3N4MB

E. coli rna polymerase alpha subunit c-terminal domain in complex with cap and dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
FDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Combined structural model for a transcription activation assembly
rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords Catabolite gene activator
total genus 21
structure length 74
sequence length 74
chains with identical sequence C
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3n4mB00
4NM2A 1TFRA 2BDPA 4J9OA 2C2RA 2JEGA 1NOMA 3C1YA 2XCAA 3RJKA 4ECRA 4EEYA 1U45A 2VA3A 8ICXA 1L3TA 9ICHA 1NK0A 4YN4A 3SV4A 7ICNA 4EBEA 5KFJA 1ZQEA 9ICKA 4GXJA 2W9BA 8ICPA 4C8KA 5KFYA 5KFXA 4J9RA 1L3SA 4M9JA 4QZBA 4QW9A 4LVSA 8ICFA 4DQSA 1LB2B 1S0MA 3MDAA 4YCXA 2P6RA 1JX4A 5EWFA 3ZDCA 5KFBA 3Q8LA 2NRZA 3M8RA 1L5UA 1ZQCA 5KT6A 3MABA 5CA7A 4LZGA 7ICUA 1U48A 3BQTA 9ICGA 4YMNA 2BHNA 3RTVA 2R8JA 3EPGA 4FBUA 3Q8RB 1XS9D 4F50A 2NRXA 1X9MA 5HP4A 1QTMA 3B0XA 4NY8A 4DF8A 7ICRA 1D8LA 4I2BA 4YD1A 4DS5A 3T5KA 3E2EA 9ICFA 3FYHA 5KG1A 2HHXA 7ICTA 4JV1A 3PX4A 1MQ3A 4J9LA 4RQ2A 4RQ8A 1U9LA 2PFPA 3SI8A 4QZGA 4I2EA 1SL1A 5L1LA 4I28A 1TV9A 4ELTA 5J2JA 4Q8FA 4DL5A 5DQGA 2PFQA 1JIHA 5KT7A 2H5XA 1S76D 1L3VA 4B9NA 2VA8A 4I2CA 1ZQYA 4F2SA 1KSPA 2R8HA 3JPRA 1SKSA 1S0VA 3C5FA 4JUZA 1HUZA 5J2DA 1ZQHA 7ICVA 3H8WA 9ICAA 2VANA 5J0QA 2I1QA 5DB8A 2AGPA 4ED2A 2FMPA 3PO5A 4O3RA 3EWAA 3T5JA 2I9GA 5IINA 1IM4A 3GFKB 4Z6DA 4KLUA 4PGXA 3BQ0A 3RBDA 1QSYA 2JEJA 4DQPA 1IXRA 4KLIA 2R8GA 4NLZA 5KFHA 4R63A 4ECUA 5DLFA 1LV5A 4JK1A 2P6UA 3PMNA 1TK5A 2C28A 4K4HA 9ICTA 8ICSA 1BGXT 2RDIA 4ED1A 5DLGA 5KT3A 2HHVA 3ORYA 4DEZA 2GWSA 4KLLA 3Q8PB 4C8LA 3MFHA 7ICEA 4EZ9A 2AGQA 1ZQVA 2ZTEA 5KFZA 3IM1A 4TUQA 4ECXA 4ECYA 1RXVA 4UB4A 4F5NA 4F4WA 4QZCA 8ICTA 2FMSA 4PHAA 4IRKA 1ZQOA 2IMWP 4RPXA 3KHRA 2RDJA 1KFTA 1B22A 3K75D 5HHIA 3B0YA 5J0RA 4RNNA 2C22A 1ZQMA 4FBTA 3QZ8A 3C21A 4NXZA 5J29A 3V72A 4DOAA 4QW8A 3N97B 3Q8KA 1XSPA 1ZQTA 4EZ6A 1QSLA 1ZQUA 2J6SA 4ED3A 4O3QA 5HMLA 5DG9A 1PZNA 1TVAA 4KLDA 3V7LA 3H8JA 4BWMA 4RT2A 2AQ0A 4FS1A 4B9LA 8ICKA 4J9QA 4ED8A 4PGQA 4QZ9A 1XC9A 2V9WA 4ELUA 1ZYQA 4J9PA 5J0UA 2J6UA 2F1IA 5DQIA 4DLEA 4B9SA 4PHEA 7ICKA 1U47A 5J2EA 3JPNA 3HX0A 3ZD9A 4RUCA 3KHLA 2BQUA 1ZQJA 3MR5A 3RJFA 4R65A 2W9BB 4CCHA 3LDAA 3HT3A 4IQUA 4P4PA 3M9OB 4O5EA 8ICZA 1S9FA 1SKWA 5D49A 4NLGA 4O5CA 2WTFA 5KFFA 5KFVA 5DGBA 1BPDA 5IIMA 2C2EA 1X9WA 4I2HA 4J9MA 4QWDA 7ICJA 3RR8A 1COOA 3GV7B 4F5RA 5J2HA 3TFRA 3LK9A 4DSKA 2BGWA 4F5OA 2KFNA 3PX0A 2XO7A 4KLQA 3ISCA 2BCUA 1AROP 1T4GA 9ICCA 1C7YA 2BPFA 5JUMA 2PI4A 4ED6A 4YR2A 5KT5A 4K4GA 5DGAA 2R8IA 5EWEA 1UA1A 4DSJA 1Z00A 3TANA 5BPCA 4BGDA 5D46A 8ICVA 4QZIA 5L1KA 4UB3A 3C2MA 1RZTA 5L9XA 9ICOA 4Q8EA 3JPPA 4M9LA 1ZQWA 3MDCA 5J2AA 1WCLA 3NGDA 4C8OA 4ECQA 4G3IA 5KFCA 4KLJA 2BR0A 7ICHA 4UB2A 4HYKA 1ZQAA 2BPCA 1TK8A 5KFTA 2XC9A 4ECZA 2AGOA 4DSFA 1D9DA 4I2FA 2ALZA 3OSPA 3PW2A 3TARA 1NK5A 1JN3A 4PPXA 4B9TA 3RH4A 4TUPA 4M9HA 1QLNA 2Q0ZX 2HHSA 5KG7A 5CJ7A 5J2BA 1QSSA 5J2FA 1MQ2A 3V6HA 3RJHA 4TURA 4RU9A 5DDYA 4DL6A 2R8KA 4F91B 5L1IA 2ASJA 3ZDBA 1Z3EB 9ICEA 2KN7A 2AU0A 1T7PA 9ICSA 3ISDA 1HJPA 1Z00B 9ICQA 4UQGA 5IIOA 1ZQLA 5DB9A 4E0DA 5KFNA 2ASLA 5IIKA 3MBYA 4O3NA 5KFPA 4R66A 4I2GA 3C1ZA 2HHTA 2ZTDA 4Z6EA 4DSIA 4RUAA 4KLOA 3HPOA 1TAQA 4RPYA 5L1JA 2A1JB 1JXLA 3ZDEA 1D8YA 4UAZA 3T3FA 2XY6A 2FPKA 2BPGA 2FLPA 5KFGA 4I2DA 2XGQA 3UPQA 4KLFA 1TAUA 4YFKA 3QZ7A 8ICNA 4ED0A 3T5HA 4F3OA 2AJQA 4I2IA 4I29A 4O5KA 4I2JA 1S10A 1NK6A 4PHDA 2KTQA 2BCRA 4DL2A 2PXIA 8ICUA 3MFIA 3T5LA 5EWGA 1ZQSA 5EOZA 3ZD8A 2ISOA 4DQQA 3RH6A 1L3UA 3RJGA 1ZQIA 2HHWA 4P4OA 5J2CA 7ICLA 1T3NA 4UAYA 4Q45A 4DQRA 3OJSA 2IHNA 5HMMA 4I27A 5KT4A 3M8SA 4ECWA 1MSWD 3PMLA 5KFAA 2FPLA 4YQWA 5DBAA 4QZEA 4M47A 4TQSA 4C8MA 2KZMA 1WCNA 8ICOA 1U49A 4YR3A 1XU4A 4M9GA 1DGSA 5KT2A 4XRHA 4KLHA 2ZJ8A 5F9LA 5KG6A 4KLSA 4F4XA 4MFCA 3PNCA 4B9MA 3RB6A 3JPSA 1NJYA 5KFIA 1BPEA 4PH5A 4DL4A 2ZUBA 3C5GA 3TQ1A 4P4MA 9ICNA 4I2AA 4F2RA 4EYIB 4RQ7A 1ZQZA 1A77A 1JMSA 3MR6A 4DWIA 4UB1A 2Y1JA 3HWTA 5KFWA 2FLNA 1RYSA 5KFOA 1SKRA 5CB1A 4KTQA 1XSNA 3H8SA 1TKDA 1ZJNA 1Y88A 3BQ2A 5DG8A 5J0YA 1NK7A 1S0OA 2XGPA 1SL2A 2IBKA 2DPJA 1NJXA 5HNKA 4DQIA 4KLTA 2IHMA 2ATLA 1BPYA 4X5VA 5IILA 8ICMA 2NRWA 3MR3A 3AU2A 3PW0A 2ZJ5A 3V6KA 4MF8A 4O3OA 4IQWA 4P2HA 4DL7A 2C2DA 4QWCA 3OHBA 2DPIA 3GV8B 5DG7A 1K1SA 3MGIA 3PW4A 3RJEA 1CEZA 1K1QA 2KZ3A 3N4MB 2W8KA 2ZJAA 3RRGA 8ICYA 1ZQRA 8ICGA 3KTQA 3UXPA 3THVA 4NLKA 4LZDA 7ICMA 4RQ1A 4TQRA 2XY7A 7ICFA 4KLGA 3JPQA 2FPMA 3H4DA 4YMMA 3KHGA 2ASDA 3AUOA 2BQRA 2ZUDA 7ICOA 3PR4A 2P66A 4F93B 3TAQA 2V4QA 3V7KA 1HUOA 4QWAA 1NK8A 8ICLA 3C23A 2A1JA 4DO9A 3AU6A 9ICIA 4JV0A 4F4KA 2JEFA 7ICQA 1KDHA 8ICIA 7ICIA 3FDSA 4KN4A 5TZVA 2F1HA 4YMOA 2BCSA 4KITB 2PFOA 1ZQDA 4M6WB 5KG3A 5DBBA 3M9NB 1BPXA 4XUSA 9ICXA 4RZRA 3UQ0A 4EYHB 2VA2A 3PW7A 4KMUA 8ICRA 1NKEA 4MFAA 3BQ1A 4RNMA 3G6YA 3RBEA 2NRTA 3SV3A 4DS4A 4Z6CA 2FMQA 2HW3A 9ICVA 5J0XA 3ISBA 2BCVA 4F8RA 1RPLA 2FLLA 3RRHA 2MAXA 2AQ4A 4IRCA 4KN7A 4RT3A 2MUTA 4Z6FA 2OWOA 1NK9A 5HHHA 5KFKA 2BKEA 4IR1A 4J9KA 3QE9Y 9ICPA 1CUKA 4RQ4A 1NJWA 5DDMA 4Q44A 4B9UA 4M0AA 2HHQA 3RR7A 1NKBA 4JWMA 4JWNA 4MEXA 4EBCA 9ICBA 3JPOA 4GLXA 1KFSA 2PFNA 4PHPA 1ZQPA 4F92B 3Q8QB 3LWLA 3GIKA 3QEAZ 1N56A 3ETLA 4NM1A 3UQ2A 3IHQB 3OJUA 5F9NA 1NK4A 1RXWA 1ZQGA 3MR2A 4DL3A 5CP2A 5CHGA 4JV2A 3MGHA 4RQ5A 5CWRA 8ICHA 5KFLA 4GXIA 3SZ2A 3RH5A 1RYRA 5KFEA 4BWJA 3GQCA 2Y1IA 1KEJA 3M9MB 4YXMA 4F5PA 4ECSA 4FS2A 3BDPA 4DLGA 4PGYA 1XWLA 1D9FA 1ZETA 4O0IA 4DFKA 1TK0A 4NLNA 4QWEA 5KFQA 5KFMA 4UBBA 4BDPA 4O3PA 1ZQXA 4RQ0A 3EZ5A 8ICEA 1SL0A 3G6XA 4KLEA 5IIIA 3K4GA 5KG2A 2HVHA 4GC6A 2XY5A 2V4RA 4J9SA 4M6WA 1UA0A 2UVWA 2ZTCA 1JXEA 4YXJA 2W9AA 3QEBZ 3RB0A 1UT8A 1DOQA 4YR0A 1ZQQA 2LYHA 5DB6A 3V7JA 3EPIA 4F4ZA 8ICWA 9ICJA 2JZBB 3ZDDA 3H40A 1X9SA 2UVVA 2UVRA 3Q8MA 2KZZA 5J0PA 2W9MA 5DBCA 2M9NA 5KFSA 5KG0A 1BPZA 4YD2A 3GV5B 4RQ3A 3PR5B 4BXOA 3RB3A 4UB5A 1ZJMA 5DB7A 4DFPA 3ZDAA 2F1JA 5KG4A 2UVUA 5BOLA 5KFRA 4M04A 4BXOB 4XQ8A 2DFLA 9ICRA 4R64A 4J9NA 1NJZA 2J6TA 4YG2A 3EYZA 1SZPA 9ICLA 3RAXA 2KFZA 8ICCA 9ICWA 4UBCA 4DOCA 2W9CA 3PX6A 3EW9A 4IRDA 4MF2A 8ICQA 2ZUCA 4QWBA 3KHHA 2W8LA 5J0OA 4QZFA 3HP6A 3H7IA 4KLMA 2MUTB 2PI5A 1ZQKA 5IIJA 4R8UB 5DKWA 3PO4A 4TUSA 5C5JA 4DFMA 3RAQA 4UAWA 7ICPA 1S0NA 2BCQA 4XA5A 5J0TA 4RNOA 4DSEA 4YP3A 1U4BA 4YVZA 5CR0A 2JEIA 3UXOA 4O9MA 1S97A 1T8EA 1NKCA 1BPBA 4DOBA 4EBDA 4IQVA 4RPZA 3OSNA 3TFSA 1N48A 4K4IA 1KTQA 8ICBA 5J2GA 5BOMA 4DF4A 3HW8A 5J0SA 4B9VA 3C2LA 3GIMA 4QZAA 2JZBA 4ELVA 2XCPA 4IQTA 4C8NA 2IA6A 1UT5A 3V6JA 1EXNA 4Q43A 1XO1A 3TI0A 1XSLA 4O3SA 2HVIA 3PV8A 2HHUA 4R8UA 4QZDA 3JPTA 5D4BA 7ICGA 1V9PA 5DQHA 1S77D 1KLNA 2NRVA 2ISPA 3BJYA 5KFDA 3TAPA 1KFDA 3UXNA 1KRPA 4F4YA 7ICSA 1H38A 5J2KA 4QZ8A 1ZQBA 2B21A 3GILA 2W9CB 3C2KA 4DSLA 3PW5A 3GDXA 1ZQFA 4ZH4A 4GXKA 4FO6A 1BVSA 3GIIA 4MFFA 1B43A 1A76A 4M2YA 9ICMA 5KG5A 3H4BA 3RB4A 4MEYA 3GIJA 3PY8A 4GC7A 4QZHA 4ECVA 3SYZA 3OGUA 3PVXA 3RJJA 4M9NA 9ICUA 5J0WA 1ZQNA 3RJIA 3G6VA 8ICAA 2BQ3A 8ICJA 5KTQA 5KFUA 4RQ6A 3NTUA 3OHAA 1X2IA 3Q8SB 4DFJA 4ED7A 1MC8A 5J2IA 3LWMA 4ECTA 4F5QA 4IR9A
chains in the Genus database with same CATH superfamily
