1B4FA

Oligomeric structure of the human ephb2 receptor sam domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
PDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPHB2
publication title Oligomeric structure of the human EphB2 receptor SAM domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
total genus 26
structure length 74
sequence length 74
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1998-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1b4fA00
5J8YA 2KSOB 3K1RB 2DKXA 1KW4A 2DL0A 4NL9C 2E8NA 2B6GA 1V38A 3BS7A 5L1MA 3KKAC 1B4FA 3SENA 2ESEA 1B0XA 2YTUA 1X9XA 4PZNA 3HILA 1UCVA 2Y9TA 1V85A 2ES6A 2F3NA 5JU5A 5J8YC 1DXSA 1SXEA 1SGGA 2JV3A 2EAMA 3SEIA 2E8PA 2KIVA 1RG6A 1PK1A 3BQ7A 3IDWA 1SXDA 1X66A 1SV0A 2KE7A 3H8MA 1WWUA 2KG5A 1WWVA 1F0MA 4IS7A 3TADA 1Z1VA 4NJ8A 2FE9A 2QARA 1PK1B 1SV0C 2L5YA 2DKZA 1LKYA 2KMDA 2GLEA 2F44A 5F3XB 5JTIA 2QARB 2QB1A 2LMRA 2D8CA 2E8OA 1COKA 1X40A 4NL9A 4RQNA 4RQMA 1LKYB 3BS5A 2QB0B 3KKAA 2K4PA 2EANA 4PZOA 1UQVA 2F8KA 1OXJA 5JRTA 2EAOA 2LPEA 3TADC 1JI7A 1PK3A 2E8MA 3BS5B 4MHVA 2K60A 3TACB 2QB0A 2KSOA 2Y9UA 2EAPA 2QKQA 5KNIA 1OW5A 2D3DA 1SV4A
chains in the Genus database with same CATH superfamily
4Y2UA 3CNHA 4F8RA 1KW4A 3MFHA 5D46A 1NKCA 2K89A 4C8MA 2F76X 4DL2A 2W3RA 2KHQA 3ORYA 4KLFA 2BCUA 2MU2A 4F5RA 3PY8A 2AQ0A 5ALUA 1ZQAA 1SWVA 2JZBB 4AP9A 5KT6A 3ZDBA 3H8SA 4Q8FA 4ED1A 4DL4A 3BJYA 2Q4TA 4IRDA 7ICFA 2KVSA 5J8YC 1PZNA 1DXSA 4RPZA 4F4KA 4OCZA 3BZKA 4UAYA 3PO4A 1K1QA 3QXGA 1XO1A 4R65A 2K4HA 2ASLA 4GLXA 4KITB 4ECXA 2KG5A 4F4ZA 2IA6A 4DEZA 5AK4A 4GC7A 1D8BA 2HHUA 3QU7A 4PHEA 2OM6A 2KVCA 3AUOA 2VA3A 1XS9D 3C5GA 2Y1JA 2RDJA 3QU5A 5L1LA 3MBYA 2BZFA 2NRWA 4ECWA 5ALNA 3AQEA 2D8CA 1BPYA 2KEYA 5CJ7A 2KD1A 3AQFA 4O9MA 5BOLA 4Z6EA 2R8IA 1SZHA 1L3TA 1XC9A 3BS5B 5KTQA 4C7YA 2V9WA 5L1IA 4F2SA 3F53A 4NWIA 1SV4A 5KL8B 3FM9A 4UAZA 4F93B 1A6SA 5CHGA 4MF8A 5AIBA 1J2MA 4FE3A 3H4BA 2BQ3A 2DKXA 4ZOHC 4PGXA 1LB2B 4BWMA 1O08A 4OJ6A 1ZQFA 4CF4A 3T3FA 2XIDA 5H2FU 7ICKA 1NJXA 4I28A 3V6HA 4US8A 1MA7A 2K8AA 7ICHA 3D2NA 5J2AA 4J9RA 4J03A 1L3VA 1NOMA 2KFNA 1S10A 9ICVA 1PVRA 1FEZA 3T5KA 3LYSA 3H7IA 4USAA 1L7PA 4DOCA 3R9KA 4AYBF 9ICGA 2DFLA 2KIVA 3T5JA 1PK1A 4M9HA 5KFJA 4QZHA 9ICNA 4GFJA 1L7OA 5HR6A 1SL1A 3Q8RB 1QQ6A 4KX5A 2UVWA 9ICHA 4IR9A 5CEHA 3PX6A 1DGJA 2UVRA 2AGOA 2F1HA 4MEYA 4J9SA 2HDOA 4I2IA 5EE1A 1A76A 4KLMA 2P66A 4DSLA 3K4GA 1KFDA 2BQUA 2G08A 2BR0A 5AKHA 3EWAA 2KIWA 1NJZA 5KFXA 5KFCA 1L8OA 1WYGA 2I5HA 3C1YA 3QYPA 3EZ5A 1BGXT 9ICKA 1NK6A 2VANA 3ZD8A 1N56A 4QWEA 2FI1A 4O3OA 4Y2YA 4MFAA 9ICJA 2HOQA 4F4XA 1RXVA 3MDCA 1JRPA 1L8LA 3QU2A 3RB4A 1ZQOA 1JROA 3LWLA 4ED8A 1S76D 2MAXA 2DQNB 1C7YA 3IP4B 3GQCA 4PL2A 1QLNA 4Y2SA 3RH4A 4ECQA 5AKKA 3SAFA 2RQ5A 4PH5A 2G09A 3IRUA 3KOOA 3TANA 4UW9A 1N48A 4EYIB 4CCHA 2ZTDA 3H0MB 4DFJA 1X2IA 1UT5A 9ICIA 4ECRA 3PR4A 4IQTA 3WK4A 5EOZA 2W7PA 5ALZA 1ZOLA 3PSFA 1L3UA 2OYYA 1PK1B 1X42A 1GO3F 2KJ5A 5K4LA 1S97A 3AL0B 5ALKA 1NKEA 2A1JA 4QZFA 5D49A 2LMRA 2ZIXA 2XC9A 1JXEA 4G9BA 2IHNA 1NNLA 5B66U 5KFYA 2W7OA 3KKAA 4YXMA 3KZXA 4KLHA 3OHAA 2EAOA 1XO0A 3OJSA 2HOFA 3RR7A 2M0NA 4UQGA 4C4RA 2JHDA 3KZIU 4ICAA 2Y9UA 4OJOA 2NO4A 5ALRA 4R8UB 2G0AA 2V4QA 5CB1A 5GTHU 4ED3A 4DQIA 2NO5A 3FYHA 4B9LA 3MGVA 5AM3A 2WHEA 4JK1A 3RJGA 3L5KA 7ICRA 1Z00A 3CP8A 2H5XA 5DB6A 3G6XA 3SAHA 5BOMA 3N28A 5J2CA 2LM4A 5KG0A 5IIIA 5J2KA 5KFMA 2WF5A 2NYVA 5KFUA 2PI4A 2W04A 1NK8A 1XNSA 3HILA 5ALMA 4QZ9A 3RRGA 1CEZA 3C2KA 1UHUA 4ECUA 2FLLA 2N1RA 2E1EA 2R8JA 5KT5A 4XRHA 7ICJA 4Y2VA 2G5IB 4DSJA 3T79A 4MF2A 4J9PA 4DFDA 3OTQA 4KN4A 4I2JA 4K4HA 3BQ0A 1SB3C 5KFNA 3NVVA 4FO6A 2FDRA 1IXRA 2HHXA 1T8EA 3TQ1A 2WF9A 1F0MA 2AXTU 4OJPA 5HMMA 5DKWA 4IS7A 1ZQIA 3AU6A 2W11A 2NRZA 5KFDA 3U26A 4PHDA 5KFSA 3QUCA 1ZRNA 9ICQA 3PSPA 2AHOB 4RPYA 3BZCA 4ED6A 3QU9A 4C4TA 2W43A 9ICTA 2LI6A 2ISPA 2JGAA 4JUZA 2HW3A 3M1YA 1J2NA 2F8KA 2ZIXB 2FPKA 4TQSA 3RTVA 2J6UA 8ICKA 4B9UA 4UAUA 2BQRA 5ALPA 2PFQA 9ICPA 3QNMA 4PGYA 1Q8KA 3C29A 4QW9A 4Y2TA 3QU4A 1T7PA 3EUB2 3PW7A 2CXYA 3V72A 3M6ZA 4DLEA 5J0RA 5DB7A 2YMMA 3ICXA 