3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
1VQNA 1SROA 4O2DA 4QJFA 2EIFA 4YCUA 3J80c 2KCMA 1IBKQ 3CP0A 5IWAL 4O0AA 3CF5A 1YJ9A 1VQIA 3KF8B 4DR1Q 2E2IH 4DV1L 2XTIA 5C4XH 4LUZA 4JI8Q 2I5HA 4A3KG 4DR4L 1SE8A 4OO1I 4BA1I 3J7A5 3K8AA 2UU9Q 4R1JA 4A3GG 4JI8L 1YZ7A 2BA0A 2K75A 1VQOA 4PZ6A 4TQUS 1PA6A 1Z9FA 4DKAC 3RZOH 3EBEA 4R4IA 1WYDA 1VQMA 4GNXC 3HKZE 2E5LL 3CW2C 3J80i 3M9BA 4DK3C 1VQ8A 4B3SL 4R4TA 5FJ8H 1PH3A 3A5UA 3CC4A 1OTCA 3VDYA 4DV0Q 1PH8A 3CCQA 3CCVA 1WI5A 3GTPH 4BBRG 1X56A 5IP9H 3PSIA 4DV2L 1Y1WG 3HOUH 5M5XH 4DV4L 4A3IG 1L2FA 3S14H 4WJ4A 4DV0L 3OW2A 1X6OA 3E9IA 4HJAA 2JQOA 4DR2L 3I7FA 4A3KH 1T9HA 2DUDA 3I56A 1KC8C 1G291 1K3RA 4HJ5A 4LF9Q 4QY7A 1HZAA 4LF6Q 4LF7L 4LUOA 1J5EQ 4A3MH 1NE3A 1N9WA 4GKKQ 1I94Q 4KHPL 1IBML 1CKOA 1PV4A 4HJ9A 4LF7Q 1Q1BA 4AYBE 1LTLA 3PO3H 1L1OA 4A3JG 4JI5Q 3U50C 3HOVH 1B7YB 3KF6A 4MTNA 4GLXA 3K7AH 1KIXA 2VUMG 2LXKA 3HOXH 1PH6A 1FL0A 3GTLH 2HT1A 3AYHB 5LMNQ 3PCOB 4DV7Q 4LNQA 2AWNA 3F2DA 4DAYB 1VQBA 4YY3Q 2OCEA 4A3EG 2Z6KA 2ZJRA 3CAMA 5C0XG 1K83H 1PHJA 2NVQH 1WCMH 1QUQB 3ULLA 1PYSB 4AIMA 4YHHQ 5C0XJ 1N36L 3FP9A 4GNXA 4DUYL 4A3DH 1YHQA 2OQKA 5IYCH 3J81c 2E2JH 3PUZA 3STBD 4A3IH 4JI4L 2JA9A 4OWWB 5M3FG 2I5LX 3S2DH 3AFQA 5JJKA 1GVPA 2Q2HA 3EN2A 4JI2L 3ER0A 1J5EL 5C44H 4LW1A 5LMNW 3A5ZB 3SGIA 1I5FA 4IFDI 3T1YQ 1PFSA 1GM5A 1G6PA 3U4ZA 2L15A 3F2BA 3KDFB 1VQEA 3UDIA 4QGUA 4LF8Q 2E8GA 2GVBA 4POGA 3PV0A 4Y7NH 2HHHQ 4JC0A 4JI3Q 2UXDQ 4DR5L 1PH4A 2UUBL 3S24A 4PMWA 3K7UC 1UE1A 1YIJA 4TVAB 3GDEA 4K0KL 1JT8A 1YZ6A 5BR8Q 1YJWA 1K8AC 2JA6H 2ZJPA 1YITA 4DV4Q 2PI2A 3I4MH 4IO9A 1KAWA 2ID0A 4A3FH 4OX9Q 5K36G 4JI2Q 3UDXA 1L1OC 4YWKA 1M1KC 1HNZQ 4FDBA 1VQ9A 4DV5L 5IY0A 2PNHA 1IYJB 1LM0A 2GN5A 3PIOA 3KF6B 1IBKL 1HJPA 4A3CG 4UPAA 2C35B 4DV6Q 1WOCA 1UWVA 1HNZL 1L0WA 1N36Q 1SFOH 1YEZA 2UXCQ 1A63A 5JEAJ 4GS3A 3I4NH 1I3QH 2IT1A 2BH8A 3GO5A 3W1GA 3HOUG 3CC7A 2JA7G 4BBRH 5LMNL 2RCNA 4BBSH 3OYYA 2K52A 4POFA 1M90C 2UUBQ 5GROA 4YY3L 3H15A 2ATWA 3M4OH 4QIWE 1CSPA 2JK8A 3CPFA 1XMOQ 1KD1C 4JI5L 1JE5A 1RIPA 2YTVA 4DR6Q 4APVA 1EOVA 4L5RC 1A62A 1U0LA 1Q46A 3M85A 4GNXB 3RLFA 1PH2A 1JMCA 4A3GH 2VZAA 1Q86C 4DR7L 2ZJQA 4IOCA 2OQ0A 4X64Q 1I6HH 1MKHA 1K9MC 1C9OA 2ZTCA 3GTKH 3QSYB 3KJOA 3M4QA 3RLNA 4JI3L 5IYDH 4L5QA 2Q2IA 3JAMc 5C0XI 1B8AA 3D0FA 4MZ9A 2KCTA 4DUZQ 1E3PA 1ASYA 1KXLA 2OTJA 1V43A 2UXBL 1D8LA 2NN6G 1KQSA 4DV5Q 4JI6L 4B3TL 3CMEA 2I5MX 2PI2E 1KRTA 3TEHB 1N34Q 1SN8A 1NY4A 4NPSA 2A1AA 5M3MG 1XMOL 3BU2A 4LFCQ 2D62A 4X66Q 3PUYA 4BXXG 4KLKA 4BBSG 1NJIC 4LFBQ 5FLMG 2JE6I 1XPRA 1S72A 1EUJA 1VQ4A 1N8RC 1JJCB 1GO3E 4JCVE 3PF4A 1Q12A 4ME3A 4KI0A 4A3CH 2H5XA 1XJVA 2R7FA 1CKNB 3AFPA 2ZM6L 3U58A 3CCMA 2BA1A 2F4VQ 4A3FG 4B3ML 1PVOA 2YTXA 4JI6Q 4HIOA 1J6QA 2JA6G 3S2HH 2IY5B 3M7NA 2UXCL 2F4VL 1VQCA 3TRZA 3BZKA 3GTQH 1N32L 1H95A 4NXMQ 4P74A 1HZBA 1HNWL 3H3VH 2YTYA 4LF9L 2WAQE 1OXSC 4DUYQ 1X3GA 2EQSA 3I2ZA 3PUVA 2UUAL 1UE6A 5FLXc 2N3SA 2A19A 1IBLL 4NXML 1GD7A 4X6AH 4J15A 2DGYA 3T1HL 2PQAA 3NBHB 4DR3Q 3PO2H 3TS2A 1K0RA 1BBUA 2AWOA 1TWAH 1WFQA 3KLWA 2JA7H 2UXDL 3TS0A 1XNRQ 4A76A 1IL2A 2NZHA 2R7ZH 4LFBL 1Y1VH 1BBWA 1EIFA 4P72A 5HGQA 3J7ZC 1YJNA 1VQLA 4IOAA 4XIGS 4X62L 1VQDA 1SLJA 1WCMG 1WJJA 2F52A 2HIVA 1EQRA 1E7ZA 1VS0A 2MFIA 2UUCQ 4LF8L 4QQBX 1VQHA 3STBC 4A3LH 1HNWQ 3G6EA 3PGZA 2KHIA 2MQHA 3A74A 4IFDG 4JV5Q 2K14A 4IPCA 4B3RL 3CCJA 4DV3Q 1FGUA 3EIVA 1G51A 1YI2A 4C3IH 1UE5A 1SR3A 2K5HA 2VQEQ 2QA4A 3MXNB 1IBLQ 1X65A 1SRUA 5IT9c 4P73A 2CKZB 3OTOQ 5IYBG 2AHOB 4DV1Q 1EYGA 4B3SQ 4L5SA 3NEMA 1I50H 4JI0L 1MIUA 4GOPA 2RF4A 1LUZA 4JI1Q 4LF4L 1X3EA 4DR6L 1NMGA 5C4JH 4IPDA 1FJGQ 4AQYL 3CD6A 1YBYA 1MJCA 4IJHA 3IRBA 4GKJL 4XTCS 5BR8L 1PH9A 3CCRA 1R9TH 3WWVA 1MJEA 2NN6I 3FKIG 4WJ3M 2K50A 1AE2A 5IWAQ 1TWGH 3HKZG 2NVXH 1XTDA 4A4IA 5GAGC 3G48A 2PQAB 5AJ3L 4DAMA 5M5YH 3S1QH 3H0GG 4HJ7A 4A3LG 3G71A 3RN5A 1W3SA 1TWFH 5M3FH 2VNUD 1OXVA 2B3GA 3OTOL 4DR4Q 1FVIA 1P8LA 4KHPQ 3PUWA 4K0KQ 1OXXK 1QZHA 1EFWA 4BA2I 4OX9L 3GTGH 5ELOA 4C3HH 1C0AA 3L0OA 4GN4B 2JEBI 1CUKA 2NZOA 4AQYQ 1JJ2A 2Y0SG 1A0IA 1EIYB 3JC66 2AMCB 3K80C 3S1RH 4GKKL 4DPGA 4JI4Q 3RR5A 4LFAQ 1HR0L 1CKNA 1VQ5A 4JI0Q 2QEXA 1PH7A 4B3TQ 2IX1A 3HOXG 2VL6A 2HIXA 2VS1A 2N49A 3L7ZC 2VW9A 1XNQQ 2Z0SA 2JA8G 4A3BG 3PUXA 5C4XG 4A3JH 3HOVG 2RHSB 4DR3L 3S16H 4OO1G 5IYBH 4IJLA 2R93G 4B3RQ 1Q8KA 3CMAA 1C7YA 4JV5L 2N8NA 4JBMA 2R7DA 3I55A 2RHQB 2ASBA 4DK6C 1QZGA 2ALYB 2IX0A 4NXNQ 5JJLA 1N33L 2UXBQ 4X62Q 1VQAA 1K8GA 1HNXQ 2UU9L 5GAEC 2CQOA 2D0OA 4JOIA 2WP8J 2CWAA 3HOZG 4R4QA 1KHIA 2R93H 5IP7G 3HOWH 2JJQA 4IFDJ 1RL2A 2WFWA 5E7NA 2ZTEA 1AE3A 1SMXA 2AKWB 5M5WH 5FLMH 4A3BH 1Y1VG 5IP9G 3H3VI 2PMZE 1FJGL 3U4VA 4DV3L 2R7ZG 1EWIA 5GQOA 2NVTH 4BY1G 1XNQL 4HIKA 3W5OA 2LXJA 4DV7L 3AQQA 3BZCA 3JAMi 2CWPA 3CPWA 4X65L 3PIPA 2R92H 3CQZH 1CKMA 3BJUA 3UDGA 3ULJA 3DM3A 3DLLA 1HH2P 4JG2A 2QGQA 1Q82C 4P75A 3UE1A 1NTGA 1YHAA 1O7IA 2YYZA 5ELNA 2D0PA 4DV2Q 2Q2UA 4LF6L 3F1ZA 1X9NA 1U5KA 2Q2TA 4RG1A 4DV6L 5DLQE 1VCIA 3H0GH 4YCVA 4PZ7A 3TREA 2VQFQ 3S1NH 5JEAG 3Q8DA 3ZJYC 4NXNL 4NB3A 2UUCL 1Y14B 