1B4FA

Oligomeric structure of the human ephb2 receptor sam domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
74
structure length
74
Chain Sequence
PDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords EPHB2
publication title Oligomeric structure of the human EphB2 receptor SAM domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 74
sequence length 74
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1998-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1b4fA00
1X40A 1PK1B 4RQNA 3SENA 1PK3A 2EAMA 2E8OA 1PK1A 2D3DA 2QKQA 2B6GA 2KE7A 4NL9A 1LKYA 1V85A 3IDWA 1X66A 2KSOB 4RQMA 2QARA 1SXDA 1UCVA 2KSOA 2YTUA 1COKA 1DXSA 1SXEA 2E8PA 1JI7A 3TADA 1Z1VA 2EANA 3H8MA 5JRTA 1LKYB 1KW4A 3KKAA 4MHVA 2EAPA 1B0XA 2E8MA 4NJ8A 2ES6A 2L5YA 2DKZA 3TACB 2QARB 2Y9TA 2K60A 3SEIA 2KIVA 1V38A 2FE9A 2K4PA 5J8YC 2D8CA 5L1MA 2F3NA 2DL0A 3BQ7A 2QB1A 1B4FA 1F0MA 4PZOA 2Y9UA 1SV0C 3BS5B 4PZNA 5JU5A 1RG6A 5KNIA 2QB0B 3BS7A 2DKXA 3BS5A 2QB0A 1SV4A 3HILA 4NL9C 4IS7A 1OW5A 2F44A 1WWUA 2F8KA 2JV3A 1WWVA 2KMDA 5JTIA 2EAOA 2GLEA 2ESEA 1OXJA 2LPEA 5F3XB 5J8YA 3TADC 1UQVA 2LMRA 2E8NA 1X9XA 2KG5A 3KKAC 1SGGA 1SV0A 3K1RB
chains in the Genus database with same CATH superfamily
2IHMA 1QSLA 3QZ8A 4B9SA 4OJPA 2UVUA 1B43A 3T79A 9ICNA 3IRUA 3HJEA 1ZQ1C 4GC6A 2B21A 4M6WB 5AK3A 2WF8A 5IIJA 3T5KA 5AI4A 3C1YA 2KE7A 5AKEA 4A8EA 5JUMA 1S77D 5J2IA 1ZQRA 2PI5A 3V7JA 4TUPA 2QLTA 2HOFA 4QJFB 4QIWC 4FS2A 3H8WA 4I2FA 3GU3A 2BCSA 5J2CA 2DPJA 4EEKA 2A1AA 2V4RA 5EE1A 5KFZA 2MSNA 3C2MA 2KICA 3TAQA 2EAPA 3NTUA 8ICEA 4KLDA 3QU7A 2L5YA 3TACB 2HHSA 5J0SA 3C2LA 2ZTCA 3T5JA 3QU5A 1CEZA 4YVZA 1L3VA 4TQSA 5L1JA 8ICYA 3PZPA 5DB9A 3BDPA 2I5HA 4QZAA 5DB7A 1A6SA 4OD0A 1PVPA 4Y2JA 2NRVA 2VANA 2Y9UA 5ALOA 3M1YA 1IXRA 5FP0A 3PW0A 4M0AA 4QZBA 4IQUA 1SKSA 3C1ZA 4DL3A 2QB0A 3ZD9A 3GIMA 5KFRA 2BCQA 4PL1A 1VDVA 3BQ2A 2BQUA 1JN3A 3MDCA 2DF4B 1QCKA 2KMDA 4E0DA 4IRCA 1KEJA 1PVRA 3QUBA 1A76A 4UBCA 5AM0A 2M0NA 5HR7A 4UAUA 4Q45A 3MR5A 5EWFA 1KFDA 3BQ1A 5AKZA 2F1JA 2R8IA 3OSPA 3LWLA 1VJ5A 2EH9A 1X40A 2PFNA 4WJ3B 3NVVA 5AM5A 5IIKA 4RUAA 3PSFA 4J9SA 2DPIA 3MC1A 2LHTA 2E5SA 4R8UA 5KFMA 8ICUA 4QWEA 2IOFA 5HR6A 5KT3A 2ATLA 3Q8LA 1PVQA 2YX8A 4MF8A 1L7OA 4NM2A 3BZCA 2M9NA 1A77A 2R18A 3A0HU 5K4LA 3KFUF 3ZD8A 3OPXA 3AUOA 2W03A 1NK8A 4B9VA 4DQPA 4ELUA 3QUTA 4QNLA 4DSIA 3ISCA 1ZD5A 4BUGA 5DG7A 3Q8MA 3ZI4A 2YQEA 4AYBC 4RQ2A 4PZOA 4KMOB 5C5JA 1SV0C 8ICKA 4I2BA 2FPLA 3JPRA 2QB0B 4Z6EA 5ALNA 5KFVA 2KFNA 4GFJA 3M9NB 4F5RA 2BQRA 1LB2B 4UBBA 3E58A 4QZDA 7ICIA 3N97B 1L6NA 4Y2YA 4IS7A 4HAIA 5DQHA 4LZDA 2HOQA 2WHEA 4DQRA 3IP4B 3DDHA 5G5HA 2AQ0A 3FYHA 1NJZA 4IL6U 1U47A 2RP5A 5AKXA 3H8SA 2LM1A 4KLGA 4CF3A 3H4DA 2W8LA 5J2BA 2OCEA 4USAA 1RYUA 1ZQJA 2FPKA 2JZBA 4YD2A 1KL9A 9ICSA 2C2EA 4NLNA 1O03A 5AM2A 2GOLA 3AU2A 5IILA 4F50A 5J2EA 4KLTA 1KQQA 4DS4A 2VA8A 4US8A 4IRDA 4DQSA 3ISDA 2HBKA 4B9TA 3EYZA 1U48A 9ICKA 3MFHA 2ISOA 3CW2C 4Y2RA 2JGAA 2YY6A 2HHXA 4DFKA 2UVVA 4UAZA 3JPSA 3BQ0A 9ICWA 3LVVA 1D9DA 2QB1A 4ELVA 3Q8KA 2W9CA 5ALUA 2HW3A 2FPMA 2ZIUA 1S0MA 5ALVA 2DUYA 3F2CA 1DRGA 1DK2A 1L7NA 2KZ3A 4I2CA 5KG0A 2OYYA 1TV9A 1NK5A 2F8KA 1X9WA 5DBBA 4TURA 3RRGA 1DGSA 3H0MB 9ICIA 3F5EA 5J8YA 4DEZA 1WCNA 4ECRA 1NKBA 4IRKA 4IQWA 4ELTA 5KL8B 3T5HA 1D8BA 4Q8FA 4P0QA 4XUSA 2H5XA 1SB3C 5L9XA 1NK7A 5DLGA 4RQNA 3PR4A 4DOAA 2YMLA 3NVZA 2FJ6A 1ZQKA 3IHQB 3TFSA 8ICNA 2PMZF 3QUQA 3RJIA 1U4BA 2W3RA 9ICLA 1NK4A 2E8PA 3RBEA 4FBTA 3RR8A 4O0IA 1X42A 2OM6A 3UQ0A 1RQLA 2NRTA 2NV3A 3V7KA 3GIJA 4YN4A 7ICMA 2BZFA 2E8MA 2H3ZA 2QARB 3VCBA 3MGVA 3WK7A 4F2SA 5HMLA 3QYPA 5AKGA 1MN8A 5J2HA 2ZIUB 5KT6A 1Z3EB 2CN1A 4JUZA 5KFHA 4C80A 1D9FA 5EE0A 2MA1A 4DO9A 8ICPA 4KLFA 8ICFA 4O3QA 5L1IA 3GV8B 5DG9A 8ICMA 4UARA 2HVHA 2AXTU 3D2NA 5CR0A 5CWRA 4KLIA 4KMUA 2W9BB 1XNSA 2EZXA 3RB4A 5GTHU 4Y2QA 3UQ2A 5JTIA 7ICNA 2FMSA 2HHUA 1T4GA 4O3PA 4P0QB 2DFLA 2F1IA 5KAIU 1NOMA 2EDUA 4ACOA 3D6JA 5DDYA 2HBMA 5J0YA 5J2KA 1HEKA 4B9MA 4ECYA 2AQ4A 1QQ5A 3PV8A 4QZFA 4LZGA 3QU4A 4RPZA 3SENA 4QZEA 3WK8A 2H3IA 3LK9A 2JEIA 4DF4A 4EX6A 4UB3A 4EBCA 1ZQAA 