4DL7A 2XY7A 2FPLA 3K1RB 5J0WA 3RFAA 3NUQA 2WB1F 4TQRA 3LK9A 4I2GA 9ICWA 3WK9A 3KKAC 4BX9C 2K4IA 3MGIA 2KN7A 4EX6A 1NK4A 5AKJA 1Z00B 2ESEA 1ZQJA 4DSFA 4XQ8A 1PVQA 1YT3A 4CF3A 3NASA 5FP0A 2KJ9A 2CRXA 2HHQA 4TUPA 1SGGA 5AKGA 4YCXA 4RUCA 1ZQWA 1NJWA 5J29A 3GV7B 2G07A 1ZQVA 1WWVA 2KZMA 1DK3A 4P4PA 5AK5A 2IOHA 3TADA 4FBUA 4B9SA 3RH5A 5DBAA 2J6TA 4F5OA 2DKZA 1ZQYA 3SMVA 8ICAA 4F5NA 1ZQXA 7ICIA 2BCVA 4I2AA 9ICRA 3H0LB 4Q45A 2MUTA 3JPRA 5KAIU 3F5EA 3N7SC 2C22A 1UQVA 4QWAA 3GILA 1OXJA 4ECYA 5DG8A 3SAGA 1SL2A 5BPCA 4PHPA 3JPSA 5KFBA 5F9LA 1T4GA 5KG7A 4DSIA 4IQWA 1X9SA 1XWLA 8ICRA 4M47A 5L1JA 2HI0A 4RQ6A 2FMPA 2EZXA 1HEKA 1U4BA 3V6KA 3WKBA 4IQVA 2R8KA 5DGBA 8ICBA 5L9XA 2DWQA 1YZ7A 2EQYA 4F72A 1AQ6A 4PZNA 3G6VA 1MC8A 4RQ8A 2I6XA 4O0IA 2W9BA 5ALHA 4YR3A 3M8SA 4ZH4A 4DF4A 8ICIA 1V85A 2ES6A 1LVHA 2VKQA 4YVZA 5DGAA 4UBCA 1ZQZA 5J2FA 4P4OA 3IG5A 2BCQA 4GXKA 3OSNA 1S5LU 3V6JA 3ZDCA 5C0YA 4JB3A 2XO7A 3CW2C 3HJEA 1X66A 8ICEA 4Q8EA 2YN4A 4M6WA 1RYUA 5DQGA 2EDUA 4LZDA 2K4EA 2W54A 2KZ3A 4KLSA 1LV5A 3GZFA 3QZ7A 4RU9A 8ICFA 4J9NA 1KDHA 5KFOA 7ICSA 2QB1A 9ICFA 3S6JA 4RNOA 2W9CA 4C7ZA 1X40A 1L7NA 5DQIA 2GH1A 3WKDA 1SKSA 4YQWA 3HPOA 2XGPA 1NZBA 5DQHA 1ZJNA 1CUKA 4GXJA 1ZQBA 3TADC 3AEVA 3UM9A 4DOBA 2MUTB 3AN1A 4MHVA 1KRPA 4F91B 4YD1A 7ICEA 2RDIA 3RJJA 3TAQA 1OW5A 3ISDA 2H3IA 5KT4A 4KLJA 7ICNA 2YQEA 1DGSA 9ICLA 1V38A 2BDPA 4DSEA 1WUDA 1ZETA 1JXLA 1JUDA 5KT7A 5AKYA 3PW2A 2FJ6A 1NK0A 9ICUA 1XU4A 5J0UA 3TI0A 1QQ5A 3GFKB 4FZNA 4DO9A 1KFTA 9ICMA 5ALSA 1NK9A 1KN5A 1VLBA 4BUGA 1DK2A 4Z6FA 1ZQDA 4K4GA 1D9FA 2HVHA 5D4BA 2W9BB 4NV0A 2JV3A 5EWGA 3SEIA 4KLQA 1X6JA 2E8PA 2H3FA 3K1ZA 1ECWA 4P2HA 4IQUA 3N97B 1U47A 3LVWA 2ALZA 2CN1A 2ISOA 1IG6A 4J9KA 2KOBA 5ALYA 4P4MA 1BNOA 2Y1IA 8ICQA 1HUOA 2L5YA 4NLKA 5F9NA 4M6WB 4OJLA 8ICHA 5F3XB 3JPPA 4P0PB 3RJEA 3IM1A 1KEJA 2PMZF 3ED5A 2IHMA 3LVVA 4P0QA 2P6UA 4EZ9A 8ICTA 4UB1A 3NRWA 8ICXA 5C5JA 2W9CB 5JRTA 3PNCA 3NVYA 4QWBA 1JI7A 4U7CA 5KFFA 1RDFA 4I2DA 1ZYQA 1QSSA 2HVIA 3M7DA 3M9MB 2ZJ8A 1TK8A 4KLUA 9ICEA 8ICCA 2BCSA 2HBKA 2A3VA 1SKRA 1N5XA 2XICA 2GO7A 4OJ5A 4ED0A 1DRGA 3C2LA 1COOA 4RPXA 5J2IA 2YB4A 2BHNA 3EPIA 4J9LA 3RB3A 1RYRA 4R8UA 3UQ0A 2JEFA 2NV3A 5L1MA 1OUQA 2PMZC 5AIAA 3H8JA 4DF8A 3CRXA 4O3SA 2Z7JA 4UATA 1YZ6A 3FC4A 5ALDA 1ZD2P 2VJ4A 3GV8B 2Y9TA 5AICA 4UB5A 3Q8SB 3WK6A 2IOFK 3RRHA 3JPOA 1TVAA 2FLNA 4LVSA 5HMLA 7ICPA 4LJXA 2FMSA 2KICA 4DQSA 4C4SA 1U9LA 1ZD3A 1URJA 1RZTA 1KKXA 4YFKA 2BCRA 2M9NA 1ZD4A 4UB4A 1WWUA 1NK7A 3HW8A 2MRLA 2ZTEA 4ECSA 8ICUA 1VDVA 2PXIA 4GIBA 1ZQTA 2QARA 2JEGA 8ICNA 2KK0A 3FAHA 5AK3A 4O5EA 3LDAA 1ZRMA 1A0PA 9ICOA 8ICLA 4QIWF 3EYZA 1IM4A 3SD7A 2WAQC 3DV9A 3SV3A 1L3SA 4GXIA 2ASDA 2RLTA 5ALQA 4B9TA 1ZQKA 2E8OA 4IL6U 3ZDAA 3Q8PB 3RH6A 5KG5A 4DOAA 1NK5A 3T5HA 3BDPA 4F4YA 5DLGA 5AM5A 1ZQLA 2PI5A 4P0QB 4DL6A 2NRTA 3N4MB 3TACB 2KSOA 4FS2A 4ELVA 5DB8A 5J0QA 5ALTA 2KJ8A 2F77X 4KMUA 1QQ7A 1QSLA 3PW0A 2BPGA 4QIWC 4DQRA 3B0YA 1JN3A 2G06A 1PVPA 4YG2A 4JWNA 1ZQUA 4G3IA 3GIJA 4I2EA 3NS1A 2RP5A 1S9FA 5CA7A 1B0XA 5B5EU 1Q46A 1A77A 2F1IA 4M04A 1SIJA 2PKEA 3MR3A 4WJ3B 5TZVA 4GC6A 2ZTCA 2WTFA 1X9MA 2HHWA 1RYSA 1D8YA 1F5SA 5AKEA 5AM0A 4B9VA 3N7PD 4JMUA 1HJPA 1ZQCA 2DBYA 4Y2QA 1BPDA 3NGDA 2ZXIA 2LM1A 1TAUA 1K1SA 1BPXA 2DGZA 4TUQA 2W9MA 3H8MA 4FS1A 4UB3A 8ICVA 3M6KA 3RBEA 3F2CA 1UA0A 2WF8A 2HMXA 5KFLA 1FFVA 3WKAA 1Z4NA 4I2HA 2P35A 2FLPA 3RR8A 1T3NA 4RQ1A 1T3QA 2BGWA 3Q8MA 3M9NB 4RNNA 2A1AA 5KFZA 2QARB 3PMNA 2CPRA 1RQNA 1FFUA 4ECVA 5HHIA 4DS4A 4PL1A 8ICWA 2LYHA 4A8EA 2O6KA 2AGPA 2XVTA 3LWMA 4F4WA 1B43A 4BWJA 1F44A 4RQ7A 4Y2PA 5KFGA 4PGQA 2D6FC 2LPEA 2NRVA 2AQ4A 3QEAZ 3PV8A 4FFDA 2OWOA 2W8KA 1BVSA 5EWFA 1FIQA 4DSKA 3C21A 4YD2A 1ZQEA 1BPBA 1JX4A 2KSOB 5AKLA 5KFWA 5T14A 7ICUA 4DL3A 2DL0A 1FO4A 3WK8A 4U6PA 3RB0A 3ALRA 4EBCA 2EZYA 4DL5A 1H38A 2ZJ5A 1Z3EB 3RF9A 3KD3A 4M9GA 8ICSA 2E1FA 4RQ5A 4K4IA 3MGHA 1UCVA 3CYMA 3IHQB 3V7JA 2MSNA 2JMGA 7ICGA 5J2EA 8ICYA 2ODGA 2ZUDA 2OH2A 5JU5A 4ELTA 2DF4B 2MA1A 5KG3A 5E79U 5ALFA 3IDWA 2V4RA 3MR6A 2LHTA 2FE9A 1ZQSA 1ZD5A 3H4DA 3I1YA 4EELA 2IOFA 3NVWA 5AM2A 2Y0SC 