1Z4NA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate cocrystallized with fluoride
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4nA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4nA01
2ODAA 1U02A 5AM1A 1X42A 4Y2QA 4Y2UA 2FEAA 2C9MA 3E58A 5ALHA 4AS3A 4B6JA 2B1RA 1Z4JA 1RC8A 2YJ5A 3WK7A 2QYHA 4IG4A 3FVVA 3N8GA 4F71A 4OCZA 3PGLA 3ZWKA 2B8JA 2IYEA 3WKBA 2B1QA 4HGPA 4EX6A 3QU7A 1CQZA 1NRWA 3ESQA 5AM5A 2FPXA 4YH1A 4CF5A 3NANA 1Z4NA 4JDPA 2Q5EA 3U7FB 2C88A 3QU5A 2YJ6A 2RARA 5ALMA 3NUQA 1RQLA 2RBKA 5ALWA 3NALA 5AVRA 5AKZA 3E8MA 2B82A 5IT0A 3N5KA 3ONNA 4UMDA 2BY4A 1YS9A 4PNHA 3E81A 1RMQA 4BEWA 5ALVA 5AM3A 1RKUA 3A1DA 3KBBA 3WKAA 1F5SA 5JJBA 3QU9A 1Y8AA 2FPWA 4NFLA 3ZTWA 1U7PA 5FP0A 5IS2A 5AM0A 5AIBA 3P96A 3I1YA 2RB5A 5AI9A 5AKYA 4Y3UA 2WM8A 5A3RA 3A1EA 3AR9A 5A3SA 1LVHA 3EF0A 5AKHA 3W5BA 3VAYA 3I6BA 3N28A 3N07A 2YMLA 2YMMA 5ALFA 4EX7A 3AR7A 3EPRA 2QLTA 4OD0A 3SD7A 3L5KA 5AVUA 2FI1A 3FGOA 5ALSA 3CZ4A 1IWOA 2VKQA 5AVYA 4XQ0A 4KN8A 2HOQA 2JAUA 1RDFA 4UASA 3QU2A 3QUTA 3MN1A 2OA0A 3QX7A 4C4RA 2AUTA 2HF2A 2ZG6A 3KZXA 3WGUA 2HEGA 4I9FA 1ZD5A 5AW2A 4L6AA 2HDOA 3AR6A 4EEKA 1RLMA 2YJ4A 2GMWA 3RFUA 3L1UA 3M9LA 3AR4A 3ZVLA 5AM2A 2G0AA 3SF0A 4DWOA 1N8NA 2WFAA 2G07A 5AKXA 3AR2A 3CNHA 3W5CA 5T41A 3U26A 5AESA 3AR8A 3UMBA 1L8OA 3L0BA 1L7MA 3TLMA 4BX0A 5AHXA 2G08A 3QUQA 3QYPA 2JAWA 1S8OA 5AK6A 4XPZA 2RAVA 5AVVA 5A3QA 4HGNA 4YCNA 3ZX4A 4XOUA 2D2VA 4C4SA 4Y2SA 5ALOA 3L8EA 5AI5A 1QQ6A 5AKIA 5AW0A 4UARA 1L7OA 3NAMA 4DW8A 5ALXA 4L6CA 3U19A 3ET4A 2CFSA 5AW6A 2WF7A 2HX1A 2YFYA 1Z4QA 4CF4A 2YMPA 2EATA 3NASA 5AICA 1Z4LA 4NABA 4UM5A 1YJ5A 1XVIA 3B9RA 1RRCA 2I34A 4J2TA 5AVSA 3ESRA 1L7PA 3U7GA 2JGAA 2P27A 2HI0A 1T9ZA 3QUBA 5ALKA 1RPZA 2PQ0A 1Z4MA 3B9BA 1J97A 4KNWA 5AW4A 3AR5A 2HO4A 1ZS9A 2P11A 1FEZA 2CFRA 5E0OA 1EK2A 1AQ6A 3IB6A 2PKEA 4UU0A 3KD3A 5AI6A 3WKDA 4MWOA 2NO5A 4KNVA 3UM9A 5AKGA 3ZTYA 3QNMA 3EF1A 1ZOLA 3WK6A 3L7YA 2MSNA 1ZD4A 3D6JA 2MU2A 2YMQA 1U2TA 2ZOSA 4BX2A 1U2SA 2FDRA 4XE5A 1VJ5A 3OCXA 3F9RA 4Y2YA 2G80A 4Y2PA 1L6RA 3KOOA 3ZVMA 3HYCA 3L0CA 2DQSA 3M1YA 4L57A 3L8GA 1Q91A 1NNLA 2HHLA 3ZUPA 3IRUA 1N9KA 3OCUA 3OPXA 4MUMA 2B0CA 2WF6A 5AI8A 5ALQA 5ALYA 2WF8A 1L8LA 1VJRA 3ZWDA 5AVZA 4Y2TA 1SU4A 1PW5A 2NO4A 2I55A 5AK4A 4UMFA 2GHQA 3L0YA 4RETA 4NWIA 3I76A 1NF2A 4EENA 4AP9A 4HGQA 3U13A 3W5AA 1ZRMA 5ALRA 2CFTA 1WVIA 4BNDA 2P69A 5AKJA 1K1EA 5AW1A 4Y2RA 3OCYA 4BBJA 2IOFA 1Z5UA 2B8EA 3OCVA 4RESA 3ZVNA 2WF5A 2G06A 1ZD3A 3EWIA 3ZW7A 1TJ5A 2C8LA 2IA5A 3MPOA 4UU1A 4BEVA 4EELA 1YDFA 2EARA 3PGVA 3R09A 2OM6A 2HSZA 2FPUA 4YIHA 3WK4A 2C8KA 1YV9A 3BA6A 2WF9A 3ZI4A 3S6JA 4NAVA 5AK3A 1QH9A 3HLTA 2YJ3A 4BKMA 1TJ3A 1RKVA 4O8CA 1CR6A 1RKQA 3L8FA 4UMVA 5AIAA 3UMCA 3W5DA 4EZEA 3J7TA 1RMYA 4HGOA 4NV0A 5AKEA 4ZEXA 2JAOA 2EAUA 2W11A 3FZQA 4OFZA 4BNDB 5AW7A 4BX3A 4FYPA 2YY6A 5ALJA 2CN1A 3DAOA 1MH9A 4CNQA 4FE3A 3QUCA 1VFPA 3FPSA 4Y2XA 4FFDA 4J03A 5ALGA 4BYGA 2GHTA 5ALLA 2HF7A 2W43A 4Y2VA 4QQFA 3WK5A 2R8XA 1Z5GA 2OBBA 2GO7A 4UATA 2NYVA 2I7DA 4I9GA 3KDPA 1J8DA 2AH5A 4HYTA 2JARA 5ALNA 1ZRNA 1TJ4A 5IT4A 4UMEA 3E84A 3NIWA 1LTQA 5AVXA 3MC1A 5ALEA 1QQ7A 4UAVA 1QYIA 2X4DA 3A1CA 1S2OA 2YBDA 3PCTA 5AKKA 3R4CA 1T5SA 1Q92A 3DNPA 5AW8A 5AVTA 3A3YA 4H1WA 3WKCA 3QLEA 4AS2A 3KC2A 3WK9A 5AM4A 3BWVA 4ZEVA 1TA0A 4YGYA 4UAUA 3L8HA 3R9KA 2ZBGA 3QGMA 3ZU6A 1T5TA 2R8YA 1WR8A 1XPJA 4DCCA 1ZD2P 3K1ZA 3IJ5A 1XP5A 3N1UA 4DFDA 1Z4IA 2AMYA 1O08A 3WGVA 2I33A 4JB3A 5ALUA 3QXGA 4UW9A 3ED5A 1L7NA 3B8EA 2YN4A 3FPBA 1JUDA 4C4TA 2FPRA 1TE2A 2Q4RA 2FUEA 2AGVA 3AR3A 3ET5A 3NRJA 1KYTA 3RF6A 4E88A 5AI4A 4KYTA 4HAIA 3QU4A 1EK1A 5AVWA 2ZXEA 1WZCA 2Q4TA 3SKYA 1Z88A 3DV9A 2O9JA 1RLOA 2FPSA 1RMTA 4YIKA 5AI0A 1Z4OA 2I54A 4KX5A 4KX3A 3FM9A 2IOHA 2ZBDA 4YCLA 2BDUA 2ZBEA 3SHQA 3WK8A 1Z4PX 4UM7A 3GYGA 4GXTA 2OYCA 5ALPA 3SMVA 3WKEA 5ALZA 2G1AA 5AW3A 4ZEWA 3SLRA 3UMGA 3OCWA 4CF3A 2GFHA 2IOFK 2W4MA 4HGRA 5AW9A 2C4NA 3I28A 1RLTA 1O03A 4QJBA 2R8EA 4F72A 1Z4KA 2MU1A 4OHFA 4YCMA 5AK5A 2HCFA 4G63A 2FUCA 1YMQA 2R8ZA 2P9JA 5AW5A 2B30A 2G09A 4Y2JA 2WHEA 2PR7A 3OTQA 2ZBFA 3L1VA 4CE6A 5AKLA 4GIBA 5ALDA 3U7EB 1RQNA 3SKXA 5AVQA 1SWWA 2O2XA 4G9BA 3OCZA 5ALIA 2I6XA 3PDWA 3ZX5A 3DDHA 1U7OA 1ZJJA 4IFTA 1YNSA 2BDEA 5ALTA 1QQ5A 1WPGA 3MMZA 1SWVA 3U7HB
chains in the Genus database with same CATH superfamily
