3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
1I50H 2CKZB 2ZTEA 4C3IH 2NVXH 3H0GH 4L5SA 2R93G 5AJ3L 4DV1L 2UU9Q 2IY5B 4JI7Q 4POGA 1OXSC 4RG1A 5LMNW 4JBWA 3CMAA 4FDBA 1WI5A 4IFDJ 3CPFA 1KC8C 2I5HA 1WYDA 3I55A 4YCWA 4HIOA 1NMFA 2HQLA 2MQHA 1X55A 3J80i 3CQZH 4GOPB 1Q1BA 3CC2A 4GOPA 3UDGA 1PH8A 3CD6A 2UXDL 2OQ0A 3RZOH 5M3MG 4IPHA 1JT8A 3UDXA 4NB3A 4A3BH 3GTJH 1EOVA 2C35B 2YV5A 2OTJA 1PYSB 1VQ5A 3RZDH 1VCIA 3BU2A 2PQAB 2I5MX 2CCZA 2D0PA 2ZM6Q 4A3GG 4C3JH 3NELA 4R4CA 5IYBH 4DR4L 3QSYB 4OONA 4JI0L 2JA8H 2R92G 4DR1Q 1SR3A 3AFPA 1B8AA 2OTLA 2JA7G 2VNUD 4BY1G 3J81j 2NVTH 4DV6L 4A3DG 3HFZB 4HJ8A 1OXUA 1J5EQ 3PIOA 3H3VI 3ULJA 2JE6I 1JMCA 1PHJA 2QGQA 4BY7H 1XMOQ 1SROA 3HKZE 2WB1E 1K83H 1VQDA 3PSIA 4QJFA 5GROA 4DUYQ 3CCLA 3KOJA 3JAMi 5GAGC 1L1OC 5HGQA 1XJVA 2HIXA 4GNXA 1YJWA 2JA5G 3HOYH 1VQEA 5BR8Q 4C2MH 3ER0A 3CCRA 1G51A 4OXPA 4JOIA 4JBMA 3K80C 4DK3C 2DGYA 1Y1VH 1NY4A 5GQOA 3STBD 2Q2UA 3S17H 4WJ4A 2AKWB 4PMWA 5C44H 5LMUL 5M3FH 4A3JH 1UEBA 4LFAL 1G291 1PH3A 4IOAA 3DLLA 3PUWA 2XTIA 4GLXA 2AWOA 4IO9A 1AE3A 2AWNA 2PNHA 1FJGL 4IPCA 1S72A 4P75A 4A93G 1J6QA 3STBC 5GADC 4GLAC 2IHFA 1HZ9A 3RLFA 5IP9G 1KD1C 2ALYB 4A3MG 4DUZQ 4JG2A 1LM0A 4DR6L 4GN4B 2E2JH 1NE3A 1IYJB 3M3YH 4LF6Q 2VUMH 4RMFA 1D7QA 4JYAQ 1EIFA 1D8LA 3BZKA 2IHEA 4MTNA 4B3TQ 3FKIH 5LMNQ 4YCVA 2QA4A 3GTQH 5IP7H 3GTPH 3GTOH 1IZ6A 1YJ9A 1YEZA 4MNOA 2BH8A 3TRZA 4GKKQ 4DV0L 2RHSB 3A74A 1YBYA 3ICEA 1KAWA 2UUBL 1CKMA 4OO1G 1OXTA 3KF6B 1WOCA 3ULPA 1YHBA 1IBKL 1B7YB 1PH4A 1KRSA 1IBLL 4B3ML 4IPDA 3TS2A 4MZ9A 4NPSA 4YY3L 1JJGA 2UUAQ 1FL0A 4P72A 1N33L 4LW1A 2VY3A 4X62L 1YZ6A 2GN5A 1PH7A 1BBWA 1EIYB 4A3BG 1IBMQ 4JI1L 1VQAA 2B63H 5FLXc 1HNZL 5C0XG 1LUZA 3T1YQ 4JI6L 4OX9L 3S14H 1TWHH 1GKHA 2AMCB 3G6EA 1YHAA 1XTDA 4O2DA 4LFCQ 5IYBG 3S1QH 1MKHA 2VQFL 1M1KC 2IX0A 1E1OA 2AHOB 4LF5L 5JEAG 4YHHL 4A3KH 2MNAA 1SE8A 1Y1WH 2HT1A 1TXYA 4DR7L 1LYLA 2JA9A 2K4KA 3F2BA 4UPAA 3U50C 1QZGA 2DUDA 4LF7Q 4A3CH 1X3FA 2OQKA 3A5UA 4HJ7A 2BA1A 4NXML 4P73A 2K5NA 1UE1A 1V9PA 3PUYA 4Y7NH 1Q7YC 4J15A 3J7A5 3PF4A 4BY7G 4K0KL 2UUCL 1VQ8A 4BXXG 2KCMA 4JI2L 4GKJQ 2E5LL 5ELNA 2WAQG 1TWGH 2HHHL 4JBJA 3EIVA 3I4MH 4LFBL 1Y14B 1MJEA 5IT9c 4OO1I 2D62A 3D0FA 4EQ5A 1VQ4A 4X65L 1C7YA 2ZTDA 4LNQA 2UXCL 3U4ZA 3CCJA 3HOWH 5ELOA 2VQEQ 4DV5Q 3L2PA 4DR3L 2CQOA 1Y1VG 2MO1A 2N8NA 2LXKA 3FP9A 5C44G 5M3FG 5EAYA 4A3JG 4JI8Q 2Y0SG 3K8AA 1JE5A 3CCSA 1I94Q 5C0XJ 4HIMA 1HNXL 1FVIA 3A0JA 5C0XI 2UU9L 2RF4A 1PFSA 2RHQB 3S1RH 2E2IH 2NVQH 3ZJYC 1HZBA 3HOZH 1PH1A 3VDYA 4LF4L 1C0AA 1HNWQ 3I2ZA 4BA1I 4TVAB 1EQRA 2GVAA 3M85A 3CCUA 4DV7L 3T1HQ 1Q46A 1WJJA 2Z6KA 2VUMG 1A8VA 1E24A 4GS3A 2F4VL 3PO3H 1JJCB 4ALPA 3FKIG 2D0OA 2EXDA 1QUQB 5IP7G 2UXDQ 4OWWB 3PGZA 1QUQA 1EYGA 4XIGS 3GD7A 3Q8DA 3K7UC 4APVA 2R7ZH 1UE6A 3K81C 3WWVA 1VQ7A 3ULLA 3AQQA 2K14A 2R6GA 3G71A 1K3RA 3IRBA 3M4PA 2ZM6L 4JI5Q 3W1BA 4DK6C 3CCQA 3J7ZC 3RN2A 3PO2G 1E3PA 2H5XA 3AYHB 3D31A 3NEMA 1I3QH 2YTXA 4A4IA 4C3HH 1GO3E 1H95A 1E22A 2GVBA 4DR1L 1X65A 4DR4Q 4IJHA 1XPOA 4JI0Q 1N32Q 4L5TA 1EWIA 4PG3A 4X64L 2QEXA 5IYCH 1J5EL 2B63G 1OXVA 1MJCA 1NTGA 3HOVH 1Q1EA 1YJNA 3UDIA 4GNXB 3GTMH 2YTYA 3AEVA 4KI0A 4X66Q 1I6HH 1XMOL 2LSSA 1LTLA 4UP7A 2CWPA 2ZJRA 3CCVA 3U4VA 1GM5A 1CSQA 5C4XH 1N9WA 2JQOA 4HIDA 4DV2Q 4PZ7A 4DUYL 4UY8C 4KHPL 3F8TA 1TWCH 1V43A 3CAMA 1Q81C 1HR0L 4A3KG 1N34Q 1Y1WG 2WP8J 3S1NH 1U5KA 2NVYH 4DV4L 4PZ8A 1PA6A 2JA6H 2UXBL 1YZ7A 1CKNA 1HH2P 1I5FA 5BR8L 4A3CG 2ZTCA 4P71A 3CMEA 3U58A 3PF5A 1X3GA 5IYDH 1RIPA 1VQHA 4JI4Q 3H3VH 3KLWA 1EUJA 3ERSX 5IY0A 3CPWA 4DNIA 3HOXG 4LUVA 5LMUQ 5C3EH 1OTCA 3KF8B 2JEAI 1PYBA 3TREA 1K8GA 1VQIA 1QVFA 3I4MG 1EFWA 3BJUA 1FJGQ 3H0GG 3HOWG 1B70B 1X9NA 4QL5A 2ZJQA 4LF6L 3I4NH 1Q82C 4JYAL 4P74A 4LF9Q 4B3TL 2MFIA 1XMQL 1SRUA 2RCNA 4LUOA 1M90C 4GKKL 5DLQE 2KENA 3G4SA 1PH5A 1BKBA 4A3LH 2R7FA 4GOPC 4L5RC 4AQYL 1SMXA 3GO5A 4POFA 4DV0Q 1WCMH 3CP0A 3S1MH 3HOZG 2N78A 3E9IA 5IWAQ 4B3RL 1WFQA 4DR2Q 4A3FH 1IBKQ 4QQBX 2WAQE 4DR5L 1IBLQ 2UUAL 3PO3G 3OTOL 4YY3Q 3EBEA 1SFOH 1GD7A 1X56A 2K52A 4HIKA 3J81i 2R92H 3HOUH 1N36Q 4QIWE 2YU9H 4GLVB 4GN3B 2JA7H 4X62Q 4TQUS 3I7FA 1Q12A 4A76A 1NMGA 2BA0A 4KHZA 3F2CA 4JI1Q 4GN5A 2JA8G 2R7ZG 3T1YL 2L15A 1HNZQ 4DAMA 1JB7A 2IT1A 2Y0SE 1VQJA 4LFCL 3I4OA 1KQSA 3E9HA 1VQFA 2A19A 5H1SE 2K5VA 1P8LA 1QZHA 3TEHB 2EQSA 3KJOA 4DV3Q 4NXNQ 4IFDG 3NBHB 1XNQQ 2I0QA 1R9TH 2JEBI 1A62A 1KRTA 4YHHQ 1L1OB 1X6OA 1RL2A 2OWOA 4LF5Q 2Q2IA 4XTCS 3S16H 1L1OA 1YNXA 3BZCA 1X54A 5IYCG 1CKOA 4AYBG 1VQ6A 4JI3Q 4UP8A 1KL9A 1YVCA 3PUXA 1XNRL 3HOVG 3J80c 4NXMQ 2OCEA 4JCVE 1HR0W 4B3SL 3RLOA 2N3SA 4GNXC 3HOYG 3S2DH 3SGIA 4LF8L 1SLJA 4GKJL 1L0WA 4JI2Q 3CW2C 2NN6G 4JOIC 4H02A 4LWCA 4A75A 1L2FA 2I5LX 1DGSA 4A3IH 2HHHQ 2JA6G 4JV5Q 2F52A 4A93H 4LFBQ 3JC66 4X65Q 5FLMH 5K36G 2HIVA 1E1TA 2N49A 2Q2HA 4YWLA 4JI7L 5AJ3Q 4DV1Q 1YITA 1NJIC 2LXJA 4AIMA 3S24A 2B29A 1S40A 3M7NA 4R1JA 2QN6B 4JI8L 4DPGA 1T9HA 1C9OA 1Q8KA 2B3GA 5GAEC 1I94L 5JEAJ 4OWTB 3CC7A 3H15A 4BBSH 2R7DA 3CXCA 3CF5A 1HNXQ 2YTVA 2FXQA 1PH9A 3PCOB 2VL6A 2NZHA 3EN2A 4KLKA 4Y52H 