4MFFA 2BDUA 3UMBA 1RXWA 1MN8A 4YR0A 5J2GA 4IR1A 1P7DA 4YN4A 1J97A 3QUTA 3GIKA 4NL9A 3UMCA 4E0DA 4RQ4A 1ZQMA 4RQ2A 4FZLA 2QB0B 3PSIA 2ZIUA 2KP7A 4O3MA 3PX4A 3TFRA 1IIPA 5J0SA 2W8LA 2H3ZA 4Z6DA 3OPXA 3ETRA 2VA2A 4QZEA 1XSPA 3ZDDA 2JR5A 3N7RC 5AM1A 3O0FA 2DPIA 4NY8A 4XUSA 4UB6U 2EH9A 4CE6A 9ICBA 1B22A 1ZQRA 1JALA 3C28A 3IN5A 2YY6A 3SENA 2AGQA 2JRZA 3EPGA 3B9JA 4ACOA 1ZQHA 5HP4A 5IIMA 4J9OA 3M9OB 3MABA 4MEXA 1SZPA 4EZ6A 3JPNA 5KT3A 2ZIVA 4F92B 1SXEA 4NLNA 2ZUBA 2EAMA 5KG1A 4UAWA 4TUSA 1SXDA 1ZQNA 2HBLA 1QTMA 3UXOA 3MDAA 3F2BA 1N5WA 4DS5A 1Z1VA 3EW9A 5J0YA 3PZPA 3H40A 3QUQA 1UT8A 5AHXA 2GWSA 1U48A 2YMLA 3QZ8A 4YMOA 7ICLA 5KFAA 4I2CA 3IV6A 1LKYA 2JXJA 2KMDA 3MC1A 3ZD9A 3Q8KA 4F5PA 5AKXA 2XCPA 1U45A 4NM2A 1KTQA 9ICCA 2OHFA 4QZGA 3I28A 1WCNA 2E3TA 4EYHB 1X9WA 2E5SA 4QZCA 3QUBA 4P0PA 3PSTA 2AU0A 2EZZA 4KLGA 2E8MA 3RJIA 4XA5A 4M9LA 2K60A 5HNKA 2YMQA 5DB9A 2ZIUB 3C23A 3HWTA 5DLFA 4BJQA 2YB1A 1QSYA 5DDMA 3HKZC 5DDYA 2UVVA 4DWIA 4KLEA 2KZZA 5KFRA 4UARA 3H0RB 4CF5A 5CP2A 4UB2A 3HX0A 4QZIA 4Y2RA 4PPXA 4NL9C 4Z6CA 1S0VA 5AKZA 2F2AB 4M9JA 1N61A 2WFAA 5J0TA 4R64A 2H3VA 3SV4A 5EE3A 3TAPA 4DQPA 2KKPA 4JWMA 5IINA 4FBTA 5ALJA 2Q0ZX 3VC8A 4EEYA 3GIIA 1S0NA 2R8GA 7ICVA 1KQQA 1DOQA 2KFZA 1RG6A 5AI0A 9ICXA 3BQ7A 4ECTA 2ZIVB 1KFSA 4B6JA 2ZIWA 3C1ZA 1AROP 3B0XA 1Y88A 9ICAA 5J2DA 1L6NA 1SV0C 4F5QA 2W55A 3AM9A 1Z19A 3ISBA 2GLEA 3NVZA 2OCEA 4PJ0U 4O3RA 2F8LA 3PW4A 4F3OA 4B9MA 5HHHA 5GTIU 1HUZA 2BPCA 3WK7A 2DUYA 1LKYB 5TISU 4QZDA 1S8OA 5J2HA 4HAIA 8ICGA 1WG8A 1V97A 1ED1A 5ALXA 2KHVA 2BKEA 3ONNA 5AI6A 2QKQA 3PW5A 1IV8A 4JV1A 3GDXA 2RHFA 2VIXA 2D3DA 4DCCA 2XGQA 1TFRA 4R66A 4C80A 5J2BA 3UXPA 5KT2A 3GIMA 1XSNA 3D2QA 2IBKA 2PFPA 2WF7A 1HIWA 2ATLA 5KG4A 7ICTA 2G5HB 3F2DA 4RQ3A 5AI8A 2OXOA 2P6RA 4DFKA 3THVA 2K8CB 4US9A 4O3QA 1TK5A 5EE0A 1XSLA 4OD0A 5J2JA 4YMNA 4TURA 4F2RA 4NLBA 3QE9Y 5J0OA 1V9PA 2XI9A 4UAVA 2BPFA 2W3SA 3RJKA 5JUMA 2FPMA 1PUZA 4KX3A 4NXZA 5AK6A 2XCAA 5KFHA 1TK0A 5ALIA 5ALVA 5G5GA 7ICMA 4DFPA 2WAQF 3UXNA 3A0BU 3KHLA 4RZRA 2JEJA 1N2XA 3WK5A 2WF6A 2B21A 4AYBC 2A19A 5DG9A 3V7LA 2ZIWB 5AI5A 4MFCA 1M6YA 2F44A 1MSWD 5ALEA 5DBCA 3MFIA 1N62A 4QWCA 1COKA 3Q8LA 4UB8U 4EEKA 4RQMA 1MQ3A 2YMPA 4HYKA 4O5CA 3UPQA 3UQ2A 2H3QA 2K4PA 5KAFU 5IIOA 2ZG6A 2W9AA 4NLGA 1ZXIA 8ICMA 5IIJA 3TARA 1D8LA 3DEEA 5DBBA 4O3PA 2ASJA 3J81j 1PK3A 2GOLA 1ZQ1C 1SL0A 2FMQA 1S0MA 4F50A 4RT3A 3OJUA 4I2FA 3WKEA 3QX7A 2HCFA 2R8HA 3PVXA 1U49A 5ALGA 2LKYA 2HSZA 1WCLA 1CRXA 4NLZA 5AM4A 5L1KA 5IIKA 2E8NA 4DFMA 1UA1A 2B6GA 4C8NA 3KHRA 5HR7A 3BS7A 5KFPA 1ZQPA 4EBEA 2DPJA 2YTUA 4DQQA 4PHAA 4C8KA 4FZMA 3AMZA 4Q44A 4UASA 2HBJA 2KTQA 2JH7A 2AH5A 1TKDA 4CNQA 1RQLA 5EWEA 4KLTA 2F3NA 4NLCA 1CI4A 1N60A 5KG2A 3F5AA 5CRXA 3GV5B 1RM6C 2VJ5A 4EX7A 4YR2A 4QNLA 4O5KA 2ZUCA 2F1JA 1MQ2A 5IILA 1VJ5A 3SI8A 2HHSA 3T5LA 2KE7A 3PR5B 1SKWA 3RJHA 4NJ8A 4M0AA 1O03A 5KFKA 4Y2XA 1Q3VA 4CDGA 5AI4A 1QH9A 3NRZA 2K8BB 4QWDA 4BXOA 3PMLA 4JV0A 2C28A 4LZGA 5JTIA 5CWRA 3DDHA 2VA8A 3I76A 3GU3A 1NKBA 3E2EA 4J9MA 4F71A 3UMGA 2XY6A 4RT2A 5J0PA 4Q43A 1NZPA 4I29A 2IMWP 4PZOA 3KTQA 5J0XA 3OSPA 5KFQA 4DLGA 3JPQA 1L7MA 4JV2A 3OGUA 2J6SA 3VCBA 5KL1B 4QZAA 4C8LA 2QB0A 8ICZA 8ICJA 3ZI4A 2LYBA 4EENA 4BGDA 2ZJAA 3BQTA 3RJFA 4KLOA 4O3NA 3TFSA 3L4PA 2R18A 1S0OA 3ISCA 1X6IA 2I9GA 4I27A 4KLDA 4BDPA 4ELUA 1TE2A 1B4FA 1UPHA 8ICPA 1X9XA 2QLTA 5KG6A 3K75D 5A0LA 1T94A 2NRXA 4UBBA 8ICOA 5G5HA 3NTUA 3JPTA 2RRDA 3L3FX 2HBMA 3H8WA 4QW8A 4IRCA 5KFVA 4CRXA 2KV2A 4X5VA 2Y0SF 4QZ8A 1JMSA 4C0ZA 4YMMA 2XY5A 5KFEA 3E0FA 3BQ1A 1JIHA 4KTQA 2A1JB 1Z4OA 3MR2A 2OEHA 2JEIA 3C2MA 1TV9A 3TKAA 2KNJA 1NI3A 2B0CA 4IC9A 2AJQA 2JH1A 2HOIA 1BNPA 4I2BA 4RQ0A 4NM1A 2UVUA 5ALOA 3KHHA 7ICQA 3C5FA 4BXOB 3RAQA 2LBOA 4RUAA 1KSPA 2KKVA 3IG8A 1S77D 1SWWA 2PFOA 3SYZA 3RB6A 3M8RA 4ED2A 3WKCA 3V7KA 3KFUF 4M2YA 3HP6A 3HT3A 4RNMA 4QJFB 1ZQQA 4IRKA 4KLLA 3RBDA 1RPLA 3BQ2A 5J8YA 1TAMA 4C8OA 3D2SA 2JZBA 2I1QA 5DG7A 4B9NA 4QZBA 2C2EA 4Y2JA 2PFNA 4OO1J 2YX8A 4EBDA 5AI9A 5ALWA 3OHBA 3ZDEA 5AKIA 1QCKA 3ETLA 5KFIA 1EXNA 1Q3UA 5ALLA 5KFTA 4CGZA 3Q8QB 2WB1C 2W03A 5EE9A 3FDSA 3G6YA 1Z1BA 9ICSA 4KLIA 3PX0A 4J9QA 1KLNA 3AU2A 4KN7A 3E58A 1KL9A 1SV0A 4YXJA 4R63A 2ZXHA 3HRDD 3SZ2A 1N63A 3SR6A 4M9NA 1C20A 3SQIA 1K5OA 3A0HU 3WU2U 4KMOB 4ECZA 1L5UA 3QEBZ 2C2RA 4RQNA 1D9DA 3BS5A 1NJYA 4ED7A 2EANA 7ICOA 3HKZF 3KBBA 1BPEA 1ZQGA 3RAXA 1ZJMA 3PO5A 2LYAA 1KBUA 2HHTA 2HHVA 3D6JA 1TAQA 2EAPA 4YP3A 5KNIA 1BPZA 2C2DA 3MR5A 5CR0A 3KHGA
