1Z4NA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate cocrystallized with fluoride
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 78
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4nA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4nA01
1RDFA 2R8YA 2Q5EA 3FZQA 3K1ZA 2IYEA 2G80A 5ALEA 3OCWA 4UMVA 2FPXA 3QGMA 4AS3A 2FEAA 2C8KA 1LVHA 1L7NA 2YMMA 4C4TA 3AR6A 2QLTA 1ZRNA 4E88A 1YDFA 2CFSA 3U7HB 4DFDA 5AI6A 5A3SA 4XE5A 3U13A 3RFUA 1RKQA 4HGPA 5AW3A 5AW7A 1RLTA 1EK1A 4J03A 4YCNA 1RKVA 4EZEA 5AI0A 1RQLA 4F72A 5IS2A 3L8GA 1Z4LA 3L8HA 1VFPA 2IOFA 3M1YA 1Z4IA 3P96A 3I1YA 3E84A 2ZG6A 3FM9A 1SU4A 2YMQA 2YMPA 4QJBA 3QYPA 1J97A 2JAOA 4UMDA 3OTQA 5AVYA 5AW1A 4BX0A 4EELA 3MPOA 1L7OA 3W5AA 2RBKA 3NIWA 3I28A 5IT4A 3E81A 3WKDA 4UU0A 1QQ7A 1QYIA 1XPJA 3E8MA 3OCVA 4UW9A 2WFAA 2WF5A 3A3YA 3SMVA 1F5SA 5A3QA 2QYHA 2HF2A 1TA0A 5ALYA 3WKAA 3UMGA 3ZI4A 2YY6A 2I6XA 3ESRA 5AVWA 2OBBA 3OCZA 2MSNA 5AW4A 5AICA 4EX6A 2IA5A 2FPWA 1VJ5A 3KC2A 4CNQA 4XPZA 3L8FA 3KBBA 2G06A 4DCCA 1ZRMA 1J8DA 2AGVA 1Z4JA 1IWOA 3W5CA 2FI1A 5AW9A 2NYVA 4ZEVA 1ZD2P 4EX7A 4BX2A 5AI8A 1RMYA 3N8GA 4Y2XA 5JJBA 3SLRA 3U26A 3HLTA 3L1UA 2ZXEA 3QU4A 4MUMA 2FPRA 3NANA 5AVSA 5AK4A 3U7EB 5AM3A 2Q4TA 3A1EA 5T41A 4HGRA 4EENA 4BNDB 4GIBA 2NO5A 5ALJA 1VJRA 4KYTA 2BDEA 3SHQA 3W5BA 5AW5A 3NUQA 4YGYA 2Q4RA 1WPGA 1TE2A 3D6JA 3CZ4A 4YIKA 1XVIA 1O03A 3AR4A 1Z4OA 2P9JA 4Y2QA 4OHFA 4OCZA 3B9RA 2WF8A 3FPBA 3NASA 2R8XA 3OCYA 1SWVA 1L6RA 3SKXA 5AVTA 1NF2A 2D2VA 3PCTA 2IOFK 1Z88A 3AR9A 2HF7A 1WZCA 4KX5A 4QQFA 4Y2JA 3ZW7A 5AW0A 3ESQA 3ZVNA 3SF0A 2ZBFA 2G09A 1Y8AA 3QUQA 3WGUA 2JARA 2I33A 1L8OA 2I54A 1RMTA 5AKEA 2G1AA 3MMZA 5AKIA 2FPUA 2DQSA 3L0BA 3QLEA 5AM4A 1RC8A 5E0OA 2O9JA 2G0AA 1ZS9A 4HAIA 3KZXA 1MH9A 2HSZA 2WHEA 1Z5GA 5AK6A 2I55A 4CF4A 4DW8A 2RB5A 3WK6A 4BBJA 3WK5A 2WM8A 3WK9A 2PKEA 4Y2UA 4CE6A 2WF9A 5ALIA 1Z4MA 4C4RA 2C9MA 2OA0A 4BNDA 2MU2A 4BX3A 4B6JA 3AR5A 3NAMA 3EF1A 4DWOA 1Z4KA 1RRCA 3ZTWA 3BA6A 4O8CA 3PGLA 3QU9A 5A3RA 3WKEA 1Z4NA 1RMQA 3ZUPA 1S8OA 5AKZA 2ZOSA 2HDOA 3J7TA 1TJ3A 3AR8A 2HX1A 5AK5A 4OD0A 4UAUA 3DDHA 1T5SA 2EARA 5AKXA 4L57A 4NABA 5ALOA 4CF5A 3F9RA 2HOQA 5AHXA 5AKKA 2BY4A 5AW2A 3PDWA 4UU1A 2RARA 4L6AA 3MC1A 3L1VA 4UMFA 2W43A 2B8JA 2HEGA 2ODAA 5IT0A 2MU1A 2HI0A 3QU5A 3N07A 3QXGA 5AKGA 2GMWA 2BDUA 3R4CA 4NWIA 3N1UA 5AVVA 3ED5A 4UATA 4UASA 3ET4A 2NO4A 1ZOLA 3ZWDA 1T9ZA 2C8LA 1QQ5A 2B8EA 2R8ZA 2WF7A 3CNHA 5AM0A 1YMQA 4NV0A 4FE3A 4JB3A 1L8LA 3OCXA 2IOHA 1YNSA 1RQNA 3A1DA 1PW5A 2G07A 4Y2VA 5ALUA 1Z5UA 1RKUA 2AMYA 3DAOA 2O2XA 4I9GA 5ALPA 4NAVA 4YIHA 3U19A 2OYCA 3QUBA 1U2SA 4UAVA 3IJ5A 3KD3A 3N28A 5AVUA 3QX7A 5AVZA 2YFYA 1ZD3A 1LTQA 3UMBA 2GO7A 4FYPA 3UM9A 2CN1A 5ALQA 5AIAA 4L6CA 3UMCA 4UM5A 1S2OA 3RF6A 3TLMA 4Y2SA 5ALLA 4KN8A 1ZD5A 3IB6A 3QNMA 3EPRA 1JUDA 3ET5A 2JGAA 1Z4QA 4ZEXA 3PGVA 4XQ0A 4EEKA 2W11A 5AI9A 1AQ6A 3WK8A 3WGVA 5ALTA 1KYTA 3HYCA 2ZBDA 2X4DA 3VAYA 2YBDA 3L7YA 5ALKA 1YJ5A 2G08A 1QQ6A 2GHTA 1ZD4A 2HHLA 4Y2PA 4AS2A 5AKYA 3ONNA 4Y3UA 4RETA 5AW6A 5ALFA 5AVQA 3B8EA 2RAVA 4YH1A 2HO4A 3I6BA 3U7GA 1L7PA 2P69A 2CFRA 2GFHA 2B1QA 5AVXA 4UM7A 4Y2RA 2C88A 5ALSA 2YJ3A 3QU2A 1CQZA 1SWWA 2YJ6A 1RLOA 3KOOA 3L8EA 3AR7A 3A1CA 4KNWA 1WVIA 3M9LA 4IG4A 5ALDA 4NFLA 3R9KA 3FPSA 1O08A 1YV9A 1N8NA 5AI4A 4J2TA 1NRWA 4HGNA 2FPSA 3ZX4A 2C4NA 2YJ4A 4C4SA 2GHQA 3DNPA 1U7OA 2P11A 1QH9A 3ZTYA 5ALRA 2HCFA 5ALVA 2OM6A 3ZWKA 5ALHA 3MN1A 2YN4A 2B0CA 3EWIA 4FFDA 1NNLA 5ALGA 3IRUA 1L7MA 2PQ0A 5AKLA 3ZX5A 2AH5A 5AKJA 2ZBGA 3ZU6A 3QU7A 2CFTA 3I76A 1K1EA 5AM2A 1RPZA 1TJ4A 2YJ5A 1Z4PX 3AR3A 5ALMA 4UMEA 3R09A 3FGOA 3SKYA 3QUCA 4UARA 2ZBEA 3KDPA 4HGQA 1FEZA 5ALNA 2B82A 4MWOA 4Y2TA 2EAUA 3OPXA 4OFZA 3WK4A 4IFTA 5AVRA 3S6JA 3B9BA 3QUTA 1Q91A 4PNHA 1XP5A 4KX3A 2FDRA 3ZVLA 2R8EA 2YMLA 4BKMA 3WKCA 3L0CA 3EF0A 3DV9A 4YCMA 4YCLA 3SD7A 3W5DA 5AM1A 4BEWA 1RLMA 1N9KA 3BWVA 4H1WA 3FVVA 1X42A 3N5KA 4XOUA 3U7FB 1EK2A 1ZJJA 3ZVMA 2AUTA 2JAWA 5AI5A 2I7DA 3NALA 4HYTA 3E58A 1T5TA 2FUEA 3AR2A 3GYGA 1TJ5A 1YS9A 4JDPA 5ALXA 5AW8A 2B30A 5AKHA 1U7PA 2FUCA 2W4MA 4GXTA 3OCUA 4G63A 4CF3A 1CR6A 5AIBA 2I34A 3L5KA 2P27A 5AM5A 4ZEWA 4F71A 1U2TA 2VKQA 5AK3A 2B1RA 5ALZA 5AESA 1WR8A 5FP0A 4HGOA 4AP9A 4BYGA 2EATA 4RESA 1Q92A 3NRJA 2JAUA 2WF6A 1U02A 4I9FA 5ALWA 4Y2YA 4KNVA 3L0YA 4G9BA 2PR7A 4BEVA 3WKBA 3WK7A
chains in the Genus database with same CATH superfamily
