3TAPA

Crystal structure of bacillus dna polymerase i large fragment bound to duplex dna with cytosine-adenine mismatch at (n-3) position
Total Genus 205
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
205
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I
publication title Structural evidence for the rare tautomer hypothesis of spontaneous mutagenesis.
pubmed doi rcsb
source organism Geobacillus
total genus 205
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2011-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3tapA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3tapA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tapA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tapA01
3LZJA 1ASWA 3DOKA 3HL8A 4EBEA 3HM9A 4O3SA 1NJXA 1ZBHA 4C8KA 2HNYA 3OS0A 5DBBA 4KTZA 1IH7A 3QEWA 4KB1A 1RNHA 9ICJA 1J54A 3AVJA 3KLFA 4B8AB 8ICAA 3AVAA 4HHTA 4MEYA 2HHUA 1SL1A 3KHLA 2G8UA 3C95A 4IR9A 1EKEA 4DQSA 2M9NA 4DMNA 2ASJA 1FKOA 4YXMA 4N41A 1TKTA 3KK2A 2J6SA 4LZGA 4HUGA 1RXVA 3MR5A 1WSFA 5KFWA 3SPYA 5KT7A 4UB4A 1WAFA 1ZQAA 1HQUA 5C24A 4BDZA 4KLHA 1TKZA 3L3VA 3TAMA 2AU0A 7ICOA 1UAXA 3ZCMA 3NE6A 2G8WA 4B9MA 3OYGA 3RMDA 1VK0A 9ICKA 4P4PA 7ICMA 4FLUA 4M6WB 3K58A 4DU4A 4RPZA 4O3PA 2XGPA 4DSKA 5J2AA 3FDSA 1S0VA 4OJRA 1S6QA 4CHZA 1LAVA 1ZQVA 2VG5A 4H4OA 4NM1A 3KKRA 1EX4A 4DSIA 4XA5A 3C94A 1S97A 4KLJA 5IIIA 2G8FA 4J9QA 3AO3A 4FLWA 3PNCA 3K2PA 3V9SA 4G1QA 4Y1DA 1HMVA 3OYEA 4BACA 5J2PA 2EX3A 4CFBA 3I0SA 5KRSA 4KMUA 4PGYA 2MAXA 1BPDA 2FBTA 2UVUA 2B21A 2PZSA 5KG7A 3RAQA 2A1JA 1U04A 4DO9A 5KFRA 3MFIA 1L3UA 3KHGA 2W8LA 1I39A 4QWBA 4YFUA 4QWCA 3C5GA 1DOQA 3EPIA 3OYCA 1J9AA 4KN7A 3V6HA 1S0NA 4IQTA 5J2IA 7ICNA 1FKPA 8ICRA 2IHMA 4ECZA 3M9OB 2IC3A 1GOBA 4O3NA 3PMNA 2JEFA 3AVKA 4CEZA 3GV7B 1JN3A 3AVLA 4CEDA 3LPUA 1RTDA 5J1EA 1XI1A 1XSNA 4CJ3A 3C2MA 5J0QA 3AUOA 3ZSWA 4F5NA 4X5VA 4RU9A 1S9GA 3OYAA 3QIPA 3GILA 2I5JA 2W9BA 4DQIA 1IKVA 4E7KA 1X9MA 1RYSA 3F9KA 3NDKA 4O0IA 2E6MA 3K5OA 5J2MA 4YQWA 3WNFA 5KFDA 4GC7A 7ICLA 5KG2A 4Q5VA 4FZYA 3PR5B 3OSPA 2BCUA 2R8JA 4FJ7A 3UXOA 4KHNA 8ICTA 1U45A 3LWLA 4DFJA 1TK5A 1RDBA 3JYTA 1YTUA 3KLIA 4DTRA 1WCLA 4P2HA 9ICXA 1XWLA 5KGXA 2JEGA 5HLFA 2R8KA 3O3FA 4M9HA 2D0AA 5KFAA 4TURA 4PH5A 5DK5A 3OHBA 4J9KA 1S9EA 3HWTA 2LYHA 5FRMA 3TR8A 2NRWA 4B9TA 4I2EA 3RRGA 4LY7A 3S3MA 4YNQA 4IKFA 5KG6A 3KLEA 4L8RB 3PX0A 1HUOA 3PO4A 2Q0ZX 3NBPA 2PFNA 3MXJA 4ED8A 1S0MA 1JXEA 3M8RA 4RW7A 1JX4A 2BQRA 4B9LA 3O3GA 2HHTA 1VSFA 3NHGA 2NUBA 3HJFA 1VSMA 4LH4A 3KK3A 8ICXA 3KK1A 3M9MB 2FPMA 5F9NA 5KFJA 2FLNA 3OSNA 4FJJA 4O3OA 4ELUA 4EYIB 2RKIA 1T8EA 4KKOA 4M45A 5KGWA 4AHUA 1BGXT 9ICUA 1ZQTA 1JLQA 3SQ2A 4PWDA 3GFKB 5L1LA 2YNHA 2A1JB 5IIJA 5DB6A 4M2YA 4ECSA 3EY1A 3G6VA 4NCAA 4CGFA 2ITGA 1T03A 4PPXA 8ICYA 4CEAA 4UAZA 3ZDCA 2Z1IA 4ED1A 2IOCA 3GIJA 1XC9A 1HUZA 3CQ8A 3AVHA 1JLEA 1NK7A 4CFCA 4HCBA 3H08A 1NK4A 3MR2A 1S0OA 4ECYA 2R8IA 8ICOA 1JLFA 3NH0A 2VG7A 4ED2A 4LH5A 3HT3A 3GQCA 3FYHA 3DLKA 1RDCA 5DG7A 3HPGA 3TFRA 4GMJB 2XO7A 5CB1A 1C0MA 2A1RA 5J0OA 4ED3A 1L3SA 3V7JA 2ZTDA 3BDPA 3KD1E 3SQ0A 1TL3A 5IIOA 1ZQGA 1HRHA 3UPQA 3OYLA 4DTJA 3KKSA 3T5JA 4CFAA 4CERA 3MEDA 2DFHA 2BGGA 3VQ5A 4KAZA 4EP4A 2YV0X 3V81A 3KJVA 2AGPA 3AVGA 4Z4FA 4ECXA 3DLEA 3C6TA 1ZQOA 3RB0A 3MDAA 1BPZA 3OY9A 2HHWA 3VQ9A 4BXOA 4CF1A 3VQ7A 3H40A 3VA3A 5J2JA 4CGIA 4YR2A 2P5GA 4EYHB 1JXLA 3MR6A 5DMRA 4I2GA 1XHXA 3PW2A 1N6QA 2XRIA 3RBDA 5IIMA 2BDPA 2ZTCA 1ZBIA 2V4RA 7ICJA 2KFNA 4Q45A 1KSPA 5KFNA 4QWAA 4JWNA 4KB0A 1TAQA 3S3NA 4YD2A 1HPZA 3HYFA 3T19A 4I27A 3LP2A 2JZBA 2JEJA 2ISPA 3ZD9A 3RR7A 1ZBUA 3QLHA 5DDMA 2MUTB 2ZUBA 4QWDA 1BHLA 3QEXA 4KLFA 2J6UA 4FZXC 5KG0A 4F91B 3PUFA 1ZQMA 3PX4A 4PGXA 1WSGA 3D0PA 5DB7A 8ICKA 1TFRA 3WNEA 4CF0A 1VRUA 4RQ3A 2AQ4A 1ZYQA 1ZETA 2YNFA 4J2BA 1TV9A 4KLSA 4QZDA 5DGAA 3AO5A 5D3GA 3B0XA 3PW7A 2FPKA 3QO9A 4TQSA 1WSIA 3RBEA 3VQCA 4I2AA 5JS2A 3AA3A 1RYRA 4NLKA 3IHQB 2BCRA 1J53A 4MFFA 3QETA 1QHTA 3DRPA 3JPRA 2O4GA 2O4IA 4MQ3A 3RR8A 3ZDDA 3AVCA 1ASVA 3LAMA 1I3AA 4IQUA 3T5LA 2P5OA 1NOZA 3OS2A 3LZIA 4DQQA 1RDDA 4W5OA 1NKCA 5DBAA 4OGCA 4ZHRA 1JIHA 4K4IA 1ZQJA 3O4NA 2HVIA 2HB5A 1UA0A 3DOLA 3DLHA 1WN7A 4O9MA 1XSPA 8ICBA 4RUAA 2VWKA 1N5YA 5KFHA 1O1WA 4O3QA 5C5JA 4FLYA 1HNIA 4FJHA 4LSLA 2HNZA 3ULDA 1BISA 3SPZA 4UB1A 2VANA 1NK8A 3IS9A 1Q9YA 4DTPA 4KI4A 4FJ5A 4RZRA 4CCHA 3TABA 4F4XA 4O5KA 3ZSRA 7ICIA 3MDCA 4AH9A 3JPNA 2IMWP 2FLLA 3GV5B 2OZMA 4NLNA 1A77A 3PV8A 4TUQA 4I2CA 4J9PA 2JEIA 3SUQA 5DG9A 5KFQA 2BPCA 4JV1A 4J9MA 3PW5A 4BXOB 5EWFA 3QINA 8ICVA 5HMLA 3UQ2A 4IRDA 3P1GA 4CGJA 2G8KA 4CK1A 2PI4A 5J2FA 3C5FA 2H5XA 4GXJA 2I9GA 3O3HA 3JPTA 2QXFA 3GV8B 3OYFA 1H38A 4LZDA 3VQ8A 3RTVA 4CE9A 4G3IA 4FJXA 3VQDA 1HYZA 4KPYA 4KLLA 2UVWA 2XCAA 4RQ2A 3IG1A 2IHNA 3RB3A 3RH6A 3H8WA 3V7LA 1IKWA 3MXIA 9ICVA 4F92B 2JZBB 4DS5A 4K8XA 2ZJAA 5DDYA 4HTUA 4FJKA 5L1JA 1ASUA 3L2RA 5HRSA 3DRSA 3AVMA 4UQGA 1VRTA 3H8JA 1ITGA 5IIKA 5T7BA 1ZJNA 4FO6A 4EP5A 2HHVA 4BE2A 2ATQA 4KREA 1TKDA 4F4YA 1X9WA 4O5EA 1S6PA 1C0TA 4O5CA 4Z6EA 1LWFA 1UT5A 3E01A 9ICBA 4DSFA 4Q8FA 2KZMA 4QAGA 5KRTA 3EW9A 2BANA 4ID1A 2JLEA 3QESA 1DGSA 3MEEA 