4E0DA

Binary complex of bacillus dna polymerase i large fragment e658a and duplex dna
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4e0dA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4e0dA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e0dA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e0dA01
3M8RA 4FLXA 1CXUA 4CIFA 4DTJA 1C1AA 9ICWA 4CHYA 1Z26A 1WAFA 3OHAA 2XGPA 4Z4FA 4IRDA 3H40A 1CZ9A 4PUOA 1S0MA 5C25A 4RG8A 1RBRA 5DLFA 3L3VA 1NJXA 3NGDA 8ICFA 2Q3SA 3V9WA 3HPHA 5KFMA 1NK4A 3PW5A 3RJFA 3HPGA 4HCCA 5J2FA 3AO2A 5IIMA 1JLEA 4GW6A 3QESA 4O3SA 1EP4A 3P1GA 3HP6A 2YHAA 4OKKA 2YHBA 1Q9YA 4CE9A 8ICQA 8ICUA 5I3UA 4CJ4A 4M04A 2HNDA 2RN2A 3NH0A 3H8SA 4YG2A 1S9FA 4CHPA 3ZCMA 4QOZB 2W9CB 5KFXA 5EWGA 1BCMA 3VQ9A 4GC7A 5HP4A 5KFSA 4JS5A 4TURA 1ZQFA 2BHNA 4DSFA 1YTUA 1BI4B 5KFAA 1W0HA 4IFVA 5DGAA 1XSLA 2VA8A 4H4OA 3NE6A 4LH5A 5SWMA 2G8UA 3JSMA 4KKOA 4FJGA 4ELVA 9ICLA 2BPCA 2FC0A 2BCQA 3CYMA 4GMJB 1KFSA 5F9NA 4B8AB 4M9NA 2OYQA 4Q0BA 3OGUA 4F92B 5KGWA 5J2KA 4MF8A 4JV2A 2HVHA 2W9MA 1NKBA 3HJFA 4WE1A 4KLSA 4QCLA 1QSYA 1TKDA 2R8IA 1UAXA 1WLJA 2FLPA 2W9AA 2IA6A 1S10A 1HQEA 4DL4A 3QEAZ 1TL3A 4FBUA 2HHUA 4CJLA 1ZBLA 3PO4A 1YT3A 8ICRA 1S97A 4P4OA 4F3OA 4KTQA 1S6QA 4W5NA 3K75D 4AH9A 4KLUA 1Q8IA 1ZQKA 1HNVA 4JWMA 3E2EA 1ZQVA 2FLLA 4QZBA 3BQ1A 1G15A 4CEOA 4K4GA 3BGRA 3RTVA 1WSFA 4CEQA 5HRPA 5KFRA 1BQNA 2WONA 2YNGA 4F4XA 4PH5A 2UVUA 4R8UB 4F4YA 4DFPA 1KVAA 3C6UA 1RBSA 2W8KA 1D9DA 5IINA 3V1RA 4NLZA 4QZAA 5KFUA 3DRSA 5KFKA 4OLAA 5J0PA 3GV7B 1FK9A 2A1JA 4B9NA 4KMUA 4M3TA 4DF8A 4JS4A 3HSTB 1LWEA 3C1ZA 2OPQA 1NK7A 2ZTEA 3AO3A 4FJ9A 3HO1A 2B4JA 5J2HA 2I9GA 1RDBA 3BQTA 4B9SA 2DPIA 4IQVA 2ALZA 4ED6A 5J2EA 3PY8A 5J0QA 4B9LA 4FJNA 1CXQA 4NCGA 4DSEA 5HRSA 2R8HA 2OA8A 4DL2A 1L3SA 1RXWA 5HP1A 4DOBA 2DFFA 4ECVA 4CFDA 4X5VA 4ECQA 2IMWP 2IHNA 3LWLA 3AA2A 3LP3A 3IM1A 4PGQA 4OKEA 1ZQZA 1QLNA 2AGQA 3UQ0A 3UXOA 2XRIA 3LPTA 5FDLA 2XCPA 1DTQA 3MAQA 9ICUA 3ZT1A 2PFPA 8ICHA 3RMDA 4KLQA 3GV8B 3DLGA 4FO6A 4UAZA 1BISA 9ICVA 3T5JA 3L3UA 4RW8A 3Q8SB 2PFNA 8ICAA 2BCVA 8ICVA 1LW2A 4AHSA 3OJSA 3T5HA 5CZ1A 3PV8A 4Q5VA 2C2DA 2ZJ8A 3OS0A 3O4NA 1JMSA 1O1WA 4M3RA 3CM5A 3Q8PB 1GOAA 3GIMA 3SI8A 4M3XA 1ASVA 2XY5A 3U6FA 3ASMA 5HHIA 3QE9Y 2AGOA 3MXMA 2Z1HA 3MFIA 9ICGA 4FJKA 3QZ7A 4DSIA 8ICZA 5KG7A 3ALYA 4CK2A 4ID5A 4DL7A 1ZBUA 4ED0A 4Z6EA 3GFKB 8ICWA 4NLNA 3KK2A 5KFYA 4C8LA 4DOAA 2E4LA 4J9SA 5DG9A 3GQCA 3PX0A 1FKPA 3KHGA 4I9LA 5C5JA 4O3OA 4DU1A 4DQRA 4LZGA 4DTSA 4AILC 4CHNA 4QZEA 2P5OA 2FLNA 2RDJA 4O5EA 3CFRA 3OYNA 1IXRA 2IOCA 4CIGA 3MGHA 4KHNA 3ZD9A 1ZQDA 5KFQA 3M9OB 4CGJA 8ICLA 5CB1A 3C95A 1C0TA 4CHOA 2QKBA 4R65A 1ZETA 3ZDCA 4P4PA 9ICCA 1X9SA 1IKYA 3V7JA 3AO5A 1ASWA 2BKEA 4AHTA 5DKWA 4EZ9A 2GUIA 4PA1A 3NH1A 3Q8QB 3ZSYA 2ZUCA 5KG5A 2MUTA 3RMAA 5KFJA 4MEXA 4BXOB 1B43A 4QAGA 2UVWA 4Q8EA 2NRWA 4DTUA 3K5OA 4F5QA 1SL2A 3RJGA 3MEEA 8ICOA 4Z6CA 1T4GA 1GOCA 1WSHA 4TQRA 2IC3A 1JLCA 3MABA 5BOLA 3DM2A 4J2AA 1NOMA 2JZBB 1ZJNA 2BPFA 4PPXA 4LD0A 3QEVA 4Z6DA 4ECRA 1A5WA 9ICAA 2XY8A 3OYAA 2JEGA 4ECWA 1JXEA 4FXDA 4HUGA 5KT5A 2ITGA 2Z1JA 4QZ8A 3LZIA 2IDOA 3QEWA 4O0IA 3RMCA 4DF4A 4DLEA 4DTMA 3HPOA 3DRRA 5DBBA 4JLHA 5CY4A 3RBEA 2P66A 2R8KA 7ICVA 3GDXA 3RB3A 4DS4A 4M47A 4CHZA 3V9XA 2C22A 4Q45A 4RPXA 1UT5A 4Y1DA 4BE2A 1UWBA 5BPCA 2OZMA 2RPIA 1L3VA 1LAVA 2IHMA 1JKHA 3K5MA 1JX4A 1XSPA 2QKKA 4KV8A 1S0NA 4OVLA 3C21A 4I2EA 5L1JA 3OYJA 2V4RA 4M0AA 1JLBA 2O4IA 3AVFA 1TV9A 4RPYA 1XHXA 4B08A 3O4QA 2X78A 3OSPA 4DQIA 2HHWA 2AQ4A 1QE1A 2G8WA 4MFBA 1HMVA 3V4IA 1RTJA 4PY5A 1WNSA 4JRQA 2RKIA 1IH7A 1ZQWA 4I2DA 4DQSA 3PUFA 5HNKA 4KHYA 3C1YA 1KVCA 4CEEA 5EOZA 5J2NA 5DBAA 4R66A 4M3UA 4FLYA 3UXPA 3MXJA 1T8EA 4IQTA 2IGIA 2FBXA 5HMLA 5HRNA 1NK5A 3EWAA 2YNHA 3NGYA 3S3MA 1MQ3A 3M9MB 2D5RA 1D8LA 4GC6A 4IQWA 1BI4A 4OJRA 1CUKA 3SQ4A 3L2RA 4ED2A 4O3PA 4KLGA 1TKTA 2OWOA 3SI6A 1HUZA 4ED7A 2C28A 3MDCA 3KHHA 2FBVA 3E01A 3C6TA 4O5BA 3ZDAA 1A5VA 3C5FA 2BCUA 3ISDA 3K59A 1NKEA 9ICNA 4UB3A 3AA5X 4BGDA 3H08A 2BPGA 4RW7A 3EYZA 4OLBA 4I2QA 3O3HA 1ZQMA 1RDAA 2KZ3A 3H4DA 4DLGA 4B9UA 3OYKA 1JXLA 4PHPA 7ICSA 4MQ3A 3L2QA 3B0XA 4Z6FA 4KLJA 5KFCA 2BCRA 4NM2A 1B9FA 3AO1A 3PR4A 1J9AA 1UA0A 4Y1CA 5KFHA 1RZTA 2KZZA 2XHBA 5KFPA 4RNMA 3SUPA 4KLOA 2NRXA 1ZQCA 1QQCA 3H4BA 4YXJA 3ZT3A 4UB2A 4M6WB 4J9OA 2GBZA 4DMNA 2BQUA 3OYIA 4J9PA 4DS5A 1XS9D 3RH4A 8ICMA 1VSHA 3GIIA 5KG3A 1VK0A 1QS4A 3ORYA 5DQIA 4F5NA 3MFHA 3VQ8A 5C42A 2F96A 1XO1A 3RAXA 3B0YA 5KFZA 2X6SA 4O5KA 1B9DA 2YKMA 8ICKA 2BE2A 2I1QA 3NFAA 5D46A 4N47A 3RBDA 4OGEA 4JUZA 1C7YA 3FDSA 3CFOA 4BDPA 2ZQBA 5J2GA 4KB0A 1R0AA 1RT1A 4E7KA 1ZJMA 4I2AA 3TAFA 5HRRA 9ICPA 4DTNA 2ZTDA 4HYKA 3ZDBA 3QERA 5T7BA 4IR9A 3IHQB 4I2JA 3VQDA 5KFFA 4XRHA 5DB8A 4EBDA 4FK2A 3M8PA 1TV6A 4KLMA 1WCNA 4FLZA 3V1OA 4PQUA 4KREA 2W8LA 1JXBA 2FPLA 1AROP 2ASLA 2XC9A 1EETA 4AHUA 1TKXA 4AHVA 2DY4A 2EX3A 2LSNA 4GVMA 3OYLA 3V7KA 2XY6A 1J5OA 2G8KA 4UB4A 3EPIA 2KFNA 2DFHA 3MR3A 3KLEA 2ZUDA 3NDKA 2PZSA 2ATLA 1Z25A 2JLEA 1IKXA 1BGXT 1X1PA 4F8RA 3M9NB 4CJEA 3M8SA 4CF8A 3AVIA 3ITHA 2V9WA 4CJSA 2BGGA 4GXJA 