4E0DA

Binary complex of bacillus dna polymerase i large fragment e658a and duplex dna
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIALRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural factors that determine selectivity of a high fidelity DNA polymerase for deoxy-, dideoxy-, and ribonucleotides.
pubmed doi rcsb
source organism Geobacillus kaustophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 208
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4e0dA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4e0dA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e0dA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e0dA01
3D0PA 4DS5A 2R8JA 4CFCA 7ICNA 4FJJA 3H08A 1VSFA 3Q8KA 3FFIA 4YMNA 3AO4A 4FJLA 3HP9A 4KV8A 2ZJAA 1C7YA 4DTNA 1ZJNA 5HRNA 1XWLA 1SKWA 5L1JA 5J29A 3I8DA 1TK0A 3RH5A 4RUCA 4CFAA 3H40A 1HYVA 5DGAA 4ELTA 4LD0A 4RPZA 4OGCA 3QZ7A 1CEZA 4IG0A 1ZETA 2G8KA 5BOMA 1BPDA 5DLGA 5KFKA 1JLBA 2I9GA 2RF2A 1RT2A 1CUKA 2W8KA 4DSIA 3CYMA 2PY5A 2ATLA 2R8HA 1NK5A 3TR8A 1RBRA 5E41A 5I3UA 4Z6CA 3NF7A 4F2RA 1BHLA 4FBTA 3NTUA 4CJEA 4AHSA 1HRHA 1L3VA 3VQ6A 3JPRA 1BI4B 1LWFA 4BDPA 4CEDA 2W8LA 2B5JA 1H38A 5EWGA 3MFHA 3QEPA 3V9UA 2E6MA 3CFRA 5EOZA 2ZJ5A 2KFZA 1ZQQA 5HMLA 5F9LA 1UT8A 2YKNA 4DTRA 4I2PA 3OSPA 3GIKA 4KAZA 4M0AA 4E19A 4CJWA 3KLIA 1VSIA 3UXOA 2Z1HA 2AQ0A 5D4BA 2VG5A 3HPGA 4CIFA 4B9MA 4CHOA 1SL2A 2ASLA 2JEJA 1NOYA 3QZ8A 1SV5A 8ICZA 3V81A 1A5VA 1TK8A 4I2JA 3NHGA 3HK2A 1C1CA 4FVMA 2FBXA 5IIJA 3ZDBA 2D0BA 2W9AA 3V6HA 4ECYA 4F92B 2Z1IA 4ZHRA 7ICFA 3RB0A 1KFSA 4DL4A 2G8VA 4F5QA 4M3RA 4RPYA 5KT3A 1ZQKA 2P5GA 4EBEA 4BWMA 3KLHA 2FLNA 4MEXA 5DGBA 3SNNA 8ICRA 2IA6A 3PO4A 1MSWD 4ELVA 4O0JA 5KFTA 4HUGA 3QEXA 1D9FA 4M3TA 2W42A 4DU3A 3QESA 1XS9D 3LP3A 2BPCA 4DQQA 3TQ1A 3AVFA 4DQPA 1RTIA 3V6KA 4QZHA 2ISOA 1HJPA 4DOBA 3QERA 8ICEA 1K1SA 4RG8A 4UBCA 3WNGA 3NF6A 4E7JA 5KT5A 1ZQMA 4QZDA 5DB9A 4KN4A 3T5JA 4B08A 3V1QA 3M9OB 4M9LA 4B3OA 1RBSA 3AVLA 4FJNA 2F1HA 4KKOA 4O0IA 1N5YA 4DOCA 4MF2A 4I2DA 5IINA 4I2QA 7ICSA 1RYRA 3LDSA 3VQPA 9ICSA 3EYZA 2FMQA 3SQ0A 2BQ3A 4DFKA 4IQVA 3T19A 5FDLA 1U04A 1WAJA 3SI6A 3HPOA 2OPQA 1J9AA 4MF8A 3AVBA 3KKRA 1KVBA 3ASMA 4CE9A 3G6YA 4QZ8A 3AU2A 1QLNA 3MXJA 3O3HA 3C23A 4FZYA 2DPJA 4O55A 3SUQA 4IBNA 1NOMA 2OPSA 5SZTA 2QKBA 4BDYA 8ICBA 1LWEA 2I1QA 1IG9A 2D0CA 9ICLA 3NH1A 4DL6A 3OYMA 1BPYA 3SUNA 5L1IA 4ED1A 2JEIA 5KFFA 1TKXA 3RR8A 4B9NA 4MEYA 4C8OA 3GV5B 3NBPA 2G8IA 3ORYA 4KLDA 8ICCA 1A76A 4HCCA 1C0MA 1FKPA 3WNEA 4KLFA 4IFYA 4E7IA 3B0XA 3JPTA 2KN7A 4RQ3A 1B9DA 4KLLA 2OPPA 1LWCA 4NYFA 3AVIA 3QEVA 1VSKA 1J5OA 1SKRA 3RRGA 2ZQBA 1ZQGA 1TVAA 3U6FA 4QZIA 2RPIA 5K14A 4ZTJA 5KG6A 3K5OA 4EP4A 5KFVA 3LDAA 2HHVA 2BANA 2IC3A 5KFCA 5KFAA 2ZD1A 1RBUA 1TV6A 4HTUA 3PW4A 1IKXA 3ULDA 3SQ4A 5KFBA 2FPKA 1S77D 3AO2A 4IQUA 3SUPA 5FROA 8ICXA 1TFRA 3OYLA 4O9MA 2PYLA 3TAMA 1BI4A 3VQ9A 3K75D 4KLEA 3JPOA 5KFWA 4I2AA 3EWAA 5L1LA 2IHNA 5DG9A 1UA1A 3OYBA 4QWEA 1U9LA 1VRUA 2ITGA 4CJPA 3TAFA 3AUOA 3MEDA 2FC0A 1X2IA 4BE0A 1JL1A 3MEEA 4Q5VA 1BISA 2O4IA 4E7LA 5D49A 4ED0A 2BQUA 4IDKA 1HNIA 2OA8A 2R8IA 1C0TA 3V6JA 7ICMA 4I2IA 1GOBA 5L1KA 7ICOA 9ICJA 3DRSA 4GXJA 4J9PA 1WSJA 2F96A 2HNYA 8ICKA 1KVAA 1RT4A 4FYDA 4RT2A 4FK0A 1WSHA 4C8LA 4O3QA 4R63A 2MUTA 2KW4A 4YG2A 1U48A 5JS1A 1ZQTA 2XY5A 2A1SA 2G8UA 3ETLA 3NH2A 3GDXA 4HVJA 1ZQXA 4H8KA 3PW2A 4DSFA 5KFIA 5IIMA 4TUQA 5KFOA 3RB4A 2VANA 4PHEA 3N4MB 1T05A 4F4YA 4ECZA 3B6OA 3AVMA 1S1TA 4RNMA 1KLMA 4YP3A 3ZSXA 4QZGA 3OYAA 4DU4A 3OYKA 1S1VA 1EXNA 3UXPA 1Q8IA 3K58A 3C21A 5J2BA 2JZBB 5FRNA 3PVXA 3HO1A 2H5XA 4DFJA 4CGJA 9ICKA 1QSSA 3E2EA 3VQ5A 4QW9A 4F4ZA 1TAUA 3OYGA 2PYJA 4KLGA 3ZD8A 2HHQA 3RJKA 5HP4A 3G6XA 3IHQB 4M04A 1F21A 5KFRA 4BWJA 4O5EA 1L5UA 4XUSA 8ICGA 4YFKA 1ZQLA 3OYHA 4FLXA 3H4DA 4RW4A 4CIEA 1QS4A 1YVUA 4DFPA 3PY8A 4C8KA 5KRSA 2R8GA 7ICHA 4FW1A 4HCBA 1BCMA 1L3SA 1SL1A 1ZQYA 4PGXA 1ZQRA 3RBDA 4J9KA 2F1IA 1XHZA 4KLTA 3RTVA 4YN4A 2GV9A 4CFBA 5J2CA 1XO1A 2HNDA 4EBCA 1LAVA 4R8UB 1TKTA 2F8SA 2I5JA 3VQBA 2LYHA 2IBKA 3E01A 3KHGA 2W9BB 8ICSA 1XU4A 3HX0A 3DLBA 4ECWA 1MQ3A 4CF1A 1RNHA 2DTUA 1S1XA 4EEYA 4CJTA 4O3RA 3RMCA 4NYNA 5HNKA 3DLRA 3PW5A 2WONA 1RXWA 1QE1A 1EETA 1C6VA 1X9MA 2DFEA 4CGHA 4P2HA 3SV3A 8ICLA 7ICJA 2DFHA 2ETJA 3LZIA 2AGOA 1NJWA 1GOAA 3UQ2A 1KCFA 2IS3A 4E7KA 4Q0BA 3MBYA 1ZQEA 4E7HA 8ICUA 3ALYA 1ZQWA 2NRZA 1SZPA 3L2RA 5KFJA 2IAJA 1BIUA 3OHBA 2FPLA 4CK1A 2GWSA 1NJZA 1HQUA 5DBAA 3OS2A 3PR4A 2BCRA 4PWDA 1SUQA 2ZTDA 3TANA 2C2DA 2J6UA 5DDMA 1B43A 4NLGA 5BPCA 1JXLA 4YVZA 2HMIA 2NRXA 1JIHA 3P5JA 2G8HA 2C2RA 4FLZA 3BQ1A 3DOKA 1BQNA 1WN7A 3OS0A 4HUFA 5HLFA 1HUZA 9ICFA 4CHQA 3BDPA 4QZ9A 4F8RA 1QHTA 3MR3A 3MAQA 3GIMA 4N5SA 1RT6A 1NK8A 3K5MA 1WAFA 4JV2A 3TAGA 4E0DA 2HVHA 5EWEA 4RQ5A 4M9NA 1JMSA 3FYHA 5C42A 4CGIA 3AVKA 4DSLA 9ICNA 1S6PA 4QAGA 1U45A 5SWMA 8ICAA 1EKEA 1EXQA 2PFOA 3HP6A 2FBTA 3VQ4A 3THVA 3TFRA 4CHPA 2IDOA 4PGQA 1U49A 5CYMA 1ASUA 4LZDA 1RCHA 1ZQOA 5KFYA 2HW3A 3DOLA 3OYCA 8ICNA 1T7PA 4B8AB 2E4LA 7ICTA 1JLFA 4RT3A 3MXIA 3ZT4A 1N48A 1RDBA 1TGOA 4FJKA 3HXMA 2DPIA 4R5PA 4DMNA 4F93B 4F3TA 1ZQIA 5KG2A 