1Z4NA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate cocrystallized with fluoride
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 78
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4nA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4nA01
3M1YA 4UU0A 5ALSA 2WM8A 2WF9A 3A1EA 4BNDB 4DWOA 3MC1A 4QQFA 2W4MA 2O9JA 2BY4A 5IT4A 3WKAA 4KX3A 1Q92A 5A3SA 3I28A 4KYTA 1T5SA 1ZRMA 4XPZA 5IT0A 1Q91A 1T5TA 1LVHA 3ET4A 5ALOA 2OBBA 1QQ7A 4Y2RA 3QLEA 1Y8AA 2RAVA 3L0CA 3ZVNA 3FM9A 5AESA 3ZVMA 3ZWDA 2NYVA 2O2XA 2W11A 1TE2A 3WKDA 3ZTYA 2W43A 5AW1A 4CF3A 3U7FB 4UMFA 2Q4RA 1NRWA 5AVQA 4J2TA 3NAMA 2FPWA 4KNVA 4KX5A 3ESQA 2CFRA 5AI6A 5ALUA 3WK6A 2PKEA 2GMWA 4FFDA 3DNPA 2B82A 2YMPA 2C4NA 3EWIA 3UM9A 2FI1A 1ZD5A 5AM1A 3CZ4A 5ALQA 2MU1A 2PR7A 4NV0A 2CFSA 1RLOA 3AR2A 3OCUA 5AW3A 1RQNA 1O03A 4F71A 2B30A 4AS3A 2B8JA 3WKCA 2HCFA 3QUBA 5AI5A 3ZX4A 2MSNA 4UARA 4YH1A 3K1ZA 3QGMA 1U2SA 3W5BA 2G06A 4NAVA 2VKQA 4MWOA 1YJ5A 3KBBA 3AR8A 1ZJJA 3L8FA 3SF0A 2I6XA 5ALFA 4DW8A 5AK5A 2G0AA 4EZEA 2AH5A 1WPGA 1N9KA 3QX7A 1KYTA 3NUQA 2YJ4A 4HYTA 5AM5A 3D6JA 1SWWA 3GYGA 3U7HB 1JUDA 3AR4A 1WVIA 1Z5UA 2YJ6A 1ZD4A 2WF8A 3R4CA 2NO4A 1U2TA 5AW6A 3SHQA 4PNHA 3NANA 5AIBA 1RC8A 4FYPA 4DCCA 1RRCA 3P96A 3AR9A 2EARA 4ZEXA 3OCXA 2B0CA 4UW9A 2FPXA 2WHEA 2Q5EA 2ODAA 2R8EA 2HX1A 1EK2A 2IOFK 4JB3A 1J8DA 4EELA 4EX6A 3KOOA 3WK4A 2I54A 5AK3A 3QXGA 2WF7A 4OCZA 5JJBA 3I76A 3ZI4A 4UMVA 4KN8A 4RESA 3CNHA 3QU5A 4UM5A 3NRJA 3IRUA 4UM7A 4XE5A 1K1EA 3OCVA 1PW5A 1ZRNA 3WK5A 2YMMA 3UMCA 3E81A 3FPSA 3L8GA 1U7PA 5ALLA 3RF6A 3SLRA 3U7GA 4I9GA 4UMEA 1TA0A 2CFTA 1YNSA 2D2VA 5E0OA 5AVWA 4MUMA 2B1QA 3PCTA 4OHFA 4Y2SA 2WF5A 5AKGA 4YIHA 5AKZA 4CE6A 3A1CA 5ALNA 1RMTA 5A3QA 3B9BA 2C8KA 3U19A 5ALPA 1L7OA 3ONNA 2JAOA 2OA0A 2YJ3A 3W5AA 4ZEWA 3QUCA 3PGLA 2Q4TA 1ZD2P 3A3YA 1IWOA 3E84A 1EK1A 3MPOA 4YCMA 2HSZA 4NABA 1RMYA 2QYHA 3ZU6A 5AI9A 3W5DA 3L8HA 4L6CA 1U7OA 4UASA 2YY6A 1VJRA 4HGOA 1AQ6A 3WGVA 4Y2UA 3WKBA 5AVTA 2G1AA 4CF4A 1YDFA 5ALXA 1RQLA 2YBDA 2P69A 3ZVLA 3KDPA 4F72A 5AM3A 3ZUPA 3QU2A 4BEVA 2B1RA 4OFZA 5AKHA 3EF0A 2AUTA 4HGPA 2HI0A 3WK7A 1RLTA 2NO5A 3A1DA 4C4TA 4BBJA 3ZTWA 1L7MA 1ZD3A 2IA5A 3AR5A 1L7NA 4AP9A 1YMQA 3SKXA 5AVYA 1N8NA 2YN4A 2G80A 4O8CA 5ALZA 2ZBFA 2FUEA 5AM0A 2OYCA 3KZXA 2FPUA 1Z4QA 5AW8A 2IOHA 1SWVA 2JAWA 4UAUA 4Y2YA 4Y2VA 1L6RA 1Z88A 5A3RA 3ESRA 5AI0A 3IB6A 4HGQA 5AW7A 4BNDA 3MMZA 4YCNA 1SU4A 2PQ0A 3E8MA 1YV9A 3BWVA 3N28A 1ZOLA 4J03A 5ALMA 3UMGA 1Z4MA 3QYPA 1RDFA 2AGVA 4NWIA 1VFPA 4UAVA 2RB5A 4HGRA 3I6BA 3RFUA 3L8EA 3WK9A 5AVZA 2FEAA 4EEKA 2G07A 5ALTA 2EAUA 2JGAA 1CR6A 4IFTA 1XPJA 2BDUA 5ALKA 3L7YA 4BKMA 4G9BA 1Z5GA 2P9JA 3QNMA 4QJBA 1L8LA 1Z4JA 5ALYA 3FVVA 4UMDA 3L0YA 4EENA 2RARA 1ZS9A 2G09A 1WR8A 2HDOA 2MU2A 2P11A 1QH9A 1XVIA 2R8YA 5ALWA 1XP5A 4L57A 2ZOSA 2HF2A 5ALHA 3BA6A 3F9RA 4YGYA 4CF5A 4HGNA 1Z4LA 5AW0A 2ZG6A 2ZBEA 3HYCA 3OCZA 3R09A 3J7TA 2C8LA 3MN1A 2GO7A 3WGUA 1FEZA 4Y2TA 5ALJA 3QU9A 2G08A 3ZX5A 2EATA 4BYGA 2FUCA 4Y2XA 2HHLA 3L5KA 1O08A 4AS2A 5AIAA 5AKLA 2BDEA 5AW2A 5AW5A 3AR7A 4BX0A 5AVVA 1RKQA 3L0BA 4I9FA 2GHTA 2ZBDA 5AM2A 2IOFA 2YFYA 4BX3A 5AVUA 5IS2A 2QLTA 4Y3UA 1MH9A 5AK4A 5AKEA 2I7DA 1T9ZA 2WF6A 1J97A 1QQ5A 4GIBA 2RBKA 2HEGA 3B8EA 3ET5A 4XQ0A 4B6JA 5AI4A 5AKXA 2R8ZA 5ALEA 3OPXA 1QQ6A 3NIWA 4BEWA 3U13A 2YMQA 3N5KA 4C4RA 4UU1A 4ZEVA 3ZWKA 1TJ5A 3QU7A 4EX7A 5AKJA 3TLMA 3FGOA 3AR6A 3PDWA 3SMVA 3L1UA 3DAOA 1Z4KA 5AVRA 3OCWA 2R8XA 4L6AA 1YS9A 1VJ5A 2FPRA 2JARA 5ALVA 3U26A 2B8EA 2P27A 4H1WA 3OTQA 3I1YA 3FZQA 3N1UA 1F5SA 5AW4A 1RPZA 4BX2A 5AKKA 3NALA 2JAUA 3U7EB 1Z4OA 2AMYA 3VAYA 1QYIA 1X42A 3UMBA 1L7PA 4C4SA 4JDPA 3PGVA 2IYEA 4FE3A 4DFDA 2YMLA 4YCLA 2OM6A 4UATA 4E88A 1Z4IA 3AR3A 5AI8A 1CQZA 2WFAA 4Y2PA 5FP0A 2HOQA 2X4DA 2HF7A 4CNQA 5AKYA 5T41A 2FDRA 3N8GA 2GFHA 3NASA 3OCYA 2CN1A 4IG4A 3S6JA 1Z4PX 1WZCA 5AICA 5ALGA 5ALIA 5AVXA 3KC2A 4RETA 4GXTA 3WK8A 2C9MA 3M9LA 3EF1A 3SD7A 5AK6A 2I34A 2ZXEA 1NNLA 2FPSA 5AVSA 1Z4NA 1TJ3A 5AKIA 2DQSA 3QUQA 4Y2JA 3L1VA 3WKEA 5ALRA 1LTQA 3EPRA 1TJ4A 3R9KA 5ALDA 2HO4A 2ZBGA 3QU4A 3DDHA 1S8OA 1NF2A 3B9RA 4KNWA 3HLTA 2I33A 3N07A 5AW9A 3W5CA 3QUTA 1U02A 2GHQA 2C88A 1RLMA 4XOUA 5AM4A 5AHXA 1S2OA 3E58A 4OD0A 2I55A 3KD3A 3ED5A 4NFLA 1RMQA 3IJ5A 4G63A 2YJ5A 3DV9A 1RKUA 3FPBA 4YIKA 4Y2QA 1RKVA 1L8OA 3ZW7A 4HAIA 3SKYA
chains in the Genus database with same CATH superfamily