1GZ3A 5LU9A 3BJMA 4Q3KA 1AN9A 5FTKA 2AZXA 2B8JA 2ZJBA 4N3CA 3DMTC 3E35A 1UOOA 2Y4NA 3U3KA 3DEHA 1WHSB 4ZVNA 4N5DA 5IDQA 3RYTC 1U6KA 3CJTA 1QAQA 3K8YA 2ZQYA 3VPBA 1YQWA 1GKIA 4WY8A 3OOEA 2EW1A 3HBFA 1OILA 4M89A 1RW4A 5JJBA 4A1FA 3JS5A 1SFRA 3TQTA 3OT1A 1X3SA 1KZGB 2NTNA 3MCTA 3LC1O 4KWTA 1KERA 4LG1A 3N7TA 1YK1A 2WG2A 3I6QA 2CNNA 4ILKA 3R7NA 1Z28A 1OJ7A 3E9CA 3L7JA 2BEJA 4PYJA 4GDFA 2W71A 1EM8B 5HRCA 1IPHA 1Q50A 4HCJA 3T7SA 3OF3A 3CZAA 5HXAA 1GUDA 3OQVA 4W7IA 1SKUA 2ZM5A 4Q9KA 2J46A 2XMSA 1FFYA 5AK0A 1RYNA 3L0SA 1F6WA 1QKIA 2OXCA 2P9ZA 3UOWA 5EJFA 1NBAA 2L82A 2EJUA 1B8OA 3OE7A 3W5JA 4DQSA 4BVAA 4YCNA 2O2GA 3DZJA 3DBLB 4RTSA 3NDIA 3SM9A 3B9QA 3RU9A 2PGJA 4TLLB 1XJCA 1XNRB 1PT9A 4MVJH 3ET4A 3M83A 4LNUB 3MZ0A 2ZIXB 4OH1A 3GIMA 1K08A 1DC4A 2OV4A 4DSOA 4GNRA 1DC7A 4HH4A 3C3XA 2W2NA 1OPRA 3TLKA 4DLUA 2WSSD 4B3BA 3GT4A 3PVSA 3U4MA 3IKJA 4NATA 4DV0B 2ZFUA 4K7JA 4UBLA 1S6YA 2ZIWB 2FSHA 5DIZA 5GGXA 2FWAA 1H9AA 1T8RA 3ND9A 4BCDA 1GPNA 4OK5A 4XDYA 3MJVA 2L17A 2CJPA 5JQGB 3FRHA 4HZUB 4UUAA 2ZAIA 2YDYA 3P9PA 5CDFA 4UHFA 1F2DA 4MUEA 5HK9A 2J7PD 5JE8A 3P2MA 4KBFA 2J3HA 4NJEB 2NRXA 4JJ8A 2ILTA 1UP4A 4AG3A 2JW5A 3CG0A 4YXFA 1C3OB 1Z6PA 4LOKA 4D82A 4KLTA 4TZTA 1R9GA 2PD3A 1E3DA 3W0LB 2GD6A 4BDTA 2GEKA 4RW0A 5I01A 3WK4A 4KLCA 4HWPA 4US8A 2R48A 3SHWA 4LTMA 1SNYA 3MXOA 1ZJZA 4UMVA 2W2LD 4G5GA 2A7XA 2FZVA 1YVEI 1C1HA 1M83A 1OW5A 1PKXA 2YXPX 1H8EA 4BC0A 4QOFA 2BLNA 2FJPA 3O8OB 2PX3A 3NPAA 3DOUA 1D1TA 2F8MA 3JQ8A 2CXXA 3GRUA 3BQ2A 4N18A 3LVBA 6REQB 3N0VA 2F1OA 2VDWA 2JARA 3GFKB 3RSLA 4L02A 2A5JA 1M0SA 2R6DA 1EFLA 4N5LA 4TRRA 2EV9A 3I3OA 2FA9A 5I9TA 4MRMB 1LK0A 2WJVA 4KQIA 3HU1A 3HRHA 4D41A 2ZE8A 2R47A 1Y33E 2HJRA 4D25A 3L0IB 1X1QA 4GMHA 3PUVA 4UM8B 3AWDA 5HGXA 4YBRA 1RXSA 4BPBA 4CMGA 2P7IA 2Q4RA 2XLCA 1CJBA 2J33A 5EQJB 4ZREA 1Y7LA 1OY1A 1E1NA 2AOUB 3SKYA 5GONA 2VT7A 4IDGA 4C7XA 5HX7A 2PN1A 3O82A 2K89A 2PGXA 2WE8A 5J5CA 1GCIA 2VG8A 4IAOA 2OQRA 1E7YA 1WQ1R 5KKCA 4GMDA 3NW9A 5JXIA 3SM3A 4O02B 4O4JB 2NTVA 5F2EA 4ZHQF 3ETDA 2PBRA 2AR9A 1PG2A 1IPFA 5L40A 2TMGA 2QM0A 1NQVA 1HMPA 1UOPA 2XGOA 4C2UA 1HT0A 4R31A 3UHAA 2BM1A 3FRJA 4DQ0A 2NZYA 3ND8A 5A5GA 4M7RA 3NAZA 3QU7A 1JFRA 4HBZA 2YYAA 1P91A 2YZNA 3GG2A 4OXIA 1V35A 3QY9A 4ACOA 3PX3A 5KNBD 4WVLA 5THKA 2VHCA 2DKZA 1JSLA 4ZT6A 4JJ4A 1TV9A 1NQUA 4MB0A 5NLLA 1YUBA 2KZ3A 4ZCMA 3OEWA 1LJ8A 5FAKA 3M6XA 1Z1BA 3FOAA 2PFOA 4LF6B 2ZJFA 4K86A 3LQKA 3PXAA 4MPJA 3HXTA 1VJDA 1YE3A 2QRLA 5HJ7A 1JA9A 2JIPA 4HR7A 4NXMB 2ACVA 4QZAA 4ME6A 4RSHA 3GLFA 3QZ7A 3C21A 1YQGA 4EFLA 4BJ5A 3L1JA 3ZHUA 2VXOA 2XF8A 5AUQA 5I48A 3H5LA 4A4DA 5JSHA 1P9LA 4QZHA 1EUCA 1W0KD 4KZKA 1XYYA 4OG2A 1IZ9A 2W22A 1MJGA 2Y4OA 4QJFB 2XVAA 3WNCA 4HT3B 1RJEA 1E2BA 3HADA 2JGDB 4MRVA 3K70D 2AWNA 3VPXA 4DW8A 3GCWA 5DHPA 4Q4AB 3E2IA 1Y1RA 2UUBB 2C7BA 3ROTA 4M0CA 1ORHA 3GEPA 5KDOA 1SU7A 4AB1A 1THGA 4CDGA 4HDOB 3EGDB 1I3NA 1ODJA 1PI3A 3HB1A 1AOXA 2ZYHA 1SIOA 4RNCA 5A2QA 1F7VA 4ID9A 3TB6A 4DLTA 3SWWA 2B4YA 3TR6A 3M1LA 2JF0A 4O4HF 4IPTA 2REQB 4MR8A 3KL2A 3RRHA 2NVOA 1YFKA 2G5GX 4P82A 3WMWA 2HIMA 4AKTA 1L1EA 5IAGA 4Z6EA 3MINB 2K8AA 1V9SA 1YSCA 4JI0B 3LJKA 1F0PA 1QF7A 3SJ7A 2A67A 4KK4A 5ER9A 3JAKB 1KY3A 1KZHA 2Y9UA 2FMTA 1K1EA 2OHHA 3DCNA 3VHRA 1NOMA 3UXEA 4XA5A 3GZNB 1FTYA 3FIUA 3HA7A 1DELA 1GU1A 4B3FX 1UXHA 3DOHA 2KBFA 2IQIA 2WT4A 2CYAA 3JQ6A 2GYWA 4PICA 3R77A 3W5IA 4YDHB 3A7EA 1P2DA 1T0UA 2SKEA 2GKGA 3EGXB 1SCIA 1LC3A 2JFBA 3QSGA 4JIMA 4J0HA 1AS2A 3ECSA 2WB1F 3QFRA 1P0IA 3M6LA 1QWOA 1CWUA 2EBWA 2Y92A 5EE1A 2OHGA 3EEYA 5KINB 2HBYA 1P61B 2XNJA 3HJNA 5BQ3A 1V39A 4GHWA 5ALEA 4CMEA 4PC7A 1HL3A 2ZEJA 1VLZA 3WV4A 2R8YA 3OETA 1RBYA 3CO5A 5F2OA 1Z73A 3H7AA 1LX7A 3G1WA 1TI7A 4MKRA 4HVLA 5LOVB 1JSZA 1U4SA 4JOQA 1Z0UA 4M0FA 3L07A 2IIPA 3VVMA 2RAPA 9ICWA 5IINA 1T0HB 2GN1A 2R1TB 3ANNA 4D9JA 2P5TB 4LTDA 2IPXA 4ZVRA 2JHDA 2ZVQX 3OC6A 3R3YA 1VZ3A 4FVTA 4YRPA 1JDVA 1MVOA 3MOSA 1XQYA 5AW9A 1FFEA 4ZVLA 2D1QA 5E3HA 4RF4A 3TAXA 2E8MA 1IHXA 1PFWA 3LQ2A 1XFAA 2G7MC 5J2GA 1JFLA 1U28A 4BMVA 1NYQA 1DPGA 1M8FA 1MOPA 2DKNA 3R0ZA 2HBZA 2BDEA 4PG6A 1POXA 2WFLA 3D31A 2X5KO 4B9TA 2GB4A 5K4HA 1OFHA 2MCFA 3PGLA 1U7UA 4C7JA 3CUEF 1UBFA 4FPXA 4NY8A 3T54A 4FZ3A 1L7RA 2JD2A 1KVUA 3KYCB 5CG1A 2Y67A 2H16A 3E15A 5L7WA 2VP6A 4OJPA 2WJGA 1D9ZA 1XDWA 3WL4A 1J2JA 3VTKA 2YWDA 2VNHA 5KNDH 2BMFA 5REQB 4H18A 1XN1A 4HTFB 2QY9A 3LIPA 1WWUA 2EDAA 4G0XA 4Z0PA 4BNZA 2JEFA 2VJPA 4QARA 4TYMA 4EJSA 2J1LA 8ICRA 3H87A 1WXXA 4I5FA 4JP5A 5B37A 2QAIA 1NIPA 4UASA 5D5HA 5FO0A 5E6RA 5TPWB 3CEHA 1ZM7A 3LGSA 1JEYA 3QENA 2VA2A 5DTQA 1Q1BA 1UZLA 1YHZA 3EIOA 6REQA 3MWDA 2DETA 3O8LA 4IP0A 2OCGA 2OHVA 1D8BA 2AFVA 4F0JA 3K4HA 4WJZA 4F9TA 4IJ5A 3U5ZB 4YJDA 1V5IA 3TDMA 2CFSA 3DFKA 1MENA 3BH7A 2GXAA 1T9AA 1YVPA 1HOTA 2JATA 1BKSB 1I2AA 4U7JA 3DDNA 4BKRA 4C5BA 4LYDA 9ICPA 2D4HA 2PU5A 4KQ6A 1ZKMA 3ID6C 3GGPA 2FPPA 2QUIA 2OQ2A 3I9V6 1AQLA 3I2YX 4DEYA 2ZK7A 1U5BB 3O4JA 2BGLA 4J0EA 1H1DA 4CMEC 3JWEA 2XQJA 3LT4A 4PZCA 1X39A 5CVVA 2PX8A 1BS2A 3C6YA 5GIPE 3NT4A 1Z8NA 1ULSA 3A37A 4PINA 4ZWNA 1CETA 4G97A 3FOBA 5EZ6B 3SIRA 1WY7A 4GOKA 4RD1A 2A5FA 1GOTA 4H7HA 4ZTZB 3D7NA 2KB0A 2A5LA 5LDGA 4E2WA 2QQ0A 4KOEC 2H2DA 1UKCA 2Q5OA 3Q9SA 4EZIA 5K8TA 3O9ZA 1FFAA 4FQ5A 1QCDA 1TTQB 3EIUA 4R41A 1FMLA 3M81A 1YXMA 4OAQA 2XCRB 2BKLA 2I99A 4WCVA 2C31A 13PKA 2VVTA 2ZATA 5HVNA 2PQ2A 5TV2A 4CLOB 4EPYA 3OZUA 1D09A 1GNPA 1GFZA 3B20A 4E11A 2KWIA 1A8IA 5K3CA 4DGSA 2I9GA 4PC2A 1ULTA 1OFUX 4PTZA 3C4JA 4Q12A 4EUEA 2A1UB 4I8IA 2OT3B 3U1BA 3F7TA 4Y2VA 3T3IA 4MPTA 3I83A 3T9FA 5AJWA 2ZIAA 1TJ4A 1UBTS 5CLHA 1IVYA 3NGXA 4GBED 4FS3A 2LE0A 1CSEE 4YCDA 4ESOA 4AWAA 4LXYA 5H02A 1PQWA 2P91A 5G4KB 1VBNA 3FDSA 2XHEA 2XE6A 2IV3A 3DV0A 2HIHA 4UNRA 4EK9A 1JTEA 1IEVA 3I6YA 1QCCA 1TRHA 3G0GA 2PZAA 4EJSC 1QV9A 3SF8A 1OXTA 4K28A 3UHJA 4LZGA 2XECA 