3TAPA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-3) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tapA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tapA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tapA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tapA01
4HYKA 4Q5VA 4CF2A 5HRRA 4R8UB 3RBEA 1ZQPA 1RXWA 4FK0A 4R66A 4G3IA 4W5QA 2G8UA 3EYZA 4LVSA 1XSNA 3TAQA 2EX3A 4YFUA 2A1JB 2Z1HA 4TQSA 1NOYA 4M9JA 2ASJA 1ZQCA 1ZQTA 2HHXA 2E6MA 1BPYA 3L2RA 5KFNA 5KFGA 5BPCA 4DWIA 3C6TA 4KREA 4F4KA 4Z0UA 4PHEA 1T4GA 5J2JA 2PI5A 3NH1A 2XO7A 4DEZA 3I0SA 4QAGA 3ZSQA 3IRXA 5DDYA 4O5EA 4J2DA 1XS9D 1BQNA 2XY8A 4CHPA 4DL5A 1ZBIA 3ISNC 2Z1JA 4YMOA 5J1EA 1BPDA 5KGXA 4YR2A 5KG5A 4W5TA 4KLIA 3K2PA 4RT3A 2JLEA 2P66A 2XHBA 1XI1A 2VWJA 4QZCA 1N48A 2W9BA 3O4QA 1IG9A 4CEAA 1GOCA 4DLEA 1BI4B 4YVZA 2PFOA 4KB1A 1S1UA 3OYNA 3S3MA 3ASMA 3T5JA 3K5MA 2RN2A 2R8JA 1X9MA 1RBRA 4CHOA 3KD1E 1ZBFA 3MEEA 1EXNA 2BQ3A 3C1ZA 4PHPA 3GIKA 3DLKA 5DB6A 2I5JA 4CIGA 3EPGA 3AA3A 3BQ2A 3TABA 1UA0A 9ICIA 4DTUA 4E7KA 4DF8A 4KLOA 3DRSA 4ECZA 4B9LA 4FK2A 1XU4A 4FM1A 3ZT4A 3C21A 7ICFA 1LW2A 4DL4A 1JLQA 4KMUA 4AHCA 4EBDA 3LPTA 4DSLA 1HMVA 3DLHA 4FJNA 4AHSA 4FJ7A 1LWFA 4FLZA 5HLFA 2J6UA 4OLBA 4EP4A 3V6JA 5J0PA 3NFAA 5J0SA 4ZTFA 4CJQA 4UB4A 1T03A 2V9WA 4TUPA 3TFRA 1RDBA 3Q8QB 1VK0A 3KKSA 3AU2A 5J2BA 4B8CA 3KLGA 4RG8A 5IIOA 5KFSA 4ECYA 3MR3A 3SPYA 1B43A 1T05A 1VSKA 1SL2A 4OPJA 3ZT0A 4ZH4A 4C8OA 1A77A 4K4GA 1N56A 2KZ3A 3VQ8A 4M47A 1DTQA 1K1SA 1QHTA 4F4YA 1BL3A 4KTZA 4RW7A 1ZQKA 9ICCA 2NRTA 3AU6A 2VA8A 1ZQGA 1HYZA 1TV6A 4FLVA 5CB1A 2JGUA 2PFPA 3NGDA 1JKHA 1JLGA 4CK2A 5I3UA 1IKVA 4RQ1A 4J9NA 2HHUA 1L3SA 3WNGA 3LDAA 1BVSA 2ALZA 3MXIA 4KV8A 3V1QA 4KTQA 2HW3A 3AUOA 1L5UA 3ZSXA 5EWFA 1TK8A 1TKXA 5FRMA 3H4DA 4O5BA 1HYSA 1UAXA 2XC9A 2XCAA 2V4RA 5DB7A 3JPOA 2G8VA 4PGQA 3HP9A 4HUGA 3IAYA 3AO3A 4UAYA 4YQWA 3RH4A 3NE6A 3H8WA 3MEDA 2PY5A 5KG6A 4DTNA 3V4IA 2KQ2A 3OJSA 3V9SA 3KKRA 1EXQA 3PW5A 2BANA 2MUTB 3SZ2A 2LYHA 4RNOA 3V7KA 8ICYA 4FS2A 4IRKA 1ZQWA 3H4BA 1TKTA 4RW4A 7ICMA 4MF2A 4H4OA 3HJFA 4QW9A 4QWAA 4CFDA 1JXEA 4CFBA 4Q0BA 1N5YA 5KT3A 4DTRA 5DBCA 1T3NA 3OYIA 3PR4A 3C94A 4NM1A 4JS4A 2JZBB 4KFBA 2F8SA 2Q0ZX 4QZFA 3GV8B 3VQDA 5C42A 3TQ1A 2FPLA 1C1CA 9ICMA 3S3OA 4YD2A 4KI4A 2G8FA 3SYZA 4CK3A 4L8RB 3HL8A 1CLQA 4LH5A 3ISBA 3L2VA 4JLHA 2OYQA 1HRHA 4ECTA 4F5PA 3OYHA 3VQAA 3ZSVA 8ICTA 3MEGA 3T3FA 3QETA 3PNCA 5HBMA 1RT3A 3L2WA 1B9FA 1WNSA 2AGOA 3C1YA 4C8NA 3QEVA 3KK1A 3V9UA 2XCPA 3LPUA 1WN7A 2ZUCA 4F2SA 3WNEA 1YT3A 2XY7A 3ITHA 1S6QA 3H8SA 1ZBUA 1TVRA 3PVXA 1JLCA 1KRPA 4KLGA 4FLWA 1D8LA 4LH4A 3QEBZ 5HMLA 1Q9YA 2HHWA 1HNVA 4KHUA 4FJHA 4ECWA 2OA8A 1REVA 4BDPA 5J2CA 2GWSA 3JPTA 1KVBA 3U3GA 1UT8A 4BXOA 3QEIA 3HM9A 2ETJA 4B9VA 4GMJB 4Y1DA 9ICAA 4CJPA 4Z6CA 2I9GA 3HVRA 4H8KA 2P5OA 1LAWA 1AROP 2ASDA 4I2JA 4AH9A 3OYFA 5KTQA 2J6SA 9ICVA 1QE1A 4KN4A 3QINA 4HUEA 3ZDEA 4RQ4A 3N97B 4DU1A 4MEXA 1CXUA 3DYAA 5DG9A 1VSDA 4O9MA 4CJKA 1UOCA 1XSPA 4F3TA 4HUFA 3F73A 1S0MA 4K4IA 3TAEA 4OLAA 3B6PA 3GIIA 1SUQA 2DY4A 4FJMA 4NLGA 4M3TA 3HYFA 4E7IA 4Z6DA 1MC8A 3MR5A 5E41A 3QZ8A 4FJ5A 4QZ8A 5IINA 2P51A 4JV0A 2HMIA 3P1GA 2Y1JA 1S97A 4MQ3A 3NBPA 2Y1IA 4YMMA 2C2DA 4OGEA 5L1LA 3Q8RB 2FMPA 1EP4A 3K5NA 1EX4A 2FBTA 4J9SA 3SV3A 3E01A 4C8KA 3HT3A 1IKYA 3HSTB 1Z00B 4JRPA 2ISPA 3OJUA 5CA7A 4CGJA 4IG3A 4Z6EA 5J29A 4BDZA 4NCGA 4ED3A 3AA5X 5DG8A 5KT7A 2X74A 1BCOA 8ICOA 2PYLA 4IQUA 1VSHA 1KTQA 4PGXA 1TV9A 3U6FA 1U47A 9ICLA 8ICZA 4CJ5A 5KFOA 4B9NA 5KFVA 5J0XA 3P5JA 4XRHA 3ZT2A 3NGZA 4QZGA 4RUAA 3CFPA 4M3WA 4O3PA 4CEOA 5K14A 4GXJA 3VN5A 4M9NA 1VSLA 1JXBA 3M8QA 3LK9A 1QS4A 4FM0A 5FROA 5J0YA 4E1NA 1C7YA 4CEDA 4CJEA 1Z25A 3SUNA 1KLNA 1A5XA 4O0JA 1NK0A 9ICGA 4UBCA 3G6YA 1WSFA 2VA2A 2BCQA 4Z4FA 2XRIA 9ICKA 5D49A 2YV0X 2R8IA 3H7IA 1BPXA 3V72A 4B9MA 4PQUA 4CHNA 4DQSA 3RJJA 2BPCA 7ICUA 4FJGA 5DGAA 5J0WA 4I2BA 1NK7A 4ZTJA 2FLNA 3OS2A 2BDPA 4E7JA 4JK1A 4F4WA 3U3YA 1KFDA 5D46A 1NK4A 4AHRA 1IH7A 3RJHA 1RDAA 4ECRA 1XWLA 3MBYA 4RPYA 3THVA 4CJWA 5KFFA 1F21A 4FK4A 2JZBA 3MFHA 3KHLA 5CYQA 3PO4A 4F4ZA 1ZQOA 8ICUA 9ICWA 1VRUA 1XHXA 4CECA 3JPNA 4JWMA 2E6LA 4M3XA 3V7LA 1TL3A 5HRNA 2AQ4A 1RT4A 1NK6A 4NY8A 3SCXA 5HRSA 1FK9A 2FBXA 5J2EA 3SUPA 3PX6A 2WTFA 3KIOA 2IMWP 3SNNA 4PA1A 4CJLA 4BWMA 3OYAA 5J2PA 3B0YA 9ICRA 2G8WA 4N56A 1BPEA 2MUTA 1V9PA 2F1IA 3PR5B 4CGFA 5J0TA 8ICSA 4QOZB 4O4GA 3ZDBA 8ICNA 3TFSA 3OYEA 4HVJA 3BGRA 4Q43A 1GOAA 4EZ6A 3TAGA 4TSXA 3LALA 4WE1A 2PXIA 4OVLA 2ASLA 2ZTDA 3FYHA 3V6KA 3MFIA 3HPOA 1TFRA 2R8GA 5SWMA 2YNFA 2PZSA 1NJZA 4OPKA 5KFXA 5DBBA 8ICRA 3PW4A 4RU9A 4ED2A 4I2HA 1HQEA 3LAMA 3AA4A 3AVKA 1BGXT 1EKEA 4I2FA 3PX4A 3SQ1A 2P5GA 1WSHA 5DGBA 4EP5A 4Q8EA 4BXOB 1ZQSA 3UQ0A 5SZTA 3G6XA 4TUQA 3AVJA 1HUZA 4M41A 4DQIA 7ICGA 5KFQA 4QZIA 2AGPA 1ITGA 1ZQHA 3PO5A 3CM6A 4M9HA 1T7PA 5T7BA 8ICWA 1ASVA 4W5OA 3H40A 4ECXA 1TK5A 1SL0A 4NM2A 1TAQA 1ZQYA 3RB4A 3UQ2A 3OYBA 3QESA 3LP0A 1UT5A 3ISDA 4DLGA 5L1JA 2UVVA 5L1KA 1RDDA 3AVFA 3ZT3A 4XQ8A 4ED1A 3O3HA 1Z3EB 3AO1A 8ICGA 4Z4GA 3V7JA 4RUCA 4IDKA 4NLNA 3JPSA 4RNNA 