1Z4NA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate cocrystallized with fluoride
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
b'MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4nA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4nA01
3SLRA 3OCZA 4BX2A 2YY6A 3NAMA 1RLTA 2NO5A 2FUEA 2I34A 4QJBA 4HGPA 3W5BA 5AKJA 3QYPA 4MUMA 4RESA 2JAUA 4ZEVA 2PKEA 5AKXA 4EX6A 1U7PA 1TA0A 2MU2A 2HHLA 3MPOA 3CZ4A 3QU5A 2O2XA 2RARA 3NUQA 3RF6A 2OBBA 1ZD5A 2ZG6A 1SWVA 3RFUA 1U7OA 4DWOA 1Z5GA 3FPSA 2MU1A 2P69A 2PQ0A 2Q4TA 1JUDA 3L8HA 5AVXA 1F5SA 3ZWKA 2EATA 3L0CA 4KX3A 4HGQA 2FDRA 1SU4A 4I9FA 1ZRMA 4I9GA 1IWOA 2ZBEA 3A1CA 2RBKA 2YMPA 2HCFA 3UMCA 2YMLA 4ZEXA 4AS2A 1Z4KA 3WK4A 3AR8A 1J8DA 5AVVA 3L5KA 3OTQA 4UU1A 4UAVA 4OD0A 2GHTA 4XQ0A 5AK5A 3IRUA 1Z4JA 2Q5EA 3FPBA 4C4TA 3QGMA 1RRCA 4GIBA 3UMGA 2O9JA 3EF0A 3R4CA 2YJ6A 1L8LA 3SKYA 4BNDA 4DFDA 4Y2TA 1Z4MA 5AKGA 5A3SA 5AW2A 3NANA 5AESA 4IFTA 1Z4NA 1ZS9A 1L7MA 1RPZA 1ZD2P 4Y2QA 1U2SA 5AKKA 5ALLA 4F71A 1LVHA 5ALMA 4Y3UA 2YMMA 5AW4A 5AVTA 1VJRA 2CFSA 1YDFA 5A3RA 2CFRA 4EZEA 2B8JA 5ALIA 4L57A 4OFZA 2WM8A 4YH1A 1Q92A 2AUTA 3I1YA 2X4DA 1RMTA 4YCLA 4HGOA 2IOFA 2P27A 2BY4A 4Y2JA 1N9KA 4KYTA 3WK6A 1KYTA 4DCCA 5AVYA 1T9ZA 5ALOA 1RKUA 3QLEA 1K1EA 2AGVA 2OA0A 2CFTA 3B9RA 3N28A 1L6RA 3U7FB 3B9BA 2HO4A 2R8XA 2B8EA 4UATA 3ET4A 4KNWA 3L0YA 3QXGA 1Z88A 4HGNA 2B1QA 3QNMA 5AM2A 1QH9A 2WFAA 3WKDA 3HLTA 2C9MA 2B0CA 1PW5A 3SMVA 4UMFA 1AQ6A 3DAOA 3FM9A 3BWVA 3NASA 1J97A 2YBDA 2QLTA 4YGYA 5ALRA 4CF4A 5AVUA 4HGRA 5AKEA 3EF1A 5AHXA 1YJ5A 3HYCA 3ESQA 4KX5A 2W11A 1QQ7A 1ZJJA 4HYTA 1QQ6A 3QU7A 3ZU6A 4IG4A 3L7YA 4DW8A 3KC2A 2FPWA 1RC8A 2EARA 2I55A 2NYVA 1Y8AA 4Y2XA 2GFHA 3OCYA 1YV9A 3PGVA 1RQLA 1TJ5A 4F72A 1NNLA 3AR4A 4JB3A 1TJ3A 5ALQA 3L8FA 3P96A 3I28A 1Z4QA 1NF2A 3QUTA 3PGLA 3U26A 4NWIA 5AKZA 3E8MA 3E58A 5ALPA 3WK7A 1QQ5A 2HI0A 5FP0A 2IYEA 4UASA 3U7EB 3MMZA 2P9JA 1EK2A 5T41A 2JARA 2MSNA 2QYHA 5ALZA 3KOOA 2YN4A 4CNQA 2C8LA 5ALKA 3TLMA 3ZTYA 3DDHA 3ZVLA 2R8YA 3IB6A 4UMDA 4BEVA 5IT4A 2YMQA 3DV9A 3PDWA 3AR2A 4CE6A 4HAIA 4Y2YA 2G07A 1TJ4A 4PNHA 4G63A 4UMEA 4CF5A 3K1ZA 5AK3A 2G0AA 3KZXA 1RKQA 2RB5A 1L7NA 2ZOSA 3DNPA 3ONNA 4CF3A 1XP5A 2EAUA 2YJ3A 4J03A 2GMWA 4J2TA 5AK6A 4Y2SA 2G1AA 3QX7A 4Y2RA 5AW1A 5AW9A 4EELA 3U13A 2PR7A 4OHFA 4Y2VA 3ZVNA 3SF0A 3FVVA 1XVIA 4EEKA 2FPRA 2I54A 2D2VA 3AR5A 5AKLA 1L7OA 2ODAA 1ZD4A 1T5TA 2C88A 3AR7A 3QU4A 1VFPA 1CR6A 3QUQA 2AH5A 1RKVA 3ED5A 5ALWA 1WR8A 1Z4LA 3U7GA 3QUBA 5ALJA 1L8OA 4UU0A 1U02A 3W5DA 3ZI4A 3NALA 5A3QA 3F9RA 1RMYA 3WK5A 1LTQA 2BDEA 3A1DA 4OCZA 1S2OA 4YCMA 5ALTA 3ZUPA 3OCWA 2ZBGA 3M1YA 5AI4A 4EENA 5AI6A 1RLMA 3L1VA 1O03A 3QU9A 3WKAA 3MC1A 4BX0A 1CQZA 3UM9A 5ALFA 1RLOA 3L8GA 1Z4PX 3N8GA 1XPJA 5ALUA 3CNHA 1TE2A 4FFDA 3N07A 2YJ5A 4KN8A 5AVWA 2B1RA 3KBBA 5AM3A 3OCVA 2I7DA 3AR6A 3S6JA 2FEAA 2OM6A 4BBJA 3QU2A 4Y2UA 2FPXA 2R8EA 4BNDB 2BDUA 4QQFA 5AVRA 1U2TA 3NRJA 4UM5A 3OPXA 5AW6A 3W5CA 2FPSA 1ZD3A 2R8ZA 4UARA 5AI9A 4C4RA 5AW8A 1T5SA 2HX1A 2HOQA 1NRWA 4L6AA 2IOFK 3KD3A 5AW7A 2FI1A 5AM0A 2Q4RA 5ALGA 1YNSA 2HF7A 3ZVMA 2W43A 5AKIA 3D6JA 1ZOLA 3ZX5A 4YIHA 1WPGA 1WVIA 2WF8A 3ZTWA 3IJ5A 1ZRNA 5IT0A 4BYGA 4FE3A 3AR9A 5AM1A 3ZW7A 4AS3A 1SWWA 3SKXA 3N1UA 3L1UA 3WGUA 3ZWDA 2WF9A 3OCUA 3A3YA 5ALYA 3WKEA 2CN1A 4UW9A 3FZQA 1O08A 4E88A 5AVQA 4NAVA 4H1WA 3ET5A 1RQNA 1L7PA 5ALSA 3U19A 4FYPA 3N5KA 4YCNA 2I6XA 2JAOA 1Z5UA 2G09A 5AW0A 2P11A 2WF5A 3W5AA 4C4SA 5AIAA 2I33A 2HDOA 2HSZA 5ALEA 2C8KA 5ALXA 5AI8A 3MN1A 2JGAA 4G9BA 4BEWA 3E84A 2FPUA 2RAVA 4Y2PA 5AK4A 1VJ5A 3WKCA 3QUCA 4UM7A 2YFYA 2WHEA 3U7HB 4BKMA 1N8NA 2YJ4A 5AI0A 3EPRA 2WF6A 3E81A 5AVSA 2IA5A 4GXTA 1WZCA 5AKHA 5AKYA 4RETA 4EX7A 5IS2A 3KDPA 4YIKA 5AM4A 3UMBA 3WGVA 3SD7A 1S8OA 2GO7A 5ALVA 3WK8A 2C4NA 1QYIA 3L8EA 3BA6A 2NO4A 2VKQA 2ZXEA 1YMQA 5AM5A 3L0BA 4B6JA 3PCTA 2ZBDA 3R9KA 1MH9A 5AIBA 2G08A 2AMYA 4UAUA 2OYCA 3SHQA 4NFLA 2DQSA 4L6CA 2ZBFA 3FGOA 2HF2A 5ALHA 4ZEWA 5ALNA 2W4MA 3A1EA 4XOUA 2G06A 3B8EA 4AP9A 5AW5A 2GHQA 2WF7A 3AR3A 3NIWA 4BX3A 4NABA 4MWOA 3WK9A 4XE5A 5AICA 3R09A 2HEGA 3ZX4A 5AVZA 4UMVA 2IOHA 4KNVA 1FEZA 4NV0A 3ESRA 3VAYA 5AI5A 2B30A 1X42A 3I6BA 2FUCA 4O8CA 3I76A 1RDFA 2G80A 1Q91A 1YS9A 1Z4IA 3M9LA 3WKBA 3GYGA 2JAWA 4JDPA 1Z4OA 2B82A 5ALDA 1EK1A 3J7TA 3OCXA 3EWIA 4XPZA 5AW3A 1RMQA 5E0OA 5JJBA
chains in the Genus database with same CATH superfamily