2NVYH 2I0QA 3CCSA 2MO0A 2IHFA 3MEFA 4UP9A 3T1YL 1QVFA 5H1SE 2ZTDA 4GLAC 1I94L 2FXQA 1IZ6A 5C3EG 1KL9A 3UE0A 3KFUA 3I4NG 2B63G 4LUVA 2LSSA 2N78A 3S17H 4BY7G 2JA8H 1Q1EA 4R4CA 4RMFA 1E1OA 5HY6A 3CCUA 3RLOA 1S40A 1X3FA 4JI1L 4C2MH 5AJ3Q 2E2HH 4JOIC 1Z47A 2QMUB 1CSQA 3NENA 4A93G 1TWCH 4GKJQ 3I4MG 4JYAQ 3NELA 1LYLA 1JJGA 2KBNA 4GLVB 2VY3A 4GOPB 4DR7Q 1OXUA 4DR5Q 1E1TA 2ZM6Q 4ALPA 1VQ7A 2GVAA 4JYAL 3KOJA 3CC2A 1XPOA 2HQLA 2UUAQ 4L5TA 4JBWA 2E5LQ 3GD7A 4LF4Q 3J81j 1VQFA 3D31A 4GN5A 5GADC 2MNAA 1HNXL 3CXCA 4UY8C 1XPUA 4GN3B 3G4SA 3E9HA 4PG3A 2KENA 3FKIH 1NMFA 4OXPA 1YNXA 2K4KA 3PO2G 2K5VA 1XNRL 5C44G 1NBWA 2HHHL 3KYHC 3ICEA 1N34L 1DGSA 2JA5H 4YWMA 2VUMH 4DNIA 3M3YH 4GOPC 3LGJA 2IHEA 4DR2Q 2CFMA 2YU9H 3HOYH 5JJIA 4A3DG 2B29A 2BH2A 1VQJA 2Y0SE 4A75A 1XMQL 3KDFA 3RN2A 2WAQG 5LMUL 4LWCA 4HIDA 1KRSA 1QVGA 2XGTA 1ASZA 5J3BA 1XMQQ 4R4OA 2R6GA 4YWLA 3RNUA 1VQ6A 2ES2A 4A93H 3UDFA 4IPGA 3CCLA 4YHHL 1HR0Q 4H02A 4P71A 2B63H 4Y52H 1N32Q 4DUZL 3RZDH 1UEBA 2V1CC 4C3JH 3PO3G 3HOYG 1HR0W 2JA5G 1TXYA 4EQ5A 1K73C 4JBKA 4BY7H 1E24A 5C3EH 3K81C 3PF5A 5M3MH 1Q7YC 2YV5A 1JB7A 1QUQA 1EQQA 1UE7A 1VQGA 2K5NA 3I4OA 4OWTB 5IE8A 4X66L 4HJ8A 3T1HQ 1PH5A 3GTJH 2JEAI 1GKHA 3L2PA 4JI7L 4B3MQ 1N33Q 4IPHA 4DR1L 1TWHH 1QVCA 1HZCA 1D7QA 1X54A 4AYBG 5IYDG 2VQFL 3CCEA 1V9PA 2MO1A 4MNOA 1YHBA 2VQEL 1A8VA 1E22A 3F2CA 3FHWA 4UP8A 1VQKA 4LF5Q 1HZ9A 2OTLA 1BVSA 3AEVA 5LMUQ 2KHJA 4HIMA 1L1OB 1Y1WH 4LFCL 3ERSX 4AH6A 4OWXB 4PZ8A 5GAHC 1OXTA 2F3IA 2R92G 4JBJA 4LF5L 4A3EH 5FJ8G 2WB1G 2CCZA 3S1MH 1V1QA 3E0EA 4UP7A 4LFAL 4OONA 1AH9A 2QN6B 1IXRA 1Q81C 3M4PA 3W1BA 3A0JA 3TQYA 5IYCG 3B6YA 3ULPA 1VQPA 1B70B 3GTOH 4JI7Q 4BY1H 1BKBA 2WB1E 3KJPA 3S15H 1YVCA 3HFZB 4QL5A 1IBMQ 1P16A 1PH1A 5IP7H 2Z6KC 4YCWA 3K0XA 4X64L 3GTMH 3HOZH 4BXXH 1X55A 3F8TA 2OWOA 4KHZA 2A8VA 3HKSA 2EXDA 3HOWG 4X65Q 1PYBA 1S3OA 3J81i 5EAYA 4EX5A 4A3MG 1W2BA
chains in the Genus database with same CATH superfamily
2E1CA 1N36J 1TKWB 3KF8B 4DR1Q 4DV1L 2G5DA 5ALDA 4RGMA 3FRPB 1U49A 2E5JA 2BANA 1BF4A 3NS7B 1BUVT 5KG1A 3LP0B 1BDOA 2HDLA 4ZPBA 1NOMA 4UY85 2OPQB 2N3OA 3NUQA 1QVFR 5D4NA 1O7YA 3CCQA 3CCVA 1WI5A 1NK9A 5LXRA 2WOMA 2HSZA 4C8OA 2G2YA 1TQLA 2MQ8A 2K03A 3DNCA 4DXLA 3HHLC 8ICNA 3QJLA 5EPKA 2DR7A 3MM8B 4LJZC 3CJQA 3EVMA 3RW6A 2DYAA 3OGUA 2EPIA 1N5YA 4QZAA 2VU5A 3CWJA 1J5EQ 7ICKA 4W90B 2HOIA 4QZFA 3S1MB 1OUQA 2ZIUA 3A0BU 2CPRA 1CQMA 5KNIA 3I9V9 3IFEA 3W61A 5A8WA 4EQOA 3JPOA 4LNQA 2OD6A 4RQ2A 3E58A 1T03B 3VYUA 4V19X 2Z6KA 1IJFB 2RNEA 2PIIA 1EP4B 2LBOA 3JPPA 1WCMH 2V0NA 1SEBD 2BKPA 3GU3A 4GNXA 1TP7A 1IKVA 3VAJA 1DBDA 3J81c 2YQEA 4CLYA 2RDJA 2J6SA 2HVEA 1J5EL 3J81L 1ZQEA 2HZCA 4M95A 1V3ZA 4F04B 1G4CA 1ZQKA 3N5BA 1O51A 2KOLA 2NYVA 2L15A 4I64A 4LJMA 4KC5A 4H4MA 1M5SA 5ALXA 1PH4A 1WC6A 1YZ6A 3I4MH 1VDVA 1K0TA 4M5DB 3JSYA 5IY0A 3AT1B 3A8JE 3UD3P 3M6KA 4K4IA 1R6YA 3GDXA 5C7PA 2B6AB 4DHVA 2KHDA 9ICIA 4A8WA 1B64A 4CDGA 3HLUA 3JYTB 4LF4J 4KMOB 2M70A 2UZAA 3A3PB 4KTQA 5GROA 3PJWA 3D2QA 3OHXC 1HD1A 3MXNA 1FFGB 5HANA 3GTMB 1RXOB 2XMMA 4BY1B 1UPHA 1KSPA 2G0CA 4OJLA 5HURA 4B17A 2CPDA 1PMRA 3R9LA 2FPKA 2CH4W 4MFAA 2BHNA 3M7GA 1FEHA 1NY4A 4JI0F 3GFKB 4BXXG 4BBSG 2Z9HA 2BJ9A 2XIWA 3CKIB 2IHNA 1GO3E 4Z6FA 3T19A 5GAGI 2V94A 4DBQA 2DXEA 3SEIA 1TS4A 2QGFB 5AKJA 1Y5IB 2GW8A 4CLKA 3NRWA 2GFFA 2DD8S 5FP0A 2XI3A 1ZS6A 3N6MA 2IRUA 4ULLA 4KN7C 2O67A 2A6ED 5ALPA 2UUAL 3I2ZA 4DSEA 1WSVA 3M4XA 5FLXc 2Y0BB 4X6AH 2B3TB 4J15A 1RDPD 4P2MA 2F8LA 1RT3B 3PO2H 4DV7J 4MJKA 5IIFA 4EK2A 1AROP 1EWHA 5BOLA 5AK5A 3FDSA 2QMWA 1F1BB 1R8CA 2CFXA 5BYSA 5MLCV 2ZDOA 3GV7B 1VS0A 1M1GA 3FRZA 2HFZA 4XXEA 3OHBA 3VAIA 1S6PB 4DCJB 2CNKB 2HAFA 1MN7A 4I7FB 3KLIA 2K5HA 3RZDB 9ICTA 2ZXIA 5IT9c 5IYBG 2AHOB 4PHEA 2VBXA 3TI0A 4MKBA 2VG5B 2R2TA 2O6KA 1WELA 2W8KA 4V0BA 2DPJA 4JI1Q 3DU5A 2A73B 2KSOA 3NCRA 1FJGQ 3UDEA 5HNKA 3G6YA 1RLDA 3QQCD 1K73T 3KLGA 3HFVA 1VQ9S 3CCRA 4NXMF 4IOAQ 1GH8A 2HGLA 5JJKA 5GAGC 4DAMA 5IM0B 4NLKA 3H0GG 4M9HA 2D69A 3FPPA 1GNKA 1FVIA 3D6MB 2D9PA 1PJ6A 4DF7A 1M5HA 3KDNA 5KT7A 1C0AA 1CUKA 1JJ2A 4P7VA 5JVHQ 3JC66 1DQAA 3NMAA 3S1RH 3KJVA 5G3LD 4ED1A 4B3TQ 3ETMA 2P5VA 5B0CA 1NUCA 4ECXA 1FRMA 4UAZA 4RUAA 2DK2A 1RHPA 2AU0A 2IA6A 1CC7A 3NTIA 2ZZMA 4MIWA 4Y2SA 3AQOA 2DIVA 2K8AA 3GJSB 3JS9A 1FJGF 2DR9A 1FWLA 2RKSA 3QWUA 3NNHA 3GYNA 4NRUA 1HUOA 3BZCA 2OTLS 1AN8A 2BE2B 4Y3CA 4ZJQA 1W2IA 2B4PA 3S16B 4I67A 3L9AX 2K4EA 3BJUA 3UDGA 5ETTA 4RX6A 3WK7A 3AU7A 3QWPA 5CYQB 4K5RA 1WC4A 2NRZA 2YYZA 3R2TA 4LF6L 3DFEA 2W4CA 2EFPA 2KK0A 4K5VA 1N0UA 3PMNA 1UA1A 5CYUA 1U1RA 2W3RA 3V6HA 4U7CA 3HHLB 3T6JA 2MO0A 1UTAA 2FGCA 3T1YL 4CHTB 1E6YA 3UI3A 9ICUA 3UE0A 2PXIA 3U9OA 4I2QA 5F8HA 2ILYA 4P2SA 3OWEB 1RQ0A 1T02A 2OHDA 1E1OA 2LLZA 2OKQA 4C2MH 4F5PA 3GP7A 1LT4D 4RWXA 3MEEB 3TMEA 3NENA 1Q0NA 1BWVA 1S0NA 5FDLA 4X4TA 3FFIA 1JJGA 4CJ0B 1JI7A 5I9PA 3GLJA 4S0MA 3K5OA 3C2PA 2VUMB 4KFBB 4DV4F 4Y2YA 5AI5A 1OYDA 2HPUA 1LW0A 2D8CA 1LK7A 2J0SD 1EY6A 3HD1A 3K59A 3D6JA 2JA5H 3H09A 5J2HA 9ICQA 3H2LA 1ZQXA 2OT2A 1U8WA 3K5NA 4OZ0A 3RJGA 5CYMB 5EJWA 