3TAPA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-3) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tapA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tapA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tapA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tapA01
2KW4A 4QAGA 3OYIA 4LZGA 3M8QA 3ZDBA 3ORYA 2EHGA 3ZSRA 4CESA 5CHGA 4DQIA 3PX4A 1Y97A 1TL1A 3WNFA 1CLQA 3ZDEA 4R66A 1LW0A 1VSHA 2MUTA 5J2CA 5FROA 7ICPA 1RBUA 1LWEA 4CJPA 4PHEA 4PY5A 3NH0A 2W9MA 2GBZA 4TUQA 8ICTA 2FMSA 3KKRA 4GXJA 2FPMA 4RW6A 4R8UA 4KLUA 1ZJNA 5EU7A 3PUFA 3NGDA 9ICXA 1ZQEA 9ICVA 1D8LA 2HHTA 3HL8A 5HMMA 2PFNA 4Q5VA 3LP2A 2B21A 3KLGA 3RWUA 4M9JA 4I9LA 2HHWA 2XY6A 3C2LA 3NCIA 1ZQTA 4K4HA 4CJWA 1N6QA 2V9WA 4B8CA 9ICHA 4CFDA 4DOAA 2DFEA 2F1HA 1S9FA 3VN5A 4YNQA 2F1JA 3HVTA 3BQ2A 3RMAA 9ICNA 2D5RA 2QXFA 4Y1CA 2YNHA 3QIOA 4QZAA 2AGOA 4RQ8A 4E1NA 3QZ8A 3VQEA 4CJEA 1WSGA 3OS2A 3QIPA 2RF2A 4MF8A 2MAXA 4CJ5A 1S0NA 2DFHA 4B3OA 3T3FA 1B9DA 4CHYA 4DSIA 8ICKA 3HWTA 4F2RA 4TUPA 2VA2A 5CA7A 3O3HA 1KVBA 3DYAA 4DSLA 4E19A 3SYZA 1BIZA 2XHBA 4O5EA 1CXQA 1WCNA 3M8RA 2G8VA 5KFLA 3AA5X 1SUQA 4R63A 5DBAA 4B9TA 3NHGA 5KTQA 2QKBA 4KRFA 1Z3EB 1ZJMA 3B0XA 4YMOA 5JUMA 8ICQA 3JPPA 3S3MA 4J9RA 5DG7A 1QSYA 8ICLA 8ICHA 2XO7A 3HXMA 2XGPA 4ECUA 4P4OA 1S97A 3PMNA 1NKEA 1Z25A 3NDKA 4DTNA 2G8KA 1C0MA 1BCOA 1ZBIA 4FS2A 5IILA 4DSKA 3PO5A 3KK3A 1S0MA 2BHNA 2P1JA 2ZUDA 3O4NA 3H8SA 5DDYA 4BDZA 3K4GA 1RT7A 3VQ6A 3WNEA 3E2EA 3AU2A 4KLJA 1JXLA 1ZQYA 1ZBHA 4YR3A 2HHQA 4CJ4A 5J2HA 4MQ3A 4JS4A 4F92B 4F8RA 3U3YA 4NCBA 3OYNA 2PZSA 2QKKA 3GV8B 4JUZA 3S3OA 8ICRA 3K58A 2ZTDA 4FM0A 1HYZA 2JLEA 2HNZA 3V4IA 4KI4A 4M3WA 4K8XA 1L3VA 9ICRA 2ISOA 4MEYA 4J2EA 3SZ2A 3TAGA 3NF8A 4RW7A 1ASUA 4OGCA 4CJTA 2DPIA 1VRTA 2R8JA 2HVIA 3L3VA 9ICAA 4TUSA 1HUZA 2KFNA 3RMBA 5KT6A 4FJIA 2OPSA 2BQUA 4EZ6A 4CEOA 2O4IA 2E6MA 2JZBA 5DLFA 3QESA 3ZSWA 5DQGA 3VQ7A 4CJ3A 3EZ5A 4E1MA 5BOMA 2M9NA 4FW1A 3V72A 3MR6A 2FLLA 5KGXA 4YCXA 5KFSA 4DOBA 3CFRA 1ZQIA 1NOMA 1K1QA 3TFSA 2NRTA 1QE1A 2OZSA 1DTTA 1WLJA 3MXMA 1WSFA 1HMVA 2VG6A 4R64A 3V9SA 3L2WA 1XI1A 5HROA 2E4LA 4E7HA 5KFEA 4OLBA 4UB2A 5DB9A 1U47A 2HMIA 2JEIA 1PZNA 1HJRA 3QEVA 4F5PA 1BQNA 1ZQJA 4PPXA 3ZDDA 4BACA 3MR2A 3BQ0A 1X9WA 4F4ZA 1RT2A 2YKNA 3AVLA 3GIIA 1O1WA 2DFLA 3HSTB 3HJFA 4FJXA 3BQTA 3HYFA 5KG7A 4MFFA 4HHTA 5CY4A 5IIOA 4CJLA 3SUOA 7ICGA 3HT3A 5KFGA 1ZBUA 4DU4A 4IFVA 5L1LA 1BPZA 3QNOA 3RB0A 9ICKA 1I3AA 3LP3A 2R8IA 1RXVA 4I2CA 5J2IA 4P4MA 3UPQA 3M9MB 2BCUA 2HB5A 3QEXA 2VA8A 9ICGA 2IHNA 2VWKA 1XHXA 3ZSVA 2ZTCA 5E41A 2PFPA 1T8EA 3OYMA 1T05A 2O4GA 4IQVA 3MXJA 4CIGA 5HLFA 2A1JA 1XS9D 3ULDA 3IS9A 1ASVA 3NGIA 4DTJA 4W5OA 5C24A 4JLHA 1BQMA 4NM2A 5HNKA 3RJIA 5CZ2A 1CZ9A 4IR9A 4IQTA 4BXOB 3UXOA 3TWHA 4EBEA 4CF2A 3PW7A 2IMWP 3AO2A 4KITB 1JXEA 2PYLA 4QWEA 3RMCA 4E7JA 1TVAA 3RH4A 3KJVA 5DBCA 3NH1A 4KN7A 1IO2A 3C2KA 4ED0A 3C5GA 5I3UA 4FJ5A 2UVVA 4AHVA 5D46A 4J9OA 2A1SA 1JLGA 4FBUA 1S1UA 4M2YA 4IQUA 4CHNA 2PFOA 1UWBA 4RQ5A 3JSMA 3RMDA 5KG4A 3AA2A 3QEIA 2AU0A 4O55A 3RH6A 2HW3A 4P2HA 1GOCA 3NF7A 1V9PA 1TK8A 4DQQA 3V1RA 4E7KA 2IS3A 4JV1A 1EX4A 1BL3A 3DOKA 3NAEA 1D8YA 3DLKA 4AHUA 4ID1A 4M9NA 3JPNA 4RPXA 4DTPA 3DRRA 3C1ZA 3I8DA 4EZ9A 9ICIA 1QS4A 2OPPA 4M3YA 4JRQA 3PR4A 4J9MA 4LSLA 2G8HA 1U04A 4XIUA 4RQ1A 3KLIA 4CCHA 4O5BA 4FJHA 2IC3A 5TZVA 1ZQAA 3M9OB 3ZSYA 4ECQA 3LAKA 4HUFA 4RQ7A 4AHRA 2BDPA 4DF8A 1RT5A 4FJ9A 5CR0A 2BKEA 3VA0A 4DTXA 4IDKA 5BPCA 2FC0A 2ASDA 3RJKA 4M0AA 4JK1A 1KDHA 4B9MA 3VQQA 4OJRA 7ICFA 1BCMA 3LPTA 1DLOA 2G8UA 4CFCA 1TKZA 1VSFA 5F9LA 3AO4A 4Q8FA 3Q8SB 3DLBA 3OYKA 3HVRA 3FDSA 4PQUA 2W9CA 1TK0A 4BE1A 1Z00A 2H5XA 4FJLA 4M3XA 1WN7A 2JGUA 5CWRA 4M47A 1ZQXA 1U4BA 1TGOA 3A2FA 5DG9A 4RNOA 1SKRA 5K14A 3OYFA 5KT5A 4IFYA 5CZ1A 4FLZA 2VA3A 4PHPA 4FVMA 3RB6A 3I0SA 4E0DA 2YV0X 1VK0A 2MUTB 1S0VA 2BQRA 4UQGA 5HHIA 1BI4B 3L2UA 4I2PA 4DEZA 2BPFA 3HO1A 2Q0ZX 4IR1A 4F5QA 1CXUA 1L3UA 1GOBA 4RUCA 4QZ8A 4FK0A 4J2BA 3AVCA 1RBRA 1GOAA 3QEBZ 5FDLA 2BGWA 5JS1A 4QW9A 3LP0A 1HUOA 5HP4A 3TFRA 1TAUA 3ZD9A 1A5WA 3AA4A 4M3TA 3G6XA 1DGSA 3KTQA 4N5SA 5EWGA 4CGFA 4QZEA 1U45A 4GVMA 3LALA 4F91B 1NKCA 1BISA 3HP9A 4J9KA 2ATLA 2YNFA 5CYMA 2IOCA 4Y1DA 3AVBA 4CHQA 4GW6A 2BCSA 4DSJA 3AVNA 5KFRA 1NK8A 1JKHA 2W9BA 4GC7A 4UB4A 4M6WA 1T03A 3MABA 3C2MA 1L5UA 3RR8A 4O5CA 3LZJA 4O3PA 4IG0A 4UAWA 2IDOA 7ICRA 1U9LA 1ZQLA 1SV5A 2RPIA 4FJGA 3KK1A 3LP1A 9ICTA 4DFPA 4CGIA 3T5HA 1KVAA 1IKWA 1NOYA 4CF8A 7ICJA 4ECZA 1UOCA 1VSLA 1EXQA 4XRHA 4RZRA 2BGGA 4HVJA 2Z1IA 1H38A 4FM2A 4YD1A 3EY1A 4RPYA 2P5OA 7ICMA 2JEGA 4LZDA 5DKWA 2ITGA 4H4OA 4KTQA 3EW9A 4KV8A 4F5RA 4FJMA 3ZT3A 4NYFA 3MXIA 3B6OA 5KT4A 4IRKA 1TKTA 4H4MA 4KI6A 3MR5A 4M9HA 1DOQA 4TURA 2ZE2A 1EXNA 3IHQB 3V7JA 1D9DA 5T7BA 4FK4A 5FRNA 3OYBA 1UT8A 3Q8MA 4DO9A 4DTMA 1KLMA 1A76A 4MFCA 1RTIA 3S3NA 2PI4A 3M9NB 7ICVA 3C5FA 4CIEA 4LSNA 3D0PA 1KEJA 3PY8A 1YT3A 4XUSA 5KFZA 3QE9Y 7ICOA 4YN4A 4B08A 1ZQOA 5J0PA 3ZSXA 4PWDA 1FKOA 3P83D 1TV6A 4Z4GA 4EP5A 5KFKA 3TI0A 4NM1A 2DY4A 1JLCA 4OPKA 1CUKA 1COOA 1K6YA 4ED1A 4TQSA 1ZQGA 1HYSA 4OKJA 7ICTA 