1LY1A 2HRZA 2P9QA 3PEVA 5DYGA 4CLXA 1O5IA 1YZYA 1SY7A 1C8VB 1SCUB 1BJKA 3U40A 2A9KA 4BMSA 4WSOA 2VK4A 2O6HA 4IEEA 2NLOA 1DEXA 4DMUB 3WL4A 1EAYA 1VXOA 1SKWA 2XVTA 4G37A 4I81A 3VPAA 5TV2A 4II2A 1DI0A 2W2XA 1L4BA 5A7GA 3IP4B 1EK0A 4FS3A 3CNEA 4R0MA 1BZYA 4M9ZA 3RG8A 1E7RA 3WQSB 2WHRA 1PVDA 3JWEA 1KIMA 3OLVA 2OV2A 2ERYA 5IRCD 5HW0A 4G8CA 2QUBA 1DWOA 4H0CA 2JCYA 4MZDA 5B5EU 4LIPD 3B7GA 1U0FA 5J8YA 1D3AA 2P4QA 1G66A 4B81A 3OM9A 1T0PA 4CM8A 3LKDA 4GZMA 4QYIA 1J6UA 2Q6OA 1YTUA 2K4IA 3NASA 2GRJA 3BKXA 4N54A 3L6UA 3AESB 3E3OA 1RCFA 2EZXA 1N62A 4PCVA 5EXDA 4IL6U 5JTIA 3NBAA 1ANKA 2QRPA 1ZQKA 3U26A 2EF1A 3G1TA 1H1TA 3DBLB 4JCOA 3TOSA 4TTTS 3P9ZA 2HDHA 1Q5PA 3ZXIA 5H68A 1NJ6A 4JLKA 5A6SB 1E5QA 1HV8A 4HUQB 1R6BX 4OUDA 2ZIZA 2Q07A 1SV4A 2WAQF 3ZKWB 3PNCA 1QKIA 3FLMA 3A4NA 3EA0A 2QD2A 4UB3A 1ESDA 4R2XA 4DV3B 1SUEA 2CB0A 3QMVA 2O1WA 1KLNA 3O8OB 4B3HA 1Z5VA 3UPUA 5SICE 3VHXB 4YI5A 5ERGB 3RS4A 4QDOA 4OP2A 1Z2DA 2EIHA 4PZPA 4Q47A 3NALA 4FIZA 4RJIA 2BEWB 1QZTA 4FGUA 1CB7A 1G6Q1 2J6BA 4R6XA 5IXSA 4DVGA 4JMLA 1VIDA 1RWBA 2DQNB 2OMKA 1U3WA 2OAGA 1BFKA 3GELA 4IAOA 3F74A 2VL7A 3JQ7A 621PA 1IPFA 1EI9A 1KZYC 4YG2A 1U4SA 1CBUA 2ZRCA 3JARA 1BSVA 1A2KC 2F1RA 3F6RA 1E8MA 5JH7A 3S44A 5AW6A 4W9NA 3JW8A 2H1SA 1ID1A 2LUOA 3JXEA 5K3OA 1XO0A 4YFKA 1J0CA 4ROTA 1JWLA 3CT4A 1W46A 2FQYA 3A9SA 4R65A 4S1PA 3CVUA 3RLIA 4PJ0U 5K0FA 3HB5X 3KTAB 5FUWA 4LS3A 4CM3A 2WQZA 4QVKA 4K1LA 4YCNA 4MW0A 4YR9A 4MPJA 2Z09A 3VTZA 3STVA 1TPZA 3MTEA 3IUSA 2GTIA 3ZE7A 1E0SA 1GYPA 4M2LA 1WO8A 3JZFA 3FW1A 3ZLTA 2NMVA 4CKXA 3F6EX 1ABEA 2C9OA 1BXKA 5HF6A 4A8JB 1U2RA 2IRWA 4B3BA 1QTMA 5DEOA 2VK2A 2OGTA 4QU9A 1M33A 3SY8A 4IZOA 2BYTA 4EATA 4TROA 1CEQA 1JR6A 1QVWA 5ALHA 3A1EA 2X5XA 3I23A 3PWTA 4HY3A 1NIPA 4AYBF 3I45A 3JALA 5KQSA 2P2DA 1DQSA 2CZCA 4EFKA 2FMSA 1K4KA 4HNGA 2Y0BA 5TQJA 1HRDA 2P4SA 2WR8A 3EYWA 1GQOA 3K09A 5F4ZA 5FQNA 5ER9A 3MJTA 3CM0A 2QG4A 4FE4A 1FUKA 3ORHA 1NQTA 4J29A 4Q7LA 1A6SA 4GMGA 4DAOA 1G7TA 1FDRA 4QXOA 1JHAA 2FUEA 3G82C 2Q7OE 4K28A 4B1FA 3VO9A 2XE7A 5IAGA 1WCXA 4M76B 3ZQJA 2P69A 4HEA1 1E96A 4QA9A 2K8BB 3DUFA 1K6XA 5BXYA 3AOGA 5YASA 2J3EA 4JMPA 3SCZA 2UYGA 1ZQQA 4RE5A 5LQCA 3CPJB 1E5TA 1ZKDA 1N8SA 3RH5A 3JVUA 1Y6ZA 4P83A 1W85A 1A04A 1EA7A 2HTFA 5G0VA 5I48A 4PXSA 4HFJA 3UMGA 2AHRA 2EERA 1ZONA 1C9DB 1C1YA 1A4UA 4UTZA 3V4VB 2W9CB 1PT8A 4ER7A 4LZLA 3EC1A 3MMXA 1NJSA 2ZTEA 4P31A 4YH1A 5CB6A 1ZN9A 3FJYA 4FOLA 1JRLA 3LO8A 4RZ2A 3H2ZA 2O20A 4LV8B 2ZREA 2TS1A 4BFTA 1D2EA 3VVCA 1CE8A 1JBKA 4PYIA 1U80A 3VR4A 5HX7A 3DVRX 1KXJA 8ICXA 5HUQA 1JWAB 2ZW9A 2FWNA 3GPBA 3TRIA 3WHPA 2HWXA 1WUTA 1N6IA 4UB1A 1CQJA 1CNMA 9ICVA 3ROGA 2PD4A 4U63A 4Z3DA 3CXUA 2W37A 1P4JA 1I5OA 3L8ZA 4JB2A 3L7LA 2DFKB 2IYUA 3IVXA 4AX8A 1Y5LA 4BB6A 4REOA 2CV2A 2G6BA 8ATCA 4TQRA 2PM8A 5KYWB 1S2DA 2QENA 4FLEA 1D07A 1YOVA 2Q6IA 3AUFA 3C3BA 1QX3A 1MZPA 5FBQB 3C14C 5CU7A 4JJFA 3AR2A 4DA9A 8ICOA 4JASB 5FWAA 2F1IA 1FX0B 4C7XA 8ICTA 3V4RA 1JHDA 2EAUA 3PFWO 1IZ8A 3BMCB 4U6SA 1RWMA 5I4KA 2FJ0A 3B6JA 3BDVA 4L72A 2HA5A 3KZNA 3OZ7A 2O19A 4BVHA 4EBEA 5J2TB 1FP1D 2LBOA 4U39A 4U6NA 3LDGA 3RAGA 4ALMA 4CZ2A 2ODQA 1KEWA 5CDUA 1Z8FA 3RS7A 2ZR8A 3RW9A 5KFHA 2CC2A 1JLKA 1P5RA 5DPMA 3F2DA 7ICKA 3VR2D 4OCZA 3UV6A 2CNWD 2R2GA 2WJPA 4CT0A 3IKJA 4CIYA 1H4VB 4CEHA 3FMPB 3LIIA 3KXKA 4TYMA 3W8NA 2GNPA 3SQDA 3SVLA 3LUDA 3N07A 3RJIA 1NW9B 4JENA 4DUZB 2IH5A 4JLVA 2QDXA 4J9PA 4YV1A 2EAOA 2V6FA 2DCMA 3WQBA 1X70A 1N4DA 2GN2A 4CLEA 1RPJA 2C9BA 3NHUA 5COAA 3Q72A 4KP7A 1P18A 3LVQE 3GNTA 1Z5OA 5C3MA 2ESRA 4HL6A 3T15A 5CYPA 1SG9A 1BXRA 3N1UA 2RGXA 5KNDH 5D01A 3FSEA 2QTFA 1Z3CA 4FE7A 4X90A 4E13A 2HDOA 1QAOA 2EKDA 4MWBA 5C31A 1LX7A 1SGGA 4TMXA 1UOEA 3K70B 1PKEA 1DIGA 5L53A 3BD6A 3K6SA 3EEFA 3KTQA 4DYDA 3P2MA 5CVVA 3Q40A 4JLAA 2WA2A 3SK0A 3DDNA 3VTAA 4EI2A 1F5NA 5AJZA 2YYAA 4C43A 5IT9A 2O05A 2HYDA 1DBPA 3TKLA 4D74A 1RRGA 2YICA 4IDDA 1ZH4A 3MWFA 3Q0IA 1CUYA 2XGPA 3NRBA 1EEHA 1XEAA 2XMCA 5KFQA 4BJ1A 2CHVA 3PUIA 4MWOA 4HYYA 2QMQA 4MV7A 4UNQA 3VKWA 2NUAB 2ZROA 3AU9A 5KFNA 2XYRA 1GGHA 1YS9A 5DWDA 1EK1A 3IJEB 1CHNA 1P0QA 4GPEA 2H31A 1YFJA 1MXFA 1UMDA 2OKCA 4HSEA 4WTOA 1P80A 3N6XA 3QU5A 3T1VA 2OBBA 4TLCA 2ZWVA 1NOIA 1MJNA 4CODB 1DKUA 4IO0A 5K4AA 3JSAA 1MXHA 4BE4A 3N6VA 4PPFA 3ELBA 3UMCA 5IULC 1Q0RA 2IHZA 5B30A 3WWYA 1EFVB 3RTEA 5H16A 4O5EA 4ZDIA 1W94A 1Y42X 4Y9DA 3EF0A 2D2FA 4RNOA 2DB3A 4AMZA 1GGMA 2J9FB 3C3PA 3UPQA 1COWD 2LMRA 2O0LA 1FYFA 4L73A 2RKOA 2F2AB 3BN3A 4M9GA 2R6DA 3W2TA 1U8CB 4L76A 1H9BA 3IXQA 2FPIB 2IXEA 3BJMA 4HH1A 3M33A 3DR3A 4MW9A 4C7JA 5H2FU 3A1TA 4UOEA 3PA6A 2Y1FA 4KREA 5EIFA 3DAOA 1D1PA 1Y4AE 4FZMA 4KLOA 1INLA 3GP8A 3PUYA 4HB3A 4WE3A 2F9FA 1X7DA 4AKIA 4X1KB 5LSAA 1ZJJA 1TI7A 1XNQB 3Q8WA 3R24A 4GWLA 2I55A 3NVMB 4X6UA 5DDIP 4XIYA 3BDAA 2IV2X 1TJ5A 1KYXA 3SV4A 3O8DA 3RAPR 2K6GA 2XBLA 1YL5A 4U8GA 2A1UA 3O47A 3E58A 1M75A 4WUTA 2CUTA 2GKGA 1V7QA 2FJUA 1I6MA 1Q12A 3N2LA 3QXSA 1TLFA 4L78A 3EDQA 5B4TA 3ASVA 3E22B 3BXXA 1FP4B 1S77D 4JUAA 5DM4A 1C0IA 1R16A 5C35A 2BM8A 4ARAA 4X91A 1H3EA 2JBWA 4ND6A 1XUOA 2JLRA 1NBIA 1MQ9A 1LQ2A 2ZIWB 2QJTA 5IJAA 2QUZA 2IGTA 3BS7A 2RHDA 1PLLA 1D9FA 1GUBA 2UYHA 4RQ0A 4ELTA 1ZM9A 2FFRA 5IILA 3BS5A 2Z5VA 3LT5A 1ELOA 3QHQA 2OZPA 5JQGB 2O07A 3D3WA 2VHZA 1PI3A 2IYVA 1EK6A 2PBLA 4LDRA 4BFZA 2F55A 2GXSA 4P54A 2QB0A 9ABPA 1C5KA 1PWHA 1KN5A 4WCDA 3EHDA 1KMCA 2UVPA 1AUQA 2DPLA 2G1JA 5A5EA 3W9BA 4FYYA 1J2EA 4ACOA 3AGPA 3GPIA 2GA9A 3KKEA 4PLVA 2X19A 1ED1A 1U2TA 3UPTA 4EEYA 1JXMA 2I8CA 3GDOA 3GLVA 4OEHA 4PRLA 4TZTA 1LQTA 2W6IA 1D7AA 3TZHA 3X1YA 4R1TA 4HQRA 4FHDA 1XMJA 5FUQA 1ZRNA 3OKPA 1EB9A 1Y7TA 3FWZA 4PHGA 4R69A 5T4BA 4G5XA 1PEDA 5EUBA 3F4BA 1AGYA 3NWOA 2G09A 4M89A 4UCFA 2ETXA 5ER6A 1MIHA 3PEWA 2FMIA 4RY9A 3RUCA 2JGRA 4FFOA 4G9BA 1WOYA 2BW0A 2NZXA 