4NM2A 1L7NA 2HCFA 2BDPA 2H3ZA 1L7OA 3RJKA 8ICXA 1U45A 1NK0A 3SV4A 4GXJA 3CNHA 4J9RA 3U26A 1LB2B 3MDAA 2LPEA 5AM5A 5KFBA 3M8RA 1ZQCA 4LZGA 1U48A 4YMNA 1P7DA 2YX8A 3DEEA 3PSIA 1X9MA 7ICRA 2KVSA 9ICFA 3E2EA 4DS5A 2HHXA 3UM9A 7ICTA 4I2EA 1SL1A 5L1LA 3SAGA 5J2JA 1JIHA 2KIVA 2E8MA 2H5XA 1S76D 2VA8A 1SKSA 4JUZA 1ZQHA 4CE6A 4P0PB 3H8WA 2VANA 4EX6A 3EWAA 3O0FA 2PMZF 3T5JA 4PGXA 3WKEA 3RBDA 1QSYA 2JEJA 4DQPA 2VIXA 4ICAA 5KFHA 4R63A 4ECUA 2P6UA 1TK5A 2C28A 4K4HA 3D2NA 2RDIA 3I76A 4ED1A 5DLGA 5KT3A 3IG5A 2QB1A 3Q8PB 1L8OA 1HIWA 3TACB 4NL9A 3AL0B 4F5NA 1SWWA 8ICTA 2FMSA 4PHAA 3I28A 2RDJA 4RNNA 1KBUA 2Z7JA 3C21A 4DOAA 5T14A 3DDHA 5KNIA 5HMLA 1PZNA 3V7LA 4BWMA 2AQ0A 1XC9A 4J9PA 5J0UA 4PHEA 7ICKA 5J2EA 3HX0A 5ALOA 1JROA 2BQUA 1ZQJA 3MR5A 4CCHA 3LDAA 8ICZA 2KJ8A 4PL2A 5KFVA 5IIMA 5J8YC 3CRXA 3KBBA 4I2HA 2W04A 2WAQF 3WK8A 1COOA 3UMBA 2EAMA 3TFRA 2M0NA 3AN1A 9ICCA 3ONNA 4QIWC 2ODGA 2RHFA 5B66U 1KQQA 2F76X 2IOFK 4C7ZA 4BGDA 5D46A 2NO5A 4QZIA 3JPPA 1ZQWA 2KJ9A 4IC9A 4C8OA 4G3IA 1IV8A 4KLJA 1ZQAA 2HSZA 1TK8A 1ZRNA 4Y2PA 1FFVA 4I2FA 2ALZA 3OSPA 2A1AA 1JN3A 4B9TA 1RDFA 5J2BA 4RU9A 5DDYA 1ECWA 1X9XA 2HBJA 2K8CB 9ICQA 2A3VA 3NVVA 4ZOHC 5KFNA 5IIKA 3C1ZA 2ZTDA 4RUAA 5AM4A 5L1JA 2ZIVA 3ZDEA 2LYBA 2BPGA 8ICNA 2XGQA 2G08A 4Y2XA 4F3OA 4Y2RA 4I2JA 5KL1B 3MFIA 2L5YA 3AQFA 4DQQA 1RQNA 3HKZF 2W3SA 4OCZA 3M8SA 3PMLA 4QZEA 5DBAA 2DL0A 2ZIUB 1A6SA 3LVWA 4YR3A 3N7SC 4UB6U 4KLHA 4MFCA 1RQLA 3JPSA 1NJYA 2A19A 1BPEA 4DL4A 2ZUBA 4RQ7A 5ALZA 1JMSA 4UB1A 1KN5A 2FLNA 1RYSA 5K4LA 5KFOA 2CRXA 4C4RA 2WAQC 3H8SA 4OO1J 3LYSA 2DPJA 1J2NA 1BPYA 4X5VA 4MF8A 4AP9A 4BJQA 1K1SA 1QQ5A 3SEIA 2KZ3A 3THVA 4LZDA 4TQRA 1F5SA 4YMMA 2ASDA 3BS7A 2QB0B 2BQRA 7ICOA 1JI7A 1RM6C 4QWAA 1NK8A 2HMXA 1FO4A 9ICIA 3ZI4A 4OJ6A 3H0RB 3HRDD 4PL1A 3AMZA 4KN4A 5GTHU 2F1HA 4UAUA 4YMOA 2BCSA 3S6JA 1ZQDA 3NS1A 2LM4A 5ALIA 4MFAA 1FFUA 4RNMA 3E0FA 3WKAA 1ZD4A 2HW3A 3ISBA 5HR7A 2MAXA 2MUTA 2OEHA 5KFKA 2E8PA 1CUKA 1NJWA 4B9UA 2QB0A 3RR7A 4JWMA 4JWNA 2EZXA 3IRUA 3Q8QB 3GIKA 4NM1A 2MRLA 3UQ2A 3OJUA 5CHGA 3MGHA 2OHFA 3NVZA 3RH5A 4FE3A 1ZRMA 2K89A 5AKHA 3NASA 2YN4A 1QH9A 3SAHA 4NLNA 2ZIWB 4O3PA 2VJ5A 4OJLA 4KLEA 4J9SA 2UVWA 2HBMA 1JXEA 3RB0A 2ZTCA 5ALPA 2LYHA 3QX7A 4Y2JA 2EQYA 2JZBB 5AI0A 2KZZA 5DBCA 3F2BA 4C4TA 3GV5B 2YMMA 4BXOA 1ZJMA 2H3IA 2ESEA 1TAMA 2UVUA 4XQ8A 9ICRA 1NJZA 2J6TA 2KFZA 8ICCA 4DOCA 2IOHA 3EW9A 3KHHA 4QWBA 2OCEA 2PI5A 2RQ5A 5C5JA 3RAQA 4RNOA 4DSEA 4YP3A 1U4BA 2EZZA 2KKPA 1S97A 1NKCA 3SENA 2F44A 4EBDA 4IQVA 4WJ3B 4K4IA 2AH5A 2YTUA 4B9VA 3GIMA 2ZIWA 3QXGA 1SZHA 2HVIA 1XSLA 4O3SA 3PV8A 1V9PA 1S77D 2ISPA 2F3NA 3TAPA 1H38A 4QZ8A 3K1RB 3L4PA 5AKXA 1SV0C 4ZH4A 4GXKA 4B6JA 1ED1A 2JRZA 1N5WA 3FC4A 4QZHA 3RJJA 5J0WA 3RJIA 2BQ3A 1X2IA 4RQMA 5J2IA 4ECTA 2JEGA 1NZPA 4NV0A 2XCAA 7ICNA 3NRZA 5KFYA 4RQNA 4LVSA 4QW9A 2Y0SF 8ICFA 1Q8KA 1S0MA 1JX4A 1L5UA 4F71A 3MABA 2BHNA 2KJ5A 3EPGA 4FBUA 3Q8RB 1XS9D 1QTMA 4NY8A 4DF8A 2JR5A 4GFJA 5ALMA 3T5KA 3FYHA 5KG1A 2N1RA 1F44A 4JV1A 4J9LA 1U9LA 4I28A 1TV9A 4ELTA 5DQGA 3R9KA 1L3VA 4I2CA 2XI9A 3QUTA 1KSPA 1S0VA 2W54A 2XVTA 3LVVA 1NNLA 7ICVA 3HJEA 5J0QA 2I1QA 2AGPA 4ED2A 5IINA 1IM4A 1UQVA 2R8GA 4UW9A 2DGZA 8ICSA 4DEZA 2JH7A 4C7YA 5ALYA 2KICA 4EZ9A 4TUQA 4ECYA 1RXVA 4F4WA 2B6GA 4IRKA 3ED5A 1ZQOA 1N63A 4RPXA 3K75D 5J0RA 1ZQMA 4NXZA 5J29A 1XSPA 4P0PA 2ZG6A 5DG9A 1TVAA 1NI3A 3H8JA 4RT2A 2QLTA 4B9LA 8ICKA 4ED8A 4ELUA 2V9WA 2F1IA 1U47A 3ETRA 3RJFA 3ZD9A 4RUCA 5AK5A 3HT3A 3DV9A 4O5EA 5FP0A 1S9FA 5DGBA 2D3DA 2JV3A 2C2EA 1X9WA 2G07A 3GZFA 4F5RA 5ALRA 5J2HA 3LK9A 2WB1F 4F5OA 4KLQA 2D8CA 2BPFA 2PI4A 4ED6A 5KL8B 3J81j 2P35A 4P0QB 5EWEA 4DSJA 2G5IB 3TANA 4UB3A 3QUBA 1RZTA 1Q46A 3KKAC 4Q8EA 2E8OA 3MDCA 4CF3A 2H3VA 3FM9A 5ALJA 2BR0A 4Y2TA 4ECZA 4DSFA 3TARA 3RH4A 4TUPA 2Q0ZX 2HHSA 5KG7A 1WUDA 4UATA 3V6HA 4TURA 3KOOA 2R8KA 4F91B 5AKEA 2KV2A 1Z3EB 3RFAA 2AU0A 1HJPA 1Z00B 2W3RA 4EENA 2OH2A 4I2GA 2HHTA 4Z6EA 2JXJA 5ALHA 2FPKA 4KMOB 4I2DA 3UPQA 3H0MB 4ED0A 3T5HA 1DXSA 3FAHA 4I2IA 3H8MA 2EDUA 1S10A 2KTQA 2BCRA 4DL2A 2PXIA 8ICUA 5EWGA 2ISOA 4P4OA 4DQRA 2G5HB 3HKZC 5KT4A 4Y2VA 4ECWA 4HAIA 3QNMA 4TQSA 2KZMA 8ICOA 1X6JA 5EE0A 5KT2A 2ZJ8A 3PNCA 3RB6A 5F3XB 5KFIA 4PH5A 3TQ1A 4P4MA 1A77A 2Y1JA 3C28A 5KFWA 1PVPA 3BS5A 1SKRA 5CB1A 3K1ZA 4KTQA 1XSNA 1TKDA 2XGPA 3B9JA 4KLTA 2IHMA 5IILA 3MR3A 1SGGA 2MSNA 2ZJ5A 2K4PA 4O3OA 4QJFB 4DL7A 2O6KA 3GV8B 5DG7A 3RJEA 1K1QA 4Y2UA 3N4MB 2EZYA 3KTQA 4RQ1A 5TISU 4KLGA 3JPQA 3H4DA 3AUOA 2ZUDA 4F93B 1HUOA 2ZIVB 4JV0A 5AK4A 2YY6A 5TZVA 4OJ5A 4UASA 2HBKA 4M6WB 1CI4A 4XUSA 4EX7A 3PSTA 2VA2A 1D8BA 3OPXA 3PW7A 4KMUA 2HI0A 2WB1C 1NKEA 3BQ1A 3G6YA 5A0LA 3SV3A 2JGAA 9ICVA 5AK3A 3RRHA 2AQ4A 4RT3A 4Z6FA 1WG8A 4IR1A 4J9KA 2HOIA 4RQ4A 4M0AA 4MEXA 5AKYA 2HOFA 3M7DA 1ZQPA 4F92B 3QEAZ 1ZQGA 3IHQB 3SQIA 1RXWA 3F2DA 3VCBA 2G0AA 4GXIA 5AKIA 4BWJA 5AIAA 3I1YA 4FZLA 4CF5A 1Q3UA 5ALDA 2E5SA 5KFMA 4BDPA 5H2FU 3EZ5A 2D6FC 5IIIA 3K4GA 5KG2A 1UA0A 2V4RA 4M6WA 2RLTA 5CRXA 2W9AA 1ZD5A 3QEBZ 1DOQA 1T94A 1ZQQA 3QU7A 5DB6A 2LHTA 1L7MA 4F4ZA 2KE7A 8ICWA 9ICJA 3RF9A 1WYGA 3H40A 2UVVA 3CW2C 5AIBA 2M9NA 5KFSA 4RQ3A 5DB7A 4DFPA 3ZDAA 5BOLA 4R64A 2RRDA 3F5EA 4YG2A 1SZPA 9ICLA 3RAXA 2W9CA 5J0OA 5L1MA 1J2MA 2F8LA 5DKWA 2F2AB 2YMLA 3A0HU 5J0TA 1X6IA 4YVZA 5CR0A 2JEIA 2YB4A 1ZD3A 1DK2A 4CF4A 1BPBA 1UPHA 4DOBA 3TFSA 3OSNA 2H3QA 8ICBA 5BOMA 2LM1A 5J0SA 3C2LA 2JZBA 2XCPA 4C8NA 1EXNA 2LYAA 1SIJA 2HHUA 4KX3A 1DGJA 4R8UA 2RP5A 3F2CA 2YMPA 5KFDA 3PSPA 4F4YA 2XICA 1MN8A 2B21A 2W9CB 3C2KA 4DSLA 1V97A 2KNJA 4FO6A 1KKXA 2CXYA 1Z1BA 3AM9A 1A76A 4M2YA 4MEYA 3PY8A 3SYZA 3PVXA 9ICUA 1ZQNA 3Q8SB 1MC8A 4F5QA 2ES6A 1TFRA 1PK3A 3C1YA 1N5XA 4ECRA 2Y9UA 4EEYA 4EEKA 3WK5A 9ICHA 5AI8A 2K8AA 1ZQEA 5KFJA 2WF7A 1DK3A 9ICKA 2W9BA 8ICPA 4M9JA 4QZBA 4DQSA 4YCXA 3ZDCA 3IP4B 3Q8LA 2NRZA 3QUCA 2NYVA 5KT6A 5CA7A 7ICUA 3QUQA 3BQTA 2KK0A 3RTVA 2R8JA 2F77X 2NRXA 3B0XA 1D8LA 4YD1A 3D2QA 1SXEA 1MQ3A 4J03A 3N7PD 2I6XA 2PFPA 4Q8FA 2DF4B 4P0QA 4DL5A 2DKZA 2FJ6A 5KT7A 4CNQA 3AEVA 1O03A 1ZQYA 4F2SA 2R8HA 3TKAA 2K8BB 2EAPA 5DB8A 4O3RA 2FMPA 3SD7A 4Y2YA 2G09A 1GO3F 4Z6DA 3BQ0A 3QU9A 1IXRA 4NLZA 2QKQA 5DLFA 4NLBA 4JK1A 2GH1A 4A8EA 3CP8A 2ZIUA 4KLLA 5ALQA 4C8LA 7ICEA 2AGQA 5KFZA 2ZTEA 1BNOA 4ECXA 4NJ8A 4O3MA 4US9A 1UCVA 2IMWP 1COKA 2DBYA 3BS5B 4OD0A 2KEYA 5HHIA 2C22A 3M1YA 3N97B 3V72A 1ZQTA 4EZ6A 1ZQUA 4O3QA 3KKAA 4KLDA 4FS1A 4J9QA 4US8A 3EUB2 5DQIA 4B9SA 2W43A 2JH1A 3M9OB 5D49A 4O5CA 2WTFA 5KFFA 1BPDA 3UMCA 1UHUA 4Y2SA 3GV7B 3KZIU 5ALEA 3WKDA 2NO4A 2BGWA 2KFNA 2XIDA 3ISCA 2CPRA 1T4GA 2DUYA 5EE9A 2I5HA 5JUMA 4YR2A 5KT5A 2OYYA 5J8YA 2R8IA 3NRWA 5ALXA 1ZXIA 1Z00A 5BPCA 8ICVA 5L1KA 5AKZA 5L9XA 5KAIU 9ICOA 1L6NA 1WWVA 3PSFA 4M9LA 4ECQA 5AKKA 7ICHA 3MGVA 5KFTA 2XC9A 2AGOA 2E3TA 1RYUA 3OTQA 4PPXA 2YB1A 1QLNA 1J97A 2WFAA 1Z4OA 1QSSA 5J2FA 3RJHA 3M6ZA 5L1IA 2ASJA 2KN7A 9ICSA 1T7PA 3ISDA 1ZQLA 1F0MA 5DB9A 2ASLA 1X66A 3MBYA 4R66A 4DSIA 1A0PA 2W11A 5C0YA 3NVYA 3HPOA 4RPYA 1JXLA 1ZOLA 2XY6A 3PZPA 5AI5A 1TAUA 4YFKA 2AJQA 4I29A 4O5KA 4PHDA 3T5LA 5EOZA 3ZD8A 3RJGA 1L3UA 4UAYA 4BUGA 2W7OA 2FDRA 1MSWD 2FPLA 1WCNA 1JALA 1XU4A 1DGSA 4U7CA 5F9LA 5KG6A 4KLSA 2KP7A 4B9MA 3KZXA 9ICNA 4F2RA 5EE3A 4DWIA 1SL2A 3BQ2A 5DG8A 3M6KA 1NK7A 1NJXA 5HNKA 4DQIA 1PUZA 5AI6A 1PK1B 8ICMA 2NRWA 2JHDA 4OJOA 4P2HA 2C2DA 1N62A 2DPIA 1CEZA 5JTIA 3MGIA 1XO0A 1KL9A 2ZIXB 2ZJAA 1ZQRA 1AQ6A 2K4HA 1DRGA 7ICMA 4G9BA 2XY7A 7ICFA 3KHGA 3D2SA 3PR4A 3D6JA 3TAQA 2A1JA 2FE9A 3AU6A 2JEFA 1LKYA 8ICIA 3N7RC 3NVWA 2PFOA 3WK9A 1N60A 2AHOB 5KG3A 5DBBA 3M9NB 3IN5A 9ICXA 3UQ0A 4EYHB 2KVCA 1Z1VA 4NL9C 2NRTA 4Z6CA 5J0XA 2BCVA 2EANA 1RPLA 5AM0A 4IRCA 5AM2A 1URJA 1NK9A 5HHHA 2BKEA 5G5GA 1M6YA 3QE9Y 4C4SA 5DDMA 2HHQA 2G06A 1NKBA 4EBCA 5ALUA 4GIBA 4GLXA 1KFSA 3WKBA 3LWLA 2EAOA 1NK4A 4JV2A 2BDUA 4RQ5A 5CWRA 3QYPA 2QARB 5KFLA 3SZ2A 1RYRA 2KHVA 5AK6A 3BZKA 1X40A 4F5PA 3VC8A 1D9FA 1XWLA 1ZETA 4O0IA 1TK0A 5KFQA 2PKEA 4UBBA 1ZQXA 4RQ0A 1SL0A 2E1FA 3GU3A 4GC6A 1UT8A 2AXTU 3ZDDA 2UVRA 3Q8MA 5JU5A 5J0PA 2W9MA 1BPZA 3RB3A 3L3FX 4UB5A 5KFRA 4BXOB 2DFLA 2LI6A 4J9NA 3EYZA 8ICQA 3BZCA 4IRDA 4EELA 2W8LA 3H7IA 2GLEA 5IIJA 2WF6A 4R8UB 3PO4A 4DFMA 2WF8A 2K4IA 7ICPA 1S0NA 2BCQA 3UXOA 1T8EA 1BNPA 3TADC 1VDVA 4RPZA 4PZNA 3HW8A 4ELVA 4QZAA 5ALKA 2ZIXA 2IA6A 3V6JA 3IDWA 4BX9C 4ACOA 7ICGA 2YQEA 5DQHA 1KLNA 2NRVA 1KFDA 5G5HA 5J2KA 5AM1A 2W03A 3GDXA 1L7PA 3GIIA 5ALSA 4MFFA 1QQ7A 1B43A 1X42A 2DKXA 5KG5A 3H4BA 3RB4A 1QQ6A 4GC7A 