2KVSA

Nmr solution structure of q7a1e8 protein from staphylococcus aureus: northeast structural genomics consortium target: zr215
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
MAGDPMTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMANLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MW0776
publication title NMR Solution Structure of Q7A1E8 protein from Staphylococcus aureus: Northeast Structural Genomics Consortium target: ZR215
rcsb
source organism Staphylococcus aureus
molecule tags Structural genomics, unknown function
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2kvsA00
2FJ6A 2O6KA 2KVSA
chains in the Genus database with same CATH superfamily
9ICSA 4DQRA 2W03A 4FE3A 3EZ5A 1SB3C 1RZTA 5AKKA 7ICPA 2KZMA 4IQVA 2R8IA 3LWMA 3WKAA 4ECTA 4IQTA 1K1SA 5ALEA 8ICWA 1SL0A 2P66A 4IL6U 1AQ6A 5KFQA 4DSKA 4NL9C 3F2CA 4XUSA 5AK4A 5EE1A 3F2DA 3BDPA 4YMOA 3QUQA 3ONNA 3HWTA 2ZIUA 5KT3A 2LKYA 2JGAA 3SENA 3AQEA 1L7MA 4YFKA 2K4PA 3PW2A 3BQ2A 8ICPA 5AM4A 1N5WA 1LKYA 5DGBA 2O6KA 3PMLA 8ICLA 2K8CB 4EYIB 4ELTA 1S0VA 3K4GA 4FS2A 2BR0A 1D8YA 4O3QA 1FEZA 4F4XA 4CDGA 4F4YA 2ASJA 3Q8QB 4O3OA 4HYKA 2RRDA 3TFSA 4YXMA 2KZZA 1TV9A 4YN4A 3TARA 2EANA 1NZBA 4DFDA 4O0IA 5ALHA 4EYHB 5ALUA 3NRZA 2QB1A 2JHDA 5AM3A 4Q45A 2OEHA 5DG9A 1CI4A 4ECXA 1L8OA 3N7RC 1K5OA 5GTIU 2HCFA 1ZJMA 1VJ5A 4IRDA 2YMLA 3M6KA 2Y0SC 4KLMA 2ZIVA 2BCSA 3JPQA 2KHVA 5IIJA 1QCKA 3NUQA 5J2CA 1U45A 1ZD4A 8ICGA 2EQYA 5AI5A 2W7PA 5T14A 4J9LA 5KFOA 5BPCA 9ICWA 3ICXA 4IS7A 3TAQA 5ALRA 1ZQZA 2I5HA 4NLZA 2XVTA 5AHXA 5KFWA 3T3FA 4OJ6A 2AXTU 2W9BA 2XY7A 3PW5A 3PR4A 2F1JA 2BHNA 4K4IA 8ICIA 4QZBA 4Y2UA 3ISDA 1KBUA 2HBMA 3HT3A 5AK5A 3MDAA 3AU2A 7ICNA 2UVUA 4ELVA 4UB8U 5ALXA 4E0DA 4C80A 2FPKA 3N97B 4DL2A 2UVRA 2DBYA 2PI4A 4Y2JA 5ALGA 2LHTA 2AHOB 1J2NA 5TZVA 4CCHA 2ZUBA 1ZOLA 4BWMA 5KFMA 4GXJA 5C0YA 2QARA 1XNSA 4KLOA 2ISPA 1H38A 4PHEA 1Z4NA 4NLCA 2H3VA 2XIDA 4ICAA 5KAFU 5CA7A 5L1IA 3UXPA 1S9FA 4EEKA 9ICGA 3RB0A 4OD0A 3OJSA 1N61A 1NK0A 2NRXA 4I2EA 9ICXA 1MSWD 2JR5A 4JV2A 1NKBA 2HDOA 3RJEA 3TFRA 2C2EA 3MR2A 3D2NA 1TKDA 4QZDA 2FJ6A 5HHHA 5KG6A 4UAYA 3ZDAA 2LPEA 4P0QA 4DL6A 4J9QA 5JRTA 3VC8A 3T5KA 2R18A 1D9FA 3VCBA 3KHLA 1NJYA 2L5YA 4LZDA 8ICTA 3QU4A 4KN4A 4I28A 3QZ7A 4M04A 3QUTA 2XY6A 5IIKA 1EXNA 3PSIA 7ICGA 2RQ5A 3K75D 3RH6A 3K1ZA 1L3SA 2DF4B 1S8OA 2KK0A 3F5EA 4EBEA 3RFAA 1N60A 3GFKB 2OHFA 1PK1B 4QZEA 3RJFA 3WKDA 3RF9A 4UATA 5KG3A 2AGQA 5DBBA 4NJ8A 1NK9A 3WKBA 3PX6A 1BNPA 5ALIA 1FFUA 2E3TA 5GTHU 7ICKA 2WF6A 5AI6A 1N63A 2M0NA 3MDCA 8ICFA 1M6YA 1A6SA 5ALFA 4PL1A 3QU2A 4AP9A 3OHAA 4I2CA 5J2GA 2HHUA 1KSPA 2DKXA 2PMZC 4RNMA 5AKGA 5EE3A 4C8NA 3GIIA 2BCUA 3RJGA 4KLSA 3QUCA 5AIAA 5CEHA 3K1RB 1LV5A 4UB2A 5E79U 2NRZA 5KFBA 4DQQA 1ZQMA 1HUZA 3CNHA 3UM9A 3IM1A 4F71A 4C8MA 4CGZA 1ZQ1C 5KG2A 3WK7A 4ZOHC 2HHTA 2FE9A 1XO0A 2HVIA 2WF5A 9ICCA 2YY6A 1XU4A 2Y9UA 3WKEA 3C1ZA 3WK6A 3MR3A 1ZXIA 4ECVA 1F44A 5K4LA 4KX3A 4DQSA 1ZQRA 2B0CA 2VJ4A 3OHBA 4U7CA 2RDJA 2Q0ZX 2OCEA 3OGUA 1B4FA 1JRPA 2KJ9A 2GWSA 4XA5A 7ICSA 5J2HA 4PL2A 2VA3A 2HI0A 2PFPA 1HIWA 1ZQXA 2G06A 4MFFA 4F4KA 3V7LA 3BZKA 4TQRA 3RBDA 3TKAA 5KT7A 5KFTA 1T4GA 1IM4A 3IG5A 3AN1A 1HJPA 4J9PA 4ECUA 3ED5A 3ALRA 4C8LA 1OXJA 1CUKA 2OYYA 4RQ5A 4B9TA 4QZ9A 5KT6A 5J2DA 4RUCA 5J0OA 4QZFA 4RQMA 3UQ2A 2N1RA 2W3RA 4MFCA 4EX7A 2HBKA 4TUSA 1PK3A 1L3VA 3THVA 2BCVA 4DLGA 5KG1A 3CP8A 5ALMA 4PHPA 3H4DA 1ZQYA 3C21A 2ATLA 1OUQA 5KFDA 1COOA 1TE2A 1WG8A 2F76X 4M9GA 4O3MA 1NKEA 1SKWA 3PO5A 1B22A 2FLLA 4O5EA 1KFSA 3SR6A 4OJOA 3V72A 1NJXA 2HOFA 4O9MA 2JV3A 8ICUA 3V6KA 1ZQJA 4C4SA 2I9GA 2I1QA 5AKXA 4QWBA 4F92B 2JMGA 3LYSA 5J2EA 4J9KA 5DB9A 2ES6A 3JPPA 4BGDA 3RRGA 1Q3UA 5KAIU 2GLEA 