1Z4NA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate cocrystallized with fluoride
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4nA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4nA01
3FPSA 1Z4QA 3E84A 2YY6A 2IA5A 3L7YA 4XQ0A 2PR7A 2CN1A 4RESA 3SHQA 2YMPA 1ZS9A 3L8GA 3UMBA 3WK8A 1LVHA 1YS9A 5ALSA 3WGVA 3ZW7A 2IOFK 3W5DA 3K1ZA 4MUMA 1U02A 2NO4A 1RKVA 3EF0A 1ZD4A 5AW2A 3IB6A 4NV0A 5AIAA 5AIBA 3WKEA 2PKEA 2JAOA 5AKLA 5AM0A 1U7OA 4HGQA 3S6JA 2HI0A 3NIWA 2G80A 4BEVA 3FVVA 4YIHA 3TLMA 4KX5A 3SKXA 3SMVA 1L8OA 1VJ5A 3AR8A 3NRJA 3ONNA 1QQ7A 1RC8A 3OTQA 3QUTA 2C8KA 3R4CA 2JGAA 2B0CA 5ALEA 4BX2A 2BDUA 4CE6A 1N8NA 4HGNA 4FFDA 2AGVA 2C8LA 1RMTA 3L8HA 5AI5A 4BX0A 5ALMA 2YMQA 3ED5A 1RKUA 3U7FB 1Z5UA 2W43A 5AM2A 2O2XA 3WK7A 4KX3A 4GXTA 2NO5A 3A1CA 1ZOLA 2HOQA 1Z4OA 3DNPA 4F72A 4MWOA 3AR4A 4RETA 2AUTA 4BBJA 3QU2A 2ZOSA 3N28A 1L7OA 2C9MA 3B9BA 5ALKA 3KOOA 3FPBA 5A3RA 5AVZA 5AM4A 1O03A 3QLEA 5ALHA 1YV9A 3DAOA 1Z4NA 3GYGA 1EK2A 5ALGA 1Z5GA 5AI6A 3ZTWA 1S2OA 2YMLA 5ALNA 5AKZA 2OBBA 4AP9A 5AW4A 3U7HB 3J7TA 3SF0A 4HGPA 2HSZA 4BKMA 2IOFA 4I9GA 3QNMA 4NWIA 5AKKA 2I33A 3ZU6A 2HCFA 2Q5EA 3A1EA 2YN4A 5ALWA 3I1YA 4L6CA 3RF6A 3DV9A 3E8MA 4FYPA 3QUQA 3NAMA 4UU0A 5AESA 2ZBEA 3HLTA 1QYIA 2PQ0A 3ZWDA 3NANA 1LTQA 2B8JA 2C88A 3QX7A 3WK9A 1F5SA 1K1EA 1L6RA 2AMYA 2R8EA 5AVUA 1N9KA 2HF7A 2WF8A 5AKJA 3L0YA 4J03A 1Z4IA 4KNWA 4NAVA 3OCWA 1XPJA 5ALVA 3QGMA 4IFTA 5AVXA 3M1YA 1SWVA 4EX6A 4HAIA 4Y2YA 3QXGA 5ALYA 3A3YA 1JUDA 5IS2A 4C4RA 3EPRA 2YMMA 4BX3A 4UASA 2RAVA 1ZRNA 4J2TA 5AHXA 3WKBA 2CFTA 4AS3A 4BEWA 1RQLA 3ZX5A 2EARA 2WM8A 2HEGA 1U7PA 1Z4LA 2G07A 3E58A 1TE2A 4UMFA 3WKDA 1CR6A 2JAUA 3I28A 1CQZA 4XE5A 3WK5A 2G0AA 3EF1A 5AW5A 4Y2TA 4CF3A 2B1QA 5JJBA 4NFLA 1MH9A 3OPXA 5AK3A 1ZJJA 3WK6A 1NRWA 2YBDA 2CFSA 2FUEA 4BYGA 1L8LA 3L8FA 2WF7A 1NNLA 4UMVA 4ZEWA 2Q4RA 4ZEXA 1Z4JA 2QLTA 1SU4A 2G09A 1XVIA 1RKQA 2ZBFA 2MSNA 2RARA 2HF2A 4L57A 1TA0A 3QUBA 3QU7A 4EZEA 2B1RA 5AVQA 4DFDA 3IJ5A 3QU9A 3AR2A 2YJ4A 1Q91A 4UATA 2R8YA 3W5CA 3D6JA 4PNHA 1T5TA 5ALXA 3HYCA 5ALJA 1EK1A 2JAWA 3ESRA 4UW9A 3B8EA 3L1UA 2FDRA 3SLRA 3OCUA 1T9ZA 3UMCA 1TJ5A 4FE3A 3ZVLA 4Y2JA 2WF5A 5AVRA 3N07A 4GIBA 2I7DA 1X42A 4C4SA 2OM6A 2NYVA 5ALQA 5ALRA 3AR3A 4QJBA 3WK4A 4YIKA 3UMGA 4Y2QA 4ZEVA 4DW8A 1IWOA 3ZI4A 1U2TA 2O9JA 2X4DA 2OA0A 5AKXA 3N1UA 3ZVNA 2HX1A 3BA6A 3ET4A 1KYTA 1WZCA 4YH1A 4E88A 2IOHA 4EEKA 2QYHA 3L8EA 3EWIA 5ALPA 4UM5A 3NASA 1PW5A 3FZQA 3I6BA 3E81A 1S8OA 4BNDA 2Q4TA 1Z4PX 3BWVA 5ALTA 5ALLA 2FPRA 3MC1A 5AW8A 5AVSA 5ALDA 4YCLA 4H1WA 5A3SA 1Y8AA 3KBBA 1WPGA 4L6AA 1YNSA 3PGVA 2B30A 3N5KA 5T41A 5IT4A 1ZD3A 1QQ5A 1RDFA 2I34A 3MPOA 1QH9A 3MN1A 3U19A 3L5KA 1RLOA 5AK6A 2YFYA 1RQNA 4EX7A 1J8DA 5AI9A 4YGYA 2JARA 2G08A 2WF9A 3QU4A 3P96A 3W5AA 3F9RA 4BNDB 5AK4A 2GHQA 2YJ3A 2ZBGA 1FEZA 4CF4A 4Y2XA 1O08A 1WR8A 2R8XA 1AQ6A 2GO7A 2FI1A 2FPSA 5FP0A 3I76A 2RBKA 3SKYA 2FPUA 1RRCA 5E0OA 2MU1A 5AW0A 2W11A 1L7NA 1YDFA 4OHFA 5AW6A 1YMQA 1RLTA 3OCZA 4I9FA 2WFAA 4HGRA 2AH5A 4QQFA 3ZUPA 4HGOA 4UAVA 4UARA 2I6XA 3RFUA 3ET5A 1ZD5A 2ZBDA 3AR6A 3QU5A 3U13A 2IYEA 1Q92A 1RMQA 2ODAA 2ZG6A 5AW3A 3KC2A 3FM9A 2OYCA 2W4MA 3SD7A 3OCVA 3U7EB 4YCMA 2VKQA 4KN8A 4UM7A 5AW1A 5AKGA 3N8GA 2EAUA 1VFPA 3DDHA 2G1AA 4G9BA 2GFHA 4UMDA 1RMYA 2YJ6A 2B82A 5AKHA 4NABA 3WKAA 1TJ3A 2C4NA 2HHLA 3OCXA 1U2SA 3L1VA 3NALA 5A3QA 5IT0A 3QUCA 5AK5A 2D2VA 5ALOA 2GMWA 3W5BA 3U26A 4OFZA 2MU2A 4Y2VA 3KDPA 4EENA 2WHEA 3CNHA 3WKCA 4CF5A 5ALFA 2FPWA 4OD0A 2G06A 4XPZA 3AR5A 2GHTA 5AI0A 3PDWA 5AM3A 2P9JA 3ZWKA 4DWOA 3QYPA 2HO4A 5AW7A 4JB3A 4C4TA 1XP5A 3ZTYA 3AR9A 4UU1A 1ZRMA 2ZXEA 3VAYA 2R8ZA 3UM9A 5AM5A 2EATA 4EELA 3PGLA 2DQSA 1QQ6A 3L0BA 1L7MA 3CZ4A 5ALIA 5AKYA 2I54A 1Z4KA 2CFRA 4YCNA 4UAUA 5AVYA 1TJ4A 2HDOA 3ZX4A 2BDEA 2FUCA 5AVVA 3R09A 3WGUA 3IRUA 3ESQA 4XOUA 1YJ5A 3KZXA 4KYTA 3ZVMA 5AVTA 4CNQA 1L7PA 1RLMA 4G63A 4Y2SA 4O8CA 2B8EA 4B6JA 3NUQA 4Y3UA 1WVIA 3M9LA 3FGOA 4F71A 3L0CA 4AS2A 2WF6A 1RPZA 3R9KA 4UMEA 1Z4MA 4KNVA 2P11A 2FEAA 3KD3A 3MMZA 2FPXA 5AICA 4JDPA 1VJRA 4Y2PA 4Y2UA 1Z88A 2RB5A 4DCCA 3A1DA 4IG4A 4Y2RA 5AVWA 5ALUA 2BY4A 5AKIA 4HYTA 1J97A 3OCYA 5AI8A 5AM1A 5AI4A 5ALZA 2P27A 1SWWA 3B9RA 3U7GA 5AKEA 5AW9A 2I55A 1NF2A 1ZD2P 3AR7A 3PCTA 1T5SA 4OCZA 2YJ5A 2P69A
chains in the Genus database with same CATH superfamily
