5JTIA

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
LDMNISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jtiA00
3IDWA 1Z1VA 2YTUA 2ES6A 2K4PA 3KKAC 4RQMA 2EAMA 4RQNA 1PK1A 4NL9A 4NL9C 1KW4A 1V38A 1OW5A 1B0XA 1V85A 1JI7A 2F44A 1X66A 3BS5B 3SEIA 2QARA 2QB0B 1B4FA 5JTIA 2JV3A 1RG6A 2EAOA 3K1RB 2DKZA 5J8YA 1X9XA 4PZOA 2QB1A 1UCVA 2DKXA 5KNIA 3HILA 2KMDA 2K60A 3BS5A 5F3XB 3H8MA 3TACB 1SXEA 5L1MA 5JRTA 1LKYB 1WWUA 2E8MA 2ESEA 2E8PA 2EANA 2QB0A 2KIVA 1SV4A 1SGGA 1OXJA 2E8NA 2L5YA 1DXSA 2KG5A 2F8KA 1SXDA 1F0MA 5J8YC 4MHVA 2Y9UA 3BS7A 2D8CA 1SV0A 1SV0C 3TADA 2KSOB 3TADC 3BQ7A 5JU5A 1UQVA 2E8OA 2B6GA 2EAPA 2DL0A 2F3NA 1PK1B 1WWVA 3KKAA 1LKYA 1X40A 2QARB 4IS7A 3SENA 2KE7A 2LPEA 2Y9TA 2D3DA 1COKA 2GLEA 2LMRA 4NJ8A 1PK3A 2FE9A 2KSOA 2QKQA 4PZNA
chains in the Genus database with same CATH superfamily
5JUMA 2JH1A 2IBKA 3H0LB 3OJSA 4DLGA 4B6JA 3KKAC 4ECSA 2EAMA 1Z3EB 4NL9A 4F91B 8ICUA 4NL9C 5KFPA 2IMWP 3WKBA 8ICBA 1ZQBA 2ZUDA 2ZTDA 3JPPA 1KN5A 4NLNA 4M47A 2RQ5A 1L8OA 1AQ6A 4JK1A 4DQSA 2F8LA 2LM1A 4YVZA 2DFLA 4J03A 3TANA 4EX7A 3QU4A 4QZAA 5AI8A 2WTFA 3MDAA 4DQRA 4I2EA 1UCVA 4ED1A 3SV4A 4KMUA 2HOFA 4MFCA 8ICXA 1UA1A 5KFRA 4F4YA 9ICWA 4O0IA 4ED6A 5JRTA 4B9UA 3NUQA 5TISU 1B22A 7ICLA 2MA1A 4EYHB 1DGSA 2G09A 2BPFA 4KLTA 3AMZA 4QJFB 2W9BA 2VANA 1QSYA 3HPOA 2H3ZA 5ALTA 4F2RA 3PV8A 3WK4A 2FLNA 3RB4A 3QZ7A 7ICRA 7ICNA 4IRKA 2MUTB 4DL5A 4P4PA 2B6GA 2EAPA 1A6SA 5EWFA 2ZJAA 3M8SA 4FZMA 4YR2A 3GDXA 5KFBA 1A77A 2KJ9A 5IINA 1X40A 4YR0A 5AICA 1HUOA 5KT3A 2F1JA 1KFSA 5KFQA 2XO7A 8ICOA 5D4BA 3PW0A 1ZJMA 4DF4A 2VA8A 1SIJA 3M9OB 4PJ0U 2A1JB 2MSNA 3SYZA 4NLGA 2ZIWB 3G6VA 1MQ3A 2LBOA 1KW4A 2OH2A 5ALUA 1JI7A 4JWMA 2ISOA 2KD1A 1TAMA 2KJ8A 1BPBA 9ICCA 1IXRA 4RU9A 2K8AA 1UT5A 7ICGA 9ICIA 1MN8A 2PKEA 4DSIA 4ECZA 5J8YA 3RH4A 2FMQA 2QB1A 3Q8QB 4O3NA 1JUDA 1D8BA 3NRZA 3ISCA 2PXIA 3QYPA 2HHUA 5IIKA 2WAQF 2KICA 3BS5A 4FBUA 4BDPA 2W04A 2PMZF 2H3FA 1L3UA 1WWUA 3F2CA 3Q8LA 3C2LA 5AIBA 1CI4A 1X2IA 3ISBA 1NK7A 2W8KA 5CJ7A 4F4ZA 1K5OA 4EZ9A 4F50A 4MHVA 1T4GA 3BS7A 1MA7A 4F3OA 4BXOB 2KN7A 3GIIA 3QUQA 2RLTA 4KLMA 2HBLA 8ICMA 4B9VA 1NJXA 2KZMA 2FI1A 4I2JA 1SKWA 3QU9A 5EE1A 1SKSA 4GXKA 1XO0A 3HWTA 4DL7A 4ELUA 4GC7A 4Y2VA 4B9MA 2R18A 9ICSA 5AKLA 1ZD4A 4R63A 2DWQA 3UQ2A 2D6FC 3T5KA 8ICKA 3QU7A 1Y88A 4WJ3B 5AKHA 2QB0B 3NGDA 1VLBA 5KFLA 3ZDAA 5F9NA 3RBEA 5DG7A 5IILA 4TURA 4C8KA 3WK8A 3F2BA 5J2CA 7ICQA 1FO4A 2ISPA 4Q45A 3RRGA 2RDIA 1JXLA 1S5LU 5CR0A 2R8KA 3JPNA 1N5XA 4RNOA 2JEFA 8ICSA 3H8WA 2G5IB 4KLOA 2UVRA 5KFIA 2NYVA 3KOOA 4C7ZA 4FE3A 5L9XA 3TACB 2KFNA 5AM2A 3DV9A 3SQIA 5AKEA 5DLGA 4MF8A 1XO1A 5ALMA 4US8A 2KK0A 3VCBA 2H3IA 1NKCA 5KFHA 2G07A 3NTUA 5HMMA 3OSPA 5J0WA 4C8OA 3M9MB 1ZQZA 3PSTA 3ZD8A 3TKAA 5ALQA 1KBUA 4KLIA 3GILA 2R8GA 2H3VA 4RQ4A 5DQIA 7ICKA 2N1RA 2LYBA 2W03A 5ALPA 3ED5A 1GO3F 3RJJA 7ICVA 2ZIUA 4M9JA 1L3SA 4UW9A 4QZEA 4U7CA 4YXMA 4DWIA 1ZOLA 2YX8A 1U49A 1D8YA 4LJXA 4UB4A 2EZYA 2Q0ZX 5CRXA 1T3NA 3MR3A 2FLPA 1NJYA 3HT3A 4J9SA 1PK1A 4PHDA 2YMPA 4I2HA 2MAXA 5J2KA 3SEIA 3O0FA 5KFTA 3OHBA 3MBYA 2ZTCA 2RHFA 7ICJA 5J0QA 3TAQA 2XI9A 3H7IA 5KG6A 1ZETA 1SZHA 1WCNA 5H2FU 2M9NA 3K75D 5ALRA 4DL3A 5AKKA 2W3SA 4Q8FA 4QIWF 2KEYA 8ICVA 3Q8SB 1NK8A 5J2IA 1S0VA 3SI8A 3WKAA 4PHAA 5G5GA 3C1ZA 1ZQEA 2W7OA 5ALGA 4KLSA 2IHMA 4F5OA 4NM2A 1ZQSA 2ZIXB 3IRUA 3RTVA 2KG5A 4FZNA 8ICEA 3KHHA 2Y9UA 4UATA 3C2MA 5AHXA 3RJIA 4NM1A 1ECWA 4UAZA 3RH6A 2F1HA 3C28A 4TUPA 4F2SA 3BQTA 2IOFK 3RAXA 5CHGA 5KG1A 3C5GA 4GLXA 3WK9A 2OHFA 3UM9A 4RQ1A 4Y2SA 4AYBF 1SWVA 2Z7JA 1F44A 1V97A 4RQ5A 5KFKA 3ZDDA 1QSSA 4G9BA 5DLFA 1ZQIA 2B0CA 1RM6C 5DBBA 3BQ2A 2HHTA 5AK6A 1A0PA 1ZQVA 2YTUA 1XS9D 4NY8A 3RB0A 4R65A 1JALA 2KOBA 4GIBA 4F5RA 4TUQA 1X66A 4OJLA 4PGXA 2JEIA 2OEHA 4ECYA 2HCFA 2ZJ8A 3CW2C 2F77X 1N48A 4O3PA 1FEZA 5AM5A 2F1IA 1BPEA 4R64A 2JMGA 5AK3A 5KFNA 3K1RB 2EQYA 4HAIA 4PGYA 3HKZF 3GV5B 1S9FA 3PSPA 5DG8A 2WF7A 5J0TA 5A0LA 1CUKA 5KFEA 4BWJA 1BPYA 4QW9A 4I2CA 2JHDA 5KT5A 1RQNA 2ASDA 2F8KA 5KG7A 4NLKA 2W55A 4QZIA 1F0MA 3EPIA 3BQ0A 