3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
1Q12A 4GS3A 4IJHA 1WYDA 5M3MG 1PH4A 4JI8Q 1GKHA 4BXXG 4JYAL 1OXSC 4QY7A 1YJNA 3J80i 4POFA 2CCZA 1MJEA 4YWMA 1YHQA 1NMGA 3CC4A 1X3FA 4YCVA 1VCIA 3FKIG 2VQEL 2DUDA 4JI2L 4GN4B 2Q2UA 3GTPH 3J7A5 4A3LG 4A3BH 3S1NH 4GN5A 4GN3B 1X65A 5LMUL 2YTVA 1PH7A 4DV1Q 1B7YB 1HNWQ 2UXDQ 1YEZA 3W1BA 4L5QA 4IFDG 4DK3C 5JJKA 1EUJA 3F2CA 3TQYA 4KHZA 5GROA 4QGUA 4HJ7A 1IBLQ 2NN6G 2VUMH 2JJQA 3RNUA 3H3VI 2AMCB 5M5WH 3PUXA 1K8AC 3D31A 4A93H 1W3SA 1VQ7A 4A3CG 1QZGA 1NMFA 3MEFA 4DUZQ 4UY8C 1N33L 1G6PA 1M90C 1SN8A 3I56A 4AH6A 1VQCA 1PH5A 4LFCQ 1HZAA 1LM0A 1YNXA 3K0XA 2N3SA 3T1HQ 1V1QA 4Y52H 1A8VA 4PZ7A 3W1GA 4IPDA 1YBYA 4P71A 3STBD 3CCEA 1YITA 2IT1A 3H15A 2YYZA 4LF8L 3GTQH 1CKMA 1E22A 3I4NH 2R92G 1YZ6A 1G51A 1VQIA 1X9NA 3PO2G 4TQUS 1VQLA 1SRUA 2PQAA 1VQ4A 2R6GA 3S16H 2LXJA 1X3EA 5IP9G 2ZM6L 3L7ZC 3CPWA 2Q2IA 2Z6KC 2VZAA 3BZCA 4YHHQ 3F2BA 2UUCL 3S14H 1P16A 2YU9H 4GLAC 1AH9A 2JA6G 4QJFA 1SFOH 1I94Q 1YZ7A 2CWAA 2WAQE 3B6YA 4X66L 4DV2Q 1Q7YC 5FLMH 1IZ6A 1C7YA 4UP9A 4Y7NH 4L5SA 1HZBA 1KIXA 2ZTDA 2FXQA 3PUVA 4DV5Q 4MZ9A 1KHIA 2ZTEA 3AQQA 1HJPA 1PYSB 1J5EL 4GKJL 1WI5A 4UP8A 5GADC 3H0GG 4IJLA 1K9MC 2MO0A 2K14A 3HOVG 1X6OA 2PI2E 4NXNL 2ZJQA 3KF6B 2K5HA 4LF5L 2KBNA 4IPGA 1Y1WG 3GTMH 1SR3A 3KJOA 4B3TQ 2NVYH 5LMNW 3M4QA 3CCMA 2KCMA 5ELOA 4JI1Q 4X65L 1PH3A 4MTNA 2MQHA 5IYDG 2E2IH 2JA5H 4LNQA 1PH6A 2BH2A 1IBKL 2JE6I 4OX9Q 2D62A 4DR3L 4OO1I 4X62L 2ID0A 3L0OA 3I4MG 1CSQA 1Q82C 2RF4A 3HOXG 4JI3Q 4JI6Q 4NXMQ 4BBSH 4B3RL 1Q46A 1YHAA 2RHSB 3UDGA 1R9TH 3UDXA 3PO3H 2E5LQ 3EBEA 3EN2A 4LF7Q 4JI8L 1OXVA 3BJUA 3LGJA 1NE3A 1MKHA 1VQDA 1VQ8A 4UP7A 1VQFA 4BA2I 4KI0A 1JB7A 5IP7H 1Z47A 3STBC 4GNXA 4TVAB 1HNWL 4DV1L 4LUZA 2UXDL 1FVIA 2VS1A 1S3OA 4P74A 3CP0A 2HHHQ 2VUMG 2R7ZH 2GN5A 3E9HA 1HR0W 1IBLL 2CKZB 1KRSA 4DAMA 4A93G 2IHEA 3ULLA 3A74A 2KHIA 1D8LA 4DV4Q 3BU2A 4DUZL 2JEAI 3J81c 1JMCA 1MIUA 2K50A 2AWNA 3U50C 5IWAQ 1SLJA 2KENA 3HKSA 3S2DH 4LFCL 2JA8H 2A8VA 1N32Q 3DLLA 2QGQA 3T1HL 1IBMQ 2BA0A 3I4NG 1L2FA 5HY6A 3DM3A 1YHBA 2EIFA 3JAMc 2B3GA 4A75A 3GTLH 4DR7L 3H3VH 4HJ9A 3GTGH 4P75A 4R4IA 2EXDA 4PZ6A 4GOPB 3PF5A 5IT9c 1M1KC 2KHJA 5M3FH 4KLKA 2HT1A 2ZJPA 3KDFA 1YJWA 3PUWA 4YHHL 1YI2A 3PIPA 4IPCA 1OTCA 2OTLA 4HIDA 5FLMG 1GO3E 5C0XG 1I94L 4O0AA 3K7AH 4DV2L 3CMEA 1N36Q 2OTJA 3S15H 4LF6Q 5EAYA 2XTIA 1Y1VH 1SROA 2VL6A 3ER0A 4AYBG 2ATWA 3K7UC 4LUVA 3CCSA 4DV5L 2QMUB 3J81j 4P73A 2E2JH 4DV6Q 3T1YQ 3GTOH 4DR1Q 1QZHA 4B3SQ 4DUYQ 3F8TA 1QUQA 4C3HH 4A3KH 1PH9A 1AE3A 1A63A 4C3JH 4BY7H 1VQHA 3D0FA 5GAEC 3VDYA 2F4VQ 1DGSA 4WJ3M 4PG3A 4FDBA 2Y0SG 3NENA 1PHJA 3RZDH 1TXYA 4HJ8A 2ZTCA 1BBUA 1Q1EA 1GVPA 1XNRQ 3ICEA 2VNUD 2AHOB 3CAMA 4B3TL 1EIFA 1A0IA 2UU9Q 5GQOA 1B8AA 4JI1L 5IY0A 3HOYH 3ULJA 4A3FH 2LXKA 1JJGA 2KCTA 5C0XJ 2PNHA 2H5XA 3J7ZC 3J80c 4OX9L 4HIMA 3HOUG 1WFQA 3ERSX 4BBSG 4L5RC 1XMOL 4NXML 4JI3L 3PO3G 4JI6L 1K8GA 4A3DH 1GD7A 5C44G 1E1OA 2E5LL 3I7FA 4A3CH 3QSYB 1UE5A 4LF7L 3S1MH 4WJ4A 4GKKL 4GOPC 4A3EG 3M4OH 3HKZG 3CXCA 3CC2A 1KXLA 1VQGA 1CKNA 1X54A 3UE0A 5IP7G 3I55A 1I6HH 1K3RA 3RLNA 1KD1C 1PA6A 1JJ2A 1IL2A 1LTLA 2XGTA 1NJIC 4BBRH 4HJAA 2R7ZG 3RN2A 1WCMH 2CFMA 2HHHL 2Z6KA 1FGUA 4JI4Q 2HQLA 1IXRA 4RG1A 1L0WA 3ULPA 4A3IH 3HOWH 5C4XH 4BY1G 1VQAA 2CQOA 1Q86C 3G4SA 3PF4A 2GVAA 2OQKA 2BH8A 4MNOA 4DV4L 1E1TA 4JI0Q 1VQOA 5IWAL 2JA8G 4BXXH 4AQYQ 1N32L 1JE5A 1EFWA 3CPFA 2N8NA 3UE1A 1IBML 4JCVE 1D7QA 4A3LH 4AYBE 1KRTA 3S2HH 5GAHC 1TWHH 1L1OB 1RL2A 5M3FG 5JEAG 3HOZH 1EQRA 5FJ8G 1X3GA 3I2ZA 5IYBG 2D0PA 1HZ9A 4JI5Q 1VQ6A 3PCOB 1HNZQ 3KDFB 3EIVA 3K8AA 1HZCA 2K5NA 3K81C 4YY3Q 1VQEA 1BKBA 3CF5A 2QA4A 3U4VA 1N36L 1Y1VG 4A3BG 4LF6L 1XJVA 4BA1I 4OWWB 1XNQQ 1QVGA 1TWGH 4DR5Q 5AJ3Q 3TS2A 4DKAC 1O7IA 2OQ0A 5FLXc 2NVXH 4DV6L 3T1YL 4JV5Q 3RR5A 4DR1L 4B3SL 3CCVA 1N8RC 3KOJA 2PI2A 2R92H 5HGQA 2D0OA 1YIJA 2F4VL 3L2PA 1IYJB 3NBHB 3WWVA 4A4IA 3M85A 2UUBQ 5JEAJ 1V43A 4IFDI 2Z0SA 3CCJA 1UE6A 3GO5A 5IP9H 1C9OA 2VQFQ 4JBMA 1XNRL 2NN6I 4APVA 1JJCB 2BA1A 3CCRA 4LF4Q 4NB3A 5JJLA 4DR2Q 4X66Q 1E3PA 3HKZE 2UU9L 4A3FG 2UUAQ 4DR6Q 1XTDA 3KJPA 4C2MH 1CSPA 4EQ5A 1E7ZA 4QL5A 3OTOQ 4ME3A 2I5MX 2IX1A 3E9IA 5J3BA 3M7NA 2A19A 4R1JA 2IY5B 2WB1G 3AFPA 4IPHA 1VQBA 4DR4Q 3CMAA 5LMNQ 2I5LX 1HNXQ 2UXBQ 2PQAB 1Y14B 3GTJH 4A3JH 3S24A 1A62A 1PV4A 3TEHB 3RLFA 1PFSA 5DLQE 2HIXA 1LYLA 3HFZB 1L1OC 3KF6A 4YWLA 3HOVH 4K0KQ 2OCEA 1I50H 4A3MH 1CKOA 2K52A 2RCNA 4HIOA 1Y1WH 3KYHC 2JA7H 4OO1G 1UE7A 3G48A 2YTYA 4JOIC 2RHQB 4OWTB 4BBRG 5M5XH 1N34Q 3S17H 1WCMG 4HJ5A 1Z9FA 5IYCH 4KHPQ 4XIGS 1U0LA 1VQPA 3A5UA 5BR8Q 1UWVA 3AFQA 3PV0A 1OXUA 1S72A 1Q81C 1GM5A 1VQ5A 2I0QA 4JBJA 4JI4L 2UXCQ 4H02A 2R7DA 5C4XG 1NBWA 1YVCA 1BVSA 2CWPA 1EIYB 3I4MH 3IRBA 1PH2A 1PH8A 2NVQH 3TS0A 3CD6A 2JEBI 2YV5A 3CCLA 1XMQQ 2B63H 4JI0L 1V9PA 3PGZA 2GVBA 1HR0Q 4JBWA 2E2HH 4AQYL 4LFBQ 2Q2HA 1CUKA 2R7FA 1PVOA 2JA5G 1U5KA 4DV7Q 1EWIA 2L15A 4DAYB 3A5ZB 4A3GH 2N78A 3GDEA 3HOZG 2YTXA 3KLWA 1B70B 2MO1A 4NPSA 4A76A 4X64Q 1XPUA 1PYBA 5GAGC 1X56A 2K4KA 4JI5L 2JK8A 2JQOA 2NVTH 1HNZL 4DV3Q 3CW2C 