5JTIA

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
b'LDMNISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jtiA00
3KKAC 2FE9A 1V85A 1B0XA 3BQ7A 1JI7A 2LPEA 1OW5A 2F3NA 1COKA 3SEIA 2E8MA 1UQVA 1SGGA 3KKAA 4NJ8A 1LKYA 2JV3A 2DKZA 1X9XA 2D3DA 2EAPA 2L5YA 2EAMA 4PZOA 1X40A 3H8MA 3TADC 2KG5A 1SV0C 1PK1B 2B6GA 3BS5B 5F3XB 2Y9UA 2EAOA 2QARA 2KSOA 4RQMA 3TADA 1RG6A 1SV0A 1PK3A 1WWUA 2E8NA 3BS7A 2LMRA 1V38A 2KMDA 2GLEA 1B4FA 2E8PA 1OXJA 1Z1VA 2ES6A 2QB0A 3SENA 2E8OA 1F0MA 4MHVA 1LKYB 1DXSA 2QB1A 5JU5A 2KE7A 2KIVA 2QKQA 2D8CA 1PK1A 2YTUA 1WWVA 3TACB 3K1RB 3IDWA 5JTIA 1X66A 1KW4A 2K60A 2DL0A 2ESEA 1UCVA 4IS7A 4PZNA 2K4PA 4NL9C 2DKXA 5J8YC 2QB0B 3HILA 1SXDA 3BS5A 5KNIA 5L1MA 2F44A 4RQNA 4NL9A 5J8YA 5JRTA 2QARB 2KSOB 2EANA 2Y9TA 1SV4A 1SXEA 2F8KA
chains in the Genus database with same CATH superfamily
3GV7B 3ZDEA 4F4YA 9ICKA 1VDVA 1SL2A 2JR5A 3THVA 1BPEA 1RDFA 1DK3A 3M1YA 3SEIA 1ZQNA 2DUYA 2LM4A 1N62A 3EPGA 3QYPA 3PNCA 2ISPA 3M9MB 2FJ6A 4P0PA 3OSNA 1X9XA 1QSLA 1KEJA 1YT3A 1O08A 3JPOA 4J9RA 4F5PA 4PZOA 4ECUA 5F3XB 2I9GA 1X9MA 9ICUA 2CN1A 3TADA 4UQGA 3ZDAA 4I2CA 1D9FA 3L4PA 2KHQA 3MC1A 3G6YA 1XSPA 1AROP 3OJSA 3T5JA 3TANA 8ICXA 4C8KA 3WKCA 1S10A 5AM2A 1SWVA 1F0MA 3QE9Y 5KG1A 2KTQA 4AYBF 3V6HA 2CXYA 2LHTA 2HHWA 5AM3A 4B9UA 4Y2QA 4ECXA 4DFPA 2W9BB 4C4TA 4JMUA 4RUCA 4UAZA 5DQHA 5AI5A 5J0WA 1WCLA 3WK6A 4BXOA 3H0MB 1UCVA 2VJ4A 3L3FX 1JX4A 2VA2A 3LK9A 3GDXA 2H3VA 4EYIB 8ICAA 4M6WA 4QZAA 2BKEA 4ED6A 4F2RA 7ICJA 3BS5A 1SZPA 4DEZA 1Z1BA 1SV4A 1SXEA 5KFKA 3M9NB 4EENA 2R8JA 3N7PD 4Y2XA 3RB4A 1JN3A 2LPEA 4MF8A 2FDRA 2W8KA 2BCRA 1COKA 3T5KA 1U9LA 5KFHA 2KJ8A 3MGVA 4B9SA 1JALA 9ICBA 4MF2A 1F44A 1RYRA 8ICEA 4DWIA 3RJIA 3UQ2A 2J6TA 3F2DA 2B6GA 4F4WA 4DSJA 1QQ6A 2P66A 3MDAA 4I2GA 3M6KA 2BQUA 1KTQA 1BPXA 3ETLA 5IIKA 5DG8A 3M6ZA 5KFRA 1TK0A 3WK9A 2OEHA 2ZG6A 5F9NA 2PFNA 2BCSA 2JHDA 1NZBA 1Z1VA 2W11A 9ICTA 3IP4B 4OJOA 2QB0A 4Z6DA 4QZFA 2HDOA 3MBYA 4KLTA 4Q8FA 2FI1A 2NO4A 5K4LA 3ISDA 3OHBA 1AQ6A 4NXZA 4RQ1A 2YY6A 3C1YA 3V7LA 4DLEA 3PW2A 1X2IA 1NOMA 5AKHA 4DF4A 3TQ1A 5KFDA 1M6YA 1ZD3A 1FIQA 4ECSA 5L1KA 2RQ5A 4UARA 2G09A 3KBBA 2K8BB 5L1MA 2E1FA 5J0PA 3JPSA 4Y2JA 8ICYA 4IC9A 1SL1A 4BJQA 9ICCA 1ECWA 2ZUDA 1NI3A 3QU5A 4ELTA 4KLSA 2W3SA 5KT2A 4UAYA 4NLKA 3F5EA 2E8MA 3ORYA 4OCZA 5AM1A 3TAPA 2KZZA 2F76X 4YR2A 1N2XA 4BDPA 2LM1A 2VKQA 1XU4A 3AM9A 2XY5A 5IIIA 3ICXA 4DLGA 4QZCA 2QARA 4RT2A 5KT3A 3RJKA 2LYAA 2KSOA 4RQMA 4O5EA 5AK4A 3SD7A 5HR7A 2AHOB 4XA5A 5DGBA 1SV0A 4I2BA 4UW9A 2G08A 4OJPA 1BPYA 3PVXA 5ALOA 1L7PA 7ICQA 2KJ9A 2E8PA 1S5LU 5L9XA 4F5RA 2LI6A 3RFAA 2ISOA 3MR2A 5C0YA 2J6UA 5JUMA 4QZGA 2RRDA 1K1SA 3CRXA 5JU5A 4KLJA 3BQ2A 2D8CA 4EEKA 8ICQA 2F1HA 4F4KA 5KFCA 4PHEA 3HT3A 1PK1A 3WK5A 2ZJ5A 3ETRA 4GXJA 2BCQA 3K1RB 1RM6C 5JTIA 4DFMA 3BQ0A 1D9DA 1YZ6A 4PHAA 8ICMA 5HR6A 1HUOA 3PO4A 3SV3A 4EBCA 3HILA 5KT6A 2C2RA 3NRWA 3RR7A 4IL6U 1B22A 4G3IA 1IV8A 4M0AA 3I76A 3RF9A 1ZQUA 5CB1A 5J8YA 3UXPA 4LZGA 3KZXA 4PHPA 1ZD4A 3FDSA 2XI9A 2JEFA 8ICZA 1V85A 1NJXA 2OXOA 1OW5A 4LZDA 1UQVA 7ICOA 4YXJA 4O5KA 4KLIA 7ICGA 4US9A 1LKYA 3B0YA 3IN5A 4P0QA 1B43A 5CA7A 4FBUA 2V4RA 1ZQDA 2G06A 5AK3A 4M9GA 2O6KA 4Y2PA 1NKEA 1UA1A 4QZ8A 5ALLA 1TKDA 4QJFB 4IR9A 1PK3A 3FC4A 5BPCA 9ICWA 1X9SA 4IQVA 1KLNA 2D6FC 2H3IA 5AK6A 2W8LA 5KFFA 1JIHA 5AKGA 1XSNA 7ICSA 3GIMA 4RQ2A 5AICA 2RP5A 2A1JA 4F2SA 5J0QA 8ICKA 2KEYA 2DPJA 5L1LA 3V6JA 1PUZA 1NZPA 4R8UA 2KIWA 2QKQA 1K1QA 2BDUA 3TACB 3RJGA 3T5HA 2PXIA 4QIWF 1S9FA 2YMMA 3EWAA 1A77A 1ZXIA 4KLMA 3OPXA 3LWMA 5KG4A 4ECTA 2DL0A 1SWWA 2UVRA 4LJXA 1QQ5A 4EEYA 2R8IA 2KVSA 2V9WA 5J2EA 1P7DA 2K4PA 4KLHA 1XS9D 1UT5A 2KK0A 1MQ2A 2ALZA 3RRGA 4KLDA 4FZMA 4ED2A 3KHGA 2K8CB 3C2MA 1C7YA 3C1ZA 1DOQA 2ZIVB 4DO9A 3MFIA 4M9JA 4O3PA 2JEGA 1ZQVA 3ZDBA 2ASJA 2J6SA 1ZYQA 2MUTA 4F4XA 4DSLA 2ZIWB 3WKEA 1CUKA 1UA0A 2WF9A 4TUQA 9ICQA 4YVZA 5ALIA 4MFCA 5AKXA 5ALKA 4UB1A 1Z00B 3RB6A 4JV0A 2QLTA 3TKAA 1QSYA 2LYHA 1MQ3A 1WWUA 4GXKA 3KD3A 4M47A 2ZIXA 4Z6EA 1ZQTA 5J0OA 4DFKA 2XY6A 4FO6A 3E58A 1U48A 5GTHU 