2VS1A 2WFWA 3TS0A 4YCUA 3I56A 1PVOA 3CC4A 1HNWL 1NBWA 5J3BA 3T1HL 1KXLA 1E7ZA 3DM3A 4LF4Q 3GTGH 4DV7Q 1VQCA 3I4NG 4PZ6A 4IFDI 3G48A 1N8RC 1P16A 3JAMc 1Q86C 2F4VQ 2A1AA 3KJPA 2CWAA 4A3LG 1HZAA 3F2DA 5IE8A 2ZJPA 4AH6A 1KIXA 3L0OA 3L7ZC 1WCMG 4JI5L 1S3OA 1ASYA 3M4QA 4YWMA 4L5QA 3GTLH 3KFUA 5FJ8H 2PQAA 1UE7A 4DV6Q 4A3FG 4BBRH 2CFMA 1W3SA 3AFQA 2NN6I 5JJLA 4A3EH 2A8VA 3UDFA 3KYHC 3HOUG 1N32L 4JC0A 4X6AH 1V1QA 2V1CC 3PIPA 1VQNA 1A0IA 4X64Q 1IXRA 4OWXB 1QVGA 1Z9FA 1OXXK 2YYZA 5C4JH 1CKNB 2IX1A 3M4OH 4X66L 1G6PA 1AE2A 5M5XH 1VQ9A 1HJPA 4DV2L 2KHJA 3TQYA 4BXXH 3OYYA 4KHPQ 4DAYB 1N34L 1VQLA 1CUKA 2XGTA 1HR0Q 1PV4A 5JJKA 1VQBA 4IPGA 4DV4Q 4LFAQ 2UXBQ 2R93H 1KHIA 1O7IA 1TWFH 3RR5A 3W5OA 2JJQA 2BH2A 1FGUA 4JI4L 3PV0A 2Z0SA 2Q2TA 1W2BA 1Z47A 4DUZL 2K75A 3RNUA 3CCEA 1K73C 1PH6A 2JK8A 1QVCA 1SN8A 2NZOA 3NENA 4DR6Q 3M9BA 3UE1A 1X3EA 4A3IG 5LMNL 2PMZE 5GAHC 4IOCA 5M3MH 3J81c 1VQPA 1K0RA 5FLMG 4O0AA 4R4IA 3HKZG 2WB1G 4IJLA 4LF9L 2ES2A 3K7AH 2UUBQ 4HJ5A 4A3GH 1U0LA 3RN5A 1XMQQ 4B3MQ 1UWVA 1MIUA 4AYBE 4BBSG 3K0XA 2Z6KC 1BVSA 4R4QA 1EQQA 2VZAA 2ASBA 1YIJA 1AH9A 1N33Q 5M5YH 4BA2I 4AQYQ 1JJ2A 1IBML 3PUZA 5IWAL 3HKSA 4BY1H 4DR2L 4A3DH 3OW2A 3KF6A 4B3RQ 1YHQA 3PO2H 1VQGA 4ME3A 4DR5Q 3OTOQ 1HZCA 4JI6Q 3MXNB 4DKAC 1N36L 1UE5A 4OX9Q 3GTKH 3CCMA 4HJ9A 2F3IA 3RLNA 3A5ZB 3S15H 1BBUA 1K9MC 1YI2A 4QGUA 2VQFQ 4QY7A 2PI2A 3MEFA 1A63A 1XPRA 4DR7Q 4UP9A 1IL2A 3E0EA 5FJ8G 4LF7L 2K50A 5E7NA 1VQKA 2KCTA 3S2HH 4BBRG 2JA5H 2ID0A 1PH2A 4DV3L 2ATWA 4NXNL 4EX5A 1XNQL 2PI2E 2E2HH 2E8GA 2VW9A 4A3EG 1XPUA 2KHIA 3LGJA 4R4OA 2UUCQ 4K0KQ 1CSPA 1VS0A 3B6YA 4WJ3M 5C4XG 4JI3L 1VQMA 4HJAA 2E5LQ 4JBKA 3W1GA 3KDFB 1K8AC 1XNRQ 3KDFA 3FHWA 3UE0A 4R4TA 4LUZA 2K5HA 3PUVA 2KBNA 4YWKA 5IP9H 2VQEL 1VQOA 4B3SQ 4A3MH 2UXCQ 5M5WH 1TWAH 3HOXH 5IYDG 4DV5L 4LF8Q 1GVPA 2EIFA 4DR3Q 1ASZA 4JV5L 3F1ZA 5HY6A 2QMUB 5JJIA 2MO0A 5C3EG 3GDEA
chains in the Genus database with same CATH superfamily
2ASLA 5AI6A 2LA6A 3OVSA 3EX7B 1S0OA 1RKIA 4UTGA 4ECQA 3MM8B 1X4HA 5ALVA 1F0XA 1M4VA 4R8UB 1TFYA 3JB9k 1G2SA 3D68A 2KYZA 1CQFA 1D3WA 2UXDL 1JT8A 1S59A 5LSOA 5I42B 1AYEA 3QIPA 2C9OA 1GMUA 4RT3A 5IC4B 2F0KA 2X3DA 2V8PA 3KHLA 2JH3A 1PZJD 2DO0A 1MD2D 2NS1B 2HDLA 2ZUBA 1B8AA 1WTOA 1RTJA 4G7ZC 1OXUA 1J5EQ 3H4DA 4KLQA 2ZIXA 1HMVB 5KTQA 2JE6I 5EE9A 1BPZA 4OCZA 1SROA 2W01A 3TA0A 5KFKA 3LX0A 4I2PA 2OPQA 3R2TA 3A13A 1VDVA 4HMIA 2GO9A 5GVQA 4H4KC 2OXPA 4JOIA 1C0UB 3PJWA 3RU0A 4QWEA 1VLBA 2HNDB 5ALSA 1NKCA 1UVLA 1ZQGA 1T03B 2FZCB 1B3QA 5HNKA 3QE9Y 5IWAJ 3GCXP 3MWYW 1TVXA 5EPKA 3FEYB 3T6JA 1YQHA 1I6HB 2E2JH 3AOCA 4J90A 5M2RA 4J9RA 3PQIA 4P2MA 1FIQA 4P7VA 1M5VC 5C4XB 4X4UA 4OI6A 2B2TC 4YG2A 2B9WA 2GIFA 4DV0L 1SNPA 4IQZA 1KTQA 3KF6B 2RVLA 4ETZA 4RW9A 4MZ9A 3A8IA 4YUDA 5TSSA 1V1PB 3BB5A 5C3EB 3DMJA 1FE4A 2HWIA 3A8IE 2ZT9C 4H4OB 5FLXc 1FDBA 2CJBA 2E1AA 1TWHH 1RWMB 3D66A 5KL1B 1F6TA 1WSVA 3G87A 1WD1A 2CDRB 1HI1A 1P9QC 3EPGA 2CZ9A 3VR5A 2WW8A 3IWXA 1EKSA 1H6KX 2J9DA 1RAIB 1QZGA 1W26A 3MR2A 4DR2F 5J1NA 1T05A 4ODGA 2H4WB 5DDQC 4OZ0A 2J9DE 2RE1A 3BDPA 3I9V9 3H91A 1Y10A 1KHWA 2F8HA 3D6JA 2WONA 5DM6Q 4RQ0A 1H9KA 4Z7YA 4I29A 3CCJA 2KHSA 7ICJA 1TVRA 4DV5Q 1YDLA 5B0DA 1GXDC 3I4HX 4DV3F 5KT6A 1PRTD 2CVEA 8ICJA 3NTUA 2Y0SG 2E9RX 1FTRA 4HIMA 4K4SA 1JKHB 1ZJNA 3QMQA 2YWHA 2UU9L 1T3QA 3M1YA 1C1CB 2DNZA 3C1ZA 1MNEA 5KNCA 7ICVA 2V2VA 2O66A 3FPUB 4AYBC 1EQRA 3T1HQ 3WZ0A 1D9AA 1QE1B 2CQDA 1FXDA 8ICKA 1WTPA 1ZQHA 4BS2A 2ZITA 1HBOB 3Q8DA 4C4SA 5C42A 3HVWA 2AXTU 1K3RA 3D6CA 1WDDA 1ZQYA 3VR2A 4Y2YA 3AYHB 1B3AA 3OUYA 4DR4Q 3X3UA 4L5TA 2W8LA 1EWIA 1MWYA 1Z00A 3KUHA 5ALIA 3MHYA 1OXVA 5ALHA 2BM1A 4GNXB 1CG2A 4KI0A 1MMDA 3HWTA 3B4MA 2F4VF 3LF0A 3CQZB 1NRKA 2JQOA 1RADB 2CJ9A 3F8TA 1KD1T 3R7BB 2D6FC 2JA6H 1I5FA 2Q8IB 2ZHAA 2ZTCA 3PF5A 3H3VH 3RBDA 1FFGB 5GAGI 1BBXC 2FJ2A 2KEEA 2RQ5A 2BVZA 3OFHA 4DSJA 3V2TA 1LVHA 1W2IA 1B70B 2QA2A 1Q82C 2EY5A 1LTRD 4KHPF 1WC3A 3MCNA 9ICMA 1VS3A 2K8BB 2HKEA 5B0GA 4NXNJ 3V05A 2UXBF 4YHHJ 1NM2A 3QLHA 2R93B 1AQ6A 1HUZA 4FZNA 5CRXA 5IWAQ 1DD2A 2VV5A 1TR0A 2UUAL 1R4PB 1CTMA 1SFOH 1S1VA 2WTFA 3LWMA 4XQJA 4EU0A 4DR6F 3KG0A 5KFRA 4NYPA 1KONA 2G09A 1FFWB 5ALMA 1VJWA 5M3MB 4RW4B 4XQ8A 3RFAA 2JH7A 3WK7A 2Y0SE 4X4SA 3K7AB 4ICAA 3DNCA 4IFDG 2GGPA 1SQFA 4RGTA 3RJIA 4O5EA 4CDGA 1L1OA 1DRZA 3HKWA 4XT1B 5LOQA 3J80c 4NM2A 1LFWA 1DARA 3UQ0A 2HLTA 4IUPA 3PO2B 1KVJA 3HOYG 3OPXA 3T5KA 2DCUB 2M2BA 4RUHA 3W9IA 2EH9A 2YNHB 2DNYA 4KRWA 3K59A 4LFBQ 2KH9A 4FNHA 3SQOP 2J6SA 5A2QU 1RT7B 1S1UA 3BDOA 3NY0A 5FIIA 5EGYA 5BOMA 2HIVA 4OX7A 3LVWA 2K06A 2DHHA 3CE8A 5ITHA 4OX8A 5C5MA 3MAQA 3S2HB 3S24A 2B29A 3HVTA 1T9HA 4RPYA 2Z6BA 1T5EA 5E79U 3CCSS 3CC4A 5DDOC 2MGSA 1AEXA 3MPWA 1XNSA 2KJ9A 5M5WB 4RNFA 4NA2A 1ZJMA 1FGBD 1C4AA 7AT1B 2YMMA 1DY3A 3QT8A 3QJLA 2H48B 2HSEB 5C0XH 3T9ZA 4UAZA 2E1RA 8AT1B 3VVTA 4EQNA 4Z6DA 1DJRD 3HKZF 5J2EA 4ECWA 1S1TA 2O5JC 2R7XA 4UAYA 4IUQA 3KLSX 2OEKA 1XIQA 4MKBA 4EO6A 5EJWA 3Q8VA 4NLOA 3WX4A 2EYPA 5EOZA 4P4MA 1LWFB 1PO6A 3GMGA 3ILOA 2CJKA 3MMAB 2ZM6F 3VAIA 3GDXA 4USHA 1FVSA 