8ICZA 4DFPA 3OJUA 1PZNA 3RR7A 4DL2A 5KFYA 1ZQLA 3S6JA 2KSOA 4DSEA 3ETLA 5DBAA 1SWVA 4O3NA 2A1JA 1Z1VA 3H8MA 3SAHA 7ICFA 1KW4A 3SAGA 4NLZA 4US9A 1B0XA 1Z1BA 1U45A 4DL5A 3HPOA 2F8LA 5B5EU 4YR3A 1KFSA 5AK4A 2ZIVA 5KFJA 5ALJA 5J0QA 1SL0A 1ED1A 1QQ7A 3ZDBA 9ICFA 4UAVA 1IM4A 2RDIA 2KN7A 4DL7A 9ICTA 1F0MA 3HT3A 2KVSA 1Z00B 1A0PA 2W04A 3DEEA 1UPHA 4J9RA 3C23A 1ZQBA 3UXPA 1YT3A 1NJWA 5KG3A 4ED0A 3BS5A 3EZ5A 4RZRA 5ALTA 3FAHA 2BDUA 3EW9A 1FO4A 4NL9C 2J6UA 4ED8A 5KG1A 5AICA 3TQ1A 3EUB2 1WWUA 4PPXA 4UB1A 2ASDA 4DSJA 3PMLA 1MC8A 1Z4OA 1RXVA 1ZYQA 9ICOA 8ICGA 4DWIA 1L7MA 1RYRA 5AIAA 2BPGA 3GQCA 5J2DA 4R63A 2VJ5A 4QW9A 3M8SA 1NK6A 4K4HA 3RJKA 1ZQMA 1KLNA 2LI6A 2Y1IA 2UVRA 2J6TA 4UAWA 1SZHA 4P4PA 4Z6CA 4M9NA 1BGXT 4YXJA 1MSWD 1N5XA 5KT7A 2KSOB 2ZUDA 3CP8A 3M9OB 1ZJNA 1ZQDA 4PGXA 2GWSA 3RJGA 2A1JB 4NLKA 1JXLA 3SV3A 2W8KA 3KHGA 4JK1A 5HP4A 1HUZA 2WB1F 1LKYB 5CA7A 2WF9A 4HYKA 3D2QA 4YP3A 4QZ9A 2HCFA 2ZIVB 2BHNA 3TI0A 2HOIA 2BKEA 2ZUCA 3I28A 3K4GA 4CNQA 2VIXA 3JPOA 5AHXA 4KLJA 1HIWA 5DB8A 9ICPA 3F2DA 4EEYA 3SQIA 3PSTA 3BS5B 9ICGA 2LBOA 4P4MA 2KHVA 5H2FU 3QU9A 2DKXA 3IV6A 3H0RB 4KN4A 1L7PA 3JPPA 3A0BU 2KZZA 4DLGA 4M9LA 4DOCA 3HILA 8ICHA 3AN1A 1QTMA 4B9UA 8ICVA 4J9QA 1H38A 4BWJA 3GFKB 7ICHA 2PFPA 1WWVA 2VJ4A 3KHRA 4CF5A 4EX7A 2G06A 2RRDA 5KFFA 4RPYA 4C7YA 2V4QA 4ZH4A 2AGPA 1ZQIA 2P66A 3KKAC 4EBEA 2GH1A 4ECWA 2MUTA 5EWGA 3HX0A 3KHLA 2EZYA 4ED7A 8ICOA 3OTQA 4NLBA 2KFZA 1ZD2P 1V85A 2PI4A 1QQ6A 4Y2PA 2E1FA 4F5NA 1V97A 2F76X 4YR2A 2G07A 2KTQA 4MF2A 4ECUA 1SXEA 2BCVA 2W54A 4RQ8A 3Q8QB 4FE3A 1N62A 5ALHA 4I2GA 2XY5A 4YFKA 2NO4A 1L5UA 2JXJA 2ZIWA 9ICHA 3UMCA 2IOFK 3LWMA 9ICCA 5AI0A 2DKZA 1J97A 4IC9A 2G09A 3ZDDA 4XQ8A 1X6IA 3V6HA 4F8RA 1DK3A 4QWDA 1Z4NA 3ICXA 1C20A 2ZJ5A 3RBDA 1XU4A 2KIWA 4RNMA 2ZG6A 4BX9C 2P6RA 5AKLA 4F4WA 1QSYA 3L5KA 2Y1JA 2B0CA 3T3FA 2KD1A 1BPZA 1Y88A 4IQVA 8ICSA 1XSNA 2YN4A 4ECZA 4CDGA 2N1RA 4DSFA 1UA0A 5J0RA 1ZQGA 3C21A 5KTQA 2W55A 4F5PA 3WK6A 3HKZF 5ALMA 3MBYA 9ICJA 4C8MA 3OJSA 2E8NA 2KG5A 3PX6A 3SV4A 3PSIA 4Z6FA 3K75D 1SGGA 1NZPA 1SV0A 3KOOA 3QXGA 3LYSA 4KN7A 5J29A 1L3TA 1T7PA 5ALLA 1PK1A 5CRXA 1F5SA 5ALIA 3H8JA 3BJYA 4IR9A 2BQ3A 2KKVA 4EELA 3ZDCA 3QNMA 1N60A 3G6VA 9ICEA 2D6FC 3C2KA 3RAQA 4OJLA 2NO5A 1KKXA 1AROP 2Q0ZX 3CRXA 2WB1C 3TARA 3SI8A 3RB0A 2I1QA 1COOA 1YZ6A 4OJOA 5J2GA 4R8UB 4YQWA 1ZETA 1TK8A 4C8LA 2XC9A 3MR3A 2ES6A 4KLHA 4KLQA 1IV8A 5KG6A 3JPQA 2Z7JA 2G0AA 2BPFA 1ZQHA 3L4PA 4QZ8A 3GIIA 4RQ6A 5KFSA 3UXNA 4MFCA 4ED6A 2ISPA 1BPDA 2EZZA 4FZNA 4DOBA 3IG5A 4PZNA 3PW4A 4F91B 2AU0A 3PO4A 4M2YA 1TKDA 2DGZA 4XA5A 4UASA 4RT2A 2HVIA 4C7ZA 3AL0B 1T3NA 5HHIA 5CB1A 4EYHB 3IN5A 3TAPA 4I2HA 4F2RA 3OGUA 1JX4A 1X6JA 2KJ9A 4B6JA 4F71A 5AKKA 3PX4A 1Q3UA 3D2SA 4P0PA 5F9LA 1XSPA 1PK1B 1N56A 4RQ3A 4XRHA 2AGOA 2JEGA 4DL6A 5AM3A 2YMPA 4BXOA 4DQIA 7ICKA 3GIKA 5ALZA 2DBYA 1RQNA 1RYSA 4EYIB 5J0UA 3U26A 5AK6A 3RTVA 2XICA 3FM9A 2XVTA 2ZJ8A 2YTUA 3RJEA 3BZKA 2JZBB 4OO1J 1TVAA 4R64A 1N61A 3TFRA 1RPLA 1FEZA 2FDRA 2PFQA 1BPXA 2E3TA 3TANA 3MR6A 4UAYA 2Y9TA 3SEIA 1ZQNA 3PO5A 3EPGA 3MR2A 4C8KA 3RAXA 2FE9A 1JXEA 1URJA 2G08A 5AKHA 3WKBA 5L1MA 2F3NA 5KT4A 1O08A 1S0OA 4F92B 2HHTA 4ECSA 1BPEA 5EE3A 4I2AA 2G5IB 8ICIA 5JU5A 4C4RA 2MU2A 3FC4A 2JH1A 3AQEA 8ICJA 3AMZA 1FIQA 3E0FA 5KFUA 2P35A 5AI8A 2W11A 3LVWA 4KLLA 5AK5A 3M6ZA 2HBJA 2W9AA 7ICUA 4FZMA 2ZXHA 3V6KA 1ZQPA 3NGDA 2W9CB 1MQ2A 5KFBA 5A0LA 4QZCA 3Q8SB 5GTIU 5CJ7A 3WKCA 1Q46A 5KFEA 5KFKA 2FMPA 4DLEA 2WAQF 5DBCA 5KFIA 4K4IA 4P0PB 4F3OA 1SWWA 1LV5A 3H7IA 3F2BA 4TQRA 4Y2TA 3H4BA 3K1RB 1IIPA 3OHBA 5CHGA 1L8OA 4LJXA 4FO6A 2G5HB 1MQ3A 3PR5B 1ZOLA 3QZ7A 2IMWP 4KITB 3IDWA 5J2AA 2FI1A 2A19A 4Z6DA 5ALEA 3RH5A 5ALXA 2PKEA 4I2DA 4DFMA 5KFDA 1ECWA 3B9JA 4GIBA 1GO3F 4UB6U 1NKCA 2K4HA 3NS1A 3PW5A 2P6UA 1SL2A 4Y2SA 1QSSA 3ED5A 5AKYA 3DV9A 4O5CA 4C0ZA 1S8OA 1ZXIA 5KFCA 1KDHA 1JIHA 2RLTA 2HHVA 4U7CA 2JHDA 5L1KA 2IHNA 2YB1A 8ICAA 4CCHA 4GC7A 4PL2A 2Y0SF 3PSPA 1J2MA 2OEHA 4KX3A 3SAFA 2WF5A 1FFVA 2JEFA 1N63A 1UHUA 5D4BA 3PMNA 2KK0A 5KFTA 2XO7A 1NJYA 2XIDA 3JPNA 2FMQA 8ICWA 8ICQA 2JRZA 3GDXA 1ZQYA 1BPBA 