3TAPA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-3) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tapA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tapA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tapA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tapA01
2BPCA 1ZQPA 3SJJA 4Z0UA 4CJ4A 3SCXA 2FMSA 1RZTA 2YHAA 9ICSA 1JLAA 1SKRA 4KHSA 4FXDA 4CHZA 2EX3A 5KTQA 4Z4HA 5J2QA 5KFZA 1ZQQA 3SV3A 3RMBA 4P2HA 4ECQA 2GUIA 3JPPA 3V81A 3SUPA 3RWUA 3FFIA 2LYHA 1KLMA 1U4BA 4YVZA 5DB7A 4G1QA 2P6RA 4DFMA 3QLHA 3M8SA 4EBEA 4J9QA 5CJ7A 4KLGA 3S3OA 4CJSA 4CCHA 9ICCA 4KHWA 4ECWA 8ICMA 4E1MA 2W9AA 3KHGA 3AVNA 2BR0A 2IS3A 3HPHA 5HRRA 5HRNA 3VA3A 3AUOA 4KHQA 3AVJA 3EZ5A 2NRZA 3Q8KA 5J2GA 1EETA 3ISBA 5KFYA 3U3YA 3TABA 1L3VA 1S1TA 4UB1A 3N4MB 4RQ8A 4Y1CA 5CA7A 1BI4B 4JV2A 4FJ8A 4CHQA 7ICPA 3OVNA 3QIOA 5DKWA 4Z4CA 4OKKA 4DQSA 4ED8A 4Q5VA 4JWMA 4KI4A 3D0PA 1RBTA 3EPIA 2KFNA 4CEDA 1SL0A 4UAYA 4IDKA 4KN4A 1AROP 3QEAZ 1C6VA 2WONA 4ECXA 4ED2A 4JUZA 1LWFA 3ITHA 2ZE2A 4QZ8A 2BPGA 3MDAA 2ATLA 5T7BA 4CF2A 2W9CB 2E6LA 1L5UA 4ZH4A 4O0IA 2FBXA 1VSKA 1XS9D 4DMNA 5FRNA 4KLJA 1PZNA 4QW9A 2OA8A 3GV8B 2BKEA 5KG1A 4EZ9A 4NLGA 2ITGA 4YXJA 5DBCA 4NY8A 4FZXC 3AU6A 4F3OA 2UVUA 5DB9A 1TL3A 4DOCA 2FPMA 5DK5A 5E41A 4N5SA 4N47A 4CK2A 4M9NA 2F1JA 4QWBA 4M41A 4RQ6A 2R7YA 1YTAA 3AVGA 1NOZA 2HNDA 5I42A 3GIKA 9ICTA 4JRPA 3JPOA 1BPXA 4Z6EA 3C2KA 7ICLA 3RRHA 2KFZA 4FS1A 8ICLA 1VSLA 2JEIA 5C24A 4J2DA 1RYSA 4FBUA 3DI6A 3IAYA 4CERA 2KQ2A 4YMOA 1MSWD 3MGIA 3ISNC 4MFCA 2OPQA 5HMMA 2ZTCA 1B9FA 4ID1A 4NM1A 2RN2A 4FYDA 4CIFA 2XCAA 9ICIA 3OJUA 4W5OA 3V6HA 1ZQRA 8ICXA 3HPOA 2GWSA 3PV8A 4DLGA 3S9HA 4M42A 4CHOA 5HRPA 7ICKA 2XGQA 1J53A 4QAGA 4J9OA 4FJMA 3HWTA 3MFHA 4DFKA 2YKMA 1JN3A 3DLGA 3KLHA 3H4BA 4PH5A 2FLPA 4DTSA 3EW9A 2X6NA 1IKVA 3SV4A 4Z4IA 3PY8A 1KSPA 4CIGA 4ECVA 1IKWA 1LAWA 2I1QA 5DBAA 4X5VA 3M8QA 4OGCA 4FJXA 5KGWA 3RMCA 1C1BA 4CGIA 2RKIA 5KFLA 4KPYA 3I8DA 3GFKB 3C5GA 4JWNA 4IKFA 5J0YA 3DLEA 1IKXA 3AVLA 3V9UA 1QSYA 1N48A 4DU1A 4PPXA 4M3UA 4E7LA 3OGUA 4RUAA 4DTMA 3AA4A 5F9NA 3KKSA 4F4WA 3HVTA 3K5LA 1KEJA 7ICQA 1RBSA 4Y1DA 1ZQSA 3MXJA 4RZRA 1ZQOA 1BIUA 4DTRA 1TKDA 3OYKA 5J2BA 4DL5A 4KHYA 1RT1A 4PUOA 2G8VA 3NGYA 5KG4A 1HQUA 5HBMA 3G0ZA 4E1NA 4I2FA 5J2HA 4RW9A 5J2PA 3EYZA 1YT3A 4O0JA 1ZQUA 2ZJ8A 4F93B 3T1AA 3AO1A 4E0DA 1ZBLA 5D49A 1HYSA 3KK1A 5DB6A 5J0QA 4PGQA 2ASLA 3HP9A 4CEBA 3SI8A 1HUZA 4KLUA 3JPSA 2VA8A 4IR9A 5J1EA 2ETJA 4RNMA 9ICMA 3RJJA 4K4HA 3LPUA 1EKEA 1L3SA 3RH5A 1ZQKA 3AVAA 4DS4A 4BDPA 3EWAA 2O4GA 4FLVA 4KLOA 5J0SA 7ICVA 1RXWA 1WSJA 2ZTDA 5I3UA 4BGDA 4GXJA 1U45A 4B9TA 5KFBA 2G8HA 3ZSQA 4I9LA 4BWJA 4HUGA 1VSJA 4QZBA 3MAQA 4JS4A 3NH2A 5EOZA 3KLIA 4TUQA 3K5OA 3Q8SB 5FRMA 1ZETA 3NH1A 1DOQA 5KI6A 2J6UA 4KLSA 3KKRA 4YR2A 1ZQMA 4R5PA 5KG3A 2AQ0A 4YP3A 3RMDA 3OY9A 4F5NA 1T8EA 1BVSA 3AA3A 1ZYQA 2YNGA 2Y1IA 1RTIA 2XRIA 4OJRA 2BCUA 8ICBA 4M9GA 1TKTA 2KN7A 2C2EA 4OGEA 2Q3SA 3G6VA 3CYMA 4PHPA 2V4RA 4QZDA 3TANA 2R8KA 2I9GA 9ICBA 4FLYA 7ICIA 4NYNA 1RDDA 4YNQA 4DO9A 3PW2A 3B0XA 3VQ5A 2BQUA 4C8NA 2OYQA 3KK3A 3QINA 5DG9A 5F9LA 1D5AA 3MXIA 5J2CA 9ICFA 4MFAA 4YG2A 2G8FA 3O4QA 3C2LA 4CGHA 3MR3A 3V6KA 9ICHA 5DBBA 3DLBA 1HRHA 2BPFA 3PO5A 4CFCA 4B8CA 3TAGA 3P83D 4ECUA 1X2IA 1T4GA 4EEYA 3MXMA 2MAXA 4J2EA 4FJKA 3RTVA 4M0AA 1T05A 3V7JA 4RQ2A 3TAPA 8ICGA 1ZBUA 3L2VA 1XHZA 4I2HA 4O5KA 5KFCA 1RTJA 2BQRA 4FW1A 3OYIA 2DPJA 4ED6A 3S3NA 3ALYA 2OZSA 4EYIB 5KFXA 1L3TA 4YMMA 1KVCA 2YNHA 3KTQA 4M04A 2XGPA 2FBVA 1WCNA 2PI5A 2C22A 4I2AA 3OS1A 4ECSA 3ZDCA 1H38A 3ZT2A 1HNVA 4R66A 1BPEA 4BDZA 1NOYA 4CEOA 2UVWA 2NRTA 3VQ9A 1EXQA 4CJEA 2B4JA 4N76A 5JUMA 4CHNA 3K4GA 1K1QA 5KFEA 2VWKA 5J2MA 4N56A 1BHLA 5C25A 1ZQBA 2FMQA 4M9HA 3IRXA 1KFSA 4HHTA 5KT4A 9ICGA 4UBCA 1RT3A 3JPTA 1S5JA 4P4OA 3HSTB 1N56A 2YV0X 1JXEA 1JKHA 3AVCA 3HW8A 3HX0A 5KG0A 1MU2A 4BE2A 3AV9A 3K57A 2NUBA 1QHTA 4DTXA 3AU2A 3ZSXA 3PW4A 3OJSA 4F91B 4DF4A 3MEDA 2UVRA 5J29A 1VRUA 1BPBA 4QWCA 1RTHA 1S97A 3M9MB 1G15A 2HHTA 4GC7A 4O3OA 1Z00A 4RPYA 2IBKA 3IS9A 2GV9A 4Q0BA 3AA5X 5CYQA 3RB0A 4ED7A 1Z25A 2PFPA 5KFRA 2FMPA 3U6FA 4B9UA 9ICRA 1ZQTA 5D46A 2IC3A 4CF0A 3F73A 3QETA 2P5GA 4AH9A 1XWLA 3KHRA 3Q8RB 5K14A 3C1YA 3QO9A 1RBVA 3CFRA 3BQ1A 4XIUA 2C28A 4Z4FA 1Q8IA 4ZHRA 4E19A 1RDAA 2VG6A 2A1RA 1IG9A 3LAMA 1SKSA 3MEGA 3TAEA 5J0PA 1TV9A 4F5OA 4AHTA 4M2YA 1GOAA 7ICNA 4CJVA 3QEBZ 4PA1A 4Q44A 1QS4A 4Q8EA 3NCIA 4KN7A 3PW0A 4KB0A 3E2EA 2VG5A 2D0BA 3PR4A 3C95A 3PNCA 3BJYA 4FLXA 3AVKA 4ZTJA 1IM4A 2W42A 1S0MA 4DL7A 5J0UA 1CZBA 4IRKA 5KFNA 4OKJA 4DSFA 4KTQA 3SYZA 4IBNA 3V4IA 1SZPA 4FJ7A 4CK1A 2R8JA 1KLNA 3MBYA 1C1CA 2HB5A 4PHAA 1CEZA 3LDAA 3JPQA 2M9NA 4I2BA 5KFOA 3OS0A 3C1ZA 4FS2A 2ZUCA 1NK0A 1JLEA 2PYLA 1TFRA 1NK6A 4F4ZA 4XQ8A 3ZSZA 4LSNA 4DL6A 2A1JA 2HVIA 1HQEA 2BCSA 4LH4A 5J2EA 1RT6A 3ISCA 2PFQA 3HPGA 4ECRA 5DDMA 8ICHA 7ICHA 1K6YA 2G8IA 4AHUA 1RDBA 8ICVA 3ZCMA 1NKEA 3KIOA 1RDCA 4M3WA 4NCGA 4M3ZA 4FLZA 3SQ4A 2AQ4A 4GMJB 4TQRA 3RR8A 4CJ3A 4CEEA 1YTUA 3T5HA 2ZUBA 2W9MA 3TFSA 3T3FA 3TAMA 4DU4A 2JEFA 1XSLA 3BGRA 5C42A 1JLFA 