4EP4A 4O3QA 4Z4EA 4RPZA 4FJXA 1X9WA 2D0AA 4GLXA 4ECXA 4KLEA 3Q8RB 3OHBA 1S1XA 4CGHA 4I2FA 3V6HA 4ECUA 4IBNA 4KO0A 1Y97A 3AVNA 3FYHA 1REVA 5KFNA 3EPGA 1VRTA 3RH5A 1IKWA 2BDPA 4DL3A 2ISPA 4N5SA 3KHRA 4HHTA 5IIKA 5J2QA 3SYZA 2PI4A 2JEFA 4QW8A 3DOKA 4FS2A 1RPLA 4F2SA 4DSLA 4DU3A 4UBCA 1RT2A 3L2WA 3LPUA 4LVSA 1A76A 3K2PA 1C0UA 5HLFA 4CCHA 4Z4GA 4MFAA 4E1MA 5J0YA 8ICSA 4NYNA 3EY1A 4FM2A 4F93B 1LWCA 2YV0X 2J6UA 4NY8A 3F9KA 4CGDA 3OS2A 1Q9XA 4RQ2A 4KLLA 4W5RA 7ICNA 1LV5A 3JPQA 4DTXA 3JPSA 3C2LA 2F1JA 4FLUA 5KFLA 4B9MA 3AVBA 1K1QA 1RT4A 1S1UA 4CEBA 4NCAA 1HYSA 3KKSA 3HW8A 1NK8A 1JL1A 1RXVA 1C1BA 1CZBA 4NYFA 3S3NA 4OPKA 5KG6A 2BQRA 2FMPA 1LB2B 2BGWA 2R7YA 3P5JA 3G6YA 3QIOA 5DB7A 4J2EA 3KD5E 4DTOA 1MQ2A 3ZSRA 3MGIA 1HYZA 5EWFA 2ATQA 1EXNA 3PW2A 3PMNA 3LK9A 2P5GA 2DPJA 4R63A 3TAPA 4E0DA 2BCSA 3I0SA 4ICLA 8ICBA 8ICJA 3ZSOA 3RJEA 2IAJA 2C2RA 3WNGA 1WN7A 4BE0A 3RR8A 2YNFA 4TSXA 3PW0A 2ETJA 1BPXA 4F5OA 1QTMA 1BPEA 2G8VA 3V9UA 4DWIA 4FVMA 4QW9A 3VN5A 3HYFA 3TAQA 3TFRA 2V4QA 1Z00A 4PGYA 1UT8A 4KHWA 1KRPA 3KK3A 4QZ9A 4I9QA 1BIUA 4DFKA 4HUFA 1KFTA 4QZHA 1SZPA 1EXQA 3EZ5A 3UPQA 4RQ5A 4K8ZA 5FRNA 3MEDA 3NF8A 4YMOA 2FBYA 3MR2A 5HBMA 1TVAA 9ICOA 2R8JA 1S0OA 4XIUA 4FLWA 1KEJA 4YR0A 3H7IA 5JUMA 4KHUA 1KSPA 1CEZA 3NF6A 5FROA 1KLMA 4OGCA 3PX4A 2E6MA 5FRMA 4P4MA 2WOMA 1JLFA 1ZQAA 2NRVA 2J6TA 3HP9A 1NK9A 4DTPA 4DO9A 4RQ6A 1SKRA 3B6OA 4Q44A 4CFAA 1N56A 1QHTA 3KLGA 3HXMA 5CJ7A 3SZ2A 9ICTA 3HK2A 1S1WA 3DRPA 4QWBA 3OYFA 4YD2A 3ISNC 3ZSVA 1WSIA 2HHQA 2E6LA 2VANA 2W9BB 1U47A 4M9HA 3NHGA 5KFGA 2PFQA 4KN4A 4G1QA 9ICMA 5EU7A 4F4ZA 1L5UA 4Z4IA 4RUAA 3NCIA 4B3OA 3DLHA 1TL1A 2ASJA 1H38A 2NRZA 5J2JA 4DU4A 1RYSA 5J0XA 3VQEA 4I2HA 3NF7A 3TABA 4TUPA 2B21A 1TGOA 1U48A 3LALA 1TKZA 1N6QA 2PYLA 4ZH4A 1S9EA 8ICNA 1HYVA 3NTUA 3SNNA 4FBTA 4FJ8A 4O3RA 4DSKA 1RBVA 4I2BA 4UAWA 3PO5A 9ICBA 8ICIA 1IM4A 4TUQA 5DDMA 3OVNA 5KG4A 3RJKA 4FZXC 3TARA 4KAZA 4PGXA 3P83D 3PW4A 2A1JB 7ICJA 5DK5A 4CJ5A 5IIOA 5CHGA 3JPOA 3C94A 4AHCA 1NJYA 4IDKA 7ICFA 1XI1A 5CP2A 3V6KA 3QEBZ 2B6AA 4DOCA 2KZMA 1BQMA 3EW9A 1U4BA 2OZSA 3GIJA 3ZSQA 3DYAA 4C8KA 2XY7A 2VA2A 4J9MA 2VWKA 1SUQA 1RDDA 1NK0A 3U3YA 3IRXA 2KFZA 1ZQUA 1W9HA 1JIHA 3CQ8A 4YMMA 3T5LA 4QZFA 3LAKA 2AU0A 4M41A 1LWFA 5KFEA 4RW6A 4YXMA 5KFOA 7ICKA 3RRHA 9ICHA 8ICCA 4FJ7A 4DG1A 1ZQOA 4BDYA 5J0SA 5DB9A 2B5JA 1D9FA 3PVXA 4CJ3A 8ICYA 1VSJA 3U3GA 4QWEA 4CEZA 3BQ0A 4I2CA 4ZTFA 2FMSA 5DB6A 3JYTA 4Q43A 2DFLA 4C8MA 1ZQSA 3SCXA 5TZVA 3NBPA 1J53A 1ZQHA 5KG1A 3MR5A 3T5KA 1U49A 5J2PA 4CF1A 7ICIA 3QO9A 1DOQA 3PMLA 7ICLA 3G10A 5J0UA 4F5RA 4MFFA 4P2HA 4B8CA 3S9HA 4RQ0A 1SL1A 9ICXA 4J9KA 4RQ8A 3TI0A 3TAMA 2KN7A 4W5TA 4RT2A 2G8HA 3DOLA 3VQBA 4I7FA 3ULDA 3ZT4A 4FM1A 5DGBA 3DMJA 3LP2A 1JLQA 4YCXA 2JGUA 4KRFA 2O4GA 1C6VA 2XGQA 4CJTA 3MECA 3HVTA 1IG9A 2KTQA 3KLHA 9ICJA 4FJJA 4FW1A 1BPZA 1BCOA 3B6PA 4I2GA 4FK4A 4RW4A 3V6JA 2UVVA 1S5JA 2W9CA 1BPYA 3FFIA 1WSJA 4IG0A 3LAMA 1IO2A 3OYMA 1FXXA 2OPPA 3AU2A 3K57A 3V9SA 4CESA 4CIEA 4F5PA 4IR1A 5KG0A 3VA0A 4FYDA 4QZIA 1YVUA 3KLFA 4UB5A 1ZQQA 1MC8A 2G8FA 2FPKA 3QETA 2NUBA 3AVHA 7ICQA 3UIQA 4CECA 2MUTB 2HHXA 3SUNA 2JEJA 5KG2A 3TANA 1ZQBA 5IILA 1VSEA 4DQPA 1RTIA 1SKSA 2FBTA 3G6XA 1D8YA 1ITGA 4CHQA 1VSLA 2PFOA 4O4GA 4YR3A 3AVJA 5KFIA 4MFCA 5K14A 4DQQA 3O3GA 1S77D 3V1QA 3GV5B 9ICFA 1BPDA 5L1KA 3BJYA 5J2IA 3T3FA 3RH6A 1HQUA 3H8WA 5CA7A 1RBTA 4YFKA 1Z3EB 2M9NA 1CLQA 5JS2A 1KCFA 1N48A 4DTRA 5J2DA 2ZJAA 3VQAA 3V9ZA 4ID1A 1NOZA 4PHAA 2VG6A 5IIJA 3RR7A 4R8UA 2P1JA 3BQ2A 4O3NA 1S76D 5KFBA 4UBBA 1EKEA 3I0RA 4F4KA 4AHRA 2FPMA 1LAWA 3AVGA 4KLIA 1RT3A 2VWJA 1NOYA 4HTUA 1RT6A 4QZCA 4FLTA 4IKFA 1BL3A 3AVMA 4KB1A 1ASUA 4CJKA 1ZBFA 4J9NA 4RU9A 1RDCA 1TAQA 1TVRA 4IRKA 1X2IA 1LW0A 4R5PA 3LZJA 4CF9A 4FJMA 1ZQIA 3SQ1A 1KTQA 3WNHA 3C2MA 3ZT2A 1KLNA 4E19A 1VSFA 3AU6A 9ICIA 4KLFA 4O9MA 3OYCA 3ZT0A 4JRPA 2ZE2A 1BHLA 3AO4A 1FKOA 4CJRA 5J0OA 4HUEA 4CK3A 3SJJA 2OPRA 4M9LA 3TWHA 1QSLA 4O5CA 1IKVA 5DQHA 1XU4A 4FLVA 4K8XA 4QZGA 4QZDA 1NK6A 5L9XA 4CEDA 1BVSA 1TK5A 4KITB 3JPTA 1I3AA 3IAYA 3N97B 1ZQLA 3RB0A 2F8SA 3SPZA 1ZQGA 7ICHA 4EBCA 4YFUA 1VSMA 1RCHA 4YQWA 4QWDA 3SPYA 3OJUA 4KTZA 4J2DA 1TFRA 4Q8FA 5JS1A 4DL5A 3LP0A 3RJIA 4N56A 3VQPA 2GV9A 2HVIA 2BQ3A 4KTWA 1S6PA 4UQGA 5KT7A 4DFMA 3MBYA 3QZ8A 4LH4A 4CF2A 2XCAA 5DMRA 4XQ8A 1XC9A 1ZQTA 1BIZA 5CWRA 4M42A 1RYRA 4KFBA 3MXIA 3PX6A 8ICTA 4ZTJA 4KN7A 5J2AA 3OY9A 3KD1E 7ICTA 4C8NA 3RRGA 4E1NA 4ECYA 3HL8A 2KQ2A 5KGXA 1ZQPA 2RF2A 3T19A 4W5QA 4LZDA 4I28A 1U04A 1Y88A 2W9BA 4F50A 3L8BA 1RTDA 1B22A 8ICXA 4KLDA 9ICRA 4M45A 3V81A 2VG7A 9ICSA 1WCLA 4LY7A 5HMMA 5KRTA 4QWCA 4OPJA 1VRUA 2D0CA 3HM9A 3H8JA 4E89A 3RJJA 3T1AA 4PWDA 4ECSA 2R8GA 3VQCA 2HHSA 1SV5A 3RAQA 3TFSA 3OYGA 5L1IA 3JPNA 2HHVA 4LSLA 3ZDEA 4O55A 1RILA 3G0ZA 1B92A 3KKRA 3OYBA 1J54A 4FJIA 4I2PA 3VQQA 4CK1A 3QINA 4NCBA 1U45A 2G8IA 1T7PA 3CFPA 2AQ0A 2HNYA 3ISBA 4K4HA 4FZZA 2Z1GA 9ICQA 1A5XA 2VG5A 5J29A 3SUOA 4KI4A 3VA3A 1ZQYA 1V9PA 5KFTA 4YD1A 1VSKA 3TR8A 4PHDA 4N76A 1VSIA 4BXOA 1T03A 1I39A 3THVA 5KT3A 5D49A 5CR0A 4CFBA 3UXNA 1RT7A 4TQSA 4NM1A 