3H65A 2YS6A 5CB0A 3OCWA 4EF4A 2JCBA 1BVSA 2HCTA 4LOAA 3R7LA 4CT4B 3OE5A 2RGRA 1PSDA 3SXUA 5ALDA 2PUDA 1ML3A 2QD2A 3PDWA 2YY5A 3BHMA 1FQWA 1E66A 2R6JA 1R0WA 1QSYA 4X90A 2XEDA 1K4YA 3DKVA 5KT7A 1FDSA 2HW3A 4F5NA 4ZYXA 2J0EA 5GP1A 3RC9A 5MN5A 2Q3CA 4QOSA 2QN3A 2UZ0A 3IV6A 4A91A 4BWFB 5TMPA 3CBQA 3RSCA 5BSVA 2REQA 1VB3A 1ZVMA 4PYNA 2K4MA 1U6IA 5J47A 2C77A 3EYWA 1ZQSA 1TMGE 2WWFA 2WDPA 3TTYA 1FDRA 3WSWA 3H2JA 4MQMA 5IT9A 2B98A 3OJCA 4DN6A 2HWWA 4DSFA 4HNQA 5HR5A 2KHVA 3PNOA 3TQQA 4Z6DA 4KLGA 3C98A 1NJ1A 4IJWA 4W5JA 2INGX 1L1RA 1PP4A 4RQ4A 3KR2A 3FYDA 4PSDA 2ISOA 3OZ7A 5K0CA 3W2IA 8ICFA 5HOEA 2FZKA 1BC5A 1AUPA 1LKZA 4GX0A 4I19A 3AETA 3W6PA 4WZAA 3HR7A 4B3DA 2ODNA 2PGIA 3L7LA 4CL8A 2IVFA 4Q3AA 2HHHB 4F92B 2V54A 4GEGA 4KR9A 1M1UA 2Q9BA 5B6PA 5AESA 5DN9A 4NK4A 2F8TA 4P4SB 2CL5A 5A3QA 1DX4A 1KI4A 1WWKA 2FR8A 2X7HA 3DWGA 3H1TA 3E2EA 1R74A 3BZUA 3D5TA 4C4SA 1QCZA 1MTZA 2ZXIA 5HS6A 3NEYA 4DPMA 1A5BB 3RHFA 1QO7A 3ZWCA 3PGA1 521PA 4TT8A 3IP3A 4G8CA 1UJCA 4QZCA 3U4CA 5J58A 1F4VA 9ICTA 1A3CA 3QG1A 2Z7JA 1EMDA 2OGWA 3MB8A 1GD1O 3V7WA 4FX2A 4ND5A 3RB3A 2R8JA 4B6RA 1HDRA 3TM5A 2JLZA 3NIFB 4WERA 3GJ3A 4WXRA 2QUAA 4J1TA 1OHHA 4RAQA 4P3XA 2WHXA 3IMEA 1UMDB 2SCUA 4JR0A 2CVHA 3RBAA 5HGJA 1NJWA 1PT6A 4KITB 3TUIC 1PGOA 1OGYA 3VDMA 3RS2A 2AJLI 3EFOB 2PK3A 4GQAA 2IU6A 2XNDD 4RY2A 2KW5A 3GLSA 1UMBB 3X0DA 4E5KA 3U1TA 3CTMA 2C2EA 2Q5IA 4BZWA 4BBJA 4UHDA 3PXGA 1TGYA 2FE4A 3QXXA 1VMEA 2ANCA 4HWOA 3S1AB 1G55A 1JXOA 4W8GA 3VZRA 1KMHA 3KZCA 4MQFA 2XQKA 1GUBA 3MOIA 1X3LA 4H17A 4UHCA 3RSOA 4HH0A 1KARA 3EXAA 2O2SA 1W0CA 4LZAA 1I0LA 2X7JA 2ODEA 4KVZA 4D4IA 4JU8A 1MH9A 4YCBA 4FOSA 3CVJA 3WICA 3JZAA 2AZ4A 4MUIA 2P3SA 2XJ4A 1E4YA 1UZAA 3RQIA 1TK5A 4Z3DA 1SGWA 1ZVKA 5ELMA 4OVKA 5DDYA 4I4TB 3BCUA 1KDYA 5COQA 1TAHA 1EVIA 2C42A 3BBLA 3CRW1 2CLLB 3WHPA 3R6GA 5DLYA 2E8OA 3OHBA 3QVJA 1R0BA 4BLVA 2A4KA 4JR1A 4LJ7A 4JL6A 4X1IB 5IEBA 2R8IA 4WXYB 1M3SA 3IOCA 4Y6LA 1ZUWA 3MMNA 1YFLA 1DTEA 4X54A 1Z34A 3SJBA 3PX0A 4ESHA 2VIXA 3AERB 3GQBB 1H42A 1WEKA 3ZD6A 1KO4A 1S7GA 1YS6A 4PFJA 1Q15A 1CY8A 4OLAA 4I2VA 4JV1A 4ABYA 3ETGA 1XK7A 2QD3A 4HNAA 5IKMA 2IOHA 1HFJA 4XVHA 2QV0A 4I3GA 2R79A 5ALZA 1NUQA 3IBGA 4UUNA 3C5VA 1G63A 4MWSA 3KAKA 2XUHA 4TX1A 3HCEA 4M1QA 4GPEA 3SJAA 4TURA 2GAAA 3AF0A 4F84A 3CP8A 2POCA 1MKYA 5HM6A 2W5UA 4U2KA 1A2OA 3W06A 2ZBUA 1GGEA 1U8EA 1DG9A 2FR8C 4KFRA 1ZGAA 3HO8A 2GPYA 4FONA 4B71A 2D2FA 4LZNA 3RYFA 1I1NA 1ZITA 3T4EA 1J8VA 3G2KA 1N1GA 4GXRA 1H2RS 5CX1B 1E2FA 3HZRA 3DO6A 4Z8YA 5HFAA 3EJ6A 3L7NA 1OR8A 4TTIA 3QWAA 1NW9B 2XUIA 4M38A 1XCBA 4YJ2A 1A4IA 2XA1A 4YMVA 1NXVA 3O38A 3HSKA 5IK2D 5DHTA 3M9XA 1HE1C 1OBVA 1JBKA 4Q7LA 5B2EA 2PXXA 4J1TC 3DFUA 4QOEA 1NY5A 5KYUA 5EOZA 1G7RA 2A9VA 3MGCA 3UGQA 4JELA 1UP7A 4QIWF 3I9MA 3W5UA 1W8IA 1MDFA 4IWNA 1ZA1A 4D7AA 1C0EA 4IHAA 4CMCA 5BWMA 4XFJA 2JZCA 3UPUA 2FPMA 2AI2A 4Z9YA 2IH5A 3VDQA 2W7TA 3UAOA 2ZJ1A 3DVAB 2FMKA 1FJHA 1KO1A 4P7KA 2NT3A 1Q5PA 1QHHB 3OIUA 4ZOLB 5IIOA 4NFSA 2X0IA 1JHUA 4CM4A 4LRWA 3BILA 2C2OA 2Q1TA 1Z36A 3JAWB 2GK4A 3KE8A 4KAFA 2BE7A 4PG4A 1KBZA 2PBFA 5EZYB 1ZHHA 3PHJA 2ZI7A 3BGVA 5IABA 3AHJA 1UFKA 2C7RA 2ZUTA 1P4HA 1DTWA 1Z4QA 3KOYA 4NICA 4D4KA 5ARBA 2YMPA 1Q0QA 4FNOA 2F48A 2YV3A 3RH5A 2WHPB 2B1GA 4TQUS 5B7GA 5IP5A 4L4UA 2O50A 1KTQA 2BH2A 3H2IA 1P7VA 3TQCA 1WLSA 1IOZA 1R16A 2WM3A 2YX8A 1YZ7A 1YT5A 3B1KA 3RIGA 2BMWA 4LSMA 1YI1A 3VJRA 3IT3A 4DT1B 3QX9A 1FDWA 4S24A 5C0YA 2CT8A 1YJXA 3PJEA 4OREX 1OWMA 2QLFA 3O9VA 1H2YA 1TF7A 4OHYA 2AEJA 1XV5A 1U90A 4CMIB 4M9JA 3KZIU 3JR7A 3BIOA 4UEQA 1KSHA 3VZPA 1L5HA 3AHIA 1JJFA 2J3QA 1ZAYA 3OZBA 3FBWA 1OXXK 4Y6PA 3VI3B 1H8HD 3RVDA 2FZGA 2AXTU 1JDTA 5AUNB 3Q11A 1QR2A 2HWXA 3C3EA 5J40A 5BR1A 1Z5WA 3OMXA 4FGWA 2O2DA 4K0KB 1B00A 1BJTA 4LJXA 3HJGA 5EHNA 1Y82A 3QKSB 5H4GA 1ULHA 4FILA 4EBBA 1P2FA 2P67A 5DG9A 5HHTA 5H4HA 5JWHA 3WLOA 1UBUS 5G0UA 5C1DA 1NSTA 4GWLA 4TYPA 4EEYA 3RASA 4B48A 4HUTA 3JWPA 3R1IA 3ZI7A 3W4IA 3SBOA 3VO8A 1X1DA 1IRIA 2VBCA 1RAGA 4NLCA 2C97A 3BOSA 2Y9MB 2ZIUB 4GGMX 4L5AA 3HGQA 1Z06A 3OY2A 3GJ0A 3PBKA 1G8SA 2LW7A 2FX2A 4Z6CA 3E48A 1Z0SA 1ZQPA 1UKYA 5A3JA 4RA9A 3AUJB 3RU2A 1O97C 5IYZF 4JLDA 1MB0A 5AQ1A 3LRXA 1JEAA 3DVRX 1D6NA 4ZQBA 1YA6A 1E4VA 4H27A 1A9SA 1UFOA 4B9UA 3GFVA 2OB1A 1LV7A 2OCBA 2PD6A 2DC1A 4NBSA 3D1JA 5L3SA 4NMLA 2GX6A 1X1EA 2HFJA 2GZDA 5EIHA 2V45A 3C39A 4PHPA 4RY0A 1ISFA 3KU1A 2W6ZA 1O58A 1DGJA 4RULA 3DPSA 3BH0A 1C4KA 2D54A 4X71A 3JR3A 1W4RA 2VUUA 1ZC4A 4XSGA 1LXCA 2D5AA 1PEAA 3LWZA 2YJ5A 4M36A 4P0PA 3LF1A 5JZBA 1AKVA 3H3FA 1LDBA 2YC2C 1E61A 1W75A 2CYBA 2JRCA 3K1RB 4G4JA 2I7TA 4MV8A 2PAFA 2ET6A 4KUHA 2R7AA 4KDRA 4DJAA 2F3SA 5DQGA 3KQVA 4HTAA 4D3YA 5IT0A 3FKQA 4MEYA 1Z6AA 3DTNA 3OIGA 3PW4A 4ELUA 1HRDA 4AECA 1XPOA 1DJMA 4DM4A 1KZ1A 4B6QA 3WI7A 4FLFA 1KY4A 5AJHA 3P2IA 1NZDA 3HVIA 1FNSA 1Z5ZA 2P40A 2G4LA 1OKKD 3HB9A 4JQCA 2ORIA 5CA1F 5LL6P 1Y4UA 5HUQA 2CNOA 3CX7A 1KS9A 1F60A 2P2LA 5E1DA 1H1LA 4Q3DA 2JLCA 4FBTA 1KR5A 4A9AA 4GUDA 4R1PA 4IEIA 3OT1B 1Z12A 1U99A 3SR3A 2WR8A 4GFDA 4RPCA 1WCYA 1Z75A 4E5MA 1XJ5A 1N8NA 4I7EA 3OFSA 