1Z1VA

Nmr structure of the saccharomyces cerevisiae ste50 sam domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
SQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STE50 protein
publication title Saccharomyces cerevisiae Ste50 binds the MAPKKK Ste11 through a head-to-tail SAM domain interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 25
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1z1vA00
2E8NA 2EAMA 1PK3A 3KKAC 2F3NA 1SV0A 5JU5A 1OW5A 1SGGA 2F44A 4RQMA 2LPEA 1JI7A 2EANA 2Y9TA 1SXDA 1LKYB 1SV4A 3TADA 1RG6A 1SV0C 2KG5A 2DL0A 1PK1A 2KSOB 3H8MA 3BQ7A 2E8MA 1B0XA 3TADC 2QKQA 1UCVA 2Y9UA 5L1MA 2ESEA 2KIVA 2JV3A 2DKXA 2L5YA 2E8OA 4RQNA 3K1RB 3BS7A 3SEIA 5JRTA 5JTIA 5J8YA 2GLEA 2B6GA 1F0MA 2KE7A 2E8PA 5F3XB 1X40A 2KMDA 3HILA 1COKA 3BS5A 2QB0A 1V85A 1PK1B 1WWVA 2D8CA 5KNIA 3IDWA 2FE9A 5J8YC 2K4PA 2QARA 1SXEA 3TACB 1UQVA 1V38A 1B4FA 2QARB 2F8KA 4MHVA 1KW4A 3SENA 2EAPA 2QB1A 1X9XA 4IS7A 2DKZA 2D3DA 4PZNA 3BS5B 1X66A 1LKYA 2QB0B 4NL9A 4PZOA 1OXJA 2LMRA 2K60A 3KKAA 4NJ8A 2YTUA 1DXSA 1WWUA 2KSOA 1Z1VA 2EAOA 4NL9C 2ES6A
chains in the Genus database with same CATH superfamily
2ALZA 2AHOB 3RFAA 4EENA 3PW4A 5AI8A 4QZHA 2W9CB 3SI8A 8ICYA 2XGPA 3D6JA 5J0UA 3PMLA 4B9NA 4OJ6A 3IHQB 5KFWA 3FC4A 4J9OA 4DFKA 1SWWA 2HBLA 1KRPA 4DL4A 4XA5A 4ACOA 2JMGA 4ZH4A 1Z00A 2IOHA 3QNMA 2JGAA 3WU2U 2E8MA 3AQEA 3QUCA 4LJXA 2ZIXA 2FLNA 4CF5A 1ZQVA 4DF8A 4FZLA 1H38A 2H3FA 4JB3A 3FAHA 5IIIA 2ZUBA 4F4KA 1DRGA 2F2AB 3MC1A 2B6GA 3MR6A 8ICQA 2E8PA 1X9SA 3EPGA 5EWEA 4KLOA 2J6TA 5EWGA 3L5KA 1PK1B 3NVZA 2YB4A 2D8CA 1ZQCA 3IDWA 2HHTA 2YY6A 5HHHA 2K4PA 3PSFA 4ED2A 4EBDA 2VA8A 3IN5A 1KW4A 1KFSA 4I28A 4DSJA 3ZDBA 5ALUA 2F76X 1C20A 5J2IA 9ICKA 1JROA 4ZOHC 4DQRA 4PH5A 4PZNA 3M8RA 1NKEA 3N7RC 4PZOA 5AK3A 5KG7A 4QW9A 3MFIA 8ICBA 3NVWA 3PO5A 2P6UA 2LYAA 3KHHA 4ECUA 4KLIA 8ICIA 4UATA 4WJ3B 2EAOA 4DSFA 1X42A 4USAA 3PW7A 4ECVA 4ELUA 2MA1A 1XC9A 4CNQA 5JU5A 5HP4A 1C7YA 3JPNA 1L3TA 4RQMA 2BQUA 1N5XA 4PPXA 4GC7A 2MAXA 9ICMA 1HJPA 2HHVA 4IQUA 1L3UA 1XS9D 4R8UA 2RDJA 5AKJA 5ALFA 1T7PA 4YMOA 4DL7A 5AKGA 3GV5B 1NKCA 2WTFA 1QQ7A 4DF4A 3OJSA 2BQRA 3ZDEA 2HHUA 3KHGA 3QX7A 2RRDA 2B0CA 3UMCA 4RQ6A 4O3NA 2OM6A 5CB1A 2XY6A 4M47A 1HIWA 5ALRA 4JV1A 3SV4A 5CA7A 5DG9A 2YMMA 3SMVA 4F4XA 3RB6A 3S6JA 4UAVA 4ED6A 4I2AA 5KG5A 5DLFA 1BNPA 4AYBF 3HKZC 1X2IA 4PHAA 2HSZA 1KL9A 4IRCA 4F91B 4TQSA 1X9MA 1K1QA 4JV2A 2I5HA 5DQIA 4F3OA 3H8WA 5J0RA 4GXIA 2QB1A 4P0PB 4GXJA 4KLLA 3RH6A 3ONNA 1IG6A 3Q8KA 4HAIA 4C4RA 1ZQIA 4ED3A 4NL9A 1RQLA 9ICLA 3SR6A 3QU9A 3QUQA 3H0MB 5J2EA 5DQHA 2W7PA 2WF6A 3T79A 3HT3A 1TKDA 1UHUA 3RTVA 4Z6FA 4B9SA 1RXWA 3LWMA 2JEJA 4MF2A 1U49A 4YMNA 1OW5A 3SZ2A 2IBKA 3J81j 4UB8U 5DB7A 3BQ1A 3ICXA 4BUGA 3UM9A 2G07A 2R8IA 2PFQA 3MDCA 5J2KA 4YN4A 4QWEA 4F8RA 2CN1A 5ALEA 2XGQA 1Q8KA 4PGQA 1CEZA 3UQ0A 4Y2UA 4DOBA 1N60A 3SYZA 3BQ7A 3FM9A 5KFAA 2Y9UA 3MABA 5EOZA 4KTQA 1TK8A 7ICTA 1ZOLA 2DKXA 2L5YA 3BQ2A 3Q8LA 4BWMA 2EQYA 5L9XA 5KT3A 3V7LA 2WFAA 1YZ7A 2E3TA 3QXGA 3IG8A 2PFPA 2VANA 2JEIA 3M7DA 4CE6A 2IOFA 2KIWA 1UQVA 1V38A 4QWBA 1B4FA 1ZYQA 2Z7JA 5AKYA 2FDRA 5ALJA 2ZTDA 5KFZA 3M6ZA 4ECWA 5AIBA 5J0PA 8ICWA 1F5SA 5AHXA 5AKZA 1D9FA 2LMRA 4YFKA 2I6XA 4NJ8A 5ALKA 2MU2A 3GILA 1RZTA 3NGDA 4IR9A 4JK1A 4DFMA 4Y2RA 4US9A 4BXOA 2EAMA 1QSLA 4YXMA 1N63A 2KJ9A 4QIWC 4P0QA 4DSEA 5EE3A 2HHQA 2W9AA 2JEFA 2I9GA 3WK7A 1KEJA 4C8NA 4J9SA 4RQ4A 2BDUA 1IIPA 4PGYA 4ICAA 4ECTA 7ICHA 2WB1C 3H0RB 1ZQJA 2R8JA 4I2EA 1BPEA 3C5FA 1JALA 3L3FX 3ZDAA 1ZQYA 4KLUA 4UAWA 1FFUA 4OD0A 4RQNA 3V6KA 5G5GA 2BCUA 4RQ0A 3THVA 5DQGA 1NJZA 2HW3A 5CR0A 1F0MA 3PVXA 3KZXA 5D46A 3WK9A 1ECWA 3TAPA 1NK6A 1JXEA 2PKEA 2QB0A 4B9TA 2ZG6A 2BKEA 4PHEA 3TFSA 9ICSA 4NLGA 1N62A 4BGDA 5DGAA 1ZJNA 1NI3A 1U9LA 1LB2B 2QLTA 4KN4A 1NK0A 2LBOA 3UXPA 3Q8MA 4OJOA 8ICSA 4FBUA 3QZ8A 4J9QA 4DQIA 4M6WA 3BZCA 2W9BB 1S76D 2BGWA 1QCKA 4KLEA 8ICCA 1OUQA 3RJJA 5KFDA 4FS1A 1N48A 5ALXA 2I1QA 1ZQMA 3L4PA 4O5EA 2HOIA 5AM1A 1DXSA 4CGZA 5KFEA 1MC8A 5FP0A 1TFRA 3CRXA 1MQ3A 2NRTA 1NNLA 3UMGA 3AM9A 2EH9A 2C22A 2J6UA 5DDMA 7ICKA 