2KVSA

Nmr solution structure of q7a1e8 protein from staphylococcus aureus: northeast structural genomics consortium target: zr215
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
MAGDPMTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMANLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of Q7A1E8 protein from Staphylococcus aureus: Northeast Structural Genomics Consortium target: ZR215
rcsb
source organism Staphylococcus aureus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein MW0776
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2kvsA00
2KVSA 2O6KA 2FJ6A
chains in the Genus database with same CATH superfamily
4RQ2A 4KTQA 5AK5A 1XU4A 3QU4A 5KAFU 2WTFA 2OM6A 3WK6A 5KFIA 3H0LB 1C20A 1V97A 4PHPA 1ZQEA 2ZIXB 4EEYA 3ED5A 5ALWA 5DG9A 3S6JA 3TADC 2C2DA 3QUBA 4G3IA 1QQ6A 9ICEA 2KG5A 1IG6A 4UB3A 3AU2A 2ZTDA 2DUYA 2C2RA 4EZ6A 2AHOB 2YMPA 5EE0A 5DQGA 1S8OA 3LWLA 5KT4A 7ICPA 2KFZA 4UB6U 2ZUBA 1MN8A 5AM4A 1UQVA 1NJZA 9ICRA 9ICOA 2J6UA 4ECUA 4C0ZA 3RF9A 5E79U 2LKYA 3C29A 3L3FX 1ECWA 3MR6A 2K4IA 4DFDA 3SYZA 2E8NA 1N5WA 1OW5A 4P0PA 4DQIA 4M47A 1NZBA 3GIJA 2I5HA 4PZOA 1UHUA 3OSPA 1A6SA 3UMCA 2UVRA 4UW9A 1FO4A 2ASLA 1NK6A 1KRPA 2HHTA 5ALJA 3HW8A 1V85A 1L6NA 4CCHA 1EXNA 1GO3F 1PK3A 2K89A 4UB4A 3ICXA 3IN5A 4USAA 1U48A 5KG4A 5DQIA 4YXMA 3M8RA 4IRCA 3Q8LA 3ETRA 5KL8B 4PGQA 3H0RB 4RT2A 1TAQA 4NJ8A 5KT6A 3FYHA 2J6TA 3D6JA 5DDMA 1F44A 4OJ6A 2AJQA 1NNLA 2W9CB 2VA3A 4M2YA 2KE7A 2XIDA 2VA2A 2HBMA 2KVCA 3GU3A 2IMWP 5CJ7A 3IHQB 2W9CA 1K5OA 3EWAA 4M9LA 3TARA 1KKXA 4QZ9A 4C8LA 4OO1J 1NI3A 3E2EA 4DF8A 5L1JA 4EX7A 2YMQA 5J0RA 4F5PA 1IM4A 8ICWA 1X66A 5AICA 1IV8A 8ICSA 3DV9A 2ZUDA 4RQ5A 1IIPA 4UBCA 2JZBA 1O08A 1ZQNA 2R8JA 5ALMA 1ZQXA 1ZQSA 3C2MA 1DK3A 2GH1A 5DLGA 4NLZA 2KSOB 4O0IA 9ICAA 4QW8A 3WK9A 3F2DA 3PSFA 1DGSA 2NRXA 5C5JA 2V9WA 2W8KA 3BZKA 5EWFA 1T8EA 4RQ3A 2KD1A 3MR3A 4R8UA 1PZNA 8ICJA 3JPRA 4YMOA 2JH1A 2BQUA 2NRZA 3PX6A 3K1RB 8ICHA 1KFSA 2R18A 5CB1A 4B6JA 4NM2A 5CR0A 9ICQA 5D46A 2PXIA 1D9DA 5ALOA 2KSOA 3NS1A 3AUOA 2NRTA 4R65A 3RTVA 2MSNA 1SWVA 1WCNA 5HHHA 4RUCA 3ZD8A 3RB6A 3PMLA 1C7YA 5KFOA 5J2EA 3SAGA 2IOFK 1YT3A 5ALPA 3JPPA 1PVPA 3GIMA 1NZPA 8ICXA 4QWEA 4OJPA 3T5KA 1RZTA 1FFVA 2Y0SC 3NGDA 4QZHA 4PGXA 3A0BU 5DB8A 3PW7A 5KFTA 2ISOA 4GIBA 2WFAA 1U49A 1ZJMA 3F5EA 2DBYA 3GV5B 4OJ5A 3GQCA 4Q43A 2K8BB 2VANA 1SKRA 4M0AA 4KN7A 3BZCA 4QNLA 4ECTA 4KLIA 4Y2QA 3JPTA 4RQ7A 2HW3A 4M9NA 1N60A 3FM9A 8ICKA 9ICCA 1NK5A 4JV1A 5L1KA 8ICQA 1RQLA 3QU5A 3H8JA 4ELUA 4CF3A 1DK2A 7ICQA 4PJ0U 4DSIA 3QUCA 2LPEA 1RM6C 5J2JA 1UT8A 4UB1A 5KT5A 4E0DA 4O3OA 1ZQTA 5KFGA 4M9JA 4QIWC 3RJGA 3NVZA 2FI1A 4B9VA 2W3RA 2H3FA 1RQNA 4CGZA 5ALEA 2XC9A 4DLEA 8ICTA 2K4EA 2W9MA 4J9MA 5AI0A 4UBBA 1JI7A 1N48A 1WWVA 2FPLA 1SKWA 4JMUA 3AQFA 5ALDA 2KJ5A 2W9BB 1OUQA 3HILA 4F8RA 3SV3A 5AIBA 1PVRA 2KJ9A 2QARA 4YQWA 1ZQRA 2LYBA 8ICAA 5KFVA 3Q8KA 2OWOA 4O3MA 1MSWD 2QB1A 2ZIXA 3C5GA 9ICSA 3UMGA 3IV6A 4HAIA 3RB4A 3V6KA 5ALSA 1COOA 5KFXA 2W03A 4UB5A 3RR8A 4RQ1A 2ZIUB 4F5RA 4Z6CA 4DSFA 2KHQA 4F93B 4ED7A 3I76A 9ICWA 2HSZA 2KEYA 3B0YA 4I2JA 4P2HA 5KFSA 3FAHA 1QSYA 3EYZA 2ZTEA 4P4PA 4C8KA 5J2GA 2NO5A 4ICAA 5EOZA 2LYHA 2BPFA 3NUQA 4KLMA 4J9NA 4RQ4A 4QZGA 3F5AA 4RZRA 4FZMA 5KNIA 5HHIA 5ALYA 2PI4A 5EE1A 3O0FA 7ICIA 1H38A 5KFLA 2IA6A 4DWIA 5J8YC 8ICMA 1PK1B 1S9FA 2H3QA 3T5LA 1SB3C 1ZQOA 2BDPA 1S97A 3ISBA 2HOIA 5ALIA 1MC8A 4Y2TA 3RFAA 3RJHA 4RPXA 4P0QA 4F5QA 3HKZC 1PVQA 2C28A 7ICRA 5L1MA 2HHVA 4F3OA 3SENA 3SR6A 4J9LA 1S10A 4ECSA 2AQ0A 4KX5A 7ICLA 3SZ2A 4BJQA 1D8YA 3OTQA 3Q8QB 1D9FA 1Q3VA 1T3NA 2WAQF 3TAPA 1SL1A 1S77D 3VCBA 3J81j 2QB0A 1V9PA 3BS5A 3TQ1A 8ICZA 3DDHA 2VJ5A 4GXJA 5BOLA 4DQRA 5KFRA 