5JTIA

Crystal structure of the human tankyrase 1 (tnks) sam domain (d1055r), crystal form 2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
63
structure length
63
Chain Sequence
LDMNISQFLKSLGLEHLRDIFETEQITLRVLADMGHEELKEIGINAYGHRHKLIKGVERLLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Tankyrase-1
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 63
sequence length 63
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jtiA00
4NJ8A 4NL9A 3TADA 2D8CA 4NL9C 1B0XA 3TADC 1X40A 1SXDA 2YTUA 1COKA 5L1MA 2E8PA 3BS5A 1Z1VA 3TACB 2EAOA 2Y9TA 2EAPA 1SXEA 1LKYB 5JTIA 5JU5A 1PK1B 1WWUA 4PZOA 1OW5A 1OXJA 1RG6A 1SGGA 1SV0A 1V85A 1X9XA 4MHVA 1SV0C 2KE7A 1F0MA 1B4FA 2E8OA 2QKQA 3K1RB 2ESEA 2KIVA 3H8MA 2KMDA 2QARB 1UCVA 2F44A 4RQNA 3SENA 1PK3A 5JRTA 2JV3A 2ES6A 3HILA 1KW4A 1UQVA 2B6GA 2KSOB 3IDWA 2K60A 2Y9UA 1LKYA 2E8MA 2QB0B 5F3XB 1PK1A 2D3DA 3KKAA 2KSOA 2K4PA 1X66A 3KKAC 2FE9A 4PZNA 4RQMA 2QB0A 2KG5A 5J8YC 3BS5B 2DKXA 2F3NA 2QARA 2F8KA 2LMRA 2DL0A 1SV4A 2LPEA 2GLEA 2DKZA 1JI7A 3SEIA 4IS7A 2QB1A 3BS7A 2L5YA 5J8YA 5KNIA 3BQ7A 2EAMA 1WWVA 2E8NA 1DXSA 2EANA 1V38A
chains in the Genus database with same CATH superfamily
4EEKA 1ZRNA 4O9MA 4PH5A 1WG8A 2G0AA 4M04A 4IC9A 3M8SA 1TVAA 2VANA 8ICRA 3C1YA 2Y9TA 1LKYB 1D9DA 2PFOA 4KLUA 2YB4A 9ICBA 5DQHA 2VJ4A 2HMXA 2ZUCA 3JPRA 1JALA 4EYHB 4RZRA 2KFZA 3N97B 4RUCA 1Q8KA 4EZ6A 1GO3F 5KFVA 4MHVA 3KHLA 1ZQGA 1SV0C 4DSLA 4P0PB 3CRXA 1TK0A 3ED5A 4TUQA 5AKGA 3Q8KA 2KMDA 1S5LU 4QW8A 3KFUF 9ICHA 2KZMA 4PGXA 1ZRMA 1EXNA 3ETRA 3NS1A 4FZNA 3Q8PB 5ALKA 3RFAA 2QB0B 4M6WA 1J2NA 1URJA 5IINA 2K89A 4DEZA 1MQ3A 5KFYA 4RNNA 2NV3A 3B0XA 4J9QA 2WB1C 5AKHA 4C8MA 3SD7A 2P6UA 1PZNA 4K4HA 3NRWA 4KLQA 4PHEA 1VJ5A 2WTFA 1NK7A 4NLKA 1WCLA 4ELTA 3L5KA 2CRXA 2CN1A 3T5LA 1ZQHA 5KG7A 5J8YA 1XO0A 4EZ9A 2E8NA 2AHOB 5J0QA 3OSPA 4Y2SA 2ZIXB 1RQLA 3JPNA 4O3NA 1ZQBA 1L3TA 1BVSA 2HHSA 7ICTA 1HUZA 2JGAA 1SZPA 5G5GA 1SIJA 2F77X 2JH7A 1KQQA 5EWGA 4U6PA 1JROA 2FLPA 1ZQNA 1XSNA 2HSZA 5HHHA 5JTIA 5AM3A 1CUKA 3B9JA 1ED1A 1X9XA 5KG5A 1RXVA 2PMZF 2ZIVA 3L4PA 3TQ1A 4MEXA 3T3FA 2KIVA 1TFRA 5J2FA 2I1QA 4KLSA 8ICLA 5DG8A 7ICJA 3BZCA 3AL0B 3QU9A 2LHTA 2XY5A 4I2FA 5KT2A 2Y0SC 2LM1A 2RHFA 2K60A 3V7LA 3AM9A 2FMPA 1S8OA 5J0WA 5ALTA 5IILA 4QJFB 3VC8A 1N61A 2BPFA 2HBLA 3WKCA 4ED8A 1ZQYA 2A3VA 2PFPA 4YMOA 1FFUA 2I9GA 3R9KA 3C23A 1U47A 3BS5B 4QIWF 4F5QA 3DEEA 5T14A 2ODGA 1A76A 1ZQRA 1B22A 3ZD9A 5DBCA 8ICHA 1M6YA 5ALRA 2D6FC 4RQ6A 3IV6A 3QX7A 5AM1A 4GC6A 2V4QA 2ZUDA 3T5JA 3WK8A 1WWVA 1SB3C 2BKEA 3OHAA 3OGUA 4I2HA 4NM1A 1N2XA 4QZFA 5DG7A 5DKWA 4QWBA 2PI4A 2BCQA 3F5AA 4CF4A 3RJIA 2C2RA 1Z1VA 2VKQA 1WYGA 4YG2A 2B0CA 3BQ2A 4DQPA 1S0MA 3WKAA 3UM9A 1WWUA 4XQ8A 3QNMA 4KLDA 2KHQA 1ZOLA 4M9HA 4NLNA 5IIOA 5KG2A 4J9OA 3C5GA 8ICMA 4AP9A 4M9JA 4DS4A 4LZGA 3E0FA 3VCBA 4OJ5A 2W54A 2XGQA 1VDVA 4BWMA 3TAPA 4CRXA 3PO5A 4J9KA 7ICPA 2JV3A 5A0LA 7ICUA 4ECZA 1KTQA 4I2BA 2K8BB 2AJQA 8ICUA 3KZXA 1Z00A 4I2JA 1XS9D 1L8OA 4TQRA 1SKSA 2ZJ8A 2I6XA 4I2AA 3JPSA 2AGPA 4DL3A 1N5XA 2JZBA 4F92B 5AI8A 3UPQA 5KL1B 5H2FU 1SV4A 3E2EA 4O5EA 8ICKA 9ICKA 2AU0A 4MF8A 4YQWA 7ICVA 2BQRA 2BDUA 4JV2A 1JXLA 3BS7A 2LYAA 1OUQA 1RYRA 2KN7A 2KFNA 1ZQXA 1Q46A 3K1ZA 2EZXA 5KFHA 2EANA 5AK5A 3WU2U 4ACOA 3IN5A 2OWOA 3I28A 5J0SA 3TADA 5KG1A 3WK4A 4DQQA 3MR6A 2ZIUB 2JEJA 3RJKA 2RP5A 3RB6A 1L7PA 5KFLA 1L3VA 2ZJ5A 3T5HA 2HOQA 1ZQJA 2HHUA 4ECWA 2E1EA 2GO7A 4UB3A 3ZDCA 3MR3A 1X6JA 2LM4A 2HW3A 5ALOA 5KFIA 3LWMA 1D9FA 1UCVA 1YT3A 5ALJA 2LYHA 8ICCA 1PK3A 1MN8A 5JRTA 3UQ2A 3GU3A 1KDHA 3PW0A 5KFRA 4C4TA 1LKYA 4JUZA 4UB6U 2E8MA 3RF9A 2XCPA 4K4IA 1S0OA 2AQ4A 1KBUA 1MC8A 5K4LA 1JMSA 3KKAA 2YMMA 1RM6C 2W11A 4YD1A 4RQMA 5EE9A 3PSIA 4P0PA 5ALYA 2VA8A 1COOA 3EW9A 2DKXA 1QSLA 3SR6A 2XI9A 9ICSA 1Z19A 3TANA 5ALFA 1DK2A 2KTQA 1TK5A 1KFDA 4I2GA 3KHRA 4DSEA 5J2JA 3QEAZ 1RXWA 1ZQEA 5CJ7A 2WHEA 4Z6CA 7ICFA 8ICNA 1QSYA 1ZQFA 5GTHU 4Q8FA 4BX9C 3T79A 4QWEA 2M0NA 4PHDA 3PW2A 4Q44A 4FS1A 4FS2A 1D8LA 1SZHA 5IIJA 4BXOB 4F72A 2HOIA 2ZTDA 4F2SA 3EWAA 4B9TA 2P6RA 2NRTA 2QKQA 3K75D 5B66U 5KFFA 4UB1A 1AQ6A 