2HHSA 2Z1GA 3ZD8A 3FDSA 2O4IA 1ZQNA 2YKMA 4BWJA 8ICAA 1FKOA 4FW2A 4PY5A 2VWKA 2XGPA 4FXDA 4DSKA 4HCCA 4Q44A 3CQ8A 4RPXA 3NF6A 2F1HA 4KITB 1QSYA 1RTHA 4E1MA 2D0AA 5J2HA 1LW0A 4DFPA 2VA3A 2HB5A 3VQ5A 3L3UA 4O3SA 3OY9A 4YP3A 5CJ7A 1ZQBA 2AJQA 4FJJA 4HCBA 2R8HA 5KFAA 2G8HA 4J9RA 4YMNA 1H38A 3S3NA 4CGHA 5J2AA 4I2DA 1NKBA 1FKPA 3KLFA 2DPJA 2FMQA 1S0VA 1A5VA 4ICLA 4KLLA 9ICNA 1NJXA 7ICKA 4EBEA 4KRFA 1RZTA 1ZYQA 3TAMA 1RCHA 1S6PA 4YXJA 3EWAA 5HP4A 5KFZA 4X5VA 3RMDA 1VSJA 4KO0A 4HTUA 4CJ4A 1J9AA 4F91B 1BHLA 3LANA 7ICNA 4CJRA 4AHVA 3NH0A 4ELTA 8ICJA 5J2MA 3VQBA 1WLJA 3O3FA 2OPSA 9ICJA 3GIMA 1B22A 4QW8A 4I9LA 3DLGA 3QIOA 8ICBA 1QLNA 3KHRA 2IS3A 4BACA 2ZTEA 2NRVA 3B0XA 1ZJNA 3SJJA 1JX4A 1KSPA 2VG7A 3OYJA 1NK9A 1S0OA 5F9NA 3CFRA 9ICFA 4DOCA 2IC3A 2JEGA 1CUKA 1KDHA 1VSMA 4KI6A 2YNGA 2C2RA 8ICFA 3H08A 3QNOA 3RAXA 8ICEA 4UB2A 4UBBA 2GBZA 1ZETA 2WONA 3NF9A 1FXXA 2HNZA 1JLEA 4KHSA 2YHAA 4C8LA 1BIZA 4I28A 3DLEA 3JPPA 1NJWA 5JUMA 4IR9A 2YNHA 2BCVA 4M0AA 1U9LA 4LY7A 3AVLA 5DLFA 2FC0A 1YTUA 4DQRA 5DQHA 3NF8A 1KFSA 1ASUA 1WSEA 3LWLA 2JEFA 1IO2A 4ID5A 4RW9A 4B9SA 5DG7A 1ZQXA 3DLBA 5KFIA 3G0ZA 5KRTA 3T5LA 1S1TA 2KZMA 1CXQA 4ECVA 2BQRA 3QEXA 1K6YA 1SKRA 3RJIA 4P4PA 1VSEA 3FFIA 3OSPA 5KFJA 1JMSA 4FJXA 2DTUA 3IM1A 4I7FA 5KG0A 3DLRA 3PY8A 1UWBA 3M9MB 4F92B 3CYMA 3MGHA 3CFOA 4K8XA 1T8EA 4CERA 4ECSA 4KLEA 3ZDDA 8ICVA 5HROA 4KHNA 3RTVA 1TVAA 2F96A 4BE1A 4O44A 4RQ2A 4M42A 5HP1A 2JEJA 4R8UA 3EY1A 3ETLA 4GLXA 3OYCA 4DTXA 3AVGA 4IFVA 4DO9A 4RW6A 5TZVA 3D0PA 3NGYA 5J0QA 5KFKA 4J9QA 4F3OA 4KHYA 4PWDA 4IKFA 4O3OA 4RQ5A 3VA3A 1RTDA 7ICTA 4FYDA 4IRCA 3G6VA 3WNHA 7ICSA 3K57A 2Q3SA 2BCRA 4GW6A 1SZPA 2IA6A 9ICHA 1X2IA 2P1JA 4YNQA 4KTWA 4Z4IA 4F5RA 3KLHA 1ZQDA 4ELVA 5KFYA 4UAWA 3OYLA 3BQ0A 1I39A 3UIQA 4B3OA 1Y88A 4E7LA 3RMBA 3SQ2A 3PW0A 3RRGA 1S9EA 5KFHA 1N6QA 1RBUA 2EHGA 2ZE2A 4CEZA 1XHZA 4IQTA 3HK2A 4YXMA 4YCXA 4M2YA 3OHBA 4R64A 2QXFA 4CEFA 3V9ZA 3OVNA 1RBVA 3OS0A 1HYVA 5KT6A 4Z4HA 5J2DA 3NF7A 2VG5A 2W9BB 4MFBA 2W9MA 3PUFA 4FZYA 3LWMA 3JPQA 5JS2A 4N41A 3NTUA 5KFWA 2UVRA 2BGGA 3OHAA 5IIJA 1XC9A 5DMRA 2VANA 1ZQLA 1WSJA 3NCIA 3GFKB 1WCLA 3EPIA 3RR7A 4KLQA 4ED0A 4M04A 1D9DA 4J9MA 7ICLA 3HWTA 5JS1A 2PFNA 2RKIA 3T1AA 5KG2A 1S9GA 3KLIA 4DSFA 3BQ1A 2RF2A 4B9TA 5KG1A 1Z00A 4NYFA 4K4HA 4BE2A 4J9PA 3C2MA 4F5OA 4ED8A 4IBNA 4QWDA 3VQ7A 4JUZA 2E4LA 4QZ9A 2BR0A 5DBAA 4CJTA 2D5RA 3RMCA 4FBTA 4JV1A 5KG7A 1WCNA 7ICJA 3B6OA 2PFQA 5KFPA 5DKWA 3QNNA 5CZ2A 4CEBA 3CG7A 3ULDA 3F9KA 4DF4A 9ICSA 3SV4A 4UQGA 5EWGA 2OWOA 5J2IA 3L8BA 4ECUA 3RR8A 4IQWA 2FMSA 4CJVA 7ICOA 1LWCA 2G8KA 1ZQEA 1NKCA 3ZCMA 4O3NA 4P4OA 3QEAZ 4F8RA 1YVUA 4ZHRA 4KAZA 3EZ5A 4EBCA 1SV5A 3IG1A 4KLHA 2NRZA 5KFMA 3RJGA 1D9FA 2PYJA 4DFMA 4OGCA 3L3VA 1QQCA 5I42A 5IIKA 4CGIA 3TAFA 3O3GA 1U4BA 3AVHA 4F93B 4FLUA 4UB3A 4M6WA 2B4JA 4CIEA 5CR0A 3NHGA 2B5JA 3AVBA 4EEYA 4LZDA 5IIMA 1B92A 4J2AA 3V9XA 4E89A 1U49A 4R5PA 1ZQVA 4DG1A 4DTJA 2I1QA 4DL6A 3K58A 1JLFA 3Q8LA 4AHTA 4BE0A 3T19A 1IM4A 1Q9XA 3BJYA 2BQUA 4P4MA 4M3ZA 3K4GA 2V4QA 1VSFA 1K1QA 4QWEA 1HQUA 4CJSA 1C0UA 2G8IA 1U04A 3LZIA 2IOCA 3SUOA 4Q8FA 4W5RA 1SL1A 4M3UA 5F9LA 3OSNA 4KPYA 3M8PA 4PHDA 3M9NB 2DFEA 1B9DA 1GOBA 4CF0A 5KFTA 4CFCA 4RPZA 3SI6A 3C6UA 5D3GA 4DSJA 3MXMA 2C2EA 1X9WA 5HRPA 3KHGA 3OYMA 5KFEA 4ED7A 3LP3A 4H4MA 3Q8KA 2D0BA 4KLFA 1ZQJA 1NOMA 3NAEA 2HNDA 8ICHA 4FLXA 3TI0A 2BCSA 3V6DA 5KFUA 8ICPA 2HVIA 1KCFA 4YG2A 2FLLA 3VQEA 1S5JA 4J9LA 3NH2A 4I2EA 4QZDA 4EZ9A 3GDXA 1WSGA 4DTPA 2FLPA 1TK0A 5L9XA 3ZT1A 2DFFA 3RH5A 1RYRA 1RTJA 4IRDA 1UA1A 4P2HA 4TUSA 2VG6A 2P6RA 1S1XA 4TQRA 1C6VA 4PH5A 1LWEA 4CHZA 3TARA 3ZSRA 2H5XA 1ZQAA 4NLZA 4CE9A 8ICXA 4DS4A 3AVAA 3QIPA 3ZDCA 3RAQA 4O5KA 5C5JA 2KFNA 4M9LA 4O3RA 1CZ9A 3SI8A 4Y1CA 4QZHA 5J2QA 1S9FA 4Z6FA 1WAJA 3ZSOA 4JRQA 3VQ9A 1RBTA 2OZMA 3T5HA 3HPHA 4J9OA 3GV5B 1O1WA 3ZD9A 4BDYA 5J0UA 1TGOA 1DGSA 1ZQIA 1C1BA 4CF8A 2BPFA 7ICRA 3UXNA 1RT7A 4FLYA 1Z26A 3K5LA 3C95A 1ZQZA 3MR6A 5J2GA 4CCHA 5CP2A 4IG0A 5IIIA 4RQ3A 4N47A 2W8LA 2ZUDA 4GC7A 1S77D 1X1PA 4I2PA 2ZQBA 4FW1A 4CESA 3TANA 1NKEA 4CF1A 3DRRA 4I2AA 7ICIA 3Q8SB 1D5AA 1KVCA 1BIUA 2C22A 1YTAA 5DB8A 4KLTA 3OYGA 2KFZA 4DSIA 2O4GA 4IR1A 2ZD1A 1NOZA 3G10A 3ISCA 3UXPA 3GILA 4FJIA 2OPRA 3HP6A 4FCYA 1COOA 1QSLA 5KGWA 2B6AA 1MSWD 4MFAA 3DOKA 1BQMA 1LAVA 2ATQA 4ED6A 4I2GA 3VQ4A 4PUOA 3MAQA 1QSSA 7ICHA 4GC6A 5J2NA 1SKWA 1ZJMA 5KG3A 3SUQA 3VQCA 4CJUA 5DLGA 2ZUBA 2NRXA 1C0MA 1NK5A 3PV8A 2KN7A 1KLMA 3KK2A 4OKEA 2ZJAA 3AO4A 1DOQA 3VQ6A 4DTMA 1JL2A 4B08A 4LZGA 1DTTA 5L1IA 1C1AA 9ICBA 3RB0A 1JL1A 1RDCA 4YR0A 5FRNA 4NLKA 1RILA 4DL3A 1KVAA 4DL7A 3OYKA 1U48A 1QTMA 3RH6A 4B8AB 4M45A 2C28A 2PI4A 4CHYA 2Z1IA 4E3SA 8ICMA 4OKKA 4ELUA 3ZSZA 1ZQUA 3K59A 2WOMA 4KHWA 5FDLA 3C5FA 4RQ7A 3TR8A 4CJFA 4FZZA 5EOZA 2RDIA 1TL1A 2RDJA 1S1VA 1X9SA 2A1JA 4XIUA 3DI6A 5J2KA 1ZQRA 4O5CA 5C25A 4O3QA 2UVUA 5KT5A 3MR2A 1J53A 1RNHA 3C2LA 2IHMA 3GIJA 7ICPA 1A5WA 1SKSA 3V1RA 4DOBA 1Q8IA 4NCAA 5IILA 3BDPA 1R0AA 1ZQQA 4F50A 3UXOA 5KFLA 3C2KA 4AILC 3K5OA 3DRPA 4FM2A 3C23A 2XGQA 3AVCA 4N76A 3HX0A 3ALYA 3MXJA 4FLTA 