3N4MB

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
b'FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Catabolite gene activator
publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 21
structure length 74
sequence length 74
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n4mB00
4O3NA 4R66A 4YD1A 5J2FA 5KFRA 2HHXA 4P4OA 1ZQXA 4YXJA 4UBBA 5L1LA 1S76D 7ICTA 3UXPA 3GV8B 5KFIA 5KFUA 4I2EA 4RQ4A 5IIMA 2BQUA 1XSNA 3IM1A 4RPZA 3C21A 4UB1A 4J9SA 4KLUA 3OJUA 2M9NA 1SL0A 2FLNA 3RJEA 9ICAA 8ICJA 5IIKA 4QZIA 4RQ7A 3PW5A 4DSJA 3PX0A 2AGOA 4QW8A 3M8SA 9ICCA 1ZQJA 3H8WA 1K1QA 4J9OA 3EYZA 1S10A 3LK9A 4F8RA 5KFLA 1S0VA 1XWLA 2IHNA 3C1ZA 1KFSA 4ECRA 1N48A 1ZQWA 4QZDA 2BCVA 4FS2A 5F9NA 4TQRA 1Z00A 4R65A 2J6TA 8ICTA 4I2AA 1U4BA 3RH4A 2BHNA 4RT2A 4PGYA 3QEBZ 4K4GA 1UA0A 2W9BB 1HUZA 5KFNA 4BXOA 1C7YA 5IIIA 4DLGA 4J9PA 3UXOA 3MGHA 4M6WA 2NRVA 4EBDA 1TV9A 2Y1IA 5CR0A 4QZAA 3RJIA 3GIJA 3JPTA 7ICGA 4O3RA 2AJQA 2ZTEA 5L9XA 4DS5A 3Q8SB 4Q43A 2LYHA 5KFFA 4IRCA 4JV0A 4EYIB 4O5CA 5EWGA 4QZGA 1A77A 3M8RA 3EPGA 3OHBA 2R8IA 1ZQVA 1L3SA 4PHPA 3M9OB 3C2LA 3QZ8A 1Z3EB 5KG2A 2P6UA 4DFKA 4O9MA 3OSPA 3ETLA 1ZJMA 4YMNA 2ATLA 2J6SA 4B9VA 4JK1A 1ZQKA 4F2RA 3NGDA 4KTQA 2BDPA 8ICKA 3KHLA 5KFCA 3H8JA 2V4QA 1IXRA 3Q8LA 4KLIA 4YP3A 9ICEA 1TFRA 1ZQNA 4ECZA 4F4ZA 8ICUA 4KLDA 1ZYQA 1TVAA 1RYRA 4PPXA 1JXLA 1L3VA 5DB9A 4PGXA 1ZETA 1WCLA 4QZ9A 4ECUA 4M2YA 3Q8MA 8ICOA 4PHEA 4UB2A 4I2JA 4JWNA 4F4YA 3ORYA 4NXZA 4EYHB 1ZQHA 4M9LA 5L1JA 1BVSA 4IQWA 2F1IA 2KFNA 3V6KA 3BJYA 3QZ7A 7ICPA 4ECSA 1BGXT 7ICSA 4RQ5A 2I9GA 5EOZA 3V7LA 4O3PA 1RPLA 5DB7A 4B9TA 5KFGA 4I2CA 9ICOA 3H7IA 5HHHA 1KRPA 4DFMA 2A1JB 4I28A 2KZZA 3HWTA 3V6JA 1NKBA 4RZRA 1KLNA 2ZTDA 1ZQQA 3ZDDA 1JX4A 4FBUA 2XY6A 9ICNA 3V72A 1ZQSA 4UB4A 4K4HA 2OWOA 8ICMA 1D8LA 1BPDA 4GC6A 4B9NA 4B9MA 5J2JA 2BQ3A 4M9NA 4KLTA 3RH6A 8ICLA 4YVZA 5KG1A 4I2BA 3OJSA 9ICMA 5CB1A 2NRWA 3EWAA 5KFPA 2ALZA 2BPFA 4YG2A 4NM2A 4QW9A 1LV5A 4P2HA 3C23A 5KFSA 1SKWA 5KFTA 2HHUA 2PI4A 1X2IA 3RH5A 5D4BA 4ECQA 4J9MA 5CHGA 4O3OA 3JPSA 4RNMA 3JPOA 5KFMA 2R8HA 2XY5A 3PV8A 2ASDA 1QSYA 3KHRA 2AGQA 5KFWA 3TANA 4O5KA 1CUKA 2W9BA 9ICVA 2AGPA 4RQ1A 1TKDA 3MBYA 4DOCA 4RUCA 2BGWA 4QZBA 4DQSA 3RB6A 4DSLA 4EBEA 5DGAA 8ICBA 4GC7A 2AQ4A 3PW0A 3OHAA 1HUOA 5HMMA 1BPEA 4KLMA 2AQ0A 3BQ2A 4CCHA 5BOMA 1XS9D 4F91B 4PHDA 3RR8A 5DBAA 2UVRA 5DBCA 2RDIA 2XO7A 3ZDEA 4IQVA 1KDHA 2MAXA 2XCAA 1TAQA 2KZMA 4XA5A 4I2IA 1N56A 1L3TA 4KMUA 2P66A 1U49A 8ICAA 4ECXA 4DSEA 5J2EA 3Q8QB 3C5GA 1RZTA 4KN4A 1ZQGA 1ZQAA 5IIJA 3FYHA 4XRHA 5KFHA 4J9RA 4UAYA 1NKEA 1NJYA 2UVUA 3JPRA 5IIOA 1IM4A 2XGQA 5J29A 4DOBA 3H40A 4ECVA 2BR0A 5KFBA 1BPXA 4KLOA 2WTFA 1NJZA 4FO6A 3RB0A 5J2KA 1BPYA 1ZQOA 4I27A 2VANA 1HJPA 1S9FA 4M9GA 4KN7A 4I2DA 4TUSA 9ICUA 2R8KA 3GFKB 2C2EA 3GV5B 2BPCA 2B21A 4YR2A 3RBDA 2ASLA 4F2SA 4LZGA 8ICWA 1TK5A 9ICKA 3RTVA 2A1JA 4TUQA 2ZUBA 1D9FA 2PFPA 4YXMA 4YMMA 3RRHA 5DGBA 1ZQCA 1ZQDA 2PFQA 4Z6EA 5DQIA 3PR4A 5KFAA 5KTQA 5DDYA 4TUPA 4JV1A 4KLHA 1DOQA 5KFXA 3JPNA 5J0PA 3UQ0A 4RNNA 1XSPA 3ZDAA 4RPYA 4Q8EA 2PFNA 5HHIA 3RJFA 3M9MB 4DL6A 3TAQA 2NRTA 2IHMA 1B22A 9ICLA 4B9LA 1JN3A 4KLJA 3ZDCA 4DQPA 2UVVA 4ECTA 1S0OA 3V6HA 4KLQA 1JIHA 1ZQEA 2Q0ZX 3PW4A 4IR1A 2DPIA 3MDCA 2VA3A 4B9SA 3ZD8A 1TK0A 2BCSA 7ICRA 1ZQRA 4R63A 4C8KA 4K4IA 3HW8A 3ZD9A 4EZ6A 9ICSA 1U48A 2W9CB 8ICIA 2ZUCA 3T5LA 3SV3A 4C8LA 1QSLA 1QTMA 3RJGA 5DDMA 2XCPA 3MFIA 5L1KA 1KTQA 2ZJ8A 5DQHA 1NK7A 4F50A 3AUOA 4QZFA 9ICTA 4DLEA 5KG7A 4DQQA 2W8LA 2Y1JA 3RBEA 1RXVA 4I29A 1SZPA 4PHAA 2HVHA 2HHSA 5J2GA 4P4PA 4Q44A 4PGQA 5IILA 5KT5A 5F9LA 3KHGA 5KFZA 3GQCA 5J2DA 2ZTCA 4KLEA 4DF8A 5CP2A 2DPJA 4C8MA 3OGUA 2BQRA 4GXIA 1KSPA 5KT2A 5CJ7A 7ICKA 4J9QA 5KT4A 1QSSA 4J9LA 3TQ1A 4DQRA 4KLGA 4RNOA 4RQ0A 4J9NA 9ICWA 7ICMA 3UQ2A 2HHQA 4GLXA 8ICSA 7ICVA 4F5PA 5J0OA 1JXEA 4DO9A 5KFYA 1NK0A 4YR3A 5CWRA 3GDXA 2JEIA 4F5RA 2XY7A 3JPPA 3OSNA 3C2KA 2ISOA 4ECYA 4QZCA 1NK8A 5J0TA 4C8NA 4F4KA 8ICQA 4JUZA 5CA7A 3T3FA 5DLFA 3AU2A 1T3NA 3ZDBA 4E0DA 4YCXA 4R8UB 1BPZA 4ELVA 3RAXA 3TAPA 5DKWA 3EZ5A 5KG0A 4EBCA 4RU9A 5KFOA 5HMLA 4RT3A 5IINA 2V9WA 4DL3A 3EW9A 3RB4A 2JEGA 4DWIA 4F4WA 1RYSA 4M47A 5C5JA 3UPQA 1B43A 9ICJA 4O3SA 5KG3A 4F92B 1XC9A 5KT3A 1NK4A 4G3IA 4NY8A 3RR7A 4I2GA 5J0SA 3HPOA 1SL2A 2XC9A 2IA6A 9ICXA 1D8YA 1ZQZA 5EWEA 2HHVA 4MEYA 3FDSA 1RXWA 1UT5A 4PH5A 1NK5A 4C8OA 1MSWD 4R64A 3T5JA 4ED1A 2FMSA 1UT8A 5J0QA 3PX4A 5J0YA 3THVA 1TK8A 1SKSA 2GWSA 4I2HA 5JUMA 1S0MA 2V4RA 4M9JA 4IQUA 1L5UA 4EZ9A 8ICZA 3HP6A 9ICPA 3LDAA 2IMWP 3BQ1A 3SI8A 1XO1A 5DG9A 4QWBA 2W9CA 3BQ0A 5BPCA 3N4MB 5EWFA 4Q8FA 7ICJA 1KEJA 1A76A 7ICLA 1PZNA 2KN7A 1S77D 4NLZA 2R8GA 3PMNA 1MC8A 5KT6A 4QZEA 4DL7A 3PO5A 4RQ3A 4MEXA 4IR9A 2HVIA 4BDPA 4RPXA 5J2IA 4O0IA 2FPLA 4ELTA 4ED2A 4UAZA 3RRGA 3RJHA 4LZDA 5J2BA 4NLGA 5J2HA 4ECWA 4XUSA 4GXKA 4RUAA 3QEAZ 3BQTA 5DQGA 3C2MA 5J2AA 4RQ6A 2PFOA 4FBTA 4DQIA 5L1IA 1WCNA 3RJKA 1XU4A 4Z6CA 5J0RA 4M0AA 9ICRA 4ED0A 3HT3A 4DEZA 7ICEA 2FMQA 1K1SA 1MQ3A 1T8EA 1ZJNA 2MUTB 2NRXA 3N97B 4MFAA 3K4GA 4P4MA 4YFKA 4DL5A 1ZQMA 4B9UA 5KG4A 9ICQA 3EPIA 3GILA 1AROP 3TFSA 5KG5A 3G6YA 4DSKA 3MR6A 3PVXA 2J6UA 7ICQA 1Y88A 2JZBB 4IRDA 2C2RA 3PW7A 4F5NA 2KFZA 3PMLA 1H38A 2FPKA 3K75D 2FLPA 1NK6A 3ISCA 4LVSA 4UBCA 1ZQIA 4JV2A 3T5KA 3NTUA 4EEYA 3KTQA 4R8UA 2W9AA 4DL4A 3B0YA 2DFLA 3BDPA 2BPGA 7ICHA 5BOLA 3V7JA 2XGPA 3G6XA 8ICVA 5TZVA 7ICOA 9ICHA 1TAUA 2BCQA 2R8JA 3M9NB 3H4BA 2C22A 4QWDA 2HHTA 4GXJA 2AU0A 5HNKA 2PXIA 3LWLA 2W8KA 4QZHA 3MGIA 1KFDA 4DSFA 3PO4A 1X9WA 3LWMA 7ICFA 4F4XA 4ED8A 3AU6A 3JPQA 4Z6DA 3MR5A 5DBBA 4DOAA 5KFDA 3KHHA 1ZQLA 2JEFA 3HX0A 4TQSA 1ZQPA 4HYKA 4NLKA 2FLLA 4O3QA 1U45A 4UQGA 3MABA 5J0UA 4XQ8A 3T5HA 2BCUA 3SZ2A 4ELUA 4YD2A 4BGDA 2ZJ5A 3RJJA 1ZQUA 4J9KA 5D49A 3TI0A 2VA2A 4M04A 3PY8A 8ICGA 5KG6A 3TFRA 4RQ8A 4DF4A 3TARA 4F3OA 3C5FA 1X9MA 4I2FA 4ZH4A 4QWCA 2ISPA 4IRKA 4KITB 2KTQA 2F1JA 1D9DA 1S97A 8ICHA 3Q8RB 1LB2B 2W9MA 1S0NA 1QLNA 5KFEA 2HW3A 3GV7B 4YN4A 1UA1A 2ASJA 4MF8A 3PR5B 3ISBA 1NJXA 4BWMA 4KLSA 9ICGA 3C1YA 4YQWA 1XSLA 3H8SA 4ED7A 9ICFA 8ICXA 3Q8PB 3E2EA 4YMOA 4BWJA 1NKCA 3UXNA 4QZ8A 5D46A 4KLLA 5DG7A 1T7PA 4Q45A 4X5VA 2C28A 1SL1A 4MF2A 8ICRA 2IBKA 1SKRA 1Z00B 4F5QA 8ICPA 1L3UA 9ICBA 1U47A 3MFHA 2MUTA 4MFFA 4QWEA 4Z6FA 5DLGA 4F5OA 2BKEA 3MDAA 4KLFA 2ZJAA 1ZQYA 4BXOB 1NJWA 2H5XA 4MFCA 1CEZA 1MQ2A 1EXNA 5J2CA 4M6WB 2VA8A 8ICEA 2JZBA 4NLNA 2BCRA 3SYZA 4O5EA 1NOMA 3V7KA 5J0XA 4DFJA 7ICUA 1U9LA 1DGSA 8ICCA 2UVWA 4DSIA 5KT7A 3H4DA 7ICIA 3G6VA 4NM1A 1ZQFA 4UB5A 3PW2A 2I1QA 4UAWA 4UB3A 2FPMA 5KFVA 8ICNA 9ICIA 1KFTA 3B0XA 5DB6A 4FS1A 3ISDA 1ZQTA 2RDJA 1X9SA 2JEJA 4DS4A 3PX6A 1COOA 3MR3A 5J0WA 4QWAA 3GIMA 8ICYA 3SV4A 3GIIA 2ZUDA 5HP4A 4DFPA 3MR2A 2C2DA 3IHQB 4F93B 3GIKA 1NK9A 7ICNA 8ICFA 1JMSA 2HHWA 4ED6A 4TURA 3Q8KA 2PI5A 4RQ2A 2FMPA 1BPBA 4IQTA 5KFQA 3RB3A 4ED3A 3RAQA 2F1HA 1T4GA 3PNCA 5DG8A 4DL2A 4JWMA 1ZQBA 1V9PA 5DB8A 2NRZA 3QE9Y 2P6RA 4M9HA 2KZ3A 4YR0A 5KFKA 5KFJA
chains in the Genus database with same CATH superfamily