5EIWA 3OZIA 4OXKA 4IVQA 2GLUA 4JBWA 8ICUA 4DWOA 4GYKA 3D2LA 4BWJA 2G6TA 1VPEA 2EBFX 2W4MA 3ZE8A 5GZ3A 3IE1A 1FFAA 1KTVA 2UYHA 3SF8A 3VJKA 2BFWA 3RS9A 3OZRA 4I81A 1EK0A 3BQ2A 4M0UA 3C6KA 4OMUA 2R1TB 1X6IA 2DETA 1ZRMA 2FN9A 1F6WA 3DAYA 1ZVQA 2QRNA 3ET4A 5KNDD 1II8B 3AFHA 1KVQA 2A0WA 1YKGA 2GB4A 4MKFA 5KFJA 3UWMA 3TSWA 3WL5A 4RDIA 4ERXA 4INOA 4BXOB 2QXUA 3GVPA 3KEGA 3RHZA 1YA4A 3FDSA 1D07A 2O2XA 1CDEA 1ZHHA 3EZ9A 3WKDA 1E4EA 4B47A 1YHNA 4Z6EA 2VDJA 4UMFA 5JPIA 3QEMA 3WQQA 2G82A 4F2HA 2NTYC 2HJGA 3VOTA 1PR2A 3CIFA 5TMEA 4QEZA 3H4MA 3U3XA 1LSOA 3AX6A 3GBVA 3CEPB 1YI1A 3INTA 1YS4A 3CPJB 4KNVA 1NXSA 2DCUA 3IE0A 3CY6A 4RX1A 3IMFA 2PAFA 3RB4A 4PTZA 2HW8A 3WSVA 3ZS9A 5CJ2A 1LSJA 1RVV1 2XLCA 3SVLA 3IP3A 1QKJA 3ZTTA 4IMJB 4YAIA 4P93A 4KKVA 5HVNA 3UM9A 3B20A 4IRCA 3A6EA 3CZ4A 1J0EA 5FULA 3L6DA 2WUDA 4NV0A 2HIAA 5DGCA 4QZVA 2IPAB 2AX4A 4F6CA 2H18A 4MP3A 3T12A 1KKMA 1Z73A 3ECCA 5KL1B 3Q7EA 3I12A 4Y6OA 5EWMA 4Z0HO 5JANA 4HX9A 3Q9LA 4B43A 1LV5A 1O54A 2QARB 3TE7A 3AHDA 5SYNA 3K0AA 1CUKA 3V97A 4IM7A 1CQJB 1GT6A 3EXHC 2FW6A 3G9ZA 4ENVA 1FK8A 4AVYA 5DBCA 1Z63A 1P80A 2W6JA 3KHUA 4S04A 1M33A 3H2YA 1P6UA 5CVEA 1CUAA 1GITA 4GKJB 2V7WA 3L8FA 4L72A 1JN3A 1MEEA 1X7GA 3N8HA 5A6VA 2P6PA 2B5OA 3OWOA 4OQEA 3I9V1 1NSFA 1SHLA 2AR9A 1B0AA 3NP7A 3V4OA 2V3VA 3RC9A 4EG5A 2EJTA 4YV7A 3WWYA 3PHCA 1R37A 5L7WA 3E9RA 1JG7A 1UKBA 3NUQA 2WM2A 3HA5A 3EGWA 3K5HA 3LDFA 4LX0A 3GAZA 5CURA 5DMHA 1P7CA 1QP8A 4WZBA 2CJYA 4WOBA 2O8DA 1ZD1A 1BPXA 1W4CA 5JAUA 4YD2A 2V0GA 2G8NA 2EDUA 3PC2A 1CUZA 1YDHA 3IOEA 2G1JA 1TK5A 1HURA 1X80A 3N6VA 2D13A 3AMVA 3DGFC 4UCFA 5A7GA 5T4FA 2XW6A 2BM9A 2NU7A 1HDXA 3GJQA 1D8LA 1SMKA 1YONA 4PY2A 2OENG 2ODTX 2G7ZA 3JQAB 4J4HA 4UHCA 3BB1A 2PD4A 3OOWA 4MVJA 1B74A 2CXPA 3R3YA 1RRCA 3NJRA 3Q5EA 4AKEA 1PFGA 1WDLA 1Y63A 2PBFA 2G9QA 5CX1A 3ER9A 4QAJA 1DQRA 2AJCA 3HBNA 2OK8A 4O4LB 3HA3A 5DHRA 4CF6A 3INGA 2XQFA 2EOAA 3HJHA 4A8PA 4JKOA 1LX6A 2YWBA 2IUUA 1KFCB 2C8VA 1ZQSA 3DZ8A 3UG6A 1SQ5A 3P9CA 4PTYA 3W5IA 3VTZA 4IXTA 1T6ZA 4MWBA 3OHMA 2WF7A 1FJ2A 1GFIA 1NVFA 3L6BA 2WTMA 3A58B 3Q3VA 3MDAA 3QU5A 2UU9B 1ZK1A 3PPWA 4WADA 2JHAA 2I8AA 4UQLA 4PIVA 2XRYA 1DXSA 3RHTA 5CIQA 1G7CA 2QM7A 1L8XA 4R2XA 4A0GA 2HK9A 2ONZA 3G88A 4EJMA 2CE7A 5D4BA 1K1EA 3OCVA 3PK0A 5SZJA 2R8GA 1XGKA 1EFUA 4CMAA 2WABA 2X41A 3U2QA 2B4AA 1JP7A 3DYBA 4YP7A 2JDIA 1Z29A 3Q0EA 5IDVA 4RZ3A 1HZZC 4J29A 2DGDA 1ZP6A 4GC7A 3EA4A 4FMDF 3U44B 3F2VA 4JQOA 5B4TA 5FOVA 3EVBA 2XB4A 4QPPA 4KUHA 1CRXA 2CFTA 3GJ8A 3IJEB 3QBVA 1P2FA 4M9GA 2BGMA 3A9WA 4GP6A 1Y0BA 2KJ9A 4Q8FA 3M6UA 2VO1A 4GGPA 3RFTA 3TJMA 3ZCSA 3MTBA 4G0QA 2BGWA 5FQNA 1HMPA 5LSAA 5AKGA 3DFMA 5HE9A 4EEYA 1NPTO 2ODBA 3AFOA 3QE3A 4Q6WA 2A0UA 4EW6A 2YWHA 3KSZO 4HD8A 3B9BA 3PNBA 2Y05A 1MVNA 4TUYA 4R84A 1QU3A 4B79A 4OO1J 1ONSA 1ENZA 1T1IA 4PCVA 1ZU4A 2G8LA 1XZ8A 2FLVA 4UBOA 4DIEA 1YMUA 3DWIA 1RZVA 3E7PA 2WAAA 4S1TA 2PUEA 4PAWA 4TMWA 4QOSA 3E53A 2Z1NA 1LKYA 2E5LB 1X9GA 3MPOA 1BHJA 4DZZA 1T9GR 2W7OA 4U2DA 2H51A 2G6BA 3E9MA 3TAQA 3TZLA 2PGLA 4O3QA 4BLRA 2OY0A 4DCGA 2A5DA 4WLVA 3LX5A 4DWJA 4YAGA 3EISA 5BWBA 4URFA 1FUUA 1JR3D 3ASYA 4AG5A 1C2TA 4YRPA 1SUDA 3GBSA 4IUCS 4BFLA 3O4GA 1UP6A 1NTOA 4M9XA 2HN9A 1ZMBA 5KNDA 1T0IA 1KSPA 3N2GA 4AJKA 2AXQA 3O8OA 4ZDKA 5ERYA 4ND5A 4AMBA 2SECE 2DKOA 5IRCD 1ECCA 5J2CA 1XZJA 2H2FA 5AM3A 3DKRA 3HSKA 1RLJA 2JFXA 1R6TA 3MA0A 5BN5B 3L6OO 4IO1A 3WLJA 1QDLB 1SKBA 2GM5A 2QG4A 1GYPA 5E6RB 3KSMA 1QYVA 2AUTA 2MMCA 4MH0R 4M49A 5KJEA 4C8LA 1V5GA 3IOYA 4HDMA 1W5TA 2I1VB 3BFVA 1E7SA 2IA5A 2XBLA 4KTVE 4COKA 1U4SA 2XF2A 2HDNB 1MJ5A 5B6JA 1KORA 3LYLA 4RF3A 1PS0A 5JE8A 3PGKA 4D8VA 1NYRA 2OSBA 3K73O 5ITZB 5AVYA 2JGEA 3GZFA 4YCDA 2HBJA 3EDYA 1K5PA 2ZEJA 1HTTA 4B3SB 1EVKA 5TEVA 3VUFA 3F8TA 3NBMA 1E2NA 4UQOA 2FW0A 4FFSA 4YECA 3CZQA 5E8JA 1EIWA 4AZVA 1IG0A 1EDEA 4KAJA 1ZG3A 4JBLA 5A3RA 1ZIOA 1RZUA 2IPLA 1YZQA 3FGZA 3KTOA 5G3ZA 5IVIA 5I7UA 4ED8A 1F38A 1PJCA 3E8MA 4GMDA 2X0EA 3ZCRA 3HVKA 1C1DB 2A0KA 4ASUA 1C1XB 3UPUA 3ZY2A 4IEFB 3HJTA 4KK4A 4EGSA 2C3PA 1RDFA 3H1PA 1FDTA 3S8MA 2ZRDA 4OF4A 2C94A 3ZY5A 1F7VA 4O2BF 2X7XA 4R0MA 5DNEA 4TTQA 1PUJA 1H2BA 5EMHA 3URMA 3E2PA 3NOXA 3MMXA 4W5JA 3CNLA 3KDAA 2OZKA 3GK3A 5DNVA 2FEAA 1ZI6A 2MSDB 2WINI 5ALTA 4F1WA 1DRKA 1LLQA 3GRCA 2CRXA 1W88B 2AFVA 1KQ3A 5JNUA 3FMOB 4KO2S 1UT8A 1E0KA 1OPXA 2EAMA 2D5LA 3ISCA 3TD2A 5T4BA 1PWHA 4JJFA 6AT1A 3MWEB 3AKDA 2NU8B 1QC5A 2QB1A 1X92A 2ORYA 1PJSA 3C5FA 1GLGA 3R7AA 4UAWA 1A04A 1BMFA 1HFKA 4JWTA 4TKUB 3WISA 2P6RA 1QM5A 2BFBA 3L0YA 3P9KA 2PO7A 3LBHA 4EHAA 5L95A 4H18A 2VUTA 2UZAA 5K3AA 2D2EA 1SJ9A 2HGZA 4UOEA 4FVTA 4PVCA 4QM7A 8ICBA 4ODIA 1DQPA 3Q7QA 4B3BA 3PRJA 4HSGA 4TZKA 4KGDA 4TKVA 3BWBA 4EJ2A 3MGKA 5F9NA 5JAMA 3OUTA 4I2BA 4W1SA 4DLAA 4ETNA 2JGMA 2ODEA 2XXAA 1EUCB 1EQAA 3K2IA 3P9RA 1NJSA 1RZTA 2YW9A 4KMMA 4TXNA 1OWOA 5ICFA 3FYUA 1F2VA 2A9KA 4KQEA 4M9QA 3I73A 4YJ2B 4GXKA 5H5JA 4ZTZB 1T94A 4LDNA 4QAQA 5IX8A 1IY1A 4P82A 3C24A 2WC1A 3VTFA 1Q0TA 4M3NA 3K0AB 3IL2A 2CFOA 2J32A 4LF6B 9ICEA 2P8JA 1JQKA 3PFFA 4OIFA 3SYMA 3RYCA 3FCAA 3STYA 1MPTA 3PHJA 4Q47A 4R1LA 2HMWA 4KN6A 2LKYA 5E9AA 5FI0B 4BV8A 3HZHA 3V1MA 2I65A 1GL9B 2NT4A 1MDFA 3F5QA 5CRIA 1B16A 4X20B 3PXGA 3AEKA 3SQXA 1K08A 2EATA 3KB8A 3UJCA 2I76A 4BN5A 3MQ4A 1TM7E 2WTBA 2KE5A 4EM6A 4PS1A 3PDIA 3WXBA 5L3SB 4BTVA 3LDAA 1GM5A 4R8RA 3SYNA 4BLVA 5LWQA 1PZFA 3E48A 4ND2A 1X1TA 4HB4A 2AF4C 3ISBA 4J9QA 2WSMA 2GHTA 3K9QO 1QIGA 1L4HA 1C9YA 1Z82A 4US1R 1HE4A 4N47A 1I9CA 1SXHA 4TTSA 5JYEA 3COJA 4UCWA 1P91A 1I4EB 1Y1SA 1NKTA 1RNLA 1JEEA 1TVKB 2LW7A 1OJ7A 3HE3A 3EVGA 3RLFA 5LDGA 1LUAA 3E23A 1RHJA 4AXXA 4LRUA 4FZVA 4OXYA 3VNQA 2FZ5A 5AJHA 1YZ3A 3NORA 4IL5A 4NARA 1OFIA 3ABZA 2F77X 4NTZA 4P0TA 4R1PA 1KIFA 5C2JB 1U2EA 1JLHA 3FPFA 3NTXA 1FZQA 3OEED 3A4LA 2AF3C 