4QW8A 9ICPA 4RQ0A 3K5MA 1G15A 1XS9D 3AVNA 4KN4A 4R8UB 4CJWA 4DSJA 5KI6A 1EP4A 4JUZA 3I0RA 3VQBA 5CWRA 4CEEA 2W8KA 4YD1A 5CP2A 1TVRA 3L2QA 1F21A 4KLIA 1RZTA 1U47A 4NCBA 4CJRA 4E7HA 1N48A 4FLTA 3ZT3A 3G6YA 5KFTA 1NK9A 3V6JA 2KZ3A 4NCGA 3HVRA 3S3OA 3E2EA 1RT6A 1UOCA 5I3UA 5KG1A 1KTQA 4CGDA 4RT2A 2F96A 3NF9A 3UQ0A 2PFQA 5DQIA 5KFLA 4DQRA 3CM5A 3AVFA 1BPYA 1BPEA 2OZSA 2XCPA 1L5UA 4HVJA 2G8HA 4QW9A 3V6KA 2ZUDA 3VQ4A 3KTQA 3V9XA 4KHQA 4CF8A 1BCMA 2R7YA 2DFEA 2D5RA 4Q44A 7ICVA 1SKSA 4J2AA 4JS5A 1ZQNA 3AV9A 4AHRA 4FLVA 4FXDA 4CIGA 4EZ6A 5KFMA 1EXNA 2ISOA 4QZ8A 3IRXA 1ZQPA 4MF2A 1TL1A 5CHGA 1DLOA 4ZTJA 4E0DA 4N76A 4FYDA 2QKBA 3SZ2A 2ZE2A 4ID5A 5D4BA 4CF9A 5HHIA 1QTMA 3BJYA 4F2SA 4E1NA 1TKXA 2BPGA 4DOAA 3K5NA 4DWIA 3ZT2A 4ZH4A 4R63A 1LB2B 4LVSA 2C22A 3O4QA 3TAFA 5EWEA 4Q8EA 1Z25A 4NYNA 3RJFA 1ZQFA 1C1BA 4E7LA 3AVBA 1AROP 4KLGA 4YR0A 4HUFA 1MC8A 1UWBA 4Z4IA 3NAEA 4KLQA 4PHPA 4IQVA 4CF2A 2P1JA 2W9MA 3MGHA 1MSWD 5EOZA 3L8BA 2I1QA 2NRZA 3BGRA 3OYHA 1BI4B 1NKBA 2F1IA 3QEBZ 5J0RA 7ICKA 2P51A 3ZDBA 3RWUA 1XO1A 4Q43A 2IA6A 4Z6FA 3HO1A 3H7IA 4KLMA 3CFOA 3MABA 2OPPA 3AO2A 4CHYA 4MF8A 4YMOA 1LV5A 1S1XA 1BQMA 4DFMA 4RNOA 5KFZA 2W9CB 1FXXA 3HX0A 4RQ1A 8ICMA 4FK2A 2KQ2A 4CJ4A 1Z26A 1KRPA 2E6LA 1U48A 1IXRA 2BE2A 4PHAA 4J2EA 3IAYA 2ATLA 4B9NA 3U6FA 3ASMA 1Q9XA 7ICFA 4ELTA 1PZNA 9ICCA 3T5KA 1JL1A 1ZBFA 3B0YA 2MUTA 5J29A 7ICPA 1HQEA 5KT6A 9ICNA 4CJ5A 3L3UA 1B22A 1X1PA 3JPQA 3TAQA 1D9DA 1MQ3A 3ZSOA 2RN2A 2HVHA 5DLGA 1QE1A 4E19A 1RBVA 9ICIA 4CHOA 1S9FA 3PVXA 4RQ8A 3OYNA 3Q8SB 3AU6A 1ZQHA 1JXBA 4YMNA 5DQHA 4XIUA 4RT3A 5KFFA 5DG8A 4E89A 3HPHA 3SCXA 5KFVA 1U4BA 4ZTFA 3LPTA 3C21A 4DSLA 2V4QA 3ZT4A 3NF6A 1IG9A 4I9QA 4CEFA 4FW2A 4LSNA 2YNGA 2YHBA 4I29A 4FJNA 4UAYA 4B3OA 4IG3A 3MXMA 4UAWA 3ITHA 5HBMA 3KHRA 5HP4A 2PI5A 4PUOA 1Y88A 3G10A 4FJ8A 2D0CA 4FJMA 4CJEA 3OYBA 4DFPA 1NK5A 4JS4A 1A76A 1XU4A 3L2WA 4YP3A 4O4GA 4QZHA 3MR3A 4KLUA 5J2QA 2R8HA 2C2RA 4YFKA 3WNGA 4CGGA 3HW8A 1ZQUA 1Z3EB 2Y1JA 1COOA 5HHHA 1Z00A 3A2FA 4AHSA 4M0AA 1BQNA 3M8QA 5IILA 2HHQA 4CFDA 7ICEA 4R5PA 3V4IA 4UB5A 4BE0A 4ECUA 4M3XA 4DOBA 4QZEA 4C8LA 3HP9A 4YVZA 1RPLA 4MFCA 4JV2A 4DS4A 1RT3A 2ALZA 3AO4A 5J2HA 1WNSA 3M8SA 3SYZA 8ICHA 4KI6A 3KHHA 1K1QA 1DTQA 9ICFA 2RF2A 3AA2A 2PFPA 3G0ZA 1KFTA 4DG1A 3U3YA 4I2DA 1NJZA 3DLBA 1CZBA 4E7IA 3RJJA 3SUPA 4MEXA 1D8LA 3NF7A 4CGHA 4DOCA 4QZAA 4F5OA 1HJRA 1GOAA 2ZQBA 1REVA 3Q8PB 3QEVA 4CHPA 2OPQA 2VA3A 2FC0A 1KCFA 4JRPA 1WAJA 8ICPA 1IM4A 1ZQXA 4OKKA 2BR0A 1KVCA 4ECTA 4MFBA 3UXNA 1D9FA 5CY4A 2NRXA 1LAWA 1FK9A 5KG4A 4OPJA 2F8TA 4FJIA 3QEPA 1NK6A 4RQ4A 1RBSA 1C0UA 1KDHA 8ICSA 3TAGA 3UXPA 2ASLA 5HRRA 2A1SA 4UBCA 5J2BA 3GDXA 4TQRA 1JLAA 2DFLA 4CHNA 5TZVA 3V6DA 5CR0A 4LD0A 3MGIA 3V1OA 3L2UA 3QEAZ 4GLXA 8ICCA 3C6UA 4FM0A 2IS3A 4R8UA 2X78A 1U49A 1JKHA 4KLOA 3P83D 3ZDEA 3THVA 1ZJMA 3VQAA 4F3OA 4I28A 2D0BA 4KTQA 3ZT0A 4F8RA 4AHTA 3HPOA 5SWMA 4NYFA 1HYSA 2BPFA 1ZQBA 1ZQEA 3UIQA 4FBTA 2BQ3A 1ZQIA 4I7FA 4IFYA 1ZQLA 2BCQA 9ICTA 5SZTA 3ALYA 4KLDA 3SJJA 4R66A 4DLEA 2RDIA 2NRVA 3SNNA 2X6NA 1Z00B 3NFAA 1YTAA 4DL2A 4NLGA 4Z4GA 4PGQA 4Z4CA 2XHBA 1LWCA 1W0HA 3PX6A 2KTQA 1A5WA 4KRFA 2HHSA 1ZQZA 1ZQWA 1T4GA 2DPJA 4FJLA 5JS1A 2GUIA 4FCYA 2FPLA 4XRHA 4IRKA 2YKMA 2BHNA 4J9OA 4YMMA 3S9HA 2B5JA 8ICJA 2HMIA 4Z0UA 2Z1HA 1TAUA 2KZZA 2ETJA 4I2PA 4F2RA 2GBZA 1BPBA 3LK9A 4I2QA 1V9PA 2RPIA 3V7KA 3KIOA 4FZZA 3KLGA 3DLGA 1WSEA 4QZGA 3RJIA 1C7YA 4OKJA 4O44A 5HNKA 8ICLA 1BIZA 1LWEA 4KHSA 2Q3SA 4GC6A 4CK3A 1X9SA 4QZ9A 4F5QA 5KT2A 1EETA 5KFUA 2AQ0A 1KFDA 3GIMA 4M9LA 4CK2A 2LSNA 3VQEA 3DMJA 1KLNA 5L9XA 4W5NA 9ICRA 4IBNA 4M3RA 2HHXA 4DL7A 9ICWA 2DFFA 7ICUA 5J0UA 4QWEA 3T5HA 4RW9A 1NKEA 3ETLA 2BQUA 3TFSA 3VN5A 4I2IA 3K57A 4FJ9A 4GXIA 2IAJA 5J0PA 9ICHA 4BDYA 4FJGA 4KHWA 3G6XA 1HNVA 4DTMA 2F1HA 4J9NA 1YVUA 8ICUA 3SI6A 5DBCA 4DTNA 1Q8IA 4F4ZA 4PA1A 4Y1CA 1L3VA 5KT5A 2OPSA 3ZT1A 3ZSVA 3H4BA 1TVAA 1JLBA 3MFHA 4OVLA 1ZQQA 2AGQA 3B6PA 4ECVA 1BI4A 4K8ZA 4M47A 4EZ9A 3BQ2A 5JUMA 1XSLA 1CEZA 4O5BA 5J2CA 1K1SA 1VSIA 4M9NA 1CZ9A 3ISBA 3OYMA 4B8CA 3TARA 5EU7A 9ICSA 1RBTA 4M9GA 1YT3A 2W9CA 1CXQA 3NGIA 1NJYA 1CLQA 5J0YA 3EWAA 4ED0A 4KHUA 3ORYA 4ELVA 5KFPA 3IM1A 3ISNC 4RQ6A 1NK0A 2GWSA 4B08A 4DQPA 2QKKA 3RH4A 4CJSA 2OWOA 4KV8A 2KW4A 3RRHA 4CJKA 1QSYA 3HK2A 4E7JA 4XQ8A 1SV5A 1D8YA 2KN7A 1SL2A 5KFKA 1S5JA 2XGQA 4QOZB 4DF8A 4M3ZA 3N4MB 2YNIA 4BE1A 4AILC 1ZQRA 3P5JA 4RQ5A 2WONA 4F50A 2JGUA 2OPRA 5L1KA 7ICHA 1JLCA 1LW0A 4KO0A 4F5PA 2XC9A 1WSHA 1RTIA 2PY5A 3PW4A 7ICTA 5FROA 4Q0BA 4CIFA 1HYVA 3RJGA 4J9LA 5KFIA 5KT4A 3RJEA 3CG7A 3QIOA 3MECA 3LAKA 4DTUA 1X2IA 4JRQA 4PY5A 1CXUA 1JMSA 1WLJA 1UT8A 3BQ0A 1KFSA 5J2DA 4YXJA 4YN4A 5EWGA 3Q8QB 3BQ1A 5KT3A 3C2KA 3L2VA 4M41A 5J2NA 1W9HA 4YG2A 2PYLA 2AJQA 1UA1A 2BGWA 3NH2A 4OGEA 3EZ5A 3F73A 4Z6DA 4DF4A 4EBDA 3BQTA 3TI0A 3B6OA 3C1YA 4Z4HA 1RT7A 4KHYA 1BIUA 3PO5A 1T7PA 2Z1GA 1KVAA 2XY6A 2ZTEA 1RBRA 2ZJ8A 1LW2A 5I42A 3H4DA 5J2KA 1RTJA 4M04A 4RW4A 4J2DA 3Q8LA 1S1UA 2WOMA 3U3GA 2FLPA 4I9LA 4M3TA 5DKWA 1BL3A 1Y97A 5HRPA 3TANA 4FW1A 2WTFA 3NGDA 4R64A 3OYJA 5KFYA 1JL2A 4R65A 1RT4A 7ICQA 2ZUCA 5KFOA 3RB6A 1SUQA 5J0TA 4CJTA 