2D3DA 1KL9A 3AM9A 1ZQXA 5L1LA 2FJ6A 2DGZA 4I2EA 5IIMA 2BQUA 1XSNA 4J9SA 3WKBA 4NL9A 4RPZA 4KLUA 2HOIA 1UQVA 1T94A 3PW5A 2F76X 5ALLA 4DSJA 2R18A 2ZG6A 3H8WA 3EYZA 3LK9A 5KFLA 1S0VA 1XWLA 2IHNA 1KFSA 4QZDA 2KSOA 1L7MA 1JRPA 3RH4A 1SZHA 2BHNA 5B5EU 1SV4A 4PGYA 3QEBZ 4Y2RA 2W9BB 4BXOA 2M0NA 2E8PA 3K1RB 4J9PA 3UXOA 4EBDA 1Z1BA 2Y1IA 1RQLA 3JPTA 2KK0A 2LI6A 3F53A 1FO4A 5AI9A 2R8IA 3M8RA 1A77A 2H3IA 2QB0A 3PSTA 3SR6A 1PVQA 2W54A 3C2LA 3QZ8A 5KG2A 3BQ7A 4O9MA 3ETLA 4F2RA 2J6SA 1ZQKA 3NGDA 1OW5A 5KFCA 3H8JA 1ZOLA 9ICEA 4ECZA 3S6JA 1ED1A 1L3VA 5DB9A 1SB3C 8ICOA 2E5SA 3Q8MA 5AIBA 4UB2A 4JWNA 3ORYA 1ZQHA 2F1IA 4P0QB 3V6KA 3QZ7A 4G9BA 4O3PA 5DB7A 2QB1A 5KFGA 2K4EA 3H7IA 5HHHA 2A1JB 1KLNA 1ZQQA 2XY6A 4UATA 1ZQSA 5ALSA 1A6SA 4B9NA 4NLBA 5ALRA 3N7RC 2BPFA 2JXJA 2ZIWA 4QW9A 1VJ5A 3C23A 5KFTA 2PI4A 3GU3A 5CHGA 1L7PA 4O3OA 3JPOA 5KFMA 2R8HA 1QSYA 3KHRA 4CF3A 4O5KA 1M6YA 2AGPA 1TKDA 2D8CA 4CRXA 4DQSA 2K4IA 3PW0A 1BPEA 3NVYA 2XO7A 2WF7A 3ONNA 4IQVA 3QYPA 2XCAA 1TAQA 4XA5A 1ZQ1C 2EZYA 1RDFA 4KMUA 4AP9A 1RZTA 3Q8QB 1ZQAA 2E8OA 2QARB 4UAYA 2WF5A 4ECVA 4UAVA 2BR0A 2NO5A 1NZPA 5KFBA 2WTFA 3RB0A 4BUGA 1HJPA 1S9FA 3WK6A 9ICUA 3A0HU 3GV5B 1PVRA 3NUQA 2BPCA 4PZOA 4YR2A 8ICWA 9ICKA 3RTVA 2E1FA 2ZUBA 2DBYA 2PFPA 1X66A 5DGBA 2PFQA 4QJFB 5KTQA 2KVSA 3UM9A 4CE6A 3HJEA 3JPNA 1XSPA 4RPYA 3UMGA 2NRTA 2RRDA 1ZD2P 3VCBA 4UW9A 5ALKA 1QCKA 3TADA 4KLQA 4UB6U 4B9SA 2HBMA 7ICRA 3ZD9A 3GZFA 4EZ6A 9ICSA 3SV3A 2Q4TA 5DDMA 1KTQA 3E0FA 3AUOA 4QZFA 4DLEA 3LVWA 3IG8A 4DQQA 2Y1JA 3BS5A 1RM6C 5J2GA 4Q44A 3PW4A 3GQCA 4KLEA 5CP2A 4GXIA 5KT2A 5CJ7A 4J9LA 3SAHA 4DQRA 1KN5A 3UQ2A 4C7YA 5J0OA 1JXEA 3IRUA 4DCCA 5KFYA 3UMCA 3GDXA 2JEIA 4F5RA 2XY7A 3JPPA 3C2KA 5J0TA 4F4KA 1L7NA 5HR7A 5DLFA 4B6JA 3AU2A 2JH7A 3ZDBA 3ETRA 4R8UB 3RAXA 3TAPA 2GO7A 3C28A 4CNQA 4RT3A 1ECWA 4DL3A 3EW9A 3RB4A 4DWIA 1RYSA 4QIWC 5C5JA 4O3SA 4J03A 3RR7A 3T79A 4I2GA 1N63A 5J0SA 2G06A 1SL2A 1TAMA 2YB1A 1ZQZA 4CDGA 5AI8A 2GH1A 2JGAA 4MEYA 2Y9UA 1UT5A 4C8OA 4R64A 3THVA 1SKSA 1S0MA 2V4RA 3QU4A 1WUDA 5AM5A 3BQ1A 3SI8A 1XO1A 3BQ0A 7ICJA 5BPCA 2G09A 4UARA 1S77D 5KT6A 3PO5A 4RQ3A 4MEXA 4IR9A 2ES6A 4BDPA 4RPXA 5J2IA 4UAZA 3R9KA 2DUYA 3ICXA 4RQ6A 2B0CA 1XU4A 4M0AA 3HT3A 4DEZA 7ICEA 2FMQA 1MQ3A 2MUTB 4OCZA 4P4MA 4FE3A 3IG5A 5KG5A 4DSKA 3MR6A 3ALRA 3AN1A 7ICQA 1Y88A 2KFZA 4P0PB 2FLPA 3MGVA 4UBCA 2L5YA 1P7DA 3B0YA 2OEHA 1YT3A 5BOLA 1V85A 2HDOA 3M9NB 4F72A 3H4BA 2C22A 2HHTA 2AU0A 5AK6A 3MGIA 4DSFA 7ICFA 3IP4B 3ED5A 4Z6DA 5DBBA 3KHHA 2JEFA 1ZQPA 5AKIA 1O08A 5ALZA 2F3NA 2FLLA 4UQGA 2KJ9A 3MABA 3F2CA 3T5HA 2BCUA 2LMRA 4ELUA 2WB1F 1PK1A 2KNJA 4J9KA 3TI0A 4M04A 5KG6A 4F3OA 1X9MA 4ZH4A 2ISPA 2F1JA 1D9DA 3Q8RB 1S0NA 5AK3A 2ASJA 3PR5B 1VLBA 4KLSA 3H8SA 5AHXA 3SENA 2WAQF 4EENA 1NKCA 2E3TA 3E58A 3AQFA 5DG7A 1T7PA 1SL1A 1L3UA 4MFFA 5DLGA 4KLFA 1L6NA 1ZQYA 1SWVA 1CI4A 3WK8A 2VA8A 4CGZA 4NLNA 2BCRA 3SYZA 1NOMA 4DFJA 4IS7A 5J0XA 3N7PD 2HBLA 3H4DA 2EH9A 4UAWA 8ICNA 5KFVA 9ICIA 1KFTA 2ZIXA 2WAQC 1QH9A 3NVWA 1FFVA 1X9SA 1PK3A 3PSPA 1OUQA 2YN4A 3TACB 1IV8A 4QWAA 3GIMA 8ICYA 1QQ6A 3SV4A 2ZUDA 1JROA 4DFPA 5AM3A 3MR2A 5KAIU 2HHWA 2HI0A 4TURA 1SV0A 1BPBA 3RB3A 2F44A 4ED3A 3RAQA 1T4GA 1WYGA 5KFKA 4O3NA 2H3ZA 1DRGA 2AH5A 5AKXA 1C20A 4OJ5A 5KFIA 3FM9A 3IM1A 3C21A 4NWIA 3OJUA 2MU2A 2M9NA 2FLNA 3RJEA 4QNLA 4UASA 5IIKA 4QZIA 2HOQA 1X40A 3M8SA 9ICCA 1ZQJA 1S10A 3C1ZA 4ECRA 4FS2A 4RT2A 2PMZF 4C4SA 4ZOHC 2ZIVB 2JHDA 4QZAA 2K8AA 3GIJA 7ICGA 2DWQA 4O3RA 2ZTEA 4EEKA 2B6GA 3Q8SB 2H3FA 3D2SA 4O5CA 5EWGA 2LM1A 3DEEA 1L3SA 3U26A 2DKZA 1VDVA 1Z3EB 2VIXA 3SQIA 2P6UA 2KKVA 2ATLA 4JK1A 4KTQA 3QXGA 2OHFA 2E8MA 1IXRA 1ZQNA 2PMZC 3NRWA 4F4ZA 8ICUA 4F71A 1AQ6A 1URJA 4PGXA 3A0BU 5G5HA 4F4YA 7ICPA 1BGXT 2G08A 5EOZA 3V7LA 9ICOA 4DFMA 3WKEA 5EE9A 2KZZA 1NKBA 3V6JA 5J8YC 3ZDDA 2DKXA 4UB4A 8ICMA 4GC6A 4B9MA 4M9NA 5J2JA 2BQ3A 2RP5A 3OJSA 9ICMA 2KP7A 1LV5A 4P2HA 2EZZA 1X2IA 2K4PA 3JPSA 2XY5A 3PV8A 2HMXA 1CUKA 2W9BA 9ICVA 2OCEA 4Y2JA 5B66U 2OYYA 2YMLA 2ZXHA 4EBEA 4Y2VA 4GC7A 2AQ4A 3OHAA 2AQ0A 3BS7A 4F91B 4PHDA 3RR8A 5DBAA 5KAFU 2RDIA 3ZDEA 1KDHA 2MAXA 1D8BA 4NL9C 2YB4A 1SIJA 2A19A 1U49A 4DSEA 3FYHA 4XRHA 5KFHA 2P35A 1WWVA 3JPRA 3LVVA 5AK4A 5IIOA 1IM4A 3CNHA 3H40A 1BPXA 5ALIA 1NJZA 1BPYA 4I27A 4M9GA 5JU5A 3WKDA 3GFKB 4P0QA 2KMDA 1L8OA 2WF8A 2B21A 1TK5A 2A1JA 4TUQA 2W04A 4YXMA 3RRHA 1DGJA 3UQ0A 5J0PA 3ZDAA 4DL6A 3QNMA 9ICLA 2RQ5A 2YMMA 4DQPA 2UVVA 3NVVA 3N7SC 3V6HA 1K5OA 1ZQEA 5CRXA 4IR1A 2VA3A 3MDCA 4KX3A 3SAFA 4R63A 2EANA 1U48A 1JI7A 3HRDD 4C8LA 2EAOA 4NV0A 1QSLA 3OTQA 3M6KA 3RJGA 5KL8B 1Q3UA 2XCPA 3MFIA 5DQHA 2HSZA 1NK7A 9ICTA 5KG7A 3RBEA 4FZMA 2HHSA 4P4PA 2ZXIA 2QARA 5J2DA 4DF8A 4KX5A 2BQRA 1KSPA 3N28A 1QSSA 3TQ1A 4KLGA 4ICAA 2LPEA 2XVTA 3I1YA 4RQ0A 7ICMA 2HHQA 1F44A 4DO9A 3QUBA 3QU9A 2G5HB 2WF6A 4AYBF 3T3FA 1UHUA 5DKWA 5KG0A 4RU9A 5KFOA 2V9WA 3KBBA 2AHOB 4F4WA 3UPQA 5KG3A 3RF9A 1NK4A 4NY8A 3K1ZA 9ICXA 2IA6A 5EWEA 3CRXA 2HHVA 4PH5A 1NK5A 1MSWD 1UT8A 4AYBC 4I2HA 3ZI4A 5JUMA 3L4PA 8ICZA 2IMWP 3QU7A 2A3VA 5EWFA 1T3QA 2JH1A 1A76A 1PZNA 4GFJA 2KN7A 4NLZA 1MC8A 4OD0A 4OJLA 3RRGA 4LZDA 3KZIU 4ECWA 4GXKA 4RUAA 5DQGA 5J2AA 2PFOA 4FBTA 4DQIA 4CF4A 2DL0A 9ICRA 2KJ5A 1T8EA 5KG4A 2JRZA 2NYVA 9ICQA 3QU2A 3TADC 2LKYA 2C2RA 4F5NA 1H38A 4JV2A 3T5KA 5AM0A 4R8UA 2W9AA 4DL4A 4JMUA 2DFLA 2BPGA 3G6XA 2W7PA 7ICOA 1O03A 5GTIU 3F2BA 2BCQA 2ODGA 4GXJA 5HNKA 2EAMA 2BDUA 3PO4A 1KFDA 3AU6A 4Y2UA 3MR5A 1J97A 4HYKA 4XQ8A 4QIWF 1KKXA 4YD2A 2ZJ5A 2VA2A 5D49A 2LM4A 3SMVA 4IRKA 1CRXA 8ICHA 3QUCA 1LB2B 3UMBA 1QLNA 2HW3A 3IV6A 4MF8A 1NZBA 2K4HA 4YQWA 1XSLA 9ICFA 4BWJA 3UXNA 4Q45A 2C28A 8ICRA 2IBKA 1SKRA 1Z00B 4F5QA 9ICBA 2IOFK 3MFHA 5AM4A 2MUTA 4QWEA 2ZJAA 4C0ZA 3NS1A 3I28A 4BJQA 4M6WB 8ICEA 3SD7A 4P0PA 3V7KA 7ICUA 2LYAA 1DGSA 8ICCA 2UVWA 4DSIA 5KT7A 7ICIA 4O3MA 3G6VA 4NM1A 5EE3A 2CXYA 2PKEA 1X9XA 1YZ7A 2FPMA 3B0XA 3QX7A 1ZQTA 2JEJA 5KL1B 4DS4A 3PX6A 3MR3A 3GIIA 2MRLA 2YY6A 5AKKA 3IHQB 4F93B 8ICFA 1JMSA 5ALVA 2F8KA 3Q8KA 4RQ2A 2FMPA 3PNCA 2O6KA 4DL2A 4JWMA 1V9PA 5DB8A 2NRZA 2P6RA 2KZ3A 4YR0A 2FE9A 2W43A 4JB3A 2EZXA 3FAHA 5J2FA 5KFRA 2HHXA 1DXSA 3H8MA 4YXJA 7ICTA 1F0MA 5KFUA 2HBKA 4UB1A 2KD1A 1GO3F 3L5KA 3PX0A 1KQQA 4QW8A 4J9OA 2WHEA 1YZ6A 3CP8A 4Y2PA 5ALJA 2BCVA 5F9NA 4TQRA 5H2FU 4R65A 4I2AA 5ALWA 1DK3A 3L3FX 1C7YA 2G0AA 5C0YA 3H0MB 3MGHA 1MA7A 2NRVA 1TV9A 5T14A 5CR0A 4NJ8A 2AJQA 5L9XA 4GIBA 4Q43A 5GTHU 4IRCA 4U7CA 4JV0A 4EYIB 4QZGA 2E1EA 3WKAA 1LKYA 4PHPA 1A0PA 2KV2A 1KW4A 1X6JA 1B4FA 4DFKA 3OSPA 1Z19A 4YMNA 4B9VA 2BDPA 3KHLA 2KG5A 1TFRA 4KLDA 3WK7A 1TVAA 1RYRA 5EE1A 1JXLA 1ZETA 3NVZA 4ECUA 4M2YA 3HILA 4NXZA 3KKAC 4EYHB 4M9LA 1S5LU 1BVSA 4IQWA 3BJYA 3QU5A 1J2NA 4ECSA 7ICSA 2I9GA 1RPLA 5AKZA 4I2CA 1KRPA 4I28A 1QQ7A 1HEKA 4RZRA 3KKAA 2ZTDA 4FBUA 5HR6A 3V72A 2YQEA 4K4HA 2OWOA 1D8LA 1N62A 8ICLA 5KG1A 2NRWA 2ALZA 1NI3A 4YG2A 2W03A 4NM2A 2HHUA 2W55A 4ECQA 1LKYB 4J9MA 4RNMA 2F77X 3SAGA 2AGQA 5KFWA 3TANA 2ZIVA 1SV0C 2QLTA 4DOCA 4PL2A 2BGWA 5DGAA 1ZD3A 1HUOA 2RLTA 4CCHA 3CYMA 1XS9D 2BZFA 1Q8KA 2KZMA 1N56A 4PZNA 2VJ5A 2P66A 8ICAA 1SXEA 4ECXA 2EQYA 4KN4A 5IIJA 2UVUA 1NJYA 5ALXA 2XGQA 5J29A 3J81j 1FIQA 5J2KA 2VANA 5ALPA 4KN7A 4I2DA 5AICA 2C2EA 4FZLA 5ALNA 3RBDA 2ASLA 1RQNA 4LZGA 2D6FC 2OH2A 1L8LA 1D9FA 5A0LA 1ZQCA 1ZQDA 5DQIA 5KFAA 4US8A 3HKZF 5KFXA 4IL6U 5G5GA 4C4RA 4RNNA 4Y2QA 2PFNA 4Y2XA 1B22A 2JR5A 1JN3A 3ZDCA 1JUDA 2K89A 2Q0ZX 2BCSA 2FDRA 4IC9A 4C8KA 4K4IA 4CF5A 5AI5A 3OPXA 2W9CB 2ZUCA 4UAUA 1QTMA 3NRZA 3HKZC 5L1KA 2K8CB 2GOLA 4F50A 1RXVA 2HVHA 4PHAA 1PVPA 4PGQA 5IILA 3KHGA 5F9LA 5KFZA 2DPJA 4J9QA 5KT4A 3AL0B 7ICVA 2KJ8A 2W11A 4UB8U 1NK0A 5CWRA 1NK8A 2IOHA 8ICQA 4JUZA 5CA7A 4E0DA 1UPHA 1T3NA 3PSFA 1ZD4A 4YCXA 1BPZA 2KEYA 1N61A 1XNSA 1B43A 9ICJA 2W3SA 5KT3A 3IN5A 2MSNA 2XC9A 1XO0A 3M6ZA 5AI4A 1RXWA 2LYBA 5ALEA 3PX4A 1Z1VA 1IIPA 1ZD5A 1SWWA 5ALQA 4EZ9A 9ICPA 3DDHA 2YTUA 3N4MB 4Q8FA 1KEJA 1Q46A 3PMNA 4QZEA 3WK9A 2HVIA 4ELTA 4NLGA 1X42A 4XUSA 1BNOA 5L1IA 3RJKA 5J0RA 1L7OA 1K1SA 4MFAA 3K4GA 4YFKA 2Z7JA 1Z4NA 4DL5A 1ZQMA 4B9UA 4U6PA 3EPIA 3TFSA 3G6YA 3PVXA 2J6UA 2JZBB 4IRDA 3PW7A 2MA1A 2F8LA 3K75D 3ISCA 1ZQIA 4OO1J 4EEYA 2OXOA 3KTQA 7ICHA 5AM1A 3V7JA 2KHQA 8ICVA 5TZVA 9ICHA 2R8JA 4QWDA 1RG6A 3LWLA 3D6JA 4Y2SA 3LWMA 1X9WA 3HX0A 2KKPA 5AIAA 5EE0A 4NLKA 4ACOA 1U45A 2KE7A 5J0UA 4BGDA 3RJJA 4KMOB 1ZQUA 2N1RA 8ICGA 3TARA 4RQ8A 2KTQA 4I2FA 4QWCA 3B9JA 5ALOA 2HBJA 3QUQA 4EELA 3GV7B 4YN4A 1NJXA 4BWMA 9ICGA 3C1YA 8ICXA 3Q8PB 2XICA 5ALTA 4YMOA 4QZ8A 5K4LA 2KSOB 8ICPA 4MF2A 2K60A 1SXDA 3D2NA 4F5OA 3MDAA 4BXOB 2H5XA 1CEZA 1MQ2A 4PL1A 1EXNA 1IG6A 2W3RA 