3IAS9 1WTOA 1Z00A 3HP3A 4IZ8A 2C2MB 1HHVA 3QT6A 4NM1A 4KB7A 4A8SA 2FHJD 2KVSA 2ZKUA 2XVSA 2KZMA 1N32Q 2WONA 3N4MB 2V1CC 4BY7H 4LBHA 2J7UA 1UE7A 3P45B 3CRKC 3L2PA 3MTKA 2Y9HA 1RBAA 4I2BA 1KKHA 1R6VA 1E22A 1S1VB 1JRPA 3I4HX 3HRZC 2B8PA 2DHAA 1NM2A 2CWKA 5G0RA 1P8GA 4LF5L 3G9CA 4QWCA 2R3ZA 1C1CA 1V1QA 1TKXA 5KFWA 3WK5A 3EMTA 2CNOB 2UVWA 2C3YA 2Z4HA 4K5XA 4UZBA 3H40A 2EE1A 4DR5J 3TZUA 2A8VA 1YNNC 1FKOA 1HA6A 1PJ7A 1KLUD 8ICHA 5DEHA 1JLCA 2WB1F 1LWCA 4BBSB 2CG4A 1DAXA 4N7TA 1ACMB 4RNNA 4JI8F 5ALUA 4MHEA 2XTIA 1APSA 2EBGA 2OPRA 4PYAA 5D6GA 1JJHA 3DI6B 3MCSA 3J7A1 2E3TA 4I2AA 3A3NB 4PZ6A 4TQUS 2YMQA 4GNXC 4PV1C 4HI2A 4DK3C 2OSQA 4B3SF 2KYZA 4LF8J 1TWHB 3WK9A 4U96A 4QWEA 3FBCA 2XZWA 4QUFA 4ILRA 3J7YI 1KC8T 4N76A 1B4FA 4QIWD 1T9HA 1MROB 2PFPA 1VLOA 1ZZFA 4Q0FA 3SK8A 2I0XA 4IG0A 2JWNA 1IV8A 4RCNA 4HJ9A 1KN6A 2HK2A 1RWOB 3K4GA 2YNHB 4R63A 3FPUB 3V6JA 4EEKA 3U50C 4I28A 5IGFA 3K7AH 1TU0B 4C3IG 2F3WA 3BN4A 3AYHB 4FYYB 4DR3J 3EGZA 2YX4A 1KLGD 1RT7A 4DFAA 1VI7A 4C0BA 3LAMA 4RPXA 1F2ZA 2OF1A 2FC9A 3ZZZA 2CN1A 1IN0A 3R5CA 3CMQA 4YHHQ 1JB3A 3OFEA 2B0GA 4J03A 1TU2B 3QGIA 6FDRA 3J7YW 3IFTA 2OI2A 1DQ9A 4FNFA 4NA1A 3ER0A 3N9UC 4F5NA 4KPCA 4K7QA 1GM5A 5AFWA 3H8WA 1VQEA 3TOQA 4ANDA 2O5IC 1FFWB 4YHHF 1F2MA 4WU3A 3SI8A 4DQIA 4TVAB 4DV5J 2PI2A 4J1MA 4G1PA 4XQNA 1RDFA 5JPNC 1FWPA 4UPAA 2MU2A 1LV9A 4JYAF 5IV4A 2W25A 1TVXA 2IT1A 2BH8A 3IAM9 4FYWB 5LMNL 1KLMB 3AM9A 4KJIA 1M90C 3H15A 1WTHA 1WUUA 1JE5A 3RRKA 4APVA 4EX6A 2QILA 3HKZC 2ZWOA 3BVGA 5LSRA 4DR7L 1TAQA 3C14B 3SMVA 5J2JA 1SJ1A 5G3LF 1WTWA 1BWEA 2HW3A 5IYDH 1R3NA 2HBZB 2C2NA 1WCNA 8AT1B 4DUTA 4JI2J 5ETVA 1SN8A 4NPSA 3BU2A 5GTHU 4IS7A 4X66Q 1S72A 4GXJA 4NLTA 3ZZTA 2KVQE 1YLXA 3BR8A 4KGVB 9ICMA 4ICAA 4A3CH 1VK8A 1VLBA 1HQRD 2BA1A 3EVOA 4PWUA 1V3SA 4ZN3A 1NZPA 5AI8A 3MM9B 2EFQA 2H3ZA 1N5VA 5KFNA 4WFZA 4LF9L 2VC1A 5KYLA 2V4DA 2A19A 1IUJA 4E98A 4UHVA 3PRDA 4PHAA 4QZHA 2PPBC 1IKXB 2FVPA 4LREA 3PSTA 1LT6D 5ALLA 2QV6A 3MDCA 1S1VA 3URYA 2VC0A 2KFNA 1RSCA 3ZD8A 2H3QA 2Q8RE 1VQHA 4CDFC 1AW7A 3A74A 1XO0A 3DN9A 3QYPA 1VBYA 2H3VA 2W03A 4JI0J 1JWUD 4NW2A 4N41A 1MU2B 2C1EB 5LJ5Y 2JLFA 4RNHA 3DOLB 1MIUA 2LMCB 2OELA 2NRVA 4F7XA 4I2PB 9ICKA 1NJZA 1T95A 2GVZB 1JXVA 2R4FA 1HCZA 4F4WA 4PJ0U 5BR8L 1PFNA 3DYAA 4HEDA 5EE1A 3I82A 2K50A 2F8MA 3EUB2 3Q89A 4A4IA 2BRKA 1L6NA 1HYSA 4YDXA 1SMYD 2HBKA 4O9MA 2GMLA 4PG6A 1RWKB 4F88A 1S12A 1YJUA 2MQMA 3VQTA 2DKOB 9ICPA 4ZPCA 1U26A 3ZC4A 3HKZD 2R18A 4B9XA 1SZPA 5KFXA 4KKTA 1PILA 3RRGA 2KFZA 4RR5A 5C4XG 1M0SA 2F8KA 1N48A 2XZTB 3WX8A 2LEAA 4X62Q 1U47A 4R4QA 3I9ZA 1N56A 5E7NA 1KHWA 3EUNA 2IJNA 2RF2A 4U7UD 4NASA 1HUNA 5C2CA 2ASYA 2XGQA 4G7HC 2J9DE 4FBTA 5ETMA 4EZ9A 1PFBA 4NCGB 2A69D 3TP7A 5KFAA 2VQEF 3DRSB 1QJHA 1X2IA 2N88A 3PHEA 2VBYA 1N6QB 1S1WB 3THVA 1DHMA 1YHAA 2PC6A 2IOHA 1STEA 3F1ZA 2AQ2B 1RTIB 2QB0B 3V6KA 5BOMA 1ZYRD 1PLFA 2ZH1A 3CF5Q 2NRWA 4A8XA 1TL3B 2I0QA 1YNJD 3EDQB 1XTZA 4A3FB 4ID5B 4NLWA 2BKEA 3BQ7A 2I1RA 1F9QA 1BCPC 3H98A 4R4CA 1S40A 4JI1L 3NLCA 3U27A 1XTCD 3T53B 3I76A 1RODA 4A8QA 1X5SA 2RRDA 5AI0A 1V3RA 1H7WA 2GVDB 3IBCB 2XO7A 5CZVA 2ZM6J 2AGPA 1Q8BA 3SZ2A 1O5JA 2BXJA 4IDKB 4WXOA 3FKIH 2CPEA 3KUEA 4OHJA 4PMCA 4ZITA 2GAGC 5LL6S 4RW8A 2W2NP 2TSSA 3K0YA 4DNIA 3CCTA 3CSKA 4OGQC 5F9NA 1ICWA 1GMWA 1TR5A 2G2ZA 3UPQA 5ETRA 4C8LA 5ETQA 4QZBA 3QBCA 3H5SA 1PTOC 2KSOB 3RNUA 5AI6A 1C0UB 5F3XB 2PEHA 2J0XA 4Q8FA 2X6GA 4P71A 4JWNA 3M6ZA 3G6JB 1TUGB 5CHGA 2LMRA 4C9DA 4TUPA 3CB4A 2FE9A 3D2SA 2AV5A 1L3UA 2QLBB 2MGSA 1S6PA 1JKHB 2EC2A 4EELA 1J2NA 2W2OP 1HZCA 2W7PA 4UBCA 4AYBG 4DV3F 2RIJA 4R5PA 3W2VA 2ZITA 1HBMA 1KABA 3ERSX 2DH7A 1ZM9A 2WVBA 4O5CA 2JLGA 2ATCB 2OHFA 2ZH3A 3E0EA 4CRXA 2HBJA 3QRRA 3FMBA 2ZH9A 3GTOH 3K0JA 1BKBA 2PQEA 1S5LU 3BQTA 1P16A 1JLQA 3W9JA 1D1UA 3MBYA 1D8BA 1F2LA 4EU0A 4DK1A 2RBMA 2WVFA 3HKSA 5ALTA 3G87A 4A3MG 3OFGA 2MQNA 1ZQQA 2MY8A 4QIFA 2XLJA 1KLMA 4CF5A 3HP6A 2YQ3A 2F1IA 2K32A 5C4XH 3VA7A 1FK9B 4I2FA 4JI8Q 1LW2B 3PY8A 4UZCA 3TP2A 4YUDA 3T1HF 4R1JA 3NG8A 9ICSA 1YZ7A 2XZDB 3PNCA 2YNIA 3D3CJ 4ED8A 5DKWA 3M9BA 5ALMA 1VQ8A 2KJVA 4QZ8A 3EVWA 2HS4A 3OW7A 3C6TB 3G8TA 4KLTA 4WZMA 3BQ0A 1VS3A 2ZZTA 1Y1WG 4WJ4A 4F92B 4TU9A 4HTHA 3E9IA 3MEGA 4AL7A 3RAXA 4A3KH 3NEKA 3GFHA 5D4LA 4ZKAA 5H9EK 4IUNA 4LF9Q 3UN2A 4CP5A 3N28A 1HZAA 1XR6A 1F0MA 4Y2XA 3CJ2A 3MR5A 4LF7Q 1Q1BA 2ZEJA 3CIZA 4OYOA 1F5CA 1SXTA 3KFWX 5K8NA 3D66A 1LV5A 2VHGA 5ETSA 1VBZA 1WHWA 1ULRA 4ODGA 4JV1A 4ZCKA 3F2DA 2OCEA 2A6HC 2NVQH 1TL3A 1MA7A 3OR2B 4Q7AA 2YNHA 1M1KT 2VJ5A 4BDPA 2IOFA 4LUBA 3P1HA 2FJ2A 2W55A 3BVMA 4M8LA 1NPKA 5E41A 2Q2HA 4BS9A 2POKA 1QE6A 5J2NB 2F9JA 5AICA 1Q81T 4EYHB 3OHAA 4ANCA 4YXJA 4PNYA 5KFOA 3F2BA 3HZEA 4QGUA 1SYDA 4K6LA 3RW7A 2V69A 3WQPA 2G5IB 1C2PA 3AB2B 4DXGA 3GDEA 2Y0SB 1YJWA 5B7WA 2NSBA 4DV4Q 1HLWA 4EEYA 8ICWA 4FDBA 4FNHA 2KA7A 2QZ8A 4N8OA 4OFZA 2KCCA 2BA9A 1SH3A 3GZ7A 3ZZRA 4Y2PA 4NZ6A 4XQ8A 1CTMA 1JLCB 4DG1B 4CTAB 3NXWA 1K8MA 3GR1A 8ICRA 1SXLA 4NYPA 2QL9B 2PA8D 4USIA 2AQ1B 4KX3A 3LX0A 2DNCA 4A3BB 1JLFB 3MAAA 2PNRC 2K4IA 1KN5A 3IM1A 4F26A 