3N4MB

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
total genus 21
structure length 74
sequence length 74
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n4mB00
4YR3A 4RQ4A 4PHDA 3Q8PB 1D9DA 3PY8A 8ICYA 7ICLA 1TAQA 1QSLA 2PFOA 2AJQA 2ZJ5A 1XO1A 1TV9A 5BOLA 3JPNA 4J9NA 1X9MA 2XY7A 4YD1A 3MGHA 5KFRA 3RB3A 3RTVA 2BPCA 2FPLA 1NK9A 4NY8A 4NLZA 8ICNA 2AQ4A 4I2AA 9ICTA 3PNCA 1ZQRA 9ICKA 4P4PA 1BPXA 4KLMA 2BR0A 2J6SA 2VA2A 1ZETA 4ELUA 4F5QA 4O5KA 3HWTA 4RUAA 4TUQA 3PW0A 4F93B 4ED0A 4I2GA 3RB0A 3BQ2A 5IIIA 3OHBA 7ICEA 4QZBA 2BCUA 5KG4A 5DQHA 5DGBA 4DFMA 3PMLA 3AU6A 4C8KA 2NRTA 1MQ3A 4PHEA 1MSWD 5KG2A 1ZQFA 4KLSA 3SV4A 1QLNA 1L3UA 4B9MA 4QZ8A 3JPPA 3T5KA 2AGQA 4DF4A 3PV8A 2IBKA 4J9PA 1V9PA 2KZZA 4EYHB 2BQ3A 1COOA 2FPMA 2KZ3A 4F5NA 3PW7A 4QZDA 2JEGA 3ZDAA 7ICQA 2R8GA 3GFKB 3V7LA 3LK9A 4IRCA 1WCLA 3C5GA 8ICGA 1U48A 1ZJNA 4NXZA 5L1LA 2BCRA 4TQSA 5HMMA 2ZUBA 1Y88A 5KFYA 1L3SA 4ELTA 1T4GA 1D8YA 3OHAA 4NLGA 2NRZA 7ICHA 4PPXA 2V4QA 3RRHA 3EZ5A 2BPGA 2C2DA 1BPEA 2F1JA 3RBDA 8ICKA 3IM1A 1ZQTA 2DPJA 4EZ9A 3PR5B 1CEZA 3KHGA 4I28A 2UVRA 3OSPA 2KTQA 8ICSA 3N4MB 4K4HA 3RAQA 4K4GA 2W9MA 3OJSA 4BDPA 4DSKA 3PW2A 4IR9A 3Q8QB 3RJJA 5CJ7A 2BCVA 3TI0A 1S9FA 4G3IA 4UB4A 1X2IA 1B22A 8ICOA 4JK1A 5J2FA 5TZVA 3EWAA 5KFCA 3M8SA 4O3SA 4Q8FA 8ICTA 4GC6A 1IM4A 5HHHA 4ZH4A 5KFTA 2ASDA 2ZUDA 4KLEA 2PFPA 8ICRA 9ICVA 4ECVA 5EWFA 4ED6A 2P66A 8ICBA 9ICCA 5KFKA 5J2KA 1MQ2A 1KLNA 4MFAA 4NLNA 4RT2A 2ZTDA 3C1ZA 2HHUA 1NJZA 5KFDA 4J9RA 4JUZA 2RDIA 5KFFA 1BGXT 1XWLA 1EXNA 4QZHA 1S10A 1RYRA 1ZQDA 5KFPA 3AUOA 4ELVA 4GXJA 3PVXA 8ICXA 2HHTA 3MBYA 3ZDBA 3QZ7A 9ICLA 4C8NA 4DF8A 4RQ5A 2W8LA 3MR2A 4PH5A 1KFTA 4QZGA 1Z00A 4RQ2A 7ICPA 4B9SA 2UVVA 1ZQAA 4ED7A 4YP3A 4DOCA 2W9BB 2FLLA 5J0SA 4DSJA 3ZD9A 3H8SA 4RPYA 4ECQA 4DSEA 4KLIA 3T5LA 4O3QA 3UXNA 4YG2A 5BOMA 3EPIA 4QWEA 5HMLA 5KG6A 3LDAA 4IQVA 1S0NA 3RB4A 3KTQA 4UAYA 4TQRA 5J2BA 3GIJA 4DFPA 3T5JA 4IQUA 4ECUA 3KHRA 9ICAA 2GWSA 1XU4A 5KG3A 5IIKA 1JXLA 3IHQB 7ICSA 1ZQBA 4DOBA 2F1IA 4DFKA 7ICUA 4JWMA 4KTQA 2H5XA 1AROP 3HPOA 3PO5A 3SZ2A 4J9MA 4M04A 1S77D 3H4DA 4R65A 5KFHA 4B9TA 4QWDA 3H4BA 1XSLA 4DLEA 1RZTA 3KHLA 3PW4A 2Y1JA 5J2JA 4B9VA 4I2DA 4QZCA 2PI4A 1S0MA 9ICXA 2ASJA 4M9LA 1ZQHA 4YR0A 5KFNA 9ICSA 3V6JA 2W9AA 2KFNA 4QWBA 2UVWA 7ICNA 4F91B 2HVIA 1XC9A 2XGPA 4KLHA 4MFFA 4DSLA 4BXOB 4RPXA 3C2KA 1TK0A 4XQ8A 5KT2A 4ED3A 3Q8SB 4I27A 4XUSA 2RDJA 3ISCA 4XRHA 4GLXA 2ZJ8A 3T3FA 2ALZA 3RJKA 2MUTA 3GV5B 4M6WB 3RH4A 4IQTA 1S76D 5KTQA 5KFJA 4KLOA 4IQWA 1RYSA 4ECRA 1ZQWA 5DKWA 1JN3A 9ICJA 5KFOA 1ZQVA 3B0XA 3Q8LA 2XCAA 4M2YA 4KLUA 2NRVA 3RAXA 5C5JA 1NK0A 3GV8B 1Z3EB 4QZFA 4QWAA 4DS4A 4M9JA 4LVSA 1ZQPA 1ZQGA 2PFNA 2BQRA 4YVZA 4DL4A 5EOZA 1U45A 1ZQLA 1NK6A 2J6TA 4I2CA 3PW5A 5DB9A 2BQUA 2MUTB 1BPZA 4J9QA 3RH5A 1TKDA 4F2SA 8ICPA 3M8RA 4P4OA 5F9LA 4UAWA 4ECWA 5KFZA 3RJEA 1WCNA 4CCHA 3JPOA 1NJXA 4DS5A 4DQIA 4O5CA 1ZQOA 1XS9D 3GILA 3H8WA 2XCPA 3PX0A 2IHMA 4F50A 1KRPA 1NKEA 4P2HA 8ICWA 3MABA 3C5FA 3UPQA 8ICLA 5KFGA 5DBAA 3H7IA 7ICKA 3ZDEA 2HHXA 1U49A 4DLGA 1ZQMA 4NM1A 4QWCA 5J0RA 5CR0A 7ICIA 4RQ3A 4FBTA 2FMPA 4F4ZA 4MEYA 4F5OA 4QW8A 4UAZA 4UB2A 8ICHA 3C2MA 3KHHA 5J2EA 4RNMA 3H40A 1H38A 4IRKA 4MEXA 1KTQA 4F92B 4J9SA 4EEYA 1HJPA 5DG7A 4F4KA 8ICFA 2PFQA 2HHSA 4O3PA 2Q0ZX 4MF8A 9ICUA 1ZQJA 5J0TA 2C22A 4RPZA 1NJYA 3ZDDA 4R66A 8ICEA 3C21A 4LZGA 1SL2A 3OSNA 5CWRA 2XGQA 2XC9A 3MR5A 2BKEA 2AGOA 7ICVA 8ICUA 4X5VA 1KDHA 5KFIA 4M9HA 4IRDA 1UT8A 3OJUA 4RNNA 2M9NA 1MC8A 3HW8A 4YD2A 5KFMA 3GIIA 2AU0A 2BCQA 3HX0A 4PHAA 5EWEA 4I2HA 2C2RA 1N56A 2XO7A 3QE9Y 1D8LA 4EYIB 5KG7A 3V7KA 4EBDA 1NK7A 1N48A 3MR6A 4M9NA 4MFCA 4K4IA 9ICNA 3FDSA 3H8JA 2VANA 1U4BA 1BVSA 5IILA 9ICMA 7ICOA 3ZD8A 5DB7A 3EW9A 2KN7A 2V4RA 2HHQA 3BQ0A 4Z6FA 4ECYA 3BQTA 4PGXA 4YCXA 2FMQA 4ECSA 1S0OA 3PX6A 1UA1A 5DG8A 4M47A 8ICIA 5J0QA 3BDPA 5DGAA 4O3RA 3K4GA 4R8UA 5DLFA 3TANA 2JEIA 4YMNA 4KLDA 3B0YA 5D49A 7ICGA 3SYZA 1BPDA 9ICRA 1ZQIA 3RB6A 5KFSA 4QZ9A 2J6UA 2KZMA 5HP4A 2Y1IA 1QTMA 4O9MA 4YXJA 5J0PA 4DSIA 4TURA 3MGIA 2NRWA 9ICHA 4FO6A 4GXKA 4RQ8A 3ZDCA 1A76A 4DQRA 1XSNA 2I9GA 1K1QA 3M9MB 3G6VA 3GIMA 5J2CA 4XA5A 8ICVA 4QZEA 1BPYA 5L1IA 4RNOA 7ICFA 1ZQNA 3MR3A 9ICWA 1SKSA 5JUMA 4GC7A 4UBBA 4ED8A 2AGPA 1NKCA 1KFSA 4KLTA 5D46A 4R8UB 4EBEA 1LB2B 4I2BA 4LZDA 3V6KA 4QW9A 5DB8A 5L9XA 4QZIA 4FS2A 3RRGA 4JWNA 2HW3A 3E2EA 5CA7A 3BQ1A 4BXOA 8ICQA 4C8MA 1U9LA 1TK5A 3LWLA 4DL6A 3RR8A 3EYZA 5KT3A 4KLFA 1S0VA 5KFXA 3JPQA 2XY6A 3MDAA 4DQQA 4RZRA 2JZBA 1B43A 5CP2A 4QZAA 2AQ0A 2FLPA 1TK8A 4NM2A 9ICIA 4C8LA 5KFBA 4Z6CA 1SKWA 4RT3A 5DBBA 1HUZA 4RUCA 4JV2A 4YQWA 4BGDA 5KFWA 5KT6A 4TUSA 4DFJA 4YXMA 2BHNA 5KG1A 2JEFA 9ICPA 4KITB 4BWJA 5KT7A 4EZ6A 2F1HA 5KG5A 3PMNA 4O5EA 3EPGA 2HHVA 5DQIA 3PO4A 1DOQA 4KN4A 2ISOA 4DOAA 4ED2A 2FLNA 5HHIA 4B9LA 4I2FA 3UXOA 5DB6A 4F4XA 5KT4A 4F4YA 2IMWP 7ICJA 2PI5A 3ORYA 3MFHA 2ZTEA 4DL3A 3SI8A 2VA8A 3PX4A 3MFIA 2W9CA 1ZYQA 5KFEA 5L1KA 9ICEA 9ICGA 3ISBA 5KFVA 4KLJA 5KFAA 4YR2A 4YMOA 4J9LA 3TFSA 4RQ1A 5DDMA 2OWOA 2IA6A 4F8RA 2KFZA 7ICRA 3NGDA 4F4WA 2DPIA 2R8IA 2C28A 4Q8EA 9ICBA 4I2JA 2ASLA 3MDCA 4I2IA 4UB3A 1SKRA 1ZQKA 5DG9A 2A1JB 4FS1A 1ZQEA 3JPSA 2FMSA 1SZPA 2B21A 4C8OA 5HNKA 3GDXA 2P6UA 1A77A 4DSFA 4KLGA 3T5HA 4DL5A 1JIHA 2ZUCA 8ICCA 1ZQYA 1IXRA 5DQGA 4DEZA 1TVAA 5J2GA 1S97A 2V9WA 4O3NA 1ZQXA 4DO9A 2BGWA 4F2RA 4ED1A 4HYKA 1UA0A 1CUKA 3M9OB 3C2LA 3G6XA 5J0UA 4YN4A 3UQ0A 5D4BA 1X9WA 3RR7A 4M0AA 5J0OA 4KLQA 5DDYA 1Z00B 1KFDA 1JMSA 3SV3A 4JV0A 5KFUA 4FBUA 2I1QA 1ZQUA 1L3TA 4RU9A 3V6HA 4PGYA 4Q45A 3RBEA 1NK8A 1RXVA 4RQ0A 1ZQCA 2A1JA 1RPLA 2ISPA 4IR1A 3ISDA 4NLKA 1DGSA 3K75D 3RJFA 1KSPA 3C23A 3QZ8A 2UVUA 1QSSA 3TFRA 4PGQA 3GQCA 4F5RA 1NK4A 4UBCA 1U47A 3TAQA 1RXWA 3Q8MA 1JX4A 4B9NA 1ZQZA 2XY5A 1L5UA 4ECZA 7ICMA 1SL0A 2JZBB 1T7PA 4DQPA 1LV5A 5J2IA 4UB5A 1BPBA 1UT5A 5IIJA 5EWGA 5J0YA 3LWMA 3QEBZ 4F3OA 4KLLA 9ICOA 3G6YA 8ICZA 3HT3A 5KFLA 4RQ7A 2FPKA 3Q8KA 2JEJA 4PHPA 9ICQA 3JPTA 3UQ2A 1XSPA 2BCSA 3RJIA 1ZQSA 4YFKA 4KMUA 2IHNA 1L3VA 3RJGA 8ICMA 5DBCA 3TAPA 3TQ1A 2HVHA 2W8KA 1D9FA 2R8KA 4MF2A 9ICFA 2R8JA 2PXIA 5J2AA 2NRXA 1T3NA 4TUPA 2W9CB 2ATLA 1NK5A 5BPCA 4O0IA 4DWIA 3GV7B 2C2EA 4P4MA 4ECXA 5J2HA 2W9BA 3AU2A 4R63A 4M6WA 1NKBA 5KFQA 3PR4A 3NTUA 3HP6A 4DL2A 5DLGA 3V72A 2HHWA 3N97B 4UQGA 1X9SA 3Q8RB 3TARA 3UXPA 3THVA 2ZJAA 2MAXA 1TAUA 1PZNA 2DFLA 4Z6EA 5CB1A 4UB1A 2VA3A 4Z6DA 5KT5A 5J2DA 4YMMA 1HUOA 3RH6A 4E0DA 4M9GA 4O3OA 3GIKA 1K1SA 2BPFA 3M9NB 5J0XA 4GXIA 5IINA 4B9UA 7ICTA 5J0WA 4F5PA 2LYHA 3C1YA 2WTFA 5IIMA 4JV1A 3JPRA 1C7YA 1QSYA 3FYHA 4EBCA 1NOMA 8ICAA 5CHGA 2R8HA 1KEJA 4RQ6A 4DQSA 3BJYA 4BWMA 4J9KA 1ZJMA 4J9OA 4KN7A 4Q43A 5F9NA 4ECTA 3V7JA 4I2EA 5J29A 4R64A 3ETLA 4Q44A 2P6RA 1T8EA 4I29A 5IIOA 5L1JA 4DL7A 3RJHA 1SL1A 1TFRA 2ZTCA 5KG0A 1NJWA 1ZQQA 3QEAZ 3OGUA 2BDPA 8ICJA 1JXEA
chains in the Genus database with same CATH superfamily