3FYHA 3JPTA 1KKXA 3PW5A 1COOA 4TUPA 2KICA 5F9LA 3HKZF 2HBLA 4DL7A 3SAFA 2YTUA 4QW8A 5KFMA 3HWTA 1URJA 3OTQA 4J9LA 3UQ0A 3RAXA 4I2IA 2W9CB 2HHQA 1SKSA 2Y1IA 4UB3A 4I2HA 2A3VA 3E2EA 1L5UA 1X6JA 1RXWA 5KFXA 3WK4A 3KHRA 3LYSA 1YZ7A 4UATA 4P2HA 4XRHA 2XGPA 1LB2B 4KLQA 3PX4A 4CDGA 2UVUA 3TAQA 5B5EU 5JRTA 4UB6U 5J2KA 3BQTA 5J0TA 4DOBA 1S0VA 2GO7A 2ZUCA 4RQ6A 3QU4A 4F72A 1RXVA 2ODGA 1X9WA 5AM0A 4KMUA 1ZQMA 2F3NA 5KG3A 3RB0A 5KFOA 2JMGA 5KFIA 2G5HB 2WB1C 1Q3VA 4RNMA 5EWFA 3H8SA 4DQSA 3HRDD 2OYYA 4UBBA 1ZQBA 5J2BA 1KFSA 2JEIA 4B9LA 1S76D 5AM5A 4F93B 4YR3A 1L7MA 2F1JA 4F5QA 5DB7A 3PW4A 2KFZA 2HOFA 3AEVA 2DPIA 3NGDA 2GLEA 3EZ5A 8ICJA 1H38A 5AM4A 4K4GA 4ED0A 4GLXA 2YB1A 4CF5A 4YQWA 4C0ZA 1J2MA 4ED1A 8ICNA 3B0XA 4Y2RA 3UM9A 3HP6A 4CE6A 3E0FA 4C4SA 1Z3EB 3EYZA 3EUB2 1X66A 4XQ8A 3LDAA 3Q8PB 3NUQA 1XC9A 3GILA 8ICCA 4IS7A 4RQ8A 1UT8A 4YG2A 2C28A 2N1RA 2KP7A 3C23A 4UASA 4KN4A 3PW0A 4KLGA 2AGPA 2BQ3A 5HNKA 5KFTA 3QU9A 3QUTA 2HVHA 4QWEA 1RYSA 3L5KA 5ALSA 2EANA 2IHNA 4C4RA 2F8KA 2W9BA 1ZQJA 1NKBA 2W7OA 2ZXIA 3SMVA 1NJZA 3BDPA 4ED8A 4F5NA 4F5OA 7ICMA 5AKKA 1V97A 3RJFA 4C7YA 3GIJA 1ZD2P 5HMMA 5TISU 3OSPA 4PGYA 1N5XA 3V6KA 4M6WB 2L5YA 3PX6A 3PZPA 4DSIA 7ICTA 2KG5A 4C8NA 4MFFA 3BS5B 7ICIA 1JROA 3B9JA 3PW7A 7ICVA 1N56A 8ICOA 3N7SC 2PFQA 4UB2A 4YMNA 1RG6A 2FMSA 3IRUA 4NLGA 8ICBA 5ALNA 1DRGA 5EE1A 3H7IA 3J81j 1LV5A 9ICIA 5AI4A 1CEZA 4J03A 4QZHA 8ICIA 4UB5A 4O3SA 4OD0A 2KE7A 2DGZA 3QEAZ 2ZIUA 5KL1B 5G5GA 5KAIU 3QNMA 1TFRA 5ALWA 2PKEA 1BVSA 5J2JA 5J2HA 5IIJA 5ALQA 1X6IA 1NJWA 3MGHA 1U49A 4PZNA 1O03A 8ICRA 1L7OA 2ZTCA 1SIJA 2KKPA 2F2AB 3HX0A 1BNOA 3QEBZ 2QB0B 1NK7A 3PR5B 2BDPA 2F44A 4U7CA 1A6SA 2IHMA 1C20A 2DBYA 5DB8A 4U6PA 2EZYA 2PI5A 3MR3A 3PSFA 1T3NA 8ICHA 4BWMA 4PJ0U 3KKAC 1B0XA 5KT4A 4QWAA 1TVAA 4PL1A 2YMLA 1SKWA 1QCKA 1NK5A 1N48A 3VCBA 4ELUA 2JGAA 4QWCA 3NVYA 2VJ5A 5T14A 2JH1A 3H0LB 1L3TA 5AKYA 3DEEA 2WAQF 3KHHA 4Y2UA 2DF4B 3H8WA 4AP9A 4O5CA 2K89A 2HHXA 4DSKA 2Y9UA 5J29A 4F4ZA 2LBOA 3JPNA 3C2KA 4ACOA 1OUQA 1KRPA 4ICAA 4DF8A 1RZTA 3BS7A 2VIXA 1QQ7A 2KV2A 1L3UA 2HHUA 3MGIA 2DFLA 3ZD8A 2Y0SF 5E79U 1OXJA 4QZBA 2JRZA 1XNSA 4CCHA 2BPCA 2IOFK 2VA3A 3N7RC 1HJPA 2DWQA 2R18A 3PMNA 4QZDA 4MFAA 3KFUF 4DL3A 3M8SA 1CRXA 1ZJMA 2B21A 3AU2A 5HHHA 5D4BA 4ECVA 2UVWA 1KW4A 4MEXA 3D2NA 2FMQA 4GXIA 1NJYA 2E5SA 2KOBA 4Y2YA 4JUZA 1JXEA 3SV4A 4BX9C 4NL9C 4A8EA 3PSIA 2NRVA 4DL6A 2H3QA 3QXGA 1ZQEA 1L8LA 4ZH4A 4Z6CA 5AKJA 2BGWA 1TAMA 3H8JA 1XSLA 4NM1A 5AKEA 2AGQA 5D49A 4J9NA 1UHUA 4YMMA 4OJ5A 5EWEA 2YMPA 3SZ2A 4FZNA 5KFNA 2F77X 5DLFA 4E0DA 2B0CA 1ZQRA 7ICPA 5KG6A 2OM6A 4USAA 1KSPA 2FPKA 4TQSA 3TADC 2KKVA 4KITB 8ICUA 3JPPA 1BGXT 2JZBB 2WF7A 5CEHA 2Q4TA 1IXRA 5EE0A 5AK5A 4C8LA 1BPBA 2AXTU 1TE2A 2DQNB 5G5HA 4DS4A 4F71A 1T8EA 2K8AA 2ASDA 4UAUA 3ZD9A 3T3FA 2Q0ZX 3GU3A 2HI0A 4J9SA 1MA7A 4IRCA 2JEJA 1LKYB 3G6VA 1ZQOA 1WCNA 3SAGA 4CF3A 2YX8A 1N60A 4J9PA 1TK8A 5CRXA 3NVZA 2IOFA 2A1AA 5ALUA 1RPLA 1ZQPA 3IV6A 5CP2A 4ECZA 4G9BA 2M9NA 4B9VA 1UPHA 1ZOLA 3QU7A 2ESEA 2G0AA 2NRWA 3M8RA 4DQQA 4DQIA 3H40A 1ZQKA 4O3OA 3F2CA 5J0RA 3AL0B 2PMZF 3G6XA 5ALVA 1ZQQA 2A1JB 1QSSA 5ALPA 1S77D 4FFDA 4R8UB 4B9TA 2HW3A 1FFUA 5FP0A 1ZQXA 3VC8A 2VA8A 2PFOA 3JPQA 3RR8A 4CRXA 4M04A 1PVPA 1CI4A 4TURA 5A0LA 4Y2SA 2HHVA 5KFAA 8ICWA 3CNHA 2JV3A 3NVWA 3UMGA 4YFKA 1FFVA 2KHVA 3NVVA 3HJEA 4KX3A 2PI4A 2IBKA 5J2IA 2P35A 2HHSA 2JXJA 4DCCA 2LYBA 3ZDDA 1KN5A 2W54A 4M9NA 2LKYA 2NRTA 2RDIA 1VJ5A 4R64A 1V38A 2EZXA 2BCVA 2IA6A 9ICMA 4GIBA 4HYKA 2W04A 3C28A 1A76A 3PY8A 4BWJA 2MRLA 2RDJA 3UXNA 8ICPA 3PX0A 3QUQA 2FLPA 2EQYA 2W7PA 2WHEA 3C2LA 3MABA 3F5AA 3ONNA 4C80A 1EXNA 3AN1A 4P4PA 1QH9A 1L3SA 1PZNA 3N4MB 5KFGA 1IG6A 3AQEA 3OGUA 3KTQA 4QWBA 4QIWC 4OJ6A 4QZ9A 2ZIXB 5DB9A 4UAVA 4JK1A 2WB1F 2OHFA 4DOCA 7ICHA 3RJHA 9ICFA 1NK0A 3TFRA 1SXDA 5KFQA 1DK2A 4NLNA 4YN4A 1WYGA 4NY8A 7ICEA 1RQLA 2Y9TA 4KLFA 1VLBA 3K1ZA 5KTQA 5KG7A 3TI0A 4R63A 5KFBA 1ZQYA 5DG7A 2V4QA 5AKZA 3CP8A 4GC7A 7ICLA 9ICOA 3RAQA 9ICEA 4I2AA 1S8OA 4NLBA 1TAQA 3T79A 2F1IA 1ZRNA 4FS1A 2EAPA 2RLTA 