chains in the Genus database with same CATH topology
5J8YA 2KSOB 3K1RB 2DKXA 1KW4A 2DL0A 4NL9C 2E8NA 2B6GA 1V38A 3BS7A 5L1MA 3KKAC 1B4FA 3SENA 2ESEA 1B0XA 2YTUA 1X9XA 4PZNA 3HILA 1UCVA 2Y9TA 1V85A 2ES6A 2F3NA 5JU5A 5J8YC 1DXSA 1SXEA 1SGGA 2JV3A 2EAMA 3SEIA 2E8PA 2KIVA 1RG6A 1PK1A 3BQ7A 3IDWA 1SXDA 1X66A 1SV0A 2KE7A 3H8MA 1WWUA 2KG5A 1WWVA 1F0MA 4IS7A 3TADA 1Z1VA 4NJ8A 2FE9A 2QARA 1PK1B 1SV0C 2L5YA 2DKZA 1LKYA 2KMDA 2GLEA 2F44A 5F3XB 5JTIA 2QARB 2QB1A 2LMRA 2D8CA 2E8OA 1COKA 1X40A 4NL9A 4RQNA 4RQMA 1LKYB 3BS5A 2QB0B 3KKAA 2K4PA 2EANA 4PZOA 1UQVA 2F8KA 1OXJA 5JRTA 2EAOA 2LPEA 3TADC 1JI7A 1PK3A 2E8MA 3BS5B 4MHVA 2K60A 3TACB 2QB0A 2KSOA 2Y9UA 2EAPA 2QKQA 5KNIA 1OW5A 2D3DA 1SV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J8Y A;  2KSO B;  3K1R B;  2DKX A;  1KW4 A;  2DL0 A;  4NL9 C;  2E8N A;  2B6G A;  1V38 A;  3BS7 A;  5L1M A;  3KKA C;  1B4F A;  3SEN A;  2ESE A;  1B0X A;  2YTU A;  1X9X A;  4PZN A;  3HIL A;  1UCV A;  2Y9T A;  1V85 A;  2ES6 A;  2F3N A;  5JU5 A;  5J8Y C;  1DXS A;  1SXE A;  1SGG A;  2JV3 A;  2EAM A;  3SEI A;  2E8P A;  2KIV A;  1RG6 A;  1PK1 A;  3BQ7 A;  3IDW A;  1SXD A;  1X66 A;  1SV0 A;  2KE7 A;  3H8M A;  1WWU A;  2KG5 A;  1WWV A;  1F0M A;  4IS7 A;  3TAD A;  1Z1V A;  4NJ8 A;  2FE9 A;  2QAR A;  1PK1 B;  1SV0 C;  2L5Y A;  2DKZ A;  1LKY A;  2KMD A;  2GLE A;  2F44 A;  5F3X B;  5JTI A;  2QAR B;  2QB1 A;  2LMR A;  2D8C A;  2E8O A;  1COK A;  1X40 A;  4NL9 A;  4RQN A;  4RQM A;  1LKY B;  3BS5 A;  2QB0 B;  3KKA A;  2K4P A;  2EAN A;  4PZO A;  1UQV A;  2F8K A;  1OXJ A;  5JRT A;  2EAO A;  2LPE A;  3TAD C;  1JI7 A;  1PK3 A;  2E8M A;  3BS5 B;  4MHV A;  2K60 A;  3TAC B;  2QB0 A;  2KSO A;  2Y9U A;  2EAP A;  2QKQ A;  5KNI A;  1OW5 A;  2D3D A;  1SV4 A; 
#chains in the Genus database with same CATH topology
 4Y2U A;  3CNH A;  4F8R A;  1KW4 A;  3MFH A;  5D46 A;  1NKC A;  2K89 A;  4C8M A;  2F76 X;  4DL2 A;  2W3R A;  2KHQ A;  3ORY A;  4KLF A;  2BCU A;  2MU2 A;  4F5R A;  3PY8 A;  2AQ0 A;  5ALU A;  1ZQA A;  1SWV A;  2JZB B;  4AP9 A;  5KT6 A;  3ZDB A;  3H8S A;  4Q8F A;  4ED1 A;  4DL4 A;  3BJY A;  2Q4T A;  4IRD A;  7ICF A;  2KVS A;  5J8Y C;  1PZN A;  1DXS A;  4RPZ A;  4F4K A;  4OCZ A;  3BZK A;  4UAY A;  3PO4 A;  1K1Q A;  3QXG A;  1XO1 A;  4R65 A;  2K4H A;  2ASL A;  4GLX A;  4KIT B;  4ECX A;  2KG5 A;  4F4Z A;  2IA6 A;  4DEZ A;  5AK4 A;  4GC7 A;  1D8B A;  2HHU A;  3QU7 A;  4PHE A;  2OM6 A;  2KVC A;  3AUO A;  2VA3 A;  1XS9 D;  3C5G A;  2Y1J A;  2RDJ A;  3QU5 A;  5L1L A;  3MBY A;  2BZF A;  2NRW A;  4ECW A;  5ALN A;  3AQE A;  2D8C A;  1BPY A;  2KEY A;  5CJ7 A;  2KD1 A;  3AQF A;  4O9M A;  5BOL A;  4Z6E A;  2R8I A;  1SZH A;  1L3T A;  1XC9 A;  3BS5 B;  5KTQ A;  4C7Y A;  2V9W A;  5L1I A;  4F2S A;  3F53 A;  4NWI A;  1SV4 A;  5KL8 B;  3FM9 A;  4UAZ A;  4F93 B;  1A6S A;  5CHG A;  4MF8 A;  5AIB A;  1J2M A;  4FE3 A;  3H4B A;  2BQ3 A;  2DKX A;  4ZOH C;  4PGX A;  1LB2 B;  4BWM A;  1O08 A;  4OJ6 A;  1ZQF A;  4CF4 A;  3T3F A;  2XID A;  5H2F U;  7ICK A;  1NJX A;  4I28 A;  3V6H A;  4US8 A;  1MA7 A;  2K8A A;  7ICH A;  3D2N A;  5J2A A;  4J9R A;  4J03 A;  1L3V A;  1NOM A;  2KFN A;  1S10 A;  9ICV A;  1PVR A;  1FEZ A;  3T5K A;  3LYS A;  3H7I A;  4USA A;  1L7P A;  4DOC A;  3R9K A;  4AYB F;  9ICG A;  2DFL A;  2KIV A;  3T5J A;  1PK1 A;  4M9H A;  5KFJ A;  4QZH A;  9ICN A;  4GFJ A;  1L7O A;  5HR6 A;  1SL1 A;  3Q8R B;  1QQ6 A;  4KX5 A;  2UVW A;  9ICH A;  4IR9 A;  5CEH A;  3PX6 A;  1DGJ A;  2UVR A;  2AGO A;  2F1H A;  4MEY A;  4J9S A;  2HDO A;  4I2I A;  5EE1 A;  1A76 A;  4KLM A;  2P66 A;  4DSL A;  3K4G A;  1KFD A;  2BQU A;  2G08 A;  2BR0 A;  5AKH A;  3EWA A;  2KIW A;  1NJZ A;  5KFX