2IE0A 4F97A 4RLHA 2AG0A 1DDGA 1XK6A 3QK7A 1LLQA 1IQUA 4XM0A 1E6CA 1NJ2A 3WZMA 3V7JA 1DFIA 1IM2A 2PGDA 4OSPA 4HQ6A 3H13A 4G24A 1ZA2A 2G80A 4ITRC 4BO6A 5GJWC 4BJHB 3M6MD 3PWZA 4JB2A 1GQYA 4TRRA 3RH0A 1XVVA 3SF8A 3S81A 1KSHA 2AB0A 4YPOA 1N8NA 4PN7A 2Y6UA 2G71A 3FVTA 2ZRFA 4C87A 2GCIA 3KXPA 3HNPA 1KE1A 2YXLA 4BWJA 3DNPA 1AH2A 3QELA 2ZS8A 4F8YA 3HDYA 3CVXA 1DAFA 3EG9A 2VH1A 3PA8A 4EHBA 4QQRA 1AO0A 4DM4A 1ZW1A 4K6CA 5JMPA 4E0DA 5KG7A 3E23A 4IJ6A 1M1ZA 1P18A 2GPBA 4R9RA 3SF0A 1XCPA 2EWVA 1BMFD 1Q0QA 2PT9A 1YR3A 2V0CA 3LX4A 3SX2A 1N7IA 2GS9A 2VRCD 1QYWA 4Q4HA 3LPAA 1KZYC 1OWPA 3M1LA 2J4DA 4FQ5A 4QSHA 3UMRA 4J3NA 4D3ZA 1NULA 5GADl 4NDNE 3TD6A 4K8OA 4P34A 4R3NA 4BLTA 2ZJ8A 4M54A 1H2WA 5FOUA 3QGMA 4OA8A 4LWPA 5EJ4A 4ZT4A 2RAVA 4K6FA 1ZRNA 5G4LA 5LYJB 4D45A 5C4IA 4TL6A 2SKDA 1UT6A 2WOJA 5HZMA 1SFRA 1YKGA 4V0KA 2YVAA 3Q8XB 4N7RA 3W1WA 3TAPA 4UBIA 1IHDA 4NCKA 3BMCB 2QNBA 3GZFA 3M3HA 3DAHA 1POWA 1TF7A 2IK8A 3M89A 2JFYA 4CRXA 2YWGA 4GM4A 4JKOA 4ZYLA 1M7GA 2Q4DA 3V2IA 2B78A 1RBYA 1YHYA 3DWIA 4KE9A 3L04A 1E9BA 5HHIA 1S5LU 4R4JA 4KUGA 2GZMA 4MVYA 3BS4A 1XTZA 3OTHA 2A1JB 3IUSA 5JSFA 3KT3A 2CYAA 4X64B 3EXIA 5DEIA 5SYMA 1ORRA 2BR4A 2BFCA 2RBGA 4X63A 4OXXA 3B7GA 3PUKA 3GROA 2PSFA 1GARA 2J9FA 1QZTA 1E9RA 1XLTC 5BSFA 4M1ZA 1W87A 4XD7D 4AECA 1SKYE 3B5IA 3KCQA 1E3DA 3V4RA 1YFKA 3HV0A 4WNAB 3LL7A 5K6TA 1PNQA 4PXSA 1KERA 4OHBA 3SY8A 1QGOA 3Q6MA 4L76A 2PAFA 1CDDA 1TQ6A 1IY9A 1Y7IA 5ELXA 2XO7A 1DAKA 3LW8A 4QZVA 1AK2A 3SC4A 2I6XA 3RVNA 2XJ9A 4W8GA 3RVRA 2ZG6A 5J5AA 3HEBA 3PICA 4LXTA 4UUPA 4DM3A 1SV4A 1FO4A 3PGA1 2VJKA 2XXBA 2PBFA 4RLSA 3IUBA 4YJ3B 4WQMA 1KDZA 2Z4TA 1ZA1A 2LKYA 2IGTA 4P22A 5LLTA 4RTRA 4M6WA 3R0VA 1YR7A 4B6FA 4F3TA 3G2OA 1CYDA 2P9JA 4NOMA 3S3TA 1C80A 3N2GB 3EVFA 3V55A 3DP9A 1C1XB 5GV8A 4ZJPA 4MHSA 2H92A 2PGJA 4RQTA 4FMBB 1KFKB 3O3NB 3I30X 2SECE 5TY0A 1FDUA 1B73A 3LVQE 2GF9A 3GV5B 1FLAA 2ATXA 2ZIWA 4IS3A 3SSMA 2UYYA 5KFPA 4QA9A 1GSOA 5DO9A 4MO2A 2QLMA 1AQUA 1YI0A 2VT6A 5IZCA 4WDQA 4QT0A 3DT8A 1XHEA 2I2BA 4Q4DA 4AYWA 3M4ZA 5E9JA 3NHPA 1H5QA 5AM1A 5EKUA 5F1PA 1NIPA 1N4AA 4F3CA 2ZSJA 2MWMA 3I9LA 3O4GA 4CFZA 2IBMA 4CKEA 5F2NA 3PQFA 4PTYA 3HUUA 1PL0A 4OQPA 5DEOA 3B3QA 2SNIE 3TFOA 1QOZA 1K66A 4YAEA 3V4OA 4V1CB 5LOVA 4J7XA 2JAOA 3HA5A 3L4EA 4O4LA 3LT1A 1G4UR 3QX3A 1SMKA 2BF4A 3RVPA 1TXGA 4HNQA 3DPIA 4DUGD 1KO7A 3QFRA 1JDZA 2PPLA 2J7KA 1PLJA 3OJLA 4GOKA 4NAUA 4GDFA 3LUJA 5AM2A 1RIIA 5F23A 3DZGA 3D5TA 1GXSA 3SPXA 2BL4A 4KG7A 3C6XA 2GPYA 3D0KA 4D8TA 4HDSA 5D5PA 1YV9A 2QW1A 4C0ZA 1FL9A 1KS2A 3F8WA 1RABA 2OBBA 2WAYA 3ZV7A 1EHCA 2XE4A 2QKQA 5F1OA 1R6AA 2XRYA 4GFJA 4A5OA 4U6SA 4D2IA 1ZC3A 3BFXA 3S8YA 5LSAA 3U31A 1CY7A 1EBFA 3E18A 1YE3A 2K89A 1TL7C 2KKPA 1PQYA 5HWSA 1SUSA 3IEMA 1KYXA 4BO3A 3T3EA 1L7AA 5JRJA 3TI9A 2WC1A 2AQ0A 4R7GA 1NP7A 3QXGA 2W54A 4K05A 2X15A 2A30A 2XYPA 3WIEA 4K7JA 1MNAA 4JELA 2AS0A 4XASA 3HKCA 1PU2A 2H8GA 1RYEA 1Q57A 3NHLA 1UOQA 2Y9MB 4OP2A 3GLFA 1GV0A 1PJAA 3TPCA 1WBBA 2WJAA 3GNQA 5H4HA 2RKWA 3OT5A 2BCGY 3DF9A 1U9LA 1P2SA 2VN8A 5COQA 1HTBA 1I2DA 1F0NA 2V0NA 3MQFA 1FNSA 3K9LA 3DDWA 2ECKA 4J7UA 5THXA 1QB7A 1E9SA 4POAA 3D43A 4Z4FA 4UB3A 4NZZA 5FULA 4KK4A 1MHPA 5K0NA 2JL1A 4JLSA 5LKAA 1ILEA 3WNZA 4M7OA 9LDTA 1VJ0A 3LLMA 5I9BA 2BBTA 5JI2E 3RJ5A 3TW8B 2IUEA 3AZPA 4MWTA 3B8HA 4KLCA 3HBNA 2UZ1B 4QBKA 2GERA 2W9AA 4DLWA 3DLHA 3PW5A 4ZI7B 3AERA 4PLYA 1YL5A 4YP9A 1I5EA 4YJFA 4P3PA 4RK4A 1PV2A 2XGSA 5ILGA 4RPGA 1CQPA 1T36A 4ECWA 1MZPA 2OUKA 2WF9A 3DHEA 3LWDA 3MS2A 3C8UA 4PRLA 3EVEA 1SBQA 4YAGA 4YRIA 4X62B 2NZJA 2EHJA 2XCRB 4RFLA 4TKLA 2AUMA 1R1DA 1SH7A 2W11A 2ISSD 5KFMA 1MEEA 3N76A 4J0JA 3UHOA 1FBTA 1XZBA 1FTWA 1XD2A 4H3SA 9ICBA 1SXJA 1P9NA 3BQ1A 4TYWA 2VQ3A 1Z07A 1FQWA 3H2JA 1GL7A 4HH3C 3DLIA 2CHVA 1IBRA 4NENB 3HDHA 2V6IA 3ZGYA 4FVTA 4R65A 1GG2A 2EDAA 3BZBA 2IHYA 4FOSA 4ZOLA 2EF1A 4ZCRA 2DPYA 4EQ6B 3IVGA 4CT5A 2E87A 1VI2A 3S28A 4PONA 2EIHA 3UV7A 1BQ4A 3CLUD 3DULA 1T3NA 5CFNA 1Y3FE 1U6KA 4B76A 5H4GA 4Y2SA 3U0BA 1UJ5A 4ARUA 2O5EA 3UAGA 2ERCA 4JLNA 4OHMA 1P7WA 5KWEA 1GWNA 2I2WA 3HWSA 4ARVA 1F0MA 1ZMBA 1OPRA 4DABA 1RKBA 1VLBA 4OSEA 1X9WA 2P69A 5IEJA 3VJLA 3LNCA 5DLEA 1A4RA 1AQNA 1SCUA 2NU9B 4YP0A 4ZCSA 4F5OA 3BMNA 4BRSA 1CS0B 2FGKA 4NL4H 2IT1A 3O2JA 4KIJA 1E3LA 3PQ5A 3TD2A 2HSJA 3A4LA 4DOBA 4LV8B 1BE0A 1CQJA 2VIXA 4AL4A 3IOCA 2I6SA 5D51S 2RK6A 4W1QA 3R7WA 3R8FA 3GFGA 3GGCA 3A1CA 4GOND 4ESHA 4Q1BA 3LPCA 1UXGA 2ECQA 1WQ4A 1TUBA 2PMWB 5JAUA 1YDMA 1PVPA 1PO7A 3ZGVA 1U0SY 4FQ7A 1U4SA 1G291 4QTTB 5ADWA 2BUCA 5JNVA 4X1YA 4G0UA 4KDRA 4DA6A 3JWJA 1JHXA 3A3NA 4UAZA 3USES 5JISA 3V1YA 2BKAA 4QUIA 5F76A 2V7EA 3OESA 3JPPA 2JZBB 1N9KA 1ULUA 3E27A 5KWJA 3L0YA 4RKWA 1MQAA 3EEQA 2Y1CA 3ZJ5A 3R3YA 4NBNA 4QUAA 2XW6A 3IPYA 3VUFA 2N9UA 5DNUA 1ZQRA 2YMMA 5JMWA 4OXKA 1RYBA 4HRVA 5IXSA 4UM8B 2XTZA 4RAOA 5LQCA 3TOVA 1IEQA 2E3TA 4B4OA 1WULS 2W6ZA 1FF9A 2ZVDA 1DPFA 5F77A 1N2EA 2ZXIA 1ZQJA 2HWYA 4FI3C 4QXRA 5JRDS 2O3RA 3DD1A 2ZYDA 4A2WA 1GQRA 4OJKA 2OK8A 4BZXA 5G5HA 4FYHA 2I3AA 5CLGA 1YCDA 4O25A 1CIPA 2F6RA 2JHCA 1MAAA 2M1ZA 5LXTB 3RUCA 5ALXA 2CF6A 4FCTA 2BEWB 1J9EA 3SI8A 1BXGB 3OLQA 4XGIA 4A5SA 1XZAA 4NATA 3TZQA 3HCCA 4D9KA 4YMOA 3HZZA 1KY5A 4CMKA 1JVSA 2P2NA 1WXWA 1YWGO 4FDMA 4MEAA 4EA9A 2JLZA 4JOCA 4YFKA 4KC0A 4FN4A 4GGMX 4RHCA 3TF5A 4YDQA 1VA4A 4R0NA 4K26A 4MS3B 1JALA 2H5EA 2NAFA 4DY4A 1WDMA 3FTFA 4MH0R 2BP7A 2VTDA 3WYBA 1QRDA 5I51A 4WAUA 5TGTA 1NRIA 2XUQA 3SSNA 3YASA 1NK6A 1Z3IX 2QQ0A 2PWPA 4EPTA 1RM3A 3I4CA 3TECE 5JYDA 3PXXA 3GW8A 5HFNA 3HL4A 4Y2XA 4KTQA 4I55B 5JY6A 3RODA 2BUAA 3HU5A 2E55A 4A9AA 3RS3A 4EW6A 1TGYA 3SHVA 4OO1J 2OFFA 4HAZA 2X76A 3ANMA 1Q3VA 3H1FA 1NOMA 2OCEA 4B81A 1SUIA 2ZBDA 2R00C 3VZBA 2Z08A 3T6KA 4FNAA 5BMOA 2OFOA 1H5UA 4KO3S 5BUSA 1GUDA 2V4UA 2O7QA 3TRIA 5DGCA 4UBNA 1GADO 2HM7A 2EFDB 5IIJA 4Y2VA 4PCUA 