3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
b'TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
1KD1C 2WB1E 2Y0SG 4GNXB 4BBSH 1YHAA 5GQOA 4BY1H 4JBKA 1VQGA 3RLOA 1EIFA 1WCMH 4A4IA 4ALPA 1SLJA 1PH8A 4A3IH 2Z0SA 1A62A 4R1JA 3HOWG 4HJAA 3NENA 4DR3Q 1VQHA 1MJCA 1VQDA 2ZTCA 4L5TA 5E7NA 4DUYL 1KRTA 2UXBL 2NVXH 3M4QA 4QQBX 2UUBL 2HIVA 2E2IH 1PH6A 1PH3A 1K0RA 4GN4B 4C3JH 1PH2A 1NE3A 4X66Q 1X3GA 4DKAC 1AE3A 4HJ8A 1B7YB 2ZTEA 3CPFA 4JBWA 3FHWA 2KHIA 3FKIG 1HZAA 2LSSA 1EFWA 3J80c 4JI4Q 4A3KG 1GKHA 3KOJA 3OTOQ 1YITA 2B63G 3PO2H 4JI0Q 5DLQE 4DUZQ 5JJIA 1B8AA 2HIXA 1IBML 1XTDA 1N9WA 3A74A 4KLKA 2ES2A 1VQCA 1Q12A 3HOYG 2EQSA 1Q86C 4JI7Q 1HZBA 1VQIA 3F1ZA 4GLVB 4JOIA 1G6PA 2CKZB 2E5LQ 5LMUL 1Q81C 4LF8L 1GD7A 3PIPA 4KHPL 3CP0A 4JI2Q 4GKJL 2R7ZH 3M7NA 4JI1Q 4DV6Q 4DPGA 2CWPA 5IWAQ 3TRZA 1BVSA 1NJIC 1D7QA 2ALYB 4DR6L 1K8AC 2R93H 2E8GA 4BA1I 2D62A 2PNHA 3TREA 4DR2L 2HT1A 3KLWA 1N34L 4GLAC 1EYGA 3T1YL 1IYJB 1VQEA 3I2ZA 1UE6A 4JI6Q 1FJGL 1I94L 3I4NG 3U58A 4O0AA 3GTGH 5C4XH 1L2FA 2B3GA 1PH4A 1HR0Q 4JI3Q 3GTKH 3CCVA 1YI2A 2HHHL 3H3VI 3HOZG 2R93G 5BR8Q 2I5LX 5FLXc 1YNXA 2NZHA 3PIOA 1D8LA 3U50C 2WB1G 5M3MG 4JYAL 1KAWA 1VQMA 1BBWA 1PYSB 3FP9A 3S24A 4Y52H 2R6GA 5AJ3L 2K50A 2R7FA 4P74A 1VQJA 2RHQB 3A5ZB 2NVQH 1OXXK 4DV2L 3M3YH 3U4VA 5IYCH 4X6AH 4LF6Q 4GN3B 4GKKQ 4QGUA 4C3IH 3GDEA 4DAMA 4LF8Q 4NXMQ 4KHPQ 1B70B 4YCWA 4A3FG 5JJKA 5EAYA 4YWLA 2NN6G 3GTLH 5FLMG 4IFDI 3RR5A 3CC4A 3UDXA 3AQQA 4HJ7A 4B3RL 3HFZB 4JCVE 4TVAB 1XNQL 4A3LG 1E24A 1L1OC 2IT1A 5C44G 5IYBH 1UEBA 1N34Q 1Q1EA 3T1YQ 1VQAA 2CFMA 5C3EG 4DR1Q 4EX5A 1E7ZA 4JBJA 3PUYA 3ICEA 3TS2A 4BA2I 4LUVA 4K0KQ 2AKWB 1NTGA 1K73C 5ELOA 2VQEQ 5IP9H 5IP7G 3FKIH 4A3MH 4X64L 4JI5Q 