8ICSA 1JLEA 3OGUA 2VWJA 3QETA 5C25A 4KHUA 1IH7A 3IG1A 8ICXA 4YXMA 3KD5E 2ATQA 3LZIA 8ICWA 4YD2A 2UVRA 8ICGA 1UA0A 2BR0A 2P51A 2HNDA 4KHYA 4NYNA 4I9QA 1EKEA 1TV9A 2JZBB 1T4GA 1NK4A 3DM2A 1DTQA 4PGYA 3AU6A 1LWFA 3T5LA 2J6TA 2XCPA 4I2QA 3CFOA 3L3UA 3C6UA 4PGXA 3EPIA 4KHQA 1VSEA 5J0YA 5KFVA 3PVXA 4DSEA 3QINA 4CEBA 3NGZA 4DFMA 5J0QA 3PMLA 4YMMA 5DG8A 1ZBLA 4FJ7A 2KTQA 1W9HA 3JPSA 4CEAA 1WCLA 2VG7A 4ID5A 1S1WA 4IBNA 5IIMA 5HMLA 5J0OA 2B5JA 4O4GA 9ICBA 2OWOA 5KT3A 1QSLA 4DU3A 4KREA 3HPGA 2P6UA 1LW2A 4ELUA 5HBMA 3VA3A 1SKSA 4F3OA 4CEDA 3OYGA 4KLGA 4Q44A 3VQDA 4O44A 1S77D 4X5VA 2FMPA 2HHXA 4F5OA 2RKIA 4DS4A 1ZQWA 7ICLA 4RNNA 3V9ZA 4IG3A 1MQ2A 3FYHA 4ZHRA 4Q43A 1XSLA 4ECWA 2PXIA 5DK5A 3AVGA 4K4IA 4HYKA 5HRRA 4KTWA 5KFNA 3V9WA 3RBDA 1QTMA 1XSNA 3O3FA 3JPRA 4FJ8A 1TKDA 3DLRA 4DMNA 2BE2A 4CJRA 1WAFA 9ICOA 2YHBA 4DQRA 2NRXA 4CEZA 4J2DA 1RT1A 2VG5A 3K5NA 3E01A 4ICLA 4N47A 4ECSA 1ZQUA 4BE0A 4CJKA 1UA1A 4XQ8A 1RYRA 3U6FA 4BWMA 2KQ2A 2YHAA 4QWAA 2IAJA 1VSKA 3L8BA 4FXDA 4TSXA 4J9PA 3AVIA 1S0OA 4KB0A 5J2AA 3ZT4A 1NJZA 2V4QA 4RW9A 1TFRA 2DPJA 1TVRA 3N97B 3OSPA 1I39A 3T19A 5SWMA 7ICIA 3VQBA 3QERA 2R8GA 3AV9A 2F96A 3VQ8A 3LWMA 5D3GA 3PW2A 4RQ0A 9ICWA 4AHTA 4QW8A 1C1BA 2X74A 3DMJA 4DTOA 5C5JA 4DTSA 1A5VA 1S1TA 3AVMA 4F4XA 2NRVA 3V1QA 1AROP 4C8KA 5KFCA 2XY5A 4AH9A 3V7KA 2D0AA 5L9XA 1Q8IA 4CF9A 5EWEA 1B92A 2Q3SA 3QEPA 4E3SA 4QCLA 3MGHA 7ICQA 4Q45A 2OPRA 8ICUA 2DFFA 3C1YA 5J1EA 4FM1A 1TKXA 1JMSA 3K57A 5J0XA 2NUBA 4PA1A 1J53A 8ICNA 4CGDA 4HCCA 1TL3A 4ED3A 4I2AA 4B9UA 1KTQA 4DFJA 2KZZA 2HNYA 1X9SA 1RTJA 5CYQA 4O3SA 3H40A 3KIOA 2I9GA 4UB5A 4E7IA 3KLEA 3DLEA 2AQ0A 3K2PA 2W42A 4DLEA 1ZQHA 2ZUBA 4AHSA 1B9FA 4M04A 7ICUA 4CK3A 2ASJA 2Y1IA 3KKSA 2BPCA 5KFPA 1IM4A 4I2IA 5DQIA 4Q0BA 1VSMA 4WE1A 1VRUA 4RW8A 3ISBA 3M8SA 1RT6A 5IIIA 3C23A 4DG1A 3V9XA 1RBSA 2ZJ8A 1NK5A 3ZD8A 4NXZA 4GXIA 1L3TA 3MDCA 8ICVA 4N41A 4F5NA 4CK1A 2W9CB 4M41A 4OKKA 1Z00B 3PNCA 3QO9A 2D0CA 7ICEA 5J0UA 1ZQRA 7ICHA 4I28A 5KT7A 1YVUA 3TAFA 1RXWA 1RBTA 1ZQQA 4YFKA 2P6RA 1G15A 3DI6A 4I29A 4M42A 4LH5A 4Z6EA 2AGPA 4YMNA 1SL0A 7ICKA 4AILC 2G8WA 5KFIA 1RPLA 1FKPA 5J29A 3TQ1A 3LK9A 1J54A 4G3IA 1REVA 4DFKA 2LSNA 3RRHA 8ICEA 1XC9A 8ICOA 3TR8A 3WNGA 1HNIA 3RAQA 3T5JA 5DBBA 4Z0UA 1K1SA 3SI8A 4I2EA 2X6SA 4DS5A 4RNMA 4I2GA 3H4DA 1S5JA 2BCVA 8ICBA 4EEYA 3P5JA 5EOZA 4QOZB 3PV8A 3GV7B 3L2VA 3U3GA 2HHVA 1Q9YA 5JS2A 3PW4A 2F1IA 1LAWA 1JXBA 1IKVA 3SV4A 3TAPA 2FPKA 1QQCA 4UB3A 4FYDA 1NOZA 4QZHA 4O3OA 4F2SA 2IA6A 3PX0A 5D4BA 4YFUA 3LANA 2W9BB 4M6WB 3T1AA 3V1OA 4Z6DA 4KHWA 4DQPA 4PGQA 2W8KA 2NRWA 1X9MA 5KFFA 4KLOA 3AO1A 2V4RA 3CM5A 4FLYA 4QWCA 3V81A 3HM9A 4KHSA 1N5YA 2ZUCA 4M9GA 4CHOA 4B8AB 5L1IA 2HHSA 3BDPA 3H4BA 3BGRA 5KFWA 4ZH4A 4UAZA 1C1CA 1RCHA 2FBYA 3ALYA 2ISPA 4W5NA 4Z4EA 4M3UA 4KFBA 1MQ3A 3KHHA 4KAZA 4FJKA 4QZGA 3QEWA 2ZJ5A 5J0TA 4I2BA 4YQWA 5DQHA 3RJFA 4QZDA 4ED2A 1KRPA 3H8WA 1XU4A 1CEZA 1IXRA 3OYAA 4FBTA 3OSNA 4DF4A 4O3QA 4RT2A 4ECYA 4B9SA 4FJNA 1LWCA 1X1PA 4F4YA 1J9AA 4Z4FA 1YTAA 1QLNA 4R8UB 4KMUA 3CG7A 2ZD1A 4W5RA 4HUGA 1RTHA 3SUNA 4CK2A 4FLUA 2ALZA 4RQ6A 5L1KA 1JLBA 3OYDA 3EPGA 2BANA 3AVAA 4MFBA 3MAQA 3ZT2A 3OS0A 1T3NA 1IKYA 2LYHA 5KFAA 1XHZA 1N56A 3G6YA 1BPBA 4Z4CA 5J2GA 4QZBA 4KLIA 5IINA 5DGBA 4RU9A 1W0HA 3LAMA 5DMRA 3OYJA 3KLHA 4DL2A 4AHCA 4CJQA 2ZQBA 4FCYA 5DGAA 4ZTFA 2FLNA 2G8FA 3Q8QB 3V9UA 1S9GA 1BPEA 4KLDA 4KLFA 5J2JA 4JV2A 2B6AA 2J6SA 4UBBA 1VSIA 2PY5A 9ICUA 2FMQA 1EP4A 3Q8PB 3PR5B 8ICJA 3QEAZ 2WTFA 4M3ZA 4DU1A 4FS1A 1S10A 2Y1JA 4DSFA 2OZMA 7ICSA 2YNIA 4W5TA 5J2NA 1TAQA 3V6KA 5DB8A 4IKFA 3ZSOA 5J2DA 1B22A 2A1RA 3P1GA 1KFTA 4DL4A 3HK2A 1SL1A 5DLGA 4YR2A 1RDDA 4CFAA 1S76D 4OKEA 3RTVA 4KLLA 3VQAA 4HTUA 3ETLA 3K75D 5EWFA 1S6QA 4ZTJA 2XY8A 5DB6A 4P4PA 2YNGA 3ASMA 1UT5A 3MGIA 4L8RB 1JIHA 4DL6A 3HW8A 4G1QA 4Z6FA 3AA3A 3GFKB 4CEFA 4K4GA 3TAMA 3DLGA 4FZYA 4QWDA 1BI4A 1RNHA 2OPQA 1A5XA 1JL2A 3SNNA 1L3SA 2BCQA 4DL5A 8ICZA 2GUIA 3G0ZA 5IIKA 4ED8A 5HRNA 3Q8LA 3LPUA 2XC9A 3RBEA 4ELVA 3MFHA 2OA8A 3MEEA 2RDIA 3OYLA 2I1QA 3OYCA 4C8MA 3IRXA 5SZTA 1SZPA 4CHPA 1HQUA 4I2HA 4J2AA 4DTUA 4QZFA 2IHMA 2WONA 3F9KA 1QSSA 4KLTA 1LV5A 4I7FA 1HJPA 8ICYA 1C1AA 1ZBFA 4O3RA 2D0BA 2Z1HA 4R5PA 3I0RA 4HCBA 5J0SA 4J9LA 1D5AA 2C28A 3SQ1A 3HPOA 4ECTA 2C2RA 3KHRA 3AVKA 3OJSA 4KPYA 4M9LA 3ZT0A 1XO1A 4HUEA 2JEFA 5J2QA 4OLAA 4R65A 4PHAA 3SPYA 1KLNA 5KFYA 1XWLA 4FLWA 4KN4A 4EYHB 5KFHA 4CE9A 3KD1E 9ICFA 3ZCMA 3OYHA 3C94A 5KRTA 4OGEA 3AVHA 3SJJA 4CGHA 1VSJA 8ICMA 4C8NA 1RBVA 2J6UA 1Z26A 1ASWA 4QZCA 1RT4A 3ISDA 3THVA 3UXPA 3VQ4A 1ZQPA 4Q8EA 3MECA 4FLXA 9ICLA 3TAEA 3SPZA 5KG0A 3PW5A 3GIMA 3VQ5A 5KFTA 3MFIA 3T5KA 4I27A 1WSEA 4BDPA 4FZZA 3GQCA 4YR0A 2AQ4A 1ZQBA 3PX6A 3NGYA 4MEXA 3SUQA 2GWSA 4M3RA 1HPZA 4NCGA 3MEDA 5J2FA 3SQ4A 4KLMA 9ICEA 4RPZA 3S9HA 7ICNA 4ED6A 2WOMA 5C42A 4QWBA 4Z4HA 3QLHA 5J2PA 1JN3A 3PW0A 3LWLA 3RB4A 1BPDA 2BPGA 1NJXA 2IBKA 3MDAA 1HRHA 1RILA 1KCFA 3DRPA 5CB1A 2FBVA 2KZ3A 4GLXA 3H7IA 1JLQA 4ECRA 4FW2A 4JWMA 4CF1A 4PHDA 1ZQSA 1WSJA 1ZYQA 3TANA 1ZQZA 5KG6A 3NF6A 9ICPA 1RDCA 1RZTA 5KFUA 1MSWD 4NLGA 