4E0DA

Binary complex of bacillus dna polymerase i large fragment e658a and duplex dna
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4e0dA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4e0dA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e0dA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e0dA01
2G8FA 3JPSA 1FK9A 1BPEA 4KREA 3SV3A 3IHQB 4QWDA 3MFHA 1ZQPA 3DLKA 3NCIA 3T5KA 2GUIA 4PH5A 2X6NA 4CF0A 3ZT4A 1RT2A 5TZVA 4NM2A 1J54A 4IFVA 4FLYA 3OYKA 3LALA 4FYDA 5KRSA 4HTUA 2VA3A 4IQWA 3RBEA 5HRNA 3C6UA 4CJUA 4KKOA 2BPGA 5J2EA 3Q8QB 4AHUA 4E19A 4DTXA 4DG1A 3PO5A 4FK4A 1L3SA 1ASVA 3G6YA 3K5NA 2IBKA 4DL5A 1WLJA 4CGDA 3NF9A 1S9FA 4KLDA 1N6QA 5DB7A 4KV8A 2PFNA 3KD1E 1BCMA 5T7BA 9ICWA 4RUCA 1ZQKA 4C8KA 3OYMA 4OKKA 3VQPA 4M47A 1XSPA 3BGRA 3CFOA 3PVXA 4O55A 4TQRA 5DBBA 4O5KA 3AVCA 4GXKA 5IINA 9ICAA 1U47A 1V9PA 4DFMA 3Q8MA 4DTSA 8ICLA 1HYVA 3SUNA 1NK8A 2Y1JA 3QIPA 2P5GA 1MQ2A 4BXOA 5E41A 2KTQA 4FJKA 1KEJA 2O4IA 1A5XA 4RQ8A 4FS1A 3V81A 4KLFA 4Z6CA 5KFBA 3ZT3A 4TSXA 5KFTA 9ICLA 1X2IA 1C1AA 4M9HA 4DTPA 1UA0A 3ZDDA 2QXFA 5KFDA 1JX4A 3L2RA 1NOZA 1W9HA 1KLNA 3RR8A 5KFOA 1TL3A 3LP3A 4RUAA 2E4LA 3V1RA 4F91B 1VRUA 4PGQA 4O3OA 4GVMA 4JK1A 2D0CA 3GIKA 4OVLA 4FJ8A 1J53A 1Z3EB 4LZDA 2ISOA 8ICBA 1Z00B 4K8XA 1GOAA 4KLUA 4Q0BA 3P83D 4QWEA 3OS2A 1JLBA 2ZUBA 3ZSVA 4I29A 4KHSA 1Q8IA 4FLXA 2ATQA 5D49A 3L8BA 5EU7A 1WSGA 3NAEA 4ED2A 3DM2A 3TQ1A 4IDKA 1IKVA 8ICCA 4C8OA 3IG1A 4FLZA 4JS4A 3RB0A 3KLEA 2UVRA 3NE6A 4F92B 1FKOA 4GC6A 8ICAA 2ZUCA 4RPYA 3QINA 2B4JA 2B5JA 3ZT1A 1RT3A 4IR1A 1CEZA 5KT5A 1BL3A 3KKSA 4QZFA 4F4ZA 1VK0A 4PHPA 5J2FA 3RTVA 3KK1A 2VG7A 4BWJA 3SJJA 3QEWA 1JLGA 2ZJAA 4NCAA 2HHWA 3NGIA 1RCHA 4DF4A 4R5PA 5KG3A 4UAWA 3NF7A 4GW6A 3RJGA 1MC8A 4QZ8A 4CEOA 2PYLA 2FPMA 1RTIA 3BQ2A 3PY8A 1VRTA 3MAQA 3ZCMA 3HXMA 4KTWA 5EOZA 1BQNA 5KG6A 4QZHA 2XGQA 4O5EA 4FCYA 2F8SA 2IHNA 5KG5A 3C2LA 5DMRA 4M3UA 1ZQRA 1U04A 2P66A 4J9QA 4E0DA 4CHOA 1S0OA 4CJTA 9ICHA 4DEZA 4RW6A 2IOCA 2OPQA 3OS0A 3NF8A 1O1WA 4Y1CA 3BDPA 3RWUA 1VSDA 4Z4IA 2IC3A 3OVNA 4WE1A 3RMDA 4F8RA 4KN7A 3EWAA 2E6MA 3AUOA 8ICHA 1TV6A 3FDSA 4FVMA 1I39A 3V6JA 4PY5A 4J9LA 4PGYA 1L5UA 4TUQA 3MDCA 3TAFA 3DLHA 4M3XA 3T1AA 5HP1A 4UAYA 2QKKA 3GIJA 3M9OB 1C1BA 5JS2A 3O3FA 1SL2A 4HUGA 3HX0A 3NFAA 3RMCA 4EBDA 3Q8PB 4ELVA 1JN3A 3QEAZ 3S9HA 5KG4A 3PX0A 1CLQA 2NRTA 2RN2A 4QWCA 2KQ2A 3LK9A 3VA0A 1NK0A 1SKSA 4R8UB 3RJIA 4YQWA 4KLGA 3CG7A 3HP6A 5DQIA 8ICQA 1T05A 2DY4A 4DTNA 5KFIA 3L2WA 2HHSA 3BQTA 1NK9A 5CA7A 3WNEA 4N47A 4DQPA 4IRCA 3SQ2A 5KT4A 4DL6A 3SNNA 1RZTA 1D9FA 1VSJA 1ZBHA 2ASJA 3OSNA 1T03A 5CWRA 3M8QA 3ISDA 1U9LA 3QEIA 4OGEA 4CJ4A 3NF6A 4ID5A 4M3TA 2G8KA 1UT8A 4BE0A 3SPZA 4M3WA 5J2KA 4DS4A 4DSFA 4YMNA 4FJMA 5IIOA 3N4MB 3LPTA 3PR4A 2BCRA 4FJIA 2VA8A 3K2PA 3TWHA 5KG7A 2I1QA 1N5YA 2QKBA 4RNOA 3H8WA 1ITGA 2UVVA 4YVZA 1Z00A 7ICTA 3UXNA 1GOCA 4YR2A 1X9SA 4LVSA 2F96A 4MEXA 3QEVA 3UQ0A 2Z1HA 4J2BA 1RT5A 4HUFA 3K5MA 5K14A 4YNQA 4OLBA 4K4GA 4RQ6A 5DGBA 4RQ2A 4JV0A 4CCHA 3DLEA 3NTUA 3L3VA 1QSLA 5KFFA 4DSJA 2FBYA 3GDXA 1C0MA 1ZQZA 1XO1A 4IRDA 1WAFA 3TAPA 1ASUA 2Z1IA 5J2HA 5DDYA 5HHIA 2HVHA 2Q3SA 3LPUA 3V9WA 1WSEA 2BANA 1JMSA 4RQ5A 3AVNA 3DI6A 1UT5A 4DSEA 3PW2A 5DBAA 4OLAA 1ZJNA 5KT2A 3VQQA 4RNMA 4M2YA 4KI6A 4DFKA 1NOMA 8ICNA 1C0TA 4BXOB 3WNGA 8ICYA 1B92A 2RDIA 2AGOA 4QOZB 5J2DA 1ZQUA 2C2EA 1S77D 4J9KA 3DOLA 4YD2A 4Z4CA 3AO5A 2AU0A 4CECA 4QCLA 2WTFA 3NBPA 4FM2A 4DTMA 4PHDA 3S3NA 2R8GA 1QHTA 4EYHB 4IQVA 5KFKA 5KGWA 2ZJ5A 2P6UA 4JV1A 4BE1A 1X9MA 5F9NA 3LAKA 3M9NB 3MDAA 3PUFA 1ZBIA 4PHEA 4F4YA 4HVJA 4DFPA 4YMMA 1HJRA 1UOCA 5DB6A 4B9SA 1WN7A 1JLFA 4CGJA 4RPZA 2KFZA 4UB2A 5DBCA 4BE2A 4ECQA 4CJ5A 3SUPA 4BDYA 3C1ZA 3OYHA 4KLOA 2X6SA 4KLLA 2VG6A 4TURA 2ZTEA 5J2NA 4B8CA 4HCBA 2Q0ZX 1ZQIA 3V6DA 4DQQA 4FK0A 4ZH4A 4FLWA 1ZQGA 1SKRA 5HBMA 1ZQCA 2DPJA 3BJYA 4CIEA 1JL1A 1K6YA 2ZTCA 2ALZA 3M9MB 3PW5A 2I9GA 4O0IA 8ICVA 4CE9A 4O5BA 4QZIA 2G8IA 4DU3A 3AU6A 3MXIA 1T8EA 3GILA 4Z6EA 5J0RA 1HQUA 4CFBA 3MBYA 2FMPA 2B6AA 3K57A 2FLPA 1C7YA 5KFYA 3PMNA 3AO2A 4ICLA 3LDAA 2KN7A 3V7KA 3HJFA 2Z1GA 4CEZA 1ZQTA 4Z6DA 4KTZA 2BGWA 3AVKA 1KTQA 1S5JA 5KFSA 3G6XA 3T5JA 7ICRA 1A5WA 5BOMA 1ZQVA 2RDJA 1ZQSA 9ICIA 4PPXA 9ICRA 5KRTA 5J0QA 2XGPA 3L2UA 2BGGA 4YCXA 4IQUA 3ASMA 1LW0A 1XWLA 1K1SA 4NLZA 1RT6A 1WAJA 4KN4A 3KTQA 4KFBA 4CESA 1QLNA 3UXPA 2HHXA 3HSTB 3CM5A 1L3VA 3QESA 1RT7A 2XC9A 4BWMA 5KFLA 4Q44A 3LP0A 1DTTA 4CF1A 4CJ3A 4FZXC 2F1IA 1LWEA 1BGXT 1HPZA 4IG3A 1GOBA 4CEAA 5L1IA 4J2DA 3PNCA 3KK2A 3HP9A 5KFEA 2YNHA 1JXLA 3Q8KA 3MABA 4F93B 1DLOA 5L1JA 4I2IA 3ORYA 2YNFA 4M45A 1ZYQA 3ISBA 2KFNA 1HRHA 5DQGA 3QZ7A 1VSMA 3PW0A 1KVCA 4B9MA 3SUOA 4RPXA 3KLIA 4E89A 3H08A 5KFXA 1ZBUA 2NUBA 1SUQA 1ZQLA 3I0SA 5KG0A 4B3OA 5EWGA 1TAUA 2R8HA 1RBRA 3UPQA 4LSLA 1S1XA 2P51A 1X9WA 3UXOA 1VSFA 4R64A 3SI8A 1WSHA 1JXEA 7ICHA 1TGOA 2HW3A 4QZDA 5IIIA 4R65A 2GBZA 3QE9Y 4NCBA 3GV8B 4KHWA 5CYQA 4Q43A 7ICVA 2G8UA 3K59A 2IGIA 1S1VA 5J2BA 1KVBA 5L9XA 5J0XA 5KFZA 3ZSRA 1B9DA 3P1GA 2MUTA 2FBTA 3VN5A 2PYJA 3K4GA 3EYZA 4KHUA 2HVIA 4TUPA 4DU4A 2DTUA 2V4RA 