4CIFA 2OPQA 4FZXC 2GUIA 1ZQFA 7ICVA 2FPKA 1JLBA 3T5KA 3AVNA 3PMNA 2R8KA 3DMJA 3ZSWA 2ITGA 3IHQB 3HPGA 4I9QA 2A1RA 3V6HA 4J9KA 1RT5A 4I2QA 2DFHA 5CZ1A 3A2FA 2A1SA 4RT2A 2FBYA 3AV9A 3KJVA 4DU3A 3SQ4A 1RBSA 3ORYA 3LP1A 2RPIA 1MQ2A 2YNIA 5KFCA 2BHNA 2HVHA 1RT6A 2BKEA 4YFKA 3GQCA 5CYMA 3Q8PB 2M9NA 2AU0A 2ZTCA 3VA0A 9ICUA 4O0IA 4I27A 1VRTA 5KFBA 5KT4A 9ICOA 5BOLA 4ECQA 4RW8A 8ICQA 8ICLA 1IKWA 2HHVA 3OGUA 1TKDA 4PGYA 5C24A 4UAZA 5D4BA 3KD5E 4J2EA 3TWHA 4GXKA 7ICEA 3RJFA 4CHQA 3RB3A 3AO5A 1ASWA 3K75D 4I2CA 4I2IA 3JPRA 3KHHA 1RPLA 1IXRA 4HHTA 4CF9A 3HO1A 3KTQA 4QZBA 3QEWA 2FBVA 2ZJ8A 1RXVA 1LV5A 1W0HA 3JSMA 3V9WA 4DQPA 1KFTA 4KB0A 4JV2A 3VQPA 3PX0A 1BISA 5J2FA 4IFYA 3MDAA 1MQ3A 4E7HA 3MABA 4F5QA 1RTIA 2XY6A 2IHNA 3RJKA 5HNKA 1BPZA 5EWEA 4QWCA 2HHQA 4RZRA 3RWUA 4MEYA 3MECA 1TKZA 4YN4A 3S9HA 3PW2A 3L2UA 2MAXA 2W9CA 1IKXA 4FJ9A 4FJKA 2QKBA 1A76A 9ICTA 3LZJA 4OKJA 3N4MB 2D0CA 3V1OA 1HNIA 4CGDA 4LSNA 4C8MA 4EYHB 3E2EA 4MFCA 2BGWA 1JLAA 4DOAA 3QLHA 5J0RA 1S76D 3SPZA 4B9UA 1L3VA 4Z4EA 4FBUA 1NJYA 8ICCA 4PPXA 3OS1A 4PHAA 3RJEA 2AGQA 1DLOA 3AO2A 2X78A 4KLMA 1WSIA 4F5NA 4KLSA 3V81A 9ICXA 5KT2A 2XY5A 4TURA 2KW4A 2QKKA 2BCUA 4KLJA 4DQQA 5DB9A 2F8TA 2LSNA 2YKNA 4IQVA 3NDKA 4UB5A 4NXZA 4BGDA 3D45A 5HMMA 4CJ3A 2ATLA 8ICIA 2W9CB 1C0TA 5DK5A 2HHTA 2ZJ5A 3ZDAA 2OPPA 5DQGA 3QE9Y 3LP2A 4FO6A 1CZBA 1VSIA 4K8ZA 4JWNA 1J5OA 2X6SA 4E19A 1PZNA 1S10A 3H8JA 4NYNA 2NRWA 1J54A 3C5GA 3PW7A 3RMAA 3AA2A 3HXMA 9ICPA 1HJRA 3UPQA 2ISOA 1JXLA 5HHHA 4KHQA 3QZ7A 2BPGA 3AVIA 4XA5A 1S1WA 3RBDA 2IGIA 4QZEA 5CWRA 8ICKA 1ZBHA 3EW9A 4LD0A 3RB6A 1WAFA 2W42A 3AVMA 4CFAA 1BPBA 4DTSA 2X6NA 3VQQA 2J6TA 2HNYA 4FVMA 5KG4A 2NUBA 4QCLA 2GV9A 1RYSA 4AHUA 4MFFA 3LAKA 4RQ6A 2OZSA 3QERA 4LSLA 3TAPA 4Q45A 3JYTA 3DOLA 2IAJA 3O4NA 3MDCA 1HPZA 3HVTA 4R65A 4CK1A 4DU4A 3Q8MA 1ZQMA 4MF8A 1W9HA 2B21A 3GV7B 4R63A 2QK9A 9ICQA 4DSEA 3M9OB 4UB1A 5HHIA 1I3AA 5KFDA 1BCMA 4QWBA 4F2RA 1EETA 2P6UA 2KTQA 9ICEA 4DMNA 2DFLA 1LB2B 3PMLA 3SQ0A 3KLEA 3OYDA 1U45A 3I0RA 4O55A 4M6WB 5CY4A 4YD1A 4FJLA 1XSLA 3M8RA 3DM2A 2YHBA 4XUSA 3M8SA 2R7YA 2F1JA 2IBKA 3RRHA 4DL2A 3KK3A 2KZZA 4DTOA 4KLUA 4M3YA 4CEQA 4KKOA 1JIHA 4F4XA 2FPMA 4EYIB 5CHGA 4KLDA 4CGGA 3CM5A 1KEJA 4NCBA 3HW8A 4KN7A 4Z4CA 4W5NA 4RNMA 2DPIA 1BI4A 1HJPA 4DFJA 4JS5A 1HUOA 1CEZA 2W8KA 2IDOA 1XO1A 4J2BA 5KRSA 3P83D 4QZAA 3QEPA 3LDSA 1RT1A 3NGIA 2AQ0A 5BOMA 1NK8A 4RQ8A 1RT2A 4YR3A 5KFRA 3MGIA 1L3UA 1Y97A 5EU7A 4E0DA 4FS1A 4ID1A 3IS9A 3BQTA 2W9AA 4M9GA 4I29A 1D8YA 1MU2A 5KI6A 4DS5A 7ICQA 5J0OA 1S0NA 4M3RA 1G15A 3L2QA 2BE2A 5DDMA 2UVWA 4DFKA 3WNFA 4CEEA 2JEIA 1TAUA 3I8DA 3QO9A 3ZSYA 4G1QA 4OJRA 4GVMA 4RQ0A 4N5SA 1ZBLA 4FJ8A 1JN3A 5DQIA 4GXIA 1L3TA
chains in the Genus database with same CATH superfamily
4HYKA 2NRRA 4B3MK 4DR2F 1ZQPA 1RTHB 2HS3A 4FK0A 4R66A 4DU7A 1OXJA 4GRSA 2AJ1A 2YHYA 2LDIA 2G8UA 4LF6J 2QWPA 2EX3A 3D2FB 4TQSA 2ASJA 1FI4A 4Z37A 2WC9A 3CF5L 2E6MA 1TYQB 4DKWA 5KFGA 3B54A 4DWIA 3GG0A 2JWNA 4PHEA 2ASOA 3NH1A 3UCZP 2XO7A 1GH8A 4JMUA 3W3SA 3I0SA 5J2PB 2Y8YA 1SAZA 1IJFB 1WI8A 4IS7A 3QPIA 2BM1A 4O5EA 2XY8A 4BR0A 2OYYA 4DL5A 5EY4A 4G1QB 4CZEA 4DZ6A 4YMOA 4CD3A 2EZYA 1KQKA 4YR2A 4OJHA 2I7NA 4W5TA 5EOYA 2DNPA 2VWJA 4QZCA 4AF1A 2HEKA 1N48A 3BP8A 2PGCA 1IG9A 1GOCA 4OX8A 2ZJRL 3JSBA 3T6JA 4DUYF 1S1UA 3NGKA 1PVRA 4NA3A 2RD5C 3TZYA 3QSYB 3FZLA 1GLLO 4LF8J 4WE1B 2R8JA 3NOGA 1YJ9N 2YQ3A 1RBRA 3Q22A 1ITPA 4CHOA 4Y0FA 4KHRA 2MQLA 2RNEA 4NB4A 2QLJB 3GIKA 5DB6A 3I8BA 3EPGA 2ZKUA 2LEBA 1SS6A 2DNRA 4Y2QA 4PWWA 4EU0A 1K9MO 1QQ7A 1UA0A 1N61A 4A62A 4ILGB 4ECZA 4EEKA 4B9LA 1YUWA 3QMLA 4FM1A 3MM6B 2FLOA 4PL2A 4DL4A 1JLQA 1TUWA 2B9WA 2HQGA 4L74A 3TUPA 4NRUA 2P9SB 4KT0C 3EL2A 2CPFA 4LF9F 4FLZA 5HLFA 4A8EA 4OLOA 5IXUA 3F5AA 1EWRA 5LL6d 3QT7A 5CEHA 5JVHL 4PZNA 5AKKA 2ZH1A 3G87A 2GOLA 3BR9A 1VK0A 5CYMB 4LFAK 3WK4A 5IIOA 1KS2A 5A0LA 1W97L 4DHVA 2XSFA 3QRPA 5ALTA 2PD1A 4RW7A 4IOCL 9ICCA 5KOXA 2NRTA 1LFWA 2VA8A 5MLCQ 3WXJA 1TV6A 1D1UA 3O4WA 4FLVA 4NL9C 2JGUA 2Q66A 3DXMA 4JEPA 2GO9A 2VBWA 1X8DA 1JLGA 3OXLA 4EIAA 1J2MA 1IKVA 2M3DA 1FEEA 1GXLA 4J9NA 2ZOFA 3WNGA 2DY1A 2LU2A 4L75A 2FHOB 4BR7A 4KV8A 3V1QA 3ED5A 1L5UA 2QO3A 2DUYA 2NXJA 1TK8A 4DV4F 3AY0A 5C15A 5FRMA 1N34J 4J03A 4PKDB 4O5BA 4AM6A 3R6GB 5DB7A 3JPOA 3B4DA 5ALFA 2K1RA 4DV1K 4HUGA 3KVGA 3IAYA 4OZ1A 4O8UA 3HSZA 1ZQ1C 3H8WA 1T9VA 2PY5A 1HNZK 5AM3A 3T1HJ 5KG6A 2QEXS 1ZRMA 1N32J 1EXQA 3IDWA 3D1QA 3QU7A 3SZ2A 4RNOA 2FD2A 2K8GA 2NXUA 3QLHB 2C2OB 4CWBA 2MMYA 3HJFA 2GLEA 4IG0B 4CFBA 1WF2A 2I38A 1WJ9A 2XEXA 1T3NA 1JI7A 3BEXA 3PR4A 4LVNP 4FP9A 3M8QB 2PE8A 4KJIA 3QYPA 1RJJA 3ZX3A 5ETKA 3JS9A 2B7CB 4BX9C 5BRFA 2F8SA 2Q0ZX 2G5IB 1K8AT 1H3DA 1LOUA 3UNGC 2IOHA 2V2VA 3B4MA 2G8FA 2KVCA 2OAUA 4L8RB 1CLQA 1FRXA 2MRLA 4LH5A 2P9KB 3AHPA 2ZH3A 2QYCA 1WUAA 4JLHA 1HRHA 3MMAB 1K0TA 2ZIUB 3IBPA 2H48B 1S1VB 3JB9k 2UXDF 1W2BR 3RUBL 2HRUA 1WG4A 3PNCA 3QETA 1JCFA 1RT3A 1BO5O 2HGMA 1B9FA 2YX8A 1HNXF 4BREA 4C8NA 5AK6A 3BGRB 1NGEA 3LPUA 3MAAA 2WW8A 1TMJA 3WNEA 5AJ3J 2ZDOA 5HAOA 3ITHA 1XMBA 3WBZA 4KMOB 3WT0A 3MPWA 5JXSA 1RGIA 1D8LA 