5D3GA 5IIKA 4AILC 3NGYA 3O4NA 1S9GA 1S10A 3QEWA 9ICPA 4CERA 3MR5A 1UA0A 9ICAA 1NKCA 3M8SA 8ICPA 3MGHA 3JSMA 4ED8A 3T5HA 5KGWA 3ZDCA 3ZSRA 4Q44A 2OPRA 3OSNA 2FLPA 8ICOA 1ZQUA 4QZFA 4KRFA 4DL3A 1WSIA 4CEZA 3GQCA 3KHLA 4FJGA 2ZUCA 1IKWA 4BE1A 1ZQPA 3RH4A 5EU7A 1ASWA 4F4WA 3RAQA 5CZ1A 5T7BA 5J0SA 4RQ8A 3DLHA 1RZTA 3VN5A 4FJ8A 1TVRA 4HUEA 1HQEA 1RXVA 3KLEA 4RQ7A 3SV4A 3P1GA 4BACA 3AV9A 2HVIA 1S76D 1D9DA 2G8WA 4FLYA 1C1BA 4QZBA 1BPZA 4K4HA 3QNOA 3JPSA 4QW8A 4KLQA 5CP2A 3Q8QB 3V72A 1SKSA 4AHTA 4JRQA 3AO1A 4DLGA 4KMUA 1YTUA 3HVTA 5KFNA 2AU0A 9ICGA 2W9BA 3V6DA 4CJQA 3NE6A 4J2AA 3V1OA 1WSEA 3EW9A 3MGIA 4NLNA 3JPPA 5TZVA 1LW0A 1NKEA 4CGGA 4FJ7A 9ICBA 1K6YA 1Q9XA 1LW2A 1RTDA 4Z4HA 5KFSA 1X9WA 7ICEA 1KVCA 2W9CA 4MQ3A 4OKEA 4N76A 5EWFA 4FJXA 4KHNA 1XI1A 4NM2A 3RJHA 3K2PA 2QKKA 4TURA 4FS1A 2AQ4A 4N47A 4EZ6A 1DLOA 3AVHA 2B6AA 2ZUDA 2FMSA 3C95A 1WSFA 1MC8A 4CHZA 2LSNA 2PI5A 3ZDDA 2ASDA 1BQMA 3AO3A 3SPYA 2FBYA 3KIOA 4RQ0A 3U3GA 3VQEA 1BVSA 1Z25A 4CEBA 2J6SA 3AA4A 2BCQA 3EPIA 5D46A 1XHXA 2NRVA 5J2PA 3RJEA 3LAKA 2KZZA 4J9RA 4O5KA 5DBBA 3VA0A 2JZBA 3RJJA 2XY6A 2VA3A 5JS2A 1S0VA 1J53A 2YHBA 4IR9A 9ICHA 4FJIA 1KLNA 5J2KA 2JEGA 4CFDA 8ICJA 4XRHA 5J2FA 4BXOA 1TL3A 3EPGA 4DL2A 4I28A 2YHAA 3M9MB 2R7YA 3GIJA 2P6UA 2BDPA 1RTJA 2FMPA 5KG7A 3T3FA 3AA3A 3GV7B 1ZBHA 3Q8PB 1DTTA 3AVAA 3LWMA 1ZQZA 5DG8A 1CZ9A 4UB1A 4NLKA 3QIOA 1KTQA 4OLAA 2UVWA 3AA5X 2RDJA 2XHBA 3DI6A 3I0RA 4YD1A 4M47A 4JUZA 3KK1A 7ICVA 3OHAA 3L3UA 1WNSA 2BE2A 4FW2A 4NM1A 3K57A 2YNGA 5J2DA 4PGYA 1L3UA 2ZJ8A 4DLEA 4JRPA 4R64A 3RMBA 2VG6A 4P4PA 4MFCA 3LALA 1Q9YA 3GIIA 5J2QA 1X1PA 3N97B 2BQRA 1IO2A 2HHUA 3KD1E 4QZCA 4PPXA 5J2MA 9ICOA 1BPBA 3AVGA 3B6PA 2HHSA 4QOZB 3PMNA 8ICTA 2WOMA 4R65A 5KT4A 4F91B 4Q8EA 3PW7A 3HVRA 3TFSA 2BPFA 3OGUA 2EHGA 4CJ4A 3OY9A 3BQTA 1UAXA 2Z1JA 3HL8A 1JXEA 3AVJA 9ICVA 3MEGA 1D8YA 3Q8RB 2DFFA 3ZSOA 1COOA 4FM2A 3V9XA 4JLHA 3LPTA 3PR5B 1NK9A 8ICYA 1BPXA 4ED7A 4OKJA 3ZSVA 3PX4A 1HPZA 4UB3A 4CJRA 2HHTA 3LK9A 4K4GA 5HHHA 3HPHA 5CZ2A 5J2AA 3WNFA 4DTJA 4FLWA 1YTAA 4B9VA 3SZ2A 2BCVA 4DTXA 3C2MA 5KFMA 2A1JA 1ZQAA 3OYNA 5DDYA 5HROA 3KD5E 3K59A 4O44A 3Q8MA 2UVUA 2HHWA 4P4MA 3C1ZA 3ZT1A 3DLEA 4G3IA 3H8JA 4ELUA 4XQ8A 4F2SA 5HMMA 4M6WB 3C2LA 5KI6A 4KB0A 1ZBFA 1QTMA 2XY7A 7ICIA 5J0TA 4BE2A 1B9FA 4F50A 4UB2A 4GLXA 4QCLA 4KI4A 4KLHA 4M9GA 4E1NA 3UPQA 4DWIA 1Z3EB 4O5CA 1D8LA 2ISPA 2BCSA 3C6TA 3T5KA 2OWOA 4ECQA 1JLGA 2VWJA 1N56A 4J9NA 2VA2A 4B8CA 4E1MA 4ECTA 2A1RA 4CEEA 3MFIA 1NOZA 4ID1A 1C0UA 1LV5A 2PZSA 1S1WA 4UQGA 4M41A 5KFQA 3VQQA 4ZTFA 9ICRA 4NLZA 3LAMA 4NCBA 2KZMA 2FPMA 3HSTB 1RT3A 4GXIA 3PNCA 1RBTA 3DMJA 1ZQHA 5CJ7A 2RDIA 4Z6DA 4YFUA 3SQ1A 4DQRA 4I2FA 1VSEA 4DTOA 1R0AA 1FK9A 1TL1A 3RMDA 4N56A 5J0WA 1RDCA 4UAWA 1VSLA 7ICLA 9ICTA 1IXRA 2P51A 4LSLA 3ZDAA 7ICUA 3M8RA 2JGUA 3GV8B 4KTWA 4PHAA 1B22A 4Z4GA 4C8MA 3S3NA 4JV0A 2BKEA 4W5QA 4EYIB 3ZT3A 3V9ZA 3DM2A 3QNNA 3PX6A 1QSYA 1BIZA 3V9WA 1HYZA 4CECA 1WCLA 4IQWA 4I27A 3DLKA 3TAQA 3BQ0A 1IKYA 4IRCA 3ZSYA 1HYSA 1ZQCA 3V7KA 3K5NA 5J2HA 2B4JA 4QWBA 1KFTA 2BGGA 1V9PA 2EX3A 4RW6A 3VQAA 4PA1A 1DTQA 4LH5A 5J0PA 4ED6A 4IG3A 3L2VA 3PV8A 1RILA 7ICPA 4CEOA 1RT1A 1RDDA 4M6WA 1C1AA 4KREA 5DKWA 3KK3A 4FZZA 8ICFA 5J0OA 5J2JA 4J9QA 2Q0ZX 3ZD9A 2V4QA 4QWCA 3QEIA 3V4IA 3GILA 1O1WA 2IMWP 2M9NA 1ZQNA 4CJUA 4UB4A 4Q43A 1TK5A 2ALZA 3ISBA 1MU2A 1Y88A 4O3NA 1BCOA 2G8FA 2PXIA 4KHSA 4CCHA 5IIIA 1A5XA 3JYTA 2PFNA 4TQSA 4OKKA 4YCXA 3F9KA 1EP4A 3OVNA 3NAEA 3OS1A 2KFNA 5I42A 2YNIA 4L8RB 3C94A 1KFDA 3TAEA 4KTZA 1ZQFA 5DG7A 3VQ8A 4NY8A 3SCXA 2BR0A 1CZBA 4FJ9A 1VSJA 4H4OA 4J2EA 4NCAA 4UBBA 4J9OA 4KHUA 3TI0A 4KLSA 4M9HA 9ICQA 4R66A 1NJXA 3QEBZ 4PY5A 4AHRA 1EX4A 3C1YA 2AGQA 5KG0A 4DTUA 2KQ2A 4E3SA 5KGXA 4I2GA 1IH7A 4YR0A 3LP1A 7ICGA 4I9QA 5KG3A 4DS4A 4Y1CA 4GC7A 4ICLA 3ZDEA 1X9SA 4I2HA 1REVA 3OYFA 4XA5A 1T3NA 5KTQA 4B9TA 4KLUA 4AHCA 3Q8LA 3NH0A 1VSHA 4DF8A 3QLHA 5HHIA 4ECVA 2ASJA 4I7FA 2HB5A 4CJLA 4M2YA 2C2EA 2J6TA 1NK7A 3A2FA 3SYZA 4DF4A 4AHUA 2XGQA 3O3GA 1IM4A 2P5OA 2ZTCA 2RN2A 2X6SA 2XGPA 4G1QA 2DFLA 4B9SA 5FRMA 1T4GA 4KPYA 3PUFA 4JK1A 1YT3A 4CF9A 4DSJA 3H8WA 2YKMA 5C25A 4UAZA 1CXUA 4JS5A 1U4BA 1NKBA 1KDHA 4HHTA 4F5PA 4IR1A 1L3TA 5J2GA 5KT6A 4CHYA 3AA2A 5CA7A 2AGPA 3NDKA 2BHNA 3Q8SB 3QETA 4UB5A 4PHDA 4WE1A 5CYQA 4FJHA 4M3UA 2IHMA 4KITB 4M9JA 3GFKB 2HNZA 4PHPA 3MDAA 5KG5A 5DMRA 4CGDA 2UVRA 1JLCA 4F4KA 4UAYA 9ICIA 2HHXA 4O3PA 3P83D 1JN3A 3OYDA 4CHNA 3G0ZA 4FBUA 1XSPA 1WSGA 2X74A 5J2NA 5KG4A 5JUMA 4FXDA 4CJVA 3KJVA 1JLEA 4CJSA 3NGDA 3OYIA 4ID5A 4J2DA 2W9MA 5CR0A 4X5VA 5HP1A 2X78A 4CJKA 4IQTA 5J0XA 4R8UA 4K8XA 4W5TA 3FDSA 4RQ2A 3G6VA 5KFZA 5DB6A 1VRTA 2FLLA 5KFXA 3KHRA 1S1UA 2ZTEA 1AROP 4Z0UA 5KFGA 4CK2A 2KZ3A 3EY1A 3NF8A 1I39A 1JLAA 3MXMA 3L2QA 1QSLA 3IM1A 3CM6A 3QINA 4KFBA 1PZNA 4TSXA 4EZ9A 4DL7A 5CB1A 2VG7A 1LAWA 2NRWA 3T1AA 1LB2B 1ZYQA 3CQ8A 4M3ZA 4AH9A 4EYHB 4KB1A 2WTFA 2Z1GA 4KLMA 3PMLA 1MQ2A 2P6RA 4LH4A 4FZXC 4RQ4A 1A77A 4C8NA 3CM5A 1UWBA 1JL2A 1KSPA 3NFAA 4Z6EA 4GC6A 3RJFA 2B21A 4ED3A 1HMVA 1W0HA 2ZUBA 1ZQBA 1N6QA 3RAXA 4ECUA 2Q3SA 1RTHA 1UOCA 3ZSQA 4CESA 3BJYA 3L2WA 3B0YA 3K4GA 