4GVMA 4EEYA 2UVRA 1S1WA 1XHZA 1QS4A 5KFEA 3SV4A 3PMLA 3CYMA 3K5LA 3KD5E 3LANA 5CA7A 2DTUA 1K6YA 3PW0A 2FBXA 2ASDA 3NGZA 4J9RA 3N97B 7ICSA 2XY5A 1VSLA 1DTTA 3ZSYA 2G8VA 1TV6A 3RJKA 1RT1A 3QNNA 4DLGA 3JPPA 4K4GA 3CFRA 5KTQA 1VSHA 3VQPA 2NRTA 1ZQSA 3VA0A 2BCSA 3TQ1A 1QLNA 2B4JA 1BVSA 4YCXA 3QEIA 1TK0A 3LWMA 4OLAA 3AU2A 1RCHA 4CJVA 4JK1A 5CYMA 4DL6A 2HNDA 4AHVA 1QSLA 3OHAA 4F4WA 4J9SA 5KFGA 5D49A 8ICZA 1C1AA 5CZ2A 1TK8A 3RMBA 4KTWA 4PQUA 4FLZA 1S76D 3PR4A 5DGBA 5KFBA 4FK0A 4DL5A 3Q8RB 1RTHA 4O55A 3EYZA 1RT2A 1RT5A 5FDLA 3T1AA 3SQ1A 4FVMA 4M42A 4GW6A 7ICRA 3TAEA 3V9ZA 4GXKA 1C6VA 3MEGA 3WNHA 1MU2A 5HMMA 1SKRA 5BPCA 4NLZA 1SKWA 1NOMA 4FM2A 3AA4A 1VSJA 2IGIA 3NGYA 1RILA 2P6RA 3PY8A 2E4LA 2BCVA 2XY7A 3GIKA 2IBKA 2OYQA 4E1MA 2PXIA 5DLFA 4FM1A 3OYKA 4MFAA 4I2BA 4FLXA 3HXMA 4ECRA 9ICQA 4Z4EA 3RMAA 4CHQA 4N5SA 3AA5X 2ZD1A 3RH5A 5E41A 2IDOA 3SI8A 3LDSA 1KLMA 8ICQA 1R0AA 4IFVA 4W5TA 3OYDA 1NOYA 4QZCA 3MAQA 4P4MA 3C2LA 4NM2A 1D5AA 3NF8A 5BOLA 5DB8A 4ED7A 4RG8A 1A5XA 2X6SA 3OS1A 2W9AA 2KFZA 4UB3A 4F93B 5KG5A 4B9SA 3V1QA 5L1IA 1C1CA 2FBYA 3RAXA 1IO2A 5CJ7A 4RNNA 3RB4A 1IKYA 1QQCA 4RPYA 3TAPA 2F1JA 3DRRA 3AO1A 3SQ4A 4KLTA 2PYJA 4QZIA 5F9LA 1N56A 1ZQKA 5KFXA 1TGOA 3SV3A 1QSSA 3NCIA 3OJUA 2W9BB 1CUKA 3DLRA 4HYKA 3QZ7A 4M9JA 1S1VA 4W5QA 3K75D 3H8SA 2J6TA 3OVNA 2P66A 4M3UA 2FMPA 8ICEA 4DTOA 4BDPA 3CM6A 1S1TA 3M8PA 1GOCA 3HVTA 4EBCA 3KLHA 1KVBA 1VSEA 5DB9A 4F3TA 4RUCA 1ZBLA 4ED6A 2VG6A 1B92A 4CJLA 5DQGA 3DM2A 1U9LA 4O3RA 1SL0A 8ICNA 4C8MA 4DL3A 4DL4A 5KFCA 3Q8MA 2C2DA 3NH1A 4FK4A 2BKEA 4H8KA 4IG0A 3V72A 4IR1A 1S10A 3QE9Y 3QERA 4C8NA 5J2EA 1B9DA 4B9VA 1S77D 2PFOA 3ZD8A 5HRNA 4H4MA 3LDAA 4W5RA 8ICFA 3FFIA 2AGOA 4I2JA 1RXWA 4TUSA 2B6AA 2X74A 4ECQA 4QCLA 1T3NA 4O0JA 4IQWA 3LALA 3TWHA 4ICLA 4NXZA 5J0WA 2DY4A 1ZQCA 4DSEA 4M3WA 2F8SA 4BGDA 3ZSQA 4PHDA 4JV0A 5IINA 4RPXA 2FBVA 3JPSA 9ICGA 3K4GA 2VA2A 4UB2A 9ICMA 3HSTB 4OKEA 3D45A 4WE1A 4CJUA 4M3YA 4JLHA 9ICAA 8ICWA 3V9UA 5HROA 1KEJA 2FMSA 9ICEA 2OA8A 4N47A 4HCCA 3ZDAA 3LP1A 1IKXA 4NY8A 3ZSZA 4HUEA 2VA8A 4DU3A 8ICGA 1RDAA 3CFPA 3NTUA 1BPXA 1EXQA 3DYAA 3OJSA 4CESA 5BOMA 4YR3A 3GIIA 4FS1A 4B9UA 3VQQA 4RNMA 3C23A 5J0SA 5D46A 4M6WA 1RBUA 3ZSXA 3T3FA 2ZJ5A 9ICOA 4RW6A 3SUOA 4KFBA 4DTXA 4RW8A 4ECWA 1VSDA 5HP1A 1WCNA 4FS2A 4XUSA 4N56A 4RQ7A 5C42A 4CECA 2QK9A 3LP3A 2R8GA 4FBUA 3OYIA 3ISDA 2C28A 3ISCA 2XY8A 3M9NB 2YHAA 5FRNA 4DFKA 1NJWA 3Q8KA 4AHCA 4BWJA 3SUNA 1L3TA 4QZBA 2EHGA 1ZQDA 4CJFA 3QZ8A 4OPKA 4DTSA 5C25A 3C1ZA 5J0XA 1SZPA 4CJPA 2DPIA 2FMQA 4I2HA 4QZFA 3OGUA 1T05A 3I8DA 4DEZA 1WSJA 2V9WA 2VWJA 4F5RA 3DI6A 4OLBA 3K59A 3V1RA 4CEBA 4CJQA 5KG3A 5CYQA 1A5VA 1JLGA 4P4OA 2C2EA 3JSMA 2G8IA 4TSXA 4E3SA 4F4KA 4UBBA 5CZ1A 9ICLA 5KFSA 2UVVA 5K14A 4CIEA 1BCOA 2HW3A 1B9FA 2RDJA 3VQ6A 4JWMA 2YKNA 4CEQA 3RJHA 2W42A 1B43A 5J2GA 2P6UA 4TUPA 7ICGA 4PHEA 3V9WA 4CEOA 3RMCA 8ICIA 3JPOA 4BWMA 3HP6A 4I2FA 2Z1JA 1MQ2A 1HJPA 1J5OA 4Z6CA 2Y1IA 3LP0A 3EPGA 1ZQYA 4IRCA 3QNOA 3AVIA 1VSKA 4IDKA 4C8OA 4KITB 2GV9A 4KLEA 4K4HA 4DU1A 3MBYA
chains in the Genus database with same CATH superfamily
2CQ3A 3D6FB 1JCEA 4ICLB 3M6KA 4O3SA 2MQOA 5AQKA 5DBBA 4KTZA 2MQMA 1IH7A 3VAJA 1RNHA 4YHHJ 1DGKN 4JI2F 2Q79A 1MROA 3N4PA 4ILJA 3JAMU 1BXNA 3G8SA 4HHTA 4PCQA 3GE1A 1SL1A 5GAHI 3KHLA 4BRCA 1EKEA 1RQLA 2M9NA 4DMNA 3ELHA 1FKOA 1F60B 5CCMA 2HHPA 1VQ6N 4DR5F 1Y10A 1HHQA 4WU3A 3SPYA 2DNYA 1ZAXA 4UB4A 3W5YA 1ZQAA 1NGIA 2KT2A 1HQUA 1XNSA 5C24A 1Q16B 2V2KA 2M0GB 3CMQA 3TAMA 1VQ5S 1UAXA 1KHWA 2H4WB 1P90A 3NE6A 1VHFA 3G4SS 3RMDA 2G8WA 3SQOP 2YQ0A 3OFHA 4O4RA 2A6MA 4M6WB 3K58A 4DU4A 4O3PA 1S0VA 4OJRA 1YAGA 5HP1B 5AZIB 1WC0A 4AL7A 4XA5A 4J9QA 1YBTA 3CULA 4FLWA 2YHXA 3PNCA 3K2PA 3V9SA 5EXWA 3OVAA 4Y1DA 5CZVA 2C42A 5KRSA 4KMUA 3FZ2A 2PZSA 4XDCA 4OYXA 2YQ3A 1LK5A 3RAQA 1U04A 1HKAA 4X65F 5KFRA 2DHSA 4BX9C 1PVPA 3MFIA 5C25B 2JSXA 1FRHA 2BJEA 4YFUA 4QIWD 3NVMA 4FKXA 1T05B 1J9AA 1RWKB 4KN7A 1Q81T 4X64K 2AF6A 1BE4A 1P8GA 4Y2KA 4NYOA 3ETRA 7ICNA 4QIWF 1FKPA 4MDAA 5DETA 1HA1A 3FNNA 4ZVGA 5JVHQ 1VQSA 1M6YA 3M9OB 3GJRB 2XEXA 3EZOA 3MOJB 3H5YA 2NLXA 3CQYA 5AZJB 4OV6A 3J80Y 2Y9HA 3TWZA 4USAA 1IJJA 1Y5LB 2P9IB 4WJ3B 2GVZA 2V8HA 4CEDA 4C97A 4OX6A 4OCZA 5J1EA 4ZDNA 3ZSWA 4F5NA 5KNIA 3O1LA 4QZVB 2KYXA 5CHCB 1V97A 4CDIA 3IP0A 1JJCB 2LEAA 3QIPA 1R8PA 1S72N 1Y9OA 4DJBA 1RHUB 5LJ3Y 2LHTA 3DRSB 4C9DA 4E7KA 1RYSA 3R1HA 3NDKA 2ZEJA 4DXLA 2F8LA 1WF0A 2O8DB 1X5OA 2EC2A 2JMGA 2J0SD 3OSPA 2R8JA 4FJ7A 4UB6U 3UXOA 1B64A 3KLFB 1NBWA 4DV3F 3MAAA 3BREA 2FVSA 1K8KB 3LWLA 1TK5A 1RDBA 4FE3A 6AT1B 3JYTA 1KN6A 5G5HA 4URGA 1YTUA 3CEDA 1DBDA 5LMNJ 9ICXA 2JEGA 2BANB 2R8KA 2D0AA 4PL8A 3N9UC 5DK5A 4NRTA 3HWTA 2RQKA 4WP3A 3T9NA 1Q8LA 3IN5A 2Q2RA 4LY7A 4YNQA 4WP8A 2P9LB 3MX5A 4WZQA 4JI0J 4ED8A 4J90A 1NCLA 1R0CB 5EX3A 5DM7L 1HR0J 5E3PA 2ZH7A 4AP9A 4BRKA 5HAOA 2HHTA 3THXB 2NUBA 3HHDA 3H2VE 1U0SA 3KK1A 4DR3J 3M6WA 4LF5K 2DK2A 4ETZA 1EO1A 2UXDJ 4NCGB 2CQ0A 5F9NA 4P7TA 5KFJA 1NM1A 4UAVA 3L9ZA 4NPOA 4ZPAA 1CC7A 4EEKA 1UHUA 4EYIB 1RK8A 2LFVA 4Z2XA 3EVOA 1BGXT 1ATRA 4RWWA 4U8YA 3KUGA 3EGWB 3SQ2A 2KM8B 3G25A 5L1LA 2A1JB 1W2BR 2DD8S 1C4AA 1DHMA 