2R93H 4YY3L 2E8GA 4B3MQ 4JI7Q 4LF9Q 3I4OA 3AYHB 1K83H 1BBWA 4YCWA 3KF8B 4QQBX 4GLXA 5H1SE 2EQSA 1XNQL 1I3QH 4DR5L 3OW2A 3F2DA 5AJ3L 1C0AA 4GNXB 4GLVB 4XTCS 4UPAA 1SE8A 1YJ9A 1FL0A 3M3YH 3PSIA 2AKWB 1FJGQ 2K75A 4DR7Q 4JV5L 3RN5A 5C3EH 4ALPA 3TRZA 2WB1E 3GD7A 4GOPA 2HIVA 4PMWA 1EQQA 2K5VA 4IOAA 3M4PA 4R4OA 4DV0Q 4LFAQ 1PH1A 2UUBL 4IFDJ 1K0RA 3S1QH 2MFIA 2DGYA 2VQFL 4JYAQ 2I5HA 3U4ZA 4LF4L 2OWOA 5M3MH 4DR2L 2UUAL 1AE2A 3Q8DA 4JI2Q 4DR6L 1NY4A 1SMXA 1UEBA 2VQEQ 1W2BA 3OTOL 3FKIH 3K80C 4YCUA 5LMUQ 1H95A 3CQZH 4IO9A 4OXPA 1KQSA 3KFUA 4DR4L 4A3JG 4C3IH 5LMNL 3CC7A 3GTKH 1HNXL 2UXBL 1VQKA 4QIWE 2Q2TA 1T9HA 2ES2A 4DK6C 3S1RH 4AIMA 1Q1BA 1P8LA 3JC66 4K0KL 4HIKA 2VY3A 4A3MG 2NZHA 1KC8C 1KL9A 3SGIA 2Y0SE 1VQJA 4RMFA 2IX0A 3ZJYC 1N33Q 5IE8A 1G291 2JA7G 1VS0A 4R4TA 3MXNB 3RZOH 5IYCG 1J6QA 2V1CC 3PIOA 1N34L 3CCQA 4KHPL 3PUZA 1NTGA 5C0XI 5BR8L 1OXXK 2UXCL 4LF8Q 1KAWA 4A3KG 3J81i 3A0JA 5M5YH 4DUYL 1QUQB 4BY7G 4JC0A 1XMOQ 3HOUH 2B29A 4GNXC 1JT8A 4JBKA 2B63G 5E7NA 3UDIA 3PO2H 1RIPA 1UE1A 1N9WA 3CCUA 3OYYA 2ZM6Q 1XMQL 4X6AH 5C44H 5K36G 2UUCQ 3RLOA 1HH2P 4L5TA 3JAMi 4YWKA 5ELNA 1HR0L 4GKKQ 2VW9A 4LFBL 2ASBA 1Q8KA 4PZ8A 4OONA 2AWOA 2MNAA 4A3EH 2JA6H 4DV7L 3HOYG 1TWAH 1LUZA 4O2DA 4A3GG 3G6EA 1TWCH 3E0EA 1WOCA 4R4CA 1VQMA 1K73C 1I5FA 3AEVA 3G71A 2WFWA 2JA9A 2A1AA 4LW1A 3U58A 4POGA 1WJJA 4JG2A 4X64L 1OXTA 3NELA 3NEMA 1J5EQ 2NZOA 4IOCA 4A3DG 2LSSA 4GKJQ 2R93G 1XPRA 2N49A 1VQNA 4DV3L 1EYGA 2F3IA 3FHWA 3H0GH 4JI7L 4B3ML 4LF9L 4NXNQ 2F52A 4DPGA 2ALYB 4BY1H 1E24A 4OWXB 4R4QA 2WAQG 3TREA 4EX5A 2ZJRA 4LF5Q 1S40A 1CKNB 2WP8J 1TWFH 4LUOA 2IHFA 1VQ9A 4X65Q 2QN6B 3PUYA 2PMZE 1FJGL 5C3EG 5JJIA 4LWCA 3M9BA 2C35B 3FP9A 1ASZA 3F1ZA 1IBKQ 5IYDH 1L1OA 4DR3Q 5C4JH 1QVCA 1X55A 4J15A 4X62Q 3HOWG 4A3IG 1EOVA 4DNIA 1ASYA 1QVFA 4P72A 3BZKA 3W5OA 3UDFA 4B3RQ 1MJCA 5FJ8H 4DV0L 1XPOA 4LFAL 5IYBH 3HOXH 4JOIA 2QEXA
chains in the Genus database with same CATH superfamily
5B5EU 1WYDA 4PXEA 4JI8Q 9ICQA 1DOMA 2K3KA 1TY2A 3GTPH 4AQYF 3S1NH 2JZBA 1NHVA 1PH7A 2KRRA 4FZLA 3DXBA 1IBLQ 4U7CA 5C2CA 4A8KA 1NSAA 3LF0A 2Z2YB 1RAOA 3QU5A 1GMWA 4Y2IA 4Z7YA 1YVFA 3STBD 3ETLA 3VVUA 5F9LA 1VQIA 4G7OC 2YWGA 3OOCA 1RQNA 4FBUA 2ZH7A 2K89A 1JLGB 1DCZA 3W2VA 2IYGA 1ZD3A 1C7YA 5FLMH 3S2HB 4Y7NH 1GTEA 3K0YA 4L5SA 1U48A 5EWGA 4DV5Q 1CEZA 2QO3A 5DAUA 2F5GA 2KE7A 4ZHRB 5DGBA 2FJVA 1WWUA 1X3QA 4K5XA 2YVSA 2YQ0A 4N76A 1TS2A 3H09A 1YHQS 2MKCA 1HD0A 3CCMA 2XGPA 1DTQB 1ZPVA 1CULA 3HKWA 1N8RT 4DZDA 3SQGA 3I4MG 3TKAA 3QYPA 3KYLA 1Q82C 3HOXG 4JI6Q 3FDTA 1TV9A 2XMJA 2FY1A 2Q3PA 1O0PA 1YKWA 2HZAA 1TWCB 2M00A 3VR3A 4WRDA 2H3EB 5KFFA 1VQ8A 2VA2A 4UP7A 3GMGA 1VOMA 3ENVA 2ZKTA 4I6WA 4DNRB 4P74A 1LB2B 4US8A 2OXPA 1HR0W 1DOKA 4A93G 3G6XA 1D5ZC 3A74A 1FRKA 5CGKA 2F0QA 2B4UA 4KKSA 4OJHA 3J81c 4QIGA 1STGA 1ZAWA 2PZTA 2LVWA 2LECA 1VRQC 5C4JB 1N56A 3ORYA 1YHBA 2B3GA 1FJ7A 1JOQA 5M3FH 4A8MP 2V4RA 2F0KA 3NVZA 4PXBA 4LFAF 1YI2A 3M2RB 8ICSA 4L75A 1I94L 1GUTA 4ZK7M 4JYAF 3TQEA 4C11A 5AM3A 4WJ3B 4DDFA 3T1YQ 3EVWA 3JQJA 2MSTA 2VU5A 3PIOQ 3KLVA 2DR7A 4HR2A 2PKEA 3MFGA 4JBCA 3W9JA 1UA1A 2XRSD 1WC6A 1A0IA 2H65B 4B17A 1S0NA 2RDJA 3GTYX 4OX9L 2BR0A 1KRPA 3MOJB 2DHXA 1AZQA 4X4RA 1G7CB 4DV3J 1K8GA 2E9ZA 1QQ7A 3DDNA 4HYKA 5IIJA 1UE5A 2PMHA 2OEHA 4EX6A 3EE3A 4RW9A 1BQNA 4K4XA 3GG1A 1N5TA 1NZAA 5J1ZA 1FGUA 5K8OA 4BHQA 3K1RB 5KFJA 1VQAA 3PF4A 1RWKB 1R4PB 2AEMA 5CQGA 4XQQA 5IWAL 3EXYA 3QG1A 4DPUA 4F4KA 2HBYB 2J7KA 1RU2A 3JYTA 2CQDA 2RQ5A 1Y00A 1L1OB 3UCUP 1YNJD 2QYGA 1UCVA 2ATCB 1BR9A 3JPRA 1GT8A 2WIIB 4M9HA 1KDBA 1DYQA 4RPFA 2B56A 1S4FA 1XJVA 4CJ0B 2A2CA 3NE5B 4XO0A 4U9RA 2VKZG 3D4WA 4M5KA 4JV5Q 1Y69U 4UB1A 2P8IA 2BV3A 1J97A 1N60A 4O5CA 1AUSL 3C15B 2EY5A 4I2PB 3M2VB 2BW2A 2LFVA 5TISU 2EG2A 7ICMA 3R97A 2NN6I 3SDZA 3J7AF 4NB3A 1TQOA 1QD1A 4PWUA 2GVDB 3GTLB 1CSPA 1NAPA 4F5NA 1PZJD 5J3BA 1WOSA 1FFWB 1DRGA 1CSJA 3C8YA 4AXJA 5K14B 3TEHB 4USIA 1LXNA 4K0KQ 1L1OC 3KF6A 3PG9A 5J2NA 3M8PA 1ML0D 2WF7A 5KOWA 1S5FD 2HNZB 2WBMA 4Q5VA 3V81A 4EEYA 4JBJA 4UUXA 2HSEB 1S49A 5C4XG 2PFPA 1BVSA 3NRWA 3KWMA 4UY8T 5EGYA 4NA3A 4R8NA 4G1QA 1YTYA 3H0LB 3Q8LA 1UZHA 1BD6A 4JI8J 3JPQA 1NR4A 1UHUA 2GS8A 3MFYA 3OT9A 4AQYL 4A3FB 3HHKA 4NLQA 2ENBA 3KZIU 9ICNA 1S7HA 4CIOA 4KN7A 5H9EJ 2IHR1 2VJVA 1AZSA 1GAOA 1O8BA 1U24A 4RU2A 4PQXA 1B70B 5IT4A 2IRYA 3X3NA 4USHA 1LFPA 1KQQA 1S5LU 3U9SA 4CH0S 2B0CA 3CCRS 1Q7YT 2E5LF 2HD3A 1WC5A 5H1SE 2MDAA 3HX0A 1I3QH 4Q8EA 5LJ3Y 4GRSA 1RT1A 2EYHA 1GX6A 1N5SA 2DGUA 5AIAA 5ETPA 1DD2A 1KQKA 3TRZA 2BW7A 3NS5A 4HCEA 1UL3A 4P10A 5I9PA 4DWIA 4Q45A 3MCSA 3AOCA 3M4YA 2B5JA 2AEFA 1PZNA 1FTRA 1WNEA 5G5GA 4M94A 2NRZA 3DGPA 3VWSA 4DV5J 5LMUQ 2DEIA 3KTQA 4JPBW 1H95A 1RT7B 5IM0A 1RTDB 4ZPBA 3F5EA 3CIMA 3OPKA 1KLGD 3PHTA 2HRTA 4JK1C 2FJAB 1T9HA 2ES2A 1RXVA 4Q7AA 1SC1B 3A0HU 3VA7A 1HHQA 3QAEA 5IYCG 2WV6D 2OF1A 5IQQA 2R92B 2NB0A 4DFMA 3GIRA 3QJYA 2F4FA 1H9JA 4JI6J 1XMOQ 2ICIA 1WWHA 4ED6A 2VXWA 4C8NA 5JVH3 4KX5A 2K6AA 2HIYA 5ALWA 2ZITA 1RM6C 1JNZB 2C3YA 5HMMA 4YR0A 2CPIA 1TWCH 2W7OA 4QYZK 2UV8A 1VQMA 