1K1QA 3MR6A 4CJFA 4DOAA 4W5RA 3DLGA 2XY8A 1ZBUA 4OPKA 4BXOB 3VQCA 4RW9A 1G15A 4M42A 4KTQA 3RB6A 4IFVA 3V1RA 3C6UA 3AU6A 3RH6A 4FK2A 5CHGA 1S6QA 3RWUA 5F9NA 3L2UA 4FCYA 5KRTA 4DO9A 3QO9A 3VA3A 1UT5A 5DB7A 4OGEA 4BGDA 1BL3A 4TUPA 3DRPA 3C5FA 2PFPA 5J2IA 3IG1A 1B92A 5DQGA 2XO7A 4GXKA 3U3YA 1BGXT 4TQRA 4O3SA 3UXNA 4I2BA 4YXMA 5KFDA 4DL5A 4F5NA 2FBVA 5DLFA 3MDCA 3CG7A 3K5LA 4KO0A 4RW7A 3V9SA 4RNNA 4FM1A 5CWRA 1S9FA 1IKVA 4LSNA 4CF8A 3H4BA 5KT2A 4JWNA 3OYEA 4KLJA 4IKFA 2UVVA 4EP5A 4QWDA 4M3XA 1JX4A 1QQCA 5HRSA 1U47A 8ICVA 4PUOA 2O4GA 3O3FA 4NXZA 1JXBA 1W9HA 8ICMA 4RUAA 1S0MA 4CF0A 4YR2A 4IRDA 4DG1A 5J2EA 1XSNA 4W5OA 2Y1JA 3LP2A 3DYAA 3T5LA 1XSLA 1A5WA 4DTMA 3RR7A 4DU1A 4Q45A 3UQ0A 5C5JA 2IOCA 2NRTA 3O4QA 1RDAA 3MECA 1XC9A 1NK6A 8ICWA 2OYQA 3NGZA 4FLVA 1VK0A 2C22A 3CFOA 1ZQVA 4KN7A 5HBMA 2R8KA 5KFUA 1RBVA 4J9MA 4Z4CA 1ZJMA 4OVLA 2KTQA 2XCAA 4ECRA 4CEAA 4QWAA 3RJIA 1T8EA 4LVSA 3KLFA 4F3OA 4H4MA 2V9WA 3KTQA 5J0QA 3M9NB 3G10A 4F5RA 3H7IA 1VSMA 4XIUA 4YNQA 5HRPA 4K8ZA 4Z4IA 1KEJA 1ZBIA 3KLGA 4I9LA 2YNHA 3TABA 3SUOA 2A1JB 4TUSA 4JV1A 4FLTA 4O5BA 4GVMA 3HT3A 1NK0A 3RB3A 2W9CB 1J54A 3KKSA 4KHWA 3ISCA 4HYKA 4CEFA 2E6LA 5KFPA 5KFEA 4Z4EA 7ICKA 4MFBA 2D0AA 5DK5A 3RJGA 4RW8A 4KLIA 2XRIA 3RBEA 3L8BA 1JLQA 3NF9A 4I2EA 2YV0X 4PH5A 9ICEA 1HNVA 3F73A 4DSKA 4M45A 3SJJA 4DTSA 4FLUA 3OYJA 7ICQA 4Z4FA 5KG1A 4J9SA 3S3MA 8ICIA 2P1JA 3V7LA 3HW8A 1TKDA 3C2KA 9ICCA 4F4XA 4QZEA 1TV9A 5L9XA 4GW6A 3ZT2A 4FS2A 2F8TA 3LPUA 3NCIA 2RKIA 1SL0A 3PO5A 3LP0A 4KHYA 4Z6FA 2GBZA 3ZCMA 3DRRA 4E89A 1ZQSA 3ITHA 3M8PA 1WLJA 4OJRA 2Y1IA 4ED2A 4KI6A 5J0RA 1T03A 2BGWA 2C28A 4W5NA 3KK2A 5KFHA 1JKHA 4OPJA 3JPQA 1S97A 4Q8FA 3MABA 4Y1DA 5CY4A 4RPXA 2NUBA 1RT5A 4JS4A 4F5OA 2XCPA 4M3WA 1NK4A 3VQDA 4M3YA 3AVNA 4RU9A 3V7JA 2YNFA 2F1JA 1DGSA 4MFFA 3VQ7A 1S5JA 5BOLA 4MFAA 1TKZA 4YQWA 5DB8A 4O3OA 3JPNA 4CJ5A 1CXQA 4GMJB 3ZT0A 4FJMA 2JLEA 3S9HA 4DTPA 4B9UA 1Y97A 1S0OA 4AHVA 1TAQA 3LANA 4DFMA 2BPGA 1S9EA 2BCUA 3S3OA 1ASVA 1KRPA 3BGRA 4N41A 4CK3A 4PQUA 2MUTB 3RMAA 4DQSA 1FKOA 3RRHA 2V4RA 3M8QA 3TAPA 3LWLA 4CIGA 5IIOA 1Z26A 4FO6A 2OZMA 3TWHA 2MAXA 4DQIA 4P4OA 3EZ5A 4B9LA 2ZE2A 1ITGA 2AJQA 4K4IA 1RT7A 2VA8A 1CLQA 4I2CA 4YMMA 4OLBA 1D5AA 4LZGA 2OZSA 4ECSA 4EBDA 4ECXA 1FXXA 3IRXA 3UIQA 3HYFA 9ICMA 2PFQA 1S0NA 1BPEA 5KFLA 2VWKA 2GUIA 9ICXA 8ICHA 7ICRA 3SQ2A 4YMOA 1HUOA 5DBCA 4RNOA 5KT7A 1GOCA 8ICQA 9ICUA 2P66A 4DSEA 4ZH4A 2DY4A 5J1EA 3QEAZ 4JWMA 3IS9A 3HWTA 2XC9A 4BDZA 3OJUA 3SPZA 3ZSWA 5HRRA 1DOQA 4RZRA 4J9LA 4CJ3A 4KLOA 4I29A 2PI4A 4FJ5A 3CFPA 3ISNC 2D5RA 2ATQA 4QZAA 4CEQA 3IAYA 3HJFA 3PX0A 2IGIA 9ICWA 3BQ2A 4LY7A 3H8SA 1I3AA 1WCNA 2QXFA 4J2BA 2QK9A 3WNHA 1RPLA 4CGFA 3ZSZA 3I0SA 2X6NA 1ZQDA 5DQIA 3L3VA 5IILA 3ISDA 3KHHA 4FK4A 1NJYA 4DEZA 3QIPA 3TARA 3AVCA 2JEFA 3PW0A 4YXJA 1VSDA 1ZBLA 3C5GA 1Z00A 3AO5A 3D45A 4RQ1A 3HM9A 1Z00B 5DQHA 4YR3A 4CF2A 4O4GA 4RQ6A 3QE9Y 3SI8A 4FM0A 3NGIA 5J0UA 4KHQA 3MR2A 4YD2A 5C24A 3OJSA 4IRKA 1RYSA 4NCGA 3LZJA 1ZQJA 1HJRA 5J0YA
chains in the Genus database with same CATH superfamily
3D0PA 5ALFA 3L4PA 4JHDA 4PQUB 3Q8KA 3PRVA 5A8RB 3SMZA 4FJLA 4DV3J 1AZSB 3HT0A 3BF3A 2ZJAA 3QFHA 1ZJNA 1SKWA 1SV5B 3I8DA 1HBUA 2EEYA 2K89A 2P8IA 1YRXA 4OFZA 4KE5A 1BHNA 3QZ7A 1CEZA 2CWKA 3SJHA 4OHWA 1BPDA 3RZAA 5DLGA 3U9ZA 4DSIA 3CYMA 5ALWA 1F5SA 5JICA 2O8CA 3UMGA 5E41A 1V3RA 3VEWA 4UAVA 1U1OA 5DDRC 3WXKA 2FJAB 1WD6A 2VV5A 2GOLA 4CLTA 1S3XA 3L4BC 1ATRA 1HRHA 3BZKA 3THXA 3CT9A 4J9VA 3HSDA 4CYUA 4CEDA 2W8LA 2B5JA 2AJ1A 3H2LA 3L7UA 2YX4A 2GFFA 2YY3A 2FJEB 2AX1A 2BJEA 3R27A 1TAMA 3DI6B 3I0RB 1YF5L 1Z1BA 2VQFJ 2K8CB 1PJ7A 1RWKB 4JKEA 1EHWA 3M1VB 4ILMA 4M8LA 3OTQA 1X4BA 4I2PA 1Q7YT 3TX8A 3ZYYX 4M0AA 5F8GA 4CJWA 1P9YA 4Y2RA 3QAEA 2AQ0A 5D4BA 4CIFA 4CHOA 2PE8A 2DUYA 5A76A 4FXWA 5KQDA 1SV5A 1U1RA 1OH6A 1NOYA 3V81A 2DR9A 3PJXA 2UU9F 3ZX0A 4UTGA 4CBXA 3HK2A 5A8RA 3ZTRA 1HNZJ 3NUQA 4ZPDA 4OV1A 3ZDBA 1KOHA 4N8OA 4A8EA 1O0PA 1GFWB 3PYDA 7ICFA 1KFSA 4BRIA 3SCJE 3FZHA 1HYSB 1ZQKA 1ZM2A 2NRHA 3WHIA 2FLNA 5DGBA 5ALSA 2GVZB 7FDRA 3AL0B 2BACA 1KWMA 3C19A 2ZWHA 3WQTA 3PO4A 2Y1LB 1IBKF 4NZ7A 1Q46A 4HUGA 3IWXA 3UFCX 3TYTA 4M3TA 2DO0A 3BV8A 3WKBA 3TQ1A 5AE3A 1JQGA 3V6KA 4A8KA 1NXIA 3QERA 1RISA 4K2JA 4LFBK 4UBCA 3WNGA 3GJSB 3C7NB 4DCHA 4A8SA 3CJKB 1VGYA 4QZDA 3IP4B 1ZC6A 1CI4A 3T5JA 4UY85 3AVLA 1RTDB 2KVQE 4FJNA 4DV4K 4KKOA 4I2DA 2LMRA 2MA1A 1URNA 3D6FB 4I2QA 4IOCQ 1SJ3P 2HKEA 1TP7A 3D1QA 1VQMN 4I2QB 3OA9A 2JWKA 3EYZA 2FMQA 1V9OA 2EDUA 3SQ0A 1BQNB 2LXUA 1VQ7S 5FDLA 2CGJA 1GXLA 2AZ1A 3GTYX 4CE9A 1QLNA 2DPJA 2J9CA 3SUQA 3OUYB 1NOMA 2OPSA 4WWSA 4U8YA 5AZIA 8ICBA 2OPPB 4LIRA 2E1PA 2M7SA 2XBPA 2HBMA 3SUNA 4JI0J 4LF9F 1U1LA 3RR8A 3RAMA 5F3ZA 3AOCA 4B9NA 1RA6A 3NBPA 2Y1RI 2HZAA 1A76A 3AXMA 1HI8A 4EEKA 4CD1A 2AIRB 3CMQA 3S8SA 1N32K 1FKPA 5JXSA 3WNEA 1MN7A 1JCEA 3F53A 3AOAA 1KQGB 4BC5A 1HBNB 4DUYJ 4EX6A 3B0XA 4KIAA 1DK3A 3O5BA 4UW2A 4BBYA 2P6TA 4KLLA 5IOLA 2X1GA 1J5OA 1SKRA 2ZQBA 1S1XB 1F9EB 1DEJA 2FUG9 1Q5VA 3U6FA 2MKJA 1H6KX 3H98A 4FVUA 4ZTJA 2R7TA 2CPIA 4WYWA 4M7YA 4EP4A 5KFVA 3LDAA 1MMNA 3NNCA 2GUPA 2XG8A 1G6BA 2ZD1A 4I6YA 2A0FB 