1N61A 4IL6U 2KKVA 3ICXA 3C29A 3G6VA 5AKGA 5KTQA 4RQ6A 3NTUA 3OHAA 2H3FA 4IR9A 2KIWA 4J9OA 2C2RA 1FEZA 4F72A 1NOMA 3ALRA 4JB3A 2VA3A 1L3TA 2W55A 2E8NA 4YN4A 1IIPA 5ALNA 4EBEA 4C8KA 5KFXA 5HR6A 1L3SA 3QU2A 2R18A 2P6RA 4UAVA 5EWFA 3AQEA 5ALFA 9ICGA 4CGZA 4F50A 5HP4A 4I2BA 3PX4A 4RQ2A 4RQ8A 3SI8A 4QZGA 5KAFU 2KHQA 3IV6A 5AM3A 2PFQA 2LKYA 1KW4A 4B9NA 2OXOA 3WKCA 3JPRA 3SMVA 3C5FA 4U6PA 2Q4TA 3WK7A 1HUZA 5J2DA 9ICAA 2MA1A 3PO5A 2I9GA 3GFKB 4KLUA 2LMRA 4IS7A 4AYBC 4KLIA 1OXJA 1T3QA 1LV5A 2B0CA 3QU4A 3PMNA 5AICA 9ICTA 1BGXT 2HHVA 3ORYA 2GWSA 1K5OA 3MFHA 2FI1A 1ZQVA 3IM1A 5AKLA 1SB3C 4UB4A 1HEKA 4QZCA 1CRXA 1S8OA 3KHRA 4C0ZA 1KFTA 1B22A 4FBTA 3B0YA 3QZ8A 3Q8KA 4QW8A 1JRPA 1QSLA 3H0LB 4NLCA 2J6SA 4ED3A 1SWVA 3TADA 2GO7A 1QCKA 4PGQA 4QZ9A 1ZYQA 1V38A 4Y2QA 2J6UA 4DLEA 3JPNA 1VJ5A 3KHLA 4R65A 2W9BB 1ZQ1C 4IQUA 4P4PA 1SKWA 4NLGA 1B0XA 1RG6A 4J9MA 1Z4NA 4QWDA 7ICJA 1IG6A 1LKYB 3KD3A 3RR8A 4DSKA 3PX0A 2XO7A 2WHEA 2BCUA 1AROP 1C7YA 5ALLA 4K4GA 5DGAA 4OJPA 1V85A 1UA1A 1FIQA 3C2MA 4PZOA 2VKQA 4KX5A 5J2AA 1WCLA 3NGDA 3E58A 5KFCA 4UB2A 4HYKA 3QU5A 2BPCA 1S5LU 1D9DA 1XNSA 3PW2A 1NK5A 4M9HA 5CJ7A 1MQ2A 1SXDA 3T79A 2KD1A 4DL6A 3ZDBA 9ICEA 4UQGA 5IIOA 1O08A 4E0DA 4O3NA 5KFPA 2YMQA 4KLOA 1TAQA 2A1JB 1D8YA 4UAZA 3T3FA 3A0BU 2FLPA 5KFGA 4KLFA 3SR6A 3QZ7A 2DQNB 2ZXIA 1NK6A 1L8LA 4UB8U 2MU2A 1C20A 1ZQSA 1JUDA 2HHWA 3RH6A 2BZFA 1ZQIA 5AI9A 5J2CA 7ICLA 4UARA 1T3NA 4Q45A 3OJSA 2IHNA 2WF5A 5HMMA 4I27A 1YZ7A 1MA7A 5KFAA 4YQWA 4M47A 4C8MA 1U49A 4M9GA 1NZBA 4XRHA 1ZD2P 4QIWF 1YZ6A 4PJ0U 4DFDA 4F4XA 3C5GA 4I2AA 4EYIB 1ZQZA 1YT3A 3MR6A 3HWTA 1ZJNA 1Y88A 1S0OA 5J0YA 1PK1A 2IBKA 2F8KA 1PVRA 2ATLA 3AU2A 3CYMA 3PW0A 3V6KA 3BQ7A 1TE2A 4IQWA 2WF9A 2ZXHA 4QWCA 3OHBA 2EH9A 3PW4A 4CDGA 4DCCA 4JMUA 2W8KA 3RRGA 4MHVA 8ICYA 8ICGA 1SV4A 3UXPA 4NLKA 2FPMA 2P66A 2V4QA 3V7KA 8ICLA 3C23A 3IG8A 4DO9A 4FFDA 5ALVA 2VJ4A 4F4KA 5AI4A 7ICQA 5CEHA 1KDHA 7ICIA 2HOQA 2LBOA 5JRTA 3FDSA 2DWQA 4KITB 3KFUF 1WWUA 2K60A 1BPXA 4RZRA 2W7PA 4C80A 8ICRA 1PVQA 3L5KA 3RBEA 4DS4A 3UMGA 2FMQA 4F8RA 2FLLA 4KN7A 4CRXA 1OUQA 2OWOA 5AHXA 9ICPA 5E79U 4Q44A 1Q3VA 9ICBA 5ALWA 3JPOA 2CN1A 2PFNA 4PHPA 1N56A 3ETLA 5F9NA 3MR2A 4DL3A 5CP2A 2KG5A 5EE1A 8ICHA 5KFEA 3GQCA 2Y1IA 2QARA 1KEJA 2KMDA 3M9MB 4FZNA 4YXMA 5ALTA 4ECSA 4FS2A 1OW5A 3N28A 4PGYA 4DLGA 3BDPA 3SAFA 4DFKA 4QWEA 1VLBA 2PMZC 8ICEA 3G6XA 3F53A 5ALGA 2HVHA 2XY5A 4YXJA 2HDOA 4YR0A 5AKJA 3V7JA 3EPIA 1X9SA 1B4FA 4AYBF 5KG0A 4YD2A 3PR5B 4NWIA 2F1JA 5KG4A 2GOLA 3WK6A 4M04A 2NV3A 3F5AA 9ICWA 4UBCA 3WU2U 3PX6A 4MF2A 2ZUCA 4QZFA 3HP6A 4KLMA 2MUTB 2HBLA 3NUQA 1ZQKA 4TUSA 2KSOB 2KOBA 5GTIU 4UAWA 4XA5A 4O9MA 1N48A 2K4EA 1KTQA 5J2GA 4DF4A 2OM6A 1SV0A 3MC1A 2Y9TA 4IQTA 1UT5A 3TI0A 4Q43A 1XO1A 4QZDA 3HILA 3JPTA 5D4BA 1Z19A 2KSOA 2Y0SC 3BJYA 1KRPA 3UXNA 7ICSA 1ZQBA 4USAA 3GILA 5B5EU 3PW5A 1LVHA 2IOFA 1ZQFA 4LJXA 1BVSA 2E1EA 4QNLA 9ICMA 3GIJA 4ECVA 3OGUA 4M9NA 4FZMA 8ICAA 8ICJA 5KFUA 4DFJA 3WK4A 1N2XA 4ED7A 3LWMA 2JMGA
chains in the Genus database with same CATH topology
4NM2A 1TFRA 2BDPA 4J9OA 2C2RA 2JEGA 1NOMA 3C1YA 2XCAA 3RJKA 4ECRA 4EEYA 1U45A 2VA3A 8ICXA 1L3TA 9ICHA 1NK0A 4YN4A 3SV4A 7ICNA 4EBEA 5KFJA 1ZQEA 9ICKA 4GXJA 2W9BA 8ICPA 4C8KA 5KFYA 5KFXA 4J9RA 1L3SA 4M9JA 4QZBA 4QW9A 4LVSA 8ICFA 4DQSA 1LB2B 1S0MA 3MDAA 4YCXA 2P6RA 1JX4A 5EWFA 3ZDCA 5KFBA 3Q8LA 2NRZA 3M8RA 1L5UA 1ZQCA 5KT6A 3MABA 5CA7A 4LZGA 7ICUA 1U48A 3BQTA 9ICGA 4YMNA 2BHNA 3RTVA 2R8JA 3EPGA 4FBUA 3Q8RB 1XS9D 4F50A 2NRXA 1X9MA 5HP4A 1QTMA 3B0XA 4NY8A 4DF8A 7ICRA 1D8LA 4I2BA 4YD1A 4DS5A 3T5KA 3E2EA 9ICFA 3FYHA 5KG1A 2HHXA 7ICTA 4JV1A 3PX4A 1MQ3A 4J9LA 4RQ2A 4RQ8A 1U9LA 2PFPA 3SI8A 4QZGA 4I2EA 1SL1A 5L1LA 4I28A 1TV9A 4ELTA 5J2JA 4Q8FA 4DL5A 5DQGA 2PFQA 1JIHA 5KT7A 2H5XA 1S76D 1L3VA 4B9NA 2VA8A 4I2CA 1ZQYA 4F2SA 1KSPA 2R8HA 3JPRA 1SKSA 1S0VA 3C5FA 4JUZA 1HUZA 5J2DA 1ZQHA 7ICVA 3H8WA 9ICAA 2VANA 5J0QA 2I1QA 5DB8A 2AGPA 4ED2A 2FMPA 3PO5A 4O3RA 3EWAA 3T5JA 2I9GA 5IINA 1IM4A 3GFKB 4Z6DA 4KLUA 4PGXA 3BQ0A 3RBDA 1QSYA 2JEJA 4DQPA 1IXRA 4KLIA 2R8GA 4NLZA 5KFHA 4R63A 4ECUA 5DLFA 1LV5A 4JK1A 2P6UA 3PMNA 1TK5A 2C28A 4K4HA 9ICTA 8ICSA 1BGXT 2RDIA 4ED1A 5DLGA 5KT3A 2HHVA 3ORYA 4DEZA 2GWSA 4KLLA 3Q8PB 4C8LA 3MFHA 7ICEA 4EZ9A 2AGQA 1ZQVA 2ZTEA 5KFZA 3IM1A 4TUQA 4ECXA 4ECYA 1RXVA 4UB4A 4F5NA 4F4WA 4QZCA 8ICTA 2FMSA 4PHAA 4IRKA 1ZQOA 2IMWP 4RPXA 3KHRA 2RDJA 1KFTA 1B22A 3K75D 5HHIA 3B0YA 5J0RA 4RNNA 2C22A 1ZQMA 4FBTA 3QZ8A 3C21A 4NXZA 5J29A 3V72A 4DOAA 4QW8A 3N97B 3Q8KA 1XSPA 1ZQTA 4EZ6A 1QSLA 1ZQUA 2J6SA 4ED3A 4O3QA 5HMLA 5DG9A 1PZNA 1TVAA 4KLDA 3V7LA 3H8JA 4BWMA 4RT2A 2AQ0A 4FS1A 4B9LA 8ICKA 4J9QA 4ED8A 4PGQA 4QZ9A 1XC9A 2V9WA 4ELUA 1ZYQA 4J9PA 5J0UA 2J6UA 2F1IA 5DQIA 4DLEA 4B9SA 4PHEA 7ICKA 1U47A 5J2EA 3JPNA 3HX0A 3ZD9A 4RUCA 3KHLA 2BQUA 1ZQJA 3MR5A 3RJFA 4R65A 2W9BB 4CCHA 3LDAA 3HT3A 4IQUA 4P4PA 3M9OB 4O5EA 8ICZA 1S9FA 1SKWA 5D49A 4NLGA 4O5CA 2WTFA 5KFFA 5KFVA 5DGBA 1BPDA 5IIMA 2C2EA 1X9WA 4I2HA 4J9MA 4QWDA 7ICJA 3RR8A 1COOA 3GV7B 4F5RA 5J2HA 3TFRA 3LK9A 4DSKA 2BGWA 4F5OA 2KFNA 3PX0A 2XO7A 4KLQA 3ISCA 2BCUA 1AROP 1T4GA 9ICCA 1C7YA 2BPFA 5JUMA 2PI4A 4ED6A 4YR2A 5KT5A 4K4GA 5DGAA 2R8IA 5EWEA 1UA1A 4DSJA 1Z00A 3TANA 5BPCA 4BGDA 5D46A 8ICVA 4QZIA 5L1KA 4UB3A 3C2MA 1RZTA 5L9XA 9ICOA 4Q8EA 3JPPA 4M9LA 1ZQWA 3MDCA 5J2AA 1WCLA 3NGDA 4C8OA 4ECQA 4G3IA 5KFCA 4KLJA 2BR0A 7ICHA 4UB2A 4HYKA 1ZQAA 2BPCA 1TK8A 5KFTA 2XC9A 4ECZA 2AGOA 4DSFA 1D9DA 4I2FA 2ALZA 3OSPA 3PW2A 3TARA 1NK5A 1JN3A 4PPXA 4B9TA 3RH4A 4TUPA 4M9HA 1QLNA 2Q0ZX 2HHSA 5KG7A 5CJ7A 5J2BA 1QSSA 5J2FA 1MQ2A 3V6HA 3RJHA 4TURA 4RU9A 5DDYA 4DL6A 2R8KA 4F91B 5L1IA 2ASJA 3ZDBA 1Z3EB 9ICEA 2KN7A 2AU0A 1T7PA 9ICSA 3ISDA 1HJPA 1Z00B 9ICQA 4UQGA 5IIOA 1ZQLA 5DB9A 4E0DA 5KFNA 2ASLA 5IIKA 3MBYA 4O3NA 5KFPA 4R66A 4I2GA 3C1ZA 2HHTA 2ZTDA 4Z6EA 4DSIA 4RUAA 4KLOA 3HPOA 1TAQA 4RPYA 5L1JA 2A1JB 1JXLA 3ZDEA 1D8YA 4UAZA 3T3FA 2XY6A 2FPKA 2BPGA 2FLPA 5KFGA 4I2DA 2XGQA 3UPQA 4KLFA 1TAUA 4YFKA 3QZ7A 8ICNA 4ED0A 3T5HA 4F3OA 2AJQA 4I2IA 4I29A 4O5KA 4I2JA 1S10A 1NK6A 4PHDA 2KTQA 2BCRA 4DL2A 2PXIA 8ICUA 3MFIA 3T5LA 5EWGA 1ZQSA 5EOZA 3ZD8A 2ISOA 4DQQA 3RH6A 1L3UA 3RJGA 1ZQIA 2HHWA 4P4OA 5J2CA 7ICLA 1T3NA 4UAYA 4Q45A 4DQRA 3OJSA 2IHNA 5HMMA 4I27A 5KT4A 3M8SA 4ECWA 1MSWD 3PMLA 5KFAA 2FPLA 4YQWA 5DBAA 4QZEA 4M47A 4TQSA 4C8MA 2KZMA 1WCNA 8ICOA 1U49A 4YR3A 1XU4A 4M9GA 1DGSA 5KT2A 4XRHA 4KLHA 2ZJ8A 5F9LA 5KG6A 4KLSA 4F4XA 4MFCA 3PNCA 4B9MA 3RB6A 3JPSA 1NJYA 5KFIA 1BPEA 4PH5A 4DL4A 2ZUBA 3C5GA 3TQ1A 4P4MA 9ICNA 4I2AA 4F2RA 4EYIB 4RQ7A 1ZQZA 1A77A 1JMSA 3MR6A 4DWIA 4UB1A 2Y1JA 3HWTA 5KFWA 2FLNA 1RYSA 5KFOA 1SKRA 5CB1A 4KTQA 1XSNA 3H8SA 1TKDA 1ZJNA 1Y88A 3BQ2A 5DG8A 5J0YA 1NK7A 1S0OA 2XGPA 1SL2A 2IBKA 2DPJA 1NJXA 5HNKA 4DQIA 4KLTA 2IHMA 2ATLA 1BPYA 4X5VA 5IILA 8ICMA 2NRWA 3MR3A 3AU2A 3PW0A 2ZJ5A 3V6KA 4MF8A 4O3OA 4IQWA 4P2HA 4DL7A 2C2DA 4QWCA 3OHBA 2DPIA 3GV8B 5DG7A 1K1SA 3MGIA 3PW4A 3RJEA 1CEZA 1K1QA 2KZ3A 3N4MB 2W8KA 2ZJAA 3RRGA 8ICYA 1ZQRA 8ICGA 3KTQA 3UXPA 3THVA 4NLKA 4LZDA 7ICMA 4RQ1A 4TQRA 2XY7A 7ICFA 4KLGA 3JPQA 2FPMA 3H4DA 4YMMA 3KHGA 2ASDA 3AUOA 2BQRA 2ZUDA 7ICOA 3PR4A 2P66A 4F93B 3TAQA 2V4QA 3V7KA 1HUOA 4QWAA 1NK8A 8ICLA 3C23A 2A1JA 4DO9A 3AU6A 9ICIA 4JV0A 4F4KA 2JEFA 7ICQA 1KDHA 8ICIA 7ICIA 3FDSA 4KN4A 5TZVA 2F1HA 4YMOA 2BCSA 4KITB 2PFOA 1ZQDA 4M6WB 5KG3A 5DBBA 3M9NB 1BPXA 4XUSA 9ICXA 4RZRA 3UQ0A 4EYHB 2VA2A 3PW7A 4KMUA 8ICRA 1NKEA 4MFAA 3BQ1A 4RNMA 3G6YA 3RBEA 2NRTA 3SV3A 4DS4A 4Z6CA 2FMQA 2HW3A 9ICVA 5J0XA 3ISBA 2BCVA 4F8RA 1RPLA 2FLLA 3RRHA 2MAXA 2AQ4A 4IRCA 4KN7A 4RT3A 2MUTA 4Z6FA 2OWOA 1NK9A 5HHHA 5KFKA 2BKEA 4IR1A 4J9KA 3QE9Y 9ICPA 1CUKA 4RQ4A 1NJWA 5DDMA 4Q44A 4B9UA 4M0AA 2HHQA 3RR7A 1NKBA 4JWMA 4JWNA 4MEXA 4EBCA 9ICBA 3JPOA 4GLXA 1KFSA 2PFNA 4PHPA 1ZQPA 4F92B 3Q8QB 3LWLA 3GIKA 3QEAZ 1N56A 3ETLA 