3N4MB

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
total genus 21
structure length 74
sequence length 74
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n4mB00
5J2JA 5J0WA 4C8OA 1K1SA 4C8LA 4M9GA 8ICLA 4ED8A 4KMUA 4O3PA 4J9PA 8ICUA 1KFDA 4TUQA 5CR0A 5IIKA 4QW9A 2F1HA 1SL1A 2W9CB 4O5CA 4RNMA 1ZQIA 4F92B 3TI0A 3HP6A 3MR2A 4B9MA 2HHTA 4UBBA 1U9LA 9ICOA 1SKSA 5F9LA 4F2RA 9ICIA 4ECTA 7ICMA 1ZETA 1SL0A 5EWEA 5J2CA 4UB5A 4C8MA 3SV4A 4EEYA 1H38A 2ATLA 3Q8KA 3B0XA 2FMPA 7ICEA 4RUAA 3Q8PB 2AQ4A 4R64A 1TFRA 1U45A 9ICVA 4I2GA 2AU0A 3MABA 8ICKA 2ZUBA 1ZQSA 4TURA 4ELVA 1ZQZA 4RQ3A 1NJZA 1JX4A 4RUCA 5CHGA 4TQSA 4F5NA 4I2FA 5L1LA 4UAYA 3C2LA 4NLNA 8ICAA 3ZDCA 1COOA 1T3NA 2KZZA 4DS5A 3MDCA 4DO9A 2BGWA 3C5FA 1JXLA 2IA6A 4EZ6A 5J0QA 2ISPA 1U47A 3PX6A 9ICGA 3RB0A 3OJUA 3ISCA 1A76A 3NGDA 1MQ2A 1T4GA 3EPGA 1V9PA 5KFVA 4RQ5A 3HWTA 5KFNA 4DSFA 2AGPA 4ECVA 4M9JA 4NM1A 9ICTA 9ICMA 4KLUA 2HHVA 3MR5A 4O3RA 4MFCA 3RBDA 4TUSA 2BPGA 1NK0A 4YQWA 1EXNA 3C5GA 2IHMA 1XSLA 4GXJA 5L9XA 1Y88A 2Q0ZX 4KN4A 4LZDA 5KFZA 2NRVA 4QZEA 4UAWA 5DB8A 9ICEA 3H7IA 3B0YA 4R8UB 4YXJA 2GWSA 3RJGA 3SZ2A 4F5RA 2J6SA 1SKWA 8ICYA 5KT4A 7ICFA 3PW5A 9ICJA 4YCXA 4DS4A 4M9HA 8ICMA 4O3NA 3JPSA 4DQPA 4PHPA 9ICRA 4K4GA 3V6HA 1BPYA 9ICSA 4M04A 2PFNA 3V72A 1ZQPA 3PW7A 1BVSA 2VA2A 2RDJA 1S76D 4O3OA 3HT3A 2JEIA 4J9KA 2HHWA 2KZMA 3RBEA 3PW2A 2FLLA 1ZQUA 4I27A 4YR2A 4PH5A 1S0MA 2KZ3A 3PVXA 2HVHA 1JN3A 2Y1JA 4DLEA 3ZD9A 1DGSA 3T3FA 3QZ8A 2FMSA 1S9FA 3GIJA 1SZPA 4YD2A 1Z3EB 3RR8A 5DGBA 1ZQNA 4YVZA 5J2KA 3JPOA 1AROP 3KHHA 3RB4A 4F91B 4YD1A 5HHIA 3OHBA 4ECRA 4BXOB 4KLFA 5KFAA 1ZQLA 3GIMA 2VA3A 4O5EA 2AGOA 1C7YA 5IIOA 1ZQVA 3ZD8A 5F9NA 2FPMA 2V9WA 5KFTA 4KLEA 1XC9A 4J9SA 3RH6A 1TV9A 1WCLA 4ED1A 4UB4A 4M0AA 2ASJA 3OGUA 4I2IA 3K75D 1JIHA 5KG2A 4UQGA 4PHEA 1N48A 1XO1A 1ZQHA 5J2AA 8ICWA 1X9SA 3GIKA 3RJFA 7ICHA 1ZQGA 2ZTDA 3RRGA 5EWGA 5J2FA 4R63A 3T5KA 4F8RA 9ICHA 4ELUA 7ICGA 4DF8A 5KFJA 3MDAA 4J9MA 4ECYA 5J0OA 5KFBA 2XGQA 5KT5A 1S10A 3C2MA 4YFKA 3RAQA 3EYZA 2FLNA 5D4BA 2BCUA 3H8WA 4DQIA 4DSIA 1IM4A 5EOZA 5DBBA 2JEFA 3LDAA 2FMQA 4I2AA 3FDSA 3HW8A 5L1IA 5KFFA 5DB7A 5J2BA 1RYSA 5J29A 1BPEA 3AU2A 2IMWP 4ED3A 1X2IA 4IQTA 4NLZA 2ISOA 4MEXA 4YMMA 2JZBB 9ICXA 4KLTA 3G6VA 4FS1A 1L3TA 1RZTA 4I28A 4X5VA 4PHDA 1XS9D 3RB3A 4QZCA 4JV2A 1QSYA 3ZDBA 4M2YA 4KLGA 8ICQA 2P6RA 1TVAA 2C2EA 1RXWA 1ZQEA 1S0NA 3THVA 1TK0A 4DOBA 5KFOA 4NXZA 4RQ2A 3PW4A 2R8JA 1ZQKA 2BR0A 2HHUA 4B9TA 4P2HA 2ZUCA 3UQ2A 3PW0A 3ORYA 1U49A 2MUTA 4EBEA 4IQVA 3PMNA 4KLIA 3GV7B 4F50A 4ED0A 3RTVA 3UXNA 3ZDEA 4F4XA 1WCNA 2C2RA 1NJWA 4RQ8A 3BDPA 4F4YA 5EWFA 8ICNA 2UVVA 5KFGA 4GC6A 4MFFA 2PFQA 3TARA 4QZ8A 4DOAA 3TAQA 1ZQWA 4UAZA 1L3SA 4O9MA 2KN7A 4J9QA 2HHXA 1TAQA 3GQCA 2UVUA 3HPOA 3GDXA 4KLMA 3V7LA 3M8SA 8ICOA 5KG7A 4YP3A 4HYKA 1D9DA 2ZTEA 4MEYA 1ZJNA 4RU9A 1S0OA 1KSPA 4IR1A 2B21A 2BCVA 1KLNA 2BDPA 3H8JA 3SYZA 3KHRA 5IIJA 2R8IA 1ZYQA 4ECSA 2P6UA 4Q45A 5DG8A 4B9VA 4TUPA 5KFCA 5D46A 5DQGA 2XGPA 2XY5A 2NRZA 5DGAA 1UA1A 1ZQOA 2F1IA 3C23A 1L3VA 3ZDAA 2W8KA 4KN7A 5KFXA 1HUZA 2MAXA 3MR3A 4F5PA 4GLXA 9ICLA 1HUOA 4EYIB 4RQ4A 5C5JA 8ICTA 2MUTB 5DDMA 2XCAA 4YG2A 4RT2A 4R8UA 4QZFA 1D8LA 3RAXA 1NJXA 1PZNA 4PGQA 2KFNA 4JUZA 3T5LA 4RQ0A 5HNKA 2NRTA 1NK8A 4R65A 2DPJA 2WTFA 5KFHA 4DQQA 3MBYA 4EZ9A 4M9NA 4QZGA 9ICPA 5CA7A 3IM1A 1X9MA 4KLDA 9ICCA 4QZDA 1B22A 9ICFA 8ICRA 1KEJA 5J2HA 4DL7A 4J9NA 4F3OA 4Q8FA 4KLLA 1B43A 3H4DA 3OSPA 4DFPA 4M6WA 1KRPA 4DFKA 3RJKA 4JK1A 4RPXA 3ISDA 3N97B 4J9RA 1SL2A 1NK9A 5BOMA 3C2KA 3V7KA 3BQTA 4C8NA 4XA5A 5DB6A 1X9WA 2AQ0A 2ZUDA 2BCQA 4F5OA 3RB6A 4K4HA 3QZ7A 1UT5A 4QWEA 5J2DA 2BKEA 4J9LA 5KFMA 5KFQA 5KFUA 2R8GA 4F2SA 4LZGA 3K4GA 5KG5A 3EW9A 4DL4A 5IIIA 3H8SA 4UB3A 3V7JA 1ZQQA 4BWMA 5HMLA 1ZQTA 1ZQRA 2UVRA 4IR9A 2RDIA 3GV8B 4Z6FA 3FYHA 4K4IA 1KDHA 1QTMA 2FLPA 3M9MB 4F4ZA 5CP2A 4PPXA 2C2DA 4KITB 2XC9A 2JZBA 2W9MA 4RNOA 4GC7A 5HMMA 4TQRA 1ZQYA 3OHAA 2XY6A 1NJYA 1BPZA 8ICIA 3PX4A 4YMOA 1D8YA 4YMNA 5D49A 3AUOA 4O5KA 3E2EA 2VANA 4P4PA 4B9LA 4RQ7A 1NK7A 5IINA 2OWOA 3TAPA 4P4MA 3PY8A 5J0PA 4IRDA 7ICKA 5KG1A 3C21A 2I9GA 3G6YA 4KLQA 3MR6A 5KG3A 4KLSA 2BHNA 1A77A 3Q8SB 3RR7A 4I2HA 4RT3A 4QWBA 4QZBA 4DFMA 1NK5A 2F1JA 1QSLA 8ICEA 4E0DA 2ZJAA 3PV8A 4KLHA 2FPKA 1ZQBA 2AJQA 2HVIA 3EWAA 3PMLA 8ICGA 5TZVA 8ICBA 1T8EA 2V4RA 4I2BA 3KHGA 7ICLA 3RJJA 4Q44A 1DOQA 4PGXA 5KFEA 4JV0A 5DQHA 2BQ3A 4F93B 1HJPA 4ED2A 2NRWA 1ZQFA 2R8HA 4P4OA 3Q8RB 4DEZA 3RJIA 1ZQCA 1ZQJA 2J6UA 1ZQXA 2H5XA 3UXPA 5DKWA 2BPFA 2JEJA 1T7PA 5KTQA 2BCSA 7ICJA 4ECZA 2ZJ8A 2BQRA 5J2EA 2HHSA 3BQ0A 1S0VA 4M9LA 3C1YA 4YXMA 2UVWA 5CB1A 1IXRA 4YR0A 4FBTA 2IBKA 4RPZA 4RQ6A 5KFIA 1MSWD 4ELTA 4M6WB 3M9NB 3SI8A 4M47A 1NOMA 5DBAA 4C8KA 3GIIA 5DQIA 3EPIA 1Z00A 2A1JB 5L1JA 4ZH4A 3T5JA 5BPCA 1KTQA 5KT2A 9ICUA 4DL6A 4B9NA 4NY8A 1TAUA 4GXIA 4I2DA 7ICQA 4ECXA 7ICVA 5KFRA 1SKRA 2KFZA 4FBUA 5CJ7A 3KHLA 5J0XA 3LK9A 3V6KA 5DG7A 3QEBZ 4NLKA 4KLOA 2IHNA 4I2EA 1ZQDA 4DSJA 2NRXA 3QE9Y 2AGQA 4JWNA 5BOLA 2V4QA 3BJYA 2A1JA 2BPCA 3PX0A 2C22A 2FPLA 3TANA 4I2JA 2PFPA 3LWMA 1ZQAA 4EBCA 3UQ0A 4O0IA 3TQ1A 4LVSA 7ICNA 2ASLA 3UPQA 3TFSA 1NKCA 3PR5B 3AU6A 1RXVA 4MFAA 4R66A 4CCHA 3V6JA 3GV5B 3RJEA 1KFSA 2XO7A 4JV1A 5KT6A 2ASDA 4MF8A 2R8KA 1UT8A 1XWLA 3GFKB 4QZIA 4KLJA 8ICZA 4QZ9A 4B9SA 4ED6A 5J0RA 1L5UA 2HW3A 4DWIA 2J6TA 8ICCA 2VA8A 4DLGA 5JUMA 4DSKA 3LWLA 3UXOA 2PFOA 1QLNA 8ICVA 7ICSA 3PO5A 8ICJA 5DLFA 3H4BA 3BQ2A 1N56A 7ICTA 1TKDA 8ICXA 4RNNA 8ICSA 5KG0A 5J0UA 3Q8MA 2P66A 5KFPA 4DSLA 7ICIA 5DBCA 2W9CA 1S77D 2ALZA 1CEZA 1BPXA 4EBDA 1JXEA 5L1KA 5KFSA 7ICOA 2ZTCA 3Q8LA 7ICRA 5KFWA 4DSEA 4J9OA 5DB9A 1UA0A 4O3QA 1Z00B 3ISBA 1BGXT 5CWRA 3JPPA 3RRHA 1TK5A 4BGDA 1RYRA 2DPIA 5IILA 4BXOA 4IRCA 4UBCA 4QZHA 4F4WA 4F4KA 2ZJ5A 5J0SA 4DOCA 3PO4A 2W9BA 3NTUA 8ICHA 4DFJA 4G3IA 4GXKA 3PNCA 2M9NA 3OJSA 4IQWA 3OSNA 4DL5A 1BPDA 4Q43A 1JMSA 1KFTA 2I1QA 4DQSA 1XSPA 1TK8A 4XRHA 2KTQA 3JPRA 4IRKA 1U4BA 4DF4A 5KG6A 5KT7A 3IHQB 4FS2A 3MFIA 1NKBA 5J2IA 3TFRA 4PGYA 3KTQA 4NLGA 1NK4A 4Z6CA 4Z6DA 4QW8A 4DL3A 2BCRA 4Q8EA 4JWMA 4F5QA 9ICNA 2BQUA 9ICAA 1XSNA 1ZJMA 1LV5A 4YN4A 3BQ1A 2XY7A 4DQRA 4QWCA 5KG4A 8ICPA 3H40A 3SV3A 3Q8QB 2PI4A 3T5HA 5J0YA 1NK6A 3PR4A 7ICPA 4QZAA 4PHAA 1L3UA 1ZQMA 3G6XA 3MGIA 4IQUA 2W9AA 2PI5A 1MQ3A 3EZ5A 5KT3A 1RPLA 4QWDA 3RH4A 1CUKA 2LYHA 1LB2B 3C1ZA 9ICKA 4RZRA 4ECUA 4DL2A 5HP4A 1XU4A 9ICQA 5IIMA 1D9FA 5KFLA 3QEAZ 4MF2A 9ICWA 5KFYA 5DLGA 5HHHA 1BPBA 5KFDA 3JPNA 4EYHB 5J0TA 4YR3A 2DFLA 4Z6EA 3JPQA 4ED7A 1S97A 9ICBA 4B9UA 4QWAA 4ECWA 2JEGA 1K1QA 1QSSA 3RH5A 4NM2A 4BWJA 3N4MB 4I29A 2XCPA 4I2CA 2W9BB 3ETLA 3JPTA 2C28A 2Y1IA 4FO6A 1NKEA 5DDYA 3M9OB 3RJHA 5DG9A 3MFHA 5KFKA 2HHQA 4UB2A 3MGHA 4BDPA 8ICFA 2PXIA 3ZDDA 4RQ1A 2W8LA 1MC8A 4O3SA 4ECQA 3M8RA 4XUSA 5J2GA 3HX0A 7ICUA 4XQ8A 4RPYA 3GILA 4UB1A 4KTQA 1U48A
chains in the Genus database with same CATH superfamily