7ICOA 3PR5B 3HWTA 1NKCA 4ED1A 3D0PA 4BWMA 3IG1A 5KFDA 3QNNA 4NXZA 1JLGA 1ZBIA 2I5JA 4Z0UA 4UAYA 2JZBA 3LP1A 2KW4A 3KLIA 5KI6A 4CJWA 2Y1IA 1NJWA 3RB6A 1TK8A 3TAGA 4FJHA 3C2KA 4H4MA 1S9GA 2IBKA 5CZ2A 3ISCA 1DTTA 2W42A 4CGGA 4RQ3A 4RNOA 5D3GA 5F9LA 1UA1A 4CGFA 1ZQRA 2PY5A 3M8QA 3K5LA 3V7LA 1N5YA 4C8OA 3NGIA 1S1TA 4NLKA 3ZDDA 1T05A 4RT3A 1XHZA 1JLAA 4KLHA 2ZTCA 7ICUA 2X74A 3K5NA 4CERA 4F91B 8ICPA 4F3TA 4KPYA 3NAEA 2ZJ5A 5DLGA 1WAJA 1L3UA 5E41A 1EX4A 2P6RA 3OYEA 2UVRA 3O3FA 5KTQA 1UOCA 1X9MA 2Y1JA 3A2FA 1HJPA 3C5GA 4PHEA 4QWAA 4CJQA 1KFDA 3VQ6A 5J0RA 3AA4A 4JV1A 5KT6A 4GXIA 4CGIA 3LDSA 3RJHA 2HNZA 7ICMA 2BANA 2FMQA 4CJPA 4FZYA 5KT4A 1ZQXA 3MR6A 5DBCA 4J2BA 5L1LA 3ZSZA 4YVZA 8ICGA 1DGSA 3LDAA 4FJLA 2DFEA 1JN3A 4FW2A 1RTHA 5CYMA 2AJQA 2X6NA 1BPBA 1TAUA 4W5OA 1KVBA 1SL0A 2HMIA 3CG7A 4Z4HA 3I8DA 3WNFA 4IFYA 2QXFA 5KFWA 3RB4A 4M3WA 1ZBHA 4E7IA 2J6SA 4IRCA 4ECTA 3HT3A 2QK9A 4E3SA 3VQ5A 1S1VA 3DI6A 3MEGA 4DL6A 3G6VA 4G3IA 4HVJA 5J0TA 1HPZA 4K4IA 1C1CA 1RBUA 4ED8A 2EHGA 1MU2A 3NGZA 3QLHA 4RQ1A 4FM0A 3DLRA 3VQ7A 5I42A 9ICKA 2F1IA 4CJFA 4M2YA 1T3NA 4XA5A 2ZD1A 3AV9A 9ICEA 2ISOA 4I27A 3MDAA 1ZQEA 2OPSA 4B9VA 3K4GA 2P6UA 5HROA 2JEIA 1JL2A 2WTFA 3ZSXA 4RUCA 8ICEA 4M3YA 4DFJA 3GIKA 4ECZA 3ETLA 3LWMA 5J0WA 3D45A 4O0JA 3Q8KA 4ZHRA 1A77A 3SUQA 2A1SA 1U9LA 3L2VA 3NH2A 2PI5A 4EEYA 3AVLA 3AVAA 4KHSA 2RDIA 4CFCA 4EYHB 3ZD8A 3V6DA 4JV0A 4M9JA 2P51A 3C23A 1YTAA 5DG7A 4J9LA 4FK0A 2VA3A 2PXIA 2HHTA 3Q8LA 2F8TA 4M6WA 3OYHA 1ZQNA 1ZYQA 4ELUA 1SKWA 3BDPA 1XWLA 4RQ7A 1Z00B 3QIPA 3Q8MA 2D0BA 1KDHA 4YMNA 1F21A 1ZQJA 2GWSA 5SZTA 2YNIA 4BDZA 3DLEA 2H5XA 4TUSA 2BR0A 3DLKA 4BWJA 3WNEA 7ICRA 3SV4A 3S3OA 5DG8A 5KFVA 4J9RA 1C0MA 3SV3A 4OKJA 4CF0A 2A1RA 2ZUBA 5J2CA 5C24A 5KT2A 3KK1A 2LYHA 3OYDA 3SQ2A 1WSGA 3AA3A 3HVRA 4DSJA 3VQ4A 1RT5A 2Z1IA 5CYQA 4L8RB 3PW7A 3K58A 4O44A 4ED3A 5J1EA 1GOBA 4E7HA 2ASDA 1XSNA 3JPPA 3OS1A 3AUOA 3RWUA 2PYJA 5IIIA 4MF2A 2IS3A 3HX0A 2YKNA 4Z4CA 4EZ6A 4KLTA 3QEXA 3ZSWA 4FS1A 1D5AA 1RNHA 4BE1A 4MEYA 1L3TA 4RW9A 5D4BA 2F1HA 4B9TA 3PNCA 2Q0ZX 4JWNA 4H8KA 4I29A 1HJRA 3OSNA 4HCBA 1HUOA 2DTUA 1K6YA 5J2MA 1MSWD 3V72A 4I2IA 4UB1A 5KRSA 1DLOA 4EYIB 4BACA 3F73A 4LSNA 3LANA 4F4WA 4YNQA 1S0VA 4E7LA 1HNIA 4CJVA 3L2UA 3QEPA 7ICPA 1NJZA 4IQUA 3IS9A 3KJVA 5HHHA 4CEAA 1K1SA 3CM6A 4CJUA 1VSDA 3QNOA 2C2EA 4EBEA 4F2RA 3TQ1A 4CEFA 4ELTA 4KI6A 4DEZA 2MAXA 4GXKA 4YP3A 3SQ0A 4YN4A 7ICEA 3GILA 4FJ5A 3UQ2A 1TK0A 4KHQA 1HRHA 1WSEA 5DDYA 1QSSA 5J2BA 4YR2A 4XUSA 3KHLA 2AGPA 3AVKA 4NLGA 5BOMA 3JPRA 4M3ZA 5DQGA 4IG3A 3TAEA 4N41A 2NRTA 4RNNA 2XO7A 4M9GA 3AVCA 4J9QA 4JK1A 5EWEA 2HW3A 4E7JA 1COOA 3KIOA 4R64A 4EP5A 3KTQA 3N4MB 4RQ4A 1PZNA 3NF9A 3DLBA 3RMBA 4FCYA 7ICGA 3QEIA 4RZRA 2HB5A
chains in the Genus database with same CATH superfamily
2KM8B 3M8RA 4FLXA 1CXUA 4CIFA 1C1AA 5M2PA 2Z30B 5LSOA 1JNRB 1OH7A 2KIVA 3GU3A 1HWUA 4RWXA 5E79U 3NBPB 4ACOA 5A8KA 4Z4FA 5BRFA 4IRDA 3TZWA 4RG8A 5DLFA 2GHPA 4CP5A 1JCGA 4XDDA 4KX5A 3TAMB 2EBGA 4GKKK 1CQMA 1TUVA 2O1PA 3B4DA 3PW5A 1IR0A 1I5OB 4Y2MA 2CQBA 1E3MA 3D2SA 5DM6L 1E6VB 3VQTA 2J9EA 3AJDA 3QESA 3LP2B 2UV8G 4B02A 1VQ4N 4OKKA 2YY3A 3GU0A 1Q9YA 3VC8A 4CE9A 2JZ5A 1HHSA 8ICUA 1VOMA 3NH0A 1T6DA 3H8SA 2V2KA 3CCVN 3FNNA 2ZIXA 2GS8A 2HBJA 2YNHB 3E66A 4IG0B 2DXFA 3BF3A 2O8CB 4JS5A 1ZQFA 2BHNA 4WFXA 5KFAA 4IFVA 5GADI 3FAHA 2JDJA 3C15A 1V4TA 4XO0A 2JMGA 2Q3PA 4KKOA 3E01B 3HSJA 2K1RB 1COKA 3ULHA 3W9HA 3WKCA 2BCQA 3CYMA 2Y0SD 2YY6A 3NCQA 2KKPA 4DR3J 3M2UA 4FYYB 4HDHA 5K8OA 2GQ2A 3CCVS 4RW7B 3SDEA 3SQIA 3PHTA 4CRXA 1IQZA 1AA1B 1L7MA 1ZTTA 1S10A 1YI2S 1WI8A 3HDSA 4DL4A 2Z7JA 3QEAZ 4FBUA 2JWKA 1YJWS 3OL7A 1ZBLA 1OVYA 4ZLLA 2DKZA 2WVBA 4KTQA 3TJ9A 4RNFA 3CUNA 5CD4H 1ZQKA 1W7AA 1SXDA 1HNVA 3OTEA 4TNOA 3E2EA 1OH5A 1ZQVA 1HQUB 2RILA 2JR5A 3NASA 2YVSA 3I56S 2VPZB 5AQJA 2KM8C 4IO8A 1Q8BA 4WF9L 2X1AA 4JKEA 1L7NA 2KJ9A 5KFRA 1LCUA 2VG6B 1MN9A 3OLBA 1XMQF 4PH5A 1S3XA 2UUCK 2P6TA 4F4YA 3H1VX 4Y2CA 2DGXA 3I0RB 5IINA 1NDPA 3G87A 2CAJA 4OYMA 1JCFA 1GLCG 1WELA 5HQ8A 2GHVC 1RCXB 1RT6B 1TMJA 2ZNYA 3I4HX 3DRSA 5KFKA 3GONA 3IO1A 3THYA 5J0PA 1B3TA 1FK9A 4LQ9A 2O8DA 4B9NA 2Y9UA 4CM0A 4KMUA 4M3TA 3H7HB 4KHPF 2NZCA 4LFBK 4K41A 5IM0A 1VQ7N 4C4WA 3AO3A 3RAMA 2Z8QA 1ZM4A 2ZHBA 4DR4K 4BQZA 5J0QA 1HNXK 3IBPA 2CH5A 1J5EJ 2WTUA 1MN8A 4DSEA 2OA8A 4K2JA 3VETA 2DEIA 5HP1A 1RWOB 3CIMA 4DOBA 5LY3A 2P6SA 2IHNA 2XYHB 3IUCA 2KB2A 2CPJA 1CC7A 3DGPB 1GX6A 4IH5A 1IKVB 4JI5J 3I28A 3UXOA 1DTQA 3FFKB 4YY3K 2HQIA 1T11A 3RMDA 1URRA 3GV8B 3U1NA 2UU9K 4Y2VA 1DT9A 4P2SA 3T5JA 3G82A 3NRZA 3Q8SB 4U96A 1AXQA 3Q23A 1WUAA 3HJVA 8ICVA 1LW2A 4PG6A 2OEMA 4KO0B 4FP9A 1S6UA 3W65A 3QJPA 2WW8A 4CBUA 3T5HA 5CZ1A 1R43A 3PV8A 1OY9A 1WC5A 4DKWA 1S6PB 3A3NB 1IKWB 3PEHA 2C2DA 2EWSA 2ZJ8A 2PMZF 1FTCA 1TUWA 4H5RA 1JMSA 1O1WA 4M3RA 4LF2A 3SI8A 1RLDA 4M3XA 2NRHA 4L3NA 4K4VA 2AGOA 3CJ8A 3MFIA 3GL1A 4FJKA 1DRGA 5KG7A 1AFJA 2C2OB 1Q7YO 2RF2B 1V4SA 4DOAA 3GPAA 5EDWA 4C8YA 3JQKA 1RTDB 1M5HA 4URGA 2CPFA 3NUQA 3LDOA 4O3OA 2W7OA 5F8MA 2H3QA 4LZGA 1IR2A 1TELA 2POKA 2XWXA 2ZJPQ 3QRPA 2HF3A 3CNHA 