4F4XA 3QX7A 5ALZA 5L9XA 2HVHA 3ZDBA 3TFRA 4UB2A 2BDUA 4PPXA 1ZQCA 4RUAA 2V4RA 4PGYA 3H4DA 1QQ7A 2KN7A 4I2IA 4XUSA 3T5JA 2HHQA 2LM1A 1YZ6A 1TKDA 5BOMA 3ZDDA 4PZNA 1KFDA 9ICKA 4RNMA 4AYBF 4HYKA 4QZFA 2K60A 2XVTA 2W43A 3AL0B 2Y0SF 4X5VA 2GOLA 2MU2A 1CUKA 3IG5A 1Z1BA 4QWDA 1XWLA 2K8CB 4QZEA 4FZLA 1U45A 1MQ2A 2FLNA 9ICHA 4FO6A 2KOBA 1F5SA 5F9LA 2DPJA 1ZYQA 4Y2UA 2XCPA 2IBKA 3RBEA 1QQ5A 3ZDAA 3PVXA 2RP5A 8ICEA 2O6KA 5KFDA 4I28A 4OD0A 1J2NA 2ZIWA 5F9NA 4KLOA 2ESEA 3GFKB 2MRLA 1KN5A 3PMNA 9ICGA 1L3VA 4NL9C 3I28A 5KFNA 2DWQA 4RT3A 3BS7A 1P7DA 1U47A 4TQRA 2NV3A 1LB2B 2HOQA 4ED2A 3MC1A 4M9HA 3UXPA 5AM5A 4Q8FA 5KT7A 2Y9TA 9ICJA 5AK3A 2I6XA 4DLGA 3TADA 2PFPA 1ZQDA 2BCSA 5KG2A 2XY7A 4F91B 5H2FU 2OXOA 3MDAA 1NK9A 3M9OB 3F2CA 2JHDA 5FP0A 9ICMA 1PK1A 4DF4A 1S0VA 2ASJA 5EE3A 1A0PA 1ZQ1C 5AKLA 4NLNA 3Q8RB 3I1YA 2P6UA 2XICA 3H7IA 3AU6A 1TAMA 5KT3A 5KL1B 1BVSA 1SL2A 2NYVA 2P35A 5CEHA 3HX0A 2NRWA 3A0HU 3SAHA 3HPOA 2JEIA 1JMSA 3KD3A 3R9KA 2A1JB 4TURA 4NLCA 2RDIA 5ALUA 4UASA 1T4GA 1MA7A 1NKBA 5AKYA 3BQ7A 2JRZA 2KMDA 3AM9A 1NJYA 3GILA 2KIVA 5B5EU 1B43A 2PFQA 3C5FA 3M1YA 3N7RC 2N1RA 2ZIUA 5KG0A 2YX8A 2YB1A 1SWWA 5AIAA 4O3NA 4PHAA 2AH5A 2JXJA 2QKQA 4K4HA 2D6FC 4DO9A 3KHHA 3QUTA 1UT5A 1CEZA 2BGWA 3LYSA 2C2EA 4ED8A 2JR5A 3N7PD 1U9LA 1ZJNA 4MHVA 4KLFA 3V7JA 5DDYA 3QEAZ 4DOAA 4UQGA 4Y2JA 1X40A 7ICKA 2XGPA 2EZXA 3IM1A 3MFHA 4QW9A 4GXKA 2PI5A 4MEXA 3QZ7A 1L7PA 4F71A 4EYHB 2JMGA 5J0YA 4UAWA 3QZ8A 3T79A 5CRXA 8ICGA 2F8KA 1SV4A 3AMZA 3E58A 4I29A 2FLLA 2Y1JA 3UMBA 4YR2A 2FJ6A 2E1FA 3KBBA 3PX4A 2HVIA 3NVYA 1ZQUA 1MQ3A 2LBOA 8ICFA 4IC9A 3LK9A 4I2EA 4MFAA 4KLJA 1ZD5A 4DSEA 4YN4A 5J2KA 2AGOA 8ICRA 3MABA 2BQ3A 2G5HB 3RH4A 4DQSA 5AKEA 1SIJA 1Z4OA 3MGHA 1QLNA 4O3SA 1NK7A 7ICGA 5JRTA 1BNOA 3HWTA 5DQHA 4YFKA 2HHSA 4ECQA 1QSLA 4C7YA 5ALHA 1NK0A 3WU2U 4G9BA 1B0XA 2BQRA 1SXDA 3D2SA 5DBBA 3QU7A 2F1IA 4OJLA 1QCKA 1ZRMA 5DGBA 5AM0A 4ELTA 5KG7A 4ELVA 4QZCA 7ICEA 4FS1A 3GIKA 2AGPA 2PMZC 5KG3A 2PMZF 4LZDA 2NO4A 3QNMA 3PR4A 5AKHA 3RR7A 2WAQC 3SMVA 1UPHA 1ZQGA 5CP2A 2ZXHA 4Y2VA 2I1QA 5AM3A 4RU9A 1CI4A 2G0AA 2BHNA 3V7KA 3E0FA 2KKPA 2YN4A 2UVVA 2LMRA 2UVUA 3L4PA 1CRXA 4DL5A 8ICIA 5D4BA 2ZTCA 4KN4A 4CF5A 2DGZA 3GV7B 4TUPA 3DEEA 3WKDA 2VIXA 4R8UB 1ZETA 4DOCA 3PO4A 1XSLA 4DFKA 5J2IA 3EW9A 1L7NA 3T5HA 4RPYA 1XC9A 4Q8EA 4C8OA 4F92B 5J2FA 3BQTA 2F44A 4ECXA 3K1ZA 2AQ4A 8ICNA 3CW2C 3AQEA 3RH6A 2KFNA 1Q8KA 3N28A 2F3NA 2KJ8A 1BPDA 4BUGA 1N2XA 1O03A 5KFQA 1QTMA 2OCEA 4MFCA 4KMUA 1RXWA 5DB9A 1N61A 3SEIA 2JZBB 2MAXA 2ODGA 4J9QA 4P4OA 3B9JA 3PSTA 1K1SA 3QU2A 3G6VA 1VDVA 1UCVA 1NK4A 3OGUA 3V6JA 4KLSA 2AGQA 4RNNA 3PR5B 3TFSA 5ALVA 1RYSA 1QH9A 3H0MB 4J9OA 1DRGA 2GLEA 3HKZF 2XCAA 2LM4A 2YQEA 4C4TA 1L3SA 2PKEA 4GLXA 2GWSA 4Z6EA 5KTQA 3MGVA 2RHFA 2HBLA 3QE9Y 4CF4A 4CNQA 4WJ3B 1WCLA 2JH7A 1DGJA 4NL9A 4RNOA 1Q3UA 2JGAA 2BKEA 3KFUF 4QZDA 1YZ7A 2MUTA 5C0YA 7ICUA 3SD7A 3C1YA 3UPQA 2XY6A 1ZQZA 4YG2A 2RDJA 3RAXA 1COKA 4DS4A 1XNSA 4IRDA 5J2DA 2YTUA 4OCZA 5ALGA 5KFUA 4B9LA 2DFLA 4Y2PA 3MGIA 2OHFA 2KP7A 3C2KA 5BPCA 1K1QA 4IQWA 1RDFA 3NASA 4Y2XA 1TK5A 5J0TA 3BQ2A 3RB3A 5KFYA 7ICTA 3MR5A 5DLFA 4DFMA 4I2HA 3PW4A 9ICLA 1X9SA 2WB1C 2EAMA 4DSLA 4F2RA 5AKXA 1ZQIA 8ICBA 4KLDA 1QSSA 2B0CA 2DKZA 4DL2A 4KLEA 3NRZA 5J0UA 1UA0A 1L5UA 4ECYA 1SV0A 2DKXA 1D8LA 4XQ8A 2QARB 4RQ0A 4MF2A 2ALZA 3WKCA 1RXVA 1JALA 3NRWA 9ICTA 3CNHA 4QJFB 4I2AA 2ZJ5A 2DPIA 3FC4A 2FPKA 2OH2A 4DCCA 4FBTA 4R64A 4YMMA 5AI8A 3LWMA 2HMXA 3KOOA 2Y1IA 5ALRA 2HHXA 8ICCA 1ZQWA 1L3TA 3RRHA 2E3TA 3V72A 4XRHA 5HNKA 2P66A 9ICUA 4P4MA 1LV5A 4F2SA 2WF7A 2G08A 4TUQA 4MF8A 5KFFA 2BR0A 1ZQBA 4UAZA 3F2BA 4QWAA 2R8GA 2G07A 5KFHA 1U4BA 2ES6A 4FFDA 4Z6DA 5A0LA 3OJUA 2H3VA 