1ZQZA 3JPQA 5ALEA 3H8JA 1MQ2A 1FEZA 2G5HB 4US9A 3H4BA 4EBCA 5KFXA 4BJQA 9ICNA 3MR2A 2FJ6A 1N62A 9ICWA 2PMZC 4TQSA 2IA6A 2RLTA 4QZIA 1N56A 2YB1A 3D2NA 1DGSA 1U9LA 3AMZA 3SYZA 1FO4A 3BQTA 4PZNA 1IIPA 5L1IA 3H0MB 4ECUA 4DS5A 4CE6A 4GFJA 1UA1A 2F3NA 2AQ0A 3HX0A 3KHGA 5ALGA 4JK1A 1JRPA 5KT6A 8ICWA 1BGXT 3HT3A 3H8SA 2NRZA 2P35A 3AU2A 3PW4A 1NOMA 3C28A 4OO1J 4PHAA 4DFJA 4OD0A 2RQ5A 3OTQA 3RH4A 4LJXA 3IM1A 3KD3A 7ICEA 2W9AA 4O3PA 1LV5A 5KFJA 3UXPA 3BDPA 4NJ8A 2ZJAA 5J0TA 4DOBA 1Z4OA 1NK0A 4PGQA 3WK9A 4KX3A 1XNSA 3I76A 3BS5A 5AK4A 3ISBA 3RB0A 2BDPA 4FZLA 2ALZA 5ALXA 3UMBA 1D8YA 1F44A 5CA7A 3RRHA 5JU5A 4UB2A 5EE3A 2HHVA 3QU2A 3GIKA 3N7SC 1RG6A 4E0DA 5CR0A 1QQ7A 3Q8SB 4NLGA 8ICXA 5DBBA 8ICPA 2KHVA 2K4IA 1X9WA 2NRWA 4DFDA 4F5PA 3PMLA 5CRXA 1A77A 1ZQLA 2E3TA 2DWQA 3FYHA 1SL2A 1B43A 3M1YA 5CB1A 4WJ3B 4I2DA 2W9MA 2PFNA 1BPYA 3GQCA 1C7YA 1UQVA 4ICAA 3IDWA 2Y9UA 4U7CA 4B9VA 2F1IA 2OEHA 3H40A 1QTMA 5AK6A 4O5CA 3GILA 3PMNA 3OJUA 3C2MA 5KFUA 4J9MA 3RAQA 4B9LA 1ZQDA 1RPLA 4F4YA 2KKPA 4JV0A 2HBJA 5CP2A 4DFPA 2LBOA 1NK5A 2FI1A 9ICAA 4DL2A 4F4ZA 2W8KA 4IQUA 3RB3A 1JI7A 4YVZA 1ZD5A 2EQYA 5J2IA 3SV4A 4UARA 2BZFA 5HNKA 3H0RB 4MEYA 1T3NA 1DGJA 3KBBA 1S77D 2KP7A 3MGIA 4NL9A 1X2IA 3CW2C 2HCFA 4DF8A 5KFTA 2BCUA 1COKA 3QYPA 1BPDA 4UAVA 2KZ3A 9ICLA 5DB9A 2EAOA 3TARA 8ICIA 8ICJA 1NJXA 3RTVA 9ICTA 3GV7B 7ICQA 2FPMA 4I2CA 4KMOB 4MFCA 1KEJA 2F8LA 3IHQB 1PK1B 4UBBA 5J0OA 1VLBA 4UAZA 3MFHA 2EDUA 2C28A 2P66A 3OSNA 3AN1A 4YXMA 4F91B 2OYYA 4FBUA 3HP6A 4PL1A 4IQTA 4RQ7A 3KOOA 3HW8A 1SWVA 4XRHA 9ICOA 1JN3A 4OJPA 2RDJA 2ZIUA 2V9WA 4DO9A 3PO4A 2FPKA 1QQ6A 3ONNA 4YR3A 3THVA 1S0NA 1N63A 4ECTA 5BOMA 2XO7A 3KTQA 2KOBA 5KFSA 3N7RC 2H3QA 3ETLA 5AIAA 1U4BA 1V97A 2MU2A 4OJ6A 4BDPA 4OJOA 4YCXA 2DQNB 2KSOA 3I1YA 2WFAA 1NK6A 4QZEA 3KHHA 2JEFA 3DV9A 5J2BA 4I2EA 1CEZA 1X6IA 1NI3A 4UAYA 3SMVA 4DCCA 1L7NA 4J9PA 3FM9A 1ZQMA 5KG0A 2PXIA 4XUSA 2HHWA 4F71A 2PI5A 4K4GA 2RDIA 5KFQA 2MSNA 4IS7A 5KFZA 2R8JA 3JPTA 3PW5A 3WKBA 4J9LA 5J0UA 2AXTU 2FDRA 1JX4A 2UVVA 3M7DA 2EZYA 3TADC 4I28A 4F5NA 1C20A 2N1RA 1U49A 3E58A 2HBKA 4OCZA 8ICAA 3TACB 4P4PA 2XVTA 1T7PA 2W3SA 1KL9A 2C2DA 3RBDA 2BPCA 1CRXA 2J6UA 1TAQA 5TZVA 5G5HA 5AKXA 5J2KA 2KICA 4LZDA 1ZQCA 1F0MA 2MUTB 4RQ2A 1Z4NA 2WAQC 3K1RB 4KLMA 2QARB 1HEKA 4RNOA 2VJ5A 2IOFA 2WF6A 4J9RA 1IV8A 4FZMA 4IQVA 3TKAA 1NK9A 2R8KA 2YMLA 4ECYA 4NXZA 3TFSA 1Q3UA 4M9NA 1KRPA 3M6KA 5KFEA 3FDSA 3MC1A 4BXOA 3KKAC 4IRDA 1L8LA 1QSSA 1BPBA 1PVQA 3UXOA 3MR5A 1HUOA 4KLTA 4BWJA 3PW7A 3GZFA 3EPGA 4M0AA 2E5SA 3N7PD 5ALLA 3F2BA 2DBYA 4RPXA 4DQSA 2KJ9A 2LPEA 5J2CA 9ICXA 4PJ0U 3UMCA 1XO1A 5D46A 3NVVA 4NLCA 4RPYA 3SEIA 5KFCA 4MFAA 4DOAA 3ZDBA 1IM4A 2BCVA 3FAHA 9ICIA 4I29A 2W9BB 1N60A 2W04A 5HR6A 2HI0A 3ZDAA 2W8LA 2YN4A 5AKZA 5AI9A 2YY6A 5DGBA 1SXEA 2F76X 2IOFK 1KN5A 4EYIB 4O3QA 4UB8U 1X9MA 1SGGA 4J03A 1SL1A 2O6KA 3GFKB 5ALSA 1O03A 2KJ5A 2E8OA 4RQ0A 3SQIA 4QZAA 2H3IA 2ESEA 4RQNA 4GC7A 5DDYA 3M8RA 1ZETA 3WKEA 2BCRA 1NJYA 2W03A 1IXRA 5CWRA 1QLNA 7ICSA 5J0XA 2JHDA 1TK8A 1JIHA 2KSOB 5EOZA 3ORYA 2C22A 2FMSA 4F5RA 3SAGA 4EENA 4ZH4A 4EX6A 4ED1A 4USAA 4QWAA 2G06A 4F3OA 5ALVA 2OCEA 1NZBA 1J2MA 4J9NA 1RQNA 2NRXA 5KG3A 3RRGA 1YZ7A 4TURA 5J2HA 2JMGA 1TV9A 3Q8RB 5AM0A 1D8BA 2W7PA 2NYVA 2GLEA 4EEYA 1ZQSA 4DLEA 1K1QA 1ZD2P 3N28A 4B9SA 5KNIA 2XC9A 4RQ3A 2G08A 2YMPA 4RQ5A 4TUSA 1L6NA 1WUDA 2W43A 1T94A 5DDMA 4PHPA 3HPOA 1FFVA 3GV8B 7ICRA 2OXOA 5L1MA 3HWTA 3RJGA 2BHNA 4NLBA 3WKDA 4MFFA 1BNPA 1XU4A 2F2AB 2A1JB 5J2AA 5AKJA 3QUCA 2AGQA 5AHXA 1S97A 5L1KA 1IG6A 2YX8A 2I5HA 1NNLA 5AKYA 2V4RA 3EUB2 1L3SA 5IIMA 5ALUA 2WAQF 3SV3A 5L1JA 1Y88A 5E79U 3J81j 3IG8A 4YXJA 2IHNA 5EWFA 5ALQA 3IG5A 3MABA 3MFIA 5KTQA 3BZKA 3QUTA 2LYBA 3PSPA 3GDXA 2G07A 5DB7A 1PK1A 4Y2XA 2OH2A 3PR4A 3RH6A 2VA2A 4NM2A 3TFRA 4US8A 2XGPA 3QE9Y 4UQGA 4DF4A 4C4RA 1K5OA 5KFGA 1AROP 5KG6A 3LWLA 3O0FA 1KKXA 2GWSA 2F8KA 2DL0A 1KLNA 1ZYQA 2GOLA 2OM6A 3UMGA 4P4OA 2NRVA 4Z6DA 1BPZA 3MGVA 4KTQA 4DL5A 1H38A 3RJHA 4ZOHC 1P7DA 1SWWA 1NKCA 4NLZA 4RT2A 1S10A 1DXSA 4UBCA 1A0PA 3UXNA 5J0RA 3NTUA 3EPIA 4NL9C 3PR5B 