4KH5A 2ZNZA 5F3XB 4HTUA 3IR7B 2MZ1A 5EGYA 2V8PA 4P2FA 3ULDA 3CP8A 3SQ4A 5KFBA 3PM9A 1S77D 5FROA 3OL8A 3DLGB 2GIRA 2DKOB 3A12A 4O9MA 1SH3A 1YJVA 2IRUA 4EUVA 3GSIA 3E3XA 2ZXIA 3QIDA 4ZVEA 3VQ9A 3THWB 2K4HA 2GO7A 2JH7A 3THXB 3OL6A 3JPOA 4NA1A 4QZVB 1UVKA 2R7WA 3EWAA 5L1LA 4V19S 1IBMF 3OYBA 1V3SA 3R3LA 2ITGA 1N52B 3TAFA 1IQTA 3VCBA 3ENVA 3MEEA 4X66K 3C3LA 1GLBG 1WKJA 1UWAA 2DNKA 2BEFA 1HNIA 4EIAA 3SAHA 4NLTA 7ICMA 4I2IA 2KT3A 3IBFB 2JWLA 2VBWA 4FWSA 3EKSA 3T1HK 2HNYA 1LFPA 8ICKA 3LP0B 4OPAA 5IQQA 1CJVA 1WSHA 4RWXA 4C8LA 4O3QA 2YMPA 2G1DA 2QM1A 3KK1B 4DB3A 5JS1A 2Z2MA 2ZJPQ 4MDBA 2ZOMA 5LMNF 5KPTA 5AQGA 5HVGA 2A1SA 1NGJA 3NH2A 1DRZA 3OW2M 2GGPB 4WXWA 2DB1A 4C3MA 5IIMA 4TUQA 2QWRA 2ZH8A 4LF8F 1FFUA 3CCUN 3GG1A 4UOGA 4FSVA 4LRCA 3AVMA 3FCWA 3CMEN 1K8AT 1ZTTA 3M8WA 4OX8A 3N79A 2ZWOA 4OZ0A 4QZGA 1RZMA 1X5PA 2WTUA 3ZTPA 1S1VA 2DCUB 3VF6A 4IO1A 3QBCA 1YXQA 3NMUA 3MM6A 4MK9A 3C21A 4CNQA 1F5BA 3IP0A 1JUDA 2AMCB 4LF5F 3BB5A 2A40A 3CJ7A 3GR0A 3I87A 3PVXA 3L3CA 3HO1A 1J2NA 3TTDA 3PHTA 2G1HA 4CF3A 2EW9A 6FDRA 1EKSA 4QW9A 3OYGA 5AKKA 1R0CB 3FGUA 3C15A 4BGAA 1L5UA 2KDOA 1N5TA 3QIPB 3MD3A 3OYHA 2M0GB 3H4DA 2DGZA 1YVUA 2UYTA 3PY8A 4C8KA 2YQ1A 4OX9K 1SJ1A 1NM2A 1WKLA 2KMDA 2E9ZA 1L3SA 2MQLA 1SL1A 4PGXA 3WK9A 1XUPO 3RTVA 1XO1A 4TYBA 2GW8A 2PGCA 4JI7J 1J5EJ 3QQCD 2F8SA 2YHWA 3G2XA 3VQBA 3E01A 3HULA 2BMBA 4ILJA 1S5LU 2ZH7A 4PRFA 1NNEA 2Z58B 2EFGA 2AX0A 2OPQB 4ISEA 2HFZA 4NLVA 1E6YA 4FPBA 3DLBA 1CBKA 1MQ3A 4UARA 4CF1A 3AAWB 4EEYA 2KH9A 4NYNA 2LU2A 3QJLA 5HNKA 4HHJA 4LRAA 5HMXA 1HKBA 2UXCK 2EAMA 1C6VA 3MCAB 4LSZB 2DJWA 4P2HA 2XEXA 2YWKA 3SV3A 4NE9C 3QB0A 8ICLA 2MGZA 1FKAF 5GAEP 3LZIA 2KV2A 3VVUA 2AGOA 4M5GA 2ZBCA 3NAIA 2WVFA 1GOAA 3UQ2A 5AQNA 3CJQA 4P0PB 2N82B 1ZAXA 2NRZA 4X64F 1SZPA 1N54B 3NGSA 1BIUA 5IM0A 2E5LK 1OKJA 2GMHA 2FC9A 3QAUA 2D4WA 4AF1A 4Y2CA 1NJZA 1HQUA 3BF4A 2BCRA 5M1PA 1SUQA 1N62A 5FP0A 2D3OR 3HKZD 5KQ8A 4X4OA 4DV1K 1JB0C 1FD8A 2V4JB 2C2KB 2HQFA 5BPCA 1NLVA 3ZI4A 4YVZA 4USMA 2G5IB 2NRXA 2OD6A 3R1HA 3PYGA 3B82A 3VAJA 1FWPA 4QIEA 2WMMA 3P5JA 1NSAA 2C2RA 2BOAA 5THWA 3KJNB 3OS0A 1DFDA 4WQ5A 1T0TV 2WFAA 1UMJA 4CLKA 3BBCA 3BDPA 4F8RA 1QHTA 4JKHA 4N5SA 2F1FA 1HKGA 1CC8A 1KONA 2FHMA 2XIDA 1WAFA 4JV2A 3TAGA 4PG6A 5HI7A 5GINA 4KAIA 2ZBQA 3SDEB 4DSLA 1S6PA 3J7AP 4QAGA 8ICAA 4BRPA 3MI7X 2ZUAA 1EXQA 2V2ZA 4Y2UA 3VTHA 2PFOA 4P71A 4PZOA 2LMIA 3CJ3A 2FBTA 4PHTX 2Y0SC 3TFRA 4E8UA 4ES2A 4TVAB 5KFYA 4NOHA 2IOFK 4DR2J 3OYCA 8ICNA 4FWOA 2E4LA 3OXFA 2P5VA 1A0OB 3LGMA 5AK6A 3CJ8A 1Y00A 2HGLA 1X4HA 4NI2A 4NL9C 3HLUA 4ZVHA 2A1AA 2DPIA 4R5PA 5E7OB 3V81B 4ANCA 3ONNA 2RF2B 3GR1A 4UOHA 4PL2A 3JAMU 3CCMS 2M8DB 3O4NA 4F0MA 1XMQF 3QEWA 2JHEA 9ICAA 4NLPA 3CJSA 2ZH4A 4XDDA 4Y2PA 1NKCA 3M8SA 3KKFA 8ICPA 3UMBA 1D8BA 2KK0A 5AKIA 3GZFA 2YVSA 4FDFA 3ZSRA 1N33F 2QT7A 2DNZA 4OHYA 4LBIA 1HR0J 4CEZA 2R7XA 3BQ7A 3GQCA 3EEQA 3QX7A 5D78A 2QFJA 1H1VA 2NR0A 4YUDA 4RBUA 3EM1A 3IWNC 5ALMA 3I56N 3SEIA 5E26A 2O66A 2XSJB 2O67A 2B0CA 1RZTA 1YWXA 2RKIB 4WFNL 2CAJA 2A6OA 3VZIA 2KJ5A 1YTYA 2JC1A 3KLEA 4CM0A 3WEEB 3AV9A 3SD7A 2KU7A 2A1BA 2HVIA 1S76D 1Y3JA 3KWIA 4QZBA 1VRTB 4USAA 1CJUB 2BW2A 4V19J 3P45B 4DV1J 5CP2A 3Q8QB 1TUUA 4NLWA 4BRCA 4DR7K 3FBCA 4CTAB 2GJIA 4L75A 3N9UC 1E3MA 1CS4B 3EGZA 2AU0A 1W2BR 2P9SB 2W9BA 4NL9A 3AQOA 3V6DA 2LXFA 4J2AA 2HEKA 3D9BA 1WSEA 3QSIA 4EENA 3EW9A 4MN4C 1F1BB 4I68A 4ES1A 5TZVA 2R7VA 4JD2A 4CGGA 5I3PA 1ATNA 1N5YB 3MDQA 1MROA 3AN1A 3CD6N 7ICEA 1KVCA 2XMJA 1IBMK 2XTJP 4MQ3A 1JLEB 1IJFB 2RRAA 1FD2A 2GZOA 3ZEUA 4NM2A 3CJBA 5IWAJ 3RJHA 3K2PA 3D2QA 2QKKA 4FS1A 1B99A 4RO0A 4JN4A 2UUCF 1EWRA 4N47A 1X3NA 3AVHA 2FMSA 5BR8K 1MC8A 4CHZA 4I67A 3VERA 2ASDA 1BQMA 3AO3A 3SPYA 2P2CB 4PQAA 2FBYA 5TKYA 3U3GA 3BPDA 1IBLF 1U1MA 1RAEB 3CC2N 5D46A 1LXJA 2NRVA 4H4OB 5IWAF 4K4UA 2KZZA 2YJFA 4J9RA 2PSZA 3R5AA 1G7CB 4UASA 2Q79A 2JZBA 3RJJA 1S6QB 5CAAA 5JS2A 1N36F 1NHVA 3VAHA 4W4MA 1H2VZ 5CZVA 2H51B 4BRDA 4O5FA 1JMTA 3CXCM 3V2UC 4I28A 4C80A 3M9MB 1RTHB 3T1YK 4KHMA 4H5RA 2G5HB 5EX0A 3PSFA 1ZBHA 3Q8PB 3AVAA 5C0YA 5DG8A 1CZ9A 4NLKA 3QIOA 2YX7A 2E8MA 1LKYB 2CQ3A 2ZM6J 5JTIA 3MZIA 4J90A 3I33A 4ZPTR 3KK1A 2UXDF 1WNSA 3FQLA 2PDAA 3MEGB 2P9IB 4FW2A 2YNGA 5J2DA 1L3UA 4DUYF 4JRPA 2E8AA 4R64A 2MHNA 2HBLA 3RMBA 2VG6A 4FYVB 3H0LB 4BRHA 4WZMA 3KD1E 1X1PA 3N97B 4LR9A 4ITSA 5GAGP 4PPXA 4AXIA 2QB1A 3PMNA 1H72C 8ICTA 3EGNA 4V1Ak 3A8IA 3OXLA 3NCPA 2RNEA 3JYTB 1TYQA 4Q8EA 1NPKA 3HVRA 3OGUA 2OTLN 2WB4A 1UAXA 3VAKA 4CF5A 2ZBPA 2Y0BB 3JTPA 3EJMA 2DFFA 1OXJA 3V9XA 3CMAS 4JLHA 4ID8A 4RR5A 5IFMA 1X0PA 1NK9A 1BPXA 2GNKA 2O01C 4OKJA 3I4PA 3RBZA 2HHTA 4U7CA 4K4GA 2EK1A 3HPHA 3AA8A 3UN3A 3KBBA 3TX0A 2YJEA 5CZ2A 5J2AA 5H9FJ 4Y65A 4CZHA 1SC4B 3JAMY 4DTXA 2GX8A 5JVGL 1ZQAA 2E5HA 5DDYA 2UXDJ 5HROA 5AKEA 1HKCA 3UO0A 3TZYA 1R7IA 4ALZA 2ILZA 5DM6L 2GJ2A 1JJ2M 2R4FA 4P4MA 3ZT1A 4OQJA 3DLEA 3AJ1A 4YOTA 1SH2A 4MK7A 1OIAA 4ELUA 5HVFA 4F2SA 2A2DA 2MQPA 1VQ9N 3SBMA 4ISFA 3TSQA 4KB0A 2QLTA 7ICIA 1NBEB 2F65A 1VOMA 4BE2A 3MURP 3KUHA 4UB2A 4C11B 3NRZA 4KI4A 1JJHA 3ZTOA 3SSSA 4LFAJ 2Y3YA 3I0SB 4PKGA 3VEYA 2VICA 1Z3EB 3N7RC 4O5CA 2ISPA 1NRKA 2IJNA 