3V7JA 2KZ3A 2ASLA 5KFZA 2XVTA 1SV0C 3O0FA 2AU0A 1MN8A 1NK8A 3NASA 3AU6A 1PVRA 1SKRA 1Z4OA 3WKAA 4DQPA 7ICKA 3Q8RB 4OO1J 3RBEA 8ICFA 1QLNA 5IILA 2GOLA 1N61A 1NK6A 2XGQA 4PH5A 4I2JA 1ZQCA 4F91B 1LVHA 3K75D 3HW8A 3MDCA 1J97A 4M9LA 3LVVA 1HIWA 2E8OA 5KFWA 4ECWA 3Q8LA 9ICHA 2QB1A 1F5SA 4RQ5A 2IMWP 5BOLA 4RPYA 2WF6A 3RJEA 3GIKA 7ICUA 1WWVA 1Q8KA 5H2FU 4RT3A 3HKZC 5HMLA 5J2DA 2K60A 2HBMA 4B9MA 2KN7A 4F8RA 4RPXA 3A0BU 4YXMA 3KZIU 5CWRA 3FAHA 2NRZA 5DDMA 5J8YC 4P0PB 4I2FA 1NK4A 1Q46A 2FPMA 4J9QA 5KNIA 3PV8A 3BQ1A 2P6RA 2H3FA 4RQNA 2KVCA 4PL2A 4F50A 1ZJNA 5IINA 3GFKB 2BR0A 3WKDA 4J9MA 2NV3A 2H3ZA 8ICSA 3QZ7A 5ALYA 9ICPA 1T3QA 5AKLA 3WK7A 4DQRA 4O3NA 4O0IA 4YCXA 5KFEA 1BNPA 4JWMA 1Y88A 3UXOA 4FE3A 1SGGA 2PFPA 2WF5A 2FLNA 4Q8EA 2EH9A 4EYHB 3AMZA 2OCEA 4US8A 1ZQIA 2DKZA 2BZFA 3CW2C 2YB4A 2EAMA 1ZQWA 4GC6A 3BZKA 2HMXA 4QW9A 5BOMA 4Q43A 4KLLA 3H4BA 1T94A 5DBCA 2ZTDA 2E8NA 2GH1A 1IM4A 4BXOB 3RJJA 5B66U 3ISCA 3SYZA 4UBCA 2NO5A 4ELVA 4O9MA 2W9AA 3ISBA 3T5LA 4IQUA 1K5OA 1U47A 4EBEA 8ICTA 2EZZA 2ZUBA 3IG5A 3QZ8A 2NYVA 4K4HA 4QWDA 5J0SA 3GZFA 2ATLA 2ZJAA 1L6NA 5AI9A 2FMPA 5KFVA 4CNQA 4R65A 4ECYA 1ZQLA 2KFNA 2K4HA 3F53A 4TUSA 5HHIA 3ED5A 1HUZA 2XCAA 1KBUA 2Z7JA 5ALRA 4YD1A 3HPOA 5KFLA 1MSWD 2FPLA 4RQ4A 4UAWA 9ICSA 5J0UA 5ALHA 3DDHA 3RH6A 9ICAA 4C8OA 1WG8A 5TZVA 2BCUA 4J9OA 4AYBC 4RZRA 2AQ4A 2WTFA 5ALGA 5L1JA 4IRKA 2M0NA 7ICRA 3OJUA 8ICLA 5ALZA 5J2FA 2XO7A 1ZQSA 2ZIUB 4ZOHC 2XCPA 4ED3A 4EX7A 3Q8QB 3R9KA 4Q45A 3BQ7A 1JI7A 1Z4NA 2UVVA 4LVSA 4NJ8A 1BPZA 2GWSA 4I29A 3IG8A 3K4GA 2R8HA 4F3OA 1A0PA 2XICA 4RPZA 4EBDA 2K4IA 1WUDA 2Y1JA 3N28A 1L3VA 4JB3A 4CGZA 1SL0A 2HOQA 4FS2A 1N63A 5DGAA 5EWGA 3C5FA 3BJYA 3DV9A 3RTVA 3QX7A 4QZIA 3SQIA 4TQRA 5IIOA 4KLOA 9ICJA 4NM2A 4PGQA 3D2SA 1T4GA 4FZLA 1DXSA 3A0HU 3WK8A 4I2EA 1ZQGA 4NWIA 2MAXA 3D2QA 2KZMA 4PHDA 9ICLA 4GFJA 4C7ZA 5CHGA 3GQCA 2AJQA 4KMOB 3PR4A 3PSPA 4KX5A 1NNLA 2BQRA 2I5HA 2W9MA 2XIDA 4PPXA 1S0OA 2WF8A 5J2CA 5AIAA 1X42A 3JPRA 4J9KA 4M9HA 3RH4A 1KDHA 4Y2VA 5IIMA 4DL2A 1KFTA 4DOAA 2YN4A 3NS1A 1XO0A 5EOZA 5KFPA 1JXLA 4X5VA 5DQGA 3KHLA 4F92B 1IIPA 1S0MA 2QARB 2KSOB 2WFAA 1SZHA 1S97A 1N5WA 4DFDA 2OH2A 7ICNA 3EW9A 4BUGA 5ALFA 4P4OA 4KLEA 3NTUA 2HCFA 4NLCA 5AHXA 1SB3C 1X40A 3H8MA 4EX6A 1PK1B 2BHNA 5J2GA 1ED1A 4NV0A 4KTQA 1PVQA 4Z6FA 2WAQC 1L8OA 4YD2A 4QZEA 2XY7A 4ECQA 4B9NA 3C21A 2LMRA 2KMDA 2H5XA 2ZTEA 4RUAA 3RH5A 5ALDA 2ES6A 1U4BA 4RQ7A 2ZXHA 2Y0SC 3SI8A 4O3QA 3GV5B 1NKCA 2EDUA 3KOOA 5ALTA 2NRXA 9ICNA 4XUSA 2KIVA 3UMBA 5D46A 1GO3F 1D8BA 3EPIA 4IQWA 3C29A 1Z19A 2JZBA 5GTIU 4RNNA 4DSEA 5ALJA 1D8YA 2W43A 4Y2TA 5C5JA 5J2AA 2G07A 4DS5A 3I1YA 3RBDA 1FO4A 4P0QB 5EE3A 4RNOA 5AI0A 3GIIA 3RB3A 1BPDA 1TV9A 2RHFA 5ALMA 5DKWA 4ED7A 3PO5A 4DL5A 1ZQ1C 2KJ5A 2OWOA 3TARA 2HBJA 1XO1A 5AI8A 2BPFA 5L1IA 4ECRA 1JUDA 2W03A 3OHAA 5DG9A 3LWLA 4QNLA 1ZQFA 8ICGA 2IOHA 5KFYA 5DBAA 2AGOA 2C2DA 2F8LA 3QUBA 5ALXA 1U45A 2E3TA 5KFSA 1ZD5A 3QU2A 1ZQZA 3C5GA 1V9PA 2EAOA 3M7DA 4JV1A 5KAFU 4EELA 2FLLA 1HEKA 5KFJA 3WU2U 1B4FA 3I28A 4IQTA 7ICFA 3CYMA 3SENA 3Q8KA 4HAIA 3SAHA 2MA1A 4DL4A 2YQEA 4MHVA 2KD1A 5KT5A 4YR0A 3MFHA 5KL8B 4EZ9A 5DBBA 2HBKA 1KQQA 3UPQA 4RU9A 5KFUA 5CR0A 2ZIVA 1RYUA 1DGSA 3ZI4A 3D6JA 3SR6A 3UMCA 5AI6A 4K4IA 4CF4A 5KG5A 5KG2A 3QUCA 4Q44A 4YP3A 2C22A 3Q8MA 2ZIWA 2MUTB 2BPGA 2YMQA 3WKBA 3FM9A 4I2DA 1JMSA 3Q8SB 3MR5A 9ICGA 4JV2A 3PMLA 1ZQAA 4YMOA 2VANA 2HSZA 1ZRMA 2CPRA 5DDYA 2PMZC 3ZDCA 1Z00A 2E1EA 5KG0A 4MEYA 2MSNA 3NRZA 5J0XA 9ICXA 1NK9A 1D8LA 2C2EA 2HOIA 2MU2A 2FE9A 5DB6A 4RQ0A 3AQFA 4IR1A 4KN7A 3RRHA 1T7PA 4NLZA 2AQ0A 3TFSA 2G5IB 4JWNA 3KKAA 4P4MA 4M2YA 5AKIA 2R8KA 4DFJA 3ALRA 2R8GA 3F2BA 2CRXA 9ICRA 2ZJ8A 2D3DA 4C8MA 4R66A 1L7NA 2W3RA 4B6JA 4WJ3B 4IRDA 2K4EA 3U26A 2P6UA 1KFDA 3AUOA 4I28A 1Q3UA 2W9CA 4FBTA 1QTMA 5KT7A 3H4DA 4RQ3A 3H0RB 4OJLA 1XWLA 2HVIA 8ICVA 5EE9A 1RQNA 3GV8B 2I6XA 2I1QA 5DLGA 2JH7A 3MR6A 3V72A 2XC9A 4O3MA 1MC8A 4UB4A 4DSFA 4EZ6A 1S0NA 4I27A 1TAUA 5CJ7A 3IDWA 3IHQB 1ZETA 3N97B 4UB8U 1TK5A 1DGJA 1J2NA 4PGXA 3LVWA 5HP4A 9ICVA 1KL9A 2DKXA 2AH5A 1FEZA 4KLUA 5ALEA 2KNJA 5DQIA 3V7KA 4O3RA 3S6JA 2HHTA 2A19A 5AIBA 4NL9A 3IM1A 1ZQHA 1JRPA 3BZCA 3PSTA 5J0YA 3M9OB 4BGDA 2W55A