4P4PA 3SQIA 4NLNA 7ICFA 7ICVA 4QZIA 1NOMA 2XICA 3RJEA 7ICJA 3AL0B 3H4BA 2C28A 1SIJA 2E1FA 1WG8A 5KTQA 1A76A 5KFCA 7ICRA 3K75D 4ELTA 1S77D 3C28A 3H40A 3OHAA 3V72A 1U47A 1JIHA 4UB2A 4DOAA 9ICVA 2QKQA 4CRXA 2ESEA 4DFJA 2YMLA 4U7CA 1O03A 4QWAA 3JPSA 5AM0A 3C2MA 3RJIA 4O3MA 2NRZA 2VKQA 2W43A 5CWRA 1BPZA 3PV8A 1FIQA 3KHRA 3UXNA 9ICFA 1COKA 1SWVA 3H8SA 4QIWF 5J2BA 1ZD4A 2XY5A 2EZZA 5J2DA 1XWLA 4MHVA 2MSNA 4EYIB 4KX3A 5AIAA 1EXNA 2ZIWA 2FPKA 4CF4A 3RR7A 1CUKA 3GQCA 4NLBA 1TVAA 5KAIU 4IL6U 4F93B 4Z6DA 4NM2A 4PGXA 4DCCA 3QUTA 3F2DA 4M9HA 2ISPA 1DK3A 3E2EA 1LKYA 3C5GA 2OH2A 4P2HA 3KKAA 5ALSA 4Y2TA 3ZI4A 2XIDA 1RM6C 3MDAA 1FEZA 7ICSA 3PSIA 1S0MA 4M0AA 2P35A 2XI9A 2V4QA 1L8OA 4KLHA 2OCEA 9ICPA 1IV8A 3WKEA 1FO4A 2OHFA 2F44A 1Q46A 1F44A 2LPEA 3OJUA 4P0QB 3UXOA 2ATLA 2OEHA 2EDUA 1ZQTA 3M1YA 2H3QA 2P6RA 1SL1A 1KKXA 5J0SA 1SB3C 3HP6A 4J03A 2AGOA 9ICRA 3H0LB 4Q44A 1A0PA 3Q8RB 5KG2A 1UCVA 4B9MA 4FZNA 2FI1A 3C21A 4EX6A 3PNCA 5EE9A 1X6IA 2O6KA 4ECSA 3OGUA 1RYRA 5JUMA 4EZ6A 5TISU 5J8YA 2KTQA 2GLEA 2DBYA 5F3XB 4UW9A 2KMDA 3DDHA 3WK6A 3IP4B 1BGXT 2AGPA 3BS5A 1MSWD 1RXVA 4MEXA 2XO7A 4GXKA 3QUBA 4DL6A 1WWVA 1KFDA 4DSLA 3I76A 3GDXA 5AM4A 1A6SA 9ICGA 1ZQZA 7ICQA 5GTIU 2AU0A 3SAHA 4Y2JA 2IOFK 4Q43A 4Y2VA 2WF8A 2HOFA 2PMZC 4RQ1A 3LK9A 1NJXA 4Z6CA 1ZQRA 4C8MA 5ALZA 2D3DA 2Y1JA 4M6WB 4DFDA 8ICVA 3AUOA 4R64A 4RUAA 4TUSA 2BPFA 5AM3A 3K4GA 3D2NA 4A8EA 1TAUA 2BCVA 5KFSA 3AN1A 4RU9A 4RPXA 1L7NA 1SKWA 2FMPA 3OHBA 2HI0A 4NL9C 4YQWA 1ZD3A 5AI6A 4FBTA 4EZ9A 3VCBA 1S8OA 4RT3A 4F4WA 4KLFA 4F5RA 5BPCA 2N1RA 3PMNA 2B21A 3QEBZ 4F5NA 4J9KA 2AGQA 4LVSA 4KLMA 4Q45A 1FFVA 2VJ4A 9ICQA 2KSOB 4QZEA 3V6HA 5A0LA 3B0XA 4AP9A 3NVVA 1YZ6A 4GIBA 7ICMA 9ICWA 5IIOA 2ZXHA 4RPZA 3TFRA 1IXRA 2FLPA 1PUZA 3H7IA 4NY8A 4RZRA 2LKYA 2OYYA 2BDPA 1TE2A 2KHQA 5J2JA 4O3RA 3M9MB 1KQQA 2ZUCA 5DBAA 5ALYA 1WUDA 3IM1A 3C2KA 2GH1A 1SL2A 4QNLA 4F50A 2OXOA 2HHSA 2F1JA 3GU3A 5KFHA 2YX8A 1ZQWA 2ZIWB 8ICXA 2JZBB 2JRZA 1MN8A 2M0NA 3C1ZA 4M9LA 4UBCA 1ZQUA 4R63A 4QZFA 2W55A 4K4HA 1BPYA 1D8LA 4FS2A 3T5JA 4PJ0U 3PW5A 2YN4A 8ICUA 2NYVA 4OJ5A 4K4GA 1L3VA 4NLZA 3RJHA 1KN5A 1QQ5A 2ES6A 2BCRA 1KTQA 2A19A 1QLNA 4ED0A 4O9MA 3ALRA 3QU4A 3N7PD 2YQEA 3EPIA 1QSSA 2KZMA 3PZPA 1JXLA 2XC9A 4UQGA 2H3VA 4BDPA 2AXTU 4ECXA 4UB1A 4OJPA 3DV9A 2PFNA 1PVQA 1WYGA 3E58A 4ED1A 4DQPA 3TKAA 1T94A 2BPGA 4I2IA 2VIXA 5L1MA 5E79U 3Q8QB 4M2YA 4MF8A 4ED8A 4QZDA 1XU4A 3TANA 1ED1A 2K8CB 3C23A 5ALMA 5K4LA 4DO9A 1T3QA 2BZFA 5J0TA 3RJFA 3MR5A 4DLGA 4J9PA 5CJ7A 3NTUA 2NRXA 4E0DA 3OSPA 1Z00B 3BZKA 5KNIA 2FMQA 4YCXA 2ZIVA 3WKDA 2W3RA 2ZIXB 2F8KA 5KFPA 2F1IA 4YR3A 3F5EA 3KTQA 1NZPA 5F9NA 4YMMA 5AKXA 3SAFA 5F9LA 5B5EU 4EBEA 2F77X 3I28A 5KFKA 5DKWA 3F5AA 5G5HA 4DOCA 4Y2SA 1ZJMA 1SKRA 5BOMA 2WF9A 4QZCA 2EZYA 1PZNA 4EELA 3G6YA 5AKLA 1S10A 3WK8A 4EEYA 4QWCA 2DGZA 1U45A 2YTUA 5HMMA 4I2FA 2JR5A 2Y0SC 7ICGA 3G6VA 1Z1VA 5KFJA 4XUSA 3WKAA 4DS4A 4JMUA 1JN3A 7ICIA 4RQ7A 3PR5B 3M8SA 1KFTA 4K4IA 3K1ZA 2G08A 1BPXA 3RB0A 1SGGA 1JI7A 2W04A 5KFVA 1SXDA 3JPQA 2RQ5A 2XCAA 8ICGA 3RJKA 4MEYA 3TADA 5ALVA 5ALQA 4O5CA 1UT8A 4J9NA 5AK5A 9ICUA 3CW2C 1O08A 2M9NA 4GLXA 2DPIA 4QZ9A 1ZQNA 2ZIUA 3HKZF 5KG1A 4IC9A 1QSYA 4C8KA 3EZ5A 3EW9A 1DGSA 2NO5A 3K1RB 4EYHB 4FE3A 4F2RA 3NUQA 4QJFB 4R8UB 2JHDA 5J0OA 3HILA 4OJLA 3V6JA 1ZXIA 5HR6A 1TAQA 4YD2A 1J97A 1DK2A 5T14A 1V85A 1Z19A 5AKHA 1S0OA 3RRHA 4US8A 4UBBA 3JPOA 1BPDA 3BQTA 4YD1A 1MQ2A 1ZQBA 3Q8PB 4IQTA 1XO1A 3D2SA 4O3PA 9ICCA 4DEZA 2UVUA 2H3IA 2CXYA 2VA2A 5C0YA 3PW2A 1RYUA 2W9CA 3UPQA 3H4DA 2Q0ZX 3KZIU 4F5OA 2OWOA 2IA6A 2A3VA 2Q4TA 1SZHA 4BJQA 3RH5A 4I2BA 4QZAA 5KT5A 4LZDA 9ICAA 1VLBA 2PXIA 3KKAC 9ICNA 2CPRA 1DOQA 1AROP 3AU2A 1TK5A 3NRZA 4RNOA 5KAFU 4RQ5A 2EANA 2Y9TA 3GIKA 1TV9A 2KD1A 1K1SA 4YR2A 4G3IA 1JX4A 1ZQPA 3BDPA 2A1JA 5EE0A 2WAQC 2LM1A 5AKIA 3RB4A 8ICHA 3RF9A 1PK1A 3EWAA 2NO4A 2UVWA 4YG2A 3MGIA 4J9MA 1JRPA 3RR8A 2DUYA 1BVSA 2GOLA 2RDIA 1KDHA 2G5HB 2HMXA 2DFLA 4UB4A 1K5OA 1ZD2P 3IRUA 3F2CA 3O0FA 2LHTA 3ISBA 4XQ8A 3PW0A 2HDOA 2KE7A 2K4HA 4J9RA 2RLTA 2KJ5A 5AM5A 2FJ6A 4C4SA 5KG6A 1IM4A 4KMOB 