9RUBA 3CMES 3C65A 4A8QA 4F02A 1L8OA 3NOGA 1WOSA 1N56A 5BPNA 2L9DA 2XLKA 1XMOK 3J81U 2H5JB 4CEEA 2W4CA 1PAUB 1NOZA 1CJTB 2YQ3A 4HHUA 3FEXB 4GY2B 2A6AA 1DQAA 1S1WA 3IO1A 3WU2U 9ICRA 4WFZA 2CPFA 5AK3A 4B3RJ 4MKBA 3AARA 2C2ZB 3HRDD 2MXYA 4GXIA 2IA0A 3DDNA 1TUWA 1X7VA 2CADA 3L9ZA 4Z6DA 2B9YA 1RGIA 1WTBA 1R0AA 4DTOA 3EKUA 4A8WA 1NHUA 2WRMA 2HWIA 4C11A 2IVPA 3E1YA 2E5IA 3WQUA 9ICTA 4OZNA 2MKIA 1ULRA 4DV7K 4KTWA 4C8MA 1X4FA 1J97A 4CO5A 3VGVA 1VAZA 1XR5A 3DLKA 5ALJA 3TAQA 3BQ0A 2RQMA 4WU3A 3M1FA 3DRPB 2B4JA 2FYXA 2UUBK 1FDNA 3FBEA 1APSA 5C2GA 4DPYA 1RHRB 1RWWB 7ICPA 3RW7A 5DKWA 5T7LB 4FZZA 2DY9A 3IM9A 2Q0ZX 5LSLA 1RM6C 2V4QA 4QWCA 2LEPA 3V4IA 4DFDA 2IMWP 1PVQA 1ZQNA 1HIYA 4OL8A 4L3QA 1MMLA 3BY5A 3UVJA 1Y88A 4DV5F 5DM7L 4O3NA 3GFXA 1X4GA 3NGUA 3KYLA 1FNOA 3O0FA 2GELA 2XYHB 4YEAA 2JSXA 3JYTA 1IM6A 2GO9A 4OKKA 2IDLA 1EP4A 3OVNA 3OS1A 2VDIA 2K3IA 1YSJA 4CH0S 2YNIA 3E58A 5D0RA 3KK3B 2LA6A 4C2MA 2OSRA 4KTZA 3BN4A 4ZJQA 2KHCA 3M8PB 3C6AA 4NY8A 4ED5A 4AQYK 1CJVB 1R8AA 1ED1A 2BR0A 3C16A 3D4JA 2QLWA 2DGUA 3KXDA 2W24A 2BE7D 5HOOA 3G82B 2FD2A 1I1GA 5CH7B 2V2QA 4KHUA 2YKQA 5IC4B 4C9DA 4IOAL 2GHWA 4TLQA 1YZ7A 3R5BA 1HX1A 1YGYA 1FFWB 2AP1A 4BVPA 1K0VA 4R66A 4YOUA 1RXOB 4UY8T 2HG4A 3DXBA 1EX4A 5AQJA 3IKMA 4JI8F 4E3SA 5FPMA 1JLBB 1IH7A 4MTPA 2CNLB 2FVSA 2EG2A 4S0MA 4CI0B 2E1MC 2CWXA 1R0AB 2KD1A 4JK7A 4GC7A 2QWOA 4ICLA 3VGKA 1QQMA 1X9SA 1FFVA 3OYFA 2OO4A 1NO8A 2HZCA 2JL9A 2P9CA 3QSYB 3Q8LA 3GG4A 5B66U 2HIQA 4DF8A 3QLHA 4JI1K 1N34K 3O8WA 3W5ZA 1MA9B 1M1GA 4OI0A 1YHQN 2YPYA 4PZVA 2LXIA 2HRTA 3RGIA 2Z8QA 3ULEA 3DC2A 2XGQA 2HS0A 2QO3A 3R6MA 3SBTA 1HR0F 4A2AA 5FRMA 1T4GA 1J5OB 1CJUA 3MM9B 4BS2A 3KNAA 5K9FA 4DSJA 1JCFA 4AE5A 1RHUB 5C25A 1RABB 2ZEJA 1NKBA 5A8KA 1L3TA 2ABYA 2DHHA 5CYQB 1X66A 3AA2A 1TQLA 3HHDA 4UB5A 1OO0B 1KN6A 5K8OA 3J80O 1N2XA 2PT0A 4KITB 2HNZA 2EFQA 2F9JA 1HBOB 4ZMMA 4DPWA 4JD2B 4CZLA 4YDUA 3KD3A 9ICIA 1VHXA 2HQCA 2ZIVA 1NI3A 2ACYA 3CJ5A 3AQFA 3IG5A 1XSPA 1WSGA 3JXOA 2YTCA 4FXDA 3T6JA 3K1ZA 4OZJA 4K5RA 3H5YA 3OYIA 1UCVA 2YWHA 2MQ8A 1NGIA 2K4EA 1WOPA 3WIVA 5J0XA 2W4DA 4R8UA 3VWSA 4HH1A 2UXDK 5D3GB 3FDSA 7AT1B 1VRTA 1ZTWA 4M5DA 4AL7A 2B9XA 3C15B 2IM0A 4FOIA 4ACOA 4ZN3A 2ZTEA 1AROP 3ZX2A 4QR0A 4K4YA 1FWLA 1FJGF 3KDOA 1SIZA 3MTJA 1QSLA 4JKGA 3CM6A 4DN0A 2A6MA 4NYPA 4DR6K 2JC0A 4OI6A 4O0NA 3QRQA 1Z4NA 2DGOA 3Q83A 5M1QA 1ZYQA 3KVGA 4GKKF 2KHVA 1VLBA 4AH9A 3CDUA 4KGVB 2MLZA 2MY7A 5JMNA 4OHVA 4LH4A 3QFPA 4RQ4A 3AODA 1Z1VA 5ALUA 4JI5J 1M90O 1UWBA 3NFAA 1W0HA 4ED3A 5CRXA 1Y3KA 2CH5A 1UOCA 3B0YA 3BO3A 4DOAA 4W5RA 4OPKA 4BXOB 1VQSA 4KTQA 3TUJC 4MH8A 2UUBJ 1K8AO 1U2FA 3D7EO 3BH7B 3X3UA 2DVIA 3PSPA 1U7LA 5IQ6A 5CHGA 1V5IB 5F9NA 2XWXA 5KRTA 4ENOA 3QO9A 3VA3A 1DAXA 4JB8B 2WAQC 1R8BA 5J2IA 3IG1A 2I0XA 2FZCB 4GXKA 1SWVA 3U3YA 4QJFB 1WTFA 1MWQA 1SUQB 4I2BA 5HJYA 2Z0GA 2BVZA 2O8BB 4F5NA 4B3TF 1UEUA 2HHHF 2D1KA 4IOCL 1BXNA 3VGLA 2V8GA 2BV3A 4N8NA 3CCUS 4P73A 4GKKJ 4FM1A 5CWRA 1S6PB 4LF6K 4LSNA 4BR4A 3DRRB 2H5IB 2MKKA 3J8AA 3K9JA 4Y2VA 5HRSA 2P9PB 1TUVA 1VQ8N 5H1SQ 4Y2IA 5K8MA 4LQ9A 4FPAA 8ICMA 1IBCB 1W9HA 3H45C 3HSZA 4BR7A 4CLFA 2B4PA 4CF0A 5JLFA 3MN5A 4IRDA 1JXVA 1XSNA 2ZD1B 4PYAA 2Y1JA 5MLCQ 1KR4A 4XTTA 4DU1A 1FWKA 3UQ0A 5C5JA 1UJ4A 3O4QA 3EZUA 4OYAA 1NK6A 2YQ0A 4LJMA 3H1QA 3EDQB 2BKPA 2DNYA 3HFKA 1AZSA 3VAIA 2D0PA 1YK9A 5KFUA 2VKQA 4KYZA 2MSNA 3TP2A 3NS7B 1F60B 3J7A1 2ZG6A 2M88A 5DJBA 5J2PB 4OVLA 4ECRA 4LF4J 3FSXA 3HZGA 2KYXA 3TRGA 2QLJB 3RJIA 4BR5A 4YY3F 4H4MA 2V9WA 2G06A 1WUDA 4CQ1A 1ELOA 1IR0A 1FE4A 5AQVA 3HHLA 3G10A 3OL9A 1XQIA 5F3TA 4K8ZA 3FRZA 3C6TB 2H3VA 2J9DA 2A42A 3OUYA 3KLGA 3FC9A 2F40A 3SUOA 5GAGI 2A1JB 2Y9UA 4UQTA 4JV1A 4FLTA 4O5BA 4KHWA 2KVIA 3KKSA 3A3PB 4CEFA 1YJNN 3THYA 7ICKA 1W2IA 1PK1A 1NJIO 4CLYA 4LF2A 4JOUA 1GLEG 4OYMA 1J5EF 1Q81T 3L8BA 5ALOA 3DGPB 3MECB 4KT0C 3U9DA 3EGWB 2YWGA 1HNVA 2QMXA 4DSKA 1RAGB 1P1LA 2HFVA 5A0YA 4AL5A 3TSPA 1XBWA 4BG8A 4HTIA 1NH8A 3ZTQA 4DTSA 1R27B 4OX9F 3VCDA 3JQJA 7ICQA 1HLWA 5KG1A 3CMAN 5GAHP 2LEBA 2CXEA 1UJ6A 3HW8A 4K2XA 1TKDA 4F4XA 1TV9A 3PSIA 1EAYC 2V6AA 5AQTA 2VJ4A 1TFWA 2F8TA 3FZLA 1U09A 3NCIA 2VGNA 4KGZB 4JKFA 5M1OA 4X64J 1SL0A 2G0IA 4OZ2A 3CD0A 3LP0A 1YAGA 4UT4A 2GBZA 2O8EB 2XMVA 1MLAA 1MWZA 1WLJA 4JI8K 3M6XA 3KK2A 3JPQA 1S97A 1K9MO 4Q8FA 2F7TA 4Y1DA 2JWNA 4RPXA 2NUBA 4KBIA 5LJVA 1HLUA 3ILLA 2F9WA 3L09A 1NK4A 2HWTA 3UN5A 1FESA 4P7VA 4ER8A 3SEOA 2JJ4D 3H0PA 1EB0A 4OLOA 1GK8A 3GSDA 2QFIA 1SV4A 1FKOB 1YDLA 2F8EX 5J1PA 1RHMB 3BSOA 4X64K 2YWFA 4FJMA 3GFYA 4IKAA 3S9HA 1S0OA 2RVJA 1XNRJ 2LI6A 1FI4A 3C8YA 1ASVA 3BGRA 4MLHA 4FVCA 3RMAA 4DQSA 1RA7A 2XZWA 3RRHA 2OCEA 2CQPA 4JV5F 1KP6A 4UUXA 2MTLA 3R1XA 3TWHA 3HFVA 3I9V9 4DR4J 1XEZA 2ZE2A 1ITGA 4OJLA 1UL3A 1S48A 4K4IA 5FPNA 4OLBA 1D5AA 4LZGA 2OZSA 4EBDA 1RK8A 2DIVA 2AZ3A 1FXXA 1I94F 1X6JA 2ROEA 2OD4A 4H4KA 4DR3F 2O8EA 5C42B 3F2KA 1OVYA 4FF1A 4O23A 3UDCA 2CZ4A 2B4OA 1XNRK 2E20A 2VWKA 4AYBC 2P9LA 2NYIA 5DDPC 1OYDA 1HUOA 4LF9K 4W92B 3JSYA 1ZD5A 3TUZC 4FF3A 9ICUA 4DSEA 4DCOB 4ZA1A 4JKAA 4ETXA 2CKWA 2DY4A 3W2VA 3QEAZ 5LSOA 2D1CA 3TVZA 4JHDB 2F76X 1KXPA 3IS9A 1OY8A 1GLDG 4DCJB 2P9KA 