4RPZA 3QUTA 5AK5A 1KRPA 3RJKA 2HSZA 4DSEA 1ZQAA 3RR8A 2UVVA 3GIKA 3V7JA 3BQ7A 2KHQA 1D8LA 1UPHA 1X6JA 4ZH4A 3MFHA 3CYMA 1UQVA 3WKEA 4TUSA 5KFZA 4DFKA 3KZIU 2P66A 2UVUA 1U45A 1JIHA 5GTHU 2HVIA 5KG5A 3FM9A 4Q44A 2Q4TA 1Q3UA 2QARB 1ZQOA 1RXWA 3PW7A 1O08A 4J9PA 5ALEA 2D3DA 4IQWA 3QX7A 4ED7A 4KLHA 5KG3A 1O03A 3RFAA 4DFDA 1TVAA 3AQFA 2OWOA 1RXVA 3FC4A 4RZRA 3OHAA 4I28A 4PZNA 4JWNA 3H4BA 2G0AA 1C7YA 3EUB2 3WK6A 1ZQLA 3AUOA 5AM1A 4YMOA 1S76D 4M6WB 1OW5A 3H0RB 5IIIA 2DUYA 4BX9C 2DQNB 1VDVA 2W8LA 4EZ6A 2OXOA 2YMQA 1ZQYA 4FO6A 3ZD9A 3UMBA 2OYYA 1TKDA 5AKZA 4QWDA 8ICWA 3I1YA 4NWIA 5AK4A 1PZNA 2JZBB 2DKZA 3MGIA 2BKEA 5DBCA 2ZTEA 4C8LA 2XIDA 5E79U 4YQWA 4NLBA 4YR3A 2DKXA 7ICIA 1D9DA 3UMCA 4J9QA 1L7MA 2K60A 1HIWA 2PFNA 2AU0A 2JRZA 4P0QA 4IC9A 2E8NA 3GIMA 3NVWA 4XUSA 1RYUA 2A1AA 1ZQWA 4EEKA 2VA2A 5KFCA 3KHRA 4P0PB 4QZ9A 2IHNA 2M0NA 1CEZA 3JPOA 3DEEA 5AI5A 2E8OA 4Q43A 4LZGA 4DFJA 2NO5A 4YFKA 1ZQQA 4EYIB 3ZDBA 2BGWA 4CCHA 1ZQHA 1LV5A 2ALZA 2E3TA 2HBKA 2PI4A 1M6YA 4HYKA 4KN4A 4O5CA 3I76A 2Y0SF 5KG2A 3RF9A 4F8RA 3F5AA 8ICPA 1LVHA 5L1KA 3IDWA 5KTQA 3N7RC 2NRWA 5ALSA 1XSLA 1JROA 2FPLA 4R66A 7ICOA 2HDOA 2ZG6A 2HOQA 5J0PA 3RJHA 3T79A 2P6RA 1V38A 4IQUA 3PSFA 1IV8A 5TZVA 2WF8A 4UAYA 4KLJA 3GV7B 5CA7A 5J2FA 2UVWA 4Z6EA 4YN4A 4Y2PA 2VA3A 3N7SC 1QQ6A 2E5SA 4QZHA 2EAOA 2IOFA 2J6UA 4KLQA 4F93B 2JEJA 4DL2A 5HR6A 1L7NA 3KHLA 1ZQDA 3QUBA 2G08A 4PHEA 4QIWC 5KT6A 3N97B 4O3RA 3IN5A 1Q46A 1Q8KA 2H3QA 2GH1A 2ASJA 3BJYA 1AROP 5J2BA 1IM4A 4M9GA 1SGGA 1BPXA 3QU2A 5ALLA 3T3FA 1DK3A 4R8UA 3EWAA 3PSIA 5J8YC 3HP6A 4DL4A 2ASLA 4ECXA 1RPLA 3SD7A 2RRDA 3V7LA 2KSOB 1NZBA 1KFTA 1IG6A 4DQIA 3M7DA 3TI0A 1ZQ1C 2QLTA 4ZOHC 4EENA 2ZIVA 3SV3A 4RQ2A 5EOZA 1TK5A 4ECTA 4CDGA 3ICXA 4I2BA 4IL6U 1LKYA 1ZQXA 4DOBA 5KFSA 9ICXA 1JMSA 3RBDA 2KZZA 2BCSA 4QZFA 3NVZA 2GLEA 2I1QA 2G5HB 3H40A 1PK3A 8ICLA 4O3SA 1Z00A 2JR5A 2VJ4A 4UB8U 2XVTA 4F4WA 3OTQA 3B0YA 3GV8B 3HJEA 3TFSA 2KJ5A 5J0XA 3WK7A 2E1FA 1KL9A 5FP0A 1S8OA 1ZQKA 3RB6A 1V85A 4M6WA 3ALRA 2DF4B 5AI4A 1BNOA 3Q8MA 1BGXT 3KHGA 4DSKA 1ZRMA 2AHOB 3F2DA 3H8SA 1ZQCA 4DS5A 3GQCA 3VC8A 4PZOA 2XGPA 2K8BB 4M9NA 2Y1JA 4YMMA 3PX6A 2DPIA 3V72A 2VIXA 4M9HA 4J9RA 3OJUA 9ICUA 1SXEA 3UXPA 1HUZA 4DSJA 4K4IA 4DEZA 2KIVA 1NKEA 1NOMA 4KTQA 4DFMA 3HW8A 3WKDA 4YXJA 2B21A 2JEGA 1FFUA 2W43A 1QQ5A 2NRZA 3IM1A 5IIJA 5BOLA 2R8JA 4BJQA 1FFVA 2MRLA 1SV0A 1SV0C 3N4MB 1S0OA 4ELTA 3UXNA 3T5JA 1ZJNA 4ED0A 1B43A 2WB1C 5CEHA 2W9CB 4O3OA 4QW8A 1WYGA 7ICHA 2H5XA 4UARA 1LB2B 3SAHA 2HVHA 1QH9A 5J2EA 1HEKA 1SL0A 5IIMA 3PR5B 3BQ1A 5AM3A 4ECVA 3KFUF 4X5VA 1Z1BA 5KG4A 1K1SA 2CRXA 1ZRNA 2MUTA 4F92B 4USAA 2W9MA 3PX4A 2K4PA 4FS2A 2MU2A 4KX5A 4RQMA 4IR9A 1X42A 4MEYA 2C2RA 3PO4A 3TFRA 1N5WA 1BNPA 2LHTA 4B9NA 7ICSA 4UBBA 3FDSA 2BPCA 2FDRA 5J0YA 3DDHA 5KFXA 3RR7A 9ICGA 2ZXIA 1ZYQA 3KD3A 5HHIA 2C28A 3CRXA 5CB1A 3I28A 2A1JA 4YD2A 1YZ7A 5KFUA 3EZ5A 8ICFA 4YCXA 2ZIWA 2W7PA 1S0MA 5KNIA 1NK6A 4MF2A 4NLCA 3OGUA 2FMPA 1RYSA 1T3QA 4CF5A 2ESEA 2E8MA 2EANA 5KT7A 4MFFA 5AKGA 1N62A 4OJ5A 2HHVA 5K4LA 1NK0A 1QLNA 2BCVA 1X9MA 4Y2RA 1KSPA 2YN4A 3QEBZ 1X9WA 5DGAA 2D8CA 1BVSA 3RJGA 3ISDA 3TADA 5AKYA 3TADC 2YY6A 3RAQA 2A19A 5D49A 4Y2YA 2DL0A 5ALJA 4EEYA 2WF9A 3THVA 2XCPA 8ICIA 5T14A 2YMMA 2XCAA 4PL2A 1L7PA 3AQEA 4QZBA 1WUDA 3TAPA 4EELA 4GXIA 8ICRA 3PVXA 4BXOA 1Z1VA 2Y0SC 4Y2UA 3SAGA 8ICJA 5KFDA 2PFOA 4AP9A 4RQNA 1Q3VA 4ED8A 3MGHA 2F44A 2ZXHA 4F5QA 2NV3A 3MR6A 2E1EA 4I2AA 1WCLA 2HHWA 5G5HA 1NZPA 5J2AA 3UXOA 5J2DA 3RH5A 1C20A 3D2NA 3QZ8A 2W9BB 4KLUA 4PH5A 3D6JA 4YMNA 7ICFA 4C4RA 1S77D 4BUGA 4BGDA 2Y1IA 8ICNA 5DQGA 4KLLA 1TV9A 1KKXA 1ZQGA 3A0BU 4KMOB 2QB0A 1SL2A 4RPYA 1DXSA 9ICVA 5L1LA 5HHHA 5ALIA 1L3VA 4RQ3A 2LYAA 9ICKA 5HP4A 3N28A 3PX0A 4JV0A 5ALKA 4ELVA 2HHSA 4F5NA 2KKPA 1JXEA 5KL1B 9ICHA 4O9MA 3E58A 2WAQC 3V6JA 1NJZA 4FZLA 3FYHA 4OJOA 2PMZC 2KVCA 4M0AA 2BDUA 1J2NA 1RQLA 4JB3A 4ED2A 3NVVA 4C8NA 5DB6A 2XGQA 1COKA 2WF5A 1X6IA 2LMRA 3WKCA 3T5HA 5KT2A 1JRPA 4DOCA 2W54A 3NASA 2BDPA 7ICEA 3E2EA 4QWAA 4Z6CA 3LK9A 1N56A 2BQUA 3PO5A 3QNMA 