A;  5KFC A;  1L8O A;  1WYG A;  2I5H A;  3C1Y A;  3QYP A;  3EZ5 A;  1BGX T;  9ICK A;  1NK6 A;  2VAN A;  3ZD8 A;  1N56 A;  4QWE A;  2FI1 A;  4O3O A;  4Y2Y A;  4MFA A;  9ICJ A;  2HOQ A;  4F4X A;  1RXV A;  3MDC A;  1JRP A;  1L8L A;  3QU2 A;  3RB4 A;  1ZQO A;  1JRO A;  3LWL A;  4ED8 A;  1S76 D;  2MAX A;  2DQN B;  1C7Y A;  3IP4 B;  3GQC A;  4PL2 A;  1QLN A;  4Y2S A;  3RH4 A;  4ECQ A;  5AKK A;  3SAF A;  2RQ5 A;  4PH5 A;  2G09 A;  3IRU A;  3KOO A;  3TAN A;  4UW9 A;  1N48 A;  4EYI B;  4CCH A;  2ZTD A;  3H0M B;  4DFJ A;  1X2I A;  1UT5 A;  9ICI A;  4ECR A;  3PR4 A;  4IQT A;  3WK4 A;  5EOZ A;  2W7P A;  5ALZ A;  1ZOL A;  3PSF A;  1L3U A;  2OYY A;  1PK1 B;  1X42 A;  1GO3 F;  2KJ5 A;  5K4L A;  1S97 A;  3AL0 B;  5ALK A;  1NKE A;  2A1J A;  4QZF A;  5D49 A;  2LMR A;  2ZIX A;  2XC9 A;  1JXE A;  4G9B A;  2IHN A;  1NNL A;  5B66 U;  5KFY A;  2W7O A;  3KKA A;  4YXM A;  3KZX A;  4KLH A;  3OHA A;  2EAO A;  1XO0 A;  3OJS A;  2HOF A;  3RR7 A;  2M0N A;  4UQG A;  4C4R A;  2JHD A;  3KZI U;  4ICA A;  2Y9U A;  4OJO A;  2NO4 A;  5ALR A;  4R8U B;  2G0A A;  2V4Q A;  5CB1 A;  5GTH U;  4ED3 A;  4DQI A;  2NO5 A;  3FYH A;  4B9L A;  3MGV A;  5AM3 A;  2WHE A;  4JK1 A;  3RJG A;  3L5K A;  7ICR A;  1Z00 A;  3CP8 A;  2H5X A;  5DB6 A;  3G6X A;  3SAH A;  5BOM A;  3N28 A;  5J2C A;  2LM4 A;  5KG0 A;  5III A;  5J2K A;  5KFM A;  2WF5 A;  2NYV A;  5KFU A;  2PI4 A;  2W04 A;  1NK8 A;  1XNS A;  3HIL A;  5ALM A;  4QZ9 A;  3RRG A;  1CEZ A;  3C2K A;  1UHU A;  4ECU A;  2FLL A;  2N1R A;  2E1E A;  2R8J A;  5KT5 A;  4XRH A;  7ICJ A;  4Y2V A;  2G5I B;  4DSJ A;  3T79 A;  4MF2 A;  4J9P A;  4DFD A;  3OTQ A;  4KN4 A;  4I2J A;  4K4H A;  3BQ0 A;  1SB3 C;  5KFN A;  3NVV A;  4FO6 A;  2FDR A;  1IXR A;  2HHX A;  1T8E A;  3TQ1 A;  2WF9 A;  1F0M A;  2AXT U;  4OJP A;  5HMM A;  5DKW A;  4IS7 A;  1ZQI A;  3AU6 A;  2W11 A;  2NRZ A;  5KFD A;  3U26 A;  4PHD A;  5KFS A;  3QUC A;  1ZRN A;  9ICQ A;  3PSP A;  2AHO B;  4RPY A;  3BZC A;  4ED6 A;  3QU9 A;  4C4T A;  2W43 A;  9ICT A;  2LI6 A;  2ISP A;  2JGA A;  4JUZ A;  2HW3 A;  3M1Y A;  1J2N A;  2F8K A;  2ZIX B;  2FPK A;  4TQS A;  3RTV A;  2J6U A;  8ICK A;  4B9U A;  4UAU A;  2BQR A;  5ALP A;  2PFQ A;  9ICP A;  3QNM A;  4PGY A;  1Q8K A;  3C29 A;  4QW9 A;  4Y2T A;  3QU4 A;  1T7P A;  3EUB 2;  3PW7 A;  2CXY A;  3V72 A;  3M6Z A;  4DLE A;  5J0R A;  5DB7 A;  2YMM A;  3ICX A;  4DL7 A;  2XY7 A;  2FPL A;  3K1R B;  5J0W A;  3RFA A;  3NUQ A;  2WB1 F;  4TQR A;  3LK9 A;  4I2G A;  9ICW A;  3WK9 A;  3KKA C;  4BX9 C;  2K4I A;  3MGI A;  2KN7 A;  4EX6 A;  1NK4 A;  5AKJ A;  1Z00 B;  2ESE A;  1ZQJ A;  4DSF A;  4XQ8 A;  1PVQ A;  1YT3 A;  4CF3 A;  3NAS A;  5FP0 A;  2KJ9 A;  2CRX A;  2HHQ A;  4TUP A;  1SGG A;  5AKG A;  4YCX A;  4RUC A;  1ZQW A;  1NJW A;  5J29 A;  3GV7 B;  2G07 A;  1ZQV A;  1WWV A;  2KZM A;  1DK3 A;  4P4P A;  5AK5 A;  2IOH A;  3TAD A;  4FBU A;  4B9S A;  3RH5 A;  5DBA A;  2J6T A;  4F5O A;  2DKZ A;  1ZQY A;  3SMV A;  8ICA A;  4F5N A;  1ZQX A;  7ICI A;  2BCV A;  4I2A A;  9ICR A;  3H0L B;  4Q45 A;  2MUT A;  3JPR A;  5KAI U;  3F5E A;  3N7S C;  2C22 A;  1UQV A;  4QWA A;  3GIL A;  1OXJ A;  4ECY A;  5DG8 A;  3SAG A;  1SL2 A;  5BPC A;  4PHP A;  3JPS A;  5KFB A;  5F9L A;  1T4G A;  5KG7 A;  4DSI A;  4IQW A;  1X9S A;  1XWL A;  8ICR A;  4M47 A;  5L1J A;  2HI0 A;  4RQ6 A;  2FMP A;  2EZX A;  1HEK A;  1U4B A;  3V6K A;  3WKB A;  4IQV A;  2R8K A;  5DGB A;  8ICB A;  5L9X A;  2DWQ A;  1YZ7 A;  2EQY A;  4F72 A;  1AQ6 A;  4PZN A;  3G6V A;  1MC8 A;  4RQ8 A;  2I6X A;  4O0I A;  2W9B A;  5ALH A;  4YR3 A;  3M8S A;  4ZH4 A;  4DF4 A;  8ICI A;  1V85 A;  2ES6 A;  1LVH A;  2VKQ A;  4YVZ A;  5DGA A;  4UBC A;  1ZQZ A;  5J2F A;  4P4O A;  3IG5 A;  2BCQ A;  4GXK A;  3OSN A;  1S5L U;  3V6J A;  3ZDC A;  5C0Y A;  4JB3 A;  2XO7 A;  3CW2 C;  3HJE A;  1X66 A;  8ICE A;  4Q8E A;  2YN4 A;  4M6W A;  1RYU A;  5DQG A;  2EDU A;  4LZD A;  2K4E A;  2W54 A;  2KZ3 A;  4KLS A;  1LV5 A;  3GZF A;  3QZ7 A;  4RU9 A;  8ICF A;  4J9N A;  1KDH A;  5KFO A;  7ICS A;  2QB1 A;  9ICF A;  3S6J A;  4RNO