2Y1IA 1Q3UA 4KITB 5KL1B 5J8YC 4LZGA 3KFUF 4Y2QA 1ZQXA 3TI0A 4O3OA 1RDFA 3GIMA 4KLTA 1NJYA 2NRWA 3T5KA 5DB9A 3UMBA 1URJA 2KEYA 5ALHA 1B22A 2BPCA 5KG4A 3MBYA 1CI4A 4B9LA 2BCSA 4KMUA 8ICPA 5KFNA 4TQRA 1LVHA 2AJQA 4UB3A 3ED5A 1ZQ1C 2HVIA 2A1AA 3RB3A 4EEKA 4UAYA 2VJ5A 2ZTEA 4M04A 2KVSA 3GV7B 2RP5A 5ALPA 2WB1F 2W11A 3SD7A 2W9MA 5EE1A 1S9FA 2E8NA 5L1IA 9ICHA 2G09A 4NM1A 3WK4A 2G5IB 8ICRA 5J0QA 4UB5A 1AQ6A 4R66A 1N2XA 3EUB2 4UB6U 1L8LA 4X5VA 4C8LA 2W3SA 2JH7A 2KK0A 1RG6A 3ZD8A 2YMPA 2DL0A 4I2JA 3U26A 5DBCA 3F53A 4CCHA 3MFHA 4F2SA 2K89A 3H8MA 5HR7A 3QEAZ 1QH9A 2HHXA 4BXOB 4FFDA 7ICLA 4JWNA 2W54A 3N7SC 4IRDA 4TUPA 3PY8A 4ECZA 2XY7A 5JTIA 4P0PA 3PX0A 2KZ3A 1SZPA 7ICOA 3F2BA 8ICLA 5KFOA 3HJEA 2E5SA 3OTQA 8ICEA 3T3FA 5J2AA 7ICNA 4HYKA 5AICA 4CDGA 5HNKA 5AI0A 4C80A 2H5XA 2IMWP 1V97A 5AI9A 1XSLA 1CRXA 1M6YA 5AK6A 3V7JA 4B9VA 2FMSA 8ICAA 3CP8A 3CYMA 4AYBC 1P7DA 1TAMA 3D2QA 4Y2XA 1T4GA 1XSPA 3SV3A 2QB0B 4OO1J 2NV3A 1ZQDA 1NK9A 1Q3VA 1XSNA 2PFOA 2KP7A 1UA0A 3HWTA 2HOQA 3Q8SB 1X9WA 2W03A 4BWJA 4ECQA 1PK3A 1J2MA 5B66U 1SV0A 3IV6A 1COOA 3JPTA 1RQNA 5L1LA 5ALOA 5KT2A 4YXJA 3B0YA 2ZJ8A 4I29A 4I2HA 2K4IA 2KZZA 1SV4A 5J2FA 3BQ0A 2W7OA 4NXZA 4F92B 4RUCA 2ODGA 3ETRA 2A1JB 2BR0A 3PSPA 2ZJAA 1RYSA 1V9PA 7ICEA 1NZBA 2HBJA 3KD3A 1Z3EB 4ECRA 3N97B 3DEEA 5KG3A 5TZVA 5IINA 3C2LA 2ZUDA 1HEKA 2LM4A 5AKKA 3LVWA 2E8OA 1ZQQA 5KFFA 4ELVA 4PHPA 1PVPA 3TQ1A 3BJYA 5KT7A 1T8EA 4I27A 2ISOA 2JEGA 2ZJ5A 3LDAA 3QE9Y 1JMSA 1NK5A 2ASJA 1ZQGA 4QZBA 5J2CA 3GV8B 2ASDA 5J0XA 4DFPA 8ICTA 1DGJA 1PVRA 4FO6A 4M9GA 2KOBA 2K8BB 3QYPA 2EAPA 2KNJA 3IG5A 9ICOA 1KSPA 3KHLA 3QU5A 4YR0A 4F71A 4KLSA 5AKEA 2DPJA 1L7OA 1Z4NA 5ALIA 2ASLA 3VC8A 4F5PA 1L5UA 5DGBA 5CEHA 4C0ZA 1ZQSA 1VJ5A 1WCLA 5H2FU 1HUZA 4UARA 4Q8FA 5IILA 3GIIA 2LYBA 1JUDA 1LKYB 2HHWA 2HBKA 2KG5A 5ALGA 2R8HA 1UA1A 1UT5A 2DQNB 5KFGA 2PI4A 3WK5A 3SAGA 3TADC 2WHEA 3AEVA 4DWIA 4KLDA 4I2CA 3RH4A 2H3ZA 4I2GA 5JRTA 4NLCA 4DSKA 1MA7A 4UASA 2W9BA 3G6XA 4PHDA 2PMZF 2WF5A 2JH1A 5DLGA 3CNHA 8ICFA 5J0WA 3QU2A 2DF4B 1L3SA 3T5HA 4C8OA 9ICXA 5KFMA 4KX5A 3EYZA 4M9NA 5IIJA 3PX6A 1D9DA 1VDVA 2XVTA 3B9JA 5D49A 1S97A 4C7YA 3TARA 2DKZA 3FYHA 4EBCA 1ZQLA 3BS5B 2R8GA 1X66A 8ICJA 1D8YA 4QWDA 2K4EA 3GFKB 9ICTA 1NK4A 3M6KA 1ZQKA 2AH5A 2KJ8A 3ZD9A 2ZXIA 3HX0A 4M9JA 5CHGA 4MFFA 4Y2PA 4F4YA 2HCFA 5D4BA 5KFIA 1U4BA 2FPMA 3A0BU 2YB1A 4RNMA 4G9BA 4RQ3A 4JWMA 3LWLA 4QW8A 3PO4A 1S5LU 4DL3A 1QQ6A 5DG8A 4NLKA 3R9KA 4DL5A 9ICEA 3KOOA 1N56A 3ZDDA 4U6PA 1NK7A 1WCNA 4C4TA 3HRDD 4RQ8A 1U48A 2KIVA 5BOLA 4Y2YA 1S0VA 4GFJA 4DSIA 3QZ7A 2W8LA 7ICPA 5AI5A 3MR2A 3BS7A 4DL2A 1ZQHA 1S0NA 4B9UA 2P66A 4P4MA 2KKPA 1NKBA 4O3QA 4DLEA 2WF7A 1LV5A 2R8KA 2C2DA 2E1EA 3C1YA 2V9WA 4NV0A 2FE9A 2ZTCA 3ORYA 2QARA 5AK4A 5ALWA 3TACB 2MUTA 2VA3A 2PI5A 9ICJA 5KL8B 2AQ4A 2GWSA 4JUZA 2HVHA 4RQ2A 4EX7A 2G0AA 4RNNA 4MFAA 1L6NA 8ICOA 3RJGA 4B6JA 4IS7A 5HMLA 3MGVA 5KFQA 3LYSA 2LYHA 3KBBA 4UAZA 1J2NA 3MR3A 1L7MA 1GO3F 4F4ZA 2LI6A 4F5QA 2C2EA 3NS1A 1OXJA 1ZQOA 5DDYA 5ALTA 1Z4OA 3M9OB 3WKBA 3V7KA 5L1KA 4QZGA 1ZQFA 3N28A 3TAQA 8ICZA 5ALNA 1YT3A 2J6SA 4O0IA 1ZRMA 2AQ0A 1ZD5A 2F3NA 2F8LA 3ETLA 1N61A 4KLJA 5KFLA 4RPYA 5L1JA 2V4RA 4DQQA 5ALLA 3E0FA 3JPRA 3AMZA 1Z1BA 5IIMA 4MFCA 4DS5A 5C5JA 2YMQA 5ALDA 2KFNA 3GZFA 4FZMA 1ZETA 1KBUA 2IHNA 3NVYA 5DB8A 2KV2A 3RRGA 2JV3A 1BNOA 1L7PA 4NWIA 3AU6A 4YVZA 4PL2A 4IRKA 3LVVA 8ICNA 3ISDA 2W8KA 3H8JA 2GO7A 1ZRNA 2JXJA 2BCQA 3RBDA 2MRLA 5DBBA 9ICIA 2UVRA 4KLGA 4Z6EA 1BPBA 3PSTA 1SXEA 5IIKA 2DWQA 4KLQA 2KFZA 3MGHA 3SENA 1XO0A 2Y0SF 4P4OA 3RBEA 3PR4A 5KFXA 4CF3A 1T3NA 2RHFA 1XNSA 5KT4A 1TK0A 2UVVA 2C2RA 5J2HA 1HUOA 2D6FC 2FLLA 5EWFA 2CRXA 4UAUA 3JPPA 3RAXA 4OCZA 3FDSA 1ZQAA 4GC6A 2ZIVB 1SL0A 4RT2A 1UPHA 4PL1A 5J2GA 2KSOA 5KFBA 4J9LA 3ZDCA 1KLNA 3NASA 3N4MB 3ISCA 4Q8EA 8ICMA 3NRWA 5CRXA 5KFTA 5KG0A 3C29A 2K8AA 1X6JA 3WKCA 2R18A 4IR1A 3OSNA 1SV0C 4XRHA 4IQWA 5AM2A 3QU7A 4JV0A 2KN7A 2KVCA 1A77A 1N5WA 4QZ8A 1B0XA 4KN7A 7ICUA 2F1HA 2BQ3A 4R65A 3A0HU 4O5KA 5KT6A 3SEIA 3OPXA 2EZXA 3M9NB 2JZBA 1X40A 2XCPA 2KICA 3HPOA 2KKVA 3GIJA 3I1YA 1NJWA 5KFYA 3AQFA 4TUQA 4BX9C 1QTMA 2G06A 2ZIUB 4C7ZA 3T5LA 3HW8A 2IHMA 5CP2A 5KFRA 4ED7A 4IQVA 4YP3A 2QARB 5DB6A 2MUTB 8ICKA 5HHIA 1RPLA 4O3SA 1B43A 1SKSA 5J29A 2KHVA 4TURA 4ECYA 1NK8A 1D8BA 1ZQEA 5AI4A 1Y88A 3UQ2A 1X9XA 5GTHU 5J0YA 4F72A 2HBMA 2NRVA 3RAQA 2FPLA 4I2DA 4DQSA 2K60A 5KFUA 5DG7A 2WAQF 3PX4A 1WWUA 2BHNA 9ICBA
