3TAPA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-3) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tapA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tapA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tapA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tapA01
1WLJA 5CY4A 4Y1CA 4AHCA 2EX3A 3QETA 4M3TA 3KKRA 3RMCA 1ZBUA 7ICLA 5J0TA 4WE1A 4JV0A 4FS1A 4PUOA 3DOLA 3KJVA 3HJFA 3SI8A 4O0IA 1HUOA 1RDDA 4GXJA 2I5JA 4F5NA 3OHAA 2HHSA 4FK4A 2KFNA 5KFEA 4KMUA 4EP5A 3UXNA 4R66A 4MFFA 5J2QA 1T8EA 1IKYA 3ZT1A 5KG1A 1RTHA 4FJJA 4F4WA 3ISBA 4B9MA 2V4QA 2OPQA 1RBRA 4CIFA 4CIEA 1ZBIA 3SV3A 2NRTA 4E89A 3TQ1A 3M9NB 2ALZA 3ALYA 2PI5A 3V9ZA 4IR9A 4J9PA 3NTUA 4O44A 5HRRA 4OPKA 4J9QA 1BIUA 2YHBA 1HNVA 4KFBA 3FDSA 4KLGA 2ZD1A 1NKCA 3IAYA 4QW8A 2X78A 1RBUA 2HHXA 3C1ZA 2G8KA 2DY4A 2H5XA 5J2IA 3QEIA 1KFSA 3UIQA 3K4GA 1VSEA 3QERA 2XGQA 5JUMA 2HHUA 1EX4A 3AVKA 3VA3A 3HPHA 3WNGA 2XY6A 5KG4A 4QWEA 2YNGA 4YXMA 1RBSA 3RTVA 4DFPA 2HVIA 1VSDA 4CF9A 2OZMA 4DFMA 4DTXA 9ICKA 4QWAA 3VQQA 5I3UA 1S1XA 1ZQKA 1J54A 4M9GA 1QSSA 4CECA 3CFRA 1CZ9A 3C2LA 1LB2B 4RNOA 4KB1A 4DFJA 4UAZA 1JLCA 2ZTEA 3K57A 3RJJA 3GV8B 2R8GA 2FBTA 2V9WA 3H8JA 3CG7A 3PW5A 2XCAA 2Z1HA 3TAEA 4DTNA 3MXMA 1WSHA 1ZQEA 2BDPA 4NLNA 3HXMA 2YV0X 4KAZA 2BE2A 4CF8A 1MC8A 4BGDA 2YKMA 3OYBA 4CERA 3LP3A 4CGDA 2ZTDA 4KHWA 2KW4A 2DFHA 3LANA 4Z6CA 5DGAA 1ZQDA 2XCPA 3CQ8A 1TL1A 2RPIA 4IFYA 2Q3SA 4QZBA 3HP6A 3ZSYA 4EZ6A 5KFDA 4DLEA 4MQ3A 4YQWA 4BE1A 3AVJA 7ICTA 3QIPA 4CF2A 5EWFA 3DOKA 3C1YA 4HYKA 4CGIA 5DKWA 3RJGA 2O4GA 4C8NA 1QLNA 1XSLA 4CJ5A 4KITB 4LZDA 4PHAA 4FJKA 4J9KA 1ZJMA 5KFUA 4CHQA 3T5KA 2YHAA 1T4GA 2NRVA 4F4ZA 1FK9A 2ZTCA 4J9NA 1IKWA 5D3GA 1KLMA 4I2HA 1NK0A 3MR3A 4DF8A 3CM5A 1XWLA 4IBNA 4CJPA 2QKBA 3QNOA 2F1HA 3ZT4A 3NH0A 1XHXA 4DQPA 3GIJA 1U45A 3UQ2A 3BQTA 3QLHA 3E2EA 2E6MA 5FRMA 1JXLA 1S1VA 1S6QA 2G8UA 1QTMA 4F2SA 3SQ4A 4RQ8A 4HTUA 2FMPA 3S3MA 5KT3A 4CK3A 5DLFA 3AVNA 4HHTA 4F8RA 3OJSA 1LW2A 2BKEA 4OLBA 2PYJA 2NUBA 4ECSA 4DS4A 2J6TA 5SWMA 5HROA 4ED8A 4RPZA 4Z4EA 5CP2A 5D49A 4J9MA 1ZQRA 4OJRA 4F3OA 5KFLA 4CF0A 4YR2A 3MEDA 4BDPA 1YTUA 1D5AA 3M8PA 1U4BA 3DRRA 4CFDA 3PY8A 3TFSA 2FPKA 3L2UA 4CE9A 3CFOA 5BOLA 3AVHA 4RQ6A 2A1RA 5SZTA 1WNSA 3H4BA 4TQSA 3BDPA 1GOAA 3OYMA 4M6WA 2BPGA 3OGUA 3SYZA 2D5RA 4E1MA 3C2MA 1ZQAA 5IIJA 4CEZA 3ULDA 3RMDA 1X9SA 4M0AA 1QSLA 1RTIA 4RW4A 3SUQA 4BXOA 9ICNA 1S77D 3VQ6A 3G6VA 2C2DA 8ICMA 4ED6A 2R8JA 2ZUDA 4HCBA 3HPGA 2ZQBA 4DWIA 2EHGA 2OPPA 5KFQA 3NGIA 2A1JB 2ASLA 3H8SA 7ICQA 2IMWP 4FLTA 1BPBA 3Q8QB 1RDCA 1LWFA 4UB3A 2NRXA 3TR8A 4DSFA 2PYLA 3SUNA 2KZZA 5HP4A 1WCNA 2F1JA 2RDIA 3I0RA 4DU1A 1DTTA 4YMOA 3KHLA 4J2AA 3NGYA 3Q8LA 2BCUA 3LZJA 4JRQA 1G15A 1X9WA 9ICVA 3K5NA 5L1JA 3IS9A 5L9XA 4NLKA 3VQDA 3V6HA 8ICAA 4RNMA 4F93B 3LP0A 3M8QA 4BDZA 3RH6A 4UAWA 1S0NA 4F91B 3SCXA 3O4NA 1S1TA 4IR1A 4K8ZA 5F9LA 4DOCA 3LZIA 4HUFA 4FLWA 5KFCA 4QW9A 1YT3A 3KTQA 3GV7B 4O4GA 1RXWA 4YCXA 1J53A 3PV8A 1JXBA 3NH1A 4UB2A 2DFEA 5J0WA 3NF7A 1TKDA 4KLHA 3EPGA 4R64A 1NOZA 1D8LA 4YMMA 4QZ9A 2C2RA 4M9LA 1ZQWA 5L1LA 3MEGA 4EYIB 3A2FA 4Q43A 2W8LA 5KFIA 3AVGA 3SV4A 3V72A 2JEJA 1RCHA 3OYLA 4H8KA 4FW2A 1T03A 1HPZA 3QEXA 4M3YA 3RJKA 1SKRA 4CEAA 4UB4A 4F2RA 4J2EA 1RNHA 2VA8A 2IOCA 4KKOA 1KVCA 4P4OA 4N47A 1XS9D 2KTQA 3LALA 4DL7A 4CJVA 4K4HA 1XU4A 5C42A 4JV1A 4DL2A 3V7JA 2FLPA 5CYMA 1TGOA 1SV5A 4NYFA 2FBXA 3RRGA 3RRHA 4CJ4A 3DI6A 3I8DA 1JIHA 2DTUA 5EU7A 4M9NA 4KLMA 2W9BA 5HMMA 1ZQYA 3KD1E 4PHDA 3KLHA 3CFPA 3C94A 3TAMA 1VSIA 8ICBA 5DBAA 2VWKA 4J2BA 4ID1A 3LK9A 1ZQXA 4ELVA 2IS3A 3AVMA 3IRXA 4OGCA 2FPLA 4R8UB 2W9BB 2I9GA 4IRCA 3VQBA 3ZT0A 1U04A 1BPEA 3DLGA 4UBBA 4KLFA 8ICFA 2WTFA 3SJJA 3BQ1A 2C22A 1ZQZA 4EZ9A 5J2DA 4DQIA 5J0QA 2BHNA 1ZQHA 3IM1A 3VQ4A 2B5JA 9ICGA 3NAEA 4UBCA 4KPYA 1VSJA 2O4IA 2XGPA 1EXQA 5EWEA 4QCLA 3QE9Y 3T5JA 2IBKA 4GVMA 1MQ2A 4E19A 5DDMA 2X74A 1WSFA 3IG1A 2JEFA 3N97B 4DTJA 1SL2A 2FLNA 3OYFA 8ICWA 5KT5A 3PW4A 5KG6A 3C6TA 2X6NA 4FJ7A 4J9OA 2G8VA 9ICPA 3B6PA 1ZBHA 3MDCA 5CB1A 2JZBA 3MBYA 3V1RA 2XHBA 2PY5A 8ICHA 4AH9A 4CHOA 1RILA 2ZJ5A 4ELTA 3RB3A 3M8RA 1SZPA 4PH5A 3BQ2A 1K1SA 5KRTA 4FJGA 4LVSA 1I3AA 3HPOA 8ICVA 3C95A 1KVBA 4CEEA 1SUQA 2OPRA 2G8HA 2IHNA 1QHTA 2P66A 4E0DA 1JN3A 1J9AA 4CJSA 3LAMA 1C1AA 4ED1A 3T1AA 3NGZA 4M47A 1VSLA 4E7HA 4F5OA 3KIOA 1D8YA 5J2PA 2HW3A 2W9CA 2OA8A 4N5SA 3L2WA 3C21A 4HVJA 3HSTB 4CEDA 4Q45A 5J2JA 3MDAA 3DM2A 2FMSA 5K14A 3TAQA 1WN7A 2ZUBA 4Q8EA 4FJ8A 5DG7A 4YFUA 4KRFA 4MFAA 4CHZA 9ICFA 3HYFA 4MF2A 1EKEA 3T5LA 4O3RA 2BANA 3TAGA 3K75D 3VQAA 4M2YA 4CEQA 4KHSA 5J2EA 2G8IA 4BWJA 4Y1DA 4DG1A 5KT2A 1NK4A 5KFHA 3Q8KA 4ECVA 4PGYA 1ITGA 4M6WB 4RG8A 1EXNA 1N56A 1RBVA 3OJUA 2RN2A 4KLQA 4R8UA 8ICYA 1TV6A 3DRSA 4QZGA 4FLUA 3AO2A 1Y97A 9ICTA 5KI6A 2R7YA 2NRZA 3H4DA 3G6XA 3L3UA 1VSHA 2VA3A 5HRNA 1BPYA 3MFIA 2E4LA 4JWMA 3B6OA 3VQ7A 1GOBA 3HVTA 2Y1IA 3DMJA 1TV9A 2FLLA 4DTPA 2F1IA 5KT7A 3QNNA 3OYHA 2J6SA 4FXDA 3AO4A 5E41A 3C5GA 1NK5A 1D9FA 4P2HA 2IGIA 3CYMA 4FO6A 3KLEA 3KK2A 3DLHA 5CZ1A 2W42A 2UVUA 5DK5A 8ICRA 5KFAA 9ICQA 3NFAA 1RZTA 7ICGA 