3QWFA 2P5YA 4EW2A 3H9CA 3PV0A 1C2YA 2B4AA 2W42A 4DFDA 4IFIA 2GPSA 5EGNA 5DNUA 1LV8A 3KAQA 1IQ0A 1GZSA 5LQSA 1YE3A 4OREX 2YMPA 2JRCA 3ZH9B 1EUZA 4EI2A 4C7JA 1T4GA 2PRIA 4CMEC 3WWOA 3HU1A 1KRWA 1YTLA 3OKFA 3V7JA 5C5IA 1PZEA 2EBWA 3WHPA 4L8GA 4TUPA 3RYCB 1YIOA 3P9CA 1N0VC 4FR5A 4X54A 2HJGA 3NPMA 4BQEA 2NOAA 1KZ6A 2DQKA 2HTFA 3RKRA 3GRFA 3CTPA 4I55B 2AR7A 4OH7A 4Q9DA 4KXNA 3QFHA 3HV0A 4OJQA 1K66A 5IF3A 5LA6F 3ZCVA 4XVQA 4DMLA 2VCYA 5EQTA 1FDOA 1E9FA 1Y3HA 3VH1A 3K8QA 3U31A 1SURA 1UJ2A 4KR9A 1H2FA 2FR0A 3C16C 3HK2A 4YXMA 3QXXA 3E5HA 2X8JA 2E3JA 1MO3A 1LRJA 5C81A 1KS2A 5U9CA 1FE8A 1CR4A 5BQXA 4NOLA 1CQJA 3P0RA 4DMRA 2Q5QA 4LDNA 9ICTA 4LVNA 3RRMA 3MIZA 2Y0PA 1D6SA 1PQUA 4PXYA 4KREA 2VA2A 1CB7A 3DEJA 1N7GA 3CVXA 4IGIA 4J0FA 4IIJF 4N5IX 2QVYX 4ZVOA 1AQIA 4WA8A 4BQFA 1MOPA 3VPXA 3EGDB 3VZRA 1W4AA 3WGKA 3IAUA 2OC4A 4YV1A 1U9ZA 3HP7A 1KYIA 1GY8A 5BXYA 3ONFA 4HNHA 1FMCA 2I4IA 2PIAA 3EEBA 4BX8A 1OWNA 3ZWDA 4KTTE 3H3XA 1F12A 1QAQA 3E9NA 4RZHA 2JHGA 3GNLA 3W2GA 3M49A 2FP4A 1M7HA 5ALUA 1B00A 5JHHB 3RAGA 2XT6A 4CTJA 4LV6A 4G5GA 3JX9A 2IZ1A 3U4GA 3G89A 2ONZA 3MJVA 4C03A 3IHKA 1OPRA 1KNXA 2WZDA 1DE0A 3VOBA 1R6UA 3RSQA 2XAAA 3NTLA 5DGHA 3ESCA 1QTMA 3ROQA 4XWGA 5DH9A 4N7JA 2VUHB 1OREA 3A28A 2H4WA 2HO4A 2HNKA 3F73A 4AZTA 2O2YA 2KKVA 4I5FA 4DCTA 5KFYA 4OXRA 4MYTA 4L0MA 1V7PC 2YHIB 2IYVA 2PXHA 4C78A 2OB2A 4MHTA 4FMDB 1U49A 4MYHA 3TNFA 3NYIA 2HRQA 5KFOA 4AD8A 4DDKA 1GNPA 4OKSA 2Y77A 2ZCJA 4S1PA 1KRHA 3TI7A 2JGLA 4HDOB 1XMQB 3DZHA 1IN8A 4PL1A 5YASA 4B2YA 4E15A 3NKVA 1SKUA 1R9MA 4EIWA 4G0PA 5DP1A 5IIIA 1Z1BA 2QTWB 5CNKA 2ODBA 1J33A 2YQ5A 3LDGA 3PQ5A 1W2GA 3KIPA 2EKQA 4OAPA 4LRQA 2AZDA 5GGYA 4C76A 2ZRIA 1B6SA 3E9DA 1ZIPA 1FO4A 2FUCA 5K4GA 2LV8A 3MGAA 2J7KA 4JL6A 2Q0ZX 2C20A 4QZ9A 2QBYA 2JKYA 3AUXA 4G4JA 5EJ2A 3I6YA 1U0BB 3L4BA 5EP3A 4IJ6A 1M6VA 1ZJWA 2GD2A 3K96A 4OP2A 4KODA 2HIGA 1CZRA 5FPTA 2BEWB 1LDGA 5JYEA 3FNIA 5FF9A 4JIMA 3QSGA 4B3BA 2DULA 3LX5A 2PMDA 3MWGA 3L77A 3DYIA 5HZGA 2FU5C 2PL3A 5CT4A 2BGRA 1XVVA 1M2OB 3HHEA 1AKEA 1XGKA 3KYBA 3DC7A 2GD0A 2G40A 3FNFA 2J31A 2X8LA 4RQ0A 4XUSA 4UAJA 5DOVA 3LOUA 4KWEA 4HV4A 1OX4A 2WQ6A 5E6SB 2OBNA 1CF9A 1XYVA 4QOFA 3HJHA 2WLSA 4X90A 3JYQA 2R6AA 2QM8A 2I3ZA 3QVGA 1TW3A 4EGFA 3H9UA 4I1VA 4KLIA 1CT9A 4KO2S 5IN5A 3PPVA 3P20A 3IJPA 1HIWA 4F4UA 5C1IA 1Q46A 2QSUA 4IHQA 3TACB 1S2NA 3NOVA 9LDBA 2H9IA 3ZGYA 1IM2A 4M60A 4DAEA 3GV7B 1VPDA 1DZ3A 2EGGA 5IMBA 5LMUB 4IQTA 5AHKA 2W2OA 3Q3VA 3QK7A 2K89A 2JJQA 1HG0A 4M8IA 3OPYA 3PQ6A 1GDDA 3GIDA 3RFCA 1YXMA 5DK6A 2GJ9A 3AHHA 3DXXA 1FIUA 3PYLA 3DQZA 1T8TA 2C0QA 2P2YA 3CCBA 5K8IA 4J9UE 2O8EA 1OA1A 1VLJA 4R40A 1A5TA 1C14A 3PRYA 3T7KA 2R8HA 5DIZA 1EFDN 2F3SA 3I2GA 4B6SA 1X9GA 3PGKA 2VHUA 1DEAA 2CKMA 3TH5A 2FP4B 1AG9A 1BZYA 1JR4A 2WPDA 3DW3X 3U4HA 1KAQA 3ANTA 1HLPA 2XD4A 2P4HX 2KLHA 4DNPA 3IHWA 1FPQA 5CR0A 5EE3A 4R8KA 1V16A 2JR5A 3T5CA 2Q5HA 4JP2A 1J2JA 2QD1A 2FRXA 4DQKA 2GO1A 4GHWA 4L08A 4AJEA 4OF4A 1WMSA 4LZAA 2HHQA 1F3LA 1J1UA 1Z2AA 1BNOA 2WWVD 4C87A 5DTIA 4ARCA 3DDZX 4BO7A 4NZPA 2GZRA 3I9FA 1AHPA 4K81B 1ODCA 2HFJA 2A9VA 5BW8A 2KM1A 4RM3A 3CSUA 121PA 4NCKA 5AHWA 5ICEA 1A8PA 1Z2PX 2BEUB 4YMHA 4RK4A 2JZBA 1MNAA 4DLBA 3B48A 4X20B 2YZ2A 4FB5A 4QAQA 1Z36A 4ZAXA 2BGGA 1SOVA 3AFGA 5ES4B 2F7SA 2QTTA 4YVZA 2ZTLA 3V7WA 2D3DA 2XBUA 3EXHB 4BFCA 3ZWWA 3Q8RB 1A98A 4RMJA 3Q0EA 1Z45A 8ICIA 4NZNA 1AY0A 4KZPA 3FTEA 3RC8A 2ENWA 2BCVA 4BWGA 3UAZA 1XQWA 4BX9C 2HPVA 4ZT2A 3OM9A 1RYEA 3QFRA 1B6RA 1HKUA 2ZB3A 1JB9A 1AGRA 1QR6A 3ZJUA 5CYOA 2WDPA 4B3RB 4GH5A 4JJKA 5AKJA 1T94A 5EP4A 3I76A 1A2QA 2KJ8A 4AI6A 3BZKA 3WGJA 5EIFA 1GUZA 1ZSYA 1JS1X 1KY5A 1PJCA 2WJIA 2NTVA 4UTZA 3PC8C 1J8MF 1COWA 2QBYB 4Z0NA 2WEKA 3O4VA 1RD4A 4KAJA 1LPBB 2BI7A 5EZ5A 3TZ6A 1ESMA 3TBHA 5LBUA 1PGOA 2PX4A 5AQEA 4R8UA 1O4WA 3FCSB 4FXPA 2PUVA 1TQDA 2FCAA 1SVIA 2VPTA 2ZPUA 3RK4A 3WOHA 4P53A 3IKMB 1TYBE 2SKDA 1HDRA 4HAVA 1Q0RA 2F44A 3M70A 3EPIA 1AD2A 5FD8A 1G38A 2IL1A 4A8HA 3IX7A 4Z6EA 1O6GA 1Q0QA 2NZJA 1U0FA 1XZGA 1Z6TA 2UVVA 4ATNA 5DYGA 3WBKA 1U1EA 2AQIA 2B37A 1WMEA 3G8AA 2RP5A 3AQ4A 1ZX1A 4MXDA 1JE0A 2Q5EA 3RH5A 4EGSA 1ORWA 5FOXA 5ITVA 5L53A 3WTCA 2JBHA 3RC3A 1PZNA 4YRNA 3QVGB 3H3JA 1QQTA 3BQ0A 2Z2XA 1QC5B 1NVFA 1OC4A 3VAZA 4B79A 3MWFA 1N2EA 3OSUA 3CVOA 3AILA 2ZYRA 4MUHA 5TGDA 2QSJA 2IPNA 3FMIA 3NONA 1P4SA 3A0UA 2XV1A 3KZVA 4FW8A 4KXXA 5ALYA 1TYAE 3CX6A 3GPCA 3JYNA 2EZ8A 3T5LA 3BXEA 2Y9UA 4HQ6A 2A9FA 2VXBA 3K72B 1CZNA 3IVXA 1OLSB 4QYTA 4BX2A 1K6IA 2M1XA 1KMMA 2WU3A 3VM6A 8GPBA 1XZDA 3JW8A 2HBQA 2QRQA 2VYFA 5I8ZA 2ODQA 2FPIB 1XMOB 3CLUC 4HF7A 5JNRA 1I4EB 4PHEA 2XB4A 2FPPA 1E94E 2PQMA 4L5CA 2E82A 1KF0A 2X77A 1UWCA 1OLOA 1DO0A 5IVKA 4DSZA 4GBED 1W5EA 1R6AA 4HC4A 4NCNA 1EE1A 3IBTA 1RC8A 1HURA 1N5DA 1RVV1 1YK1A 4PGAA 2OHOA 1N9ZA 5SYAA 3VHXB 5A62A 4AYXA 3TL6A 4PH5A 3SZRA 1SA0B 4UBOA 3HJEA 1T9DA 3ER9A 1OFUX 4Y9TA 1KW4A 1XC9A 5K6AC 1EP9A 4Q44A 3FSJX 1L3UA 5J0YA 4G1UC 3AR8A 2IYWA 4KTVE 1YUMA 2EWWA 1ZQSA 1ZVVA 3JWGA 1KMQA 4DV1B 5FCDA 5L1LA 1XALA 4D8VA 2B36A 3OQPA 5BYKA 2G25A 1NP7A 1EVYA 5F2EA 1E1LA 2WE8A 2RK6A 2YW2A 4N12A 1JH9A 2HC9A 2C8VA 4CUZA 5BOSA 1TFRA 4JH0A 3EGOA 4MQ6A 3MB8A 3HI6A 4BVJA 2HWXA 4DV4B 3ZLTA 3J81A 4K9MA 1WXHA 1N61A 4KXFB 4CR7A 1W85B 2JLSA 4H3VA 3ABZA 3GLHA 3ZIAA 3ZDAA 2BN4A 2C2GA 4PV7A 3E5RA 4MKFA 4F96A 4FFRA 2EXXA 1H94A 5KFMA 4M9HA 3Q10A 4JXKA 1GQQA 1ZUNA 4HS9A 1HV8A 3WGGA 1RXWA 3RH6A 5U4XA 1NKBA 2ZWVA 1P80A 4KLGA 3B36A 5FTKA 2P9EA 1D7OA 1P2UA 4J7AA 2TRSB 4O0IA 4Y3UA 3BIXA 2ADMA 4MVXA 4ARSA 2F3QA 3AERA 4QBIA 2F8SA 1DMSA 3MSCA 2DPMA 3U3RA 2X58A 4R8UB 1O08A 1CEYA 4KKVA 3HSYA 3BA1A 1RE0A 2BZSA 5HKOA 5KS2A 5KL1B 4EF5A 1IU9A 3CZRA 3HBNA 3L82B 1ISMA 4YXJA 2QTRA 2Q5OA 3WU2U 4TVBA 4FFPA 4ER0A 5KYNA 4P7GA 4EY3A 4QHTA 2GPTA 4RX1A 5KKCA 3EOAI 