5CEHA 2KZMA 4PHAA 5KG7A 4PHDA 4JV0A 9ICMA 3RH4A 2JMGA 2HMXA 5DGAA 1TK5A 4M9JA 4F4ZA 3M6KA 4M6WA 3TADC 5KT5A 2PXIA 5T14A 5AKIA 9ICXA 5KG4A 4DL4A 4FS1A 2C2DA 3M8RA 2D3DA 4NL9A 3OHAA 4ED2A 4PH5A 5KFPA 2K8BB 4UW9A 5DLFA 3NVYA 1ZRMA 4NLCA 1X2IA 4K4GA 3ONNA 3N28A 1B22A 5AI9A 4BJQA 1BPYA 3CNHA 1PUZA 3ORYA 1TAUA 2PMZC 5E79U 5DQGA 1NZBA 4KLOA 1TFRA 3SZ2A 4GXJA 4NM1A 2KIVA 1HUOA 5ALRA 1V38A 5HHHA 1IG6A 2KJ5A 2DWQA 2PFOA 3J81j 1BNOA 5HNKA 3Q8RB 4YMNA 2KV2A 5AM1A 4DSKA 4KLSA 3F53A 1N5WA 4YR0A 3AEVA 4M9GA 4MFFA 7ICRA 1FFUA 2XGQA 3C28A 1K1SA 2JH7A 4YG2A 5KFAA 4LVSA 4NY8A 5L1LA 7ICPA 4RQ0A 2BR0A 4NXZA 4YMOA 4F4YA 1QH9A 5ALPA 3SYZA 2EAOA 8ICCA 4O5KA 1OXJA 2DQNB 2ZIXA 2WAQC 4J9PA 4F4XA 4MEYA 4Y2UA 1ZQQA 4ED1A 2YMMA 5CP2A 1T3QA 1S9FA 2C28A 1U49A 5KFOA 1V9PA 2EQYA 4DF8A 1BVSA 3RB6A 1XSLA 2XY6A 1N48A 2QKQA 3NRWA 3UMGA 4RNNA 4F5OA 3PNCA 1D8LA 2WTFA 3B0XA 3EPIA 3AQFA 2VKQA 1JMSA 1SIJA 3ZDEA 7ICEA 1DXSA 1JI7A 1JALA 3E2EA 2R8GA 3N7PD 4FFDA 3KKAA 1S97A 1RXWA 7ICTA 1TAQA 4C8OA 2LYHA 2R8HA 3NUQA 3B0YA 5IINA 2K60A 3KTQA 4RUCA 1KTQA 4ZOHC 2Y0SC 1RDFA 3PX0A 1X9MA 2IA6A 2WF7A 2DL0A 5J0OA 3BQ7A 5AM4A 3JPTA 4JWNA 3OSNA 5ALKA 1C7YA 3N7SC 1ZQXA 4RT3A 2I9GA 2ASLA 2HSZA 4J9MA 4Q43A 4BGDA 3AM9A 4F4KA 5B66U 3WK5A 2W7PA 3MABA 3RJHA 4NV0A 5ALWA 3M7DA 1CUKA 3UMBA 4PGQA 1OW5A 4B9NA 1NK0A 2F44A 3WU2U 4EBDA 2ZIXB 5KFQA 3NVWA 2H3QA 5ALYA 5IIMA 1F44A 4C8NA 1ZQUA 1K5OA 2W43A 3QE9Y 1WG8A 4CRXA 3PW7A 4DS5A 1BNPA 4JV2A 3SMVA 4G9BA 1LVHA 4JMUA 4FZLA 5DDMA 2HDOA 4R66A 1SKRA 5D46A 5KAFU 3GILA 4MEXA 4MFAA 2EAMA 2YMQA 2E8OA 4RQ5A 9ICRA 1ZD4A 4JWMA 1DOQA 3HRDD 1QLNA 3L3FX 1XO1A 2BCRA 4ECQA 4I2IA 3KHHA 1UCVA 2K4EA 2MUTB 1X9SA 4KLEA 3MDAA 2I6XA 4RQ4A 4FBUA 2KVCA 4Y2VA 3PY8A 1S0NA 3HW8A 5KFNA 1EXNA 5DG8A 4QW8A 3HWTA 4PJ0U 7ICLA 2W3SA 4NJ8A 4C4TA 3LDAA 5BPCA 2FLPA 2HHWA 1HJPA 2K8AA 4QZIA 5DKWA 2FLNA 9ICAA 1XO0A 2HI0A 2CPRA 2ZTEA 5AIBA 2D8CA 2ZIWB 2NRXA 3GZFA 3Q8PB 2Q4TA 3UXOA 4J9OA 1RG6A 3RJFA 5KNIA 1U9LA 5ALSA 3QUCA 2A3VA 3FDSA 4R65A 4O3SA 2ZTDA 4ED3A 9ICQA 2CRXA 4RPXA 3RF9A 4J9NA 2XCAA 7ICGA 3T5LA 5DGBA 2LYBA 1S5LU 4KLMA 3ZDAA 4P4OA 9ICBA 5J2JA 3PW2A 1YZ7A 5TZVA 7ICQA 5EWEA 3N7RC 8ICTA 1UQVA 4M9HA 3MFIA 3WKAA 2VA2A 1ZQSA 4F93B 2LKYA 5KFXA 4Q8EA 2E1EA 1K1QA 2MRLA 3I1YA 4TUSA 3KD3A 1PK3A 3RB3A 2WF6A 5G5GA 1KFTA 2W7OA 4B9LA 4C4SA 2KOBA 1X66A 1KN5A 5KG5A 4U6PA 8ICRA 3C29A 7ICOA 2H3FA 4JV1A 2QARA 1SXDA 1VLBA 1ZQOA 4TUQA 3KZXA 2UVWA 5KFLA 4I2JA 4QZGA 3R9KA 1RM6C 4J9KA 4UB2A 4ECXA 4O9MA 1ZJMA 3VC8A 2JEJA 4DSLA 4MHVA 2XCPA 3QX7A 2IBKA 4F5QA 5BOLA 2LM4A 2NYVA 1JUDA 4DFDA 1SZPA 5J0PA 4Q44A 3F5AA 3QEBZ 2K4PA 5J8YC 1ZRNA 4GXKA 1NK9A 3RH6A 2AGQA 2W9BA 4J9LA 1WCLA 4IR1A 4EZ6A 3H40A 7ICSA 1RZTA 1L8LA 3BS7A 3BQTA 1S76D 3GV5B 3KBBA 3M9MB 4PHPA 1AQ6A 2AJQA 3H0LB 2H3VA 1SKWA 5DQIA 9ICVA 4G3IA 2ASJA 1M6YA 3TKAA 3ISBA 2F1HA 2JV3A 2KNJA 5J0WA 1ZQEA 2GLEA 2BGWA 3RJJA 2LPEA 2ZXIA 5BOMA 1ZQWA 1ZQZA 2BCUA 4QZHA 4YCXA 1WYGA 4KX5A 4F72A 3V7LA 2W9MA 5J2FA 3V72A 3NRZA 4I29A 1XWLA 4AP9A 1KBUA 4KTQA 2GO7A 5DB6A 3C5GA 1UT8A 5KT2A 4CGZA 2NRZA 2B6GA 5J0XA 3HKZC 3UPQA 3KZIU 2KKPA 3G6YA 3RFAA 1L3UA 2V9WA 4RQMA 4UB5A 4QWAA 2OWOA 2RHFA 4OJ5A 2C2RA 4PHEA 1SL1A 3WK9A 3EWAA 3WKEA 2JR5A 4QIWF 1COKA 2ODGA 2OHFA 1TAMA 5IIIA 4BXOB 4O3OA 3THVA 2EANA 3MGIA 3N4MB 1CRXA 8ICBA 2HBLA 4YMMA 1Z00A 3V6JA 4EENA 1L3SA 5IIOA 3I76A 2KEYA 1JRPA 4Y2XA 2YB4A 2BPCA 1S0VA 4RQ1A 2AHOB 2RDJA 3GV7B 5C0YA 3RRHA 4KLUA 5AI6A 3ALRA 3HP6A 4NLGA 4O3RA 3WKDA 4DCCA 1NKEA 8ICXA 1ZQCA 4YD1A 3SD7A 4UB4A 4QWCA 2KP7A 5KL1B 1NJXA 3ETRA 4YXMA 2F2AB 3IG8A 1ZQFA 5ALGA 4I28A 1SV4A 1UT5A 5ALFA 5KFWA 4P2HA 1ZD3A 4BWMA 1DGJA 2ALZA 1N2XA 5J0TA 1TK0A 2K4IA 1NI3A 1UA1A 2LYAA 2CXYA 2ESEA 4M04A 2HHQA 2BDPA 2LMRA 9ICUA 1X9XA 3MGHA 1Q8KA 2XGPA 4DFJA 2NRWA 4RQ7A 4BDPA 4PGYA 3IM1A 2OH2A 3PVXA 2C22A 3G6XA 4I27A 1D8YA 1Z19A 1ZQVA 4UATA 1KRPA 2OXOA 4UB8U 1NNLA 1LKYA 8ICLA 4GLXA 4JB3A 4UQGA 5F9NA 2XI9A 4QWBA 5ALDA 4ECTA 3AU6A 3K1ZA 4RU9A 1J2NA 4NWIA 2R8KA 5TISU 5EE9A 3TADA 4J03A 4X5VA 2F77X 3C5FA 4OCZA 3QU2A 5JRTA 7ICJA 2KJ8A 3NASA 4I2EA 3SR6A 5ALQA 2K89A 4O3MA 5D49A 2AH5A 1JROA 2R8JA 4IQTA 3QEAZ 4RNOA 2WFAA 2IOHA 2ZUBA 4GXIA 1XC9A 1ZQTA 1B4FA 4AYBF 2K8CB 1Q3VA 1WUDA 5HMMA 4M47A 2XY7A 7ICVA 2FLLA 2VA3A 1T94A 4ECVA 5KG2A 2RQ5A 2O6KA 3UM9A 1S10A 5KFGA 1P7DA 1XS9D 2ZJAA 3WK4A 3O0FA 2KHQA 5AI5A 5EOZA 2J6SA 1KSPA 4CF4A 5F3XB 4OJ6A 1T8EA 4EZ9A 4O5EA 2MAXA 4CE6A 5AKJA 1OUQA 1MA7A 1TE2A 1CI4A 4DQQA 3CYMA 4ICAA