4MJ3A 1HE8B 4B76A 5G41A 2NRXA 4P4OA 2XZOA 4DLUA 5ALEA 1OPRA 1KK2A 4NENB 2ZITA 4E3ZA 1KQGA 5EUBA 1E2HA 5JS8A 3L9WA 3II6X 3T3EA 2C07A 2W71A 4ESEA 3COYA 4RSHA 2VXCA 3RVRA 2CL5A 4IDHA 5C3UA 2D06A 2VUSA 1WZ2A 3MMNA 4JT8A 5L40A 4OY3A 4LDZA 3NS1A 2FR1A 4RZXA 3PDWA 1UJCA 3L1UA 3SAHA 2ZE6A 4OA5A 1C7JA 2QLJA 2NSLA 3ESCA 3HI4A 3RAJA 1W36C 4ZPJA 1Y1PA 1JTEA 4H0FA 1SVUA 2BKVA 3L7BA 4KOAA 5JLJA 2WTUA 1IONA 3O90A 4JBXA 4Q8EA 2JIPA 2UKDA 2ZSHA 2XEDA 5H3LA 3W1EA 4I2NA 4B40A 4O4IB 1TDJA 2XJ4A 5B4VA 7ICUA 1ZYQA 3EQ6A 4LBWA 5ANRB 4MPDA 1VYHA 2QLLA 1ESCA 2Z3ZA 4ZOHC 1CVIA 8ICPA 1C30A 4WFQA 4BNVA 1HNZB 4YLYA 5IMBA 5FOSA 4QVKA 2CVOA 3FI9A 3V7WA 1L7PA 3OJ0A 3D81A 1W4RA 3EA5A 2Z43A 4OHXA 2OXTA 1V8BA 4BMVA 4ESVA 2IYNA 4R01A 3THSA 3GLHE 1U80A 4UB4A 3I2YX 3W7VA 3GDXA 2OFPA 3RM3A 2YQ4A 9ICMA 2JFFA 4G5GA 5FFNA 4KXMA 4LC0A 5FQOA 5BSMA 1MFPA 5AI8A 2YUTA 4KQFA 5EY5B 2PXCA 5D1NA 4HC4A 5K3CA 4E5UA 1N2EA 3Q4GA 3CLRD 4HWRA 2BEWA 4OQLA 4LHSA 1YBMA 4DSIA 3BREA 4YUZA 5KFCA 3LG2A 5CLHA 3CNBA 5DI3B 1P73A 1KAMA 3RO7A 1T3NA 3ZU5A 3FPLA 1Z4PX 2GKOA 2AGQA 2PMZF 1BA2A 2FHPA 1FNBA 2PH1A 4DBLC 4MW5A 3PGJA 1V7CA 2FKNA 2C1EA 2Z1DA 4LA4A 4R68A 4ASUD 4BNXA 5J1SB 2QX6A 1F8YA 5JU6A 1U2ZA 2C9MA 3WJ7A 3OQMA 4LDQA 5AK6A 4IQWA 2IHTA 3E1GA 4WNCA 1MCZA 3DXYA 1NV9A 1ZXBA 1MAHA 2H8GA 2EWVA 2YASA 4HJXA 4NEHB 4YRQA 5CLJA 1U4NA 5IBPA 2H11A 4Y2HA 3OTIA 3OT1A 2ODGA 2Z8XA 4RTLA 3AKZA 3MHTA 1ZQGA 2BBOA 4IRDA 2X58A 4O4HF 2J0UB 3KUDA 3YASA 3ZZTA 4IKEA 5A04A 1U2GA 1JQLB 2QUKA 1V5FA 1RHRA 4QPZA 4ZXPA 3RAFC 3RH5A 4P7BA 3SYZA 1OGYA 3K71B 3ZYCA 2WYOA 2H1OA 1Z0KA 2QGFA 2XCAA 1NJ6A 4IGEA 3LC1O 3KR0A 1F4VA 3N2LA 4JVOA 4I3GA 1SIWA 1H69A 2BE7A 4ZREA 4EO9A 4RQAA 1SFRA 3AQ4A 3W5CA 1ZVKA 1LI5A 2PUWA 2DR2A 3FTDA 3H65A 2QD2A 3U61B 4ISBA 2G72A 1DRUA 5C8YF 1SCBA 3AUOA 4BLPA 2X19A 5DYWA 4E09A 5IVHA 4ND7A 3CR7A 2C3OA 4BNZA 2PRKA 1MO4A 1X1AA 1RJ9A 5AWFC 3O83A 5K0TA 4TWIA 5DNDA 4B9SA 1FNCA 4RWEA 4TLDA 5EYPB 4FYIA 4QO8A 1XTZA 2QV7A 1KTQA 4L75A 4FMPA 2PFPA 4C76A 2PX0A 5KWIA 1Q1BA 4GUDA 3ZXIA 2V5AA 2ZSEA 4WCFC 1SXJA 5ECDA 3VYTB 3MZ0A 4P4TA 3TNYA 3S70A 1ABBA 1PVVA 1GGJA 4OQ4A 3R7NA 5F9MA 4LF9B 3GHYA 1VQ1A 3I37X 5T57A 1BFDA 1N1MA 1PU2A 4XX0A 4A2QA 3MMPA 3G2PA 2KI5A 3FPCA 3K6JA 5IIIA 1GL6A 1OLSB 4BWVA 2XB2A 1J0AA 1IWPB 2IE8A 4MWZA 1ISFA 3D7NA 5TS2A 2WAOA 5C3MA 3MEQA 3IDFA 1BE1A 2VCEA 4ZT6A 2RRDA 2W4QA 3HJNA 3MGBA 3PIRA 1QTIA 1U3CA 4C4XA 4ZDWA 3W04A 1NVDA 2IW1A 3DTVA 3I92A 2R00C 3FWYA 4J7AA 1DCFA 3NDPA 4LZGA 1ST2A 3RVBA 4EUNA 4HRXA 1XQ9A 2QN1A 1ZQLA 3M6VA 4INAA 4RO0A 5DBEX 1H4TA 1DJOA 1NR7A 5KVQA 3MWLA 3VR0A 1P0PA 4AYTA 2RAVA 1WXGA 1Z18A 1T91A 1XCGB 3HN2A 3Q6MA 4B7UA 5AESA 1SXJE 1X7XA 4LVUA 2NYVA 2AGOA 2W11A 1TE2A 1MIOB 5BYBA 2CXTA 3TS1A 1YJXA 2IU3A 3MD9A 4E2XA 1R5JA 3ZGYA 1XTVA 2J3HA 1E3IA 5BP7A 4U6SA 3D6TB 1W8DA 4Y67A 1XXHA 5LUBA 2X0KA 1HPLA 2H5JA 4RQMA 4ER5A 4F4HA 1OIVA 5CYPA 1W0CA 3DB2A 2C2HA 2FPWA 2R84A 4J9UE 5H9VA 2ICAA 3A7DA 3N2KB 4FDAA 1RXVA 3GPCA 1SA0B 1W29A 1UHUA 3HJAA 4FSDA 1ODSA 3WP0A 5DB4A 3TMYA 5EG5A 1WOMA 2B82A 2AYYA 4DIDA 4PZYA 5BN1A 2YV4A 2IYUA 5AM1A 1PR3A 2IV2X 2XOKD 4A6PA 3UQYS 2O06A 4MGKR 1KY3A 1PX2A 2PGDA 1N92A 4ON9A 4E51A 1G38A 3NR2A 3LCJA 1ZIDA 3AUYA 3ORSA 4JD5A 1IBMB 3B0XA 3MWFA 2HMTA 5H16A 3U3OA 4AF8A 1M1UA 2HCFA 1G21B 1NOIA 4B8YA 4EKEA 1TTPB 1EVLA 2Z6UA 2ON6A 4ALLA 1FSPA 2XIJA 4NICA 4TXMA 2ZYWX 3LCCA 1M8PA 5EWJB 3SHOA 3UH1A 3RAXA 1RHKA 1PGPA 3OZXA 5CEFA 4MWOA 1XD2B 4H17A 2AKEA 3JXEA 5FWYA 2MHCA 4U5XA 4QUJA 5DMXA 5J1TB 1OMOA 4EY7A 1LLUA 1YZLA 2WA2A 1ECJA 3G1TA 1ACLA 2FWMX 3HO6A 3LO8A 4QUIA 4W5HA 4QUGA 4BBZA 4F38A 3ENWA 4QXQA 4JB8A 4I55F 4EBDA 4MK4A 2R4UA 2JGKA 2G0AA 2R25B 4U5QA 5MN6A 1E6KA 1NMQA 4C8MA 3UJDA 1VMAA 3ZHOA 4GD3Q 2HQBA 2PX4A 1OTXA 1Y3AA 4JQCA 2B69A 3RIEA 3SR4A 4CMHA 2REOA 2VRBA 1XTJA 1L3IA 3T5GA 2NPOA 2CPRA 3BSFA 4CM9A 4J0GA 2XQIA 1SWWA 3KXPA 1BXRB 1DB3A 5I7HA 1BVYF 2BI4A 2Y9PB 3PI6A 2EH9A 1BZYA 2WHPB 2ZJZA 4LWPA 1PGQA 2EGGA 3QVTA 4L08A 4D9GA 3R4CA 2QM0A 5KFHA 2QVBA 3A6FA 4X6UA 5KWSA 4RNMA 3OAAA 4MB0A 2ZQYA 3WWPA 1US8B 2C54A 4KFRA 5DDMA 2EFHB 4WKOA 5BV7A 4K8RB 4JWNA 4ZEXA 1S3SA 3OPYA 1VDVA 4C7JA 5CX1B 2WHEA 4CODB 6GPBA 4X62B 1U0TA 1OIWA 2ODAA 4KU4A 3IIEA 5HGXA 4EFMA 1Z7EA 1GTJ1 1YGPA 4FC7A 4N4AA 5FBWB 1E3WB 1U3TA 5G5HA 2VDWA 3GARA 4LE0A 5FBRB 3HUDA 3HDQA 4HNGA 3GJ6A 3RUDA 1U81A 4HUQA 4X8LA 3GMIA 3ZXXA 1XTBA 3GGCA 3PFNA 5F9LA 4A0QA 2WQ7A 1DFIA 4XGIA 1BMTA 3COZA 4HXFB 1WG8A 2NAPA 4C6TA 1UXGA 5KQSA 3WZMA 1MRNA 2BQUA 2NVBA 2ST1A 5F3DA 5ICMA 1LNSA 1U48A 5F1PA 2X0DA 5J43A 3ILVA 3JZMA 4IEEA 4MQBA 3GPLA 1LLFA 4LYYA 2CB9A 4MVJD 4X85A 1N4AA 3WGOA 5ILOA 3RUIA 4INPA 4O4IF 3UFXB 1Q22A 3ASVA 3AYZB 1EAMA 3O2JA 5HILA 2GPYA 1OH6A 2A5YB 1P9LA 4EPRA 4NKRA 3E81A 5IJXA 3A6PC 3DLCA 4LMPA 3H99A 4PICA 3TADC 1E9CA 1ND5A 1ESEA 3F8SA 4LXTA 1YBVA 4RE5A 5K8LA 5C5IA 2YKGA 3RABA 4A8HA 2P3LA 3CLUC 1AUPA 2QGZA 4K5QA 1RXUA 1WUIS 4TKLA 1VOTA 3GD5A 5JCPA 1ZGZA 1VGQA 3PTLA 2QYTA 4CIYA 4CCAA 1KE2A 3E5HA 2PV7A 3F9CA 5LUAA 3RBEA 3JQBC 2JGLA 1W0JA 4G0YA 4NCJA 4OGKA 1HC7A 4RACA 3VC3A 1F2TB 