2A1JB 3CFPA 2VANA 5D49A 3SI6A 3K5MA 4E7LA 3HP6A 4Z4IA 4FLTA 3K59A 3GV5B 4F3TA 4CEQA 3OYEA 1YTUA 3D45A 8ICCA 5I42A 2PFQA 1RTDA 4O9MA 5KT2A 5KFDA 4CJSA 3CYMA 5J0WA 5J2EA 1MU2A 3MR3A 4DL3A 3ZDAA 5KG2A 3RJJA 1JLAA 3N4MB 2UVUA 1SL2A 8ICIA 3EWAA 3EYZA 1IG9A 4TQRA 2EX3A 4BDYA 1KFDA 4M45A 4NLZA 4KHNA 4RUAA 4OVLA 2Z1JA 2KZMA 8ICAA 3HPHA 3OS1A 2FPLA 3JPQA 4CIFA 4C8LA 4LVSA 3H8JA 4LY7A 3C95A 4IRCA 3TAQA 1X2IA 1UAXA 1U48A 2HVHA 1NK6A 1JLFA 5CJ7A 3NTUA 2XGQA 4RQ2A 4YG2A 1TK5A 3IAYA 3LDSA 2IGIA 1WNSA 3DOLA 4FO6A 4FK2A 4PH5A 3UQ2A 2DTUA 1WSHA 4MFAA 2E6LA 3V6HA 2XRIA 1LAVA 4ELTA 3SV3A 3K5LA 5DDMA 4RT3A 4DTRA 3Q8RB 1HNVA 4EP4A 4YP3A 2X78A 8ICFA 3M8PA 3JYTA 2R8HA 2XCAA 2FBXA 3NF9A 3CQ8A 3V6DA 2JEJA 1C6VA 3RAXA 3AUOA 3DLHA 2G8IA 3KHLA 1F21A 2ZJAA 4KTZA 2PI5A 3VQ9A 4NY8A 2C2DA 1IKXA 3RJHA 3NH2A 4BWJA 4F50A 3WNHA 3C21A 5BOLA 1KFSA 3CM6A 4YXJA 3UQ0A 2KFZA 4CECA 3GILA 4E89A 5HRSA 9ICCA 1ZQKA 3OY9A 5CP2A 1ZQMA 4JS5A 2RDJA 2FLPA 1BHLA 3V6JA 1RDAA 4PUOA 3ZSQA 4B9NA 4QZIA 4QZ9A 1A77A 4LD0A 4CF0A 2C22A 4KO0A 5HP1A 5F9NA 4CGJA 4IQWA 3ZDCA 1Y88A 4RQ4A 1Q9XA 1S1XA 2GV9A 1BVSA 1NK0A 3TABA 3LDAA 3NFAA 5KRSA 4F93B 4W5QA 3SQ0A 4J9QA 3MEGA 1EETA 5KGWA 3UIQA 4RG8A 1KVCA 3G6VA 3IM1A 3ISNC 4KB1A 1RYSA 3MBYA 1NK9A 4UB1A 3HX0A 3RR7A 2Z1GA 4CJVA 2BCRA 4KLQA 2YKMA 5J0RA 2KN7A 4EBCA 4KKOA 1BGXT 4O3NA 4CGGA 1BIUA 1B43A 3AO3A 4FLVA 2HHUA 3OJUA 1ZQNA 3QZ7A 3UXNA 1WAJA 4O5KA 3ZSZA 1J5OA 2F8SA 4F4WA 3B0YA 1NJWA 2NRZA 1NK7A 2R7YA 2AGQA 4BGDA 1HYVA 1NKBA 4IRDA 5HRPA 4KLHA 4NLKA 4B9LA 8ICPA 1C7YA 1WSIA 3L2QA 4K8ZA 4UBCA 4DQSA 4XA5A 3RJGA 1NJYA 4UAYA 5KFBA 5KG3A 4GC6A 3O4QA 1D9FA 4C8OA 3BQ1A 5J2KA 2P66A 1FK9A 4KLEA 4BE2A 3C6TA 1SKWA 4J9NA 3GDXA 1CZBA 1ZETA 3JPOA 4JRPA 3ITHA 1U49A 2OYQA 4DL7A 4RW4A 2ETJA 2BQ3A 5HHHA 3JPTA 3GIKA 1S6PA 3DRSA 3K5OA 4RQ3A 2ASLA 1ITGA 4BXOA 4EBDA 9ICSA 1C0UA 4FJJA 3AO5A 4DWIA 3TARA 1RT3A 3Q8KA 9ICJA 2C2EA 3SQ2A 3OHBA 3O3GA 1HQEA 5KFMA 5J2BA 5IIJA 4ECXA 4CERA 4JWNA 3SUPA 2PYJA 2F8TA 1T7PA 4O0JA 4NCAA 4H8KA 2W8LA 1ZQFA 1JL1A 4OPJA 2X6NA 4ECVA 5KFQA 3L2RA 4NLNA 2P5GA 4CHZA 3OVNA 4CEEA 2AJQA 4GMJB 1ZQCA 1MC8A 4KLSA 2R8KA 5DB7A 4MF2A 2I5JA 3GIJA 1ZQVA 2W9AA 3B6PA 5KFXA 2RN2A 4DLGA 5KFJA 3G10A 3AVJA 1ZQDA 4JV0A 1KSPA 4N56A 3RB3A 2UVWA 1S1VA 3KLFA 9ICMA 9ICQA 2FBTA 4I2JA 3PO4A 3SCXA 1C0TA 4CJUA 3NE6A 2B4JA 1JX4A 4I2FA 1VSDA 4ED7A 5J2MA 4I2DA 5FRMA 2QK9A 3OHAA 3V7LA 4Z6CA 3VQPA 4GXKA 3RRGA 4FZXC 4F4KA 1S9EA 3ISCA 4CFBA 5KG1A 3F73A 3FFIA 1R0AA 5KFOA 4O0IA 1RDBA 4LH4A 3RJEA 3H08A 1QHTA 5KI6A 4J9SA 1N48A 1BPYA 4N76A 4CJFA 3QNNA 4DOCA 1BPXA 3NBPA 3KK2A 3BJYA 2ZTEA 1LB2B 3AVFA 5L1JA 5KG5A 3KHGA 4EYIB 1FXXA 4YVZA 2XY7A 3VQCA 4B9VA 1XSPA 3ZT1A 3RH5A
chains in the Genus database with same CATH superfamily
4QAGA 3OYIA 4LZGA 2NYHA 2XHWA 1ZOTA 4KMOB 2DB1A 5E3CA 5AQHA 4CESA 5DRKA 3C14B 4KH6A 5JVGL 4LBHA 2DKOB 4AL7A 3QQCD 2RLTA 2RDDA 1VSHA 2HK3A 2FZGB 3JQMA 2V7ZA 1LWEA 4KT0C 2GBZA 2N82B 3OTDA 4TUQA 1FTCA 5EU7A 5F0XA 1ZQEA 1FEZA 4CLLA 1J2MA 3UWTA 3FFKB 3HL8A 2KVIA 4NOHA 3LP2A 1WC4A 1X6IA 2ZWPA 3I56N 4M9JA 4I9LA 2HHWA 2IYGA 3K8WA 3Q2TC 2DNLA 4NCGB 3MEDB 1CPZA 2UXDJ 2V9WA 3BPSP 3ZC4A 2J4RA 3MMAA 3G2XA 4DOAA 2DFEA 2QLTA 3VN5A 1S9FA 3QLHB 3SSSA 2XYPB 4OI6A 4QPTA 2GVZA 2YNHA 4OPAA 2QA1A 3VVTA 4E1NA 1WSGA 1N2XA 2E7XA 4CJ5A 5H1SV 1OH6A 4WZMA 1RT1B 1S7IA 3QAEA 8ICKA 1H73A 3KFWX 3UFCX 2VA2A 5CA7A 1U2CA 3C16A 4MH8A 2CG4A 2ACYA 3DYAA 4E19A 3TQEA 3WDOA 1CJKB 1XNRJ 3SYZA 4B9QA 1BIZA 2HLTA 3B8AX 2P9NB 2G8VA 1PJ5A 2EC2A 4PCQA 4MIBA 2YMLA 1NNEA 4TU8A 2HBKA 4R63A 4LF2A 3TA1A 3H5YA 5KTQA 3VEOA 3I87A 3GB0A 2HFUA 4BC2A 1Z3EB 4FL9A 3H59A 1YBAA 4NMXA 4YMOA 5JUMA 8ICQA 1S1TB 3JPPA 3S3MA 3TADC 8ICLA 1U02A 5HOOA 2XGPA 2G1DA 3UDLA 1S97A 3PMNA 1Z25A 2DY1A 2UUCK 4DCOB 1Q81O 1BCOA 1ZBIA 4OYMA 4FS2A 5IILA 3B4DA 2BHNA 4OL8A 4BRMA 1U0HA 3O4NA 2QT7A 5IOLA 5DDYA 2GHPA 3RAMA 4A4JA 1BE4A 2IM2A 3WNEA 3TSQA 3AU2A 4OJOA 1ZQYA 5K20B 3DDKA 4ES2A 2Q2RA 3RSEA 7FD1A 1SH3A 3D2EB 4MQ3A 4DCPB 1R8PA 4Y0FA 4ZVFA 1HD1A 1H0HB 5CYQB 3OYNA 2QKKA 3GV8B 4Y2MA 3DXKA 4WU3A 5B0BA 2BJ1A 3UKUA 4FM0A 4KI4A 4K8XA 3M2UA 1N62A 2J9DA 2U1AA 1UVNA 3WIUA 3TX0A 4AE5A 1NG9A 4CZFA 3V6DB 3M30B 1B0TA 1VRTA 3T1HK 2HVIA 3L3VA 2KSOA 3CQYA 2KFNA 2E5LK 2BOPA 3WKEA 2BQUA 4EZ6A 5ALLA 1IKXB 2K4IA 1HBNA 1UMJA 5E33A 4CH7A 2KEYA 4CEOA 2O4IA 3PHTA 4EX6A 4U7UD 2K8GA 4GO5X 4CJ3A 3T79A 1EWRA 4YCXA 2HQDA 1DRGA 4A47A 1U6ZA 1JJ4A 2O6KA 1QE1A 1DTTA 1WLJA 3QIDA 2VG6A 3GLJA 3L2WA 4A8QA 4L75A 2EBGA 4TNOA 4UB2A 3MEGB 4IO1A 2DGZA 2VQFJ 4KHPK 2C2KB 1HQ2A 3Q83A 2W3SA 4B17A 4DR7F 1W7AA 4F5PA 4NEZA 3PJXA 2DHXA 1ATNA 4X62K 1X9WA 4F4ZA 4UB6U 3NS6A 2RD5C 2YKNA 3PYFA 4KKOB 3DAWA 3LGNA 2Y9HA 1B0PA 4K41A 1O1WA 5B0EA 2B0GA 3ONNA 3HSTB 2G5HB 5DM6L 3O3LA 1YIJS 4G9ZA 2MZJA 5KG7A 3J7A1 1YAGA 3S01A 3MM6A 2W04A 2OUGA 2FTRA 3W9JA 1HNXJ 5L1LA 4YOUA 1AUDA 5AKKA 2KK0A 2R8IA 4I2CA 1FF2A 2N7YA 4P4MA 3KMQA 2A6OA 2VA8A 4CZIA 2JH3A 5E26A 3ZSVA 2OEJA 2NXNA 2BA9A 2L9WA 1T8EA 3CCEN 1VBKA 4Q2MA 1T05A 2DNYA 4IQVA 1CQNA 2W4PA 5K8PA 2UUTA 1N63A 2A1JA 1XS9D 1B3TA 4UY85 