1SXHA 2RGGA 2DG2A 2NG1A 3LY7A 1MJ5A 3RVJA 1WZEA 3K6SB 3H17A 5HDQA 3C41J 4F8RA 1UWCA 1AXGA 3R7AA 1MAWA 2XZDA 4KPFC 1M72A 1PNOA 4R6XA 4J9MA 3H4BA 1PYGA 3FYCA 4N7RA 4QZIA 4MKHA 5A4KA 1Q16A 4RTQA 3L8MA 1VMAA 2QVGA 3TW6A 1N2CA 5K4LA 5DGXA 5CP2A 3L7MA 4QSHA 1E3IA 5F9HA 4KNWA 5AW4A 1XPUA 3UYKA 4QPJC 4R83A 3D4LA 4MR9A 4ZYVA 4HQRA 2BUCA 1F6BA 2OV6A 1P74A 4ZZ3A 2ENWA 4K6GA 1Q8KA 1J49A 4DIDA 5KNCD 4KRGA 3L8GA 4XWAA 1Z8HA 4BNGA 2X9GA 3BWXA 2ID4A 4IJQA 3ZWDA 1S1MA 3AU2A 2HT1A 3LW7A 5M34A 2CLCX 4WLNA 4GXIA 1USIA 3LGAA 3H5AA 4LNAA 5CJJA 1JX4A 3STTA 1ZRMA 4QASA 4J76A 4CDRA 3EWIA 1OTYA 4LKOA 1JG6A 4FHZA 3OU2A 1UQTA 2R8KA 1Z35A 4WDRA 5LYYA 2HGZA 4O8CA 5F35A 2NVUB 3WQBA 4LA4A 4DE5A 2Q62A 3R5XA 3D64A 4ZEXA 4AFNA 3Q7RA 1GV0A 4X7MA 1I7LA 3OECA 1B74A 2WP8J 2WTMA 5AR1A 4BNVA 3ROPA 1U9ZA 2O3SA 4GBGA 3L0PA 1UJBA 1XNJA 3NVAA 5FNVA 5CFQA 2FZLA 4MF2A 4QBFA 3ORRA 1JYEA 1GSIA 4PC3A 1G7TA 3D7MA 3K92A 1UKEA 4A6DA 4BPRA 4EITA 3IIJA 3FLMA 3BIWA 1ESCA 1CY2A 1ZESA 5DGDA 2CB0A 3CEJA 2A1IA 1W34A 3JQ8B 4V0OA 4EQ6A 5FI1B 2VDWB 4KN9S 2X9VA 2B3DA 3GGCA 1BFUA 4ARIA 3FROA 3JPNA 3O95A 3IE1A 3I9V1 2E1RA 1E2NA 4ISBA 1GG2A 1EK5A 2PKCA 4YFKA 5HCNA 1E9RA 3GWGA 3DHNA 2XKJE 4BRUA 4NL9C 3ZV6A 4D9CA 4R9VA 5A4FS 1NJ8A 2PIDA 3ZY2A 1G8FA 2HAEA 3B13B 1KSJA 4B3RB 4KTTE 5IU6A 1CR1A 1LKYA 3OKPA 4F6RA 4HSGA 2AR0A 3OFNA 2C4VA 4G07A 1P2GA 5LZ9A 1TVEA 1RQNA 3F3YA 5GONB 4PF1A 1D8LA 4GT1A 4RQNA 5JEEA 1DIOB 3THVA 5DF1A 4RFLA 5SICE 4DT1A 1M2WA 3HT3A 1YI8A 2W6ID 3DMTA 3U7RA 1GPH1 4HBGA 4ALMA 2QN6A 6NULA 3X2EA 1FFDA 2QIOA 4QUJA 4PG7A 5DHRA 2EZ9A 2Q2VA 3TAQA 4I99A 2XNKA 1IQRA 3ASZA 4YYZA 1I0ZA 4K9OA 4PNHA 1T1GA 7ICJA 2O3TA 4DR1B 3QE2A 3OZDA 4M98A 1FVHA 3DAFA 4JP3A 4WBSA 1I7DA 2DY1A 1KQFA 4X24A 3RBZA 1N6NA 1RBMA 5CM8B 4C3UA 2O05A 4GZ6A 1L5SA 5CFMA 5I5GA 3N07A 4MAAA 3AXTA 2XUAA 3VAAA 3EPRA 2ZSFA 3A06A 5KFKA 2OE2A 2ZB2A 3B3QA 1F0NA 4G5YA 5BQPA 3EMBA 5KFSA 1HNNA 1QTQA 4PLYA 2CXUA 5JRZA 3PQ8A 1V5WA 2ZKIA 4KAXA 4MTCA 2IH4A 3RFUA 3WFIA 5C5DA 4ALIA 5JECA 3FYUA 3GLGE 2YYZA 3FTFA 1SQFA 3NJ4A 3W2HA 1B8UA 1FTNA 3HP7A 2D62A 2VZEA 4P4LA 3CS3A 3NDPA 1R9MA 3FVTA 3SZ3A 1OH8A 5BN3A 2DBQA 4DL9A 2ARKA 1TA4A 4LSWA 3LK9A 1IJFA 1XVIA 2HPVA 3KPUA 3HCPA 2AK2A 2Z08A 1EUCB 3CHYA 4LF7B 1T9ZA 4HWKA 3HLYA 4Z49A 1V45E 3L6DA 1U45A 3AX6A 2ZDQA 4BQOA 3GEMA 1U2TA 4QM6A 3AHGA 3MUEA 3F2VA 2A5GA 3PGMA 2QX6A 2C4MA 2G8NA 1K1QA 3HDTA 2QNBA 5JSYA 2WTXA 3ENKA 1F8YA 3ZLJA 3FPFA 4KU4A 4DLGA 2LRHA 3IQXA 4KQWA 4M53A 4X45A 3GQVA 5JH7F 2EBHX 1CUVA 1RZRD 5DGIA 4I2GA 4FYYA 2B35A 5HMLA 2XQIA 1PSZA 4OH7A 2K8BB 5K8JB 5DM0A 1ZNZA 5FYDA 4EVQA 2ZSIA 2PI4A 2C8LA 1BPBA 3PGVA 3CG4A 2C5FA 2YV1A 4MR8B 2O7NA 1N8TA 3E05A 4OIFA 3QTBA 3S4YA 4DL7A 4WOJA 5DLFA 1KKUA 2KEYA 4NAHA 4ECQA 4O0LA 5CCDA 3TNJA 3ZK9A 3PB3A 1P8JA 3DEEA 1NZPA 1W8DA 3VPDA 4D5GA 2IZOA 5DBAA 4AM8A 3SZOA 1JAHA 1QDEA 1HFWA 1JHYA 1YZLA 4CGZA 2G3YA 5I9IA 4Z4IA 2F64A 3HM2A 3LGXA 1IXYA 2J4DA 2BD0A 2F43A 4N7BA 8ICLA 1VP3A 2IODA 4PO1A 3TE7A 4DILA 2AFIE 3GFPA 2FSIA 3TRFA 2X86A 4UULA 3TGWA 1WR8A 3GRFA 3LUFA 2QRGA 3DEYX 4TKLA 1ADJA 1Q0RA 1JWBB 4L4SA 2ZWOA 1MB3A 1LF5A 2WUDA 2RONA 2WSMA 5EJMA 4EI8A 2WHRA 1KYTA 1W30A 5FAXA 3OUZA 4OXKA 2FEKA 2NMVA 8ICXA 3LA6A 4ZQEA 3C1YA 2C7GA 2YXDA 3K6SA 1PQPA 1ZLXA 4K9SA 1B6RA 2OYCA 3D6NB 3ANSA 3ZD8A 3PR5B 1HGXA 4C0HA 2ZP1A 1L4MA 4RF2A 3WQSB 4NOKA 2Y1GA 3FUTA 4HXYA 3WHKA 3V7FA 2HBKA 2XSZD 7ICHA 3S8MA 3NO4A 3FYUC 4IHQA 2XA2A 1T2NA 1QUEA 2PSSA 4QGBA 3SR0A 4L07A 2M9NA 3M8SA 3V6MA 1MBZA 4Q1VA 3OIWA 1UFQA 4DQPA 3OQBA 2ZJYA 4TL6A 3H0EA 5J3JA 3NJRA 1PLLA 5KCZA 3RTBA 5TEVA 5KHAA 3SE7A 4WBNF 4BP3A 3QXJA 3LFTA 1GFIA 1YJBA 4QXAA 1E2PA 2WFLB 5DG8A 2R1VA 4C6HA 3R6TA 3GIJA 3T5DA 3SX2A 2BPCA 4DTCA 5AIBA 1ORDA 4HLUA 2J87A 2AVDA 4Y0NA 3P2JA 5ESWA 3TWOA 3GIKA 3BTOA 1PJLA 4C0XA 1HLFA 1Z25A 1EZ1A 3QTLA 4K6CA 4ED7A 2NVUA 1YMUA 3R3ZA 2R96A 3CNNA 2C5SA 4INPA 3GLIE 3FTCA 2JEZA 1DAGA 1T4GA 2YIDA 1G20E 1MXFA 4PJ0U 5K3SA 3K8ZA 2TSYB 3JPOA 4WKOA 4BX0A 2O5CA 2XCAA 3DWEX 4M0DA 4EJSB 4C0JA 5BR8B 1AK1A 4EYSA 1AMOA 4O3MA 3USES 1BYUA 3RO7A 4ED6A 5E6RB 1M6YA 4YDRA 4U8GA 4C7YA 1NOKA 2D0DA 2C5EA 3A6JA 4C7VA 3GXOA 1J33A 3DDZX 1JEYB 4CKXA 1TVCA 4MGZR 5A9RA 2DPIA 1EHYA 4EKYA 3QUBA 2W4IA 1Q12A 2H29A 4I28A 3MWDB 3K15A 4A92A 1A9ZA 1PZNA 1I80A 3S68A 5EINA 1OFVA 3OA2A 3QITA 2V0CA 5A5VA 3O2QB 4PC6A 1YA4A 5K2OA 3L93A 2ZVPX 2V7QA 4MDYA 3AVWA 2W9AA 4RGVA 4JB0A 3LWBA 2FPPB 1SU4A 5FFFA 3A05A 3K0BA 4XWYA 2QZJA 3I8XA 3KJIA 3Q15C 1VG1A 1MVNA 4V0KA 4YP9A 4IR9A 3SHOA 3ER9A 3JQCA 3OA0A 3GJSA 1VLHA 1V43A 2P30A 3W9YA 2CV0A 2QD4A 2X1MA 1OWOA 3QBJA 3B5IA 4EW3A 2OCIA 3BM5A 5KFXA 1XD9A 1T6XA 4WA7A 4LY6A 2VFAA 1IM2A 1ZQMA 2OGUA 5EWFA 3KHRA 2P4HX 3NBMA 4CHTA 1V96A 4N9QA 2WMDA 4ENRA 3OF2A 4FTWA 2HA7A 2Z2ZA 4DLKA 5FBZA 4BLRA 1MOZA 1UANA 1K7XB 1W1UA 4XGNA 4QZEA 3L2OB 4EBEA 2PBLA 4LVUA 1QPGA 3LKZA 1BX3A 4ETWA 4ZYWA 1A82A 3HXKA 4HYTA 2W6QA 1N36B 4DBLC 3P0EA 5J0YA 1LLFA 3ZGYA 4OLJA 1KP2A 2A6PA 4JV5B 1Z7WA 2Z9DA 2J0VA 1ODFA 1YOVA 1XVUA 1HXHA 2Z9BA 4EA8A 4MNTA 4ELVA 1BD4A 4TMTA 4EB0A 2WTUA 3LHFA 2NWQA 