3G6VA 3LAMA 4K4IA 4I2PA 3MR5A 1LAVA 2P1JA 4FBTA 4NY8A 2JLEA 7ICPA 2FBXA 2YV0X 4IKFA 4DL4A 2C2RA 4MQ3A 2FBVA 2BE2A 2ATLA 2JEIA 4DO9A 1C1CA 4F5QA 3RJJA 4ECZA 4Q8FA 1U45A 4CJKA 2PFPA 2HNZA 5J1EA 3SQ4A 4DLEA 3JYTA 3FYHA 3GQCA 3C6TA 3TFSA 3K75D 1T4GA 2F8TA 3ZSWA 3M8PA 3SPYA 3RMBA 1SL0A 2VWKA 3HPGA 4OJRA 3E2EA 3SQ0A 3LZJA 4ECRA 1BVSA 4ECSA 4NYFA 4OPJA 2OPRA 7ICNA 5J0UA 4FJNA 2RF2A 3AA2A 4C8NA 4CHNA 1KLMA 3DRRA 3QNNA 1NKEA 4DWIA 1XSLA 1Z26A 3OYNA 5J2AA 2D0AA 4ECWA 2FMQA 1RDDA 3DYAA 1F21A 2NRXA 1L3TA 4ED7A 4B9VA 2C28A 1HYSA 4ZTJA 1BIZA 4DOBA 3QEXA 3EPGA 1YTUA 2BCQA 5KFAA 1Q9YA 4IRKA 2MAXA 5DQHA 1EKEA 4OPKA 1T3NA 1ZQOA 5J0TA 2XY6A 4GXJA 4F3OA 3HPHA 4J9MA 2I5JA 4RQ1A 3RH4A 4CJSA 3ZD9A 1TL1A 4KB1A 4YFKA 1HUOA 3GFKB 5J2MA 3RB6A 3RJFA 5BOLA 3HVRA 3KHLA 1EP4A 2IMWP 5KFPA 4PGXA 1RDAA 2O4GA 4M9LA 1R0AA 4KLTA 2JEFA 4XA5A 2J6UA 2R8IA 2XO7A 1NJYA 4DU1A 4CEBA 5IIJA 3B0XA 1W0HA 3H40A 4J9PA 1NK5A 1MSWD 3RB4A 1B43A 2PI4A 2VWJA 1IKXA 1EETA 4I28A 5J29A 4NM1A 1T7PA 5C24A 3OYGA 8ICKA 1TVAA 5D4BA 1DGSA 4JWMA 5J0WA 3LWMA 4HCCA 1MQ3A 1UAXA 5J2JA 3QETA 2XY5A 3TFRA 4OGCA 4J9RA 1KDHA 1RT4A 4QW8A 3SV4A 5DB8A 4E3SA 3P5JA 3MEGA 3H4BA 3QNOA 1TKXA 1COOA 4RQ7A 1TKTA 2BHNA 3HPOA 1NJWA 4M04A 4FJ9A 3AVIA 4ED1A 4JS5A 4ZHRA 4QZAA 1QQCA 9ICOA 1XC9A 8ICIA 9ICKA 4Z0UA 4LZGA 5KFUA 1SZPA 3CM6A 2WOMA 3Q8LA 2QK9A 3C23A 3K58A 1MU2A 2ZE2A 2B21A 4CHPA 8ICTA 4EZ9A 2DPIA 4DTRA 5KFVA 4CEDA 2BPFA 4E7IA 1QSSA 2W9BB 2UVWA 3PX6A 2OYQA 4RW8A 3H8JA 4IFYA 3NGYA 3OYAA 1Y88A 4O3NA 1G15A 3MGIA 1BPYA 5D3GA 3U3GA 1XI1A 1U48A 1S97A 4CIFA 1WSJA 3JSMA 4F4WA 4KLSA 4RZRA 4FLUA 4DLGA 1Y97A 3TAMA 4RQ3A 5CZ1A 4B9LA 1ZQHA 4B9UA 2OWOA 4YN4A 4Z6FA 3TAQA 4UB5A 2GWSA 3OYBA 3L2QA 3HWTA 3PW4A 1X1PA 2IS3A 4I2JA 4FJJA 3GV7B 1KCFA 3VQCA 3LANA 2W9CA 3PR5B 2F1JA 4KLMA 9ICMA 3ZSQA 1SKWA 2BPCA 5IIKA 1S6PA 5HRRA 4FJLA 2RPIA 2X74A 3V6HA 1JL2A 5C25A 4CERA 4MF2A 3ZSXA 1A76A 1QSYA 4YR0A 1QTMA 3MXJA 3F9KA 5J2IA 4UB4A 4UQGA 4FXDA 4K8ZA 4OKJA 4QZ9A 1ZQXA 3F73A 2G8VA 2J6TA 3NH1A 4C8LA 3QZ8A 3GIMA 3IS9A 4YG2A 3T5LA 4W5QA 1S10A 1JXBA 1HUZA 4Z4GA 3KKRA 1QE1A 4CF2A 4FZZA 1LB2B 3CFRA 3O4QA 1HQEA 2IDOA 3OJSA 1BI4A 1KFDA 1XU4A 1ZJMA 4PA1A 3AVMA 1HYZA 1ASWA 3VQ4A 3V1QA 3NDKA 1S9GA 3MEDA 1RBTA 5BPCA 4F5OA 4GXIA 3ZDBA 1Z25A 3RH6A 3E01A 4P2HA 1N56A 3AO4A 2HHVA 1NK7A 2FLLA 4CEFA 3KJVA 3OHBA 4FM1A 1JLCA 1ZBLA 4KITB 3JPOA 4XUSA 2GV9A 4NYNA 1WSIA 4AHTA 4O44A 1AROP 1KFTA 4DS5A 1ZQEA 4IG0A 4KPYA 4JRQA 4DSIA 3RR7A 5KTQA 4W5RA 4QZCA 4FJHA 1WSFA 5J0PA 4IR9A 4ID1A 1ZQWA 1ZQAA 4CFAA 2H5XA 4FJXA 1J5OA 4CJPA 4ED6A 4HYKA 3KLFA 9ICFA 2MUTB 4IQTA 3ZSYA 3NGDA 2FMSA 3NH0A 1S9EA 4EYIB 1NK4A 2NRWA 4ZTFA 1ZETA 3HVTA 4J9NA 2WONA 3AVFA 4CF9A 3NGZA 1VSHA 1RDBA 4KRFA 4I27A 3C5FA 9ICJA 1D5AA 2FLNA 4EP5A 1ZQNA 3D0PA 4O5CA 1WCNA 5DGAA 1JLEA 3RBDA 1WCLA 3H7IA 4B9NA 8ICSA 3QEBZ 3SI6A 9ICBA 1SV5A 1ZQQA 1JLQA 2PFQA 3B0YA 4QWAA 2BQ3A 3TAGA 8ICMA 4PHAA 1D8LA 1S0NA 3RJHA 4CJWA 3OYCA 3DLBA 2R7YA 3LWLA 3OHAA 4I2BA 4UB3A 3LP1A 4ECYA 4RW7A 3KHGA 4AHVA 3MECA 3L3UA 3AVJA 1LW2A 5HHHA 1N48A 3V9UA 4H4MA 8ICGA 1Q9XA 2ZJ8A 3B6PA 4R63A 2KZMA 5HNKA 2PFOA 4MFAA 1IH7A 3QIOA 4KLQA 4CJEA 2W9BA 4ED8A 1PZNA 4YP3A 8ICRA 1S6QA 2IAJA 4CK3A 5L1LA 2YHAA 1BHLA 3PMLA 3VQAA 3AU2A 2PZSA 1UWBA 2W8LA 3DLGA 3QO9A 5CY4A 3VQ8A 9ICUA 4M9GA 4KLHA 1C6VA 4K4HA 2HB5A 3H8SA 4NLKA 4I2AA 7ICIA 3AA4A 4FK2A 4F4KA 3LDSA 3IAYA 3C2KA 3ZT0A 3EPIA 7ICOA 5KT3A 2A1JA 4FLTA 3JPNA 4XRHA 4M9NA 2AQ0A 1IO2A 4CFDA 3VQEA 1D8YA 3RAQA 2W9AA 1RTHA 3C2MA 5SZTA 2PXIA 2AGPA 5HMMA 2KZ3A 2XRIA 2XY7A 4M6WA 3CYMA 2OPSA 4RW4A 3C1YA 4J9OA 5KT7A 3MGHA 1IKYA 2ZUDA 3MR2A 4ELTA 3QLHA 4B8AB 4YD1A 4DL3A 3AVHA 4CEEA 2NRZA 1WNSA 4UB1A 1NKCA 4HHTA 4KLEA 3G10A 2A1RA 4O3SA 4I2EA 4CFCA 4E7KA 3RMAA 4E7HA 5DLGA 4RG8A 2VA2A 1A77A 5KFNA 1D9DA 4MFCA 4AILC 5IILA 4DL2A 2X78A 3I8DA 1LV5A 4I2FA 4E7JA 4MEYA 1S76D 2JZBA 1A5VA 4DQSA 4GLXA 4PUOA 5J0YA 3ZDAA 1RT1A 4AHCA 2KW4A 5DLFA 1TKZA 1KVAA 4O3QA 4NLGA 5I42A 1TKDA 1TVRA 3AVGA 4FLVA 4M42A 1EXNA 1BPXA 4LY7A 2M9NA 1RILA 1RDCA 4F50A 1XSNA 4FBUA 3K5OA 1IXRA 3KLGA 4RU9A 3JPQA 5KGXA 5DK5A 5HMLA 1NJZA 5L1KA 4E1MA 3PW7A 1ZQDA 4FW1A 8ICFA 1ZQYA 3HM9A 4ECTA 3V9XA 3OSPA 1JIHA 2E6LA 4Q5VA 4DQRA 4ED0A 9ICSA 3TI0A 1EX4A 3NHGA 1XHZA 4CK2A 3RH5A 3HL8A 1LWFA 5KFHA 4CJRA 1ZQBA 9ICEA 4J2EA 2BQRA 3HYFA 3AA5X 3MXMA 4M0AA 2W9CB 4W5OA 4I2HA 3QERA 4EEYA 2W8KA 3I0RA 5JUMA 3IRXA 1C0UA 1S0VA 5HROA 3LP2A 8ICXA 3ALYA 3O4NA 4XQ8A 4KO0A 4JUZA 5I3UA 4B9TA 3U3YA 3SQ1A 4QAGA 5FROA 5C5JA 4QZGA 4AHSA 4DSLA 3RJEA 4F5RA 1S1WA 1B9FA 4CK1A 2XCPA 4BDZA 4KAZA 2BKEA 2VANA 4DTOA 5CP2A 3HW8A 3VQ5A 4EBCA 4HUEA 2HHTA 5J2PA 4F2SA 2W42A 4Y1DA 4TQSA 4ECVA 3V7JA 2ZD1A 1VSKA 1BI4B 2D5RA 2C22A 3KHRA 1CXUA 4YMOA 4J9SA 4NXZA 4RT2A 1RBUA 4RQ0A 4O4GA 4BGDA 2RKIA 3SUQA 3ZDEA 4W5TA 1CXQA 1LWCA 9ICXA 5DKWA 2D0BA 5D46A 3BQ1A 3AO3A 5IIMA 2Z1JA 3M8SA 2PI5A 2BCVA 1U49A 7ICUA 3LZIA 4FJGA 5DG8A 4AH9A 3DOKA 3D45A 3ISNC 3L2VA 1RNHA 9ICPA 4TUSA 4CHZA 3KLHA 3AA3A 4FJ5A 3DMJA 1B22A 3AVBA 3KHHA 3SCXA 1RXWA 1RTDA 2R8KA 3JPTA 4Q8EA 4Z4FA 2DFLA 3OYIA 