2G2OA 2VHGA 3BUZB 3R7NB 1C0UB 1S4FA 4J37A 5H2FU 2XYPB 5HRRA 3FVYA 4YOEA 3U8XA 2DH7A 4PKDB 4MKAA 2IBOA 3CNHA 4RZRA 4KLOA 1R89A 4KRWA 4YOXA 3CFPA 4XPCA 2L48A 4ANDA 2D5RA 3O44A 3AD9C 3PX0A 1M5VC 3KUGA 4LY7A 2EBEA 1A0PA 3M7DA 3WNHA 3D0HE 3TTFA 2W6LA 2FHJA 4WE1B 1HW9A 4LBHA 3ISDA 3TA1A 3RW6A 1EO1A 3A1YG 4DU8A 2WBMA 3QIPA 3AVCA 3A5MC 4YXJA 3OFEA 2ODGA 1VSDA 1RWPB 5LMUJ 1Z00A 1XNQJ 2BZ2A 3HM9A 1Z00B 3MHYA 3FCVA 2O6KA 4RQ6A 4QIGA 3OL7A 4FM0A 3F56A 3DHXA 3MR2A 2O5DA 3F2DA 2V0NA 3ELHA 1S1TB 4FNHA 2F5GA 4QPXA 3GCXP 1WF1A 2HSEB 7ICNA 4DBQA 4CO1A 2ADCA 3FFIA 1Q4RA 4I69A 1C7YA 4I6MB 5L1JA 3K89A 3UD3P 3QU7A 3AB4B 5IT9U 3CCZA 3RH5A 3PIOQ 4RUCA 1AUSL 1HNXJ 4ZVTB 1LCUA 4P2XA 4LD0A 4OGCA 3ID8A 2LU1A 1ZETA 3NGTA 4MIBA 3M1VA 2I9GA 1FW6A 2WB1D 2PY5A 1WI8A 2B8QA 3C29A 5C10A 2ATLA 2ZH5A 2G07A 5F0UA 1SS6A 3A5OC 3MMBB 1C1BB 1NK5A 4MIWA 3UD4P 1RHKB 3Q23A 1AQ6A 3NF7A 4EFHA 1VQLS 1IQZA 2HOIA 4FL9A 4AHSA 5AKZA 3A5NC 4BGBA 3RYLA 4Y2YA 4IZ9A 1ROFA 3VQ6A 1LWFA 2VL1A 3H42A 3KKAA 1C0TB 2HLUA 3KFWX 1WC3A 4OYIA 4K0KK 1LKYA 4HHHA 2ZJ5A 1ZQQA 4FZLA 5E33A 2W3SA 2GMJA 5ALHA 5F9LA 2AF6A 3J7Z5 4DTRA 1TKZB 4ZPBA 3FC4A 3GIKA 2E3TA 3GZ7A 3ALRA 1S99A 3UXOA 5IWAK 2KXFA 2Z1HA 1F9HA 2VG5A 4WFBL 3HPGA 1SL2A 1C1CB 2CQHA 4Q7AA 8ICZA 3CC7N 1LXNA 5K5MA 5ALNA 5JRTA 4FVMA 4EHTA 2D0BA 3KNGA 2W9AA 3D67A 4E2FB 3P5TL 2SXLA 4K8RA 4M3RA 3L3FX 4RPYA 1RAIB 1RAAB 3H2UB 3MM5A 3KLHA 3C6HA 3M32B 3O3LA 2KFYA 3FM9A 1Z05A 1SV0A 5CYMB 8ICRA 1HKAA 2V68A 2F3NA 2MJNA 1R6VA 2OJ3A 3EVOA 1QE1B 2QB0A 4DV2F 4DU3A 4HACA 4QS8A 2BDUA 2BPCA 4DQQA 2IY5B 4ERDA 1RCXB 4DQPA 1RTIA 2EKYA 2ZZNA 4WQ4C 1HJPA 1DJ0A 5D0GA 2U1AA 4F36A 3F5EA 3KZXA 4X65K 4LF8J 3HOSA 2P9NA 1FKPB 1FK9B 3TW0A 3EX7B 2IPOB 1SB6A 5KT5A 2P9GA 1NSQA 3EXCX 1ZQMA 2XNRA 1Y7PA 1WF0A 2K60A 5E79U 5DZ6A 4B08A 3V1QA 2NYHA 4M9LA 3H0MB 4DUYK 2I5JB 2ZIWA 1N5YA 4H54A 4HR2A 5I3UB 3JB9k 5LOQA 2EI5A 2Y0SF 5C12A 7ICSA 3P4IA 2EZZA 3FFIB 1SBRA 9ICSA 1T44A 2FJXA 1DARA 4DFKA 4NYZA 3T19A 3U7JA 3OLAA 2YXLA 2G2YA 3HPOA 2E5LF 2EBGA 4USWA 4IG0B 4BREA 4JI6J 5BR8J 4Y2XA 2PEHA 5DDOC 4FZYA 4O55A 4IBNA 4WP3A 4PCQA 3TNVA 3IN5A 9ICLA 1PC4A 4NXMJ 3CIPA 2Y0SD 3OYMA 1BPYA 2RMLA 2IAJB 5L1IA 1TKXA 5F41A 1XERA 2VKRA 2ZOFA 4U96A 2K1RA 4MEYA 1VR6A 3GV5B 2RH3A 2G8IA 8ICCA 4B3RF 2XSJA 2H3GX 4DI6A 2HFOA 3C7NA 3CEDA 4PL1A 3KLGB 3HSJA 2VU5A 2F4VF 2P9UB 4BJQA 1K44A 1ZM3A 3ZZOA 2XM3A 2FIUA 2W7OA 4C6AA 1LWEB 4NYFA 4L6V3 3PJ9A 1VSKA 2DXEA 2F8LA 3DHWC 1ZQGA 4H4MB 4YB1P 4NXNK 2RPIA 5AM1A 1VS3A 4EI2A 2FJDB 3K5OA 2E8OA 1FDDA 3P4UB 4J03A 1UETA 2Y8WA 2BANA 4B3SK 1PC5A 5KFAA 4ZCIA 2DR6A 2VFVA 5JVHQ 2HNDB 3PW4A 4FYXB 1IKXA 5E3PA 2IJRA 2FPKA 3SUPA 4UATA 2KXNB 8ICXA 2PYLA 3CCQS 1T95A 3BSAA 2JLFA 3TAMA 3CDAA 2N4DA 4ICLB 1HMVB 4KLEA 5RUBA 4DV0J 5KFWA 4QIVA 1UA1A 1XR6A 4QWEA 4CJPA 1NZPA 3AUOA 3M8YA 1G99A 2PA8D 2HGMA 4BE0A 1FXLA 5J2MB 1JKHB 2GIFA 3WXMB 5D49A 2IM3A 2BQUA 4IDKA 2OA8A 1C0TA 1F5CA 4AM6A 1T03B 3HRGA 3M32A 4ZVGA 4KJIA 7ICOA 2OLWA 4YB5A 3QGPA 2ZVSA 1I51B 3E8OA 3SDEA 1X0FA 3U27A 1WSJA 2RD5C 1KQSM 4UF4A 2ZFHA 4RT2A 4BG9A 4BC7A 1RBAA 4R63A 5AM5A 5JVGQ 1BLUA 4P7TA 4AL6A 2ZWPA 1QM9A 4BHQA 4LF8K 3ETLA 3KMQA 3GDXA 3MC1A 1DHMA 4C4TA 2GH1A 4DV5J 3BS5B 1YJWS 5KFOA 3N4MB 1T05A 1HPMA 1UVIA 3M7VA 3B6OA 2EANA 2RHFA 3QMQA 4YP3A 3SENA 3OYAA 1EQ0A 5AZJA 4B1WB 4IQXA 1QDUB 3DRXA 3O6WA 3UXPA 3SIPB 2IMOA 2EWHA 4IO9L 2FY1A 2G0AA 3Q7BA 2LBOA 2KVCA 3W7BA 1U1PA 5FRNA 3Q8YA 2LHTA 4DCPB 3WK8A 2ZGYA 3PACA 3E2EA 4UB8U 1XNQF 1LK5A 2VOPA 1YKWA 2WB1C 3RJKA 2MDAA 5HP4A 4DR3J 4EO6A 1PKUA 4XUSA 4LF1A 4YFKA 4GVLA 4X62F 3W62A 5D6GA 1ZQLA 2AKWB 2OXOA 3HKWA 1L3KA 2M70A 5GAEI 4CIEA 2MKYA 2KKPA 4IJAA 5JU5A 2R8GA 1KAYA 3I55N 3WIUA 4FW1A 3VGUA 3E01B 3CDEA 1BCMA 2IVOA 4O8KA 2NXNA 1YITN 4J9KA 2YKOA 4EFAC 2RS2A 4EBCA 2UU9K 1TKTA 3AH6A 1IWGA 1SV0C 1FRLA 2VD3A 2RHKA 2CZVC 4C98A 2NLXA 2LYHA 3FEYB 1WHVA 2D69A 1ZPWX 2DGXA 3WX4A 3H59A 1UW4A 2D6FC 3ILIA 4CT9A 4O3RA 3RMCA 1FO4A 4HTJA 2WONA 3DDHA 1RXWA 1Y0HA 1EETA 1X9MA 2DFEA 3P5BP 5AM0A 7ICJA 1VQMS 2DFHA 4EX7A 5CZXA 3ZTSA 1NJWA 4UZCA 1KCFA 2IS3A 3B8HA 2R42A 1SIJA 2QKQA 4UUWA 4EMDA 1H2UX 3OHBA 2CJYB 2FPLA 4F7VA 2FY8A 2QB0B 2OKQA 5DBAA 3OS2A 2RILA 5U47A 1QCKA 3M8ZA 1EIYB 1LFWA 1VBYA 5KOXA 1BC6A 2HBKA 2DRBA 5ALPA 3CNQP 2E9TA 2COLA 3B54A 3NY0A 3PHEA 2BUNA 1WHXA 4ZVQB 1JIHA 4OJ6A 2VONA 4MLEA 4DR6J 2G8HA 3FUYA 1WN7A 2CVIA 5AXNA 2OANA 1NMDA 3Q8VA 3FGVA 3T6BA 1HUZA 3CQXA 2HCFA 3MAQA 5KPRA 1NK8A 2VF3A 3VENA 3VAFA 2D0OA 3TADC 3MPUB 1QVFM 3D5MA 2X1FA 2HVHA 3T41A 2EQYA 1KHWA 4RQ5A 1JMSA 3FYHA 2XS2A 4CGIA 3A8JA 7FD1A 3F2BA 5SWMA 2MKHA 2XLIA 1M1HA 1BOTO 2ZHOA 3HP6A 1R8CA 5HQMA 4J5OA 3DXKB 2IDOA 4KHPK 5HR7A 3KK2B 2Z56B 1X31C 4LZDA 1UVJA 2HW3A 5EOYA 1LVHA 4GKJJ 4PG8A 1KS2A 3CJRA 1SJ4P 4WCEQ 2NO5A 4OI3A 5K8PA 1Q18A 1HBUB 2KNJA 4FZMA 5M1FA 1U1QA 5AKXA 1N48A 1RDBA 4FJKA 3FZ2A 5EHHA 4EU0A 5IT9O 2VFTA 3SK3A 1HBMB 4F93B 1M5HA 4F3TA 5I42B 1ZQIA 4LF6J 1HD0A 1X5TA 4M1KA 2AT1B 4TY8B 4GVBB 3R8EA 4CERA 1YJRA 1UA0A 2G4BA 3DXSX 2P6SA 3MGHA 3LYSA 3KJQB 2ASYA 4KH1B 3T5HA 3HI0A 3CVKA 4Q44A 5GVQA 2OPRA 1QVGR 4F67A 5BR9A 2FLPA 8ICOA 1C0GA 1WUUA 