3O95A 4MLZA 4GZLA 1OBFO 1DXHA 2Z2JA 2G76A 2D8MA 4GXTA 1DGQA 5AKHA 4FEAA 1YJ8A 2K7ZA 4M9XA 1THTA 4S0XA 2OTCA 1N0VC 3GGSA 1F6DA 4X8HA 4EUSA 5BRAA 1XU9A 3WDKA 2H1VA 1NGSA 2CFOA 4J1TC 3Q98A 1LPPA 4Q00A 3PX7A 5KNIA 2Y1DA 1RYNA 2ILTA 4Z53A 4FDLA 4X24A 3DT9A 2YN0A 2CEAA 3EVCA 4NABA 4YX9A 2ZB3A 4O3SA 4GVXA 4INOA 4KHPB 1HE5A 5JS7A 1ONNA 1S5PA 1PWZA 2BFWA 1NBME 3FLAA 1R37A 4BL5A 2VT2A 4HZUB 3IDZA 2GEVA 1DG9A 4A8TA 2CJWA 3L7JA 1XVAA 2I62A 3E05A 1GAQA 4XB6B 3ZXSA 1TM3E 2B92A 1OXJA 4AZWA 5A9RA 1EFTA 2FW7A 2V5UA 4AROA 4LRYA 2VP3A 1NDUA 1JIUA 3FPHA 3ZCQA 2H4XA 3AM9A 4JSTA 3H4BA 1O6FA 4I1UA 5BN4B 1XZDA 4QXAA 2EJTA 3TMKA 4LJ6A 4KTTE 3A1WA 1SN7A 1I51A 1PS0A 5G1OA 1ND6A 2AFIE 4NRDA 4TYWA 4QHSA 1KVTA 2YWRA 1KHHA 4F3KA 4I2EA 1DQNA 2FFBA 4YJ3B 1U2SA 2BR4A 5CHEA 2FX3A 4FSDA 2NU9A 4M0EA 1OBOA 4BC0A 4CMAA 2I03A 4XGIA 2ZIVA 2EKLA 1QWSA 1T4BA 1N9KA 5JALA 3H9BA 3PIDA 4O4JB 5IKPA 3QBJA 1Z88A 4MWZA 1AK9A 1H2YA 2ISCA 4G5GA 4ECAA 1H8HA 2CNDA 4M0MA 1NWHA 1TK0A 5DF1A 4H35A 4BGDA 4D5GA 4CF4A 1HUOA 5ABPA 2I6FA 3IH5A 1SBNE 1SMKA 3WWDA 4RAOA 3TQQA 1DRVA 4BE7B 1EDDA 4TT8A 2VYND 1R88A 5LBTA 3F7OA 2QZSA 4PV7A 3VR6A 4E6PA 1YJXA 4DS3A 4LSZA 3EWSA 4MAMA 2OZVA 4JROA 4UMDA 4YAGA 3O5AA 3ETRA 1T5OA 1UDWA 3STTA 3OPVA 4CF3A 3NS1A 4HMPA 2IUYA 3ONVA 4IUDS 2PRSA 2H92A 2F17A 3UUEA 1TCCA 3A6HA 1BMFA 1RM4A 3A0UA 3ID6C 2R3SA 1ZD4A 5FJJA 3GHHA 2HV9A 5ICGA 2FSVC 1MA0A 5D6NA 4C5CA 1QSSA 1IOLA 3ZI4A 1VLLA 4XVQA 1Z0KA 3LUAA 2GEJA 4RLHA 2R1UA 2FMKA 4FZNA 1CUJA 1GY8A 4M36A 3K0FB 2R1VB 5DB9A 1QYDA 6AT1A 2CCKA 2FQXA 1SOMA 2ATEA 4YPOA 5AVWA 2AC7A 4XQ9A 4DUGD 4GKVA 3DEIA 1S76D 1BWRA 3EAGA 4RMGA 1JEQB 4Z1OA 1I3NA 2MINA 2C9ZA 4KQCA 3LPAA 2JANA 1H2BA 4DJAA 3R5TA 3VV3A 4URYR 4DNPA 3PHLA 4MRAA 2FUKA 4QO8A 4AY3A 3B0YA 4GRIA 3HU5A 2ZCVA 4JBYA 1S6YA 4R16A 5H59A 4E88A 1R4ZA 4D9FA 1NZBA 2HWYA 1VLQA 4GC5A 2JK0A 3BZCA 4YR7A 4BUZA 5KSYA 3MS4A 1DELA 1CERA 3SHWA 5TGDA 3PR2B 1N2JA 1ZCJA 4C9BA 3AESA 3I8SA 1UQUA 4MVJH 1U7UA 4QW9A 2E4UA 2AQ0A 1WUYA 4J4HA 4M8LA 2BZFA 2NV2B 4ZQHA 1NA5A 2AX3A 3NLLA 3ZQ6A 4LW8A 1CYDA 1FDTA 7ICPA 1MT3A 1WPQA 1X0XA 2ZXEA 3E70C 3GYBA 3W5HA 1QO7A 3SJ7A 1FXSA 2Z1DA 3O38A 3ISVA 5AIBA 2HJGA 4DMGA 1OROA 9ICQA 3JQ9C 1BPDA 3H2IA 3PDCA 4BNFA 3DQPA 1NUTA 1E2IA 4I5GA 3FMVA 3ALRA 4Y0VA 4XOUA 3FUUA 3OJWA 3ZKWA 2GZSA 4PGHA 2DKOA 1SO8A 4HKTA 4QQNA 3UWMA 1T91A 3O8OA 5CA0B 2Q0XA 2D1YA 1VYHA 3ZNOA 3VHXA 5B55A 4CQJA 5CA1B 5C4GB 1WTCA 3V8QA 4O4HF 4CTKA 4EJSA 5J0RA 3AW8A 1JHXA 1PK7A 1M5RA 3IEMA 1WY5A 1SVWA 1WXFA 1GRNA 4DMFA 3RF9A 3NTXA 4GOLD 1D9ZA 1YHNA 1IXKA 1AKEA 3M89A 2ZB2A 2VJPA 1DAFA 3D6NB 1DKQA 3DC7A 2WOJA 3U6BA 4F46A 5J2UB 1VA4A 3DDOA 1Z18A 3F8SA 5L6MB 3HU3A 4F9FA 1VE5A 2G36A 4RPCA 1X9XA 1CFZA 1UA1A 2FHPA 2X76A 5HF5A 1ZOOA 3EARA 3L0DA 3JAMA 2ZDHA 5KWSA 2AFRA 4DSTA 5SYNA 1OGJA 1E5VA 2Q5QA 1PJ3A 2RKWA 4OSOA 9ATCA 2IVFA 4JJEA 3VXKA 3KTAA 3L0YA 4BQPA 5BVHB 2J9RA 4QZ9A 2CXSA 2JFZA 3KEQA 1EUZA 4BIIA 5J2CA 1WB4A 3PQ8A 2XICA 2PX0A 4ENQA 5MFZA 4BMCA 1R4MA 5TY0A 1GPAA 4P3XA 2QMYA 3VFDA 3IPXA 1K6EA 3LX8A 3JAKB 1NF2A 5D46A 1RM5A 2M1XA 2V0NA 2Z3VA 2DUWA 4JZYA 4E5NA 3WMGA 3CF2A 5BNFA 1X6JA 2FK8A 3LXUX 4DV5B 2JJ2D 2GETA 1XDZA 2Q9CA 2JFXA 3GIJA 1C9JA 4C05A 1FPQA 4LCJA 4Z6KA 4KQWA 4KLNA 4YEDA 1KQNA 3SHOA 1XCBA 5C1IA 5KFEA 2WKPA 3QMMA 1U0LA 2JA2A 1R0ZA 2LKCA 2NO9A 5B5SA 1G3MA 3IXLA 4KXWA 3FN4A 4Y6PA 3PRJA 1UDCA 5LXTB 4UU0A 2PH5A 2ADFA 4LXHA 3E0QA 1RMYA 5GV8A 4PHCA 2XEDA 4PAMA 8ICKA 4O59O 3M3DA 4F4DA 1F2UA 1PNOA 1V5FA 2VHQA 4AUEA 2HSEA 2W90A 3K9BA 2V3CC 4C06A 4A0SA 2WNIA 1TE2A 4WFIA 3FDFA 4MXDA 4JMUA 2B20A 2O2CA 4HC4A 4DM7A 4JJGA 2C83A 3TJRA 1U0EA 4LJRA 3AP3A 1HQDA 1CJSA 2FPSA 4F9EA 1MO5A 3CTPA 5DM0A 4L6AA 3OCJA 4EYOA 1F9AA 1GKYA 1ZQTA 2PLAA 3U44B 3SF8B 2WKQA 4OGGA 4TLLB 1TMYA 1AQUA 2HWUA 3ABRB 3HB7A 1U6JA 2BRUA 1PR5A 5ADWA 2DR3A 3PXGA 1SBZA 3W0LB 4IF4A 1ETHA 3SAFA 3CKMA 2ZSKA 1NU8A 4JVOA 4YP5A 3CCFA 5ALXA 3WBFA 3KT0A 2N1BA 3LY8A 2GX6A 4QFBA 1ACLA 2GWHA 3LC2O 3EZ9A 3A58B 1VJ5A 2ZJFA 3RCBA 4B9MA 1JKMA 1P9RA 1JMSA 2JF0A 5HFJA 3EUEA 2IY9A 1WW2A 4LGMA 4KQ9A 1OW5A 1QG0A 1E1YA 4XM0A 4KN5A 1KY4A 3RTAA 4GI3A 1XZAA 1S2GA 4C6SA 3ODGA 3AFMA 4RHXA 2ZAOA 4A1OA 2QM0A 2G5IB 2E5FA 4NPCA 4OXYA 1AURA 2H0AA 3JWHA 3QA3E 1QH8B 1J9ZA 2GYYA 3HYRA 9ICHA 3DFFA 3AWIA 1YQTA 3IG5A 4LQ4A 4E2FA 4IFBA 4TOIA 4XH9B 4I4IA 2A7XA 3BMCA 2PT7A 5TMDA 2HEGA 4EEZA 2BN4A 3RARA 1HDEA 4NDNE 2IOHA 5JEDA 1OAOA 3VNRA 1AKWA 3WZMA 2CHGA 1XMXA 2D3WA 4BMYA 5EJ4A 1FQOA 5FXMA 4NAUA 2O8FA 4MVJE 2X9VA 2X0RA 4BX2A 3GAAA 4OX9B 3JPWA 3BCSA 3MCUA 4YRFA 2G67A 1WHTB 4EYKA 2Q4TA 1SFRA 3JS5A 1H2HA 3VR2A 1IWOA 1OFIA 3HPRA 3OQPA 3K4PA 2R4UA 4ALJA 4NICA 3I9V1 9ICUA 2RH4A 4QZEA 1R6DA 1Z0ZA 3HRDD 2JIPA 1SH7A 1SZHA 2ZAYA 3U80A 4ZYYA 4WZZA 4RCZA 4F1KA 4Q82A 4GLOA 4CNBA 4RGBA 1QP0A 4ER5A 4KPEC 2B8TA 3GCGA 4RGVA 3RT7A 2YMMA 1TF7A 1XPOA 4PU0A 1F0NA 3SR4A 2ASLA 3KJFA 2X58A 3N0RA 1KK1A 2IMWP 2P79A 3KO8A 5JSHA 3IEKA 1BS9A 3MUNA 4RFSB 2BBOA 1MN6A 3ZWCA 3GZNB 5EZYA 1ZC4A 5E8JA 5DB7A 1ADFA 1U8ZA 1WSDA 4MRPA 3TG8A 4D25A 2FPWA 4AIIA 2VBFA 3SXPA 4EKEA 1L1EA 