4CIGA 4LSNA 4R66A 3Q8RB 4QW9A 4Z4HA 1K1QA 1YT3A 3HK2A 3OYJA 3AVLA 3KK3A 2A1SA 2IHMA 2OA8A 8ICOA 2AJQA 1NKBA 2DFEA 4I2QA 3V6KA 2ASDA 3GV5B 4Z4EA 3V9SA 3JPRA 1RYRA 3V9ZA 2BQUA 5J2GA 1CZ9A 4X5VA 9ICGA 1L3UA 3KD5E 4EZ6A 5CB1A 1KSPA 2C2DA 3DRPA 1KFSA 2AGQA 5DG7A 5J0OA 7ICJA 2ZQBA 4KMUA 1YVUA 2YNIA 4N41A 8ICUA 4CHYA 2ASLA 3C5GA 2EX3A 4DOAA 2JGUA 5DB9A 2LSNA 3ETLA 1JLAA 3EZ5A 5CR0A 3OY9A 1IKWA 3BQ0A 1IM4A 3VQ9A 4FZYA 3O3GA 4M3YA 3QEPA 3M8RA 2DFHA 3RRHA 4Q45A 2FPKA 3AVAA 2LYHA 1BIUA 5KFCA 3WNFA 3PV8A 4GC7A 4MFFA 4JWNA 9ICVA 1NJXA 1FKPA 1BQMA 5C42A 4EBEA 5KG1A 5HRSA 4KLIA 2EHGA 4QZBA 5FRMA 2VG5A 4MF8A 9ICTA 1UA1A 5HRPA 5KFJA 3PO4A 2OZSA 1TK5A 9ICQA 2A1JB 1FXXA 4G1QA 4CJQA 3HO1A 4YXMA 2W9MA 3ISCA 4UAZA 4F5PA 3G0ZA 4BDPA 2FC0A 2BDPA 2XY8A 4NCGA 5SWMA 3T19A 3TR8A 3C21A 1S1TA 3OS1A 3EY1A 3V4IA 4O0JA 3UQ2A 4I2CA 4M6WB 8ICPA 4G3IA 4PWDA 3V7LA 1J9AA 4I2GA 3TAEA 4BACA 4E1NA 1XHXA 7ICGA 1TFRA 2ETJA 3SZ2A 4FO6A 4DTUA 3GIIA 5F9LA 3V72A 3OYEA 1RBVA 1HMVA 4CGGA 4LH5A 4N56A 4MFBA 5CZ2A 2HMIA 2G8WA 2UVUA 2BCUA 1REVA 4N76A 4DF8A 3AV9A 1BISA 3NH2A 2NRVA 5HLFA 3DLRA 4I9LA 4N5SA 2HNDA 2JZBB 5KFQA 1RPLA 3B6OA 3K5LA 4M9JA 3OYDA 4RNNA 5KT6A 3RAXA 4H4OA 3MFIA 3VA3A 3OGUA 4I9QA 4JV2A 2YNGA 8ICJA 1EXQA 1S1UA 4CGIA 2XHBA 1TK0A 1BPBA 3TARA 2JEGA 9ICNA 3V1OA 3RJKA 3MR6A 3ZDCA 7ICKA 4IBNA 1ZBFA 4JLHA 4CHQA 2P5OA 1RYSA 4PQUA 4FW2A 5KI6A 4KHNA 5DG9A 4J2AA 1TV9A 4P4MA 4NLNA 2KZZA 4O3PA 4RQ4A 4M3RA 3VQBA 4LH4A 2YKMA 7ICSA 3T3FA 1HNIA 3C95A 9ICCA 1TAQA 5CHGA 4CF8A 8ICZA 4GMJB 4UBBA 2V9WA 3MR3A 2HHQA 3H4DA 4DTJA 3CFPA 4DOCA 2R8JA 2P6RA 3S3OA 7ICMA 4F4XA 2AQ4A 1RBSA 2HNYA 3VQDA 2PY5A 2BR0A 3UIQA 1ZQFA 3RRGA 5CYMA 4I2DA 4DQIA 4LD0A 4ECUA 5EWFA 2FPLA 2J6SA 4H8KA 3O3HA 7ICLA 1RTJA 7ICFA 1VSLA 2F1HA 3EW9A 4F2RA 4CJLA 3JPPA 2OPPA 2Y1IA 4ELUA 2YHBA 1JKHA 4EP4A 4JRPA 3ITHA 5CJ7A 3TANA 4FM0A 1RXVA 1VSEA 8ICEA 4CGHA 1YTAA 1U4BA 4FJ7A 2HHUA 4CJFA 1SL1A 5FRNA 1ZQJA 3A2FA 5KFRA 1DOQA 3FFIA 3OYFA 3T5HA 3U6FA 2OZMA 3WNHA 3Q8SB 7ICQA 1CUKA 5J2CA 3VQ7A 2JEJA 4UBCA 3N97B 8ICWA 4I7FA 4OKEA 4AHRA 3PX4A 4CEQA 4L8RB 4DSKA 4DL7A 4CGFA 4RW9A 3MEEA 5FDLA 3TABA 2G8HA 2ISPA 1BCOA 4YXJA 4DMNA 1NOYA 4O9MA 2V4QA 5HP4A 4B08A 5KG2A 2XCAA 3OJUA 5EWEA 4KTQA 4XIUA 4FS2A 3KIOA 2IA6A 1IG9A 3RB3A 3C94A 1HJPA 3DRSA 4R8UA 4P4OA 3SYZA 4ECXA 3AO1A 4KB0A 4YFUA 2ITGA 3ZSZA 4O3RA 1KRPA 1DTQA 4P4PA 4KLJA 3IM1A 4KHQA 5JS1A 3THVA 1H38A 5DDMA 4RT3A 1CZBA 4KHYA 3VQ6A 4M41A 1QS4A 3ULDA 4DFJA 1I3AA 1BPDA 4YR3A 3OYLA 4ED3A 5J0SA 2YKNA 2ZTDA 4C8MA 1NK6A 5KFWA 1S0MA 5KFGA 7ICEA 4QWBA 1XS9D 1HNVA 4M3ZA 4QZEA 4E7LA 4F3TA 3HT3A 5J2QA 1VSIA 1BPZA 4F5NA 1ZQMA 3ZT2A 1LAWA 2BCSA 4W5NA 5KFMA 3ZD8A 3ZSOA 3CQ8A 1TK8A 4KI4A 4CJVA 2DFFA 3S3MA
chains in the Genus database with same CATH superfamily
2Z4PA 2BW2A 1FK9A 2F3JA 3MFHA 1RK8A 2YNIB 3CTRA 5AHXA 2C3OA 1K9MO 5DO2A 1VFJA 3DLKA 2X6NA 2P2CB 4X4QA 2DBBA 3QFUA 3N01A 3OVBA 3G8SA 3OYKA 1VQ5S 4OHZA 3LALA 3CJ9A 4HTUA 4IQWA 4NPOA 3RBEA 2ACMA 5C12A 3UMGA 2DPNA 2ZJRL 4AHUA 2QA4G 2Q3PA 3VGVA 1RGIA 1OXJA 1ASVA 2IBKA 3B9JA 1ATSA 3CERA 4CGDA 4KLDA 1RISA 5DB7A 4KV8A 5C42B 4LF5F 2CRLA 1SZ2A 1BCMA 3A8KA 3N5FA 4G9ZA 1SWVA 4C8KA 2HRUA 3PVXA 2YBVA 2VV5A 4F0HA 4YDXA 4GXKA 2N7CA 5IINA 3KUEA 4DPYA 1V9PA 4DFMA 3I87A 3UI3A 3Q8MA 3A5NC 3PNIA 2Y0SD 4DTSA 4HACB 3DDKA 2V67A 5AQGA 1Q79A 2OD4A 3PDNA 2FJWA 1M6YA 1L8LA 3V4IB 1KEJA 3LA0A 2O4IA 4PWDB 4BRLA 1TL7B 3W60A 1T03B 1J6ZA 1RBLA 2J0QD 5KFBA 4YOXA 4TSXA 3CC4N 5KFTA 4QR1A 4DTPA 3CJBA 3CDWA 4QBUA 1NDPA 2GIRA 1TL3A 1CLFA 4K4XA 2QE5A 1MMDA 2EWHA 2G2ZA 4BROA 3G9CA 3SAHA 4GVMA 1REVB 1FFSB 3UD4P 4K4ZA 1O51A 3O9UA 4LZDA 3GONA 4OI4A 1HR0F 1XO0A 2J0WA 3NXZA 4Q0BA 5A8RB 4QWEA 3OS2A 1Q8LA 3H42A 3ZSVA 3NS7B 3TZXA 2MQLA 3A13A 3VCBA 1Q8IA 1J27A 4FLXA 4ZLNA 5D49A 4BRFA 3Q83A 2VBXA 4ED2A 3J7YI 3IDHA 4C8OA 2VKZG 3TVKA 2NYIA 3KLEA 2YKAA 4P72A 2LU2A 2RUGA 3PIPL 4ALZA 5ALKA 4BRGA 1PYSB 3BO4A 1C4AA 4RPYA 2XSFA 3E9LA 2R7OA 3OL8A 1HUXA 2XZDB 1CEZA 4X4RA 1BL3A 1HNIB 3IBFB 4JI0J 1WSRA 3CO0P 2HMPA 4BQLA 3ONQA 1VK0A 1IM6A 3CC2N 2I1RA 1BNPA 3CC7S 5HMYA 3W9JA 4OPAA 4ANEA 1ULRA 3ZI4A 1GLEG 3NAIA 4JI8K 1T3OA 1RCHA 2HVDA 1WC3A 4QZ8A 1NNEA 3WK9A 3D1OA 1SV0A 1VRTA 3L4QA 1B64A 1Z19A 1IR1A 3HZ6A 5LMNK 2XHWA 2XGQA 4O5EA 2F8SA 2IHNA 3VAMA 5KG5A 3C2LA 4FPAA 3TJ9A 2F4VJ 4U6PA 2WF5A 4AL6A 2KE7A 3UMBA 1JKHB 2IOCA 3SSRA 2F76X 2CG8A 1RDWX 2H3FA 1LOUA 3RU0A 2FHKA 3CJ7A 1TV6A 3DXKB 4GV6A 1I39A 3V6JA 5KAKA 4TUQA 4KX5A 1HWJA 3FEZA 3AY0A 5ALIA 3TACB 1SCJB 5IZHA 3QJLA 1VISA 4M3XA 1B0VA 1OMSA 5L46A 4KAIA 1EARA 2IJNA 1B0TA 1K0VA 3BZKA 3M9OB 4USUA 1FCAA 3PHTA 2UUAF 1XR7A 2H5JB 2XMUA 1U24A 3RMCA 3HHLD 3QEAZ 5KG4A 3PX0A 2NRTA 2FDNA 2ZG6A 2VFVA 2RN2A 1JUDA 2IM0A 3P45B 5GIOA 4QWCA 1NK0A 4DV4K 3H8MA 3DRSB 3HTVA 2AZ3A 4B1UB 2ASOA 1DTQB 4NXNJ 1U6ZA 2HQGA 4FL9A 5ALFA 8ICQA 1DQAA 1N62A 2CAJA 3MUVP 1NK9A 3WUHA 4K4YA 3SQ2A 3R7SB 1BY9A 1M5HA 3TZYA 4NX9A 2HZAA 2R2UA 1HPMA 1HNVB 3NRZA 1U9LA 4MK9A 2OXOA 2G8KA 3GJSB 3WZ0A 2EK1A 1M5PC 5AQIA 3H2UB 4M3WA 5AKJA 4US9A 2DNKA 5HVHA 1I1GA 4AFFA 5DM7L 