4RNOA 1BGXT 4I27A 2KKPA 2XCPA 8ICZA 1HEKA 2WAQF 4UASA 4YMNA 2VJ5A 4RNNA 3TQ1A 2OXOA 4QWDA 3BS5B 5EWEA 4R64A 4I2HA 1A76A 2KD1A 4OJLA 5AK6A 1TVAA 1KW4A 2QLTA 1BPBA 4F50A 3M9OB 2VA2A 4RQ2A 1Z00A 3SYZA 5J0XA 2HSZA 3JPTA 4K4GA 4NL9A 5AKJA 4DEZA 3TI0A 3QU7A 5AM5A 2JRZA 2WTFA 4QWEA 2A3VA 4F3OA 3TADC 2MAXA 4Y2RA 5ALNA 1S10A 3WK5A 4PZOA 4LJXA 2ALZA 1TK8A 4EBDA 2ASLA 1BPEA 3KKAC 3RR7A 2WF8A 1L3UA 1PK1A 4Y2VA 2UVWA 4DSLA 1DGSA 5AI8A 4PHAA 2WHEA 5HMMA 3UXNA 3N4MB 4RU9A 1JMSA 8ICQA 1BPXA 2QB0A 1XC9A 8ICRA 3UMGA 3SV3A 3GU3A 1LVHA 5DBAA 2A1AA 2BQRA 2E8NA 1KEJA 1KLNA 1NK7A 5HP4A 4IC9A 4OJPA 2WB1F 2BPGA 5DG7A 2DUYA 2ZTCA 3RH5A 4UAZA 4DO9A 1WCNA 2G09A 4HAIA 3SV4A 8ICCA 4KLEA 4Q8FA 4RQ7A 2ISOA 3NASA 3RAXA 1NZPA 3KZIU 5KFEA 1WYGA 1PUZA 3M7DA 5L9XA 1DGJA 1WWUA 2ZUDA 4FZLA 2HHSA 5DB6A 2J6SA 1SKSA 2BQ3A 4RQ1A 3EPIA 1DXSA 3G6YA 1SXDA 8ICOA 1QSYA 2F77X 4YVZA 1BPDA 1XWLA 2P35A 2E5SA 1T3NA 3H0MB 3PR5B 3OJUA 4F72A 1PVQA 2HHQA 4LVSA 2MUTB 2BCRA 4GXKA 3IG8A 4UBBA 4CF5A 1Z19A 2LM4A 3IRUA 2KV2A 5KFCA 1ZQEA 3ZDDA 5KTQA 4DL3A 3BQ1A 5J2KA 3QU9A 4JV0A 2YQEA 3NGDA 1QQ6A 2HHVA 5ALPA 2JEGA 3F2BA 3KBBA 1U49A 1RXVA 1N56A 3RBEA 4KLIA 4C7YA 3C2MA 3ISCA 3J81j 3HKZF 5KG5A 2R8GA 2ZG6A 3GDXA 5ALOA 4NM1A 9ICVA 5CRXA 3C1YA 5DQHA 5ALLA 5KNIA 1F0MA 5KFHA 2CPRA 3KD3A 9ICFA 2BKEA 2Q4TA 1ZQHA 2G5IB 4ECRA 2GOLA 3PSFA 8ICVA 4P4OA 2KN7A 1ZQLA 1Q8KA 1KFDA 1NOMA 5KFYA 3RTVA 1Z1VA 1HUOA 2W11A 5IILA 1V38A 1Y88A 9ICAA 4NLBA 2XCAA 3I28A 4YMMA 1UHUA 5AKIA 1A77A 2R8JA 3LVWA 1TAUA 1SL1A 7ICOA 1ZD2P 4DSIA 1JXLA 3DDHA 4DQIA 4EZ9A 4IRCA 4DSFA 4QZAA 4KTQA 1MQ3A 4CF4A 3FYHA 2D8CA 4O5KA 4NLGA 2KIWA 3IHQB 4DL4A 2KE7A 1D8LA 5IINA 3PX0A 3PV8A 4US8A 1X6IA 3OPXA 1O08A 3UPQA 1MA7A 2ZIXB 3QE9Y 1ZQOA 2VANA 3QXGA 3EWAA 3E58A 3D2SA 4YXJA 3A0HU 2G5HB 1KQQA 2LBOA 2PFNA 1NNLA 4NM2A 2MA1A 4Q43A 5J29A 2NO4A 4UAVA 4O5CA 8ICAA 3BS7A 2JH7A 4EENA 3NVVA 2KVSA 4P0PB 3BS5A 2F8LA 4QZHA 8ICXA 2QKQA 3EW9A 2IOFA 4I2BA 1MC8A 5AI4A 2FMSA 3CRXA 1ZRMA 2LYHA 3GZFA 5ALQA 9ICJA 5AKZA 3M8RA 2KJ8A 4EZ6A 1RQNA 3Q8SB 5CR0A 1T8EA 5J8YC 4TURA 4F2RA 2RLTA 1KKXA 5KG7A 2WF7A 4UQGA 2W9AA 5HHIA 2W9MA 2EZXA 9ICEA 5KT5A 4ED3A 2Y1JA 3G6XA 2ZJ5A 1ZQAA 1Z00B 2H3IA 4US9A 5DLFA 3QNMA 3ZD8A 1L8LA 3O0FA 2V4QA 5H2FU 4USAA 1UT8A 2WAQC 2XO7A 2FPMA 3C5GA 1WUDA 4F5RA 4J9SA 4KLDA 2K4IA 4RPYA 2MSNA 1N5XA 3KHHA 4NY8A 5ALDA 4DFMA 4GXIA 3WK4A 3T79A 3AQFA 3GIKA 4FBTA 5ALZA 4I2DA 3L5KA 3V6JA 4KLFA 3D2QA 8ICNA 1CEZA 3OSPA 5IIMA 5J0UA 2F2AB 2J6UA 3KTQA 2IOHA 4B6JA 1X42A 1ZQNA 2W43A 4Q44A 2AGOA 2QB0B 4RQ0A 1TK0A 2C2DA 5ALTA 3HRDD 2YMMA 2KHQA 5KFRA 3M8SA 1V9PA 4DOCA 1V85A 4PGYA 4C0ZA 3A0BU 2MU2A 2KIVA 2HBLA 4J9OA 5DB7A 1B0XA 1RYRA 3G6VA 4Z6FA 5DLGA 1JN3A 2FLPA 1L7OA 1QSLA 4ECZA 3TAPA 4JB3A 2NYVA 2G0AA 4M9HA 3SZ2A 5CHGA 2K8AA 1O03A 4QW8A 2KZ3A 1TAQA 1ZD3A 1JX4A 3C29A 1ZQDA 4M2YA 2ZTDA 3D6JA 3F53A 4UW9A 4ELUA 4DOAA 4Y2QA 2MUTA 2WB1C 3BQ7A 2C22A 1TK5A 4TUQA 2YB4A 3SAGA 3PZPA 4M47A 2F1HA 3C5FA 3V7KA 4DS5A 7ICRA 5DDYA 4UARA 2CN1A 2A19A 3PW7A 4QIWF 1Z4OA 3NVZA 5J2BA 4G9BA 5HNKA 1QLNA 3ETLA 3CYMA 3ZDBA 4QW9A 4EEYA 1ZQVA 2K4EA 2YMPA 1KN5A 2RP5A 1SGGA 3FM9A 1DK3A 5B66U 3RJIA 1S0MA 4KLLA 1UCVA 3SAHA 3JPRA 3MGIA 2IMWP 4FBUA 2DPJA 4C8KA 3C2LA 8ICKA 1RXWA 3MBYA 3Q8PB 3NVWA 3HX0A 3TANA 4M9LA 3QX7A 4FZNA 2EDUA 1LB2B 2ESEA 4UBCA 2G08A 2FI1A 5EWFA 3LWLA 1SIJA 2ZTEA 4BJQA 1SWVA 4FFDA 3FDSA 4Z6CA 3L4PA 3EUB2 4UB6U 3HKZC 3H8JA 2DFLA 4ECWA 3TADA 4YR0A 4KMOB 5EOZA 2H5XA 3Q8KA 3ETRA 1RM6C 3QEAZ 4EX6A 2ZJAA 1JUDA 4I2IA 4Q8EA 2DGZA 4J9MA 3LDAA 2KNJA 5BOLA 5J0WA 9ICUA 2ZIXA 5AK3A 3KKAA 2BPFA 2BZFA 1K1QA 2EH9A 3AM9A 1ZQTA 3M1YA 2EAPA 1NJWA 1C20A 4B9SA 4RT3A 3RB6A 1SZPA 5DB8A 4DL5A 2C2RA 1PZNA 