1RKJA 2A6AA 2P5OA 2E1CA 1LNQA 1XIQA 5BPMA 2G4BA 2A19A 1IXRA 1SV5B 4Y65A 2MTLA 2HCFA 3FBBA 2EG1A 2ZH5A 2QG9B 2FHKA 2K06A 3OA9A 3M9OB 4PXEA 2F4VF 1S1UB 8ICLA 2L9DA 1C1BB 1PVPA 2M8HA 2HNYB 1P7DA 2A3ZA 3HULA 2Y1LB 3VVTA 4R65A 2HLTA 2OEKA 1TL5A 2VG5B 1VYAA 1NGJA 2MLYA 9ICCA 4X64F 1VQMS 4ZP8A 5LL6d 3CEDA 3J81U 4AHTA 4WJ3B 4IOXA 3ZSYA 1S12A 2ZH8A 3VTIA 2XSFA 2QMUB 1VQ8S 1FVQA 2ACMA 3HOTA 5F3XB 1F0MA 1B43A 2B4PA 4U67Q 4LIRA 2NRWA 4DR1F 4A8FA 3ELHA 2QLTA 4J9UE 2X51A 1GEHA 4F5QA 2HQCA 4OI4A 1DBDA 3SSQA 4BRGA 2EXUA 4TQRA 1PK1A 1RADB 8ATCB 1JLCA 3I87A 3MABA 2I5JB 2DEJA 3D54A 1ZJNA 5IQ6A 4QR2A 3KLIB 4WK1A 4ECRA 4BRDA 4GY2B 9ICAA 1GQEA 5ALPA 3SBTA 1S9GB 1SXLA 4YB6A 4CO2A 4FXDA 3O0FA 3K2YA 2C2KB 3ZI4A 4QZ8A 4BRCA 3QEWA 4DLEA 2BDUA 3EUNA 5HBMB 3MURP 2DT9A 2HDOA 1XNSA 7ICVA 5AE1A 2WOMB 4V19J 2AJFE 5AXKA 5FPEA 2ZBPA 4BC5A 2DR6A 4Q45A 1PG5B 4BE2A 1PSDA 3UPFA 1UWBA 3NMAA 2OZMA 1QVFR 1V6HA 1EIYB 1JKHA 2CQPA 4DU8A 2B7CB 1JX4A 1RHUB 3VAGA 3C2PA 1SZ2A 4KV8A 4XK8C 4OVLA 3QWPA 4I2EA 4HHJA 2QL9B 5L1JA 4RBUA 4WWSA 2A2DA 5CCLA 3AVFA 5M1QA 4RPYA 5AIAA 2QZ8A 4G1QB 3U02A 3GFXA 1NPRA 3G8SA 1IBMJ 1HKGA 2D6FC 2HNZB 2XBPA 1VQ9S 4FZLA 1HMVA 3V4IA 1GXUA 4UOFA 1AUSL 5ALJA 4OI6A 4PG7A 1QHAA 2P9UA 3PUFA 4B3SJ 5HNKA 2Q0UA 5EOZA 5AQMA 4R66A 4X2BA 4M3UA 4FLYA 3UXPA 2LM1A 2AJ4A 2HMIB 4NLYA 4EU0A 1Y5NB 4IFYB 2FBXA 3DC2A 3AOBA 1ZAVA 2YNHA 3VEOA 3QYPA 1N52B 4MK7A 4O4RA 1S1VB 1MQ3A 2G2OA 1WC4A 4M5GA 4IQWA 3GSDA 3UFCX 3W2VA 4OJRA 1CUKA 4ED4A 3A8EA 5GAEU 4O3PA 4KLGA 4CNYA 3E01A 1H0HB 4I6YA 4MDBA 5I42B 3MGVA 4OJ6A 5IV4A 3QPIA 4ZP7A 1GX5A 3QUBA 4UB3A 1Q16B 2AT1B 4LFAJ 3G71S 3AA5X 1BQMB 1KL9A 1RDFA 4LF4J 1L3KA 2OPSB 4RW7A 2FIUA 4OLBA 4LIWA 5HROB 4OI3A 5KPZA 1RDAA 1NLVA 2CZ4A 1PVQA 4X65F 3OYKA 4ZHRB 4PZVA 3HMJG 2Z2MA 3HFVA 3B0XA 4Z6FA 5B0GA 4YHHJ 4DV5F 1UA0A 2EFGA 2UXBK 3E9OA 2W55A 2XHBA 4HACB 3SUPA 2VGNA 4JI7F 4F0MA 5A6PA 2LCWA 2YB1A 4J9OA 4O8UA 3ZX0A 2QWLA 3OYIA 4J9PA 3V5RA 2CVEA 2Y0BB 8ICMA 1GMWD 2YNIB 2F7TA 1VK0A 1QS4A 3DLEB 1X4CA 4F5NA 3MFHA 1WD6A 5C42A 4FFDA 3C16A 3DLKB 4WPAA 5D0HA 3RAXA 3EKUA 2GCFA 3B0YA 3NAHA 2YKMA 3JYTB 2E9ZA 8ICKA 4DV7K 4LF9K 2MZSA 4K0KK 5LMUK 3NFAA 1WUDA 3QX7A 1L8LA 2FI1A 2V2QA 4A8OA 1CULA 1RT5B 3CJRA 2HVZA 4DR6F 4O44B 5B0BA 4NO7A 1PAEX 1X3NA 9ICPA 4DTNA 4ZVPB 3HZ6A 4QQBA 2UUAJ 3CJCA 3RU0A 3OW2R 1XERA 3VQDA 5KFFA 3WT0A 4IQMA 5DB8A 2HGNA 3CCJN 1TV6A 4KLMA 1MWMA 1NZAA 2FPLA 3H25A 4FKXA 3GYXB 2ASLA 1VQNS 2KJVA 4AHUA 4OZ3A 2EX3A 5CAAA 2LSNA 3C0BA 3V7KA 3VGTA 4HHUA 1HBMA 1J5OA 3EPIA 3BKUA 2KFNA 5J2MB 1BDGA 2ASMA 1GFWB 1YJNN 4FPRA 4LSNB 3SK3A 1UJ5A 1OH8A 2MB0B 5C2GA 2BGGA 3ITHA 2V9WA 1B0XA 5D78A 4GXJA 4KH4A 3M2VA 2W4DA 1SH3A 4FJXA 2DO4A 5D4PA 3PYDA 1S1XA 1EWQA 3KJVB 4WZQA 4CGHA 1ZOLA 3V6HA 1XUPO 3ETOA 4KO0A 4C0ZA 4ZCKA 1IKWA 2BDPA 3CW2C 4US8A 2IMOA 4HHTA 3KG4A 5MLCV 5J2QA 3ZXWA 1O51A 2JEFA 1MN7A 3AGKA 4QW8A 3TSPA 5K14B 1RPLA 4F2SA 3BV8A 4ZJQA 5FJ4A 5BR8K 4DU3A 4UBCA 3F2BA 2HFNA 3LPUA 1A76A 3CGIA 3LYSA 3K2PA 2B43A 4MKYA 3KJFB 4F26A 4DV6K 3HRDD 4FM2A 4B3TJ 1SI9A 2E2QA 2ZVSA 2YV0X 4FWLA 1VCTA 3EVWA 4WFAQ 3F9KA 2ZH1A 4CGDA 1EB0A 1Q9XA 1DQ9A 2V69A 3PKYA 2VC1A 5GINA 3Q22A 3VF2A 3M32B 3F0NA 2VJ5A 5AK5A 4FLUA 1ATRA 4B9MA 3HKZC 1K1QA 1Z19A 1QM9A 4B3MF 1BC6A 5E3CA 4PZOA 1RT4A 1S1UA 4NA3A 1NK8A 1RXVA 1C1BA 2W3SA 1CZBA 5GAGU 2GWKA 3TW0A 4U7UD 1HX1A 2BQRA 2BGWA 2FDNA 2VV5A 4PWUA 4PWWA 4PUOB 2AYBA 3KD5E 4DTOA 1MQ2A 1DQAA 2CJAA 2V51B 4GVEA 3PW2A 4BC4A 2CYYA 2ABYA 4CI6A 2BCSA 3I0SA 1P8ZA 3O5BA 8ICBA 1YJ7A 3PIPL 4X66J 1FKOB 4ZOHC 2LA6A 1MG7A 1NSQA 3SSRA 4B1YB 2HQFA 3Q24A 3RR8A 2VBXA 2ETJA 1BPXA 4K4YA 2BKPA 4F5OA 1QTMA 2HWTA 1OVQA 5I3UB 4CDIA 4PCQA 5E84A 1H74A 3UCUP 2IM2A 1Z00A 3SAGA 4DMZA 1UT8A 4KHWA 1KRPA 3KUHA 3AGRA 5JVGQ 1BIUA 4DFKA 2CNOB 2HAIA 4QZHA 1EXQA 3EZ5A 4BRHA 3M6ZA 1B64A 1VHFA 5HBMA 2R8JA 2FJAB 3H7IA 2YQ1A 4KHUA 3BB5A 1B4FA 4OGCA 3PX4A 3EZUA 2WOMA 2JVOA 2CRLA 2AYGA 3G4SS 4KFBB 2NRVA 4NLVA 4M5IA 4DO9A 2CG4A 4RQ6A 4I56A 4Q0BB 1SKRA 3R1LA 2RRNA 3B78A 4FYWB 1EHWA 4CFAA 2K7JA 4PABA 2HEKA 4YN3B 2VQFK 3SZ2A 1N88A 3AM9A 2O8FB 5L9NA 5ALEA 4QWBA 4JI1K 3ISNC 3QUTA 4OZ5A 2VKQA 4R0EA 4JI8J 3I8BA 4ZVQB 1YXQA 1NWKA 4FWKA 4NLQA 1M5OC 4CZLA 4M9HA 3G86A 2PFQA 1DY3A 4G1QA 5EU7A 2QMWA 2M0GB 4Z4IA 4RUAA 5D0RA 3DLHA 1TL1A 4FWPA 2ASJA 3FCHA 5AQIA 3KDOA 2PFUA 5J2JA 4DU4A 1V5IB 1LXNA 1ZA1B 1RYSA 2CPXA 2FJEB 2Q79A 1KOHA 1WF2A 1PK3A 2E5HA 4C9DA 3MHYA 3N0VA 3TABA 2XMKA 4P2FA 2B21A 2FZKB 1OO0B 1U48A 3NTUA 4CIOA 3W63A 3CDAA 1Q95G 4AYBC 4O3RA 1S72N 4OJ3A 2FHJA 4LRBA 3PO5A 4DL0C 2GW8A 1BMQB 2LU1A 3DXMA 3SEOA 3OVNA 3W64A 4J37A 2UUBK 5KG4A 4CYUA 2H4WB 2UXCJ 4KAZA 3PKMA 3PW4A 2A1JB 1HBUA 3MMAA 3H59A 1T03B 4CJ5A 1P1LA 4JYAJ 2ZH6A 2HOFA 3KVGA 2V0NA 3GG4A 4U6PA 7ICFA 3GWCA 1CRXA 5CQGA 3RZAA 1BQMA 1U4BA 3G8QA 2OZSA 5HOOA 4C8KA 5ETTA 4J9MA 1RDDA 4G65A 1Q82T 3IRXA 2GNKA 4NXNK 2ZXIA 1B7FA 2A42A 2DGUA 3US5A 2M52A 2ZJRQ 4GKJK 1N32K 4QZFA 3U1LA 1DTTB 3MMVA 2YI1A 2F1FA 1CSJA 3PRDA 2RU9A 4MDAA 4E2FB 1Q18A 5FDLB 3K0SA 1PJ7A 9ICHA 1NJIO 8ICCA 3VF4A 4O0NA 3DLGB 2GX8A 1M1HA 5J0SA 