2R93B 1RACB 4KHVA 3QIPB 3TEHB 1ZQMA 1NSKL 3M30A 1FHTA 3UO0A 2AYEA 3S8SA 4M5GA 3MXHP 2CPXA 2FZKB 5AIBA 3BH7B 1WJ9A 2RS2A 2ZM6L 5HK4A 1Q53A 4HIOA 3GQBA 9ICXA 2AJFE 4O23A 4NLRA 3FQLA 3ET6A 2QX0A 3OXGA 3VZHA 2IX3A 4UB3A 9ATCB 5CYMA 4ICLA 4C4WA 5I3UA 1GTEA 2PMZD 2FUG9 3QNMA 2LI6A 4ZVRB 5CGKA 2F2AB 2HDMA 4TKOB 5GAHI 1SXEA 3AB9A 4IFVA 2OFGX 1CFMA 4CM2A 1Q4RA 5C25A 4K8JA 4JV5Q 1B7FA 4IPCA 5HQ8A 4I65A 4Q43A 3SBMA 2BOSA 2HFNA 4B3SQ 5L1LA 4ZVQB 4K4YA 2K1RA 4DU8A 1C0TB 1UVKA 3P4UB 1WTXA 2MAXA 1WF0A 5C4JH 1B99A 2HNZA 2RILA 2KHQA 3PFOA 3LGMA 1QD1A 3UWTA 4FBUA 4N56A 2MDAA 1FDNA 2KJWA 4XTCS 3RB0A 3ZTPA 2E7WA 5ALYA 1WC0A 1XTDA 1COKA 4ECWA 2RDIA 3L4PA 4HJ7A 2B9EA 2R2UA 1I4GA 5L8RC 2HCCA 1W3SA 4J9RA 2CKWA 1YDLA 1VF7A 1I3OB 4WU2A 2DGQA 1VQ5S 7FD1A 1SZHA 2LXIA 1VF5C 1GX6A 1PRTF 5A8KB 2CQIA 3B4MA 4TYBA 2AJ2A 4OX9L 2YQ0A 1WD0A 1X4DA 3C14A 4F5QA 3WKAA 2D7SA 3KUGA 2Y0SG 3N0VA 1EYDA 2L9HA 2E1AA 2EY5A 2WKDA 5AKYA 1IBLJ 4P0PA 3M1VA 1CKNA 5C4ZA 1G91A 6FD1A 1EZ8A 4PL1A 2Z0SA 1B22A 3BR9A 3BDCA 3C66A 2O01C 3HOVG 1AUSL 1I94F 1C4QA 1FX2A 1C7YA 3PX0A 3CMAA 4CIOA 3TAMB 2RUSA 1URNA 4F4YA 1SNMA 2IX0A 3EFXD 5D4PA 5LSLA 2EEYA 1VQAA 4K4GA 1K8GA 4YXMA 1S4FA 2JJQA 3BGRA 1ZA1B 3FEZA 1ZQZA 4DF4A 5GMEA 1WI8A 3DCAA 2F76X 3D2WA 3NBPB 1IWAA 2AZ1A 2YWGA 1VIXA 1MMLA 3GMGA 3Q8PB 2B8FA 2HBLA 1CKMA 3HM9A 2F63A 4RBUA 4UARA 1RD9D 1WKLA 3D1QA 1BPYA 1GQEA 3QZ7A 4QYZK 2EG1A 4J9PA 1KBUA 3JPRA 5HLFA 3V81A 3PFEA 4EYIB 3BGUA 2GWSA 3K2YA 1GUOA 2UUCL 2KVIA 2QT7A 2EKNA 5KG4A 2L0CA 5K4LA 1O03A 1A6XA 3A8IA 3TP6A 3QLHB 4B9LA 1OSCA 3I55S 3GV8B 1KFDA 2W9MA 2CNLB 3MWBA 2QMUB 2RQ4A 1M5OC 2DR6A 2I9GA 4DXFA 1L5UA 5I4DA 5HBMB 1ZXTA 3MHBA 4F8MA 4J9MA 3KBXA 2DH9A 4MIAA 4JBWA 1G6BA 1VQ7S 5KG3A 3GD7A 2RQXA 4GN5A 4E8UA 2MNAA 3P5TL 2KB2A 2CQ2A 1ZQLA 2HFVA 3N6NA 1X60A 1WOOA 4I7AA 1S0OA 2K3IA 2K6AA 1M5KC 1RAIB 2VKZG 4UB6U 3CDWA 3LGJA 4ID5A 2CFMA 3V2TA 5H9FJ 2YN4A 2XSFA 3QOJA 2IC3A 1MC8A 4WRDA 3M6UA 4P4OA 4JI3J 3P6YC 1PVPA 1YQHA 3AQEA 1X6JA 2R6GA 4RL1A 2NXEA 3J7AF 1MHWC 2X6LA 1S1WA 1NB2A 3HHEA 1N6QA 1NZAA 5IGGA 1FFSB 2V8GA 3KLSA 5C3EH 1EKSA 4IN3A 2GOLA 1HQ2A 3GTJH 1K83B 2BQRA 1HIWA 3THPA 2KYXA 2CW0C 1L3VA 1SH2A 4KBIA 2UUAF 3MM5B 2PZWA 4F91B 2QFIA 4RW7A 1X32A 2KTQA 2M0NA 3ZDCA 1A8VA 4N8X1 4UP8A 3G4SS 4YMNA 1O0PA 4PYDA 1RWVB 4A3EH 2QW7A 3DM1A 2V8PA 4CJ1B 4LFAF 1FKPA 1H2UX 3W1BA 5HQLA 4QJFB 3CCMS 4LF8F 2LHTA 2C2KB 4QR0A 1YVCA 3HFZB 1IBMQ 2XMKA 5DBCA 4X64L 2VFRA 4ZLPA 4DK0A 2FHJA 3UVJB 4ZMMA 4WK3A 2RP5A 2NXJA 3RJIA 3D4WA 3NE5B 1MNEA 3PRBA 3JYTA 2CVRA 4WBFA 3D68A 5BJRA 1YJ9A 3BREA 5GVQA 2NV3A 9ICEA 2N55A 2YWFA 2JC0A 1Q5VA 1S4ZA 1VRTB 4S3SA 4EUVA 1S8OA 1DLOB 3I4MB 2F1JA 3KHLA 5A8RB 1PH8A 2JNJA 4C2MA 2DRAA 3C1YA 2RDDA 2W9BA 1S9FA 3OL9A 4U95A 3NGSA 1K3RA 5IIKA 2XO6A 4GKKQ 4C7ZA 1G2TA 3CCLS 4MKYA 2Y9UA 1CKOA 4GZYC 2HFUA 4A3EB 2RUGA 3HOVH 3DDIA 2G06A 1UT8A 1KIXA 3CRXA 4C56C 1IM6A 1GOZA 2RF2B 1ONLA 2ZJ8A 2MHVA 2PE8A 1S5CD 2DEJA 3T13A 4YCXA 3C15A 1QTMA 1U0HA 1PYSB 1WOPA 4KRWA 1HNWF 4FXKC 3DRRB 1XNSA 3UMGA 2KHSA 2J9DA 3PUZA 1S9EA 3W9IA 2E29A 3Q8VA 1MGSA 4RFBA 3LF0A 2RHFA 5B0AA 8ICYA 4XUSA 4LT6A 4WYLA 3SGIA 1I5FA 5JAVA 4QIVA 1XO1A 1CQFA 2K4PA 2XQCA 4UTGA 2MZJA 4NLXA 3UQ2A 3WKCA 4GFJA 3K7UC 4LF4F 1JT8A 4G1IA 4QWDA 5IWAJ 3HHNB 1IM4A 2BX6A 4OX9Q 2E9ZA 1H72C 4JI8J 1KRPA 4B9VA 3VR6A 3PW0A 2LYVA 5JEAJ 1I3QH 2LYHA 3BO2A 3CC7A 1IYVA 4BBRH 3T4AC 2P9CA 3OYYA 4NLYA 2IJRA 3VA5A 4F4KA 1PTOH 2H3IA 3QWNA 1B9NA 1RIPA 1M8AA 2QE5A 2F0IA 1TWCB 3M85A 1BNPA 3HZGA 1UW4A 1OXJA 1E2WA 4GKJJ 1FDAA 3GTKH 8ICMA 7ICPA 3BGFA 4MAKA 1U4MA 4UOCA 3WX4A 4LIWA 1HARA 1RT6A 1KXLA 2F65A 1V43A 1G3OA 4DV5Q 4X4QA 1FFVA 1DOKA 3MR6A 4FO2A 4PXEA 2HQCA 3LWUA 5CR3A 3NP5A 3V81B 1RYUA 2CQCA 2OH2A 2XIDA 4HVZA 2KN7A 4R8UB 1SYEA 3SDZA 1BCPF 3SENA 3JPQA 3U58A 1RZMA 3TAPA 4CO0A 3D4RA 2HCFA 1NR4A 4B3ML 2JX2A 2YTXA 2E74C 4DOBA 2HHTA 3GTQH 2DXFA 2NTSA 4GIBA 2M9KA 1EXNA 3SK6A 5DO2A 2MKIA 3MECB 1RU1A 3BO4A 1ZJNA 4USWA 4DR3Q 2MKCA 2Y1RI 2BABA 1NSNS 1XNRQ 2CYYA 2FMPA 3BJYA 2CADA 4DPTA 3NVWA 4P72A 1YJNA 4XIGS 4X62L 1VQMS 4X64J 2UUCQ 3OL6A 4RWSC 1SL1A 5E79U 1HNWQ 3BQ1A 1U6FA 1JK9B 4LF6J 1XMOJ 4DV3Q 4NXZA 1F9SA 1ENCA 1MI2A 4ZPAA 3KK2A 2A3JA 4DV1Q 9ICBA 1XN9A 2DNKA 2RF4A 3AQFA 4LBPA 2F0VA 4EGLA 3MD3A 4U9RA 4UAWA 1MJCA 4KITB 4YFUA 4ZIWA 1JLGA 1AE2A 1B0VA 3DI6A 3NVVA 1CI4A 1JMSA 1PYOB 2V4JA 1VHFA 2WIIB 1RT4A 3Q2SC 1P8LA 3J81U 2ZBRA 3LGHA 1LWCB 1C0TA 5IT9Y 3EPGA 3GTGH 4UAYA 1PRTB 3I3CA 4ID8A 3V72A 1FYCA 4HDGA 2QMXA 2FMQA 2HRTA 1CK1A 2RDHA 2VG7A 4ME5A 1MLAA 5D46A 1LTID 2KIWA 4LFBF 2YKNA 4H4KC 3C16B 4JBMA 1NPRA 2GQ2A 4L63B 3JSRA 2G13A 4RBTA 4IRDA 4ICLB 4UOHA 2D0OA 3HOZG 1RT7B 5IP7G 3AUOA 1Y3JA 1AE3A 1U6BA 2RH3A 2PMZE 5I4MA 4K50A 2XLKA 2NZ4A 2VZ9A 3N7RC 1H98A 2GA4B 3SQGB 4EBDA 4ECQA 3K58A 2PO4A 5EGYA 5H1SV 3SYZA 3N97B 3ONNA 4IG0B 3TUPA 2KJ8A 4ZJOA 3FSYA 1NCLA 2HMIA 1GO3F 4HSVA 4YCVA 3PZPA 3RTVA 4K59A 3J7ZT 4ZAIA 3RJJA 2O5JC 1ZQHA 3MAQA 2E5HA 1NSQA 1S1UA 1IBMF 3KJNB 5L9XA 3MAAB 4CKEA 4DN4M 4FF2A 2B2VA 3PRVA 2CJKA 3P75A 3DRXA 2MB0B 