HVHA 2V4QA 5DBAA 5KFSA 1M6YA 3WK4A 5A0LA 1ZQXA 2XIDA 2ZTEA 4UW9A 2K4EA 4AYBC 3ZD9A 1CRXA 4UB3A 3C2MA 2W9CB 2HHVA 2LYHA 2KVSA 5KFPA 1MSWD 3AQEA 2KICA 3BJYA 1MC8A 2ZIXB 3TKAA 1NJXA 4C4TA 5CB1A 4F50A 1AQ6A 2R8GA 2OYYA 8ICMA 4RT3A 4GXIA 4J9OA 1KRPA 1NOMA 3MABA 1Y88A 4UAVA 4ED7A 5KG1A 5KG0A 2NRXA 5IIJA 3C5GA 2Y9TA 1F44A 4FBTA 4OJLA 3QEBZ 2WTFA 1YT3A 9ICEA 2EDUA 2YX8A 1NI3A 1ZQWA 5KL8B 3WKCA 3H4BA 5E79U 4M0AA 5KG3A 3PSPA 8ICGA 2C2EA 2K8BB 1N56A 1J97A 9ICLA 2OWOA 2A3VA 3AMZA 2RRDA 4QZHA 2JV3A 3IM1A 4M9JA 5KFBA 3WKDA 1ZQUA 4DFKA 2W9AA 2HHXA 5ALSA 4KLJA 4J03A 1ZQEA 5H2FU 4DQSA 3Q8LA 9ICSA 5J2BA 3PZPA 5KFZA 4BX9C 3WKBA 3ETLA 3RH6A 2LM4A 4YP3A 3RAXA 4PHAA 5ALFA 5AKXA 4EBEA 4YN4A 4YMNA 1C20A 5J2KA 4B9TA 1S9FA 1LKYB 4Z6EA 4DS4A 1SXEA 4YFKA 1JMSA 4OJOA 7ICVA 1ZD3A 3D2SA 7ICEA 5J2GA 5KT3A 3M1YA 1ZRNA 3PR4A 4JWNA 4FZMA 3ALRA 2DPJA 5J0SA 4NWIA 1RYSA 1IV8A 2PMZC 1RYRA 3RB6A 3C2LA 2W03A 3CYMA 5EE0A 1RYUA 3L5KA 1RPLA 4DS5A 5J0PA 4NXZA 3JPTA 4DO9A 2VA2A 8ICZA 3A0HU 4BGDA 3ZDAA 3KHLA 1HUOA 2YB1A 1BNPA 3BZKA 2LBOA 4P2HA 5TZVA 5L1KA 5AKEA 4J9QA 4O3QA 2W7PA 2M0NA 3L4PA 2PFNA 2DFLA 4DQIA 2KKPA 1N48A 4IRDA 5HMMA 4NV0A 3TFSA 4XA5A 3RR8A 2HSZA 1QTMA 5K4LA 3D2QA 5CJ7A 2MU2A 2G07A 3RTVA 2G09A 3N7RC 1DRGA 4WJ3B 4DL2A 4BWJA 3SQIA 2KHQA 9ICMA 3NRZA 3HKZF 3WU2U 2LYAA 3EUB2 3SR6A 2GH1A 4ED3A 4TQRA 1F0MA 3IRUA 3ISCA 2V9WA 3THVA 3MBYA 2BDPA 4F5NA 1TKDA 4O3SA 2NO5A 1N63A 2JR5A 5ALMA 4NM2A 1KBUA 2ZUBA 4P0PA 2YB4A 2W04A 1WYGA 4EEYA 3AU2A 3MDCA 1X9MA 1L3VA 3NASA 2H3ZA 5HHIA 1VLBA 2W9BA 2O6KA 4TUPA 3PX0A 9ICBA 5AM4A 1PK1B 4FZLA 4NL9C 4DCCA 4I2CA 1FFUA 4UBBA 4DL5A 1OUQA 1ZQTA 1D8LA 2W54A 2Y0SC 1RQLA 3BQ1A 2WAQC 4IQWA 2BCQA 5DB8A 2ZUCA 2WF5A 3IG8A 3KHGA 2Q4TA 3KHHA 4C8OA 1XNSA 1EXNA 3QYPA 3E2EA 2KHVA 2ZIUA 4AYBF 4F91B 2VA8A 9ICOA 5CWRA 3J81j 4Y2TA 5L1JA 2W43A 3T5JA 4CNQA 4YR0A 8ICUA 3TI0A 2G08A 2ZTDA 9ICAA 1NK9A 2MAXA 3D2NA 2FLNA 3GIMA 2F2AB 2AQ4A 2J6TA 2WHEA 2IOHA 2KIWA 1ZQSA 4QZBA 3C23A 5AKHA 2UVRA 4BDPA 4YQWA 1ZQYA 3M8RA 2PFPA 4KITB 2Z7JA 4DOAA 1PVQA 4NLZA 4B9MA 4M9HA 5DDYA 3C1YA 2MUTA 1SIJA 1TAQA 3WK6A 1KKXA 4B9NA 3OJUA 4NM1A 4R65A 4CF4A 2RDJA 8ICKA 2VA3A 3OPXA 3NVYA 3MGVA 1XC9A 1KFDA 2AJQA 7ICOA 3IDWA 4ED2A 3OTQA 3NVVA 3QZ7A 5D46A 4JK1A 1X9SA 3M7DA 5AKZA 2W55A 1Z3EB 4DL4A 1ZQOA 1QSYA 4KLGA 5DB9A 1IIPA 1KDHA 2E3TA 4NLNA 3UXPA 4NL9A 3KD3A 3TFRA 1L8OA 3C1ZA 2I9GA 5J0YA 5ALPA 4B9LA
chains in the Genus database with same CATH topology
