1Z1VA

Nmr structure of the saccharomyces cerevisiae ste50 sam domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
70
structure length
70
Chain Sequence
SQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords STE50 protein
publication title Saccharomyces cerevisiae Ste50 binds the MAPKKK Ste11 through a head-to-tail SAM domain interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1z1vA00
1SV4A 3KKAC 2K4PA 2LMRA 3BS5A 3TADC 2KMDA 5JU5A 2L5YA 1DXSA 1LKYA 2QB0B 3BS7A 1SV0A 4RQMA 5J8YA 1V38A 2E8PA 1PK1B 2E8NA 2EAPA 1SXDA 1B4FA 2QKQA 1B0XA 2ESEA 1X9XA 2QARB 2KSOB 1OW5A 1Z1VA 1SXEA 2Y9TA 1UCVA 5L1MA 1KW4A 2EAOA 1V85A 1RG6A 3KKAA 2E8OA 2DKZA 3IDWA 2GLEA 1COKA 2KIVA 2EANA 2LPEA 1SV0C 1X40A 3BS5B 5J8YC 2EAMA 1LKYB 2F8KA 1JI7A 5JRTA 2DKXA 4PZOA 1OXJA 3K1RB 1PK3A 3SEIA 2QB0A 4NL9A 2FE9A 1UQVA 5KNIA 2B6GA 2D3DA 2D8CA 3BQ7A 4NJ8A 3H8MA 2F3NA 1F0MA 2F44A 3HILA 3TADA 4PZNA 4RQNA 1PK1A 2ES6A 2KG5A 5JTIA 3SENA 5F3XB 3TACB 1WWUA 2QARA 2KSOA 2YTUA 4IS7A 1SGGA 2KE7A 2E8MA 2Y9UA 1WWVA 2DL0A 1X66A 2K60A 2QB1A 4MHVA 4NL9C 2JV3A
chains in the Genus database with same CATH superfamily
4BJQA 2XY7A 9ICBA 4PL1A 5DB6A 9ICGA 1DXSA 3G6YA 2D6FC 3PO5A 2BHNA 4UAUA 4B9TA 5AM0A 3MDAA 2FMSA 2W9CA 1PK1B 2GWSA 4F5NA 4CGZA 5HMLA 1ZQ1C 5DG8A 3Q8PB 2G09A 5ALIA 8ICIA 2HHTA 5J2AA 4F4KA 3ISBA 5KFLA 5AICA 1RYUA 3L4PA 5L9XA 2NRVA 2HHWA 1V9PA 5AK6A 3C21A 4RQ8A 4KLTA 5B5EU 5GTHU 1QQ7A 4I2HA 4DQSA 4C8KA 4QZGA 5L1IA 4J9MA 4YFKA 4NLGA 4F93B 2W7OA 1OXJA 4XUSA 7ICQA 1NK0A 2G06A 4BWMA 4B9LA 8ICSA 2NO5A 2KP7A 2EH9A 3RJFA 4MEYA 1ZQSA 5KFVA 4ECRA 5KFFA 3SAFA 4EZ9A 4JUZA 1BGXT 2DPJA 4EX7A 3V6KA 3U26A 2KSOA 4GFJA 2LKYA 1D9FA 1KSPA 2KFNA 2ASLA 5EOZA 3OJUA 3MFIA 5JUMA 1YT3A 1ZQCA 1XO1A 4ECUA 4O5CA 3G6VA 4EBDA 5KFMA 1SZHA 4DQQA 4UB2A 4YMMA 1ZQXA 8ICWA 4IL6U 1WYGA 4DL7A 4P0QB 2L5YA 3NRWA 3DDHA 2C2EA 5DBCA 5G5HA 5AI6A 3TKAA 5ALTA 3M9NB 3EYZA 2ZTDA 2KIWA 2ZUDA 5AKYA 2E8NA 3MR5A 3HWTA 1M6YA 1OW5A 8ICAA 4US8A 2EZYA 5CRXA 3QUCA 2HMXA 3ISCA 4ECVA 8ICGA 3MR2A 1COKA 4F4YA 4OJ6A 1N48A 1NK9A 3GV7B 5KFHA 1KL9A 4TQSA 2YQEA 3KZXA 9ICQA 4NM1A 2P6UA 5J2EA 2LYBA 4TQRA 4BXOA 4IRCA 5E79U 4J9SA 1NK5A 3GU3A 3SR6A 2AH5A 9ICJA 2HW3A 4HYKA 5KFRA 5HMMA 3F5AA 2F76X 4PPXA 8ICPA 5CHGA 1ZQPA 2F44A 4DCCA 5DQGA 1NK6A 4FZNA 3UM9A 1JXEA 3JPOA 2E5SA 5F3XB 3DV9A 3RR7A 5AKLA 2AU0A 3NUQA 5AI8A 1RQNA 3QU9A 4I2CA 3ETRA 4ECTA 1Z1BA 2HOIA 2KE7A 2JGAA 2E8MA 3QU4A 1KFDA 2DUYA 1ZQQA 8ICLA 1S0NA 2WFAA 1IG6A 5AKXA 1T3QA 8ICOA 2YMQA 4NV0A 3GIJA 1T8EA 4IQUA 2AGPA 1HJPA 5DGAA 3SZ2A 1JX4A 4OD0A 3T79A 1UA1A 4F4ZA 1FEZA 2N1RA 4Y2RA 5KFYA 3C5FA 2CN1A 2XGQA 2MU2A 1KFTA 2G08A 3KFUF 7ICHA 2YMMA 2CRXA 1CEZA 2ZJ8A 2MUTA 5AM2A 4BUGA 1TVAA 2HHSA 1SWWA 1SKRA 2A1JA 2KNJA 5CWRA 1RZTA 4O3MA 1MQ2A 5J2IA 3PX4A 3RR8A 1SV0C 3MR3A 3OGUA 1Q3UA 5DBAA 4PJ0U 2UVVA 2JEIA 4F5QA 3C28A 1L7OA 4QZCA 4KN4A 3AEVA 3HJEA 2ISOA 4IQWA 3AU6A 4QZ9A 5HR6A 2ZUBA 5ALYA 2EZZA 2FLPA 2HBKA 3AQEA 8ICQA 1S5LU 3TARA 1PK1A 2I5HA 5JTIA 1NJZA 5G5GA 5D4BA 5BOMA 4DSLA 4JMUA 1X9MA 1S9FA 4I2GA 1ZETA 2YTUA 1RDFA 4P2HA 2Y9UA 1DGSA 2KJ9A 5KFBA 4KN7A 3C29A 2ZJAA 4ZOHC 3PV8A 2NRTA 2OYYA 2K60A 2JV3A 1NK7A 4J9OA 2IHMA 3NVVA 3PSIA 3EWAA 3CRXA 4Q44A 3RH4A 3SD7A 2F1IA 1ZOLA 4UB5A 5KG4A 4CNQA 4UAYA 4DFJA 4J9NA 9ICFA 4TURA 1QQ5A 2KEYA 3M6ZA 3PW5A 2FI1A 2ZIWB 2ZTCA 4IC9A 2ZIXB 2F8LA 2PI4A 2C28A 4DQRA 2Y9TA 4KTQA 5CP2A 1Z4NA 7ICNA 5J0OA 3K75D 4C4SA 4PGXA 4O0IA 7ICGA 3F2DA 1IIPA 1N2XA 1BPDA 4U7CA 5J0SA 4LJXA 4AYBC 3I1YA 2NO4A 3F53A 3BS5B 1NKEA 4GXIA 3N28A 1YZ7A 3BQ2A 3IHQB 1JUDA 4EYHB 1NKCA 4P0QA 5TZVA 5J2KA 2W55A 3HP6A 4NL9A 5KTQA 1Y88A 1KDHA 3GIKA 5KG2A 1XSLA 3M6KA 2PFOA 2OM6A 2XY6A 4CF3A 2BCUA 4MF2A 1ECWA 1XC9A 2XO7A 2W11A 5DKWA 4YXJA 3AU2A 2FMPA 3SYZA 2IMWP 3LVWA 1ZQTA 3A0BU 4QJFB 1JMSA 2W9MA 5AI9A 4F2RA 3M9OB 1SV4A 9ICXA 1TK8A 1ZD2P 4F4XA 1UT5A 4CF4A 2K4PA 2WF5A 4OJOA 5ALWA 3QUQA 5AM1A 4CRXA 5KFSA 4R63A 1NK8A 1KEJA 1KBUA 3JPTA 3PW7A 3NVWA 5ALPA 3J81j 5IIOA 1ZQEA 3V7KA 2R8IA 5J0XA 3Q8RB 2RP5A 5AK3A 1ZQAA 1X9XA 1NOMA 2CPRA 4QWDA 4ED3A 4C4TA 