2KVSA

Nmr solution structure of q7a1e8 protein from staphylococcus aureus: northeast structural genomics consortium target: zr215
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
b'MAGDPMTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMANLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MW0776
publication title NMR Solution Structure of Q7A1E8 protein from Staphylococcus aureus: Northeast Structural Genomics Consortium target: ZR215
rcsb
source organism Staphylococcus aureus
molecule tags Structural genomics, unknown function
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2kvsA00
2FJ6A 2KVSA 2O6KA
chains in the Genus database with same CATH superfamily
3F53A 2DUYA 5ALGA 4F71A 2FLLA 4DFKA 2WFAA 3OSNA 1SL0A 3RAQA 7ICMA 5IIOA 5IINA 8ICMA 1ZETA 4BJQA 3JPNA 4EYIB 4CNQA 2MA1A 3MDCA 3TADA 1TFRA 2H3FA 3A0BU 4GC6A 3M9NB 1ZQQA 4OCZA 4DQRA 4F92B 1TVAA 3RBDA 4Y2UA 2KHQA 3RB0A 1ZQBA 1QQ5A 2FMQA 3BS5B 4UBCA 4QZ8A 4UB5A 3U26A 2YB1A 4KLUA 1DGJA 3GV7B 1JI7A 9ICWA 4O3RA 5AKHA 2HBMA 4I2FA 1ED1A 4IRDA 7ICHA 5AHXA 4J9NA 2BCSA 3QUTA 1ZQLA 3HJEA 3Q8MA 3E58A 3UQ0A 8ICSA 3PR4A 5DQGA 2KFZA 5J2GA 4KLFA 2KKVA 2IOFA 1RXVA 1RM6C 2ZTEA 4NLKA 2J6TA 2ESEA 2FPMA 5KL1B 3TQ1A 2XO7A 1RZTA 4ELTA 4BXOB 9ICBA 4ECYA 3V6HA 2PMZC 5KFNA 3ONNA 1COKA 3B0XA 5DB9A 2BPGA 4IRCA 1L3VA 5ALWA 1FIQA 2RDIA 3WKDA 4C4TA 2ZTDA 3PO4A 2K4EA 3HKZF 1QTMA 3OGUA 1T3QA 8ICRA 3PV8A 4PJ0U 3BQ0A 2XVTA 3GDXA 4G9BA 1ZXIA 1A0PA 4BWMA 4M9LA 9ICMA 4PGYA 2M9NA 4UW9A 3G6VA 2KZZA 5DLGA 3RJEA 3MR2A 5ALZA 2YN4A 3QEAZ 2FDRA 2AU0A 4Y2RA 1KQQA 4Y2SA 3PSFA 4NLZA 5AK4A 3GV5B 2C22A 2G06A 5J2DA 3NVWA 5EWEA 4RPYA 7ICFA 4RQ2A 2XC9A 5HHHA 4DLGA 2F77X 2W8LA 3KHRA 4PH5A 2A1JB 2ASJA 2W9BA 4B9SA 3JPSA 1ZQXA 4O9MA 3WK5A 4C8OA 4RT3A 2I9GA 4P4PA 9ICLA 2KNJA 3M6KA 3MR3A 3SD7A 2K8AA 2VIXA 4OJPA 1VDVA 1SXEA 5DGAA 3GILA 1A77A 3HX0A 3UXPA 2EZYA 5KFLA 3C23A 4F4XA 1X40A 5DQHA 2W03A 2B21A 3WK7A 8ICOA 1ZQFA 4MF2A 2JZBA 1NZPA 4EBDA 4HAIA 4J9QA 3RJIA 3C5GA 5KFZA 5DG8A 4U6PA 3FC4A 5CRXA 4A8EA 1QH9A 4KLLA 8ICIA 4BGDA 1ZQEA 2F3NA 4XUSA 4ELVA 1CUKA 2R8IA 4ECWA 1RG6A 2AHOB 4F4WA 4O5KA 3UMGA 2PI4A 7ICRA 1IM4A 4RQ3A 4O3NA 2R18A 5KT7A 1A76A 1ZQSA 1AQ6A 2F44A 1T3NA 4DOAA 3PMLA 3QX7A 4IC9A 3FAHA 1D8BA 2E8NA 3QZ8A 3UXNA 5KT6A 5KFGA 4RNMA 7ICLA 4QZCA 3KKAA 3BZCA 4J03A 2VKQA 1TV9A 2YMPA 3H8MA 2G5IB 2DF4B 4I2DA 3TI0A 3HILA 2LM1A 4Q8FA 4EX7A 4GXIA 3ISDA 1NKCA 1RDFA 8ICPA 3PO5A 2IMWP 2HOQA 2XCPA 1SZPA 5L1MA 2ASDA 7ICEA 8ICAA 4IQVA 4UQGA 9ICHA 3KHHA 4B6JA 1XO1A 5J0XA 2E5SA 2A19A 2BPCA 5CB1A 2JRZA 5ALPA 2B6GA 1ZRMA 2C28A 5CP2A 4KITB 3RB4A 2XIDA 5AIBA 5KFYA 4Z6DA 3OJSA 4KX3A 4DWIA 1DXSA 1LKYA 4YVZA 1V97A 2E3TA 4DSEA 2GH1A 1Q3VA 4O3OA 2BCVA 1DK3A 2FLNA 8ICNA 1N5WA 1NK7A 4XA5A 3MABA 2RRDA 3H8SA 4DFPA 4QW8A 4GFJA 5KFQA 4NL9C 2EAOA 3NRWA 4O3SA 1KDHA 4J9MA 1ZQWA 2H3VA 4ED8A 1B0XA 4UB3A 4MFFA 4JWNA 1Y88A 3RAXA 3K4GA 4CCHA 5HMLA 3QU2A 5KFEA 5IIIA 2QARB 1UA0A 1S8OA 2QKQA 4QZBA 2AJQA 2HDOA 2R8HA 4DCCA 1BPYA 3N28A 2C2EA 3C21A 3E0FA 3RBEA 8ICEA 4FO6A 1WCLA 4YFKA 5DBBA 2QLTA 1S9FA 3PW0A 3SV4A 2LBOA 3KFUF 4RPZA 4TQSA 4OJ5A 2KEYA 1X66A 1URJA 1K5OA 1WUDA 1IXRA 1YZ7A 5HP4A 5TZVA 2BQ3A 4TQRA 4Y2YA 3G6XA 3HKZC 3WKCA 4ECRA 5L1KA 3EPGA 1L7NA 3T5JA 2JZBB 1PK1A 4TURA 1MSWD 4M6WA 5KG1A 4B9TA 2PMZF 5ALUA 2Y0SC 3HRDD 4C7YA 3RTVA 3KTQA 4P0PA 4KX5A 1FFVA 1NKEA 3D2QA 4P2HA 3N7PD 3WK9A 2Q4TA 8ICLA 1KLNA 2DFLA 4ECTA 1UT8A 2GO7A 5ALMA 2FLPA 2OXOA 4QWEA 1NK6A 8ICJA 4MF8A 2W9CB 2UVRA 4BUGA 4UBBA 4EX6A 1UHUA 3MR5A 3IG8A 5ALSA 1TK0A 4QZAA 5ALIA 1RYRA 4R65A 9ICTA 3M8SA 5JUMA 3KD3A 1PVQA 4I28A 5J0TA 2E8PA 5ALFA 3UMCA 4QWAA 5KT5A 1ZQHA 3RB3A 3CNHA 4J9RA 1ZD5A 5KG6A 