1KN5A 1KQQA 2KK0A 2LM1A 2EQYA 2JXJA 2LI6A 2RQ5A 5K4LA 2YQEA 1IG6A 5CEHA 2EH9A 1RYUA 2CXYA 4LJXA 1C20A 2JRZA 2OEHA 1KKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KN5 A;  1KQQ A;  2KK0 A;  2LM1 A;  2EQY A;  2JXJ A;  2LI6 A;  2RQ5 A;  5K4L A;  2YQE A;  1IG6 A;  5CEH A;  2EH9 A;  1RYU A;  2CXY A;  4LJX A;  1C20 A;  2JRZ A;  2OEH A;  1KKX A; 
#chains in the Genus database with same CATH topology
 4IRK A;  2KK0 A;  2PI5 A;  1RG6 A;  2DBY A;  2LPE A;  4RQ7 A;  5EOZ A;  2I5H A;  3RAQ A;  3QU7 A;  1Z00 A;  1HJP A;  2CXY A;  7ICP A;  3CRX A;  3KFU F;  5AM3 A;  2KZZ A;  2ALZ A;  2GO7 A;  4M6W A;  1ZQV A;  4ZOH C;  4TUR A;  2IMW P;  4DFM A;  2ZJ8 A;  4M2Y A;  3PMN A;  1SKS A;  4F93 B;  5DGB A;  5ALW A;  5J2J A;  3G6Y A;  1DK2 A;  1L8L A;  4F5P A;  5J0R A;  4PZO A;  2R8I A;  3KTQ A;  2KN7 A;  4QW8 A;  4I2I A;  4R66 A;  2KJ9 A;  1C7Y A;  4IR9 A;  2QB0 B;  8ICX A;  3V72 A;  5D4B A;  2ZJ5 A;  1BGX T;  2EAM A;  3H8J A;  3UMG A;  1HEK A;  1SB3 C;  2J6S A;  3UQ0 A;  3JPO A;  3F2C A;  2P66 A;  3KBB A;  2ZIV A;  1KEJ A;  5KFF A;  5J0U A;  1ZQM A;  4UB8 U;  5AIC A;  4C0Z A;  3WK8 A;  5J2F A;  3N7S C;  2XGQ A;  2G5I B;  3ZDB A;  2K4H A;  1IM4 A;  1ZQK A;  4KLF A;  4Y2V A;  1MN8 A;  2HBK A;  3V6H A;  2ZG6 A;  4CF5 A;  2JMG A;  4DSF A;  1ED1 A;  4DL6 A;  1ECW A;  2H3V A;  5KT7 A;  1XU4 A;  2ODG A;  5AI6 A;  3RBD A;  3Q8K A;  5KT4 A;  4GXJ A;  2KOB A;  3ZI4 A;  3BDP A;  2PI4 A;  3MFI A;  2F44 A;  1SXD A;  2F3N A;  2HDO A;  4XUS A;  5J2D A;  4ELV A;  5KFY A;  4R8U B;  3ONN A;  3FYH A;  4PL2 A;  5DLF A;  5KG7 A;  1V9P A;  1S5L U;  2V4R A;  5ALN A;  5IIL A;  2F1H A;  3E58 A;  2JZB B;  4I2J A;  3EYZ A;  5C5J A;  4K4H A;  2WF7 A;  2L5Y A;  1QQ6 A;  1TFR A;  3DV9 A;  1COO A;  1S97 A;  9ICT A;  3DDH A;  3GV5 B;  3T5L A;  3QE9 Y;  5KTQ A;  2UVU A;  2G5H B;  5ALV A;  2C2R A;  4OD0 A;  1ZQD A;  1PVP A;  1BPB A;  2DKZ A;  2BCS A;  8ICE A;  3LWL A;  1U9L A;  5F9L A;  4NLB A;  4ECX A;  2NRT A;  2Y0S F;  2WF8 A;  5KFM A;  3NVW A;  5ALD A;  3VCB A;  2KVC A;  1JI7 A;  4PHD A;  2B21 A;  4EBC A;  3GV8 B;  3MFH A;  3Q8Q B;  4ED1 A;  8ICJ A;  3RJJ A;  4PZN A;  4HYK A;  5DLG A;  4C8K A;  4QZD A;  8ICA A;  4UB5 A;  4IR1 A;  1QCK A;  3OHA A;  2ATL A;  1UT8 A;  1RDF A;  2YQE A;  2BQ3 A;  4Y2Y A;  2R8K A;  7ICM A;  4UB2 A;  4ED0 A;  4QWC A;  2ZUD A;  2JEJ A;  1Q46 A;  1TK0 A;  7ICS A;  3ORY A;  2F1I A;  5ALU A;  2AXT U;  4RZR A;  4US8 A;  4KMU A;  3Q8P B;  4QZG A;  1T3Q A;  2F76 X;  9ICN A;  2XI9 A;  1NKC A;  1X42 A;  4ACO A;  3ED5 A;  3WKA A;  2RQ5 A;  1S0N