A;  2W9C A;  4C7Z A;  1X40 A;  1L7N A;  5DQI A;  2GH1 A;  3WKD A;  1SKS A;  4YQW A;  3HPO A;  2XGP A;  1NZB A;  5DQH A;  1ZJN A;  1CUK A;  4GXJ A;  1ZQB A;  3TAD C;  3AEV A;  3UM9 A;  4DOB A;  2MUT B;  3AN1 A;  4MHV A;  1KRP A;  4F91 B;  4YD1 A;  7ICE A;  2RDI A;  3RJJ A;  3TAQ A;  1OW5 A;  3ISD A;  2H3I A;  5KT4 A;  4KLJ A;  7ICN A;  2YQE A;  1DGS A;  9ICL A;  1V38 A;  2BDP A;  4DSE A;  1WUD A;  1ZET A;  1JXL A;  1JUD A;  5KT7 A;  5AKY A;  3PW2 A;  2FJ6 A;  1NK0 A;  9ICU A;  1XU4 A;  5J0U A;  3TI0 A;  1QQ5 A;  3GFK B;  4FZN A;  4DO9 A;  1KFT A;  9ICM A;  5ALS A;  1NK9 A;  1KN5 A;  1VLB A;  4BUG A;  1DK2 A;  4Z6F A;  1ZQD A;  4K4G A;  1D9F A;  2HVH A;  5D4B A;  2W9B B;  4NV0 A;  2JV3 A;  5EWG A;  3SEI A;  4KLQ A;  1X6J A;  2E8P A;  2H3F A;  3K1Z A;  1ECW A;  4P2H A;  4IQU A;  3N97 B;  1U47 A;  3LVW A;  2ALZ A;  2CN1 A;  2ISO A;  1IG6 A;  4J9K A;  2KOB A;  5ALY A;  4P4M A;  1BNO A;  2Y1I A;  8ICQ A;  1HUO A;  2L5Y A;  4NLK A;  5F9N A;  4M6W B;  4OJL A;  8ICH A;  5F3X B;  3JPP A;  4P0P B;  3RJE A;  3IM1 A;  1KEJ A;  2PMZ F;  3ED5 A;  2IHM A;  3LVV A;  4P0Q A;  2P6U A;  4EZ9 A;  8ICT A;  4UB1 A;  3NRW A;  8ICX A;  5C5J A;  2W9C B;  5JRT A;  3PNC A;  3NVY A;  4QWB A;  1JI7 A;  4U7C A;  5KFF A;  1RDF A;  4I2D A;  1ZYQ A;  1QSS A;  2HVI A;  3M7D A;  3M9M B;  2ZJ8 A;  1TK8 A;  4KLU A;  9ICE A;  8ICC A;  2BCS A;  2HBK A;  2A3V A;  1SKR A;  1N5X A;  2XIC A;  2GO7 A;  4OJ5 A;  4ED0 A;  1DRG A;  3C2L A;  1COO A;  4RPX A;  5J2I A;  2YB4 A;  2BHN A;  3EPI A;  4J9L A;  3RB3 A;  1RYR A;  4R8U A;  3UQ0 A;  2JEF A;  2NV3 A;  5L1M A;  1OUQ A;  2PMZ C;  5AIA A;  3H8J A;  4DF8 A;  3CRX A;  4O3S A;  2Z7J A;  4UAT A;  1YZ6 A;  3FC4 A;  5ALD A;  1ZD2 P;  2VJ4 A;  3GV8 B;  2Y9T A;  5AIC A;  4UB5 A;  3Q8S B;  3WK6 A;  2IOF K;  3RRH A;  3JPO A;  1TVA A;  2FLN A;  4LVS A;  5HML A;  7ICP A;  4LJX A;  2FMS A;  2KIC A;  4DQS A;  4C4S A;  1U9L A;  1ZD3 A;  1URJ A;  1RZT A;  1KKX A;  4YFK A;  2BCR A;  2M9N A;  1ZD4 A;  4UB4 A;  1WWU A;  1NK7 A;  3HW8 A;  2MRL A;  2ZTE A;  4ECS A;  8ICU A;  1VDV A;  2PXI A;  4GIB A;  1ZQT A;  2QAR A;  2JEG A;  8ICN A;  2KK0 A;  3FAH A;  5AK3 A;  4O5E A;  3LDA A;  1ZRM A;  1A0P A;  9ICO A;  8ICL A;  4QIW F;  3EYZ A;  1IM4 A;  3SD7 A;  2WAQ C;  3DV9 A;  3SV3 A;  1L3S A;  4GXI A;  2ASD A;  2RLT A;  5ALQ A;  4B9T A;  1ZQK A;  2E8O A;  4IL6 U;  3ZDA A;  3Q8P B;  3RH6 A;  5KG5 A;  4DOA A;  1NK5 A;  3T5H A;  3BDP A;  4F4Y A;  5DLG A;  5AM5 A;  1ZQL A;  2PI5 A;  4P0Q B;  4DL6 A;  2NRT A;  3N4M B;  3TAC B;  2KSO A;  4FS2 A;  4ELV A;  5DB8 A;  5J0Q A;  5ALT A;  2KJ8 A;  2F77 X;  4KMU A;  1QQ7 A;  1QSL A;  3PW0 A;  2BPG A;  4QIW C;  4DQR A;  3B0Y A;  1JN3 A;  2G06 A;  1PVP A;  4YG2 A;  4JWN A;  1ZQU A;  4G3I A;  3GIJ A;  4I2E A;  3NS1 A;  2RP5 A;  1S9F A;  5CA7 A;  1B0X A;  5B5E U;  1Q46 A;  1A77 A;  2F1I A;  4M04 A;  1SIJ A;  2PKE A;  3MR3 A;  4WJ3 B;  5TZV A;  4GC6 A;  2ZTC A;  2WTF A;  1X9M A;  2HHW A;  1RYS A;  1D8Y A;  1F5S A;  5AKE A;  5AM0 A;  4B9V A;  3N7P D;  4JMU A;  1HJP A;  1ZQC A;  2DBY A;  4Y2Q A;  1BPD A;  3NGD A;  2ZXI A;  2LM1 A;  1TAU A;  1K1S A;  1BPX A;  2DGZ A;  4TUQ A;  2W9M A;  3H8M A;  4FS1 A;  4UB3 A;  8ICV A;  3M6K A;  3RBE A;  3F2C A;  1UA0 A;  2WF8 A;  2HMX A;  5KFL A;  1FFV A;  3WKA A;  1Z4N A;  4I2H A;  2P35 A;  2FLP A;  3RR8 A;  1T3N A;  4RQ1 A;  1T3Q A;  2BGW A;  3Q8M A;  3M9N B;  4RNN A;  2A1A A;  5KFZ A;  2QAR B;  3PMN A;  2CPR A;  1RQN A;  1FFU A;  4ECV A;  5HHI A;  4DS4 A;  4PL1 A;  8ICW A;  2LYH A;  4A8E A;  2O6K A;  2AGP A;  2XVT A;  3LWM A;  4F4W A;  1B43 A;  4BWJ A;  1F44 A;  4RQ7 A;  4Y2P A;  5KFG A;  4PGQ A;  2D6F C;  2LPE A;  2NRV A;  2AQ4 A;  3QEA Z;  3PV8 A;  4FFD A;  2OWO A;  2W8K A;  1BVS A;  5EWF A;  1FIQ A;  4DSK A;  3C21 A;  4YD2 A;  1ZQE A;  1BPB A;  1JX4 A;  2KSO B;  5AKL A;  5KFW A;  5T14 A;  7ICU A;  4DL3 A;  2DL0 A;  1FO4 A;  3WK8 A;  4U6P A;  3RB0 A;  3ALR A;  4EBC A;  2EZY A;  4DL5 A;  1H38 A;  2ZJ5 A;  1Z3E B;  3RF9 A;  3KD3 A;  4M9G A;  