2K8CB 2ZXHA 4DSEA 5BOLA 3KHGA 4F91B 1BPZA 1N61A 3IRUA 2BQ3A 2GLEA 4DF4A 5KT4A 3ZD9A 2EANA 8ICCA 4NXZA 4M9HA 5J8YC 2IOFA 5J0RA 4IRDA 4ELVA 1K5OA 5KFKA 2K89A 4OJPA 4M47A 5HHIA 4KLUA 1PZNA 1NJYA 1CI4A 2AQ4A 3IV6A 1VJ5A 3BQ7A 2VJ4A 2F77X 3HILA 3TADA 2HCFA 2BDUA 2KG5A 5HP4A 5C5JA 2QLTA 2YMLA 8ICKA 3QU2A 2LHTA 1B22A 4QZIA 3F5EA 1RPLA 2UVRA 3ZDCA 4F5RA 4KLHA 2LBOA 5IINA 4DFDA 2R8KA 2XCAA 5B66U 1XWLA 1X42A 3BZCA 2YMPA 3HKZF 4M04A 4MHVA 3BQ1A 2DPIA 2XVTA 3TI0A 2BCRA 5L1KA 3EUB2 4DSIA 1ZQNA 3LDAA 3ZDDA 3N7RC 2KK0A 1N56A 4DSJA 4QIWF 5HHHA 1TKDA 8ICTA 5KG6A 1FIQA 2KVSA 2AHOB 3M7DA 2YB1A 5DG7A 3EPIA 5AI5A 2JMGA 4DFMA 1SXDA 5J29A 2LM1A 8ICBA 2ASJA 2VA8A 1PVQA 3QX7A 4DFPA 2HBLA 1BPXA 3TANA 2BR0A 5L1MA 3JPPA 2VA3A 4XRHA 1FFUA 5KT3A 2H3FA 5DGBA 4YD1A 4YR3A 2NV3A 2RDIA 7ICRA 3THVA 1YZ6A 4FFDA 3BQTA 4DL5A 5DLFA 4USAA 3AMZA 1TK5A 4P4MA 5J2DA 2EAMA 2KKPA 4Z6CA 2I9GA 5JRTA 2JRZA 3LWMA 2W3SA 1L3UA 5KL1B 5KL8B 1SB3C 1NK4A 4UB3A 4KLMA 4Y2PA 5J2CA 3OHAA 2AJQA 5ALOA 5T14A 1U48A 2F3NA 1IXRA 4UAWA 3UXNA 2MSNA 2W43A 3SENA 4R8UB 4F8RA 4IR9A 3T3FA 2ZIWA 1QH9A 1HUOA 2GH1A 2HDOA 3UXOA 2ZIXA 3H8SA 2ZIUB 2IOFK 5J0WA 1ZQIA 2FMQA 1ZQBA 1S76D 4KLFA 5DB9A 4UQGA 5ALRA 4KX5A 7ICFA 5J0PA 3RJJA 3OSPA 4Y2SA 2FPLA 3QUTA 4O9MA 3BS5A 2RDJA 9ICHA 2DGZA 4DOBA 2BPFA 3ZDEA 4K4HA 4Q8FA 5IIMA 4MFAA 5ALFA 2XY5A 7ICIA 2NYVA 1A6SA 4C8MA 3IP4B 2Y1JA 2WAQF 2FLLA 4DQPA 5D46A 4IQTA 3O0FA 4PH5A 3BZKA 4GXJA 3CP8A 2BKEA 2ZG6A 4ICAA 2MA1A 3QYPA 1HIWA 1Z1VA 2OXOA 1KRPA 1UCVA 2JR5A 5KFGA 4MF8A 2JZBB 4F2SA 3NASA 2JHDA 3WK8A 2ZXIA 3UXPA 5EWEA 3V72A 5KFWA 1KQQA 3ZDBA 1IM4A 3H0RB 3OPXA 4UB6U 3RFAA 5ALEA 1SZPA 3MR6A 4P4OA 2WF9A 4LZDA 5AM5A 5ALXA 2D3DA 5IILA 3ETLA 2XC9A 1QQ6A 1NZPA 5EE0A 1SL1A 4RPYA 4ZH4A 2LYHA 5D49A 2UVWA 2I1QA 2HHQA 3JPRA 4QWAA 4JV1A 5EE1A 2YY6A 3EZ5A 1WWVA 3PR5B 2PMZF 5DG9A 4DLGA 4NLCA 1ZRMA 2G5IB 1DK3A 4UBCA 5ALUA 3PZPA 9ICMA 2KMDA 4RQ1A 2DF4B 3M8SA 5DQIA 3RB6A 4O3QA 4UAVA 4DSFA 3KZIU 5KFQA 7ICSA 3K1ZA 4WJ3B 2HHUA 2HSZA 4RT3A 2UVUA 4J03A 3WKAA 2EAPA 2W8KA 2A19A 8ICXA 8ICMA 3PSPA 1TAUA 1L7MA 1T3NA 3GIMA 4RQ0A 4Y2YA 1ZD3A 5ALJA 4QW8A 2ZTEA 5AM4A 1SXEA 9ICIA 1XSNA 1JN3A 3GZFA 1KKXA 3GIIA 4I2FA 4M9GA 3C2KA 3IDWA 4DOCA 1LV5A 2H3VA 3SMVA 4I2BA 1X40A 3H40A 5AKEA 1XS9D 3PX0A 3MFHA 3N7SC 2F8KA 1J97A 4ED0A 4FO6A 4GLXA 1L8LA 2WTFA 4PZOA 2ATLA 3RRGA 2JEFA 7ICLA 2VKQA 2Y0SF 5KT6A 2AGQA 4Y2UA 9ICCA 4LVSA 2D8CA 1QTMA 4YMNA 3CNHA 4PHAA 3OJSA 2K4EA 1BPBA 2K8BB 8ICHA 4ECZA 2OH2A 1MA7A 4C4RA 3UMCA 3PW2A 4RQ7A 4B9MA 4YR0A 4I28A 1RM6C 1K1SA 4KLJA 1DOQA 1NZBA 4BDPA 1ZQOA 1S97A 3OTQA 2J6TA 2BGWA 4I2DA 2W54A 3DEEA 4JWNA 2PFPA 3RBEA 2E3TA 4DOAA 2JEGA 5KFNA 5CA7A 3VC8A 5KFJA 4ECSA 4B9SA 3FYHA 3T5HA 3I76A 1TAQA 4HAIA 4RQ4A 3V7LA 4P4PA 4F71A 5KFAA 3AL0B 9ICAA 2QKQA 4QZFA 4KITB 3MABA 2ESEA 1DGJA 3IM1A 1ZQMA 3H8JA 3EPGA 3LVVA 4R8UA 4ED2A 2BCSA 1DRGA 5F9NA 2WB1F 4QIWC 2KN7A 2XICA 2ZIUA 5AK4A 3LWLA 4K4GA 4RUCA 1RG6A 5EE9A 1F44A 4M0AA 5A0LA 2KTQA 1S77D 3WKBA 4NLNA 2JEJA 3QU5A 5KT2A 4FS1A 2G0AA 1U45A 1C7YA 4EBCA 4YXMA 3QZ8A 3ICXA 5J0YA 4Q45A 2AQ0A 3K1RB 4GC7A 3AN1A 1BNOA 1N63A 1ZQVA 3SV3A 4KLEA 4M6WB 2LYAA 1L7NA 3H0LB 1ZQDA 4OO1J 1ZQKA 3RJKA 4C80A 2OHFA 4YMOA 3K4GA 1XU4A 2IOHA 5AHXA 4NLKA 2YX8A 4I29A 3HPOA 4J9PA 3GFKB 5J0UA 5KFZA 2B0CA 3IG8A 2JZBA 5ALKA 4ECXA 1SWVA 5AK5A 2DL0A 5DBBA 4FZMA 4DF8A 2ODGA 4NL9C 2W7PA 1L8OA 3PNCA 3BQ0A 3B0YA 2Q4TA 2PXIA 3PVXA 4AP9A 4M2YA 2QB0B 5L1JA 2K4IA 9ICNA 3HT3A 2H3ZA 3MBYA 4RQMA 2EZXA 5DB7A 3F2BA 1PVRA 3KHHA 1U47A 1Z00B 1K1QA 3MGVA 4TUPA 5K4LA 2M0NA 1ZQWA 4YCXA 4ED6A 2QARB 3OHBA 1F5SA 2V4RA 4BGDA 4RQ3A 5ALNA 1QSSA 2EAOA 5DLGA 1V85A 5KFDA 5KFTA 1GO3F 2KHQA 4IQVA 2MAXA 1NJWA 4DSKA 3LYSA 2WAQC 4YG2A 5ALVA 4CCHA 3TFSA 2WF7A 4Q8EA 1BVSA 4RNOA 1QSYA 4Z6FA 5AKKA 4YQWA 3M1YA 2V4QA 4R65A 3PY8A 5CEHA 4EZ6A 4GC6A 1RXVA 7ICKA 4O3RA 4LZGA 1L6NA 9ICLA 2BDPA 4PZNA 2KV2A 3KOOA 1ZYQA 3ZDAA 3RB0A 4B6JA 4PL2A 2LI6A 2J6SA 2HHVA 1WWUA 2EDUA 1ZD4A 3AM9A 2P35A 2HOFA 5CB1A 2OCEA 2ALZA 3B0XA 4EYIB 3RB4A 3E58A 4M9JA 5J2GA 5EWFA 9ICUA 3BJYA 2W03A 3D6JA 