A;  2KV2 A;  2K8C B;  2HHW A;  4DSI A;  4CGZ A;  3UPQ A;  2F8L A;  3V7J A;  2AGQ A;  4QZI A;  3HRD D;  3BS5 A;  3PR5 B;  9ICC A;  4GC6 A;  2JH1 A;  3F2D A;  2QB1 A;  3SAG A;  1PZN A;  2EQY A;  3UXO A;  2NRV A;  1ARO P;  4ICA A;  3ISD A;  4KLI A;  1L6N A;  1X2I A;  4I2A A;  3D6J A;  1ZD2 P;  4O9M A;  1NNL A;  4PGX A;  1L3S A;  3QU4 A;  1MQ2 A;  5KFH A;  3HX0 A;  2A19 A;  1S10 A;  2Y1J A;  2KSO B;  4NLG A;  5D49 A;  4PH5 A;  4DOC A;  3V7L A;  5KNI A;  2M9N A;  5KFQ A;  2JGA A;  1ZQ1 C;  3JPQ A;  4NLC A;  4KLO A;  3ZDE A;  3UQ2 A;  4FO6 A;  9ICX A;  2JXJ A;  2W9M A;  3AUO A;  1KFS A;  1ZD4 A;  1JXL A;  1NK4 A;  3SI8 A;  4KN7 A;  4UAS A;  1K1Q A;  3PW0 A;  4F4W A;  4LJX A;  2MA1 A;  4EYI B;  4F5R A;  1ZQC A;  3IN5 A;  2IHN A;  1JX4 A;  4JB3 A;  4BXO A;  2FI1 A;  1Z1V A;  5AKG A;  2WF9 A;  4PGQ A;  1L3U A;  3QZ8 A;  1S0O A;  4NLK A;  4KN4 A;  5AM2 A;  3NVZ A;  5J2E A;  2C28 A;  5KFV A;  3UM9 A;  2RP5 A;  3BQ0 A;  2Q0Z X;  1SV0 C;  5KFJ A;  2KP7 A;  1NK7 A;  3QEA Z;  2BR0 A;  4LZD A;  5KFA A;  3BQ2 A;  5ALG A;  3BZC A;  2DUY A;  2HW3 A;  5AK6 A;  9ICK A;  2JEI A;  2LI6 A;  5ALZ A;  2XO7 A;  3TAR A;  1NK5 A;  4IQT A;  5ALT A;  5GTH U;  4EBD A;  2B0C A;  2YN4 A;  4Y2S A;  3HJE A;  3JPP A;  2NYV A;  3EWA A;  4JMU A;  4YVZ A;  2BCR A;  4Y2U A;  4MFF A;  4ECR A;  4BUG A;  3GV7 B;  2FE9 A;  4J9L A;  4DF4 A;  9ICP A;  4QWB A;  5J0W A;  9ICW A;  1V85 A;  3T5H A;  4UB6 U;  2JEG A;  3TAC B;  3T5K A;  1BNO A;  1Q8K A;  4CE6 A;  3UXN A;  5AM1 A;  1KSP A;  4DSK A;  2P6R A;  2E1E A;  3B9J A;  4LZG A;  1UA1 A;  4M9L A;  2VIX A;  5DQH A;  3RJF A;  2K4P A;  2YY6 A;  1SKR A;  4M04 A;  5ALO A;  4JV0 A;  5CRX A;  4DL3 A;  2DGZ A;  1K1S A;  5KT5 A;  2QAR B;  4OCZ A;  4YR3 A;  2LYB A;  7ICN A;  9ICQ A;  5J8Y C;  4KLQ A;  5ALR A;  4F2R A;  1JRP A;  3H0M B;  2BQU A;  4C4R A;  1SZH A;  1DK3 A;  2ZIW B;  5L9X A;  1CUK A;  3FAH A;  2BQR A;  4I27 A;  2DF4 B;  8ICC A;  5DG7 A;  5DG8 A;  4UAW A;  3N97 B;  4EEN A;  4K4I A;  4I2F A;  1SV0 A;  1J2N A;  2D8C A;  3M6K A;  3CW2 C;  3NS1 A;  5L1I A;  2OHF A;  5AI4 A;  3N7P D;  1ZQL A;  1KW4 A;  1N5X A;  2IBK A;  2AH5 A;  4PGY A;  2KZ3 A;  3TAP A;  2PFO A;  4Z6C A;  2UVW A;  3PVX A;  5KFN A;  1UPH A;  3GDX A;  4C8N A;  3LYS A;  3BQ7 A;  5KL1 B;  1WWU A;  2YMQ A;  3QU2 A;  1X6J A;  1SKW A;  2G0A A;  5J29 A;  3SV4 A;  2AHO B;  4R64 A;  1DOQ A;  1ZOL A;  2WF6 A;  4CRX A;  3RRH A;  2FJ6 A;  4USA A;  3JPS A;  1X40 A;  5L1M A;  5T14 A;  2HOF A;  3GU3 A;  