4E0DA

Binary complex of bacillus dna polymerase i large fragment e658a and duplex dna
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4e0dA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4e0dA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e0dA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e0dA01
8ICYA 4FZZA 4B8AB 3V7JA 2Y1JA 1C1AA 4PHDA 1NOZA 9ICKA 2XHBA 5J2MA 4FJ5A 4Z6EA 1AROP 3RJKA 3V6HA 2AGQA 3RWUA 1HMVA 1RYRA 1W0HA 2FPMA 1HYSA 8ICGA 4ECRA 3MXIA 1KSPA 4P4OA 4E1NA 4M0AA 3KKRA 4PHEA 5CB1A 5BOMA 1VSEA 3AA2A 5CP2A 2G8IA 1JMSA 1WLJA 4CHOA 4UAYA 3OYLA 4FJXA 3NGYA 4DTPA 3KK2A 2C2DA 4GLXA 3KTQA 8ICQA 4LSNA 1WCNA 1BHLA 4PGXA 4DL6A 4CJ4A 4L8RB 1D8YA 3O4NA 1ASVA 5DKWA 1BPZA 3PX4A 1KEJA 1NK7A 3AVAA 2HHTA 4FLTA 4DMNA 4UBBA 4FLYA 1L3SA 2QK9A 3CM6A 3K57A 4XA5A 4PA1A 5HNKA 5D49A 3H4DA 5KI6A 2EX3A 2IHMA 3KK3A 1JLAA 4O3RA 4F4KA 1CZBA 1Q8IA 2Z1HA 2FC0A 4OJRA 3HPGA 1KTQA 1BPYA 2W8KA 3EW9A 1LAWA 4B08A 3ITHA 3NGZA 4AH9A 1IKVA 4FLVA 1XI1A 5KFIA 4G3IA 4IKFA 4TQSA 7ICLA 4KTWA 5J2BA 4ICLA 5HRRA 3ZDAA 1C1CA 4DOAA 1NJYA 4DSIA 4QWDA 9ICPA 1LW2A 3RJHA 2FLNA 3VQ9A 3AU2A 4I2AA 5KT5A 3GIMA 3OYDA 9ICNA 3ZSWA 4KREA 5KG7A 2ZJ5A 5KG0A 1Y88A 3BQ0A 4MQ3A 3K5MA 3SI6A 4DSEA 3ZT2A 4OGCA 3V7LA 3H8JA 4BE1A 4NXZA 3V72A 3DYAA 3NTUA 2A1SA 1BQNA 1VSLA 8ICJA 2P5GA 1NJXA 3EY1A 2G8FA 3T3FA 4DSJA 4YNQA 4FJNA 3N97B 4RQ1A 2AJQA 1RBSA 2JGUA 2KFZA 4RQ3A 2ISOA 4M3YA 1RT7A 2XY8A 3L2WA 3RR7A 3DLBA 1U49A 1JLQA 3AA5X 3GIKA 3L2QA 2DFEA 4GXKA 1EP4A 2F8TA 4QCLA 1ZQNA 1RPLA 1VK0A 1ZQYA 3KIOA 3SUPA 3PW0A 1CXUA 3PMNA 1N48A 3GFKB 1J53A 2JLEA 4Q8FA 1ZQFA 3RBDA 3V9ZA 3RH6A 4EEYA 5HRPA 1J5OA 4FLUA 1SKRA 1ZQEA 1IKWA 8ICMA 2F1HA 2UVRA 2C28A 1ASUA 3C1YA 2RPIA 2BCSA 4O3OA 3B6PA 4Q5VA 1EXNA 1S1XA 5KG1A 4TUSA 5J1EA 3BQTA 3SQ1A 3PR4A 4ECXA 5KFOA 2HNZA 3NAEA 4PY5A 4Z4IA 2ASDA 4CFAA 1ZQVA 5D3GA 5KFQA 1JIHA 4QW9A 5KFYA 2IA6A 1TL3A 1ZBUA 2OZSA 4RNNA 7ICMA 3Q8KA 1HYZA 1B22A 9ICAA 1IG9A 1LWCA 4O0JA 5C5JA 1T7PA 1ZQPA 5KFPA 2V4QA 3V9UA 3ISBA 3TQ1A 2ZUBA 3M9NB 4CJVA 4DTNA 1PZNA 2X6NA 4ECUA 4RW4A 4CHYA 3SV4A 3HXMA 2UVVA 4QWCA 1RXVA 2HHSA 4O4GA 4I9QA 4JRPA 5KT2A 3ZT1A 2ZUDA 1GOCA 2AGPA 4ECZA 2MUTA 4DFKA 5CHGA 2PI5A 1YTUA 2X74A 2FMSA 1BI4B 1RTJA 1ZBLA 7ICFA 2PFOA 3ZCMA 4ZH4A 4CEAA 3VQBA 3OJSA 3SUNA 4IQUA 4M6WA 3WNGA 4JLHA 1TKTA 4IBNA 4J9NA 3ZT3A 4QZHA 3ASMA 4RZRA 4ZTJA 3AVBA 4ZTFA 1KRPA 3AO2A 1R0AA 1TK5A 5FROA 3C21A 7ICHA 2ASJA 4CEZA 5KFXA 4E7KA 4CK1A 1VSKA 2IHNA 3ZSYA 2PFPA 4GW6A 4CJ3A 3LZIA 5J2HA 3C5GA 1BIZA 4DQPA 4IRDA 4ELUA 7ICIA 4HCBA 4RW6A 4P4PA 1RTHA 4ED6A 3VQAA 1WSIA 3WNFA 3Q8SB 2B6AA 5I3UA 2FMPA 2YHBA 3T5LA 3MFIA 1U4BA 1D8LA 1V9PA 3ULDA 3PW4A 1NK8A 4ELTA 1KVCA 4CJRA 3NGIA 5EWEA 4W5NA 3MXMA 3KLEA 1RDCA 4BDZA 3QIOA 2E6MA 1BVSA 2YNHA 8ICEA 4DFMA 4NCGA 5KFWA 4FO6A 2HHXA 4IFVA 5HMMA 5D4BA 1VRTA 3NCIA 3M8QA 5JS1A 1KFDA 1RBVA 2Z1GA 3SUOA 4TQRA 3D0PA 4ECQA 3ZSOA 4I2JA 4KLUA 5IIMA 3F73A 3EWAA 3HJFA 2HHWA 5KFCA 3HW8A 4FBTA 2HHQA 5KG2A 4UQGA 3UIQA 3OYHA 3Q8QB 1S1VA 4QZCA 2IGIA 2YNIA 1SKWA 1K1SA 3OJUA 4F4WA 4IRKA 4FK0A 2BDPA 9ICWA 4I2PA 2BQRA 2KFNA 8ICWA 2YKNA 4DG1A 2ATQA 5J0WA 3KKSA 4J9MA 3AVIA 4F3OA 1X9WA 4FJJA 4KO0A 1C0MA 2BE2A 3KHGA 3L3UA 1LB2B 4RPZA 2W8LA 1HRHA 4NM1A 4E7HA 4DQSA 1HNVA 4LH4A 5EU7A 1D5AA 4M9HA 2O4GA 3RMCA 4DL4A 7ICTA 3S3NA 4GVMA 4DTJA 3NF8A 4FJMA 5C42A 1ZQAA 2F96A 2DTUA 5KFUA 3OYMA 1L3TA 5IILA 5DLGA 3OYEA 5J2DA 5KFAA 5IIOA 2BPGA 4DFPA 3K2PA 2KZMA 3HVTA 1JLGA 4F93B 8ICBA 3RAQA 4CEBA 2WONA 4AHSA 4R66A 4EZ9A 3LK9A 4N56A 5K14A 2R8KA 4KI4A 3H4BA 4IR1A 2IC3A 2BCVA 4KLMA 5BPCA 3MEDA 1J54A 4KHYA 3T1AA 4B9TA 3MEGA 2ZTDA 4KHWA 5L1LA 2BQUA 4NYFA 4FXDA 3KLGA 1TVRA 1UWBA 5C25A 3FYHA 2IS3A 1Z00A 4KV8A 4YN4A 4KLJA 4NLNA 4E19A 1LWEA 1YTAA 7ICRA 2ZTEA 4FM2A 1T4GA 4DQIA 2VA8A 2J6SA 4UB1A 4O5KA 2FPLA 5L1JA 3AVCA 3M8SA 1D9FA 3HT3A 4DL5A 3EPIA 3ORYA 3V81A 3AO3A 4FLXA 4KMUA 4J9OA 1JLBA 4CJLA 3OSNA 4FK2A 3DOKA 4AHUA 2BGGA 5L1KA 3QEVA 1XS9D 4CEEA 2OZMA 2AQ4A 5EWGA 3UPQA 5CYMA 1RXWA 3ZDDA 5KFGA 8ICCA 3AO4A 3EPGA 2FPKA 3MAQA 2V9WA 2B5JA 4BACA 2P66A 4RQ6A 3LP3A 4JS5A 2NUBA 3QERA 4J2DA 2FLPA 3PX0A 1S5JA 1SL1A 4F5RA 3O3FA 1J9AA 3FDSA 3T5JA 7ICVA 1VRUA 1MU2A 1T03A 3LZJA 4UB3A 3Q8RB 3OVNA 2NRVA 2ZJAA 1WAFA 4AHCA 1COOA 4P2HA 4I2IA 4P4MA 1HYVA 1RTIA 1U04A 4F92B 1XSLA 5KFKA 1ZQXA 1QSLA 3OYAA 5BOLA 2XGPA 1WSGA 3M9MB 8ICNA 4MF2A 4ED2A 3H40A 2IDOA 2DPJA 4JRQA 4IG3A 4HVJA 1RBRA 2RDJA 4MFBA 3RRHA 1ZJNA 1KLNA 4JK1A 2D0CA 3V1OA 3MBYA 3QINA 3JYTA 4DOBA 3IG1A 4E3SA 4UAZA 1ZQTA 3PV8A 2GV9A 3G0ZA 3TAQA 5KT4A 4F2SA 3VQ5A 1MQ2A 3IM1A 4F5QA 4Z6FA 4KLEA 2XGQA 1WSJA 3OS0A 2R8HA 3PO4A 4DS4A 4DQRA 1TKDA 3JPPA 1I39A 1VSHA 4PPXA 4J9LA 3QEWA 4DL7A 4I2EA 4F5NA 1RTDA 4DTUA 3QETA 4B9UA 3SJJA 3VA0A 4KN4A 4F4XA 4PWDA 4F5OA 1TGOA 4XQ8A 1HJPA 3IHQB 4CGDA 3AVGA 3JPNA 3TFSA 1NKBA 5CYQA 4KHQA 3QZ7A 4M3UA 4YD1A 3V6KA 3OY9A 3L3VA 4OKEA 4CHPA 3NBPA 2XY5A 1NJWA 2I9GA 4PH5A 4LY7A 3NHGA 4Z4FA 4FJKA 5L9XA 3V4IA 2ATLA 4BWMA 2Q3SA 1S76D 3MXJA 2D0BA 1S97A 4G1QA 1A5VA 2PYJA 3RMAA 4ED8A 1UOCA 4KITB 8ICXA 2J6UA 4BDPA 