5KBYA 3BL6A 4IY1A 1IBLB 2C4VA 1A1VA 3JZAA 3BXFA 3ZNPA 3MHPA 5HSGA 3UXHA 4ABTA 4DBZA 2UXCB 3LPMA 4PBSA 1AC5A 1NUUA 2GKSA 2IF0A 3LPAA 4MTCA 4LSZA 3OPYI 5ENDA 3IV7A 3C28A 2RGEA 3RJEA 1XPUA 3H9UA 1NWCA 1TO6A 4FOSA 4YRJA 1E94E 3ICVA 2DZDA 1Z34A 5JBNA 4LJ4A 3HVJA 1EK1A 1ZD9A 1ZINA 4EPXA 2FDXA 1I3NA 2DUNA 4GXQA 4M22A 1YRWA 1RMYA 2QYHA 4EY3A 1PFQA 3DHNA 2C1XA 4N5HX 4ZYXA 4MHTA 4KRFA 5GVRA 3DEFA 3JY6A 3QV2A 5BNFA 1PIWA 4FEEA 5JXJA 4YRSA 3RJZA 5FPSA 3RBDA 2XCUA 5JD3A 2ZVJA 3DYIA 3K0SA 5DDYA 1N8SA 4XGNA 1M8FA 1UMCA 5JR3A 4GEGA 2Y9TA 2FB9A 2G9ZA 4FC6A 2HSWA 2W6IA 1MMFB 1IOVA 1ESNA 2D0PB 1EQ2A 4MUFA 3ZXSA 2QTRA 4PHAA 1SVKA 3BJZA 3RRBA 2REBA 4H60A 1JIHA 3VH4A 4MRSA 5HDBB 2CZCA 1JDJA 2JCYA 4OM7A 1Y6JA 2B34A 4QECA 4NOMA 4BO9A 4AAYA 1DC6A 2B25A 1KN5A 3TTVA 4GRDA 5CYOA 2FMTA 5CCDA 5B7PA 2QP4A 4HGPA 3W2HA 1GRRA 1VE5A 1ZW6A 5ESRA 2HCRA 3CZCA 1L7MA 1Q6YA 2C96A 1E2JA 2HXSA 4K6OA 4EYGA 2H31A 1I2BA 1QGOA 1UDCA 2ECKA 3E9DA 4UE6A 4IWNA 5C7IO 3V6MA 2H65A 1I2ZA 1QE3A 2NW6A 3DBLB 1OIXA 3KQUA 5L4NA 3BHIA 2BUCA 1ORRA 4GOMD 4DLGA 2JKYA 3KXDA 3C6MA 1Z4QA 3C0KA 5EIXA 5JJLA 1BC5A 4ZVLA 4LVOA 3BCSA 4O2AB 5AVJA 5IJ9A 3GLGB 2BR4A 2RDIA 2UVWA 4E7OA 5AI0A 2P9YA 1DI0A 5KVVA 2AD1A 2RIRA 3GNTA 5E3JA 2QJFA 3FCOA 1D8AA 1OLSA 1S0NA 2MR6A 2NVOA 3C5VA 2GCEA 2P40A 2Q8NA 3C1AA 3ICWA 4JR0A 5HKOA 5KOHA 2QR2A 4A0HA 2VLIA 3EXG2 3W3AD 1P2BA 2B8WA 4MPJA 1GYRA 2V54A 4CMEA 4CV1A 4YXWA 4NVRA 3LBIA 5C4MA 1JLSA 1I7PA 3ISTA 3LRPA 1RAHA 1V11A 3OJFA 3HWWA 3BRQA 4EG3A 4KQ1A 1PLKA 5C18A 5DTEA 5G0TA 3UWKA 4C3VA 5H9WA 4ZHQB 4IOJA 1OFVA 3AH8A 2R48A 4KK3A 4EEKA 1E6LA 5TARA 5U1PA 3HKDA 2ZSAA 3DEAA 2BR0A 1P2GA 3ZJYA 1G8HA 4B3IA 1ZGGA 5IP5A 4UJ5A 4QX6A 2F4VB 3OIDA 2BDUA 2K8BB 2H7CA 3VGPA 1SD1A 1K7SN 4UM9B 3VKHA 1CNMA 1DIBA 3MABA 1Y7HA 1EWQA 2ZR7A 4MGEA 4JUCA 4EECA 1GKIA 1KFJB 2IJGX 4JY7A 4I7EA 5DN6D 3AJEA 1KEKA 2QB0A 3C8HA 3IO3A 4QUDA 1HLGA 5JUWA 4KO1S 4YP0A 4JC8A 3RRMA 1D1SA 2VN8A 1ETHA 5G4KB 2KBFA 2LYHA 2Q0XA 1A9XA 3AL0C 4YB8A 2FKAA 4L2IB 5T3YA 4WBNA 1PEKE 5BSFA 4QOHA 5DSZA 4P83A 2ERXA 1UPHA 2ZOSA 1QIJA 4MR8A 2HGSA 1DHTA 4S1VA 3OA2A 1CEZA 3PQ6A 4XPIA 3OP1A 3IQGX 2V74B 4FLMA 4NJMB 4PGAA 4GPBA 4V0SA 3T4EA 1H1LB 9ICUA 3PHGA 1JDPA 3AESA 3L49A 1ZMXA 1JFLA 4JT4A 1YZNA 3VI3B 4S35A 1XVLA 4OOEA 3GP8A 5BN3A 3VSAA 4W1PA 4UHBA 3IAM6 1K8RA 2OYSA 2ORED 2Q1WA 3FRIA 3MMSA 1IN5A 1P2SA 1QR2A 1SXDA 2OCGA 3QA3E 2ZUDA 1RPLA 2BYTA 2IEDA 4NP6A 4Y2XA 2KP7A 3F5EA 1J90A 2CHEA 4V2UA 2P30A 3HCBA 4BMCA 3NJ8A 3OIWA 3N3AC 4MRMB 1P2VA 4F85A 1Z5OA 4E33A 4RQ3A 4XOIA 3SQDA 2PSSA 1E7YA 1NULA 4BX0A 4HLUA 3HUEA 2YC2C 5K6AC 2FV8A 3RJ5A 1DOAA 1NDHA 2FW1A 3LQ1A 2J45A 3P20A 5T6MA 3TL2A 5IS2A 3AXTA 4RV9A 5IC4A 2QENA 1SXEA 2GD2A 4AMUA 4YUWA 3G59A 4RQUA 4OYYA 2KW5A 5FRDA 2HMVA 4BHTA 4C7YA 1MJNA 1E9RA 2PZFA 4I4CA 5KWEA 2E37A 4DNOA 1ZIYA 2P4SA 1GHTA 2VTVA 4X92A 3ZH9B 5JALA 1QFXA 3MIIA 5AI4A 1KI2A 1XJQA 2C5AA 4UPEA 2BEUA 3OPXA 2IQ5A 2W48A 4M86A 4QL3A 5TB5A 3O8RA 4DV6B 4F3NA 2VHXA 4RZQA 4YQZA 3O0TA 5F23A 2W7PA 1NSTA 1PS8A 4Q1AA 3EWAA 1D2MA 4UHHA 5CUQA 3W0LB 5DP1A 5B1SA 3DF7A 1F0PA 5DOVA 1R5NA 3SN6A 3B1FA 2VTBA 4RGYA 1FLDA 3CUKA 2V98A 3ZDQA 3S2SA 2G9RA 2NACA 5E3HA 4C78A 2NN3C 1R88A 4KR2A 1UJ6A 3DAOA 3FVWA 4Y0VA 3HKCB 1KLNA 3MJTA 1ORIA 3H4IA 2JRCA 3HY4A 4H3VA 4IGFA 4RVOA 4ZI7F 5JV5A 5JMWA 2J3DA 4CMKA 5DLFA 3FKSD 2PZJA 4QBKA 2O0HA 3MFYA 4YAFA 5DW0A 5IARA 4XIJA 5EUCA 3WDKA 1XDSA 1SQ0A 2FPRA 4MEXA 1JRLA 2RHWA 3DV0A 3U26A 3DVAB 3T7AA 1SHJA 1ONOA 3UK2A 1GG5A 1CEQA 3MT7A 3PPXA 5K6AA 4H59A 1OXVA 4QOGA 3KG2A 4RK5A 5CBKA 1C3EA 4UNQA 3QMWA 1IB0A 2AMYA 2GHRA 4HDSA 3E5NA 1ZJ5A 3KKQA 1HUZA 4H1VA 1RWNA 4TT8A 3ZE7A 4CLEA 1DHRA 4KKXB 3OTHA 4V1CA 3B1YA 1DBIA 3LKZA 2TMGA 1AIPA 2QLFA 2JIZD 5HHIA 3KKKA 3FETA 1B8NA 2POCA 2W58A 3BX1A 5BYJA 4IL6U 1I3KA 1UEJA 2BMWA 1J2YA 5IAEA 5HJ7A 2EKBA 4UATA 3QHAA 4AYXA 2UUPA 3IPRA 3A11A 2VDUE 4R81A 5LXTF 3SQNA 5BW8A 2AFHB 1LBSA 5JJKA 4BXOA 1D0IA 4OI2A 4RZHA 2P0YA 2QQGA 4PGMA 1M7BA 4XTRA 5J9FA 2IKQA 1GR1A 2Y77A 3CWCA 4UJ3A 2HCBA 3F6YA 3ZH2A 1NKVA 3BXEA 3Q3JB 4RH0A 1QK5A 2ZREA 2RAPA 4H7EA 2HRQA 4KMUA 4EYIB 2J4DA 3HCCA 4NYMR 4OKIA 3EF1A 3ZZUA 2I34A 5J2FA 3TQ1A 1JXEA 3EUFA 1SK8A 1P74A 7ICMA 1PYGA 2GRUA 1M5UA 1EG7A 1K6MA 1V25A 2X0JA 2WOOA 4S2UA 2B94A 1G8JA 5LP6F 4K6GA 2O7SA 1NG1A 3JQQA 3QBDA 1M2FA 4QNRA 2BRUA 2VUHB 2JZNA 5HR5A 1TJNA 3WHIA 2E8OA 4ZVVA 5D7NA 1A96A 4ZODA 4BP3A 1N77A 2K8AA 3KWMA 1PV1A 1D0SA 3QPCA 1WBBA 4D9BA 2BMVA 1KQNA 1UWLA 2HLDA 4YUYA 1Y8ZA 5F5LA 4BO6A 3NRWA 3GH3A 5AW9A 3TCXB 1YU6A 3K9BA 3P94A 1E5VA 3HWTA 3A9CA 3S2UA 3KVNA 1DC3A 1P1HA 2I4RA 2WZQA 2YVLA 4RKWA 4DAEA 1T0HB 1H2HA 4URZR 621PA 5KNCH 1UKZA 2DR0A 3NVYA 1XTUA 3ZE9A 4JLKA 1X7WB 3M6ZA 4OFXA 1QB8A 2P4HX 4H1TA 5KU1A 2WSSA 4K05A 5JQWA 4F93B 1DQYA 3LUCA 5FWXB 1Z9BA 2Z9DA 1U7UA 2I55A 1MABB 2J5BA 2XWPA 5B1IA 3LYSA 4DB2A 3PMLA 1ACJA 3CLVA 4YV2A 3SC3A 1T2CA 2R8KA 4MQEA 1MJHA 1MX3A 1OFGA 1QS0B 3NGMA 1RKUA 2NMVA 1T1GA 1X1SA 2J0EA 4ZAGA 4EYKA 5CVCA 4CMGA 4Y2QA 1M6VB 4C3ZA 4Q4CA 5HJ5A 2NSDA 4EFKA 4MICA 2JLYA 3MVEA 5FXMA 2Z30A 4CM3A 1XPRA 