5JTIA

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
LDMNISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Tankyrase-1
total genus 20
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jtiA00
1SV0A 2L5YA 4RQMA 3BS5A 3SENA 1JI7A 2D8CA 1F0MA 2DKZA 5KNIA 2F44A 3SEIA 2YTUA 1X66A 2Y9TA 1KW4A 2QB0B 2F8KA 2DKXA 1SV4A 1X9XA 1UQVA 1OW5A 1COKA 2EAOA 3HILA 3K1RB 1UCVA 1B4FA 1WWVA 1X40A 4NL9A 5JRTA 2ES6A 1PK3A 5JU5A 4MHVA 3BS5B 5JTIA 4RQNA 2Y9UA 2K4PA 2KE7A 2KG5A 2QKQA 1WWUA 1SGGA 2EAPA 1B0XA 3H8MA 4NL9C 1SXDA 2DL0A 4PZOA 2B6GA 3IDWA 1Z1VA 5J8YA 1LKYB 1SV0C 1LKYA 3TADA 2KIVA 4IS7A 5F3XB 2QB1A 3KKAA 1V38A 1DXSA 5J8YC 1RG6A 3BS7A 2QARB 2E8OA 4NJ8A 2KMDA 2QARA 1PK1A 2F3NA 3BQ7A 2GLEA 2EANA 2D3DA 3TACB 2E8MA 2EAMA 2LMRA 5L1MA 2ESEA 1OXJA 2KSOA 2E8NA 2LPEA 2JV3A 2KSOB 2QB0A 4PZNA 2K60A 3TADC 3KKAC 2E8PA 1PK1B 1SXEA 1V85A 2FE9A
chains in the Genus database with same CATH superfamily
3BJYA 1F5SA 1SV0A 3B0YA 1D9DA 1EXNA 4C7ZA 1RXWA 2H5XA 4P2HA 2ZJAA 4FBTA 1A0PA 5KNIA 4ELVA 2VKQA 3KZIU 1KW4A 4TQSA 1MA7A 4K4HA 2FDRA 2DKXA 2BCUA 1Z4NA 3CW2C 3HILA 2HOFA 1U9LA 4QJFB 2I1QA 1Q8KA 3NS1A 5HR6A 2FMQA 1N56A 4Z6CA 4JV1A 2KE7A 4UB2A 3T3FA 1SGGA 4F92B 5DBCA 4P0PA 3EUB2 8ICSA 1SXDA 3KHRA 2BQRA 2HSZA 1NK5A 2W9MA 2PFQA 3PW7A 1HIWA 3QUCA 4PGQA 5CEHA 2EZXA 4UBCA 1V38A 2OXOA 1JXLA 2EQYA 5AI9A 3HX0A 3NUQA 4DS4A 7ICEA 2LM1A 5K4LA 5AKYA 4FS1A 1ZRMA 2ZIXA 2EANA 4DQSA 4M9HA 4O3NA 2DF4B 5IIOA 1TK0A 2NRTA 3N7RC 1K1SA 2CRXA 4YG2A 3RR8A 1KLNA 5AK4A 5J2KA 5AM1A 3UXOA 4F4KA 3QEAZ 4Y2RA 2QLTA 3BQ0A 3QUQA 2WTFA 3RBEA 3SENA 4KITB 3PV8A 5KFQA 1WCNA 5DKWA 1NK0A 3H8JA 3ISCA 1X6JA 4F5NA 1Z00B 2LM4A 3RAXA 3ISDA 4JWMA 5KFYA 3IP4B 3RH5A 4UB6U 3C2KA 1ZYQA 5ALKA 8ICLA 4ECTA 5H2FU 3FDSA 4RUAA 4DQIA 3CYMA 2B0CA 2C2DA 2ES6A 4NLKA 1JMSA 5BOMA 3SAGA 2MRLA 1S0OA 2AGOA 4RQNA 2O6KA 1NZPA 1ZQZA 4RQ0A 1L7PA 3OPXA 3TARA 1D8YA 3OTQA 2UVRA 3PW2A 5J2FA 3I1YA 2R8KA 1RDFA 5AIAA 2RDIA 2ISPA 3WK5A 5J8YA 1L3UA 4M9LA 4XA5A 4RUCA 1SV0C 5J2CA 1F44A 3EZ5A 2ASLA 4OJLA 5KG7A 1NJWA 4O3QA 1DXSA 5DB7A 3IN5A 5ALUA 2KVSA 5J2JA 3RB3A 4Z6EA 3MGHA 3SQIA 2WHEA 4U6PA 1ED1A 4RQ8A 3MDAA 4YVZA 2GH1A 5KAIU 1SKSA 4KTQA 4P0QB 7ICJA 3KTQA 4IQUA 3O0FA 4J9MA 7ICOA 2EZYA 3OHAA 2KSOB 5KG4A 2KN7A 4DSFA 2E5SA 1TK8A 4IC9A 5AM0A 2J6TA 1BPYA 5JUMA 4PHAA 5AKIA 2BCSA 1ZQWA 5DB8A 4JV2A 1ZD3A 2RQ5A 3V7JA 1PVQA 2I5HA 1N2XA 4AP9A 3RJJA 2HHXA 4PH5A 1FEZA 3D2NA 2WB1C 2IHMA 2A1JA 5KFKA 3NVYA 1L3VA 1KQQA 3Q8LA 4MFCA 1Z19A 1K1QA 3QUTA 5TZVA 1S0VA 1IIPA 4B9TA 1YT3A 3UXPA 3QU9A 1Q3VA 1L7MA 4F71A 4RQ5A 5DB9A 1N5WA 9ICEA 2P6UA 4WJ3B 2V4QA 5ALVA 1VLBA 2VANA 1ZQMA 1IXRA 2NV3A 5ALQA 1NKEA 2ZJ8A 4P0QA 7ICNA 4RPZA 3H40A 2BR0A 1N63A 1SIJA 1LB2B 1CRXA 9ICFA 2K8CB 5ALGA 4XUSA 5HMMA 2LKYA 2KIVA 1ZQNA 3TFSA 3RF9A 3V7KA 5FP0A 3RB0A 1BVSA 4EX7A 4QZGA 3B9JA 3JPTA 4UARA 4DLEA 3G6XA 1L7OA 4NLCA 3PR5B 1T94A 2OH2A 9ICJA 2LHTA 5KT2A 4J9QA 8ICQA 4ECUA 2ZUCA 5DQIA 1T7PA 3JPRA 5DQGA 4DWIA 4IQVA 1ZQIA 1DK3A 1X6IA 3NRWA 3ZI4A 1HUOA 4C4SA 5J0YA 4CCHA 4RNNA 2VA8A 4O3PA 4RNOA 4EELA 4J9PA 4PL1A 5KG3A 1V85A 2IOHA 5D49A 4ED1A 4I2AA 1B43A 4Z6FA 2K8BB 4TQRA 4DL6A 4LJXA 3Q8PB 2BKEA 5G5HA 4QWCA 3UXNA 2AQ4A 4FE3A 8ICPA 3ZDBA 4OJOA 2AJQA 4C8OA 4DF8A 4B9NA 1X2IA 2VIXA 4P4OA 5HP4A 4I29A 4KLEA 2EAOA 1QH9A 2XO7A 1C7YA 5IIKA 4JV0A 5KFNA 8ICFA 4IRCA 2BQ3A 5JTIA 4DOCA 3QU7A 1NK7A 3F2BA 4P4PA 2W3SA 4QZIA 3WK7A 2ISOA 4NV0A 4PZOA 4QWDA 1ZJMA 5J0TA 4ICAA 3RJKA 2KJ8A 4I2DA 1ZQCA 3LVVA 4R63A 2J6UA 4KX3A 4UB5A 2JZBB 4F4XA 3WKAA 2RLTA 1V9PA 5KT3A 5J8YC 3IG5A 5J29A 3MR5A 3JPNA 3PMLA 4TUPA 2VA2A 4I28A 1S77D 3KHGA 2NYVA 5KG2A 1RYRA 1NZBA 4DO9A 5KG5A 3G6VA 5BPCA 1OXJA 2E8NA 3WK9A 3LWLA 4DEZA 4KX5A 2PMZC 4F2SA 4NXZA 1TKDA 5ALZA 3F53A 2FPMA 4UQGA 5KFXA 5ALLA 5DB6A 2K4EA 4B9UA 3HRDD 3BZCA 2YTUA 4DSKA 2W03A 1KSPA 2Q0ZX 4C4RA 4QW8A 2YY6A 2HHUA 1ZD4A 4ECXA 2KKPA 1ZRNA 2ATLA 2HHWA 3AL0B 3QNMA 5BOLA 3GV5B 1Z00A 2PFOA 3T5KA 5AM2A 3RH6A 4QZBA 2YQEA 3HKZC 4M9NA 1M6YA 3BS5B 3EPIA 5KG6A 2PFPA 2DUYA 2MUTB 5KFZA 3PW0A 1TK5A 4EZ9A 3ORYA 