1PK1B 2QG9B 1RM6C 2R9LA 1X3NA 3D6FB 3AA9A 3CIPA 3ICXA 4NM2A 3OFHA 5JU5A 2RRNA 2PMHA 4IR9A 4XTTA 4BQZA 4BXOB 3UR0A 1T02A 3TWHA 4UOGA 2HVZA 1M5HA 2IMWP 3AO2A 3QRRA 1JXEA 2B4PA 2VF3A 3BO4A 1TMMA 2DGTA 3RH4A 4IJAA 3KJVA 3P4UB 2K7KA 4P72A 3WC2A 4PRFA 4OV1A 3CC4N 5J8YA 4AP9A 1XBWA 3C5GA 2V9KA 1YJNS 3Q23A 3NCPA 4AHVA 3QX7A 1WHYA 3HZGA 4X84A 5LSOA 5M1NA 2A1SA 3VCDA 1N32F 4FPRA 3A3NB 4M5DB 5ALGA 2LHTA 1M1KO 3AY9A 4CHNA 2PFOA 3TOQA 3PZPA 3RMDA 5KG4A 2G2OA 2ZH1A 3QEIA 2YWEA 2ZNZA 3JXOA 2DYAA 4OJPA 1T9WA 4P2HA 1NRKA 2IDLA 1GOCA 2HS3A 1TK8A 4DQQA 1RG6A 1X0FA 3AARA 3KMSA 1EX4A 1S1VB 5AFUA 1CS4B 3DLKA 2RIJA 2NXCA 5JVHL 4M9NA 4K50A 3UVJB 1QS4A 3GU0A 2HBJA 4UATA 1LK5A 3PR4A 4LSLA 1Q7YT 1B4SA 4URSA 1BY9A 5J2MB 3M9OB 1Q5YA 2DGVA 4KH0B 4ECQA 1SH2A 4JKEA 2BDPA 3FRYA 1IR0A 3AEVA 4XH4A 5AR0A 3L5KA 1YZ7A 4EENA 4IDKA 2ASDA 1WKJA 4M0AA 4NX9A 1X4GA 2E9ZA 3UO0A 7ICFA 4IS7A 2KJVA 3CGIA 5A8RA 3KK2B 1KAYA 2C3OA 2JWKA 3CD7A 4Q8FA 3P5BP 3DLBA 5ALYA 2XVTA 3FDSA 1VR6A 2SXLA 1MA9B 2JWNA 1Z00A 2H5XA 3K9JA 2WF6A 1T9UA 1X4CA 1SWVA 4NXMF 1WN7A 3DHXA 1NHKL 1TGOA 5AXKA 2OO4A 2CPHA 3AGKA 1L8LA 2WVFA 3W2WA 5CHIA 4DR2F 5CZ1A 1TL1B 3KKFA 4PHPA 2AEFA 4E0DA 1DQ9A 3NRWA 1Z6RA 2LVWA 2NLXA 2R2RA 2WSFC 5K9FA 4DV1J 1GLCG 4IQMA 1SAZA 2HEKA 2BPFA 5DO2A 1SI9A 4RW6B 2VV5A 5H9EJ 3AVCA 4J2BA 4C1NK 5FDLA 1RBRA 3T1YF 4MTPA 4QW9A 2K3KA 3K5PA 3LP0A 4I6MA 1HUOA 1ZQ1C 1NEEA 3U1LA 2ZH2A 3KG4A 4USJC 4NLUA 1DGSA 2V8GA 3TA2A 4N5SA 1ZAVA 3BF1A 3A0IX 4ISFA 2Z57B 5CD4H 1UWAA 3LALA 4OX6A 3TZYA 1KL9A 1NKCA 1X9JA 3HP9A 1WF1A 4J9KA 2YNFA 4Y1DA 2A1AA 3AVBA 1NGBA 4GW6A 4LF5K 2WAQF 1VC5A 3AVNA 1LXJA 1NK8A 1EO1A 1WSRA 3K1RB 2W9BA 4GC7A 4K4ZA 2K89A 3MABA 4X66J 1L5UA 4IFEA 1HIYA 2DRBA 2PSZA 3FM9A 3LZJA 1X4HA 3BYRA 1UL3A 3KWMA 4O3PA 1NDKA 7ICRA 3VEWA 3NWGA 1SV5A 5B08A 4OHWA 4FJGA 3FEXB 4QU7A 3KK1A 2QLXA 1RE1B 1YUWA 9ICTA 4FWKA 4DFPA 2Y1RI 4TLQA 1NOYA 4CF8A 1EKRA 5CR4A 1S5ZA 3M6VA 4CO2A 4HVJA 3OL8A 4E1JA 2C3UA 2Z1IA 3EY1A 4RPYA 2HOEA 7ICMA 2P9UB 4P74A 3AJ2A 1S72N 3MM5A 2XYHB 3DU6A 3ZT3A 4H0TB 1T94A 1G3OA 1IR1A 2MSSA 4H4MA 1KXPA 3R7NB 1T9TA 2WW8A 4KI6A 3MR5A 2FB0A 4K4VA 1DOQA 2X3DA 2JC0A 1EXNA 4IOAQ 5FRNA 3QYYA 3OYBA 4GMKA 2KHCA 1XC3A 2E9RX 2JMGA 1ICEB 4DO9A 4DTMA 4A8WA 4BR7A 2KO1A 3PHEA 1URJA 1RTIA 4AM7A 4P7VA 2PI4A 4DV2K 3C28A 3D6HB 5A2QY 2CJYB 4CIEA 3D0PA 1KEJA 3CJ0A 1YT3A 3LF0A 2R7UA 5J2PB 3KLVA 4B08A 4ZLJA 4N8OA 4KR0B 4PWDA 3ZSXA 1RCXB 3KKAA 1NDCA 4C4SA 1TV6A 3P4IA 4Z4GA 5GAGI 1KAXA 2BVZA 3PKMA 4QPXA 1LVHA 2HNZB 2DY4A 1K6YA 3GSDA 1HYSA 2B8PA 2GQ2A 3L7PA 4DPOA 2V67A 4RW7B 4TU9A 4JYAJ 3OA9A 2ZM6J 8ICXA 1T6DA 4LUBA 1VHFA 4YXMA 3PYGA 2ATQA 3KD5E 2HSZA 3CXCM 8ICWA 4YD2A 4B3RK 3WXLA 1UA0A 2BR0A 4IO8A 2EZXA 3TEGA 3GR0A 5E84A 3ENHA 5J1NA 3CO9A 1X5TA 3CDBA 1EKEA 1R8HA 5GADI 5KPTA 1RZMA 4Z7YA 3OTOJ 1GLBG 1LWFA 3T5LA 4MN4C 1SV0A 3L3UA 4H54A 2HFNA 1JCEA 5ALDA 3O9TA 3EGVA 4TY8A 1KVKA 3SQGA 4PGXA 3EPIA 2VODA 1WC5A 1FRIA 4X65F 5H2FU 5J0YA 4M5LA 3PVXA 1N54B 2N4DA 3DRXA 4ZCLA 3NGZA 5HN0A 4TVAB 5J0QA 3MX2A 3IAM9 3FZ2A 5DG8A 3D1HA 3IMXA 1WCLA 3E9OA 4OZ2A 1JCGA 5IIMA 5J0OA 2BJ8A 1RWOB 3MUTP 1BQNB 1IR2A 3NVYA 2LQ8A 2EAMA 1JXVA 1OMSA 3R9PA 4ELUA 1LW2A 2UUWA 5HBMA 4RLEA 5G4DA 4USTA 4KLGA 2VHGA 4Q44A 4A46A 1S77D 1XMQK 2FMPA 1EHWA 3NCQA 2VUGA 2LPEA 4RNNA 1HLUA 2RQCA 3V9ZA 4MKVA 4CTAB 4JI3J 3MAAA 3EMTA 5B0DA 1F9EB 2J8AA 5F8IA 3L0QA 3JYTB 2BUPA 4HYKA 5HRRA 1RHRB 4KTWA 5KFNA 2RU9A 4YB6A 3CCRS 3ID6A 1Q8KA 1Q4RA 1RDFA 1XSNA 1WNEA 4Y2QA 4AL5A 1KN5A 1T44A 3SQOP 2MDAA 2JH1A 2ZXIA 2RU3A 4CJRA 3OFFA 1WAFA 2YHBA 1ZOLA 4J2DA 1RT1A 5EE0A 3O5TB 4K0KF 3K5NA 4LF6F 1BWVA 4ECSA 4WJ3B 3BSNA 4PL1A 3RW6A 4BWMA 2JJ4D 2LXIA 2XMAA 2KQ2A 4QWAA 1V3SA 2IAJA 1VQ6S 1S0OA 1NJZA 2V4QA 2CNOB 1P8ZA 4I6WA 5SWMA 5B5EU 1S1XB 1MROB 3V2UC 2M8DB 4UOFA 4DX6A 5ALKA 3JB9k 1N33F 1CC7A 2F96A 3CQXA 1R8BA 2FYXA 4M5HA 3CJ7A 3WK7A 1B4FA 2Q1NA 4DTOA 5C5JA 2RRDA 3AA8A 3UW1A 2Q43A 4Q2LA 3O9RA 3MF5A 3UMGA 4MLHA 2XEXA 1S1TA 3L4BC 1A5VA 2QGFB 3ZX0A 1YRTA 2NRVA 4N77A 1U1RA 2VKRA 3QU4A 2XY5A 3H3OB 3B9JA 2D0AA 5L9XA 2G0IA 3EUB2 2PA3A 4CF9A 2W4DA 4DR5K 1RWVB 4E3SA 3MGHA 4Q45A 1PKUA 1OO0B 1R89A 1TUGB 8ICUA 4NLOA 3GP9A 1QVGM 3U1MA 5J1EA 1J5OB 4LF4J 3PTWA 1TKXA 5DJBA 2NUBA 3UCZP 4HCCA 2E1RA 3FLCO 4FF2A 2CXEA 3D2EA 2CIMA 1KQQA 3AAQA 3M32B 4DFJA 1T3QA 2HHPA 3DOKB 5E5NA 5SUHA 5CYJA 5CYQA 3KZBA 5C12A 3H40A 1RLCL 3MURP 2KICA 2I9GA 3PFEA 3E1YA 2AQ0A 1TTHB 2W42A 3O1LA 2G09A 2L9NA 4ZPDA 1RHKB 5HQLA 5LJ5Y 2E1MC 2LXUA 2HBRB 4UW2A 3ITHB 3P49B 1YI2S 3THXB 4UAUA 2CQ3A 1FJ7A 4M04A 7ICUA 2ASJA 1YJRA 3KKSA 3A8EA 2ABYA 4EU0A 4ETXA 3OQ2A 3QU9A 3QU2A 1IM4A 2M9KA 3BN7A 2DR5A 1VSMA 1MN7A 2KD1A 2RS2A 1NLVA 2W41A 1RT6A 3NGSA 4UTGA 5CCMA 3KWGA 4JMUA 5AM0A 3ZO7A 1RBSA 2BV3A 3ZD8A 4NXZA 3OUYA 4DV3J 4J03A 4GXIA 2HAIA 2M3DA 2DEIA 1I94K 4Y28C 1L7OA 7AT1B 4MT1A 4CK1A 2W9CB 4OKKA 2UU9J 2CGKA 1ZD4A 5JLHA 4J91A 4JI8J 1X5OA 5J0UA 1HKBA 4RNFA 4GKKK 2XSFA 5KT7A 2VQEJ 4DI6A 1YVUA 4ERDA 1G15A 4YFKA 2P6RA 4I29A 2CZ9A 4Z6EA 4CT8A 2Y8WA 4L3KA 4JEPA 3R6MA 3SBGA 4AILC 5KFIA 2UUBK 3HJVA 3HRGA 2EC0A 