5AK4 A;  7ICG A;  1SWW A;  4GIB A;  1IXR A;  2KNJ A;  7ICF A;  4UAR A;  1ZYQ A;  5DBC A;  4J9S A;  4F3O A;  1S8O A;  3MR2 A;  2A1J A;  4YMM A;  1KN5 A;  2W11 A;  1LB2 B;  2CPR A;  1ZQA A;  3F5E A;  4O3R A;  4I29 A;  5KFK A;  2W3S A;  2VJ5 A;  4Y2P A;  2P35 A;  1T94 A;  3ICX A;  5IIO A;  4U7C A;  2FPM A;  3QX7 A;  3AN1 A;  2W9C A;  5KAF U;  5KAI U;  3WKE A;  3I28 A;  2FPK A;  7ICK A;  2ZIX A;  5CP2 A;  2BPF A;  3WK7 A;  5J8Y A;  4JUZ A;  3TAN A;  4UAY A;  3QU5 A;  3RH5 A;  5AK3 A;  2DPI A;  2ZXH A;  3I76 A;  2AU0 A;  3UMC A;  2I6X A;  3ZD8 A;  4EX7 A;  3SEN A;  4J9R A;  5DG9 A;  5ALK A;  1ZQB A;  7ICU A;  4KLL A;  5B66 U;  2OEH A;  4KLM A;  2DWQ A;  5AI9 A;  4E0D A;  8ICB A;  5EWF A;  1X6I A;  9ICR A;  3PO4 A;  4DEZ A;  3MC1 A;  8ICO A;  4CF3 A;  4GFJ A;  2H3F A;  2XY6 A;  1KFT A;  5ALX A;  3KZI U;  4B9U A;  4DQP A;  4Q44 A;  2AGP A;  1NK8 A;  4K4G A;  3I1Y A;  4Z6F A;  3RR7 A;  1TV9 A;  3RH4 A;  2YMP A;  4EYH B;  2R18 A;  1WG8 A;  3K1Z A;  1Z4N A;  3HPO A;  1ZQI A;  5ALY A;  3GIJ A;  4ECS A;  8ICT A;  2GOL A;  2EZX A;  3RF9 A;  5HML A;  2DL0 A;  3FDS A;  1H38 A;  4O3M A;  5ALQ A;  4XQ8 A;  1T3N A;  5J0Q A;  3C5F A;  1JAL A;  2EAN A;  4CCH A;  5KG5 A;  3PX4 A;  2IHM A;  1L7M A;  1N60 A;  2XVT A;  4RNN A;  4EEK A;  4O3O A;  2LM1 A;  2H3I A;  2P6U A;  4QWE A;  3H7I A;  4P0Q A;  2GWS A;  1FO4 A;  4O3N A;  5BOL A;  3SAH A;  4F71 A;  7ICQ A;  4US9 A;  3H40 A;  5JUM A;  5KFE A;  3RJH A;  1KTQ A;  2BZF A;  4I2B A;  5DBB A;  3JPR A;  4RQ5 A;  4DFP A;  4UB4 A;  1LKY A;  1RXV A;  4G9B A;  3U26 A;  3WK9 A;  4YXJ A;  3NGD A;  5KT2 A;  1V97 A;  1T8E A;  5KFW A;  5BOM A;  2BPC A;  2HCF A;  1NKE A;  5AHX A;  3IP4 B;  2C2D A;  1FFV A;  4YCX A;  1L7N A;  3B0Y A;  2KG5 A;  2PKE A;  4C7Z A;  4F4Z A;  3MGI A;  2XIC A;  5HNK A;  3H0L B;  1ZQF A;  4FS1 A;  2ASD A;  5GTI U;  3RB0 A;  1TE2 A;  3RJI A;  2BCV A;  3H4D A;  1S77 D;  1ZQN A;  3OHB A;  5ALE A;  4ECW A;  5KFR A;  3RB4 A;  1L5U A;  5HP4 A;  5KFL A;  1L3T A;  5KG4 A;  4RU9 A;  5ALH A;  4UAZ A;  7ICT A;  1X9X A;  2K4I A;  8ICL A;  4NY8 A;  1VJ5 A;  1QSL A;  4ECZ A;  5KG2 A;  5C0Y A;  4QIW F;  2BDU A;  4QJF B;  4QNL A;  5AI5 A;  2YTU A;  2EAP A;  1TAM A;  1TVA A;  1QLN A;  1A0P A;  2KE7 A;  1O03 A;  1D8B A;  3SAF A;  5EE1 A;  3A0B U;  3CP8 A;  3V6K A;  2HBL A;  1BVS A;  4KMO B;  4QWD A;  1WWV A;  2G06 A;  3OSN A;  4C7Y A;  1T4G A;  3Q8S B;  8ICV A;  3G6V A;  3PV8 A;  2H5X A;  4J9N A;  4Y2Q A;  1TAU A;  4IQU A;  3UMB A;  5AI8 