2KVSA

Nmr solution structure of q7a1e8 protein from staphylococcus aureus: northeast structural genomics consortium target: zr215
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
b'MAGDPMTFYNFIMGFQNDNTPFGILAEHVSEDKAFPRLEERHQVIRAYVMSNYTDHQLIETTNRAISLYMANLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MW0776
publication title NMR Solution Structure of Q7A1E8 protein from Staphylococcus aureus: Northeast Structural Genomics Consortium target: ZR215
rcsb
source organism Staphylococcus aureus
molecule tags Structural genomics, unknown function
total genus 21
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06855 YozE_SAM_like YozE SAM-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.260 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 YozE SAM-like 2kvsA00
2FJ6A 2KVSA 2O6KA
chains in the Genus database with same CATH superfamily
2IOHA 4BJQA 2EZZA 4YVZA 4EEYA 2G5HB 4MF8A 4OJOA 4Q45A 8ICEA 1UT5A 3N7RC 2HDOA 1RQNA 4GXKA 4DS4A 8ICYA 3ZDAA 3OTQA 2JRZA 1HIWA 4UAVA 3ONNA 2WF8A 5C5JA 1ZQKA 2NRVA 4QIWF 3PSFA 1L8OA 4P4OA 3V7JA 1PVRA 1OUQA 4Y2QA 5J0UA 3LK9A 4PHEA 3CNHA 4ICAA 1ZQAA 1L8LA 1ZQTA 2YMPA 3V7KA 4FBTA 3IV6A 3UPQA 5KFKA 7ICEA 1RQLA 1DGSA 4GFJA 3ISCA 2WF6A 1UQVA 3ORYA 4UATA 2E1FA 4KN4A 2BCRA 5AKZA 2F3NA 2KK0A 3GQCA 2DPIA 2AJQA 2LYAA 2M0NA 2C22A 2JR5A 2YMQA 1QTMA 2KKPA 1FIQA 2JEGA 2AGOA 3H8SA 2HOFA 4ELUA 3EW9A 3ZI4A 2HVHA 1S0VA 3KKAC 4J9QA 1ZD2P 2PMZC 5ALTA 3M7DA 1D8LA 3PW5A 1BPDA 2YQEA 3QEAZ 5KFWA 3KHLA 3B0YA 5C0YA 9ICMA 3V6JA 2KG5A 2ZIWB 2HHQA 4M6WB 4PZNA 4ECXA 5KG5A 3D2QA 4R8UA 5AKXA 5EWFA 2W03A 3GU3A 5AI0A 1NNLA 4R64A 5KFRA 2OWOA 4B9VA 2FJ6A 1UCVA 2LPEA 3MR3A 2AGPA 1PK1A 3O0FA 4ELTA 1JXEA 3IHQB 4YXJA 2XCAA 2C2DA 3U26A 1D8BA 2GWSA 3HJEA 2G5IB 2BCUA 4IR1A 2WAQC 3GIKA 1ZQYA 3A0BU 5AM2A 5EE0A 2KOBA 2J6UA 3ZD9A 2PKEA 2VANA 1MA7A 2LI6A 5J2FA 1COKA 1SV4A 4NLGA 1OW5A 3NRZA 2KVCA 4FO6A 2BQ3A 2DBYA 2IOFA 3OHAA 4M9HA 3H0MB 3ISDA 2PFPA 4DL6A 1SGGA 3M1YA 5J2EA 8ICCA 5KFMA 4QWDA 5AI6A 3G6XA 4Q43A 2BPFA 2Y9TA 1NK4A 2NRTA 4KLIA 5AKGA 2W9BA 2M9NA 4J9OA 2KZ3A 3WK6A 4YP3A 5CWRA 3UXPA 2RDJA 5DDMA 1RM6C 5BPCA 2XY6A 2P6RA 4CGZA 4OJLA 5J0OA 1T94A 5D46A 2ZJ8A 4M9GA 2K8BB 4K4GA 3R9KA 1PVQA 1U45A 3IP4B 2AGQA 4J9KA 2J6TA 2KICA 1KQQA 1ZQ1C 1MQ3A 3KKAA 9ICIA 4KX3A 8ICPA 2MU2A 4UAWA 5AKHA 1N60A 1TAQA 4DSJA 3UMGA 3PR5B 1X9MA 4F93B 5K4LA 4PGXA 2G07A 5AM5A 3G6VA 1Z1BA 4RNNA 2FMQA 3H7IA 5DBCA 3C1ZA 4TQSA 3RJHA 1F44A 2K89A 3HT3A 3RR8A 4B6JA 3H40A 3BZKA 3I28A 4J9NA 3KZXA 2E8MA 3BQTA 4RQ8A 2ASJA 5ALPA 2YX8A 4NLZA 3J81j 4Z6CA 2BZFA 1X6IA 3JPOA 4IQUA 3GIMA 4HYKA 4YCXA 7ICRA 4BUGA 2A1JB 1C7YA 3RAQA 3CP8A 2GOLA 3LVWA 4M47A 3PNCA 1LKYB 4C4TA 3IG5A 1S76D 5ALHA 4DSKA 5KFQA 1U48A 2W55A 4QWCA 2HMXA 4O9MA 1NK0A 1TVAA 2ZIUA 4EENA 1TV9A 3RRGA 8ICLA 2ATLA 4RU9A 5IIOA 1ZQNA 1IIPA 2OXOA 1TKDA 2E3TA 2G0AA 1ZQVA 1ZYQA 1ZQHA 2IHMA 5ALVA 5AKEA 2XGPA 4YN4A 1JI7A 3A0HU 1ZQXA 3BJYA 3C28A 4IRDA 5ALKA 1ZQGA 5J2IA 5J2JA 1TK5A 2PFNA 2ASLA 4F2SA 1L7PA 3NS1A 2EAPA 4NXZA 9ICPA 2KSOA 3M8RA 1ZQCA 4UARA 1AQ6A 2G06A 2BQUA 4QWBA 3H4BA 3LWLA 4MFCA 2A19A 4PHAA 4I28A 1SB3C 4ELVA 2R18A 7ICFA 3F5AA 5KT6A 1KKXA 1MSWD 5ALSA 4PL2A 1N5XA 2CPRA 2RLTA 3HKZF 4OCZA 4F5NA 1S97A 1XWLA 4ED0A 1MQ2A 2NV3A 3PX6A 1QSSA 2H3IA 9ICTA 4US9A 3AUOA 3C2LA 1MC8A 4YXMA 1SL1A 5ALNA 5EWGA 4C7ZA 1N63A 5KT2A 7ICTA 3D6JA 3OSPA 4G9BA 5KFOA 2I5HA 3QU5A 4ECZA 3PW4A 4RT3A 4RT2A 5J2DA 4BDPA 1XU4A 2HHTA 3H8JA 4RQ6A 4A8EA 1BPXA 2Q4TA 4C8OA 4ECYA 2QB1A 2ISOA 5E79U 2BGWA 5KFNA 3HP6A 2K4EA 4YMMA 5J0TA 4DFKA 4PZOA 1Q3UA 3SAGA 4Z6DA 4ECQA 2RRDA 4UB4A 2W9CA 4PGYA 2JEIA 4ED6A 5ALIA 5ALRA 8ICNA 1SL2A 1TAMA 2BDUA 5AIAA 4RQ2A 3NRWA 1OXJA 2EDUA 5A0LA 