4C80A 4O5EA 1S8OA 4FZNA 2DQNB 2EAPA 5F3XB 1ZQFA 3PW2A 2I1QA 2QB0B 5DB6A 4FS1A 1N2XA 3ISDA 2YMQA 5HP4A 5CEHA 3AQEA 1NK9A 2FI1A 2KVCA 2PI5A 2WFAA 3KFUF 2F1HA 5DG8A 1TE2A 3QE9Y 3WK5A 1QQ5A 1KBUA 5KFJA 2GLEA 4R66A 4YD1A 4P4OA 5ALGA 4UBBA 1S76D 5AKLA 3GV8B 3UXPA 4BX9C 4RQ4A 3BZKA 3KD3A 3MC1A 1SL0A 9ICAA 8ICJA 1N60A 4RQ7A 2AGOA 2CRXA 1K1QA 4F8RA 2EDUA 2ZIWB 5AKHA 1N48A 1ZQWA 1Z00A 2J6TA 4WJ3B 8ICTA 1U4BA 4C7ZA 4K4GA 1UA0A 1HUZA 3O0FA 5KFNA 5IIIA 4DLGA 1Z4OA 4M6WA 1F5SA 3RJIA 2XI9A 5AK5A 4DS5A 2KOBA 4HAIA 2LYHA 5KFFA 2NV3A 3KOOA 3EPGA 1ZQVA 3M9OB 2DF4B 1ZJMA 5FP0A 8ICKA 2V4QA 2KIVA 3Q8LA 4KLIA 4YP3A 4OJ6A 1ZYQA 4PPXA 4RQNA 1WCLA 4QZ9A 4PHEA 4I2JA 1V97A 5L1JA 2KFNA 1WG8A 4RQ5A 1J2MA 4B9TA 1X6IA 3HWTA 9ICNA 1JX4A 1BPDA 4KLTA 3RH6A 3F5EA 4YVZA 4I2BA 5CB1A 2H3QA 3EWAA 5KFPA 1SKWA 5KFSA 3D2QA 3I76A 3RH5A 5D4BA 2IOFA 2ZIUA 2LBOA 2ASDA 2RHFA 1NNLA 2HOFA 3AEVA 4RQ1A 3QUTA 3MBYA 4RUCA 4QZBA 1ZRNA 2KIWA 3RB6A 3IDWA 8ICBA 5HMMA 3BQ2A 1RYUA 5BOMA 3NASA 5DBCA 1PUZA 2UVRA 2LHTA 2E8NA 5AKYA 3C29A 4I2IA 1L3TA 3BS5B 5J2EA 3C5GA 2CN1A 1ZQGA 4J9RA 1NKEA 5ALUA 4DOBA 4US9A 4KLOA 3FC4A 4FO6A 5ALHA 1ZQOA 2CPRA 2KICA 4TUSA 5ALYA 2R8KA 1V38A 1DK2A 4F2SA 2ZIUB 2YMPA 3WK4A 4USAA 4YMMA 4Z6EA 3PR4A 4JV1A 5DDYA 4TUPA 2AXTU 4KLHA 5TISU 1DOQA 4Q8EA 4NLCA 4C4TA 5HHIA 2HCFA 3RJFA 3M9MB 2IHMA 3TAQA 4B9LA 4KLJA 2A1AA 3CW2C 4ECTA 1S0OA 5AKGA 1JIHA 5AI6A 2VKQA 1UCVA 2DPIA 3ZD8A 1TK0A 2WF9A 1ZQRA 4OJOA 3HW8A 2I6XA 8ICIA 3T5LA 2VJ4A 4A8EA 2ZJ8A 3SEIA 2KHVA 2W8LA 4FFDA 1SZPA 4I29A 4DFDA 4DSLA 4KLMA 5AKEA 1LVHA 5KT5A 2ZTCA 5ALFA 1FFUA 4C8MA 3OGUA 7ICKA 4RNOA 9ICWA 4J9NA 8ICSA 4GLXA 4F5PA 4Y2TA 4YR3A 2ISOA 3OSNA 4ECYA 4QZCA 4C8NA 2YX8A 2JMGA 2Y9TA 4ELVA 3M7DA 2F2AB 3WKCA 3EZ5A 4EBCA 5HMLA 5IINA 2JEGA 5AI0A 4M47A 2WB1C 4F92B 3F5AA 1XC9A 4G3IA 3EUB2 5E79U 3HPOA 1COKA 1D8YA 3LYSA 3FDSA 4LJXA 3T5JA 2FMSA 4ED1A 5J0QA 5J0YA 1TK8A 1BNPA 3TKAA 2GWSA 3WU2U 3VC8A 4M9JA 4IQUA 1B0XA 1L5UA 3HP6A 1PK1B 3LDAA 4QWBA 5DG9A 2W9CA 2W7OA 2I5HA 7ICLA 5AM2A 3BZCA 2R8GA 4DL7A 1ZRMA 4O0IA 2FPLA 3KZXA 5ALMA 4ED2A 2NO4A 3RJHA 1OXJA 5JRTA 5J2BA 5J2HA 3QEAZ 3BQTA 5KNIA 3C2MA 2OM6A 2Y0SF 1WCNA 2XIDA 4Z6CA 4ED0A 2H3VA 1FEZA 5JTIA 3M1YA 5ALDA 2G5IB 1ZJNA 2NRXA 3N97B 2JV3A 3GILA 1AROP 2FPKA 1NK6A 4LVSA 4EX6A 3NTUA 3BDPA 2ZIXB 2Y0SC 2XGPA 3H0RB 1TAUA 1JALA 2PXIA 2W8KA 1MN8A 4QZHA 4F4XA 3RFAA 4ED8A 3JPQA 1ZQLA 4DOAA 5KFDA 4TQSA 4OJPA 4O3QA 2ESEA 2G07A 3SZ2A 3PY8A 3TFRA 4DF4A 5AKJA 3C5FA 4KITB 1S97A 1N5XA 2W9MA 5KFEA 1SGGA 1UA1A 3ISBA 4ED7A 3E2EA 4Y2YA 5D46A 4KLLA 2QKQA 3PZPA 4X5VA 3F2DA 1U47A 4Z6FA 4MHVA 2BKEA 1NJWA 4MFCA 5J2CA 2JZBA 1U9LA 5L1MA 5J8YA 2K8BB 4UB5A 4UB3A 2RDJA 1HIWA 1ZXIA 4EX7A 1COOA 5J0WA 4RQMA 3DV9A 3PSIA 4PJ0U 3GIKA 2C2DA 7ICNA 4ED6A 1Q3VA 4IQTA 1N5WA 1WWUA 5KFQA 3H0LB 3AMZA 1ZQBA 4M9HA 3PMLA 3OHBA
chains in the Genus database with same CATH topology
4O3NA 4R66A 4YD1A 5J2FA 5KFRA 2HHXA 4P4OA 1ZQXA 4YXJA 4UBBA 5L1LA 1S76D 7ICTA 3UXPA 3GV8B 5KFIA 5KFUA 4I2EA 4RQ4A 5IIMA 2BQUA 1XSNA 3IM1A 4RPZA 3C21A 4UB1A 4J9SA 4KLUA 3OJUA 2M9NA 1SL0A 2FLNA 3RJEA 9ICAA 8ICJA 5IIKA 4QZIA 4RQ7A 3PW5A 4DSJA 3PX0A 2AGOA 4QW8A 3M8SA 9ICCA 1ZQJA 3H8WA 1K1QA 4J9OA 3EYZA 1S10A 3LK9A 4F8RA 5KFLA 1S0VA 1XWLA 2IHNA 3C1ZA 1KFSA 4ECRA 1N48A 1ZQWA 4QZDA 2BCVA 4FS2A 5F9NA 4TQRA 1Z00A 4R65A 2J6TA 8ICTA 4I2AA 1U4BA 3RH4A 2BHNA 4RT2A 4PGYA 3QEBZ 4K4GA 1UA0A 2W9BB 1HUZA 5KFNA 4BXOA 1C7YA 5IIIA 4DLGA 4J9PA 3UXOA 3MGHA 4M6WA 2NRVA 4EBDA 1TV9A 2Y1IA 5CR0A 4QZAA 3RJIA 3GIJA 3JPTA 7ICGA 4O3RA 2AJQA 2ZTEA 5L9XA 4DS5A 3Q8SB 4Q43A 2LYHA 5KFFA 4IRCA 4JV0A 4EYIB 4O5CA 5EWGA 4QZGA 1A77A 3M8RA 3EPGA 3OHBA 2R8IA 1ZQVA 1L3SA 4PHPA 3M9OB 3C2LA 3QZ8A 1Z3EB 5KG2A 2P6UA 4DFKA 4O9MA 3OSPA 3ETLA 1ZJMA 4YMNA 2ATLA 2J6SA 4B9VA 4JK1A 1ZQKA 4F2RA 3NGDA 4KTQA 2BDPA 8ICKA 3KHLA 5KFCA 3H8JA 2V4QA 1IXRA 3Q8LA 4KLIA 4YP3A 9ICEA 1TFRA 1ZQNA 4ECZA 4F4ZA 8ICUA 4KLDA 1ZYQA 1TVAA 1RYRA 4PPXA 1JXLA 1L3VA 5DB9A 4PGXA 1ZETA 1WCLA 4QZ9A 4ECUA 4M2YA 3Q8MA 8ICOA 4PHEA 4UB2A 4I2JA 4JWNA 4F4YA 3ORYA 4NXZA 4EYHB 1ZQHA 4M9LA 5L1JA 1BVSA 4IQWA 2F1IA 2KFNA 3V6KA 3BJYA 3QZ7A 7ICPA 4ECSA 1BGXT 7ICSA 4RQ5A 2I9GA 5EOZA 3V7LA 4O3PA 1RPLA 5DB7A 4B9TA 5KFGA 4I2CA 9ICOA 3H7IA 5HHHA 1KRPA 4DFMA 2A1JB 4I28A 2KZZA 3HWTA 3V6JA 1NKBA 4RZRA 1KLNA 2ZTDA 1ZQQA 3ZDDA 1JX4A 4FBUA 2XY6A 9ICNA 3V72A 1ZQSA 4UB4A 4K4HA 2OWOA 8ICMA 1D8LA 1BPDA 4GC6A 4B9NA 4B9MA 5J2JA 2BQ3A 4M9NA 4KLTA 3RH6A 8ICLA 4YVZA 5KG1A 4I2BA 3OJSA 9ICMA 5CB1A 2NRWA 3EWAA 5KFPA 2ALZA 2BPFA 4YG2A 4NM2A 4QW9A 1LV5A 4P2HA 3C23A 5KFSA 1SKWA 5KFTA 2HHUA 2PI4A 1X2IA 3RH5A 5D4BA 4ECQA 4J9MA 5CHGA 4O3OA 3JPSA 4RNMA 3JPOA 5KFMA 2R8HA 2XY5A 3PV8A 2ASDA 1QSYA 3KHRA 2AGQA 5KFWA 3TANA 4O5KA 1CUKA 2W9BA 9ICVA 2AGPA 4RQ1A 1TKDA 3MBYA 4DOCA 4RUCA 2BGWA 4QZBA 4DQSA 3RB6A 4DSLA 4EBEA 5DGAA 8ICBA 4GC7A 2AQ4A 3PW0A 3OHAA 1HUOA 5HMMA 1BPEA 4KLMA 2AQ0A 3BQ2A 4CCHA 5BOMA 1XS9D 4F91B 4PHDA 3RR8A 5DBAA 2UVRA 5DBCA 2RDIA 2XO7A 3ZDEA 4IQVA 1KDHA 2MAXA 2XCAA 1TAQA 2KZMA 4XA5A 4I2IA 1N56A 1L3TA 4KMUA 2P66A 1U49A 8ICAA 4ECXA 4DSEA 5J2EA 3Q8QB 3C5GA 1RZTA 4KN4A 1ZQGA 1ZQAA 5IIJA 3FYHA 4XRHA 5KFHA 4J9RA 4UAYA 1NKEA 1NJYA 2UVUA 3JPRA 5IIOA 1IM4A 2XGQA 5J29A 4DOBA 3H40A 4ECVA 2BR0A 5KFBA 1BPXA 4KLOA 2WTFA 1NJZA 4FO6A 3RB0A 5J2KA 1BPYA 1ZQOA 4I27A 2VANA 1HJPA 1S9FA 4M9GA 4KN7A 4I2DA 4TUSA 9ICUA 2R8KA 3GFKB 2C2EA 3GV5B 2BPCA 2B21A 4YR2A 3RBDA 2ASLA 4F2SA 4LZGA 8ICWA 1TK5A 9ICKA 3RTVA 2A1JA 4TUQA 2ZUBA 1D9FA 2PFPA 4YXMA 4YMMA 3RRHA 5DGBA 1ZQCA 1ZQDA 2PFQA 4Z6EA 5DQIA 3PR4A 5KFAA 5KTQA 5DDYA 4TUPA 4JV1A 4KLHA 1DOQA 5KFXA 3JPNA 5J0PA 3UQ0A 4RNNA 1XSPA 3ZDAA 4RPYA 4Q8EA 2PFNA 5HHIA 3RJFA 3M9MB 4DL6A 3TAQA 2NRTA 2IHMA 1B22A 9ICLA 4B9LA 1JN3A 4KLJA 3ZDCA 4DQPA 2UVVA 4ECTA 1S0OA 3V6HA 4KLQA 1JIHA 1ZQEA 2Q0ZX 3PW4A 4IR1A 2DPIA 3MDCA 2VA3A 4B9SA 3ZD8A 1TK0A 2BCSA 7ICRA 1ZQRA 4R63A 4C8KA 4K4IA 3HW8A 3ZD9A 4EZ6A 9ICSA 1U48A 2W9CB 8ICIA 2ZUCA 3T5LA 3SV3A 4C8LA 1QSLA 1QTMA 3RJGA 5DDMA 2XCPA 3MFIA 5L1KA 1KTQA 2ZJ8A 5DQHA 1NK7A 4F50A 3AUOA 4QZFA 9ICTA 4DLEA 5KG7A 4DQQA 2W8LA 2Y1JA 3RBEA 1RXVA 4I29A 1SZPA 4PHAA 2HVHA 2HHSA 5J2GA 4P4PA 4Q44A 4PGQA 5IILA 5KT5A 5F9LA 3KHGA 5KFZA 3GQCA 5J2DA 2ZTCA 4KLEA 4DF8A 5CP2A 2DPJA 4C8MA 3OGUA 2BQRA 4GXIA 1KSPA 5KT2A 5CJ7A 7ICKA 4J9QA 5KT4A 1QSSA 4J9LA 3TQ1A 4DQRA 4KLGA 4RNOA 4RQ0A 4J9NA 9ICWA 7ICMA 3UQ2A 2HHQA 4GLXA 8ICSA 7ICVA 4F5PA 5J0OA 1JXEA 4DO9A 5KFYA 1NK0A 4YR3A 5CWRA 3GDXA 2JEIA 4F5RA 2XY7A 3JPPA 3OSNA 3C2KA 2ISOA 4ECYA 4QZCA 1NK8A 5J0TA 4C8NA 4F4KA 8ICQA 4JUZA 5CA7A 3T3FA 5DLFA 3AU2A 1T3NA 3ZDBA 4E0DA 4YCXA 4R8UB 1BPZA 4ELVA 3RAXA 3TAPA 5DKWA 3EZ5A 5KG0A 4EBCA 4RU9A 5KFOA 5HMLA 4RT3A 5IINA 2V9WA 4DL3A 3EW9A 3RB4A 2JEGA 4DWIA 4F4WA 1RYSA 4M47A 5C5JA 3UPQA 1B43A 9ICJA 4O3SA 5KG3A 4F92B 1XC9A 5KT3A 1NK4A 4G3IA 4NY8A 3RR7A 4I2GA 5J0SA 3HPOA 1SL2A 2XC9A 2IA6A 9ICXA 1D8YA 1ZQZA 5EWEA 2HHVA 4MEYA 3FDSA 1RXWA 1UT5A 4PH5A 1NK5A 4C8OA 1MSWD 4R64A 3T5JA 4ED1A 2FMSA 1UT8A 5J0QA 3PX4A 5J0YA 3THVA 1TK8A 1SKSA 2GWSA 4I2HA 5JUMA 1S0MA 2V4RA 4M9JA 4IQUA 1L5UA 4EZ9A 8ICZA 3HP6A 9ICPA 3LDAA 2IMWP 3BQ1A 3SI8A 1XO1A 5DG9A 4QWBA 2W9CA 3BQ0A 5BPCA 3N4MB 5EWFA 4Q8FA 7ICJA 1KEJA 1A76A 7ICLA 1PZNA 2KN7A 1S77D 4NLZA 2R8GA 3PMNA 1MC8A 5KT6A 4QZEA 4DL7A 3PO5A 4RQ3A 4MEXA 4IR9A 2HVIA 4BDPA 4RPXA 5J2IA 4O0IA 2FPLA 4ELTA 4ED2A 4UAZA 3RRGA 3RJHA 4LZDA 5J2BA 4NLGA 5J2HA 4ECWA 4XUSA 4GXKA 4RUAA 3QEAZ 3BQTA 5DQGA 3C2MA 5J2AA 4RQ6A 2PFOA 4FBTA 4DQIA 5L1IA 1WCNA 3RJKA 1XU4A 4Z6CA 5J0RA 4M0AA 9ICRA 4ED0A 3HT3A 4DEZA 7ICEA 2FMQA 1K1SA 1MQ3A 1T8EA 1ZJNA 2MUTB 2NRXA 3N97B 4MFAA 3K4GA 4P4MA 4YFKA 4DL5A 1ZQMA 4B9UA 5KG4A 9ICQA 3EPIA 3GILA 1AROP 3TFSA 5KG5A 3G6YA 4DSKA 3MR6A 3PVXA 2J6UA 7ICQA 1Y88A 2JZBB 4IRDA 2C2RA 3PW7A 4F5NA 2KFZA 3PMLA 1H38A 2FPKA 3K75D 