2A1JB 1KL9A 4P0PA 2E1FA 3WK9A 2IA6A 4J9NA 4IR1A 2XGQA 1ZQWA 5AM1A 5F9NA 4Y2SA 4ECQA 2BQUA 2HHXA 4QZIA 1N48A 2P6RA 1QQ5A 2BCQA 4TUPA 4R65A 7ICIA 5AKLA 1P7DA 4O3NA 4F2SA 1SV0C 5L1MA 3ORYA 2JEJA 2E8PA 3PSTA 3QYPA 1Q46A 4DFKA 1SXEA 1U47A 1JIHA 2KJ5A 3LVVA 2E8OA 1FO4A 4DFPA 5KFXA 7ICHA 1JI7A 4JUZA 4DSEA 3Q8MA 3JPNA 5KFFA 2HOQA 4O3SA 3C2KA 4YD2A 1J97A 4MEXA 2D3DA 2JEFA 4MF2A 3ZDEA 2KMDA 4RQNA 2VIXA 1DRGA 3IV6A 1D8BA 2RHFA 1UA1A 4DF8A 4Y2XA 1L7PA 4FS1A 5EE0A 3BZCA 2ZXIA 3TACB 3RH4A 5DQIA 4ED1A 5L1LA 1X40A 3UMCA 4RUAA 7ICLA 9ICHA 4PPXA 3Q8LA 2W55A 4DQPA 1RYSA 2BDPA 2E1EA 5G5GA 3GIJA 3H7IA 1SV4A 1D9DA 5KL8B 4WJ3B 5L1JA 5TISU 1COKA 1U48A 7ICVA 1L7NA 4PH5A 3AU6A 1IIPA 2LYBA 2IHNA 4KITB 4I2GA 2DKZA 5F9LA 5AICA 2V9WA 4Y2PA 2Y9TA 1ZETA 5KG0A 2W9CB 2DPIA 2GH1A 1YZ7A 4KLHA 4UAUA 5JTIA 1ZQSA 4QNLA 2EAMA 3SAFA 1S97A 5FP0A 4GC7A 2B6GA 1ZQPA 3PX4A 1FIQA 4GFJA 3WKCA 4EELA 7ICQA 8ICMA 5AI0A 2F1IA 1MQ2A 2KFZA 2Z7JA 5D49A 3N7PD 1KDHA 4KN7A 5HMLA 1PVPA 1ZQBA 2MRLA 4BDPA 2YMQA 3PW0A 5DKWA 1DOQA 2I6XA 4B9UA 4M9NA 2KICA 4CNQA 4F5QA 2P6UA 4RQ6A 4ED2A 3KFUF 4KX5A 1CRXA 2FMPA 2DL0A 2PXIA 4DCCA 3RR8A 1JROA 2E8MA 4PGXA 1BVSA 4PZNA 7ICTA 2PKEA 5CJ7A 4RT2A 3I1YA 3DEEA 5KG4A 2IHMA 2HHWA 3ZD9A 3GILA 2KOBA 4K4HA 3KZXA 3M9NB 1XSNA 8ICSA 5J2IA 3N28A 5J0RA 1S0OA 4A8EA 4Z6DA 3RJHA 4LZGA 4NLKA 3GV7B 4AYBF 4YG2A 5AKHA 5EE9A 8ICYA 3UMBA 1L5UA 1SZHA 5EWGA 4ED0A 1RYUA 5KFKA 3PVXA 2W04A 2WFAA 1UPHA 4UB1A 3V7JA 1B43A 2UVVA 4TQSA 2CXYA 4I2JA 5IIOA 9ICMA 5J8YA 2VA8A 4MFAA 2FDRA 2EAOA 1YT3A 4P4PA 2W8LA 1ZQCA 1V97A 4QIWC 1A0PA 1ZJNA 5KFAA 4G3IA 3NS1A 3V6HA 2JEIA 4C8OA 5KFVA 2KSOB 4IQWA 2XICA 4C4RA 4R63A 4RZRA 9ICTA 3B0XA 4UB5A 4R66A 5ALSA 2DWQA 3NVYA 5DBCA 4IR9A 3BQTA 2JZBB 3AMZA 8ICEA 1X9SA 3MR5A 3PMNA 2NRTA 3RB4A 2V4RA 2ZIWB 2HOIA 1ED1A 1ZD5A 4YR2A 2A1JA 1RQLA 5B5EU 1QQ7A 2YTUA 1NK6A 4M9JA 9ICRA 4B9VA 3HW8A 1C7YA 1RG6A 2F44A 1WCLA 4M6WB 4QWAA 4B9MA 7ICJA 1VLBA 3PW4A 3LK9A 5J2FA 3R9KA 3U26A 3AL0B 4DF4A 1X6JA 1S0NA 2PI5A 4F5PA 4RQ8A 2KP7A 2FLNA 1IXRA 4Z6EA 1ZRNA 3KOOA 5C5JA 2W3SA 1IG6A 4I29A 3PSPA 2NRWA 4F8RA 4MHVA 3EPGA 5KFZA 5BOMA 2AU0A 4F5OA 3T5JA 4YQWA 1MN8A 4BUGA 2ASDA 7ICMA 3EYZA 1QSSA 4U6PA 2VKQA 1URJA 3ZDCA 2FMQA 4FO6A 3RJJA 2H3QA 2AJQA 5G5HA 3T5HA 4NXZA 2FPLA 3MFIA 1NK5A 1F5SA 1ZQUA 4CE6A 2H3FA 3M9MB 2F3NA 4CF3A 4P2HA 4ECSA 3GV8B 2ODGA 5DDMA 1ZQKA 5J2AA 4QZCA 4F93B 3HPOA 4DLEA 4OCZA 3MC1A 3HJEA 3E0FA 4PJ0U 4B9NA 3QUBA 2KVCA 4NWIA 1S77D 1NKCA 2W9CA 4QZ8A 9ICLA 1BPZA 3MGVA 9ICKA 4BXOA 5KT4A 1QH9A 4YD1A 1PVRA 1SL2A 2KG5A 3L3FX 3SMVA 2OH2A 3GIMA 1U4BA 4QZGA 5KL1B 2KFNA 5KFGA 3SEIA 1JALA 3AEVA 5DG8A 4GC6A 2AQ4A 5ALYA 5IIIA 2BGWA 3NTUA 3HILA 4JV1A 9ICNA 2K8BB 1TFRA 2K60A 4UB4A 2R8KA 2AGPA 2W8KA 8ICBA 4R8UB 1NJZA 2R8HA 1N2XA 2HBJA 5KFIA 4F4ZA 3RAQA 4QJFB 3WK8A 4KLQA 2KKVA 3OSNA 3SI8A 4JK1A 1X66A 2PFOA 5CP2A 4OO1J 3C23A 5ALWA 4YCXA 3KHRA 4NV0A 4BWJA 1GO3F 5KFSA 3PNCA 2JXJA 5ALKA 9ICQA 5ALVA 5J2JA 2AQ0A 1Z1BA 7ICUA 5D4BA 4IRKA 4RPXA 2K89A 3M6ZA 3PO4A 4YP3A 4ED7A 4NLNA 2KEYA 2XGPA 4JWMA 2W54A 1X9WA 2HW3A 3H40A 3ZI4A 1OW5A 4DFJA 3B0YA 4BX9C 4ECYA 1L6NA 3ISBA 5KFLA 1XSPA 2W7OA 4I2AA 3H4BA 1X9MA 4F91B 5JU5A 9ICIA 5CB1A 2ZIUB 5AM2A 3KHGA 1Q3VA 2Y0SF 4PHDA 2OM6A 5HR6A 4DOBA 2RDIA 1YZ6A 1X2IA 1VDVA 2GO7A 1ZQFA 1LKYB 5JUMA 5AM0A 4KLUA 3MR6A 1WWVA 2XI9A 2YB1A 3RRHA 2KTQA 3BJYA 1KTQA 2LYAA 5AIBA 8ICHA 1RPLA 1SV0A 4J9RA 1RDFA 3NRWA 4DWIA 2BPCA 1ECWA 5KT2A 2CRXA 4X5VA 5L1KA 3FC4A 2C28A 2KSOA 7ICEA 4M0AA 5J0TA 3WU2U 2LM1A 4Y2YA 5A0LA 3E2EA 2ZXHA 2EZZA 4ED6A 3CW2C 4AYBC 3PY8A 2OWOA 2LMRA 1XSLA 4KLTA 5KFNA 3H8SA 2JZBA 5AI9A 4DS4A 4Y2TA 4RPZA 2NRVA 5KFJA 4O3PA 4ZH4A 2ZIWA 2ZIVB 4GIBA 4CRXA 3H8WA 