5KNIA 2ZIVA 2G09A 5HR6A 3RJKA 3RJJA 2ZUCA 1Y88A 3RH5A 1WWUA 4RQ7A 3HPOA 1Z00B 2KIWA 1NZPA 3QU2A 2MUTA 9ICLA 3RJEA 4B9SA 2R8HA 4M9NA 2VJ4A 2ZUDA 4QNLA 4Y2JA 3AL0B 1T3QA 2UVUA 3M6ZA 4NY8A 9ICCA 3QUTA 2KMDA 2F8KA 1ZQWA 4X5VA 4QZHA 3PSTA 5HMLA 5KFFA 5ALGA 5KFJA 1ED1A 5AKKA 4J03A 3AU2A 4RQ3A 3RAXA 3RB0A 9ICFA 1N62A 1S9FA 1NKCA 5BOMA 4I2FA 2N1RA 4UAUA 3ZD8A 4US8A 5AM4A 1ZQRA 4KLDA 4YR3A 1NK6A 3GV5B 4F91B 3UMCA 3WKEA 1NOMA 3RB6A 3WK7A 3VCBA 2DWQA 4KLEA 8ICUA 3WKAA 2Q0ZX 5J0SA 4QZCA 2WB1F 3GV7B 5HR7A 5KL1B 2AHOB 3RB3A 3MFIA 4B9UA 5IILA 3WU2U 5J29A 3BS7A 2KIVA 4BGDA 2FMSA 5L1KA 3N7PD 3N28A 1NKEA 1NI3A 4FFDA 4Q8EA 1V85A 3TFSA 4ED3A 4O0IA 4QZGA 2FI1A 3QNMA 2B21A 2DF4B 2BCQA 3RJIA 5KFTA 5DBBA 2HW3A 2NO4A 3T5LA 2K60A 1TK0A 4MFFA 3LWMA 3CYMA 1U47A 1J2MA 3FDSA 3GIJA 4F4KA 3UXNA 4P0PA 5J8YC 1S0OA 3EPIA 5KG0A 4CF5A 1S0NA 4C4SA 1B22A 4RQMA 1JMSA 2ISPA 3TADC 1SL0A 3BS5B 1ZQPA 3TI0A 1KL9A 3ZDCA 7ICGA 3M9NB 3RH4A 3V6KA 2AQ4A 3HWTA 1SZHA 3JPTA 3SYZA 1DXSA 4ZH4A 4BXOA 1SKWA 4IL6U 4UAZA 2GO7A 4NWIA 4FBUA 4UB1A 4C4RA 2ZIXA 3E0FA 1WYGA 2YB1A 2IHNA 3JPSA 3FM9A 3OGUA 4PH5A 5DKWA 3QYPA 5TZVA 2CRXA 1V9PA 4UW9A 2WFAA 3H8MA 2C2RA 1J97A 3G6YA 1CRXA 2JHDA 2ZTEA 4ECTA 9ICBA 4KITB 3GDXA 4O3SA 4KLLA 4UB2A 5KFEA 1SXEA 4J9LA 2ZG6A 8ICAA 3RF9A 1K1SA 3UXOA 1S10A 4GIBA 4DL2A 1WUDA 4F8RA 5D4BA 4UB3A 3JPRA 7ICVA 2B0CA 5IIJA 3DDHA 3QUBA 2JV3A 1BPEA 2QARA 5KG7A 3H0RB 2W3RA 4I2EA 2K8CB 3QX7A 1X42A 3M9OB 1Z4OA 3IG8A 5KFDA 5J2BA 1C20A 4NV0A 2DPJA 1DOQA 4R65A 4UBBA 2BPCA 3TARA 5TISU 2RP5A 2IA6A 4EELA 2PFQA 2GLEA 4DF4A 1JN3A 1LV5A 1F0MA 5H2FU 1B43A 4K4IA 8ICTA 5J8YA 1FEZA 2VIXA 4PGQA 1L7MA 1BPZA 5AM1A 3SI8A 4Y2VA 5DB8A 3WKDA 1D9FA 5L9XA 3TADA 2HVIA 3JPNA 5HP4A 2C28A 5KT4A 4F5PA 4KLSA 3GILA 3NVWA 9ICGA 1JXLA 3C1YA 4DFJA 3T5JA 4DQRA 4R8UB 7ICMA 7ICKA 2JEFA 5AI8A 2R8IA 3C21A 4EYHB 8ICOA 2P35A 5KTQA 3WK9A 5B66U 4EBEA 1T7PA 1YZ7A 4F92B 5KFHA 2JEJA 1B4FA 9ICOA 4EX7A 2F8LA 7ICNA 2WTFA 3UM9A 3ZDDA 2XY5A 1VDVA 1PK1B 1JALA 2Y1IA 4MEYA 4O3NA 1KTQA 1N56A 4TUQA 3WK8A 4UBCA 4C8KA 3PVXA 9ICJA 5ALUA 3F53A 1UA1A 2EZYA 2HSZA 2WB1C 4TQRA 2I9GA 8ICSA 4I29A 2Y0SC 2WF9A 1ZXIA 1SV0C 2K8AA 4YR2A 5KFZA 3M8SA 1KW4A 2KKVA 1NJZA 4QWEA 5DG7A 3C5FA 4TURA 4UB5A 4NJ8A 3TKAA 3C29A 5AM0A 8ICVA 1PVPA 4KLUA 1XO0A 4GC6A 2KJ5A 4J9RA 3ICXA 3QEBZ 2Z7JA 4CF3A 2LYBA 4JUZA 3GIIA 4GC7A 8ICMA 3RB4A 2E1EA 9ICAA 3PV8A 2KD1A 2MAXA 3MBYA 1EXNA 7ICQA 2K4PA 4EZ9A 1WCLA 2BQRA 5J2KA 4DCCA 4AYBF 8ICWA 2LMRA 3NVYA 2HHVA 4HAIA 5HMMA 2XC9A 4XA5A 4PJ0U 2FLNA 1N5WA 4DL5A 2QLTA 1NK9A 1BNPA 1QSYA 3QU9A 5DQGA 2W9MA 3RJGA 5IINA 3NVZA 2CN1A 2NRZA 4UB8U 3T3FA 7ICUA 4DSFA 3KTQA 4QZDA 3PZPA 4XRHA 5CA7A 4QZBA 2LM1A 5KFPA 3WK4A 4OJPA 4F2RA 2OYYA 2RQ5A 3V7LA 5ALMA 4RNOA 4C0ZA 2JMGA 1ZETA 1YT3A 4MFAA 4FE3A 1ZD3A 4DSLA 3AQFA 3LDAA 4ECUA 2QB0A 2BDPA 3H0LB 1PUZA 4F71A 2E5SA 4QIWC 1Z19A 4Q8FA 1ZD5A 3KFUF 5EE1A 1FO4A 1Z4NA 2XGQA 4JV0A 2BCSA 4DL4A 2AU0A 4I2CA 5AK3A 1RPLA 2F44A 4PHPA 1SIJA 4ED7A 2VKQA 1SV0A 2KV2A 3MC1A 3SMVA 4DFDA 3IRUA 2H3QA 4KLJA 4E0DA 5DQIA 4AP9A 4DOCA 2KEYA 4I2BA 1CEZA 8ICZA 2MRLA 7ICJA 4DS5A 3ETRA 2CXYA 2NYVA 1S5LU 2C2EA 3DEEA 4XQ8A 3QE9Y 3UQ2A 4P0QA 1AROP 4OD0A 5AM3A 3EUB2 4GLXA 2HBKA 5CB1A 3F2CA 3PMLA 2WF7A 5AK6A 1Q46A 3MGVA 5KFVA 1ZRMA 4Y2RA 2W43A 1J2NA 5DG8A 1BPYA 2KSOB 2FDRA 3C23A 4RQ0A 4O3RA 4IRKA 2Y9UA 5KFSA 3MABA 4FZLA 3JPPA 4GXIA 2RHFA 5KG2A 4OJ6A 5J0QA 2FPKA 4J9PA 2DQNB 4QZAA 4I2JA 5L1MA 4I2HA 4CNQA 3E58A 4ECRA 3B9JA 3NASA 3S6JA 4YQWA 3IDWA 5CHGA 1NK7A 3QXGA 2A1AA 4YMNA 5AI4A 1T3NA 4P4PA 2JZBA 1VJ5A 4O5CA 2OM6A 3MDAA 2HCFA 3D2SA 1SKSA 4F3OA 3H4DA 1ZQEA 2YMLA 3N7SC 3Q8RB 1TK8A 5EE3A 1NJXA 5AKLA 4DL3A 4B9MA 4C8NA 3MR5A 4RQNA 5CR0A 5J0XA 5DGBA 3MFHA 