4NM1A 3UQ2A 3IHQB 3OJUA 5F9NA 1NK4A 1RXWA 1ZQGA 3MR2A 4DL3A 5CP2A 5CHGA 4JV2A 3MGHA 4RQ5A 5CWRA 8ICHA 5KFLA 4GXIA 3SZ2A 3RH5A 1RYRA 5KFEA 4BWJA 3GQCA 2Y1IA 1KEJA 3M9MB 4YXMA 4F5PA 4ECSA 4FS2A 3BDPA 4DLGA 4PGYA 1XWLA 1D9FA 1ZETA 4O0IA 4DFKA 1TK0A 4NLNA 4QWEA 5KFQA 5KFMA 4UBBA 4BDPA 4O3PA 1ZQXA 4RQ0A 3EZ5A 8ICEA 1SL0A 3G6XA 4KLEA 5IIIA 3K4GA 5KG2A 2HVHA 4GC6A 2XY5A 2V4RA 4J9SA 4M6WA 1UA0A 2UVWA 2ZTCA 1JXEA 4YXJA 2W9AA 3QEBZ 3RB0A 1UT8A 1DOQA 4YR0A 1ZQQA 2LYHA 5DB6A 3V7JA 3EPIA 4F4ZA 8ICWA 9ICJA 2JZBB 3ZDDA 3H40A 1X9SA 2UVVA 2UVRA 3Q8MA 2KZZA 5J0PA 2W9MA 5DBCA 2M9NA 5KFSA 5KG0A 1BPZA 4YD2A 3GV5B 4RQ3A 3PR5B 4BXOA 3RB3A 4UB5A 1ZJMA 5DB7A 4DFPA 3ZDAA 2F1JA 5KG4A 2UVUA 5BOLA 5KFRA 4M04A 4BXOB 4XQ8A 2DFLA 9ICRA 4R64A 4J9NA 1NJZA 2J6TA 4YG2A 3EYZA 1SZPA 9ICLA 3RAXA 2KFZA 8ICCA 9ICWA 4UBCA 4DOCA 2W9CA 3PX6A 3EW9A 4IRDA 4MF2A 8ICQA 2ZUCA 4QWBA 3KHHA 2W8LA 5J0OA 4QZFA 3HP6A 3H7IA 4KLMA 2MUTB 2PI5A 1ZQKA 5IIJA 4R8UB 5DKWA 3PO4A 4TUSA 5C5JA 4DFMA 3RAQA 4UAWA 7ICPA 1S0NA 2BCQA 4XA5A 5J0TA 4RNOA 4DSEA 4YP3A 1U4BA 4YVZA 5CR0A 2JEIA 3UXOA 4O9MA 1S97A 1T8EA 1NKCA 1BPBA 4DOBA 4EBDA 4IQVA 4RPZA 3OSNA 3TFSA 1N48A 4K4IA 1KTQA 8ICBA 5J2GA 5BOMA 4DF4A 3HW8A 5J0SA 4B9VA 3C2LA 3GIMA 4QZAA 2JZBA 4ELVA 2XCPA 4IQTA 4C8NA 2IA6A 1UT5A 3V6JA 1EXNA 4Q43A 1XO1A 3TI0A 1XSLA 4O3SA 2HVIA 3PV8A 2HHUA 4R8UA 4QZDA 3JPTA 5D4BA 7ICGA 1V9PA 5DQHA 1S77D 1KLNA 2NRVA 2ISPA 3BJYA 5KFDA 3TAPA 1KFDA 3UXNA 1KRPA 4F4YA 7ICSA 1H38A 5J2KA 4QZ8A 1ZQBA 2B21A 3GILA 2W9CB 3C2KA 4DSLA 3PW5A 3GDXA 1ZQFA 4ZH4A 4GXKA 4FO6A 1BVSA 3GIIA 4MFFA 1B43A 1A76A 4M2YA 9ICMA 5KG5A 3H4BA 3RB4A 4MEYA 3GIJA 3PY8A 4GC7A 4QZHA 4ECVA 3SYZA 3OGUA 3PVXA 3RJJA 4M9NA 9ICUA 5J0WA 1ZQNA 3RJIA 3G6VA 8ICAA 2BQ3A 8ICJA 5KTQA 5KFUA 4RQ6A 3NTUA 3OHAA 1X2IA 3Q8SB 4DFJA 4ED7A 1MC8A 5J2IA 3LWMA 4ECTA 4F5QA 4IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NM2 A;  1TFR A;  2BDP A;  4J9O A;  2C2R A;  2JEG A;  1NOM A;  3C1Y A;  2XCA A;  3RJK A;  4ECR A;  4EEY A;  1U45 A;  2VA3 A;  8ICX A;  1L3T A;  9ICH A;  1NK0 A;  4YN4 A;  3SV4 A;  7ICN A;  4EBE A;  5KFJ A;  1ZQE A;  9ICK A;  4GXJ A;  2W9B A;  8ICP A;  4C8K A;  5KFY A;  5KFX A;  4J9R A;  1L3S A;  4M9J A;  4QZB A;  4QW9 A;  4LVS A;  8ICF A;  4DQS A;  1LB2 B;  1S0M A;  3MDA A;  4YCX A;  2P6R A;  1JX4 A;  5EWF A;  3ZDC A;  5KFB A;  3Q8L A;  2NRZ A;  3M8R A;  1L5U A;  1ZQC A;  5KT6 A;  3MAB A;  5CA7 A;  4LZG A;  7ICU A;  1U48 A;  3BQT A;  9ICG A;  4YMN A;  2BHN A;  3RTV A;  2R8J A;  3EPG A;  4FBU A;  3Q8R B;  1XS9 D;  4F50 A;  2NRX A;  1X9M A;  5HP4 A;  1QTM A;  3B0X A;  4NY8 A;  4DF8 A;  7ICR A;  1D8L A;  4I2B A;  4YD1 A;  4DS5 A;  3T5K A;  3E2E A;  9ICF A;  3FYH A;  5KG1 A;  2HHX A;  7ICT A;  4JV1 A;  3PX4 A;  1MQ3 A;  4J9L A;  4RQ2 A;  4RQ8 A;  1U9L A;  2PFP A;  3SI8 A;  4QZG A;  4I2E A;  1SL1 A;  5L1L A;  4I28 A;  1TV9 A;  4ELT A;  5J2J A;  4Q8F A;  4DL5 A;  5DQG A;  2PFQ A;  1JIH A;  5KT7 A;  2H5X A;  1S76 D;  1L3V A;  4B9N A;  2VA8 A;  4I2C A;  1ZQY A;  4F2S A;  1KSP A;  2R8H A;  3JPR A;  1SKS A;  1S0V A;  3C5F A;  4JUZ A;  1HUZ A;  5J2D A;  1ZQH A;  7ICV A;  3H8W A;  9ICA A;  2VAN A;  5J0Q A;  2I1Q A;  5DB8 A;  2AGP A;  4ED2 A;  2FMP A;  3PO5 A;  4O3R A;  3EWA A;  3T5J A;  2I9G A;  5IIN A;  1IM4 A;  3GFK B;  4Z6D A;  4KLU A;  4PGX A;  3BQ0 A;  3RBD A;  1QSY A;  2JEJ A;  4DQP A;  1IXR A;  4KLI A;  2R8G A;  4NLZ A;  5KFH A;  4R63 A;  4ECU A;  5DLF A;  1LV5 A;  4JK1 A;  2P6U A;  3PMN A;  1TK5 A;  2C28 A;  4K4H A;  9ICT A;  8ICS A;  1BGX T;  2RDI A;  4ED1 A;  5DLG A;  5KT3 A;  2HHV A;  3ORY A;  4DEZ A;  2GWS A;  4KLL A;  3Q8P B;  4C8L A;  3MFH A;  7ICE A;  4EZ9 A;  2AGQ A;  1ZQV A;  2ZTE A;  5KFZ A;  3IM1 A;  4TUQ A;  4ECX A;  4ECY A;  1RXV A;  4UB4 A;  4F5N A;  4F4W A;  4QZC A;  8ICT A;  2FMS A;  4PHA A;  4IRK A;  1ZQO A;  2IMW P;  4RPX A;  3KHR A;  2RDJ A;  1KFT A;  1B22 A;  3K75 D;  5HHI A;  3B0Y A;  5J0R A;  4RNN A;  2C22 A;  1ZQM A;  4FBT A;  3QZ8 A;  3C21 A;  4NXZ A;  5J29 A;  3V72 A;  4DOA A;  4QW8 A;  3N97 B;  3Q8K A;  1XSP A;  1ZQT A;  4EZ6 A;  1QSL A;  1ZQU A;  2J6S A;  4ED3 A;  4O3Q A;  5HML A;  5DG9 A;  1PZN A;  1TVA A;  4KLD A;  3V7L A;  3H8J A;  4BWM A;  4RT2 A;  2AQ0 A;  4FS1 A;  4B9L A;  8ICK A;  4J9Q A;  4ED8 A;  4PGQ A;  4QZ9 A;  1XC9 A;  2V9W A;  4ELU A;  1ZYQ A;  4J9P A;  5J0U A;  2J6U A;  2F1I A;  5DQI A;  4DLE A;  4B9S A;  4PHE A;  7ICK A;  1U47 A;  5J2E A;  3JPN A;  3HX0 A;  3ZD9 A;  4RUC A;  3KHL A;  2BQU A;  1ZQJ A;  3MR5 A;  3RJF A;  4R65 A;  2W9B B;  4CCH A;  3LDA A;  3HT3 A;  4IQU A;  4P4P A;  3M9O B;  4O5E A;  8ICZ A;  1S9F A;  1SKW A;  5D49 A;  4NLG A;  4O5C A;  2WTF A;  5KFF A;  5KFV A;  5DGB A;  1BPD A;  5IIM A;  2C2E A;  1X9W A;  4I2H A;  4J9M A;  4QWD A;  7ICJ A;  3RR8 A;  1COO A;  3GV7 B;  4F5R A;  5J2H A;  3TFR A;  3LK9 A;  4DSK A;  2BGW A;  4F5O A;  2KFN A;  3PX0 A;  2XO7 A;  4KLQ A;  3ISC A;  2BCU A;  1ARO P;  1T4G A;  9ICC A;  1C7Y A;  2BPF A;  5JUM A;  2PI4 A;  4ED6 A;  4YR2 A;  5KT5 A;  4K4G A;  5DGA A;  2R8I A;  5EWE A;  1UA1 A;  4DSJ A;  1Z00 A;  3TAN A;  5BPC A;  4BGD A;  5D46 A;  8ICV A;  4QZI A;  5L1K A;  4UB3 A;  3C2M A;  1RZT A;  5L9X A;  9ICO A;  4Q8E A;  3JPP A;  4M9L A;  1ZQW A;  3MDC A;  5J2A A;  1WCL A;  3NGD A;  4C8O A;  4ECQ A;  4G3I A;  5KFC A;  4KLJ A;  2BR0 A;  7ICH A;  4UB2 A;  4HYK A;  1ZQA A;  2BPC A;  1TK8 A;  5KFT A;  2XC9 A;  4ECZ A;  2AGO A;  4DSF A;  1D9D A;  4I2F A;  2ALZ A;  3OSP A;  3PW2 A;  3TAR A;  1NK5 A;  1JN3 A;  4PPX A;  4B9T A;  3RH4 A;  4TUP A;  4M9H A;  1QLN A;  2Q0Z X;  2HHS A;  5KG7 A;  5CJ7 A;  5J2B A;  1QSS A;  5J2F A;  1MQ2 A;  3V6H A;  3RJH A;  4TUR A;  4RU9 A;  5DDY A;  4DL6 A;  2R8K A;  4F91 B;  5L1I A;  2ASJ A;  3ZDB A;  1Z3E B;  9ICE A;  2KN7 A;  2AU0 A;  1T7P A;  9ICS A;  3ISD A;  1HJP A;  1Z00 B;  9ICQ A;  4UQG A;  5IIO A;  1ZQL A;  5DB9 A;  4E0D A;  5KFN A;  2ASL A;  5IIK A;  3MBY A;  4O3N A;  5KFP A;  4R66 A;  4I2G A;  3C1Z A;  2HHT A;  2ZTD A;  4Z6E A;  4DSI A;  4RUA A;  4KLO A;  3HPO A;  1TAQ A;  4RPY A;  5L1J A;  2A1J B;  1JXL A;  3ZDE A;  1D8Y A;  4UAZ A;  3T3F A;  2XY6 A;  2FPK A;  2BPG A;  2FLP A;  5KFG A;  4I2D A;  2XGQ A;  3UPQ A;  4KLF A;  1TAU A;  4YFK A;  3QZ7 A;  8ICN A;  4ED0 A;  3T5H A;  4F3O A;  2AJQ A;  4I2I A;  4I29 A;  4O5K A;  4I2J A;  1S10 A;  1NK6 A;  4PHD A;  2KTQ A;  2BCR A;  4DL2 A;  2PXI A;  8ICU A;  3MFI A;  3T5L A;  5EWG A;  1ZQS A;  5EOZ A;  3ZD8 A;  2ISO A;  4DQQ A;  3RH6 A;  1L3U A;  3RJG A;  1ZQI A;  2HHW A;  4P4O A;  5J2C A;  7ICL A;  1T3N A;  4UAY A;  4Q45 A;  4DQR A;  3OJS A;  2IHN A;  5HMM A;  4I27 A;  5KT4 A;  3M8S A;  4ECW A;  1MSW D;  3PML A;  5KFA A;  2FPL A;  4YQW A;  5DBA A;  4QZE A;  4M47 A;  4TQS A;  4C8M A;  2KZM A;  1WCN A;  8ICO A;  1U49 A;  4YR3 A;  1XU4 A;  4M9G A;  1DGS A;  5KT2 A;  4XRH A;  4KLH A;  2ZJ8 A;  5F9L A;  5KG6 A;  4KLS A;  4F4X A;  4MFC A;  3PNC A;  4B9M A;  3RB6 A;  3JPS A;  1NJY A;  5KFI A;  1BPE A;  4PH5 A;  4DL4 A;  2ZUB A;  3C5G A;  3TQ1 A;  4P4M A;  9ICN A;  4I2A A;  4F2R A;  4EYI B;  4RQ7 A;  1ZQZ A;  1A77 A;  1JMS A;  3MR6 A;  4DWI A;  4UB1 A;  2Y1J A;  3HWT A;  5KFW A;  2FLN A;  1RYS A;  5KFO A;  1SKR A;  5CB1 A;  4KTQ A;  1XSN A;  3H8S A;  1TKD A;  1ZJN A;  1Y88 A;  3BQ2 A;  5DG8 A;  5J0Y A;  1NK7 A;  1S0O A;  2XGP A;  1SL2 A;  2IBK A;  2DPJ A;  1NJX A;  5HNK A;  4DQI A;  4KLT A;  2IHM A;  2ATL A;  1BPY A;  4X5V A;  5IIL A;  8ICM A;  2NRW A;  3MR3 A;  3AU2 A;  3PW0 A;  2ZJ5 A;  3V6K A;  4MF8 A;  4O3O A;  4IQW A;  4P2H A;  4DL7 A;  2C2D A;  4QWC A;  3OHB A;  2DPI A;  3GV8 B;  5DG7 A;  1K1S A;  3MGI A;  3PW4 A;  3RJE A;  1CEZ A;  1K1Q A;  2KZ3 A;  3N4M B;  2W8K A;  2ZJA A;  3RRG A;  8ICY A;  1ZQR A;  8ICG