3SD7A 1T94A 2PFQA 3UQ0A 7ICFA 4IQUA 3GV5B 4JMUA 5DGAA 1DK2A 5KFUA 3B9JA 3JPOA 2Y1IA 4KLGA 9ICPA 4FZMA 5J0YA 2IOFK 2LI6A 5ALJA 4J03A 1ZQGA 4M6WA 4DL7A 4F4WA 3Q8RB 3IN5A 1JXEA 2BDUA 2XY5A 3H0RB 1ZQQA 3HP6A 1X9XA 4I2FA 2W9BB 3UXOA 2D6FC 2HMXA 2XC9A 1UA0A 4MF8A 1S76D 1J2MA 2B21A 2WF9A 5AKEA 5KFPA 3F5AA 1KFTA 4XQ8A 2H3ZA 2JH1A 3T5LA 3IP4B 2AH5A 5J0QA 3MABA 2F8KA 4QWCA 2NV3A 4ED8A 5D46A 4GLXA 3C28A 4C7ZA 1IV8A 3AUOA 3QZ8A 3BQ0A 2QARB 5J0SA 4MEYA 1NI3A 2YX8A 4PGQA 1BNOA 3JPSA 4KLJA 1KRPA 1T7PA 2J6TA 1UQVA 2M9NA 1NK8A 9ICBA 1FFVA 1SWWA 1QTMA 3OTQA 4B9LA 3N7SC 8ICJA 3MGHA 3QEBZ 1TAMA 2NO5A 2ZJ8A 2EZYA 3H8MA 4P4MA 3SQIA 2HVHA 1Z3EB 4UAWA 4C4TA 1SKRA 2IBKA 5CWRA 1ZYQA 3I76A 5J0PA 4OJ5A 4P0QB 3MFHA 2K4HA 4UB3A 3S6JA 3H0LB 4O3RA 3RJKA 2YN4A 4YR3A 3RB3A 1L3TA 4DSJA 4JWNA 1NK4A 3QU5A 1S5LU 3IDWA 2PMZF 4ACOA 1XS9D 5AKYA 4RQ3A 1N62A 4F5NA 4KMUA 1AROP 1T3QA 2DQNB 5DQGA 4EBCA 1U9LA 4BXOB 2G07A 2ZUCA 5HR7A 4R8UA 4XRHA 1BPYA 9ICOA 1XO1A 3GQCA 3DV9A 3FAHA 1UT5A 5F3XB 1ZQIA 4RQ4A
chains in the Genus database with same CATH topology
2FJ6A 2O6KA 2KVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ6 A;  2O6K A;  2KVS A; 
#chains in the Genus database with same CATH topology
 9ICS A;  4DQR A;  2W03 A;  4FE3 A;  3EZ5 A;  1SB3 C;  1RZT A;  5AKK A;  7ICP A;  2KZM A;  4IQV A;  2R8I A;  3LWM A;  3WKA A;  4ECT A;  4IQT A;  1K1S A;  5ALE A;  8ICW A;  1SL0 A;  2P66 A;  4IL6 U;  1AQ6 A;  5KFQ A;  4DSK A;  4NL9 C;  3F2C A;  4XUS A;  5AK4 A;  5EE1 A;  3F2D A;  3BDP A;  4YMO A;  3QUQ A;  3ONN A;  3HWT A;  2ZIU A;  5KT3 A;  2LKY A;  2JGA A;  3SEN A;  3AQE A;  1L7M A;  4YFK A;  2K4P A;  3PW2 A;  3BQ2 A;  8ICP A;  5AM4 A;  1N5W A;  1LKY A;  5DGB A;  2O6K A;  3PML A;  8ICL A;  2K8C B;  4EYI B;  4ELT A;  1S0V A;  3K4G A;  4FS2 A;  2BR0 A;  1D8Y A;  4O3Q A;  1FEZ A;  4F4X A;  4CDG A;  4F4Y A;  2ASJ A;  3Q8Q B;  4O3O A;  4HYK A;  2RRD A;  3TFS A;  4YXM A;  2KZZ A;  1TV9 A;  4YN4 A;  3TAR A;  2EAN A;  1NZB A;  4DFD A;  4O0I A;  5ALH A;  4EYH B;  5ALU A;  3NRZ A;  2QB1 A;  2JHD A;  5AM3 A;  4Q45 A;  2OEH A;  5DG9 A;  1CI4 A;  4ECX A;  1L8O A;  3N7R C;  1K5O A;  5GTI U;  2HCF A;  1ZJM A;  1VJ5 A;  4IRD A;  2YML A;  3M6K A;  2Y0S C;  4KLM A;  2ZIV A;  2BCS A;  3JPQ A;  2KHV A;  5IIJ A;  1QCK A;  3NUQ A;  5J2C A;  1U45 A;  1ZD4 A;  8ICG A;  2EQY A;  5AI5 A;  2W7P A;  5T14 A;  4J9L A;  5KFO A;  5BPC A;  9ICW A;  3ICX A;  4IS7 A;  3TAQ A;  5ALR A;  1ZQZ A;  2I5H A;  4NLZ A;  2XVT A;  5AHX A;  5KFW A;  3T3F A;  4OJ6 A;  2AXT U;  2W9B A;  2XY7 A;  3PW5 A;  3PR4 A;  2F1J A;  2BHN A;  4K4I A;  8ICI A;  4QZB A;  4Y2U A;  3ISD A;  1KBU A;  2HBM A;  3HT3 A;  5AK5 A;  3MDA A;  3AU2 A;  7ICN A;  2UVU A;  4ELV A;  4UB8 U;  5ALX A;  4E0D A;  4C80 A;  2FPK A;  3N97 B;  4DL2 A;  2UVR A;  2DBY A;  2PI4 A;  4Y2J A;  5ALG A;  2LHT A;  2AHO B;  1J2N A;  5TZV A;  4CCH A;  2ZUB A;  1ZOL A;  4BWM A;  5KFM A;  4GXJ A;  5C0Y A;  2QAR A;  1XNS A;  4KLO A;  2ISP A;  1H38 A;  4PHE A;  1Z4N A;  4NLC A;  2H3V A;  2XID A;  4ICA A;  5KAF U;  5CA7 A;  5L1I A;  3UXP A;  1S9F A;  4EEK A;  9ICG A;  3RB0 A;  4OD0 A;  3OJS A;  1N61 A;  1NK0 A;  2NRX A;  4I2E A;  9ICX A;  1MSW D;  2JR5 A;  4JV2 A;  1NKB A;  2HDO A;  3RJE A;  3TFR A;  2C2E A;  3MR2 A;  3D2N A;  1TKD A;  4QZD A;  2FJ6 A;  5HHH A;  5KG6 A;  4UAY A;  3ZDA A;  2LPE A;  4P0Q A;  4DL6 A;  4J9Q A;  5JRT A;  3VC8 A;  3T5K A;  2R18 A;  1D9F A;  3VCB A;  3KHL A;  1NJY A;  2L5Y A;  4LZD A;  8ICT A;  3QU4 A;  4KN4 A;  4I28 A;  3QZ7 A;  4M04 A;  3QUT A;  2XY6 A;  5IIK A;  1EXN A;  3PSI A;  7ICG A;  2RQ5 A;  3K75 D;  3RH6 A;  3K1Z A;  1L3S A;  2DF4 B;  1S8O