3AM9A 1FEZA 3KOOA 3WK6A 4DQPA 2W7OA 1Z3EB 1XO0A 2JR5A 2VANA 4F5QA 5BOMA 2Q0ZX 4C0ZA 1L8LA 1DRGA 1M6YA 4DSKA 4K4IA 4IR1A 4DSJA 3TACB 3IDWA 1UCVA 2LHTA 8ICXA 2KIVA 4C8MA 2OHFA 2G07A 1ZQKA 4RQ6A 5C5JA 4ED3A 1TK5A 1LB2B 4CE6A 5ALYA 5J2CA 1TAQA 4M04A 1L6NA 3LVWA 2A3VA 7ICKA 3MBYA 3KBBA 2AGPA 1NZBA 4O5EA 4UB8U 5KT2A 3V7JA 3F2CA 3MGHA 3ETRA 4KLMA 4JMUA 1IG6A 4O5CA 1N60A 3IV6A 3C1ZA 5JU5A 3Q8LA 2R8KA 1TK8A 5G5GA 3I28A 2JHDA 2DL0A 4XQ8A 5ALEA 4QZFA 2ZTCA 5KL8B 3PNCA 3D6JA 3C28A 5AI4A 1TAMA 4Z6CA 4EEYA 4IR9A 3RFAA 1B22A 3QU9A 4QIWF 3GFKB 2JEGA 5F9NA 1SGGA 5KFTA 2H5XA 5G5HA 4GLXA 2EAMA 4CF4A 5AK5A 2DQNB 5KFSA 4IRKA 7ICGA 3K1ZA 1ZD4A 1D8LA 4Y2TA 5C0YA 5F3XB 2DKXA 4F5NA 1NNLA 3PW5A 2J6SA 4IQUA 1WCNA 2ZIXA 3KHGA 1PK3A 2KFNA 1D9FA 4J9SA 2VA8A 3UM9A 2KJ5A 4KMOB 3PSTA 4F5RA 3MGIA 3HWTA 3E2EA 2YX8A 5J0QA 1JIHA 1MA7A 4AYBC 5KT3A 1U9LA 4ED6A 1B43A 5DB7A 4UAWA 5KG7A 4Q8EA 5D4BA 4R63A 1TE2A 4NLGA 1CI4A 4R8UB 1PK1B 4ED2A 1FO4A 4KLHA 1U49A 2OWOA 4M6WB 5L1JA 3TFSA 2W9AA 2V4QA 2HBKA 3RF9A 1ZD2P 9ICPA 1QQ6A 2LYHA 3SR6A 4US9A 1NK9A 3GIJA 4KLQA 1FFUA 4JV2A 3ZDCA 2HCFA 2BCRA 1VJ5A 2FJ6A 2FMPA 1F0MA 4KLGA 2GOLA 2LM4A 5CWRA 3C2KA 2ZUBA 2H3IA 1SV4A 5AKGA 2O6KA 3WU2U 5J29A 3V6JA 5EE1A 2E8OA 2NRVA 5IILA 1ZQRA 3QU5A 3LWMA 4QWBA 2KZMA 9ICCA 4PHPA 7ICNA 5AM1A 3N7RC 4RQ8A 5AICA 9ICSA 2BGWA 4CRXA 2KD1A 4P4MA 3RJGA 2JGAA 4EBEA 2KKPA 3AU2A 3Q8RB 4XRHA 4Q43A 3QEBZ 3OSPA 1NJWA 4QZHA 2HSZA 2HHQA 4KLOA 2NO5A 5ALLA 1U48A 9ICXA 2HI0A 1X9WA 3R9KA 3RJHA 1N5XA 1SIJA 3KZXA 2EZXA 2JMGA 4ECQA 4TUSA 1COOA 2KTQA 1ZQZA 4M9NA 4B9UA 4RUCA 5ALDA 2F8LA 4IS7A 4NLBA 3NRZA 4R64A 3WK4A 4NL9A 4BWJA 1D8YA 4LZGA 3SI8A 4J9KA 5B66U 2KE7A 2DPIA 4EZ9A 2Y0SF 3RR7A 2KHVA 4TUPA 4M9GA 2WF6A 2DKZA 4KLDA 4J9PA 2WF8A 2HVHA 4NY8A 4ZH4A 3BS7A 1JXEA 2AH5A 3RH4A 3PZPA 5JTIA 4YD1A 1SXDA 1QCKA 2GLEA 3H8JA 2W3SA 2RHFA 4DS5A 8ICBA 1KL9A 1DK2A 1X2IA 3J81j 4YXJA 2FE9A 7ICVA 2XI9A 2W04A 4KLTA 3B0YA 5IIJA 2KVCA 4I2BA 3SAHA 4TUQA 2ZIXB 1PVRA 4FZMA 5AI6A 2ALZA 1NOMA 3NVYA 1BPEA 1JX4A 2UVWA 2E8MA 1WWUA 2WF9A 2HBJA 2XGPA 1BPBA 2KK0A 2DGZA 3QU4A 4RNNA 4YR2A 4DF8A 2W43A 2VA3A 3UMBA 1XU4A 3GQCA 2ZXHA 4UASA 1S0OA 3GZFA 2VJ4A 1YZ6A 2EH9A 5J2HA 5KFDA 2WB1C 5KG4A 8ICCA 1MQ2A 4DL4A 3GU3A 2HOIA 2PFPA 4GXJA 1NJZA 4B9NA 2YMMA 5ALNA 4RU9A 3IG5A 2WF7A 2Y9UA 3RR8A 2RQ5A 4ECUA 1S0NA 4Y2XA 4O3QA 4UAVA 2NRWA 2DPJA 2JEJA 4I2EA 2JEFA 4QIWC 2AQ0A 3M9OB 1UT5A 2H3QA 5DLFA 3TANA 1CEZA 3TADC 2PXIA 4DSFA 4YP3A 8ICFA 3THVA 3WKBA 4LVSA 7ICSA 3ZI4A 4OJOA 1Z4NA 4PHEA 1RQNA 2NRTA 3NVZA 3HT3A 1JN3A 2E1EA 3AMZA 5J0SA 1UA1A 1KKXA 2F1HA 2ZIWA 5KFVA 4DFDA 4QZEA 4CDGA 3F2BA 4PPXA 3AUOA 5KG2A 1QSSA 2JH7A 3GIMA 2B0CA 4RQ5A 9ICUA 4MHVA 4YXMA 5DKWA 4UAUA 1N62A 4ICAA 3UPQA 2G09A 1SZHA 3PW7A 3M1YA 4FS1A 4UB6U 3PMNA 5J2EA 4ECXA 3SEIA 1XWLA 1T8EA 7ICOA 3F5AA 5J2KA 4BDPA 4C7ZA 2LI6A 3QZ7A 4AYBF 4GXKA 3H40A 3M6ZA 5AI8A 5KFXA 4DS4A 3H8WA 4FBUA 5ALOA 1JMSA 3RRHA 1L7MA 2ZJ8A 3DEEA 4RQMA 2HOFA 5CHGA 4RQ0A 1ZQPA 1S0MA 5L1LA 3IRUA 4K4GA 1NK0A 2RP5A 4B9MA 4FBTA 1WWVA 1IV8A 1U45A 4FS2A 2JH1A 5KG5A 1X6IA 4RQNA 1MC8A 2XCAA 2ZUDA 4USAA 1ZQYA 2KICA 4UB2A 5KG0A 3ZD8A 3A0HU 4J9LA 3ICXA 2W9BB 5KNIA 1SL1A 5KFUA 1SWWA 2QB1A 5ALRA 7ICPA 1K1QA 1S97A 1J2MA 2KMDA 5KFPA 4NJ8A 1C20A 3QYPA 5DDMA 4M0AA 2F76X 3AL0B 7ICJA 4CGZA 2UVUA 2IHNA 4F5OA 1NK5A 2AGOA 1S5LU 1LVHA 3V7KA 3AQFA 1BPZA 1JRPA 4Z6EA 2W8KA 5D49A 1RPLA 3NGDA 2GWSA 4F2RA 4JV0A 4Y2JA 4DL5A 4M2YA 1SKWA 2CRXA 4QZGA 4F4ZA 3HW8A 4NV0A 3MGVA 1ZJNA 4DL7A 3QU7A 4PGQA 3EUB2 2PKEA 4EENA 3CW2C 2ZIVA 3BQ7A 2ZJ5A 1SKSA 1RYUA 4O3PA 3GIIA 5H2FU 1GO3F 4M47A 2W11A 2XY5A 1C7YA 2FPKA 5EOZA 2EQYA 5FP0A 3K1RB 3BJYA 5AI9A 1SKRA 2EDUA 1ZQVA 1X6JA 3B9JA 