A;  3KTQ A;  3UXP A;  3THV A;  4NLK A;  4LZD A;  7ICM A;  4RQ1 A;  4TQR A;  2XY7 A;  7ICF A;  4KLG A;  3JPQ A;  2FPM A;  3H4D A;  4YMM A;  3KHG A;  2ASD A;  3AUO A;  2BQR A;  2ZUD A;  7ICO A;  3PR4 A;  2P66 A;  4F93 B;  3TAQ A;  2V4Q A;  3V7K A;  1HUO A;  4QWA A;  1NK8 A;  8ICL A;  3C23 A;  2A1J A;  4DO9 A;  3AU6 A;  9ICI A;  4JV0 A;  4F4K A;  2JEF A;  7ICQ A;  1KDH A;  8ICI A;  7ICI A;  3FDS A;  4KN4 A;  5TZV A;  2F1H A;  4YMO A;  2BCS A;  4KIT B;  2PFO A;  1ZQD A;  4M6W B;  5KG3 A;  5DBB A;  3M9N B;  1BPX A;  4XUS A;  9ICX A;  4RZR A;  3UQ0 A;  4EYH B;  2VA2 A;  3PW7 A;  4KMU A;  8ICR A;  1NKE A;  4MFA A;  3BQ1 A;  4RNM A;  3G6Y A;  3RBE A;  2NRT A;  3SV3 A;  4DS4 A;  4Z6C A;  2FMQ A;  2HW3 A;  9ICV A;  5J0X A;  3ISB A;  2BCV A;  4F8R A;  1RPL A;  2FLL A;  3RRH A;  2MAX A;  2AQ4 A;  4IRC A;  4KN7 A;  4RT3 A;  2MUT A;  4Z6F A;  2OWO A;  1NK9 A;  5HHH A;  5KFK A;  2BKE A;  4IR1 A;  4J9K A;  3QE9 Y;  9ICP A;  1CUK A;  4RQ4 A;  1NJW A;  5DDM A;  4Q44 A;  4B9U A;  4M0A A;  2HHQ A;  3RR7 A;  1NKB A;  4JWM A;  4JWN A;  4MEX A;  4EBC A;  9ICB A;  3JPO A;  4GLX A;  1KFS A;  2PFN A;  4PHP A;  1ZQP A;  4F92 B;  3Q8Q B;  3LWL A;  3GIK A;  3QEA Z;  1N56 A;  3ETL A;  4NM1 A;  3UQ2 A;  3IHQ B;  3OJU A;  5F9N A;  1NK4 A;  1RXW A;  1ZQG A;  3MR2 A;  4DL3 A;  5CP2 A;  5CHG A;  4JV2 A;  3MGH A;  4RQ5 A;  5CWR A;  8ICH A;  5KFL A;  4GXI A;  3SZ2 A;  3RH5 A;  1RYR A;  5KFE A;  4BWJ A;  3GQC A;  2Y1I A;  1KEJ A;  3M9M B;  4YXM A;  4F5P A;  4ECS A;  4FS2 A;  3BDP A;  4DLG A;  4PGY A;  1XWL A;  1D9F A;  1ZET A;  4O0I A;  4DFK A;  1TK0 A;  4NLN A;  4QWE A;  5KFQ A;  5KFM A;  4UBB A;  4BDP A;  4O3P A;  1ZQX A;  4RQ0 A;  3EZ5 A;  8ICE A;  1SL0 A;  3G6X A;  4KLE A;  5III A;  3K4G A;  5KG2 A;  2HVH A;  4GC6 A;  2XY5 A;  2V4R A;  4J9S A;  4M6W A;  1UA0 A;  2UVW A;  2ZTC A;  1JXE A;  4YXJ A;  2W9A A;  3QEB Z;  3RB0 A;  1UT8 A;  1DOQ A;  4YR0 A;  1ZQQ A;  2LYH A;  5DB6 A;  3V7J A;  3EPI A;  4F4Z A;  8ICW A;  9ICJ A;  2JZB B;  3ZDD A;  3H40 A;  1X9S A;  2UVV A;  2UVR A;  3Q8M A;  2KZZ A;  5J0P A;  2W9M A;  5DBC A;  2M9N A;  5KFS A;  5KG0 A;  1BPZ A;  4YD2 A;  3GV5 B;  4RQ3 A;  3PR5 B;  4BXO A;  3RB3 A;  4UB5 A;  1ZJM A;  5DB7 A;  4DFP A;  3ZDA A;  2F1J A;  5KG4 A;  2UVU A;  5BOL A;  5KFR A;  4M04 A;  4BXO B;  4XQ8 A;  2DFL A;  9ICR A;  4R64 A;  4J9N A;  1NJZ A;  2J6T A;  4YG2 A;  3EYZ A;  1SZP A;  9ICL A;  3RAX A;  2KFZ A;  8ICC A;  9ICW A;  4UBC A;  4DOC A;  2W9C A;  3PX6 A;  3EW9 A;  4IRD A;  4MF2 A;  8ICQ A;  2ZUC A;  4QWB A;  3KHH A;  2W8L A;  5J0O A;  4QZF A;  3HP6 A;  3H7I A;  4KLM A;  2MUT B;  2PI5 A;  1ZQK A;  5IIJ A;  4R8U B;  5DKW A;  3PO4 A;  4TUS A;  5C5J A;  4DFM A;  3RAQ A;  4UAW A;  7ICP A;  1S0N A;  2BCQ A;  4XA5 A;  5J0T A;  4RNO A;  4DSE A;  4YP3 A;  1U4B A;  4YVZ A;  5CR0 A;  2JEI A;  3UXO A;  4O9M A;  1S97 A;  1T8E A;  1NKC A;  1BPB A;  4DOB A;  4EBD A;  4IQV A;  4RPZ A;  3OSN A;  3TFS A;  1N48 A;  4K4I A;  1KTQ A;  8ICB A;  5J2G A;  5BOM A;  4DF4 A;  3HW8 A;  5J0S A;  4B9V A;  3C2L A;  3GIM A;  4QZA A;  2JZB A;  4ELV A;  2XCP A;  4IQT A;  4C8N A;  2IA6 A;  1UT5 A;  3V6J A;  1EXN A;  4Q43 A;  1XO1 A;  3TI0 A;  1XSL A;  4O3S A;  2HVI A;  3PV8 A;  2HHU A;  4R8U A;  4QZD A;  3JPT A;  5D4B A;  7ICG A;  1V9P A;  5DQH A;  1S77 D;  1KLN A;  2NRV A;  2ISP A;  3BJY A;  5KFD A;  3TAP A;  1KFD A;  3UXN A;  1KRP A;  4F4Y A;  7ICS A;  1H38 A;  5J2K A;  4QZ8 A;  1ZQB A;  2B21 A;  3GIL A;  2W9C B;  3C2K A;  4DSL A;  3PW5 A;  3GDX A;  1ZQF A;  4ZH4 A;  4GXK A;  4FO6 A;  1BVS A;  3GII A;  4MFF A;  1B43 A;  1A76 A;  4M2Y A;  9ICM A;  5KG5 A;  3H4B A;  3RB4 A;  4MEY A;  3GIJ A;  3PY8 A;  4GC7 A;  4QZH A;  4ECV A;  3SYZ A;  3OGU A;  3PVX A;  3RJJ A;  4M9N A;  9ICU A;  5J0W A;  1ZQN A;  3RJI A;  3G6V A;  8ICA A;  2BQ3 A;  8ICJ A;  5KTQ A;  5KFU A;  4RQ6 A;  3NTU A;  3OHA A;  1X2I A;  3Q8S B;  4DFJ A;  4ED7 A;  1MC8 A;  5J2I A;  3LWM A;  4ECT A;  4F5Q A;  4IR9 A; 
#chains in the Genus database with same CATH topology
 4NM2 A;  1L7N A;  2HCF A;  2BDP A;  2H3Z A;  1L7O A;  3RJK A;  8ICX A;  1U45 A;  1NK0 A;  3SV4 A;  4GXJ A;  3CNH A;  4J9R A;  3U26 A;  1LB2 B;  3MDA A;  2LPE A;  5AM5 A;  5KFB A;  3M8R A;  1ZQC A;  4LZG A;  1U48 A;  4YMN A;  1P7D A;  2YX8 A;  3DEE A;  3PSI A;  1X9M A;  7ICR A;  2KVS A;  9ICF A;  3E2E A;  4DS5 A;  2HHX A;  3UM9 A;  7ICT A;  4I2E A;  1SL1 A;  5L1L A;  3SAG A;  5J2J A;  1JIH A;  2KIV A;  2E8M A;  2H5X A;  1S76 D;  2VA8 A;  1SKS A;  4JUZ A;  1ZQH A;  4CE6 A;  4P0P B;  3H8W A;  2VAN A;  4EX6 A;  3EWA A;  3O0F A;  2PMZ F;  3T5J A;  4PGX A;  3WKE A;  3RBD A;  1QSY A;  2JEJ A;  4DQP A;  2VIX A;  4ICA A;  5KFH A;  4R63 A;  4ECU A;  2P6U A;  1TK5 A;  2C28 A;  4K4H A;  3D2N A;  2RDI A;  3I76 A;  4ED1 A;  5DLG A;  5KT3 A;  3IG5 A;  2QB1 A;  3Q8P B;  1L8O A;  1HIW A;  3TAC B;  4NL9 A;  3AL0 B;  4F5N A;  1SWW A;  8ICT A;  2FMS A;  4PHA A;  3I28 A;  2RDJ A;  4RNN A;  1KBU A;  2Z7J A;  3C21 A;  4DOA A;  5T14 A;  3DDH A;  5KNI A;  5HML A;  1PZN A;  3V7L A;  4BWM A;  2AQ0 A;  1XC9 A;  4J9P A;  5J0U A;  4PHE A;  7ICK A;  5J2E A;  3HX0 A;  5ALO A;  1JRO A;  2BQU A;  1ZQJ A;  3MR5 A;  4CCH A;  3LDA A;  8ICZ A;  2KJ8 A;  4PL2 A;  5KFV A;  5IIM A;  5J8Y C;  3CRX A;  3KBB A;  4I2H A;  2W04 A;  2WAQ F;  3WK8 A;  1COO A;  3UMB A;  2EAM A;  3TFR A;  2M0N A;  3AN1 A;  9ICC A;  3ONN A;  4QIW C;  2ODG A;  2RHF A;  5B66 U;  1KQQ A;  2F76 X;  2IOF K;  4C7Z A;  4BGD A;  5D46 A;  2NO5 A;  4QZI A;  3JPP A;  1ZQW A;  2KJ9 A;  4IC9 A;  4C8O A;  4G3I A;  1IV8 A;  4KLJ A;  1ZQA A;  2HSZ A;  1TK8 A;  1ZRN A;  4Y2P A;  1FFV A;  4I2F A;  2ALZ A;  3OSP A;  2A1A A;  1JN3 A;  4B9T A;  1RDF A;  5J2B A;  4RU9 A;  5DDY A;  1ECW A;  1X9X A;  2HBJ A;  2K8C B;  9ICQ A;  2A3V A;  3NVV A;  4ZOH C;  5KFN A;  5IIK A;  3C1Z A;  2ZTD A;  4RUA A;  5AM4 A;  5L1J A;  2ZIV A;  3ZDE A;  2LYB A;  2BPG A;  8ICN A;  2XGQ A;  2G08 A;  4Y2X A;  4F3O A;  4Y2R A;  4I2J A;  5KL1 B;  3MFI A;  2L5Y A;  3AQF A;  4DQQ A;  1RQN A;  3HKZ F;  2W3S A;  4OCZ A;  3M8S A;  3PML A;  4QZE A;  5DBA A;  2DL0 A;  2ZIU B;  1A6S A;  3LVW A;  4YR3 A;  3N7S C;  4UB6 U;  4KLH A;  4MFC A;  1RQL A;  3JPS A;  1NJY A;  2A19 A;  1BPE A;  4DL4 A;  2ZUB A;  4RQ7 A;  5ALZ A;  1JMS A;  4UB1 A;  1KN5 A;  2FLN A;  1RYS A;  5K4L A;  5KFO A;  2CRX A;  4C4R A;  2WAQ C;  3H8S A;  4OO1 J;  3LYS A;  2DPJ A;  1J2N A;  1BPY A;  4X5V A;  4MF8 A;  4AP9 A;  4BJQ A;  1K1S A;  1QQ5 A;  3SEI A;  2KZ3 A;  3THV A;  4LZD A;  4TQR A;  1F5S A;  4YMM A;  2ASD A;  3BS7 A;  2QB0 B;  2BQR A;  7ICO A;  1JI7 A;  1RM6 C;  4QWA A;  1NK8 A;  2HMX A;  1FO4 A;  9ICI A;  3ZI4 A;  4OJ6 A;  3H0R B;  3HRD D;  4PL1 A;  3AMZ A;  4KN4 A;  5GTH U;  2F1H A;  4UAU A;  4YMO A;  2BCS A;  3S6J A;  1ZQD A;  3NS1 A;  2LM4 A;  5ALI A;  4MFA A;  1FFU A;  4RNM A;  3E0F A;  3WKA A;  1ZD4 A;  2HW3 A;  3ISB A;  5HR7 A;  2MAX A;  2MUT A;  2OEH A;  5KFK A;  2E8P A;  1CUK A;  1NJW A;  4B9U A;  2QB0 A;  3RR7 A;  4JWM A;  4JWN A;  2EZX A;  3IRU A;  3Q8Q B;  3GIK A;  4NM1 A;  2MRL A;  3UQ2 A;  3OJU A;  5CHG A;  3MGH A;  2OHF A;  3NVZ A;  3RH5 A;  4FE3 A;  1ZRM A;  2K89 A;  5AKH A;  3NAS A;  2YN4 A;  1QH9 A;  3SAH A;  4NLN A;  2ZIW B;  4O3P A;  2VJ5 A;  4OJL A;  4KLE A;  4J9S A;  2UVW A;  2HBM A;  1JXE A;  3RB0 A;  2ZTC A;  5ALP A;  2LYH A;  3QX7 A;  4Y2J A;  2EQY A;  2JZB B;  5AI0 A;  2KZZ A;  5DBC A;  3F2B A;  4C4T A;  3GV5 B;  2YMM A;  4BXO A;  1ZJM A;  2H3I A;  2ESE A;  1TAM A;  2UVU A;  4XQ8 A;  9ICR A;  1NJZ A;  2J6T A;  2KFZ A;  8ICC A;  4DOC A;  2IOH A;  3EW9 A;  3KHH A;  4QWB A;  2OCE A;  2PI5 A;  2RQ5 A;  5C5J A;  3RAQ A;  4RNO A;  4DSE A;  4YP3 A;  1U4B A;  2EZZ A;  2KKP A;  1S97 