3N4MB

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
total genus 21
structure length 74
sequence length 74
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n4mB00
3JPTA 4GXIA 5CB1A 4O5CA 2UVWA 5HHIA 2PFNA 4BWJA 1ZQUA 4RT3A 5KFWA 4DLGA 4DQPA 4F5NA 3MR5A 3SV3A 4KLQA 4F2RA 7ICVA 4UBBA 5DKWA 5CHGA 3MR3A 3GIMA 4X5VA 2DPJA 2PI4A 7ICNA 1HJPA 5KFDA 4GXKA 1UT5A 8ICHA 4P2HA 4KLUA 3TARA 1KFDA 3GIKA 1NK8A 1DOQA 4K4IA 7ICJA 4KLTA 3NTUA 4XQ8A 4IQWA 4RQ2A 3AUOA 2V4RA 4F8RA 2RDIA 1BVSA 1WCNA 2NRXA 1ZQHA 5KT3A 8ICMA 4DSFA 1CEZA 3PMNA 3RH4A 2J6TA 5DG8A 2BQUA 4YXJA 4YN4A 4K4HA 4I2IA 5DDMA 5CA7A 2ZJ5A 4Q45A 5KFYA 4UB1A 2A1JA 4DEZA 4PGQA 4DS4A 1NJZA 3PO4A 2W9MA 5J2DA 2W8KA 2ALZA 2XGQA 3T5JA 1ZQPA 4EYHB 5J2GA 4KLHA 2JZBB 1TVAA 4M9JA 5DG9A 3PW5A 1MQ3A 4GXJA 1RXVA 2KZZA 8ICNA 1RPLA 3QZ8A 1SL0A 4UB3A 4HYKA 9ICUA 3ISCA 4J9NA 4YD1A 1X2IA 5F9NA 5KFEA 3OGUA 4PH5A 1D8LA 4J9KA 2BCSA 4EZ6A 4Q44A 4MFFA 8ICJA 4GC7A 5EOZA 1T3NA 1K1QA 1SKWA 4GLXA 4ELTA 9ICFA 1KFTA 2RDJA 5KG3A 1SKSA 5BOMA 3QEAZ 3RH6A 5J0XA 3QE9Y 4KLEA 4KLJA 5J2IA 2XY7A 4NY8A 5EWFA 2BCRA 5KFGA 4J9QA 9ICLA 1NOMA 4F4YA 5CR0A 4FBUA 3ISDA 3V7LA 1JIHA 1U49A 3BDPA 4KLGA 1KDHA 1D9FA 2NRZA 1S0VA 4F5QA 3RJGA 2XY5A 3T3FA 2P6UA 4QWBA 1KTQA 2BCUA 3C21A 5DG7A 5DB8A 4EBCA 3TFRA 3C23A 4Z6FA 7ICLA 1COOA 4M47A 2KFNA 5HMLA 2HHUA 8ICTA 3BQ1A 5KTQA 3T5KA 4KLLA 4IQVA 3RJJA 3AU2A 5DB7A 4XRHA 1RYSA 1S0NA 2JEFA 4JV1A 4PPXA 4ED3A 4LZDA 1Z3EB 1DGSA 4M6WA 4M6WB 2XY6A 5IIKA 3UPQA 3SYZA 1XSLA 4P4PA 2Q0ZX 2BQ3A 5KFXA 2NRVA 4O5KA 9ICHA 3C2KA 3Q8MA 1UA0A 4QZIA 5KFLA 4JK1A 5KFTA 2ASLA 2P66A 2V9WA 4F4ZA 2VA3A 4Q8FA 4YVZA 1TAQA 2Y1IA 4KLFA 1BGXT 1UA1A 4DSKA 3RB6A 5KG2A 1CUKA 3EPGA 4F5OA 4UAWA 4BDPA 9ICSA 5HHHA 1X9SA 7ICTA 2W8LA 5KG0A 3HW8A 4J9PA 2AQ4A 1S10A 3JPNA 2W9CB 4KMUA 5D49A 4YQWA 4I27A 8ICIA 3G6YA 2FPKA 4Q8EA 4FO6A 9ICNA 3H4DA 5L1LA 2IMWP 1X9MA 5DLGA 2C2DA 3RJIA 1JX4A 5BOLA 3MDAA 4F50A 4BXOA 3JPPA 4TQSA 1S76D 5KFMA 5CWRA 4PHPA 3PNCA 3RBEA 4DSIA 5KFNA 2XGPA 3ZDBA 4DL7A 5J0WA 7ICKA 1BPBA 3H8SA 5KFKA 5KFAA 4UQGA 4Z6EA 1U4BA 3JPSA 3MR6A 4DL6A 2R8KA 3QZ7A 7ICMA 2LYHA 1KRPA 4ECWA 1ZQQA 8ICXA 8ICQA 3UXOA 4GC6A 2R8JA 5L1IA 5KFOA 2KN7A 3EW9A 1Y88A 1NJWA 1ZQIA 4DL4A 4QZHA 4F5RA 2J6SA 3MR2A 3TANA 5CJ7A 8ICRA 2W9BB 5J0UA 3PW4A 1SL1A 4IRDA 4MF8A 2FMSA 3KTQA 4DQRA 4I2GA 2HVIA 5HMMA 4MEYA 2XC9A 4RZRA 1XSNA 4MFCA 3TAQA 4TUSA 7ICFA 7ICEA 4RNMA 4NLKA 4PGYA 5EWGA 3ZDCA 3C1YA 4I2JA 3BQ0A 5J2KA 1S97A 4NLNA 8ICKA 3EYZA 2KFZA 3HT3A 2R8GA 1ZQCA 4EYIB 2PI5A 4QWAA 3UQ0A 4TQRA 4RQ5A 3MBYA 5IIIA 2VANA 5J2FA 2FLLA 4TUQA 5IINA 4IRKA 4M04A 3JPQA 4EZ9A 4ZH4A 3Q8KA 4ECRA 4M9GA 5J0TA 1TV9A 4KLMA 2HW3A 1WCLA 3IHQB 4RQ1A 5IIMA 2DFLA 3ETLA 3OSNA 4YMOA 4NLGA 1ZQNA 3OHAA 1BPDA 4QWDA 2VA2A 4PHAA 1C7YA 1NK9A 2C2EA 1L3UA 3GIJA 3RBDA 3GDXA 4DOBA 3TI0A 4RPXA 5IIOA 3MGIA 4J9LA 4DL2A 1NK4A 4I2BA 9ICIA 7ICQA 2ZTEA 3V7JA 5TZVA 2A1JB 5KFJA 5DBBA 5J2BA 4UB5A 4RNNA 4C8LA 3TFSA 2AJQA 4NXZA 3C2MA 2JEIA 4EBEA 4QZCA 3HX0A 3RRGA 5BPCA 2FPMA 4UB4A 4B9MA 3V72A 3M9MB 1ZQZA 4B9NA 2HVHA 2FMQA 9ICKA 3PW7A 2F1JA 4KN4A 5DGAA 2ATLA 1NK7A 3H4BA 4ECXA 4ECZA 4Q43A 3EPIA 1ZJMA 3PO5A 4G3IA 4F93B 3V6JA 4YXMA 9ICEA 8ICUA 4DO9A 1NK5A 1ZQMA 4I2DA 3HPOA 3G6XA 5HP4A 1ZQDA 4O3SA 4ECUA 3V7KA 4TUPA 5KFQA 7ICGA 5F9LA 4R66A 4O3NA 3HP6A 4MEXA 4PGXA 1EXNA 2ISPA 1JXEA 2XO7A 4TURA 3MGHA 4O3QA 3THVA 3RAXA 3PR5B 4F92B 4ED2A 4ED8A 1N56A 1QSYA 4DOAA 3E2EA 1ZQXA 1QSSA 4ELUA 8ICGA 4DFMA 4EEYA 3LWMA 1RZTA 5DGBA 3IM1A 3ISBA 4DF4A 3HWTA 3TAPA 2ASDA 3PW0A 4B9TA 4MFAA 4ECSA 5KT7A 7ICHA 2HHTA 4IQTA 1NKBA 4DOCA 1RYRA 2MUTA 4RPYA 5KT4A 4J9SA 5L1JA 5KFCA 3PX4A 1U47A 7ICSA 5J2CA 2BPGA 5KFVA 1ZQSA 1MC8A 5J2JA 1T7PA 1KEJA 4RQ6A 1D8YA 3C5GA 4FS2A 5KFHA 3RRHA 4P4MA 1T4GA 4J9RA 4DLEA 5J0YA 1NJYA 4R63A 4RU9A 1ZQGA 4B9SA 3LK9A 4I2HA 4DSEA 4J9MA 3K4GA 2BDPA 3RJEA 5KFPA 1S9FA 1ZQAA 3RJKA 4JWNA 8ICBA 2H5XA 4DF8A 4M9NA 2AGPA 2ZUDA 2ZTCA 1JXLA 4JV2A 1NJXA 7ICIA 5JUMA 3OHBA 4UB2A 8ICSA 3M8RA 3BJYA 1JMSA 1B22A 4M0AA 1XWLA 4ECQA 4BXOB 3KHHA 2ASJA 2PFQA 3PX6A 9ICGA 4E0DA 1L3TA 2ZJ8A 3Q8QB 5DQIA 5IIJA 3RR7A 4JV0A 4O3OA 4RQ8A 3SV4A 4DWIA 4O3RA 2F1IA 3RAQA 1ZQOA 1ZJNA 5KT2A 4YFKA 2Y1JA 3ORYA 3AU6A 2C28A 4F91B 5D46A 3PR4A 1Z00A 4RNOA 3KHGA 3GQCA 4ED7A 2I9GA 4KLIA 5KFFA 5J2HA 4B9UA 2HHWA 2WTFA 4XA5A 7ICPA 1ZQJA 5KT6A 4DFPA 2IBKA 4JUZA 4DQQA 1SZPA 1U9LA 3GFKB 4BWMA 4QWCA 3Q8PB 4DL3A 3N4MB 5DDYA 1QSLA 4M9HA 7ICRA 2GWSA 8ICZA 3FDSA 3MFHA 5KFBA 7ICOA 1LV5A 4QW9A 3LWLA 3C5FA 2R8HA 1TKDA 9ICBA 5KFSA 1S77D 1JN3A 1XO1A 3ZDDA 4F4KA 4QZGA 2R8IA 3G6VA 1NKEA 4YMNA 2P6RA 4ED1A 4KN7A 4RQ0A 4F3OA 2KZ3A 1UT8A 1MSWD 4LZGA 4RUCA 5J2EA 1IM4A 4YR3A 3SI8A 3RB0A 1ZQWA 2B21A 1QTMA 2FLPA 5DBCA 4KLDA 3B0YA 4RT2A 4QZ9A 1AROP 1SL2A 4NM1A 4NLZA 3NGDA 1HUOA 3GV8B 2DPIA 5L1KA 4IR1A 8ICPA 3ZDEA 3N97B 9ICMA 5DQGA 4F4WA 2BKEA 1S0MA 4M9LA 3MFIA 4I2AA 5J29A 2M9NA 3B0XA 1N48A 2UVVA 8ICAA 9ICJA 9ICOA 3QEBZ 4QZAA 1H38A 3RTVA 3RR8A 8ICVA 1TFRA 8ICOA 1KFSA 2AU0A 3UXPA 4ED6A 1KSPA 4Z6DA 1TK8A 4QZDA 4QWEA 3ZD9A 2I1QA 3T5LA 1QLNA 1ZQEA 4QZEA 2MAXA 4RQ7A 4XUSA 5DBAA 2HHQA 4I2CA 3TQ1A 4ECYA 3V6HA 4M2YA 2BHNA 3RB4A 4O5EA 5KG6A 3H8WA 2ZUBA 3H7IA 9ICPA 2KZMA 1TK5A 3ZDAA 9ICRA 9ICAA 4QZFA 4RUAA 4PHDA 1T8EA 1D9DA 4KTQA 1TK0A 3RJFA 3PX0A 1ZQBA 1RXWA 3ZD8A 2JZBA 5D4BA 2IA6A 5J0PA 2J6UA 2AQ0A 2ZJAA 4YG2A 4EBDA 4K4GA 1XU4A 3GIIA 5DB9A 1ZQFA 1X9WA 1S0OA 1B43A 3RB3A 2C2RA 2UVUA 2XCAA 5HNKA 2C22A 3M9NB 8ICEA 1KLNA 9ICXA 3C2LA 2NRWA 5KFUA 5J2AA 7ICUA 2FLNA 2IHMA 8ICFA 4RQ4A 4UAYA 1LB2B 2IHNA 1ZQTA 4ELVA 1SKRA 3EWAA 5C5JA 4KLOA 2ISOA 2ZUCA 4DS5A 9ICCA 3OJSA 2NRTA 4YMMA 4DSLA 2UVRA 3LDAA 3PW2A 3MDCA 4R65A 2MUTB 3FYHA 4YD2A 1ZQLA 4YP3A 4UAZA 3H8JA 4I2FA 4Z6CA 4FS1A 1ZYQA 4JWMA 3GV7B 2JEGA 3KHLA 5DB6A 1ZQRA 4IRCA 4ED0A 4MF2A 3UQ2A 3PY8A 2W9AA 2PXIA 4F4XA 1ZQKA 1TAUA 1XC9A 5IILA 5KG7A 4O3PA 4DQIA 3PV8A 5KG4A 2FMPA 2PFPA 4IR9A 5KG1A 4KITB 1NK0A 1U45A 1A77A 1NKCA 2HHVA 2BGWA 4QZ8A 4O0IA 1ZQVA 2FPLA 4I28A 3V6KA 9ICQA 1BPEA 4I2EA 2AGOA 1NK6A 4YCXA 1BPZA 5KFRA 3PVXA 1L3VA 2PFOA 4BGDA 4B9LA 4RQ3A 3GILA 4IQUA 3RJHA 8ICCA 4DL5A 4B9VA 2XCPA 2V4QA 5J0SA 2BCQA 1ZQYA 1BPYA 1ZETA 3JPOA 3BQ2A 3RH5A 3H40A 5CP2A 4DSJA 2W9CA 8ICYA 1Z00B 4F5PA 9ICVA 1IXRA 5KFZA 4R8UA 3M9OB 3OJUA 4R8UB 5EWEA 1L3SA 2AGQA 2BPCA 5KT5A 2HHSA 9ICWA 1A76A 2JEJA 2ZTDA 4QW8A 3PMLA 5J0RA 4NM2A 4PHEA 4ECTA 1BPXA 2OWOA 4C8NA 2BR0A 1PZNA 4O9MA 3MABA 4DFKA 1XS9D 1U48A 1L5UA 4C8MA 5J0OA 3M8SA 4FBTA 2BQRA 3KHRA 2BPFA 4UBCA 4ECVA 5KG5A 1MQ2A 4CCHA 2KTQA 3C1ZA 3BQTA 4YR2A 4LVSA 3EZ5A 4DQSA 9ICTA 4J9OA 1XSPA 5DQHA 3UXNA 4QZBA 3Q8SB 4P4OA 4RPZA 5DLFA 2BCVA 3Q8LA 4KLSA 8ICWA 3Q8RB 2W9BA 3JPRA 2VA8A 4YR0A 4C8KA 3GV5B 3OSPA 1K1SA 4R64A 5KFIA 4C8OA 3K75D 1HUZA 8ICLA 1V9PA 5J0QA 3T5HA 4DFJA 4I29A 2F1HA 3SZ2A 4F2SA 2HHXA 5L9XA
chains in the Genus database with same CATH superfamily