4DUZJ 4JI1F 2AUJD 1Z47A 4KSEB 2ZIUB 5E3FA 4DUZF 4JI1J 1OSDA 1TL7B 4F2SA 3NELA 1AP0A 4DG1A 5C0YA 1LFPA 3AMUA 1L7PA 3SXHA 2ACYA 3EX7B 1XSLA 3SHLA 3D31A 3NTUA 3CXCA 2R8GA 3L9ZA 2KENA 2MZSA 1SAPA 3H7HB 2J0WA 4EZ6A 2WBMA 2GNKA 5KFRA 3T56B 3LWMA 3D4DA 3ICEA 2KH9A 5KG7A 4EGVA 3DOMB 3M3YH 7ICQA 4PRFA 2YH1A 3C8YA 4KE5A 1KVIA 5G0RB 3F5AA 2BCQA 3KK3B 5D78A 2KEEA 3PKYA 2CPJA 1KRSA 2DNGA 4B3MJ 1NKCA 3PIOQ 1XMQQ 3NNCA 1VJQA 1S6QA 3PM9A 4BWGB 3S6JA 3MCNA 4ZPWR 2G09A 4FNIA 3HOYG 4YIJA 4NI2A 4LVOP 2UXCF 5FKAC 3TJ9A 1HW9A 2FC8A 2DJWA 3MOJB 2ZJQQ 1PUZA 1E2VA 4O3NA 4HL9A 2GO7A 2E66A 1N34J 5BN4A 2L3MA 3PMLA 3ZZYA 5LL6X 1KLNA 3UDCA 4ZLJA 1TMJA 1EARA 1PYWD 4QPTA 8ICAA 3M4PA 2VOPA 4ES2A 4JP8A 1HFEL 1FDDA 3OVAA 1ZM4A 2LKVA 4QL5A 3S15H 4DQRA 4CDDC 2FPLA 1E6VA 4YCWA 1EWCA 4OYXA 2IIHA 4KFBA 1PYBA 1GUGA 2C3MA 3UN5A 2Q4TA 1XMQF 5TISU 2D2CC 1TFWA 1DYQA 2IPOB 3QFHA 4Y2UA 3C6TA 2FLLA 1RAEB 1S9GA 1PVQA 1E0BA 1FD7D 3KZXA 1SE8A 5KFSA 1R0BG 3BKTA 1ILQA 2ZXHA 4UY8C 1DZ1A 2GC8A 3HDSA 3CW2C 5F8GA 1N8RT 2HHXA 2AEMA 3VDYA 2GJ2A 2KNJA 1FJGJ 4FZNA 3R1LA 2QARB 1LOUA 4L73A 1RYRA 2MZQA 3SCLE 2Q6BA 2Y0SD 3GE9A 4FS2A 1LABA 4CRJA 5D15A 1RISA 4LF6Q 1NK6A 4X4UA 2EK1A 1F5AA 2F0FA 1HNWJ 1B0PA 4ZYSA 1IBML 3MPDA 5E5NA 1HWIA 3BS5B 1LTLA 3SCJE 1HBMB 2V9WA 4FKYA 1B7YB 2LDYA 1ZQCA 2LXKA 2AGOA 2NPIA 4QIGA 4WP9A 4X62J 3M8YA 2AWNA 3DLGB 1VQBA 2Z2MA 5C0XG 1PHJA 3CJTA 1N33J 1N36L 2IBOA 4GKKJ 5EWFA 5ALIA 3O8WA 5KFGA 1BR9A 4FF4A 1GXLA 1Z4NA 1PVRA 3ZNUA 3TEGA 5C44H 5K8OA 2MJUA 5IT9E 3CVKA 1DFDA 2MUYA 2OJ3A 3T1YQ 1PZID 3GIMA 2BE5C 3VVUA 3U4ZA 1WWVA 1VDHA 2PGCA 1ZQPA 2UXDQ 4F25A 5A8RA 1GXTA 1YIJA 4FXGC 3EGWB 1MWZA 2ZVSA 4CLLA 1Z4UA 4ZPVR 2FINB 1IBKF 1UVLA 3BSAA 4G1QA 3MXGA 1Q3UA 5HN0A 5C4HA 1YEZA 5JVH3 3H0GB 4GS3A 3GO5A 5E33A 3W1GA 1QAJA 4C8NA 2GVDA 2KL8A 2UU9F 2RDGA 4DPYA 3VR1A 1FRXA 3TNVA 2EYOA 4BXOB 1W6JA 3KLIB 4I7FA 4OV1A 3AD9C 3BYTB 1C9OA 4PGXA 1FE4A 1DRZA 4LK1C 1ZAXA 2ESEA 4KYZA 3V7JA 3D67A 4MEYA 4PQUB 1CZGA 3D0FA 2RQMA 1Q3LA 2VFTA 3CCZA 1W2BR 3DKDA 4OX9J 3ZDDA 2VB3X 5EN1A 5E4WC 3CMEA 4CE6A 2D62A 2W54A 1OJ4A 1XPRA 2HK3A 4J7CA 1N8RC 2J0TD 4ECYA 3M8PA 3AMZA 1U45A 4I2HA 2ASJA 4DAVA 2ZH8A 3JXOA 2BMBA 3QFWA 5ALZA 3M7DA 2WKCA 3M8WA 4KR0B 3DOKB 1H2VZ 5KNCA 4Y2VA 5AXKA 3KG4A 2F4VL 3UXOA 1QVGR 3BEGB 3H3VH 1UEUA 3SXLA 1AFPA 2N3SA 5E3AA 4NXML 1GD7A 2ZHOA 4DNRB 1F5SA 1QCBD 3RJEA 1WFQA 4WE1B 3BS5A 3H2UB 4DV6F 1VISA 1BBWA 2P6TA 1KQQA 3IG1B 2NTTA 2F52A 2GMHA 3I0RA 4HYKA 3IP4B 2K14A 3AU6A 3J80L 1SR3A 3MXNB 1RA7A 1SRUA 4P73A 4F67A 2BDOA 3J7YU 5DDYA 5THWA 1J97A 4HACB 4PQAA 4YMMA 2V2VA 1QOHA 1B4SA 4UB1A 1O8BA 4GKJL 3TDQA 1TFYA 3FKIG 4YR0A 4DV4J 7ICFA 3AFGA 3G48A 5KFFA 2ROEA 4OX7A 2FJWA 3G71A 1CA5A 4LF2A 5M3FH 2BACA 3DWPA 3L3OC 3SMZA 2YX7A 4LF5F 2CH4A 1SV4A 1K5OA 3GJQB 2X1FA 4M94A 3TAQA 3MGJA 1K8OA 3N6RA 4C3HH 3L0OA 3CJKA 4NL9A 4M9NA 4RKUC 1XU4A 2AMCB 2ZIWB 1RE1B 3U1NA 1IKYA 5HVGA 2VL6A 1M5PC 4DV5F 1K47A 3Q8YA 4A3JH 4DR3L 3VF0B 3M7VA 8ICEA 2F0DA 3DEOA 2EK6A 2R7ZB 2ASBA 4IYQA 3NBPA 4LRCA 4FPRA 2UXBQ 2NZ1D 5M5WB 2W1BA 2CW0D 3DLGA 2XS2A 2BCVA 1AYEA 2EDUA 3ICLA 5FLMH 4LSNA 3DV9A 4NJ8A 1CA6A 4RA8A 4PGQA 4NE9C 3QO9A 3TAMA 1I94J 3FSXA 3OTOF 3MPUB 5TSSA 1RTDA 2WAQC 1Z1BA 5AKIA 3H5YA 1RAAB 1ZQTA 2M00A 2ERRA 5DS7A 1NTGA 5JMNA 3OUYB 5DAUA 2Q2TA 3AY0A 4YQWA 3O0FA 2G0JA 4MK9A 2XSJA 4RT3A 5L39A 3HWTA 4M9LA 1EU4A 2QARA 1QWYA 1XBWA 2ZUGA 5J2PA 3CCSA 3MEFA 2IHFA 1EQVA 5L1MA 1NJXA 2F03A 2K5QA 3QGGA 4OZNA 4Q2LA 4KLFA 1D8ZA 3CCUA 1WHVA 1IJEB 5KG5A 3NTHA 1C4CA 2QEXS 2HNZB 4YD2A 4QPXA 5EE0A 3OSPA 2VQFF 1EQMA 3OD2A 3VCBA 1VQ7A 1N2XA 5IWAF 4OI3A 1L3KA 3TZDA 2YX8A 1AT1B 2M5YA 1PDQA 3J81j 1V6HA 1X4HA 1IIPA 4NX9A 1KNAA 1VBKA 2Z57B 3GYXB 2HHHL 1U1NA 5KFMA 4YWMA 1NH8A 4BC7A 7ICMA 1ZQOA 1HWUA 2C3OA 2V2ZA 2VA8A 2ZC3A 1PK1A 1WYGA 4CLSA 4KLIA 4QMGA 1C48A 3PO3B 4ZS6A 1QVGA 2RSNA 4D3HA 5J3BA 4R4OA 3FM9A 1VQ6A 4NMLA 2F4IA 2QL5B 1RKJA 3TVZA 1KDAA 3HGBA 1Y0HA 4TXSA 1RQLA 3MGHA 4DV7F 1TXYA 3U1MA 4M5IA 2YV5A 3CJKB 2ZH4A 1QUQA 4OL7A 1X4BA 2V2QA 1GKHA 2GQQA 4EENA 2F4FA 2EANA 1WHYA 2KJ5A 5IGBA 4ZVUB 3MXPA 2Z6BA 1VQKA 2B2WC 2OTLA 4MKAA 4QCLA 1FEZA 1IW7C 5LMUQ 1X9XA 2A5HA 1ZQSA 4V190 2AXTU 2UXBJ 3C16A 3OSNA 3GFXA 4RT2A 3KWMA 3A0JA 1VQPA 2MKHA 1W7WA 1MROA 2QB1A 2E5LJ 2AZ3A 4K0KF 5BN3A 1X3PA 1URJA 1MMDA 5KEEA 2BW7A 5ETOA 1DOMA 4K5WA 2KCMA 1D5XC 4KIAA 4DV6J 3G86A 2G5HB 5ITHA 1YI2S 3HD2A 3E51A 3BV8A 2NWGA 3J7A5 4FYXB 1WC1A 1MN9A 2ZIVA 2OEMA 3FUYA 1STAA 4QOTA 3FEYB 3GJRB 2UU9J 1RXVA 3GILA 4B6JA 2M9VA 5EQ0A 3GTPH 4A47A 4NLZA 4R0JA 5M3MB 1NK0A 3CD7A 1J5OB 1X6OA 2K5DA 1SWWA 1RKNA 3EROA 3CO9A 4HSPA 1D9DA 2JMGA 2XI2A 1ZQNA 1P27B 5CV7A 4IUUA 1S48A 4RW9B 5I3PA 3L4BC 4YMOA 1U24A 1G8ZD 3KLEA 4X4SA 5E3RA 4A3JG 1VR6A 3OR2A 3DLHA 3D3BJ 4USKA 2V8HA 2BBEA 4U8YA 2HT1A 5E4XA 2XWXA 4HR2A 1HTLD 3FBFA 2RA4A 4UY8T 3GV5B 5ALQA 2EYJA 3OQ2A 3KHGA 4B3RJ 3CEDA 1QUQB 3ULLA 1YJRA 3TYTA 2NREA 9ICOA 5M3FG 2I5LX 3AQPA 3G2XA 3EN2A 4J9LA 2QG9B 2FPMA 3PO5A 3FCHA 2RQKA 4J91A 2WB4A 3MEGB 7ICSA 1IKLA 3QR8A 4G1QB 4DV0J 1Z00B 9ICRA 