2NYVA 1XC9A 3NUQA 1L8OA 2ZIWB 3BS5A 3ORYA 5EE0A 3QE9Y 3KZIU 4EZ6A 2ES6A 5KFAA 5ALTA 5DQIA 3BDPA 2ZG6A 3CRXA 3M8RA 1VLBA 3EPIA 2W7PA 2BZFA 1YT3A 3L4PA 7ICUA 4UB1A 2BR0A 3SV3A 5GTIU 2G5HB 7ICTA 2NRZA 2R8GA 2K4PA 2XY7A 5AKKA 3WKAA 3HP6A 1LKYB 1BNOA 1J97A 2IBKA 3QUBA 4QZ9A 4Y2QA 1EXNA 3O0FA 4DOBA 1ZQCA 3AQEA 5JRTA 2RDJA 4BXOA 4ED1A 1XNSA 9ICIA 2BDUA 3JPPA 2PFQA 5CA7A 1L3TA 4QZIA 3OHBA 3DV9A 2DBYA 2QB0A 2WB1F 2P6RA 2E1FA 4ECZA 4YR3A 3N97B 5KAIU 4C8NA 8ICWA 2KP7A 2FI1A 1QSYA 2JXJA 4MEYA 4I2AA 4C80A 3TAQA 4YG2A 2WTFA 4ZOHC 1LV5A 4OO1J 3IP4B 5KFBA 4RNOA 2UVVA 1RYSA 1X9XA 8ICUA 2RLTA 1L3SA 5J2FA 2DWQA 5J8YC 4OJLA 1O08A 4I2HA 1JXLA 5KTQA 4DQSA 2C2RA 1RQLA 5J0RA 2KSOA 1B4FA 4F2SA 1ZQAA 1U4BA 4I2IA 3QUCA 3EYZA 4DEZA 3HPOA 3LYSA 3EWAA 4FZLA 1MN8A 3F5EA 8ICQA 5EE9A 1AROP 2A1AA 2D3DA 4KN7A 3SAFA 2HHVA 4DO9A 3FYHA 9ICVA 3PR5B 2M0NA 4P0QA 3ISCA 2AQ4A 1OUQA 3NASA 4BX9C 2J6UA 4JUZA 1WG8A 3H0RB 1RXWA 2IOFK 1KRPA 3M7DA 1NKBA 5AKJA 4PL1A 1HEKA 3SMVA 4PGXA 2HHUA 1QQ7A 1ZQTA 4P0PB 4EELA 2LMRA 4MEXA 2BCQA 1NI3A 1K1SA 3OHAA 3N7SC 3VC8A 1SV0C 5DBCA 9ICQA 5AKZA 4DLEA 1QSLA 2CXYA 2HMXA 2XGQA 3C5FA 3PW2A 2ZIVB 3Q8PB 1N2XA 5DG7A 1PZNA 3BZKA 3UXOA 4ACOA 4J9OA 1N48A 2BDPA 5DGBA 8ICHA 4YR0A 5AKXA 1T7PA 1KFDA 2V9WA 2YMQA 3MFHA 4FFDA 2BQUA 4F3OA 2KIWA 2K60A 3JPRA 3RRGA 4HYKA 2ISPA 1KTQA 3PW4A 3H0LB 4F5PA 9ICNA 4F8RA 3SQIA 4CF3A 5AKLA 3AU6A 5KFJA 5T14A 2KVSA 3OJUA 1QLNA 2NO4A 8ICGA 2BCUA 2JEIA 4C8LA 1XSLA 4IL6U 3LWLA 4KLSA 3BQTA 1XSPA 3ZDEA 1U47A 9ICJA 4KMUA 1OW5A 8ICYA 1T94A 3QNMA 4U7CA 4YMNA 4KLJA 2MAXA 1HUOA 1BGXT 5KFOA 1V9PA 2LKYA 5AM0A 4KTQA 1F5SA 3L5KA 4FZNA 1ZQUA 2MRLA 5AI5A 5DBAA 5DG9A 2QB0B 2ZXIA 4KLEA 1ZJMA 4E0DA 2P35A 3TARA 5ALJA 3D2NA 3DDHA 5D46A 1V38A 1SWVA 3H4DA 4I2JA 4JK1A 2HBLA 2YTUA 4JB3A 5J0OA 1BVSA 1L7OA 1HIWA 4M9HA 7ICIA 4I27A 3MFIA 2ZIUA 4I2CA 1ZRNA 1Q46A 4PL2A 3SENA 3CP8A 1T4GA 4CF5A 5B5EU 3RH5A 8ICKA 3ZDAA 5KFHA 4O0IA 1IIPA 1ZYQA 1Z19A 1F44A 4QJFB 1KFTA 4YMMA 4UARA 3N4MB 1ZQOA 1KEJA 2KJ9A 3I1YA 4DSLA 3AN1A 2KSOB 5CR0A 5KFKA 4RZRA 4RQ7A 3ED5A 3IM1A 2C2DA 3M9MB 4DQQA 1BPDA 2QARA 5AKIA 1SL2A 2EAPA 1KW4A 1UQVA 1L3UA 1BNPA 2WHEA 3G6YA 2PFOA 4RT2A 3ZDBA 1XS9D 5AI0A 4P0QB 4NLNA 2OYYA 1KSPA 3I76A 2WF5A 2CN1A 4DQIA 4F72A 2OCEA 9ICFA 1X9MA 4Z6FA 2BQRA 5ALQA 1Z00A 4O3MA 4IQWA 2HHTA 2IA6A 4M9JA 1N56A 4OD0A 3V72A 2ZUCA 2F1JA 4DSIA 5J0PA 2HHWA 2I1QA 1KN5A 1ZQJA 4US8A 2FPLA 1CRXA 3JPOA 5HR6A 3NVVA 4QWDA 4JWMA 5DDYA 1V85A 8ICZA 1PUZA 3ISBA 4DL3A 3Q8QB 5AM2A 3H0MB 3T5LA 2MU2A 4PHAA 3CYMA 1NK4A 2YB4A 1BPXA 2HW3A 4I29A 4NWIA 4R66A 3PSIA 2W9CA 2AGQA 5CJ7A 3JPTA 4C4RA 2K4IA 1ZQ1C 3KHLA 4YD2A 5J2JA 4RPXA 5AM4A 5AM3A 2WAQC 1Z1VA 2I6XA 1JUDA 2P6UA 4DL6A 3MR6A 1TKDA 3SZ2A 2LPEA 3FM9A 5AKEA 4RQ4A 2ATLA 1HUZA 4ED7A 4EEKA 2K8CB 1L7PA 1S77D 2HVIA 2KG5A 1X42A 5HHIA 5J2AA 5J0WA 5KT4A 3PX0A 3PSPA 2NV3A 3T3FA 9ICRA 4AP9A 2CPRA 5EWGA 2EANA 5E79U 4DL2A 1UPHA 3Q8KA 2H3ZA 4QNLA 2HHSA 4ED0A 4OJ6A 3L3FX 5J0YA 3PX6A 1H38A 9ICKA 1OXJA 4B9VA 4UB4A 1ZD3A 1S0VA 3QUQA 2PI5A 5BPCA 4F4KA 3IHQB 4DF4A 3H7IA 2W3RA 3QXGA 1Q8KA 2ZIUB 4NM1A 3T5HA 2W55A 2W54A 1HJPA 3GIKA 1J2NA 1N63A 2MUTA 3PY8A 2OH2A 2XICA 2OEHA 5J8YA 2LYBA 1PVPA 4DFMA 5HNKA 3RH6A 5KFRA 4YCXA 2BKEA 2KOBA 2G08A 1S76D 1MQ3A 4B9LA 1A6SA 1NJYA 4EYHB 3LK9A 4Q44A 1JROA 3ZD9A 2G0AA 2D6FC 1ZQIA 4NXZA 4UATA 3RJKA 4X5VA 3OPXA 2Y9TA 3S6JA 2IHMA 5DB8A 2IOHA 4GIBA 3TAPA 5KG3A 5HMMA 5AK6A 4F93B 2P66A 4K4HA 2OM6A 4MFCA 4LJXA 1Z00B 1SV0A 5AIAA 3C2LA 2BHNA 1ZOLA 2VJ5A 3RJFA 4YMOA 3UQ2A 2KV2A 4R8UA 1X9SA 4RUAA 4KLIA 9ICGA 3T5KA 4RQ1A 5L9XA 1O03A 3MDAA 5ALKA 1N61A 3F2DA 2Z7JA 2EZZA 5KFFA 1TAUA 9ICAA 1DOQA 4ECSA 1Z4OA 3PVXA 2VA2A 5HR7A 4DOCA 3TKAA 