3HT3A 1LKYA 3D2NA 5J0QA 5KFEA 4PL1A 2ZJAA 1T3QA 4ECRA 3M9MB 2YMMA 3IRUA 4FZNA 4DEZA 2ZXIA 2W55A 3C2LA 3ALRA 4KITB 1RG6A 2MA1A 4KMOB 4O3PA 4F5NA 2ZJ8A 5KFWA 3G6XA 4M04A 3CYMA 2WF8A 3PSIA 5IINA 3UM9A 2LI6A 5HMLA 4C8MA 5KFBA 1Z00A 1L8OA 5B66U 4QWBA 5EWGA 4DQQA 2ASDA 4JV2A 4JUZA 2IOFA 4EBEA 1XSNA 1HUZA 4YXJA 1SZPA 2W04A 4FS2A 2Z7JA 4EX6A 4I2BA 1N56A 4IQUA 5J2HA 4ACOA 1TV9A 2EZYA 8ICVA 5KFKA 4OJOA 4PHDA 5DG7A 3JPNA 3KHRA 4U7CA 3UQ0A 4ED1A 1NKEA 4TUSA 4UARA 5J0SA 1S76D 7ICFA 4AP9A 3M8SA 4DL7A 2YMLA 3C21A 1ZD2P 5IIKA 4JV0A 5KFCA 1XS9D 2H3ZA 4F72A 1X2IA 1J2MA 1KLNA 4ED0A 2EAOA 4YP3A 1V38A 4J03A 4DSJA 3JPOA 3EPGA 5IIJA 4CE6A 4A8EA 4JWNA 3JPSA 3H40A 1S5LU 2AU0A 1BPEA 2RRDA 2D3DA 3V6HA 3QYPA 4YVZA 2DL0A 2C22A 2PFNA 5IIIA 3V7LA 5IIMA 1XO1A 4I27A 1WWUA 9ICXA 9ICBA 2BCQA 2F1JA 2ATLA 2W3SA 4J9SA 4KLTA 3OSNA 4RQNA 2HHUA 4IS7A 4US9A 9ICPA 5HR7A 4DL4A 1KQQA 1ZD4A 2W9AA 3T3FA 4GC7A 1N5XA 5KG6A 4AYBC 2EH9A 2BCRA 4QZIA 3NTUA 2XO7A 4B9NA 1ZD3A 4BGDA 3PW2A 4C4RA 2B21A 2MUTB 4IQTA 5KFZA 4K4GA 2A1AA 5ALQA 4QZ8A 1JXEA 2Q0ZX 3RAQA 3IDWA 9ICNA 2R8HA 4K4IA 3PY8A 3THVA 2LHTA 2M0NA 1ZQJA 4U6PA 4UAYA 2FMSA 3H8MA 3WKEA 2W8LA 5KAIU 1ED1A 3BJYA 1Q46A 5KFPA 4ZOHC 3JPQA 2J6SA 4NV0A 4F4WA 3KZIU 4YD1A 2W7OA 2E5SA 4QIWF 3C1ZA 1NJXA 3PW0A 4F4YA 2FMQA 4M6WA 1N63A 3ZDEA 2ZIVB 1ZQMA 4CDGA 4EBCA 3C28A 2W11A 4Y2SA 4ECZA 3HP6A 5AKZA 1TE2A 2F1HA 3H8WA 5J0XA 4P0PB 3PO5A 5T14A 2KTQA 3M6KA 5G5HA 3UXNA 4TQSA 2CXYA 1JUDA 4EELA 1Z1VA 2EAPA 3ZI4A 4XA5A 4KLGA 3UXOA 2G09A 2K8AA 4UATA 4C7ZA 3GIIA 4KLLA 2WF9A 1SL0A 1ZQHA 1D8BA 3ZDCA 7ICMA 1HJPA 4LJXA 4RQMA 3BDPA 4RQ6A 1ZOLA 3RB0A 4PHEA 5AK4A 3PV8A 3KHLA 1KBUA 2F2AB 5AM2A 2H3IA 3TKAA 3G6YA 4JWMA 2H5XA 4RPZA 4QWCA 1OXJA 4YR3A 8ICOA 1PUZA 2RQ5A 1UA1A 5HP4A 5CA7A 3NVVA 5DB7A 3QEBZ 4YR0A 3LVWA 1KL9A 4LZGA 3QUQA 3SAFA 5D49A 4ED3A 4NLGA 1SKSA 4Q44A 1LVHA 1AROP 1HIWA 4BWJA 3QXGA 5KG1A 3LDAA 1NK8A 3H8SA 3MBYA 2NRVA 3NVWA 1JIHA 2KVSA 2WF5A 5DB6A 5DKWA 4RQ8A 2HBKA 3GDXA 4ZH4A 5AKIA 1BGXT 4BWMA 1FEZA 5AI9A 1JXLA 2A1JA 2R8IA 2F76X 2HBJA 3KZXA 4O5KA 3PX0A 1N62A 2YY6A 2G06A 2D8CA 3K75D 1BPXA 2L5YA 1NOMA 2HI0A 5CWRA 2GO7A 5KT2A 2ZUCA 3OHAA 1JRPA 2FLPA 4KLUA 1ZQFA 2XGQA 3L5KA 4B9MA 7ICJA 4F5OA 7ICVA 1SV0C 1WG8A 1KW4A 1B22A 4BXOB 3GZFA 4O5CA 4CRXA 1HEKA 5AHXA 3MDCA 3KHGA 1NKCA 4KLQA 2QLTA 4YCXA 2ZG6A 4BXOA 4O5EA 2K4HA 5ALXA 4YD2A 1ZQQA 2R8KA 5J29A 3KKAC 2KZMA 9ICFA 3WKBA 3AEVA 4QZAA 3KTQA 1IXRA 4UAUA 4C4SA 4IL6U 1BPBA 5AM1A 5JTIA 5L1IA 2JEJA 2ISPA 4J9KA 4B9TA 3M6ZA 7ICSA 5GTIU 2PFOA 3M9NB 5G5GA 1BPZA 3VC8A 2W7PA 4DL3A 3HRDD 4B9SA 2E8PA 9ICVA 1AQ6A 2KNJA 2KIWA 1RYUA 1L7MA 4Z6FA 4ECVA 1BNPA 3SQIA 5AKGA 1Z3EB 5ALLA 2KICA 4YMNA 5IIOA 5F3XB 2A3VA 3D2QA 5AKJA 3MR2A 2KKVA 3SI8A 5TISU 4ECWA 5HR6A 1ZQAA 2WF6A 1SGGA 1KTQA 2CPRA 2EANA 3ETLA 1JX4A 4C80A 4NLBA 4UAVA 1S0NA 4KX3A 5ALTA 4F50A 4DQPA 2BPCA 2E8MA 3PSPA 2CRXA 1X9WA 3M7DA 2VJ4A 1TFRA 1WYGA 4J9RA 3Q8MA 4KLHA 4EEKA 3OJSA 4DL6A 2DQNB 8ICUA 3IG8A 3N97B 5DBAA 2E8OA 2A19A 1WUDA 4GC6A 2FMPA 8ICLA 2OYYA 1VJ5A 3Q8SB 2HDOA 5ALFA 4O3RA 2Y9UA 1TVAA 1L7OA 3RRGA 3BQ0A 4I2GA 1DOQA 2EQYA 3OPXA 3N4MB 1KEJA 4R63A 3EPIA 2KHVA 2QB0B 4FE3A 3TAQA 2JEFA 5J8YA 5IILA 3CRXA 2ZIVA 4I2FA 4I2DA 4EBDA 5DGAA 2BCUA 4M6WB 1SXEA 5J2AA 1KDHA 7ICHA 1B4FA 5CHGA 3RJFA 2Q4TA 4LVSA 2P6RA 3FDSA 4US8A 4P0QB 1ZRNA 5JUMA 4NM1A 3RH5A 4MFFA 1L3UA 1T94A 4EENA 3RJJA 1ZQKA 2HCFA 5AKKA 2AXTU 1HUOA 4DOBA 4IR9A 2KZZA 2ZIWB 4BDPA 8ICYA 1A76A 3WK7A 5AI4A 1RYRA 5AK6A 3HJEA 1M6YA 3ONNA 2F77X 4Y2YA 3RBDA 4PL2A 4DFJA 5DG8A 5DBCA 3EZ5A 9ICIA 2HOFA 4PH5A 1TK0A 4IR1A 4J9PA 1SZHA 4NXZA 2FPMA 5J2BA 1X9MA 4EZ9A 3B0XA 3BQ1A 3UQ2A 4NY8A 1TAUA 1BPYA 1X6IA 2JV3A 3PZPA 2VKQA 