3JPTA 2DF4B 4O5CA 2UVWA 2PFNA 4BWJA 4DQPA 2KK0A 7ICVA 4UBBA 2JV3A 5ALWA 2DPJA 5KFDA 3M6ZA 4GXKA 8ICHA 4P2HA 1FO4A 1JALA 3I1YA 3TARA 1V38A 3A0BU 4CDGA 5ALOA 3HRDD 2RDIA 1BVSA 1L8LA 5KT3A 8ICMA 3RH4A 3N28A 5DG8A 2BQUA 4Q45A 4UB1A 5KFYA 4FZNA 2A1JA 3D6JA 2W9MA 5J2DA 2ALZA 3QU7A 5J2GA 2KZZA 1IIPA 3PW5A 1RXVA 2H3VA 3SAFA 5ALRA 3OGUA 5F9NA 1WYGA 4PH5A 1D8LA 2BCSA 4EZ6A 4MFFA 4CF5A 4GC7A 2KEYA 9ICFA 2OCEA 5J0XA 3QE9Y 4KLJA 5ALIA 1S5LU 9ICLA 3K1RB 4FBUA 2FJ6A 3ISDA 3WKAA 1U49A 1D9FA 4F5QA 3NVVA 2XY5A 4QWBA 3SAGA 4EBCA 3TFRA 4Z6FA 5A0LA 2WHEA 8ICTA 1A6SA 3TKAA 3RJJA 3AU2A 5AKKA 2KSOA 2BQ3A 5KFXA 4O5KA 4QZIA 5KFLA 5KFTA 1WG8A 3AEVA 2VA3A 4KLFA 4Y2SA 3EPGA 4UB8U 2L5YA 2AQ4A 2EDUA 8ICIA 5D49A 4YQWA 1CI4A 9ICNA 3O0FA 5DLGA 2C2DA 3MDAA 1NZPA 1PVPA 3UM9A 5AK6A 4PHPA 4FFDA 7ICKA 1Q8KA 3ED5A 3WKBA 1U4BA 3JPSA 1VDVA 7ICMA 3HKZF 1YT3A 2R8JA 5L1IA 3M7DA 3EW9A 1Y88A 1NJWA 2J6SA 4AYBC 5CEHA 5CJ7A 8ICRA 5J0UA 3PW4A 1SL1A 8ICPA 2FMSA 1X6JA 2HVIA 3QUCA 3TAQA 3QNMA 3L4PA 4I2JA 4NLNA 2R8GA 1ZD5A 3UQ0A 4TQRA 4RQ5A 3MBYA 2IOHA 4M04A 4EZ9A 4NV0A 1WCLA 3IHQB 3LYSA 3ETLA 3OSNA 2WAQF 1SB3C 1SXDA 3RBDA 3TI0A 4RPXA 1NK4A 4J9LA 5TZVA 2A1JB 5J2BA 4NL9A 2WF7A 2JEIA 2EAPA 2FPMA 4Y2JA 4B9MA 3V72A 1KBUA 5HR6A 2OM6A 1NK7A 2JMGA 4G3IA 4F93B 5C0YA 3G6XA 1ZQDA 4TUPA 1DK3A 3HP6A 1JXEA 3RAXA 4TURA 3PR5B 1N56A 2GH1A 1QSYA 1P7DA 8ICGA 2YQEA 2H3IA 4DFMA 3LWMA 4NWIA 4B9TA 4ECSA 2W43A 4J9SA 3PX4A 2KOBA 3KD3A 1T7PA 5AI8A 1FEZA 5ALDA 5EE9A 1ZQGA 4DLEA 5ALFA 2FDRA 3K4GA 2YMMA 1S9FA 3RJKA 1SV4A 4DF8A 8ICSA 3QUTA 4ECQA 2ASJA 2DUYA 3RR7A 4JV0A 3SV4A 2F1IA 3RAQA 1ZJNA 5KT2A 3ORYA 4QNLA 1J2NA 2FE9A 4F91B 1Z00A 3GQCA 5KFFA 4MHVA 4B9UA 1L7OA 2K8AA 1SZPA 4DL3A 1QSLA 4M9HA 2GWSA 4FZMA 1TKDA 2YMPA 2EQYA 2W3RA 1S77D 2KKPA 2R8IA 3F5EA 4KN7A 2QB0B 5AKJA 2K4EA 4LZGA 2K8BB 2XVTA 4YR3A 3SI8A 4BX9C 2WB1F 3RB0A 1ZQWA 2FLPA 5AM4A 5ALXA 5L1KA 3H0RB 1SGGA 1T94A 1K5OA 9ICMA 1PK3A 1S0MA 3IRUA 1N48A 2YMQA 2CPRA 1RQNA 1H38A 1KFSA 1J97A 1DRGA 1KSPA 1ZQ1C 4OJOA 1QLNA 4UARA 3QUBA 3TQ1A 1V97A 2BHNA 3RB4A 5KG6A 1X9XA 3NUQA 2JH1A 2IOFA 9ICAA 4QZFA 4RUAA 3RF9A 1TK0A 3RJFA 4U6PA 2OEHA 4K4GA 3GIIA 1B43A 2K8CB 2D6FC 1KLNA 9ICXA 5KFUA 5ALTA 2WFAA 2FLNA 8ICFA 4UAYA 1LKYA 4ELVA 5C5JA 4OJ5A 2ZUCA 9ICCA 2G07A 2NRTA 4KX5A 2ODGA 2MA1A 4P0PA 4R65A 2HSZA 4YD2A 4Z6CA 4FS1A 5DB6A 4ED0A 3BS5A 2EAOA 2PXIA 1ZQKA 1TAUA 5KG7A 3AQFA 3PV8A 4KITB 1COKA 1NK0A 1ZD4A 4PL1A 4QZ8A 2FPLA 2W04A 4EELA 1SIJA 4I2EA 1NK6A 1URJA 2RP5A 5KFRA 3PVXA 1SV0C 3NVWA 1L3VA 2PFOA 8ICCA 1WUDA 2XCPA 1WWUA 4RQNA 1SXEA 3RH5A 5CP2A 4B6JA 3IP4B 1Z00B 1IXRA 2H3FA 2KIVA 3M9OB 3OJUA 5KT5A 2HHSA 4ACOA 4PZNA 1U48A 2IOFK 1OW5A 3DV9A 1L5UA 4FBTA 2BQRA 2BPFA 4YR2A 1QCKA 9ICTA 4USAA 1XSPA 5DQHA 3Q8RB 3KZXA 2GLEA 2HOIA 1O03A 2E3TA 4R64A 5KFIA 4DFJA 3T5HA 2HHXA 4DL6A 2AXTU 2ZG6A 1LVHA 5KFWA 4F5NA 5AKEA 3MR3A 3GIMA 2PI4A 3ETRA 4KLUA 4EX7A 3NVYA 3AUOA 2V4RA 2OXOA 3CYMA 4K4HA 4I2IA 3SR6A 5F3XB 1VJ5A 2E8MA 3QU9A 3CRXA 2R18A 4QIWF 3T5JA 1ZQPA 1BNPA 4KLHA 1TVAA 4M9JA 3SQIA 8ICNA 1MQ3A 2NO4A 1F44A 2YX8A 9ICUA 3ISCA 1BNOA 1L7MA 4YD1A 5KFEA 4J9NA 4IS7A 4Q44A 1OXJA 3PSFA 1T3NA 2K89A 2XICA 2RDJA 4UATA 3RH6A 1QQ7A 5J2IA 2XY7A 2EZZA 1N62A 2KV2A 5EE1A 1JIHA 3OPXA 4P0PB 4KLGA 1N63A 2NRZA 2KJ5A 3B9JA 4Y2XA 2P6UA 1X66A 1JROA 2DQNB 1ECWA 3BS5B 2KHQA 2KFNA 1ZD2P 2HHUA 5AM0A 1F0MA 5KTQA 4KLLA 3HKZC 4PPXA 4ED3A 1FIQA 3VCBA 5ALEA 1XSLA 3QX7A 9ICHA 1Z4NA 4Q8FA 4YVZA 5KAIU 2KMDA 1YZ7A 4DSKA 1UA1A 5KG2A 4UAWA 4BDPA 5HHHA 1N61A 5KG0A 2HMXA 2KHVA 2G08A 4CGZA 4I27A 4Q8EA 2HDOA 4FO6A 3KZIU 1X9MA 1JX4A 1X42A 1S76D 1RYUA 2YY6A 3RBEA 4DSIA 1B0XA 4DL7A 1BPBA 5KFAA 3MR6A 2R8KA 3QZ7A 2WAQC 1ZQQA 3CNHA 4GC6A 2K4HA 4NJ8A 5GTIU 5KFOA 4QZHA 3MR2A 2ESEA 4Y2RA 4IRDA 4DQRA 5HMMA 3I76A 4MEYA 4RZRA 7ICFA 4TUSA 4RNMA 5KAFU 3BQ0A 1ZQCA 2YN4A 4TUQA 1XO0A 4M9GA 5J0TA 1Z4OA 4RQ1A 5IIMA 2DFLA 3H0LB 4CNQA 4YMOA 4NLGA 1ZQNA 2VA2A 1C7YA 1NK9A 3MGVA 3GDXA 4DOBA 2KKVA 7ICQA 1UHUA 3DEEA 5DBBA 2E1EA 4RNNA 3TFSA 2P35A 2AJQA 3C2MA 4QZCA 1NI3A 4KMOB 2HVHA 2FMQA 9ICKA 5ALPA 2CXYA 2MRLA 3H4BA 4Q43A 3EPIA 1ZJMA 5AM3A 2RQ5A 4CF3A 4DO9A 4JB3A 4C7YA 3F53A 3PSTA 4I2DA 5ALJA 3HPOA 5HP4A 4O3SA 5KFQA 3VC8A 4O3NA 2ISPA 2XO7A 3MGHA 4C80A 2KE7A 1RZTA 2NO5A 1RQLA 3IM1A 4DF4A 3HWTA 2ASDA 3QU4A 7ICHA 2HHTA 4IQTA 5ALUA 1NKBA 4DOCA 1RYRA 2XI9A 4RPYA 5EE3A 1U47A 5KFCA 4NL9C 5KFVA 1MC8A 1D8YA 3T79A 4FS2A 5KFHA 3RRHA 4P4MA 1T4GA 4J9RA 1NJYA 2J6UA 4R63A 2VJ4A 1JUDA 4J9MA 1KW4A 5J8YA 2BDPA 1ZQAA 1QQ6A 2A1AA 2CRXA 4M9NA 2ZTCA 2F2AB 5ALZA 4JV2A 1NJXA 5JUMA 4UB2A 5GTHU 3WU2U 1Z19A 4UB6U 1XWLA 1KN5A 2PFQA 3WKEA 9ICGA 2ZJ8A 3Q8QB 2WB1C 4RQ8A 4O3RA 4YFKA 3AU6A 2C28A 3WK5A 2QARB 5D46A 3KHGA 4KLIA 5J2HA 1V85A 2WTFA 4XA5A 4O3MA 4DFPA 2IBKA 4Y2UA 4DQQA 5DDYA 8ICZA 3FDSA 5KFBA 2HBJA 1LV5A 3F2BA 9ICBA 5KFSA 2DGZA 1JN3A 5AKGA 3G6VA 2QB0A 2P6RA 4ED1A 4RQ0A 1MSWD 5J2EA 1RG6A 1QTMA 3B0YA 5AHXA 4QZ9A 1SL2A 4NM1A 3NGDA 2DPIA 3GV8B 3ZDEA 2JHDA 3B0XA 3QEBZ 3RTVA 5ALNA 1TFRA 4ED6A 1TK8A 4QZDA 4QWEA 3ZD9A 2MAXA 4RQ7A 5DBAA 2ZIUA 3H7IA 2KZMA 3ZI4A 4F72A 5ALKA 5AKXA 3ZDAA 9ICRA 1IV8A 4P0QA 2RHFA 4Y2VA 1RXWA 1Q3VA 4HAIA 5D4BA 5J0PA 2ZJAA 3BZKA 4YG2A 1D8BA 5DB9A 1X9WA 1S0OA 2UVUA 2C22A 2DKXA 4CF4A 4WJ3B 3C2LA 5J2AA 3D2NA 5HR7A 7ICUA 1LB2B 1ZQTA 1SKRA 3EWAA 2ISOA 3PSPA 4DS5A 3OJSA 2LPEA 4EENA 3LDAA 1C20A 4YP3A 5CRXA 4I2FA 1UPHA 1ZYQA 5AI9A 1ZQRA 4IRCA 4MF2A 1RM6C 3L3FX 4F4XA 5AK5A 4IR9A 5KG4A 2FMPA 3F5AA 3LVWA 1N2XA 4O0IA 2YB1A 1Q46A 1ZQVA 3V6KA 3GZFA 2AGOA 1BPZA 1KKXA 3RJHA 3BZCA 2Y0SF 2LYAA 4B9VA 1ZETA 2E5SA 5FP0A 2BZFA 3H40A 8ICYA 9ICVA 5KFZA 1L3SA 5EWEA 9ICWA 1A76A 4QW8A 3PMLA 4NM2A 1PZNA 3MABA 4C8MA 3M8SA 2LHTA 4ECVA 4CCHA 2E8PA 3BQTA 2EZXA 4DQSA 4J9OA 3UXNA 3AMZA 4RPZA 2EANA 3Q8LA 2OH2A 4KLSA 2VA8A 4QIWC 2EZYA 3OSPA 2DKZA 1K1SA 4C8OA 2I5HA 2F76X 1HUZA 1V9PA 1L7PA 2D8CA 4F2SA 2F1HA 5L9XA 2NYVA 2ZIWB 1B4FA 5CB1A 1ZQUA 4DLGA 4KLQA 4F2RA 5DKWA 3GU3A 2VIXA 2YTUA 1NK8A 1DOQA 4PZOA 4K4IA 1L8OA 4Y2TA 4IQWA 5AIAA 2HOFA 5AM5A 4US8A 4EEKA 4DSFA 1CEZA 2K60A 2ZIUB 2J6TA 5DDMA 5CA7A 2ZJ5A 4DEZA 3F2DA 3QYPA 5ALHA 5E79U 4P0QB 2XGQA 2H3ZA 4EYHB 2K4PA 2JRZA 3J81j 4GXJA 1RPLA 1SL0A 2Q4TA 1X2IA 8ICJA 1IG6A 5EOZA 1N60A 5JRTA 3PSIA 4ELTA 3SENA 5JU5A 4J9QA 3FC4A 2LKYA 5AI0A 3BDPA 2QKQA 3RJGA 1KTQA 5DG7A 5JTIA 2RRDA 3C23A 3D2SA 7ICLA 1COOA 4M47A 3BQ1A 3PZPA 4XRHA 1S0NA 4JV1A 4LZDA 1NZBA 1DGSA 4M6WB 2XY6A 1T3QA 2Y9TA 2Q0ZX 2NRVA 3Q8MA 1UA0A 2KVCA 4JK1A 2P66A 5AIBA 4F4ZA 2Y1IA 3QU5A 3RB6A 1CUKA 1FFUA 2HBMA 4F5OA 2Z7JA 1X9SA 7ICTA 2W8LA 1PVRA 1S10A 3JPNA 4KMUA 3G6YA 2FPKA 3LVVA 5L1LA 4BXOA 4F50A 3JPPA 4TQSA 5CWRA 2XGPA 5KFKA 3E0FA 8ICXA 3SAHA 2KN7A 1ZQIA 4DL4A 4F5RA 3UMGA 3TANA 4I2GA 7ICEA 3FAHA 4NLKA 4PGYA 5EWGA 3ZDCA 1F5SA 8ICKA 3EYZA 3HT3A 2JXJA 1UQVA 2PI5A 2KICA 2VANA 2DWQA 5J2FA 2FLLA 3JPQA 4ZH4A 3Q8KA 1OUQA 1PK1A 1CRXA 4KLMA 2HW3A 4IL6U 3NRZA 4PHAA 2WF5A 1L3UA 5EE0A 2HBLA 5IIOA 2ZTEA 1SZHA 5KFJA 4UB5A 4US9A 3HX0A 4C0ZA 3RRGA 3NASA 5BPCA 4UB4A 1ZQZA 4B9NA 3KFUF 2F1JA 1NNLA 4KN4A 2ATLA 4ECXA 4ECZA 3TADC 2JGAA 1WWVA 5ALLA 4YXMA 1ZRMA 4LJXA 9ICEA 1NK5A 3CW2C 2LBOA 4ECUA 2KVSA 1ZOLA 7ICGA 5F9LA 4OO1J 1EXNA 3WKDA 3THVA 4O3QA 4F92B 3QXGA 1HEKA 3NS1A 5DGBA 3ISBA 3TAPA 2MUTA 3TACB 2H3QA 4OJLA 5J2CA 2BPGA 1ZQSA 4RQ6A 3WK9A 5J0YA 4RU9A 4I2HA 4DSEA 5KFPA 2A3VA 4JWNA 8ICBA 1JXLA 3OHBA 3M8RA 3BJYA 1B22A 4M0AA 5AI6A 4NLCA 1RDFA 4BXOB 3KHHA 4E0DA 2ES6A 4O3OA 3AM9A 1ZQOA 2F44A 2QARA 4C7ZA 4JUZA 1U9LA 4BWMA 4C4RA 3N4MB 1PVQA 7ICRA 3A0HU 3N7SC 3TADA 4QW9A 1ZXIA 3C5FA 2LMRA 4C4TA 5ALVA 1O08A 3ZDDA 4JMUA 1ZD3A 2MSNA 4QZGA 5J8YC 4YMNA 4ZOHC 4F3OA 2KZ3A 1IM4A 1PK1B 2B21A 5DBCA 3FM9A 4NLZA 1HUOA 5AM1A 2F8LA 3N97B 2W54A 5DQGA 4F4WA 2BKEA 4M9LA 2KP7A 2YB4A 3R9KA 2M9NA 4I2AA 3K1ZA 2UVVA 9ICOA 2OHFA 3F2CA 2N1RA 3M1YA 2AU0A 3UXPA 5B5EU 5H2FU 2JH7A 4ICAA 1ZQEA 4QZEA 4XUSA 2HHQA 4M2YA 3V6HA 3H8WA 4CRXA 2ZUBA 4DFDA 5ALQA 1TK5A 2LM1A 4PHDA 1T8EA 5TISU 3WK4A 2JZBA 1MA7A 2NV3A 2IA6A 2AQ0A 4EBDA 1XU4A 3KBBA 3RB3A 5HNKA 8ICEA 2IHNA 2Y0SC 2PMZF 2LM4A 4J03A 4DSLA 2HCFA 5AKHA 3MDCA 3HJEA 2MUTB 1ZQLA 4DCCA 2W7PA 3UMBA 4JWMA 2CN1A 3ALRA 2E1FA 3PY8A 2W9AA 2G0AA 2ZIVA 1XC9A 5IILA 2PFPA 2M0NA 1TAMA 1A77A 1NKCA 2AH5A 4UAVA 9ICQA 4YCXA 2ZIXA 2PKEA 2V4QA 5G5GA 1PUZA 5J0SA 2BCQA 1ZQYA 1KL9A 3BQ2A 2W9CA 2F77X 4F5PA 2WF6A 2EH9A 4R8UB 2AGQA 2BPCA 3C28A 1SWVA 3UMCA 2ZTDA 2JEJA 2QLTA 5J0RA 4PHEA 1BPXA 2BR0A 4DFKA 1XS9D 1SWWA 1JI7A 5KG5A 1MQ2A 2KTQA 3C1ZA 3AN1A 3EZ5A 5KL1B 3QU2A 5DLFA 2BCVA 8ICWA 2W9BA 2VJ5A 2WF8A 3K75D 8ICLA 3SZ2A 3IDWA 2ZIWA 4GXIA 5HHIA 4RT3A 3MR5A 3SV3A 2G5HB 5CHGA 4X5VA 7ICNA 1HJPA 1UT5A 5ALGA 4C4SA 1KFDA 3QUQA 3GIKA 7ICJA 4KLTA 