1XNHA 3VYVA 4HLUC 4JZYA 1RAEA 3GDWA 2A59A 2D59A 1CVLA 3QG5A 2R11A 4D6XA 3I9LA 1EXMA 4H1VA 3IUYA 1AJEA 5LQCA 2EKQA 2FUKA 4LPKA 1F7UA 3MT9A 2GYVA 5FJJA 2Z1DA 1V47A 5EPEA 9ICQA 2XZTA 4LFBB 5DI3A 3DV0B 4XYGA 2W4MA 3FIJA 2QIPA 1E1CA 4R98A 4ZOAA 1IM4A 1HA3A 2R8ZA 2PR7A 1KPGA 1URPA 2WIJA 1UPAA 2VSFA 4G9BA 2HWUA 4HMOA 1GLVA 3PRYA 4MKIA 3OJOA 4WOPA 2ATXA 3SF8B 4ZT3A 1SXIA 4C4AA 2XUDA 3O21A 1TK9A 1ORTA 4YP1A 3P2KA 2WUVA 4HGPA 1DQSA 4EHBA 1ADBA 1S4QA 3UK7A 2PRJA 5HHIA 1RCFA 3JD4A 1JLMA 1U3VA 3SXUB 4Q1CA 1A97A 1YUMA 4CM8A 1KJZA 1J20A 1FS4A 4K6OA 2O8CA 1FNNA 4HUJA 2MYPA 1TZKA 1U2ZA 1I5OA 2IXAA 3WLSA 4IM7A 4UQPA 4QUGA 1TM3E 4Z3KA 5DG7A 2CJWA 2NV0A 3UBTA 2WM8A 1SIWA 1TDJA 4KLOA 4NAUA 3DKIA 5GZ3A 3EEOA 1RHUA 4EEZA 4AXBA 1G42A 3KELA 2HJSA 1OBFO 3DZCA 9ICGA 1XYVA 4ZAGA 2PH3A 1X6JA 3LY9A 3Q5DA 4PCVA 4HP8A 5T14A 3W5HA 4FR2A 3K2BA 2F1RA 2ZYWX 4ETMA 3KTOA 5J29A 1X0XA 2CXTA 5KT2A 5KAMA 3OOSA 3SF0A 4CIBA 3G0HA 1W6UA 4JN6B 2XWPA 1QF9A 3OSZA 2GK6A 2G88A 2CEAA 4ND6A 3A6LA 3GROA 5HR6A 1HEUA 3AETB 4EQZA 4WZAB 1J39A 4JT8A 2HHXA 4RK6A 3B53X 2AC4A 5CVUA 5EXXA 1JWAB 2H0QA 1MO3A 2PGOA 2PZFA 4PZOA 1UDXA 2EQBA 1OVMA 4FGJA 1PBTA 1V6AA 1QYXA 2Q5JA 2Z3ZA 3NHSA 4NESA 2PMKA 2ZR7A 1XTJA 1JFSA 3T5KA 2R2AA 4F8YA 2BJWA 4BWGA 1FSPA 1XFDA 3K0FA 2C1XA 4D9MA 1GKUB 1PEYA 3S2ZA 1MTOA 1WUHS 2X23A 3BREA 3SSAA 2QMZA 2PRYA 3CLSC 4AO6A 2FQXA 3OQPA 1JVSA 4X00A 4W7HA 4OFXA 1IOVA 3UQYS 4QZ9A 3I23A 2FFAA 1COZA 3L77A 3G0BA 1CT9A 4AKEA 4AJPA 2UVQA 4F97A 1KQ3A 4JODA 1A77A 1XTRA 4O4LF 2SCUB 2ERXA 2IW3A 5JUWA 1VPDA 4Z99A 1USUA 2FH5B 2XYQA 3S6JA 1TO1E 5FBQB 3R44A 3HCRA 2OGZA 4G85A 4G0NA 4FFBA 1E62A 1VJGA 1N56A 1RT9A 2C84A 1WP4A 4N12A 1KKMA 1TK0A 3KQPA 3FNEA 5AKEA 4YMSA 1PL6A 1Y6ZA 4JEIA 2KKPA 3W04A 5B1YA 5LN1A 1AUVA 2HNBA 4I2DA 2GFQA 1KMHB 2IU0A 4MQFB 3H9BA 4ED8A 3ODPA 5I9LA 1T10A 2AKYA 3WIBA 2C7OA 1YMVA 1S1CA 1A04A 5L3RA 5AVTA 5H3CA 3UTDA 3T7JA 1WA5A 4KMSA 1LDYA 5J4HA 4IYRA 4U6QA 1BPYA 1KJNA 1PR2A 4F7WA 2H4JA 5EMHA 5B3LA 2YN4A 4BFZA 4ARZA 1EXNA 1NAIA 2FUEA 5T64A 4J9SA 3ET5A 1F5NA 3WB9A 1WY5A 3AF1A 2G8LA 5KL8B 1M1NA 5I3ZA 2HA2A 1XSPA 2GZAA 4DFKA 1KR2A 4F4YA 5DMHA 2RKBA 2VP9A 1J56A 2HPHA 1I2BA 3BTVA 3SYZA 2R62A 1J2UA 5IJAA 1KAMA 3WFZA 1QVVA 4A0GA 1SBYA 4OHFA 3JAMA 1UC9A 1GY8A 3GD7A 5ENVA 3GP8A 2CNWD 2QY6A 2QT9A 5DGBA 4II7A 1VCMA 2O3QA 4HPXB 5CIYA 4HNAB 5J2AA 4AY5A 3OJWA 3OQHA 2ZB8A 4JB8A 2RHMA 3M4NA 3I4LA 3OJUA 5C8YF 3TLJA 2IHVA 3IDZA 1HEIA 5G0WA 2QDKA 4GBJA 1N6HA 4I66A 1GTSA 1E8NA 2COEA 3DUFA 4YJKA 4NECA 1GZ6A 1GGNA 4BGIA 2HJGA 4LY9A 3I04M 4XR4A 4MCHA 2OAEA 1KI2A 1WB6A 3RYFB 1X77A 2XXAA 1P39A 2P6UA 2YQ5A 3CNQS 1LVHA 4OQQA 1BA2A 3PJGA 3KB2A 1XSNA 4RTJA 4YJ2B 3KT8A 4AJEA 3UV3A 4NCXA 1ZUIA 1TPZA 2ISCA 3E1SA 3K3PA 2Q3BA 3M49A 4KN8A 1SVWA 1RM0A 1PQ4A 1SCAA 3PCRB 4M76B 5IKEA 1M6NA 4BLQA 4JV0A 4AMGA 4LX0A 3T7TA 5KYUB 4R3NA 3T5BA 4GM0A 1DOZA 1LX6A 3EXG1 5E4JA 2I2AA 3R6WA 2QTRA 4DAOA 2O6KA 4PO8A 2I4OA 2XWJI 2GXQA 2GPSA 1ECFA 5A4MS 2Y66A 4AMBA 1N3LA 1N7IA 3D3JA 2WWHA 2GDJA 2Q0HA 5KG1A 3U3ZA 1RRCA 4CM4B 3SDBA 1A2QA 4IIJF 1K68A 2PQ0A 1RAAA 2J9FA 1BPXA 5E0OA 1EK2A 4TWZA 3LSTA 3A0UA 1RI3A 2XQGA 1G16A 3GLQA 1ZIDA 4LN1A 1L5WA 4JWNA 5H2FU 3H5RA 3BCHA 3LPCA 4OXYA 3RJKA 3WNVA 1L4EA 1DTWB 1P4JA 2JEOA 3H6KA 3BMOA 5LQAA 1XRRA 4QBTA 1SY7A 5G0SA 4MKFA 1YK0A 3QUAA 3TZCA 4LNHA 3T1VA 1XZHA 1ZN9A 5CVDA 3UXOA 2VJDA 3D3WA 3LYUA 3IAAA 5BSHA 4RPYA 4HDAA 2E7ZA 3OICA 3S55A 3C45A 4GRDA 4MH0R 5FEMA 1V3VA 1N9ZA 1CEQA 2NO6A 3KYIB 2HQ1A 4GF5A 3GJXC 1N2EA 2IZ5A 1RHRA 2FN4A 4RJLA 4KPEC 3H97A 3DHYA 4AIRA 2QXYA 1W36C 3BWDD 3UO8B 2JASA 1TFRA 4E09A 1T8WA 3BB4A 4DFPA 1F8GA 1L7EA 3BKXA 5C32A 2RBEA 1L5HB 4XGQA 2GAJA 1I14A 5IIMA 3KWLA 4ECXA 3E9RA 1W1WA 4PZAA 4FE3A 1MO4A 3DE1X 2Q0QA 4GVXA 1QG2A 1VG0B 5DE3A 1T4CA 3BK7A 2ZU0C 5LA6F 1RACA 3PY8A 1UKZA 3A10A 2VOEA 1XQ6A 4WKGA 4JI7B 3O6VA 3TTWA 3RRBA 1OA0A 5FHQA 1XQXA 3I5XA 1C81A 2GD2A 1R6XA 5EMMA 5LQMA 1GNVA 4UM9B 1KAHA 3DSRA 3NYRA 4CODB 2FX3A 5ANRB 2LYBA 3DB2A 4XD7D 4CMBA 2V7BA 2UZIR 5KMGA 1Z2AA 3KAJA 3AMZA 5EJ9A 4N6OA 2DPGA 4IIDA 5D7NA 1RAHA 5DKFA 4QSMA 4B9MA 2EIXA 3KPVA 4XVCA 4EGQA 1OBCA 4MV3A 5KAIU 2FOXA 2EERA 1BPEA 3KU4A 2XVMA 3SNHA 1MA0A 3IRVA 1JHZA 2AFHA 4U02A 4RA9B 1D2RA 1J2NA 1EDBA 2YV2A 3EXIA 1I30A 3WJ1A 3BMQA 3RI3A 4PBRA 3DBOB 3SC2A 2N1BA 4L08A 3NH6A 5K01A 1Z62A 2NU7A 4XYLA 3GVPA 3V5NA 4E5PA 5L3SB 5KQSA 2E87A 1QSGA 2W2QA 1D6JA 4QWAA 1A5ZA 2GJAA 1G2IA 3PPWA 3E8MA 4LWOA 3RU3A 2GCEA 1CJKC 2QL6A 2FXVA 2RHJA 3OZXA 5LYJB 3N0XA 1ARZA 5IUNC 4NPCA 4GOOD 4P0PB 2OC9A 5EJ5A 3PUXA 5YASA 3WA7A 4F7DA 4KREA 5K05A 3JU3A 3RTCA 1G9SA 4ECTA 3MGAA 3ZW9A 4DIOA 4P93A 2YMLA 4X60A 4Q18A 3TARA 5BQXA 1SB8A 2HMYB 2PSDA 3GT3A 3DMRA 1E6WA 4Z1MD 5B2FA 5IDWA 4E5DA 2R2GA 3CN7A 4AYBF 1BA3A 2PGLA 1FFHA 4YCAA 3EYAA 3EARA 2E49A 4ZRDA 3D2NA 3F71A 1H8ED 2OECA 1N77A 3ITEA 4PGYA 3WYNA 2JAWA 1H1LB 2OXRA 2H59A 4RPXA 1L3SA 2XMPA 5G02A 5ALXA 2DVMA 4GXJA 2OXTA 4GUAA 2QN7A 5FOUA 3GLFE 3MT7A 5KKNB 5I9BA 1MAAA 2Q4EA 3BFVA 1J1UA 1E4EA 3RR2A 5ITWA 2JGAA 3G5AA 4RV9A 1X7YA 3I12A 3D4IA 2OSBA 