1TK5A 3C6TA 9ICXA 4YD1A 4Z4EA 1TKZA 3OYAA 2JEGA 1NJYA 4KLLA 3Q8LA 1UOCA 4FM2A 3SUOA 1ZQHA 1X1PA 1D9DA 3KHLA 4FO6A 1HPZA 1NK7A 1JLGA 7ICFA 5KG2A 4RT2A 1WSFA 5BOLA 1RPLA 1K1SA 4TUPA 1FKOA 1S10A 3F9KA 1VSDA 3RBEA 3JPRA 4GXIA 4XA5A 4R65A 3K59A 4MEYA 5DQIA 2I5JA 3OYNA 4M3RA 4OKEA 3V9WA 1TK8A 2YNIA 4O5CA 3OYBA 1ZQYA 4I29A 4YN4A 3NGDA 4QOZB 4ECTA 2VA3A 2JGUA 4EBDA 4CF9A 1X9MA 3KLGA 2QKKA 3AA2A 1XO1A 1LW0A 5BPCA 3B0YA 5KT6A 1TV6A 4RQ0A 1Q9XA 3ZSOA 4R64A 1KCFA 4KV8A 1CUKA 4NM2A 4RW4A 3NF6A 4CIEA 2Z1GA 2PFNA 4GW6A 2OPPA 4O44A 2FBTA 5SZTA 4DSIA 5DG8A 1IH7A 3UXPA 1LB2B 4DS5A 3V6DA 5J0XA 3V7LA 4I2EA 5KFAA 3LP1A 3MR5A 2G8UA 1SL2A 4JV1A 3NH0A 4AHVA 3NBPA 4CF1A 4J9PA 5BOMA 2VANA 5KFTA 3RJHA 4KHUA 4C8MA 3HL8A 4PQUA 3DOLA 4ED1A 3ZSVA 3HM9A 4EP5A 1IKYA 4O3QA 4OPJA 1WSEA 5TZVA 4HCBA 4OLBA 4QCLA 5KFGA 2WTFA 4E89A 3OYGA 3CQ8A 2HHXA 5CYMA 3OYDA 4DLEA 2F1HA 5FDLA 3NGIA 5FROA 3GIJA 1JL2A 4BACA 4IFYA 3AO4A 2YNFA 5J2IA 4M47A 4CFAA 4BWMA 4Q45A 1NK8A 3M8PA 3RH6A 3C2MA 4F3TA 3HYFA 4OLAA 4CJWA 1A5VA 2Y1JA 3ZDEA 1QQCA 4ZTFA 4F50A 5C5JA 1ZQXA 1JIHA 2DY4A 9ICLA 1XHXA 1A76A 4DTOA 4LSLA 1C7YA 2YKNA 4DFJA 3ZT4A 1HMVA 5KFQA 3O3HA 4N41A 4QW8A 4CJRA 4C8OA 5KT5A 2R8HA 4FLTA 2DFFA 4B9VA 3VQEA 4KO0A 1FK9A 3A2FA 5DGBA 2KW4A 5IIOA 1NK4A 1RYRA 3SUNA 3KD1E 1J5OA 4RG8A 3L3UA 1I3AA 5IIJA 3HO1A 5IIIA 1WSIA 1NKBA 1BI4A 7ICOA 4FJGA 1ZQGA 4M45A 5KFPA 3VQ6A 3T5JA 1ZQCA 3VQBA 2W9BA 4DL3A 3QNNA 1S9GA 3BDPA 2B6AA 2P5OA 3CM6A 4ICLA 4R8UA 3RAQA 1LAVA 1U48A 3H8WA 3OS2A 5EU7A 5IILA 8ICFA 3OHAA 1HYZA 4KI6A 4UQGA 1I39A 4I2DA 4LZGA 4FK4A 3K75D 5HRSA 2E4LA 4LH5A 4CJLA 2W9CA 3RAXA 3HK2A 1C0MA 2AJQA 3DOKA 2D0CA 1CXUA 4IQTA 8ICTA 3AVIA 1S9FA 4E7HA 4WE1A 1S77D 1VSMA 4FZZA 2C2RA 3CFOA 4J9NA 3UIQA 3MGHA 5KFVA 3VQCA 4PY5A 5KT7A 4UAWA 1A5XA 3KD5E 1TAUA 3SQ2A 1WLJA 1Z00B 3RJIA 3V1QA 5HLFA 1SV5A 5KG5A 3DRSA 3LP2A 4UB4A 2Z1JA 1S9EA 5HHIA 4FJHA 4KHNA 3EY1A 2PY5A 1T7PA 1S1WA 3CFPA 2HHQA 8ICNA 3C21A 8ICKA 5DDYA 3BQ0A 2A1SA 3SZ2A 3NF7A 4W5RA 4RU9A 4JRQA 4OPKA 3ORYA 5HP4A 2E6MA 3V9ZA 3ZDAA 2DTUA 3LZJA 3VQQA 4IRCA 5HHHA 2NRWA 4QZIA 3KHHA 4CFBA 3AO5A 1BQMA 5DLFA 4H4OA 3ZSRA 4FJ9A 3OYFA 1VK0A 3LZIA 3TR8A 1WSGA 1ZQAA 2BHNA 4F4KA 1HJRA 4E7JA 2IA6A 2HHWA 2F96A 4RNOA 3Q8PB 8ICUA 4ELVA 4HYKA 3ZD8A 2ISOA 3G10A 1ZBIA 4CJQA 5DQGA 4CGDA 4MQ3A 3N97B 1LW2A 4FZYA 5J0OA 4DL2A 3V1OA 4YR0A 3NTUA 2IAJA 4FBTA 3HT3A 4QZCA 4DOAA 4DWIA 2G8KA 4O3RA 2XC9A 5D3GA 3H8SA 2BGGA 1KDHA 3WNEA 3AVFA 4K4GA 3H08A 5J0WA 4H4MA 4CGGA 3DLHA 4HUFA 4W5NA 1JXLA 4CESA 2MUTA 1VSFA 3V72A 1ASWA 5KFHA 2OZMA 4FW2A 1RT4A 3QZ8A 4I2QA 2AGOA 1A5WA 4KLEA 4NXZA 3UQ2A 3VN5A 1WNSA 1SKWA 2HNZA 2A1JB 3QIPA 4ELUA 4M3XA 4M9LA 4FLUA 4HCCA 3HJFA 4TSXA 2IOCA 1B43A 3PR5B 3G6YA 3BQTA 1S76D 2BE2A 3K58A 5CWRA 4F5RA 4UB5A 3LP3A 2W8LA 3ULDA 3NAEA 1S0NA 4B8AB 4ECYA 1NK5A 1CLQA 1TGOA 4IG0A 3FDSA 3HP6A 4GC6A 4RNNA 3LWLA 3LAKA 4CJ5A 1ZQZA 5L1JA 1ZQVA 2FLLA 4UBBA 1EP4A 1QTMA 7ICEA 2OPSA 3RR7A 3MR6A 4CJKA 4I27A 1UWBA 4KTZA 3SUQA 2LSNA 1QSLA 3L2QA 3O3GA 3HXMA 4B3OA 5KT3A 5CZ1A 3O3FA 4YXMA 3ZD9A 4RW8A 4R63A 3MDCA 4E7KA 1WSHA 4OVLA 1NJXA 1IXRA 1ZQJA 4NLKA 4DQQA 3WNHA 2D0AA 3JPNA 2V4QA 3UXOA 3SI6A 3VQDA 3LK9A 1Y97A 1JL1A 3QEWA 4J2AA 3M9NB 4KLQA 4FJIA 1ZQEA 3AO3A 4C8LA 4PHDA 3JYTA 1TKXA 5CZ2A 1WAJA 4ECZA 4ED3A 4FLWA 1C0UA 4P4PA 3D45A 3AVHA 1BPZA 2AGQA 1TVAA 3GV5B 1BGXT 4HVJA 1IO2A 4RW6A 4DQRA 3DYAA 4PGXA 3HVRA 1NK9A 4B9MA 3RB6A 4FM0A 3RRGA 2XY5A 2BQ3A 4CHYA 3H8JA 4ELTA 4DU3A 4FJJA 3MEEA 3OYEA 3H4DA 3VA0A 4HUEA 3OYCA 1W9HA 2ASDA 4GXKA 8ICCA 8ICYA 4QZ9A 4DTUA 3JSMA 4CJTA 2X78A 4MF8A 9ICAA 4DEZA 1JX4A 1ASVA 3O4NA 2YHBA 4KRFA 5J2NA 4QZEA 3H40A 4CECA 1NOMA 7ICMA 2ZJ5A 3H7IA 3GIIA 1QE1A 1JMSA 3DLKA 1BPDA 3ASMA 3RJFA 4F8RA 4I2PA 4FJLA 1Q9YA 2BCRA 3QNOA 4E7IA 4IQVA 4KLFA 5CP2A 1TVRA 4DSEA 3NF9A 4HTUA 7ICTA 4M6WA 1EXNA 1CXQA 4J2BA 2XHBA 1SL1A 3P5JA 5L1KA 2QK9A 3EPGA 5KFJA 1KVBA 5KFMA 2P1JA 2UVVA 4B08A 4NYFA 2HNYA 2DPIA 2RDJA 4KLIA 4F2SA 3V6JA 3C23A 1A77A 5CHGA 1B22A 4K4IA 2IGIA 3S3MA 4O3PA 4I2CA 3C94A 1QSSA 1RNHA 1ZQDA 4UB2A 5IIKA 3ZT3A 4AHCA 2FC0A 1YVUA 1J54A 2F1IA 3QERA 2D5RA 4NLNA 2Q0ZX 4DG1A 4NLZA 3M8RA 5EWEA 3RB3A 4F92B 1NKCA 1S1UA 4KITB 3E01A 1LWCA 2W9BB 3PX4A 2RF2A 5D4BA 3IG1A 4CEAA 4CF8A 3UPQA 4IQUA 3KK2A 4CEFA 5KG6A 3NGZA 3OYJA 5J0RA 4R8UB 3DM2A 4RQ1A 4F4YA 3K5MA 3PW7A 1XU4A 1RBRA 2XCPA 3K2PA 5CB1A 4YQWA 1DTQA 4KB1A 4DTPA 2BGWA 1RCHA 3NDKA 2JLEA 4NCAA 5KRTA 2QKBA 4B9NA 4DQIA 4KMUA 4CEQA 5EWFA 3VQ8A 4RQ3A 8ICAA 1WAFA 4CE9A 4W5QA 4J9RA 3PX0A 3QEXA 1LV5A 4AILC 4LVSA 1T03A 3GIMA 4FJNA 1ZQWA 3ISDA 2B21A 3ZSWA 4IRDA 1REVA 4RQ4A 4DSKA 2NRVA 5KG7A 4JK1A 4M9JA 2KZZA 4Z4GA 5CR0A 3QEPA 3NF8A 2KZ3A 4ED0A 4O3SA 2X74A 3WNFA 1RXVA 4BXOA 4FK0A 2DFEA 4Q43A 2AU0A 1W0HA 1KFDA 4CGFA 2IMWP 3SPZA 4K8ZA 4P4MA 2JZBA 4DOBA 5HP1A 4TQSA 1ZJNA 1RBUA 1UA0A 4B9SA 1ITGA 4I2JA 5KFWA 3LP0A 3KLEA 2XY6A 4BE1A 1BIZA 3OSNA 1COOA 1GOBA 5L1IA 1GOCA 4PGYA 3RJEA 1ZQIA 5DMRA 3IHQB 2V9WA 1O1WA 3PMNA 9ICPA 2Z1IA 9ICVA 1JXBA 3Q8MA 4IG3A 1VSEA 4CJUA 3OYMA 4PHEA 1B92A 4CEZA 3PVXA 7ICUA 4I2GA 1EX4A 