2XSJB 1K47A 4RCHA 3SCLE 1PUZA 3MM7A 5A0LA 2OSQA 5AI4A 4GO7X 3R1XA 1HUZA 5GAGU 2XTJP 3AVHA 1JLEA 1X4CA 3CMAS 3S6JA 1LKYA 4HCBA 1UW4A 2ZE2B 1NK4A 1JI7A 4WFAL 4Y2UA 1H2UX 3HHKA 4RU2A 1HBNA 1Z2LA 2V5HG 2VG7A 4LH5A 5D4OA 3PFEA 1N5WA 4IOCL 1F3FA 3CDAA 4NLPA 1TMJA 3NOGA 3HPGA 3I32A 1RWVB 5J0OA 3C14B 3JXUA 2EAOA 3MF5A 2ASOA 4JHDA 2MLYA 2LA4A 1X4HA 1H98A 5IIOA 1HRHA 2FJEB 2BUNA 3UPQA 4DTJA 1U1NA 3T5JA 4CFAA 2KFYA 2ZH9A 3SMPA 2BGGA 5CH7B 3J81U 2XMTA 2FF6A 3GR1A 5DDOC 2A2CA 4UUWA 3C6TA 5BR9A 4ZCMA 4RTFD 2OM6A 2C3OA 3MDQA 3VQ9A 3BZQA 4URSA 4BXOA 5ADZA 4L6V3 3VQ7A 4CH0S 3MR6A 2OPPB 3PW2A 2DHGA 2E8OA 3L7PA 4ES2A 1ZOLA 3B78A 3DDKA 1UP1A 3F5EA 2NCKL 5AXNA 4LF9J 2EZXA 2P6TA 1FFUA 1SS6A 4YD2A 2G0IA 5AICA 2ABYA 3CJQA 4XTTA 3HYFA 4OPAA 5AI8A 4WIQA 2DKZA 2GJFA 3QSIA 4C4SA 1BHLA 1K73O 3QEXA 1WC6A 3QYYA 4KBIA 4JI4J 1AB8A 3SSRA 2CQIA 5EHHA 4FZXC 2YI1A 1VBYA 3IR6B 3WKAA 1N5TA 1ZQMA 1FJGF 3ZTSA 5F0XA 2NXCA 1PAEX 2AYGA 2WTUA 3AY9A 3D0PA 5DB7A 3ET6A 1TFRA 3CTRA 5LMNF 1X4AA 4Y2MA 4GV6A 1I5OB 4LRCA 2AP1A 3PW7A 1VC5A 4PWDB 2L9NA 3CNQP 3SFUA 4TQSA 4AQYJ 1QZ6A 1WSIA 1Z19A 3IXQA 2F7TA 3AQOA 4I2AA 2HQIA 4DV4K 3FC4A 4DV5K 3QETA 1J53A 4MFFA 1MMLA 4JI0F 1QUPA 2M7SA 4MQ3A 2UUTA 4F02A 1ASVA 3LAMA 1I3AA 1I51B 1R6YA 2CWKA 2ADCA 5EVZA 1RDDA 4DV0F 4DR3F 3D1QA 2UXDF 1NKCA 2HKEA 3M2RB 1CJKA 1JIHA 4PXDA 3U9ZA 3DOLA 3DLHA 3FSYA 4JKGA 1FJEB 4O9MA 8ICBA 3UR3C 4NWIA 1N5YA 3CCLN 2VJ5A 4FLYA 1HNIA 4BVOA 2MKHA 5A6PA 1QAIA 1YUWA 5HMXA 1BISA 4B3TK 4UB1A 3PXGa 3FMBA 4R5PB 1RP5A 4K5SA 5GTIU 4DTPA 5L46A 2OFGX 3WEEB 3TABA 3CJRA 3IRWP 4F72A 1T94A 4F4XA 1UFLA 4LREA 4FOEA 4BR5A 3DGVA 4J9PA 1OWXA 1BD6A 3SUQA 3IMXA 4R25A 3M2UA 5KFQA 3BPDA 3PW5A 4MIWA 4ZIVA 1NGEA 1DGJA 5HMLA 3HHLD 3VAHA 1JCFA 5FPDA 1NNEA 2VH7A 1Y0HA 2VC0A 2I9GA 5A8WA 1BUXA 1D1UA 2QXFA 4CF5A 3TZZA 3CXCM 3VQ8A 3RTVA 4UARA 2BDUA 2F44A 3BP8A 4RNHA 3GE9A 4JKAA 2FD2A 4OL8A 1T6DA 1U7LA 5AE3A 3VQDA 4KPYA 5AJ3K 4X66J 3CCRS 3IFEA 2UVWA 3NL0A 4B1ZA 4RQ2A 4CLWA 1URRA 4OO1J 3TP2A 2Y1LB 1HNXJ 3OHRA 2KE7A 2ZKUA 1ZPWX 4CE6A 2DT9A 5KPTA 3CWJA 1AFJA 3VHQA 1IKWA 9ICVA 2FVCA 1HHSA 4J8FA 4DR7K 4OYMA 4PXCA 5DDYA 2ZM6J 4FZMA 5L1JA 2GVDA 4P7VA 4ILGB 4JN4A 2HFVA 1SB3C 1TAMA 3OTOJ 3AVMA 5HRSA 3H8JA 5T7BA 5IIKA 1IG6A 2KT3A 1VQLS 3CIMA 3TEHB 3IM9A 3X3UA 3EWGA 1VC0A 4ZVPB 4WKRA 4O5EA 2K06A 5CRXA 1VRUB 3MMBA 5FPNA 1CULA 4ZVQB 4GVBB 5C10A 2NO5A 9ICBA 2DH8A 3MCNA 4LF9F 4M63A 3VOVA 2ACMA 5KRTA 1HW9A 2Q31A 2BM0A 2NREA 2XSFA 3F2CA 4PQAA 2B9EA 9ICPA 2F8MA 3KOOA 2CGKA 2YKOA 1E6VB 5ALOA 1WELA 3WIVA 2KOBA 1XNQJ 4EX6A 2GWKA 1TUYA 5EDWA 2Z8QA 4F3MA 4JUZA 4JI4F 3MM8B 4AF1A 1H0HB 2F63A 2DXFA 2DRDA 2GWJA 1EJ7L 4C8YA 2YBVA 1RZTA 3BGOP 4NCBA 4K0KK 2XI2A 5IT9U 4ZHRB 2ZBCA 4MYTA 3G6YA 2HRUA 1NK9A 3S3OA 4GIBA 3A5NC 5I3UA 5KG1A 2RRBA 4WYWA 1ZM2A 4AQYF 2H3FA 4RT2A 2F96A 3CJ4A 5AE2A 2HNZB 4WQ5C 2LXIA 5KFLA 4DQRA 1TMMA 4H5WA 2AEMA 5GINA 1BPEA 2HFNA 2XCPA 1L5UA 3PJ9A 2AXTU 5AQPA 2DNHA 1EQMA 4HVJA 2VFSA 3V6KA 2G2YA 5A0YB 2LMIA 3K9JA 1OW5A 3NMRA 2Q3PA 2B5JB 2DFEA 2FC9A 1N33K 1SVDA 4L76A 4OYPA 4ZS6A 4F36A 1N34J 3OPXA 3DLGB 3CC7N 1T9UA 2O66A 4CIGA 2ISOA 1EXNA 3IRXA 5T41A 5AQYA 4EI2A 1DLOA 2OSRA 3KNGA 1HD1A 3SZ2A 1S22A 1XMQF 2NPIA 4S0MA 4F2SA 1XMOJ 4E1NA 1SC3B 1HQ2A 3SMVA 1J2NA 3KOAA 5IWAF 1Q7LB 4GV3A 3FVYA 1LB2B 3VCDA 5EWEA 2P6SA 1WWVA 2RMLA 3IG1B 3N4QA 1Z25A 3RJFA 2NNWA 4E7LA 2UUCF 3J7ZT 2WMMA 5H2FU 1AROP 2FZGB 4YR0A 2QEXN 4HUFA 4Z4IA 1QQ7A 3WIUA 2DNLA 2OPSB 3TZYA 3HI9A 1GQEA 4LFBK 1U6BA 3RF9A 1UCVA 4X2BA 2WCXA 2P1JA 3L8BA 2W2MP 5GAHU 1BI4B 2D6FC 1WUDA 1RHJB 2HG4A 3CERA 2F1IA 3UKUB 1S6PB 3WXLA 2P51A 5AKYA 5IV3A 3ZDBA 2D0PA 2E1EA 4FWNA 1XO1A 1XNRJ 2XMWA 4Z6FA 3HO1A 2XMAA 4GKKK 1JALA 4WPAA 4YMOA 1BQMA 2AEFA 4X66F 2A40A 2GUPA 3HX0A 2G9OA 2ZJRL 4RQ1A 2OTLS 2K4EA 2EWHA 4DV2J 4A8KA 1MA9B 2WAQC 1HNXF 4IOAL 3MI7X 3OXGA 4DZ6A 4PXBA 3DOMB 1SXLA 1KRPA 4ZLJA 1WHVA 2E1RA 1IXRA 4WK1A 2E5LK 2ATLA 4KV8B 3OTOF 1N5XA 1Q9XA 3T5KA 1RKIA 2NLWA 1PO6A 2ACYA 3D6RA 4NYZA 2DHHA 5KT6A 4P0QA 2A1AA 4ZPVR 3R7BB 2V8PA 4EENA 3R2CJ 2RN2A 5DLGA 1FF2A 1QE1A 1A6LA 4CNQA 4LIWA 3BY5A 4RQ8A 3QUQA 1RCOB 1S79A 2KV2A 3FC9A 3GG4A 5HR6A 3QNWB 5DQHA 1ELOA 4E89A 4Y2RA 1U4BA 2V8VA 1SBRA 1XNQF 3D2FB 2CXEA 2A3JA 1SZ2A 2YX1A 2CN1A 4OX9F 2D4WA 1IG9A 1NMNA 4A8QA 2ZC3A 4V19X 4UAYA 5LJWA 4B3OA 1QTNB 4IG3A 2COLA 1TYQB 3KHRA 2AP6A 4ZPDA 2I6WA 3G10A 2VC1A 3C19A 3EXCX 2XZWA 5HJXA 4DFPA 1A76A 1P27B 4JK7A 3A3PB 4KLUA 5J2QA 3KVGA 2AYMA 1EWRA 3C15A 1N36K 1Z3EB 3ICXA 3IWXA 5ITHA 2GGPA 1XK8A 2FXUA 4YY3J 1WUAA 1IR2A 5I42B 1RWOB 2KKZA 4B3MJ 2HHQA 3NGTA 2F3JA 2JWNA 5AKLA 2YWEA 5ETLA 1MWQA 2YPZA 1RAJA 2OMLA 3MCMA 3CC2N 4RO0A 4PABA 4OJ3A 2KSOB 5MAOA 1FFGB 1RT3A 1URJA 5LY3A 2CA9A 3DFEA 1N34F 4EO8A 3M8SA 4V19S 9ICFA 1NHKL 2KIVA 1KFTA 3VAGA 2W7AA 4X62K 3EJMA 4PXEA 3BGRB 1SUQB 1VQ7S 1YX2A 3AJ1A 2X51A 1CZBA 4ZJOA 1XMOF 1AUDA 3RJJA 5JMVA 3QAEA 3C66A 2KRRA 2V94A 1E4FT 1RT1B 2NSCA 1HJRA 3W9IA 4DX7A 4U67Q 3NGSA 1B7FA 1REVA 2J9DE 2XS2A 1VMBA 2RVJA 2YH0A 4EMDA 1KCFA 3H20A 1GLAG 1PJ6A 3AAQA 3WKCA 1KOOA 1IM4A 4DR6K 4OKKA 1KVCA 5U47A 4ECTA 2NXNA 4I0WA 4XDDA 1UETA 3NGKA 3UXNA 