chains in the Genus database with same CATH topology
2E8NA 2EAMA 1PK3A 3KKAC 2F3NA 1SV0A 5JU5A 1OW5A 1SGGA 2F44A 4RQMA 2LPEA 1JI7A 2EANA 2Y9TA 1SXDA 1LKYB 1SV4A 3TADA 1RG6A 1SV0C 2KG5A 2DL0A 1PK1A 2KSOB 3H8MA 3BQ7A 2E8MA 1B0XA 3TADC 2QKQA 1UCVA 2Y9UA 5L1MA 2ESEA 2KIVA 2JV3A 2DKXA 2L5YA 2E8OA 4RQNA 3K1RB 3BS7A 3SEIA 5JRTA 5JTIA 5J8YA 2GLEA 2B6GA 1F0MA 2KE7A 2E8PA 5F3XB 1X40A 2KMDA 3HILA 1COKA 3BS5A 2QB0A 1V85A 1PK1B 1WWVA 2D8CA 5KNIA 3IDWA 2FE9A 5J8YC 2K4PA 2QARA 1SXEA 3TACB 1UQVA 1V38A 1B4FA 2QARB 2F8KA 4MHVA 1KW4A 3SENA 2EAPA 2QB1A 1X9XA 4IS7A 2DKZA 2D3DA 4PZNA 3BS5B 1X66A 1LKYA 2QB0B 4NL9A 4PZOA 1OXJA 2LMRA 2K60A 3KKAA 4NJ8A 2YTUA 1DXSA 1WWUA 2KSOA 1Z1VA 2EAOA 4NL9C 2ES6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8N A;  2EAM A;  1PK3 A;  3KKA C;  2F3N A;  1SV0 A;  5JU5 A;  1OW5 A;  1SGG A;  2F44 A;  4RQM A;  2LPE A;  1JI7 A;  2EAN A;  2Y9T A;  1SXD A;  1LKY B;  1SV4 A;  3TAD A;  1RG6 A;  1SV0 C;  2KG5 A;  2DL0 A;  1PK1 A;  2KSO B;  3H8M A;  3BQ7 A;  2E8M A;  1B0X A;  3TAD C;  2QKQ A;  1UCV A;  2Y9U A;  5L1M A;  2ESE A;  2KIV A;  2JV3 A;  2DKX A;  2L5Y A;  2E8O A;  4RQN A;  3K1R B;  3BS7 A;  3SEI A;  5JRT A;  5JTI A;  5J8Y A;  2GLE A;  2B6G A;  1F0M A;  2KE7 A;  2E8P A;  5F3X B;  1X40 A;  2KMD A;  3HIL A;  1COK A;  3BS5 A;  2QB0 A;  1V85 A;  1PK1 B;  1WWV A;  2D8C A;  5KNI A;  3IDW A;  2FE9 A;  5J8Y C;  2K4P A;  2QAR A;  1SXE A;  3TAC B;  1UQV A;  1V38 A;  1B4F A;  2QAR B;  2F8K A;  4MHV A;  1KW4 A;  3SEN A;  2EAP A;  2QB1 A;  1X9X A;  4IS7 A;  2DKZ A;  2D3D A;  4PZN A;  3BS5 B;  1X66 A;  1LKY A;  2QB0 B;  4NL9 A;  4PZO A;  1OXJ A;  2LMR A;  2K60 A;  3KKA A;  4NJ8 A;  2YTU A;  1DXS A;  1WWU A;  2KSO A;  1Z1V A;  2EAO A;  4NL9 C;  2ES6 A; 
#chains in the Genus database with same CATH topology
 2ALZ A;  2AHO B;  3RFA A;  4EEN A;  3PW4 A;  5AI8 A;  4QZH A;  2W9C B;  3SI8 A;  8ICY A;  2XGP A;  3D6J A;  5J0U A;  3PML A;  4B9N A;  4OJ6 A;  3IHQ B;  5KFW A;  3FC4 A;  4J9O A;  4DFK A;  1SWW A;  2HBL A;  1KRP A;  4DL4 A;  4XA5 A;  4ACO A;  2JMG A;  4ZH4 A;  1Z00 A;  2IOH A;  3QNM A;  2JGA A;  3WU2 U;  2E8M A;  3AQE A;  3QUC A;  4LJX A;  2ZIX A;  2FLN A;  4CF5 A;  1ZQV A;  4DF8 A;  4FZL A;  1H38 A;  2H3F A;  4JB3 A;  3FAH A;  5III A;  2ZUB A;  4F4K A;  1DRG A;  2F2A B;  3MC1 A;  2B6G A;  3MR6 A;  8ICQ A;  2E8P A;  1X9S A;  3EPG A;  5EWE A;  4KLO A;  2J6T A;  5EWG A;  3L5K A;  1PK1 B;  3NVZ A;  2YB4 A;  2D8C A;  1ZQC A;  3IDW A;  2HHT A;  2YY6 A;  5HHH A;  2K4P A;  3PSF A;  4ED2 A;  4EBD A;  2VA8 A;  3IN5 A;  1KW4 A;  1KFS A;  4I28 A;  4DSJ A;  3ZDB A;  5ALU A;  2F76 X;  1C20 A;  5J2I A;  9ICK A;  1JRO A;  4ZOH C;  4DQR A;  4PH5 A;  4PZN A;  3M8R A;  1NKE A;  3N7R C;  4PZO A;  5AK3 A;  5KG7 A;  4QW9 A;  3MFI A;  8ICB A;  3NVW A;  3PO5 A;  2P6U A;  2LYA A;  3KHH A;  4ECU A;  4KLI A;  8ICI A;  4UAT A;  4WJ3 B;  2EAO A;  4DSF A;  1X42 A;  4USA A;  3PW7 A;  4ECV A;  4ELU A;  2MA1 A;  1XC9 A;  4CNQ A;  5JU5 A;  5HP4 A;  1C7Y A;  3JPN A;  1L3T A;  4RQM A;  2BQU A;  1N5X A;  4PPX A;  4GC7 A;  2MAX A;  9ICM A;  1HJP A;  2HHV A;  4IQU A;  1L3U A;  1XS9 D;  4R8U A;  2RDJ A;  5AKJ A;  5ALF A;  1T7P A;  4YMO A;  4DL7 A;  5AKG A;  3GV5 B;  1NKC A;  2WTF A;  1QQ7 A;  4DF4 A;  3OJS A;  2BQR A;  3ZDE A;  2HHU A;  3KHG A;  3QX7 A;  2RRD A;  2B0C A;  3UMC A;  4RQ6 A;  4O3N A;  2OM6 A;  5CB1 A;  2XY6 A;  4M47 A;  1HIW A;  5ALR A;  4JV1 A;  3SV4 A;  5CA7 A;  5DG9 A;  2YMM A;  3SMV A;  4F4X A;  3RB6 A;  3S6J A;  4UAV A;  4ED6 A;  4I2A A;  5KG5 A;  5DLF A;  1BNP A;  4AYB F;  3HKZ C;  1X2I A;  4PHA A;  2HSZ A;  1KL9 A;  4IRC A;  4F91 B;  4TQS A;  1X9M A;  1K1Q A;  4JV2 A;  2I5H A;  5DQI A;  