3S1RH 4LW1A 1SMXA 2JA9A 1W3SA 3ULLA 1J5EQ 1OXTA 4DV3Q 5AJ3Q 3W5OA 3HOXH 3ER0A 1QVGA 4DR3L 3J81c 4R4QA 2I5MX 1VCIA 2XTIA 3VDYA 2H5XA 4GN5A 3TQYA 1V43A 4UP7A 3STBC 2UUCQ 1X3FA 1K8GA 2RCNA 1PYBA 4HIOA 4A75A 5IY0A 3RN5A 1SFOH 4IO9A 3S1NH 3CD6A 4A3CG 1YIJA 3DM3A 4LF7L 2UXCQ 4JI4L 3K81C 1KHIA 3UE1A 3QSYB 1I3QH 4L5SA 3CMEA 3E0EA 4POGA 4DUZL 3W1GA 1H95A 4GNXA 4TQUS 1EWIA 3I4NH 4A3JH 1A0IA 4GOPC 5JJLA 4JI7L 3HOZH 1Q7YC 2JJQA 1KIXA 4LFAL 4BY7H 1LTLA 4IPCA 2E5LL 3CCEA 4PZ7A 3G48A 2ZTDA 4L5QA 4JI2L 1CSQA 4JI1L 4PMWA 2IHEA 1HZCA 4O2DA 4DV6L 2OTJA 2YYZA 5IWAL 4QL5A 4EQ5A 4POFA 1XMQQ 1X3EA 4JG2A 1XPOA 3CMAA 3RLNA 4DR5Q 1ASZA 4YHHQ 2QGQA 3BU2A 3RNUA 1C9OA 1SE8A 3PUWA 2AWOA 4DR4Q 1NY4A 2VQFQ 3HOVG 4LUOA 4JI6L 3SGIA 3S14H 4BXXG 4WJ4A 1HR0L 4OXPA 4JI3L 4DV5Q 5C4JH 2E2JH 3EBEA 5BR8L 1M1KC 3JAMi 4R4IA 4A3LH 1E3PA 1HR0W 4LF7Q 4A3DG 2VZAA 4RG1A 2R7DA 4IPGA 4QY7A 3AFQA 3NELA 3PO3G 5C3EH 1CKOA 3HKSA 2PI2E 2MFIA 3K0XA 4YWKA 1PH1A 2JA5G 4HIMA 1GO3E 2RF4A 4A3GG 1G291 2NN6I 1TWFH 1Q1BA 3CPWA 5HGQA 4LFAQ 2R92G 5IP7H 3CCSA 4HIKA 3HKZE 2CQOA 4LF6L 4GKKL 4NXML 4JI8Q 1T9HA 5GAHC 1IBKQ 2OTLA 1AH9A 3K7AH 2ZJQA 1X56A 3HOUG 3H15A 1S3OA 1JJ2A 3MXNB 4JBMA 2IX1A 3H3VH 1Y1VG 1L1OB 4DV0Q 2N78A 1R9TH 2BH8A 2AWNA 1IL2A 4H02A 2JA7G 4DNIA 3E9HA 3PSIA 4DR1L 2JA6G 2YTXA 1Q82C 3LGJA 5M3FG 4A93G 2ID0A 2ZJRA 3M4OH 4A3CH 3KF8B 4K0KL 2K4KA 3WWVA 4DV4L 2VQEL 5ELNA 3TS0A 2UU9L 4LF5Q 2GN5A 4JI5L 1JT8A 1HNZQ 1J5EL 1DGSA 3H0GG 2PQAA 4DV3L 2K52A 1PH9A 2VUMG 1TXYA 3CCRA 1UWVA 2JA8G 3KJOA 2ASBA 4LWCA 2Q2TA 4GS3A 2K5HA 3STBD 4BBRG 4UP8A 1HZ9A 2AMCB 4DV7Q 1VQ8A 3L7ZC 2UUCL 4DV1Q 1HJPA 3PF5A 2PQAB 3KJPA 3AEVA 1X6OA 2F52A 2LXJA 3B6YA 1VQLA 3S2DH 1YHQA 2MNAA 3OYYA 1MKHA 