3WKEA 1ZQDA 7ICQA 3C29A 4GC7A 4PZNA 4EBCA 3EW9A 1L5UA 3FDSA 4QZDA 3K75D 1NK8A 4C8KA 1DGSA 2LYAA 1XSNA 8ICVA 2ASLA 2I5HA 3LVVA 3SYZA 2NRXA 3BQ2A 3RJJA 4G3IA 4IQTA 4LZDA 1KBUA 5F9LA 2BPFA 5K4LA 4I2GA 2KJ8A 2FMSA 5TISU 4MFAA 5J0UA 5EWFA 3NTUA 4UAZA 4KN4A 5BOLA 3KKAC 2R8JA 5KFIA 5ALXA 4JV1A 3D2SA 5AK3A 1KFSA 3RB6A 3ALRA 2YQEA 5ALVA 4F50A 2Y1IA 4YN4A 2ODGA 1Q3UA 2ISOA 5J2IA 2K89A 2ZJAA 5ALHA 2F8KA 1P7DA 5DB6A 5KFWA 3JPQA 4YQWA 5J2BA 3AEVA 3TFRA 5CEHA 5AM5A 1WYGA 3WK8A 4P4OA 1D9DA 5IIKA 3T79A 2PFNA 4PZOA 2W9MA 2XY6A 2JV3A 2HHXA 3ETLA 4F91B 4DFJA 1ZQNA 2YY6A 2AXTU 3Q8SB 5GTHU 1SB3C 4F4YA 3ZDDA 1S10A 3H4BA 1ZQMA 3IN5A 4ECVA 9ICOA 2F2AB 4NM2A 1ECWA 5KFCA 4Y2PA 3GV8B 2MUTB 9ICEA 2D8CA 8ICTA 4QW9A 2KZ3A 4WJ3B 3EZ5A 2L5YA 4UAYA 3BQ1A 3LDAA 5A0LA 2K4HA 4PHDA 1NJXA 2N1RA 5AKYA 1Z1BA 4Q45A 1JALA 3SAGA 3OTQA 2KN7A 5KFMA 2MSNA 4ELUA 4C4SA 4NLCA 2V4RA 3PX4A 4Y2VA 1ZQGA 3C2MA 5KAFU 2YMLA 3C1YA 2K8BB 3NS1A 2WAQF 5L1IA 2A1JA 4QWCA 3V6KA 5EE3A 2Y1JA 3VCBA 2F1IA 4FE3A 5IIMA 3V7LA 3MC1A
chains in the Genus database with same CATH topology
2FJ6A 2KVSA 2O6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ6 A;  2KVS A;  2O6K A; 
#chains in the Genus database with same CATH topology
 3F53 A;  2DUY A;  5ALG A;  4F71 A;  2FLL A;  4DFK A;  2WFA A;  3OSN A;  1SL0 A;  3RAQ A;  7ICM A;  5IIO A;  5IIN A;  8ICM A;  1ZET A;  4BJQ A;  3JPN A;  4EYI B;  4CNQ A;  2MA1 A;  3MDC A;  3TAD A;  1TFR A;  2H3F A;  3A0B U;  4GC6 A;  3M9N B;  1ZQQ A;  4OCZ A;  4DQR A;  4F92 B;  1TVA A;  3RBD A;  4Y2U A;  2KHQ A;  3RB0 A;  1ZQB A;  1QQ5 A;  2FMQ A;  3BS5 B;  4UBC A;  4QZ8 A;  4UB5 A;  3U26 A;  2YB1 A;  4KLU A;  1DGJ A;  3GV7 B;  1JI7 A;  9ICW A;  4O3R A;  5AKH A;  2HBM A;  4I2F A;  1ED1 A;  4IRD A;  7ICH A;  5AHX A;  4J9N A;  2BCS A;  3QUT A;  1ZQL A;  3HJE A;  3Q8M A;  3E58 A;  3UQ0 A;  8ICS A;  3PR4 A;  5DQG A;  2KFZ A;  5J2G A;  4KLF A;  2KKV A;  2IOF A;  1RXV A;  1RM6 C;  2ZTE A;  4NLK A;  2J6T A;  2ESE A;  2FPM A;  5KL1 B;  3TQ1 A;  2XO7 A;  1RZT A;  4ELT A;  4BXO B;  9ICB A;  4ECY A;  3V6H A;  2PMZ C;  5KFN A;  3ONN A;  1COK A;  3B0X A;  5DB9 A;  2BPG A;  4IRC A;  1L3V A;  5ALW A;  1FIQ A;  2RDI A;  3WKD A;  4C4T A;  2ZTD A;  3PO4 A;  2K4E A;  3HKZ F;  1QTM A;  3OGU A;  1T3Q A;  8ICR A;  3PV8 A;  4PJ0 U;  3BQ0 A;  2XVT A;  3GDX A;  4G9B A;  1ZXI A;  1A0P A;  4BWM A;  4M9L A;  9ICM A;  4PGY A;  2M9N A;  4UW9 A;  3G6V A;  2KZZ A;  5DLG A;  3RJE A;  3MR2 A;  5ALZ A;  2YN4 A;  3QEA Z;  2FDR A;  2AU0 A;  4Y2R A;  1KQQ A;  4Y2S A;  3PSF A;  4NLZ A;  5AK4 A;  3GV5 B;  2C22 A;  2G06 A;  5J2D A;  3NVW A;  5EWE A;  4RPY A;  7ICF A;  4RQ2 A;  2XC9 A;  5HHH A;  4DLG A;  2F77 X;  2W8L A;  3KHR A;  4PH5 A;  2A1J B;  2ASJ A;  2W9B A;  4B9S A;  3JPS A;  1ZQX A;  4O9M A;  3WK5 A;  4C8O A;  4RT3 A;  2I9G A;  4P4P A;  9ICL A;  2KNJ A;  3M6K A;  3MR3 A;  3SD7 A;  2K8A A;  2VIX A;  4OJP A;  1VDV A;  1SXE A;  5DGA A;  3GIL A;  1A77 A;  3HX0 A;  3UXP A;  2EZY A;  5KFL A;  3C23 A;  4F4X A;  1X40 A;  5DQH A;  2W03 A;  2B21 A;  3WK7 A;  8ICO A;  1ZQF A;  4MF2 A;  2JZB A;  1NZP A;  4EBD A;  4HAI A;  4J9Q A;  3RJI A;  3C5G A;  5KFZ A;  5DG8 A;  4U6P A;  3FC4 A;  5CRX A;  4A8E A;  1QH9 A;  4KLL A;  8ICI A;  4BGD A;  1ZQE A;  2F3N A;  4XUS A;  4ELV A;  1CUK A;  2R8I A;  4ECW A;  1RG6 A;  2AHO B;  4F4W A;  4O5K A;  3UMG A;  2PI4 A;  7ICR A;  1IM4 A;  4RQ3 A;  4O3N A;  2R18 A;  5KT7 A;  1A76 A;  1ZQS A;  1AQ6 A;  2F44 A;  1T3N A;  4DOA A;  3PML A;  3QX7 A;  4IC9 A;  3FAH A;  1D8B A;  2E8N A;  3QZ8 A;  3UXN A;  5KT6 A;  5KFG A;  4RNM A;  7ICL A;  4QZC A;  3KKA A;  3BZC A;  4J03 A;  2VKQ A;  1TV9 A;  2YMP