4DS4A 1A0PA 5KFXA 1ZQZA 1UHUA 4QWCA 5AKZA 1B43A 3KKAC 2FLNA 4I2EA 1WCNA 9ICWA 2K4HA 5ALQA 3TADC 1T7PA 1URJA 2KKVA 3D2QA 4J9LA 3H7IA 5KG1A 4JV2A 1QSLA 4RQ6A 1ZJMA 2G07A 1WCLA 3QE9Y 1ED1A 1D9DA 1SKSA 2IA6A 1P7DA 1TK0A 3IG5A 1FO4A 4F5OA 3WK7A 1WUDA 4RNMA 2BPGA 2RHFA 4UATA 2ISPA 2MRLA 7ICVA 4KLGA 2R8HA 4Z6EA 1KFSA 2P66A 5IIKA 2W8LA 1CUKA 9ICRA 3CW2C 3NVZA 4O3PA 3B9JA 4C8LA 2E1EA 4QWBA 2W9AA 4OCZA 4NWIA 1Q46A 2FPKA 3C5GA 4ELUA 3KTQA 1S8OA 2O6KA 5IIIA 1J2MA 2DQNB 3WK6A 3V7JA 3N4MB 2B6GA 1PVPA 4Y2XA 4F50A 2EQYA 4C8OA 1ZQHA 1U49A 3H8WA 1D8YA 1O08A 4J9RA 1MSWD 3RH6A 1J2NA 5KFOA 5J2FA 5KFEA 4Y2JA 2Y0SC 4RUAA 3D2SA 5AKJA 2RLTA 1UA0A 8ICRA 2F1JA 3IN5A 4E0DA 4YP3A 4QW9A 4AYBF 3JPSA 4XQ8A 2W9BB 5ALZA 5TISU 5EE3A 3SAGA 3PMLA 3WKEA 2WHEA 2HHXA 1NKBA 3H0MB 2ZIVB 1WG8A 4C7YA 3SQIA 1KLNA 2OEHA 3FM9A 1ZQYA 3ED5A 4NLBA 2ZJ5A 2XI9A 4M6WA 3WK4A 3RTVA 4PGYA 4DLEA 3QXGA 2BPCA 4DS5A 5KFPA 4RPXA 8ICNA 2FPMA 2P6RA 4QZAA 5KT5A 1S0MA 1BPEA 3L3FX 4BWJA 1XO0A 5ALHA 2AGOA 3MGHA 3WK9A 2DKZA 7ICJA 3ISDA 2H3IA 4PHDA 1NJXA 1SL0A 2Y1IA 1NI3A 3UPQA 2H5XA 1Z4OA 4J9QA 4FBTA 2HI0A 4Q43A 1O03A 1AQ6A 5AM3A 9ICKA 2LM4A 1LVHA 3T5KA 4IRKA 2JH7A 3C1YA 4ED1A 2B21A 5J0TA 1U4BA 1L3VA 3RF9A 7ICUA 3PX6A 1N5XA 1HEKA 2WB1C 3D2NA 1PK3A 2QB0A 4YD2A 3RB3A 1ZQLA 4QZBA 3H8MA 3G6XA 4DO9A 2G5HB 2KJ8A 7ICPA 2ES6A 1Z00A 1OUQA 3MDCA 3TACB 4OJ5A 2KOBA 2QARA 2R8GA 8ICFA 3Q8LA 2BCQA 5J2JA 1TFRA 7ICEA 2GOLA 1X66A 2VIXA 1D8BA 2FJ6A 1T4GA 3GILA 2XIDA 3QEAZ 2W04A 4ECQA 2RRDA 5HNKA 3I28A 2BQUA 4CE6A 1FFVA 7ICOA 3OSNA 1N60A 3BS7A 2PFQA 3RAXA 2VANA 1RYRA 3UMGA 2E8PA 1X9WA 4KMUA 5C0YA 2KHVA 1ZRNA 3WU2U 4F92B 4K4IA 2NRZA 4P0PB 4QWEA 3TQ1A 2ASDA 2DWQA 4RZRA 3AQFA 3UQ2A 8ICZA 4KLLA 2HBMA 2Q0ZX 4UBBA 2E8OA 3MGIA 2C2RA 2KICA 3EW9A 4DFKA 2K8AA 4JV0A 4J9KA 2KZMA 4QZHA 4DL3A 2LPEA 1LB2B 1U9LA 2C2DA 4OJLA 4RT2A 1LKYB 8ICUA 3NVYA 1ZQFA 7ICTA 2XCPA 2DKXA 5DB8A 4EENA 5ALSA 4DEZA 1MC8A 4JWMA 1N62A 1BPYA 5KNIA 5DDMA 1A76A 3UMBA 4MFFA 3C2MA 3HX0A 3FAHA 4KLIA 5AI4A 4U6PA 4DL6A 4EBEA 2KFZA 4MFCA 4EELA 3NRZA 2M9NA 4X5VA 4PHEA 5KFCA 1PUZA 4RU9A 4KLOA 2KZZA 3RBDA 9ICEA 2ZUCA 1JIHA 1VDVA 3GV8B 8ICJA 2KJ5A 5AKGA 5H2FU 1CRXA 4B9UA 4I27A 5CR0A 1Q8KA 4FS2A 5ALGA 5AKIA 4NY8A 1JRPA 4JB3A 2NRWA 9ICSA 3ORYA 5F9LA 1N5WA 1SV0A 1SL2A 1EXNA 3WK5A 1COOA 3GDXA 3QNMA 1XNSA 4NM2A 3R9KA 3TFRA 9ICPA 1D8LA 1B4FA 4A8EA 2E1FA 4TUSA 2RQ5A 3MC1A 8ICEA 1X6IA 3RRHA 9ICOA 4B9NA 5ALLA 1JROA 1UPHA 5AKHA 8ICYA 2JXJA 1X2IA 1C20A 5HR7A 3JPQA 2BQRA 4ED7A 4F72A 5KT7A 3PMNA 3HKZC 2KIVA 3WKDA 4JK1A 4R64A 4F4WA 2W9BA 5AIBA 1QCKA 2PI5A 1S0OA 3E2EA 3GQCA 5CJ7A 2ZIVA 5J2BA 3E0FA 3C2LA 1XSPA 2NRXA 2IBKA 5EWGA 1ZD5A 1QLNA 2PFNA 3RJEA 2F1HA 2W9CB 4MEXA 2BZFA 2FDRA 3ZI4A 3KHRA 1F0MA 3UQ0A 3ONNA 5KG0A 3SV4A 5L1LA 3HW8A 1NNLA 1ZXIA 4Y2TA 2PKEA 3T5LA 3PR4A 4ACOA 2R18A 4YN4A 1KN5A 4RNNA 4EEKA 4F5PA 1SGGA 2GO7A 4C8NA 7ICMA 3V6HA 1TAMA 2V9WA 1Z3EB 3QZ7A 1Z19A 2QB1A 3M9MB 3KHLA 4DL4A 4EX6A 2LMRA 2BCVA 3RJHA 5KG5A 4UB4A 3H4BA 1SKWA 3Q8KA 2CXYA 4G9BA 1ZQUA 1RYSA 1T94A 2VJ5A 3M8RA 3N97B 1JXLA 1V38A 3VCBA 5DDYA 4C7ZA 1BNPA 3QU7A 4PHPA 4FBUA 3KD3A 2W3RA 2OWOA 1B0XA 3L5KA 5J0QA 2KSOB 4I2IA 4QZDA 1UT8A 1S10A 5AI0A 3WKCA 3FDSA 3BDPA 1V97A 1DK2A 1IV8A 2C22A 5ALMA 4I2JA 3ZD8A 4RPZA 4KLSA 4UASA 4PGQA 4UB8U 3ALRA 2HVHA 4UW9A 5AIAA 2JH1A 4US9A 3JPNA 3KBBA 3Q8QB 2XGPA 1ZJNA 4FE3A 2WF8A 2A1AA 3QEBZ 4O5EA 3SEIA 3RAQA 1UQVA 1AROP 3CYMA 3TAQA 4CDGA 1L3TA 2KVCA 4XA5A 4O3SA 4ELTA 4KLDA 2WF6A 3PW0A 5DQHA 3TAPA 4M9LA 2DBYA 4GIBA 1X9SA 2IHNA 5ALDA 4ECYA 4RQ2A 4P0PA 4G3IA 1SIJA 3RH5A 5IIJA 4F3OA 1L7PA 1TE2A 4IS7A 2KZ3A 3V6JA 4BX9C 4Z6DA 2HBJA 4O3NA 2F2AB 4O3OA 2HOQA 4UARA 9ICVA 4TUQA 4BXOB 3S6JA 1X6JA 5KAFU 5JU5A 4O5KA 3SAHA 4DQIA 4QNLA 5KFIA 4IR1A 1LKYA 2AXTU 3PW4A 1A77A 2Z7JA 1JALA 3H4DA 4UB1A 1ZQJA 1VLBA 2R8JA 3C1ZA 4Y2VA 2YN4A 5J8YA 4DL2A 3C23A 4FZLA 4CF5A 1RXWA 4GXKA 2YB4A 5KG3A 1HUZA 1TV9A 3RJIA 3RJGA 1MN8A 1RQLA 3PO4A 3Q8MA 8ICVA 2VA2A 4Y2QA 5KFUA 1L5UA 1KW4A 2H3QA 5FP0A 1S0VA 2J6UA 3KKAA 1H38A 3QUBA 4I2AA 3PSFA 2I6XA 3N7PD 3NS1A 2PMZC 4DWIA 4KX3A 1JI7A 5BPCA 3LK9A 4M9NA 3A0HU 3HRDD 3T5JA 4YVZA 1ZQGA 3AUOA 5KG7A 2FE9A 1MQ3A 3SI8A 1Q3VA 2DFLA 4NJ8A 2A3VA 4KLQA 5KAIU 4R66A 4RQNA 4B9VA 1KTQA 3FC4A 4ED8A 2HVIA 2MUTB 3Q8SB 3NGDA 4UAZA 4QZEA 4YR2A 4RQ5A 4KMOB 3F2CA 2A1JB 3GV5B 2KD1A 3NTUA 4C0ZA 9ICTA 5GTIU 4QZ8A 4EEYA 3PSTA 4ECWA 5J2HA 1L3SA 4NLZA 1ZQRA