chains in the Genus database with same CATH topology
3KKAC 2FE9A 1V85A 1B0XA 3BQ7A 1JI7A 2LPEA 1OW5A 2F3NA 1COKA 3SEIA 2E8MA 1UQVA 1SGGA 3KKAA 4NJ8A 1LKYA 2JV3A 2DKZA 1X9XA 2D3DA 2EAPA 2L5YA 2EAMA 4PZOA 1X40A 3H8MA 3TADC 2KG5A 1SV0C 1PK1B 2B6GA 3BS5B 5F3XB 2Y9UA 2EAOA 2QARA 2KSOA 4RQMA 3TADA 1RG6A 1SV0A 1PK3A 1WWUA 2E8NA 3BS7A 2LMRA 1V38A 2KMDA 2GLEA 1B4FA 2E8PA 1OXJA 1Z1VA 2ES6A 2QB0A 3SENA 2E8OA 1F0MA 4MHVA 1LKYB 1DXSA 2QB1A 5JU5A 2KE7A 2KIVA 2QKQA 2D8CA 1PK1A 2YTUA 1WWVA 3TACB 3K1RB 3IDWA 5JTIA 1X66A 1KW4A 2K60A 2DL0A 2ESEA 1UCVA 4IS7A 4PZNA 2K4PA 4NL9C 2DKXA 5J8YC 2QB0B 3HILA 1SXDA 3BS5A 5KNIA 5L1MA 2F44A 4RQNA 4NL9A 5J8YA 5JRTA 2QARB 2KSOB 2EANA 2Y9TA 1SV4A 1SXEA 2F8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKA C;  2FE9 A;  1V85 A;  1B0X A;  3BQ7 A;  1JI7 A;  2LPE A;  1OW5 A;  2F3N A;  1COK A;  3SEI A;  2E8M A;  1UQV A;  1SGG A;  3KKA A;  4NJ8 A;  1LKY A;  2JV3 A;  2DKZ A;  1X9X A;  2D3D A;  2EAP A;  2L5Y A;  2EAM A;  4PZO A;  1X40 A;  3H8M A;  3TAD C;  2KG5 A;  1SV0 C;  1PK1 B;  2B6G A;  3BS5 B;  5F3X B;  2Y9U A;  2EAO A;  2QAR A;  2KSO A;  4RQM A;  3TAD A;  1RG6 A;  1SV0 A;  1PK3 A;  1WWU A;  2E8N A;  3BS7 A;  2LMR A;  1V38 A;  2KMD A;  2GLE A;  1B4F A;  2E8P A;  1OXJ A;  1Z1V A;  2ES6 A;  2QB0 A;  3SEN A;  2E8O A;  1F0M A;  4MHV A;  1LKY B;  1DXS A;  2QB1 A;  5JU5 A;  2KE7 A;  2KIV A;  2QKQ A;  2D8C A;  1PK1 A;  2YTU A;  1WWV A;  3TAC B;  3K1R B;  3IDW A;  5JTI A;  1X66 A;  1KW4 A;  2K60 A;  2DL0 A;  2ESE A;  1UCV A;  4IS7 A;  4PZN A;  2K4P A;  4NL9 C;  2DKX A;  5J8Y C;  2QB0 B;  3HIL A;  1SXD A;  3BS5 A;  5KNI A;  5L1M A;  2F44 A;  4RQN A;  4NL9 A;  5J8Y A;  5JRT A;  2QAR B;  2KSO B;  2EAN A;  2Y9T A;  1SV4 A;  1SXE A;  2F8K A; 
#chains in the Genus database with same CATH topology
 3GV7 B;  3ZDE A;  4F4Y A;  9ICK A;  1VDV A;  1SL2 A;  2JR5 A;  3THV A;  1BPE A;  1RDF A;  1DK3 A;  3M1Y A;  3SEI A;  1ZQN A;  2DUY A;  2LM4 A;  1N62 A;  3EPG A;  3QYP A;  3PNC A;  2ISP A;  3M9M B;  2FJ6 A;  4P0P A;  3OSN A;  1X9X A;  1QSL A;  1KEJ A;  1YT3 A;  1O08 A;  3JPO A;  4J9R A;  4F5P A;  4PZO A;  4ECU A;  5F3X B;  2I9G A;  1X9M A;  9ICU A;  2CN1 A;  3TAD A;  4UQG A;  3ZDA A;  4I2C A;  1D9F A;  3L4P A;  2KHQ A;  3MC1 A;  3G6Y A;  1XSP A;  1ARO P;  3OJS A;  3T5J A;  3TAN A;  8ICX A;  4C8K A;  3WKC A;  1S10 A;  5AM2 A;  1SWV A;  1F0M A;  3QE9 Y;  5KG1 A;  2KTQ A;  4AYB F;  3V6H A;  2CXY A;  2LHT A;  2HHW A;  5AM3 A;  4B9U A;  4Y2Q A;  4ECX A;  4DFP A;  2W9B B;  4C4T A;  4JMU A;  4RUC A;  4UAZ A;  5DQH A;  5AI5 A;  5J0W A;  1WCL A;  3WK6 A;  4BXO A;  3H0M B;  1UCV A;  2VJ4 A;  3L3F X;  1JX4 A;  2VA2 A;  3LK9 A;  3GDX A;  2H3V A;  4EYI B;  8ICA A;  4M6W A;  4QZA A;  2BKE A;  4ED6 A;  4F2R A;  7ICJ A;  3BS5 A;  1SZP A;  4DEZ A;  1Z1B A;  1SV4 A;  1SXE A;  5KFK A;  3M9N B;  4EEN A;  2R8J A;  3N7P D;  4Y2X A;  3RB4 A;  1JN3 A;  2LPE A;  4MF8 A;  2FDR A;  2W8K A;  2BCR A;  1COK A;  3T5K A;  1U9L A;  5KFH A;  2KJ8 A;  3MGV A;  4B9S A;  1JAL A;  9ICB A;  4MF2 A;  1F44 A;  1RYR A;  8ICE A;  4DWI A;  3RJI A;  3UQ2 A;  2J6T A;  3F2D A;  2B6G A;  4F4W A;  4DSJ A;  1QQ6 A;  2P66 A;  3MDA A;  4I2G A;  3M6K A;  2BQU A;  1KTQ A;  1BPX A;  3ETL A;  5IIK A;  5DG8 A;  3M6Z A;  5KFR A;  1TK0 A;  3WK9 A;  2OEH A;  2ZG6 A;  5F9N A;  2PFN A;  2BCS A;  2JHD A;  1NZB A;  1Z1V A;  2W11 A;  9ICT A;  3IP4 B;  4OJO A;  2QB0 A;  4Z6D A;  4QZF A;  2HDO A;  3MBY A;  4KLT A;  4Q8F A;  2FI1 A;  2NO4 A;  5K4L A;  3ISD A;  3OHB A;  1AQ6 A;  4NXZ A;  4RQ1 A;  2YY6 A;  3C1Y A;  3V7L A;  4DLE A;  3PW2 A;  1X2I A;  1NOM A;  5AKH A;  4DF4 A;  3TQ1 A;  5KFD A;  1M6Y A;  1ZD3 A;  1FIQ A;  4ECS A;  5L1K A;  2RQ5 A;  4UAR A;  2G09 A;  3KBB A;  2K8B B;  5L1M A;  2E1F A;  5J0P A;  3JPS A;  4Y2J A;  8ICY A;  4IC9 A;  1SL1 A;  4BJQ A;  9ICC A;  1ECW A;  