5DB9A 1JLAB 2K60A 4RW8B 2CH6A 5AKXA 1D9FA 4CJ3A 3FK4A 3U3GA 2H4YB 4QWEA 4CEZA 4ZLNA 3BQ0A 2QM1A 2D3O1 4USHA 3JYTA 1VJQA 4O5FA 1MMDA 2R7RA 1F44A 4QU7A 2AJ0A 2YWFA 4JI4J 4F5RA 4C7YA 4C0OC 1R8AA 1SL1A 3RW7A 9ICXA 1OYEA 3TI0A 4DV1K 3QGIA 3UKRA 4W5TA 4RT2A 2G8HA 2HS3A 1RBLA 4I7FA 4NXMJ 4FM1A 2YQEA 3MGJA 5DGBA 2XM3A 1RDWX 5AHXA 4CLSA 2O4GA 4ERDA 1C6VA 3HVTA 1IG9A 9ICJA 1J6ZA 4LF8F 4FJJA 3W5ZA 3BR8A 3B6PA 2WRMA 3G6ES 2W9CA 3KUGA 3FFIA 1KQQA 1X40A 3VAKA 2PFFB 5K9FA 1IO2A 2M70A 3OYMA 1FXXA 3MOJB 2UYTA 3CF5Q 1RWXB 2J8SA 2R7OA 3T1HJ 5HL7Q 4UZCA 1X5PA 1C0TB 1MU2B 3SJHA 4Y2PA 1D3WA 4FOEA 3LUYA 1N36F 1ZQQA 1R8HA 1NRKA 2FPKA 1NO8A 4USWA 2NUBA 4K4XA 3UIQA 1U1NA 2XNQA 3TANA 1CQNA 1NZ8A 3ID8A 3WQUA 2FBTA 1VQKS 4P6QA 3MEEB 1FW6A 4HTLA 4KQZA 2FVQA 2V4JA 3EDQB 1NGEA 2JSXA 1ATNA 2ZF5O 3EEQA 1Q4RA 4PJ0U 5K14A 4MO4A 3V6DB 4BRIA 3CC2N 2U2FA 3GV5B 1BPDA 3Q2TC 1Y11A 4DV3K 3M8ZA 1RBTA 3QIPB 2M9NA 3SR6A 5BPLA 3L3CA 4KHRA 2FGOA 2QFIA 3CPWR 2I6XA 5J2DA 2DKXA 4N77A 2ZJAA 1GMUA 4ID1A 3WXLA 1NOZA 3DRRB 3TU5A 2IJFA 3QXGA 2RSQA 4R8UA 3A4TA 3CVKA 3BQ2A 4B1XB 4O3NA 3MM5A 5KFBA 3T41A 3OUYB 4UBBA 1C4AA 2AF6A 1T3QA 4HWIA 2E5LK 1WOSA 4JI2F 4WKRA 3RF9A 1NU4A 4KLIA 1RT3A 4LF5F 1RA7A 1YX2A 4OD0A 5CYQB 1BL3A 1ZPVA 2OSRA 1ZBFA 1NGGA 1UCNA 3I5BA 3ZLJA 3M4XA 3TA2A 3FMWA 4H54A 1LW0A 4X4VA 4R5PA 1JLBB 3LZJA 4CF9A 5AQFA 4B1WB 2B0GA 5L38A 2XMTA 2PMZC 1F2GA 1FVSA 2A3JA 1KLNA 2B51A 4ZIWA 3LDQA 4OHWA 4OQJA 3VQSA 4JRPA 4AUKA 3K9KA 2RKIB 3M2RB 4JI0F 1YBAA 1FKOA 2P8IA 2PKEA 2MA1A 1RGIA 5GIOA 2PO4A 3OR2B 1E6YA 1QSLA 2KKHA 5EGYA 4FLVA 3LQVA 2QLWA 1NK6A 4KITB 1IG8A 2F8SA 3FQLA 1I6JA 1ZQGA 2PBDA 1RCHA 4UARA 4B3RK 2ZBQA 4P73A 1TFRA 4Q8FA 2MQNA 2ZBRA 2KL8A 5AJ3K 4AYBD 3VQPA 1D0EA 4LF7K 2DNKA 4ZPCA 3MZIA 3B82A 1OUQA 2BA9A 3QZ8A 4LH4A 4B9QA 4R79A 5DMRA 5ADXA 4IKAA 1YZ7A 5FP0A 4L72B 1B70B 4KFBA 1X5OA 4JV5J 2D3ZA 2RUSA 2JWNA 2CPYA 3OY9A 5DS7A 3RRGA 1ZAXA 4A8SA 1ZS6A 3FMBA 3AFGA 4ECYA 2RS2A 3UE2A 4N7TA 1Y10A 5IWAK 1NB2A 4DOZA 4JI3F 3K7RA 4PKIA 4I28A 2BACA 4ISFA 4QIWF 3FC4A 2MY8A 3FR0A 3L8BA 4HH1A 5HR6A 2QARA 4C11B 3BKFA 1X3MA 2VG7A 3EX7B 5KRTA 5K8MA 4QWCA 4I0WA 1UP1A 3HM9A 2NPIA 3MAAB 4PWDA 2R8GA 5F8HA 4XH1A 3RAQA 3WK6A 3TFSA 4CZGA 5L1IA 3IRWP 4CLPA 4TKTA 4O55A 3MWBA 2JC0A 2BJ1A 1K8AO 2DGOA 2FJDB 4DFDA 4FJIA 1U45A 1GLBG 3CFPA 2B8QA 4C3MA 2HRYA 3SBMA 3ISBA 4K4HA 3TRGA 4FZZA 1Z2ZA 4ZPDA 3PYFA 3WIUA 4OX7A 4V19X 2J9DE 2OEJA 4BVPA 2MPUA 2HMPA 4H5VA 2XTJP 4X4RA 3PNIA 5H9EK 4YD1A 2H3FA 1VSIA 1T03A 2VPYB 1X4FA 1I39A 4M5NA 5D49A 2HHHJ 2FY8A 3M8PB 3PR5B 3IBCB 1JLEB 4ED1A 1EP4B 1N2XA 5A8WA 3DU5A 4NXZA 3HT0A 4WFAL 4K4ZA 4Z0UA 4OZJA 2YMPA 1EETB 4NLRA 4ID8A 2I9SA 3QFHA 3MM6A 2KKVA 4CJWA 2Y1IA 1O6XA 1YBTA 3C2KA 1HBNB 2CQGA 4FL9A 5BN9A 2R7SA 2GQCA 4JK8A 1DTTA 1V5VA 3QDKA 2J9DA 1XNQJ 1YIJS 4RQ3A 4WFZA 2LM4A 5F9LA 4CVNE 3KUEA 3MN5A 3N7SC 4PL8A 2WAQF 2FHOB 3P6YC 1ZQRA 1Y4ZB 3K5LA 3PSTA 3V7LA 2YHWA 3A5NC 1N5YA 4OZ2A 2QB0A 4NLKA 3ZDDA 1T05A 1JLAA 3V2UC 2VIXA 1NZPA 3J7YI 2ZJ5A 1WHYA 2V8VA 1B0TA 1TAMA 3GR0A 1REVB 1EX4A 3U1MA 4WE1B 5H2FU 3R3LA 3OYEA 2UVRA 3O3FA 1XNRK 3CMAS 2HS4A 1XMOJ 3A2FA 1HJPA 3AN1A 4QWAA 2H5EA 3VQ6A 3DOKB 3IBWA 2W4PA 1VLBA 3K9JA 3I1YA 1S6QB 4CTAA 1RT2B 3MX2A 1W2IA 4AQYK 1C0UB 2FMQA 4EELA 3SQGB 2DRDA 4F25A 1C0FA 4FZYA 5KT4A 3MR6A 5LXRA 4J2BA 3ZSZA 8ICGA 3TZYA 1HR0F 5KPRA 2MSTA 4FW2A 2VU5A 2ZKUA 3JSBA 3ET6A 2AJQA 1LWCB 4TYAA 2X6NA 1BPBA 1Z4UA 3TYTA 2A18A 4MKBA 1U8SA 3CC7S 2KP7A 4Z4HA 1HNWF 3I8DA 3WNFA 4BROA 2HPUA 5CD4A 3N9UC 2GJ2A 5MAOA 1FJGK 4ITSA 3CD6S 3VQ5A 4MO5A 3KMSA 3HF5A 1MMLA 2CQ3A 5J0TA 2W2QP 3D4JA 1RBUA 1RABB 1MU2A 1XR5A 2MKKA 3D7EO 5F1XA 3L7UA 4KYZA 5TKYA 2E9TA 3VEYA 1UMJA 4PKHA 1XTZA 2ZD1A 2FLOA 3AV9A 4BR2A 1D9AA 1IBLJ 4I27A 4C7QA 4QS8A 3CJ9A 3WQTA 3K4GA 2DNRA 3FSIA 1JL2A 2WTFA 4OX9J 5ETSA 8ICEA 4ICLB 4M3YA 4DFJA 5LSRA 3LWMA 4MMOA 5J0WA 2L9NA 4O0JA 2FJBB 2QGFB 2A1SA 2CIMA 3L2VA 1Q86O 2PI5A 2MY7A 4CZJA 1IJJA 4FN5A 3V6DA 3WXIA 2P51A 2F77X 5AQVA 4XH4A 1NSAA 4H5TA 2W25A 1WEZA 4J9LA 4I69A 1X8DA 2RRDA 2HHTA 1EWRA 1FKAF 1ZYQA 3BDPA 2OELA 3A5MC 1XWLA 4RQ7A 1TFYA 3QIPA 2BZ2A 3KK3B 2D0BA 4BVOA 1XN9A 5SZTA 2F9JA 1QQ5A 3D3BJ 1ZPWX 2A2CA 3VGMA 1W2BM 3D67A 2HRUA 1YJVA 3OUYA 2O67A 2ZUBA 5KT2A 3KK1A 3P31A 3OYDA 3AA3A 1RWNB 5AK3A 3HVRA 2BH1A 4DSJA 2EFNA 1DURA 4J91A 5CYQA 1BG3A 4L8RB 3K58A 1LWXA 2DNZA 3DRPB 3UNYA 4ED3A 2IYGA 2BEFA 3O9SA 5AI8A 4DV0J 3RWUA 3BS5B 3H8YA 3THWB 2ADCA 3DWLA 2ZJRL 2D3DA 3CXCR 2HQ3A 2IS3A 3QBXA 4KLTA 2PA3A 1J97A 2XSJB 2HZAA 2DNOA 4RW9A 3GE1A 2NO5A 1U2RA 4B3OB 2P9LB 4IZ9A 4H8KA 2O8BB 3ILOA 1IG6A 5RUBA 4CW7B 3V72A 3OR2A 2ZM6J 5K8PA 4DQ8A 3R9KA 2WK4A 5KRSA 1DAXA 2EZZA 2F8EX 1DLOA 3GB0A 4DZDA 4F4WA 1QVGM 5C15A 3KD3A 3OTOJ 2C3OA 2HI0A 5ALMA 2PT0A 4L76A 3QGHA 2BJ9A 1WBDA 4M8LA 1N8RT 3IG5A 4OI0A 4CEAA 1AT1B 1K1SA 4UUXA 4NZ7A 5CE3A 4GVBB 2ZIUB 4EBEA 1I1GA 3QFWA 1N61A 2F40A 4WP8A 3QBCA 4IDKB 1XC3A 5C7PA 4DEZA 2MAXA 4GXKA 3SQ0A 3NVWA 4PG8A 1P6TA 1QTNB 5AQZA 4QPTA 2BZFA 4QZVB 1TK0A 1HRHA 3D2WA 1SUQB 3U7JA 4YR2A 3CJQA 4GV6A 2AGPA 3AEVA 4DR2J 3JPRA 4IG3A 2UU9F 