3NTUA 4XQ8A 4RQ2A 4F8RA 1WCNA 2NRXA 1ZQHA 3WKCA 4FZLA 3PMNA 4YXJA 4YN4A 3AL0B 4PGQA 1NJZA 4DS4A 3PO4A 4GFJA 2W8KA 5B66U 2JZBB 5DG9A 2B6GA 3QZ8A 2HOQA 4UB3A 4HYKA 3NRWA 4J9KA 1K1QA 1SKWA 4GLXA 3SEIA 1KFTA 5KG3A 1SKSA 5BOMA 3QEAZ 4KLEA 4NY8A 5EWFA 2BCRA 5KFGA 3BS7A 4GIBA 4Y2YA 1NOMA 3I28A 4F4YA 5CR0A 3V7LA 2D3DA 1KDHA 1S0VA 3SD7A 3T3FA 5AM2A 2BCUA 3C21A 5DB8A 4PJ0U 5HMLA 2LI6A 4Y2QA 2ZIVB 2A19A 3T5KA 4IQVA 5DB7A 1RYSA 2JEFA 1Z3EB 4OCZA 4M6WA 2KSOB 5IIKA 3UPQA 3SYZA 4P4PA 3C2KA 2V9WA 3IG5A 2ASLA 4PL2A 1TAQA 1BGXT 2ZIXB 9ICSA 4UW9A 5AKLA 4J9PA 3HW8A 3AQEA 4OJPA 2W9CB 3H4DA 1AQ6A 2IMWP 1YZ6A 3RJIA 5BOLA 3KOOA 5KFMA 3PNCA 5KFNA 3ZDBA 5J0WA 3H8SA 4UQGA 4Z6EA 2LYHA 1KRPA 4ECWA 4RQMA 8ICQA 2EAMA 3UXOA 5AK3A 1DK2A 2W9BB 1L6NA 4MF8A 3KTQA 2XC9A 1XSNA 4MFCA 3C1YA 5J2KA 1S97A 2KFZA 5AKIA 4EYIB 3BQ7A 3CP8A 2BDUA 4QWAA 5AKYA 5IIIA 5IINA 4IRKA 1FFVA 1Z1BA 4ECRA 1TV9A 1DXSA 5AI4A 3DDHA 3N7PD 4KX3A 3OHAA 1BPDA 4QWDA 1MN8A 2AHOB 2C2EA 3GIJA 4NLBA 5ALSA 4DL2A 3MGIA 4I2BA 9ICIA 4AYBF 3V7JA 2W55A 2QB1A 2E8NA 4C8LA 3L5KA 1ZRNA 4NXZA 4EBEA 1X40A 3NVZA 3M9MB 2G09A 5KL8B 3PW7A 5DGAA 3OTQA 2FI1A 3PO5A 1X6IA 1Z1VA 2JR5A 4EX6A 1ED1A 3ONNA 1L7NA 3V6JA 8ICUA 1ZQMA 3KKAC 3RFAA 3V7KA 4R66A 4MEXA 3N7RC 4PGXA 2XIDA 4ED2A 3E2EA 4ED8A 4DOAA 1ZQXA 1QSSA 4ELUA 4EEYA 1QH9A 3PW0A 1KQQA 4MFAA 5KT7A 4AP9A 2F3NA 2ZXHA 5KT4A 5L1JA 7ICSA 5ALYA 2O6KA 5J2JA 1KEJA 2KNJA 1S8OA 3C5GA 2W3SA 4B9SA 2GO7A 3LK9A 4BUGA 2KIWA 3RJEA 2GOLA 2H5XA 2AGPA 2ZUDA 7ICIA 1JMSA 4FE3A 3PX6A 4CE6A 5L1MA 1L3TA 3SMVA 5DQIA 5IIJA 4DWIA 5K4LA 5AI5A 2Y1JA 3PR4A 3IV6A 4RNOA 2I9GA 4ED7A 2HHWA 1QQ5A 7ICPA 1ZQJA 5KT6A 3D2QA 4U7CA 1A0PA 3GFKB 3Q8PB 3H8MA 4QWCA 2KD1A 4OJ6A 3MFHA 5AK4A 7ICOA 3LWLA 2HBKA 2R8HA 3MC1A 2OYYA 3WK8A 1XO1A 4F4KA 3KKAA 1NKEA 2KJ9A 3EUB2 1UT8A 4RUCA 2DL0A 3IN5A 1UCVA 2RLTA 1N5XA 3IG8A 4RT2A 4KLDA 1AROP 4IR1A 4F71A 3U26A 3WK7A 3MFIA 5J29A 8ICAA 9ICJA 4QZAA 3RR8A 8ICVA 8ICOA 4A8EA 3S6JA 2PMZC 2W03A 4Z6DA 1VLBA 5AKZA 2I1QA 3T5LA 2G06A 4I2CA 4ECYA 4O5EA 9ICPA 3HILA 5ALMA 1D9DA 4KTQA 4Y2PA 2K4IA 3PX0A 1ZQBA 3ZD8A 2W11A 2I6XA 1SV0A 1ZQFA 1GO3F 2C2RA 1N5WA 2XCAA 5AICA 3M9NB 4UAUA 2NRWA 2IHMA 4RQ4A 3E58A 1LKYB 4KLOA 2LYBA 3C29A 1XNSA 4YMMA 2UVRA 3PW2A 2ZXIA 3FYHA 4UAZA 3H8JA 2B0CA 2HI0A 3WK6A 3GV7B 2F8KA 2JEGA 3KHLA 1HIWA 5KNIA 3UQ2A 4G9BA 4O3PA 4DQIA 2VKQA 5KG1A 1M6YA 1U45A 4QJFB 2HHVA 2BGWA 4OD0A 2KJ8A 1TE2A 4I28A 1BPEA 4BGDA 4B9LA 4RQ3A 3GILA 4IQUA 1JRPA 4DL5A 1BPYA 2W7OA 3JPOA 2Y9UA 4DSJA 2DBYA 2KG5A 5G5HA 3ICXA 4R8UA 2YMLA 1Q3UA 5T14A 2OWOA 4ECTA 4C8NA 2MU2A 4O9MA 1J2MA 2E8OA 2G5IB 5J0OA 3KHRA 2WF9A 4UBCA 4LVSA 4UASA 3Q8SB 4QZBA 4P4OA 3M6KA 4IC9A 3JPRA 4YR0A 4C8KA 3GV5B 5J0QA 4I29A 1DGJA 3H0MB 4BJQA
chains in the Genus database with same CATH topology
3JPTA 4GXIA 5CB1A 4O5CA 2UVWA 5HHIA 2PFNA 4BWJA 1ZQUA 4RT3A 5KFWA 4DLGA 4DQPA 4F5NA 3MR5A 3SV3A 4KLQA 4F2RA 7ICVA 4UBBA 5DKWA 5CHGA 3MR3A 3GIMA 4X5VA 2DPJA 2PI4A 7ICNA 1HJPA 5KFDA 4GXKA 1UT5A 8ICHA 4P2HA 4KLUA 3TARA 1KFDA 3GIKA 1NK8A 1DOQA 4K4IA 7ICJA 4KLTA 3NTUA 4XQ8A 4IQWA 4RQ2A 3AUOA 2V4RA 4F8RA 2RDIA 1BVSA 1WCNA 2NRXA 1ZQHA 5KT3A 8ICMA 4DSFA 1CEZA 3PMNA 3RH4A 2J6TA 5DG8A 2BQUA 4YXJA 4YN4A 4K4HA 4I2IA 5DDMA 5CA7A 2ZJ5A 4Q45A 5KFYA 4UB1A 2A1JA 4DEZA 4PGQA 4DS4A 1NJZA 3PO4A 2W9MA 5J2DA 2W8KA 2ALZA 2XGQA 3T5JA 1ZQPA 4EYHB 5J2GA 4KLHA 2JZBB 1TVAA 4M9JA 5DG9A 3PW5A 1MQ3A 4GXJA 1RXVA 2KZZA 8ICNA 1RPLA 3QZ8A 1SL0A 4UB3A 4HYKA 9ICUA 3ISCA 4J9NA 4YD1A 1X2IA 5F9NA 5KFEA 3OGUA 4PH5A 1D8LA 4J9KA 2BCSA 4EZ6A 4Q44A 4MFFA 8ICJA 4GC7A 5EOZA 1T3NA 1K1QA 1SKWA 4GLXA 4ELTA 9ICFA 1KFTA 2RDJA 5KG3A 1SKSA 5BOMA 3QEAZ 3RH6A 5J0XA 3QE9Y 4KLEA 4KLJA 5J2IA 2XY7A 4NY8A 5EWFA 2BCRA 5KFGA 4J9QA 9ICLA 1NOMA 4F4YA 5CR0A 4FBUA 3ISDA 3V7LA 1JIHA 1U49A 3BDPA 4KLGA 1KDHA 1D9FA 2NRZA 1S0VA 4F5QA 3RJGA 2XY5A 3T3FA 2P6UA 4QWBA 1KTQA 2BCUA 3C21A 5DG7A 5DB8A 4EBCA 3TFRA 3C23A 4Z6FA 7ICLA 1COOA 4M47A 2KFNA 5HMLA 2HHUA 8ICTA 3BQ1A 5KTQA 3T5KA 4KLLA 4IQVA 3RJJA 3AU2A 5DB7A 4XRHA 1RYSA 1S0NA 2JEFA 4JV1A 4PPXA 4ED3A 4LZDA 1Z3EB 1DGSA 4M6WA 4M6WB 2XY6A 5IIKA 3UPQA 3SYZA 1XSLA 4P4PA 2Q0ZX 2BQ3A 5KFXA 2NRVA 4O5KA 9ICHA 3C2KA 3Q8MA 1UA0A 4QZIA 5KFLA 4JK1A 5KFTA 2ASLA 2P66A 2V9WA 4F4ZA 2VA3A 4Q8FA 4YVZA 1TAQA 2Y1IA 4KLFA 1BGXT 1UA1A 4DSKA 3RB6A 5KG2A 1CUKA 3EPGA 4F5OA 4UAWA 4BDPA 9ICSA 5HHHA 1X9SA 7ICTA 2W8LA 5KG0A 3HW8A 4J9PA 2AQ4A 1S10A 3JPNA 2W9CB 4KMUA 5D49A 4YQWA 4I27A 8ICIA 3G6YA 2FPKA 4Q8EA 4FO6A 9ICNA 3H4DA 5L1LA 2IMWP 1X9MA 5DLGA 2C2DA 3RJIA 1JX4A 5BOLA 3MDAA 4F50A 4BXOA 3JPPA 4TQSA 1S76D 5KFMA 5CWRA 4PHPA 3PNCA 3RBEA 4DSIA 5KFNA 2XGPA 3ZDBA 4DL7A 5J0WA 7ICKA 1BPBA 3H8SA 5KFKA 5KFAA 4UQGA 4Z6EA 1U4BA 3JPSA 3MR6A 4DL6A 2R8KA 3QZ7A 7ICMA 2LYHA 1KRPA 4ECWA 1ZQQA 8ICXA 8ICQA 3UXOA 4GC6A 2R8JA 5L1IA 5KFOA 2KN7A 3EW9A 1Y88A 1NJWA 1ZQIA 4DL4A 4QZHA 4F5RA 2J6SA 3MR2A 3TANA 5CJ7A 8ICRA 2W9BB 5J0UA 3PW4A 1SL1A 4IRDA 4MF8A 2FMSA 3KTQA 4DQRA 4I2GA 2HVIA 5HMMA 4MEYA 2XC9A 4RZRA 1XSNA 4MFCA 3TAQA 4TUSA 7ICFA 7ICEA 4RNMA 4NLKA 4PGYA 5EWGA 3ZDCA 3C1YA 4I2JA 3BQ0A 5J2KA 1S97A 4NLNA 8ICKA 3EYZA 2KFZA 3HT3A 2R8GA 1ZQCA 4EYIB 2PI5A 4QWAA 3UQ0A 4TQRA 4RQ5A 3MBYA 5IIIA 2VANA 5J2FA 2FLLA 4TUQA 5IINA 4IRKA 4M04A 3JPQA 4EZ9A 4ZH4A 3Q8KA 4ECRA 4M9GA 5J0TA 1TV9A 4KLMA 2HW3A 1WCLA 3IHQB 4RQ1A 5IIMA 2DFLA 3ETLA 3OSNA 4YMOA 4NLGA 1ZQNA 3OHAA 1BPDA 4QWDA 2VA2A 4PHAA 1C7YA 1NK9A 2C2EA 1L3UA 3GIJA 3RBDA 3GDXA 4DOBA 3TI0A 4RPXA 5IIOA 3MGIA 4J9LA 4DL2A 1NK4A 4I2BA 9ICIA 7ICQA 2ZTEA 3V7JA 5TZVA 2A1JB 5KFJA 5DBBA 5J2BA 4UB5A 4RNNA 4C8LA 3TFSA 2AJQA 4NXZA 3C2MA 2JEIA 4EBEA 4QZCA 3HX0A 3RRGA 5BPCA 2FPMA 4UB4A 4B9MA 3V72A 3M9MB 1ZQZA 4B9NA 2HVHA 2FMQA 9ICKA 3PW7A 2F1JA 4KN4A 5DGAA 2ATLA 1NK7A 3H4BA 4ECXA 4ECZA 4Q43A 3EPIA 1ZJMA 3PO5A 4G3IA 4F93B 3V6JA 4YXMA 9ICEA 8ICUA 4DO9A 1NK5A 1ZQMA 4I2DA 3HPOA 3G6XA 5HP4A 1ZQDA 4O3SA 4ECUA 3V7KA 4TUPA 5KFQA 7ICGA 5F9LA 4R66A 4O3NA 3HP6A 4MEXA 4PGXA 1EXNA 2ISPA 1JXEA 2XO7A 4TURA 3MGHA 4O3QA 3THVA 3RAXA 3PR5B 4F92B 4ED2A 4ED8A 1N56A 1QSYA 4DOAA 3E2EA 1ZQXA 1QSSA 4ELUA 8ICGA 4DFMA 4EEYA 3LWMA 1RZTA 5DGBA 3IM1A 3ISBA 4DF4A 3HWTA 3TAPA 2ASDA 3PW0A 4B9TA 4MFAA 4ECSA 5KT7A 7ICHA 2HHTA 4IQTA 1NKBA 4DOCA 1RYRA 2MUTA 4RPYA 5KT4A 4J9SA 5L1JA 5KFCA 3PX4A 1U47A 7ICSA 5J2CA 2BPGA 5KFVA 1ZQSA 1MC8A 5J2JA 1T7PA 1KEJA 4RQ6A 1D8YA 3C5GA 4FS2A 5KFHA 3RRHA 4P4MA 1T4GA 4J9RA 4DLEA 5J0YA 1NJYA 4R63A 4RU9A 1ZQGA 4B9SA 3LK9A 4I2HA 4DSEA 4J9MA 3K4GA 2BDPA 3RJEA 5KFPA 1S9FA 1ZQAA 3RJKA 4JWNA 8ICBA 2H5XA 4DF8A 4M9NA 2AGPA 2ZUDA 2ZTCA 1JXLA 4JV2A 1NJXA 7ICIA 5JUMA 3OHBA 4UB2A 8ICSA 3M8RA 3BJYA 1JMSA 1B22A 4M0AA 1XWLA 4ECQA 4BXOB 3KHHA 2ASJA 2PFQA 3PX6A 9ICGA 4E0DA 1L3TA 2ZJ8A 3Q8QB 5DQIA 5IIJA 3RR7A 4JV0A 4O3OA 4RQ8A 3SV4A 4DWIA 4O3RA 2F1IA 3RAQA 1ZQOA 1ZJNA 5KT2A 4YFKA 2Y1JA 3ORYA 3AU6A 2C28A 4F91B 5D46A 3PR4A 1Z00A 4RNOA 3KHGA 3GQCA 4ED7A 2I9GA 4KLIA 5KFFA 5J2HA 4B9UA 2HHWA 2WTFA 4XA5A 7ICPA 1ZQJA 5KT6A 4DFPA 2IBKA 4JUZA 4DQQA 1SZPA 1U9LA 3GFKB 4BWMA 4QWCA 3Q8PB 4DL3A 3N4MB 5DDYA 1QSLA 4M9HA 7ICRA 2GWSA 8ICZA 3FDSA 3MFHA 5KFBA 7ICOA 1LV5A 4QW9A 3LWLA 3C5FA 2R8HA 1TKDA 9ICBA 5KFSA 1S77D 1JN3A 1XO1A 3ZDDA 4F4KA 4QZGA 2R8IA 3G6VA 1NKEA 4YMNA 2P6RA 4ED1A 4KN7A 4RQ0A 4F3OA 2KZ3A 1UT8A 1MSWD 4LZGA 4RUCA 5J2EA 1IM4A 4YR3A 3SI8A 3RB0A 1ZQWA 2B21A 1QTMA 2FLPA 5DBCA 4KLDA 3B0YA 4RT2A 4QZ9A 1AROP 1SL2A 4NM1A 4NLZA 3NGDA 1HUOA 3GV8B 2DPIA 5L1KA 4IR1A 8ICPA 3ZDEA 3N97B 9ICMA 5DQGA 4F4WA 2BKEA 1S0MA 4M9LA 3MFIA 4I2AA 5J29A 2M9NA 3B0XA 1N48A 2UVVA 8ICAA 9ICJA 9ICOA 3QEBZ 4QZAA 1H38A 3RTVA 3RR8A 8ICVA 1TFRA 8ICOA 1KFSA 2AU0A 3UXPA 4ED6A 1KSPA 4Z6DA 1TK8A 4QZDA 4QWEA 3ZD9A 2I1QA 3T5LA 1QLNA 1ZQEA 4QZEA 2MAXA 4RQ7A 4XUSA 5DBAA 2HHQA 4I2CA 3TQ1A 4ECYA 3V6HA 4M2YA 2BHNA 3RB4A 4O5EA 5KG6A 