2LKYA 1XSPA 9ICUA 4EBDA 4EBCA 3DV9A 3PX4A 2O6KA 1U4BA 3F5EA 3FYHA 2FLPA 2DKXA 3BZCA 4ZOHC 2JXJA 2W54A 3AQEA 1ZQQA 1URJA 1X40A 1Q8KA 3PO5A 2ZIVB 1SKRA 3LYSA 3TAQA 3KD3A 1O03A 2KFZA 2EAMA 3QZ7A 2KZMA 4DOAA 4KLTA 1CI4A 2UVWA 3D2NA 2MUTB 3RJFA 2OEHA 1UHUA 2HOQA 2FE9A 3V6HA 3AM9A 2OH2A 5DBAA 3ED5A 2YY6A 1KSPA 2BKEA 4KMUA 4QW9A 4I2GA 2A3VA 4IC9A 5BOLA 5KT7A 2KNJA 1Z00A 1NK8A 3L4PA 1ZQMA 3RFAA 3UMBA 4MEXA 1GO3F 4ED1A 2PMZF 1WG8A 3QU4A 2KVSA 4M0AA 4R63A 4DSIA 4IQWA 1KDHA 3KHHA 2NO5A 4ED8A 3SQIA 3Q8LA 5AKYA 4KLMA 3CRXA 3RR7A 1WWVA 4O3OA 3SV4A 5J2HA 1X9XA 1X66A 1L3VA 1DRGA 3TAPA 4O3MA 2RDIA 5J0YA 1TE2A 2KZZA 1ZD4A 1NJWA 2W7PA 2R8KA 2HBLA 4Z6FA 4M04A 2WAQF 2KFNA 5KAIU 4NL9C 4NLKA 5HHIA 1A6SA 5ALQA 3IM1A 4OJ5A 1COOA 3AMZA 1X9WA 2PFOA 3AEVA 1A0PA 5JTIA 4P0PB 1DK2A 1KBUA 5J2GA 4G3IA 5AHXA 2EANA 3PY8A 3BQ7A 5J2CA 4NM2A 4F4WA 4WJ3B 2H3FA 4F4YA 4IQTA 5KFGA 4DL7A 8ICIA 8ICQA 4IR9A 2EQYA 4F5RA 4F50A 2F76X 4BXOB 1ZQBA 1RG6A 3BQ2A 3F2BA 4F72A 4CDGA 5F9LA 3SEIA 1NZBA 3BQ1A 4U7CA 9ICRA 4QWAA 2ZIXB 3BS5A 2ES6A 3HKZC 3HRDD 4IQVA 3ZDBA 4YG2A 1K1QA 5AK4A 1QQ7A 2YMMA 1PK3A 3KHRA 3SAHA 4NLNA 3E2EA 1N48A 3WKCA 2K4IA 5ALJA 3EYZA 1L7NA 3JPQA 2LHTA 4DQIA 4KN7A 9ICHA 4QJFB 3PMNA 2AQ0A 1Q3VA 2YB4A 4Q44A 5AIBA 2VA3A 4QZ8A 1L3TA 1RZTA 8ICJA 5AKIA 5G5HA 2DUYA 2PI5A 3PW7A 3QUQA 2F1IA 4ECSA 2W11A 3NTUA 3RRHA 5DG9A 3BQ0A 4J9MA 4QZ9A 3MR2A 3ETLA 5KAFU 2OHFA 5KFBA 2FPMA 2QARB 2B6GA 1KN5A 4O3QA 2HI0A 4IRCA 4NL9A 2VA2A 4B9TA 4JMUA 2YN4A 3FAHA 4RQ5A 3NGDA 1TFRA 5GTIU 1A76A 1TAUA 1S77D 4DQPA 9ICNA 2L5YA 4LZGA 4GXJA 5KFCA 2PI4A 5CRXA 4FZMA 5IIIA 4XUSA 3VC8A 3EZ5A 2ASDA 3KZIU 8ICHA 2H5XA 1SWWA 2P6UA 5F9NA 2BHNA 3TACB 1ZQFA 7ICIA 1O08A 2KJ8A 2HBMA 3H8WA 1FFVA 4EYIB 3V72A 1UPHA 4LVSA 5G5GA 4KLFA 1X2IA 4C80A 4NM1A 1SWVA 2D8CA 4Y2SA 1IXRA 4B9NA 3HILA 5EOZA 3PW2A 5J0PA 4R66A 2P66A 3GFKB 5DB9A 2ODGA 8ICBA 8ICKA 2ZUBA 2DFLA 3HW8A 1FFUA 1L3SA 2ZIWA 4M6WA 2HHWA 1L3UA 2D6FC 2ZXIA 1H38A 4BWJA 1D9DA 5T14A 2H3ZA 3K1ZA 3ISBA 3I1YA 7ICLA 2KHVA 2KE7A 4DOBA 2I6XA 2FMPA 1ZQOA 4UQGA 5JUMA 1QLNA 3THVA 1ZQLA 4M9LA 4KTQA 2E8NA 3L5KA 2WHEA 1BNOA 2HHXA 3BDPA 4Z6EA 5AICA 4UAYA 2G08A 3MGIA 3TQ1A 4NLBA 1YZ6A 5KG6A 1KFDA 1S8OA 1L5UA 5KG3A 2BCVA 5ALZA 3PW0A 2ZJ5A 3K1RB 3GZFA 2W9BB 4ECVA 1LB2B 3AU6A 2W8KA 4YD1A 2BR0A 5DDYA 5KG4A 1KRPA 1KLNA 3MDCA 2W3SA 2JGAA 4RUAA 2IMWP 4KLOA 2Y1JA 3ALRA 2V4RA 2W8LA 2DKZA 2AH5A 4I27A 5KFYA 4BWMA 4F5OA 3SZ2A 1SXDA 2XY7A 1VLBA 2XICA 1L6NA 2KTQA 1DGJA 2AXTU 1RXWA 8ICGA 4O5KA 2KHQA 3RBDA 1IG6A 2MA1A 3HX0A 5ALWA 4DWIA 4RPZA 4YR0A 3OJUA 2F2AB 3PR4A 1QCKA 1XNSA 1ZQIA 5JRTA 2YTUA 4LZDA 4RPXA 4C8LA 5JU5A 5DQHA 3CW2C 1HUOA 7ICSA 4UB6U 3UQ0A 4Y2UA 2FLLA 1X9SA 5KFAA 1F5SA 5D49A 1X6JA 2QB0B 1BPBA 5IIMA 3KBBA 4NLCA 4KX5A 2HBJA 3MGHA 3WK5A 3M9MB 9ICKA 4QZIA 5ALOA 4I2IA 2OCEA 2JH1A 3F2DA 2W9AA 1Z3EB 4ACOA 4M9JA 1MN8A 4DSEA 3B0XA 5B5EU 3RBEA 2ZIUB 1JIHA 9ICVA 5F3XB 5ALXA 3TFRA 2W04A 2A1JA 1ZJNA 2R8JA 4P0QB 5KFXA 2WF5A 3N97B 1ZRNA 1LKYA 3NUQA 1ZJMA 1IM4A 2V9WA 9ICQA 2JH7A 5ALEA 1U9LA 4I2DA 4K4HA 2EH9A 2D3DA 1ZQDA 9ICWA 4CF4A 3I76A 4PHDA 3PSIA 1UT8A 1XSNA 5KFUA 2ALZA 5EWEA 5FP0A 1QQ6A 1N61A 5KT5A 1NK5A 3MR6A 1K5OA 3C2MA 4PPXA 1QQ5A 4RQ1A 1ZQUA 3WKBA 2R8GA 1ZQZA 2ZTCA 3T79A 8ICXA 2E8PA 2QKQA 2MSNA 3RH6A 3OJSA 3QUCA 3SENA 4JV2A 2LBOA 1ZQSA 1N2XA 1T4GA 4ECWA 2KN7A 4DLGA 1XS9D 1XO1A 2JZBB 1P7DA 4DF8A 4OO1J 1JROA 4JB3A 5ALYA 4DEZA 1V38A 3PSPA 2NRWA 2XI9A 4FZNA 4JV1A 4O5EA 1T8EA 4EEKA 2IOFK 2J6SA 5L1LA 9ICSA 2DGZA 4MF2A 8ICFA 5GTHU 5ALLA 4MHVA 5ALDA 4TUPA 2XO7A 3ZDEA 1DK3A 5KL8B 2E8OA 2FPLA 5J0WA 3K4GA 2HHUA 4KLHA 5EE9A 2F1HA 3PO4A 1S0MA 4C8MA 9ICXA 3C5GA 2W9CB 5L1IA 5DGAA 3OPXA 4DFMA 1NKBA 2HHSA 4RUCA 5CJ7A 4YMOA 1NJYA 