1E0BA 4A3JB 2LXUA 1KABA 2M9NA 4NXNQ 4K4WA 1CHQD 4RUBA 3EFXD 3RJHA 2A18A 3D3CJ 1UPMB 3QLHB 4ZP8A 1V5VA 3HJFA 4B9LA 4BLGA 1UVLA 2WF9A 2R2SA 5C3EG 5G5HA 3PHEA 3FSYA 4OMFG 1ECWA 5C4JH 1MQ2A 2VG5A 1J5OA 2NXEA 2XNQA 2G9DA 4LFAL 1VGYA 3ETOA 4KFBA 4JYAL 2YMLA 1YJNA 4A8YA 1LK5A 2QRRA 4KLTA 4K4VA 1A77A 1TE2A 4EQOA 3T1YJ 1UJ4A 4C3IG 1UFLA 2VUGA 2GFFA 4F93B 4QGUA 2HI0A 4DXLA 4FKXA 4NI2B 4F0MA 1VQ7A 2YKOA 2DJGC 4DUZQ 5CABA 4KGZB 2X51A 5F9NA 3RB4A 1MBYA 3K0XA 3JAME 5I2XA 3QGIA 4A47A 1K8OA 1UWBA 1HYSA 5KG3A 3G86A 2OEMA 2CPRA 2HIQA 2XCPA 7ICLA 3TJ9A 2LEPA 1P16A 2A1JA 3S9WA 1VF5C 5A6PA 1RWUA 3W60A 1IZ6A 4JWMA 5C42A 1ZJNA 5F8MA 4FZMA 2D74B 4TRDA 3JPPA 5T41A 5GTHU 4UP8A 4IUQA 4DR4F 5A8WB 4DV0J 3ZDAA 2MO0A 5CEHA 3IM8A 3KLHB 2J7UA 4DSLA 4KLLA 4HKQA 1IM4A 4J03A 2GC8A 2EK1A 2R9LA 1N36F 3M32A 4JI1Q 3BQ2A 1HD1A 2AZ1A 3SK5A 3IAYA 2H9ZA 4EZ6A 1XWEA 1MROB 1JKHB 1SYCA 5J8YA 2JE6I 2ZHAA 3J7A1 9ICWA 1CSQA 3L7OA 4DPWA 2UVWA 5KG5A 2GO9A 4EZ9A 4I7ZC 3RJFA 2YKNA 2BGWA 1I6VC 1MKHA 2K3IA 2CW0D 4XPCA 1U1KA 4CNQA 2VOPA 1JB7A 4YP3A 4JV5J 1S3OA 1N0VC 2FHJD 4OIXA 2N3LA 1HW8A 1PJ5A 4MFBA 4AYBF 4NDXA 5CV8A 3HVWA 3QUCA 2FIUA 2KENA 2RA4A 3MXUA 2WSFC 2OLWA 2EYJA 3M8QA 5HJXA 4NM1A 3GTLH 2HS0A 4HJ9A 5ALOA 1URJA 2JVOA 4PZ6A 3HHLD 2BABA 3CDUA 1IR1A 2ZJPA 4DL4A 1QAIA 1IL8A 5J2BA 2BE9B 3KLFA 2ZC4A 1JI7A 1C4QA 3QFHA 5FLMG 3I90A 4ZCLA 2PC6A 1B64A 4DMZA 3CCSA 4Q0BB 4PG4A 2IVMA 2KVSA 5M5WB 3TQ1A 3HZXA 1EY7A 3MM6B 1K8AT 2B9EA 2VKRA 4FYDA 2I8EA 3A7AB 4LIRA 5B08A 4FDBA 4V190 1LQ9A 2EPIA 3EYZA 2VNUD 1WHYA 4MFFA 3BBCA 1X4DA 2W9CA 3HW8A 4N7TA 3E2EA 3NAHA 3NWRA 4A3FH 2LXKA 2B6AA 4ELUA 5KFZA 3J7ZC 1RDFA 3CT9A 4AYBD 2BJDA 1HQRD 1RTJA 2E5LL 2YQEA 2CAJA 5LSOA 2IOFA 4OZLA 3UXNA 4Y2YA 4X66F 1TL7B 4KB7A 1ZQUA 1C4AA 1TUVA 4USUA 4NLNA 2XY6A 2HHHL 4BUGA 5CV9A 3FEYB 3J7AN 4ED0A 2H3IA 3ULPA 3B54A 4DFDA 2HHQA 5GAGU 3KLEB 1Q86C 1GHKA 5B0CA 5LXYA 1FNOA 4OZ1A 1A6XA 3OMCA 1EFWA 4UBBA 5LMUJ 2VPXB 3HEJA 3Q8YA 3D6HB 4KHPF 5M3FG 3L3FX 1P1LA 2OM6A 4NCAA 3F44A 1LWXA 1HNZQ 1N6QB 1C20A 4L63B 2JOQA 1VQEA 3LP2A 3HO1A 3FMWA 2X1BA 1HR0F 4BA1I 3K5OA 2JZBB 1WCNA 3H4BA 2NVXH 1WKLA 5J2EA 2G07A 4K2JA 2YWWA 1XMOJ 3D2NA 3SYZA 4IN3A 2R92H 5CP2A 1UNSA 3J81Y 4O3QA 5BPCA 4RGNA 3AOBA 4B3MF 1UUPA 4FNIA 2KVMA 3IL8A 2L3MA 3K4GA 2AYBA 5DB7A 4H44C 1XTDA 3HDSA 3J7YU 3ZTQA 1PJ6A 5DQIA 3H42A 3S7RA 5D0HA 3THTA 5DDOC 2HAFA 5T1GA 3LGNA 4A3JH 3S24A 4NXNJ 2OXOA 1OPIA 1PFSA 3K7AB 2JXJA 2W2PP 4YHHF 4GC7A 3TZDA 1IWAA 2G13A 4M1UB 2E2JB 3IWXA 4NX9A 3MGVA 3GFXA 3HGBA 2XWYA 4C3HB 1GM5A 1S72A 1U25A 1UVMA 1IW7C 4DOAA 2I1QA 2BM1A 1NBWA 3IRBA 1PH2A 4IQVA 2DXEA 4BBYA 1TK5A 4JBWA 2X3GA 4DSIA 4B9MA 1CULB 7ICUA 1TT2A 1T9VA 2K4KA 1LNQA 2PT0A 4PGXA 2OFHX 4LREA 3U1LA 1QQ5A 4DUZJ 5JOBA 1DONA 5M2UA 2ZIUA 3E58A 1HXYD 4EQNA 1CQFA 1ZQIA 2MLYA 3IRUA 1X4EA 1IWGA 4ID5B 4K6LA 2CPFA 4EQPA 4C0ZA 1SH2A 3LANA 3ZO7A 3ENWA 2MQMA 4O3NA 1S5ZA 2VQEQ 2KU7A 1S77D 3HOZB 4BXOA 1WELA 4DR4L 4OI4A 1XNSA 1OUQA 2HZCA 3R6GB 2VA8A 2B2WC 4RL1A 5L39A 4WIQA 2QG9B 1XYIA 2VY3A 5KGUA 4ME5A 4RMFA 3FVQA 1SNOA 4IG0A 3EX7B 4C11B 3LWLA 3N7RC 1TIID 3KBGA 3RZOH 1HCZA 2AQ0A 1GEHA 3LTOA 3R27A 4JI1J 1HPCA 2EWHA 4OJ5A 1AA1B 2SEBD 2L9DA 1S1WA 2FLLA 3VYRA 2CRXA 1SJQA 3AA8A 2WZ1A 1ENAA 8ICLA 1T9TA 4K2KA 4ZMMA 1YBAA 1VDHA 1JMTA 1VQSA 4DGZA 1Q8KA 3IV6A 2MZQA 2HDOA 1X31C 1BO0A 2WCXA 1VJWA 2HYIB 2BDOA 3DU5A 4UOFA 1ILQA 1O51A 4PQAA 2GA4B 4GKJQ 2DNYA 3B6BA 1XPRA 3LO3A 3EGVA 5IGEA 2ZG6A 4FF1A 3SMZA 3P5TL 1WG4A 3UO0A 5EQ0A 1G6BA 2G0JA 2V2KA 4RW9B 2D3O1 1BQNB 2JHEA 4KLIA 1RQLA 5KT4A 4IURA 4A3KB 3NWSA 3DMJB 1FI4A 4OHYA 2NVQB 2PA8D 4MYTA 1UTAA 1YJUA 2K8GA 1NBEB 1F9FA 2DGWA 4TKOB 1PAUB 3EDRB 4IJHA 3QFWA 2OO4A 3R3OA 3A0BU 1CJTA 3MA2B 2HQCA 3JYTB 2FPLA 4I2EA 2QX0A 1HHSA 2K05A 5HMYA 2OSQA 1ZZNA 5DBBA 3RU0A 5KAIU 2JJQA 4M95A 4WJBA 5M5WH 2FZGB 1Z2LA 4IALA 4P2HA 4Y2XA 4KK7A 1G6PA 2Q6CA 2BCRA 4Z9CB 1SV0C 5DDYA 1LT4D 4LFCQ 5ETNA 2KA7A 3TUIC 3EXCX 3CCEA 1Y88A 3CJ0A 3AB2B 1NZPA 1YZ6A 1G51A 4PPZA 3MECA 3C1ZA 1DQ8A 3M8WA 2VHGA 4J9MA 3F2BA 3C1EA 2VPYB 1RT4A 2H5IB 4GLAC 1YZ7A 2C2EA 4X66L 1EIGA 1EB0A 3ZZYA 2KYZA 4I2JA 2BDPA 1F44A 2ZTEA 2O5DA 2WHEA 4RH6A 1BXNA 5DJBA 4F50A 2G5DA 3BYPA 3D3RA 3NTHA 1EAYC 3KF6B 4WU2A 3M9OB 2EJGC 3M8PB 1X6IA 1QNUA 4B08A 2Y9HA 3OR2A 3KFUF 3LNNA 3IHQB 2XO7A 1X9WA 3G7LA 3T5KA 1PH3A 3V81B 1Z1BA 3GIMA 1SBBB 4QIVA 4RX6A 5EBCA 3HXMA 2EAMA 4UQTA 1NZ8A 5U47A 4Z6FA 1ELOA 4DUYF 1HNZJ 4G1QB 3T1AA 3I56S 2LQ8A 4TU7A 4YD1A 1VQFA 2FHTA 2QW7A 1AZSB 4HI2A 2IHEA 3ULLA 1R8CA 5KIXA 3ND8A 3OFHA 4NLUA 2JHDA 1C0UA 3HKSA 1NAQA 1VMBA 1RT1B 2Q1LA 3T6BA 3AJDA 1L2FA 4YMEA 4GXKA 2MSNA 2EXDA 3QE9Y 2KHJA 5FO8B 2ADBA 3RJMB 3FYHA 1UW9A 3BS5A 1UKUA 3TANA 1KEJA 4YHHL 3UN2A 1H2TZ 5E3CA 1FKPB 2XMWA 3PRVA 2B5JB 3K7AH 4DV2L 1PK1A 3SAHA 1Q53A 1RTIA 4HMIA 3DGPB 1HRJA 3PEJA 2VL6A 3VGUA 4DF4A 2HCCA 5IM0B 4LMQD 2E2JH 1RP5A 3GFYA 1SXTA 4O0NA 8ICFA 2MEWA 1SXEA 4C3HH 4KN7C 3VDYA 2DKOB 2E1CA 4M5DA 4JI5F 1J2NA 3IWNC 4F2SA 1D2BA 1IXKA 2AHOB 4ZQ3A 3DRSA 3H7HB 3M7DA 1M5HA 1FX4A 3R5BA 3R2CJ 4F02A 