4P2HA 2BPGA 4Y2TA 3U26A 5DQHA 5J2GA 3BS5B 5EE9A 3RB3A 3E0FA 4ECUA 1B4FA 4I2IA 5J2HA 2HMXA 4KLDA 2KP7A 4IR1A 2NO4A 4PGQA 1MSWD 1PUZA 5B66U 1ZQRA 3R9KA 4RT3A 2XY7A 1PVQA 5DKWA 2BHNA 2I6XA 2C2DA 2PFPA 3AU2A 3SAFA 4FBTA 4KITB 1Z4OA 3M9NB 5KFFA 2R8HA 1UA0A 3CP8A 1N63A 1BPZA 4U6PA 3IG5A 4DQQA 2AGPA 2K4EA 4RNMA 4NXZA 5DBAA 3PNCA 3AEVA 4I29A 4UB5A 4M04A 4O5EA 7ICMA 5ALHA 4C80A 5JU5A 2LI6A 5DB7A 2BQ3A 5C0YA 1TAUA 3KKAA 1K1QA 4JUZA 2NRXA 3K1ZA 2VKQA 4YG2A 4IS7A 2ZIXA 2IOHA 5ALVA 1YT3A 1QQ7A 1XNSA 3B0XA 3EYZA 4JV2A 5J0UA 3J81j 3C21A 1NI3A 3ETLA 5J0SA 1KTQA 1DOQA 5EE0A 5ALWA 2KIWA 2WFAA 2PFQA 1ZQMA 1UT8A 2HI0A 1OUQA 2JGAA 3H4DA 3PZPA 1S0NA 4KX3A 2W11A 1U47A 2HBJA 2AQ0A 4UB3A 3GIJA 4QZGA 3KZXA 2XY6A 5IIOA 3M8RA 1KFDA 5KFVA 2OM6A 2LYHA 4C0ZA 3UPQA 2J6TA 5AI0A 3V6KA 2JXJA 1DGJA 2A3VA 4C4TA 8ICAA 3LYSA 8ICHA 3ONNA 3A0HU 1BPDA 4BWMA 2RP5A 5AM0A 4KLGA 4JMUA 1H38A 4K4GA 2RDJA 3LDAA 2BCQA 5L1MA 5DB9A 1NK5A 1MQ2A 2E8PA 2ZIUB 1SV4A 1N61A 4ICAA 3V6HA 2L5YA 2KFZA 1NK4A 5AM4A 2VJ5A 4DFPA 4NLZA 3IV6A 5ALZA 5AI6A 5D46A 2I5HA 2FPKA 1SKRA 2C2EA 4US9A 1KQQA 4EBDA 1KDHA 3TQ1A 5KT4A 4EBEA 2BR0A 3Q8PB 1PK1B 3LVVA 2OCEA 7ICPA 4O3QA 2AQ4A 7ICTA 3MFIA 5KL8B 4LZDA 2KE7A 4UAVA 9ICJA 2HOIA 1J97A 4M9LA 1TE2A 4RNNA 5HR7A 5CP2A 9ICEA 1ZQPA 4O3MA 1RDFA 4QWCA 4A8EA 2I9GA 4M2YA 3RRHA 3PW2A 4KLFA 3CNHA 1S97A 2CPRA 3G6XA 4EBCA 4UAUA 2R8IA 4AYBC 4Z6FA 2EZZA 5EWEA 1U4BA 4I2DA 9ICRA 2KZ3A 3NS1A 2AJQA 3NRWA 2QARA 3G6YA 4DLEA 5EWGA 4B9LA 4UAWA 1JN3A 2FPMA 3AU6A 1L7OA 4FS1A 2C22A 3BDPA 2XICA 1XC9A 3Q8RB 1SB3C 4RPXA 2FJ6A 4UQGA 9ICNA 5DDMA 2K89A 1RZTA 3S6JA 5KAFU 4CRXA 2YQEA 4DOAA 3UMGA 1T94A 1SZPA 4B9TA 1N60A 1DK2A 2O6KA 5ALDA 1PVRA 1KLNA 4JV1A 5DDYA 4RQ8A 2KNJA 2PI5A 4RQ7A 4IRDA 3L5KA 4OJPA 3B9JA 3L3FX 4E0DA 3EW9A 9ICQA 1OXJA 3IP4B 5KFOA 4J9KA 1L8LA 2HHQA 1QSLA 4OJ6A 3EPGA 4Y2XA 4OO1J 2JZBA 4C8MA 2LKYA 3ZDCA 3M6ZA 3HKZC 4F72A 2ATLA 1U48A 3PMNA 2W9AA 4RQ0A 4MEXA 1IIPA 4UB6U 1MC8A 3F5EA 3TARA 3RJEA 1ZD3A 2NRVA 3AL0B 5DG9A 3V7KA 4F5PA 1FIQA 2LPEA 4GC6A 3AM9A 3IG8A 4PL1A 4XQ8A 4I27A 4DCCA 3ETRA 4TQRA 9ICBA 4RUAA 4NJ8A 1Z19A 3D2SA 1ZQUA 2ZUCA 2YB4A 5HMLA 1SWWA 4P0PA 3C23A 1UHUA 5KAIU 2V4QA 4RQ6A 3WK5A 1QTMA 9ICMA 9ICOA 1YZ6A 3PW5A 2NRTA 3JPRA 4B9SA 3LWLA 1TK0A 9ICAA 5J2JA 1EXNA 5AI9A 2AXTU 4CF4A 5JTIA 1XWLA 2IA6A 1CRXA 2ODGA 1RG6A 4QZCA 1T7PA 1X9XA 4Y2QA 4KLEA 1ZQFA 7ICUA 1SL1A 3C1YA 3JPTA 3QE9Y 2P6UA 2BCUA 1L5UA 4G3IA 3UQ0A 3HILA 5F9LA 2DBYA 2EH9A 5F3XB 3H8MA 2YMLA 1ZQJA 2CXYA 4P4MA 3Q8KA 1NNLA 3NVYA 4EX6A 4UB1A 3L4PA 3MR5A 2GO7A 5J0OA 3HRDD 3ORYA 4ED3A 5BOMA 1ZD2P 4J9LA 2ZJ5A 5B5EU 3KBBA 5AIAA 3LWMA 5AKXA 4NV0A 1XSPA 2KVSA 3MR2A 3GU3A 3BZKA 4OD0A 1V9PA 2F2AB 4QNLA 5DB8A 3FAHA 8ICYA 3QU5A 2BCRA 3SENA 2Y9TA 4Q8EA 4UBCA 4Z6DA 3QUCA 2EDUA 1A76A 2V4RA 4GXJA 3SMVA 2KSOA 4PHPA 5ALNA 1NK9A 1D9FA 2HBMA 4ECRA 2ES6A 2CN1A 4F4XA 1U9LA 3ZI4A 4C4SA 5KFAA 2EZXA 1COOA 4O5KA 4ECQA 4MFAA 3MC1A 3QXGA 4YP3A 3HX0A 3PW4A 3LVWA 2AGQA 4DQPA 4K4HA 5ALOA 4DF8A 1XU4A 4CE6A 4F71A 1S10A 2AGOA 5C5JA 4ACOA 4P0QB 4CF3A 4DO9A 2BQRA 3H8JA 4RT2A 4DSFA 2J6SA 1XSNA 1RYRA 1Z4NA 2K4IA 2XY5A 3KTQA 1WG8A 1HJPA 4TQSA 3MDCA 4UB2A 5KG0A 3MGVA 1X9SA 4XA5A 5HNKA 3GZFA 3C29A 1L6NA 1J2MA 5ALXA 5L1JA 2JH7A 2KKVA 9ICTA 1ZXIA 1KEJA 3BZCA 3F53A 4PPXA 5ALFA 5AKJA 2WHEA 3M1YA 5ALYA 4UASA 2ZUBA 3C2KA 4RUCA 3WU2U 5KFYA 4P4OA 4J9OA 3M6KA 2FLLA 2F3NA 4LVSA 4ECWA 4IRCA 2KV2A 1QCKA 4DL6A 3RJFA 5GTIU 4QZ8A 4J9MA 1P7DA 3SZ2A 5AKIA 1JX4A 9ICPA 3PMLA 3SR6A 4Y2JA 4I2FA 2XC9A 2K4HA 2KTQA 3JPQA 3QEAZ 5KFGA 5CWRA 3OPXA 9ICFA 8ICTA 1F5SA 5EE3A 4F4KA 3MABA 2W9CA 1B0XA 3D2QA 3T5LA 3H0MB 2BZFA 2W3RA 8ICGA 2GOLA 4QZDA 4YD1A 5KFJA 4KN7A 1VJ5A 4DS4A 4GFJA 3PR4A 2JV3A 3GFKB 4R8UB 1URJA 5DGBA 2G06A 4FFDA 4DSLA 2HW3A 2KHVA 1L3TA 3AN1A 5J0RA 4QWEA 3K4GA 4CNQA 3ZDEA 3PY8A 1NKBA 2KMDA 2ZIVB 2WB1F 2F76X 8ICQA 5BPCA 5J29A 4C7YA 2AH5A 2P35A 2DPJA 4I2GA 1NJWA 1LKYB 9ICLA 2WF6A 4IQVA 1SXDA 4IQTA 3IHQB 2DGZA 1Z00B 3C5FA 1TAQA 5KFWA 1ZQNA 4J9NA 8ICZA 1N2XA 1TK8A 1TFRA 1ED1A 4OCZA 1T8EA 2V9WA 1WWVA 5KFMA 2HHXA 3OSNA 1ZD5A 3N7PD 4CGZA 4QWBA 2K8CB 1PVPA 8ICCA 1ZQTA 2FMSA 4XRHA 5L1IA 3JPSA 2LM4A 2GWSA 2YB1A 2FE9A 1DRGA 2QKQA