chains in the Genus database with same CATH topology
1SV4A 3KKAC 2K4PA 2LMRA 3BS5A 3TADC 2KMDA 5JU5A 2L5YA 1DXSA 1LKYA 2QB0B 3BS7A 1SV0A 4RQMA 5J8YA 1V38A 2E8PA 1PK1B 2E8NA 2EAPA 1SXDA 1B4FA 2QKQA 1B0XA 2ESEA 1X9XA 2QARB 2KSOB 1OW5A 1Z1VA 1SXEA 2Y9TA 1UCVA 5L1MA 1KW4A 2EAOA 1V85A 1RG6A 3KKAA 2E8OA 2DKZA 3IDWA 2GLEA 1COKA 2KIVA 2EANA 2LPEA 1SV0C 1X40A 3BS5B 5J8YC 2EAMA 1LKYB 2F8KA 1JI7A 5JRTA 2DKXA 4PZOA 1OXJA 3K1RB 1PK3A 3SEIA 2QB0A 4NL9A 2FE9A 1UQVA 5KNIA 2B6GA 2D3DA 2D8CA 3BQ7A 4NJ8A 3H8MA 2F3NA 1F0MA 2F44A 3HILA 3TADA 4PZNA 4RQNA 1PK1A 2ES6A 2KG5A 5JTIA 3SENA 5F3XB 3TACB 1WWUA 2QARA 2KSOA 2YTUA 4IS7A 1SGGA 2KE7A 2E8MA 2Y9UA 1WWVA 2DL0A 1X66A 2K60A 2QB1A 4MHVA 4NL9C 2JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  3KKA C;  2K4P A;  2LMR A;  3BS5 A;  3TAD C;  2KMD A;  5JU5 A;  2L5Y A;  1DXS A;  1LKY A;  2QB0 B;  3BS7 A;  1SV0 A;  4RQM A;  5J8Y A;  1V38 A;  2E8P A;  1PK1 B;  2E8N A;  2EAP A;  1SXD A;  1B4F A;  2QKQ A;  1B0X A;  2ESE A;  1X9X A;  2QAR B;  2KSO B;  1OW5 A;  1Z1V A;  1SXE A;  2Y9T A;  1UCV A;  5L1M A;  1KW4 A;  2EAO A;  1V85 A;  1RG6 A;  3KKA A;  2E8O A;  2DKZ A;  3IDW A;  2GLE A;  1COK A;  2KIV A;  2EAN A;  2LPE A;  1SV0 C;  1X40 A;  3BS5 B;  5J8Y C;  2EAM A;  1LKY B;  2F8K A;  1JI7 A;  5JRT A;  2DKX A;  4PZO A;  1OXJ A;  3K1R B;  1PK3 A;  3SEI A;  2QB0 A;  4NL9 A;  2FE9 A;  1UQV A;  5KNI A;  2B6G A;  2D3D A;  2D8C A;  3BQ7 A;  4NJ8 A;  3H8M A;  2F3N A;  1F0M A;  2F44 A;  3HIL A;  3TAD A;  4PZN A;  4RQN A;  1PK1 A;  2ES6 A;  2KG5 A;  5JTI A;  3SEN A;  5F3X B;  3TAC B;  1WWU A;  2QAR A;  2KSO A;  2YTU A;  4IS7 A;  1SGG A;  2KE7 A;  2E8M A;  2Y9U A;  1WWV A;  2DL0 A;  1X66 A;  2K60 A;  2QB1 A;  4MHV A;  4NL9 C;  2JV3 A; 
#chains in the Genus database with same CATH topology
 4BJQ A;  2XY7 A;  9ICB A;  4PL1 A;  5DB6 A;  9ICG A;  1DXS A;  3G6Y A;  2D6F C;  3PO5 A;  2BHN A;  4UAU A;  4B9T A;  5AM0 A;  3MDA A;  2FMS A;  2W9C A;  1PK1 B;  2GWS A;  4F5N A;  4CGZ A;  5HML A;  1ZQ1 C;  5DG8 A;  3Q8P B;  2G09 A;  5ALI A;  8ICI A;  2HHT A;  5J2A A;  4F4K A;  3ISB A;  5KFL A;  5AIC A;  1RYU A;  3L4P A;  5L9X A;  2NRV A;  2HHW A;  1V9P A;  5AK6 A;  3C21 A;  4RQ8 A;  4KLT A;  5B5E U;  5GTH U;  1QQ7 A;  4I2H A;  4DQS A;  4C8K A;  4QZG A;  5L1I A;  4J9M A;  4YFK A;  4NLG A;  4F93 B;  2W7O A;  1OXJ A;  4XUS A;  7ICQ A;  1NK0 A;  2G06 A;  4BWM A;  4B9L A;  8ICS A;  2NO5 A;  2KP7 A;  2EH9 A;  3RJF A;  4MEY A;  1ZQS A;  5KFV A;  4ECR A;  5KFF A;  3SAF A;  4EZ9 A;  4JUZ A;  1BGX T;  2DPJ A;  4EX7 A;  3V6K A;  3U26 A;  2KSO A;  4GFJ A;  2LKY A;  1D9F A;  1KSP A;  2KFN A;  2ASL A;  5EOZ A;  3OJU A;  3MFI A;  5JUM A;  1YT3 A;  1ZQC A;  1XO1 A;  4ECU A;  4O5C A;  3G6V A;  4EBD A;  5KFM A;  1SZH A;  4DQQ A;  4UB2 A;  4YMM A;  1ZQX A;  8ICW A;  4IL6 U;  1WYG A;  4DL7 A;  4P0Q B;  2L5Y A;  3NRW A;  3DDH A;  2C2E A;  5DBC A;  5G5H A;  5AI6 A;  3TKA A;  5ALT A;  3M9N B;  3EYZ A;  2ZTD A;  2KIW A;  2ZUD A;  5AKY A;  2E8N A;  3MR5 A;  3HWT A;  1M6Y A;  1OW5 A;  8ICA A;  4US8 A;  2EZY A;  5CRX A;  3QUC A;  2HMX A;  3ISC A;  4ECV A;  8ICG A;  3MR2 A;  1COK A;  4F4Y A;  4OJ6 A;  1N48 A;  1NK9 A;  3GV7 B;  5KFH A;  1KL9 A;  4TQS A;  2YQE A;  3KZX A;  9ICQ A;  4NM1 A;  2P6U A;  5J2E A;  2LYB A;  4TQR A;  4BXO A;  4IRC A;  5E79 U;  4J9S A;  1NK5 A;  3GU3 A;  3SR6 A;  2AH5 A;  9ICJ A;  2HW3 A;  4HYK A;  5KFR A;  5HMM A;  3F5A A;  2F76 X;  4PPX A;  8ICP A;  5CHG A;  1ZQP A;  2F44 A;  4DCC A;  5DQG A;  1NK6 A;  4FZN A;  3UM9 A;  1JXE A;  3JPO A;  2E5S A;  5F3X B;  3DV9 A;  3RR7 A;  5AKL A;  2AU0 A;  3NUQ A;  5AI8 A;  1RQN A;  3QU9 A;  4I2C A;  3ETR A;  4ECT A;  1Z1B A;  2HOI A;  2KE7 