5J0WA 4C8OA 2H3FA 4KMUA 4J9PA 8ICUA 2HBMA 4QW9A 4MHVA 1ZQIA 3TI0A 3HP6A 2HHTA 3ICXA 2F3NA 3M6KA 1ZD4A 5AKGA 1ZETA 1URJA 5J2CA 5B5EU 2FMPA 4FZLA 3Q8KA 3B0XA 7ICEA 4R64A 3SAGA 9ICVA 3T79A 2KTQA 4TURA 4AP9A 3D6JA 5CHGA 4TQSA 2EAMA 1DRGA 1T3NA 3BS5B 4DO9A 2ISPA 3UM9A 4UAVA 1T4GA 5KFVA 4RQ5A 5KFNA 1J2NA 1RQNA 4ECVA 9ICTA 2HHVA 1OUQA 3RBDA 1NK0A 4YQWA 4IS7A 2G08A 3BQ7A 3AMZA 2PMZC 5L9XA 1N60A 4F5RA 4YCXA 2CRXA 4UW9A 8ICMA 4DQPA 5K4LA 2KNJA 4PHPA 3V6HA 9ICSA 1ECWA 4M04A 1NI3A 3RBEA 3PW2A 2LPEA 1X40A 4YR2A 1S0MA 3PVXA 1JN3A 3ZD9A 3T3FA 1SXEA 5EE1A 4YVZA 4ECRA 3S6JA 4BXOB 4CF5A 2EH9A 2O6KA 2WF8A 2V9WA 1DK2A 3WK4A 2AHOB 4CE6A 3O0FA 3NVVA 4USAA 1N48A 2A19A 5J2AA 3GIKA 2ZTDA 4R63A 4PL1A 2W43A 3MDAA 3RF9A 5KFBA 2Y0SF 4PJ0U 3EYZA 4DQIA 3H8WA 5EOZA 2JEFA 2FMQA 4LZGA 1RYSA 5J29A 2IMWP 4YMMA 4JV2A 1QSYA 8ICQA 1TVAA 2W03A 2OXOA 4EX7A 3B9JA 3CP8A 2G09A 3PW0A 5KAFU 4KLIA 2KFZA 1NJWA 3CYMA 2C2RA 2KOBA 5AK4A 3UMBA 4RQ8A 5EWFA 2UVVA 5KFGA 3KFUF 2D3DA 4QZ8A 4DOAA 1SXDA 2HHXA 2Q4TA 2UVUA 5AM3A 3HPOA 5AKYA 3V7LA 2YTUA 3AQEA 3M8SA 3F2BA 4NL9A 4EENA 1ZJNA 4US9A 4IR1A 3H8JA 5ALYA 2K8BB 5IIJA 2R8IA 2ZIWA 1ZD3A 2P6UA 1RM6C 3IV6A 1X6JA 1ZQOA 1TAMA 3C23A 2W8KA 3CRXA 2EANA 3MR3A 4RQ4A 5DDMA 2XCAA 4QZFA 4PGQA 1L7PA 5HNKA 2BZFA 5GTIU 2WTFA 4Y2QA 5KFHA 4EELA 4KLDA 3ALRA 1MN8A 4QZDA 3WKBA 1U48A 5J2HA 1K5OA 4J9NA 1B43A 1X42A 3H0MB 1KRPA 4C4SA 2WF5A 4JK1A 4RPXA 4J9RA 4HAIA 3C2KA 3V7KA 2BCQA 3KOOA 2BKEA 5KFMA 5KFUA 2R8GA 4DL4A 1JROA 1ZQQA 5HMLA 1ZQTA 1ZQRA 4IR9A 3GV8B 4K4IA 2KK0A 3L3FX 2K4IA 2FLPA 2XC9A 2JZBA 3QUBA 5HMMA 2KHQA 2KG5A 2VANA 2JH1A 1SIJA 5J0PA 4C4RA 3WU2U 1Z4NA 5KG3A 4KLSA 2BHNA 3RR7A 1NK5A 4QZBA 4DFMA 1BNOA 2FPKA 3C29A 7ICLA 1L8LA 4PGXA 2VIXA 2OH2A 4JV0A 5KFEA 2NRWA 2R8HA 2ES6A 2OEHA 1ZQXA 1T7PA 2BCSA 7ICJA 2WAQC 4YXMA 2EQYA 5CB1A 2RQ5A 3SI8A 2BDUA 1Z00A 5L1JA 2VKQA 3HKZF 4B9NA 2WF9A 4I2DA 2HSZA 5CJ7A 2QARB 3BJYA 3I28A 3TANA 2FPLA 4I2JA 2PFPA 5EE9A 3TQ1A 3F2DA 1SB3C 2XO7A 4JV1A 1XWLA 3TADA 1N61A 4QZ9A 3NRWA 5ALJA 1IIPA 1L5UA 4DWIA 2RP5A 8ICCA 2VA8A 5JUMA 4DSKA 1T94A 7ICSA 3BQ2A 4JB3A 1TKDA 5KG0A 2H3QA 1CEZA 5C0YA 2JR5A 1WYGA 5KFWA 4O3QA 3ISBA 2E8MA 5IILA 4KX3A 1ZXIA 5J0SA 4F4KA 4DOCA 8ICHA 3OPXA 4GXKA 3PNCA 4IQWA 4DL5A 1BPDA 1JUDA 3JPRA 4FZNA 4DF4A 5KG6A 1UPHA 3TFRA 4J03A 4Z6DA 2F44A 9ICNA 4WJ3B 4DQRA 1VDVA 1S8OA 4QZAA 5ALGA 1ZQMA 3MGIA 2DL0A 1RG6A 5KT3A 1RPLA 4ZOHC 1A6SA 2LYHA 3C1ZA 9ICKA 4RZRA 9ICQA 4JWNA 3JPNA 2C22A 2JV3A 4EYHB 5ALNA 5J0TA 4NM1A 9ICBA 3JPQA 2LHTA 1F0MA 5EE3A 5AKIA 3N4MB 3JPTA 4FO6A 3RJHA 3MFHA 2HHQA 4U7CA 3MGHA 8ICFA 1KKXA 4B6JA 4O3SA 5AM1A 4M9GA 1K1SA 8ICLA 3K1RB 3L5KA 4PZNA 2W9CB 2W7OA 2GO7A 3WKAA 4B9MA 9ICOA 1SKSA 1V97A 4F2RA 9ICIA 3F5AA 5AIBA 3SV4A 1H38A 2MA1A 2YN4A 1TFRA 2EZXA 1U45A 1DXSA 1M6YA 5ALFA 2FDRA 1ZQSA 4ELVA 4RQ3A 1NJZA 4I2FA 4RUCA 4C0ZA 8ICAA 4KX5A 3ZDCA 4DS5A 1JXLA 9ICGA 1A76A 3NGDA 5ALXA 1V9PA 3EPGA 3TACB 2HDOA 9ICMA 4KLUA 4MFCA 1PVRA 2IHMA 1NNLA 2E3TA 4GXJA 4KN4A 4UARA 4QZEA 5KFZA 3SZ2A 8ICYA 2E8OA 3PW5A 2OYYA 2NO5A 4DS4A 5ALWA 3E0FA 2OHFA 3NRZA 2PFNA 1S76D 1BVSA 2JEIA 2HHWA 5FP0A 2G06A 3RFAA 2FLLA 4I27A 1V38A 2KZ3A 1KW4A 2Y1JA 3QU9A 1UQVA 3KZIU 3QZ8A 3GIJA 1SZPA 3RR8A 2JXJA 5DGBA 3JPOA 4F91B 2A1AA 2E5SA 2Y9TA 2VA3A 2K4PA 2AGOA 5F9NA 4KLEA 1XC9A 2LMRA 3QU7A 3QU2A 4UQGA 5KG2A 4OO1J 7ICHA 1SGGA 5ALTA 2HBLA 5L1MA 5AI4A 1LVHA 5AKHA 4DF8A 4KMOB 1S10A 8ICXA 5F3XB 4J9MA 2XGQA 5KT5A 1B0XA 2FLNA 3MC1A 5ALQA 1PK1A 5DBBA 3LDAA 3E58A 3FDSA 1RDFA 2W3SA 5DB7A 3AU2A 9ICXA 5ALEA 3G6VA 2E1FA 2DKZA 4PHDA 2ZIUB 1XS9D 3ZDBA 4M2YA 1N62A 2P6RA 1S0NA 5KFOA 2KMDA 2BR0A 2ZUCA 3FAHA 1U49A 3DEEA 3ORYA 4IQVA 3M7DA 4ED0A 3RTVA 4F4XA 4GC6A 3BS7A 1ZQWA 1SV0C 4O9MA 2KN7A 1TAQA 4QJFB 3GDXA 1RQLA 1ZOLA 4YP3A 4HYKA 2ZTEA 3SR6A 4AYBC 4RU9A 2B21A 3TADC 2BDPA 1ZYQA 5CEHA 5DG8A 2XY5A 1UA1A 1L3VA 3ZDAA 1SWVA 2B0CA 5KFXA 2E8PA 2ZIXA 4PL2A 2MUTB 4YG2A 4RT2A 3RAXA 2I5HA 2KFNA 2FE9A 2NRTA 1F5SA 1NK8A 4R65A 2DPJA 4M9NA 4EZ9A 2KVSA 4QZGA 1X9MA 1B22A 9ICCA 8ICRA 2G0AA 1O03A 4DL7A 3D2QA 3M1YA 4KLLA 2CN1A 2LM1A 2RLTA 4M6WA 2ZIUA 4NWIA 3N97B 1NK9A 1L6NA 5DB6A 4XA5A 1X9WA 4F5OA 5AI8A 3QZ7A 4F2SA 2ZIXB 2WF6A 3M6ZA 5IIIA 4UB3A 1J97A 4Z6FA 1KDHA 4C7ZA 2EDUA 4NLCA 3M9MB 4CDGA 4F4ZA 4LJXA 2IOFK 1KN5A 2C2DA 4PPXA 2W9MA 4TQRA 4EEKA 4YMNA 5D49A 5J8YA 3PZPA 4B9LA 4RQ7A 1NK7A 4P4MA 4Y2TA 3C21A 1WWUA 3HRDD 4KLQA 3WK9A 2F1JA 1SWWA 4BX9C 3CNHA 4E0DA 2ZJAA 2HVIA 8ICGA 1T8EA 2V4RA 4I2BA 3QXGA 4Q44A 2NV3A 5DQHA 2BQ3A 4P4OA 3RJIA 3UXPA 2BPFA 2JEJA 3GU3A 1Q46A 1Q8KA 4IL6U 2HHSA 3BQ0A 3GZFA 3C1YA 1IXRA 4YR0A 4FBTA 2IBKA 4RPZA 1QQ6A 4GFJA 5KFIA 4ELTA 1XO0A 5KL8B 3LVWA 1NOMA 5DBAA 5AM2A 4C8KA 4M47A 3EPIA 3OTQA 1L7MA 3T5JA 5BPCA 4DL6A 2W3RA 1TAUA 7ICQA 4ECXA 5KFRA 4FBUA 3KHLA 3V6KA 2IHNA 3QYPA 2AGQA 3PSIA 1BNPA 2A1JA 3PX0A 3WK6A 7ICNA 3TFSA 4FE3A 3PR5B 1RXVA 3I76A 4CCHA 3V6JA 4UASA 3GFKB 4PZOA 4QZIA 2Y9UA 2ZXHA 1KQQA 2F8LA 2J6TA 1QLNA 3KKAC 2CPRA 5AI0A 2P66A 5KFPA 2G07A 3BS5A 1S77D 1HEKA 1BPXA 1JXEA 2MU2A 4OJ6A 2AH5A 2QB1A 4J9OA 2LI6A 3JPPA 2F8KA 2DPIA 4BXOA 4UBCA 4F4WA 5ALRA 2ZJ5A 4G3IA 2KSOB 5AK3A 3OJSA 4Y2VA 1JMSA 2QKQA 3IG8A 2I1QA 1XSPA 2KICA 5KT7A 4FS2A 2YMMA 2FJ6A 4Z6CA 4DL3A 2BCRA 3CW2C 4F5QA 4GIBA 2BQUA 2KV2A 1XSNA 4YN4A 3BQ1A 2XY7A 4QWCA 5KG4A 2E1EA 1A0PA 3IG5A 2KJ5A 5J0YA 3C28A 1OW5A 1PVPA 2WB1C 3K1ZA 3G6XA 2GH1A 3EZ5A 5HR6A 3RH4A 1LB2B 1D9FA 5KFLA 4MF2A 9ICWA 5KFYA 5HHHA 1BPBA 1S97A 4YR3A 2DFLA 4Z6EA 4ED7A 5J8YC 4QWAA 1QSSA 3RH5A 4BWJA 2W9BB 2Y1IA 1AQ6A 3H8MA 5DDYA 5DG9A 1JRPA 4UB2A 3PSTA 2ZG6A 2PXIA 1CRXA 5H2FU 4RQ1A 2W8LA 2ZXIA 1D8BA 4XUSA 1Z4OA 3GILA 2A3VA 4ACOA 5J2JA 4JMUA 4Y2XA 4NL9C 1HIWA 1KFDA 1Z19A 4UB8U 4F72A 4F92B 3MR2A 3H0LB 5EWEA 3F2CA 4EEYA 2ATLA 4RUAA 2AQ4A 4I2GA 2AU0A 8ICKA 2ZUBA 3IP4B 2W54A 4F5NA 2ESEA 5L1LA 4UAYA 3C2LA 4NLNA 1COOA 2KZZA 2XIDA 3MDCA 3C5FA 2IA6A 4EZ6A 3PX6A 3OJUA 4Y2UA 3HWTA 1NZBA 4M9JA 4OJPA 3MR5A 3SAFA 3C5GA 3KZXA 1XSLA 2KJ9A 2Q0ZX 4LZDA 9ICEA 5DB8A 3H7IA 2GWSA 4R8UB 1SKWA 7ICFA 4Y2JA 3WKDA 2DQNB 4K4GA 5AK6A 2DKXA 2EAOA 3V72A 1ZQPA 3PW7A 2VA2A 2GLEA 4O3OA 3HT3A 4J9KA 2KZMA 1VLBA 2HCFA 1RYUA 4FFDA 2HOIA 2HVHA 4DLEA 1DGSA 2K4HA 2FMSA 2K8AA 4YD2A 1Z3EB 1ZQNA 3KHHA 1WG8A 3RB4A 4YD1A 5HHIA 3OHBA 5KFAA 1ZQLA 3GIMA 3A0HU 4O5EA 3J81j 3ZD8A 2FPMA 1X66A 4J9SA 3RH6A 1TV9A 1WCLA 4ED1A 3ETRA 2QB0B 4M0AA 2ASJA 4I2IA 4PHEA 1ZQHA 1ZQGA 1ZRNA 3T5KA 4ELUA 4QIWF 3AM9A 5KFJA 5J0OA 3C2MA 2L5YA 4YFKA 3TKAA 3RAQA 4DSIA 2ODGA 4I2AA 3HW8A 5L1IA 2NYVA 4CF3A 2GOLA 4Y2YA 4ED3A 1X2IA 4IQTA 2ISOA 2YY6A 4KLTA 4FS1A 3D2SA 2JGAA 1RZTA 4I28A 4X5VA 3RB3A 4QZCA 2Z7JA 4KLGA 2LBOA 2C2EA 1RXWA 1ZQEA 3THVA 1TK0A 3HILA 4DOBA 2KJ8A 1ZQKA 4B9TA 4P2HA 4Y2RA 4NLBA 1L7NA 3BZCA 3GV7B 4F50A 3PSPA 3ZDEA 3BDPA 5AK5A 1WCNA 4A8EA 4F4YA 8ICNA 3LYSA 5ALVA 4MFFA 1YZ7A 2JRZA 2W04A 3TAQA 3AQFA 2ZIWB 1IV8A 1N5WA 8ICOA 2H3ZA 1D9DA 1S0OA 2BCVA 3AN1A 2YB4A 4ECSA 4Q45A 4B9VA 1B4FA 2XGPA 5D46A 5DQGA 2NRZA 5DGAA 1N5XA 1OXJA 2F1IA 2F2AB 1HUZA 2IOHA 4GLXA 9ICLA 4EYIB 5C5JA 8ICTA 1D8LA 1NJXA 3SQIA 1PZNA 4JUZA 3T5LA 1KBUA 2XVTA 2LM4A 5HR7A 3QU4A 1PVQA 4F3OA 5AI5A 4DFPA 2HBKA 3IRUA 4DFKA 3IDWA 3ISDA 1SL2A 2ZIVB 2H3VA 2LYBA 2AQ0A 2ZUDA 2K89A 3RB6A 4K4HA 5J2DA 1QH9A 1YT3A 3K4GA 4UB6U 5KG5A 3EW9A 3H8SA 4BWMA 2UVRA 2RDIA 2HOQA 2PKEA 3KD3A 4OJLA 3AEVA 4RNOA 1BPZA 2XY6A 8ICIA 3WK8A 1Z1VA 4O5KA 3E2EA 4P4PA 2OWOA 3PY8A 1QQ7A 5AICA 4IRDA 2I9GA 2G5IB 3MR6A 1PK1B 3Q8SB 4I2HA 4QWBA 4F71A 1Q3UA 4P0PA 2DWQA 2AJQA 3EWAA 4EX6A 5TZVA 3KHGA 5TISU 1QQ5A 3HKZC 1FFVA 4OD0A 4F93B 1HJPA 3Q8RB 2CXYA 4DEZA 4QIWC 1ZQCA 1ZQJA 2H5XA 5DKWA 5KTQA 5ALHA 4U6PA 3F53A 2ZJ8A 5J2EA 1FEZA 4M9LA 3L4PA 2UVWA 1O08A 3QU5A 1MSWD 4M6WB 5KAIU 3M9NB 5G5GA 2I6XA 4ZH4A 1KTQA 9ICUA 5KT2A 7ICVA 1SKRA 1SV4A 3QEBZ 3LK9A 5DG7A 4ICAA 1X9XA 4DSJA 2NRXA 5BOLA 2KD1A 2WB1F 2OCEA 1X6IA 1ZQAA 4LVSA 3UQ0A 1P7DA 2ASLA 1PK3A 1L8OA 4P0QA 4MFAA 3RJEA 2ASDA 8ICZA 2HW3A 1WUDA 3LWLA 3UXOA 2PFOA 8ICVA 2DF4B 5DLFA 8ICJA 3SAHA 4RNNA 4DSLA 7ICIA 5DBCA 2PMZF 4EBDA 7ICOA 1ZQ1C 2ZTCA 7ICRA 1UA0A 3NUQA 5CWRA 3RRHA 4IRCA 4QZHA 1UCVA 4AYBF 3N7PD 2W9BA 3NTUA 3PO4A 4DFJA 2M9NA 4Q43A 1KFTA 3ZI4A 3EUB2 4DQSA 1COKA 2KVCA 2N1RA 4IRKA 1NKBA 3KTQA 3MFIA 4NLGA 5J2IA 2NO4A 1NK4A 5AI6A 4Q8EA 4JWMA 2QLTA 3F5EA 2P35A 4CGZA 1ZJMA 1LV5A 8ICPA 4NV0A 5T14A 3Q8QB 3T5HA 1NK6A 3PR4A 7ICPA 1J2MA 2RHFA 2HMXA 4IQUA 2W9AA 2ZIVA 4QWDA 1CUKA 5AKKA 2WAQF 4ECUA 4DL2A 2RRDA 5HP4A 1XU4A 4OCZA 3QEAZ 2JH7A 2DBYA 5DLGA 5ALPA 5KFDA 5AI9A 1K1QA 5EE0A 1QCKA 2XCPA 4I2CA 3ETLA 1NKEA 5E79U 5KFKA 3DDHA 3M8RA 5J2GA 1ZD2P 7ICUA 1N2XA 4RPYA 1SV0A 3QNMA 4KTQA 4IC9A 5JRTA 5AKZA 4C8LA 4ED8A 2KIVA 4O3PA 2E8NA 1JI7A 5CR0A 4TUQA 5IIKA 