3TQ1A 1WOQA 3QGIA 4CLTA 2LQ9A 3OTEA 4OI3A 1WWVA 2J9EA 2HQFA 3HD2A 1FEEA 1FVSA 4Z37A 3RRHA 4Z94A 4USMA 2D3UA 4PG6A 1OH5A 2XZDB 8ATCB 1K1SA 2QX0A 3RRKA 3H4DA 1C0TB 5K8NA 3P5JA 3OR1B 3TUZC 5EOZA 4F36A 3PV8A 2K1RB 3GV7B 2DKZA 3L2VA 2RH3A 3PSTA 4IKAA 4QR1A 3PW4A 2F1IA 3BR8A 1JXBA 8AT1B 3J7YI 4BVOA 2DH8A 4IH7A 4O3OA 2I7PA 2IA6A 2ADBA 3PX0A 5IT0A 3LANA 2WF9A 1UZHA 3I4PA 4Z6DA 2FUG9 1JROA 4PGQA 2O3DA 2J7UA 4FN5A 2W40A 4KLOA 2Q79A 2A10A 3HM9A 1TR0A 3J7Z5 2FXUA 2CPRA 2JHEA 4W4MA 2V52B 2HHSA 5M2UA 1Z2LA 3HKZF 4JI4K 1F9HA 2FY1A 4Z4EA 2PDAA 4M3UA 2E5SA 4QZGA 4FJKA 3BN4A 2ZJ5A 2J7KA 3AMZA 3QJPA 2ASMA 4I6AA 2NSBA 3RJFA 2ZIXA 1KRPA 4HI1A 1LW0B 3MHYA 1XU4A 3U26A 3SAHA 1PVRA 4H0PA 1HBOA 4O3QA 3ISZA 4FF4A 2R7QA 5TKWA 3NLCA 4FYYB 4F4YA 3Q86A 3GJSB 4R8UB 4KMUA 4M5DA 5JJBA 3NWRA 4X4VA 2ZH9A 1ATRA 2ALZA 5LT5A 2HZAA 1KLMB 4BJQA 3AVAA 1CVJA 4KBIA 1UFWA 1SJ3P 4LSNB 5KFAA 3A1YG 4BRGA 4YY3F 4DX8H 1CS4A 5ALVA 5J2GA 2A41A 4QZBA 4KLIA 2F4VJ 1KD1T 1HX1A 5F2RA 3OYJA 5DMRA 5AI6A 4AHCA 2L48A 4JI7J 3PRDA 4DV7F 1BPEA 4KLDA 3HI0A 2V63A 3JTOA 1FERA 3B8HA 2DRAA 3UPFA 4YDUA 2KJ5A 2CPXA 2GJFA 3Q8PB 3PR5B 8ICJA 2KE7A 1Z4OA 3MPYA 2X3GA 3MTJA 3FRZA 2WTFA 1MWMA 2HNDB 5LJ3Y 2AP6A 3CRXA 5EXWA 2X1FA 5J2NA 1TAQA 3DM2B 1DT9A 1TUYA 3ZSOA 4ZP6A 4GVBB 1B22A 2V2KA 2HRTA 3P1GA 1Q7YO 2ZG6A 3O5BA 3QBWA 5DLGA 3O1WA 1RDDA 2VFVA 4CFAA 1NBEB 4FP9A 3VQAA 3TJ8A 2YJFA 4HTUA 5A8KA 2E2NA 5EWFA 4CJ7A 4WK1A 1WWUA 2YWKA 1VQ9S 2JDJA 4LQ3A 4ID5B 3AA3A 5AFUH 3FSXA 3DLGA 4FZYA 5T7LB 3UM9A 2W2MP 1P8GA 1NGFA 1HFEL 3AQEA 1A5XA 5B8HA 3UNGC 3QAUA 5B0FA 3RGIA 1F1BB 2IOHA 1NI3A 3G0ZA 4WFNQ 3Q8LA 4C48A 3LVVA 4O5FA 2XC9A 4O44B 3K8VA 3KG0A 1WJ9A 1B0VA 3KUEA 2GS8A 2HWIA 1NAQA 1KTVA 3T69A 1NU4A 2RDIA 2I1QA 3OYCA 3D2WA 4C8MA 5SZTA 3VTIA 4V19S 4J2AA 5BRFA 3I4HX 1P1TA 2MHNA 4I7FA 1HJPA 1C1AA 4O3RA 3I0RA 4HCBA 5AKYA 2X7IA 4J9LA 2H1YA 2OPSB 3QMLA 2C28A 3AVKA 3OJSA 2CZVC 4KPYA 4IC9A 4ZLPA 4ICLB 1X0PA 4S0MA 2V69A 4BRAA 1EB0A 4B3MF 2CA9A 2BACA 2HDOA 5FPEA 2CADA 1KLNA 1SGGA 3HSGA 4CE9A 4DOZA 1X66A 4KGMA 9ICFA 4UARA 2HVEA 1FRKA 1QUVA 3C94A 2JHDA 3O80A 2JWLA 1SJ1A 2FHJD 1NPKA 1FKAF 3H6EA 2HFZA 1OSCA 2F63A 1Z26A 3THVA 3ISDA 2P9UA 2GIQA 3VHQA 1NGDA 3T41A 1SIJA 4FWMA 1XIQA 4I6YA 1PAUB 3NRBA 9ICLA 3PW5A 3MN9A 3A8YA 3U1NA 2DY9A 3VQ5A 1V4TA 2DWQA 3T5KA 5AI8A 3TUJC 3RBZA 3S6EA 4FZZA 1DAXA 1KDNA 1SXLA 2FHJA 4CO1A 4NLRA 4FZNA 4YR0A 1ZQBA 1JJ2R 4PKHA 1IBLK 1TL7A 5HL7L 1VAZA 2GWSA 4OJGA 3VF0B 2I38A 3C6AA 2DH7A 3IG5A 1VS3A 3RF9A 2XS2A 7ICNA 1KONA 3ENVA 5J2PA 2WAQC 2IBKA 2DHGA 2DRDA 3QPIA 3M8WA 5IV3A 1RILA 3WXIA 1C4AA 3TU5A 4I64A 2F9WA 5EHHA 1BWEA 4CF1A 3IFRA 4H03B 2EKYA 3I1YA 3FK4A 4PAAA 3NF6A 9ICPA 3E8OA 2H3EB 3WT0A 4LREA 4WK3A 2YMPA 4OYWA 1UVJA 4IXCA 2P9LB 5FIIA 2BJ3A 3K59A 4LFBF 1VYAA 4JK8A 4CEQA 1YTUA 1UTAA 2CN1A 3BS9A 8ICCA 2CPFA 4Q0BB 4WE1B 2ZZMA 2PFQA 1GTHA 4O9MA 3EVMA 5CZVA 5KFDA 4U8VA 4M1KA 2XMWA 4CJSA 3IP0A 5J0WA 5J2EA 1MU2A 3D0HE 3VERA 3MR3A 2FE9A 3M1FA 3OT9A 3BUZB 1W26A 1XMOJ 2V7YA 2NZ4A 4K0KJ 2JX2A 4DU7A 1IG9A 4OX9F 4BDYA 1NZAA 5HQMA 4NLZA 2N7CA 4ANCA 1S12A 3HPHA 8ICAA 1IJFB 3JPQA 4FNHA 3H8JA 1JLGB 2CDQA 2KYZA 1X2IA 2M70A 3A8IA 1LQ9A 1RHJB 4HH1A 5AQYA 1UAXA 5F8MA 3CCMS 5BRDA 1NK6A 1JLFA 2HPUA 3NTUA 4M5MA 1H6KX 4ZVTB 4RQ2A 1N33J 4ZCKA 3FZBA 2A18A 4C4RA 3ZZYA 2DH9A 2WVCA 4ZN1A 2XIDA 1MA7A 4RBUA 1IJJA 3A0BU 5HMXA 2BJDA 3BM7A 1WSHA 3TSPA 1VLOA 3V6HA 1TL5A 3HDSA 3ILIA 2XRIA 4CLYA 4PPZA 3SV3A 3K5LA 1CI4A 4RT3A 2CH5A 2K8BB 1EQ0A 4KSEB 4US8A 3ZTQA 1W2IA 5EE3A 4DV0F 3Q8RB 4CTAA 2E44A 2OSQA 4U95A 3CCVN 2EFOA 2HF3A 3KLIB 2ZH7A 2FPHX 1FD2A 3A3PB 3DLLQ 4GRSA 3JYTA 2V6AA 2JLFA 2A19A 2R8HA 2E3TA 1VI7A 1FRXA 1Y7PA 2JEJA 4L6V3 3CVKA 3BQ7A 3MK6A 3KHLA 2EFNA 4KTZA 5AKLA 4NY8A 3F2BA 1SJQA 1KFSA 3CM6A 3FE1A 4FWQA 3UQ0A 4CECA 2K7JA 3GILA 4LFAF 2M52A 5F8LA 9ICCA 2KRBA 3W61A 5GAHP 2EW9A 2FHMA 1SQEA 3QATA 2NZCA 1NNLA 4Y0WA 4QOTA 3V6JA 4C3KA 4B9NA 2VQFK 4QZ9A 1A77A 4LD0A 4K4SA 3KUGA 1HI0P 4LRDA 5F9NA 3PEHA 3ZDCA 1S1XA 2WBMA 1BVSA 2G0JA 1KBRA 1NK0A 4CI0B 1YRUA 3OL6A 1RWUA 3CSKA 4KFBB 3UN2A 2V2ZA 4WYWA 1UJ4A 4J9QA 4YDXA 4OJLA 1V4SA 3GFHA 3PIPQ 2OXOA 4KB1A 3FMBA 3MBYA 3HX0A 2Z1GA 2HRUA 2FGOA 1SVDA 2ZJPL 4DV6F 2OM6A 2YKMA 4AQYJ 2PMZF 2BJ9A 3VF4A 1TZ0A 1E6YA 1B43A 3AO3A 2A42A 3OJUA 1UPMB 3M6KA 1VJ5A 3QMQA 4P7TA 3CW2C 2Q31A 3AQFA 1Z05A 1HKAA 1HW9A 3CJ5A 1J5OA 4OYIA 2ROEA 2MQLA 3W5XA 1F60B 1NJWA 5F8NA 1RXOB 1DK3A 1Q3UA 2HHHF 5HRPA 3M32A 1X3MA 5U47A 3G86A 2BKNA 2IM1A 3L2QA 2DGOA 3VZIA 4K4YA 4IOXA 2BE7D 3FBEA 2WVDA 3TADA 3GJQB 4BQLA 4HT7A 1WUUA 3R8YA 4HI2A 2HIYA 3EGZA 2YVSA 2J0QD 1D9FA 3Q8VA 2QWLA 2KKPA 3BQ1A 4UB8U 1VQPS 2VWBA 3SJHA 2P66A 5AM3A 1PCAA 1RAJA 3G82B 2YTUA 4FKXA 3JPOA 4UF4A 5AQZA 2F8EX 4JRPA 4FZLA 4PYDA 3ITHA 2LA6A 2LP4A 1U49A 1R43A 2GCFA 1EP4B 4WF9L 3F53A 3GIKA 3K5OA 1FX2A 4K4WA 4EBDA 4WKRA 4FJJA 1H2UX 2M88A 4FKYA 3Q8KA 9ICJA 3SQ2A 2YX8A 3O3GA 2M0NA 5J2BA 2GVDB 2XLKA 2QLJB 2WK4A 3H90A 1U09A 2V8VA 3IWXA 3C3LA 1RKJA 1NH7A 2GO7A 2V8HA 4XAKA 4DJBA 3TZZA 4NLDA 1T7PA 4O0JA 2W25A 4NCAA 4H8KA 1ZQFA 4H0VB 1A7GE 3OD2A 