3H8WA 2ZUBA 3H7IA 9ICPA 2KZMA 1TK5A 3ZDAA 9ICRA 9ICAA 4QZFA 4RUAA 4PHDA 1T8EA 1D9DA 4KTQA 1TK0A 3RJFA 3PX0A 1ZQBA 1RXWA 3ZD8A 2JZBA 5D4BA 2IA6A 5J0PA 2J6UA 2AQ0A 2ZJAA 4YG2A 4EBDA 4K4GA 1XU4A 3GIIA 5DB9A 1ZQFA 1X9WA 1S0OA 1B43A 3RB3A 2C2RA 2UVUA 2XCAA 5HNKA 2C22A 3M9NB 8ICEA 1KLNA 9ICXA 3C2LA 2NRWA 5KFUA 5J2AA 7ICUA 2FLNA 2IHMA 8ICFA 4RQ4A 4UAYA 1LB2B 2IHNA 1ZQTA 4ELVA 1SKRA 3EWAA 5C5JA 4KLOA 2ISOA 2ZUCA 4DS5A 9ICCA 3OJSA 2NRTA 4YMMA 4DSLA 2UVRA 3LDAA 3PW2A 3MDCA 4R65A 2MUTB 3FYHA 4YD2A 1ZQLA 4YP3A 4UAZA 3H8JA 4I2FA 4Z6CA 4FS1A 1ZYQA 4JWMA 3GV7B 2JEGA 3KHLA 5DB6A 1ZQRA 4IRCA 4ED0A 4MF2A 3UQ2A 3PY8A 2W9AA 2PXIA 4F4XA 1ZQKA 1TAUA 1XC9A 5IILA 5KG7A 4O3PA 4DQIA 3PV8A 5KG4A 2FMPA 2PFPA 4IR9A 5KG1A 4KITB 1NK0A 1U45A 1A77A 1NKCA 2HHVA 2BGWA 4QZ8A 4O0IA 1ZQVA 2FPLA 4I28A 3V6KA 9ICQA 1BPEA 4I2EA 2AGOA 1NK6A 4YCXA 1BPZA 5KFRA 3PVXA 1L3VA 2PFOA 4BGDA 4B9LA 4RQ3A 3GILA 4IQUA 3RJHA 8ICCA 4DL5A 4B9VA 2XCPA 2V4QA 5J0SA 2BCQA 1ZQYA 1BPYA 1ZETA 3JPOA 3BQ2A 3RH5A 3H40A 5CP2A 4DSJA 2W9CA 8ICYA 1Z00B 4F5PA 9ICVA 1IXRA 5KFZA 4R8UA 3M9OB 3OJUA 4R8UB 5EWEA 1L3SA 2AGQA 2BPCA 5KT5A 2HHSA 9ICWA 1A76A 2JEJA 2ZTDA 4QW8A 3PMLA 5J0RA 4NM2A 4PHEA 4ECTA 1BPXA 2OWOA 4C8NA 2BR0A 1PZNA 4O9MA 3MABA 4DFKA 1XS9D 1U48A 1L5UA 4C8MA 5J0OA 3M8SA 4FBTA 2BQRA 3KHRA 2BPFA 4UBCA 4ECVA 5KG5A 1MQ2A 4CCHA 2KTQA 3C1ZA 3BQTA 4YR2A 4LVSA 3EZ5A 4DQSA 9ICTA 4J9OA 1XSPA 5DQHA 3UXNA 4QZBA 3Q8SB 4P4OA 4RPZA 5DLFA 2BCVA 3Q8LA 4KLSA 8ICWA 3Q8RB 2W9BA 3JPRA 2VA8A 4YR0A 4C8KA 3GV5B 3OSPA 1K1SA 4R64A 5KFIA 4C8OA 3K75D 1HUZA 8ICLA 1V9PA 5J0QA 3T5HA 4DFJA 4I29A 2F1HA 3SZ2A 4F2SA 2HHXA 5L9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JPT A;  4GXI A;  5CB1 A;  4O5C A;  2UVW A;  5HHI A;  2PFN A;  4BWJ A;  1ZQU A;  4RT3 A;  5KFW A;  4DLG A;  4DQP A;  4F5N A;  3MR5 A;  3SV3 A;  4KLQ A;  4F2R A;  7ICV A;  4UBB A;  5DKW A;  5CHG A;  3MR3 A;  3GIM A;  4X5V A;  2DPJ A;  2PI4 A;  7ICN A;  1HJP A;  5KFD A;  4GXK A;  1UT5 A;  8ICH A;  4P2H A;  4KLU A;  3TAR A;  1KFD A;  3GIK A;  1NK8 A;  1DOQ A;  4K4I A;  7ICJ A;  4KLT A;  3NTU A;  4XQ8 A;  4IQW A;  4RQ2 A;  3AUO A;  2V4R A;  4F8R A;  2RDI A;  1BVS A;  1WCN A;  2NRX A;  1ZQH A;  5KT3 A;  8ICM A;  4DSF A;  1CEZ A;  3PMN A;  3RH4 A;  2J6T A;  5DG8 A;  2BQU A;  4YXJ A;  4YN4 A;  4K4H A;  4I2I A;  5DDM A;  5CA7 A;  2ZJ5 A;  4Q45 A;  5KFY A;  4UB1 A;  2A1J A;  4DEZ A;  4PGQ A;  4DS4 A;  1NJZ A;  3PO4 A;  2W9M A;  5J2D A;  2W8K A;  2ALZ A;  2XGQ A;  3T5J A;  1ZQP A;  4EYH B;  5J2G A;  4KLH A;  2JZB B;  1TVA A;  4M9J A;  5DG9 A;  3PW5 A;  1MQ3 A;  4GXJ A;  1RXV A;  2KZZ A;  8ICN A;  1RPL A;  3QZ8 A;  1SL0 A;  4UB3 A;  4HYK A;  9ICU A;  3ISC A;  4J9N A;  4YD1 A;  1X2I A;  5F9N A;  5KFE A;  3OGU A;  4PH5 A;  1D8L A;  4J9K A;  2BCS A;  4EZ6 A;  4Q44 A;  4MFF A;  8ICJ A;  4GC7 A;  5EOZ A;  1T3N A;  1K1Q A;  1SKW A;  4GLX A;  4ELT A;  9ICF A;  1KFT A;  2RDJ A;  5KG3 A;  1SKS A;  5BOM A;  3QEA Z;  3RH6 A;  5J0X A;  3QE9 Y;  4KLE A;  4KLJ A;  5J2I A;  2XY7 A;  4NY8 A;  5EWF A;  2BCR A;  5KFG A;  4J9Q A;  9ICL A;  1NOM A;  4F4Y A;  5CR0 A;  4FBU A;  3ISD A;  3V7L A;  1JIH A;  1U49 A;  3BDP A;  4KLG A;  1KDH A;  1D9F A;  2NRZ A;  1S0V A;  4F5Q A;  3RJG A;  2XY5 A;  3T3F A;  2P6U A;  4QWB A;  1KTQ A;  2BCU A;  3C21 A;  5DG7 A;  5DB8 A;  4EBC A;  3TFR A;  3C23 A;  4Z6F A;  7ICL A;  1COO A;  4M47 A;  2KFN A;  5HML A;  2HHU A;  8ICT A;  3BQ1 A;  5KTQ A;  3T5K A;  4KLL A;  4IQV A;  3RJJ A;  3AU2 A;  5DB7 A;  4XRH A;  1RYS A;  1S0N A;  2JEF A;  4JV1 A;  4PPX A;  4ED3 A;  4LZD A;  1Z3E B;  1DGS A;  4M6W A;  4M6W B;  2XY6 A;  5IIK A;  3UPQ A;  3SYZ A;  1XSL A;  4P4P A;  2Q0Z X;  2BQ3 A;  5KFX A;  2NRV A;  4O5K A;  9ICH A;  3C2K A;  3Q8M A;  1UA0 A;  4QZI A;  5KFL A;  4JK1 A;  5KFT A;  2ASL A;  2P66 A;  2V9W A;  4F4Z A;  2VA3 A;  4Q8F A;  4YVZ A;  1TAQ A;  2Y1I A;  4KLF A;  1BGX T;  1UA1 A;  4DSK A;  3RB6 A;  5KG2 A;  1CUK A;  3EPG A;  4F5O A;  4UAW A;  4BDP A;  9ICS A;  5HHH A;  1X9S A;  7ICT A;  2W8L A;  5KG0 A;  3HW8 A;  4J9P A;  2AQ4 A;  1S10 A;  3JPN A;  2W9C B;  4KMU A;  5D49 A;  4YQW A;  4I27 A;  8ICI A;  3G6Y A;  2FPK A;  4Q8E A;  4FO6 A;  9ICN A;  3H4D A;  5L1L A;  2IMW P;  1X9M A;  5DLG A;  2C2D A;  3RJI A;  1JX4 A;  5BOL A;  3MDA A;  4F50 A;  4BXO A;  3JPP A;  4TQS A;  1S76 D;  5KFM A;  5CWR A;  4PHP A;  3PNC A;  3RBE A;  4DSI A;  5KFN A;  2XGP A;  3ZDB A;  4DL7 A;  5J0W A;  7ICK A;  1BPB A;  3H8S A;  5KFK A;  5KFA A;  4UQG A;  4Z6E A;  1U4B A;  3JPS A;  3MR6 A;  4DL6 A;  2R8K A;  3QZ7 A;  7ICM A;  2LYH A;  1KRP A;  4ECW A;  1ZQQ A;  8ICX A;  8ICQ A;  3UXO A;  4GC6 A;  2R8J A;  5L1I A;  5KFO A;  2KN7 A;  3EW9 A;  1Y88 A;  1NJW A;  1ZQI A;  4DL4 A;  4QZH A;  4F5R A;  2J6S A;  3MR2 A;  3TAN A;  5CJ7 A;  8ICR A;  2W9B B;  5J0U A;  3PW4 A;  1SL1 A;  4IRD A;  4MF8 A;  2FMS A;  3KTQ A;  4DQR A;  4I2G A;  2HVI A;  5HMM A;  4MEY A;  2XC9 A;  4RZR A;  1XSN A;  4MFC A;  3TAQ A;  4TUS A;  7ICF A;  7ICE A;  4RNM A;  4NLK A;  4PGY A;  5EWG A;  3ZDC A;  3C1Y A;  4I2J A;  3BQ0 A;  5J2K A;  1S97 A;  4NLN A;  8ICK A;  3EYZ A;  2KFZ A;  3HT3 A;  2R8G A;  1ZQC A;  4EYI B;  2PI5 A;  4QWA A;  3UQ0 A;  4TQR A;  4RQ5 A;  3MBY A;  5III A;  2VAN A;  5J2F A;  2FLL A;  4TUQ A;  5IIN A;  4IRK A;  4M04 A;  3JPQ A;  4EZ9 A;  4ZH4 A;  3Q8K A;  4ECR A;  4M9G A;  5J0T A;  1TV9 A;  4KLM A;  2HW3 A;  1WCL A;  3IHQ B;  4RQ1 A;  5IIM A;  2DFL A;  3ETL A;  3OSN A;  4YMO A;  4NLG A;  1ZQN A;  3OHA A;  1BPD A;  4QWD A;  2VA2 A;  4PHA A;  1C7Y A;  1NK9 A;  2C2E A;  1L3U A;  3GIJ A;  3RBD A;  3GDX A;  4DOB A;  3TI0 A;  4RPX A;  5IIO A;  3MGI A;  4J9L A;  4DL2 A;  1NK4 A;  4I2B A;  9ICI A;  7ICQ A;  2ZTE A;  3V7J A;  5TZV A;  2A1J B;  5KFJ A;  5DBB A;  5J2B A;  4UB5 A;  4RNN A;  4C8L A;  3TFS A;  2AJQ A;  4NXZ A;  3C2M A;  2JEI A;  4EBE A;  4QZC A;  3HX0 A;  3RRG A;  5BPC A;  2FPM A;  4UB4 A;  4B9M A;  3V72 A;  3M9M B;  1ZQZ A;  4B9N A;  2HVH A;  2FMQ A;  9ICK A;  3PW7 A;  2F1J A;  4KN4 A;  5DGA A;  2ATL A;  1NK7 A;  3H4B A;  4ECX A;  4ECZ A;  4Q43 A;  3EPI A;  1ZJM A;  3PO5 A;  4G3I A;  4F93 B;  3V6J A;  4YXM A;  9ICE A;  8ICU A;  4DO9 A;  1NK5 A;  1ZQM A;  4I2D A;  3HPO A;  3G6X A;  5HP4 A;  1ZQD A;  4O3S A;  4ECU A;  3V7K A;  4TUP A;  5KFQ A;  7ICG A;  5F9L A;  4R66 A;  4O3N A;  3HP6 A;  4MEX A;  4PGX A;  1EXN A;  2ISP A;  1JXE A;  2XO7 A;  4TUR A;  3MGH A;  4O3Q A;  3THV A;  3RAX A;  3PR5 B;  4F92 B;  4ED2 A;  4ED8 A;  1N56 A;  1QSY A;  4DOA A;  3E2E A;  1ZQX A;  1QSS A;  4ELU A;  8ICG A;  4DFM A;  4EEY A;  3LWM A;  1RZT A;  5DGB A;  3IM1 A;  3ISB A;  4DF4 A;  3HWT A;  3TAP A;  2ASD A;  3PW0 A;  4B9T A;  4MFA A;  4ECS A;  5KT7 A;  7ICH A;  2HHT A;  4IQT A;  1NKB A;  4DOC A;  1RYR A;  2MUT A;  4RPY A;  5KT4 A;  4J9S A;  5L1J A;  5KFC A;  3PX4 A;  1U47 A;  7ICS A;  5J2C A;  2BPG A;  5KFV A;  1ZQS A;  1MC8 A;  5J2J A;  1T7P A;  1KEJ A;  4RQ6 A;  1D8Y A;  3C5G A;  4FS2 A;  5KFH A;  3RRH A;  4P4M A;  1T4G A;  4J9R A;  4DLE A;  5J0Y A;  1NJY A;  4R63 A;  4RU9 A;  1ZQG A;  4B9S A;  3LK9 A;  4I2H A;  4DSE A;  4J9M A;  3K4G A;  2BDP A;  3RJE A;  5KFP A;  1S9F A;  1ZQA A;  3RJK A;  4JWN A;  8ICB A;  2H5X A;  4DF8 A;  4M9N A;  2AGP A;  2ZUD A;  2ZTC A;  1JXL A;  4JV2 A;  1NJX A;  7ICI A;  5JUM A;  3OHB A;  4UB2 A;  8ICS A;  3M8R A;  3BJY A;  1JMS A;  1B22 A;  4M0A A;  1XWL A;  4ECQ A;  4BXO B;  3KHH A;  2ASJ A;  2PFQ A;  3PX6 A;  9ICG A;  4E0D A;  1L3T A;  2ZJ8 A;  3Q8Q B;  5DQI A;  5IIJ A;  3RR7 A;  4JV0 A;  4O3O A;  4RQ8 A;  3SV4 A;  4DWI A;  4O3R A;  2F1I A;  3RAQ A;  1ZQO A;  1ZJN A;  5KT2 A;  4YFK A;  2Y1J A;  3ORY A;  3AU6 A;  2C28 A;  4F91 B;  5D46 A;  3PR4 A;  1Z00 