1JLBA 2BDPA 4KKOA 4IQWA 4KFBA 4QWEA 4J9SA 2HW3A 2PFOA 2KTQA 5J2JA 4J9KA 5DLGA 3T19A 1ZJMA 1CZ9A 1ZQFA 4CK3A 2W8KA 1TL1A 4J9LA 3OYHA 3I0RA 9ICWA 9ICEA 2HMIA 2BCVA 1BL3A 2X6SA 3ZT0A 2MUTB 4F4XA 1RT5A 3RB4A 4CHPA 8ICJA 3VQ7A 3ZT1A 4MFBA 4DQPA 7ICRA 3SNNA 1N5YA 4RT3A 2ZJAA 4EBCA 3KLFA 3IM1A 2IHMA 3L3VA 4ID5A 3GDXA 2OWOA 1DLOA 5L9XA 3K5NA 3UXNA 1FXXA 3V9SA 8ICIA 1S1VA 2F8TA 1JLQA 3U3GA 3LALA 4DTNA 9ICQA 3GV7B 1JLCA 1RT2A 4O9MA 2VA2A 3KJVA 3DRRA 4YD2A 4O55A 2NRXA 2R8GA 4B9LA 4J9MA 3OHBA 1XC9A 3P1GA 3WNGA 2XO7A 4LD0A 5DGAA 8ICQA 1BISA 4RQ5A 4YFKA 3MABA 1Z26A 1UT5A 4O5BA 2PYJA 2FLNA 3BQ2A 5EWGA 1U47A 5KRSA 1V9PA 2ZD1A 4JS5A 2ZTEA 5J2KA 2ALZA 1X9SA 3M9OB 5J2FA 3RJKA 3PW5A 2C2DA 4EZ6A 4I7FA 3TI0A 3V9XA 2Z1HA 3T5LA 1U49A 1VRTA 4EP4A 1S6PA 2HHVA 1C1AA 2PXIA 4QWDA 2IDOA 3VQPA 2ZUDA 1VSHA 3PUFA 4AHSA 4I2IA 4DL4A 5IINA 1MQ2A 2XY8A 4RQ7A 1SUQA 4UB3A 4KLTA 1C0TA 2HHSA 2PI4A 2P66A 4QZGA 2P51A 5DQHA 3AVBA 5J0TA 5HMLA 2HHUA 9ICKA 1WN7A 3ETLA 1LWEA 1MC8A 1ZBHA 4O3NA 3QEIA 8ICPA 2ASJA 2GBZA 5DG7A 4JLHA 4FCYA 3MECA 3SPYA 4GVMA 3B6OA 3L2UA 3SQ0A 1BPYA 2JEJA 4BDYA 3QESA 4RUCA 1HYVA 2ZQBA 9ICUA 1S0OA 3NHGA 3PO4A 3C6UA 4O5EA 1XSNA 4Q8FA 4F5PA 4MF2A 3UQ0A 4CJPA 4FJ5A 4DSLA 1UAXA 5KFKA 1HUOA 5JS2A 4XRHA 1VSIA 4Z6CA 3RH4A 4IFVA 5KFDA 3ZDBA 3L2WA 2RDIA 2QXFA 5KT2A 2KZMA 3TWHA 1NJZA 1ZBFA 1R0AA 1D9FA 4CFDA 5KFUA 5HNKA 7ICGA 4JV0A 2PZSA 3B6PA 3NFAA 3PX6A 2WOMA 4BE0A 4DSJA 1S1XA 2BANA 1Y88A 3PMLA 4DTJA 1UT8A 1TAQA 5JS1A 8ICSA 1U04A 3C5FA 1Z3EB 5DB8A 3VQAA 4FM1A 1HJPA 1F21A 4M6WB 2RPIA 3V7KA 4EYHB 1ASUA 4C8KA 2ISPA 4TURA 4LY7A 7ICSA 4KTWA 9ICOA 1KVAA 2VG7A 3NE6A 1FKPA 1MQ3A 2AGPA 4FK2A 3CG7A 5KGXA 4O4GA 3THVA 2FBYA 1S0VA 3FYHA 4NCBA 1KRPA 2P6UA 2F8SA 4G3IA 4KLMA 1QLNA 2R8IA 3AVMA 5L1LA 5KFFA 4YFUA 2DFHA 4KREA 4DF8A 2ATQA 4DFPA 4I28A 4QZHA 5J2DA 4AHRA 1HNIA 1TK0A 2DFLA 3TARA 4Z6FA 4KAZA 1D8YA 4PWDA 4QWAA 1XI1A 4M3TA 3DLRA 2J6TA 3OSPA 1NJWA 3DRPA 3SQ1A 4YR3A 4CJFA 8ICOA 1BQNA 4YMNA 8ICZA 4YCXA 4KLHA 1DTTA 2H5XA 3ZSYA 4GLXA 3TFRA 4E3SA 4H8KA 4IR1A 4QZAA 1XSPA 3ZDDA 3LWMA 8ICWA 3QE9Y 2J6SA 3T5KA 9ICNA 4F2RA 4L8RB 8ICRA 1N6QA 3TQ1A 3QEVA 3QZ7A 1BCOA 1RILA 3AO2A 4KLDA 2XY7A 2G8WA 4F5QA 3GILA 2HVHA 1T3NA 3L2RA 2O4IA 3TAFA 1UA1A 4TUSA 4UAZA 5IIMA 5SWMA 1B9DA 3MR2A 1KTQA 2IHNA 3VQ4A 1DGSA 1S6QA 3GQCA 3OYLA 4XUSA 5CY4A 4CGJA 3L8BA 4BXOB 5KFSA 3V1RA 5HROA 8ICEA 2BCQA 3MFIA 4MFFA 1WCLA 3RBDA 4K8XA 7ICJA 3LPTA 4RW7A 2JZBB 1J9AA 1U9LA 4Z6DA 3CM5A 3RMAA 1RTDA 1BCMA 2EHGA 1X9WA 1KFTA 4RPZA 3LANA 4I9QA 2FPKA 5KFIA 4LZDA 4M3YA 3DMJA 1ZQLA 3RJGA 9ICJA 2VWJA 2FPLA 2B5JA 4W5TA 4FVMA 3G6XA 1D8LA 2OPRA 1L3UA 3TAQA 3LDSA 4MEXA 4QZFA 1RT7A 4RPXA 1ZQNA 5J2AA 3I0SA 3Q8QB
chains in the Genus database with same CATH superfamily
3Q7CA 3BO2A 4LFCJ 1RZTA 4NLPA 4QYZK 3AFGA 3BZQA 5BXIA 1JLAA 4CHZA 5J2QA 3RMBA 1DGJA 2E88A 3JPPA 2KICA 5ETVA 3SUPA 4A8OA 1HBUB 2FZCB 2LYHA 1U4BA 4G1QA 3D2WA 3LVVA 3N7RC 2BJ9A 3L4BC 4EBEA 1V3RA 3S3OA 5CJ7A 2JX2A 3PFEA 2D6FC 4DUYJ 8ICMA 3P96A 4USHA 3AVNA 2W03A 4ID5B 4KHQA 4ANDA 3PKYA 3CSKA 2QL5B 3EDQB 5J2GA 3KKAC 3ISBA 4BHQA 3TABA 1S1TA 5CD4A 3ZNJ1 1NNDA 1J27A 2GS8A 2DH7A 2ZWPA 3OVNA 5DKWA 1FD8A 1RT2B 2ACYA 4RWXA 2AYBA 2JLGA 4Z4CA 3KJVB 2WCXA 4FVCA 3GONA 3MWPA 4JWMA 3D0PA 1RBTA 2B56A 1TE2A 2CJ9A 4DUZK 3I56S 4UAYA 4KN4A 1M5VC 1NZAA 1VBYA 1W2BM 5TKYA 1TYQB 1SWVA 4C7QA 1LWFA 4GO7X 2ZE2A 4QZ8A 3PJ9A 3MDAA 2ATLA 1Z2ZA 4YOUA 2WBMA 4CF2A 4DR7J 2VPWB 2MU2A 1L5UA 4FWRA 4ES1A 4BQLA 1FDAA 1FVQA 2OA8A 3ZETA 3IUCA 2E8AA 2WBRA 4EZ9A 4NLGA 3HOSA 2ITGA 1KKXA 1QQMA 2KKVA 1M1GA 4F3OA 2CQHA 3T1HJ 1TL3A 3CCZA 4DOCA 5E41A 2AF6A 1ED1A 5M1KA 1HLWA 4ITSA 2IRUA 1OUQA 4HHJA 4MK7A 4URGA 1YTAA 3AVGA 5ALRA 1NOZA 2HNDA 5I42A 3G71N 4LF7F 1HX1A 2J8SA 3F2BA 2JOQA 5AZIA 8ICLA 1R31A 2JEIA 3W61A 4J2DA 1RYSA 3MECB 7FD1A 3THYB 4HI2A 4YMOA 3DWLA 3NCQA 4ZCKA 3MGIA 4MFCA 2ZTCA 2FTRA 4ID1A 4NM1A 3MHYA 2UUCJ 4DV1J 2XCAA 4IXCA 3OJUA 3MMVA 8ICXA 3HPOA 4CIOA 2V2VA 2PC6A 3PV8A 3E58A 2BV3A 3DEEA 1KVKA 1J53A 2EAOA 4IS7A 4LFBK 2PEHA 4X4PA 3D2NA 2CVEA 2YKMA 1WDDA 3DLGA 4RX6A 3E1YA 4PH5A 3PIOL 5FLXO 3DRXA 3CD5A 5ALKA 1FF2A 1C20A 2MLYA 2WVFA 2WOMB 3MD3A 3B4MA 2FJVA 1IKWA 2I1QA 5DBAA 2IY5B 3M8QA 5E0OA 2F7TA 2P9UB 2D3O1 4USAA 2RKIA 2LQ8A 4ZLJA 3B82A 2BACA 1HNWJ 2KB2A 1YWXA 2VBXA 3M1VA 3GFKB 3SBMA 3I87A 5J0YA 1FXRA 3V9UA 4DU1A 1FD2A 4PPXA 4M3UA 3ET6B 5EE3A 2E1MC 3KKSA 4Y2RA 1SJFA 3K5LA 4FF1A 1VIXA 7ICQA 1FJGJ 4Y1DA 1ZQSA 4KX3A 4KY3A 3MXJA 1BIUA 2H9ZA 4FNIA 1TKDA 3LPEA 2QWMA 1VDHA 3ID8A 5K8MA 4KHYA 1RT1A 3FBFA 2G8VA 1HQUA 3TWZA 4FO0A 4ICAA 3G0ZA 2P9CA 3QYYA 5GAHI 5HMZA 4UAUA 3FBCA 1XJWB 1ZBLA 1HYSA 2PN6A 1UWBB 5BRHA 3NOCA 1F5AA 3V5RA 1HUZA 3K0JA 2Y9UA 2ZG6A 4TU7A 4IR9A 1S12A 4MHVA 4RNMA 9ICMA 2V69A 4JI4F 2D74B 1U2CA 1TP7A 3AVAA 4B3MJ 2YQ3A 2RP5A 2UUAF 2R2UA 2BJDA 2G1DA 7ICVA 1WSJA 4CD1A 4DDFA 3IXQA 4CLLA 4KGXB 4DPYA 3J7ZO 3CCTA 2A19A 4BWJA 1VSJA 3VGVA 2GX9A 5A0YA 4JS4A 4U6PA 2NCKL 3J80Y 4TUQA 3QICA 2XHWA 2F9TA 3NRZA 2AV5A 1XNQK 1DOQA 4IDHA 2A6OA 5E3CA 3KDNA 2OFHX 2QLBB 1LK5A 2XYPB 3K17A 3CCES 