2MUTB 3UXHA 4LKOA 3TMKA 4P36A 3S27A 2WWTA 1QK5A 2FJ6A 3FOEC 4D1YA 4EPVA 1TK2A 1DBRA 3SFVA 4JT4A 4U00A 1PFYA 2VHQA 1BYUA 4Z4CA 2GN8A 1PJZA 5FPKA 5KYVA 1YB4A 1H0HA 4HDAA 2WJ6A 3HVRA 4G63A 4J0KA 3ECSA 9ICPA 5EL0A 1NMEA 1ODSA 8ICCA 2FK7A 1JPJA 3C1OA 4DA8A 1C9JA 1WDTA 2HDNB 4KXYA 3OF2A 1X3SA 2OUKA 3O74A 1LI7A 2FEXA 1IBSA 1TO2E 1GAQA 1TZ2A 4R9UC 3W04A 2R68A 1S7CA 4M6WA 3EVBA 1G8PA 5CFQA 5HF6A 4RVUA 1OXUA 3G2HA 4EF6A 1JZQA 1KERA 2PANA 4YS6A 3ED1A 2A7XA 4N5HX 4ZALA 3B0XA 2FEPA 5KG5A 2GS9A 5BSVA 4TLAA 4RZRA 1L5SA 2AI2A 1D4AA 2H1RA 2MR5A 4QZAA 1I6MA 1OMOA 1UM8A 3G23A 1HI9A 3AZOA 2FFHA 1FX0B 1EHIA 3NNSA 2WMOB 4FOSA 5JS2A 3HJBA 4B9MA 4BNYA 1BTOA 3LLVA 1E6EA 1S0NA 2PFQA 1NVVQ 1D0IA 5KNCH 1QF6A 1K1QA 4MULA 1G20B 1JZSA 3ZPXA 4Z6DA 1X8LA 4BLSA 5G2OA 5KFRA 3OOEA 1XSNA 4AWXA 2VTBB 1IWOA 4OGGA 1ZD2P 4J9RA 4FDAA 2FJUA 4GNRA 5JJBA 1BXZA 1C4KA 2ID4A 4XR9A 1Y6FA 3M9MB 1D7AA 1UINA 3AINA 5EIBD 4YMTA 3SZGA 3OSZA 1JLKA 4RE5A 2COKA 1VCOA 4O3RA 1CR0A 3O75A 4G6ZA 5IYZA 1YCHA 4E0BA 5LOVF 1NFQA 4YJFA 3N75A 2UZIR 4KSCA 2JGIA 2IF2A 7AT1A 3EFOA 3G8DA 4EBCA 2HSZA 1QJ4A 1V96A 2I3DA 3P4XA 3EHEA 1VTKA 5DBAA 4P3NA 1W4LA 3DEAA 1R7RA 1ZIYA 3F5DA 3LCJA 4MQEB 1UDXA 2Q8QA 2ZCVA 3OU2A 1WZIA 3ZU2A 2TMGA 4S12A 4PE5B 2W37A 5TXGA 4JBGA 2JIMA 4ARZA 3SSMA 1YQUA 4K46A 4D82A 2I1LA 2B8JA 1I24A 2QMQA 1NK4A 1SCQA 3AFIA 2Z9BA 2HCRA 3GFVA 3K9NA 1T9ZA 3UVEA 5BRJA 2AI3A 1HMPA 1GO2A 4YP7A 3AERB 4BNTA 3QWAA 5EZYA 3QZ8A 3PJGA 4RZSA 3IJ5A 5AVZA 2DBRA 4JJFA 1J1IA 1EB8A 1G8MA 1GHTA 1P3Y1 3OECA 2NV3A 1SBQA 3LVFO 2XGOA 3AESB 5BQ3A 5K3FB 1MZPA 5D1HA 1Z9BA 2M9MA 4LXTA 4EKGA 5IWAB 3I1JA 1AGXA 2WUDA 1XEFA 4DWIA 1EK6A 3OQIA 4RGQA 4TWRA 2O8VA 5EJ7A 1VSBA 4B6PA 3QHQA 3KVYA 5KJEA 4XJVA 1GRRA 2AJQA 5FUXA 3WWZA 3CUYA 4B83A 2PRZA 1YZ7A 2YXEA 1M74A 4HT3B 2CC2A 4AY4A 1R37A 1DRGA 4H3HB 5M04A 3VBCA 1YRYE 3BTVA 4FONA 3SR4A 1P77A 1UPBA 3SQDA 4NLBA 1NKCA 1G55A 3DO8A 5F51A 5K0CA 2W2MA 2VA3A 3JQ7A 3ZX5A 2Q1YA 3ZU6A 1FTWA 1UKBA 1O95C 3Q8PB 2PSJA 4LJ8A 4ID9A 1KDHA 2Z6AA 3M4NA 2F1KA 3RUPA 1H2YA 4EG7A 1QH0A 2NUBA 3GA7A 2FDRA 4PYLA 3S8YA 4F4WA 3SC3A 3PXAA 1JW9B 1WY7A 3QVSA 1XTPA 4O2LA 1PU2A 2W9XA 1A2OA 4EFMA 2AGPA 3SD7A 3B1YA 3RRHA 1QBKC 1PDWA 4HFNA 4BMSA 4YCXA 2OQVA 3WWPA 4B2LA 1NMQA 1W2WB 5JLAA 4JWMA 4UOEA 1H8EA 2Q5FA 4LGYA 5JWRA 4KN9S 3VVMA 3FUCA 1RCTE 3H4DA 3VO9A 1GGNA 2H8KA 5EP1A 4G5FA 1QH1A 3OE4A 8ICHA 1IC6A 1GO3F 1GGMA 4HGOA 2FGJA 3L7MA 2QX8A 3VSAA 4R1NA 2ZYAA 1U6JA 3GD5A 4TUQA 2P2LA 3I6IA 3C7CB 3M5CA 4H59A 1ZRNA 2CUTA 1NUQA 4GL2A 3O3OB 4I1PA 3H65A 4HS4A 1J9EA 5JSZB 1D9XA 5I45A 4Y0AA 3E22A 2A9RA 4N9WA 3COYA 2DHRA 5IM5A 3BRCA 3GC6A 3N05A 4EB8A 2BPFA 3DT8A 1SXJB 1VZ3A 3BL5A 4GVXA 3TOXA 2ZRMA 4DEYA 3L1HA 4OGKA 5J0QA 3IULA 2NU8B 3GF4A 3GV0A 4B8YA 4M36A 1P8JA 3RAEC 3ZJ4A 1Z5ZA 3LPMA 5IYZB 3IALA 1J42A 5KEIA 3LPDA 1UC9A 1X2EA 3BQMB 3ELBA 3B7PA 2FF7A 3GH1A 4EG4A 2AGVA 3W5CA 3F6RA 4Q66C 4LF7B 1D9DA 4M0UA 2D0OB 4U9HS 2ZM6B 2GPBA 3OIUA 4BV8A 1DFIA 2PLAA 1MIOA 3NRWA 3A70A 2ZRLA 3N6RA 3TFWA 2W2VA 4K6OA 2ACWA 3UBTA 2R3SA 4BLRA 1AUVA 3RIYA 5LQMA 1RI1A 4ZDJA 1VHDA 4PXAA 4IR9A 4AXXA 1P5FA 2OFOA 4US9A 1BS1A 4L1KA 1H85A 3IP7A 4AMUA 2X1VA 3H2HA 3HC7A 1EXMA 1Q7EA 2V58A 1AB5A 4MGZR 3NWOA 4HNVA 1JB1A 1ADBA 2GD1O 9ICRA 2X0JA 3HI4A 4ZT5A 3RV3A 1A4XA 5CG2A 2QX6A 2PFNA 3EZ9A 3RTDA 1RYUA 2G1UA 1G7RA 1XMXA 3PKJA 1ZNZA 5L1MA 2BMJA 5EKUA 4ITVA 1OVMA 5P21A 3GRYA 1U7UA 2OO3A 2PKQO 3QVKA 2IHNA 3V8RA 2VC2B 2DUWA 3ZDEA 3LKBA 3F53A 1KR5A 3ISTA 2MA1A 9ICLA 1UBSB 3E9YA 3OTWA 4IDAA 3BUSA 3V4PB 2YWCA 5ALPA 5F64A 5J2UA 3AEKA 4NE7A 4DJFC 3DCYA 2RKOA 4TWBA 4DRZA 4M89A 1ECWA 3WY9A 3FNRA 4EFDA 1E96A 3JQ7B 1W30A 3ISBA 3KR9A 4I7EA 2C31A 4M1TA 3TSWA 3PQ2A 3LXXA 2QTVA 2QZPA 1L5LA 4RULA 1CJBA 1P18A 4U7HA 4DS4A 5LZ8A 3QBDA 2BFPA 2JS7A 3I9JA 1QTIA 4HLDA 3F3MA 1R0KA 3ZWYA 1MW9X 4H6XA 2V7XA 4IINA 3V9AA 4ZOAA 1XDSA 2OZVA 4V0NA 1B4DA 5CR9A 2OG2A 1Z2OX 1ES9A 2ZBPA 3Q9UA 5C1BA 4QBKA 2EBFX 2EFHB 4FCTA 2ST1A 5L1KA 4JGBA 4IGFA 5KFIA 3QE3A 4MO9A 2Y0SF 4J9QA 3D43A 4CCHA 3GHHA 3NH9A 3K2BA 3PWTA 4OI1A 1EFKA 2UYGA 3JQPA 3W6PA 1O5IA 5K51A 8ICSA 2JI7A 1VYUA 1MB4A 9ICNA 3AMZA 2VJCA 2QQGA 1CP3A 4GLBA 5DTMA 1WHSA 1PR4A 3A32A 3GJ6A 1GDTA 2PXCA 4YDSA 2RHTA 1UDCA 3L8ZA 1N32B 4R1SA 4QDUA 3A0BU 4B5LA 4OGLA 2DFLA 9ICSA 3D1LA 1ZN2A 1F2UA 1P7CA 3E6AA 5BYAA 3II6X 4RA6B 3WB2A 2RIPA 5LBIA 2Q4BA 3B3JA 4J1TC 2AC2A 4DWVA 2Y4OA 1RE1A 3EVNA 3VNAA 4MI3A 2FN3A 1E2EA 5ALWA 5FI5A 1DKRA 5JJ5A 5DYWA 4LF9B 3PNVA 3G9TA 3RUEA 5H83A 2ZKLA 5DRTA 2GXAA 3RRXA 4XWWA 1UP4A 5K6TA 3ORQA 3PXEA 5BT8A 3WR5A 2BJVA 1U0LA 3MRVA 3T5DA 4YB8A 2YIVX 1RLTA 4PZOA 4AT1A 1RQLA 3AN1A 2G88A 1IOZA 3UXPA 4YYZA 1KJQA 3IAM1 2IP4A 3EGVA 3DKIA 4ZI7F 3OCVA 2P4EA 5JPCA 3HKCA 2JH9A 4EH1A 5HUJA 3D7LA 5IDWA 3BILA 1ESEA 2EDAA 4B85A 1P7WA 2GJKA 4N8EA 2PWZA 4W82A 4ZTBA 1L8XA 2XIDA 1TIKA 4JJ4A 4FJ0A 1GCGA 1VL5A 4HEJA 4KPYA 3L7OA 3ZD8A 1QZTA 2R1TA 1EGQA 3RB3A 3DYBA 2PE5A 1U1DA 5IAJA 1X8XA 3K6RA 3QEBZ 1HLFA 4ZAVA 3KUUA 5J0WA 4UEKA 3PHCA 3C5CA 5D49A 4FZ5A 1L5HA 4NG4A 3LHIA 1T6YA 2GK4A 1LH0A 4E51A 7ICOA 3OM0A 