2Q6CA 4DZDA 2XTJP 3W64A 3L2RA 4QU6A 3ZZUA 5K5MA 2ADCA 4CEEA 2WBRA 3LDLA 2YNGB 3MCSA 4IH6A 2GC8A 1EWQA 1JCFA 1ZQVA 1URNA 4PXDA 3B6PA 3GCXP 1ILYA 2KI2A 4DLGA 1JWWA 1K73T 2F5GA 1N52B 3BS5B 3VGMA 2YX1A 4JV0A 3N5FA 4JI0F 3CEDA 2YX7A 1WBDA 4GV3A 2UVWA 9ICMA 2MKIA 5AK4A 4I2JA 3MEEB 5AM4A 1C0TA 3NVZA 1LEOA 2DT9A 4CJUA 1JX4A 1J97A 2A3JA 3VF2A 4B1WB 4HDGA 3EX7B 3BY5A 2QK9A 5E3QA 1YJ7A 3BF3A 3NMRA 2I0XA 3OHAA 1PBUA 2BDUA 1OPIA 2GJIA 4DR3J 4GXKA 5JTIA 2CKWA 4R5PB 4F4KA 4P52A 3ISCA 3F73A 1R0AA 1N5TA 1RDBA 2EWSA 3QU7A 4WFBQ 5AQOA 3JQJA 1HBMB 4J9SA 1BPYA 4I2QB 1BPXA 3NBPA 5C10A 4CZEA 5L1JA 4A8OA 1ZS6A 1XSPA 4JKDA 3CCUS 2NREA 1N0UA 2KW4A 3IMQJ 4CLPA 2L41A 2OYYA 4DV1K 1X8DA 3ZDBA 2EHGA 2BE9B 1MN9A 4AYBC 4U9RA 4DQIA 3PX4A 3OPXA 3CPWR 5H9EK 3OFEA 3QNMA 2VKQA 3WNFA 2WVEA 3ZDEA 4ILHA 3DLLL 1LW0A 5KL8B 1JNZB 1GNKA 1KBUA 2MUTA 1HNZJ 4V1Ak 2J9CA 2UXBF 3TPQA 5L46A 1RBUA 2LEBA 4NA1A 1U2VB 4CJPA 2V4JB 3NH0A 4R8UA 4KLUA 1ZJNA 3PUFA 5BPLA 3NGDA 3AM9A 3ETRA 2XMJA 9ICVA 1WC6A 2AJ1A 5B0GA 3QUTA 2IVOA 4Q5VA 2GGPB 1N5WA 2RSQA 2DBYA 3KLGA 1BO5O 4H0XB 1HPZB 4MMOA 1ZQTA 4K4HA 3PYEA 3CMQA 1YIJN 2OP5A 4CFDA 4ZVQB 4BR5A 2F1HA 4X66K 4YNQA 2F1JA 3KVGA 3ZTPA 3RMAA 4LBIA 1R8AA 1YHQS 3IO1A 1H98A 1N4LA 3PM9A 3LVWA 2KL8A 2MAXA 1S0NA 2VFRA 1QQOA 4NWBA 4CHYA 4DSIA 4M7XA 1Q46A 2A6MA 3MD1A 2P9PA 4F2RA 2CJ9A 1SKUB 1H72C 4QIWF 1L6NA 3FBFA 4LF9F 3HKZC 1ELOA 3JS9A 3GIRA 1SC4B 2XHBA 1NSQA 1CXQA 3VMFB 3THWB 3CTRA 3MDFA 3KXDA 5KFLA 2HQGA 1TUVA 1GLEG 3WQPA 1HBUB 1KD1O 2D3ZA 4GNIA 4WQ5A 3ZZOA 3C0BA 4ILJA 5DBAA 1N34K 2QKBA 2W2NP 1O08A 4YMEA 4KRFA 3H0MB 4MDAA 4DUYJ 3BREA 3UB5A 4J9RA 5DG7A 1QSYA 3M7VA 1UVIA 4CH0S 3NS5A 1QUPA 2HF4A 1NKEA 1YJNN 4DTNA 3MN5A 4KC5A 2VC1A 3KK3A 3CE8A 5AJ3J 4P2MA 3IXQA 2HGMA 4BDZA 4ACOA 1S8OA 3HMJG 3DOLB 1RWPB 3E2EA 3MCOA 4Z2XA 4KLJA 3ET6A 1WG4A 4QS9A 4F92B 2MGZB 4F8RA 4PABA 2KV2A 3I82A 4JBCA 1ZXOA 3DJCA 4EHTA 2ZM6K 4JYAK 4PZNA 3TTFA 2DR7A 4JUZA 2X1AA 3MZIA 2UXCJ 8ICRA 1RLDA 1PBAA 4R0EA 1CJTA 2ZTDA 3FSIA 3K58A 2D1KA 3V4IA 3KLEB 1HNVB 2HKEA 2OFHX 3M8PB 4UAVA 4MEYA 2NUHA 4V19X 1VDVA 3SZ2A 2AZ1A 3OTOK 4OGCA 2C2OB 4A8FA 2DPIA 1ZD2P 2R3VA 5LM7E 4DL0C 3W9IA 3FC9A 4TUSA 1WB9A 3RMBA 4LR8A 3D3BJ 4FJIA 1VJWA 2OPSA 3MOJB 3R1XA 4FF3A 3CJ8A 4WTOB 4IDHA 4O3MA 3QESA 5DQGA 3VQ7A 5C2GA 2A3ZA 1LKYB 5HMWA 1U26A 2FF6A 2XBPA 4KX3A 3BGOP 3MD3A 4FW1A 1BUPA 3MR6A 2ZKTA 2KHVA 4RKUC 5AQVA 2QTDA 4DOBA 4C8ZA 4KO0B 2VJVA 3TFSA 2ZNYA 2YKPA 1X42A 1RTZA 1NO8A 3J80O 4LFBJ 3VCBA 1FX4A 4L72B 1ESVA 2O67A 3VENA 4B1UB 1SBRA 4OLBA 5GIOA 1AFIA 3GE9A 1U47A 3C66A 4FOEA 3QEVA 1IJEB 5HK4A 1DKGD 4PPXA 3CJAA 4K2XA 1LFWA 5ADZA 4B3SF 4JI3K 1KQGB 5AZJB 1KQKA 2DGWA 4OX9J 3HJFA 3RJMB 4FJXA 2CQDA 2P9KB 1FXLA 3QRQA 4V19J 2PFUA 5CRXA 5IIOA 5KFGA 4RQNA 4DU4A 1OPZA 3US5A 2BTFA 1BPZA 1S6UA 2NCKL 4HH0A 1RXVA 3WC0A 1V85A 2DO0A 4ETZA 2ZZNA 2BCUA 2HB5A 5AKZA 2VWKA 2YJEA 2MQQA 2A6AA 5KOXA 3OYMA 1V5VA 5F1XA 4NXNJ 2RHSB 4WWSA 5HLFA 3UR3C 3VF6A 3IS9A 2DR8A 4DTJA 2BM0A 4W5OA 5C24A 4JLHA 4RW4B 5HNKA 1GMWD 1CZ9A 4LF7F 3EICA 1N5YB 1C0UB 3LM2A 5BPNA 4CLWA 1WOPA 4QJVA 4FVUA 2KJ8A 5H9FJ 4CD3A 1VHIA 3IDWA 4KITB 2Q0UA 4ZPBA 3RMCA 3D2FB 1MWYA 1NCLA 4E7JA 2RAQA 3BZKA 5DBCA 3NH1A 4KN7A 1IO2A 2ROGA 2YB4A 2K60A 4I67A 4NRTA 3Q0AA 3C2KA 2O1PA 1JMTA 4ZPVR 4FDFA 3KKAC 4N7TA 1GMWA 2YY6A 1U2FA 4Y2VA 4LFAJ 4LF4K 2O5DA 1R0CB 3H1QA 2OLWA 5D4PA 4J9OA 1FXRA 1N60A 1JLGA 2LKZA 1IBMK 2F40A 2N3OA 4M2YA 2XULA 2CQCA 2WRMA 1NPRA 1UWBA 5A6PA 4YHHF 1SZ2A 3AA2A 5IWAJ 3MMCB 4O55A 2BANB 4WFYA 3I5CA 4NZ7A 3VPZA 3PSIA 5ALEA 3NAEA 4NWIA 1VQKS 4AHUA 1UPHA 4ID1A 4F25A 3PRBA 3C46A 4RPXA 2CNLB 2W2OP 2LBOA 2LYVA 4EZ9A 9ICIA 4M3YA 2HQIA 4J9MA 2LQBA 2JOQA 4Y6IA 2G8HA 1IBKF 5EN1A 1HD0A 4QYZJ 3KLIA 1I5OB 2IC3A 2DHSA 1ZQAA 2HOQA 3OXFA 3VGSA 5ALXA 5LMNF 3OBWA 4TKTA 4AHRA 3AJDA 4DV4F 4DV3K 1SWWA 3VA0A 1S9EB 4DTXA 5F0WA 4JK1A 2DNHA 1B64A 2J0SD 2UU9K 2ZF5O 4JI8K 1K0VA 2O8DB 2NQPA 3LPTA 4QJFB 1DLOA 3MM8B 1DARA 1TKZA 1VSFA 5F9LA 4YUDA 3Q8SB 3HI9A 1FDBA 2V51B 4CZLA 4BE1A 4MO5A 5ALIA 4M3XA 5AIAA 5CWRA 4OHYA 3ZEUA 3TUIC 3A2FA 1S6QB 3KZXA 4RNOA 3OYFA 2RT3A 1HJOA 1YQHA 3MMBB 5EOYA 1SH0A 2ASYA 3R8EA 2RRBA 3RB6A 2IMOA 1NSKL 5FLXO 1VK0A 1FO1A 1PK3A 1XNQJ 1CRXA 3PSFA 5HHIA 3L2UA 2CQ2A 1LWEB 4ILRA 2Q0ZX 4HLBA 3E9PA 2R7OA 2RMLA 4NV0A 3O9SA 4BRPA 4FK0A 1J2NA 1YX2A 2XQCA 4Y2JA 2Z7JA 1C4CA 3LP2B 2VPWB 1XN9A 1TAUA 1M5VC 1RJJA 5G5GA 5IZHA 1V3ZA 5ALTA 3KTQA 5EWGA 4CGFA 3ALRA 1BU6O 3MMAB 3N4WA 1U45A 4GVMA 1E6VA 5IT9O 4CZKA 1BISA 5D8HB 2F3NA 5CYMA 2GVZB 5F0UA 2YNHB 3F0NA 1I1GA 4CHQA 2GQQA 4GVLA 2NO4A 4L76A 5T14A 4W98A 3F2CA 4JI0J 4CLUA 3CCRN 2HHHK 4M6WA 2LFVA 4B1VA 1S6OA 4HAIA 3IBWA 4O5CA 5M2RA 3ZZZA 4OI0A 4PZVA 3CCSS 1ZPWX 2ZBIA 4IG0A 1U9LA 2KP7A 1ZQLA 3HF5A 4OHVA 3C16B 4FXWA 1ZTTA 1VBZA 1XMBA 1C20A 3LP1A 3VALA 3H20A 5B0CA 2F1FA 2HSTA 4CGIA 3UCGA 3FZLA 5C2DA 4Y3CA 7ICJA 3IR7B 1VQ6N 4XRHA 2BGGA 1OQ3A 4YD1A 2P5OA 2UUCF 4LZDA 5EE1A 3EXYA 1PJ6A 1OY8A 2YWHA 4H4OA 3VAJA 2LA4A 4BHQA 4F5RA 4NLQA 3MXIA 2D9OA 4U7CA 1Q78A 3LDNA 4IRKA 2MSNA 1TKTA 3HVAA 4LFCJ 1UKUA 1U1MA 3OLAA 