2KVSA

Nmr solution structure of q7a1e8 protein from staphylococcus aureus: northeast structural genomics consortium target: zr215
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
MAGDPMTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMANLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MW0776
publication title NMR Solution Structure of Q7A1E8 protein from Staphylococcus aureus: Northeast Structural Genomics Consortium target: ZR215
rcsb
source organism Staphylococcus aureus
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2kvsA00
2KVSA 2O6KA 2FJ6A
chains in the Genus database with same CATH superfamily
4EBCA 2A1JB 3GIMA 5ALKA 1TFRA 3PX6A 4IQUA 3KOOA 1RQNA 4RQ2A 1U49A 8ICLA 2FMPA 5KFIA 4YR3A 4DWIA 5CP2A 4KX3A 1F5SA 4NLGA 3RH5A 3PVXA 3RJFA 4UB2A 3OHAA 1AROP 4O3MA 1L6NA 5KG4A 1WCNA 1FIQA 3QXGA 3I28A 4RPZA 3C2LA 2HHWA 3SYZA 1MSWD 1WUDA 2ISOA 5EWEA 2IOFK 3MGVA 3IDWA 4DEZA 9ICCA 4JWNA 4NLZA 2GH1A 4CGZA 4Q8FA 5HHIA 1ZQ1C 3GZFA 2ASLA 3B0YA 3JPOA 2XCPA 2OM6A 2ODGA 3F2BA 2OH2A 1MQ2A 4QZHA 4DLGA 2W7OA 8ICOA 5IIIA 5KFWA 3F2DA 2W54A 2VKQA 4Y2PA 1KDHA 1LV5A 5KAIU 4ED7A 4FBUA 4C7ZA 2K4PA 5HHHA 1WG8A 2H3VA 2KJ8A 2KOBA 2AHOB 7ICUA 3RBDA 4B9TA 3IG5A 2N1RA 2OEHA 5C0YA 1T94A 1ZQIA 5KFZA 1PVPA 2DQNB 4B9VA 3H8WA 4ED0A 2XY5A 4K4IA 3AMZA 4J9RA 2DPJA 2K4HA 3IM1A 4GIBA 1ZRNA 4CF4A 3RRHA 3PX0A 2DPIA 3EW9A 1ZQQA 3UXNA 4UB3A 1MN8A 2E3TA 4KLMA 1V85A 3NVWA 4O5EA 4Z6FA 4UAWA 4NWIA 2KP7A 2NRXA 1N61A 3AN1A 5AICA 4ELVA 2C2RA 5J8YC 4DOBA 3BZCA 5CEHA 4O5CA 2ZJAA 1Z3EB 1IV8A 4NM1A 2VA3A 2JH7A 4F3OA 1FEZA 4HYKA 1ZQZA 5KFFA 3H7IA 4QZAA 2XGQA 5AI5A 4MHVA 1XWLA 3LWMA 4ECVA 3QUQA 1HEKA 2D8CA 3H4BA 1HUOA 4DQRA 4OJLA 1Z1VA 1L3UA 3RJKA 2KJ9A 4DS5A 9ICLA 1Q46A 9ICBA 1KEJA 5KFEA 5KAFU 3EYZA 3AQEA 2K89A 4TURA 5AIBA 5EWFA 1XNSA 3LWLA 4FS1A 1QQ6A 3PO4A 4IR1A 3RH4A 9ICAA 4DF8A 5DG8A 4NLCA 2MSNA 3GQCA 2DBYA 1QQ5A 4RT2A 1Z00A 4FZNA 5ALEA 3EZ5A 2HSZA 2HHXA 3K75D 3RR7A 2JV3A 3UXOA 2NYVA 2OWOA 3NVZA 5D4BA 4ICAA 4F4XA 1WYGA 1VJ5A 3MBYA 4I2BA 4UQGA 1K5OA 1JXEA 1ZD5A 5J2FA 3HX0A 4JV1A 1ZQLA 4B9UA 4PGXA 7ICSA 1A77A 2I9GA 4UB1A 7ICKA 5F9LA 2BDUA 2NO4A 1HUZA 3MDCA 3PW2A 1NK4A 5ALHA 2L5YA 5J0TA 1Z1BA 4M9JA 2PKEA 3CP8A 1NJWA 3JPPA 2V9WA 4OJOA 1J2MA 1X9MA 3N28A 2OHFA 3S6JA 4NL9C 8ICRA 2ZJ5A 4C8LA 5TISU 1SGGA 3K4GA 5BPCA 2NRWA 2JRZA 4OJPA 4YP3A 3MFIA 1ZQTA 1Q3UA 3GIIA 4Y2UA 1TAMA 3SV4A 3M6ZA 1M6YA 4MEXA 2G5HB 1Z00B 4GFJA 4G3IA 1XSNA 3PSPA 2O6KA 4PZNA 1JX4A 2KD1A 4EENA 2HI0A 4UAYA 3PMLA 3WU2U 4C8MA 1HIWA 1Y88A 4O5KA 3AU2A 2YY6A 1LKYA 3MDAA 3PZPA 2KZMA 4EX7A 1O08A 1Q3VA 3HPOA 3ZDAA 1NK0A 2BPFA 1NK7A 1BNOA 4TUSA 4QJFB 4UW9A 2HHSA 3WKEA 4F2RA 4ECUA 4ECTA 3MC1A 3M9OB 4RQNA 4MFCA 4Q45A 4EX6A 4RZRA 2F3NA 4XQ8A 5DG7A 4O3RA 3GFKB 2BCQA 3NTUA 5F9NA 4I2CA 3PNCA 1K1QA 1ZQFA 4BXOA 2PXIA 2LI6A 2YMQA 3F53A 3RRGA 2I5HA 2F1HA 1X9WA 4PHDA 3EWAA 1X6IA 3RJIA 1COKA 5J2HA 5AKXA 4RQ5A 1NK8A 3D2SA 5HP4A 1KSPA 5KT4A 5KG0A 4F50A 4OD0A 4USAA 4DCCA 1ZD3A 3H8SA 2VJ4A 3RB0A 4B6JA 2EAPA 3UQ0A 4UB8U 5ALRA 4IS7A 3ZDEA 3MGHA 5J0SA 1ZQYA 4DOAA 7ICHA 1KFTA 4QZGA 1LKYB 8ICFA 2WF8A 3H0MB 2HOQA 4ED8A 1SV4A 4FS2A 1H38A 9ICVA 2PMZF 2JHDA 1SIJA 5CRXA 9ICOA 1JALA 1N60A 5J2GA 3Q8MA 2FJ6A 1XO1A 2WB1C 5CB1A 1ZQDA 1S0OA 2XC9A 2MAXA 4YVZA 2RHFA 2HBMA 4Q44A 5G5GA 1ZD4A 3PMNA 2E1FA 4G9BA 4YMMA 2BPCA 4BXOB 4TQRA 2PI5A 4UATA 3PW4A 2VA8A 4YCXA 2P66A 1A76A 3JPQA 4B9SA 3V72A 5CHGA 8ICMA 5DQIA 1B22A 2PFPA 4Y2JA 4J9KA 5J2AA 1RPLA 3LVVA 3GILA 5J2EA 4RNMA 4QZDA 5FP0A 4EZ9A 2CN1A 3DEEA 3TADC 9ICXA 1VLBA 1DK3A 2XI9A 2W04A 1TK0A 3QUCA 9ICWA 2A19A 2EANA 2PMZC 5EE3A 1BPXA 1L7OA 5D46A 2W55A 5KFBA 4IQVA 3WK9A 2LM1A 4J9PA 2MRLA 3NVVA 