A;  4RNO A;  3KHG A;  3GQC A;  4ED7 A;  2I9G A;  4KLI A;  5KFF A;  5J2H A;  4B9U A;  2HHW A;  2WTF A;  4XA5 A;  7ICP A;  1ZQJ A;  5KT6 A;  4DFP A;  2IBK A;  4JUZ A;  4DQQ A;  1SZP A;  1U9L A;  3GFK B;  4BWM A;  4QWC A;  3Q8P B;  4DL3 A;  3N4M B;  5DDY A;  1QSL A;  4M9H A;  7ICR A;  2GWS A;  8ICZ A;  3FDS A;  3MFH A;  5KFB A;  7ICO A;  1LV5 A;  4QW9 A;  3LWL A;  3C5F A;  2R8H A;  1TKD A;  9ICB A;  5KFS A;  1S77 D;  1JN3 A;  1XO1 A;  3ZDD A;  4F4K A;  4QZG A;  2R8I A;  3G6V A;  1NKE A;  4YMN A;  2P6R A;  4ED1 A;  4KN7 A;  4RQ0 A;  4F3O A;  2KZ3 A;  1UT8 A;  1MSW D;  4LZG A;  4RUC A;  5J2E A;  1IM4 A;  4YR3 A;  3SI8 A;  3RB0 A;  1ZQW A;  2B21 A;  1QTM A;  2FLP A;  5DBC A;  4KLD A;  3B0Y A;  4RT2 A;  4QZ9 A;  1ARO P;  1SL2 A;  4NM1 A;  4NLZ A;  3NGD A;  1HUO A;  3GV8 B;  2DPI A;  5L1K A;  4IR1 A;  8ICP A;  3ZDE A;  3N97 B;  9ICM A;  5DQG A;  4F4W A;  2BKE A;  1S0M A;  4M9L A;  3MFI A;  4I2A A;  5J29 A;  2M9N A;  3B0X A;  1N48 A;  2UVV A;  8ICA A;  9ICJ A;  9ICO A;  3QEB Z;  4QZA A;  1H38 A;  3RTV A;  3RR8 A;  8ICV A;  1TFR A;  8ICO A;  1KFS A;  2AU0 A;  3UXP A;  4ED6 A;  1KSP A;  4Z6D A;  1TK8 A;  4QZD A;  4QWE A;  3ZD9 A;  2I1Q A;  3T5L A;  1QLN A;  1ZQE A;  4QZE A;  2MAX A;  4RQ7 A;  4XUS A;  5DBA A;  2HHQ A;  4I2C A;  3TQ1 A;  4ECY A;  3V6H A;  4M2Y A;  2BHN A;  3RB4 A;  4O5E A;  5KG6 A;  3H8W A;  2ZUB A;  3H7I A;  9ICP A;  2KZM A;  1TK5 A;  3ZDA A;  9ICR A;  9ICA A;  4QZF A;  4RUA A;  4PHD A;  1T8E A;  1D9D A;  4KTQ A;  1TK0 A;  3RJF A;  3PX0 A;  1ZQB A;  1RXW A;  3ZD8 A;  2JZB A;  5D4B A;  2IA6 A;  5J0P A;  2J6U A;  2AQ0 A;  2ZJA A;  4YG2 A;  4EBD A;  4K4G A;  1XU4 A;  3GII A;  5DB9 A;  1ZQF A;  1X9W A;  1S0O A;  1B43 A;  3RB3 A;  2C2R A;  2UVU A;  2XCA A;  5HNK A;  2C22 A;  3M9N B;  8ICE A;  1KLN A;  9ICX A;  3C2L A;  2NRW A;  5KFU A;  5J2A A;  7ICU A;  2FLN A;  2IHM A;  8ICF A;  4RQ4 A;  4UAY A;  1LB2 B;  2IHN A;  1ZQT A;  4ELV A;  1SKR A;  3EWA A;  5C5J A;  4KLO A;  2ISO A;  2ZUC A;  4DS5 A;  9ICC A;  3OJS A;  2NRT A;  4YMM A;  4DSL A;  2UVR A;  3LDA A;  3PW2 A;  3MDC A;  4R65 A;  2MUT B;  3FYH A;  4YD2 A;  1ZQL A;  4YP3 A;  4UAZ A;  3H8J A;  4I2F A;  4Z6C A;  4FS1 A;  1ZYQ A;  4JWM A;  3GV7 B;  2JEG A;  3KHL A;  5DB6 A;  1ZQR A;  4IRC A;  4ED0 A;  4MF2 A;  3UQ2 A;  3PY8 A;  2W9A A;  2PXI A;  4F4X A;  1ZQK A;  1TAU A;  1XC9 A;  5IIL A;  5KG7 A;  4O3P A;  4DQI A;  3PV8 A;  5KG4 A;  2FMP A;  2PFP A;  4IR9 A;  5KG1 A;  4KIT B;  1NK0 A;  1U45 A;  1A77 A;  1NKC A;  2HHV A;  2BGW A;  4QZ8 A;  4O0I A;  1ZQV A;  2FPL A;  4I28 A;  3V6K A;  9ICQ A;  1BPE A;  4I2E A;  2AGO A;  1NK6 A;  4YCX A;  1BPZ A;  5KFR A;  3PVX A;  1L3V A;  2PFO A;  4BGD A;  4B9L A;  4RQ3 A;  3GIL A;  4IQU A;  3RJH A;  8ICC A;  4DL5 A;  4B9V A;  2XCP A;  2V4Q A;  5J0S A;  2BCQ A;  1ZQY A;  1BPY A;  1ZET A;  3JPO A;  3BQ2 A;  3RH5 A;  3H40 A;  5CP2 A;  4DSJ A;  2W9C A;  8ICY A;  1Z00 B;  4F5P A;  9ICV A;  1IXR A;  5KFZ A;  4R8U A;  3M9O B;  3OJU A;  4R8U B;  5EWE A;  1L3S A;  2AGQ A;  2BPC A;  5KT5 A;  2HHS A;  9ICW A;  1A76 A;  2JEJ A;  2ZTD A;  4QW8 A;  3PML A;  5J0R A;  4NM2 A;  4PHE A;  4ECT A;  1BPX A;  2OWO A;  4C8N A;  2BR0 A;  1PZN A;  4O9M A;  3MAB A;  4DFK A;  1XS9 D;  1U48 A;  1L5U A;  4C8M A;  5J0O A;  3M8S A;  4FBT A;  2BQR A;  3KHR A;  2BPF A;  4UBC A;  4ECV A;  5KG5 A;  1MQ2 A;  4CCH A;  2KTQ A;  3C1Z A;  3BQT A;  4YR2 A;  4LVS A;  3EZ5 A;  4DQS A;  9ICT A;  4J9O A;  1XSP A;  5DQH A;  3UXN A;  4QZB A;  3Q8S B;  4P4O A;  4RPZ A;  5DLF A;  2BCV A;  3Q8L A;  4KLS A;  8ICW A;  3Q8R B;  2W9B A;  3JPR A;  2VA8 A;  4YR0 A;  4C8K A;  3GV5 B;  3OSP A;  1K1S A;  4R64 A;  5KFI A;  4C8O A;  3K75 D;  1HUZ A;  8ICL A;  1V9P A;  5J0Q A;  3T5H A;  4DFJ A;  4I29 A;  2F1H A;  3SZ2 A;  4F2S A;  2HHX A;  5L9X A; 
#chains in the Genus database with same CATH topology
 3JPT A;  2DF4 B;  4O5C A;  2UVW A;  2PFN A;  4BWJ A;  4DQP A;  2KK0 A;  7ICV A;  4UBB A;  2JV3 A;  5ALW A;  2DPJ A;  5KFD A;  3M6Z A;  4GXK A;  8ICH A;  4P2H A;  1FO4 A;  1JAL A;  3I1Y A;  3TAR A;  1V38 A;  3A0B U;  4CDG A;  5ALO A;  3HRD D;  2RDI A;  1BVS A;  1L8L A;  5KT3 A;  8ICM A;  3RH4 A;  3N28 A;  5DG8 A;  2BQU A;  4Q45 A;  4UB1 A;  5KFY A;  4FZN A;  2A1J A;  3D6J A;  2W9M A;  5J2D A;  2ALZ A;  3QU7 A;  5J2G A;  2KZZ A;  1IIP A;  3PW5 A;  1RXV A;  2H3V A;  3SAF A;  5ALR A;  3OGU A;  5F9N A;  1WYG A;  4PH5 A;  1D8L A;  2BCS A;  4EZ6 A;  4MFF A;  4CF5 A;  4GC7 A;  2KEY A;  9ICF A;  2OCE A;  5J0X A;  3QE9 Y;  4KLJ A;  5ALI A;  1S5L U;  9ICL A;  3K1R B;  4FBU A;  2FJ6 A;  3ISD A;  3WKA A;  1U49 A;  1D9F A;  4F5Q A;  3NVV A;  2XY5 A;  4QWB A;  3SAG A;  4EBC A;  3TFR A;  4Z6F A;  5A0L A;  2WHE A;  8ICT A;  1A6S A;  3TKA A;  3RJJ A;  3AU2 A;  5AKK A;  2KSO A;  2BQ3 A;  5KFX A;  4O5K A;  4QZI A;  5KFL A;  5KFT A;  1WG8 A;  3AEV A;  2VA3 A;  4KLF A;  4Y2S A;  3EPG A;  4UB8 U;  2L5Y A;  2AQ4 A;  2EDU A;  8ICI A;  5D49 A;  4YQW A;  1CI4 A;  9ICN A;  3O0F A;  5DLG A;  2C2D A;  3MDA A;  1NZP A;  1PVP A;  3UM9 A;  5AK6 A;  4PHP A;  4FFD A;  7ICK A;  1Q8K A;  3ED5 A;  3WKB A;  1U4B A;  3JPS A;  1VDV A;  7ICM A;  3HKZ F;  1YT3 A;  2R8J A;  5L1I A;  3M7D A;  3EW9 A;  1Y88 A;  1NJW A;  2J6S A;  4AYB C;  5CEH A;  5CJ7 A;  8ICR A;  5J0U A;  3PW4 A;  1SL1 A;  8ICP A;  2FMS A;  1X6J A;  2HVI A;  3QUC A;  3TAQ A;  3QNM A;  3L4P A;  4I2J A;  4NLN A;  2R8G A;  1ZD5 A;  3UQ0 A;  4TQR A;  4RQ5 A;  3MBY A;  2IOH A;  4M04 A;  4EZ9 A;  4NV0 A;  1WCL A;  3IHQ B;  3LYS A;  3ETL A;  3OSN A;  2WAQ F;  1SB3 C;  1SXD A;  3RBD A;  3TI0 A;  4RPX A;  1NK4 A;  4J9L A;  5TZV A;  2A1J B;  5J2B A;  4NL9 A;  2WF7 A;  2JEI A;  2EAP A;  2FPM A;  4Y2J A;  4B9M A;  3V72 A;  1KBU A;  5HR6 A;  2OM6 A;  1NK7 A;  2JMG A;  4G3I A;  4F93 B;  5C0Y A;  3G6X A;  1ZQD A;  4TUP A;  1DK3 A;  3HP6 A;  1JXE A;  3RAX A;  4TUR A;  3PR5 B;  1N56 A;  2GH1 A;  1QSY A;  1P7D A;  8ICG A;  2YQE A;  2H3I A;  4DFM A;  3LWM A;  4NWI A;  4B9T A;  4ECS A;  2W43 A;  4J9S A;  3PX4 A;  2KOB A;  3KD3 A;  1T7P A;  5AI8 A;  1FEZ A;  5ALD A;  5EE9 A;  1ZQG A;  4DLE A;  5ALF A;  2FDR A;  3K4G A;  2YMM A;  1S9F A;  3RJK A;  1SV4 A;  4DF8 A;  8ICS A;  3QUT A;  4ECQ A;  2ASJ A;  2DUY A;  3RR7 A;  4JV0 A;  3SV4 A;  2F1I A;  3RAQ A;  1ZJN A;  5KT2 A;  3ORY A;  4QNL A;  1J2N A;  2FE9 A;  4F91 B;  1Z00 A;  3GQC A;  5KFF A;  4MHV A;  4B9U A;  1L7O A;  2K8A A;  1SZP A;  4DL3 A;  1QSL A;  4M9H A;  2GWS A;  4FZM A;  1TKD A;  2YMP A;  2EQY A;  2W3R A;  1S77 D;  2KKP A;  2R8I A;  3F5E A;  4KN7 A;  2QB0 B;  5AKJ A;  2K4E A;  4LZG A;  2K8B B;  2XVT A;  4YR3 A;  3SI8 A;  4BX9 C;  2WB1 F;  3RB0 A;  1ZQW A;  2FLP A;  5AM4 A;  5ALX A;  5L1K A;  3H0R B;  1SGG A;  1T94 A;  1K5O A;  9ICM A;  1PK3 A;  1S0M A;  3IRU A;  1N48 A;  2YMQ A;  2CPR A;  1RQN A;  1H38 A;  1KFS A;  1J97 A;  1DRG A;  1KSP A;  1ZQ1 C;  4OJO A;  1QLN A;  4UAR A;  3QUB A;  3TQ1 A;  1V97 A;  2BHN A;  3RB4 A;  5KG6 A;  1X9X A;  3NUQ A;  2JH1 A;  2IOF A;  9ICA A;  4QZF A;  4RUA A;  3RF9 A;  1TK0 A;  3RJF A;  4U6P A;  2OEH A;  4K4G A;  3GII A;  1B43 A;  2K8C B;  2D6F C;  1KLN A;  9ICX A;  5KFU A;  5ALT A;  2WFA A;  2FLN A;  8ICF A;  4UAY A;  1LKY A;  4ELV A;  5C5J A;  4OJ5 A;  2ZUC A;  9ICC A;  2G07 A;  2NRT A;  4KX5 A;  2ODG A;  2MA1 A;  4P0P A;  4R65 A;  2HSZ A;  4YD2 A;  4Z6C A;  4FS1 A;  5DB6 A;  4ED0 A;  3BS5 A;  2EAO A;  2PXI A;  1ZQK A;  1TAU A;  5KG7 A;  3AQF A;  3PV8 A;  4KIT B;  1COK A;  1NK0 A;  1ZD4 A;  4PL1 A;  4QZ8 A;  2FPL A;  2W04 A;  4EEL A;  1SIJ A;  4I2E A;  1NK6 A;  1URJ A;  2RP5 A;  5KFR A;  3PVX A;  1SV0 C;  3NVW A;  1L3V A;  2PFO A;  8ICC A;  1WUD A;  2XCP A;  1WWU A;  4RQN A;  