1PNQA 3GFOA 1O8BA 2OGUA 4ZEOA 4Z4IA 1QTRA 5J5VA 1M7BA 2F00A 3M9NB 1PNRA 1JHRA 2E3TA 3LWMA 4NC9A 3SC6A 3A36A 2A0UA 3WA6A 1V48A 3QE0A 3UO8B 2YZNA 5K8IA 4NCBA 4FBTA 2ZZKA 1EBFA 4K9RA 2OH2A 4XWWA 3SWWA 3PW5A 4E7PA 4YALA 4S35A 4R1UA 4MF8A 1IC6A 4BDSA 1T5TA 3QU4A 2R6AA 5LKRA 2J8ZA 1TKRA 3RADC 5JZVA 3GLTA 1SL1A 2RBGA 3Q8KA 1JMYA 4ZCSA 1H2ZA 4ALKA 4OI4A 3T7IA 3CR8A 2AK2A 2HSJA 3T94A 3H4VA 5B2FA 4ARSA 4QU5A 4HQ6A 3PW2A 4N5MA 4DLTA 1VHJA 2QF7A 3JRNA 1KK0A 4IICA 3SEAA 3BCHA 4FMCF 2DRIA 4C7BA 4NK4A 3K31A 4H18A 4YRQA 2O2EA 4DQVA 4LI0A 1DJMA 3T5GA 3PFNA 3ZWWA 4O0MA 2HBKA 4XYLA 4AY6A 13PKA 1MZVA 2E8PA 3ZHYA 4KYIB 5J2BA 3CLUC 4LOHA 4PG7A 3MA0A 3ZU3A 1WPGA 1FXWF 4ECUA 1D2HA 1COWA 2CE2X 5KTSA 4G5QA 2QUAA 4WUVA 2FPIA 4BUJA 1SWWA 4Q4DA 1W1UA 5GTIU 4Y7DA 4UBIA 4FFBA 4X94A 3V32A 2XUHA 3ZGNA 1Z5UA 5AW0A 3LNTA 3QIVA 4DF4A 4CG3A 4MR8A 1TLTA 3P2JA 4BNHA 1NXSA 5JRJA 4OQNA 4WAUA 3BWYA 3MINA 4X1KA 1K5DA 2B8NA 4W8OA 4EAQA 1C41A 3FWNA 2OP1A 3FPEA 3DR5A 2XF8A 5DO9A 3QWAA 1FB5A 4DM3A 2R8IA 3VKFA 3NT5A 4R3UC 3MGAA 4Q21A 2WLTA 2F59A 3WRYA 5CGZA 2A14A 2NO7A 4YRIA 5LU9A 5ALVA 3BA6A 3FOCA 4LVSA 1M6YA 2AWOA 4TN5A 5DH9A 3DL2A 4PPGA 1QFSA 3DYIA 1ULBA 1FP4A 2AB0A 4YO7A 3NIWA 2XJ4A 2F9LA 4HRYA 3OI7A 1WB6A 1NPDA 1JHUA 1LWNA 3GFVA 1BDMA 2J9GA 2WYUA 1X42A 4GUAA 1M54A 5DQGA 5L4SA 4OQQA 3KOUA 1KFKB 3OKAA 2AT1A 3I0ZA 2RHCA 4PLWA 3GLQA 3ZBTA 2GLEA 3SEIA 2BHNA 1Y8CA 1KO5A 4QOSA 5IKOA 5P21A 1KDZA 1L7RA 2ZSIA 4RESA 3BFKA 2ZDQA 3ABZA 2NU8B 4MYCA 3O1IC 5HJ7A 3BMQB 1P6QA 1XDGA 4ADSG 5TT1A 1H05A 4CN9A 1M8FA 2N9UA 3HGQA 5HIJA 1Z0AA 3WNCA 2Y4OA 4RNCA 2LIPA 4FXPA 2DPJA 3QEKA 1T6XA 4C21A 4UAVA 4EHNA 1P5HA 2JGFA 2BVNA 1HRKA 1Z8DA 1J7JA 4FUQA 4EYIB 5FBWB 4MARA 3KQUA 3LHFA 5B37A 2GWSA 4P93A 1O4VA 3ZE8A 3CEMA 1M34E 4OJQA 2D8CA 4O3OA 2EYUA 2IEAA 3WHLA 3G8CA 5ALOA 3BJZA 3ZJVA 5EJFA 4EJ6A 1TM2A 1PQYA 2GM3A 1D6JA 2V6GA 4PQGA 3D4NA 2ZYSA 3U6KA 5L7YA 3UH0A 1F20A 3U0BA 2V59A 2IBSA 5K0JA 5MN4A 3IHKA 4DV2B 1ECPA 3AC0A 2J0EA 2WUEA 3UENA 1J2UA 2QJFA 1JS1X 3IALA 1XCGB 2MA1A 2LM1A 2X0IA 1U8EA 2GEBA 5K3FB 1Q0TA 1XA0A 1CVIA 1Z2AA 1SKUA 3LRXA 1CRQA 1C9KA 2XMZA 1GL7A 4OHKA 3AY7A 3GLGB 2E37A 1P1KA 1DEOA 2VSYA 4ZU6X 2IZOA 2AN5A 4Y1RA 2BF7A 1HBJA 3CX4A 3H5IA 3L4SO 2KSQA 5C18A 3HMQA 4ZMBA 5J0QA 4LJ5A 4EEKA 2IV3A 1YS2X 1XD8A 4HZUA 3VDXA 3C7TA 2IBKA 4JBGA 3S28A 5EUCA 5IFKA 5KFXA 3QVOA 1MB0A 2JHCA 4CG0A 3V3KA 4MB0A 3C8DA 4ECRA 4EARA 2VO1A 2FN4A 3FG9A 3BILA 2IKQA 1EJBA 3R4VA 5HF9A 3MK31 3IKTA 3ABIA 2KJ5A 2R85A 3BXPA 4NCIA 4BTLA 3QUAA 1LB2B 4OLAA 5BN4A 1DVRA 3HV0A 1AUOA 4LQLA 1W581 3CLTD 1O58A 1PJTA 3LYSA 1ADCA 2VR1A 2R6FA 5I7HA 1VQ1A 2AGQA 3IKMB 3SYLA 1G5HA 3KKOA 1JIIA 4KR0A 1WSWA 1G38A 2VPIA 3DZKA 1FUIA 2OBFA 2NXCA 4I6JA 3I9FA 1Z17A 5K01A 4ETWA 1RWWA 2WIKA 3H87A 1RYMA 3ENZA 2PWZA 3D6TB 3FLBA 3GEPA 1DG3A 4E22A 3C5EA 4OXIA 3UAYA 4DXDA 5FTWA 1F2TA 3HYTA 3H1FA 1EP1B 3P4UA 4PZYA 4X66B 4G1CA 2BEVB 4DL6A 2VSFA 1DO8A 3C8UA 1N2OA 5HGJA 5DYWA 4JI3B 4D6XA 5EJGA 2RBEA 4Q3BA 3KT6A 5A9TA 1YQGA 5DT2A 4QZAA 4MQ5A 1GNTA 5HUHA 1ML3A 3MWGA 4DWJA 2GASA 3PV8A 5BRJA 2CXTA 4J9KA 5CBKA 2VYNA 3BQ2A 1Y8QA 4JBIA 4LK3A 4CM6A 3FJ1A 1KFBB 2GS9A 4H7KA 4I1IA 2GN8A 1EUCA 5PNTA 2X1VA 4G86A 3I01M 5TGZA 2CLFB 1VSBA 3OE7D 5KAPA 5E38A 1WD7A 3G2QA 1O87A 5JZOA 1LX6A 1UFOA 3HYSA 1VLHA 3NEAA 5H3LA 1NX9A 3R77A 5CPFA 4L5AA 2IW1A 3GJ4A 5IDXA 4PZEA 5FOVA 5FTKA 3ACDA 4F3OA 1FFSA 4YA6A 1KTQA 4OQFA 2JFVA 4MUMA 3VGJA 1T9KA 5M5BA 4ARVA 3S2YA 3FRIA 4NQRA 3H04A 4FEGA 5ES4B 2ZBEA 3BQ0A 1GG2A 2R1VA 3JD1A 1EFRD 2CLLB 2QVGA 4WT7A 3ZLUA 3CZQA 2ZVPX 4KQMA 1OWMA 2FPPB 1MRZA 3AY0A 3EBLA 3SKVA 5T6BA 3IO3A 2NVBA 4PX3A 1S2NA 2XUAA 4U2FA 2NT4A 5AKGA 1JQ5A 3BTVA 4CL3A 1JEQA 3ED1A 2DWQA 3HJFA 1C7QA 4HNQA 4AG3A 3Q0EA 3FLEA 1JZTA 2R84A 3T3HA 3EA5A 4YMNA 3M0EA 1T8SA 3TNLA 3MWYW 3VYSB 2X4DA 1RMTA 5KFGA 2XZDA 1BVSA 5I7RA 1BNPA 5KFBA 3DXZA 2WABA 5F7OA 1DTSA 1KNQA 3C74A 3QXGA 2C4KA 5FPKA 2FSUA 2WQ6A 3ZXXA 1EFHA 2CPRA 1NYQA 5JDIA 2ZTSA 3GN2A 5EIEA 3VRHA 3QU7A 1NW3A 2VP4A 4GGOA 4NS4A 3TOCA 1NNLA 3CW2C 4WPGA 1CQXA 3HBFA 1L7DA 2A3RA 3NEPX 4LK2A 1N5MA 4AF6A 2JEGA 1LFDB 3GGJA 1BN7A 1E1LA 3AONB 5LQRA 4DSFA 2NADA 1GQ2A 4CKZA 5KTYA 4KBFA 3LF1A 2EJBA 3KVNA 3QK7A 2GCOA 3KYDA 1IPEA 2AUMA 1OZGA 4C2UA 1X87A 5BN1A 4Z86A 1G6KA 3QBDA 2HU2A 1WWVA 3IG8A 1VJCA 3WIVA 2O6LA 1B6GA 1LTKA 1K4MA 4IGAA 4I9HA 5ITSA 2EH9A 2FUG6 1XCPA 2G77B 5CA1A 5DV9A 4IS7A 4JC8A 1AE1A 5JO0A 4MB2A 3O03A 3IPRA 1RP1A 3TTUA 5LPNA 3LWBA 2FETA 1JIQA 1LBHA 4ZYXA 1A9ZA 3DXXA 4FMDF 1OZ0A 2YTUA 1U47A 4TXJA 3RYIB 4B9TA 1ZUD1 4CETA 2X9NA 1NUSA 1AB6A 3WJ1A 4F3TA 1E0JA 1OXVA 2JEZA 1ESMA 5FF9A 3KLPX 4D9KA 4H08A 1RHMA 5CAEB 4GVPA 1L5KA 3O4IA 1OF1A 1AX9A 4X7MA 5E9JA 4I2DA 3OQMA 3G5TA 1HKHA 1N2GA 4HLNA 4I6EA 421PA 2JNWA 2IYPA 5AJYA 2P9FA 3PXXA 3N0XA 1RHJA 3T3EA 4MS3B 4UQOA 4JVLA 1H2EA 2H0QA 3UMJA 4CM9D 2ZSEA 1O2DA 1O6ZA 2W93A 4DEYA 1KDHA 1JLSA 1BPEA 4FTWA 2R79A 5FPYA 1LZLA 1UXHA 1P2FA 4RQNA 5KCMA 5KQRA 5BR1A 1ABFA 2WQ7A 2IYAA 2F6RA 4LZOA 3WKCA 5TDHA 5EIBC 3B6EA 5KTRA 1S96A 3EPRA 1FFUA 4W1QA 4A5OA 3GV5B 5KFVA 