chains in the Genus database with same CATH topology
3IDWA 1Z1VA 2YTUA 2ES6A 2K4PA 3KKAC 4RQMA 2EAMA 4RQNA 1PK1A 4NL9A 4NL9C 1KW4A 1V38A 1OW5A 1B0XA 1V85A 1JI7A 2F44A 1X66A 3BS5B 3SEIA 2QARA 2QB0B 1B4FA 5JTIA 2JV3A 1RG6A 2EAOA 3K1RB 2DKZA 5J8YA 1X9XA 4PZOA 2QB1A 1UCVA 2DKXA 5KNIA 3HILA 2KMDA 2K60A 3BS5A 5F3XB 3H8MA 3TACB 1SXEA 5L1MA 5JRTA 1LKYB 1WWUA 2E8MA 2ESEA 2E8PA 2EANA 2QB0A 2KIVA 1SV4A 1SGGA 1OXJA 2E8NA 2L5YA 1DXSA 2KG5A 2F8KA 1SXDA 1F0MA 5J8YC 4MHVA 2Y9UA 3BS7A 2D8CA 1SV0A 1SV0C 3TADA 2KSOB 3TADC 3BQ7A 5JU5A 1UQVA 2E8OA 2B6GA 2EAPA 2DL0A 2F3NA 1PK1B 1WWVA 3KKAA 1LKYA 1X40A 2QARB 4IS7A 3SENA 2KE7A 2LPEA 2Y9TA 2D3DA 1COKA 2GLEA 2LMRA 4NJ8A 1PK3A 2FE9A 2KSOA 2QKQA 4PZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IDW A;  1Z1V A;  2YTU A;  2ES6 A;  2K4P A;  3KKA C;  4RQM A;  2EAM A;  4RQN A;  1PK1 A;  4NL9 A;  4NL9 C;  1KW4 A;  1V38 A;  1OW5 A;  1B0X A;  1V85 A;  1JI7 A;  2F44 A;  1X66 A;  3BS5 B;  3SEI A;  2QAR A;  2QB0 B;  1B4F A;  5JTI A;  2JV3 A;  1RG6 A;  2EAO A;  3K1R B;  2DKZ A;  5J8Y A;  1X9X A;  4PZO A;  2QB1 A;  1UCV A;  2DKX A;  5KNI A;  3HIL A;  2KMD A;  2K60 A;  3BS5 A;  5F3X B;  3H8M A;  3TAC B;  1SXE A;  5L1M A;  5JRT A;  1LKY B;  1WWU A;  2E8M A;  2ESE A;  2E8P A;  2EAN A;  2QB0 A;  2KIV A;  1SV4 A;  1SGG A;  1OXJ A;  2E8N A;  2L5Y A;  1DXS A;  2KG5 A;  2F8K A;  1SXD A;  1F0M A;  5J8Y C;  4MHV A;  2Y9U A;  3BS7 A;  2D8C A;  1SV0 A;  1SV0 C;  3TAD A;  2KSO B;  3TAD C;  3BQ7 A;  5JU5 A;  1UQV A;  2E8O A;  2B6G A;  2EAP A;  2DL0 A;  2F3N A;  1PK1 B;  1WWV A;  3KKA A;  1LKY A;  1X40 A;  2QAR B;  4IS7 A;  3SEN A;  2KE7 A;  2LPE A;  2Y9T A;  2D3D A;  1COK A;  2GLE A;  2LMR A;  4NJ8 A;  1PK3 A;  2FE9 A;  2KSO A;  2QKQ A;  4PZN A; 
#chains in the Genus database with same CATH topology
 5JUM A;  2JH1 A;  2IBK A;  3H0L B;  3OJS A;  4DLG A;  4B6J A;  3KKA C;  4ECS A;  2EAM A;  1Z3E B;  4NL9 A;  4F91 B;  8ICU A;  4NL9 C;  5KFP A;  2IMW P;  3WKB A;  8ICB A;  1ZQB A;  2ZUD A;  2ZTD A;  3JPP A;  1KN5 A;  4NLN A;  4M47 A;  2RQ5 A;  1L8O A;  1AQ6 A;  4JK1 A;  4DQS A;  2F8L A;  2LM1 A;  4YVZ A;  2DFL A;  4J03 A;  3TAN A;  4EX7 A;  3QU4 A;  4QZA A;  5AI8 A;  2WTF A;  3MDA A;  4DQR A;  4I2E A;  1UCV A;  4ED1 A;  3SV4 A;  4KMU A;  2HOF A;  4MFC A;  8ICX A;  1UA1 A;  5KFR A;  4F4Y A;  9ICW A;  4O0I A;  4ED6 A;  5JRT A;  4B9U A;  3NUQ A;  5TIS U;  1B22 A;  7ICL A;  2MA1 A;  4EYH B;  1DGS A;  2G09 A;  2BPF A;  4KLT A;  3AMZ A;  4QJF B;  2W9B A;  2VAN A;  1QSY A;  3HPO A;  2H3Z A;  5ALT A;  4F2R A;  3PV8 A;  3WK4 A;  2FLN A;  3RB4 A;  3QZ7 A;  7ICR A;  7ICN A;  4IRK A;  2MUT B;  4DL5 A;  4P4P A;  2B6G A;  2EAP A;  1A6S A;  5EWF A;  2ZJA A;  3M8S A;  4FZM A;  4YR2 A;  3GDX A;  5KFB A;  1A77 A;  2KJ9 A;  5IIN A;  1X40 A;  4YR0 A;  5AIC A;  1HUO A;  5KT3 A;  2F1J A;  1KFS A;  5KFQ A;  2XO7 A;  8ICO A;  5D4B A;  3PW0 A;  1ZJM A;  4DF4 A;  2VA8 A;  1SIJ A;  3M9O B;  4PJ0 U;  2A1J B;  2MSN A;  3SYZ A;  4NLG A;  2ZIW B;  3G6V A;  1MQ3 A;  2LBO A;  1KW4 A;  2OH2 A;  5ALU A;  1JI7 A;  4JWM A;  2ISO A;  2KD1 A;  1TAM A;  2KJ8 A;  1BPB A;  9ICC A;  1IXR A;  4RU9 A;  2K8A A;  1UT5 A;  7ICG A;  9ICI A;  1MN8 A;  2PKE A;  4DSI A;  4ECZ A;  5J8Y A;  3RH4 A;  2FMQ A;  2QB1 A;  3Q8Q B;  4O3N A;  1JUD A;  1D8B A;  3NRZ A;  3ISC A;  2PXI A;  3QYP A;  2HHU A;  5IIK A;  2WAQ F;  2KIC A;  3BS5 A;  4FBU A;  4BDP A;  2W04 A;  2PMZ F;  2H3F A;  1L3U A;  1WWU A;  3F2C A;  3Q8L A;  3C2L A;  5AIB A;  1CI4 A;  1X2I A;  3ISB A;  1NK7 A;  2W8K A;  5CJ7 A;  4F4Z A;  1K5O A;  4EZ9 A;  4F50 A;  4MHV A;  1T4G A;  3BS7 A;  1MA7 A;  4F3O A;  4BXO B;  2KN7 A;  3GII A;  3QUQ A;  2RLT A;  4KLM A;  2HBL A;  8ICM A;  4B9V A;  1NJX A;  2KZM A;  2FI1 A;  4I2J A;  1SKW A;  3QU9 A;  5EE1 A;  1SKS A;  4GXK A;  1XO0 A;  3HWT A;  4DL7 A;  4ELU A;  4GC7 A;  