2R8JA 3ISBA 5H2FU 3A0HU 8ICQA 1V97A 4UB4A 1D8LA 9ICJA 3DV9A 2DGZA 2WF7A 5J2DA 1FO4A 2KE7A 4F5OA 4GXKA 1NK6A 2W9CA 1YZ7A 4C0ZA 1L5UA 1ZRMA 4YD1A 8ICSA 4RQ7A 3SMVA 5J2CA 1IIPA 1ZQBA 1N56A 3EPIA 1SWWA 2XGPA 2H3QA 5ALQA 7ICPA 1Z4NA 1KFDA 2KVCA 1ZQHA 5KFCA 3CW2C 5J2KA 1QTMA 3TARA 1P7DA 4E0DA 9ICTA 2LYHA 2JEIA 2E8OA 3BDPA 4M04A 4BWJA 4J9NA 1X2IA 3C1YA 2BCRA 1RDFA 1KKXA 2ZUCA 5KG3A 2E8NA 4I2HA 1T3NA 2LBOA 3V6KA 3ETRA 1X66A 3TADA 4PPXA 4KN7A 4YFKA 4DQSA 1B0XA 3BS7A 7ICNA 1AQ6A 5DB6A 1L7PA 3M8RA 2YMPA 3SQIA 2YB1A 5KFPA 4Z6DA 4YR2A 1ZETA 1ZQOA 4B9LA 3SD7A 8ICVA 4NY8A 4O3QA 4J9LA 3RAQA 2E8MA 3HJEA 1ZQWA 1HJPA 5J2JA 3GV7B 4R63A 4YMOA 1N2XA 3B0XA 1OW5A 5ALYA 2W9CB 3LK9A 3H4DA 2F8KA 5AK3A 3GDXA 4I2JA 5AM4A 3VC8A 2Y1JA 4CNQA 1ZJMA 1UT5A 3VCBA 3BQTA 3N97B 4P4MA 5AKKA 3OJSA 4K4HA 3MGIA 4UBCA 2W9MA 1S0MA 3JPSA 3KHLA 4TUPA 3PR4A 1BPDA 5KTQA 4BGDA 1SL0A 5KFVA 1ZOLA 3E2EA 1NZBA 3NGDA 4C8OA 2F8LA 5AI8A 4QW8A 3PW7A 4KLJA 4RQMA 2ZUDA 1KTQA 2AQ4A 3SZ2A 2UVVA 4XA5A 1XO0A 2PI4A 5C5JA 1L3VA 3TAPA 2ASJA 1KW4A 3GV5B 4ELUA 1U47A 2J6SA 2D6FC 1BVSA 4KLLA 2MUTA 2IBKA 2WFAA 5KFHA 1U4BA 1BPZA 5L1JA 4KLQA 1RM6C 3UPQA 4US8A 3OSNA 3BQ7A 5J0PA 3M9MB 1LB2B 1S0NA 1MC8A 4Y2SA 1CI4A 3D2NA 3IRUA 1DGJA 3Q8RB 3UMBA 2JR5A 1TAUA 3FC4A 1SZPA 5AI6A 4ELTA 5KT7A 1X6JA 3KBBA 4F8RA 2RQ5A 3FAHA 4P4OA 1CUKA 2R18A 5J0WA 1SWVA 5E79U 2FDRA 1NJYA 4B9MA 1JROA 1X9SA 3WKBA 1D9DA 4Q43A 4GC6A 2HHTA 2AJQA 3HT3A 2PFQA 5CJ7A 1K1SA 3I76A 2KZZA 5KFLA 2K4IA 4QW9A 1XSLA 3MR6A 1KFSA 4Z6CA 2ZIXA 2FLPA 3KHHA 3RB3A 4MEYA 3CRXA 5HMLA 2ZIWA 2G5IB 2AXTU 2KMDA 2XY6A 2AGQA 1C7YA 2WTFA 2EZZA 7ICQA 4RT3A 4IQWA 4YXJA 4F92B 3H8JA 1DXSA 1TV9A 4NV0A 4DL4A 4KTQA 8ICNA 2HBJA 2RDJA 2MUTB 1JXLA 2R8GA 4KLTA 2BQ3A 5AKIA 4QZCA 4DSJA 4KN4A 1ZQEA 2HHVA 9ICQA 8ICJA 4YD2A 2NO5A 4QIWF 3G6XA 4KLEA 8ICZA 5DB7A 3HKZF 1PK3A 4ECZA 4CE6A 5AI9A 2JEJA 3PSIA 4I2EA 5AK6A 4IR9A 9ICGA 4BDPA 4ECWA 3WK7A 2KIWA 3UMGA 3Q8SB 3ISCA 3RR8A 2K8CB 3SI8A 2F1JA 2KNJA 5ALLA 5D49A 4DL5A 3J81j 4EYHB 4U7CA 1ZYQA 3ETLA 5GTIU 5KFKA 1XS9D 7ICTA 1Q8KA 4CCHA 3ISDA 5HR7A 3M9NB 8ICBA 3M6KA 2G07A 3KHRA 4EEKA 4R66A 5AKLA 1UHUA 2VJ5A 3GIJA 5B5EU 5IIOA 5AKEA 1NNLA 5KFQA 2EAOA 2ZTDA 1ZQRA 4YXMA 1DK2A 3KZIU 4C80A 3QUBA 4F5RA 2ZIXB 8ICPA 2F44A 2NV3A 5EWGA 4EEYA 1DGSA 2ZIWB 5K4LA 7ICEA 3PX4A 2I1QA 2KJ5A 2WF9A 1BPBA 5AKJA 2FMQA 4C4TA 1X9XA 3A0BU 2B0CA 3QEAZ 3C5GA 4DS4A 3E58A 9ICIA 5J0YA 5J0UA 4KMUA 4QIWC 4RQ1A 3HKZC 5KFGA 1ED1A 5IILA 1L3TA 1BPEA 1RXWA 3QU9A 5ALUA 3KKAC 2BPGA 1ZXIA 3IHQB 2VIXA 1QLNA 3ZD9A 4C7YA 3SAGA 5B66U 5DQGA 5KFJA 8ICAA 2G06A 5KT2A 4GXJA 5CR0A 4ECYA 4QWDA 1A6SA 7ICFA 3RB6A 3M1YA 2Q0ZX 3WKDA 8ICYA 5ALZA 5AHXA 5AM0A 2V4RA 4J9SA 2NRZA 2XO7A 1F44A 2PFNA 5HR6A 3BQ2A 4PL2A 1XU4A 1SKWA 5AI4A 2EQYA 2KZ3A 5J0XA 3AM9A 2R8KA 1QCKA 5DG9A 2XVTA 5ALFA 1PVQA 5BOMA 2OYYA 2R8HA 4KLOA 2NRVA 4J9QA 4IC9A 4QWEA 2Y1IA 3Q8KA 4P0PA 9ICHA 5KFTA 4C4SA 1MQ3A 3BS5A 1T7PA 2HBKA 3CNHA 4P2HA 3WK5A 5DGBA 3RBEA 2ZXIA 1D8YA 5T14A 5ALGA 5HMMA 3EPGA 8ICGA 4FO6A 2W3SA 3RJJA 5EE0A 5KNIA 1NOMA 4QZEA 2WB1F 1ZQGA 5KFYA 2KN7A 2G09A 3KKAA 3N4MB 1B43A 3QZ8A 1ZQVA 1NJXA 1BPYA 5ALDA 2KKPA 4DQIA 1KRPA 8ICUA 1T3QA 1NK9A 2DUYA 4P0QA 3MR5A 8ICTA 2C28A 5KFXA 2F2AB 5AIAA 1X40A 1OUQA 5GTHU 3AQFA 3C23A 1S8OA 9ICEA 4KLUA 3TI0A 4F2SA 2OCEA 2GLEA 2UVRA 5BOLA 1PVRA 2RDIA 1NI3A 1SL2A 2M9NA 1VDVA 1NK5A 5ALIA 1UT8A 5IIJA 2MA1A 4DL6A 4UAUA 1ZQMA 2UVUA 4F5QA 1J2NA 2CXYA 3PSFA 3UM9A 3PR5B 5AM5A 3UQ2A 5DB8A 3PO5A 2J6TA 7ICJA 3TFRA 3NUQA 3UMCA 4P0PB 4EBEA 1SKRA 2ZXHA 3BS5B 1IG6A 3D2QA 2OXOA 2HOIA 8ICCA 4OCZA 3U26A 4I29A 2V4QA 5AI0A 1KBUA 1RG6A 2H3IA 1TE2A 2I6XA 3IP4B 4TQSA 4F93B 2YX8A 3NRWA 4Y2RA 3Q8QB 