2ZUD A;  1NI3 A;  3QU5 A;  4ELT A;  4KLS A;  2W3S A;  5KT2 A;  4UAY A;  4NLK A;  3F5E A;  2E8M A;  3ORY A;  4OCZ A;  5AM1 A;  3TAP A;  2KZZ A;  2F76 X;  4YR2 A;  1N2X A;  4BDP A;  2LM1 A;  2VKQ A;  1XU4 A;  3AM9 A;  2XY5 A;  5III A;  3ICX A;  4DLG A;  4QZC A;  2QAR A;  4RT2 A;  5KT3 A;  3RJK A;  2LYA A;  2KSO A;  4RQM A;  4O5E A;  5AK4 A;  3SD7 A;  5HR7 A;  2AHO B;  4XA5 A;  5DGB A;  1SV0 A;  4I2B A;  4UW9 A;  2G08 A;  4OJP A;  1BPY A;  3PVX A;  5ALO A;  1L7P A;  7ICQ A;  2KJ9 A;  2E8P A;  1S5L U;  5L9X A;  4F5R A;  2LI6 A;  3RFA A;  2ISO A;  3MR2 A;  5C0Y A;  2J6U A;  5JUM A;  4QZG A;  2RRD A;  1K1S A;  3CRX A;  5JU5 A;  4KLJ A;  3BQ2 A;  2D8C A;  4EEK A;  8ICQ A;  2F1H A;  4F4K A;  5KFC A;  4PHE A;  3HT3 A;  1PK1 A;  3WK5 A;  2ZJ5 A;  3ETR A;  4GXJ A;  2BCQ A;  3K1R B;  1RM6 C;  5JTI A;  4DFM A;  3BQ0 A;  1D9D A;  1YZ6 A;  4PHA A;  8ICM A;  5HR6 A;  1HUO A;  3PO4 A;  3SV3 A;  4EBC A;  3HIL A;  5KT6 A;  2C2R A;  3NRW A;  3RR7 A;  4IL6 U;  1B22 A;  4G3I A;  1IV8 A;  4M0A A;  3I76 A;  3RF9 A;  1ZQU A;  5CB1 A;  5J8Y A;  3UXP A;  4LZG A;  3KZX A;  4PHP A;  1ZD4 A;  3FDS A;  2XI9 A;  2JEF A;  8ICZ A;  1V85 A;  1NJX A;  2OXO A;  1OW5 A;  4LZD A;  1UQV A;  7ICO A;  4YXJ A;  4O5K A;  4KLI A;  7ICG A;  4US9 A;  1LKY A;  3B0Y A;  3IN5 A;  4P0Q A;  1B43 A;  5CA7 A;  4FBU A;  2V4R A;  1ZQD A;  2G06 A;  5AK3 A;  4M9G A;  2O6K A;  4Y2P A;  1NKE A;  1UA1 A;  4QZ8 A;  5ALL A;  1TKD A;  4QJF B;  4IR9 A;  1PK3 A;  3FC4 A;  5BPC A;  9ICW A;  1X9S A;  4IQV A;  1KLN A;  2D6F C;  2H3I A;  5AK6 A;  2W8L A;  5KFF A;  1JIH A;  5AKG A;  1XSN A;  7ICS A;  3GIM A;  4RQ2 A;  5AIC A;  2RP5 A;  2A1J A;  4F2S A;  5J0Q A;  8ICK A;  2KEY A;  2DPJ A;  5L1L A;  3V6J A;  1PUZ A;  1NZP A;  4R8U A;  2KIW A;  2QKQ A;  1K1Q A;  2BDU A;  3TAC B;  3RJG A;  3T5H A;  2PXI A;  4QIW F;  1S9F A;  2YMM A;  3EWA A;  1A77 A;  1ZXI A;  4KLM A;  3OPX A;  3LWM A;  5KG4 A;  4ECT A;  2DL0 A;  1SWW A;  2UVR A;  4LJX A;  1QQ5 A;  4EEY A;  2R8I A;  2KVS A;  2V9W A;  5J2E A;  1P7D A;  2K4P A;  4KLH A;  1XS9 D;  1UT5 A;  2KK0 A;  1MQ2 A;  2ALZ A;  3RRG A;  4KLD A;  4FZM A;  4ED2 A;  3KHG A;  2K8C B;  3C2M A;  1C7Y A;  3C1Z A;  1DOQ A;  2ZIV B;  4DO9 A;  3MFI A;  4M9J A;  4O3P A;  2JEG A;  1ZQV A;  3ZDB A;  2ASJ A;  2J6S A;  1ZYQ A;  2MUT A;  4F4X A;  4DSL A;  2ZIW B;  3WKE A;  1CUK A;  1UA0 A;  2WF9 A;  4TUQ A;  9ICQ A;  4YVZ A;  5ALI A;  4MFC A;  5AKX A;  5ALK A;  4UB1 A;  1Z00 B;  3RB6 A;  4JV0 A;  2QLT A;  3TKA A;  1QSY A;  2LYH A;  1MQ3 A;  1WWU A;  4GXK A;  3KD3 A;  4M47 A;  2ZIX A;  4Z6E A;  1ZQT A;  5J0O A;  4DFK A;  2XY6 A;  4FO6 A;  3E58 A;  1U48 A;  5GTH U;  3FYH A;  3JPT A;  1KKX A;  3PW5 A;  1COO A;  4TUP A;  2KIC A;  5F9L A;  3HKZ F;  2HBL A;  4DL7 A;  3SAF A;  2YTU A;  4QW8 A;  5KFM A;  3HWT A;  1URJ A;  3OTQ A;  4J9L A;  3UQ0 A;  3RAX A;  4I2I A;  2W9C B;  2HHQ A;  1SKS A;  2Y1I A;  4UB3 A;  4I2H A;  2A3V A;  3E2E A;  1L5U A;  1X6J A;  1RXW A;  5KFX A;  3WK4 A;  3KHR A;  3LYS A;  1YZ7 A;  4UAT A;  4P2H A;  4XRH A;  2XGP A;  1LB2 B;  4KLQ A;  3PX4 A;  4CDG A;  2UVU A;  3TAQ A;  5B5E U;  5JRT A;  4UB6 U;  5J2K A;  3BQT A;  5J0T A;  4DOB A;  1S0V A;  2GO7 A;  2ZUC A;  4RQ6 A;  3QU4 A;  4F72 A;  1RXV A;  2ODG A;  1X9W A;  5AM0 A;  4KMU A;  1ZQM A;  2F3N A;  5KG3 A;  3RB0 A;  5KFO A;  2JMG A;  5KFI A;  2G5H B;  2WB1 C;  1Q3V A;  4RNM A;  5EWF A;  3H8S A;  4DQS A;  3HRD D;  2OYY A;  4UBB A;  1ZQB A;  5J2B A;  1KFS A;  2JEI A;  4B9L A;  1S76 D;  5AM5 A;  4F93 B;  4YR3 A;  1L7M A;  2F1J A;  4F5Q A;  5DB7 A;  3PW4 A;  2KFZ A;  2HOF A;  3AEV A;  2DPI A;  3NGD A;  2GLE A;  3EZ5 A;  8ICJ A;  1H38 A;  5AM4 A;  4K4G A;  4ED0 A;  4GLX A;  2YB1 A;  4CF5 A;  4YQW A;  4C0Z A;  1J2M A;  4ED1 A;  8ICN A;  3B0X A;  4Y2R A;  3UM9 A;  3HP6 A;  4CE6 A;  3E0F A;  4C4S A;  1Z3E B;  3EYZ A;  3EUB 2;  1X66 A;  4XQ8 A;  3LDA A;  3Q8P B;  3NUQ A;  1XC9 A;  3GIL A;  8ICC A;  4IS7 A;  4RQ8 A;  1UT8 A;  4YG2 A;  2C28 A;  