1WWVA 2F1HA 1SL1A 1IG6A 4O5CA 2MSNA 4RNMA 3IN5A 4UBBA 1U9LA 3FC4A 2W7PA 5F9LA 2HBJA 1V85A 4ECTA 7ICMA 1SL0A 4UB5A 3N7RC 4C8MA 2EZZA 3Q8PB 3MABA 1L7OA 1ZQZA 1JX4A 4CRXA 3ONNA 4UAUA 2BGWA 3I1YA 5J0QA 1U47A 3RB0A 1MQ2A 3ISCA 2IOFA 4DSFA 2AGPA 4O3RA 1DK3A 2K60A 3LVVA 4TUSA 2BPGA 1EXNA 2K4EA 2W11A 3MGVA 1F44A 1Y88A 2VJ4A 4UAWA 2NRVA 3B0YA 3RJGA 4YXJA 1DGJA 2J6SA 5KT4A 9ICJA 2AXTU 4M9HA 4P0QB 4O3NA 3JPSA 1VJ5A 5B66U 9ICRA 4UATA 1BPYA 2QARA 2RDJA 5AM4A 1ZQUA 4PH5A 1NZPA 1S9FA 3NVZA 5J2KA 1AROP 4KLFA 5ALDA 4DFDA 3BZKA 2W55A 3QUQA 1C7YA 5IIOA 5AKEA 1ZQVA 2DUYA 5KFTA 4UB4A 3OGUA 3K75D 1JIHA 3KKAA 1XO1A 8ICWA 1X9SA 3FM9A 3RJFA 3SMVA 3RRGA 3NASA 5EWGA 5J2FA 5AM5A 4F8RA 9ICHA 2K8CB 3WK5A 4ECYA 5AKLA 1UHUA 5ALSA 5D4BA 2BCUA 1IM4A 1XNSA 1SZHA 5KFFA 5J2BA 1BPEA 1ZRMA 4NLZA 3WKEA 4MEXA 1PUZA 2JZBB 1L3TA 3N28A 2WF7A 2YMQA 1JALA 4US8A 5AKJA 3DV9A 3WKCA 4NXZA 4RQ2A 3PW4A 2R8JA 2HHUA 3VCBA 3UQ2A 2MUTA 4EBEA 3SD7A 4Y2SA 3PMNA 5ALZA 3UXNA 2FI1A 2PFQA 3TARA 4UAZA 1L3SA 2HOFA 2KKVA 4J9QA 3GQCA 4KLMA 4OJOA 5KG7A 4MEYA 3SEIA 2WFAA 1KSPA 1KLNA 3SYZA 3KHRA 4Y2PA 3AL0B 4TUPA 5KFCA 1TE2A 3N7SC 2H3IA 5ALKA 2R18A 4KN7A 2MAXA 4F5PA 1HUOA 1FFUA 4R8UA 5KL1B 2F77X 3QUTA 4RQNA 1T3QA 4RQ0A 5JU5A 4BUGA 2KP7A 4DQQA 3MBYA 9ICPA 5CRXA 5CA7A 3IM1A 9ICFA 4NJ8A 1KEJA 4BJQA 2YB1A 2QB0A 4Q8FA 3H4DA 1Q3VA 3OSPA 5AHXA 5AM0A 3RJKA 2B6GA 5BOMA 3PSFA 3BQTA 4C8NA 1UT5A 4QWEA 4J9LA 5KFQA 4DCCA 5ALUA 3V7JA 3UMCA 3FYHA 1QTMA 2XI9A 1KL9A 5CP2A 4GC7A 4KITB 1N63A 1ZQYA 3OHAA 1NJYA 3PX4A 4YMOA 4P0PB 5G5HA 1D8YA 3AUOA 5IINA 3TAPA 7ICKA 2KHVA 5KG1A 2LYAA 2KSOA 1ED1A 3G6YA 1A77A 7ICGA 4RT3A 5ALLA 1QSLA 8ICEA 3PV8A 4KLHA 1ZQBA 4O3MA 3PMLA 2OM6A 8ICBA 3RJJA 1DOQA 2YMLA 4ED2A 1ZQFA 2J6UA 4ECZA 2BQRA 2KE7A 3SENA 5ALMA 1S0VA 2D8CA 4RQ6A 2EZYA 4OJ5A 4G9BA 3GIIA 4QNLA 5DQIA 2A1JB 4NY8A 4GXIA 5AIAA 2MRLA 1FO4A 5J0XA 4KLOA 4NLKA 2M0NA 2F76X 4I2EA 4C80A 1ZQDA 2WHEA 3QE9Y 2V4QA 2BPCA 3LWMA 4EBCA 4O0IA 3UPQA 1NKCA 3AU6A 4R66A 3GV5B 1KFSA 3D2NA 5ALIA 5KT6A 4FZMA 4MF8A 2R8KA 1UT8A 2LKYA 4KLJA 4C7YA 4B9SA 2JMGA 4ED6A 2HI0A 4CF4A 1CI4A 5J0RA 2EAPA 3NVWA 4DLGA 1ZD5A 1YZ6A 3PO5A 3H4BA 1N56A 2KEYA 7ICTA 8ICSA 5J0UA 3Q8MA 5GTHU 1LKYA 2W9CA 2ALZA 1S5LU 3A0BU 1Z1BA 3KBBA 1FIQA 5KFSA 5L1KA 3Q8LA 4C4TA 4DSEA 5DB9A 1Z00B 1TK5A 1BGXT 1RYRA 3NS1A 4BGDA 3U26A 2VJ5A 1GO3F 3HJEA 3OSNA 1MA7A 1TK8A 4XRHA 1U4BA 3IHQB 4PGYA 4QW8A 2DGZA 5AKXA 9ICAA 3VC8A 4CNQA 2KKPA 3H40A 3SV3A 2YMPA 2PI4A 3UMGA 5ALOA 2D6FC 2Y0SC 4PHAA 1L3UA 2YX8A 2PI5A 1MQ3A 3QUCA 5IIMA 5JTIA 1LKYB 5A0LA 4B9UA 4ECWA 2JEGA 4NM2A 3R9KA 4I29A 3WK7A 2JHDA 2C28A 5KNIA 3M9OB 3H0RB 4BDPA 2KIWA 4RQMA 3ZDDA 3NVYA 1MC8A 4ECQA 2YQEA 3HX0A 1C20A 2G5HB 3QX7A 4XQ8A 4UB1A 2XICA 3ED5A
chains in the Genus database with same CATH topology
5J2JA 5J0WA 4C8OA 1K1SA 4C8LA 4M9GA 8ICLA 4ED8A 4KMUA 4O3PA 4J9PA 8ICUA 1KFDA 4TUQA 5CR0A 5IIKA 4QW9A 2F1HA 1SL1A 2W9CB 4O5CA 4RNMA 1ZQIA 4F92B 3TI0A 3HP6A 3MR2A 4B9MA 2HHTA 4UBBA 1U9LA 9ICOA 1SKSA 5F9LA 4F2RA 9ICIA 4ECTA 7ICMA 1ZETA 1SL0A 5EWEA 5J2CA 4UB5A 4C8MA 3SV4A 4EEYA 1H38A 2ATLA 3Q8KA 3B0XA 2FMPA 7ICEA 4RUAA 3Q8PB 2AQ4A 4R64A 1TFRA 1U45A 9ICVA 4I2GA 2AU0A 3MABA 8ICKA 2ZUBA 1ZQSA 4TURA 4ELVA 1ZQZA 4RQ3A 1NJZA 1JX4A 4RUCA 5CHGA 4TQSA 4F5NA 4I2FA 5L1LA 4UAYA 3C2LA 4NLNA 8ICAA 3ZDCA 1COOA 1T3NA 2KZZA 4DS5A 3MDCA 4DO9A 2BGWA 3C5FA 1JXLA 2IA6A 4EZ6A 5J0QA 2ISPA 1U47A 3PX6A 9ICGA 3RB0A 3OJUA 3ISCA 1A76A 3NGDA 1MQ2A 1T4GA 3EPGA 1V9PA 5KFVA 4RQ5A 3HWTA 5KFNA 4DSFA 2AGPA 4ECVA 4M9JA 4NM1A 9ICTA 9ICMA 4KLUA 2HHVA 3MR5A 4O3RA 4MFCA 3RBDA 4TUSA 2BPGA 1NK0A 4YQWA 1EXNA 3C5GA 2IHMA 1XSLA 4GXJA 5L9XA 1Y88A 2Q0ZX 4KN4A 4LZDA 5KFZA 2NRVA 4QZEA 4UAWA 5DB8A 9ICEA 3H7IA 3B0YA 4R8UB 4YXJA 2GWSA 3RJGA 3SZ2A 4F5RA 2J6SA 1SKWA 8ICYA 5KT4A 7ICFA 3PW5A 9ICJA 4YCXA 4DS4A 4M9HA 8ICMA 4O3NA 3JPSA 4DQPA 4PHPA 9ICRA 4K4GA 3V6HA 1BPYA 9ICSA 4M04A 2PFNA 3V72A 1ZQPA 3PW7A 1BVSA 2VA2A 2RDJA 1S76D 4O3OA 3HT3A 2JEIA 4J9KA 2HHWA 2KZMA 3RBEA 3PW2A 2FLLA 1ZQUA 4I27A 4YR2A 4PH5A 1S0MA 2KZ3A 3PVXA 2HVHA 1JN3A 2Y1JA 4DLEA 3ZD9A 1DGSA 3T3FA 3QZ8A 2FMSA 1S9FA 3GIJA 1SZPA 4YD2A 1Z3EB 3RR8A 5DGBA 1ZQNA 4YVZA 5J2KA 3JPOA 1AROP 3KHHA 3RB4A 4F91B 4YD1A 5HHIA 3OHBA 4ECRA 4BXOB 4KLFA 5KFAA 1ZQLA 3GIMA 2VA3A 4O5EA 2AGOA 1C7YA 5IIOA 1ZQVA 3ZD8A 5F9NA 2FPMA 2V9WA 5KFTA 4KLEA 1XC9A 4J9SA 3RH6A 1TV9A 1WCLA 4ED1A 4UB4A 4M0AA 2ASJA 3OGUA 4I2IA 3K75D 1JIHA 5KG2A 4UQGA 4PHEA 1N48A 1XO1A 1ZQHA 5J2AA 8ICWA 1X9SA 3GIKA 3RJFA 7ICHA 1ZQGA 2ZTDA 3RRGA 5EWGA 5J2FA 4R63A 3T5KA 4F8RA 9ICHA 4ELUA 7ICGA 4DF8A 5KFJA 3MDAA 4J9MA 4ECYA 5J0OA 5KFBA 2XGQA 5KT5A 1S10A 3C2MA 4YFKA 3RAQA 3EYZA 2FLNA 5D4BA 2BCUA 3H8WA 4DQIA 4DSIA 1IM4A 5EOZA 5DBBA 2JEFA 3LDAA 2FMQA 4I2AA 3FDSA 3HW8A 5L1IA 5KFFA 5DB7A 5J2BA 1RYSA 5J29A 1BPEA 3AU2A 2IMWP 4ED3A 1X2IA 4IQTA 4NLZA 2ISOA 4MEXA 4YMMA 2JZBB 9ICXA 4KLTA 3G6VA 4FS1A 1L3TA 1RZTA 4I28A 4X5VA 4PHDA 1XS9D 3RB3A 4QZCA 4JV2A 1QSYA 3ZDBA 4M2YA 4KLGA 8ICQA 2P6RA 1TVAA 2C2EA 1RXWA 1ZQEA 1S0NA 3THVA 1TK0A 4DOBA 5KFOA 4NXZA 4RQ2A 3PW4A 2R8JA 1ZQKA 2BR0A 2HHUA 4B9TA 4P2HA 2ZUCA 3UQ2A 3PW0A 3ORYA 1U49A 2MUTA 4EBEA 4IQVA 3PMNA 4KLIA 3GV7B 4F50A 4ED0A 3RTVA 3UXNA 3ZDEA 4F4XA 1WCNA 2C2RA 1NJWA 4RQ8A 3BDPA 4F4YA 5EWFA 8ICNA 2UVVA 5KFGA 4GC6A 4MFFA 2PFQA 3TARA 4QZ8A 4DOAA 3TAQA 1ZQWA 4UAZA 1L3SA 4O9MA 2KN7A 4J9QA 2HHXA 1TAQA 3GQCA 2UVUA 3HPOA 3GDXA 4KLMA 3V7LA 3M8SA 8ICOA 5KG7A 4YP3A 4HYKA 1D9DA 2ZTEA 4MEYA 1ZJNA 4RU9A 1S0OA 1KSPA 4IR1A 2B21A 2BCVA 1KLNA 2BDPA 3H8JA 3SYZA 3KHRA 5IIJA 2R8IA 1ZYQA 4ECSA 2P6UA 4Q45A 5DG8A 4B9VA 4TUPA 5KFCA 5D46A 5DQGA 2XGPA 2XY5A 2NRZA 5DGAA 1UA1A 1ZQOA 2F1IA 3C23A 1L3VA 3ZDAA 2W8KA 4KN7A 5KFXA 1HUZA 2MAXA 3MR3A 4F5PA 4GLXA 9ICLA 1HUOA 4EYIB 4RQ4A 5C5JA 8ICTA 2MUTB 5DDMA 2XCAA 4YG2A 4RT2A 4R8UA 4QZFA 1D8LA 3RAXA 1NJXA 1PZNA 4PGQA 2KFNA 4JUZA 3T5LA 4RQ0A 5HNKA 2NRTA 1NK8A 4R65A 2DPJA 2WTFA 5KFHA 4DQQA 3MBYA 4EZ9A 4M9NA 4QZGA 9ICPA 5CA7A 3IM1A 1X9MA 4KLDA 9ICCA 4QZDA 1B22A 9ICFA 8ICRA 1KEJA 5J2HA 4DL7A 4J9NA 4F3OA 4Q8FA 4KLLA 1B43A 3H4DA 3OSPA 4DFPA 4M6WA 1KRPA 4DFKA 3RJKA 4JK1A 4RPXA 3ISDA 3N97B 4J9RA 1SL2A 1NK9A 5BOMA 3C2KA 3V7KA 3BQTA 4C8NA 4XA5A 5DB6A 1X9WA 2AQ0A 2ZUDA 2BCQA 4F5OA 3RB6A 4K4HA 3QZ7A 1UT5A 4QWEA 5J2DA 2BKEA 4J9LA 5KFMA 5KFQA 5KFUA 2R8GA 4F2SA 4LZGA 3K4GA 5KG5A 3EW9A 4DL4A 5IIIA 3H8SA 4UB3A 3V7JA 1ZQQA 4BWMA 5HMLA 1ZQTA 1ZQRA 2UVRA 4IR9A 2RDIA 3GV8B 4Z6FA 3FYHA 4K4IA 1KDHA 1QTMA 2FLPA 3M9MB 4F4ZA 5CP2A 4PPXA 2C2DA 4KITB 2XC9A 2JZBA 2W9MA 4RNOA 4GC7A 5HMMA 4TQRA 1ZQYA 3OHAA 2XY6A 1NJYA 1BPZA 8ICIA 3PX4A 4YMOA 1D8YA 4YMNA 5D49A 3AUOA 4O5KA 3E2EA 2VANA 4P4PA 4B9LA 4RQ7A 1NK7A 5IINA 2OWOA 3TAPA 4P4MA 3PY8A 5J0PA 4IRDA 7ICKA 5KG1A 3C21A 2I9GA 3G6YA 4KLQA 3MR6A 5KG3A 4KLSA 2BHNA 1A77A 3Q8SB 3RR7A 4I2HA 4RT3A 4QWBA 4QZBA 4DFMA 1NK5A 2F1JA 1QSLA 8ICEA 4E0DA 2ZJAA 3PV8A 4KLHA 2FPKA 1ZQBA 2AJQA 2HVIA 3EWAA 3PMLA 8ICGA 5TZVA 8ICBA 1T8EA 2V4RA 4I2BA 3KHGA 7ICLA 3RJJA 4Q44A 1DOQA 4PGXA 5KFEA 4JV0A 5DQHA 2BQ3A 4F93B 1HJPA 4ED2A 2NRWA 1ZQFA 2R8HA 4P4OA 3Q8RB 4DEZA 3RJIA 1ZQCA 1ZQJA 2J6UA 1ZQXA 2H5XA 3UXPA 5DKWA 2BPFA 2JEJA 1T7PA 5KTQA 2BCSA 7ICJA 4ECZA 2ZJ8A 2BQRA 5J2EA 2HHSA 3BQ0A 1S0VA 4M9LA 3C1YA 4YXMA 2UVWA 5CB1A 1IXRA 4YR0A 4FBTA 2IBKA 4RPZA 4RQ6A 5KFIA 1MSWD 4ELTA 4M6WB 3M9NB 3SI8A 4M47A 1NOMA 5DBAA 4C8KA 3GIIA 5DQIA 3EPIA 1Z00A 2A1JB 5L1JA 4ZH4A 3T5JA 5BPCA 1KTQA 5KT2A 9ICUA 4DL6A 4B9NA 4NY8A 1TAUA 4GXIA 4I2DA 7ICQA 4ECXA 7ICVA 5KFRA 1SKRA 2KFZA 4FBUA 5CJ7A 3KHLA 5J0XA 3LK9A 3V6KA 5DG7A 3QEBZ 4NLKA 4KLOA 2IHNA 4I2EA 1ZQDA 4DSJA 2NRXA 3QE9Y 2AGQA 4JWNA 5BOLA 2V4QA 3BJYA 2A1JA 2BPCA 3PX0A 2C22A 2FPLA 3TANA 4I2JA 2PFPA 3LWMA 1ZQAA 4EBCA 3UQ0A 4O0IA 3TQ1A 4LVSA 7ICNA 2ASLA 3UPQA 3TFSA 1NKCA 3PR5B 3AU6A 1RXVA 4MFAA 4R66A 