1HQEB 4P0PB 2NRXA 4O3MA 4RR5A 5KG4A 5K20B 5HJYA 3BS7A 4DCOB 2FI1A 3W1YC 4Z7CA 3D2SA 1LOTB 1TUVA 1X7VA 8ICSA 2K4PA 4ES3A 2AJ4A 5HRRA 4UBCA 4LVOP 4YN3B 4DV2F 2KDOA 2FJVA 3GU0A 3KJQB 1ZOTA 3MGIA 4NLOA 3M6XA 2CQGA 5JVGQ 4R8UA 2CJXB 1Y5IB 1JKHA 4KLOA 3UD4P 1MWYA 1S57A 2AHOB 1ZJMA 1NSQA 3H1VX 1TUWA 2ROEA 2D0BA 4EHTA 3ZT0A 1HKBA 4AHTA 1HYSA 3T1YK 3MEKA 2ZZMA 1M5VC 4O4GB 2C2MB 4TLQA 1NPKA 4ZITA 1ZQLA 9ICTA 3MM9B 5D4NA 3ALYA 3M2VA 3TPQA 4R66A 3EO3A 4DLEA 2RDIA 3MUTP 4JI8J 4UOGA 2B8PA 4LR7A 4JKDA 1A7GE 4Y2AA 5F3XB 2FHJD 4JB3A 2KK0A 1R27B 1SJFA 2W7PA 1IJEB 3QDKA 3VGTA 2QB1A 3EVWA 1SC6A 3H25A 1ZBTA 3CE8A 5B7WA 3CCMN 1YRUA 3FM9A 3Q7BA 1SIJA 1WHWA 4I2QA 4DPUA 2F4VJ 1AT1B 2ZH2A 1FEEA 3DJCA 3KWMA 2BABA 3UD5A 2VJUA 4BRDA 1ROFA 5HNKA 2E29A 1BIZA 1CJUA 2APOA 4NE9C 3O6WA 1LWEA 2VZ9A 2Q3SA 4BRIA 1A9NB 4CYUA 2RQ5A 3MC1A 1YI2N 4YY3F 3DMJA 5L9XA 4W5NA 4K4SA 3E1YA 5DS7A 4IBNA 4CVNE 2GMLA 1GT8A 3L4PA 2Z2ZA 3C8YA 2CDRB 4RJVA 3ULEA 3KLHB 3DGPB 4K42A 3EZWA 3OBIA 3CCLS 1YK9A 4X84A 3ETLA 4TNOA 3VN5A 4LF7K 1GX6A 1BC6A 9ICHA 2OELA 3ZX2A 3M1VB 4H0YB 3G6XA 3DM2B 4DTMA 2QB0A 3TVZA 4F4ZA 4PA1A 4Y1CA 1YITN 1RU2A 3L6QA 5KT5A 4OZ5A 2WSFC 4JMUA 2EVZA 1FK9B 4IG0B 5F0UA 5B0BA 4L73A 4OI1A 3UKRB 1ZQQA 2AGQA 4XPCA 4LFCK 2QO3A 4H4MB 4ECVA 4K8ZA 4M47A 4EZ9A 5JUMA 4ZPBA 1CEZA 3WT0A 1HLWA 4RNFA 3OYMA 3HM8A 3TARA 1RBTA 2QJ3A 2PBDA 4M9GA 1YT3A 2W9CA 1CXQA 3HILA 1FX2A 4YOEA 2P9PB 2ZUGA 5ETRA 2J9DA 5AQMA 4KHUA 5KFPA 3IM1A 3FMWA 1GX5A 3ISNC 3C6UB 2GWSA 1NK0A 4Y0FA 3UQSA 4BR0A 4PYDA 4DN9A 3RH4A 2IOFA 1YZ7A 2PDAA 2ZFHA 3KUHA 5F8NA 2KW4A 4EAHD 2XULA 3EL2A 3DDIA 1IV0A 2GIFA 3HHEA 1CI4A 5KFKA 4I7FB 1N5SA 1S5JA 3LPEA 4OX7A 4M3ZA 3QSYB 2DBYA 3PTWA 3P5JA 4JNEA 3SAHA 1ZA1B 4F50A 1Y00A 1YRXA 2JGUA 2I0XA 2RRNA 7ICHA 1L7PA 3WK4A 1OXJA 3A0BU 1RTIA 4QS9A 2PE8A 1HBMA 4KT0C 5FROA 4L74A 1SV4A 2KRBA 2W6KA 3HI0A 4J9LA 5KFIA 3TUJC 3CG7A 3QIOA 3MECA 1CJTA 5AR0A 3LAKA 4DTUA 2DXEA 3W2WA 1RU1A 3OTDA 1JMSA 1YKWA 4NZ0A 2W03A 1D8ZA 2CPJA 1NU0A 4YXJA 4KRWA 2H3GX 4YN4A 3T7ZA 5CYJA 2FIUA 1BWFO 4JKEA 1W9HA 2FF3B 4M63C 2KP7A 4JI8F 2WW4A 3EZ5A 3F73A 1EETB 4PG6A 4CIOA 3LO3A 3C1YA 1RT7A 1N32K 1T7PA 2XY6A 1S4FA 1VGYA 2WF8A 4Y2VA 3ZETB 4DR2F 5CABA 4OPHA 2ZIXA 2WOMA 5K14B 2A5XA 2EK6A 4FP9A 3FZLA 2QT7A 1U25A 5DKWA 1BL3A 1RWMB 5HRPA 3TANA 1V6HA 3ZX3A 1Y3JA 1VLBA 3AEVA 3QYPA 1LOUA 2F4VF 2WHOA 3SQGA 3BSOA 2LBOA 5KFYA 3RSEA 2YTUA 1YJRA 2ZJQL 5KFOA 3RB6A 2QYGA 4DFDA 2MB0B 2HBYB 4G9ZA 2MGZB 3QRRA 4EEYA 1IXKA 4CT8A 2CPYA 3PMLA 3KD5E 3HX9A 1K0VA 1XR7A 2IM3A 2X1AA 4CRJA 4BC7A 3ETMA 1VSLA 2G8VA 3M1FA 3RJKA 4NLYA 1AUSL 3QNNA 3DLJA 1LXNA 4K4GA 1IBKK 1KWMA 1Q7YT 4HI1A 1RAFB 5E3CA 1ZQSA 3THWB 1Z4OA 4M5JA 1BQXA 3L3FX 1WUUA 3F41A 3BN7A 1BVSA 3R5GA 3C46A 4YCXA 4U6PA 2AEJA 3LWMA 4I6MB 4JK1A 4ANCA 1G6BA 2G2ZA 2E8PA 4C0BA 1S3XA 5H9FK 5FPMA 4DV5J 3DHWC 5CZ2A 5C24B 3UDLA 3D2EA 4ILMA 3TAMB 3V5RA 5KFBA 3CW2C 2AJ1A 4DV7K 3EYZA 1RT5A 2OPRB 1H73A 2R42A 3M32B 1HJOA 1GLJO 3ICLA 4OI3A 4KMOB 2VFUA 2EPIA 1C6VA 2BJ8A 1FO1A 2GCFA 2HIQA 4JKBA 1SKWA 4USTA 2HSZA 5E33A 2IGIA 1RILA 3DC2A 1RACB 1HBUA 1FD8A 4FM1A 4X4VA 2B51A 3EUNA 4MFAA 3HXMA 3U7JA 3R7SB 9ICQA 3T9ZA 3KNAA 3RMAA 3W66A 4B3TJ 2FTRA 3AA5X 3V4MA 1NG9A 4CZLA 3G8TA 5E41A 1NJIO 3KJNB 5J2NB 1DXSA 1BUPA 3D3BJ 1D0EA 1SPBP 4GKJK 5T14A 1R0AA 1YTYA 4IFVA 4W5TA 4ZCLA 5I3PA 1CBKA 2AZ3A 4CO1A 1F5AA 1IR1A 3D2NA 3C2LA 4FPBA 4YB7A 4NM2A 2IVOA 3QGIA 5BOLA 1FKPB 1RTJB 3MMJA 4ED7A 1NLKL 3TOQA 1M5OC 3GONA 3OS1A 4UB3A 2UUWA 5KG5A 1G2EA 2FDRA 1IO2A 4RNNA 2MQQA 2GVZB 2KHCA 1PJ5A 4OYBA 4CTAB 5DO2A 1WHYA 2E8AA 2Q1LA 2Z2LA 5J1EB 4RWXA 1JUDA 1F9EB 4KLTA 3UN2A 2JRZA 1W2BM 1F2HA 1TGOA 1Z1BA 3IDHA 5HANA 3QIPB 3W64A 3VVTA 4YORA 4DR7J 1B0VA 3FJ2A 3IGNA 2XMKA 4M9JA 2FJDB 4W5QA 4J91A 1GMWD 4U7BA 2FMPA 1F5BA 3CM6A 4HI2A 3RRKA 5LSLA 2R7VA 3EMTA 3MAAB 3OVSA 2O3DA 1SJQA 1OKJA 1VSEA 2N3OA 3JYTB 4IO1A 4JI5K 1B0PA 2EFOA 1B92A 3PEHA 1LQ9A 1UQVA 4CLZA 6FD1A 4QU6A 5M1NA 1U9LA 3UDVA 8ICNA 1SL0A 1DKGD 4QIWC 3LGMA 1VDHA 4DL4A 4AYBF 2R7QA 3OFEA 5D4LA 3Q8MA 3C16B 4FK4A 1PK3A 4H8KA 3CUNA 5KL1B 3D0IE 2WSEC 4WFYA 4PR6A 3QE9Y 3PFOA 4Y65A 3QWUA 2ZWHA 3WK8A 1S77D 4EFAC 2PFOA 2QWQA 1OY9A 2FDNA 3UE5A 1GLEG 5FDLB 3FFIA 3OTQA 1PVQA 2UXCK 3K5PA 1H6KX 3CCVN 3HCXA 4ECQA 4Z94A 3A5OC 3MEGB 1U02A 1MU2B 4ICLA 4LF4F 2DY4A 3J7YI 3GMGA 4KJIA 4OJGA 4P52A 3ZSQA 1NGHA 2HAFA 3W5XA 2C2KB 5AKEA 4IFEA 3HRDD 4KHPJ 3D28A 4H4KA 1UVJA 3UO0A 3HSDA 3PJXA 3QFHA 4M3YA 5B0GA 5AKGA 2GJIA 3CHWA 3MMAA 1R89A 1KEJA 1TL4A 9ICEA 3N28A 4N47A 3CJAA 4CZJA 5FIIA 3R27A 4CLPA 3MM7B 4X4NA 3J7AP 3M6VA 3MPWA 4Y2JA 1BU6O 2VQFK 1GLFO 3KFUF 3GIIA 1Q3UA 1JLEB 3C23A 3I8BA 2OP5A 4M6WA 3VCBA 4BG8A 1X5PA 1LKYB 3HLUA 2M52A 1EHWA 5C7PA 2KIWA 4RW8A 2QTWA 2KKHA 5HP1A 5AZIA 1WCNA 4YMEA 2KD1A 2FHOB 4B1VA 2AW0A 4N8OA 2R7TA 2CKWA 2CNKB 4P72A 3JSBA 2QK9A 3ZX0A 2P9UA 5EX5A 4IO9L 4B3TF 4P73A 3OYIA 2IYIA 2HPUA 2WB1D 3M9NB 3L3CA 1RUSA 1YJNS 2H4YB 4CBWA 3IRUA 1IBLK 3F2KA 3SUNA 1L3TA 3O5TB 3G71N 4CJFA 2P8IA 4OPKA 4NI2A 4OI6A 5C25A 1Q79A 2K8CB 2R4FA 2L9DA 4QIVA 2HFZA 3US5A 5ALWA 4I2HA 2GHVC 1T05A 2Z2MA 4DEZA 1FE0A 1WSJA 3DKDA 4OLBA 3K59A 