A;  2KK0 A;  3F5E A;  4EBE A;  3RFA A;  1N60 A;  3GFK B;  2OHF A;  1PK1 B;  4QZE A;  3RJF A;  3WKD A;  3RF9 A;  4UAT A;  5KG3 A;  2AGQ A;  5DBB A;  4NJ8 A;  1NK9 A;  3WKB A;  3PX6 A;  1BNP A;  5ALI A;  1FFU A;  2E3T A;  5GTH U;  7ICK A;  2WF6 A;  5AI6 A;  1N63 A;  2M0N A;  3MDC A;  8ICF A;  1M6Y A;  1A6S A;  5ALF A;  4PL1 A;  3QU2 A;  4AP9 A;  3OHA A;  4I2C A;  5J2G A;  2HHU A;  1KSP A;  2DKX A;  2PMZ C;  4RNM A;  5AKG A;  5EE3 A;  4C8N A;  3GII A;  2BCU A;  3RJG A;  4KLS A;  3QUC A;  5AIA A;  5CEH A;  3K1R B;  1LV5 A;  4UB2 A;  5E79 U;  2NRZ A;  5KFB A;  4DQQ A;  1ZQM A;  1HUZ A;  3CNH A;  3UM9 A;  3IM1 A;  4F71 A;  4C8M A;  4CGZ A;  1ZQ1 C;  5KG2 A;  3WK7 A;  4ZOH C;  2HHT A;  2FE9 A;  1XO0 A;  2HVI A;  2WF5 A;  9ICC A;  2YY6 A;  1XU4 A;  2Y9U A;  3WKE A;  3C1Z A;  3WK6 A;  3MR3 A;  1ZXI A;  4ECV A;  1F44 A;  5K4L A;  4KX3 A;  4DQS A;  1ZQR A;  2B0C A;  2VJ4 A;  3OHB A;  4U7C A;  2RDJ A;  2Q0Z X;  2OCE A;  3OGU A;  1B4F A;  1JRP A;  2KJ9 A;  2GWS A;  4XA5 A;  7ICS A;  5J2H A;  4PL2 A;  2VA3 A;  2HI0 A;  2PFP A;  1HIW A;  1ZQX A;  2G06 A;  4MFF A;  4F4K A;  3V7L A;  3BZK A;  4TQR A;  3RBD A;  3TKA A;  5KT7 A;  5KFT A;  1T4G A;  1IM4 A;  3IG5 A;  3AN1 A;  1HJP A;  4J9P A;  4ECU A;  3ED5 A;  3ALR A;  4C8L A;  1OXJ A;  1CUK A;  2OYY A;  4RQ5 A;  4B9T A;  4QZ9 A;  5KT6 A;  5J2D A;  4RUC A;  5J0O A;  4QZF A;  4RQM A;  3UQ2 A;  2N1R A;  2W3R A;  4MFC A;  4EX7 A;  2HBK A;  4TUS A;  1PK3 A;  1L3V A;  3THV A;  2BCV A;  4DLG A;  5KG1 A;  3CP8 A;  5ALM A;  4PHP A;  3H4D A;  1ZQY A;  3C21 A;  2ATL A;  1OUQ A;  5KFD A;  1COO A;  1TE2 A;  1WG8 A;  2F76 X;  4M9G A;  4O3M A;  1NKE A;  1SKW A;  3PO5 A;  1B22 A;  2FLL A;  4O5E A;  1KFS A;  3SR6 A;  4OJO A;  3V72 A;  1NJX A;  2HOF A;  4O9M A;  2JV3 A;  8ICU A;  3V6K A;  1ZQJ A;  4C4S A;  2I9G A;  2I1Q A;  5AKX A;  4QWB A;  4F92 B;  2JMG A;  3LYS A;  5J2E A;  4J9K A;  5DB9 A;  2ES6 A;  3JPP A;  4BGD A;  3RRG A;  1Q3U A;  5KAI U;  2GLE A;  4RNO A;  1BGX T;  4I27 A;  2KKP A;  2XCP A;  8ICZ A;  1HEK A;  2WAQ F;  4UAS A;  4YMN A;  2VJ5 A;  4RNN A;  3TQ1 A;  2OXO A;  4QWD A;  3BS5 B;  5EWE A;  4R64 A;  4I2H A;  1A76 A;  2KD1 A;  4OJL A;  5AK6 A;  1TVA A;  1KW4 A;  2QLT A;  1BPB A;  4F50 A;  3M9O B;  2VA2 A;  4RQ2 A;  1Z00 A;  3SYZ A;  5J0X A;  2HSZ A;  3JPT A;  4K4G A;  4NL9 A;  5AKJ A;  4DEZ A;  3TI0 A;  3QU7 A;  5AM5 A;  2JRZ A;  2WTF A;  4QWE A;  2A3V A;  4F3O A;  3TAD C;  2MAX A;  4Y2R A;  5ALN A;  1S10 A;  3WK5 A;  4PZO A;  4LJX A;  2ALZ A;  1TK8 A;  4EBD A;  2ASL A;  1BPE A;  3KKA C;  3RR7 A;  2WF8 A;  1L3U A;  1PK1 A;  4Y2V A;  2UVW A;  4DSL A;  1DGS A;  5AI8 A;  4PHA A;  2WHE A;  5HMM A;  3UXN A;  3N4M B;  4RU9 A;  1JMS A;  8ICQ A;  1BPX A;  2QB0 A;  1XC9 A;  8ICR A;  3UMG A;  3SV3 A;  3GU3 A;  1LVH A;  5DBA A;  2A1A A;  2BQR A;  2E8N A;  1KEJ A;  1KLN A;  1NK7 A;  5HP4 A;  4IC9 A;  4OJP A;  2WB1 F;  2BPG A;  5DG7 A;  2DUY A;  2ZTC A;  3RH5 A;  4UAZ A;  4DO9 A;  1WCN A;  2G09 A;  4HAI A;  3SV4 A;  8ICC A;  4KLE A;  4Q8F A;  4RQ7 A;  2ISO A;  3NAS A;  3RAX A;  1NZP A;  3KZI U;  5KFE A;  1WYG A;  1PUZ A;  3M7D A;  5L9X A;  1DGJ A;  1WWU A;  2ZUD A;  4FZL A;  2HHS A;  5DB6 A;  2J6S A;  1SKS A;  2BQ3 A;  4RQ1 A;  3EPI A;  1DXS A;  3G6Y A;  1SXD A;  8ICO A;  1QSY A;  2F77 X;  4YVZ A;  1BPD A;  1XWL A;  2P35 A;  2E5S A;  1T3N A;  3H0M B;  3PR5 B;  3OJU A;  4F72 A;  1PVQ A;  2HHQ A;  4LVS A;  2MUT B;  2BCR A;  4GXK A;  3IG8 A;  4UBB A;  4CF5 A;  1Z19 A;  2LM4 A;  3IRU A;  2KV2 A;  5KFC A;  1ZQE A;  3ZDD A;  5KTQ A;  4DL3 A;  3BQ1 A;  5J2K A;  3QU9 A;  4JV0 A;  2YQE A;  3NGD A;  1QQ6 A;  2HHV A;  5ALP