4OHKA 5GMOA 5EJFA 5D4BA 5COQA 3FPAA 4R05A 3RNLA 1I0LA 4Q12A 2I6TA 2JV3A 3RC9A 4S3MA 1MAAA 5EHZA 2F3RA 5FWYA 5JS8A 2W8ZA 3ZHBA 5D3KA 5J2UB 1KSFX 4C3UA 1NBMD 4EVRA 4DIKA 2KICA 1E9BA 5C31A 9ICWA 1CJVC 4UKDA 2BTEA 2LKYA 4JBYA 4ZVRA 1NRXA 4HLUC 2ZR9A 4Q6WA 2GAOA 1MDBA 3OZAA 2O7SA 2MU1A 1I51A 1T0IA 2GVNA 4MR8B 1ULAA 4ARVA 5JS7A 5LD2B 1SHTX 2OOKA 2J0QA 1OZFA 1H3NA 1KH1A 4Z6FA 3DLPX 3G2OA 2X86A 3VDMA 1JMSA 1BX1A 4TV9B 1IBLB 3IFSA 2IPLA 4QELA 5SZKB 2V4ZA 4I36A 3TGPA 1ODJA 1SXJD 2ZJOA 3AEVA 2NNWB 5DBFA 2OV2A 5JMOA 5REQB 4JEIA 1YDEA 3SCZA 1YULA 2DUMA 2ZUUA 2QDKA 1O8CA 1KMNA 2X4DA 2PO7A 2BH9A 2FOXA 3W6ZA 3WYNA 4JP5A 1U0OC 4D43A 4QXOA 1XEXA 2C57A 5KG0A 3W1WA 2XUZA 4BZPA 3PSPA 1YDGA 4EYSA 1OAAA 1GQOA 2EWVA 4N0DA 1EFHA 2MRLA 1CQXA 2BKXA 2VDMB 3K94A 3SZUA 3SBEA 1L4UA 1GPDG 4HTFB 2Z98A 3KPUA 1WHSB 3DDCA 3ID6C 2HT1A 4QZBA 4NCXA 2P9BA 2YY7A 1IWPB 4F5NA 2I4TA 1R0BA 2P5UA 5DWQA 2HMYB 1XWFA 2W5UA 1F2UB 1EUYA 4QUGA 4A8JC 5KDOA 2H2HA 1R0ZA 2QRPA 5TRTA 2PMKA 4NS1A 3BJRA 4FKMA 4IDCA 3DCJA 1A5ZA 5G1NA 2II6A 5EJGA 1DUSA 3AYXB 1BWQA 5LP6B 1HLGA 1QIFA 1RLMA 3RIGA 4ZZ3A 2J3DA 3I2YX 1EK2A 2FF5A 7GPBA 1PS9A 1E2IA 2ODNA 3G7NA 4PYKA 3OEED 1KSGA 2PNJA 1J2EA 2QRJA 1Z2NX 1P81A 3SQLA 4BDPA 4CF3A 1XXHB 4OL0A 4Y6OA 4LXXA 3DZDA 4YRMA 2R48A 1M6EX 2VCEA 2CZQA 1E6CA 1DGJA 2DFTA 1D5CA 1YJCA 3SS7X 5ECWA 1NZPA 2IZ6A 1N1GA 3RYCA 3RUFA 5LB4A 5FORA 4N8SA 3ZDQA 1OX5A 4YRKA 4BIMA 5COAA 3MLEA 2PJUA 4REQB 4B4DA 4GPEA 4OQ4A 1ZZEA 1G8AA 2ICAA 2DT5A 4E07A 3FVTA 2R6ZA 3P0EA 8ICUA 2MSEB 1KZ1A 1L7OA 1C1YA 1Z73A 1XN4A 4CV0A 1ZR4A 2JCVA 2QB1A 5EP2A 3T4PA 4B74A 1RPNA 1BNCA 1H4SA 4JR1A 1F8XA 5AJVB 2F62A 5NULA 2JD1A 3JU3A 2FZEA 3BULA 1LLQA 4LJ9A 3VO2A 3C2KA 4PLTA 3SLKA 4BKPA 5KFNA 3ZU4A 1YB7A 4CF7A 2O2IA 3I8SA 1BPEA 3ZIUA 1YZUA 1CUHA 3P52A 1H8ED 4QDZA 5AK0A 2JLQA 5FWYB 1TMOA 3ZYCA 3UGQA 4Q4CA 5B3AA 3EGDA 3VR6H 4LK3A 3F2IA 1GQRA 1IPHA 3QW2A 3K2EA 2Q9AA 1Y37A 3QUQA 4TWZA 2CDRA 1VMEA 3M5DA 1N0WA 1U0HC 2RKBA 3UFBA 1XTJA 4LHXA 2ZJZA 4TMZA 1JHVA 1ZS9A 3DSRA 4DLVA 3O6VA 1HOXA 4L8LA 3CB4A 2BQRA 4MARA 3CLVA 3DE7X 3WK9A 2Z83A 3RJEA 1X87A 3H86A 3QTTA 1R6TA 4P3OA 5GOZA 3V6HA 3BQTA 4KMUA 3BC1A 3GMIA 4C2UA 3COSA 3HCOA 3ZDRA 2W9AA 3R7WB 4AIIA 5GJWC 5CH5A 2NUAB 1D04A 1XDBA 3BAFA 3TM4A 3OZTA 1KI3A 2FSIA 1XU7A 4L3VA 3Q1KA 1D2GA 4M22A 2HD4A 4NY8A 2R2AA 5LNK1 3LT2A 1G5FA 3DW1X 3U1VA 1H2EA 1I14A 4MWTA 4UHHA 3CH7A 4TS9A 4GLJA 2XNCA 3LC2O 3M7DA 4WXPA 3GMDA 2XRZA 4YMOA 1KJIA 2GPYA 1I1QB 1J06A 4RJTA 5C80A 2PZLA 3NOXA 4M0DA 4PN7A 1K7EB 2YHIA 2Q7DA 1IUNA 3D5EA 4B9VA 2VPIA 1FYDA 3SZOA 1RWKA 4Q4AB 3I58A 3SICE 2JGAA 1DWUA 2C7PA 3W8FA 3Q8XB 4L8YA 4TTQA 2H3FA 2E49A 1YZQA 3FWHA 5LP1A 2Q3FA 4AU1A 3S8EA 1U9IC 3AFMA 3RCBA 2EQBA 2XE6A 5AXAA 1HTWA 1WV0A 4BS9A 2Z4SA 4L5JA 1GITA 2JGEA 1A9RA 2B8NA 4ZGBA 5AXCA 2PWBA 1BJTA 4KN4A 4W9NC 3COPA 1LY1A 1P1HA 1CF4A 2IUEA 2BVNA 1NMSA 5KFCA 1TM2A 1ZLXA 4IIBA 3LA8A 3JWEA 3WFZA 2PDAA 4I29A 4K8RB 3RHZA 1M83A 2EQ5A 4EYEA 3O92A 2YIDA 5L51A 1TVCA 4PLVA 4OY3A 3C7DB 1P0PA 3M2TA 1KAGA 3IAS1 5DCUA 3MGBA 4JXXA 4CEJB 3L18A 1PJTA 4KX3A 3AJAA 4CU2A 3CLSD 2GM5A 4GEGA 2A7QA 4UHJA 1MJ5A 1TU4A 2NRXA 4J0JA 2QJRA 4HNUA 1ZN7A 2BEWA 3U7IA 1H3EA 4PF1A 5HR7A 3BS4A 2VDUE 5KFUA 3ENKA 1BDHA 3WWEA 3BFVA 4N3NA 3P0FA 3EA0A 5KWIA 1M2OA 4LZNA 3CZMA 5A0FA 4IXTA 3FYUC 4B1FA 3ZHCA 3FTCA 1TEZA 2Z5VA 5LQJA 1CR6A 5HE8A 2XYHA 2OYSA 1WR8A 5E6SA 3PX4A 4N7MA 1U28A 3TZKA 1RTKA 1MB2A 1OUMA 1EPUA 2Q9UA 1MB3A 4JMLA 4XSGA 3UOAB 1SD5A 2V55B 4C0WA 1W5SA 2I80A 4N0QA 1KAMA 3PUXA 3WLKX 1XLTC 3X2EA 3SYTA 1VFPA 2XCUA 3OY7A 3T3MB 3LUDA 3VI4B 1MABB 4XYEA 3UH0A 3UB3A 5I3CA 5IULC 1CRZA 3PO5A 3NHLA 4HVAA 1RQGA 3A4YA 1LCIA 3RQSA 2OFXA 1DDOA 4QZEA 1L5QA 3P9KA 4JSTA 5A71A 1J0CA 3IE0A 4A2QA 2ISQA 4N3AA 1IZ9A 5KVCA 4G8CA 2AS0A 2J48A 4Q6BA 4ZYZA 2D5AA 4HYEA 4XSVA 4IOKA 1RZRD 2V7BA 4OYHA 4EVSA 1W96A 3ZXXA 1FW8A 3TQSA 4XVUA 2FWIA 2NRZA 4QBGB 4D92A 1VPEA 5G5HA 3DOUA 3WGHA 3GH3A 5MDHA 1L5MA 3QG1A 4D9GA 3R0VA 1NUAA 4YNBA 4HDCA 4F8RA 3CZ4A 4TMWA 2GJ8A 5E7IA 3MR3A 1R4MB 3O91A 4PWZA 2O2DA 2LM4A 4AN1A 4B7CA 3MJDA 2UZ4A 2E4VA 3ZW7A 2ZJ4A 2BGJA 4BFWA 4NXMB 3FHOA 3GRAA 4JWTA 1WXIA 3HB9A 3W5IA 3OJWA 1W35A 4J9NA 4PO3X 1WSAA 3MUEA 3TMAA 1PR5A 3ZY3A 4BUGA 3LPNA 4IIXA 3S1AB 4TWAA 2CY0A 3EPPA 4BBJA 3SK0A 3QEMA 5IBPA 1KP9A 4L4UA 3UAGA 4OAOA 3HN6A 5G40A 2BEUA 3R5JA 2K60A 3DFFA 2C5GA 1EJBA 4RY0A 4X20A 2VDWB 1Q0TA 3HZOA 4IIYA 3NI2A 2G5HB 3GIJA 4BEJA 1EP2B 1FTYA 3F0TA 2QM7A 1QU2A 1MAWA 3A1TA 5H3LA 2DPHA 2AF3C 3A31A 1I9CA 3G1UA 3VI3B 5HJ7A 3EXHA 4U1RA 4JB2A 2WDZA 1H6DA 1VSVA 1SV0C 1XTBA 4BX9A 4G4SP 4DYVA 4GKBA 4NYIQ 4UHKA 4ZDWA 2YHBA 3RW9A 5IXSA 4P80A 3UMFA 1TD9A 1NJ1A 1NVDA 1QNFA 4Q7MB 5TT1A 4FHGA 2B6NA 1F5NA 4WLNA 1N5LA 1Z25A 1A5BB 1NK8A 2HO5A 4DMUB 3RTCA 2HHSA 2UXBB 1OAKA 4ZZ1A 5TVGA 5EHQA 2GRUA 1GUYA 2G67A 4J4HA 5BR7A 4FZNA 2A94A 5JDCC 5CT6A 1E7RA 1ZINA 2FWJA 3ZV6A 5B2EA 3AF4A 3D3NA 1E9EA 1RYFA 4Z9BA 1OPXA 5AVXA 5LKRA 3W6OA 4E7OA 4F38A 2E6UX 5ILGA 1KY3A 2I6SA 2D00A 3OUZA 3O26A 1VPVA 5JG7A 1MU0A 4DDHA 3H5RA 2ZRCA 2FUG6 2AOUB 1VE6A 1NULA 