1T44A 4YEAA 4CEBA 2A0FB 1B0TA 1RA7A 3E51A 1NPRA 3Q83A 3HVTB 2XZDB 2C2EA 4CO2A 4F4KA 4UBBA 5CZ1A 1VQNN 2HHHJ 4CIEA 4CZGA 1XTZA 3GFXA 4GKKJ 1B9FA 1P6TA 4Q7AA 5F41A 1RQNA 3UCGA 3VQ6A 1C2PA 4CEQA 3RJHA 3LM9A 4ETXA 2LQ8A 1O08A 5KOXA 1B43A 2P6UA 7ICGA 4PHEA 4JI3J 2E2PA 3HP6A 3A3NB 1IVZA 3VV2B 3ZFVA 4ES1A 5DM7Q 4DR7F 3EPGA 4OV1A 2E5LJ 1F9FA 2CPIA 2YWWA 2G1DA 4KITB 2EBGA 3K8WA 4K4HA 1B3TA 4BRPA 2R2RA 2B6AB 4OI0A 4FFDA 1PBUA 4CF4A 4MKBA 4EBEA 2KVSA 1NJXA 2HNYA 2VKQA 4JI1K 4NXMF 3TZWA 5IFMA 3IAS9 1J54A 3KLFA 3AVJA 2MJNA 1K8KA 4JI2K 1FWKA 3FCVA 3NWGA 3LGHA 2LM1A 2G8UA 3RJMB 3C95A 4IR9A 3RW7A 1X9JA 4FXVA 5HROB 4GVLA 1SJRA 4YXMA 2V4JA 4LZGA 1PBAA 4JBCA 1RXVA 4DR5K 1WAFA 4G65A 4KLHA 1TKZA 2JH7A 4V1Ak 3L3VA 4BROA 2AU0A 1M1KT 3ZCMA 1X42A 4WCEQ 4QNLA 3OYGA 4WFAQ 4KHRA 1VK0A 1Y3KA 1V3ZA 2CRLA 4UOCA 4K8RA 5AI0A 1OYEA 4RUBA 2GZOA 2M2BA 1CJKB 2OGUA 1LAVA 1ZQVA 1PAUB 2VG5A 2DR8A 3OR2B 4DSIA 4KHPF 1NSAA 2K8GA 3DOLB 4JKGB 1WC1A 4DKWA 1N36J 3VTIA 4BACA 1HNIB 2EX3A 4CFBA 5LMUF 5KG7A 4M5GA 1N8RO 2A1JA 3IKMA 4NOHA 2XQCA 4DO9A 3CJ9A 2CADA 1K9MT 1NWKA 2N7YA 4QWBA 4QWCA 3C5GA 3EPIA 1T9YA 5BR8K 1FTCA 5DDQC 2OFHX 3M2UB 4IQTA 1MG7A 2GAGC 2ZVSA 1HNWJ 1N0VC 3EKUA 2BRLA 2G5HB 2PMHA 1LNQA 4ICAA 3UN3A 3JSMB 2H3IA 8ICRA 3OV7A 2XI9A 2Y9UA 5AT1B 1M90T 2OXOA 4O3NA 2JEFA 2LLZA 3OUYB 4AXJA 1HL6A 1JN3A 3CMEN 3IFRA 2G06A 3LPUA 3C2MA 1UEKA 4P9SA 1IKWB 1L8LA 4RU9A 1MN7A 4C7QA 4NV0A 2GVDB 3AMZA 2PFFB 1X9MA 3F9KA 4O0IA 3K5OA 2E6MA 3DAWA 2HSEB 3Q23A 3WNFA 2QA4N 4GC7A 7ICLA 1GTEA 5KG2A 4FZYA 2ZH6A 4X4SA 1NM2A 1RAAB 2X3GA 2HHHF 3VTHA 3AXMA 4ATNA 4A48A 4KHNA 2KKPA 4ZVSB 4C3LA 3R8YA 2VPWB 1CULB 1S5ZA 2Y1RI 2JC0A 1YDLA 4DTRA 1WCLA 1VS3A 2CG8A 2CIMA 4MK8A 4JI3F 2Q6BA 5HLFA 3O3FA 2VJ4A 4YOYA 1QJHA 1TKTB 2EFQA 3KK2B 4J9KA 3OHBA 3QBCA 2LYHA 3MWBA 3TR8A 2NRWA 4A2BA 4B9TA 4KH5A 1VHIA 1VQKN 3RRGA 2QLJB 3JAMY 1ILYA 3S3MA 2E9RX 4IKFA 1HIYA 5KG6A 2Q1NA 5D0HA 1HUOA 3CDUA 3MXJA 1S0MA 3M8RA 4ZIWA 1S6QB 3EZUA 3MCAB 3NHGA 8ICXA 3CIZA 2B56A 5LJVA 2QA4G 4LT6A 4FNHA 4K4UA 2QG9B 2FLNA 4U7UD 1YG0A 5I3UB 4FJJA 4O3OA 2BACA 2QLFB 3N01A 2B7BB 3QAUA 1NDCA 3BYRA 4B1WB 4TYAA 3W61A 1RHKB 3WK5A 2GTDA 4KBOA 2CQ1A 2RU3A 9ICUA 2RB7A 4PWDA 2Z4PA 2YH1A 2FGOA 5IIJA 3W8PA 3EY1A 1SJ3P 4CGFA 3R6MA 5D77A 4P6QA 1ITPA 1COKA 2JNJA 8ICYA 3ZDCA 3QT7A 3SENA 2KG5A 4X4OA 3UR0A 3GIJA 3PJWA 2JLGA 3IRXB 1NK7A 1JXVA 4WTOB 5LL6Z 4CFCA 2HBZB 3AY0A 5D0GA 3M2RA 1N36F 3H08A 3MR2A 2QL5B 5IC6B 1S0OA 4DCPB 2QLTA 5CHIA 2NS1B 3FYHA 2RHKA 2Z30B 4QBUA 1WB9A 3O1BA 3D9BA 2XMJA 3TFRA 4GMJB 3WK9A 2XO7A 5CB1A 1W26A 3NS1A 4ZVOB 2MKJA 3F0NA 1C0MA 2A1RA 1HWUA 4ED3A 5HQ8A 4LF7J 3V7JA 1CSJA 1YJWS 3BDPA 3KD1E 1X40A 2I5JB 1GXUA 5C2FA 3VGMA 2E9TA 1HNWF 4A2AA 1T02A 4BR9A 4ECXA 1RISA 1SJ1A 3VZIA 2ZBRA 2BX6A 3RB0A 3MDAA 1GNKA 1KONA 2HHWA 4IUFA 4LFCJ 1Z6RA 1VISA 4C2MA 2LP4A 3P8BB 2YQ1A 2P5GA 3MMCA 4NLTA 4C7ZA 1XO0A 1FEHA 4NASA 4P2FA 1V38A 4W98A 3RBDA 1VC6A 2XRIA 2ZTCA 1ZBIA 2V4RA 2DPNA 1TR0A 1U1QA 1KSPA 4JWNA 2PEHA 3KLEB 3CCWA 3T19A 2HBKA 3R5CA 1GMVA 2V2VA 1QZ5A 4F7VA 3BKUA 1PYOB 2W4CA 3FGUA 4F91B 2HRTA 3PUFA 2VBYA 2UZAA 5AQGA 4BR7A 4A5AA 4CZFA 3LVWA 2HWTA 1EKRA 2MSTA 3HULA 4M5IA 1FJGK 5IXUA 2DCLA 1QD1A 1VRUA 1SCJB 1ZYQA 5C0YA 1TV9A 5LMNK 1WORA 4KLSA 4QZDA 3AO5A 5D3GA 3FRYA 1JLQB 2FPKA 5A2QU 3RBEA 3VQCA 3N4WA 5AM4A 3L0QA 5JS2A 3AJ2A 1T9WA 1RA6A 2GS8A 1T03B 1E6VA 3BBBA 3HT0A 3ILOA 3DRPA 3JPRA 1SH2A 2E7XA 2O4GA 1J27A 4B3OB 1R8AA 2D3OR 3RR8A 4DU7A 2KXNB 1SH3A 2CPZA 3NG8A 3T5LA 4CBUA 5AQLA 3OS2A 3LZIA 1WDTA 1NSKL 3ENBA 4W5OA 4DV0K 5J2QB 1RLCL 5ETKA 3CCVS 3ED5A 5KAFU 5TISU 5DBAA 4ZHRA 4DR3K 4K4IA 3O4NA 3ZZRA 2CAJA 4OZJA 1UA0A 1JLFB 2ZXHA 1TZ0A 1WN7A 3CRXA 2PN6A 4MMOA 1XSPA 1CS4A 4NLSA 2VWKA 3HZ6A 4W90B 5KFHA 1V5IB 1QAYA 4NL5A 3EE8A 2W2NP 4FJHA 2HNZA 2H51B 2VANA 3BO4A 1YLXA 4DB3A 3KHYA 4FJ5A 1IUJA 2P9EA 4RZRA 4CCHA 1FESA 4U8VA 2CJAA 2V7ZA 3CCUS 1RT3B 3JPNA 3PIPQ 3VAIA 2H3VA 2OZMA 2QZ8A 2Q4TA 2VWBA 3PV8A 3V81B 4I2CA 3IC1A 1KHVA 3AARA 2H3QA 4A5BA 2BPCA 4J9MA 4H4KC 1A6SA 3QQCD 1YJVA 3QINA 2WZ1A 4TY8A 4CGJA 2YWGA 2P9GA 2F5GA 2ZJRQ 3HKZD 1DARA 3K8VA 4IOAQ 4QR1A 4GXJA 3BZKA 3JPTA 5IT0A 1H38A 3Q7CA 1V3SA 4CE9A 2JFDA 4MIBA 3LW5C 4FJXA 1IBKJ 1REVB 3HKZF 2QL7B 2U2FA 1HYZA 4KLLA 3SAGA 3IG1A 2WFBA 3AL0B 3RH6A 3V7LA 4HDGA 4WBFA 1F3VA 4OX8A 2KXFA 4TN2A 3J7YU 1V4SA 3GBTA 2ZJAA 1FVQA 4OJLA 4XEIA 1VRTA 4K43A 1ITGA 4LFCF 1ZJNA 1U0HB 4FO6A 1DURA 2IYGA 5H9FJ 4BE2A 5BRDA 2ATQA 2VB6A 1RWWB 1S6PA 4DV7J 4FYYB 3CJ5A 1GO3F 4O5CA 4Z6EA 1LWFA 4BC3A 2IVFB 3E01A 3MN7A 4L72B 3HVWA 1NHUA 1Z05A 1VQNS 1FFSB 4LF9K 4QW8A 4RQ0A 3K5MA 3AVNA 3DOMA 1M5SA 3PRVA 1IV8A 1N61A 1H7WA 4R8UB 3VESA 3FK4A 1YXQA 3B6BA 4CEEA 2W8KA 5AFUH 4YD1A 3AFGA 4BR2A 1SGGA 2QXLA 2C2ZB 1P8ZA 4C7YA 1P7DA 1NZPA 1F21A 1U47A 2PT0A 4WF9Q 2IHR1 3K1RB 4AL5A 4RBVA 5CAAA 2OEHA 1Q95G 2IJFA 3E2EA 1UOCA 2VPXB 4C8ZA 3UQ0A 3MN6A 5DQIA 3TTCA 3CM5A 1UFKA 4AQYK 3AVFA 3UN5A 2OZSA 2YX8A 3TQEA 3D2FA 2G8HA 4CBXA 4DUTA 2RE1A 2VFRA 2D9PA 4KHQA 3AH6A 5HR7A 1S6UA 2Q0RA 3MN5A 3JTNA 2D3DA 4J2AA 4I2QB 3EE3A 4JS5A 1ZQNA 5ALPA 2ZDPA 4FXDA 4FLVA 3GB0A 4WK3A 3UMCA 1ZQPA 2F9DA 2RQCA 