4B3TK 4JI8K 1Q9YA 2CQHA 3OVBA 4O8KA 4IO9Q 2IIHA 3JPTA 2W7PA 5GMEA 1KVBA 3U3GA 2H1YA 3QT5A 1UT8A 3R5GA 3BGOP 1VRQC 4Y1DA 9ICAA 2OHDA 5ALXA 3R9LA 4CJPA 3VF0B 3IRWP 2I9GA 4IYQA 2P5OA 1LAWA 1AROP 4I2JA 4ZCKA 9ICVA 2JWKA 4TVAB 1FD2A 3WDOA 4QBUA 1FXRA 3BKUA 4QIGA 3HHNB 4HACA 1VSDA 1XMQK 4E8UA 4O9MA 3JXUA 4CJKA 1XSPA 1FDAA 1SUQA 2DY4A 3TA1A 4E7IA 1EKSA 2Q1LA 4UB8U 4JI0K 4FJ5A 4QZ8A 3TYTA 1QZ5A 2P51A 3RRKA 3P1GA 5GADU 4FPIA 4XPCA 2FF6A 4MQ3A 3MPUB 4UOHA 4K4XA 1NU0A 3QNMA 1YTYA 1U6FA 2GEMA 3Q8RB 2AIRB 1EP4A 3K5NA 2FBTA 2A40A 1B0PA 4P52A 4JI5J 1IVZA 2PDAA 3THYB 3HT3A 2WAQD 3EZWA 2VKRA 3D6MB 1GQEA 3MGJA 1Z00B 1OY8A 4JRPA 2HHHK 5CA7A 4H5NA 4CGJA 4Z6EA 2HURA 3QYYA 3IG5A 2OLWA 3QMQA 4NCGA 2EQYA 2UV8A 5KT7A 3BH7B 2O8CA 4AQYJ 3WX8A 2PYLA 3M2VA 2J0XA 3H5SA 1Q82O 1U0SA 4JI7J 2QM1A 3SBTA 3VESA 1U47A 4LF7K 2KG0A 1PO6A 2BE7D 3KKFA 3WC0A 1RFQA 1Y00A 2P2CB 1UP1A 2MU2A 4XRHA 3ZT2A 4CNQA 2VOOA 2HF4A 5AK3A 3CFPA 1DEJA 4LFBJ 2JVOA 4CEOA 3FKBA 4F0MA 3NMRA 2IY5B 2XI2A 1S72S 7AT1B 5F3TA 3SSSA 1C7YA 1WWHA 3SUNA 4JYAK 5LOQA 2VDHA 1I94K 3ZZTA 2YJEA 2DIVA 3Q0AA 2E5IA 2XRIA 3K8WA 5A76A 1RHKB 2GV1A 2YV0X 4V19X 5FJ4A 4ZOSA 1BPXA 4JI8F 1QTNB 4YOVA 3AA9A 2H3IA 3NASA 3VAJA 7ICUA 4PR6A 5J0WA 2CH5A 4RW7B 1DRZA 3QBWA 2V63A 5AXLA 1S1XB 3CQXA 2KV2A 3GFXA 3CW2C 1OY6A 1Z2LA 2KO1A 2C2ZB 3OT9A 3KJNB 2XMAA 4I69A 2H51B 3FZ2A 2JZBA 3MFHA 2K3KA 2GA7A 3WIVA 1ZQOA 8ICUA 1IWGA 3J81Y 1XHXA 4CECA 4JWMA 1S5LU 3CCRS 5ALJA 2J8AA 2E6LA 1TZ0A 4DR3F 1WOQA 1S1TB 3MM8A 3DEEA 3SCXA 2KD1A 3O2IA 3I87A 4ZJLA 3O44A 3T9NA 5HRSA 2FBXA 5J2EA 3VAHA 3SUPA 2FHKA 4PKGA 2IMWP 1DJ0A 2FPHX 1KKXA 4NLVA 3CC4S 4Y2VA 3PSPA 4Z2XA 1HIYA 1DTQB 5AM4A 1JLQB 3QWUA 5HL7Q 3KNGA 2MUTA 1V9PA 4Y34A 4M63C 4MDAA 5HN0A 1VBZA 8ICSA 3KZBA 3G4SS 4EFAC 1V3SA 1N0UA 8ICNA 3TFSA 4IZ9A 4ES2A 3LGMA 1X4AA 2NSBA 2MYFA 4QIFA 4JI1K 3BBFA 4XH5A 3OL6A 3LALA 3J80U 4NO7A 3HPOA 3NNCA 1S6UA 4LF1A 1E6YB 3N4QA 2J76E 1NJZA 2RKIB 2BBEA 2HGLA 2VKQA 5DBBA 2HOIA 2KT3A 1RWVB 3H59A 2GMJA 2V2KA 2VYPA 2E8PA 4BXOB 5IWAJ 1NNLA 4CJ7A 3AVJA 3SQGA 3IWNC 1HUZA 3ENQA 1LW2B 2VL1A 2EZXA 4CZKA 1XK8A 4DCPB 1ITGA 3HDSA 1ZQHA 2VJ5A 4ETXA 3HI9A 1QAYA 1U1MA 4WIIA 4BRPA 1GMWA 4P10A 4DR2J 4W5OA 3M1YA 3HMJG 4ECXA 3HD1A 4EX6A 1SL0A 1WC1A 1E3MA 2PN6A 4L73A 3OYBA 5AM0A 1RDDA 3ZT3A 3A5NC 4DR3K 3SLCA 1R3NA 1MA9B 3AO1A 3P4IA 4Z4GA 2HFZA 1VAZA 2E1PA 3FDSA 3AD8C 2Q6CA 5LXRA 3THTA 4XAKA 3MX5A 8ICAA 4X65K 1GEHA 2P6TA 2YQ1A 2AZ1A 3PM9A 5FPDA 2F1HA 1RTHA 1S48A 1U1OA 2J7UA 2D0AA 5ALZA 4LF5K 1LW0A 4DFPA 2KMDA 2VA3A 1V3RA 3WIUA 3UKRB 3L3UA 3CDWA 1NGAA 5CJ7A 2AJQA 4HCBA 2E2PA 5KFAA 2G8HA 4YMNA 2I1RA 4DR6F 3S3NA 4CLSA 1D8ZA 2NXNA 1MNEA 4ZITA 3ENWA 2E88A 5B7WA 4WFAQ 3MOJB 1NHUA 2IDEA 2FMQA 4HACB 3Q8VA 2WB1C 5IQ6A 4GV6A 4KLLA 2V7ZA 5DO2A 1NJXA 4KH6A 2B4VA 4JHDB 2CQDA 1RZTA 2YNFB 1NHKL 1FDNA 3CCRN 3FBBA 2EFVA 1PJ7A 3EWAA 4F26A 2DXEA 2M70A 2D4WA 5DM7Q 3ELHA 5E3PA 4X5VA 3B82A 1VSJA 5H1SQ 2CJYB 4BG9A 1SV0A 4FWPA 3DXKA 5AQTA 1NH7A 1LK5A 1HA1A 5J2MA 1B0VA 2CJXB 3LOUA 1IV8A 3GIMA 1HLUA 2IM1A 3R6MA 3W63A 3MEKA 4NLTA 4W90B 1PJ5A 4UF4A 1QLNA 1P9QC 3DGPB 1K8AO 3KHRA 2AEMA 1T6DA 2DO4A 2MKHA 4DU8A 3B0XA 2LA4A 1KSPA 1O51A 3FFKB 2RF2B 1JJCB 4C4TA 4K0KJ 3CFRA 4LC9B 4GIBA 3ISND 2JEGA 2NNWA 1KDHA 1SH2A 1VSMA 1X5OA 1WD6A 1VIOA 2WONA 2CA9A 1ZA2B 1JLEA 3CC7N 4KHSA 1WBBA 2YHAA 3DLEA 3JPPA 2YJFA 4HI2A 1AYEA 3GSIA 4JOUA 3HOSA 5EN1A 3D1HA 1RWMB 1Z05A 5DLFA 1UW9A 5DQHA 4C8ZA 1KKHA 5ALYA 3LGNA 4HL9A 4A8YA 3PHEA 4B9SA 5DG7A 5KFIA 5KRTA 4Y2AA 3UCGA 2KZMA 2B3TB 2WVFA 1O8BA 5ALMA 1WC6A 3H90A 1CJVA 4C0ZA 1PJ6A 5DM6L 1K6YA 3MM6A 4P4PA 2KVIA 4K4UA 2Q79A 3BS9A 1U6ZA 4F71A 1JMSA 4FJXA 2DTUA 1YJ7A 3POTA 3IM1A 4I7FA 2Q0UA 2NYVA 3VQSA 1GLAG 1UWBA 4JI7F 3CDAA 4H0TB 3MGHA 4NEZA 1H2VZ 4Y2RA 4AXJA 1L7NA 5AM5A 4KHNA 3RTVA 1FE0A 4X66J 5B0GA 4O44A 5HP1A 4QYZJ 4LRBA 4OHXA 4N8NA 1SQKA 2DRAA 3ET6A 2O5DA 3Q2TC 4A8OA 4QNLA 3KWGA 3OYCA 4DTXA 1LCUA 4WWSA 1ZM2A 3D0PA 4M1KA 1TMMA 2IVPA 3NGYA 1M6YA 2MKJA 5J0QA 3BSCA 3IR6B 4CNZA 4XDCA 4IKFA 3M6VA 2KLAA 2NPIA 2PMZD 2Q0RA 3VA3A 1TV6B 3IMQJ 5LY3A 2RB7A 3G6VA 4G6VB 2G06A 9ICHA 1JJ2R 1YXQA 2P1JA 2EXUA 1OPZA 1JLEB 4JI6F 4YNQA 4Z4IA 2HNDB 3KLHA 3NVMA 4HLBA 3NWRA 2KRRA 4ELVA 3OYLA 4UAWA 3UIQA 3RMBA 3CUNA 3CCLS 3P96A 4U67L 4C7YA 3PW0A 1MWYA 1RM6C 2JC0A 2B9EA 2EHGA 4CBUA 4CEZA 2U2FA 5K4LA 4YCXA 3M2UB 1XNRF 3OHBA 4R64A 1S7HA 4K5RA 3VERA 4FKXA 2OEKA 4OJ5A 1HYVA 1P90A 4LQ3A 1CULB 2VG5A 1KD1O 5D77A 4IO8A 3PUFA 1HNWJ 4FZYA 4JI4J 4UZCA 1TKZB 1HKBA 5T7LA 4N41A 1Z2ZA 3R8YA 3NTUA 5A8KA 2AKWB 1VQ4N 2YBVA 4DV6F 3OHAA 5IIJA 2F65A 4DJBA 5DMRA 2VANA 2FHMA 1ZQLA 2P5VA 3GFKB 1WCLA 2KOBA 2NZCA 1QJHA 3CI5A 4NWBA 1TYQA 4F67A 1F5SA 2AYMA 4GVBA 2P9IA 3KK1B 1NPRA 2HHHF 3ID8A 3L3FX 4BRFA 3SEIA 4WTYA 2RKIA 4RBVA 2QA4N 4IO1A 3MN7A 3NVWA 3CMES 4NYFA 4MKVA 3C2PA 4BE2A 1VDVA 3OHRA 3RW7A 3THPA 4UOFA 4KR0B 2BR0A 5DBAA 3WKEA 1B70B 3RMCA 3WHIA 1FJ7A 3PJ9A 1HI1A 2A18A 3DU5A 2POKA 3Q23A 1WSVA 3C19A 3BZQA 5KFPA 2B8QA 5BR9A 4OJ1A 2K4PA 2H5EA 2J0QD 3WQTA 3AJDA 4JKGB 4BRMA 3RR8A 4CO0A 4MO4A 4CZJA 7ICOA 5C25B 