4CCHA 3V6JA 3GV5B 3RJEA 1KFSA 2XO7A 4JV1A 5KT6A 2ASDA 4MF8A 2R8KA 1UT8A 1XWLA 3GFKB 4QZIA 4KLJA 8ICZA 4QZ9A 4B9SA 4ED6A 5J0RA 1L5UA 2HW3A 4DWIA 2J6TA 8ICCA 2VA8A 4DLGA 5JUMA 4DSKA 3LWLA 3UXOA 2PFOA 1QLNA 8ICVA 7ICSA 3PO5A 8ICJA 5DLFA 3H4BA 3BQ2A 1N56A 7ICTA 1TKDA 8ICXA 4RNNA 8ICSA 5KG0A 5J0UA 3Q8MA 2P66A 5KFPA 4DSLA 7ICIA 5DBCA 2W9CA 1S77D 2ALZA 1CEZA 1BPXA 4EBDA 1JXEA 5L1KA 5KFSA 7ICOA 2ZTCA 3Q8LA 7ICRA 5KFWA 4DSEA 4J9OA 5DB9A 1UA0A 4O3QA 1Z00B 3ISBA 1BGXT 5CWRA 3JPPA 3RRHA 1TK5A 4BGDA 1RYRA 2DPIA 5IILA 4BXOA 4IRCA 4UBCA 4QZHA 4F4WA 4F4KA 2ZJ5A 5J0SA 4DOCA 3PO4A 2W9BA 3NTUA 8ICHA 4DFJA 4G3IA 4GXKA 3PNCA 2M9NA 3OJSA 4IQWA 3OSNA 4DL5A 1BPDA 4Q43A 1JMSA 1KFTA 2I1QA 4DQSA 1XSPA 1TK8A 4XRHA 2KTQA 3JPRA 4IRKA 1U4BA 4DF4A 5KG6A 5KT7A 3IHQB 4FS2A 3MFIA 1NKBA 5J2IA 3TFRA 4PGYA 3KTQA 4NLGA 1NK4A 4Z6CA 4Z6DA 4QW8A 4DL3A 2BCRA 4Q8EA 4JWMA 4F5QA 9ICNA 2BQUA 9ICAA 1XSNA 1ZJMA 1LV5A 4YN4A 3BQ1A 2XY7A 4DQRA 4QWCA 5KG4A 8ICPA 3H40A 3SV3A 3Q8QB 2PI4A 3T5HA 5J0YA 1NK6A 3PR4A 7ICPA 4QZAA 4PHAA 1L3UA 1ZQMA 3G6XA 3MGIA 4IQUA 2W9AA 2PI5A 1MQ3A 3EZ5A 5KT3A 1RPLA 4QWDA 3RH4A 1CUKA 2LYHA 1LB2B 3C1ZA 9ICKA 4RZRA 4ECUA 4DL2A 5HP4A 1XU4A 9ICQA 5IIMA 1D9FA 5KFLA 3QEAZ 4MF2A 9ICWA 5KFYA 5DLGA 5HHHA 1BPBA 5KFDA 3JPNA 4EYHB 5J0TA 4YR3A 2DFLA 4Z6EA 3JPQA 4ED7A 1S97A 9ICBA 4B9UA 4QWAA 4ECWA 2JEGA 1K1QA 1QSSA 3RH5A 4NM2A 4BWJA 3N4MB 4I29A 2XCPA 4I2CA 2W9BB 3ETLA 3JPTA 2C28A 2Y1IA 4FO6A 1NKEA 5DDYA 3M9OB 3RJHA 5DG9A 3MFHA 5KFKA 2HHQA 4UB2A 3MGHA 4BDPA 8ICFA 2PXIA 3ZDDA 4RQ1A 2W8LA 1MC8A 4O3SA 4ECQA 3M8RA 4XUSA 5J2GA 3HX0A 7ICUA 4XQ8A 4RPYA 3GILA 4UB1A 4KTQA 1U48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2J A;  5J0W A;  4C8O A;  1K1S A;  4C8L A;  4M9G A;  8ICL A;  4ED8 A;  4KMU A;  4O3P A;  4J9P A;  8ICU A;  1KFD A;  4TUQ A;  5CR0 A;  5IIK A;  4QW9 A;  2F1H A;  1SL1 A;  2W9C B;  4O5C A;  4RNM A;  1ZQI A;  4F92 B;  3TI0 A;  3HP6 A;  3MR2 A;  4B9M A;  2HHT A;  4UBB A;  1U9L A;  9ICO A;  1SKS A;  5F9L A;  4F2R A;  9ICI A;  4ECT A;  7ICM A;  1ZET A;  1SL0 A;  5EWE A;  5J2C A;  4UB5 A;  4C8M A;  3SV4 A;  4EEY A;  1H38 A;  2ATL A;  3Q8K A;  3B0X A;  2FMP A;  7ICE A;  4RUA A;  3Q8P B;  2AQ4 A;  4R64 A;  1TFR A;  1U45 A;  9ICV A;  4I2G A;  2AU0 A;  3MAB A;  8ICK A;  2ZUB A;  1ZQS A;  4TUR A;  4ELV A;  1ZQZ A;  4RQ3 A;  1NJZ A;  1JX4 A;  4RUC A;  5CHG A;  4TQS A;  4F5N A;  4I2F A;  5L1L A;  4UAY A;  3C2L A;  4NLN A;  8ICA A;  3ZDC A;  1COO A;  1T3N A;  2KZZ A;  4DS5 A;  3MDC A;  4DO9 A;  2BGW A;  3C5F A;  1JXL A;  2IA6 A;  4EZ6 A;  5J0Q A;  2ISP A;  1U47 A;  3PX6 A;  9ICG A;  3RB0 A;  3OJU A;  3ISC A;  1A76 A;  3NGD A;  1MQ2 A;  1T4G A;  3EPG A;  1V9P A;  5KFV A;  4RQ5 A;  3HWT A;  5KFN A;  4DSF A;  2AGP A;  4ECV A;  4M9J A;  4NM1 A;  9ICT A;  9ICM A;  4KLU A;  2HHV A;  3MR5 A;  4O3R A;  4MFC A;  3RBD A;  4TUS A;  2BPG A;  1NK0 A;  4YQW A;  1EXN A;  3C5G A;  2IHM A;  1XSL A;  4GXJ A;  5L9X A;  1Y88 A;  2Q0Z X;  4KN4 A;  4LZD A;  5KFZ A;  2NRV A;  4QZE A;  4UAW A;  5DB8 A;  9ICE A;  3H7I A;  3B0Y A;  4R8U B;  4YXJ A;  2GWS A;  3RJG A;  3SZ2 A;  4F5R A;  2J6S A;  1SKW A;  8ICY A;  5KT4 A;  7ICF A;  3PW5 A;  9ICJ A;  4YCX A;  4DS4 A;  4M9H A;  8ICM A;  4O3N A;  3JPS A;  4DQP A;  4PHP A;  9ICR A;  4K4G A;  3V6H A;  1BPY A;  9ICS A;  4M04 A;  2PFN A;  3V72 A;  1ZQP A;  3PW7 A;  1BVS A;  2VA2 A;  2RDJ A;  1S76 D;  4O3O A;  3HT3 A;  2JEI A;  4J9K A;  2HHW A;  2KZM A;  3RBE A;  3PW2 A;  2FLL A;  1ZQU A;  4I27 A;  4YR2 A;  4PH5 A;  1S0M A;  2KZ3 A;  3PVX A;  2HVH A;  1JN3 A;  2Y1J A;  4DLE A;  3ZD9 A;  1DGS A;  3T3F A;  3QZ8 A;  2FMS A;  1S9F A;  3GIJ A;  1SZP A;  4YD2 A;  1Z3E B;  3RR8 A;  5DGB A;  1ZQN A;  4YVZ A;  5J2K A;  3JPO A;  1ARO P;  3KHH A;  3RB4 A;  4F91 B;  4YD1 A;  5HHI A;  3OHB A;  4ECR A;  4BXO B;  4KLF A;  5KFA A;  1ZQL A;  3GIM A;  2VA3 A;  4O5E A;  2AGO A;  1C7Y A;  5IIO A;  1ZQV A;  3ZD8 A;  5F9N A;  2FPM A;  2V9W A;  5KFT A;  4KLE A;  1XC9 A;  4J9S A;  3RH6 A;  1TV9 A;  1WCL A;  4ED1 A;  4UB4 A;  4M0A A;  2ASJ A;  3OGU A;  4I2I A;  3K75 D;  1JIH A;  5KG2 A;  4UQG A;  4PHE A;  1N48 A;  1XO1 A;  1ZQH A;  5J2A A;  8ICW A;  1X9S A;  3GIK A;  3RJF A;  7ICH A;  1ZQG A;  2ZTD A;  3RRG A;  5EWG A;  5J2F A;  4R63 A;  3T5K A;  4F8R A;  9ICH A;  4ELU A;  7ICG A;  4DF8 A;  5KFJ A;  3MDA A;  4J9M A;  4ECY A;  5J0O A;  5KFB A;  2XGQ A;  5KT5 A;  1S10 A;  3C2M A;  4YFK A;  3RAQ A;  3EYZ A;  2FLN A;  5D4B A;  2BCU A;  3H8W A;  4DQI A;  4DSI A;  1IM4 A;  5EOZ A;  5DBB A;  2JEF A;  3LDA A;  2FMQ A;  4I2A A;  3FDS A;  3HW8 A;  5L1I A;  5KFF A;  5DB7 A;  5J2B A;  1RYS A;  5J29 A;  1BPE A;  3AU2 A;  2IMW P;  4ED3 A;  1X2I A;  4IQT A;  4NLZ A;  2ISO A;  4MEX A;  4YMM A;  2JZB B;  9ICX A;  4KLT A;  3G6V A;  4FS1 A;  1L3T A;  1RZT A;  4I28 A;  4X5V A;  4PHD A;  1XS9 D;  3RB3 A;  4QZC A;  4JV2 A;  1QSY A;  3ZDB A;  4M2Y A;  4KLG A;  8ICQ A;  2P6R A;  1TVA A;  2C2E A;  1RXW A;  1ZQE A;  1S0N A;  3THV A;  1TK0 A;  4DOB A;  5KFO A;  4NXZ A;  4RQ2 A;  3PW4 A;  2R8J A;  1ZQK A;  2BR0 A;  2HHU A;  4B9T A;  4P2H A;  2ZUC A;  3UQ2 A;  3PW0 A;  3ORY A;  1U49 A;  2MUT A;  4EBE A;  4IQV A;  3PMN A;  4KLI A;  3GV7 B;  4F50 A;  4ED0 A;  3RTV A;  3UXN A;  3ZDE A;  4F4X A;  1WCN A;  2C2R A;  1NJW A;  4RQ8 A;  3BDP A;  4F4Y A;  5EWF A;  8ICN A;  2UVV A;  5KFG A;  4GC6 A;  4MFF A;  2PFQ A;  3TAR A;  4QZ8 A;  4DOA A;  3TAQ A;  1ZQW A;  4UAZ A;  1L3S A;  4O9M A;  2KN7 A;  4J9Q A;  2HHX A;  1TAQ A;  3GQC A;  2UVU A;  3HPO A;  3GDX A;  4KLM A;  3V7L A;  3M8S A;  8ICO A;  5KG7 A;  4YP3 A;  4HYK A;  1D9D A;  2ZTE A;  4MEY A;  1ZJN A;  4RU9 A;  1S0O A;  1KSP A;  4IR1 A;  2B21 A;  2BCV A;  1KLN A;  2BDP A;  3H8J A;  3SYZ A;  3KHR A;  5IIJ A;  2R8I A;  1ZYQ A;  4ECS A;  2P6U A;  4Q45 A;  5DG8 A;  4B9V A;  4TUP A;  5KFC A;  5D46 A;  5DQG A;  2XGP A;  2XY5 A;  2NRZ A;  5DGA A;  1UA1 A;  1ZQO A;  2F1I A;  3C23 A;  1L3V A;  3ZDA A;  2W8K A;  4KN7 A;  5KFX A;  1HUZ A;  2MAX A;  3MR3 A;  4F5P A;  4GLX A;  9ICL A;  1HUO A;  4EYI B;  4RQ4 A;  5C5J A;  8ICT A;  2MUT B;  5DDM A;  2XCA A;  4YG2 A;  4RT2 A;  4R8U A;  4QZF A;  1D8L A;  3RAX A;  1NJX A;  1PZN A;  4PGQ A;  2KFN A;  4JUZ A;  3T5L A;  4RQ0 A;  5HNK A;  2NRT A;  1NK8 A;  4R65 A;  2DPJ A;  2WTF A;  5KFH A;  4DQQ A;  3MBY A;  4EZ9 A;  4M9N A;  4QZG A;  9ICP A;  5CA7 A;  3IM1 A;  1X9M A;  4KLD A;  9ICC A;  4QZD A;  1B22 A;  9ICF A;  8ICR A;  1KEJ A;  5J2H A;  4DL7 A;  4J9N A;  4F3O A;  4Q8F A;  4KLL A;  1B43 A;  3H4D A;  3OSP A;  4DFP A;  4M6W A;  1KRP A;  4DFK A;  3RJK A;  4JK1 A;  4RPX A;  3ISD A;  3N97 B;  4J9R A;  1SL2 A;  1NK9 A;  5BOM A;  3C2K A;  3V7K A;  3BQT A;  4C8N A;  4XA5 A;  5DB6 A;  1X9W A;  2AQ0 A;  2ZUD A;  2BCQ A;  4F5O A;  3RB6 A;  4K4H A;  3QZ7 A;  1UT5 A;  4QWE A;  5J2D A;  2BKE A;  4J9L A;  5KFM A;  5KFQ A;  5KFU A;  2R8G A;  4F2S A;  4LZG A;  3K4G A;  5KG5 A;  3EW9 A;  4DL4 A;  5III A;  3H8S A;  4UB3 A;  3V7J A;  1ZQQ A;  4BWM A;  5HML A;  1ZQT A;  1ZQR A;  2UVR A;  4IR9 A;  2RDI A;  3GV8 B;  4Z6F A;  3FYH A;  4K4I A;  1KDH A;  1QTM A;  2FLP A;  3M9M B;  4F4Z A;  5CP2 A;  4PPX A;  2C2D A;  4KIT B;  2XC9 A;  2JZB A;  2W9M A;  4RNO A;  4GC7 A;  5HMM A;  4TQR A;  1ZQY A;  3OHA A;  2XY6 A;  1NJY A;  1BPZ A;  8ICI A;  3PX4 A;  4YMO A;  1D8Y A;  4YMN A;  5D49 A;  3AUO A;  4O5K A;  3E2E A;  2VAN A;  4P4P A;  4B9L A;  4RQ7 A;  1NK7 A;  5IIN A;  2OWO A;  3TAP A;  4P4M A;  3PY8 A;  5J0P A;  4IRD A;  7ICK A;  5KG1 A;  3C21 A;  2I9G A;  3G6Y A;  4KLQ A;  3MR6 A;  5KG3 A;  4KLS A;  2BHN A;  1A77 A;  3Q8S B;  3RR7 A;  4I2H A;  4RT3 A;  4QWB A;  4QZB A;  4DFM A;  1NK5 A;  2F1J A;  1QSL A;  8ICE A;  4E0D A;  2ZJA