4KXLA 5LUAA 3QYPA 4U8HA 4PG7A 4NMLA 4N8EA 2HQBA 5DASA 1THZA 3R74A 1XYVA 4ER5A 4ZDWA 3H0MB 1PUXA 1B16A 1CY4A 3OE5A 4EI2A 2J6BA 3GU3A 3ZX4A 4HFRA 3VYRB 4ELUA 3L8CA 3MFYA 2WU0A 2DKXA 3ADOA 3RS8A 2R86A 1Q7RA 4RVDA 1NXWA 4EKEA 5LWHA 1EZZA 5DK6A 1E1DA 3QVJA 2X0FA 3EQZA 2I3BA 2PX5A 4NK5A 4JDPA 1VJRA 4MUIA 4Q16A 3DGEC 3DBLB 4RBNA 1TZJA 2YKGA 4A6EA 2YV3A 4YMVA 5CFZA 5AKEA 4F3YA 3FR7A 5DNWA 1OJ7A 1O97D 4QASA 5FI5A 2ZJ3A 4R2LA 9ICVA 5KT2A 3H6HA 3UXHA 4QT4A 4NARA 8ICSA 4LE1A 1UDCA 2JCGA 2JDID 4M37A 3V8VA 4ZZ3A 2JHPA 2PKEA 1JFTA 1DK2A 3SEQA 5KSPA 5JMOA 2C8KA 4OBEA 1G3IA 4KWHA 1D6SA 5A4KA 1JI7A 1G9XA 3RJMA 3RGGA 2QRUA 3GPDG 2NVUB 4JASB 2O8EA 3E61A 4LC0A 4ZOQI 1NJ1A 3FDJA 3NI2A 2FP3A 2WUVA 1C0PA 3W6NA 3GUVA 3G0HA 5J0TA 1R64A 5ED0A 4AZTA 2AQIA 1L8AA 2N1BA 4H3HB 1K6EA 3BD7A 1F20A 5BO5A 3VPCA 4AXBA 3CJQA 1U04A 3DE2X 1QYIA 4RQ3A 4C0JA 1PJ3A 1IBLB 2B4KA 3IX7A 3L1IA 3ZHOA 2JATA 2P2SA 1PD0A 5G53C 1SC3A 1Z5NA 5DNEA 1OYOA 1PVDA 3QZ7A 3M6XA 1G5QA 4EYKA 2GYWA 1FSGA 5HP4A 1HE5A 4TL7A 1QZUA 5FPQA 4ZCIA 5KKCA 5DOZA 1SY7A 4AS3A 1MCZA 1QS0B 4BU0A 3F7OA 1KO4A 4QDTA 1O6GA 3GILA 1OKKA 2DPGA 2HMSA 1V95A 2GJAA 4CL8A 3Q4GA 2YZMA 2H4ZA 3R5HA 2C9DA 1E79A 4NBWA 4LJ5A 1Y9ZA 3WMEA 4AY2A 5HIJA 2BGNA 1SC9A 3B38A 3A6FA 3DLCA 4ALNA 3ED1A 1IJEA 3UK1A 4R2MA 1TVKA 1ILWA 3F74A 3IKTA 3DOJA 1M10A 2GLTA 3QV2A 1ZIDA 2GBCA 4EKGA 3GR6A 1OASA 1TMGE 1M34B 1Y1RA 3BSSA 3WK4A 2OCIA 3OZUA 4XWWA 2VP9A 3GFTA 5IH3A 1FW8A 3UPDA 1SXQA 3IVRA 2IS2A 4C8LA 4DEZA 3UKOA 3WYGA 4Y1EA 2PAAA 3GEHA 4BB9A 1VJDA 1SCJA 5IAKA 3VH4A 4RHTA 5IJXA 3BXPA 2BISA 1M2HA 2A9PA 3L77A 2J41A 3TM4A 1FMFA 1NJSA 3HP4A 4PS1A 1ZI9A 1TB4A 2Y76A 3DMHA 5HHHA 4I08A 3SFVA 2HMWA 4AMUA 4BO2A 1UOEA 1YO6A 2FW7A 2OBMA 5J4KA 5HRUA 2ODNA 1PK8A 1ZD5A 3PPXA 3ERCA 3JD4A 3R7LA 4QNLA 2IHJA 2QVBA 3QPUA 1NHWA 5DPMA 3MR6A 1XSEA 4YCCA 1NTRA 2HRCA 5ES3A 1K3FA 4RM3A 4S04A 2VXCA 2H3QA 3EVAA 1A9YA 3BDPA 1G21E 4PPXA 3W9BA 4FHEA 3ZIDA 2MMGA 1V4VA 1OHHA 4PPGA 2CNWD 2PSHA 2DFNA 1TX4B 1V6CA 1EGMB 2JLBA 4W9NC 4P32A 4V2IA 4DQVA 2HHUA 5CA0A 1V26A 4JNKA 5KUTA 2KVSA 5CIWA 3WGYA 1Z15A 1C9MA 1I7LA 3LUAA 3CGGA 1RAAA 9ICFA 1PWYE 1R6TA 2E4UA 3PNMA 3F2DA 3EZ5A 1XF9A 4R8KA 4JI1B 7ICVA 1FSZA 2B34A 2ZITA 2BFFA 1T8RA 4D0RA 1K68A 4UCWA 5B1DA 1SN7A 4O2AB 2QSYA 1Z2OX 3BRWD 2Q9AA 1NW4A 3R3UA 3CEAA 1UFOA 2MDTA 4RH1A 1P2FA 2HD4A 3F1KA 2QAGC 4NE7A 3LHSA 4BUZA 2CNNA 1KN5A 4LJSA 3O7WA 2VUIB 4R3WA 3HCOA 2XUZA 4NMWA 1NVFA 2Q28A 1G3UA 2RIRA 3B7PA 3KUCA 1OAAA 1UXOA 3UPUA 3GRZA 5JZSA 3WAKA 2GAFA 1T5OA 5IBQA 4R1UA 4EZIA 4U2BA 1CJSA 1KI8A 1A27A 3DE1X 1ENOA 4GXTA 1V3UA 3WNVA 2XNKA 4F72A 1SG0A 3Q2KA 8ICOA 4ZFNA 2EBWA 1TADA 4ZOAA 4E13A 2DVMA 2IU4A 2IYSA 3NBXX 1CR0A 3E2MA 3N0VA 3DAOA 3W7AA 3D5EA 5DH9A 4DLSA 1DL5A 4M0UA 4S1NA 4ECUA 4IJMA 4GBGA 1YR1A 1X7HA 1JG1A 2W37A 1UJ4A 2HBKA 4BNWA 2AG1A 5AD1A 1ONNA 4B9LA 3IH5A 1BGWA 3EOZA 2X0RA 3FDIA 1BE1A 1K8YB 2FXIA 3PCRB 1BFUA 1HE1C 1VLLA 1CKEA 3K16A 3FZGA 5JFOA 2PS3A 1KEUA 1QUEA 3P5BA 1DIOB 3KYBA 2I5HA 4K4IA 2V7UA 2JMGA 3TZ6A 3GCXA 4CW7A 1Z0DA 2XOKA 4U1RA 4Z5XA 3AK4A 4P5EA 2UYGA 5J4VA 1KDPA 1KHHA 3NBFA 1QV9A 4G9EA 2P40A 4BNNA 4QXAA 3F5DA 3U4AA 1DCTA 5KTRA 1O9BA 4JFRA 1D4OA 5C81A 5I7VA 4EJ2A 2B1RA 4MRPA 5LN1A 3I37X 3UJPA 5J2IA 2WICA 5HQJA 3DEAA 2KG5A 5DCYA 6CHYA 3OJWA 3DZFA 2PMDA 1U7ZA 2HT1A 2ORVA 1T9ZA 4G65A 7ICRA 2CJXA 3VNAA 5C1IA 4DSJA 2WHPA 1E3EA 3B0YA 1PT7A 3R3SA 3H11B 4IXWA 3VDQA 4QJ3A 1YBAA 3EWIA 1OXMA 3ORQA 4ARIA 4WK0B 1EXNA 2XKKA 4XEUA 4BX9A 4WY5A 1HNZB 3ELUA 1WZIA 3ITKA 1X7YB 3UT0A 1QG6A 1EWRA 4ESOA 3N4MB 4WXPA 3GWGA 1CE8B 5J2UB 3UJNA 1JYSA 3EBPA 3SJCA 5MN5A 1M1NB 4LJRA 3ER9A 3TADC 5LD2C 4EL5A 4DXHA 4IYJA 3BJMA 2RG7A 4RK7A 4COKA 1PAUA 3DV2A 4KQJA 3T3MB 2VSNA 4Z4GA 2MHCA 4Z7QB 2G40A 3SBEA 4RD2A 4CM9D 3OZRA 1G60A 3KPYA 3VR2D 4PGQA 1XQVA 4L0CA 4UHKA 4DIMA 2RI0A 4EYIB 1Y7TA 3Q3CA 2I65A 4MLCA 2EKPA 2OCLA 4M88A 7ICJA 1HDIA 3VU0A 4PAOA 5DQIA 2JH3A 1D2GA 3UXOA 8ICMA 3V2UA 3RSLA 1DV1A 1AQLA 2W8BB 4NBUA 5LZ4A 1Z82A 3RJHA 3NHMA 5CXUA 5E6UB 4OHYA 3TPZA 4YRQA 2YW9A 1JDTA 3WQHA 3FCXA 1X7XA 1FSSA 4YA6A 3OM8A 2K4EA 4FZ3A 3WL8A 3WJ7A 4UHCA 4PYJA 4P5DA 4H7IA 1ZXIA 1KOJA 3R9KA 5D3MA 3VVLA 1JXQA 4MULA 1DX4A 4BGVA 5SV2A 3FHTA 3FIUA 4BJ3A 1OT5A 5FWXB 1G17A 3JSXA 4UQOA 2IHVA 3DHWC 4YAOA 1B0PA 3TS1A 1GGHA 2A1IA 4DTCA 4NYJR 4RK1A 2X2EA 4F4CA 4M86A 1LRKA 4HB0A 5AW2A 2HL6A 5I4BA 1BKDR 2VEOA 1JGTA 2NVWA 4TMXA 2R5FA 5JJ5A 4WBNA 3OM1A 1US8B 1XWLA 1VCOA 2DR0A 3L0PA 4BECA 2CLKB 5ECWA 2JEOA 1J7JA 4JC5A 4DQSA 2HBZA 3O8LA 4PAGA 2H3EA 2PGOA 4CQLB 1R3UA 3FMVA 1QDLB 4MO9A 1N36B 5GAJA 5JSYA 4IZOA 1NMSA 2JAHA 2H5JA 1JH8A 3TEJA 1YRBA 1A9TA 5EZYF 1ESNA 4HXFB 2ZE5A 1GTJ1 2O3UA 3QXXA 1NUUA 3PGMA 4O63O 3HXLA 3AQ4A 3RJGA 3MWKA 1TT5A 3EVDA 1K9VF 1XZNA 1BGXT 2GUGA 3LBHA 1G42A 1SVNA 4DKXA 2BKEA 1VG9B 3L43A 3WQSB 3KTOA 1LPAB 1H4QA 4HH1A 5LMUB 4ZO6A 1MSWD 4M9RA 2H6EA 2ZJBA 5JDCA 4RPIA 4Q43A 1CZKA 1SV0C 4ZZ1A 5BV2P 3DPUA 4BX3A 4LY3A 4MUBA 1DUSA 5J5CA 2BCVA 3MWEB 3I45A 3UMVA 3USZA 3D9QX 1WMAA 3TJZA 3K1AB 1CULC 4N3AA 3PEFA 2AEJA 4B9AA 3PQ4A 1WA5A 