2FLPA 1NK6A 3ISCA 4LVSA 4UBCA 1ZQIA 4JV2A 3T5KA 3NTUA 4EEYA 3KTQA 4R8UA 2W9AA 4DL4A 3B0YA 2DFLA 3BDPA 2BPGA 7ICHA 5BOLA 3V7JA 2XGPA 3G6XA 8ICVA 5TZVA 7ICOA 9ICHA 1TAUA 2BCQA 2R8JA 3M9NB 3H4BA 2C22A 4QWDA 2HHTA 4GXJA 2AU0A 5HNKA 2PXIA 3LWLA 2W8KA 4QZHA 3MGIA 1KFDA 4DSFA 3PO4A 1X9WA 3LWMA 7ICFA 4F4XA 4ED8A 3AU6A 3JPQA 4Z6DA 3MR5A 5DBBA 4DOAA 5KFDA 3KHHA 1ZQLA 2JEFA 3HX0A 4TQSA 1ZQPA 4HYKA 4NLKA 2FLLA 4O3QA 1U45A 4UQGA 3MABA 5J0UA 4XQ8A 3T5HA 2BCUA 3SZ2A 4ELUA 4YD2A 4BGDA 2ZJ5A 3RJJA 1ZQUA 4J9KA 5D49A 3TI0A 2VA2A 4M04A 3PY8A 8ICGA 5KG6A 3TFRA 4RQ8A 4DF4A 3TARA 4F3OA 3C5FA 1X9MA 4I2FA 4ZH4A 4QWCA 2ISPA 4IRKA 4KITB 2KTQA 2F1JA 1D9DA 1S97A 8ICHA 3Q8RB 1LB2B 2W9MA 1S0NA 1QLNA 5KFEA 2HW3A 3GV7B 4YN4A 1UA1A 2ASJA 4MF8A 3PR5B 3ISBA 1NJXA 4BWMA 4KLSA 9ICGA 3C1YA 4YQWA 1XSLA 3H8SA 4ED7A 9ICFA 8ICXA 3Q8PB 3E2EA 4YMOA 4BWJA 1NKCA 3UXNA 4QZ8A 5D46A 4KLLA 5DG7A 1T7PA 4Q45A 4X5VA 2C28A 1SL1A 4MF2A 8ICRA 2IBKA 1SKRA 1Z00B 4F5QA 8ICPA 1L3UA 9ICBA 1U47A 3MFHA 2MUTA 4MFFA 4QWEA 4Z6FA 5DLGA 4F5OA 2BKEA 3MDAA 4KLFA 2ZJAA 1ZQYA 4BXOB 1NJWA 2H5XA 4MFCA 1CEZA 1MQ2A 1EXNA 5J2CA 4M6WB 2VA8A 8ICEA 2JZBA 4NLNA 2BCRA 3SYZA 4O5EA 1NOMA 3V7KA 5J0XA 4DFJA 7ICUA 1U9LA 1DGSA 8ICCA 2UVWA 4DSIA 5KT7A 3H4DA 7ICIA 3G6VA 4NM1A 1ZQFA 4UB5A 3PW2A 2I1QA 4UAWA 4UB3A 2FPMA 5KFVA 8ICNA 9ICIA 1KFTA 3B0XA 5DB6A 4FS1A 3ISDA 1ZQTA 2RDJA 1X9SA 2JEJA 4DS4A 3PX6A 1COOA 3MR3A 5J0WA 4QWAA 3GIMA 8ICYA 3SV4A 3GIIA 2ZUDA 5HP4A 4DFPA 3MR2A 2C2DA 3IHQB 4F93B 3GIKA 1NK9A 7ICNA 8ICFA 1JMSA 2HHWA 4ED6A 4TURA 3Q8KA 2PI5A 4RQ2A 2FMPA 1BPBA 4IQTA 5KFQA 3RB3A 4ED3A 3RAQA 2F1HA 1T4GA 3PNCA 5DG8A 4DL2A 4JWMA 1ZQBA 1V9PA 5DB8A 2NRZA 3QE9Y 2P6RA 4M9HA 2KZ3A 4YR0A 5KFKA 5KFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3N A;  4R66 A;  4YD1 A;  5J2F A;  5KFR A;  2HHX A;  4P4O A;  1ZQX A;  4YXJ A;  4UBB A;  5L1L A;  1S76 D;  7ICT A;  3UXP A;  3GV8 B;  5KFI A;  5KFU A;  4I2E A;  4RQ4 A;  5IIM A;  2BQU A;  1XSN A;  3IM1 A;  4RPZ A;  3C21 A;  4UB1 A;  4J9S A;  4KLU A;  3OJU A;  2M9N A;  1SL0 A;  2FLN A;  3RJE A;  9ICA A;  8ICJ A;  5IIK A;  4QZI A;  4RQ7 A;  3PW5 A;  4DSJ A;  3PX0 A;  2AGO A;  4QW8 A;  3M8S A;  9ICC A;  1ZQJ A;  3H8W A;  1K1Q A;  4J9O A;  3EYZ A;  1S10 A;  3LK9 A;  4F8R A;  5KFL A;  1S0V A;  1XWL A;  2IHN A;  3C1Z A;  1KFS A;  4ECR A;  1N48 A;  1ZQW A;  4QZD A;  2BCV A;  4FS2 A;  5F9N A;  4TQR A;  1Z00 A;  4R65 A;  2J6T A;  8ICT A;  4I2A A;  1U4B A;  3RH4 A;  2BHN A;  4RT2 A;  4PGY A;  3QEB Z;  4K4G A;  1UA0 A;  2W9B B;  1HUZ A;  5KFN A;  4BXO A;  1C7Y A;  5III A;  4DLG A;  4J9P A;  3UXO A;  3MGH A;  4M6W A;  2NRV A;  4EBD A;  1TV9 A;  2Y1I A;  5CR0 A;  4QZA A;  3RJI A;  3GIJ A;  3JPT A;  7ICG A;  4O3R A;  2AJQ A;  2ZTE A;  5L9X A;  4DS5 A;  3Q8S B;  4Q43 A;  2LYH A;  5KFF A;  4IRC A;  4JV0 A;  4EYI B;  4O5C A;  5EWG A;  4QZG A;  1A77 A;  3M8R A;  3EPG A;  3OHB A;  2R8I A;  1ZQV A;  1L3S A;  4PHP A;  3M9O B;  3C2L A;  3QZ8 A;  1Z3E B;  5KG2 A;  2P6U A;  4DFK A;  4O9M A;  3OSP A;  3ETL A;  1ZJM A;  4YMN A;  2ATL A;  2J6S A;  4B9V A;  4JK1 A;  1ZQK A;  4F2R A;  3NGD A;  4KTQ A;  2BDP A;  8ICK A;  3KHL A;  5KFC A;  3H8J A;  2V4Q A;  1IXR A;  3Q8L A;  4KLI A;  4YP3 A;  9ICE A;  1TFR A;  1ZQN A;  4ECZ A;  4F4Z A;  8ICU A;  4KLD A;  1ZYQ A;  1TVA A;  1RYR A;  4PPX A;  1JXL A;  1L3V A;  5DB9 A;  4PGX A;  1ZET A;  1WCL A;  4QZ9 A;  4ECU A;  4M2Y A;  3Q8M A;  8ICO A;  4PHE A;  4UB2 A;  4I2J A;  4JWN A;  4F4Y A;  3ORY A;  4NXZ A;  4EYH B;  1ZQH A;  4M9L A;  5L1J A;  1BVS A;  4IQW A;  2F1I A;  2KFN A;  3V6K A;  3BJY A;  3QZ7 A;  7ICP A;  4ECS A;  1BGX T;  7ICS A;  4RQ5 A;  2I9G A;  5EOZ A;  3V7L A;  4O3P A;  1RPL A;  5DB7 A;  4B9T A;  5KFG A;  4I2C A;  9ICO A;  3H7I A;  5HHH A;  1KRP A;  4DFM A;  2A1J B;  4I28 A;  2KZZ A;  3HWT A;  3V6J A;  1NKB A;  4RZR A;  1KLN A;  2ZTD A;  1ZQQ A;  3ZDD A;  1JX4 A;  4FBU A;  2XY6 A;  9ICN A;  3V72 A;  1ZQS A;  4UB4 A;  4K4H A;  2OWO A;  8ICM A;  1D8L A;  1BPD A;  4GC6 A;  4B9N A;  4B9M A;  5J2J A;  2BQ3 A;  4M9N A;  4KLT A;  3RH6 A;  8ICL A;  4YVZ A;  5KG1 A;  4I2B A;  3OJS A;  9ICM A;  5CB1 A;  2NRW A;  3EWA A;  5KFP A;  2ALZ A;  2BPF A;  4YG2 A;  4NM2 A;  4QW9 A;  1LV5 A;  4P2H A;  3C23 A;  5KFS A;  1SKW A;  5KFT A;  2HHU A;  2PI4 A;  1X2I A;  3RH5 A;  5D4B A;  4ECQ A;  4J9M A;  5CHG A;  4O3O A;  3JPS A;  4RNM A;  3JPO A;  5KFM A;  2R8H A;  2XY5 A;  3PV8 A;  2ASD A;  1QSY A;  3KHR A;  2AGQ A;  5KFW A;  3TAN A;  4O5K A;  1CUK A;  2W9B A;  9ICV A;  2AGP A;  4RQ1 A;  1TKD A;  3MBY A;  4DOC A;  4RUC A;  2BGW A;  4QZB A;  4DQS A;  3RB6 A;  4DSL A;  4EBE A;  5DGA A;  8ICB A;  4GC7 A;  2AQ4 A;  3PW0 A;  3OHA A;  1HUO A;  5HMM A;  1BPE A;  4KLM A;  2AQ0 A;  3BQ2 A;  4CCH A;  5BOM A;  1XS9 D;  4F91 B;  4PHD A;  3RR8 A;  5DBA A;  2UVR A;  5DBC A;  2RDI A;  2XO7 A;  3ZDE A;  4IQV A;  1KDH A;  2MAX A;  2XCA A;  1TAQ A;  2KZM A;  4XA5 A;  4I2I A;  1N56 A;  1L3T A;  4KMU A;  2P66 A;  1U49 A;  8ICA A;  4ECX A;  4DSE A;  5J2E A;  3Q8Q B;  3C5G A;  1RZT A;  4KN4 A;  1ZQG A;  1ZQA A;  5IIJ A;  3FYH A;  4XRH A;  5KFH A;  4J9R A;  4UAY A;  1NKE A;  1NJY A;  2UVU A;  3JPR A;  5IIO A;  1IM4 A;  2XGQ A;  5J29 A;  4DOB A;  3H40 A;  4ECV A;  2BR0 A;  5KFB A;  1BPX A;  4KLO A;  2WTF A;  1NJZ A;  4FO6 A;  3RB0 A;  5J2K A;  1BPY A;  1ZQO A;  4I27 A;  2VAN A;  1HJP A;  1S9F A;  4M9G A;  4KN7 A;  4I2D A;  4TUS A;  9ICU A;  2R8K A;  3GFK B;  2C2E A;  3GV5 B;  2BPC A;  2B21 A;  4YR2 A;  3RBD A;  2ASL A;  4F2S A;  4LZG A;  8ICW A;  1TK5 A;  9ICK A;  3RTV A;  2A1J A;  4TUQ A;  2ZUB A;  1D9F A;  2PFP A;  4YXM A;  4YMM A;  3RRH A;  5DGB A;  1ZQC A;  1ZQD A;  2PFQ A;  4Z6E A;  5DQI A;  3PR4 A;  5KFA A;  5KTQ A;  5DDY A;  4TUP A;  4JV1 A;  4KLH A;  1DOQ A;  5KFX A;  3JPN A;  5J0P A;  3UQ0 A;  4RNN A;  1XSP A;  3ZDA A;  4RPY A;  4Q8E A;  2PFN A;  5HHI A;  3RJF A;  3M9M B;  4DL6 A;  3TAQ A;  2NRT A;  2IHM A;  1B22 A;  9ICL A;  4B9L A;  1JN3 A;  4KLJ A;  3ZDC A;  4DQP A;  2UVV A;  4ECT A;  1S0O A;  3V6H A;  4KLQ A;  1JIH A;  1ZQE A;  2Q0Z X;  3PW4 A;  4IR1 A;  2DPI A;  3MDC A;  2VA3 A;  4B9S A;  3ZD8 A;  1TK0 A;  2BCS A;  7ICR A;  1ZQR A;  4R63 A;  4C8K A;  4K4I A;  3HW8 A;  3ZD9 A;  4EZ6 A;  9ICS A;  1U48 A;  2W9C B;  8ICI A;  2ZUC A;  3T5L A;  3SV3 A;  4C8L A;  1QSL A;  1QTM A;  3RJG A;  5DDM A;  2XCP A;  3MFI A;  5L1K A;  1KTQ A;  2ZJ8 A;  5DQH A;  1NK7 A;  4F50 A;  3AUO A;  4QZF A;  9ICT A;  4DLE A;  5KG7 A;  4DQQ A;  2W8L A;  2Y1J A;  3RBE A;  1RXV A;  4I29 A;  1SZP A;  4PHA A;  2HVH A;  2HHS A;  5J2G A;  4P4P A;  4Q44 A;  4PGQ A;  5IIL A;  5KT5 A;  5F9L A;  3KHG A;  5KFZ A;  3GQC A;  5J2D A;  2ZTC A;  4KLE A;  4DF8 A;  5CP2 A;  2DPJ A;  4C8M A;  3OGU A;  2BQR A;  4GXI A;  1KSP A;  5KT2 A;  5CJ7 A;  7ICK A;  4J9Q A;  5KT4 A;  1QSS A;  4J9L A;  3TQ1 A;  4DQR A;  4KLG A;  4RNO A;  4RQ0 A;  4J9N A;  9ICW A;  7ICM A;  3UQ2 A;  2HHQ A;  4GLX A;  8ICS A;  7ICV A;  4F5P A;  5J0O A;  1JXE A;  4DO9 A;  5KFY A;  1NK0 A;  4YR3 A;  5CWR A;  3GDX A;  2JEI A;  4F5R A;  2XY7 A;  3JPP A;  3OSN A;  3C2K A;  2ISO A;  4ECY A;  4QZC A;  1NK8 A;  5J0T A;  4C8N A;  4F4K A;  8ICQ A;  4JUZ A;  5CA7 A;  3T3F A;  5DLF A;  3AU2 A;  1T3N A;  3ZDB A;  4E0D A;  4YCX A;  4R8U B;  1BPZ A;  4ELV A;  3RAX A;  3TAP A;  5DKW A;  3EZ5 A;  5KG0 A;  4EBC A;  4RU9 A;  5KFO A;  5HML A;  4RT3 A;  5IIN A;  2V9W A;  4DL3 A;  3EW9 A;  3RB4 A;  2JEG A;  4DWI A;  4F4W A;  1RYS A;  4M47 A;  5C5J A;  3UPQ A;  1B43 A;  9ICJ A;  4O3S A;  5KG3 A;  4F92 B;  1XC9 A;  5KT3 A;  1NK4 A;  4G3I A;  4NY8 A;  3RR7 A;  4I2G A;  5J0S A;  3HPO A;  1SL2 A;  2XC9 A;  2IA6 A;  9ICX A;  1D8Y A;  1ZQZ A;  5EWE A;  2HHV A;  4MEY A;  3FDS