4IFVA 2JRSA 3AU2A 4K4WA 1VRTB 1PV4A 5KFJA 4OJGA 1UUPA 3W5OA 1TWFH 4CGYB 4AQYJ 1GK8A 1HTLD 4I1TA 3L5KA 2NZOA 3NENA 1VIXA 3I70A 4RQ2A 3MUVP 3SI8A 1JE4A 3CRLC 3NAHA 2PMZE 1VK3A 1VRQC 2BUNA 1YNJC 1UL3A 1PRTB 3D6WA 3QUCA 7ICRA 3T1YJ 5HO4A 7ICMA 1U26A 1TMMA 2ZE2B 5IODA 4F4WA 4PPDA 4RGNA 5TISU 2VZAA 2KKVA 1WD0A 1JJ2A 1WCLA 3VZHA 1K9MT 2ZIWA 2NLWA 3DU6A 1O7LA 3HSZA 3RBXA 2RKIB 4UATA 3J7AV 2VUMB 2SEBD 3RLNA 3A5ZB 4LR8A 3S15H 3G6ES 4U8YA 1SCJB 1SKSA 2GH1A 1PLFA 1YBTA 4ZOHC 4DR7Q 2AZ3A 3WOEA 1IL2A 4YQWA 2I1RA 4JI7J 3ZFVA 5AK5A 1XPUA 4JBCA 1SV5A 1G2TA 2PO4A 1G6BA 4WU3A 2E5LQ 2F1HA 2W1BA 4L72B 3FEXB 4FYVB 1IW7C 1S5ED 4DOZA 2EYFA 2W54A 1AZSA 4KAIA 4DV5L 3HOXH 1HTPA 2Z7JA 1NPRA 2LEAA 3S1QB 1S48A 4A8YA 1YK9A 1Y1WB 3C2MA 4P2SA 1RXVA 4M5DA 4F36A 2HQEA 4RG1A 1Z1BA 7FD1A 2B0GA 3VGTA 3LGHA 5C4HA 1WYDA 4YCWA 4HIOA 4EFAC 3RB6A 2MQLA 4KGZB 1SWVA 3KUEA 4M1KA 4KN7A 2QEJC 4EBEA 3E58A 4CNQA 2A6HC 5ELEA 2XMUA 4CLTA 1SYFA 3AODA 4QZVB 4R4CA 4OHVA 2YTCA 2Q6CA 4DR4L 3JQJA 4BJQA 3RTVA 1UVMA 3TA2A 1U0SA 4R8NA 3NWGA 5HBMA 3E5SA 4PV1C 5AE3A 4DUYQ 1K73T 3I91A 1SUQA 1LT3D 1XJVA 4Z37A 3IFTA 5HVHA 2NR0A 5BR8Q 2VASA 2V69A 2W9CB 1SDFA 4PMWA 4RUAA 1XYIA 2YWWA 1UFKA 3C29A 4OHYA 5GADC 5J8YC 4OJ5A 4Y2RA 1EHWA 1F44A 1TUVA 4LF6Q 3R1HA 4DG1B 3CCES 4Y2VA 2DNLA 5DJBA 3D2QA 4FPRA 2BH8A 2CG8A 3A0BU 5AM5A 2EG1A 3CCZA 2VD3A 1FXLA 1JLEB 1D5XC 4FVCA 1K1SA 1NH7A 1S9FA 1BO0A 5I4DA 2MKIA 1HBNA 3KMQA 4IG0A 1S1WA 2DCLA 2A6OA 3NTHA 2ZEJA 2B2UC 3T1YQ 3CPWR 3HDSA 1PYWD 5ELDA 2ZDOA 5EBDA 3PV8A 4R8IA 3UD3P 1R6VA 2P66A 3PX4A 2TSSA 5IT0A 4ILRA 5F3XB 4EBCA 2OQKA 3WBZA 5F3TA 2NZ4A 1U1KA 2HK3A 5CZXA 4OJOA 1LKYB 3PR5B 2D9OA 2HNZB 5KT2A 4I2IA 2DGUA 4LFBL 4DPXA 3OGUA 4CM0A 5IT9c 4KSEB 1TAQA 4C8ZA 5HANA 4JI5J 1R3NA 4KHVA 4NXNF 3MPDA 1IXKA 3CHBD 1TL1A 3P49B 4XA5A 2E1EA 1JE5A 4YHHF 2H51B 4PHPA 2QTWA 4G57A 2UVRA 1C20A 4OZNA 2R7UA 2J76E 4I2CA 4TUSA 3CDAA 5AXKA 1GUOA 3K7UC 1VQ7A 4UAIA 1SWWA 5ETTA 4A3MB 2TMPA 4AL5A 4CJ2C 3LDAA 3RN2A 1CI3M 5D15A 4IFDH 1U47A 5BN4A 4DPTA 1UVIA 3PXGa 1N32Q 4AL7A 4UOHA 5B0CA 1JMTA 5EQ0A 2MZRA 1D9FA 1YJNA 1L8OA 1OO9B 2DNOA 2F65A 2YH1A 3EE3A 3OHBA 3ZTSA 1G1XA 3QJYA 3S1NH 3P5BP 2LYBA 2XWXA 4N9TA 2B51A 3GG0A 3KBXA 2CQIA 1CJTB 3GFHA 3DGPB 5IIFA 1R6YA 1UWBA 1GJXA 1EUJA 2W7OA 3CPWA 1IBLJ 5MLCV 2DISA 2R7WA 1F9RA 2WOMB 1JUDA 2CQ4A 3TMEA 5KNDA 1KWMA 2OPRA 4UW9A 4QL5A 2QLFB 4WYWA 2NTSA 3VALA 4ICLA 4ANCA 3W3SA 2XYPB 4DQPA 5GAHI 5J0SA 3NOCA 1CS4B 4JK1C 1V6HA 3FVQA 1BHNA 4EQOA 4CJ0B 3GO5A 1EIGA 2IHMA 5IGDA 3I28A 1KDCA 1LWEA 3S17B 4P2CB 4YY3Q 2RHFA 2V4JB 1V5VA 3RR8A 2R92H 2VICA 4EZ6A 1Y9OA 5F8HA 4A4JA 4KGMA 3JSYA 1K3BC 4U7CA 2R4FA 5L39A 1VQFA 5ALQA 3VYTA 2H3EB 4MTKA 3DLGA 2EOTA 1K0VA 2AQ1B 3KKAC 4LR9A 4MN3A 1RAOA 1RL2A 2JZ5A 3NGKA 4A8FA 4XTCS 2G0JA 3J7AN 2EI5A 4WF9Q 3Q2TC 4AQYF 2BRLA 2F4FA 1HUOA 4XRHA 4NXMQ 4A3DB 2BV3A 1EX8A 1S9GB 2DGZA 4RZRA 1CULB 3H7IA 1N5TA 2HLUA 2DNGA 1L0WA 1P1TA 1WC5A 4N47A 3PNIA 4LWCA 4J9LA 3HGBA 2LBOA 1ZAXA 1ZEQX 2QF7A 3AJDA 5DLGA 1PTOC 1G4CA 2YX1A 3VC8A 3K5NA 1FX4A 4C3KA 4P52A 2B3GA 5GAEC 2JL9A 5HMMA 3PCOB 1NSKL 2FJ6A 1V3SA 5M2UA 1C48A 3NBIA 3DM3A 4QWBA 3GTGH 3H20A 5MAOA 4I2DA 3QUQA 2HZAA 1X4BA 2GAHC 1R89A 3I82A 1XMOJ 4KR0B 2A1AA 3M2VA 3M05A 3M9NB 4I2JA 2ZJPA 2KL8A 2AP6A 5AIAA 1I4QA 5HGTA 5B5EU 4JI7F 4NZ6A 3C5GA 2LVWA 4K4VA 3I32A 1PJ5A 4DFAA 4X6AH 9ICTA 3AXKA 2E8NA 1VQNA 1SVDA 3DOLB 2B56A 5C4JH 1L8LA 1GUWA 1S76D 4UUXA 2LKYA 4G1QA 3M4YA 2NV3A 4DAYB 1KQQA 4Y2AA 4M5LA 5JJKA 1VQBA 2RB7A 5A8RA 1E2ZA 3T5LA 1W7WA 4MF2A 1OYDA 1Z47A 3R3TA 3CMES 3CT9A 3J81E 2NBFA 3BKFA 2MGZA 3MI7X 1YKWA 1U1OA 4URSA 1BPBA 2FPHX 1YJUA 4PPZA 4ENOA 3R5DA 4X3UA 4ZKBB 2H3VA 4EI2A 4ABNA 2UUBQ 2BGWA 4V1Ak 2AJFE 5DRKA 1UWVA 1GUGA 1L3VA 1PAUB 1EQQA 1ZTWA 4DL2A 3HP6A 2YB4A 1FO1A 4PQUA 1TK0A 4CO0A 2JJ4D 2QKQA 1KR4A 4TNOA 3ETMA 2XTJP 3PKMA 1SH2A 1UE5A 3A3OB 3A3NB 1K9MC 1T7PA 2PI2A 1WEYA 1TL5A 3E0EA 2UVWA 3HRZC 5E4XA 2DY9A 3I4NB 2KCTA 3HHLD 2KN4A 1PH2A 1RWNB 3MR7A 4G6VB 2PI2E 3M6KA 2YWEA 2Z8QA 1CSPA 1U8SA 2QA4G 2EC0A 4JI3L 1VQMA 2K8AA 1OPIA 3KDFB 2CQ1A 2QLJB 3DDKA 3TP5A 1QTNB 2IRUA 1HFGA 2QL5B 3DYAB 4USIA 3SFGA 2JHEA 8ATCB 5ISRA 2V2ZA 4R65A 1TQOA 2DHAA 1JICA 1HQUB 3F1ZA 8ICTA 3B0XA 4J1MA 4QIFA 1D09B 3CO0P 1STHA 1N5QA 4XQQA 5AJ3L 2IAJB 3HJFA 4OYOA 4P0PB 5ALYA 4C48A 2I5HA 3OT9A 2XNRA 1PYTA 5AXNA 1DOQA 4ZH4A 1PH8A 3CD6A 3DGVA 4OELB 5C3WA 4IPHA 3IO1A 3QB3A 4PYAA 3SQGA 1FRKA 4LJMA 2WAQC 1SL0A 1DONA 3D1HA 3LP0B 1RWKB 4OJ3A 1O03A 2XCPA 2ZIVA 2BKOA 1VR6A 5K14B 2JV3A 1M5HA 4K2XA 2NVTH 3CDBA 1B4FA 2E2IB 1S7HA 2PFPA 1T9XA 4L73A 3ZXWA 2F0VA 1X4AA 3M1VA 5ALTA 2JSOA 1XMOQ 5DBAA 5J29A 4LRCA 4V19X 2UP1A 1IVZA 2KHDA 5KFNA 3KOJA 1S79A 1SQEA 3GIKA 5B0EA 4Z9CB 1F5AA 4ZQ3A 3WQPA 2F40A 2XLKA 4JI5F 3PVXA 4J9QA 2K03A 1E6YA 1G51A 1NY4A 3BKTA 1JNRB 1UEBA 2UUAJ 2N3LA 2NO4A 3IP4B 1L3KA 2FPLA 3FBFA 4DL5A 2ZJ8A 1SC4B 3D5MA 4HACA 4PWUA 4K4IA 3JPNA 2DY1A 4NCGA 3AB4B 4CNYA 1PYOB 4LRBA 2NXNA 4USVA 2QA4A 4KY6A 5J0PA 4QZ8A 3TAQA 1N5VA 2G06A 2BCQA 3M2RA 1RTOA 4CJ1B 2LMIA 1WG1A 3LTOA 