8ICS A;  2E1F A;  4RQ5 A;  4K4I A;  3MGH A;  1UCV A;  3CYM A;  3IHQ B;  3V7J A;  2MSN A;  2JMG A;  7ICG A;  5J2E A;  8ICY A;  2ODG A;  2ZUD A;  2OH2 A;  5JU5 A;  4ELT A;  2DF4 B;  2MA1 A;  5KG3 A;  5E79 U;  5ALF A;  3IDW A;  2V4R A;  3MR6 A;  2LHT A;  2FE9 A;  1ZQS A;  1ZD5 A;  3H4D A;  3I1Y A;  4EEL A;  2IOF A;  3NVW A;  5AM2 A;  2Y0S C;  4MFF A;  2BDU A;  3UMB A;  1RXW A;  1MN8 A;  4YR0 A;  5J2G A;  4IR1 A;  1P7D A;  4YN4 A;  1J97 A;  3QUT A;  3GIK A;  4NL9 A;  3UMC A;  4E0D A;  4RQ4 A;  1ZQM A;  4RQ2 A;  4FZL A;  2QB0 B;  3PSI A;  2ZIU A;  2KP7 A;  4O3M A;  3PX4 A;  3TFR A;  1IIP A;  5J0S A;  2W8L A;  2H3Z A;  4Z6D A;  3OPX A;  3ETR A;  2VA2 A;  4QZE A;  1XSP A;  3ZDD A;  2JR5 A;  3N7R C;  5AM1 A;  3O0F A;  2DPI A;  4NY8 A;  4XUS A;  4UB6 U;  2EH9 A;  4CE6 A;  9ICB A;  1B22 A;  1ZQR A;  1JAL A;  3C28 A;  3IN5 A;  2YY6 A;  3SEN A;  2AGQ A;  2JRZ A;  3EPG A;  3B9J A;  4ACO A;  1ZQH A;  5HP4 A;  5IIM A;  4J9O A;  3M9O B;  3MAB A;  4MEX A;  1SZP A;  4EZ6 A;  3JPN A;  5KT3 A;  2ZIV A;  4F92 B;  1SXE A;  4NLN A;  2ZUB A;  2EAM A;  5KG1 A;  4UAW A;  4TUS A;  1SXD A;  1ZQN A;  2HBL A;  1QTM A;  3UXO A;  3MDA A;  3F2B A;  1N5W A;  4DS5 A;  1Z1V A;  3EW9 A;  5J0Y A;  3PZP A;  3H40 A;  3QUQ A;  1UT8 A;  5AHX A;  2GWS A;  1U48 A;  2YML A;  3QZ8 A;  4YMO A;  7ICL A;  5KFA A;  4I2C A;  3IV6 A;  1LKY A;  2JXJ A;  2KMD A;  3MC1 A;  3ZD9 A;  3Q8K A;  4F5P A;  5AKX A;  2XCP A;  1U45 A;  4NM2 A;  1KTQ A;  9ICC A;  2OHF A;  4QZG A;  3I28 A;  1WCN A;  2E3T A;  4EYH B;  1X9W A;  2E5S A;  4QZC A;  3QUB A;  4P0P A;  3PST A;  2AU0 A;  2EZZ A;  4KLG A;  2E8M A;  3RJI A;  4XA5 A;  4M9L A;  2K60 A;  5HNK A;  2YMQ A;  5DB9 A;  2ZIU B;  3C23 A;  3HWT A;  5DLF A;  4BJQ A;  2YB1 A;  1QSY A;  5DDM A;  3HKZ C;  5DDY A;  2UVV A;  4DWI A;  4KLE A;  2KZZ A;  5KFR A;  4UAR A;  3H0R B;  4CF5 A;  5CP2 A;  4UB2 A;  3HX0 A;  4QZI A;  4Y2R A;  4PPX A;  4NL9 C;  4Z6C A;  1S0V A;  5AKZ A;  2F2A B;  4M9J A;  1N61 A;  2WFA A;  5J0T A;  4R64 A;  2H3V A;  3SV4 A;  5EE3 A;  3TAP A;  4DQP A;  2KKP A;  4JWM A;  5IIN A;  4FBT A;  5ALJ A;  2Q0Z X;  3VC8 A;  4EEY A;  3GII A;  1S0N A;  2R8G A;  7ICV A;  1KQQ A;  1DOQ A;  2KFZ A;  1RG6 A;  5AI0 A;  9ICX A;  3BQ7 A;  4ECT A;  2ZIV B;  1KFS A;  4B6J A;  2ZIW A;  3C1Z A;  1ARO P;  3B0X A;  1Y88 A;  9ICA A;  5J2D A;  1L6N A;  1SV0 C;  4F5Q A;  2W55 A;  3AM9 A;  1Z19 A;  3ISB A;  2GLE A;  3NVZ A;  2OCE A;  4PJ0 U;  4O3R A;  2F8L A;  3PW4 A;  4F3O A;  4B9M A;  5HHH A;  5GTI U;  1HUZ A;  2BPC A;  3WK7 A;  2DUY A;  1LKY B;  5TIS U;  4QZD A;  1S8O A;  5J2H A;  4HAI A;  8ICG A;  1WG8 A;  1V97 A;  1ED1 A;  5ALX A;  2KHV A;  2BKE A;  3ONN A;  5AI6 A;  2QKQ A;  3PW5 A;  1IV8 A;  4JV1 A;  3GDX A;  2RHF A;  2VIX A;  2D3D A;  4DCC A;  2XGQ A;  1TFR A;  4R66 A;  4C80 A;  5J2B A;  3UXP A;  5KT2 A;  3GIM A;  1XSN A;  3D2Q A;  2IBK A;  2PFP A;  2WF7 A;  1HIW A;  2ATL A;  5KG4 A;  7ICT A;  2G5H B;  3F2D A;  4RQ3 A;  5AI8 A;  2OXO A;  2P6R A;  4DFK A;  3THV A;  2K8C B;  4US9 A;  4O3Q A;  1TK5 A;  5EE0 A;  1XSL A;  4OD0 A;  5J2J A;  4YMN A;  4TUR A;  4F2R A;  4NLB A;  3QE9 Y;  5J0O A;  1V9P A;  2XI9 A;  4UAV A;  2BPF A;  2W3S A;  3RJK A;  5JUM A;  2FPM A;  1PUZ A;  4KX3 A;  4NXZ A;  5AK6 A;  2XCA A;  5KFH A;  1TK0 A;  5ALI A;  5ALV A;  5G5G A;  7ICM A;  4DFP A;  2WAQ F;  3UXN A;  3A0B U;  3KHL A;  4RZR A;  2JEJ A;  1N2X A;  3WK5 A;  2WF6 A;  2B21 A;  4AYB C;  2A19 A;  5DG9 A;  3V7L A;  2ZIW B;  5AI5 A;  4MFC A;  1M6Y A;  2F44 A;  1MSW D;  5ALE A;  5DBC A;  3MFI A;  1N62 A;  4QWC A;  1COK A;  3Q8L A;  4UB8 U;  4EEK A;  4RQM A;  1MQ3 A;  2YMP A;  4HYK A;  4O5C A;  3UPQ A;  3UQ2 A;  2H3Q A;  2K4P A;  5KAF U;  5IIO A;  2ZG6 A;  2W9A A;  4NLG A;  1ZXI A;  8ICM A;  5IIJ A;  3TAR A;  1D8L A;  3DEE A;  5DBB A;  4O3P A;  2ASJ A;  3J81 j;  1PK3 A;  2GOL A;  1ZQ1 C;  1SL0 A;  2FMQ A;  1S0M A;  4F50 A;  4RT3 A;  3OJU A;  4I2F A;  3WKE A;  3QX7 A;  2HCF A;  2R8H A;  3PVX A;  1U49 A;  5ALG A;  2LKY A;  2HSZ A;  1WCL A;  1CRX A;  