2N1R A;  2KP7 A;  3C23 A;  4UAS A;  4KN4 A;  3PW0 A;  4KLG A;  2AGP A;  2BQ3 A;  5HNK A;  5KFT A;  3QU9 A;  3QUT A;  2HVH A;  4QWE A;  1RYS A;  3L5K A;  5ALS A;  2EAN A;  2IHN A;  4C4R A;  2F8K A;  2W9B A;  1ZQJ A;  1NKB A;  2W7O A;  2ZXI A;  3SMV A;  1NJZ A;  3BDP A;  4ED8 A;  4F5N A;  4F5O A;  7ICM A;  5AKK A;  1V97 A;  3RJF A;  4C7Y A;  3GIJ A;  1ZD2 P;  5HMM A;  5TIS U;  3OSP A;  4PGY A;  1N5X A;  3V6K A;  4M6W B;  2L5Y A;  3PX6 A;  3PZP A;  4DSI A;  7ICT A;  2KG5 A;  4C8N A;  4MFF A;  3BS5 B;  7ICI A;  1JRO A;  3B9J A;  3PW7 A;  7ICV A;  1N56 A;  8ICO A;  3N7S C;  2PFQ A;  4UB2 A;  4YMN A;  1RG6 A;  2FMS A;  3IRU A;  4NLG A;  8ICB A;  5ALN A;  1DRG A;  5EE1 A;  3H7I A;  3J81 j;  1LV5 A;  9ICI A;  5AI4 A;  1CEZ A;  4J03 A;  4QZH A;  8ICI A;  4UB5 A;  4O3S A;  4OD0 A;  2KE7 A;  2DGZ A;  3QEA Z;  2ZIU A;  5KL1 B;  5G5G A;  5KAI U;  3QNM A;  1TFR A;  5ALW A;  2PKE A;  1BVS A;  5J2J A;  5J2H A;  5IIJ A;  5ALQ A;  1X6I A;  1NJW A;  3MGH A;  1U49 A;  4PZN A;  1O03 A;  8ICR A;  1L7O A;  2ZTC A;  1SIJ A;  2KKP A;  2F2A B;  3HX0 A;  1BNO A;  3QEB Z;  2QB0 B;  1NK7 A;  3PR5 B;  2BDP A;  2F44 A;  4U7C A;  1A6S A;  2IHM A;  1C20 A;  2DBY A;  5DB8 A;  4U6P A;  2EZY A;  2PI5 A;  3MR3 A;  3PSF A;  1T3N A;  8ICH A;  4BWM A;  4PJ0 U;  3KKA C;  1B0X A;  5KT4 A;  4QWA A;  1TVA A;  4PL1 A;  2YML A;  1SKW A;  1QCK A;  1NK5 A;  1N48 A;  3VCB A;  4ELU A;  2JGA A;  4QWC A;  3NVY A;  2VJ5 A;  5T14 A;  2JH1 A;  3H0L B;  1L3T A;  5AKY A;  3DEE A;  2WAQ F;  3KHH A;  4Y2U A;  2DF4 B;  3H8W A;  4AP9 A;  4O5C A;  2K89 A;  2HHX A;  4DSK A;  2Y9U A;  5J29 A;  4F4Z A;  2LBO A;  3JPN A;  3C2K A;  4ACO A;  1OUQ A;  1KRP A;  4ICA A;  4DF8 A;  1RZT A;  3BS7 A;  2VIX A;  1QQ7 A;  2KV2 A;  1L3U A;  2HHU A;  3MGI A;  2DFL A;  3ZD8 A;  2Y0S F;  5E79 U;  1OXJ A;  4QZB A;  2JRZ A;  1XNS A;  4CCH A;  2BPC A;  2IOF K;  2VA3 A;  3N7R C;  1HJP A;  2DWQ A;  2R18 A;  3PMN A;  4QZD A;  4MFA A;  3KFU F;  4DL3 A;  3M8S A;  1CRX A;  1ZJM A;  2B21 A;  3AU2 A;  5HHH A;  5D4B A;  4ECV A;  2UVW A;  1KW4 A;  4MEX A;  3D2N A;  2FMQ A;  4GXI A;  1NJY A;  2E5S A;  2KOB A;  4Y2Y A;  4JUZ A;  1JXE A;  3SV4 A;  4BX9 C;  4NL9 C;  4A8E A;  3PSI A;  2NRV A;  4DL6 A;  2H3Q A;  3QXG A;  1ZQE A;  1L8L A;  4ZH4 A;  4Z6C A;  5AKJ A;  2BGW A;  1TAM A;  3H8J A;  1XSL A;  4NM1 A;  5AKE A;  2AGQ A;  5D49 A;  4J9N A;  1UHU A;  4YMM A;  4OJ5 A;  5EWE A;  2YMP A;  3SZ2 A;  4FZN A;  5KFN A;  2F77 X;  5DLF A;  4E0D A;  2B0C A;  1ZQR A;  7ICP A;  5KG6 A;  2OM6 A;  4USA A;  1KSP A;  2FPK A;  4TQS A;  3TAD C;  2KKV A;  4KIT B;  8ICU A;  3JPP A;  1BGX T;  2JZB B;  2WF7 A;  5CEH A;  2Q4T A;  1IXR A;  5EE0 A;  5AK5 A;  4C8L A;  1BPB A;  2AXT U;  1TE2 A;  2DQN B;  5G5H A;  4DS4 A;  4F71 A;  1T8E A;  2K8A A;  2ASD A;  4UAU A;  3ZD9 A;  3T3F A;  2Q0Z X;  3GU3 A;  2HI0 A;  4J9S A;  1MA7 A;  4IRC A;  2JEJ A;  1LKY B;  3G6V A;  1ZQO A;  1WCN A;  3SAG A;  4CF3 A;  2YX8 A;  1N60 A;  4J9P A;  1TK8 A;  5CRX A;  3NVZ A;  2IOF A;  2A1A A;  5ALU A;  1RPL A;  1ZQP A;  3IV6 A;  5CP2 A;  4ECZ A;  4G9B A;  2M9N A;  4B9V A;  1UPH A;  1ZOL A;  3QU7 A;  2ESE A;  2G0A A;  2NRW A;  3M8R A;  4DQQ A;  4DQI A;  3H40 A;  1ZQK A;  4O3O A;  3F2C A;  5J0R A;  3AL0 B;  2PMZ F;  3G6X A;  5ALV A;  1ZQQ A;  2A1J B;  1QSS A;  5ALP A;  1S77 D;  4FFD A;  4R8U B;  4B9T A;  2HW3 A;  1FFU A;  5FP0 A;  1ZQX A;  3VC8 A;  2VA8 A;  2PFO A;  3JPQ A;  3RR8 A;  4CRX A;  4M04 A;  1PVP A;  1CI4 A;  4TUR A;  5A0L A;  4Y2S A;  2HHV A;  5KFA A;  8ICW A;  3CNH A;  2JV3 A;  3NVW A;  3UMG A;  4YFK A;  1FFV A;  2KHV A;  3NVV A;  3HJE A;  4KX3 A;  2PI4 A;  2IBK A;  5J2I A;  2P35 A;  2HHS A;  2JXJ A;  4DCC A;  2LYB A;  3ZDD A;  1KN5 A;  2W54 A;  4M9N A;  2LKY A;  2NRT A;  2RDI A;  1VJ5 A;  4R64 A;  1V38 A;  2EZX A;  2BCV A;  2IA6 A;  9ICM A;  4GIB A;  4HYK A;  2W04 A;  3C28 A;  1A76 A;  3PY8 A;  4BWJ A;  2MRL A;  2RDJ A;  3UXN A;  8ICP A;  3PX0 A;  3QUQ A;  2FLP A;  2EQY A;  2W7P A;  