4Y7NH 3HOWH 2UXCL 4AQYQ 2VW9A 4XTCS 2UXDQ 1VQ6A 4AYBE 5IYDG 2D0PA 3PF4A 4XIGS 3UDFA 5C0XG 1X9NA 3I7FA 4BBSG 1E1OA 1U5KA 2GVAA 1M90C 4A3BG 1UE5A 5H1SE 4DK3C 1WCMG 1PVOA 1XJVA 1HNXL 4A76A 3PV0A 3CC2A 1NBWA 1Z9FA 3HKZG 4DV4Q 4HJ5A 2UU9Q 3BJUA 4A3KH 2KCMA 2B63H 1XMQL 3GTPH 3OW2A 2K75A 3PUVA 4DR5L 1J6QA 3JC66 1HNWQ 4QIWE 4YHHL 1S72A 4A3GH 3HOYH 3KDFB 4DAYB 1IXRA 1K3RA 4DR4L 1Y14B 4R4OA 2VQFL 1MIUA 3M4PA 1NMGA 2IX0A 2C35B 4ME3A 1LUZA 1X55A 4FDBA 4NPSA 3PO2G 3KFUA 2BA0A 4MZ9A 2UUAQ 1AE2A 2YTYA 4DV5L 1YJNA 4IJLA 2A19A 3IRBA 2N8NA 1L0WA 3T1HL 1CSPA 4L5RC 1TWHH 3I4OA 3EN2A 4MTNA 3CCJA 3KF6A 2RHSB 3F8TA 4A3EG 2BA1A 4HJ9A 3Q8DA 1N32Q 1N33Q 3AYHB 2JA6H 2OCEA 2MO0A 2Q2IA 3I4MG 5M3FH 4OO1G 2IHFA 4P75A 1Q8KA 2WAQE 2KENA 3K7UC 1HH2P 3KF6B 3CC7A 4X62Q 1HNXQ 1OTCA 1XMOQ 1S40A 3J81j 3UDGA 1PH7A 1VQ5A 1Q46A 4JI8L 3CAMA 1IBKL 5M3MH 1QZHA 1VQ4A 2E2HH 4B3TQ 1CKNA 2L15A 2XGTA 2K14A 5C4XG 2VUMH 3RN2A 1JJGA 2KHJA 1WFQA 3CQZH 4DV0L 2JA8H 1UE7A 1YJ9A 4LUZA 1RL2A 2KCTA 4AYBG 2JEAI 3GTQH 4R4CA 1WOCA 1OXUA 4C2MH 1CUKA 2YTVA 3EIVA 3GTOH 1RIPA 1CKNB 3DLLA 4A3FH 1PV4A 1P8LA 1VQOA 2Q2UA 3J7ZC 2OQ0A 2JEBI 5FLMH 2KBNA 1YBYA 1XNRL 4LF5L 2JE6I 5IE8A 5FJ8G 3T1HQ 1JB7A 3K8AA 1EIYB 3S2HH 5JEAJ 4JV5Q 3CCMA 3NBHB 1TWGH 5IYCG 5GADC 4UPAA 5C44H 3GO5A 3F2BA 2ZJPA 1HNZL 2ATWA 5M5XH 4A3BH 4IPDA 3G6EA 4KHZA 1VQFA 4NB3A 5LMNQ 4P73A 3S16H 4P72A 1G51A 4JC0A 4LFCL 1GM5A 1WYDA 1EQQA 4LFBQ 2I5HA 5C0XJ 1L1OA 1OXSC 3A0JA 3GD7A 3TEHB 3L2PA 1BBUA 2MQHA 5IYBG 4DV7L 4LF9Q 4DR7Q 1E22A 1UE1A 2N3SA 1VQ9A 4B3MQ 3F2CA 4DV1L 3J7A5 2QN6B 2IY5B 4KI0A 5C0XI 2PMZE 2DGYA 1TWAH 4AQYL 2UXDL 1OXVA 3CW2C 3L0OA 5IP9G 3GTMH 1YHBA 4A3MG 4QJFA 4LF4Q 1N36Q 3BZCA 3PUZA 5IT9c 3I55A 4HIDA 1X65A 