2IHNA 5GTHU 5EWEA 1Z19A 2JEGA 4R66A 1TK8A 1X9XA 2EZZA 4UB8U 3ORYA 1L8LA 2WHEA 5AI6A 5TZVA 2BZFA 3H4BA 4M9GA 4FBUA 3ISDA 4GXIA 3WKAA 4F4ZA 1S0OA 2G5IB 5EE9A 2VA8A 1XO0A 5KG5A 1FIQA 3PNCA 3WK8A 5KFMA 5J0PA 3PW5A 5ALKA 4EYIB 2W9BA 2BCVA 2I9GA 1ZQLA 1KSPA 4O9MA 2V4QA 3BS5B 4DS5A 2CN1A 3RJIA 3RJEA 5J0OA 3QU9A 5JU5A 2KZ3A 4ED6A 4DFPA 4C8NA 2KV2A 1JN3A 2DF4B 5KFAA 2M9NA 2FDRA 4BX9C 4JK1A 2LYAA 3LVVA 3TACB 2HHWA 1S0MA 1Z00B 1X6JA 1Y88A 3C23A 3N7SC 5J0WA 1ZQPA 1Z4NA 2E1EA 2UVWA 5K4LA 2KK0A 2RLTA 2FE9A 1ZQVA 3RJKA 3SV4A 4Q45A 1JROA 2XI9A 2EDUA 4I2CA 1VLBA 5AI5A 2K4PA 2XY5A 1F0MA 4O3QA 2BPGA 3WK4A 4IRKA 3K4GA 3CP8A 5KFJA 4NLKA 2WB1F 7ICOA 4Y2RA 5HMMA 1LKYB 4NWIA 4DSKA 7ICNA 3OHBA 4IQVA 2B6GA 1T7PA 4F4KA 3WK5A 3ISCA 3U26A 3GV8B 1X42A 2YB4A 4GFJA 1J97A 2F8LA 3EUB2 4JB3A 1ZXIA 3TI0A 4B9UA 2W54A 1NJWA 3KKAA 4MEYA 3Q8PB 5ALNA 1FFUA 5J2CA 2IHMA 1KFTA 3ZD9A 2OEHA 1RPLA 2IOHA 3IP4B 1DXSA 8ICPA 1A77A 1ZQYA 3MFIA 3F53A 4QZBA 1URJA 3TANA 3AN1A 1XSPA 5L1LA
chains in the Genus database with same CATH topology
2KVSA 2O6KA 2FJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVS A;  2O6K A;  2FJ6 A; 
#chains in the Genus database with same CATH topology
 4RQ2 A;  4KTQ A;  5AK5 A;  1XU4 A;  3QU4 A;  5KAF U;  2WTF A;  2OM6 A;  3WK6 A;  5KFI A;  3H0L B;  1C20 A;  1V97 A;  4PHP A;  1ZQE A;  2ZIX B;  4EEY A;  3ED5 A;  5ALW A;  5DG9 A;  3S6J A;  3TAD C;  2C2D A;  3QUB A;  4G3I A;  1QQ6 A;  9ICE A;  2KG5 A;  1IG6 A;  4UB3 A;  3AU2 A;  2ZTD A;  2DUY A;  2C2R A;  4EZ6 A;  2AHO B;  2YMP A;  5EE0 A;  5DQG A;  1S8O A;  3LWL A;  5KT4 A;  7ICP A;  2KFZ A;  4UB6 U;  2ZUB A;  1MN8 A;  5AM4 A;  1UQV A;  1NJZ A;  9ICR A;  9ICO A;  2J6U A;  4ECU A;  4C0Z A;  3RF9 A;  5E79 U;  2LKY A;  3C29 A;  3L3F X;  1ECW A;  3MR6 A;  2K4I A;  4DFD A;  3SYZ A;  2E8N A;  1N5W A;  1OW5 A;  4P0P A;  4DQI A;  4M47 A;  1NZB A;  3GIJ A;  2I5H A;  4PZO A;  1UHU A;  3OSP A;  1A6S A;  3UMC A;  2UVR A;  4UW9 A;  1FO4 A;  2ASL A;  1NK6 A;  1KRP A;  2HHT A;  5ALJ A;  3HW8 A;  1V85 A;  1L6N A;  4CCH A;  1EXN A;  1GO3 F;  1PK3 A;  2K89 A;  4UB4 A;  3ICX A;  3IN5 A;  4USA A;  1U48 A;  5KG4 A;  5DQI A;  4YXM A;  3M8R A;  4IRC A;  3Q8L A;  3ETR A;  5KL8 B;  4PGQ A;  3H0R B;  4RT2 A;  1TAQ A;  4NJ8 A;  5KT6 A;  3FYH A;  2J6T A;  3D6J A;  5DDM A;  1F44 A;  4OJ6 A;  2AJQ A;  1NNL A;  2W9C B;  2VA3 A;  4M2Y A;  2KE7 A;  2XID A;  2VA2 A;  2HBM A;  2KVC A;  3GU3 A;  2IMW P;  5CJ7 A;  3IHQ B;  2W9C A;  1K5O A;  3EWA A;  4M9L A;  3TAR A;  1KKX A;  4QZ9 A;  4C8L A;  4OO1 J;  1NI3 A;  3E2E A;  4DF8 A;  5L1J A;  4EX7 A;  2YMQ A;  5J0R A;  4F5P A;  1IM4 A;  8ICW A;  1X66 A;  5AIC A;  1IV8 A;  8ICS A;  3DV9 A;  2ZUD A;  4RQ5 A;  1IIP A;  4UBC A;  2JZB A;  1O08 A;  1ZQN A;  2R8J A;  5ALM A;  1ZQX A;  1ZQS A;  3C2M A;  1DK3 A;  2GH1 A;  5DLG A;  4NLZ A;  2KSO B;  4O0I A;  9ICA A;  4QW8 A;  3WK9 A;  3F2D A;  3PSF A;  1DGS A;  2NRX A;  5C5J A;  2V9W A;  2W8K A;  3BZK A;  5EWF A;  1T8E A;  4RQ3 A;  2KD1 A;  3MR3 A;  4R8U A;  1PZN A;  8ICJ A;  3JPR A;  4YMO A;  2JH1 A;  2BQU A;  2NRZ A;  3PX6 A;  3K1R B;  8ICH A;  1KFS A;  2R18 A;  5CB1 A;  4B6J A;  4NM2 A;  5CR0 A;  9ICQ A;  5D46 A;  2PXI A;  1D9D A;  5ALO A;  2KSO A;  3NS1 A;  3AUO A;  2NRT A;  4R65 A;  3RTV A;  2MSN A;  1SWV A;  1WCN A;  5HHH A;  4RUC A;  3ZD8 A;  3RB6 A;  3PML A;  1C7Y A;  5KFO A;  5J2E A;  3SAG A;  2IOF K;  1YT3 A;  5ALP A;  3JPP A;  1PVP A;  3GIM A;  1NZP A;  8ICX A;  4QWE A;  4OJP A;  3T5K A;  1RZT A;  1FFV A;  2Y0S C;  3NGD A;  4QZH A;  4PGX A;  3A0B U;  5DB8 A;  3PW7 A;  5KFT A;  2ISO A;  4GIB A;  2WFA A;  1U49 A;  1ZJM A;  3F5E A;  2DBY