1KFSA 3MR3A 1WWUA 2XGQA 1KN5A 5AK5A 1SWVA 5AM5A 5F9LA 4EENA 2OYYA 2DL0A 3RJGA 3IDWA 2HOIA 4EEKA 4R8UB 4C8MA 1NK8A 3N7PD 5EWEA 4KLLA 1ZQGA 3TADA 2HVHA 2PI4A 3G6YA 3RJIA 3H4BA 3PO4A 1S10A 2QB1A 4UAUA 9ICMA 2JXJA 4F93B 5KFUA 4OD0A 3Q8MA 5ALMA 2XY6A 4QIWC 3C21A 5DG9A 2BPFA 1TAUA 9ICRA 4UASA 4AYBF 5EWGA 2JHDA 3PW4A 2ESEA 3ZD8A 4CF3A 4YR2A 4QZ8A 2LPEA 2YB1A 2ASJA 1QSYA 3J81j 1WYGA 4BX9C 5KFBA 3D6JA 5J0XA 3PO5A 5L1KA 2UVWA 4ED0A 5J0QA 4MFAA 4QZFA 3ETRA 8ICXA 4RT2A 2IMWP 3M9OB 5EE1A 3QYPA 2EDUA 3SMVA 3PSIA 1F0MA 4B9SA 1XO1A 3FAHA 1CI4A 2Y9TA 3NASA 1O03A 1BPDA 4X5VA 3KD3A 8ICUA 4M9GA 1KBUA 3WKBA 1KEJA 2W3RA 3I28A 2IA6A 2G5HB 3V6KA 2XI9A 7ICKA 3MBYA 2H3ZA 2RRDA 3C2MA 3AN1A 2NRXA 3PNCA 3QZ7A 4GXIA 1PVPA 2FJ6A 5ALEA 3GZFA 3H8MA 2HDOA 1X9MA 2AH5A 5KFDA 2VJ4A 3ZDCA 5AI6A 5J2HA 1DOQA 1A6SA 4TUSA 4IQWA 4OCZA 5AICA 1P7DA 1X42A 3RFAA 1LV5A 3AMZA 3Q8SB 1C20A 2RHFA 3D2SA 4K4GA 4I2JA 1BPBA 5AIBA 5IIIA 1NJXA 5J2IA 2WF9A 1U49A 1IG6A 4YQWA 2QARB 4ECZA 2E3TA 4Y2SA 3CRXA 8ICHA 2LYBA 1X9WA 2GLEA 3MFIA 2BZFA 5AKEA 4DL5A 3TACB 2R8JA 4GXKA 4DQRA 5L1MA 1L3SA 4FZMA 1RXVA 3ZD9A 5L1IA 1RQLA 1AQ6A 1ZQDA 2DPJA 4J9KA 3M6KA 1QLNA 5A0LA 4MEXA 4O5CA 4EX6A 1U45A 2RP5A 4QZ9A 4KMOB 1S76D 4BJQA 2KNJA 3SV4A 2AXTU 4Q8EA 1KFTA 2D8CA 1HJPA 2W8LA 3SEIA 4DOBA 2PI5A 4J9OA 4JWNA 2NO5A 1ZQQA 5AKGA 2QB0B 4MFFA 2IBKA 4YMOA 1OW5A 8ICTA 4O3MA 4RQ4A 4IR9A 5TISU 2HW3A 1UCVA 2FPKA 3UQ2A 2BCRA 3T5LA 1S0NA 8ICIA 4FS2A 2G06A 1S97A 4BUGA 1J2NA 1FFVA 1XSNA 5ALNA 3THVA 3V6HA 1ZQ1C 2EAPA 3T79A 1L3TA 8ICKA 5ALIA 3E0FA 4ECYA 3ETLA 3M9MB 2HVIA 4UAVA 2JGAA 2F1HA 2HMXA 2PKEA 5EE0A 1MSWD 2Y0SC 1K5OA 1JUDA 2KVCA 4M47A 4Z6DA 1CEZA 4M2YA 4IL6U 3N7SC 2R8GA 2HCFA 8ICAA 2W9BA 3OJSA 2JEJA 8ICOA 2JH7A 5AKXA 1UA1A 4NLNA 2W11A 9ICPA 2AHOB 4EYHB 4J9NA 5KAFU 4NLGA 2RDJA 5ALXA 1TFRA 3A0HU 5KL8B 4RQ6A 5AKKA 2DFLA 5J0OA 1JRPA 2WF7A 3LK9A 3NTUA 5ALFA 3RJFA 7ICQA 2OWOA 1A76A 2K8AA 4CF5A 2BHNA 3M1YA 4KLOA 4Y2UA 2HBKA 2K4IA 3K75D 2Q4TA 2YMPA 2W7OA 8ICCA 4ACOA 9ICWA 3RB6A 4PJ0U 1QTMA 1JALA 3C28A 4F8RA 3OJUA 4ECQA 3HPOA 5DDMA 5C0YA 1X9SA 1UQVA 4F5PA 3H0RB 4F4WA 7ICUA 4RQ1A 4BDPA 2LYAA 2MU2A 3KZXA 7ICSA 1COOA 1LVHA 1S8OA 9ICVA 2K4PA 3HJEA 3L3FX 4KLGA 3BQ2A 3IM1A 3PZPA 4M04A 2YMLA 5KG0A 1SWWA 4GLXA 4Y2PA 5DLGA 1LKYB 2KHVA 1NJYA 3OHBA 5KFAA 2R8HA 2HHVA 2UVUA 4NLBA 2J6SA 1SKRA 3SV3A 4C8KA 4Y2JA 3K1ZA 4I27A 4PHDA 2NRZA 3PY8A 4EBDA 2NRVA 3UM9A 1N48A 4NJ8A 3M8RA 3ZDEA 4RQ7A 2G0AA 3RBDA 4DSLA 3WKEA 3CP8A 4J9RA 5DGBA 2CPRA 5E79U 2JEFA 4DFKA 2WF5A 4F5QA 2ZTDA 5CHGA 2KOBA 1PK1B 2ZG6A 3H7IA 3QU2A 1RYUA 1ZQJA 3KFUF 5AI0A 2ZIUB 4CDGA 5HHHA 1HUZA 1NK6A 3HT3A 1MN8A 3L5KA 3OSPA 2OM6A 1X66A 4NLZA 1WG8A 2R18A 4YFKA 2W9BB 1SB3C 4JMUA 1L7NA 4QZAA 4KLQA 4QW9A 4Q44A 2WF6A 2V9WA 1ZQKA 3MABA 4DSJA 3C2LA 2ZTCA 1UT5A 4EBEA 3DV9A 1CUKA 2H3IA 4QIWF 4Y2YA 2KEYA 4USAA 2ZJ5A 4O3RA 5KFWA 3RB4A 2DWQA 4NWIA 1H38A 2FLNA 4I2BA 3E2EA 1ZOLA 3HP6A 3LYSA 5ALJA 4IR1A 2IOFA 4KLDA 3ED5A 3GQCA 2XY5A 5CA7A 5B5EU 5DBAA 1FO4A 3KHHA 9ICTA 1RPLA 4DLGA 3SAFA 3AU2A 1TV9A 1KFDA 4UB8U 1U47A 2E8OA 3ZDDA 1ZD2P 4M0AA 1KKXA 3Q8QB 2YN4A 1UA0A 4YN4A 5KFEA 4KLIA 3OGUA 2F8LA 2W9AA 5KT4A 7ICIA 3GV7B 8ICWA 4BXOA 5DQHA 4KLHA 5DLFA 2K60A 1ZETA 3MFHA 4PL2A 4ZOHC 3MC1A 2P6RA 2ZIUA 8ICYA 1BPEA 1ZQOA 8ICRA 3IG8A 9ICCA 3KBBA 2FE9A 5ALPA 2Z7JA 3UMBA 3IV6A 5GTIU 3PR4A 2UVVA 1Q46A 3BS5A 4QZCA 2BPCA 2KK0A 1DRGA 3M8SA 5KFMA 5J0PA 5DG8A 9ICUA 5GTHU 1S0MA 1ZQTA 4I2HA 4O9MA 5AI5A 4F91B 5KFCA 1S5LU 1ZJNA 2G08A 1T8EA 3SD7A 5CJ7A 7ICPA 4YR0A 3AQFA 1B4FA 3WKCA 4UW9A 2AGPA 3LWMA 3UMGA 2KG5A 2W8KA 5AKJA 3C5FA 4Y2XA 2VJ5A 3PSPA 3HW8A 4YR3A 5AKZA 2GWSA 1SZPA 3FC4A 2IOFK 3GIIA 4RNMA 1XC9A 5AKHA 3RJHA 3PSFA 4DL7A 2F77X 1JIHA 3C5GA 3TQ1A 4BGDA 4Q43A 1IM4A 2P35A 1ZQXA 5KFRA 1VJ5A 1YZ7A 1MC8A 4NY8A 4XRHA 3ZDAA 4F72A 2W43A 2F2AB 1NOMA 1PZNA 2KSOA 4R65A 3BZKA 2ZIWA 3DEEA 2KZMA 1NK9A 5ALRA 4DFDA 2KKVA 9ICGA 1RQNA 3UMCA 2ZUBA 1JX4A 1ZQLA 4OJPA 2ZTEA 5B66U 3SYZA 4KN7A 1UPHA 5KFJA 3AQEA 3TFRA 1V97A 4PGYA 3PX6A 5KFGA 2AQ0A 2Y1IA 1Q3UA 2PMZF 