A;  3H8M A;  2G5I B;  2DF4 B;  4I2D A;  3TI0 A;  3HIL A;  2LM1 A;  4Q8F A;  4EX7 A;  4GXI A;  3ISD A;  1NKC A;  1RDF A;  8ICP A;  3PO5 A;  2IMW P;  2HOQ A;  2XCP A;  1SZP A;  5L1M A;  2ASD A;  7ICE A;  8ICA A;  4IQV A;  4UQG A;  9ICH A;  3KHH A;  4B6J A;  1XO1 A;  5J0X A;  2E5S A;  2A19 A;  2BPC A;  5CB1 A;  2JRZ A;  5ALP A;  2B6G A;  1ZRM A;  2C28 A;  5CP2 A;  4KIT B;  3RB4 A;  2XID A;  5AIB A;  5KFY A;  4Z6D A;  3OJS A;  4KX3 A;  4DWI A;  1DXS A;  1LKY A;  4YVZ A;  1V97 A;  2E3T A;  4DSE A;  2GH1 A;  1Q3V A;  4O3O A;  2BCV A;  1DK3 A;  2FLN A;  8ICN A;  1N5W A;  1NK7 A;  4XA5 A;  3MAB A;  2RRD A;  3H8S A;  4DFP A;  4QW8 A;  4GFJ A;  5KFQ A;  4NL9 C;  2EAO A;  3NRW A;  4O3S A;  1KDH A;  4J9M A;  1ZQW A;  2H3V A;  4ED8 A;  1B0X A;  4UB3 A;  4MFF A;  4JWN A;  1Y88 A;  3RAX A;  3K4G A;  4CCH A;  5HML A;  3QU2 A;  5KFE A;  5III A;  2QAR B;  1UA0 A;  1S8O A;  2QKQ A;  4QZB A;  2AJQ A;  2HDO A;  2R8H A;  4DCC A;  1BPY A;  3N28 A;  2C2E A;  3C21 A;  3E0F A;  3RBE A;  8ICE A;  4FO6 A;  1WCL A;  4YFK A;  5DBB A;  2QLT A;  1S9F A;  3PW0 A;  3SV4 A;  2LBO A;  3KFU F;  4RPZ A;  4TQS A;  4OJ5 A;  2KEY A;  1X66 A;  1URJ A;  1K5O A;  1WUD A;  1IXR A;  1YZ7 A;  5HP4 A;  5TZV A;  2BQ3 A;  4TQR A;  4Y2Y A;  3G6X A;  3HKZ C;  3WKC A;  4ECR A;  5L1K A;  3EPG A;  1L7N A;  3T5J A;  2JZB B;  1PK1 A;  4TUR A;  1MSW D;  4M6W A;  5KG1 A;  4B9T A;  2PMZ F;  5ALU A;  2Y0S C;  3HRD D;  4C7Y A;  3RTV A;  3KTQ A;  4P0P A;  4KX5 A;  1FFV A;  1NKE A;  3D2Q A;  4P2H A;  3N7P D;  3WK9 A;  2Q4T A;  8ICL A;  1KLN A;  2DFL A;  4ECT A;  1UT8 A;  2GO7 A;  5ALM A;  2FLP A;  2OXO A;  4QWE A;  1NK6 A;  8ICJ A;  4MF8 A;  2W9C B;  2UVR A;  4BUG A;  4UBB A;  4EX6 A;  1UHU A;  3MR5 A;  3IG8 A;  5ALS A;  1TK0 A;  4QZA A;  5ALI A;  1RYR A;  4R65 A;  9ICT A;  3M8S A;  5JUM A;  3KD3 A;  1PVQ A;  4I28 A;  5J0T A;  2E8P A;  5ALF A;  3UMC A;  4QWA A;  5KT5 A;  1ZQH A;  3RB3 A;  3CNH A;  4J9R A;  1ZD5 A;  5KG6 A;  3AM9 A;  1FEZ A;  3KOO A;  3WK6 A;  4DQP A;  2W7O A;  1Z3E B;  1XO0 A;  2JR5 A;  2VAN A;  4F5Q A;  5BOM A;  2Q0Z X;  4C0Z A;  1L8L A;  1DRG A;  1M6Y A;  4DSK A;  4K4I A;  4IR1 A;  4DSJ A;  3TAC B;  3IDW A;  1UCV A;  2LHT A;  8ICX A;  2KIV A;  4C8M A;  2OHF A;  2G07 A;  1ZQK A;  4RQ6 A;  5C5J A;  4ED3 A;  1TK5 A;  1LB2 B;  4CE6 A;  5ALY A;  5J2C A;  1TAQ A;  4M04 A;  1L6N A;  3LVW A;  2A3V A;  7ICK A;  3MBY A;  3KBB A;  2AGP A;  1NZB A;  4O5E A;  4UB8 U;  5KT2 A;  3V7J A;  3F2C A;  3MGH A;  3ETR A;  4KLM A;  4JMU A;  1IG6 A;  4O5C A;  1N60 A;  3IV6 A;  3C1Z A;  5JU5 A;  3Q8L A;  2R8K A;  1TK8 A;  5G5G A;  3I28 A;  2JHD A;  2DL0 A;  4XQ8 A;  5ALE A;  4QZF A;  2ZTC A;  5KL8 B;  3PNC A;  3D6J A;  3C28 A;  5AI4 A;  1TAM A;  4Z6C A;  4EEY A;  4IR9 A;  3RFA A;  1B22 A;  3QU9 A;  4QIW F;  3GFK B;  2JEG A;  5F9N A;  1SGG A;  5KFT A;  2H5X A;  5G5H A;  4GLX A;  2EAM A;  4CF4 A;  5AK5 A;  2DQN B;  5KFS A;  4IRK A;  7ICG A;  3K1Z A;  1ZD4 A;  1D8L A;  4Y2T A;  5C0Y A;  5F3X B;  2DKX A;  4F5N A;  1NNL A;  3PW5 A;  2J6S A;  4IQU A;  1WCN A;  2ZIX A;  3KHG A;  1PK3 A;  2KFN A;  1D9F A;  4J9S A;  2VA8 A;  3UM9 A;  2KJ5 A;  4KMO B;  3PST A;  4F5R A;  3MGI A;  3HWT A;  3E2E A;  2YX8 A;  5J0Q A;  1JIH A;  1MA7 A;  4AYB C;  5KT3 A;  1U9L A;  4ED6 A;  1B43 A;  5DB7 A;  4UAW A;  5KG7 A;  4Q8E A;  5D4B A;  4R63 A;  1TE2 A;  4NLG A;  1CI4 A;  4R8U B;  1PK1 B;  4ED2 A;  1FO4 A;  4KLH A;  1U49 A;  2OWO A;  4M6W B;  5L1J A;  3TFS A;  2W9A A;  2V4Q A;  2HBK A;  3RF9 A;  1ZD2 P;  9ICP A;  1QQ6 A;  2LYH A;  3SR6 A;  4US9 A;  1NK9 A;  3GIJ A;  4KLQ A;  1FFU A;  4JV2 A;  3ZDC A;  2HCF A;  2BCR A;  1VJ5 