chains in the Genus database with same CATH topology
1X40A 1PK1B 4RQNA 3SENA 1PK3A 2EAMA 2E8OA 1PK1A 2D3DA 2QKQA 2B6GA 2KE7A 4NL9A 1LKYA 1V85A 3IDWA 1X66A 2KSOB 4RQMA 2QARA 1SXDA 1UCVA 2KSOA 2YTUA 1COKA 1DXSA 1SXEA 2E8PA 1JI7A 3TADA 1Z1VA 2EANA 3H8MA 5JRTA 1LKYB 1KW4A 3KKAA 4MHVA 2EAPA 1B0XA 2E8MA 4NJ8A 2ES6A 2L5YA 2DKZA 3TACB 2QARB 2Y9TA 2K60A 3SEIA 2KIVA 1V38A 2FE9A 2K4PA 5J8YC 2D8CA 5L1MA 2F3NA 2DL0A 3BQ7A 2QB1A 1B4FA 1F0MA 4PZOA 2Y9UA 1SV0C 3BS5B 4PZNA 5JU5A 1RG6A 5KNIA 2QB0B 3BS7A 2DKXA 3BS5A 2QB0A 1SV4A 3HILA 4NL9C 4IS7A 1OW5A 2F44A 1WWUA 2F8KA 2JV3A 1WWVA 2KMDA 5JTIA 2EAOA 2GLEA 2ESEA 1OXJA 2LPEA 5F3XB 5J8YA 3TADC 1UQVA 2LMRA 2E8NA 1X9XA 2KG5A 3KKAC 1SGGA 1SV0A 3K1RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X40 A;  1PK1 B;  4RQN A;  3SEN A;  1PK3 A;  2EAM A;  2E8O A;  1PK1 A;  2D3D A;  2QKQ A;  2B6G A;  2KE7 A;  4NL9 A;  1LKY A;  1V85 A;  3IDW A;  1X66 A;  2KSO B;  4RQM A;  2QAR A;  1SXD A;  1UCV A;  2KSO A;  2YTU A;  1COK A;  1DXS A;  1SXE A;  2E8P A;  1JI7 A;  3TAD A;  1Z1V A;  2EAN A;  3H8M A;  5JRT A;  1LKY B;  1KW4 A;  3KKA A;  4MHV A;  2EAP A;  1B0X A;  2E8M A;  4NJ8 A;  2ES6 A;  2L5Y A;  2DKZ A;  3TAC B;  2QAR B;  2Y9T A;  2K60 A;  3SEI A;  2KIV A;  1V38 A;  2FE9 A;  2K4P A;  5J8Y C;  2D8C A;  5L1M A;  2F3N A;  2DL0 A;  3BQ7 A;  2QB1 A;  1B4F A;  1F0M A;  4PZO A;  2Y9U A;  1SV0 C;  3BS5 B;  4PZN A;  5JU5 A;  1RG6 A;  5KNI A;  2QB0 B;  3BS7 A;  2DKX A;  3BS5 A;  2QB0 A;  1SV4 A;  3HIL A;  4NL9 C;  4IS7 A;  1OW5 A;  2F44 A;  1WWU A;  2F8K A;  2JV3 A;  1WWV A;  2KMD A;  5JTI A;  2EAO A;  2GLE A;  2ESE A;  1OXJ A;  2LPE A;  5F3X B;  5J8Y A;  3TAD C;  1UQV A;  2LMR A;  2E8N A;  1X9X A;  2KG5 A;  3KKA C;  1SGG A;  1SV0 A;  3K1R B; 
#chains in the Genus database with same CATH topology
 2IHM A;  1QSL A;  3QZ8 A;  4B9S A;  4OJP A;  2UVU A;  1B43 A;  3T79 A;  9ICN A;  3IRU A;  3HJE A;  1ZQ1 C;  4GC6 A;  2B21 A;  4M6W B;  5AK3 A;  2WF8 A;  5IIJ A;  3T5K A;  5AI4 A;  3C1Y A;  2KE7 A;  5AKE A;  4A8E A;  5JUM A;  1S77 D;  5J2I A;  1ZQR A;  2PI5 A;  3V7J A;  4TUP A;  2QLT A;  2HOF A;  4QJF B;  4QIW C;  4FS2 A;  3H8W A;  4I2F A;  3GU3 A;  2BCS A;  5J2C A;  2DPJ A;  4EEK A;  2A1A A;  2V4R A;  5EE1 A;  5KFZ A;  2MSN A;  3C2M A;  2KIC A;  3TAQ A;  2EAP A;  3NTU A;  8ICE A;  4KLD A;  3QU7 A;  2L5Y A;  3TAC B;  2HHS A;  5J0S A;  3C2L A;  2ZTC A;  3T5J A;  3QU5 A;  1CEZ A;  4YVZ A;  1L3V A;  4TQS A;  5L1J A;  8ICY A;  3PZP A;  5DB9 A;  3BDP A;  2I5H A;  4QZA A;  5DB7 A;  1A6S A;  4OD0 A;  1PVP A;  4Y2J A;  2NRV A;  2VAN A;  2Y9U A;  5ALO A;  3M1Y A;  1IXR A;  5FP0 A;  3PW0 A;  4M0A A;  4QZB A;  4IQU A;  1SKS A;  3C1Z A;  4DL3 A;  2QB0 A;  3ZD9 A;  3GIM A;  5KFR A;  2BCQ A;  4PL1 A;  1VDV A;  3BQ2 A;  2BQU A;  1JN3 A;  3MDC A;  2DF4 B;  1QCK A;  2KMD A;  4E0D A;  4IRC A;  1KEJ A;  1PVR A;  3QUB A;  1A76 A;  4UBC A;  5AM0 A;  2M0N A;  5HR7 A;  4UAU A;  4Q45 A;  3MR5 A;  5EWF A;  1KFD A;  3BQ1 A;  5AKZ A;  2F1J A;  2R8I A;  3OSP A;  3LWL A;  1VJ5 A;  2EH9 A;  1X40 A;  2PFN A;  4WJ3 B;  3NVV A;  5AM5 A;  5IIK A;  4RUA A;  3PSF A;  4J9S A;  2DPI A;  3MC1 A;  2LHT A;  2E5S A;  4R8U A;  5KFM A;  8ICU A;  4QWE A;  2IOF A;  5HR6 A;  5KT3 A;  2ATL A;  3Q8L A;  1PVQ A;  2YX8 A;  4MF8 A;  1L7O A;  4NM2 A;  3BZC A;  2M9N A;  1A77 A;  2R18 A;  3A0H U;  5K4L A;  3KFU F;  3ZD8 A;  3OPX A;  3AUO A;  2W03 A;  1NK8 A;  4B9V A;  4DQP A;  4ELU A;  3QUT A;  4QNL A;  4DSI A;  3ISC A;  1ZD5 A;  4BUG A;  5DG7 A;  3Q8M A;  3ZI4 A;  2YQE A;  4AYB C;  4RQ2 A;  4PZO A;  4KMO B;  5C5J A;  1SV0 C;  8ICK A;  4I2B A;  2FPL A;  3JPR A;  2QB0 B;  4Z6E A;  5ALN A;  