3OT4A 1PNVA 4ICAA 4OKIA 1IK6A 4IDPA 4L73A 1TKAA 3W7VA 4ADSG 5B58C 3V1KA 2J85A 2EH9A 3CRW1 2XMPA 2R65A 2W0SA 1ADGA 4R81A 4ZICA 1EFTA 1RWPA 1XP5A 3MDAA 3AUUA 3A0HU 4GKAA 4JU9A 3EZ7A 2OBMA 4TV8F 1JAXA 4F5PA 1YO6A 2OGTA 4UUPA 1GL7A 2V9CA 4BEWA 2EKDA 4TYPA 2GNAA 4K8OA 1QC5A 1KFKB 3E3MA 2ZRNA 2I4NA 1DJLA 1P19A 3DOCA 4KDFA 3F3SA 3ZHQA 4UFOA 1XZFA 4QWBA 1XCOA 1BRTA 1TCUA 4FSDA 4XARA 3KB6A 2HCJB 2NSJA 4HSEA 1SEPA 3FFWA 3CXRA 3SV4A 1ECFA 3QEKA 2PWAA 2WTEA 4N5LA 3QUSA 4BFLA 2PL9A 1FXWF 4ILKA 3GEHA 4QFBA 5FBQB 3T5AA 1OLSA 1OYVA 4ZTZB 3QUAA 5BSUA 4HDQB 3D81A 4MQFB 2C2EA 1DRWA 2FPIA 3LIIA 1H8HD 4C0LA 2XCPA 3AIMA 3FWPA 4HK4A 1E2GA 1NASA 3FM9A 3G2IA 1V5GA 4LJ6A 1ZQXA 5KTKA 3DP9A 4P3PA 5KX5A 4AO7A 4CEHB 1ZP6A 5ELXA 3SVLA 3FNGA 1FLAA 3U7JA 4H7DA 5G53C 3PEVA 3HFGA 4URYR 4GYJA 2I6XA 3QKRB 4JSYA 1P0CA 2KKPA 2H3VA 3S44A 4W5WA 3ROKA 2DC1A 4R9VA 2PUDA 4R3UC 3VHXA 3A9TA 5I7FA 1DRUA 1Q95A 1SA0A 2F9LA 1QLWA 2JZCA 4Z4FA 2CJWA 3QEMB 4F45A 3BORA 3D0QA 3IG5A 4AUNA 4RELA 2X4GA 3TI0A 3PUKA 3EARA 3PXGA 5LUBA 3AR4A 2X4IA 4LYEA 5KNCA 3K30A 4FBTA 3FHTA 2C4HA 3CR8A 1T5HX 5CVUA 3TLXA 1RT9A 4LF4B 4YPVA 2ZRBA 5ESXA 1P6XA 1FSPA 5K0ZA 1KJJA 1NJWA 3F78A 4L8WB 2NRWA 2K8CB 3L04A 3T9AA 1W85A 1EESA 1E18A 4KTQA 4M0CA 4LGMA 4OJLA 1KWKA 3L6EA 4KXQA 3LHDA 1BMDA 1ZAKA 2ZJ2A 3D8UA 1TYCA 2P66A 5KDLA 2IGBA 4OD0A 1N8TA 4E11A 4K9KA 4RAOA 2BY4A 1CUSA 1MDFA 2XJ4A 4JZYA 4PFQA 5BV8A 5BUZA 3EMBA 1U6IA 2B1GA 3NDJA 4TL9A 1K0FA 1EGVB 4M54A 5L4NA 4YR3A 2YFQA 4E1VA 4GMXA 1LDEA 3ZQ4A 2C5EA 4FR2A 4B3SB 3FWKA 4LVOA 8ICBA 2E85A 5A5VA 1ZUD1 3PQDA 3QV1A 1ZH4A 2HN9A 4B71A 2C78A 3EPRA 4C1BA 4BFZA 2QLMA 5FULA 4KP7A 2DCUA 2WSLA 3BQ7A 5I4CA 1SKWA 5KT3A 4DB4A 1N2GA 3M89A 4PZNA 1VIDA 1KIAA 2MUTA 1XQVA 1ZK0A 1KDRA 4RHTA 4BO8A 2MSDB 3A1NA 2DHCA 3D0RA 3WGYA 4RZQA 5A9SB 1LS1A 1M1XB 4O4HB 2LM1A 4TQUS 2VPWA 3C85A 1NK6A 4CF6A 3VSCA 3UPQA 4LMRA 1DAKA 4DL5A 2B0CA 4L6IA 1GUBA 3LCUA 1TJ4A 1YRWA 1NVTA 3WV4A 2P9ZA 4Y6RA 4OFZA 4LHVA 4MV6A 1DV2A 3QXCA 2Z4TA 5F2NA 5CW2A 2UYOA 1V5FA 4IVRA 2WKWA 5EWMA 3EY9A 2B7LA 5EXDA 2G0TA 1D8BA 1CUGA 3TXAA 5AM1A 1VDVA 1YCDA 5G1PA 5FUMA 1KYZA 1EBFA 2H1WA 1IM5A 2BM0A 3VJRA 3AZQA 1GTZA 9ICFA 1JIVA 1ZC3A 4IIEA 1FX0A 3Q85A 3WQBA 5BO5A 3V7NA 1T5IA 2ORED 3NOOA 3GMTA 5BOVA 3WAJA 3O0DA 4AY3A 5KX5B 1C41A 5CEJA 2B25A 2QMOA 4O25A 1HUQA 2PR7A 2NG1A 3HA2A 1G20A 1YUBA 4PTYA 1RPLA 4UAZA 4W5HA 4IYJA 2VTBA 5JH7F 4KLAA 4FUTA 1LI4A 1AE1A 3GLTA 1HQYE 3BL8A 1TF7A 4CG2A 3KEGA 3CN7A 1FF9A 3DE6X 4L07A 3R7DA 2DECA 1E9VA 2WV9A 2R9VA 1XSLA 1OWPA 2CJWB 2D3TA 2GOLA 9GPBA 4GKKB 2IFTA 1QB7A 3W8RA 3UJ7A 4QWCA 2DBQA 4NIMA 4EB6B 1MJGA 2KHQA 4UE6A 1ZR2A 2KIWA 1F0KA 3BMQB 1F5SA 4U7PB 4ZO8A 3T54A 4ECWA 3MWLA 4DNOA 4H77A 4LJ7A 2MSNA 4RVNA 5F7ZA 2BEJA 4M0LA 4LX0A 4JOBA 4YMSA 2C4VA 3PGMA 1GPBA 1UBRS 1J2TA 1PJ3A 3IMKA 5DB9A 3B1FA 1N2BA 4FO6A 3VPSA 4WEOA 1DBWA 3ZH2A 2OQIA 1YU6A 3P0IA 2P77A 4MQEA 4FN5A 3FOBA 3USCS 1YE8A 1DRJA 2VT6A 3JVDA 1P7PA 2J46A 3G6WA 3AFHA 3MS7A 2OQ2A 1MO5A 2H3QA 1EMDA 3C3JA 4DQ0A 1MG0A 4R6XA 1GP2A 2DQSA 3D2LA 2ZXHA 3C3XA 3L06A 4UDXX 4ON9A 5JZMA 4K5QA 4BNFA 5A06A 1RCUA 4UBNA 1JI0A 4NBSA 2J7PD 3NAMA 5FOVA 2WY2D 5IT5A 2XLBA 5BMVF 4CZ2A 3ZKWB 3ROXA 3AESA 4UREA 5K3FA 4LW8A 2QTGA 5SYNA 4ZT3A 4OHZA 2NWQA 2R84A 4B6QA 4JK1A 1FDWA 4WBXC 3WZLA 3ZLJA 4FKBA 4N8DA 2RGNA 3N1UA 2BR4A 5LYYA 5C53B 1NJGA 1E98A 1K5GA 1JXLA 2M6SA 5DLYA 1QIDA 2J6CA 4R41A 4IV0A 3H2BA 4RQ8A 3L92A 1SUSA 5IW8A 5CAEB 4CUJA 3TLKA 2OCEA 4EI7A 3RJFA 2KHVA 3KHKA 2WWGA 3CISA 1ZOIA 2O3SA 5D86A 5E1BA 4DARA 2NYUA 3VR0A 4EKIA 4L78A 1TPYA 3U4AA 4RDXA 4FQ8A 2VH5R 1SU7A 1WUKS 1P5RA 3LY5A 4YH1A 4HXFB 2I7CA 2GJAA 1PK8A 1JVBA 3PPIA 2DTEA 3K1TA 4GXQA 5FHRA 5HW0A 3W5VA 2PPLA 2BFAA 5HR6A 5EWMB 2HMUA 1J0AA 1WUHS 2BDTA 1AK9A 1HYBA 1ZKDA 4YY3B 1NBMA 3KVVA 3NBKA 3EWIA 2E4WA 3H2KA 1ADFA 3TLAA 3IAEA 3WLHA 1G98A 4RD1A 3FPHA 2VPXA 2YCLA 3TLBA 1FEZA 4OB6A 3ADCA 3B9BA 4YJ3B 4NYIR 5C37A 1H9AA 2H9YA 3T1TA 4KV7A 2QX4A 4HNRA 4G1VA 4MRSA 4G56A 3F71A 5K0BA 2FP3A 1UMBB 5JSZA 1E77A 1OLUB 5CDTA 2FCRA 3HHPA 1XMPA 3DO6A 1ZJYA 2H4YA 1SXJA 2W4MA 2JFUA 4AZVA 4YUWA 3BTUA 4CIYA 1NXTA 5H70A 2NU8A 1S01A 2GM3A 1I30A 1S7GA 1JJAA 2D2XA 4TQGA 1N6LA 1OXXK 4C8MA 2J4FA 2Q0HA 1D2AA 4DV5B 5EE9A 2WW8A 2YVQA 1O54A 2UKDA 1I3OA 2BCRA 2WYUA 4FHDA 3CW2A 3HVJA 3OH8A 5IN4A 5HS4A 5KFHA 3D59A 1SL2A 3KQYA 3EZFA 4ZI5A 3MCUA 2PBFA 5B12A 1ZESA 2CD7A 4UXJA 4AKEA 2D6FA 4FFSA 3FVRA 4ZDKA 4B0OA 1DAHA 3HCBA 4MW4A 2QSYA 3K2QA 2WKPA 4CV3A 3L0SA 4UNPA 1WW8A 4OX9Y 3P0HA 1DXYA 3W6NA 2DFDA 1T9CA 8ICJA 1EWVA 2CUNA 4P5EA 2I7XA 3Q7PA 5DBHX 2HQ1A 1U3GA 1TJPB 3U26A 3UV7A 1TLTA 4GP9A 1E2PA 3TQ1A 4F2SA 4P22A 4KXVA 3H0EA 3OEEA 1FB5A 2PS1A 3BQ1A 1SXEA 4JI0B 4D8XA 2OAEA 3OCYA 1Y4UA 3M6LA 4AJJA 3TF5A 1Z6YA 2J3KA 3CBGA 4KQEA 3SVZA 2JFVA 4PX2A 3QFCA 5TIIA 1A71A 3B2NA 4FEGA 1AUPA 3LY7A 1VYVA 2PQ6A 1UBLS 2J08A 1KDTA 4KLOA 3CE6A 2IYOA 1D2CA 4AJNA 3M3DA 1Y3IA 1JEEA 3KZXA 5JLJA 1KKMA 2G5CA 3D5QA 3HBJA 4QZ8A 2NTEA 4DG5A 5CB1A 5FBLB 5C52B 3EB9A 3UK1A 2MU2A 2ODWA 3CLUD 3NEJA 1G7SA 4UQGA 4ZJUA 3A3PA 5KFWA 4Z4IA 3CJQA 