1SXDA 2DFLA 3AQFA 2E8PA 4ECXA 8ICYA 2JH1A 3GV5B 3A0HU 1ZQOA 2Q0ZX 5C5JA 2H5XA 5D49A 8ICGA 4RU9A 3RB4A 3S6JA 4F8RA 2KIWA 8ICOA 4PZOA 1OW5A 4QZCA 4EBEA 1V85A 3U26A 5L1LA 2FMQA 3M9OB 2HHQA 4GXKA 4GXJA 2B21A 3AUOA 1B4FA 4RNMA 1NKEA 3H4DA 2DGZA 7ICOA 2W9CB 1J97A 4GIBA 4C8NA 3SENA 4R66A 3EYZA 4UB4A 5JUMA 2VA3A 4F2RA 5KL8B 3H8WA 1ZQWA 2ZXIA 2ZUBA 1NK4A 3V6KA 3Q8MA 8ICZA 8ICQA 1XWLA 3C2LA 2FLNA 2ISPA 4F5OA 1S9FA 2K4PA 3QU4A 2J6TA 2ASJA 5ALWA 1ZQTA 4IRCA 4Q45A 2MUTA 4M47A 3PSTA 5KT3A 3SZ2A 7ICLA 3EZ5A 3D2SA 2AH5A 3G6VA 4BUGA 2QARA 5ALDA 1KFTA 1YZ6A 2XICA 5J29A 4P0QA 4KLHA 5AM2A 2M9NA 1X42A 7ICGA 3NUQA 2QB1A 4Y2JA 3D6JA 3NVYA 1RZTA 4Q43A 4RT3A 4ELUA 1BNOA 1QQ5A 3LDAA 3LYSA 2BGWA 1V38A 4DL4A 1NJZA 2YMQA 2JEGA 1X9SA 3LVVA 4X5VA 4J9SA 1N5WA 3L3FX 1UHUA 4DOCA 5EWEA 4O3SA 4FE3A 4QW9A 3RAXA 4UB5A 1T4GA 3ZDDA 9ICEA 2KV2A 4F93B 4B9NA 2BQ3A 2FPLA 4Y2VA 4CF5A 1UPHA 1OXJA 3GIJA 3IP4B 1NZPA 4A8EA 1XC9A 1RYSA 3DDHA 2QLTA 1ZQVA 4ECSA 8ICFA 4UAUA 4QZ8A 4JB3A 2W9BA 5IIKA 4O5KA 3OPXA 4YR2A 4YMMA 3PX6A 4DQRA 3V72A 2KZZA 2LKYA 5DLGA 4UW9A 4CNQA 4RQ1A 3CP8A 1L7OA 2R8GA 3AQEA 1JXEA 2DPJA 2HBMA 1ZQIA 2ZIWA 4EBDA 3H0LB 4IR1A 4DLGA 4KLIA 2KNJA 2KVCA 4NWIA 3ALRA 4ELVA 1MA7A 5AKLA 2XIDA 2F1HA 3V7JA 2R18A 4I27A 9ICVA 5KFPA 4M2YA 2ASLA 4KLGA 2DKZA 2KJ8A 2BR0A 4O3RA 2H3FA 2K8AA 4PPXA 1HJPA 2IHMA 4Y2RA 2W55A 2HOFA 2EAMA 2W7OA 4M9LA 1UT5A 1SKWA 3LVWA 1T3QA 3V6HA 1LVHA 5KT5A 5IIIA 1TE2A 3ZI4A 4AYBC 4UASA 2Y1JA 1X40A 2EAPA 1RDFA 3QU5A 3PSFA 1N48A 4KLJA 4RPZA 9ICUA 4R65A 2HHTA 1BPXA 4YR0A 3C2KA 1HIWA 1L7MA 1ZQPA 3ZDEA 4KX5A 4RUAA 1SV0A 2WF5A 4G9BA 4QZHA 1TKDA 4O0IA 4KLEA 4Y2QA 3QU7A 4CDGA 5AI4A 2H3VA 3GIMA 2BQUA 2YQEA 2Q4TA 1JUDA 5KFBA 4YD2A 1KSPA 4IR9A 2W3RA 4FFDA 3SAHA 2ES6A 2F1JA 3MDCA 2B6GA 2CXYA 3OJSA 4KLOA 9ICGA 4YP3A 3QUBA 2G5IB 3V6JA 3GIIA 4DSJA 2A1JA 4F50A 2Y1IA 1DRGA 4HYKA 3MBYA 2RRDA 4CGZA 3JPOA 4ED2A 3QZ7A 2ZTEA 3SI8A 1ZD3A 3RJJA 3MGHA 3RJEA 4Y2PA 4P0QB 1TAUA 7ICNA 4DL6A 3AU6A 5J0YA 3F2DA 5DBAA 5KT4A 3UQ0A 4KLFA 5DLFA 4DSIA 2DUYA 2A19A 3WK7A 4CCHA 4MF2A 1A6SA 4GXIA 4ECRA 9ICJA 5KAFU 5C0YA 1XSPA 2ISOA 2JEIA 9ICRA 2L5YA 5KFAA 5ALPA 5AIBA 2VIXA 5BOLA 3MDAA 7ICHA 3RH5A 3HRDD 1PUZA 3IRUA 3RBEA 4PL2A 3TI0A 4JMUA 4EX7A 4Q8EA 7ICIA 4KMUA 5KAIU 5ALIA 2MRLA 4M9GA 5AKIA 4HAIA 3PVXA 2BCSA 2XY6A 4NY8A 4P2HA 5ALZA 4M6WB 3NGDA 4OJLA 2H3ZA 2Z7JA 3NASA 4QZDA 1WCNA 2E1FA 3HJEA 2KE7A 5DB8A 5KFOA 2CPRA 4DFKA 2ZXHA 3QXGA 4QNLA 1L5UA 4NV0A 3RR8A 3B0YA 9ICMA 2HVHA 3JPPA 1XSLA 3M6ZA 3PV8A 2WB1F 5KFMA 3C29A 4LVSA 2UVWA 2UVUA 3HILA 3PX0A 1PVPA 5HHIA 2EH9A 7ICKA 2ZIWB 4O3MA 2IMWP 1T8EA 3M9MB 2DF4B 5F3XB 2D3DA 2HVIA 1KFSA 2JRZA 1X66A 2LI6A 5ALHA 1ZQ1C 5FP0A 3WK6A 4XA5A 4EELA 5CHGA 3F5EA 5HMLA 2KG5A 4TUPA 8ICEA 3Q8QB 1ZD4A 2W9CA 2KVSA 4B9UA 4QWDA 3V7KA 5D4BA 8ICSA 3QUQA 4IRKA 2A1AA 5ALNA 1NK8A 4C80A 3SAFA 3KZIU 5KFDA 2KEYA 8ICTA 3RJFA 4R8UA 3C1ZA 4Y2YA 2ATLA 5J2EA 2ZIVB 3NVWA 3HKZC 5DGAA 4RQ4A 5KFNA 1U45A 5HMMA 1ZXIA 2J6SA 4DL7A 1MSWD 4AYBF 2YTUA 3G6YA 4I2IA 4P4MA 5AI5A 3NVZA 1O08A 1FIQA 1Q3VA 4C4SA 3Q8LA 1SL0A 2Y0SF 4Y2UA 1Z3EB 2R8IA 8ICBA 3M9NB 2FLLA 1ZJNA 2JXJA 4JWMA 3A0BU 3C5FA 4C8LA 2OHFA 5AICA 5DB6A 4ED6A 4O3OA 1Z1BA 5AM4A 3H8MA 2ASDA 3RR7A 4Z6FA 5KT7A 4DFMA 2F44A 5AK3A 1V9PA 1QCKA 4ECVA 2MA1A 4DSKA 2ZG6A 5B5EU 2IBKA 4KN7A 9ICQA 3TAQA 1KW4A 2DPIA 1ZQKA 2G09A 7ICMA 1NKBA 4QZBA 3ISCA 4ED3A 2BPGA 4Y2TA 5TISU 5BPCA 2FE9A 5KG4A 3OHBA 2QB0A 5J2GA 5AI6A 5AM5A 4B6JA 4PGYA 2PKEA 2KK0A 4CF3A 4R63A 2WF7A 5AI0A 2MAXA 4UATA 3G6XA 5L9XA 3LK9A 9ICPA 2AGOA 5GTIU 3N4MB 3NRZA 4FO6A 3PY8A 2XCAA 1K1SA 3C21A 3CNHA 5F9LA 2GH1A 3ICXA 4C7ZA 4JV1A 1L3UA 2UVRA 2PFQA 4DQIA 4G3IA 5HP4A 1S76D 1QH9A 3QEBZ 5EE0A 2D8CA 5AKEA 1ZJMA 1B0XA 4KITB 3BQ1A 4BGDA 5ALMA 4FBTA 4ED0A 2ZIXA 5KFWA 5J0PA 4IQWA 2NO4A 4QWCA 4C8KA 3PX4A 9ICCA 1Z00B 2KKVA 4GLXA 3AEVA 3F53A 4DSFA 3BJYA 2ZTCA 2K4EA 2JR5A 1NJWA 1CI4A 4IL6U 1ECWA 3T5KA 4QZGA 1PVRA 3WK5A 3PZPA 2NO5A 3QZ8A 5AKKA 4YN4A 2JZBB 2HDOA 5F9NA 5DG9A 4KLLA 4YMNA 1BPEA 1ZQAA 5KFKA 1TAMA 2WF8A 2HHXA 2EZZA 3ZD8A 4F4KA 1DK3A 4JWNA 2K8CB 4C8OA 5DQIA 5HR7A 3F2CA 8ICVA 3PNCA 5J2DA 3CYMA 4UAWA 4R64A 4B9MA 3ISDA 2WF9A 1S0VA 5DQGA 1LB2B 4QIWC 3H7IA 5J8YC 4DWIA 2KD1A 4ECQA 4RQ8A 5EE1A 2XY7A 4QZ9A 3FC4A 3K4GA 4Z6EA 2LMRA 4YFKA 4R8UB 2K4HA 1ZQUA 5CEHA 4ED7A 1RYUA 2R8HA 3BQ0A 1DOQA 2C2EA 3D2QA 1ZQQA 1UT8A 4F4XA 4C7YA 1U48A 9ICFA 2IOHA 4KN4A 4F4WA 3BQ7A 4C0ZA 1F5SA 1SKRA 1UA0A 3HKZF