4ECVA 2RN2A 4DL2A 3RH5A 4F4YA 4Q45A 4QZBA 2IOCA 3U6FA 2BPCA 5J2JA 4FLWA 1S0VA 4CCHA 3TFRA 5KFZA 5HP4A 4JUZA 3MR2A 1LAVA 3L8BA 3G6XA 9ICRA 3VQ6A 4CJQA 1ZQMA 5JUMA 3JPSA 1KVAA 2VANA 4I2FA 3DLEA 2MUTB 4R64A 3V6DA 4XUSA 3MGIA 3M9OB 3RJIA 7ICOA 7ICPA 1HUZA 4M3WA 3RJGA 2O4IA 4BGDA 4M3ZA 2F8SA 3OYBA 4DLEA 3V7KA 1ZQLA 1A5XA 3KJVA 1NK0A 3AVHA 4CK2A 5J2EA 4CFBA 3VQDA 3IS9A 1RBUA 1XWLA 4CJKA 4C8LA 4M6WB 1QHTA 1TV6A 1XSNA 4DTXA 2YKMA 1CZ9A 1NK5A 3C95A 3EZ5A 3P1GA 1L3UA 3DOLA 3QNNA 4NYNA 1KFTA 2LSNA 5J2QA 2C22A 4DF4A 4I2QA 4F50A 1T05A 4FVMA 4DS5A 8ICSA 4FBUA 4J9SA 3H7IA 3SQ4A 2GBZA 3OYGA 1G15A 3CG7A 1BISA 4GC7A 1RT2A 4RQ5A 9ICTA 2B21A 4LH5A 4GXIA 5KTQA 9ICQA 4NM2A 3QO9A 3E01A 3JSMA 4FJIA 4OVLA 1Z25A 2X6SA 1S9FA 4M9GA 4CJTA 4FJGA 1C7YA 2ZJ8A 2W9BB 3HSTB 3O3HA 4RNMA 1HNIA 7ICGA 9ICMA 3T19A 3HX0A 5DK5A 4EBEA 4CEOA 2P1JA 1QE1A 4HYKA 4YVZA 8ICFA 1SUQA 2XRIA 7ICJA 3LPUA 5CZ1A 3VA3A 4Z6CA 4QW8A 3N4MB 1ZQBA 2PFQA 1N5YA 1RT4A 2ALZA 3VQ8A 4FZXC 3VQCA 3HK2A 1RYSA 3ZSQA 5T7BA 4EBDA 4KLIA 4K4HA 4FJ8A 1ZQOA 3JPOA 1JLCA 2IBKA 4RUAA 1HQUA 5IIIA 2XC9A 4R8UA 9ICBA 2JEGA 2VG5A 2WTFA 1UAXA 4I28A 4CK3A 4H4OA 5KFBA 4K4IA 3RAXA 2BCUA 3LWMA 4O3PA 5DG8A 1JLEA 2DPIA 1ZQRA 2HHVA 1BL3A 3U3YA 5DQHA 4YG2A 2YHAA 5J0XA 2HVIA 4IQVA 3NDKA 1BPXA 4UB4A 5DG7A 3OYKA 4CF2A 3BQ2A 4UAWA 3K58A 4RG8A 1ZQQA 4KB0A 3ZDCA 4TSXA 1CXQA 4QWBA 2BANA 1ZQCA 4EP5A 3VQPA 3VN5A 5J2IA 3TAPA 4FYDA 4RQ7A 4FJ9A 1VSFA 1SL2A 7ICEA 2BCRA 4XRHA 4R65A 1RDAA 4DFJA 2XCPA 3S9HA 4Y1CA 5DBBA 4RPXA 3GIJA 1UA1A 4JWNA 3PX6A 4J2AA 1L3VA 3KLIA 3PVXA 3PUFA 4C8NA 3FFIA 1TK8A 1B9DA 4AHTA 4DU3A 5J0UA 3PO5A 3OHBA 4CGGA 4W5OA 4KLFA 2ZTCA 3GQCA 1T3NA 1UT5A 2JEFA 3KK1A 1DGSA 2XY7A 4IR9A 1RZTA 8ICTA 3HYFA 4QZEA 4K4GA 4ECYA 1ZQZA 4DU1A 2X78A 4QZGA 1Z00B 2I1QA 3TARA 4O3SA 2W9BA 5KG3A 4E0DA 1KVBA 3QNOA 3V9XA 3UXOA 4MFCA 3C94A 4W5QA 3AV9A 1GOBA 4AHRA 5KT3A 4O9MA 2DFFA 3CYMA 4CECA 1ASWA 3ZSRA 3QEBZ 3P83D 1TL1A 4H4MA 2JZBB 4BXOB 4KHUA 4E89A 3OYFA 2ZUCA 5KFHA 2VA2A 3WNEA 5DDYA 9ICSA 3PNCA 3TABA 3ZDEA 3BDPA 3NH1A 3THVA 1H38A 4HTUA 4RQ4A 9ICHA 5DB6A 4QZIA 4IQWA 4MEYA 3VQ4A 2FBVA 3RJFA 2HMIA 4IG0A 1ZQUA 1IH7A 4HHTA 1RT6A 3H8WA 4RQ2A 1L5UA 1Z3EB 3NH0A 3IAYA 1RDDA 1S0NA 3MECA 2IMWP 5J0TA 3ZD9A 1QQCA 4JV2A 1FKOA 3QESA 4K8XA 5HRSA 4IRCA 3H08A 4O44A 1BCOA 3TANA 1YT3A 4CJWA 2PXIA 4OPJA 2PY5A 4KFBA 4EBCA 2C2EA 1QSYA 5HROA 5CWRA 3AVLA 3L2RA 5FRNA 2HW3A 4AHVA 1XU4A 4KB1A 4LD0A 1IM4A 2B4JA 4NLZA 2PFNA 5SZTA 3SI8A 3PR5B 3TAGA 4YMMA 1KCFA 4CHZA 5KG4A 1B43A 5KG6A 1X2IA 1QSSA 3C2MA 4QOZB 4TUQA 4CFCA 3HP6A 3O3GA 2HNYA 1XHZA 4YMNA 4KKOA 5CY4A 3I8DA 8ICZA 4FJLA 4KTQA 4KLQA 1NKEA 5KFEA 3I0RA 1F21A 1QS4A 1S77D 4DF8A 4F3TA 4YR2A 3NF7A 4KLHA 4Z6DA 1ZQSA 4M04A 5DLFA 2QKBA 4N5SA 4CJPA 1ZQHA 1RCHA 4Q44A 3T5HA 4RUCA 2MAXA 4DOCA 1C6VA 4ELVA 8ICLA 3VQEA 1SZPA 1Z26A 2BCQA 4BE0A 4RPYA 7ICUA 1ZYQA 4KLGA 4Z4CA 4EYIB 5F9LA 5DGBA 1JXLA 2Z1IA 3CFPA 2JZBA 4BXOA 4CJSA 5DB8A 4NLKA 4YCXA 4B8CA 1ZQKA 3S3MA 4ED1A 4PQUA 3SUQA 3SZ2A 3I0SA 4M9LA 5CZ2A 3MABA 4DSKA 4CHQA 3AVKA 2D5RA 4R63A 3AVMA 1JKHA 3ZSXA 1TFRA 1X9MA 4JWMA 3RB4A 2PI4A 4OLBA 3LP1A 5J2KA 3MR6A 1B9FA 1N56A 1N6QA 1WSHA 3ALYA 1JXBA 4UBCA 8ICRA 4CJUA 3B0YA 2YNGA 1LV5A 2KTQA 4CJFA 2ASLA 8ICUA 3EYZA 4XIUA 3RR8A 5CJ7A 5DBAA 4J2EA 1S1TA 2Y1IA 3KLHA 4YP3A 5KFNA 9ICEA 4OLAA 2J6TA 1QLNA 2VG6A 2ZQBA 4ZHRA 3MGHA 4M3RA 4DQQA 4FLZA 5KFMA 4DO9A 4B9VA 3GILA 1ZBFA 1IXRA 4YMOA 4M42A 8ICIA 3OYJA 3G6YA 4E7LA 1W9HA 3L2UA 2EHGA 4PGQA 4ID1A 3LWLA 4J9PA 5J0SA 4MEXA 1JL2A 4CJEA 3B0XA 4OPKA 1S6PA 3PW2A 3OSPA 3ZT0A 8ICOA 3SQ0A 1S10A 3KHHA 3K4GA 1RILA 2F1IA 4E7JA 4C8KA 1U9LA 3C2KA 3DRRA 4AILC 3ZT4A 2P6RA 4KPYA 1C1BA 3K5OA 4FK4A 4Q43A 4KLDA 5DGAA 4I9LA 4FCYA 4I27A 4J2BA 5J0YA 2UVUA 1CLQA 5J0PA 1IKXA 3K75D 4F4ZA 1MSWD 1S9GA 3UQ0A 1KLMA 9ICUA 3OS1A 4J9RA 1HPZA 2ZE2A 3RB6A 1S9EA 3V1QA 3AO1A 4CF9A 2ZD1A 5CR0A 5DB7A 4O3QA 3MDAA 5KT6A 1C0TA 4CJ5A 2E6LA 4YXMA 4KTZA 1WNSA 3LAKA 3QEXA 2G8UA 1DTTA 2OPPA 4OKKA 4K8ZA 2Q0ZX 5J2AA 1REVA 3ZDBA 2GWSA 4ECSA 4PGYA 5HMLA 4CEFA 2OPQA 4N47A 3AUOA 2R8IA 4Y1DA 3SQ2A 1NOYA 3SCXA 3DI6A 1Q9YA 1DLOA 1U45A 3BJYA 4NY8A 4ECWA 5EWFA 3LAMA 2AU0A 4RW9A 2KZZA 3AU6A 1ZQIA 4PHAA 2VA3A 5KRTA 3UXPA 4KRFA 1GOAA 2W9AA 1EKEA 3TAMA 4FM1A 4EZ6A 4CEDA 3RBEA 1CUKA 3UQ2A 3MR3A 4CF1A 4LZDA 3HVRA 4Z0UA 1T8EA 2JEIA 4KLTA 1BGXT 4X5VA 4CGHA 1HJRA 9ICVA 1X9SA 7ICQA 2W9CA 5SWMA 3V6JA 3LALA 2NRZA 1RT3A 1ZBIA 3C6UA 5DQGA 2FMQA 4DTMA 1S1WA 4J9QA 3CQ8A 4FW1A 5TZVA 1ZQWA 5DDMA 4YQWA 1JLFA 4I2DA 3MEEA 4B9SA 4R8UB 9ICIA 4Z4GA 1U47A 1SKSA 4W5TA 1I3AA 4DLGA 3DMJA 2AQ0A 5DMRA 2P51A 2R8GA 3LDAA 1EETA 4YR0A 4M47A 1RDBA 2OPSA 3QEIA 2ISPA 3HM9A 2W42A 1ITGA 3K5LA 4ED0A 3DLKA 3RJEA 4CEQA 1TK0A 2BKEA 2BPFA 4HUGA 1BIUA 1XO1A 1UT8A 3HL8A 3E2EA 2NRTA 4QAGA 2YV0X 3RH4A 4DTRA 4JS4A 3KHRA 4M2YA 5J2CA 4DU4A 4CGJA 4HUFA 7ICNA 3HP9A 1C0UA 1WAJA 1EXQA 4RW7A 3DRPA 1XHXA 3NF6A 2VWJA 4YXJA 2FBTA 5IINA 3LDSA 3DM2A 3QIPA 5IIKA 4TUPA 2G8KA 4QZ9A 3AA4A 5KRSA 4O3NA 1BPDA 1S1UA 2OWOA 4HUEA 4BWJA 3SV3A 1XC9A 5KFVA 3C1ZA 1CEZA 1NK6A 4KLLA 3BGRA 