A;  3GV5 B;  4OJ5 A;  3GQC A;  4Q43 A;  2K8B B;  2VAN A;  1SKR A;  4M0A A;  4KN7 A;  3BZC A;  4QNL A;  4ECT A;  4KLI A;  4Y2Q A;  3JPT A;  4RQ7 A;  2HW3 A;  4M9N A;  1N60 A;  3FM9 A;  8ICK A;  9ICC A;  1NK5 A;  4JV1 A;  5L1K A;  8ICQ A;  1RQL A;  3QU5 A;  3H8J A;  4ELU A;  4CF3 A;  1DK2 A;  7ICQ A;  4PJ0 U;  4DSI A;  3QUC A;  2LPE A;  1RM6 C;  5J2J A;  1UT8 A;  4UB1 A;  5KT5 A;  4E0D A;  4O3O A;  1ZQT A;  5KFG A;  4M9J A;  4QIW C;  3RJG A;  3NVZ A;  2FI1 A;  4B9V A;  2W3R A;  2H3F A;  1RQN A;  4CGZ A;  5ALE A;  2XC9 A;  4DLE A;  8ICT A;  2K4E A;  2W9M A;  4J9M A;  5AI0 A;  4UBB A;  1JI7 A;  1N48 A;  1WWV A;  2FPL A;  1SKW A;  4JMU A;  3AQF A;  5ALD A;  2KJ5 A;  2W9B B;  1OUQ A;  3HIL A;  4F8R A;  3SV3 A;  5AIB A;  1PVR A;  2KJ9 A;  2QAR A;  4YQW A;  1ZQR A;  2LYB A;  8ICA A;  5KFV A;  3Q8K A;  2OWO A;  4O3M A;  1MSW D;  2QB1 A;  2ZIX A;  3C5G A;  9ICS A;  3UMG A;  3IV6 A;  4HAI A;  3RB4 A;  3V6K A;  5ALS A;  1COO A;  5KFX A;  2W03 A;  4UB5 A;  3RR8 A;  4RQ1 A;  2ZIU B;  4F5R A;  4Z6C A;  4DSF A;  2KHQ A;  4F93 B;  4ED7 A;  3I76 A;  9ICW A;  2HSZ A;  2KEY A;  3B0Y A;  4I2J A;  4P2H A;  5KFS A;  3FAH A;  1QSY A;  3EYZ A;  2ZTE A;  4P4P A;  4C8K A;  5J2G A;  2NO5 A;  4ICA A;  5EOZ A;  2LYH A;  2BPF A;  3NUQ A;  4KLM A;  4J9N A;  4RQ4 A;  4QZG A;  3F5A A;  4RZR A;  4FZM A;  5KNI A;  5HHI A;  5ALY A;  2PI4 A;  5EE1 A;  3O0F A;  7ICI A;  1H38 A;  5KFL A;  2IA6 A;  4DWI A;  5J8Y C;  8ICM A;  1PK1 B;  1S9F A;  2H3Q A;  3T5L A;  1SB3 C;  1ZQO A;  2BDP A;  1S97 A;  3ISB A;  2HOI A;  5ALI A;  1MC8 A;  4Y2T A;  3RFA A;  3RJH A;  4RPX A;  4P0Q A;  4F5Q A;  3HKZ C;  1PVQ A;  2C28 A;  7ICR A;  5L1M A;  2HHV A;  4F3O A;  3SEN A;  3SR6 A;  4J9L A;  1S10 A;  4ECS A;  2AQ0 A;  4KX5 A;  7ICL A;  3SZ2 A;  4BJQ A;  1D8Y A;  3OTQ A;  3Q8Q B;  1D9F A;  1Q3V A;  1T3N A;  2WAQ F;  3TAP A;  1SL1 A;  1S77 D;  3VCB A;  3J81 j;  2QB0 A;  1V9P A;  3BS5 A;  3TQ1 A;  8ICZ A;  3DDH A;  2VJ5 A;  4GXJ A;  5BOL A;  4DQR A;  5KFR A;  4F4X A;  3QX7 A;  5ALZ A;  5L9X A;  2HVH A;  3ZDB A;  3TFR A;  4UB2 A;  2BDU A;  4PPX A;  1ZQC A;  4RUA A;  2V4R A;  4PGY A;  3H4D A;  1QQ7 A;  2KN7 A;  4I2I A;  4XUS A;  3T5J A;  2HHQ A;  2LM1 A;  1YZ6 A;  1TKD A;  5BOM A;  3ZDD A;  4PZN A;  1KFD A;  9ICK A;  4RNM A;  4AYB F;  4HYK A;  4QZF A;  2K60 A;  2XVT A;  2W43 A;  3AL0 B;  2Y0S F;  4X5V A;  2GOL A;  2MU2 A;  1CUK A;  3IG5 A;  1Z1B A;  4QWD A;  1XWL A;  2K8C B;  4QZE A;  4FZL A;  1U45 A;  1MQ2 A;  2FLN A;  9ICH A;  4FO6 A;  2KOB A;  1F5S A;  5F9L A;  2DPJ A;  1ZYQ A;  4Y2U A;  2XCP A;  2IBK A;  3RBE A;  1QQ5 A;  3ZDA A;  3PVX A;  2RP5 A;  8ICE A;  2O6K A;  5KFD A;  4I28 A;  4OD0 A;  1J2N A;  2ZIW A;  5F9N A;  4KLO A;  2ESE A;  3GFK B;  2MRL A;  1KN5 A;  3PMN A;  9ICG A;  1L3V A;  4NL9 C;  3I28 A;  5KFN A;  2DWQ A;  4RT3 A;  3BS7 A;  1P7D A;  1U47 A;  4TQR A;  2NV3 A;  1LB2 B;  2HOQ A;  4ED2 A;  3MC1 A;  4M9H A;  3UXP A;  5AM5 A;  4Q8F A;  5KT7 A;  2Y9T A;  9ICJ A;  5AK3 A;  2I6X A;  4DLG A;  3TAD A;  2PFP A;  1ZQD A;  2BCS A;  5KG2 A;  2XY7 A;  4F91 B;  5H2F U;  2OXO A;  3MDA A;  1NK9 A;  3M9O B;  3F2C A;  2JHD A;  5FP0 A;  9ICM A;  1PK1 A;  4DF4 A;  1S0V A;  2ASJ A;  5EE3 A;  1A0P A;  1ZQ1 C;  5AKL A;  4NLN A;  3Q8R B;  3I1Y A;  2P6U A;  2XIC A;  3H7I A;  3AU6 A;  1TAM A;  5KT3 A;  5KL1 B;  1BVS A;  1SL2 A;  2NYV A;  2P35 A;  5CEH A;  3HX0 A;  2NRW A;  3A0H U;  3SAH A;  3HPO A;  2JEI A;  1JMS A;  3KD3 A;  3R9K A;  2A1J B;  4TUR A;  4NLC A;  2RDI A;  5ALU A;  4UAS A;  1T4G A;  1MA7 A;  1NKB A;  5AKY A;  3BQ7 A;  2JRZ A;  2KMD A;  3AM9 A;  1NJY A;  3GIL A;  2KIV A;  5B5E U;  