1CJUB 1PCAA 4HHUA 2K4IA 1J6ZA 3N6NA 1R59O 3VPZA 2QKBA 4CYUB 2ZITA 4ZCIA 1QH9A 1RI7A 3WC2A 4ZN1A 5HHIA 1QTMA 3P49B 3DMJB 3D6TB 4HACA 1XMQK 3K1ZA 1Q46A 2VIXA 2DGSA 2WC9A 2L08A 4M5DA 3O4QA 5IWAK 2X3DA 1U2RA 4PKDB 2A3VA 3H0RB 3MM6A 3JXOA 1VLYA 3BDEA 5GAGI 1YRTA 1YJTA 3AVBA 4KLGA 2QB0B 3C7NA 3SBGA 2UUCK 1MC8A 1RTZA 3NAEA 3S7RA 5ALRA 3F5AA 3I33A 4NMLA 4I67A 5EUHA 2NSBA 2DXDA 4G1IA 5AXMA 2FVQA 1RAHB 2NRZA 3BGRA 3Q8UA 1NKBA 1JQGA 4HKQA 3QEBZ 7ICKA 3O9RA 2QWMA 4Q43A 2FPHX 2UXCJ 1D3WA 3KFWX 2KM8C 3MABA 4PZVA 4H5RA 4MF8A 2Q0UA 1DK3A 1S1XA 2W9CB 2NYHA 5AQJA 4FK2A 3GP9A 2IOHA 4X66K 3ID8A 3KZIU 2KQ2A 3ILLA 2B3TB 1HNXK 3N7RC 4PHAA 4FZNA 4J2EA 2OEMA 5E2QA 5AQSA 3U02A 4AE5A 2EBEA 2W40A 3I0RB 3RYLA 3U6FA 4F0KA 3NVZA 1K0TA 7ICFA 3H5UA 3H46O 3B0YA 4DOZA 2MUTA 5J29A 1U1RA 3R3LA 1W7AA 1FW6A 1KNZA 3ISZA 3VETA 1WACA 1HQEA 3TA1A 4C4RA 4P0PA 1JJHA 1VR6A 3L3UA 1X1PA 3PKYA 1D9DA 4IDHA 4ZK7M 2HVHA 4OLPA 4FO0A 2QA4S 2AA4A 1RBVA 3WKDA 2YQEA 2QC3A 4I6YA 2QARB 3PVXA 3BPSP 2XO6A 2VQFJ 3Q8SB 5GMEA 1SI9A 1ZQHA 2XNQA 1JXBA 4BJQA 3SMZA 4XIUA 2Y9TA 1S8OA 4AM6A 3HPHA 3CD0A 3SCXA 3O0FA 5KFVA 3QGGA 4C48A 3CCTA 3F2BA 3NASA 2OKQA 4PG4A 5IT9Y 3LPTA 1CJTB 3VF0B 3W2WB 1XNQK 2YHBA 4OX9K 1KP6A 2JFKA 1AZSA 2C3YA 2CVIA 4UAWA 5HVFA 1VQKS 3ITHA 5HP4A 4FJ8A 5CZXA 1IBLJ 3FAHA 1H2VZ 1TL1B 4JS4A 1S4EA 4O4GA 3I9V9 3PG9A 4FN5A 2C2RA 4CLKA 4G9BA 1RT7B 2D7SA 2BJ7A 5CR4A 1ZQUA 2JWLA 1RAGB 2CRXA 3ZTPA 5HHHA 2E1PA 3HTVA 4M0AA 2ZH4A 1BQNA 5IILA 3EDRB 1FXLA 4PJ0U 1GMUA 3C3LA 4PWWA 2ZIXB 3TADA 3OL9A 4ECUA 4M3XA 1U24A 4DHVA 4DOBA 4QZEA 1GLCG 3QJPA 1RPLA 3OPKA 4DS4A 2KXHA 4YB5A 5J2HA 2BKPA 1VQ4S 1WNSA 2CJBA 3SQGB 4Y2TA 3SYZA 4KI6A 3KHHA 3SBTA 3SSQA 3FLCO 2KICA 4MH8A 1K73T 3G0ZA 3IR7B 3TA2A 1NJZA 3SD7A 4LRAA 2DGWA 4E7IA 1VQPS 3A4TA 2CPXA 3H0PA 1WG4A 1K8AO 1XMOK 3QT5A 2AWZA 1ZD5A 3NF7A 2HWHA 4YDXA 4B3RK 2NYIA 4CGHA 4F5OA 3CCSN 3DRYA 2ZQBA 4FF1A 3GFYA 3CO0P 2LDYA 1OH5A 5JVHL 4CD3A 1H7XA 4JI1J 3P5BP 4Y0WA 3DGPA 4BRAA 1CLFA 5AXLA 5BYRA 2MZJA 3LQVA 3OR1A 5IQQA 4NZ6A 3KMSA 4JI2J 3BKFA 4JRPA 3I82A 4F3QA 3M1VA 3OA9A 2E20A 1WAJA 4KH1B 1ZQXA 2BR0A 4A4JA 4CZKA 4EO6A 1LAWA 1FK9A 4OQJA 4OPJA 1UTAA 3CDWA 3UKRA 1AFIA 4FJIA 4DR5J 3PACA 5F8JA 2UXCF 1RBSA 1UMJA 1VJWA 1F44A 1KDHA 3BUZB 1UVLA 2CQHA 5ADXH 2M8DB 5ADXA 3D6MB 5ALFA 2OMOA 4UOFA 2HOEA 5TZVA 5E84A 3S41A 4ZPCA 4UAUA 1FJCA 4CZIA 4CZEA 3W3DA 2K8AA 2MJUA 4DV2K 2P9PA 2G09A 2RQMA 1FKAF 3L2UA 4LJXA 3QEAZ 2QM1A 1RGVA 3C6UA 2YNGB 3G82B 2HOIA 4ZLNA 2UUAJ 5D6GA 3CPEA 3VQAA 4F3OA 2JLFA 3UNGC 1ATSA 3KZBA 4F8RA 3HPOA 4NYFA 3CJBA 3ZZUA 2BPFA 1ATNA 1FXRA 1C20A 1R0AB 3FE1A 3UIQA 4LBIA 4IFVB 4I7FA 2BCQA 1V9OA 3QXGA 3GU3A 4KLDA 1O03A 2ILZA 2NRVA 1RAIB 5BR8J 4ZOHC 3OXLA 3TVYA 2X6NA 1Z00B 4JI6F 1WTBA 2YX6A 4NLBA 2Y0SD 3CVKA 3M8QB 1L8OA 2XVTA 1W0HA 5B0FA 2OI2A 2KTQA 2LPEA 4AXIA 1A5WA 3S6EA 3CDEA 1ZQWA 4NLUA 1KQSR 4ZVHA 4FJLA 3VGUA 3C65A 4CNZA 2K3KA 2Y0SF 2YKMA 2UUBJ 5MLCQ 2QLBB 2ZJQQ 3S9HA 3R6GB 1IBLF 4Z0UA 2HDOA 4KPCA 2GBZA 2RF2B 1V9PA 4M8LA 3KLGA 4I4BA 1C7YA 1U09A 4OKJA 5LL6d 2ZJPQ 4KHSA 3SR6A 1X9SA 1QQMA 1EETA 5KPZA 2AQ0A 4M9LA 3NEKA 4CK2A 1KLNA 1OS5A 4YY3K 2PO4A 2F9JA 2MHNA 2DQNB 2YWFA 2CH6A 4M3RA 4P2MA 3ZETA 3VEZA 3ALRA 2G08A 4DL7A 4L3NA 4KQZA 2W25A 4QWEA 1NKEA 4I2IA 2V69A 2PMZD 4FJ9A 4GXIA 4BDYA 4FJGA 2YMPA 2F1HA 4J9NA 3SI6A 8ICUA 2R7RA 2G0CA 1Q8IA 1KEKA 4I56A 5JICA 1L3VA 7AT1B 3ZT1A 2PMZF 3QU5A 4CLLA 3MFHA 4UW9A 4USJC 1VQ8N 3B8AX 2B4VA 4OVLA 2ATCB 2I6XA 1UPHA 2QFJA 2EG1A 1WBBA 2MGZA 4A8WA 3O44A 2J9CA 5CCLA 5J2CA 4M5LA 4LBHA 3QWPA 2G2OA 1PC4A 2G4BA 2ZVIA 2RS8A 5AQZA 1JLAB 5E3RA 5LSOA 5EU7A 4JI1F 2BBEA 3S8SA 5ALIA 2L5YA 5JXSA 1NJYA 3BR9A 1CLQA 5ETVA 3EWAA 5AQUA 4ELVA 3H42A 5EN1A 3TX8A 1V3RA 2DNOA 3THWA 4DQPA 3O4WA 3O8WA 2ZDOA 3CF5Q 1PIEA 1JCGA 3RRHA 1IBMJ 4I6MA 3MMAB 3DLLL 3W62A 1QSYA 3JAMO 2FVRA 3HK2A 3U9DA 1W2IA 4XQ8A 1SV5A 3AGKA 4US9A 2KN7A 3RGIA 4LFAF 3K0JA 4YB6A 2G0AA 2F40A 2J5AA 2XGQA 2N3LA 3TVKA 4PG8A 3QFUA 2A10A 3M6UA 4AILC 2EG2A 1X9XA 1WEYA 4AYBC 2P5VA 2OPRA 4FWQA 5L1KA 3M32A 2XC9A 1WSHA 1R3NA 4CGZA 2YKQA 2L41A 4RW8B 2OAUA 2PSZA 2FJBB 1DAXA 2YHYA 2M0NA 1ZAVA 3FBCA 4WTYA 2I1RA 2P9UB 2W43A 1EB0A 1M1HA 4ZPTR 4PY5A 4HTIA 2UUAF 1B4SA 3O9QA 1FNXH 1FDDA 3O9SA 1UT8A 3GJQB 2UP1A 5J2DA 2J9EA 1RZMA 4I2PB 2OH2A 5EWGA 3H2LA 5DDPC 3TR5A 5KT3A 3C2KA 3ZNUA 3VEXA 1FEZA 2YTCA 4M41A 4O44B 5J2NA 1WKKA 2A18A 3TKAA 2W54A 4YG2A 4NI2B 2POKA 2PYLA 1VQ9S 2W04A 1UA1A 3BGFA 1KR4A 2LQ9A 5BR8F 4OGEA 3NH2A 3CCJN 3N79A 1NBEB 3B6OA 1VQYA 4Z4HA 2EW9A 4ZP7A 3GZFA 2XLJA 2IY5B 4JI8K 1BMQB 1BIUA 3PO5A 1JJ2M 3GDQA 4NA2A 1F5CA 1KVAA 3G6EN 2ZJ8A 2ZHOA 5MLCV 4USVA 1RTJA 2BKOA 2BW7A 3VAFA 2YY6A 4RW4A 2DKXA 1UKUA 2FZCB 2FLPA 2UUBF 2ERRA 4DR2K 4I9LA 2CZVC 1YZ6A 2JX2A 3MUMP 4CTAA 4R64A 7FDRA 3OYJA 4IQMA 4LR9A 5J1PA 2LQJA 1JLBB 2F4VK 1NH7A 1RWPB 4I68A 4OHWA 1RT4A 4DUYK 1WC3A 7ICQA 2HK2A 2R7XA 4JK9A 3R9PA 5J0TA 1VQMN 3CYMA 3K5LA 3LANA 2IDLA 3PW0A 3NGZA 3ATVA 2XY5A 3ZSYA 1TV6A 2MXYA 3QUBA 2HNYB 2HS0A 3I76A 3CFRA 1VSHA 2NRTA 2GQ2A 1BLUA 2VBXA 4C98A 2ZNYA 3FKBA 5HK4A 1FJGJ 2ZZNA 4DCHA 1HI8A 1WEXA 1TK0A 4ZLPA 2J8AA 2YN4A 2HGMA 2V4JB 