3FSRA 5CM2Z 2QWXA 4MTLA 2WT9A 2A9JA 2VIXA 5AKXA 1HXHA 5CCDA 4NV3A 4EB3A 3U6BA 4DM3A 4WNYA 3WNBA 3KQSA 4E14A 3M6ZA 2BV3A 5FA8A 5IM4F 3P2YA 3IAXA 3PJEA 4OAQA 1GSHA 1BPXA 3A14A 3NBMA 4NU6A 2B4QA 1U9YA 4G5QA 3TG2A 5F1YA 3LVBA 4AURA 3PVZA 1CHDA 1M5TA 1YA8A 1V9CA 3E1SA 4YDHB 4X63A 2CN1A 5HXAA 3ZU5A 4MPPA 1GRNA 4ZEXA 1BDJA 4PGGA 1FNDA 2PQ2A 4XUCA 1XTVA 1NJ8A 4NZZA 4H16A 4QNLA 2WA1A 3IVMA 4WX2B 1M8GA 5KNCD 4DT1B 3JQRA 3T9DA 2ISCA 2OV3A 2RAUA 4QUIA 4R2JA 4BP1A 3L1IA 1Z82A 4FCVA 1Z0IA 2O07A 2IF0A 3L8EA 3LQYA 3K70C 1OBVA 1UKAA 2HPAA 3ZX4A 1FXSA 3IESA 1XDUA 4KXMA 1SIUA 3CUUA 3QI7A 3GGGA 4PAGA 5JMPA 5DG7A 1H0KA 3KOMA 4DL4A 4RA6A 3QTLA 5ALHA 1P2FA 4W63A 3HBMA 4KVFA 2HBLA 3BD9A 5BSMA 1GPKA 2ONKA 3T15A 1LV7A 2JIBA 4LVCA 2C7BA 4FDUA 4YHHB 4MMYB 4UZEA 1P5JA 2A3VA 1RZTA 4QASA 3FMGA 2P3QA 1Z2EA 3HT3A 3HNOA 2FRDC 4OXIA 2X9NA 2GEDA 1Q11A 1OAOA 1UAGA 4J0HA 5I8PA 3X3HA 5AUOB 1JSXA 4RCYA 5FXMA 1KDZA 1JU4A 2VDOB 3IT0A 1ZQ1C 2QP4A 3D6HA 4YRFA 4QGAA 2KS6A 3K6JA 2VL7A 2E2WA 2P27A 4EZ6A 4ED6A 2B9VA 2QI9F 4UDNA 4FQ7A 3JPRA 4BMZA 2IEDA 4D9IA 5E2IA 4ISBA 3FWNA 1XYGA 2I2WA 1QORA 2PBLA 3U5TA 4POOA 2JD0A 2HMTA 2BLLA 2DPIA 4L27A 1A3CA 2CLEB 4JFRA 2GAFA 2B8WA 1XQYA 2IQIA 4PQFA 3EVDA 4KAXA 1PFUA 4L76A 1YDFA 2QT0A 4X60A 5BUQA 3CJTA 2HK7A 3N2KB 4KIUA 2QTFA 1D1QA 5BQ5A 4WY5A 3EOBI 4CKYA 3I83A 2VJAA 4YUXA 5KBYA 5F23A 2Y71A 2ZG6A 1YD7A 2O2EA 1ZQFA 4MRVA 2XVZA 1YCFA 4CR8A 4AJOA 3KR0A 1XEAA 1I2AA 2XRYA 4M87A 5KQPA 4LI3X 2PI5A 1TAGA 4XWTA 2YS6A 3KU1A 4BTVA 4EHBA 1P7YA 3PMNA 1N34B 5K8LA 3GJ7A 2WTFA 3M9NB 2A9QA 1PVRA 4PG4A 5KJCA 1D8YA 3JD4A 1RWMA 1ZVMA 3H2SA 4C7MA 2QGNA 3OZ7A 3ER8A 1NN0A 4EW3A 5IJ9B 4AY2A 1X9MA 3ZTTA 1ZM9A 5A7GA 3AUKA 3KQHA 1K89A 2AQKA 1P5ZB 4WDRA 5CT9A 2AN1A 3L41A 1R5BA 3ZXUB 3GGPA 5CK5A 2QNRA 1XVTA 5BNZA 1TV9A 1D2MA 2H4ZA 3HU5A 3O2NA 2GCPA 2RGDA 2JKZA 2CJFA 1OZAA 2AI1A 3REFA 1SBHA 1Z8NA 4LTDA 3MELA 5D2CA 1JVSA 1XN1A 3EVAA 4MR8A 4BMDA 2ZATA 4XGNA 4ARIA 4KG7A 5LB2A 2FA9A 3T52A 1KWGA 1ZGGA 3GJRA 1K7SN 1ZH8A 2Q2QA 3UUFA 4TV9A 3P97A 5FR2A 3FKQA 3M5WA 3OZDA 5HIKA 1YS7A 4CM4B 3C3CA 2O4CA 3BWDD 3EF1A 3ZEAA 3QU9A 4F5EA 2V4RA 5I4BA 2ZOSA 5REQA 2UUAB 1RXCA 4WFIA 1ZD8A 3FLEA 1KIFA 5ARCA 1FNSA 1MEJA 3RS2A 1NPYA 1KVSA 2AK2A 4HB0A 5IC6A 3AHGA 2YOFA 5GADl 1NZJA 4GAEA 1UJCA 1PUJA 3MXTA 3H3FA 1T36B 3SJAA 2H1OA 1X74A 1DOQA 1E4VA 3FDIA 2VHVA 4FQ5A 1IPEA 5KFXA 2L42A 2XWQA 6AT1A 3G5LA 3PJFA 2WRZA 2GKOA 1RZRA 4US2R 1Z7BA 4HTFA 4I9GA 4G0XA 4NF2A 1WCWA 3PX6A 4Y30A 5JXIA 4C3ZA 2AHRA 2W6IA 1P73A 3NGMA 3TLMA 4UVEA 1MB9A 4V0OA 2WJYA 1V7QA 3HEBA 4YR0A 4OSPA 4ENTA 2I71A 1YFKA 3H2YA 1LNSA 4PONA 1OCEA 4PAMA 4WL0A 5AOBA 2CHVA 3B7GA 3OFND 3RVMA 4H1VA 3H97A 3BL6A 5KTTA 3BHMA 5K2OA 3QE9Y 1V43A 2DUJA 1ACMA 4R2WA 3I1IA 1HC7A 2OHVA 4UNQA 4O1IA 4TM7A 1T0JB 3QTBA 821PA 5LP6A 1IY9A 1JEJA 2ZULA 3MJ4A 2RONA 3EDYA 3KWMA 2D1TA 1JFRA 2RGUA 1Q1QA 4R54A 3ECAA 2RHOA 1QZZA 3U0BA 4X66B 4CFZA 2O6LA 4I1YA 3WL8A 2C83A 1I0IA 3KFXA 1M73E 2CT8A 3G6YA 1T8SA 2Z5FA 4RTMA 1ULZA 2WM3A 1OU4A 5KVAA 5FLKA 1XXHA 1Z6ZA 1TC2A 4URXR 5D01A 1HLDA 4MEJA 3E18A 5EJ8A 3WNDA 3K4PA 1KR2A 1MV5A 3CGWA 1ENYA 3A58B 1W25A 2Q7OE 2JXJA 1I2MA 2OFWA 4KO1S 5MGNA 2G83A 4AMBA 16PKA 2B3TA 3R0JA 4F6RB 1LWOA 2ZJ8A 1KI7A 3DL2A 3I8OA 3KT8A 3G5UA 4FOTA 2G76A 4OGFA 1NDHA 3VNVA 4XOUA 4B3DA 4MDEA 2AUTA 5J8YC 4REQA 1YGYA 1HRKA 4JT9A 5JFOA 2P91A 1ZH6A 1O95D 4A6EA 4RMHA 4WACA 1TQHA 3Q72A 3Q0TA 1CRWG 1UJ4A 3AF2A 1LTHR 4OJOA 4AKHA 2WMDA 3L0PA 3AJDA 2NPOA 5EPEA 4I5IA 1CQIB 2XHZA 2GJ4A 4DMMA 2ZIUA 5ALEA 3JPTA 2KWIA 1MN8A 3AUTA 2JVJA 4QGFA 3A4IA 1LPSA 1VMIA 5A3SA 2EBUA 2F1IA 2VEOA 1J8VA 2O1SA 1C50A 1TIBA 4PSVA 5IZCA 2UXDB 5BURA 3NAGA 3ZDXB 4EYGA 5GIOE 3EPHA 2EANA 3OZCA 4Q4JB 3ABIA 3Q8SB 3WE7A 4UW9A 5BV7A 4Q1VA 4L5YA 4XX1A 3BRQA 3K15A 5FBZA 4QJIA 2P62A 2GD6A 4FTWA 4WUTA 1PDOA 2W9BB 5IJAA 3I4LA 4E7PA 5CLHA 1XVUA 3AIKA 4ZO4A 1NC1A 4ZZ2A 2X2FA 3MRXA 3UMYA 4DFJA 3AOGA 1Z3EB 3R7WA 4TLBA 1YB1A 1NE7A 3WSTA 1RKBA 2NUAA 5PNTA 4V38A 1ENZA 2QW8A 1GPMA 3O21A 3OLQA 5FO0A 2PA0A 4TMFA 2G5TA 4A0HA 5LZ5A 1DT5A 4U02A 5GINE 3SPXA 2FQWA 1IZ8A 3OEWA 5GJBA 1RHMA 1SPXA 3OE7A 5I9MA 3EGCA 1ZQIA 2GN6A 4PSCA 4KJXA 1A5AB 2W7OA 2G0AA 1TVEA 1GCAA 4M88A 3DC2A 2VDQB 3DMRA 4PLZA 4JUIA 2WTXA 3PW5A 1JI3A 4DILA 2J41A 1W47A 3WHLA 2ZKIA 4BOYA 3LLSA 2FFRA 1H8HA 3MFHA 4CU5A 4GYKA 5EZSA 4Q4AA 3PHJA 2WIDA 5FV7A 1V4VA 4OHYA 3JQDA 4G5HA 4A8JB 1HT0A 3MS4A 3TRDA 2HUNA 1QZXA 1NTRA 1ML4A 3FN4A 3AM3A 4GM4A 3EYZA 4TQSA 4FDVA 3P9QA 4FFNA 4ENUA 2H00A 3SQWA 2VIIA 5FA6A 1L8LA 1D2NA 1DQZA 2J3IA 1GGFA 3A1VA 1GUDA 4LGCA 1FFDA 4TYMA 2YQZA 3LNTA 3RR8A 1JHUA 5DYYA 2HRZA 4JP8A 3UMCA 3IAHA 3M8RA 2WWYA 3HUEA 2LCQA 3QH4A 4CMEA 1ZHHA 2LDXA 1KU0A 2AJDA 1PV4A 1MF7A 4ZOEA 2VP9A 1K08A 2CW5A 3IURA 3E7FA 4CEJA 1TM7E 1A9OA 3FOAA 2P69A 4J7CA 4IHJF 1RLOA 2XAUA 3H9JA 4MVJI 5DTJA 5E0KB 1EJ2A 1B41A 3FYUA 3ZZUA 1EVQA 3CCFA 4B8WA 5J0RA 3QZ7A 2QPLA 3QXSA 4O3PA 1I4OA 1ISGA 3BJZA 4F4IA 2QL9A 3L7JA 4WKPA 5ES3A 5CU7A 4YHBA 5C32A 1H6BA 3VZSA 3NG1A 3W2EA 1X9HA 3TTYA 5JAOA 5DG8A 5F5LA 4D3ZA 4DEVA 2VJPA 3ROTA 