3ULJA 4O4GA 2HVZA 1WFQA 2ROEA 2RQMA 2FMPA 4HI1A 3NQIA 2N3OA 2ZUDA 2D3OR 3P4UB 2ZH6A 1SKUB 1ZM9A 1H9KA 2EYLA 3QZ8A 1B4SA 5D4OA 4ILWA 2F8HA 3MBYA 4OO1H 3M8ZA 1CPZA 4GXIA 1CJUA 5FLXL 1HIWA 3SDEA 5DDPC 3QU2A 4UAYA 4KX3A 2JJ4D 1WF2A 2HQLA 1RAJA 2XZTB 3FSXA 1HNXF 2KK0A 1TTHB 1VQOA 3CJ5A 1ZQRA 5IGCA 2VQEJ 2LXFA 3PYGA 2VODA 3AY0A 1ZS6A 3HOZH 5C44B 2LU1A 3H0PA 4KFBB 5AIBA 1HBMA 4J9OA 2MSSA 4JI8F 2BM0A 2W11A 2BEFA 1H72C 2R2RA 3MMCA 2KNJA 1PZKD 2K4HA 2V4JA 3I4HX 1R8HA 1IBLF 4OZ5A 1NK8A 5IT9U 3NRZA 3TDQA 1ICFB 1FIQA 3W7BA 4DL2A 1WHXA 5AK3A 4WE1A 2L0CA 4CKBA 3CDBA 4A3FG 3IDWA 5DG8A 1U9RA 3FMBA 3CHBD 5A2QY 4ME3A 2ZJAA 1EEFD 1V5IB 2A74C 1HYSB 3AFPA 4BWMA 2NBFA 5LMNQ 4LSNA 3TA2A 1NU4A 1RCXB 3K57A 3DC2A 3HMJG 4OHXA 3LUYA 4OYZA 2A1BA 1T8EA 3RFAA 3JB9k 2BE7D 2A1JB 2OCEA 4K4GA 1HA6A 1DQ9A 5D14A 1ZAVA 5C42B 2HFNA 1Q5YA 4RLEA 3SQIA 2EVBA 4DV5F 1QNKA 2CXEA 4M63A 3K59A 1UVKA 3ONQA 5GMKa 1PH8A 2NVQH 1L7MA 5THWA 1SVDA 3H8MA 3BYRA 3IS9B 3MVVA 1QWYA 4IDKA 1CUKA 4XK8C 2FJ2A 2NRTA 4DXGA 4DV7Q 3M32B 4CLTA 2L15A 4NRTA 5HQ8A 5I4DA 1YLXA 3BGOP 2A69D 4LVSA 4X64Q 5J2CA 4IQXA 4K4UA 3GU0A 1Z1VA 4NA2A 2NVTH 4JI6F 2E8GA 3I4OA 3PW2A 1RQ0A 2LKYA 1ZJMA 2E5IA 1OS5A 4BBRB 1UAPA 4J90A 1TR0A 1C0AA 2F8KA 5AM1A 1RAGB 1TL4A 3SXLA 4MFBB 3MM9B 2H3QA 4PV1C 1IKVA 4N8FA 1NPRA 4C3KA 2Z57B 1IVZA 3D7SB 7ICPA 2IWHA 4LF2A 9ICUA 5EGTA 4JI2Q 3M8QB 2WSEC 2ZIVA 2P6TA 4KHVA 1PZID 4JI4J 4A3JG 3AM9A 2KRBA 4YXJA 3CD6S 1AN8A 1HBNA 4KLGA 5J8YC 3N79A 4M8LA 3H5YA 1P8LA 4B3RF 2ZD1A 4XYOA 4ZDNA 1H3DA 2ERRA 5E7OB 1PFBA 1D3WA 3PIOA 1ZQVA 2MKSA 1KVJA 5J0PA 4Y2PA 2DT9A 1Y5IB 4DUYL 4IFVA 1XJWB 3T1YF 2RRNA 3IAM9 3OLBA 4C8YA 1R0BG 1JT8A 4JBKA 5GADU 2MRLA 1SV5B 3JAMi 4GKKQ 3UE2A 2W9CB 2AWOA 2PMZB 1SL1A 2B6AB 5KL1B 1FCAA 4A8SA 2VG7B 1J5EQ 4TUQA 3MOZA 1RTJB 4DV3L 2XNRA 1A2TA 4DPGA 3BGRA 1RZTA 1Z3EB 3TREA 3VF0B 2WP8J 3D6MB 4G9BA 2NRXA 4X2BA 3O8WA 2OYYA 2Y1RI 1VQ9A 3AQEA 2PEHA 3TAQA 3CRLC 2NTSA 2VDHA 5KT6A 5KFIA 2VFUA 3MURP 2E2HB 2APOA 5CBEE 4LSZB 2AQ3B 2EFNA 3MEGA 1OXSC 4CO3A 3W2WA 3P45B 2ADCA 3R9KA 4A3GB 2RS2A 4A3LG 3QBCA 2EDGA 1NJZA 2EZXA 3VZHA 3BPSP 3TX8A 4OHWA 2AQ1B 2PMZC 2QKIC 1MW7A 2G4BA 4KHZA 9ICMA 3T9ZA 1FXLA 3DUZA 5AI5A 2XSFA 1JCKB 1YBUA 3DI6B 2FUG9 3IN5A 2Z4HA 2BCSA 1U09A 2CIMA 4AH6A 2QLBB 4I2QA 5JJZA 1M5VC 4K8IA 1NKBA 3CJTA 1YITA 1T11A 4KMUA 1X9NA 1GUSA 1LVHA 1PAEX 4M5JA 5KG4A 4IUTA 2VFTA 1KNZA 3AB4B 1RYSA 1JQGA 2XZWA 3PIPQ 2ZXHA 1IBMF 4ECXA 3PTWA 9ICFA 3H7IA 1MNEA 2QEXS 2ISOA 4RO0A 2E9RX 4K0KF 2DNGA 3UQ0A 3NSWA 1U4MA 2EKYA 2DNQA 2MJNA 2O6KA 2JA5H 3TADA 4MTNA 4V19J 2D8CA 1FDAA 2G9OA 3SD7A 1YRUA 3L0OA 2SXLA 4B3SF 4L6TB 1T03A 3NGDA 3ETMA 2YY3A 3D28A 2XICA 1W25A 4MFCA 9ICEA 4JI8L 4LF7Q 1HQUA 3BJUA 2HK3A 1M5PC 2GJFA 1Y10A 3I96A 3TZUA 3ISBA 2R2TA 2GMJA 3QT5A 1IBLL 1DLOA 1X40A 2YPYA 2DKZA 1L7NA 4G7HC 3DWPA 1KTVA 2M70A 2F1MA 3Q8UA 1DY3A 4AFFA 2ZIUB 2MUYA 5AK4A 1X42A 1SJED 5LMNJ 4P75A 2FDNA 4LMZA 1BPBA 2KJ5A 1ZQGA 3FEZA 4IPCA 4WBFA 1HBUA 5L9XA 1Q8BA 3CMEA 2CQHA 1JLEB 2OTJA 1MN7A 4LF6Q 3CE8A 5EAYA 1IJEB 5ETKA 4BXOB 4DV5L 5LMUF 2W25A 2P6SA 4ZJQA 2V94A 4P4PA 2AGOA 4PQUA 1K83B 5DNFA 3A8EA 5BYRA 1VQHA 2IIHA 3WKBA 3DMUA 1Q1EA 4IG0B 1R6VA 3CAMA 3RBXA 2P9GA 4DV7J 4X4PA 1NXIA 3I4NB 1B8AA 4DV1J 3GQBA 5KG6A 1S1WB 2XS2A 1KAAA 5SUHA 1U2FA 3WC2A 4X64J 4MTPA 1MWYA 4JI6L 1MG7A 4LIWA 9RUBA 1BPXA 2XLJA 1EY5A 5B0GA 3QIPB 1WVLA 1KXLA 1VQGA 1GNKA 1ZQQA 4BBRH 2X3DA 3GONA 2FJWA 3ZD8A 2F4IA 4RG1A 1VR6A 1BCPB 3H2VE 2BH8A 4DL5A 1OYEA 1RWNB 2AX0A 5DRKA 3J81L 1YRTA 5BN4A 4LR9A 4JI2J 3CMQA 1KNAA 1S0OA 4FNFA 3CB4A 2HNDB 5CYUA 1D7QA 3ISNC 4DAVA 3OL9A 2YKMB 3HKZD 3MMJA 3I70A 3AHPA 1EQRA 4HN7A 2CJKA 5RUBA 2C2RA 1AEXA 5IYBG 3W62A 1W7WA 1WHWA 4KY3A 1CQVA 2FE9A 1TL3A 3OUYA 4C0BA 2E1PA 4F4XA 4M2YA 3KF8A 5ALUA 3OFFA 3QNMA 4DR5Q 1UT5A 4FXWA 1V9OA 3T1YL 2VBXA 4C3HG 1KN6A 2KJXA 1WJ9A 4MN3A 4H54A 2O66A 1HWKA 1T0TV 4IR9A 4RW7A 2VL1A 1S10A 2YKPA 2N7CA 5IP9H 4GKKJ 5ETMA 3I55S 1N5WA 3MAAA 2EFOA 4EBCA 1BCPC 2YNGA 1ZQSA 3OWFA 3MD1A 3KJPA 2BRKA 1S6UA 3HSGA 2NSCA 2G1HA 5HNKA 5COYA 1A6SA 2LXIA 2L55A 5DBAA 3D6CA 4IPHA 1VQBA 9ICXA 2UXBQ 3GTJH 3H6MA 3Q23A 1C1BA 3HOVH 2DR9A 4F71A 1G8ZD 1TS3A 3M6VA 1Q78A 4OO1G 1PG5B 4X4NA 4OWTB 2OPRB 4C3JB 4RU9A 4ZJLA 2F3NA 4BGDA 5T7LA 3QT7A 1KS2A 3GZFA 1TVAA 3JQKA 2JEBI 2P5ZX 4C8KA 3OR2B 5EOZA 2KHVA 2CQCA 2E2HH 5KTQA 2W7AA 3O2IA 2ZOMA 3QU9A 1FX2A 1WG5A 4A3GH 4QIFA 4JI1F 3PW4A 3HOZG 4URSA 1LK7A 4NPSA 3UD5A 2O1PA 2XM3A 2MQPA 4CRXA 1TQLA 1SUQB 4KTAA 3KOAA 3WK5A 3VAJA 3M2UA 5HN0A 1P9QC 2W4DA 1D1UA 2UUCF 3PSFA 3MGJA 4Z6EA 2XS5A 1WCMB 1ZQNA 4GLVB 2KVQE 3MD3A 3PSIA 4WFN3 4XQJA 2ZJRQ 4JV5L 3CMAS 4MMOA 4FO2A 2FC8A 3SSRA 3GD7A 4J9VA 5HQLA 1V97A 1C0UB 1RHRB 2WK4A 4WP8A 4LF5F 2RRBA 3UQ2A 1AE2A 1RU1A 3KLIB 4ZAIA 5ALYA 5KFLA 1L3TA 2A6HC 5GAHI 4O0IA 5D6GA 4YMMA 4FXGC 3QB3A 2OUGA 2NRVA 2G9HD 4RUAA 3BS5B 4ZCIA 3H5XA 2GHVC 4YFKA 3NBPA 4K0KL 1H7XA 4FYXB 1U6FA 1WD0A 1KL9A 2Y0SE 1PK1B 2MQNA 1RTIB 1S4EA 3UD4P 3CRXA 3SSQA 1KOHA 4DX8H 2XYHB 2UXDF 4A3KG 4D3HA 2XSJA 1L7OA 4JC0A 4NOHA 2EI5A 