A;  1NKC A;  3SEN A;  2F44 A;  4EBD A;  4IQV A;  4WJ3 B;  4K4I A;  2AH5 A;  2YTU A;  4B9V A;  3GIM A;  2ZIW A;  3QXG A;  1SZH A;  2HVI A;  1XSL A;  4O3S A;  3PV8 A;  1V9P A;  1S77 D;  2ISP A;  2F3N A;  3TAP A;  1H38 A;  4QZ8 A;  3K1R B;  3L4P A;  5AKX A;  1SV0 C;  4ZH4 A;  4GXK A;  4B6J A;  1ED1 A;  2JRZ A;  1N5W A;  3FC4 A;  4QZH A;  3RJJ A;  5J0W A;  3RJI A;  2BQ3 A;  1X2I A;  4RQM A;  5J2I A;  4ECT A;  2JEG A;  1NZP A;  4NV0 A;  2XCA A;  7ICN A;  3NRZ A;  5KFY A;  4RQN A;  4LVS A;  4QW9 A;  2Y0S F;  8ICF A;  1Q8K A;  1S0M A;  1JX4 A;  1L5U A;  4F71 A;  3MAB A;  2BHN A;  2KJ5 A;  3EPG A;  4FBU A;  3Q8R B;  1XS9 D;  1QTM A;  4NY8 A;  4DF8 A;  2JR5 A;  4GFJ A;  5ALM A;  3T5K A;  3FYH A;  5KG1 A;  2N1R A;  1F44 A;  4JV1 A;  4J9L A;  1U9L A;  4I28 A;  1TV9 A;  4ELT A;  5DQG A;  3R9K A;  1L3V A;  4I2C A;  2XI9 A;  3QUT A;  1KSP A;  1S0V A;  2W54 A;  2XVT A;  3LVV A;  1NNL A;  7ICV A;  3HJE A;  5J0Q A;  2I1Q A;  2AGP A;  4ED2 A;  5IIN A;  1IM4 A;  1UQV A;  2R8G A;  4UW9 A;  2DGZ A;  8ICS A;  4DEZ A;  2JH7 A;  4C7Y A;  5ALY A;  2KIC A;  4EZ9 A;  4TUQ A;  4ECY A;  1RXV A;  4F4W A;  2B6G A;  4IRK A;  3ED5 A;  1ZQO A;  1N63 A;  4RPX A;  3K75 D;  5J0R A;  1ZQM A;  4NXZ A;  5J29 A;  1XSP A;  4P0P A;  2ZG6 A;  5DG9 A;  1TVA A;  1NI3 A;  3H8J A;  4RT2 A;  2QLT A;  4B9L A;  8ICK A;  4ED8 A;  4ELU A;  2V9W A;  2F1I A;  1U47 A;  3ETR A;  3RJF A;  3ZD9 A;  4RUC A;  5AK5 A;  3HT3 A;  3DV9 A;  4O5E A;  5FP0 A;  1S9F A;  5DGB A;  2D3D A;  2JV3 A;  2C2E A;  1X9W A;  2G07 A;  3GZF A;  4F5R A;  5ALR A;  5J2H A;  3LK9 A;  2WB1 F;  4F5O A;  4KLQ A;  2D8C A;  2BPF A;  2PI4 A;  4ED6 A;  5KL8 B;  3J81 j;  2P35 A;  4P0Q B;  5EWE A;  4DSJ A;  2G5I B;  3TAN A;  4UB3 A;  3QUB A;  1RZT A;  1Q46 A;  3KKA C;  4Q8E A;  2E8O A;  3MDC A;  4CF3 A;  2H3V A;  3FM9 A;  5ALJ A;  2BR0 A;  4Y2T A;  4ECZ A;  4DSF A;  3TAR A;  3RH4 A;  4TUP A;  2Q0Z X;  2HHS A;  5KG7 A;  1WUD A;  4UAT A;  3V6H A;  4TUR A;  3KOO A;  2R8K A;  4F91 B;  5AKE A;  2KV2 A;  1Z3E B;  3RFA A;  2AU0 A;  1HJP A;  1Z00 B;  2W3R A;  4EEN A;  2OH2 A;  4I2G A;  2HHT A;  4Z6E A;  2JXJ A;  5ALH A;  2FPK A;  4KMO B;  4I2D A;  3UPQ A;  3H0M B;  4ED0 A;  3T5H A;  1DXS A;  3FAH A;  4I2I A;  3H8M A;  2EDU A;  1S10 A;  2KTQ A;  2BCR A;  4DL2 A;  2PXI A;  8ICU A;  5EWG A;  2ISO A;  4P4O A;  4DQR A;  2G5H B;  3HKZ C;  5KT4 A;  4Y2V A;  4ECW A;  4HAI A;  3QNM A;  4TQS A;  2KZM A;  8ICO A;  1X6J A;  5EE0 A;  5KT2 A;  2ZJ8 A;  3PNC A;  3RB6 A;  5F3X B;  5KFI A;  4PH5 A;  3TQ1 A;  4P4M A;  1A77 A;  2Y1J A;  3C28 A;  5KFW A;  1PVP A;  3BS5 A;  1SKR A;  5CB1 A;  3K1Z A;  4KTQ A;  1XSN A;  1TKD A;  2XGP A;  3B9J A;  4KLT A;  2IHM A;  5IIL A;  3MR3 A;  1SGG A;  2MSN A;  2ZJ5 A;  2K4P A;  4O3O A;  4QJF B;  4DL7 A;  2O6K A;  3GV8 B;  5DG7 A;  3RJE A;  1K1Q A;  4Y2U A;  3N4M B;  2EZY A;  3KTQ A;  4RQ1 A;  5TIS U;  4KLG A;  3JPQ A;  3H4D A;  3AUO A;  2ZUD A;  4F93 B;  1HUO A;  2ZIV B;  4JV0 A;  5AK4 A;  2YY6 A;  5TZV A;  4OJ5 A;  4UAS A;  2HBK A;  4M6W B;  1CI4 A;  4XUS A;  4EX7 A;  3PST A;  2VA2 A;  1D8B A;  3OPX A;  3PW7 A;  4KMU A;  2HI0 A;  2WB1 C;  1NKE A;  3BQ1 A;  3G6Y A;  5A0L A;  3SV3 A;  2JGA A;  9ICV A;  5AK3 A;  3RRH A;  2AQ4 A;  4RT3 A;  4Z6F A;  1WG8 A;  4IR1 A;  4J9K A;  2HOI A;  4RQ4 A;  4M0A A;  4MEX A;  5AKY A;  2HOF A;  3M7D A;  1ZQP A;  4F92 B;  3QEA Z;  1ZQG A;  3IHQ B;  3SQI A;  1RXW A;  3F2D A;  3VCB A;  2G0A A;  4GXI A;  5AKI A;  4BWJ A;  5AIA A;  3I1Y A;  4FZL A;  4CF5 A;  1Q3U A;  5ALD A;  2E5S A;  5KFM A;  4BDP A;  5H2F U;  3EZ5 A;  2D6F C;  5III A;  3K4G A;  5KG2 A;  1UA0 A;  2V4R A;  4M6W A;  2RLT A;  5CRX A;  2W9A A;  1ZD5 A;  3QEB Z;  1DOQ A;  1T94 A;  1ZQQ A;  3QU7 A;  5DB6 A;  2LHT A;  1L7M A;  4F4Z A;  2KE7 A;  8ICW A;  9ICJ A;  3RF9 A;  1WYG A;  3H40 A;  2UVV A;  3CW2 C;  5AIB A;  2M9N A;  5KFS A;  4RQ3 A;  5DB7 A;  4DFP A;  3ZDA A;  5BOL A;  4R64 A;  2RRD A;  3F5E A;  4YG2 A;  1SZP A;  9ICL A;  3RAX A;  2W9C A;  5J0O A;  5L1M A;  1J2M A;  2F8L A;  5DKW A;  2F2A B;  2YML A;  3A0H U;  5J0T A;  1X6I A;  4YVZ A;  5CR0 A;  2JEI A;  2YB4 A;  1ZD3 A;  1DK2 A;  4CF4 A;  1BPB A;  1UPH A;  4DOB A;  3TFS A;  3OSN A;  2H3Q A;  8ICB A;  5BOM A;  2LM1 A;  5J0S A;  3C2L A;  2JZB A;  2XCP A;  4C8N A;  1EXN A;  2LYA A;  1SIJ A;  2HHU A;  4KX3 A;  1DGJ A;  4R8U A;  2RP5 A;  3F2C A;  2YMP A;  5KFD A;  3PSP A;  4F4Y A;  2XIC A;  1MN8 A;  2B21 A;  2W9C B;  3C2K A;  4DSL A;  1V97 A;  2KNJ A;  4FO6 A;  1KKX A;  2CXY A;  1Z1B A;  3AM9 A;  1A76 A;  4M2Y A;  4MEY A;  3PY8 A;  3SYZ A;  3PVX A;  9ICU A;  1ZQN A;  3Q8S B;  1MC8 A;  4F5Q A;  2ES6 A;  1TFR A;  1PK3 A;  3C1Y A;  1N5X A;  4ECR A;  2Y9U A;  4EEY A;  4EEK A;  3WK5 A;  9ICH A;  5AI8 A;  2K8A A;  1ZQE A;  5KFJ A;  2WF7 A;  1DK3 A;  9ICK A;  2W9B A;  8ICP A;  4M9J A;  4QZB A;  4DQS A;  4YCX A;  3ZDC A;  3IP4 B;  3Q8L A;  2NRZ A;  3QUC A;  2NYV A;  5KT6 A;  5CA7 A;  7ICU A;  3QUQ A;  3BQT A;  2KK0 A;  3RTV A;  2R8J A;  2F77 X;  2NRX A;  3B0X A;  1D8L A;  4YD1 A;  3D2Q A;  1SXE A;  1MQ3 A;  4J03 A;  3N7P D;  2I6X A;  2PFP A;  4Q8F A;  2DF4 B;  4P0Q A;  4DL5 A;  2DKZ A;  2FJ6 A;  5KT7 A;  4CNQ A;  3AEV A;  1O03 A;  1ZQY A;  4F2S A;  2R8H A;  3TKA A;  2K8B B;  2EAP A;  5DB8 A;  4O3R A;  2FMP A;  3SD7 A;  4Y2Y A;  2G09 A;  1GO3 F;  4Z6D A;  3BQ0 A;  3QU9 A;  1IXR A;  4NLZ A;  2QKQ A;  5DLF A;  4NLB A;  4JK1 A;  2GH1 A;  4A8E A;  3CP8 A;  2ZIU A;  4KLL A;  5ALQ A;  4C8L A;  7ICE A;  2AGQ A;  5KFZ A;  2ZTE A;  1BNO A;  4ECX A;  4NJ8 A;  4O3M A;  4US9 A;  1UCV A;  2IMW P;  1COK A;  2DBY A;  3BS5 B;  4OD0 A;  2KEY A;  5HHI A;  2C22 A;  3M1Y A;  3N97 B;  3V72 A;  1ZQT A;  4EZ6 A;  1ZQU A;  4O3Q A;  3KKA A;  4KLD A;  4FS1 A;  4J9Q A;  4US8 A;  3EUB 2;  5DQI A;  4B9S A;  2W43 A;  2JH1 A;  3M9O B;  5D49 A;  4O5C A;  2WTF A;  5KFF A;  1BPD A;  3UMC A;  1UHU A;  4Y2S A;  3GV7 B;  3KZI U;  5ALE A;  3WKD A;  2NO4 A;  2BGW A;  2KFN A;  2XID A;  3ISC A;  2CPR A;  1T4G A;  2DUY A;  5EE9 A;  2I5H A;  5JUM A;  4YR2 A;  5KT5 A;  2OYY A;  5J8Y A;  2R8I A;  3NRW A;  5ALX A;  1ZXI A;  1Z00 A;  5BPC A;  8ICV A;  5L1K A;  5AKZ A;  5L9X A;  5KAI U;  9ICO A;  1L6N A;  1WWV A;  3PSF A;  4M9L A;  4ECQ A;  5AKK A;  7ICH A;  3MGV A;  5KFT A;  2XC9 A;  2AGO A;  2E3T A;  1RYU A;  3OTQ A;  4PPX A;  2YB1 A;  1QLN A;  1J97 A;  2WFA A;  1Z4O A;  1QSS A;  5J2F A;  3RJH A;  3M6Z A;  5L1I A;  2ASJ A;  2KN7 A;  9ICS A;  1T7P A;  3ISD A;  1ZQL A;  1F0M A;  5DB9 A;  2ASL A;  1X66 A;  3MBY A;  4R66 A;  4DSI A;  1A0P A;  2W11 A;  5C0Y A;  3NVY A;  3HPO A;  4RPY A;  1JXL A;  1ZOL A;  2XY6 A;  3PZP A;  5AI5 A;  1TAU A;  4YFK A;  2AJQ A;  4I29 A;  4O5K A;  4PHD A;  3T5L A;  5EOZ A;  3ZD8 A;  3RJG A;  1L3U A;  4UAY A;  4BUG A;  2W7O A;  2FDR A;  1MSW D;  2FPL A;  1WCN A;  1JAL A;  1XU4 A;  1DGS A;  4U7C A;  5F9L A;  5KG6 A;  4KLS A;  2KP7 A;  4B9M A;  3KZX A;  9ICN A;  4F2R A;  5EE3 A;  4DWI A;  1SL2 A;  3BQ2 A;  5DG8 A;  3M6K A;  1NK7 A;  1NJX A;  5HNK A;  4DQI A;  1PUZ A;  5AI6 A;  1PK1 B;  8ICM A;  2NRW A;  2JHD A;  4OJO A;  4P2H A;  2C2D A;  1N62 A;  2DPI A;  1CEZ A;  5JTI A;  3MGI A;  1XO0 A;  1KL9 A;  2ZIX B;  2ZJA A;  1ZQR A;  1AQ6 A;  2K4H A;  1DRG A;  7ICM A;  4G9B A;  2XY7 A;  7ICF A;  3KHG A;  3D2S A;  3PR4 A;  3D6J A;  3TAQ A;  2A1J A;  2FE9 A;  3AU6 A;  2JEF A;  1LKY A;  8ICI A;  3N7R C;  3NVW A;  2PFO A;  3WK9 A;  1N60 A;  2AHO B;  5KG3 A;  5DBB A;  3M9N B;  3IN5 A;  9ICX A;  3UQ0 A;  4EYH B;  2KVC A;  1Z1V A;  4NL9 C;  2NRT A;  4Z6C A;  5J0X A;  2BCV A;  2EAN A;  1RPL A;  5AM0 A;  4IRC A;  5AM2 A;  1URJ A;  1NK9 A;  5HHH A;  2BKE A;  5G5G A;  1M6Y A;  3QE9 Y;  4C4S A;  5DDM A;  2HHQ A;  2G06 A;  1NKB