4NLZ A;  5AM4 A;  5L1K A;  5IIK A;  2E8N A;  4DFM A;  1UA1 A;  2B6G A;  4C8N A;  3KHR A;  5HR7 A;  3BS7 A;  5KFP A;  1ZQP A;  4EBE A;  2DPJ A;  2YTU A;  4DQQ A;  4PHA A;  4C8K A;  4FZM A;  3AMZ A;  4Q44 A;  4UAS A;  2HBJ A;  2KTQ A;  2JH7 A;  2AH5 A;  1TKD A;  4CNQ A;  1RQL A;  5EWE A;  4KLT A;  2F3N A;  4NLC A;  1CI4 A;  1N60 A;  5KG2 A;  3F5A A;  5CRX A;  3GV5 B;  1RM6 C;  2VJ5 A;  4EX7 A;  4YR2 A;  4QNL A;  4O5K A;  2ZUC A;  2F1J A;  1MQ2 A;  5IIL A;  1VJ5 A;  3SI8 A;  2HHS A;  3T5L A;  2KE7 A;  3PR5 B;  1SKW A;  3RJH A;  4NJ8 A;  4M0A A;  1O03 A;  5KFK A;  4Y2X A;  1Q3V A;  4CDG A;  5AI4 A;  1QH9 A;  3NRZ A;  2K8B B;  4QWD A;  4BXO A;  3PML A;  4JV0 A;  2C28 A;  4LZG A;  5JTI A;  5CWR A;  3DDH A;  2VA8 A;  3I76 A;  3GU3 A;  1NKB A;  3E2E A;  4J9M A;  4F71 A;  3UMG A;  2XY6 A;  4RT2 A;  5J0P A;  4Q43 A;  1NZP A;  4I29 A;  2IMW P;  4PZO A;  3KTQ A;  5J0X A;  3OSP A;  5KFQ A;  4DLG A;  3JPQ A;  1L7M A;  4JV2 A;  3OGU A;  2J6S A;  3VCB A;  5KL1 B;  4QZA A;  4C8L A;  2QB0 A;  8ICZ A;  8ICJ A;  3ZI4 A;  2LYB A;  4EEN A;  4BGD A;  2ZJA A;  3BQT A;  3RJF A;  4KLO A;  4O3N A;  3TFS A;  3L4P A;  2R18 A;  1S0O A;  3ISC A;  1X6I A;  2I9G A;  4I27 A;  4KLD A;  4BDP A;  4ELU A;  1TE2 A;  1B4F A;  1UPH A;  8ICP A;  1X9X A;  2QLT A;  5KG6 A;  3K75 D;  5A0L A;  1T94 A;  2NRX A;  4UBB A;  8ICO A;  5G5H A;  3NTU A;  3JPT A;  2RRD A;  3L3F X;  2HBM A;  3H8W A;  4QW8 A;  4IRC A;  5KFV A;  4CRX A;  2KV2 A;  4X5V A;  2Y0S F;  4QZ8 A;  1JMS A;  4C0Z A;  4YMM A;  2XY5 A;  5KFE A;  3E0F A;  3BQ1 A;  1JIH A;  4KTQ A;  2A1J B;  1Z4O A;  3MR2 A;  2OEH A;  2JEI A;  3C2M A;  1TV9 A;  3TKA A;  2KNJ A;  1NI3 A;  2B0C A;  4IC9 A;  2AJQ A;  2JH1 A;  2HOI A;  1BNP A;  4I2B A;  4RQ0 A;  4NM1 A;  2UVU A;  5ALO A;  3KHH A;  7ICQ A;  3C5F A;  4BXO B;  3RAQ A;  2LBO A;  4RUA A;  1KSP A;  2KKV A;  3IG8 A;  1S77 D;  1SWW A;  2PFO A;  3SYZ A;  3RB6 A;  3M8R A;  4ED2 A;  3WKC A;  3V7K A;  3KFU F;  4M2Y A;  3HP6 A;  3HT3 A;  4RNM A;  4QJF B;  1ZQQ A;  4IRK A;  4KLL A;  3RBD A;  1RPL A;  3BQ2 A;  5J8Y A;  1TAM A;  4C8O A;  3D2S A;  2JZB A;  2I1Q A;  5DG7 A;  4B9N A;  4QZB A;  2C2E A;  4Y2J A;  2PFN A;  4OO1 J;  2YX8 A;  4EBD A;  5AI9 A;  5ALW A;  3OHB A;  3ZDE A;  5AKI A;  1QCK A;  3ETL A;  5KFI A;  1EXN A;  1Q3U A;  5ALL A;  5KFT A;  4CGZ A;  3Q8Q B;  2WB1 C;  2W03 A;  5EE9 A;  3FDS A;  3G6Y A;  1Z1B A;  9ICS A;  4KLI A;  3PX0 A;  4J9Q A;  1KLN A;  3AU2 A;  4KN7 A;  3E58 A;  1KL9 A;  1SV0 A;  4YXJ A;  4R63 A;  2ZXH A;  3HRD D;  3SZ2 A;  1N63 A;  3SR6 A;  4M9N A;  1C20 A;  3SQI A;  1K5O A;  3A0H U;  3WU2 U;  4KMO B;  4ECZ A;  1L5U A;  3QEB Z;  2C2R A;  4RQN A;  1D9D A;  3BS5 A;  1NJY A;  4ED7 A;  2EAN A;  7ICO A;  3HKZ F;  3KBB A;  1BPE A;  1ZQG A;  3RAX A;  1ZJM A;  3PO5 A;  2LYA A;  1KBU A;  2HHT A;  2HHV A;  3D6J A;  1TAQ A;  2EAP A;  4YP3 A;  5KNI A;  1BPZ A;  2C2D A;  3MR5 A;  5CR0 A;  3KHG A; 
#chains in the Genus database with same CATH homology
 5J8Y A;  2KSO B;  3K1R B;  2DKX A;  1KW4 A;  2DL0 A;  4NL9 C;  2E8N A;  2B6G A;  1V38 A;  3BS7 A;  5L1M A;  3KKA C;  1B4F A;  3SEN A;  2ESE A;  1B0X A;  2YTU A;  1X9X A;  4PZN A;  3HIL A;  1UCV A;  2Y9T A;  1V85 A;  2ES6 A;  2F3N A;  5JU5 A;  5J8Y C;  1DXS A;  1SXE A;  1SGG A;  2JV3 A;  2EAM A;  3SEI A;  2E8P A;  2KIV A;  1RG6 A;  1PK1 A;  3BQ7 A;  3IDW A;  1SXD A;  1X66 A;  1SV0 A;  2KE7 A;  3H8M A;  1WWU A;  2KG5 A;  1WWV A;  1F0M A;  4IS7 A;  3TAD A;  1Z1V A;  4NJ8 A;  2FE9 A;  2QAR A;  1PK1 B;  1SV0 C;  2L5Y A;  2DKZ A;  1LKY A;  2KMD A;  2GLE A;  2F44 A;  5F3X B;  5JTI A;  2QAR B;  2QB1 A;  2LMR A;  2D8C A;  2E8O A;  1COK A;  1X40 A;  4NL9 A;  4RQN A;  4RQM A;  1LKY B;  3BS5 A;  2QB0 B;  3KKA A;  2K4P A;  2EAN A;  4PZO A;  1UQV A;  2F8K A;  1OXJ A;  5JRT A;  2EAO A;  2LPE A;  3TAD C;  1JI7 A;  1PK3 A;  2E8M A;  3BS5 B;  4MHV A;  2K60 A;  3TAC B;  2QB0 A;  2KSO A;  2Y9U A;  2EAP A;  2QKQ A;  5KNI A;  1OW5 A;  2D3D A;  1SV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...