3H4DA 5ALSA 4ELTA 5KG1A 5KFHA 2H3QA 2F8KA 2YMMA 1J97A 4PHEA 5AM3A 3MGVA 2I6XA 3GV8B 4CRXA 5CP2A 2JZBA 3TKAA 5KT7A 4JB3A 2CN1A 2KZZA 7ICTA 2KIWA 4XQ8A 2W04A 5J2AA 3MR6A 4PPXA 1B22A 4EBCA 3FM9A 4AYBC 4F4YA 4Q45A 3JPOA 5DBBA 3M7DA 3DDHA 2XICA 1GO3F 2Y1JA 5L9XA 1Z1VA 2G5IB 4YCXA 3TI0A 1DGJA 2JH1A 4QWAA 2JEIA 4EZ6A 4C4TA 2HBLA 1UT8A 4KLJA 4FZLA 4ELUA 2GO7A 3KKAA 4O5KA 3S6JA 4O5EA 2FPLA 1BPZA 9ICLA 2BPGA 2KHQA 2N1RA 1JXEA 5D46A 1O08A 2KZ3A 3BQ7A 3RTVA 4MEYA 2KTQA 2D3DA 2XVTA 3A0BU 1T4GA 3GIKA 2GOLA 1NJZA 4DF4A 1KDHA 2YB4A 4ED6A 3QX7A 5AHXA 2QB0A 1PVRA 3BDPA 1XNSA 2FMPA 3KKAC 5KFIA 3QUBA 1RZTA 3LVWA 5EOZA 4B6JA 4F2RA 2AGQA 3TAQA 1ZXIA 2L5YA 4YD1A 1JI7A 2PXIA 2JMGA 2DKZA 1HEKA 2B21A 3NRZA 2C28A 2FMSA 5L1JA 4RQ3A 1TAQA 3KOOA 4G3IA 3RAQA 3V6JA 4NM1A 1QQ5A 4YMNA 5J2BA 4RT3A 2FI1A 4LZDA 2LYHA 1X40A 2OEHA 5L1LA 3GDXA 4DQPA 3F5AA 3Q8KA 5AK3A 2ZXIA 1QQ6A 3QU4A 2ODGA 4B9MA 4QNLA 4F3OA 2QKQA 4PHPA 2G07A 1N5XA 4MF2A 1MQ3A 5EE3A 2ZIXB 3IHQB 2LBOA 1RYSA 4DFPA 3JPPA 3Q8RB 1ZQBA 5J0UA 3C23A 1TVAA 3OSNA 2C22A 2V4RA 3AM9A 1LKYA 4DFMA 5CRXA 2FLPA 3L4PA 5F3XB 4RU9A 4UB3A 3NGDA 1XU4A 7ICHA 5KFOA 4ED2A 4C7YA 4QZEA 2ZIVB 1XO0A 2MA1A 2WB1F 4C0ZA 4IRDA 2HI0A 3RRGA 4P0PB 2YMQA 5HNKA 3KHLA 4GXJA 4E0DA 5HMLA 2F1IA 3RRHA 4JK1A 1FIQA 1OUQA 5DG7A 4HYKA 4QWEA 3WK8A 2NRWA 2BCVA 2HBJA 2E8PA 3F2DA 4DSIA 2HHSA 4EYIB 3AU6A 1RM6C 4ECWA 4YD2A 4NM2A 1Z1BA 9ICIA 4DL3A 4KLSA 9ICAA 5CWRA 5KFSA 4G9BA 2ZUDA 2XCAA 9ICHA 4LZGA 4OO1J 1N60A 2E1EA 8ICNA 3B0XA 1QSLA 2ZXHA 3SI8A 1X9XA 2H3FA 1SZHA 2HHQA 3AEVA 2KJ5A 4J9LA 5JRTA 5ALOA 3EYZA 4F5RA 4HAIA 4KLMA 4MHVA 4ECVA 5KFVA 1WUDA 1D8LA 9ICOA 2Y9UA 1BNPA 4DCCA 4I2EA 4C80A 2W9CA 4Y2TA 1ZQRA 3UQ0A 2KD1A 4M6WB 2A1AA 4R8UA 2JEGA 4US9A 2BCQA 4C8NA 4OJ5A 2W55A 4GFJA 5ALTA 4YXMA 5CB1A 1ZQAA 4GIBA 5J2EA 1T3QA 2WF8A 3JPQA 3PVXA 1S9FA 7ICMA 9ICNA 4P4MA 1RG6A 4J9SA 1XS9D 2ASDA 3H8SA 2I9GA 4PGXA 2DGZA 2P66A 4YP3A 5CR0A 1VDVA 3F5EA 7ICLA 5IIJA 3FYHA 4F50A 2E8MA 2A1JB 8ICEA 2LMRA 4ZH4A 4DS5A 4CE6A 5AI8A 1QQ7A 3T5JA 2JRZA 1T3NA 4TURA 1NI3A 4US8A 3PSTA 1PUZA 3ALRA 3MDCA 2K89A 3QE9Y 3QEBZ 3WU2U 3NVWA 2KJ9A 3EWAA 1WCLA 1SXEA 3IRUA 3LDAA 2W7PA 3K4GA 5DGAA 5AKLA 3JPSA 1Z3EB 2EH9A 1NK4A 4O3SA 3C1ZA 4KMUA 4CF4A 2XGPA 4QZHA 1L6NA 2BDUA 2BDPA 3BQTA 2JR5A 1L8LA 2H3VA 5J2GA 1PK3A 4M6WA 3E58A 4O3OA 3ICXA 4I2GA 3SZ2A 1ZQPA 3N4MB 7ICVA 5J0SA 7ICGA 2LI6A 3T5HA 5KFFA 1ZQFA 5ALYA 1B0XA 3RH4A 5KTQA 5ALWA 3SAHA 4R66A 1JROA 3MR2A 3QU5A 2MAXA 1L8OA 2XIDA 5J0WA 2CXYA 5IINA 3EPGA 2YX8A 1NKCA 4IS7A 3ONNA 4I2IA 2KP7A 4UB4A 5KFLA 5EE9A 2DBYA 1ZQEA 2M0NA 4FZNA 4Y2VA 4FBUA 3QZ8A 4I2CA 1AROP 2QARA 1PK1A 4BWMA 8ICBA 1SL0A 2KFNA 5ALHA 3C29A 1ECWA 8ICMA 4BWJA 3UPQA 5C5JA 2W54A 4JUZA 2XCPA 2R8IA 1BNOA 1ZD5A 3PX0A 3CNHA 3WK6A 4A8EA 3GIMA 2ZIWB 4Q8FA 1ZQVA 3TADC 4RPYA 9ICSA 4YMMA 4UAWA 4IRKA 2OCEA 4KN4A 4RQMA 5KFPA 4B9VA 4M9JA 1L5UA 4U7CA 2C2RA 1U48A 2HBMA 3HKZF 8ICVA 1J2MA 4K4IA 1KRPA 8ICZA 2VA3A 4O0IA 1BGXT 2W9CB 1JN3A 3WK4A 4UBBA 3M9NB 5D4BA 2WFAA 3H8WA 4FFDA 4UB1A 4C8LA 2WAQC 1IV8A 5AI4A 3M6ZA 1WWVA 5JU5A 1SKWA 5G5GA 9ICKA 3VC8A 3H0LB 4MF8A 4RQ2A 4KLFA 1URJA 1TAMA 4UATA 4UAZA 2F1JA 2K4HA 4QWBA 2WAQF 3TAPA 2HOQA 4DOAA 1ZQYA 4ED3A 4I2FA 2NO4A 4IQTA 2BGWA 4ED8A 3TANA 3V72A 9ICBA 4ECSA 5AK6A 4R64A 3WKDA 2KV2A 2KICA 2DQNB 1DK2A 5KFTA 2C2EA 4B9LA 1UHUA 5HR7A 4DL2A 4F5OA 1BPXA 3GU3A 4DFJA 2EZZA 3N28A 4GC7A 7ICFA 2ALZA 3HWTA 3MGIA 4RZRA 1D9FA 2EAMA 5KT5A 2A19A 1A77A 2JV3A 3SR6A 2PFNA 2DPIA 3R9KA 2FLLA 4PZNA 2G09A 1XWLA 1D8BA 3F2CA 2XC9A 5DDYA 2HHTA 3U26A 3C1YA 1SL1A 1FFUA 4OJ6A 3D2QA 2ZIVA 1YZ6A 9ICXA 4FO6A 2F44A 5IIMA 4ECRA 1ZQSA 4GC6A 1ZQUA 1TE2A 1ZQHA 4EEYA 4UAYA 1SV4A 1U4BA 2Y0SF 2F76X 1COKA 4KLTA 3K1RB 2D6FC 4DSEA 4NL9A 1XSLA 4ED7A 5KL1B 8ICJA 2A3VA 4DL4A 4QZDA 3VCBA 1N61A 3RJEA 1Y88A 3ISBA 5HHIA 4LVSA 4YXJA 4NL9C 2B6GA 2IHNA 2OHFA 4CNQA 1NKBA 4BXOB 3I76A 3GIJA 8ICGA 3NVZA 5F9NA 3NVVA 4J03A 5ALDA 5J0RA 1DGSA 4KLUA 2XY7A 2BQUA 5IILA 2MUTA 5KT6A 5AM4A 3AUOA 3BS7A 3BQ1A 3EW9A 3GILA 5EWFA 1N62A 2AU0A 2KMDA 2MSNA 2F3NA 1SL2A 3V7LA 4F4ZA 3PW5A 2E1FA 1QSSA 2KFZA 1QCKA 1KL9A 3N97B 4RPXA 1MQ2A 1NNLA 4TUQA 3H0MB 4CGZA 9ICQA 1KTQA 3QXGA 3PMNA 3GFKB 5T14A 5J2DA 7ICRA 4DQQA 3PX4A 1Z4OA 3RR7A 4Y2QA 2M9NA 1XSPA