3S5UA 2K8AA 5HIAA 1ZUNB 3CVOA 2DHQA 1M0TA 1KO8A 4O3QA 4FIDA 1NMZA 1GT91 3NB0A 1GV1A 4HEA1 2Q5FA 2YJ4A 5KJ6A 3NM6B 1W0JD 3UEOA 1FPMA 5ERXA 4MRRA 3W5JA 4B4KA 3H1BA 4EPRA 1V5FA 3JAWA 5EHZA 3OCJA 1VL8A 1MGPA 1T26A 3USCS 2IEIA 5FUBA 5KNBA 2NRWA 3HA2A 4IIJA 4MUGA 4ZVRA 3NHKA 3MGGA 5H2FU 1T2FA 3RVOA 1JFFA 3NHAA 4KBFA 1HQKA 4QYSA 4NH4A 2VUHB 2BRUA 1EGVB 4ERXA 1RZRA 3W4JA 3FETA 3OLXA 4MWSA 1FJXA 1XLVA 1LUAA 5C8YA 1RYNA 3CH4B 3OQJA 2PX2A 3L5KA 3R7AA 5A9SA 1A2OA 1TFUA 5CW2A 3NOOA 2PUBA 1O7JA 4RPZA 3VO1A 2NXNA 1Q1BA 1SB3C 4TLMB 5IYZB 2NU7B 2ZGVA 1C9DB 5DLDA 1DAGA 4RMIA 2UV8A 1U8UA 2ZUWA 1J6UA 1RCFA 3H87A 3I34X 3AEUA 4R1PA 2H5XA 4B5LA 1SBHA 4EB3A 2GN6A 2ZZMA 1M6VA 3EVTA 2JJ2A 2VJOA 3REQA 3T79A 1IPHA 1BPXA 2HN9A 2F00A 3KXKA 4MRSA 2OENG 1N2HA 1S76D 4TTVA 2XUIA 4FGSA 1WEKA 4IWNA 1ND6A 4EITA 1QFXA 5LP6C 2BUBA 3P0JA 5T3YA 3PGLA 2QMHA 5KWIA 3N97B 4XA8A 1L3CA 3DHNA 2P1RA 4BNKA 2H0RA 5MGBA 4E94A 3HB7A 3NO4A 1T3ZA 1E18A 3OEHD 1IQRA 1HFJA 3GIDA 3UXPA 2RHJA 1CUSA 1YRWA 5JH7F 5JQGA 4PX5A 2W6JA 4MJXA 5DG8A 1RU3A 1JSCA 2JK0A 1AHPA 4ZT5A 4HN4B 3KD3A 3KETA 5LB2A 1T8TA 3A2MA 2VDJA 1L1QA 3FLBA 2WNHA 1PEYA 2OV8A 5CLJA 1KDHA 2HSDA 3QXCA 4KN9S 2BZGA 3NUGA 2XJ4A 2HW8A 5LA6B 1J8MF 1KY3A 2B2XA 3RVLA 3E84A 4XLLA 1RYRA 1KETA 2RBEA 2FEWB 1G6HA 4PAMA 4DQPA 3OA2A 3HFRA 2J9YB 4WXYB 2K8BB 4Q9AA 3V34A 1FUYB 1L8OA 1VJ5A 5IXYA 3QUTA 3F47A 3E5NA 4KQ6A 1TF5A 4ALIA 5AQ1A 1JU4A 1DXSA 5DRTA 1H1TA 2VJYA 1GITA 3C3CA 2W00A 5IUNC 3W5UA 3UUEA 2J5QA 2I80A 3KQOA 4JYPA 4ZTZB 2G0NA 1NIJA 3FUTA 5T4BA 2H4JA 1IN7A 1ZHHA 4GGOA 2O6LA 4UNSA 1JKFA 2W6PA 1SEPA 4MW9A 1FP2A 1YA8A 3KXIA 4ND6A 2NZVG 3EW7A 4JSYA 5IM5A 3PE3A 1OI3A 2BI8A 3CX4A 5BURA 1CRQA 2PXHA 4RUAA 1XFAA 2W55A 4O1HA 1AIPA 3L4BA 3GEIA 1OGIA 4MRVA 4ED8A 3ZU3A 3LVFO 4GZMA 2PQ0A 4BMOB 2ZYVX 3EZXA 3P0HA 3WZLA 1FPQA 4F45A 1DAOA 1T8WA 4ZYTA 2RLTA 2WD9A 1UQTA 2QXUA 1R0XA 3TE7A 3OCWA 4BB5A 3V1UA 4LZPA 1CZOA 4L5JA 1YK0A 2AV6A 3U62A 1F1BA 4MR9B 4ENVA 2EFEB 1YTLA 2IYYA 4KHPB 2V6JA 4OHZA 1YQUA 5CEFA 5L4NA 1NM5C 3FJYA 5C8ZA 1MQSA 2Y1GA 3THWB 3ZDYB 3NTUA 1ISJA 3S1LA 9ICAA 3RHSA 4DV2B 1F38A 5C53B 2IE8A 2CJFA 1J2UA 1V8FA 3ISCA 3ONFA 3FRHA 4H7DA 4XIJA 4BIMA 4A03A 3OPYA 4URXR 4COOA 2Y1IA 5K0ZA 4AJHA 1P7DA 4YRKA 3W2IA 3RB8A 2AE1A 1LSUA 3EIQA 4I0WB 1RI2A 4N5HX 5CA1A 2Q5OA 3QBTA 4FJ2A 1ZK4A 2OV3A 3LECA 8ICAA 2W2PA 3Q0TA 3IKLA 3UATA 4MWCA 4RNOA 1N3LA 1S97A 1IG0A 4KGVA 2X3YA 3BPSA 3KYCB 4KJZA 2W98A 4HBGA 4G26A 5TB5A 2G36A 3PWTA 4NQZA 4E6PA 1CEYA 4H1WA 4II7A 4CEHB 2ISPA 4L28A 2MSEB 3GO4A 3MPOA 4BNFA 2FMIA 4IIDA 3W8FA 1MAHA 2XMSA 5DN9A 1AXGA 3E53A 4DREA 4IRCA 4EWLA 5T4EA 5DHTA 3BD8A 1COWA 4KH0A 3PFFA 4U7CA 2H1FA 3Q9SA 2F3QA 4L5CA 1W4AA 4QYTA 3NYRA 5CMLA 3TAQA 4J9SA 1HG1A 4MXDA 3CLHA 2P30A 1AN0A 9ICCA 1NVKA 2VPYA 4LDZA 3ZV6A 4NCXA 3QSYA 2WOOA 1HQYE 1NV8A 4UJ5A 4PEVA 2GZ2A 4J4TA 2WSMA 4UM9B 2OKCA 5JYEA 2DUYA 2WSLA 1IUPA 2ZI6A 1FUUA 5AKHA 5C80A 4C4AA 2WWTA 3MRTA 3R24A 2I62A 1OQAA 1JT9A 2JGDA 5HBGA 2XYGA 2OD2A 5KFYA 3IVCA 4QGSA 3UHAA 3LHIA 4JROA 4AKEA 2VDMB 5HZHA 1GAJA 4MVJA 1J23A 1ZCBA 1U1DA 2WTEA 4EG6A 2WD8A 1WWVA 4GZ6A 2B4AA 1L1EA 3EZLA 4P36A 4J2OA 3PVXA 4YCNA 1QHSA 2RHMA 4BB6A 4NHOA 1CRXA 1OYWA 2C77A 5ILOA 3HADA 4HADA 4G81A 3MINB 2SBTA 4OJOA 4ZZ2A 3R3XA 4LRUA 2OQIA 1N5DA 2O2JA 1FNDA 4R8UB 1SQ5A 2HHSA 2XVZA 5DLQC 4YXWA 3HN2A 2XQGA 4HWOA 4G86A 2HHWA 1Z7GA 3OEEA 1XSPA 3RRMA 4HYTA 3SEZA 1T91A 1IEVA 3GA5A 3EXHB 1WRBA 3ORFA 1W88B 1U3UA 1YUBA 4GBJA 1OLXB 2BFDB 1JLLB 4N9QA 3CBQA 1EG7A 3MS4A 2J9RA 5EAIA 5G1OA 2WTMA 2Z1DA 1SPBS 1OX4B 1JXMA 2ZQZA 3TLMA 5DT2A 4IKOA 2DZDA 1L5SA 3T5KA 1GFSA 1P91A 2YMQA 4GS5A 1M5UA 5CVTA 1HEIA 4J43A 3PL1A 4K86A 2JEIA 4Y9RA 3ZQKA 2A0KA 5B57C 5B36A 2VHVA 1PD1A 3JU3A 3B9BA 3DKPA 4YTEA 1NKEA 3RT1A 4R81A 3BH7A 2YXEA 5HBRA 1FLDA 3X2SA 4JYCA 4G56A 2HJVA 1N6OA 1K5GA 4WLNA 1K63A 2HSZA 4JV5B 4G0VA 5C31A 3DDUA 3U0VA 1TVEA 2OGTA 5KG6A 1FNNA 1WWUA 5C5IA 1GQ2A 4KQWA 4LTNA 1PR4A 1KTQA 2C99A 4B6PA 3KJEA 1DIBA 2QRZA 4YO8A 2QXTA 3B2QA 1XDSA 3CF4A 7AT1A 4EJSC 2CHUA 5DI3B 4UUAA 2JJMA 3HQ4O 5IKEA 4E1VA 3ZWQA 4JBHA 3BQNB 3OMLA 4QUEA 3G2QA 4E15A 2GZDA 3WRXA 4E08A 1Z47A 1V35A 1X13A 2AXTU 2ZR0A 3B89A 4U7HA 2VQFB 3HYLA 2QP3A 1PWEA 5KTPA 1H05A 1QSSA 1W4ZA 2ZIGA 4ZPJA 4DBZA 1H4VB 3IVAA 4MP3A 2B4RO 2ECFA 1FFDA 2PH1A 3W5CA 1DVRA 3STVA 1Q1EA 5TQ2B 3Q3IA 5K51A 5JNWA 1ADFA 3TQTA 2XVYA 5BYKA 2GZSA 4HUTA 3PI7A 5FRDA 4GSYA 3SICE 3NGDA 1VPDA 2A35A 1PJRA 2GF0A 1NZDA 1C3EA 1SUPA 1W30A 3KQPA 2HR1A 1JRLA 4BC1A 3KTQA 4MKGA 4KEAA 2ZT8A 4J9MA 1KZGB 3O0DA 4KO2S 3CW2A 3KJXA 1SL0A 2ZT7A 4ME6A 4V02A 2P9CA 5DU2A 5ALDA 2QVXX 1VL6A 2O07A 3W8NA 4KU4A 3OZAA 5DX0A 1ODJA 3TBKA 3Q5DA 1JR2A 3BDVA 3OIYA 4GXKA 3ENZA 1HH4A 2OT3B 4KH1A 3S55A 1QTIA 3EHDA 1UM9B 2UZ3A 1KYIA 3DWEX 3WP1B 2HHJA 2B4YA 4EW2A 3KKMA 1P1JA 5K4AA 2VDPB 2O20A 1TLTA 5G4KA 5FUQA 1XZCA 1NI5A 4ECAA 2G6TA 1XCJA 2PKQP 1ZQFA 2EXXA 5D1NA 1FJGB 3CJRA 4G4IA 1G3MA 1A9OA 3O8RA 1P2GA 1K6IA 3I3OA 2H06A 4LXQA 2XHEA 1C5KA 4RGVA 3P2YA 2LP4Y 3W79A 4JBWA 1R0WA 3QPBA 5H68A 4JGIA 4ZDKA 4G8JA 4XX0A 1K06A 