1B43 A;  2PFQ A;  3C5F A;  3M1Y A;  3N7R C;  2N1R A;  2ZIU A;  5KG0 A;  2YX8 A;  2YB1 A;  1SWW A;  5AIA A;  4O3N A;  4PHA A;  2AH5 A;  2JXJ A;  2QKQ A;  4K4H A;  2D6F C;  4DO9 A;  3KHH A;  3QUT A;  1UT5 A;  1CEZ A;  2BGW A;  3LYS A;  2C2E A;  4ED8 A;  2JR5 A;  3N7P D;  1U9L A;  1ZJN A;  4MHV A;  4KLF A;  3V7J A;  5DDY A;  3QEA Z;  4DOA A;  4UQG A;  4Y2J A;  1X40 A;  7ICK A;  2XGP A;  2EZX A;  3IM1 A;  3MFH A;  4QW9 A;  4GXK A;  2PI5 A;  4MEX A;  3QZ7 A;  1L7P A;  4F71 A;  4EYH B;  2JMG A;  5J0Y A;  4UAW A;  3QZ8 A;  3T79 A;  5CRX A;  8ICG A;  2F8K A;  1SV4 A;  3AMZ A;  3E58 A;  4I29 A;  2FLL A;  2Y1J A;  3UMB A;  4YR2 A;  2FJ6 A;  2E1F A;  3KBB A;  3PX4 A;  2HVI A;  3NVY A;  1ZQU A;  1MQ3 A;  2LBO A;  8ICF A;  4IC9 A;  3LK9 A;  4I2E A;  4MFA A;  4KLJ A;  1ZD5 A;  4DSE A;  4YN4 A;  5J2K A;  2AGO A;  8ICR A;  3MAB A;  2BQ3 A;  2G5H B;  3RH4 A;  4DQS A;  5AKE A;  1SIJ A;  1Z4O A;  3MGH A;  1QLN A;  4O3S A;  1NK7 A;  7ICG A;  5JRT A;  1BNO A;  3HWT A;  5DQH A;  4YFK A;  2HHS A;  4ECQ A;  1QSL A;  4C7Y A;  5ALH A;  1NK0 A;  3WU2 U;  4G9B A;  1B0X A;  2BQR A;  1SXD A;  3D2S A;  5DBB A;  3QU7 A;  2F1I A;  4OJL A;  1QCK A;  1ZRM A;  5DGB A;  5AM0 A;  4ELT A;  5KG7 A;  4ELV A;  4QZC A;  7ICE A;  4FS1 A;  3GIK A;  2AGP A;  2PMZ C;  5KG3 A;  2PMZ F;  4LZD A;  2NO4 A;  3QNM A;  3PR4 A;  5AKH A;  3RR7 A;  2WAQ C;  3SMV A;  1UPH A;  1ZQG A;  5CP2 A;  2ZXH A;  4Y2V A;  2I1Q A;  5AM3 A;  4RU9 A;  1CI4 A;  2G0A A;  2BHN A;  3V7K A;  3E0F A;  2KKP A;  2YN4 A;  2UVV A;  2LMR A;  2UVU A;  3L4P A;  1CRX A;  4DL5 A;  8ICI A;  5D4B A;  2ZTC A;  4KN4 A;  4CF5 A;  2DGZ A;  3GV7 B;  4TUP A;  3DEE A;  3WKD A;  2VIX A;  4R8U B;  1ZET A;  4DOC A;  3PO4 A;  1XSL A;  4DFK A;  5J2I A;  3EW9 A;  1L7N A;  3T5H A;  4RPY A;  1XC9 A;  4Q8E A;  4C8O A;  4F92 B;  5J2F A;  3BQT A;  2F44 A;  4ECX A;  3K1Z A;  2AQ4 A;  8ICN A;  3CW2 C;  3AQE A;  3RH6 A;  2KFN A;  1Q8K A;  3N28 A;  2F3N A;  2KJ8 A;  1BPD A;  4BUG A;  1N2X A;  1O03 A;  5KFQ A;  1QTM A;  2OCE A;  4MFC A;  4KMU A;  1RXW A;  5DB9 A;  1N61 A;  3SEI A;  2JZB B;  2MAX A;  2ODG A;  4J9Q A;  4P4O A;  3B9J A;  3PST A;  1K1S A;  3QU2 A;  3G6V A;  1VDV A;  1UCV A;  1NK4 A;  3OGU A;  3V6J A;  4KLS A;  2AGQ A;  4RNN A;  3PR5 B;  3TFS A;  5ALV A;  1RYS A;  1QH9 A;  3H0M B;  4J9O A;  1DRG A;  2GLE A;  3HKZ F;  2XCA A;  2LM4 A;  2YQE A;  4C4T A;  1L3S A;  2PKE A;  4GLX A;  2GWS A;  4Z6E A;  5KTQ A;  3MGV A;  2RHF A;  2HBL A;  3QE9 Y;  4CF4 A;  4CNQ A;  4WJ3 B;  1WCL A;  2JH7 A;  1DGJ A;  4NL9 A;  4RNO A;  1Q3U A;  2JGA A;  2BKE A;  3KFU F;  4QZD A;  1YZ7 A;  2MUT A;  5C0Y A;  7ICU A;  3SD7 A;  3C1Y A;  3UPQ A;  2XY6 A;  1ZQZ A;  4YG2 A;  2RDJ A;  3RAX A;  1COK A;  4DS4 A;  1XNS A;  4IRD A;  5J2D A;  2YTU A;  4OCZ A;  5ALG A;  5KFU A;  4B9L A;  2DFL A;  4Y2P A;  3MGI A;  2OHF A;  2KP7 A;  3C2K A;  5BPC A;  1K1Q A;  4IQW A;  1RDF A;  3NAS A;  4Y2X A;  1TK5 A;  5J0T A;  3BQ2 A;  3RB3 A;  5KFY A;  7ICT A;  3MR5 A;  5DLF A;  4DFM A;  4I2H A;  3PW4 A;  9ICL A;  1X9S A;  2WB1 C;  2EAM A;  4DSL A;  4F2R A;  5AKX A;  1ZQI A;  8ICB A;  4KLD A;  1QSS A;  2B0C A;  2DKZ A;  4DL2 A;  4KLE A;  3NRZ A;  5J0U A;  1UA0 A;  1L5U A;  4ECY A;  1SV0 A;  2DKX A;  1D8L A;  4XQ8 A;  2QAR B;  4RQ0 A;  4MF2 A;  2ALZ A;  3WKC A;  1RXV A;  1JAL A;  3NRW A;  9ICT A;  3CNH A;  4QJF B;  4I2A A;  2ZJ5 A;  2DPI A;  3FC4 A;  2FPK A;  2OH2 A;  4DCC A;  4FBT A;  4R64 A;  4YMM A;  5AI8 A;  3LWM A;  2HMX A;  3KOO A;  2Y1I A;  5ALR A;  2HHX A;  8ICC A;  1ZQW A;  1L3T A;  3RRH A;  2E3T A;  3V72 A;  4XRH A;  5HNK A;  2P66 A;  9ICU A;  4P4M A;  1LV5 A;  4F2S