4DS4A 1EX8A 2D9PA 5AT1B 1NGFA 2W4CA 1TUUA 2VA8A 1W97L 3K2PA 5M2PA 2I1QA 5KQDA 2QKBA 3VEVA 2VBYA 2ZNYA 4RNOA 2UVVA 1TMJA 3UN5A 7ICTA 1GOCA 3TADC 3BSCA 5BJRA 4TYAA 5AQJA 4MIWA 4YNQA 3MGVA 4K4GA 2ASMA 1X5PA 1C0GA 3KKFA 2YKPA 4CCHA 2RHFA 2ZKUA 3C6UB 3DLEA 5K20B 4U67L 5DDRC 3NTUA 5AK4A 4IOAL 2DIUA 2WF7A 2C42A 4CTAB 4YDDB 2GGPB 3WK8A 5M1PA 4PL1A 5A2QU 2GHWA 4WQ5C 4A4JA 2D3ZA 3A5LC 4NRTA 3Q2TC 4OZ3A 1JMSA 2I6WA 4QR0A 4RQ5A 2QJ3A 3DI6A 4NLOA 3GE9A 4DSEA 5DBAA 5D4NA 1AUDA 3VQQA 3OTEA 4L74A 2KT5A 3CETA 1GX5A 1C0TA 2AWZA 2F7VA 8ICYA 1B92A 5EY4A 3BP8A 4MKYA 2XNQA 2L3MA 1KEKA 5ETQA 2C2EA 4J9KA 5ADZA 2P9KB 3F2CA 3UD5A 3DOLA 4QS9A 3KDNA 1U1NA 4YD2A 3NVMA 4K4TA 1ZRMA 2CPYA 5BXIA 1ZTTA 2LU1A 4CECA 3VETA 1XUPO 1HI0P 4QYZK 4ZJLA 4P2XA 3DXSX 1N32J 1ZXIA 4FM2A 1N8RO 4PHDA 1S57A 3S3NA 1R0BG 2KICA 3OFEA 1QHTA 4EYHB 4PJ0U 4DUYK 1IBMK 4HL9A 5F9NA 3WXIA 2DHAA 1XNQK 4NWBA 1ZBIA 5GTIU 1YWXA 2VWBA 4HVJA 4C97A 3GU3A 3A3PB 3WXMB 2IVPA 3FGVA 3AD7C 2HNZB 2P9NB 3K8VA 2ZJPL 3PSFA 2QFJA 5DBCA 4BE2A 4ECQA 1JLBB 5KOWA 5K4LA 1FJEB 2B4OA 3SUPA 3JXUA 5AQXA 1U1LA 2XMKA 2DR5A 3OYHA 3L5KA 4KLOA 2X6SA 4KLLA 1DRGA 2DHHA 2W2NP 1RWKB 1PAEX 3DM2B 4IDKB 4NZ0A 3N5BA 1QQOA 2Q0ZX 1S12A 3U8XA 3K5PA 3V6DA 3DRRB 4DQQA 3TP2A 3THWB 4FLWA 2A0FB 5D0RA 3M6XA 4F0MA 1GMWA 3CMES 2JWKA 1JL1A 2UU9J 2E20A 3IA0A 1TYQB 2I9GA 2X1BA 3UDEA 4M5HA 4CE9A 1MDUB 1GXTA 3AU6A 4CRXA 4TU9A 1T8EA 3LM2A 3MXIA 3GILA 4BG9A 4CFBA 3MBYA 5GMDA 1NGDA 2DRAA 5B7WA 2J76E 3KK1B 4BRHA 1P1LA 4BRMA 3WKEA 3SMZA 1XTZA 1D3WA 5A0YB 3HJFA 3W3DA 4CEZA 1ZQTA 3TUJC 1RJJA 1U0HB 3U1LA 4KTZA 3EXYA 3SCKE 2BGWA 4KYZA 5AE1A 2Y9TA 1R0AB 1RTIB 3T5JA 1ZRNA 2NLWA 4YHHF 2LMIA 4CO5A 1ZQSA 1S3XA 3HT0A 3AT1B 3CCRS 1LW0A 4XH1A 1XWLA 2DJWA 1X4AA 4KN4A 4KFBA 1F3FA 4CESA 1QLNA 3RFAA 3K89A 3VHQA 1RT7A 5ALHA 3O6WA 4JNEA 4Q44A 4K42A 4CJ3A 4FZXC 2F1IA 2XTJP 3ZLJA 2Q79A 4EMDA 2MB0B 4CEAA 1PCAA 5L1IA 3PNCA 3KK2A 2G5HB 2C2NA 3D2EB 3GYXB 1F5BA 2YNFA 2KT2A 4QS8A 2KFNA 3ISBA 3QZ7A 3TRGA 1IBKF 2FJAB 4DR5K 4E89A 2NUBA 5AQRA 1SUQA 1E4FT 3F0NA 3I0SA 1N5SA 2HHHJ 5MLCQ 1S1XA 4H5NA 1BUPA 3TW0A 2BJ9A 2OUGA 2P9PA 5LMUJ 1KQSM 2K8BB 2KD1A 1WEZA 1A9NB 2DF4B 1TGOA 2KHVA 2HW3A 1ZM4A 3BS5A 4QZDA 1NGGA 5GAGU 3GV8B 2W01A 7ICVA 1O13A 4L3QA 3K59A 3H20A 2MSSA 5J2BA 2ZDPA 4X4NA 3ZZYA 5J0XA 5KFZA 1GTEA 4TY8A 3J80Y 1NLKL 1VBZA 2MUTA 3VN5A 3AFGA 3K0JA 4ID5B 3QIDA 4NLUA 2OMOA 1SH0A 2OEJA 4DV0F 2WFAA 3D2FB 4DU4A 2EXUA 2V8GA 3AGRA 1ZM2A 4F67A 3G6VA 2Q6CA 1AFIA 4CE6A 2JLEA 2K3IA 1MWYA 1QZ5A 2FBXA 2DHGA 4NYZA 2QV6A 5BR9A 4U8YA 3KZXA 3US5A 4ANCA 5M1NA 2FBVA 1T0TV 1GLLO 2ATLA 4JD2A 4F5QA 1TZ0A 3N28A 2QWOA 2DNOA 4G1IA 4LUBA 4CRJA 2YX4A 3UFCX 2UUCK 4DCOB 4CJKA 2PFPA 3D67A 3W66A 4WQ4C 5B0EA 3BGFA 3SQ4A 4CW7B 3C6TA 4WK1A 5AQOA 3HPGA 2JH1A 2BYCA 1QY7A 4ECRA 2YTCA 4NLWA 3DLLQ 3WHIA 4FJNA 5HJYA 1RAOA 4NXMK 1N2XA 2PDAA 1BWVA 1KLMA 2FVRA 1KONA 4DWIA 2XZTB 3TSQA 1R59O 2VOOA 2AXTU 4B3MJ 4B02A 3LOUA 1F60B 3ETOA 1L3TA 4B9VA 3GG1A 1HYSA 2FF6A 3QWUA 4ZTJA 5FPMA 3J7A1 3CXCM 3EPGA 5I3PA 4ILMA 3MI7X 4AM7A 2MAXA 3C14B 1EKEA 4L3NA 1S72S 1KL9A 4IG0B 1EZZB 1HWLA 4OL8A 3HPHA 2I5JA 3RH4A 3ZD9A 3ZC4A 2VH7A 1HUOA 1RE1B 5F8IA 3K9JA 3BREA 3SQGB 3Q2SC 5BOLA 3SDEA 4WKYA 3KHLA 2XG8A 3EL2A 1EP4A 3H0PA 4UW2A 4I6MB 3JQJA 1RDAA 4JKHA 1VDHA 2HBYB 3BDEA 2N3OA 3THXA 1SB3C 3IV6A 3RW6A 2XO7A 5AQNA 2WHOA 1PGZA 2B56A 4LBPA 4J9PA 4NLYA 1B43A 2GLEA 1HR0J 4ZK7M 3NBPB 3VF4A 3LGMA 4OV1A 1TU0B 2CQDA 2W3RA 3OYGA 5JU5A 4WTYA 8ICKA 4H5TA 1OYDA 2RUSA 1TVAA 3TVZA 3IGVA 3SQOP 3LWMA 5ALMA 3AN1A 2KNJA 1UVNA 3QETA 4LF7K 1RCXB 4PHTX 4P52A 1SQFA 4QW8A 4FWKA 4KH5A 3G96A 2BJ1A 3QNOA 4DX5A 4I6AA 4CT9A 4B1XB 4JS5A 1G1XA 2CPDA 1QAIA 1RBAA 2VG6B 3LP1B 4A8EA 1LKYA 1RHQB 1VYAA 2LBOA 5J2NB 2XBPA 3C28A 2K4IA 3Q8LA 2WOMA 3CHWA 1OH7A 5E3PA 3C23A 4CHPA 1IBLF 3NY0A 4EZ9A 3T1YJ 2BJ3A 2NPFA 4B1WB 4B3RF 5KPZA 5AZIB 3HBTA 5ALNA 3J81j 2D3O1 3QU4A 2Y8WA 4Y0FA 3MHYA 1N33J 2DKOB 1YRXA 1Q82T 3NGYA 3OYAA 4O3NA 2F9JA 3M8YA 2CRXA 4TKTA 5D3GA 1HQUB 1U48A 1Q95G 3OV7A 3BPDA 3POTB 3IXQA 4RZRA 4ICLB 4WFBL 4RQ3A 4B9LA 2OWOA 1RUSA 3R5AA 4I64A 3OYBA 1VQKS 3PW4A 2NCKL 4J7CA 2IVOA 1PJ6A 4ZVSB 3GV7B 3LANA 3ALRA 2Z8QA 2ILYA 3PR5B 1G7CB 2JHEA 1R6YA 4DU8A 1AW0A 2AD9A 1WOQA 9ICMA 3ZSQA 4DV2K 2ZZTA 3O3LA 4RW4B 2X3DA 2KM8C 2IIHA 3MPDA 3C16B 3MPVA 2X74A 1VIOA 1QSYA 1QTMA 5J2IA 4UB4A 1HIYA 4LF6F 4K8ZA 4N77A 5T7LB 3VEZA 4QZ9A 1DTTB 3RYLA 1QAXA 1LWEB 3NH1A 4K43A 1HPZB 3GIMA 1OKJA 2HGLA 3T5LA 3AAQA 1DLOB 1Q7LB 3D54A 1QE1A 3NNAA 4CF2A 3GCWP 4FZZA 2GIFA 4I67A 4K5RA 3OJSA 4DR3K 8AT1B 4PA1A 4JKGB 2AJ1A 4Y2KA 2AX0A 3AVMA 4M8LA 1HYZA 1KP6A 4ED4A 1VR6A 1I94K 4GXIA 1Z25A 3E01A 4A5AA 3KG4A 4RWXA 1N56A 4WFAQ 2UYTA 4CEFA 2FLLA 3IP4B 5H2FU 3THTA 4KHRA 1BLUA 1JLCA 3KFWX 4KITB 1ZBLA 1H7WA 1T6CA 4AHTA 1KFTA 1ZQEA 1R8PA 4BR9A 4DSIA 3RR7A 5KTQA 5GAEI 2OANA 3L6QA 1OO0B 4LFAK 1QH9A 3Q22A 4R25A 1WSFA 1DK3A 3JQKA 5CYQB 4EFHA 3SCLE 5EE1A 4CGZA 3QRPA 3R9PA 5CHCB 4CJPA 2F4FA 2I6XA 3NGDA 2FMSA 2W43A 1YF5L 3KWIA 3ULEA 2OGUA 1NZBA 2IM3A 4I2PB 1RBOB 2Z57B 2D6FC 1H0HB 2A2CA 4AL7A 2L5YA 