4JB3A 3MWYW 1P81A 2GA8A 1MX1A 5CBKA 5C7IO 1WSWA 1Q0TA 4F38A 5DCUA 3WB1A 2D2XA 1MC1A 2HLDA 1JYFA 2PX4A 1BTOA 3RNLA 5A4FS 3GRAA 1EX1A 1QO7A 1KFCB 3I09A 3DB2A 3L1JA 2J45A 3S40A 4AS2A 1JILA 5CDFA 5HJ7A 3QJ5A 4NSNA 5LZ8A 5JO0A 3PNSA 2RB5A 4DMFA 3U1TA 2YVKA 2ODBA 4G97A 5HGJA 3CP8A 1K5OA 2YDYA 3KFXA 3HVUA 4YRGA 4IIVA 3Q7IA 2XGGA 1JX6A 2YFQA 3FPEA 3FD8A 2JHFA 4CV1A 4K5QA 4HL6A 4CL3A 1QF6A 4O0LA 5EJ6A 4DLUA 5J2JA 3M34A 4CMHA 4DJ5X 3FX2A 2HI0A 2L69A 1Z0AA 1J25A 4EJ6A 4LMRA 2OCGA 1W35A 1QCKA 4GECA 4B79A 4BO4A 3RWOA 2VP3A 1FB5A 4J0EA 2DWUA 2N1RA 4REMA 4EBBA 4G1BA 5KKAA 2X4IA 1R8JA 1NBHA 3HA7A 5CHEA 2HCJB 2V55B 8ICJA 3U3XA 4EBCA 4DB2A 4MMZB 4D7AA 4GMGA 1QOPB 1KIFA 3EIUA 1L0BA 2YRXA 1A4XA 2CSUA 3BXFA 4PM4A 3GLGB 3RRNA 1WHTA 3DH0A 3RS9A 5AI6A 1MPTA 2WVHA 3EASA 1NPYA 3EY9A 3KZMA 4Q45A 2XGMA 5AHRA 1KMMA 4AUEA 3ESCA 5F33A 4F2SA 4FW9A 4TN5A 3DBHA 4ECXA 3OQ6A 3Q2IA 2AG8A 3S1AA 2XDQA 2GXSA 3RJKA 4Q7MB 4QZHA 1NVVR 2CHEA 3TQ1A 4YMNA 4RCVA 2LNDA 3KTDA 1CHDA 1YZ6A 3IG8A 2J87A 2V3WA 3VDXA 1WXQA 4HAIA 3FRIA 4G4SP 4PQGA 3RBAA 3QXJA 4MK4A 5AHXA 2NNWB 2VTVA 2KVCA 1ZGBA 4BXOA 3MCZA 4L0MA 5HE8A 4LRSB 4NFLA 2VT2A 3MG9A 1PT6A 2WT9A 2Q4RA 4FT2A 6AT1A 3TYXA 3L9XA 3UV6A 2P6UA 2GN1A 4EZEA 4Q3OA 3KZOA 2FJPA 4Z6DA 3WGLA 3IP9A 4FFPA 3OHMA 1VCMA 4WI1A 3EARA 3KQYA 4JWNA 4EECA 1QSYA 3OECA 4YMUA 5F3XB 1PZMA 3BF7A 4UE2A 2CVQA 4Q21A 4DW8A 4G23A 1O0BA 2KX7A 4XXHA 4FDUA 3T3HA 1A8PA 5DQHA 1L7BA 4CLRA 4RF5A 1FXWA 2JFFA 4B47A 3BWVA 5JFGA 3NWBA 1PJQA 1M2JA 5K3FA 2XZTA 3MWGA 2WSBA 3H2BA 1RI4A 3AGQA 1JQLB 1I6WA 5EXXA 4YGYA 1R2QA 4IRDA 5TF4A 5KFAA 3O3MB 5FFFA 1C1YA 3WIOA 1R9GA 9ICMA 2W0SA 1D0VA 1DINA 4PO1A 2PKWA 2FI1A 5FP0A 3TMYA 4R84A 4D9JA 4GC5A 4OGLA 3DXYA 4PYKA 3K71B 4S12A 3SNHA 4ESVA 1TM4E 2LDXA 3EGOA 3K2EA 5LMZA 2OFXA 5F7ZA 1D2NA 3D4PA 3GVHA 4I2CA 3FSGD 1EVKA 3I23A 5FWYA 3CJTA 5K0SA 1O0SA 2E82A 3E9YA 4E4YA 4PGHA 3ZY5A 1JXOA 3ZDEA 1KI7A 2D0IA 1Q0UA 4CMIA 1XTBA 5DHPA 5JAPA 3QE2A 2X0IA 2H1RA 4ZKDA 2FFBA 3RYHB 1WV0A 1Z2PX 2Q1WA 5EA2A 4FGKA 1MTZA 3KQMA 3T3DA 4LDJA 4KLQA 3IBGA 1T4CA 4LCJA 2QTRA 5F52A 3K9QO 4DHEA 3IO3A 2NADA 5CVCA 1NQOA 4H1VA 4OTZA 2C22A 1HG0A 3K5HA 2NXCA 4EHFA 3AOEC 3G7UA 1LBQA 2A9RA 3N5CA 3NVYA 5G0UA 2JLWA 2JCSA 3EGIA 3R6DA 5PGMA 5IVKA 1YRYE 1KO5A 2YS7A 5CWRA 5KMGA 2QSUA 3JQAB 5GONA 1SVMA 4HI0E 1XZKA 3C7AA 5CG1A 1Z6AA 4QZ9A 4L4UA 2Q4BA 5K0LA 3OU2A 1JR3E 4MW1A 2XZOA 1C7ZA 2AE2A 1B8UA 3ZZNA 1SIUA 3UGKA 2PD3A 2QTVA 1ZU5A 2LDBA 2YY6A 3JALA 3RRXA 3S29A 1XVTA 4TKVB 4YJ3F 1NE7A 2YIMA 4XEHA 2YUTA 4CN8A 2V6FA 3DE4X 3PI6A 1ZR4A 5DW3A 2PZKA 5KQPA 1UQRA 4QVGA 5BVHA 2CWDA 5K3DA 4QPCA 1CTQA 1M2FA 4QWWA 1DJPA 3EFEA 3BD6A 4F46A 5HS4A 1FFAA 3TX2A 3L0IB 3O8BA 2PMKA 1TM5E 1OPXA 1VLVA 3WK7A 4L9AA 4F8EA 4RVGA 4OHUA 2QPOA 4A2PA 3G2KA 3KSDO 4DLPA 3ICVA 3OG9A 4BMPB 5BNWA 1V4NA 1JIJA 4RQNA 4GI5A 5EQDA 3ZHXA 2I1LA 4Z2AA 4B9TA 1JR3D 5JC1A 2J0QA 2ZRCA 4C8NA 4U3JB 4XWAA 5TS3A 5ALWA 3RF6A 2FX3A 3PXDA 3LNTA 4E30A 4LX8A 2AHRA 4EUNA 1EDBA 4CCAA 5JR3A 3BAFA 4OHXA 2FR8C 2ZE6A 2W7TA 1J5PA 1DO2A 5JPCA 1YL6A 4ZTBA 4BKPA 3R1IA 4NS4A 2AHOB 1T7PA 3AEQA 1EFTA 2PYZA 2IRWA 3GLSA 4YHBA 5M04A 2QL6A 3GRRA 3P94A 4PLHA 4JR2A 1KZHA 2I9GA 4E4TA 4D3SA 4DTIA 1QVWA 2Y68A 3NRWA 3IT2A 4ZEXA 1SQFA 2D5CA 1JMVA 2BBWA 2P67A 2ZDQA 3BXOA 4IIFA 2O1WA 3C3AA 1JROA 2GXUA 2GVZC 4DDMA 3TNDA 1DXYA 2G82A 3ANTA 3QM1A 5G5GA 4TQGA 1LTHR 1Z0JA 2AW5A 5JFTA 4LF8B 4O6VA 5HYVA 4DS5A 3FR8A 5SZHB 1B2RA 3ET4A 1H2EA 5J2AA 4DPLA 2FE4A 4YWHA 1JHOA 4PLWA 4PHGA 4RVNA 2XUHA 3OWXA 4KDCA 4DARA 5ALTA 4G1MB 5FEUA 4HWRA 2JLSA 1G2QA 3KKEA 4NC9A 2KHZA 1V8OA 4NVRA 4YI5A 2XA2A 2AI2A 1QTRA 5ADHA 1JWAB 4Q3CA 4B43A 5DBAA 2QRQA 2WIKA 3G82C 4IDHA 1I4LD 3G2IA 2PIAA 1RBZA 3VPBA 1PQPA 2X77A 1BAPA 1GCIA 2OLJA 1XDBA 2PEYA 1ZQPA 1QG4A 4WFJA 3B0XA 3L4PA 3PT5A 5TJHA 1ZKMA 4UAYA 4M87A 4US8A 4AO6A 3RG2A 2ZB4A 1JQKA 3WWOA 1V45E 2ZJAA 4PS0A 3NR2A 1CRLA 3QU5A 1LNSA 3K0CC 3L8ZA 4M7WA 4LRTB 2ORED 2X5KO 2Y92A 5E6SA 2ZAGA 1A0OA 3D02A 1VIYA 1OFGA 3ZDBA 1LWNA 1N9GA 4LHWA 1NG9A 1U80A 2NZXA 4OXIA 3DXFA 5ALFA 5NULA 3UJ6A 2CXQA 5JTTA 1G0OA 3KUXA 2HUNA 1NMQA 4NYJQ 2ZRHA 3CRQA 1O6CA 2VDRB 1CUGA 4ZI5A 1WPRA 2JHAA 3AZQA 4X0EA 4ABTA 1JE1A 1M6EX 4JQZA 3LVWA 3QX9A 2ZCVA 2OPBA 4OQEA 4JOSA 2BEUB 3CEMA 1K88A 2CJWB 5HHTA 2ATIA 3ZI0A 1VE9A 1GLGA 5ADUS 2WFLA 3BDIA 3NC1C 3Q3EA 2FE9A 3RTAA 6PFKA 3GDWA 4HDNA 1SKAA 2BY4A 3TSCA 4IQVA 5EZSA 4AF8A 2LRHA 3BGVA 2F7SA 3ZHTA 1QNFA 2DOKA 2QTZA 3ZW9A 1I3CA 2OZKA 3GUZA 2HYDA 3U7QB 3AX6A 2G5CA 3F7MA 4GXJA 1FFWA 1SZHA 2JJ1D 1ADJA 4R7ZA 4I2JA 1YU6A 3PF8A 4FHDA 3MMNA 2JW5A 1R16A 5ECGC 1E1CB 2PKCA 3QXHA 2A19A 4LXIA 4RSRA 1ZJ4A 3OIVA 5EKSA 3R9IA 3FKSA 3DVQX 2C7BA 4L6IA 1HSOA 1ESMA 3EA4A 5CFRA 1QFYA 3L2OB 3KTFA 2WM2A 1QAQA 1HMYA 3VYUB 3VPHA 5AKKA 2JD1A 1GILA 3U3RA 3QPAA 3NIFB 2ZTCA 4BWVA 3T4XA 3H7IA 3U4CA 2WUDA 5DYIA 1TQ8A 4RO0A 4W6ZA 1NNSA 5GZ6A 2C88A 2QAIA 2BVNA 3I9MA 3HKEB 1P1RA 4G5HA 2I4NA 3I52A 4HJXA 3IHKA 1ULBA 4N40A 2J1LA 3LY5A 5JYBA 2KIVA 4BWMA 2VZ8A 2VA8A 1MOPA 2QUBA 1AQYA 4MF2A 2WT8A 1P29A 1XK7A 1XPOA 1DJMA 2K60A 