2X2PA 1NBWB 3BQ7A 3S8YA 2VQEB 9ICJA 2Z5FA 2UXDB 3UCXA 4WKPA 4PCUA 3BXHA 2NO9A 2IYSA 2P65A 4RD4A 2C04A 3CEMA 1X9SA 3MRVA 1P4AA 3ONWA 4P83A 4PSVA 1XZFA 3D6HA 1N2CB 4X6XA 1QYRA 4MQEA 1Z6QA 4ZAWA 3ZK8A 1BGXT 4QXQA 5KEIA 3ICWA 3P45A 2ONJA 3ZD7A 1DBSA 1XT6A 1PJ4A 3HB7A 5LM3A 1R6VA 3HY4A 4HXFB 4MR9B 2BHNA 2F3TA 2OOSA 2R8RA 5G4LA 1XDDA 3TQRA 1RJDA 4GKKB 1QOZA 1CUAA 1PR3A 5DB7A 5KTSA 4FYXA 4Q03A 4WT7A 2H4XA 4NZYA 1TKBA 2DHDA 4BKMA 4P4UA 1TJ3A 3V6JA 5BUSA 2JCSA 1N5RA 4ALNA 1I6LA 3THYA 4ZGBA 4MUNA 4QATA 3QVVA 4Z86A 4WXEA 1MV8A 3HJTA 2P5YA 2XYVA 3FZQA 3FTPA 4A0SA 2DBRA 1RYUA 3RB8A 1OZGA 3QWIA 3GZ4A 3BXXA 4RMJA 4KSBA 2PX4A 2O0LA 3OHSX 3W1EA 3T3OA 5KSWB 4UTVA 3UQ2A 4FXPA 5IANA 2IXBA 1GL9B 2YRXA 3B3GA 3LCCA 1ISRA 4FBMA 3IG5A 4YROA 3C3DA 4QUHA 4XZ3A 3G6WA 3FG9A 2VAPA 3H9UA 5FNVB 4DLXA 2XBLA 2GM5A 1V5FA 1NKTA 2HLDD 2XKBA 4RHCA 3UT5A 1TYBE 5I9NA 2I54A 2JJ1A 2HMVA 3PENA 3IHLA 4MEAA 4FEAA 2G1AA 4JMUA 3JVIA 1NL3A 4UC0A 3Q8SB 1WXHA 1UK6A 5EVJA 2NACA 4K81B 4PZNA 5KFAA 1DGQA 1GQSA 1WHTA 2GUGA 1PK3A 4EQ6B 1T9BA 2HCFA 3Q5GA 4U9HS 3AHDA 4MRAA 3E9DA 3HW8A 4FGLA 3IAHA 1IPEA 1I10A 5U1PA 2HQRA 1VKZA 1SWVA 5DBGA 2AT1A 4DXAA 1H5NA 3BJIC 2BMEA 1S0VA 3H2BA 4X63A 3HZOA 1EHIA 4FZVA 3R0JA 2REOA 2ZUUA 3B6MA 4IUCS 4O3FA 1LKYB 4F6RB 3A4IA 3CYFA 2YWRA 4RQ7A 3OH8A 3BL6A 1JQLB 2Y8EA 3FVQA 1V8BA 5AVRA 2JDID 2A0FA 4N0PA 3BXOA 2JFZA 4PSKA 4JI2B 4PGQA 2Y0PA 2B25A 2ZB4A 3U3OA 3QU9A 3QEOA 1TGVA 1PK8A 2HHJA 4FQ7A 2WKWA 4RLSA 2IX3A 1GU7A 2J3KA 4MVJE 4MYCA 2R87A 3I0ZA 3RQSA 2IMWP 2RHOA 3VGJA 4ID3A 3L4PA 3KB1A 3G6YA 1PX2A 1U98A 4N4AA 1ZSYA 2AMFA 4LCEA 3KHTA 4LI0A 1USVA 2FZEA 2JAUA 4CKBA 2ZG6A 4TVOA 4Y9RA 1YQDA 2VRNA 3K6JA 2WQZA 1SUPA 3DDWA 5KU1A 1XCGB 3N9IA 3GI1A 1CZOA 4QXMA 4QPDA 5HKBA 1VRCA 4TLBA 2ABWA 4J8PA 5ESXA 1XD2A 1UDWA 1E99A 3A7DA 4LZPA 5MF6A 3OBIA 2AYXA 4TV8F 5G3ZA 2FEWB 3ABQB 3DZIA 1MJHA 4PWZA 1H0SA 2VHUA 1U3GA 1C3EA 4BATA 2KS6A 1I2ZA 1PVPA 1Z00A 2PL3A 2V4ZA 5FORA 2I6FA 2OV8A 4J2TA 4XRGA 1U9YA 1GAQA 3FYUB 3VR2A 2GCOA 3BE6A 1YB4A 3TW4A 4WLUA 3ZWXA 1ZK1A 5BN4A 3NS7A 1II8A 5JVDA 3RGGA 1II9A 2GZSA 1CY1A 3ZNQA 2XD9A 5BN3B 3KKNA 2QU8A 4HL6A 2EZ4A 4RDHA 3GZJA 4ZRNA 5DBIA 3ZBUA 1DKLA 2A9JA 4RTRA 1JG4A 4EJ0A 5ALQA 3JPWA 2VDKB 5F1KA 4JEMA 3ZHSA 1KETA 4RFVA 3LCRA 4FI3F 1HSZA 1XZGA 4REQA 2PWBA 1CIJA 3IDOA 4ZV4A 1M0WA 2J59A 4CFZA 2B4TO 3VQTA 2PPVA 2FGKA 3QW2A 1T94A 1ENPA 1K4KA 4BKPA 3BXGA 1N1DA 3S2GA 3P9NA 2VZ9A 1N75A 2DEUA 1H2AS 1SJ9A 3KKMA 2C8KA 3UMJA 3D2AA 5KAFU 4MVJD 4M7PA 4JUDX 4EYHB 1LJLA 4O3OA 4PZPA 4Y67A 5DV9A 2IH2A 4B6EA 1H69A 3TIGA 3CW2A 1V7CA 4D56A 3ZV4A 3RPEA 1X7HA 5LYJA 3GWZA 1N60A 4W8OA 2PWZA 2F9LA 1U0BB 2QMYA 4LX8A 1ORRA 1IN4A 5FWXA 2ES4A 3E84A 3A04A 4ZI2A 4AQDA 1S2OA 1Q92A 5EKDA 3UV6A 2XXJA 4BE7B 3Q7PA 2FQQA 4W82A 2F00A 4NEHB 3W5VA 3LQ1A 4DIEA 2J32A 2YX1A 1PDWA 8ICBA 1SHUX 1ECWA 1RHKA 4I5IA 3SQDA 1GRRA 2F43B 1JWLA 3FFWA 1E79A 1Z5PA 3HX0A 4RCVA 3ZE2B 1JN3A 4W5TA 3LYLA 2FN3A 3CMCO 3SXPA 5FOXA 1IJKA 4XB1A 4QTUB 4NL9A 2C29D 3SYLA 3RVNA 2X8LA 3IO5A 1FDUA 4R8RA 4K46A 1PL8A 1DDGA 2BYTA 3WXMA 5ICMA 2Q6OA 4GZLA 2A2ZA 2AMJA 1USGA 3TQ1A 2OCPA 4UBJA 2YL2A 2ZTUA 1PJRA 1U9JA 2V7UA 4F60A 4UAYA 2GD0A 1ZUD1 4IGAA 1JAYA 1U02A 1UC8A 3DQZA 2RRDA 1NW7A 1SC4A 4OBBA 3HBAA 4I1UA 2BBOA 3I2JA 4FOLA 3IURA 4KSCA 2PL1A 2QUKA 4C7ZA 3ZIDA 2QQFA 4F4ZA 3OTIA 3KJFA 1E0AA 2E89A 3U7FB 4F5YA 1M54A 1TU4A 4NM2A 5D86A 4KXLA 1VL8A 3F2CA 4FWBA 5AOCA 4URHA 3O3MB 1SU6A 3HUTA 1UBRS 3DMDA 4KBYA 5C5JA 3U7JA 1F5SA 2J6CA 1YCFA 4OHZA 3LHSA 4M0EA 4TWBA 3EC7A 2HYIC 2Z56A 5ES4B 5TS3A 2YRWA 1UJ6A 2UXBB 5H1YA 2FW9A 2WWRA 3EH2A 1C9EA 2GBIA 1M66A 3CZ4A 2R1VB 4KGDA 3CSUA 4Q47A 1EWRA 1VDVA 3LT1A 5F5XA 1VPLA 5LLSA 1C7IA 1JR4A 3TOZA 2BOVA 4DARA 5BNZA 5JLJA 4CLDA 1CR4A 4L4RA 5CW2A 4YPVA 3TAPA 3HJEA 4PIPA 4OJOA 4IHJF 1NJ5A 4KQXA 2RAVA 2O48X 5ECDA 3LVRE 3DP9A 2PX2A 2WIAA 4HJRA 4TUYF 2R7LA 3CW2C 1Y4AE 3ZLUA 2O8FA 1WZIA 2CCKA 1WUKS 2QJOA 1F9EA 1N5JA 2AG8A 4UAWA 1NNUA 5AUOB 3WE7A 1HOXA 5CITA 1EFTA 2VPPA 1V2HE 3OPVA 2Y0BA 3OU6A 2XOEA 4AURA 1CULC 3CKLA 3RVBA 3C2KA 4KLJA 3C7TA 1ZQOA 5KX5F 2OHJA 1CUSA 4L4ZA 3I04A 3F9RA 5B30A 3RFTA 3I09A 3LX5A 3RC7A 3HWX1 1X7ZA 3L0CA 3MRTA 2DQSA 4MUMA 4CTOA 3L7OA 1L8LA 3H1GA 2YWHA 5DM4A 5LZ8A 3T5GA 3BSFA 4X7PA 3CLRD 3KVVA 4W63A 1T4BA 1SURA 3ESZA 3GD5A 2P69A 4ZP1A 2P79A 2QTTA 1DCFA 3WLPA 1ZQAA 1YDFA 3PK0A 3H2KA 3BN3A 3N6VA 1C0KA 3OHPA 4H6XA 3P9QA 3Q85A 1H2HA 4I0WB 4J3NA 3CE6A 4TXMA 4LVNA 3GDOA 3FMPB 1CYDA 4XQCA 4RTOA 3R7DA 2IZ7A 3FKSA 3V7NA 3E27A 4FN5A 1TB4A 4X44A 5LJLA 3AGPA 4QQFA 1KVTA 2NYVA 2JBAA 2D13A 3KDPA 1TAUA 3RVPA 1K86A 5AXAA 2F4NA 3DTTA 3AUTA 1Y3HA 2C4HA 3BD7A 2NO1A 3L79A 3JQBA 3IQFA 4IDOA 4E0DA 1MQ8B 3KEOA 3BDVA 1TA0A 4IO1A 2EDUA 4HDQB 1L1FA 4K9MA 3N1UA 5GZ1A 4JB3A 3D5EA 1XC7A 5EWMA 3R9WA 5CHEA 3IPXA 1DBPA 4ED9A 4KBGA 1ICIA 3K1TA 2OG1A 4B84A 3IUQA 4MUYA 1U1DA 4YRNA 3JYNA 2JLRA 3E3MA 1E9SA 1YOVB 3BE8A 2BKXA 1SOWA 4E12A 3ZS9A 2P4QA 4BL5A 3AK4A 4HC4A 3W79A 4XOIA 5C1BA 3MMXA 1U3CA 5LB4A 1K7SN 3CURA 3OM8A 4LJYA 3QFTA 4Y2JA 1BHQ1 2PS3A 1M6WA 3ZQKA 2BTEA 