9ICJA 4EP5A 1C1CB 5DGAA 3CDAA 3IBWA 2Y9HA 1RAHB 5I3UB 1VLOA 1SV5A 1JLQA 2E29A 3L3CA 3MWPA 2ROPA 3B0YA 2ZHOA 4FZMA 8ICMA 4PHAA 1D8LA 2HS3A 3OYCA 4GVLA 3M8PB 2R7YA 3OHAA 4MYUA 3CF5Q 2DNYA 1KQSR 4OX9J 2OPRB 4AXJA 3ATVA 4AHVA 3L3UA 3IG5A 3OUYA 1SPBP 5IV3A 1N48A 2QLXA 4H4MA 1Q9XA 4DL0C 4OI0A 1VC6A 1SGGA 2KYXA 2RAQA 1KD1T 2COLA 2MHNA 4GVBB 5B0BA 1NSAA 2DB1A 2FVCA 1PVQA 3WU2U 2ZHAA 3A3NB 1LWCB 4LR8A 5FLXY 1YI2S 3MCNA 1NAQA 1KKHA 3M1VA 1KQKA 1VQ7S 4LBHA 1KAYA 3DU6A 2IRUA 4ZPBA 2PZSA 5CY4A 9ICUA 4KLHA 4PKDB 4ZLJA 5AQWA 1RHRB 4I2AA 1X3MA 2IVNA 5J2MB 3ZT0A 2WTUA 4WP8A 5KT3A 4FLTA 1FDDA 4JKFA 3MMJA 5C10A 1KS2A 1HHQA 2D3DA 5C15A 3VQEA 1NB7A 5EUHA 1VJQA 4BRKA 2O5DA 4USWA 2KB2A 2PXIA 5HMMA 2KZ3A 3TR5A 2XY7A 1W7WA 1RSCA 3CYMA 1FDBA 2RQMA 3C1YA 1IKXB 1EETB 3MGHA 2DNNA 1U7LA 2ZUDA 4ELTA 3U1NA 1N0UA 4DV1J 2UV8G 2FZCB 2QFIA 4KC5A 2QLFB 3G10A 1NEEA 4YDUA 4I2EA 2M8HA 4E7KA 3RMAA 4P10A 2LXIA 1XN9A 5KFNA 1D9DA 1VBXA 1RT4B 4MFCA 5IILA 4EX7A 5L39A 2XS2A 4NL5A 3CXCR 5E79U 1YG0A 2W04A 3I8DA 4I2FA 4C2MA 2D8CA 2ZWOA 4LRFA 2XVTA 2JZBA 2E9ZA 5AK5A 3KZIU 5DLFA 1XMQK 2E1ZA 3NVZA 3KYLA 2H4YB 5I42A 1IR0A 3UN2A 3D1HA 4LY7A 5AQVA 1U8SA 3MOJB 1LVHA 3HKZC 3OXLA 1FRJA 4MO5A 2YPZA 1N5XA 4EELA 4RW8B 1QVGM 2E5LJ 3S41A 2RD5C 5KGXA 1NJZA 2ZBPA 3AD9C 1S72N 3TTCA 3QPIA 1SS6A 3JSMB 1ZQYA 3DHWC 3N9UC 3J7YU 3FGUA 4Q5VA 1RKJA 4PAAA 4DQRA 4ED0A 2O01C 1EO1A 3VVUA 1NPKA 3FZFA 4OJLA 1Y7PA 4CK2A 3CCSS 4CJRA 4XDDA 1K8AT 2E66A 3HYFA 3AA5X 5EXWA 4W5OA 4I2HA 3VESA 4EEYA 3I0RA 3IRXA 5LT5A 1C0UA 1XC3A 1SI9A 8ICXA 1F5SA 3IC1A 2K2PA 3MK6A 3CMAN 3O4NA 3BYPA 3KBBA 3MMAA 2PMWA 5AQZA 3OR2A 4JI8F 2HVEA 4XQ8A 4YY3K 2B9EA 4K4UA 5EE9A 3SQ1A 1MMLA 1M5VC 5LSRA 2W2OP 3M2UB 4YOWA 3NMRA 2LQJA 1B9FA 5LMNF 1VQYA 4BDZA 1SV4A 4KAZA 2VANA 1Q53A 2FQQB 4DTOA 1YJRA 3VQ5A 3IM9A 4EBCA 4X84A 5JJBA 1WC4A 1HA1A 4TQSA 4ECVA 1RI7A 2ZD1A 1X8DA 3U7JA 2D5RA 3T79A 1N61A 4F02A 2RS8A 1FXDA 1U2VB 1S9GB 3PSPA 2QGFB 3SUQA 1S1UB 3ZDEA 2QX0A 3C46A 4IO9Q 4BBYA 9ICXA 2DGWA 2D0BA 3CJQA 2B0CA 3FR0A 4YB6A 1VQLS 4EO6A 2GMHA 2HOEA 1P27B 7FD1A 3M8SA 2VD3A 1LCUA 1OJ4A 4DX8H 3CGIA 2CQ2A 4O44B 3TA2A 4KE5A 4AH9A 4JI6J 2GIQA 2YX8A 4NRUA 4DV0J 4C4RA 3DMJA 2KVSA 1B22A 1L3KA 3KHHA 1IWAA 3GFYA 3HM8A 2R8KA 4DV4F 5AJ3J 4LSNA 3BV8A 3S6JA 3W2VA 3KLFB 3C3LA 3Q8RB 4QW9A 2Q43A 4Z4HA 3PM9A 4TLRA 5GADP 4M7YA 1S9EB 1YT3A 1X0FA 2U2FA 3AVLA 4DR7J 3R9KA 1IXKA 2Q66A 5ALPA 4RO0A 2E1RA 5ALWA 3OPKA 2OA8A 5C7PA 3QB0A 3H5UA 3A3OB 3GV5B 2UXCF 3ICLA 3EMTA 5J2GA 2N7YA 2F44A 1D1UA 5D77A 4A8SA 2YMPA 4WZMA 2IYIA 4IH6A 3SAFA 1RTJB 1HWUA 3GMGA 3SENA 1CSJA 1KSPA 1OPIA 2AGQA 1HD0A 5DG7A 5J0OA 1YVUA 2VYPA 4XK8C 2VJ4A 5ETVA 4N41A 2Y9UA 2QLJB 3DLLL 4KMOB 3EE3A 1LXJA 4RBVA 2ZBRA 5DB9A 1WUAA 2LSNA 1TQLA 2Z58B 1VQPS 1P8ZA 4IYQA 2GWKA 4OJPA 3FFIB 2F77X 4HH0A 1ZM9A 2R4FA 1IKWA 1ZAXA 2BE9B 4KGKA 3VQ9A 1Q82O 2H5EA 2WVCA 3M8RA 2DFHA 3ZZRA 4MIAA 5FDLB 3QUTA 3AVAA 2LYHA 3WNFA 4GC7A 1K5OA 2NV3A 9ICVA 1SJFA 1YKWA 5DDOC 3V5RA 1NJXA 1AUSL 4UT4A 5KG1A 5HRSA 4KLIA 1UWBB 3QO9B 2VBWA 4QZBA 4IFEA 2HLUA 4MF8A 1FNMA 1NZPA 2FC9A 9ICTA 2FZGB 5HRPA 5KFJA 3AD8C 2OZSA 3KOAA 1TK5A 4HVZA 3DCAA 3AJ1A 4CJQA 4G1QA 2E5IA 2OCEA 4YXMA 2VPWB 1RAFB 3ISCA 5AM2A 2WB4A 4F5PA 2N3LA 4BDPA 1HNWJ 2FE9A 2CUYA 2NXCA 5RUBA 3F5TA 2QN6B 4OX6A 5ETMA 3EY1A 4I2CA 8ICPA 4IKAA 3V7LA 4I2GA 2IRYA 2KJ5A 2DGOA 1U2RA 3TAEA 2OTLN 1NSPA 3QLHB 4E1NA 1WF1A 7ICGA 4O23A 1TUYA 1HNXJ 4FO6A 1PK1A 3SD7A 2EH9A 3D2NA 3V72A 4MK8A 5L8RC 1RBVA 1WORA 2HQ3A 3VEOA 2P5VA 3R1HA 3BS7A 1RACB 1VBYA 3V4MA 4MFBA 2GX9A 4ETXA 3H25A 3FUYA 2BCUA 1BDGA 4B3RJ 3M30A 3MM6A 4N76A 5FPNA 4DF8A 3AV9A 4JI7F 1UJ5A 2NYVA 2NRVA 2PE8A 5LXRA 4LREA 4N5SA 4DUYF 1IBMF 1YJUA 2O6KA 4ERDA 4DV5K 1QUPA 3ED5A 2RB7A 3UW1A 3RAXA 4H4OA 4X62J 2YX7A 4IFVB 2LP4A 2Q1LA 3VA3A 4Y2PA 2XI2A 4JV2A 4RLEA 2YNGA 8ICJA 4Y3CA 1Y3KA 2XHBA 2DNHA 4UY8O 1ZZFA 3TARA 3O4WA 2JEGA 3RJKA 1SV0C 2V2KA 2RRDA 7ICKA 2GA7A 2XWXA 1RYSA 4IJAA 3CPEA 4GKKJ 4UOCA 2YKMA 4CF3A 3T3FA 1Y5IB 4CBWA 3C95A 9ICCA 4LRAA 3B6BA 5CHGA 1FDNA 4UBBA 2HHQA 4XTTA 3M8ZA 3QRRA 3S3OA 2ZIUA 1YZ6A 2EDUA 2AQ4A 2V52B 3UDVA 4J9UE 2BM1A 4CI0B 1UAWA 4DQIA 2JR5A 2W6LA 4RKUC 5DM6L 4ZN1A 7ICLA 3ENQA 5D0HA 7ICFA 2J7KA 4OJ1A 2HQCA 3LYSA 4F2RA 3JPPA 5LSLA 4OYAA 4OYWA 2P9LB 3ENHA 4KGZB 1V3RA 2AP1A 1T95A 2GHPA 1RXVA 8ICEA 1YTAA 1U4BA 5CCLA 4ZPDA 3ILLA 5J2PB 1QVGR 1KD1O 1HFEL 5FRNA 4DU7A 5KFRA 4PABA 5K8OA 1XNSA 3QGHA 3T5HA 3UR3C 3WNHA 1ZOLA 2LXUA 3EO3A 2JEJA 4GMKA 1NH8A 1MLAA 3ZZOA 2CZ9A 3IR5B 3GDQA 4X65K 4PXEA 3MEEA 2KM8B 3I55N 4YXJA 4GKJJ 1CPZA 1NXIA 3QYYA 1V9OA 2GJIA 4O9MA 2V4QA 5HP4A 2VPZB 5CH7B 2EQYA 2XCAA 3IG1B 5EWEA 4Y2AA 1QZ6A 1S5LU 2IA6A 1WG5A 1F9EB 3CNQP 2ZZMA 2K60A 3RB3A 4CH1A 4DR5F 3PYFA 1HJPA 3DAWA 4X66J 3KLHB 4OI1A 3R5CA 2B5JB 4KB0A 2RHKA 4YFUA 1CJVA 2RS2A 1KRPA 2VQEK 1T9TA 4KLJA 3D6FB 4C3KA 4UZCA 3VPZA 4I6WA 2ADBA 4KSEB 4M41A 1VK8A 1N63A 3ID6A 4PL7A 5HL7L 1I3AA 1BPDA 3SR6A 2YKNA 1OQ3A 5ALDA 1YK9A 5KFGA 7ICEA 4QWBA 4I2QB 2GMJA 1SQKA 1U1RA 4F3TA 1SH3A 5J2QA 5AKIA 4K2JA 3H98A 1LAWA 2BCSA 2KG1A 3ZD8A 3CQ8A 2ZITA 