4F3O A;  3H8W A;  5J0R A;  4GXI A;  2QB1 A;  4P0P B;  4GXJ A;  4KLL A;  3RH6 A;  3ONN A;  1IG6 A;  3Q8K A;  4HAI A;  4C4R A;  1ZQI A;  4ED3 A;  4NL9 A;  1RQL A;  9ICL A;  3SR6 A;  3QU9 A;  3QUQ A;  3H0M B;  5J2E A;  5DQH A;  2W7P A;  2WF6 A;  3T79 A;  3HT3 A;  1TKD A;  1UHU A;  3RTV A;  4Z6F A;  4B9S A;  1RXW A;  3LWM A;  2JEJ A;  4MF2 A;  1U49 A;  4YMN A;  1OW5 A;  3SZ2 A;  2IBK A;  3J81 j;  4UB8 U;  5DB7 A;  3BQ1 A;  3ICX A;  4BUG A;  3UM9 A;  2G07 A;  2R8I A;  2PFQ A;  3MDC A;  5J2K A;  4YN4 A;  4QWE A;  4F8R A;  2CN1 A;  5ALE A;  2XGQ A;  1Q8K A;  4PGQ A;  1CEZ A;  3UQ0 A;  4Y2U A;  4DOB A;  1N60 A;  3SYZ A;  3BQ7 A;  3FM9 A;  5KFA A;  2Y9U A;  3MAB A;  5EOZ A;  4KTQ A;  1TK8 A;  7ICT A;  1ZOL A;  2DKX A;  2L5Y A;  3BQ2 A;  3Q8L A;  4BWM A;  2EQY A;  5L9X A;  5KT3 A;  3V7L A;  2WFA A;  1YZ7 A;  2E3T A;  3QXG A;  3IG8 A;  2PFP A;  2VAN A;  2JEI A;  3M7D A;  4CE6 A;  2IOF A;  2KIW A;  1UQV A;  1V38 A;  4QWB A;  1B4F A;  1ZYQ A;  2Z7J A;  5AKY A;  2FDR A;  5ALJ A;  2ZTD A;  5KFZ A;  3M6Z A;  4ECW A;  5AIB A;  5J0P A;  8ICW A;  1F5S A;  5AHX A;  5AKZ A;  1D9F A;  2LMR A;  4YFK A;  2I6X A;  4NJ8 A;  5ALK A;  2MU2 A;  3GIL A;  1RZT A;  3NGD A;  4IR9 A;  4JK1 A;  4DFM A;  4Y2R A;  4US9 A;  4BXO A;  2EAM A;  1QSL A;  4YXM A;  1N63 A;  2KJ9 A;  4QIW C;  4P0Q A;  4DSE A;  5EE3 A;  2HHQ A;  2W9A A;  2JEF A;  2I9G A;  3WK7 A;  1KEJ A;  4C8N A;  4J9S A;  4RQ4 A;  2BDU A;  1IIP A;  4PGY A;  4ICA A;  4ECT A;  7ICH A;  2WB1 C;  3H0R B;  1ZQJ A;  2R8J A;  4I2E A;  1BPE A;  3C5F A;  1JAL A;  3L3F X;  3ZDA A;  1ZQY A;  4KLU A;  4UAW A;  1FFU A;  4OD0 A;  4RQN A;  3V6K A;  5G5G A;  2BCU A;  4RQ0 A;  3THV A;  5DQG A;  1NJZ A;  2HW3 A;  5CR0 A;  1F0M A;  3PVX A;  3KZX A;  5D46 A;  3WK9 A;  1ECW A;  3TAP A;  1NK6 A;  1JXE A;  2PKE A;  2QB0 A;  4B9T A;  2ZG6 A;  2BKE A;  4PHE A;  3TFS A;  9ICS A;  4NLG A;  1N62 A;  4BGD A;  5DGA A;  1ZJN A;  1NI3 A;  1U9L A;  1LB2 B;  2QLT A;  4KN4 A;  1NK0 A;  2LBO A;  3UXP A;  3Q8M A;  4OJO A;  8ICS A;  4FBU A;  3QZ8 A;  4J9Q A;  4DQI A;  4M6W A;  3BZC A;  2W9B B;  1S76 D;  2BGW A;  1QCK A;  4KLE A;  8ICC A;  1OUQ A;  3RJJ A;  5KFD A;  4FS1 A;  1N48 A;  5ALX A;  2I1Q A;  1ZQM A;  3L4P A;  4O5E A;  2HOI A;  5AM1 A;  1DXS A;  4CGZ A;  5KFE A;  1MC8 A;  5FP0 A;  1TFR A;  3CRX A;  1MQ3 A;  2NRT A;  1NNL A;  3UMG A;  3AM9 A;  2EH9 A;  2C22 A;  2J6U A;  5DDM A;  7ICK A;  4P4P A;  3SQI A;  4NLN A;  7ICF A;  7ICV A;  4QZI A;  1NOM A;  2XIC A;  3RJE A;  7ICJ A;  3AL0 B;  3H4B A;  2C28 A;  1SIJ A;  2E1F A;  1WG8 A;  5KTQ A;  1A76 A;  5KFC A;  7ICR A;  3K75 D;  4ELT A;  1S77 D;  3C28 A;  3H40 A;  3OHA A;  3V72 A;  1U47 A;  1JIH A;  4UB2 A;  4DOA A;  9ICV A;  2QKQ A;  4CRX A;  2ESE A;  4DFJ A;  2YML A;  4U7C A;  1O03 A;  4QWA A;  3JPS A;  5AM0 A;  3C2M A;  3RJI A;  4O3M A;  2NRZ A;  2VKQ A;  2W43 A;  5CWR A;  1BPZ A;  3PV8 A;  1FIQ A;  3KHR A;  3UXN A;  9ICF A;  1COK A;  1SWV A;  3H8S A;  4QIW F;  5J2B A;  1ZD4 A;  2XY5 A;  2EZZ A;  5J2D A;  1XWL A;  4MHV A;  2MSN A;  4EYI B;  4KX3 A;  5AIA A;  1EXN A;  2ZIW A;  2FPK A;  4CF4 A;  3RR7 A;  1CUK A;  3GQC A;  4NLB A;  1TVA A;  5KAI U;  4IL6 U;  4F93 B;  4Z6D A;  4NM2 A;  4PGX A;  4DCC A;  3QUT A;  3F2D A;  4M9H A;  2ISP A;  1DK3 A;  3E2E A;  1LKY A;  3C5G A;  2OH2 A;  4P2H A;  3KKA A;  5ALS A;  4Y2T A;  3ZI4 A;  2XID A;  1RM6 C;  3MDA A;  1FEZ A;  7ICS A;  3PSI A;  1S0M A;  4M0A A;  2P35 A;  2XI9 A;  2V4Q A;  1L8O A;  4KLH A;  2OCE A;  9ICP A;  1IV8 A;  3WKE A;  1FO4 A;  2OHF A;  2F44 A;  1Q46 A;  1F44 A;  2LPE A;  3OJU A;  4P0Q B;  3UXO A;  2ATL A;  2OEH A;  2EDU A;  1ZQT A;  3M1Y A;  2H3Q A;  2P6R A;  1SL1 A;  1KKX A;  5J0S A;  1SB3 C;  3HP6 A;  4J03 A;  2AGO A;  9ICR A;  3H0L B;  4Q44 A;  1A0P A;  3Q8R B;  5KG2 A;  1UCV A;  4B9M A;  4FZN A;  2FI1 A;  3C21 A;  4EX6 A;  3PNC A;  5EE9 A;  1X6I A;  2O6K A;  4ECS A;  3OGU A;  1RYR A;  5JUM A;  4EZ6 A;  5TIS U;  5J8Y A;  2KTQ A;  2GLE A;  2DBY A;  5F3X B;  4UW9 A;  2KMD A;  3DDH A;  