2WB1B 3SE0A 1FRHA 4Q5VA 2V8VA 3J81E 3MTSA 4RNMA 3W62A 1X66A 3HOXB 3DHWC 3OLBA 3UDXA 1VQ9A 2SNSA 1HRJA 2M4MA 4JI6Q 5AM2A 8ICVA 4CGYB 4A3CG 1JWWA 4NLSA 5HO4A 4RAUC 1R31A 1N36Q 2UXCQ 3POTA 1TK0A 2ZIXB 1Y8NB 3BH6B 4ZVFA 1YJNS 3WC2A 2ATWA 4X66F 4QIWE 1XMOQ 2BCRA 3HOZB 1X9WA 4OJ3A 1QNUA 1PH2A 2F0MA 4BJQA 5HP1A 3HT3A 4TU7A 3UCZP 3QSYB 1QY7A 4QF4A 5AJ3J 2M88A 4MZ9A 2KCTA 1JQYD 4M5KA 5K5PA 1IKWA 2NN6G 1JORA 1KRTA 1ZD5A 3CNHA 2UUBF 2QYCA 1STNA 2EOTA 2GHVC 2AQ4A 2ZKTA 3LPEA 2XCPA 3M2VB 3EICA 5KFQA 3OUYA 2A2DA 1S77D 2LU2A 1JKHA 2MLXA 2XWBB 4I29A 3QUTA 3ORYA 2M3DA 1VHIA 3T5HA 5AKZA 1JWMD 1N32L 4FVCA 4KQZA 4OYPA 3FBEA 3U9SA 1M5VC 3VZIA 1PBAA 3NGDA 3TS0A 1QJOA 3PSPA 2IPKD 5HGQA 5F8JA 1VQLA 3VAKA 1ZM3A 1VQDA 5IYCG 4RW8B 1D1IA 4A3JB 5T14A 2B9XA 1DK2A 2EY1A 1XEZA 1DTQB 1PKUA 1U8SA 1TV6A 5HJYA 2MQHA 1QSSA 3N6LA 1SNPA 4LF9J 2DHHA 5J2GA 1X65A 1S5BD 4JI4J 4O4GA 5JU5A 2XYHB 4I56A 1DTQA 3K1RB 1S5ZA 4M04A 2RJZA 1C4AA 3NS6A 1HBNB 2A1BA 2UUTA 1DLOA 4WJ3M 2H4OA 5IWAQ 3HKZG 1NAQA 2CQBA 1LB2B 2HS3A 5D4BA 2KG1A 2HDOA 3ZDEA 2HZVA 3HEJA 8ICZA 1O6XA 2PFFB 2N7CA 3MAHA 5EE3A 2QB0A 2AJ0A 2JLEA 3C29A 1TVAA 4UDUC 1RG6A 1PC5A 2FVCA 4IOCQ 4Q0BB 3JPTA 5IYBH 1S9EB 1GUNA 2ZBIA 5KL1B 1Q8KA 1FRKA 1QE1A 4NCGA 3UW1A 2OP5A 3IR5B 1RT3A 2QLTA 1NNXA 4Z6EA 1CULB 5J1NA 2Y1LB 3HOWH 1RHUB 5EUHA 1SMXA 2AIRB 5MAOA 1Y1VG 2E8PA 3KDOA 1EWIA 3M9MB 1ZQDA 1Y9OA 2JXJA 4DV7L 1M4VA 2QDBA 4IFYA 4OYAA 1J5EJ 2NR0A 3TJ8A 4I27A 1TK5A 4ECZA 2QCPX 4CH0S 2BUNA 1JXEA 2X51A 2W01A 3FAHA 2A6MA 1PG5B 1SJ3P 1N36F 1NMEB 4DOZA 1U5KA 1I4QA 4DV6L 1HMVA 4B02A 3R3OA 2CG8A 5T7LA 5KOXA 2W9BB 3AL0B 1ZOTA 2VBZA 2QF7A 4ABNA 1UKUA 3ONQA 2GO9A 2M8HA 1TQOA 1SB3C 5HY6A 2FJ6A 3RLOA 3FVQA 1JROA 4KLDA 1RPLA 4XO0A 3NWGA 4OJOA 4GKJF 2VPXB 3OTOJ 3H4DA 4ZVSB 2VY3A 4ALPA 2GVAA 2CJBA 2KN4A 1HTPA 3ISZA 3OJSA 3UVJA 4HDHA 2P35A 1LTGD 5CCLA 5AKGA 2EZVA 1VQFA 8ICBA 4NA2A 1PCAA 2F3NA 1B0XA 1TUWA 3C2KA 3G7LA 2KI2A 2ATLA 4RQNA 9ICJA 1DGSA 2ZNYA 3MGIA 5ELDA 4OYIA 1AEXA 2NYHA 2IHEA 3HOYH 4L6V3 4A3DG 5HMWA 2G08A 2BDUA 5C3XA 3IR6B 2OD4A 5K36H 3MDFA 2QTWA 2K8BB 2E44A 3UDFA 3RB6A 5CRXA 2EW9A 3ZZ0A 1NHVA 3EPIA 3UDVA 1WHXA 5DDRC 2Y3YA 2PEBA 2YXLA 4DSJA 4I6WA 1KEKA 1YNND 1Y3KA 5M3MH 4TLQA 1K0SA 2G9DA 5JPMC 5CD4H 1H73A 4BGDA 4IQTA 2VQFL 1YHBA 1FGBD 3WDNA 3GG1A 5A8WB 2BJ3A 3CDUA 4LFCL 2F3IA 2QA4G 1RLCL 3S1MH 5KG6A 3IWLA 4UP7A 4JB3A 2F0TA 2W3SA 4US8A 1PGZA 2Z2YB 3QUQA 1S99A 1N5YB 8ICUA 3MM8A 5ALJA 4AUKA 3RG6A 3WK8A 2GS8A 4I0WA 3MPWA 4KHPF 5ELCA 1VQNS 5GAEI 2PMZB 3J81i 1KFSA 1NU4A 1TMMA 2DY9A 5DJBA 2ZJPQ 2F4VF 4YCUA 4KGMA 4ZDNA 4XQQA 5E3CA 4ZPTR 4J37A 4K2KA 5F41A 3P8BB 4X4PA 3PHTA 4BA1I 4UBBA 1SQEA 1WG1A 2F0LA 4DL7A 1G7CB 3H90A 5A2QL 2FYXA 3A54A 4LBIA 2HGMA 5C5MA 4ZK9B 2C3UA 4Y7NB 4NCAA 3LP1A 4DGZA 1RCXB 1BUXA 1HXYD 5B0EA 3QIDA 4OL8A 1UWAA 3NRZA 3NGKA 2DUDA 3AA8A 4QY7A 4DV3J 2A1JB 2XS7A 4P4MA 1G6ZA 3DLEB 1NE3A 4A93B 1A2UA 2GMJA 5JUMA 2WB1C 4X3TA 1FXDA 4WTYA 1XNRJ 1HI8A 4ANEA 4Z9CB 2KV2A 4R66A 1YIJS 1S1TB 1BY9A 4G4KA 2HBYB 2YTCA 3STBD 2F0HA 4OWWB 2ZUBA 5B09A 7ICTA 3BYRA 5ETKA 1HR0J 4JPBW 1S6OA 1PFSA 3TP5A 5DBBA 3UCGA 4X66J 3IFDA 2UUBL 2FMMA 3BVZA 1K1SA 1VQPS 3RFAA 5KAFU 3DLKA 4DV5L 2B0CA 4Y2MA 4L76A 4TLRA 3PIOA 1WWHA 3QU4A 1WOCA 1HNZL 2XSJB 1U7LA 1SCJB 2E8NA 3W2WA 4A3MB 2OMLA 4BBSH 2OPSB 2K1RB 3PW2A 2F0GA 2XY7A 1TAUA 1KD1C 4A3KB 4JI5L 4U67Q 2UUBJ 4DCCA 2W4PA 2Z1CA 3QU2A 4USJC 1V8QA 3MM6B 2RRNA 2ZJQA 2JZBA 2L12A 3DDHA 1EHWA 4DS5A 2O4XA 1R8HA 1R89A 4JI3L 1Y88A 1L3TA 1YX2A 3QUBA 3KD3A 2E75C 4B9WA 5CA5A 1UAPA 2G4BA 3F2UA 1BPZA 2PI2E 4CI0B 4Z6DA 1CJUB 4LFCQ 3RAMA 3KNAA 3VYTA 1Q1KA 3TZXA 3OTBA 2LQ5A 3PF4A 1TS2A 1H38A 5D65A 3W5XA 1IL8A 5KT6A 1L7MA 4C4SA 4ER8A 3D5MA 2CRXA 4J6HA 3NWTA 2WONB 3BZDB 3SQGA 3SDEB 2HQGA 1LKYB 4IQWA 5DBAA 4W98A 4NLCA 3QPIA 5E2QA 1ZBTA 4RW4B 3OL7A 4J9NA 2Z8LA 2PQAA 1I51B 5J2FA 1IHZA 4DN9A 1EY0A 3C5FA 1IL2A 3HX0A 3GIJA 3SV4A 1UFLA 4H4OB 4YD1A 1EIFA 3EW9A 4DFKA 3R93A 5CV5A 3STBC 3W8GA 3G6EA 2K2PA 4C3IH 4C4TA 9ICHA 2VICA 2SEBD 4FPIA 4A8YA 1WTVA 1CJVA 1CS4A 2ZH2A 1I50H 4CTAA 2Y0SC 1IR0A 4AQYJ 1N5WA 2WAQB 1MSGA 2MRLA 1RT4B 3PYEA 1NHKL 2KJ9A 1BQQT 1YBYA 4IQMA 2L9WA 2XMJA 3IRBA 2GX8A 2HHQA 2F77X 1R43A 2NVXB 3GQCA 1PZJD 2IYIA 1WG4A 1HD0A 1FE0A 1KKXA 5AJ3L 5M5YH 4P6QA 4ZVOB 4ECSA 3UPFA 3JQJA 3PUWA 1UVNA 2E7VA 4OX9F 2IJFA 5IT0A 3TW0A 2W4DA 3BBBA 5AM4A 5HROB 2IBKA 4DFDA 5IS2A 1T05A 3TQEA 4FXDA 2VL1A 1LWFB 1VGYA 2JA8G 2VW9A 3M2RA 4GXKA 2XVTA 4O44B 3TQ1A 1S4EA 3S16H 2LS01 2BJ1A 5TZVA 5DQGA 2ALYB 1U1QA 4JMUA 2CHBD 3HILA 3HKZF 4RZRA 1ZQAA 5GAEC 1SIWB 5M2RA 1GT8A 3DMJA 4MYTA 3IDWA 1RL2A 4HAIA 4OZ2A 2BDPA 1IKMA 1SV5A 3B8HA 5DDQC 5GQOA 2EDGA 4YY3F 4HIKA 3CCJS 2A3VA 2KM8C 2JV3A 1LNQA 2OLWA 7ICHA 3PIPA 3N79A 2WVEA 2JC1A 3G6VA 3PW5A 4O0IA 3ILLA 2FY1A 1KOHA 4WFAQ 3M6XA 1EX8A 3KJVB 4P10A 1B53A 5DLQE 3H0GH 1PIEA 2BKNA 3EWGA 3GV3A 2DITA 1VJWA 1EEFD 2E5SA 1R0CB 2M9NA 3C1ZA 1RT6B 3CE8A 4KN7A 4U8VA 3SK5A 1TWGB 3BGLA 3ELHA 1ZD4A 4EBEA 4PH5A 2JZ5A 2KXHA 2K8CB 4DR1J 4F8RA 2LXFA 2AJ4A 2ZG6A 5JVGQ 1F9EB 