4DSIA 4KLSA 5L1LA 3AEVA 4QZBA 2Y9UA 4EELA 2B21A 4NXZA 4DO9A 1U45A 8ICHA 8ICEA 3G6VA 3PSTA 2NRTA 4UB6U 4CRXA 3ZDCA 4M6WA 1ZQNA 3BQ1A 1QSSA 3OHBA 4P0QB 3T5LA 4ED2A 4QWBA 1JN3A 1IXRA 5ALTA 2F77X 4OJ5A 3QU7A 3NASA 3MABA 3ZD8A 5J2BA 4MF8A 4O3SA 2JEFA 1BGXT 8ICKA 3V6JA 4EBDA 5EOZA 1S76D 2KSOA 2E1EA 3L5KA 4O3OA 4F4WA 5DDYA 3GU3A 4UAVA 2FLNA 1RXVA 1TK8A 4ZOHC 2KV2A 2YB4A 5G5HA 3V6HA 4EZ6A 5DQHA 4AYBF 4I2DA 3HILA 4RNOA 5KL8B 1TVAA 1QQ7A 1RZTA 4O0IA 1N5WA 1O03A 2XY7A 4DFKA 3D6JA 4DL3A 4DSKA 4F4YA 2LYBA 3H0LB 4US9A 3H8MA 2KFZA 2BZFA 4KLGA 2JGAA 4Z6EA 5KFAA 2HDOA 4I27A 2F76X 3B9JA 2HMXA 1SB3C 5ALOA 5IIMA 2D3DA 7ICRA 4C8KA 3AL0B 2JH1A 3QU4A 2P6UA 4RQ4A 1QSLA 3T5KA 4M6WB 3SAFA 4DQQA 5DBBA 2VA2A 5ALVA 3Q8LA 1XSPA 1UA0A 4QNLA 4BX9C 4ECXA 3SEIA 4DL2A 4I2IA 2ATLA 2WF5A 4M9HA 4DSFA 4JK1A 2XICA 9ICPA 2IHNA 3UXPA 2B6GA 2BCVA 1J97A 4M9GA 9ICKA 2K4EA 2KSOB 4CF3A 5JUMA 4Y2QA 5L1MA 4AYBC 4RNNA 3LDAA 2AQ0A 3F5AA 3WKCA 3E0FA 5DLFA 4QZ8A 2HVHA 8ICXA 2ZIVA 3OTQA 5ALMA 2QKQA 1WWUA 3QNMA 4I2FA 1NZPA 5J2IA 2E5SA 3SV3A 2ISPA 2EAMA 5KFMA 2RRDA 1RYUA 1KLNA 9ICRA 2M0NA 4PHPA 4R64A 4ZH4A 3QUTA 2CPRA 3V7JA 4KLHA 4DFDA 2G0AA 5L9XA 4FZLA 3HP6A 1PK1A 4X5VA 2YQEA 1X42A 2FE9A 3MFHA 4PZOA 5DGAA 4MFFA 3HW8A 3JPNA 9ICSA 1TK5A 2ZUBA 3QE9Y 4JUZA 4LVSA 1FFUA 4JB3A 3KFUF 4GC7A 2W03A 2FPMA 3K1ZA 4IRKA 3HRDD 7ICGA 1S9FA 1WCLA 1S0VA 3PV8A 2QB0A 8ICIA 4C4RA 2BQUA 4J03A 4C8NA 3C5FA 3TQ1A 1JMSA 2K8BB 3IG8A 3RAXA 4M2YA 3WK6A 3JPTA 1XC9A 4QWAA 3R9KA 4B9NA 2LPEA 3PW0A 2BCSA 2KEYA 1ZD2P 4BWMA 4DOCA 5AK4A 3Q8PB 3I1YA 1NKCA 5ALWA 4J9MA 1ECWA 4Y2XA 4JV0A 4QZ9A 1N48A 4ED3A 3TFSA 3T5HA 4XUSA 4I28A 2ZIVB 1U48A 2ZTCA 2W9AA 4DLEA 3BQ0A 2YMMA 3WKAA 3F5EA 5ALSA 4I2GA 4M0AA 3AU6A 3FM9A 1SZHA 4YR0A 4F91B 4MFAA 2LMRA 1N63A 2AU0A 2BGWA 4HAIA 4DF4A 4UAZA 4M47A 1QH9A 2H3FA 4R65A 2ALZA 4UASA 4YMNA 4PHEA 2KK0A 2J6UA 2JZBA 3LVWA 4O3NA 3OPXA 3RTVA 3BZKA 3QYPA 2ZJ8A 5AKZA 2W7PA 2HHUA 1PK1B 4PHAA 2YN4A 5KFNA 2KHVA 5CWRA 3AUOA 2KFNA 3KTQA 3M7DA 2YMLA 2IOFA 4F4KA 5AKGA 3ZDDA 3SR6A 2DFLA 1UPHA 4J9OA 2HOFA 2QB0B 2IHMA 2KIVA 5KT6A 1S77D 2AGPA 2G08A 3ICXA 1S5LU 3N7PD 2W9BA 2BCUA 4UB5A 9ICNA 4WJ3B 1TKDA 2ZTEA 1SXDA 2WAQF 3O0FA 3ALRA 4RPYA 1RYSA 3T79A 2K60A 4KX5A 4IQTA 3N7RC 2QLTA 4YQWA 2IA6A 3GIKA 1S10A 1D8BA 2Q4TA 4CF5A 4KLFA 2YTUA 5AK5A 3FDSA 3CYMA 2EZYA 2R8IA 4R8UA 3SENA 3C2MA 5ALPA 2JZBB 2W8LA 3NVYA 5IINA 3RJGA 2Y0SF 5A0LA 1URJA 4EYIB 4QZIA 2P35A 3RFAA 5CA7A 3H0RB 2BDPA 5KFOA 4FE3A 1NJZA 4M9LA 2C2DA 8ICWA 3THVA 3DDHA 4PGQA 1SV0C 1N5XA 3G6YA 5J8YA 4OO1J 1Z4OA 1ZQSA 4KITB 2BR0A 2W9BB 2WAQC 1UQVA 3PY8A 4QWCA 4JV2A 3QZ7A 4PJ0U 1WWVA 4FZMA 4MF2A 2FMSA 4Q8EA 1N62A 4ECSA 2XCAA 3ORYA 1MA7A 3TAQA 2H5XA 4DL7A 2GOLA 3KD3A 4O3PA 4GLXA 3QEBZ 3ONNA 3IN5A 4ECRA 4NLKA 2BKEA 3IV6A 5L1KA 1QSYA 3JPRA 2ZIUA 4ACOA 1FFVA 4R8UB 3NS1A 2Y0SC 4BUGA 1COOA 5EE9A 5AKYA 7ICOA 4IRDA 1F0MA 3N7SC 2QARA 4RQ8A 3EUB2 2W43A 2AH5A 5KG7A 4AP9A 4PGYA 3FYHA 3C28A 5J0QA 4O9MA 2EDUA 2LYAA 2HCFA 2KTQA 2RLTA 1SV0A 2EZXA 2IMWP 1SXEA 1SKSA 3NRZA 3V7KA 2C22A 2QB1A 4JMUA 1U9LA 2JXJA 4P4PA 3GV8B 5JRTA 4F4ZA 4DFJA 4KMOB 2DKXA 1ZQUA 1V38A 1JUDA 4IRCA 3TKAA 2IOHA 3QU2A 3RJHA 4RU9A 5F3XB 4KLIA 2ASDA 3K1RB 3L4PA 4RQ3A 2LKYA 2CRXA 1KL9A 4IL6U 5KFUA 4NL9A 2WHEA 3T3FA 1L3SA 4F5NA 2ZIUB 2HBLA 4LZDA 4QZFA 9ICFA 2JMGA 3L3FX 4PH5A 5J29A 3RH6A 2FPKA 2DF4B 1L7NA 9ICUA 1BNPA 3LYSA 2ES6A 1T8EA 2A3VA 5JU5A 2QARB 2BHNA 1RQLA 2EH9A 4GXIA 2JEGA 1A0PA 2DL0A 7ICVA 2W11A 4F71A 4M9NA 4YG2A 5AM3A 3C21A 1CRXA 1YZ6A 3SAHA 3RJEA 2Z7JA 3OJUA 7ICLA 4NM2A 7ICIA 5AM1A 5KL1B 5TZVA 4RUCA 2UVWA 4BJQA 4DSLA 3QX7A 2ESEA 1UA1A 4NLBA 3MR2A 4DSEA 4UBBA 1T4GA 4RPXA 1KN5A 2AGOA 9ICMA 4FBTA 5KG2A 