1D9DA 1Z1BA 2PFOA 2ZJ5A 1TV9A 7ICPA 4NLZA 1Z4OA 2FPLA 3PNCA 1BPXA 2BR0A 2J6SA 5KL8B 2QKQA 4ELUA 2H3QA 4F5QA 2KG5A 4RUAA 4F93B 4I2GA 3RB0A 3BQ2A 7ICEA 2BCUA 5DQHA 5DGBA 4C8KA 5KG2A 4QZ8A 3JPPA 5AK3A 2AGQA 1GO3F 2KZZA 4EYHB 2WB1C 2FPMA 5AKIA 1FEZA 1KW4A 3V7LA 8ICGA 1U48A 1ZJNA 5L1LA 4OCZA 3AEVA 4ELTA 1L3SA 1T4GA 2HMXA 3OHAA 7ICHA 3SAFA 2C2DA 5B5EU 2WFAA 3RBDA 3E58A 8ICKA 1SV0C 1CEZA 5F3XB 3KHGA 2UVRA 2KTQA 3RAQA 2W9MA 3OJSA 2G07A 5J8YC 2BCVA 2WF9A 4UB4A 1X2IA 4FZMA 2LI6A 3QX7A 5J2FA 4O3SA 2ZUDA 5ALLA 4QIWF 4ECVA 3M6ZA 9ICCA 2G5IB 2W03A 3TADC 3DV9A 4QZHA 5ALXA 3PVXA 2KJ5A 4RQ5A 3MR2A 4PH5A 4EX6A 5J0SA 2WAQC 2MA1A 4DSEA 3T5LA 4O3QA 5BOMA 5KG6A 4IQVA 4UAUA 4IQUA 3T5JA 4ECUA 5ALEA 2ZIUB 1ZQBA 3IV6A 2W43A 4J9MA 3CYMA 4Y2YA 4R65A 1XSLA 3AN1A 4QZCA 2ASJA 2KHVA 4EELA 2FJ6A 7ICNA 4F91B 2XGPA 4WJ3B 1UPHA 2WB1F 2OYYA 4I27A 2MRLA 5TISU 2RDJA 1FIQA 1ZD2P 3RJKA 3KFUF 5HR6A 5KTQA 1VLBA 2FE9A 2F8LA 4CE6A 1ZQWA 3Q8LA 1RDFA 3N7SC 3GV8B 1ZQPA 2PFNA 3N7PD 1U45A 1ZQLA 3PW5A 3EUB2 4J9QA 3RH5A 3M8RA 5F9LA 4KX5A 4ECWA 1TAMA 5KFZA 3RJEA 1KBUA 2VIXA 4DQIA 3L5KA 1FFVA 2IHMA 3IDWA 1X9XA 1XNSA 3H7IA 4DLGA 5CRXA 1CRXA 5J0RA 5CR0A 4RQ3A 5ALZA 2FMPA 4QW8A 4UAZA 3C2MA 5J2EA 3H40A 5AKYA 1KTQA 3T79A 4F72A 4JMUA 8ICFA 4G9BA 5KNIA 9ICUA 5J0TA 1NJYA 2OEHA 5AI8A 1SL2A 3D2QA 3OSNA 2XC9A 3MR5A 2H3FA 2MU2A 4X5VA 1KDHA 4IRDA 1UT8A 3SMVA 5KFMA 4I2HA 1NK7A 4M9NA 4K4IA 2QARA 5IILA 3ZD8A 5DB7A 1UCVA 4YCXA 2FMQA 2RP5A 5J0QA 5DLFA 5D49A 4FZLA 5B66U 3RB6A 1ZQIA 2J6UA 2KZMA 5AK4A 2Y1IA 3D2NA 4O9MA 4DSIA 3KBBA 5AKHA 2JHDA 2I9GA 3GIMA 1SXDA 5CEHA 1OW5A 2H3IA 3B9JA 4R8UB 2F76X 4LZDA 3V6KA 5AKKA 5DB8A 2YB1A 3RRGA 8ICCA 4BXOA 4DL6A 5KT3A 2Y0SC 4RZRA 1B43A 3BS7A 1UQVA 5KFBA 5DBBA 4NLBA 5KFWA 4TUSA 3IG5A 5KG1A 5KT7A 2F1HA 3EPGA 3PO4A 4KN4A 5ALHA 3PZPA 4ED2A 4B9LA 4OJ5A 5KT4A 4F4YA 2KMDA 3CNHA 2VA8A 1PK1A 3PX4A 2W9CA 4US9A 3ISBA 5KFVA 4C4RA 4YMOA 2IA6A 3UMCA 2C28A 1MN8A 1X66A 4Q8EA 1ZQKA 3L4PA 4I2IA 4UB3A 1SKRA 5GTHU 1A77A 2ZG6A 2GOLA 3T5HA 4DL5A 2ZUCA 1ZQYA 1IXRA 5DQGA 4DEZA 1S97A 4O3NA 2DBYA 3NUQA 7ICSA 5D4BA 3L3FX 2VKQA 1Q3VA 5FP0A 1A6SA 4JV0A 4FBUA 2ZIXB 3VCBA 3V6HA 4AP9A 4RU9A 4Q45A 1NK8A 1ZQCA 4IR1A 4NLKA 1DGSA 2CPRA 2NYVA 3F5AA 2XY5A 7ICMA 2YB4A 1T7PA 1BPBA 5IIJA 3LWMA 4RQNA 3G6YA 2FPKA 2D6FC 5AKJA 3UQ2A 1XSPA 1LKYB 5AI9A 5DBCA 4MF2A 2W9CB 3SR6A 1F5SA 3AU2A 1N5WA 3PR4A 2F8KA 1X9SA 5CB1A 1NZPA 2VA3A 3TKAA 1K1SA 4B9UA 3K1ZA 4FE3A 5J0WA 4F5PA 2LYHA 5IIMA 2WF7A 2LM4A 3JPRA 3HILA 4DQSA 4RQ6A 2JR5A 4O3MA 5ALYA 2GLEA 4NWIA 5J8YA 4I2EA 5J29A 3F5EA 3ETLA 2HI0A 4CF3A 3KD3A 4I29A 1SB3C 5ALDA 8ICJA 4ED1A 3PY8A 4PHDA 1QSLA 3SD7A 2AJQA 5BOLA 5KFRA 2NV3A 4I2AA 5AI6A 1B0XA 4P4PA 2G06A 2OCEA 4BJQA 3PW0A 4ED0A 5IIIA 3H0LB 3OHBA 1ED1A 3ED5A 3WK7A 3A0HU 4DFMA 2NRTA 3J81j 1MSWD 2E8NA 3WK4A 1ZQFA 3HRDD 5HR7A 5AM5A 4PZOA 3PV8A 4J9PA 2EANA 1COOA 4F5NA 2YQEA 2WHEA 7ICQA 4U7CA 3LK9A 1WCLA 4TQSA 2KJ9A 5HMMA 3LYSA 2ZUBA 1Y88A 3ONNA 3GZFA 2HBKA 3C29A 1KN5A 1JRPA 4I28A 4P0PA 3WK8A 4J03A 2EZYA 5AIAA 4BDPA 2GH1A 4IR9A 2K4IA 3RJJA 2EZXA 5KFCA 8ICTA 4GC6A 1IM4A 5AKZA 3HKZC 4ZH4A 2ASDA 4KLEA 1BNPA 3QNMA 4MFAA 4NLNA 3C1ZA 2HHUA 3H0MB 2XIDA 4JUZA 3NVVA 1BGXT 1XWLA 1S10A 4GXJA 3KOOA 4EENA 3ZDBA 3QZ7A 2W8LA 4RQ2A 4B9SA 2UVVA 5EE9A 3PSTA 4ED7A 4DOCA 4C4SA 3ZD9A 4ECQA 1L7PA 4YG2A 5HMLA 2W55A 3RB4A 4UAYA 4C0ZA 9ICAA 1XU4A 2G09A 3IHQB 3SEIA 3HJEA 2EQYA 4C7YA 2F1IA 7ICUA 5AI5A 2KE7A 2M0NA 3HPOA 1T94A 1S77D 4DLEA 3KHLA 4I2DA 1S0MA 9ICXA 4YR0A 3KKAA 3V6JA 1COKA 2F77X 1S5LU 3F2DA 1TK0A 4ED3A 4LJXA 4XUSA 1X6JA 3ZI4A 2CRXA 2ZJ8A 3T3FA 2ALZA 2MUTA 3RH4A 1DK3A 4IQTA 3U26A 5DKWA 2EZZA 1ZQVA 2KHQA 5GTIU 2E1FA 3GU3A 1SZHA 5C5JA 2K4EA 4QWAA 4DS4A 4IC9A 4M9JA 4LVSA 3WK9A 1ZQGA 2HCFA 2J6TA 2BQUA 4KX3A 1BPZA 4UAVA 2KICA 5L1MA 1WCNA 4CCHA 3JPOA 1NJXA 1NI3A 4P2HA 4F50A 1KRPA 5ALSA 3C5FA 1F44A 8ICLA 7ICKA 2HHXA 1JALA 1U49A 1ZQMA 4NM1A 2LYBA 5JU5A 4QJFB 4FBTA 3CW2C 3BS5A 5AKLA 4IRKA 4F92B 4J9SA 5DG7A 4F4KA 2PFQA 1B4FA 4MF8A 3NVZA 3F2CA 5C0YA 4R66A 4LZGA 5CWRA 1DK2A 2OHFA 2BKEA 4QNLA 1YZ6A 4M9HA 5KFIA 3OJUA 3WKCA 3HW8A 3KZXA 4Y2VA 3HX0A 1FFUA 1D8LA 3TADA 1N48A 4IS7A 3F2BA 3H8JA 1BVSA 4CRXA 4EX7A 1V97A 2XVTA 3EW9A 4Z6FA 4ECYA 2B0CA 4PGXA 3NVYA 1UA1A 5ALKA 5DG8A 4M47A 5DGAA 3K4GA 2JEIA 1VJ5A 4YMNA 4P0PB 2OH2A 2DKZA 1L6NA 4QZ9A 5HP4A 4TURA 1XSNA 5J2CA 4US8A 8ICVA 4QZEA 1BPYA 4HAIA 7ICFA 3BS5B 1SKSA 4ZOHC 2YTUA 5ALNA 1LB2B 3VC8A 2HW3A 1U9LA 3LWLA 2JMGA 2AHOB 5KFXA 4CGZA 2AQ0A 4QIWC 3M6KA 1TK8A 4Z6CA 2PKEA 5KT6A 4YXMA 3CP8A 2JRZA 4BWJA 4KITB 3D6JA 5KG5A 3O0FA 2AXTU 2ISOA 2FLNA 3LVWA 5DB6A 4F4XA 2W3SA 4DL3A 3SI8A 1ZD4A 9ICGA 4KLJA 3TFSA 4F8RA 3NGDA 2ASLA 2A1JB 4FS1A 1ZQEA 3UMBA 3JPSA 2FMSA 1SZPA 4C8OA 3ICXA 3GDXA 4PJ0U 5J2GA 2PMZF 1ZQXA 2E3TA 3DDHA 3RR7A 3G6XA 5J0UA 4M0AA 1PK1B 4KLQA 5DDYA 4KMOB 1Z00B 2KVSA 1JMSA 1JROA 1X40A 2HSZA 2I1QA 3WKAA 1V85A 1RPLA 3ISDA 3RJFA 3TFRA 4PGQA 3GQCA 4F5RA 3QU9A 1BNOA 2WF8A 4UBCA 3Q8MA 4IL6U 1L5UA 2KSOA 1SGGA 4DCCA 2LMRA 1LV5A 1UT5A 4F3OA 3QEBZ 3HT3A 2EH9A 5ALIA 3Q8KA 4PHPA 3NRWA 9ICQA 3JPTA 2BCSA 3RJGA 2K8BB 4KMUA 4YFKA 1V38A 1KKXA 3TAPA 3H8MA 2W8KA 4OJPA 5G5GA 2R8JA 1WYGA 2PXIA 2JH1A 1T3NA 4TUPA 1NK5A 5BPCA 4ECXA 5J2HA 4M6WA 1NKBA 5KAFU 1SV0A 4DL2A 5DLGA 3V72A 3N7RC 4UQGA 3THVA 2IOHA 1TAUA 3I28A 1LKYA 2F3NA 4YMMA 2ZIUA 3FM9A 4M9GA 4O3OA 4GXIA 5IINA 2E8MA 2VJ5A 3DEEA 4NLCA 1C7YA 1QSYA 4EBCA 4BX9C 1KEJA 1L8OA 1S8OA 4BWMA 5KAIU 4OJOA 4KN7A 5A0LA 4ECTA 3I1YA 4R64A 1T8EA 4DL7A 1O08A 1SL1A 3QEAZ 3OGUA 2BDPA 1QH9A 4ICAA 1RQNA 4RQ4A 4YR3A 3Q8PB 8ICYA 7ICLA 4UASA 1TAQA 1X9MA 2XY7A 4YD1A 1X42A 3MGHA 8ICNA 5AM2A 3MC1A 9ICTA 4KLMA 2VA2A 1ZETA 2YY6A 3IN5A 5EE1A 2KKVA 3SQIA 5E79U 5KG4A 3AU6A 1MQ3A 4PHEA 1SIJA 4KLSA 1QLNA 1V9PA 3S6JA 2KZ3A 4ACOA 3PW7A 2R8GA 3GFKB 1DGJA 1N63A 2BCRA 5KFYA 4NLGA 2NRZA 3RRHA 2BPGA 1BPEA 2F1JA 3IM1A 2DPJA 1SV4A 3PR5B 1N5XA 4Y2SA 3N4MB 1A0PA 1XO0A 2E8PA 1FO4A 3PW2A 3Q8QB 5CJ7A 4G3IA 1S9FA 1B22A 3EWAA 5TZVA 1WG8A 5ALFA 2ZXHA 2JH7A 3RFAA 5KFTA 5HHHA 8ICRA 9ICVA 2PFPA 5EWFA 4ED6A 8ICBA 5KFKA 5J2KA 3QU4A 1MQ2A 3N28A 1NJZA 2N1RA 2K8AA 3I76A 5KFDA 4J9RA 5AM3A 2RDIA 1EXNA 1RYRA 5KFPA 2HHTA 4DF8A 2QARB 2E1EA 1RM6C 1KFTA 1Z00A 2E8OA 2W9BB 3IP4B 3H8SA 4KLIA 3UXNA 3EPIA 4QWEA 4TQRA 3RF9A 3GIJA 4DFPA 4UW9A 2GWSA 5IIKA 1JXLA 2KP7A 3FAHA 4DOBA 4JWMA 4KTQA 2H5XA 2LKYA 5K4LA 3SZ2A 3PO5A 1JUDA 1ZRNA 4QWDA 4Y2XA 3PW4A 2Y1JA 4B9VA 4M9LA 1ZQHA 9ICSA 2UVWA 1J2MA 5ALWA 4DSLA 4BXOB 4RPXA 3C2KA 4XQ8A 5KT2A 1ZD5A 4UATA 4XRHA 4GLXA 2EAMA 3BZCA 3GV5B 3QUBA 4M6WB 1S76D 5AIBA 2LHTA 4ECRA 1JN3A 9ICJA 2FDRA 3B0XA 2HBJA 2XCAA 4KLUA 4CF5A 3RAXA 4RQMA 1NK0A 2W04A 2BQRA 4YVZA 4DL4A 5EOZA 1NK6A 2MUTB 4F2SA 1JI7A 2XI9A 4UAWA 2OM6A 1LVHA 2KIVA 1K5OA 5ALTA 3GILA 3H8WA 2XCPA 3PX0A 2JXJA 9ICLA 1AQ6A 3UPQA 2DUYA 3H0RB 7ICIA 3ETRA 4F4ZA 4MEYA 4F5OA 8ICHA 2RLTA 3KHHA 4RNMA 4CNQA 2W3RA 4MEXA 2R18A 4EEYA 2LBOA 1HJPA 1RYUA 4O3PA 5AICA 3WKBA 1Q8KA 2OXOA 1ZQJA 3PSIA 2C22A 2F2AB 2KOBA 1N60A 2P35A 4C80A 2XGQA 3QUQA 3WK6A 1D8BA 7ICVA 1PVQA 5AK5A 4RNNA 1MC8A 3GIIA 2KJ8A 2C2RA 5EE3A 2XO7A 3QE9Y 5ALRA 4EYIB 5KG7A 4EBDA 3WKDA 9ICNA 4MFCA 5ALGA 3F53A 2VANA 2YMPA 1U4BA 2GO7A 5JRTA 2V4RA 5H2FU 7ICOA 2HHQA 2PMZC 3BQ0A 4ECSA 1S0OA 8ICIA 3BDPA 4O3RA 3TACB 2D8CA 2KNJA 3TANA 1Q3UA 4KLDA 3B0YA 3M1YA 2HOFA 7ICGA 1BPDA 9ICRA 2NO4A 1N62A 3BZKA 2W54A 2NRWA 4GXKA 2FI1A 2LM1A 4DQRA 1QQ6A 1K1QA 3M9MB 5L1IA 4RNOA 1PVPA 3MR3A 2WAQF 1J2NA 5JUMA 4UBBA 4ED8A 2AGPA 1NKCA 4KLTA 1L7MA 4EBEA 4QW9A 5L9XA 4QZIA 4JWNA 8ICQA 5CA7A 3EYZA 1S0VA 3JPQA 3MDAA 4DQQA 2JZBA 5CP2A 5T14A 1OUQA 2FLPA 1URJA 2Z7JA 4C8LA 5ALVA 1SKWA 1HUZA 4JV2A 4YQWA 4A8EA 9ICPA 2F44A 3PSFA 4O5EA 2HHVA 5DQIA 1QQ7A 5AHXA 4DOAA 3UM9A 2ZXIA 5HHIA 4I2FA 3UXOA 3LVVA 4PL1A 2IMWP 2IOFA 3QU7A 4UB8U 4MHVA 3OPXA 3MFHA 2ZTEA 1ZYQA 5KFEA 5KFAA 1PVRA 2OWOA 4RQ1A 2DPIA 2YMMA 3E0FA 3MDCA 1ZQ1C 3KZIU 2B21A 5HNKA 1QQ5A 3BQ7A 1L7OA 2I5HA 1ZRMA 1ZXIA 4F2RA 4HYKA 1UA0A 3M9OB 4YN4A 1KFDA 3SV3A 1M6YA 1ZQUA 1L3TA 4PGYA 4Y2UA 9ICHA 4RQ0A 2A1JA 2D3DA 1N2XA 1KSPA 3C23A 3QZ8A 2UVUA 3PSPA 2QLTA 1NK4A 1U47A 3TAQA 5ALJA 1RXWA 4GIBA 1ZQZA 2HBMA 1PUZA 2JZBB 4DQPA 9ICOA 2H3ZA 8ICZA 2ZIWB 2K4HA 1KL9A 2LYAA 3D2SA 4NV0A 3SAGA 2IHNA 1L3VA 1KQQA 8ICMA 2CXYA 2HVHA 4AYBF 2R8KA 2KSOB 5J2AA 2NRXA 2ATLA 1C20A 2HOIA 4DWIA 2C2EA 4P4MA 2L5YA 4NJ8A 5AI0A 3HP6A 3R9KA 3N97B 3TARA 3UXPA 1ZD3A 2MAXA 1PZNA 4Z6EA 4UB1A 2G5HB 5J2DA 1Z1VA 1HUOA 3RH6A 4E0DA 3GIKA 2BPFA 5J0XA 7ICTA 3C1YA 2K4PA 2JV3A 8ICAA 5CHGA 4J9KA 2ZIVA 1ZJMA 4J9OA 4GFJA 4Q43A 4Q44A 3M7DA 5IIOA 1WWVA 3AL0B 1QCKA 1ZQQA 2I6XA 5G5HA 1UHUA 1L8LA 5ALOA 4BUGA 1XO1A 2KD1A 3JPNA 3AQEA 4J9NA 4UARA 4PZNA 5AM4A 