A;  5J0X A;  2NV3 A;  5AKY A;  2BKE A;  1ZQQ A;  3HW8 A;  4EX6 A;  4ECV A;  2JHD A;  2A1A A;  4P0P B;  4FZN A;  2E8M A;  1ZJM A;  4NJ8 A;  3B0X A;  1NKB A;  1D9D A;  4LVS A;  2W9B B;  1NJW A;  9ICV A;  3HIL A;  3H0R B;  2KZM A;  2Y9U A;  3N4M B;  3TAD C;  4RNO A;  4EEL A;  4Y2R A;  1PVR A;  2EZY A;  3F5A A;  3BS7 A;  1NK6 A;  2F8K A;  3MR5 A;  1UQV A;  1PK1 A;  3GQC A;  5KFD A;  2W8K A;  1CI4 A;  1A77 A;  4M47 A;  4YMO A;  2XGP A;  1COK A;  1NZP A;  1SV4 A;  3HT3 A;  3T79 A;  1A6S A;  1RZT A;  5FP0 A;  2ZIU B;  1KL9 A;  1YZ7 A;  2WB1 C;  8ICS A;  2A1J B;  3AL0 B;  2NRZ A;  4KLD A;  4UBC A;  2KFN A;  4O3P A;  4P4O A;  1RQN A;  3PW5 A;  2E8N A;  7ICH A;  2XCA A;  3EPG A;  3LK9 A;  1RXW A;  2E1F A;  4ZH4 A;  1GO3 F;  4RQ3 A;  5EE9 A;  5ALL A;  4KX3 A;  2PFQ A;  2KD1 A;  4B6J A;  3M9O B;  4DF8 A;  1B0X A;  2KJ8 A;  4RPZ A;  4KLH A;  7ICI A;  3G6X A;  2FMQ A;  4MEY A;  2HBM A;  1D8Y A;  7ICR A;  4A8E A;  5DQI A;  4ED6 A;  1ZQP A;  4KLT A;  4FS2 A;  5L1L A;  2E8P A;  2F77 X;  2HHT A;  2FDR A;  3EZ5 A;  8ICY A;  2MUT B;  4ED8 A;  2EH9 A;  4GC7 A;  3L3F X;  5AIA A;  2HOQ A;  5J0T A;  3DEE A;  8ICP A;  1ZQZ A;  4DL7 A;  4F92 B;  4RQ2 A;  4C8M A;  1SL1 A;  1ZQG A;  4DWI A;  4M9N A;  8ICF A;  2NRW A;  3R9K A;  1Z1B A;  3F2B A;  3K75 D;  2XY5 A;  4DLE A;  1HIW A;  3TAD A;  4F5O A;  1ZQR A;  1L7P A;  3SEI A;  3IG5 A;  5AM5 A;  3HP6 A;  1LVH A;  4OO1 J;  3F53 A;  3KKA C;  4QZE A;  4YD2 A;  4EZ9 A;  3C21 A;  4QZF A;  3SD7 A;  4KLS A;  5CR0 A;  3AEV A;  3C29 A;  1SL2 A;  2D6F C;  4RQ1 A;  1BPD A;  4I2H A;  4FFD A;  4BWM A;  2C22 A;  5AKI A;  3M9M B;  1Z00 B;  3PY8 A;  3HWT A;  2XY7 A;  4UAT A;  3RJE A;  5KG6 A;  5JU5 A;  4PJ0 U;  5AI0 A;  4RQ8 A;  4DQR A;  2HHU A;  5AKK A;  3IHQ B;  3KZX A;  2FPL A;  2OXO A;  4MFC A;  4P0Q B;  4ECT A;  4ECU A;  4M6W B;  4UB1 A;  2RHF A;  3SMV A;  8ICN A;  4RPY A;  1P7D A;  5DB7 A;  1XO0 A;  3RFA A;  2BCU A;  5ALJ A;  4F4K A;  2HHQ A;  2KTQ A;  3QU9 A;  4BJQ A;  2AGO A;  1F5S A;  4JV1 A;  2HOI A;  5CHG A;  4I2E A;  3LWM A;  3GII A;  3MGH A;  3FC4 A;  2RDI A;  4PHE A;  5KFT A;  3ZDD A;  9ICH A;  4F8R A;  4GXK A;  4Y2J A;  3KHR A;  5AIB A;  2QB0 A;  1ZJN A;  2ZIV B;  3K4G A;  5AKL A;  2HVI A;  4DOB A;  4YXM A;  1URJ A;  4RUA A;  2ASL A;  5J0O A;  4O5C A;  3ISB A;  2VAN A;  4PHP A;  1U45 A;  4HAI A;  3PST A;  2MRL A;  1N61 A;  4TUS A;  3QUQ A;  2N1R A;  1NZB A;  4UQG A;  1SL0 A;  5F3X B;  3LVW A;  3LVV A;  9ICG A;  3S6J A;  2ZJA A;  2OH2 