chains in the Genus database with same CATH topology
4NJ8A 4NL9A 3TADA 2D8CA 4NL9C 1B0XA 3TADC 1X40A 1SXDA 2YTUA 1COKA 5L1MA 2E8PA 3BS5A 1Z1VA 3TACB 2EAOA 2Y9TA 2EAPA 1SXEA 1LKYB 5JTIA 5JU5A 1PK1B 1WWUA 4PZOA 1OW5A 1OXJA 1RG6A 1SGGA 1SV0A 1V85A 1X9XA 4MHVA 1SV0C 2KE7A 1F0MA 1B4FA 2E8OA 2QKQA 3K1RB 2ESEA 2KIVA 3H8MA 2KMDA 2QARB 1UCVA 2F44A 4RQNA 3SENA 1PK3A 5JRTA 2JV3A 2ES6A 3HILA 1KW4A 1UQVA 2B6GA 2KSOB 3IDWA 2K60A 2Y9UA 1LKYA 2E8MA 2QB0B 5F3XB 1PK1A 2D3DA 3KKAA 2KSOA 2K4PA 1X66A 3KKAC 2FE9A 4PZNA 4RQMA 2QB0A 2KG5A 5J8YC 3BS5B 2DKXA 2F3NA 2QARA 2F8KA 2LMRA 2DL0A 1SV4A 2LPEA 2GLEA 2DKZA 1JI7A 3SEIA 4IS7A 2QB1A 3BS7A 2L5YA 5J8YA 5KNIA 3BQ7A 2EAMA 1WWVA 2E8NA 1DXSA 2EANA 1V38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJ8 A;  4NL9 A;  3TAD A;  2D8C A;  4NL9 C;  1B0X A;  3TAD C;  1X40 A;  1SXD A;  2YTU A;  1COK A;  5L1M A;  2E8P A;  3BS5 A;  1Z1V A;  3TAC B;  2EAO A;  2Y9T A;  2EAP A;  1SXE A;  1LKY B;  5JTI A;  5JU5 A;  1PK1 B;  1WWU A;  4PZO A;  1OW5 A;  1OXJ A;  1RG6 A;  1SGG A;  1SV0 A;  1V85 A;  1X9X A;  4MHV A;  1SV0 C;  2KE7 A;  1F0M A;  1B4F A;  2E8O A;  2QKQ A;  3K1R B;  2ESE A;  2KIV A;  3H8M A;  2KMD A;  2QAR B;  1UCV A;  2F44 A;  4RQN A;  3SEN A;  1PK3 A;  5JRT A;  2JV3 A;  2ES6 A;  3HIL A;  1KW4 A;  1UQV A;  2B6G A;  2KSO B;  3IDW A;  2K60 A;  2Y9U A;  1LKY A;  2E8M A;  2QB0 B;  5F3X B;  1PK1 A;  2D3D A;  3KKA A;  2KSO A;  2K4P A;  1X66 A;  3KKA C;  2FE9 A;  4PZN A;  4RQM A;  2QB0 A;  2KG5 A;  5J8Y C;  3BS5 B;  2DKX A;  2F3N A;  2QAR A;  2F8K A;  2LMR A;  2DL0 A;  1SV4 A;  2LPE A;  2GLE A;  2DKZ A;  1JI7 A;  3SEI A;  4IS7 A;  2QB1 A;  3BS7 A;  2L5Y A;  5J8Y A;  5KNI A;  3BQ7 A;  2EAM A;  1WWV A;  2E8N A;  1DXS A;  2EAN A;  1V38 A; 
#chains in the Genus database with same CATH topology
 4EEK A;  1ZRN A;  4O9M A;  4PH5 A;  1WG8 A;  2G0A A;  4M04 A;  4IC9 A;  3M8S A;  1TVA A;  2VAN A;  8ICR A;  3C1Y A;  2Y9T A;  1LKY B;  1D9D A;  2PFO A;  4KLU A;  2YB4 A;  9ICB A;  5DQH A;  2VJ4 A;  2HMX A;  2ZUC A;  3JPR A;  1JAL A;  4EYH B;  4RZR A;  2KFZ A;  3N97 B;  4RUC A;  1Q8K A;  4EZ6 A;  1GO3 F;  5KFV A;  4MHV A;  3KHL A;  1ZQG A;  1SV0 C;  4DSL A;  4P0P B;  3CRX A;  1TK0 A;  3ED5 A;  4TUQ A;  5AKG A;  3Q8K A;  2KMD A;  1S5L U;  4QW8 A;  3KFU F;  9ICH A;  2KZM A;  4PGX A;  1ZRM A;  1EXN A;  3ETR A;  3NS1 A;  4FZN A;  3Q8P B;  5ALK A;  3RFA A;  2QB0 B;  4M6W A;  1J2N A;  1URJ A;  5IIN A;  2K89 A;  4DEZ A;  1MQ3 A;  5KFY A;  4RNN A;  2NV3 A;  3B0X A;  4J9Q A;  2WB1 C;  5AKH A;  4C8M A;  3SD7 A;  2P6U A;  1PZN A;  4K4H A;  3NRW A;  4KLQ A;  4PHE A;  1VJ5 A;  2WTF A;  1NK7 A;  4NLK A;  1WCL A;  4ELT A;  3L5K A;  2CRX A;  2CN1 A;  3T5L A;  1ZQH A;  5KG7 A;  5J8Y A;  1XO0 A;  4EZ9 A;  2E8N A;  2AHO B;  5J0Q A;  3OSP A;  4Y2S A;  2ZIX B;  1RQL A;  3JPN A;  4O3N A;  1ZQB A;  1L3T A;  1BVS A;  2HHS A;  7ICT A;  1HUZ A;  2JGA A;  1SZP A;  5G5G A;  1SIJ A;  2F77 X;  2JH7 A;  1KQQ A;  5EWG A;  4U6P A;  1JRO A;  2FLP A;  1ZQN A;  1XSN A;  2HSZ A;  5HHH A;  5JTI A;  5AM3 A;  1CUK A;  3B9J A;  1ED1 A;  1X9X A;  5KG5 A;  1RXV A;  2PMZ F;  2ZIV A;  3L4P A;  3TQ1 A;  4MEX A;  3T3F A;  2KIV A;  1TFR A;  5J2F A;  2I1Q A;  4KLS A;  8ICL A;  5DG8 A;  7ICJ A;  3BZC A;  3AL0 B;  3QU9 A;  2LHT A;  2XY5 A;  4I2F A;  5KT2 A;  2Y0S C;  2LM1 A;  2RHF A;  2K60 A;  3V7L A;  3AM9 A;  2FMP A;  1S8O A;  5J0W A;  5ALT A;  5IIL A;  4QJF B;  3VC8 A;  1N61 A;  2BPF A;  2HBL A;  3WKC A;  4ED8 A;  1ZQY A;  2A3V A;  2PFP A;  4YMO A;  1FFU A;  2I9G A;  3R9K A;  3C23 A;  1U47 A;  3BS5 B;  4QIW F;  4F5Q A;  3DEE A;  5T14 A;  2ODG A;  1A76 A;  1ZQR A;  1B22 A;  3ZD9 A;  5DBC A;  8ICH A;  1M6Y