3RTVA 2BPCA 2ZIWA 3RB3A 1NK9A 2W7PA 4NY8A 1IV8A 2AQ4A 1ZQRA 9ICKA 4CDGA 2YMQA 5ALMA 4O5KA 3HWTA 4TUQA 2H3VA 4QZBA 2YX8A 1L7NA 3PMLA 3MGVA 3SV4A 2HBLA 1L3UA 2RHFA 4B9MA 3T5KA 4DF4A 2IBKA 2BQ3A 5ALUA 1DRGA 4QZDA 2JEGA 3ZDAA 1ZOLA 4IRCA 3C5GA 4NXZA 3AMZA 1SXEA 1D8YA 4PPXA 2V4QA 3EZ5A 5AKXA 2QB1A 3FC4A 1ZQTA 4EZ9A 3K1RB 3OSPA 8ICSA 4K4HA 4K4GA 2E5SA 4DSKA 3TI0A 2WF6A 8ICOA 4JK1A 3M8SA 4Q8FA 3AQFA 3IG8A 2ES6A 2WF5A 2P66A 1TE2A 1VDVA 1KLNA 4RT2A 2ZTDA 2K8CB 2NO5A 5KFFA 1ZQDA 3AUOA 4ELVA 8ICXA 2QB0B 5AK6A 3MBYA 4C8NA 2O6KA 4QZGA 1ZQAA 4YP3A 2HDOA 4C4TA 2FLLA 4DSJA 4RPYA 2Y9UA 2YMLA 5KL1B 2DQNB 3LDAA 3IRUA 2EAPA 1S0NA 3KTQA 5JTIA 5J2BA 3KHRA 5KG3A 1F0MA 1T3QA 4DFKA 1AROP 4M04A 3H4DA 5KFHA 4B9TA 3H4BA 2RRDA 1RZTA 5J2JA 2HOQA 2PI4A 5EE0A 5KFNA 2W9AA 4Y2RA 2G0AA 4QWBA 2KFNA 2HVIA 1XC9A 2W11A 4KLHA 4MFFA 3WU2U 4B6JA 3Q8SB 4C7ZA 3QU5A 3ISCA 2W7OA 4P0QA 3NRZA 4FFDA 5KFJA 4KLOA 5ALPA 4IQWA 1RYSA 3WK5A 5KFOA 2LPEA 4M2YA 4AYBC 4UB6U 1Q46A 2KV2A 2NRVA 3NASA 1PK3A 1Z3EB 4QZFA 4I2CA 5DB9A 8ICPA 1TKDA 4F71A 3NVWA 4P4OA 1IIPA 3NS1A 4OJLA 2ZIVB 4DS5A 4O5CA 1ZQOA 1XS9D 1NZBA 8ICWA 1NKEA 3MABA 1DXSA 5KFGA 5DBAA 3ZDEA 4QWCA 1O03A 2RQ5A 3QU2A 2Y0SF 4UB2A 1H38A 4NL9A 2HHSA 2B6GA 2A3VA 2Q0ZX 3QXGA 4RPZA 3ZDDA 8ICEA 4U6PA 3C21A 2A1AA 2KVCA 3QUCA 2AGOA 8ICUA 4P0QB 2M9NA 4YD2A 2AU0A 2BCQA 3UMGA 4PHAA 2KIWA 5AM0A 4DFDA 5EWEA 1N56A 2EAOA 3V7KA 3MR6A 3FDSA 2ODGA 1CI4A 1ECWA 9ICMA 2KN7A 3BQTA 3PX6A 4FZNA 4Y2TA 4R8UA 3SYZA 1NNLA 5KFSA 1YT3A 1QTMA 4YXJA 5J0PA 3MGIA 4FO6A 4RQ8A 3ZDCA 1A76A 3G6VA 4XA5A 2EDUA 1ZQNA 9ICWA 5AM1A 3OTQA 4GC7A 2BZFA 1KFSA 5D46A 4I2BA 1WWUA 1Z19A 2AH5A 4FS2A 1HIWA 3E2EA 3BQ1A 4C8MA 1TK5A 3RR8A 1Z4NA 4OJ6A 4KLFA 2QB0A 5ALQA 2XY6A 4QZAA 1IG6A 2XICA 3SAHA 4NM2A 9ICIA 4RT3A 4RUCA 2JEFA 4BGDA 1MA7A 4DFJA 2BHNA 5AKEA 4EZ6A 3PMNA 2DL0A 1DOQA 4OO1J 2KEYA 7ICJA 2PI5A 3ORYA 3MFIA 2DF4B 5L1KA 9ICEA 4YR2A 1RQLA 2KK0A 4Y2QA 4J9LA 7ICRA 5DDMA 2KFZA 4F4WA 2BDUA 2ZIXA 2R8IA 9ICBA 4I2JA 1SWWA 5DG9A 2P6UA 4DSFA 4KLGA 2G08A 1JIHA 1WUDA 1TVAA 2V9WA 2BGWA 4DO9A 1P7DA 1CUKA 3C2LA 3UQ0A 1X9WA 5J0OA 3HKZF 2ESEA 5KFUA 3RBEA 1RXVA 2ISPA 3K75D 1QSSA 2K89A 4NL9C 2CN1A 5AKGA 4USAA 1JX4A 4B9NA 1HEKA 3KKAC 4ECZA 1SL0A 2VJ4A 3C28A 5J2IA 4UB5A 3ALRA 5EWGA 5J0YA 4KLLA 3QUTA 4EEKA 5KFLA 1J97A 2Q4TA 4RQ7A 2IOFK 2JEJA 3QYPA 4PL2A 3SENA 4Y2PA 3RJIA 1ZQSA 3AM9A 3TQ1A 1N61A 4JB3A 1D9FA 2YN4A 9ICFA 2K60A 4O0IA 1X6IA 3GV7B 2W9BA 4R63A 2DKXA 5KFQA 3NTUA 1YZ7A 3WKEA 1SWVA 2DGZA 5AI4A 2HHWA 3Q8RB 2ZJAA 3A0BU 4CF4A 2DFLA 2JGAA 4Z6DA 5KT5A 2KKPA 3M9NB 2A19A 4OD0A 2WTFA 3CRXA 4Y2JA 4JV1A 1RG6A 3FYHA 1NOMA 2Y9TA 2MSNA 2R8HA 3BJYA 1OXJA 2DWQA 5F9NA 3V7JA 2P6RA 5L1JA 3RJHA 1TFRA 2ZTCA 5KG0A 1NJWA 1JXEA
chains in the Genus database with same CATH topology
4YR3A 4RQ4A 4PHDA 3Q8PB 1D9DA 3PY8A 8ICYA 7ICLA 1TAQA 1QSLA 2PFOA 2AJQA 2ZJ5A 1XO1A 1TV9A 5BOLA 3JPNA 4J9NA 1X9MA 2XY7A 4YD1A 3MGHA 5KFRA 3RB3A 3RTVA 2BPCA 2FPLA 1NK9A 4NY8A 4NLZA 8ICNA 2AQ4A 4I2AA 9ICTA 3PNCA 1ZQRA 9ICKA 4P4PA 1BPXA 4KLMA 2BR0A 2J6SA 2VA2A 1ZETA 4ELUA 4F5QA 4O5KA 3HWTA 4RUAA 4TUQA 3PW0A 4F93B 4ED0A 4I2GA 3RB0A 3BQ2A 5IIIA 3OHBA 7ICEA 4QZBA 2BCUA 5KG4A 5DQHA 5DGBA 4DFMA 3PMLA 3AU6A 4C8KA 2NRTA 1MQ3A 4PHEA 1MSWD 5KG2A 1ZQFA 4KLSA 3SV4A 1QLNA 1L3UA 4B9MA 4QZ8A 3JPPA 3T5KA 2AGQA 4DF4A 3PV8A 2IBKA 4J9PA 1V9PA 2KZZA 4EYHB 2BQ3A 1COOA 2FPMA 2KZ3A 4F5NA 3PW7A 4QZDA 2JEGA 3ZDAA 7ICQA 2R8GA 3GFKB 3V7LA 3LK9A 4IRCA 1WCLA 3C5GA 8ICGA 1U48A 1ZJNA 4NXZA 5L1LA 2BCRA 4TQSA 5HMMA 2ZUBA 1Y88A 5KFYA 1L3SA 4ELTA 1T4GA 1D8YA 3OHAA 4NLGA 2NRZA 7ICHA 4PPXA 2V4QA 3RRHA 3EZ5A 2BPGA 2C2DA 1BPEA 2F1JA 3RBDA 8ICKA 3IM1A 1ZQTA 2DPJA 4EZ9A 3PR5B 1CEZA 3KHGA 4I28A 2UVRA 3OSPA 2KTQA 8ICSA 3N4MB 4K4HA 3RAQA 4K4GA 2W9MA 3OJSA 4BDPA 4DSKA 3PW2A 4IR9A 3Q8QB 3RJJA 5CJ7A 2BCVA 3TI0A 1S9FA 4G3IA 4UB4A 1X2IA 1B22A 8ICOA 4JK1A 5J2FA 5TZVA 3EWAA 5KFCA 3M8SA 4O3SA 4Q8FA 8ICTA 4GC6A 1IM4A 5HHHA 4ZH4A 5KFTA 2ASDA 2ZUDA 4KLEA 2PFPA 8ICRA 9ICVA 4ECVA 5EWFA 4ED6A 2P66A 8ICBA 9ICCA 5KFKA 5J2KA 1MQ2A 1KLNA 4MFAA 4NLNA 4RT2A 2ZTDA 3C1ZA 2HHUA 1NJZA 5KFDA 4J9RA 4JUZA 2RDIA 5KFFA 1BGXT 1XWLA 1EXNA 4QZHA 1S10A 1RYRA 1ZQDA 5KFPA 3AUOA 4ELVA 4GXJA 3PVXA 8ICXA 2HHTA 3MBYA 3ZDBA 3QZ7A 9ICLA 4C8NA 4DF8A 4RQ5A 2W8LA 3MR2A 4PH5A 1KFTA 4QZGA 1Z00A 4RQ2A 7ICPA 4B9SA 2UVVA 1ZQAA 4ED7A 4YP3A 4DOCA 2W9BB 2FLLA 5J0SA 4DSJA 3ZD9A 3H8SA 4RPYA 4ECQA 4DSEA 4KLIA 3T5LA 4O3QA 3UXNA 4YG2A 5BOMA 3EPIA 4QWEA 5HMLA 5KG6A 3LDAA 4IQVA 1S0NA 3RB4A 3KTQA 4UAYA 4TQRA 5J2BA 3GIJA 4DFPA 3T5JA 4IQUA 4ECUA 3KHRA 9ICAA 2GWSA 1XU4A 5KG3A 5IIKA 1JXLA 3IHQB 7ICSA 1ZQBA 4DOBA 2F1IA 4DFKA 7ICUA 4JWMA 4KTQA 2H5XA 1AROP 3HPOA 3PO5A 3SZ2A 4J9MA 4M04A 1S77D 3H4DA 4R65A 5KFHA 4B9TA 4QWDA 3H4BA 1XSLA 4DLEA 1RZTA 3KHLA 3PW4A 2Y1JA 5J2JA 4B9VA 4I2DA 4QZCA 2PI4A 1S0MA 9ICXA 2ASJA 4M9LA 1ZQHA 4YR0A 5KFNA 9ICSA 3V6JA 2W9AA 2KFNA 4QWBA 2UVWA 7ICNA 4F91B 2HVIA 1XC9A 2XGPA 4KLHA 4MFFA 4DSLA 4BXOB 4RPXA 3C2KA 1TK0A 4XQ8A 5KT2A 4ED3A 3Q8SB 4I27A 4XUSA 2RDJA 3ISCA 4XRHA 4GLXA 2ZJ8A 3T3FA 2ALZA 3RJKA 2MUTA 3GV5B 4M6WB 3RH4A 4IQTA 1S76D 5KTQA 5KFJA 4KLOA 4IQWA 1RYSA 4ECRA 1ZQWA 5DKWA 1JN3A 9ICJA 5KFOA 1ZQVA 3B0XA 3Q8LA 2XCAA 4M2YA 4KLUA 2NRVA 3RAXA 5C5JA 1NK0A 3GV8B 1Z3EB 4QZFA 4QWAA 4DS4A 4M9JA 4LVSA 1ZQPA 1ZQGA 2PFNA 2BQRA 4YVZA 4DL4A 5EOZA 1U45A 1ZQLA 1NK6A 2J6TA 4I2CA 3PW5A 5DB9A 2BQUA 2MUTB 1BPZA 4J9QA 3RH5A 1TKDA 4F2SA 8ICPA 3M8RA 4P4OA 5F9LA 4UAWA 4ECWA 5KFZA 3RJEA 1WCNA 4CCHA 3JPOA 1NJXA 4DS5A 4DQIA 4O5CA 1ZQOA 1XS9D 3GILA 3H8WA 2XCPA 3PX0A 2IHMA 4F50A 1KRPA 1NKEA 4P2HA 8ICWA 3MABA 3C5FA 3UPQA 8ICLA 5KFGA 5DBAA 3H7IA 7ICKA 3ZDEA 2HHXA 1U49A 4DLGA 1ZQMA 4NM1A 4QWCA 5J0RA 5CR0A 7ICIA 4RQ3A 4FBTA 2FMPA 4F4ZA 4MEYA 4F5OA 4QW8A 4UAZA 4UB2A 8ICHA 3C2MA 3KHHA 5J2EA 4RNMA 3H40A 1H38A 4IRKA 4MEXA 1KTQA 4F92B 4J9SA 4EEYA 1HJPA 5DG7A 4F4KA 8ICFA 2PFQA 2HHSA 4O3PA 2Q0ZX 4MF8A 9ICUA 1ZQJA 5J0TA 2C22A 4RPZA 1NJYA 3ZDDA 4R66A 8ICEA 3C21A 4LZGA 1SL2A 3OSNA 5CWRA 2XGQA 2XC9A 3MR5A 2BKEA 2AGOA 7ICVA 8ICUA 4X5VA 1KDHA 5KFIA 4M9HA 4IRDA 1UT8A 3OJUA 4RNNA 2M9NA 1MC8A 3HW8A 4YD2A 5KFMA 3GIIA 2AU0A 2BCQA 3HX0A 4PHAA 5EWEA 4I2HA 2C2RA 1N56A 2XO7A 3QE9Y 1D8LA 4EYIB 5KG7A 3V7KA 4EBDA 1NK7A 1N48A 3MR6A 4M9NA 4MFCA 4K4IA 9ICNA 3FDSA 3H8JA 2VANA 1U4BA 1BVSA 5IILA 9ICMA 7ICOA 3ZD8A 5DB7A 3EW9A 2KN7A 2V4RA 2HHQA 3BQ0A 4Z6FA 4ECYA 3BQTA 4PGXA 4YCXA 2FMQA 4ECSA 1S0OA 3PX6A 1UA1A 5DG8A 4M47A 8ICIA 5J0QA 3BDPA 5DGAA 4O3RA 3K4GA 4R8UA 5DLFA 3TANA 2JEIA 4YMNA 4KLDA 3B0YA 5D49A 7ICGA 3SYZA 1BPDA 9ICRA 1ZQIA 3RB6A 5KFSA 4QZ9A 2J6UA 2KZMA 5HP4A 2Y1IA 1QTMA 4O9MA 4YXJA 5J0PA 4DSIA 4TURA 3MGIA 2NRWA 9ICHA 4FO6A 4GXKA 4RQ8A 3ZDCA 1A76A 4DQRA 1XSNA 2I9GA 1K1QA 3M9MB 3G6VA 3GIMA 5J2CA 4XA5A 8ICVA 4QZEA 1BPYA 5L1IA 4RNOA 7ICFA 1ZQNA 3MR3A 9ICWA 1SKSA 5JUMA 4GC7A 4UBBA 4ED8A 2AGPA 1NKCA 1KFSA 4KLTA 5D46A 4R8UB 4EBEA 1LB2B 4I2BA 4LZDA 3V6KA 4QW9A 5DB8A 5L9XA 4QZIA 4FS2A 3RRGA 4JWNA 2HW3A 3E2EA 5CA7A 3BQ1A 4BXOA 8ICQA 4C8MA 1U9LA 1TK5A 3LWLA 4DL6A 3RR8A 3EYZA 5KT3A 4KLFA 1S0VA 5KFXA 3JPQA 2XY6A 3MDAA 4DQQA 4RZRA 2JZBA 1B43A 5CP2A 4QZAA 2AQ0A 2FLPA 1TK8A 4NM2A 9ICIA 4C8LA 5KFBA 4Z6CA 1SKWA 4RT3A 5DBBA 1HUZA 4RUCA 4JV2A 4YQWA 4BGDA 5KFWA 5KT6A 4TUSA 4DFJA 4YXMA 2BHNA 5KG1A 2JEFA 9ICPA 4KITB 4BWJA 5KT7A 4EZ6A 2F1HA 5KG5A 3PMNA 4O5EA 3EPGA 2HHVA 5DQIA 3PO4A 1DOQA 4KN4A 2ISOA 4DOAA 4ED2A 2FLNA 5HHIA 4B9LA 4I2FA 3UXOA 5DB6A 4F4XA 5KT4A 4F4YA 2IMWP 7ICJA 2PI5A 3ORYA 3MFHA 2ZTEA 4DL3A 3SI8A 2VA8A 3PX4A 3MFIA 2W9CA 1ZYQA 5KFEA 5L1KA 9ICEA 9ICGA 3ISBA 5KFVA 4KLJA 5KFAA 4YR2A 4YMOA 4J9LA 3TFSA 4RQ1A 5DDMA 2OWOA 2IA6A 4F8RA 2KFZA 7ICRA 3NGDA 4F4WA 2DPIA 2R8IA 2C28A 4Q8EA 9ICBA 4I2JA 2ASLA 3MDCA 4I2IA 4UB3A 1SKRA 1ZQKA 5DG9A 2A1JB 4FS1A 1ZQEA 3JPSA 