2WHE A;  3C2L A;  3MAB A;  3F5A A;  3ONN A;  4C80 A;  1EXN A;  3AN1 A;  4P4P A;  1QH9 A;  1L3S A;  1PZN A;  3N4M B;  5KFG A;  1IG6 A;  3AQE A;  3OGU A;  3KTQ A;  4QWB A;  4QIW C;  4OJ6 A;  4QZ9 A;  2ZIX B;  5DB9 A;  4UAV A;  4JK1 A;  2WB1 F;  2OHF A;  4DOC A;  7ICH A;  3RJH A;  9ICF A;  1NK0 A;  3TFR A;  1SXD A;  5KFQ A;  1DK2 A;  4NLN A;  4YN4 A;  1WYG A;  4NY8 A;  7ICE A;  1RQL A;  2Y9T A;  4KLF A;  1VLB A;  3K1Z A;  5KTQ A;  5KG7 A;  3TI0 A;  4R63 A;  5KFB A;  1ZQY A;  5DG7 A;  2V4Q A;  5AKZ A;  3CP8 A;  4GC7 A;  7ICL A;  9ICO A;  3RAQ A;  9ICE A;  4I2A A;  1S8O A;  4NLB A;  1TAQ A;  3T79 A;  2F1I A;  1ZRN A;  4FS1 A;  2EAP A;  2RLT A;  3V7J A;  2KZ3 A;  2ASL A;  5KFZ A;  2XVT A;  1SV0 C;  3O0F A;  2AU0 A;  1MN8 A;  1NK8 A;  3NAS A;  3AU6 A;  1PVR A;  1SKR A;  1Z4O A;  3WKA A;  4DQP A;  7ICK A;  3Q8R B;  4OO1 J;  3RBE A;  8ICF A;  1QLN A;  5IIL A;  2GOL A;  1N61 A;  1NK6 A;  2XGQ A;  4PH5 A;  4I2J A;  1ZQC A;  4F91 B;  1LVH A;  3K75 D;  3HW8 A;  3MDC A;  1J97 A;  4M9L A;  3LVV A;  1HIW A;  2E8O A;  5KFW A;  4ECW A;  3Q8L A;  9ICH A;  2QB1 A;  1F5S A;  4RQ5 A;  2IMW P;  5BOL A;  4RPY A;  2WF6 A;  3RJE A;  3GIK A;  7ICU A;  1WWV A;  1Q8K A;  5H2F U;  4RT3 A;  3HKZ C;  5HML A;  5J2D A;  2K60 A;  2HBM A;  4B9M A;  2KN7 A;  4F8R A;  4RPX A;  3A0B U;  4YXM A;  3KZI U;  5CWR A;  3FAH A;  2NRZ A;  5DDM A;  5J8Y C;  4P0P B;  4I2F A;  1NK4 A;  1Q46 A;  2FPM A;  4J9Q A;  5KNI A;  3PV8 A;  3BQ1 A;  2P6R A;  2H3F A;  4RQN A;  2KVC A;  4PL2 A;  4F50 A;  1ZJN A;  5IIN A;  3GFK B;  2BR0 A;  3WKD A;  4J9M A;  2NV3 A;  2H3Z A;  8ICS A;  3QZ7 A;  5ALY A;  9ICP A;  1T3Q A;  5AKL A;  3WK7 A;  4DQR A;  4O3N A;  4O0I A;  4YCX A;  5KFE A;  1BNP A;  4JWM A;  1Y88 A;  3UXO A;  4FE3 A;  1SGG A;  2PFP A;  2WF5 A;  2FLN A;  4Q8E A;  2EH9 A;  4EYH B;  3AMZ A;  2OCE A;  4US8 A;  1ZQI A;  2DKZ A;  2BZF A;  3CW2 C;  2YB4 A;  2EAM A;  1ZQW A;  4GC6 A;  3BZK A;  2HMX A;  4QW9 A;  5BOM A;  4Q43 A;  4KLL A;  3H4B A;  1T94 A;  5DBC A;  2ZTD A;  2E8N A;  2GH1 A;  1IM4 A;  4BXO B;  3RJJ A;  5B66 U;  3ISC A;  3SYZ A;  4UBC A;  2NO5 A;  4ELV A;  4O9M A;  2W9A A;  3ISB A;  3T5L A;  4IQU A;  1K5O A;  1U47 A;  4EBE A;  8ICT A;  2EZZ A;  2ZUB A;  3IG5 A;  3QZ8 A;  2NYV A;  4K4H A;  4QWD A;  5J0S A;  3GZF A;  2ATL A;  2ZJA A;  1L6N A;  5AI9 A;  2FMP A;  5KFV A;  4CNQ A;  4R65 A;  4ECY A;  1ZQL A;  2KFN A;  2K4H A;  3F53 A;  4TUS A;  5HHI A;  3ED5 A;  1HUZ A;  2XCA A;  1KBU A;  2Z7J A;  5ALR A;  4YD1 A;  3HPO A;  5KFL A;  1MSW D;  2FPL A;  4RQ4 A;  4UAW A;  9ICS A;  5J0U A;  5ALH A;  3DDH A;  3RH6 A;  9ICA A;  4C8O A;  1WG8 A;  5TZV A;  2BCU A;  4J9O A;  4AYB C;  4RZR A;  2AQ4 A;  2WTF A;  5ALG A;  5L1J A;  4IRK A;  2M0N A;  7ICR A;  3OJU A;  8ICL A;  5ALZ A;  5J2F A;  2XO7 A;  1ZQS A;  2ZIU B;  4ZOH C;  2XCP A;  4ED3 A;  4EX7 A;  3Q8Q B;  3R9K A;  4Q45 A;  3BQ7 A;  1JI7 A;  1Z4N A;  2UVV A;  4LVS A;  4NJ8 A;  1BPZ A;  2GWS A;  4I29 A;  3IG8 A;  3K4G A;  2R8H A;  4F3O A;  1A0P A;  2XIC A;  4RPZ A;  4EBD A;  2K4I A;  1WUD A;  2Y1J A;  3N28 A;  1L3V A;  4JB3 A;  4CGZ A;  1SL0 A;  2HOQ A;  4FS2 A;  1N63 A;  5DGA A;  5EWG A;  3C5F A;  3BJY A;  3DV9 A;  3RTV A;  3QX7 A;  4QZI A;  3SQI A;  4TQR A;  5IIO A;  4KLO A;  9ICJ A;  4NM2 A;  4PGQ A;  3D2S A;  1T4G A;  4FZL A;  1DXS A;  3A0H U;  3WK8 A;  4I2E A;  1ZQG A;  4NWI A;  2MAX A;  3D2Q A;  2KZM A;  4PHD A;  9ICL A;  4GFJ A;  4C7Z A;  5CHG A;  3GQC A;  2AJQ A;  4KMO B;  3PR4 A;  3PSP A;  4KX5 A;  1NNL A;  2BQR A;  2I5H A;  2W9M A;  2XID A;  4PPX A;  1S0O A;  2WF8 A;  5J2C A;  5AIA A;  1X42 A;  3JPR A;  4J9K A;  4M9H A;  3RH4 A;  1KDH A;  4Y2V A;  5IIM A;  4DL2 A;  1KFT A;  4DOA A;  2YN4 A;  3NS1 A;  1XO0 A;  5EOZ A;  5KFP A;  1JXL A;  4X5V A;  5DQG A;  3KHL A;  4F92 B;  1IIP A;  1S0M A;  2QAR B;  2KSO B;  2WFA A;  1SZH A;  1S97 A;  1N5W A;  4DFD A;  2OH2 A;  7ICN A;  3EW9 A;  4BUG A;  5ALF A;  4P4O A;  4KLE A;  3NTU A;  2HCF A;  4NLC A;  5AHX