5L1IA 5ALJA 1S97A 1JIHA 5KFRA 2FPLA 1V9PA 2GWSA 4PL1A 4ECQA 4Y2VA 2BQRA 5J0OA 4U6PA 2Y9TA 3H40A 1CEZA 5DB9A 1ZQCA 4TUQA 4JWMA 1L7MA 2ZG6A 4NLNA 3WK8A 5JTIA 4OJ6A 3C2KA 4ED6A 2W3RA 2XIDA 2FI1A 3OGUA 3C1ZA 4XRHA 3WK4A 2RP5A 5AKHA 1YT3A 1ZQJA 4K4GA 4F5PA 3F2CA 5IIKA 3ED5A 1L8OA 1NKEA 4LZGA 1LVHA 4DFPA 1L8LA 4Y2TA 1SL1A 5EE1A 3TACB 1D9FA 3HWTA 3RF9A 4ED1A 1PUZA 2A1JA 2K8AA 2HW3A 1DRGA 2W8KA 2H3ZA 5DLGA 1OXJA 1ZJNA 2E8PA 4A8EA 3OSPA 2P6RA 5AM2A 2LM4A 1ZQPA 2KICA 2KKVA 5J0RA 5KFDA 1Z19A 4DQPA 4KLDA 3MR3A 4LJXA 1ZQKA 4NJ8A 3KHGA 2KHQA 1JI7A 1TAQA 2WF6A 2DWQA 2VANA 2C2EA 7ICMA 2A1AA 3T5JA 5ALNA 5DBAA 3TANA 3QU5A 5HNKA 3RB4A 1KQQA 5DBCA 3V7LA 4YN4A 2KG5A 2FLLA 5KT5A 1IM4A 2LHTA 4CDGA 2PFOA 1UCVA 4RQ0A 4F72A 1DOQA 5KT3A 3ZDBA 1NKBA 2MU2A 5KG6A 1JRPA 5DDMA 3C29A 1C20A 4Y2YA 4RQ6A 5DKWA 2F1IA 5KG5A 1ZQXA 5KFSA 1B4FA 3PW5A 4UARA 2HHQA 3ZI4A 3KZXA 1PZNA 2DKZA 1EXNA 3BJYA 1ZQAA 4FFDA 5KG1A 3M8SA 4RUAA 2HVIA 2KVSA 1RYRA 4DFMA 1GO3F 4I2AA 5ALXA 2GO7A
chains in the Genus database with same CATH topology
2KVSA 2O6KA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVS A;  2O6K A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 4EBC A;  2A1J B;  3GIM A;  5ALK A;  1TFR A;  3PX6 A;  4IQU A;  3KOO A;  1RQN A;  4RQ2 A;  1U49 A;  8ICL A;  2FMP A;  5KFI A;  4YR3 A;  4DWI A;  5CP2 A;  4KX3 A;  1F5S A;  4NLG A;  3RH5 A;  3PVX A;  3RJF A;  4UB2 A;  3OHA A;  1ARO P;  4O3M A;  1L6N A;  5KG4 A;  1WCN A;  1FIQ A;  3QXG A;  3I28 A;  4RPZ A;  3C2L A;  2HHW A;  3SYZ A;  1MSW D;  1WUD A;  2ISO A;  5EWE A;  2IOF K;  3MGV A;  3IDW A;  4DEZ A;  9ICC A;  4JWN A;  4NLZ A;  2GH1 A;  4CGZ A;  4Q8F A;  5HHI A;  1ZQ1 C;  3GZF A;  2ASL A;  3B0Y A;  3JPO A;  2XCP A;  2OM6 A;  2ODG A;  3F2B A;  2OH2 A;  1MQ2 A;  4QZH A;  4DLG A;  2W7O A;  8ICO A;  5III A;  5KFW A;  3F2D A;  2W54 A;  2VKQ A;  4Y2P A;  1KDH A;  1LV5 A;  5KAI U;  4ED7 A;  4FBU A;  4C7Z A;  2K4P A;  5HHH A;  1WG8 A;  2H3V A;  2KJ8 A;  2KOB A;  2AHO B;  7ICU A;  3RBD A;  4B9T A;  3IG5 A;  2N1R A;  2OEH A;  5C0Y A;  1T94 A;  1ZQI A;  5KFZ A;  1PVP A;  2DQN B;  4B9V A;  3H8W A;  4ED0 A;  2XY5 A;  4K4I A;  3AMZ A;  4J9R A;  2DPJ A;  2K4H A;  3IM1 A;  4GIB A;  1ZRN A;  4CF4 A;  3RRH A;  3PX0 A;  2DPI A;  3EW9 A;  1ZQQ A;  3UXN A;  4UB3 A;  1MN8 A;  2E3T A;  4KLM A;  1V85 A;  3NVW A;  4O5E A;  4Z6F A;  4UAW A;  4NWI A;  2KP7 A;  2NRX A;  1N61 A;  3AN1 A;  5AIC A;  4ELV A;  2C2R A;  5J8Y C;  4DOB A;  3BZC A;  5CEH A;  4O5C A;  2ZJA A;  1Z3E B;  1IV8 A;  4NM1 A;  2VA3 A;  2JH7 A;  4F3O A;  1FEZ A;  4HYK A;  1ZQZ A;  5KFF A;  3H7I A;  4QZA A;  2XGQ A;  5AI5 A;  4MHV A;  1XWL A;  3LWM A;  4ECV A;  3QUQ A;  1HEK A;  2D8C A;  3H4B A;  1HUO A;  4DQR A;  4OJL A;  1Z1V A;  1L3U A;  3RJK A;  2KJ9 A;  4DS5 A;  9ICL A;  1Q46 A;  9ICB A;  1KEJ A;  5KFE A;  5KAF U;  3EYZ A;  3AQE A;  2K89 A;  4TUR A;  5AIB A;  5EWF A;  1XNS A;  3LWL A;  4FS1 A;  1QQ6 A;  3PO4 A;  4IR1 A;  3RH4 A;  9ICA A;  4DF8 A;  5DG8 A;  4NLC A;  2MSN A;  3GQC A;  2DBY A;  1QQ5 A;  4RT2 A;  1Z00 A;  4FZN A;  5ALE A;  3EZ5 A;  2HSZ A;  2HHX A;  3K75 D;  3RR7 A;  2JV3 A;  3UXO A;  2NYV A;  2OWO A;  3NVZ A;  5D4B A;  4ICA A;  4F4X A;  1WYG A;  1VJ5 A;  3MBY A;  4I2B A;  4UQG A;  1K5O A;  1JXE A;  1ZD5 A;  5J2F A;  3HX0 A;  4JV1 A;  1ZQL A;  4B9U A;  4PGX A;  7ICS A;  1A77 A;  2I9G A;  4UB1 A;  7ICK A;  5F9L A;  2BDU A;  2NO4 A;  1HUZ A;  3MDC A;  3PW2 A;  1NK4 A;  5ALH A;  2L5Y A;  5J0T A;  1Z1B A;  4M9J A;  2PKE A;  3CP8 A;  1NJW A;  3JPP A;  2V9W A;  4OJO A;  1J2M A;  1X9M A;  3N28 A;  2OHF A;  3S6J A;  4NL9 C;  8ICR A;  2ZJ5 A;  4C8L A;  5TIS U;  