A;  1RXW A;  1UT5 A;  4PH5 A;  1NK5 A;  4C8O A;  1MSW D;  4R64 A;  3T5J A;  4ED1 A;  2FMS A;  1UT8 A;  5J0Q A;  3PX4 A;  5J0Y A;  3THV A;  1TK8 A;  1SKS A;  2GWS A;  4I2H A;  5JUM A;  1S0M A;  2V4R A;  4M9J A;  4IQU A;  1L5U A;  4EZ9 A;  8ICZ A;  3HP6 A;  9ICP A;  3LDA A;  2IMW P;  3BQ1 A;  3SI8 A;  1XO1 A;  5DG9 A;  4QWB A;  2W9C A;  3BQ0 A;  5BPC A;  3N4M B;  5EWF A;  4Q8F A;  7ICJ A;  1KEJ A;  1A76 A;  7ICL A;  1PZN A;  2KN7 A;  1S77 D;  4NLZ A;  2R8G A;  3PMN A;  1MC8 A;  5KT6 A;  4QZE A;  4DL7 A;  3PO5 A;  4RQ3 A;  4MEX A;  4IR9 A;  2HVI A;  4BDP A;  4RPX A;  5J2I A;  4O0I A;  2FPL A;  4ELT A;  4ED2 A;  4UAZ A;  3RRG A;  3RJH A;  4LZD A;  5J2B A;  4NLG A;  5J2H A;  4ECW A;  4XUS A;  4GXK A;  4RUA A;  3QEA Z;  3BQT A;  5DQG A;  3C2M A;  5J2A A;  4RQ6 A;  2PFO A;  4FBT A;  4DQI A;  5L1I A;  1WCN A;  3RJK A;  1XU4 A;  4Z6C A;  5J0R A;  4M0A A;  9ICR A;  4ED0 A;  3HT3 A;  4DEZ A;  7ICE A;  2FMQ A;  1K1S A;  1MQ3 A;  1T8E A;  1ZJN A;  2MUT B;  2NRX A;  3N97 B;  4MFA A;  3K4G A;  4P4M A;  4YFK A;  4DL5 A;  1ZQM A;  4B9U A;  5KG4 A;  9ICQ A;  3EPI A;  3GIL A;  1ARO P;  3TFS A;  5KG5 A;  3G6Y A;  4DSK A;  3MR6 A;  3PVX A;  2J6U A;  7ICQ A;  1Y88 A;  2JZB B;  4IRD A;  2C2R A;  3PW7 A;  4F5N A;  2KFZ A;  3PML A;  1H38 A;  2FPK A;  3K75 D;  2FLP A;  1NK6 A;  3ISC A;  4LVS A;  4UBC A;  1ZQI A;  4JV2 A;  3T5K A;  3NTU A;  4EEY A;  3KTQ A;  4R8U A;  2W9A A;  4DL4 A;  3B0Y A;  2DFL A;  3BDP A;  2BPG A;  7ICH A;  5BOL A;  3V7J A;  2XGP A;  3G6X A;  8ICV A;  5TZV A;  7ICO A;  9ICH A;  1TAU A;  2BCQ A;  2R8J A;  3M9N B;  3H4B A;  2C22 A;  4QWD A;  2HHT A;  4GXJ A;  2AU0 A;  5HNK A;  2PXI A;  3LWL A;  2W8K A;  4QZH A;  3MGI A;  1KFD A;  4DSF A;  3PO4 A;  1X9W A;  3LWM A;  7ICF A;  4F4X A;  4ED8 A;  3AU6 A;  3JPQ A;  4Z6D A;  3MR5 A;  5DBB A;  4DOA A;  5KFD A;  3KHH A;  1ZQL A;  2JEF A;  3HX0 A;  4TQS A;  1ZQP A;  4HYK A;  4NLK A;  2FLL A;  4O3Q A;  1U45 A;  4UQG A;  3MAB A;  5J0U A;  4XQ8 A;  3T5H A;  2BCU A;  3SZ2 A;  4ELU A;  4YD2 A;  4BGD A;  2ZJ5 A;  3RJJ A;  1ZQU A;  4J9K A;  5D49 A;  3TI0 A;  2VA2 A;  4M04 A;  3PY8 A;  8ICG A;  5KG6 A;  3TFR A;  4RQ8 A;  4DF4 A;  3TAR A;  4F3O A;  3C5F A;  1X9M A;  4I2F A;  4ZH4 A;  4QWC A;  2ISP A;  4IRK A;  4KIT B;  2KTQ A;  2F1J A;  1D9D A;  1S97 A;  8ICH A;  3Q8R B;  1LB2 B;  2W9M A;  1S0N A;  1QLN A;  5KFE A;  2HW3 A;  3GV7 B;  4YN4 A;  1UA1 A;  2ASJ A;  4MF8 A;  3PR5 B;  3ISB A;  1NJX A;  4BWM A;  4KLS A;  9ICG A;  3C1Y A;  4YQW A;  1XSL A;  3H8S A;  4ED7 A;  9ICF A;  8ICX A;  3Q8P B;  3E2E A;  4YMO A;  4BWJ A;  1NKC A;  3UXN A;  4QZ8 A;  5D46 A;  4KLL A;  5DG7 A;  1T7P A;  4Q45 A;  4X5V A;  2C28 A;  1SL1 A;  4MF2 A;  8ICR A;  2IBK A;  1SKR A;  1Z00 B;  4F5Q A;  8ICP A;  1L3U A;  9ICB A;  1U47 A;  3MFH A;  2MUT A;  4MFF A;  4QWE A;  4Z6F A;  5DLG A;  4F5O A;  2BKE A;  3MDA A;  4KLF A;  2ZJA A;  1ZQY A;  4BXO B;  1NJW A;  2H5X A;  4MFC A;  1CEZ A;  1MQ2 A;  1EXN A;  5J2C A;  4M6W B;  2VA8 A;  8ICE A;  2JZB A;  4NLN A;  2BCR A;  3SYZ A;  4O5E A;  1NOM A;  3V7K A;  5J0X A;  4DFJ A;  7ICU A;  1U9L A;  1DGS A;  8ICC A;  2UVW A;  4DSI A;  5KT7 A;  3H4D A;  7ICI A;  3G6V A;  4NM1 A;  1ZQF A;  4UB5 A;  3PW2 A;  2I1Q A;  4UAW A;  4UB3 A;  2FPM A;  5KFV A;  8ICN A;  9ICI A;  1KFT A;  3B0X A;  5DB6 A;  4FS1 A;  3ISD A;  1ZQT A;  2RDJ A;  1X9S A;  2JEJ A;  4DS4 A;  3PX6 A;  1COO A;  3MR3 A;  5J0W A;  4QWA A;  3GIM A;  8ICY A;  3SV4 A;  3GII A;  2ZUD A;  5HP4 A;  4DFP A;  3MR2 A;  2C2D A;  3IHQ B;  4F93 B;  3GIK A;  1NK9 A;  7ICN A;  8ICF A;  1JMS A;  2HHW A;  4ED6 A;  4TUR A;  3Q8K A;  2PI5 A;  4RQ2 A;  2FMP A;  1BPB A;  4IQT A;  5KFQ A;  3RB3 A;  4ED3 A;  3RAQ A;  2F1H A;  1T4G A;  3PNC A;  5DG8 A;  4DL2 A;  4JWM A;  1ZQB A;  1V9P A;  5DB8 A;  2NRZ A;  3QE9 Y;  2P6R A;  4M9H A;  2KZ3 A;  4YR0 A;  5KFK A;  5KFJ A; 
#chains in the Genus database with same CATH topology
 2D3D A;  1KL9 A;  3AM9 A;  1ZQX A;  5L1L A;  2FJ6 A;  2DGZ A;  4I2E A;  5IIM A;  2BQU A;  1XSN A;  4J9S A;  3WKB A;  4NL9 A;  4RPZ A;  4KLU A;  2HOI A;  1UQV A;  1T94 A;  3PW5 A;  2F76 X;  5ALL A;  4DSJ A;  2R18 A;  2ZG6 A;  3H8W A;  3EYZ A;  3LK9 A;  5KFL A;  1S0V A;  1XWL A;  2IHN A;  1KFS A;  4QZD A;  2KSO A;  1L7M A;  1JRP A;  3RH4 A;  1SZH A;  2BHN A;  5B5E U;  1SV4 A;  4PGY A;  3QEB Z;  4Y2R A;  2W9B B;  4BXO A;  2M0N A;  2E8P A;  3K1R B;  4J9P A;  3UXO A;  4EBD A;  1Z1B A;  2Y1I A;  1RQL A;  3JPT A;  2KK0 A;  2LI6 A;  3F53 A;  1FO4 A;  5AI9 A;  2R8I A;  3M8R A;  1A77 A;  2H3I A;  2QB0 A;  3PST A;  3SR6 A;  1PVQ A;  2W54 A;  3C2L A;  3QZ8 A;  5KG2 A;  3BQ7 A;  4O9M A;  3ETL A;  4F2R A;  2J6S A;  1ZQK A;  3NGD A;  1OW5 A;  5KFC A;  3H8J A;  1ZOL A;  9ICE A;  4ECZ A;  3S6J A;  1ED1 A;  1L3V A;  5DB9 A;  1SB3 C;  8ICO A;  2E5S A;  3Q8M A;  5AIB A;  4UB2 A;  4JWN A;  3ORY A;  1ZQH A;  2F1I A;  4P0Q B;  3V6K A;  3QZ7 A;  4G9B A;  4O3P A;  5DB7 A;  2QB1 A;  5KFG A;  2K4E A;  3H7I A;  5HHH A;  2A1J B;  1KLN A;  1ZQQ A;  2XY6 A;  4UAT A;  1ZQS A;  5ALS A;  1A6S A;  4B9N A;  4NLB A;  5ALR A;  3N7R C;  2BPF A;  2JXJ A;  2ZIW A;  4QW9 A;  1VJ5 A;  3C23 A;  5KFT A;  2PI4 A;  3GU3 A;  5CHG A;  1L7P A;  4O3O A;  3JPO A;  5KFM A;  2R8H A;  1QSY A;  3KHR A;  4CF3 A;  4O5K A;  1M6Y A;  2AGP A;  1TKD A;  2D8C A;  4CRX A;  4DQS A;  2K4I A;  3PW0 A;  1BPE A;  3NVY A;  2XO7 A;  2WF7 A;  3ONN A;  4IQV A;  3QYP A;  2XCA A;  1TAQ A;  4XA5 A;  1ZQ1 C;  2EZY A;  1RDF A;  4KMU A;  4AP9 A;  1RZT A;  3Q8Q B;  1ZQA A;  2E8O A;  2QAR B;  4UAY A;  2WF5 A;  4ECV A;  4UAV A;  2BR0 A;  2NO5 A;  1NZP A;  5KFB A;  2WTF A;  3RB0 A;  4BUG A;  1HJP A;  1S9F A;  3WK6 A;  9ICU A;  3A0H U;  3GV5 B;  1PVR A;  3NUQ A;  2BPC A;  4PZO A;  4YR2 A;  8ICW A;  9ICK A;  3RTV A;  2E1F A;  2ZUB A;  2DBY A;  2PFP A;  1X66 A;  5DGB A;  2PFQ A;  4QJF B;  5KTQ A;  2KVS A;  3UM9 A;  4CE6 A;  3HJE A;  3JPN A;  1XSP A;  4RPY A;  3UMG A;  2NRT A;  2RRD A;  1ZD2 P;  3VCB A;  4UW9 A;  5ALK A;  1QCK A;  3TAD A;  4KLQ A;  4UB6 U;  4B9S A;  2HBM A;  7ICR A;  3ZD9 A;  3GZF A;  4EZ6 A;  9ICS A;  3SV3 A;  2Q4T A;  5DDM A;  1KTQ A;  3E0F A;  3AUO A;  4QZF A;  4DLE A;  3LVW A;  3IG8 A;  4DQQ A;  2Y1J A;  3BS5 A;  1RM6 C;  5J2G A;  4Q44 A;  3PW4 A;  3GQC A;  4KLE A;  5CP2 A;  4GXI A;  5KT2 A;  5CJ7 A;  4J9L A;  3SAH A;  4DQR A;  1KN5 A;  3UQ2 A;  4C7Y A;  5J0O A;  1JXE A;  3IRU A;  4DCC A;  5KFY A;  3UMC A;  3GDX A;  2JEI A;  4F5R A;  2XY7 A;  3JPP A;  3C2K A;  5J0T A;  4F4K A;  1L7N A;  5HR7 A;  5DLF A;  4B6J A;  3AU2 A;  2JH7 A;  3ZDB A;  3ETR A;  4R8U B;  3RAX A;  3TAP A;  2GO7 A;  3C28 A;  4CNQ A;  4RT3 A;  1ECW A;  4DL3 A;  3EW9 A;  3RB4 A;  4DWI A;  1RYS A;  4QIW C;  5C5J A;  4O3S A;  4J03 A;  3RR7 A;  3T79 A;  4I2G A;  1N63 A;  5J0S A;  2G06 A;  1SL2 A;  1TAM A;  2YB1 A;  1ZQZ A;  4CDG A;  5AI8 A;  2GH1 A;  2JGA A;  4MEY A;  2Y9U A;  1UT5 A;  4C8O A;  4R64 A;  3THV A;  1SKS A;  1S0M A;  2V4R A;  3QU4 A;  1WUD A;  5AM5 A;  3BQ1 A;  3SI8 A;  1XO1 A;  3BQ0 A;  7ICJ A;  5BPC A;  2G09 A;  4UAR A;  1S77 D;  5KT6 A;  3PO5 A;  4RQ3 A;  4MEX A;  4IR9 A;  2ES6 A;  4BDP A;  4RPX A;  5J2I A;  4UAZ A;  3R9K A;  2DUY A;  3ICX A;  4RQ6 A;  2B0C A;  1XU4 A;  4M0A A;  3HT3 A;  4DEZ A;  7ICE A;  2FMQ A;  1MQ3 A;  2MUT B;  4OCZ A;  4P4M A;  4FE3 A;  3IG5 A;  5KG5 A;  4DSK A;  3MR6 A;  3ALR A;  3AN1 A;  7ICQ A;  1Y88 A;  2KFZ A;  4P0P B;  2FLP A;  3MGV A;  4UBC A;  2L5Y A;  1P7D A;  3B0Y A;  2OEH A;  1YT3 A;  5BOL A;  1V85 A;  2HDO A;  3M9N B;  4F72 A;  3H4B A;  2C22 A;  2HHT A;  2AU0 A;  5AK6 A;  3MGI A;  4DSF A;  7ICF A;  3IP4 B;  3ED5 A;  4Z6D A;  5DBB A;  3KHH A;  2JEF A;  1ZQP A;  5AKI A;  1O08 