3JQDA 2JLUA 1MOZA 2EKZA 2LVBA 4BQQA 2R7LA 5C7OO 1M6HA 3P9KA 2MOKA 5J8YA 1GO2A 5LMCA 1O58A 3K5WA 4YQFA 3C4QA 1MZVA 2ZYRA 5L51A 4G09A 3FCEA 3AWIA 4GEKA 2G83A 4KYIB 4ETWA 4DA9A 4ZGWA 4BZWA 3CGWA 2BKVA 2XF2A 4DQQA 4ARSA 2QX4A 4M1OA 4OJLA 3H2HA 4NPHA 3O5AA 3N07A 2ZJZA 3MGVA 3A4MA 1SBIA 8OHMA 5C9ZA 2O0KA 3HYTA 1IWOA 3A31A 1U2TA 3SQXA 2CBZA 1MB9A 3LIPA 4RKEA 2IIPA 1R10A 5CEEA 4E11A 5KOJA 2FA9A 7ICLA 4D8UA 4LVUA 4OGGA 3JASA 1BEEA 1H85A 1T1RA 3WC4A 1NNI1 1JFRA 1MVNA 3DMDA 4ZC8A 5AK6A 4XRRA 1OXUA 4HR7A 3E7DA 3FHOA 3RROA 2VPXA 2Q2WA 2PUHA 2OP0A 4I1VA 2R7NA 5F12A 2HRZA 4BIIA 2R85A 4QUKA 3G5TA 1YR9A 2WWYA 3EQ6A 2TS1A 2OGZA 5LXTF 3GG2A 4XJSA 4A3SA 5CXXA 2WAXA 3KQUA 2AQ8A 1Z22A 4GLJA 1GL9B 3B6EA 3RVMA 1NBIA 2QGZA 2HU5A 1FFYA 3AKZA 2I66A 2XWBF 3V7KA 4ZEOA 4NABA 4NRDA 3FBWA 3MJFA 4Q9HA 1IM4A 3GLUA 3CLUC 4TTQA 1XNQB 4MWEA 4XR4A 1USKA 3VAYA 4BQNA 3UM9A 3KQLA 3N8KA 1JAZA 3DBIA 1LS6A 1XTQA 5IARA 2CFRA 4LGVA 2CUNA 1M6WA 5HCIA 4QWEA 2NLOA 3OQVA 4DL5A 1LY1A 1Q44A 3W6OA 2AFHE 2N1MA 1DCKA 4QU5A 3PGJA 3GLIB 4Z4HA 4I55F 4RNDB 8LDHA 3KT0A 4RFSB 4JT2A 2F3RA 4RDXA 1LQUA 2GBLA 4C0BA 1ONOA 1E2FA 4JLWA 3BX1A 1B3BA 1I4DD 1HPLA 2J31A 4EAQA 1JV2B 3PW4A 4E09A 1VMAA 2C5BA 4DMCA 4EYSA 3UK6A 2ORWA 3PCTA 4WZBE 2Y3IA 4IP0A 5KTSA 2J0UB 5BN5A 1YZGA 2J46A 4IDGA 2IOFK 4TUYF 3SBOA 3VOSA 1O95A 1H94A 5GVSA 3MJTA 1UBEA 4UAGA 3L8YA 3GFOA 1GUZA 5AFSA 3AN1A 4F2HA 3IQDB 3WA7A 4IBOA 2HA7A 3KOUA 3GEGA 4YMIA 1JX4A 4QU0A 4V0OA 4OJPA 1AY0A 1CT9A 5TMDA 4S3MA 3OC6A 5I9NA 4IMJB 3DMPA 2R751 4IIBA 4P0PA 4UULA 4JI0B 3EXG2 1G63A 3MWFA 2XUDA 5A3RA 3VXKA 4DMUB 4E5SA 2CBXA 5B7NA 4DIOA 3CZQA 4W1SA 2B5WA 2FPGA 4BBAA 4QBFA 3UAWA 4BFLA 4UPEA 3I8OA 3S2EA 2D5IA 1JU9A 3QUQA 3T5PA 3JD0A 3PHBE 2WIDA 4W8HA 4BGUA 2V5AA 5CRIA 3HR4A 2OCYC 4DZZA 2Q27A 2MTBA 3TL6A 1MB0A 4RV4A 1NUHA 4WCFB 3O8DA 1FXSA 1PJ2A 4MUJA 3WNCA 2WMOB 2JJ8A 2A1TS 3CO5A 4R5MA 2UVPB 3EPKA 1Y1QA 3KYJB 4QYIA 1YQWA 4DBLE 4X1KA 4NL9A 4J1NA 1R9MA 1BU5A 4CT4B 1L3TA 2JBHA 4QOGA 3CUSA 1WXXA 2JAUA 2ZQ5A 4J91A 4R8RA 2GVDC 1YAJA 3I0MA 5KNCD 3BJEA 4B3DA 5KC8A 3RAXA 3OUUA 4AB1A 4ND8B 4B7CA 3QY0A 2OLEA 3K6SA 3PZRA 5HKBA 3N0RA 5EHNA 1K5PA 1CVIA 3KOYA 1UBCA 3WV4A 1TA0A 1E60A 1AKMA 2WZQA 5KWSA 1U1CA 1YJBA 3EJ6A 1HT3A 1L3VA 1X1DA 1E3IA 3MF4A 1J9ZA 4BAUA 5BRJA 3EXFB 4F4ZA 3SLRA 1Z6GA 2BSAA 5KFDA 4MHTA 3QQPA 2FFRA 2OKGA 3GJXC 2OM6A 2EU8A 4QJBA 3AJ8A 2DGZA 1U0LA 4EM6A 1BROA 2YJTD 3HKZF 3JX9A 1C0IA 2VK2A 3QFCA 1U1FA 4N0EA 5F2KA 4ECEA 1G5FA 1NVTA 1KC1A 1R8QA 2VA3A 2ZWIA 3CW9A 1T5DX 1T8UA 1YUMA 3NOVA 1Z6QA 1J21A 1FK8A 1RDFA 4HAVA 2PUJA 3VU1A 2B35A 3FYTA 4IQ0A 4N39A 4F5RA 4QJIA 3PQEA 2XCQA 5EMLA 1YFJA 3F2IA 5SY6A 5KFKA 3DG9A 4AYBF 4YY3B 3BE8A 3N7UA 4UQPA 2GN4A 1UJNA 1ZIOA 5KJCA 3AP2A 5IFKA 4RQMA 1VB3A 4MKRA 1N8TA 4IIUA 2YR0A 1EK5A 1BE8A 1IXKA 1QRRA 2GM9A 4RD3A 5C3UA 3UT5B 2Q8NA 5EWEA 3R40A 4DPKA 2RGUA 5FXMA 4C5CA 5LZ2A 4EY4A 1JJ7A 1X66A 2BV3A 4J0DA 4F3RA 4Z9XA 4MCHA 2ZU6A 3KHTA 2XSZD 1UMDB 1WCIB 2MRLA 4KLHA 3C3YA 1QG0A 3MT9A 4FNMA 2QB5A 2J48A 4C3UA 3IRUA 3RSGA 2F2TA 4G0ZA 2DULA 1GPAA 2IYPA 2KJ8A 5DISB 4KLSA 4JJZA 3CHYA 1O97C 3U40A 1VDMA 4XVQA 1D4AA 4M1QA 2Z2XA 4X1IB 1U7WA 3P26A 4LYEA 2NUTA 1P80A 2QR3A 4AO7A 4BN4A 3T94A 4E33A 3EIFA 3OFJA 1I3MA 3AF1A 1VJ1A 3R0ZA 1GVNB 2X14A 1Q3KA 3K20A 3ASYA 3U4QA 3HABA 5GMOA 1D1TA 1X1RA 1AUVA 4XRHA 4W82A 2HCBA 1G8AA 3PX6A 1YZ3A 1F8YA 1H1LB 3GDGA 4FXOA 3PV8A 5EZQA 4KQFA 5D00A 2HMXA 2QUZA 1UZAA 1T34A 2MMCA 4M1KA 5FADA 1KF0A 2ZUFA 4OJ5A 4R2HA 5ARCA 1JDBC 1ZL0A 4I1YA 1W85A 5B1IA 4DLZA 3BIJA 3VM6A 4QSMA 1FNMA 2DE0X 2BQ3A 2VUSA 4ZP1A 4BGIA 3NBMA 1V1RA 1XU7A 2VYNA 3WBBA 1KIAA 4CF7A 3LX6A 3F97A 1C81A 3V1LA 4LZNA 5J0YA 3IOYA 1IDN1 2ZP1A 1DGQA 3I2JA 4RQ1A 2K4IA 1N25A 3T0IA 1VPWA 4D9HA 3FXAA 3RFAA 1P0QA 3P27A 1J90A 1L6RA 3U16A 4TTJA 1F2DA 2HF7A 4C7OB 1XG5A 2J33A 4IFIA 2A5JA 4Y2YA 2DWCA 3C8DA 1BEUB 3A7DA 4Q4AB 1Z28A 1E2LA 2EZUA 1E7YA 2BI4A 3NV7A 1JFVA 1DAEA 1UOOA 3RUDA 1SCBA 1L8QA 4E2XA 2XODA 3U80A 4YUZA 2X6QA 3B1FA 3RU2A 4P3XA 4BFVA 5FWAA 2M1XA 3RK4A 1C30B 2NU8B 4CG0A 1JG2A 5AH0A 3IMFA 1QXSA 1VCNA 3A2NA 2ZJ5A 2ZSKA 3DL0A 3FWHA 4YMGA 2UYHA 5TJ9A 2IZ1A 1TIPA 3CYMA 2QX9A 1UJ6A 1JIUA 4P2GA 2J07A 3CMMA 2EG5A 1HURA 3CN9A 1ZD8A 1CUHA 4BLWA 3GV8B 1Z39A 4R41A 4IDOA 4TTIA 2QYHA 4XQ9A 4LGCA 3NASA 1Y8RA 1ADBA 5EUMA 3HA3A 4IHAA 2I71A 4BL5A 3W90A 5AJUA 3IUYA 2Z83A 3BTVA 2QTHA 3P2KA 2G5GX 2WYUA 3PSAA 1QR2A 5EIOA 2ZSFA 5H02A 3OX3A 4J9RA 5ITZB 2FXVA 1YB4A 5FYQA 5A5FA 3HCRA 1J39A 2YFKA 1QH1B 1JEYA 2YQ4A 3ZN2A 4C4OA 1JEQA 1IRXA 4D92A 3PJEA 1W96A 1H6BA 1KYWA 1O94A 1JQDA 4WCVA 2CXTA 3P45A 1X8JA 5F5NA 4UTRA 2PJRA 4W6QA 5KQMA 3HZHA 3RFUA 1M6NA 5B37A 2ODAA 2QDXA 1KPHA 5EJ8A 5JNSA 4ETIA 3PDCA 1GQQA 3G0GA 3VU9A 4OU5A 1NTOA 3VZRA 1UC9A 4X84A 5G3ZA 2W71A 2NACA 1QDUA 2ZT6A 4PFKA 4FBGA 4I2VA 2FPWA 3BS5B 2C4TA 4M21A 4ZVNA 1RBMA 2BH9A 5AJWA 5BW4A 9MHTA 5J2GA 4ZO4A 4P08A 4KPUB 4JGBA 1W49A 4NK4A 5AKYA 2HOFA 3THXB 3N8DA 3KBOA 4QZIA 1SIBE 5JTIA 3IDZA 2WA2A 2YJNA 2NTJA 4IQUA 2UVDA 5J2UF 2P0AA 4GR5A 1O96B 3UICA 1BSVA 3SIWA 4KLTA 3LI2A 