A;  2FJ6 A;  2FMP A;  1F0M A;  4KLG A;  2GOL A;  2LM4 A;  5CWR A;  3C2K A;  2ZUB A;  2H3I A;  1SV4 A;  5AKG A;  2O6K A;  3WU2 U;  5J29 A;  3V6J A;  5EE1 A;  2E8O A;  2NRV A;  5IIL A;  1ZQR A;  3QU5 A;  3LWM A;  4QWB A;  2KZM A;  9ICC A;  4PHP A;  7ICN A;  5AM1 A;  3N7R C;  4RQ8 A;  5AIC A;  9ICS A;  2BGW A;  4CRX A;  2KD1 A;  4P4M A;  3RJG A;  2JGA A;  4EBE A;  2KKP A;  3AU2 A;  3Q8R B;  4XRH A;  4Q43 A;  3QEB Z;  3OSP A;  1NJW A;  4QZH A;  2HSZ A;  2HHQ A;  4KLO A;  2NO5 A;  5ALL A;  1U48 A;  9ICX A;  2HI0 A;  1X9W A;  3R9K A;  3RJH A;  1N5X A;  1SIJ A;  3KZX A;  2EZX A;  2JMG A;  4ECQ A;  4TUS A;  1COO A;  2KTQ A;  1ZQZ A;  4M9N A;  4B9U A;  4RUC A;  5ALD A;  2F8L A;  4IS7 A;  4NLB A;  3NRZ A;  4R64 A;  3WK4 A;  4NL9 A;  4BWJ A;  1D8Y A;  4LZG A;  3SI8 A;  4J9K A;  5B66 U;  2KE7 A;  2DPI A;  4EZ9 A;  2Y0S F;  3RR7 A;  2KHV A;  4TUP A;  4M9G A;  2WF6 A;  2DKZ A;  4KLD A;  4J9P A;  2WF8 A;  2HVH A;  4NY8 A;  4ZH4 A;  3BS7 A;  1JXE A;  2AH5 A;  3RH4 A;  3PZP A;  5JTI A;  4YD1 A;  1SXD A;  1QCK A;  2GLE A;  3H8J A;  2W3S A;  2RHF A;  4DS5 A;  8ICB A;  1KL9 A;  1DK2 A;  1X2I A;  3J81 j;  4YXJ A;  2FE9 A;  7ICV A;  2XI9 A;  2W04 A;  4KLT A;  3B0Y A;  5IIJ A;  2KVC A;  4I2B A;  3SAH A;  4TUQ A;  2ZIX B;  1PVR A;  4FZM A;  5AI6 A;  2ALZ A;  1NOM A;  3NVY A;  1BPE A;  1JX4 A;  2UVW A;  2E8M A;  1WWU A;  2WF9 A;  2HBJ A;  2XGP A;  1BPB A;  2KK0 A;  2DGZ A;  3QU4 A;  4RNN A;  4YR2 A;  4DF8 A;  2W43 A;  2VA3 A;  3UMB A;  1XU4 A;  3GQC A;  2ZXH A;  4UAS A;  1S0O A;  3GZF A;  2VJ4 A;  1YZ6 A;  2EH9 A;  5J2H A;  5KFD A;  2WB1 C;  5KG4 A;  8ICC A;  1MQ2 A;  4DL4 A;  3GU3 A;  2HOI A;  2PFP A;  4GXJ A;  1NJZ A;  4B9N A;  2YMM A;  5ALN A;  4RU9 A;  3IG5 A;  2WF7 A;  2Y9U A;  3RR8 A;  2RQ5 A;  4ECU A;  1S0N A;  4Y2X A;  4O3Q A;  4UAV A;  2NRW A;  2DPJ A;  2JEJ A;  4I2E A;  2JEF A;  4QIW C;  2AQ0 A;  3M9O B;  1UT5 A;  2H3Q A;  5DLF A;  3TAN A;  1CEZ A;  3TAD C;  2PXI A;  4DSF A;  4YP3 A;  8ICF A;  3THV A;  3WKB A;  4LVS A;  7ICS A;  3ZI4 A;  4OJO A;  1Z4N A;  4PHE A;  1RQN A;  2NRT A;  3NVZ A;  3HT3 A;  1JN3 A;  2E1E A;  3AMZ A;  5J0S A;  1UA1 A;  1KKX A;  2F1H A;  2ZIW A;  5KFV A;  4DFD A;  4QZE A;  4CDG A;  3F2B A;  4PPX A;  3AUO A;  5KG2 A;  1QSS A;  2JH7 A;  3GIM A;  2B0C A;  4RQ5 A;  9ICU A;  4MHV A;  4YXM A;  5DKW A;  4UAU A;  1N62 A;  4ICA A;  3UPQ A;  2G09 A;  1SZH A;  3PW7 A;  3M1Y A;  4FS1 A;  4UB6 U;  3PMN A;  5J2E A;  4ECX A;  3SEI A;  1XWL A;  1T8E A;  7ICO A;  3F5A A;  5J2K A;  4BDP A;  4C7Z A;  2LI6 A;  3QZ7 A;  4AYB F;  4GXK A;  3H40 A;  3M6Z A;  5AI8 A;  5KFX A;  4DS4 A;  3H8W A;  4FBU A;  5ALO A;  1JMS A;  3RRH A;  1L7M A;  2ZJ8 A;  3DEE A;  4RQM A;  2HOF A;  5CHG A;  4RQ0 A;  1ZQP A;  1S0M A;  5L1L A;  3IRU A;  4K4G A;  1NK0 A;  2RP5 A;  4B9M A;  4FBT A;  1WWV A;  1IV8 A;  1U45 A;  4FS2 A;  2JH1 A;  5KG5 A;  1X6I A;  4RQN A;  1MC8 A;  2XCA A;  2ZUD A;  4USA A;  1ZQY A;  2KIC A;  4UB2 A;  5KG0 A;  3ZD8 A;  3A0H U;  4J9L A;  3ICX A;  2W9B B;  5KNI A;  1SL1 A;  5KFU A;  1SWW A;  2QB1 A;  5ALR A;  7ICP A;  1K1Q A;  1S97 A;  1J2M A;  2KMD A;  5KFP A;  4NJ8 A;  1C20 A;  3QYP A;  5DDM A;  4M0A A;  2F76 X;  3AL0 B;  7ICJ A;  4CGZ A;  2UVU A;  2IHN A;  4F5O A;  1NK5 A;  2AGO A;  1S5L U;  1LVH A;  3V7K A;  3AQF A;  1BPZ A;  1JRP A;  4Z6E A;  2W8K A;  5D49 A;  1RPL A;  3NGD A;  2GWS A;  4F2R A;  4JV0 A;  4Y2J A;  4DL5 A;  4M2Y A;  1SKW A;  2CRX A;  4QZG A;  4F4Z A;  3HW8 A;  4NV0 A;  3MGV A;  1ZJN A;  4DL7 A;  3QU7 A;  4PGQ A;  3EUB 2;  2PKE A;  4EEN A;  3CW2 C;  2ZIV A;  3BQ7 A;  2ZJ5 A;  1SKS A;  1RYU A;  4O3P A;  3GII A;  5H2F U;  1GO3 