3GPBA 4LJ6A 3BQ7A 3ZLTA 1QU2A 2WYVA 1X80B 5JCOC 3PEWA 4N3NA 3F6RA 3KJXA 4EGAA 3NC0C 1M0SA 2BCSA 2AQIA 2OV4A 3M6XA 4YMWA 4UD6A 8ABPA 4A23A 2O9JA 3QVLA 4BE9A 2I62A 4DDMA 3DONA 4TMZA 1E5LA 3LHIA 3ST7A 2Q3JA 3IUBA 1Z19A 1T5SA 3NX4A 3RVSA 3V1NA 4YT8A 4NSNA 4EEZA 4DADA 1MLDA 1DWQA 4LDAA 4HQNA 5C1BA 1PZEA 3GXOA 3FMPB 3K8QA 1OLXB 3TARA 1CJMA 4YJKA 3AQFA 4P80A 1QQ7A 1KAQA 4GE3A 3KXLA 4UTZA 5DRTA 4IQGA 1JA0A 3TNJA 2KLBA 1Y8AA 2B3TA 2OOSA 3BTVA 4RVNA 2FXIA 3ZWDA 4TTTS 5IKOA 2B7LA 3D6AA 3P4XA 4IIJA 4RKRA 1MIOA 1UKCA 4BRWA 4O25A 4C29A 4UUOA 1E0AA 3AINA 2GF2A 2XD4A 1AU9A 3D7KA 2AZ4A 4XVRA 2JATA 1OX4A 3L1IA 4QIHA 4DG8A 1P2DA 2FSUA 1UM9A 3NO4A 3UCFA 3NAMA 3ZD9A 4IHJA 4RK7A 1Q77A 2VWGA 1OXSC 3DOOA 4RLHA 4C5BA 2LXNA 4ZT2A 3GJ3A 4CU5A 4MA0A 5LP6B 4HYQA 1RZRD 4KLZA 2YMPA 3A28A 1WMFA 1LRKA 4TPKA 5CB4F 1H23A 3HI6A 5F2OA 2H16A 4Q05A 2LTAA 4B09A 1LU9A 2O3QA 4JYPA 4N0PA 4Q7LA 4DMHA 1N62A 1G8MA 4NLBA 1O2DA 2BFCA 2JGNA 4X5OA 2XO7A 2H29A 2WFZA 1QRTA 4NI5A 2AB0A 2EFGA 2XT9A 2C2BA 5E95A 5KJCA 4IIEA 4BZQA 3FIJA 3KZIU 3QUBA 4PSKA 4PYNA 3VJRA 1OWLA 4OH1A 4WN3A 4OL9A 5FLYA 1OV4A 2POQX 3DMTA 3F78A 5TV2A 1N75A 3IUQA 3PNMA 4E21A 5JJIA 4MGIR 5ER9A 4MA5A 3L4JA 1C20A 2JFBA 3RS2A 3S81A 5LA6B 3K92A 5HW0A 3O1JC 4PIMA 3X43A 5LL6P 1ZOIA 2WIKA 3R44A 5K7SA 3ZG6A 5EA2A 4DR5B 3T7JA 3OQNA 1Z2DA 1QBGA 4A2PA 1P7VA 2HF9A 3MCVA 1QIHA 4HI0E 4LRXA 4PC3A 1MJGA 4LBYA 1FFYA 5KAPA 5HIKA 1UKAA 1T24A 2DUWA 1GGNA 1QVAA 3OQPA 3QOFA 5LJIA 5LZ4A 5SYMA 5I4BA 2RC5A 3UWSA 2ES4A 3WJ2A 4EZ6A 4KE6A 1W5FA 1J09A 2A86A 4ZQEA 1TU4A 1PD0A 2BFDA 2PX2A 2W93A 2NXCA 3EBOA 4HNRA 1WVIA 5COQA 1YIAA 2LNDA 2RKWA 2YJ6A 4OHCA 3ORYA 3EJ6A 1Y7IA 2WF8A 1LS1A 3E82A 3QKIA 1SVNA 1VRVA 1Y3FE 4WOCA 4GNRA 4BFXA 5B55A 2GLXA 3BGIA 1MEJA 1RBMA 3D3JA 2QY9A 3KKOA 3PYXA 4RGQA 5DU2A 4BDTA 4BKOA 4EHNA 4X6YA 3GXBA 3QKSB 4QWDA 3OM1A 4BPRA 2WZCA 3MTJA 4D3FA 2YWFA 4DLEA 1QX4A 3OCXA 1L5VA 3KQQA 3T5MA 3FZNA 1DFHA 3IN5A 3HLKA 1A2KC 4N54A 2HX1A 1U9LA 3SPXA 1CS0B 1THGA 3LSTA 4P0PB 1QHYA 1U8EA 3JQPA 3MJFA 1J8DA 5GONA 3CO5A 3SSMA 4P5EA 4DR7B 5H0IA 2EJVA 4I66A 1I32A 2I9GA 3WK4A 3O1HB 3Q3EA 2EZ9A 1XBTA 3M3PA 1O95D 1IOWA 4HUQB 1W96A 4CDNA 1U1GA 2E48A 4EKIA 1JWBB 3ZI4A 3EG9B 3QI7A 4YPOA 1VLQA 3WLHA 2F43B 3A06A 3R9XA 1R6AA 3ZVRA 4D4KA 3WNDA 1X1BA 2HHQA 4MV7A 3ADDA 5EXXA 2VQSA 1RBQA 4JQYA 3HU1A 3RRGA 2DSNA 5IUKC 4LG1A 4ANFA 2Q5IA 4LAFA 1RYZA 3CNOA 3GFSA 5E38A 1DARA 1GCAA 3OUUA 3B12A 4I2EA 3KEMA 5ER6A 5J58A 2CVFA 3REFA 2R65A 1H93A 1D1PA 4D46A 5DZSA 5KQPA 3FLAA 1V7PC 3H9QA 1A9OA 1NBAA 1N3IA 4TRJA 3LCMA 1VYUA 1UBUS 3KQHA 2IBSA 4DOBA 2ZWAA 4UEWA 1NBIA 3G6XA 4B17A 1J33A 1OOEA 4IINA 4IEIA 3SLRA 4E3WA 1K89A 3GUCA 3HR7A 3FWHA 1UWVA 3VDXA 1RYRA 4QXOA 4Q7QA 1N25A 1N5DA 5AK0A 3CG0A 5KX5A 3O94A 3OPVA 1FLAA 3E15A 1V1JA 4N0DA 3GLIA 4K40A 3H42B 1JYSA 3HZOA 4XFKA 4BJ5A 1IRXA 4CE6A 1OTYA 5TGTA 1G8PA 3MNFA 4LJKA 4QW8A 3QJYA 1T3ZA 4ZIRB 5IYZA 3HG7A 4O2RA 1TOAA 1QK3A 2FMKA 5JSYA 2LPEA 2VSNA 4QQ8A 2MSEB 1TYDE 1Y1RA 4HN9A 4OHMA 3EK2A 2JIOA 3FCCA 3H11B 3HU2A 4GOOD 3ESXA 1EBBA 4I5EA 4G5OA 1SC3A 3CRQA 1YQWA 4LVNA 4LZZA 1SRQA 1JKJA 3T3FA 1NASA 1WB5A 2AW5A 1BFUA 2KD1A 1BHSA 3A3YA 3I39X 2ZDHA 3NHJA 3QMPA 3QY9A 4DFJA 4FS8A 5FTKA 4H16A 1JJIA 3E84A 4MP6A 3D8TA 2EERA 2E8MA 1KU0A 1O89A 1YXMA 2RHOA 4FJ0A 3HK2A 2HSZA 2XKKA 1CZUA 4CMJA 4E5KA 5LWHA 3SWWA 3SP1A 2NVUB 1JAZA 3O8QA 4QDJA 1Q16A 3I2HA 3HX0A 1L9XA 4EO7A 1E6CA 2PKWA 2VYFA 1Y7PA 3MCWA 3UXYA 1VLLA 1CUUA 2VZ0A 4LWOA 4S0XA 2K60A 1AXRA 1FXSA 1I5OA 1M2VA 2PA0A 2PE5A 1EP2B 3FRJA 4FBMA 2ADOA 3P2YA 2OG2A 2DUMA 3MF4A 5AXAA 1BFKA 2M1XA 3OFVA 3TDKA 3D64A 1VPWA 4M83A 2PHZA 1PZHA 4CTNA 1A82A 2YBDA 3KEFA 3RVLA 4JCCA 5K0JA 3DE3X 5FT9A 3NWPA 4ZVMA 3ZU2A 3DHWC 3P0HA 4PYMA 1D2GA 4TMFA 1T2NA 2QAGC 4FR5A 4HEA1 3CCBA 3AB7A 5CVUA 2IYRA 3GJTA 2P6UA 2PLAA 4LOIA 4DOCA 1VLVA 3MB8A 3KTFA 1J1UA 1QHHB 3H8MA 4LNUB 3ZLVA 3THVA 1ZD3A 4DXDA 1RYUA 3HB0A 3IVCA 2OBLA 3KL2A 4NH0A 2C3UA 2VNIA 3LA6A 3DLPX 4BLWA 3QVGB 2C4MA 2C9YA 2LBOA 3Q5DA 1YMQA 2QRLA 1NUAA 2W5UA 3JWIA 3LQYA 3C4JA 4JIMA 4O8CA 1BW9B 1JEAA 3L40A 4RWZA 3KQTA 2OYCA 2H3IA 2F8TA 3C8ZA 5DKFA 4BQRA 2F1IA 2F9LA 3SX4A 1QO9A 2QUJA 5FOQA 4MWEA 3W9BA 2BEKA 1AQLA 3V3TA 5LYJA 1GUYA 1JGTA 1Z88A 1GZSA 2FZ4A 4LHVA 4RDCA 2CDNA 2O6HA 1XLVA 1HSZA 3NIBA 4HDAA 2O5EA 1K7EB 4BU1A 1YVPA 1AK2A 2AFRA 3ICCA 1JLLB 3F6BX 1ZQ9A 4QC2A 3H0CA 5IXSA 1VJDA 4JI5B 3OZCA 3RFAA 2YICA 4MQFB 4RD0A 5ALMA 4DB4A 1IN7A 4JOCA 1KQOA 3ZV3A 4AJ9A 1NNEA 2KBEA 3E9NA 4D0GA 2OUKA 5AJUA 1JPNA 3JPQA 3B5JA 4GSYA 4PANA 5HS6A 3ME5A 4PPYA 5EKXA 1BOFA 1BWPA 2CL0X 2ZCUA 4MP8A 2G63A 5GAJA 1EXWA 2P5SA 4Q34A 4UVDA 1JSXA 3QMMA 1HRKA 2OCXA 4ND8B 3SBOA 4ENUA 2Y1IA 1VL6A 4G56A 4UE3S 4PXYA 2BCJQ 1S1MA 3D6HA 2ALZA 4LMAA 5CK4A 5DLEA 1T8EA 1XPJA 1HGXA 3GT3A 1GNTA 1Z36A 2D3WA 1ZCBA 3ZW8A 1G0NA 5IK2D 4JBNA 3VDQA 1CEXA 2NO0A 2WM9B 3FMFA 3ZK7A 4NBNA 1N4DA 4Q6BA 4ZV9A 4CKBB 5BUZA 1UPTA 2ACVA 4X93A 1NU6A 1UM9B 3LOUA 1O8CA 5LZ5A 4N01A 2DRIA 4IHJB 4Z3DA 4DJEC 3K1TA 4OQQA 3CH7A 5J2DA 2Y9MB 3Q8PB 3IP1A 4O4JF 1G66A 1ODCA 2WSSD 4B7CA 2GD6A 2W8BA 