2W6KA 5FLXU 1WB9A 2RUGA 5L9NA 4X62K 1BVSA 3DYAB 3L6QA 2ODGA 4JV5J 2YNGA 2XSJA 3MR7A 5AJ3F 1BOTO 4C7YA 1P9YA 1FT8A 3W3DA 3F9MA 2O8BA 4BCAA 4Y34A 4PHPA 2V4RA 1RWXB 2CPFA 3KVGA 2BKOA 1CBKA 3CMES 1VC5A 1RDDA 1SI9A 2G2YA 2E5IA 2MQNA 4TN2A 4C8NA 4PL1A 4DXLA 4FOEA 1MW7A 2MHNA 2FYXA 2YKPA 5J2CA 2PMWA 3R1HA 3GSIA 2N3LA 4CBXA 1Q3VA 2AZ3A 3I0SB 3C2LA 2YMMA 1IJFB 1PUZA 1IBMK 3V6KA 9ICHA 5DBBA 3IG8A 1HRHA 2W6LA 2BPFA 1JLAB 1TR0A 3HD2A 4B8CA 3KXDA 1X2IA 4ALZA 3OTEA 1J5EF 4DR4K 1IBKK 3G9CA 3KKFA 3JQKA 2HNYB 4ILGB 4J2EA 4FJKA 1F9HA 4M5JA 4G1QB 4N7TA 8ICGA 2E8PA 3W8PA 3MZIA 1VLBA 4JK8A 4EFAC 2WVDA 5LY3A 4U7CA 3LPYA 4EYIB 5KFXA 3OLAA 1T9XA 4YMMA 2O8EA 1HI0P 1KVCA 2YXLA 1S1TB 2CPJA 2YQ0A 3Q2SC 4LBPA 4M04A 2XGPA 2PI5A 2GIRA 4WXWA 4OIXA 1GH8A 3G4SS 3ZDCA 2OLWA 4CLTA 3A3NB 2UVWA 1BE4A 5HVGA 1FNXH 2Q1LA 2EZXA 3BBBA 4N56A 5J2MA 9ICGA 4UBCA 3R5JB 3JPTA 3HFZB 1S5JA 3OXLA 1N56A 3KUEA 1JXEA 1LWFB 3I8BA 1C4CA 3BZKA 3HW8A 1SIWB 2FUG9 1SQFA 1F60B 2GVZA 3TZWA 3CMAS 4QR0A 3EVMA 5AQIA 3WKDA 5L38A 4DTXA 2ZM6J 2HQ3A 1T03B 3PW4A 4YEAA 1U0HA 4GVLA 3ZETB 2DNRA 2LMRA 1BPBA 4QWCA 2PFDA 3S6JA 4Y2KA 1FEEA 2KP7A 4O3OA 4X64F 4EX7A 4RPYA 2D9OA 2EDUA 4DR2K 2Z58B 2QC3A 5IV4A 3QGIA 4B3TK 4GKKK 1TL3B 2ZBCA 2PFPA 4R79A 3U6FA 3VAHA 2BW7A 2NREA 2IC3A 3F73A 4WFBQ 2CNNB 2VQEJ 3QETA 3BGFA 3KWGA 3Q8RB 5AKGA 2O3DA 1HKCA 5I42B 3ATUA 3OVSA 2OO4A 3M30A 3GU0A 2C2OB 3KLEB 2R7QA 1FTCA 1NGEA 2UU9J 3Q2TC 5AQQA 1XEZA 2V0NA 3CJQA 4PWUA 3CO9A 1TV9A 4F5OA 1EWQA 2CQPA 2ZIVA 4PZVA 1TL5A 3UKRA 1A6LA 1QS4A 2P9NA 5F8IA 1RAIB 1IXKA 4RUBA 3CCWA 2RIJA 2D0BA 3PR4A 1RG6A 4FPIA 3C95A 4UB8U 1LFPA 3IMQJ 2FJBB 2LU2A 1GLJO 1UW4A 5AXLA 5F2RA 5AQNA 2YKMB 3QGGA 5J0UA 3UN5A 4IRKA 5ALSA 1OY9A 3DLGB 2GW8A 4Y2IA 1SZPA 1VCTA 4OYIA 1UEVA 3MBYA 3Q24A 4P74A 2KHVA 4KHPJ 1F6TA 4PHAA 4DR6F 1IKWB 3PEHA 3FQLA 3M8QB 5BR9A 5F8MA 2DBBA 2HEKA 1W7AA 4M8LA 2M9NA 3JS6A 4P2FA 2GQ2A 2WAQD 4AQYK 1QVGM 2RKIB 1JLEA 3M1VB 1I3OB 1NK6A 2PO4A 5F41A 4XQ8A 3D1HA 3ZFVA 3ZNUA 1TL4A 3QT8A 2FF3B 3ZSZA 4HDGA 4P0QA 2A1JA 2FC9A 2BCSA 1OSDA 3WEEB 5B0GA 3ENHA 5IT0A 3EXCX 2XLKA 2W54A 2G0IA 2LQJA 1BO5O 4ECRA 4EI2A 4GO5X 1K6YA 1BHNA 4ZIWA 2EWHA 3NVVA 1NKEA 1XNSA 1RT1B 4NCGA 1OY8A 5E33A 2AQ4A 4R0EA 3N6NA 4BY9C 1U1QA 2FHJA 4BC4A 1YTUA 4DU4A 2JEFA 3QJPA 2DRBA 4CZKA 2RHKA 1WKLA 1HYSB 1TKZA 1NJIT 3OYAA 3QUQA 2W43A 4UAVA 2WB1D 2GO8A 2VB6A 3Q8LA 1AZSA 4D3HA 1ZQHA 1U8WA 4P9SA 5GADI 2GJFA 1DGKN 1D9DA 4FO6A 2VQFK 2VKQA 3ZZPA 2F1FA 1RJJA 5ETQA 7ICFA 4H0YB 5KG2A 2CQ3A 1K1SA 4NLBA 3ULEA 5LXRA 1ATNA 1S10A 3A0BU 4GFJA 4GXIA 4XA5A 2HAIA 3C8YA 3PJXA 3SBGA 4JYAK 4LJMA 2MQQA 2Q6CA 4K2XA 3UNGC 4NI2A 4WFNQ 4Z2XA 2X1FA 5A0YB 2X1AA 3KZXA 2YNIA 2IPOB 4NO7A 4FXWA 4O5CA 1ZQYA 3NGDA 5D4LA 2MZJA 3ZC4A 4JAXA 1FRKA 1LW0A 1NDLA 5BPCA 3B0YA 4EO8A 2BABA 1HHSA 1VS3A 5D0HA 3FCHA 4ZVGA 1CUKA 1ZM3A 2WSCC 3U1NA 2PMZD 2YNGB 2XSJB 5KAIU 4CIEA 2DT9A 2Z1GA 2PFNA 2PIIA 1JJ2R 1RAJA 2OPPA 5E3QA 5SZTA 3SBTA 5DG8A 5DO2A 3UXPA 1Q0NA 1VQKS 3LP1A 5LM7E 4NLRA 4WJ3B 3LYSA 4NEYA 5BOMA 2K7KA 3FJ2A 3RJHA 4KHUA 4C8MA 1WC3A 3H0PA 1UVMA 3H20A 2FQQB 3HM9A 4EP5A 2FDNA 4O3QA 4LRAA 5TZVA 4HCBA 2YKQA 3CQ8A 2HHXA 5CYMA 1S6UA 3OFHA 3NGIA 2ZFHA 3VPZA 5C10A 2YNFA 4BGAA 2K4EA 2E5SA 2RQ5A 3C2MA 5H9FJ 4UUWA 4YMEA 5HJYA 3CUNA 2G1HA 2ZGYA 1ZQXA 2AWZA 4NJ8A 5AKLA 2WZ1A 3NWGA 1J97A 3OTOF 1NH8A 2YKNA 1Q79A 3UW1A 5KFQA 3LO3A 5AT1B 4N41A 4HWIA 2F76X 1YQHA 3KKAA 2MY8A 2DR5A 3D66A 1KW4A 5DGBA 4BR7A 3WXLA 1J5OA 4WZQA 1HL6A 1BY9A 3QBXA 4KIAA 4DPWA 2W04A 4MIWA 3U27A 1WSIA 4LFAK 1BI4A 2OMOA 1IQZA 4ES3A 2RD5C 4FJGA 1ZQGA 3L9ZA 4ZDNA 1C2PA 1U1PA 1ZQCA 1NM1A 1AB8A 2W9BA 3W3SA 3QNNA 1S9GA 3BDPA 1NSKL 3KUGA 4M5KA 1VHIA 3CM6A 1BQNB 3QU5A 3L0QA 3QT6A 4R8UA 3RAQA 1Y9OA 5J2MB 4PCQA 2P6TA 2QSWA 1U48A 3H8WA 2XB2D 3OS2A 5EU7A 4JI5F 4KH5A 4PXEA 4MKVA 1WC4A 4M5HA 4FK4A 4LH5A 3HK2A 2W9CA 3RAXA 2C1EB 2GVZB 3QBCA 1C0MA 1S6OA 1Z1VA 3AVIA 1S9FA 2OUGA 2GEMA 2CNLB 1IBLF 2HHHF 3TZYA 3A8KA 1VSMA 2CJQA 1PYSB 1U0HB 3VEVA 3UIQA 4U96A 4P71A 4PY5A 2BW2A 2ZEJA 3KD5E 5ITHA 2Q43A 1OS5A 1GMVA 2V63A 5C15A 2P9IA 3RJIA 3V1QA 3GR1A 1SBRA 4MYTA 4JK7A 4C9DA 3BS5A 4WKRA 4DR1F 4FJHA 4ZPWR 1S1WA 2IC3B 5AI6A 3BQ0A 1NU4A 4W5RA 4RU9A 3WXJA 1TMMA 4ZVUB 2Q0RA 5A8KA 4LSZB 3ZDAA 3M30B 2HLTA 1RDUA 2DTUA 3LZJA 3TTFA 2JRZA 2K8BB 3HULA 4FKYA 4Y2TA 4IRCA 1YBAA 1R0CB 1V3ZA 1XMOK 3MMCA 4CFBA 1RWKB 2WB4A 4H4KC 5ETLA 3O5BA 3W2WB 3WT0A 2EFQA 2ZOGA 1JNRB 2F7VA 3VGMA 3M1FA 2ZIVB 1LNQA 3VAFA 3UKRB 1OY6A 5BN9A 3HD1A 1HBMA 3AD7C 3GBTA 2DIVA 4ELVA 1TUUA 4HYKA 3ZD8A 5ALJA 3G6EN 5HL7Q 4MQ3A 3N97B 3IM8A 2NPFA 3QWPA 1F5BA 2LBOA 2F65A 1RYUA 3MF5A 3HT3A 1SAZA 5EGYA 2QLJB 2DO4A 2F4VK 1KDHA 2O1PA 3MM5A 4RBUA 2MZ1A 1OKJA 2QMWA 3AVFA 5HOOA 3J7AP 1U6ZA 1K0VA 4WFZA 4CGGA 3V81B 1JXLA 4CESA 2O6KA 1RKIA 1ASWA 2V94A 2E1FA 4N8NA 2OZMA 4JI4J 4FW2A 2HBLA 2VUGA 3KFUF 1ZRNA 1JLEB 4KLEA 1OH5A 1RABB 3ONQA 1GFWB 1CJVA 2UUAJ 1MMNA 4ZA1A 3ZX3A 4P0QB 2HNZA 2A1JB 5K5MA 3VF0B 3A0IX 1WHXA 3R97A 5AHXA 1X5SA 2F8HA 3H25A 5BR8K 4MDBA 2CYYA 2QZ8A 4TSXA 2CADA 5IV3A 4DUZF 3K58A 4PXDA 2PKEA 4HEA9 2J5AA 