4NJEB 3JAKA 3UMBA 2QVZX 4US9A 2XB8A 3ZHXA 3F5DA 4M1OA 3R9KA 1G5TA 2R5FA 1E2PA 4QTYA 1XSEA 5BSWA 4UE2A 5KNCD 4R7GA 1SC6A 3I8OA 5KFDA 2JJ2A 1EESA 4TQ9A 1WXWA 5JNLA 3DHVA 4R9NA 1Q7RA 1JG3A 3K20A 1XLTC 4XW2A 3ROMA 1PS8A 3E0XA 4AO7A 2VPZA 4R40A 1AZTA 4N49A 2QL7A 2NXEA 1YQDA 1F4LA 1V85A 3CISA 3ZH9B 4L9RA 1E79D 3DMPA 2B82A 1XEFA 1TVMA 2ZIUA 2P3OA 5ERYA 4IRXA 2EBWA 2Y2VA 3HKEA 4DL3A 5JJBA 4L9WA 5LXTA 4MVJM 2J5RA 4RVGA 1HDOA 4KH1A 5AKJA 3DL7A 2FSPA 3QZ8A 3IPCA 3RF6A 4RVUA 1YRBA 2ZT6A 2JH9A 4PSDA 2QRUA 2P5TB 3I5XA 1KR2A 3U61B 4AECA 3FJOA 4BV2A 1A0PA 2ZITA 5LMUB 4I9GA 2NVOA 4JJ6A 2ACVA 1Q16A 3CH6A 1E6EA 3A4IA 3K1RB 3PC6A 4QTXA 4N76A 3L5KA 2O0MA 3FPJA 5HQ3B 4XIFA 4J90A 1MSWD 1U2PA 1SBIA 1QZ3A 2H3IA 2PGXA 3X0DA 1Z3EB 4DIBA 4DGSA 1W1IA 4BAUA 4DSIA 3HABA 2FWPA 3U44A 3SF8A 2BCQA 4U5QA 1OWNA 1QH0A 1TYEB 1G2PA 4JBHA 4UNIA 4MS4B 4JJIA 3CRXA 4B6FA 2H17A 1KYTA 1ZQAA 4EG8A 2C5AA 5DT9A 1W47A 5ILOA 3K9WA 1DK3A 1M1YB 3LFTA 1XD2B 1PUZA 5BT9A 2SKCA 1FO4A 3MM4A 5D5HA 4XQ8A 2E55A 1J97A 1DTWB 1EUYA 2GOYA 5I01A 4Z6CA 3FMFA 1T1SA 5A5FA 5FUBA 3K0SA 1P8JA 3DEFA 1D1QA 3W34A 3E9RA 1AGRA 2PLFA 5KVAA 1W5TA 4M9JA 1XFDA 4AKGA 3DEYX 1OYYA 2DX7A 5JECA 2ZRIA 3GCDA 2D74A 4OHVA 4OF4A 1GOTA 2P2SA 1OYWA 4EPTA 5A0VA 2VHCA 1X7YB 3Q8QB 2GZ3A 1V5IA 3HUTA 2KW5A 3NIBA 4Q0MA 3R9IA 3QTBA 3K70D 3Q9UA 3KFLA 1HYHA 4J6FA 1P3JA 3DTVA 3KJHA 1NVVQ 3HKDA 1FQWA 1F8GA 5EIOA 3LPNA 2AR9A 4E5VA 2ZXHA 4OKIA 2UDPA 2EJCA 1ZQIA 3KQSA 3RYCB 3IBTA 2PZAA 3UT5B 3EXEB 4UEKA 1ZK0A 1ZQ1C 3GDFA 4ED6A 3RBAA 5IMBA 3QH4A 1WHTA 4WKNA 1BPXA 4YHHB 5CR0A 2WSYB 1DP4A 1OYOA 4YAKA 2WC1A 1UZAA 1E7QA 1NJGA 4EB6B 2M9MA 3GJ5A 3A4YA 1JFTA 2WG1A 1J24A 4OJTA 1E3QA 2IZ7A 2QZJA 2OCIA 5C8DA 4NBTA 4ZTZB 1V25A 3IO5A 1NRWA 4QGGA 3FGPA 4D3YA 7GPBA 1JQAA 1FTSA 3CZMA 2OWDA 1GAXA 1AJEA 1NN3A 1DWUA 3H5VA 1V2GA 3K5IA 2NTYC 4MLPA 5GV7A 2FKNA 2B5OA 2Q1XA 4BBPA 3G8BA 1XTIA 5IM4A 2V65A 3Q88A 3IOCA 4RFSA 2K4HA 3IP9A 1YK0A 1FBNA 3GZNA 4EKGA 1E3WB 1SM4A 2I7VA 1NYTA 4BEJA 3QKSB 1AG9A 2AR0A 2RHRA 1J5PA 5E95A 1RAGA 3H05A 3CGWA 1XVTA 1XSNA 1XNJA 2FKAA 2ZUFA 3DEAA 4CMEC 4TL7A 2RE8A 2FOXA 2DL0A 1FMLA 4GZ6A 1CKEA 1M2NA 3PYMA 1G8SA 4QRHA 4E6EA 3WOHA 3MMSA 2ZUBA 1XHLA 2JRCA 5DTIA 3KOWA 4DZTA 3NB0A 1TTHA 1HEKA 3BXEA 3I1IA 4XJXA 4DLSA 4R9VA 5DHSA 1I3CA 3G79A 3PQ5A 2KE5A 1JXOA 1ZSVA 1KKUA 3NNSA 2H2GA 1USVA 1YRQA 3DBRB 3VSEA 1F6WA 4EY8A 3QE9Y 2KMDA 3GZTB 4QWCA 3MWDB 1VJTA 3SVTA 1PLKA 4D1YA 3M70A 4HNUA 5DIFA 4GC9A 2PXAA 4UHKA 4QUIA 3RJMA 2ZJ5A 3I9LA 4LDAA 4QPDA 3F6BX 3NUQA 2P35A 2WYWA 2DE0X 4O4HB 5LP6C 2J59A 4R8SA 4COOA 1A9QA 3WHKA 4XWTA 2WNHA 3F5QA 4ZOLF 2D00A 4F93B 1NJ8A 2XUJA 4MEYA 4MUJA 2FQQA 5EXPA 3UMRA 4FC6A 2WJ3A 3EFEA 1GPBA 3JQQA 3KJZA 2R8RA 4LDZA 4ND3A 4LXTA 4Y2TA 1NBWB 2VYQA 2OHJA 4F4JA 2W54A 5TS2A 4HX9A 1WMEA 4MW1A 1XZLA 3L84A 1YDFA 4EH1A 1M2VA 4TYPA 1U7WA 4BIMA 4NJ8A 1DJLA 4TQUS 3RC8A 1P72A 2DTEA 3U4HA 3I2GA 3DSRA 4G1BA 1GG9A 3PYLA 3EBPA 2OA0A 1SKMA 1DLJA 3HN7A 4G8DA 4C4ZA 3HDQA 5E4JA 4XD2A 1SC3A 5HK9A 5FUXA 4UMFA 1A4RA 2ADOA 3E48A 3KFVA 3PS9A 2R8GA 5HG0A 4ZZIA 4MICA 1ZVQA 2HMWA 1E3EA 3TE6A 1S01A 2XKBA 4PHDA 2HT6A 4F12A 4YS6A 2X41A 3G6XA 2JD0A 3RROA 1XF1A 1RAAA 1YCGA 4HNRA 4OTZA 4JP5A 3K30A 4AAYA 2XJ9A 6PFKA 1OUMA 3PNKA 2VJBA 1L2TA 4Y2YA 2G07A 1PL6A 1F4PA 1RQ7A 1W93A 3IV6A 5HPYB 1E69A 2DYKA 3HR8A 3BIOA 3NAGA 3GI1A 5J4LA 4YMGA 3JQPA 4WZAE 4U7DA 4JEMA 4WXMA 1KH2A 3QPDA 3PC8A 1YXMA 2Q5HA 1X66A 3A1NA 3DB1A 3OJ0A 3DZJA 4JODA 4GSYA 3GMDA 5ADVA 1O6CA 1GUYA 1FUYB 1CY7A 1K92A 4YI3A 4Q03A 1XMQB 1TO2E 4LFCB 3ECAA 4NMMA 3BMQA 3Q5DA 5ALTA 4F2RA 5E3HA 1DEAA 4RHEA 3LX5A 4EI7A 1NG9A 2AZMA 4EG3A 3CNHA 2C97A 3BULA 4O3PA 1R8SA 2FW9A 3GIIA 4B84A 4KIWA 1U98A 3HBAA 3OSPA 5IVDA 3EUB2 2IITA 4HQLA 1Q20A 4DKJA 3GLKA 1L7VC 3OAAD 2RHMA 4HLUC 5KMGB 1MDFA 1VCIA 4BC1A 4A23A 4IRCA 4RQ5A 4FJ0A 4D92A 3L5OA 5HWSA 1U90A 4B5LA 3ZWDA 1QE5A 1U0OC 5LLDA 1L5NA 3IFSA 1A9PA 4M9LA 1IZYA 3ZW8A 1NMSA 1Z0SA 1STOA 2VHWA 4E0DA 2X7HA 7ICLA 3KOMA 5F9MA 2G9NA 4DPKA 2YRWA 3CINA 4UXIA 4M0UA 1YB7A 1PVQA 1R8YA 4NHEA 2DHEA 4XR9A 3AM1A 3FMIA 1USGA 4DWVA 1TJYA 4LYFA 5KNBH 5KREA 3UC9A 1WDTA 2AMLA 4WESA 3M49A 1GPLA 4NY1A 3GLGA 2QGFA 3KSZO 4X3OA 3G49A 3TUZC 4Y2GA 3T3DA 3TADA 4JC4A 2W4MA 1QHHA 4O4IF 3OLYA 3MDCA 2ZYDA 3SFTA 2XB4A 2IS6A 3SVZA 1BW9B 4ZKDA 3PITA 1U3DA 3C21A 1S9HA 4BUCA 5B3JA 4U0JA 4D99A 1QFJA 2IPAB 3UCXA 2HK8A 4YMLA 1KDVA 1TQ4A 2ZIXA 3C5CA 4NL9A 1KZ7B 3MWJA 1R12A 2F3SA 3TRKA 1DEKA 1R74A 2C2OA 3E7DA 2W8BA 4YR3A 2ZVJA 2YHUA 3EWNA 3TSZA 3FPSA 5JUMA 2REXB 2SKEA 4QDXA 2FXVA 4LHZA 4PONA 1SU4A 2WAXA 4RK4A 2P4HX 4KQHA 1EDOA 3MIIA 5KFRA 1C29B 3CUSA 1U1EA 1KYVA 5DLQC 3UGQA 3ABSB 5EZQA 3AM5A 4MVJF 5MDHA 1E77A 3KWMA 2J6SA 2WD7B 3NPAA 4CVNA 1Z16A 3ICQB 3O94A 3E2EA 1XZMA 3NBFA 4PGXA 1PV1A 3H9UA 3N7UA 4ZGWA 1G6HA 3BB3A 1K2WA 3EDOA 9ICBA 4DOAA 3SDBA 1G41A 3OOJA 2NO1A 1FQJA 2QE6A 1I2MA 2ETVA 2O0JA 1C3OB 1Z25A 4X61A 4ZAZA 2FWBA 2P27A 1N48A 1IEVA 3VZQA 3IT3A 2PT5A 5EI5A 1O8CA 3UMSA 1QLWA 2AJCA 4NEGA 3DZCA 3Q8LA 1SCUA 2I2FA 2R8XA 4C6HA 1O95C 5T8KC 5DISB 4YUAA 3M6XA 4OATA 5ALRA 