4QXAA 3T4XA 3THOA 1DXHA 1F8GA 3GVCA 4R64A 3CRXA 1O9BA 5CLGA 2NUTA 1SVLA 5HG0A 4KH0A 2JF0A 1FVHA 2TYSB 3PG5A 4U7CA 4YALA 5HFJA 5JZBA 3L06A 1QH9A 3K70B 4KO8A 5FO0A 3G5TA 4WZAE 4JOBA 4KLFA 4IHAA 4L7VA 4ALKA 4BCDA 3T5DA 5JC8A 1F0KA 3VOSA 5JXGA 4E70A 1DADA 4V2IA 2UAGA 5J63A 4Y0NA 3TW0A 1J8QA 1EWVA 3EJWA 3HO1A 4KN5A 4RQ1A 3CUSA 2KOBA 4CF5A 3SBEA 1BIFA 1V8FA 2I9KA 4ML3A 1A69A 1OLOA 1N57A 2O05A 4OH7A 4R31A 1JKMA 3ZE2B 4ESOA 5I3CA 3TVYA 2EL7A 2FRVA 2QRZA 3F7NA 4QFBA 1IPEA 4R6WA 5LB4A 4C7VA 4F4UA 4IIBA 2CLCX 4PAMA 1C8BA 3LO5A 4Z7NB 4RTRA 2W8LA 5FBQB 2VNKA 3FCUB 1FTSA 1MHPA 4JQZA 1A71A 2OEHA 1N6KA 2IGBA 3KLBA 4M55A 4XRRA 4ZRDA 3R7WB 3I5XA 1RCUA 2AHRA 2J6CA 4IF6A 9ICCA 1UPXA 2NSYA 1U9CA 2AFIB 1Z8HA 1U2DC 4W8OA 3T35A 2C03A 5KSZA 1NKCA 5KYXB 3W06A 3ITEA 1DELA 5DO9A 4DWVA 4PR3A 1DS6A 4Y9RA 2YWXA 1DX4A 4YP9A 3C85A 4LJAA 4RIHA 2K8CB 5AIAA 1WDTA 2F4NA 1CR0A 1U11A 1U5BA 3BH0A 4GM0A 3VPSA 1M1ZA 4N40A 5DIZA 1JEYA 1IZ8A 1NW6A 5AM2A 1OGJA 1XMXA 2V97A 5EJFA 3PHLA 4CQMD 2F9MA 3K0HA 5JNTA 1UXKA 5GTHU 4Y3UA 1O97C 2Q7XA 3LBFA 2NM0A 1MH9A 1FXWA 5J0UA 1JG4A 3JQAA 2ZETA 3A27A 1ZIPA 1T9ZA 8AT1A 4ERNA 3UJNA 3JQCA 4G67A 5CNJA 4PG8A 3PCRB 2CYAA 3CINA 4Z99A 4BP9A 3RSOA 1OWPA 1HYEA 3KJHA 1IWBB 4FMCB 4EPVA 1G16A 4P2BA 2QZSA 2GDZA 2SKDA 1X66A 3RCBA 3WSTA 1NVVR 4EBEA 5JZSA 1W36B 1D5WA 2Z1MA 2IXDA 3NIWA 1KVUA 3DZHA 3KVRA 4N7RA 4NRDA 5EHXA 2AZTA 3FUXA 1X3LA 3GI1A 4HP8A 4NCKA 4WNYA 4RM3A 1TT5A 3M82A 2A0YA 3GWGA 3LOPA 4C4RA 4YRGA 4RVFA 2D2XA 3CLTC 5D7BA 2QYSA 1F2DA 2UDPA 1KF0A 4NBVA 4IAOA 4DPLA 1E3MA 5IDWA 2O8FB 1E1RA 4EX7A 1PG5A 5KQGA 5IAOA 4PZ0A 5B5EU 2O2YA 5K8UA 1TK2A 2LD4A 3FDXA 4N7BA 4RDXA 3OZSA 2O07A 1H2FA 1POWA 2XCOA 3EBPA 4JEMA 1VMIA 4G26A 4QUBA 3RSHA 3FE2A 5F98A 2GZSA 2D0DA 1FBNA 3BB4A 2X86A 3PJRA 4BB0A 3PGMA 2OLKA 1DKQA 2IVFA 2XNCA 1XRNA 4R1SA 5KYNA 2IEBA 1X77A 3CNNA 4WVFA 3ON5A 3ZEIA 3GIJA 1N0UA 2VP9A 4KH1A 2CCJA 4TYQA 5CA7A 1UZLA 5KFTA 4K03A 3BK1A 2JAUA 1J23A 1KOLA 1QYIA 3UMBA 2FMPA 4AY5A 2ZSFA 2P2CA 2VYND 2WHRA 2PSHA 4IDGA 4QEKA 1T8YA 3ZWMA 2P1DA 3TR5A 1DTSA 4JDPA 4P38A 2PXXA 1N2SA 3PB3A 1A9ZA 4LVSA 1V5WA 4HQRA 3SOPA 4OHUA 3RVJA 4MFCA 1NYQA 1S76D 3RS4A 2YHAA 4MUEA 4G5YA 5C52B 3M6FA 2HVIA 5KJ6A 1CF9A 4EAAA 3WGZA 1GA4A 1W19A 1BXGB 1J5XA 1F6DA 1NHGA 2EIXA 2RGDA 3E3OA 3NKFA 5FP0A 1G42A 3DZFA 4IIHA 4PGQA 5GOTA 1XZDA 4CMEC 4F2PA 4E30A 2XD9A 1GG2A 2YFKA 5AMXA 3HDTA 4U3JB 3S1LA 6PFKA 3N8GA 4JYAB 3W5VA 3RAEC 3FA2A 1E5XA 1XWFA 1V3VA 5SY4A 3HL4A 5KMGA 3FB1A 2YOFA 4D0NA 1TXGA 2K89A 1NXXA 4M8IA 5HFAA 2NTEA 1I3LA 3VAZA 1SV4A 3NU1A 1R5OA 4PG6A 5D6OA 1PK8A 1XCPA 5LLSA 3OTGA 4QYTA 1WUYA 4X8HA 2UYQA 3AI3A 3K4HA 4FXOA 1FNNA 2XGSA 1ISIA 2ONCA 3R2JA 5FA6A 4YHBA 5AVSA 5HF8A 3STTA 1TKAA 3LX4A 3WLOA 3Q40A 5ES3A 1G55A 3E9EA 3NTUA 3KXIA 3VR1A 5K6RA 4JNKA 1CQIA 1XYVA 3A1VA 4QYWA 2I6TA 3U9TA 3G8AA 1SXJD 1HLFA 3B9RA 4N5DA 3C5EA 2XCTB 1OXBB 2PRJA 3UTCA 3DE6X 1P1IA 3HFRA 3I5UA 4JVMA 4PAGA 4TVOA 2Y1OA 1YL6A 2WD7B 3DCJA 4E22A 2BGJA 3KTDA 4RT2A 4V0NA 1P9OA 1G5FA 2RGAA 1PJ3A 4KWIA 1OI3A 2B36A 3HKEA 2WU0A 4M0FA 1C80A 1Q46A 3LDGA 4MW6A 3ZE1B 4AULA 4JGIA 4P3PA 3UAGA 2GHQA 3TXXA 3UPTA 5J2TB 3O38A 5K99A 2WPDD 4FDMA 4CKCA 4JBYA 1GZVA 3K05A 3QVGA 1FYVA 2EYUA 3VDNB 2QUZA 3CGGA 4JI1B 4NS4A 2BKUA 3HJBA 3PC8C 3X0DA 3WB9A 1TAMA 1A8UA 3OZVA 4XX1A 4EF4A 4EYSA 2OORC 1RAEA 2PU7A 1JWAB 2ZTLA 3VNUA 1KEJA 4YRIA 3KZMA 1ELOA 3TNDA 3WBFA 4MW0A 2OP1A 4IZOA 1M34A 1C81A 1SB9A 2M2IA 2VXYA 3JAKB 2FEMA 3NUZA 3HEMA 4U2EA 2QE7D 3GDWA 3V48A 3H5TA 1X9HA 3ANMA 4QULA 2BEJA 2XUKA 3ND6A 3HCRA 1N5OX 3A6JA 4NDNE 4EQZA 3U0VA 1WZEA 3PKIA 2GUWA 1ZGJA 3NFYA 3NRCA 4D79A 5T8KA 4M21A 5EP2A 2UZ0A 4A0RA 1LW7A 2JR5A 4KZKA 5BORA 5K0ZA 5J2UF 1T4GA 1G8YA 4I8IA 5BR4A 2CMKA 1ZGCA 2D54A 3AJRA 3VR6A 1JU4A 1TEXA 1T5TA 2Y2VA 4MUKA 1T13A 1U2QA 2OFWA 2ASLA 2QEQA 5KFDA 3SIXA 3ZK8A 4CW7A 2R8PA 1JU3A 3NIGB 1ZH8A 1NMXA 5IIJA 1JR4A 1LFAA 1VSBA 5F76A 4O33A 4CZ2A 2EEZA 1DTWA 3BORA 3L0CA 2QSUA 4Q02A 1C3LA 2AQ8A 2FNAA 2J33A 3KKEA 1LTHR 3I23A 3ZTYA 3RANA 4CM5A 2JRZA 3O8BA 1B1AA 1I51A 2VA8A 2OXIA 1U45A 3B3GA 3QPBA 4B3MB 1M76A 3ERCA 3L4BA 3LP5A 2IPXA 2N1BA 4BVLA 5AVQA 3EEFA 5EJ7A 4RTJA 4RC9A 4IDOA 2IHVA 5H4HA 4AKTA 4XQ9A 3K53A 4MKXA 5TEWA 4BFTA 1O5TA 3CSUA 4IS2A 1YR6A 1TAGA 3EGOA 1TI7A 1I4LD 1RQXA 3PV0A 5TRTA 4OJNA 3TR6A 3BDPA 2PL9A 3BC1A 1QCYA 3MDCA 3DNPA 5LP6A 2BF7A 3GEEA 2V8BA 1ISHA 1QHGA 3C3EA 3R3WA 4P4GA 3H3XA 1TF5A 4FILA 3GX1A 4BWMA 2JDID 3IXQA 4I1VA 4Y7DA 4XIGS 3O6VA 3L6CA 2WE8A 3B6IA 1TIKA 2KJQA 2HTFA 2XUJA 3HPQA 5EIHA 1BEZA 3UANA 2L18A 3A36A 3USCS 3UYLA 2VK4A 2QNBA 4DG5A 4KQXA 3B7PA 4C0SA 4ARCA 3BHJA 2PMWB 3VH1A 2GCIA 1EGQA 1Z22A 3D5TA 4BO1A 4C88A 4HH0A 3W5BA 2G06A 2ZS7A 4DGSA 5KZMB 1KU6A 3WC4A 2OV1A 6YASA 1ZQJA 3OP4A 3RRFA 4EA8A 4WZAA 1RQGA 1QQBA 5LA6A 2XUDA 3R7WA 4R8UB 4HZGA 2C99A 1BKYA 5H80A 5FV4A 5IEJA 4NBUA 3TQTA 4CV3A 4XI9A 5TMPA 3FR8A 2BSQA 4DZRA 1QFSA 3GT4A 2NO6A 4E94A 3IQDB 1K1QA 3AUXA 5EINA 1KYTA 1WB6A 5CXQA 2GOYA 2Q9UA 3IVAA 4H2DA 3RE1A 4IRUB 4YAJA 5TZVA 1JEYB 3JVVA 4NAUA 5A9TA 2RG7A 2ZTEA 2VDLB 1WWVA 