2I1QA 4Y2XA 4P2HA 4BX9C 3SD7A 1KFTA 1ECWA 3SV3A 1RYRA 3PX0A 1L7OA 1Z1VA 5AI5A 1QH9A 4DFPA 3Q8MA 4FS2A 1KFSA 4P4MA 2ZXHA 2UVRA 3KOOA 2XVTA 4IS7A 4CRXA 5CP2A 1HJPA 1M6YA 3KHGA 4F4ZA 5KG1A 3Q8KA 3QZ8A 3M6KA 5KFLA 4JWMA 1CUKA 4EX6A 4AYBC 3IN5A 4Y2PA 1IV8A 4YFKA 4ED2A 7ICOA 2ESEA 9ICEA 3FC4A 1KEJA 1RYUA 1U49A 2HOIA 1V97A 2F1JA 2F77X 2NRXA 4CCHA 1QSLA 2IBKA 4QZFA 1SZPA 5J0RA 4KLGA 3NVVA 3T5KA 2LYHA 2UVVA 4PL1A 1LVHA 2KJ9A 5DB6A 1RDFA 3AN1A 2ZTDA 1RXVA 4RQ4A 4DO9A 7ICHA 3EPGA 5AKJA 4DQQA 4O3PA 2DL0A 5AI9A 1RYSA 3N4MB 1WCNA 5CEHA 5DLFA 5HHHA 4USAA 8ICRA 2V4QA 1XSLA 4DQSA 4JWNA 1JRPA 4QZEA 3SAFA 2GH1A 1UA0A 1XC9A 4RPYA 3EWAA 4U6PA 5KT3A 5IIKA 2EZXA 4RNMA 1BGXT 4Y2YA 3OSNA 5DB7A 1BVSA 3QU7A 2Y0SF 2XCPA 4LJXA 2K4HA 4F5QA 1ZQJA 2XIDA 1HEKA 3OHBA 4TUSA 1D8YA 5HNKA 4UASA 5AK5A 3GV8B 4JK1A 5DLGA 2LM4A 1B0XA 3Q8SB 2VJ5A 3Q8QB 2EAOA 4EZ6A 4Y2TA 4KMOB 3L3FX 3SR6A 7ICPA 4KLQA 1JX4A 4YD2A 4RZRA 4CE6A 1JUDA 3LVVA 5KFIA 1HUZA 5L1JA 3C2KA 2H3VA 1ZOLA 4FS1A 4I2AA 5ALFA 4B9LA 3K75D 3RTVA 3T5HA 4QW8A 4C7YA 3Q8PB 2KP7A 3TANA 2W7OA 2PXIA 1A77A 4J9SA 2VA8A 5J2AA 2ZJAA 1PZNA 4F4XA 4DLEA 4M2YA 2BPGA
chains in the Genus database with same CATH topology
2FJ6A 2KVSA 2O6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJ6 A;  2KVS A;  2O6K A; 
#chains in the Genus database with same CATH topology
 2IOH A;  4BJQ A;  2EZZ A;  4YVZ A;  4EEY A;  2G5H B;  4MF8 A;  4OJO A;  4Q45 A;  8ICE A;  1UT5 A;  3N7R C;  2HDO A;  1RQN A;  4GXK A;  4DS4 A;  8ICY A;  3ZDA A;  3OTQ A;  2JRZ A;  1HIW A;  4UAV A;  3ONN A;  2WF8 A;  5C5J A;  1ZQK A;  2NRV A;  4QIW F;  3PSF A;  1L8O A;  4P4O A;  3V7J A;  1PVR A;  1OUQ A;  4Y2Q A;  5J0U A;  3LK9 A;  4PHE A;  3CNH A;  4ICA A;  1ZQA A;  1L8L A;  1ZQT A;  2YMP A;  3V7K A;  4FBT A;  3IV6 A;  3UPQ A;  5KFK A;  7ICE A;  1RQL A;  1DGS A;  4GFJ A;  3ISC A;  2WF6 A;  1UQV A;  3ORY A;  4UAT A;  2E1F A;  4KN4 A;  2BCR A;  5AKZ A;  2F3N A;  2KK0 A;  3GQC A;  2DPI A;  2AJQ A;  2LYA A;  2M0N A;  2C22 A;  2JR5 A;  2YMQ A;  1QTM A;  2KKP A;  1FIQ A;  2JEG A;  2AGO A;  3H8S A;  2HOF A;  4ELU A;  3EW9 A;  3ZI4 A;  2HVH A;  1S0V A;  3KKA C;  4J9Q A;  1ZD2 P;  2PMZ C;  5ALT A;  3M7D A;  1D8L A;  3PW5 A;  1BPD A;  2YQE A;  3QEA Z;  5KFW A;  3KHL A;  3B0Y A;  5C0Y A;  9ICM A;  3V6J A;  2KG5 A;  2ZIW B;  2HHQ A;  4M6W B;  4PZN A;  4ECX A;  5KG5 A;  3D2Q A;  4R8U A;  5AKX A;  5EWF A;  2W03 A;  3GU3 A;  5AI0 A;  1NNL A;  4R64 A;  5KFR A;  2OWO A;  4B9V A;  2FJ6 A;  1UCV A;  2LPE A;  3MR3 A;  2AGP A;  1PK1 A;  3O0F A;  4ELT A;  1JXE A;  3IHQ B;  4YXJ A;  2XCA A;  2C2D A;  3U26 A;  1D8B A;  2GWS A;  3HJE A;  2G5I B;  2BCU A;  4IR1 A;  2WAQ C;  3GIK A;  1ZQY A;  3A0B U;  5AM2 A;  5EE0 A;  2KOB A;  2J6U A;  3ZD9 A;  2PKE A;  2VAN A;  1MA7 A;  2LI6 A;  5J2F A;  1COK A;  1SV4 A;  4NLG A;  1OW5 A;  3NRZ A;  2KVC A;  4FO6 A;  2BQ3 A;  2DBY A;  2IOF A;  3OHA A;  4M9H A;  3H0M B;  3ISD A;  2PFP A;  4DL6 A;  1SGG A;  3M1Y A;  5J2E A;  8ICC A;  5KFM A;  4QWD A;  5AI6 A;  3G6X A;  4Q43 A;  2BPF A;  2Y9T A;  1NK4 A;  2NRT A;  4KLI A;  5AKG A;  2W9B A;  2M9N A;  4J9O A;  2KZ3 A;  3WK6 A;  4YP3 A;  5CWR A;  3UXP A;  2RDJ A;  5DDM A;  1RM6 C;  5BPC A;  2XY6 A;  2P6R A;  4CGZ A;  4OJL A;  5J0O A;  1T94 A;  5D46 A;  2ZJ8 A;  4M9G A;  2K8B B;  4K4G A;  3R9K A;  1PVQ A;  1U45 A;  3IP4 B;  2AGQ A;  4J9K A;  2J6T A;  2KIC A;  1KQQ A;  1ZQ1 C;  1MQ3 A;  3KKA A;  9ICI A;  4KX3 A;  8ICP A;  2MU2 A;  4UAW A;  5AKH A;  1N60 A;  1TAQ A;  4DSJ A;  3UMG A;  3PR5 B;  1X9M A;  4F93 B;  5K4L A;  4PGX A;  2G07 A;  5AM5 A;  3G6V A;  1Z1B A;  4RNN A;  2FMQ A;  3H7I A;  5DBC A;  3C1Z A;  4TQS A;  3RJH A;  1F44 A;  2K89 