5KFV A;  2KFN A;  4GFJ A;  3M9N B;  4F5R A;  2BQR A;  1LB2 B;  4UBB A;  3E58 A;  4QZD A;  7ICI A;  3N97 B;  1L6N A;  4Y2Y A;  4IS7 A;  4HAI A;  5DQH A;  4LZD A;  2HOQ A;  2WHE A;  4DQR A;  3IP4 B;  3DDH A;  5G5H A;  2AQ0 A;  3FYH A;  1NJZ A;  4IL6 U;  1U47 A;  2RP5 A;  5AKX A;  3H8S A;  2LM1 A;  4KLG A;  4CF3 A;  3H4D A;  2W8L A;  5J2B A;  2OCE A;  4USA A;  1RYU A;  1ZQJ A;  2FPK A;  2JZB A;  4YD2 A;  1KL9 A;  9ICS A;  2C2E A;  4NLN A;  1O03 A;  5AM2 A;  2GOL A;  3AU2 A;  5IIL A;  4F50 A;  5J2E A;  4KLT A;  1KQQ A;  4DS4 A;  2VA8 A;  4US8 A;  4IRD A;  4DQS A;  3ISD A;  2HBK A;  4B9T A;  3EYZ A;  1U48 A;  9ICK A;  3MFH A;  2ISO A;  3CW2 C;  4Y2R A;  2JGA A;  2YY6 A;  2HHX A;  4DFK A;  2UVV A;  4UAZ A;  3JPS A;  3BQ0 A;  9ICW A;  3LVV A;  1D9D A;  2QB1 A;  4ELV A;  3Q8K A;  2W9C A;  5ALU A;  2HW3 A;  2FPM A;  2ZIU A;  1S0M A;  5ALV A;  2DUY A;  3F2C A;  1DRG A;  1DK2 A;  1L7N A;  2KZ3 A;  4I2C A;  5KG0 A;  2OYY A;  1TV9 A;  1NK5 A;  2F8K A;  1X9W A;  5DBB A;  4TUR A;  3RRG A;  1DGS A;  3H0M B;  9ICI A;  3F5E A;  5J8Y A;  4DEZ A;  1WCN A;  4ECR A;  1NKB A;  4IRK A;  4IQW A;  4ELT A;  5KL8 B;  3T5H A;  1D8B A;  4Q8F A;  4P0Q A;  4XUS A;  2H5X A;  1SB3 C;  5L9X A;  1NK7 A;  5DLG A;  4RQN A;  3PR4 A;  4DOA A;  2YML A;  3NVZ A;  2FJ6 A;  1ZQK A;  3IHQ B;  3TFS A;  8ICN A;  2PMZ F;  3QUQ A;  3RJI A;  1U4B A;  2W3R A;  9ICL A;  1NK4 A;  2E8P A;  3RBE A;  4FBT A;  3RR8 A;  4O0I A;  1X42 A;  2OM6 A;  3UQ0 A;  1RQL A;  2NRT A;  2NV3 A;  3V7K A;  3GIJ A;  4YN4 A;  7ICM A;  2BZF A;  2E8M A;  2H3Z A;  2QAR B;  3VCB A;  3MGV A;  3WK7 A;  4F2S A;  5HML A;  3QYP A;  5AKG A;  1MN8 A;  5J2H A;  2ZIU B;  5KT6 A;  1Z3E B;  2CN1 A;  4JUZ A;  5KFH A;  4C80 A;  1D9F A;  5EE0 A;  2MA1 A;  4DO9 A;  8ICP A;  4KLF A;  8ICF A;  4O3Q A;  5L1I A;  3GV8 B;  5DG9 A;  8ICM A;  4UAR A;  2HVH A;  2AXT U;  3D2N A;  5CR0 A;  5CWR A;  4KLI A;  4KMU A;  2W9B B;  1XNS A;  2EZX A;  3RB4 A;  5GTH U;  4Y2Q A;  3UQ2 A;  5JTI A;  7ICN A;  2FMS A;  2HHU A;  1T4G A;  4O3P A;  4P0Q B;  2DFL A;  2F1I A;  5KAI U;  1NOM A;  2EDU A;  4ACO A;  3D6J A;  5DDY A;  2HBM A;  5J0Y A;  5J2K A;  1HEK A;  4B9M A;  4ECY A;  2AQ4 A;  1QQ5 A;  3PV8 A;  4QZF A;  4LZG A;  3QU4 A;  4RPZ A;  3SEN A;  4QZE A;  3WK8 A;  2H3I A;  3LK9 A;  2JEI A;  4DF4 A;  4EX6 A;  4UB3 A;  4EBC A;  1ZQA A;  8ICZ A;  4DFP A;  3OJU A;  1PZN A;  3RR7 A;  4DL2 A;  5KFY A;  1ZQL A;  3S6J A;  2KSO A;  4DSE A;  3ETL A;  5DBA A;  1SWV A;  4O3N A;  2A1J A;  1Z1V A;  3H8M A;  3SAH A;  7ICF A;  1KW4 A;  3SAG A;  4NLZ A;  4US9 A;  1B0X A;  1Z1B A;  1U45 A;  4DL5 A;  3HPO A;  2F8L A;  5B5E U;  4YR3 A;  1KFS A;  5AK4 A;  2ZIV A;  5KFJ A;  5ALJ A;  5J0Q A;  1SL0 A;  1ED1 A;  1QQ7 A;  3ZDB A;  9ICF A;  4UAV A;  1IM4 A;  2RDI A;  2KN7 A;  4DL7 A;  9ICT A;  1F0M A;  3HT3 A;  2KVS A;  1Z00 B;  1A0P A;  2W04 A;  3DEE A;  1UPH A;  4J9R A;  3C23 A;  1ZQB A;  3UXP A;  1YT3 A;  1NJW A;  5KG3 A;  4ED0 A;  3BS5 A;  3EZ5 A;  4RZR A;  5ALT A;  3FAH A;  2BDU A;  3EW9 A;  1FO4 A;  4NL9 C;  2J6U A;  4ED8 A;  5KG1 A;  5AIC A;  3TQ1 A;  3EUB 2;  1WWU A;  4PPX A;  4UB1 A;  2ASD A;  4DSJ A;  3PML A;  1MC8 A;  1Z4O A;  1RXV A;  1ZYQ A;  9ICO A;  8ICG A;  4DWI A;  1L7M A;  1RYR A;  5AIA A;  2BPG A;  3GQC A;  5J2D A;  4R63 A;  2VJ5 A;  4QW9 A;  3M8S A;  1NK6 A;  4K4H A;  3RJK A;  1ZQM A;  1KLN A;  2LI6 A;  2Y1I A;  2UVR A;  2J6T A;  4UAW A;  1SZH A;  4P4P A;  4Z6C A;  4M9N A;  1BGX T;  4YXJ A;  1MSW D;  1N5X A;  5KT7 A;  2KSO B;  2ZUD A;  3CP8 A;  3M9O B;  1ZJN A;  1ZQD A;  4PGX A;  2GWS A;  3RJG A;  2A1J B;  4NLK A;  1JXL A;  3SV3 A;  2W8K A;  3KHG A;  4JK1 A;  5HP4 A;  1HUZ A;  2WB1 F;  1LKY B;  5CA7 A;  2WF9 A;  4HYK A;  3D2Q A;  4YP3 A;  4QZ9 A;  2HCF A;  2ZIV B;  2BHN A;  3TI0 A;  2HOI A;  2BKE A;  2ZUC A;  3I28 A;  3K4G A;  4CNQ A;  2VIX A;  3JPO A;  5AHX A;  4KLJ A;  1HIW A;  5DB8 A;  9ICP A;  3F2D A;  4EEY A;  3SQI A;  3PST A;  3BS5 B;  9ICG A;  2LBO A;  4P4M A;  2KHV A;  5H2F U;  3QU9 A;  2DKX A;  3IV6 A;  