4Y2V A;  4B9M A;  2R18 A;  9ICS A;  5AKL A;  1ZD4 A;  4R63 A;  2DWQ A;  3UQ2 A;  2D6F C;  3T5K A;  8ICK A;  3QU7 A;  1Y88 A;  4WJ3 B;  5AKH A;  2QB0 B;  3NGD A;  1VLB A;  5KFL A;  3ZDA A;  5F9N A;  3RBE A;  5DG7 A;  5IIL A;  4TUR A;  4C8K A;  3WK8 A;  3F2B A;  5J2C A;  7ICQ A;  1FO4 A;  2ISP A;  4Q45 A;  3RRG A;  2RDI A;  1JXL A;  1S5L U;  5CR0 A;  2R8K A;  3JPN A;  1N5X A;  4RNO A;  2JEF A;  8ICS A;  3H8W A;  2G5I B;  4KLO A;  2UVR A;  5KFI A;  2NYV A;  3KOO A;  4C7Z A;  4FE3 A;  5L9X A;  3TAC B;  2KFN A;  5AM2 A;  3DV9 A;  3SQI A;  5AKE A;  5DLG A;  4MF8 A;  1XO1 A;  5ALM A;  4US8 A;  2KK0 A;  3VCB A;  2H3I A;  1NKC A;  5KFH A;  2G07 A;  3NTU A;  5HMM A;  3OSP A;  5J0W A;  4C8O A;  3M9M B;  1ZQZ A;  3PST A;  3ZD8 A;  3TKA A;  5ALQ A;  1KBU A;  4KLI A;  3GIL A;  2R8G A;  2H3V A;  4RQ4 A;  5DQI A;  7ICK A;  2N1R A;  2LYB A;  2W03 A;  5ALP A;  3ED5 A;  1GO3 F;  3RJJ A;  7ICV A;  2ZIU A;  4M9J A;  1L3S A;  4UW9 A;  4QZE A;  4U7C A;  4YXM A;  4DWI A;  1ZOL A;  2YX8 A;  1U49 A;  1D8Y A;  4LJX A;  4UB4 A;  2EZY A;  2Q0Z X;  5CRX A;  1T3N A;  3MR3 A;  2FLP A;  1NJY A;  3HT3 A;  4J9S A;  1PK1 A;  4PHD A;  2YMP A;  4I2H A;  2MAX A;  5J2K A;  3SEI A;  3O0F A;  5KFT A;  3OHB A;  3MBY A;  2ZTC A;  2RHF A;  7ICJ A;  5J0Q A;  3TAQ A;  2XI9 A;  3H7I A;  5KG6 A;  1ZET A;  1SZH A;  1WCN A;  5H2F U;  2M9N A;  3K75 D;  5ALR A;  4DL3 A;  5AKK A;  2W3S A;  4Q8F A;  4QIW F;  2KEY A;  8ICV A;  3Q8S B;  1NK8 A;  5J2I A;  1S0V A;  3SI8 A;  3WKA A;  4PHA A;  5G5G A;  3C1Z A;  1ZQE A;  2W7O A;  5ALG A;  4KLS A;  2IHM A;  4F5O A;  4NM2 A;  1ZQS A;  2ZIX B;  3IRU A;  3RTV A;  2KG5 A;  4FZN A;  8ICE A;  3KHH A;  2Y9U A;  4UAT A;  3C2M A;  5AHX A;  3RJI A;  4NM1 A;  1ECW A;  4UAZ A;  3RH6 A;  2F1H A;  3C28 A;  4TUP A;  4F2S A;  3BQT A;  2IOF K;  3RAX A;  5CHG A;  5KG1 A;  3C5G A;  4GLX A;  3WK9 A;  2OHF A;  3UM9 A;  4RQ1 A;  4Y2S A;  4AYB F;  1SWV A;  2Z7J A;  1F44 A;  1V97 A;  4RQ5 A;  5KFK A;  3ZDD A;  1QSS A;  4G9B A;  5DLF A;  1ZQI A;  2B0C A;  1RM6 C;  5DBB A;  3BQ2 A;  2HHT A;  5AK6 A;  1A0P A;  1ZQV A;  2YTU A;  1XS9 D;  4NY8 A;  3RB0 A;  4R65 A;  1JAL A;  2KOB A;  4GIB A;  4F5R A;  4TUQ A;  1X66 A;  4OJL A;  4PGX A;  2JEI A;  2OEH A;  4ECY A;  2HCF A;  2ZJ8 A;  3CW2 C;  2F77 X;  1N48 A;  4O3P A;  1FEZ A;  5AM5 A;  2F1I A;  1BPE A;  4R64 A;  2JMG A;  5AK3 A;  5KFN A;  3K1R B;  2EQY A;  4HAI A;  4PGY A;  3HKZ F;  3GV5 B;  1S9F A;  3PSP A;  5DG8 A;  2WF7 A;  5J0T A;  5A0L A;  1CUK A;  5KFE A;  4BWJ A;  1BPY A;  4QW9 A;  4I2C A;  2JHD A;  5KT5 A;  1RQN A;  2ASD A;  2F8K A;  5KG7 A;  4NLK A;  2W55 A;  4QZI A;  1F0M A;  3EPI A;  3BQ0 A;  4RPZ A;  3QUT A;  5AK5 A;  1KRP A;  3RJK A;  2HSZ A;  4DSE A;  1ZQA A;  3RR8 A;  2UVV A;  3GIK A;  3V7J A;  3BQ7 A;  2KHQ A;  1D8L A;  1UPH A;  1X6J A;  4ZH4 A;  3MFH A;  3CYM A;  1UQV A;  3WKE A;  4TUS A;  5KFZ A;  4DFK A;  3KZI U;  2P66 A;  2UVU A;  1U45 A;  1JIH A;  5GTH U;  2HVI A;  5KG5 A;  3FM9 A;  4Q44 A;  2Q4T A;  1Q3U A;  2QAR B;  1ZQO A;  1RXW A;  3PW7 A;  1O08 A;  4J9P A;  5ALE A;  2D3D A;  4IQW A;  3QX7 A;  4ED7 A;  4KLH A;  5KG3 A;  1O03 A;  3RFA A;  4DFD A;  1TVA A;  3AQF A;  2OWO A;  1RXV A;  3FC4 A;  4RZR A;  3OHA A;  4I28 A;  4PZN A;  4JWN A;  3H4B A;  2G0A A;  1C7Y A;  3EUB 2;  3WK6 A;  1ZQL A;  3AUO A;  5AM1 A;  4YMO A;  1S76 D;  4M6W B;  1OW5 A;  3H0R B;  5III A;  2DUY A;  4BX9 C;  2DQN B;  1VDV A;  2W8L A;  4EZ6 A;  2OXO A;  2YMQ A;  1ZQY A;  4FO6 A;  3ZD9 A;  3UMB A;  2OYY A;  1TKD A;  5AKZ A;  4QWD A;  8ICW A;  3I1Y A;  4NWI A;  5AK4 A;  1PZN A;  2JZB B;  2DKZ A;  3MGI A;  2BKE A;  5DBC A;  2ZTE A;  4C8L A;  2XID A;  5E79 U;  4YQW A;  4NLB A;  4YR3 A;  2DKX A;  7ICI A;  1D9D A;  3UMC A;  4J9Q A;  1L7M A;  2K60 A;  1HIW A;  2PFN A;  2AU0 A;  2JRZ A;  4P0Q A;  4IC9 A;  2E8N A;  3GIM A;  3NVW A;  4XUS A;  1RYU A;  2A1A A;  1ZQW A;  4EEK A;  2VA2 A;  5KFC A;  3KHR A;  4P0P B;  4QZ9 A;  2IHN A;  2M0N A;  1CEZ A;  3JPO A;  