5CYQA 2A6MA 3TJ8A 1KLNA 4F72A 3I9V9 4M5DB 5EX3A 1M4VA 3OYYA 5IILA 4HAEA 2MZTA 4F7VA 4QR1A 3ETRA 3BO4A 4C2MB 2C2OB 1GHJA 5AKGA 3HP3A 4G57A 1FT8A 1HEKA 2NUUG 1OSDA 1KSPA 3PJWA 4Y2SA 1NEEA 3MR2A 3UMBA 4F4YA 1B4OA 5C5JA 3TX0A 4J6HA 3W8GA 3NELA 1XK8A 1JC7A 2PW5A 3I0RB 4A3MB 1S97A 3DYAA 4R4QA 5M5XB 4QQBA 1X9MA 2A68C 2ZBPA 3Q8KA 1KNEA 3A8IA 4WKYA 8ICTA 1RB0A 4S0MA 1SB6A 2OT2A 1LT6D 1ET9A 3BO2A 4X3KA 4WORA 5LL6S 5CZVA 2J7ZA 4TXSA 2DRAA 3MHBA 4JB3A 4CRJA 2V68A 4LF6J 2UUWA 1ZRMA 2MQ8A 4OHZA 5LMUL 2YTVA 4LVOP 4MHEA 4IFDG 4N41A 3EQLC 4L6V3 4IRCA 4QNLA 2F0VA 2CPHA 4OL8A 4OJ3A 3PUXA 2LQJA 1HNZF 4ECUA 2RNEA 1HBMB 4G6VB 4QJVA 4F04B 4L3NA 3SZ2A 2AT1B 4CCHA 2QMWA 2UUTA 2HBRB 3MMCB 3Q22A 4A8WA 3I4NH 2H48B 2V4JB 2K32A 2KCCA 4KLHA 3SV3A 2PGCA 3OLAA 2AJQA 2L41A 3FGVA 3HWTA 3ZZPA 5IIMA 4OI6A 1AT1B 2VFVA 2K5QA 2DR6A 2IAJA 3PX0A 3L3OC 5DM63 4UP9A 1HZBA 4OI3A 2E3TA 1EWCA 2EFGA 2DH8A 3IBFB 4LSNB 1AUDA 1WEXA 2XWBB 4R8UA 1K9MC 2EZZA 2V6AA 4NXNL 3MUVP 2K5HA 2CPEA 3D1HA 4JP8A 1PVPA 1RF2D 3MGHA 3TSSA 4KJOA 3R5JB 2KICA 1HQMC 5KFUA 1ZD4A 4DAYA 4P2XA 4QWEA 2HBMA 2E74C 4KTQA 4TQSA 3CDWA 3QGPA 3HX9A 1U4BA 4CLSA 2RF4A 3NY0A 4Y0FA 4FYVB 1DJRD 3IBWA 3HHEA 3N5FA 4IDKB 4DS5A 4IYQA 2TMPA 4DR5J 4BA2I 3SCKE 4C98A 1IQTA 5IP7H 3VGTA 2HQDA 4PHPA 5AK6A 2GN5A 5ALMA 1SZHA 1VQ4S 4R25A 1KRSA 5CCMA 4IH5A 5FJ4A 2KHIA 3WK7A 4ER8A 4DUZL 2R7TA 2E7XA 1DQAA 4QZVB 1E6YA 1ZQCA 4KH0B 2MQQA 5ETRA 1FNVA 4U6PA 1PSDA 2LMRA 4EBDA 4KQZA 3JAMc 2IOHA 1QJOA 5F41A 3M30B 2V4DA 5IT9c 4OJ1A 1IKVB 2HT1A 4RNHA 4WK1A 2ASJA 2W1BA 2XVTA 1NK0A 3R7NB 4MKAA 2Z8QA 2FGCA 3C6TA 2A73B 4CJ2C 2ZIVB 3T79A 3CD0A 3J81j 2EFQA 3IBCB 2UV8G 4P73A 2HOQA 1RSCA 1EZZB 3JQMA 4KBIA 2XCAA 2Q79A 4C3JH 1HBNB 2Z9HA 8ICXA 3D4JA 4H4OB 5ETLA 2ZD1B 4U7UD 1XNRQ 3ICEA 2EYMA 1BLUA 1Z4NA 2UU9Q 1ZQBA 5HAOA 4JI1L 3GILA 1PRTF 3MEDA 2FJDB 1HHVA 1CA6A 4HEA9 1Z2ZA 4NZ6A 2IOFK 5C44G 1R31A 2W8LA 1PDQA 4WJ4A 1WI6A 3GSDA 1CKNA 4NXZA 3UE0A 1KOOA 1TFYA 1SPBP 2KG0A 4CO1A 1XR5A 3RN2A 1WCMH 5D0RA 1RHQB 3KD3A 1JORA 4GKJF 3HOWH 4A3IH 4OJOA 3M9MB 1NKEA 4ZPCA 2F0NA 4YDDB 2CNLB 4OX8A 3ZZUA 3HG9A 3IM9A 3NWGA 3DLJA 4USTA 1WD1A 1I94J 3IG8A 3WKAA 2KEEA 2PDAA 2XGQA 4F8RA 3EGZA 2EG1A 3QYYA 3IGVA 4QB4A 3UI2A 8ICRA 3QU4A 1EY9A 3JPOA 3LW5C 2D0PA 3J7Z5 4P2FA 4IQTA 2K5NA 2CYYA 5EE0A 4NMXA 5TSSA 4ZP6A 3NOCA 3MEGB 3W2WB 4U7UK 1K73T 2RMLA 4LSLA 4LFBF 3DN9A 1FWPA 5AJ3Q 2R7ZB 1PRTD 1Q4RA 2HRYA 1B53A 2FJBB 2PIIA 2DGSA 5BJRA 3R2TA 5HGQA 1SQFA 2W9AA 5AKJA 3J7YW 5FD1A 3ED5A 2JC1A 1V43A 3GO5A 1U6BA 1AP0A 1R6YA 5DKWA 4JBMA 1X4BA 5H1SV 2E1FA 1SH3A 4I2QB 4TUPA 1E2WA 4C2MH 2L08A 5AKHA 3WIUA 4LFCF 1VDZA 1Z6HA 3E9IA 1RAAB 2DGTA 3UVJA 4DF7A 3D1OA 5M2RA 1IIPA 4CYUA 2Q4TA 4E6IA 5BYQA 3EA6A 4MKYA 1WTQA 4A3MH 4F87A 4LBPA 4NYOA 1MI2A 4Y2UA 4BBRG 3LWMA 2YTYA 2C28A 5M5XH 7FD1A 4DU9A 2E1EA 1A0OB 2OJ3A 4C4WA 2UXCQ 3NGTA 1N5QA 1YVCA 5ALFA 3DLGA 4CH7A 4RKBA 3FCHA 5CZXA 3Q83A 4AL7A 2ZH1A 2XSCA 1URRA 1FERA 3C19A 1SL0A 5HP4A 4XDCA 4HHHA 4K5RA 4KSEB 4J9KA 1YIJS 2CQPA 5GAGC 1VC6A 3H3VC 2JK8A 1HNZL 1T03B 4LF9Q 2R4FA 4KMUC 3TVZA 1HQUB 3PVXA 2KQ3A 2ZM6F 4QQBX 1KHVA 3THPA 4BC7A 5A2QE 5IXUA 3HT3A 1XX8A 1FL0A 2TSSA 4DPTA 1MSWD 2GQ2A 3IAS9 2CUYA 1IM6A 1DLOB 1V3ZA 4TY8B 2MGZA 4ABNA 1RWMB 5HSPA 1HWUA 3MM8A 4I2HA 5KG1A 4FZVA 3HK2A 7ICHA 1RUSA 2ZDOA 4ZUIA 2E2IB 3Q8DA 1NNLA 4EENA 2CG8A 3KLSA 1A15A 2QARB 2HAIA 4L74A 1FNMA 2QB0A 1UQVA 3I91A 4R8IA 4XDXA 1X5TA 1KQSA 2QF7A 3JTNA 3OWEB 3K6OA 4M5GA 2IBOA 1FJEB 2BJEA 4DSFA 1TZ0A 5HMLA 2M2LA 3VYUA 3K1ZA 2V1CC 2B2UC 2ZT9C 2FC9A 4C1NI 1RAEB 5ELFA 1LTTD 1S57A 3VV2B 1HL6A 2NLWA 3ILLA 3PSTA 4C0HA 1N9WA 4C8ZA 2C22A 4L5TA 3THVA 1R43A 3P6YC 4A3EH 1LUZA 4A3GG 2A1AA 1L3VA 4LW1A 1RE1B 3CYMA 3DKDA 3D3BJ 2D9OA 2B51A 1OO9B 4BY1H 1T9WA 4E98A 1WDDA 2EXUA 2PMZE 5E79U 2C35B 3F1ZA 1L8LA 1H9RA 3I4MB 4N9PA 2G09A 2DNMA 1TK0A 1EY6A 2PSZA 2PN6A 2YH1A 1SJRA 1XIQA 2EYFA 3K0JA 4KV8A 3HOYB 1Q95G 2LA6A 4IG3A 2K1RA 2VQEL 2Q2UA 2FLPA 4RA8A 2N7YA 2PXIA 3UCGA 4A3DB 3ERQA 3SE0A 3KDOA 1NSPA 3HFVA 3RH4A 3S1MB 3CCUS 3MPYA 3CJ2A 1K8AC 2FLNA 3OUYB 1RG6A 2MAXA 1T02A 4I2AA 1I6HB 1RISA 1XNRJ 4ANEA 1NJIT 2UU9J 2DY1A 1WG1A 4B6JA 3U1NA 4DK1A 4FF4A 1EQTA 3FZ2A 4BCAA 1ZQMA 1VQNS 5MAOA 3WC0A 4RW7B 4DSJA 4C4RA 1PFNA 4F4AA 4F5RA 2GIRA 3BZCA 4DQPA 3MR5A 2ZOFA 1QM9A 3MAAB 5E3AA 2YNGB 4DSEA 1RGVA 2IRXA 1VF7A 2UP1A 4WZMA 2DITA 4MZ9A 4OIKA 1P27B 1HJPA 2KP7A 4GKJL 2EY6A 3H8YA 4NCBA 1HHTP 3H25A 5LMNF 3HVRA 5C2GA 3PR5B 3ISDA 1C1BB 3BKTA 2F1FA 2UZAA 1YSJA 5EJWA 1JLQA 4QZEA 2KCMA 5M5YB 5IC4B 2KEDA 1PH6A 4EVOA 2B3TB 5T7LB 3CJKA 4NRUA 5ELCA 3DNCA 4DOBA 1C8CA 3A8KA 1KDAA 1UPPA 2HFVA 3G96A 3CO0P 2VS1A 3BYYB 4HACA 2R7ZH 3TAMA 4X64F 3A12A 1H9MA 2YX7A 3AOAA 3DLEB 3M2UB 3PIO3 2BOSA 2BCOA 5CAAA 1H9SA 5KNBA 4LFCL 1S6PA 1U7LA 3DLLA 3VQTA 1Q81T 4BS9A 3I4NG 4CO5A 3PO5A 4J9PA 4DJBA 1LW0A 3H3VH 3ILJA 2FQQB 3W9HA 3GTGH 4R4IA 4N8OA 3D0HE 4UAUA 3KDFA 1F3FA 1HW9A 2VC1A 2F3JA 5ALVA 1PJ7A 3H4DA 2KOLA 1GO3E 1SZPA 1UW4A 3CCMS 1N36Q 2P66A 3N6RA 3S15H 4A8XA 2XTIA 5FLXE 2LS01 4JI2F 4FF2A 2VUMB 