2UZAA 1ZS6A 2BH1A 4LF4K 1OW5A 3PDNA 1UFWA 4Z37A 4RNNA 1RISA 2YPZA 3LAKA 1PCAA 1VRQC 1SIZA 4EX6A 1RSCA 4UBBA 1WYGA 4CLPA 7ICEA 1RHJB 3RR7A 2GNKA 2MKHA 3D54A 2EC0A 4DCPB 5AJ3J 4CJKA 5AQMA 1TKZB 2XIDA 4EENA 4PJ0U 2LSNA 4OYWA 3SUQA 2YY3A 3GPAA 2KJWA 3O3GA 4IH7A 5KT3A 5CZ1A 5MAOA 1AZSB 3ZD9A 4ZVFA 2BRLA 2L41A 5GIOA 3SSQA 1RI7A 3M7VA 4ZPDA 4N77A 5IZHA 2D0AA 2V4QA 3SI6A 2LYAA 3LK9A 2UXDJ 1Y97A 3B4DA 3CJ1A 2NS1B 4C3MA 1PJ6A 3PFOA 1VQ7S 3W65A 1NPKA 4CNYA 1NB7A 4KLQA 4FJIA 2RRNA 1PBUA 4ZS6A 4NI2B 3JYTA 2Y0SF 1TKXA 3CO0P 2EFNA 4ECZA 2DHXA 1ZD4A 1NJIO 2YNIB 1C0UA 1Y11A 2VBZA 1U6BA 1TFWA 3ZZOA 4GIBA 2F5GA 3E51A 5I3PA 2ZDPA 2BTFA 1NZ8A 1J5EJ 1BPZA 1WF0A 3KFWX 2HZCA 3I4PA 1LW0B 3SIPB 3FFKB 3C16B 1NRKA 1Q7LB 2GHVC 2P9SA 3FVYA 1U2RA 4OX6A 4PGXA 2M70A 2K2PA 1NK9A 2HLUA 1VQMN 5GAEP 2QIFA 3HOTA 3RSEA 2BQ3A 3FEXB 3H8JA 2HFZA 4LFBF 4K4YA 4ZOHC 2NXNA 4NZ7A 1UPHA 1ATSA 3P4UB 4M5NA 3EDRB 2ASDA 3LP1B 3D68A 4W4MA 5M2RA 4OQJA 3G8SA 3JSMA 3IRWP 2IVMA 3EWGA 2E3TA 1YI2N 1JX4A 2J0SD 3EKUA 3DXKA 4A62A 5AKYA 2KXHA 1NZBA 1RB0A 1HI1A 2L9WA 3N7SC 3H7IA 2O5DA 1QE1A 5T7LA 5ALOA 2A6MA 5EHHA 5DM7L 4FE3A 5CYMB 3RJFA 4I2PA 1QVGR 3WIUA 5DDPC 2DISA 1L6NA 4KLFA 5CP2A 4B17A 3CCUN 1KVJA 3NF9A 4HTUA 2CIMA 3VVTA 3KBBA 1WBBA 1KONA 4FZVA 2XVTA 3M32A 1VLYA 3QGPA 2KIVA 4J2BA 3O1LA 3TYTA 4NYFA 2DPIA 2RDJA 2M7SA 2UUBK 4H54A 1A77A 2YKNB 4BLGA 2IGIA 2W7PA 2DKXA 1N4LA 1UEUA 4WTYA 2WSFC 2DCUB 2Q3PA 5IIKA 2YWWA 2KMDA 2FPHX 4X64J 3EUB2 2HMPA 1L8LA 1YVUA 1J5OB 2ZH9A 4JKAA 2NUUG 4TU9A 4DG1A 1H3DA 3IAM9 4NLZA 3RB3A 1KBRA 4F92B 1TUWA 3BR8A 4QQBA 1T6CA 3E01A 1W2IA 3J81j 2W9BB 3PX4A 2HS0A 1S9GB 1I94K 2N7CA 3KK2A 3NGZA 3D6RA 3H45C 4R8UB 3U1MA 5F8GA 3PW7A 2LXUA 2XCPA 5CB1A 1V97A 4YQWA 2I6XA 3SLCA 3A5LC 5KRTA 3POTA 4CEQA 5EWFA 3AQOA 3FZLA 2J9CA 1MN7A 5AQFA 4W5QA 3OW2M 2W25A 2KI2A 1LV5A 2YHXA 4AILC 1XNQF 5JLHA 3GIMA 3TO8A 1VBXA 3CJSA 2MZRA 4NEZA 4JK1A 4X62F 5CR0A 2P9IB 1HUXA 4XH5A 2KZ3A 2X74A 4KQZA 3BS5B 1NSAA 9RUBA 4BXOA 4C4WA 4FK0A 1S1WB 2D3OR 1TFYA 5D0EA 5AFUA 4DR6J 3ZTPA 3UDCA 4CGFA 4CZGA 3SPZA 1UWAA 5AQTA 2B9XA 2DNZA 1ZOLA 5GVQA 3NMUA 2LYBA 4DOBA 4TQSA 3LM2A 4JI6K 1RBUA 2MQOA 1QH9A 2A3JA 4CZJA 1VQ5N 3LP0A 3A8YA 3D2SA 3SAGA 3MMCB 4EEKA 5L1IA 2QA1A 1GOCA 1K8KA 3OPKA 4PGYA 5L39A 3RJEA 3HKZC 1X6JA 4NMXA 2Y1RI 4C4SA 4XTTA 1Q81T 2F8KA 1JXBA 3Q8MA 1IBMF 1HBMB 1URNA 1LEOA 2EAMA 3EVOA 4BG9A 4X4TA 2W41A 3R5AA 3M6WA 1P7DA 4DOZA 3N4PA 1Q46A 1EX4A 2C2ZB 4DR4F 4IQWA 1IBKF 1LXJA 1QY7A 3E3XA 3MMAA 1DEJA 5J2JA 3N5FA 3T19A 2GWKA 4ZCIA 1CZ9A 1ZQFA 4UOGA 3OYHA 3M8WA 1RGIA 1N60A 3MM5B 1Y5NB 1BL3A 5AIBA 1F2GA 2X6SA 2QW9A 5K9FA 5HMXA 1RCOB 2GA7A 1Z4UA 1X7VA 2RRBA 1P8GA 1X3MA 1IN0A 3ZT1A 7ICRA 2VPXB 1CJVB 1XIQA 1HNXF 1DLOA 2VYPA 2HNZB 3GYNA 2YH1A 1FXXA 2BYCA 3U3GA 2DD8S 3GZ7A 3TUIC 3LALA 4K59A 2DQNB 1YVNA 2DEIA 4ZN1A 1JLCA 5CHCB 2W4DA 5LSLA 1WC6A 1VQPS 4AT1B 3SSRA 4UZBA 4O9MA 5ETKA 1MNEA 3GFHA 4JB3A 4YD2A 4B9LA 1YF5L 4J9MA 3OHBA 3P1GA 4ZOSA 2W7OA 3RG6A 4Y2SA 1EQ0A 4RQ5A 5CRXA 3EGWB 3K9KA 1VQ6S 4P7TA 1UT5A 1VQ9N 2FLNA 1JKHB 5AXKA 2MTLA 2YX6A 2EPIA 4KX5A 1TUYA 2KYZA 1MU2B 2FVQA 2VJ4A 3ZTOA 4DN9A 2ALZA 1OMSA 4ER8A 2YB1A 4DR2F 2M0NA 1PYOB 2LEBA 3ONNA 5J2FA 3RJKA 1REGX 4B3TF 4GKKF 2VDHA 3QUBA 3SQIA 4G1PA 2Z1HA 1BWFO 1U49A 1VRTA 3V4MA 1S6PA 4JMUA 1C1AA 2PXIA 3UKUA 2BOPA 4H0OA 2ZUDA 2MA1A 2YWGA 2MEWA 1N62A 3ZZTA 1WEXA 2WUSA 3AD9C 2XY8A 2K4HA 3JYTB 4V1Ak 5IXUA 1NDCA 4UB3A 4X4RA 4GV3A 2PI4A 2QXLA 4XPCA 1ITPA 4JI8K 2NV3A 1C0UB 5GAGU 3PTWA 3AVBA 5J0TA 5HMLA 1VLOA 4M1KA 2RU3A 4LQ9A 8ICPA 2FLOA 5DDQC 5ETOA 4JLHA 4NLSA 4DPXA 4U8VA 2P9SB 3OTOJ 4FCYA 4GVMA 1HKBA 2N4DA 5H9EK 5GTHU 2Z2MA 1WUAA 2ZQBA 5B5EU 3DDNA 1PVQA 2M4MA 2Z2YB 2W4PA 3RSEB 5JICA 3AD8C 4F5PA 4F26A 3UQ0A 1VOMA 3NASA 1QTNB 4CJPA 4FJ5A 4ISEA 4KH1B 2LPEA 3F44A 5KFKA 1HUOA 2ZZNA 1QUVA 3JSMB 2OTLS 1SKUB 4KT0C 3DXKB 4IFVA 2JFKA 4QIWC 1HNZF 2QEXS 4AQYF 1R0AA 2HDOA 5HNKA 7ICGA 1QE1B 5T7LB 2PZSA 3B6PA 1IJEB 2YTCA 4I2PB 2HOFA 4BE0A 1OH7A 4DSJA 4JI5J 3QJJA 3PMLA 4DTJA 2DWQA 3P39A 4EUVA 2BDUA 2QB1A 1B70B 2RPIA 2KRRA 3EN9A 4EYHB 4L6V3 1ASUA 3N6MA 2B4PA 4LY7A 1IBLJ 2HHHJ 5K8OA 1KVAA 3D2EA 4JK9A 3HZ6A 2AGPA 2ZXHA 3RBXA 3CG7A 3IV6A 4JKEA 1P9QC 1AUDA 4FF2A 1MMLA 3VERA 4CRXA 5L1LA 1U02A 2DFHA 3G25A 2QWOA 2ZH8A 1SXDA 1DHMA 2WRMA 3VAJA 2ATQA 4BR9A 3KMSA 4DG1B 3HHDA 4Z6FA 3DNCA 2GAGC 2FC8A 4WK3A 1D8YA 3M3ZA 3E01B 3DLRA 1NJWA 3G8QA 3SQ1A 4HKQA 2VQFF 4CJFA 8ICOA 3KK2B 1Q3UA 2F2AB 4P10A 4GV6A 2KG5A 8ICZA 2MKKA 1FFWB 4KLHA 1DTTA 1XR5A 2CXYA 3LH2S 4O23A 3TFRA 4JYAF 3WX4A 1FXLA 4H8KA 4PHTX 4IR1A 4QZAA 1XSPA 3LWMA 1FE0A 1HW9A 1MDUB 2E5HA 3POTB 9ICNA 4L8RB 4IKAA 1N6QA 5H1SV 4PG8A 3QEVA 1BCOA 1ZQ1C 1X31C 2CQIA 3AO2A 3NY0A 4ED5A 1YZ7A 3SDEA 2HVHA 3H3NO 3BF1A 2OEHA 4X4OA 1UA1A 4UAZA 1DGSA 2YWHA 3TADC 3OYLA 3ENAA 1NGFA 5CY4A 4X65K 4BXOB 5KFSA 3SMZA 1H73A 1KHWA 1GXLA 3MFIA 3O44A 2ZH4A 1U24A 2KVSA 3LPTA 5ALFA 3TKAA 1BUPA 1U9LA 4ISGA 1Y3KA 2EHGA 4O44B 1X9WA 2Y9HA 3CETA 3CCVN 2VJ5A 1D8BA 3LP0B 4BC2A 2X7IA 3MN5A 4TKTA 3LANA 1U1OA 1UPPA 2QWPA 4LZDA 2LA4A 5JVHQ 1X8DA 3AMZA 