2FMSA 1SZPA 2B21A 4C8OA 5HNKA 3GDXA 2P6UA 1A77A 4DSFA 4KLGA 3T5HA 4DL5A 1JIHA 2ZUCA 8ICCA 1ZQYA 1IXRA 5DQGA 4DEZA 1TVAA 5J2GA 1S97A 2V9WA 4O3NA 1ZQXA 4DO9A 2BGWA 4F2RA 4ED1A 4HYKA 1UA0A 1CUKA 3M9OB 3C2LA 3G6XA 5J0UA 4YN4A 3UQ0A 5D4BA 1X9WA 3RR7A 4M0AA 5J0OA 4KLQA 5DDYA 1Z00B 1KFDA 1JMSA 3SV3A 4JV0A 5KFUA 4FBUA 2I1QA 1ZQUA 1L3TA 4RU9A 3V6HA 4PGYA 4Q45A 3RBEA 1NK8A 1RXVA 4RQ0A 1ZQCA 2A1JA 1RPLA 2ISPA 4IR1A 3ISDA 4NLKA 1DGSA 3K75D 3RJFA 1KSPA 3C23A 3QZ8A 2UVUA 1QSSA 3TFRA 4PGQA 3GQCA 4F5RA 1NK4A 4UBCA 1U47A 3TAQA 1RXWA 3Q8MA 1JX4A 4B9NA 1ZQZA 2XY5A 1L5UA 4ECZA 7ICMA 1SL0A 2JZBB 1T7PA 4DQPA 1LV5A 5J2IA 4UB5A 1BPBA 1UT5A 5IIJA 5EWGA 5J0YA 3LWMA 3QEBZ 4F3OA 4KLLA 9ICOA 3G6YA 8ICZA 3HT3A 5KFLA 4RQ7A 2FPKA 3Q8KA 2JEJA 4PHPA 9ICQA 3JPTA 3UQ2A 1XSPA 2BCSA 3RJIA 1ZQSA 4YFKA 4KMUA 2IHNA 1L3VA 3RJGA 8ICMA 5DBCA 3TAPA 3TQ1A 2HVHA 2W8KA 1D9FA 2R8KA 4MF2A 9ICFA 2R8JA 2PXIA 5J2AA 2NRXA 1T3NA 4TUPA 2W9CB 2ATLA 1NK5A 5BPCA 4O0IA 4DWIA 3GV7B 2C2EA 4P4MA 4ECXA 5J2HA 2W9BA 3AU2A 4R63A 4M6WA 1NKBA 5KFQA 3PR4A 3NTUA 3HP6A 4DL2A 5DLGA 3V72A 2HHWA 3N97B 4UQGA 1X9SA 3Q8RB 3TARA 3UXPA 3THVA 2ZJAA 2MAXA 1TAUA 1PZNA 2DFLA 4Z6EA 5CB1A 4UB1A 2VA3A 4Z6DA 5KT5A 5J2DA 4YMMA 1HUOA 3RH6A 4E0DA 4M9GA 4O3OA 3GIKA 1K1SA 2BPFA 3M9NB 5J0XA 4GXIA 5IINA 4B9UA 7ICTA 5J0WA 4F5PA 2LYHA 3C1YA 2WTFA 5IIMA 4JV1A 3JPRA 1C7YA 1QSYA 3FYHA 4EBCA 1NOMA 8ICAA 5CHGA 2R8HA 1KEJA 4RQ6A 4DQSA 3BJYA 4BWMA 4J9KA 1ZJMA 4J9OA 4KN7A 4Q43A 5F9NA 4ECTA 3V7JA 4I2EA 5J29A 4R64A 3ETLA 4Q44A 2P6RA 1T8EA 4I29A 5IIOA 5L1JA 4DL7A 3RJHA 1SL1A 1TFRA 2ZTCA 5KG0A 1NJWA 1ZQQA 3QEAZ 3OGUA 2BDPA 8ICJA 1JXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YR3 A;  4RQ4 A;  4PHD A;  3Q8P B;  1D9D A;  3PY8 A;  8ICY A;  7ICL A;  1TAQ A;  1QSL A;  2PFO A;  2AJQ A;  2ZJ5 A;  1XO1 A;  1TV9 A;  5BOL A;  3JPN A;  4J9N A;  1X9M A;  2XY7 A;  4YD1 A;  3MGH A;  5KFR A;  3RB3 A;  3RTV A;  2BPC A;  2FPL A;  1NK9 A;  4NY8 A;  4NLZ A;  8ICN A;  2AQ4 A;  4I2A A;  9ICT A;  3PNC A;  1ZQR A;  9ICK A;  4P4P A;  1BPX A;  4KLM A;  2BR0 A;  2J6S A;  2VA2 A;  1ZET A;  4ELU A;  4F5Q A;  4O5K A;  3HWT A;  4RUA A;  4TUQ A;  3PW0 A;  4F93 B;  4ED0 A;  4I2G A;  3RB0 A;  3BQ2 A;  5III A;  3OHB A;  7ICE A;  4QZB A;  2BCU A;  5KG4 A;  5DQH A;  5DGB A;  4DFM A;  3PML A;  3AU6 A;  4C8K A;  2NRT A;  1MQ3 A;  4PHE A;  1MSW D;  5KG2 A;  1ZQF A;  4KLS A;  3SV4 A;  1QLN A;  1L3U A;  4B9M A;  4QZ8 A;  3JPP A;  3T5K A;  2AGQ A;  4DF4 A;  3PV8 A;  2IBK A;  4J9P A;  1V9P A;  2KZZ A;  4EYH B;  2BQ3 A;  1COO A;  2FPM A;  2KZ3 A;  4F5N A;  3PW7 A;  4QZD A;  2JEG A;  3ZDA A;  7ICQ A;  2R8G A;  3GFK B;  3V7L A;  3LK9 A;  4IRC A;  1WCL A;  3C5G A;  8ICG A;  1U48 A;  1ZJN A;  4NXZ A;  5L1L A;  2BCR A;  4TQS A;  5HMM A;  2ZUB A;  1Y88 A;  5KFY A;  1L3S A;  4ELT A;  1T4G A;  1D8Y A;  3OHA A;  4NLG A;  2NRZ A;  7ICH A;  4PPX A;  2V4Q A;  3RRH A;  3EZ5 A;  2BPG A;  2C2D A;  1BPE A;  2F1J A;  3RBD A;  8ICK A;  3IM1 A;  1ZQT A;  2DPJ A;  4EZ9 A;  3PR5 B;  1CEZ A;  3KHG A;  4I28 A;  2UVR A;  3OSP A;  2KTQ A;  8ICS A;  3N4M B;  4K4H A;  3RAQ A;  4K4G A;  2W9M A;  3OJS A;  4BDP A;  4DSK A;  3PW2 A;  4IR9 A;  3Q8Q B;  3RJJ A;  5CJ7 A;  2BCV A;  3TI0 A;  1S9F A;  4G3I A;  4UB4 A;  1X2I A;  1B22 A;  8ICO A;  4JK1 A;  5J2F A;  5TZV A;  3EWA A;  5KFC A;  3M8S A;  4O3S A;  4Q8F A;  8ICT A;  4GC6 A;  1IM4 A;  5HHH A;  4ZH4 A;  5KFT A;  2ASD A;  2ZUD A;  4KLE A;  2PFP A;  8ICR A;  9ICV A;  4ECV A;  5EWF A;  4ED6 A;  2P66 A;  8ICB A;  9ICC A;  5KFK A;  5J2K A;  1MQ2 A;  1KLN A;  4MFA A;  4NLN A;  4RT2 A;  2ZTD A;  3C1Z A;  2HHU A;  1NJZ A;  5KFD A;  4J9R A;  4JUZ A;  2RDI A;  5KFF A;  1BGX T;  1XWL A;  1EXN A;  4QZH A;  1S10 A;  1RYR A;  1ZQD A;  5KFP A;  3AUO A;  4ELV A;  4GXJ A;  3PVX A;  8ICX A;  2HHT A;  3MBY A;  3ZDB A;  3QZ7 A;  9ICL A;  4C8N A;  4DF8 A;  4RQ5 A;  2W8L A;  3MR2 A;  4PH5 A;  1KFT A;  4QZG A;  1Z00 A;  4RQ2 A;  7ICP A;  4B9S A;  2UVV A;  1ZQA A;  4ED7 A;  4YP3 A;  4DOC A;  2W9B B;  2FLL A;  5J0S A;  4DSJ A;  3ZD9 A;  3H8S A;  4RPY A;  4ECQ A;  4DSE A;  4KLI A;  3T5L A;  4O3Q A;  3UXN A;  4YG2 A;  5BOM A;  3EPI A;  4QWE A;  5HML A;  5KG6 A;  3LDA A;  4IQV A;  1S0N A;  3RB4 A;  3KTQ A;  4UAY A;  4TQR A;  5J2B A;  3GIJ A;  4DFP A;  3T5J A;  4IQU A;  4ECU A;  3KHR A;  9ICA A;  2GWS A;  1XU4 A;  5KG3 A;  5IIK A;  1JXL A;  3IHQ B;  7ICS A;  1ZQB A;  4DOB A;  2F1I A;  4DFK A;  7ICU A;  4JWM A;  4KTQ A;  2H5X A;  1ARO P;  3HPO A;  3PO5 A;  3SZ2 A;  4J9M A;  4M04 A;  1S77 D;  3H4D A;  4R65 A;  5KFH A;  4B9T A;  4QWD A;  3H4B A;  1XSL A;  4DLE A;  1RZT A;  3KHL A;  3PW4 A;  2Y1J A;  5J2J A;  4B9V A;  4I2D A;  4QZC A;  2PI4 A;  1S0M A;  9ICX A;  2ASJ A;  4M9L A;  1ZQH A;  4YR0 A;  5KFN A;  9ICS A;  3V6J A;  2W9A A;  2KFN A;  4QWB A;  2UVW A;  7ICN A;  4F91 B;  2HVI A;  1XC9 A;  2XGP A;  4KLH A;  4MFF A;  4DSL A;  4BXO B;  4RPX A;  3C2K A;  1TK0 A;  4XQ8 A;  5KT2 A;  4ED3 A;  3Q8S B;  4I27 A;  4XUS A;  2RDJ A;  3ISC A;  4XRH A;  4GLX A;  2ZJ8 A;  3T3F A;  2ALZ A;  3RJK A;  2MUT A;  3GV5 B;  4M6W B;  3RH4 A;  4IQT A;  1S76 D;  5KTQ A;  5KFJ A;  4KLO A;  4IQW A;  1RYS A;  4ECR A;  1ZQW A;  5DKW A;  1JN3 A;  9ICJ A;  5KFO A;  1ZQV A;  3B0X A;  3Q8L A;  2XCA A;  4M2Y A;  4KLU A;  2NRV A;  3RAX A;  5C5J A;  1NK0 A;  3GV8 B;  1Z3E B;  4QZF A;  4QWA A;  4DS4 A;  4M9J A;  4LVS A;  1ZQP A;  1ZQG A;  2PFN A;  2BQR A;  4YVZ A;  4DL4 A;  5EOZ A;  1U45 A;  1ZQL A;  1NK6 A;  2J6T A;  4I2C A;  3PW5 A;  5DB9 A;  2BQU A;  2MUT B;  1BPZ A;  4J9Q A;  3RH5 A;  1TKD A;  4F2S A;  8ICP A;  3M8R A;  4P4O A;  5F9L A;  4UAW A;  4ECW A;  5KFZ A;  3RJE A;  1WCN A;  4CCH A;  3JPO A;  1NJX A;  4DS5 A;  4DQI A;  4O5C A;  1ZQO A;  1XS9 D;  3GIL A;  3H8W A;  2XCP A;  3PX0 A;  2IHM A;  4F50 A;  1KRP A;  1NKE A;  4P2H A;  8ICW A;  3MAB A;  3C5F A;  3UPQ A;  8ICL A;  5KFG A;  5DBA A;  3H7I A;  7ICK A;  3ZDE A;  2HHX A;  1U49 A;  4DLG A;  1ZQM A;  4NM1 A;  4QWC A;  5J0R A;  5CR0 A;  7ICI A;  4RQ3 A;  4FBT A;  2FMP A;  4F4Z A;  4MEY A;  4F5O A;  4QW8 A;  4UAZ A;  4UB2 A;  8ICH A;  3C2M A;  3KHH A;  5J2E A;  4RNM A;  3H40 A;  1H38 A;  4IRK A;  4MEX A;  1KTQ A;  4F92 B;  4J9S A;  4EEY A;  1HJP A;  5DG7 A;  4F4K A;  8ICF A;  2PFQ A;  2HHS A;  4O3P A;  2Q0Z X;  4MF8 A;  9ICU A;  1ZQJ A;  5J0T A;  2C22 A;  4RPZ A;  1NJY A;  3ZDD A;  4R66 A;  8ICE A;  3C21 A;  4LZG A;  1SL2 A;  3OSN A;  5CWR A;  2XGQ A;  2XC9 A;  3MR5 A;  2BKE A;  2AGO A;  7ICV A;  8ICU A;  4X5V A;  1KDH A;  5KFI A;  4M9H A;  4IRD A;  1UT8 A;  3OJU A;  4RNN A;  2M9N A;  1MC8 A;  3HW8 A;  4YD2 A;  5KFM A;  3GII A;  2AU0 A;  2BCQ A;  3HX0 A;  4PHA A;  5EWE A;  4I2H A;  2C2R A;  1N56 A;  2XO7 A;  3QE9 Y;  1D8L A;  4EYI B;  5KG7 A;  3V7K A;  4EBD A;  1NK7 A;  1N48 A;  3MR6 A;  4M9N A;  4MFC A;  4K4I A;  9ICN A;  3FDS A;  3H8J A;  2VAN A;  1U4B A;  1BVS A;  5IIL A;  9ICM A;  7ICO A;  3ZD8 A;  5DB7 A;  3EW9 A;  2KN7 A;  2V4R A;  2HHQ A;  3BQ0 A;  4Z6F A;  4ECY A;  3BQT A;  4PGX A;  4YCX A;  2FMQ A;  4ECS A;  1S0O A;  3PX6 A;  1UA1 A;  5DG8 A;  4M47 A;  8ICI A;  5J0Q A;  3BDP A;  5DGA A;  4O3R A;  3K4G A;  4R8U A;  5DLF A;  3TAN A;  2JEI A;  4YMN A;  4KLD A;  3B0Y A;  5D49 A;  7ICG A;  3SYZ A;  1BPD A;  9ICR A;  1ZQI A;  3RB6 A;  5KFS A;  4QZ9 A;  2J6U A;  2KZM A;  5HP4 A;  2Y1I A;  1QTM A;  4O9M A;  4YXJ A;  5J0P A;  4DSI A;  4TUR A;  3MGI A;  2NRW A;  9ICH A;  4FO6 A;  4GXK A;  4RQ8 A;  3ZDC A;  1A76 A;  4DQR A;  1XSN A;  2I9G A;  1K1Q A;  3M9M B;  3G6V A;  3GIM A;  5J2C A;  4XA5 A;  8ICV A;  4QZE A;  1BPY A;  5L1I A;  4RNO A;  7ICF A;  1ZQN A;  3MR3 A;  9ICW A;  1SKS A;  5JUM A;  4GC7 A;  4UBB A;  4ED8 A;  2AGP