2UXCJ 5E0OA 2FHOB 3HCXA 1U2RA 2AEJA 1QUQA 3NBPB 1F60B 4WJ3M 1M90T 5ALNA 4EGVA 4HJ8A 1VQ8S 1ED1A 1RTNA 2CHBD 4ED8A 1XNQF 5DQGA 3N0VA 4RGMA 2HWIA 2XSJB 5CYQB 3ERSX 3P7JA 5B7WA 1I51B 3C2MA 4P2SA 4NYPA 2HCIA 3FAHA 4OELB 1SNCA 2DGXA 4QYZJ 3KJQB 2Q8IB 3CC2A 5IP7G 3NVVA 1J2VA 5L1LA 5NUCA 2YBVA 3GTKB 1BNOA 4YVZA 2YMPA 4X3UA 1RKJA 2N88A 2DIVA 3SCLE 1J5EF 1QAXA 1YI2S 4ED1A 2YX8A 3FDSA 2OHDA 3DYAB 2L9NA 2ZBCA 1XQIA 4Q0FA 8ATCB 4A8EA 3SCIE 1IKYB 5A8KA 3D0GE 4NCGA 1UVIA 5ALSA 4BC9A 2EY1A 3WDOA 3NVYA 2J9CA 3IO1A 3SQOP 1DZ1A 2KECA 5HHIA 3EIVA 2IJRA 3K81C 2ZH3A 3W2DA 4NZ0A 4P7VA 2CFXA 3SCJE 1QCBD 2K8CB 3D4RA 1LWFA 4UZCA 1JQYD 3R8BA 2FPHX 3N7PD 2BZ2A 3F73A 3E3XA 1B50A 2YXLA 2NPIA 3PMFA 1JWSD 2UUBQ 1JXVA 3IG5A 3CCJA 1UE6A 2Q8RE 1QAJA 1C9OA 3OXFA 3PW0A 2BJ7A 4QIWF 1SBRA 4OIJA 4X66Q 4MAKA 4ANDA 4DR6Q 5K9FA 4ZK9B 3JAMY 3KLSX 2G5HB 2FI1A 1TL1A 2F8MA 2JH3A 1X4AA 4ZLJA 5IT9Y 2PD1A 3G6YA 4RJVA 3GFKB 5ALQA 4PGQA 5ALIA 2BQRA 1F5SA 3B0XA 2EBGA 1BOSA 3NVWA 1X4HA 1CKOA 4I29A 1QOHA 2K52A 2IAJB 2RCNA 4X3TA 3KYHC 4IUPA 1UE7A 3GTOB 1N34Q 2M52A 1WCMG 4KHPQ 2Z30B 3RH5A 3PV0A 4IL6U 2OIHA 2C2ZB 3HSDA 3CD5A 3I4MH 2EBEA 2M3DA 4A8QA 3S6EA 4F2RA 3CCLA 4F4WA 1HA1A 4UOHA 2EAPA 1QE1A 1HR0Q 3V2TA 5CYMA 2MMYA 4DAYB 1A9NB 3EWGA 4CE6A 4A76A 2YX4A 5D3DA 4GVBA 4CDGA 1VBXA 3F5AA 4C7YA 3VAMA 2DL0A 7ICKA 4B3MQ 5AI4A 4QIWD 1OJ4A 4LF7F 2NR0A 3TVYA 4OYMA 3BBBA 1RTOA 4GZYC 4MT1A 2QLWA 1FJGQ 4ALPA 2DO0A 2CN1A 4GOPA 2DNLA 4JWNA 5KFMA 3CRKC 3QU7A 4O1NA 1JX4A 1LV5A 1CJVA 1E6YB 2OWOA 4V19X 4MF2A 1FNUA 3S8SA 2Z2ZA 2KH9A 2F0GA 2B2YA 1Q82T 2KJWA 2Q43A 3SXHA 1BE4A 5LMNL 4OJPA 1LKYA 1ZA1B 2J6UA 2GLEA 5KFRA 1F0XA 1QJHA 2XMTA 3FBEA 5AICA 4A3MG 4NJ8A 4A3CH 3C6TB 1HWLA 1G291 1UEAB 3V7KA 1EYDA 4K2XA 2DXFA 1T5XD 4LF6F 1JNRB 5ISRA 5KYLA 3BPDA 2C2KB 2DJWA 2HVEA 5KFDA 2Z0GA 5M5YH 1RBOB 2XG8A 1WTWA 4AP9A 3QEBZ 2HQ3A 4Y2VA 3N4MB 4DO9A 2RKIA 2R8IA 4OCZA 4DV7L 1BPDA 2VD3A 3FBBA 3DLBA 3G6EA 1CJKA 3RW6A 4QUCA 3EMTA 5AKXA 3MEDB 3P3DA 2WFWA 1EZ6A 1XN9A 1B99A 4X64L 5F0UA 3KXDA 3EUB2 3PR4A 2G2OA 4NLYA 3HLUA 3QJJA 2HURA 2W03A 1X4CA 1KBUA 4FNHA 2HQFA 3BDOA 2F0SA 4EX5A 1U0SA 2ODGA 1CKNB 4UT4A 2JWNA 2OSRA 1XS9D 3GDXA 3DWAA 1HMVB 4DR4J 3PSPA 2CZ4A 3F0NA 4X62Q 3KUPA 5E3QA 3W5OA 4AE5A 4S3SA 2H4OA 3ZXWA 3A13A 2MB0B 1PH4A 3MM5A 2DY9A 4KV6A 2J6SA 1N36J 2W43A 1MJEA 2MHVA 4P7TA 4JI2L 3QOJA 3FEXB 3P1HA 5E33A 1EETA 1F5CA 2E8PA 4DA2A 2HHPA 1F9SA 3TP6A 3TMEA 3A8JA 4OYIA 5J39A 5GROA 9ICPA 1IV8A 2VUMH 2IDEA 1CVJA 2RDGA 2WRMA 3RJIA 3OBIA 4GO7X 4C4TA 2FZCB 4ILLA 1PUZA 4LSLB 5EBDA 3WX8A 1HZAA 4ZKCB 5CD4A 1LM0A 1VQMS 3A54A 1RT2A 1SB3C 4NLKA 4IUFA 3HJEA 4P71A 2YYZA 1KVKA 3S1QB 2PQAA 2RQKA 3NRBA 3QO9A 5HLFB 3FVYA 1WWVA 3HZGA 4OI2A 4ZA1A 3JPTA 3M7VA 3ZFVA 1L7PA 6FD1A 3UVJB 3ZD9A 1RXOB 4CYUB 1J5EL 2WW4A 1FE0A 5GADC 4ELVA 1FK9A 1QTMA 2K14A 3V5RA 2UXBF 4DL6A 2JLEA 3HVAA 2DGVA 4OLPA 2KCNA 2FY8A 2CQIA 5IZHA 1YJNS 3A3NB 4LJXA 2QLJB 5I42A 1SR3A 3KJOA 2KKHA 4WWSA 3DOLB 1BPEA 2A3JA 4CZCA 2G2ZA 2P6RA 2X6GA 5JJLA 4DN0A 1RD9D 3A3OB 1SAPA 2OMOA 4Z37A 4KE5A 2F76X 2JEFA 4NWBA 1BBXC 1PVRA 1VQ7S 2R2UA 3B0YA 2D3DA 1DGJA 4QZFA 3UPFA 3UM9A 1FA0A 1FRMA 4NZ7A 1P8GA 2J76E 1H2VZ 5D3IB 2GX8A 2BPGA 3I87A 1T4GA 2POKA 1SC6A 1SIZA 4M47A 2UUBJ 2XMKA 1NJXA 2VKQA 1JMCA 4OZNA 3U50C 1ONLA 4U67Q 4X66J 3HRDD 5FDLB 1SXDA 2NXJA 2KIVA 5HY6A 2J4XA 1CFMA 3GPAA 4Y2KA 2MGZB 2GGPA 2XVSA 5F2DA 1S8OA 1M1KC 3GR1A 4I7FB 2XWJB 2H3VA 4BX9C 1FXDA 4CLKA 3MM8B 1XTZA 3PUWA 1ZBTA 4CT9A 5IIFA 4IO9Q 5J2MA 4HIDA 7ICNA 4QZ8A 1X3PA 5CH7B 4KKOA 1VS3A 3MEKA 4NE9C 3BS1A 2WVDA 2QB0B 4KHPJ 3KJVA 3SR6A 1PIEA 3N5BA 5AXKA 3GTOH 2NZ1D 3UDCA 2ZUGA 1VK3A 4DUYQ 4USVA 4LBIA 1RJJA 9ICTA 1OIAA 2Y0BB 2BA9A 3WQPA 2CQ2A 1FWLA 4W98A 1HR0J 1I4PA 3M6UA 1Y9OA 5F8JA 5IY0A 4CKEA 1SDFA 1WEYA 4ZCKA 1AW7A 1YJ7A 3HD1A 3LPEA 5CV7A 2YNHA 1L0XB 4B9WA 4B3MJ 3TN2A 4ZN3A 3N7SC 4LF7L 1WSVA 1NO8A 2KB2A 3SHLA 5CXTA 3EPIA 2E9TA 1XSNA 1X54A 1QQ6A 5B66U 1FJGJ 2R7ZG 3D6WA 4K7QA 4LRCA 3ILIA 1WHVA 4U95A 3F53A 3MPWA 2F63A 2ZXIA 5KNIA 3SK4A 2JYOA 1RT6A 3GTMB 4I27A 3UNYA 1H98A 1NM2A 1OMSA 2FGOA 1K3BC 2K2PA 3CCSS 1Q3VA 1QCKA 3UE1A 1ZQKA 9ICRA 2FVQA 3TZXA 4PMCA 4YOEA 3BZDB 4D3GA 1X8DA 1P7DA 5JEAG 3NL0A 1I4QA 4K4TA 2FPKA 1ILPA 1VQ6A 4JI5Q 2MQOA 1HFNA 4H4MA 3K5MA 2VA3A 5J0TA 4IG3B 3KJFB 2PQEA 2K1RB 4LF6L 3IP4B 1X7VA 3BKUA 3GV6A 1N5VA 3IG1A 3TS2A 1O7IA 3BQ1A 5AXMA 3FNNA 3WBZA 3E5SA 1F77A 2RVLA 4L3KA 1X9SA 5FP0A 5DBCA 3ZZZA 4JI7F 3CO9A 2E5GA 4ZN1A 2XMMA 5DO2A 1HARA 4RQ5A 1S1UA 4DR7F 5KFSA 4AUKA 1HNXQ 4FN5A 8ICNA 4KKUA 1Q8IA 2KIWA 1LYLA 5ALTA 2RF2A 3BR8A 1Z4OA 1J27A 1FKOB 3LAMA 1BPYA 3D1QA 3WX4A 5DQHA 1NSNS 2RHQB 2VB3X 3N01A 4PYAA 3UNGC 3SENA 3CEDA 4QPTA 3AD8C 1XSLA 4X62J 5CB1A 1PTOB 2RDIA 1WCLA 2F1HA 4P0QA 1V9PA 4QWDA 2GVBA 3I32A 5IV3A 2XRQD 2QA1A 3SK6A 3ET6A 1JLQB 3U02A 1U5KA 3JTPA 3NNAA 2WB1B 1X4GA 4TU9A 3GU3A 1DOLA 4HAIA 3BN4A 1X5SA 2F1JA 3TFSA 1JXEA 1MGSA 3I1YA 2FZKB 3CW2C 2I46A 4DS4A 2LKZA 4ZPDA 2ICEC 1X0FA 3H40A 1KD1T 4QZBA 3ZZRA 3HHNB 1CI4A 2E1MC 4DR5L 2RP5A 3OW2A 3K5LA 2DR5A 