2QWNA 1ZQLA 3RJGA 4DUZJ 2GFFA 4FVMA 3AN1A 2RQKA 2MGZB 3ZEUA 3M6KA 1L3UA 3TAQA 4H0XB 3W5YA 4OZJA 2I7PA 2AEFA 4KMOB 4USTA 4RPXA 2RNEA 1ZQNA 4HI1A 5AK3A 2CG8A 3ILJA 3Q8QB 2B51A 2BUPA 3MMAB 3KJFB 3M8PB 3VF2A 1LKYA 3R6GB 4FXDA 4BRGA 5AKZA 2EX3A 5KFZA 2G5HB 3SV3A 4P2HA 4ECQA 2GUIA 4JI7K 1KTVA 2VKZG 3RWUA 1FDBA 3FFIA 1GMWA 4USUA 2FZKB 3T1YK 1Q81O 2P6RA 2CNOB 2VJVA 3M8SA 3GSDA 2CQGA 4CJSA 4WIIA 3MX2A 2WAQF 1GK8A 4LFAF 1VGYA 1Q7YT 2W9AA 1RUSA 2JXJA 2IS3A 5HRNA 3HPHA 4A5AA 3AUOA 4OZLA 1DLOB 3VF6A 3U1LA 4PPZA 2W2MP 3KJQB 4DV3K 2KIWA 1S5LU 2ILYA 3N4MB 2WF9A 4I64A 4RQ8A 4Y1CA 3GE9A 5CA7A 1RAHB 4DCJB 4JV2A 1ECWA 5AI8A 1Y3JA 3QIOA 2V8HA 4OKKA 1NU0A 1N33K 4Q5VA 2JJ4D 4KI4A 3CF5L 2P8IA 2V4JA 3EPIA 4ICLB 4QIEA 1PVPA 2ADCA 4DR3K 1SL0A 2NZCA 3I76A 1IG8A 1AROP 2LQBA 1BU6O 2I7NA 2EH9A 1C6VA 1WNEA 1KQSM 3TEGA 2G07A 2CPRA 2E6LA 4LFBJ 2ASMA 3RJMB 4U95A 5E3AA 2HRTA 2WB1F 2D3DA 1PZNA 4QW9A 2F3JA 2E8OA 3I9ZA 3PZPA 2BKEA 2WF5A 5AQJA 2WK4A 4TXSA 1WG1A 1VRTB 1U1LA 3CRXA 1S6PB 1TQLA 5B8HA 1RA7A 4YXJA 3UKUB 3NMAA 1YJTA 2HGLA 5DBCA 2VGMA 3P5TL 3QUTA 1V5VA 3HRGA 4A8KA 2FPMA 5HSPA 4N5SA 3CD7A 4N47A 1WOQA 2W7AA 1XMOF 1AT1B 1TZ0A 1S48A 3JQMA 3GIKA 1M5HA 1BPXA 4Z6EA 2AJFE 3A12A 3DXMA 4DBQA 4E8UA 2WVCA 1RBLA 4C98A 5C24A 3IAYA 4CERA 1OQ6A 1KC8T 5EUHA 1MSWD 3EVWA 2OPQA 1B9FA 3GL1A 3UVJA 2PMZF 1UEKA 4MIBA 4CM0A 2GOLA 3CIPA 1TUVA 1U26A 1GEHA 3H0LB 4ISFA 4CZCA 4H5TA 2GWSA 2P9EA 3BDEA 2V2QA 4DLGA 2F4VF 3S9HA 4M42A 2VASA 2UP1A 5HRPA 2E8MA 4M63A 7ICKA 1U0SA 2YMLA 2EFPA 2P2CB 4I68A 2BJ8A 4J9OA 3FZFA 3G71S 3VEWA 4FJMA 4DFKA 4IFVB 2VFRA 3OFFA 4ZK7M 2IAJB 1RQLA 5C7PA 2VJUA 1R0AB 4YOXA 4H4MB 4EU0A 4QS8A 3SV4A 2Q79A 1KSPA 2ZGZA 3HF5A 3H98A 3T7ZA 5BR8F 2A3ZA 4FJXA 3RMCA 4NWIA 4DCCA 2X1GA 2F8LA 3M2UA 3A8EA 1ZAWA 3UD5A 4FXVA 2QGFB 4YB6A 3O1BA 4NL5A 3C5GA 4JWNA 4IKFA 1IKXA 4PG6A 1QSYA 4LF4F 4E7LA 1FRLA 2D3UA 3AA4A 5F9NA 5ETSA 3TP2A 3D2EB 1VQNN 2BVZA 2BE2B 2ZOMA 3I5BA 2XNRA 1HWUA 3LL3A 2K06A 4RZRA 1ZQOA 3VCDA 4DTRA 4MO5A 4U9RA 1ZPVA 5HMWA 2QWLA 3QXGA 3OYKA 4A57A 4DL5A 3RUBL 4UTGA 3NVWA 4PUOA 1PK3A 5KG4A 2NUHA 2P9PA 4CF4A 1N2XA 4I2FA 5J2HA 3PSPA 2VBWA 4A4JA 3NEKA 1ZQUA 2ZJ8A 4F93B 2B9YA 4E0DA 1KEKA 1DQAA 2H5IB 1C0FA 5J0QA 3CCJN 5CCLA 3BREA 1VQ4N 3HP9A 4CEBA 2E5GA 1UVKA 3JPSA 1O0PA 2MKIA 1DTTB 5AI0A 4UARA 4G65A 5J1EA 5FPDA 3FZBA 2VFSA 3CNQP 4DS4A 4FLVA 1SWWA 2H3IA 1IBMJ 3AM9A 3D2FA 5I3UA 5EX5A 4WPAA 1U45A 4TYBA 2EKYA 1T0TV 3ZSQA 3SDEB 4DR4J 3PSTA 1HR0K 4QZBA 3MAQA 4J90A 1IBKJ 4W90B 1RU1A 4PG5A 3MCMA 1W97L 1P1LA 2XHCA 1F9FA 2NSBA 1X5TA 5FRMA 3DN9A 5DS7A 3NH1A 4NA1A 3CCQN 1SB3C 1UJ5A 4JD2A 2DGWA 3EE3A 4YOYA 5C12A 1OYDA 4F5NA 1GXTA 1IVZA 1BUXA 3FAHA 1UW9A 2J8AA 2XRIA 1RTIA 2ZKTA 8ICBA 4RUHA 3GOIA 4CO3A 3C19A 4H5VA 5KAFU 4CRJA 3G6VA 3LDPA 2GLEA 2NXCA 4TYAA 3R2CJ 3CD0A 4CI0B 1NPPA 1GAOA 2I9GA 1F9EB 4CT9A 3CT9A 7ICIA 4NYNA 3O5TB 3VR1A 4YNQA 2EG2A 1Z1ZA 1R6VA 2W2NP 3VQ5A 2OYQA 1XR7A 3ZEUB 1Q18A 3QINA 1MWQA 4YY3K 4NMLA 2RS8A 5DM6Q 4X4VA 2H3QA 5F9LA 2AEMA 4ZCLA 3FZMA 2ABYA 4MFAA 3THTA 4OZ2A 4JNEA 3BZCA 2XZTB 1VK3A 3D4JA 3SAHA 4ZPBA 3MR3A 2UUBF 3M6XA 2BZFA 1LKYB 4DX7A 1RBAA 4CFCA 2FF6A 3ZZUA 2KJ9A 2RU9A 5K20B 1XNRK 3FFIB 5HR7A 1M5OC 4DR2J 1GO3F 3RTVA 4B3TJ 1BQXA 4GKKJ 1ZBUA 3RU0A 3DAWA 3KG0A 1RTJA 3OYIA 2E66A 2W3SA 1EIYB 2NNWA 4ED6A 1R8CA 2UXBK 4YS2A 3VGUA 1L7NA 3D1OA 3ALYA 4NRTA 2OZSA 2JWLA 3PM9A 5G0RB 1I94F 2GX8A 4MK9A 2YNHA 3KTQA 1NHKL 2FBVA 2HK2A 2C22A 2ZBPA 2QO3A 3OS1A 2C3UA 1HNVA 1PKUA 3WXKA 1BPEA 3ID6A 1NOYA 3CC4N 4N76A 3VQ9A 4ZVQB 2QSFA 3L3CA 3K4GA 3TA1A 2VWKA 1VQON 1BHLA 1CJUA 3UNYA 2LQ5A 2FMQA 1DAXA 3BM7A 5GIPA 1YIJN 1Q7YO 3AVCA 2JV3A 4AP9A 1VISA 1O6XA 1AW0A 5AR0A 3BGUA 3QU7A 1I6JA 3AV9A 4DHYA 2NUBA 5I4MA 1JALA 3GR0A 2XZWA 2NXJA 4W98A 4F91B 3MEDA 4M7YA 5J29A 1VRUA 4RQNA 3M9MB 1T95A 2W2QP 5AQRA 3KOOA 4GC7A 4K4SA 4BRIA 3UN3A 1KAZA 3IS9A 3R7BB 1HNZJ 1RWMB 1EB0A 3AA5X 4AQYJ 5CYQA 4DX6A 3RB0A 4ED7A 3J7AN 4F0MA 4JI6F 2FMPA 2WVEA 4B9UA 1FNOA 4ETXA 2Y8YA 2P5GA 2UXCF 4AH9A 4ZVHA 4WCEL 3C1YA 1SQGA 2IOFA 3VQTA 1IM6A 2DGZA 1Q8IA 4ZHRA 2YQ1A 3L4IA 1RDAA 3DXMB 4BQZA 2E9TA 4OV1A 1RHRB 3PNIA 3A4TA 2JWNA 3M2RA 2V34A 1RWUA 4OMFG 1SKSA 1UKUA 3MEGA 3BKUA 3TAEA 4AHTA 2E1EA 2OPQB 2ZC4A 4DUTA 3K89A 3UVJB 2HZVA 1GOAA 7ICNA 1PO6A 1KQFB 4AYBD 2HRUA 3MAAA 3NCIA 3PW0A 4OX9K 2MJUA 3E2EA 2VG5A 5ADXA 4AUKA 3VENA 1JK9B 4PL7A 3BJYA 4FLXA 4OYOA 2M52A 2F3NA 5JVGL 3JAMY 8AT1B 4DL7A 2LKYA 1CZBA 1WG4A 4DSFA 2JNJA 3SYZA 2AJ4A 3V4IA 2VQFJ 5LJWA 3SCIE 2CQ4A 4FJ7A 4FSVA 1N32K 1KC8O 1C1CA 2BRKA 3CJ3A 2NQPA 3I5CA 4JKCA 2GMHA 1CG2A 4JYAJ 3I56N 4I2BA 3M2UB 4OX8A 3IR7B 2ZIXA 1L3KA 4CNQA 3PXGa 4QU6A 1IKXB 4LSNA 4NLTA 1M5KC 1HQEA 4LH4A 3TW0A 4LBHA 5GADP 5T41A 1X4HA 1YTYA 4RLEA 1RT6A 3HX9A 5ALVA 5AIAA 3ISCA 1ZM4A 3PLAA 3FGVA 3HPGA 1R27B 3TX0A 7ICHA 3QT5A 2G8IA 1X60A 2WFBA 2WF6A 4I6YA 1HARA 5KL1B 5GINA 1VQYA 1O51A 4PUOB 3J7A1 3GLJA 2FZGB 5IT9O 3CJTA 4C3LA 3B8HA 4FLZA 2P9PB 1KQSR 5G5GA 1QHAA 5E26A 1SH2A 1BDGA 2L5YA 1SV4A 3TFSA 3AL0B 3MPWA 2D41A 5C42A 4ZLLA 2FJXA 4FYWB 4Z4EA 2DHSA 2F77X 2JEGA 3FCVA 4FL9A 