A;  5ALR A;  2D6F C;  4RQ6 A;  3IV6 A;  3QX7 A;  5AM1 A;  4GC6 A;  2V4Q A;  2ZUD A;  3T5J A;  3WK8 A;  1WWV A;  1SB3 C;  2BKE A;  3OHA A;  3OGU A;  4I2H A;  4NM1 A;  1N2X A;  4QZF A;  5DG7 A;  5DKW A;  4QWB A;  2PI4 A;  2BCQ A;  3F5A A;  4CF4 A;  3RJI A;  2C2R A;  1Z1V A;  2VKQ A;  1WYG A;  4YG2 A;  2B0C A;  3BQ2 A;  4DQP A;  1S0M A;  3WKA A;  3UM9 A;  1WWU A;  4XQ8 A;  3QNM A;  4KLD A;  2KHQ A;  1ZOL A;  4M9H A;  4NLN A;  5IIO A;  5KG2 A;  4J9O A;  3C5G A;  8ICM A;  4AP9 A;  4M9J A;  4DS4 A;  4LZG A;  3E0F A;  3VCB A;  4OJ5 A;  2W54 A;  2XGQ A;  1VDV A;  4BWM A;  3TAP A;  4CRX A;  3PO5 A;  4J9K A;  7ICP A;  2JV3 A;  5A0L A;  7ICU A;  4ECZ A;  1KTQ A;  4I2B A;  2K8B B;  2AJQ A;  8ICU A;  3KZX A;  1Z00 A;  4I2J A;  1XS9 D;  1L8O A;  4TQR A;  1SKS A;  2ZJ8 A;  2I6X A;  4I2A A;  3JPS A;  2AGP A;  4DL3 A;  1N5X A;  2JZB A;  4F92 B;  5AI8 A;  3UPQ A;  5KL1 B;  5H2F U;  1SV4 A;  3E2E A;  4O5E A;  8ICK A;  9ICK A;  2AU0 A;  4MF8 A;  4YQW A;  7ICV A;  2BQR A;  2BDU A;  4JV2 A;  1JXL A;  3BS7 A;  2LYA A;  1OUQ A;  1RYR A;  2KN7 A;  2KFN A;  1ZQX A;  1Q46 A;  3K1Z A;  2EZX A;  5KFH A;  2EAN A;  5AK5 A;  3WU2 U;  4ACO A;  3IN5 A;  2OWO A;  3I28 A;  5J0S A;  3TAD A;  5KG1 A;  3WK4 A;  4DQQ A;  3MR6 A;  2ZIU B;  2JEJ A;  3RJK A;  2RP5 A;  3RB6 A;  1L7P A;  5KFL A;  1L3V A;  2ZJ5 A;  3T5H A;  2HOQ A;  1ZQJ A;  2HHU A;  4ECW A;  2E1E A;  2GO7 A;  4UB3 A;  3ZDC A;  3MR3 A;  1X6J A;  2LM4 A;  2HW3 A;  5ALO A;  5KFI A;  3LWM A;  1D9F A;  1UCV A;  1YT3 A;  5ALJ A;  2LYH A;  8ICC A;  1PK3 A;  1MN8 A;  5JRT A;  3UQ2 A;  3GU3 A;  1KDH A;  3PW0 A;  5KFR A;  4C4T A;  1LKY A;  4JUZ A;  4UB6 U;  2E8M A;  3RF9 A;  2XCP A;  4K4I A;  1S0O A;  2AQ4 A;  1KBU A;  1MC8 A;  5K4L A;  1JMS A;  3KKA A;  2YMM A;  1RM6 C;  2W11 A;  4YD1 A;  4RQM A;  5EE9 A;  3PSI A;  4P0P A;  5ALY A;  2VA8 A;  1COO A;  3EW9 A;  2DKX A;  1QSL A;  3SR6 A;  2XI9 A;  9ICS A;  1Z19 A;  3TAN A;  5ALF A;  1DK2 A;  2KTQ A;  1TK5 A;  1KFD A;  4I2G A;  3KHR A;  4DSE A;  5J2J A;  3QEA Z;  1RXW A;  1ZQE A;  5CJ7 A;  2WHE A;  4Z6C A;  7ICF A;  8ICN A;  1QSY A;  1ZQF A;  5GTH U;  4Q8F A;  4BX9 C;  3T79 A;  4QWE A;  2M0N A;  4PHD A;  3PW2 A;  4Q44 A;  4FS1 A;  4FS2 A;  1D8L A;  1SZH A;  5IIJ A;  4BXO B;  4F72 A;  2HOI A;  2ZTD A;  4F2S A;  3EWA A;  4B9T A;  2P6R A;  2NRT A;  2QKQ A;  3K75 D;  5B66 U;  5KFF A;  4UB1 A;  1AQ6 A;  1ZQZ A;  3JPQ A;  5ALE A;  3H8J A;  1MQ2 A;  1FEZ A;  2G5H B;  4US9 A;  3H4B A;  4EBC A;  5KFX A;  4BJQ A;  9ICN A;  3MR2 A;  2FJ6 A;  1N62 A;  9ICW A;  2PMZ C;  4TQS A;  2IA6 A;  2RLT A;  4QZI A;  1N56 A;  2YB1 A;  3D2N A;  1DGS A;  1U9L A;  3AMZ A;  3SYZ A;  1FO4 A;  3BQT A;  4PZN A;  1IIP A;  5L1I A;  3H0M B;  4ECU A;  4DS5 A;  4CE6 A;  4GFJ A;  1UA1 A;  2F3N A;  2AQ0 A;  3HX0 A;  3KHG A;  5ALG A;  4JK1 A;  1JRP A;  5KT6 A;  8ICW A;  1BGX T;  3HT3 A;  3H8S A;  2NRZ A;  2P35 A;  3AU2 A;  3PW4 A;  1NOM A;  3C28 A;  4OO1 J;  4PHA A;  4DFJ A;  4OD0 A;  2RQ5 A;  3OTQ A;  3RH4 A;  4LJX A;  3IM1 A;  3KD3 A;  7ICE A;  2W9A A;  4O3P A;  1LV5 A;  5KFJ A;  3UXP A;  3BDP A;  4NJ8 A;  2ZJA A;  5J0T A;  4DOB A;  1Z4O A;  1NK0 A;  4PGQ A;  3WK9 A;  4KX3 A;  1XNS A;  3I76 A;  3BS5 A;  5AK4 A;  3ISB A;  3RB0 A;  2BDP A;  4FZL A;  2ALZ A;  5ALX A;  3UMB A;  1D8Y A;  1F44 A;  5CA7 A;  3RRH A;  5JU5 A;  4UB2 A;  5EE3 A;  2HHV A;  3QU2 A;  3GIK A;  3N7S C;  1RG6 A;  4E0D A;  5CR0 A;  1QQ7 A;  3Q8S B;  4NLG A;  8ICX A;  5DBB A;  8ICP A;  2KHV A;  2K4I A;  1X9W A;  2NRW A;  4DFD A;  4F5P A;  3PML A;  5CRX A;  1A77 A;  1ZQL A;  2E3T A;  2DWQ A;  3FYH A;  1SL2 A;  1B43 A;  3M1Y A;  5CB1 A;  4WJ3 B;  4I2D A;  2W9M A;  2PFN A;  1BPY A;  3GQC A;  1C7Y A;  1UQV A;  4ICA A;  3IDW A;  2Y9U A;  4U7C A;  4B9V A;  2F1I A;  2OEH A;  3H40 A;  1QTM A;  5AK6 A;  4O5C A;  3GIL A;  3PMN A;  3OJU A;  3C2M A;  5KFU A;  4J9M A;  3RAQ A;  4B9L A;  1ZQD A;  1RPL A;  4F4Y A;  2KKP A;  4JV0 A;  2HBJ A;  5CP2 A;  4DFP A;  2LBO A;  1NK5 A;  2FI1 A;  9ICA A;  4DL2 A;  4F4Z