1SXE A;  3RH5 A;  5CP2 A;  4B6J A;  3IP4 B;  1Z00 B;  1IXR A;  2H3F A;  2KIV A;  3M9O B;  3OJU A;  5KT5 A;  2HHS A;  4ACO A;  4PZN A;  1U48 A;  2IOF K;  1OW5 A;  3DV9 A;  1L5U A;  4FBT A;  2BQR A;  2BPF A;  4YR2 A;  1QCK A;  9ICT A;  4USA A;  1XSP A;  5DQH A;  3Q8R B;  3KZX A;  2GLE A;  2HOI A;  1O03 A;  2E3T A;  4R64 A;  5KFI A;  4DFJ A;  3T5H A;  2HHX A;  4DL6 A;  2AXT U;  2ZG6 A;  1LVH A;  5KFW A;  4F5N A;  5AKE A;  3MR3 A;  3GIM A;  2PI4 A;  3ETR A;  4KLU A;  4EX7 A;  3NVY A;  3AUO A;  2V4R A;  2OXO A;  3CYM A;  4K4H A;  4I2I A;  3SR6 A;  5F3X B;  1VJ5 A;  2E8M A;  3QU9 A;  3CRX A;  2R18 A;  4QIW F;  3T5J A;  1ZQP A;  1BNP A;  4KLH A;  1TVA A;  4M9J A;  3SQI A;  8ICN A;  1MQ3 A;  2NO4 A;  1F44 A;  2YX8 A;  9ICU A;  3ISC A;  1BNO A;  1L7M A;  4YD1 A;  5KFE A;  4J9N A;  4IS7 A;  4Q44 A;  1OXJ A;  3PSF A;  1T3N A;  2K89 A;  2XIC A;  2RDJ A;  4UAT A;  3RH6 A;  1QQ7 A;  5J2I A;  2XY7 A;  2EZZ A;  1N62 A;  2KV2 A;  5EE1 A;  1JIH A;  3OPX A;  4P0P B;  4KLG A;  1N63 A;  2NRZ A;  2KJ5 A;  3B9J A;  4Y2X A;  2P6U A;  1X66 A;  1JRO A;  2DQN B;  1ECW A;  3BS5 B;  2KHQ A;  2KFN A;  1ZD2 P;  2HHU A;  5AM0 A;  1F0M A;  5KTQ A;  4KLL A;  3HKZ C;  4PPX A;  4ED3 A;  1FIQ A;  3VCB A;  5ALE A;  1XSL A;  3QX7 A;  9ICH A;  1Z4N A;  4Q8F A;  4YVZ A;  5KAI U;  2KMD A;  1YZ7 A;  4DSK A;  1UA1 A;  5KG2 A;  4UAW A;  4BDP A;  5HHH A;  1N61 A;  5KG0 A;  2HMX A;  2KHV A;  2G08 A;  4CGZ A;  4I27 A;  4Q8E A;  2HDO A;  4FO6 A;  3KZI U;  1X9M A;  1JX4 A;  1X42 A;  1S76 D;  1RYU A;  2YY6 A;  3RBE A;  4DSI A;  1B0X A;  4DL7 A;  1BPB A;  5KFA A;  3MR6 A;  2R8K A;  3QZ7 A;  2WAQ C;  1ZQQ A;  3CNH A;  4GC6 A;  2K4H A;  4NJ8 A;  5GTI U;  5KFO A;  4QZH A;  3MR2 A;  2ESE A;  4Y2R A;  4IRD A;  4DQR A;  5HMM A;  3I76 A;  4MEY A;  4RZR A;  7ICF A;  4TUS A;  4RNM A;  5KAF U;  3BQ0 A;  1ZQC A;  2YN4 A;  4TUQ A;  1XO0 A;  4M9G A;  5J0T A;  1Z4O A;  4RQ1 A;  5IIM A;  2DFL A;  3H0L B;  4CNQ A;  4YMO A;  4NLG A;  1ZQN A;  2VA2 A;  1C7Y A;  1NK9 A;  3MGV A;  3GDX A;  4DOB A;  2KKV A;  7ICQ A;  1UHU A;  3DEE A;  5DBB A;  2E1E A;  4RNN A;  3TFS A;  2P35 A;  2AJQ A;  3C2M A;  4QZC A;  1NI3 A;  4KMO B;  2HVH A;  2FMQ A;  9ICK A;  5ALP A;  2CXY A;  2MRL A;  3H4B A;  4Q43 A;  3EPI A;  1ZJM A;  5AM3 A;  2RQ5 A;  4CF3 A;  4DO9 A;  4JB3 A;  4C7Y A;  3F53 A;  3PST A;  4I2D A;  5ALJ A;  3HPO A;  5HP4 A;  4O3S A;  5KFQ A;  3VC8 A;  4O3N A;  2ISP A;  2XO7 A;  3MGH A;  4C80 A;  2KE7 A;  1RZT A;  2NO5 A;  1RQL A;  3IM1 A;  4DF4 A;  3HWT A;  2ASD A;  3QU4 A;  7ICH A;  2HHT A;  4IQT A;  5ALU A;  1NKB A;  4DOC A;  1RYR A;  2XI9 A;  4RPY A;  5EE3 A;  1U47 A;  5KFC A;  4NL9 C;  5KFV A;  1MC8 A;  1D8Y A;  3T79 A;  4FS2 A;  5KFH A;  3RRH A;  4P4M A;  1T4G A;  4J9R A;  1NJY A;  2J6U A;  4R63 A;  2VJ4 A;  1JUD A;  4J9M A;  1KW4 A;  5J8Y A;  2BDP A;  1ZQA A;  1QQ6 A;  2A1A A;  2CRX A;  4M9N A;  2ZTC A;  2F2A B;  5ALZ A;  4JV2 A;  1NJX A;  5JUM A;  4UB2 A;  5GTH U;  3WU2 U;  1Z19 A;  4UB6 U;  1XWL A;  1KN5 A;  2PFQ A;  3WKE A;  9ICG A;  2ZJ8 A;  3Q8Q B;  2WB1 C;  4RQ8 A;  4O3R A;  4YFK A;  3AU6 A;  2C28 A;  3WK5 A;  2QAR B;  5D46 A;  3KHG A;  4KLI A;  5J2H A;  1V85 A;  2WTF A;  4XA5 A;  4O3M A;  4DFP A;  2IBK A;  4Y2U A;  4DQQ A;  5DDY A;  8ICZ A;  3FDS A;  5KFB A;  2HBJ A;  1LV5 A;  3F2B A;  9ICB A;  5KFS A;  2DGZ A;  1JN3 A;  5AKG A;  3G6V A;  2QB0 A;  2P6R A;  4ED1 A;  4RQ0 A;  1MSW D;  5J2E A;  1RG6 A;  1QTM A;  3B0Y A;  5AHX A;  4QZ9 A;  1SL2 A;  4NM1 A;  3NGD A;  2DPI A;  3GV8 B;  3ZDE A;  2JHD A;  3B0X A;  3QEB Z;  3RTV A;  5ALN A;  1TFR A;  4ED6 A;  1TK8 A;  4QZD A;  4QWE A;  3ZD9 A;  2MAX A;  4RQ7 A;  5DBA A;  2ZIU A;  3H7I A;  2KZM A;  3ZI4 A;  4F72 A;  5ALK A;  5AKX A;  3ZDA A;  9ICR A;  1IV8 A;  4P0Q A;  2RHF A;  4Y2V A;  1RXW A;  1Q3V A;  4HAI A;  5D4B A;  5J0P A;  2ZJA A;  3BZK A;  4YG2 A;  1D8B A;  5DB9 A;  1X9W A;  1S0O A;  2UVU A;  2C22 A;  2DKX A;  4CF4 A;  4WJ3 B;  3C2L A;  5J2A A;  3D2N A;  5HR7 A;  7ICU A;  1LB2 B;  1ZQT A;  1SKR A;  3EWA A;  2ISO A;  3PSP A;  4DS5 A;  3OJS A;  2LPE A;  4EEN A;  3LDA A;  1C20 A;  4YP3 A;  5CRX A;  4I2F A;  1UPH A;  1ZYQ A;  5AI9 A;  1ZQR A;  4IRC A;  4MF2 A;  1RM6 C;  3L3F X;  4F4X A;  5AK5 A;  4IR9 A;  5KG4 A;  2FMP A;  3F5A A;  3LVW A;  1N2X A;  4O0I A;  2YB1 A;  1Q46 A;  1ZQV A;  3V6K A;  3GZF A;  2AGO A;  1BPZ A;  1KKX A;  3RJH A;  3BZC A;  2Y0S F;  2LYA A;  4B9V A;  1ZET A;  2E5S A;  5FP0 A;  2BZF A;  3H40 A;  8ICY A;  9ICV A;  5KFZ A;  1L3S A;  5EWE A;  9ICW A;  1A76 A;  4QW8 A;  3PML A;  4NM2 A;  1PZN A;  3MAB A;  4C8M A;  3M8S A;  2LHT A;  4ECV A;  4CCH A;  2E8P A;  3BQT A;  2EZX A;  4DQS A;  4J9O A;  3UXN A;  3AMZ A;  4RPZ A;  2EAN A;  3Q8L A;  2OH2 A;  4KLS A;  2VA8 A;  4QIW C;  2EZY A;  3OSP A;  2DKZ A;  1K1S A;  4C8O A;  2I5H A;  2F76 X;  1HUZ A;  1V9P A;  1L7P A;  2D8C A;  4F2S A;  2F1H A;  5L9X A;  2NYV A;  2ZIW B;  1B4F A;  5CB1 A;  1ZQU A;  4DLG A;  4KLQ A;  4F2R A;  5DKW A;  3GU3 A;  2VIX A;  2YTU A;  1NK8 A;  1DOQ A;  4PZO A;  4K4I A;  1L8O A;  4Y2T A;  4IQW A;  5AIA A;  2HOF A;  5AM5 A;  4US8 A;  4EEK A;  4DSF A;  1CEZ A;  2K60 A;  2ZIU B;  2J6T A;  5DDM A;  5CA7 A;  2ZJ5 A;  4DEZ A;  3F2D A;  3QYP A;  5ALH A;  5E79 U;  4P0Q B;  2XGQ A;  2H3Z A;  4EYH B;  2K4P A;  2JRZ A;  3J81 j;  4GXJ A;  1RPL A;  1SL0 A;  2Q4T A;  1X2I A;  8ICJ A;  1IG6 A;  5EOZ A;  1N60 A;  5JRT A;  3PSI A;  4ELT A;  3SEN A;  5JU5 A;  4J9Q A;  3FC4 A;  2LKY A;  5AI0 A;  3BDP A;  2QKQ A;  3RJG A;  1KTQ A;  5DG7 A;  5JTI A;  2RRD A;  3C23 A;  3D2S A;  7ICL A;  1COO A;  4M47 A;  3BQ1 A;  3PZP A;  4XRH A;  1S0N A;  4JV1 A;  4LZD A;  1NZB A;  1DGS A;  4M6W B;  2XY6 A;  1T3Q A;  2Y9T A;  2Q0Z X;  2NRV A;  3Q8M A;  1UA0 A;  2KVC A;  4JK1 A;  2P66 A;  5AIB A;  4F4Z A;  2Y1I A;  3QU5 A;  3RB6 A;  1CUK A;  1FFU A;  2HBM A;  4F5O A;  2Z7J A;  1X9S A;  7ICT A;  2W8L A;  1PVR A;  1S10 A;  3JPN A;  4KMU A;  3G6Y A;  2FPK A;  3LVV A;  5L1L A;  4BXO A;  4F50 A;  3JPP A;  4TQS A;  5CWR A;  2XGP A;  5KFK A;  3E0F A;  8ICX A;  3SAH A;  2KN7 A;  1ZQI A;  4DL4 A;  4F5R A;  3UMG A;  3TAN A;  4I2G A;  7ICE A;  3FAH A;  4NLK A;  4PGY A;  5EWG A;  3ZDC A;  1F5S A;  8ICK A;  3EYZ A;  3HT3 A;  2JXJ A;  1UQV A;  2PI5 A;  2KIC A;  2VAN A;  2DWQ A;  5J2F A;  2FLL A;  3JPQ A;  4ZH4 A;  3Q8K A;  1OUQ A;  1PK1 A;  1CRX A;  4KLM A;  2HW3 A;  4IL6 U;  3NRZ A;  4PHA A;  2WF5 A;  1L3U A;  5EE0 A;  2HBL A;  5IIO A;  2ZTE A;  1SZH A;  5KFJ A;  4UB5 A;  4US9 A;  3HX0 A;  4C0Z A;  3RRG A;  3NAS A;  5BPC A;  4UB4 A;  1ZQZ A;  4B9N A;  3KFU F;  2F1J A;  1NNL A;  4KN4 A;  2ATL A;  4ECX A;  4ECZ A;  3TAD C;  2JGA A;  1WWV A;  5ALL A;  4YXM A;  1ZRM A;  4LJX A;  9ICE A;  1NK5 A;  3CW2 C;  2LBO A;  4ECU A;  2KVS A;  1ZOL A;  7ICG A;  5F9L A;  4OO1 J;  1EXN A;  3WKD A;  3THV A;  4O3Q A;  4F92 B;  3QXG A;  1HEK A;  3NS1 A;  5DGB A;  3ISB A;  3TAP A;  2MUT A;  3TAC B;  2H3Q A;  4OJL A;  5J2C A;  2BPG A;  1ZQS A;  4RQ6 A;  3WK9 A;  5J0Y A;  4RU9 A;  4I2H A;  4DSE A;  5KFP A;  2A3V A;  4JWN A;  8ICB A;  1JXL A;  3OHB A;  3M8R A;  3BJY A;  1B22 A;  4M0A A;  5AI6 A;  4NLC A;  1RDF A;  4BXO B;  3KHH A;  4E0D A;  2ES6 A;  4O3O A;  3AM9 A;  1ZQO A;  2F44 A;  2QAR A;  4C7Z A;  4JUZ A;  1U9L A;  4BWM A;  4C4R A;  3N4M B;  1PVQ A;  7ICR A;  3A0H U;  3N7S C;  3TAD A;  4QW9 A;  1ZXI A;  3C5F A;  2LMR A;  4C4T A;  5ALV A;  1O08 A;  3ZDD A;  4JMU A;  1ZD3 A;  2MSN A;  4QZG A;  5J8Y C;  4YMN A;  4ZOH C;  4F3O A;  2KZ3 A;  1IM4 A;  1PK1 B;  2B21 A;  5DBC A;  3FM9 A;  4NLZ A;  1HUO A;  5AM1 A;  2F8L A;  3N97 B;  2W54 A;  5DQG A;  4F4W A;  2BKE A;  4M9L A;  2KP7 A;  2YB4 A;  3R9K A;  2M9N