3H1GA 5J2EA 4Y3UA 3VR4D 4C8KA 5BSRA 1J8FA 2X0EA 1CUZA 4K8RB 3A0UA 3BFVA 3UWDA 1G18A 3UO8B 1FZQA 1AVTA 1R6DA 4J94A 4W7SA 4CTKA 3EQ2A 4MITA 2ZDGA 2VDQB 2WPDD 2AJLI 2X0DA 1LGYA 3KJFA 4OYLA 3COPA 2YHAA 3L7YA 3UXMA 2F1OA 1ZS9A 1Y89A 2R8BA 1NVVQ 5FNVB 3STXA 1X7ZB 1IAQA 3QVLA 1UBHS 2WSYB 3OHSX 1EUDA 4ROTA 4I4TB 5DHFA 2VT7A 2WYOA 2P9GA 2PSSA 3MAGA 3WJ2A 4LY9A 2PGXA 5FOTA 4PSAA 4DZRA 3REGA 1Z4OA 1BMTA 1XDUA 2R4QA 5LQDA 5JV5A 4L50A 3TDNA 4UUOA 1G9TA 4WKNA 3PNKA 3QENA 1OAOC 5JEDA 4M8NE 2E85A 1MJGA 2ORIA 1H2AS 1YHNA 2YNMA 3LGSA 5HIKA 3BQMB 4Z7JA 4FYPA 3T9EA 4QUGA 5DJ5A 3MCTA 4J9PA 1I3OA 5BPCA 5B6PA 4CU5A 2R8EA 4RZXA 3UAYA 1T43A 2I4TA 1P72A 1BO6A 2BMWA 3MILA 4WERA 1NVGA 4FWIB 2X6RA 3EPRA 1KYYA 2BONA 4UUMA 2DF4B 5KNCH 4DEVA 4R9UC 1Z0UA 3RC9A 1B8VA 1TA9A 2BFBB 1M75A 5DZSA 2E1RA 4JCCA 5D8DA 2OZLB 4IVRA 3GIWA 3GLKA 4TUSA 1ELOA 2I3GA 2MSNA 4X85A 5C4GB 1Y48E 1JQEA 5C37A 5ALJA 3D3KA 2XT0A 2ADMA 4FT4A 1JBEA 5J59A 4ICIA 1ZQ1A 4B33A 4OYRA 1GU1A 1F2TB 3LDFA 2NYVA 2QLJA 5A7FA 5HVNA 1U63A 3I62A 1TYCA 4Q44A 1E8DA 4M2YA 1JLKA 3MTIA 2FJ6A 4QU8A 5IKMA 4N03A 1GO3F 1XJ0A 4V0ME 2KZMA 2Q21A 1KI3A 3GGGA 5CLHA 4UZEA 3UA4A 5JDIC 3VTAA 4D4HA 1E3WB 2J85A 5HR7A 4LC1A 1UXHA 4AX8A 3LVVA 4I2DA 4YQEA 4FKZA 1KR5A 4C80A 3M2TA 3NXKA 2W6ID 3O8QB 3SX4A 4X6LA 1I51A 2IW1A 1ZGZA 1AHHA 2HIHA 3AUKA 3FJOA 1DCMA 4QNMA 5JCOC 3HBLA 5T6BA 1LSSA 3BN3A 4XTRA 4W5WA 1NUSA 3AVTA 1S1CA 3E2IA 3GDFA 1XDZA 2REQB 4LF4B 2CVZA 2CFIA 3DDHA 1HORA 1LFDB 5TZVA 3SHOA 2COKA 5ALOA 1WD5A 4P4MA 3AUAA 4OU4A 1A3CA 2V3VA 2G0TA 5ICMA 4IR9A 1A0PA 3ZU2A 2FSGA 3OUTA 3IAHA 4LN1A 2JCXA 4A8TA 4DJDC 3CYFA 3M5DA 2BMFA 1L5KA 3VNSA 1ZHFA 5IWCA 1L5RA 5HF9A 3IEXA 3N0XA 2YASA 2Q3DA 3NVMB 3TIFA 1MIOA 4KIGA 1CUAA 2AI1A 1XTKA 2MSWA 3R09A 1ISHA 4MFAA 4RKFA 1LI4A 4R83A 2EZXA 1RADA 4NMMA 1RLJA 4UOQA 3ZCXA 4CDRA 1AV6A 1FRQA 4C8OA 1ZQVA 2Q29A 4LYGA 2JPDA 4KODA 4TYQA 3C3JA 4UVGA 1QQTA 3Q8KA 2FW6A 3DYIA 3BD9A 4KN6A 1EP1B 2ZRLA 3ULKA 4OPMA 1MN6A 3ABOB 3OT4A 4Z6EA 1UHUA 2R84A 1AGNA 3VOAA 3NAQA 4JXZA 1DWUA 4YT5A 4UB5A 5D3ZA 3KQKA 1DG9A 2C7OA 1N7HA 3HWTA 3A26A 1DKPA 1Z2CA 2FZ5A 3LDGA 4QUJA 2AFIB 1JN3A 4M38A 4PLFA 1JTEA 4LY0A 2CDRA 5F3DA 3W5DA 5EJGA 2EGUA 1XZFA 3NIWA 4UU8A 4R2KA 4KX5A 4AQ7A 1YS1X 2PUGA 2UUPA 3ZQJA 4OSOA 4N01A 3R6LA 4BQEA 2PVPA 1UAYA 4YCJA 3HHEA 3EE6A 2E9SA 1DQRA 5JS8A 2B1IA 3DV0B 5CH3A 1IQPA 1Q16A 3N3AC 2QTLA 2VP5A 2CHFA 2Q5JA 4TTSA 3HY4A 5ALKA 2JC3A 3KOOA 3PSIA 2GLXA 4PSDA 2C98A 2R0QC 3SP1A 2W5UA 4TMYA 3OFSA 2WDZA 3CR3C 4GXQA 1YONA 4ZEMA 3WWZA 1QE5A 2HBRA 1W44A 1SVWA 4ZVPA 3TQRA 2ETVA 1QFZA 1YKSA 1YS4A 4NPCA 4C08A 2ERYA 1U0NA 2R6DA 1AK1A 3JWIA 4URWR 1ZGCA 5LA6F 1P2BA 4KV7A 3OOJA 4CCYB 1UMBA 1JEOA 4QOEA 3PWSA 3I4LA 3Q41A 1P4AA 4G3XA 2OMEA 5M5BA 3OE7A 4ZQCB 3ECCA 4C4RA 2QYTA 3ZYCA 1E2HA 2HMYB 1RQ7A 1SK9A 3EEFA 1NLFA 5CB0A 2YCLA 4KIUA 2IODA 5FBZA 4BMVA 1E5TA 2IEZA 3LPMA 1CUEA 1N57A 2GTIA 4XFJA 3WQRA 5SZKB 4A8JC 3NTQA 1T3SA 2CFSA 5F51A 3U4DA 4C04A 3A1WA 5K0FA 1KRHA 5GQSA 4RD0A 4M1MA 3NPAA 1J42A 4DLXA 4MPTA 1X2BA 2C2MA 1OA1A 4OQXA 1WCLA 2YWRA 4A8HA 3LWBA 3QPWA 3S2ZA 1ETHA 4NJMB 3IHQB 4A2QA 9ICRA 4ROSA 2O8DB 2WNSA 2Q99A 3ZJYA 4KLAA 1EFHA 3PR3A 5L8VA 4QE3A 5KNIA 2ZUDA 2R2AA 2EVWX 3FPLA 3K2IA 2QQGA 3HSKA 5T4FA 4Q15A 4PBTA 3AV3A 2SKEA 1M2VB 2C2WA 1F8GA 1SR8A 2A9FA 3KKKA 4RL6A 1EX6A 3DLAA 4PC3A 3PVZA 2H31A 5L7YA 2Q2NA 5KFIA 4BDPA 2W2NA 2AMLA 2ZIUB 5TT1A 2IH5A 3DOHA 3ESDA 3F3SA 2BZFA 1RQ2A 3UWSA 4HGOA 5A4IS 3M6IA 3OKFA 4US1R 4MPJA 1Z06A 3UHPA 1S01A 2NO1A 1OU0A 1QB8A 1NXVA 3PUVA 3VV3A 4QNNA 5IINA 5EPEA 1C8KA 4UHBA 3L7JA 2E5FA 4HDAA 1K7XB 2HFJA 1Z00A 4N6NA 5DTIA 3K0AA 1SOVA 5KVCA 4KFSA 2PGNA 1XEWX 5EE5B 3SXUB 1N3YA 4C4TA 4MQFA 1KKMA 1KZ1A 1UP7A 3IESA 4U7TB 2PVSA 3ZIUA 4LECA 2BHTA 5IBRA 4LQ4A 1KEEA 2XTMA 5IDWA 1SCQA 4GPD1 4N5MA 2ZYGA 3VR4H 5DN6A 3A6KA 4CV2A 1GZDA 2OG1A 1N60A 1RP7A 3GJ7A 3C24A 4X3CA 4LF9B 3BGDA 5IWAB 1WSDA 3CEHA 3H97A 1M1YE 4JBIA 5BV8A 4RIFA 3LLUA 4BBPA 3A4IA 1T2VA 2H85A 1YZKA 2GRJA 1Y7PA 4O1IA 3TN7A 4JZYA 3T4UA 5GGYA 4Q1VA 2DB3A 2P9ZA 4BAZA 3HK2A 4R8VA 3RVKA 2FKNA 3L02A 1RM4A 5HQ3A 3CR8A 5J63A 4FGWA 2Q2VA 3GJSA 1N2GA 2B2NA 2PUDA 3NHBA 3Q7QA 3DC7A 3WJAA 2PZBA 5HZKA 3H84A 1UT8A 2G76A 1FVHA 1F6WA 2BCSA 4G0NA 5E38A 1E2DA 1PJZA 2OTCA 2IS4A 3QIVA 3KQSA 4KLLA 3BGIA 1T1GA 1KJYA 2RK4A 2WIBA 1P61B 3JTMA 2FDCA 3B1YA 4NS1A 3IFSA 1G20E 3EAGA 4IV8A 1MH1A 3RKSA 5HFAA 2NGRA 3BEOA 3BCSA 3U39A 4AF7A 4QWCA 4I1OA 4O5EA 4BYMA 4ED2A 2IZ7A 2YXBA 1I7PA 3LUBA 4BAGA 1NVMB 4L2IA 3SEIA 2ZZKA 3V1NA 3SKVA 4FGLA 1CG6A 3I6QA 5H9WA 4W7IA 4FHFA 1NKBA 4PHCA 4EY6A 1EVYA 8ICGA 1M9NA 1FS5A 1XTTA 4M46A 1NR1A 1NVWQ 2B2CA 4S2UA 3WZ2A 1QGED 4XLZA 4MB2A 3HU3A 5DBEX 1EE1A 4A82A 5ENZA 1N0VC 2Q4EA 3HLTA 4X5OA 2JJQA 1IZ8A 4GXIA 2QG6A 4R1OA 2BH2A 2AMYA 5ES4B 3VKVA 3IHWA 5LYJF 2Q7XA 1Z74A 4M99A 2EKDA 3IUQA 1QPBA 3BZCA 1SO8A 5FOVA 3M6ZA 2ZTUA 5IDYA 4EUKA 2ZIVB 3OIGA 2CV1A 2QTAA 4B83A 1QX3A 1R4MB 1X80B 3AUFA 3R0QA 2ODTX 3JRWA 1CUJA 4JI7B 3OJOA 1ZGAA 3NX4A 1T13A 3I28A 5AWFC 3GUUA 1RWPA 4RA6B 2ZSHA 1EUQA 2BM1A 2M6RA 3LGAA 2JRLA 