1OXTA 4CT8A 4YY3L 3T1AA 5D0GA 2ZH6A 1WI6A 2RS8A 1UEVA 4OZ2A 5AT1B 1PH7A 1NMEB 3ONQA 1L3TA 2A73B 2NREA 2XB2D 1ZKOA 3K2YA 5K9FA 1F5BA 1IUJA 4O2DA 3RF9A 2JNJA 3BPSP 2RDFA 5DNFA 3LANA 1SMYD 1FD8A 4Q7AA 3S1MB 4C8MA 4NXML 1V5IB 4XIUA 4UB8U 4DV1J 4J15A 1IBLF 1BQMA 4RJVA 2L9DA 4EMDA 1JXEA 9ATCB 3SEOA 1KBRA 2HMIB 3NOGA 3I3CA 5AI0A 4BXOB 2NSCA 4N41A 4F4YA 3CDWA 2ZTDA 3L9ZA 1FHTA 2VQEQ 1C4QA 4IRKA 4O42A 5B0AA 1RYRA 2D9PA 4US8A 1UJ6A 3QRPA 1F2HA 1WOSA 3K1RB 3CC7S 3ENWA 2NUUG 5E3FA 3SXHA 1NJWA 2OHDA 1HNWQ 4I2QA 3CCUA 4RPXA 3I90A 4RKUC 1JJCB 3QT7A 2KM8C 2KSOB 5J1EA 3JAME 1U1NA 3MPYA 5L8RC 5LHY1 3ULLA 3D1QA 3FM9A 3IRBA 2HIQA 2BMBA 3OL9A 2ERRA 3H3VC 4F72A 1F2GA 1U0HB 3KLEB 1U1QA 2QDBA 1HWKA 5SUHA 2DH8A 1HHSA 1YGYA 1CHPD 4R63A 1UAPA 1FJGJ 4P2HA 3C16A 3HHLB 2D2CC 3TZDA 3E3XA 2L48A 4M5GA 5G5HA 3ZZZA 2XS2A 1SPBP 3NGTA 3SDEA 2WP8J 3P75A 4PZ8A 1NI3A 1JWUD 3F5EA 2GQQA 3FCHA 4O23A 5IYDH 3OJSA 1YJWS 2HPUA 3JTOA 5J2QB 2FD2A 5LMUQ 4J03A 3LGNA 1SXDA 1STNA 4RQ1A 1TKZA 4KJIA 2KEDA 4JI1J 1XC9A 3DLKB 1UCNA 1XMOF 1X9XA 4NLCA 1M90C 1UZHA 3MM6B 1SGGA 1PJ7A 2XMMA 1YJ9S 3LH2S 2FMPA 3O0FA 1M1KT 4P6QA 2DKOB 3PY8A 3LP2A 3HT0A 2PN6A 2DPIA 2YU9H 4QW8A 3P20A 5DBCA 4PEOA 3OD2A 4JI2J 2BA0A 1PFNA 2JA8G 4D3HA 1EYCA 5CBEE 2HHHJ 4TQSA 4DAMA 4CRXA 4QZHA 4X65J 4C1NI 5D14A 3Q8LA 3KJNB 3J7YW 5GAEU 4XDXA 3OR2A 2FTRA 3CEDA 3QWPA 4OV6A 1ZQTA 2M0GB 2VC1A 4BY1B 3LPYA 4MFBA 4NLRA 1HYSB 1BQNA 2PYKA 3NS1A 2HBZB 1YG0A 2AEFA 3S1TA 2KFNA 4Q44A 4JOIC 4G3IA 1Y8NB 4H02A 4A75A 2PMWA 4IQUA 4AYBD 4A93H 4NLSA 5KL8B 5T7LA 1KKHA 5IGEA 4MKAA 4KO0A 4DV1Q 5AK3A 5FJ4A 1OYEA 1S4EA 4JI8L 2R42A 4NI2B 1B9MA 5D0EA 2LI6A 2ICIA 5CHCB 2LY7A 3EGNA 4BWMA 3A7AB 7ICKA 1Q86C 3GIIA 1QAYA 1JALA 2L1BA 3W8GA 2EZVA 2V8DA 1ZS6A 4OX6A 1HR0J 2NVXB 1BR9A 2GVDB 2BQUA 4UAWA 1R4QB 5HMYA 2UU9F 2CIMA 1WWVA 1KBUA 1YRXA 4LJXA 1SNOA 4TY8A 5J0UA 2MMYA 5I2YA 3CWJA 4IH7A 3OSPA 1OXXK 1KTVA 1G6PA 3KLGA 3KLIA 4L6TB 1BPDA 2NZCA 5LXRA 4BXXH 5FK9C 3ZZTA 5IXUA 1LW2A 3FNNA 1VQLA 1NBEB 2MZQA 2KCNA 5G5GA 2IMWP 4EYIB 3RR5A 1O08A 5HROB 4M8LA 3GJQB 1PTOF 4DR5J 1ZD3A 2YB1A 4WE1A 4L76A 2AT1B 3QSIA 2BW2A 3AJ2A 4FXWA 4ULLA 3H98A 1R27B 4LF9L 3WK5A 1YJVA 8ICZA 4WP8A 1TTHB 4BBSG 1X9SA 1YJ7A 1VF7A 2I07B 2KA7A 3P96A 5EWGA 5IQQA 2Q43A 4B3RQ 1XNRJ 3FEWX 4ME3A 3WHIA 4J9NA 3IFDA 1H0HB 4C3LA 4DZ6A 1KEJA 4ANEA 3QGHA 2XSJA 3GTQB 3QUTA 2JDJA 2QLBB 1OWXA 3PG9A 4CZCA 2AUKA 4G7OC 5E7NA 3M6WA 2R8HA 2OD4A 2B9YA 2E8GA 2UUAF 1JWSD 4M9NA 3MTJA 2W2NP 1B4SA 3F2UA 3GYXB 4F3OA 3Q8QB 1FF2A 2ABYA 1VQ6S 1L7MA 4YWKA 1BNZA 2VQEL 3QXGA 3NE5B 4RWSC 3CCJS 2XGPA 3L4BC 1UEAB 2AQ3B 4S0MA 4PXBA 1LV5A 4NKLA 1RWPB 1QH9A 2LM1A 5HMXA 1NNLA 4YP3A 3IMQJ 1YITS 2MQHA 1HUNA 4GOPA 1LV9A 4QCLA 3P8BB 4F8RA 2MJUA 3OLAA 5J2IA 5E5NA 1KLNA 1XWLA 2WKCA 2GQCA 4X66J 3KD3A 3BS5A 4DSIA 3KWMA 3GJSB 4DS5A 4XXEA 2OTLA 2Y0SC 5E1FA 1BNOA 2KEYA 1B64A 3ADAC 4DV1F 1X4FA 2EYMA 2FHKA 3DDIA 3PIOA 3UD4P 5IGCA 3MFHA 2FVQA 3PIO3 3G8TA 4LBPA 4JW0A 4CYUA 4K4XA 4ZVUB 2YY3A 3OL8A 1L1OC 1BQQT 3H94A 3N4WA 1VQEA 1UHUA 2NRZA 3BGUA 4Z6CA 3STBD 2X1BA 4RBTA 1ET6A 1I3QB 5LMUL 2CRLA 2YNGB 2NRWA 1RCVD 4CDIA 1LWCB 1S6OA 4E6IA 1S72A 1VDHA 3FC4A 4FO6A 4AYBB 3MAAB 1LTTD 2A18A 4QZFA 3HS0C 1HD0A 3MFIA 3GTPH 5KG5A 3PX6A 2VG7B 2NVYB 4Y34A 4OIKA 1TAMA 3DN9A 2G08A 2K1RB 3TJ8A 3M8SA 4ED3A 1FDDA 1X5TA 4M63A 1BBWA 4A3BG 1Z4NA 1VQAA 1FJGF 4M1UB 5KFTA 1LUZA 3O6QA 3MEEA 4HCSA 4KKOB 5A0YA 3QAEA 2AWZA 2YKAA 4WIQA 3QNMA 1JLFA 2N3OA 2VQFL 4MYTA 2KP7A 1ESRA 1IW7D 2LDYA 3TR5A 3V81B 4JV5J 4TKOB 1YI2S 2V4DA 2R3VA 4QWCA 2W9BB 3PUYA 1S77D 4Y7NH 1YWXA 3C15A 2ZDPA 3IG1B 1FKOB 1VQ8A 4FP5D 2QB0B 4V0BA 4OHWA 5A8WA 2C3UA 2JA7B 1LTBD 2SXLA 2W4CA 4JI1F 2DO4A 4Y2TA 1WUDA 3MAHA 4CH7A 1S5ZA 3RJFA 2ZH5A 4YDXA 3L2PA 4RFBA 4DR3L 2PMZC 2CQOA 1LXNA 3V7JA 2B2YA 2A6HD 1ZQXA 4XT3B 5GTIU 2BACA 3SMZA 1SC1B 2DY8A 1OSDA 3CJKA 3QYYA 4TU9A 8ICOA 4BA1I 1RUSA 2VB3X 3FSXA 3BSNA 9ICGA 2D7SA 4JI2F 4DL4A 2Y1LB 3QUBA 2CZ4A 1N5YB 1MN9A 1RWVB 2HHHF 3C5FA 4UHVA 3GP7A 1FFUA 4X65F 2R6GA 3W1BA 3LA0A 4X4QA 3J7ZC 4J37A 2FC8A 3KK1B 4DR1L 2BCRA 3T41A 2JLGA 2NXCA 5U47A 1NTGA 5C24B 5J22A 4H4MB 2AJ0A 4X66Q 2VFRA 3KFWX 4F71A 2G13A 1LTLA 2L9HA 1KNAA 1F3FA 2XMTA 4WK3A 1N9WA 1RG6A 4HIDA 2O4XA 1N34Q 5CV7A 2Z2ZA 3H6MA 3WKCA 4CTAB 3DCAA 1NJXA 1X3GA 4IURA 5CYMA 3K0YA 4HSPA 1SB6A 4NMXA 5IY0A 3CCRS 2D3O1 4ECVA 4DF4A 1S0VA 4OL8A 2K32A 1QD1A 3DDNA 1AB8A 5ETLA 4G1IA 2HGLA 1HR0F 1TS2A 4OZ1A 3QT5A 3HZGA 3EWGA 2QYCA 4KN7C 1ZQUA 3E9IA 4B3RL 4JI3J 1IBKQ 1GMWD 4C2MA 2H9ZA 4IQMA 4D3GA 3ZZYA 1VRUA 4LJZC 1EQ0A 1NHUA 1BY9A 3TANA 2KICA 2JC0A 3JSMA 2IT1A 3MXNA 2A19A 2K5VA 5AJ3J 3KJOA 1LTGD 4F93B 1M8AA 3CNQP 1KRTA 1T8EA 1I4GA 2A69C 2F0HA 5M5YB 4QZBA 2R8GA 2WB4A 2K7JA 2R3ZA 1BE4A 5LL6X 1CFMA 4DR5F 3Q8KA 1ENCA 2FDNA 2MUTB 1S6PB 1NDCA 4KY3A 2KHVA 2NN6G 1L2FA 1SIZA 4JV5Q 4Y2SA 1FNUA 3PW4A 2KKHA 4QZCA 4XYOA 5ALKA 4NLYA 3C6TA 2W04A 5CXTA 2M2LA 4ZK7M 5CHGA 5I3UB 4RPZA 1BCPF 1DOKA 4BBSH 4K5XA 3CF5A 3AJ1A 1MQ3A 2IOFK 3SR6A 1XNRF 4LIRA 3W60A 4X64J 4RW7A 1KXLA 2HYIB 4KLEA 3QQCD 