A;  2W8K A;  4IQU A;  3RB3 A;  1JI7 A;  4YVZ A;  1ZD5 A;  2EQY A;  5J2I A;  3SV4 A;  4UAR A;  2BZF A;  5HNK A;  3H0R B;  4MEY A;  1T3N A;  1DGJ A;  3KBB A;  1S77 D;  2KP7 A;  3MGI A;  4NL9 A;  1X2I A;  3CW2 C;  2HCF A;  4DF8 A;  5KFT A;  2BCU A;  1COK A;  3QYP A;  1BPD A;  4UAV A;  2KZ3 A;  9ICL A;  5DB9 A;  2EAO A;  3TAR A;  8ICI A;  8ICJ A;  1NJX A;  3RTV A;  9ICT A;  3GV7 B;  7ICQ A;  2FPM A;  4I2C A;  4KMO B;  4MFC A;  1KEJ A;  2F8L A;  3IHQ B;  1PK1 B;  4UBB A;  5J0O A;  1VLB A;  4UAZ A;  3MFH A;  2EDU A;  2C28 A;  2P66 A;  3OSN A;  3AN1 A;  4YXM A;  4F91 B;  2OYY A;  4FBU A;  3HP6 A;  4PL1 A;  4IQT A;  4RQ7 A;  3KOO A;  3HW8 A;  1SWV A;  4XRH A;  9ICO A;  1JN3 A;  4OJP A;  2RDJ A;  2ZIU A;  2V9W A;  4DO9 A;  3PO4 A;  2FPK A;  1QQ6 A;  3ONN A;  4YR3 A;  3THV A;  1S0N A;  1N63 A;  4ECT A;  5BOM A;  2XO7 A;  3KTQ A;  2KOB A;  5KFS A;  3N7R C;  2H3Q A;  3ETL A;  5AIA A;  1U4B A;  1V97 A;  2MU2 A;  4OJ6 A;  4BDP A;  4OJO A;  4YCX A;  2DQN B;  2KSO A;  3I1Y A;  2WFA A;  1NK6 A;  4QZE A;  3KHH A;  2JEF A;  3DV9 A;  5J2B A;  4I2E A;  1CEZ A;  1X6I A;  1NI3 A;  4UAY A;  3SMV A;  4DCC A;  1L7N A;  4J9P A;  3FM9 A;  1ZQM A;  5KG0 A;  2PXI A;  4XUS A;  2HHW A;  4F71 A;  2PI5 A;  4K4G A;  2RDI A;  5KFQ A;  2MSN A;  4IS7 A;  5KFZ A;  2R8J A;  3JPT A;  3PW5 A;  3WKB A;  4J9L A;  5J0U A;  2AXT U;  2FDR A;  1JX4 A;  2UVV A;  3M7D A;  2EZY A;  3TAD C;  4I28 A;  4F5N A;  1C20 A;  2N1R A;  1U49 A;  3E58 A;  2HBK A;  4OCZ A;  8ICA A;  3TAC B;  4P4P A;  2XVT A;  1T7P A;  2W3S A;  1KL9 A;  2C2D A;  3RBD A;  2BPC A;  1CRX A;  2J6U A;  1TAQ A;  5TZV A;  5G5H A;  5AKX A;  5J2K A;  2KIC A;  4LZD A;  1ZQC A;  1F0M A;  2MUT B;  4RQ2 A;  1Z4N A;  2WAQ C;  3K1R B;  4KLM A;  2QAR B;  1HEK A;  4RNO A;  2VJ5 A;  2IOF A;  2WF6 A;  4J9R A;  1IV8 A;  4FZM A;  4IQV A;  3TKA A;  1NK9 A;  2R8K A;  2YML A;  4ECY A;  4NXZ A;  3TFS A;  1Q3U A;  4M9N A;  1KRP A;  3M6K A;  5KFE A;  3FDS A;  3MC1 A;  4BXO A;  3KKA C;  4IRD A;  1L8L A;  1QSS A;  1BPB A;  1PVQ A;  3UXO A;  3MR5 A;  1HUO A;  4KLT A;  4BWJ A;  3PW7 A;  3GZF A;  3EPG A;  4M0A A;  2E5S A;  3N7P D;  5ALL A;  3F2B A;  2DBY A;  4RPX A;  4DQS A;  2KJ9 A;  2LPE A;  5J2C A;  9ICX A;  4PJ0 U;  3UMC A;  1XO1 A;  5D46 A;  3NVV A;  4NLC A;  4RPY A;  3SEI A;  5KFC A;  4MFA A;  4DOA A;  3ZDB A;  1IM4 A;  2BCV A;  3FAH A;  9ICI A;  4I29 A;  2W9B B;  1N60 A;  2W04 A;  5HR6 A;  2HI0 A;  3ZDA A;  2W8L A;  2YN4 A;  5AKZ A;  5AI9 A;  2YY6 A;  5DGB A;  1SXE A;  2F76 X;  2IOF K;  1KN5 A;  4EYI B;  4O3Q A;  4UB8 U;  1X9M A;  1SGG A;  4J03 A;  1SL1 A;  2O6K A;  3GFK B;  5ALS A;  1O03 A;  2KJ5 A;  2E8O A;  4RQ0 A;  3SQI A;  4QZA A;  2H3I A;  2ESE A;  4RQN A;  4GC7 A;  5DDY A;  3M8R A;  1ZET A;  3WKE A;  2BCR A;  1NJY A;  2W03 A;  1IXR A;  5CWR A;  1QLN A;  7ICS A;  5J0X A;  2JHD A;  1TK8 A;  1JIH A;  2KSO B;  5EOZ A;  3ORY A;  2C22 A;  2FMS A;  4F5R A;  3SAG A;  4EEN A;  4ZH4 A;  4EX6 A;  4ED1 A;  4USA A;  4QWA A;  2G06 A;  4F3O A;  5ALV A;  2OCE A;  1NZB A;  1J2M A;  4J9N A;  1RQN A;  2NRX A;  5KG3 A;  3RRG A;  1YZ7 A;  4TUR A;  5J2H A;  2JMG A;  1TV9 A;  3Q8R B;  5AM0 A;  1D8B A;  2W7P A;  2NYV A;  2GLE A;  4EEY A;  1ZQS A;  4DLE A;  1K1Q A;  1ZD2 P;  3N28 A;  4B9S A;  5KNI A;  2XC9 A;  4RQ3 A;  2G08 A;  2YMP A;  4RQ5 A;  4TUS A;  1L6N A;  1WUD A;  2W43 A;  1T94 A;  5DDM A;  4PHP A;  3HPO A;  1FFV A;  3GV8 B;  7ICR A;  2OXO A;  5L1M A;  3HWT A;  3RJG A;  2BHN A;  4NLB A;  3WKD A;  4MFF A;  1BNP A;  1XU4 A;  2F2A B;  2A1J B;  5J2A A;  5AKJ A;  3QUC A;  2AGQ A;  5AHX A;  1S97 A;  5L1K A;  1IG6 A;  2YX8 A;  2I5H A;  1NNL A;  5AKY A;  2V4R A;  3EUB 2;  1L3S A;  5IIM A;  5ALU A;  2WAQ F;  3SV3 A;  5L1J A;  1Y88 A;  5E79 U;  3J81 j;  3IG8 A;  4YXJ A;  2IHN A;  5EWF A;  5ALQ A;  3IG5 A;  3MAB A;  3MFI A;  5KTQ A;  3BZK A;  3QUT A;  2LYB A;  3PSP A;  3GDX A;  2G07 A;  5DB7 A;  1PK1 A;  4Y2X A;  2OH2 A;  3PR4 A;  3RH6 A;  2VA2 A;  4NM2 A;  3TFR A;  4US8 A;  2XGP A;  3QE9 Y;  4UQG A;  4DF4 A;  