4FM2A 3SUOA 1B64A 3X1LB 5J1EB 3KHLA 4OFZA 5AQKA 1JLGA 1M5PC 1RDWX 2VPYB 2VFUA 2Q2RA 4TUPA 1FKOA 3NS7B 3TJ8A 2ZBIA 1O8BA 4B1WB 3F9KA 4JI8F 3QB0A 1HWKA 3RBEA 3D2FB 3JPRA 3IO1A 5I3UB 4R65A 2JH7A 2YX4A 4HR2A 3QFPA 4MEYA 5DQIA 2CXEA 2I5JA 1F1BB 1DFDA 3OYNA 1W25A 2H65B 4EGLA 4OKEA 3V9WA 1TK8A 3TADA 1X9XA 5AQZA 4BRKA 4OI3A 3OYBA 4I29A 1H7WA 4YN4A 4QOZB 2VA3A 3OA9A 3OBWA 4EBDA 1X9MA 4JD2B 2QKKA 3AA2A 1XO1A 2DGXA 3H5UA 4RQ0A 2XNQA 4KV8A 5D4NA 2VOOA 4CH7A 3K1ZA 4JI1K 1YVFA 4GW6A 2MJNA 1WWUA 2DGOA 4LFAJ 5M1NA 2FBTA 2IBOA 4DSIA 4NA3A 2IVOA 2OMLA 4CZMA 1LB2B 4DS5A 4MKAA 2FXUA 3V7LA 4I2EA 3MR5A 1SL2A 2BM0A 4AHVA 3NBPA 4DR7K 2VANA 1HBNA 2ZC3A 1RE1B 3JTNA 4PQUA 3MGJA 3DOLA 5EX3A 3A1YG 1IIPA 1PILA 3HJVA 1IKYA 3MCPA 2Z30B 1PVRA 2J4RA 2PFFB 1U1NA 3CJ9A 3C15A 2Q36A 1LKZA 4DLEA 1WHVA 2ATCB 2F1HA 4CE6A 1ZZNA 5FDLA 3GIJA 1JL2A 3AO4A 3WZ0A 4M47A 4CFAA 4Q45A 4PQAA 4QPXA 3DLLQ 3RH6A 2V52B 3H7HB 2R42A 1N54B 1QAYA 1ULRA 4C8ZA 2EC2A 4OLAA 4CJWA 2Y1JA 3ZDEA 3KWMA 4BS2A 1QQCA 5C5JA 2KH9A 3PRDA 1JIHA 3HHNB 2M88A 9ICLA 3A5OC 1A76A 1UTAA 4DFJA 1JRPA 4BC3A 1HKGA 1RTJB 4CJRA 4LF8K 4OI0A 5KT5A 2KE7A 4B9VA 2HYIB 2XO6A 3A2FA 2KW4A 1I51B 1RYRA 3K5PA 3KD1E 2OHFA 1ZZFA 3QFWA 2E5JA 1T9WA 3UD4P 2D4WA 1NKBA 1RHUB 2B8PA 2KHOA 1XMOJ 3PYGA 4Y6IA 1HNVB 5KFPA 2XMKA 3US5A 1F44A 4XH4A 5AK4A 3OXFA 4OO1J 3BSCA 1VMBA 3N5BA 3GJQB 2EEYA 3CE8A 2W40A 4IC9A 2ZJQQ 2W3RA 4KE5A 5GAHU 3CERA 4UQGA 2OAUA 3WK4A 1NM2A 3CCEN 5HRSA 3FCWA 3TNVA 2E4LA 4CJLA 1RWVB 1FW6A 1Y00A 3D6TB 3A3OB 1HBOB 2KXFA 2F4VJ 4FZZA 3CFOA 4J9NA 5KFVA 3NAHA 1QAJA 3VQCA 3MEDB 4X65F 1VRUB 4CW7B 2KNJA 1A5XA 4IL6U 3U9DA 5J8YC 1WLJA 3IS9B 1B7FA 4OJHA 5KG5A 5CYQB 2CWKA 3MCNA 1B7YB 4UB4A 1N88A 1G3OA 1NMNA 1S9EA 2HPUA 2LDIA 4KHNA 5JMNA 4BR2A 4I1TA 1M90T 4WFYA 3I28A 5HROB 3CFPA 4LF5K 3C21A 1WI8A 3CDWA 1BNOA 3KD3A 3AB2B 4NE9C 3U9ZA 2FVSA 3ORYA 2IA0A 2O01C 2BXJA 1UJ6A 1YJ7A 1KNZA 5C0YA 4IOAL 4EMDA 1SVDA 2NRWA 3U4LA 2QRRA 5I9EB 2MKYA 4LF4J 3TVYA 5A6WA 3M2RB 2LQ9A 1TMJA 3BS9A 1PC4A 4HH1A 4WTOB 3OTQA 4WF9L 3MEGB 3PIPQ 1S3XA 1IR2A 3OYFA 4FJ9A 1VK0A 3TR8A 2HWTA 2E7VA 5E5NA 3Q0AA 1MG7A 1FFSB 2MHEA 1HJRA 3MAAB 1TELA 2F96A 3LUYA 1T3OA 4DCOB 4RNOA 1GMWD 1N63A 2VG5B 1PYTA 4QIGA 4B3MK 2R7SA 4JI7F 1B99A 1LW2A 4GKJK 5J0OA 1RM6C 3NAIA 2D0OA 3V1OA 3T1YF 2ZHAA 3NTUA 1N5TA 2J9DE 4FBTA 3MPDA 1RHMB 2G8KA 3N4WA 5D3GA 4QYRA 2BGGA 5J0WA 3VEZA 1O08A 3AJ2A 3SCJE 3DLHA 4C0ZA 1RAEB 3IWNC 3V72A 1KR4A 5KFHA 2LP4A 3QLHB 4DV3F 4C80A 3OBYA 3O2IA 2F9DA 2AGOA 3BYPA 3J81O 2GJIA 4LSNB 1WNSA 1SKWA 3G6ES 1K9MO 1HQEB 2GAHC 4ELUA 1N33F 4QU7A 1EETB 2YN4A 1RT6B 3HJFA 1X66A 1QZ6A 4A2BA 3G6YA 3Q23A 4DR3F 1UVJA 1ICEB 2BJ7A 2HQGA 4Y65A 3VVUA 2W8LA 2RQ4A 3NAEA 1S0NA 4ECYA 5B08A 1TGOA 3WX8A 4PKGA 2CPXA 1X0FA 1FCAA 4O4RA 4GC6A 3LWLA 2FJDB 5L1JA 3NWRA 3L4QA 3R6MA 1UCVA 2B0CA 1EP4A 3CIZA 4FYYB 5C42B 1WKKA 3MR6A 4OJOA 4I27A 1UWBA 3CPEA 2SXLA 1LFWA 5BPLA 2WF8A 3BQ7A 1QSLA 4YDXA 1X3NA 3O3FA 4R63A 1TU0B 4MLEA 1O13A 3ZTSA 3ZTQA 2XI9A 1N36K 5MLCV 2RQCA 4WFAL 2J9EA 1JLGB 3R5GA 3OV7A 3AB4B 3QEWA 1FKOB 2BJEA 1T9YA 2KM8C 4J2AA 4U67L 5D4PA 1ZQEA 1B0PA 2Y0SD 4PHDA 1JJHA 2I5JB 4BRQA 3SMVA 1WDTA 3LDOA 1EJ7L 4BROA 4FLWA 3BN4A 2UUBJ 4A8SA 3IBWA 1NZPA 3HI9A 4P4PA 3MD1A 2W4CA 3AVHA 4P6QA 1VYAA 4K41A 3SJHA 2DGTA 3CJ7A 2H3EB 5AE1A 4KGZB 4H5RA 2XICA 1IO2A 4KV8B 3QMLA 3DYAA 3HVRA 4HT5A 3D0HE 5LSRA 3QT7A 4FM0A 4WQ4C 4C3KA 4V19S 2XS7A 1LCUA 4DU3A 4FJJA 4NWBA 1N8RT 2DKOB 5RUBA 2CNKB 4ZJOA 3OYCA 1G99A 4GXKA 8ICCA 4QZ9A 5HVHA 1MWKA 3QU4A 5D0RA 4DTUA 2ASYA 2X78A 1HBNB 1FFVA 9ICAA 4PQUB 3DOLB 3O4NA 1MA9B 5AQOA 1NGCA 2POKA 2XS2A 2QLWA 4QZEA 3H40A 2R7TA 1IKYB 3KLHB 7ICMA 2DTJA 2ZJ5A 3R27A 1VC0A 3DLKA 2EBGA 4F8RA 1OO0B 2BCRA 4IJAA 3QNOA 3D3BJ 1VQMS 1B3TA 3BO3A 2D1CA 1H2TZ 1TVRA 3CDBA 1N5SA 3WKBA 1C1BB 1ZTTA 2QWRA 7ICTA 1Q82T 2BMBA 2J7UA 1RAGB 4J8FA 3EPGA 5BRDA 2QTWA 3ZLJA 3AEVA 2HNYA 4UY8T 4OYBA 1E4FT 4JKGA 4P2SA 4OPHA 3V6JA 3C23A 3BEGB 4ZVEA 1YI2S 5CHGA 1L7OA 4HHUA 4GRSA 3FK4A 2Q6BA 3NNCA 2ZKUA 1ZQDA 3UMGA 4UB2A 4AHCA 3MN6A 2FC0A 1CLFA 2B9EA 5D4OA 4BRFA 1J54A 2D5RA 5DETA 4NLNA 4JI6J 1HLUA 4Y2AA 4RTFD 2CPEA 1WF1A 1SGGA 3MC1A 3LOUA 4URSA 5JXSA 2PGCA 5BN8A 3M7DA 1NKCA 1S1UA 4KITB 4QJFB 1QJHA 2RF2A 3KK1B 3IG1A 4CEAA 5M1PA 3IBPA 3DM2A 4RQ1A 4F4YA 3K5MA 2QYCA 2O66A 5JU5A 1X5PA 3K2PA 3O1WA 3GP9A 1DTQA 3UB5A 2DNOA 3NCPA 4OYZA 4QOTA 3NDKA 2XSFA 2QKBA 4J9VA 1HR0F 3OFGA 3QUCA 4CE9A 2IRXA 1UZHA 2MZTA 1T03A 2DH9A 5F8HA 4CQ1A 2XMAA 3NGSA 3IP4B 5GADU 4NLYA 2WHEA 2D1KA 5LOQA 2NRVA 2BKPA 4H03B 1T9VA 2KZZA 2QM1A 3GE1A 3ISND 1WC0A 5U47A 4YHHK 4NB4A 2YWFA 3T79A 3MURP 1S9EB 3UR0A 3WNFA 2HWIA 3HSZA 2O8DA 4I6MA 2DFEA 4DZDA 2DPNA 1KFDA 1E3MA 2NRHA 5C2DA 4K8ZA 4KB7A 4K4TA 1HD1A 2R2SA 3R6LB 1N5VA 2YHYA 2CKWA 1ITGA 5KFWA 1A0OB 4UQTA 2F8MA 3BPDA 1OIAA 5B0DA 3KLEA 2XY6A 2HVDA 2UYTA 2LDYA 4YY3F 5HMYA 2OFGX 2Z4PA 3D1QA 3FZKA 2NYHA 3NGTA 1ZXIA 1ZQIA 2FB0A 2PAVA 4AXIA 4NOHA 1LXNA 4NV0A 4NLWA 1O1WA 3PMNA 2Z1IA 4XK8C 9ICVA 3CJCA 4CJUA 3A8JA 3DHXA 1CI4A 3TZZA 4WXOA 1JJ2M 1OVQA 1Q8BA 1HHQA 4I2GA 2BDPA 2PMZC 3KJNB 