3RTVA 1DTQA 5J2PA 2BHNA 1NKCA 4ID5A 1NJZA 1SV5A 4GMJB 4ECTA 3LANA 4RT3A 4YR3A 4KAZA 3G6VA 8ICPA 2F1JA 1JN3A 4RQ0A 2XCAA 3NE6A 4M3TA 1A5WA 2HB5A 1MC8A 1BCMA 5KFTA 2XY6A 3ZD8A 4RW8A 1FKPA 5KGXA 3ISDA 3QLHA 9ICOA 4Q8EA 1TAUA 5CA7A 4M45A 3S3OA 3OYCA 3VQQA 3RB3A 2GUIA 5I42A 1VSMA 2NRWA 4O5CA 1Q9XA 4MFFA 4CIFA 3MFHA 4I29A 5DG9A 1D9DA 5J0QA 3KD5E 4DL3A 2M9NA 4Z4HA 3B6OA 3OYNA 3DLHA 4FJ7A 3M8PA 4QZ8A 2PZSA 3AVJA 4N41A 2RDIA 1BPBA 3DRSA 4DWIA 2LYHA 9ICCA 3DLGA 2R7YA 4MF8A 1A76A 3NGDA 4C8OA 3SYZA 4J9KA 3AO5A 4IFYA 2OPRA 4KHNA 5KG5A 8ICHA 5KGWA 2A1JB 3C6TA 1KDHA 1S0MA 5KFLA 4DSFA 3AVNA 4CGFA 1NK9A 4UB5A 2I5JA 4DTOA 4Z4EA 2DY4A 4YD2A 4I2BA 4LZGA 1S0OA 4BE2A 1ZQGA 3LPTA 1QTMA 1U48A 4JV0A 4UB2A 1RT5A 3C23A 5EOZA 3GIIA 2ETJA 3KLFA 2QKKA 1HUOA 3SPZA 3KD1E 1VSDA 2KZ3A 4PHPA 3PY8A 4I2GA 1K6YA 3GV8B 4OGEA 3NH2A 4E7IA 2G8HA 3Q8LA 4PUOA 4F91B 2HNDA 4H8KA 1TAQA 4QZDA 4B9NA 8ICAA 4FM0A 3QE9Y 4M41A 4KLSA 2R8JA 1IKYA 1IO2A 4KHSA 5L1IA 3JPTA 4W5RA 5J2NA 3ETLA 3K59A 3DLRA 4FS1A 1VSIA 3GV7B 4FS2A 5JS2A 4CIGA 5DBCA 3LP2A 3P5JA 4CESA 4KN7A 3U3GA 3OYIA 5HP1A 4FJHA 4RNOA 3CM5A 3T5KA 3Q8PB 1BPEA 2BQ3A 3OHAA 1RNHA 4CHNA 5F9NA 3SNNA 5DQIA 4NLGA 3HPOA 2WOMA 3PMLA 2IAJA 2JEJA 4CERA 2RKIA 4OKJA 3M8RA 2RF2A 4ED3A 3NF9A 9ICJA 5E41A 3H8SA 4JV1A 4QZAA 5HHIA 4B9LA 4QWEA 4RT2A 3GV5B 3AA3A 3JPQA 3NFAA 4QWAA 4ED7A 5HRNA 1MQ3A 7ICKA 4M9JA 9ICFA 3SPYA 4KI6A 2QXFA 4QZFA 2HVHA 2HHUA 3A2FA 2BGWA 5KFRA 4YFKA 3CFOA 2A1JA 3ISCA 3TI0A 4DSLA 3HWTA 4C8MA 1RT1A 4IQTA 4GC6A 4N76A 9ICXA 3PW7A 4I2CA 1NK4A 1ZETA 1ZQDA 4WE1A 2UVWA 2P6UA 4FW2A 3VQ7A 5J0RA 1ZJMA 3OGUA 5J29A 1ZBHA 4NCAA 4F8RA 1S6QA 5HHHA 3MDCA 4F2RA 3JPRA 8ICKA 3QEPA 2VG7A 1KFSA 4IDKA 1O1WA 1BI4A 2E4LA 2P5OA 4I2HA 4FZYA 4TURA 2AGOA 1TV9A 1BQMA 4CGIA 4MFAA 9ICGA 4KLOA 3RMDA 3KHLA 3V1RA 3G10A 3AVFA 5D46A 1NOMA 3ZSVA 2FLLA 3V9WA 4BDYA 2DFHA 2KQ2A 3V9SA 2Z1JA 2G8VA 1Y97A 3RRGA 4CE9A 2FBYA 2BR0A 4DTSA 5KT7A 3TR8A 9ICLA 1HQEA 4EYHB 3L2VA 2PYLA 4LSLA 3Q8MA 2FBXA 3BQ1A 3CFRA 1DOQA 2OA8A 1UA0A 1FK9A 4Q0BA 4DEZA 3QEAZ 4O5EA 4NCBA 3D45A 2YNFA 4CF8A 4O0IA 4B9MA 3F9KA 1ZQJA 1JXEA 4CFDA 3TAEA 2C2RA 2VWKA 2OYQA 1JX4A 2ITGA 5HLFA 5FDLA 3RB0A 3GDXA 1RBTA 1JL1A 4LVSA 1A77A 1WSEA 2V4RA 5J0OA 3OS2A 4I7FA 2G8WA 4YFUA 8ICVA 3O4QA 5DB9A 4M3XA 1B92A 3TAFA 1WN7A 2KW4A 4E1MA 5C24A 4O55A 1EX4A 2KN7A 3HO1A 1WCLA 4CIEA 4F5PA 3C2LA 4EP4A 3RMBA 2NRXA 1TKXA 5IIJA 5KFDA 2W9CB 5KFSA 3QZ8A 2DFLA 1SL0A 1FXXA 2A1RA 4RQ8A 3RJJA 5KFJA 4R5PA 5J2FA 1TKZA 5HBMA 1WSFA 7ICSA 4GXJA 3K5NA 3IRXA 2W9MA 4O5BA 5KFFA 4HCCA 1LW0A 1YVUA 1XSPA 3HPHA 3ZSZA 4B3OA 1LWFA 1TVAA 1K1QA 3MR5A 2XO7A 5FRMA 5J2GA 1X1PA 4CF0A 3ISNC 1VSJA 4M9NA 3C5FA 2H5XA 3UXNA 4RU9A 2D0AA 3TWHA 3LP0A 3WNHA 3PW5A
chains in the Genus database with same CATH superfamily
3V7JA 3UKRB 4DN9A 1EKRA 3FEXB 9ICKA 2IVPA 4FJ5A 4Z6EA 1RA6A 1RYRA 4TYBA 3HOSA 2V63A 4ECRA 2W3SA 3MCOA 1KWMA 3VR1A 2KP7A 2K8CB 4PHEA 3U26A 2F1FA 4LF4F 3WDOA 3AA2A 2F2AB 3ILOA 4RX6A 5JLHA 3BGRB 2LEAA 1DTQB 4CI0B 1V3RA 3OL7A 3NGSA 5I4MA 3O9UA 2FF3B 3OYLA 4FJXA 2GMHA 3UPFA 1N8RO 4DCOB 2VPYB 4OV6A 2C2DA 3HHLD 4GLXA 3KTQA 8ICQA 3UN3A 2OANA 3F41A 2KHOA 1WCNA 2EVZA 4PGXA 4DL6A 1GMWD 4CJ4A 4L8RB 1Q95G 2KM8C 4FYVB 4ES2A 3I31A 1XNQK 3PX4A 3EDQB 1NMNA 2JWLA 3AVAA 4FLTA 2DVIA 4UBBA 1L3SA 4U9RA 2XYPB 1XR6A 2MHNA 2F40A 5ALGA 5HJXA 4JI5K 4XA5A 5LM7E 4PA1A 3KMQA 2EX3A 2A1AA 2IHMA 5D4LA 3T1YF 3MCPA 1JLAA 1RB0A 2AHOB 4QS9A 4F4KA 1CZBA 5DZ6A 4AL6A 2FC0A 1P1TA 4KR0B 5D8HB 3HPGA 4GV3A 1BPYA 3P49B 4KJIA 3UQSA 4FLVA 3WC2A 1RAJA 3U7JA 3DRSB 5M2RA 1NJYA 2V94A 2QO3A 2J0WA 2FLNA 3HT0A 2V7YA 3J7Z5 3VAKA 5AXLA 5HQLA 4I2AA 1AFIA 1M6YA 2Y0SD 1MN9A 4J90A 2HFUA 4WQ5C 3E58A 3N9UC 4M5NA 4MQ3A 3BQ0A 2OEJA 1VLYA 5B8HA 3VGKA 4DSEA 3NOCA 4OGCA 4O4GB 4WF9L 1PAUB 3LM9A 3MX5A 2DNZA 4OZJA 2OKQA 4DU7A 4BE1A 2DKZA 3FC4A 1X4FA 1UMJA 4ISFA 5JTIA 2A1SA 1X0PA 3DJCA 1L8OA 3IO1A 5J1NA 1XBWA 4PPDA 3CMQA 5GAEU 8ICJA 1M90O 3C15A 2V68A 4B3SJ 1UPPA 3FZBA 2MZ1A 1SJFA 4PXEA 2UXDJ 4TXSA 2FY1A 4USIA 2XY8A 3CCZA 1AUSL 3RR7A 1U49A 1JLQA 3O6QA 4Y2RA 4DPYA 4AYBF 5FIIA 2KVQE 3B54A 3BH7B 3U9ZA 5GMEA 1CXUA 3PMNA 4ILJA 3A5OC 3ELHA 2XS7A 3M2UB 1LNQA 5KOWA 2N4DA 4HKQA 2NCKL 2UUCJ 1X42A 2C2OB 1SCJB 3D7SB 1RDFA 4EEYA 1M1KT 4WP3A 1J5OA 3ZETA 2BKOA 4H5NA 5BRFA 2FSKA 1A7GE 4LVOP 2IAJB 2I7NA 2RPIA 2BCSA 4B1VA 5MLCV 4Q5VA 1EXNA 4NA3A 1M5HA 3SQ1A 4LJXA 3QYPA 4PY5A 1R6VA 3CDAA 2KNJA 1N5TA 2YNHB 4RNNA 7ICMA 3WT0A 4NCGB 3LTOA 1K5OA 1VQ6S 9ICAA 1GH8A 3M8QB 2Q31A 5C2DA 4USWA 3CCJN 2ERRA 3HULA 2ZZTA 5C5JA 4I1TA 3CCMN 2HGMA 4C0OC 2K3IA 1OSCA 2ZVIA 2NXCA 3ONQA 2MQOA 1PZNA 3EGNA 3G2XA 5GADU 4IO1A 4WP9A 2L9NA 3SV4A 1SIWB 3JQKA 4MLEA 2YNIB 1HUXA 4NXNF 2YXLA 2E44A 1AUDA 4H5WA 1V85A 3MM6B 2W4PA 2ZG6A 4ECZA 1UJ4A 3SMSA 4DFKA 2PI5A 2X74A 4NLPA 2GWKA 5E84A 8ATCB 2ASOA 1RTJA 7ICFA 2YQ0A 1VQMN 2ZH8A 3ZCMA 1BQMB 2AJ2A 2HVEA 3OJSA 3OL6A 5L39A 4DV6F 3WNGA 3H2LA 4DV7J 2YHYA 4JLHA 1ZD5A 3CJ3A 4U7CA 3PYGA 1WC1A 5T41A 1IBLF 1J2NA 2AWZA 4QPTA 1UFWA 4RZRA 1I3OB 1LFPA 4ZTFA 5ETTA 1QUPA 5DDOC 3CD5A 1QAIA 1TK5A 