A;  2JGA A;  2E8M A;  3QU4 A;  1KFD A;  2DUY A;  1ZQQ A;  8ICL A;  1S0N A;  2WFA A;  1IG6 A;  5AKX A;  1T3Q A;  8ICO A;  2YMQ A;  4NV0 A;  3GIJ A;  1T8E A;  4IQU A;  2AGP A;  1HJP A;  5DGA A;  3SZ2 A;  1JX4 A;  4OD0 A;  3T79 A;  1UA1 A;  4F4Z A;  1FEZ A;  2N1R A;  4Y2R A;  5KFY A;  3C5F A;  2CN1 A;  2XGQ A;  2MU2 A;  1KFT A;  2G08 A;  3KFU F;  7ICH A;  2YMM A;  2CRX A;  1CEZ A;  2ZJ8 A;  2MUT A;  5AM2 A;  4BUG A;  1TVA A;  2HHS A;  1SWW A;  1SKR A;  2A1J A;  2KNJ A;  5CWR A;  1RZT A;  4O3M A;  1MQ2 A;  5J2I A;  3PX4 A;  3RR8 A;  1SV0 C;  3MR3 A;  3OGU A;  1Q3U A;  5DBA A;  4PJ0 U;  2UVV A;  2JEI A;  4F5Q A;  3C28 A;  1L7O A;  4QZC A;  4KN4 A;  3AEV A;  3HJE A;  2ISO A;  4IQW A;  3AU6 A;  4QZ9 A;  5HR6 A;  2ZUB A;  5ALY A;  2EZZ A;  2FLP A;  2HBK A;  3AQE A;  8ICQ A;  1S5L U;  3TAR A;  1PK1 A;  2I5H A;  5JTI A;  1NJZ A;  5G5G A;  5D4B A;  5BOM A;  4DSL A;  4JMU A;  1X9M A;  1S9F A;  4I2G A;  1ZET A;  2YTU A;  1RDF A;  4P2H A;  2Y9U A;  1DGS A;  2KJ9 A;  5KFB A;  4KN7 A;  3C29 A;  2ZJA A;  4ZOH C;  3PV8 A;  2NRT A;  2OYY A;  2K60 A;  2JV3 A;  1NK7 A;  4J9O A;  2IHM A;  3NVV A;  3PSI A;  3EWA A;  3CRX A;  4Q44 A;  3RH4 A;  3SD7 A;  2F1I A;  1ZOL A;  4UB5 A;  5KG4 A;  4CNQ A;  4UAY A;  4DFJ A;  4J9N A;  9ICF A;  4TUR A;  1QQ5 A;  2KEY A;  3M6Z A;  3PW5 A;  2FI1 A;  2ZIW B;  2ZTC A;  4IC9 A;  2ZIX B;  2F8L A;  2PI4 A;  2C28 A;  4DQR A;  2Y9T A;  4KTQ A;  5CP2 A;  1Z4N A;  7ICN A;  5J0O A;  3K75 D;  4C4S A;  4PGX A;  4O0I A;  7ICG A;  3F2D A;  1IIP A;  1N2X A;  1BPD A;  4U7C A;  5J0S A;  4LJX A;  4AYB C;  3I1Y A;  2NO4 A;  3F53 A;  3BS5 B;  1NKE A;  4GXI A;  3N28 A;  1YZ7 A;  3BQ2 A;  3IHQ B;  1JUD A;  4EYH B;  1NKC A;  4P0Q A;  5TZV A;  5J2K A;  2W55 A;  3HP6 A;  4NL9 A;  5KTQ A;  1Y88 A;  1KDH A;  3GIK A;  5KG2 A;  1XSL A;  3M6K A;  2PFO A;  2OM6 A;  2XY6 A;  4CF3 A;  2BCU A;  4MF2 A;  1ECW A;  1XC9 A;  2XO7 A;  2W11 A;  5DKW A;  4YXJ A;  3AU2 A;  2FMP A;  3SYZ A;  2IMW P;  3LVW A;  1ZQT A;  3A0B U;  4QJF B;  1JMS A;  2W9M A;  5AI9 A;  4F2R A;  3M9O B;  1SV4 A;  9ICX A;  1TK8 A;  1ZD2 P;  4F4X A;  1UT5 A;  4CF4 A;  2K4P A;  2WF5 A;  4OJO A;  5ALW A;  3QUQ A;  5AM1 A;  4CRX A;  5KFS A;  4R63 A;  1NK8 A;  1KEJ A;  1KBU A;  3JPT A;  3PW7 A;  3NVW A;  5ALP A;  3J81 j;  5IIO A;  1ZQE A;  3V7K A;  2R8I A;  5J0X A;  3Q8R B;  2RP5 A;  5AK3 A;  1ZQA A;  1X9X A;  1NOM A;  2CPR A;  4QWD A;  4ED3 A;  4C4T A;  2K8C B;  2ZXH A;  4DSE A;  5BOL A;  3KHG A;  4F91 B;  1BPZ A;  1N61 A;  3IRU A;  2BQ3 A;  2GLE A;  4DF4 A;  5KT4 A;  3ZD9 A;  2EAN A;  8ICC A;  4NXZ A;  4M9H A;  5J8Y C;  2IOF A;  5J0R A;  4IRD A;  4ELV A;  1K5O A;  5KFK A;  2K89 A;  4OJP A;  4M47 A;  5HHI A;  4KLU A;  1PZN A;  1NJY A;  1CI4 A;  2AQ4 A;  3IV6 A;  1VJ5 A;  3BQ7 A;  2VJ4 A;  2F77 X;  3HIL A;  3TAD A;  2HCF A;  2BDU A;  2KG5 A;  5HP4 A;  5C5J A;  2QLT A;  2YML A;  8ICK A;  3QU2 A;  2LHT A;  1B22 A;  4QZI A;  3F5E A;  1RPL A;  2UVR A;  3ZDC A;  4F5R A;  4KLH A;  2LBO A;  5IIN A;  4DFD A;  2R8K A;  2XCA A;  5B66 U;  1XWL A;  1X42 A;  3BZC A;  2YMP A;  3HKZ F;  4M04 A;  4MHV A;  3BQ1 A;  2DPI A;  2XVT A;  3TI0 A;  2BCR A;  5L1K A;  3EUB 2;  4DSI A;  1ZQN A;  3LDA A;  3ZDD A;  3N7R C;  2KK0 A;  1N56 A;  4DSJ A;  4QIW F;  5HHH A;  1TKD A;  8ICT A;  5KG6 A;  1FIQ A;  2KVS A;  2AHO B;  3M7D A;  2YB1 A;  5DG7 A;  3EPI A;  5AI5 A;  2JMG A;  4DFM A;  1SXD A;  5J29 A;  2LM1 A;  8ICB A;  2ASJ A;  2VA8 A;  1PVQ A;  3QX7 A;  4DFP A;  2HBL A;  1BPX A;  3TAN A;  2BR0 A;  5L1M A;  3JPP A;  2VA3 A;  4XRH A;  1FFU A;  5KT3 A;  2H3F A;  5DGB A;  4YD1 A;  4YR3 A;  2NV3 A;  2RDI A;  7ICR A;  3THV A;  1YZ6 A;  4FFD A;  3BQT A;  4DL5 A;  5DLF A;  4USA A;  3AMZ A;  1TK5 A;  4P4M A;  5J2D A;  2EAM A;  2KKP A;  4Z6C A;  2I9G A;  5JRT A;  2JRZ A;  3LWM A;  2W3S A;  1L3U A;  5KL1 B;  5KL8 B;  1SB3 C;  1NK4 A;  4UB3 A;  4KLM A;  4Y2P A;  5J2C A;  3OHA A;  2AJQ A;  5ALO A;  5T14 A;  1U48 A;  2F3N A;  1IXR A;  4UAW A;  3UXN A;  2MSN A;  2W43 A;  3SEN A;  