A;  2K8A A;  2ES6 A;  2JH7 A;  8ICR A;  3KKA A;  3NTU A;  4QIW C;  3PO5 A;  7ICJ A;  5JRT A;  2HMX A;  5EWG A;  1ZQJ A;  2E5S A;  2IA6 A;  1B43 A;  4OJP A;  1OW5 A;  2I1Q A;  3T3F A;  1MQ3 A;  3RJK A;  8ICH A;  1JIH A;  1O08 A;  1S76 D;  5J2C A;  4QWA A;  4XRH A;  4C4S A;  4Q43 A;  4RQN A;  1UCV A;  1DGS A;  2WFA A;  1UA0 A;  2W7O A;  4M9G A;  2EZZ A;  2GLE A;  4R8U A;  3C2K A;  1Q3U A;  3TQ1 A;  5HHH A;  1ZXI A;  3H8S A;  2R8J A;  1WUD A;  4OJ6 A;  1U49 A;  3EPI A;  3IV6 A;  3PW2 A;  2LMR A;  4I28 A;  4MHV A;  2CRX A;  5DB6 A;  2JZB A;  2ISO A;  1K5O A;  1IG6 A;  1X66 A;  1JXE A;  3FM9 A;  3MR6 A;  5IIM A;  9ICU A;  1QQ7 A;  2HI0 A;  4QZA A;  5G5H A;  3PNC A;  2LKY A;  1D9F A;  4I2D A;  4G3I A;  1SGG A;  9ICF A;  5HR7 A;  1TK5 A;  1OXJ A;  3M8S A;  1ZET A;  3PW4 A;  4J9M A;  3KOO A;  4YR2 A;  4DSE A;  2KMD A;  2F1J A;  4KTQ A;  3PX6 A;  4AP9 A;  2YML A;  4IRC A;  3WK5 A;  4R63 A;  2WB1 F;  4EZ6 A;  1KQQ A;  4ELU A;  3AM9 A;  3AU6 A;  1QQ5 A;  2ASJ A;  1BPX A;  1Z4O A;  3QXG A;  2H3Q A;  2XCP A;  4I2G A;  1N5W A;  5DQG A;  4FBU A;  1YZ6 A;  4QW9 A;  3H8M A;  3QUB A;  4IS7 A;  1WCN A;  2OM6 A;  2HBJ A;  3CNH A;  2FLL A;  2LHT A;  1NJY A;  4C80 A;  3PW7 A;  3BS5 B;  3RJG A;  2FMP A;  2J6U A;  1FIQ A;  5IIK A;  3MDA A;  1BPY A;  4DLG A;  1U47 A;  3QNM A;  1QSS A;  1FEZ A;  3GIK A;  5AM0 A;  1XSL A;  3ZDC A;  1JN3 A;  9ICJ A;  5KT6 A;  1ZQH A;  2KFZ A;  2E8O A;  3E0F A;  4DSJ A;  1NK0 A;  5TIS U;  3NRW A;  4QZ9 A;  5CEH A;  1UHU A;  4MF2 A;  3H8W A;  2BGW A;  4KLU A;  4Y2X A;  4RUC A;  3PSF A;  3RBE A;  4RT2 A;  2KSO A;  2KKV A;  4RQ4 A;  4Z6D A;  5B5E U;  2ZXI A;  7ICL A;  4FE3 A;  4YD1 A;  1HUZ A;  2KJ5 A;  3PSI A;  3K1R B;  2NO4 A;  2KEY A;  4BXO B;  4GLX A;  1ZRM A;  4P4M A;  4F72 A;  1KLN A;  1Z19 A;  4Q8E A;  2DKX A;  2IOF A;  3C28 A;  3JPN A;  3GIL A;  4F4X A;  2UVV A;  1J2M A;  2W8L A;  4RQM A;  1T7P A;  4O5E A;  2FMS A;  4UAU A;  4IQV A;  4DSL A;  1PUZ A;  2CN1 A;  4X5V A;  4C8L A;  1CEZ A;  4TQS A;  3RRG A;  3OJS A;  5AK5 A;  5J2I A;  1MA7 A;  2KIV A;  1DXS A;  1Q3V A;  1BPZ A;  4JV2 A;  2FLP A;  2ISP A;  4RPX A;  1JUD A;  1BPE A;  2D3D A;  2BPG A;  8ICI A;  5AKJ A;  1UT5 A;  2PMZ F;  4ECY A;  3SZ2 A;  4RNM A;  2BHN A;  5G5G A;  4OJ5 A;  1LV5 A;  4F4Y A;  5HR6 A;  3V6J A;  1RM6 C;  2W3R A;  5KFU A;  2HHS A;  4DFJ A;  4RQ6 A;  1XO1 A;  5F9N A;  4PL1 A;  4J9P A;  1XSP A;  2AQ0 A;  4JWM A;  2K60 A;  4KLE A;  5EE3 A;  4O5K A;  2Y1I A;  2PXI A;  5KFI A;  