A;  3HT3 A;  3RR8 A;  4B6J A;  3H40 A;  3BZK A;  3I28 A;  4J9N A;  3KZX A;  2E8M A;  3BQT A;  4RQ8 A;  2ASJ A;  5ALP A;  2YX8 A;  4NLZ A;  3J81 j;  4Z6C A;  2BZF A;  1X6I A;  3JPO A;  4IQU A;  3GIM A;  4HYK A;  4YCX A;  7ICR A;  4BUG A;  2A1J B;  1C7Y A;  3RAQ A;  3CP8 A;  2GOL A;  3LVW A;  4M47 A;  3PNC A;  1LKY B;  4C4T A;  3IG5 A;  1S76 D;  5ALH A;  4DSK A;  5KFQ A;  1U48 A;  2W55 A;  4QWC A;  2HMX A;  4O9M A;  1NK0 A;  1TVA A;  2ZIU A;  4EEN A;  1TV9 A;  3RRG A;  8ICL A;  2ATL A;  4RU9 A;  5IIO A;  1ZQN A;  1IIP A;  2OXO A;  1TKD A;  2E3T A;  2G0A A;  1ZQV A;  1ZYQ A;  1ZQH A;  2IHM A;  5ALV A;  5AKE A;  2XGP A;  4YN4 A;  1JI7 A;  3A0H U;  1ZQX A;  3BJY A;  3C28 A;  4IRD A;  5ALK A;  1ZQG A;  5J2I A;  5J2J A;  1TK5 A;  2PFN A;  2ASL A;  4F2S A;  1L7P A;  3NS1 A;  2EAP A;  4NXZ A;  9ICP A;  2KSO A;  3M8R A;  1ZQC A;  4UAR A;  1AQ6 A;  2G06 A;  2BQU A;  4QWB A;  3H4B A;  3LWL A;  4MFC A;  2A19 A;  4PHA A;  4I28 A;  1SB3 C;  4ELV A;  2R18 A;  7ICF A;  3F5A A;  5KT6 A;  1KKX A;  1MSW D;  5ALS A;  4PL2 A;  1N5X A;  2CPR A;  2RLT A;  3HKZ F;  4OCZ A;  4F5N A;  1S97 A;  1XWL A;  4ED0 A;  1MQ2 A;  2NV3 A;  3PX6 A;  1QSS A;  2H3I A;  9ICT A;  4US9 A;  3AUO A;  3C2L A;  1MC8 A;  4YXM A;  1SL1 A;  5ALN A;  5EWG A;  4C7Z A;  1N63 A;  5KT2 A;  7ICT A;  3D6J A;  3OSP A;  4G9B A;  5KFO A;  2I5H A;  3QU5 A;  4ECZ A;  3PW4 A;  4RT3 A;  4RT2 A;  5J2D A;  4BDP A;  1XU4 A;  2HHT A;  3H8J A;  4RQ6 A;  4A8E A;  1BPX A;  2Q4T A;  4C8O A;  4ECY A;  2QB1 A;  2ISO A;  5E79 U;  2BGW A;  5KFN A;  3HP6 A;  2K4E A;  4YMM A;  5J0T A;  4DFK A;  4PZO A;  1Q3U A;  3SAG A;  4Z6D A;  4ECQ A;  2RRD A;  4UB4 A;  2W9C A;  4PGY A;  2JEI A;  4ED6 A;  5ALI A;  5ALR A;  8ICN A;  1SL2 A;  1TAM A;  2BDU A;  5AIA A;  4RQ2 A;  3NRW A;  1OXJ A;  2EDU A;  5A0L A;  5KNI A;  2ZIV A;  2G09 A;  5HR6 A;  3RJK A;  3RJJ A;  2ZUC A;  1Y88 A;  3RH5 A;  1WWU A;  4RQ7 A;  3HPO A;  1Z00 B;  2KIW A;  1NZP A;  3QU2 A;  2MUT A;  9ICL A;  3RJE A;  4B9S A;  2R8H A;  4M9N A;  2VJ4 A;  2ZUD A;  4QNL A;  4Y2J A;  3AL0 B;  1T3Q A;  2UVU A;  3M6Z A;  4NY8 A;  9ICC A;  3QUT A;  2KMD A;  2F8K A;  1ZQW A;  4X5V A;  4QZH A;  3PST A;  5HML A;  5KFF A;  5ALG A;  5KFJ A;  1ED1 A;  5AKK A;  4J03 A;  3AU2 A;  4RQ3 A;  3RAX A;  3RB0 A;  9ICF A;  1N62 A;  1S9F A;  1NKC A;  5BOM A;  4I2F A;  2N1R A;  4UAU A;  3ZD8 A;  4US8 A;  5AM4 A;  1ZQR A;  4KLD A;  4YR3 A;  1NK6 A;  3GV5 B;  4F91 B;  3UMC A;  3WKE A;  1NOM A;  3RB6 A;  3WK7 A;  3VCB A;  2DWQ A;  4KLE A;  8ICU A;  3WKA A;  2Q0Z X;  5J0S A;  4QZC A;  2WB1 F;  3GV7 B;  5HR7 A;  5KL1 B;  2AHO B;  3RB3 A;  3MFI A;  4B9U A;  5IIL A;  3WU2 U;  5J29 A;  3BS7 A;  2KIV A;  4BGD A;  2FMS A;  5L1K A;  3N7P D;  3N28 A;  1NKE A;  1NI3 A;  4FFD A;  4Q8E A;  1V85 A;  3TFS A;  4ED3 A;  4O0I A;  4QZG A;  2FI1 A;  3QNM A;  2B21 A;  2DF4 B;  2BCQ A;  3RJI A;  5KFT A;  5DBB A;  2HW3 A;  2NO4 A;  3T5L A;  2K60 A;  1TK0 A;  4MFF A;  3LWM A;  3CYM A;  1U47 A;  1J2M A;  3FDS A;  3GIJ A;  4F4K A;  3UXN A;  4P0P A;  5J8Y C;  1S0O A;  3EPI A;  5KG0 A;  4CF5 A;  1S0N A;  4C4S A;  1B22 A;  4RQM A;  1JMS A;  2ISP A;  3TAD C;  1SL0 A;  3BS5 B;  1ZQP A;  3TI0 A;  1KL9 A;  3ZDC A;  7ICG A;  3M9N B;  3RH4 A;  3V6K A;  2AQ4 A;  3HWT A;  1SZH A;  3JPT A;  3SYZ A;  1DXS A;  4ZH4 A;  4BXO A;  1SKW A;  4IL6 U;  4UAZ A;  2GO7 A;  4NWI A;  4FBU A;  4UB1 A;  4C4R A;  2ZIX A;  3E0F A;  1WYG A;  2YB1 A;  2IHN A;  3JPS A;  3FM9 A;  3OGU A;  4PH5 A;  5DKW A;  3QYP A;  5TZV A;  2CRX A;  1V9P A;  4UW9 A;  2WFA A;  3H8M A;  2C2R A;  1J97 A;  3G6Y A;  1CRX A;  2JHD A;  2ZTE A;  4ECT A;  9ICB A;  4KIT B;  3GDX A;  4O3S A;  