4KI4A 3GWCA 2DFFA 4QS7A 3JPSA 3VAFA 4KREA 5HVGA 3SV3A 3IHQB 1ZQPA 3WQUA 5IWAK 2RQ5A 3K1ZA 5BREA 5EX3A 3NCIA 4PH5A 3LVVA 4CF0A 4QJVA 1CS4B 2K8CB 3ZT4A 1HBUA 5TZVA 1JLAB 3VQTA 5A8KB 3QUCA 2UUCF 4JK7A 5HO4A 4FYDA 1FRIA 3GCXP 3BZQA 3CWJA 2KKHA 4KKOA 1CBKA 2BPGA 3CULA 4H0TB 1GMWD 1RAGB 1KXPA 1RAEB 4E19A 2E9RX 4DTXA 4MYTA 5LJ3Y 3CSKA 3MX2A 2JLFA 4MMOA 1NO8A 2KJ9A 3E8OA 4J9VA 1KOHA 1S9FA 1BQMB 4ANDA 1KNZA 1V5IB 4NXMF 2GQCA 1XR5A 9ICWA 1AZSB 2LLZA 2VG5B 4NA1A 3OYMA 2RVJA 1K8AO 3VQPA 2RRAA 4M47A 1XSPA 3BGRA 3IR6B 4O55A 3W8PA 1PBUA 3Q8VA 2OI2A 5ALLA 4O5KA 2A18A 3AVCA 2MZRA 1NWKA 9ICAA 2C3UA 1HNZK 4JOUA 3VTHA 1L7PA 2AV5A 4ZP8A 1ZD3A 1HYVA 4NLTA 1BO5O 3S01A 2VQFK 2P5GA 1WDTA 4BXOA 2CFXA 2KTQA 4FJKA 1X60A 3A8YA 3WKDA 2QARA 3D5MA 2E7WA 1A5XA 5I9EB 4FS1A 2AA4A 1RGVA 1CRXA 1M5KC 3I6PA 4Z6CA 2JRSA 2LYVA 2M7SA 1X2IA 2VHGA 4M9HA 2KXHA 4OYIA 3FAHA 4DPUA 1UA0A 2CKWA 3OTBA 2QXFA 2MJUA 1JX4A 1NOZA 4P7VA 1W9HA 5KFOA 4YOEA 3LP3A 4RUAA 5AZJA 2HPUA 2E5HA 1Q16B 1VRUA 2IA0A 2L08A 3CCVS 4ZP6A 4BS2A 3GIKA 1R8AA 4FVUA 3OR1A 3PRVA 5B08A 2HNDB 2XMWA 4I56A 2WSCC 1NDLA 1SJ4P 1Z00B 3W64A 4K8XA 1NMEB 1GOAA 4KLUA 2ASPA 3NMUA 3M8WA 4I29A 1NNLA 2QRRA 3H5SA 4LF7F 1FJCA 2OSQA 1HD1A 1HKAA 3L8BA 5EU7A 3L09A 5J8YC 2DH9A 2QTWA 2PA3A 2H3EB 2Y1RI 2R9LA 3J7YP 4JS4A 5C2DA 4F92B 2KV2A 4PQUB 4BC9A 1FKOA 2IM2A 3P6YC 4GC6A 4I4BA 8ICAA 1RWWB 3H1QA 2FI1A 3QINA 3J81Y 3ZT1A 4FNIA 4JI3K 2HHPA 3W62A 2YH0A 2ZHBA 3MM8B 3ETMA 5KT5A 4QZFA 4PHPA 4IJNA 3C15B 3AMZA 3F2KA 2GH1A 3L4IA 2BX6A 3HSDA 4HH1A 2ILZA 2OEMA 2VG7A 2MKIA 4BWJA 1F6TA 3P96A 3QEWA 1NGAA 1HLUA 1T02A 3GJQB 5LOQA 1CJUA 4AL5A 2HI0A 4DF4A 2HNYB 4R5PA 5LMNJ 1MA7A 5C0YA 1E6YA 2DNLA 4K50A 3PY8A 1DAXA 3B8AX 3P4UB 2R2TA 2E2OA 3EGWB 1BQNA 3G86A 4EIAA 1X3NA 2M0GB 1WB9A 3N6MA 5DMRA 2GW8A 4V19J 4J9QA 2ZIXA 2ZUAA 4PYDA 4RW6A 5ALYA 4JI4K 4LFBJ 1KTVA 4DV2F 3ITHB 1RWMB 3NF8A 3A5MC 3GLJA 5K8MA 4Z4IA 2IC3A 4WE1A 3RMDA 1DBDA 4F8RA 4KN7A 3JQMA 3AUOA 3EZOA 4DPOA 4RTFD 2PEHA 4FVMA 4PY5A 1B70B 2ZEJA 5M1FA 2KH9A 1WG1A 4FXWA 2PA8D 4JV5J 5IS2A 2QKKA 3AJDA 3S6EA 2K7KA 1SL2A 4FN5A 5BYSA 4HUGA 2X7IA 2B4PA 4ZPTR 3QJPA 4DV6J 1HW8A 2MRLA 4DV4J 3R8EA 2F8LA 4DR3F 1NU0A 5LSOA 1M1HA 1CULB 6FD1A 4R8UB 2W03A 4XH5A 4YQWA 4DPXA 3CJ0A 1WOSA 3CG7A 3OXFA 3L4PA 2DNZA 1S7IA 5DQIA 5AQKA 5LJVA 2GFFA 3K0SA 3GJRB 1UVKA 1Y10A 1T9VA 2B6AB 4HACA 3L2WA 1QQMA 3BQTA 3WNEA 1FVQA 1RHJB 2G0IA 5IT9O 4J8FA 5KT4A 3C19A 4NWIA 3HSCA 1RZTA 4X4SA 4LFAF 1ZBHA 1TL7A 2ASJA 1YDLA 3OSNA 3S1TA 4AQYK 3I33A 3ZYYX 5GAEU 1T03A 3M8QA 4QJFB 4OGEA 4CJ4A 2W2MP 3NF6A 4YOVA 2EFGA 5U47A 1UT8A 4BE0A 1KC8T 2B7BB 4ILLA 4IS7A 5ETSA 4JP8A 4WYWA 2K4PA 4BR0A 2IJFA 1FK9B 2VICA 3TVYA 4AXIA 5HSPA 4FPBA 3BH6B 5T14A 4FJIA 3L9ZA 3TWHA 1N5YA 4I6YA 3R5GA 3R9LA 5M2RA 3DLKB 2DR6A 3CEDA 2XB2D 2Z2YB 1ITGA 5BYQA 4YVZA 2V68A 1Q0NA 4TXSA 3P49B 3UXNA 1X9SA 2F96A 4MEXA 2ZOFA 4HKQA 3UQ0A 1VQ9S 3MM7B 4OLBA 5G0RA 2MQOA 1NGIA 2DT9A 1JCGA 2K7JA 3L3VA 4FKXA 1M1KT 1QSLA 1JJCB 2FBYA 3IWNC 2FSJA 2LCWA 4KV8B 1KN6A 4IRDA 3T6JA 5CR4A 5J2HA 3OFGA 5DDYA 3H8YA 5ITHA 3O8WA 2XICA 2HVHA 4OJOA 3WIVA 2Q3SA 3V9WA 3EE8A 1RU1A 3W2WA 3AVNA 4KHPK 3B82A 4BR2A 2QA1A 1ZJNA 4NLCA 4USIA 2B9YA 2B4UA 4EHUA 1SXDA 3QJJA 2LA6A 4FO0A 4DX6A 2LYBA 4DR4J 8ICNA 4Y2VA 4EEKA 2RDIA 4CO4A 5J2DA 4A5BA 3CCLN 1S77D 3ISZA 3AOAA 2O1PA 3G4SS 4QYZJ 3FLCO 2P9GA 1WWVA 2I8EA 2AU0A 2QMUB 4QCLA 1WHXA 4IQXA 2GNKA 4L6V3 1FESA 4KY3A 3ULHA 1HI8A 1XNQJ 3O9SA 4DTMA 1M5SA 4CZCA 1WC1A 2F8MA 1TL3B 4ZKAA 3WX4A 2ZJ5A 2ZH3A 3PJ9A 4TVAB 4BE1A 4L73A 1X9MA 2P9EA 3M9NB 3J7ZT 3PUFA 4F4YA 2XULA 1HJRA 5DB6A 4B9SA 3JYTB 4DN9A 1UWAA 3IFEA 4CGJA 4RPZA 2YWHA 4QZVB 3BY5A 5HN0A 4CJ5A 3KZBA 3TZZA 2W6KA 2G13A 2V2VA 4B3TK 3CRXA 4F04B 4B8CA 4HCBA 2BBEA 3IBCB 1JNZB 1ZQIA 3RZAA 4ACOA 3KLEB 4ZH4A 2JFKA 3M2RA 1ZQGA 2EFQA 3M32A 3MUTP 3DYAB 1XMQF 2P9CA 1NMNA 2UXBK 2V50A 3BGUA 3WK5A 1U1QA 2ALZA 4IC9A 1I6JA 1UEUA 3PW5A 1RA6A 3CDUA 2IY5B 2ZM6J 4DU3A 3SAGA 3LO3A 4Z6EA 4AF1A 3C29A 2FMPA 3OL9A 1FRXA 1COKA 1WYGA 1B0XA 3PMNA 4ZVGA 2G08A 2ZJQQ 1YQHA 4X4OA 4CO1A 5B0GA 4C8YA 1FO4A 1CZAN 1YJ7A 2LECA 2EKNA 5B0DA 2CQCA 4GFJA 2QG9B 3ZZUA 1S5JA 1QDUB 1VRTB 4CH7A 4OCZA 1TUWA 2JC1A 5BOMA 1ZQVA 9ICRA 3EX7B 2XGPA 4NMLA 2V2ZA 3ASMA 2IRXA 5AM3A 2KLAA 2DQNB 4NJ8A 5HQLA 2HWHA 1R89A 3KUHA 2HHXA 3HSTB 1L3VA 3FRYA 5AQYA 3G82A 4AT1B 4RR5A 3LP0A 3CCVN 3FCWA 4CF1A 4NLVA 2HK3A 4YY3F 5G5HA 1TV6B 4J2DA 1JQGA 2YNHA 3Q8KA 5AKHA 3JSRA 2IOFA 4F93B 2EPIA 3ILOA 3H5XA 2LM4A 4I2IA 3ETRA 4ZHRB 5TKYA 2PT0A 3D2SA 5CAAA 1VSMA 1KVCA 2MZSA 3U4LA 4B9MA 4FSVA 4ZP7A 3KLIA 2J5AA 4U7UD 1VS3A 1W7AA 2EI5A 3MF5A 5KNIA 1ZBUA 1RQ0A 5DDPC 2E1MC 3AARA 5EWGA 3W3SA 3KJQB 3UPQA 1RWOB 4R64A 3SI8A 1NU4A 1JXEA 3BZCA 1RADB 4IH7A 3FCVA 2CPZA 2F9WA 3I8BA 2OSRA 5IIIA 4NCBA 2GBZA 4OQJA 2X1AA 2HAFA 1O08A 2D0PA 4Q43A 2G8UA 4RL1A 2PKEA 3G71S 1P6TA 1KVBA 4WBFA 5L9XA 2FZKB 2ZIWA 4HI2A 1U02A 4JI2J 5AM4A 2ZKTA 3NGRA 2FBTA 2CQPA 3K4GA 3VMFB 4KHUA 1KQQA 2DR7A 4Y2TA 3CP8A 4WFYA 2ZGYA 1OH6A 3GZFA 4TUPA 3TOQA 2DTUA 3TO8A 1Z4UA 3LAMA 3WDOA 2VGNA 5CABA 3MR5A 1FA0A 1X4CA 