A;  1NKC A;  1KFS A;  4KLT A;  5D46 A;  4R8U B;  4EBE A;  1LB2 B;  4I2B A;  4LZD A;  3V6K A;  4QW9 A;  5DB8 A;  5L9X A;  4QZI A;  4FS2 A;  3RRG A;  4JWN A;  2HW3 A;  3E2E A;  5CA7 A;  3BQ1 A;  4BXO A;  8ICQ A;  4C8M A;  1U9L A;  1TK5 A;  3LWL A;  4DL6 A;  3RR8 A;  3EYZ A;  5KT3 A;  4KLF A;  1S0V A;  5KFX A;  3JPQ A;  2XY6 A;  3MDA A;  4DQQ A;  4RZR A;  2JZB A;  1B43 A;  5CP2 A;  4QZA A;  2AQ0 A;  2FLP A;  1TK8 A;  4NM2 A;  9ICI A;  4C8L A;  5KFB A;  4Z6C A;  1SKW A;  4RT3 A;  5DBB A;  1HUZ A;  4RUC A;  4JV2 A;  4YQW A;  4BGD A;  5KFW A;  5KT6 A;  4TUS A;  4DFJ A;  4YXM A;  2BHN A;  5KG1 A;  2JEF A;  9ICP A;  4KIT B;  4BWJ A;  5KT7 A;  4EZ6 A;  2F1H A;  5KG5 A;  3PMN A;  4O5E A;  3EPG A;  2HHV A;  5DQI A;  3PO4 A;  1DOQ A;  4KN4 A;  2ISO A;  4DOA A;  4ED2 A;  2FLN A;  5HHI A;  4B9L A;  4I2F A;  3UXO A;  5DB6 A;  4F4X A;  5KT4 A;  4F4Y A;  2IMW P;  7ICJ A;  2PI5 A;  3ORY A;  3MFH A;  2ZTE A;  4DL3 A;  3SI8 A;  2VA8 A;  3PX4 A;  3MFI A;  2W9C A;  1ZYQ A;  5KFE A;  5L1K A;  9ICE A;  9ICG A;  3ISB A;  5KFV A;  4KLJ A;  5KFA A;  4YR2 A;  4YMO A;  4J9L A;  3TFS A;  4RQ1 A;  5DDM A;  2OWO A;  2IA6 A;  4F8R A;  2KFZ A;  7ICR A;  3NGD A;  4F4W A;  2DPI A;  2R8I A;  2C28 A;  4Q8E A;  9ICB A;  4I2J A;  2ASL A;  3MDC A;  4I2I A;  4UB3 A;  1SKR A;  1ZQK A;  5DG9 A;  2A1J B;  4FS1 A;  1ZQE A;  3JPS A;  2FMS A;  1SZP A;  2B21 A;  4C8O A;  5HNK A;  3GDX A;  2P6U A;  1A77 A;  4DSF A;  4KLG A;  3T5H A;  4DL5 A;  1JIH A;  2ZUC A;  8ICC A;  1ZQY A;  1IXR A;  5DQG A;  4DEZ A;  1TVA A;  5J2G A;  1S97 A;  2V9W A;  4O3N A;  1ZQX A;  4DO9 A;  2BGW A;  4F2R A;  4ED1 A;  4HYK A;  1UA0 A;  1CUK A;  3M9O B;  3C2L A;  3G6X A;  5J0U A;  4YN4 A;  3UQ0 A;  5D4B A;  1X9W A;  3RR7 A;  4M0A A;  5J0O A;  4KLQ A;  5DDY A;  1Z00 B;  1KFD A;  1JMS A;  3SV3 A;  4JV0 A;  5KFU A;  4FBU A;  2I1Q A;  1ZQU A;  1L3T A;  4RU9 A;  3V6H A;  4PGY A;  4Q45 A;  3RBE A;  1NK8 A;  1RXV A;  4RQ0 A;  1ZQC A;  2A1J A;  1RPL A;  2ISP A;  4IR1 A;  3ISD A;  4NLK A;  1DGS A;  3K75 D;  3RJF A;  1KSP A;  3C23 A;  3QZ8 A;  2UVU A;  1QSS A;  3TFR A;  4PGQ A;  3GQC A;  4F5R A;  1NK4 A;  4UBC A;  1U47 A;  3TAQ A;  1RXW A;  3Q8M A;  1JX4 A;  4B9N A;  1ZQZ A;  2XY5 A;  1L5U A;  4ECZ A;  7ICM A;  1SL0 A;  2JZB B;  1T7P A;  4DQP A;  1LV5 A;  5J2I A;  4UB5 A;  1BPB A;  1UT5 A;  5IIJ A;  5EWG A;  5J0Y A;  3LWM A;  3QEB Z;  4F3O A;  4KLL A;  9ICO A;  3G6Y A;  8ICZ A;  3HT3 A;  5KFL A;  4RQ7 A;  2FPK A;  3Q8K A;  2JEJ A;  4PHP A;  9ICQ A;  3JPT A;  3UQ2 A;  1XSP A;  2BCS A;  3RJI A;  1ZQS A;  4YFK A;  4KMU A;  2IHN A;  1L3V A;  3RJG A;  8ICM A;  5DBC A;  3TAP A;  3TQ1 A;  2HVH A;  2W8K A;  1D9F A;  2R8K A;  4MF2 A;  9ICF A;  2R8J A;  2PXI A;  5J2A A;  2NRX A;  1T3N A;  4TUP A;  2W9C B;  2ATL A;  1NK5 A;  5BPC A;  4O0I A;  4DWI A;  3GV7 B;  2C2E A;  4P4M A;  4ECX A;  5J2H A;  2W9B A;  3AU2 A;  4R63 A;  4M6W A;  1NKB A;  5KFQ A;  3PR4 A;  3NTU A;  3HP6 A;  4DL2 A;  5DLG A;  3V72 A;  2HHW A;  3N97 B;  4UQG A;  1X9S A;  3Q8R B;  3TAR A;  3UXP A;  3THV A;  2ZJA A;  2MAX A;  1TAU A;  1PZN A;  2DFL A;  4Z6E A;  5CB1 A;  4UB1 A;  2VA3 A;  4Z6D A;  5KT5 A;  5J2D A;  4YMM A;  1HUO A;  3RH6 A;  4E0D A;  4M9G A;  4O3O A;  3GIK A;  1K1S A;  2BPF A;  3M9N B;  5J0X A;  4GXI A;  5IIN A;  4B9U A;  7ICT A;  5J0W A;  4F5P A;  2LYH A;  3C1Y A;  2WTF A;  5IIM A;  4JV1 A;  3JPR A;  1C7Y A;  1QSY A;  3FYH A;  4EBC A;  1NOM A;  8ICA A;  5CHG A;  2R8H A;  1KEJ A;  4RQ6 A;  4DQS A;  3BJY A;  4BWM A;  4J9K A;  1ZJM A;  4J9O A;  4KN7 A;  4Q43 A;  5F9N A;  4ECT A;  3V7J A;  4I2E A;  5J29 A;  4R64 A;  3ETL A;  4Q44 A;  2P6R A;  1T8E A;  4I29 A;  5IIO A;  5L1J A;  4DL7 A;  3RJH A;  1SL1 A;  1TFR A;  2ZTC A;  5KG0 A;  1NJW A;  1ZQQ A;  3QEA Z;  3OGU A;  2BDP A;  8ICJ A;  1JXE A; 
#chains in the Genus database with same CATH topology
 1D9D A;  1Z1B A;  2PFO A;  2ZJ5 A;  1TV9 A;  7ICP A;  4NLZ A;  1Z4O A;  2FPL A;  3PNC A;  1BPX A;  2BR0 A;  2J6S A;  5KL8 B;  2QKQ A;  4ELU A;  2H3Q A;  4F5Q A;  2KG5 A;  4RUA A;  4F93 B;  4I2G A;  3RB0 A;  3BQ2 A;  7ICE A;  2BCU A;  5DQH A;  5DGB A;  4C8K A;  5KG2 A;  4QZ8 A;  3JPP A;  5AK3 A;  2AGQ A;  1GO3 F;  2KZZ A;  4EYH B;  2WB1 C;  2FPM A;  5AKI A;  1FEZ A;  1KW4 A;  3V7L A;  8ICG A;  1U48 A;  1ZJN A;  5L1L A;  4OCZ A;  3AEV A;  4ELT A;  1L3S A;  1T4G A;  2HMX A;  3OHA A;  7ICH A;  3SAF A;  2C2D A;  5B5E U;  2WFA A;  3RBD A;  3E58 A;  8ICK A;  1SV0 C;  1CEZ A;  5F3X B;  3KHG A;  2UVR A;  2KTQ A;  3RAQ A;  2W9M A;  3OJS A;  2G07 A;  5J8Y C;  2BCV A;  2WF9 A;  4UB4 A;  1X2I A;  4FZM A;  2LI6 A;  3QX7 A;  5J2F A;  4O3S A;  2ZUD A;  5ALL A;  4QIW F;  4ECV A;  3M6Z A;  9ICC A;  2G5I B;  2W03 A;  3TAD C;  3DV9 A;  4QZH A;  5ALX A;  3PVX A;  2KJ5 A;  4RQ5 A;  3MR2 A;  4PH5 A;  4EX6 A;  5J0S A;  2WAQ C;  2MA1 A;  4DSE A;  3T5L A;  4O3Q A;  5BOM A;  5KG6 A;  4IQV A;  4UAU A;  4IQU A;  3T5J A;  4ECU A;  5ALE A;  2ZIU B;  1ZQB A;  3IV6 A;  2W43 A;  4J9M A;  3CYM A;  4Y2Y A;  4R65 A;  1XSL A;  3AN1 A;  4QZC A;  2ASJ A;  2KHV A;  4EEL A;  2FJ6 A;  7ICN A;  4F91 B;  2XGP A;  4WJ3 B;  1UPH A;  2WB1 F;  2OYY A;  4I27 A;  2MRL A;  5TIS U;  2RDJ A;  1FIQ A;  1ZD2 P;  3RJK A;  3KFU F;  5HR6 A;  5KTQ A;  1VLB A;  2FE9 A;  2F8L A;  4CE6 A;  1ZQW A;  3Q8L A;  1RDF A;  3N7S C;  3GV8 B;  1ZQP A;  2PFN A;  3N7P D;  1U45 A;  1ZQL A;  3PW5 A;  3EUB 2;  4J9Q A;  3RH5 A;  3M8R A;  5F9L A;  4KX5 A;  4ECW A;  1TAM A;  5KFZ A;  3RJE A;  1KBU A;  2VIX A;  4DQI A;  3L5K A;  1FFV A;  2IHM A;  3IDW A;  1X9X A;  1XNS A;  3H7I A;  4DLG A;  5CRX A;  1CRX A;  5J0R A;  5CR0 A;  4RQ3 A;  5ALZ A;  2FMP A;  4QW8 A;  4UAZ A;  3C2M A;  5J2E A;  3H40 A;  5AKY A;  1KTQ A;  3T79 A;  4F72 A;  4JMU A;  8ICF A;  4G9B A;  5KNI A;  9ICU A;  5J0T A;  1NJY A;  2OEH A;  5AI8 A;  1SL2 A;  3D2Q A;  3OSN A;  2XC9 A;  3MR5 A;  2H3F A;  2MU2 A;  4X5V A;  1KDH A;  4IRD A;  1UT8 A;  3SMV A;  5KFM A;  4I2H A;  1NK7 A;  4M9N A;  4K4I A;  2QAR A;  5IIL A;  3ZD8 A;  5DB7 A;  1UCV A;  4YCX A;  2FMQ A;  2RP5 A;  5J0Q A;  5DLF A;  5D49 A;  4FZL A;  5B66 U;  3RB6 A;  1ZQI A;  2J6U A;  2KZM A;  5AK4 A;  2Y1I A;  3D2N A;  4O9M A;  4DSI A;  3KBB A;  5AKH A;  2JHD A;  2I9G A;  3GIM A;  1SXD A;  5CEH A;  1OW5 A;  2H3I A;  3B9J A;  4R8U B;  2F76 X;  4LZD A;  3V6K A;  5AKK A;  5DB8 A;  2YB1 A;  3RRG A;  8ICC A;  4BXO A;  4DL6 A;  5KT3 A;  2Y0S C;  4RZR A;  1B43 A;  3BS7 A;  1UQV A;  5KFB A;  5DBB A;  4NLB A;  5KFW A;  4TUS A;  3IG5 A;  5KG1 A;  5KT7 A;  2F1H A;  3EPG A;  3PO4 A;  4KN4 A;  5ALH A;  3PZP A;  4ED2 A;  4B9L A;  4OJ5 A;  5KT4 A;  4F4Y A;  2KMD A;  3CNH A;  2VA8 A;  1PK1 A;  3PX4 A;  2W9C A;  4US9 A;  3ISB A;  5KFV A;  4C4R A;  4YMO A;  2IA6 A;  3UMC A;  2C28 A;  1MN8 A;  1X66 A;  4Q8E A;  1ZQK A;  3L4P A;  4I2I A;  4UB3 A;  1SKR A;  5GTH U;  1A77 A;  2ZG6 A;  2GOL A;  3T5H A;  4DL5 A;  2ZUC A;  1ZQY A;  1IXR A;  5DQG A;  4DEZ A;  1S97 A;  4O3N A;  2DBY A;  3NUQ A;  7ICS A;  5D4B A;  3L3F X;  2VKQ A;  1Q3V A;  5FP0 A;  1A6S A;  4JV0 A;  4FBU A;  2ZIX B;  3VCB A;  3V6H A;  4AP9 A;  4RU9 A;  4Q45 A;  1NK8 A;  1ZQC A;  4IR1 A;  4NLK A;  1DGS A;  2CPR A;  2NYV A;  3F5A A;  2XY5 A;  7ICM A;  2YB4 A;  1T7P A;  1BPB A;  5IIJ A;  3LWM A;  4RQN A;  3G6Y A;  2FPK A;  2D6F C;  5AKJ A;  3UQ2 A;  1XSP A;  1LKY B;  5AI9 A;  5DBC A;  4MF2 A;  2W9C B;  3SR6 A;  1F5S A;  3AU2 A;  1N5W A;  3PR4 A;  2F8K A;  1X9S A;  5CB1 A;  1NZP A;  2VA3 A;  3TKA A;  1K1S A;  4B9U A;  3K1Z A;  4FE3 A;  5J0W A;  4F5P A;  2LYH A;  5IIM A;  2WF7 A;  2LM4 A;  3JPR A;  3HIL A;  4DQS A;  4RQ6 A;  2JR5 A;  4O3M A;  5ALY A;  2GLE A;  4NWI A;  5J8Y A;  4I2E A;  5J29 A;  