chains in the Genus database with same CATH topology
1SV0A 2L5YA 4RQMA 3BS5A 3SENA 1JI7A 2D8CA 1F0MA 2DKZA 5KNIA 2F44A 3SEIA 2YTUA 1X66A 2Y9TA 1KW4A 2QB0B 2F8KA 2DKXA 1SV4A 1X9XA 1UQVA 1OW5A 1COKA 2EAOA 3HILA 3K1RB 1UCVA 1B4FA 1WWVA 1X40A 4NL9A 5JRTA 2ES6A 1PK3A 5JU5A 4MHVA 3BS5B 5JTIA 4RQNA 2Y9UA 2K4PA 2KE7A 2KG5A 2QKQA 1WWUA 1SGGA 2EAPA 1B0XA 3H8MA 4NL9C 1SXDA 2DL0A 4PZOA 2B6GA 3IDWA 1Z1VA 5J8YA 1LKYB 1SV0C 1LKYA 3TADA 2KIVA 4IS7A 5F3XB 2QB1A 3KKAA 1V38A 1DXSA 5J8YC 1RG6A 3BS7A 2QARB 2E8OA 4NJ8A 2KMDA 2QARA 1PK1A 2F3NA 3BQ7A 2GLEA 2EANA 2D3DA 3TACB 2E8MA 2EAMA 2LMRA 5L1MA 2ESEA 1OXJA 2KSOA 2E8NA 2LPEA 2JV3A 2KSOB 2QB0A 4PZNA 2K60A 3TADC 3KKAC 2E8PA 1PK1B 1SXEA 1V85A 2FE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 A;  2L5Y A;  4RQM A;  3BS5 A;  3SEN A;  1JI7 A;  2D8C A;  1F0M A;  2DKZ A;  5KNI A;  2F44 A;  3SEI A;  2YTU A;  1X66 A;  2Y9T A;  1KW4 A;  2QB0 B;  2F8K A;  2DKX A;  1SV4 A;  1X9X A;  1UQV A;  1OW5 A;  1COK A;  2EAO A;  3HIL A;  3K1R B;  1UCV A;  1B4F A;  1WWV A;  1X40 A;  4NL9 A;  5JRT A;  2ES6 A;  1PK3 A;  5JU5 A;  4MHV A;  3BS5 B;  5JTI A;  4RQN A;  2Y9U A;  2K4P A;  2KE7 A;  2KG5 A;  2QKQ A;  1WWU A;  1SGG A;  2EAP A;  1B0X A;  3H8M A;  4NL9 C;  1SXD A;  2DL0 A;  4PZO A;  2B6G A;  3IDW A;  1Z1V A;  5J8Y A;  1LKY B;  1SV0 C;  1LKY A;  3TAD A;  2KIV A;  4IS7 A;  5F3X B;  2QB1 A;  3KKA A;  1V38 A;  1DXS A;  5J8Y C;  1RG6 A;  3BS7 A;  2QAR B;  2E8O A;  4NJ8 A;  2KMD A;  2QAR A;  1PK1 A;  2F3N A;  3BQ7 A;  2GLE A;  2EAN A;  2D3D A;  3TAC B;  2E8M A;  2EAM A;  2LMR A;  5L1M A;  2ESE A;  1OXJ A;  2KSO A;  2E8N A;  2LPE A;  2JV3 A;  2KSO B;  2QB0 A;  4PZN A;  2K60 A;  3TAD C;  3KKA C;  2E8P A;  1PK1 B;  1SXE A;  1V85 A;  2FE9 A; 
#chains in the Genus database with same CATH topology
 3BJY A;  1F5S A;  1SV0 A;  3B0Y A;  1D9D A;  1EXN A;  4C7Z A;  1RXW A;  2H5X A;  4P2H A;  2ZJA A;  4FBT A;  1A0P A;  5KNI A;  4ELV A;  2VKQ A;  3KZI U;  1KW4 A;  4TQS A;  1MA7 A;  4K4H A;  2FDR A;  2DKX A;  2BCU A;  1Z4N A;  3CW2 C;  3HIL A;  2HOF A;  1U9L A;  4QJF B;  2I1Q A;  1Q8K A;  3NS1 A;  5HR6 A;  2FMQ A;  1N56 A;  4Z6C A;  4JV1 A;  2KE7 A;  4UB2 A;  3T3F A;  1SGG A;  4F92 B;  5DBC A;  4P0P A;  3EUB 2;  8ICS A;  1SXD A;  3KHR A;  2BQR A;  2HSZ A;  1NK5 A;  2W9M A;  2PFQ A;  3PW7 A;  1HIW A;  3QUC A;  4PGQ A;  5CEH A;  2EZX A;  4UBC A;  1V38 A;  2OXO A;  1JXL A;  2EQY A;  5AI9 A;  3HX0 A;  3NUQ A;  4DS4 A;  7ICE A;  2LM1 A;  5K4L A;  5AKY A;  4FS1 A;  1ZRM A;  2ZIX A;  2EAN A;  4DQS A;  4M9H A;  4O3N A;  2DF4 B;  5IIO A;  1TK0 A;  2NRT A;  3N7R C;  1K1S A;  2CRX A;  4YG2 A;  3RR8 A;  1KLN A;  5AK4 A;  5J2K A;  5AM1 A;  3UXO A;  4F4K A;  3QEA Z;  4Y2R A;  2QLT A;  3BQ0 A;  3QUQ A;  2WTF A;  3RBE A;  3SEN A;  4KIT B;  3PV8 A;  5KFQ A;  1WCN A;  5DKW A;  1NK0 A;  3H8J A;  3ISC A;  1X6J A;  4F5N A;  1Z00 B;  2LM4 A;  3RAX A;  3ISD A;  4JWM A;  5KFY A;  3IP4 B;  3RH5 A;  4UB6 U;  3C2K A;  1ZYQ A;  5ALK A;  8ICL A;  4ECT A;  5H2F U;  3FDS A;  4RUA A;  4DQI A;  3CYM A;  2B0C A;  2C2D A;  2ES6 A;  4NLK A;  1JMS A;  5BOM A;  3SAG A;  2MRL A;  1S0O A;  2AGO A;  4RQN A;  2O6K A;  1NZP A;  1ZQZ A;  4RQ0 A;  1L7P A;  3OPX A;  3TAR A;  1D8Y A;  3OTQ A;  2UVR A;  3PW2 A;  5J2F A;  3I1Y A;  2R8K A;  1RDF A;  5AIA A;  2RDI A;  2ISP A;  3WK5 A;  5J8Y A;  1L3U A;  4M9L A;  4XA5 A;  4RUC A;  1SV0 C;  5J2C A;  1F44 A;  3EZ5 A;  2ASL A;  4OJL A;  5KG7 A;  1NJW A;  4O3Q A;  1DXS A;  5DB7 A;  3IN5 A;  5ALU A;  2KVS A;  5J2J A;  3RB3 A;  4Z6E A;  3MGH A;  3SQI A;  2WHE A;  4U6P A;  1ED1 A;  4RQ8 A;  3MDA A;  4YVZ A;  2GH1 A;  5KAI U;  1SKS A;  4KTQ A;  4P0Q B;  7ICJ A;  3KTQ A;  4IQU A;  3O0F A;  4J9M A;  7ICO A;  2EZY A;  3OHA A;  2KSO B;  5KG4 A;  2KN7 A;  4DSF A;  2E5S A;  1TK8 A;  4IC9 A;  