A;  3PV8 A;  4KLH A;  2FPK A;  1ZQB A;  2AJQ A;  2HVI A;  3EWA A;  3PML A;  8ICG A;  5TZV A;  8ICB A;  1T8E A;  2V4R A;  4I2B A;  3KHG A;  7ICL A;  3RJJ A;  4Q44 A;  1DOQ A;  4PGX A;  5KFE A;  4JV0 A;  5DQH A;  2BQ3 A;  4F93 B;  1HJP A;  4ED2 A;  2NRW A;  1ZQF A;  2R8H A;  4P4O A;  3Q8R B;  4DEZ A;  3RJI A;  1ZQC A;  1ZQJ A;  2J6U A;  1ZQX A;  2H5X A;  3UXP A;  5DKW A;  2BPF A;  2JEJ A;  1T7P A;  5KTQ A;  2BCS A;  7ICJ A;  4ECZ A;  2ZJ8 A;  2BQR A;  5J2E A;  2HHS A;  3BQ0 A;  1S0V A;  4M9L A;  3C1Y A;  4YXM A;  2UVW A;  5CB1 A;  1IXR A;  4YR0 A;  4FBT A;  2IBK A;  4RPZ A;  4RQ6 A;  5KFI A;  1MSW D;  4ELT A;  4M6W B;  3M9N B;  3SI8 A;  4M47 A;  1NOM A;  5DBA A;  4C8K A;  3GII A;  5DQI A;  3EPI A;  1Z00 A;  2A1J B;  5L1J A;  4ZH4 A;  3T5J A;  5BPC A;  1KTQ A;  5KT2 A;  9ICU A;  4DL6 A;  4B9N A;  4NY8 A;  1TAU A;  4GXI A;  4I2D A;  7ICQ A;  4ECX A;  7ICV A;  5KFR A;  1SKR A;  2KFZ A;  4FBU A;  5CJ7 A;  3KHL A;  5J0X A;  3LK9 A;  3V6K A;  5DG7 A;  3QEB Z;  4NLK A;  4KLO A;  2IHN A;  4I2E A;  1ZQD A;  4DSJ A;  2NRX A;  3QE9 Y;  2AGQ A;  4JWN A;  5BOL A;  2V4Q A;  3BJY A;  2A1J A;  2BPC A;  3PX0 A;  2C22 A;  2FPL A;  3TAN A;  4I2J A;  2PFP A;  3LWM A;  1ZQA A;  4EBC A;  3UQ0 A;  4O0I A;  3TQ1 A;  4LVS A;  7ICN A;  2ASL A;  3UPQ A;  3TFS A;  1NKC A;  3PR5 B;  3AU6 A;  1RXV A;  4MFA A;  4R66 A;  4CCH A;  3V6J A;  3GV5 B;  3RJE A;  1KFS A;  2XO7 A;  4JV1 A;  5KT6 A;  2ASD A;  4MF8 A;  2R8K A;  1UT8 A;  1XWL A;  3GFK B;  4QZI A;  4KLJ A;  8ICZ A;  4QZ9 A;  4B9S A;  4ED6 A;  5J0R A;  1L5U A;  2HW3 A;  4DWI A;  2J6T A;  8ICC A;  2VA8 A;  4DLG A;  5JUM A;  4DSK A;  3LWL A;  3UXO A;  2PFO A;  1QLN A;  8ICV A;  7ICS A;  3PO5 A;  8ICJ A;  5DLF A;  3H4B A;  3BQ2 A;  1N56 A;  7ICT A;  1TKD A;  8ICX A;  4RNN A;  8ICS A;  5KG0 A;  5J0U A;  3Q8M A;  2P66 A;  5KFP A;  4DSL A;  7ICI A;  5DBC A;  2W9C A;  1S77 D;  2ALZ A;  1CEZ A;  1BPX A;  4EBD A;  1JXE A;  5L1K A;  5KFS A;  7ICO A;  2ZTC A;  3Q8L A;  7ICR A;  5KFW A;  4DSE A;  4J9O A;  5DB9 A;  1UA0 A;  4O3Q A;  1Z00 B;  3ISB A;  1BGX T;  5CWR A;  3JPP A;  3RRH A;  1TK5 A;  4BGD A;  1RYR A;  2DPI A;  5IIL A;  4BXO A;  4IRC A;  4UBC A;  4QZH A;  4F4W A;  4F4K A;  2ZJ5 A;  5J0S A;  4DOC A;  3PO4 A;  2W9B A;  3NTU A;  8ICH A;  4DFJ A;  4G3I A;  4GXK A;  3PNC A;  2M9N A;  3OJS A;  4IQW A;  3OSN A;  4DL5 A;  1BPD A;  4Q43 A;  1JMS A;  1KFT A;  2I1Q A;  4DQS A;  1XSP A;  1TK8 A;  4XRH A;  2KTQ A;  3JPR A;  4IRK A;  1U4B A;  4DF4 A;  5KG6 A;  5KT7 A;  3IHQ B;  4FS2 A;  3MFI A;  1NKB A;  5J2I A;  3TFR A;  4PGY A;  3KTQ A;  4NLG A;  1NK4 A;  4Z6C A;  4Z6D A;  4QW8 A;  4DL3 A;  2BCR A;  4Q8E A;  4JWM A;  4F5Q A;  9ICN A;  2BQU A;  9ICA A;  1XSN A;  1ZJM A;  1LV5 A;  4YN4 A;  3BQ1 A;  2XY7 A;  4DQR A;  4QWC A;  5KG4 A;  8ICP A;  3H40 A;  3SV3 A;  3Q8Q B;  2PI4 A;  3T5H A;  5J0Y A;  1NK6 A;  3PR4 A;  7ICP A;  4QZA A;  4PHA A;  1L3U A;  1ZQM A;  3G6X A;  3MGI A;  4IQU A;  2W9A A;  2PI5 A;  1MQ3 A;  3EZ5 A;  5KT3 A;  1RPL A;  4QWD A;  3RH4 A;  1CUK A;  2LYH A;  1LB2 B;  3C1Z A;  9ICK A;  4RZR A;  4ECU A;  4DL2 A;  5HP4 A;  1XU4 A;  9ICQ A;  5IIM A;  1D9F A;  5KFL A;  3QEA Z;  4MF2 A;  9ICW A;  5KFY A;  5DLG A;  5HHH A;  1BPB A;  5KFD A;  3JPN A;  4EYH B;  5J0T A;  4YR3 A;  2DFL A;  4Z6E A;  3JPQ A;  4ED7 A;  1S97 A;  9ICB A;  4B9U A;  4QWA A;  4ECW A;  2JEG A;  1K1Q A;  1QSS A;  3RH5 A;  4NM2 A;  4BWJ A;  3N4M B;  4I29 A;  2XCP A;  4I2C A;  2W9B B;  3ETL A;  3JPT A;  2C28 A;  2Y1I A;  4FO6 A;  1NKE A;  5DDY A;  3M9O B;  3RJH A;  5DG9 A;  3MFH A;  5KFK A;  2HHQ A;  4UB2 A;  3MGH A;  4BDP A;  8ICF A;  2PXI A;  3ZDD A;  4RQ1 A;  2W8L A;  1MC8 A;  4O3S A;  4ECQ A;  3M8R A;  4XUS A;  5J2G A;  3HX0 A;  7ICU A;  4XQ8 A;  4RPY A;  3GIL A;  4UB1 A;  4KTQ A;  1U48 A; 
#chains in the Genus database with same CATH topology
 5J0W A;  4C8O A;  2H3F A;  4KMU A;  4J9P A;  8ICU A;  2HBM A;  4QW9 A;  4MHV A;  1ZQI A;  3TI0 A;  3HP6 A;  2HHT A;  3ICX A;  2F3N A;  3M6K A;  1ZD4 A;  5AKG A;  1ZET A;  1URJ A;  5J2C A;  5B5E U;  2FMP A;  4FZL A;  3Q8K A;  3B0X A;  7ICE A;  4R64 A;  3SAG A;  9ICV A;  3T79 A;  2KTQ A;  4TUR A;  4AP9 A;  3D6J A;  5CHG A;  4TQS A;  2EAM A;  1DRG A;  1T3N A;  3BS5 B;  4DO9 A;  2ISP A;  3UM9 A;  4UAV A;  1T4G A;  5KFV A;  4RQ5 A;  5KFN A;  1J2N A;  1RQN A;  4ECV A;  9ICT A;  2HHV A;  1OUQ A;  3RBD A;  1NK0 A;  4YQW A;  4IS7 A;  2G08 A;  3BQ7 A;  3AMZ A;  2PMZ C;  5L9X A;  1N60 A;  4F5R A;  4YCX A;  2CRX A;  4UW9 A;  8ICM A;  4DQP A;  5K4L A;  2KNJ A;  4PHP A;  3V6H A;  9ICS A;  1ECW A;  4M04 A;  1NI3 A;  3RBE A;  3PW2 A;  2LPE A;  1X40 A;  4YR2 A;  1S0M A;  3PVX A;  1JN3 A;  3ZD9 A;  3T3F A;  1SXE A;  5EE1 A;  4YVZ A;  4ECR A;  3S6J A;  4BXO B;  4CF5 A;  2EH9 A;  2O6K A;  2WF8 A;  2V9W A;  1DK2 A;  3WK4 A;  2AHO B;  4CE6 A;  3O0F A;  3NVV A;  4USA A;  1N48 A;  2A19 A;  5J2A A;  3GIK A;  2ZTD A;  4R63 A;  4PL1 A;  2W43 A;  3MDA A;  3RF9 A;  5KFB A;  2Y0S F;  4PJ0 U;  3EYZ A;  4DQI A;  3H8W A;  5EOZ A;  2JEF A;  2FMQ A;  4LZG A;  1RYS A;  5J29 A;  2IMW P;  4YMM A;  4JV2 A;  1QSY A;  8ICQ A;  1TVA A;  2W03 A;  2OXO A;  4EX7 A;  3B9J A;  3CP8 A;  2G09 A;  3PW0 A;  5KAF U;  4KLI A;  2KFZ A;  1NJW A;  3CYM A;  2C2R A;  2KOB A;  5AK4 A;  3UMB A;  4RQ8 A;  5EWF A;  2UVV A;  5KFG A;  3KFU F;  2D3D A;  4QZ8 A;  4DOA A;  1SXD A;  2HHX A;  2Q4T A;  2UVU A;  5AM3 A;  3HPO A;  5AKY A;  3V7L A;  2YTU A;  3AQE A;  3M8S A;  3F2B A;  4NL9 A;  4EEN A;  1ZJN A;  4US9 A;  4IR1 A;  3H8J A;  5ALY A;  2K8B B;  5IIJ A;  2R8I A;  2ZIW A;  1ZD3 A;  2P6U A;  1RM6 C;  3IV6 A;  1X6J A;  1ZQO A;  1TAM A;  3C23 A;  2W8K A;  3CRX A;  2EAN A;  3MR3 A;  4RQ4 A;  5DDM A;  2XCA A;  4QZF A;  4PGQ A;  1L7P A;  5HNK A;  2BZF A;  5GTI U;  2WTF A;  4Y2Q A;  5KFH A;  4EEL A;  4KLD A;  3ALR A;  1MN8 A;  4QZD A;  3WKB A;  1U48 A;  5J2H A;  1K5O A;  4J9N A;  1B43 A;  1X42 A;  3H0M B;  1KRP A;  4C4S A;  2WF5 A;  4JK1 A;  4RPX A;  4J9R A;  4HAI A;  3C2K A;  3V7K A;  2BCQ A;  3KOO A;  2BKE A;  5KFM A;  5KFU A;  2R8G A;  4DL4 A;  1JRO A;  1ZQQ A;  5HML A;  1ZQT A;  1ZQR A;  4IR9 A;  3GV8 B;  4K4I A;  2KK0 A;  3L3F X;  2K4I A;  2FLP A;  2XC9 A;  2JZB A;  3QUB A;  5HMM A;  2KHQ A;  2KG5 A;  2VAN A;  2JH1 A;  1SIJ A;  5J0P A;  4C4R A;  3WU2 U;  1Z4N A;  5KG3 A;  4KLS A;  2BHN A;  3RR7 A;  1NK5 A;  4QZB A;  4DFM A;  1BNO A;  2FPK A;  3C29 A;  7ICL A;  1L8L A;  4PGX A;  2VIX A;  2OH2 A;  4JV0 A;  5KFE A;  2NRW A;  2R8H A;  2ES6 A;  2OEH A;  1ZQX A;  1T7P A;  2BCS A;  7ICJ A;  2WAQ C;  4YXM A;  2EQY A;  5CB1 A;  2RQ5 A;  3SI8 A;  2BDU A;  1Z00 A;  5L1J A;  2VKQ A;  3HKZ F;  4B9N A;  2WF9 A;  4I2D A;  2HSZ A;  5CJ7 A;  2QAR B;  3BJY A;  3I28 A;  3TAN A;  2FPL A;  4I2J A;  2PFP A;  5EE9 A;  3TQ1 A;  3F2D A;  1SB3 C;  2XO7 A;  4JV1 A;  1XWL A;  3TAD A;  1N61 A;  4QZ9 A;  3NRW A;  5ALJ A;  1IIP A;  1L5U A;  4DWI A;  2RP5 A;  8ICC A;  2VA8 A;  5JUM A;  4DSK A;  1T94 A;  7ICS A;  3BQ2 A;  4JB3 A;  1TKD A;  5KG0 A;  2H3Q A;  1CEZ A;  5C0Y A;  2JR5 A;  1WYG A;  5KFW A;  4O3Q A;  3ISB A;  2E8M A;  5IIL A;  4KX3 A;  1ZXI A;  5J0S A;  4F4K A;  4DOC A;  8ICH A;  3OPX A;  4GXK A;  3PNC A;  4IQW A;  4DL5 A;  1BPD A;  1JUD A;  3JPR A;  4FZN A;  4DF4 A;  5KG6 A;  1UPH A;  3TFR A;  4J03 A;  4Z6D A;  2F44 A;  9ICN A;  4WJ3 B;  4DQR A;  1VDV A;  1S8O A;  4QZA A;  5ALG A;  1ZQM A;  3MGI A;  2DL0 A;  1RG6 A;  5KT3 A;  1RPL A;  4ZOH C;  1A6S A;  2LYH A;  3C1Z A;  9ICK A;  4RZR A;  9ICQ A;  4JWN A;  3JPN A;  2C22 A;  2JV3 A;  4EYH B;  5ALN A;  5J0T A;  4NM1 A;  9ICB A;  3JPQ A;  2LHT A;  1F0M A;  5EE3 A;  5AKI A;  3N4M B;  3JPT A;  4FO6 A;  3RJH A;  