3F5E A;  3ETL A;  2HI0 A;  4CF3 A;  3KD3 A;  4I29 A;  1SB3 C;  5ALD A;  8ICJ A;  4ED1 A;  3PY8 A;  4PHD A;  1QSL A;  3SD7 A;  2AJQ A;  5BOL A;  5KFR A;  2NV3 A;  4I2A A;  5AI6 A;  1B0X A;  4P4P A;  2G06 A;  2OCE A;  4BJQ A;  3PW0 A;  4ED0 A;  5III A;  3H0L B;  3OHB A;  1ED1 A;  3ED5 A;  3WK7 A;  3A0H U;  4DFM A;  2NRT A;  3J81 j;  1MSW D;  2E8N A;  3WK4 A;  1ZQF A;  3HRD D;  5HR7 A;  5AM5 A;  4PZO A;  3PV8 A;  4J9P A;  2EAN A;  1COO A;  4F5N A;  2YQE A;  2WHE A;  7ICQ A;  4U7C A;  3LK9 A;  1WCL A;  4TQS A;  2KJ9 A;  5HMM A;  3LYS A;  2ZUB A;  1Y88 A;  3ONN A;  3GZF A;  2HBK A;  3C29 A;  1KN5 A;  1JRP A;  4I28 A;  4P0P A;  3WK8 A;  4J03 A;  2EZY A;  5AIA A;  4BDP A;  2GH1 A;  4IR9 A;  2K4I A;  3RJJ A;  2EZX A;  5KFC A;  8ICT A;  4GC6 A;  1IM4 A;  5AKZ A;  3HKZ C;  4ZH4 A;  2ASD A;  4KLE A;  1BNP A;  3QNM A;  4MFA A;  4NLN A;  3C1Z A;  2HHU A;  3H0M B;  2XID A;  4JUZ A;  3NVV A;  1BGX T;  1XWL A;  1S10 A;  4GXJ A;  3KOO A;  4EEN A;  3ZDB A;  3QZ7 A;  2W8L A;  4RQ2 A;  4B9S A;  2UVV A;  5EE9 A;  3PST A;  4ED7 A;  4DOC A;  4C4S A;  3ZD9 A;  4ECQ A;  1L7P A;  4YG2 A;  5HML A;  2W55 A;  3RB4 A;  4UAY A;  4C0Z A;  9ICA A;  1XU4 A;  2G09 A;  3IHQ B;  3SEI A;  3HJE A;  2EQY A;  4C7Y A;  2F1I A;  7ICU A;  5AI5 A;  2KE7 A;  2M0N A;  3HPO A;  1T94 A;  1S77 D;  4DLE A;  3KHL A;  4I2D A;  1S0M A;  9ICX A;  4YR0 A;  3KKA A;  3V6J A;  1COK A;  2F77 X;  1S5L U;  3F2D A;  1TK0 A;  4ED3 A;  4LJX A;  4XUS A;  1X6J A;  3ZI4 A;  2CRX A;  2ZJ8 A;  3T3F A;  2ALZ A;  2MUT A;  3RH4 A;  1DK3 A;  4IQT A;  3U26 A;  5DKW A;  2EZZ A;  1ZQV A;  2KHQ A;  5GTI U;  2E1F A;  3GU3 A;  1SZH A;  5C5J A;  2K4E A;  4QWA A;  4DS4 A;  4IC9 A;  4M9J A;  4LVS A;  3WK9 A;  1ZQG A;  2HCF A;  2J6T A;  2BQU A;  4KX3 A;  1BPZ A;  4UAV A;  2KIC A;  5L1M A;  1WCN A;  4CCH A;  3JPO A;  1NJX A;  1NI3 A;  4P2H A;  4F50 A;  1KRP A;  5ALS A;  3C5F A;  1F44 A;  8ICL A;  7ICK A;  2HHX A;  1JAL A;  1U49 A;  1ZQM A;  4NM1 A;  2LYB A;  5JU5 A;  4QJF B;  4FBT A;  3CW2 C;  3BS5 A;  5AKL A;  4IRK A;  4F92 B;  4J9S A;  5DG7 A;  4F4K A;  2PFQ A;  1B4F A;  4MF8 A;  3NVZ A;  3F2C A;  5C0Y A;  4R66 A;  4LZG A;  5CWR A;  1DK2 A;  2OHF A;  2BKE A;  4QNL A;  1YZ6 A;  4M9H A;  5KFI A;  3OJU A;  3WKC A;  3HW8 A;  3KZX A;  4Y2V A;  3HX0 A;  1FFU A;  1D8L A;  3TAD A;  1N48 A;  4IS7 A;  3F2B A;  3H8J A;  1BVS A;  4CRX A;  4EX7 A;  1V97 A;  2XVT A;  3EW9 A;  4Z6F A;  4ECY A;  2B0C A;  4PGX A;  3NVY A;  1UA1 A;  5ALK A;  5DG8 A;  4M47 A;  5DGA A;  3K4G A;  2JEI A;  1VJ5 A;  4YMN A;  4P0P B;  2OH2 A;  2DKZ A;  1L6N A;  4QZ9 A;  5HP4 A;  4TUR A;  1XSN A;  5J2C A;  4US8 A;  8ICV A;  4QZE A;  1BPY A;  4HAI A;  7ICF A;  3BS5 B;  1SKS A;  4ZOH C;  2YTU A;  5ALN A;  1LB2 B;  3VC8 A;  2HW3 A;  1U9L A;  3LWL A;  2JMG A;  2AHO B;  5KFX A;  4CGZ A;  2AQ0 A;  4QIW C;  3M6K A;  1TK8 A;  4Z6C A;  2PKE A;  5KT6 A;  4YXM A;  3CP8 A;  2JRZ A;  4BWJ A;  4KIT B;  3D6J A;  5KG5 A;  3O0F A;  2AXT U;  2ISO A;  2FLN A;  3LVW A;  5DB6 A;  4F4X A;  2W3S A;  4DL3 A;  3SI8 A;  1ZD4 A;  9ICG A;  4KLJ A;  3TFS A;  4F8R A;  3NGD A;  2ASL A;  2A1J B;  4FS1 A;  1ZQE A;  3UMB A;  3JPS A;  2FMS A;  1SZP A;  4C8O A;  3ICX A;  3GDX A;  4PJ0 U;  5J2G A;  2PMZ F;  1ZQX A;  2E3T A;  3DDH A;  3RR7 A;  3G6X A;  5J0U A;  4M0A A;  1PK1 B;  4KLQ A;  5DDY A;  4KMO B;  1Z00 B;  2KVS A;  1JMS A;  1JRO A;  1X40 A;  2HSZ A;  2I1Q A;  3WKA A;  1V85 A;  1RPL A;  3ISD A;  3RJF A;  3TFR A;  4PGQ A;  3GQC A;  4F5R A;  3QU9 A;  1BNO A;  2WF8 A;  4UBC A;  3Q8M A;  4IL6 U;  1L5U A;  2KSO A;  1SGG A;  4DCC A;  2LMR A;  1LV5 A;  1UT5 A;  4F3O A;  3QEB Z;  3HT3 A;  2EH9 A;  5ALI A;  3Q8K A;  4PHP A;  3NRW A;  9ICQ A;  3JPT A;  2BCS A;  3RJG A;  2K8B B;  4KMU A;  4YFK A;  1V38 A;  1KKX A;  3TAP A;  3H8M A;  2W8K A;  4OJP A;  5G5G A;  2R8J A;  1WYG A;  2PXI A;  2JH1 A;  1T3N A;  4TUP A;  1NK5 A;  5BPC A;  4ECX A;  5J2H A;  4M6W A;  1NKB A;  5KAF U;  1SV0 A;  4DL2 A;  5DLG A;  3V72 A;  3N7R C;  4UQG A;  3THV A;  2IOH A;  1TAU A;  3I28 A;  1LKY A;  2F3N A;  4YMM A;  2ZIU A;  3FM9 A;  4M9G A;  4O3O A;  4GXI A;  5IIN A;  2E8M A;  2VJ5 A;  3DEE A;  4NLC A;  1C7Y A;  1QSY A;  4EBC A;  4BX9 C;  1KEJ A;  1L8O A;  1S8O A;  4BWM A;  5KAI U;  4OJO A;  4KN7 A;  5A0L A;  4ECT A;  3I1Y A;  4R64 A;  1T8E A;  4DL7 A;  1O08 A;  1SL1 A;  3QEA Z;  3OGU A;  2BDP A;  1QH9 A;  4ICA A;  1RQN A;  4RQ4 A;  4YR3 A;  3Q8P B;  8ICY A;  7ICL A;  4UAS A;  1TAQ A;  1X9M A;  2XY7 A;  4YD1 A;  1X42 A;  3MGH A;  8ICN A;  5AM2 A;  3MC1 A;  9ICT A;  4KLM A;  2VA2 A;  1ZET A;  2YY6 A;  3IN5 A;  5EE1 A;  2KKV A;  3SQI A;  5E79 U;  5KG4 A;  3AU6 A;  1MQ3 A;  4PHE A;  1SIJ A;  4KLS A;  1QLN A;  1V9P A;  3S6J A;  2KZ3 A;  4ACO A;  3PW7 A;  2R8G A;  3GFK B;  1DGJ A;  1N63 A;  2BCR A;  5KFY A;  4NLG A;  2NRZ A;  3RRH A;  2BPG A;  1BPE A;  2F1J A;  3IM1 A;  2DPJ A;  1SV4 A;  3PR5 B;  1N5X A;  4Y2S A;  3N4M B;  1A0P A;  1XO0 A;  2E8P A;  1FO4 A;  3PW2 A;  3Q8Q B;  5CJ7 A;  4G3I A;  1S9F A;  1B22 A;  3EWA A;  5TZV A;  1WG8 A;  5ALF A;  2ZXH A;  2JH7 A;  3RFA A;  5KFT A;  5HHH A;  8ICR A;  9ICV A;  2PFP A;  5EWF A;  4ED6 A;  8ICB A;  5KFK A;  5J2K A;  3QU4 A;  1MQ2 A;  3N28 A;  1NJZ A;  2N1R A;  2K8A A;  3I76 A;  5KFD A;  4J9R A;  5AM3 A;  2RDI A;  1EXN A;  1RYR A;  5KFP A;  2HHT A;  4DF8 A;  2QAR B;  2E1E A;  1RM6 C;  1KFT A;  1Z00 A;  2E8O A;  2W9B B;  3IP4 B;  3H8S A;  4KLI A;  3UXN A;  3EPI A;  4QWE A;  4TQR A;  3RF9 A;  3GIJ A;  4DFP A;  4UW9 A;  2GWS A;  5IIK A;  1JXL A;  2KP7 A;  3FAH A;  4DOB A;  4JWM A;  4KTQ A;  2H5X A;  2LKY A;  5K4L A;  3SZ2 A;  3PO5 A;  1JUD A;  1ZRN A;  4QWD A;  4Y2X A;  3PW4 A;  2Y1J A;  4B9V A;  4M9L A;  1ZQH A;  9ICS A;  2UVW A;  1J2M A;  5ALW A;  4DSL A;  4BXO B;  4RPX A;  3C2K A;  4XQ8 A;  5KT2 A;  1ZD5 A;  4UAT A;  4XRH A;  4GLX A;  2EAM A;  3BZC A;  3GV5 B;  3QUB A;  4M6W B;  1S76 D;  5AIB A;  2LHT A;  4ECR A;  1JN3 A;  9ICJ A;  2FDR A;  3B0X A;  2HBJ A;  2XCA A;  4KLU A;  4CF5 A;  3RAX A;  4RQM A;  1NK0 A;  2W04 A;  2BQR A;  4YVZ A;  4DL4 A;  5EOZ A;  1NK6 A;  2MUT B;  4F2S A;  1JI7 A;  2XI9 A;  4UAW A;  2OM6 A;  1LVH A;  2KIV A;  1K5O A;  5ALT A;  3GIL A;  3H8W A;  2XCP A;  3PX0 A;  2JXJ A;  9ICL A;  1AQ6 A;  3UPQ A;  2DUY A;  3H0R B;  7ICI A;  3ETR A;  4F4Z A;  4MEY A;  4F5O A;  8ICH A;  2RLT A;  3KHH A;  4RNM A;  4CNQ A;  2W3R A;  4MEX A;  2R18 A;  4EEY A;  2LBO A;  1HJP A;  1RYU A;  4O3P A;  5AIC A;  3WKB A;  1Q8K A;  2OXO A;  1ZQJ A;  3PSI A;  2C22 A;  2F2A B;  2KOB A;  1N60 A;  2P35 A;  4C80 A;  2XGQ A;  3QUQ A;  3WK6 A;  1D8B A;  7ICV A;  1PVQ A;  5AK5 A;  4RNN A;  1MC8 A;  3GII A;  2KJ8 A;  2C2R A;  5EE3 A;  2XO7 A;  3QE9 Y;  5ALR A;  4EYI B;  5KG7 A;  4EBD A;  3WKD A;  9ICN A;  4MFC A;  5ALG A;  3F53 A;  2VAN A;  2YMP A;  1U4B A;  2GO7 A;  5JRT A;  2V4R A;  5H2F U;  7ICO A;  2HHQ A;  2PMZ C;  3BQ0 A;  4ECS A;  1S0O A;  8ICI A;  3BDP A;  4O3R A;  3TAC B;  2D8C A;  2KNJ A;  3TAN A;  1Q3U A;  4KLD A;  3B0Y A;  3M1Y A;  2HOF A;  7ICG A;  1BPD A;  9ICR A;  2NO4 A;  1N62 A;  3BZK A;  2W54 A;  2NRW A;  4GXK A;  2FI1 A;  2LM1 A;  4DQR A;  1QQ6 A;  1K1Q A;  3M9M B;  5L1I A;  4RNO A;  1PVP A;  3MR3 A;  2WAQ F;  1J2N A;  5JUM A;  4UBB A;  4ED8 A;  2AGP A;  1NKC A;  4KLT A;  1L7M A;  4EBE A;  4QW9 A;  5L9X A;  4QZI A;  4JWN A;  8ICQ A;  5CA7 A;  3EYZ A;  1S0V A;  3JPQ A;  3MDA A;  4DQQ A;  2JZB A;  5CP2 A;  5T14 A;  1OUQ A;  2FLP A;  1URJ A;  2Z7J A;  4C8L A;  5ALV A;  1SKW A;  1HUZ A;  4JV2 A;  4YQW A;  4A8E A;  9ICP A;  2F44 A;  3PSF A;  4O5E A;  2HHV A;  5DQI A;  1QQ7 A;  5AHX A;  4DOA A;  3UM9 A;  2ZXI A;  5HHI A;  4I2F A;  3UXO A;  3LVV