4FKMA 4IDAA 7ICQA 3KKKA 3R41A 3I04M 3VI3B 1QUFA 3SJCA 1Z4QA 1WULS 2FR8C 3EGEA 3RSZA 2Q2QA 1S4QA 4JKIA 3H1BA 3ICXA 1O94C 4QZVA 4ZVKA 3HLKA 4S1OA 3VZRA 3A3KA 1E4OA 3KWJA 1U9CA 1FJ2A 2X4IA 1A77A 1AHIA 1KSHA 1YGYA 2QD5A 4XIGS 2R0QC 1F14A 3VC1A 3TPZA 5EKXA 4LJYA 2CKDA 3BL8A 2VFAA 3OPYB 3GLHE 3BTSA 4K9KA 2UVUA 5I4CA 1M0TA 3IX7A 2HQSA 5IJ9B 2D2VA 2IWRA 4X44A 2A7QA 1BOOA 2Q7XA 3KFUF 1OB5A 3R7BA 4DCVA 2ARKA 3NH6A 5C37A 4ZI7F 3LVRE 1WL8A 3U9SA 4KMRA 5JS2A 3SR3A 4PZZA 3DBLA 4HOYA 4IRUB 1NUHA 1D2GA 1J00A 3H17A 4YDHB 3UAZA 1W36C 4FKBA 1J56A 5DW0A 1FFHA 1EBUA 1SJ9A 1LDEA 2WU1A 1G4AE 3L1VA 3G0OA 1UFRA 5FX2A 5A6SA 4PAWA 4HUQA 1X2EA 1N56A 2OE2A 4JYBA 3GW8A 3H2GA 4B43A 5J0XA 2EC5A 2O2YA 4B40A 2YUIA 3T3PB 1Y0BA 1EFRA 3G2NA 2YW2A 3QLVC 5TQ0B 1EWVA 2XNDD 1U2DC 4XLZA 4NAHA 3I2FA 1U63A 1MU0A 4B0OA 4TSFD 2PZGA 3GV7B 1E9RA 2JFPA 2K4PA 2AW5A 1Q7CA 4UCQA 1SXQA 1D5WA 3ELDA 4YMSA 4FMCB 3S8EA 5I5GA 4F3YA 8ICAA 3WLLA 2H29A 1AZWA 2BEWA 5JO9A 2P4UA 4LX0A 1D8AA 2PI4A 1EBBA 1B8NA 3PQ4A 3DZHA 4M55A 4DDUA 1U7ZA 8ICHA 3O9MA 2E87A 5BSVA 1DAGA 1A4XA 2XCSB 1OCEA 2BHLA 1ZNXA 1E7WA 2HPHA 3D7MA 4QC2A 4D2IA 3AVYA 5TISU 4XQGA 2HDNB 1NXPA 1UDAA 3DMTC 2EFYA 1IM5A 5A0FA 4KNYA 4IS2A 3ESAA 4F1JA 2GERA 1ZITA 5IKEA 1PJ4A 4AS1A 2GBLC 1UBEA 5KYNA 1RRFA 3H2BA 5D3MB 1RFLA 3L8EA 1H5NA 4C01A 4ZQIA 2RJNA 1X8KA 5LKAA 2IU6A 4W5TA 5EHXA 1LLUA 1FSGA 3PUWA 5J5CA 2G9UA 4QLOA 3HKZC 2W0MA 1USIA 1NT2A 2CBGA 2QPTA 3IPYA 4RUCA 5BOMA 2CZQA 2PGNA 3LVBA 4JX9A 1XTSA 3LVWA 1CD5A 3KQVA 3U3ZA 4M2YA 4AWBA 2BHRA 1HT2E 4WQMA 3U4GA 5CPBA 4DG5A 4BJ3A 4A8JA 3ZJYA 2OILA 1TA9A 2HIHA 2AG8A 2Q3CA 2QRVB 1SL0A 3UC5A 4RA6B 3D2NA 4P6VF 3ISDA 5DB4A 1C0KA 2GFQA 2PMWB 1GCUA 3T7JA 3QNUA 3WS7A 2WM9B 2VANA 1KJJA 3PJDA 1FLNA 2XO7A 1AZSC 5HXAA 1G8MA 3M4NA 3RYTC 2JAPA 3U3KA 4C4TA 5AVJA 3FHOA 5BOLA 5G3ZA 1JFRA 4ACBA 5AESA 2XVZA 4RVNA 1R15A 4JLBA 5IC5A 5FORA 2DT8A 4JBWA 2DFDA 5AW4A 1SKBA 2BZSA 3Q6NA 4CV3A 3GRAA 5T57A 2QNIA 5ILQA 1MNAA 4MW7A 1MCZA 5J2AA 3IIEA 3NORA 4HVAA 2PSHA 1T9ZA 2XZLA 2IEYA 1TV9A 3V8BA 1IMJA 2VTBB 2W6ZA 4CM9A 3ET4A 3EGCA 3L41A 3TIVA 2BTOA 4RHFA 3RK0A 1AQ6A 2C03A 4Z2YA 1IY1A 3C1ZA 4C87A 3S1LA 1BE0A 4O33A 1D8TA 2W11A 1Z2EA 5JCOA 4L27A 3QJGA 3L7YA 1IZ0A 1HDGO 2CGEA 5B58C 3GGPA 3QYJA 2B4YA 4NJEA 4KYUA 3T7KA 4QU0A 2W9CA 2JARA 1F48A 4C2BA 4PRYA 1HE3A 1T3HA 3DDHA 1VG9B 1ZQLA 4GOKA 1TO6A 3PDWA 2QG9A 1ZBDA 4OBWA 3W7BA 2CRXA 1BVHA 4RVSA 4G1EB 1CB0A 4L74A 3KJIA 1CLEA 3JYLA 2EW2A 1MB9A 5KNCA 4F5OA 3JD2A 5FOUA 4Z7NB 3K92A 5DXFA 2R96A 4NCKA 3F5FA 1AMUA 3R3YA 1GPH1 2C88A 1NQOA 2N3ZA 4F5RA 1ILWA 3BGVA 5IIIA 1XNRB 3WVNA 1EHCA 3FNBA 3H5OA 4HGYA 1T34A 1WLYA 2C4MA 4QT0A 4EITA 1E79A 1XTBA 1YRAA 1X92A 1HTBA 3LVVA 3TS1A 3X2FA 3PSTA 3Q15C 2BGMA 1QFXA 4EPYA 5KYWA 2J4FA 2AV6A 1TLLA 2QSZA 4S2EA 4BX0A 3O1JC 2JHFA 5DBOA 1XNSA 4MUXA 1IEXA 2C7GA 1FX0A 3IIIA 2PSDA 3RFTA 3ITEA 5LNK6 2XY7A 3R40A 2YIDA 3EXG2 9LDTA 5SV2A 4QGHA 4ZV4A 3I52A 3NBZC 5J2TA 3CH5A 1AHNA 3UJHA 2NP6A 4D3FA 2EWVA 4OGWA 3V1MA 4NDZA 4J3NA 3CZ9A 3OOHA 4ZO7A 3W9YA 4JI5B 1QDEA 1AS0A 2O06A 1TIPA 2IPOA 4QL3A 2ZM5A 3FUTA 1UEIA 4MUFA 4OP1A 4PQRA 1UPXA 3ZU4A 2CNWA 3CLSC 1UBRS 4JI7B 3A6LA 3AVWA 3S1SA 5GINE 5F1OA 2QUHA 1HLDA 5B1YA 1KPIA 4PLTA 4RH0A 2OBMA 5E7IA 5L8VA 1II8B 1QYVA 4H6PA 4B3GA 2PS0A 4OI0A 3QVKA 3CMMA 1JYFA 1J5XA 3U7JA 1WETA 1MG0A 4GWKA 1FZTA 2HXGA 2TRSB 2R1TB 2HFJA 3DO8A 2YBEA 3KP1A 1KP9A 1DL5A 3FCAA 1WJGA 3CVVA 2C0QA 1T6ZA 2V4UA 5GGYA 2Y05A 4QEDA 2IOYA 2H4YA 3ZK8A 4WJLA 5FPSA 4N3CA 2G0TA 2HKIA 3D9QX 5AJHA 3TNFA 3ZJ4A 4V1CB 3IELA 2G5TA 2HL6A 2WJ4A 2FUCA 4TMKA 2W6JD 5C5EA 4N48A 1SKAA 3NGXA 3KAJA 1ZGGA 4KOAA 1SXDA 1ACMA 2JVJA 2KJ9A 4CQMB 3H4TA 3KUXA 1REQB 3LXMA 4WOPA 3IR5A 1T1EA 1LDGA 4AJNA 3AEVA 1TAHA 3RYCA 3UW3A 3NWJA 1IBCA 1VJ1A 3UT5A 1SVOA 1OLOA 4MUGA 2HA2A 3ZZ1A 1ZJWA 1JU9A 4NBVA 5ESXA 3RS9A 3W8DA 1PSDA 3DEEA 2QN8A 4KV9A 4ND2A 1R3UA 5BV0A 1U0NA 3NHZA 1OV6A 1GYQA 4CM1A 4BNKA 3WTBA 2TYSB 1AO0A 2ZLBA 4Y8VA 1M72A 2YJ6A 1DZIA 2NUAA 2J3HA 4AJHA 1HZZC 5IH3A 4N47A 1S2LA 1DCTA 4FZJA 3BFXA 1E9VA 1ZM3A 2CFSA 4F5ZA 2VCEA 5U9CA 1O57A 5KKNB 3E8SA 3A6GA 1QANA 2BPFA 4C0AC 3A7DA 3MQ4A 4GXNA 1JP7A 4N0DA 4S0ZA 4TL6A 5DFAA 1L6RA 4C03A 4ERNA 5I6DA 5AM2A 1QH9A 2B0CA 1UOOA 2FPKA 2J3KA 1F2VA 3VR5H 1OZHA 4R8UB 1Y6JA 3QKSA 3NM6B 3L1IA 5DLPA 5AVUA 3IQFA 2J48A 1B0PA 2YX8A 1FDVA 1XCJA 3H6HA 2IHUA 1CFJA 3CF6R 1EFVA 3SR6A 5JC1A 3C43A 1XJQA 4J2OA 1PBTA 2V5VA 2V9PA 1BDIA 9ICTA 2BGNA 1Q11A 4OJPA 1VHTA 3L8FA 1GO3F 1E7YA 3C0KA 4CI0B 2J9FA 4WGGA 2QROA 4OQLA 3TIXB 9ICLA 5JCXA 1RW4A 4HADA 2JKZA 3W3AD 2CMFA 3SZLA 4KGXA 4GX0A 2BMEA 4WEQA 3QV1A 2GEDA 4U6QA 4LJXA 5EQFA 4R54A 4GYWA 1JFVA 5AK3A 2J5BA 1YB1A 4QXMA 1MX3A 2YJ3A 4Z2AA 3MMPA 1P2VA 5SZKB 5K9ZA 16PKA 2PZJA 2V7VA 1U0TA 4H6XA 1ZUIA 2R00A 5A7HA 3JPRA 4BV9A 1TU0A 3DBRA 3C98A 3L43A 3E27A 3KKMA 3GJXC 4CUZA 3LVFO 3MWDA 1YAJA 3QLUC 2GILA 3C1OA 4U3JB 1JTFA 3RR8A 3UV7A 4X8OA 1L6NA 4B3JA 2ZCUA 4R4JA 1QE0A 5LR6A 1M2GA 3KJXA 4ED9A 3MGCA 4PRKA 1B0UA 3E22A 1IK6A 4FFDA 4FMDB 4H9GA 2COKA 1W76A 2QTMA 2R8BA 2AEEA 4UD6A 5EMMA 3FNQA 