A;  5ALZ A;  2F3N A;  2FLL A;  4UQG A;  2KJ9 A;  3MAB A;  3F2C A;  3T5H A;  2BCU A;  2LMR A;  4ELU A;  2WB1 F;  1PK1 A;  2KNJ A;  4J9K A;  3TI0 A;  4M04 A;  5KG6 A;  4F3O A;  1X9M A;  4ZH4 A;  2ISP A;  2F1J A;  1D9D A;  3Q8R B;  1S0N A;  5AK3 A;  2ASJ A;  3PR5 B;  1VLB A;  4KLS A;  3H8S A;  5AHX A;  3SEN A;  2WAQ F;  4EEN A;  1NKC A;  2E3T A;  3E58 A;  3AQF A;  5DG7 A;  1T7P A;  1SL1 A;  1L3U A;  4MFF A;  5DLG A;  4KLF A;  1L6N A;  1ZQY A;  1SWV A;  1CI4 A;  3WK8 A;  2VA8 A;  4CGZ A;  4NLN A;  2BCR A;  3SYZ A;  1NOM A;  4DFJ A;  4IS7 A;  5J0X A;  3N7P D;  2HBL A;  3H4D A;  2EH9 A;  4UAW A;  8ICN A;  5KFV A;  9ICI A;  1KFT A;  2ZIX A;  2WAQ C;  1QH9 A;  3NVW A;  1FFV A;  1X9S A;  1PK3 A;  3PSP A;  1OUQ A;  2YN4 A;  3TAC B;  1IV8 A;  4QWA A;  3GIM A;  8ICY A;  1QQ6 A;  3SV4 A;  2ZUD A;  1JRO A;  4DFP A;  5AM3 A;  3MR2 A;  5KAI U;  2HHW A;  2HI0 A;  4TUR A;  1SV0 A;  1BPB A;  3RB3 A;  2F44 A;  4ED3 A;  3RAQ A;  1T4G A;  1WYG A;  5KFK A;  4O3N A;  2H3Z A;  1DRG A;  2AH5 A;  5AKX A;  1C20 A;  4OJ5 A;  5KFI A;  3FM9 A;  3IM1 A;  3C21 A;  4NWI A;  3OJU A;  2MU2 A;  2M9N A;  2FLN A;  3RJE A;  4QNL A;  4UAS A;  5IIK A;  4QZI A;  2HOQ A;  1X40 A;  3M8S A;  9ICC A;  1ZQJ A;  1S10 A;  3C1Z A;  4ECR A;  4FS2 A;  4RT2 A;  2PMZ F;  4C4S A;  4ZOH C;  2ZIV B;  2JHD A;  4QZA A;  2K8A A;  3GIJ A;  7ICG A;  2DWQ A;  4O3R A;  2ZTE A;  4EEK A;  2B6G A;  3Q8S B;  2H3F A;  3D2S A;  4O5C A;  5EWG A;  2LM1 A;  3DEE A;  1L3S A;  3U26 A;  2DKZ A;  1VDV A;  1Z3E B;  2VIX A;  3SQI A;  2P6U A;  2KKV A;  2ATL A;  4JK1 A;  4KTQ A;  3QXG A;  2OHF A;  2E8M A;  1IXR A;  1ZQN A;  2PMZ C;  3NRW A;  4F4Z A;  8ICU A;  4F71 A;  1AQ6 A;  1URJ A;  4PGX A;  3A0B U;  5G5H A;  4F4Y A;  7ICP A;  1BGX T;  2G08 A;  5EOZ A;  3V7L A;  9ICO A;  4DFM A;  3WKE A;  5EE9 A;  2KZZ A;  1NKB A;  3V6J A;  5J8Y C;  3ZDD A;  2DKX A;  4UB4 A;  8ICM A;  4GC6 A;  4B9M A;  4M9N A;  5J2J A;  2BQ3 A;  2RP5 A;  3OJS A;  9ICM A;  2KP7 A;  1LV5 A;  4P2H A;  2EZZ A;  1X2I A;  2K4P A;  3JPS A;  2XY5 A;  3PV8 A;  2HMX A;  1CUK A;  2W9B A;  9ICV A;  2OCE A;  4Y2J A;  5B66 U;  2OYY A;  2YML A;  2ZXH A;  4EBE A;  4Y2V A;  4GC7 A;  2AQ4 A;  3OHA A;  2AQ0 A;  3BS7 A;  4F91 B;  4PHD A;  3RR8 A;  5DBA A;  5KAF U;  2RDI A;  3ZDE A;  1KDH A;  2MAX A;  1D8B A;  4NL9 C;  2YB4 A;  1SIJ A;  2A19 A;  1U49 A;  4DSE A;  3FYH A;  4XRH A;  5KFH A;  2P35 A;  1WWV A;  3JPR A;  3LVV A;  5AK4 A;  5IIO A;  1IM4 A;  3CNH A;  3H40 A;  1BPX A;  5ALI A;  1NJZ A;  1BPY A;  4I27 A;  4M9G A;  5JU5 A;  3WKD A;  3GFK B;  4P0Q A;  2KMD A;  1L8O A;  2WF8 A;  2B21 A;  1TK5 A;  2A1J A;  4TUQ A;  2W04 A;  4YXM A;  3RRH A;  1DGJ A;  3UQ0 A;  5J0P A;  3ZDA A;  4DL6 A;  3QNM A;  9ICL A;  2RQ5 A;  2YMM A;  4DQP A;  2UVV A;  3NVV A;  3N7S C;  3V6H A;  1K5O A;  1ZQE A;  5CRX A;  4IR1 A;  2VA3 A;  3MDC A;  4KX3 A;  3SAF A;  4R63 A;  2EAN A;  1U48 A;  1JI7 A;  3HRD D;  4C8L A;  2EAO A;  4NV0 A;  1QSL A;  3OTQ A;  3M6K A;  3RJG A;  5KL8 B;  1Q3U A;  2XCP A;  3MFI A;  5DQH A;  2HSZ A;  1NK7 A;  9ICT A;  5KG7 A;  3RBE A;  4FZM A;  2HHS A;  4P4P A;  2ZXI A;  2QAR A;  5J2D A;  4DF8 A;  4KX5 A;  2BQR A;  1KSP A;  3N28 A;  1QSS A;  3TQ1 A;  4KLG A;  4ICA A;  2LPE A;  2XVT A;  3I1Y A;  4RQ0 A;  7ICM A;  2HHQ A;  1F44 A;  4DO9 A;  3QUB A;  3QU9 A;  2G5H B;  2WF6 A;  4AYB F;  3T3F A;  1UHU A;  5DKW A;  5KG0 A;  4RU9 A;  5KFO A;  2V9W A;  3KBB A;  2AHO B;  4F4W A;  3UPQ A;  5KG3 A;  3RF9 A;  1NK4 A;  4NY8 A;  3K1Z A;  9ICX A;  2IA6 A;  5EWE A;  3CRX A;  2HHV A;  4PH5 A;  1NK5 A;  1MSW D;  1UT8 A;  4AYB C;  4I2H A;  3ZI4 A;  5JUM A;  3L4P A;  8ICZ A;  2IMW P;  3QU7 A;  2A3V A;  5EWF A;  1T3Q A;  2JH1 A;  1A76 A;  1PZN A;  4GFJ A;  2KN7 A;  4NLZ A;  1MC8 A;  4OD0 A;  4OJL A;  3RRG A;  4LZD A;  3KZI U;  4ECW A;  4GXK A;  4RUA A;  5DQG A;  5J2A A;  2PFO A;  4FBT A;  4DQI A;  4CF4 A;  2DL0 A;  9ICR A;  2KJ5 A;  1T8E A;  5KG4 A;  2JRZ A;  2NYV A;  9ICQ A;  3QU2 A;  3TAD C;  2LKY A;  2C2R A;  4F5N A;  1H38 A;  4JV2 A;  3T5K A;  5AM0 A;  4R8U A;  2W9A A;  4DL4 A;  4JMU A;  2DFL A;  2BPG A;  3G6X A;  2W7P A;  7ICO A;  1O03 A;  5GTI U;  3F2B A;  2BCQ A;  2ODG A;  4GXJ A;  5HNK A;  2EAM A;  2BDU A;  3PO4 A;  1KFD A;  3AU6 A;  4Y2U A;  3MR5 A;  1J97 A;  4HYK A;  4XQ8 A;  4QIW F;  1KKX A;  4YD2 A;  2ZJ5 A;  2VA2 A;  5D49 A;  2LM4 A;  3SMV A;  4IRK A;  1CRX A;  8ICH A;  3QUC A;  1LB2 B;  3UMB A;  1QLN A;  2HW3 A;  3IV6 A;  4MF8 A;  1NZB A;  2K4H A;  4YQW A;  1XSL A;  9ICF A;  4BWJ A;  3UXN A;  4Q45 A;  2C28 A;  8ICR A;  2IBK A;  1SKR A;  1Z00 B;  4F5Q A;  9ICB A;  2IOF K;  3MFH A;  5AM4 A;  2MUT A;  4QWE A;  2ZJA A;  4C0Z A;  3NS1 A;  3I28 A;  4BJQ A;  4M6W B;  8ICE A;  3SD7 A;  4P0P A;  3V7K A;  7ICU A;  2LYA A;  1DGS A;  8ICC A;  2UVW A;  4DSI A;  5KT7 A;  7ICI A;  4O3M A;  3G6V A;  4NM1 A;  5EE3 A;  2CXY A;  2PKE A;  1X9X A;  1YZ7 A;  2FPM A;  3B0X A;  3QX7 A;  1ZQT A;  2JEJ A;  5KL1 B;  4DS4 A;  3PX6 A;  3MR3 A;  3GII A;  2MRL A;  2YY6 A;  5AKK A;  3IHQ B;  4F93 B;  8ICF A;  1JMS A;  5ALV A;  2F8K A;  3Q8K A;  4RQ2 A;  2FMP A;  3PNC A;  2O6K A;  4DL2 A;  4JWM A;  1V9P A;  5DB8 A;  2NRZ A;  2P6R A;  2KZ3 A;  4YR0 A;  2FE9 A;  2W43 A;  4JB3 A;  2EZX A;  3FAH A;  5J2F A;  5KFR A;  2HHX A;  1DXS A;  3H8M A;  4YXJ A;  7ICT A;  1F0M A;  5KFU A;  2HBK A;  4UB1 A;  2KD1 A;  1GO3 F;  3L5K A;  3PX0 A;  1KQQ A;  4QW8 A;  4J9O A;  2WHE A;  1YZ6 A;  3CP8 A;  4Y2P A;  5ALJ A;  2BCV A;  5F9N A;  4TQR A;  5H2F U;  4R65 A;  4I2A A;  5ALW A;  1DK3 A;  3L3F X;  1C7Y A;  2G0A A;  5C0Y A;  3H0M B;  3MGH A;  1MA7 A;  2NRV A;  1TV9 A;  5T14 A;  5CR0 A;  4NJ8 A;  2AJQ A;  5L9X A;  4GIB A;  4Q43 A;  5GTH U;  4IRC A;  4U7C A;  4JV0 A;  4EYI B;  4QZG A;  2E1E A;  3WKA A;  1LKY A;  4PHP A;  1A0P A;  2KV2 A;  1KW4 A;  1X6J A;  1B4F A;  4DFK A;  3OSP A;  1Z19 A;  4YMN A;  4B9V A;  2BDP A;  3KHL A;  2KG5 A;  1TFR A;  4KLD A;  3WK7 A;  1TVA A;  1RYR A;  5EE1 A;  1JXL A;  1ZET A;  3NVZ A;  4ECU A;  4M2Y A;  3HIL A;  4NXZ A;  3KKA C;  4EYH B;  4M9L A;  1S5L U;  1BVS A;  4IQW A;  3BJY A;  3QU5 A;  1J2N A;  4ECS A;  7ICS A;  2I9G A;  1RPL A;  5AKZ A;  4I2C A;  1KRP A;  4I28 A;  1QQ7 A;  1HEK A;  4RZR A;  3KKA A;  2ZTD A;  4FBU A;  5HR6 A;  3V72 A;  2YQE A;  4K4H A;  2OWO A;  1D8L A;  1N62 A;  8ICL A;  5KG1 A;  2NRW A;  2ALZ A;  1NI3 A;  4YG2 A;  2W03 A;  4NM2 A;  2HHU A;  2W55 A;  4ECQ A;  1LKY B;  4J9M A;  4RNM A;  2F77 X;  3SAG A;  2AGQ A;  5KFW A;  3TAN A;  2ZIV A;  1SV0 C;  2QLT A;  4DOC A;  4PL2 A;  2BGW A;  5DGA A;  1ZD3 A;  1HUO A;  2RLT A;  4CCH A;  3CYM A;  1XS9 D;  2BZF A;  1Q8K A;  2KZM A;  1N56 A;  4PZN A;  2VJ5 A;  2P66 A;  8ICA A;  1SXE A;  4ECX A;  2EQY A;  4KN4 A;  5IIJ A;  2UVU A;  1NJY A;  5ALX A;  2XGQ A;  5J29 A;  3J81 j;  1FIQ A;  5J2K A;  2VAN A;  5ALP A;  4KN7 A;  4I2D A;  5AIC A;  2C2E A;  4FZL A;  5ALN A;  3RBD A;  2ASL A;  1RQN A;  4LZG A;  2D6F C;  2OH2 A;  1L8L A;  1D9F A;  5A0L A;  1ZQC A;  1ZQD A;  5DQI A;  5KFA A;  4US8 A;  3HKZ F;  5KFX A;  4IL6 U;  5G5G A;  4C4R A;  4RNN A;  4Y2Q A;  2PFN A;  4Y2X A;  1B22 A;  2JR5 A;  1JN3 A;  3ZDC A;  1JUD A;  2K89 A;  2Q0Z X;  2BCS A;  2FDR A;  4IC9 A;  4C8K A;  4K4I A;  4CF5 A;  5AI5 A;  3OPX A;  2W9C B;  2ZUC A;  4UAU A;  1QTM A;  3NRZ A;  3HKZ C;  5L1K A;  2K8C B;  2GOL A;  4F50 A;  1RXV A;  2HVH A;  4PHA A;  1PVP A;  4PGQ A;  5IIL A;  3KHG A;  5F9L A;  5KFZ A;  2DPJ A;  4J9Q A;  5KT4 A;  3AL0 B;  7ICV A;  2KJ8 A;  2W11 A;  4UB8 U;  1NK0 A;  5CWR A;  1NK8 A;  2IOH A;  8ICQ A;  4JUZ A;  5CA7 A;  4E0D A;  1UPH A;  1T3N A;  3PSF A;  1ZD4 A;  4YCX A;  1BPZ A;  2KEY A;  1N61 A;  1XNS A;  1B43 A;  9ICJ A;  2W3S A;  