A;  4PL1 A;  2IMW P;  2IOF A;  3QU7 A;  4UB8 U;  4MHV A;  3OPX A;  3MFH A;  2ZTE A;  1ZYQ A;  5KFE A;  5KFA A;  1PVR A;  2OWO A;  4RQ1 A;  2DPI A;  2YMM A;  3E0F A;  3MDC A;  1ZQ1 C;  3KZI U;  2B21 A;  5HNK A;  1QQ5 A;  3BQ7 A;  1L7O A;  2I5H A;  1ZRM A;  1ZXI A;  4F2R A;  4HYK A;  1UA0 A;  3M9O B;  4YN4 A;  1KFD A;  3SV3 A;  1M6Y A;  1ZQU A;  1L3T A;  4PGY A;  4Y2U A;  9ICH A;  4RQ0 A;  2A1J A;  2D3D A;  1N2X A;  1KSP A;  3C23 A;  3QZ8 A;  2UVU A;  3PSP A;  2QLT A;  1NK4 A;  1U47 A;  3TAQ A;  5ALJ A;  1RXW A;  4GIB A;  1ZQZ A;  2HBM A;  1PUZ A;  2JZB B;  4DQP A;  9ICO A;  2H3Z A;  8ICZ A;  2ZIW B;  2K4H A;  1KL9 A;  2LYA A;  3D2S A;  4NV0 A;  3SAG A;  2IHN A;  1L3V A;  1KQQ A;  8ICM A;  2CXY A;  2HVH A;  4AYB F;  2R8K A;  2KSO B;  5J2A A;  2NRX A;  2ATL A;  1C20 A;  2HOI A;  4DWI A;  2C2E A;  4P4M A;  2L5Y A;  4NJ8 A;  5AI0 A;  3HP6 A;  3R9K A;  3N97 B;  3TAR A;  3UXP A;  1ZD3 A;  2MAX A;  1PZN A;  4Z6E A;  4UB1 A;  2G5H B;  5J2D A;  1Z1V A;  1HUO A;  3RH6 A;  4E0D A;  3GIK A;  2BPF A;  5J0X A;  7ICT A;  3C1Y A;  2K4P A;  2JV3 A;  8ICA A;  5CHG A;  4J9K A;  2ZIV A;  1ZJM A;  4J9O A;  4GFJ A;  4Q43 A;  4Q44 A;  3M7D A;  5IIO A;  1WWV A;  3AL0 B;  1QCK A;  1ZQQ A;  2I6X A;  5G5H A;  1UHU A;  1L8L A;  5ALO A;  4BUG A;  1XO1 A;  2KD1 A;  3JPN A;  3AQE A;  4J9N A;  4UAR A;  4PZN A;  5AM4 A;  3RTV A;  2BPC A;  2ZIW A;  3RB3 A;  1NK9 A;  2W7P A;  4NY8 A;  1IV8 A;  2AQ4 A;  1ZQR A;  9ICK A;  4CDG A;  2YMQ A;  5ALM A;  4O5K A;  3HWT A;  4TUQ A;  2H3V A;  4QZB A;  2YX8 A;  1L7N A;  3PML A;  3MGV A;  3SV4 A;  2HBL A;  1L3U A;  2RHF A;  4B9M A;  3T5K A;  4DF4 A;  2IBK A;  2BQ3 A;  5ALU A;  1DRG A;  4QZD A;  2JEG A;  3ZDA A;  1ZOL A;  4IRC A;  3C5G A;  4NXZ A;  3AMZ A;  1SXE A;  1D8Y A;  4PPX A;  2V4Q A;  3EZ5 A;  5AKX A;  2QB1 A;  3FC4 A;  1ZQT A;  4EZ9 A;  3K1R B;  3OSP A;  8ICS A;  4K4H A;  4K4G A;  2E5S A;  4DSK A;  3TI0 A;  2WF6 A;  8ICO A;  4JK1 A;  3M8S A;  4Q8F A;  3AQF A;  3IG8 A;  2ES6 A;  2WF5 A;  2P66 A;  1TE2 A;  1VDV A;  1KLN A;  4RT2 A;  2ZTD A;  2K8C B;  2NO5 A;  5KFF A;  1ZQD A;  3AUO A;  4ELV A;  8ICX A;  2QB0 B;  5AK6 A;  3MBY A;  4C8N A;  2O6K A;  4QZG A;  1ZQA A;  4YP3 A;  2HDO A;  4C4T A;  2FLL A;  4DSJ A;  4RPY A;  2Y9U A;  2YML A;  5KL1 B;  2DQN B;  3LDA A;  3IRU A;  2EAP A;  1S0N A;  3KTQ A;  5JTI A;  5J2B A;  3KHR A;  5KG3 A;  1F0M A;  1T3Q A;  4DFK A;  1ARO P;  4M04 A;  3H4D A;  5KFH A;  4B9T A;  3H4B A;  2RRD A;  1RZT A;  5J2J A;  2HOQ A;  2PI4 A;  5EE0 A;  5KFN A;  2W9A A;  4Y2R A;  2G0A A;  4QWB A;  2KFN A;  2HVI A;  1XC9 A;  2W11 A;  4KLH A;  4MFF A;  3WU2 U;  4B6J A;  3Q8S B;  4C7Z A;  3QU5 A;  3ISC A;  2W7O A;  4P0Q A;  3NRZ A;  4FFD A;  5KFJ A;  4KLO A;  5ALP A;  4IQW A;  1RYS A;  3WK5 A;  5KFO A;  2LPE A;  4M2Y A;  4AYB C;  4UB6 U;  1Q46 A;  2KV2 A;  2NRV A;  3NAS A;  1PK3 A;  1Z3E B;  4QZF A;  4I2C A;  5DB9 A;  8ICP A;  1TKD A;  4F71 A;  3NVW A;  4P4O A;  1IIP A;  3NS1 A;  4OJL A;  2ZIV B;  4DS5 A;  4O5C A;  1ZQO A;  1XS9 D;  1NZB A;  8ICW A;  1NKE A;  3MAB A;  1DXS A;  5KFG A;  5DBA A;  3ZDE A;  4QWC A;  1O03 A;  2RQ5 A;  3QU2 A;  2Y0S F;  4UB2 A;  1H38 A;  4NL9 A;  2HHS A;  2B6G A;  2A3V A;  2Q0Z X;  3QXG A;  4RPZ A;  3ZDD A;  8ICE A;  4U6P A;  3C21 A;  2A1A A;  2KVC A;  3QUC A;  2AGO A;  8ICU A;  4P0Q B;  2M9N A;  4YD2 A;  2AU0 A;  2BCQ A;  3UMG A;  4PHA A;  2KIW A;  5AM0 A;  4DFD A;  5EWE A;  1N56 A;  2EAO A;  3V7K A;  3MR6 A;  3FDS A;  2ODG A;  1CI4 A;  1ECW A;  9ICM A;  2KN7 A;  3BQT A;  3PX6 A;  4FZN A;  4Y2T A;  4R8U A;  3SYZ A;  1NNL A;  5KFS A;  1YT3 A;  1QTM A;  4YXJ A;  5J0P A;  3MGI A;  4FO6 A;  4RQ8 A;  3ZDC A;  1A76 A;  3G6V A;  4XA5 A;  2EDU A;  1ZQN A;  9ICW A;  5AM1 A;  3OTQ A;  4GC7 A;  2BZF A;  1KFS A;  5D46 A;  4I2B A;  1WWU A;  1Z19 A;  2AH5 A;  4FS2 A;  1HIW A;  3E2E A;  3BQ1 A;  4C8M A;  1TK5 A;  3RR8 A;  1Z4N A;  4OJ6 A;  4KLF A;  2QB0 A;  5ALQ A;  2XY6 A;  4QZA A;  1IG6 A;  2XIC A;  3SAH A;  4NM2 A;  9ICI A;  4RT3 A;  4RUC A;  2JEF A;  4BGD A;  1MA7 A;  4DFJ A;  2BHN A;  5AKE A;  4EZ6 A;  3PMN A;  2DL0 A;  1DOQ A;  4OO1 J;  2KEY A;  7ICJ A;  2PI5 A;  3ORY A;  3MFI A;  2DF4 B;  5L1K A;  9ICE A;  4YR2 A;  1RQL A;  2KK0 A;  4Y2Q A;  4J9L A;  7ICR A;  5DDM A;  2KFZ A;  4F4W A;  2BDU A;  2ZIX A;  2R8I A;  9ICB A;  4I2J A;  1SWW A;  5DG9 A;  2P6U A;  4DSF A;  4KLG A;  2G08 A;  1JIH A;  1WUD A;  1TVA A;  2V9W A;  2BGW A;  4DO9 A;  1P7D A;  1CUK A;  3C2L A;  3UQ0 A;  1X9W A;  5J0O A;  3HKZ F;  2ESE A;  5KFU A;  3RBE A;  1RXV A;  2ISP A;  3K75 D;  1QSS A;  2K89 A;  4NL9 C;  2CN1 A;  5AKG A;  4USA A;  1JX4 A;  4B9N A;  1HEK A;  3KKA C;  4ECZ A;  1SL0 A;  2VJ4 A;  3C28 A;  5J2I A;  4UB5 A;  3ALR A;  5EWG A;  5J0Y A;  4KLL A;  3QUT A;  4EEK A;  5KFL A;  1J97 A;  2Q4T A;  4RQ7 A;  2IOF K;  2JEJ A;  3QYP A;  4PL2 A;  3SEN A;  4Y2P A;  3RJI A;  1ZQS A;  3AM9 A;  3TQ1 A;  1N61 A;  4JB3 A;  1D9F A;  2YN4 A;  9ICF A;  2K60 A;  4O0I A;  1X6I A;  3GV7 B;  2W9B A;  4R63 A;  2DKX A;  5KFQ A;  3NTU A;  1YZ7 A;  3WKE A;  1SWV A;  2DGZ A;  5AI4 A;  2HHW A;  3Q8R B;  2ZJA A;  3A0B U;  4CF4 A;  2DFL A;  2JGA A;  4Z6D A;  5KT5 A;  2KKP A;  3M9N B;  2A19 A;  4OD0 A;  2WTF A;  3CRX A;  4Y2J A;  4JV1 A;  1RG6 A;  3FYH A;  1NOM A;  2Y9T A;  2MSN A;  2R8H A;  3BJY A;  1OXJ A;  2DWQ A;  5F9N A;  3V7J A;  2P6R A;  5L1J A;  3RJH A;  1TFR A;  2ZTC A;  5KG0 A;  1NJW A;  1JXE A; 
#chains in the Genus database with same CATH homology
 4YR3 A;  4RQ4 A;  4PHD A;  3Q8P B;  1D9D A;  3PY8 A;  8ICY A;  7ICL A;  1TAQ A;  1QSL A;  2PFO A;  2AJQ A;  2ZJ5 A;  1XO1 A;  1TV9 A;  5BOL A;  3JPN A;  4J9N A;  1X9M A;  2XY7 A;  4YD1 A;  3MGH A;  5KFR A;  3RB3 A;  3RTV A;  2BPC A;  2FPL A;  1NK9 A;  4NY8 A;  4NLZ A;  8ICN A;  2AQ4 A;  4I2A A;  9ICT A;  3PNC A;  1ZQR A;  9ICK A;  4P4P A;  1BPX A;  4KLM A;  2BR0 A;  2J6S A;  2VA2 A;  1ZET A;  4ELU A;  4F5Q A;  4O5K A;  3HWT A;  4RUA A;  4TUQ A;  3PW0 A;  4F93 B;  4ED0 A;  4I2G A;  3RB0 A;  3BQ2 A;  5III A;  3OHB A;  7ICE A;  4QZB A;  2BCU A;  5KG4 A;  5DQH A;  5DGB A;  4DFM A;  3PML A;  3AU6 A;  4C8K A;  2NRT A;  1MQ3 A;  4PHE A;  1MSW D;  5KG2 A;  1ZQF A;  4KLS A;  3SV4 A;  1QLN A;  1L3U A;  4B9M A;  4QZ8 A;  3JPP A;  3T5K A;  2AGQ A;  4DF4 A;  3PV8 A;  2IBK A;  4J9P A;  1V9P A;  2KZZ A;  4EYH B;  2BQ3 A;  1COO A;  2FPM A;  2KZ3 A;  4F5N A;  3PW7 A;  4QZD A;  2JEG A;  3ZDA A;  7ICQ A;  2R8G A;  3GFK B;  3V7L A;  3LK9 A;  4IRC A;  1WCL A;  3C5G A;  8ICG A;  1U48 A;  1ZJN A;  4NXZ A;  5L1L A;  2BCR A;  4TQS A;  5HMM A;  2ZUB A;  1Y88 A;  5KFY A;  1L3S A;  4ELT A;  1T4G A;  1D8Y A;  3OHA A;  4NLG A;  2NRZ A;  7ICH A;  4PPX A;  2V4Q A;  3RRH A;  3EZ5 A;  2BPG A;  2C2D A;  1BPE A;  2F1J A;  3RBD A;  8ICK A;  3IM1 A;  1ZQT A;  2DPJ A;  4EZ9 A;  3PR5 B;  1CEZ A;  3KHG A;  4I28 A;  2UVR A;  3OSP A;  2KTQ A;  8ICS A;  3N4M B;  4K4H A;  3RAQ A;  4K4G A;  2W9M A;  3OJS A;  4BDP A;  4DSK A;  3PW2 A;  4IR9 A;  3Q8Q B;  3RJJ A;  5CJ7 A;  2BCV A;  3TI0 A;  1S9F A;  4G3I A;  4UB4 A;  1X2I A;  1B22 A;  8ICO A;  4JK1 A;  5J2F A;  5TZV A;  3EWA A;  5KFC A;  3M8S A;  4O3S A;  4Q8F A;  8ICT A;  4GC6 A;  1IM4 A;  5HHH A;  4ZH4 A;  5KFT A;  2ASD A;  2ZUD A;  4KLE A;  2PFP A;  8ICR A;  9ICV A;  4ECV A;  5EWF A;  4ED6 A;  2P66 A;  8ICB A;  9ICC A;  5KFK A;  5J2K A;  1MQ2 A;  1KLN A;  4MFA A;  4NLN A;  4RT2 A;  2ZTD A;  3C1Z A;  2HHU A;  1NJZ A;  5KFD A;  4J9R A;  4JUZ A;  2RDI A;  5KFF A;  1BGX T;  1XWL A;  1EXN A;  4QZH A;  1S10 A;  1RYR A;  1ZQD A;  5KFP A;  3AUO A;  4ELV A;  4GXJ A;  3PVX A;  8ICX A;  2HHT A;  3MBY A;  3ZDB A;  3QZ7 A;  9ICL A;  4C8N A;  4DF8 A;  4RQ5 A;  