3RQSA 4BV8A 2I6TA 4R8MA 4MI6A 4YAUA 2ACEA 3BK7A 4ZOEA 2IDKA 2W2KB 2ZIWA 1YS6A 5KG5A 3EULA 2P8SA 1DGJA 3M6MD 4HX5A 2XCLA 2J4CA 2QN6A 1Q0ZA 4XYBA 1RCUA 3P8ZA 1HDYA 1JIHA 5JQGA 3MAGA 4M0PA 4UW9A 4U0KA 4W1RA 2ZJYA 1Y80A 8ICFA 3AUKA 5AYVA 2I33A 4P92A 1KU6A 5CW1A 1NRJB 3FOFC 3HCDA 4FOTA 5KTTA 3JQAD 4UNSA 3TLAA 4ZJZA 3JQAB 3CPHA 3Q7QA 4JYCA 1G9TA 3OD5A 1QF6A 4P32A 4A6DA 2B94A 2D5BA 3TAHA 1NONA 1IN7A 3RUAA 3PCTA 1KK2A 1NMXA 2GYUA 3AXSA 2Q3MA 4YTEA 3CB2A 1A9RA 3D59A 2PSEA 5KKAA 3DOUA 3QIAA 1ES9A 3CUEF 1LH0A 3X43A 2WM3A 3SQMA 4ITUA 3N86A 1RBMA 1TZBA 5JBQA 4ZARA 4L3VA 9GPBA 3PP8A 4RV5A 1AS2A 2X15A 4IY1A 4RJLA 4UM9D 4MFAA 3G23A 3E8XA 1YI0A 3IP3A 4IJUA 5HS6A 2XA2A 4UM9B 5A02A 3DL0A 1ZD8A 3OVMA 1O6BA 1OH5A 1GLGA 2PQ0A 3CEJA 3U56A 1IRIA 3MIZA 5KNDD 4J16A 5L40A 3G9QA 4MV4A 1ZQXA 3R5XA 3AB8A 4C8OA 4YPFA 3SXUB 1NBMD 3AGQA 1ZOSA 1V26A 2W3RA 1PX0A 1UIRA 5DM70 4RTRA 3S5JA 2AQHA 2IP2A 3A9CA 1E3IA 5I7UA 1D6NA 1VRVA 4EUHA 1LWOA 1XC7A 3AHJA 1NLUA 1R5JA 5G1PA 4E1BA 1S0NA 4DF3A 3KAKA 4PSCA 1G0NA 1QSGA 3V33A 3D7NA 3BD8A 4HGOA 4KXUA 3THSA 3ZTTA 3OAAA 5L3RA 2H7YA 3PUJA 3RVPA 1WMAA 1NR1A 5B4VA 2A58A 4IV5A 3BF8A 3AHFA 3N3BC 4TXHA 3GROA 3MBOA 4UBNA 4B3RB 4G2TA 3PW0A 3OT1B 1XK7A 3GJQA 2D0OB 3C2LA 5JY6A 3WHIA 2Q1WA 2AFIB 3ICCA 2EARA 1HTTA 4LTDA 4PTZA 3L06A 4K4HA 3ZVRA 5DN9A 4C1NA 3UMMA 3VPFA 2IXTA 2A78A 2C3PA 4KGVA 4UASA 3PPXA 4YJ3A 4YHBA 4X63A 1BMQA 1JEYB 3UTCA 3I5YA 3FKQA 3G3EA 4CV0A 2QRHA 1XZ8A 2P0YA 1LNSA 2QL6A 2J31A 3MJCA 1WXIA 4UHJA 3EXHB 4NBUA 4HTFB 1O7JA 1RQ2A 3W7VA 5KFSA 5HOEA 2JH7A 4RKYA 4BFUA 2A67A 4OPMA 2QZ9A 3W5JA 4CM4B 4O4JA 1WZNA 1T2AA 1PFKA 5BNTA 5LZ4A 1Y3IA 4WLNA 1ZW6A 1A4IA 3ZD8A 2JVKA 5DB8A 2BJWA 3ISJA 2K5UA 3GVCA 1Q1EA 4XFDA 4DLGA 2PVCA 4C4YA 1RXSA 5EWFA 4XFJA 4HS4A 2AZ4A 2IHKA 3RHFA 5THXA 4BNYA 1FLVA 4F8YA 5CJPA 3X2SA 4IIDA 4RQAA 3E03A 4P58A 3HCAA 4OHPA 1Z63A 2RDJA 4KLAA 3H5LA 4PIPA 4QYWA 2BGIA 3GEHA 5A3JA 1DDGA 3G8AA 4MUIA 3GZ4A 2FV8A 2C4HA 1SV0C 2DBQA 1WBBA 1ONBA 2CW5A 1UFKA 2OHXA 2D1SA 5LMNB 3PVCA 2XCPA 1JB9A 1BKDR 3OE5A 1E3JA 5DB6A 3TR0A 1PK3A 1KH1A 4HLDA 4ZOCA 4HH3C 1NW5A 5JD4A 2K8CB 4PL2A 1K27A 2ON6A 3SJUA 2VT7A 1QZZA 4H1VA 5DBEX 1QHFA 2QPAA 3PFFA 4OJ6A 3W78A 3U7IA 3MT0A 2IEZA 4TKVB 1M6HA 5F3WB 4X5VA 1WSBA 3SENA 3WGKA 3K0FA 1WCV1 3E84A 4ZCTA 3PNOA 4CBVA 4NCAA 2WWVD 1SIJA 1R9JA 1GSOA 3U4IA 3GARA 4Q3NA 4B7XA 3BQ1A 5KOYA 4DUGA 3FDJA 2WTBA 2CF6A 2E82A 2ASJA 4URWR 1QVRA 1J0EA 5DHQA 3GVHA 1SUSA 2V9CA 1CWUA 2H9YA 1YZQA 3UA4A 1NHGA 3PYXA 5TPWB 3KHLA 1R9GA 1Y5RA 1N3IA 4Q9HA 2CSXA 3L4JA 2IYXA 1T5LA 2CB9A 4ZEWA 4EB0A 4COKA 4MQFB 3IUJA 3U1VA 3FYCA 4GOOD 1JXLA 3A26A 4E32A 1RDFA 3IC5A 5IJ9A 2ZRAA 5DHUA 3KEGA 2WSIA 4LISA 3H6KA 1C1DB 4A92A 2XEXA 2BFAA 4JP8A 3UANA 2XMSA 2BSQA 1DAPA 2HMSA 4A2CA 1K3UB 5FI5A 1F5SA 4A0GA 4EUFA 4AICA 1R9NA 3N8DA 2RP5A 4OFXA 1T3LA 5DCWA 1KGDA 2CXNA 1ECJA 2Z83A 1SCAA 2E4ZA 3ZD7A 5KG4A 1K8XB 1ODFA 3I32A 1KA9H 1XKLA 5AWFC 5TQ0A 1A27A 2QU7A 1N5RA 5CA0A 3IHTA 3HSKA 1TK5A 1FW8A 3IT0A 2XUQA 2AOUB 3UWDA 2XNDA 2Y9TA 1ORTA 4DN6A 4TSFA 3QLEA 1A72A 5JNSA 3O1HB 3HILA 1LJLA 1Z6ZA 4WK2B 5K1ZA 2V7PA 3NTRA 4R3WA 3TW4A 9ICOA 2J7KA 2GZ2A 3O4JA 3OEED 4IXWA 5CP8A 3IV7A 3K0AB 3AVXA 2QAGC 1D2NA 2FEKA 3U49A 4MKFA 1K2VN 5J2UA 5KEIA 3FSJX 2OCXA 1YZHA 2ECOA 4Q4CA 2RHGB 3AR4A 4U7PB 1VB5A 3MXOA 5BNWA 4KLZA 2XZTA 3P94A 4UTNA 4HMQA 4QJ3A 1UA0A 4UEJA 3I37X 5D3MA 2VJKA 3A6JA 4Q4AB 3VBCA 1GZ6A 4EKYA 3EH1A 5KCZA 4I2AA 3EQZA 2J6IA 2X7XA 4ZPJA 3ER8A 4CF5A 2HK6A 4HFRA 2RB5A 2ZOSA 3QOFA 4RL6A 2GVZC 2WZDA 5L1JA 2AGOA 1KSGA 5BVHA 3ICEA 2PS1A 5BMOA 5U4XA 1FC0A 1T2EA 4S05A 2F43B 2NV6A 1NQWA 3O8RA 1UPBA 5ILGA 1G8HA 3D3NA 3FTPA 2R6JA 2FLKA 4ZT5A 3TANA 3BH7A 1KMNA 3IMCA 5CD1A 4HB0A 1PR3A 2HHQA 2GF2A 1D7OA 4I4TF 1XQ9A 2MWMA 4E5MA 8ICSA 3RS5A 1ESZA 4X0EA 3KS9A 3A10A 4CKCB 1TCBA 2XGJA 4NZNA 2AEMA 4WDQA 3D6AA 5FLYA 3OZSA 5DZSA 3GVPA 3EHEA 3L7OA 1DE0A 3V5NA 1HLPA 2QRVA 4YT5A 4RA6A 1LTHR 4D9EA 3C8HA 2Y2UA 5TARA 1KQ3A 2R8PA 4OU5A 4Q45A 4I1RA 1OY1A 4NBRA 2FLNA 2WTAA 1E6WA 3M5CA 2GTHA 1FMTA 3UK1A 3UAGA 1PEYA 1ZD3A 1VGQA 4O3QA 4Z3KA 5E6SB 1CRWG 2RD2A 3KQYA 1X15A 2CD9A 4GYJA 5HIMA 2L82A 2QIPA 1H65A 4Y9SA 4E5YA 1PVOA 3ZX5A 4AXXA 3FNGA 4BYGA 2OORA 4XVUA 1KVUA 2F7SA 5AM1A 2PFSA 2VEOA 4ENVA 5D3KA 2NYUA 3WLTA 5CGQB 1CUVA 1U2GC 2BH2A 4Z1MD 3OTGA 3HY4A 2VTBA 4K9NA 3PTZA 4ON9A 4Q19A 4AUNA 3D7SA 2R7LA 2NPIA 4CCSA 3L18A 4DSEA 4DEZA 5FDFA 4IV0A 4X3PA 3PUHA 1GPWB 4O29A 3OZAA 1I3KA 3RVDA 2BGJA 3GA7A 1L5YA 4A2QA 1AF4A 4G0UA 1E98A 2R62A 3B5IA 4UOZA 1I33A 3B3FA 3A8TA 2O7SA 3L04A 3JPSA 1PYOA 3FBWA 1P4RA 2VJMB 4O2BF 2ILVA 1TEZA 2Z5FA 4OBEA 4KFRA 1BRMA 2O23A 3RJKA 3HJEA 5JYBA 4RZUA 3ZLBA 2QHXA 1LPNA 3X3HA 2JG3A 3OF5A 3ROZA 1T0BA 1HDCA 3RRMA 2WBLC 1FA9A 3RC2A 3UAOA 3HRHA 1T6BY 4YRCA 4LRXA 4L4YA 2D1FA 2Q3LA 3AJDA 3ADKA 5J0YA 3I2YX 1BHJA 3OTIA 2CVPA 1P91A 4NMHA 4S04A 2FN7A 3DP9A 4P4SB 2VQDA 3GRRA 5DK4A 1K6IA 4O3FA 1RG6A 2RARA 3KQHA 2Z8YM 1D5CA 2ZTDA 4KX3A 5EIHA 2GCIA 4CEIB 3A1CA 4BATA 5IM5A 1QLJA 1QH8A 4RK7A 4JWTA 1U0HC 1EPUA 3BGIA 3CHYA 1NJWA 2JLUA 1ZU4A 3NW9A 