A;  4EBC A;  5ALU A;  4GIB A;  4GLX A;  1KFS A;  3WKB A;  3LWL A;  2EAO A;  1NK4 A;  4JV2 A;  2BDU A;  4RQ5 A;  5CWR A;  3QYP A;  2QAR B;  5KFL A;  3SZ2 A;  1RYR A;  2KHV A;  5AK6 A;  3BZK A;  1X40 A;  4F5P A;  3VC8 A;  1D9F A;  1XWL A;  1ZET A;  4O0I A;  1TK0 A;  5KFQ A;  2PKE A;  4UBB A;  1ZQX A;  4RQ0 A;  1SL0 A;  2E1F A;  3GU3 A;  4GC6 A;  1UT8 A;  2AXT U;  3ZDD A;  2UVR A;  3Q8M A;  5JU5 A;  5J0P A;  2W9M A;  1BPZ A;  3RB3 A;  3L3F X;  4UB5 A;  5KFR A;  4BXO B;  2DFL A;  2LI6 A;  4J9N A;  3EYZ A;  8ICQ A;  3BZC A;  4IRD A;  4EEL A;  2W8L A;  3H7I A;  2GLE A;  5IIJ A;  2WF6 A;  4R8U B;  3PO4 A;  4DFM A;  2WF8 A;  2K4I A;  7ICP A;  1S0N A;  2BCQ A;  3UXO A;  1T8E A;  1BNP A;  3TAD C;  1VDV A;  4RPZ A;  4PZN A;  3HW8 A;  4ELV A;  4QZA A;  5ALK A;  2ZIX A;  2IA6 A;  3V6J A;  3IDW A;  4BX9 C;  4ACO A;  7ICG A;  2YQE A;  5DQH A;  1KLN A;  2NRV A;  1KFD A;  5G5H A;  5J2K A;  5AM1 A;  2W03 A;  3GDX A;  1L7P A;  3GII A;  5ALS A;  4MFF A;  1QQ7 A;  1B43 A;  1X42 A;  2DKX A;  5KG5 A;  3H4B A;  3RB4 A;  1QQ6 A;  4GC7 A;  1N61 A;  4IL6 U;  2KKV A;  3ICX A;  3C29 A;  3G6V A;  5AKG A;  5KTQ A;  4RQ6 A;  3NTU A;  3OHA A;  2H3F A;  4IR9 A;  2KIW A;  4J9O A;  2C2R A;  1FEZ A;  4F72 A;  1NOM A;  3ALR A;  4JB3 A;  2VA3 A;  1L3T A;  2W55 A;  2E8N A;  4YN4 A;  1IIP A;  5ALN A;  4EBE A;  4C8K A;  5KFX A;  5HR6 A;  1L3S A;  3QU2 A;  2R18 A;  2P6R A;  4UAV A;  5EWF A;  3AQE A;  5ALF A;  9ICG A;  4CGZ A;  4F50 A;  5HP4 A;  4I2B A;  3PX4 A;  4RQ2 A;  4RQ8 A;  3SI8 A;  4QZG A;  5KAF U;  2KHQ A;  3IV6 A;  5AM3 A;  2PFQ A;  2LKY A;  1KW4 A;  4B9N A;  2OXO A;  3WKC A;  3JPR A;  3SMV A;  3C5F A;  4U6P A;  2Q4T A;  3WK7 A;  1HUZ A;  5J2D A;  9ICA A;  2MA1 A;  3PO5 A;  2I9G A;  3GFK B;  4KLU A;  2LMR A;  4IS7 A;  4AYB C;  4KLI A;  1OXJ A;  1T3Q A;  1LV5 A;  2B0C A;  3QU4 A;  3PMN A;  5AIC A;  9ICT A;  1BGX T;  2HHV A;  3ORY A;  2GWS A;  1K5O A;  3MFH A;  2FI1 A;  1ZQV A;  3IM1 A;  5AKL A;  1SB3 C;  4UB4 A;  1HEK A;  4QZC A;  1CRX A;  1S8O A;  3KHR A;  4C0Z A;  1KFT A;  1B22 A;  4FBT A;  3B0Y A;  3QZ8 A;  3Q8K A;  4QW8 A;  1JRP A;  1QSL A;  3H0L B;  4NLC A;  2J6S A;  4ED3 A;  1SWV A;  3TAD A;  2GO7 A;  1QCK A;  4PGQ A;  4QZ9 A;  1ZYQ A;  1V38 A;  4Y2Q A;  2J6U A;  4DLE A;  3JPN A;  1VJ5 A;  3KHL A;  4R65 A;  2W9B B;  1ZQ1 C;  4IQU A;  4P4P A;  1SKW A;  4NLG A;  1B0X A;  1RG6 A;  4J9M A;  1Z4N A;  4QWD A;  7ICJ A;  1IG6 A;  1LKY B;  3KD3 A;  3RR8 A;  4DSK A;  3PX0 A;  2XO7 A;  2WHE A;  2BCU A;  1ARO P;  1C7Y A;  5ALL A;  4K4G A;  5DGA A;  4OJP A;  1V85 A;  1UA1 A;  1FIQ A;  3C2M A;  4PZO A;  2VKQ A;  4KX5 A;  5J2A A;  1WCL A;  3NGD A;  3E58 A;  5KFC A;  4UB2 A;  4HYK A;  3QU5 A;  2BPC A;  1S5L U;  1D9D A;  1XNS A;  3PW2 A;  1NK5 A;  4M9H A;  5CJ7 A;  1MQ2 A;  1SXD A;  3T79 A;  2KD1 A;  4DL6 A;  3ZDB A;  9ICE A;  4UQG A;  5IIO A;  1O08 A;  4E0D A;  4O3N A;  5KFP A;  2YMQ A;  4KLO A;  1TAQ A;  2A1J B;  1D8Y A;  4UAZ A;  3T3F A;  3A0B U;  2FLP A;  5KFG A;  4KLF A;  3SR6 A;  3QZ7 A;  2DQN B;  2ZXI A;  1NK6 A;  1L8L A;  4UB8 U;  2MU2 A;  1C20 A;  1ZQS A;  1JUD A;  2HHW A;  3RH6 A;  2BZF A;  1ZQI A;  5AI9 A;  5J2C A;  7ICL A;  4UAR A;  1T3N A;  4Q45 A;  3OJS A;  2IHN A;  2WF5 A;  5HMM A;  4I27 A;  1YZ7 A;  1MA7 A;  5KFA A;  4YQW A;  4M47 A;  4C8M A;  1U49 A;  4M9G A;  1NZB A;  4XRH A;  1ZD2 P;  4QIW F;  1YZ6 A;  4PJ0 U;  4DFD A;  4F4X A;  3C5G A;  4I2A A;  4EYI B;  1ZQZ A;  1YT3 A;  3MR6 A;  3HWT A;  1ZJN A;  1Y88 A;  1S0O A;  5J0Y A;  1PK1 A;  2IBK A;  2F8K A;  1PVR A;  2ATL A;  3AU2 A;  3CYM A;  3PW0 A;  3V6K A;  3BQ7 A;  1TE2 A;  4IQW A;  2WF9 A;  2ZXH A;  4QWC A;  3OHB A;  2EH9 A;  3PW4 A;  4CDG A;  4DCC A;  4JMU A;  2W8K A;  3RRG A;  4MHV A;  8ICY A;  8ICG A;  1SV4 A;  3UXP A;  4NLK A;  2FPM A;  2P66 A;  2V4Q A;  3V7K A;  8ICL A;  3C23 A;  3IG8 A;  4DO9 A;  4FFD A;  5ALV A;  2VJ4 A;  4F4K A;  5AI4 A;  7ICQ A;  5CEH A;  1KDH A;  7ICI A;  2HOQ A;  2LBO A;  5JRT A;  3FDS A;  2DWQ A;  4KIT B;  3KFU F;  1WWU A;  2K60 A;  1BPX A;  4RZR A;  2W7P A;  4C80 A;  8ICR A;  1PVQ A;  3L5K A;  3RBE A;  4DS4 A;  3UMG A;  2FMQ A;  4F8R A;  2FLL A;  4KN7 A;  4CRX A;  1OUQ A;  2OWO A;  5AHX A;  9ICP A;  5E79 U;  4Q44 A;  1Q3V A;  9ICB A;  5ALW A;  3JPO A;  2CN1 A;  2PFN A;  4PHP A;  1N56 A;  3ETL A;  5F9N A;  3MR2 A;  4DL3 A;  5CP2 A;  2KG5 A;  5EE1 A;  8ICH A;  5KFE A;  3GQC A;  2Y1I A;  2QAR A;  1KEJ A;  2KMD A;  3M9M B;  4FZN A;  4YXM A;  5ALT A;  4ECS A;  4FS2 A;  1OW5 A;  3N28 A;  4PGY A;  4DLG A;  3BDP A;  3SAF A;  4DFK A;  4QWE A;  1VLB A;  2PMZ C;  8ICE A;  3G6X A;  3F53 A;  5ALG A;  2HVH A;  2XY5 A;  4YXJ A;  2HDO A;  4YR0 A;  5AKJ A;  3V7J A;  3EPI A;  1X9S A;  1B4F A;  4AYB F;  5KG0 A;  4YD2 A;  3PR5 B;  4NWI A;  2F1J A;  5KG4 A;  2GOL A;  3WK6 A;  4M04 A;  2NV3 A;  3F5A A;  9ICW A;  4UBC A;  3WU2 U;  3PX6 A;  4MF2 A;  2ZUC A;  4QZF A;  3HP6 A;  4KLM A;  2MUT B;  2HBL A;  3NUQ A;  1ZQK A;  4TUS A;  2KSO B;  2KOB A;  5GTI U;  4UAW A;  4XA5 A;  4O9M A;  1N48 A;  2K4E A;  1KTQ A;  5J2G A;  4DF4 A;  2OM6 A;  1SV0 A;  3MC1 A;  2Y9T A;  4IQT A;  1UT5 A;  3TI0 A;  4Q43 A;  1XO1 A;  4QZD A;  3HIL A;  3JPT A;  5D4B A;  1Z19 A;  2KSO A;  2Y0S C;  3BJY A;  1KRP A;  3UXN A;  7ICS A;  1ZQB A;  4USA A;  3GIL A;  5B5E U;  3PW5 A;  1LVH A;  2IOF A;  1ZQF A;  4LJX A;  1BVS A;  2E1E A;  4QNL A;  9ICM A;  3GIJ A;  4ECV A;  3OGU A;  4M9N A;  4FZM A;  8ICA A;  8ICJ A;  5KFU A;  4DFJ A;  3WK4 A;  1N2X A;  4ED7 A;  3LWM A;  2JMG A; 
#chains in the Genus database with same CATH homology
 4NM2 A;  1TFR A;  2BDP A;  4J9O A;  2C2R A;  2JEG A;  1NOM A;  3C1Y A;  2XCA A;  3RJK A;  4ECR A;  4EEY A;  1U45 A;  2VA3 A;  8ICX A;  1L3T A;  9ICH A;  1NK0 A;  4YN4 A;  3SV4 A;  7ICN A;  4EBE A;  5KFJ A;  1ZQE A;  9ICK A;  4GXJ A;  2W9B A;  8ICP A;  4C8K A;  5KFY A;  5KFX A;  4J9R A;  1L3S A;  4M9J A;  4QZB A;  4QW9 A;  4LVS A;  8ICF A;  4DQS A;  1LB2 B;  1S0M A;  3MDA A;  4YCX A;  2P6R A;  1JX4 A;  5EWF A;  3ZDC A;  5KFB A;  3Q8L A;  2NRZ A;  3M8R A;  1L5U A;  1ZQC A;  5KT6 A;  3MAB A;  5CA7 A;  4LZG A;  7ICU A;  1U48 A;  3BQT A;  9ICG A;  4YMN A;  2BHN A;  3RTV A;  2R8J A;  3EPG A;  4FBU A;  3Q8R B;  1XS9 D;  4F50 A;  2NRX A;  1X9M A;  5HP4 A;  1QTM A;  3B0X A;  4NY8 A;  4DF8 A;  7ICR A;  1D8L A;  4I2B A;  4YD1 A;  4DS5 A;  3T5K A;  3E2E A;  9ICF A;  3FYH A;  5KG1 A;  2HHX A;  7ICT A;  4JV1 A;  3PX4 A;  1MQ3 A;  4J9L A;  4RQ2 A;  4RQ8 A;  1U9L A;  2PFP A;  3SI8 A;  4QZG A;  4I2E A;  1SL1 A;  5L1L A;  4I28 A;  1TV9 A;  4ELT A;  5J2J A;  4Q8F A;  4DL5 A;  5DQG A;  2PFQ A;  1JIH A;  5KT7 A;  2H5X A;  1S76 D;  1L3V A;  4B9N A;  2VA8 A;  4I2C A;  1ZQY A;  4F2S A;  1KSP A;  2R8H A;  3JPR A;  1SKS A;  1S0V A;  3C5F A;  4JUZ A;  1HUZ A;  5J2D A;  1ZQH A;  7ICV A;  3H8W A;  9ICA A;  2VAN A;  5J0Q A;  2I1Q A;  5DB8 A;  2AGP A;  4ED2 A;  2FMP A;  3PO5 A;  4O3R A;  3EWA A;  3T5J A;  2I9G A;  5IIN A;  1IM4 A;  3GFK B;  4Z6D A;  4KLU A;  4PGX A;  3BQ0 A;  3RBD A;  1QSY A;  2JEJ A;  4DQP A;  1IXR A;  4KLI A;  2R8G A;  4NLZ A;  5KFH A;  4R63 A;  4ECU A;  5DLF A;  1LV5 A;  4JK1 A;  2P6U A;  3PMN A;  1TK5 A;  2C28 A;  4K4H A;  9ICT A;  8ICS A;  1BGX T;  2RDI A;  4ED1 A;  5DLG A;  5KT3 A;  2HHV A;  3ORY A;  4DEZ A;  2GWS A;  4KLL A;  3Q8P B;  4C8L A;  3MFH A;  7ICE A;  4EZ9 A;  2AGQ A;  1ZQV A;  2ZTE A;  5KFZ A;  3IM1 A;  4TUQ A;  4ECX A;  4ECY A;  1RXV A;  4UB4 A;  4F5N A;  4F4W A;  4QZC A;  8ICT A;  2FMS A;  4PHA A;  4IRK A;  1ZQO A;  2IMW P;  4RPX A;  3KHR A;  2RDJ A;  1KFT A;  1B22 A;  3K75 D;  5HHI A;  3B0Y A;  5J0R A;  4RNN A;  2C22 A;  1ZQM A;  4FBT A;  3QZ8 A;  3C21 A;  4NXZ A;  5J29 A;  3V72 A;  4DOA A;  4QW8 A;  3N97 