5J0WA 3IGNA 4FYDA 1Q78A 2DTJA 4FZMA 5A2QE 4PG5A 1YVFA 4O1NA 5L37A 3CC2A 1SJ4P 4LZGA 4BBRB 1PAUB 2Z30B 2E5LQ 3P5BP 8ICFA 1NNLA 3G4SA 3PO2G 5C24B 1EIHA 1VOMA 4YFKA 3H0MB 4Y2JA 2PFOA 5CMDA 2MA1A 4KD4A 4O5EA 3T1YF 2DKXA 4DR2Q 4PQXA 4DX5A 4KLGA 5K9FA 7AT1B 3EDRB 3TX8A 5DLFA 1XMQL 3RN2A 2WAQG 2XGTA 1ZD2P 3WKDA 4LQ3A 1CC8A 2NSCA 4E6IA 2PT0A 2ZOGA 3T1YJ 1U48A 4YHHL 1WWUA 2W9CA 4O0NA 2MZ1A 1UFWA 3KBBA 4Y52H 2LEBA 5FOBB 3QRPA 1HR0W 5D8HB 3KLRA 3LH2S 1IBCB 5D3DA 2YNGB 2ASDA 1OPIA 3SV3A 4JW0A 2SDFA 1EQQA 1VQGA 2JEAI 2R3VA 2HVHA 1PH5A 4AXIA 3LWEA 3VGTA 3IWNC 1UNSA 1TL5A 3WOFA 4DR4F 1GEHA 5K14B 2MO1A 4N8FA 1OW5A 8ICLA 4IG3B 3M4YA 4OWXB 1HHTP 7ICVA 2RLTA 1OXTA 3DXSX 4NL9C 3R9KA 4JBJA 2L1BA 5FJ8G 3V4IB 2W8LA 3O3LA 2H5EA 4LF7J 4DF8A 1B70B 2A68D 4BY1H 1N34F 1JC7A 2XSCA 1PH1A 4YG2A 3ED5A 4DS4A 2AYGA 1S5ED 2B4UA 3LPYA 4P2FA 4EX5A 3S14B 2B4OA 4DQSA 3MR7A 3JPNA 4FZVA 3LDAA 8ICJA 4M5JA 4LUZA 1B1ZA 3R7SB 4KLOA 2AJQA 5J1ZA 1LTSD 3OR1B 3VGVA 3NVYA 2DNRA 3H2VE 2GCFA 3MCOA 2KD1A 4RQ8A 2HBRB 1SJFA 1NK4A 2BCSA 2YWEA 5ALSA 4B3SL 1I6JA 2ZC4A 2I6XA 2WAQD 2F3JA 3SSRA 1F9PA 3DOLA 3GFZA 2BRLA 3FMWA 4LRDA 1SKUB 2IAJB 1RI7A 4NM2A 5DGAA 4DV0L 4NI2B 2JQOA 1SSOA 2PA3A 3VVTA 3W3AA 3D54A 1G291 4KKUA 1YBTA 4DL5A 4AE5A 4M63A 3C3LA 5AXMA 1RHMB 4ELUA 3QGPA 1Y4ZB 5SZTA 2EJGC 1UJ4A 3KK1A 4Y34A 2D3DA 5C42B 2O1PA 5KAKA 1QAYA 2V6AA 4PG7A 5J0PA 3B9JA 1PH6A 2NXCA 4IQVA 3GTLH 3KKAC 1AZSB 1NLKL 3BDOA 3M3YB 4RUCA 3Q8LA 3R97A 1Z3EB 1K83H 4FO6A 4DL0C 4AIMA 4Z2XA 4DUYL 2ZH6A 2B2WA 1B44D 2LFNA 3DEPA 4QB4A 1VQ8S 2DBYA 2WF5A 5ALNA 2JYOA 4USUA 3GP9A 2YTUA 1NZBA 2KRRA 3CDAA 2K06A 4IFDI 4H54A 2UV8A 1TL7A 3MUVP 3IBFB 1P9YA 3ITPA 2DNOA 3HHDA 3UDIA 4ED2A 1NCVA 3L3FX 1RCOB 3V05A 4OJPA 5JJZA 2IM0A 2OPQA 2OIHA 1K8AC 3WBZA 2ZJPA 3W64A 1ZQIA 3LP0A 3PXGa 5D3GB 3JB9k 1L1OC 4YWKA 2BANB 2FVQA 3ILOA 3LAKA 2KE7A 2MEWA 3TSSA 2VODA 1IBKJ 1KBRA 4RU2A 2WF9A 3I4NH 1O80A 3KBGA 2YH0A 4KLUA 2HVDA 5BYRA 1RJTA 3CGIA 5CORA 3D28A 2JGAA 1JOKA 3M9OB 2B9WA 1TL1B 5LOQA 5KG2A 3I4LA 1MKHA 2FZGB 4OHWA 3M4QA 4UUXA 1PC4A 2ZNZA 1X6IA 4KLSA 1E3PA 3W9HA 1ENAA 2UXBL 1XWLA 4LMQD 2RAQA 1Y10A 2A1AA 2IOFK 2PMZC 4HLBA 4K14A 4LFBQ 1Q3VA 4C3JG 1KHVA 1S10A 4LIRA 1VQ4A 4QR2A 2CZ9A 1EYCA 4JCVE 2ZXRA 2VG7B 1HPZB 3N5FA 1XJVA 1RP5A 1FERA 2EAOA 4C3KA 4DV2J 2W2QP 1FR3A 3CU7A 1J6QA 2CDQA 1J27A 1YRXA 5GTIU 3V6DA 1F2YA 3JTNA 2YTYA 1OXSC 1VQKS 3NHHA 3DXJC 2YWHA 3BSOA 2B56A 2EWHA 3A7LA 1PZNA 4IG3A 1FNWA 2VIXA 1EB0A 3OTQA 1FK9A 5F8NA 3MR2A 4ECRA 2G2OA 3J7ZC 2KIVA 1PTOF 2VOOA 1FWKA 4OO1J 5CJ7A 3GZFA 3BM7A 2GH1A 4ZA1A 2OXPA 1WKJA 3DDKA 4B3RF 2F1MA 2HQ3A 2P66A 1KP6A 2VQEQ 4KTAA 2RU3A 4PZOA 4R0EA 4X4RA 4LFAJ 3RF9A 1JLQB 3VALA 2BQ3A 3GIRA 2MP1A 3IS9B 4OI6A 4JI0L 1JLEB 2E9TA 3I56S 2HNYB 3P49B 3KFUF 2H3EB 1DD2A 4AQYL 1GK8A 3HULA 1TWFB 1R9TH 3HKWA 2NN6I 2CPIA 4Y2RA 3A8KE 2A18A 2XULA 1T94A 4UB5A 2AYMA 3NL0A 3G8SA 3VQSA 4WJ3B 2RRBA 3TKAA 1REGX 1QZHA 4MTPA 3GU0A 1FKOB 3LOUA 5EKKA 4Y2IA 3S1NB 1NJIT 2QA1A 3HJVA 1HR0L 2QEXA 5J2IA 2VS1A 2N49A 3H94A 4O3OA 2KG0A 1T3NA 1DURA 3EVQA 3VHQA 2JVOA 4IJLA 2R92B 4M2YA 1KVJA 3PR5B 1WF1A 2RHQB 4KLJA 3DUZA 4FP9A 3HO1A 2PSZA 2JA7B 2Y8YA 4MMOA 2CQOA 1VQ4S 2H4YB 5LMUJ 4IFDJ 5AKHA 9ICVA 2Z8QA 2BDNA 3QT7A 4CF4A 2FQQB 1CEZA 1MG7A 1X4CA 2MKYA 5L1KA 5F0UA 4C6AA 5KFDA 4Y2CA 1H6KX 1FA0A 4HTJA 2ICIA 1HBOA 1TELA 2PKEA 5CZXA 1BE4A 1ZJMA 2MQQA 4IUVA 2CJXB 2IHR1 1X9NA 4TN2A 1NBEB 1VCIA 4X3SA 4XAKA 4PZ7A 4CYUB 2ALZA 1M6YA 2VA3A 1F77A 5J2AA 2EYMA 1JN3A 2F0JA 1WF2A 3THTA 4LSLB 5H1SE 1N62A 2FXQA 3ALRA 1DGJA 2B63G 1RWUA 2QLWA 2O2LD 1Q1EA 4IUQA 1UA0A 3RB3A 4PKDB 4OIKA 1LW0B 2OPRB 5HP4A 4DFPA 4BC9A 1MSWD 1OY8A 2F9DA 2XRSD 5BXIA 4MFBB 3M2RB 4NWIA 1E1TA 1ZAVA 3G82A 3GONA 1U1OA 2VA2A 5F8LA 4LF4Q 1UT5A 3MZIA 4WXWA 2KMDA 3D0IE 1QLNA 4A3DB 4C3HB 2HSEB 1U0HB 2L9NA 4X3UA 3HX9A 4OXPA 1WI6A 2YKOA 2MSNA 2R9LA 4ED6A 1JNZB 4AP9A 2DWQA 3AJ2A 1TZ0A 4K4HA 3ZZPA 4DMZA 1Y8PB 4RQMA 1BQXA 1E6YB 3LO3A 3LGNA 5JJIA 1TWAB 3HHLA 2ZFHA 2MKJA 1SV0A 1A2TA 1BLUA 3KK1B 3T9NA 1IQTA 4CLFA 1SWVA 2J7KA 2QA2A 3ENAA 5J2NA 5KFPA 4CLUA 5IOCA 3A7AB 5GAHU 4NLDA 3D1OA 1HQMC 5FD1A 2H4WB 3RZDH 2HVZA 2RVLA 3R7NB 1K73C 4FP5D 3IM8A 4NWBA 3S1TA 2K01A 4MTKA 2JH1A 4FN5A 4B9NA 4DSIA 2VDHA 1VJ5A 2B2YC 4LFBJ 4B3MQ 1QVCA 1A3VA 1DARA 3BB5A 2MYFA 3AD8C 5DLGA 2DO0A 3CD6S 3IM9A 3K5LA 3NGUA 1HNXJ 3JQMA 4ALZA 5KFJA 3OXLA 1DJ0A 4ED0A 1ZXIA 2GVZA 4AYBB 1TV9A 3MMBA 1JWSD 4OJ5A 4KAIA 3I73A 1BNZA 1QM9A 4ZK7M 4WWSA 2UUAJ 2VIHA 2FDRA 5J39A 3HOZH 2ACMA 3F8TA 2B4VA 4Y2KA 1UWBB 2R8HA 5KFUA 4QJFA 2EIFA 1U09A 3ZO7A 2FJDB 1J2MA 4US9A 1IBKQ 3IO1A 3M2UB 4PABA 3ULHA 3QGHA 1IYUA 1UEKA 4A3KG 1PRTD 5IM0A 3T5JA 2F0NA 1RAOA 4ETZA 1D0EA 2DBBA 4RW7B 4J9QA 3J80i 1HQUB 2B9YA 4Y2QA 1Y00A 3BPDA 3GG0A 2HOFA 1D6EC 4IUTA 4XRHA 3HJEA 3V4MA 2GGPA 3A5UA 3LK9A 3R6LB 2ODGA 3SFUA 2XMWA 3MDAA 5IP9H 2J6UA 1SV0C 2DH8A 4CNQA 3CRLC 3C5GA 4NEYA 9ICAA 2BV3A 2H54B 3EE3A 3EXYA 1RHJB 2OPSA 4FF1A 4QBUA 4A3MH 3HVTA 4A3IB 3TUJC 1QUVA 2F0QA 4AYBE 3B0YA 3UI2A 5CBAE 4JI5Q 2E76C 4GRSA 3ZXWA 3DLKB 