1SGG A;  3K4G A;  5BPC A;  2NRW A;  2JRZ A;  4OJP A;  4YP3 A;  3MFI A;  1ZQT A;  1Q3U A;  3GII A;  4Y2U A;  1TAM A;  3SV4 A;  3M6Z A;  1M6Y A;  4MEX A;  2G5H B;  1Z00 B;  4GFJ A;  4G3I A;  1XSN A;  3PSP A;  2O6K A;  4PZN A;  1JX4 A;  2KD1 A;  4EEN A;  2HI0 A;  4UAY A;  3PML A;  3WU2 U;  4C8M A;  1HIW A;  1Y88 A;  4O5K A;  3AU2 A;  2YY6 A;  1LKY A;  3MDA A;  3PZP A;  2KZM A;  4EX7 A;  1O08 A;  1Q3V A;  3HPO A;  3ZDA A;  1NK0 A;  2BPF A;  1NK7 A;  1BNO A;  4TUS A;  4QJF B;  4UW9 A;  2HHS A;  3WKE A;  4F2R A;  4ECU A;  4ECT A;  3MC1 A;  3M9O B;  4RQN A;  4MFC A;  4Q45 A;  4EX6 A;  4RZR A;  2F3N A;  4XQ8 A;  5DG7 A;  4O3R A;  3GFK B;  2BCQ A;  3NTU A;  5F9N A;  4I2C A;  3PNC A;  1K1Q A;  1ZQF A;  4BXO A;  2PXI A;  2LI6 A;  2YMQ A;  3F53 A;  3RRG A;  2I5H A;  2F1H A;  1X9W A;  4PHD A;  3EWA A;  1X6I A;  3RJI A;  1COK A;  5J2H A;  5AKX A;  4RQ5 A;  1NK8 A;  3D2S A;  5HP4 A;  1KSP A;  5KT4 A;  5KG0 A;  4F50 A;  4OD0 A;  4USA A;  4DCC A;  1ZD3 A;  3H8S A;  2VJ4 A;  3RB0 A;  4B6J A;  2EAP A;  3UQ0 A;  4UB8 U;  5ALR A;  4IS7 A;  3ZDE A;  3MGH A;  5J0S A;  1ZQY A;  4DOA A;  7ICH A;  1KFT A;  4QZG A;  1LKY B;  8ICF A;  2WF8 A;  3H0M B;  2HOQ A;  4ED8 A;  1SV4 A;  4FS2 A;  1H38 A;  9ICV A;  2PMZ F;  2JHD A;  1SIJ A;  5CRX A;  9ICO A;  1JAL A;  1N60 A;  5J2G A;  3Q8M A;  2FJ6 A;  1XO1 A;  2WB1 C;  5CB1 A;  1ZQD A;  1S0O A;  2XC9 A;  2MAX A;  4YVZ A;  2RHF A;  2HBM A;  4Q44 A;  5G5G A;  1ZD4 A;  3PMN A;  2E1F A;  4G9B A;  4YMM A;  2BPC A;  4BXO B;  4TQR A;  2PI5 A;  4UAT A;  3PW4 A;  2VA8 A;  4YCX A;  2P66 A;  1A76 A;  3JPQ A;  4B9S A;  3V72 A;  5CHG A;  8ICM A;  5DQI A;  1B22 A;  2PFP A;  4Y2J A;  4J9K A;  5J2A A;  1RPL A;  3LVV A;  3GIL A;  5J2E A;  4RNM A;  4QZD A;  5FP0 A;  4EZ9 A;  2CN1 A;  3DEE A;  3TAD C;  9ICX A;  1VLB A;  1DK3 A;  2XI9 A;  2W04 A;  1TK0 A;  3QUC A;  9ICW A;  2A19 A;  2EAN A;  2PMZ C;  5EE3 A;  1BPX A;  1L7O A;  5D46 A;  2W55 A;  5KFB A;  4IQV A;  3WK9 A;  2LM1 A;  4J9P A;  2MRL A;  3NVV A;  2R8J A;  3ISB A;  5H2F U;  3A0H U;  8ICQ A;  1V97 A;  4UB4 A;  1D8L A;  9ICJ A;  3DV9 A;  2DGZ A;  2WF7 A;  5J2D A;  1FO4 A;  2KE7 A;  4F5O A;  4GXK A;  1NK6 A;  2W9C A;  1YZ7 A;  4C0Z A;  1L5U A;  1ZRM A;  4YD1 A;  8ICS A;  4RQ7 A;  3SMV A;  5J2C A;  1IIP A;  1ZQB A;  1N56 A;  3EPI A;  1SWW A;  2XGP A;  2H3Q A;  5ALQ A;  7ICP A;  1Z4N A;  1KFD A;  2KVC A;  1ZQH A;  5KFC A;  3CW2 C;  5J2K A;  1QTM A;  3TAR A;  1P7D A;  4E0D A;  9ICT A;  2LYH A;  2JEI A;  2E8O A;  3BDP A;  4M04 A;  4BWJ A;  4J9N A;  1X2I A;  3C1Y A;  2BCR A;  1RDF A;  1KKX A;  2ZUC A;  5KG3 A;  2E8N A;  4I2H A;  1T3N A;  2LBO A;  3V6K A;  3ETR A;  1X66 A;  3TAD A;  4PPX A;  4KN7 A;  4YFK A;  4DQS A;  1B0X A;  3BS7 A;  7ICN A;  1AQ6 A;  5DB6 A;  1L7P A;  3M8R A;  2YMP A;  3SQI A;  2YB1 A;  5KFP A;  4Z6D A;  4YR2 A;  1ZET A;  1ZQO A;  4B9L A;  3SD7 A;  8ICV A;  4NY8 A;  4O3Q A;  4J9L A;  3RAQ A;  2E8M A;  3HJE A;  1ZQW A;  1HJP A;  5J2J A;  3GV7 B;  4R63 A;  4YMO A;  1N2X A;  3B0X A;  1OW5 A;  5ALY A;  2W9C B;  3LK9 A;  3H4D A;  2F8K A;  5AK3 A;  3GDX A;  4I2J A;  5AM4 A;  3VC8 A;  2Y1J A;  4CNQ A;  1ZJM A;  1UT5 A;  3VCB A;  3BQT A;  3N97 B;  4P4M A;  5AKK A;  3OJS A;  4K4H A;  3MGI A;  4UBC A;  2W9M A;  1S0M A;  3JPS A;  3KHL A;  4TUP A;  3PR4 A;  1BPD A;  5KTQ A;  4BGD A;  1SL0 A;  5KFV A;  1ZOL A;  3E2E A;  1NZB A;  3NGD A;  4C8O A;  2F8L A;  5AI8 A;  4QW8 A;  3PW7 A;  4KLJ A;  4RQM A;  2ZUD A;  1KTQ A;  2AQ4 A;  3SZ2 A;  2UVV A;  4XA5 A;  1XO0 A;  2PI4 A;  5C5J A;  1L3V A;  3TAP A;  2ASJ A;  1KW4 A;  3GV5 B;  4ELU A;  1U47 A;  2J6S A;  2D6F C;  1BVS A;  