4R8U B;  4F8R A;  4IR9 A;  3T3F A;  2ZIW A;  1QH9 A;  1HUO A;  2GH1 A;  2HDO A;  3UXO A;  2ZIX A;  3H8S A;  2ZIU B;  2IOF K;  5J0W A;  1ZQI A;  2FMQ A;  1ZQB A;  1S76 D;  4KLF A;  5DB9 A;  4UQG A;  5ALR A;  4KX5 A;  7ICF A;  5J0P A;  3RJJ A;  3OSP A;  4Y2S A;  2FPL A;  3QUT A;  4O9M A;  3BS5 A;  2RDJ A;  9ICH A;  2DGZ A;  4DOB A;  2BPF A;  3ZDE A;  4K4H A;  4Q8F A;  5IIM A;  4MFA A;  5ALF A;  2XY5 A;  7ICI A;  2NYV A;  1A6S A;  4C8M A;  3IP4 B;  2Y1J A;  2WAQ F;  2FLL A;  4DQP A;  5D46 A;  4IQT A;  3O0F A;  4PH5 A;  3BZK A;  4GXJ A;  3CP8 A;  2BKE A;  2ZG6 A;  4ICA A;  2MA1 A;  3QYP A;  1HIW A;  1Z1V A;  2OXO A;  1KRP A;  1UCV A;  2JR5 A;  5KFG A;  4MF8 A;  2JZB B;  4F2S A;  3NAS A;  2JHD A;  3WK8 A;  2ZXI A;  3UXP A;  5EWE A;  3V72 A;  5KFW A;  1KQQ A;  3ZDB A;  1IM4 A;  3H0R B;  3OPX A;  4UB6 U;  3RFA A;  5ALE A;  1SZP A;  3MR6 A;  4P4O A;  2WF9 A;  4LZD A;  5AM5 A;  5ALX A;  2D3D A;  5IIL A;  3ETL A;  2XC9 A;  1QQ6 A;  1NZP A;  5EE0 A;  1SL1 A;  4RPY A;  4ZH4 A;  2LYH A;  5D49 A;  2UVW A;  2I1Q A;  2HHQ A;  3JPR A;  4QWA A;  4JV1 A;  5EE1 A;  2YY6 A;  3EZ5 A;  1WWV A;  3PR5 B;  2PMZ F;  5DG9 A;  4DLG A;  4NLC A;  1ZRM A;  2G5I B;  1DK3 A;  4UBC A;  5ALU A;  3PZP A;  9ICM A;  2KMD A;  4RQ1 A;  2DF4 B;  3M8S A;  5DQI A;  3RB6 A;  4O3Q A;  4UAV A;  4DSF A;  3KZI U;  5KFQ A;  7ICS A;  3K1Z A;  4WJ3 B;  2HHU A;  2HSZ A;  4RT3 A;  2UVU A;  4J03 A;  3WKA A;  2EAP A;  2W8K A;  2A19 A;  8ICX A;  8ICM A;  3PSP A;  1TAU A;  1L7M A;  1T3N A;  3GIM A;  4RQ0 A;  4Y2Y A;  1ZD3 A;  5ALJ A;  4QW8 A;  2ZTE A;  5AM4 A;  1SXE A;  9ICI A;  1XSN A;  1JN3 A;  3GZF A;  1KKX A;  3GII A;  4I2F A;  4M9G A;  3C2K A;  3IDW A;  4DOC A;  1LV5 A;  2H3V A;  3SMV A;  4I2B A;  1X40 A;  3H40 A;  5AKE A;  1XS9 D;  3PX0 A;  3MFH A;  3N7S C;  2F8K A;  1J97 A;  4ED0 A;  4FO6 A;  4GLX A;  1L8L A;  2WTF A;  4PZO A;  2ATL A;  3RRG A;  2JEF A;  7ICL A;  2VKQ A;  2Y0S F;  5KT6 A;  2AGQ A;  4Y2U A;  9ICC A;  4LVS A;  2D8C A;  1QTM A;  4YMN A;  3CNH A;  4PHA A;  3OJS A;  2K4E A;  1BPB A;  2K8B B;  8ICH A;  4ECZ A;  2OH2 A;  1MA7 A;  4C4R A;  3UMC A;  3PW2 A;  4RQ7 A;  4B9M A;  4YR0 A;  4I28 A;  1RM6 C;  1K1S A;  4KLJ A;  1DOQ A;  1NZB A;  4BDP A;  1ZQO A;  1S97 A;  3OTQ A;  2J6T A;  2BGW A;  4I2D A;  2W54 A;  3DEE A;  4JWN A;  2PFP A;  3RBE A;  2E3T A;  4DOA A;  2JEG A;  5KFN A;  5CA7 A;  3VC8 A;  5KFJ A;  4ECS A;  4B9S A;  3FYH A;  3T5H A;  3I76 A;  1TAQ A;  4HAI A;  4RQ4 A;  3V7L A;  4P4P A;  4F71 A;  5KFA A;  3AL0 B;  9ICA A;  2QKQ A;  4QZF A;  4KIT B;  3MAB A;  2ESE A;  1DGJ A;  3IM1 A;  1ZQM A;  3H8J A;  3EPG A;  3LVV A;  4R8U A;  4ED2 A;  2BCS A;  1DRG A;  5F9N A;  2WB1 F;  4QIW C;  2KN7 A;  2XIC A;  2ZIU A;  5AK4 A;  3LWL A;  4K4G A;  4RUC A;  1RG6 A;  5EE9 A;  1F44 A;  4M0A A;  5A0L A;  2KTQ A;  1S77 D;  3WKB A;  4NLN A;  2JEJ A;  3QU5 A;  5KT2 A;  4FS1 A;  2G0A A;  1U45 A;  1C7Y A;  4EBC A;  4YXM A;  3QZ8 A;  3ICX A;  5J0Y A;  4Q45 A;  2AQ0 A;  3K1R B;  4GC7 A;  3AN1 A;  1BNO A;  1N63 A;  1ZQV A;  3SV3 A;  4KLE A;  4M6W B;  2LYA A;  1L7N A;  3H0L B;  1ZQD A;  4OO1 J;  1ZQK A;  3RJK A;  4C80 A;  2OHF A;  4YMO A;  3K4G A;  1XU4 A;  2IOH A;  5AHX A;  4NLK A;  2YX8 A;  4I29 A;  3HPO A;  4J9P A;  3GFK B;  5J0U A;  5KFZ A;  2B0C A;  3IG8 A;  2JZB A;  5ALK A;  4ECX A;  1SWV A;  5AK5 A;  2DL0 A;  5DBB A;  4FZM A;  4DF8 A;  2ODG A;  4NL9 C;  2W7P A;  1L8O A;  3PNC A;  3BQ0 A;  3B0Y A;  2Q4T A;  2PXI A;  3PVX A;  4AP9 A;  4M2Y A;  2QB0 B;  5L1J A;  2K4I A;  9ICN A;  3HT3 A;  2H3Z A;  3MBY A;  4RQM A;  2EZX A;  5DB7 A;  3F2B A;  1PVR A;  3KHH A;  1U47 A;  1Z00 B;  1K1Q A;  3MGV A;  4TUP A;  5K4L A;  2M0N A;  1ZQW A;  4YCX A;  4ED6 A;  2QAR B;  3OHB A;  1F5S A;  2V4R A;  4BGD A;  4RQ3 A;  5ALN A;  1QSS A;  2EAO A;  5DLG A;  1V85 A;  5KFD A;  5KFT A;  1GO3 F;  2KHQ A;  4IQV A;  2MAX A;  1NJW A;  4DSK A;  3LYS A;  2WAQ C;  4YG2 A;  5ALV A;  4CCH A;  3TFS A;  2WF7 A;  4Q8E A;  1BVS A;  4RNO A;  1QSY A;  4Z6F A;  5AKK A;  4YQW