5FROA 1JCEA 2BJ9A 1Q8LA 4RUBA 2IC3B 4E7KA 4CK1A 3CD6S 3ZSYA 3R9KA 5JVGL 3MEDB 4F26A 2UUAF 1FO4A 2H54B 4DQPA 4IRDA 1D09B 4USAA 1FFUA 3L4PA 1RTHA 4YB1P 1FFGB 4ED6A 1KDNA 1TVRB 1UWBB 2ZIVA 4GY2B 2J76E 3MFIA 1V9PA 3PW4A 4KHPJ 1KVCA 5EWEA 1ECWA 3KLEA 4CBXA 3I55S 3LYSA 3NNHA 1GLAG 2PFFB 5IC6B 5KFWA 3GJQB 3MPYA 3R5JB 4H5VA 2V51B 2WW8A 5JS1A 1NZAA 1RBVA 2H4YB 3L9ZA 4ECQA 1S79A 3CP8A 2POKA 1FTRA 3BP8A 2QB1A 5C24B 3MMBA 1C20A 3R1LA 2HHQA 2X1GA 4QIWC 1FD2A 5J1PA 4URSA 3Q8QB 1S1VA 3KUGA 4DV5K 3OJUA 4F4WA 3QRPA 2KD1A 3W5YA 4JK8A 2YKNA 4DG1A 3IMXA 5J0WA 5HBMB 1XC3A 1QM9A 4BGAA 4BREA 1Q46A 1XK8A 4ISGA 2CGJA 1QH9A 2DRDA 3QNMA 1ZAXA 2RNEA 1X9WA 4JI5F 1HNZK 1M5OC 3KHGA 2W24A 2HZAA 4RPZA 2ZNZA 2Y0SF 4LH4A 1DRGA 4YOUA 1NUEA 2HFNA 4IH6A 5AQOA 1OSDA 4DTJA 3NF8A 5C42A 2DTUA 4PQAA 3OYMA 1L3TA 5IILA 3OYEA 3M1FA 2BRLA 1HKCA 2BPGA 2CKWA 2OTJS 1JLGA 2IVOA 1WI8A 2BUNA 2VD3A 4CEBA 2A3ZA 4NEYA 2MSTA 4Y2KA 3K9KA 1P6TA 5K14A 4PG7A 2BJDA 1OJ4A 2E1EA 4QIFA 3WU2U 3TEGA 3NGTA 3TWZA 2J9DE 4KX3A 4P52A 2JH1A 5BPCA 4J7CA 5L46A 1J54A 3MEGA 5AJ3K 2QMUB 3VALA 2K1RB 3QWPA 3VAMA 4CTAA 3KLGA 2C2NA 2HFSA 1Z00A 2ZWPA 1FWKA 4KLJA 4NLNA 3NAIA 5FLXY 1J27A 3KK2B 4LF4J 5F8JA 4E19A 3THWB 4AQYK 5IWAF 3VMFB 3IBCB 2WCXA 4DQIA 4O5KA 2MLXA 1RTDB 2DBBA 4QIEA 5KNIA 5C2FA 4LFAK 5EDWA 2WUSA 4PWWA 4Y28C 3DXBA 3DRYA 3D1QA 1G1XA 2R7TA 3D0IE 2DGUA 3KZBA 3V81A 4CLSA 2CG8A 3AO3A 4FLXA 3TA1A 4KMUA 5KAKA 3OSNA 3ET6B 4ZJOA 4WK1A 3ENQA 3DOKA 1CJUB 1Q79A 3FC9A 4FWLA 3GYGA 3QEVA 1XS9D 3T1YJ 3V4IB 4CEEA 5L8RC 5EWGA 3CSKA 3NAHA 1VR6A 3DU6A 5KFGA 1RFQA 2DUYA 2HQIA 4B02A 2ZBIA 2V9WA 2B5JA 5IV3A 2I7PA 4KBOA 3OR1A 4CO5A 3I28A 4CH0S 4JS5A 5ALFA 3QERA 2MQPA 3NVVA 1SL1A 4F5RA 5H2FU 3O3FA 1J9AA 2E8OA 1X4AA 7ICVA 1X66A 1EAYC 2Y0SC 5ALKA 3Q8RB 1RLCL 2ZJAA 2JGAA 2EQYA 1GTEA 1V4TA 1GLLO 4WIIA 2E8NA 3H0MB 3C2PA 1EX8A 3AA8A 2ILZA 2CDRB 5AI6A 3VHQA 2KYZA 3OYAA 5BOLA 1BQNB 2AW0A 4EFAC 2F9WA 3CD7A 4PR6A 3F0NA 4XPEA 4ED2A 4RBTA 2DPJA 1PK3A 2M8HA 3SSRA 4HVJA 1YAGA 4LMZA 3PHEA 2NSCA 2UUTA 4MFBA 4PG8A 3RRHA 1HQ2A 3C6AA 3GE1A 3T1HF 1FE0A 3GYXB 3JYTA 3ZZOA 5TISU 1SGGA 1VFJA 3R6LB 3SDEA 4UT4A 3C29A 3G0ZA 3UI3A 2DNNA 3G9CA 3TAQA 4I2QB 1J5EK 2FC8A 4GVLA 4KLEA 3GE9A 3HZ6A 2R8HA 3PO4A 4DS4A 3JPPA 4V19X 3NKYA 4OYIA 1IBKK 2EAOA 2O6KA 2K7KA 3CJ9A 3QEWA 4DL7A 4Y2YA 2LQ8A 3SJJA 4KN4A 2W4CA 4RBUA 4XQ8A 4CGDA 2YX7A 3EL2A 4ZIWA 1RUSA 3ALRA 3FEYB 3WXJA 4A61A 1U1LA 1WDDA 4ZK7M 1NKBA 4KHQA 4M3UA 3POTA 4DV3K 3CCVN 5ALUA 3RW6A 4ILHA 2FVRA 2I9GA 5B0AA 1IR2A 1UZHA 3WXMB 4LY7A 1NDCA 4CLKA 4Z4FA 4FJKA 2EZYA 3PKMA 3UDLA 2ATLA 2E1FA 2G2ZA 2YN4A 2G09A 2PYJA 3RMAA 3CPEA 4P2MA 1YLXA 4KMOB 8ICXA 2W2OP 3FE1A 3A12A 3MGJA 5ETQA 4OI1A 1SB3C 1YITS 3U6FA 2BPCA 5J2JA 5C7PA 1S0VA 4M5DA 4CCHA 1PSDA 3O9QA 2QTDA 4ZVTB 3G6XA 9ICRA 2HWIA 4EHUA 1QY7A 5JUMA 2V2QA 2H3VA 4J91A 2C3UA 2FPHX 5EX0A 3C14A 1RU1A 4AT1B 2MUTB 3N5BA 4R64A 1JLEB 4XUSA 2KXHA 4JI7F 3M9OB 3RJIA 7ICOA 7ICPA 2BJEA 4NXNJ 1HUZA 2KI2A 4M3ZA 3OYBA 4PXCA 3KJVA 2RU9A 2HLTA 4NB4A 4DOZA 4JI6F 4M6WB 5E3CA 1M5SA 2ZXHA 4AL5A 2HBRB 3Q8VA 2YKMA 1NK5A 3SQIA 4NYNA 1AA1B 1SH0A 5J2QA 4PHTX 4DV6J 4AFFA 2UV8G 1HR0F 5B5EU 1T05A 2UXBK 2EH9A 4FVMA 4H0XB 2R9LA 3SQ4A 2HDOA 3FFIB 4F7VA 3EZWA 1QZ5A 4QQBA 2V8HA 5AZJB 3NASA 2MKYA 4KGKA 1VI7A 3ZTPA 1O51A 3NGKA 2KV2A 1TTHB 2RS2A 2MY8A 2DGVA 3E01A 4FJIA 3IR7B 2B8QA 2UUAJ 1K8KA 4M9GA 1PIEA 4FJGA 3O3HA 4RNMA 2B43A 2DH7A 4WU3A 3THYA 3ILIA 3PEHA 2A2CA 4ZOSA 2PT0A 7ICJA 3W65A 2XI2A 3MMCB 4Z6CA 3TTDA 4QW8A 3NVZA 3H90A 1JB0C 1ZTWA 4FZXC 2Z8QA 4EBDA 4KLIA 2GWJA 5GAHI 2IOHA 2MQNA 1BE4A 1R89A 5T7LB 3NUQA 3JPOA 2X3GA 1JLCA 1H3DA 1WWVA 1IG6A 1E4FT 3C7NB 3MCNA 1FWPA 4R8UA 9ICBA 2JEGA 4MIBA 3KZIU 2LVWA 3EZOA 3THXB 4IG0B 1Y4ZB 2KXNB 2A6AA 4USHA 4AD6A 3UNYA 4KGZB 4JV5K 3QMQA 3O5BA 3SCJE 4DHYA 4DPUA 2DPNA 2PMHA 1BL3A 5J0XA 2HVIA 2AA4A 4UAWA 4JKAA 4U67L 4RG8A 3U9DA 1ZQQA 4JI5J 1UEKA 3MM9A 2XEXA 4Y2JA 3BZQA 5HROB 1RU2A 2HSZA 4QWBA 2BANA 4MYTA 1S7HA 2QA2A 2HWTA 1QD1A 1KBRA 1SL2A 4Y65A 2IBOA 1XTZA 2PGCA 3KBBA 4NA2A 2LXUA 4R65A 2CZVC 1VK3A 3GIJA 1G99A 2BH1A 3KOOA 1UA1A 1L3VA 2G06A 4BJQA 4C4RA 3PUFA 2OM6A 5GINA 3BBCA 1TK8A 3OW2R 4AHTA 4KH1B 2DIVA 2HNYB 3HD2A 5IV4A 2GJIA 5J0UA 3BO2A 3FSYA 2ZTCA 3GQCA 4A8OA 3KK1A 2R7SA 1DGSA 2E2OA 1DQAA 1RZTA 2V67A 3M2VA 2LEBA 1TZ0A 1PILA 2RB7A 3SENA 1VLOA 4LF6K 5AQFA 2I1QA 3ENHA 3R3LA 3TARA 4O3SA 5KG3A 3QNOA 1KVBA 1OYEA 1T3OA 2C1EB 3KDOA 5KAFU 2EC0A 4PG6A 5KPRA 1GOBA 4AHRA 5KT3A 4KBIA 4LIRA 3CYMA 1HBNB 3ZSRA 3QEBZ 1DFDA 1TUVA 3F9MA 2ZJPQ 4WQ4C 2W43A 5H1SV 3IAM9 1NSPA 2GIRA 3OLAA 4NLTA 3L3FX 4PQUB 1RWWB 2VC1A 3HHDA 2M8DB 4A8EA 3LDOA 5AI9A 1JLBB 4X66K 2LM4A 2YWHA 1J5EF 5AIAA 3BDPA 4HTUA 1F5CA 4FF4A 1HLWA 5AQJA 5M1PA 2LHTA 4MEYA 1VQNN 1ZQUA 2IY5B 1ZD2P 3OPKA 2R4FA 4A8KA 1YVFA 3QNWB 2DK2A 2RQMA 5D0RA 3H8WA 4P0QB 3HZGA 1S1TB 3SR6A 4HI2A 1L7PA 2ZJRQ 2HYIB 2NO5A 1M5PC 4IOAQ 2VG6B 3ZD9A 3HILA 2P35A 4YOWA 4IRCA 2M70A 1VRUB 4A48A 2GA7A 1YIJN 3AVLA 3F2BA 5AM0A 2DR9A 2HQ3A 2HW3A 3SCKE 3TAGA 3B78A 1KCFA 5KG4A 3OTBA 1RLDA 2PIIA 2HFOA 5DO2A 2P9NB 1COKA 