3H0R B;  4KN4 A;  1L7P A;  3JPP A;  3A0B U;  2KZZ A;  4DLG A;  4M9L A;  4DOC A;  3HIL A;  8ICH A;  3AN1 A;  1QTM A;  4B9U A;  8ICV A;  4J9Q A;  1H38 A;  4BWJ A;  3GFK B;  7ICH A;  2PFP A;  1WWV A;  2VJ4 A;  3KHR A;  4CF5 A;  4EX7 A;  2G06 A;  2RRD A;  5KFF A;  4RPY A;  4C7Y A;  2V4Q A;  4ZH4 A;  2AGP A;  1ZQI A;  2P66 A;  3KKA C;  4EBE A;  2GH1 A;  4ECW A;  2MUT A;  5EWG A;  3HX0 A;  3KHL A;  2EZY A;  4ED7 A;  8ICO A;  3OTQ A;  4NLB A;  2KFZ A;  1ZD2 P;  1V85 A;  2PI4 A;  1QQ6 A;  4Y2P A;  2E1F A;  4F5N A;  1V97 A;  2F76 X;  4YR2 A;  2G07 A;  2KTQ A;  4MF2 A;  4ECU A;  1SXE A;  2BCV A;  2W54 A;  4RQ8 A;  3Q8Q B;  4FE3 A;  1N62 A;  5ALH A;  4I2G A;  2XY5 A;  4YFK A;  2NO4 A;  1L5U A;  2JXJ A;  2ZIW A;  9ICH A;  3UMC A;  2IOF K;  3LWM A;  9ICC A;  5AI0 A;  2DKZ A;  1J97 A;  4IC9 A;  2G09 A;  3ZDD A;  4XQ8 A;  1X6I A;  3V6H A;  4F8R A;  1DK3 A;  4QWD A;  1Z4N A;  3ICX A;  1C20 A;  2ZJ5 A;  3RBD A;  1XU4 A;  2KIW A;  4RNM A;  2ZG6 A;  4BX9 C;  2P6R A;  5AKL A;  4F4W A;  1QSY A;  3L5K A;  2Y1J A;  2B0C A;  3T3F A;  2KD1 A;  1BPZ A;  1Y88 A;  4IQV A;  8ICS A;  1XSN A;  2YN4 A;  4ECZ A;  4CDG A;  2N1R A;  4DSF A;  1UA0 A;  5J0R A;  1ZQG A;  3C21 A;  5KTQ A;  2W55 A;  4F5P A;  3WK6 A;  3HKZ F;  5ALM A;  3MBY A;  9ICJ A;  4C8M A;  3OJS A;  2E8N A;  2KG5 A;  3PX6 A;  3SV4 A;  3PSI A;  4Z6F A;  3K75 D;  1SGG A;  1NZP A;  1SV0 A;  3KOO A;  3QXG A;  3LYS A;  4KN7 A;  5J29 A;  1L3T A;  1T7P A;  5ALL A;  1PK1 A;  5CRX A;  1F5S A;  5ALI A;  3H8J A;  3BJY A;  4IR9 A;  2BQ3 A;  2KKV A;  4EEL A;  3ZDC A;  3QNM A;  1N60 A;  3G6V A;  9ICE A;  2D6F C;  3C2K A;  3RAQ A;  4OJL A;  2NO5 A;  1KKX A;  1ARO P;  2Q0Z X;  3CRX A;  2WB1 C;  3TAR A;  3SI8 A;  3RB0 A;  2I1Q A;  1COO A;  1YZ6 A;  4OJO A;  5J2G A;  4R8U B;  4YQW A;  1ZET A;  1TK8 A;  4C8L A;  2XC9 A;  3MR3 A;  2ES6 A;  4KLH A;  4KLQ A;  1IV8 A;  5KG6 A;  3JPQ A;  2Z7J A;  2G0A A;  2BPF A;  1ZQH A;  3L4P A;  4QZ8 A;  3GII A;  4RQ6 A;  5KFS A;  3UXN A;  4MFC A;  4ED6 A;  2ISP A;  1BPD A;  2EZZ A;  4FZN A;  4DOB A;  3IG5 A;  4PZN A;  3PW4 A;  4F91 B;  2AU0 A;  3PO4 A;  4M2Y A;  1TKD A;  2DGZ A;  4XA5 A;  4UAS A;  4RT2 A;  2HVI A;  4C7Z A;  3AL0 B;  1T3N A;  5HHI A;  5CB1 A;  4EYH B;  3IN5 A;  3TAP A;  4I2H A;  4F2R A;  3OGU A;  1JX4 A;  1X6J A;  2KJ9 A;  4B6J A;  4F71 A;  5AKK A;  3PX4 A;  1Q3U A;  3D2S A;  4P0P A;  5F9L A;  1XSP A;  1PK1 B;  1N56 A;  4RQ3 A;  4XRH A;  2AGO A;  2JEG A;  4DL6 A;  5AM3 A;  2YMP A;  4BXO A;  4DQI A;  7ICK A;  3GIK A;  5ALZ A;  2DBY A;  1RQN A;  1RYS A;  4EYI B;  5J0U A;  3U26 A;  5AK6 A;  3RTV A;  2XIC A;  3FM9 A;  2XVT A;  2ZJ8 A;  2YTU A;  3RJE A;  3BZK A;  2JZB B;  4OO1 J;  1TVA A;  4R64 A;  1N61 A;  3TFR A;  1RPL A;  1FEZ A;  2FDR A;  2PFQ A;  1BPX A;  2E3T A;  3TAN A;  3MR6 A;  4UAY A;  2Y9T A;  3SEI A;  1ZQN A;  3PO5 A;  3EPG A;  3MR2 A;  4C8K A;  3RAX A;  2FE9 A;  1JXE A;  1URJ A;  2G08 A;  5AKH A;  3WKB A;  5L1M A;  2F3N A;  5KT4 A;  1O08 A;  1S0O A;  4F92 B;  2HHT A;  4ECS A;  1BPE A;  5EE3 A;  4I2A A;  2G5I B;  8ICI A;  5JU5 A;  4C4R A;  2MU2 A;  3FC4 A;  2JH1 A;  3AQE A;  8ICJ A;  3AMZ A;  1FIQ A;  3E0F A;  5KFU A;  2P35 A;  5AI8 A;  2W11 A;  3LVW A;  4KLL A;  5AK5 A;  3M6Z A;  2HBJ A;  2W9A A;  7ICU A;  4FZM A;  2ZXH A;  3V6K A;  1ZQP A;  3NGD A;  2W9C B;  1MQ2 A;  5KFB A;  5A0L A;  4QZC A;  3Q8S B;  5GTI U;  5CJ7 A;  3WKC A;  1Q46 A;  5KFE A;  5KFK A;  2FMP A;  4DLE A;  2WAQ F;  5DBC A;  5KFI A;  4K4I A;  4P0P B;  4F3O A;  1SWW A;  1LV5 A;  3H7I A;  3F2B A;  4TQR A;  4Y2T A;  3H4B A;  3K1R B;  1IIP A;  3OHB A;  5CHG A;  1L8O A;  4LJX A;  4FO6 A;  2G5H B;  1MQ3 A;  3PR5 B;  1ZOL A;  3QZ7 A;  2IMW P;  4KIT B;  3IDW A;  5J2A A;  2FI1 A;  2A19 A;  4Z6D A;  5ALE A;  3RH5 A;  5ALX A;  2PKE A;  4I2D A;  4DFM A;  5KFD A;  1ECW A;  3B9J A;  4GIB A;  1GO3 F;  4UB6 U;  1NKC A;  2K4H A;  3NS1 A;  3PW5 A;  2P6U A;  1SL2 A;  4Y2S A;  1QSS A;  3ED5 A;  5AKY A;  3DV9 A;  4O5C A;  4C0Z A;  1S8O A;  1ZXI A;  5KFC A;  1KDH A;  1JIH A;  