4OWTB 1E1TA 2WFWA 2QEXA 3CCQA 2NVTH 1LYLA 1IZ6A 1SN8A 2WAQG 4J15A 3HOXG 1ASYA 1I50H 1C0AA 1IBLQ 4R4TA 1XNRQ 4LNQA 4UY8C 5M5YH 2EIFA 2ZM6Q 2VY3A 4PZ6A 4A3EH 4YCUA 4YY3Q 1Y1WG 2AHOB 2YV5A 1P16A 4B3SQ 3I4MH 1EQRA 1HNWL 4GNXC 3PGZA 2Z6KC 2K5NA 3CF5A 2F4VL 4LFCQ 3J81i 3CXCA 1GVPA 3AFPA 1XPUA 1LM0A 4DUYQ 2UUAL 1A63A 2UXBQ 5JEAG 4IOAA 2UUBQ 2B29A 3CCUA 4A3JG 2LXKA 4GOPA 1FGUA 1WJJA 3M9BA 4PZ8A 4OO1I 3JAMc 1PA6A 4BY7G 2NVYH 1A8VA 4AH6A 3PUXA 2BH2A 3RZOH 1N32L 2OQKA 5GROA 1N33L 2VL6A 3HOVH 1K83H 1QUQA 3KYHC 4NXNL 4BY1G 5J3BA 4GOPB 3ZJYC 1V9PA 3A5UA 4UP9A 2YU9H 4OWWB 4BXXH 5K36G 3BZKA 3UE0A 1PFSA 3M85A 1IBMQ 4A3IG 4APVA 4X62L 5FJ8H 1XMOL 4OX9L 3E9IA 4IFDJ 1VS0A 3KDFA 3CCLA 4A3DH 1V1QA 1QUQB 5LMUQ 1VQNA 2F3IA 4B3TL 3PO3H 4GLXA 4GKJQ 4X65L 2VS1A 4MNOA 2Y0SE 4IJHA 2JA5H 4DR6Q 4IOCA 1FL0A 2FXQA 2DUDA 2F4VQ 2K5VA 1YEZA 1X54A 4DR2Q 1VQ7A 3G71A 4JOIC 1U0LA 1XPRA 1MJEA 2R92H 1FVIA 1NMFA 3U4ZA 1VQBA 3ULJA 3UDIA 1YZ7A 2MO1A 1VQPA 3HOUH 1FJGQ 1I94Q 1BKBA 3S1MH 2NZOA 2EXDA 1Y1VH 1CKMA 1EUJA 2HHHQ 4JV5L 1QZGA 5GAGC 2V1CC 1KC8C 3K80C 1PH5A 1KQSA 2JQOA 2WP8J 3RLFA 1PHJA 1EOVA 4DK6C 2JA7H 3GTJH 4JYAQ 2R7ZG 4OWXB 3J80i 5LMNL 1I5FA 2I0QA 4WJ3M 2CCZA 4NXNQ 4LFBL 5M5WH 4IPHA 4A93H 2HQLA 3W1BA 4YCVA 2OWOA 3D0FA 1KL9A 4C3HH 5LMNW 1YJWA 4LF9L 4DR7L 2QMUB 3I56A 4B3ML 4OX9Q 4DV2Q 1KXLA 1JJCB 3MEFA 1KRSA 1Z47A 3RZDH 1Y1WH 3NEMA 4AIMA 3ERSX 5GAEC 4PG3A 3H0GH 3D31A 4X66L 4X65Q 1JMCA 1O7IA 3ULPA 3PCOB 1QVFA 1I6HH 1K9MC 3F2DA 1QVCA 4B3RQ 2CWAA 1W2BA 1XNQQ 1C7YA 4LF4L 4BBRH 1N36L 1SROA 2VNUD 3S15H 3OTOL 2GVBA 2Q2HA 4JI0L 3S1QH 1N8RC 4IFDG 2D0OA 5HY6A 4YWMA 1TWCH 2PI2A 2Z6KA 2N49A 4OONA 3G4SA 1YZ6A 1VQKA 1IBLL 2JK8A 1JE5A 2QA4A 1WI5A 2A8VA 3S17H 1SRUA 1YVCA 4P71A 2ZM6L 2A1AA 5IYDH 4RMFA 1SR3A 4YY3L 4B3SL 4X64Q