1B3AA 1CA5A 2PA3A 4HACB 3TAMB 3M9NB 4HTHA 1ZQEA 1K1SA 3U26A 4QUFA 2DGOA 3KJNB 3S1QH 4BDPA 4X84A 1JOOA 4I2GA 2I5HA 1H9SB 3U4ZA 3C66A 3I28A 1S6PB 1PTOC 2F0IA 2AYEA 3SFUA 4N9TA 1W2BA 1U1NA 1Y11A 2IDLA 3D8GA 1S72S 5D3GA 1LW0B 2Y1JA 1SNDA 1R9TB 1WG8A 5KG7A 3CC7A 3EDQB 5FLXU 2UXBL 4LBHA 4ZLPA 3GIKA 2HEKA 4PZVA 2WB1C 2I1RA 5IQ6A 4HIKA 2QYCA 3OW7A 2KVIA 5HP1A 3D6JA 1ZXIA 5J0QA 8ICUA 1GUWA 2ZNZA 1ZYRD 2LDYA 2DNNA 4ECZA 5A35A 5AM4A 8ICMA 4DFKA 1QUQB 3B4MA 2U2FA 2B29A 2BOAA 3G9CA 1R3NA 2E7WA 1SH0A 3L7PA 4J9SA 2ASBA 3FMCA 3ZDEA 1XNRF 2CPYA 3HOYG 4TURA 3OVAA 3SAFA 2G06A 2KXHA 5KG0A 3M8SA 2UU9F 2PI5A 4OJGA 2W9BA 2YMQA 4B9UA 1WJJA 3NEMA 4A3DG 3NNHA 2E1AA 4YB5A 2N49A 3O3LA 1OSCA 1VJQA 3I5CA 1KQFB 1D8YA 4ECSA 3O1LA 1LABA 5JU5A 4KO0A 3UW1A 3T51B 4PJ0U 3X3MA 2HFOA 4Q2MA 2YWHA 1TWFH 4LVNP 2ZXOA 4LF1A 1ENCA 3NK9A 2AJ2A 3OHBA 4KLFA 1JLAA 1SNPA 4DR3Q 1FDDA 1X55A 4OZ3A 4CF3A 2HGNA 1FFUA 3MGIA 4B3RQ 3N28A 1G91A 3AQOA 1D0EA 4K4ZA 1P1TA 1RZMA 4RW4A 4BS2A 4ZLTF 3BO3A 5A8KB 1F0MA 1X3FA 3BS9A 4WPAA 4PPXA 1G2SA 3JSYA 2X7IA 4DK0A 2Y8YA 3CF5Q 3DRRA 3W1BA 2PCFB 4DUYJ 3M6XA 4DXFA 1SJ4P 5AHXA 4CLZA 4FS1A 4NXMF 1APSA 3NBHA 1W3SA 4A3CG 4TKTA 1QZGA 5BOLA 1KKHA 2M9VA 2BKEA 4RUCA 3DWQA 1LWFB 3AJ1A 3JTOA 3O13A 3T1HQ 1XBWA 3RBDA 4PZ7A 5AJ3F 1YBYA 1U1LA 3ADAC 3H15A 2HFUA 3MAHA 4ECRA 1Q86T 3Q2TC 2PW7A 5F3ZA 1HI1A 4QCLA 3LDAA 1JR0D 5GAEU 3TACB 3CPWA 1OO0B 3S14H 1EY0A 3O44A 1TL1B 3PUVA 2NPFA 1XEZA 1JLBA 1PYSB 2Z2LA 5J2GA 2EW9A 3DDIA 3PX4A 4FP9A 1SI9A 4TU8A 2ZJQA 4JMUA 2QB1A 2BE2A 2RJZA 2AGPA 3I76A 3NXWA 3GTMH 4EO8A 5AM5A 4C3MA 3M4QA 3H98A 2CJAA 2IPOB 1AQ6A 5EPLA 4RPXA 4USJC 4DV6F 2UXCF 1DJ0A 4JI5J 3CTRA 4YDXA 1NB7A 4HTIA 5CYMB 2ILYA 3CCES 3OSNA 1X9XA 2FVSA 1FF2A 2J0WA 4GNXA 2D6FC 1XMBA 5DM7Q 2VUMG 4ECVA 4GVBB 5GAHU 1IYVA 4PUOB 1PBAA 2IM2A 1ZETA 5D4BA 2OP5A 4UHVA 4YG2A 1R89A 2R7RA 2BKNA 4LF9F 4WFZA 1L6NA 1MIUA 4UUWA 4WP3A 4ZLLA 4RKUC 2DBYA 1M5KC 4IOAQ 2A8VA 1N32Q 2CPZA 3GFZA 1IBMQ 4CQ1A 4DR7L 3C16A 3MMAA 1VC0A 1HNXJ 4GOPB 1EY8A 4UAZA 5F3XB 2NXUA 4CO4A 4FE3A 4F25A 2R7VA 2YTUA 2OTLA 3VGVA 3MAQA 5LOQA 5C0XG 4P0PA 4DU8A 1C0TA 1JALA 4RBVA 3BN7A 3M6WA 2EZVA 1DFDA 4B3SQ 3F8TA 1LKYB 1S1TA 3LOUA 2ILZA 2R42A 5ALRA 4KJIA 2R8GA 3NENA 1RAIB 4ZVRB 2HFSA 2ZTCA 3GV7B 1GVPA 1PTOH 3H5UA 3P8BB 1CK1A 2VASA 3PW7A 1D5XC 3Q8MA 2RRAA 4CF4A 4ICAA 4RBTA 5CCLA 1IBLJ 4L5RC 1S76D 1NDPA 4J8QA 1GD7A 1E1OA 3PFOA 2RDHA 1PC5A 2RKIB 4GOPC 4K14A 3CXCA 2V2VA 1CJKB 4TY9A 1EKSA 5IIKA 1RKNA 1H74A 2Z6KA 8RUCA 4RQ3A 4XXEA 2B2YC 4WJWA 2QMXA 2CKWA 5AKKA 2DHHA 1EP4A 4IQZA 4ED7A 1AFJA 4M9LA 1TKWB 3MTSA 1LEOA 3J7YI 2EK6A 2N8NA 4UY85 4WK3A 4Y2AA 3S2HH 2CG4A 5HJYA 4URQU 3JAML 4RKLA 4Y2RA 2WACA 5JMNA 4FS2A 4CKCA 3MM5B 5KFVA 1OXJA 2IVFB 4CWBA 2QT7A 1ITPA 2O2LD 2LA4A 3MCMA 4A48A 4J9NA 1RAHB 3IR6B 4F3OA 1EETB 3A8IE 2J0XA 4KLEA 1U8WA 3PRBA 3LVWA 1BNPA 5HURA 3RW7A 3ZZOA 3DRYA 1IYJB 2PFOA 2QKQA 1XNRL 4WF9Q 2N55A 1NK7A 4DR2Q 2UU9L 4X4SA 1RT2B 2BOPA 3OTOQ 2AV5A 2VONA 3I4PA 5C5LA 4GIBA 2AJ0A 2YQ1A 3KHRA 2PQAB 4PH5A 1S4ZA 1VQOS 3QO9B 3HFZB 1TFRA 3OL6A 1Y1VB 4A3BB 1ZQHA 4I6AA 2CWKA 3P96A 2DIUA 5DS7A 1DAXA 3V96A 2MZRA 8ICGA 1VQPA 3BGLA 4J9UE 5BR8Q 4DR3J 1VQ5A 4C7QA 1U1MA 5F8GA 4H13C 1FK9B 4KLQA 4B3RJ 2AF6A 3B9JA 2PI4A 4F92B 3MXPA 4LUBA 1K5OA 3HF5A 5I42B 3BDCA 5K5PA 4CLFA 1PVOA 2FPMA 2VC0A 3RJGA 1WF1A 5ETVA 1FYCA 1RAFB 4OO1J 3S16B 4ZUJA 2R7QA 3DHWC 4CM0A 2JEGA 2IVYA 2DISA 4L76A 4CLYA 9ICIA 3POTB 4ID6A 1STAA 3VAFA 1B3TA 4ZLNA 1VHFA 1T3QA 2FHJA 5AJ3L 1XSPA 4OV6A 2XN9C 5DDMA 5FO9B 4RQNA 5ADZA 5IT9E 3D6FB 2O5IC 3E51A 1S5DD 2YWFA 4M6WA 2HIVA 2NYZD 1YNNC 2PFQA 3M4PA 2CQ3A 4ZVFA 3V2UC 4ITSA 3FJ2A 1KR4A 8ICHA 3HHLA 2BJ3A 3K80C 1PTOF 1UETA 4ICLA 3AD9C 3G87A 2GGPB 1REGX 1NK6A 1IBKF 1ZH5A 3AH6A 5TZVA 3IRWP 4WFYA 5J2MB 2A6EC 2K4EA 2R7SA 5IE8A 3OW2R 3UMCA 1HUMA 1RPLA 2BUNA 3LP1B 1IG6A 3C14A 3CCQA 3IGNA 1NTGA 2UXCL 4LF8Q 2FTRA 1Q3LA 4LT6A 5I3PA 4MK8A 4WFBQ 4UDUC 2LKVA 2E66A 2UUCQ 3RLOA 4RNOA 1W2BR 2V8DA 1JICA 2GQQA 1SXLA 3R5DA 1I5FA 3AEVA 4KIAA 3U58A 2HCFA 4NLVA 1CZWA 3KLRA 5KFEA 1Y8PB 4F7XA 2YNHB 3PW5A 3AU7A 4USAA 5ALPA 3BGUA 4LF9L 2ALYB 4QYRA 4LF5Q 2LI6A 1S40A 2RQXA 2I5JA 1N32J 4LUOA 1GX5A 4PG7A 1IBMJ 4OJ6A 2MLXA 1S9GA 1V3SA 1BWVA 1DTQA 3L95X 5IYDH 1ASZA 4BY7B 2HWHA 3J7AV 1EOVA 4DNIA 1SEBD 1RT6B 2WKCA 3I9ZA 1SWWA 3N9UC 4K0KJ 2FINB 2VDIA 4OZ2A 5BOMA 2Z4IA 3OD2A 1JLFA 3LX0A 1X65A 1HNWQ 3OIPA 2UXDQ 4K5WA 4B3SJ 2R93B 1E6VA 3F2CA 4HJ7A 1OQ6A 1M1HA 3PIP3 2HGMA 4H4MB 2RU9A 3NKYA 3MZIA 1F9PA 4IOBA 2VB6A 5J1EA 4M5LA 2HLTA 5T1IA 3EROA 1Q0NA 1I1GA 4F4ZA 3IG1B 5I4MA 2CQGA 2I07B 4YR2A 3RF9A 3N4WA 1CKMA 1E22A 4PAAA 2CDRB 3W64A 1VQLA 1SRUA 4F88A 1TP7A 5DLFA 5M3MB 3AMZA 2VZAA 2UUBF 2AWZA 3M2RA 1AH9A 8ICVA 2LYBA 5HROB 4KGXB 3MMBB 2XHWA 1VQ9S 3CQZB 4YUDA 4NASA 4QU6A 1JMSA 4DR6F 2MXYA 5AKZA 5DB9A 1S1UB 1CRXA 4I4BA 4ZKBB 3HZEA 5HMZA 1WKJA 4KHMA 1U1OA 1X6OA 1TFWA 4NLCA 5AKEA 2DCUB 3EGNA 4MIWA 3U9OA 1SC3B 2VBWA 1F2LA 1LT3D 3KKFA 2F3WA 3J80E 2LQ5A 3H5SA 1N34F 4UB2A 2F65A 2V4QA 3PO2B 5EKKA 5DZ6A 3CPWR 1Q46A 