2XOXA 3D7KA 1N3YA 3EDCA 4AXXA 1XAJA 4RC9A 4GYJA 1ULAA 4CCYA 4NV1A 3BGOS 1XZCA 4FB5A 3BULA 1RQ2A 3H42B 4A10A 3CJRA 5EWEA 5DI3B 1NWHA 1SCQA 1E1CB 4Q9AA 4KO3S 3HJRA 4A8PA 5IW8A 3KL4A 5B1EA 1ULBA 4JUFA 3G9QA 2B99A 4DDTA 3VU0A 1DQYA 1QYCA 1P44A 3WL8A 1E1MA 4YJGA 2UUCB 3HN6A 2F6RA 5IC6A 2WBLC 4F04A 1NVXQ 1Q7BA 3IJRA 1JIJA 4E5NA 3LBYA 4C2TA 2DKOA 3MJFA 4GR9A 4O4IF 2EJVA 2XGGA 1NZBA 4KOAA 5A3SA 3AVVA 4PVDA 5D3ZA 3ZJYA 1Q83A 5CLLA 2FYTA 2N1RA 5AJXA 4CM8B 1X1AA 4ZVUA 3TH5A 4OY3A 3IP6A 8LDHA 2O8CB 3OSNA 4B5KA 1SUWA 3CLKA 4JT9A 1RFLA 5ICCA 1QIDA 2PUAA 2JI6A 4P92A 3KDSE 3DDUA 2CJWB 1F1BA 3C1AA 3E9QA 5COBA 3VH2A 2QNRA 3G2HA 2JAXA 2RG1A 1RZ3A 3T38A 5HBRA 3PGXA 4NVRA 2AOVA 3NEPX 3QE0A 4BO9A 4BB9A 1KI9A 2ODQA 2FWIA 2VF7A 3OUTA 5HIAA 5JQWA 1PTKA 2HK6A 4KHPB 1B6GA 1BMQA 2H1HA 7YASA 4IOJA 4WA8A 3OX1A 4D57A 1WU8A 5GPBA 1DRWA 5A03A 3LZDA 3RRJA 3LI2A 4EY3A 2GVZC 3W34A 1J70A 2PHZA 2VDJA 1DAFA 1U31A 5KNDD 2I4NA 3QKIA 2PLAA 3FI0A 3OIDA 1PX0A 4K2AA 3JQBC 4UVEA 1S2GA 2JVKA 1JDZA 4MSUA 4BY9E 1EDEA 1M73E 3M6ZA 1BN7A 4PPYA 3CM0A 1E1RD 5LWHA 1FTGA 3LL4A 3E9ZA 3ZI0A 2A0WA 5AH0A 2F76X 1R8XA 1QB8A 1BE6A 3BFXA 2W3RA 1OOEA 4UHKA 1EH5A 2XT9A 4JLVA 4R01A 2QEQA 4LZDA 1YRWA 3H9JA 1MGOA 3CVUA 2NOAA 3FMGA 4AP9A 1J99A 2Z2IA 3K72B 4R05A 3K0FB 3WRYC 2AHRA 4UBNA 1TUEA 1N61A 1CD5A 1WJGA 1V6CA 3QMPA 4S3MA 4KYUA 5SYMA 4EPVA 1T8TA 2PUBA 2BFCA 2BM9A 4IKPA 4JC8A 4MQ6A 4QJ4A 3LHIA 2Q0ZX 1CR2A 4PSAA 3D1VA 5DSZA 1R12A 5D8DA 4DCUA 1SCDA 3SC3A 1NRJB 3OVMA 3A3PA 3EVGA 3AG5A 5M04A 4FFBB 3AM4A 3TZBA 2IXFA 1U8TA 1DKUA 1XYGA 1YZNA 3I62A 2CJFA 1I3MA 5AHRA 3MBOA 1C29B 2BEWA 1V7PC 1JN0A 1NV8A 4WXPA 4Q43A 4UXIA 5CM2Z 5JY6A 1D9DA 3DE4X 3ZWNA 3WLEA 2PS1A 1JAZA 1ESEA 1PL7A 2O52A 4FU0A 2VWPA 5K0NA 2H00A 3ED5A 3L46A 4KODA 1QBGA 3AV0B 2QUBA 2AGVA 1YRQA 1Q3UA 4LXXA 1JXMA 3QMWA 1KKLA 3NCTA 4D6YA 5FWAA 2IEGA 1UXGA 2FF7A 1WZCA 2WYHA 2PQMA 1HEYA 3B6IA 2RH4A 3K9CA 3MLBA 2HU5A 2QAGC 4GG1A 2CLIB 3WKEA 3BQ9A 4R1NA 2VDPB 3UW3A 2HVHA 2PA0A 3RODA 4B2LA 1FLVA 4ARZB 5TZVA 5JZ9A 2NU8A 1J8MF 1T1EA 3NUGA 3GA0A 1M1NB 2HIAA 4MW5A 1W93A 1B6SA 1OI4A 1JEJA 2JK1A 5ALHA 4C22A 3HP6A 1BH2A 1W36B 3TOCA 2O1SA 2RJ3A 4AZ0A 3PFFA 3T9DA 1V95A 3NZEA 4YWJA 1C7FA 5J2CA 3MYRA 2H7YA 2XBUA 2WMOB 4ZHQA 1E3SA 5FHRA 2K8CB 3GJYA 1RI5A 4C4OA 1QE0A 3I52A 5BUQA 4MWDA 4Q3EA 3QKUA 4QC2A 1ITZA 3QJGA 1NURA 2P4UA 1SXQA 1HM5A 3TMAA 4WK0B 1CF2O 1DIRA 2LVBA 3DUFB 4QT0A 3TEJA 4QZ8A 1AF4A 1MU0A 2VKQA 2B3TA 3GGGA 1KK0A 3K2IA 4TTTS 2XXAB 2OILA 3PFGA 1P9RA 5JAIA 5FI0B 4ARAA 2O0KA 2RE8A 2KFZA 3W9SA 2KYRA 1KEJA 5T41A 2WINI 3HH8A 4XLTA 3EGCA 2WA2A 3Q7EA 2D0OB 4MROA 3LQYA 5ARDA 2Q3MA 2G1UA 4UE6A 4M0AA 3NEAA 5BN5A 2XRZA 4TM7A 1L5MA 2IEBA 4WSOA 4GX5A 4TS3A 4JI4B 1XTUA 5DN6D 3Q3CA 3UV7A 3BGWA 2Q5LA 4GR4A 2XRMA 4BQRA 2UVUA 4O1IA 2IEZA 4DIFA 4ENTA 3F4KA 1LBHA 1J25A 1DG1G 4J9QA 4WFIA 4R6WA 1EA7A 4YECA 1ZGZA 4LYEA 4DEXA 3SYKA 2NZVG 5U9CA 3ZDFA 3CSDA 4Q05A 3VGPA 4LMRA 1IQUA 1GN9A 2JEJA 1UQUA 3IBCA 1AUQA 3KG2A 1YZHA 5CJ7A 1S7CA 3NWEA 3SICE 2J9FB 1LA2A 3RFVA 2XI4A 1L4UA 4QNLA 3HY3A 2EIHA 5DP1A 1X7WA 3HUDA 1F0MA 2W2KA 4Y7DA 1HV8A 3DL7A 5TMEA 3GV5B 2EEZA 4H7DA 1GQOA 2ETXA 3IL2A 3BMOB 3IGFA 2H4ZA 1I2DA 4HXEB 4Q0MA 3O4HA 3EQ9A 3NHWA 3ABZA 2MTBA 1D8AA 4O4HA 1NK0A 1NIJA 2BCSA 3ICPA 4NARA 3OPYI 3D3WB 4X7BA 3HYRA 2VSQA 3UWKA 1A8UA 3GRPA 3TI7A 4QU9A 1ZGBA 2QW8A 2DH5A 1XIVA 2OD7A 1O95D 4AN0A 1TL7C 2A94A 4DGQA 5DXAA 3Q6MA 1LF0A 3H2GA 2HVIA 4AYTA 3JQRA 1TADA 1I51A 4WN9A 4LQ4A 4MZXA 1XKLA 1UXOA 4P08A 3O0TA 4R69A 4ZVTA 5JCXA 5TVKA 5F7ZA 3RSGA 3VHXA 1ZMBA 2W04A 1IY1A 4A0QA 5K0FA 3EAQA 5CTJA 2EKLA 2E6UX 4CIVA 1T4CB 1J23A 1KQQA 4OL0A 3PUJA 2XCLA 4N01A 1T26A 4M1MA 5TT1A 4RUCA 3HRKA 1D3AA 8ADHA 3LS2A 1KY5A 2O9JA 1PZGA 1W5EA 2CWDA 2NAFA 2BDUA 1UBJS 1EWKA 3RAEC 1AZLA 3CLUD 5AW3A 2NSLA 5KMGB 2CJYA 4Z54A 2E9SA 4HGRA 1V25A 1WDKA 5C3MA 5HYVA 1T13A 1R27A 3ACCA 3GLTA 1NK5A 5BWOA 4PHCA 1BYIA 3ISDA 4KH0A 2IS4A 1G8MA 2ZRMA 4AVYA 5C7YA 3U7EB 2RGWA 1SWWA 4R8VA 5TQVA 1DS6A 1EG2A 3M9WA 5JD4A 1H4VB 5F5NA 1VRWA 1ECCA 5K8CA 1KHTA 1ZNQO 1M2HA 4URUR 1ODCA 1JALA 5JCJA 4HLNA 3TM4A 2AFHB 4O4LA 4CF5A 1VJCA 4GVLA 4JI1B 4Z4GA 3EXIB 5T4FA 3VPGA 1GPMA 3BMQB 4QQRA 2O7SA 5G2OA 1GZ5A 1AXRA 2ZSHA 2ZYRA 3SC2B 2QTHA 2AN3A 3GELA 4CT5A 2NU7B 3K5IA 3WGYA 5IC4A 4C0BA 4Y30A 2AR7A 2B1IA 1XZDA 3FW1A 2PH7A 1XEWY 4FMDB 1U8FO 3S2YA 5SYAA 5J23A 1POWA 3Q3IA 3TCNA 1YB7A 3E9NA 2JGKA 3CH5A 3MJSA 4G65A 4PW0A 5IM5A 2W83A 2EAMA 3QJ5A 5MN6A 2WAYA 3BTUA 2Q6KA 4R1QA 3BJYA 4UB8U 2IWRA 3D8HA 5IXYA 1I3KA 4F86A 4AMYA 2Q0XA 2HSGA 2DYKA 3CUSA 4XFKA 2L69A 1NLFA 2YZMA 3P2YA 3PICA 5ERYA 6CHYA 2VH5R 1ZM3A 1MCZA 3RRZA 4L3VA 3UK1A 1GILA 1QQBA 2RHBA 2CVZA 4CG0A 1XU9A 3WISA 4QRHA 2XX3A 2VJ4A 4KJZA 4FN4A 3ZE6A 1EVZA 3HL0A 3LHDA 5FXMA 5KWIA 4MVWA 3HI6A 4G0UA 2YVQA 4C4YA 1F48A 1LSJA 1DB3A 2PFPA 3WBBA 5JD5A 4BX2A 1XXLA 2GRUA 4YC7A 4AZTA 1THMA 2FRXA 4HLDA 1D03A 3ZWMA 3JXEA 1E4EB 1DRGA 2F8SA 2WB1C 1X7YB 4DV2B 2DBZA 3GAZA 3HKBA 4JH0A 2CMHA 4ITRC 2X76A 1AK2A 1XDSA 3IN5A 3OPYA 4F1KA 2OAQ1 3SZRA 2PT7A 2R5WA 4GPTA 4BNIA 3DZHA 