3MFH A;  2HHQ A;  4U7C A;  3MGH A;  8ICF A;  1KKX A;  4B6J A;  4O3S A;  5AM1 A;  4M9G A;  1K1S A;  8ICL A;  3K1R B;  3L5K A;  4PZN A;  2W9C B;  2W7O A;  2GO7 A;  3WKA A;  4B9M A;  9ICO A;  1SKS A;  1V97 A;  4F2R A;  9ICI A;  3F5A A;  5AIB A;  3SV4 A;  1H38 A;  2MA1 A;  2YN4 A;  1TFR A;  2EZX A;  1U45 A;  1DXS A;  1M6Y A;  5ALF A;  2FDR A;  1ZQS A;  4ELV A;  4RQ3 A;  1NJZ A;  4I2F A;  4RUC A;  4C0Z A;  8ICA A;  4KX5 A;  3ZDC A;  4DS5 A;  1JXL A;  9ICG A;  1A76 A;  3NGD A;  5ALX A;  1V9P A;  3EPG A;  3TAC B;  2HDO A;  9ICM A;  4KLU A;  4MFC A;  1PVR A;  2IHM A;  1NNL A;  2E3T A;  4GXJ A;  4KN4 A;  4UAR A;  4QZE A;  5KFZ A;  3SZ2 A;  8ICY A;  2E8O A;  3PW5 A;  2OYY A;  2NO5 A;  4DS4 A;  5ALW A;  3E0F A;  2OHF A;  3NRZ A;  2PFN A;  1S76 D;  1BVS A;  2JEI A;  2HHW A;  5FP0 A;  2G06 A;  3RFA A;  2FLL A;  4I27 A;  1V38 A;  2KZ3 A;  1KW4 A;  2Y1J A;  3QU9 A;  1UQV A;  3KZI U;  3QZ8 A;  3GIJ A;  1SZP A;  3RR8 A;  2JXJ A;  5DGB A;  3JPO A;  4F91 B;  2A1A A;  2E5S A;  2Y9T A;  2VA3 A;  2K4P A;  2AGO A;  5F9N A;  4KLE A;  1XC9 A;  2LMR A;  3QU7 A;  3QU2 A;  4UQG A;  5KG2 A;  4OO1 J;  7ICH A;  1SGG A;  5ALT A;  2HBL A;  5L1M A;  5AI4 A;  1LVH A;  5AKH A;  4DF8 A;  4KMO B;  1S10 A;  8ICX A;  5F3X B;  4J9M A;  2XGQ A;  5KT5 A;  1B0X A;  2FLN A;  3MC1 A;  5ALQ A;  1PK1 A;  5DBB A;  3LDA A;  3E58 A;  3FDS A;  1RDF A;  2W3S A;  5DB7 A;  3AU2 A;  9ICX A;  5ALE A;  3G6V A;  2E1F A;  2DKZ A;  4PHD A;  2ZIU B;  1XS9 D;  3ZDB A;  4M2Y A;  1N62 A;  2P6R A;  1S0N A;  5KFO A;  2KMD A;  2BR0 A;  2ZUC A;  3FAH A;  1U49 A;  3DEE A;  3ORY A;  4IQV A;  3M7D A;  4ED0 A;  3RTV A;  4F4X A;  4GC6 A;  3BS7 A;  1ZQW A;  1SV0 C;  4O9M A;  2KN7 A;  1TAQ A;  4QJF B;  3GDX A;  1RQL A;  1ZOL A;  4YP3 A;  4HYK A;  2ZTE A;  3SR6 A;  4AYB C;  4RU9 A;  2B21 A;  3TAD C;  2BDP A;  1ZYQ A;  5CEH A;  5DG8 A;  2XY5 A;  1UA1 A;  1L3V A;  3ZDA A;  1SWV A;  2B0C A;  5KFX A;  2E8P A;  2ZIX A;  4PL2 A;  2MUT B;  4YG2 A;  4RT2 A;  3RAX A;  2I5H A;  2KFN A;  2FE9 A;  2NRT A;  1F5S A;  1NK8 A;  4R65 A;  2DPJ A;  4M9N A;  4EZ9 A;  2KVS A;  4QZG A;  1X9M A;  1B22 A;  9ICC A;  8ICR A;  2G0A A;  1O03 A;  4DL7 A;  3D2Q A;  3M1Y A;  4KLL A;  2CN1 A;  2LM1 A;  2RLT A;  4M6W A;  2ZIU A;  4NWI A;  3N97 B;  1NK9 A;  1L6N A;  5DB6 A;  4XA5 A;  1X9W A;  4F5O A;  5AI8 A;  3QZ7 A;  4F2S A;  2ZIX B;  2WF6 A;  3M6Z A;  5III A;  4UB3 A;  1J97 A;  4Z6F A;  1KDH A;  4C7Z A;  2EDU A;  4NLC A;  3M9M B;  4CDG A;  4F4Z A;  4LJX A;  2IOF K;  1KN5 A;  2C2D A;  4PPX A;  2W9M A;  4TQR A;  4EEK A;  4YMN A;  5D49 A;  5J8Y A;  3PZP A;  4B9L A;  4RQ7 A;  1NK7 A;  4P4M A;  4Y2T A;  3C21 A;  1WWU A;  3HRD D;  4KLQ A;  3WK9 A;  2F1J A;  1SWW A;  4BX9 C;  3CNH A;  4E0D A;  2ZJA A;  2HVI A;  8ICG A;  1T8E A;  2V4R A;  4I2B A;  3QXG A;  4Q44 A;  2NV3 A;  5DQH A;  2BQ3 A;  4P4O A;  3RJI A;  3UXP A;  2BPF A;  2JEJ A;  3GU3 A;  1Q46 A;  1Q8K A;  4IL6 U;  2HHS A;  3BQ0 A;  3GZF A;  3C1Y A;  1IXR A;  4YR0 A;  4FBT A;  2IBK A;  4RPZ A;  1QQ6 A;  4GFJ A;  5KFI A;  4ELT A;  1XO0 A;  5KL8 B;  3LVW A;  1NOM A;  5DBA A;  5AM2 A;  4C8K A;  4M47 A;  3EPI A;  3OTQ A;  1L7M A;  3T5J A;  5BPC A;  4DL6 A;  2W3R A;  1TAU A;  7ICQ A;  4ECX A;  5KFR A;  4FBU A;  3KHL A;  3V6K A;  2IHN A;  3QYP A;  2AGQ A;  3PSI A;  1BNP A;  2A1J A;  3PX0 A;  3WK6 A;  7ICN A;  3TFS A;  4FE3 A;  3PR5 B;  1RXV A;  3I76 A;  4CCH A;  3V6J A;  4UAS A;  3GFK B;  4PZO A;  4QZI A;  2Y9U A;  2ZXH A;  1KQQ A;  2F8L A;  2J6T A;  1QLN A;  3KKA C;  2CPR A;  5AI0 A;  2P66 A;  5KFP A;  2G07 A;  3BS5 A;  1S77 D;  1HEK A;  1BPX A;  1JXE A;  2MU2 A;  4OJ6 A;  2AH5 A;  2QB1 A;  4J9O A;  2LI6 A;  3JPP A;  2F8K A;  2DPI A;  4BXO A;  4UBC A;  4F4W A;  5ALR A;  2ZJ5 A;  4G3I A;  2KSO B;  5AK3 A;  3OJS A;  4Y2V A;  1JMS A;  2QKQ A;  3IG8 A;  2I1Q A;  1XSP A;  2KIC A;  5KT7 A;  4FS2 A;  2YMM A;  2FJ6 A;  4Z6C A;  4DL3 A;  2BCR A;  3CW2 C;  4F5Q A;  4GIB A;  2BQU A;  2KV2 A;  1XSN A;  4YN4 A;  3BQ1 A;  2XY7 A;  4QWC A;  5KG4 A;  2E1E A;  1A0P A;  3IG5 A;  2KJ5 A;  5J0Y A;  3C28 A;  1OW5 A;  1PVP A;  2WB1 C;  3K1Z A;  3G6X A;  2GH1 A;  3EZ5 A;  5HR6 A;  3RH4 A;  1LB2 B;  1D9F A;  5KFL A;  4MF2 A;  9ICW A;  5KFY A;  5HHH A;  1BPB A;  1S97 A;  4YR3 A;  2DFL A;  4Z6E A;  4ED7 A;  5J8Y C;  4QWA A;  1QSS A;  3RH5 A;  4BWJ A;  2W9B B;  2Y1I A;  1AQ6 A;  3H8M A;  5DDY A;  5DG9 A;  1JRP A;  4UB2 A;  3PST A;  2ZG6 A;  2PXI A;  1CRX A;  5H2F U;  4RQ1 A;  2W8L A;  2ZXI A;  1D8B A;  4XUS A;  1Z4O A;  3GIL A;  2A3V A;  4ACO A;  5J2J A;  4JMU A;  4Y2X A;  4NL9 C;  1HIW A;  1KFD A;  1Z19 A;  4UB8 U;  4F72 A;  4F92 B;  3MR2 A;  3H0L B;  5EWE A;  3F2C A;  4EEY A;  2ATL A;  4RUA A;  2AQ4 A;  4I2G A;  2AU0 A;  8ICK A;  2ZUB A;  3IP4 B;  2W54 A;  4F5N A;  2ESE A;  5L1L A;  4UAY A;  3C2L A;  4NLN A;  1COO A;  2KZZ A;  2XID A;  3MDC A;  3C5F A;  2IA6 A;  4EZ6 A;  3PX6 A;  3OJU A;  4Y2U A;  3HWT A;  1NZB A;  4M9J A;  4OJP A;  3MR5 A;  3SAF A;  3C5G A;  3KZX A;  1XSL A;  2KJ9 A;  2Q0Z X;  4LZD A;  9ICE A;  5DB8 A;  3H7I A;  2GWS A;  4R8U B;  1SKW A;  7ICF A;  4Y2J A;  3WKD A;  2DQN B;  4K4G A;  5AK6 A;  2DKX A;  2EAO A;  3V72 A;  1ZQP A;  3PW7 A;  2VA2 A;  2GLE A;  4O3O A;  3HT3 A;  4J9K A;  2KZM A;  1VLB A;  2HCF A;  1RYU A;  4FFD A;  2HOI A;  2HVH A;  4DLE A;  1DGS A;  2K4H A;  2FMS A;  2K8A A;  4YD2 A;  1Z3E B;  1ZQN A;  3KHH A;  1WG8 A;  3RB4 A;  4YD1 A;  5HHI A;  3OHB A;  5KFA A;  1ZQL A;  3GIM A;  3A0H U;  4O5E A;  3J81 j;  3ZD8 A;  2FPM A;  1X66 A;  4J9S A;  3RH6 A;  1TV9 A;  1WCL A;  4ED1 A;  3ETR A;  2QB0 B;  4M0A A;  2ASJ A;  4I2I A;  4PHE A;  1ZQH A;  1ZQG A;  1ZRN A;  3T5K A;  4ELU A;  4QIW F;  3AM9 A;  5KFJ A;  5J0O A;  3C2M A;  2L5Y A;  4YFK A;  3TKA A;  3RAQ A;  4DSI A;  2ODG A;  4I2A A;  3HW8 A;  5L1I A;  2NYV A;  4CF3 A;  2GOL A;  4Y2Y A;  4ED3 A;  1X2I A;  4IQT A;  2ISO A;  2YY6 A;  4KLT A;  4FS1 A;  3D2S A;  2JGA A;  1RZT A;  4I28 A;  4X5V A;  3RB3 A;  4QZC A;  2Z7J A;  4KLG A;  2LBO A;  2C2E A;  1RXW A;  1ZQE A;  3THV A;  1TK0 A;  3HIL A;  4DOB A;  2KJ8 A;  1ZQK A;  4B9T A;  4P2H A;  4Y2R A;  4NLB A;  1L7N A;  3BZC A;  3GV7 B;  4F50 A;  3PSP A;  3ZDE A;  3BDP A;  5AK5 A;  1WCN A;  4A8E A;  4F4Y A;  8ICN A;  3LYS A;  5ALV A;  4MFF A;  1YZ7 A;  2JRZ A;  2W04 A;  3TAQ A;  3AQF A;  2ZIW B;  1IV8 A;  1N5W A;  8ICO A;  2H3Z A;  1D9D A;  1S0O A;  2BCV A;  3AN1 A;  2YB4 A;  4ECS A;  4Q45 A;  4B9V A;  1B4F A;  2XGP A;  5D46 A;  5DQG A;  2NRZ A;  5DGA A;  1N5X A;  1OXJ A;  2F1I A;  2F2A B;  1HUZ A;  2IOH A;  4GLX A;  9ICL A;  4EYI B;  5C5J A;  8ICT A;  1D8L A;  1NJX A;  3SQI A;  1PZN A;  4JUZ A;  3T5L A;  1KBU A;  2XVT A;  2LM4 A;  5HR7 A;  3QU4 A;  1PVQ A;  4F3O A;  5AI5 A;  4DFP A;  2HBK A;  3IRU A;  4DFK A;  3IDW A;  3ISD A;  1SL2 A;  2ZIV B;  2H3V A;  2LYB A;  2AQ0 A;  2ZUD A;  2K89 A;  3RB6 A;  4K4H A;  5J2D A;  1QH9 A;  1YT3 A;  3K4G A;  4UB6 U;  5KG5 A;  3EW9 A;  3H8S A;  4BWM A;  2UVR A;  2RDI A;  2HOQ A;  2PKE A;  3KD3 A;  4OJL A;  3AEV A;  4RNO A;  1BPZ A;  2XY6 A;  8ICI A;  3WK8 A;  1Z1V A;  4O5K A;  3E2E A;  4P4P A;  2OWO A;  3PY8 A;  1QQ7 A;  5AIC A;  4IRD A;  2I9G A;  2G5I B;  3MR6 A;  1PK1 B;  3Q8S B;  4I2H A;  4QWB A;  4F71 A;  1Q3U A;  4P0P A;  2DWQ A;  2AJQ A;  3EWA A;  4EX6 A;  5TZV A;  3KHG A;  5TIS U;  1QQ5 A;  3HKZ C;  1FFV A;  4OD0 A;  4F93 B;  1HJP A;  3Q8R B;  2CXY A;  4DEZ A;  4QIW C;  1ZQC A;  1ZQJ A;  2H5X A;  5DKW A;  5KTQ A;  5ALH A;  4U6P A;  3F53 A;  2ZJ8 A;  5J2E A;  1FEZ A;  4M9L A;  3L4P A;  2UVW A;  1O08 A;  3QU5 A;  1MSW D;  4M6W B;  5KAI U;  3M9N B;  5G5G A;  2I6X A;  4ZH4 A;  1KTQ A;  9ICU A;  5KT2 A;  7ICV A;  1SKR A;  1SV4 