A;  1SB3 C;  1X40 A;  3H8M A;  4EX6 A;  1PK1 B;  2BHN A;  5J2G A;  1ED1 A;  4NV0 A;  4KTQ A;  1PVQ A;  4Z6F A;  2WAQ C;  1L8O A;  4YD2 A;  4QZE A;  2XY7 A;  4ECQ A;  4B9N A;  3C21 A;  2LMR A;  2KMD A;  2H5X A;  2ZTE A;  4RUA A;  3RH5 A;  5ALD A;  2ES6 A;  1U4B A;  4RQ7 A;  2ZXH A;  2Y0S C;  3SI8 A;  4O3Q A;  3GV5 B;  1NKC A;  2EDU A;  3KOO A;  5ALT A;  2NRX A;  9ICN A;  4XUS A;  2KIV A;  3UMB A;  5D46 A;  1GO3 F;  1D8B A;  3EPI A;  4IQW A;  3C29 A;  1Z19 A;  2JZB A;  5GTI U;  4RNN A;  4DSE A;  5ALJ A;  1D8Y A;  2W43 A;  4Y2T A;  5C5J A;  5J2A A;  2G07 A;  4DS5 A;  3I1Y A;  3RBD A;  1FO4 A;  4P0Q B;  5EE3 A;  4RNO A;  5AI0 A;  3GII A;  3RB3 A;  1BPD A;  1TV9 A;  2RHF A;  5ALM A;  5DKW A;  4ED7 A;  3PO5 A;  4DL5 A;  1ZQ1 C;  2KJ5 A;  2OWO A;  3TAR A;  2HBJ A;  1XO1 A;  5AI8 A;  2BPF A;  5L1I A;  4ECR A;  1JUD A;  2W03 A;  3OHA A;  5DG9 A;  3LWL A;  4QNL A;  1ZQF A;  8ICG A;  2IOH A;  5KFY A;  5DBA A;  2AGO A;  2C2D A;  2F8L A;  3QUB A;  5ALX A;  1U45 A;  2E3T A;  5KFS A;  1ZD5 A;  3QU2 A;  1ZQZ A;  3C5G A;  1V9P A;  2EAO A;  3M7D A;  4JV1 A;  5KAF U;  4EEL A;  2FLL A;  1HEK A;  5KFJ A;  3WU2 U;  1B4F A;  3I28 A;  4IQT A;  7ICF A;  3CYM A;  3SEN A;  3Q8K A;  4HAI A;  3SAH A;  2MA1 A;  4DL4 A;  2YQE A;  4MHV A;  2KD1 A;  5KT5 A;  4YR0 A;  3MFH A;  5KL8 B;  4EZ9 A;  5DBB A;  2HBK A;  1KQQ A;  3UPQ A;  4RU9 A;  5KFU A;  5CR0 A;  2ZIV A;  1RYU A;  1DGS A;  3ZI4 A;  3D6J A;  3SR6 A;  3UMC A;  5AI6 A;  4K4I A;  4CF4 A;  5KG5 A;  5KG2 A;  3QUC A;  4Q44 A;  4YP3 A;  2C22 A;  3Q8M A;  2ZIW A;  2MUT B;  2BPG A;  2YMQ A;  3WKB A;  3FM9 A;  4I2D A;  1JMS A;  3Q8S B;  3MR5 A;  9ICG A;  4JV2 A;  3PML A;  1ZQA A;  4YMO A;  2VAN A;  2HSZ A;  1ZRM A;  2CPR A;  5DDY A;  2PMZ C;  3ZDC A;  1Z00 A;  2E1E A;  5KG0 A;  4MEY A;  2MSN A;  3NRZ A;  5J0X A;  9ICX A;  1NK9 A;  1D8L A;  2C2E A;  2HOI A;  2MU2 A;  2FE9 A;  5DB6 A;  4RQ0 A;  3AQF A;  4IR1 A;  4KN7 A;  3RRH A;  1T7P A;  4NLZ A;  2AQ0 A;  3TFS A;  2G5I B;  4JWN A;  3KKA A;  4P4M A;  4M2Y A;  5AKI A;  2R8K A;  4DFJ A;  3ALR A;  2R8G A;  3F2B A;  2CRX A;  9ICR A;  2ZJ8 A;  2D3D A;  4C8M A;  4R66 A;  1L7N A;  2W3R A;  4B6J A;  4WJ3 B;  4IRD A;  2K4E A;  3U26 A;  2P6U A;  1KFD A;  3AUO A;  4I28 A;  1Q3U A;  2W9C A;  4FBT A;  1QTM A;  5KT7 A;  3H4D A;  4RQ3 A;  3H0R B;  4OJL A;  1XWL A;  2HVI A;  8ICV A;  5EE9 A;  1RQN A;  3GV8 B;  2I6X A;  2I1Q A;  5DLG A;  2JH7 A;  3MR6 A;  3V72 A;  2XC9 A;  4O3M A;  1MC8 A;  4UB4 A;  4DSF A;  4EZ6 A;  1S0N A;  4I27 A;  1TAU A;  5CJ7 A;  3IDW A;  3IHQ B;  1ZET A;  3N97 B;  4UB8 U;  1TK5 A;  1DGJ A;  1J2N A;  4PGX A;  3LVW A;  5HP4 A;  9ICV A;  1KL9 A;  2DKX A;  2AH5 A;  1FEZ A;  4KLU A;  5ALE A;  2KNJ A;  5DQI A;  3V7K A;  4O3R A;  3S6J A;  2HHT A;  2A19 A;  5AIB A;  4NL9 A;  3IM1 A;  1ZQH A;  1JRP A;  3BZC A;  3PST A;  5J0Y A;  3M9O B;  4BGD A;  2W55 A; 
#chains in the Genus database with same CATH homology
 3KKA C;  2FE9 A;  1V85 A;  1B0X A;  3BQ7 A;  1JI7 A;  2LPE A;  1OW5 A;  2F3N A;  1COK A;  3SEI A;  2E8M A;  1UQV A;  1SGG A;  3KKA A;  4NJ8 A;  1LKY A;  2JV3 A;  2DKZ A;  1X9X A;  2D3D A;  2EAP A;  2L5Y A;  2EAM A;  4PZO A;  1X40 A;  3H8M A;  3TAD C;  2KG5 A;  1SV0 C;  1PK1 B;  2B6G A;  3BS5 B;  5F3X B;  2Y9U A;  2EAO A;  2QAR A;  2KSO A;  4RQM A;  3TAD A;  1RG6 A;  1SV0 A;  1PK3 A;  1WWU A;  2E8N A;  3BS7 A;  2LMR A;  1V38 A;  2KMD A;  2GLE A;  1B4F A;  2E8P A;  1OXJ A;  1Z1V A;  2ES6 A;  2QB0 A;  3SEN A;  2E8O A;  1F0M A;  4MHV A;  1LKY B;  1DXS A;  2QB1 A;  5JU5 A;  2KE7 A;  2KIV A;  2QKQ A;  2D8C A;  1PK1 A;  2YTU A;  1WWV A;  3TAC B;  3K1R B;  3IDW A;  5JTI A;  1X66 A;  1KW4 A;  2K60 A;  2DL0 A;  2ESE A;  1UCV A;  4IS7 A;  4PZN A;  2K4P A;  4NL9 C;  2DKX A;  5J8Y C;  2QB0 B;  3HIL A;  1SXD A;  3BS5 A;  5KNI A;  5L1M A;  2F44 A;  4RQN A;  4NL9 A;  5J8Y A;  5JRT A;  2QAR B;  2KSO B;  2EAN A;  2Y9T A;  1SV4 A;  1SXE A;  2F8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...