1AUSL 2J0WA 3EGWB 2AW0A 3AD7C 5KFEA 3C1YA 1Q90A 3BZDB 3M9OB 4PXCA 2HQIA 4C3IB 2ZZTA 3H0GB 1A3VA 3T19A 2CFMA 3BGFA 4YXMA 3IRXB 4USAA 1Z1VA 3BSCA 4MF8A 4CF3A 2V1CC 3M8PB 1RLCL 1ZQ1C 3MTKA 1IXRA 2F0WA 3MM7B 3QIDA 3ZZPA 1TVAA 1S5FD 5KT4A 3CCTA 3DWQA 5K8PA 1NHKL 5KT3A 2EFNA 4NLUA 2W11A 9ICXA 9ICRA 1SJHD 2L5TA 8ICIA 1QSLA 1WKKA 2BE9B 3RJHA 4B9LA 7ICFA 1GHKA 4DU9A 1HARA 3HILA 4QU6A 4DXLA 2MRLA 1O5JA 4X66F 2OPPB 1BOSA 4YN3B 3W8PA 3BREA 4B3MQ 4PZOA 2QO3A 4LSNA 2EAPA 1N33Q 4BA2I 2NYHA 4MFFA 1CRXA 3R3OA 2GVZA 1JLBA 4IC9A 2DXFA 2E7XA 4JI6Q 3OPOA 3IWLA 4GVLA 3AN1A 1U1LA 3V72A 3EWAA 3JQMA 1CSJA 3NRBA 3GTOB 4K7QA 3MEFA 1HQEB 2RD5C 3A3PB 2EK1A 2W4PA 4EVOA 1WHXA 4BGDA 2BJ3A 2IJ0A 2F0LA 2P5ZX 2ID0A 4C7YA 1XNQL 5KFGA 1IKYB 1Y11A 4C11A 2X3GA 2NRVA 5IIJA 3I1YA 5C4XG 3BPDA 3GU0A 2DR6A 3NGSA 2V4QA 4JOUA 1JLGA 1CM9A 4C0HA 1XO0A 4O44A 2LQJA 4B3SQ 4TQRA 2WBRA 3QEBZ 3KJVA 3UVJA 3KZXA 1FX2A 1PBUA 3QFWA 5C3EG 5CAAA 2OD6A 1HBUB 4IG3A 4OLOA 3VR4A 2NB0A 5H2FU 2B0CA 3CPFA 3BS9A 1T94A 4DBQA 5DETA 3CC2A 4M9HA 2LEPA 4F5NA 2OQ0A 5KFVA 3NWRA 2RA4A 3SV3A 4A3BH 2EPIA 3GFXA 2C35B 1RT5B 3ILLA 5A0LA 2E7WA 4Y65A 4W90B 3I56S 1G3OA 4A3GG 4ME5A 4DOCA 2FIUA 4YD2A 4JV5F 4ZJLA 4PMBA 4KX3A 3MFGA 1FTCA 4DV6L 4HMJA 4HJ8A 4NOHA 2ZD1B 2NVQB 3CJ0A 3F41A 1S49A 2CJQA 2OH2A 1KHVA 1X9WA 1II3A 2J0TD 3E51A 2F3JA 2H1EA 2UVVA 5GROA 3D9BA 3D6FB 4USUA 4F25A 4PZVA 1ZH5A 1RQNA 4EGVA 8ICCA 4C2MH 4OIXA 5E3PA 2QKIC 2ZVIA 2D74B 3Q6SA 1VQ9S 2VODA 4Z6EA 1C0UA 1GUTA 2W2PP 4ECSA 4MKVA 4K5WA 1NDLA 4MK7A 2HNDA 4DPYA 2AJ2A 1HWLA 5HQ8A 1T03A 4C56C 2GOLA 1UT5A 2VPZB 1F1BB 1FJEB 2PIIA 1IYJB 2ZBPA 5DDMA 1OY8A 2EFPA 2GMLA 5AKYA 1TKTB 5DB9A 2R2RA 1U6BA 3GQCA 1VBZA 1IBKL 2BE2B 3ONAB 1FL0A 3O1LA 4LW1A 1K28A 3Q0AA 4F3MA 1V1PA 3LWEA 1YZ6A 3GFYA 2GN5A 2FJXA 1SNMA 3SCLE 4H4OA 3PMNA 2PFNA 3TSSA 4RW6A 4LFCQ 4CLYA 1J97A 2RRNA 4J9PA 3CCMS 3C46A 4JI8J 1HPZA 1KFSA 4Y2CA 2KJVA 4HYKA 3QR8A 3HG9A 2H3IA 2V9WA 4B6JA 2PDAA 1VQKS 1WC1A 1ESFA 1W6JA 1S8OA 4GKJQ 2GZOA 1ZOLA 3KK2B 3QO9B 1DYQA 1ILQA 1EFID 2AIRB 1TU2B 3M32A 2UXCL 1ZQEA 3TP2A 1T9YA 1WF2A 4B9VA 2QCPX 4KGKA 1VQOS 4DSKA 2E9TA 3ITHA 5EAYA 1JJHA 2WAQD 4NL5A 1CQVA 5KEEA 3OIQA 2H4OA 1C1CA 4JI3F 1S6UA 3NLCA 1UA0A 5GAEI 3TACB 3I2ZA 1C0TA 5K8OA 4USTA 4I27A 5ELFA 2G9OA 1XQIA 1LO5D 4N8FA 4OWWB 5KAKA 3VQSA 4ZUIA 1NAQA 2A1BA 4DJBA 3K5PA 2F0NA 5AJ3F 5L9NA 5CGKA 3PO2G 1VQ5S 3HX0A 1XO1A 1H9JA 3W2DA 2KJWA 2HNYB 1VC0A 2WIIB 1YJRA 4DHVA 9ICSA 3RAMA 4HHHA 3W2VB 1R8PA 2J0SD 3A8EA 4Y6IA 2LSSA 3H5XA 2N88A 2JH1A 2BCVA 2HHQA 1YBUA 1ZRNA 4LF9J 3E01A 1Q81C 2NN6H 3C1EA 1TL7A 1YZ7A 1HH2P 2YPYA 3A8JA 1WEXA 1ZXIA 4WYLA 1G91A 9ICLA 1X31C 3A8JE 3N7PD 3FQKA 3KF8B 2HHVA 3T4AC 3TREA 4KLFA 3SR1A 4ACOA 1XS9D 4X64F 3RZAA 4X62J 2WVDA 3IR7B 4LSLA 1KOHA 4CNZA 3M8WA 4PUOB 2IBOA 4M9GA 4LUOA 4I64A 1PH5A 2EEYA 4C0BA 1SMXA 4QIWB 2F03A 2F8MA 3OXFA 4DU7A 3U9SA 1N5SA 4RQ3A 1BGXT 3MZ5A 1FXRA 2ZKUA 3N79A 3LWLA 1N36Q 2HEKA 2ZHBA 2Z57B 3DRSB 3GWCA 2ZVSA 2J7WA 1RLDA 4QIVA 2PFFB 3R93A 2G4BA 2E7VA 1Y5IB 4ED8A 4CWBA 5H1SE 5C25B 3AY0A 2A6EC 4C3MA 3VQTA 3K8WA 2JEBI 3S16H 1IWGA 2VG6B 4PG8A 1X54A 3KNAA 1KDAA 3DRYA 1KL9A 4ZDNA 2HAIA 3MEGA 4QPXA 4DK0A 4N8NA 4B3SL 4Q43A 3SSRA 4KT0C 4LF4J 3TI0A 4UQTA 1N2XA 4DV7J 1U1RA 1NJIT 3ETRA 9ICHA 5NUCA 2YNHA 2F7VA 3NEKA 2F52A 1HFEL 1VQ4S 1JROA 4OI1A 4PWWA 1S5CD 4CDCC 3M9MB 3Q8YA 5HI7A 1N8RT 1N56A 3I4PA 2KXNB 3FMCA 1X8DA 2IYIA 5C0YA 2VS1A 1TMJA 2WFWA 4UBCA 1R0BG 1S7IA 1ZA2B 5J3BA 5IFMA 1RHRB 2RS2A 4F7XA 5CP2A 2ILZA 4ZVQB 1CJKA 2DBYA 3MCSA 2GJFA 5ALJA 4Y2JA 1UJ5A 5C5JA 2XI3A 3N52A 4UY8T 1SZHA 3M4QA 1PG5B 2J4XA 4RU2A 3PJXA 1DTQA 2VPXB 1BNPA 4HTIA 2OUGA 1B0VA 3MBYA 3BEGB 3HOUG 2OHFA 4KN4A 1IIPA 3PW7A 1QTMA 2RQKA 3C1FA 1U1PA 3WK8A 3R27A 1VDZA 2R8KA 3IAS9 2IX1A 2HWHA 4DV2L 4GIBA 3MR6A 4PZNA 3WIUA 3ETLA 4FF4A 1SNCA 1CJVB 4PGYA 2Z0SA 1N0UA 1G7CB 5RUBA 1PH6A 4NCAA 2ISPA 1M5KC 4A3IG 4K4TA 4IOCA 2VF3A 1ZYRC 3J81c 3IAM9 2F0PA 1J5OA 5T1IA 2FJDB 2VQFJ 5H9EK 2E1MC 2MQNA 1D1UA 2GIQA 2ES2A 4O3NA 1Z1ZA 1R0AA 2O1PA 4A3GH 3AA8A 2ZE2A 2P8IA 3CIZA 4LMZA 1KDHA 4YVZA 1XN9A 1R31A 3NVVA 1JX4A 5GMEA 2XQCA 3P7JA 5GTHU 2FJVA 2G5IB 2E2JB 2QFIA 2RKIA 5G0RB 2C2KB 4PABA 2LYVA 4DR3J 4H7BA 2L9NA 1S99A 1BXTA 1XTCD 1IKMA 3BGLA 3ZC4A 2EKYA 3NXZA 4DO9A 1HHTP 1VLOA 1EY4A 3U1LA 3PRVA 1TY2A 2OMOA 3TOQA 3UE0A 2VG5B 1NEEA 2VOOA 4LVOP 1PK1A 1TWHB 5IT9E 2ZJPQ 1GVPA 4ZN1A 2EPBA 2WK4A 1RAFB 3TUJC 3GDEA 5BN3A 2I6XA 4PCQA 3DHQA 1J2MA 1U4MA 4FNIA 4DR1J 1RHJB 5LMNW 3DKDA 1B3TA 3Q2SC 2Z8LA 2AF6A 3WC2A 2XMAA 5ELCA 1X55A 3CQZH 3TJAA 4NB3A 2KYXA 4X4TA 1TY0A 2Z9HA 2EVBA 2V34A 2PA8D 2F1MA 4N77A 5C6AA 1REVA 1TV6A 2XIWA 4JI8F 4OONA 3KLRA 4B9SA 2WB1F 2QIFA 1SR3A 2K3KA 1O6XA 4CI0B 6FDRA 3CUNA 2YNFB 2OEHA 3H3VI 5EE3A 4JI4J 2ZBQA 1F9QA 4DUZJ 1ENFA 2HGNA 4UT4A 1K83H 1VQDA 2BKPA 2DTJA 2OPSB 5HN0A 1RA6A 2NWGA 2PZUA 4DCJB 3DOMA 2HIXA 1S1XB 2GJ2A 4Y00A 2ESEA 3QAUA 2KCCA 1P7DA 1RI7A 1EP4A 1B0TA 4EEYA 1Q3LA 4A46A 2PNHA 1FT8A 5JMNA 3AD9C 2Q79A 1WF1A 3HSDA 1IBMJ 4A3MG 4JG2A 4RMFA 2M8DB 1MWQA 2PA3A 2V94A 