A;  3QEB Z;  3LK9 A;  5DG7 A;  4ICA A;  1X9X A;  4DSJ A;  2NRX A;  5BOL A;  2KD1 A;  2WB1 F;  2OCE A;  1X6I A;  1ZQA A;  4LVS A;  3UQ0 A;  1P7D A;  2ASL A;  1PK3 A;  1L8O A;  4P0Q A;  4MFA A;  3RJE A;  2ASD A;  8ICZ A;  2HW3 A;  1WUD A;  3LWL A;  3UXO A;  2PFO A;  8ICV A;  2DF4 B;  5DLF A;  8ICJ A;  3SAH A;  4RNN A;  4DSL A;  7ICI A;  5DBC A;  2PMZ F;  4EBD A;  7ICO A;  1ZQ1 C;  2ZTC A;  7ICR A;  1UA0 A;  3NUQ A;  5CWR A;  3RRH A;  4IRC A;  4QZH A;  1UCV A;  4AYB F;  3N7P D;  2W9B A;  3NTU A;  3PO4 A;  4DFJ A;  2M9N A;  4Q43 A;  1KFT A;  3ZI4 A;  3EUB 2;  4DQS A;  1COK A;  2KVC A;  2N1R A;  4IRK A;  1NKB A;  3KTQ A;  3MFI A;  4NLG A;  5J2I A;  2NO4 A;  1NK4 A;  5AI6 A;  4Q8E A;  4JWM A;  2QLT A;  3F5E A;  2P35 A;  4CGZ A;  1ZJM A;  1LV5 A;  8ICP A;  4NV0 A;  5T14 A;  3Q8Q B;  3T5H A;  1NK6 A;  3PR4 A;  7ICP A;  1J2M A;  2RHF A;  2HMX A;  4IQU A;  2W9A A;  2ZIV A;  4QWD A;  1CUK A;  5AKK A;  2WAQ F;  4ECU A;  4DL2 A;  2RRD A;  5HP4 A;  1XU4 A;  4OCZ A;  3QEA Z;  2JH7 A;  2DBY A;  5DLG A;  5ALP A;  5KFD A;  5AI9 A;  1K1Q A;  5EE0 A;  1QCK A;  2XCP A;  4I2C A;  3ETL A;  1NKE A;  5E79 U;  5KFK A;  3DDH A;  3M8R A;  5J2G A;  1ZD2 P;  7ICU A;  1N2X A;  4RPY A;  1SV0 A;  3QNM A;  4KTQ A;  4IC9 A;  5JRT A;  5AKZ A;  4C8L A;  4ED8 A;  2KIV A;  4O3P A;  2E8N A;  1JI7 A;  5CR0 A;  4TUQ A;  5IIK A;  1WWV A;  2F1H A;  1SL1 A;  1IG6 A;  4O5C A;  2MSN A;  4RNM A;  3IN5 A;  4UBB A;  1U9L A;  3FC4 A;  2W7P A;  5F9L A;  2HBJ A;  1V85 A;  4ECT A;  7ICM A;  1SL0 A;  4UB5 A;  3N7R C;  4C8M A;  2EZZ A;  3Q8P B;  3MAB A;  1L7O A;  1ZQZ A;  1JX4 A;  4CRX A;  3ONN A;  4UAU A;  2BGW A;  3I1Y A;  5J0Q A;  1U47 A;  3RB0 A;  1MQ2 A;  3ISC A;  2IOF A;  4DSF A;  2AGP A;  4O3R A;  1DK3 A;  2K60 A;  3LVV A;  4TUS A;  2BPG A;  1EXN A;  2K4E A;  2W11 A;  3MGV A;  1F44 A;  1Y88 A;  2VJ4 A;  4UAW A;  2NRV A;  3B0Y A;  3RJG A;  4YXJ A;  1DGJ A;  2J6S A;  5KT4 A;  9ICJ A;  2AXT U;  4M9H A;  4P0Q B;  4O3N A;  3JPS A;  1VJ5 A;  5B66 U;  9ICR A;  4UAT A;  1BPY A;  2QAR A;  2RDJ A;  5AM4 A;  1ZQU A;  4PH5 A;  1NZP A;  1S9F A;  3NVZ A;  5J2K A;  1ARO P;  4KLF A;  5ALD A;  4DFD A;  3BZK A;  2W55 A;  3QUQ A;  1C7Y A;  5IIO A;  5AKE A;  1ZQV A;  2DUY A;  5KFT A;  4UB4 A;  3OGU A;  3K75 D;  1JIH A;  3KKA A;  1XO1 A;  8ICW A;  1X9S A;  3FM9 A;  3RJF A;  3SMV A;  3RRG A;  3NAS A;  5EWG A;  5J2F A;  5AM5 A;  4F8R A;  9ICH A;  2K8C B;  3WK5 A;  4ECY A;  5AKL A;  1UHU A;  5ALS A;  5D4B A;  2BCU A;  1IM4 A;  1XNS A;  1SZH A;  5KFF A;  5J2B A;  1BPE A;  1ZRM A;  4NLZ A;  3WKE A;  4MEX A;  1PUZ A;  2JZB B;  1L3T A;  3N28 A;  2WF7 A;  2YMQ A;  1JAL A;  4US8 A;  5AKJ A;  3DV9 A;  3WKC A;  4NXZ A;  4RQ2 A;  3PW4 A;  2R8J A;  2HHU A;  3VCB A;  3UQ2 A;  2MUT A;  4EBE A;  3SD7 A;  4Y2S A;  3PMN A;  5ALZ A;  3UXN A;  2FI1 A;  2PFQ A;  3TAR A;  4UAZ A;  1L3S A;  2HOF A;  2KKV A;  4J9Q A;  3GQC A;  4KLM A;  4OJO A;  5KG7 A;  4MEY A;  3SEI A;  2WFA A;  1KSP A;  1KLN A;  3SYZ A;  3KHR A;  4Y2P A;  3AL0 B;  4TUP A;  5KFC A;  1TE2 A;  3N7S C;  2H3I A;  5ALK A;  2R18 A;  4KN7 A;  2MAX A;  4F5P A;  1HUO A;  1FFU A;  4R8U A;  5KL1 B;  2F77 X;  3QUT A;  4RQN A;  1T3Q A;  4RQ0 A;  5JU5 A;  4BUG A;  2KP7 A;  4DQQ A;  3MBY A;  9ICP A;  5CRX A;  5CA7 A;  3IM1 A;  9ICF A;  4NJ8 A;  1KEJ A;  4BJQ A;  2YB1 A;  2QB0 A;  4Q8F A;  3H4D A;  1Q3V A;  3OSP A;  5AHX A;  5AM0 A;  3RJK A;  2B6G A;  5BOM A;  3PSF A;  3BQT A;  4C8N A;  1UT5 A;  4QWE A;  4J9L A;  5KFQ A;  4DCC A;  5ALU A;  3V7J A;  3UMC A;  3FYH A;  1QTM A;  2XI9 A;  1KL9 A;  5CP2 A;  4GC7 A;  4KIT B;  1N63 A;  1ZQY A;  3OHA A;  1NJY A;  3PX4 A;  4YMO A;  4P0P B;  5G5H A;  1D8Y A;  3AUO A;  5IIN A;  3TAP A;  7ICK A;  2KHV A;  5KG1 A;  2LYA A;  2KSO A;  1ED1 A;  3G6Y A;  1A77 A;  7ICG A;  4RT3 A;  5ALL A;  1QSL A;  8ICE A;  3PV8 A;  4KLH A;  1ZQB A;  4O3M A;  3PML A;  2OM6 A;  8ICB A;  3RJJ A;  1DOQ A;  2YML A;  4ED2 A;  1ZQF A;  2J6U A;  4ECZ A;  2BQR A;  2KE7 A;  3SEN A;  5ALM A;  1S0V A;  2D8C A;  4RQ6 A;  2EZY A;  4OJ5 A;  4G9B A;  3GII A;  4QNL A;  5DQI A;  2A1J B;  4NY8 A;  4GXI A;  5AIA A;  2MRL A;  1FO4 A;  5J0X A;  4KLO A;  4NLK A;  2M0N A;  2F76 X;  4I2E A;  4C80 A;  1ZQD A;  2WHE A;  3QE9 Y;  2V4Q A;  2BPC A;  3LWM A;  4EBC A;  4O0I A;  3UPQ A;  1NKC A;  3AU6 A;  4R66 A;  3GV5 B;  1KFS A;  3D2N A;  5ALI A;  5KT6 A;  4FZM A;  4MF8 A;  2R8K A;  1UT8 A;  2LKY A;  4KLJ A;  4C7Y A;  4B9S A;  2JMG A;  4ED6 A;  2HI0 A;  4CF4 A;  1CI4 A;  5J0R A;  2EAP A;  3NVW A;  4DLG A;  1ZD5 A;  1YZ6 A;  3PO5 A;  3H4B A;  1N56 A;  2KEY A;  7ICT A;  8ICS A;  5J0U A;  3Q8M A;  5GTH U;  1LKY A;  2W9C A;  2ALZ A;  1S5L U;  3A0B U;  1Z1B A;  3KBB A;  1FIQ A;  5KFS A;  5L1K A;  3Q8L A;  4C4T A;  4DSE A;  5DB9 A;  1Z00 B;  1TK5 A;  1BGX T;  1RYR A;  3NS1 A;  4BGD A;  3U26 A;  2VJ5 A;  1GO3 F;  3HJE A;  3OSN A;  1MA7 A;  1TK8 A;  4XRH A;  1U4B A;  3IHQ B;  4PGY A;  4QW8 A;  2DGZ A;  5AKX A;  9ICA A;  3VC8 A;  4CNQ A;  2KKP A;  3H40 A;  3SV3 A;  2YMP A;  2PI4 A;  3UMG A;  5ALO A;  2D6F C;  2Y0S C;  4PHA A;  1L3U A;  2YX8 A;  2PI5 A;  1MQ3 A;  3QUC A;  5IIM A;  5JTI A;  1LKY B;  5A0L A;  4B9U A;  4ECW A;  2JEG A;  4NM2 A;  3R9K A;  4I29 A;  3WK7 A;  2JHD A;  2C28 A;  5KNI A;  3M9O B;  3H0R B;  4BDP A;  2KIW A;  4RQM A;  3ZDD A;  3NVY A;  1MC8 A;  4ECQ A;  2YQE A;  3HX0 A;  1C20 A;  2G5H B;  3QX7 A;  4XQ8 A;  4UB1 A;  2XIC A;  3ED5 A; 
#chains in the Genus database with same CATH homology
 5J2J A;  5J0W A;  4C8O A;  1K1S A;  4C8L A;  4M9G A;  8ICL A;  4ED8 A;  4KMU A;  4O3P A;  4J9P A;  8ICU A;  1KFD A;  4TUQ A;  5CR0 A;  5IIK A;  4QW9 A;  2F1H A;  1SL1 A;  2W9C B;  4O5C A;  4RNM A;  1ZQI A;  4F92 B;  3TI0 A;  3HP6 A;  3MR2 A;  4B9M A;  2HHT A;  4UBB A;  1U9L A;  9ICO A;  1SKS A;  5F9L A;  4F2R A;  9ICI A;  4ECT A;  7ICM A;  1ZET A;  1SL0 A;  5EWE A;  5J2C A;  4UB5 A;  4C8M A;  3SV4 A;  4EEY A;  1H38 A;  2ATL A;  3Q8K A;  3B0X A;  2FMP A;  7ICE A;  4RUA A;  3Q8P B;  2AQ4 A;  4R64 A;  1TFR A;  1U45 A;  9ICV A;  4I2G A;  2AU0 A;  3MAB A;  8ICK A;  2ZUB A;  1ZQS A;  4TUR A;  4ELV A;  1ZQZ A;  4RQ3 A;  1NJZ A;  1JX4 A;  4RUC A;  5CHG A;  4TQS A;  4F5N A;  4I2F A;  5L1L A;  4UAY A;  3C2L A;  4NLN A;  8ICA A;  3ZDC A;  1COO A;  1T3N A;  2KZZ A;  4DS5 A;  3MDC A;  4DO9 A;  2BGW A;  3C5F A;  1JXL A;  2IA6 A;  4EZ6 A;  5J0Q A;  2ISP A;  1U47 A;  3PX6 A;  9ICG A;  3RB0 A;  3OJU A;  3ISC A;  1A76 A;  3NGD A;  1MQ2 A;  1T4G A;  3EPG A;  1V9P A;  5KFV A;  4RQ5 A;  3HWT A;  5KFN A;  4DSF A;  2AGP A;  4ECV A;  4M9J A;  4NM1 A;  9ICT A;  9ICM A;  4KLU A;  2HHV A;  3MR5 A;  4O3R A;  4MFC A;  3RBD A;  4TUS A;  2BPG A;  1NK0 A;  4YQW A;  1EXN A;  3C5G A;  2IHM A;  1XSL A;  4GXJ A;  5L9X A;  1Y88 A;  2Q0Z X;  4KN4 A;  4LZD A;  5KFZ A;  2NRV A;  4QZE A;  4UAW A;  5DB8 A;  9ICE A;  3H7I A;  3B0Y A;  4R8U B;  4YXJ A;  2GWS A;  3RJG A;  3SZ2 A;  4F5R A;  2J6S A;  1SKW A;  8ICY A;  5KT4 A;  7ICF A;  3PW5 A;  9ICJ A;  4YCX A;  4DS4 A;  4M9H A;  8ICM A;  4O3N A;  3JPS A;  4DQP A;  4PHP A;  9ICR A;  4K4G A;  3V6H A;  1BPY A;  9ICS A;  4M04 A;  2PFN A;  3V72 A;  1ZQP A;  3PW7 A;  1BVS A;  2VA2 A;  2RDJ A;  1S76 D;  4O3O A;  3HT3 A;  2JEI A;  4J9K A;  2HHW A;  2KZM A;  3RBE A;  3PW2 A;  2FLL A;  1ZQU A;  4I27 A;  4YR2 A;  4PH5 A;  1S0M A;  2KZ3 A;  3PVX A;  2HVH A;  1JN3 A;  2Y1J A;  4DLE A;  3ZD9 A;  1DGS A;  3T3F A;  3QZ8 A;  2FMS A;  1S9F A;  3GIJ A;  1SZP A;  4YD2 A;  1Z3E B;  3RR8 A;  5DGB A;  1ZQN A;  4YVZ A;  5J2K A;  3JPO A;  1ARO P;  3KHH A;  3RB4 A;  4F91 B;  4YD1 A;  5HHI A;  3OHB A;  4ECR A;  4BXO B;  4KLF A;  5KFA A;  1ZQL A;  3GIM A;  2VA3 A;  4O5E A;  