A;  3M1Y A;  2V4Q A;  4R65 A;  3PY8 A;  5CEH A;  4EZ6 A;  4GC6 A;  1RXV A;  7ICK A;  4O3R A;  4LZG A;  1L6N A;  9ICL A;  2BDP A;  4PZN A;  2KV2 A;  3KOO A;  1ZYQ A;  3ZDA A;  3RB0 A;  4B6J A;  4PL2 A;  2LI6 A;  2J6S A;  2HHV A;  1WWU A;  2EDU A;  1ZD4 A;  3AM9 A;  2P35 A;  2HOF A;  5CB1 A;  2OCE A;  2ALZ A;  3B0X A;  4EYI B;  3RB4 A;  3E58 A;  4M9J A;  5J2G A;  5EWF A;  9ICU A;  3BJY A;  2W03 A;  3D6J A;  4DS4 A;  1A0P A;  5KFX A;  1ZQZ A;  1UHU A;  4QWC A;  5AKZ A;  1B43 A;  3KKA C;  2FLN A;  4I2E A;  1WCN A;  9ICW A;  2K4H A;  5ALQ A;  3TAD C;  1T7P A;  1URJ A;  2KKV A;  3D2Q A;  4J9L A;  3H7I A;  5KG1 A;  4JV2 A;  1QSL A;  4RQ6 A;  1ZJM A;  2G07 A;  1WCL A;  3QE9 Y;  1ED1 A;  1D9D A;  1SKS A;  2IA6 A;  1P7D A;  1TK0 A;  3IG5 A;  1FO4 A;  4F5O A;  3WK7 A;  1WUD A;  4RNM A;  2BPG A;  2RHF A;  4UAT A;  2ISP A;  2MRL A;  7ICV A;  4KLG A;  2R8H A;  4Z6E A;  1KFS A;  2P66 A;  5IIK A;  2W8L A;  1CUK A;  9ICR A;  3CW2 C;  3NVZ A;  4O3P A;  3B9J A;  4C8L A;  2E1E A;  4QWB A;  2W9A A;  4OCZ A;  4NWI A;  1Q46 A;  2FPK A;  3C5G A;  4ELU A;  3KTQ A;  1S8O A;  2O6K A;  5III A;  1J2M A;  2DQN B;  3WK6 A;  3V7J A;  3N4M B;  2B6G A;  1PVP A;  4Y2X A;  4F50 A;  2EQY A;  4C8O A;  1ZQH A;  1U49 A;  3H8W A;  1D8Y A;  1O08 A;  4J9R A;  1MSW D;  3RH6 A;  1J2N A;  5KFO A;  5J2F A;  5KFE A;  4Y2J A;  2Y0S C;  4RUA A;  3D2S A;  5AKJ A;  2RLT A;  1UA0 A;  8ICR A;  2F1J A;  3IN5 A;  4E0D A;  4YP3 A;  4QW9 A;  4AYB F;  3JPS A;  4XQ8 A;  2W9B B;  5ALZ A;  5TIS U;  5EE3 A;  3SAG A;  3PML A;  3WKE A;  2WHE A;  2HHX A;  1NKB A;  3H0M B;  2ZIV B;  1WG8 A;  4C7Y A;  3SQI A;  1KLN A;  2OEH A;  3FM9 A;  1ZQY A;  3ED5 A;  4NLB A;  2ZJ5 A;  2XI9 A;  4M6W A;  3WK4 A;  3RTV A;  4PGY A;  4DLE A;  3QXG A;  2BPC A;  4DS5 A;  5KFP A;  4RPX A;  8ICN A;  2FPM A;  2P6R A;  4QZA A;  5KT5 A;  1S0M A;  1BPE A;  3L3F X;  4BWJ A;  1XO0 A;  5ALH A;  2AGO A;  3MGH A;  3WK9 A;  2DKZ A;  7ICJ A;  3ISD A;  2H3I A;  4PHD A;  1NJX A;  1SL0 A;  2Y1I A;  1NI3 A;  3UPQ A;  2H5X A;  1Z4O A;  4J9Q A;  4FBT A;  2HI0 A;  4Q43 A;  1O03 A;  1AQ6 A;  5AM3 A;  9ICK A;  2LM4 A;  1LVH A;  3T5K A;  4IRK A;  2JH7 A;  3C1Y A;  4ED1 A;  2B21 A;  5J0T A;  1U4B A;  1L3V A;  3RF9 A;  7ICU A;  3PX6 A;  1N5X A;  1HEK A;  2WB1 C;  3D2N A;  1PK3 A;  2QB0 A;  4YD2 A;  3RB3 A;  1ZQL A;  4QZB A;  3H8M A;  3G6X A;  4DO9 A;  2G5H B;  2KJ8 A;  7ICP A;  2ES6 A;  1Z00 A;  1OUQ A;  3MDC A;  3TAC B;  4OJ5 A;  2KOB A;  2QAR A;  2R8G A;  8ICF A;  3Q8L A;  2BCQ A;  5J2J A;  1TFR A;  7ICE A;  2GOL A;  1X66 A;  2VIX A;  1D8B A;  2FJ6 A;  1T4G A;  3GIL A;  2XID A;  3QEA Z;  2W04 A;  4ECQ A;  2RRD A;  5HNK A;  3I28 A;  2BQU A;  4CE6 A;  1FFV A;  7ICO A;  3OSN A;  1N60 A;  3BS7 A;  2PFQ A;  3RAX A;  2VAN A;  1RYR A;  3UMG A;  2E8P A;  1X9W A;  4KMU A;  5C0Y A;  2KHV A;  1ZRN A;  3WU2 U;  4F92 B;  4K4I A;  2NRZ A;  4P0P B;  4QWE A;  3TQ1 A;  2ASD A;  2DWQ A;  4RZR A;  3AQF A;  3UQ2 A;  8ICZ A;  4KLL A;  2HBM A;  2Q0Z X;  4UBB A;  2E8O A;  3MGI A;  2C2R A;  2KIC A;  3EW9 A;  4DFK A;  2K8A A;  4JV0 A;  4J9K A;  2KZM A;  4QZH A;  4DL3 A;  2LPE A;  1LB2 B;  1U9L A;  2C2D A;  4OJL A;  4RT2 A;  1LKY B;  8ICU A;  3NVY A;  1ZQF A;  7ICT A;  2XCP A;  2DKX A;  5DB8 A;  4EEN A;  5ALS A;  4DEZ A;  1MC8 A;  4JWM A;  1N62 A;  1BPY A;  5KNI A;  5DDM A;  1A76 A;  3UMB A;  4MFF A;  3C2M A;  3HX0 A;  3FAH A;  4KLI A;  5AI4 A;  4U6P A;  4DL6 A;  4EBE A;  2KFZ A;  4MFC A;  4EEL A;  3NRZ A;  2M9N A;  4X5V A;  4PHE A;  5KFC A;  1PUZ A;  4RU9 A;  4KLO A;  2KZZ A;  3RBD A;  9ICE A;  2ZUC A;  1JIH A;  1VDV A;  3GV8 B;  8ICJ A;  2KJ5 A;  5AKG A;  5H2F U;  1CRX A;  4B9U A;  4I27 A;  5CR0 A;  1Q8K A;  4FS2 A;  5ALG A;  5AKI A;  4NY8 A;  1JRP A;  4JB3 A;  2NRW A;  9ICS A;  3ORY A;  5F9L A;  1N5W A;  1SV0 A;  1SL2 A;  1EXN A;  3WK5 A;  1COO A;  3GDX A;  3QNM A;  1XNS A;  4NM2 A;  3R9K A;  3TFR A;  9ICP A;  1D8L A;  1B4F A;  4A8E A;  2E1F A;  4TUS A;  2RQ5 A;  3MC1 A;  8ICE A;  1X6I A;  3RRH A;  9ICO