3D6MB 3MN5A 2QARB 3FZLA 3EDRB 3SMZA 4WTOB 3CDWA 4FJLA 5ALLA 4KTQA 1UETA 4DF8A 4F3TA 2Z2LA 3IG1B 2IOFK 1NH8A 4CO1A 3NF7A 4KLHA 2VJ4A 4MT1A 4NA1A 4H54A 3J7A1 3T1HJ 1ZQHA 5G0RB 4RUCA 1AQ6A 1UP1A 3PRVA 1U1QA 4DOCA 1C6VA 4KH4A 4M94A 2MKCA 2BJ8A 3GFHA 2HQGA 1ZRMA 2OPPB 1AZSA 4PWDB 4XH4A 4EYIB 1IQZA 2JR5A 1V5VA 1JXLA 6FD1A 2AEMA 1ZXIA 5IS2A 4CJSA 5DB8A 4NLKA 4B8CA 3BR9A 4BROA 3MN9A 3NWGA 4DSKA 3AVKA 5LJ3Y 3BS5A 3GSIA 1PCAA 4G65A 1JKHA 5KL8B 3ZSXA 3RB4A 2YB4A 1RCOB 2KICA 5J2KA 1Q82T 2V6AA 1B9FA 3I5CA 1N6QA 4GFJA 4JKHA 4L3QA 3PNIA 1JXBA 2BVZA 2VH7A 2QW9A 2J9EA 5DBAA 2EC2A 2NYIA 2O67A 2MZJA 2KE7A 2LM1A 1N33K 2HCFA 3ZTOA 5CZVA 2WAQD 1IG8A 5KOXA 4OI6A 5KFMA 5GTIU 1FFWB 1UJ5A 2JV3A 2VQEK 2GVZA 4I69A 4FPBA 1LKZA 2KHDA 4K4YA 1U09A 3OYJA 4E7LA 1KVIA 2KG0A 2D0PA 3DLEB 3L2UA 4ID1A 4J9PA 3ILLA 4M1KA 4JB8B 3UN5A 1N63A 4ILMA 4YOYA 2CQHA 3OLBA 2OPSB 3TR5A 1LVHA 3PW2A 2IJRA 3OSPA 4OZ2A 8ICOA 4FOEA 2V8PA 3KHHA 3DLKB 2XHCA 4DUZF 3IS9B 4E7JA 4GO5X 4JI7J 5E3AA 2E1MC 3K0JA 2QRRA 4KPYA 4TYAA 1VHIA 2PMWA 4OZ0A 3ZT4A 2H3ZA 1DRZA 4Q43A 3FCVA 1S6OA 4I27A 4K50A 4J2BA 1FNOA 4BS2A 2QB0A 4J9VA 3FEZA 3PJ9A 1XMOK 1QQ7A 1MSWD 1S9GA 4JI6J 4OJ3A 4YN3B 5IXUA 1RHJB 1RYUA 2VGMA 9ICUA 1HPZA 3RB6A 2NLWA 2ZD1A 4NLQA 1VQPN 2VFVA 3DCAA 3EGWB 4CO2A 1RKIA 3HCXA 1HR0J 2KJVA 1BUPA 4K4TA 1HNZJ 5J2AA 2F4VF 3ZDBA 1PJ7A 1GLFO 2W11A 5KQ8A 5HMLA 2Z2YB 1VBYA 4CLTA 2R8IA 4Y1DA 1E6YB 5EOYA 1NOYA 4OX8A 3PZPA 3HJVA 2EFVA 3M30A 1DLOA 2GHVC 4Z94A 4Y3CA 2CH5A 1HKBA 1ZQIA 3QATA 4MDBA 4A2BA 2NZ4A 3HZEA 1GOAA 3FZMA 1X4CA 3H5XA 1EKEA 3R6MA 3TAMA 1Q53A 1WKKA 4FM1A 2DGZA 4CEDA 4LR8A 3TU5A 3MR3A 4C3MA 2PSZA 4Z0UA 5ALYA 3H8MA 5ALRA 4X5VA 1RT4B 1SC3B 2HS4A 5AQHA 2K89A 1X9SA 4OYXA 5G4DA 1M5KC 1HIWA 7ICQA 2W9CA 3LALA 2NRZA 4WIQA 1RT3A 3QICA 4IXCA 2P9LB 4MLHA 2ZBPA 5TZVA 2QA4G 4RJVA 5HOOA 2CXEA 4I2DA 3WZ0A 4Y2CA 1HI0P 4WZMA 4DL0C 2DHHA 4H4OB 2U1AA 1SKSA 3A13A 2IYIA 1O03A 4QR0A 1K9MT 1U24A 2AQ0A 4H0OA 4MHVA 4QU7A 3WX4A 1Y5IB 3P8BB 4LRBA 4ZVUB 1UVMA 1E3MA 2W42A 1HIYA 3MPDA 1ITGA 3ONNA 5AI5A 2J4RA 2EZXA 4X66F 2MKSA 5FLXU 1BWFO 2E1YA 1Z6RA 4JB3A 2BPFA 1XO1A 4UASA 1ZBSA 2N7YA 2FGOA 3KHRA 2GFFA 3O5TB 3P6YC 1FJCA 4IO9Q 2QEXN 4GRSA 4ZCLA 4P6QA 5IZHA 3DRPA 4BR4A 2VWJA 3GWCA 5IINA 3DM2A 1ZZNA 1X6JA 2ESEA 1SH2A 3QRRA 5AIBA 3VF4A 4O3NA 1S1UA 2IDEA 2DBYA 1XC9A 1KOHA 4EGLA 1S72S 3LGHA 1JRPA 4ID5A 3HHKA 2DNYA 4GMJB 2VV5A 2NYHA 5LL6d 1VQ7N 1WHYA 4KAZA 8ICPA 1FXRA 9ATCB 5IQQA 3ZXWA 2RRAA 3KLVA 4RQ0A 2ILYA 4M3TA 2RAQA 2WHOA 1ATNA 1BCMA 1HWJA 2XO6A 4I67A 5TKWA 3F2KA 1I51B 4UY8T 1KONA 2ZFHA 5K8MA 2PDAA 3VQQA 1NXIA 4LFCK 2WF7A 1VQ9S 2NRWA 4WFBQ 4CIFA 2R7UA 1YI2N 2WOMB 5J0QA 2AYEA 3PG9A 2RE1A 1TL1B 1KS2A 3G86A 4Z4HA 3A5MC 3G8QA 2DGOA 1SVDA 4N41A 3H0PA 1VQPS 4DR1F 1GK8A 3E3XA 1HBUA 2LYHA 4QIVA 4C8OA 3AO5A 4WYWA 2HMIB 1J5EJ 1URRA 2OEKA 2VUGA 1UVIA 4IUFA 5FP0A 3KWIA 1NZPA 1KVKA 4RWXA 1X7VA 2R7WA 2JFDA 3H0RB 4DSFA 3AVNA 1PJ5A 4UB5A 2WAQF 4DTOA 2VPWB 3SEOA 2GHPA 1S0OA 1YG0A 3NNAA 1SV4A 2VZ9A 2O8DB 2ASPA 3MM7A 4HR2A 5ETOA 2LEPA 5ELZA 1EHWA 4N7TA 2QLBB 4K4XA 2CQIA 1L7NA 2AX1A 1MWZA 3V2UC 3OUYB 4IDKB 5AK5A 4I2GA 1AT1B 3GV8B 3TACB 4CM2A 2G13A 4CZHA 3SMVA 5BRHA 1Y3JA 4CZLA 4P2XA 4EO6A 2Q1LA 1N33F 4FM0A 2DKOB 5LJVA 1EB0A 4NLWA 5DM7L 2E29A 2R8JA 1E6VB 2CJYB 2XYHB 2NQPA 4J03A 4KHSA 5J2NA 2VQEF 2QLTA 1Q82O 4BG8A 3QT5A 2XZWA 3L5KA 4LRAA 4EMDA 2MSSA 2RU3A 2FY8A 4B6JA 3GV7B 5JS2A 4GKKK 3U1LA 2RSQA 1KD1O 3LP2A 3P5JA 2EWSA 3D28A 2K3KA 2ZWHA 2GLEA 3OYIA 5HP1A 2XI3A 3M2RA 3ZNJ1 3A0HU 3CM5A 3OHAA 1FK9B 4CHNA 5D0GA 4B1ZA 3R7NB 3HPOA 2YNFB 3MM5B 2KDOA 2L48A 5C0YA 2GIQA 3M8RA 3CCQS 2CNLB 4OX7A 3NF9A 1DQ9A 5AXMA 3H8SA 3MC1A 1GMVA 4MH8A 3MI7X 1U6BA 4B9LA 4KYZA 4F36A 4RT2A 4OLPA 3JPQA 2JVRA 3UE5A 5AZIA 7ICKA 3DN9A 5GTHU 4FWNA 1ZTTA 1A0PA 2XULA 3N4QA 1HBMB 2QXFA 1SJQA 4QZFA 4Y0WA 2IJFA 2O8CA 2OD6A 1P8ZA 1PG5B 2UXBJ 3A2FA 1K0VA 2BGWA 1VQ7S 5KFRA 2A6MA 3CFOA 3ISCA 3H98A 3KG4A 3ZZZA 2EFPA 3RU0A 3PW7A 4F25A 1DJ0A 4FKYA 1ZBTA 3QRQA 4RO0A 1ZQDA 4ZHRB 5D15A 4ACOA 2MU2A 1RACB 1KOOA 1Z4OA 2WAQC 2EKNA 1HBOA 3KUHA 2D9PA 3MDCA 4OMFG 3W66A 4CWBA 2OCEA 1S3XA 4HHJA 3P4UB 4FZYA 5BPNA 4PL2A 1W97L 1VS3A 2RS8A 1MWQA 4M5JA 1MMLA 1DBDA 3LDNA 3IP0A 3QUBA 1ZA2B 2FHJA 1YBUA 5ALNA 1NOMA 3ED5A 1RHKB 2ZM6K 1NGDA 1AB8A 2GGPA 2DFHA 2KQ2A 2HWHA 3AMZA 4IDHA 1RWPB 2V52B 2NYVA 3VWSA 3RRGA 2HFVA 4OJLA 2BR0A 3HKZD 2WRMA 2HHHF 4DUZJ 1ZQ1C 5KT7A 2E1AA 2XTJP 1HYSB 1UHUA 3CFRA 4DR6F 1DOQA 2P5VA 2OA8A 3EUNA 1S9EB 2WBNA 1Z2ZA 3LPEA 4N8OA 1T94A 2WK4A 2F5GA 2BABA 3M7DA 4W92B 1W7AA 1KR4A 1JNZB 3CCES 2P9KB 4LF8F 1S59A 1GLCG 2Y1RI 4KH0B 1RDWX 4B9MA 1ZQJA 1HNXK 3DHWC 1U7LA 3TAEA 2C2RA 4K4UA 1KP6A 4CLWA 2F4VJ 1BXNA 3DI6B 2MJNA 5HLFA 1H2VZ 1JL1A 3ZI4A 4LVSA 3QPIA 2VGNA 3RAMA 5G5GA 4H5TA 1T9XA 1ITPA 4IL6U 2UXCF 1FRXA 5AICA 5HVGA 3O4QA 4C0ZA 4CNZA 3C0BA 1WN7A 3BO4A 5ETKA 4E1MA 1EX4A 3O9SA 4F5PA 1N32K 3VERA 5C15A 2H3EB 5KFDA 3R97A 5KFSA 4CLLA 2DXFA 2P9IB 4R5PA 3FZFA 3O1LA 5J2FA 1KBUA 1WSFA 4C11A 2BV3A 4ICLB 1NBEB 3IRXA 1NSQA 3CQXA 2BACA 3DOMA 2B9EA 3TA0A 1B64A 5ETPA 3QU9A 