4QZEA 4YG2A 2BGGA 4CEBA 3PX0A 2J6UA 1NKBA 7ICVA 4I9LA 1S76D 4C8LA 1HMVA 4EBEA 2MUTA 3ZSZA 4KHNA 4RPXA 1JLEA 1L3TA 3M9MB 3OYNA 3L8BA 5KFGA 1TK0A 2VG6A 4B3OA 4O3QA 4CJKA 2BCVA 1JLFA 3RBDA 3VQ8A 3PMLA 5HNKA 2XY8A 3QEBZ 1Q8IA 3H08A 2MAXA 1U9LA 4AILC 3AO3A 4QZFA 3OYGA 3VA0A 1ZQVA 1RTJA 4B08A 4DTOA 4I2DA 9ICAA 1CZBA 4FVMA 1U48A 1TFRA 5DBCA 3OYJA 3LP1A 3V6KA 4OVLA 3ISCA 4Z4GA 1A76A 1V9PA 3PR4A 5HHIA 1Q9XA 5IINA 2DFLA 3TWHA 1Z26A 5IIKA 4ECZA 2Z1JA 1XO1A 3MXIA 5KFRA 3GV5B 1RTDA 5J0UA 4IQWA 3RH4A 5KFSA 1ZYQA 4I2QA 4CFAA 4BE2A 2DPJA 3WNFA 4AHSA 4CJQA 5J2BA 9ICEA 1BVSA 3K5LA 2IHMA 2ISPA 8ICTA 2PFQA 5KFKA 4FJ5A 2LSNA 4KN7A 1IO2A 3NF9A 3DLKA 3UXPA 1Z25A 4DF4A 1TL3A 2W9CB 4RW8A 1NK8A 1Z00A 4I2FA 1C6VA 2GWSA 4CJFA 4M3WA 4PWDA 5KGXA 3P1GA 4DL4A 1JXEA 1ZQBA 8ICUA 7ICKA 3PNCA 4I27A 5DBBA 1S6PA 3JSMA 1ZQLA 4KTQA 4YN4A 4DL6A 4HUGA 3PO4A 4F4YA 1B92A 4CJEA 2XY7A 1ZQGA 4ED2A 3F9KA 1LWCA 4P4PA 4M3RA 3QEVA 1RBTA 3SQ0A 3KD5E 3V9UA 4FJIA 4M04A 3LDAA 5J0PA 4KO0A 4YNQA 2P6RA 3RMAA 1UOCA 1RT7A 4W5NA 5KFTA 4CJWA 2R8IA 1ZQSA 4PHEA 1KLNA 4KTWA 1L3UA 2IDOA 1NJXA 9ICSA 3GFKB 3SNNA 2QKKA 4CK1A 4E7LA 4NXZA 3HWTA 7ICMA 4DOBA 1KFDA 3ISNC 4NCAA 4B9LA 1RT5A 3KKSA 3MR5A 4JRPA 2F8SA 1RDBA 5IIMA 4I2AA 3UXOA 4N76A 1W9HA 4ED3A 2NRWA 1BPXA 5KG2A 2ASJA 2M9NA 1C1CA 1HJPA 4RNNA 1C7YA 9ICWA 3AVIA 4RU9A 3JYTA 3RB0A 2ZE2A 1S1WA 4H4MA 4X5VA 4F4XA 1S0OA 3V81A 1NOYA 4O5EA 4MEYA 3H7IA 4QWCA 4W5RA 1JL2A 1S97A 3PX4A 1K6YA 2GV9A 4I2EA 4FLYA 4TUSA 1RDAA 3ZD9A 2Z1GA 4GMJB 2KQ2A 4KN4A 2PFNA 2D0AA 3DLBA 4IG3A 3QZ7A 1VSMA 5DGBA 2GBZA 1JLBA 1NK7A 4FBTA 4QZ8A 4KLLA 1VSKA 3QIOA 4CJRA 5KG7A 1LAVA 3PO5A 3QO9A 3JPOA 4ID5A 5KTQA 1RYSA 4FLZA 4NM1A 1ZQPA 4XIUA 4DSIA 3AUOA 4W5OA 3RB4A 1MU2A 4RQ4A 1ASVA 5J2MA 4KLUA 3LWLA 4FJHA 1QS4A 1NJZA 3AVAA 1W0HA 2ITGA 4HUEA 4I9QA 3NCIA 3IHQB 1VSFA 2YKNA 4NCGA 1CXUA 1BHLA 8ICPA 5BPCA 1QSYA 1HUZA 4LSLA 3HP9A 4IDKA 4ELUA 3L3VA 4DSJA 1DTQA 4C8MA 4J9SA 4I29A 8ICEA 4I7FA 5CHGA 2C28A 4B9TA 1JL1A 3SZ2A 7ICHA 5J2AA 3SUPA 1HQEA 4R5PA 3OSPA 4HCCA 1D9DA 2P51A 4ECTA 4PPXA 3JPTA 3BQ0A 3RWUA 1NKEA 1RYRA 4I2CA 4E3SA 1KTQA 4I2PA 4FK0A 3HX0A 2OPSA 1X9MA 5C25A 3LAKA 3K2PA 2XRIA 3V9WA 4M3XA 3N4MB 3NF8A 4YD1A 4Z6EA 2FMQA 5C24A 3RR8A 2BQRA 4JWNA 4QZCA 4KLJA 1Q9YA 1TKZA 3OS2A 4EBDA 4DMNA 2JGUA 4DU4A 8ICCA 1S0VA 4CJ3A 4Q44A 2UVRA 3L2RA 5J0YA 3O3GA 5DQIA 4KHQA 7ICOA 1XI1A 4KLSA 7ICEA 3QEPA 1UT5A 1ZQQA 5CZ2A 2B6AA 4CF1A 1C0MA 2IAJA 2FC0A 5C5JA 4CK2A 3QINA 2D0BA 2W9MA 1ZQOA 3DRPA 4KTZA 4KLTA 3OSNA 4K4GA 3ZSQA 4XQ8A 5KT6A 3OS1A 4M42A 4DSLA 1FXXA 5FDLA 3TAFA 5KG0A 4ECWA 4RZRA 4CJLA 4EEYA 4GXIA 1C0TA 2BCRA 4F4KA 4CGJA 1WSEA 3O3FA 3WNHA 1KDHA 2HMIA 2KFZA 4O5KA 1LV5A 1UT8A 4Z6FA 4CIGA 5FROA 2ZJAA 4PGQA 3AVFA 1UAXA 5DMRA 4DL5A 2BPCA 7ICFA 3GQCA 3S9HA 3QEAZ 4YD2A 3PVXA 3OYEA 4TUPA 5J2HA 4DTRA 2RF2A 5J0RA 3P83D 4YR3A 5KFBA 4ECXA 3PMNA 2AQ4A 3C23A 1RPLA 1IXRA 1N48A 1L3SA 4EYHB 2ETJA 4C8KA 1TK8A 3SQ2A 1BI4B 4GLXA 4F92B 5J29A 5CYQA 4BE0A 8ICOA 2Z1IA 1B43A 4JK1A 4RT2A 1BQNA 4ED7A 4I2BA 5BOMA 5KGWA 3HM9A 1JKHA 4DS5A 2XY5A 1N5YA 2BQ3A 2ZJ8A 4B9NA 4I2JA 3HO1A 4UB1A 2P1JA 4FLVA 2P6UA 4CFBA 9ICCA 3MEEA 2OYQA 1HNIA 1ZQMA 9ICJA 3AO1A 4RQ0A 4LH5A 3G10A 3AA5X 3RJFA 1ZQFA 1T7PA 3T19A 3PW2A 1DGSA 4CHPA 3Q8PB 5EWGA 4F5PA 3WNEA 2X6SA 5J2NA 5HLFA 2G8FA 4UQGA 2WOMA 4DFKA 3C6UA 3U3GA 3VQ5A 5FRNA 5J2KA 3K5OA 4DLGA 4NLGA 4CFCA 4FBUA 3NH2A 4FLXA 1Z3EB 1BQMA 4J9RA 2W8KA 1X1PA 5KFXA 1UWBA 1TKTA 4O5BA 4RQ7A 3JPNA 3OY9A 2JEGA 1BISA 4ZTFA 5HBMA 1L3VA 4PQUA 1MQ3A 3M9OB 9ICHA 2KZ3A 4DQSA 3V6DA 3ZSOA 1TK5A 1ZQTA 3Q8MA 4CGFA 2A1JA 3RJHA 1X2IA 4NLZA 4YMNA 3FFIA 2HNDA 2V4RA 1I39A 4RQ3A 1R0AA 1ZQUA 1NK9A 4E7JA 3EWAA 4RW7A 3UQ0A 2DFFA 4Z4IA 5JS2A 4GC7A 3RMBA 3D0PA 4IFVA 4XRHA 3PX6A 4CJTA 1BL3A 2PFPA 2VANA 3E01A 3AA3A 2BGWA 5HRSA 3JPSA 1S9GA 3ETLA 3ZDEA 5DLGA 2ISOA 1COOA 3MAQA 1JX4A 4I2IA 4L8RB 2HHVA 4QZIA 5DB7A 1S9FA 7ICRA 3SPYA 3RAXA 3RJIA 1TVAA 2IA6A 7ICIA 5TZVA 1VRUA 1UA1A 7ICNA 4N56A 2P5GA 5CR0A 3PR5B 5KG5A 2XC9A 4AHTA 4AHRA 1A5XA 3ZDCA 3TABA 2HHTA 3OYKA 4QZAA 2AGQA 1YTAA 3V9SA 4FS2A 1XSPA 4LY7A 3KK3A 4IRDA 3H40A 2W9AA 4DU3A 1O1WA 2JZBB 1QQCA 4ZHRA 1RT1A 2D0CA 4B8CA 4NCBA 5CJ7A 3EYZA 3T3FA 1B22A 1EP4A 3QEWA 3DLEA 5KT4A 1T05A 4M9HA 3VQEA 2DPIA 5IIIA 1ASWA 3ZD8A 2QK9A 3ZSWA 4ECRA 4O3SA 4Q0BA 3AO5A 2MUTB 1BCMA 4KLIA 1KVAA 3ZSVA 4NM2A 4JLHA 3L2QA 1ZQCA 3P5JA 2KN7A 4ECYA 3V4IA 1K1QA 2JEIA 4RT3A 4KLDA 4FM0A 5HRPA 2ASDA 1BPZA 4DSEA 4FJNA 1H38A 8ICQA 5KFNA 4YP3A 5DB9A 2VWJA 2F8TA 1CUKA 3MECA 3ORYA 4JUZA 4PHPA 4IG0A 5HMLA 3C2KA 1SL1A 4K4IA 3O3HA 4YFKA 3ISDA 5KFFA 4Z4HA 2B4JA 3GIMA 4Z6DA 4E1NA 4FZXC 2A1SA 4O5CA 3NF6A 1HQUA 4K8XA 1HRHA 3MXJA 3RAQA 3ZSXA 5DG8A 1NJWA 2HNYA 3VN5A 2FBYA 4Z4CA 1WCLA 1AROP 4G1QA 1CXQA 5KRSA 2HHQA 4KV8A 1T3NA 5KFPA 1IKVA 2GUIA 4ECQA 4OPJA 1F21A 4IKFA 2RDJA 3KLGA 5DB8A 4B9SA 2VG5A 2HVHA 4GW6A 3MR6A 1IH7A 4Z4FA 2P5OA 5DB6A 3M8SA 3D45A 3UPQA 4OKKA 1TAQA 4O55A 3KLIA 2VA2A 3ZT3A 1JLAA 2ATQA 3DYAA 3U3YA 3AVBA 1MSWD 1A77A 2B21A 1WAJA 3PUFA 1KFTA 1S10A 9ICUA 4F3TA 1TAUA 3HVRA 2XO7A 1VRTA 