4KLL A;  2MUT A;  2IBK A;  2WFA A;  5KFH A;  1U4B A;  1BPZ A;  5L1J A;  4KLQ A;  1RM6 C;  3UPQ A;  4US8 A;  3OSN A;  3BQ7 A;  5J0P A;  3M9M B;  1LB2 B;  1S0N A;  1MC8 A;  4Y2S A;  1CI4 A;  3D2N A;  3IRU A;  1DGJ A;  3Q8R B;  3UMB A;  2JR5 A;  1TAU A;  3FC4 A;  1SZP A;  5AI6 A;  4ELT A;  5KT7 A;  1X6J A;  3KBB A;  4F8R A;  2RQ5 A;  3FAH A;  4P4O A;  1CUK A;  2R18 A;  5J0W A;  1SWV A;  5E79 U;  2FDR A;  1NJY A;  4B9M A;  1JRO A;  1X9S A;  3WKB A;  1D9D A;  4Q43 A;  4GC6 A;  2HHT A;  2AJQ A;  3HT3 A;  2PFQ A;  5CJ7 A;  1K1S A;  3I76 A;  2KZZ A;  5KFL A;  2K4I A;  4QW9 A;  1XSL A;  3MR6 A;  1KFS A;  4Z6C A;  2ZIX A;  2FLP A;  3KHH A;  3RB3 A;  4MEY A;  3CRX A;  5HML A;  2ZIW A;  2G5I B;  2AXT U;  2KMD A;  2XY6 A;  2AGQ A;  1C7Y A;  2WTF A;  2EZZ A;  7ICQ A;  4RT3 A;  4IQW A;  4YXJ A;  4F92 B;  3H8J A;  1DXS A;  1TV9 A;  4NV0 A;  4DL4 A;  4KTQ A;  8ICN A;  2HBJ A;  2RDJ A;  2MUT B;  1JXL A;  2R8G A;  4KLT A;  2BQ3 A;  5AKI A;  4QZC A;  4DSJ A;  4KN4 A;  1ZQE A;  2HHV A;  9ICQ A;  8ICJ A;  4YD2 A;  2NO5 A;  4QIW F;  3G6X A;  4KLE A;  8ICZ A;  5DB7 A;  3HKZ F;  1PK3 A;  4ECZ A;  4CE6 A;  5AI9 A;  2JEJ A;  3PSI A;  4I2E A;  5AK6 A;  4IR9 A;  9ICG A;  4BDP A;  4ECW A;  3WK7 A;  2KIW A;  3UMG A;  3Q8S B;  3ISC A;  3RR8 A;  2K8C B;  3SI8 A;  2F1J A;  2KNJ A;  5ALL A;  5D49 A;  4DL5 A;  3J81 j;  4EYH B;  4U7C A;  1ZYQ A;  3ETL A;  5GTI U;  5KFK A;  1XS9 D;  7ICT A;  1Q8K A;  4CCH A;  3ISD A;  5HR7 A;  3M9N B;  8ICB A;  3M6K A;  2G07 A;  3KHR A;  4EEK A;  4R66 A;  5AKL A;  1UHU A;  2VJ5 A;  3GIJ A;  5B5E U;  5IIO A;  5AKE A;  1NNL A;  5KFQ A;  2EAO A;  2ZTD A;  1ZQR A;  4YXM A;  1DK2 A;  3KZI U;  4C80 A;  3QUB A;  4F5R A;  2ZIX B;  8ICP A;  2F44 A;  2NV3 A;  5EWG A;  4EEY A;  1DGS A;  2ZIW B;  5K4L A;  7ICE A;  3PX4 A;  2I1Q A;  2KJ5 A;  2WF9 A;  1BPB A;  5AKJ A;  2FMQ A;  4C4T A;  1X9X A;  3A0B U;  2B0C A;  3QEA Z;  3C5G A;  4DS4 A;  3E58 A;  9ICI A;  5J0Y A;  5J0U A;  4KMU A;  4QIW C;  4RQ1 A;  3HKZ C;  5KFG A;  1ED1 A;  5IIL A;  1L3T A;  1BPE A;  1RXW A;  3QU9 A;  5ALU A;  3KKA C;  2BPG A;  1ZXI A;  3IHQ B;  2VIX A;  1QLN A;  3ZD9 A;  4C7Y A;  3SAG A;  5B66 U;  5DQG A;  5KFJ A;  8ICA A;  2G06 A;  5KT2 A;  4GXJ A;  5CR0 A;  4ECY A;  4QWD A;  1A6S A;  7ICF A;  3RB6 A;  3M1Y A;  2Q0Z X;  3WKD A;  8ICY A;  5ALZ A;  5AHX A;  5AM0 A;  2V4R A;  4J9S A;  2NRZ A;  2XO7 A;  1F44 A;  2PFN A;  5HR6 A;  3BQ2 A;  4PL2 A;  1XU4 A;  1SKW A;  5AI4 A;  2EQY A;  2KZ3 A;  5J0X A;  3AM9 A;  2R8K A;  1QCK A;  5DG9 A;  2XVT A;  5ALF A;  1PVQ A;  5BOM A;  2OYY A;  2R8H A;  4KLO A;  2NRV A;  4J9Q A;  4IC9 A;  4QWE A;  2Y1I A;  3Q8K A;  4P0P A;  9ICH A;  5KFT A;  4C4S A;  1MQ3 A;  3BS5 A;  1T7P A;  2HBK A;  3CNH A;  4P2H A;  3WK5 A;  5DGB A;  3RBE A;  2ZXI A;  1D8Y A;  5T14 A;  5ALG A;  5HMM A;  3EPG A;  8ICG A;  4FO6 A;  2W3S A;  3RJJ A;  5EE0 A;  5KNI A;  1NOM A;  4QZE A;  2WB1 F;  1ZQG A;  5KFY A;  2KN7 A;  2G09 A;  3KKA A;  3N4M B;  1B43 A;  3QZ8 A;  1ZQV A;  1NJX A;  1BPY A;  5ALD A;  2KKP A;  4DQI A;  1KRP A;  8ICU A;  1T3Q A;  1NK9 A;  2DUY A;  4P0Q A;  3MR5 A;  8ICT A;  2C28 A;  5KFX A;  2F2A B;  5AIA A;  1X40 A;  1OUQ A;  5GTH U;  3AQF A;  3C23 A;  1S8O A;  9ICE A;  4KLU A;  3TI0 A;  4F2S A;  2OCE A;  2GLE A;  2UVR A;  5BOL A;  1PVR A;  2RDI A;  1NI3 A;  1SL2 A;  2M9N A;  1VDV A;  1NK5 A;  5ALI A;  1UT8 A;  5IIJ A;  2MA1 A;  4DL6 A;  4UAU A;  1ZQM A;  2UVU A;  4F5Q A;  1J2N A;  2CXY A;  3PSF A;  3UM9 A;  3PR5 B;  5AM5 A;  3UQ2 A;  5DB8 A;  3PO5 A;  2J6T A;  7ICJ A;  3TFR A;  3NUQ A;  3UMC A;  4P0P B;  4EBE A;  1SKR A;  2ZXH A;  3BS5 B;  1IG6 A;  