A;  4I2A A;  3K1Z A;  2UVV A;  9ICO A;  2OHF A;  3F2C A;  2N1R A;  3M1Y A;  2AU0 A;  3UXP A;  5B5E U;  5H2F U;  2JH7 A;  4ICA A;  1ZQE A;  4QZE A;  4XUS A;  2HHQ A;  4M2Y A;  3V6H A;  3H8W A;  4CRX A;  2ZUB A;  4DFD A;  5ALQ A;  1TK5 A;  2LM1 A;  4PHD A;  1T8E A;  5TIS U;  3WK4 A;  2JZB A;  1MA7 A;  2NV3 A;  2IA6 A;  2AQ0 A;  4EBD A;  1XU4 A;  3KBB A;  3RB3 A;  5HNK A;  8ICE A;  2IHN A;  2Y0S C;  2PMZ F;  2LM4 A;  4J03 A;  4DSL A;  2HCF A;  5AKH A;  3MDC A;  3HJE A;  2MUT B;  1ZQL A;  4DCC A;  2W7P A;  3UMB A;  4JWM A;  2CN1 A;  3ALR A;  2E1F A;  3PY8 A;  2W9A A;  2G0A A;  2ZIV A;  1XC9 A;  5IIL A;  2PFP A;  2M0N A;  1TAM A;  1A77 A;  1NKC A;  2AH5 A;  4UAV A;  9ICQ A;  4YCX A;  2ZIX A;  2PKE A;  2V4Q A;  5G5G A;  1PUZ A;  5J0S A;  2BCQ A;  1ZQY A;  1KL9 A;  3BQ2 A;  2W9C A;  2F77 X;  4F5P A;  2WF6 A;  2EH9 A;  4R8U B;  2AGQ A;  2BPC A;  3C28 A;  1SWV A;  3UMC A;  2ZTD A;  2JEJ A;  2QLT A;  5J0R A;  4PHE A;  1BPX A;  2BR0 A;  4DFK A;  1XS9 D;  1SWW A;  1JI7 A;  5KG5 A;  1MQ2 A;  2KTQ A;  3C1Z A;  3AN1 A;  3EZ5 A;  5KL1 B;  3QU2 A;  5DLF A;  2BCV A;  8ICW A;  2W9B A;  2VJ5 A;  2WF8 A;  3K75 D;  8ICL A;  3SZ2 A;  3IDW A;  2ZIW A;  4GXI A;  5HHI A;  4RT3 A;  3MR5 A;  3SV3 A;  2G5H B;  5CHG A;  4X5V A;  7ICN A;  1HJP A;  1UT5 A;  5ALG A;  4C4S A;  1KFD A;  3QUQ A;  3GIK A;  7ICJ A;  4KLT A;  3NTU A;  4XQ8 A;  4RQ2 A;  4F8R A;  1WCN A;  2NRX A;  1ZQH A;  3WKC A;  4FZL A;  3PMN A;  4YXJ A;  4YN4 A;  3AL0 B;  4PGQ A;  1NJZ A;  4DS4 A;  3PO4 A;  4GFJ A;  2W8K A;  5B66 U;  2JZB B;  5DG9 A;  2B6G A;  3QZ8 A;  2HOQ A;  4UB3 A;  4HYK A;  3NRW A;  4J9K A;  1K1Q A;  1SKW A;  4GLX A;  3SEI A;  1KFT A;  5KG3 A;  1SKS A;  5BOM A;  3QEA Z;  4KLE A;  4NY8 A;  5EWF A;  2BCR A;  5KFG A;  3BS7 A;  4GIB A;  4Y2Y A;  1NOM A;  3I28 A;  4F4Y A;  5CR0 A;  3V7L A;  2D3D A;  1KDH A;  1S0V A;  3SD7 A;  3T3F A;  5AM2 A;  2BCU A;  3C21 A;  5DB8 A;  4PJ0 U;  5HML A;  2LI6 A;  4Y2Q A;  2ZIV B;  2A19 A;  3T5K A;  4IQV A;  5DB7 A;  1RYS A;  2JEF A;  1Z3E B;  4OCZ A;  4M6W A;  2KSO B;  5IIK A;  3UPQ A;  3SYZ A;  4P4P A;  3C2K A;  2V9W A;  3IG5 A;  2ASL A;  4PL2 A;  1TAQ A;  1BGX T;  2ZIX B;  9ICS A;  4UW9 A;  5AKL A;  4J9P A;  3HW8 A;  3AQE A;  4OJP A;  2W9C B;  3H4D A;  1AQ6 A;  2IMW P;  1YZ6 A;  3RJI A;  5BOL A;  3KOO A;  5KFM A;  3PNC A;  5KFN A;  3ZDB A;  5J0W A;  3H8S A;  4UQG A;  4Z6E A;  2LYH A;  1KRP A;  4ECW A;  4RQM A;  8ICQ A;  2EAM A;  3UXO A;  5AK3 A;  1DK2 A;  2W9B B;  1L6N A;  4MF8 A;  3KTQ A;  2XC9 A;  1XSN A;  4MFC A;  3C1Y A;  5J2K A;  1S97 A;  2KFZ A;  5AKI A;  4EYI B;  3BQ7 A;  3CP8 A;  2BDU A;  4QWA A;  5AKY A;  5III A;  5IIN A;  4IRK A;  1FFV A;  1Z1B A;  4ECR A;  1TV9 A;  1DXS A;  5AI4 A;  3DDH A;  3N7P D;  4KX3 A;  3OHA A;  1BPD A;  4QWD A;  1MN8 A;  2AHO B;  2C2E A;  3GIJ A;  4NLB A;  5ALS A;  4DL2 A;  3MGI A;  4I2B A;  9ICI A;  4AYB F;  3V7J A;  2W55 A;  2QB1 A;  2E8N A;  4C8L A;  3L5K A;  1ZRN A;  4NXZ A;  4EBE A;  1X40 A;  3NVZ A;  3M9M B;  2G09 A;  5KL8 B;  3PW7 A;  5DGA A;  3OTQ A;  2FI1 A;  3PO5 A;  1X6I A;  1Z1V A;  2JR5 A;  4EX6 A;  1ED1 A;  3ONN A;  1L7N A;  3V6J A;  8ICU A;  1ZQM A;  3KKA C;  3RFA A;  3V7K A;  4R66 A;  4MEX A;  3N7R C;  4PGX A;  2XID A;  4ED2 A;  3E2E A;  4ED8 A;  4DOA A;  1ZQX A;  1QSS A;  4ELU A;  4EEY A;  1QH9 A;  3PW0 A;  1KQQ A;  4MFA A;  5KT7 A;  4AP9 A;  2F3N A;  2ZXH A;  5KT4 A;  5L1J A;  7ICS A;  5ALY A;  2O6K A;  5J2J A;  1KEJ A;  2KNJ A;  1S8O A;  3C5G A;  2W3S A;  4B9S A;  2GO7 A;  3LK9 A;  4BUG A;  2KIW A;  3RJE A;  2GOL A;  2H5X A;  2AGP A;  2ZUD A;  7ICI A;  1JMS A;  4FE3 A;  3PX6 A;  4CE6 A;  5L1M A;  1L3T A;  3SMV A;  5DQI A;  5IIJ A;  4DWI A;  5K4L A;  5AI5 A;  2Y1J A;  3PR4 A;  3IV6 A;  4RNO A;  2I9G A;  4ED7 A;  2HHW A;  1QQ5 A;  7ICP A;  1ZQJ A;  5KT6 A;  3D2Q A;  4U7C A;  1A0P A;  3GFK B;  3Q8P B;  3H8M A;  4QWC A;  2KD1 A;  4OJ6 A;  3MFH A;  5AK4 A;  7ICO A;  3LWL A;  2HBK A;  2R8H A;  3MC1 A;  2OYY A;  3WK8 A;  1XO1 A;  4F4K A;  3KKA A;  1NKE A;  2KJ9 A;  3EUB 2;  1UT8 A;  4RUC A;  2DL0 A;  3IN5 A;  1UCV A;  2RLT A;  1N5X A;  3IG8 A;  4RT2 A;  4KLD A;  1ARO P;  4IR1 A;  4F71 A;  3U26 A;  3WK7 A;  3MFI A;  5J29 A;  8ICA A;  9ICJ A;  4QZA A;  3RR8 A;  8ICV A;  8ICO A;  4A8E A;  3S6J A;  2PMZ C;  2W03 A;  4Z6D A;  1VLB A;  5AKZ A;  2I1Q A;  3T5L A;  2G06 A;  4I2C A;  4ECY A;  4O5E A;  9ICP A;  3HIL A;  5ALM A;  1D9D A;  4KTQ A;  4Y2P A;  2K4I A;  3PX0 A;  1ZQB A;  3ZD8 A;  2W11 A;  2I6X A;  1SV0 A;  1ZQF A;  1GO3 F;  2C2R A;  1N5W A;  2XCA A;  5AIC A;  3M9N B;  4UAU A;  2NRW A;  2IHM A;  4RQ4 A;  3E58 A;  1LKY B;  4KLO A;  2LYB A;  3C29 A;  1XNS A;  4YMM A;  2UVR A;  3PW2 A;  2ZXI A;  3FYH A;  4UAZ A;  3H8J A;  2B0C A;  2HI0 A;  3WK6 A;  3GV7 B;  2F8K A;  2JEG A;  3KHL A;  1HIW A;  5KNI A;  3UQ2 A;  4G9B A;  4O3P A;  4DQI A;  2VKQ A;  5KG1 A;  1M6Y A;  1U45 A;  4QJF B;  2HHV A;  2BGW A;  4OD0 A;  2KJ8 A;  1TE2 A;  4I28 A;  1BPE A;  4BGD A;  4B9L A;  4RQ3 A;  3GIL A;  4IQU A;  1JRP A;  4DL5 A;  1BPY A;  2W7O A;  3JPO A;  2Y9U A;  4DSJ A;  2DBY A;  2KG5 A;  5G5H A;  3ICX A;  4R8U A;  2YML A;  1Q3U A;  5T14 A;  2OWO A;  4ECT A;  4C8N A;  2MU2 A;  4O9M A;  1J2M A;  2E8O A;  2G5I B;  5J0O A;  3KHR A;  2WF9 A;  4UBC A;  4LVS A;  4UAS A;  3Q8S B;  4QZB A;  4P4O A;  3M6K A;  4IC9 A;  3JPR A;  4YR0 A;  4C8K A;  3GV5 B;  5J0Q A;  4I29 A;  1DGJ A;  3H0M B;  4BJQ A; 
#chains in the Genus database with same CATH homology
 3JPT A;  4GXI A;  5CB1 A;  4O5C A;  2UVW A;  5HHI A;  2PFN A;  4BWJ A;  1ZQU A;  4RT3 A;  5KFW A;  4DLG A;  4DQP A;  4F5N A;  3MR5 A;  3SV3 A;  4KLQ A;  4F2R A;  7ICV A;  4UBB A;  5DKW A;  5CHG A;  3MR3 A;  3GIM A;  4X5V A;  2DPJ A;  2PI4 A;  7ICN A;  1HJP A;  5KFD A;  4GXK A;  1UT5 A;  8ICH A;  4P2H A;  4KLU A;  3TAR A;  1KFD A;  3GIK A;  1NK8 A;  1DOQ A;  4K4I A;  7ICJ A;  4KLT A;  3NTU A;  4XQ8 A;  4IQW A;  4RQ2 A;  3AUO A;  2V4R A;  4F8R A;  2RDI A;  1BVS A;  1WCN A;  2NRX A;  1ZQH A;  5KT3 A;  8ICM A;  4DSF A;  1CEZ A;  3PMN A;  3RH4 A;  2J6T A;  5DG8 A;  2BQU A;  4YXJ A;  4YN4 A;  4K4H A;  4I2I A;  5DDM A;  5CA7 A;  2ZJ5 A;  4Q45 A;  5KFY A;  4UB1 A;  2A1J A;  4DEZ A;  4PGQ A;  4DS4 A;  1NJZ A;  3PO4 A;  2W9M A;  5J2D A;  2W8K A;  2ALZ A;  2XGQ A;  3T5J A;  1ZQP A;  4EYH B;  5J2G A;  4KLH A;  2JZB B;  1TVA A;  4M9J A;  5DG9 A;  3PW5 A;  1MQ3 A;  4GXJ A;  1RXV A;  2KZZ A;  8ICN A;  1RPL A;  3QZ8 A;  1SL0 A;  4UB3 A;  4HYK A;  9ICU A;  3ISC A;  4J9N A;  4YD1 A;  1X2I A;  5F9N A;  5KFE A;  3OGU A;  4PH5 A;  1D8L A;  4J9K A;  2BCS A;  4EZ6 A;  4Q44 A;  4MFF A;  8ICJ A;  4GC7 A;  5EOZ A;  1T3N A;  1K1Q A;  1SKW A;  4GLX A;  4ELT A;  9ICF A;  1KFT A;  2RDJ A;  5KG3 A;  1SKS A;  5BOM A;  3QEA Z;  3RH6 A;  5J0X A;  3QE9 Y;  4KLE A;  4KLJ A;  5J2I A;  2XY7 A;  4NY8 A;  5EWF A;  2BCR A;  5KFG A;  4J9Q A;  9ICL A;  1NOM A;  4F4Y A;  5CR0 A;  4FBU A;  3ISD A;  3V7L A;  1JIH A;  1U49 A;  3BDP A;  4KLG A;  1KDH A;  1D9F A;  2NRZ A;  1S0V A;  4F5Q A;  3RJG A;  2XY5 A;  3T3F A;  2P6U A;  4QWB A;  1KTQ A;  2BCU A;  3C21 A;  5DG7 A;  5DB8 A;  4EBC A;  3TFR A;  3C23 A;  4Z6F A;  7ICL A;  1COO A;  4M47 A;  2KFN A;  5HML A;  2HHU A;  8ICT A;  3BQ1 A;  5KTQ A;  3T5K A;  4KLL A;  4IQV A;  3RJJ A;  3AU2 A;  5DB7 A;  4XRH A;  1RYS A;  1S0N A;  2JEF A;  4JV1 A;  4PPX A;  4ED3 A;  4LZD A;  1Z3E B;  1DGS A;  4M6W A;  4M6W B;  2XY6 A;  5IIK A;  3UPQ A;  3SYZ A;  1XSL A;  4P4P A;  2Q0Z X;  2BQ3 A;  5KFX A;  2NRV A;  4O5K A;  9ICH A;  3C2K A;  3Q8M A;  1UA0 A;  4QZI A;  5KFL A;  4JK1 A;  5KFT A;  2ASL A;  2P66 A;  2V9W A;  4F4Z A;  2VA3 A;  4Q8F A;  4YVZ A;  1TAQ A;  2Y1I A;  