F;  4M47 A;  2W11 A;  2XY5 A;  1C7Y A;  2FPK A;  5EOZ A;  2EQY A;  5FP0 A;  3K1R B;  3BJY A;  5AI9 A;  1SKR A;  2EDU A;  1ZQV A;  1X6J A;  3B9J A;  2NYV A;  1XC9 A;  3NUQ A;  1L8O A;  2ZIW B;  3BS5 A;  3ORY A;  5EE0 A;  3QE9 Y;  3KZI U;  4EZ6 A;  2ES6 A;  5KFA A;  5ALT A;  5DQI A;  3BDP A;  2ZG6 A;  3CRX A;  3M8R A;  1VLB A;  3EPI A;  2W7P A;  2BZF A;  1YT3 A;  3L4P A;  7ICU A;  4UB1 A;  2BR0 A;  3SV3 A;  5GTI U;  2G5H B;  7ICT A;  2NRZ A;  2R8G A;  2K4P A;  2XY7 A;  5AKK A;  3WKA A;  3HP6 A;  1LKY B;  1BNO A;  1J97 A;  2IBK A;  3QUB A;  4QZ9 A;  4Y2Q A;  1EXN A;  3O0F A;  4DOB A;  1ZQC A;  3AQE A;  5JRT A;  2RDJ A;  4BXO A;  4ED1 A;  1XNS A;  9ICI A;  2BDU A;  3JPP A;  2PFQ A;  5CA7 A;  1L3T A;  4QZI A;  3OHB A;  3DV9 A;  2DBY A;  2QB0 A;  2WB1 F;  2P6R A;  2E1F A;  4ECZ A;  4YR3 A;  3N97 B;  5KAI U;  4C8N A;  8ICW A;  2KP7 A;  2FI1 A;  1QSY A;  2JXJ A;  4MEY A;  4I2A A;  4C80 A;  3TAQ A;  4YG2 A;  2WTF A;  4ZOH C;  1LV5 A;  4OO1 J;  3IP4 B;  5KFB A;  4RNO A;  2UVV A;  1RYS A;  1X9X A;  8ICU A;  2RLT A;  1L3S A;  5J2F A;  2DWQ A;  5J8Y C;  4OJL A;  1O08 A;  4I2H A;  1JXL A;  5KTQ A;  4DQS A;  2C2R A;  1RQL A;  5J0R A;  2KSO A;  1B4F A;  4F2S A;  1ZQA A;  1U4B A;  4I2I A;  3QUC A;  3EYZ A;  4DEZ A;  3HPO A;  3LYS A;  3EWA A;  4FZL A;  1MN8 A;  3F5E A;  8ICQ A;  5EE9 A;  1ARO P;  2A1A A;  2D3D A;  4KN7 A;  3SAF A;  2HHV A;  4DO9 A;  3FYH A;  9ICV A;  3PR5 B;  2M0N A;  4P0Q A;  3ISC A;  2AQ4 A;  1OUQ A;  3NAS A;  4BX9 C;  2J6U A;  4JUZ A;  1WG8 A;  3H0R B;  1RXW A;  2IOF K;  1KRP A;  3M7D A;  1NKB A;  5AKJ A;  4PL1 A;  1HEK A;  3SMV A;  4PGX A;  2HHU A;  1QQ7 A;  1ZQT A;  4P0P B;  4EEL A;  2LMR A;  4MEX A;  2BCQ A;  1NI3 A;  1K1S A;  3OHA A;  3N7S C;  3VC8 A;  1SV0 C;  5DBC A;  9ICQ A;  5AKZ A;  4DLE A;  1QSL A;  2CXY A;  2HMX A;  2XGQ A;  3C5F A;  3PW2 A;  2ZIV B;  3Q8P B;  1N2X A;  5DG7 A;  1PZN A;  3BZK A;  3UXO A;  4ACO A;  4J9O A;  1N48 A;  2BDP A;  5DGB A;  8ICH A;  4YR0 A;  5AKX A;  1T7P A;  1KFD A;  2V9W A;  2YMQ A;  3MFH A;  4FFD A;  2BQU A;  4F3O A;  2KIW A;  2K60 A;  3JPR A;  3RRG A;  4HYK A;  2ISP A;  1KTQ A;  3PW4 A;  3H0L B;  4F5P A;  9ICN A;  4F8R A;  3SQI A;  4CF3 A;  5AKL A;  3AU6 A;  5KFJ A;  5T14 A;  2KVS A;  3OJU A;  1QLN A;  2NO4 A;  8ICG A;  2BCU A;  2JEI A;  4C8L A;  1XSL A;  4IL6 U;  3LWL A;  4KLS A;  3BQT A;  1XSP A;  3ZDE A;  1U47 A;  9ICJ A;  4KMU A;  1OW5 A;  8ICY A;  1T94 A;  3QNM A;  4U7C A;  4YMN A;  4KLJ A;  2MAX A;  1HUO A;  1BGX T;  5KFO A;  1V9P A;  2LKY A;  5AM0 A;  4KTQ A;  1F5S A;  3L5K A;  4FZN A;  1ZQU A;  2MRL A;  5AI5 A;  5DBA A;  5DG9 A;  2QB0 B;  2ZXI A;  4KLE A;  1ZJM A;  4E0D A;  2P35 A;  3TAR A;  5ALJ A;  3D2N A;  3DDH A;  5D46 A;  1V38 A;  1SWV A;  3H4D A;  4I2J A;  4JK1 A;  2HBL A;  2YTU A;  4JB3 A;  5J0O A;  1BVS A;  1L7O A;  1HIW A;  4M9H A;  7ICI A;  4I27 A;  3MFI A;  2ZIU A;  4I2C A;  1ZRN A;  1Q46 A;  4PL2 A;  3SEN A;  3CP8 A;  1T4G A;  4CF5 A;  5B5E U;  3RH5 A;  8ICK A;  3ZDA A;  5KFH A;  4O0I A;  1IIP A;  1ZYQ A;  1Z19 A;  1F44 A;  4QJF B;  1KFT A;  4YMM A;  4UAR A;  3N4M B;  1ZQO A;  1KEJ A;  2KJ9 A;  3I1Y A;  4DSL A;  3AN1 A;  2KSO B;  5CR0 A;  5KFK A;  4RZR A;  4RQ7 A;  3ED5 A;  3IM1 A;  2C2D A;  3M9M B;  4DQQ A;  1BPD A;  2QAR A;  5AKI A;  1SL2 A;  2EAP A;  1KW4 A;  1UQV A;  1L3U A;  1BNP A;  2WHE A;  3G6Y A;  2PFO A;  4RT2 A;  3ZDB A;  1XS9 D;  5AI0 A;  4P0Q B;  4NLN A;  2OYY A;  1KSP A;  3I76 A;  2WF5 A;  2CN1 A;  4DQI A;  4F72 A;  2OCE A;  9ICF A;  1X9M A;  4Z6F A;  2BQR A;  5ALQ A;  1Z00 A;  4O3M A;  4IQW A;  2HHT A;  2IA6 A;  4M9J A;  1N56 A;  4OD0 A;  3V72 A;  2ZUC