3RRKA 1T9YA 5IQ6A 4OCZA 2CQDA 3DMJB 4B3OA 5KAIU 1JXVA 3MR5A 5FRMA 3FBEA 5FPNA 3ISNC 1SWVA 3C5FA 1VQLN 3UXNA 1EZZB 4YY3K 1VK8A 3BH6B 3LP0A 4X65F 5EHHA 3WNHA 2VPZB 3LW5C 4YORA 5KFTA 4FFDA 4YDXA 2Y1JA 5AFUA 2ITMA 1NEEA 1C1AA 4PHDA 2A19A 4QYRA 5J2MA 3IFRA 4X66J 2W7AA 2ZOFA 2KO1A 4YHHF 3V6HA 2MGZA 2QWRA 2AGQA 1Q1KA 4LSZB 4RW7B 2QA4S 2LMIA 3QIPB 3UE2A 3DKDA 5K8OA 4OJ5A 3SBTA 4M0AA 3VTHA 5CP2A 1Z1BA 1PVPA 4TY8A 2A10A 5A8RA 2VOPA 3TW0A 1SV5B 3NGYA 4FZLA 2Z57B 5D4NA 4LSNA 1BHLA 1RDRA 2DNQA 1D8YA 2PAVA 3O4NA 1ASVA 3IBWA 4HTIA 3FSXA 3TNVA 3PKYA 3Q8UA 2KMDA 1R7IA 1KEJA 2RHFA 4DR2K 2GO8A 4JI1K 5LOQA 4FLYA 1T6DA 1XQSC 3PXGa 3KD3A 2FZKB 2JX2A 5D49A 1U02A 3CC7N 2KJ8A 3KK3A 2E2NA 5AXNA 3RBZA 1UCNA 3K1RB 2G2OA 3ILJA 2W8KA 3EW9A 1LAWA 2B0GA 3TADC 2CRXA 5D3GB 1S99A 3IXQA 7ICLA 2NR0A 5HRRA 1NBWA 3MAHA 1JCGA 3C8YA 3DLGB 3J7YP 4DSIA 4H4KC 2V50A 1N5WA 3RJHA 4YDUC 2FHKA 4WYBA 2W6LA 4DR1J 2HGLA 5E3QA 4ETZA 3GIMA 4CI6A 3DXKA 4ZKAA 3W62A 5KG0A 1GT8A 1RABB 3UVJB 1T9WA 3MMAB 4R25A 1I94K 3K5MA 4FWQA 1BWVA 4GV6A 3DWLA 4DUYK 2K60A 1RT5B 2OIHA 1YHQN 2GC8A 3UKRA 3KLFB 4BC7A 5HVHA 4NXZA 2CJ9A 3DYAA 8RUCA 1VSLA 1SQKA 2VPXB 4CBUA 2RMLA 1SIZA 4Y2AA 2P5GA 4V19J 2G8FA 4PUOB 4ILLA 4DSJA 5JJBA 3BO3A 3N97B 2QM1A 2L41A 4RQ1A 1X4EA 1QAXA 3NS5A 4Y34A 2JGUA 4JHDB 2QL5B 4RQ3A 3OXFA 5HVFA 4B1XB 2ZITA 3QQCD 3FCWA 3HHEA 1UJ6A 1HFEL 3TUJC 4EHTA 4GV9A 2RH3A 5AQTA 1N33J 2DFEA 3OFEA 4GXKA 2VB6A 1EP4A 4K25A 2F8TA 1ZQNA 1RPLA 4K4VA 2UU9K 1R8CA 4B1UB 2VQEJ 1HARA 1N48A 2R7QA 4NLSA 3GYNA 2ACMA 2JLEA 3I87A 1XR5A 3ZTSA 4A62A 1RISA 5CHCB 3V9ZA 4DPOA 5HRPA 2ZM6F 1SKRA 5AKHA 8ICMA 4MN4C 1KHVA 2F1HA 2CQPA 2FC9A 2E20A 3UR3C 2C28A 3BBBA 2E7VA 1K47A 5I3UB 1FTCA 3B6PA 2RF2B 1MNEA 3L0QA 4ECXA 5KFOA 3MMVA 3NAEA 4Z4IA 5KFQA 1JIHA 4QW9A 2IA6A 2OZSA 5JICA 4CP5A 1LKYB 2H5IB 2L9DA 1B22A 1VRTB 3LA0A 1WEYA 2JMGA 4DV2K 2C3YA 1KL9A 2P9UB 5K8PA 1QAYA 5LSRA 5KFPA 2V4QA 2ZBCA 3M9NB 4CJVA 4X4OA 4DTNA 2B7BB 1OYDA 3VC8A 1HNXF 2H5EA 4RW4A 3KOAA 3IBFB 4QWCA 2XWXA 4P10A 3CCLS 3CE8A 1RXVA 4FZVA 4O4GA 4DV1K 5KT2A 1YXQA 1GOCA 5AE2A 1GXLA 3T6BA 4TN2A 2CPRA 5AE1A 1IWGA 2GMJA 4ZLPA 1TUYA 1HNVB 4RQNA 3MURP 4IQUA 5ALPA 4NOHA 1X4HA 4AM6A 1IR1A 3CTRA 3M5RA 1TKTA 4RNFA 1WACA 3FSIA 3ZT3A 4FN5A 4QZHA 3VEYA 4WFNL 1LK5A 2D0OA 2C2ZB 4WQ4A 3HVTB 3VCDA 1WG8A 1WC4A 3QU4A 1HWIA 2D4WA 2KKPA 2EFNA 3H5YA 1R0AA 3WC0A 3G25A 3M6KA 1R3NA 4FWKA 2KT5A 1WBBA 5KFXA 3M2UA 3UM9A 2DCUB 4DR3K 4CLYA 3R27A 2HHHJ 3MWBA 1CJKB 1R8BA 4LF7K 4NLCA 1BIZA 2VICA 4ELUA 3THPA 4P4PA 1KC8T 1T44A 1WSIA 3CJAA 3I82A 3R7BB 2AJ0A 4DR6J 3Q8SB 3SBMA 4BRKA 4BQLA 4KV8B 1OPZA 1RGVA 1NK8A 4ELTA 3R8EA 4DR4K 3WIUA 2YB1A 4PYAA 3MXMA 3BSAA 4BDZA 3QIOA 1Y00A 4LF8J 2ZIXA 2VBXA 2YNHA 8ICEA 4NCGA 1VC6A 4IFVA 3VGMA 5HMMA 4LJMA 3UDEA 2DQNB 2OTLN 3M8QA 4I7FB 2FZGB 1KFDA 3EGVA 2Z1GA 4TQRA 2VKRA 1GQEA 2C2KB 5IIMA 3HJFA 3BF3A 3VEZA 5E79U 3AOBA 4FBTA 3BF1A 5BR8K 3SQGA 1YJNS 3SXLA 4UQGA 2UXCJ 4QZCA 4WXWA 4DBQA 2YNIA 1TKXB 2HOFA 4FK0A 2BDPA 9ICWA 5H9EK 4WFAQ 4I2PA 2BQRA 8ICWA 2ATQA 3MM6A 4DR2F 4O8KA 4JI1F 3VAJA 4J9MA 2AX0A 4F3OA 5K5MA 2FD2A 1AYEA 1C0MA 2BE2A 3L3UA 1VOMA 4R79A 3N4PA 4NM1A 1SWWA 4M9HA 1WHWA 4DUTA 5CCMA 3R5DA 4GNIA 3NGUA 4JYAF 3S3NA 1Z19A 5CD4A 2YH0A 1MN7A 1WF2A 1R8HA 1N61A 3CHWA 4CYUA 4PG4A 5J2DA 5KFAA 3IR5B 4DFPA 3K2PA 4CT8A 3ZYYX 3H2VE 1RHUB 3C28A 3RAQA 3TVZA 2IHR1 4X65J 3SBGA 2YVSA 4P2SA 4ZA1A 3AA9A 3H4BA 1U1PA 2GQ2A 2IC3A 1S57A 4IG3B 4XK8C 2KT2A 2G1HA 2HAFA 4NL5A 1X4BA 2HF4A 3MEDA 4YHHJ 4KHYA 1I94F 2ZTDA 5F41A 5L1LA 1NGEA 2ZJPL 2BQUA 4DUYF 4FXDA 2ZC3A 1TVRA 4WFZA 1UWBA 3FYHA 2IS3A 4YN4A 3PACA 1UVLA 3OFFA 4BR7A 5FLXO 1LWEA 1ILYA 7ICRA 3CMAN 4NE9C 2QLFB 5F8HA 2RJZA 4XO0A 1TYQA 2VA8A 2J6SA 4UB1A 5CRXA 3TUZC 1W7WA 2KEYA 5IM0A 3US5A 2KRRA 3M8SA 1D9FA 1ZD4A 4G1IA 2JVOA 1V38A 3D67A 3EPIA 2WSCC 2ZJQL 4CZJA 2ZJRL 1IVZA 3LGMA 1JLAB 3FR0A 2H65B 4W98A 3NBPB 2CUYA 2XMVA 2FDNA 2UU9F 5JRTA 3FZ2A 4OYBA 2BGGA 4JMUA 5B09A 2AQ4A 3UPQA 5CCLA 1OXJA 3ZDDA 4NMXA 3CJ7A 1X31C 4NWBA 5GIOA 5ALTA 1D4XA 1CQNA 4DCPB 3VETA 4HTLA 4RQ6A 3BZKA 1Q81O 1ZZFA 2MZRA 3G6ES 2NUBA 4CZKA 2WF8A 3EICA 4J2DA 3NRWA 1L3KA 4FZMA 4MKYA 3T5JA 2L3MA 1MU2A 2J7UA 1T03A 2NRVA 4M95A 1VIOA 1N0UA 4P4MA 2M9KA 1U04A 4F92B 3V6DB 4KHRA 3AJDA 1VQKS 4BLGA 1OMSA 5LY3A 1JALA 1RE1B 3WKDA 2XGPA 1U8SA 3N6MA 4HL9A 8ICNA 4CD3A 3IBPA 2I2YA 2G08A 2AYGA 3N7SC 1VDVA 5A0LA 2RDJA 2LA6A 3K2YA 1KLNA 4OZ1A 4JK1A 1HD1A 2D0CA 5EY4A 4HDHA 1UWAA 3MBYA 1ZAVA 2VDHA 3MK6A 5I9EB 4DV1F 4FNIA 5A8KA 3K89A 1IQTA 1JLQB 4F2SA 1MA9B 4ES1A 3VQ5A 1GLEG 4BQZA 4F5QA 4Z6FA 2CJKA 4A8WA 1WSJA 1VSHA 1I39A 3WXLA 2YMQA 1RTDA 4F5NA 4B9UA 3NS6A 1J2MA 3I4PA 2PMZD 3CD0A 3VEVA 3AVGA 4FL9A 4FWPA 1IBMF 3QO9B 3M3ZA 1SKUB 3K5PA 3SQOP 3ZETB 5D78A 4ZLNA 4TU7A 1D9AA 2AJ1A 4CHPA 3R8YA 1KW4A 1YBAA 2XY5A 1CJUA 2ZM6J 2GMLA 4BR0A 3NVKA 1S5LU 2AXTU 2Q1NA 2LKZA 3I56S 3V4IA 3EE3A 1B70B 1QE1B 4XH5A 3MXJA 4DR3F 3B82A 1S97A 3HD1A 1UOCA 2J6UA 2RN2A 4ECVA 3ID6A 4DL2A 4QR1A 1ULRA 4BBYA 3WX8A 4C8YA 2V7ZA 2W2QP 4IEEA 1PGZA 2UZAA 1NGBA 3TSUA 3HI0A 1Y11A 3MR2A 4NYPA 2HRTA 