3OHAA 3C16A 1YHQN 2GHPA 2ZBPA 3WX8A 1C1AA 3CC4N 4PQUA 4FLZA 3PR4A 2YNIB 1K5OA 1TKZB 1X4BA 5DGBA 2UXBK 3QJLA 4DL5A 3Q8RB 1RTHA 3T1AA 1YIJN 4FK0A 5FDLA 1T0TV 3SQ1A 2E88A 3H1QA 4UOHA 4UY85 3V9ZA 1Q7YO 4DX8H 2GAHC 3UCUP 3MEGA 1MU2A 1B0XA 2VG5B 4DV0J 1A0OB 2XYHB 3VQSA 4IO9Q 1SKRA 2B4PA 5BPCA 1NOMA 5BN8A 3M1YA 4BRQA 1NZAA 2BCVA 7FD1A 1IBMF 4J9UE 4LF1A 2G0JA 2MZQA 2ZBIA 4E1MA 2NUUG 2PXIA 4NX9A 3LOUA 3QBWA 1RWXB 4ECRA 4URQU 4CHQA 3HMJG 2IRYA 2NO4A 4LRBA 4QYZK 2UU9K 2QMUB 3B82A 1KLMA 8ICQA 3OYDA 1UPPA 3L7UA 2MKIA 5AQFA 5E3QA 4CP5A 4CZHA 4ZKAA 3JQJA 2DF4B 3NNHA 5B0DA 2NXJA 3S01A 4A61A 2IFXA 1D5AA 4KAIA 2HEKA 1LW2B 1KS2A 2AJ0A 3ENWA 3KWIA 2N4DA 2V68A 4RG8A 1VQOS 1S1UB 2W9AA 3NCRA 2PAVA 4IH7A 4USHA 3OTBA 4A8XA 1OQ3A 1S5LU 4KYZA 3MPVA 4ZJQA 3FSIA 4RPYA 3CJ1A 5AKXA 4F67A 2CQ4A 2F1JA 4IQXA 5EE3A 1N56A 5KFXA 4CH7A 4DMZA 4JYAK 3SV3A 2AD9A 4I1TA 1ZZNA 3WXIA 1S1WB 3CCQN 3OJUA 3HFVA 5A76A 1CUKA 3DLRA 3QZ7A 3DXKA 1KDNA 3FZKA 2Y8YA 3W65A 4K4ZA 2P66A 5F8LA 5AKZA 3NAIA 4GRSA 3S1TA 2NRRA 4BDPA 3RVCA 3T1HK 2ZWPA 3J81O 3DN9A 2J0QD 3HVTA 4EBCA 1GOCA 4BQZA 4PEOA 2J7UA 4ED6A 2VG6A 1VOMA 3O2IA 4CJLA 3D54A 3TA0A 4RQNA 5HLFB 5CYMB 4IOXA 4DL3A 1UJ4A 2ZKTA 2Q43A 5B66U 2W11A 4K41A 5A8KB 1S10A 2Z7JA 3THTA 2RAQA 1T6CA 5HOOA 5HMWA 4C8NA 5F8HA 1YJ9N 5J2EA 1Q53A 2BYCA 3BBCA 3O80A 5C12A 5HRNA 3GYNA 1Z2ZA 3CJKB 2AGOA 4DV6J 4P74A 4BRNA 1RXWA 2OJ3A 1WG1A 3TADC 2HRYA 3M8YA 4A8MP 2B6AA 2IRUA 4USIA 3MD1A 1ZH5A 4O0JA 2DR7A 4JV5F 4NXZA 2GA7A 6FDRA 4GV9A 2A41A 2VPYB 4LF4K 3CCSS 5IINA 1VK8A 3J81j 2MZRA 1N88A 4RPXA 3R5AA 2FBVA 2RE2A 2HMXA 2VA2A 4UB2A 9ICMA 3SFGA 2MLZA 3F9MA 4OZLA 2WBMA 1Q1KA 4JAXA 4JLHA 2AJ2A 4XAKA 4CRXA 9ICAA 4EWTA 3V9UA 5HROA 3VR1A 5E7OB 1Y64A 4L75A 1EWQA 3GJSB 3ZDAA 1IKXA 3PYFA 3R2DJ 3PIOL 4HUEA 3I55N 4MN4C 2JRSA 3CJ7A 3NTUA 3CFPA 1EXQA 5ETPA 2PC6A 4ANEA 1FDBA 2EKYA 1KQKA 4H0PA 5BOMA 4FS1A 3VQQA 2MY7A 4RNMA 2DVIA 1RBUA 3ZSXA 4JD2A 5CD4H 2ZJ5A 2H5JB 1ZS6A 5E0OA 3SUOA 4KFBA 1T3OA 5CD4A 4ECWA 1VSDA 2ES6A 3MM5B 3OR2A 2MQPA 4CLUA 4FS2A 2ZH5A 2KU7A 5C42A 4RQ7A 2VODA 4K4WA 3LYSA 1WOQA 2EAMA 2FUG9 1GFWB 2PEBA 1XMQJ 3LP3A 4FBUA 2WAQD 3DRRB 3AAWB 5IWAJ 4DFKA 3TW0A 2A3ZA 3BYPA 3A5LC 3O6QA 5J0XA 1VK3A 2UUCJ 3T41A 1S1VB 2YB4A 3OGUA 1HARA 3I8DA 1ED1A 4OHZA 2V9WA 3V2UC 4F5RA 4M5KA 2RIJA 2E5SA 2WF7A 4F9OA 1QVGM 2Y3YA 2UV8G 4M94A 4K4VA 4P4OA 3JSMA 2G8IA 3J7A1 3MMCB 3ZEUA 1VBKA 4KH4A 5KFSA 3A0HU 1BHNA 3GWCA 3AA9A 3K2YA 1WNEA 4TU7A 5G0RA 2E1ZA 3OUYA 2ZOGA 4CLFA 1R6VA 4A8EA 5J2GA 1D4XA 1O6XA 3BH7B 2CPHA 1L7MA 4I2FA 1VQ5N 2Z1JA 1MQ2A 5AM3A 3Q86A 1HJPA 3G4SN 2DR5A 3Q2SC 3LDPA 2Y1IA 3QNOA 1KD1T 1T95A 5HO4A 4C8OA 1W97L 4MIAA 4CH1A 2EC0A 3Q8VA 3I31A 2CQ2A 3LZJA 3HL8A 4XH4A 3HM9A 1ZBHA 4C8KA 3A8YA 1E4GT 2IBOA 1MN8A 3QEWA 3NGUA 1U2CA 4KB1A 2DL0A 1Q0NA 2R2UA 1XJWB 8ICAA 5AIBA 2MEWA 3AVAA 4NXMK 5HMYA 3NS6A 4U67L 2N82B 2W55A 4MEYA 4MKAA 5J1NA 2QRRA 2HHUA 4WE1B 3SIPB 2AX0A 4NMXA 5D3GB 3ZZZA 4DQSA 2WF9A 2B4UA 5GAEU 5A8RA 2FJ6A 3OLAA 1TKTA 3KK2A 5AKJA 2J6SA 1B70B 4HUGA 3IO1A 2A19A 4CT9A 2X1BA 5KFWA 4FVUA 3DRPB 2DH7A 2DHXA 4FNIA 3K0SA 4DV6F 1PVRA 4BDZA 4QS8A 4OX9J 4HR2A 3D6JA 1VQ8S 7ICOA 2KG1A 3A8JA 4B9MA 4DR4K 4P4PA 7ICMA 4QOTA 4U7CA 4FF3A 2VOOA 4RPZA 5J2AA 3M3ZA 1S6QA 4CHZA 4H4OA 4NM1A 4KLJA 4CI0B 3CD5A 4KHPK 1CS4B 4DPXA 5IT9O 2PMWA 2L48A 4HDHA 4OHXA 1TUGB 5J2PA 3PM9A 4NXNK 4U9RA 2NR0A 2O8FB 2MAXA 4ZLLA 3HBTA 2BMBA 1WOPA 4Y28C 4EIAA 2R2SA 5LMUK 1BA0A 4FWOA 2R2TA 3U1NA 4PKHA 4MTPA 5EOYA 1RADB 2W8LA 2E3TA 1VQ6S 2EANA 1S12A 4FPIA 2F76X 3CNHA 1DOQA 2B43A 2VOPA 4YOTA 3VQTA 3OYCA 2H5IB 3H98A 3H7HB 3OLBA 1ZXIA 3V6HA 1S0NA 4IWVA 3HJEA 2XHCA 2Q97A 5CYQB 4TY8B 4DR1J 3VZHA 3HSGA 1VJQA 1ZM4A 1I3OB 3MWTA 2IIRA 4QYRA 1V4TA 1GOBA 2IVPA 4CEZA 3ZI4A 3JTPA 4B3RJ 4OYZA 3GV7B 4NLCA 2KL8A 2YKNB 3R9LA 5GAGP 2QMWA 1FRIA 1RTDA 3P39A 5K5MA 5GMKa 5AQOA 1XSNA 2D3UA 1JRPA 3VGSA 1K9MO 3FR0A 3AUOA 2LU2A 3ETOA 1SWVA 1J5OB 5LT5A 4XPEA 1S9GA 2V7YA 3PSTA 3OYAA 2I5JA 3PKMA 2W9BA 4DQIA 4RBUA 4LF8F 4H5VA 2QYCA 1VRTB 3NVWA 2QLXA 5J2MA 4YQWA 1FFWB 1NMEB 2W2QP 3DOKB 5KFDA 2HF4A 3I4PA 3PR5B 4F25A 1M90O 1LWFB 5ALGA 3CDBA 3PYDA 5T7LB 2HHHK 3E01B 5FLXU 1XIQA 3UPFA 1C0GA 4OLOA 2HIYA 2BZFA 5KGXA 4FZLA 4M9HA 4WXOA 4MLHA 5FLXO 3CPWR 4JI3K 2DWQA 5FRMA 2YY3A 1M5HA 2DRBA 3DNCA 3G8QA 3KLEA 1TQLA 1EX8A 4NLDA 1IR0A 3PO4A 3R5BA 4NWBA 3HKZC 4ISGA 2PFNA 4K2JA 2BKNA 5ETNA 1JXEA 2GV1A 2RHQB 5JTIA 1JX4A 4BC4A 4B9LA 1S72S 1EAYC 3O3GA 1VSFA 4YOVA 3GPAA 3BB5A 1BG3A 4LH4A 3C2PA 3HVAA 1XR5A 3O8MA 2RT3A 2FPMA 3U27A 2KJVA 3OSNA 2QWNA 1TL7A 3NLCA 2RH3A 1X31C 2GQQA 1HMVB 1T8EA 3BGUA 3I0SB 5BJRA 5KGWA 2LKZA 2VCPA 2B9YA 4F04B 1ZQTA 3TJ9A 4FOIA 1JLQA 1RG6A 1BOTO 3HZEA 4M2YA 5DB6A 4BRMA 1SC4B 2CPDA 4U7UK 1T03A 4PPXA 4UASA 4CEAA 2HAIA 1QQ6A 2I38A 4KGZB 4ISFA 4ZN3A 3DWLA 4QJFB 3CC4S 3WU2U 2HSTA 2MA1A 5AQTA 1XC9A 2XI3A 1RDRA 2MQ8A 3CQ8A 2BOAA 1YIJS 4WFZA 2LU1A 2JVRA 3PSFA 1MA7A 3NY0A 3TJAA 2IC3B 2XMVA 2R8IA 4QU7A 1O0PA 2XLIA 1JLFA 2IPOB 3NH0A 4ED2A 3PZPA 4HACB 4RBTA 4OZNA 3QJJA 1NH8A 3EICA 2H65B 4M5DB 4WYBA 1RYUA 4TXSA 3MM6B 3UE2A 2JJ4D 2I9SA 3ISND 4NL9A 4KGKA 3VF6A 5THWA 2ZTDA 3SQ0A