A;  2F1J A;  4DSI A;  5J0P A;  2HHW A;  2I1Q A;  1KN5 A;  1ZQJ A;  4US8 A;  2FPL A;  1CRX A;  3JPO A;  5HR6 A;  3NVV A;  4QWD A;  4JWM A;  5DDY A;  1V85 A;  8ICZ A;  1PUZ A;  3ISB A;  4DL3 A;  3Q8Q B;  5AM2 A;  3H0M B;  3T5L A;  2MU2 A;  4PHA A;  3CYM A;  1NK4 A;  2YB4 A;  1BPX A;  2HW3 A;  4I29 A;  4NWI A;  4R66 A;  3PSI A;  2W9C A;  2AGQ A;  5CJ7 A;  3JPT A;  4C4R A;  2K4I A;  1ZQ1 C;  3KHL A;  4YD2 A;  5J2J A;  4RPX A;  5AM4 A;  5AM3 A;  2WAQ C;  1Z1V A;  2I6X A;  1JUD A;  2P6U A;  4DL6 A;  3MR6 A;  1TKD A;  3SZ2 A;  2LPE A;  3FM9 A;  5AKE A;  4RQ4 A;  2ATL A;  1HUZ A;  4ED7 A;  4EEK A;  2K8C B;  1L7P A;  1S77 D;  2HVI A;  2KG5 A;  1X42 A;  5HHI A;  5J2A A;  5J0W A;  5KT4 A;  3PX0 A;  3PSP A;  2NV3 A;  3T3F A;  9ICR A;  4AP9 A;  2CPR A;  5EWG A;  2EAN A;  5E79 U;  4DL2 A;  1UPH A;  3Q8K A;  2H3Z A;  4QNL A;  2HHS A;  4ED0 A;  4OJ6 A;  3L3F X;  5J0Y A;  3PX6 A;  1H38 A;  9ICK A;  1OXJ A;  4B9V A;  4UB4 A;  1ZD3 A;  1S0V A;  3QUQ A;  2PI5 A;  5BPC A;  4F4K A;  3IHQ B;  4DF4 A;  3H7I A;  2W3R A;  3QXG A;  1Q8K A;  2ZIU B;  4NM1 A;  3T5H A;  2W55 A;  2W54 A;  1HJP A;  3GIK A;  1J2N A;  1N63 A;  2MUT A;  3PY8 A;  2OH2 A;  2XIC A;  2OEH A;  5J8Y A;  2LYB A;  1PVP A;  4DFM A;  5HNK A;  3RH6 A;  5KFR A;  4YCX A;  2BKE A;  2KOB A;  2G08 A;  1S76 D;  1MQ3 A;  4B9L A;  1A6S A;  1NJY A;  4EYH B;  3LK9 A;  4Q44 A;  1JRO A;  3ZD9 A;  2G0A A;  2D6F C;  1ZQI A;  4NXZ A;  4UAT A;  3RJK A;  4X5V A;  3OPX A;  2Y9T A;  3S6J A;  2IHM A;  5DB8 A;  2IOH A;  4GIB A;  3TAP A;  5KG3 A;  5HMM A;  5AK6 A;  4F93 B;  2P66 A;  4K4H A;  2OM6 A;  4MFC A;  4LJX A;  1Z00 B;  1SV0 A;  5AIA A;  3C2L A;  2BHN A;  1ZOL A;  2VJ5 A;  3RJF A;  4YMO A;  3UQ2 A;  2KV2 A;  4R8U A;  1X9S A;  4RUA A;  4KLI A;  9ICG A;  3T5K A;  4RQ1 A;  5L9X A;  1O03 A;  3MDA A;  5ALK A;  1N61 A;  3F2D A;  2Z7J A;  2EZZ A;  5KFF A;  1TAU A;  9ICA A;  1DOQ A;  4ECS A;  1Z4O A;  3PVX A;  2VA2 A;  5HR7 A;  4DOC A;  3TKA A;  3WKE A;  1ZQD A;  7ICQ A;  3C29 A;  4GC7 A;  4PZN A;  4EBC A;  3EW9 A;  1L5U A;  3FDS A;  4QZD A;  3K75 D;  1NK8 A;  4C8K A;  1DGS A;  2LYA A;  1XSN A;  8ICV A;  2ASL A;  2I5H A;  3LVV A;  3SYZ A;  2NRX A;  3BQ2 A;  3RJJ A;  4G3I A;  4IQT A;  4LZD A;  1KBU A;  5F9L A;  2BPF A;  5K4L A;  4I2G A;  2KJ8 A;  2FMS A;  5TIS U;  4MFA A;  5J0U A;  5EWF A;  3NTU A;  4UAZ A;  4KN4 A;  5BOL A;  3KKA C;  2R8J A;  5KFI A;  5ALX A;  4JV1 A;  3D2S A;  5AK3 A;  1KFS A;  3RB6 A;  3ALR A;  2YQE A;  5ALV A;  4F50 A;  2Y1I A;  4YN4 A;  2ODG A;  1Q3U A;  2ISO A;  5J2I A;  2K89 A;  2ZJA A;  5ALH A;  2F8K A;  1P7D A;  5DB6 A;  5KFW A;  3JPQ A;  4YQW A;  5J2B A;  3AEV A;  3TFR A;  5CEH A;  5AM5 A;  1WYG A;  3WK8 A;  4P4O A;  1D9D A;  5IIK A;  3T79 A;  2PFN A;  4PZO A;  2W9M A;  2XY6 A;  2JV3 A;  2HHX A;  3ETL A;  4F91 B;  4DFJ A;  1ZQN A;  2YY6 A;  2AXT U;  3Q8S B;  5GTH U;  1SB3 C;  4F4Y A;  3ZDD A;  1S10 A;  3H4B A;  1ZQM A;  3IN5 A;  4ECV A;  9ICO A;  2F2A B;  4NM2 A;  1ECW A;  5KFC A;  4Y2P A;  3GV8 B;  2MUT B;  9ICE A;  2D8C A;  8ICT A;  4QW9 A;  2KZ3 A;  4WJ3 B;  3EZ5 A;  2L5Y A;  4UAY A;  3BQ1 A;  3LDA A;  5A0L A;  2K4H A;  4PHD A;  1NJX A;  2N1R A;  5AKY A;  1Z1B A;  4Q45 A;  1JAL A;  3SAG A;  3OTQ A;  2KN7 A;  5KFM A;  2MSN A;  4ELU A;  4C4S A;  4NLC A;  2V4R A;  3PX4 A;  4Y2V A;  1ZQG A;  3C2M A;  5KAF U;  2YML A;  3C1Y A;  2K8B B;  3NS1 A;  2WAQ F;  5L1I A;  2A1J A;  4QWC A;  3V6K A;  5EE3 A;  2Y1J A;  3VCB A;  2F1I A;  4FE3 A;  5IIM A;  3V7L A;  3MC1 A; 
#chains in the Genus database with same CATH homology
 2FJ6 A;  2KVS A;  2O6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...