3D2Q A;  2OXO A;  2HOI A;  8ICC A;  4OCZ A;  3U26 A;  4I29 A;  2V4Q A;  5AI0 A;  1KBU A;  1RG6 A;  2H3I A;  1TE2 A;  2I6X A;  3IP4 B;  4TQS A;  4F93 B;  2YX8 A;  3NRW A;  4Y2R A;  3Q8Q B;  4DSI A;  4KLS A;  5L1L A;  3AEV A;  4QZB A;  2Y9U A;  4EEL A;  2B21 A;  4NXZ A;  4DO9 A;  1U45 A;  8ICH A;  8ICE A;  3G6V A;  3PST A;  2NRT A;  4UB6 U;  4CRX A;  3ZDC A;  4M6W A;  1ZQN A;  3BQ1 A;  1QSS A;  3OHB A;  4P0Q B;  3T5L A;  4ED2 A;  4QWB A;  1JN3 A;  1IXR A;  5ALT A;  2F77 X;  4OJ5 A;  3QU7 A;  3NAS A;  3MAB A;  3ZD8 A;  5J2B A;  4MF8 A;  4O3S A;  2JEF A;  1BGX T;  8ICK A;  3V6J A;  4EBD A;  5EOZ A;  1S76 D;  2KSO A;  2E1E A;  3L5K A;  4O3O A;  4F4W A;  5DDY A;  3GU3 A;  4UAV A;  2FLN A;  1RXV A;  1TK8 A;  4ZOH C;  2KV2 A;  2YB4 A;  5G5H A;  3V6H A;  4EZ6 A;  5DQH A;  4AYB F;  4I2D A;  3HIL A;  4RNO A;  5KL8 B;  1TVA A;  1QQ7 A;  1RZT A;  4O0I A;  1N5W A;  1O03 A;  2XY7 A;  4DFK A;  3D6J A;  4DL3 A;  4DSK A;  4F4Y A;  2LYB A;  3H0L B;  4US9 A;  3H8M A;  2KFZ A;  2BZF A;  4KLG A;  2JGA A;  4Z6E A;  5KFA A;  2HDO A;  4I27 A;  2F76 X;  3B9J A;  2HMX A;  1SB3 C;  5ALO A;  5IIM A;  2D3D A;  7ICR A;  4C8K A;  3AL0 B;  2JH1 A;  3QU4 A;  2P6U A;  4RQ4 A;  1QSL A;  3T5K A;  4M6W B;  3SAF A;  4DQQ A;  5DBB A;  2VA2 A;  5ALV A;  3Q8L A;  1XSP A;  1UA0 A;  4QNL A;  4BX9 C;  4ECX A;  3SEI A;  4DL2 A;  4I2I A;  2ATL A;  2WF5 A;  4M9H A;  4DSF A;  4JK1 A;  2XIC A;  9ICP A;  2IHN A;  3UXP A;  2B6G A;  2BCV A;  1J97 A;  4M9G A;  9ICK A;  2K4E A;  2KSO B;  4CF3 A;  5JUM A;  4Y2Q A;  5L1M A;  4AYB C;  4RNN A;  3LDA A;  2AQ0 A;  3F5A A;  3WKC A;  3E0F A;  5DLF A;  4QZ8 A;  2HVH A;  8ICX A;  2ZIV A;  3OTQ A;  5ALM A;  2QKQ A;  1WWU A;  3QNM A;  4I2F A;  1NZP A;  5J2I A;  2E5S A;  3SV3 A;  2ISP A;  2EAM A;  5KFM A;  2RRD A;  1RYU A;  1KLN A;  9ICR A;  2M0N A;  4PHP A;  4R64 A;  4ZH4 A;  3QUT A;  2CPR A;  3V7J A;  4KLH A;  4DFD A;  2G0A A;  5L9X A;  4FZL A;  3HP6 A;  1PK1 A;  4X5V A;  2YQE A;  1X42 A;  2FE9 A;  3MFH A;  4PZO A;  5DGA A;  4MFF A;  3HW8 A;  3JPN A;  9ICS A;  1TK5 A;  2ZUB A;  3QE9 Y;  4JUZ A;  4LVS A;  1FFU A;  4JB3 A;  3KFU F;  4GC7 A;  2W03 A;  2FPM A;  3K1Z A;  4IRK A;  3HRD D;  7ICG A;  1S9F A;  1WCL A;  1S0V A;  3PV8 A;  2QB0 A;  8ICI A;  4C4R A;  2BQU A;  4J03 A;  4C8N A;  3C5F A;  3TQ1 A;  1JMS A;  2K8B B;  3IG8 A;  3RAX A;  4M2Y A;  3WK6 A;  3JPT A;  1XC9 A;  4QWA A;  3R9K A;  4B9N A;  2LPE A;  3PW0 A;  2BCS A;  2KEY A;  1ZD2 P;  4BWM A;  4DOC A;  5AK4 A;  3Q8P B;  3I1Y A;  1NKC A;  5ALW A;  4J9M A;  1ECW A;  4Y2X A;  4JV0 A;  4QZ9 A;  1N48 A;  4ED3 A;  3TFS A;  3T5H A;  4XUS A;  4I28 A;  2ZIV B;  1U48 A;  2ZTC A;  2W9A A;  4DLE A;  3BQ0 A;  2YMM A;  3WKA A;  3F5E A;  5ALS A;  4I2G A;  4M0A A;  3AU6 A;  3FM9 A;  1SZH A;  4YR0 A;  4F91 B;  4MFA A;  2LMR A;  1N63 A;  2AU0 A;  2BGW A;  4HAI A;  4DF4 A;  4UAZ A;  4M47 A;  1QH9 A;  2H3F A;  4R65 A;  2ALZ A;  4UAS A;  4YMN A;  4PHE A;  2KK0 A;  2J6U A;  2JZB A;  3LVW A;  4O3N A;  3OPX A;  3RTV A;  3BZK A;  3QYP A;  2ZJ8 A;  5AKZ A;  2W7P A;  2HHU A;  1PK1 B;  4PHA A;  2YN4 A;  5KFN A;  2KHV A;  5CWR A;  3AUO A;  2KFN A;  3KTQ A;  3M7D A;  2YML A;  2IOF A;  4F4K A;  5AKG A;  3ZDD A;  3SR6 A;  2DFL A;  1UPH A;  4J9O A;  2HOF A;  2QB0 B;  2IHM A;  2KIV A;  5KT6 A;  1S77 D;  2AGP A;  2G08 A;  3ICX A;  1S5L U;  3N7P D;  2W9B A;  2BCU A;  4UB5 A;  9ICN A;  4WJ3 B;  1TKD A;  2ZTE A;  1SXD A;  2WAQ F;  3O0F A;  3ALR A;  4RPY A;  1RYS A;  3T79 A;  2K60 A;  4KX5 A;  4IQT A;  3N7R C;  2QLT A;  4YQW A;  2IA6 A;  3GIK A;  1S10 A;  1D8B A;  2Q4T A;  4CF5 A;  4KLF A;  2YTU A;  5AK5 A;  3FDS A;  