A;  2JEG A;  3F2B A;  3KBB A;  1U49 A;  1RXV A;  1N56 A;  3RBE A;  4KLI A;  4C7Y A;  3C2M A;  3ISC A;  3J81 j;  3HKZ F;  5KG5 A;  2R8G A;  2ZG6 A;  3GDX A;  5ALO A;  4NM1 A;  9ICV A;  5CRX A;  3C1Y A;  5DQH A;  5ALL A;  5KNI A;  1F0M A;  5KFH A;  2CPR A;  3KD3 A;  9ICF A;  2BKE A;  2Q4T A;  1ZQH A;  2G5I B;  4ECR A;  2GOL A;  3PSF A;  8ICV A;  4P4O A;  2KN7 A;  1ZQL A;  1Q8K A;  1KFD A;  1NOM A;  5KFY A;  3RTV A;  1Z1V A;  1HUO A;  2W11 A;  5IIL A;  1V38 A;  1Y88 A;  9ICA A;  4NLB A;  2XCA A;  3I28 A;  4YMM A;  1UHU A;  5AKI A;  1A77 A;  2R8J A;  3LVW A;  1TAU A;  1SL1 A;  7ICO A;  1ZD2 P;  4DSI A;  1JXL A;  3DDH A;  4DQI A;  4EZ9 A;  4IRC A;  4DSF A;  4QZA A;  4KTQ A;  1MQ3 A;  4CF4 A;  3FYH A;  2D8C A;  4O5K A;  4NLG A;  2KIW A;  3IHQ B;  4DL4 A;  2KE7 A;  1D8L A;  5IIN A;  3PX0 A;  3PV8 A;  4US8 A;  1X6I A;  3OPX A;  1O08 A;  3UPQ A;  1MA7 A;  2ZIX B;  3QE9 Y;  1ZQO A;  2VAN A;  3QXG A;  3EWA A;  3E58 A;  3D2S A;  4YXJ A;  3A0H U;  2G5H B;  1KQQ A;  2LBO A;  2PFN A;  1NNL A;  4NM2 A;  2MA1 A;  4Q43 A;  5J29 A;  2NO4 A;  4UAV A;  4O5C A;  8ICA A;  3BS7 A;  2JH7 A;  4EEN A;  3NVV A;  2KVS A;  4P0P B;  3BS5 A;  2F8L A;  4QZH A;  8ICX A;  2QKQ A;  3EW9 A;  2IOF A;  4I2B A;  1MC8 A;  5AI4 A;  2FMS A;  3CRX A;  1ZRM A;  2LYH A;  3GZF A;  5ALQ A;  9ICJ A;  5AKZ A;  3M8R A;  2KJ8 A;  4EZ6 A;  1RQN A;  3Q8S B;  5CR0 A;  1T8E A;  5J8Y C;  4TUR A;  4F2R A;  2RLT A;  1KKX A;  5KG7 A;  2WF7 A;  4UQG A;  2W9A A;  5HHI A;  2W9M A;  2EZX A;  9ICE A;  5KT5 A;  4ED3 A;  2Y1J A;  3G6X A;  2ZJ5 A;  1ZQA A;  1Z00 B;  2H3I A;  4US9 A;  5DLF A;  3QNM A;  3ZD8 A;  1L8L A;  3O0F A;  2V4Q A;  5H2F U;  4USA A;  1UT8 A;  2WAQ C;  2XO7 A;  2FPM A;  3C5G A;  1WUD A;  4F5R A;  4J9S A;  4KLD A;  2K4I A;  4RPY A;  2MSN A;  1N5X A;  3KHH A;  4NY8 A;  5ALD A;  4DFM A;  4GXI A;  3WK4 A;  3T79 A;  3AQF A;  3GIK A;  4FBT A;  5ALZ A;  4I2D A;  3L5K A;  3V6J A;  4KLF A;  3D2Q A;  8ICN A;  1CEZ A;  3OSP A;  5IIM A;  5J0U A;  2F2A B;  2J6U A;  3KTQ A;  2IOH A;  4B6J A;  1X42 A;  1ZQN A;  2W43 A;  4Q44 A;  2AGO A;  2QB0 B;  4RQ0 A;  1TK0 A;  2C2D A;  5ALT A;  3HRD D;  2YMM A;  2KHQ A;  5KFR A;  3M8S A;  1V9P A;  4DOC A;  1V85 A;  4PGY A;  4C0Z A;  3A0B U;  2MU2 A;  2KIV A;  2HBL A;  4J9O A;  5DB7 A;  1B0X A;  1RYR A;  3G6V A;  4Z6F A;  5DLG A;  1JN3 A;  2FLP A;  1L7O A;  1QSL A;  4ECZ A;  3TAP A;  4JB3 A;  2NYV A;  2G0A A;  4M9H A;  3SZ2 A;  5CHG A;  2K8A A;  1O03 A;  4QW8 A;  2KZ3 A;  1TAQ A;  1ZD3 A;  1JX4 A;  3C29 A;  1ZQD A;  4M2Y A;  2ZTD A;  3D6J A;  3F53 A;  4UW9 A;  4ELU A;  4DOA A;  4Y2Q A;  2MUT A;  2WB1 C;  3BQ7 A;  2C22 A;  1TK5 A;  4TUQ A;  2YB4 A;  3SAG A;  3PZP A;  4M47 A;  2F1H A;  3C5F A;  3V7K A;  4DS5 A;  7ICR A;  5DDY A;  4UAR A;  2CN1 A;  2A19 A;  3PW7 A;  4QIW F;  1Z4O A;  3NVZ A;  5J2B A;  4G9B A;  5HNK A;  1QLN A;  3ETL A;  3CYM A;  3ZDB A;  4QW9 A;  4EEY A;  1ZQV A;  2K4E A;  2YMP A;  1KN5 A;  2RP5 A;  1SGG A;  3FM9 A;  1DK3 A;  5B66 U;  3RJI A;  1S0M A;  4KLL A;  1UCV A;  3SAH A;  3JPR A;  3MGI A;  2IMW P;  4FBU A;  2DPJ A;  4C8K A;  3C2L A;  8ICK A;  1RXW A;  3MBY A;  3Q8P B;  3NVW A;  3HX0 A;  3TAN A;  4M9L A;  3QX7 A;  4FZN A;  2EDU A;  1LB2 B;  2ESE A;  4UBC A;  2G08 A;  2FI1 A;  5EWF A;  3LWL A;  1SIJ A;  2ZTE A;  4BJQ A;  1SWV A;  4FFD A;  3FDS A;  4Z6C A;  3L4P A;  3EUB 2;  4UB6 U;  3HKZ C;  3H8J A;  2DFL A;  4ECW A;  3TAD A;  4YR0 A;  4KMO B;  5EOZ A;  2H5X A;  3Q8K A;  3ETR A;  1RM6 C;  3QEA Z;  4EX6 A;  2ZJA A;  1JUD A;  4I2I A;  4Q8E A;  2DGZ A;  4J9M A;  3LDA A;  2KNJ A;  5BOL A;  5J0W A;  9ICU A;  2ZIX A;  5AK3 A;  3KKA A;  2BPF