A;  4B9N A;  5ALL A;  1JRO A;  1UPH A;  5AKH A;  8ICY A;  2JXJ A;  1X2I A;  1C20 A;  5HR7 A;  3JPQ A;  2BQR A;  4ED7 A;  4F72 A;  5KT7 A;  3PMN A;  3HKZ C;  2KIV A;  3WKD A;  4JK1 A;  4R64 A;  4F4W A;  2W9B A;  5AIB A;  1QCK A;  2PI5 A;  1S0O A;  3E2E A;  3GQC A;  5CJ7 A;  2ZIV A;  5J2B A;  3E0F A;  3C2L A;  1XSP A;  2NRX A;  2IBK A;  5EWG A;  1ZD5 A;  1QLN A;  2PFN A;  3RJE A;  2F1H A;  2W9C B;  4MEX A;  2BZF A;  2FDR A;  3ZI4 A;  3KHR A;  1F0M A;  3UQ0 A;  3ONN A;  5KG0 A;  3SV4 A;  5L1L A;  3HW8 A;  1NNL A;  1ZXI A;  4Y2T A;  2PKE A;  3T5L A;  3PR4 A;  4ACO A;  2R18 A;  4YN4 A;  1KN5 A;  4RNN A;  4EEK A;  4F5P A;  1SGG A;  2GO7 A;  4C8N A;  7ICM A;  3V6H A;  1TAM A;  2V9W A;  1Z3E B;  3QZ7 A;  1Z19 A;  2QB1 A;  3M9M B;  3KHL A;  4DL4 A;  4EX6 A;  2LMR A;  2BCV A;  3RJH A;  5KG5 A;  4UB4 A;  3H4B A;  1SKW A;  3Q8K A;  2CXY A;  4G9B A;  1ZQU A;  1RYS A;  1T94 A;  2VJ5 A;  3M8R A;  3N97 B;  1JXL A;  1V38 A;  3VCB A;  5DDY A;  4C7Z A;  1BNP A;  3QU7 A;  4PHP A;  4FBU A;  3KD3 A;  2W3R A;  2OWO A;  1B0X A;  3L5K A;  5J0Q A;  2KSO B;  4I2I A;  4QZD A;  1UT8 A;  1S10 A;  5AI0 A;  3WKC A;  3FDS A;  3BDP A;  1V97 A;  1DK2 A;  1IV8 A;  2C22 A;  5ALM A;  4I2J A;  3ZD8 A;  4RPZ A;  4KLS A;  4UAS A;  4PGQ A;  4UB8 U;  3ALR A;  2HVH A;  4UW9 A;  5AIA A;  2JH1 A;  4US9 A;  3JPN A;  3KBB A;  3Q8Q B;  2XGP A;  1ZJN A;  4FE3 A;  2WF8 A;  2A1A A;  3QEB Z;  4O5E A;  3SEI A;  3RAQ A;  1UQV A;  1ARO P;  3CYM A;  3TAQ A;  4CDG A;  1L3T A;  2KVC A;  4XA5 A;  4O3S A;  4ELT A;  4KLD A;  2WF6 A;  3PW0 A;  5DQH A;  3TAP A;  4M9L A;  2DBY A;  4GIB A;  1X9S A;  2IHN A;  5ALD A;  4ECY A;  4RQ2 A;  4P0P A;  4G3I A;  1SIJ A;  3RH5 A;  5IIJ A;  4F3O A;  1L7P A;  1TE2 A;  4IS7 A;  2KZ3 A;  3V6J A;  4BX9 C;  4Z6D A;  2HBJ A;  4O3N A;  2F2A B;  4O3O A;  2HOQ A;  4UAR A;  9ICV A;  4TUQ A;  4BXO B;  3S6J A;  1X6J A;  5KAF U;  5JU5 A;  4O5K A;  3SAH A;  4DQI A;  4QNL A;  5KFI A;  4IR1 A;  1LKY A;  2AXT U;  3PW4 A;  1A77 A;  2Z7J A;  1JAL A;  3H4D A;  4UB1 A;  1ZQJ A;  1VLB A;  2R8J A;  3C1Z A;  4Y2V A;  2YN4 A;  5J8Y A;  4DL2 A;  3C23 A;  4FZL A;  4CF5 A;  1RXW A;  4GXK A;  2YB4 A;  5KG3 A;  1HUZ A;  1TV9 A;  3RJI A;  3RJG A;  1MN8 A;  1RQL A;  3PO4 A;  3Q8M A;  8ICV A;  2VA2 A;  4Y2Q A;  5KFU A;  1L5U A;  1KW4 A;  2H3Q A;  5FP0 A;  1S0V A;  2J6U A;  3KKA A;  1H38 A;  3QUB A;  4I2A A;  3PSF A;  2I6X A;  3N7P D;  3NS1 A;  2PMZ C;  4DWI A;  4KX3 A;  1JI7 A;  5BPC A;  3LK9 A;  4M9N A;  3A0H U;  3HRD D;  3T5J A;  4YVZ A;  1ZQG A;  3AUO A;  5KG7 A;  2FE9 A;  1MQ3 A;  3SI8 A;  1Q3V A;  2DFL A;  4NJ8 A;  2A3V A;  4KLQ A;  5KAI U;  4R66 A;  4RQN A;  4B9V A;  1KTQ A;  3FC4 A;  4ED8 A;  2HVI A;  2MUT B;  3Q8S B;  3NGD A;  4UAZ A;  4QZE A;  4YR2 A;  4RQ5 A;  4KMO B;  3F2C A;  2A1J B;  3GV5 B;  2KD1 A;  3NTU A;  4C0Z A;  9ICT A;  5GTI U;  4QZ8 A;  4EEY A;  3PST A;  4ECW A;  5J2H A;  1L3S A;  4NLZ A;  1ZQR A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  3KKA C;  2K4P A;  2LMR A;  3BS5 A;  3TAD C;  2KMD A;  5JU5 A;  2L5Y A;  1DXS A;  1LKY A;  2QB0 B;  3BS7 A;  1SV0 A;  4RQM A;  5J8Y A;  1V38 A;  2E8P A;  1PK1 B;  2E8N A;  2EAP A;  1SXD A;  1B4F A;  2QKQ A;  1B0X A;  2ESE A;  1X9X A;  2QAR B;  2KSO B;  1OW5 A;  1Z1V A;  1SXE A;  2Y9T A;  1UCV A;  5L1M A;  1KW4 A;  2EAO A;  1V85 A;  1RG6 A;  3KKA A;  2E8O A;  2DKZ A;  3IDW A;  2GLE A;  1COK A;  2KIV A;  2EAN A;  2LPE A;  1SV0 C;  1X40 A;  3BS5 B;  5J8Y C;  2EAM A;  1LKY B;  2F8K A;  1JI7 A;  5JRT A;  2DKX A;  4PZO A;  1OXJ A;  3K1R B;  1PK3 A;  3SEI A;  2QB0 A;  4NL9 A;  2FE9 A;  1UQV A;  5KNI A;  2B6G A;  2D3D A;  2D8C A;  3BQ7 A;  4NJ8 A;  3H8M A;  2F3N A;  1F0M A;  2F44 A;  3HIL A;  3TAD A;  4PZN A;  4RQN A;  1PK1 A;  2ES6 A;  2KG5 A;  5JTI A;  3SEN A;  5F3X B;  3TAC B;  1WWU A;  2QAR A;  2KSO A;  2YTU A;  4IS7 A;  1SGG A;  2KE7 A;  2E8M A;  2Y9U A;  1WWV A;  2DL0 A;  1X66 A;  2K60 A;  2QB1 A;  4MHV A;  4NL9 C;  2JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...