1V6HA 1NKCA 4KFBB 4PG7A 2FDRA 1YVUA 3US5A 1TL7B 3EZ5A 4G65A 5LM7E 3EGZA 1R59O 4I4BA 3PDNA 5KFMA 5HR6A 1FO1A 3LUYA 2PYJA 1QQCA 1E4GT 2HQFA 5IIKA 4RQMA 5CRXA 5AQGA 4FFDA 1U4BA 4HTJA 1E6VA 4UB3A 1TR0A 2B4JA 4A8KA 5CR0A 1S1WB 4O4RA 3GOIA 4UAVA 3L9ZA 2UXBJ 1VFJA 3HSGA 4EEYA 2XG8A 2DK2A 1B92A 4FKYA 4DTJA 3DHWC 5B0BA 1Y7PA 2EFGA 1YHQS 3K58A 1QAXA 3PRVA 4EO8A 3T19A 4B3SF 4JV5J 1Q9XA 3AY9A 4M3ZA 4KC5A 2MJNA 3KYLA 1Q95G 1VQLS 1HQUA 1UVNA 3VAKA 2G8IA 2HVDA 2ZVSA 3TUJC 2IOCA 3SUOA 4DL0C 3M8YA 4Q8FA 3CNQP 4C7ZA 1SL1A 3UE2A 3I55N 3M8PA 1E6VB 4L3NA 4OYMA 4RPZA 2V8GA 2YKAA 4UY8T 3BSOA 4AP9A 3I0RB 2BUNA 4F3MA 4NZ0A 1X9WA 3A4TA 5KFEA 4G1PA 5BRHA 2M8DB 3LP3A 5ALGA 3Q8KA 3OW2M 1ZQJA 2XS5A 5TKYA 3EN9A 8ICHA 2HLUA 2IAJB 3C16A 2F4VJ 3EKUA 3V6DA 2NZ4A 3G71N 2F5GA 4Y2SA 4M5LA 2YWKA 5ALWA 2HBYB 3AQPA 2FLLA 1HNVB 4NLOA 4QZDA 3ZTRA 3AB2B 2A6AA 4RO0A 4X4NA 5M1NA 3TO8A 2DFFA 4JKFA 4IRDA 2P9UB 2WBNA 2ALYB 2W1BA 4F9OA 5IQQA 4HR2A 2P6RA 4RW4B 3CPEA 2AYEA 2MQMA 3DRSB 5AQIA 4LF6F 1HKGA 3FZFA 4TQRA 4OHZA 4NXNF 4H5RA 2NCKL 2E8OA 2QV6A 2YQ0A 2VJVA 1EAYC 3UDLA 3W62A 8ICXA 3PSFA 1N34F 2B7BB 3SMSA 3H7HB 2O8FA 1CZ9A 1UCVA 3SI8A 4Y1CA 3ZYYX 4V19S 2FY1A 2MKIA 1S9FA 1X4CA 1RAJA 4J9OA 1RHMB 2DKOB 1O1WA 2VQEJ 2A5XA 1MWKA 3U4LA 3HKZC 1KQQA 1ZQIA 1VQ6S 1G99A 3D5MA 2PMWA 3ZX0A 3RU0A 3R7NB 7ICRA 2YWGA 4PZOA 2O67A 1Z26A 1EP4B 1WEZA 2CRXA 3PKMA 1HMVB 3C95A 2K06A 5HOOA 4ENOA 3ZO7A 4N47A 2W8LA 3ILJA 2ZUDA 3N5FA 3KZIU 1F2HA 1JJ4A 2UUAK 2YMMA 4XTTA 1LXNA 1RAOA 2ZQBA 4FW1A 1R0CB 4CESA 3TANA 1UTAA 1S59A 1YHQN 3DRRA 5AI4A 4FWLA 1KVCA 3MEEB 4ZPDA 3M2VB 1OS5A 2ESEA 3VEXA 2XMJA 4IR1A 2V0NA 2OPRA 2O8EB 4LF4J 5DDPC 4KHPJ 4FCYA 1RKJA 1SB6A 1WC5A 2A1BA 2BH1A 3G8TA 4DV7J 4MFAA 2W43A 4CM0A 3AXMA 3H8MA 3OLBA 4I2GA 1C1BB 2O66A 5CHIA 5G4DA 5J2NA 1VQSA 2RUGA 1SKWA 4CO1A 3R2CJ 4JI2J 5KG3A 3ZI4A 3IBWA 2V2QA 1YK9A 4ILHA 2PAVA 3PV8A 5F3ZA 2DF4B 1NRKA 1KLMA 3KK2A 3AO4A 4H4MB 3CJ9A 2OEMA 5CD4H 1JL1A 4UW9A 4NLKA 2EPIA 4K4ZA 4NLBA 4DL3A 2I5JB 4C1NI 4M95A 2A1AA 1KVAA 1M5OC 4DL7A 3OYKA 3F5EA 1QTMA 5ALRA 2VONA 2C28A 4CHYA 3JTPA 1O13A 1SQEA 3AARA 4K5SA 8ICMA 2XICA 4ELUA 3AEVA 3ENAA 2AT1B 2HWIA 4CDGA 1ZQUA 2RQMA 2JR5A 2H3GX 2DJWA 1CJVB 3TR8A 3OL7A 2E1EA 3FCWA 4P7TA 1GO3F 4O5CA 3E01B 5KT5A 4NLDA 3MR2A 2ZGYA 4U67Q 1GLFO 4X4RA 2IHMA 1A5WA 1WNEA 4YOUA 1MN9A 4RJVA 3VVTA 1OH8A 4F0HA 1FE4A 3NP5A 4F50A 3QATA 3ULEA 3BZKA 3UXOA 3GU0A 3L09A 1NZAA 5KFLA 2CVEA 3Q86A 3GLJA 1X0PA 4B3RJ 2H4YB 2QWLA 3DRPA 5EXWA 1U1LA 2KH9A 3AVCA 3WKCA 3QRRA 2UUBK 4N76A 4WP9A 1NZPA 2EC2A 2XMUA 2G5HB 1VYAA 3O8WA 3T5KA 3RG6A 1UEUA 1QQNA 3P6YC 2R8KA 3ZSWA 4KH0B 3HPGA 2BJ3A 4ERDA 2IJFA 2DFHA 3KKAC 3A2FA 1N33J 2FBYA 4DU3A 1QUVA 2ASYA 3N6LA 4YY3K 3HSCA 3ORYA 2H4WB 5K5MA 1O0PA 2XNRA 2I6XA 5GINA 4YFKA 2BE9B 3GQCA 3OD2A 2UU9K 3HZ6A 1GAOA 3CPWM 4JKHA 2MKSA 3TUZC 3EVMA 3T1HF 4RCHA 1KTVA 1VBYA 4EHUA 3MM7B 2F1FA 5ADZA 3BO3A 5DZ7A 4H03B 3CIZA 4QPXA 5C24A 4PGYA 3EM1A 3W5XA 2GVZB 5JMNA 4K25A 2MTLA 3O5TB 2HIYA 2HNYB 1I51B 2FJDB 1YQHA 1EB0A 4DUZF 3SAGA 1BU6O 3K1RB 3JPRA 2QLTA 2QLFB 1RPLA 3IV6A 4NZ7A 3QUCA 3CCMN 2ZWHA 2CPHA 1VQKN 3DRRB 5HO4A 2FC9A 4BRQA 1WWVA 2FBVA 2ZJ8A 3FZKA 3V9WA 2FJEB 1SJRA 4B3RF 1KFTA 4U8YA 2B4PA 3AAWB 3MMCB 5J2FA 2V4JA 3VR1A 3ULEB 3DKDA 2QI2A 4F5QA 3EE3A 3KFUF 4QWCA 5J2NB 1YAGA 4MEYA 3MECA 3LP2B 3WXMB 1Q86T 3S9HA 4M5HA 2MAXA 1RZMA 2W9CA 1C0TB 1IKXA 1P8ZA 4FJ9A 5A8RB 1A76A 3LZJA 3AH6A 4WTOB 3N4MB 4MLHA 1KBRA 3V1OA 3DM2B 4ZVSB 2BABA 4LSNA 5AT1B 5D4OA 3E2EA 1JLAA 4DOAA 4CF3A 1EQYA 2AP6A 4G1IA 2CRLA 4FBUA 2R2RA 1NJYA 4WQ5A 4YB6A 1T95A 2YVSA 1DLOA 4C11B 4GKJK 1N54B 5K8OA 4Y2KA 4GY2B 1RKIA 2ZM6F 1WHXA 1N34K 2HSEB 2ACYA 4F5NA 2UZAA 3LW5C 9ICXA 2QKKA 2MLYA 2BCUA 2MPUA 2OHFA 2YKNA 4IQVA 2HPUA 3NDKA 1BQMB 3MWTA 4NXZA 1S1UB 3VTHA 3AOBA 3D45A 1N32K 5I3UB 1D3WA 1GLJO 4ZVHA 1FKAF 4F7VA 1VQ7S 1CZBA 1RAAB 5AM1A 2DGVA 3DJCA 3WKDA 1J5OA 2ITMA 2X6SA 3TQEA 3W60A 4NYNA 3QFUA 1U1PA 3CJRA 2P6SA 1VDHA 3PW7A 3RMAA 2O8FB 3HXMA 9ICPA 1RU1A 1HJRA 4OYBA 2GJIA 2WZ1A 1WI6A 5AM2A 3G82B 1QVFM 3I55S 3GFHA 3AVIA 1SC4B 1S1WA 2IGIA 4QZEA 5CWRA 5K9FA 1I3OB 2KHDA 5KPRA 1NJIO 3TEHB 2SXLA 2F8EX 3RB6A 1WAFA 2A41A 3TUIC 1RK8A 2QTDA 1BPBA 3VQTA 1NCLA 1XMOJ 3EICA 1Q7LB 1IBMF 2V67A 1P9YA 5KG4A 2LMIA 2NUBA 5I3QA 2MA1A 3I32A 2GV9A 1RYSA 4AHUA 4MFFA 4BC4A 5IT0A 1VCTA 2HRYA 4X4OA 4Q45A 2RT3A 3O4NA 4Z94A 2OMLA 4R65A 4QPTA 2Y1RI 3GV7B 4YHHJ 9ICQA 2E1ZA 5HQMA 2HQ3A 3GTYX 3M9OB 2O6KA 5ETNA 1IR2A 3P49B 1BCMA 4BR4A 3CD6S 4QWBA 1EETA 4J9VA 3GDQA 3GCWP 3VWSA 9ICEA 2DFLA 2XBPA 3MD1A 4JI8J 3KLEA 4DV3K 1Q86O 3I0RA 4NMXA 2BX6A 4FJLA 2W4DA 3DM2A 2WHOA 4NZ6A 2CVIA 2Y3YA 4XUSA 1U2FA 3M8SA 4P72A 1H7WA 2DB1A 2IBKA 5B0CA 3BYPA 3GL1A 5AQZA 5EE1A 4M3YA 4WJ3B 4EYIB 2FGCA 1R8CA 1KEJA 4OI2A 4HTLA 2W04A 2DPIA 1BI4A 4LREA 5D0GA 2VFTA 4CTAA 1YF5L 1ELOA 2CWXA 3DDHA 5CAAA 3GYGA 1XIQA 3W5ZA 1XO1A 2UUTA 1Q5YA 5KRSA 3VAGA 2XHCA 4QZAA 3LTOA 4IXCA 1RT1A 3QU5A 3NGIA 3LDSA 5BOMA 3MI7X 1IWAA 4MH8A 4YR3A 2HBZB 4JI0J 1L3UA 1Y97A 5A2QU 2R7TA 4E0DA 4PKIA 3MTKA 4I29A 4KRWA 4DS5A 4ZLPA 5J0OA 4BR9A 