4KLL A;  4UB2 A;  5KFE A;  1SXE A;  4J9L A;  2ZG6 A;  8ICA A;  3RF9 A;  1K1S A;  3UXO A;  1S10 A;  4GIB A;  4DL2 A;  1WUD A;  4F8R A;  5D4B A;  4UB3 A;  3JPR A;  7ICV A;  2B0C A;  5IIJ A;  3DDH A;  3QUB A;  2JV3 A;  1BPE A;  2QAR A;  5KG7 A;  3H0R B;  2W3R A;  4I2E A;  2K8C B;  3QX7 A;  1X42 A;  3M9O B;  1Z4O A;  3IG8 A;  5KFD A;  5J2B A;  1C20 A;  4NV0 A;  2DPJ A;  1DOQ A;  4R65 A;  4UBB A;  2BPC A;  3TAR A;  5TIS U;  2RP5 A;  2IA6 A;  4EEL A;  2PFQ A;  2GLE A;  4DF4 A;  1JN3 A;  1LV5 A;  1F0M A;  5H2F U;  1B43 A;  4K4I A;  8ICT A;  5J8Y A;  1FEZ A;  2VIX A;  4PGQ A;  1L7M A;  1BPZ A;  5AM1 A;  3SI8 A;  4Y2V A;  5DB8 A;  3WKD A;  1D9F A;  5L9X A;  3TAD A;  2HVI A;  3JPN A;  5HP4 A;  2C28 A;  5KT4 A;  4F5P A;  4KLS A;  3GIL A;  3NVW A;  9ICG A;  1JXL A;  3C1Y A;  4DFJ A;  3T5J A;  4DQR A;  4R8U B;  7ICM A;  7ICK A;  2JEF A;  5AI8 A;  2R8I A;  3C21 A;  4EYH B;  8ICO A;  2P35 A;  5KTQ A;  3WK9 A;  5B66 U;  4EBE A;  1T7P A;  1YZ7 A;  4F92 B;  5KFH A;  2JEJ A;  1B4F A;  9ICO A;  4EX7 A;  2F8L A;  7ICN A;  2WTF A;  3UM9 A;  3ZDD A;  2XY5 A;  1VDV A;  1PK1 B;  1JAL A;  2Y1I A;  4MEY A;  4O3N A;  1KTQ A;  1N56 A;  4TUQ A;  3WK8 A;  4UBC A;  4C8K A;  3PVX A;  9ICJ A;  5ALU A;  3F53 A;  1UA1 A;  2EZY A;  2HSZ A;  2WB1 C;  4TQR A;  2I9G A;  8ICS A;  4I29 A;  2Y0S C;  2WF9 A;  1ZXI A;  1SV0 C;  2K8A A;  4YR2 A;  5KFZ A;  3M8S A;  1KW4 A;  2KKV A;  1NJZ A;  4QWE A;  5DG7 A;  3C5F A;  4TUR A;  4UB5 A;  4NJ8 A;  3TKA A;  3C29 A;  5AM0 A;  8ICV A;  1PVP A;  4KLU A;  1XO0 A;  4GC6 A;  2KJ5 A;  4J9R A;  3ICX A;  3QEB Z;  2Z7J A;  4CF3 A;  2LYB A;  4JUZ A;  3GII A;  4GC7 A;  8ICM A;  3RB4 A;  2E1E A;  9ICA A;  3PV8 A;  2KD1 A;  2MAX A;  3MBY A;  1EXN A;  7ICQ A;  2K4P A;  4EZ9 A;  1WCL A;  2BQR A;  5J2K A;  4DCC A;  4AYB F;  8ICW A;  2LMR A;  3NVY A;  2HHV A;  4HAI A;  5HMM A;  2XC9 A;  4XA5 A;  4PJ0 U;  2FLN A;  1N5W A;  4DL5 A;  2QLT A;  1NK9 A;  1BNP A;  1QSY A;  3QU9 A;  5DQG A;  2W9M A;  3RJG A;  5IIN A;  3NVZ A;  2CN1 A;  2NRZ A;  4UB8 U;  3T3F A;  7ICU A;  4DSF A;  3KTQ A;  4QZD A;  3PZP A;  4XRH A;  5CA7 A;  4QZB A;  2LM1 A;  5KFP A;  3WK4 A;  4OJP A;  4F2R A;  2OYY A;  2RQ5 A;  3V7L A;  5ALM A;  4RNO A;  4C0Z A;  2JMG A;  1ZET A;  1YT3 A;  4MFA A;  4FE3 A;  1ZD3 A;  4DSL A;  3AQF A;  3LDA A;  4ECU A;  2QB0 A;  2BDP A;  3H0L B;  1PUZ A;  4F71 A;  2E5S A;  4QIW C;  1Z19 A;  4Q8F A;  1ZD5 A;  3KFU F;  5EE1 A;  1FO4 A;  1Z4N A;  2XGQ A;  4JV0 A;  2BCS A;  4DL4 A;  2AU0 A;  4I2C A;  5AK3 A;  1RPL A;  2F44 A;  4PHP A;  1SIJ A;  4ED7 A;  2VKQ A;  1SV0 A;  2KV2 A;  3MC1 A;  3SMV A;  4DFD A;  3IRU A;  2H3Q A;  4KLJ A;  4E0D A;  5DQI A;  4AP9 A;  4DOC A;  2KEY A;  4I2B A;  1CEZ A;  8ICZ A;  2MRL A;  7ICJ A;  4DS5 A;  3ETR A;  2CXY A;  2NYV A;  1S5L U;  2C2E A;  3DEE A;  4XQ8 A;  3QE9 Y;  3UQ2 A;  4P0Q A;  1ARO P;  4OD0 A;  5AM3 A;  3EUB 2;  4GLX A;  2HBK A;  5CB1 A;  3F2C A;  3PML A;  2WF7 A;  5AK6 A;  1Q46 A;  3MGV A;  5KFV A;  1ZRM A;  4Y2R A;  2W43 A;  1J2N A;  5DG8 A;  1BPY A;  2KSO B;  2FDR A;  3C23 A;  4RQ0 A;  4O3R A;  4IRK A;  2Y9U A;  5KFS A;  3MAB A;  4FZL A;  3JPP A;  4GXI A;  2RHF A;  5KG2 A;  4OJ6 A;  5J0Q A;  2FPK A;  4J9P A;  2DQN B;  4QZA A;  4I2J A;  5L1M A;  4I2H A;  4CNQ A;  3E58 A;  4ECR A;  3B9J A;  3NAS A;  3S6J A;  4YQW A;  3IDW A;  5CHG A;  1NK7 A;  3QXG A;  2A1A A;  4YMN A;  5AI4 A;  1T3N A;  4P4P A;  2JZB A;  1VJ5 A;  4O5C A;  2OM6 A;  3MDA A;  2HCF A;  3D2S A;  1SKS A;  4F3O A;  3H4D A;  1ZQE A;  2YML A;  3N7S C;  3Q8R B;  1TK8 A;  5EE3 A;  1NJX A;  5AKL A;  4DL3 A;  4B9M A;  4C8N A;  3MR5 A;  4RQN A;  5CR0 A;  5J0X A;  5DGB A;  3MFH A;  2LKY