4P0QB 3BYTB 1ET6A 3UDGA 2QE5A 2VIHA 4M8AA 4Z2XA 3ET6B 1W2IA 3V4MA 5L8RC 1YITS 2V8HA 3STBC 3ZDDA 4OHJA 3NTIA 2IC3A 3KHLA 1K47A 3Q8SB 4DV4Q 3BU2A 1Y1WB 5HI7A 3C1FA 3QNWB 4LRDA 4DR2J 1WUDA 2F0WA 2F1IA 3OTOJ 5IOCA 2C1EB 2RKSA 2H5JB 2WVEA 1RYRA 4MH8A 2OEJA 2A10A 3SBMA 2Q0ZX 1FJGF 4PNYA 9ICHA 5J0XA 1A3UA 3E0FA 5J2AA 3L9ZA 2H51B 5DZ7A 1YJWA 3JSRA 2RCFA 1VBKA 1VFJA 5A76A 2MKKA 4NV0A 2V8PA 3DM2A 3W2VB 3MXNA 1TMMA 1Y1VH 3ER0A 3K7UC 4LUVA 5D3GB 4K5VA 4ES1A 1QZHA 4RAUC 3AODA 3MPUB 1PH9A 1A63A 3C15A 4OYWA 2F4VQ 4I2PA 8ICWA 3M2VA 4DPOA 2D5DA 1COOA 4HDHA 2VZ9A 3RRGA 1BBUA 5HP1B 1A3VA 5KFPA 5HVFA 2W2NP 3GTQB 4M9JA 2A2DA 2KCTA 1WSRA 1HNIA 4EYIB 3M7GA 3SQGB 5K8MA 4LZDA 1S0MA 2K60A 3R7BB 1KLMA 1FNWA 5K14A 5LXRA 1MSGA 5J2IA 4FVCA 5A0LA 2K1BA 4I65A 4TLRA 1ZQJA 1RKIA 2HBLA 4DPYA 1X66A 1MD2D 1FRHA 2W9BB 4RGOS 2B4PA 1T9YA 5CHCB 3T53B 2AUKA 3RRHA 2KHCA 2Y0SB 5EKIA 2GVAA 4KO0B 4PWDA 3W66A 2Q66A 3US5A 3T5LA 3CMES 2OTJS 3KUEA 4YFUA 2QSWA 1NK5A 3UDVA 4MKVA 2EOTA 1STYA 4JK1A 3CCZA 4A3LH 3MZ5A 2CQ1A 3CU7A 4G65A 1JLAB 4C8OA 5ITHA 5AKYA 1DURA 1DZ5A 2JXMB 3W3SA 1X3GA 5ELEA 4X62F 1ZQAA 4AT1B 4YY3Q 2XZDB 5KEEA 3C5FA 3CXCR 4RW4B 1N36L 1R27B 4C0OC 2DHAA 2KL8A 3DRRB 5FLXc 4LF8J 2W7PA 3NGRA 4Y34A 2RVJA 2IHMA 5CR0A 2BE5C 5KFWA 3NBHB 3MDAA 2XWXA 1KP6A 2UUCJ 3QUTA 3ZNJ1 4M1KA 2VQFQ 1KBRA 5HATA 2ZBQA 2UUAQ 2Y0SC 4RHSA 4OQJA 2KVCA 2KD1A 1RT5A 5J0OA 3A3PB 3W9IA 2M5YA 1OPZA 3K89A 4LQ3A 1IKMA 1RT7A 4CLUA 2WB1G 3MUTP 1U26A 4IO1A 3PXGa 1FNXH 2MYFA 1EU4A 2LM1A 3Q2SC 4LF5J 4I2BA 3NASA 2P9CA 3S1NB 3QWNA 3R3TA 4NKLA 2L4NA 2V9KA 1Z9FA 1JLBB 4L73A 1WC4A 1JUDA 2H3ZA 1YNJC 2I0QA 4ILRA 2GH1A 3V7LA 1ZQYA 1XR7A 2BE2B 2WVFA 3FRZA 3PGZA 4LFBQ 2XMVA 2J8SA 3KUGA 1XC9A 1EWIA 1HNWJ 1G2EA 2UXDJ 4ZVSB 2RRDA 3KLWA 5BYSA 5EX0A 4DOZA 1X56A 2R93H 3M4OB 1WYGA 4R5PA 4R9WA 5KRUA 4W90B 4TUSA 1C1CA 4Y7NB 1S48A 3NGKA 2CJYB 2F44A 3KDNA 1S5ED 2MUTA 2WF8A 4GNXB 4HMJA 3HI9A 3EVQA 1HQEA 2FVRA 1IYUA 4R0JA 2WB1E 4NLTA 2C3UA 2LQ9A 2UUBL 3HULA 2HKEA 2HMXA 4V0BA 4HH1A 3WK4A 2DGYA 5D77A 2IX3A 5JRTA 1KW4A 2EPBA 5LSRA 1UPHA 5M3MH 3C28A 4DR6L 3V6DA 1HI8A 3A8KE 1CG2A 2WVBA 4YCUA 1F3VA 1BUXA 1TS4A 1EU3A 3CQZH 4IO9A 3MMAB 3L9AX 3KFUA 2YKAA 1A7GE 3E6ZX 1ZD2P 3RMHA 3OTDA 4LRAA 4NI2A 3WKEA 1KC8C 2NZHA 5J2NB 2RBMA 3JPSA 2W8KA 4P0PB 4R4TA 5I9OA 1JB3A 1J6QA 1N34L 4KHPL 2NUCA 2LHTA 4PKDB 2CJXB 2DRBA 4A8OA 4DZ6A 1S1TB 2K7KA 3NGUA 3RB6A 4GNXC 3PO2H 4OYOA 2ZM6Q 3OQ2A 3G8TA 1VI7A 1HR0L 5D65A 2VW9A 1KKXA 2OPSA 2M7SA 4OEMB 2HOFA 4RUHA 3BREA 2I6XA 4JG2A 1OXTA 3HVTA 4IOCA 3DEEA 4FPIA 3GP7A 1KN5A 2F3IA 4B3ML 4DV4J 1VDVA 4DCOB 5KFXA 3H91A 4PGYA 1GXDC 3BDLA 1SQEA 3CCWA 1SYEA 1FJGL 2DEJA 4DQRA 4ZVEA 2M88A 2WF6A 1DK2A 5L1MA 3PYFA 2OD6A 5ETSA 1G4CA 3UXPA 1T3NA 5IYBH 3OV7A 3DM1A 2AW0A 1EP4B 4OYAA 4HT7A 5IS2A 1Q5VA 4POFA 2HNYA 1NMGA 3BSAA 1K8MA 2CQ4A 4GN3B 4PR6A 2KOBA 4EYHB 3BZQA 2IM0A 4LJZC 1OYDA 1HQ2A 1WEZA 2NN6G 2F4VJ 3RNUA 2AMCB 2YNIA 3PACA 2C2MB 1M90C 1SN8A 1VQCA 2I6WA 4PABA 3PYEA 5EPKA 4NYZA 4LNQA 4UB4A 3GTQH 2RQ4A 3S1TA 2NO4A 1TELA 2IT1A 3AUOA 2SDFA 5SZTA 1YDLA 2VOOA 2KN7A 3AMUA 2CJQA 2R7XA 2Z6KC 2LP4A 5D0GA 2DGZA 3KZXA 4XYQA 2NUHA 4F5PA 3ZC4A 4OX6A 1UEUA 4RT2A 4QZGA 1HWIA 1ZM4A 2VJ5A 4J9RA 8ICPA 5IGFA 3KG1A 1L3UA 1RA7A 3DOMA 4RHRA 3P49B 5AM0A 1HNVA 2QL5B 1FKAF 3M6ZA 2X69A 5IYDG 3Q0AA 1EX8A 2K8BB 3ZI4A 2F0UA 1QTNB 2VG5B 3NS6A 3I0SA 4X62L 1J5OB 3NEKA 2B2VA 2RHSB 1RCVD 1SYGA 1LTGD 2IPKD 1NJYA 2JA6B 3DXSX 3LGJA 5I3QA 1ZRNA 2G1DA 1SIWB 2MP1A 3HRZC 2GA7A 4ZIWA 4QOTA 1TL7A 2DNRA 2Z8LA 2EEYA 1W6KA 3I4LA 2CKZB 3NPPA 1ACMB 3C6UA 2ISPA 3ZTPA 2KJVA 4ED5A 5KT3A 2UUAJ 1VMPA 1UWBB 1FRJA 4GKJJ 3H90A 4M6WB 4PHDA 4KGVB 4RQ8A 5E4WC 4X4UA 5JVGQ 4KY6A 2VF3A 1N6QA 1EQMA 2BJ1A 4Y2JA 4KR0B 1OTCA 3MCOA 4XDDA 3WK6A 2MY7A 3SAGA 2JRSA 3IKJA 2M4MA 2VH7A 1GXLA 3HHLB 4CF5A 2M8DB 1DTTA 4ICLB 3L5KA 2NYIA 2CRLA 3MPVA 4Y3CA 1ZQXA 4A3KH 4ZPWR 4HCSA 2BCQA 2BZFA 5CWRA 2RAQA 1I3QB 2VJ4A 3CP8A 2ZDPA 1CTMA 4LFBJ 2VIXA 5IOLA 2CW0C 2GHWA 2AYGA 3C14B 3BSNA 2XLIA 1JJGA 3HOUG 5J0SA 3TBIB 5B0EA 4NMLA 4P2CB 3UPQA 2YKNB 2QLTA 3MUMP 8ICCA 3M4OH 2GNKA 4LFCJ 4AYBB 4KPYA 1FFGB 4AD6A 2XGTA 3KLGA 1A0PA 4IQMA 3A7LA 3HHLC 1M5OC 2X1AA 4M9NA 1LWEA 2W3SA 2D2CC 2DNEA 3G4SA 2DVIA 2OQKA 4ZVOB 4N8X1 4K4HA 2PNRC 2I5JB 3BGFA 5T14A 1WC0A 2Q8TA 3CPFA 1S9GB 3QRQA 1JWUD 2KEYA 2FFKB 2C5CA 2B2WA 1MN8A 3MR3A 1I6JA 3LP0A 4IFDH 3FM9A 4DFAA 4DR3F 4WFXA 1IW7D 3UCZP 1IKXA 1GUOA 1ICWA 1KFTA 1P6TA 3UN5A 3KLFB 1BKBA 3CF5A 1PFMA 1FFSB 1Y1VG 4A3BG 1JLFB 3NG8A 1XNQQ 2B39A 1ZQ1C 3CJ8A 2MJ8A 2CZVC 3QXGA 3W5YA 3G2XA 4EGLA 1QH9A 1FRIA 1PLFA 1Z7TA 2CDQA 4UATA 3RR5A 1E6VB 2OHFA 2NTTA 2W4CA 4AYBC 3VYTA 1GMWD 4ID5A 1D9AA 2OMLA 4A4IA 1W26A 2ZM6J 4GXJA 2Z0SA 1VISA 1STBA 8ICEA 5J1EB 2DF4B 3QX7A 5D78A 4M04A 2MPMA 3T5JA 4QL5A 2Y0SF 3IFEA 3T1HF 1N61A 1EXNA 2A19A 1NPKA 4KLJA 4RFBA 4CT8A 2QEJC 2I5LX 3VAKA 3A8JE 1A62A 2GAGC 3ZDBA 4NY8A 5H2FU 1R8BA 3BSOA 2Z1CA 2F8EX 1ZQDA 3KNAA 3MEEA 4ECYA 3GYXB 1BPZA 2KHDA 5EE1A 3J80U 3MCNA 2JEJA 2V8GA 1XMQQ 1R7IA 3I3CA 2E76C 5K36H 1F2YA