1SKWA 1CLQA 4QWDA 2BCSA 5JS1A 3KHHA 3MGHA 3EZ5A 5J2GA 3RJEA 3AVLA 4NY8A 3OYCA 1YVUA 2R8KA 3QESA 4CEFA 4ZH4A 4GC6A 3ASMA 5DG9A 3F73A 4MFCA 2PFOA 3ZDDA 1JLGA 1HYZA 2PZSA 2ATLA 4OLAA 4M41A 1U47A 4AHUA 4DL3A 4M9JA 4CGGA 4KHUA 3GDXA 3MABA 4M3UA 3AA2A 4M45A 4I2GA 5L1IA 3G6YA 3NE6A 4BACA 4Q5VA 3NHGA 3K59A 8ICGA 4LD0A 3TANA 1WAFA 2G8WA 3MGIA 1BIZA 3V9XA 4FK2A 4UAYA 4RPYA 3Q8SB 9ICIA 3SPZA 3G0ZA 3MFHA 1UA0A 5KFJA 1XSNA 3AV9A 3OYIA 3LP2A 1S9EA 4QWBA 4KHYA 2RKIA 4PA1A 3OYAA 9ICBA 3GIKA 4RW9A 4CHYA 3HT3A 1FKPA 8ICIA 2AU0A 5KFMA 2YNFA 4RQ2A 4W5QA 4BDYA 4AHVA 5F9NA 3C5FA 8ICZA 2LYHA 4DTSA 2I1QA 4JS5A 3T5HA 3K5MA 3AA4A 2BQUA 3EPIA 4FW1A 4OGEA 2OZSA 4LZGA 3HW8A 4O9MA 9ICMA 4QZDA 1BGXT 4TURA 9ICRA 1SKSA 3S3OA 1ZQIA 3TFRA 2JLEA 3OYDA 5KFWA 4Q8FA 3TAPA 3MR2A 2BCQA 4LH4A 5KFOA 4Z0UA 5T7BA 3NDKA 2C2EA 4E7KA 2AJQA 3KHGA 3Q8RB 4JV2A 2KZMA 3NGDA 2OWOA 1RT4A 4DQRA 3L2VA 4QZHA 3ZCMA 1RXVA 2UVWA 1KEJA 1NK6A 2ZUCA 4XUSA 4CCHA 7ICPA 3JPPA 3K58A 9ICXA 4MFBA 4FM1A 2VG7A 8ICXA 8ICJA 4DOAA 1GOCA 3OS0A 4DSKA 1S0MA 3AVCA 1B9DA 4OKJA 4RUCA 1B9FA 1SL0A 4ECUA 2IC3A 3VQCA 1IG9A 5J2CA 4YR0A 1LW0A 1RT2A 3B0YA 3AU2A 3LPTA 4CESA 5EOZA 3B0XA 1JLQA 3RH5A 1NJYA 4I28A 7ICSA 4ICLA 8ICSA 1U49A 5DQHA 4YVZA 3FYHA 3LDSA 1REVA 3BGRA 4J2DA 3ZDBA 1KCFA 2E6LA 5I42A 4PGXA 4O3OA 3V7KA 3JPQA 4B9VA 4ED0A 1BCOA 3HK2A 4FZYA 1ZETA 1A5WA 3ZT2A 4MEXA 4CGHA 5HHHA 1XC9A 5KFVA 7ICUA 3EY1A 3OVNA 3BJYA 3EW9A 4QAGA 3VQPA 3ITHA 3PW0A 4O0JA 3H8WA 2PI4A 4XA5A 4TSXA 4UB5A 4QOZB 2YNIA 3RBEA 3U6FA 1C1BA 5KFYA 4OKEA 4MF8A 5D4BA 3TARA 4EP4A 4E7IA 2UVVA 1JMSA 8ICNA 4YXJA 4J9LA 4NYNA 4ZTJA 1DLOA 3RR7A 4H4OA 5HP1A 1C0UA 4P4MA 4TUQA 4F5QA 1ZQNA 3DLRA 2QXFA 4B9UA 3V1QA 2AGOA 4EBCA 4FYDA 1HJRA 1IM4A 1RT3A 4KI6A 1BI4A 1TVRA 3VQ9A 4KI4A 4W5TA 3LPUA 4JS4A 3HL8A 3JPRA 3S3NA 1VK0A 1WSIA 3KHRA 4FJMA 3QZ8A 2FBVA 1J5OA 1ZBFA 3SQ1A 5L1KA 8ICLA 4O3PA 4IRKA 5DDYA 4B8AB 5DQGA 3KLFA 3KK1A 3AU6A 3V7LA 8ICKA 1ASUA 4DTUA 4F5RA 1HYVA 4FZZA 4DTMA 3RB6A 2BR0A 2HNZA 2HHWA 4DEZA 4RQ5A 5CWRA 1Z00B 2AGPA 4R65A 1LWEA 5KG3A 2FPMA 1HYSA 4DQQA 2YNHA 4FM2A 3GIIA 1N6QA 4FJ9A 4GXKA 5J0XA 5J1EA 4FJXA 2Y1JA 1KSPA 3NBPA 1IKXA 3THVA 2AQ0A 5IIOA 1S5JA 9ICLA 3TI0A 1PZNA 1A5VA 4KLOA 4KB0A 1ZJNA 4RQ1A 4KREA 4CJUA 1QE1A 2PXIA 4IQUA 2BPFA 5D46A 1TKXA 4IQTA 1RT6A 4TQRA 3LWMA 1KRPA 2HB5A 1Y88A 4M3ZA 3ZSRA 2R8HA 5KFZA 3I0SA 4G3IA 4N41A 1FKOA 4C8OA 1S1UA 2F96A 4CHNA 4IQVA 5IILA 1LAWA 5CA7A 4DO9A 4O3NA 4BXOB 3GILA 1WSJA 3PW7A 5J2FA 3OHBA 3SUOA 4FJLA 9ICOA 4PY5A 4F50A 4RW6A 7ICJA 2WONA 2Q0ZX 3V1OA 1XHZA 4BWMA 3V6JA 4LSNA 1L5UA 4FCYA 1EETA 3O4QA 3SI6A 1DOQA 4R63A 3ZDAA 3CM6A 1WSGA 4KLEA 1NOMA 5J0OA 1ZBLA 1BPDA 1ZQJA 4CEOA 5J0SA 4RUAA 1CEZA
chains in the Genus database with same CATH superfamily
5CY4A 1U26A 3MX2A 4OL8A 2GCFA 3MTJA 4JV0A 1U1QA 4X4TA 3LOUA 3NOCA 1U6BA 1H98A 4JEPA 4O0IA 1WF0A 4IEEA 1CC8A 2BANB 3HJVA 2MHNA 2M3DA 4ED5A 2HBMA 4EP5A 4DUZJ 3E1YA 5B5EU 1Z1VA 3SDEA 1CZAN 1T8EA 2W2NP 3MPYA 3ZT1A 5KG1A 3WXMB 4BG9A 3ISBA 4B9MA 2V4QA 1CULA 1RBRA 4CIFA 3D6RA 5LM7E 2NO5A 4DX8H 4CIEA 2WAQF 2LHTA 1IJEB 3IM8A 3H3NO 3NAHA 3NBPB 4DR5J 4IQMA 3M9NB 1GMUA 5J2PB 4EHUA 1RABB 2N7CA 3ALYA 3D6FB 4DV7J 3M32B 4NPOA 4YB6A 3MMJA 4IR9A 4J9VA 1AFJA 5CYQB 3OR1B 2GC8A 1O03A 3VAGA 1DGJA 1BIUA 4KFBA 4KLGA 2ZD1A 3O44A 5CXTA 2JL9A 3QU7A 4PHTX 1WJ9A 1T3OA 4NLUA 2J5AA 2QL7B 4UW2A 2G8KA 3QEIA 1GMWA 2PA8D 1N54B 5IFMA 1XMOF 3K4GA 1VSEA 4ZPCA 1S72S 2KK0A 2HHUA 3AVKA 2HFUA 3WKBA 5E5NA 3KLHB 4G1QB 2GWKA 1IV8A 1ZD5A 2XY6A 2DB1A 4QYZJ 2W6LA 1F9FA 2XMVA 2RHQB 4PR6A 4JI4J 5IV3A 4DFMA 2HMXA 3VQQA 1U7LA 2B8QA 3BBBA 3A0BU 1ZQKA 1J54A 2YWFA 4M9GA 4CECA 2CJ9A 2FDRA 4HH1A 1CZ9A 4TY8A 1LB2B 4RNOA 4KB1A 3L4PA 4UAZA 2FJEB 3K57A 1S5ZA 2CRLA 4J9UE 2DUYA 2DBYA 3ZFVA 2ZEJA 5AQUA 4IZ9A 4WYBA 3GV8B 2B9EA 3BGUA 1EX8A 1RUSA 4DTNA 1W25A 2CFXA 2AEFA 2ZOFA 3FR0A 3MC1A 2YV0X 2CPRA 5E79U 3D1OA 1FXLA 1T44A 4ZPBA 2ZTDA 1VC5A 1JJ4A 3BBFA 3OXFA 2KW4A 4XEIA 1ZQDA 2XCPA 2EBGA 2EWHA 3D7SB 1OH6A 2BKOA 2OKQA 4YQWA 4BE1A 3AVJA 7ICTA 4CF2A 5ADXA 5EWFA 4FOIA 3C1YA 5THWA 4JKCA 1EJ7L 6AT1B 3WQPA 1EO1A 2KJ8A 4C8NA 4DR1F 3ILIA 3M8QB 4KITB 5B66U 1H2TZ 4OI3A 3I9V9 4CHQA 4CD1A 5GADU 3T5KA 3MM8A 3KWMA 2GJFA 2YHAA 2FDNA 4J9NA 3DXKB 3EXCX 4I2HA 1NK0A 4BX9C 1GX6A 4GVLA 3C14B 2CPHA 4IH6A 4IBNA 2CA9A 1Z1ZA 2KJWA 3QNOA 2F1HA 4R0JA 3NH0A 2ABYA 3GIJA 3L3FX 1U45A 4ERDA 3BQTA 5FRMA 3E2EA 2E6MA 1S1VA 4LF8K 4ZITA 4RQ8A 1N8RT 2MQOA 5M2RA 2I0XA 1ZRNA 2OFGX 3TEHB 5H9EJ 4CK3A 3KLVA 2QB1A 1M90T 3M1VB 3OJSA 3K9JA 2PYJA 4BG8A 2VQEF 4NOHA 3PSTA 2WAQC 1WORA 1DY3A 2VB6A 4X62F 3MEDA 3M8PA 4ANDA 2LCWA 2EWSA 3CCQN 4CE9A 2YX1A 3D54A 1ZTTA 4Y2QA 2CXYA 3B8AX 1QUVA 3MOZA 4I64A 2A1RA 2E9RX 3IWNC 1SBRA 1YVNA 3VWSA 1H1VA 2QE5A 5C7PA 2VFTA 2HS3A 3PFEA 3SYZA 1ZC6A 2O8CA 3RMDA 2ZH4A 1QHAA 1OMSA 3EE3A 4RW4A 3DNCA 3KJFB 5CA5A 4L3QA 3MZIA 5AJ3J 1TZ0A 3AM9A 3G6VA 3SMZA 1WOPA 2B3TB 1MA7A 3AD7C 4NLOA 4HCBA 4UATA 2OPPA 4HWIA 2VASA 4FP9A 2QA4S 2ASLA 1GLJO 7ICQA 3MM7A 1SXLA 5RUBA 5BR9A 1RDCA 1LWFA 4EI2A 2E1YA 2G09A 3QT6A 4LF9F 2QLFB 3TR8A 2PYLA 