3T6BA 4K5RA 1KVKA 3F44A 4JK1A 1M1KO 3TVKA 2EZXA 5AQKA 4CJ7A 4DX7A 1N33F 4KGVB 4UY8O 1HKAA 4USAA 3QWUA 3NVZA 4R64A 1PYTA 4DG1B 3N4MB 4C6AA 4OI2A 4IYQA 3RMBA 3I32A 2HB5A 2EWHA 3OL6A 2NYVA 4ZN3A 4DTJA 5DETA 1UAWA 1IVZA 2L41A 9ICWA 4USVA 5HMWA 3WK8A 3R1HA 2GJFA 3WHIA 1OXJA 4KE5A 2ASYA 1ZTWA 4BC9A 1CZ9A 2FHMA 2FF3B 3Q8UA 1NNDA 2C2ZB 3QO9B 3SAFA 1RQLA 5EX0A 4NE9C 5DDPC 3VESA 2Q3SA 2LLZA 3HZEA 5E3AA 3GBTA 5KFMA 4X64K 4HI1A 4U7CA 3AOAA 2M88A 3MPWA 1MLAA 1GLDG 1EO1A 5J2FA 3AO2A 1JLEA 1EP4A 2ZC3A 4LQ3A 2WSEC 1M5VC 3JSRA 4FWQA 2Y8WA 2LI6A 4DR1K 5AM5A 1GMVA 5LMNK 4USJC 4IOCL 8ICQA 2DR8A 2G5IB 3DOMA 2RN2A 2NXCA 3TNVA 2ROGA 1WTBA 3ZCMA 4QOZB 3VQ9A 4GC7A 5ALSA 5KFSA 2GQQA 1HBNA 2B4UA 5AKJA 5EXWA 2OPPB 2VC0A 4QR1A 2YJFA 3ZEUA 2ZOMA 4JKAA 1UJ6A 2DNNA 2AZ1A 1T9TA 3L95X 3CO0P 5B8HA 3BH7B 2RD5C 2FQQB 4FJGA 4ELVA 2BPCA 4JHDB 2HZCA 3CT9A 4MIBA 4OV6A 2RS8A 4USIA 2Q1NA 4GMJB 4FF2A 1VQOS 2HOQA 5C2DA 2AEFA 4M9NA 2OYQA 3IV6A 3OGUA 2XLJA 5J2KA 4MF8A 1SS6A 4DV2K 4I2QB 2FJWA 2W9MA 2IRUA 4WE1A 4KLSA 2GO8A 1RA6A 1RTIB 2EI5A 1WLJA 3AD8C 4O4GB 4I6MA 1HQEA 1IBKF 1TL3A 2HHUA 2UXDJ 2LYVA 1YBUA 1ZZFA 2ZWHA 3JAMO 2CDQA 1YT3A 8ICRA 1S6QA 3TVZA 3K75D 3J7AP 2M7SA 1OY6A 1A6SA 1Q8IA 5GAHI 1WOPA 1CG2A 2AH5A 1TL7B 1ECWA 3VGVA 4JN4A 3BQ1A 3JXUA 1G15A 4CEOA 3IBFB 4K4GA 2B9WA 1WC1A 1WSFA 4Y2SA 5HRPA 2B9YA 1BQNA 2IPOB 2VQEJ 2OTJN 2E5JA 4Y0WA 1KTVA 2YNGA 1HHQA 3AHPA 2H54B 3FE1A 3PRBA 3HOSA 1KVAA 2E8OA 3C6UA 2CQCA 1RBSA 2W8KA 2VH7A 1O13A 3V1RA 2F7VA 5IT9O 4NMXA 2LXIA 4JMUA 4OYWA 4A8XA 4BRMA 4BC3A 2CQDA 3MTKA 2KO1A 1CJKA 2YHYA 1U25A 2GWJA 1FEEA 4JS4A 1TVRB 4WU2A 1LWEA 1YHQS 4FZNA 4DUZF 2ZTEA 2KXNB 1L7OA 2B4JA 4N8NA 5J2HA 3FCVA 1RDBA 3ILIA 3NRWA 5DZ6A 4B9SA 4OHXA 2N3OA 2XZTB 4USMA 2DPIA 3W61A 2V2VA 2ALZA 5J2EA 3PY8A 4B9LA 1CXQA 1YK9A 2ZE2B 1TKXB 2MLXA 1DK2A 5HRSA 4DL2A 4N8OA 3DLJA 4RNHA 4M5DB 5IXUA 2IMWP 1YKWA 3LWLA 1HW9A 2OPRB 1EQMA 3IM1A 4RU2A 1ZQZA 1IKXB 2AGQA 4C2MA 1WJ9A 2XRIA 4AM7A 2J76E 4RBTA 2XCPA 3O3LA 2XMUA 3ZT1A 1RWVB 3A8KA 2PFPA 3IWNC 3O9RA 1G2EA 2H3EB 3T69A 1F0XA 1WKJA 2P9KA 4JI7K 4DCOB 2BJ3A 2MYFA 5LM7E 3OJSA 3OFGA 4UW2A 2VYPA 3CJ1A 2DNQA 3SAHA 1NDKA 4Q5VA 3MPDA 3OS0A 2DGVA 2DPNA 3AAPA 2J7UA 3MCPA 3O4NA 2DNYA 3CM5A 3Q8PB 1WG5A 1VBZA 1KOOA 3ZYYX 1N5XA 1ASVA 2XY5A 1HNZK 2FSKA 5HHIA 4JAXA 2GMHA 1VC0A 4HEA9 4XTTA 1V85A 3CJKB 2Z1HA 4MTPA 9ICGA 1FO4A 3W8GA 5ALHA 5E3PA 2CXYA 1IQTA 3P38A 4ID5A 5HLFB 1VQ6S 2D0OA 2HYIB 3BS5A 2PIIA 3R5GA 3KK2A 5KFYA 4KC5A 4OJLA 2XVTA 2J0SD 3GQCA 2NSCA 1FKPA 2QWRA 5A6WA 2P9CA 1PBUA 1R6VA 5E33A 3EJMA 5AKKA 1I94J 4CO0A 4M5JA 3S6EA 1Q3UA 4O5EA 2P9EA 2VPXB 1SJRA 1ZM2A 3MGHA 4GKKJ 3ZTOA 2KJWA 4DV7F 4LF9F 4LSLB 4K0KF 4KHNA 3ZD9A 5KFQA 4UW9A 3TSUA 2RHSB 4JKHA 5DDRC 2PFDA 2NR0A 1B4SA 4I2PB 1OPIA 5CB1A 1X4HA 2CPZA 2VKRA 3UB5A 3C95A 1P9QC 1KW4A 4IJNA 2KG0A 4ILHA 3OVBA 5EN1A 2E7WA 1X6IA 2E5SA 2NUHA 2QKBA 1ZETA 3CTRA 1VI7A 3THXB 4WCEL 3WZ0A 1IKYA 1ASWA 2X7IA 2ZUCA 3RMAA 3DRYA 5CZXA 4FOIA 4DN0A 1VBKA 4QAGA 2UVWA 5AM3A 4Q8EA 4DTUA 7AT1B 2KYZA 3CDEA 2E1YA 3D2EB 2KRBA 8ICOA 4V1Ak 3TWZA 1WSHA 4JK7A 2OD6A 3BSNA 5BOLA 3GOIA 4J2AA 2JZBB 3UKUB 2E5GA 3LP1B 4U95A 1HFEL 1HWJA 3QEVA 4DR3K 1PYSB 3CJ3A 1WSRA 1A5WA 3OYAA 4S0MA 2JEGA 4JKCA 4EX7A 4LUBA 4ECWA 5D15A 1IWGA 5ALGA 4HUGA 2BMBA 4AXIA 2KHCA 3JSYA 2CQ2A 3LZIA 2IDOA 3F5EA 4DF4A 4Y34A 3HPOA 5DBBA 1OKJA 5CY4A 1X5TA 2O3DA 3RBEA 3MM8A 5ETPA 3ZFVA 2I7PA 2P66A 2R8KA 1SJ3P 4DS4A 7FD1A 1W26A 3V9XA 1UT5A 4QJVA 4A8QA 4OFZA 5CABA 3UNGC 2GVDA 3HHLC 1UW9A 3PRVA 4IUFA 2VCPA 4BG9A 4PL2A 1S1WB 2CFXA 5BR8F 3C21A 4C4TA 2CPRA 3D66A 4M0AA 1ZXIA 3OR1A 2UUCJ 4PPDA 2DBYA 2O4IA 1TV9A 4F7VA 3LGHA 2WW4A 3Q7BA 1XHXA 3MD3A 5AT1B 1OSDA 2KHVA 2X78A 4HL9A 4DV6F 4DQIA 3IRUA 2AQ4A 4MFBA 3D0GE 2BANB 1LKYA 5DM7L 1MDUB 1RCOB 1WNSA 4JRQA 4I2DA 4LFBJ 1B0PA 3QJLA 1A0PA 3C1YA 5CYMB 1YVFA 4CEEA 3A0HU 3VF6A 5J2NA 3WX4A 2K8GA 3DNCA 3MXJA 4QIWC 2VUGA 3LOUA 3E9LA 4IQTA 4FF3A 1YTYA 4DR4J 5AI6A 2FZGB 5TKWA 2XZDB 5HRNA 1HNXJ 2KI2A 1PC4A 3NGYA 4WZMA 3DI6B 4JI6F 2D5RA 3PIOQ 1FA0A 4DCCA 1R0CB 3SI6A 2OWOA 4YOVA 3NVKA 3MDCA 3K5PA 2FBVA 4O5BA 2KD1A 5B0AA 3EO3A 4FE3A 2QEXN 1JWWA 4P74A 2MGZB 2HMXA 4JHDA 2BJ7A 1CJVB 3G9CA 2W40A 3C14A 3K59A 1JB0C 1NKEA 4YY3J 4LR8A 4R0JA 4ZDNA 3CCES 2NREA 3BS7A 1IXKA 3SSSA 4KR0B 2WB4A 4FXVA 2EPIA 1S7IA 3R27A 2ZIVB 4DR7J 3EYZA 4I2QA 2VJUA 3K8WA 3JS9A 2VKZG 2KZ3A 3H4DA 4B9UA 3CJBA 1PIEA 3BN7A 2AMCB 1VQ5N 2BV3A 3R3TA 2A10A 5KFCA 4I6AA 2MQQA 3AO1A 3PR4A 1FEHA 2JNJA 4Y1CA 5KFHA 1RZTA 1LWFB 2NV3A 2RIJA 3R8EA 4RNMA 1LFWA 1P9YA 4KLOA 3BBBA 4CO5A 4PHTX 4YXJA 3ZT3A 4UB2A 4M6WB 2WVEA 3HFKA 1W7WA 2CG8A 5F0UA 3CCSN 4DS5A 2DVIA 3RH4A 5DM6Q 3FRYA 1VSHA 5CEHA 2D41A 1FE0A 2HOEA 5B08A 1FFGB 2NXEA 3VQ8A 5ITHA 2DO0A 2YPYA 1SJ4P 3HJEA 1SKUB 2A41A 2YQ0A 5HAOA 2ZBCA 4O5KA 4WQ5C 5AXMA 2VQFF 2BE2A 1Z4OA 2WAQC 4QR0A 3AH6A 5D46A 4RKUC 4JI1F 3RBDA 4OGEA 5IOLA 1IWAA 3FDSA 1Q1KA 4BDPA 4K4SA 3MWPA 4DBQA 4F02A 3AT1B 4E7KA 3D68A 1ZJMA 2IVPA 2E8PA 1JJ2R 5HRRA 3UVJB 3QERA 4USUA 3CC4N 4I2JA 1BWEA 3DMJB 5KOWA 2DHSA 4FLZA 3BDEA 3V1OA 1CJUB 4PKGA 