5KT3 A;  3IN5 A;  2MSN A;  2XC9 A;  1XO0 A;  3M6Z A;  5AI4 A;  1RXW A;  2LYB A;  5ALE A;  3PX4 A;  1Z1V A;  1IIP A;  1ZD5 A;  1SWW A;  5ALQ A;  4EZ9 A;  9ICP A;  3DDH A;  2YTU A;  3N4M B;  4Q8F A;  1KEJ A;  1Q46 A;  3PMN A;  4QZE A;  3WK9 A;  2HVI A;  4ELT A;  4NLG A;  1X42 A;  4XUS A;  1BNO A;  5L1I A;  3RJK A;  5J0R A;  1L7O A;  1K1S A;  4MFA A;  3K4G A;  4YFK A;  2Z7J A;  1Z4N A;  4DL5 A;  1ZQM A;  4B9U A;  4U6P A;  3EPI A;  3TFS A;  3G6Y A;  3PVX A;  2J6U A;  2JZB B;  4IRD A;  3PW7 A;  2MA1 A;  2F8L A;  3K75 D;  3ISC A;  1ZQI A;  4OO1 J;  4EEY A;  2OXO A;  3KTQ A;  7ICH A;  5AM1 A;  3V7J A;  2KHQ A;  8ICV A;  5TZV A;  9ICH A;  2R8J A;  4QWD A;  1RG6 A;  3LWL A;  3D6J A;  4Y2S A;  3LWM A;  1X9W A;  3HX0 A;  2KKP A;  5AIA A;  5EE0 A;  4NLK A;  4ACO A;  1U45 A;  2KE7 A;  5J0U A;  4BGD A;  3RJJ A;  4KMO B;  1ZQU A;  2N1R A;  8ICG A;  3TAR A;  4RQ8 A;  2KTQ A;  4I2F A;  4QWC A;  3B9J A;  5ALO A;  2HBJ A;  3QUQ A;  4EEL A;  3GV7 B;  4YN4 A;  1NJX A;  4BWM A;  9ICG A;  3C1Y A;  8ICX A;  3Q8P B;  2XIC A;  5ALT A;  4YMO A;  4QZ8 A;  5K4L A;  2KSO B;  8ICP A;  4MF2 A;  2K60 A;  1SXD A;  3D2N A;  4F5O A;  3MDA A;  4BXO B;  2H5X A;  1CEZ A;  1MQ2 A;  4PL1 A;  1EXN A;  1IG6 A;  2W3R A;  4C80 A;  4O5E A;  1S8O A;  4FZN A;  2DQN B;  2EAP A;  5F3X B;  1ZQF A;  3PW2 A;  2I1Q A;  2QB0 B;  5DB6 A;  4FS1 A;  1N2X A;  3ISD A;  2YMQ A;  5HP4 A;  5CEH A;  3AQE A;  1NK9 A;  2FI1 A;  2KVC A;  2PI5 A;  2WFA A;  3KFU F;  2F1H A;  5DG8 A;  1TE2 A;  3QE9 Y;  3WK5 A;  1QQ5 A;  1KBU A;  5KFJ A;  2GLE A;  4R66 A;  4YD1 A;  4P4O A;  5ALG A;  4UBB A;  1S76 D;  5AKL A;  3GV8 B;  3UXP A;  4BX9 C;  4RQ4 A;  3BZK A;  3KD3 A;  3MC1 A;  1SL0 A;  9ICA A;  8ICJ A;  1N60 A;  4RQ7 A;  2AGO A;  2CRX A;  1K1Q A;  4F8R A;  2EDU A;  2ZIW B;  5AKH A;  1N48 A;  1ZQW A;  1Z00 A;  2J6T A;  4WJ3 B;  8ICT A;  1U4B A;  4C7Z A;  4K4G A;  1UA0 A;  1HUZ A;  3O0F A;  5KFN A;  5III A;  4DLG A;  1Z4O A;  4M6W A;  1F5S A;  3RJI A;  2XI9 A;  5AK5 A;  4DS5 A;  2KOB A;  4HAI A;  2LYH A;  5KFF A;  2NV3 A;  3KOO A;  3EPG A;  1ZQV A;  3M9O B;  2DF4 B;  1ZJM A;  5FP0 A;  8ICK A;  2V4Q A;  2KIV A;  3Q8L A;  4KLI A;  4YP3 A;  4OJ6 A;  1ZYQ A;  4PPX A;  4RQN A;  1WCL A;  4QZ9 A;  4PHE A;  4I2J A;  1V97 A;  5L1J A;  2KFN A;  1WG8 A;  4RQ5 A;  1J2M A;  4B9T A;  1X6I A;  3HWT A;  9ICN A;  1JX4 A;  1BPD A;  4KLT A;  3RH6 A;  3F5E A;  4YVZ A;  4I2B A;  5CB1 A;  2H3Q A;  3EWA A;  5KFP A;  1SKW A;  5KFS A;  3D2Q A;  3I76 A;  3RH5 A;  5D4B A;  2IOF A;  2ZIU A;  2LBO A;  2ASD A;  2RHF A;  1NNL A;  2HOF A;  3AEV A;  4RQ1 A;  3QUT A;  3MBY A;  4RUC A;  4QZB A;  1ZRN A;  2KIW A;  3RB6 A;  3IDW A;  8ICB A;  5HMM A;  3BQ2 A;  1RYU A;  5BOM A;  3NAS A;  5DBC A;  1PUZ A;  2UVR A;  2LHT A;  2E8N A;  5AKY A;  3C29 A;  4I2I A;  1L3T A;  3BS5 B;  5J2E A;  3C5G A;  2CN1 A;  1ZQG A;  4J9R A;  1NKE A;  5ALU A;  4DOB A;  4US9 A;  4KLO A;  3FC4 A;  4FO6 A;  5ALH A;  1ZQO A;  2CPR A;  2KIC A;  4TUS A;  5ALY A;  2R8K A;  1V38 A;  1DK2 A;  4F2S A;  2ZIU B;  2YMP A;  3WK4 A;  4USA A;  4YMM A;  4Z6E A;  3PR4 A;  4JV1 A;  5DDY A;  4TUP A;  2AXT U;  4KLH A;  5TIS U;  1DOQ A;  4Q8E A;  4NLC A;  4C4T A;  5HHI A;  2HCF A;  3RJF A;  3M9M B;  2IHM A;  3TAQ A;  4B9L A;  4KLJ A;  2A1A A;  3CW2 C;  4ECT A;  1S0O A;  5AKG A;  1JIH A;  5AI6 A;  2VKQ A;  1UCV A;  2DPI A;  3ZD8 A;  1TK0 A;  2WF9 A;  1ZQR A;  4OJO A;  3HW8 A;  2I6X A;  8ICI A;  3T5L A;  2VJ4 A;  4A8E A;  2ZJ8 A;  3SEI A;  2KHV A;  2W8L A;  4FFD A;  1SZP A;  4I29 A;  4DFD A;  4DSL A;  4KLM A;  5AKE A;  1LVH A;  5KT5 A;  2ZTC A;  5ALF A;  1FFU A;  4C8M A;  3OGU A;  7ICK A;  4RNO A;  9ICW A;  4J9N A;  8ICS A;  4GLX A;  4F5P A;  4Y2T A;  4YR3 A;  2ISO A;  3OSN A;  4ECY A;  4QZC A;  4C8N A;  2YX8 A;  2JMG A;  2Y9T A;  4ELV A;  3M7D A;  2F2A B;  3WKC A;  3EZ5 A;  4EBC A;  5HML A;  5IIN A;  2JEG A;  5AI0 A;  4M47 A;  2WB1 C;  4F92 B;  3F5A A;  1XC9 A;  4G3I A;  3EUB 2;  5E79 U;  3HPO A;  1COK A;  1D8Y A;  3LYS A;  3FDS A;  4LJX A;  3T5J A;  2FMS A;  4ED1 A;  5J0Q A;  5J0Y A;  1TK8 A;  1BNP A;  3TKA A;  2GWS A;  3WU2 U;  3VC8 A;  4M9J A;  4IQU A;  1B0X A;  1L5U A;  3HP6 A;  1PK1 B;  3LDA A;  4QWB A;  5DG9 A;  2W9C A;  2W7O A;  2I5H A;  7ICL A;  5AM2 A;  3BZC A;  2R8G A;  4DL7 A;  1ZRM A;  4O0I A;  2FPL A;  3KZX A;  5ALM A;  4ED2 A;  2NO4 A;  3RJH A;  1OXJ A;  5JRT A;  5J2B A;  5J2H A;  3QEA Z;  3BQT A;  5KNI A;  3C2M A;  2OM6 A;  2Y0S F;  1WCN A;  2XID A;  4Z6C A;  4ED0 A;  2H3V A;  1FEZ A;  5JTI A;  3M1Y A;  5ALD A;  2G5I B;  1ZJN A;  2NRX A;  3N97 B;  2JV3 A;  3GIL A;  1ARO P;  2FPK A;  1NK6 A;  4LVS A;  4EX6 A;  3NTU A;  3BDP A;  2ZIX B;  2Y0S C;  2XGP A;  3H0R B;  1TAU A;  1JAL A;  2PXI A;  2W8K A;  1MN8 A;  4QZH A;  4F4X A;  3RFA A;  4ED8 A;  3JPQ A;  1ZQL A;  4DOA A;  5KFD A;  4TQS A;  4OJP A;  4O3Q A;  2ESE A;  2G07 A;  3SZ2 A;  3PY8 A;  3TFR A;  4DF4 A;  5AKJ A;  3C5F A;  4KIT B;  1S97 A;  1N5X A;  2W9M A;  5KFE A;  1SGG A;  1UA1 A;  3ISB A;  4ED7 A;  3E2E A;  4Y2Y A;  5D46 A;  4KLL A;  2QKQ A;  3PZP A;  4X5V A;  3F2D A;  1U47 A;  4Z6F A;  4MHV A;  2BKE A;  1NJW A;  4MFC A;  5J2C A;  2JZB A;  1U9L A;  5L1M A;  5J8Y A;  2K8B B;  4UB5 A;  4UB3 A;  2RDJ A;  1HIW A;  1ZXI A;  4EX7 A;  1COO A;  5J0W A;  4RQM A;  3DV9 A;  3PSI A;  4PJ0 U;  3GIK A;  2C2D A;  7ICN A;  4ED6 A;  1Q3V A;  4IQT A;  1N5W A;  1WWU A;  5KFQ A;  3H0L B;  3AMZ A;  1ZQB A;  4M9H A;  3PML A;  3OHB A; 
#chains in the Genus database with same CATH homology
 4O3N A;  4R66 A;  4YD1 A;  5J2F A;  5KFR A;  2HHX A;  4P4O A;  1ZQX A;  4YXJ A;  4UBB A;  5L1L A;  1S76 D;  7ICT A;  3UXP A;  3GV8 B;  5KFI A;  5KFU A;  4I2E A;  4RQ4 A;  5IIM A;  2BQU A;  1XSN A;  3IM1 A;  4RPZ A;  3C21 A;  4UB1 A;  4J9S A;  4KLU A;  3OJU A;  2M9N A;  1SL0 A;  2FLN A;  3RJE A;  9ICA A;  8ICJ A;  5IIK A;  4QZI A;  4RQ7 A;  3PW5 A;  4DSJ A;  3PX0 A;  2AGO A;  4QW8 A;  3M8S A;  9ICC A;  1ZQJ A;  3H8W A;  1K1Q A;  4J9O A;  3EYZ A;  1S10 A;  3LK9 A;  4F8R A;  5KFL A;  1S0V A;  1XWL A;  2IHN A;  3C1Z A;  1KFS A;  4ECR A;  1N48 A;  1ZQW A;  4QZD A;  2BCV A;  4FS2 A;  5F9N A;  4TQR A;  1Z00 A;  4R65 A;  2J6T A;  8ICT A;  4I2A A;  1U4B A;  3RH4 A;  2BHN A;  4RT2 A;  4PGY A;  3QEB Z;  4K4G A;  1UA0 A;  2W9B B;  1HUZ A;  5KFN A;  4BXO A;  1C7Y A;  5III A;  4DLG A;  4J9P A;  3UXO A;  3MGH A;  4M6W A;  2NRV A;  4EBD A;  1TV9 A;  2Y1I A;  5CR0 A;  4QZA A;  3RJI A;  3GIJ A;  3JPT A;  7ICG A;  4O3R A;  2AJQ A;  2ZTE A;  5L9X A;  4DS5 A;  3Q8S B;  4Q43 A;  2LYH A;  5KFF A;  4IRC A;  4JV0 A;  4EYI B;  4O5C A;  5EWG A;  4QZG A;  1A77 A;  3M8R A;  3EPG A;  3OHB A;  2R8I A;  1ZQV A;  1L3S A;  4PHP A;  3M9O B;  3C2L A;  3QZ8 A;  1Z3E B;  5KG2 A;  2P6U A;  4DFK A;  4O9M A;  3OSP A;  3ETL A;  1ZJM A;  4YMN A;  2ATL A;  2J6S A;  4B9V A;  4JK1 A;  1ZQK A;  4F2R A;  3NGD A;  4KTQ A;  2BDP A;  8ICK A;  3KHL A;  5KFC A;  3H8J A;  2V4Q A;  1IXR A;  3Q8L A;  4KLI A;  4YP3 A;  9ICE A;  1TFR A;  1ZQN A;  4ECZ A;  4F4Z A;  8ICU A;  4KLD A;  1ZYQ A;  1TVA A;  1RYR A;  4PPX A;  1JXL A;  1L3V A;  5DB9 A;  4PGX A;  1ZET A;  1WCL A;  4QZ9 A;  4ECU A;  4M2Y A;  3Q8M A;  8ICO A;  4PHE A;  4UB2 A;  4I2J A;  4JWN A;  4F4Y A;  3ORY A;  4NXZ A;  4EYH B;  1ZQH A;  4M9L A;  5L1J A;  1BVS A;  4IQW A;  2F1I A;  2KFN A;  3V6K A;  3BJY A;  3QZ7 A;  7ICP A;  4ECS A;  1BGX T;  7ICS A;  4RQ5 A;  2I9G A;  5EOZ A;  3V7L A;  4O3P A;  1RPL A;  5DB7 A;  4B9T A;  5KFG A;  4I2C A;  9ICO A;  3H7I A;  5HHH A;  1KRP A;  4DFM A;  2A1J B;  4I28 A;  2KZZ A;  3HWT A;  3V6J A;  1NKB A;  4RZR A;  1KLN A;  2ZTD A;  1ZQQ A;  3ZDD A;  1JX4 A;  4FBU A;  2XY6 A;  9ICN A;  3V72 A;  1ZQS A;  