3WK6 A;  3IP4 B;  1BGX T;  2AGP A;  3BS5 A;  1MSW D;  1RXV A;  4MEX A;  2XO7 A;  4GXK A;  3QUB A;  4DL6 A;  1WWV A;  1KFD A;  4DSL A;  3I76 A;  3GDX A;  5AM4 A;  1A6S A;  9ICG A;  1ZQZ A;  7ICQ A;  5GTI U;  2AU0 A;  3SAH A;  4Y2J A;  2IOF K;  4Q43 A;  4Y2V A;  2WF8 A;  2HOF A;  2PMZ C;  4RQ1 A;  3LK9 A;  1NJX A;  4Z6C A;  1ZQR A;  4C8M A;  5ALZ A;  2D3D A;  2Y1J A;  4M6W B;  4DFD A;  8ICV A;  3AUO A;  4R64 A;  4RUA A;  4TUS A;  2BPF A;  5AM3 A;  3K4G A;  3D2N A;  4A8E A;  1TAU A;  2BCV A;  5KFS A;  3AN1 A;  4RU9 A;  4RPX A;  1L7N A;  1SKW A;  2FMP A;  3OHB A;  2HI0 A;  4NL9 C;  4YQW A;  1ZD3 A;  5AI6 A;  4FBT A;  4EZ9 A;  3VCB A;  1S8O A;  4RT3 A;  4F4W A;  4KLF A;  4F5R A;  5BPC A;  2N1R A;  3PMN A;  2B21 A;  3QEB Z;  4F5N A;  4J9K A;  2AGQ A;  4LVS A;  4KLM A;  4Q45 A;  1FFV A;  2VJ4 A;  9ICQ A;  2KSO B;  4QZE A;  3V6H A;  5A0L A;  3B0X A;  4AP9 A;  3NVV A;  1YZ6 A;  4GIB A;  7ICM A;  9ICW A;  5IIO A;  2ZXH A;  4RPZ A;  3TFR A;  1IXR A;  2FLP A;  1PUZ A;  3H7I A;  4NY8 A;  4RZR A;  2LKY A;  2OYY A;  2BDP A;  1TE2 A;  2KHQ A;  5J2J A;  4O3R A;  3M9M B;  1KQQ A;  2ZUC A;  5DBA A;  5ALY A;  1WUD A;  3IM1 A;  3C2K A;  2GH1 A;  1SL2 A;  4QNL A;  4F50 A;  2OXO A;  2HHS A;  2F1J A;  3GU3 A;  5KFH A;  2YX8 A;  1ZQW A;  2ZIW B;  8ICX A;  2JZB B;  2JRZ A;  1MN8 A;  2M0N A;  3C1Z A;  4M9L A;  4UBC A;  1ZQU A;  4R63 A;  4QZF A;  2W55 A;  4K4H A;  1BPY A;  1D8L A;  4FS2 A;  3T5J A;  4PJ0 U;  3PW5 A;  2YN4 A;  8ICU A;  2NYV A;  4OJ5 A;  4K4G A;  1L3V A;  4NLZ A;  3RJH A;  1KN5 A;  1QQ5 A;  2ES6 A;  2BCR A;  1KTQ A;  2A19 A;  1QLN A;  4ED0 A;  4O9M A;  3ALR A;  3QU4 A;  3N7P D;  2YQE A;  3EPI A;  1QSS A;  2KZM A;  3PZP A;  1JXL A;  2XC9 A;  4UQG A;  2H3V A;  4BDP A;  2AXT U;  4ECX A;  4UB1 A;  4OJP A;  3DV9 A;  2PFN A;  1PVQ A;  1WYG A;  3E58 A;  4ED1 A;  4DQP A;  3TKA A;  1T94 A;  2BPG A;  4I2I A;  2VIX A;  5L1M A;  5E79 U;  3Q8Q B;  4M2Y A;  4MF8 A;  4ED8 A;  4QZD A;  1XU4 A;  3TAN A;  1ED1 A;  2K8C B;  3C23 A;  5ALM A;  5K4L A;  4DO9 A;  1T3Q A;  2BZF A;  5J0T A;  3RJF A;  3MR5 A;  4DLG A;  4J9P A;  5CJ7 A;  3NTU A;  2NRX A;  4E0D A;  3OSP A;  1Z00 B;  3BZK A;  5KNI A;  2FMQ A;  4YCX A;  2ZIV A;  3WKD A;  2W3R A;  2ZIX B;  2F8K A;  5KFP A;  2F1I A;  4YR3 A;  3F5E A;  3KTQ A;  1NZP A;  5F9N A;  4YMM A;  5AKX A;  3SAF A;  5F9L A;  5B5E U;  4EBE A;  2F77 X;  3I28 A;  5KFK A;  5DKW A;  3F5A A;  5G5H A;  4DOC A;  4Y2S A;  1ZJM A;  1SKR A;  5BOM A;  2WF9 A;  4QZC A;  2EZY A;  1PZN A;  4EEL A;  3G6Y A;  5AKL A;  1S10 A;  3WK8 A;  4EEY A;  4QWC A;  2DGZ A;  1U45 A;  2YTU A;  5HMM A;  4I2F A;  2JR5 A;  2Y0S C;  7ICG A;  3G6V A;  1Z1V A;  5KFJ A;  4XUS A;  3WKA A;  4DS4 A;  4JMU A;  1JN3 A;  7ICI A;  4RQ7 A;  3PR5 B;  3M8S A;  1KFT A;  4K4I A;  3K1Z A;  2G08 A;  1BPX A;  3RB0 A;  1SGG A;  1JI7 A;  2W04 A;  5KFV A;  1SXD A;  3JPQ A;  2RQ5 A;  2XCA A;  8ICG A;  3RJK A;  4MEY A;  3TAD A;  5ALV A;  5ALQ A;  4O5C A;  1UT8 A;  4J9N A;  5AK5 A;  9ICU A;  3CW2 C;  1O08 A;  2M9N A;  4GLX A;  2DPI A;  4QZ9 A;  1ZQN A;  2ZIU A;  3HKZ F;  5KG1 A;  4IC9 A;  1QSY A;  4C8K A;  3EZ5 A;  3EW9 A;  1DGS A;  2NO5 A;  3K1R B;  4EYH B;  4FE3 A;  4F2R A;  3NUQ A;  4QJF B;  4R8U B;  2JHD A;  5J0O A;  3HIL A;  4OJL A;  3V6J A;  1ZXI A;  5HR6 A;  1TAQ A;  4YD2 A;  1J97 A;  1DK2 A;  5T14 A;  1V85 A;  1Z19 A;  5AKH A;  1S0O A;  3RRH A;  4US8 A;  4UBB A;  3JPO A;  1BPD A;  3BQT A;  4YD1 A;  1MQ2 A;  1ZQB A;  3Q8P B;  4IQT A;  1XO1 A;  3D2S A;  4O3P A;  9ICC A;  4DEZ A;  2UVU A;  2H3I A;  2CXY A;  2VA2 A;  5C0Y A;  3PW2 A;  1RYU A;  2W9C A;  3UPQ A;  3H4D A;  2Q0Z X;  3KZI U;  4F5O A;  2OWO A;  2IA6 A;  2A3V A;  2Q4T A;  1SZH A;  4BJQ A;  3RH5 A;  4I2B A;  4QZA A;  5KT5 A;  4LZD A;  9ICA A;  1VLB A;  2PXI A;  3KKA C;  9ICN A;  2CPR A;  1DOQ A;  1ARO P;  3AU2 A;  1TK5 A;  3NRZ A;  4RNO A;  5KAF U;  4RQ5 A;  2EAN A;  2Y9T A;  3GIK A;  1TV9 A;  2KD1 A;  1K1S A;  4YR2 A;  4G3I A;  1JX4 A;  1ZQP A;  3BDP A;  2A1J A;  5EE0 A;  2WAQ C;  