1T1JA 2RI1A 2ZROA 3CSDA 3GMTA 4FM9A 2MSKA 2AEMA 4BNHA 5HJEA 4D8YA 3EW7A 1JFFB 3QX3A 2C9ZA 1V35A 4PSCA 1VCOA 1V16A 3HBFA 3ITKA 1X6JA 2FEPA 4WKNA 4COOA 1JR3A 3ZGOA 3FKQA 5DQHA 3G2IA 1URPA 1FMLA 1LX7A 1ONNA 2FHSA 3AZPA 1BS9A 3RF7A 2C57A 3AIMA 4JUDX 4XWTA 4ZK2A 6REQB 2ZVDA 2Q5EA 1QO7A 4MUHA 2ZIGA 1K9VF 2Z4TA 4DA7A 1RAGA 2OXCA 3R7DA 2PLNA 1QOQB 3ECSA 1UJ5A 2P7HA 3ZQ6A 2CDRA 2GZ2A 1W0KA 3QVOA 3KQVA 2QUIA 1HE1C 2FZGA 3KOZA 4MAFA 4R9VA 2ZE8A 5H81A 1QKKA 2QLNA 5CVTA 4YMGA 1XU4A 2ZDGA 2A5LA 1U4OA 1E9VA 3SEFA 1XO0A 3AY3A 1JIXA 3GEGA 1V9CA 2CJFA 4LDPA 4RQBA 1ND6A 2IUSA 3ULKA 1FLNA 3B7WA 5HFNA 1D5CA 1YJQA 2SKCA 4XE5A 5EWLA 2LDXA 2Q6OA 1KMMA 1SBCA 1M1YE 4YO8A 3U7QB 1U7TA 2V59A 5JATA 3TDMA 2DG2A 5KTMA 2TMDA 1LWOA 1JWLA 3V7KA 5KFYA 2WJWA 1QPBA 4E08A 1BJKA 3JQ9A 3P0FA 1B15A 2ISCA 5EUMA 4UM8B 5EPOA 4BMDA 4EFLA 4AIIA 1PHRA 4RFVA 5KU7A 3BQ1A 1COZA 1Y81A 1BWQA 1UJ4A 5IFKA 1NOMA 3R3JA 4QSHA 1L4YA 1ZQTA 1IHXA 3NRBA 4WN9A 3ZDEA 1C30B 1MXHA 4FYVA 5EMMA 2F3QA 1NYLA 2O2IA 3VSBA 2W2NA 5DYTA 1X0VA 2C3YA 3OCJA 2YS7A 4OREX 3CSSA 1SZJG 4JLMA 1SL2A 1CJSA 1NQVA 3VTKA 5L9AA 4ADSG 3LLUA 1CFZA 2PBLA 4UFOA 2OBYA 4DILA 1GU0A 1IUOA 2V7QD 3CIOA 1E1QA 3OH8A 3G2HA 4FYJA 4ARBA 1E2IA 3CRNA 2C9BA 5HR7A 4GH5A 4F5EA 1T6BY 4GVLA 3WHKA 1RVDA 3PD1A 2DUYA 4HL6A 4IJQA 4AZ3B 2F8LA 1HBJA 4EZIA 3SEQA 1ZD2P 1GPJA 5ECGC 8ICCA 2IYYA 2O8VA 1CIPA 2J6HA 4CCSA 1PT6A 4TV9A 4HY3A 2H0AA 2H4XA 3QZ7A 2K6GA 2PTHA 1XNRB 1PO7A 4KJZA 4XYMA 3NOOA 1P4JA 1TTQB 3DF9A 4UEKA 2ONJA 1BPDA 1UFKA 4FZLA 1CJKC 5DTQA 4OLBA 1ZH0A 1AKEA 1R2QA 4M99A 2VWQA 2V6JA 1VJRA 3BD7A 4HGOA 3NTVA 4N39A 5KL8B 4WCFA 3ZU3A 2BMJA 4PBRA 3WGVA 3NVWA 5JECA 4AO6A 3GUUA 1ZQUA 1KWKA 2A1IA 3ZZ1A 3NBUA 3VGJA 3BZCA 4K9NA 4DM7A 2BE9A 4MLDA 4ER0A 5KJFA 4Y6RA 8ICIA 1BS1A 3EDMA 2P69A 2IUEA 3H1BA 4JXZA 3QTTA 1GDTA 3X1WA 2NP7A 2F00A 5I4CA 4ALIA 3DVQX 4W1QA 3KT0A 5K8TA 4JYZA 1RC0A 2NWQA 3D3KA 5IKXA 7ICSA 1HA3A 3B1XA 4KLLA 4JVNA 5KHLB 4FFBA 4XDYA 1ZISA 4MV4A 1YDWA 5EKTA 2JMGA 3BAFA 1N2HA 1QHHA 4L5CA 4RZSA 3QP9A 2DBYA 4EQ6A 5KFMA 3FROA 1DGSA 4UTNA 5KYTA 1RJWA 1GTMA 1YL7A 2AEJA 1IQ0A 3DDZX 3EQZA 1TUGA 1EX6A 4L22A 4X1YB 4MQ4A 2LKCA 3W6NA 1P3Y1 3I01M 2HBKA 1VG0B 4QT0A 1VMEA 5FUMA 2Q2NA 1SXJC 1HLDA 5E9QA 3SJ7A 1V3QE 2WWRA 3RC2A 2Y4OA 1L5HA 2V3CC 3N8KA 1YASA 3K4PA 1AMUA 1O58A 4J16A 2FMSA 1WX1A 1RTKA 1Y3BE 3GC6A 3I42A 3KAJA 3DBOB 2XVAA 3HZRA 4WZBB 4CWAA 5DX0A 4C7KA 4IV5A 4Z5XA 5IULC 1YZ7A 3RG8A 3Q0IA 4AN4A 4F8RA 5DB7A 1ISGA 3GRPA 4FONA 3VNSA 4Y9DA 1SU4A 3IPCA 3ZQJA 2IYPA 8ICZA 1SHZA 3JWHA 4CHGA 3ANLA 3BM5A 3MJDA 4MYTA 4YBRA 3C3YA 3MRVA 2PGIA 2ZJ6A 4XCVA 1CLEA 3W4IA 1TM1E 4XJTA 3SF8B 1Z0SA 5KI6A 2QE6A 3CHYA 3EQ7A 2VH2A 2OORA 2W42A 1DAEA 3RK1A 4NWIA 3ZDFA 4H31A 4AUEA 6LDHA 2EF0A 2Q8PA 1OQAA 1O9GA 1XMVA 1BGXT 3BCHA 4HGRA 5DCYA 5FPPA 2V1XA 3MB5A 4OP2A 1JH8A 1T6NA 1YVEI 1TU3A 2RB4A 3UG7A 4B3TB 1TPYA 1P1RA 1HEUA 5C7LO 1K75A 2I87A 1P0MA 4MWDA 4PFKA 3U56A 1RW4A 4KPYA 5EJ6A 2GKGA 4DCMA 3L7YA 4TM8A 3UO8B 2VQEB 5I7VA 4OLAA 2EIHA 4H7FA 4LY0A 4RJIA 4WXYB 3TECE 4K81B 2OH2A 4HYYA 4XJXA 3PRKE 2W9BB 4RJJA 2H3QA 2OR3A 2QM3A 4IPTA 4QDTA 1IM2A 4A27A 4QODA 3W2FA 1DK2A 1WZIA 1G4HA 3HXPA 3Q3GE 2A3VA 4PGYA 2ZSIA 4JU9A 4RJKA 3ZWBA 2J7PD 4EL5A 1RM0A 3HU3A 2YJZA 1YDEA 3MOGA 1UXIA 1VG8A 1XMOB 1S7GA 3IDOA 2X7HA 2PKRA 2EAPA 5FFFA 2ID7A 2MU2A 3E7XA 4MWSA 4Y9SA 3FSGD 2CUKA 3DO8A 1MC4A 1XVIA 4M8KA 2GARA 5ALWA 2B78A 1LH0A 2C5LA 4DBLE 5JXHA 4D9HA 1RYMA 4G1MB 5J2TF 4WRRA 1L7VC 3BKWA 4PC6A 3B38A 1ZD8A 2VJOA 4WEQA 3VH2A 4X3PA 4RA6B 2ISOA 1EEHA 2EKLA 1CY1A 1Z4LA 2OHVA 2XY6A 1WHTA 3AFMA 2ZATA 3DEJA 2QUHA 3CRMA 3RFCA 2ZBEA 4AJ1A 2Q9CA 4LPSA 4IQTA 2VJLA 4FGUA 1L5RA 1NNI1 3C1UA 3NAGA 2HBMA 2P6MA 2XDYA 3PKJA 1G9SA 2C2EA 3JAWA 3O4RA 4ND4A 4WZAB 3RROA 4DIOA 5J47A 3LBNA 1CY4A 2GPSA 3WLTA 3QH4A 4C4OA 1WUJS 2OV6A 2WG0A 2VDOB 3S1AA 4K88A 2WDZA 1UIMA 3TGLA 2AT1A 4EZBA 4QNLA 1DMSA 2OXEA 2QDXA 1HDZA 4HNAA 3N2EA 2O5RA 1ZR4A 4MINA 2FUCA 1A9QA 3KELA 4DC1A 4RFSA 2J46A 4ZCRA 1JDZA 4DCSA 1Q74A 3GNLA 1OAOC 3BGVA 5L4SA 1YQTA 1ZQNA 1A72A 1G2PA 4JMLA 5EC8A 3D8BA 5AW2A 1SUPA 1XRPA 2JH7A 4X8MA 3OE5A 4KQ2A 4B33A 2BCVA 2ATLA 2PO5A 3IILA 2HJSA 4KE8A 1QAMA 4D9CA 5AVUA 3DLTA 4C0JA 4ENQA 5KNDH 2X2OA 3D0OA 3EGCA 2X5XA 2BV3A 2H1HA 2VYVA 3LXMA 1FX1A 3NPAA 5DGDA 4LY9A 3T9BA 3W6OA 4YMLA 1II9A 2BMDA 3H2GA 5TQ0B 5FLXA 3Q8QB 3UOAB 1ZM3A 3G13A 4DAOA 1P1BA 4C8KA 3KPWA 1NRJB 1UC9A 2KZMA 2RBKA 3ZBUA 3JQFA 4DPMA 4JODA 4CLRA 3O8OB 1CUGA 1QV6A 3ABOB 3I58A 4XQ0A 2JFZA 1VHDA 3O9ZA 2WKPA 1SG9A 4K28A 3IJRA 2X9GA 4KN4A 1H05A 2VAMA 4WINA 3ZHSA 1DEOA 4QG7A 5DQIA 2CBXA 3K31A 5LMNB 4J6FA 5GJWC 3DC7A 5C46F 4H0CA 4RY8A 4UU1A 3BKXA 3HVIA 4O8ZA 4BMZA 3E7FA 1LDBA 4WI1A 2ZI6A 1CUVA 3QELA 3ZCPA 2P2SA 4C3UA 3VX3A 1ZJYA 3TLMA 5TLSA 3EEIA 4DF4A 2J31A 16PKA 2RFLA 1PBNA 2WJGA 3PQ4A 4IX9A 3PJFA 1MQAA 4JI3B 5JVDA 4LHYA 3AHGA 4ZQBA 1XXLA 3ID6C 5LMUB 5DT2A 3BWXA 4N03A 4DR2B 1RP1A 3TFQA 3WZ2A 5DSXA 3UXEA 3GFVA 5EZYB 3W2IA 2B9VA 5B36A 2B8EA 4BGDA 3EZLA 5JFOA 1GNVA 2Q3DA 2JFUA 4EPTA 5K3OA 3CW2C 1WF6A 4QFMA 2FE1A 1E0SA 1RPZA 