3DEE A;  5AI5 A;  2E8O A;  4Q43 A;  4LZG A;  4DFJ A;  2NO5 A;  4YFK A;  1ZQQ A;  4EYI B;  3ZDB A;  2BGW A;  4CCH A;  1ZQH A;  1LV5 A;  2ALZ A;  2E3T A;  2HBK A;  2PI4 A;  1M6Y A;  4HYK A;  4KN4 A;  4O5C A;  3I76 A;  2Y0S F;  5KG2 A;  3RF9 A;  4F8R A;  3F5A A;  8ICP A;  1LVH A;  5L1K A;  3IDW A;  5KTQ A;  3N7R C;  2NRW A;  5ALS A;  1XSL A;  1JRO A;  2FPL A;  4R66 A;  7ICO A;  2HDO A;  2ZG6 A;  2HOQ A;  5J0P A;  3RJH A;  3T79 A;  2P6R A;  1V38 A;  4IQU A;  3PSF A;  1IV8 A;  5TZV A;  2WF8 A;  4UAY A;  4KLJ A;  3GV7 B;  5CA7 A;  5J2F A;  2UVW A;  4Z6E A;  4YN4 A;  4Y2P A;  2VA3 A;  3N7S C;  1QQ6 A;  2E5S A;  4QZH A;  2EAO A;  2IOF A;  2J6U A;  4KLQ A;  4F93 B;  2JEJ A;  4DL2 A;  5HR6 A;  1L7N A;  3KHL A;  1ZQD A;  3QUB A;  2G08 A;  4PHE A;  4QIW C;  5KT6 A;  3N97 B;  4O3R A;  3IN5 A;  1Q46 A;  1Q8K A;  2H3Q A;  2GH1 A;  2ASJ A;  3BJY A;  1ARO P;  5J2B A;  1IM4 A;  4M9G A;  1SGG A;  1BPX A;  3QU2 A;  5ALL A;  3T3F A;  1DK3 A;  4R8U A;  3EWA A;  3PSI A;  5J8Y C;  3HP6 A;  4DL4 A;  2ASL A;  4ECX A;  1RPL A;  3SD7 A;  2RRD A;  3V7L A;  2KSO B;  1NZB A;  1KFT A;  1IG6 A;  4DQI A;  3M7D A;  3TI0 A;  1ZQ1 C;  2QLT A;  4ZOH C;  4EEN A;  2ZIV A;  3SV3 A;  4RQ2 A;  5EOZ A;  1TK5 A;  4ECT A;  4CDG A;  3ICX A;  4I2B A;  4IL6 U;  1LKY A;  1ZQX A;  4DOB A;  5KFS A;  9ICX A;  1JMS A;  3RBD A;  2KZZ A;  2BCS A;  4QZF A;  3NVZ A;  2GLE A;  2I1Q A;  2G5H B;  3H40 A;  1PK3 A;  8ICL A;  4O3S A;  1Z00 A;  2JR5 A;  2VJ4 A;  4UB8 U;  2XVT A;  4F4W A;  3OTQ A;  3B0Y A;  3GV8 B;  3HJE A;  3TFS A;  2KJ5 A;  5J0X A;  3WK7 A;  2E1F A;  1KL9 A;  5FP0 A;  1S8O A;  1ZQK A;  3RB6 A;  1V85 A;  4M6W A;  3ALR A;  2DF4 B;  5AI4 A;  1BNO A;  3Q8M A;  1BGX T;  3KHG A;  4DSK A;  1ZRM A;  2AHO B;  3F2D A;  3H8S A;  1ZQC A;  4DS5 A;  3GQC A;  3VC8 A;  4PZO A;  2XGP A;  2K8B B;  4M9N A;  2Y1J A;  4YMM A;  3PX6 A;  2DPI A;  3V72 A;  2VIX A;  4M9H A;  4J9R A;  3OJU A;  9ICU A;  1SXE A;  3UXP A;  1HUZ A;  4DSJ A;  4K4I A;  4DEZ A;  2KIV A;  1NKE A;  1NOM A;  4KTQ A;  4DFM A;  3HW8 A;  3WKD A;  4YXJ A;  2B21 A;  2JEG A;  1FFU A;  2W43 A;  1QQ5 A;  2NRZ A;  3IM1 A;  5IIJ A;  5BOL A;  2R8J A;  4BJQ A;  1FFV A;  2MRL A;  1SV0 A;  1SV0 C;  3N4M B;  1S0O A;  4ELT A;  3UXN A;  3T5J A;  1ZJN A;  4ED0 A;  1B43 A;  2WB1 C;  5CEH A;  2W9C B;  4O3O A;  4QW8 A;  1WYG A;  7ICH A;  2H5X A;  4UAR A;  1LB2 B;  3SAH A;  2HVH A;  1QH9 A;  5J2E A;  1HEK A;  1SL0 A;  5IIM A;  3PR5 B;  3BQ1 A;  5AM3 A;  4ECV A;  3KFU F;  4X5V A;  1Z1B A;  5KG4 A;  1K1S A;  2CRX A;  1ZRN A;  2MUT A;  4F92 B;  4USA A;  2W9M A;  3PX4 A;  2K4P A;  4FS2 A;  2MU2 A;  4KX5 A;  4RQM A;  4IR9 A;  1X42 A;  4MEY A;  2C2R A;  3PO4 A;  3TFR A;  1N5W A;  1BNP A;  2LHT A;  4B9N A;  7ICS A;  4UBB A;  3FDS A;  2BPC A;  2FDR A;  5J0Y A;  3DDH A;  5KFX A;  3RR7 A;  9ICG A;  2ZXI A;  1ZYQ A;  3KD3 A;  5HHI A;  2C28 A;  3CRX A;  5CB1 A;  3I28 A;  2A1J A;  4YD2 A;  1YZ7 A;  5KFU A;  3EZ5 A;  8ICF A;  4YCX A;  2ZIW A;  2W7P A;  1S0M A;  5KNI A;  1NK6 A;  4MF2 A;  4NLC A;  3OGU A;  2FMP A;  1RYS A;  1T3Q A;  4CF5 A;  2ESE A;  2E8M A;  2EAN A;  5KT7 A;  4MFF A;  5AKG A;  1N62 A;  4OJ5 A;  2HHV A;  5K4L A;  1NK0 A;  1QLN A;  2BCV A;  1X9M A;  4Y2R A;  1KSP A;  2YN4 A;  3QEB Z;  1X9W A;  5DGA A;  2D8C A;  1BVS A;  3RJG A;  3ISD A;  3TAD A;  5AKY A;  3TAD C;  2YY6 A;  3RAQ A;  2A19 A;  5D49 A;  4Y2Y A;  2DL0 A;  5ALJ A;  4EEY A;  2WF9 A;  3THV A;  2XCP A;  8ICI A;  5T14 A;  2YMM A;  2XCA A;  4PL2 A;  1L7P A;  3AQE A;  4QZB A;  1WUD A;  3TAP A;  4EEL A;  4GXI A;  8ICR A;  3PVX A;  4BXO A;  1Z1V A;  2Y0S C;  4Y2U A;  3SAG A;  8ICJ A;  5KFD A;  2PFO A;  4AP9 A;  4RQN A;  1Q3V A;  4ED8 A;  3MGH A;  2F44 A;  2ZXH A;  4F5Q A;  2NV3 A;  3MR6 A;  2E1E A;  4I2A A;  1WCL A;  2HHW A;  5G5H A;  1NZP A;  5J2A A;  3UXO A;  5J2D A;  3RH5 A;  1C20 A;  3D2N A;  3QZ8 A;  2W9B B;  4KLU A;  4PH5 A;  3D6J A;  4YMN A;  7ICF A;  4C4R A;  1S77 D;  4BUG A;  4BGD A;  2Y1I A;  8ICN A;  