1EKRA 2F1JA 4QIEA 4YMOA 1WWUA 1EWQA 3NGYA 2AV5A 2BCUA 5A8KA 3MM9B 2CKWA 3MCPA 3IR5B 2YTUA 1X9WA 9ICVA 1KS2A 3LPYA 3K5NA 4CTAB 3IS9A 3BS5B 2P6SA 2VKQA 2EZZA 2QXLA 4F93B 3LP0A 5M2UA 4BDZA 2G5HB 3RH6A 5SUHA 2LQJA 2ZDOA 2LP4A 4IR1A 4K8ZA 1K9MT 3UMCA 2CPFA 2FIUA 4FLWA 1PO6A 4AM6A 3RBXA 4O4GA 1KAXA 3C7NB 3NCPA 1J53A 1JXBA 2L5YA 4C7ZA 4PG6A 1XMQK 3DAWA 2QMWA 4NL9C 3KWIA 4QZ9A 1ZQWA 2DR9A 2B8PA 2F7TA 1K8KA 2J4RA 2Y9HA 4FWQA 2VQEK 3ALRA 3AVGA 3HILA 2K7KA 1RCHA 3OYLA 2CDQA 2MQ8A 3RJKA 2ODGA 1SKRA 4LR8A 3I33A 5B0AA 4F2RA 3QB0A 1RNHA 2IOCA 4J2EA 3HHLC 4N47A 4P4OA 1KVCA 4JAXA 2MQQA 2HOQA 3J80Y 2DR5A 3P39A 4ILRA 4K4HA 4R5PB 3GB0A 3A0HU 3V7JA 3W60A 3TX0A 1SV5A 4C11B 4NYFA 4P7VA 3RRHA 1GLAG 1YGYA 3TPQA 5F8IA 3B54A 1P8GA 5HMMA 3IWXA 1ZQYA 5I42B 4PHDA 2FHJA 3EVOA 4YS2A 5M1KA 4TLRA 4KH6A 1M5OC 4ATNA 3C6AA 3CDAA 4BR0A 4KQZA 3D6MB 4DR3F 1YKWA 4J2BA 1NZPA 3ULHA 3LK9A 2E1PA 4E1JA 2A6MA 2IS3A 1EQ0A 3NMAA 2GVDB 3T69A 2W9BB 4FF4A 2J7UA 2VJVA 2QWRA 3VGKA 4UBBA 4KLFA 2UXBF 1A7GE 1VR6A 3SJJA 2FSNA 3BQ1A 4DQIA 5J0QA 2CH6A 5EE0A 2HWTA 4F04B 3VQ4A 5AFUA 2MKCA 4KPYA 1LKZA 1FX2A 3GTYX 3VVTA 5L38A 3LDOA 2G06A 3L3CA 3MURP 1PGZA 5DDMA 2JZ5A 3BN4A 4RW7B 4ISEA 4ZKAA 1WSFA 4JI2K 4RX6A 2MKJA 4FO0A 1B64A 4P71A 5KG6A 4YMEA 3KUGA 4FJ7A 1RT7B 2G8VA 3NRZA 4K4ZA 4H4MB 4KV8B 5K8NA 4M7XA 2AYBA 3NXZA 2X1GA 4EO8A 2UUCF 3L6QA 2K4PA 2W2QP 2DIUA 4K4UA 4ZLNA 3CCUN 2PY5A 3A5LC 2KN4A 4DV5K 5AK3A 2ZJ5A 3T9ZA 4A8SA 4NJ8A 4LVSA 1R31A 3HPOA 3GIRA 3CJ5A 3FZLA 3C95A 1KVBA 4BJQA 4CEEA 3LGNA 3V2UC 1QHTA 4E0DA 1JN3A 2V7YA 5AQGA 5ALUA 4ZP8A 1YIJS 4HTJA 2W7OA 1FDNA 3MF5A 4IFVB 4E7HA 5AQTA 3QU4A 2OEMA 3MMAA 1FF2A 4CEDA 1CC7A 2ZH1A 1VLYA 3ZNJ1 5KOXA 4WXWA 3A3PB 3UD3P 5K14A 3VAMA 4YFUA 4I2QB 4NXMJ 3ENHA 4ID5B 4RPFA 4DCJB 9ICFA 2V8GA 3HYFA 3T5LA 4O3RA 1DQAA 1YJUA 1FJGJ 2J7KA 5F2RA 3K75D 3VQAA 2RLTA 4M2YA 2BKNA 2YJEA 4CLUA 1RKIA 2ZBPA 4YEAA 5KFHA 3N9UC 4ECVA 3CXCM 1ITGA 4M6WB 4RG8A 1RBVA 3OJUA 2RN2A 1Z2LA 4G1PA 3FBFA 4NMXA 2QJ3A 4LF6K 4FLUA 3KG4A 1Y97A 2WB1C 3ISZA 5KI6A 1N6QB 2R7YA 2NRZA 4DV3K 2QTDA 2B9WA 4X84A 3H4DA 3G6XA 4DR6J 4IH7A 4CVNE 4OHWA 3AA8A 4O44B 1K8AT 2XB2D 5HRNA 1YZ7A 2E4LA 4JWMA 3B6OA 4OYIA 5A0YB 1HBNB 1KOHA 2Y1IA 3E51A 1VRTB 1HKCA 5TKYA 3DMJA 1H2VZ 3CJ3A 3FEZA 3N4PA 1RXOB 3CCJN 2BBEA 4FO6A 3KK2A 3DEEA 2JWKA 3QGIA 5DK5A 4RCHA 2WAQD 4CLKA 1WEYA 7ICGA 2YWEA 2BGGA 4BRKA 5F3XB 2J6UA 2UP1A 4FWKA 1NKBA 1HMVA 2BXJA 3GP9A 1SCJB 2RSQA 3LGHA 4RPXA 1IR0A 3NASA 1ZBSA 3N4WA 4GVBB 3AQEA 3IAS9 4ZJQA 4WE1B 3CCLS 5I3PA 2CGKA 4L6V3 3T1YJ 1JLFA 3FFKB 4FPBA 4MLHA 2GNKA 4AILC 1NZBA 1HLWA 2ES6A 2EAOA 4GVBA 2IPOB 5M1QA 2F8EX 4KGZB 1RTJA 1O08A 1HNXF 5JRTA 2IIRA 1HQ2A 1Q86T 1QY7A 2J9DA 4DJBA 5DBCA 4Y2VA 5ALWA 3LP1A 3J7ZT 3Q24A 4WFNQ 3PR4A 4X4RA 1X4HA 4DG1B 4JI7F 5IINA 4NYPA 1FDDA 3ID8A 1Z26A 5IIKA 1X66A 2E5HA 4KSEB 5J8YC 4OJHA 1MROA 2E29A 4I0WA 4IQWA 3RH4A 2NUUG 2VQFF 4CFAA 1VQ6S 2MZQA 2YWWA 3RYLA 3QGGA 1S1VB 1NGHA 2K8AA 4K50A 2DKOB 2XBPA 3J81O 2XM3A 2LSNA 2H3QA 1X4EA 1L7OA 3MM5A 2W9CB 1OYEA 3VHQA 2MKSA 3EDRB 2QZ8A 3MWPA 4YHHK 3HSZA 1WI8A 1IBMF 2I7NA 4I2FA 1C6VA 4M3WA 4NZ0A 5KGXA 3QDKA 3P1GA 4IDHA 2QLTA 2W25A 7ICKA 3R9KA 1SQKA 1SV5B 1SIZA 5DBBA 3I28A 3KK1B 1S6PA 4Y2YA 1ZQLA 2CQ2A 4OZLA 3DXMB 4KTQA 5ETNA 3AGRA 3J7YI 1GLCG 3FVYA 3J80U 1GH8A 2D3DA 2F8KA 2XWYA 2XY7A 4DPUA 4UAVA 1GTHA 2LM1A 3P8BB 3PZPA 2B6AB 2XHCA 4DUTA 4H5TA 2YHYA 4R79A 1VCTA 4P4PA 1MG7A 5GTHU 2IOFA 5ALXA 3NNHA 3TR5A 1GO3F 3UCZP 4I1TA 2Q66A 2DGZA 2KM8C 1HW9A 2E1EA 5KFTA 1P8ZA 3UN5A 4PHEA 1IKYB 1N5VA 2IDOA 2Z0GA 2AJ0A 5C2DA 2XYGB 3DXKA 5AM4A 3SNNA 3NVZA 2KKVA 4OZ0A 4BGBA 3DLLL 2UZAA 5ELZA 4RR5A 3GDQA 5EVZA 5AQLA 4BQZA 2W54A 1H73A 2OTJN 3I56S 3MR5A 4PG5A 2OO4A 4I2PB 4JRPA 3RW6A 1NDKA 1T9TA 5IIMA 3A4TA 1RT1B 2VKZG 4NLDA 1A0OB 1ZQ1C 4CRJA 1WBBA 3DJCA 2RQMA 1TYQB 1SIJA 5EHHA 5DM7L 3NVWA 2XSJA 5BR8K 4M5MA 4Q2MA 3L09A 5D78A 3CC2S 3BSAA 1S97A 2MU2A 4K2XA 3V4MA 1LK7A 4WP9A 4WJBA 1IXKA 2PEHA 4KAIA 2PGCA 2XNQA 4FLYA 4LF9K 2KQ2A 5E3RA 1PK1A 2NSBA 3DLBA 4IG3A 4OYOA 2NXJA 3IWLA 1HD1A 4FBTA 3A3NB 4BRNA 2YMQA 3QO9A 2BJEA 1WSRA 5CHIA 1RTIB 3I8BA 1CJKB 1JI7A 4JYAK 3CQYA 3FNNA 3OW2R 4YOUA 4KLUA 1FCAA 2EQYA 2ITGA 2K89A 2H3VA 1S59A 5J1PA 1ZM4A 1EQYA 3O6QA 2AJ4A 1VSFA 2I7PA 3EO3A 4X64F 1F5SA 2E7VA 3OFHA 2BA9A 4WIIA 1BQMB 3HP9A 3UN2A 2YPZA 5LXYA 3FSYA 4CZKA 2R42A 2XG8A 1DQ9A 1DTQA 3VCDA 8ICEA 4B9TA 1M1GA 4Y0WA 4QR1A 1M5KC 3NGSA 1F5AA 4OHZA 1D9DA 4JI5J 1W2BM 5F1XA 4PPXA 1Y9OA 2HK3A 2E5GA 2I1RA 3D5MA 1RFQA 3NCRA 1NKEA 3UD5A 2QM1A 3CCLN 3BBCA 4WU3A 1K9MO 1B7YB 4I2CA 4NI2B 4LF8F 4WK3A 4FK0A 2MA1A 3VEXA 2BW2A 5C25A 1FXRA 2XRIA 3SQGB 2E2QA 1H72C 4DL0C 1Y10A 3F2BA 4Z6EA 1HW8A 5C24A 1XMBA 2ASOA 5DM7Q 2QX0A 3CJAA 1V4TA 4EBDA 3CJ2A 8ICCA 4CJ3A 4Q44A 4LBHA 3DKDA 2C3OA 5DQIA 1Q79A 4KHQA 2C2ZB 4JBCA 2ZM6J 4B3MJ 2GVZA 1BQXA 3UFCX 4BRAA 3EL2A 1EQMA 1C0MA 3LP0B 3DRPA 2H9ZA 2V2ZA 1VQ6N 3GFYA 4CF5A 1NLVA 3OSNA 3CHWA 3SJHA 3ZSQA 2GEMA 5KT6A 3HKZC 1TFYA 4A8YA 3S8SA 5H2FU 3O1LA 4M42A 3WQTA 5FDLA 1FXXA 3TAFA 5A0LA 5KG0A 2FYXA 1JRPA 2OSRA 1TUVA 7FD1A 3JQMA 