5AM0 A;  2J6T A;  1BPY A;  5JUM A;  4PHA A;  5AKI A;  2BCS A;  1ZQW A;  5DB8 A;  4JV2 A;  1ZD3 A;  2RQ5 A;  3V7J A;  1PVQ A;  2I5H A;  1N2X A;  4AP9 A;  3RJJ A;  2HHX A;  4PH5 A;  1FEZ A;  3D2N A;  2WB1 C;  2IHM A;  2A1J A;  5KFK A;  3NVY A;  1L3V A;  1KQQ A;  3Q8L A;  4MFC A;  1Z19 A;  1K1Q A;  3QUT A;  5TZV A;  1S0V A;  1IIP A;  4B9T A;  1YT3 A;  3UXP A;  3QU9 A;  1Q3V A;  1L7M A;  4F71 A;  4RQ5 A;  5DB9 A;  1N5W A;  9ICE A;  2P6U A;  4WJ3 B;  2V4Q A;  5ALV A;  1VLB A;  2VAN A;  1ZQM A;  1IXR A;  2NV3 A;  5ALQ A;  1NKE A;  2ZJ8 A;  4P0Q A;  7ICN A;  4RPZ A;  3H40 A;  2BR0 A;  1N63 A;  1SIJ A;  1LB2 B;  1CRX A;  9ICF A;  2K8C B;  5ALG A;  4XUS A;  5HMM A;  2LKY A;  2KIV A;  1ZQN A;  3TFS A;  3RF9 A;  3V7K A;  5FP0 A;  3RB0 A;  1BVS A;  4EX7 A;  4QZG A;  3B9J A;  3JPT A;  4UAR A;  4DLE A;  3G6X A;  1L7O A;  4NLC A;  3PR5 B;  1T94 A;  2OH2 A;  9ICJ A;  2LHT A;  5KT2 A;  4J9Q A;  8ICQ A;  4ECU A;  2ZUC A;  5DQI A;  1T7P A;  3JPR A;  5DQG A;  4DWI A;  4IQV A;  1ZQI A;  1DK3 A;  1X6I A;  3NRW A;  3ZI4 A;  1HUO A;  4C4S A;  5J0Y A;  4CCH A;  4RNN A;  2VA8 A;  4O3P A;  4RNO A;  4EEL A;  4J9P A;  4PL1 A;  5KG3 A;  1V85 A;  2IOH A;  5D49 A;  4ED1 A;  4I2A A;  1B43 A;  4Z6F A;  2K8B B;  4TQR A;  4DL6 A;  4LJX A;  3Q8P B;  2BKE A;  5G5H A;  4QWC A;  3UXN A;  2AQ4 A;  4FE3 A;  8ICP A;  3ZDB A;  4OJO A;  2AJQ A;  4C8O A;  4DF8 A;  4B9N A;  1X2I A;  2VIX A;  4P4O A;  5HP4 A;  4I29 A;  4KLE A;  2EAO A;  1QH9 A;  2XO7 A;  1C7Y A;  5IIK A;  4JV0 A;  5KFN A;  8ICF A;  4IRC A;  2BQ3 A;  5JTI A;  4DOC A;  3QU7 A;  1NK7 A;  3F2B A;  4P4P A;  2W3S A;  4QZI A;  3WK7 A;  2ISO A;  4NV0 A;  4PZO A;  4QWD A;  1ZJM A;  5J0T A;  4ICA A;  3RJK A;  2KJ8 A;  4I2D A;  1ZQC A;  3LVV A;  4R63 A;  2J6U A;  4KX3 A;  4UB5 A;  2JZB B;  4F4X A;  3WKA A;  2RLT A;  1V9P A;  5KT3 A;  5J8Y C;  3IG5 A;  5J29 A;  3MR5 A;  3JPN A;  3PML A;  4TUP A;  2VA2 A;  4I28 A;  1S77 D;  3KHG A;  2NYV A;  5KG2 A;  1RYR A;  1NZB A;  4DO9 A;  5KG5 A;  3G6V A;  5BPC A;  1OXJ A;  2E8N A;  3WK9 A;  3LWL A;  4DEZ A;  4KX5 A;  2PMZ C;  4F2S A;  4NXZ A;  1TKD A;  5ALZ A;  3F53 A;  2FPM A;  4UQG A;  5KFX A;  5ALL A;  5DB6 A;  2K4E A;  4B9U A;  3HRD D;  3BZC A;  2YTU A;  4DSK A;  2W03 A;  1KSP A;  2Q0Z X;  4C4R A;  4QW8 A;  2YY6 A;  2HHU A;  1ZD4 A;  4ECX A;  2KKP A;  1ZRN A;  2ATL A;  2HHW A;  3AL0 B;  3QNM A;  5BOL A;  3GV5 B;  1Z00 A;  2PFO A;  3T5K A;  5AM2 A;  3RH6 A;  4QZB A;  2YQE A;  3HKZ C;  4M9N A;  1M6Y A;  3BS5 B;  3EPI A;  5KG6 A;  2PFP A;  2DUY A;  2MUT B;  5KFZ A;  3PW0 A;  1TK5 A;  4EZ9 A;  3ORY A;  1KFS A;  3MR3 A;  1WWU A;  2XGQ A;  1KN5 A;  5AK5 A;  1SWV A;  5AM5 A;  5F9L A;  4EEN A;  2OYY A;  2DL0 A;  3RJG A;  3IDW A;  2HOI A;  4EEK A;  4R8U B;  4C8M A;  1NK8 A;  3N7P D;  5EWE A;  4KLL A;  1ZQG A;  3TAD A;  2HVH A;  2PI4 A;  3G6Y A;  3RJI A;  3H4B A;  3PO4 A;  1S10 A;  2QB1 A;  4UAU A;  9ICM A;  2JXJ A;  4F93 B;  5KFU A;  4OD0 A;  3Q8M A;  5ALM A;  2XY6 A;  4QIW C;  3C21 A;  5DG9 A;  2BPF A;  1TAU A;  9ICR A;  4UAS A;  4AYB F;  5EWG A;  2JHD A;  3PW4 A;  2ESE A;  3ZD8 A;  4CF3 A;  4YR2 A;  4QZ8 A;  2LPE A;  2YB1 A;  2ASJ A;  1QSY A;  3J81 j;  1WYG A;  4BX9 C;  5KFB A;  3D6J A;  5J0X A;  3PO5 A;  5L1K A;  2UVW A;  4ED0 A;  5J0Q A;  4MFA A;  4QZF A;  3ETR A;  8ICX A;  4RT2 A;  2IMW P;  3M9O B;  5EE1 A;  3QYP A;  2EDU A;  3SMV A;  3PSI A;  1F0M A;  4B9S A;  1XO1 A;  3FAH A;  1CI4 A;  2Y9T A;  3NAS A;  1O03 A;  1BPD A;  4X5V A;  3KD3 A;  8ICU A;  4M9G A;  1KBU A;  3WKB A;  1KEJ A;  2W3R A;  3I28 A;  2IA6 A;  2G5H B;  3V6K A;  2XI9 A;  7ICK A;  3MBY A;  2H3Z A;  2RRD A;  3C2M A;  3AN1 A;  2NRX A;  3PNC A;  3QZ7 A;  4GXI A;  1PVP A;  2FJ6 A;  5ALE A;  3GZF A;  3H8M A;  2HDO A;  1X9M A;  2AH5 A;  5KFD A;  2VJ4 A;  3ZDC A;  5AI6 A;  5J2H A;  1DOQ A;  1A6S A;  4TUS A;  4IQW A;  4OCZ A;  5AIC A;  1P7D A;  1X42 A;  3RFA A;  1LV5 A;  3AMZ A;  3Q8S B;  1C20 A;  2RHF A;  3D2S A;  4K4G A;  4I2J A;  1BPB A;  5AIB A;  