4FOPA 1KC3A 3OQMA 1FP4A 2ZIUB 1G9SA 5JE8A 4TZ6A 1HO3A 1YZ3A 2VZEA 4H6VA 4C7VA 1ZNQO 2FHSA 5B6PA 4B7AA 2C3UA 4GX1A 3SYZA 3SNKA 3ITEA 5A4KA 1S2IA 1IL0A 4YMGA 1MABA 4LZGA 1VE9A 2CMDA 3PRJA 2JATA 1SOWA 3GAMA 2BMDA 4C4YA 4WE3A 3FVQA 5FP0A 1QGOA 3DXZA 3KQNA 2QP9X 2P0AA 4JJEA 2EX4A 4B82A 4R1OA 2IELA 5T3UA 1L0BA 1LUAA 4LI0A 1NOKA 3N2GB 3NHZA 4OQNA 3A6EA 4NECA 3TIIA 1Q7GA 3BF8A 2VG8A 1PG5A 4V0ME 1ONNA 4XDZA 4GPTA 1BSVA 4PZPA 1UEXC 4GI1A 4N6NA 2KHZA 2OY0A 2OCAA 2AD5A 2GBCA 3DMPA 5CBPB 3I1YA 1NYTA 3KZMA 1DRKA 3OLXA 1R4MA 1NVEA 4Q1CA 3RTGA 1K6MA 1QFYA 4LDRA 3MLAA 3ONVA 2QJFA 2BUCA 4ZCLA 1WOMA 4QZHA 3S1AA 3H6HA 2HF9A 3IQXA 1L1RA 5DWDA 4HB4A 4LNAA 4EEZA 3CLRC 1J07A 2I66A 3FG9A 3SKVA 1CUCA 3O9VA 5BVGB 4MV1A 2QVGA 2VDWA 5H8WA 2E8MA 1TC1A 3KZIU 3VDRA 4KITB 4NBUA 3UAYA 3R0QA 5E2BA 2HSJA 4RIGA 2QRMA 1QX3A 5T4HA 2HVIA 1RYZA 1SV0A 1U9LA 5KQSA 4TVSA 2XMRA 2KZZA 2YIJA 4CIWA 3E2EA 1XU9A 1XX6A 4KMOB 1A7UA 4EG1A 4IMPA 3EPJA 4EG5A 2E3TA 2K4MA 2BGKA 3RBZA 4Y9DA 4E5MA 2ZT5A 7ICNA 1NXOA 2E0IA 4WMLA 4Z4HA 5I4KA 2WJGA 4PZDA 4AKIA 4JLVA 3PDWA 4DSUA 1RTTA 4YRCA 1YRHA 2O0KA 2NYRA 3N7TA 2W8KA 5IJXA 3QVJA 2HMAA 3AUJB 1XZNA 2K7ZA 3HMKA 1Q0HA 2I62A 2OORC 2IS4A 1NXXA 3U49A 3C3PA 4R84A 5CB8A 5F9FA 3LBFA 4RNDB 1JMYA 1JYSA 5IINA 4LV8B 3RJMA 4CM7A 1V4NA 1NXQA 3QLVC 2PZMA 1L2TA 3FYUB 2AOUA 5DNCA 2JAQA 1EDBA 3EC2A 1ZD5A 2CPRA 4KJZA 2EEPA 3SJBA 2EZXA 3LKZA 2KFNA 3GCWA 1G16A 3G59A 4XCXA 2WLTA 4KPEC 3WGVA 1Z56C 5AH0A 1RYYA 4INJA 1QQ6A 3G2NA 4TXLA 5I48A 2VKTA 2ZI4A 2NO7A 4M0AA 3V4LA 2AHOB 2JFPA 1Z6AA 1ONBA 4GKJB 3SU8A 2RK4A 3WGZA 2LBPA 2OLKA 2PG3A 2FSVC 1ZQRA 4ED1A 4Z8XA 2FSPA 4KNWA 4K7JA 2QGFA 5IFKA 1FP4B 4UU7A 2C59A 4J2TA 2AEFA 1BX3A 4I5EA 2J7PA 4ZQBA 4XLTA 2JLRA 1QH9A 3ZD7A 1GAJA 4FWTA 1ZSNA 5C3UA 1S2GA 5CFOA 3SSAA 3VR6D 4EJFA 3RYTC 1BDBA 2RH5A 1H3FA 3A6GA 2SICE 1BS9A 2AR9A 4WH0A 3REQB 1C7YA 3W78A 2O7VA 4EJ6A 4MB0A 1M2JA 3QUTA 1HDCA 2VZLA 3BZUA 3GPLA 1ECBA 2GYWA 1A88A 5JS1A 3L0CA 4RE6A 3BXOA 1UJ6A 2HDWA 4GC9A 2A67A 4IIHA 2ZR8A 5JUWA 4MQFA 2F1OA 4G4GA 4PR0A 1TKCA 3G1WA 1LDNA 3I23A 3OWXA 4P9NA 3KEQA 3GMSA 4CTMA 1E2BA 1EX7A 2W6ID 1PUIA 4AG3A 1N0HA 1WCLA 1LJLA 2GSDA 3O73A 1V5IA 3T35A 4CEHA 3C4QA 5LBTA 4I9FA 4D9HA 1V37A 2GTIA 1BW9B 5CH3A 2O8BB 3MCWA 3FUXA 3QKRA 4UAUA 4IL6U 4P92A 1ODKA 2PX8A 3R7AA 3EGXB 1YDHA 1JBEA 2VF5X 2WOJA 2IXFA 1QR2A 1S2LA 4ZWNA 2DQYA 2ADOA 2KVSA 2F1JA 4TRMA 3OJOA 1ZM4A 1JTFA 4AZSA 1Y8CA 4XQCA 1PI3A 1BJKA 2V65A 4FCWA 2YMQA 2CXRA 4DR2B 3L40A 2ODEA 1O0SA 2I8CA 4LCEA 5LJIA 3AETA 4UB4A 4KE6A 3O03A 2WR8A 1F7VA 4W1QA 3DDSA 1FVHA 3TAHA 3TAUA 4LV5B 2ZQ5A 4PGQA 4H6WA 1F6BA 3UH1A 4AUKA 3ZDBA 1Z17A 4KLFA 4QICA 2DP4E 4F9TA 4RNCA 5D6NA 2JGNA 4JX8A 4W6ZA 4GT1A 3HKDA 2EP7A 4KU4A 3R5TA 3RROA 4K03A 4PPQA 2R96A 5G0UA 1XD2B 4E22A 3RG8A 3T7SA 4D74A 3TJRA 3RDPA 2P40A 2A1UB 1YSCA 4LA4A 3KJIA 2JFOA 3GIKA 1ZW1A 2XHEA 4IJWA 1OTXA 3PC8A 4ESHA 1VLMA 3DBIA 3CCCA 3GJYA 4H1HA 4AUMA 3DV2A 3AEYA 1O58A 4PYOA 3ICQB 4OBBA 4LSWA 1T10A 3EG9B 1NQXA 4D46A 3GLKA 4PVDA 4U5XA 1C8BA 2QUJA 1XP8A 3LYLA 3C1ZA 4O8CA 1NVBA 2Q8PA 2IU0A 4KQ9A 2BUAA 4RK0A 2PUTA 1OXKB 5B53A 2UAGA 4DDVA 2EZUA 4GE0A 1U8AA 2D7CA 4CL0A 2IY9A 4XFJA 1AKRA 2V97A 2W04A 1LS6A 1JLMA 1SCUB 3OEYA 1EA7A 5TMDA 1VSTA 3N0TA 1O5OA 1QIEA 2XKJE 1IBKB 1UANA 1U3UA 4C0ZA 1SUFA 4ZO6A 2IH5A 4MLDA 3JVIA 3OVMA 2WB1F 5C34B 1WVGA 4Z2YA 2CHUA 5A9SA 1Y8RB 3TS1A 2C98A 1R8QA 4O4HA 4BO2A 2CFIA 4UEQA 3PNLA 1CHNA 4UULA 1USGA 2UZAA 3QFTA 4GZ5A 5KC8A 4MQUA 2FMIA 2OCYC 3OM1A 1V95A 8MHTA 1O4VA 1SB3C 4H18A 1XD9A 3KQLA 3SHFA 1MO6A 4OXXA 4LEIA 4V39A 4Z9XA 3R40A 5EEGA 1Q14A 1QHIA 2Y93A 1WDWB 2WOOA 3FDZB 5B58T 1N6PA 3OE7D 4P2GA 3R6LA 2C88A 3W0LB 4MYUA 4MX8A 2BQ3A 3OU6A 2VAVA 3DCNA 4DXHA 2AXEA 2YV4A 2C4NA 4KUEA 4GRDA 3UJ6A 4C4XA 1ORDA 5EZ6B 1OR8A 3F6BX 1MA0A 5B1SA 1WSWA 3AGQA 1UBMS 5BQFA 2GBIA 3OTHA 4E1BA 4XRRA 1RPTA 1AHHA 1UXIA 1HGXA 4DQIA 2Z08A 1B73A 3FCOA 4C2TA 3FETA 1P17A 3G3EA 1RG6A 1KDOA 1WMAA 4HDSB 1I33A 1T5BA 3EIHA 1J5PA 2V8BA 1XG5A 1U8UA 1ADCA 1N9KA 2IS1A 1E5DA 1UBFA 4UOQA 3KJGA 5AI5A 5KSZA 2XXBA 5K6AA 2JHPA 3HKEB 2G4VA 2DTXA 1ESNA 1QHYA 3Q15C 5KFFA 1BX0A 4EB6A 2G3YA 1JFLA 2A0XA 1XRSB 4RPHA 3BMQA 4OHCA 4LYAA 4BVHA 1NYRA 4BNIA 3AETB 2GBGA 1BDIA 4EAQA 2HL6A 2XQKA 4PCAA 3BRWD 1DUVG 3Q12A 2ZVPX 1JLSA 1XELA 1E9AA 5CA1B 3JQQA 3MSXA 3RYHA 4HUTA 1ZW6A 3AJRA 3MJRA 2EC5A 1P4GA 4RNMA 4YCNA 4EZEA 1C9KA 1DV1A 3V00A 4JYPA 3WTBA 2AZMA 3HKDB 2EHDA 3QLTA 3GDOA 4X5VA 4YUYA 4YQEA 4P4PA 1QUEA 5IAAA 2M9NA 4MUNA 1N5XA 3RJTA 5C46F 3H1TA 4QATA 1BOOA 4L8FA 1A2KC 5KB3A 3OF5A 3CPHA 4WT7A 3WAGA 1WP4A 1C7ZA 1G5QA 5FL7D 2QVZX 4BVEA 3T1QA 5IAOA 4QUDA 3PXUA 1JTEA 4KFCA 2XE4A 1KSPA 3L1UA 1NI3A 2DF8A 2DUYA 3PXCX 4U7WA 1QO9A 1U3CA 1OZHA 2XUGA 4BWFB 1DG9A 2AG8A 4B7XA 2RHBA 3ZKWA 3UGJA 1OYOA 2KI5A 5JANA 4GLXA 1T5DX 3HTXA 1V38A 3K9FC 2JF0A 5DYTA 4G85A 2J6SA 1K8QA 3PV8A 3LDAA 3FNQA 3LBAA 4KB5A 5D5QA 1V4BA 1KETA 1OV6A 3AEXA 4LRWA 3GT3A 2QR5A 3I12A 4WFJA 3U80A 2WHEA 2OKGA 1VE5A 2CXTA 4NZYA 4ZVKA 1A4RA 5CAEA 1NUHA 1V3UA 4G67A 3OFJA 2IYTA 3OJ0A 3KM0A 5DEOA 3IP5A 