3RR7A 4B3TQ 5LMNQ 5A8KA 2EJMA 4MNOA 2JA6B 4FYWB 2AU0A 2PEBA 4GKKQ 1JLQB 4K2KA 3NG8A 3LALA 2C2RA 2DKXA 2FMCA 5FOBB 2H54B 1PH4A 2B4VA 1KQFB 3W61A 1SEBD 2L0CA 4ED0A 2VOPA 5KOWA 1Z2ZA 2IM1A 3D8GA 3FUYA 4LF1A 5C7PA 5KAIU 3J81U 4BHQA 2J9EA 2L41A 4LF9F 1N6QB 4DA2A 4FXKC 4RQNA 2RRDA 2QARA 1OUQA 4HSVA 2JZBB 3IS9A 4LF7Q 3A5UA 4FS1A 2BA1A 5LJ3Y 1DLOA 3H5UA 3PF4A 4K0KL 2UUCL 3NBHA 4PXEA 1SFOB 1NDKA 4X62F 2P9CA 3VHQA 1KC8T 3K5OA 1CC7A 5C44G 3HSJA 2DQNB 1T3NA 4CDDC 3UCZP 5J8YA 2AQ4A 2V2QA 5D3GA 1I94Q 3UO0A 1ZOTA 1Y8OB 5C0XI 2P6UA 2OFGX 1DZ5A 1HNIA 3S1RH 4A8XA 4UW2A 3GE9A 3QIPB 2I0XA 1KEKA 4GS3A 2Y0SD 2Z2LA 4ALPA 2QX0A 1Z3EB 2WSFC 4MIBA 3I55S 3HJEA 3PGZA 3NVYA 3VGSA 2HVHA 1RTJB 3QT6A 2K01A 2ZOGA 1SAPA 2ZIXB 1RTIA 3IDWA 1E3PA 2H4YB 3NEMA 2FFKB 2YTXA 4F26A 1D0EA 1Y8PB 1AT1B 1UW9A 3JYTB 4JI0Q 1ZD4A 3BS1A 1HEKA 2XICA 3BYPA 2WSEC 1RQLA 4WPAA 4I2PB 5B7WA 4LF4F 3DLJA 4DV7F 3W9HA 1PXUA 2IM0A 4YIJA 2K7VA 5KFXA 2EFQA 3D6HB 4QBUA 2DXDA 3R6GB 2Q66A 2NSBA 5KG1A 3ISBA 1B0PA 1J27A 2JN4A 1V3RA 1F9HA 4JI4Q 3K4GA 3DGPA 2IM3A 1RGVA 4CLUA 2R18A 5IOCA 1BD6A 2ZH7A 3MXUA 4J9VA 1RU2A 1VQIA 4YB5A 3X1LB 4ZK9B 4EQPA 5KFDA 2FYXA 2G2OA 4YFUA 9ICPA 1X9NA 1GX6A 3BQ0A 1HNZJ 4BY7B 4Y2IA 4P74A 3P5TL 1MLAA 2FJAB 4IALA 3FZBA 5AXMA 3PW2A 4QIWF 1CS4A 1RAHB 3BZQA 3KNGA 5A76A 3DMJB 1XNQJ 3D0HE 4GOPC 1UEKA 2YKMA 3ZZOA 4M6WB 3PX0A 4J9SA 3OL6A 1TWFB 3HOZG 4WWSA 1ZQWA 3E6ZX 1XR6A 1KQKA 3V96A 4P9SA 2XEXA 1GD7A 2RILA 4QIGA 3HOUH 2RSQA 2EQYA 5E2QA 4JB3A 2DBBA 1K0SA 3NS5A 1KTKA 4YS2A 4JV2A 4DX5A 3UDLA 7ICIA 5J2FA 4HCEA 3MVVA 1T05B 2HFOA 1QDUB 2K33A 2V67A 2E5HA 1A62A 1Q7LB 3O8WA 1QILA 4YDDB 3RAXA 2PMZD 2L12A 2WONB 5AM3A 4KFBA 5KG2A 3S2DH 1S9GA 1TVRB 1CULA 2HQ3A 2C3OA 1TKXA 1JXLA 2BA9A 4A3IH 2I5LX 3S15B 3DRPB 5IOLA 2VQFF 1SNDA 2WINB 3HHEA 3OWEB 1E1TA 4NPOA 4YWLA 1AW7A 1NJIC 2KV2A 2LXJA 1FRLA 3UPFA 4EBDA 2QN6B 4DV6J 4R1JA 4EGLA 4KMUC 3TAMB 2XM3A 1Q8KA 4DU8A 4HEA9 1HNXQ 2XVTA 2XLJA 4KBIA 5C42B 2QLXA 4FZLA 2RSNA 4JK1A 1RT1A 3I4NG 1NZPA 1N8RC 5JU5A 2K5DA 1VBXA 3HOXB 1DURA 4DR3F 3OTQA 3OUYB 2F0FA 4M04A 1URJA 4J5OA 2FZGB 1Z00B 3L7ZC 4DV4J 1FYCA 1HNVB 3G71S 1H3DA 4OJPA 5T1GA 1UFLA 3CCQS 2HSZA 2GWSA 1NSPA 5BYQA 4JC0A 2N1RA 4HEDA 4JMUA 3PIPA 4CKCA 3S01A 1WC0A 4URGA 4GVBA 3PIP3 3TW0A 3KKAA 3UXNA 1VLYA 3JAMU 2IW3A 2XLIA 4IPGA 4DR1F 1UVNA 2JJQA 3FAHA 3PSPA 3GV7B 1OW5A 1ZQAA 2JVOA 4ZVFA 4B9UA 2BDNA 2K75A 3RNUA 5DBBA 3A8KA 4ID8A 5LMNL 2DEIA 2B2YC 1S0NA 4KPYA 1VQPA 1EB0A 1FD2A 2H5IB 3QLHB 3D2NA 4GXJA 4J6HA 4AXJA 1S1VB 4R4QA 1APSA 4LBHA 1WELA 4IR1A 2Y0SB 4DL3A 2XMVA 2QMXA 4F88A 2IMOA 4DUZF 1HZCA 4P0QA 2HOQA 2BOSA 2UXCJ 3FK4A 1RAEB 4CLFA 2GGPB 3L4PA 4F4ZA 4QGUA 4QY7A 2CNOB 4LF7L 3M6XA 3R8BA 4TUPA 5J1ZA 4I0WA 2ATWA 5DEHA 9ICAA 1RPLA 4R4OA 4DGZA 5J0XA 4WJ3M 3W5ZA 4KQZA 2C3MA 3DWAA 1AFIA 2DGOA 1IBMF 3KDFA 4DQIA 3URYA 4ES3A 1O7YA 4F5QA 1S1UB 4A3MH 4YCXA 1KW4A 2E8OA 4ECRA 3HVTB 2XS7A 1RACB 1LT4D 1FKAF 3AHPA 1I94L 4N56A 4O4RA 2NRXA 4DFPA 2ZTEA 1SE3A 2IAJA 2ZZMA 2KG5A 4FDBA 4P0PA 4RCNA 2WVEA 2B6AA 2DD8S 2HCIA 4RKBA 3U26A 4A48A 4F02A 3C3LA 1CA6A 4F3QA 4I6WA 4RHSA 1PYSB 2OTJA 1AXQA 3FRZA 3RZDH 3LP0A 3ED5A 1HHVA 2MTLA 2PGCA 3PYGA 5AE2A 3OQ2A 3VAGA 1S1TB 4JI0L 3G9CA 5DS7A 1MSHA 3NBPB 3S7RA 2HHPA 1FRMA 2ZKTA 4EZ9A 5F2DA 3GG1A 4J7CA 4K8IA 4OI2A 1Q0NA 3NMAA 1PCAA 1Q95G 2EE1A 2YY6A 2W24A 3OMCA 4IFVB 4NEZA 1SYBA 1VGYA 5K8NA 2RBMA 2P6TA 2VONA 3CCLA 2VKZG 8RUCA 5DB6A 4P2XA 4MKYA 3DLHA 8ICAA 2DH9A 2PMZB 2BXJA 3B6BA 3MA2B 4DK3C 3S17H 1UP1A 2NXJA 3KBBA 3UMCA 4KLDA 1Q8LA 5C44H 3FKBA 4LFAL 1TAUA 1IKLA 2ZXIA 2AWOA 4IO9A 3FMBA 4DI6A 1P27B 3P45B 3RG6A 4J9UE 1NUEA 2MDAA 1D7QA 3V6KA 4JYAQ 4BUGA 4MTNA 2Y1IA 2A5HA 2WV6D 1IR2A 2VFUA 1NJYA 2XHWA 3V2UC 4PWDB 4ITSA 4OYIA 2ZIWB 4O0IA 1RE1B 2OEJA 4IPDA 4TU8A 1HA6A 1QCBD 2CRXA 2IIHA 2B5JB 2ZH4A 2GAGC 3K7RA 1UPMB 4K50A 2VBZA 1COKA 4OX9L 3S14H 4KTAA 1GT8A 5AM1A 1MKHA 1Q7YT 1SV5B 3SBMA 4O3SA 1TXYA 3JAML 2XZWA 4RNOA 1UE1A 3M8QA 1AZSB 3VF0B 2G5HB 4JP8A 3NMRA 4RX6A 5I6WA 4CO3A 2R92B 4K2LA 1TFWA 2IA6A 1MJEA 3EDRB 4UOCA 1LT5D 1HNZF 3S8SA 1F5SA 3U4ZA 4PQXA 1D9DA 1CT1D 2RIJA 4M5DB 3BDLA 2MO1A 1T4GA 2YWKA 2VB6A 1XNQF 4KHMA 3MEDB 4TYAA 2L55A 1HNXL 3PIOQ 3B78A 2D5DA 3CNHA 2WF6A 4B9WA 4PH5A 3HOZH 4W4MA 1C0AA 3BN4A 1N4LA 1WJJA 3ETOA 1WSRA 3TAPA 1WTHA 4NM1A 2KSOA 4DV2J 3IBWA 1LTID 1UE6A 3K81C 4RQMA 4M95A 4ZCLA 3BQ2A 2E5IA 3IN5A 4OHZA 3HMJG 5JVH3 4K5RA 3D31A 1BF4A 2FGCA 1H95A 5LT5A 4U7UK 3KLEA 3VAMA 1T9WA 5HBMB 1PTOH 3IG5A 4NLNA 3D3BJ 3ET6B 2R7OA 2B63G 3FBBA 3NWSA 3IHQB 2KIVA 3AEVA 1KLMA 3GTGB 4KK7A 2CWPA 3D2SA 5IZHA 1FERA 4A3KG 1GXTA 1WI8A 2ZBIA 4A8WA 3AD8C 3N6LA 4DV6F 4HT5A 2LS01 1C2PA 2H3FA 4DNIA 5J2QA 1B7FA 5DDPC 1DHMA 2MYFA 3PACA 5C4JB 7ICLA 3TKAA 1ZD2P 3I4NH 1U4RA 1OPZA 2Q1LA 4I68A 3FC9A 5J2HA 1HBNB 3G4SA 4IG0B 3T6BA 4DV4F 1S1WB 2R7FA 5EE1A 2HURA 2KDOA 4LF5J 4ZOSA 3MM6A 2WKDA 3QYPA 3ZDAA 9ICJA 4DR2Q 5CABA 1PZNA 1ZA1B 4CLPA 3EBEA 1X56A 1DQ8A 2ZNZA 4GLVB 4ZVHA 4PG4A 4C4WA 4A76A 1SBRA 3HP3A 1ZETA 2F76X 2CA9A 2OFHX 1PDQA 3EZUA 1P1LA 3I4OA 4AUKA 