2LM1 A;  5AKI A;  3RB4 A;  8ICH A;  3RF9 A;  1PK1 A;  3EWA A;  2NO4 A;  2UVW A;  4YG2 A;  3MGI A;  4J9M A;  1JRP A;  3RR8 A;  2DUY A;  1BVS A;  2GOL A;  2RDI A;  1KDH A;  2G5H B;  2HMX A;  2DFL A;  4UB4 A;  1K5O A;  1ZD2 P;  3IRU A;  3F2C A;  3O0F A;  2LHT A;  3ISB A;  4XQ8 A;  3PW0 A;  2HDO A;  2KE7 A;  2K4H A;  4J9R A;  2RLT A;  2KJ5 A;  5AM5 A;  2FJ6 A;  4C4S A;  5KG6 A;  1IM4 A;  4KMO B;  2Y1I A;  1Q3U A;  4KIT B;  5KL1 B;  5J8Y C;  4LZG A;  3KFU F;  4Y2Q A;  1ZQX A;  3TI0 A;  4O3O A;  1RDF A;  3GIM A;  4KLT A;  1NJY A;  2NRW A;  3T5K A;  5DB9 A;  3UMB A;  1URJ A;  2KEY A;  5ALH A;  1B22 A;  2BPC A;  5KG4 A;  3MBY A;  1CI4 A;  4B9L A;  2BCS A;  4KMU A;  8ICP A;  5KFN A;  4TQR A;  1LVH A;  2AJQ A;  4UB3 A;  3ED5 A;  1ZQ1 C;  2HVI A;  2A1A A;  3RB3 A;  4EEK A;  4UAY A;  2VJ5 A;  2ZTE A;  4M04 A;  2KVS A;  3GV7 B;  2RP5 A;  5ALP A;  2WB1 F;  2W11 A;  3SD7 A;  2W9M A;  5EE1 A;  1S9F A;  2E8N A;  5L1I A;  9ICH A;  2G09 A;  4NM1 A;  3WK4 A;  2G5I B;  8ICR A;  5J0Q A;  4UB5 A;  1AQ6 A;  4R66 A;  1N2X A;  3EUB 2;  4UB6 U;  1L8L A;  4X5V A;  4C8L A;  2W3S A;  2JH7 A;  2KK0 A;  1RG6 A;  3ZD8 A;  2YMP A;  2DL0 A;  4I2J A;  3U26 A;  5DBC A;  3F53 A;  4CCH A;  3MFH A;  4F2S A;  2K89 A;  3H8M A;  5HR7 A;  3QEA Z;  1QH9 A;  2HHX A;  4BXO B;  4FFD A;  7ICL A;  4JWN A;  2W54 A;  3N7S C;  4IRD A;  4TUP A;  3PY8 A;  4ECZ A;  2XY7 A;  5JTI A;  4P0P A;  3PX0 A;  2KZ3 A;  1SZP A;  7ICO A;  3F2B A;  8ICL A;  5KFO A;  3HJE A;  2E5S A;  3OTQ A;  8ICE A;  3T3F A;  5J2A A;  7ICN A;  4HYK A;  5AIC A;  4CDG A;  5HNK A;  5AI0 A;  4C80 A;  2H5X A;  2IMW P;  1V97 A;  5AI9 A;  1XSL A;  1CRX A;  1M6Y A;  5AK6 A;  3V7J A;  4B9V A;  2FMS A;  8ICA A;  3CP8 A;  3CYM A;  4AYB C;  1P7D A;  1TAM A;  3D2Q A;  4Y2X A;  1T4G A;  1XSP A;  3SV3 A;  2QB0 B;  4OO1 J;  2NV3 A;  1ZQD A;  1NK9 A;  1Q3V A;  1XSN A;  2PFO A;  2KP7 A;  1UA0 A;  3HWT A;  2HOQ A;  3Q8S B;  1X9W A;  2W03 A;  4BWJ A;  4ECQ A;  1PK3 A;  1J2M A;  5B66 U;  1SV0 A;  3IV6 A;  1COO A;  3JPT A;  1RQN A;  5L1L A;  5ALO A;  5KT2 A;  4YXJ A;  3B0Y A;  2ZJ8 A;  4I29 A;  4I2H A;  2K4I A;  2KZZ A;  1SV4 A;  5J2F A;  3BQ0 A;  2W7O A;  4NXZ A;  4F92 B;  4RUC A;  2ODG A;  3ETR A;  2A1J B;  2BR0 A;  3PSP A;  2ZJA A;  1RYS A;  1V9P A;  7ICE A;  1NZB A;  2HBJ A;  3KD3 A;  1Z3E B;  4ECR A;  3N97 B;  3DEE A;  5KG3 A;  5TZV A;  5IIN A;  3C2L A;  2ZUD A;  1HEK A;  2LM4 A;  5AKK A;  3LVW A;  2E8O A;  1ZQQ A;  5KFF A;  4ELV A;  4PHP A;  1PVP A;  3TQ1 A;  3BJY A;  5KT7 A;  1T8E A;  4I27 A;  2ISO A;  2JEG A;  2ZJ5 A;  3LDA A;  3QE9 Y;  1JMS A;  1NK5 A;  2ASJ A;  1ZQG A;  4QZB A;  5J2C A;  3GV8 B;  2ASD A;  5J0X A;  4DFP A;  8ICT A;  1DGJ A;  1PVR A;  4FO6 A;  4M9G A;  2KOB A;  2K8B B;  3QYP A;  2EAP A;  2KNJ A;  3IG5 A;  9ICO A;  1KSP A;  3KHL A;  3QU5 A;  4YR0 A;  4F71 A;  4KLS A;  5AKE A;  2DPJ A;  1L7O A;  1Z4N A;  5ALI A;  2ASL A;  3VC8 A;  4F5P A;  1L5U A;  5DGB A;  5CEH A;  4C0Z A;  1ZQS A;  1VJ5 A;  1WCL A;  5H2F U;  1HUZ A;  4UAR A;  4Q8F A;  5IIL A;  3GII A;  2LYB A;  1JUD A;  1LKY B;  2HHW A;  2HBK A;  2KG5 A;  5ALG A;  2R8H A;  1UA1 A;  1UT5 A;  2DQN B;  5KFG A;  2PI4 A;  3WK5 A;  3SAG A;  3TAD C;  2WHE A;  3AEV A;  4DWI A;  4KLD A;  4I2C A;  3RH4 A;  2H3Z A;  4I2G A;  5JRT A;  4NLC A;  4DSK A;  1MA7 A;  4UAS A;  2W9B A;  3G6X A;  4PHD A;  2PMZ F;  2WF5 A;  2JH1 A;  5DLG A;  3CNH A;  8ICF A;  5J0W A;  3QU2 A;  2DF4 B;  1L3S A;  3T5H A;  4C8O A;  9ICX A;  5KFM A;  4KX5 A;  3EYZ A;  4M9N A;  5IIJ A;  3PX6 A;  1D9D A;  1VDV A;  2XVT A;  3B9J A;  5D49 A;  1S97 A;  4C7Y A;  3TAR A;  2DKZ A;  3FYH A;  4EBC A;  1ZQL A;  3BS5 B;  2R8G A;  1X66 A;  8ICJ A;  1D8Y A;  4QWD A;  2K4E A;  3GFK B;  9ICT A;  1NK4 A;  3M6K A;  1ZQK A;  2AH5 A;  2KJ8 A;  3ZD9 A;  2ZXI A;  3HX0 A;  4M9J A;  5CHG A;  4MFF A;  4Y2P A;  4F4Y A;  2HCF A;  5D4B A;  5KFI A;  1U4B A;  2FPM A;  3A0B U;  2YB1 A;  4RNM A;  4G9B A;  4RQ3 A;  4JWM A;  3LWL A;  4QW8 A;  3PO4 A;  1S5L U;  4DL3 A;  1QQ6 A;  5DG8 A;  