4P4P A;  1QH9 A;  8ICW A;  4TUQ A;  4YG2 A;  4KX5 A;  1U4B A;  2OCE A;  3SYZ A;  1XWL A;  4ELT A;  4F2S A;  2VKQ A;  1PK3 A;  3RB3 A;  1SZP A;  5KFG A;  2IOF K;  1S0M A;  3LDA A;  1JRO A;  4QZC A;  3N28 A;  2YMM A;  3Q8M A;  2B6G A;  4IC9 A;  4DFD A;  3GZF A;  4O0I A;  4MEX A;  1SWV A;  1VDV A;  2QKQ A;  2QAR A;  2ZTC A;  8ICQ A;  2VJ4 A;  1S0V A;  3GFK B;  3PML A;  4DQQ A;  2QLT A;  5III A;  3OGU A;  1NJZ A;  2K89 A;  3TAQ A;  4B9V A;  4B9S A;  2ZIW A;  1WCL A;  5J2H A;  3HKZ C;  4RQ0 A;  3V7K A;  4MF8 A;  3BQT A;  2XC9 A;  5BPC A;  1DGJ A;  2JRZ A;  3AQF A;  2RLT A;  1XS9 D;  1XSN A;  3ETR A;  3M9N B;  4Q45 A;  1TK8 A;  4J9K A;  5EWE A;  1B22 A;  1V38 A;  1U48 A;  2ESE A;  2EAO A;  4IL6 U;  5IIN A;  2DQN B;  3NUQ A;  3MR3 A;  5KFX A;  5KFC A;  2JEF A;  4QZ8 A;  2MSN A;  1B4F A;  1ZD5 A;  3SV3 A;  4ECQ A;  3QUC A;  2R8H A;  4PPX A;  5DKW A;  9ICI A;  5J2A A;  1L7O A;  4MFA A;  4U6P A;  3M6Z A;  2WAQ F;  4Q8F A;  5DDM A;  5DGA A;  3O0F A;  4CDG A;  5ALI A;  3VC8 A;  3QUT A;  1X9W A;  1N2X A;  1N62 A;  5CA7 A;  5JTI A;  1A76 A;  3EW9 A;  4F5Q A;  5KFO A;  3Q8R B;  3OSP A;  2HVH A;  2V4Q A;  5DBA A;  5KFS A;  1M6Y A;  3WK4 A;  5A0L A;  1ZQX A;  2XID A;  2ZTE A;  4UW9 A;  2K4E A;  4AYB C;  3ZD9 A;  1CRX A;  4UB3 A;  3C2M A;  2W9C B;  2HHV A;  2LYH A;  2KVS A;  5KFP A;  1MSW D;  3AQE A;  2KIC A;  3BJY A;  1MC8 A;  2ZIX B;  3TKA A;  1NJX A;  4C4T A;  5CB1 A;  4F50 A;  1AQ6 A;  2R8G A;  2OYY A;  8ICM A;  4RT3 A;  4GXI A;  4J9O A;  1KRP A;  1NOM A;  3MAB A;  1Y88 A;  4UAV A;  4ED7 A;  5KG1 A;  5KG0 A;  2NRX A;  5IIJ A;  3C5G A;  2Y9T A;  1F44 A;  4FBT A;  4OJL A;  3QEB Z;  2WTF A;  1YT3 A;  9ICE A;  2EDU A;  2YX8 A;  1NI3 A;  1ZQW A;  5KL8 B;  3WKC A;  3H4B A;  5E79 U;  4M0A A;  5KG3 A;  3PSP A;  8ICG A;  2C2E A;  2K8B B;  1N56 A;  1J97 A;  9ICL A;  2OWO A;  2A3V A;  3AMZ A;  2RRD A;  4QZH A;  2JV3 A;  3IM1 A;  4M9J A;  5KFB A;  3WKD A;  1ZQU A;  4DFK A;  2W9A A;  2HHX A;  5ALS A;  4KLJ A;  4J03 A;  1ZQE A;  5H2F U;  4DQS A;  3Q8L A;  9ICS A;  5J2B A;  3PZP A;  5KFZ A;  4BX9 C;  3WKB A;  3ETL A;  3RH6 A;  2LM4 A;  4YP3 A;  3RAX A;  4PHA A;  5ALF A;  5AKX A;  4EBE A;  4YN4 A;  4YMN A;  1C20 A;  5J2K A;  4B9T A;  1S9F A;  1LKY B;  4Z6E A;  4DS4 A;  1SXE A;  4YFK A;  1JMS A;  4OJO A;  7ICV A;  1ZD3 A;  3D2S A;  7ICE A;  5J2G A;  5KT3 A;  3M1Y A;  1ZRN A;  3PR4 A;  4JWN A;  4FZM A;  3ALR A;  2DPJ A;  5J0S A;  4NWI A;  1RYS A;  1IV8 A;  2PMZ C;  1RYR A;  3RB6 A;  3C2L