A;  2WF7 A;  2G08 A;  4TUQ A;  4MF8 A;  5KFF A;  2BR0 A;  1ZQB A;  4UAZ A;  3F2B A;  4QWA A;  2R8G A;  2G07 A;  5KFH A;  1U4B A;  2ES6 A;  4FFD A;  4Z6D A;  5A0L A;  3OJU A;  2H3V A;  3HT3 A;  1LKY A;  3D2N A;  5J0Q A;  5KFE A;  4PL1 A;  2ZJA A;  1T3Q A;  4ECR A;  3M9M B;  2YMM A;  3IRU A;  4FZN A;  4DEZ A;  2ZXI A;  2W55 A;  3C2L A;  3ALR A;  4KIT B;  1RG6 A;  2MA1 A;  4KMO B;  4O3P A;  4F5N A;  2ZJ8 A;  5KFW A;  3G6X A;  4M04 A;  3CYM A;  2WF8 A;  3PSI A;  5IIN A;  3UM9 A;  2LI6 A;  5HML A;  4C8M A;  5KFB A;  1Z00 A;  1L8O A;  5B66 U;  4QWB A;  5EWG A;  4DQQ A;  2ASD A;  4JV2 A;  4JUZ A;  2IOF A;  4EBE A;  1XSN A;  1HUZ A;  4YXJ A;  1SZP A;  2W04 A;  4FS2 A;  2Z7J A;  4EX6 A;  4I2B A;  1N56 A;  4IQU A;  5J2H A;  4ACO A;  1TV9 A;  2EZY A;  8ICV A;  5KFK A;  4OJO A;  4PHD A;  5DG7 A;  3JPN A;  3KHR A;  4U7C A;  3UQ0 A;  4ED1 A;  1NKE A;  4TUS A;  4UAR A;  5J0S A;  1S76 D;  7ICF A;  4AP9 A;  3M8S A;  4DL7 A;  2YML A;  3C21 A;  1ZD2 P;  5IIK A;  4JV0 A;  5KFC A;  1XS9 D;  2H3Z A;  4F72 A;  1X2I A;  1J2M A;  1KLN A;  4ED0 A;  2EAO A;  4YP3 A;  1V38 A;  4J03 A;  4DSJ A;  3JPO A;  3EPG A;  5IIJ A;  4CE6 A;  4A8E A;  4JWN A;  3JPS A;  3H40 A;  1S5L U;  2AU0 A;  1BPE A;  2RRD A;  2D3D A;  3V6H A;  3QYP A;  4YVZ A;  2DL0 A;  2C22 A;  2PFN A;  5III A;  3V7L A;  5IIM A;  1XO1 A;  4I27 A;  1WWU A;  9ICX A;  9ICB A;  2BCQ A;  2F1J A;  2ATL A;  2W3S A;  4J9S A;  4KLT A;  3OSN A;  4RQN A;  2HHU A;  4IS7 A;  4US9 A;  9ICP A;  5HR7 A;  4DL4 A;  1KQQ A;  1ZD4 A;  2W9A A;  3T3F A;  4GC7 A;  1N5X A;  5KG6 A;  4AYB C;  2EH9 A;  2BCR A;  4QZI A;  3NTU A;  2XO7 A;  4B9N A;  1ZD3 A;  4BGD A;  3PW2 A;  4C4R A;  2B21 A;  2MUT B;  4IQT A;  5KFZ A;  4K4G A;  2A1A A;  5ALQ A;  4QZ8 A;  1JXE A;  2Q0Z X;  3RAQ A;  3IDW A;  9ICN A;  2R8H A;  4K4I A;  3PY8 A;  3THV A;  2LHT A;  2M0N A;  1ZQJ A;  4U6P A;  4UAY A;  2FMS A;  3H8M A;  3WKE A;  2W8L A;  5KAI U;  1ED1 A;  3BJY A;  1Q46 A;  5KFP A;  4ZOH C;  3JPQ A;  2J6S A;  4NV0 A;  4F4W A;  3KZI U;  4YD1 A;  2W7O A;  2E5S A;  4QIW F;  3C1Z A;  1NJX A;  3PW0 A;  4F4Y A;  2FMQ A;  4M6W A;  1N63 A;  3ZDE A;  2ZIV B;  1ZQM A;  4CDG A;  4EBC A;  3C28 A;  2W11 A;  4Y2S A;  4ECZ A;  3HP6 A;  5AKZ A;  1TE2 A;  2F1H A;  3H8W A;  5J0X A;  4P0P B;  3PO5 A;  5T14 A;  2KTQ A;  3M6K A;  5G5H A;  3UXN A;  4TQS A;  2CXY A;  1JUD A;  4EEL A;  1Z1V A;  2EAP A;  3ZI4 A;  4XA5 A;  4KLG A;  3UXO A;  2G09 A;  2K8A A;  4UAT A;  4C7Z A;  3GII A;  4KLL A;  2WF9 A;  1SL0 A;  1ZQH A;  1D8B A;  3ZDC A;  7ICM A;  1HJP A;  4LJX A;  4RQM A;  3BDP A;  4RQ6 A;  1ZOL A;  3RB0 A;  4PHE A;  5AK4 A;  3PV8 A;  3KHL A;  1KBU A;  2F2A B;  5AM2 A;  2H3I A;  3TKA A;  3G6Y A;  4JWM A;  2H5X A;  4RPZ A;  4QWC A;  1OXJ A;  4YR3 A;  8ICO A;  1PUZ A;  2RQ5 A;  1UA1 A;  5HP4 A;  5CA7 A;  3NVV A;  5DB7 A;  3QEB Z;  4YR0 A;  3LVW A;  1KL9 A;  4LZG A;  3QUQ A;  3SAF A;  5D49 A;  4ED3 A;  4NLG A;  1SKS A;  4Q44 A;  1LVH A;  1ARO P;  1HIW A;  4BWJ A;  3QXG A;  5KG1 A;  3LDA A;  1NK8 A;  3H8S A;  3MBY A;  2NRV A;  3NVW A;  1JIH A;  2KVS A;  2WF5 A;  5DB6 A;  5DKW A;  4RQ8 A;  2HBK A;  3GDX A;  4ZH4 A;  5AKI A;  1BGX T;  4BWM A;  1FEZ A;  5AI9 A;  1JXL A;  2A1J A;  2R8I A;  2F76 X;  2HBJ A;  3KZX A;  4O5K A;  3PX0 A;  1N62 A;  2YY6 A;  2G06 A;  2D8C A;  3K75 D;  1BPX A;  2L5Y A;  1NOM A;  2HI0 A;  5CWR A;  2GO7 A;  5KT2 A;  2ZUC A;  3OHA A;  1JRP A;  2FLP A;  4KLU A;  1ZQF A;  2XGQ A;  3L5K A;  4B9M A;  7ICJ A;  4F5O A;  7ICV A;  1SV0 C;  1WG8 A;  1KW4 A;  1B22 A;  4BXO B;  3GZF A;  4O5C A;  4CRX A;  1HEK A;  5AHX A;  3MDC A;  3KHG A;  1NKC A;  4KLQ A;  2QLT A;  