1KBOA 4H3SA 1AKWA 4F60A 1Z4OA 3VAYA 1NU8A 3O74A 3E7DA 1U8TA 2GZ1A 1WCWA 2H07A 4ELVA 2WA1A 3WSWA 2X1MA 3PE3A 2JGDA 1D9XA 1S96A 4EB6A 2WSYB 2JIRA 5LQSA 5B3KA 3OY2A 2Q0QA 3GLFA 1UT6A 3CVVA 4IZHA 3O3NB 2YMLA 2DQ4A 2IA6A 1ETUA 1LA2A 4GBJA 4PLGA 3T3HA 3X2FA 2A1AA 1NLMA 1VKOA 3ZWAA 4RPXA 4BWFB 3V80A 4IDCA 4HAVA 1T1SA 3E27A 5IN4A 2NXJA 1G3IA 2WFAA 2HPZA 3C41J 1OX6A 1HQCA 1TUIA 2K4MA 1X15A 3DAGA 3P0JA 2WP0A 1GGMA 2AMJA 4NBRA 3BK2A 4IBOA 1K2WA 1UPUA 2JCXA 2CUTA 2P9CA 3JPOA 4NMHA 3OCYA 4RKYA 1GT91 2QVXX 3RGGA 5K3DA 4LYJA 2BPGA 3ZYZA 3IIIA 1KZ1A 5HE8A 2NGRA 3MJEA 1NDQA 1NXOA 5FI1B 3C1TA 1RJGA 4I08A 2MYTA 5KO2A 3IIJA 1B3RA 2EW1A 3NONA 4WCFB 1L5GB 1U31A 5CJ7A 5CLIA 4LTNA 3QPUA 1B8PA 4Q43A 2I67A 3TSZA 4Y2JA 1J6UA 3BS5B 1FQKA 1T15A 2ZSJA 3BH7A 3FBTA 2FUG6 3GJZA 3GIDA 4L4UA 5EQDA 1SZHA 1K68A 3S40A 7REQA 2R96A 1KO1A 2PUFA 3GJSA 1EUCA 1RP7A 2Y9UA 3MR5A 1TVCA 2HZ7A 1DKPA 3DWGA 3I8SA 4MVJI 4P7KA 4RY0A 3N8NA 5J59A 2WAMA 4A03A 1Z2AA 4MDHA 4KR3A 1KFDA 4I5IA 5GADl 1TKCA 5DB8A 1KEWA 1IZYA 8ICRA 1LVUA 1P1FA 1DG3A 1Z0ZA 2YIMA 2ZJ4A 2ZYIA 4FGZA 4UDYX 2RQ5A 2E89A 4Z2YA 2YOHA 3VPCA 4DLWA 5JFGA 1SELA 3P4UA 3BIWA 1IXYA 2F1JA 4P7GA 2HWKA 4XSHA 3FXAA 2PMZC 1U02A 1KBZA 1H94A 3KKLA 5I48A 1KL7A 1P62B 1VHWA 1K88A 1J2UA 3D0RA 1Y1LA 3AI2A 4IGAA 4D02A 3OIVA 5AO9A 5JS1A 2L0XA 2DY0A 5EEGA 1X3SA 1DRJA 1ZOSA 1QPGA 1Z7WA 4C5AA 3AOEC 1CIJA 1G6Q1 1EVQA 2DWUA 1QDUA 3HW8A 2DL0A 2IZ6A 2PX8A 2VDPB 1B26A 3AUUA 2W9CA 3BXHA 5KFPA 3GFTA 1MOZA 3GMSA 4PQEA 5HCNA 5I7FA 1ZA2A 2UZIR 3OZFA 4KYVA 3ZWCA 2CY0A 2G1KA 2BEVA 4E0DA 2A59A 3FDJA 2Y1KA 3H3JA 3CP8A 3DV2A 2EX4A 5JYCA 2Q5FA 1E96A 5JQGB 1J0XO 2ZI4A 4OK6A 1T10A 3F7OA 1WLSA 1OXTA 2R85A 4I8DA 1QVWA 2GCPA 1SL0A 4GPZA 3RJFA 3F2CA 4R16A 5TJ9A 1JMVA 2IWHA 5J4LA 2PZLA 2H8KA 1WDMA 3DTYA 1Y6ZA 4DSJA 1KE1A 4B9LA 1MH1A 1F51E 5CM2Z 4C14A 3I28A 3GROA 4UULA 4UB5A 4WBXC 4CG3A 3LT4A 1FP2A 2DHDA 2IYLD 2VSOA 3HCPA 4BPBA 1YE5A 4B9EA 1ZWKA 3BXXA 1OFHA 3T9AA 2ILTA 3BE4A 5AUQA 4CRXA 2AUNA 4ID9A 2WWHA 4J0CA 4C5CA 2OFFA 2XSZA 5JSFA 4QBHA 4XD7D 3GFGA 3IALA 5CJJA 3MJ4A 1YJCA 2HBYA 1OI7A 2VNAA 4UHJA 2GX6A 1W6RA 1E2LA 5LQKA 3FHLA 1N2JA 2PLFA 1K7XB 2W43A 2HMXA 3BJIC 4Z0PA 4ZVUA 4RV4A 2VG8A 5ELLA 3EIWA 3INRA 4UBLA 3N53A 4PQYA 2B99A 5JD5A 2GBIA 1CVRA 4EPWA 1R27A 1GQFA 4J2TA 4G2NA 5HRUA 1X9WA 3W6UA 2ALJA 4J91A 5A0VA 2CFRA 1N0VC 3L0DA 4RZIA 4B87A 1HTWA 2PKEA 1P9RA 1XIVA 3L7DA 3Q8WA 3KYDA 1NLYA 1B4FA 2P9EA 4ECYA 4NZPA 2WTNA 4TM7A 2EKDA 3KKNA 4ZGGA 3TL6A 3WWEA 3GDOA 1PL0A 2VSYA 2H92A 3D2BA 1C4OA 3EWIA 3NOQA 3RUFA 3TZKA 1ZD5A 3T5HA 1BH6A 2AG8A 4AFNA 4XQ8A 3TSAA 2B35A 1IZ9A 2MMGA 4FHDA 2ZT6A 3ZGVA 2XZLA 2QX7A 4A91A 4DYVA 2V5UA 3WIBA 4LV8B 1QWOA 4J94A 3FPAA 3I45A 4Q4HA 4H3KB 3DVSX 3C70A 3WKCA 1Q1AA 4XPIB 3OFKA 5EN4A 4ACAA 4UARA 1YA8A 2VZ8A 4AG3A 4EAQA 2KLHA 2Z0MA 3EPKA 2C7QA 1BVHA 2L19A 4BFCA 2O1EA 3VKGA 1H1LA 1EEXB 4RY2A 4IGKA 5D87A 4DV0B 3NDBB 4RTSA 2HU7A 4B0PA 5B6PA 2QQFA 2DH5A 3L8MA 4KLUA 2DUJA 4FU0A 4WBNF 5BQPA 3JTEA 1SIJA 3GUVA 5IDYA 4UFPA 1IHDA 1QHFA 3VV2A 1XJCA 4QREA 3TIGA 5J2HA 4X20A 3TQFA 3AEKB 5DG7A 5DCUA 4DS4A 3WYCA 3V4VB 4IOKA 1Q7GA 4C4PA 3V7NA 1P39A 2UUBB 3UJ9A 1EFCA 4HYKA 3HN7A 5KFEA 3UGKA 2VPWA 3MCTA 1H3NA 4MW4A 4G5QA 3GP5A 1R0ZA 4J9OA 1ZFNA 4TS3A 2CUZA 2BF4A 3RSSA 1JRPA 1I1QB 1M5TA 4HCJA 4QZAA 4YAOA 1H9CA 1CUXA 1ZMOA 2P3QA 1OVMA 1Y42X 2Y1JA 1KYYA 1GU1A 4ZALA 3DBVO 4B80A 5IT5A 3UCXA 1WTAA 3BGDA 4DL2A 3U7HB 3LWMA 2NO4A 1LS6A 2J85A 1J8VA 1XL1A 3SEAA 1NPYA 4WEOA 3KKZA 3ZC3A 4RD1A 1CV2A 5ECWA 1T5LA 2GPBA 3LVRE 1J07A 4JBGA 2JLVA 1HI9A 3FCYA 5CP8A 4M7WA 2O1XA 1TQ4A 2R7MA 3VR5A 1CCWA 3PZPA 3F5DA 4J1NA 4KGZA 1SN7A 2Q0HA 3MELA 3KEOA 4DJAA 3G2JA 1XL0A 3T3PB 4UEJA 4AF7A 4FI3C 4ZMSA 1FC0A 1N9ZA 3R23A 3AERA 3PA8A 1Q11A 2HD4A 4IR9A 2KFNA 1ZK3A 3RYHB 3GN1A 2IWRA 5JJBA 2R7KA 1XMPA 3DZBA 4UMVA 4PLYA 4ZMRA 3HYLA 4OSOA 1TJPB 1EJ0A 1Y9ZA 2I4IA 1KZ7B 1P4GA 3HY3A 4KC0A 3TLBA 5TQ2B 1BNPA 3ZNOA 4C22A 3KDSE 1TIPA 2OO3A 4MGZR 4EH1A 3ORFA 2VTEA 4UM7A 3IAS6 5JQGF 1QSGA 4HDKB 2WVGA 3LVFO 2Q2OA 1N7HA 4Z9FA 4L9WA 5G0UA 4JV5B 5A5FA 4FHFA 4J9MA 5M5BA 3SHFA 3P32A 2ODWA 2JJQA 5A7HA 1MOPA 4YR2A 4L4RA 3HJUA 2ZTCA 2VSFA 3ONFA 5FD8A 3HXOA 1MGOA 3MUFA 1RKBA 4TRMA 4OX9Y 4ZJPA 3AXSA 3QPVA 2C2WA 4ME6A 4Z53A 2HKIA 4U9HS 3TIIA 4ENTA 3AF1A 1WP4A 5KVSA 3H2IA 2JLSA 2P9FA 2VOJA 3IUYA 2AQ4A 3HEBA 2CVQA 4JHXA 4E13A 5IFLA 2NRTA 5E0OA 3PU6A 4OHFA 3PX7A 4IH9A 2Y1GA 2KWIA 3SQOA 3RR7A 1GTSA 4G85A 3MT9A 4J0DA 5ALNA 1XZNA 3G2QA 3TUJC 5J0XA 1KQPA 2D1RA 1G20E 2AYZA 2B8TA 2JLRA 4XR9A 4A92A 5LLDA 1QRAA 5HM6A 1FFEA 2LIVA 3W5AA 1GSIA 3LGAA 4X6XA 4AXBA 4DLYA 1QG0A 2DX7A 5ILGA 3WGHA 2UYYA 3I09A 1T35A 4C0AC 1N8TA 3Q41A 2BGGA 2P35A 1MPXA 4EA6A 2ISSD 3OIGA 5CH3A 2VP4A 4ALNA 1WVGA 2CK3A 3EFEA 5KUTA 1J1ZA 2R47A 2IBMA 3A04A 1SGWA 3UMYA 3QWHA 1D2HA 4YJHA 4LQDA 1SIOA 1KO4A 3GILA 3LF1A 3HP6A 1OWMA 3JSXA 3L7NA 1KETA 2YY6A 1Q50A 4HNQA 5E7JA 1E0JA 2DBRA 1FF9A 1EM8A 1S9DA 1TZBA 2WAYA 1XOIA 2X76A 1RHUA 3EVTA 3O47A 3QVSA 4WA8A 1MVOA 4KQMA 2C31A 3D2QA 2ZYVX 3OHAA 5G40A 1T6YA 1ADCA 1PR0A 1N3BA 1USGA 2Z8ZA