1WSEA 3B6BA 5GAHU 1KDHA 1TVRB 2KFZA 3AN1A 1LV5A 4CIGA 1VQLN 5DMRA 4USTA 2BPCA 5A8RA 3K8WA 2LYAA 1G3OA 1K0TA 7ICFA 3CDBA 4P2MA 3BSOA 1X5TA 3OYEA 4C3KA 2IMOA 3D67A 3MPVA 3P83D 1E3MA 2CZ4A 2AQ4A 1B4SA 3NNCA 1IXRA 6FD1A 2PMHA 1L3SA 1FKOB 4EENA 2ZNYA 4U8VA 1BI4B 3QFPA 4ZIVA 8ICOA 3GBTA 2W40A 3I1YA 4JK1A 4RT2A 2YN4A 5HJYA 4I2BA 2GS8A 3CXCR 2JH7A 1RQ0A 3WEEA 1UVLA 4JI0J 2ZVSA 1N5YA 2ZJ8A 4B9NA 4I2JA 1YBAA 2D9PA 3BYRA 1XQIA 3R6LB 4B1XB 1X42A 3ISND 5A8WA 4FLVA 9ICCA 3VERA 3MPDA 4M8LA 3EKUA 3AO1A 3ONQA 3SBGA 3T9NA 1LFPA 2UU9F 1WC0A 3AA5X 2MZSA 4A8OA 5LMNJ 5H9FK 1ZQFA 3AAPA 4CLWA 1DGSA 3KOAA 4Y2PA 5HO4A 2IYIA 2D0OA 1FEZA 1CQNA 5I9EB 3FMWA 4Y2MA 4OPAA 5D0RA 5FRNA 2QMXA 1SWVA 2XMTA 2QWPA 4ISGA 4CFCA 3VEZA 4IDKB 2A40A 6FDRA 1R8CA 2ZIXB 3NGKA 4X65J 3WX4A 1M1KO 4RQ7A 1HR0F 3M7VA 3QGPA 3L4BC 3M9OB 3NS5A 1T11A 4QBUA 1HNXJ 1SJRA 2B4OA 2HBJA 4AL6A 2VG7B 2K1RA 3T6BA 2A1JA 3HKZD 4OX6A 1OY9A 1VS3A 2I38A 3IKMA 3ENOA 3Q2SC 3FZFA 3EM1A 5LJVA 1YTYA 3EWAA 2JRSA 4EMDA 3ZI4A 3UQ0A 3W9JA 2WUSA 1HQEB 1Q78A 3RMBA 4IFYB 3MMCB 4CI0B 1GTEA 2XI2A 3D0PA 4USIA 4M5HA 3B4MA 4XRHA 1PVQA 3HVTB 4CJTA 2PFPA 2KHDA 3E01A 1F3VA 2BGWA 5DLGA 2ISOA 4I2IA 2YPYA 4KH4A 1O51A 3T1YK 4NE9C 7ICRA 1KBUA 3VZIA 3SPYA 3RAXA 5FPMA 2HMPA 1UA1A 2XS5A 3TQEA 3M2RA 3PR5B 3BEGB 5KG5A 1HBMA 4M5LA 3ZDCA 2IM0A 1TUWA 1VRUB 4JV5F 2AGQA 2G13A 1YTAA 3V9SA 1XSPA 1N32F 5ADXH 2ZZTA 3PFOA 2CRXA 4FKYA 1O1WA 2JZBB 1IR1A 3C15B 1DJ0A 4I6YA 2MYFA 4J7CA 5KT4A 2HOFA 1IBLK 3TJ9A 1NM2A 1CJVB 1ASWA 3AJ2A 2Y0SF 2OJ3A 2VDHA 2ZWHA 2QK9A 2LEBA 3ZSWA 4L74A 3M6ZA 4ECRA 4Q0BA 3M6UA 4GKJF 2QGFB 4CNZA 4P7TA 4JLHA 1ZQCA 3KDNA 4XDDA 1OUQA 4JYAF 2AP1A 3MEGB 2V9KA 4RT3A 2KLAA 1FJGF 3O8MA 2GHVC 1H38A 4XH5A 1HIWA 1MDUB 2F8TA 4CTAA 5B0GA 3L4IA 4Y2JA 1CUKA 1VQ4N 1KQQA 4JUZA 3C2KA 2FJDB 3O3HA 3G6EN 3IRWP 4DX5A 2C2MB 2B4JA 4Z4HA 4O5CA 3NF6A 4QU7A 2VPWB 3MXJA 3BY5A 1T9YA 2CQHA 2HDOA 1SPBP 3ZSXA 1NJWA 2HNYA 3WKDA 3VN5A 1SWWA 4A8QA 2KMDA 2DHHA 2HHQA 4TY9A 1I6JA 4CDIA 2HBZB 4OI2A 1T3NA 3HD2A 5KFPA 2O1PA 3EMTA 4DBQA 4JK7A 1L7PA 4IKFA 3KLGA 2KT3A 2F4VK 2YWHA 1VQ8N 2KDOA 5L46A 4IO8A 1UVIA 4O8UA 4OYPA 2P5OA 4A48A 2DNOA 3NG8A 3UB5A 3DRYA 3KYLA 3ZT3A 3PYEA 1JLAA 1DZ5A 3KDOA 3C7NA 2PO4A 1YBUA 2VG5B 2RQ4A 1B0TA 3PUFA 2ZKTA 1S48A 2ILZA 4F3TA 1TAUA 4FYXB 2FHMA 2P9CA 3NVYA 2M4MA 2MSTA 2CQIA 1L6NA 4OD0A 1JLGB 2G1HA 2CJBA 3AVLA 4OJOA 2PFDA 2EAPA 1P90A 4PKGA 3UKUA 4JI1K 4DPTA 5ALZA 4C0ZA 3ZDDA 4NO7A 4FSVA 2PZSA 1N0VC 1U47A 1KVJA 4DL3A 3FBCA 5ITHA 4BUGA 4M3UA 1TL7B 3AA2A 1X31C 4QIWC 3U8XA 1R43A 1IWGA 2Z30B 4BACA 5B0CA 2AJ2A 4LJMA 2EG2A 8ICGA 4CQ1A 2XMUA 4DR7F 4GV6A 4JKGB 3U1NA 4JI5K 1VQNN 4RPYA 3Q8SB 3MMBA 4YHHF 9ICIA 3UW1A 4K42A 1HNWJ 3SPZA 3MFHA 5M2PA 3F5TA 3BREA 1XSNA 1SJ3P 3C28A 4B1VA 2WMMA 4QWBA 2H4WB 2OHDA 1TQLA 3DWLA 3AH6A 4JI3F 5E3QA 1RGIA 4RU2A 2RKIA 9ICBA 4RW9A 4CHYA 4RJVA 3Q89A 2DY9A 1FKPA 3VAJA 4KBOA 1M0SA 4KHPJ 3O4WA 3CF5L 5F8JA 4USJC 4F25A 3MN7A 4BDYA 4USKA 2Y0SC 4P0QB 3CWJA 3CCRS 2VQFK 4N7TA 1CRXA 3IFEA 2I1QA 2A1BA 3BSCA 4CO3A 3BF3A 5ALLA 4OO1J 3AA4A 3HSJA 1NSKL 3WQUA 4FW1A 4NA1A 3W2WA 4Z7CA 2HQDA 9ICMA 1X9JA 2VBXA 5JMVA 3MECB 1VLOA 1PYOB 2HURA 3R9LA 1N34F 3OYDA 3MM6A 4Q8FA 3SSQA 3TAPA 4FYWB 5KFOA 4Z0UA 3TJAA 3ZLJA 5BJRA 4LRBA 2FUG9 4GIBA 2AJQA 1N88A 3KHGA 4E7KA 1C0UB 1YDLA 3GYXB 4JV2A 2WSFC 2KZMA 3U7JA 2ZHAA 1PJ5A 2A6AA 3QAEA 5AQYA 2ZUCA 4NLWA 3RFAA 2KVIA 2N1RA 3UVJA 2UXDJ 3IXQA 2VL1A 4CNQA 2K4HA 4CLZA 2VG7A 1VJWA 3ILJA 2Y3YA 3N6LA 3QATA 1S0MA 1RAGB 1X5OA 3MXHP 5ETKA 2NUHA 2ZH5A 1QQOA 1VBKA 5J2CA 4YR0A 4TKTA 3KMSA 3KXDA 5AQQA 4OX7A 1OH5A 3B0XA 1KLMB 1NJYA 7ICSA 3SAHA 2XTJP 5FD1A 5IS2A 3LDSA 4NWIA 2HHHJ 2R2UA 1REVA 2Y1RI 4NXNJ 2G4BA 5MAOA 4QIWD 2ZWOA 4PQUB 1Y0HA 1YITS 3K5PA 5AKHA 4B9VA 5AJ3K 3AL0B 4DR2K 2D0PA 2C2KB 1MNEA 1GT8A 3FLCO 1N5YB 4ZMMA 3ZT2A 4CGHA 2Q97A 4UW9A 3OVNA 1NGAA 4ER8A 3BJYA 3C66A 4QAGA 3G71N 1PYSB 1VC0A 4OLOA 1OY6A 3W3DA 4ETZA 3DHXA 1Z6RA 1U0HB 2F77X 3CIZA 5D77A 1KHVA 5CABA 3WKCA 4A47A 1C1BA 5KFYA 2HSEB 5D4BA 3G9CA 2WFBA 1YJ9S 2P9SB 4V19S 1CJTA 4P4MA 2B4UA 2H5EA 5HMWA 3V1QA 3L7OA 1HJRA 4F71A 5HMYA 4E2FB 3J7AN 2NQPA 4BRCA 3G86A 4KI4A 4W5TA 3DLKB 4CM2A 3JPRA 1RCOB 3CNQP 1LWXA 4FL9A 1XMQJ 3SQ1A 4LF7F 5CR4A 4N77A 2PE8A 1C1BB 2POKA 2DEJA 2IC3B 1YUWA 2NRRA 5DDYA 3ZO7A 5AZIA 5BN9A 4PZOA 3KK1A 4PXDA 3AU6A 3MN6A 3W8PA 2KVCA 3V7LA 8ICKA 1ASUA 2B4PA 3DXMA 3RB6A 2BR0A 2K4EA 2HHWA 3CD6N 1HNWF 4DEZA 2VGMA 3ET6B 4R65A 3BB5A 2KHVA 2BUNA 2NR0A 4DQQA 1REGX 2P5VA 4DV0K 1F3FA 1QQNA 4KX3A 2LA4A 3K7RA 1KSPA 4FKXA 1R6YA 2EFOA 1C20A 3F56A 4KB0A 4CZIA 1Z05A 3WC0A 4PZVA 1R8PA 2J0WA 8AT1B 3F9MA 1UFKA 4IQTA 4M3ZA 3B4DA 4G3IA 2IVFB 2X1AA 1FKOA 3A8KA 2ADBA 2XLKA 4CHNA 5A76A 2AHOB 2ZIUB 5EE3A 2X1BA 1QZ5A 5AIAA 3NWRA 1XIQA 4Y28C 1QD1A 5IILA 3SQIA 3MGJA 3FQKA 5CA7A 1SVDA 2CPYA 1RHQB 5LJ5Y 5LSRA 1NCLA 1H3DA 1WSJA 4ZP7A 1D8ZA 2K1RB 4WZMA 1S1UB 4FJLA 3WUHA 2UUCJ 4F50A 4LF4K 1WB9A 4C0OC 2ZJPL 2WONA 1N0UA 3V6DB 4ES3A 1XHZA 1KWMA 3V6JA 2ZBIA 1IWAA 4LSNA 1EETA 5C10A 1TL5A 3CM6A 2DNGA 5J0OA 4LF1A 1UW9A 3TEGA 1RAAB 3D6TB 4RUAA 