4NLK A;  3R9K A;  4DL5 A;  9ICE A;  3KOO A;  1N56 A;  3ZDD A;  4U6P A;  1NK7 A;  1WCN A;  4C4T A;  3HRD D;  4RQ8 A;  1U48 A;  2KIV A;  5BOL A;  4Y2Y A;  1S0V A;  4GFJ A;  4DSI A;  3QZ7 A;  2W8L A;  7ICP A;  5AI5 A;  3MR2 A;  3BS7 A;  4DL2 A;  1ZQH A;  1S0N A;  4B9U A;  2P66 A;  4P4M A;  2KKP A;  1NKB A;  4O3Q A;  4DLE A;  2WF7 A;  1LV5 A;  2R8K A;  2C2D A;  2E1E A;  3C1Y A;  2V9W A;  4NV0 A;  2FE9 A;  2ZTC A;  3ORY A;  2QAR A;  5AK4 A;  5ALW A;  3TAC B;  2MUT A;  2VA3 A;  2PI5 A;  9ICJ A;  5KL8 B;  2AQ4 A;  2GWS A;  4JUZ A;  2HVH A;  4RQ2 A;  4EX7 A;  2G0A A;  4RNN A;  4MFA A;  1L6N A;  8ICO A;  3RJG A;  4B6J A;  4IS7 A;  5HML A;  3MGV A;  5KFQ A;  3LYS A;  2LYH A;  3KBB A;  4UAZ A;  1J2N A;  3MR3 A;  1L7M A;  1GO3 F;  4F4Z A;  2LI6 A;  4F5Q A;  2C2E A;  3NS1 A;  1OXJ A;  1ZQO A;  5DDY A;  5ALT A;  1Z4O A;  3M9O B;  3WKB A;  3V7K A;  5L1K A;  4QZG A;  1ZQF A;  3N28 A;  3TAQ A;  8ICZ A;  5ALN A;  1YT3 A;  2J6S A;  4O0I A;  1ZRM A;  2AQ0 A;  1ZD5 A;  2F3N A;  2F8L A;  3ETL A;  1N61 A;  4KLJ A;  5KFL A;  4RPY A;  5L1J A;  2V4R A;  4DQQ A;  5ALL A;  3E0F A;  3JPR A;  3AMZ A;  1Z1B A;  5IIM A;  4MFC A;  4DS5 A;  5C5J A;  2YMQ A;  5ALD A;  2KFN A;  3GZF A;  4FZM A;  1ZET A;  1KBU A;  2IHN A;  3NVY A;  5DB8 A;  2KV2 A;  3RRG A;  2JV3 A;  1BNO A;  1L7P A;  4NWI A;  3AU6 A;  4YVZ A;  4PL2 A;  4IRK A;  3LVV A;  8ICN A;  3ISD A;  2W8K A;  3H8J A;  2GO7 A;  1ZRN A;  2JXJ A;  2BCQ A;  3RBD A;  2MRL A;  5DBB A;  9ICI A;  2UVR A;  4KLG A;  4Z6E A;  1BPB A;  3PST A;  1SXE A;  5IIK A;  2DWQ A;  4KLQ A;  2KFZ A;  3MGH A;  3SEN A;  1XO0 A;  2Y0S F;  4P4O A;  3RBE A;  3PR4 A;  5KFX A;  4CF3 A;  1T3N A;  2RHF A;  1XNS A;  5KT4 A;  1TK0 A;  2UVV A;  2C2R A;  5J2H A;  1HUO A;  2D6F C;  2FLL A;  5EWF A;  2CRX A;  4UAU A;  3JPP A;  3RAX A;  4OCZ A;  3FDS A;  1ZQA A;  4GC6 A;  2ZIV B;  1SL0 A;  4RT2 A;  1UPH A;  4PL1 A;  5J2G A;  2KSO A;  5KFB A;  4J9L A;  3ZDC A;  1KLN A;  3NAS A;  3N4M B;  3ISC A;  4Q8E A;  8ICM A;  3NRW A;  5CRX A;  5KFT A;  5KG0 A;  3C29 A;  2K8A A;  1X6J A;  3WKC A;  2R18 A;  4IR1 A;  3OSN A;  1SV0 C;  4XRH A;  4IQW A;  5AM2 A;  3QU7 A;  4JV0 A;  2KN7 A;  2KVC A;  1A77 A;  1N5W A;  4QZ8 A;  1B0X A;  4KN7 A;  7ICU A;  2F1H A;  2BQ3 A;  4R65 A;  3A0H U;  4O5K A;  5KT6 A;  3SEI A;  3OPX A;  2EZX A;  3M9N B;  2JZB A;  1X40 A;  2XCP A;  2KIC A;  3HPO A;  2KKV A;  3GIJ A;  3I1Y A;  1NJW A;  5KFY A;  3AQF A;  4TUQ A;  4BX9 C;  1QTM A;  2G06 A;  2ZIU B;  4C7Z A;  3T5L A;  3HW8 A;  2IHM A;  5CP2 A;  5KFR A;  4ED7 A;  4IQV A;  4YP3 A;  2QAR B;  5DB6 A;  2MUT B;  8ICK A;  5HHI A;  1RPL A;  4O3S A;  1B43 A;  1SKS A;  5J29 A;  2KHV A;  4TUR A;  4ECY A;  1NK8 A;  1D8B A;  1ZQE A;  5AI4 A;  1Y88 A;  3UQ2 A;  1X9X A;  5GTH U;  5J0Y A;  4F72 A;  2HBM A;  2NRV A;  3RAQ A;  2FPL A;  4I2D A;  4DQS A;  2K60 A;  5KFU A;  5DG7 A;  2WAQ F;  3PX4 A;  1WWU A;  2BHN A;  9ICB A; 
#chains in the Genus database with same CATH homology
 2E8N A;  2EAM A;  1PK3 A;  3KKA C;  2F3N A;  1SV0 A;  5JU5 A;  1OW5 A;  1SGG A;  2F44 A;  4RQM A;  2LPE A;  1JI7 A;  2EAN A;  2Y9T A;  1SXD A;  1LKY B;  1SV4 A;  3TAD A;  1RG6 A;  1SV0 C;  2KG5 A;  2DL0 A;  1PK1 A;  2KSO B;  3H8M A;  3BQ7 A;  2E8M A;  1B0X A;  3TAD C;  2QKQ A;  1UCV A;  2Y9U A;  5L1M A;  2ESE A;  2KIV A;  2JV3 A;  2DKX A;  2L5Y A;  2E8O A;  4RQN A;  3K1R B;  3BS7 A;  3SEI A;  5JRT A;  5JTI A;  5J8Y A;  2GLE A;  2B6G A;  1F0M A;  2KE7 A;  2E8P A;  5F3X B;  1X40 A;  2KMD A;  3HIL A;  1COK A;  3BS5 A;  2QB0 A;  1V85 A;  1PK1 B;  1WWV A;  2D8C A;  5KNI A;  3IDW A;  2FE9 A;  5J8Y C;  2K4P A;  2QAR A;  1SXE A;  3TAC B;  1UQV A;  1V38 A;  1B4F A;  2QAR B;  2F8K A;  4MHV A;  1KW4 A;  3SEN A;  2EAP A;  2QB1 A;  1X9X A;  4IS7 A;  2DKZ A;  2D3D A;  4PZN A;  3BS5 B;  1X66 A;  1LKY A;  2QB0 B;  4NL9 A;  4PZO A;  1OXJ A;  2LMR A;  2K60 A;  3KKA A;  4NJ8 A;  2YTU A;  1DXS A;  1WWU A;  2KSO A;  1Z1V A;  2EAO A;  4NL9 C;  2ES6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...