5FDLB 1IJEB 1S0NA 5AIAA 4UUWA 3MM5B 1RU2A 2BKNA 2UVWA 4DFKA 2UXCK 3K7RA 3C65A 1MROB 5D4NA 4USKA 4A57A 4H0YB 1V5IB 3CB4A 3QO9A 3WXKA 3ZSYA 2DNKA 3VAIA 4RQ0A 2XB2D 4N5SA 4QJFB 4WP3A 1XQSC 2BEFA 4CDIA 1VRTB 2UP1A 1LXJA 2A10A 3LF0A 3ZEUB 3DV9A 4GXIA 1Q8KA 4AL7A 2ZBCA 1RWUA 5HRRA 3RBEA 2F3NA 2CQ4A 3M32A 3CCWA 3BS7A 4URSA 4W5QA 4PL7A 2W4PA 4LVSA 1XSNA 3TAQA 2GCFA 2A1JB 3KK3B 3KJQB 1ZQCA 1QAIA 2MZSA 5IWAF 1VQ4S 3PNIA 3BO4A 2UUCJ 4NX9A 5BPCA 5DETA 7FDRA 1FKPB 3C6TA 1N33F 2LDYA 4DR4J 3W7BA 4JKBA 4Z0UA 1T4GA 1FF2A 2FIUA 3OVAA 2WMMA 2G07A 4DEZA 1SV5B 1SQFA 4V19J 3ZSQA 5HQ8A 2GHWA 2ZG6A 5LSRA 4J2DA 1XS9D 3J7YI 3CERA 4DOZA 1WEXA 4DR7K 3ISNC 4IOXA 3DLJA 3NGUA 3R5BA 1N5SA 4N77A 3A3PB 3DOMA 4RT3A 2P66A 1ROFA 2QFJA 3JTNA 1XI1A 1N60A 3SCIE 3K0JA 3KNAA 4CEAA 5FLXU 4DLEA 3OTOK 2PFOA 1HNXK 4KB1A 4OQJA 3I28A 2LM4A 3W9JA 2OEJA 3WU2U 2HQIA 1VK3A 3ASMA 2X51A 4B3OB 2DHGA 3KD1E 3JSMB 2DYAA 2JV3A 4BC7A 3MEEA 1EXNA 2BQ3A 4PHPA 4ILRA 3DLKA 1O08A 4HI1A 2OCEA 4ILMA 1J5EK 1U1KA 3BS5A 5EX0A 5B8HA 1F9EB 1H0HB 4ISEA 4DTUA 4DF8A 4KLOA 1AZSA 3G6ES 2ADBA 3RYLA 4EBDA 3LPTA 1HMVA 4FJNA 1L7OA 1TP7A 1Q82T 3HBTA 1NSPA 2J6UA 2WFBA 4EP4A 1RWPB 5E2QA 5J0PA 4ZTFA 3K0SA 1KD1T 2Q43A 4M5DA 3OTOF 1N5YB 4UB4A 2F76X 4W98A 1T03A 3QJLA 3TFRA 4L3KA 5G5HA 2FVSA 2ZIWA 2XZWA 2NSCA 3VGVA 1HNZF 2RHFA 3HJEA 2BMBA 5JU5A 1ZM9A 3C15A 1TUUA 1B43A 1T05A 3V5RA 8AT1B 4OPJA 1RYUA 1SJQA 1UW4A 3ZT0A 4C8OA 2CZ9A 4K4GA 4K59A 3KJVB 1IG6A 3VQ8A 2QSWA 1QHTA 4F4YA 1OH5A 2ADCA 4USUA 3HFZB 5CB1A 5AZJA 2CQBA 1WWUA 2PFPA 2NR0A 3NGDA 5BXIA 2OD4A 2ZFHA 3R5DA 5LXYA 4LF8K 4CK2A 3C3LA 4M5DB 3OR2A 5ITHA 1L3SA 1VLYA 3FEYB 3JAMY 1BVSA 2GFFA 2R2SA 4K0KF 3MXIA 2WB1D 4LJMA 4C8YA 1WDTA 1NGJA 4YN3B 4DCJB 2F40A 4H5WA 3H4DA 1RG6A 1NLKL 3O9QA 3D7EO 2ZXIA 2G8VA 3HP9A 1LQ9A 1HHTP 2EAMA 3AO3A 1GMVA 4YQWA 1JK9B 5C7PA 3NE6A 1LKYB 3MEDA 3P3DA 2D0PA 2I0XA 2MZTA 3AB4B 3EVWA 2E7WA 5E0OA 3IM9A 2ZC4A 3V7KA 3KDOA 8ICYA 4FS2A 4MKBA 3ETOA 1NUEA 1NB7A 2VKZG 4RW4A 7ICMA 4MF2A 2VV5A 4QWAA 4DPUA 4NXMJ 2E5GA 2ZZMA 4Q0BA 3W61A 1N5YA 5KT3A 3HULA 3TRGA 2ZHOA 3NAHA 5DBCA 5L1MA 2MY7A 2WAQC 1DTTB 3RSEB 5C2FA 3VPZA 4NM1A 2OTJN 3R3LA 4JKEA 1VQYA 3ZFVA 1REVB 4EI2A 1RAIB 3GV8B 1J2VA 5C42A 1G1XA 5F1XA 3TQ1A 2K8AA 9ICMA 2A6OA 4YDUC 3S3OA 4YD2A 4IFYB 3SYZA 4CK3A 5DDOC 1RAEB 3ISBA 4WFXA 4OYIA 4LF2A 4CO4A 3OYHA 4GV3A 3CCMS 3ZSVA 2W2NP 4OZNA 5I4MA 3F2DA 2DHXA 3I76A 1GMWD 1GX6A 1LK7A 1UVKA 4B1VA 2WVDA 5D0EA 3MUTP 4BLGA 3QEVA 4JI5K 2XS2A 2XCPA 2QW9A 2ZUCA 1YT3A 1EETB 1TL7A 1YGYA 1S6QA 2AXTU 3NKYA 3I5BA 3H8SA 1ZBUA 1NBWA 4YOYA 5FD1A 3PVXA 3O1LA 1KRPA 1GLBG 2PMHA 1S22A 4CLKA 1U0HA 4ZHRB 3QEBZ 5HMLA 5C42B 1IKWB 2HHWA 1N36F 4TYAA 4FJHA 4ECWA 2HQDA 1REVA 4MHVA 1RI7A 3ADAC 3SFGA 3HM8A 4IO9L 2GWSA 2FY8A 4CLPA 1M5KC 1UVIA 1OO0B 2E66A 4BXOA 3HM9A 4LF7J 4GMJB 3BUZB 3L7OA 4KH1B 1WYGA 2JFDA 3HJVA 2FJBB 4WQ4C 2WK4A 2NS1B 1X9JA 4CTAB 2J6SA 4ZMMA 1M5HA 2ROPA 5CA5A 2FHJD 4AT1B 2E1YA 4HUEA 4RQ4A 3CJTA 4H4OB 2HK3A 2ZE2B 1S0MA 1PYOB 3ILIA 4P0QA 5LJWA 1DRGA 1LKYA 4M5KA 5CZVA 2AEJA 1MC8A 4CBXA 3OTQA 2RSQA 1XUPO 2BTFA 3KG0A 3OVSA 2HMIA 2KI2A 3RGIA 2CADA 2HF3A 3J7YP 3IBCB 2VG6B 2ZJQQ 3NBPA 2Y1IA 3OBIA 1SZ2A 1DK2A 1WOPA 1IM6A 3RJMB 1EX4A 1C0FA 3HOTA 1XR6A 2J0WA 2QG9B 3FQKA 4NPOA 1S8OA 1R27B 5F8HA 2P9LB 3SV3A 4ES3A 4C8KA 1IKYA 5AJ3K 1FXLA 5GADI 5B5EU 4WFNL 3PJXA 2HI0A 1B0XA 3E9OA 2GHVC 4NI2B 1UAWA 3F5TA 1NGFA 2K8BB 5CZXA 3BYRA 4B3TJ 3AA5X 2R7SA 5DG8A 2ZD1B 4LIRA 1BCOA 8ICOA 4WZQA 5GAEU 3M8ZA 4B1YB 3EGVA 4IQUA 1KTQA 4PGXA 1TV9A 3LL3A 1EO1A 1B7YB 4GKJF 4LFCJ 1MW7A 2Z0GA 4DUYJ 2RE1A 4J91A 4LF6K 2G2ZA 2YMQA 1S79A 4CJ5A 5GAHI 2JOQA 3OUYB 4XEIA 1UZDA 2HWTA 3NGZA 4QZGA 2OD6A 2MXYA 1GXTA 5K14A 4MTPA 2MGZB 4M9NA 1YJUA 4DN0A 1JXBA 4FM0A 2ZEJA 3DI6B 1ZA1B 2XSJB 4JI1J 2E1AA 5JVGQ 2HFVA 5J0YA 3SSQA 1CSJA 4O0JA 1FTCA 3Q8YA 9ICGA 2W03A 1NDLA 2VA2A 2UXBF 2BCQA 1U2RA 2J8SA 4ZOHC 5D49A 1RCXB 2FXUA 3CMQA 3FNNA 1BQNB 2QWOA 3H7IA 3V72A 3I96A 4CZHA 4CHNA 1HBNB 1VQ5S 3OS2A 3DLLL 2HNZB 2AJFE 3CSKA 5BPMA 2E5LJ 2HHPA 3U3YA 5D46A 1NK4A 2EAPA 4AHRA 1IH7A 2BKPA 1FWLA 2MEWA 1RDAA 4CO5A 4ECRA 2V94A 3AJ2A 3CC7S 1J6ZA 3CJ8A 3HCXA 5KFFA 1F21A 3IG1B 2H3EB 3C6AA 9ICWA 4DR3J 1HBUB 3NS7B 3THWA 3BBBA 2G08A 2AEFA 4M3XA 1ZH5A 5AKIA 3V7LA 1KDNA 2WAQF 1TL3A 3MM7A 2X1FA 5HRNA 1RT4A 2CJKA 1T94A 4NY8A 1NLVA 3GFZA 2AJ2A 3PX6A 4JI7K 2YX4A 3O5BA 2V68A 3D6FB 3M2RB 4PA1A 4BWMA 3QBXA 3OYAA 4RWWA 3IA0A 4A48A 4OYPA 4N56A 1UWBB 1U2CA 5SUHA 3PR5B 3OLAA 4CGFA 4I7FB 1XR7A 2B56A 1HBOA 3OYEA 3MUVP 3BGRA 4NOHA 2QB0A 3F2CA 4Q43A 1GOAA 4P0PA 5A0YA 4OHWA 2ASLA 4TN2A 3FYHA 3V6KA 3NL0A 3PIPL 1YWXA 1T3QA 3FQLA 2R8GA 3CJQA 4I6MA 2GUPA 5KFXA 4OI6A 3PKYA 2NZTA 1HQEA 4I2HA 2HBMA 3LAMA 4B17A 1BGXT 4R0EA 3VTIA 1EKEA 4IFEA 4I2FA 3PX4A 3W8PA 4BY9C 3SQ1A 2P5GA 2G0IA 1NWKA 1NNEA 5LMUF 4H0PA 4Q8EA 1ZQSA 3TADA 2CAJA 4G9ZA 5D8HB 1PCAA 2EFQA 5AZJB 3ENVA 3IGVA 1A6SA 1KR4A 4QZIA 4BQZA 1KVJA 2FUG9 4ZVRB 3PO5A 3GYNA 3M6XA 1NH8A 8ICWA 4DR6J 4J9UE 1ASVA 3M6KA 1WDDA 3H40A 3GR1A 1TK5A 4NM2A 3MN6A 3VF4A 5AZIA 2DHHA 3RB4A 5ALNA 3UQ2A 3QBCA 