4C4R A;  1K5O A;  5KFG A;  1ARO P;  5KG6 A;  3LWL A;  3O0F A;  1KKX A;  2GWS A;  2F8K A;  2DL0 A;  1KLN A;  1ZYQ A;  2GOL A;  2OM6 A;  3UMG A;  4P4O A;  2NRV A;  4Z6D A;  1BPZ A;  3MGV A;  4KTQ A;  4DL5 A;  1H38 A;  3RJH A;  4ZOH C;  1P7D A;  1SWW A;  1NKC A;  4NLZ A;  4RT2 A;  1S10 A;  1DXS A;  4UBC A;  1A0P A;  3UXN A;  5J0R A;  3NTU A;  3EPI A;  4NL9 C;  3PR5 B;  1SXD A;  2DFL A;  3AQF A;  2E8P A;  4ECX A;  8ICY A;  2JH1 A;  3GV5 B;  3A0H U;  1ZQO A;  2Q0Z X;  5C5J A;  2H5X A;  5D49 A;  8ICG A;  4RU9 A;  3RB4 A;  3S6J A;  4F8R A;  2KIW A;  8ICO A;  4PZO A;  1OW5 A;  4QZC A;  4EBE A;  1V85 A;  3U26 A;  5L1L A;  2FMQ A;  3M9O B;  2HHQ A;  4GXK A;  4GXJ A;  2B21 A;  3AUO A;  1B4F A;  4RNM A;  1NKE A;  3H4D A;  2DGZ A;  7ICO A;  2W9C B;  1J97 A;  4GIB A;  4C8N A;  3SEN A;  4R66 A;  3EYZ A;  4UB4 A;  5JUM A;  2VA3 A;  4F2R A;  5KL8 B;  3H8W A;  1ZQW A;  2ZXI A;  2ZUB A;  1NK4 A;  3V6K A;  3Q8M A;  8ICZ A;  8ICQ A;  1XWL A;  3C2L A;  2FLN A;  2ISP A;  4F5O A;  1S9F A;  2K4P A;  3QU4 A;  2J6T A;  2ASJ A;  5ALW A;  1ZQT A;  4IRC A;  4Q45 A;  2MUT A;  4M47 A;  3PST A;  5KT3 A;  3SZ2 A;  7ICL A;  3EZ5 A;  3D2S A;  2AH5 A;  3G6V A;  4BUG A;  2QAR A;  5ALD A;  1KFT A;  1YZ6 A;  2XIC A;  5J29 A;  4P0Q A;  4KLH A;  5AM2 A;  2M9N A;  1X42 A;  7ICG A;  3NUQ A;  2QB1 A;  4Y2J A;  3D6J A;  3NVY A;  1RZT A;  4Q43 A;  4RT3 A;  4ELU A;  1BNO A;  1QQ5 A;  3LDA A;  3LYS A;  2BGW A;  1V38 A;  4DL4 A;  1NJZ A;  2YMQ A;  2JEG A;  1X9S A;  3LVV A;  4X5V A;  4J9S A;  1N5W A;  3L3F X;  1UHU A;  4DOC A;  5EWE A;  4O3S A;  4FE3 A;  4QW9 A;  3RAX A;  4UB5 A;  1T4G A;  3ZDD A;  9ICE A;  2KV2 A;  4F93 B;  4B9N A;  2BQ3 A;  2FPL A;  4Y2V A;  4CF5 A;  1UPH A;  1OXJ A;  3GIJ A;  3IP4 B;  1NZP A;  4A8E A;  1XC9 A;  1RYS A;  3DDH A;  2QLT A;  1ZQV A;  4ECS A;  8ICF A;  4UAU A;  4QZ8 A;  4JB3 A;  2W9B A;  5IIK A;  4O5K A;  3OPX A;  4YR2 A;  4YMM A;  3PX6 A;  4DQR A;  3V72 A;  2KZZ A;  2LKY A;  5DLG A;  4UW9 A;  4CNQ A;  4RQ1 A;  3CP8 A;  1L7O A;  2R8G A;  3AQE A;  1JXE A;  2DPJ A;  2HBM A;  1ZQI A;  2ZIW A;  4EBD A;  3H0L B;  4IR1 A;  4DLG A;  4KLI A;  2KNJ A;  2KVC A;  4NWI A;  3ALR A;  4ELV A;  1MA7 A;  5AKL A;  2XID A;  2F1H A;  3V7J A;  2R18 A;  4I27 A;  9ICV A;  5KFP A;  4M2Y A;  2ASL A;  4KLG A;  2DKZ A;  2KJ8 A;  2BR0 A;  4O3R A;  2H3F A;  2K8A A;  4PPX A;  1HJP A;  2IHM A;  4Y2R A;  2W55 A;  2HOF A;  2EAM A;  2W7O A;  4M9L A;  1UT5 A;  1SKW A;  3LVW A;  1T3Q A;  3V6H A;  1LVH A;  5KT5 A;  5III A;  1TE2 A;  3ZI4 A;  4AYB C;  4UAS A;  2Y1J A;  1X40 A;  2EAP A;  1RDF A;  3QU5 A;  3PSF A;  1N48 A;  4KLJ A;  4RPZ A;  9ICU A;  4R65 A;  2HHT A;  1BPX A;  4YR0 A;  3C2K A;  1HIW A;  1L7M A;  1ZQP A;  3ZDE A;  4KX5 A;  4RUA A;  1SV0 A;  2WF5 A;  4G9B A;  4QZH A;  1TKD A;  4O0I A;  4KLE A;  4Y2Q A;  3QU7 A;  4CDG A;  5AI4 A;  2H3V A;  3GIM A;  2BQU A;  2YQE A;  2Q4T A;  1JUD A;  5KFB A;  4YD2 A;  1KSP A;  4IR9 A;  2W3R A;  4FFD A;  3SAH A;  2ES6 A;  2F1J A;  3MDC A;  2B6G A;  2CXY A;  3OJS A;  4KLO A;  9ICG A;  4YP3 A;  3QUB A;  2G5I B;  3V6J A;  3GII A;  4DSJ A;  2A1J A;  4F50 A;  2Y1I A;  1DRG A;  4HYK A;  3MBY A;  2RRD A;  4CGZ A;  3JPO A;  4ED2 A;  3QZ7 A;  2ZTE A;  3SI8 A;  1ZD3 A;  3RJJ A;  3MGH A;  3RJE A;  4Y2P A;  4P0Q B;  1TAU A;  7ICN A;  4DL6 A;  3AU6 A;  5J0Y A;  3F2D A;  5DBA A;  5KT4 A;  3UQ0 A;  4KLF A;  5DLF A;  4DSI A;  2DUY A;  2A19 A;  3WK7 A;  4CCH A;  4MF2 A;  1A6S A;  4GXI A;  4ECR A;  9ICJ A;  5KAF U;  5C0Y A;  1XSP A;  2ISO A;  2JEI A;  9ICR A;  2L5Y A;  5KFA A;  5ALP A;  5AIB A;  2VIX A;  5BOL A;  3MDA A;  7ICH A;  3RH5 A;  3HRD D;  1PUZ A;  3IRU A;  3RBE A;  4PL2 A;  3TI0 A;  4JMU A;  4EX7 A;  4Q8E A;  7ICI A;  4KMU A;  5KAI U;  5ALI A;  2MRL A;  4M9G A;  5AKI A;  4HAI A;  3PVX A;  2BCS A;  2XY6 A;  4NY8 A;  4P2H A;  5ALZ A;  4M6W B;  3NGD A;  4OJL A;  2H3Z A;  2Z7J A;  3NAS A;  4QZD A;  1WCN A;  2E1F A;  3HJE A;  2KE7 A;  5DB8 A;  5KFO A;  2CPR A;  4DFK A;  2ZXH A;  3QXG A;  4QNL A;  1L5U A;  4NV0 