4YCX A;  2ZG6 A;  4BXO A;  4O5E A;  2K4H A;  5ALX A;  4YD2 A;  1ZQQ A;  2R8K A;  5J29 A;  3KKA C;  2KZM A;  9ICF A;  3WKB A;  3AEV A;  4QZA A;  3KTQ A;  1IXR A;  4UAU A;  4C4S A;  4IL6 U;  1BPB A;  5AM1 A;  5JTI A;  5L1I A;  2JEJ A;  2ISP A;  4J9K A;  4B9T A;  3M6Z A;  7ICS A;  5GTI U;  2PFO A;  3M9N B;  5G5G A;  1BPZ A;  3VC8 A;  2W7P A;  4DL3 A;  3HRD D;  4B9S A;  2E8P A;  9ICV A;  1AQ6 A;  2KNJ A;  2KIW A;  1RYU A;  1L7M A;  4Z6F A;  4ECV A;  1BNP A;  3SQI A;  5AKG A;  1Z3E B;  5ALL A;  2KIC A;  4YMN A;  5IIO A;  5F3X B;  2A3V A;  3D2Q A;  5AKJ A;  3MR2 A;  2KKV A;  3SI8 A;  5TIS U;  4ECW A;  5HR6 A;  1ZQA A;  2WF6 A;  1SGG A;  1KTQ A;  2CPR A;  2EAN A;  3ETL A;  1JX4 A;  4C80 A;  4NLB A;  4UAV A;  1S0N A;  4KX3 A;  5ALT A;  4F50 A;  4DQP A;  2BPC A;  2E8M A;  3PSP A;  2CRX A;  1X9W A;  3M7D A;  2VJ4 A;  1TFR A;  1WYG A;  4J9R A;  3Q8M A;  4KLH A;  4EEK A;  3OJS A;  4DL6 A;  2DQN B;  8ICU A;  3IG8 A;  3N97 B;  5DBA A;  2E8O A;  2A19 A;  1WUD A;  4GC6 A;  2FMP A;  8ICL A;  2OYY A;  1VJ5 A;  3Q8S B;  2HDO A;  5ALF A;  4O3R A;  2Y9U A;  1TVA A;  1L7O A;  3RRG A;  3BQ0 A;  4I2G A;  1DOQ A;  2EQY A;  3OPX A;  3N4M B;  1KEJ A;  4R63 A;  3EPI A;  2KHV A;  2QB0 B;  4FE3 A;  3TAQ A;  2JEF A;  5J8Y A;  5IIL A;  3CRX A;  2ZIV A;  4I2F A;  4I2D A;  4EBD A;  5DGA A;  2BCU A;  4M6W B;  1SXE A;  5J2A A;  1KDH A;  7ICH A;  1B4F A;  5CHG A;  3RJF A;  2Q4T A;  4LVS A;  2P6R A;  3FDS A;  4US8 A;  4P0Q B;  1ZRN A;  5JUM A;  4NM1 A;  3RH5 A;  4MFF A;  1L3U A;  1T94 A;  4EEN A;  3RJJ A;  1ZQK A;  2HCF A;  5AKK A;  2AXT U;  1HUO A;  4DOB A;  4IR9 A;  2KZZ A;  2ZIW B;  4BDP A;  8ICY A;  1A76 A;  3WK7 A;  5AI4 A;  1RYR A;  5AK6 A;  3HJE A;  1M6Y A;  3ONN A;  2F77 X;  4Y2Y A;  3RBD A;  4PL2 A;  4DFJ A;  5DG8 A;  5DBC A;  3EZ5 A;  9ICI A;  2HOF A;  4PH5 A;  1TK0 A;  4IR1 A;  4J9P A;  1SZH A;  4NXZ A;  2FPM A;  5J2B A;  1X9M A;  4EZ9 A;  3B0X A;  3BQ1 A;  3UQ2 A;  4NY8 A;  1TAU A;  1BPY A;  1X6I A;  2JV3 A;  3PZP A;  2VKQ A;  2IHN A;  5GTH U;  5EWE A;  1Z19 A;  2JEG A;  4R66 A;  1TK8 A;  1X9X A;  2EZZ A;  4UB8 U;  3ORY A;  1L8L A;  2WHE A;  5AI6 A;  5TZV A;  2BZF A;  3H4B A;  4M9G A;  4FBU A;  3ISD A;  4GXI A;  3WKA A;  4F4Z A;  1S0O A;  2G5I B;  5EE9 A;  2VA8 A;  1XO0 A;  5KG5 A;  1FIQ A;  3PNC A;  3WK8 A;  5KFM A;  5J0P A;  3PW5 A;  5ALK A;  4EYI B;  2W9B A;  2BCV A;  2I9G A;  1ZQL A;  1KSP A;  4O9M A;  2V4Q A;  3BS5 B;  4DS5 A;  2CN1 A;  3RJI A;  3RJE A;  5J0O A;  3QU9 A;  5JU5 A;  2KZ3 A;  4ED6 A;  4DFP A;  4C8N A;  2KV2 A;  1JN3 A;  2DF4 B;  5KFA A;  2M9N A;  2FDR A;  4BX9 C;  4JK1 A;  2LYA A;  3LVV A;  3TAC B;  2HHW A;  1S0M A;  1Z00 B;  1X6J A;  1Y88 A;  3C23 A;  3N7S C;  5J0W A;  1ZQP A;  1Z4N A;  2E1E A;  2UVW A;  5K4L A;  2KK0 A;  2RLT A;  2FE9 A;  1ZQV A;  3RJK A;  3SV4 A;  4Q45 A;  1JRO A;  2XI9 A;  2EDU A;  4I2C A;  1VLB A;  5AI5 A;  2K4P A;  2XY5 A;  1F0M A;  4O3Q A;  2BPG A;  3WK4 A;  4IRK A;  3K4G A;  3CP8 A;  5KFJ A;  4NLK A;  2WB1 F;  7ICO A;  4Y2R A;  5HMM A;  1LKY B;  4NWI A;  4DSK A;  7ICN A;  3OHB A;  4IQV A;  2B6G A;  1T7P A;  4F4K A;  3WK5 A;  3ISC A;  3U26 A;  3GV8 B;  1X42 A;  2YB4 A;  4GFJ A;  1J97 A;  2F8L A;  3EUB 2;  4JB3 A;  1ZXI A;  3TI0 A;  4B9U A;  2W54 A;  1NJW A;  3KKA A;  4MEY A;  3Q8P B;  5ALN A;  1FFU A;  5J2C A;  2IHM A;  1KFT A;  3ZD9 A;  2OEH A;  1RPL A;  2IOH A;  3IP4 B;  1DXS A;  8ICP A;  1A77 A;  1ZQY A;  3MFI A;  3F53 A;  4QZB A;  1URJ A;  3TAN A;  3AN1 A;  1XSP A;  5L1L A; 
#chains in the Genus database with same CATH homology
 2KVS A;  2O6K A;  2FJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...