3CYM A;  2EZY A;  2R8I A;  4R8U A;  3SEN A;  3C2M A;  5ALP A;  2JZB B;  2W8L A;  3NVY A;  5IIN A;  3RJG A;  2Y0S F;  5A0L A;  1URJ A;  4EYI B;  4QZI A;  2P35 A;  3RFA A;  5CA7 A;  3H0R B;  2BDP A;  5KFO A;  4FE3 A;  1NJZ A;  4M9L A;  2C2D A;  8ICW A;  3THV A;  3DDH A;  4PGQ A;  1SV0 C;  1N5X A;  3G6Y A;  5J8Y A;  4OO1 J;  1Z4O A;  1ZQS A;  4KIT B;  2BR0 A;  2W9B B;  2WAQ C;  1UQV A;  3PY8 A;  4QWC A;  4JV2 A;  3QZ7 A;  4PJ0 U;  1WWV A;  4FZM A;  4MF2 A;  2FMS A;  4Q8E A;  1N62 A;  4ECS A;  2XCA A;  3ORY A;  1MA7 A;  3TAQ A;  2H5X A;  4DL7 A;  2GOL A;  3KD3 A;  4O3P A;  4GLX A;  3QEB Z;  3ONN A;  3IN5 A;  4ECR A;  4NLK A;  2BKE A;  3IV6 A;  5L1K A;  1QSY A;  3JPR A;  2ZIU A;  4ACO A;  1FFV A;  4R8U B;  3NS1 A;  2Y0S C;  4BUG A;  1COO A;  5EE9 A;  5AKY A;  7ICO A;  4IRD A;  1F0M A;  3N7S C;  2QAR A;  4RQ8 A;  3EUB 2;  2W43 A;  2AH5 A;  5KG7 A;  4AP9 A;  4PGY A;  3FYH A;  3C28 A;  5J0Q A;  4O9M A;  2EDU A;  2LYA A;  2HCF A;  2KTQ A;  2RLT A;  1SV0 A;  2EZX A;  2IMW P;  1SXE A;  1SKS A;  3NRZ A;  3V7K A;  2C22 A;  2QB1 A;  4JMU A;  1U9L A;  2JXJ A;  4P4P A;  3GV8 B;  5JRT A;  4F4Z A;  4DFJ A;  4KMO B;  2DKX A;  1ZQU A;  1V38 A;  1JUD A;  4IRC A;  3TKA A;  2IOH A;  3QU2 A;  3RJH A;  4RU9 A;  5F3X B;  4KLI A;  2ASD A;  3K1R B;  3L4P A;  4RQ3 A;  2LKY A;  2CRX A;  1KL9 A;  4IL6 U;  5KFU A;  4NL9 A;  2WHE A;  3T3F A;  1L3S A;  4F5N A;  2ZIU B;  2HBL A;  4LZD A;  4QZF A;  9ICF A;  2JMG A;  3L3F X;  4PH5 A;  5J29 A;  3RH6 A;  2FPK A;  2DF4 B;  1L7N A;  9ICU A;  1BNP A;  3LYS A;  2ES6 A;  1T8E A;  2A3V A;  5JU5 A;  2QAR B;  2BHN A;  1RQL A;  2EH9 A;  4GXI A;  2JEG A;  1A0P A;  2DL0 A;  7ICV A;  2W11 A;  4F71 A;  4M9N A;  4YG2 A;  5AM3 A;  3C21 A;  1CRX A;  1YZ6 A;  3SAH A;  3RJE A;  2Z7J A;  3OJU A;  7ICL A;  4NM2 A;  7ICI A;  5AM1 A;  5KL1 B;  5TZV A;  4RUC A;  2UVW A;  4BJQ A;  4DSL A;  3QX7 A;  2ESE A;  1UA1 A;  4NLB A;  3MR2 A;  4DSE A;  4UBB A;  1T4G A;  4RPX A;  1KN5 A;  2AGO A;  9ICM A;  4FBT A;  5KG2 A;  5L1I A;  5ALJ A;  1S97 A;  1JIH A;  5KFR A;  2FPL A;  1V9P A;  2GWS A;  4PL1 A;  4ECQ A;  4Y2V A;  2BQR A;  5J0O A;  4U6P A;  2Y9T A;  3H40 A;  1CEZ A;  5DB9 A;  1ZQC A;  4TUQ A;  4JWM A;  1L7M A;  2ZG6 A;  4NLN A;  3WK8 A;  5JTI A;  4OJ6 A;  3C2K A;  4ED6 A;  2W3R A;  2XID A;  2FI1 A;  3OGU A;  3C1Z A;  4XRH A;  3WK4 A;  2RP5 A;  5AKH A;  1YT3 A;  1ZQJ A;  4K4G A;  4F5P A;  3F2C A;  5IIK A;  3ED5 A;  1L8O A;  1NKE A;  4LZG A;  1LVH A;  4DFP A;  1L8L A;  4Y2T A;  1SL1 A;  5EE1 A;  3TAC B;  1D9F A;  3HWT A;  3RF9 A;  4ED1 A;  1PUZ A;  2A1J A;  2K8A A;  2HW3 A;  1DRG A;  2W8K A;  2H3Z A;  5DLG A;  1OXJ A;  1ZJN A;  2E8P A;  4A8E A;  3OSP A;  2P6R A;  5AM2 A;  2LM4 A;  1ZQP A;  2KIC A;  2KKV A;  5J0R A;  5KFD A;  1Z19 A;  4DQP A;  4KLD A;  3MR3 A;  4LJX A;  1ZQK A;  4NJ8 A;  3KHG A;  2KHQ A;  1JI7 A;  1TAQ A;  2WF6 A;  2DWQ A;  2VAN A;  2C2E A;  7ICM A;  2A1A A;  3T5J A;  5ALN A;  5DBA A;  3TAN A;  3QU5 A;  5HNK A;  3RB4 A;  1KQQ A;  5DBC A;  3V7L A;  4YN4 A;  2KG5 A;  2FLL A;  5KT5 A;  1IM4 A;  2LHT A;  4CDG A;  2PFO A;  1UCV A;  4RQ0 A;  4F72 A;  1DOQ A;  5KT3 A;  3ZDB A;  1NKB A;  2MU2 A;  5KG6 A;  1JRP A;  5DDM A;  3C29 A;  1C20 A;  4Y2Y A;  4RQ6 A;  5DKW A;  2F1I A;  5KG5 A;  1ZQX A;  5KFS A;  1B4F A;  3PW5 A;  4UAR A;  2HHQ A;  3ZI4 A;  3KZX A;  1PZN A;  2DKZ A;  1EXN A;  3BJY A;  1ZQA A;  4FFD A;  5KG1 A;  3M8S A;  4RUA A;  2HVI A;  2KVS A;  1RYR A;  4DFM A;  1GO3 F;  4I2A A;  5ALX A;  2GO7 A; 
#chains in the Genus database with same CATH homology
 2KVS A;  2O6K A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...