3LP0A 3ISDA 4DLGA 5L1JA 2UVVA 2KK0A 5L1KA 2WBMA 2ZWPA 1IBKF 2W6KA 4E2FB 4JV5K 2HS4A 2KJVA 4ZP6A 4AYBF 1N6QB 3TJ8A 1PUZA 2DPNA 2D9OA 3V7JA 4RUCA 2FJXA 3JPSA 1SPBP 2ZJPQ 2HHSA 1RT2B 2Z1GA 3ZD8A 2KKVA 1ZQNA 2JL9A 2YKMA 5E84A 2A19A 1FKOA 1CJUB 4MK7A 1KQSR 3P38A 4FXDA 3DGVA 4HCCA 3QX7A 4RPXA 3PSTA 2ZWOA 2GWJA 3NUQA 2QWNA 2GGPB 2G09A 4JK8A 3ZXWA 3JSYA 2H5JB 2W7AA 3PTWA 3A5LC 1ZQBA 4FJJA 1WF1A 2R8HA 4ZVOB 3ZZ0A 4J9RA 4ZKAA 1ED1A 5BYSA 1H6KX 1S49A 4D3HA 5J2AA 5IT9U 1ZS6A 3B9JA 1NKBA 1FKPA 3MM5A 2FVQA 1A5VA 3MAAB 2M5YA 2JLGA 9ICNA 5GAGP 2LMRA 5LMNF 1RAHB 1X4BA 7ICKA 4KRFA 1H7XA 1N5QA 2IVFB 4FXVA 1ZYQA 3TAMA 4UASA 2B4UA 2AD9A 1S6PA 4JB3A 5HP4A 4BROA 4A2BA 2BANB 4K4TA 4ZJQA 3W9IA 4DR1F 2P9GA 3HLUA 3DNCA 3M3ZA 4LMZA 4HTUA 4DPWA 1Q8BA 1J9AA 4F91B 4RQNA 2KHVA 1KQSM 1N32F 4DR2K 4AHVA 4ELTA 1HLWA 3U1MA 3VQBA 1WLJA 3B8AX 1VLBA 9ICJA 3UR3C 3SBGA 1DK3A 3VGLA 2E2OA 3SCKE 8ICBA 3WUHA 2QRRA 3JYTB 4DV2F 3QAEA 2IS3A 4Z7CA 1JLCB 4OX7A 3TTFA 2YKMB 2F7VA 3CJBA 3R27A 4C3KA 5KAIU 1JX4A 3T7ZA 2H3QA 5GAHU 3OYJA 1NK9A 5F9NA 3J7AP 2OSQA 2IC3A 3EWGA 1CUKA 5T41A 8ICFA 3QNOA 4FVCA 2DHSA 4LF5J 8ICEA 2JRZA 4I6WA 4UB2A 2FZKB 2GBZA 3PFOA 3NF9A 1VISA 3H0RB 3IP0A 2VPZB 2VIHA 1LWEB 3W8GA 3D1OA 1NJWA 3S1TA 2B51A 3D3BJ 4IL6U 2YNHA 2NUHA 4M0AA 5ETPA 3SXLA 3VHQA 5GAEP 1Q7YT 1YTUA 3NF8A 2PFFB 1ASUA 3UDVA 1L3KA 4ID5A 2FVPA 3DLBA 3VEYA 1QQOA 2R7XA 3G0ZA 4DR5F 5AFUH 2NV3A 4DBQA 3IAM9 3EMTA 2IVYA 3QEXA 2D8CA 3LO3A 1CC7A 5ALIA 3RJIA 3CCUS 2I2YA 4E98A 1IXKA 2JNJA 2VUGA 2MLXA 4I2PB 3PHTA 5AXKA 5HJXA 3L4BC 3UQSA 3U26A 2QB1A 3M9MB 4WF9Q 2LHTA 2N1RA 4N8OA 2V8VA 4F92B 3CFOA 4PCQA 1DAXA 4NI2A 1J5OB 3GJRB 4KLEA 3ZDDA 3BY5A 1K9MT 5ETOA 5HROA 3QJJA 3K2YA 1TVAA 4FWRA 2VB6A 4RQ2A 4WFZA 4GKKJ 1M1GA 4BRHA 2C3YA 2JEJA 4R8UA 5CABA 3EY1A 4NLRA 3D2NA 2J0SD 4IFVA 2IJNA 4DO9A 3PYFA 1B3TA 3CMAS 4CYUA 4P9SA 3IDHA 5FLXO 5KFKA 4PWDA 1TFWA 2ROEA 3M1VA 4ZPVR 2EVZA 1YBUA 4C80A 4FYDA 1XMOF 1GK8A 4IRCA 3D2SA 3WNHA 7ICSA 4C4SA 4LFBK 4GW6A 4GMKA 4K2JA 2C2KB 2BRLA 3PIOL 1WC3A 4KTWA 3HKZF 2ES6A 3N79A 3UWTA 3SQ2A 1Y9OA 4USMA 5AI8A 3D6TB 4JYAF 1YIJS 4ILLA 2RQCA 1RBUA 4NXMF 2E9RX 3HK2A 1UPPA 5IM0B 4YXMA 3WXIA 2QXFA 3V9ZA 1Y5IB 3IO1A 1HWUA 2OPQB 3OS0A 3MMBA 2HFNA 4Z4HA 4ANEA 3A0BU 2WHEA 4CNYA 1IG8A 4MFBA 1ZAXA 2W9MA 2IM3A 3CJCA 3JPQA 5JS2A 4FOEA 3HTVA 3I9ZA 3R7SB 2COLA 5M1PA 2HBJA 3QT8A 4JAXA 2UVRA 2BGGA 1RBLA 3QGPA 2V8PA 3GZFA 1WSJA 1U02A 3FGVA 2W2PP 2ZBPA 4KLQA 3FR0A 3D2EB 2CPIA 4M04A 5EUHA 1D9DA 4A8FA 1SUQB 4X66K 3EXCX 2DBYA 2PFNA 1S6QB 2RMLA 1S9GA 1R6YA 5ETVA 2I6WA 4WIQA 3E9LA 3T6BA 5A8WB 2YNGB 5KG1A 3GR0A 1Z00A 4ZS6A 4JUZA 2DR7A 4QZ9A 1BWEA 2CGKA 1ICEB 3G8SA 2DCUB 1X60A 2D5RA 2FZGB 3MECB 2C3UA 2EAOA 1RABB 1QQ5A 3CO9A 4MAKA 3F0NA 2PFQA 5KQ8A 2E9TA 4JI3K 2VFUA 1ZOLA 3BV8A 9ICSA 3F9KA 3SV4A 4UQGA 3L6QA 1FEHA 1W2IA 2DCLA 3I6PA 2ZH6A 3J7AN 1BUXA 2CQ1A 3MK6A 2BVZA 2VOPA 1RBAA 1LWCA 3I5CA 2LKYA 1ZQEA 4OD0A 1NPPA 1ULRA 2F4VK 7FD1A 4O3NA 4P4OA 3SAHA 4KAZA 2YY6A 2DR5A 4EBCA 1UFKA 4CD1A 3D4JA 4P0QB 1VQ9N 4U9RA 2NRZA 1HR0K 3MCOA 2BDUA 3HHKA 1D9FA 2E8AA 3L3VA 2XI3A 3V2UC 5I42A 3TAFA 2KT5A 1CJKA 2FJAB 3M5RA 4F93B 4FLUA 4DCHA 3O9RA 2Z2MA 1Z6RA 2B5JA 3AVBA 2AMCB 4BC9A 5AQUA 2DBBA 2KHOA 2LXUA 4CLLA 1NJIT 4J2AA 2Y0BB 1S72N 1HI0P 3JS6A 1U49A 1ZQVA 4DG1A 2H9ZA 2HSZA 4UB6U 2X7IA 1RA6A 3QU9A 1C20A 4ACOA 4BE0A 4TNOA 1IM4A 4OJ3A 1X0FA 4UQTA 1VSFA 1K1QA 1MDUB 4L76A 5CR4A 2V5HG 2Y0SC 4CJSA 3HZGA 1C0UA 4GV9A 1XC3A 4X65J 2D7SA 5ADXA 4GO5X 1BE4A 3DWLA 2O8EA 4M3UA 3OSNA 4KPYA 1N5TA 2DFEA 1EZZB 1FFVA 3PIPQ 5THWA 4CF0A 1GNKA 2WOMB 5KFTA 2EC0A 2CN1A 4RUBA 3HX9A 2HGNA 3O6WA 3W66A 3CCSN 1SV4A 3C6UA 5JJBA 2OTLS 4DSJA 1UCNA 4CF5A 2DGOA 4A47A 2D9PA 4FF1A 3QIPB 3KHGA 2DNLA 4DX6A 2ZDPA 3F44A 2EWHA 2CNOB 1NOMA 1SJ3P 4LF4F 2HNDA 5FPMA 1XERA 1Q78A 2BCSA 2LM1A 5KFUA 1QVGM 4MIBA 1S7IA 1AFJA 5AE2A 1YJNS 4YG2A 4LIWA 4H0VB 4GVEA 1S5JA 4I2EA 4EZ9A 3GDXA 2O8BA 4DTPA 2FLPA 3ETRA 3RH5A 5B0FA 1RYRA 4ANDA 3E1YA 1NO8A 1XJWB 3PXGa 2CJ9A 2W11A 2IDLA 1FEZA 3CCQS 1A6LA 3UNYA 1C6VA 2IA0A 4CHZA 3TARA 4DV2K 3G25A 2RP5A 4GO7X 1QD1A 3J7ZT 1RDRA 2ERRA 3AVAA 3QIPA 1Z19A 3RAQA 3J81U 2YMPA 3KK2B 3EEQA 2LYAA 1WKKA 3J7A1 3ZZRA 2OZMA 1CJTB 2WB1F 3LDNA 4OV6A 2LBOA 3H5XA 3HPHA 4B3SK 3ZD9A 2ZXHA 3HHLA 5J0UA 5IV3A 5C2GA 4USAA 4ZJOA 3UPFA 4CF8A 3MPDA 2ZITA 2JVRA 1ZQZA 4TXSA 3VGSA 5LJ5Y 4CCHA 4IG0A 5IIIA 2J9DA 2VPXB 4EX7A 3D67A 4GC7A 4J5OA 1X1PA 4CZMA 3UVJA 1NKEA 3OQ2A 4CF1A 1Z4UA 1X4HA 4I2AA 5HMZA 3O1WA 2C22A 1XMQF 5DB8A 2KM8B 5TKWA 2E2NA 3ISCA 4F72A 3GILA 1ZXIA 2WB4A 3VALA 3OFEA 1REGX 1JWWA 3HP6A 1OQ6A 4DHYA 2CXEA 3MN5A 2B6AA 4LF9K 1W7AA 2CQ0A 2DO0A 3E3XA 4IOCQ 1NMNA 2EK6A 4ITSA 2E5JA 4ED6A 4GKKF 2XO6A 3VQ4A 1QSSA 4PPZA 3ZZPA 5E3CA 3FUYA 3S41A 2FSJA 3E0FA 5D0RA 5HMYA 1YSJA 3SUQA 4P75A 1ATNA 4PXBA 5DLGA 4F4AA 3T1YK 2KYXA 4M5NA 3FK4A 3VQ6A 5HVGA 4HWIA 6FD1A 3VAFA 4B08A 5JLFA 3R6LB 2L3MA 5F8GA 4X2BA 1RDCA 3QO9B 4YR0A 4ZVPB 3L4PA 1RILA 1NDPA 5D4LA 3QUTA 2BJDA 4FZVA 3KBBA 2ZKTA 3BF4A 1VQ8S 4B8AB 1GFWB 4DB3A 2Z2ZA 3DDNA 1KN6A 4CRJA 3C6UB 3M8PB 2WUSA 2E5SA 