4KLF A;  1BGX T;  1UA1 A;  4DSK A;  3RB6 A;  5KG2 A;  1CUK A;  3EPG A;  4F5O A;  4UAW A;  4BDP A;  9ICS A;  5HHH A;  1X9S A;  7ICT A;  2W8L A;  5KG0 A;  3HW8 A;  4J9P A;  2AQ4 A;  1S10 A;  3JPN A;  2W9C B;  4KMU A;  5D49 A;  4YQW A;  4I27 A;  8ICI A;  3G6Y A;  2FPK A;  4Q8E A;  4FO6 A;  9ICN A;  3H4D A;  5L1L A;  2IMW P;  1X9M A;  5DLG A;  2C2D A;  3RJI A;  1JX4 A;  5BOL A;  3MDA A;  4F50 A;  4BXO A;  3JPP A;  4TQS A;  1S76 D;  5KFM A;  5CWR A;  4PHP A;  3PNC A;  3RBE A;  4DSI A;  5KFN A;  2XGP A;  3ZDB A;  4DL7 A;  5J0W A;  7ICK A;  1BPB A;  3H8S A;  5KFK A;  5KFA A;  4UQG A;  4Z6E A;  1U4B A;  3JPS A;  3MR6 A;  4DL6 A;  2R8K A;  3QZ7 A;  7ICM A;  2LYH A;  1KRP A;  4ECW A;  1ZQQ A;  8ICX A;  8ICQ A;  3UXO A;  4GC6 A;  2R8J A;  5L1I A;  5KFO A;  2KN7 A;  3EW9 A;  1Y88 A;  1NJW A;  1ZQI A;  4DL4 A;  4QZH A;  4F5R A;  2J6S A;  3MR2 A;  3TAN A;  5CJ7 A;  8ICR A;  2W9B B;  5J0U A;  3PW4 A;  1SL1 A;  4IRD A;  4MF8 A;  2FMS A;  3KTQ A;  4DQR A;  4I2G A;  2HVI A;  5HMM A;  4MEY A;  2XC9 A;  4RZR A;  1XSN A;  4MFC A;  3TAQ A;  4TUS A;  7ICF A;  7ICE A;  4RNM A;  4NLK A;  4PGY A;  5EWG A;  3ZDC A;  3C1Y A;  4I2J A;  3BQ0 A;  5J2K A;  1S97 A;  4NLN A;  8ICK A;  3EYZ A;  2KFZ A;  3HT3 A;  2R8G A;  1ZQC A;  4EYI B;  2PI5 A;  4QWA A;  3UQ0 A;  4TQR A;  4RQ5 A;  3MBY A;  5III A;  2VAN A;  5J2F A;  2FLL A;  4TUQ A;  5IIN A;  4IRK A;  4M04 A;  3JPQ A;  4EZ9 A;  4ZH4 A;  3Q8K A;  4ECR A;  4M9G A;  5J0T A;  1TV9 A;  4KLM A;  2HW3 A;  1WCL A;  3IHQ B;  4RQ1 A;  5IIM A;  2DFL A;  3ETL A;  3OSN A;  4YMO A;  4NLG A;  1ZQN A;  3OHA A;  1BPD A;  4QWD A;  2VA2 A;  4PHA A;  1C7Y A;  1NK9 A;  2C2E A;  1L3U A;  3GIJ A;  3RBD A;  3GDX A;  4DOB A;  3TI0 A;  4RPX A;  5IIO A;  3MGI A;  4J9L A;  4DL2 A;  1NK4 A;  4I2B A;  9ICI A;  7ICQ A;  2ZTE A;  3V7J A;  5TZV A;  2A1J B;  5KFJ A;  5DBB A;  5J2B A;  4UB5 A;  4RNN A;  4C8L A;  3TFS A;  2AJQ A;  4NXZ A;  3C2M A;  2JEI A;  4EBE A;  4QZC A;  3HX0 A;  3RRG A;  5BPC A;  2FPM A;  4UB4 A;  4B9M A;  3V72 A;  3M9M B;  1ZQZ A;  4B9N A;  2HVH A;  2FMQ A;  9ICK A;  3PW7 A;  2F1J A;  4KN4 A;  5DGA A;  2ATL A;  1NK7 A;  3H4B A;  4ECX A;  4ECZ A;  4Q43 A;  3EPI A;  1ZJM A;  3PO5 A;  4G3I A;  4F93 B;  3V6J A;  4YXM A;  9ICE A;  8ICU A;  4DO9 A;  1NK5 A;  1ZQM A;  4I2D A;  3HPO A;  3G6X A;  5HP4 A;  1ZQD A;  4O3S A;  4ECU A;  3V7K A;  4TUP A;  5KFQ A;  7ICG A;  5F9L A;  4R66 A;  4O3N A;  3HP6 A;  4MEX A;  4PGX A;  1EXN A;  2ISP A;  1JXE A;  2XO7 A;  4TUR A;  3MGH A;  4O3Q A;  3THV A;  3RAX A;  3PR5 B;  4F92 B;  4ED2 A;  4ED8 A;  1N56 A;  1QSY A;  4DOA A;  3E2E A;  1ZQX A;  1QSS A;  4ELU A;  8ICG A;  4DFM A;  4EEY A;  3LWM A;  1RZT A;  5DGB A;  3IM1 A;  3ISB A;  4DF4 A;  3HWT A;  3TAP A;  2ASD A;  3PW0 A;  4B9T A;  4MFA A;  4ECS A;  5KT7 A;  7ICH A;  2HHT A;  4IQT A;  1NKB A;  4DOC A;  1RYR A;  2MUT A;  4RPY A;  5KT4 A;  4J9S A;  5L1J A;  5KFC A;  3PX4 A;  1U47 A;  7ICS A;  5J2C A;  2BPG A;  5KFV A;  1ZQS A;  1MC8 A;  5J2J A;  1T7P A;  1KEJ A;  4RQ6 A;  1D8Y A;  3C5G A;  4FS2 A;  5KFH A;  3RRH A;  4P4M A;  1T4G A;  4J9R A;  4DLE A;  5J0Y A;  1NJY A;  4R63 A;  4RU9 A;  1ZQG A;  4B9S A;  3LK9 A;  4I2H A;  4DSE A;  4J9M A;  3K4G A;  2BDP A;  3RJE A;  5KFP A;  1S9F A;  1ZQA A;  3RJK A;  4JWN A;  8ICB A;  2H5X A;  4DF8 A;  4M9N A;  2AGP A;  2ZUD A;  2ZTC A;  1JXL A;  4JV2 A;  1NJX A;  7ICI A;  5JUM A;  3OHB A;  4UB2 A;  8ICS A;  3M8R A;  3BJY A;  1JMS A;  1B22 A;  4M0A A;  1XWL A;  4ECQ A;  4BXO B;  3KHH A;  2ASJ A;  2PFQ A;  3PX6 A;  9ICG A;  4E0D A;  1L3T A;  2ZJ8 A;  3Q8Q B;  5DQI A;  5IIJ A;  3RR7 A;  4JV0 A;  4O3O A;  4RQ8 A;  3SV4 A;  4DWI A;  4O3R A;  2F1I A;  3RAQ A;  1ZQO A;  1ZJN A;  5KT2 A;  4YFK A;  2Y1J A;  3ORY A;  3AU6 A;  2C28 A;  4F91 B;  5D46 A;  3PR4 A;  1Z00 A;  4RNO A;  3KHG A;  3GQC A;  4ED7 A;  2I9G A;  4KLI A;  5KFF A;  5J2H A;  4B9U A;  2HHW A;  2WTF A;  4XA5 A;  7ICP A;  1ZQJ A;  5KT6 A;  4DFP A;  2IBK A;  4JUZ A;  4DQQ A;  1SZP A;  1U9L A;  3GFK B;  4BWM A;  4QWC A;  3Q8P B;  4DL3 A;  3N4M B;  5DDY A;  1QSL A;  4M9H A;  7ICR A;  2GWS A;  8ICZ A;  3FDS A;  3MFH A;  5KFB A;  7ICO A;  1LV5 A;  4QW9 A;  3LWL A;  3C5F A;  2R8H A;  1TKD A;  9ICB A;  5KFS A;  1S77 D;  1JN3 A;  1XO1 A;  3ZDD A;  4F4K A;  4QZG A;  2R8I A;  3G6V A;  1NKE A;  4YMN A;  2P6R A;  4ED1 A;  4KN7 A;  4RQ0 A;  4F3O A;  2KZ3 A;  1UT8 A;  1MSW D;  4LZG A;  4RUC A;  5J2E A;  1IM4 A;  4YR3 A;  3SI8 A;  3RB0 A;  1ZQW A;  2B21 A;  1QTM A;  2FLP A;  5DBC A;  4KLD A;  3B0Y A;  4RT2 A;  4QZ9 A;  1ARO P;  1SL2 A;  4NM1 A;  4NLZ A;  3NGD A;  1HUO A;  3GV8 B;  2DPI A;  5L1K A;  4IR1 A;  8ICP A;  3ZDE A;  3N97 B;  9ICM A;  5DQG A;  4F4W A;  2BKE A;  1S0M A;  4M9L A;  3MFI A;  4I2A A;  5J29 A;  2M9N A;  3B0X A;  1N48 A;  2UVV A;  8ICA A;  9ICJ A;  9ICO A;  3QEB Z;  4QZA A;  1H38 A;  3RTV A;  3RR8 A;  8ICV A;  1TFR A;  8ICO A;  1KFS A;  2AU0 A;  3UXP A;  4ED6 A;  1KSP A;  4Z6D A;  1TK8 A;  4QZD A;  4QWE A;  3ZD9 A;  2I1Q A;  3T5L A;  1QLN A;  1ZQE A;  4QZE A;  2MAX A;  4RQ7 A;  4XUS A;  5DBA A;  2HHQ A;  4I2C A;  3TQ1 A;  4ECY A;  3V6H A;  4M2Y A;  2BHN A;  3RB4 A;  4O5E A;  5KG6 A;  3H8W A;  2ZUB A;  3H7I A;  9ICP A;  2KZM A;  1TK5 A;  3ZDA A;  9ICR A;  9ICA A;  4QZF A;  4RUA A;  4PHD A;  1T8E A;  1D9D A;  4KTQ A;  1TK0 A;  3RJF A;  3PX0 A;  1ZQB A;  1RXW A;  3ZD8 A;  2JZB A;  5D4B A;  2IA6 A;  5J0P A;  2J6U A;  2AQ0 A;  2ZJA A;  4YG2 A;  4EBD A;  4K4G A;  1XU4 A;  3GII A;  5DB9 A;  1ZQF A;  1X9W A;  1S0O A;  1B43 A;  3RB3 A;  2C2R A;  2UVU A;  2XCA A;  5HNK A;  2C22 A;  3M9N B;  8ICE A;  1KLN A;  9ICX A;  3C2L A;  2NRW A;  5KFU A;  5J2A A;  7ICU A;  2FLN A;  2IHM A;  8ICF A;  4RQ4 A;  4UAY A;  1LB2 B;  2IHN A;  1ZQT A;  4ELV A;  1SKR A;  3EWA A;  5C5J A;  4KLO A;  2ISO A;  2ZUC A;  4DS5 A;  9ICC A;  3OJS A;  2NRT A;  4YMM A;  4DSL A;  2UVR A;  3LDA A;  3PW2 A;  3MDC A;  4R65 A;  2MUT B;  3FYH A;  4YD2 A;  1ZQL A;  4YP3 A;  4UAZ A;  3H8J A;  4I2F A;  4Z6C A;  4FS1 A;  1ZYQ A;  4JWM A;  3GV7 B;  2JEG A;  3KHL A;  5DB6 A;  1ZQR A;  4IRC A;  4ED0 A;  4MF2 A;  3UQ2 A;  3PY8 A;  2W9A A;  2PXI A;  4F4X A;  1ZQK A;  1TAU A;  1XC9 A;  5IIL A;  5KG7 A;  4O3P A;  4DQI A;  3PV8 A;  5KG4 A;  2FMP A;  2PFP A;  4IR9 A;  5KG1 A;  4KIT B;  1NK0 A;  1U45 A;  1A77 A;  1NKC A;  2HHV A;  2BGW A;  4QZ8 A;  4O0I A;  1ZQV A;  2FPL A;  4I28 A;  3V6K A;  9ICQ A;  1BPE A;  4I2E A;  2AGO A;  1NK6 A;  4YCX A;  1BPZ A;  5KFR A;  3PVX A;  1L3V A;  2PFO A;  4BGD A;  4B9L A;  4RQ3 A;  3GIL A;  4IQU A;  3RJH A;  8ICC A;  4DL5 A;  4B9V A;  2XCP A;  2V4Q A;  5J0S A;  2BCQ A;  1ZQY A;  1BPY A;  1ZET A;  3JPO A;  3BQ2 A;  3RH5 A;  3H40 A;  5CP2 A;  4DSJ A;  2W9C A;  8ICY A;  1Z00 B;  4F5P A;  9ICV A;  1IXR A;  5KFZ A;  4R8U A;  3M9O B;  3OJU A;  4R8U B;  5EWE A;  1L3S A;  2AGQ A;  2BPC A;  5KT5 A;  2HHS A;  9ICW A;  1A76 A;  2JEJ A;  2ZTD A;  4QW8 A;  3PML A;  5J0R A;  4NM2 A;  4PHE A;  4ECT A;  1BPX A;  2OWO A;  4C8N A;  2BR0 A;  1PZN A;  4O9M A;  3MAB A;  4DFK A;  1XS9 D;  1U48 A;  1L5U A;  4C8M A;  5J0O A;  3M8S A;  4FBT A;  2BQR A;  3KHR A;  2BPF A;  4UBC A;  4ECV A;  5KG5 A;  1MQ2 A;  4CCH A;  2KTQ A;  3C1Z A;  3BQT A;  4YR2 A;  4LVS A;  3EZ5 A;  4DQS A;  9ICT A;  4J9O A;  1XSP A;  5DQH A;  3UXN A;  4QZB A;  3Q8S B;  4P4O A;  4RPZ A;  5DLF A;  2BCV A;  3Q8L A;  4KLS A;  8ICW A;  3Q8R B;  2W9B A;  3JPR A;  2VA8 A;  4YR0 A;  4C8K A;  3GV5 B;  3OSP A;  1K1S A;  4R64 A;  5KFI A;  4C8O A;  3K75 D;  1HUZ A;  8ICL A;  1V9P A;  5J0Q A;  3T5H A;  4DFJ A;  4I29 A;  2F1H A;  3SZ2 A;  4F2S A;  2HHX A;  5L9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...