A;  1XSP A;  9ICU A;  4EBD A;  4EBC A;  3DV9 A;  3PX4 A;  2O6K A;  1U4B A;  3F5E A;  3FYH A;  2FLP A;  2DKX A;  3BZC A;  4ZOH C;  2JXJ A;  2W54 A;  3AQE A;  1ZQQ A;  1URJ A;  1X40 A;  1Q8K A;  3PO5 A;  2ZIV B;  1SKR A;  3LYS A;  3TAQ A;  3KD3 A;  1O03 A;  2KFZ A;  2EAM A;  3QZ7 A;  2KZM A;  4DOA A;  4KLT A;  1CI4 A;  2UVW A;  3D2N A;  2MUT B;  3RJF A;  2OEH A;  1UHU A;  2HOQ A;  2FE9 A;  3V6H A;  3AM9 A;  2OH2 A;  5DBA A;  3ED5 A;  2YY6 A;  1KSP A;  2BKE A;  4KMU A;  4QW9 A;  4I2G A;  2A3V A;  4IC9 A;  5BOL A;  5KT7 A;  2KNJ A;  1Z00 A;  1NK8 A;  3L4P A;  1ZQM A;  3RFA A;  3UMB A;  4MEX A;  1GO3 F;  4ED1 A;  2PMZ F;  1WG8 A;  3QU4 A;  2KVS A;  4M0A A;  4R63 A;  4DSI A;  4IQW A;  1KDH A;  3KHH A;  2NO5 A;  4ED8 A;  3SQI A;  3Q8L A;  5AKY A;  4KLM A;  3CRX A;  3RR7 A;  1WWV A;  4O3O A;  3SV4 A;  5J2H A;  1X9X A;  1X66 A;  1L3V A;  1DRG A;  3TAP A;  4O3M A;  2RDI A;  5J0Y A;  1TE2 A;  2KZZ A;  1ZD4 A;  1NJW A;  2W7P A;  2R8K A;  2HBL A;  4Z6F A;  4M04 A;  2WAQ F;  2KFN A;  5KAI U;  4NL9 C;  4NLK A;  5HHI A;  1A6S A;  5ALQ A;  3IM1 A;  4OJ5 A;  1COO A;  3AMZ A;  1X9W A;  2PFO A;  3AEV A;  1A0P A;  5JTI A;  4P0P B;  1DK2 A;  1KBU A;  5J2G A;  4G3I A;  5AHX A;  2EAN A;  3PY8 A;  3BQ7 A;  5J2C A;  4NM2 A;  4F4W A;  4WJ3 B;  2H3F A;  4F4Y A;  4IQT A;  5KFG A;  4DL7 A;  8ICI A;  8ICQ A;  4IR9 A;  2EQY A;  4F5R A;  4F50 A;  2F76 X;  4BXO B;  1ZQB A;  1RG6 A;  3BQ2 A;  3F2B A;  4F72 A;  4CDG A;  5F9L A;  3SEI A;  1NZB A;  3BQ1 A;  4U7C A;  9ICR A;  4QWA A;  2ZIX B;  3BS5 A;  2ES6 A;  3HKZ C;  3HRD D;  4IQV A;  3ZDB A;  4YG2 A;  1K1Q A;  5AK4 A;  1QQ7 A;  2YMM A;  1PK3 A;  3KHR A;  3SAH A;  4NLN A;  3E2E A;  1N48 A;  3WKC A;  2K4I A;  5ALJ A;  3EYZ A;  1L7N A;  3JPQ A;  2LHT A;  4DQI A;  4KN7 A;  9ICH A;  4QJF B;  3PMN A;  2AQ0 A;  1Q3V A;  2YB4 A;  4Q44 A;  5AIB A;  2VA3 A;  4QZ8 A;  1L3T A;  1RZT A;  8ICJ A;  5AKI A;  5G5H A;  2DUY A;  2PI5 A;  3PW7 A;  3QUQ A;  2F1I A;  4ECS A;  2W11 A;  3NTU A;  3RRH A;  5DG9 A;  3BQ0 A;  4J9M A;  4QZ9 A;  3MR2 A;  3ETL A;  5KAF U;  2OHF A;  5KFB A;  2FPM A;  2QAR B;  2B6G A;  1KN5 A;  4O3Q A;  2HI0 A;  4IRC A;  4NL9 A;  2VA2 A;  4B9T A;  4JMU A;  2YN4 A;  3FAH A;  4RQ5 A;  3NGD A;  1TFR A;  5GTI U;  1A76 A;  1TAU A;  1S77 D;  4DQP A;  9ICN A;  2L5Y A;  4LZG A;  4GXJ A;  5KFC A;  2PI4 A;  5CRX A;  4FZM A;  5III A;  4XUS A;  3VC8 A;  3EZ5 A;  2ASD A;  3KZI U;  8ICH A;  2H5X A;  1SWW A;  2P6U A;  5F9N A;  2BHN A;  3TAC B;  1ZQF A;  7ICI A;  1O08 A;  2KJ8 A;  2HBM A;  3H8W A;  1FFV A;  4EYI B;  3V72 A;  1UPH A;  4LVS A;  5G5G A;  4KLF A;  1X2I A;  4C80 A;  4NM1 A;  1SWV A;  2D8C A;  4Y2S A;  1IXR A;  4B9N A;  3HIL A;  5EOZ A;  3PW2 A;  5J0P A;  4R66 A;  2P66 A;  3GFK B;  5DB9 A;  2ODG A;  8ICB A;  8ICK A;  2ZUB A;  2DFL A;  3HW8 A;  1FFU A;  1L3S A;  2ZIW A;  4M6W A;  2HHW A;  1L3U A;  2D6F C;  2ZXI A;  1H38 A;  4BWJ A;  1D9D A;  5T14 A;  2H3Z A;  3K1Z A;  3ISB A;  3I1Y A;  7ICL A;  2KHV A;  2KE7 A;  4DOB A;  2I6X A;  2FMP A;  1ZQO A;  4UQG A;  5JUM A;  1QLN A;  3THV A;  1ZQL A;  4M9L A;  4KTQ A;  2E8N A;  3L5K A;  2WHE A;  1BNO A;  2HHX A;  3BDP A;  4Z6E A;  5AIC A;  4UAY A;  2G08 A;  3MGI A;  3TQ1 A;  4NLB A;  1YZ6 A;  5KG6 A;  1KFD A;  1S8O A;  1L5U A;  5KG3 A;  2BCV A;  5ALZ A;  3PW0 A;  2ZJ5 A;  3K1R B;  3GZF A;  2W9B B;  4ECV A;  1LB2 B;  3AU6 A;  2W8K A;  4YD1 A;  2BR0 A;  5DDY A;  5KG4 A;  1KRP A;  1KLN A;  3MDC A;  2W3S A;  2JGA A;  4RUA A;  2IMW P;  4KLO A;  2Y1J A;  3ALR A;  2V4R A;  2W8L A;  2DKZ A;  2AH5 A;  4I27 A;  5KFY A;  4BWM A;  4F5O A;  3SZ2 A;  1SXD A;  2XY7 A;  1VLB A;  2XIC A;  1L6N A;  2KTQ A;  1DGJ A;  