1XNRF 5FP0A 2HBJA 4KFBA 5AKKA 3BGLA 1LW2B 1YRTA 2PFOA 5L8RC 5AKJA 4OI2A 1V38A 1VQ5S 1KOOA 2KRBA 2G08A 3VETA 2W8KA 5AQHA 5D3GB 3HVAA 5CR4A 3O6QA 3HLUA 5FD1A 9ICEA 4BC5A 3R5CA 2HMIA 2AD9A 2UXBF 3F2CA 1WSVA 1HI8A 1Y10A 3CJKA 2E20A 2EFOA 3T6JA 1FEZA 3RB4A 2A6AA 3VQ7A 1U1MA 3F2DA 1ZM9A 1N5YA 4RT3A 2ZJAA 4EBCA 1CSJA 3IM1A 3OL8A 3ICLA 1N61A 1GX5A 1GTHA 1ROFA 4JI8J 3WEEA 2RAQA 2PE8A 3UXNA 1SPBP 1COKA 2F8TA 1RCXB 2I38A 4KHMA 3IC1A 4NLQA 4LUBA 5ALIA 5KOXA 1ZOTA 2LMIA 3GV7B 3KDOA 2DB1A 5IQ6A 1VC6A 4ZMMA 4IOCQ 5H9EJ 3HSJA 3M6GA 3DRRA 3H8MA 1J2VA 2JC0A 4K5RA 4ILMA 4H5WA 3HRDD 1LK7A 4K4XA 4LD0A 3PYEA 1BISA 3MPYA 5LMNK 2K8CB 4YFKA 1NBWA 3MABA 1EP4B 1CZAN 3P49B 1D8ZA 2IDLA 1V9PA 5CQGA 4JKFA 1YXQA 5LL6Z 1V3SA 2MQ8A 3BPSP 3O6WA 3M9OB 3EX7B 3VMFB 2FI1A 1B0TA 5GAGI 3MPUB 4ZP7A 3HHEA 1VSHA 4AHSA 4PABA 3H5XA 5JTIA 5IINA 3DXSX 1MQ2A 1WJ9A 3JTPA 2YY6A 1DK2A 1FXDA 4L73A 4KLTA 1KQKA 1D09B 2GHPA 4UASA 1YJRA 1Z4NA 3C29A 2P66A 1EKRA 3M05A 3H90A 2FHOB 1Q4RA 2H4WB 3LVWA 4O3NA 3K8WA 5F3ZA 4CBUA 2ASJA 1S57A 5LL6d 3IFEA 2GBZA 2ZIUA 2K7JA 4DPOA 3PRBA 1N34K 5DJBA 4OX9F 3T9ZA 1QDUB 2JEJA 4OI6A 9ICUA 1BA1A 5HO4A 5J1PA 4OZNA 4P73A 3WK8A 3OVAA 4US8A 4O5EA 2J7WA 1RWPB 1ZAXA 4MF2A 3I31A 4BX9C 4NA2A 3MTKA 2I2YA 1WKJA 1SJ4P 2CRLA 1LWXA 1NSPA 4CLSA 1XMQJ 5KAKA 5B0FA 4YDUC 2ZNYA 2IIHA 5JS2A 2MMYA 4M5LA 1N32F 3D5MA 2HGMA 4DV0J 1VSIA 4LF9K 5KFDA 5G5HA 1ZBFA 4EHTA 4DCHA 5ETMA 3BBCA 5K4LA 3NFAA 3DLKB 3HHLA 3HSCA 5C2FA 3FZHA 2CJKA 5L1MA 3N01A 4L75A 1S1XA 2BANA 5AM4A 2PDAA 1TVRB 1UT8A 3FSYA 4BRLA 1N8RO 3VQAA 2HQIA 2L48A 1N5QA 2NPIA 3OTCA 2DXFA 4IO1A 4LT6A 4C8KA 2HQFA 2ISPA 2LU1A 4JKGB 7ICSA 2GQCA 3NOGA 2GELA 1IV8A 4FWNA 5AKEA 1C4AA 2FBYA 3N4QA 5A2QO 4X65J 5I3QA 1KRPA 3QYPA 2VZ9A 2HFVA 1UETA 1DRZA 1NHUA 4G3IA 3GFYA 3AY9A 3MM9A 1EARA 1X4DA 4KREA 4NZ0A 4O3MA 4AHRA 3ILIA 2YQEA 2KXNB 1Q82O 4WFBL 2Y9TA 4RNFA 1HNXK 1V85A 1S1UB 1V9OA 4QWAA 1XI1A 1HFEL 4HT7A 2RF2B 3UR3C 1OVYA 3IG1B 1BQNA 4YMNA 2YMQA 3DM2B 2XYGB 3Q7BA 4ZKAA 3CNHA 4YCXA 4AL6A 2B4UA 4QR2A 1YUWA 2IVYA 2Y3YA 4OCZA 3H5SA 4GLXA 3ZSYA 1DTQB 4E3SA 3M2VA 3OR1A 4US9A 8ICWA 4XDCA 4B1ZA 4F2RA 8ICRA 4WBFA 2Q0UA 2AEJA 2K3KA 5SUHA 4C1NK 3IAS9 4Y0FA 2G8WA 1KDNA 2R3VA 4F5QA 4NL9C 3BSAA 4I69A 4JI7J 3L2RA 3E9LA 4K4VA 4QR1A 3TAFA 1GLCG 1QAXA 4TUSA 5SWMA 5IIMA 1B9DA 2VICA 3CJ5A 4JI1F 2IHNA 5THWA 3MN9A 3Q8YA 3GB0A 3SK3A 3GQCA 5AE3A 4CGJA 4A8XA 1UAWA 2O8DB 3V1RA 2RE2A 4I6MB 2C42A 2RS2A 4MN4C 2BCQA 4MFFA 3CCSN 2IOFK 4FP9A 1WCLA 4DV3J 2GMLA 3RBDA 2KJVA 2ZVSA 4KRWA 2ZJPL 4K4UA 1LOTB 2GVDA 1OYEA 1AYEA 4RW7A 1VQ8N 1J9AA 4DR7F 4RO0A 1BCMA 4FDFA 2VC0A 2IJRA 3CMQA 4U7UK 2FPKA 5KFIA 4M3YA 1M1KT 1N33J 2ZH1A 3EMTA 1RP5A 2XI2A 5FPEA 3W2WA 2FSJA 4DR3J 4W5TA 3DDHA 3QDKA 3NMRA 3GZFA 1D8LA 2AX1A 2OPRA 4WP3A 4BRHA 2HRYA 3SCKE 2XI3A 1CQNA 3IR6B 3GJTB 3LDSA 5A2QU 1Q86T 4AYBF 4MEXA 2BEFA 2P6SA 2QX0A 3CJAA 1RT7A 3K0SA 5J2AA 1SCJB 2IOHA 3R7NB 9ATCB 2UXDK 4KFBB 2BPCA 2DGQA 4ETZA 1SZHA 3CCVS 1AFIA 3D0GE 4Z0UA 4CJ4A 3IN5A 3SCXA 1WEYA 2YHAA 1QUPA 2XMWA 2LI6A 3M1YA 5KTQA 4M5GA 1Y4ZB 1YRXA 1ZQQA 3ELHA 4LF8F 3BKFA 2HMIB 1HQ2A 3V81A 4YORA 1X42A 1KLMA 5A8RA 3MPVA 5DB7A 3CJKB 4J9QA 4KLGA 2E1ZA 1MMDA 1FFUA 2ROPA 1N5YB 4KHWA 3H2LA 2G4BA 2BUNA 3KHGA 5G4DA 2BR0A 5HRRA 3VA3A 2AHOB 3AVJA 1BNPA 3EZ5A 1YJ9N 3Q8KA 4J5OA 5ALZA 1L3VA 1TL7A 4A8QA 1BXNA 4OL8A 2CQ2A 2DY1A 3M8ZA 2ZF5O 4WFNL 3NLCA 2FDRA 4DPUA 7ICPA 3QIDA 3H1VX 3CD6N 1MWYA 4CM2A 2YKOA 1X4FA 3DRRB 1YJNN 3KNAA 2KFNA 3ZZZA 2KJ8A 1WG8A 2LXIA 4V19X 3OFEA 4IDKA 3J7YI 3QEAZ 2KD1A 4WU3A 1OJ4A 1X4AA 4ECXA 2VU5A 4MTPA 4Y2YA 2HOIA 4BRCA 2BPGA 3C2PA 5T7BA 5B0BA 2XULA 1Q8KA 4CH0S 1L8OA 3GMGA 3RBZA 2AJ0A 1VSKA 4DMNA 1FJEB 5FRNA 2LM1A 3KYLA 4PRFA 3GV8B 5KG1A 8RUCA 4RL1A 2VV5A 3W2VA 4LF5F 1PG5B 5CZXA 5TKWA 4CGZA 4NY8A 3G82A 3NKYA 4USJC 1P8ZA 4FZXC 5DB9A 3OPXA 2E1PA 4WQ5A 4A8WA 2XEXA 1HHTP 4L3KA 1F5SA 3DGVA 1Y0HA 3AQEA 1FI4A 1ZBTA 3HBTA 3B6BA 2R7YA 4B3SK 2MKJA 9ICTA 4JRPA 2XQCA 2CA9A 3BF4A 3JPOA 1E4GT 2I9SA 4C0HA 3UI3A 3RRHA 2MKCA 3BSNA 3C16A 2ZIUB 1VHXA 3LM9A 3DI6A 4MJKA 3F5EA 2KQ2A 5BYRA 2ACMA 2KJ5A 4B3MF 2IM3A 1E6VA 3U02A 4GKJF 4DV6K 3EEQA 2CPIA 5KL8B 1PK1A 1L7PA 2RDDA 3K7RA 1FKAF 5LT5A 2OEMA 2F44A 2XGQA 1Y5IB 1YK9A 3HWTA 1H72C 2KKZA 1JN3A 1RU2A 4XO0A 1NI3A 4DTSA 2VPZB 2D8CA 2KDOA 1YDLA 1IKVA 2W1BA 4Z4IA 3HHLB 3PY8A 2OIHA 2I8EA 1S1XB 2K4IA 2BANB 4OGCA 5KGWA 1RT4B 1G2EA 1UVIA 4CGIA 1DK3A 5KFLA 1HR0J 3PSIA 3AVLA 1N48A 3OGUA 3W64A 4RUAA 4DTMA 2YJEA 2Q66A 4K42A 3HVTA 3FE1A 4X2BA 1RBSA 3MEKA 3SQGB 4IWVA 3NP5A 2OH2A 2PSZA 4FWPA 2R2TA 3N6LA 3TOQA 3UCGA 5B0AA 3OLBA 3MM9B 2E2QA 3CJBA 2ITMA 2G06A 1NLKL 5HBMA 1QVFM 2YPYA 4E1NA 4RW9A 2A18A 1AXQA 3EYZA 1WG5A 3MUMP 1UCNA 1S79A 1YT3A 1P6TA 4O0JA 4OD0A 1RLDA 4JI0K 1N36F 5D49A 4GVEA 2ZWHA 1WORA 4LF7J 1K0TA 4IJNA 2ASLA 2RQMA 1VQNS 3SI8A 4KLUA 3FEZA 4ZJQA 4ILJA 2VA8A 4YY3J 5GMKa 4TNOA 3L4PA 3ICXA 3RJJA 4K4HA 2RMLA 3CP8A 3M2VB 5IFMA 3OR1B 1EKEA 3LPUA 5JMVA 1RWWB 3BO4A 1L3SA 3RH5A 2DGUA 1GLLO 1BWVA 2O4GA 5J0SA 3UDVA 3B8AX 1RXWA 3BBFA 5ADXH 3QU9A 4G9BA 3UPFA 5D15A 2ZTDA 1Q78A