The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
52
|
sequence length |
263
|
structure length |
252
|
Chain Sequence |
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb |
| molecule tags |
Ribosome
|
| source organism |
Saccharomyces cerevisiae
|
| molecule keywords |
18S rRNA
|
| total genus |
52
|
| structure length |
252
|
| sequence length |
263
|
| ec nomenclature | |
| pdb deposition date | 2014-08-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| j | PF00575 | S1 | S1 RNA binding domain |
| j | PF07541 | EIF_2_alpha | Eukaryotic translation initiation factor 2 alpha subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | Translation initiation factor 2; subunit 1; domain 2 | ||
| Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | Nucleic acid-binding proteins | ||
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | EIF_2_alpha |