4KRFA 3UD5A 4DL3A 3UKUA 2WW8A 3NG8A 1K8KA 4FF4A 4HL9A 2D3DA 4DDFA 3LPEA 3TJAA 2ZUCA 1IKWA 2PMZC 3K2YA 1ZQPA 1FX2A 4A57A 3RH4A 1ASWA 3WUHA 4LSLB 4CZCA 1ZD2P 3RAQA 4KH6A 1VDHA 5CZ1A 2F4VK 4TNOA 3TUIC 3A5LC 3BO4A 4NXMK 1VQ6N 3VN5A 1H0HB 1UEKA 1FX4A 4QU6A 4CH1A 4W90B 3LL3A 3J80U 2G8WA 1NGFA 2FVRA 3D7SB 4K4HA 2B6AB 1DGKN 4OYPA 2OEHA 3U4LA 4AHTA 3G71N 4DR7J 3BGUA 4DLGA 5F1XA 2J8AA 2PN6A 3R2CJ 5AM4A 3U1LA 4LUBA 3ZZRA 5EDWA 4LF6F 2QWQA 3ENAA 3DYAB 1BE4A 5GMKa 2V67A 1ZA1B 3LUYA 1BY9A 2WF7A 3DOMB 4OJ3A 3M1YA 1AB8A 3MGIA 4NLNA 3D3BJ 3JPPA 3CCJN 1WDTA 3IBWA 1LW0A 4A8YA 2DF4B 1DKGD 1NKEA 1YBAA 8ATCB 3WKEA 4FJ7A 2FZGB 3EICA 2DKXA 1Q7YO 2EKNA 1HNZK 5KFSA 4DU7A 5BRHA 2UUAK 4A62A 1K73O 5E3RA 2FSNA 2YMQA 4OCZA 3IDWA 2NZTA 5AI4A 4K25A 1V85A 1KVJA 2NXUA 5HN0A 4KHNA 3TUPA 4A47A 3GE1A 3CC4S 2NQPA 2ZOGA 4TURA 2AQ4A 2Q6CA 1SVDA 5GAHU 4PXDA 4WXOA 4EZ6A 2QYCA 3D1OA 5FIIA 4DV5K 3JQMA 4CD3A 2MQOA 3KIOA 3VQEA 1WC6A 4OMFG 3N7SC 1WBDA 5E0OA 2GHPA 1WSRA 3QRRA 1VBXA 4R0EA 1W7WA 4WFAL 3EPIA 3OV7A 3JS6A 5J2PA 3UCUP 3RJEA 2NZCA 5AM2A 3UB5A 3ZZZA 3VA0A 3VVTA 4AYBD 1S0VA 4IR9A 1KLNA 3G8TA 2JEGA 8ICJA 1J2VA 1RBOB 1HWUA 4DL2A 3KJFB 2R7YA 5AQWA 3R5DA 2ALYB 4JI5K 1RTJA 4Y2MA 3T3FA 5ETOA 1C20A 1DTTA 3LWMA 2MKSA 2AEJA 3R8YA 2GMLA 1KQFB 4UB1A 4LRDA 3HF5A 3AA5X 3JTOA 2RDJA 2ZF5O 3DI6A 3I0RA 1VQ8S 1P6TA 1P8ZA 2GLEA 5L1MA 2CUYA 3L95X 1RB0A 3M6UA 1EZZB 4DV0F 1ICEB 5ETRA 3WK6A 4CYUB 2RJZA 4XH5A 4PGYA 1EWQA 2RQKA 3OLBA 2I2YA 3KG4A 3DOLB 3NWRA 3GIIA 4NEZA 3IAS9 5J2QA 2EVZA 1IO2A 2HHUA 2E9RX 4YY3J 3R5GA 3QU2A 1FRMA 1BPBA 1Y9OA 2FGCA 2WOMA 1NMEB 2FJWA 1VRUB 4MMOA 1BDGA 5KT4A 4F91B 2UUWA 1NH7A 1BQXA 2EHGA 3BQTA 3AD7C 2ZH2A 3HL8A 4D3HA 1JXEA 3M2RA 3MCMA 3MEGA 2P9IA 5IC6B 1D8YA 4I6WA 2E7VA 1COOA 2JFDA 2WBNA 3NVVA 3D2NA 4L74A 1NG9A 4L72B 1KDNA 1UZHA 4HDGA 3ZSVA 3PX4A 2AYEA 4UB3A 3CQYA 2K7JA 1CSJA 5HHHA 1SIWB 2VASA 4DKWA 4BC9A 2V50A 4F26A 4PR6A 2BCVA 4YORA 1UWBB 3N28A 4DPXA 3OYNA 4BR0A 2VQFF 1S72N 4AT1B 4O44A 3AJDA 4KPCA 1QJHA 2JLGA 1VHFA 2NS1B 4HAIA 3BR8A 3I5CA 1F2HA 3Q8MA 2UVUA 1NDCA 4DR5K 1UKUA 2YKMB 4UOFA 3H8JA 5AQFA 4JI6K 5HMMA 1GX5A 3QNWB 3M6KA 1QTMA 5J0TA 2RAQA 1HQEB 2O1PA 3UCGA 3O1WA 5IZHA 2K1RB 1QQ5A 4DWIA 3KLVA 3I8BA 4TKTA 5A8WB 2OEJA 3HJEA 3WXIA 3EWGA 1XMOF 4ECQA 4LRBA 5AKJA 1YVNA 1JLGA 1UVNA 1FJGK 1PGZA 4X62J 4IC9A 2ESEA 1ZAVA 4MIAA 1KD1T 4ECTA 1FRKA 1TL1B 1SI9A 4CNYA 1C0UA 3KWMA 3T1HF 4BQZA 3AEVA 2VQEF 4G1IA 1T9UA 4BCAA 3BSNA 1MROB 2MZSA 3LAMA 3CIMA 2O3DA 4WFXA 2KZMA 4X4RA 3EO3A 2W41A 2FPMA 1RT3A 2WFBA 4WQ5C 5C2CA 3DMJA 4F71A 1ZM4A 3RBXA 5CJ7A 2RDIA 2HPUA 2J0XA 4YFUA 3SQ1A 3VEVA 1HUXA 4DQRA 1VSEA 3PIPQ 2GWJA 1CS4A 2VC1A 1Q3UA 1SAZA 1FK9A 4U95A 3R9LA 4NLXA 1VSLA 7ICLA 2WF6A 4ZOHC 7ICUA 1N5VA 1HNXF 4C7YA 4HACB 2QLBB 4Z4GA 3NXZA 4JV0A 3V4MA 3V9ZA 3QNNA 3DM2A 4W98A 4OYOA 4CP5A 1QSYA 5AICA 2BE9B 3UNYA 1BIZA 1HYZA 4XAKA 4I27A 1IKYA 3KZIU 3ZSYA 1ZRNA 1UAWA 3G82A 1ZQCA 1UTAA 3NRWA 3V7KA 5JJBA 2E5GA 5L46A 3KUEA 2ITMA 1V9PA 1UFWA 2EX3A 4PA1A 4ZHRB 1TL5A 3WK7A 4CRJA 3PV8A 4CEOA 1RT1A 1RDDA 1OW5A 3QDKA 4KREA 1WUAA 1FE0A 2GAHC 3KK3A 3T9NA 4XPEA 2F8HA 5J2JA 4J9QA 2DISA 3RG6A 5AQIA 2DEIA 4CJUA 2BJ7A 4Q43A 1RWVB 3ISBA 2VPZB 2B4UA 5CE3A 1BCOA 5AE2A 4QU7A 1M6YA 5H1SV 3IRWP 4QBUA 2MKCA 2PXIA 3BF1A 2QV6A 1A5XA 3OFFA 1ZH5A 3KMSA 2VJVA 2YWWA 5ALYA 3NAEA 2C1EB 5ETSA 5I42A 4DR1F 2X3DA 4R5PB 4L8RB 3C94A 1KFDA 3MAHA 2W6KA 1P27B 3CCLS 1TE2A 2CQDA 5BPMA 5DG7A 2R7OA 3VQ8A 2VG6B 2XI3A 2HQ3A 4BRKA 1VSJA 3W66A 2O8FB 2YNGB 2LCWA 1S57A 3LF0A 3VMFB 5LJ3Y 2QWNA 2PD1A 2GO8A 1X6IA 9ICQA 1L7NA 1RWXB 1FEZA 3MMBA 3BKFA 1Z4UA 4PY5A 4AHRA 4PZNA 2AGQA 2VJ5A 4DTUA 5KGXA 4I2GA 4YDXA 2HS4A 4Y2KA 4YY3K 1WC5A 7ICGA 5M2RA 1VQON 4Y1CA 2YKPA 5K20B 1ZD4A 2HMIB 1REVA 3FBBA 3I56S 5KTQA 3TA2A 3ICLA 4C7ZA 1WACA 3DLLQ 5AQUA 3NH0A 4K4VA 4ECVA 2I38A 3GJQB 4G1PA 1HHQA 4LREA 1J6ZA 5A8WA 4DR1J 3NS1A 5EN1A 1F9FA 3A2FA 3M3ZA 1FFSB 1T3QA 3HHNB 4AHUA 3ENOA 1IM4A 5C24B 3A0BU 4FNIA 2CJBA 2I7NA 2RN2A 4USJC 3BH6B 1RCOB 4B9SA 3H46O 4KPYA 3CGIA 3BKTA 4CF9A 3GB0A 2YKMA 4LC9B 1CXUA 5KNIA 1T02A 1KDHA 2B0GA 1X4AA 2DNOA 4P2MA 4HHTA 4IR1A 3N7PD 4O44B 1Q8KA 5CA7A 4A61A 3Q8SB 2DR7A 5BRDA 3NNHA 5CYQA 3AY0A 4CNZA 4M3UA 2Q4TA 4M9JA 1GTEA 4PHPA 2HBYB 5DMRA 4WTYA 1MWYA 4CGDA 5G5GA 3WXLA 4FN5A 2IYGA 2NSBA 3MMCB 4KGXB 1HPZB 2QN6B 1D0EA 4O3PA 3O9QA 2KP7A 2PMZF 3P83D 1WB9A 2WW4A 1FEEA 3VPZA 5J2NA 4GKJK 5KG4A 4CJVA 4CJSA 3CCWA 3QYPA 2FZKB 2PFDA 2W9MA 5HP1A 5J8YC 4C3LA 4W5TA 2HOQA 1JJ4A 2LQBA 2V94A 5KFXA 4ES3A 3OR2B 2P9PA 4KBOA 4OJPA 2RHSB 2RSQA 3MAAB 3TU5A 4CK2A 5KFGA 2EWSA 5D15A 1N34J 4JI1J 3NF8A 2AW0A 3IBCB 2FB0A 3G71S 3CJKA 4MDAA 4WCEL 1JLAA 3VV2B 3MXMA 2A2CA 3IM1A 3QINA 1JALA 2VOOA 3T7ZA 1HEKA 5HAOA 3MOJB 1HA1A 1OH8A 4IDKB 2K8BB 4CDGA 2OH2A 5AQLA 2E44A 2ACMA 2QARA 4JK9A 1U2RA 1XQSC 2ZJRL 1VQYA 4N77A 3PMLA 3K1RB 1VYAA 2PAVA 1WHYA 1WWHA 1UPHA 4ZVUB 2J5AA 4CE6A 3VETA 1KSPA 5ELZA 3ATVA 3OFGA 2FE9A 2MJUA 2B21A 1HMVA 3SQGA 3EXYA 3RAXA 2RHQB 4ECUA 3HJVA 2QL5B 2Q3SA 3GIRA 4BRFA 4PEOA 5FLXU 1K1QA 2N3LA 3SFGA 4CJFA 1ZBUA 3SMSA 3KOOA 4KB7A 3VQCA 5JLHA 2LQJA 1G15A 2XWYA 3P31A 