4UB4 A;  4K4H A;  2OWO A;  8ICM A;  1D8L A;  1BPD A;  4GC6 A;  4B9N A;  4B9M A;  5J2J A;  2BQ3 A;  4M9N A;  4KLT A;  3RH6 A;  8ICL A;  4YVZ A;  5KG1 A;  4I2B A;  3OJS A;  9ICM A;  5CB1 A;  2NRW A;  3EWA A;  5KFP A;  2ALZ A;  2BPF A;  4YG2 A;  4NM2 A;  4QW9 A;  1LV5 A;  4P2H A;  3C23 A;  5KFS A;  1SKW A;  5KFT A;  2HHU A;  2PI4 A;  1X2I A;  3RH5 A;  5D4B A;  4ECQ A;  4J9M A;  5CHG A;  4O3O A;  3JPS A;  4RNM A;  3JPO A;  5KFM A;  2R8H A;  2XY5 A;  3PV8 A;  2ASD A;  1QSY A;  3KHR A;  2AGQ A;  5KFW A;  3TAN A;  4O5K A;  1CUK A;  2W9B A;  9ICV A;  2AGP A;  4RQ1 A;  1TKD A;  3MBY A;  4DOC A;  4RUC A;  2BGW A;  4QZB A;  4DQS A;  3RB6 A;  4DSL A;  4EBE A;  5DGA A;  8ICB A;  4GC7 A;  2AQ4 A;  3PW0 A;  3OHA A;  1HUO A;  5HMM A;  1BPE A;  4KLM A;  2AQ0 A;  3BQ2 A;  4CCH A;  5BOM A;  1XS9 D;  4F91 B;  4PHD A;  3RR8 A;  5DBA A;  2UVR A;  5DBC A;  2RDI A;  2XO7 A;  3ZDE A;  4IQV A;  1KDH A;  2MAX A;  2XCA A;  1TAQ A;  2KZM A;  4XA5 A;  4I2I A;  1N56 A;  1L3T A;  4KMU A;  2P66 A;  1U49 A;  8ICA A;  4ECX A;  4DSE A;  5J2E A;  3Q8Q B;  3C5G A;  1RZT A;  4KN4 A;  1ZQG A;  1ZQA A;  5IIJ A;  3FYH A;  4XRH A;  5KFH A;  4J9R A;  4UAY A;  1NKE A;  1NJY A;  2UVU A;  3JPR A;  5IIO A;  1IM4 A;  2XGQ A;  5J29 A;  4DOB A;  3H40 A;  4ECV A;  2BR0 A;  5KFB A;  1BPX A;  4KLO A;  2WTF A;  1NJZ A;  4FO6 A;  3RB0 A;  5J2K A;  1BPY A;  1ZQO A;  4I27 A;  2VAN A;  1HJP A;  1S9F A;  4M9G A;  4KN7 A;  4I2D A;  4TUS A;  9ICU A;  2R8K A;  3GFK B;  2C2E A;  3GV5 B;  2BPC A;  2B21 A;  4YR2 A;  3RBD A;  2ASL A;  4F2S A;  4LZG A;  8ICW A;  1TK5 A;  9ICK A;  3RTV A;  2A1J A;  4TUQ A;  2ZUB A;  1D9F A;  2PFP A;  4YXM A;  4YMM A;  3RRH A;  5DGB A;  1ZQC A;  1ZQD A;  2PFQ A;  4Z6E A;  5DQI A;  3PR4 A;  5KFA A;  5KTQ A;  5DDY A;  4TUP A;  4JV1 A;  4KLH A;  1DOQ A;  5KFX A;  3JPN A;  5J0P A;  3UQ0 A;  4RNN A;  1XSP A;  3ZDA A;  4RPY A;  4Q8E A;  2PFN A;  5HHI A;  3RJF A;  3M9M B;  4DL6 A;  3TAQ A;  2NRT A;  2IHM A;  1B22 A;  9ICL A;  4B9L A;  1JN3 A;  4KLJ A;  3ZDC A;  4DQP A;  2UVV A;  4ECT A;  1S0O A;  3V6H A;  4KLQ A;  1JIH A;  1ZQE A;  2Q0Z X;  3PW4 A;  4IR1 A;  2DPI A;  3MDC A;  2VA3 A;  4B9S A;  3ZD8 A;  1TK0 A;  2BCS A;  7ICR A;  1ZQR A;  4R63 A;  4C8K A;  4K4I A;  3HW8 A;  3ZD9 A;  4EZ6 A;  9ICS A;  1U48 A;  2W9C B;  8ICI A;  2ZUC A;  3T5L A;  3SV3 A;  4C8L A;  1QSL A;  1QTM A;  3RJG A;  5DDM A;  2XCP A;  3MFI A;  5L1K A;  1KTQ A;  2ZJ8 A;  5DQH A;  1NK7 A;  4F50 A;  3AUO A;  4QZF A;  9ICT A;  4DLE A;  5KG7 A;  4DQQ A;  2W8L A;  2Y1J A;  3RBE A;  1RXV A;  4I29 A;  1SZP A;  4PHA A;  2HVH A;  2HHS A;  5J2G A;  4P4P A;  4Q44 A;  4PGQ A;  5IIL A;  5KT5 A;  5F9L A;  3KHG A;  5KFZ A;  3GQC A;  5J2D A;  2ZTC A;  4KLE A;  4DF8 A;  5CP2 A;  2DPJ A;  4C8M A;  3OGU A;  2BQR A;  4GXI A;  1KSP A;  5KT2 A;  5CJ7 A;  7ICK A;  4J9Q A;  5KT4 A;  1QSS A;  4J9L A;  3TQ1 A;  4DQR A;  4KLG A;  4RNO A;  4RQ0 A;  4J9N A;  9ICW A;  7ICM A;  3UQ2 A;  2HHQ A;  4GLX A;  8ICS A;  7ICV A;  4F5P A;  5J0O A;  1JXE A;  4DO9 A;  5KFY A;  1NK0 A;  4YR3 A;  5CWR A;  3GDX A;  2JEI A;  4F5R A;  2XY7 A;  3JPP A;  3OSN A;  3C2K A;  2ISO A;  4ECY A;  4QZC A;  1NK8 A;  5J0T A;  4C8N A;  4F4K A;  8ICQ A;  4JUZ A;  5CA7 A;  3T3F A;  5DLF A;  3AU2 A;  1T3N A;  3ZDB A;  4E0D A;  4YCX A;  4R8U B;  1BPZ A;  4ELV A;  3RAX A;  3TAP A;  5DKW A;  3EZ5 A;  5KG0 A;  4EBC A;  4RU9 A;  5KFO A;  5HML A;  4RT3 A;  5IIN A;  2V9W A;  4DL3 A;  3EW9 A;  3RB4 A;  2JEG A;  4DWI A;  4F4W A;  1RYS A;  4M47 A;  5C5J A;  3UPQ A;  1B43 A;  9ICJ A;  4O3S A;  5KG3 A;  4F92 B;  1XC9 A;  5KT3 A;  1NK4 A;  4G3I A;  4NY8 A;  3RR7 A;  4I2G A;  5J0S A;  3HPO A;  1SL2 A;  2XC9 A;  2IA6 A;  9ICX A;  1D8Y A;  1ZQZ A;  5EWE A;  2HHV A;  4MEY A;  3FDS A;  1RXW A;  1UT5 A;  4PH5 A;  1NK5 A;  4C8O A;  1MSW D;  4R64 A;  3T5J A;  4ED1 A;  2FMS A;  1UT8 A;  5J0Q A;  3PX4 A;  5J0Y A;  3THV A;  1TK8 A;  1SKS A;  2GWS A;  4I2H A;  5JUM A;  1S0M A;  2V4R A;  4M9J A;  4IQU A;  1L5U A;  4EZ9 A;  8ICZ A;  3HP6 A;  9ICP A;  3LDA A;  2IMW P;  3BQ1 A;  3SI8 A;  1XO1 A;  5DG9 A;  4QWB A;  2W9C A;  3BQ0 A;  5BPC A;  3N4M B;  5EWF A;  4Q8F A;  7ICJ A;  1KEJ A;  1A76 A;  7ICL A;  1PZN A;  2KN7 A;  1S77 D;  4NLZ A;  2R8G A;  3PMN A;  1MC8 A;  5KT6 A;  4QZE A;  4DL7 A;  3PO5 A;  4RQ3 A;  4MEX A;  4IR9 A;  2HVI A;  4BDP A;  4RPX A;  5J2I A;  4O0I A;  2FPL A;  4ELT A;  4ED2 A;  4UAZ A;  3RRG A;  3RJH A;  4LZD A;  5J2B A;  4NLG A;  5J2H A;  4ECW A;  4XUS A;  4GXK A;  4RUA A;  3QEA Z;  3BQT A;  5DQG A;  3C2M A;  5J2A A;  4RQ6 A;  2PFO A;  4FBT A;  4DQI A;  5L1I A;  1WCN A;  3RJK A;  1XU4 A;  4Z6C A;  5J0R A;  4M0A A;  9ICR A;  4ED0 A;  3HT3 A;  4DEZ A;  7ICE A;  2FMQ A;  1K1S A;  1MQ3 A;  1T8E A;  1ZJN A;  2MUT B;  2NRX A;  3N97 B;  4MFA A;  3K4G A;  4P4M A;  4YFK A;  4DL5 A;  1ZQM A;  4B9U A;  5KG4 A;  9ICQ A;  3EPI A;  3GIL A;  1ARO P;  3TFS A;  5KG5 A;  3G6Y A;  4DSK A;  3MR6 A;  3PVX A;  2J6U A;  7ICQ A;  1Y88 A;  2JZB B;  4IRD A;  2C2R A;  3PW7 A;  4F5N A;  2KFZ A;  3PML A;  1H38 A;  2FPK A;  3K75 D;  2FLP A;  1NK6 A;  3ISC A;  4LVS A;  4UBC A;  1ZQI A;  4JV2 A;  3T5K A;  3NTU A;  4EEY A;  3KTQ A;  4R8U A;  2W9A A;  4DL4 A;  3B0Y A;  2DFL A;  3BDP A;  2BPG A;  7ICH A;  5BOL A;  3V7J A;  2XGP A;  3G6X A;  8ICV A;  5TZV A;  7ICO A;  9ICH A;  1TAU A;  2BCQ A;  2R8J A;  3M9N B;  3H4B A;  2C22 A;  4QWD A;  2HHT A;  4GXJ A;  2AU0 A;  5HNK A;  2PXI A;  3LWL A;  2W8K A;  4QZH A;  3MGI A;  1KFD A;  4DSF A;  3PO4 A;  1X9W A;  3LWM A;  7ICF A;  4F4X A;  4ED8 A;  3AU6 A;  3JPQ A;  4Z6D A;  3MR5 A;  5DBB A;  4DOA A;  5KFD A;  3KHH A;  1ZQL A;  2JEF A;  3HX0 A;  4TQS A;  1ZQP A;  4HYK A;  4NLK A;  2FLL A;  4O3Q A;  1U45 A;  4UQG A;  3MAB A;  5J0U A;  4XQ8 A;  3T5H A;  2BCU A;  3SZ2 A;  4ELU A;  4YD2 A;  4BGD A;  2ZJ5 A;  3RJJ A;  1ZQU A;  4J9K A;  5D49 A;  3TI0 A;  2VA2 A;  4M04 A;  3PY8 A;  8ICG A;  5KG6 A;  3TFR A;  4RQ8 A;  4DF4 A;  3TAR A;  4F3O A;  3C5F A;  1X9M A;  4I2F A;  4ZH4 A;  4QWC A;  2ISP A;  4IRK A;  4KIT B;  2KTQ A;  2F1J A;  1D9D A;  1S97 A;  8ICH A;  3Q8R B;  1LB2 B;  2W9M A;  1S0N A;  1QLN A;  5KFE A;  2HW3 A;  3GV7 B;  4YN4 A;  1UA1 A;  2ASJ A;  4MF8 A;  3PR5 B;  3ISB A;  1NJX A;  4BWM A;  4KLS A;  9ICG A;  3C1Y A;  4YQW A;  1XSL A;  3H8S A;  4ED7 A;  9ICF A;  8ICX A;  3Q8P B;  3E2E A;  4YMO A;  4BWJ A;  1NKC A;  3UXN A;  4QZ8 A;  5D46 A;  4KLL A;  5DG7 A;  1T7P A;  4Q45 A;  4X5V A;  2C28 A;  1SL1 A;  4MF2 A;  8ICR A;  2IBK A;  1SKR A;  1Z00 B;  4F5Q A;  8ICP A;  1L3U A;  9ICB A;  1U47 A;  3MFH A;  2MUT A;  4MFF A;  4QWE A;  4Z6F A;  5DLG A;  4F5O A;  2BKE A;  3MDA A;  4KLF A;  2ZJA A;  1ZQY A;  4BXO B;  1NJW A;  2H5X A;  4MFC A;  1CEZ A;  1MQ2 A;  1EXN A;  5J2C A;  4M6W B;  2VA8 A;  8ICE A;  2JZB A;  4NLN A;  2BCR A;  3SYZ A;  4O5E A;  1NOM A;  3V7K A;  5J0X A;  4DFJ A;  7ICU A;  1U9L A;  1DGS A;  8ICC A;  2UVW A;  4DSI A;  5KT7 A;  3H4D A;  7ICI A;  3G6V A;  4NM1 A;  1ZQF A;  4UB5 A;  3PW2 A;  2I1Q A;  4UAW A;  4UB3 A;  2FPM A;  5KFV A;  8ICN A;  9ICI A;  1KFT A;  3B0X A;  5DB6 A;  4FS1 A;  3ISD A;  1ZQT A;  2RDJ A;  1X9S A;  2JEJ A;  4DS4 A;  3PX6 A;  1COO A;  3MR3 A;  5J0W A;  4QWA A;  3GIM A;  8ICY A;  3SV4 A;  3GII A;  2ZUD A;  5HP4 A;  4DFP A;  3MR2 A;  2C2D A;  3IHQ B;  4F93 B;  3GIK A;  1NK9 A;  7ICN A;  8ICF A;  1JMS A;  2HHW A;  4ED6 A;  4TUR A;  3Q8K A;  2PI5 A;  4RQ2 A;  2FMP A;  1BPB A;  4IQT A;  5KFQ A;  3RB3 A;  4ED3 A;  3RAQ A;  2F1H A;  1T4G A;  3PNC A;  5DG8 A;  4DL2 A;  4JWM A;  1ZQB A;  1V9P A;  5DB8 A;  2NRZ A;  3QE9 Y;  2P6R A;  4M9H A;  2KZ3 A;  4YR0 A;  5KFK A;  5KFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...