A;  2BZF A;  1K1Q A;  2EH9 A;  3AM9 A;  1ZQT A;  3M1Y A;  2EAP A;  1NJW A;  1C20 A;  4B9S A;  4RT3 A;  3RB6 A;  1SZP A;  5DB8 A;  4DL5 A;  2C2R A;  1PZN A;  2A1J B;  1KL9 A;  4P0P A;  2E1F A;  3WK9 A;  2IA6 A;  4J9N A;  4IR1 A;  2XGQ A;  1ZQW A;  5AM1 A;  5F9N A;  4Y2S A;  4ECQ A;  2BQU A;  2HHX A;  4QZI A;  1N48 A;  2P6R A;  1QQ5 A;  2BCQ A;  4TUP A;  4R65 A;  7ICI A;  5AKL A;  1P7D A;  4O3N A;  4F2S A;  1SV0 C;  5L1M A;  3ORY A;  2JEJ A;  2E8P A;  3PST A;  3QYP A;  1Q46 A;  4DFK A;  1SXE A;  1U47 A;  1JIH A;  2KJ5 A;  3LVV A;  2E8O A;  1FO4 A;  4DFP A;  5KFX A;  7ICH A;  1JI7 A;  4JUZ A;  4DSE A;  3Q8M A;  3JPN A;  5KFF A;  2HOQ A;  4O3S A;  3C2K A;  4YD2 A;  1J97 A;  4MEX A;  2D3D A;  2JEF A;  4MF2 A;  3ZDE A;  2KMD A;  4RQN A;  2VIX A;  1DRG A;  3IV6 A;  1D8B A;  2RHF A;  1UA1 A;  4DF8 A;  4Y2X A;  1L7P A;  4FS1 A;  5EE0 A;  3BZC A;  2ZXI A;  3TAC B;  3RH4 A;  5DQI A;  4ED1 A;  5L1L A;  1X40 A;  3UMC A;  4RUA A;  7ICL A;  9ICH A;  4PPX A;  3Q8L A;  2W55 A;  4DQP A;  1RYS A;  2BDP A;  2E1E A;  5G5G A;  3GIJ A;  3H7I A;  1SV4 A;  1D9D A;  5KL8 B;  4WJ3 B;  5L1J A;  5TIS U;  1COK A;  1U48 A;  7ICV A;  1L7N A;  4PH5 A;  3AU6 A;  1IIP A;  2LYB A;  2IHN A;  4KIT B;  4I2G A;  2DKZ A;  5F9L A;  5AIC A;  2V9W A;  4Y2P A;  2Y9T A;  1ZET A;  5KG0 A;  2W9C B;  2DPI A;  2GH1 A;  1YZ7 A;  4KLH A;  4UAU A;  5JTI A;  1ZQS A;  4QNL A;  2EAM A;  3SAF A;  1S97 A;  5FP0 A;  4GC7 A;  2B6G A;  1ZQP A;  3PX4 A;  1FIQ A;  4GFJ A;  3WKC A;  4EEL A;  7ICQ A;  8ICM A;  5AI0 A;  2F1I A;  1MQ2 A;  2KFZ A;  2Z7J A;  5D49 A;  3N7P D;  1KDH A;  4KN7 A;  5HML A;  1PVP A;  1ZQB A;  2MRL A;  4BDP A;  2YMQ A;  3PW0 A;  5DKW A;  1DOQ A;  2I6X A;  4B9U A;  4M9N A;  2KIC A;  4CNQ A;  4F5Q A;  2P6U A;  4RQ6 A;  4ED2 A;  3KFU F;  4KX5 A;  1CRX A;  2FMP A;  2DL0 A;  2PXI A;  4DCC A;  3RR8 A;  1JRO A;  2E8M A;  4PGX A;  1BVS A;  4PZN A;  7ICT A;  2PKE A;  5CJ7 A;  4RT2 A;  3I1Y A;  3DEE A;  5KG4 A;  2IHM A;  2HHW A;  3ZD9 A;  3GIL A;  2KOB A;  4K4H A;  3KZX A;  3M9N B;  1XSN A;  8ICS A;  5J2I A;  3N28 A;  5J0R A;  1S0O A;  4A8E A;  4Z6D A;  3RJH A;  4LZG A;  4NLK A;  3GV7 B;  4AYB F;  4YG2 A;  5AKH A;  5EE9 A;  8ICY A;  3UMB A;  1L5U A;  1SZH A;  5EWG A;  4ED0 A;  1RYU A;  5KFK A;  3PVX A;  2W04 A;  2WFA A;  1UPH A;  4UB1 A;  3V7J A;  1B43 A;  2UVV A;  4TQS A;  2CXY A;  4I2J A;  5IIO A;  9ICM A;  5J8Y A;  2VA8 A;  4MFA A;  2FDR A;  2EAO A;  1YT3 A;  4P4P A;  2W8L A;  1ZQC A;  1V97 A;  4QIW C;  1A0P A;  1ZJN A;  5KFA A;  4G3I A;  3NS1 A;  3V6H A;  2JEI A;  4C8O A;  5KFV A;  2KSO B;  4IQW A;  2XIC A;  4C4R A;  4R63 A;  4RZR A;  9ICT A;  3B0X A;  4UB5 A;  4R66 A;  5ALS A;  2DWQ A;  3NVY A;  5DBC A;  4IR9 A;  3BQT A;  2JZB B;  3AMZ A;  8ICE A;  1X9S A;  3MR5 A;  3PMN A;  2NRT A;  3RB4 A;  2V4R A;  2ZIW B;  2HOI A;  1ED1 A;  1ZD5 A;  4YR2 A;  2A1J A;  1RQL A;  5B5E U;  1QQ7 A;  2YTU A;  1NK6 A;  4M9J A;  9ICR A;  4B9V A;  3HW8 A;  1C7Y A;  1RG6 A;  2F44 A;  1WCL A;  4M6W B;  4QWA A;  4B9M A;  7ICJ A;  1VLB A;  3PW4 A;  3LK9 A;  5J2F A;  3R9K A;  3U26 A;  3AL0 B;  4DF4 A;  1X6J A;  1S0N A;  2PI5 A;  4F5P A;  4RQ8 A;  2KP7 A;  2FLN A;  1IXR A;  4Z6E A;  1ZRN A;  3KOO A;  5C5J A;  2W3S A;  1IG6 A;  4I29 A;  3PSP A;  2NRW A;  4F8R A;  4MHV A;  3EPG A;  5KFZ A;  5BOM A;  2AU0 A;  4F5O A;  3T5J A;  4YQW A;  1MN8 A;  4BUG A;  2ASD A;  7ICM A;  3EYZ A;  1QSS A;  4U6P A;  2VKQ A;  1URJ A;  3ZDC A;  2FMQ A;  4FO6 A;  3RJJ A;  2H3Q A;  2AJQ A;  5G5H A;  3T5H A;  4NXZ A;  2FPL A;  3MFI A;  1NK5 A;  1F5S A;  1ZQU A;  4CE6 A;  2H3F A;  3M9M B;  2F3N A;  4CF3 A;  4P2H A;  4ECS A;  3GV8 