5III A;  1NJX A;  5J2I A;  2WF9 A;  1U49 A;  1IG6 A;  4YQW A;  2QAR B;  4ECZ A;  2E3T A;  4Y2S A;  3CRX A;  8ICH A;  2LYB A;  1X9W A;  2GLE A;  3MFI A;  2BZF A;  5AKE A;  4DL5 A;  3TAC B;  2R8J A;  4GXK A;  4DQR A;  5L1M A;  1L3S A;  4FZM A;  1RXV A;  3ZD9 A;  5L1I A;  1RQL A;  1AQ6 A;  1ZQD A;  2DPJ A;  4J9K A;  3M6K A;  1QLN A;  5A0L A;  4MEX A;  4O5C A;  4EX6 A;  1U45 A;  2RP5 A;  4QZ9 A;  4KMO B;  1S76 D;  4BJQ A;  2KNJ A;  3SV4 A;  2AXT U;  4Q8E A;  1KFT A;  2D8C A;  1HJP A;  2W8L A;  3SEI A;  4DOB A;  2PI5 A;  4J9O A;  4JWN A;  2NO5 A;  1ZQQ A;  5AKG A;  2QB0 B;  4MFF A;  2IBK A;  4YMO A;  1OW5 A;  8ICT A;  4O3M A;  4RQ4 A;  4IR9 A;  5TIS U;  2HW3 A;  1UCV A;  2FPK A;  3UQ2 A;  2BCR A;  3T5L A;  1S0N A;  8ICI A;  4FS2 A;  2G06 A;  1S97 A;  4BUG A;  1J2N A;  1FFV A;  1XSN A;  5ALN A;  3THV A;  3V6H A;  1ZQ1 C;  2EAP A;  3T79 A;  1L3T A;  8ICK A;  5ALI A;  3E0F A;  4ECY A;  3ETL A;  3M9M B;  2HVI A;  4UAV A;  2JGA A;  2F1H A;  2HMX A;  2PKE A;  5EE0 A;  1MSW D;  2Y0S C;  1K5O A;  1JUD A;  2KVC A;  4M47 A;  4Z6D A;  1CEZ A;  4M2Y A;  4IL6 U;  3N7S C;  2R8G A;  2HCF A;  8ICA A;  2W9B A;  3OJS A;  2JEJ A;  8ICO A;  2JH7 A;  5AKX A;  1UA1 A;  4NLN A;  2W11 A;  9ICP A;  2AHO B;  4EYH B;  4J9N A;  5KAF U;  4NLG A;  2RDJ A;  5ALX A;  1TFR A;  3A0H U;  5KL8 B;  4RQ6 A;  5AKK A;  2DFL A;  5J0O A;  1JRP A;  2WF7 A;  3LK9 A;  3NTU A;  5ALF A;  3RJF A;  7ICQ A;  2OWO A;  1A76 A;  2K8A A;  4CF5 A;  2BHN A;  3M1Y A;  4KLO A;  4Y2U A;  2HBK A;  2K4I A;  3K75 D;  2Q4T A;  2YMP A;  2W7O A;  8ICC A;  4ACO A;  9ICW A;  3RB6 A;  4PJ0 U;  1QTM A;  1JAL A;  3C28 A;  4F8R A;  3OJU A;  4ECQ A;  3HPO A;  5DDM A;  5C0Y A;  1X9S A;  1UQV A;  4F5P A;  3H0R B;  4F4W A;  7ICU A;  4RQ1 A;  4BDP A;  2LYA A;  2MU2 A;  3KZX A;  7ICS A;  1COO A;  1LVH A;  1S8O A;  9ICV A;  2K4P A;  3HJE A;  3L3F X;  4KLG A;  3BQ2 A;  3IM1 A;  3PZP A;  4M04 A;  2YML A;  5KG0 A;  1SWW A;  4GLX A;  4Y2P A;  5DLG A;  1LKY B;  2KHV A;  1NJY A;  3OHB A;  5KFA A;  2R8H A;  2HHV A;  2UVU A;  4NLB A;  2J6S A;  1SKR A;  3SV3 A;  4C8K A;  4Y2J A;  3K1Z A;  4I27 A;  4PHD A;  2NRZ A;  3PY8 A;  4EBD A;  2NRV A;  3UM9 A;  1N48 A;  4NJ8 A;  3M8R A;  3ZDE A;  4RQ7 A;  2G0A A;  3RBD A;  4DSL A;  3WKE A;  3CP8 A;  4J9R A;  5DGB A;  2CPR A;  5E79 U;  2JEF A;  4DFK A;  2WF5 A;  4F5Q A;  2ZTD A;  5CHG A;  2KOB A;  1PK1 B;  2ZG6 A;  3H7I A;  3QU2 A;  1RYU A;  1ZQJ A;  3KFU F;  5AI0 A;  2ZIU B;  4CDG A;  5HHH A;  1HUZ A;  1NK6 A;  3HT3 A;  1MN8 A;  3L5K A;  3OSP A;  2OM6 A;  1X66 A;  4NLZ A;  1WG8 A;  2R18 A;  4YFK A;  2W9B B;  1SB3 C;  4JMU A;  1L7N A;  4QZA A;  4KLQ A;  4QW9 A;  4Q44 A;  2WF6 A;  2V9W A;  1ZQK A;  3MAB A;  4DSJ A;  3C2L A;  2ZTC A;  1UT5 A;  4EBE A;  3DV9 A;  1CUK A;  2H3I A;  4QIW F;  4Y2Y A;  2KEY A;  4USA A;  2ZJ5 A;  4O3R A;  5KFW A;  3RB4 A;  2DWQ A;  4NWI A;  1H38 A;  2FLN A;  4I2B A;  3E2E A;  1ZOL A;  3HP6 A;  3LYS A;  5ALJ A;  4IR1 A;  2IOF A;  4KLD A;  3ED5 A;  3GQC A;  2XY5 A;  5CA7 A;  5B5E U;  5DBA A;  1FO4 A;  3KHH A;  9ICT A;  1RPL A;  4DLG A;  3SAF A;  3AU2 A;  1TV9 A;  1KFD A;  4UB8 U;  1U47 A;  2E8O A;  3ZDD A;  1ZD2 P;  4M0A A;  1KKX A;  3Q8Q B;  2YN4 A;  1UA0 A;  4YN4 A;  5KFE A;  4KLI A;  3OGU A;  2F8L A;  2W9A A;  5KT4 A;  7ICI A;  3GV7 B;  8ICW A;  4BXO A;  5DQH A;  4KLH A;  5DLF A;  2K60 A;  1ZET A;  3MFH A;  4PL2 A;  4ZOH C;  3MC1 A;  2P6R A;  2ZIU A;  8ICY A;  1BPE A;  1ZQO A;  8ICR A;  3IG8 A;  9ICC A;  3KBB A;  2FE9 A;  5ALP A;  2Z7J A;  3UMB A;  3IV6 A;  5GTI U;  3PR4 A;  2UVV A;  1Q46 A;  3BS5 A;  4QZC A;  2BPC A;  2KK0 A;  1DRG A;  3M8S A;  5KFM A;  5J0P A;  5DG8 A;  9ICU A;  5GTH U;  1S0M A;  1ZQT A;  4I2H A;  4O9M A;  5AI5 A;  4F91 B;  5KFC A;  1S5L U;  1ZJN A;  2G08 A;  1T8E A;  3SD7 A;  5CJ7 A;  7ICP A;  4YR0 A;  3AQF A;  1B4F A;  3WKC A;  4UW9 A;  2AGP A;  3LWM A;  3UMG A;  2KG5 A;  2W8K A;  5AKJ A;  3C5F A;  4Y2X A;  2VJ5 A;  3PSP A;  3HW8 A;  4YR3 A;  5AKZ A;  2GWS