2CWKA 1C0FA 2GQCA 1CEZA 2UXBK 1WOQA 1WLJA 2V7ZA 2CGJA 4Z37A 4Y1CA 2MHEA 1RDRA 2ZNZA 3KKRA 3RMCA 4H5WA 1ZBUA 4GKKF 4PUOA 4KR0B 3Q22A 2EDUA 3GG1A 3KJVA 3D68A 3OBWA 3FC9A 4WQ4C 1HUOA 4Y0FA 2LVWA 4GXJA 2B7BB 3PDNA 3OTEA 1WELA 2HHSA 2KFNA 3U4LA 2G0AA 4DR5F 4M63A 3VGUA 1UHUA 4R66A 2KVQE 4MFFA 1PBUA 4AQYJ 1IKYA 2RRNA 3KKAC 1XJWB 3SD7A 3AODA 4U6PA 4QOTA 2HBLA 4F4WA 1ZM2A 5ALMA 2YMMA 1XO0A 3TACB 2LEPA 3TW0A 2JLGA 1ZBIA 1NHKL 1RP5A 3TQ1A 3EICA 2ALZA 3CCVN 2JRZA 2CADA 4LRAA 3MM7B 3TO8A 2OH2A 3U1MA 3CIMA 4O44A 5HRRA 4P2FA 1SH3A 1SI9A 4F02A 3CP8A 4RW4B 1FXDA 3NVMA 5JVHL 2Q6CA 4CLPA 4JI6F 3H3OB 2BZFA 1HWJA 4J90A 3DDHA 1RBUA 2DXEA 4A62A 1U09A 2DY4A 4B3MK 1NGDA 1KFSA 2DGVA 5ETQA 5E3PA 3QERA 1C4CA 3KFUF 3VA3A 4P0PB 1DKGD 5ETLA 3IV6A 4O0NA 1ATRA 2J8AA 4JKHA 3RTVA 2HVIA 1VSDA 1ZZFA 2QKQA 2OZMA 9ICKA 4QWAA 1DQ8A 1UVKA 2GGPB 3R5DA 3OVAA 2UV8A 3H1VX 1S1XA 2U1AA 1I94K 1QSSA 2A3VA 1YJTA 3CFRA 1JLCA 1MWZA 3U27A 5IT9U 3FCWA 1JK9B 4LFBF 1IQZA 1U1NA 4IS7A 4GKKK 2R3VA 1ECWA 3PRDA 5LJWA 2V9WA 2PBDA 3CG7A 3PW5A 2XCAA 3D3CJ 2Z1HA 4RQNA 1T3VA 1WSHA 1ZQEA 1B70B 2XO6A 4WYWA 4WYLA 1XR5A 2M2BA 1UWBB 1YSJA 3HXMA 1RKJA 4IG3B 3VGMA 4CF8A 4CERA 3LP3A 4CGDA 4GFJA 3TJ8A 3HHLB 5DGAA 5GTIU 3V81B 3CQ8A 3VTHA 3W9IA 4YORA 3HP6A 5CD4A 3ZSYA 1HNVB 3TA1A 1HNZK 3QIPA 3DOKA 2NLXA 4DB3A 3SFUA 1T94A 4HYKA 4B17A 4CGIA 1JROA 4YOEA 5DKWA 3RJGA 2O4GA 4X4OA 1QLNA 1XSLA 4CJ5A 1L8LA 4J9KA 2AW0A 3ENQA 1X5PA 1I94J 2QWQA 4F4ZA 2NRVA 1XK8A 4DV2F 2KJ9A 2ZTCA 3A8EA 4DV1F 4DCPB 3WEEB 5T7LA 4DF8A 2QKBA 2HF4A 4O5FA 1AB8A 2BJ8A 3M2UA 2OM6A 1JXLA 2G8UA 3FEXB 2MZ1A 3OTQA 3NMRA 2XYPB 3JTNA 2AYEA 4O23A 3S3MA 5DLFA 4H0OA 2VPYB 4ECSA 3P5TL 2M0GB 1NMDA 5SWMA 3I82A 4KY3A 3U02A 1WACA 5B0FA 4J9MA 2O8FB 4OJRA 2Z7JA 4DR4J 2CUYA 3H8YA 3IDWA 2ZDPA 2GQQA 2B5JB 1YTUA 4I69A 1U4BA 3DXBA 3PY8A 3TFSA 3L2UA 5BOLA 3VESA 5AM5A 4RQ6A 1WNSA 4TQSA 3RU0A 3CMES 1UETA 1IKXB 2DTJA 4WTOB 5K9FA 4M6WA 2LKZA 2BPGA 3OGUA 5IIJA 3ULDA 1X9SA 4M0AA 2VFVA 1PCAA 3O1BA 5U47A 3RJMB 1QSLA 1RTIA 2YH0A 3SUQA 3JAMU 1LWEB 2GIRA 3TZWA 4BXOA 2A1AA 3NS7B 3VQ6A 2C2DA 1D9AA 5HVGA 4ED6A 4X65K 4B3TK 4TLQA 4MMOA 4OZJA 3H8SA 3CERA 3IR6B 3QUCA 2V94A 2ITMA 4DSFA 3F2CA 4AE5A 4EX7A 1C0TB 1NPRA 3OR2A 3M3ZA 1QVFM 3GG4A 1TKXB 4HL9A 3PIOQ 1DTTA 4LFCJ 1QUPA 2COLA 2P6TA 3OTOK 4JRQA 1SXEA 3VAKA 5AJ3F 4DN0A 3JQKA 2OANA 2E7WA 1Q5VA 3WK9A 4UOFA 3KJVB 3VQDA 2OI2A 3V6HA 1GMVA 3KD3A 1WD6A 2FZGB 4UAWA 4MKAA 1WI6A 1S0NA 3B9JA 2LBOA 1S1TA 2MZRA 4OIXA 1S8OA 3LZIA 4U7UK 1DGKN 1YT3A 4ZVQB 2H51B 2O67A 1Q46A 4UB2A 5J0WA 2HCFA 1TKDA 1G99A 1FFWB 1VQKN 1SB6A 3EPGA 1M5SA 4RWXA 4WKYA 2Z4PA 1HKGA 2YMPA 3IA0A 2W8LA 4XPEA 1CLFA 3SV4A 3IO1A 3OL8A 1O8BA 4CZLA 5AKJA 1UWAA 4H8KA 4I6WA 4MYUA 1HPZA 3QEXA 1Q16B 3RAMA 5GAGI 5HVHA 4B1ZA 4X4UA 2UV8G 4M5DB 4FN5A 2KTQA 3MPUB 3WK5A 4DL7A 1YRUA 4W4MA 4JI2J 1GEHA 1FESA 1XU4A 5C42A 3C29A 5FPDA 3D0HE 1PK1B 2G0CA 4CJ4A 1J2MA 5J1NA 3I8DA 3VVUA 3CRXA 1TKZB 3LH2S 3G4SS 4KLMA 2HWIA 3NLCA 3ZZUA 3CCSN 3QPIA 1R8BA 4HT5A 2XYHB 2ZZMA 3KLHA 5ETRA 3C94A 4NCGB 4FZNA 3M6VA 2CPDA 1VSIA 2QW9A 5DBAA 1S7IA 2Y0SD 3KZBA 4ID1A 3DU5A 3AVMA 2HPUA 4NLQA 4R8UB 1FRXA 1JNZB 2I9GA 4NZ6A 1BPEA 3DLGA 5E3AA 5ADZA 2KD1A 1R8AA 4LQ9A 2LDYA 2CZVC 3MAAB 3IM1A 9ICGA 1WDDA 2GVZB 4UBCA 5CCMA 3NAEA 5AQRA 2O4IA 3PJXA 1EXQA 1JLFB 2OTJS 3A5OC 2IBKA 4FXWA 4CYUB 4E19A 4GRSA 4CZCA 3IG1A 4OYAA 3N97B 5M1PA 4NV0A 8ICWA 5F8MA 5KT5A 3C6TA 2ZC4A 2DD8S 2X6NA 3O0FA 3M5RA 1S79A 2P9KB 3B6PA 3I87A 4F0HA 1IBKF 2A2DA 1ZBHA 1Q7YT 5AE1A 4JI1F 2XQCA 3CC2N 5CB1A 2JZBA 3MBYA 3UCGA 2KXFA 1YJ7A 2HSTA 8ICHA 4GY2B 1N4LA 4X4NA 2WOMB 1TL1B 5K8OA 4DUZK 3M8RA 4PH5A 1K1SA 5D4PA 4LUBA 2FHOB 1JJ2M 3T6JA 3HFKA 1SC1B 8ICVA 1BA1A 1T9XA 5H1SV 2I8EA 4M1KA 4M5JA 1HWUA 2AJFE 2F40A 2G8HA 2IHNA 5J8YA 4F26A 3IDHA 2K8BB 2Z8QA 5AQNA 3DXSX 3DGPB 4K0KK 1OO0B 4TXSA 1QTNB 2HIYA 2W9CA 4LREA 4CDGA 3M05A 2OA8A 1JALA 2XZTB 3HSTB 4HVJA 2K7JA 4OJ3A 2L3MA 4Q45A 3ZEUB 1CULB 2IM2A 4BS2A 4OYBA 1WWHA 4NLXA 3MDAA 4U7BA 3DM2A 2FMSA 3ZTQA 2HLUA 1X0PA 2J0XA 3KJNB 4KRFA 2AH5A 4QZVB 1WEXA 4MF2A 1FVQA 3TAGA 3Q7BA 5K20B 5LMUJ 1VI7A 2DCUB 2G8IA 4BWJA 4DG1A 4Y1DA 5EUHA 3CMAN 1CVJA 2YWKA 3CGIA 1EXNA 3IRXB 4B3RF 2CQCA 3BZCA 2R7VA 2R2SA 1TV6A 1WNEA 5E26A 3CDUA 5E7OB 3MUTP 4Y2RA 1F5BA 5F8GA 3ZZ0A 4F9OA 2MQMA 2R9LA 3L3UA 3A3OB 4S0MA 1N36F 3CJ0A 1BPYA 4Y2TA 2H54B 3VQ7A 3CDWA 3TZZA 1MN9A 2DRDA 1TV9A 2FLLA 3AT1B 2KI2A 5H1SQ 1UZHA 5E41A 3C5GA 1HR0J 1D9FA 2KG0A 5AKXA 1SJ1A 4WFAQ 3DLHA 3GONA 2W42A 3MCNA 2A5XA 1VGYA 5KFAA 9ICQA 3GE1A 3NFAA 2GMLA 4QZEA 2O8CB 2EAMA 3EVMA 3SEOA 4NI2A 3PX0A 4JV5K 7ICVA 1S76D 1VQKS 3U9DA 4EBEA 3UR3C 2MUTA 2PKEA 4KHNA 4MN4C 2P2CB 1VK3A 1L3TA 3R1HA 2E5LK 3R5BA 3KK7A 3QICA 3OYNA 3A12A 4DV2J 1M5HA 4X4PA 3L8BA 1TK0A 1K0VA 4O3QA 3QWUA 3E0FA 2XWXA 4OZNA 4LF5K 3RBDA 4MTPA 5HNKA 3P4IA 3H08A 1U9LA 1S1TB 3AO3A 3VA0A 1MLAA 3HFVA 1NB2A 4B08A 4DTOA 3E9PA 2QYGA 2RRAA 3S6JA 4AT1B 4PUOB 4AP9A 2RKIB 4FVMA 1TFRA 4BRDA 5CYJA 5H9EK 4RWWA 5E0OA 3AJ1A 1FD8A 4CBUA 3PHTA 1S4FA 2PMZD 4LSZB 2QB0A 3KZXA 4BRGA 5LMUK 2DGSA 2Z1JA 1XO1A 4JI0F 