B;  2ODG A;  5DDM A;  1ZQK A;  5J2A A;  4QZC A;  4F93 B;  3HPO A;  4DLE A;  4OCZ A;  3MC1 A;  3HJE A;  3E0F A;  4PJ0 U;  4B9N A;  3QUB A;  2KVC A;  4NWI A;  1S77 D;  1NKC A;  2W9C A;  4QZ8 A;  9ICL A;  1BPZ A;  3MGV A;  9ICK A;  4BXO A;  5KT4 A;  1QH9 A;  4YD1 A;  1PVR A;  1SL2 A;  2KG5 A;  3L3F X;  3SMV A;  2OH2 A;  3GIM A;  1U4B A;  4QZG A;  5KL1 B;  2KFN A;  5KFG A;  3SEI A;  1JAL A;  3AEV A;  5DG8 A;  4GC6 A;  2AQ4 A;  5ALY A;  5III A;  2BGW A;  3NTU A;  3HIL A;  4JV1 A;  9ICN A;  2K8B B;  1TFR A;  2K60 A;  4UB4 A;  2R8K A;  2AGP A;  2W8K A;  8ICB A;  4R8U B;  1NJZ A;  2R8H A;  1N2X A;  2HBJ A;  5KFI A;  4F4Z A;  3RAQ A;  4QJF B;  3WK8 A;  4KLQ A;  2KKV A;  3OSN A;  3SI8 A;  4JK1 A;  1X66 A;  2PFO A;  5CP2 A;  4OO1 J;  3C23 A;  5ALW A;  4YCX A;  3KHR A;  4NV0 A;  4BWJ A;  1GO3 F;  5KFS A;  3PNC A;  2JXJ A;  5ALK A;  9ICQ A;  5ALV A;  5J2J A;  2AQ0 A;  1Z1B A;  7ICU A;  5D4B A;  4IRK A;  4RPX A;  2K89 A;  3M6Z A;  3PO4 A;  4YP3 A;  4ED7 A;  4NLN A;  2KEY A;  2XGP A;  4JWM A;  2W54 A;  1X9W A;  2HW3 A;  3H40 A;  3ZI4 A;  1OW5 A;  4DFJ A;  3B0Y A;  4BX9 C;  4ECY A;  1L6N A;  3ISB A;  5KFL A;  1XSP A;  2W7O A;  4I2A A;  3H4B A;  1X9M A;  4F91 B;  5JU5 A;  9ICI A;  5CB1 A;  2ZIU B;  5AM2 A;  3KHG A;  1Q3V A;  2Y0S F;  4PHD A;  2OM6 A;  5HR6 A;  4DOB A;  2RDI A;  1YZ6 A;  1X2I A;  1VDV A;  2GO7 A;  1ZQF A;  1LKY B;  5JUM A;  5AM0 A;  4KLU A;  3MR6 A;  1WWV A;  2XI9 A;  2YB1 A;  3RRH A;  2KTQ A;  3BJY A;  1KTQ A;  2LYA A;  5AIB A;  8ICH A;  1RPL A;  1SV0 A;  4J9R A;  1RDF A;  3NRW A;  4DWI A;  2BPC A;  1ECW A;  5KT2 A;  2CRX A;  4X5V A;  5L1K A;  3FC4 A;  2C28 A;  2KSO A;  7ICE A;  4M0A A;  5J0T A;  3WU2 U;  2LM1 A;  4Y2Y A;  5A0L A;  3E2E A;  2ZXH A;  2EZZ A;  4ED6 A;  3CW2 C;  4AYB C;  3PY8 A;  2OWO A;  2LMR A;  1XSL A;  4KLT A;  5KFN A;  3H8S A;  2JZB A;  5AI9 A;  4DS4 A;  4Y2T A;  4RPZ A;  2NRV A;  5KFJ A;  4O3P A;  4ZH4 A;  2ZIW A;  2ZIV B;  4GIB A;  4CRX A;  3H8W A;  3SD7 A;  1T94 A;  2PFQ A;  3UQ0 A;  7ICF A;  4IQU A;  3GV5 B;  4JMU A;  5DGA A;  1DK2 A;  5KFU A;  3B9J A;  3JPO A;  2Y1I A;  4KLG A;  9ICP A;  4FZM A;  5J0Y A;  2IOF K;  2LI6 A;  5ALJ A;  4J03 A;  1ZQG A;  4M6W A;  4DL7 A;  4F4W A;  3Q8R B;  3IN5 A;  1JXE A;  2BDU A;  2XY5 A;  3H0R B;  1ZQQ A;  3HP6 A;  1X9X A;  4I2F A;  2W9B B;  3UXO A;  2D6F C;  2HMX A;  2XC9 A;  1UA0 A;  4MF8 A;  1S76 D;  1J2M A;  2B21 A;  2WF9 A;  5AKE A;  5KFP A;  3F5A A;  1KFT A;  4XQ8 A;  2H3Z A;  2JH1 A;  3T5L A;  3IP4 B;  2AH5 A;  5J0Q A;  3MAB A;  2F8K A;  4QWC A;  2NV3 A;  4ED8 A;  5D46 A;  4GLX A;  3C28 A;  4C7Z A;  1IV8 A;  3AUO A;  3QZ8 A;  3BQ0 A;  2QAR B;  5J0S A;  4MEY A;  1NI3 A;  2YX8 A;  4PGQ A;  1BNO A;  3JPS A;  4KLJ A;  1KRP A;  1T7P A;  2J6T A;  1UQV A;  2M9N A;  1NK8 A;  9ICB A;  1FFV A;  1SWW A;  1QTM A;  3OTQ A;  4B9L A;  3N7S C;  8ICJ A;  3MGH A;  3QEB Z;  1TAM A;  2NO5 A;  2ZJ8 A;  2EZY A;  3H8M A;  4P4M A;  3SQI A;  2HVH A;  1Z3E B;  4UAW A;  4C4T A;  1SKR A;  2IBK A;  5CWR A;  1ZYQ A;  3I76 A;  5J0P A;  4OJ5 A;  4P0Q B;  3MFH A;  2K4H A;  4UB3 A;  3S6J A;  3H0L B;  4O3R A;  3RJK A;  2YN4 A;  4YR3 A;  3RB3 A;  1L3T A;  4DSJ A;  4JWN A;  1NK4 A;  3QU5 A;  1S5L U;  3IDW A;  2PMZ F;  4ACO A;  1XS9 D;  5AKY A;  4RQ3 A;  1N62 A;  4F5N A;  4KMU A;  1ARO P;  1T3Q A;  2DQN B;  5DQG A;  4EBC A;  1U9L A;  4BXO B;  2G07 A;  2ZUC A;  5HR7 A;  4R8U A;  4XRH A;  1BPY A;  9ICO A;  1XO1 A;  3GQC A;  3DV9 A;  3FAH A;  1UT5 A;  5F3X B;  1ZQI A;  4RQ4 A; 
#chains in the Genus database with same CATH homology
 2FJ6 A;  2O6K A;  2KVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...