B;  3Q8K A;  1XSP A;  1ZQT A;  4EZ6 A;  1QSL A;  1ZQU A;  2J6S A;  4ED3 A;  4O3Q A;  5HML A;  5DG9 A;  1PZN A;  1TVA A;  4KLD A;  3V7L A;  3H8J A;  4BWM A;  4RT2 A;  2AQ0 A;  4FS1 A;  4B9L A;  8ICK A;  4J9Q A;  4ED8 A;  4PGQ A;  4QZ9 A;  1XC9 A;  2V9W A;  4ELU A;  1ZYQ A;  4J9P A;  5J0U A;  2J6U A;  2F1I A;  5DQI A;  4DLE A;  4B9S A;  4PHE A;  7ICK A;  1U47 A;  5J2E A;  3JPN A;  3HX0 A;  3ZD9 A;  4RUC A;  3KHL A;  2BQU A;  1ZQJ A;  3MR5 A;  3RJF A;  4R65 A;  2W9B B;  4CCH A;  3LDA A;  3HT3 A;  4IQU A;  4P4P A;  3M9O B;  4O5E A;  8ICZ A;  1S9F A;  1SKW A;  5D49 A;  4NLG A;  4O5C A;  2WTF A;  5KFF A;  5KFV A;  5DGB A;  1BPD A;  5IIM A;  2C2E A;  1X9W A;  4I2H A;  4J9M A;  4QWD A;  7ICJ A;  3RR8 A;  1COO A;  3GV7 B;  4F5R A;  5J2H A;  3TFR A;  3LK9 A;  4DSK A;  2BGW A;  4F5O A;  2KFN A;  3PX0 A;  2XO7 A;  4KLQ A;  3ISC A;  2BCU A;  1ARO P;  1T4G A;  9ICC A;  1C7Y A;  2BPF A;  5JUM A;  2PI4 A;  4ED6 A;  4YR2 A;  5KT5 A;  4K4G A;  5DGA A;  2R8I A;  5EWE A;  1UA1 A;  4DSJ A;  1Z00 A;  3TAN A;  5BPC A;  4BGD A;  5D46 A;  8ICV A;  4QZI A;  5L1K A;  4UB3 A;  3C2M A;  1RZT A;  5L9X A;  9ICO A;  4Q8E A;  3JPP A;  4M9L A;  1ZQW A;  3MDC A;  5J2A A;  1WCL A;  3NGD A;  4C8O A;  4ECQ A;  4G3I A;  5KFC A;  4KLJ A;  2BR0 A;  7ICH A;  4UB2 A;  4HYK A;  1ZQA A;  2BPC A;  1TK8 A;  5KFT A;  2XC9 A;  4ECZ A;  2AGO A;  4DSF A;  1D9D A;  4I2F A;  2ALZ A;  3OSP A;  3PW2 A;  3TAR A;  1NK5 A;  1JN3 A;  4PPX A;  4B9T A;  3RH4 A;  4TUP A;  4M9H A;  1QLN A;  2Q0Z X;  2HHS A;  5KG7 A;  5CJ7 A;  5J2B A;  1QSS A;  5J2F A;  1MQ2 A;  3V6H A;  3RJH A;  4TUR A;  4RU9 A;  5DDY A;  4DL6 A;  2R8K A;  4F91 B;  5L1I A;  2ASJ A;  3ZDB A;  1Z3E B;  9ICE A;  2KN7 A;  2AU0 A;  1T7P A;  9ICS A;  3ISD A;  1HJP A;  1Z00 B;  9ICQ A;  4UQG A;  5IIO A;  1ZQL A;  5DB9 A;  4E0D A;  5KFN A;  2ASL A;  5IIK A;  3MBY A;  4O3N A;  5KFP A;  4R66 A;  4I2G A;  3C1Z A;  2HHT A;  2ZTD A;  4Z6E A;  4DSI A;  4RUA A;  4KLO A;  3HPO A;  1TAQ A;  4RPY A;  5L1J A;  2A1J B;  1JXL A;  3ZDE A;  1D8Y A;  4UAZ A;  3T3F A;  2XY6 A;  2FPK A;  2BPG A;  2FLP A;  5KFG A;  4I2D A;  2XGQ A;  3UPQ A;  4KLF A;  1TAU A;  4YFK A;  3QZ7 A;  8ICN A;  4ED0 A;  3T5H A;  4F3O A;  2AJQ A;  4I2I A;  4I29 A;  4O5K A;  4I2J A;  1S10 A;  1NK6 A;  4PHD A;  2KTQ A;  2BCR A;  4DL2 A;  2PXI A;  8ICU A;  3MFI A;  3T5L A;  5EWG A;  1ZQS A;  5EOZ A;  3ZD8 A;  2ISO A;  4DQQ A;  3RH6 A;  1L3U A;  3RJG A;  1ZQI A;  2HHW A;  4P4O A;  5J2C A;  7ICL A;  1T3N A;  4UAY A;  4Q45 A;  4DQR A;  3OJS A;  2IHN A;  5HMM A;  4I27 A;  5KT4 A;  3M8S A;  4ECW A;  1MSW D;  3PML A;  5KFA A;  2FPL A;  4YQW A;  5DBA A;  4QZE A;  4M47 A;  4TQS A;  4C8M A;  2KZM A;  1WCN A;  8ICO A;  1U49 A;  4YR3 A;  1XU4 A;  4M9G A;  1DGS A;  5KT2 A;  4XRH A;  4KLH A;  2ZJ8 A;  5F9L A;  5KG6 A;  4KLS A;  4F4X A;  4MFC A;  3PNC A;  4B9M A;  3RB6 A;  3JPS A;  1NJY A;  5KFI A;  1BPE A;  4PH5 A;  4DL4 A;  2ZUB A;  3C5G A;  3TQ1 A;  4P4M A;  9ICN A;  4I2A A;  4F2R A;  4EYI B;  4RQ7 A;  1ZQZ A;  1A77 A;  1JMS A;  3MR6 A;  4DWI A;  4UB1 A;  2Y1J A;  3HWT A;  5KFW A;  2FLN A;  1RYS A;  5KFO A;  1SKR A;  5CB1 A;  4KTQ A;  1XSN A;  3H8S A;  1TKD A;  1ZJN A;  1Y88 A;  3BQ2 A;  5DG8 A;  5J0Y A;  1NK7 A;  1S0O A;  2XGP A;  1SL2 A;  2IBK A;  2DPJ A;  1NJX A;  5HNK A;  4DQI A;  4KLT A;  2IHM A;  2ATL A;  1BPY A;  4X5V A;  5IIL A;  8ICM A;  2NRW A;  3MR3 A;  3AU2 A;  3PW0 A;  2ZJ5 A;  3V6K A;  4MF8 A;  4O3O A;  4IQW A;  4P2H A;  4DL7 A;  2C2D A;  4QWC A;  3OHB A;  2DPI A;  3GV8 B;  5DG7 A;  1K1S A;  3MGI A;  3PW4 A;  3RJE A;  1CEZ A;  1K1Q A;  2KZ3 A;  3N4M B;  2W8K A;  2ZJA A;  3RRG A;  8ICY A;  1ZQR A;  8ICG A;  3KTQ A;  3UXP A;  3THV A;  4NLK A;  4LZD A;  7ICM A;  4RQ1 A;  4TQR A;  2XY7 A;  7ICF A;  4KLG A;  3JPQ A;  2FPM A;  3H4D A;  4YMM A;  3KHG A;  2ASD A;  3AUO A;  2BQR A;  2ZUD A;  7ICO A;  3PR4 A;  2P66 A;  4F93 B;  3TAQ A;  2V4Q A;  3V7K A;  1HUO A;  4QWA A;  1NK8 A;  8ICL A;  3C23 A;  2A1J A;  4DO9 A;  3AU6 A;  9ICI A;  4JV0 A;  4F4K A;  2JEF A;  7ICQ A;  1KDH A;  8ICI A;  7ICI A;  3FDS A;  4KN4 A;  5TZV A;  2F1H A;  4YMO A;  2BCS A;  4KIT B;  2PFO A;  1ZQD A;  4M6W B;  5KG3 A;  5DBB A;  3M9N B;  1BPX A;  4XUS A;  9ICX A;  4RZR A;  3UQ0 A;  4EYH B;  2VA2 A;  3PW7 A;  4KMU A;  8ICR A;  1NKE A;  4MFA A;  3BQ1 A;  4RNM A;  3G6Y A;  3RBE A;  2NRT A;  3SV3 A;  4DS4 A;  4Z6C A;  2FMQ A;  2HW3 A;  9ICV A;  5J0X A;  3ISB A;  2BCV A;  4F8R A;  1RPL A;  2FLL A;  3RRH A;  2MAX A;  2AQ4 A;  4IRC A;  4KN7 A;  4RT3 A;  2MUT A;  4Z6F A;  2OWO A;  1NK9 A;  5HHH A;  5KFK A;  2BKE A;  4IR1 A;  4J9K A;  3QE9 Y;  9ICP A;  1CUK A;  4RQ4 A;  1NJW A;  5DDM A;  4Q44 A;  4B9U A;  4M0A A;  2HHQ A;  3RR7 A;  1NKB A;  4JWM A;  4JWN A;  4MEX A;  4EBC A;  9ICB A;  3JPO A;  4GLX A;  1KFS A;  2PFN A;  4PHP A;  1ZQP A;  4F92 B;  3Q8Q B;  3LWL A;  3GIK A;  3QEA Z;  1N56 A;  3ETL A;  4NM1 A;  3UQ2 A;  3IHQ B;  3OJU A;  5F9N A;  1NK4 A;  1RXW A;  1ZQG A;  3MR2 A;  4DL3 A;  5CP2 A;  5CHG A;  4JV2 A;  3MGH A;  4RQ5 A;  5CWR A;  8ICH A;  5KFL A;  4GXI A;  3SZ2 A;  3RH5 A;  1RYR A;  5KFE A;  4BWJ A;  3GQC A;  2Y1I A;  1KEJ A;  3M9M B;  4YXM A;  4F5P A;  4ECS A;  4FS2 A;  3BDP A;  4DLG A;  4PGY A;  1XWL A;  1D9F A;  1ZET A;  4O0I A;  4DFK A;  1TK0 A;  4NLN A;  4QWE A;  5KFQ A;  5KFM A;  4UBB A;  4BDP A;  4O3P A;  1ZQX A;  4RQ0 A;  3EZ5 A;  8ICE A;  1SL0 A;  3G6X A;  4KLE A;  5III A;  3K4G A;  5KG2 A;  2HVH A;  4GC6 A;  2XY5 A;  2V4R A;  4J9S A;  4M6W A;  1UA0 A;  2UVW A;  2ZTC A;  1JXE A;  4YXJ A;  2W9A A;  3QEB Z;  3RB0 A;  1UT8 A;  1DOQ A;  4YR0 A;  1ZQQ A;  2LYH A;  5DB6 A;  3V7J A;  3EPI A;  4F4Z A;  8ICW A;  9ICJ A;  2JZB B;  3ZDD A;  3H40 A;  1X9S A;  2UVV A;  2UVR A;  3Q8M A;  2KZZ A;  5J0P A;  2W9M A;  5DBC A;  2M9N A;  5KFS A;  5KG0 A;  1BPZ A;  4YD2 A;  3GV5 B;  4RQ3 A;  3PR5 B;  4BXO A;  3RB3 A;  4UB5 A;  1ZJM A;  5DB7 A;  4DFP A;  3ZDA A;  2F1J A;  5KG4 A;  2UVU A;  5BOL A;  5KFR A;  4M04 A;  4BXO B;  4XQ8 A;  2DFL A;  9ICR A;  4R64 A;  4J9N A;  1NJZ A;  2J6T A;  4YG2 A;  3EYZ A;  1SZP A;  9ICL A;  3RAX A;  2KFZ A;  8ICC A;  9ICW A;  4UBC A;  4DOC A;  2W9C A;  3PX6 A;  3EW9 A;  4IRD A;  4MF2 A;  8ICQ A;  2ZUC A;  4QWB A;  3KHH A;  2W8L A;  5J0O A;  4QZF A;  3HP6 A;  3H7I A;  4KLM A;  2MUT B;  2PI5 A;  1ZQK A;  5IIJ A;  4R8U B;  5DKW A;  3PO4 A;  4TUS A;  5C5J A;  4DFM A;  3RAQ A;  4UAW A;  7ICP A;  1S0N A;  2BCQ A;  4XA5 A;  5J0T A;  4RNO A;  4DSE A;  4YP3 A;  1U4B A;  4YVZ A;  5CR0 A;  2JEI A;  3UXO A;  4O9M A;  1S97 A;  1T8E A;  1NKC A;  1BPB A;  4DOB A;  4EBD A;  4IQV A;  4RPZ A;  3OSN A;  3TFS A;  1N48 A;  4K4I A;  1KTQ A;  8ICB A;  5J2G A;  5BOM A;  4DF4 A;  3HW8 A;  5J0S A;  4B9V A;  3C2L A;  3GIM A;  4QZA A;  2JZB A;  4ELV A;  2XCP A;  4IQT A;  4C8N A;  2IA6 A;  1UT5 A;  3V6J A;  1EXN A;  4Q43 A;  1XO1 A;  3TI0 A;  1XSL A;  4O3S A;  2HVI A;  3PV8 A;  2HHU A;  4R8U A;  4QZD A;  3JPT A;  5D4B A;  7ICG A;  1V9P A;  5DQH A;  1S77 D;  1KLN A;  2NRV A;  2ISP A;  3BJY A;  5KFD A;  3TAP A;  1KFD A;  3UXN A;  1KRP A;  4F4Y A;  7ICS A;  1H38 A;  5J2K A;  4QZ8 A;  1ZQB A;  2B21 A;  3GIL A;  2W9C B;  3C2K A;  4DSL A;  3PW5 A;  3GDX A;  1ZQF A;  4ZH4 A;  4GXK A;  4FO6 A;  1BVS A;  3GII A;  4MFF A;  1B43 A;  1A76 A;  4M2Y A;  9ICM A;  5KG5 A;  3H4B A;  3RB4 A;  4MEY A;  3GIJ A;  3PY8 A;  4GC7 A;  4QZH A;  4ECV A;  3SYZ A;  3OGU A;  3PVX A;  3RJJ A;  4M9N A;  9ICU A;  5J0W A;  1ZQN A;  3RJI A;  3G6V A;  8ICA A;  2BQ3 A;  8ICJ A;  5KTQ A;  5KFU A;  4RQ6 A;  3NTU A;  3OHA A;  1X2I A;  3Q8S B;  4DFJ A;  4ED7 A;  1MC8 A;  5J2I A;  3LWM A;  4ECT A;  4F5Q A;  4IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...