2KX7A 4ODIA 5CK4A 1ZYQA 1CY4A 1E6KA 4UE2A 3MPOA 2A9KA 5TIIA 3QYJA 5CB8A 4D98A 7ICNA 2VO1A 1EFRD 2J3JA 4MQEB 2CHFA 1D1QA 4O6VA 5C8ZA 2FZWA 3PNQA 4FZJA 1N8SA 3RT7A 9ICOA 5SY6A 1ZLYA 3V8RA 1P7CA 4EZEA 3ENVA 1N6KA 3SV3A 1JE1A 1X1BA 3ZHCA 4A6XA 1SOVA 1U1FA 4JBLA 5DBEX 1RAIA 3BEDA 4WNYA 1VFPA 3NTXA 2G40A 1Q3HA 4YRFA 3HEMA 3GRZA 3H11A 2W43A 3LVWA 1TOAA 5J1SB 3S29A 1GITA 2I4TA 3G8CA 3ZGXA 4QVGA 3S40A 5CG2A 5AKKA 2HSWA 3THYB 4D97A 5JNWA 3WRXA 1A95A 3VNSA 4BVLA 3OLZA 3B1WA 1L0BA 3M6KA 5TARA 2TMKA 1Q7GA 2HTEA 4EYQA 3IHKA 4EMTA 4IGFA 3EIHA 3WWYA 4D8TA 4QKQA 1O8BA 5DKWA 3SV4A 3A14A 2HQBA 4ARBA 5I4IA 4ENVA 2LUOA 4YY3B 1ZI8A 2PWAA 3Q72A 4BNMA 1ISSA 3D8UA 3D8TA 3SEAA 2J9ZB 3QXSA 5J0WA 3X1XA 1I3LA 8OHMA 3TFSA 2C4NA 1RLTA 3CZQA 3UK0A 1H0RA 3GZFA 3F8TA 4F2WA 3SZMA 3SXJA 3RSSA 1SELA 2G09A 4L5BA 1KO8A 1BXZA 2LWIA 4MWBA 1ZISA 1FPQA 1CVRA 5ALIA 3UT5B 4MW2A 1ZVQA 2A9FA 2H52A 4Y2QA 4NCBA 1IYZA 1RHMA 5DX8A 1Q84A 1WHTB 2DH6A 1KQPA 2WM2A 2JGLA 2ZSEA 3E82A 1CUJA 5IXSA 1KSFX 4GKJB 1STOA 4FC7A 1XKQA 4XDHA 1Z5OA 4G3IA 4W5QA 1NHWA 3VI4B 4BKOA 2G4VA 4KSYA 4GMKA 5P8WA 3FWPA 2H54A 3OPMA 3KLOA 1JRLA 2O23A 3A25A 2BBTA 2CHVA 4FJ0A 3AKZA 4URYR 1VLLA 3IVMA 5DHQA 5KYWA 4RNNA 3LP5A 4YMLA 4KQKA 3FPLA 4MLPA 4Y6RA 4J6EA 4U6PA 3VTAA 2FWPA 2JGRA 2P1ZA 1MQSA 5COAA 1W48A 1ZQFA 4YMHA 4I9FA 5LKAA 1H2EA 1HT2E 1P2BA 3DE5X 5JAHA 2CGEA 2I4LA 2A1TR 4JCOA 4UHJA 5AM2A 4RIHA 1IK4A 3D6AA 4DQUA 2C28A 3T79A 1QYWA 1H2FA 2HF8A 2OGSA 2OLKA 1AHHA 1YZYA 4O29A 4MQ4A 3OP1A 2IHTA 3QKWA 1BHJA 3ZU4A 1ZEMA 1J90A 3QBDA 4Q9NA 4A36A 1NKBA 4CKBB 1Q0UA 1SZPA 3CWZA 5CDFE 1SM4A 1JDNA 3NBQA 2CLOB 3KEMA 1X70A 2CUZA 4WEOA 4YWHA 3BYZA 3A6FA 5EHQA 3G9UA 3L5OA 1XD2B 2JZNA 4GGOA 1R5BA 3GH1A 2KSOA 2KPOA 3Q7SA 4IDCA 1JSCA 1QZXA 2YN0A 3V6KA 1D5CA 3IPAA 1GAEO 5LZ7A 3CGWA 4ND7A 5BOVA 1WSAA 3WRXC 1Z00B 3L7AA 1I7QB 4RL6A 1R2QA 3O4RA 1VE5A 2D5CA 1P19A 2Z3WA 3Q5EA 3LPAA 1VKJA 1U0FA 4QGSA 3AM1A 2WF6A 3PSIA 2FKAA 2WWXA 3FD8A 2GCOB 3TSCA 1ZJ6A 2VSOA 3G6KA 4L0QA 3ZG6A 4F50A 3FUUA 4UMFA 5BN4B 3I01M 1PR0A 1WZ2A 3PW5A 4HZGA 1II8B 5JVDB 3ITDA 1D1SA 1UPBA 4JP1A 2P9GA 4C80A 5JJLA 3N8KA 3IXQA 1PEDA 1QWSA 3GARA 2A7QA 3OE7D 4WRRA 1SBZA 4H31A 5EZQA 4OMFG 4OHRA 4IIFA 2IEYA 1UKVY 4REQB 4DM3A 2WIBA 4QPNA 1QP4A 2AQKA 4KR7A 2ZE7A 1NI3A 5EMLA 1NDQA 4JS0A 3TLXA 1UAYA 2P2ZA 3FVWA 2GHTA 1JYFA 1KK1A 2LXNA 3DV2A 2H2GA 4HB2A 1OGIA 5THQA 4ER5A 5JV5A 3DC7A 3OIFA 721PA 4V2UA 2J5QA 3CW8X 1USKA 4IFIA 3SYNA 1UAGA 4ZEVA 3NRCA 4F4UA 3L8HA 5H16A 1ZQTA 1U8UA 1FIQA 2OV2A 4G5QA 2EQ5A 1LLUA 3WQQA 2IW1A 1YR6A 3RH4A 3KUUA 3BAZA 3PNMA 5CDHA 2K60A 2NZWA 5FWXB 1IHYA 1ODLA 1JKXA 2GCPA 2WSBA 1EK1A 4MYRA 5CMLA 2WYOA 2IVZA 5UKDA 4UEKA 3ROMA 3C1TA 3AW9A 3IPLA 2VDLB 1D0SA 1JDPA 2C5LA 4HFRA 2R84A 5EWLA 1BKYA 2JCXA 5EC8A 3PHIA 1JHQA 2YV5A 1J0XO 5TNXA 3OLQA 5TEWA 7ICPA 2ZULA 3H9GA 3R4VA 2ZAMA 1KZ6A 1GU0A 4HWTA 5I7UA 1C9DB 4A23A 2OZPA 4XDGA 1M7BA 5CVCA 3HTXA 2Q7DA 4OU5A 2JFXA 2F77X 5KFWA 1ICEA 3IP9A 2AXNA 1R00A 4WKBA 3DLPX 2CDNA 1WB5A 3F2IA 1VSUA 3NTUA 5B4TA 1S0UA 4B9LA 3IKMB 2BFEA 4M60A 1JU9A 4IUDS 4ECZA 2YIMA 2XYGA 3WLLA 4ZARA 2QZPA 3QXHA 4EKDA 1ZVJA 2Q8QA 3NHLA 2XKAA 1BEZA 3C3WA 3BD8A 3ONNA 1EWYA 1RKUA 3SAHA 2B21A 1VPVA 1L4BA 4B7UA 4YFYA 2GCIA 2CZCA 1JIQA 2ZB7A 4LPSA 3S70A 3SX0A 1GYQA 3ZE0B 5KTKA 2C1EA 1PGPA 1SUIA 4DLYA 3GLKA 4BV3A 3TAUA 2HRZA 1Z8DA 5B4UA 1BJKA 4IINA 3IT0A 4L3WA 3A1VA 5KG7A 3O8RA 1AV6A 1SOMA 4WD3A 4AJ4A 4RK5A 3Q2OA 4J16A 3V4LA 3VH4A 3A58B 1MO2A 1Y8QA 3RK0A 4EFDA 6AT1A 1QRRA 3GPLA 3FCEA 4XW2A 3T15A 3KWFA 4PSCA 4EB6A 5LSAA 3TJMA 4JGBA 2XC9A 3ONFA 3O7MA 3U3RA 4GPZA 3C97A 1DT3A 1D7OA 1QRSA 3V8MA 3U7QA 3M4JA 3GX1A 1AKMA 3OJLA 4W6QA 1WKBA 5K0JA 5TSDA 3WDLA 3LLCA 3GUYA 3UQ0A 4WBXC 5KKAA 1P1KA 2J7KA 4BJ1A 4DBVO 5FUVA 1XDUA 3AY7A 1JGTA 2QD1A 2QXUA 1C30A 3QBTA 2C2ZA 2YUTA 3N2EA 3N59A 3A0HU 2O8FB 3ZVMA 4HNSA 3JD2A 5CIWA 3NYIA 4E3WA 3B48A 1U4NA 4I8DA 1WABA 1N9KA 4RTPA 2W0SA 4EDFA 3NG1A 2J07A 4RVNA 3VVBA 4I6JA 5SZKB 4URXR 1NF8A 4R54A 3I34X 1U3UA 4FXOA 2GH1A 2B78A 4X6LA 2YWBA 1FIUA 2MWMA 4QNMA 3PGKA 1PK1A 1LEHA 4FO6A 1UK9A 1X7ZB 1IRXA 3C6XA 4QX6A 3LCUA 4NZPA 1J21A 1BOOA 3SZ2A 3CLHA 5CBPA 1F12A 4W99A 1E4OA 2W6JA 2FCRA 1BZYA 2X0DA 2FPOA 4HS4A 2WKRA 2AX3A 1T5HX 2VHJA 1JJ7A 2D0PB 4L2IA 1D9XA 3IQEA 4OQXA 4WK2B 2R6CA 2DPXA 2CDAA 1RQRA 3T5LA 4MV0A 1TQDA 4TWRA 4ELTA 1XR3A 3CF6R 2QAJA 5A4AA 4IW3B 1W73A 2XB4A 1CRWG 2ALJA 2HKIA 3WK9A 4UTZA 3T7RA 5DSXA 3G5TA 4US2R 3E4CA 4KWEA 1J2RA 2RKOA 3A28A 1PJ2A 3SQWA 5B57C 5DXJA 4NS1A 2JBAB 3EEBA 1GWNA 4IX1A 1APBA 3HZZA 1M8JA 2HHUA 1U7DA 4MFCA 4UNNA 2ZRDA 5ILGA 2X5XA 4J9RA 2XUZA 3W6UA 1FE8A 3VBCA 2JH8A 3ZKWA 4I9HA 1RRVA 2JD0A 3OZGA 4JEUA 4UM7A 3RADC 3UF0A 3CIOA 5L6LB 4L9WA 1G4UR 4YR9A 3AYXB 2XDWA 4IOMA 2QMEA 4PCAA 4JKOA 5DLDA 3EX7C 4J16C 3RJJA 5EWMB 4O5KA 1DAPA 3U44A 1SC3A 2SHKA 3GRRA 3CBGA 2WHEA 4DJDC 1MB9A 1YA8A 4FFMA 2A4MA 5L7YA 1QFJA 1XDBA 2QD5A 4QIWC 4QG7A 1SHLA 1FP7A 2EG9A 5IYZA 4J94A 2HRDA 5BSKA 1TC2A 5DYNA 4Z9FA 4P22A 3VSEA 3AFGA 3WYCA 3KQLA 2VP3A 2XCTB 1UDRA 2BDTA 1QRAA 1HR0B 2IYPA 1NRXA