2RLT A;  2HHV A;  4U7C A;  2JHD A;  5L1K A;  2IHN A;  2YB1 A;  8ICA A;  4CCH A;  4GC7 A;  4PL2 A;  2Y0S F;  3PSP A;  1J2M A;  2OEH A;  4KX3 A;  3SAF A;  2WF5 A;  1FFV A;  2JEF A;  1N63 A;  1UHU A;  5D4B A;  3PMN A;  2KK0 A;  5KFT A;  2XO7 A;  1NJY A;  2XID A;  3JPN A;  2FMQ A;  8ICW A;  8ICQ A;  2JRZ A;  3GDX A;  1ZQY A;  1BPB A;  5CEH A;  2KZM A;  4PHA A;  5KG7 A;  4PHD A;  4JV0 A;  9ICM A;  3RH4 A;  2JMG A;  2HMX A;  5DGA A;  1TK5 A;  4M9J A;  4F4Z A;  3M6K A;  4M6W A;  3TAD C;  5KT5 A;  2PXI A;  5T14 A;  5AKI A;  9ICX A;  5KG4 A;  4DL4 A;  4FS1 A;  2C2D A;  3M8R A;  2D3D A;  4NL9 A;  3OHA A;  4ED2 A;  4PH5 A;  5KFP A;  2K8B B;  4UW9 A;  5DLF A;  3NVY A;  1ZRM A;  4NLC A;  1X2I A;  4K4G A;  3ONN A;  3N28 A;  1B22 A;  5AI9 A;  4BJQ A;  1BPY A;  3CNH A;  1PUZ A;  3ORY A;  1TAU A;  2PMZ C;  5E79 U;  5DQG A;  1NZB A;  4KLO A;  1TFR A;  3SZ2 A;  4GXJ A;  4NM1 A;  2KIV A;  1HUO A;  5ALR A;  1V38 A;  5HHH A;  1IG6 A;  2KJ5 A;  2DWQ A;  2PFO A;  3J81 j;  1BNO A;  5HNK A;  3Q8R B;  4YMN A;  2KV2 A;  5AM1 A;  4DSK A;  4KLS A;  3F53 A;  1N5W A;  4YR0 A;  3AEV A;  4M9G A;  4MFF A;  7ICR A;  1FFU A;  2XGQ A;  3C28 A;  1K1S A;  2JH7 A;  4YG2 A;  5KFA A;  4LVS A;  4NY8 A;  5L1L A;  7ICP A;  4RQ0 A;  2BR0 A;  4NXZ A;  4YMO A;  4F4Y A;  1QH9 A;  5ALP A;  3SYZ A;  2EAO A;  8ICC A;  4O5K A;  1OXJ A;  2DQN B;  2ZIX A;  2WAQ C;  4J9P A;  4F4X A;  4MEY A;  4Y2U A;  1ZQQ A;  4ED1 A;  2YMM A;  5CP2 A;  1T3Q A;  1S9F A;  2C28 A;  1U49 A;  5KFO A;  1V9P A;  2EQY A;  4DF8 A;  1BVS A;  3RB6 A;  1XSL A;  2XY6 A;  1N48 A;  2QKQ A;  3NRW A;  3UMG A;  4RNN A;  4F5O A;  3PNC A;  1D8L A;  2WTF A;  3B0X A;  3EPI A;  3AQF A;  2VKQ A;  1JMS A;  1SIJ A;  3ZDE A;  7ICE A;  1DXS A;  1JI7 A;  1JAL A;  3E2E A;  2R8G A;  3N7P D;  4FFD A;  3KKA A;  1S97 A;  1RXW A;  7ICT A;  1TAQ A;  4C8O A;  2LYH A;  2R8H A;  3NUQ A;  3B0Y A;  5IIN A;  2K60 A;  3KTQ A;  4RUC A;  1KTQ A;  4ZOH C;  2Y0S C;  1RDF A;  3PX0 A;  1X9M A;  2IA6 A;  2WF7 A;  2DL0 A;  5J0O A;  3BQ7 A;  5AM4 A;  3JPT A;  4JWN A;  3OSN A;  5ALK A;  1C7Y A;  3N7S C;  1ZQX A;  4RT3 A;  2I9G A;  2ASL A;  2HSZ A;  4J9M A;  4Q43 A;  4BGD A;  3AM9 A;  4F4K A;  5B66 U;  3WK5 A;  2W7P A;  3MAB A;  3RJH A;  4NV0 A;  5ALW A;  3M7D A;  1CUK A;  3UMB A;  4PGQ A;  1OW5 A;  4B9N A;  1NK0 A;  2F44 A;  3WU2 U;  4EBD A;  2ZIX B;  5KFQ A;  3NVW A;  2H3Q A;  5ALY A;  5IIM A;  1F44 A;  4C8N A;  1ZQU A;  1K5O A;  2W43 A;  3QE9 Y;  1WG8 A;  4CRX A;  3PW7 A;  4DS5 A;  1BNP A;  4JV2 A;  3SMV A;  4G9B A;  1LVH A;  4JMU A;  4FZL A;  5DDM A;  2HDO A;  4R66 A;  1SKR A;  5D46 A;  5KAF U;  3GIL A;  4MEX A;  4MFA A;  2EAM A;  2YMQ A;  2E8O A;  4RQ5 A;  9ICR A;  1ZD4 A;  4JWM A;  1DOQ A;  3HRD D;  1QLN A;  3L3F X;  1XO1 A;  2BCR A;  4ECQ A;  4I2I A;  3KHH A;  1UCV A;  2K4E A;  2MUT B;  1X9S A;  4KLE A;  3MDA A;  2I6X A;  4RQ4 A;  4FBU A;  2KVC A;  4Y2V A;  3PY8 A;  1S0N A;  3HW8 A;  5KFN A;  1EXN A;  5DG8 A;  4QW8 A;  3HWT A;  4PJ0 U;  7ICL A;  2W3S A;  4NJ8 A;  4C4T A;  3LDA A;  5BPC A;  2FLP A;  2HHW A;  1HJP A;  2K8A A;  4QZI A;  5DKW A;  2FLN A;  9ICA A;  1XO0 A;  2HI0 A;  2CPR A;  2ZTE A;  5AIB A;  2D8C A;  2ZIW B;  2NRX A;  3GZF A;  3Q8P B;  2Q4T A;  3UXO A;  4J9O A;  1RG6 A;  3RJF A;  5KNI A;  1U9L A;  5ALS A;  3QUC A;  2A3V A;  3FDS A;  4R65 A;  4O3S A;  2ZTD A;  4ED3 A;  9ICQ A;  2CRX A;  4RPX A;  3RF9 A;  4J9N A;  2XCA A;  7ICG A;  3T5L A;  5DGB A;  2LYB A;  1S5L U;  4KLM A;  3ZDA A;  4P4O A;  9ICB A;  5J2J A;  3PW2 A;  1YZ7 A;  5TZV A;  7ICQ A;  5EWE A;  3N7R C;  8ICT A;  1UQV A;  4M9H A;  3MFI A;  3WKA A;  2VA2 A;  1ZQS A;  4F93 B;  2LKY A;  5KFX A;  4Q8E A;  2E1E A;  1K1Q A;  2MRL A;  3I1Y A;  4TUS A;  3KD3 A;  1PK3 A;  3RB3 A;  2WF6 A;  5G5G A;  1KFT A;  2W7O A;  4B9L A;  4C4S A;  2KOB A;  1X66 A;  1KN5 A;  5KG5 A;  4U6P A;  8ICR A;  3C29 A;  7ICO A;  2H3F A;  4JV1 A;  2QAR A;  1SXD A;  1VLB A;  1ZQO A;  4TUQ A;  3KZX A;  2UVW A;  5KFL A;  4I2J A;  4QZG A;  3R9K A;  1RM6 C;  4J9K A;  4UB2 A;  