2ZE2A 3T6JA 5T7BA 2MJUA 3J81O 2ZKUA 4ALZA 4NL5A 2FDRA 3PSPA 1U0HB 4NPOA 3Q8MA 1VRQC 1SJRA 4Y2XA 4USHA 5ELZA 1A76A 3SLCA 3R5AA 1OJ4A 3D6TB 1QH9A 4JI7K 1EX8A 1HR0J 3P3DA 4ZVPB 1FE0A 3M9NB 7ICVA 3VQTA 4DUZK 3C5FA 3PY8A 2W01A 3RSEB 5F41A 4YN4A 1BOTO 3GJRB 1FKOA 3P83D 5KFKA 4ZKAA 3TI0A 3T1HF 2XB2D 3PEJA 4BRQA 2QJ3A 3UKUB 2YX4A 2MRLA 2E5LF 1PG5B 3WKDA 1AA1B 8ICSA 2VWJA 4A2BA 1S59A 4KHUA 3D67A 1K5OA 3BBCA 2Z2ZA 4P9SA 3FJ2A 3GBTA 3LZIA 2MQOA 1HKGA 2YQ3A 2QEXS 1H1VA 8ICGA 2KSOB 3LDQA 4I9QA 1N5SA 2BUNA 1YI2N 5D0EA 4Y2IA 5D4NA 1HBNB 2AEMA 4FZMA 5D78A 5KAFU 3K89A 4PGYA 2Y8YA 1HBMA 4JKHA 3AU6A 4H4KC 2XCPA 4I2QA 3WK5A 2VBWA 2G13A 3I8BA 2P9EA 2IJRA 1VQLS 1VSEA 4ZVEA 5KFVA 3DN9A 3NMAA 2CDRB 4BRDA 3WHIA 4KHPF 4OZJA 3QGHA 3QINA 2ODGA 3M7DA 1X5SA 4Y00A 4USWA 4X62F 2FDNA 1ZBLA 1SB6A 1ZD5A 3JPSA 4CEAA 1CQMA 3VESA 2WCXA 5HMLA 3QRPA 4QS8A 4O4GA 9ICBA 1WEYA 1QSLA 1JQGA 3L3FX 3CJBA 5AIBA 2P6UA 3NGUA 1JNRB 2YX6A 2Y9UA 2ZOFA 4F3OA 3OYGA 2CJQA 3VQDA 2V8PA 4X5VA 2E9TA 2VGMA 2UXBK 3ZTRA 4DS4A 2ACMA 1ZQWA 3CCJS 2VPXB 3FYHA 3BKTA 4C0ZA 2R2SA 2RQ4A 2EQYA 2UUAJ 2Z56B 4K4IA 5TISU 2R7VA 4GFJA 3SEOA 4CDIA 3ILLA 1QTMA 2IJFA 3CF5Q 2WHOA 4DV5K 4FJ8A 3DLRA 2EZZA 4OZLA 4DMNA 2BE2A 4ZLNA 4GKJF 2DQNB 2KG5A 1FJGJ 4CEZA 1T05B 4N47A 3FAHA 4OX7A 2RB7A 4BE0A 1T3OA 1Z1VA 4CJKA 1UA1A 4XQ8A 4AF1A 3C29A 4LC9B 1BQXA 3L8BA 1WI8A 4TSXA 3OW2M 3AVIA 4P0QA 4RW9A 3HOSA 2YKAA 3THWA 1TFRA 1TVRA 3N97B 1I39A 2PEHA 2MEWA 5AICA 3TNVA 2KNJA 3VQBA 4OZ5A 2R8GA 3AV9A 3VQ8A 3LWMA 3KJVB 1COKA 3CCTA 4RQ0A 2LDIA 4QW8A 3AAPA 2I8EA 5KPZA 4CYUA 2X74A 3M6UA 3BH7B 3AJ1A 4BGAA 5K8MA 1Z1ZA 3WK8A 2QSWA 2G1HA 3J80U 2KJ9A 2E1FA 1Q8IA 3OFGA 1VQYA 5EWEA 3LPEA 5LOQA 3NASA 2CVEA 5LSLA 2OIHA 4PL2A 2HMPA 4NA2A 4NLYA 4YDUC 4BVPA 3JSYA 4LBPA 2VD3A 3K57A 2ZIWB 4O8KA 3ENBA 2HGLA 1AT1B 4B9UA 4F3MA 1HNWJ 3JXUA 1MMLA 4LR7A 3LTOA 2NV3A 2OSRA 3DLKB 4Y2AA 4ANEA 3N4QA 2WB1F 2APOA 4UB5A 4C7QA 4LSLB 3KLEA 4KRWA 4B1ZA 1FK9B 4QIWC 3D1OA 1QQ7A 4KE5A 4MK7A 1ZQHA 1SIZA 1QAXA 2B7CB 2RQKA 4CK3A 4WFAQ 3M2RA 1ZBSA 2BPCA 3DRSB 5KFPA 3GYGA 5DQIA 4IDKB 1DGJA 3VAGA 2GOLA 4K8RA 1RT3B 3PG9A 3M8SA 5IIIA 2V2QA 1VHXA 5DDPC 3C23A 3R27A 3GL1A 4CO3A 4DG1A 5A8RB 3V9XA 2ZJ8A 2DVIA 1L3TA 3WXJA 2YKOA 5ALPA 4N41A 2IVYA 3R9LA 2GELA 3PIOL 2RP5A 1Z00B 3PNCA 3QO9A 4H5VA 4IZ9A 7ICEA 3TEHB 3I9ZA 4WPAA 4I28A 4UQTA 2CQ4A 2N1RA 4H0OA 4G9BA 1F5CA 4X64J 3TAFA 1RXWA 3DHWC 4YEAA 4M5GA 4LH5A 3W2WB 4KGVB 4JV5J 1G2EA 2QWNA 1IVZA 1IBCB 5E79U 2NUUG 2G8WA 3SEIA 1E3MA 1VQ9N 5J29A 4LF1A 1J54A 3T6BA 1REVA 2B7BB 5AZJA 2LSNA 2Z2MA 8ICEA 1XC9A 4Y2TA 1FA0A 5FDLB 8ICOA 3R7SB 3KLFB 3LP0B 4I6MB 1FDAA 4JI1K 2P9KA 5DBBA 3UCUP 2GFFA 1N61A 2PA8D 4DS5A 3P45B 2X6SA 3NGKA 2BCVA 4B3SK 2W6KA 4QOZB 3U27A 4LF5F 1LFPA 2LKYA 3F2KA 2EK1A 4NEYA 3A5NC 4ANDA 3CJKA 5HR6A 3M2VB 3MM7B 2QKQA 1QTNB 5D4LA 4UT4A 1IKVA 1FFSB 2B4OA 4L3NA 2WAQD 2Q1LA 1LOTB 3TJ9A 1NXIA 1YJTA 3VVUA 1CULA 2B43A 2W9BB 2CWXA 3PXGa 3Q24A 3T1AA 3V1OA 1GLJO 3I33A 4NLXA 2MKHA 2FJAB 2NRWA 5KFFA 2VBZA 4K4TA 1FRJA 3CM5A 3V81A 3IBPA 4LF8J 4FSVA 2WVBA 3KK1B 1N5YA 2ZUCA 1LK7A 2HQ3A 4B8AB 5L1IA 3I31A 2G0AA 2BM1A 3H4BA 3BGRA 1D4XA 1U8WA 2FBYA 3GFZA 3D2FA 2DNZA 2ISPA 4W5NA 2YPZA 4DV4J 1X6JA 4KAZA 2DGXA 3R1LA 2AW0A 5ALHA 3M1VA 4JD2B 1ZTWA 5J0TA 3QGPA 4QZDA 4ED2A 4X4PA 1RAIB 2ZHBA 3OYAA 3D7SB 3PFOA 4FBTA 1VIOA 4DF4A 2I5HA 4ECYA 1NGGA 2AP1A 1UEKA 2P35A 3WU2U 4H4MB 4DV2F 2K2PA 1G6BA 1LXNA 3AXMA 1RTHA 2HI0A 4CK2A 5EUHA 4FLUA 1WI6A 1RAFB 3MMCA 5E3RA 2BANA 2C3PA 3ETOA 3MUMP 1RTIB 3MMVA 3MAQA 3ZT2A 1M6YA 2EI5A 1WHVA 5FJ4A 2LYHA 4FF1A 4IWVA 3HVTB 4W90B 4F72A 1FXDA 3H25A 4PWDB 3AQPA 1VQNS 3A4TA 1SQGA 3LAMA 3AGRA 2ZJRL 4B3RF 2ZQBA 4FCYA 3QIPB 5DGAA 2G8FA 3Q8QB 3CJ4A 1HYSB 1ZM4A 1NJIO 1NDPA 1S9GA 3T9ZA 2WHEA 4Z7CA 4KLFA 1PSDA 5J2JA 4JV2A 2J6SA 2BJ7A 5IT9U 9ICUA 4B1XB 3POTA 3K9KA 5ALNA 1NZ8A 3TVZA 3PRVA 1IBKK 3NG8A 4D3HA 2J76E 1S3XA 4DU1A 1RYUA 1WEZA 4K59A 4FS1A 3D68A 2ZC3A 2OZMA 7ICSA 1W25A 3UN3A 5LMNK 4W5TA 2DNOA 4GY2B 2VJ5A 4IKFA 1LWFB 3QSYB 3SMZA 4TY8B 3VOVA 4DL4A 2VJUA 1SL1A 4JK9A 2MKCA 4OJ5A 1Q16B 2O8CA 1S76D 4OKEA 2EZYA 4UZBA 5AXLA 3DOMB 3ETLA 3K75D 4DR1J 1S6QA 4P4PA 4C4TA 1JIHA 3M4XA 3HFZB 3MMBA 4YOXA 4ATNA 1F2HA 3DGVA 4Z6FA 4CEFA 2DIVA 1DXSA 2JR5A 3RBXA 1XMQF 2CPZA 3GPAA 3H2UB 1FE4A 4X4NA 2E5IA 2L9DA 4BGBA 2MQMA 1RNHA 2OPQA 4DR4K 3KZIU 2LYBA 3SNNA 1L3SA 2BCQA 1A6SA 1LW2B 2QRRA 5HBMB 3SFUA 3CCMN 3CP8A 5IQQA 3MPWA 4ED8A 4YB1P 3CO0P 3RBEA 1Y5LB 3J81U 3OVSA 2OA8A 2Y0SF 3FUYA 2V68A 4DR3K 3OYLA 3MAAB 2E8AA 1ZC6A 1HQUA 4I2HA 2IM3A 3LA0A 4RWXA 1RAEB 3QWUA 4DTUA 4QZFA 2WONA 5B7WA 2NYIA 5A6WA 4KQZA 1ZBFA 2Z1HA 4BC4A 4YORA 1PYOB 1KN6A 5BR9A 2C2RA 3KHRA 4NASA 2W43A 2E29A 1P9QC 2H54B 1QCKA 4OJ3A 4YB5A 3QU5A 4M9LA 3ILJA 2GMJA 2JEFA 4OLAA 4R65A 3NGRA 3SPYA 2EEYA 2Z0GA 2IAJB 3BR9A 4EYHB 3ZCMA 5KNIA 5GIPA 3OYHA 2H51B 4Y65A 4OGEA 1HNZK 3SJJA 1VSJA 5GADP 2F8LA 3X3UA 1HMVB 8ICMA 1VQ5S 1ASWA 4QZCA 4NL9A 4LRFA 1ZQPA 2KN4A 3LPYA 3MECA 4DR5F 3TAEA 3GIMA 5M1QA 1EAYC 4FWRA 3J81j 2F9DA 2D3O1 1BNPA 3LGMA 4HVZA 4RBTA 3NP5A 3PX6A 4MEXA 4KHPJ 