2AXT U;  1RXW A;  8ICG A;  4O5K A;  2KHQ A;  3RBD A;  1IG6 A;  2MA1 A;  3HX0 A;  5ALW A;  4DWI A;  4RPZ A;  4YR0 A;  3OJU A;  2F2A B;  3PR4 A;  1QCK A;  1XNS A;  1ZQI A;  5JRT A;  2YTU A;  4LZD A;  4RPX A;  4C8L A;  5JU5 A;  5DQH A;  3CW2 C;  1HUO A;  7ICS A;  4UB6 U;  3UQ0 A;  4Y2U A;  2FLL A;  1X9S A;  5KFA A;  1F5S A;  5D49 A;  1X6J A;  2QB0 B;  1BPB A;  5IIM A;  3KBB A;  4NLC A;  4KX5 A;  2HBJ A;  3MGH A;  3WK5 A;  3M9M B;  9ICK A;  4QZI A;  5ALO A;  4I2I A;  2OCE A;  2JH1 A;  3F2D A;  2W9A A;  1Z3E B;  4ACO A;  4M9J A;  1MN8 A;  4DSE A;  3B0X A;  5B5E U;  3RBE A;  2ZIU B;  1JIH A;  9ICV A;  5F3X B;  5ALX A;  3TFR A;  2W04 A;  2A1J A;  1ZJN A;  2R8J A;  4P0Q B;  5KFX A;  2WF5 A;  3N97 B;  1ZRN A;  1LKY A;  3NUQ A;  1ZJM A;  1IM4 A;  2V9W A;  9ICQ A;  2JH7 A;  5ALE A;  1U9L A;  4I2D A;  4K4H A;  2EH9 A;  2D3D A;  1ZQD A;  9ICW A;  4CF4 A;  3I76 A;  4PHD A;  3PSI A;  1UT8 A;  1XSN A;  5KFU A;  2ALZ A;  5EWE A;  5FP0 A;  1QQ6 A;  1N61 A;  5KT5 A;  1NK5 A;  3MR6 A;  1K5O A;  3C2M A;  4PPX A;  1QQ5 A;  4RQ1 A;  1ZQU A;  3WKB A;  2R8G A;  1ZQZ A;  2ZTC A;  3T79 A;  8ICX A;  2E8P A;  2QKQ A;  2MSN A;  3RH6 A;  3OJS A;  3QUC A;  3SEN A;  4JV2 A;  2LBO A;  1ZQS A;  1N2X A;  1T4G A;  4ECW A;  2KN7 A;  4DLG A;  1XS9 D;  1XO1 A;  2JZB B;  1P7D A;  4DF8 A;  4OO1 J;  1JRO A;  4JB3 A;  5ALY A;  4DEZ A;  1V38 A;  3PSP A;  2NRW A;  2XI9 A;  4FZN A;  4JV1 A;  4O5E A;  1T8E A;  4EEK A;  2IOF K;  2J6S A;  5L1L A;  9ICS A;  2DGZ A;  4MF2 A;  8ICF A;  5GTH U;  5ALL A;  4MHV A;  5ALD A;  4TUP A;  2XO7 A;  3ZDE A;  1DK3 A;  5KL8 B;  2E8O A;  2FPL A;  5J0W A;  3K4G A;  2HHU A;  4KLH A;  5EE9 A;  2F1H A;  3PO4 A;  1S0M A;  4C8M A;  9ICX A;  3C5G A;  2W9C B;  5L1I A;  5DGA A;  3OPX A;  4DFM A;  1NKB A;  2HHS A;  4RUC A;  5CJ7 A;  4YMO A;  1NJY A;  2I1Q A;  4Y2X A;  4P2H A;  4BX9 C;  3SD7 A;  1KFT A;  1ECW A;  3SV3 A;  1RYR A;  3PX0 A;  1L7O A;  1Z1V A;  5AI5 A;  1QH9 A;  4DFP A;  3Q8M A;  4FS2 A;  1KFS A;  4P4M A;  2ZXH A;  2UVR A;  3KOO A;  2XVT A;  4IS7 A;  4CRX A;  5CP2 A;  1HJP A;  1M6Y A;  3KHG A;  4F4Z A;  5KG1 A;  3Q8K A;  3QZ8 A;  3M6K A;  5KFL A;  4JWM A;  1CUK A;  4EX6 A;  4AYB C;  3IN5 A;  4Y2P A;  1IV8 A;  4YFK A;  4ED2 A;  7ICO A;  2ESE A;  9ICE A;  3FC4 A;  1KEJ A;  1RYU A;  1U49 A;  2HOI A;  1V97 A;  2F1J A;  2F77 X;  2NRX A;  4CCH A;  1QSL A;  2IBK A;  4QZF A;  1SZP A;  5J0R A;  4KLG A;  3NVV A;  3T5K A;  2LYH A;  2UVV A;  4PL1 A;  1LVH A;  2KJ9 A;  5DB6 A;  1RDF A;  3AN1 A;  2ZTD A;  1RXV A;  4RQ4 A;  4DO9 A;  7ICH A;  3EPG A;  5AKJ A;  4DQQ A;  4O3P A;  2DL0 A;  5AI9 A;  1RYS A;  3N4M B;  1WCN A;  5CEH A;  5DLF A;  5HHH A;  4USA A;  8ICR A;  2V4Q A;  1XSL A;  4DQS A;  4JWN A;  1JRP A;  4QZE A;  3SAF A;  2GH1 A;  1UA0 A;  1XC9 A;  4RPY A;  3EWA A;  4U6P A;  5KT3 A;  5IIK A;  2EZX A;  4RNM A;  1BGX T;  4Y2Y A;  3OSN A;  5DB7 A;  1BVS A;  3QU7 A;  2Y0S F;  2XCP A;  4LJX A;  2K4H A;  4F5Q A;  1ZQJ A;  2XID A;  1HEK A;  3OHB A;  4TUS A;  1D8Y A;  5HNK A;  4UAS A;  5AK5 A;  3GV8 B;  4JK1 A;  5DLG A;  2LM4 A;  1B0X A;  3Q8S B;  2VJ5 A;  3Q8Q B;  2EAO A;  4EZ6 A;  4Y2T A;  4KMO B;  3L3F X;  3SR6 A;  7ICP A;  4KLQ A;  1JX4 A;  4YD2 A;  4RZR A;  4CE6 A;  1JUD A;  3LVV A;  5KFI A;  1HUZ A;  5L1J A;  3C2K A;  2H3V A;  1ZOL A;  4FS1 A;  4I2A A;  5ALF A;  4B9L A;  3K75 D;  3RTV A;  3T5H A;  4QW8 A;  4C7Y A;  3Q8P B;  2KP7 A;  3TAN A;  2W7O A;  2PXI A;  1A77 A;  4J9S A;  2VA8 A;  5J2A A;  2ZJA A;  1PZN A;  4F4X A;  4DLE A;  4M2Y A;  2BPG A; 
#chains in the Genus database with same CATH homology
 2FJ6 A;  2KVS A;  2O6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...