1FWPA 3ULEB 5HR7A 3MECB 3JTNA 2R9LA 1XR7A 2HK2A 1TKXA 3VAIA 3DU6A 2DY4A 1WKKA 2YX6A 1VMBA 3RVCA 2OYYA 2ILZA 3MR3A 4K43A 3KLEA 4IDHA 2ZUDA 2X1BA 3EL2A 4ZVOB 3NDKA 1GLLO 2Y3YA 2N7CA 2DB1A 1EQYA 1QQ6A 1IKXA 1S99A 1BGXT 2HLUA 2UUBF 4RBVA 4CF8A 1YUWA 4CJSA 3M6KA 4EP4A 3QNMA 2KIWA 2CJQA 1X9WA 4BREA 3P8BB 3TEGA 2HF4A 3RSEA 4WF9Q 1Y3KA 2GFFA 5ALRA 4ECUA 2YBVA 3FYHA 5KFNA 3EPGA 5AQRA 4DL3A 2ISPA 1NDLA 4N5SA 4BLGA 1RJJA 2CPHA 2M5YA 1NH7A 3CCUS 4BCAA 2G9OA 4PL1A 4RR5A 2IVMA 3CCQN 3HSGA 3CJKA 4GKJF 1N32F 3KZBA 3A1YG 2GO7A 1SB6A 3RG6A 4LVSA 4Y2KA 1HI8A 5HLFA 3HHLA 1IV8A 3MPYA 3BGFA 1S4FA 2D0PA 1TZ0A 5AQLA 3CMEN 4TYBA 3L4IA 2GELA 3ZZZA 1ZM9A 4DPYA 1HLUA 5HMXA 3B4MA 2D1KA 1XQIA 2J6UA 4CLFA 4NY8A 2CPDA 4EHTA 4W5RA 3AXKA 4DPTA 2XMMA 1SH2A 2ROPA 1FX2A 3JPQA 4TY9A 5ETNA 4LJXA 3C2LA 2F1JA 1OPZA 1IBMK 5AIBA 1X5SA 3I82A 1PBAA 4NOHA 5A0YB 4X84A 5A2QU 4MKVA 4RL1A 2C42A 3KKSA 3HW8A 3I55N 1FFVA 4U7BA 4L74A 2Y9TA 1WORA 3UDEA 5A8KB 1NHVA 1HWLA 3B8HA 4DV1F 3P5JA 2VDIA 3G6YA 3QIOA 4J5OA 2CNKB 4C4RA 2CRXA 5BN8A 3ZSRA 2F8LA 3MGIA 1RAHB 1NGCA 4GO7X 2P9PB 3K1ZA 3LK9A 2P5GA 2PEBA 2DPJA 3F5AA 3TAPA 1U24A 2SXLA 1F6TA 1RAOA 2G1DA 3NAIA 3RUBL 3GR1A 4CZMA 2KXFA 3QJJA 4UB8U 4BUGA 3FSYA 3K0JA 1WF1A 4TXSA 4AL5A 2QWMA 2FDRA 5LJVA 1G4CA 1YJ9N 1FXDA 3P45B 5B0DA 1J2NA 2FJ6A 3UMBA 4DWIA 4FVMA 4QW9A 2ZIXB 5AKZA 2V4QA 3T1YF 2F65A 2Q6BA 4HUFA 3X3UA 4K8RA 3OBYA 3UPQA 3C15B 1AB8A 5IT0A 1K8KB 2JLFA 3MEDA 2CVIA 4UF4A 9ICOA 4KKOB 1U6BA 4F9OA 1KEJA 5JUMA 2UXBJ 1KSPA 3NF6A 5FROA 4GMKA 5ALDA 2CGKA 4P4MA 2E6MA 1MW7A 2IDEA 3M2UB 3R7NB 1R6YA 1JK9B 1LEOA 1T94A 4Q44A 3SDEB 3HXMA 9ICTA 1S1WA 4QOTA 5ADZA 1VBXA 3OYFA 4Y2JA 4YD2A 2IHR1 3FZFA 3ZSVA 2WHEA 2ZVIA 1TE2A 3ADAC 1RQNA 1LXJA 1RZMA 3D6RA 4DV3F 3D1OA 4BHQA 4F0KA 3BP8A 3S7RA 5BXIA 3NHGA 5LMUJ 4X62J 4W4MA 4KN4A 1G6BA 5LL6Z 1L5UA 3IGNA 5EE3A 4KX3A 3OTDA 4LF1A 2RNEA 2VFUA 4UB6U 2CJYB 4ILGB 3O1WA 2BJEA 5J0XA 1U1QA 3NF7A 2GMJA 2AEJA 4BR0A 1TGOA 3J81O 2E5LF 3O1BA 3LALA 2JLGA 1N6QA 4ZH4A 1S9EA 2UUAK 4RTFD 4JI0K 3M8YA 1GT8A 3CCMS 2M3DA 1KNZA 2ATCB 6FDRA 4DSKA 1U1OA 4I2BA 9ICBA 3EXYA 4TUQA 5IT4A 3M30A 4DUTA 3AB2B 3DRSB 3RJKA 5BPNA 3TARA 3VWSA 1Q81T 3THYB 1FK9B 1HL6A 2O8DB 4AE5A 1X6JA 2BJDA 2WAQD 2DHAA 1N34J 2DQNB 5IM0B 2Q36A 1UFWA 4EENA 5CHGA 3M1FA 4IH7A 1DK3A 4CLZA 3JPOA 2BBEA 2F8MA 1CJVA 5FLXU 3MMBB 2QWPA 2YWEA 4RUBA 4BRKA 1FIQA 3V6KA 3WIVA 3QEBZ 2B6AA 4ISEA 3EW9A 2E7XA 2N3LA 3GIJA 3PFOA 2NXUA 2GC8A 2V52B 2VWKA 4DHVA 5HP1B 4IFEA 2OP5A 2N4DA 2ZNZA 1ZQUA 3I5CA 1W9HA 1JIHA 5ETOA 2IDLA 2L5YA 3HM8A 1BQXA 4M41A 4B3RF 2J0QD 1V3SA 1LWFA 1S8OA 1QJHA 5KFEA 1RQ0A 4RW6A 1Q82O 5KFOA 7ICKA 3RRHA 2HG4A 4XDCA 3GFZA 3FZKA 4LF7F 2OAUA 4BDYA 2L9WA 3J80U 3G82B 2B5JA 3SCLE 3PJWA 2EZYA 3PVXA 4FYVB 3P4IA 1LW2B 2YX7A 3M1VB 4IEIA 4I2CA 1NU0A 2ZBIA 5BREA 2WB1F 2DFLA 2LEAA 4B3TK 2MZTA 2OIHA 5IWAF 1NGIA 1J53A 3MR5A 3T5KA 1U49A 1FRKA 7ICIA 4L73A 3G10A 1GLFO 3S9HA 3AB4B 3CJ5A 2Q0RA 3AJ2A 3H0MB 4BBYA 5M1NA 3PJXA 2EAPA 3J81j 2KE7A 3IWXA 3I5AA 3L5KA 3DMJA 1ZXOA 4KRFA 2VL1A 1NUEA 2WBMA 3N6LA 4LFCF 3MECA 3B9JA 4DX8H 2E66A 3KLHA 1URJA 2V67A 1N5VA 4CO1A 4OZ0A 4ZJLA 4I2GA 3TTDA 2V8GA 3WQPA 4Z94A 2KVIA 2V34A 3A3OB 1WSJA 1SC1B 3BF1A 2CXEA 1KKXA 2OTLS 1BHNA 3UDVA 3AU2A 2VOPA 2DJWA 4CIEA 5KPTA 1RM6C 4CD1A 4X66K 1YJRA 4QZIA 1APSA 1NDCA 2NS1B 3KLFA 3ZTPA 2L08A 1SAZA 1HUXA 2LYBA 4DCHA 4UB5A 2QA4N 2YKOA 3BZKA 3NMRA 3FQKA 1YZ6A 2PSZA 4CECA 3AD7C 1X0FA 2HHXA 3SUNA 3THPA 1ZQBA 3W2WB 4DQPA 4C0BA 4UOCA 1ITGA 4CHQA 4YR3A 5F8GA 3AVJA 2V6AA 3OL9A 2AXTU 3LM9A 3ILLA 3F2CA 3CSKA 3O3GA 2G2ZA 5ALVA 5L1KA 3N7RC 3BJYA 3J8AA 4DUYJ 4XH5A 4BRNA 3RGIA 1KCFA 1N48A 2CJ9A 3MD1A 2E20A 3V9ZA 5T41A 2LQ8A 3NGTA 3FEZA 5LJ5Y 2KOBA 2HFVA 2XZWA 2OANA 2G0IA 5F8JA 1ATSA 5HJYA 2FPMA 1LAWA 2MU2A 2KVCA 2IY5B 2EVZA 1XNRF 3NS5A 4HTUA 1UWBB 4FLTA 3M8WA 3CD7A 1JKHB 3M5RA 3AVMA 5A0YA 4KB1A 4P0PA 4CJKA 4KV8B 5BYRA 1YITS 4J9NA 2GAGC 1TAQA 4AQYF 1UVIA 3C29A 5AQYA 2YKNB 3C8YA 1WG4A 1RU2A 3WNHA 3ZT2A 3DFEA 1VSFA 2E5IA 1G3OA 2QC3A 2P9PA 2G5HB 9ICIA 1JMTA 3IC1A 1HMVB 3V4IB 3CJ7A 2WF7A 2BW7A 3PTWA 4U8YA 3JXOA 2FTRA 4H03B 3E9PA 1QAIA 2P9UB 4OX6A 4Y2UA 4CK3A 3SJJA 5AR0A 1K44A 2LECA 4BGAA 4O5CA 1FJGF 1XU4A 4K8XA 2NLWA 4CE6A 2V7YA 4QZGA 3JTOA 8RUCA 3UW1A 1Y00A 3IAYA 5DJBA 3RB0A 3SPZA 1VSMA 4EBCA 5GADP 3KFWX 4YQWA 3KNGA 3SPYA 3OJUA 3PM9A 2GJIA 1SH0A 3GZ7A 4NXNJ 3ENHA 3W2VB 3LP0A 3KWMA 1MWQA 2HK3A 3TR5A 1SC6A 1K8KA 1OJ4A 3H5XA 1RHRB 2BQ3A 5I9EB 1U1PA 3MBYA 3QU2A 2XCAA 1VQ4S 4XQ8A 1XC9A 1BIZA 3MXIA 5GVQA 8ICTA 3LPEA 3FKBA 5D0GA 3EE9A 3KD1E 4C8NA 1CS4A 4NYOA 3H45C 4E1NA 2V63A 2HS0A 2G07A 4CRJA 2K4EA 1ZQPA 4HVZA 5FD1A 1Y88A 2D69A 4FWRA 1Q79A 2CJBA 2X3DA 1XO0A 2JH7A 1PUZA 4YOTA 4M45A 9ICSA 1WCLA 1RAJA 3VAHA 3IM9A 4LBHA 1S4EA 4I67A 1V3ZA 3GYGA 3UDLA 3H8JA 4E89A 1JJ2M 4HLBA 3RJJA 4DCJB 1E4FT 4CZKA 3PIPQ 3I9V9 4ZS6A 3GG1A 1YLXA 3LDLA 2Z0GA 4OYZA 2EC0A 3JPNA 1KQGB 2A6MA 4DV4J 3OV7A 1VJWA 1S59A 2HBLA 4C80A 3AOCA 3C16B 5C42B 1QQOA 3L4PA 1L6NA 3OYBA 2BUPA 4NXMK 3VQQA 3BY5A 2D3OR 2YKMB 2DGZA 3VEWA 2A40A 2R2TA 4E98A 5C25B 