2EYHA 3DV9A 4DV3Q 2DNRA 2H5EA 3TVZA 2IHNA 3H0LB 4C80A 3ISNC 2JXMB 2F0DA 5D6GA 1A2UA 2CZVC 3J81Y 1R8HA 3F53A 3CYMA 2OO4A 4MK8A 4EELA 2B9EA 1U49A 5LL6S 3AU7A 1F9PA 2MHEA 2KFYA 1SB3C 1Y4ZB 2GIRA 1SV4A 2HHSA 2K5QA 4IUVA 4AIMA 2XS5A 3I0RA 1T95A 2DNHA 5JEAJ 2DVIA 2IYGA 4KV6A 4EUVA 1PH9A 2VL6A 5B08A 3KTQA 1L0YB 3I5BA 3ICLA 1D8ZA 3GIMA 2G1HA 3KLVA 1FRHA 2FLOA 2UXCF 5IC6B 2F4VQ 4RW8A 3TWZA 2V50A 2ROPA 5IGBA 1UEUA 2OELA 2XCAA 4ZKAA 2HFZA 5B0FA 2CAJA 2EDUA 2PQAA 5DG9A 2BQRA 3KLFA 2WF5A 2MQPA 1JRPA 3RRHA 2VHGA 1A0IA 4NWIA 2F0GA 2MU2A 5J0RA 4IUTA 2A2CA 3GZ7A 1AE2A 1HW8A 2MZJA 4LIWA 1UWBB 3P4UB 4KHPQ 3SAHA 3BSOA 1XMQJ 2KXFA 3L7PA 2UXBQ 1U2RA 2LYHA 1KHIA 3JTPA 2NVTB 4HTJA 2F9DA 2YKPA 4OHXA 5HROA 2OPRB 1QCKA 4Q5VA 4ID5B 3SZ2A 4IQXA 2JR5A 1QVCA 4DR6Q 1S12A 1GMVA 3PRBA 4TLRA 4AP9A 4CHTB 5D4NA 5COYA 4RLEA 3CCWA 1SBBB 1Q16B 4IFYA 2HFUA 3N4MB 2JYOA 1Y7PA 1DRGA 4M2YA 3KG4A 1LWEB 4CH0S 4A8SA 1BVSA 2C2DA 4LAAA 4K0KJ 2KU7A 2UUCJ 1DOLA 2A6ED 4I7FB 3OW2A 5BXIA 2CQ0A 4RCOA 2FJWA 1P9YA 5LM7E 4LRFA 4RR5A 3RUZA 3I5AA 2VPWB 1RTHA 3FFIA 2VB2X 1ECWA 1NSAA 3DLGB 4LF8J 4DAPA 1JLAA 2KTQA 2D3OR 2BBEA 2NO5A 4RNMA 4KLHA 3R5JB 1NPPA 1TQLA 4DCOB 3CF5Q 4EX5A 2MKKA 5LJ5Y 1FK9B 3FSIA 2ZXOA 2I5JA 3NKYA 5AKEA 4ATNA 3RJGA 1VYAA 2K5HA 4BWGB 1N60A 5THWA 1CEZA 3I8ZA 1JXVA 4WFBQ 1PSDA 4GRSA 4KGXB 2AX0A 1ASZA 1RAGB 4B9TA 3MCMA 5AK6A 1MA7A 1NOMA 1YVFA 1U9LA 2K7KA 4OYWA 2ZG6A 2DL0A 4JBWA 4C1NK 3RAQA 1DOMA 4KJNA 3HRDD 3MF5A 4O4GA 1S10A 2VUGA 1RJTA 3M2VB 4RQ5A 3V7LA 5EDWA 2C2MB 1NSQA 3SSSA 1LFPA 2ZM6Q 1ZZNA 1RF2D 3ZI4A 5KG6A 2QC3A 9ICBA 3R9LA 4FXVA 2FI1A 1EKRA 1COOA 2JA7G 1IKVA 3HFZB 1CA5A 4ZS6A 3K1ZA 1WTFA 4DOBA 2ZH2A 1NCLA 4U96A 3CRXA 1NUCA 1ZQQA 2ZXHA 4WU2A 1BC6A 2MY8A 5GAGC 4F5PA 3CJTA 2H3QA 4RH6A 1NB2A 3BBBA 3LVVA 1HFNA 2DXEA 3K80C 1ZYRD 2DGYA 3DOKA 1GNKA 1IN0A 2MGZB 3PUWA 3NGDA 2KHCA 2ACYA 3JSBA 5HVFA 1F9FA 8ICHA 5SZTA 2IHFA 3CJQA 2X7IA 1STGA 3MAAA 1OXJA 2LA4A 4EEKA 3JAMY 1EL0A 4WCEQ 3BZKA 5HHIA 4DV2F 4PR6A 4IUFA 1FNVA 1FWPA 2Y9TA 4KMOB 1FJCA 2F0IA 3TRZA 3MOJB 3H2VE 4PQUB 2YQEA 3EVQA 3BH6B 3RRKA 4CGZA 3X3MA 1CKMA 3BQ1A 3FRYA 3MGHA 1D8YA 2BKNA 4M9JA 1RP5A 3R8YA 4DX6A 4KX5A 2XHCA 1H38A 2B63H 3TZUA 3DRRA 1JMSA 2ASJA 5IM0B 2AQ2B 3D4DA 4YB7A 1YHQS 2N4CA 2F0SA 2IX0A 3QX7A 4DOAA 3A1YG 1HIYA 4A3KH 4KN4C 1A9NB 5K4LA 1LYLA 1MMNA 5ALWA 2IHR1 1LACA 1SXLA 1Q7YC 2QV6A 2LCWA 3K58A 1UVJA 3IG1A 2QB0A 2B2WA 2CJXB 2YU9B 2J7ZA 3DRXA 3KLHB 1WC4A 4OO1I 9RUBA 4U95A 5FLXU 5ELOA 2ZUAA 3O5TB 3UN2A 4ED6A 4QR2A 2LXKA 4F5OA 1WCNA 4A3JG 3OR1B 1DCZA 2A1JA 4LF5F 2IC3A 3CCSA 2F77X 3ZYYX 1UPPA 3SQGB 5AFWA 2H1YA 3D54A 1RTZA 1PRTC 3EVWA 5I9PA 4QYRA 1HI0P 2WFAA 3HPOA 2KO1A 4Q2MA 1EAYC 1Q46A 3FDSA 3TQ1A 4WJ3B 3K5LA 2F4VL 2E8MA 3PHTA 1AROP 1AFPA 3VR3A 2ZIVB 3FKIG 1ZQPA 2VXWA 5IP7G 2VIXA 5ALPA 4TLQA 5J2KA 4A93B 3WWVA 4DK6C 4A4IA 4C3HH 3TFRA 4G7HC 1Y5NB 2J0QD 2YN4A 3HK2A 1J5EL 1WOOA 5H9EJ 1M1GA 3TYTA 2VBYA 3UDIA 5C24A 2YNIB 1N61A 1EQMA 2RDGA 1E6YB 2LEBA 5J1PA 1CSQA 4KHPL 3PNCA 4PZ7A 3RZOB 2XBPA 2HQDA 3ONNA 2UXBL 1OQ6A 5DZ6A 1H74A 5F8MA 2AH5A 1B22A 2O5IC 4HACB 1IBCB 3ZDEA 3R2IA 2ICEC 4NCGB 3AXMA 2DHGA 2R2UA 4BDPA 1PYBA 3I4MG 1K8GA 2FQQB 5KFYA 1D6EC 3H0GG 3PO5A 2OLWA 3M2RB 2CH4W 4ZA1A 4X4NA 2G0AA 2MSSA 5HSPA 1R43A 2SDFA 1SRUA 3TVYA 1K47A 2KENA 1BKBA 3KUGA 4L5RC 2BHNA 3G6XA 2MPMA 3PO3G 4Q8EA 1SI9A 5ALFA 3TX8A 4QUCA 1U48A 2Y8YA 2EY1A 4MIAA 5HL7Q 4UAUA 2PNRC 1BQMB 1XMQF 4NXNQ 4U7UD 4YHHQ 1UVKA 3PSFA 4YB6A 2I9GA 1WG8A 1A76A 3HOVG 2IPKD 1IKWA 4OO1J 5G3LD 2BE7D 3ULHA 4NXZA 4LZDA 5HP1A 4DL0C 4KLJA 2MUTA 3CKIB 1S6PA 4I56A 3C6UA 2DGQA 3GTYX 4I6YA 3KK3A 2EC2A 4ILLA 4OZLA 2V2KA 1RD9D 5AE1A 2CPRA 1S9EA 3VCDA 1Y3KA 3O3LA 2CJYB 4M47A 1DGJA 1TV9A 4K0KF 2UUCF 3PEHA 4KLKA 3CJ4A 5FDLB 4ZVRB 1D2BA 4EK2A 3T1HL 4ZP8A 3J80U 1NXIA 4ZLJA 4PZ6A 3VAJA 4LF8F 2AGPA 2PW7A 2RDJA 3VR6A 3CSKA 4WXOA 4A3LG 3V4IA 3DHWC 2DT9A 1WCMG 1S3OA 3LAMA 1ASYA 3GTLH 3KG1A 4A3FG 1JIHA 3WK9A 1QJOA 1W3SA 3C16B 1DFDA 1WDTA 2AYEA 3SDEB 3L95X 1WWHA 5L1IA 2DJGC 2ZC3A 3A56A 5M5XH 1JLCB 4E8UA 2MKCA 4U9RA 2F3VA 5FLXL 3FPPA 1FEZA 1U2CA 3WIVA 4IUNA 2ZH3A 3M8ZA 3IC1A 2QRRA 1KRPA 1TKZB 2MAXA 3IRUA 5A2QL 1TUGB 3SCKE 3ALRA 3CCEA 3C8YA 4PXDA 4F4AA 3M9BA 3OTOJ 4OX9J 1DBDA 2AD9A 3DLBA 3TZXA 5H9FK 4NLWA 3MM5A 4K4HA 3N9UC 4F67A 2HCCA 3N0VA 2WB1G 4ERDA 2OPPA 3TZZA 1PVQA 4I6AA 3LP2B 2R9LA 4QOTA 3ZTQA 2ASBA 3MGIA 4AQYQ 2DB1A 8ICNA 2ZOFA 5IWAL 4BWJA 1LTAD 3MMCB 1M5PC 3RMHA 5AM4A 1JCKB 4WJBA 2XYHB 3QRRA 1SE2A 2RUGA 5E3QA 1OMSA 4ZVPB 4FBUA 3GTKH 4FKYA 1OQ3A 3C66A 2RLTA 3R5GA 5HMZA 1AN8A 3GTPB 2VANA 2RJZA 4MFBB 5D4PA 3EVMA 5J2GA 2E2HH 2BPGA 4J9KA 1RABB 5A6PA 4O1NA 1VS0A 4CDEC 4ELUA 1ZQJA 5L38A 2A74C 4K6LA 4H44C 5BJRA 3PHEA 3PUVA 4B9XA 3IFEA 1MC8A 1SNQA 3CJ2A 2U1AA 2JFKA 4NWBA 4JI7Q 3BN7A 1JB3A 3TX0A 4Y7NB 1A77A 2DY7A 4F91B 2W9MA 2KT2A 2HDOA 3UDXA 2BANA 5GAGU 3KUPA 4FP9A 3UDVA 2YV5A 1RT5A 2EANA 1VCIA 3BU2A 4NLKA 1EOTA 2MY7A 2DR8A 2M00A 3FVYA 1PK3A 1FRIA 1EY7A 3J81j 1QJHA 1S97A 2YWFA 3KLIB 2OI2A 4IOCQ 4IR9A 3DM2A 5BOLA 3H59A 1X0FA 