A;  3RR8 A;  3B0Y A;  9ICM A;  2HVH A;  3JPP A;  1XSL A;  3M6Z A;  3PV8 A;  2WB1 F;  5KFM A;  3C29 A;  4LVS A;  2UVW A;  2UVU A;  3HIL A;  3PX0 A;  1PVP A;  5HHI A;  2EH9 A;  7ICK A;  2ZIW B;  4O3M A;  2IMW P;  1T8E A;  3M9M B;  2DF4 B;  5F3X B;  2D3D A;  2HVI A;  1KFS A;  2JRZ A;  1X66 A;  2LI6 A;  5ALH A;  1ZQ1 C;  5FP0 A;  3WK6 A;  4XA5 A;  4EEL A;  5CHG A;  3F5E A;  5HML A;  2KG5 A;  4TUP A;  8ICE A;  3Q8Q B;  1ZD4 A;  2W9C A;  2KVS A;  4B9U A;  4QWD A;  3V7K A;  5D4B A;  8ICS A;  3QUQ A;  4IRK A;  2A1A A;  5ALN A;  1NK8 A;  4C80 A;  3SAF A;  3KZI U;  5KFD A;  2KEY A;  8ICT A;  3RJF A;  4R8U A;  3C1Z A;  4Y2Y A;  2ATL A;  5J2E A;  2ZIV B;  3NVW A;  3HKZ C;  5DGA A;  4RQ4 A;  5KFN A;  1U45 A;  5HMM A;  1ZXI A;  2J6S A;  4DL7 A;  1MSW D;  4AYB F;  2YTU A;  3G6Y A;  4I2I A;  4P4M A;  5AI5 A;  3NVZ A;  1O08 A;  1FIQ A;  1Q3V A;  4C4S A;  3Q8L A;  1SL0 A;  2Y0S F;  4Y2U A;  1Z3E B;  2R8I A;  8ICB A;  3M9N B;  2FLL A;  1ZJN A;  2JXJ A;  4JWM A;  3A0B U;  3C5F A;  4C8L A;  2OHF A;  5AIC A;  5DB6 A;  4ED6 A;  4O3O A;  1Z1B A;  5AM4 A;  3H8M A;  2ASD A;  3RR7 A;  4Z6F A;  5KT7 A;  4DFM A;  2F44 A;  5AK3 A;  1V9P A;  1QCK A;  4ECV A;  2MA1 A;  4DSK A;  2ZG6 A;  5B5E U;  2IBK A;  4KN7 A;  9ICQ A;  3TAQ A;  1KW4 A;  2DPI A;  1ZQK A;  2G09 A;  7ICM A;  1NKB A;  4QZB A;  3ISC A;  4ED3 A;  2BPG A;  4Y2T A;  5TIS U;  5BPC A;  2FE9 A;  5KG4 A;  3OHB A;  2QB0 A;  5J2G A;  5AI6 A;  5AM5 A;  4B6J A;  4PGY A;  2PKE A;  2KK0 A;  4CF3 A;  4R63 A;  2WF7 A;  5AI0 A;  2MAX A;  4UAT A;  3G6X A;  5L9X A;  3LK9 A;  9ICP A;  2AGO A;  5GTI U;  3N4M B;  3NRZ A;  4FO6 A;  3PY8 A;  2XCA A;  1K1S A;  3C21 A;  3CNH A;  5F9L A;  2GH1 A;  3ICX A;  4C7Z A;  4JV1 A;  1L3U A;  2UVR A;  2PFQ A;  4DQI A;  4G3I A;  5HP4 A;  1S76 D;  1QH9 A;  3QEB Z;  5EE0 A;  2D8C A;  5AKE A;  1ZJM A;  1B0X A;  4KIT B;  3BQ1 A;  4BGD A;  5ALM A;  4FBT A;  4ED0 A;  2ZIX A;  5KFW A;  5J0P A;  4IQW A;  2NO4 A;  4QWC A;  4C8K A;  3PX4 A;  9ICC A;  1Z00 B;  2KKV A;  4GLX A;  3AEV A;  3F53 A;  4DSF A;  3BJY A;  2ZTC A;  2K4E A;  2JR5 A;  1NJW A;  1CI4 A;  4IL6 U;  1ECW A;  3T5K A;  4QZG A;  1PVR A;  3WK5 A;  3PZP A;  2NO5 A;  3QZ8 A;  5AKK A;  4YN4 A;  2JZB B;  2HDO A;  5F9N A;  5DG9 A;  4KLL A;  4YMN A;  1BPE A;  1ZQA A;  5KFK A;  1TAM A;  2WF8 A;  2HHX A;  2EZZ A;  3ZD8 A;  4F4K A;  1DK3 A;  4JWN A;  2K8C B;  4C8O A;  5DQI A;  5HR7 A;  3F2C A;  8ICV A;  3PNC A;  5J2D A;  3CYM A;  4UAW A;  4R64 A;  4B9M A;  3ISD A;  2WF9 A;  1S0V A;  5DQG A;  1LB2 B;  4QIW C;  3H7I A;  5J8Y C;  4DWI A;  2KD1 A;  4ECQ A;  4RQ8 A;  5EE1 A;  2XY7 A;  4QZ9 A;  3FC4 A;  3K4G A;  4Z6E A;  2LMR A;  4YFK A;  4R8U B;  2K4H A;  1ZQU A;  5CEH A;  4ED7 A;  1RYU A;  2R8H A;  3BQ0 A;  1DOQ A;  2C2E A;  3D2Q A;  1ZQQ A;  1UT8 A;  4F4X A;  4C7Y A;  1U48 A;  9ICF A;  2IOH A;  4KN4 A;  4F4W A;  3BQ7 A;  4C0Z A;  1F5S A;  1SKR A;  1UA0 A;  3HKZ F; 
#chains in the Genus database with same CATH homology
 4NJ8 A;  4NL9 A;  3TAD A;  2D8C A;  4NL9 C;  1B0X A;  3TAD C;  1X40 A;  1SXD A;  2YTU A;  1COK A;  5L1M A;  2E8P A;  3BS5 A;  1Z1V A;  3TAC B;  2EAO A;  2Y9T A;  2EAP A;  1SXE A;  1LKY B;  5JTI A;  5JU5 A;  1PK1 B;  1WWU A;  4PZO A;  1OW5 A;  1OXJ A;  1RG6 A;  1SGG A;  1SV0 A;  1V85 A;  1X9X A;  4MHV A;  1SV0 C;  2KE7 A;  1F0M A;  1B4F A;  2E8O A;  2QKQ A;  3K1R B;  2ESE A;  2KIV A;  3H8M A;  2KMD A;  2QAR B;  1UCV A;  2F44 A;  4RQN A;  3SEN A;  1PK3 A;  5JRT A;  2JV3 A;  2ES6 A;  3HIL A;  1KW4 A;  1UQV A;  2B6G A;  2KSO B;  3IDW A;  2K60 A;  2Y9U A;  1LKY A;  2E8M A;  2QB0 B;  5F3X B;  1PK1 A;  2D3D A;  3KKA A;  2KSO A;  2K4P A;  1X66 A;  3KKA C;  2FE9 A;  4PZN A;  4RQM A;  2QB0 A;  2KG5 A;  5J8Y C;  3BS5 B;  2DKX A;  2F3N A;  2QAR A;  2F8K A;  2LMR A;  2DL0 A;  1SV4 A;  2LPE A;  2GLE A;  2DKZ A;  1JI7 A;  3SEI A;  4IS7 A;  2QB1 A;  3BS7 A;  2L5Y A;  5J8Y A;  5KNI A;  3BQ7 A;  2EAM A;  1WWV A;  2E8N A;  1DXS A;  2EAN A;  1V38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...