1N52B 2KKHA 3QU7A 3I1YA 1IKWB 3A12A 1KW4A 5CBEE 3N01A 2JRZA 3PCOB 4CJ2C 3R5GA 4AFFA 2R7QA 4F02A 2XMAA 1IXKA 2GHPA 3FP9A 3BS7A 5DZ7A 3ENQA 1XX8A 1GVPA 3MZ5A 1YJ9S 5AK4A 1HHSA 1N32J 3D6HB 2MKSA 3HXMA 2C28A 1UEAB 3VR4A 1D5ZC 5HBMA 3CC2S 1T9YA 5LHY1 2F8HA 2B2TA 2K7JA 2C5CA 2XY5A 3QLHA 1WOSA 1FT8A 4IO9A 1KAWA 5K36G 2KJXA 3AB4B 2PNHA 4E2FB 3ONAB 1JALA 2FHKA 2HWIA 4OCZA 1WTFA 5DB7A 3FZ2A 1X5TA 4IR9A 4AL6A 3A8JA 4N8NA 5HLFB 3ZZOA 1BMQB 4QZEA 2JA7G 2B6GA 5KRUA 1H9MA 1UETA 2X1BA 3CPFA 2RB7A 4DUYF 4MEXA 4HI1A 3CULA 2X1GA 3A56A 4OJHA 3F44A 2VZAA 1HEKA 3NK9A 5ELEA 4KGZB 3KJOA 5ETNA 3C19A 3MABA 3E2EA 3KKFA 1B8AA 5J0TA 3QUCA 1Y1WB 4PHDA 4H4MB 3SSSA 5KFBA 2EVBA 4WPAA 3DM2B 4KLKA 2JEGA 4HT7A 4WTOB 2FI1A 5KT5A 1J9OA 5J2MB 1RTIA 1UP1A 4RW9A 3QO2A 1RAFB 3PNIA 3IS9A 2R7FA 3AFPA 3A8EA 1N88A 3X1LB 4LMZA 2CQPA 3FCVA 2CQ1A 3I31A 5KGUA 3MCMA 3FSIA 3BKFA 3TRZA 3SAFA 3ZNJ1 3BZKA 2CPFA 4OZ1A 4P74A 1HNWL 2Z4PA 1L0YB 2Q66A 3WKBA 2FJVA 5KFZA 2QDLA 1HI0P 2HLUA 2HIVA 3T5LA 1TFRA 4UASA 3V6DB 2GV1A 3MMJA 5JVG3 1I50B 1N33F 1CS4B 4M9JA 3EIVA 2VPZB 4B3TJ 3OJUA 4J5OA 3S1NH 1VMCA 2CKZB 5EWGA 2I8EA 1P1LA 3UDLA 2L08A 2WOMB 1AB8A 4IFVB 4JUZA 2Y0SF 2XICA 4ACOA 1S1XB 1Z7TA 1EY5A 1TKXB 1C1CB 3BSCA 2BJDA 5J0RA 1PH9A 1R8AA 1CQNA 3JPSA 3LP2B 3NY0A 4J9UE 2PQAB 1FRJA 4RPZA 1TWFH 4RW4A 2G9HD 3MUTP 3MEKA 4LZDA 4I2PA 4ETXA 1OXXK 4OIXA 2E1PA 2I9SA 5ALVA 4QUCA 5HHIA 5ELOA 2RQ5A 1WORA 1YSJA 2NO5A 1TL1A 4RNFA 2JN4A 1D9AA 4LFAQ 5DM73 2R8KA 2EBEA 1RTNA 3WIVA 2FJEB 2R7UA 1J8IA 2EAMA 2R93G 4F50A 2R7DA 3CCUS 4OX8A 2A0FB 2PFQA 1SNDA 2M7SA 5B0FA 3RJMB 1LTTD 1B4OA 1NJYA 4MIBA 4Y6IA 4KY5A 4P4PA 3MFIA 5IZHA 3CCES 4KN4C 6AT1B 2JSXA 5T7LB 4GO7X 3MM6A 1V1PB 3C1EA 3D2NA 4X65L 1NH7A 4EFAC 3FRYA 4M47A 2MQOA 1SVDA 2LA6A 2QGQA 3NMRA 3NKYA 4BBYA 2MQPA 4DV2Q 3I5BA 2KZZA 1STYA 5IV3A 3CCRS 3I0SA 3I5CA 2VQFQ 1FD8A 1XMQJ 4K0KJ 5HMLA 2B21A 2UUCF 1U25A 1S5DD 7ICIA 1QVFA 2BR0A 1HA5A 1LWXA 2F7VA 2F0WA 3HVWA 3E01A 1CHPD 3H4BA 2LECA 1FVQA 5J2PB 3M32A 4OEMB 3CDBA 4IC9A 3VR2A 2C9OA 4ECVA 1G2EA 2QC3A 3OT9A 1SBRA 2HMXA 3E6ZX 1B3TA 3RBXA 2MJ8A 1XPOA 1RTDB 3MR3A 2YMMA 1HBUB 2Q6CA 2IAJA 3TN2A 2BPCA 1YNXA 2UXCJ 1NBWA 3CPWR 3HVRA 5AKXA 3IR7B 2RE1A 5GAGU 2LP4A 3ITHB 5J2QA 1FO1A 1WNEA 1I4HA 3OR1A 3HZXA 1REVA 1WDDA 2MTLA 1SE2A 2N1RA 3PV8A 1LWEB 1D8YA 4IFDH 5I2YA 2ES2A 1ZA2B 4I69A 2DY7A 1IKYB 3K5MA 3CJ4A 2Q8IB 1JXLA 1FNUA 4EQ5A 1RHRB 1Q7YC 4DZDA 3JAMU 2K5NA 3I4OA 9ICGA 1S59A 2CXEA 4NZ7A 5DQIA 4IPHA 1P1TA 2YNIB 4P0QA 3FHWA 4LF5Q 1T3OA 1VLYA 1Y1WH 4EMDA 1QAIA 3N4WA 3MHYA 2IW3A 5C4XB 3IP0A 4OHZA 4X84A 1Q81C 2C2DA 1HPCA 4I2EA 3KKAA 1I6VC 4IALA 4IUPA 1Q8LA 5J1PA 2BM1A 2HHVA 1LT3D 1VRUA 4OYBA 1PBUA 1CJKA 2IFXA 4H13C 1VQNA 3OPXA 7ICRA 1TIID 2KG5A 3CP0A 4NMZA 3CF5A 5KFIA 1BPDA 1VQIA 2F0KA 3SR6A 3J7AV 3CMES 5IODA 2XY6A 2OO4A 4UAVA 4R5PB 3VWSA 2DR5A 2C2OB 2K1BA 2E5LL 2BOAA 3HKZE 2IMWP 2ZUCA 3HW8A 1PH3A 3GTKB 1X56A 3S14H 4DV4L 1L2FA 2N4CA 1EKRA 4DPXA 4RGTA 4HJAA 3I7FA 4C3JB 1RHKB 2PDAA 4GMKA 3CTRA 1ECWA 4KKOA 2XNAC 2V67A 1R4PB 4FE3A 1PV4A 2DNQA 4Z37A 3KF6A 3ZTQA 4UW2A 4RPYA 4GLXA 2OAUA 3CIMA 4W92B 4KH0B 5ALRA 4WFNQ 4DA2A 2JA6B 1UCNA 3A8IE 2PYKA 3ZI4A 1AUDA 2V63A 4L72B 4OHYA 3D9BA 3MFHA 5IYCH 4C1NK 5BYQA 5BR8F 5L1JA 3S2DH 3AFQA 2K89A 1JOQA 1SUQA 3SQIA 2ZE2B 2D9OA 3RGIA 1F9RA 2CJAA 5CXTA 1V85A 2JHEA 3A3OB 4YS2A 1Z1ZA 2B6AA 4B3TF 2YPZA 1S0MA 4NLBA 3BDEA 4LF8Q 4ZVEA 2AEFA 3PV0A 4M5DA 1XWEA 3GCWP 2R61A 3KZIU 1KFTA 3RJFA 2H51B 1M1KC 1HNZQ 1LM0A 3W3SA 3KF6B 1HJPA 4PXBA 4HAEA 4RJVA 4QZ9A 1JMTA 2VF3A 3BYPA 1AZPA 2Y8WA 1ICFB 5D0HA 5M9OA 3BZQA 2UUBQ 3CJ0A 2LMIA 3FFIB 3O1LA 1OO9B 4C1NI 3DMUA 4IOBA 3GSDA 1A62A 1SL2A 1Q46A 2QLXA 4GNXB 5HROA 3T6BA 3Q6SA 2VFVA 1JNRB 4IO9Q 4F71A 2DGTA 4OHXA 2HGNA 1YWXA 2WSFC 5AK6A 1SIJA 3RUBL 3E5SA 3JAMc 5KFHA 4CDEC 2L55A 4CLWA 2MUTB 3H42A 1S79A 1HQEA 1STHA 5HR6A 1EY7A 5M3MG 4WFYA 2XYGB 2HUGA 4CCHA 4NKLA 2HHHJ 1NUEA 1J2VA 1NXIA 2R7RA 1RTJA 4X2BA 3P3DA 1ZKOA 1V5IB 3H0RB 2ZXOA 1VQLS 4RW6A 2HEKA 3R1HA 2K33A 2M52A 3IMQJ 4YR3A 4IKAA 1SPBP 2F5GA 5GAEU 1RZTA 2IY5B 1I5OB 2UXCL 2R7XA 2XG8A 3B4DA 1HWLA 3IRXA 1BQNA 2WAQE 4NYOA 2XYPB 4H4OA 4WZQA 1QH9A 2R7OA 4OYWA 4TYAA 2UVVA 4KX5A 2KOBA 2I2YA 1N5TA 2DPIA 4X4VA 2Y1IA 1K0RA 5LMNJ 3KLWA 3TARA 3A4TA 4A76A 1MN8A 4OJ1A 2I46A 2DNYA 4JI5J 1S76D 4DSKA 1E7ZA 2HIQA 2EYPA 1LKYA 3GR0A 1UPPA 2CQ3A 4GVLA 2BKOA 3JQKA 5E0OA 3K1ZA 4IFDG 4DJBA 4OD0A 1F9HA 4WF9Q 2QA4A 1E6VB 2Z2ZA 1N54B 3OVSA 2UVUA 1UPMB 3F56A 1ZQJA 1RWPB 3HKZB 3NWSA 3NGTA 3PTWA 4ZUIA 1SC3B 1N32F 5FLXY 5HL7Q 4F3OA 4DR6L 1NMGA 2LY7A 2BE9B 3CD0A 4AQYF 3UQ0A 5IT4A 2E2HB 1CJUA 2XN9C 1EQ0A 2NVXH 3FK4A 3P20A 1ZD3A 4JK1C 2VNUD 1OXVA 1I4XA 4QW9A 2M2BA 2MGZA 3RRHA 1FNMA 2XTJP 3KLFB 3C1FA 3D1HA 3HSDA 4BA2I 3SAGA 4I2CA 2EY6A 1RAHB 2JZBB 3R27A 5HMZA 1EIYB 4M8AA 4HT5A 1RT1A 2ZXPA 5IIJA 2F8EX 3SEOA 5CAAA 3J80E 3QG1A 3L3CA 2IVFB 2E7XA 2NUCA 1RABB 1SH0A 1HHQA 1HW8A 3BKUA 4USAA 1CHQD 4B3RQ 1FEEA 1Y1VB 3F0NA 2VJVA 4UQGA 4ID6A 5JJLA 3QB3A 3R5AA 4QIWB 3IL8A 2X1AA 1NKEA 3LWLA 4YEAA 1N61A 4N5SA 2L