1JKHB 5KFRA 5A6PA 2Q79A 5J0UA 3NGUA 4RQMA 4LSLB 4DPYA 4I2QA 3TZXA 3WK8A 3DU6A 4KGXB 2CPZA 4GNIA 5BYSA 4ZPTR 1T9VA 3ZTRA 4WTYA 1RLCL 2ZF5O 3M6XA 2J0QD 3DN9A 5HAOA 3K5LA 3UVJB 4BLGA 1GFWB 2IHMA 8ICTA 2PFQA 5B8HA 2OEJA 1ZA1B 5G0RA 4FJ5A 1YHQS 2DY1A 3OTDA 2WVCA 2YNIB 4M7YA 3KG1A 2CQ4A 4R25A 1NBEB 1IKWB 4AXIA 4A5BA 3UXPA 2HAFA 3HVWA 1Z25A 4DF4A 3TSUA 1RT3B 2NZCA 1NSAA 4NXMF 2DH8A 2AMCB 4JI8F 1WHWA 1FFGB 2GO8A 5J1EB 2Y9TA 3GR1A 4UF4A 2KL8A 1HFEL 3NCQA 4PWDA 1ZQBA 3M8PB 2MKIA 1ZXOA 3G8QA 3J7YU 3JSMA 1V3ZA 1N5QA 2D1KA 5DJBA 3C65A 4DCHA 3TVYA 2Q1LA 4OPHA 1H6KX 4HUGA 3PO4A 4E98A 4CJEA 5EDWA 2WB1F 1DTQB 1U8SA 3BS7A 3J8AA 3OR1A 3DOKB 4KHPF 1HBOA 4FPAA 3AY0A 5KL1B 4K59A 2VONA 3KD5E 2IVOA 5HBMB 5J0PA 2MTLA 1HMVB 4YNQA 2P6RA 3OXLA 5ALPA 3HOTA 4NL5A 3RMAA 1RT7A 3HRDD 1SQGA 2FY8A 3C6HA 2V69A 1ZQSA 2KU7A 1M6YA 1ATNA 4KTWA 2LDIA 5KPZA 3H0PA 2VIHA 3H59A 2D1CA 3BGLA 1WC1A 1FWKA 1ULRA 3KKSA 2CGLA 1XN9A 2JX2A 4ZP9A 1FKAF 2XSFA 5EE1A 2Y8WA 5KG2A 4OHXA 1C1CA 1SJQA 3KKFA 1W97L 4EEKA 9ICWA 3KK3B 2QSWA 4H4MA 2JH3A 4X5VA 1BHNA 4BRFA 3SMSA 1S0OA 2FXUA 1WHXA 2RD5C 1FT8A 1NOYA 3GG0A 4QWCA 3VTIA 3PX4A 2B4VA 1K6YA 2GV9A 4I2EA 1NMEB 5EX3A 1RDAA 4KGKA 1JQGA 4LQ3A 3AOAA 3NOGA 5GMKa 2VBWA 5AQFA 4OX8A 2NXCA 1AW0A 4KN4A 2DRBA 2DXDA 3IRUA 2GQ2A 2D0AA 3N79A 3QZ7A 2HAIA 2M0NA 5ETVA 1JLBA 2YKQA 1NK7A 4RUBA 3W5YA 1HX1A 2HHHF 1VSKA 3QIOA 1LAVA 5C42B 4BR5A 4ID5A 5AI9A 5G0RB 5ALGA 1RYSA 4NM1A 4W5OA 2V6AA 5HI7A 1S12A 4P72A 1MU2A 1RTHB 2ZJRQ 4ZP6A 3PLAA 4ILGB 4FJHA 1NJZA 4USVA 2NNWA 4F3QA 3QSIA 4FZLA 1FX4A 5IT4A 2YKNA 1BHLA 4KH5A 3TADA 1NGCA 3QJJA 3TUPA 5BYQA 1QSYA 2V4JB 1HUZA 5HN0A 3AQPA 1RU1A 2F3JA 2IYGA 2O5DA 3IMXA 1Q81O 3CJSA 4PWWA 4EWTA 4ZVOB 1SAZA 4J9SA 1Q3UA 5CHGA 1HKBA 4H0YB 3SZ2A 4LFAJ 2O6KA 5J2AA 1HQEA 3IBCB 3THPA 3NVVA 3P49B 3BQ0A 1OQ3A 3I4HX 5LL6Z 3TA2A 2A19A 4O4RA 3AAWB 3ETMA 1URRA 4E3SA 1KTQA 1KAZA 4IH5A 2R18A 1QCKA 4M3XA 3N4MB 2G1DA 3CJ1A 4CGZA 4YD1A 1UFWA 2FVSA 4FPRA 4UY8T 4QZCA 2W4PA 2QARB 1HL6A 3VQTA 4JI4F 4LF2A 2OMOA 5LL6d 4NMLA 4OJ6A 1RBAA 2QEXS 3AGKA 7ICOA 2IRYA 2HBKA 3QEPA 3PNIA 5I4MA 5CZ2A 2IAJA 4WIQA 2FC0A 2OHFA 5C5JA 4PL2A 1F9EB 4FYYB 3ZTPA 2CQPA 3W65A 2D0BA 2W9MA 1U2VA 3CJ7A 1ZQOA 1I3OB 2B0CA 1F60B 3D66A 4Z94A 4K4SA 4K5SA 2NREA 1RAHB 2QTWA 2F8MA 3N01A 2DNMA 4K4GA 1O6XA 3OS1A 8ATCB 4ID8A 4LF5F 2ZGYA 4HI1A 3M8YA 2WC9A 4WBFA 2BCRA 3DRRB 3WNHA 1Y7PA 1Q53A 3SCKE 2XIDA 3VR1A 3O9QA 3J7YP 1UT8A 2DNLA 1UAXA 4DL5A 1VQ7N 2ZHOA 4YN3B 2JH1A 2PDAA 2DQNB 3GQCA 5F8NA 3KWGA 3PVXA 4TUPA 4OI1A 4DTRA 4YB5A 3CPEA 2O8EA 5AK5A 4JMUA 4C8ZA 1BNOA 2QV6A 3PACA 4AM7A 3ZXWA 4GVEA 3C23A 1RPLA 3I55N 2LYBA 1FNXH 2GGPA 4EYHB 4WQ4A 2OXOA 2WF8A 3OL9A 2ZBCA 4LF6J 5A8RB 2ZM6K 5J29A 2HRUA 3CCRN 4CRXA 5CYQA 3F53A 2A3ZA 3NNAA 2ROPA 1NGBA 3LO3A 1SXDA 3THXB 3QLHB 4CLTA 1RLDA 5KGWA 3AOCA 3VAFA 4DS5A 2XY5A 1SC3B 2BQ3A 1L7MA 1FD2A 3H5SA 3HO1A 4UB1A 4JI7J 8RUCA 1NDCA 3R5CA 2P6UA 2Y0BB 3MEEA 2OYYA 2PMZC 4P52A 4U67Q 9ICJA 1YVFA 4O3MA 4Y2CA 2CPXA 2KYXA 1MN7A 3WBZA 3RJFA 1WC5A 1T7PA 3MTKA 3T19A 3P38A 5D4LA 2A3JA 1GMWD 2N3LA 3UMGA 1C0GA 2KSOB 1VC6A 2BTFA 1GLBG 3WNEA 1LOTB 2ZH8A 1SC6A 2PAVA 5HLFA 3HHNB 2DO0A 2K3IA 2WOMA 4DFKA 5ALDA 3U3GA 3K5OA 3PYFA 1OYDA 4P9SA 3OVSA 4C3LA 2ZOMA 4DV4K 3NH2A 4FLXA 3H8MA 4C1NK 1P9YA 2J9DE 2D8CA 1ROFA 3KG0A 4H0XB 3M2VB 4N8NA 1TKTA 4O5BA 2V2VA 1NGJA 3OY9A 4ZTFA 3D2FB 1L3VA 4PQUA 3TOQA 9ICHA 2H5JB 5AQSA 3K1RB 3V6DA 3ZSOA 1ZQTA 2SXLA 4Y65A 2EPIA 1RBOB 3TUJC 1JB0C 3ZETA 3RJHA 2LXIA 1X2IA 2GWJA 4LFCF 4C7QA 3QU5A 4YMNA 4WF9L 3FFIA 4ZPAA 3LPEA 4ICAA 5E3CA 4LT6A 4ILMA 1G1XA 1ZQUA 1U0HA 4IO1A 2DFFA 4M5GA 1UAWA 3R2DJ 4Z4IA 5JS2A 2RNEA 4PYDA 1ZD4A 1PC4A 3TZYA 1BL3A 1NZAA 3O5TB 3JPSA 3ZDEA 1RWPB 4UASA 2YX7A 1ICEB 1HWLA 2L9NA 1Q3VA 1SQFA 4YOYA 3U9ZA 5TZVA 7ICNA 2P5GA 4QYRA 3SBTA 4AHTA 3FCHA 2HHTA 4B1WB 1MU2B 4JNEA 3HKZF 3NUQA 4DV0F 4LY7A 2FVCA 3P6YC 4IRDA 5BREA 3H40A 2W9AA 2K3KA 4DU3A 3H0RB 2AXTU 4L3KA 1YJWS 2CJAA 4F67A 5IWAJ 2D0CA 2LXUA 4B8CA 2A6OA 5CJ7A 3EYZA 4BRIA 1QZ6A 3T3FA 3OTOJ 2BJ1A 3DLEA 3OUYA 3S41A 1T05A 4PQAA 4WJ3B 3TVZA 2DPIA 3R7SB 4DV7K 3H2LA 4DFDA 4NLSA 3WK4A 4O3SA 3AO5A 2MUTB 1KVAA 2BACA 3LL3A 4ENOA 3P5JA 2IVNA 2VIXA 4ECYA 1GXLA 2VCPA 4IUFA 1RADB 2ASDA 1BPZA 4DSEA 3PG9A 4NXNF 4OJGA 1I1GA 1EIYB 3HZ6A 4DV1J 4YP3A 5DB9A 5BN8A 3I31A 2L9WA 3ORYA 5FJ4A 3WK7A 5HMLA 1SL1A 4K4IA 4DUYF 2CJYB 1KEKA 4FZXC 4I4BA 3HCXA 3LGMA 4J91A 5GAGU 4K8XA 1DTTB 2QFIA 3TSPA 1LCUA 2ZD1B 1WWVA 4BRPA 2CH5A 2IJFA 1D8BA 2DRAA 4RL1A 4DV5J 2FPHX 2H3GX 4Y2AA 1NI3A 1WCLA 2JHDA 3W62A 4OYWA 4KV8A 2QLWA 2GUIA 4ECQA 4G6VB 3GR0A 4OPJA 1FRIA 1F21A 2RDJA 1NNEA 4B9SA 1EB0A 3SMVA 4EAHD 4RW8B 4DHVA 2R4FA 2GMJA 3M8SA 2QARA 3T1HJ 2CNLB 3KLIB 5L1MA 2MB0B 3CCEN 3ZX2A 4OKKA 1TAQA 1N33J 1YX2A 2ATQA 4A8KA 2WK4A 3U3YA 4NLPA 2BJ7A 4IOCQ 3SQGA 1MSWD 4LF7J 2EEYA 1KFTA 1S10A 9ICUA 4TU8A 1KL9A 2IBOA 1ED1A 4NLCA 1WKJA 4OYMA 2DGWA 3MGHA 3Q23A 5J2GA 2QWNA 4BVOA 4A46A 2ZG6A 1N52B 4YDUC 4WPAA 5IT0A 4DI6A 3HI9A 4ZH4A 2QL9B 2W3RA 2MEWA 2OSQA 5AXNA 5JVGL 2JSXA 4MFCA 2EXUA 2PFOA 5CHCB 2FVPA 1JLGA 3IM9A 