3AQPA 4NLOA 5EHHA 1F60B 1CULB 3VA3A 3BYPA 1ZQYA 2F9DA 2OSQA 5ELZA 2HBKA 3TR8A 4PHDA 2ZUAA 2KSOA 4BXOA 4LF6F 3THVA 4CFBA 2HVDA 1UVLA 2ZJQL 4A62A 5BR9A 1RT7A 2EBEA 2Q43A 3EVOA 3MMBA 2CQ0A 1TV6B 1DKGD 5D4OA 3IG1A 3T1HK 3QNNA 1ZBIA 1SIWB 1BWVA 1OW5A 3HI0A 2KW4A 5E26A 1HBMB 1J5OB 2MMYA 1M90O 2OUGA 4NLCA 2C2MB 2G13A 3UMCA 3M6XA 4IOBA 1RU1A 1V97A 1KS2A 4CGGA 5D3GA 4BR5A 1VQ7S 4DDFA 1UA1A 5LT5A 1U2CA 3H0PA 3TX8A 4F36A 2PY5A 3ITHB 3M8QA 3WXKA 3M2VB 5AQOA 2CGJA 4C8OA 3NGIA 1S1TA 1BY9A 1T0TV 2PA8D 4EHUA 4KLHA 3K5NA 2MQMA 1S1XB 3IP4B 3AD9C 2OJ3A 1VAZA 2LQ9A 4JP8A 3NAEA 4WTYA 3M1VA 5DLGA 1N33K 1L3UA 5E41A 2NXNA 4KJIA 2P6RA 1C2PA 3FZ2A 2Y1JA 5J2QB 4HT5A 3MMCA 3ZC4A 2HRTA 3C5GA 2EK1A 4PHEA 2FGCA 2K3KA 3L0QA 1RBOB 2RAQA 2M9KA 2OMLA 5J0RA 3IWLA 1T3OA 3AA4A 2VHGA 5KT6A 4GXIA 4GRSA 2ZZMA 3CERA 1SQEA 4CGIA 4EIAA 4UQTA 3RJHA 1NPKA 3FBCA 1UEVA 4CJPA 1UEUA 3C66A 1ZQXA 2EAMA 5ALLA 3DN9A 4FJLA 1R59O 3L7PA 1YQHA 1WDDA 4DR5F 3P3DA 2NLXA 2DNMA 3MCSA 1VS3A 1H98A 1FX4A 2EH9A 4F67A 3RB4A 5HMYA 2Q97A 1ZBHA 4E7IA 2QK9A 2LXUA 3MEGA 4DL6A 3OD2A 3G6VA 4G3IA 5HATA 1HPZA 4I68A 4A61A 4K4IA 1RT4B 1C1CA 4ED8A 3NGZA 3QLHA 2H51B 4RQ1A 4FM0A 3FLCO 3DLRA 5HN0A 2F1IA 5IV3A 1U1KA 2HURA 2LYAA 2GIRA 4FWNA 1ACMB 3KG1A 2NQPA 3ENOA 2DNHA 3W2WA 4RLEA 3ZSXA 1IJFB 3I0SB 4RUCA 3T9ZA 3AQFA 4K4UA 5AJ3J 3SENA 4P0QA 5LMNF 2GGPA 1ITPA 1U9LA 3SQOP 4CLLA 2Q31A 3K8VA 1Q8LA 3Q86A 2RDIA 4EYHB 3LVWA 3ZD8A 2P5VA 3C23A 2K4HA 2XI2A 1HIYA 1QD1A 4FK0A 1IBKK 4JV5K 3OYHA 3VTHA 1I51B 4C3LA 2HGLA 3ICLA 1Z00B 5JVHL 3WK7A 1NNEA 3Q8VA 4YMNA 2H5XA 4P10A 1HPMA 3A0BU 2BR0A 4BWJA 4Y28C 2XQCA 3ZZ0A 1KAXA 3EKSA 1MWKA 1HBOA 1O5JA 3MF5A 4DV2F 1SIZA 3MDFA 1C0MA 2KVSA 3SV3A 4YOUA 4CF0A 4M5LA 4PG4A 1DQ8A 5J2CA 3F9MA 1JUDA 4Z7CA 3TADA 4F3MA 2ZKTA 3I76A 4B17A 2Z2ZA 3RBXA 4Z37A 3PYGA 1UETA 4OZ1A 5J1EA 4GIBA 5ALWA 1XSNA 3AUOA 1VQPN 4KB7A 2WFAA 3VF0B 2PYJA 2ZITA 2YKNA 1K73T 4EZ6A 3UN3A 4F72A 3F56A 3R97A 3S1TA 4CNQA 1D5AA 2W6KA 1RNHA 4BE1A 4ZKAA 4ZIVA 3NKYA 3I33A 4RQMA 4DUZK 3HVAA 3MUTP 3PNCA 2Q0ZX 3UM9A 1TL1B 4KT0C 3OSNA 4L3KA 1RACB 4YDDB 4RO0A 2Q6CA 2A1AA 4OLPA 3FVYA 4I2IA 5C2CA 4QS9A 4UB1A 4H0XB 2F8HA 5E5NA 4AFFA 4HTIA 4MLEA 1F2HA 4BACA 1HIWA 4NWIA 4CF5A 3LANA 1RHQB 2KDOA 1FRJA 3HCXA 5AQWA 2W03A 5MLCQ 3O2IA 4NYPA 1ZOTA 3UD5A 3QSIA 4BR9A 1VC6A 3DXMB 4OJPA 3L2UA 7ICPA 4IQUA 4ZVFA 4CYUB 4C4SA 3KJNB 3CCRN 1HBUB 4QIGA 3MMAB 4UATA 2LP4A 3CCLN 2P2CB 1QUVA 4JKBA 3GG0A 2DIUA 2COLA 3BYRA 2QTDA 4B1ZA 4ELTA 2VOOA 4WJBA 5D8HB 4X4QA 4Y0FA 3PSIA 2C3MA 4ES3A 1QSSA 2GVZB 2RH3A 3IRXB 1AW0A 3KHLA 4ETXA 3CMQA 2ZGZA 4NLGA 5AE2A 2YTUA 5C0YA 2OO4A 1QAXA 2XWYA 2AWZA 1NSKL 2AX1A 3L9ZA 3O6WA 3BSOA 4WFNL 2BXJA 1TL4A 3QMLA 1J2VA 5E0OA 1ZC6A 1UW4A 1RAFB 4A4JA 3D2NA 1AZSA 1PZNA 2YPZA 7ICGA 3S01A 1R3NA 3QEIA 2R7TA 1HNZF 5BRDA 2ZEJA 5AE3A 3OLAA 4IC9A 1RXOB 4Z7YA 4PXDA 5K8NA 2AKWB 1B0VA 1Z26A 1Q46A 2XGPA 2X1GA 2VGMA 3H40A 3GE9A 3SMSA 2H5IB 5C25A 1CJTB 2QYCA 3IKMA 4YUDA 1RBRA 1Q7LB 2VB6A 3NGDA 8ICFA 4PG5A 1MA7A 1QE1B 1VK8A 2R7XA 3SEIA 3V9WA 2YH1A 3HPHA 4C98A 3UKRB 2XHCA 4I7FB 1OMSA 4DHYA 4ANEA 2EFOA 2KMDA 2XEXA 4GW6A 3P1GA 4A5AA 3ENVA 2YHAA 2BVZA 3HVTB 2LEBA 2YHBA 2QA4G 3VAMA 3OPXA 4KRWA 2A1BA 5DRKA 3OL8A 4CJ4A 4M04A 1IBLK 2W9CB 3OFHA 1BCMA 3FFIB 4ZOSA 5A8RA 4TURA 3KHYA 3AY0A 5DDQC 5EX5A 1BI4B 4KMOB 5DGAA 4OX9K 2PMWA 1FFWB 4PPZA 4UASA 1XSLA 3NWGA 2VA8A 4H4OA 4LH5A 2G8UA 3JSMA 1TU0B 3CCJS 9ICLA 2Q2RA 1Y64A 1KFSA 2EW9A 4JB8B 3N4WA 4LMZA 4YOYA 1BA1A 2DISA 5KGWA 3QU4A 1RLCL 5JLHA 2CWXA 4WFBL 4NRTA 2PEHA 3HJFA 4QCLA 1QSYA 2HBQB 1ELOA 1UAXA 4OJ1A 1YJNS 4NJ8A 2W9AA 2QE5A 2V4JB 4DR3F 2A0FB 3GSIA 2HVEA 3PO4A 2HFSA 3FZBA 1LVHA 4P4OA 1GTEA 1TQLA 2KYXA 4KLUA 4AH9A 1XMQJ 5G5HA 5KQDA 2ZG6A 4H0TB 4HH0A 1ZRNA 4BC7A 3R8YA 2P35A 1S5ZA 2ITMA 2W1BA 2FLLA 4QZBA 2MKSA 2O66A 3TA0A 4OPAA 3BGRA 1RHJB 3MCMA 5AQTA 2YB4A 2FUG9 5DO2A 2WONA 1OH6A 4F4XA 4ANDA 3W0LA 1HQ2A 2UVUA 4R8UB 4KHPJ 4DFPA 3MM5B 4JB3A 2LQBA 1M5SA 3IMQJ 1RHMB 1D9DA 3TTFA 4TY8A 1RT3B 5D6GA 1FERA 4QZAA 2ZIWB 1FJ7A 2D7SA 2AIRB 4BRPA 3Q0AA 1Q78A 3C6HA 4OLAA 3DXKB 3GV7B 4RWWA 1WEXA 4DF8A 4JI6K 5AQNA 4OV1A 3C1ZA 2B6GA 2OPQA 1NK7A 2QLJB 2ZM6K 2DR7A 1LW0B 2MQLA 2RQKA 2XYGB 4R5PB 5K20B 1KXPA 4FJ9A 3HO1A 3CPEA 3MR7A 3N5BA 4UAUA 3NY0A 2WB1C 1CBKA 4TLRA 1NLKL 1MROA 1Y0HA 2MJNA 3BQTA 1U8WA 3PJ9A 3OTOK 3X1LB 4Y3CA 4KSEB 5GAEI 4FJNA 2R8HA 3GDQA 2P9SA 3NNCA 1IIPA 4IL6U 2DFFA 2FSNA 1OY8A 4ECQA 5G0RA 1E6YB 1WC3A 2BTFA 2CGLA 3MN7A 1HEKA 3JAMY 5F8IA 2H5JB 2J7WA 3MI7X 4ZP9A 5FPDA 2DR5A 5AQSA 1J5EF 2G1HA 3MAQA 9ICUA 4X4NA 3KYLA 8ICHA 4Z2XA 4CLTA 4KLQA 1X31C 2RLTA 5FIIA 3D1HA 9ICVA 4NLPA 3L3UA 4URSA 3POTA 5AZIB 8ICAA 4LT6A 1HD0A 2MHEA 3PCOB 2LVWA 3TKAA 4AHSA 4JI5F 4DR2K 3MM7A 4AF1A 4PQAA 2ZHAA 1RKIA 4C0HA 1JRPA 5IT9Y 4FNHA 2CZ9A 2D1CA 1GOAA 2ZGYA 1XR6A 3QE9Y 2BX6A 3C19A 4Y2IA 3MXMA 1RWPB 4K4WA 3UCGA 1SWVA 1NM2A 4DSIA 8ICZA 3ALYA 4ED0A 4M5KA 1M0SA 3CDWA 1F1BB 4DPXA 3D3CJ 2MZ1A 5BRHA 2DF4B 4C8LA 1M5PC 2E4LA 6AT1B 5DG9A 3E1YA 5JICA 1VHXA 2QARB 4CT9A 5C5JA 4OI1A 2VG7B 4DU1A 1QQMA 2F4VJ 4AILC 3FSXA 2BRLA