A;  2W03 A;  3CYM A;  5EE0 A;  1RYU A;  3L5K A;  1RPL A;  4DS5 A;  5J0P A;  4NXZ A;  3JPT A;  4DO9 A;  2VA2 A;  8ICZ A;  3A0H U;  4BGD A;  3ZDA A;  3KHL A;  1HUO A;  2YB1 A;  1BNP A;  3BZK A;  2LBO A;  4P2H A;  5TZV A;  5L1K A;  5AKE A;  4J9Q A;  4O3Q A;  2W7P A;  2M0N A;  3L4P A;  2PFN A;  2DFL A;  4DQI A;  2KKP A;  1N48 A;  4IRD A;  5HMM A;  4NV0 A;  3TFS A;  4XA5 A;  3RR8 A;  2HSZ A;  1QTM A;  5K4L A;  3D2Q A;  5CJ7 A;  2MU2 A;  2G07 A;  3RTV A;  2G09 A;  3N7R C;  1DRG A;  4WJ3 B;  4DL2 A;  4BWJ A;  3SQI A;  2KHQ A;  9ICM A;  3NRZ A;  3HKZ F;  3WU2 U;  2LYA A;  3EUB 2;  3SR6 A;  2GH1 A;  4ED3 A;  4TQR A;  1F0M A;  3IRU A;  3ISC A;  2V9W A;  3THV A;  3MBY A;  2BDP A;  4F5N A;  1TKD A;  4O3S A;  2NO5 A;  1N63 A;  2JR5 A;  5ALM A;  4NM2 A;  1KBU A;  2ZUB A;  4P0P A;  2YB4 A;  2W04 A;  1WYG A;  4EEY A;  3AU2 A;  3MDC A;  1X9M A;  1L3V A;  3NAS A;  2H3Z A;  5HHI A;  1VLB A;  2W9B A;  2O6K A;  4TUP A;  3PX0 A;  9ICB A;  5AM4 A;  1PK1 B;  4FZL A;  4NL9 C;  4DCC A;  4I2C A;  1FFU A;  4UBB A;  4DL5 A;  1OUQ A;  1ZQT A;  1D8L A;  2W54 A;  2Y0S C;  1RQL A;  3BQ1 A;  2WAQ C;  4IQW A;  2BCQ A;  5DB8 A;  2ZUC A;  2WF5 A;  3IG8 A;  3KHG A;  2Q4T A;  3KHH A;  4C8O A;  1XNS A;  1EXN A;  3QYP A;  3E2E A;  2KHV A;  2ZIU A;  4AYB F;  4F91 B;  2VA8 A;  9ICO A;  5CWR A;  3J81 j;  4Y2T A;  5L1J A;  2W43 A;  3T5J A;  4CNQ A;  4YR0 A;  8ICU A;  3TI0 A;  2G08 A;  2ZTD A;  9ICA A;  1NK9 A;  2MAX A;  3D2N A;  2FLN A;  3GIM A;  2F2A B;  2AQ4 A;  2J6T A;  2WHE A;  2IOH A;  2KIW A;  1ZQS A;  4QZB A;  3C23 A;  5AKH A;  2UVR A;  4BDP A;  4YQW A;  1ZQY A;  3M8R A;  2PFP A;  4KIT B;  2Z7J A;  4DOA A;  1PVQ A;  4NLZ A;  4B9M A;  4M9H A;  5DDY A;  3C1Y A;  2MUT A;  1SIJ A;  1TAQ A;  3WK6 A;  1KKX A;  4B9N A;  3OJU A;  4NM1 A;  4R65 A;  4CF4 A;  2RDJ A;  8ICK A;  2VA3 A;  3OPX A;  3NVY A;  3MGV A;  1XC9 A;  1KFD A;  2AJQ A;  7ICO A;  3IDW A;  4ED2 A;  3OTQ A;  3NVV A;  3QZ7 A;  5D46 A;  4JK1 A;  1X9S A;  3M7D A;  5AKZ A;  2W55 A;  1Z3E B;  4DL4 A;  1ZQO A;  1QSY A;  4KLG A;  5DB9 A;  1IIP A;  1KDH A;  2E3T A;  4NLN A;  3UXP A;  4NL9 A;  3KD3 A;  3TFR A;  1L8O A;  3C1Z A;  2I9G A;  5J0Y A;  5ALP A;  4B9L A; 
#chains in the Genus database with same CATH homology
 1KN5 A;  1KQQ A;  2KK0 A;  2LM1 A;  2EQY A;  2JXJ A;  2LI6 A;  2RQ5 A;  5K4L A;  2YQE A;  1IG6 A;  5CEH A;  2EH9 A;  1RYU A;  2CXY A;  4LJX A;  1C20 A;  2JRZ A;  2OEH A;  1KKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...