2LP4A 3TVYA 4FPIA 4IFVA 1MN9A 1OSCA 2CGKA 4ZKAA 2R7SA 3AU6A 4B3TJ 4DUZF 2DH8A 2L41A 4DO9A 1UT5A 5GAEU 4DR7F 5AKGA 4TUPA 2OMOA 3O9UA 2PFPA 4I2PB 4KX5A 3MCNA 4Z94A 2AA4A 5KAKA 4JI6F 2XO7A 3QBWA 3IDHA 3V4IB 1BGXT 2ZIUB 4ZLNA 2BRKA 2GGPA 1TL3B 3Q7CA 4U7UK 3R7SB 2W7PA 3AQPA 5KFDA 5B0AA 4C48A 1VC5A 3OT9A 1Q82O 2FBVA 3ENWA 3K5LA 4FKXA 1KVIA 1S9FA 1IKVA 1Q86T 4CF8A 5AQMA 5F8HA 5KT2A 1PO6A 2HMPA 1NNLA 4EP5A 1V5VA 1WC1A 3UR0A 4JI2K 4M3XA 2RRDA 2ROGA 1QAIA 1QQCA 4JKDA 1U47A 2GTDA 1GH8A 5HL7Q 1HD1A 2O4GA 3O3FA 4NXZA 2BKOA 2E7XA 2HBQB 3POTA 3CTRA 2GV1A 1BD6A 2HS3A 3DYAA 5A0YB 3T5LA 3L4IA 4ZP9A 1HNWF 2M5YA 4J91A 2L3MA 4KGMA 2NRTA 3G9CA 4FF2A 4IDHA 1RAJA 3ZNUA 1RLCL 1XC9A 3CDWA 8ICWA 2CQGA 3D3CJ 5FPEA 1ZQVA 4WZQA 4B3MF 1OUQA 5EX5A 3NP5A 4FWMA 3MUVP 2RQCA 3W0LA 5LT5A 2BANB 1RBVA 4UAUA 2QLFB 2KTQA 2XCAA 1J27A 4IO8A 4CEAA 3P8BB 4X4PA 1T8EA 1U1NA 4JKBA 4A46A 4OJOA 3LO3A 1VSMA 4XIUA 3G86A 1OQ6A 3NMAA 3MN6A 3TO8A 1ZBIA 1G3OA 1FRIA 1HARA 2MZTA 1AFIA 3TABA 4ZP6A 2FC8A 2ADBA 1NHKL 1IJEB 2I8EA 2NPIA 4GVMA 1U2VA 3HT3A 1NK0A 3RB3A 4K4TA 3CHWA 4TY8A 1UVLA 3K0JA 1QH9A 3ISCA 5ADZA 5AQQA 3MX2A 3SLCA 1RE1B 1T11A 2HDOA 4MT1A 4R25A 4KLIA 3M30A 3RBEA 4I64A 2BJ3A 3BKUA 3NF9A 4PH5A 3J7ZO 4DV6F 3R9KA 4IWVA 3F73A 4QNLA 2WSFC 2XZDB 4LFCJ 3SJJA 2Z2YB 3BEXA 4RTFD 2X51A 2CJAA 3K0SA 4G65A 5ETNA 5ALQA 3UDEA 4Z4FA 4J9SA 3S3MA 2XB2D 8ICIA 1ZBTA 2DH9A 2P1JA 4YHHF 3CW2C 4QZEA 4QYZJ 5L9XA 3ZT2A 3LPUA 4CZEA 3IG8A 3NASA 2DYAA 4EGLA 1N5QA 3PO5A 3MWBA 5FPDA 3ZCMA 1KHVA 5TKWA 1GMUA 1Q78A 4PG5A 1ZQSA 3M8PA 2K8AA 3HTVA 5J0RA 2BM0A 3O1BA 3JSRA 3O9TA 3MPWA 4LFBJ 4C1NK 3LQVA 3IR6B 4IXCA 4USUA 2W55A 3US5A 5GMEA 3AY9A 4M3WA 2XCPA 4YB7A 4M3YA 4PPDA 1M5PC 2YNFA 3MM7A 3CJ9A 3HMJG 1DGSA 1T9VA 4MFFA 1JK9B 4YQWA 5DB8A 2NUHA 2MPUA 1S4EA 3MTKA 2X3GA 1H98A 4EO8A 1N32J 1WBBA 4ZP8A 1MG7A 3VGSA 2V7YA 4DTPA 4RW9B 3Q24A 4AHVA 1S22A 4DFMA 1S9EA 3OR1B 4N41A 4CK3A 3M5RA 2MUTB 3E66A 1R59O 3KKAC 3CWJA 2VDHA 1GLFO 2V4RA 4WF9Q 3BR9A 3M8QA 5ALZA 5HQLA 3I28A 1RT4B 3LWLA 2CRXA 5IIOA 2RU3A 1Z26A 1EJ7L 2D41A 2GAGC 2WHOA 2DNNA 3BS5A 4ILLA 2WOMB 1RT7A 4WF9L 2MRLA 3WC2A 3FAHA 2QZ8A 3HDSA 4YMMA 3FE1A 4ECSA 3CCRN 1UJ5A 4MO4A 5ADXH 4Y28C 4IFYB 4ANEA 5DETA 3OPKA 3CF5Q 2ZC3A 1NB2A 2KO1A 3ZZUA 3RJMB 2KIWA 2FSKA 2CQIA 3SQ2A 1N61A 2P66A 2IRYA 4ZH4A 4F04B 2FI1A 3BS7A 5HP1B 1NMNA 4ILRA 1NGBA 1DTTB 3PIPL 3VEZA 3OJUA 4A48A 5IT0A 2IM1A 4ZIVA 2HHHJ 5T14A 4J9LA 3DNCA 3DLLL 2UUBF 1FJEB 1K9MT 5LXRA 5J2NB 5H9EK 2ATQA 2VBZA 2KJ8A 1VIXA 3HJFA 2IGIA 4H0VB 2WF5A 1I3AA 1WCNA 3S7RA 1WKKA 1R6YA 4B3TK 1Q53A 1CPZA 4US8A 1BNPA 3I0SA 1UW9A 1NGGA 3L3VA 2R2RA 4NLCA 3EE8A 3KHHA 4IH6A 1HQ2A 3PW0A 2O8DA 5BXIA 3O8MA 2JV3A 4P0QA 1ZBLA 3C5GA 3SSQA 1DQ9A 1GT8A 3D45A 3KFUF 4RQ1A 4PKIA 2Z57B 3NWGA 2A5XA 2VC0A 3CCMN 4LFCK 2YN4A 3NGIA 4ZCMA 3EVWA 2B43A 3AA9A 4YD2A 5C24A 1RYSA 4DQ8A 1FJGJ 5AT1B 1AT1B 1OJ4A 3FK4A 3I6PA 2CPZA 2BW7A 3M8QB 2JGAA 4B17A 4ZCLA 5FDLB 3TVKA 3MOZA 2YHXA 2R8JA 2MLYA 4CFCA 3DJCA 4FJJA 1HWIA 3H08A 2HFUA 2D3ZA 1OY9A 3MM6B 5B5EU 1YI2N 4KV8A 3I96A 1U0SA 4DTNA 5HRNA 1OVQA 3H3OB 5AXMA 1H74A 5AQZA 1VLOA 5AKYA 1TR0A 1QHAA 3FZKA 4LQ3A 1HYVA 5DGAA 4ELTA 4DX7A 4IG0A 2QI2A 2KRBA 2UUCJ 2ATCB 4LF5J 1KQQA 4RL1A 2NV3A 3GOIA 1DXSA 2RF2A 1RT2A 1TZ0A 4CVNE 2W8KA 3BSCA 5J1EB 3QGGA 4ED4A 4ILHA 4Z37A 4ZVRB 2ZH6A 1IBKK 3D1HA 5AQYA 4Z6CA 4F2RA 1BHLA 3WKCA 1T6CA 1OQ3A 4CJEA 1VQNS 1L3VA 3LDNA 3PNIA 3JPRA 3W64A 1BI4B 2VPYB 5F2RA 1B64A 2MSTA 3LOUA 2KEYA 4OJGA 2QW9A 4CDIA 5EWGA 1S9EB 5ETKA 1FA0A 4ZK7M 1M5KC 3QEPA 3V9UA 2E6MA 3CFRA 2E5JA 1U1KA 3NCQA 4GRSA 5B0GA 2E8PA 3PEHA 1BMQB 3QUQA 3JS9A 4WFYA 4BRLA 3AGRA 3OSPA 2DIUA 4JI7F 2NZ4A 1CZAN 1NCLA 4P6QA 4E19A 3KLIA 1SC1B 1GMVA 2GS8A 3DGPA 1YJUA 3BGRB 3N6LA 4NLSA 2IVNA 4DUTA 2QA4S 3QZ8A 4YB6A 2QL7B 1LWCB 1YJNS 2DPNA 3OPXA 2JFKA 4I2JA 2QIFA 3CDBA 2IVYA 1P90A 3NVZA 1NU0A 3NHGA 1C1CA 1TV6B 2FBXA 1QVGM 2XHWA 2HK3A 2P9UA 1SXDA 4ECYA 3ETRA 4F92B 4CLWA 3RB0A 5JVHL 2G8VA 4JI0K 2I5HA 1YLXA 4MEXA 1T94A 1N60A 3SNNA 3QWPA 1RI7A 2RE2A 2MLXA 2IA6A 1MSWD 4ELVA 4O0JA 3DM2B 5KFTA 4XH1A 5GADP 2OHDA 3QEXA 1BG3A 3QESA 3QGHA 5GADU 4DOBA 3PFEA 2E88A 5A2QU 8ICEA 4B1ZA 5AIBA 3ENBA 3NF6A 3DWLA 4E7JA 5ALTA 2IIRA 2QA4N 1RBSA 3TAMB 5L39A 2F1HA 2FHKA 2LQ8A 4MF2A 1RQLA 4V19X 4H4KC 1WG8A 1T9YA 1VQ4N 3A8EA 2K4PA 1NLKL 3WK5A 3RRKA 4PYDA 4GKKK 5CHCB 2BQ3A 4M5MA 1JWWA 4IQVA 1U04A 1VQ9S 4Y0FA 1WAJA 1E6YB 3F2CA 3OTEA 3O2IA 3KKRA 1PJ6A 4NCGB 1HNVB 3ASMA 5EE3A 3G6YA 4QZ8A 4E1JA 1X60A 3JTNA 1Z1ZA 1I94J 1TMMA 2UV8G 4IO9Q 3MXJA 3O3HA 3C23A 1E6VB 1JLQB 4F0KA 3MMJA 5SZTA 1Y5LB 1LWEA 1B0TA 2I1QA 1RAHB 2CH6A 4LF4K 5IV4A 3NH1A 3TEGA 4DL6A 3HZEA 4X66F 4ED1A 1FCAA 2M3DA 4H03B 5B7WA 1YI2S 1TVRB 4NYOA 4KLDA 4PL7A 2VIXA 1B7FA 1C0MA 1OWXA 4RNHA 3E9OA 4B1UB 4CZIA 4E7IA 4ZLPA 4OLPA 3TR5A 4DCCA 3JPTA 1RP5A 1G2EA 1B9DA 3GYGA 5B8HA 1VQ7N 1LWCA 3AVIA 3QEVA 4BROA 3RRGA 3CD6S 2Q0RA 3GLJA 3FKBA 2ZIUA 4QZIA 5I4MA 3SAFA 3CC4N 5KG6A 1KLMB 2EAOA 5A6PA 5KL8B 5CCMA 3BS9A 2KOBA 2HHVA 2IC3A 5F8IA 1FT8A 1HW8A 3NGKA 1RBUA 4D3GA 1I5OB 1KKXA 3UWTA 2EFNA 4O3MA 1URRA 4BR2A 1TL7B 4M7XA 3RSEA 5LJWA 4IQUA