4OQJA 3L8BA 2OMLA 4CJQA 1ZQMA 2AYBA 3WKAA 1UCVA 2FB0A 2DGSA 2DGWA 1HNXJ 1GFWB 2WBRA 4DCCA 1P8GA 3M6WA 1OUQA 4OYMA 2PN6A 3K17A 1CI4A 4CLUA 3MTKA 2O4IA 4BGDA 2B4PA 3NP5A 2AV5A 4DLEA 1A5XA 1YJ9N 1UL3A 1RTJB 5GAGU 4CK2A 1CQMA 3QGIA 5BXIA 2YWEA 4ZCIA 3VEWA 3CJBA 4C8LA 3KFWX 2QWOA 3SD7A 2DJWA 1TV6A 3C3LA 4KQZA 4OFZA 4K4SA 2E88A 4DTXA 1P7DA 1CZ9A 3C95A 3DOLA 1KFTA 4IWVA 1VQON 2LSNA 2F4FA 1SB6A 2K8AA 4I2QA 2EK6A 4F50A 1FRLA 4DS5A 3M6UA 1HKAA 3FZKA 4DR7F 4LBIA 5KQDA 4DQ8A 4J9SA 1J97A 3UDCA 3A0IX 5CH7B 3OYGA 1G15A 1BISA 1U2CA 1RT2A 3CO0P 4RQ5A 4K7QA 3ZZRA 1YJWN 1R43A 3VAIA 4BRHA 9ICTA 2X7IA 2BJ1A 4O0NA 3SFUA 5KTQA 1FF2A 3CCRS 1GAOA 2CFXA 5AM2A 1PJ6A 1RTHB 2CPEA 4UY85 3KNAA 4OVLA 1Z25A 4CF5A 2G0CA 1S9FA 1U6FA 2W9BB 1NLVA 2JZ5A 9ICMA 2X1FA 4KH5A 5DK5A 4EBEA 4CEOA 2LQ5A 3BYRA 2F8LA 5F8IA 3KLEB 1LXNA 2ZNYA 5AQNA 4YVZA 4LF9K 1SUQA 4MK7A 3LPUA 1VIXA 4M5IA 4BC2A 1HNWF 2F8HA 3N4MB 3O44A 4CF4A 1ZQBA 1N5YA 2ALZA 5HN0A 3VQCA 3SCLE 1CJVA 5CYJA 4YOXA 5T7BA 3EUB2 2LYBA 1FEEA 4FJ8A 5CXTA 4K0KF 5AKLA 1T0TV 2IBKA 2FLOA 5IOLA 1FJGF 1FEZA 4JI0F 2KRBA 3MCSA 1N8RT 3Q23A 2Z7JA 4F0HA 4YOEA 2HOEA 2FJWA 2GJ2A 2YKNB 4BX9C 4F71A 2APOA 3RAXA 2BCUA 3LWMA 2NREA 5DG8A 1JLEA 1V3SA 3H5UA 1R6YA 2V8GA 4GO7X 2DPIA 2JNJA 4L3NA 5DQHA 1N54B 2QMWA 2XSJA 4BR9A 3NDKA 2P6SA 4DR2J 2OSQA 4ICAA 1BPXA 4UB4A 4JI1J 5LXYA 3UW1A 3K58A 1NPKA 5M1NA 5H9FK 2LPEA 3TTFA 1GX6A 2E7WA 4KB0A 1BU6O 1UW9A 4TSXA 4I6AA 3TSPA 3UR0A 5C42B 3RVCA 2GVDA 5GAEP 3TAPA 2LU1A 4UZCA 2DHSA 4JYAJ 4FJ9A 1LWXA 7AT1B 1VSFA 1RBOB 5AI0A 7ICEA 2BCRA 1JLGB 2H5JB 4ZVPB 4Y1CA 5BN9A 4RPXA 2CGKA 2W4DA 5ALOA 2VU5A 3HVWA 3KLIA 5K14B 3PVXA 3X1LB 3FFIA 4ES3A 4A5AA 2BA9A 2IOFA 4WFBL 4KKOB 2X1AA 5AZJA 4IH5A 3PO5A 4AUKA 3J81j 4CGGA 1U2VB 4LT6A 2JEFA 3MEGB 1VQ8N 1RAIB 3HYFA 2P9SA 4QZEA 3KLGB 3H7HB 1CULB 5ETRA 4LFBK 1QUVA 3U4LA 3JSBA 1Z00B 1NB2A 1I94J 4E0DA 3UXOA 4DUYJ 1KN5A 1JJHA 4MFCA 2GS8A 3JTNA 3C94A 4ILGB 4W5QA 3AV9A 2ZGYA 2F9DA 1JJCB 4QPXA 2O8EA 4M63C 3DGVA 4CECA 2M0GB 4IQXA 3PIOQ 5AM3A 3F5EA 2ZUGA 2VBWA 3LH2S 1M90T 4H4MA 3DU5A 8AT1B 4BXOB 3MAAA 3C65A 4KHUA 2CPZA 4M5KA 4E89A 2B51A 3I0SB 3W5XA 5CE3A 3BDEA 4QYZK 2QWQA 9ICSA 5KL1B 3ZDEA 4RPFA 3NH1A 4ZOHC 3THVA 3DOKB 1ZXOA 3C7NA 1H38A 3D1HA 9ICHA 4Q2LA 2RRBA 2YKQA 2A41A 3OTOF 4R0JA 2YTCA 3THXA 3RJFA 1OW5A 1XUPO 4IG0A 1IH7A 1WOPA 2YNGB 2UU9J 3JQJA 1RT6A 1Z3EB 1U8WA 3N7RC 2B5JB 3MECA 1NG9A 2IMWP 1QQCA 2VWBA 4K8XA 1WDTA 2NNWA 4K43A 1BCOA 4LF2A 3I4HX 1X0FA 2MB0B 1IJEB 2LQBA 2XQCA 5E26A 1HWLA 5GAGI 5HROA 3OPXA 2E8AA 3L2RA 5C2CA 1CG2A 1UVNA 2QA1A 4WTYA 3NL0A 2WW4A 3TJ8A 1XU4A 2B6GA 4KB1A 4NXMK 4BRCA 4NLZA 3KHYA 5SZTA 3U8XA 2FVPA 3PR5B 1DK3A 2E5GA 1B43A 3OL9A 3FVYA 2JRZA 4CFCA 3HP6A 5AQGA 2HNYA 2ZH4A 2CNNB 2ZKUA 3DRRB 4NASA 4HACA 2CN1A 8ICZA 1NLKL 1VHFA 4MFBB 3C16A 5KFEA 3I0RA 1S77D 2BJ7A 2E8PA 2BW7A 5D77A 3S8SA 3WK7A 3O80A 4Y2QA 4UAUA 1IKXB 3DXSX 4IO8A 1SQFA 2VQFK 4N77A 4M04A 3SDEB 3MUMP 4K5RA 4CJPA 2OHDA 2V8VA 1X40A 2A2DA 3T5HA 1UAWA 1KQFB 4DV1J 2ODGA 2MAXA 2B4VA 2HAIA 3M32A 4C4SA 2AEFA 3VQEA 1SZPA 1REGX 4FPAA 7ICUA 3MN6A 4KLGA 4YUDA 1GLJO 2VASA 1BLUA 1RAEB 3PYEA 3CFPA 3HF5A 1CC7A 3S3MA 4PQUA 3SZ2A 3KWGA 1KKHA 4ED5A 4FWSA 2IPOB 4CLPA 2OYYA 3AVMA 4RW9B 1TFRA 2EEYA 2VFRA 1NGHA 1IBMJ 2PI4A 2ZF5O 4OLBA 4RLEA 2WBMA 2M88A 5ALXA 2VC0A 3B0YA 4ETXA 3NGRA 3RR8A 3CCUS 4UATA 4P0QA 4J2EA 1S1TA 2O8BA 2G0AA 3KLHA 1APSA 4YP3A 1WKJA 2E1CA 4OLAA 2J6TA 2VG6A 2E1PA 5AI8A 1VQ4S 4DR3J 1VBZA 3MGHA 3TZWA 4DQQA 4FLZA 4M5DB 1KQGB 3B4MA 3W9IA 4DO9A 2YHXA 4F02A 1U1NA 4Y2TA 3NNCA 1JK9B 1JUDA 2W04A 1ZBFA 2NPIA 1IXRA 3ZFVA 3MEEB 3UKUB 3U27A 5ETNA 8ICIA 2DHGA 3G6YA 4LF9F 5E5NA 3HSCA 5AM1A 5AE3A 2XICA 4LRDA 4HH1A 3JTPA 1B7YB 3A0BU 2E5LK 4L3KA 4PL8A 1S6PA 3KMSA 1S5ZA 3Q86A 2NLXA 1S10A 5JU5A 4C8KA 4R0EA 5FPEA 4O8UA 1C1BA 3K5OA 5AQZA 1FVSA 2MRLA 4H0VB 4KLDA 2K8BB 4FCYA 3T69A 1CLQA 4WF9Q 5J0PA 2XNQA 3SIPB 3K75D 1C0UB 5J2QB 3P39A 5AQPA 1KQSM 4J9RA 4PYDA 1F9EB 1NZ8A 2OH2A 5H9EJ 2Y8YA 1O13A 3ULEB 5F3TA 2K4PA 3AO1A 5KT6A 3TADA 2DITA 2E6LA 1QDUB 4KTZA 1VQ6N 1WNSA 3BGLA 3RW7A 1DTTA 2OPPA 2VYPA 1M1GA 3PLAA 2Q0ZX 3O3LA 4DR7J 2RP5A 2N4CA 4LIWA 4ECSA 2HURA 4H4KA 4B9QA 4CEFA 2RUGA 4N47A 5BPMA 4YDUA 4UZBA 1OVYA 3SQ2A 4B3MK 2H3QA 1G3OA 5SUHA 3E01B 2KHQA 3J7AP 1MN8A 1U45A 4NY8A 1K8KB 3KG1A 4ID8A 4PHAA 2VA3A 3UXPA 1QVGR 3IN5A 5AQUA 4KRFA 2W9AA 1RAOA 3OA9A 3OD2A 3THYB 2EWHA 3IR6B 2D3UA 1SC6A 2CWKA 2N3OA 3EXYA 5RUBA 1BGXT 1HJRA 3CJKA 1KTVA 4LFBF 3M8PB 3GFZA 3IDHA 1HNWJ 5BREA 3WIVA 2N7CA 3VENA 4IOCQ 1SXEA 4FW1A 1JLCB 1ZQWA 1JLFA 1F0XA 4B9SA 4R8UB 4Z4GA 2AD9A 1XEZA 2NUUG 3QMLA 4M8LA 3CMES 1U47A 1F5AA 1YBTA 3T9NA 4K0KJ 2M52A 2OPRB 4CE6A 4O4RA 5DMRA 1FJGJ 2ZH2A 1HPMA 1IM6A 3C6TB 4JI0J 3H59A 2I5JB 2YY6A 2OPSA 1RDBA 2ISPA 3CD6N 4ED0A 3EVOA 3A8JA 1U26A 2EG2A 3DLKA 3HSDA 4HHUA 4CEQA 4HUGA 2BKEA 2WB1D 4P75A 1UT8A 2CQGA 2LQ9A 2NRTA 2Y9UA 2YV0X 1ZPVA 3MM9B 3RH4A 2CAJA 4JS4A 3PYFA 3ZNUA 2BANB 4CGJA 4B1WB 4WJBA 1WAJA 4YOTA 2GELA 2QL9B 3NF6A 4YXJA 2IVNA 3BGOP 4TUPA 4NPOA 4BHQA 3I55N 1WKLA 3D66A 5KRSA 2VIHA 3T41A 2HMXA 