4ECX A;  4O9M A;  1ZJM A;  3VC8 A;  2JEJ A;  4DSL A;  4MHV A;  2XCP A;  3QX7 A;  2IBK A;  4F5Q A;  5BOL A;  2LM4 A;  2NYV A;  1JUD A;  4DFD A;  1SZP A;  5J0P A;  4Q44 A;  3F5A A;  3QEB Z;  2K4P A;  5J8Y C;  1ZRN A;  4GXK A;  1NK9 A;  3RH6 A;  2AGQ A;  2W9B A;  4J9L A;  1WCL A;  4IR1 A;  4EZ6 A;  3H40 A;  7ICS A;  1RZT A;  1L8L A;  3BS7 A;  3BQT A;  1S76 D;  3GV5 B;  3KBB A;  3M9M B;  4PHP A;  1AQ6 A;  2AJQ A;  3H0L B;  2H3V A;  1SKW A;  5DQI A;  9ICV A;  4G3I A;  2ASJ A;  1M6Y A;  3TKA A;  3ISB A;  2F1H A;  2JV3 A;  2KNJ A;  5J0W A;  1ZQE A;  2GLE A;  2BGW A;  3RJJ A;  2LPE A;  2ZXI A;  5BOM A;  1ZQW A;  1ZQZ A;  2BCU A;  4QZH A;  4YCX A;  1WYG A;  4KX5 A;  4F72 A;  3V7L A;  2W9M A;  5J2F A;  3V72 A;  3NRZ A;  4I29 A;  1XWL A;  4AP9 A;  1KBU A;  4KTQ A;  2GO7 A;  5DB6 A;  3C5G A;  1UT8 A;  5KT2 A;  4CGZ A;  2NRZ A;  2B6G A;  5J0X A;  3HKZ C;  3UPQ A;  3KZI U;  2KKP A;  3G6Y A;  3RFA A;  1L3U A;  2V9W A;  4RQM A;  4UB5 A;  4QWA A;  2OWO A;  2RHF A;  4OJ5 A;  2C2R A;  4PHE A;  1SL1 A;  3WK9 A;  3EWA A;  3WKE A;  2JR5 A;  4QIW F;  1COK A;  2ODG A;  2OHF A;  1TAM A;  5III A;  4BXO B;  4O3O A;  3THV A;  2EAN A;  3MGI A;  3N4M B;  1CRX A;  8ICB A;  2HBL A;  4YMM A;  1Z00 A;  3V6J A;  4EEN A;  1L3S A;  5IIO A;  3I76 A;  2KEY A;  1JRP A;  4Y2X A;  2YB4 A;  2BPC A;  1S0V A;  4RQ1 A;  2AHO B;  2RDJ A;  3GV7 B;  5C0Y A;  3RRH A;  4KLU A;  5AI6 A;  3ALR A;  3HP6 A;  4NLG A;  4O3R A;  3WKD A;  4DCC A;  1NKE A;  8ICX A;  1ZQC A;  4YD1 A;  3SD7 A;  4UB4 A;  4QWC A;  2KP7 A;  5KL1 B;  1NJX A;  3ETR A;  4YXM A;  2F2A B;  3IG8 A;  1ZQF A;  5ALG A;  4I28 A;  1SV4 A;  1UT5 A;  5ALF A;  5KFW A;  4P2H A;  1ZD3 A;  4BWM A;  1DGJ A;  2ALZ A;  1N2X A;  5J0T A;  1TK0 A;  2K4I A;  1NI3 A;  1UA1 A;  2LYA A;  2CXY A;  2ESE A;  4M04 A;  2HHQ A;  2BDP A;  2LMR A;  9ICU A;  1X9X A;  3MGH A;  1Q8K A;  2XGP A;  4DFJ A;  2NRW A;  4RQ7 A;  4BDP A;  4PGY A;  3IM1 A;  2OH2 A;  3PVX A;  2C22 A;  3G6X A;  4I27 A;  1D8Y A;  1Z19 A;  1ZQV A;  4UAT A;  1KRP A;  2OXO A;  4UB8 U;  1NNL A;  1LKY A;  8ICL A;  4GLX A;  4JB3 A;  4UQG A;  5F9N A;  2XI9 A;  4QWB A;  5ALD A;  4ECT A;  3AU6 A;  3K1Z A;  4RU9 A;  1J2N A;  4NWI A;  2R8K A;  5TIS U;  5EE9 A;  3TAD A;  4J03 A;  4X5V A;  2F77 X;  3C5F A;  4OCZ A;  3QU2 A;  5JRT A;  7ICJ A;  2KJ8 A;  3NAS A;  4I2E A;  3SR6 A;  5ALQ A;  2K89 A;  4O3M A;  5D49 A;  2AH5 A;  1JRO A;  2R8J A;  4IQT A;  3QEA Z;  4RNO A;  2WFA A;  2IOH A;  2ZUB A;  4GXI A;  1XC9 A;  1ZQT A;  1B4F A;  4AYB F;  2K8C B;  1Q3V A;  1WUD A;  5HMM A;  4M47 A;  2XY7 A;  7ICV A;  2FLL A;  2VA3 A;  1T94 A;  4ECV A;  5KG2 A;  2RQ5 A;  2O6K A;  3UM9 A;  1S10 A;  5KFG A;  1P7D A;  1XS9 D;  2ZJA A;  3WK4 A;  3O0F A;  2KHQ A;  5AI5 A;  5EOZ A;  2J6S A;  1KSP A;  4CF4 A;  5F3X B;  4OJ6 A;  1T8E A;  4EZ9 A;  4O5E A;  2MAX A;  4CE6 A;  5AKJ A;  1OUQ A;  1MA7 A;  1TE2 A;  1CI4 A;  4DQQ A;  3CYM A;  4ICA A; 
#chains in the Genus database with same CATH homology
 1X40 A;  1PK1 B;  4RQN A;  3SEN A;  1PK3 A;  2EAM A;  2E8O A;  1PK1 A;  2D3D A;  2QKQ A;  2B6G A;  2KE7 A;  4NL9 A;  1LKY A;  1V85 A;  3IDW A;  1X66 A;  2KSO B;  4RQM A;  2QAR A;  1SXD A;  1UCV A;  2KSO A;  2YTU A;  1COK A;  1DXS A;  1SXE A;  2E8P A;  1JI7 A;  3TAD A;  1Z1V A;  2EAN A;  3H8M A;  5JRT A;  1LKY B;  1KW4 A;  3KKA A;  4MHV A;  2EAP A;  1B0X A;  2E8M A;  4NJ8 A;  2ES6 A;  2L5Y A;  2DKZ A;  3TAC B;  2QAR B;  2Y9T A;  2K60 A;  3SEI A;  2KIV A;  1V38 A;  2FE9 A;  2K4P A;  5J8Y C;  2D8C A;  5L1M A;  2F3N A;  2DL0 A;  3BQ7 A;  2QB1 A;  1B4F A;  1F0M A;  4PZO A;  2Y9U A;  1SV0 C;  3BS5 B;  4PZN A;  5JU5 A;  1RG6 A;  5KNI A;  2QB0 B;  3BS7 A;  2DKX A;  3BS5 A;  2QB0 A;  1SV4 A;  3HIL A;  4NL9 C;  4IS7 A;  1OW5 A;  2F44 A;  1WWU A;  2F8K A;  2JV3 A;  1WWV A;  2KMD A;  5JTI A;  2EAO A;  2GLE A;  2ESE A;  1OXJ A;  2LPE A;  5F3X B;  5J8Y A;  3TAD C;  1UQV A;  2LMR A;  2E8N A;  1X9X A;  2KG5 A;  3KKA C;  1SGG A;  1SV0 A;  3K1R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...