A;  1SZP A;  3FC4 A;  2IOF K;  3GII A;  4RNM A;  1XC9 A;  5AKH A;  3RJH A;  3PSF A;  4DL7 A;  2F77 X;  1JIH A;  3C5G A;  3TQ1 A;  4BGD A;  4Q43 A;  1IM4 A;  2P35 A;  1ZQX A;  5KFR A;  1VJ5 A;  1YZ7 A;  1MC8 A;  4NY8 A;  4XRH A;  3ZDA A;  4F72 A;  2W43 A;  2F2A B;  1NOM A;  1PZN A;  2KSO A;  4R65 A;  3BZK A;  2ZIW A;  3DEE A;  2KZM A;  1NK9 A;  5ALR A;  4DFD A;  2KKV A;  9ICG A;  1RQN A;  3UMC A;  2ZUB A;  1JX4 A;  1ZQL A;  4OJP A;  2ZTE A;  5B66 U;  3SYZ A;  4KN7 A;  1UPH A;  5KFJ A;  3AQE A;  3TFR A;  1V97 A;  4PGY A;  3PX6 A;  5KFG A;  2AQ0 A;  2Y1I A;  1Q3U A;  2PMZ F;  3H4D A;  5ALS A;  4ELT A;  5KG1 A;  5KFH A;  2H3Q A;  2F8K A;  2YMM A;  1J97 A;  4PHE A;  5AM3 A;  3MGV A;  2I6X A;  3GV8 B;  4CRX A;  5CP2 A;  2JZB A;  3TKA A;  5KT7 A;  4JB3 A;  2CN1 A;  2KZZ A;  7ICT A;  2KIW A;  4XQ8 A;  2W04 A;  5J2A A;  3MR6 A;  4PPX A;  1B22 A;  4EBC A;  3FM9 A;  4AYB C;  4F4Y A;  4Q45 A;  3JPO A;  5DBB A;  3M7D A;  3DDH A;  2XIC A;  1GO3 F;  2Y1J A;  5L9X A;  1Z1V A;  2G5I B;  4YCX A;  3TI0 A;  1DGJ A;  2JH1 A;  4QWA A;  2JEI A;  4EZ6 A;  4C4T A;  2HBL A;  1UT8 A;  4KLJ A;  4FZL A;  4ELU A;  2GO7 A;  3KKA A;  4O5K A;  3S6J A;  4O5E A;  2FPL A;  1BPZ A;  9ICL A;  2BPG A;  2KHQ A;  2N1R A;  1JXE A;  5D46 A;  1O08 A;  2KZ3 A;  3BQ7 A;  3RTV A;  4MEY A;  2KTQ A;  2D3D A;  2XVT A;  3A0B U;  1T4G A;  3GIK A;  2GOL A;  1NJZ A;  4DF4 A;  1KDH A;  2YB4 A;  4ED6 A;  3QX7 A;  5AHX A;  2QB0 A;  1PVR A;  3BDP A;  1XNS A;  2FMP A;  3KKA C;  5KFI A;  3QUB A;  1RZT A;  3LVW A;  5EOZ A;  4B6J A;  4F2R A;  2AGQ A;  3TAQ A;  1ZXI A;  2L5Y A;  4YD1 A;  1JI7 A;  2PXI A;  2JMG A;  2DKZ A;  1HEK A;  2B21 A;  3NRZ A;  2C28 A;  2FMS A;  5L1J A;  4RQ3 A;  1TAQ A;  3KOO A;  4G3I A;  3RAQ A;  3V6J A;  4NM1 A;  1QQ5 A;  4YMN A;  5J2B A;  4RT3 A;  2FI1 A;  4LZD A;  2LYH A;  1X40 A;  2OEH A;  5L1L A;  3GDX A;  4DQP A;  3F5A A;  3Q8K A;  5AK3 A;  2ZXI A;  1QQ6 A;  3QU4 A;  2ODG A;  4B9M A;  4QNL A;  4F3O A;  2QKQ A;  4PHP A;  2G07 A;  1N5X A;  4MF2 A;  1MQ3 A;  5EE3 A;  2ZIX B;  3IHQ B;  2LBO A;  1RYS A;  4DFP A;  3JPP A;  3Q8R B;  1ZQB A;  5J0U A;  3C23 A;  1TVA A;  3OSN A;  2C22 A;  2V4R A;  3AM9 A;  1LKY A;  4DFM A;  5CRX A;  2FLP A;  3L4P A;  5F3X B;  4RU9 A;  4UB3 A;  3NGD A;  1XU4 A;  7ICH A;  5KFO A;  4ED2 A;  4C7Y A;  4QZE A;  2ZIV B;  1XO0 A;  2MA1 A;  2WB1 F;  4C0Z A;  4IRD A;  2HI0 A;  3RRG A;  4P0P B;  2YMQ A;  5HNK A;  3KHL A;  4GXJ A;  4E0D A;  5HML A;  2F1I A;  3RRH A;  4JK1 A;  1FIQ A;  1OUQ A;  5DG7 A;  4HYK A;  4QWE A;  3WK8 A;  2NRW A;  2BCV A;  2HBJ A;  2E8P A;  3F2D A;  4DSI A;  2HHS A;  4EYI B;  3AU6 A;  1RM6 C;  4ECW A;  4YD2 A;  4NM2 A;  1Z1B A;  9ICI A;  4DL3 A;  4KLS A;  9ICA A;  5CWR A;  5KFS A;  4G9B A;  2ZUD A;  2XCA A;  9ICH A;  4LZG A;  4OO1 J;  1N60 A;  2E1E A;  8ICN A;  3B0X A;  1QSL A;  2ZXH A;  3SI8 A;  1X9X A;  2H3F A;  1SZH A;  2HHQ A;  3AEV A;  2KJ5 A;  4J9L A;  5JRT A;  5ALO A;  3EYZ A;  4F5R A;  4HAI A;  4KLM A;  4MHV A;  4ECV A;  5KFV A;  1WUD A;  1D8L A;  9ICO A;  2Y9U A;  1BNP A;  4DCC A;  4I2E A;  4C80 A;  2W9C A;  4Y2T A;  1ZQR A;  3UQ0 A;  2KD1 A;  4M6W B;  2A1A A;  4R8U A;  2JEG A;  4US9 A;  2BCQ A;  4C8N A;  4OJ5 A;  2W55 A;  4GFJ A;  5ALT A;  4YXM A;  5CB1 A;  1ZQA A;  4GIB A;  5J2E A;  1T3Q A;  2WF8 A;  3JPQ A;  3PVX A;  1S9F A;  7ICM A;  9ICN A;  4P4M A;  1RG6 A;  4J9S A;  1XS9 D;  2ASD A;  3H8S A;  2I9G A;  4PGX A;  2DGZ A;  2P66 A;  4YP3 A;  5CR0 A;  1VDV A;  3F5E A;  7ICL A;  5IIJ A;  3FYH A;  4F50 A;  2E8M A;  2A1J B;  8ICE A;  2LMR A;  4ZH4 A;  4DS5 A;  4CE6 A;  5AI8 A;  1QQ7 A;  3T5J A;  2JRZ A;  1T3N A;  4TUR A;  1NI3 A;  4US8 A;  3PST A;  1PUZ A;  3ALR A;  3MDC A;  2K89 A;  3QE9 Y;  3QEB Z;  3WU2 U;  3NVW A;  2KJ9 A;  3EWA A;  1WCL A;  1SXE A;  3IRU A;  3LDA A;  2W7P A;  3K4G A;  5DGA A;  5AKL A;  3JPS A;  1Z3E B;  2EH9 A;  1NK4 A;  4O3S A;  3C1Z A;  4KMU A;  4CF4 A;  2XGP A;  4QZH A;  1L6N A;  2BDU A;  2BDP A;  3BQT A;  2JR5 A;  1L8L