2W8L A;  3MR2 A;  4PH5 A;  1KFT A;  4QZG A;  1Z00 A;  4RQ2 A;  7ICP A;  4B9S A;  2UVV A;  1ZQA A;  4ED7 A;  4YP3 A;  4DOC A;  2W9B B;  2FLL A;  5J0S A;  4DSJ A;  3ZD9 A;  3H8S A;  4RPY A;  4ECQ A;  4DSE A;  4KLI A;  3T5L A;  4O3Q A;  3UXN A;  4YG2 A;  5BOM A;  3EPI A;  4QWE A;  5HML A;  5KG6 A;  3LDA A;  4IQV A;  1S0N A;  3RB4 A;  3KTQ A;  4UAY A;  4TQR A;  5J2B A;  3GIJ A;  4DFP A;  3T5J A;  4IQU A;  4ECU A;  3KHR A;  9ICA A;  2GWS A;  1XU4 A;  5KG3 A;  5IIK A;  1JXL A;  3IHQ B;  7ICS A;  1ZQB A;  4DOB A;  2F1I A;  4DFK A;  7ICU A;  4JWM A;  4KTQ A;  2H5X A;  1ARO P;  3HPO A;  3PO5 A;  3SZ2 A;  4J9M A;  4M04 A;  1S77 D;  3H4D A;  4R65 A;  5KFH A;  4B9T A;  4QWD A;  3H4B A;  1XSL A;  4DLE A;  1RZT A;  3KHL A;  3PW4 A;  2Y1J A;  5J2J A;  4B9V A;  4I2D A;  4QZC A;  2PI4 A;  1S0M A;  9ICX A;  2ASJ A;  4M9L A;  1ZQH A;  4YR0 A;  5KFN A;  9ICS A;  3V6J A;  2W9A A;  2KFN A;  4QWB A;  2UVW A;  7ICN A;  4F91 B;  2HVI A;  1XC9 A;  2XGP A;  4KLH A;  4MFF A;  4DSL A;  4BXO B;  4RPX A;  3C2K A;  1TK0 A;  4XQ8 A;  5KT2 A;  4ED3 A;  3Q8S B;  4I27 A;  4XUS A;  2RDJ A;  3ISC A;  4XRH A;  4GLX A;  2ZJ8 A;  3T3F A;  2ALZ A;  3RJK A;  2MUT A;  3GV5 B;  4M6W B;  3RH4 A;  4IQT A;  1S76 D;  5KTQ A;  5KFJ A;  4KLO A;  4IQW A;  1RYS A;  4ECR A;  1ZQW A;  5DKW A;  1JN3 A;  9ICJ A;  5KFO A;  1ZQV A;  3B0X A;  3Q8L A;  2XCA A;  4M2Y A;  4KLU A;  2NRV A;  3RAX A;  5C5J A;  1NK0 A;  3GV8 B;  1Z3E B;  4QZF A;  4QWA A;  4DS4 A;  4M9J A;  4LVS A;  1ZQP A;  1ZQG A;  2PFN A;  2BQR A;  4YVZ A;  4DL4 A;  5EOZ A;  1U45 A;  1ZQL A;  1NK6 A;  2J6T A;  4I2C A;  3PW5 A;  5DB9 A;  2BQU A;  2MUT B;  1BPZ A;  4J9Q A;  3RH5 A;  1TKD A;  4F2S A;  8ICP A;  3M8R A;  4P4O A;  5F9L A;  4UAW A;  4ECW A;  5KFZ A;  3RJE A;  1WCN A;  4CCH A;  3JPO A;  1NJX A;  4DS5 A;  4DQI A;  4O5C A;  1ZQO A;  1XS9 D;  3GIL A;  3H8W A;  2XCP A;  3PX0 A;  2IHM A;  4F50 A;  1KRP A;  1NKE A;  4P2H A;  8ICW A;  3MAB A;  3C5F A;  3UPQ A;  8ICL A;  5KFG A;  5DBA A;  3H7I A;  7ICK A;  3ZDE A;  2HHX A;  1U49 A;  4DLG A;  1ZQM A;  4NM1 A;  4QWC A;  5J0R A;  5CR0 A;  7ICI A;  4RQ3 A;  4FBT A;  2FMP A;  4F4Z A;  4MEY A;  4F5O A;  4QW8 A;  4UAZ A;  4UB2 A;  8ICH A;  3C2M A;  3KHH A;  5J2E A;  4RNM A;  3H40 A;  1H38 A;  4IRK A;  4MEX A;  1KTQ A;  4F92 B;  4J9S A;  4EEY A;  1HJP A;  5DG7 A;  4F4K A;  8ICF A;  2PFQ A;  2HHS A;  4O3P A;  2Q0Z X;  4MF8 A;  9ICU A;  1ZQJ A;  5J0T A;  2C22 A;  4RPZ A;  1NJY A;  3ZDD A;  4R66 A;  8ICE A;  3C21 A;  4LZG A;  1SL2 A;  3OSN A;  5CWR A;  2XGQ A;  2XC9 A;  3MR5 A;  2BKE A;  2AGO A;  7ICV A;  8ICU A;  4X5V A;  1KDH A;  5KFI A;  4M9H A;  4IRD A;  1UT8 A;  3OJU A;  4RNN A;  2M9N A;  1MC8 A;  3HW8 A;  4YD2 A;  5KFM A;  3GII A;  2AU0 A;  2BCQ A;  3HX0 A;  4PHA A;  5EWE A;  4I2H A;  2C2R A;  1N56 A;  2XO7 A;  3QE9 Y;  1D8L A;  4EYI B;  5KG7 A;  3V7K A;  4EBD A;  1NK7 A;  1N48 A;  3MR6 A;  4M9N A;  4MFC A;  4K4I A;  9ICN A;  3FDS A;  3H8J A;  2VAN A;  1U4B A;  1BVS A;  5IIL A;  9ICM A;  7ICO A;  3ZD8 A;  5DB7 A;  3EW9 A;  2KN7 A;  2V4R A;  2HHQ A;  3BQ0 A;  4Z6F A;  4ECY A;  3BQT A;  4PGX A;  4YCX A;  2FMQ A;  4ECS A;  1S0O A;  3PX6 A;  1UA1 A;  5DG8 A;  4M47 A;  8ICI A;  5J0Q A;  3BDP A;  5DGA A;  4O3R A;  3K4G A;  4R8U A;  5DLF A;  3TAN A;  2JEI A;  4YMN A;  4KLD A;  3B0Y A;  5D49 A;  7ICG A;  3SYZ A;  1BPD A;  9ICR A;  1ZQI A;  3RB6 A;  5KFS A;  4QZ9 A;  2J6U A;  2KZM A;  5HP4 A;  2Y1I A;  1QTM A;  4O9M A;  4YXJ A;  5J0P A;  4DSI A;  4TUR A;  3MGI A;  2NRW A;  9ICH A;  4FO6 A;  4GXK A;  4RQ8 A;  3ZDC A;  1A76 A;  4DQR A;  1XSN A;  2I9G A;  1K1Q A;  3M9M B;  3G6V A;  3GIM A;  5J2C A;  4XA5 A;  8ICV A;  4QZE A;  1BPY A;  5L1I A;  4RNO A;  7ICF A;  1ZQN A;  3MR3 A;  9ICW A;  1SKS A;  5JUM A;  4GC7 A;  4UBB A;  4ED8 A;  2AGP A;  1NKC A;  1KFS A;  4KLT A;  5D46 A;  4R8U B;  4EBE A;  1LB2 B;  4I2B A;  4LZD A;  3V6K A;  4QW9 A;  5DB8 A;  5L9X A;  4QZI A;  4FS2 A;  3RRG A;  4JWN A;  2HW3 A;  3E2E A;  5CA7 A;  3BQ1 A;  4BXO A;  8ICQ A;  4C8M A;  1U9L A;  1TK5 A;  3LWL A;  4DL6 A;  3RR8 A;  3EYZ A;  5KT3 A;  4KLF A;  1S0V A;  5KFX A;  3JPQ A;  2XY6 A;  3MDA A;  4DQQ A;  4RZR A;  2JZB A;  1B43 A;  5CP2 A;  4QZA A;  2AQ0 A;  2FLP A;  1TK8 A;  4NM2 A;  9ICI A;  4C8L A;  5KFB A;  4Z6C A;  1SKW A;  4RT3 A;  5DBB A;  1HUZ A;  4RUC A;  4JV2 A;  4YQW A;  4BGD A;  5KFW A;  5KT6 A;  4TUS A;  4DFJ A;  4YXM A;  2BHN A;  5KG1 A;  2JEF A;  9ICP A;  4KIT B;  4BWJ A;  5KT7 A;  4EZ6 A;  2F1H A;  5KG5 A;  3PMN A;  4O5E A;  3EPG A;  2HHV A;  5DQI A;  3PO4 A;  1DOQ A;  4KN4 A;  2ISO A;  4DOA A;  4ED2 A;  2FLN A;  5HHI A;  4B9L A;  4I2F A;  3UXO A;  5DB6 A;  4F4X A;  5KT4 A;  4F4Y A;  2IMW P;  7ICJ A;  2PI5 A;  3ORY A;  3MFH A;  2ZTE A;  4DL3 A;  3SI8 A;  2VA8 A;  3PX4 A;  3MFI A;  2W9C A;  1ZYQ A;  5KFE A;  5L1K A;  9ICE A;  9ICG A;  3ISB A;  5KFV A;  4KLJ A;  5KFA A;  4YR2 A;  4YMO A;  4J9L A;  3TFS A;  4RQ1 A;  5DDM A;  2OWO A;  2IA6 A;  4F8R A;  2KFZ A;  7ICR A;  3NGD A;  4F4W A;  2DPI A;  2R8I A;  2C28 A;  4Q8E A;  9ICB A;  4I2J A;  2ASL A;  3MDC A;  4I2I A;  4UB3 A;  1SKR A;  1ZQK A;  5DG9 A;  2A1J B;  4FS1 A;  1ZQE A;  3JPS A;  2FMS A;  1SZP A;  2B21 A;  4C8O A;  5HNK A;  3GDX A;  2P6U A;  1A77 A;  4DSF A;  4KLG A;  3T5H A;  4DL5 A;  1JIH A;  2ZUC A;  8ICC A;  1ZQY A;  1IXR A;  5DQG A;  4DEZ A;  1TVA A;  5J2G A;  1S97 A;  2V9W A;  4O3N A;  1ZQX A;  4DO9 A;  2BGW A;  4F2R A;  4ED1 A;  4HYK A;  1UA0 A;  1CUK A;  3M9O B;  3C2L A;  3G6X A;  5J0U A;  4YN4 A;  3UQ0 A;  5D4B A;  1X9W A;  3RR7 A;  4M0A A;  5J0O A;  4KLQ A;  5DDY A;  1Z00 B;  1KFD A;  1JMS A;  3SV3 A;  4JV0 A;  5KFU A;  4FBU A;  2I1Q A;  1ZQU A;  1L3T A;  4RU9 A;  3V6H A;  4PGY A;  4Q45 A;  3RBE A;  1NK8 A;  1RXV A;  4RQ0 A;  1ZQC A;  2A1J A;  1RPL A;  2ISP A;  4IR1 A;  3ISD A;  4NLK A;  1DGS A;  3K75 D;  3RJF A;  1KSP A;  3C23 A;  3QZ8 A;  2UVU A;  1QSS A;  3TFR A;  4PGQ A;  3GQC A;  4F5R A;  1NK4 A;  4UBC A;  1U47 A;  3TAQ A;  1RXW A;  3Q8M A;  1JX4 A;  4B9N A;  1ZQZ A;  2XY5 A;  1L5U A;  4ECZ A;  7ICM A;  1SL0 A;  2JZB B;  1T7P A;  4DQP A;  1LV5 A;  5J2I A;  4UB5 A;  1BPB A;  1UT5 A;  5IIJ A;  5EWG A;  5J0Y A;  3LWM A;  3QEB Z;  4F3O A;  4KLL A;  9ICO A;  3G6Y A;  8ICZ A;  3HT3 A;  5KFL A;  4RQ7 A;  2FPK A;  3Q8K A;  2JEJ A;  4PHP A;  9ICQ A;  3JPT A;  3UQ2 A;  1XSP A;  2BCS A;  3RJI A;  1ZQS A;  4YFK A;  4KMU A;  2IHN A;  1L3V A;  3RJG A;  8ICM A;  5DBC A;  3TAP A;  3TQ1 A;  2HVH A;  2W8K A;  1D9F A;  2R8K A;  4MF2 A;  9ICF A;  2R8J A;  2PXI A;  5J2A A;  2NRX A;  1T3N A;  4TUP A;  2W9C B;  2ATL A;  1NK5 A;  5BPC A;  4O0I A;  4DWI A;  3GV7 B;  2C2E A;  4P4M A;  4ECX A;  5J2H A;  2W9B A;  3AU2 A;  4R63 A;  4M6W A;  1NKB A;  5KFQ A;  3PR4 A;  3NTU A;  3HP6 A;  4DL2 A;  5DLG A;  3V72 A;  2HHW A;  3N97 B;  4UQG A;  1X9S A;  3Q8R B;  3TAR A;  3UXP A;  3THV A;  2ZJA A;  2MAX A;  1TAU A;  1PZN A;  2DFL A;  4Z6E A;  5CB1 A;  4UB1 A;  2VA3 A;  4Z6D A;  5KT5 A;  5J2D A;  4YMM A;  1HUO A;  3RH6 A;  4E0D A;  4M9G A;  4O3O A;  3GIK A;  1K1S A;  2BPF A;  3M9N B;  5J0X A;  4GXI A;  5IIN A;  4B9U A;  7ICT A;  5J0W A;  4F5P A;  2LYH A;  3C1Y A;  2WTF A;  5IIM A;  4JV1 A;  3JPR A;  1C7Y A;  1QSY A;  3FYH A;  4EBC A;  1NOM A;  8ICA A;  5CHG A;  2R8H A;  1KEJ A;  4RQ6 A;  4DQS A;  3BJY A;  4BWM A;  4J9K A;  1ZJM A;  4J9O A;  4KN7 A;  4Q43 A;  5F9N A;  4ECT A;  3V7J A;  4I2E A;  5J29 A;  4R64 A;  3ETL A;  4Q44 A;  2P6R A;  1T8E A;  4I29 A;  5IIO A;  5L1J A;  4DL7 A;  3RJH A;  1SL1 A;  1TFR A;  2ZTC A;  5KG0 A;  1NJW A;  1ZQQ A;  3QEA Z;  3OGU A;  2BDP A;  8ICJ A;  1JXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...