5KVQA 4N76A 1Z16A 1QGYA 5JALA 1R66A 1WHSA 4HDMB 1N2CA 2E89A 4IMPA 3A9RA 1DC3A 5I7HA 4XARA 3A4TA 4CKXA 2FEOA 4PQFA 1H2HA 2PGLA 2XYRA 4RMNA 4B35A 4YT2A 3IAEA 1NA5A 5ECYA 5JW6A 4UATA 1OFIA 2Q6VA 4RS4A 2PZEA 4NLBA 4YD2A 5HF6A 1IY1A 4R2XA 4I14A 4Y2JA 1YU9A 2HMAA 5DM4A 1M0SA 4F12A 2Q3LA 3LF1A 2VF2A 1P1KA 2NXWA 2WJYA 1JXAA 5IILA 1MABA 4X91A 2QB0B 3R3HA 4XI9A 2IZZA 1XRPA 3PEEA 2VA2A 2H7XA 1REQB 3ANSA 3SI7A 1CZRA 1Q2XA 2AGOA 2DU8A 3TEMA 1KI4A 4HQRA 3PD1A 2W22A 4YJHB 3VR5D 4KE8A 2IELA 2YFYA 1TM7E 2AOUA 4DCNA 2WWXA 1FTGA 2J5RA 4BMNA 3GUCA 2KJQA 1M7HA 2BEVA 4V3BA 2VWQA 4IFEA 3GJ5A 2QM0A 4PX2A 1KYVA 2KFZA 5FI1B 1HETA 2N46A 1XWFA 2EW2A 5BWLA 2NO7A 2L18A 2FUG6 2NP7A 3KC2A 2PFOA 1G8JA 1X7WA 5ENVA 2WIFA 3Q3JB 1K75A 3SDZA 3FDZA 2RHLA 3LP8A 2HFKA 1QC5A 1TKRA 2VRNA 4FKMA 5EMJA 2WHEA 1SU6A 3SZOA 4ZCQA 5CAEA 3UUGA 1RHKA 1J22A 3FYUC 4WNYA 2B36A 4EPXA 3JR3A 3I72A 1CFJA 1X9SA 2JCBA 4B3FX 3MERA 8ICNA 5IRCD 3KJZA 3UZUA 2VBGA 1RZTA 3KEMA 4WZAB 1NLMA 4WNAA 4NBLA 1RWKA 4U7GA 1A96A 4H7EA 1NBEA 1SXJD 2W9BB 5L4SA 4G1UC 1XJCA 3T7CA 4OA5A 3VKUA 3A6HA 1K5HA 3IR5A 3BXZA 3OSNA 4FFBB 4Q7EA 4RABA 2J5KA 1L5UA 3RK1A 1AGYA 1JBQA 1T5SA 4NJ8A 3R2JA 1TM3E 2VF4X 2ENWA 3O4RA 1ZQNA 3GBSA 3SR6A 5FL3A 1C2YA 1UKAA 3CE6A 3WX0A 4B8YA 4C0AC 2XITA 1QCCA 4B6SA 2C5HA 3UG7A 4GLOA 4S1WA 1ZNYA 1QQ7A 5K05A 1GYRA 3PW7A 3P9IA 5EHGA 5HZGA 4YAKA 1ZNZA 2CLCX 2YZKA 3IQEA 4TRMA 1GOTA 3QQ5A 1KDOA 2V7BA 1UMCB 3FTQA 2FMPA 2FOIA 4DUYB 4C0SA 4B4WA 3VSAA 4W5HA 4WLEA 2NO5A 2YS6A 2GK3A 3LV8A 3I0NA 5L3ZA 5TPZA 4UFNA 4DL6A 4MFCA 3B7WA 1ORIA 1TRKA 1H23A 1NKSA 5JANA 2PMCA 5EMNA 4TVOA 5DHAA 2H00A 4OUDB 2VNSA 3ZHRA 2P2CA 4X24A 1LPOA 4KQXA 3VHRA 4RDCA 1D1PA 3IHLA 1WKCA 2HHAA 5L3RA 3ZDCA 2JFGA 2OHVA 3L5OA 1P4SA 5JD4A 5SY4A 4Z49A 4TRJA 1KTVA 4LG1A 2AC2A 3KKQA 1IMJA 4NFHA 3JQGB 4U9IS 3C2LA 1QLHA 4HMQA 3CCFA 4FEGA 3WHLA 2QS9A 4LZDA 2H1LA 5DNYB 1ZI6A 3ZE7A 3ZWMA 3HB1A 4JI6B 1J5EB 2EBUA 4AKTA 1V38A 3FVRA 4J2TA 5CT8A 3MDAA 5FI3A 4FGZA 3K70B 2PUEA 1MAWA 3FOAA 3KDAA 3SZMA 3E58A 3QKSB 4XE5A 2Z2KA 2YDXA 4WL0A 3L9WA 1RHUA 1OF1A 1RAEA 1G8FA 2HA5A 3RJIA 2JFPA 3P97A 1B26A 3OZDA 3AC0A 3FRJA 2DRIA 5T6MA 2PZJA 4MVXA 3GZNB 2P1DA 3N0WA 2FOLA 3NHUA 4RF2A 2COEA 4BZQA 3EFHA 4HDRA 1XNGA 5TSDA 4RTMA 3ORHA 1C4WA 1T8EA 2JAWA 3LX8A 1HTWA 3OJEA 3RM3A 2Z56A 2X1VA 1PSDA 2YTUA 2ZI3A 1EDZA 3NQ41 3NFRA 1W73A 3E2PA 4N7BA 1R0KA 3OA0A 2C2ZA 5KTNA 2Y6VA 5TMBA 3IOMA 4HNUA 3DTNA 4EB0A 5K9ZA 4R0MA 2RH4A 2WQ7A 4ZI7F 3I42A 3V32A 5JD5A 4JA0A 2H2FA 3OI7A 2FNAA 2BGIA 4D3DA 2YZ7A 2GD1O 3CNQS 5CG2A 3SQOA 2ID8A 4J1TA 2QGNA 5A3SA 1HA3A 1ECFA 4LBYA 2XB9A 3AKEA 4ZYYA 1VMDA 2Y1OA 1U2GC 4YRLA 3DTVB 3RARA 4ZALA 1GGEA 4C76A 3KQNA 3WAJA 3VC8A 4R54A 5J3JA 4NH0A 2XMRA 3PQCA 3ABZA 1T9GS 4KW7A 3D3NA 3LDUA 4LI0A 3PITA 3NS7A 1FMLA 3SZ3A 3EEIA 3O4FA 5KYNA 3S0JA 1NN5A 1QO0A 4UARA 1YVDA 1H5NA 2Y0SC 1GDTA 1Z35A 2IXDA 1KP2A 1Q92A 1KJNA 1SL1A 4O5KA 3IAXA 1PHRA 8ICLA 1SCIA 4JYZA 4BPBA 1EH5A 2XF8A 1X7DA 1FFUA 2CXYA 2CXNA 5I3ZA 2PUFA 3JW8A 4YREA 3TW8A 2GBGA 2PSDA 1N6IA 4M1SA 3PF9A 2CZGA 3T5TA 2JG3A 4HRYA 1DCFA 4UBJA 3JQ6A 1ZNQO 4ZAFA 3WLKX 3KHGA 3CISA 1PN3A 1JDSA 4EI7A 3PE6A 3F1LA 4GR9A 3DM5A 4RHYA 4DILA 3FVQA 2QD5A 3PY8A 1RE1A 2CNKA 1MIHA 3D59A 4OI2A 3H0LB 3ZZ1A 1A77A 3Q87B 2ZBRA 1CZHA 5ILQA 5B1EA 4P0TA 1AOXA 4H60A 1KWKA 1ZGJA 5BWOA 5KSZA 1XTJA 2I1WA 3BILA 4M9CA 1C1DB 4GDMA 4FONA 1A5BB 1W36B 3EF3A 2VDWA 2LTAA 2ZSBA 4H18A 2ZXHA 1U8CB 3H18A 3AR7A 5CLLA 3NAGA 3FNFA 3EPHA 4IZ6A 1RAGA 4HYKA 2J5BA 3KQHA 3MJHA 1JQJC 3A9SA 3I61A 4O1MA 4EJ0A 4C07A 1U11A 4A10A 1KEPA 3GN1A 4KVAA 3UK0A 3LZDA 4XWOA 2O48X 3X1KA 1C7YA 3RC7A 5D85A 5HQTA 1AKWA 4WLFA 3L6DA 3Q8QB 3FNHA 1JR4A 4H08A 3BHNA 1R6UA 5WRFA 2ZOSA 2WD7B 2FWRA 3GPBA 4K46A 3E9RA 3GYGA 1T1JA 2OEHA 1DX9A 3RBDA 1KQ3A 2Z4RA 4GQBA 4KO4S 4JP5A 4BVEA 3ZJ4A 2BQUA 3D2SA 3UJAA 5KI6A 2VSXA 2Y93A 5TVKA 3CU5A 3EC2A 3KPUA 4C30A 1WWKA 3TK1A 4B74A 3DV9A 5EE9A 2NYAA 4X97A 1VDVA 3ANNA 1QMPA 3L7NA 1U99A 4OK5A 3VISA 3I04M 1VBKA 3IUNA 1X15A 4P2BA 4OX9Y 5JE8A 4E51A 3R3ZA 1ULAA 1N6PA 1A7UA 2X1LA 2RGXA 4HAOA 4BN5A 3EDOA 1DBQA 1S8FA 4CGYA 3M6WA 4OJNA 5ARDA 3IPLA 3M8SA 4JJEA 3D54D 4P4UA 3O8NA 1SJ9A 5F3WB 4KTTE 2OZVA 3C7CB 4GLFA 2OCPA 4P80A 1EE2A 3RQIA 5A6SB 1KR2A 3CG4A 1M33A 3SNKA 4WFIA 3HBJA 3DAGA 3OCCA 2DCMA 3BSYA 3CPEA 3NBYC 4KP7A 1X3SA 5BT9A 2O3TA 4WT7A 3SJAA 3KL2A 3HYRA 2R8HA 2C2YA 1Q2UA 2C0PA 3G2MA 2UVWA 4KOEC 2ZRNA 1EBBA 1DEOA 1X1QA 4F6CA 1E6WA 1BCSA 3MFHA 2EW8A 3L1HA 3PDUA 3V1MA 3L7AA 4HHEA 4KZKA 4AWXA 3O94A 3ONVA 5AUOB 4NCBA 1DO0A 3FPJA 1RXSA 1OKKD 3K05A 4RJJA 2QW8A 1R4AA 1JDPA 4XVUA 1U90A 3VR5H 2AG5A 1Z4PX 1GEGA 4UNRA 3QBVA 1SHZA 5B2ZA 3QHAA 4ZOHC 2UVUA 3A37A 4PYNA 2REBA 1BJRE 1DBRA 5A05A 2AQ4A 4KUEA 3B9PA 4D6YA 3M4JA 1WKBA 2OXFA 1XV5A 1EUZA 4ETNA 3MIIA 1WMSA 4BX8A 3IR7A 5H59A 3RAJA 1JHRA 3I5MA 1GPMA 1GA4A 2FMXA 4OHFA 4MRMB 5FH9A 2AVNA 1WU8A 1U9IC 3H9EO 4AJ2A 3ELYA 4XSGA 3HM2A 1G8KA 5BSVA 4Y6OA 3QF4A 1CEEA 3C3BA 5EJIA 4I8DA 3SQIA 1ITZA 2VZ9A 4Q7QA 1SQ0A 5JVDB 3QYJA 2V5UA 1M0EA 1ZU4A 5EL0A 1SL2A 3VDNB 1VTKA 4MS3A