5DQG A;  4KLL A;  1TV9 A;  1KKX A;  1ZQG A;  3A0B U;  4KMO B;  2QB0 A;  1SL2 A;  4RPY A;  1DXS A;  9ICV A;  5L1L A;  5HHH A;  5ALI A;  1L3V A;  4RQ3 A;  2LYA A;  9ICK A;  5HP4 A;  3N28 A;  3PX0 A;  4JV0 A;  5ALK A;  4ELV A;  2HHS A;  4F5N A;  2KKP A;  1JXE A;  5KL1 B;  9ICH A;  4O9M A;  3E58 A;  2WAQ C;  3V6J A;  1NJZ A;  4FZL A;  3FYH A;  4OJO A;  2PMZ C;  2KVC A;  4M0A A;  2BDU A;  1J2N A;  1RQL A;  4JB3 A;  4ED2 A;  3NVV A;  4C8N A;  5DB6 A;  2XGQ A;  1COK A;  2WF5 A;  1X6I A;  2LMR A;  3WKC A;  3T5H A;  5KT2 A;  1JRP A;  4DOC A;  2W54 A;  3NAS A;  2BDP A;  7ICE A;  3E2E A;  4QWA A;  4Z6C A;  3LK9 A;  1N56 A;  2BQU A;  3PO5 A;  3QNM A;  4P2H A;  2BPG A;  4Y2T A;  3U26 A;  5DQH A;  5J2G A;  3BS5 B;  5EE9 A;  3RB3 A;  3E0F A;  4ECU A;  1B4F A;  4I2I A;  5J2H A;  2HMX A;  4KLD A;  2KP7 A;  4IR1 A;  2NO4 A;  4PGQ A;  1MSW D;  1PUZ A;  5B66 U;  1ZQR A;  3R9K A;  4RT3 A;  2XY7 A;  1PVQ A;  5DKW A;  2BHN A;  2I6X A;  2C2D A;  2PFP A;  3AU2 A;  3SAF A;  4FBT A;  4KIT B;  1Z4O A;  3M9N B;  5KFF A;  2R8H A;  1UA0 A;  3CP8 A;  1N63 A;  1BPZ A;  4U6P A;  3IG5 A;  4DQQ A;  2AGP A;  2K4E A;  4RNM A;  4NXZ A;  5DBA A;  3PNC A;  3AEV A;  4I29 A;  4UB5 A;  4M04 A;  4O5E A;  7ICM A;  5ALH A;  4C80 A;  5JU5 A;  2LI6 A;  5DB7 A;  2BQ3 A;  5C0Y A;  1TAU A;  3KKA A;  1K1Q A;  4JUZ A;  2NRX A;  3K1Z A;  2VKQ A;  4YG2 A;  4IS7 A;  2ZIX A;  2IOH A;  5ALV A;  1YT3 A;  1QQ7 A;  1XNS A;  3B0X A;  3EYZ A;  4JV2 A;  5J0U A;  3J81 j;  3C21 A;  1NI3 A;  3ETL A;  5J0S A;  1KTQ A;  1DOQ A;  5EE0 A;  5ALW A;  2KIW A;  2WFA A;  2PFQ A;  1ZQM A;  1UT8 A;  2HI0 A;  1OUQ A;  2JGA A;  3H4D A;  3PZP A;  1S0N A;  4KX3 A;  2W11 A;  1U47 A;  2HBJ A;  2AQ0 A;  4UB3 A;  3GIJ A;  4QZG A;  3KZX A;  2XY6 A;  5IIO A;  3M8R A;  1KFD A;  5KFV A;  2OM6 A;  2LYH A;  4C0Z A;  3UPQ A;  2J6T A;  5AI0 A;  3V6K A;  2JXJ A;  1DGJ A;  2A3V A;  4C4T A;  8ICA A;  3LYS A;  8ICH A;  3ONN A;  3A0H U;  1BPD A;  4BWM A;  2RP5 A;  5AM0 A;  4KLG A;  4JMU A;  1H38 A;  4K4G A;  2RDJ A;  3LDA A;  2BCQ A;  5L1M A;  5DB9 A;  1NK5 A;  1MQ2 A;  2E8P A;  2ZIU B;  1SV4 A;  1N61 A;  4ICA A;  3V6H A;  2L5Y A;  2KFZ A;  1NK4 A;  5AM4 A;  2VJ5 A;  4DFP A;  4NLZ A;  3IV6 A;  5ALZ A;  5AI6 A;  5D46 A;  2I5H A;  2FPK A;  1SKR A;  2C2E A;  4US9 A;  1KQQ A;  4EBD A;  1KDH A;  3TQ1 A;  5KT4 A;  4EBE A;  2BR0 A;  3Q8P B;  1PK1 B;  3LVV A;  2OCE A;  7ICP A;  4O3Q A;  2AQ4 A;  7ICT A;  3MFI A;  5KL8 B;  4LZD A;  2KE7 A;  4UAV A;  9ICJ A;  2HOI A;  1J97 A;  4M9L A;  1TE2 A;  4RNN A;  5HR7 A;  5CP2 A;  9ICE A;  1ZQP A;  4O3M A;  1RDF A;  4QWC A;  4A8E A;  2I9G A;  4M2Y A;  3RRH A;  3PW2 A;  4KLF A;  3CNH A;  1S97 A;  2CPR A;  3G6X A;  4EBC A;  4UAU A;  2R8I A;  4AYB C;  4Z6F A;  2EZZ A;  5EWE A;  1U4B A;  4I2D A;  9ICR A;  2KZ3 A;  3NS1 A;  2AJQ A;  3NRW A;  2QAR A;  3G6Y A;  4DLE A;  5EWG A;  4B9L A;  4UAW A;  1JN3 A;  2FPM A;  3AU6 A;  1L7O A;  4FS1 A;  2C22 A;  3BDP A;  2XIC A;  1XC9 A;  3Q8R B;  1SB3 C;  4RPX A;  2FJ6 A;  4UQG A;  9ICN A;  5DDM A;  2K89 A;  1RZT A;  3S6J A;  5KAF U;  4CRX A;  2YQE A;  4DOA A;  3UMG A;  1T94 A;  1SZP A;  4B9T A;  1N60 A;  1DK2 A;  2O6K A;  5ALD A;  1PVR A;  1KLN A;  4JV1 A;  5DDY A;  4RQ8 A;  2KNJ A;  2PI5 A;  4RQ7 A;  4IRD A;  3L5K A;  4OJP A;  3B9J A;  3L3F X;  4E0D A;  3EW9 A;  9ICQ A;  1OXJ A;  3IP4 B;  5KFO A;  4J9K A;  1L8L A;  2HHQ A;  1QSL A;  4OJ6 A;  3EPG A;  4Y2X A;  4OO1 J;  2JZB A;  4C8M A;  2LKY A;  3ZDC A;  3M6Z A;  3HKZ C;  4F72 A;  2ATL A;  1U48 A;  3PMN A;  2W9A A;  4RQ0 A;  4MEX A;  1IIP A;  4UB6 U;  1MC8 A;  3F5E A;  3TAR A;  3RJE A;  1ZD3 A;  2NRV A;  3AL0 B;  5DG9 A;  3V7K A;  4F5P A;  1FIQ A;  2LPE A;  4GC6 A;  3AM9 A;  3IG8 A;  4PL1 A;  4XQ8 A;  4I27 A;  4DCC A;  3ETR A;  4TQR A;  9ICB A;  4RUA A;  4NJ8 A;  1Z19 A;  3D2S A;  1ZQU A;  2ZUC A;  2YB4 A;  5HML A;  1SWW A;  4P0P A;  3C23 A;  1UHU A;  5KAI U;  2V4Q A;  4RQ6 A;  3WK5 A;  1QTM A;  9ICM A;  9ICO A;  1YZ6 A;  3PW5 