1HYZA 4AHUA 3ID6A 4KHUA 2RAQA 3L7UA 1SUQB 3TTDA 1DT9A 5L1IA 4HR2A 2HQFA 4PPZA 3GSIA 1LEOA 5HATA 1AYEA 3K59A 2ZH6A 4JD2A 4ZA1A 2JFKA 2EKNA 4LD0A 3TANA 4WZQA 4DUYK 3V9XA 1BIZA 2O01C 5A2QO 3DYAB 1IR2A 5AXMA 3FZ2A 3G0ZA 3BKFA 2W7PA 2V4JA 4X65F 3MM8B 1Y11A 2RS8A 3AV9A 5AZJB 3ZZOA 4KHYA 4CH1A 4DPWA 4PA1A 1LKYB 4XH1A 5FPNA 2ZXHA 4GMKA 3UE5A 1X3NA 4QPXA 2BE7D 4Q0BB 4K7QA 2YNFA 4RQ2A 1AUDA 1TAMA 3LW5C 3OL6A 1Z4OA 5F9NA 2ZUGA 4CF3A 4IO9Q 3C16B 3E01B 3R5AA 2WBMA 4U7UD 3CB4A 1ZPWX 2E20A 2K60A 4YY3K 5KAFU 3DDIA 3D3BJ 4UB8U 2DPNA 5B0EA 2BQUA 3EPIA 5LXRA 2OZSA 3TA0A 1V3SA 1FO1A 4N8OA 3G25A 3J7ZO 2VOOA 9ICRA 3S3OA 2CNOB 5KFWA 2JGAA 4X4VA 1Z4NA 2BCQA 2UUAK 1SV4A 1QAJA 1NWKA 4LH4A 3KUEA 3MCMA 5JVHQ 1OXJA 1NJIT 3GJRB 1ITPA 1RT4A 4DQRA 5G4DA 2OFHX 3HHLA 3OT9A 1LW0B 4JKBA 2UVWA 2HS4A 1KEJA 4H4KC 3C0BA 3K58A 4CCHA 3HSDA 1AQ6A 4MFBA 8ICXA 3TX8A 1GOCA 1JNRB 3AVCA 4NA2A 1B9FA 4QS9A 4ECUA 1CBKA 2OAUA 4CNYA 1Q86O 4MAKA 3ATVA 3CPWM 2M8HA 3FK4A 3LPTA 4CESA 5L8RC 4CH7A 3N6MA 2A2CA 3DV9A 4G9ZA 8ICSA 1ZRMA 4YB7A 3FZHA 1RJJA 4BRLA 4FWMA 2IJRA 3PM9A 3MHYA 2QA4N 3BGRA 2ALYB 1FDAA 1WOSA 3ZDBA 1HNZF 2YX8A 4C4TA 3JPQA 1IBKJ 4HHJA 3W3SA 1QAIA 2ZH7A 1A5WA 5DDQC 3NP5A 3WIVA 1CS4A 5AQWA 5HHHA 2KFYA 3EY1A 2PEBA 2VYPA 2DNHA 1BQNB 4NWBA 1WYGA 2EK1A 3VQPA 2CG8A 3PW0A 4O0JA 3H8WA 2PI4A 4DV4F 4UB5A 4YB1P 4BRQA 4QOZB 2YNFB 3QT7A 1NLKL 4C6AA 3RBEA 4UOCA 3TARA 2IM1A 2UVVA 1QVGM 4YXJA 4J9LA 1VQ9N 4KBIA 1DLOA 3RR7A 4H4OA 3CJTA 3QFUA 2AX0A 3HRGA 4HTIA 2H65B 2AGOA 1U2FA 1I94F 1HNIB 1IM4A 4KI6A 1BI4A 2VUGA 5AI8A 3DOMA 2D74B 4BC4A 5M1FA 2KXNB 3I76A 2FBVA 2XNRA 4P0PA 4B9QA 5L1KA 2Q0RA 3I6PA 1RWXB 4IRKA 5CE3A 3EUNA 3THXA 1CJVA 1VLBA 4F5RA 2OGUA 2BKPA 5CCLA 1HLUA 1LK5A 2HNZA 1WTBA 2ZM6F 3W1YC 4LC9B 5CWRA 1RQNA 2F9JA 2FZCB 2FPMA 1HYSA 1KONA 2VDIA 4FM2A 4C2MA 4OLPA 1CJUB 4FJ9A 1VJQA 2Y1JA 4I7FB 3QBXA 2H3EB 2F9WA 5IIOA 1S5JA 4WKRA 9ICLA 3TI0A 2MY8A 1PZNA 1A5VA 3D7EO 2GA7A 1ZJNA 2ATCB 4IQUA 1T6DA 5D46A 3FZKA 4DX7A 1RT6A 2BM0A 4JI8J 5CYMB 2MGZA 1VDHA 2XMWA 1Y88A 1O13A 2R8HA 2GMHA 3I0SA 1IUJA 3CEDA 1KQSR 3DRXA 3LA0A 4RBTA 3I4PA 2CXEA 3MCAB 2JOQA 4PAAA 4JOUA 3QMLA 3QRQA 2O8EB 4O3NA 3FFIB 4BXOB 4O8KA 3N5FA 3ZTOA 4RW9B 5AQPA 5HL7L 3DMJB 3OHBA 3SMPA 3CVKA 4PY5A 3BKUA 2LFVA 4OYXA 3V1OA 2ESEA 2JLFA 2QLXA 2HEKA 2DXFA 3MM6B 3DLJA 4ZOSA 3O4QA 5HQLA 4KLEA 2RDDA 1T95A 1ZBLA 1G7CB 4CEOA 5IC6B 4EELA 1A6SA 4K5RA 4K0KJ 4AHCA 2EX3A 2FSKA 3QETA 1I5OB 4M3TA 3R9PA 5G5GA 3VEOA 5F3ZA 3NGRA 3HJFA 3SI8A 3TTFA 2YI1A 1NGIA 4F5NA 3X3UA 4FK4A 5KFEA 3RBZA 2BYCA 2WF9A 2WSEC 5CZXA 3BQ7A 3UWTA 4FJJA 2KKPA 1V3RA 3HHDA 4HI2A 4JKDA 5K8MA 2OPQA 3CCSS 1HI8A 4BBYA 4DPOA 3SV3A 2NRTA 2W11A 1BD6A 1XNSA 3HBTA 3GMGA 3CC7S 1XMOK 2LMIA 1IG8A 5B0BA 3NTUA 1QVGR 4OPKA 4C4WA 3GJSB 1SJ4P 5AE2A 4J9QA 3FDSA 4DR7J 4FFDA 1X4AA 4PL7A 2X78A 2DH7A 2HHXA 4OMFG 4CLLA 1ZTWA 2XZDB 5KAIU 2G2YA 2H5XA 3UIQA 4DR3J 1F2GA 2DL0A 3H6EA 3QUTA 2GJ2A 3RW7A 4BC2A 4EHTA 1RB0A 2XGQA 2JC1A 1EX4A 1ZM9A 4OZ3A 3WNGA 2CQ0A 4QWEA 3GZ7A 2DIVA 2JVOA 2YNGA 4ZLJA 4LF7K 4OZ1A 3FSIA 2EC2A 3EUB2 4DFPA 4CF9A 2DGUA 2P9GA 2EANA 2D7SA 2O8FA 3OPXA 1FE0A 3EX7B 3GCWP 4QIVA 3LDLA 2JMGA 1S1XB 4DFJA 2EFVA 1WC3A 2LMRA 2ZTEA 1BUPA 1J2NA 2YMLA 2QMUB 4M5KA 2PMZF 3RJJA 3M1VA 4DR4F 2FBTA 3H8JA 2YNGB 4V1Ak 3HFZB 2J7WA 4UT4A 4NYOA 3CCJS 4F0MA 2H3IA 4KAZA 1MC8A 4BGDA 2FGCA 2DF4B 3R27A 4KHWA 3U1LA 1FVSA 2DFHA 3LANA 5DM6Q 2KP7A 3KZIU 4DR2F 4IFYA 1FHTA 4QZBA 1BXNA 3AXKA 1H74A 3C15A 2BE9B 2HZCA 4EZ6A 4ZLLA 4X64J 1TTHB 1FRHA 2B0GA 2Z2MA 3D0GE 4LFCK 1AA1B 4YDXA 4FWSA 3AJDA 4FZMA 3ZZTA 4KHPK 2BZ2A 2DR8A 4PHAA 4US9A 3WKEA 1V6HA 1SQEA 2J76E 2LLZA 5KFUA 4JB3A 3C6TB 2MSSA 1GLLO 3DFEA 1FFUA 1Q82T 4WFNL 1FK9A 3KNAA 4OJ5A 2GJIA 3HVAA 1FI4A 3CJCA 5D3GA 3SXLA 2E9ZA 3MR3A 4KB7A 3H2UB 3CM5A 4CJPA 2FLOA 3ZT4A 1XHXA 1LXNA 2F8HA 3UQ2A 1CQMA 2GTDA 1QTMA 4F2SA 3SQ4A 1PJ7A 2BJ9A 1K8AO 3EWGA 4ZK7M 3VAIA 2KJ5A 3AVNA 3THWB 4EX6A 4F8RA 1S57A 3D2QA 1TMMA 2BKEA 5AQJA 4OLBA 3PIPQ 4DS4A 3NVKA 2OD4A 4U95A 3VF2A 2VQEJ 3GFHA 2J6TA 4HAIA 5HROA 4RPZA 3FCVA 2C3YA 3MCOA 2HBYB 4Z4EA 5CP2A 4U8YA 3S1TA 3TAMB 4F3OA 2LQBA 2C2OB 3MEEB 4CF0A 3QAUA 3E9LA 4YOTA 4K8RA 1CI4A 4YR2A 4BDPA 1D5AA 1ZOTA 3DRRA 2UXBJ 3E8OA 2YY3A 1R59O 3AVHA 5H9FJ 5LMNK 2YWGA 2GELA 2E7XA 5SZTA 3US5A 4DU8A 2F3NA 1PILA 3O9UA 1YWXA 1RM6C 2Q0UA 5DDPC 1JLAB 2D5RA 1ZQAA 4E1MA 2R7OA 4M94A 2HS0A 1UKUA 1OKJA 1RGVA 4ZVHA 4JI3K 3IP0A 4K41A 2Z56B 1RISA 1B3TA 8ICMA 5AI6A 3HTVA 3G96A 2ZWPA 2R8JA 3FSXA 3I0SB 3HPGA 3O6WA 2ZQBA 4DWIA 2EHGA 5KFQA 3NGIA 2A1JB 3CCMN 2A10A 2WW4A 3A8JA 4FLTA 1BPBA 1RBLA 1RWMB 4BROA 5AZJA 1KN5A 5F0WA 3PSPA 4PJ0U 1J5EF 3SUNA 2KZZA 4GV9A 2YKPA 1RWWB 4DU1A 4FZVA 3KHLA 3T1HF 4J2AA 4YOXA 1V9OA 1U25A 4DHYA 2W01A 2DKXA 1G15A 1OW5A 3DGPA 5J2QB 4M5NA 3CQXA 8ICAA 4J37A 4RNMA 1LFWA 3SAFA 3M8QA 1BUXA 1YF5L 2VV5A 1NPPA 4F91B 1UTAA 1X4DA 3O4NA 5F9LA 2XMKA 3Q8UA 2QLBB 3LVVA 1U8WA 4HUFA 2H3FA 3N7PD 3GOIA 2ZJRL 4QW9A 3GV7B 2FC8A 4JI4K 3IGVA 2GIQA 1D0EA 3NF7A 3W2VA 3QBCA 4KLHA 3M30B 4CZEA 1CS4B 5CAAA 2NLWA 4R64A 4LMZA 1NOZA 4YMMA 5AE3A 4M9LA