2AGO A;  1C7Y A;  5IIO A;  1ZQV A;  3ZD8 A;  5F9N A;  2FPM A;  2V9W A;  5KFT A;  4KLE A;  1XC9 A;  4J9S A;  3RH6 A;  1TV9 A;  1WCL A;  4ED1 A;  4UB4 A;  4M0A A;  2ASJ A;  3OGU A;  4I2I A;  3K75 D;  1JIH A;  5KG2 A;  4UQG A;  4PHE A;  1N48 A;  1XO1 A;  1ZQH A;  5J2A A;  8ICW A;  1X9S A;  3GIK A;  3RJF A;  7ICH A;  1ZQG A;  2ZTD A;  3RRG A;  5EWG A;  5J2F A;  4R63 A;  3T5K A;  4F8R A;  9ICH A;  4ELU A;  7ICG A;  4DF8 A;  5KFJ A;  3MDA A;  4J9M A;  4ECY A;  5J0O A;  5KFB A;  2XGQ A;  5KT5 A;  1S10 A;  3C2M A;  4YFK A;  3RAQ A;  3EYZ A;  2FLN A;  5D4B A;  2BCU A;  3H8W A;  4DQI A;  4DSI A;  1IM4 A;  5EOZ A;  5DBB A;  2JEF A;  3LDA A;  2FMQ A;  4I2A A;  3FDS A;  3HW8 A;  5L1I A;  5KFF A;  5DB7 A;  5J2B A;  1RYS A;  5J29 A;  1BPE A;  3AU2 A;  2IMW P;  4ED3 A;  1X2I A;  4IQT A;  4NLZ A;  2ISO A;  4MEX A;  4YMM A;  2JZB B;  9ICX A;  4KLT A;  3G6V A;  4FS1 A;  1L3T A;  1RZT A;  4I28 A;  4X5V A;  4PHD A;  1XS9 D;  3RB3 A;  4QZC A;  4JV2 A;  1QSY A;  3ZDB A;  4M2Y A;  4KLG A;  8ICQ A;  2P6R A;  1TVA A;  2C2E A;  1RXW A;  1ZQE A;  1S0N A;  3THV A;  1TK0 A;  4DOB A;  5KFO A;  4NXZ A;  4RQ2 A;  3PW4 A;  2R8J A;  1ZQK A;  2BR0 A;  2HHU A;  4B9T A;  4P2H A;  2ZUC A;  3UQ2 A;  3PW0 A;  3ORY A;  1U49 A;  2MUT A;  4EBE A;  4IQV A;  3PMN A;  4KLI A;  3GV7 B;  4F50 A;  4ED0 A;  3RTV A;  3UXN A;  3ZDE A;  4F4X A;  1WCN A;  2C2R A;  1NJW A;  4RQ8 A;  3BDP A;  4F4Y A;  5EWF A;  8ICN A;  2UVV A;  5KFG A;  4GC6 A;  4MFF A;  2PFQ A;  3TAR A;  4QZ8 A;  4DOA A;  3TAQ A;  1ZQW A;  4UAZ A;  1L3S A;  4O9M A;  2KN7 A;  4J9Q A;  2HHX A;  1TAQ A;  3GQC A;  2UVU A;  3HPO A;  3GDX A;  4KLM A;  3V7L A;  3M8S A;  8ICO A;  5KG7 A;  4YP3 A;  4HYK A;  1D9D A;  2ZTE A;  4MEY A;  1ZJN A;  4RU9 A;  1S0O A;  1KSP A;  4IR1 A;  2B21 A;  2BCV A;  1KLN A;  2BDP A;  3H8J A;  3SYZ A;  3KHR A;  5IIJ A;  2R8I A;  1ZYQ A;  4ECS A;  2P6U A;  4Q45 A;  5DG8 A;  4B9V A;  4TUP A;  5KFC A;  5D46 A;  5DQG A;  2XGP A;  2XY5 A;  2NRZ A;  5DGA A;  1UA1 A;  1ZQO A;  2F1I A;  3C23 A;  1L3V A;  3ZDA A;  2W8K A;  4KN7 A;  5KFX A;  1HUZ A;  2MAX A;  3MR3 A;  4F5P A;  4GLX A;  9ICL A;  1HUO A;  4EYI B;  4RQ4 A;  5C5J A;  8ICT A;  2MUT B;  5DDM A;  2XCA A;  4YG2 A;  4RT2 A;  4R8U A;  4QZF A;  1D8L A;  3RAX A;  1NJX A;  1PZN A;  4PGQ A;  2KFN A;  4JUZ A;  3T5L A;  4RQ0 A;  5HNK A;  2NRT A;  1NK8 A;  4R65 A;  2DPJ A;  2WTF A;  5KFH A;  4DQQ A;  3MBY A;  4EZ9 A;  4M9N A;  4QZG A;  9ICP A;  5CA7 A;  3IM1 A;  1X9M A;  4KLD A;  9ICC A;  4QZD A;  1B22 A;  9ICF A;  8ICR A;  1KEJ A;  5J2H A;  4DL7 A;  4J9N A;  4F3O A;  4Q8F A;  4KLL A;  1B43 A;  3H4D A;  3OSP A;  4DFP A;  4M6W A;  1KRP A;  4DFK A;  3RJK A;  4JK1 A;  4RPX A;  3ISD A;  3N97 B;  4J9R A;  1SL2 A;  1NK9 A;  5BOM A;  3C2K A;  3V7K A;  3BQT A;  4C8N A;  4XA5 A;  5DB6 A;  1X9W A;  2AQ0 A;  2ZUD A;  2BCQ A;  4F5O A;  3RB6 A;  4K4H A;  3QZ7 A;  1UT5 A;  4QWE A;  5J2D A;  2BKE A;  4J9L A;  5KFM A;  5KFQ A;  5KFU A;  2R8G A;  4F2S A;  4LZG A;  3K4G A;  5KG5 A;  3EW9 A;  4DL4 A;  5III A;  3H8S A;  4UB3 A;  3V7J A;  1ZQQ A;  4BWM A;  5HML A;  1ZQT A;  1ZQR A;  2UVR A;  4IR9 A;  2RDI A;  3GV8 B;  4Z6F A;  3FYH A;  4K4I A;  1KDH A;  1QTM A;  2FLP A;  3M9M B;  4F4Z A;  5CP2 A;  4PPX A;  2C2D A;  4KIT B;  2XC9 A;  2JZB A;  2W9M A;  4RNO A;  4GC7 A;  5HMM A;  4TQR A;  1ZQY A;  3OHA A;  2XY6 A;  1NJY A;  1BPZ A;  8ICI A;  3PX4 A;  4YMO A;  1D8Y A;  4YMN A;  5D49 A;  3AUO A;  4O5K A;  3E2E A;  2VAN A;  4P4P A;  4B9L A;  4RQ7 A;  1NK7 A;  5IIN A;  2OWO A;  3TAP A;  4P4M A;  3PY8 A;  5J0P A;  4IRD A;  7ICK A;  5KG1 A;  3C21 A;  2I9G A;  3G6Y A;  4KLQ A;  3MR6 A;  5KG3 A;  4KLS A;  2BHN A;  1A77 A;  3Q8S B;  3RR7 A;  4I2H A;  4RT3 A;  4QWB A;  4QZB A;  4DFM A;  1NK5 A;  2F1J A;  1QSL A;  8ICE A;  4E0D A;  2ZJA A;  3PV8 A;  4KLH A;  2FPK A;  1ZQB A;  2AJQ A;  2HVI A;  3EWA A;  3PML A;  8ICG A;  5TZV A;  8ICB A;  1T8E A;  2V4R A;  4I2B A;  3KHG A;  7ICL A;  3RJJ A;  4Q44 A;  1DOQ A;  4PGX A;  5KFE A;  4JV0 A;  5DQH A;  2BQ3 A;  4F93 B;  1HJP A;  4ED2 A;  2NRW A;  1ZQF A;  2R8H A;  4P4O A;  3Q8R B;  4DEZ A;  3RJI A;  1ZQC A;  1ZQJ A;  2J6U A;  1ZQX A;  2H5X A;  3UXP A;  5DKW A;  2BPF A;  2JEJ A;  1T7P A;  5KTQ A;  2BCS A;  7ICJ A;  4ECZ A;  2ZJ8 A;  2BQR A;  5J2E A;  2HHS A;  3BQ0 A;  1S0V A;  4M9L A;  3C1Y A;  4YXM A;  2UVW A;  5CB1 A;  1IXR A;  4YR0 A;  4FBT A;  2IBK A;  4RPZ A;  4RQ6 A;  5KFI A;  1MSW D;  4ELT A;  4M6W B;  3M9N B;  3SI8 A;  4M47 A;  1NOM A;  5DBA A;  4C8K A;  3GII A;  5DQI A;  3EPI A;  1Z00 A;  2A1J B;  5L1J A;  4ZH4 A;  3T5J A;  5BPC A;  1KTQ A;  5KT2 A;  9ICU A;  4DL6 A;  4B9N A;  4NY8 A;  1TAU A;  4GXI A;  4I2D A;  7ICQ A;  4ECX A;  7ICV A;  5KFR A;  1SKR A;  2KFZ A;  4FBU A;  5CJ7 A;  3KHL A;  5J0X A;  3LK9 A;  3V6K A;  5DG7 A;  3QEB Z;  4NLK A;  4KLO A;  2IHN A;  4I2E A;  1ZQD A;  4DSJ A;  2NRX A;  3QE9 Y;  2AGQ A;  4JWN A;  5BOL A;  2V4Q A;  3BJY A;  2A1J A;  2BPC A;  3PX0 A;  2C22 A;  2FPL A;  3TAN A;  4I2J A;  2PFP A;  3LWM A;  1ZQA A;  4EBC A;  3UQ0 A;  4O0I A;  3TQ1 A;  4LVS A;  7ICN A;  2ASL A;  3UPQ A;  3TFS A;  1NKC A;  3PR5 B;  3AU6 A;  1RXV A;  4MFA A;  4R66 A;  4CCH A;  3V6J A;  3GV5 B;  3RJE A;  1KFS A;  2XO7 A;  4JV1 A;  5KT6 A;  2ASD A;  4MF8 A;  2R8K A;  1UT8 A;  1XWL A;  3GFK B;  4QZI A;  4KLJ A;  8ICZ A;  4QZ9 A;  4B9S A;  4ED6 A;  5J0R A;  1L5U A;  2HW3 A;  4DWI A;  2J6T A;  8ICC A;  2VA8 A;  4DLG A;  5JUM A;  4DSK A;  3LWL A;  3UXO A;  2PFO A;  1QLN A;  8ICV A;  7ICS A;  3PO5 A;  8ICJ A;  5DLF A;  3H4B A;  3BQ2 A;  1N56 A;  7ICT A;  1TKD A;  8ICX A;  4RNN A;  8ICS A;  5KG0 A;  5J0U A;  3Q8M A;  2P66 A;  5KFP A;  4DSL A;  7ICI A;  5DBC A;  2W9C A;  1S77 D;  2ALZ A;  1CEZ A;  1BPX A;  4EBD A;  1JXE A;  5L1K A;  5KFS A;  7ICO A;  2ZTC A;  3Q8L A;  7ICR A;  5KFW A;  4DSE A;  4J9O A;  5DB9 A;  1UA0 A;  4O3Q A;  1Z00 B;  3ISB A;  1BGX T;  5CWR A;  3JPP A;  3RRH A;  1TK5 A;  4BGD A;  1RYR A;  2DPI A;  5IIL A;  4BXO A;  4IRC A;  4UBC A;  4QZH A;  4F4W A;  4F4K A;  2ZJ5 A;  5J0S A;  4DOC A;  3PO4 A;  2W9B A;  3NTU A;  8ICH A;  4DFJ A;  4G3I A;  4GXK A;  3PNC A;  2M9N A;  3OJS A;  4IQW A;  3OSN A;  4DL5 A;  1BPD A;  4Q43 A;  1JMS A;  1KFT A;  2I1Q A;  4DQS A;  1XSP A;  1TK8 A;  4XRH A;  2KTQ A;  3JPR A;  4IRK A;  1U4B A;  4DF4 A;  5KG6 A;  5KT7 A;  3IHQ B;  4FS2 A;  3MFI A;  1NKB A;  5J2I A;  3TFR A;  4PGY A;  3KTQ A;  4NLG A;  1NK4 A;  4Z6C A;  4Z6D A;  4QW8 A;  4DL3 A;  2BCR A;  4Q8E A;  4JWM A;  4F5Q A;  9ICN A;  2BQU A;  9ICA A;  1XSN A;  1ZJM A;  1LV5 A;  4YN4 A;  3BQ1 A;  2XY7 A;  4DQR A;  4QWC A;  5KG4 A;  8ICP A;  3H40 A;  3SV3 A;  3Q8Q B;  2PI4 A;  3T5H A;  5J0Y A;  1NK6 A;  3PR4 A;  7ICP A;  4QZA A;  4PHA A;  1L3U A;  1ZQM A;  3G6X A;  3MGI A;  4IQU A;  2W9A A;  2PI5 A;  1MQ3 A;  3EZ5 A;  5KT3 A;  1RPL A;  4QWD A;  3RH4 A;  1CUK A;  2LYH A;  1LB2 B;  3C1Z A;  9ICK A;  4RZR A;  4ECU A;  4DL2 A;  5HP4 A;  1XU4 A;  9ICQ A;  5IIM A;  1D9F A;  5KFL A;  3QEA Z;  4MF2 A;  9ICW A;  5KFY A;  5DLG A;  5HHH A;  1BPB A;  5KFD A;  3JPN A;  4EYH B;  5J0T A;  4YR3 A;  2DFL A;  4Z6E A;  3JPQ A;  4ED7 A;  1S97 A;  9ICB A;  4B9U A;  4QWA A;  4ECW A;  2JEG A;  1K1Q A;  1QSS A;  3RH5 A;  4NM2 A;  4BWJ A;  3N4M B;  4I29 A;  2XCP A;  4I2C A;  2W9B B;  3ETL A;  3JPT A;  2C28 A;  2Y1I A;  4FO6 A;  1NKE A;  5DDY A;  3M9O B;  3RJH A;  5DG9 A;  3MFH A;  5KFK A;  2HHQ A;  4UB2 A;  3MGH A;  4BDP A;  8ICF A;  2PXI A;  3ZDD A;  4RQ1 A;  2W8L A;  1MC8 A;  4O3S A;  4ECQ A;  3M8R A;  4XUS A;  5J2G A;  3HX0 A;  7ICU A;  4XQ8 A;  4RPY A;  3GIL A;  4UB1 A;  4KTQ A;  1U48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...