1LW2B 3IA0A 2WB1E 2L5YA 5EUHA 2BCUA 2OP5A 1Y00A 2ZUGA 2VL1A 3HOYH 4ZKCB 4KLTA 4OI4A 2AGOA 3E0JA 2Z1CA 4IOAA 4A3JH 1PH3A 4WE1B 1DXSA 2B4UA 4OZJA 3H0RB 3LK9A 3AM9A 2ES6A 2DNEA 2JSXA 3LP1A 1J6QA 4N7TA 1HBMB 1KD1C 3OTCA 4A8QA 4C8LA 3OIPA 4A3EB 2ALZA 1CQNA 1D8BA 3RJEA 2B7CB 3U27A 3J80L 3OFGA 4X5VA 3FKIH 1QAXA 5IP7H 5ALLA 5CYUA 3A74A 4U67Q 3ICEA 4UY85 1Q8BA 2DRBA 4P72A 4NEYA 3DFEA 2VY3A 4AT1B 1PIEA 2XSJB 2H5JB 4RQ4A 1YSJA 4FF3A 1WORA 4XQNA 4M5HA 1Y5LB 2KRBA 3GJTB 1XTDA 1GXUA 1H7XA 1MROA 5KG7A 1KLUD 1NU4A 1UETA 1NK6A 1E1OA 2BQ3A 4YHHL 1D5ZC 4WFN3 5KFAA 4DR7L 2HWTA 2O5DA 1C8CA 4ES1A 3JPSA 4R0EA 3VV2B 4RPFA 2A3JA 1ZM2A 4C0OC 1CVJA 2KCMA 5HQMA 2E5LL 4L3KA 4ELTA 1TWGH 1UA1A 3I4MH 3QGIA 5J2JA 2UXDJ 4O9MA 1X4DA 3QO9A 2CQHA 3KKFA 2RNEA 1QSSA 4B3OA 2IVYA 3DHXA 4DL7A 3K8AA 3BO3A 1CQMA 2RF4A 2MPUA 2JA5B 4UAVA 9ICOA 1O51A 3PO3H 2Z6KA 1E24A 4DMZA 3CMAS 4OD0A 3BF4A 5K5MA 3GV3A 2F5GA 3M8YA 3NS6A 5IT9U 4FN5A 4JI5Q 3K17A 2GNKA 2MJNA 1NZBA 2K05A 4NA3A 2H5XA 2V63A 1J8IA 1HI8A 2GVBA 2D3ZA 4BBSB 2E44A 3Q8RB 4CYUB 4MK9A 2CDQA 3HOVH 3QOJA 3W2VA 1TUWA 2K2PA 5JTIA 4ZVGA 3KMSA 2HOFA 5DG7A 2IY5B 1DK3A 4KH1B 4LQ9A 4DUYL 5KNBA 2FPKA 2RP5A 2LPEA 1U5KA 2G0IA 3GTJB 5H1SV 4F5RA 4Z6FA 1CKNA 2E1FA 2F4IA 3GIRA 5BR8L 4A3CG 3CULA 3CMEA 3U58A 2WVBA 4DV0J 4N9PA 1FO4A 3DWPA 1RDFA 4NLBA 2AX1A 3ZNJ1 3WKEA 1NR2A 2XMWA 4HHJA 5J0OA 3KF8A 1TL4A 2DHXA 7ICEA 3BJUA 2L11A 4O3PA 4ZLNA 4FF1A 3HHDA 2ZJQA 1QUVA 4LF6L 3CRKC 3QOLA 1PRTF 5EWFA 5D0HA 4PUOA 2WZ1A 1SKRA 5D0RA 3L3FX 4NV0A 5EKIA 5ETVA 5D3IB 1A6SA 5KYLA 4A3LH 4K59A 4LFAF 4AQYL 2Q6BA 3SMVA 1VI7A 1WCMH 3CP0A 1EZ8A 4A3FH 1LWXA 3MEEB 5A0YB 5JRTA 1IBLQ 5AKZA 1K8OA 4W92B 2JEJA 3EYZA 1JLFB 2DH7A 4QIWE 3IRWP 3HKZD 4PNYA 4KLGA 3T1YL 4UZBA 3OTBA 2YXLA 2LMRA 3M3YB 3DI6A 4JV1A 3RJMB 1A0PA 5D3DA 3C15B 3N5BA 2I0QA 1R9TH 5DDRC 5A8WB 4U68A 1C1BB 4RL1A 2B2VA 2K6AA 2VG6A 2UU9J 2OCEA 4DCPB 4KYZA 2KT5A 3OTOF 1SLJA 4OX9F 5HLFB 1Q5VA 4OYZA 3OHAA 9ICIA 1MSGA 1RHMB 1BPYA 3NRWA 2UZAA 3JC66 3VZIA 4JI7L 3CJKB 2BE5C 3M7NA 3H5SA 4YMOA 4Y0FA 3D4WA 2XG8A 2EAMA 2F8LA 4DLGA 4QZAA 2KI2A 1K0TA 1RZTA 2DGTA 2KECA 5FLXY 1PZID 2AZ1A 2W7PA 4L63B 1E7ZA 1FRXA 3V6DB 2HD3A 4X4VA 4J9OA 1P6TA 3T79A 4O0NA 1VQYA 3H4BA 3EQLC 2PEHA 3KJPA 2NQPA 1PVPA 5AKXA 5A2QY 3SAGA 4ZMMA 1TIID 1STYA 2HGMA 1Q4RA 1KFTA 2UVUA 4QYZK 2YX8A 3NHHA 5JJLA 1QVGR 2ZWPA 1N32L 2NTTA 3CXCR 2RAQA 4NW2A 4LREA 3R2DJ 5GADU 3H7HB 1HD1A 4A3BB 5J0TA 2MA1A 4LF2A 4C8OA 3JPRA 2PSZA 2XGTA 2R7ZB 1SKUB 3NTKA 1NAPA 1KLGD 3OFEA 3W65A 4BC9A 4NCBA 9ICFA 1IM4A 4LVNP 2X69A 2IFXA 2I6WA 1K73C 3S6EA 2JK8A 3WOFA 3BVZA 2ZH1A 2HVDA 2KG1A 2WBMA 3NCPA 5EHHA 4IQVA 2H3ZA 2IDLA 3N6MA 2PFOA 4JWMA 2RF2A 4QR0A 2DIVA 4LRAA 2HW3A 4C2MB 4OV1A 5CV8A 4K8RA 3UPQA 1UPHA 5IT9L 2DYAA 1TWCB 1I6JA 2FVSA 1VRUB 1F9EB 2QLWA 1B4OA 1RODA 2RSOA 1IKXA 4ECZA 3Q8UA 3HKSA 5I4MA 2X1FA 4OI0A 1RCOB 3JSMB 2D1CA 2LP4A 2EJFC 3MXNB 4DKAC 3ISND 1H9MA 1RHQB 1ZPVA 5C4ZA 1UW4A 2R7TA 2E5JA 2DNMA 2XWBB 5K20B 1F3VA 4X3TA 3PR4A 1CBKA 2HFVA 3MECA 3HD2A 4OGQC 2DGVA 3EVOA 3B6YA 3LGMA 2XY6A 5KFCA 5AI5A 2DNQA 2MHNA 2L4NA 3T16A 2JP1A 1YLXA 3ICXA 2X51A 5F9NA 3C6TB 3T51B 5K8MA 1BXNA 4K4YA 4C8KA 4U6PA 4ZHRA 4IL6U 3LAKA 4ER8A 1QVGA 2YKQA 1I50H 2CKZB 3UXPA 3HO1A 1VBYA 2UU9Q 2IL8A 1OXSC 3PIPQ 1J5EJ 1HWIA 2I46A 5KFWA 1ED1A 1Q1BA 3IM1A 3AMZA 1STAA 2K4IA 3RB0A 5JAVA 4I2AA 2YKNA 4IO1A 2IDEA 3BR9A 4IDKA 3CO9A 3FSYA 4ECUA 2C2NA 2IOHA 3MEKA 1EY6A 2XSFA 2HZCA 2W3RA 5FO8B 3SD7A 2MZSA 5ALNA 3HKZB 3P3DA 4ALZA 5DQIA 5A6WA 3J80Y 4NYOA 1TS4A 4UASA 3ULJA 2Q8TA 3TNVA 1PHJA 1QNKA 2Z4IA 4KH0B 2O3DA 1O8BA 4MH8A 3W66A 2NPFA 1JWMD 3HD1A 2C42A 2UXDF 2W2QP 2HBYB 5CBAE 1TKDA 3QU7A 5KNIA 2G9DA 1YJWA 2PZTA 3PMFA 2VBXA 2BR0A 3TP7A 2AJ4A 3C23A 3A55A 3EFXD 4F2SA 4DL6A 3ISZA 3RW7A 4ZIWA 1LW0A 3V6HA 4I69A 1UNSA 3BS7A 1GTHA 4B9NA 4ZITA 5F0WA 1D8LA 3QEAZ 2MXYA 1DQ9A 1I4RA 3I0SA 3SIPB 4ANDA 2E3TA 5ALUA 1YJ9A 2PMHA 2KG0A 4LSNB 2XWYA 2UUBL 3NVZA 1BCPC 2GVZB 2ZIUA 1IBLL 3LUYA 4ZJQA 2UUAQ 1A6LA 5AICA 4LZGA 4FXDA 2F9JA 1EIYB 1NKBA 3W5XA 5J0WA 5CB1A 2R61A 5C0XG 1FNOA 1SV0C 3N97B 4F92B 2OF1A 4DV5J 1N6QA 1DZ1A 2BJ7A 2CHBD 3F2BA 3Q22A 1FCAA 3AOBA 4DV0F 5E3AA 5CWRA 4A3CH 2PW5A 3SAFA 4O44B 4P73A 4NLQA 2ZJAA 4RUCA 4BY7G 1WG4A 5J0QA 2M9KA 4C8YA 3T1HJ 3KJVB 3UVJB 1RXWA 2ZWOA 3VVUA 1S5DD 2FE9A 3MXGA 4ZVSB 4OJLA 4IG3B 3AU6A 3E2EA 4NRTA 4OL7A 1Y1VG 4NZ0A 3C14A 1X3PA 3A7LA 4IRCA 3MC1A 3S16B 4DR4J 3UCUP 1JJ4A 3BGOP 3LOUA 2DR9A 1RT3B 3VDYA 3QBCA 1A0OB 3U1NA 2D0OA 2OEMA 2LKVA 3ZD8A 4ECTA 5AIBA 3AQQA 2K14A 2B21A 4OJ6A 4IO9Q 1E22A 1HA1A 4MTPA 3JYTA 5EGTA 9ICNA 1MN8A 4NL9A 1WHVA 1CJUA 2FMMA 1PJ6A 1KKXA 4FZMA 1XMOL 4UP7A 1GM5A 3TO8A 2GHVC 4MYUA 3NK9A 3SQIA 3DEPA 1EYDA 2K3IA 2BABA 4ZP6A 1RHUB 4KLUA 1A15A 2GMJA 3AQFA 4C3JB 4F0MA 3HOXG 1RT4B 4LUVA 4ZLTF 1A2TA 3MABA 4HTHA 4PAAA 4C8NA 1FJGQ 2VFTA 3G6JB 4EYHB 3D0GE 5J2PA 3F44A 3HOWG 4CF4A 3HVAA 3M6UA 1STBA 4KHRA 2CQAA 4DFMA 1HA5A 3GILA 5DLQE 4OYPA 1SJ3P 5L1JA 1URRA 4M6WA 1F5CA 4NLZA 4QQBX 4RW6B 2B4PA 2K52A 4DPUA 2GFFA 4JI1Q 3ISCA 1HPZB