1WTFA 2E5JA 1KKHA 1YK9A 1DJ0A 4X62J 1HA1A 5J1EB 4MAKA 5AKIA 4M3RA 1TKXB 4KLMA 9ICEA 2VOOA 4JI2J 3O8MA 1W7WA 3FEYB 2WOMA 5C42A 1NJXA 1B70B 1Y11A 2NXJA 4W92B 5CH7B 1RGVA 1KCFA 3DRPA 5IS2A 3KHYA 1JLQA 4P2FA 2A2DA 4JWMA 1WSJA 1ZYQA 3TANA 1NB2A 5KG6A 3CT9A 1O03A 2OMLA 4JI6J 3AXKA 1RZTA 1MSWD 1RDCA 4NLGA 2IIRA 2VANA 1VQPN 4WKYA 3HP6A 3BP8A 1BQMB 1YBUA 3GV5B 4OLOA 2NNWA 4F3TA 3H45C 1I94F 1KWMA 4K5SA 2B51A 5I42A 5KT2A 1J2VA 3EVWA 4DUYK 3IN5A 1RT6B 1A0OB 3C15B 2QW9A 2FC9A 1N0VC 3W60A 2DBBA 4GKKF 4CQ1A 1GAOA 3CDUA 2B9WA 3OUYB 4WP8A 1JLAA 2ZJQQ 2G07A 4WXWA 4QBUA 1S57A 1NNDA 2RE1A 1X4BA 3N79A 3A8JA 3FGUA 5AJ3K 2UUBF 4M45A 5I3UB 4KHNA 2JFKA 4RUAA 4M5JA 1K9MT 5I9EB 4YOVA 1WSVA 2KZMA 4B02A 4C8LA 3PLAA 3C95A 3LM9A 4IRCA 3NVMA 3L7UA 3TAQA 2FVPA 5LXYA 5LMUJ 4AYBD 3D2QA 2KMDA 2HVHA 3THYA 4BRIA 2PD1A 1PUZA 4PKDB 1QVFM 2UXCK 3FCHA 3P96A 5AT1B 2IGIA 4FO6A 4FK2A 2QLBB 4MFAA 5CA5A 3L4PA 2KT2A 5EE9A 1T11A 3H0PA 3C7NA 8ICFA 2GEMA 4USIA 2E5GA 4EX7A 2XCAA 5HVGA 3NF9A 3L95X 3D4JA 3WEEA 4C3MA 3W9HA 5K8OA 3RUBL 1U1QA 1ZBTA 3IR5B 1F21A 4ZIVA 2PI5A 4OYAA 4CRXA 3ZZ0A 2YN4A 1X9XA 3C21A 2Q97A 3VAMA 2CQIA 2H65B 4JI4F 2KFZA 5BYQA 4ZVHA 4E89A 5HRSA 5IQ6A 1U1LA 5CP2A 1ZQMA 4CP5A 2RDJA 2FLPA 3R6GB 4GKJK 2AJ4A 3ZSQA 4PQUB 4QZIA 3EJMA 1CJUA 1S48A 4RQ4A 3HKZD 1Q9XA 2WSEC 2GV9A 3KOAA 5BR8K 4IO9Q 3TABA 3LDAA 3NFAA 4DR6K 2G2ZA 5AQWA 4F93B 2WW4A 4W5QA 3JTNA 1VQ4S 2QWMA 1QDUB 3UIQA 4RG8A 2ZIXB 4BR0A 1KVCA 5ETOA 3I0SB 3IM1A 3ISNC 1WC0A 4US9A 1HBOB 1MW7A 4CLKA 2Z8QA 3G8QA 4OIXA 1NK9A 4UB1A 3RR7A 4QR2A 4CJVA 2BCRA 2F9TA 4XDCA 4KLQA 4L73A 3GOIA 4WFZA 1KW4A 1BGXT 4O3NA 3ATVA 1BIUA 3GMGA 3AQOA 1IXKA 2BKPA 2HOFA 3DDNA 2A40A 1ZQNA 4O5KA 2XMUA 2KFYA 3ZSZA 5BN8A 2F8SA 4DXLA 4F4WA 1SQFA 3R1HA 2NRZA 2ZIWA 2R7YA 4BGDA 1HYVA 1J6ZA 4NXNK 2DJWA 3HHLD 3JAMO 2KH9A 4KLHA 2AMCB 4BLGA 4B9LA 2FGCA 1C7YA 4K8ZA 4U8YA 4XA5A 3RJGA 4WQ5C 4HACA 2W54A 2P9IA 5KFBA 5KG3A 2ZITA 5J2KA 1FK9A 4KLEA 4BE2A 2VOPA 5F3TA 2CQHA 4J9NA 1CSJA 1CZBA 2IJNA 1K8KA 1T03B 3EO3A 1D09B 1YJUA 2WZ1A 5GAEP 1GX6A 3VAHA 1KEKA 2GWJA 1PGZA 3NS7B 4DL7A 1Y4ZB 3EGNA 3HHLA 1S6PA 3DRSA 4LF5J 3AD9C 1DHMA 5AZIA 4E8UA 3AO5A 4EO6A 1RT3A 3OHBA 1HQEA 4C7ZA 5J2NB 5AI4A 2KHOA 2DCUB 4MK8A 4D3GA 3DGPA 5GMKa 5IIJA 2M5YA 1U1KA 4CERA 3SUPA 2CJBA 4AXJA 2G2YA 4C11A 2F8TA 1F44A 3TVYA 1NGHA 1UEUA 4OPJA 2EWHA 1KHWA 2X6NA 1JUDA 4ECVA 1A9NB 4LRCA 4RJVA 5A8KB 4NLNA 5IWAK 1G7CB 1Q0NA 5BN9A 3DCAA 1QZ6A 3OVNA 2Y0BB 3CDAA 1NU0A 2AJQA 4OZNA 4JHDB 3WKAA 4KLSA 2R8KA 5DB7A 4MF2A 3TZXA 4PG7A 5ETTA 2I7NA 4K4XA 2HMXA 3KBBA 1N36K 3DLGB 4ED4A 3SMSA 5CQGA 2KG0A 5KFJA 2E20A 5HMYA 2HFSA 3G10A 4OJHA 4DX5A 4FO0A 2IVNA 4QYZK 1KSPA 3OPKA 1IM6A 3QGGA 3KLFA 2BXJA 1ZD3A 3PO4A 1IV8A 1LCUA 1BLUA 4I2FA 2A5XA 3OL7A 1VSDA 4ED7A 2ZIVA 3FQLA 4ID8A 5FRMA 3M2VA 3MM7A 5C25B 2NRHA 3N6LA 3V7LA 4OLPA 4Z6CA 4A61A 2E8OA 4I7FB 3RRGA 1RB0A 1HLWA 2K4HA 2D74B 3I0RB 1RU2A 2HBQB 5KQ8A 2VIHA 1T95A 5KFOA 2PKEA 4NE9C 4LH4A 3VEVA 2G4BA 3GWCA 1RDUA 1QHTA 4R79A 4ES3A 5KI6A 4C0HA 2QA2A 1TFWA 2DXFA 3C6UB 4B3RJ 1DGKN 4ZOSA 3G8TA 2Y3YA 2G5IB 3KHGA 2HWTA 1FXXA 4YVZA 2XY7A 2AD9A 3EKUA 4A5BA 3IBCB 3RH5A 3D6RA 1XNQK 3M8QA 2H9ZA 4CZMA 1B7FA 3ORYA 1OXJA 3ZSRA 4X4SA 4QZVB 5CHGA 1GQEA 1JJCB 2UXDF 4OHZA 4JD2A 4JOUA 1Y97A 1UVMA 1CLQA 4R66A 1S1WB 1KC8T 1D8BA 4EFHA 2EAPA 2D3DA 3DDIA 1BXNA 3NUQA 3FCVA 1IBLF 5FROA 4FWOA 2OD4A 4BR9A 3NMUA 4PHEA 4PY5A 1FNMA 3R97A 3KKRA 4GXJA 2FPMA 1HI8A 1WG8A 4DFDA 5FPMA 1D8LA 4DN0A 4LJXA 3WUHA 5MLCQ 2PFNA 2KHDA 1TL7B 2RKIB 3RWUA 2XY6A 5D15A 3HHDA 3C2LA 4CGZA 4IG3B 3NCIA 1N6QA 3PNIA 4BR2A 3MWTA 1L8OA 5F8JA 1IWGA 2UV8A 4B8CA 3ULHA 3W5YA 3HVTA 4AM6A 3CJQA 1XMQJ 3BQ2A 2W2PP 3CJ2A 2LI6A 2HZVA 2D5RA 4Y1CA 1J5EK 2Q3PA 1EQMA 4RQ8A 3QZ8A 3QIPA 3ULEB 4MIWA 2DFHA 3R9KA 4B3OA 3T3FA 1B9DA 3E01B 3H98A 2LEPA 3JS6A 4KH4A 3HTVA 4RX6A 3HWTA 4R0JA 3N7RC 3FZHA 1GK8A 4K4UA 3O3HA 3G8SA 2DNKA 4DSLA 5BREA 4XH5A 3WX4A 4O5EA 2UV8G 3J80Y 2UZAA 1WCNA 3SMPA 3Q2SC 3AA5X 1MU2B 1SUQA 4B9TA 5L39A 5D3GB 3D2SA 2P9SA 2HBLA 3B0XA 3MM9A 3DMJB 2P2CB 2GQCA 3CC7S 4B3TK 4BRKA 1WBBA 5AQNA 5B09A 1Y9OA 2OEMA 3DOMA 1GH8A 1VK3A 2XO7A 2O8EA 3NDKA 1HR0K 4C80A 1OYEA 2J0XA 1DQAA 1C0MA 4NYOA 2YXLA 2ZUDA 1AZSA 1JLFB 3NNAA 3HKWA 3BSOA 5HVHA 3E58A 3IP4B 3K4GA 1RT7A 3MN6A 4IQXA 2W1BA 2XS5A 1HPMA 2HHQA 4CJ4A 1H2VZ 5J2HA 3W63A 1JRPA 1YXQA 4UUXA 1D0EA 3IRUA 1N5QA 2AIRB 1U6BA 2PZSA 3I5AA 3S3OA 4DZ6A 5BYRA 5AKHA 2W55A 2JLEA 1HYZA 1VQKN 4M3WA 9ICRA 2ISOA 3EUNA 1FJCA 3U9DA 5ALWA 3LUYA 3W65A 4OYXA 2KB2A 2RHQB 4CJTA 4F0KA 1VIXA 5B66U 1D9AA 2VGNA 9ICAA 5AE2A 1VGYA 2ZBRA 2ZDOA 2E6MA 2VQFF 2WC9A 2JZBA 5DLFA 3J7AN 1WTBA 2QARA 5ETRA 1NMEB 2E7WA 4E1MA 1O0PA 5BOMA 4I56A 4RWTA 2FLLA 3DDHA 1Q53A 3MN7A 5KFSA 3CFRA 2ASPA 1NOMA 2XI2A 4BC9A 1WSFA 1HMVA 3SAFA 4R64A 4P71A 3V9SA 2MB0B 2E4LA 3I55S 5LL6d 4M5KA 4RCHA 1WKLA 2POKA 2WMMA 1I94J 3QFWA 4M63A 5DB9A 4JI5K 2HMIA 1PZNA 3BGUA 1HJRA 1SC3B 1FKPB 3ZDDA 4ZVOB 5ALUA 5B0AA 1HWLA 3VEZA 3BQ0A 4NI2A 2YKMB 1RT2A 2IFXA 2PMZD 4ZCMA 3IV6A 5CE3A 1ZXIA 2UUAK 1E6YB 4P75A 5IC4B 2W7AA 3MXHP 5C15A 2C42A