2NLXA 2P1JA 4FBTA 1FHTA 2C2RA 2XZWA 2BE2A 1YJWS 4FVCA 2HRYA 2W41A 2HBMA 4CI6A 2FTRA 2CJQA 2O8CA 1U45A 1O5JA 4M5LA 2KKZA 3IMXA 2NXUA 3D2WA 3X3UA 3CI5A 1F44A 2HNZA 5J1EA 2NZTA 3R5BA 4JAXA 2K8AA 2H9ZA 3FYHA 1T4GA 2RH3A 4CZLA 3RMBA 2VWKA 1X6JA 4CYUA 3SFUA 4OYBA 3DLEB 3DU5A 5J0UA 1SB6A 2IOFK 3WKBA 4WYBA 3AA2A 4C8NA 3D9BA 4JHDB 1Y4ZB 2G4BA 3DRRA 4OZ1A 1NKEA 3WQTA 2DHSA 5J2AA 1VJWA 2EAOA 3FSIA 1Z1BA 4ED7A 2C28A 2CWXA 4FYYB 1BIZA 3N6LA 1YTUA 3NOCA 5KFAA 4IRKA 2GC8A 3BPSP 4KGXB 2J8AA 1C0FA 3DI6B 1NZAA 4OPKA 2CNOB 3B4MA 3LQVA 4GXJA 3BR8A 3IUCA 4RQ1A 4YFKA 1T9XA 2DKZA 4JI0K 3KG0A 3GFKB 4M95A 4C4SA 1C0TB 4J5OA 4HR2A 1HJOA 3NRWA 2PGCA 2WHEA 4B3SK 5CCMA 1J5OB 2O4GA 1R0AA 3TTDA 1XNRK 2J6UA 2R8IA 3FKBA 4DPWA 4DU1A 1JXVA 5IIJA 3B0XA 1W0HA 2HQFA 3HVTB 1SJ1A 4HDHA 2DGZA 3RB4A 2PI4A 4I28A 1BQXA 2A1BA 5DZ6A 3CCZA 4IDHA 1WEXA 2V7YA 6AT1B 4TNOA 4OX7A 5AXKA 3J81O 4C0OC 5DETA 5E84A 3CC4S 3D7EO 2O8DB 2F4VK 4JWMA 4HCCA 3OBWA 3MGJA 3T9NA 2P9IB 5KQ8A 3TFRA 4OGCA 4F26A 1KDHA 4NI2B 3GZ7A 3K2YA 1N36K 5EE0A 3MEGA 1FFUA 1VQ9N 1D9AA 1ZBSA 3DXMB 4RQ7A 3HPOA 1TKTA 3AVIA 4ED1A 1PYTA 1QQCA 9ICOA 4TLQA 8ICIA 4KH6A 9ICKA 4Z0UA 4Y2CA 3MECB 4MK7A 3VERA 5KFUA 3RSEB 9ATCB 3K58A 1MU2A 3V6DB 2ZOMA 2WC9A 8ICTA 4JB8B 1UPHA 3Q7BA 5DZ7A 4OX8A 2BPFA 4E7IA 3ZETB 1J97A 2IVMA 3WX8A 1VQ8S 2HSZA 5AQPA 4EENA 5IFMA 3VGTA 1PIEA 3H8JA 4IFYA 3L7PA 1DZ5A 1Y88A 1G15A 3U3GA 4C7QA 5BYRA 2X1FA 2W11A 3QFWA 1V4TA 5GINA 4A8YA 2AHOB 1MWZA 4KLSA 1YJTA 4URGA 4NXNK 3N4WA 2F65A 3TAMA 4XPEA 2HFUA 4ZVUB 2GWSA 4UB5A 2XLIA 2J7UA 4ZVFA 3LDLA 4BR4A 1VJ5A 4DV3J 3DOMA 3P8BB 4DV2J 3DNCA 4I2JA 3G4SN 1KCFA 3VQCA 2HFZA 1NB2A 2W9CA 2FJDB 2AZ1A 4O8KA 1I5OB 4C11A 5JVHQ 3SLCA 1V3SA 3U27A 2AH5A 4DN0A 1LW0B 3W0LA 2C2MB 1S6PA 2RQ4A 1BU6O 2YX6A 3V6HA 4DR2J 4KFBB 4NMXA 5C25A 1JL2A 4CERA 5IT9U 3OTOJ 1RT7B 4FXDA 3QT6A 2MMYA 4AUKA 1VMBA 2QL5B 2M4MA 3F73A 2G8VA 4QIWC 1R3NA 2BKNA 1M1KO 2YHYA 1J5EJ 1W2BM 3KK2B 4YG2A 4DR3J 1PSDA 4W5QA 4ES2A 2HEKA 3MN9A 3UNYA 1HUZA 3IFRA 1QQNA 2FUG9 2YNFB 1LB2B 3CFRA 3O4QA 1IBLK 2IDOA 1I94J 1WD6A 4OZJA 2VGMA 1DGKN 3JTOA 4C1NI 3GG4A 3VQ4A 3NEKA 1WKJA 3N79A 1RBTA 4F5OA 2LEAA 4N8NA 2GMLA 1SUQB 1WUDA 3RH6A 1WHVA 2HSEB 4QIFA 4AYBF 1S1XB 3AXKA 2MXYA 2HHVA 1NK7A 2C3MA 1T3QA 3KJVA 2Z30B 2P9PB 2AEMA 3QQCD 4LFAJ 1NG9A 3AB4B 3C14A 3KLGB 2V8DA 4X65F 2JSXA 4RBUA 3NVKA 5ETOA 4DS5A 3UE2A 4IG0A 2EBEA 1ZD5A 3E9PA 5AQLA 4AD6A 2E88A 3BS5B 3D28A 4C3MA 2FLOA 4FWRA 1EWRA 2BKPA 2QIFA 3QXGA 4M5GA 5GAEP 3IWLA 2GHVC 1E6VA 3SQGA 2OMLA 4ZJOA 4CFAA 1WOOA 3UKUA 4HYKA 3CJ5A 2MUTB 3CUNA 4EWTA 3TYTA 2VQEF 3NH0A 2NUUG 4EYIB 4IH5A 3HSJA 3GYNA 1NK4A 2OIHA 3TEHB 1RXOB 4ZTFA 4ZDNA 3QNMA 4A8MP 3NGZA 3QUQA 4KRFA 3C5FA 4WTOB 5E0OA 4O5CA 4P71A 1JLEA 4NV0A 2EBGA 3RBDA 3H7IA 4QPXA 4LRDA 1N32K 3NCQA 8ICSA 2I0XA 1R7IA 4YOYA 4YB7A 4C3LA 3TJ8A 3U26A 2C2KB 3SI6A 4UAUA 4KX3A 3HVWA 4AYBD 3TAGA 3C6TB 3VGSA 3DLBA 1RHMB 2OD6A 2AW0A 3PJWA 4PR6A 4LRBA 2DGTA 1FNOA 3LP1A 4UB3A 2K1RB 1R27B 4RW7A 3KHGA 1LW2A 3V9UA 5IWAF 8ICGA 5FPDA 3H46O 3B6PA 1KLMB 3R7NB 3MN7A 5HNKA 2PFOA 3W1YC 3BSOA 2PFUA 4MFAA 3QIOA 2L9WA 4CJEA 5AZIA 3R3LA 1HYSB 2IAJA 2KN4A 4CK3A 5ALSA 1BHLA 1EHWA 3L0QA 3PMLA 1HW9A 1RKIA 3VAHA 3AU2A 4KGMA 2DYAA 2UU9K 5AKGA 2W8LA 3H90A 3VQ8A 3DOKB 4JI5J 5ALXA 3R8YA 3POTA 1C6VA 2HB5A 4NLKA 7ICIA 4K8RA 5D4LA 3QSIA 3AQOA 4CWBA 4DKWA 2W25A 3HHNB 4R79A 1X66A 5IT4A 7ICOA 3D66A 2A1JA 4M9NA 2HWIA 3AY9A 3JAMO 1GNKA 3THXB 1D8YA 3QBXA 1HBNB 4OZLA 3Q24A 3FSXA 1HNZF 2XRIA 4N7TA 4M6WA 4RW4A 3H59A 5KT7A 2VPYB 5JMNA 5A6PA 4WF9L 1IKYA 2VQFF 2AF6A 5AFUA 3MR2A 4B8AB 4WXOA 1VQ4N 1Y00A 3HMJG 4BC5A 3G87A 1YJWN 4XDCA 4URQU 1URJA 1DGJA 1WNSA 3D6HB 4UB1A 1NKCA 2A1RA 1SKUB 2ZBCA 4O3SA 4E7HA 2Y0SF 1A77A 2KJWA 3VC8A 2X78A 1NHUA 1S59A 2QEXN 5GMEA 4MEYA 1LFWA 1LKYB 4ZLPA 1A5VA 3JS9A 4GLXA 5J0YA 1SC6A 2HIYA 2KW4A 2WOMB 3BQ7A 4BR5A 4PXCA 2KKPA 2ZH9A 1TKDA 3M6GA 4BG8A 3D2QA 1EXNA 5EDWA 2M9NA 2DGVA 2KHOA 1RDCA 2HBKA 3WK7A 4F50A 1AYEA 1IXRA 4KH0B 5DRKA 2DCUB 3MCMA 4BLGA 4CDGA 3CO9A 1GK8A 3FE1A 5L1KA 4LR9A 1ZQDA 4FW1A 8ICFA 5AI6A 3HM9A 5LMUK 2VONA 1JIHA 2E6LA 4M5MA 1QQ6A 2P6SA 3CVKA 2WW4A 1ZXOA 5JLHA 5GVQA 3DLJA 2QT7A 3F2DA 3NHGA 3RVCA 4JI3F 4L3KA 3RH5A 1Y9OA 2M0NA 3P5TL 1YUWA 4N8OA 2XSJB 1U09A 5AKYA 2KHDA 4UOHA 4A2AA 1XJWB 4JN4A 1NZ8A 1KR4A 3KKAC 2W8KA 3LW5C 4YY3J 1JCEA 3LP2A 3ALYA 5CZVA 2XYHB 3NASA 1X4FA 1HHSA 2J9DA 2GS8A 3VZHA 3UVJA 4KO0A 2EZYA 4DV7K 4JUZA 2CPHA 1G4CA 5I3UA 3U3YA 2DTJA 3MDFA 4QAGA 3R1LA 4UW9A 4AHSA 3RJEA 4F5RA 1S1WA 2F8EX 2BKEA 5AXNA 5CP2A 5H9FK 5E2QA 4HUEA 1ELOA 1QE1B 2W42A 3T1HK 4P74A 3V7JA 4JI4F 1VQMN 3KHRA 2CXYA 1PVPA 2DBYA 1VOMA 2FVPA 2UXDJ 1CXUA 4J9SA 4LJMA 4NXZA 5EVZA 4JI1J 4RQ0A 2CJXB 4O4GA 4BGDA 1IV8A 4ZOSA 5KL8B 1CXQA 1B4FA 1LWCA 1RP5A 5AKKA 4CZGA 4HT5A 2Y0SC 5A76A 1NCLA 5A6WA 3A4TA 1X9XA 3BQ1A 4NYOA 1VQ8N 5SUHA 1Z4NA 1JLCB 4B3MK 4G9BA 2QW9A 2ROEA 2FVSA 1TFYA 5ALUA 2PI5A 3LTOA 2Z1JA 3A8JA 2XMTA 3LZIA 3SCIE 5DG8A 2XLKA 3VF2A 4HWIA 1F1BB 1RU2A 1HKCA 1BD6A 1RNHA 4FJ5A 3TADA 2ESEA 3AA3A 1RHKB 3BYRA 2YKQA 3PSTA 3TTFA 2E2PA 3JPTA 