5A4MS 4FB4A 3SZMA 2R7AA 3LK6A 2ZDGA 3PUKA 5M7EA 4XDHA 3EOAI 3LDUA 4KPGA 1MOSA 2N75A 2ORWA 1AGXA 4RA9B 3EQ9A 2MSLA 4BMVA 4L57A 3UN1A 1KMIY 2HCRA 3GGDA 1AKMA 2XBMA 4OB8A 1LW7A 1NXTA 1SU7A 3ZNNA 2NRXA 1KK3A 4B4WA 2BE7A 2QX6A 3DLCA 1BXGB 3ZUGA 1YHZA 4AKEA 4HGNA 4NFYA 3ZHOA 1I4OA 4U6PA 3J7AC 3FWKA 4KWEA 3D2AA 4FC7A 3INGA 4K0RA 5C81A 1TGYA 1BD4A 1W6RA 1P7ZA 4TLMB 5JASA 3C3DA 4UE3S 4Q66C 4WFQA 1KNXA 3K15A 4PPNA 4OXRA 4EM6A 5DM1A 2LM4A 1JLLB 4ZQCB 1YZ6A 1EG7A 1FS6A 2AZTA 3VU1A 1N1EA 2P3SA 2AMFA 5KDDA 4NOMA 3WNZA 1S0VA 2YC2C 4EUEA 2Q6LA 1EXWA 3G59A 1Y88A 2RRDA 1LVGA 2AYZA 1KOJA 3DD1A 4PY2A 1M83A 2B9VA 2BCRA 4V1CA 4FN5A 2V6JA 4G24A 2HHJA 2Y1EA 5JAQA 2VEDA 1BCSB 1TVCA 5LN1A 1SUIA 1KDOA 5CDSA 5ELLA 1REQA 3A9RA 2W6JA 1QWOA 5HZMA 4G41A 4QWDA 4EYEA 2G9VA 5BV8A 4MJLA 3PBKA 1NMYA 4IFEA 2ZZMA 4MGKR 4EENA 4ZI7B 2IPLA 5KQGA 3MC1A 4RTKA 4ERXA 3ORYA 2KX7A 3AETB 1YR6A 4E2ZA 1GGNA 1KAOA 2CXUA 3H1PA 3DJFA 1CNEA 4UB8U 1N2BA 2BHTA 2UZ4A 3HVRA 1JA0A 1HYQA 4MQEB 1C81A 3BJEA 3LQRA 4USAA 4OOEA 3RAQA 4GP6A 1GZVA 3H84A 5J0WA 1WDKA 4QBHA 3BJYA 1Y7PA 4HUJA 4UARA 2XV1A 4XDZA 5ELMA 5FL7D 5FR2A 1C7JA 1ZMXA 3GBPA 1NATA 4GQIA 5H7XA 1L5ZA 4NL4H 3T3IA 3HDJA 4QYXA 3MF4A 3O82A 1QTIA 3BT7A 4WLOA 3NPMA 2G7MC 4RTMA 1KJIA 4ED7A 1L7PA 1JA1A 4GDFA 4BRWA 1KC3A 2QSJA 2O3UA 1W8DA 4OHXA 2WSMA 1L4GA 2F8KA 4E1VA 2Z0MA 1ATIA 5E8RA 1IN1A 1ST2A 3KVVA 1ZWLA 2YQ4A 1S0OA 1NYRA 4GE3A 2W6OA 4Z9XA 1ZMOA 3VKVA 4Z7OB 1GL3A 2F8MA 4MRVA 1NXXA 1TK9A 5IBRA 4DV6B 1UJ6A 3QMWA 1C3JA 3W3AA 4E33A 3LBNA 3LPLA 4YP0A 5U4QA 3EDRA 3ZCTA 4P7FA 2F48A 4LG1A 3F3MA 4ETNA 4K8RB 4ZAYA 2QARB 3AIIA 4HATA 3L6BA 2ZJZA 1V11B 1F44A 2JAWA 3ZBPA 2HPVA 5IKXA 2R8JA 3EWIA 3EGIA 5FWDA 5I47A 4DLRA 2JFQA 2AD1A 2Z2XA 1QHNA 4IJMA 5DE3A 3EZNA 5IN4A 2JFUA 4U3JA 4DO9A 3RUEA 3OHPA 3CMCO 1KO4A 2GF0A 2PTGA 4PR3A 4PXYA 5CT6A 1A3CA 3VSCA 4FILA 4HHEA 3GUUA 1H3NA 1UEJA 1MN8A 3CBQA 1I1QB 1JT9A 1AV6A 1EA5A 3EXIB 1P7VA 3ZC3A 2DR2A 1S0MA 1O4WA 1T7PA 1AU9A 4Q9KA 1P9LA 1H93A 3T9EA 4LRTB 3OIGA 2IOQA 4EB3A 3A6KA 3WDLA 3RWOA 2W2KA 2V4RA 1KEEB 3OP4A 3T38A 4PR0A 4Z5XA 2YWDA 1HEIA 1T1IA 1DRUA 1EX9A 4YCLA 4G07A 3IP5A 2Z6QA 2IF2A 5LB4A 3N28A 3OU2A 2NU8A 1CY2A 1Z62A 1CY4A 3JY6A 4JHXA 3DZBA 1EDEA 4OFBA 3VNAA 5J2FA 4BZXA 4ZVQA 3SMVA 3FM9A 4Q7KA 2BEJA 4Z6FA 1KFTA 4HB2A 3FWYA 4FW8A 4B3MB 2AQKA 1MC4A 2GFHA 4PCUA 5F2NA 3ND7A 3PGVA 4FNGA 4I50F 2IH2A 3JQAA 5FLKA 1D1SA 2J6CA 1DC8A 3WK7A 3L3FX 1M34B 2J32A 3K9GA 3PWZA 4RZQA 2NRZA 3LWLA 1SNYA 4HQOA 3NO4A 2FFJA 2VAVA 1XRMA 3CGGA 3TXAA 1Y34E 3DMFA 3UOWA 1JILA 1L9XA 4J03A 4HT3B 5HK8A 5AW9A 3BRQA 2LXNA 3UQ2A 2HA6A 3TQIA 3HCEA 3AQEA 2P6UA 3O8NA 3JD3A 3EE6A 2IHJA 3T1YB 3AEZA 2A9QA 1EHIA 3AZOA 4DILA 5FHQA 5K3FA 4JELA 4AJOA 4C22A 2JEOA 4TRRA 2EGHA 1HKUA 1UC8A 1BD3A 1R0RE 1PO7A 4HDMB 1BU8A 1I4TD 4KDFA 3R6DA 4F45A 1KJNA 3LYUA 1IIRA 2P9BA 2H18A 3FRJA 1OGIA 1DFIA 3EIWA 5JRZA 1L7AA 4GEKA 3B70A 1DCFA 3EASA 3ELUA 3SXUA 3DNMA 4E51A 5KNDA 1IHYA 2C3UA 4TKZA 3OP1A 1P7YA 3GD7A 4CV2A 3J81A 2WVGA 1NBMA 4ZDKA 3VPXA 4RVOA 1OHHD 1PW7A 1V38A 1PDOA 1E63A 1PT9A 2VDKB 2E5WA 2R66A 2EXXA 3FFTA 1Y5IA 4D82A 1SHJA 4JY7A 2IEDA 3JTMA 3RJ9A 1QHXA 3LX4A 3GUYA 1RNLA 2C28A 2H4HA 2FZWA 3LWDA 4R3NA 4MWEA 3N5KA 1TAQA 1SQ5A 2UUOA 5HP4A 2NSHA 4GPIB 4PZLA 4EF5A 5I8ZA 2PSFA 5CT4A 1FYWA 4JSRA 2NUPB 4AMBA 2H1WA 2AFIA 3CCCA 1TYZA 1U3CA 3ZI7A 5A4KA 4C0ZA 3GIMA 4PZOA 4F2PA 3KQQA 2GESA 2ZCJA 1Z5WA 1RXIA 4DWWA 1ZQBA 5K2MA 2Q3JA 2PMFA 4ZVNA 3SJZA 3ENKA 1LSJA 2HQOA 5F77A 3PXUA 2C5HA 1S0UA 2HHCA 4U7HA 2ORIA 2DQSA 2DBVO 1QQTA 1NKCA 4HPXB 4RXMA 1DJNA 3WK9A 4QJ5A 5DKWA 5C5JA 3CJTA 2QB1A 2E21A 2NGRA 1XRLA 2JFWA 3ZU5A 3HY3A 3SZOA 2BEVA 2XC9A 1NE2A 1JYSA 4YD1A 1SUWA 1CZLA 3PNMA 3L7CA 4FDVA 4M8NE 3DE1X 1Y6RA 5JATA 1MPXA 2Z5LA 3LK7A 4L02A 3GL9A 4LJ7A 2BC9A 1RMQA 2RFLA 4EK9A 5J3JA 2WWTA 1LPBB 2KNJA 4DNFA 1KKMA 8AT1A 3KPVA 1ITZA 2PV7A 2OFOA 2A94A 4HAOA 4OLJA 3OTHA 4PS1A 1VSTA 3DBHB 4WIAA 4GF5A 4RW0A 1JPNA 7ICMA 4TMVA 2IS1A 4NYJQ 2RDMA 3ZWNA 2HYIC 4C7OB 4PZCA 3ADPA 4B32A 5FFNA 2H3ZA 3PGMA 3UJPA 3OE7A 1XA3A 3VM6A 3GEEA 5EXTA 2W0SA 2X5KO 4KH0A 1V4VA 1A96A 3HO8A 4IGIA 2PX4A 5CLFA 4MA5A 3IAS6 2XE4A 3PPVA 3V4PB 1I80A 1RKUA 4ZV7A 1CRLA 4P35A 4XUDA 4ZI2A 1MJGA 3L49A 4IVPA 1NVFA 4XI9A 2I8LA 3GLFE 4TKVA 5C1DA 1ZRHA 4Z7JA 4KVZA 4LRUA 4OQ4A 3T5CA 3U62A 2VP2A 3Q7IA 1DKNA 3KSRA 2XOKD 3T7TA 1FU7A 4NECA 1TEVA 1ZKMA 4KX5A 2PD3A 2PEZA 1Y8AA 2FPPA 4M54A 1NZFA 1TJ3A 5JZMA 4MIKA 5J29A 1C9EA 4UQPA 3T3OA 2X4LA 5I4BA 5KYGA 3C41J 3FOAA 3L0OA 1OPXA 4BJ5A 4D26A 4Q8FA 5ALKA 2X40A 1DEHA 4UZEA 1TADA 5CXQA 2JI4A 4RTLA 2D1RA 4RXUA 1NPYA 3UKDA 1DOHA 2ATXA 4JX8A 2JBHA 4WZBE 1G5RA 3IA2A 3B60A 4MQFA 2ZTHA 2FLPA 3BRWD 1C30B 3U3RA 3VSAA 4K9MA 2WP8J 2F8LA 2AQ4A 4LCEA 3QM1A 3AU2A 2UVQA 1IUNA 3ABQB 1OD6A 1E2DA 3CO0S 2RQ5A 3T0IA 4OGFA 4RU9A 3A1VA 3QUBA 5JQWA 4TURA 4O3RA 1OWLA 2PIDA 2X8BA 4NR0A 4H3HB 3GT7A 3CBGA 3MT9A 3JPOA 4YBZA 4Y7CA 2E49A 3V8NA 3E3LA 2A0KA 2VPTA 4IQFA 4RGYA 1RI1A 4UVGA 1BROA 4PG6A 4YRBA 3VC2A 2A4MA 4RUAA 2QOEA 3FYUC 2VTDA 5JSZB 4YD2A 4LECA 4G23A 2AEJA 1WCIB 3QVLA 4ZHQF