A;  2NRT A;  3JPR A;  4B9S A;  3LWL A;  1TK0 A;  9ICA A;  5J2J A;  1EXN A;  5AI9 A;  2AXT U;  4CF4 A;  5JTI A;  1XWL A;  2IA6 A;  1CRX A;  2ODG A;  1RG6 A;  4QZC A;  1T7P A;  1X9X A;  4Y2Q A;  4KLE A;  1ZQF A;  7ICU A;  1SL1 A;  3C1Y A;  3JPT A;  3QE9 Y;  2P6U A;  2BCU A;  1L5U A;  4G3I A;  3UQ0 A;  3HIL A;  5F9L A;  2DBY A;  2EH9 A;  5F3X B;  3H8M A;  2YML A;  1ZQJ A;  2CXY A;  4P4M A;  3Q8K A;  1NNL A;  3NVY A;  4EX6 A;  4UB1 A;  3L4P A;  3MR5 A;  2GO7 A;  5J0O A;  3HRD D;  3ORY A;  4ED3 A;  5BOM A;  1ZD2 P;  4J9L A;  2ZJ5 A;  5B5E U;  3KBB A;  5AIA A;  3LWM A;  5AKX A;  4NV0 A;  1XSP A;  2KVS A;  3MR2 A;  3GU3 A;  3BZK A;  4OD0 A;  1V9P A;  2F2A B;  4QNL A;  5DB8 A;  3FAH A;  8ICY A;  3QU5 A;  2BCR A;  3SEN A;  2Y9T A;  4Q8E A;  4UBC A;  4Z6D A;  3QUC A;  2EDU A;  1A76 A;  2V4R A;  4GXJ A;  3SMV A;  2KSO A;  4PHP A;  5ALN A;  1NK9 A;  1D9F A;  2HBM A;  4ECR A;  2ES6 A;  2CN1 A;  4F4X A;  1U9L A;  3ZI4 A;  4C4S A;  5KFA A;  2EZX A;  1COO A;  4O5K A;  4ECQ A;  4MFA A;  3MC1 A;  3QXG A;  4YP3 A;  3HX0 A;  3PW4 A;  3LVW A;  2AGQ A;  4DQP A;  4K4H A;  5ALO A;  4DF8 A;  1XU4 A;  4CE6 A;  4F71 A;  1S10 A;  2AGO A;  5C5J A;  4ACO A;  4P0Q B;  4CF3 A;  4DO9 A;  2BQR A;  3H8J A;  4RT2 A;  4DSF A;  2J6S A;  1XSN A;  1RYR A;  1Z4N A;  2K4I A;  2XY5 A;  3KTQ A;  1WG8 A;  1HJP A;  4TQS A;  3MDC A;  4UB2 A;  5KG0 A;  3MGV A;  1X9S A;  4XA5 A;  5HNK A;  3GZF A;  3C29 A;  1L6N A;  1J2M A;  5ALX A;  5L1J A;  2JH7 A;  2KKV A;  9ICT A;  1ZXI A;  1KEJ A;  3BZC A;  3F53 A;  4PPX A;  5ALF A;  5AKJ A;  2WHE A;  3M1Y A;  5ALY A;  4UAS A;  2ZUB A;  3C2K A;  4RUC A;  3WU2 U;  5KFY A;  4P4O A;  4J9O A;  3M6K A;  2FLL A;  2F3N A;  4LVS A;  4ECW A;  4IRC A;  2KV2 A;  1QCK A;  4DL6 A;  3RJF A;  5GTI U;  4QZ8 A;  4J9M A;  1P7D A;  3SZ2 A;  5AKI A;  1JX4 A;  9ICP A;  3PML A;  3SR6 A;  4Y2J A;  4I2F A;  2XC9 A;  2K4H A;  2KTQ A;  3JPQ A;  3QEA Z;  5KFG A;  5CWR A;  3OPX A;  9ICF A;  8ICT A;  1F5S A;  5EE3 A;  4F4K A;  3MAB A;  2W9C A;  1B0X A;  3D2Q A;  3T5L A;  3H0M B;  2BZF A;  2W3R A;  8ICG A;  2GOL A;  4QZD A;  4YD1 A;  5KFJ A;  4KN7 A;  1VJ5 A;  4DS4 A;  4GFJ A;  3PR4 A;  2JV3 A;  3GFK B;  4R8U B;  1URJ A;  5DGB A;  2G06 A;  4FFD A;  4DSL A;  2HW3 A;  2KHV A;  1L3T A;  3AN1 A;  5J0R A;  4QWE A;  3K4G A;  4CNQ A;  3ZDE A;  3PY8 A;  1NKB A;  2KMD A;  2ZIV B;  2WB1 F;  2F76 X;  8ICQ A;  5BPC A;  5J29 A;  4C7Y A;  2AH5 A;  2P35 A;  2DPJ A;  4I2G A;  1NJW A;  1LKY B;  9ICL A;  2WF6 A;  4IQV A;  1SXD A;  4IQT A;  3IHQ B;  2DGZ A;  1Z00 B;  3C5F A;  1TAQ A;  5KFW A;  1ZQN A;  4J9N A;  8ICZ A;  1N2X A;  1TK8 A;  1TFR A;  1ED1 A;  4OCZ A;  1T8E A;  2V9W A;  1WWV A;  5KFM A;  2HHX A;  3OSN A;  1ZD5 A;  3N7P D;  4CGZ A;  4QWB A;  2K8C B;  1PVP A;  8ICC A;  1ZQT A;  2FMS A;  4XRH A;  5L1I A;  3JPS A;  2LM4 A;  2GWS A;  2YB1 A;  2FE9 A;  1DRG A;  2QKQ A; 
#chains in the Genus database with same CATH homology
 3IDW A;  1Z1V A;  2YTU A;  2ES6 A;  2K4P A;  3KKA C;  4RQM A;  2EAM A;  4RQN A;  1PK1 A;  4NL9 A;  4NL9 C;  1KW4 A;  1V38 A;  1OW5 A;  1B0X A;  1V85 A;  1JI7 A;  2F44 A;  1X66 A;  3BS5 B;  3SEI A;  2QAR A;  2QB0 B;  1B4F A;  5JTI A;  2JV3 A;  1RG6 A;  2EAO A;  3K1R B;  2DKZ A;  5J8Y A;  1X9X A;  4PZO A;  2QB1 A;  1UCV A;  2DKX A;  5KNI A;  3HIL A;  2KMD A;  2K60 A;  3BS5 A;  5F3X B;  3H8M A;  3TAC B;  1SXE A;  5L1M A;  5JRT A;  1LKY B;  1WWU A;  2E8M A;  2ESE A;  2E8P A;  2EAN A;  2QB0 A;  2KIV A;  1SV4 A;  1SGG A;  1OXJ A;  2E8N A;  2L5Y A;  1DXS A;  2KG5 A;  2F8K A;  1SXD A;  1F0M A;  5J8Y C;  4MHV A;  2Y9U A;  3BS7 A;  2D8C A;  1SV0 A;  1SV0 C;  3TAD A;  2KSO B;  3TAD C;  3BQ7 A;  5JU5 A;  1UQV A;  2E8O A;  2B6G A;  2EAP A;  2DL0 A;  2F3N A;  1PK1 B;  1WWV A;  3KKA A;  1LKY A;  1X40 A;  2QAR B;  4IS7 A;  3SEN A;  2KE7 A;  2LPE A;  2Y9T A;  2D3D A;  1COK A;  2GLE A;  2LMR A;  4NJ8 A;  1PK3 A;  2FE9 A;  2KSO A;  2QKQ A;  4PZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...