4I6MA 1NK6A 4KLLA 3TZYA 1XERA 1RWKB 5BN8A 5L38A 2H9ZA 3OW2M 2CGLA 4FYXB 3F56A 4RT3A 3QUCA 1UKUA 2BM1A 3M2VB 2JC1A 4NXMF 1JN3A 2VL1A 2CPDA 2HBKA 2XY6A 4OPAA 3ZD8A 4LVNP 2GAGC 2NUHA 3VVTA 2PBDA 2CPXA 1GX5A 4DCHA 5KGXA 3ISDA 9ICOA 2KXFA 2YMPA 1TE2A 4E98A 5JVHL 3OYCA 2HPUA 5I42A 1CBKA 5DG9A 5E3RA 2J0QD 4OX9K 1VBKA 3LDLA 4PKGA 2FJ6A 3KD5E 2DH9A 1B4FA 2M9NA 1VGYA 4DPXA 5AQIA 4ZPDA 2MHEA 4GKJF 4C23A 2PZSA 1U1OA 2VFTA 1BPBA 2W7PA 4NLXA 1YZ6A 4BC4A 3I9ZA 3D3CJ 3OFGA 2RD5C 1A76A 3NGDA 4QIWF 2OTJN 1UEVA 3ENBA 4NLOA 4KHNA 4NLVA 5ETMA 8ICHA 1QQ6A 1YUWA 2ZIWA 2V2VA 4CGFA 1NK9A 3OTOJ 2LXFA 4LZGA 4BE2A 4EENA 3AAWB 4CJ7A 2QIFA 5H1SQ 4WE1B 1U48A 3IG5A 4UB2A 1FEHA 3IM8A 2NV3A 3NMAA 3O1BA 4FYYB 3GIIA 4V1Ak 3SPZA 3ZC4A 4NI2A 4PHPA 3PY8A 4IZ9A 4C80A 2NO4A 2YMMA 4OGEA 2R7VA 3JAMY 3NH2A 3CIMA 1CSJA 2HNDA 1XQIA 4QZDA 1YJRA 3GPAA 2HF3A 1VYAA 5IT9Y 4UOGA 4M41A 3UDVA 4KLSA 4KIAA 2P9CA 1TFWA 3MGVA 1IKYA 3Q22A 1IO2A 3H46O 1SC1B 5F3XB 4IJNA 3T79A 3ETLA 4I4BA 3K59A 4FS1A 3W63A 1F2HA 5LMUK 3A3NB 3HOTA 2QL7B 5DBCA 5FD1A 4LSLB 4CESA 4KN7A 3BN4A 2VOOA 3U3GA 2E5LF 2Q0UA 3PCOB 3OTQA 3Q8PB 4LREA 2MEWA 1RNHA 4CNQA 4RR5A 3HRDD 5DQIA 1IXKA 3I6PA 1QQNA 2WOMA 3DGPB 2JEJA 2GEMA 4OKJA 4ED3A 2UV8A 5AR0A 2AH5A 4JV1A 3SCIE 2F77X 2HGNA 1X6IA 2IIRA 3VV2B 2EAPA 2LXIA 1BC6A 2HIQA 4F67A 2E3TA 4QWAA 4ED7A 1MQ3A 1JKHB 2EFQA 3FRYA 3VTIA 3LM2A 1HEKA 3NMRA 2DNLA 2G2YA 1YJVA 3EE8A 2HVHA 1N6QB 5DZ7A 3K7RA 2OEMA 1NGCA 4F0KA 4YFKA 4QNLA 2G07A 4DSLA 1O6XA 4IQTA 3LUYA 3F5AA 1NK4A 1K8AT 1ZETA 2O8DA 2UVWA 1XNQF 4ZP6A 3WQUA 3VQ7A 1GMUA 3CXCM 1VJWA 4X84A 1OS5A 1NMDA 5J29A 4NCAA 3NMUA 2RLTA 2GVZB 2JLGA 2H48B 4F2RA 2WVEA 3HKWA 3NVMA 3OUYA 3QEPA 4IDKA 1KFSA 3J80Y 1O1WA 1BI4A 4DX7A 5B0CA 4TURA 1TV9A 4CGIA 4MFAA 9ICGA 3RMDA 2Q66A 3KHLA 1JJ2M 2BJ3A 4LF9J 5AM4A 2MLZA 3NCPA 5D46A 3QIDA 3V9SA 2Z1JA 2YH1A 5JMNA 5THWA 4JI2K 1S12A 5T14A 4I56A 3FJ2A 3FQLA 2FBYA 4CE9A 1TMJA 3D2QA 3F2DA 2QB0B 1S9GB 3W61A 1HQEA 1HMVB 4EYHB 4M7XA 3KJFB 4KX5A 1VC5A 1FXLA 3Q8MA 4K4WA 2HEKA 2FBXA 2CA9A 2D1CA 2ZD1B 1FK9A 4Q0BA 4Z37A 3QEAZ 3P5TL 4E1JA 2Z2MA 3WKEA 4O5EA 1CJTA 5D0EA 4OJ6A 4NCBA 5HQMA 4C8ZA 3TPQA 2YNFA 3MM5A 4UF4A 2JRSA 3J7ZO 4ZPTR 4M5HA 1YITN 4ZLLA 2ROGA 3PJWA 2R7OA 1SIJA 4ZVQB 4ENOA 1RQLA 1D8ZA 2VWKA 3AY9A 1X5SA 3HHLC 5H9FJ 3OVBA 3M30B 2QV6A 4WFAL 3GDXA 2N3LA 4YB5A 1WSEA 1RQNA 2V4RA 2KKZA 1HBMA 2VODA 3OS2A 3TAMB 8ICVA 5DB9A 4M3XA 2UXDK 3OXGA 3TAFA 1T95A 3IM9A 1NMEB 4OYPA 2KN7A 2DR7A 2F9TA 1WCLA 3AQEA 3GL1A 3SSQA 3GB0A 5ALWA 3E9OA 4EP4A 2QSWA 2J8AA 2LQJA 2W9CB 3ITHB 1SL0A 1RT3B 1IKVB 3D2FA 4KRWA 4GXJA 1VMBA 2I0XA 3D6FB 5A2QY 5GAHU 3ZO7A 4LFBJ 3MUTP 4O5BA 4IH7A 2VCPA 2WTUA 1T9TA 4HCCA 1YVUA 2UUCK 3BGFA 5HMYA 2R2UA 3ATVA 4OX9F 1LWFA 2KJWA 2XO7A 1BO5O 4RKUC 5J2GA 1VSJA 5M1OA 1S7IA 2H5XA 1WOQA 5L1MA 3AOAA 3RSEB 2DNOA 2E5HA 2E9ZA 5M1FA 3CULA 1PAEX 1ZM9A 1W26A 2IVFB 3PW5A 4FZZA 4H0TB 4B8AB 2WB1C 2RE2A 3TJ9A 4M5GA 1H74A 4QYZJ 1AROP 3RJKA 1U1KA 2BMBA 3I1YA 3QFUA 3RWUA 2G5IB 3H42A 5B7WA 2FPMA 1HYSA 8ICGA 3DM2B 3MXIA 3PM9A 3QGGA 2DWQA 1KSPA 2IFXA 3ICLA 3CIPA 1S1UB 1W25A 3M6GA 2WF6A 2PD1A 1JMSA 1WLJA 2Z56B 4UAYA 3ADAC 4ZP8A 4ID5B 2W3RA 4MKBA 4CHOA 2P9KA 1T6CA 2DKXA 4DTPA 1UZDA 1UVJA 2LECA 3ISZA 4OHVA 1B0XA 3EMTA 5J8YC 5M2UA 3FFKB 3S1TA 3TRGA 5BYSA 4NXMJ 2QK9A 1J6ZA 1XIQA 1RKJA 3BEXA 4BRIA 3CPWM 2JOQA 5HNKA 2AIRB 3NCRA 3H4DA 1Q5VA 4NRUA 4OZ5A 2A42A 1NB7A 5KI6A 2WFAA 2NXJA 4EU0A 1ZC6A 2K2PA 2E66A 4O3RA 1S1XB 2IRYA 3AJ2A 3CF5L 2WZ1A 4B08A 2GJFA 1LCUA 2DIUA 4AH9A 1PYOB 2HNZB 1XI1A 2HG4A 4G3IA 4HH0A 1TL3B 4IKFA 3R5CA 5A76A 1NGFA 1HHQA 2XIDA 4ICLA 1UTAA 4V19S 2H1YA 4X4VA 2FZCB 4US9A 2GCFA 1HBUB 3SEIA 1C1CA 4DZ6A 3ETOA 1VQSA 4DOAA 2VKZG 4QWDA 4O3MA 1LW2A 4OJHA 4GKJJ 1WUDA 1MMNA 3K1ZA 3OTCA 3VQ9A 3AU2A 1TL7B 3OYDA 9ICNA 4E2FB 2GO9A 4KREA 3DEEA 2XG8A 4Y2IA 2GV1A 3CCWA 1IV0A 3DFEA 4KHPK 4CVNE 3MM7B 3V7LA 3C46A 1D1UA 2J5AA 3H8JA 3DDKA 3SLCA 2Q6CA 3V72A 3TO8A 2QWMA 2C3PA 4EK2A 2XZTB 3T9ZA 4OJOA 2ZOGA 3RGIA 2M3DA 2QYCA 3A3PB 2MZSA 2I6XA 1P9QC 4YNQA 1YJUA 5D0HA 1N60A 4DV5F 1XNRK 2I8EA 5GMKa 4USUA 1RBSA 3UO0A 3BZCA 1KQSR 2ISOA 1RT7A 3HM8A 5F8MA 3SAHA 2KOBA 4UUXA 3P3DA 3TEHB 3DLBA 3AA5X 3GIKA 4L76A 1R0BG 4WCEL 4JBCA 4A59A 1HNZF 2BZFA 4QCLA 1VK0A 4PAAA 1ZQYA 3THTA 3KIOA 3PW0A 3LP2B 2B8PA 3GFKB 2CQ4A 2CPFA 1ROFA 3O1WA 1RWXB 4HTJA 3M2RB 3E1YA 1NU4A 4Q8FA 3M4XA 1OH6A 1K8AO 4RW6B 4FLUA 1IKWA 4CT9A 1YK9A 2E5LJ 1IUJA 4EI2A 1IJFB 2UVRA 4JI4K 1X9XA 2Q3PA 1ASUA 2CVEA 1GXTA 4JI2F 1QHAA 5KG1A 3IKMA 4TUSA 5J1EA 3RFAA 2B9YA 3QXGA 2FJAB 5D3GA 1ZAWA 1ZQVA 2B9WA 2VBYA 5KFYA 3J7YI 3NG8A 5AZIB 1FRKA 3GZFA 3PFEA 5M1QA 5E0OA 4BR2A 4MYUA 1GXUA 5AJ3F 1IG9A 1LWCA 4O0JA 2QE5A 2O8CB 4C6AA 3TP2A 3ISBA 3TQ1A 2ZUBA 1Z05A 2AJ4A 4EEKA 2F8EX 3VZIA 4HHHA 3I76A 4A8XA 3V5RA 4AQYF 3M1VA 4CHYA 4K59A 1EQ0A 3MM8B 4LF5K 3UVJA 4RUHA 1DT9A 2HHSA 4A8YA 7FDRA 4I9QA 4LFAF 2ADCA 2RQ4A 2KIVA 4URGA 3G82A 3UD5A 5CHGA 1MW7A 2E9TA 1XNQJ 2FMSA 1N88A 3CO9A 4QR2A 1ZBLA 1M0SA 2PFOA 4ZH4A 4CEAA 3VQBA 3SUNA 1FRMA 2GNKA 3LF0A 4IOBA 1R8AA 3G8TA 3IRUA 2YCHA 3D0GE 4JHDA