2QYGA 4ZVEA 1GTHA 4CIGA 1P7DA 2DCLA 2GTDA 4A59A 1K1QA 1M5OC 4BRIA 3HK2A 3KWGA 3CCQS 3D0IE 3QU2A 1W2BR 1WKKA 4YORA 3CDBA 3ULEB 3FM9A 4WQ5A 1NNDA 2EW9A 2AJQA 1CJKA 2CJBA 3SMSA 3V6KA 2OH2A 4Z4EA 2NSCA 2LEBA 4PPDA 3FNNA 3M4XA 4AQYF 2YY6A 4EZ6A 1RDRA 2HFVA 1SV5B 1JLQB 3DRPA 4GV3A 7ICJA 2ZQBA 4OYXA 2YWFA 3C5GA 4U96A 4A8OA 4DOAA 2ZIVA 3HULA 2D69A 3CQYA 3O9QA 3IP0A 3PIOL 3OUYB 3BN7A 3EZ5A 4H4MB 5LL6d 3OY9A 1VLBA 1UPMB 1DRZA 2PN6A 1IM4A 4FZYA 4I7FB 1JB0C 3QEPA 1VCTA 3KOOA 8ATCB 1JJ2M 2YB4A 1BIUA 5KFCA 2QSWA 4MFFA 4P6QA 3AQEA 1SC4B 3M1VB 3OXGA 5HK4A 3J7AP 3VAKA 3KJFB 1UEVA 3BS9A 3MAAB 2EHGA 3ET6B 1NPPA 1LNQA 4BY9C 1N33K 4H0XB 4W92B 2BH1A 4DUZK 3PO4A 2O8EA 3P4IA 1FXXA 4EHTA 1X4DA 5A2QY 2ZH4A 2GQ2A 4UAZA 3G0ZA 2VC0A 1FJGK 4KHPF 4C6AA 5K8PA 2MLZA 4NCGA 2HF4A 3T19A 5CRXA 2UXCK 3CB4A 3OS1A 1S1TA 4O0JA 1GT8A 4LF1A 2HBRB 3HSGA 1J9AA 3BBCA 3HSZA 3FZBA 3BKUA 4ZVQB 3ZZTA 4KJIA 4BACA 4WIQA 3I1YA 3QICA 2QL9B 2ETJA 3HI0A 4DTUA 4OJ3A 1RQLA 2F9TA 1KHWA 1W26A 1HMVA 3I9ZA 2QWPA 3TEGA 2AJ0A 5AI0A 3HHLC 3FBCA 3GE1A 2HMIA 5CZ2A 2G8WA 4ETZA 1S48A 4DV5J 4LFCK 1SC3B 3DLRA 2KVIA 2JZBB 1RPLA 3B6OA 5JVGQ 2EAMA 3MFIA 1U2VA 4I9QA 4P2FA 4ZPVR 5I42B 1S1UA 2MY7A 1TK0A 1Q18A 1VK3A 2A1AA 5BRDA 4OO1J 2G1DA 1YTYA 1N4LA 3ZDCA 5B0FA 4NL9C 1UPPA 4JLHA 4CHQA 5D6GA 3G6ES 1BWFO 5BPLA 1HIWA 2RQCA 4B3TF 1B3TA 4KHNA 5DG9A 4J2AA 4P4MA 2KZZA 4O3PA 4M3RA 2JRZA 3EDRB 4LH4A 4CT8A 4M63C 4BRQA 4CNYA 2F7TA 2GQQA 3F5EA 1WWUA 5F2RA 4HAIA 3H0MB 1TAQA 4EUVA 2UXBF 2D3UA 2ZVIA 1VQ6N 2WB1F 2EFPA 4NOHA 2BEFA 1YJNS 3ZTSA 2W3SA 2V9WA 2VL1A 2ROGA 4X64J 1J2NA 4DTJA 3THYA 3C6HA 5E3AA 2G09A 3O5TB 3W9IA 2NYHA 3I0RB 3IRXB 3KUGA 5HR7A 2CYYA 2O8BA 1GLFO 1QJHA 5LY3A 2CPRA 1YITS 3RRGA 4WCEL 4CD3A 1DKGD 4FWLA 3V81B 3MMAB 5LM7E 1ZZNA 4I2DA 3OR2B 5H1SV 1QCKA 5EWFA 2M8DB 4CVNE 2J6SA 1ZA2B 4Y2RA 1RTJA 4DR6J 1YIJN 1KN5A 2VUGA 2F1HA 1N52B 2P9SA 4HI1A 3DJCA 4CJLA 1S49A 5HQMA 2QYCA 4FYVB 2Y1IA 4JI7K 2YHBA 3A8IA 3SXLA 4E98A 1Y5LB 4JRPA 5CJ7A 4FM0A 1VSEA 4CGHA 3K7RA 3MCAB 2HHUA 4CJFA 4M5DA 4A8WA 1TFWA 4FWSA 3ENVA 3FFIA 2HFOA 3U6FA 3K1RB 3EVOA 4HHJA 1N0VC 5HAOA 2HZCA 2PMZF 1Z6RA 4OX9K 8ICWA 2IYGA 3EWGA 1U1MA 4OKEA 5E5NA 4AHRA 2DISA 2Z56B 2E2QA 2WB1D 4RW9A 2IBOA 5FDLA 3TABA 2G8HA 1BCOA 1XMOJ 3EEQA 2ZJRQ 3E66A 3UPFA 3D0GE 1U2CA 3GYGA 1CJTA 1FXLA 1N60A 2BACA 2VQEJ 2VCPA 4LF4J 3MN6A 4WQ4A 2ZH1A 2GZOA 3C94A 2XYGB 1YXQA 4ECXA 3BR9A 3P38A 2ITGA 3I4HX 3ZSZA 4O3RA 1UL3A 2ACYA 4P7TA 4MO4A 4BCAA 4OV6A 3IM1A 1IN0A 3ZTOA 4RNHA 2NUHA 4KHQA 3THVA 2O8FB 3PXGa 1H38A 4BGBA 2MYFA 2A3ZA 4LSNB 3W2VB 2VIXA 1C2PA 4EFAC 4PG8A 3DDNA 4DR1J 1WC6A 4V1Ak 4B1ZA 2ZZNA 3ULDA 2EZZA 2BM0A 3AH6A 4YR3A 2IJRA 4K41A 2YPYA 1RM6C 1NDCA 5HMXA 2LPEA 2XMMA 4ZVHA 1XS9D 4QZEA 1BPZA 4F5NA 1ZQMA 3ZSOA 4QYRA 3QX7A 2PMZD 3S3MA 2WBMA 2WRMA 3A12A 1WWHA 1PG5B 1RWXB 5IWAJ 4JKBA 4DV1K 1BPEA 1BOTO 4QWDA 3VTIA 1UJ6A 2M5YA 4NA2A 1FDAA 1H74A 4Y2YA 4A47A 1GMUA 3R97A 2NPIA 3G8TA 1RT2A 1F5AA 3PLAA 4NM2A 4IFVA 4FLYA 4HTLA 1IKWB 2VA3A 2DEIA 3KK7A 1IR2A 3UNGC 2HQIA 3WEEA 3A8EA 2I2YA 4Y65A 1N54B 3TX0A 2VOPA 3C0BA 5KL1B 5J2EA 4MHVA 4YOTA 2E8PA 1DJ0A 3UCZP 4DG1A 1K8KA 1PC4A 2GJ2A 3PO5A 2FDRA 3G6YA 4DL5A 2QTDA 1NI3A 1HBOA 3NF9A 3BM7A 1N6QA 1XK8A 3WK4A 5T7BA 2PO4A 3GU0A 2E5LK 4RUCA 1ZQKA 3VOVA 2QB0A 1FXRA 4CLSA 3QSYB 4TQRA 5DBBA 3CJ4A 3ZTPA 3K17A 4ATNA 3J7AN 1T05B 1MWQA 3SUNA 4A8XA 1NK8A 2J0SD 3QIPA 2A6AA 2GVDB 3CCQN 1ZOTA 5E41A 3O6QA 2H48B 5ETPA 4JI0F 2CPIA 2LKZA 1IIPA 1TUVA 4KLFA 4USHA 4B3SF 3PKYA 9ICLA 1PK1B 3IRUA 3OBYA 3TUZC 1XNRF 3ZDDA 5F3XB 3O9TA 5LXYA 1KLNA 3RR8A 3NUQA 4MFBB 4RQMA 2HYIB 1JJ2R 3D0HE 4PWWA 3M30B 3MM6B 1FWLA 2P35A 2D0CA 2B7CB 4FJ8A 1J53A 4CNQA 3R6LB 8ICBA 3VGKA 3CJ3A 4RUHA 4LMZA 2HS4A 3BH7B 1BUXA 2F4VF 1NSQA 4H4OB 3P83D 2BUNA 2ZUBA 1RT5B 2LFVA 4O4RA 4OLPA 4LF5J 3PRDA 2YNGB 3DEEA 4KHSA 1GLCG 5BR8K 2QLBB 2ATQA 1T9YA 1GX6A 1N36F 2JLGA 1WSGA 3AA9A 3TQ1A 1JK9B 1IKVA 3VZIA 3KJNB 3WIUA 4ZP9A 5BPMA 2CPFA 4H0YB 3IG1A 4FLZA 3RB0A 3NCRA 2UVRA 1KAXA 1WKLA 4ZMMA 2ZUCA 2B4JA 2B5JA 3SBMA 1HQ2A 4Y34A 2G0CA 2YKMB 3ID8A 1RT3A 4C7ZA 3DGPA 3MURP 2YX1A 4CLTA 4JI6K 5GADI 2BJEA 1HLWA 3CD5A 4A2BA 3C6AA 1H73A 3NMAA 5J2FA 2DHXA 3RTVA 2MHEA 2W2PP 2DK2A 4ISEA 4K0KK 1SJRA 4JKDA 3LL3A 2MLYA 2LXFA 3SJJA 2ZIUB 5AJ3K 1JLGA 2ZJAA 5ETLA 4NCAA 3NGIA 2CQ0A 4K59A 1NGBA 4IWVA 5KG3A 4GW6A 3NF7A 3RJGA 4NXNF 4Q7AA 3WKAA 2VJUA 4CEOA 2PYLA 4Y2JA 4WZQA 4DR7K 4K25A 3BQ2A 1DQ8A 4ZCKA 4BC7A 2YXLA 4MH8A 5EOZA 5KG6A 4F36A 5HOOA 2B51A 4DCCA 4FCYA 3CCWA 4M3UA 2E8NA 1U04A 2CJKA 2AYEA 3CMAS 2P66A 5DM7Q 3UKRA 1IJEB 4EAHD 1ESVA 4CHOA 1S0OA 3N6NA 4CJTA 4DEZA 3MEKA 2V0NA 2ZBIA 3GP9A 2OPQA 3JTPA 3OS0A 1O1WA 3TPQA 4Y1CA 4NASA 4V19X 3RWUA 4H0OA 1VSDA 3OVNA 3U02A 4XH4A 1O0PA 1CS4A 1FNXH 3EWAA 8ICHA 5A8KA 3FDSA 2E8OA 1UVIA 4K2XA 1AFJA 4J9LA 1L5UA 3HHDA 1D4XA 3RG6A 4ZPCA 1PO6A 2A6OA 2YMLA 1SVDA 2FB0A 5HP1A 4UAYA 2H1YA 3GIJA 2B8QA 1C1BA 3O3FA 2YQEA 3E0FA 4OYPA 3PJXA 4U67Q 3MEEB 3ZFVA 1SJQA 4OHVA 4IOAQ 2HWTA 4EBDA 4ELVA 3S9HA 2EVZA 3FFKB 1RABB 4JB3A 2JGAA 4DDFA 3G6EN 2WBNA 1VC5A 2CWKA 2KQ2A 1GH8A