3CIOA 2E4AA 1ZL2A 1IZZA 3N6XA 1RRMA 4V24A 5BXQC 5KTNA 3TLEA 4Q82A 2EKZA 4RIIA 2DJIA 1D0SA 2G70A 1MAUA 2XGMA 3QU5A 4PZCA 2ZS8A 5TR9A 2GUGA 2BDUA 2FZKA 1L7AA 1IXYA 4UASA 4JP3A 5ULLA 4OHXA 2XZLA 3OOWA 1Z7YA 3ZQKA 4FS1A 1CG6A 3OC0A 4M0PA 1NP6A 2KLBA 4UAVA 2WMYA 3QX7A 1GG5A 2I1QA 3DVRX 5AJYA 4YC7A 3MMSA 3G2JA 2GAAA 5ADUS 2B98A 4KN8A 1GNTA 2Y67A 3FCAA 2FRVA 3KQQA 4LXUA 4V1CB 2OE2A 1Z75A 3O2JA 4JA2A 7ICJA 1F8YA 4I5GA 3B2EA 1Q1ZA 2P3LA 1FRFS 1SIWA 4OX9B 4YJ3A 1W8DA 1S0UA 5DSTA 3GZJA 3ZCPA 1PP4A 1U2GC 5AQ1A 1PDVA 3WLJA 5C51B 1EVJA 2MCFA 4F1JA 4OXQA 2HV9A 2ZU6A 3GZ4A 4D8YA 5AXDA 5JDIC 5T7BA 4IDOA 4WUVA 2JLBA 1ODTC 1UMBA 1LC0A 5CPBA 1JZTA 1OLUA 2W3SA 2XX3A 3KG2A 5HGJA 4MHSA 1FFVA 2Q28A 3BE4A 5KSWB 2C5HA 2Y0SC 2OM6A 1S76D 1QS0B 1MQ8B 2J32A 3T5MA 4ZK6A 1ZI9A 3FFXA 2GCGA 3VC8A 1CDZA 4I1SA 3NHKA 1EK0A 3FGOA 4A03A 4KACA 5T57A 3DFZA 3OA2A 4C0AC 1BVSA 1AU9A 1YJAA 4GSKA 4TLDA 3VPCA 2EW8A 4QOGA 4LZWA 4PC2A 1N5IA 4F1KA 3GUCA 2NRVA 4RVFA 1SAYA 2GEFA 3RYHB 1L5RA 1TW2A 1IFXA 4OTZA 4GOKA 2GEKA 1RJDA 1CVRA 1IK4A 1UXGA 4ZT7A 3EFEA 5HTKA 3OU7A 4C5BA 1S89A 5AM5A 3BH6A 4HBGA 1L8QA 2QVBA 1E61A 4JENA 4RESA 2Z7JA 3HVUA 1MC1A 1KMCA 3OFNA 4BKQA 2YTZA 4MYDA 4A6DA 1U7TA 4LYFA 3LK7A 4DL7A 1K63A 1N2CE 4IIUA 1Y63A 3U40A 2WIKA 2PZEA 1R5NA 4LE1A 5DGDA 2FVXA 2P90A 4GE3A 3I39X 1UMDB 2FW7A 1JXEA 4ZI7B 4J03A 3HWWA 1KMIY 3ST7A 3TLJA 3HJFA 2IOFA 1IPFA 4C8OA 2HSWA 1JKMA 1CY8A 3Q7IA 2AX3A 4EJ0A 4CT5A 1NPTO 1LPNA 3LUHA 2VP3A 1JFSA 2CB9A 3DTVB 3IERA 4WASA 2ZEJA 5AW4A 4RXTA 1YZGA 3WVNA 4ML3A 1Y34E 3GRKA 1UK9A 1I4WA 3KV3O 2EHJA 1MQ3A 3PS9A 2IYFA 2LPEA 1RMYA 4XZ3A 3W2TA 3ME5A 4C6HA 1KK2A 2VHYA 1F3OA 1DOHA 1T3QA 1TZJA 4RL6A 1RWQA 5CDFE 5DJ5A 3MF4A 3V3TA 1W48A 1L4MA 1OXTA 1O95A 2FSGA 2HHCA 3OBIA 3UY4A 2QXUA 3P9IA 1ZN9A 2ZYGA 1GEEA 3CG4A 1U7HA 4NLLA 2XGPA 2D8CA 3U60B 4D0RA 3NNNA 2G0NA 4OFXA 4JI5B 2WZCA 2HJ9A 2RD2A 4Q18A 3UC9A 4OOFA 2OP1A 4JD5A 4ZO9A 3VMMA 4JVNA 5E0OA 1T3HA 2PO5A 4DHWA 5C4IA 1PTJC 2O1WA 4BEBA 2V74B 4MUYA 4BJ5A 2VQSA 2N1RA 3J80A 4ECSA 3PK0A 1G4HA 3M6UA 2W6NA 2ZW9A 3PSHA 2R6JA 4HO1X 3ZNOA 2VRCD 1T0UA 3WGLA 4FWBA 3QPDA 4D98A 1GNSA 5BPCA 3C28A 1F4PA 3P9NA 4RQAA 1UAAA 4DT1A 2RARA 2CDCA 4OATA 4MWBA 1A7KA 4MMZB 4PYNA 3D2SA 2X2EA 4D79A 3A2NA 4ZAWA 2PLFA 4A8TA 4KVGA 2ZRFA 3U16A 3VO1A 4ECVA 5LYJA 3CH4B 1ZU4A 4KPGA 1NZDA 3ETEA 1U11A 4IKEA 3KD3A 5JFGA 5TZVA 3CUKA 3C98A 1BAPA 5FA5A 1S2OA 5JAPA 1JUDA 3QIVA 2BBTA 2D8AA 4CUKA 1A2BA 1XLVA 1QCCA 5H81A 1M2VB 4KH1A 1XZPA 4M1WA 3G17A 2FMXA 4B3XA 5HFAA 3N2ZB 4P6VF 5HEKA 1B8VA 1ISPA 3WB9A 2X0EA 1BD4A 2SKEA 3TR0A 5K05A 3QELB 2QGZA 5LQDA 2DMRA 5JPDA 3K0AB 1B3RA 1RIFA 2MR6A 4U2FA 4RQUA 4C0HA 1I2DA 1K92A 5D5HA 3GG2A 4CBVA 2AG5A 4US1R 4HWTA 3S81A 1ZQ1A 1CEEA 3UJPA 2I3BA 1NSFA 1JU9A 5ECGC 2PZBA 2OPHA 1NW5A 1CY2A 1QTQA 2GLTA 2HY7A 2VYCA 2WE7A 4HVCA 1Z5NA 3TADC 3D4LA 3HYSA 1IUKA 3ADOA 5KMGB 1ODIA 2EDUA 1U2ZA 4NX2A 2OFFA 4PLCA 4Y2TA 3E61A 3KSZO 3ODPA 3M1LA 1F44A 4DN6A 1EG2A 1X15A 3DMTC 4NZOA 4ILEA 3WKCA 1ZCAA 4EBEA 1V6CA 2ZLBA 1RM0A 2FUG1 4FHZA 3N2KA 1FFUA 4UTNA 3PL5A 2C54A 2XVYA 3U7FB 1IZYA 1FL9A 3NALA 4D02A 1SL0A 4L4ZA 1PUXA 3JPWA 1GA4A 4RH3A 3O4GA 2ORYA 1AS0A 4RKEA 5EKXA 4F91B 4RQ5A 3U5ZB 4MEBA 4UBBA 5J4LA 1E5QA 4UTRA 4I28A 1JR2A 1TDJA 1RYBA 3JVEA 3FBGA 3TRJA 1X3LA 4OQYA 2OHJA 4X41A 2IC5A 4Q00A 4BJ1A 5IJ9A 2KMDA 2IHVA 4FGJA 3I0ZA 2VDJA 3C43A 1ABBA 4JR2A 4XJTA 1TGVA 3EAQA 3P96A 4GC5A 3TAQA 1WHTB 5DT9A 2EG9A 3DLTA 5DGCA 2C2WA 2GCNA 5A3QA 1SOAA 3D6UA 1CR2A 3ZI4A 4AJ2A 3AKZA 3IEKA 2YWBA 4IIJA 2WP8J 4IUBS 3RTEA 2C77A 4H3SA 1XDWA 1JKFA 1QCKA 1L3BA 4Y2XA 1C20A 2IUUA 4CM4A 4P84A 4TURA 1BGXT 1JXOA 4R1TA 1VKNA 2KN7A 2OO5C 5L40A 1IY1A 4PX5A 2C7QA 4DCNA 3P5BA 4TTIA 2P75A 4GPIB 3O4HA 4WWHA 1T15A 4F8EA 4M98A 1B26A 1IATA 3LQ1A 4ZGGA 4DO9A 4ZVSA 2HV8A 3I2IA 1WCV1 1X77A 5JNWA 1T36A 2CBXA 4HNTA 521PA 1Y1RA 3EYAA 1R0CA 3RHFA 5KKAA 4REMA 4GZMA 4HEQA 4TVKA 4RQ7A 3LOQA 1TKBA 1R27A 3EG5A 1GGEA 2OHFA 1JX6A 3K70B 2ZSJA 4HMPA 1BFKA 3IIIA 1N3YA 3W2HA 4IQWA 1SH7A 5LYJB 4AJ1A 1I5EA 1TA4A 2ORVA 1NKTA 1ESDA 2VHTA 3TPCA 5KWSA 2H65A 5BNTA 1JSCA 4QIHA 5CVEA 4PM4A 4EFNA 4J1TA 1C0IA 1JG3A 2VJ5A 5EA2A 3F3KA 1QMPA 3BREA 3C1YA 1CPYA 3NWEA 1W581 2XNHA 1F14A 2QRLA 3C48A 1J9ZA 4NWIA 1ZQGA 1S3FA 4DDWA 2NO4A 5E79U 1U3TA 2J6TA 2LE0A 2IHZA 1QV7A 3HBAA 4V0SA 3O8LA 1WPRA 4DPMA 3AHIA 3E3OA 2OCKA 3LWZA 4DGSA 3H5AA 4N6GA 1ZJ6A 2H2IA 2ASEA 1TB4A 2LTAA 5EKSA 4DC0A 3R8CA 3WRWA 3DTVD 4JYMA 3DS8A 1A82A 1I10A 3IT1A 5K8CA 5CCXA 4XDHA 1P1FA 2ZWPA 2CFRA 3G79A 5CP8A 2G8LA 4L9AA 4NESA 3C8ZA 4XUDA 4F6RA 3B85A 4N3GA 3RT7A 3EZNA 4YJDA 2AIRA 3OT1A 3ON5A 4F06A 2OTCA 2A1TR 1VKRA 3FBWA 1XPUA 5ALVA 2D74A 3ZWKA 3ZZMA 3D64A 4G3XA 4N0EA 2J3MA 2IBKA 3R0ZA 1NKVA 4PCUA 1SPBS 2ECKA 3BBPA 2PYDA 4MWOA 4CV2A 2DWPA 3HCCA 1NUTA 1ZA1A 2BZFA 1RYRA 1CQIA 1W0CA 1P9LA 2Y6UA 2ZYDA 1ZH0A 3CKMA 2ATEA 5LA6B 5CDHA 3A05A 4IV5A 4NPCA 3B5EA 2XEDA 5EVCA 2NU6B 5I7UA 1DAPA 1J8YF 5D7NA 3WL7A 4BTEA 4G24A 1B6GA 1YS2X 3KOWA 1ITZA 2MYTA 3DUWA 7REQB 5AVOA 1UOEA 4TXHA 1SXDA 4I2HA 1Z6PA 4HLUA 4Q4JA 3F2CA 4R3WA 2E4ZA