4LR9A 4A8QA 1M90T 2EANA 2HK2A 3ZSZA 3K59A 2WOMA 1JCGA 5IZHA 2AF6A 4BVOA 5GADP 5ETQA 2RDJA 2BOAA 2NYHA 2KKPA 3NVYA 1WG5A 4XIUA 3DI6A 5C25A 2QA1A 2UVUA 2XVTA 1FERA 2FVRA 2UV8G 1J53A 4AL5A 5CHCB 2FVCA 4NLCA 2HKEA 3C2LA 2ZHAA 7ICPA 1SKSA 3V1RA 1HJOA 3ZTOA 1LWCB 1XBWA 5HK4A 1HW9A 2UUCK 3V6DB 1N8RT 3BDPA 3DCAA 3FCHA 3NS6A 1LEOA 4AILC 1RA7A 3NGSA 3QWPA 3SQIA 3I0SB 3G86A 2JLFA 5H9FK 4B02A 3K1ZA 1ACMB 3HX0A 4OLPA 4BGBA 3MXJA 4FO0A 4FLTA 2K7KA 4CIFA 2OPQA 4FZXC 3M6WA 4JI4K 1GXUA 5A8WA 3AVNA 2Z4PA 5L8RC 3PMNA 3VZIA 3VV2B 4WPAA 1H2UX 4J9KA 2K89A 1KVIA 4WKYA 3D2EA 3LP1A 4R79A 2ASPA 1APSA 4DFDA 2YNIA 3SDEA 2YHWA 4DV5J 2QLXA 2BKEA 4WFBL 5F8MA 2M9NA 2AU0A 3D68A 2ZTCA 4FPRA 2JHEA 1VRTA 4X4UA 3NMUA 5BR8K 3C7NA 2Y1LB 3KHYA 4RW8A 5IOLA 2G0CA 3WK7A 4GKJJ 1IQTA 4NASA 1ZTTA 1NDKA 2RS8A 2MSSA 3OGUA 4UTGA 5D15A 5D4BA 1UZHA 4GXKA 3VZHA 1HIWA 2WF5A 1RWXB 2CH6A 2K2PA 2LECA 4QYRA 2W3RA 3AO5A 2W2QP 4C2MA 3K75D 1Y11A 3FSXA 3MDFA 4HHTA 4HEA9 2IBOA 2FJVA 1EARA 3KTQA 3SCJE 1W0HA 4BQLA 4JV2A 2GNKA 3PX0A 2G0AA 3B8HA 1T9YA 3MD3A 3DLLQ 1RTIA 2WW4A 1AXQA 2J9DE 4QJVA 5HNKA 3F9MA 5EE3A 4RZRA 2UXBK 3QAUA 2OJ3A 1F5AA 3OA9A 2G2OA 1DFDA 3PW2A 1N33K 3L2UA 1HKAA 4X84A 2HOEA 2YB1A 2QKBA 2ODGA 2KP7A 2OSRA 4JNEA 1QZ6A 2D0CA 4HHUA 3HRGA 5FLXY 2QWQA 2HVZA 2V9KA 2UU9J 4MFCA 4IH7A 1WC4A 5BN9A 5J0RA 1PIEA 3CP8A 4GVBB 4WFYA 1NGGA 2FJ6A 3JAMO 4LF7F 3OS1A 4OI3A 2AGQA 3NLCA 4HHHA 3GB0A 5HMXA 1WBDA 3LPYA 1WOOA 5KT2A 3RF9A 2XY5A 2KW4A 1PAUB 2CJQA 1NB2A 4NXNJ 3FEXB 1KC8O 4DQQA 2VASA 5DB9A 2F8TA 4FWOA 1SGGA 2GVDB 1IUJA 4JV5F 4A8MP 8ICIA 2W9CB 1C0TA 5DK5A 3M30B 2HHTA 1X66A 5FIIA 2ZJ5A 3ZDAA 2YKNB 5DQGA 4ZN3A 1BWVA 2NYIA 1N5WA 1ZPWX 4B6JA 3CRXA 4E19A 2UUBF 1S10A 3F41A 3H8JA 4C1NK 3TACB 1J54A 4TY8B 1KAZA 3C5GA 2YNHB 3AA2A 2W7OA 4WF9L 2YX1A 1BXNA 3BZCA 2GELA 5AKLA 3CO0P 1PYSB 3CJ4A 2BXJA 1OWXA 2CPZA 4KGZB 2HWHA 4M5GA 2BW7A 5KAKA 3GG4A 1X42A 2J6TA 2H5IB 2DY9A 3SENA 2CPXA 2HNYA 4FVMA 4QCLA 3G6EN 4FE3A 4ICAA 1R31A 1FA0A 4RQ6A 2OZSA 5AKYA 5ETLA 4LSLA 4B9QA 1FFWB 1VI7A 5C2CA 1PBUA 1GT8A 3JYTA 1ZRNA 3CNHA 3HVTA 2EKNA 2UXCJ 4CK1A 4DU4A 2LPEA 1W9HA 1FDDA 3WK6A 2QT7A 5HHIA 2V4JB 1I3AA 5AIBA 2RRBA 3T1YF 4JK9A 1B99A 2DXFA 4PKHA 4F2RA 1S6PB 2KTQA 3UN3A 1FKOB 4X4VA 1LB2B 3SQ0A 1U45A 3AOAA 5JVGL 4O55A 4M6WB 4NYZA 6FDRA 1FT8A 2Z2LA 1XSLA 1O5JA 1ZXOA 4LSZB 2X1BA 3PYDA 5ETSA 4DV0K 2IRYA 4U95A 5LT5A 5AQHA 4EGLA 4KLUA 4KKOA 2AW0A 4J37A 1KN5A 4NCBA 5T14A 3HW8A 4KN7A 2YKQA 4Z4CA 2KYZA 4RNMA 3AODA 4M5MA 2UXDK 4W5NA 3FM9A 1UQVA 4FZLA 1R0AB 4JS5A 1V5VA 1RUSA 1HUOA 1ATSA 1CEZA 2W8KA 2KB2A 2QFIA 2OO4A 1YJ9S 4A5AA 3MMCA 3P83D 2JH7A 4PXEA 3QEPA 5D6GA 3BS5B 3VCDA 4P2XA 5ALVA 3ZNUA 3ENHA 4OJGA 4RQ8A 1RT2A 2YCHA 3PFEA 1SIJA 3MGIA 2DGQA 1FVSA 5EU7A 3IS9A 3BQTA 4RR5A 4ZN1A 4M9GA 1KAYA 2W41A 3D6HB 4WCEL 5KI6A 2OP5A 1KONA 2CQGA 3SJHA 5JTIA 1H98A 1HNXJ 4A8WA 1W26A 5A8RA 4J8FA 3WNFA 1NU4A 2F44A 4CEEA 3FVYA 2QSFA 3RZAA 1KHWA 1TAUA 2FF3B 2KSOA 3K9KA 3I8DA 1PILA 1LVHA 1Q7YO 4OJRA 4GVMA 2KN4A 4ZDNA 5LMUJ 3MCAB 1X5TA 2OTJS 1KL9A 2RJZA 4AFFA 4JI2F 1X7VA 4Q5VA 5A6PA 4CF2A 3AN1A 1C2PA 1RXWA 1PVPA 2W6LA 4G3IA 1JLGB 4IDHA 5AJ3F 2ZC3A 3OTCA 3EYZA 3OPKA 2NQPA 4YFUA 1Q18A 4KGXB 4I64A 2Z1HA 3UD5A 1S6OA 1ZQTA 2GMLA 1EQMA 1CS4A 4CLZA 5K8PA 5KFNA 5AZIB 4KREA 2E5HA 1CBKA 2PI5A 3LDOA 4BRIA 2LYBA 5C24B 4QAGA 1FRHA 5M1KA 3CC4N 5DDYA 3QDKA 6AT1B 5H9EJ 1BQNA 4CHPA 4OYWA 1SXDA 1KP6A 3UI3A 3CD6N 2Z1JA 2HCFA 2VPYB 3G4SN 1RT7B 5F8NA 3K2PA 2QMWA 4NYOA 2XHBA 2GX9A 2W9BA 3O4QA 4RNHA 1LWFB 2BACA 3U02A 3OYNA 3MN9A 2CPYA 3S3MA 2DITA 1S9EB 1OKJA 4RWXA 2NO4A 5BJRA 1ZD2P 3T5JA 3OR2B 2RN2A 3OL8A 3LGHA 5AHXA 2F77X 1S4EA 5DRKA 3UDEA 2IFXA 2KL8A 3AAPA 3ALRA 4BG8A 4ZP8A 2I5JA 4CIGA 2HZAA 3BQ2A 3H98A 1RT1B 3TABA 9ICIA 3H0LB 1BQXA 3DRSA 2FSKA 4FK2A 1XU4A 7ICFA 3GWCA 1ZD4A 3R97A 1YI2N 1BY9A 4AHCA 2BRKA 3KXDA 4TKTA 2AH5A 3A8JA 1OUQA 3W1YC 1I1GA 3P5BP 3V6JA 5K8MA 4KKOB 3CD7A 4WKRA 4CJQA 3VGMA 5ETRA 5E26A 1HWLA 4DR4K 4TUPA 1RDBA 2CDRB 5CYQB 3Q8QB 4GVLA 2BM0A 5J2BA 4B8CA 3EXYA 3WQUA 3KLGA 1H73A 2ZJRQ 4PG6A 1WG1A 3KLEB 3GONA 1CJTA 4I0WA 4IKAA 2E2QA 4XDDA 1NZ8A 3MR3A 3SPYA 1R8PA 2QL5B 4IQXA 2GJ2A 1N56A 2KZ3A 4M47A 1DTQA 1BL3A 4ZPCA 1ZQGA 2RUSA 4ZLJA 5H1SV 1JNRB 1IKXB 1RTDB 3O0FA 3CVKA 3AFGA 3MPVA 1JKHA 2CQ2A 4USVA 4WYBA 4DR6K 3IWLA 1YLXA 1QQMA 4HTIA 4RQ1A 2HHUA 3N6MA 2ALZA 3FMBA 1KQGB 4KTQA 2HW3A 2CZ4A 3CJ2A 4Y2XA 4BRAA 3BN4A 3IN5A 1C0UB 1HQUB 3NNHA 1J5EJ 1EWQA 1L8LA 1HYSA 4HHJA 2XC9A 3KLVA 1VQMS 4CO2A 3GJTB 4PGQA 3A8YA 1QUPA 3RH4A 3K17A 1FX4A 1IJJA 4H5TA 4KO0B 3V4IA 1YZ7A 3OJSA 2VF3A 4MIAA 4PEOA 2KQ2A 5HI7A 3KKRA 1R0BG 1XNQF 3QUQA 2DXDA 4CBWA 2MUTB 3BN7A 3IC1A 4OYOA 5E3RA 2M0NA 4IRKA 4ZCLA 2ATCB 3H4BA 1B0TA 4A61A 3G8QA 4CFDA 1JXEA 1D8BA 1K44A 1OMSA 1TL3B 4RLEA 3SBMA 4DTRA 2YB4A 4PZVA 3DLGB 3OW2R 1DQAA 2DNMA 1BLUA 2MB0B 3N9UC 1QVFR 1N36J 4KFBA 2HLTA 3R5AA 3IRXB 3I82A 4QZFA 3DXSX 4H54A 2AJ0A 4KI4A 1VHXA 1F1BB 1RISA 1XMOK 4WFBQ 3IAS9 3L2VA 2MHEA 2HMIB 2OYQA 2DKZA 4F5PA 1G3OA 2LLZA 3VQAA 1X9XA 2ROGA 2KNJA 3LP1B 5HBMA 2VQFJ 4LSNB 2RHSB 3L2WA 1MU2B