A;  2H3V A;  5J2G A;  1PK3 A;  4M6W A;  3E58 A;  4O3O A;  3ICX A;  4I2G A;  3SZ2 A;  1ZQP A;  3N4M B;  7ICV A;  5J0S A;  7ICG A;  2LI6 A;  3T5H A;  5KFF A;  1ZQF A;  5ALY A;  1B0X A;  3RH4 A;  5KTQ A;  5ALW A;  3SAH A;  4R66 A;  1JRO A;  3MR2 A;  3QU5 A;  2MAX A;  1L8O A;  2XID A;  5J0W A;  2CXY A;  5IIN A;  3EPG A;  2YX8 A;  1NKC A;  4IS7 A;  3ONN A;  4I2I A;  2KP7 A;  4UB4 A;  5KFL A;  5EE9 A;  2DBY A;  1ZQE A;  2M0N A;  4FZN A;  4Y2V A;  4FBU A;  3QZ8 A;  4I2C A;  1ARO P;  2QAR A;  1PK1 A;  4BWM A;  8ICB A;  1SL0 A;  2KFN A;  5ALH A;  3C29 A;  1ECW A;  8ICM A;  4BWJ A;  3UPQ A;  5C5J A;  2W54 A;  4JUZ A;  2XCP A;  2R8I A;  1BNO A;  1ZD5 A;  3PX0 A;  3CNH A;  3WK6 A;  4A8E A;  3GIM A;  2ZIW B;  4Q8F A;  1ZQV A;  3TAD C;  4RPY A;  9ICS A;  4YMM A;  4UAW A;  4IRK A;  2OCE A;  4KN4 A;  4RQM A;  5KFP A;  4B9V A;  4M9J A;  1L5U A;  4U7C A;  2C2R A;  1U48 A;  2HBM A;  3HKZ F;  8ICV A;  1J2M A;  4K4I A;  1KRP A;  8ICZ A;  2VA3 A;  4O0I A;  1BGX T;  2W9C B;  1JN3 A;  3WK4 A;  4UBB A;  3M9N B;  5D4B A;  2WFA A;  3H8W A;  4FFD A;  4UB1 A;  4C8L A;  2WAQ C;  1IV8 A;  5AI4 A;  3M6Z A;  1WWV A;  5JU5 A;  1SKW A;  5G5G A;  9ICK A;  3VC8 A;  3H0L B;  4MF8 A;  4RQ2 A;  4KLF A;  1URJ A;  1TAM A;  4UAT A;  4UAZ A;  2F1J A;  2K4H A;  4QWB A;  2WAQ F;  3TAP A;  2HOQ A;  4DOA A;  1ZQY A;  4ED3 A;  4I2F A;  2NO4 A;  4IQT A;  2BGW A;  4ED8 A;  3TAN A;  3V72 A;  9ICB A;  4ECS A;  5AK6 A;  4R64 A;  3WKD A;  2KV2 A;  2KIC A;  2DQN B;  1DK2 A;  5KFT A;  2C2E A;  4B9L A;  1UHU A;  5HR7 A;  4DL2 A;  4F5O A;  1BPX A;  3GU3 A;  4DFJ A;  2EZZ A;  3N28 A;  4GC7 A;  7ICF A;  2ALZ A;  3HWT A;  3MGI A;  4RZR A;  1D9F A;  2EAM A;  5KT5 A;  2A19 A;  1A77 A;  2JV3 A;  3SR6 A;  2PFN A;  2DPI A;  3R9K A;  2FLL A;  4PZN A;  2G09 A;  1XWL A;  1D8B A;  3F2C A;  2XC9 A;  5DDY A;  2HHT A;  3U26 A;  3C1Y A;  1SL1 A;  1FFU A;  4OJ6 A;  3D2Q A;  2ZIV A;  1YZ6 A;  9ICX A;  4FO6 A;  2F44 A;  5IIM A;  4ECR A;  1ZQS A;  4GC6 A;  1ZQU A;  1TE2 A;  1ZQH A;  4EEY A;  4UAY A;  1SV4 A;  1U4B A;  2Y0S F;  2F76 X;  1COK A;  4KLT A;  3K1R B;  2D6F C;  4DSE A;  4NL9 A;  1XSL A;  4ED7 A;  5KL1 B;  8ICJ A;  2A3V A;  4DL4 A;  4QZD A;  3VCB A;  1N61 A;  3RJE A;  1Y88 A;  3ISB A;  5HHI A;  4LVS A;  4YXJ A;  4NL9 C;  2B6G A;  2IHN A;  2OHF A;  4CNQ A;  1NKB A;  4BXO B;  3I76 A;  3GIJ A;  8ICG A;  3NVZ A;  5F9N A;  3NVV A;  4J03 A;  5ALD A;  5J0R A;  1DGS A;  4KLU A;  2XY7 A;  2BQU A;  5IIL A;  2MUT A;  5KT6 A;  5AM4 A;  3AUO A;  3BS7 A;  3BQ1 A;  3EW9 A;  3GIL A;  5EWF A;  1N62 A;  2AU0 A;  2KMD A;  2MSN A;  2F3N A;  1SL2 A;  3V7L A;  4F4Z A;  3PW5 A;  2E1F A;  1QSS A;  2KFZ A;  1QCK A;  1KL9 A;  3N97 B;  4RPX A;  1MQ2 A;  1NNL A;  4TUQ A;  3H0M B;  4CGZ A;  9ICQ A;  1KTQ A;  3QXG A;  3PMN A;  3GFK B;  5T14 A;  5J2D A;  7ICR A;  4DQQ A;  3PX4 A;  1Z4O A;  3RR7 A;  4Y2Q A;  2M9N A;  1XSP A; 
#chains in the Genus database with same CATH homology
 1SV0 A;  2L5Y A;  4RQM A;  3BS5 A;  3SEN A;  1JI7 A;  2D8C A;  1F0M A;  2DKZ A;  5KNI A;  2F44 A;  3SEI A;  2YTU A;  1X66 A;  2Y9T A;  1KW4 A;  2QB0 B;  2F8K A;  2DKX A;  1SV4 A;  1X9X A;  1UQV A;  1OW5 A;  1COK A;  2EAO A;  3HIL A;  3K1R B;  1UCV A;  1B4F A;  1WWV A;  1X40 A;  4NL9 A;  5JRT A;  2ES6 A;  1PK3 A;  5JU5 A;  4MHV A;  3BS5 B;  5JTI A;  4RQN A;  2Y9U A;  2K4P A;  2KE7 A;  2KG5 A;  2QKQ A;  1WWU A;  1SGG A;  2EAP A;  1B0X A;  3H8M A;  4NL9 C;  1SXD A;  2DL0 A;  4PZO A;  2B6G A;  3IDW A;  1Z1V A;  5J8Y A;  1LKY B;  1SV0 C;  1LKY A;  3TAD A;  2KIV A;  4IS7 A;  5F3X B;  2QB1 A;  3KKA A;  1V38 A;  1DXS A;  5J8Y C;  1RG6 A;  3BS7 A;  2QAR B;  2E8O A;  4NJ8 A;  2KMD A;  2QAR A;  1PK1 A;  2F3N A;  3BQ7 A;  2GLE A;  2EAN A;  2D3D A;  3TAC B;  2E8M A;  2EAM A;  2LMR A;  5L1M A;  2ESE A;  1OXJ A;  2KSO A;  2E8N A;  2LPE A;  2JV3 A;  2KSO B;  2QB0 A;  4PZN A;  2K60 A;  3TAD C;  3KKA C;  2E8P A;  1PK1 B;  1SXE A;  1V85 A;  2FE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...