chains in the Genus database with same CATH superfamily
1ZQJA 3HSJA 1SXLA 4ES1A 5K36H 4WFYA 4OIKA 2WRMA 4A3IB 4KJNA 2F7VA 1A62A 4K4ZA 2NREA 2M9VA 4EX6A 4XO0A 1RDPD 2XLKA 3MAQA 3SIPB 3BVMA 1QJOA 1JB0C 5J2NB 3BO2A 4JBWA 3M1YA 4JI4Q 4R65A 3FKIG 2HKEA 3D2QA 5EPJA 3ZFVA 3VYTA 5ALIA 3ZDDA 2QMXA 8RUCA 1Q86C 4B02A 1ZYRD 2B2YC 3CP0A 3M7NA 4DV6Q 5F9LA 1D7QA 1BVSA 2FJXA 4BA1I 1J97A 3MDFA 7ICQA 4MFBA 3A54A 3I56S 4JI6Q 2V8HA 4D3GA 2ENBA 2EOTA 1HNXF 3PIP3 1L2FA 5J0SA 3CCVA 1DOLA 4WKRA 4Z7CA 2QG9B 1S59A 3ELHA 1IQZA 1RHQB 2RHQB 3R7SB 1PRTC 1IKLA 2ZITA 2BCSA 3NK9A 4EK2A 4GKKQ 4A3FG 4UAYA 1PYTA 9ICKA 1JXLA 2AQ2B 4R0JA 1N34Q 5C3EG 3V4MA 5KT5A 1SEBD 3CULA 2DJFC 2XLIA 1R89A 3T5KA 2RQXA 3H0LB 3NXWA 4A3KB 3LALA 3KLVA 1JE4A 1N2XA 5AJ3Q 4C8NA 4DL7A 4OYPA 1DFDA 3J81c 1ZAXA 1U45A 1CJTA 1FHTA 1W6JA 4V190 5KNIA 3RR8A 1BUVT 2DRAA 2LVWA 2GHPA 1PLFA 3DM3A 3WKDA 2B2UA 3R1HA 2GQQA 2FPLA 4DOZA 3MMJA 1KD1T 1U1QA 4C8LA 5JEAH 2XWJB 2KJWA 4FO2A 4USVA 4N9PA 3Q6SA 3PHEA 4ZVUB 2HNYA 2KEYA 4EEYA 4JI1L 2GO7A 2XZWA 1U1RA 3D0IE 1X3EA 1JRPA 4FPRA 2IA0A 2Y1LB 4LJZC 3NEKA 5J1EB 1MMDA 5C4JH 2V4RA 4R4IA 4A3LH 4K2JA 2YX4A 1LTGD 4B9XA 3RBDA 4KLSA 4F4XA 5ETQA 4EI2A 1F0MA 2XMMA 5IV3A 4NP5A 4CZCA 1X5TA 5DNFA 3DLHA 1N61A 2VJUA 3NBPB 2OM6A 3A8JE 4O3RA 3T19A 1RAEB 1S3OA 4XQQA 1K1QA 2PGCA 3BR9A 1ICFB 1FJCA 5A8KB 1MU2A 3MUTP 2JA6G 2NVTB 1SBBB 3FC9A 2L3MA 5ELNA 6FD1A 3CPWR 5M5YB 4LF2A 1GMUA 1L8LA 4KV8B 2V69A 3EM1A 2HMIA 2N7CA 2JA8G 3HFVA 4CLUA 1MROA 4WP3A 4RUBA 2E5LJ 2UUCL 2XN9C 4MFCA 1EQMA 3SDEA 2LY7A 2LXJA 2K3KA 3U1LA 1B50A 4C48A 5KFTA 2Q0ZX 3ILOA 4PR6A 4OCZA 2BX6A 2DNOA 5ELBA 2QILA 4NDXA 3FBFA 4LF9F 2KSOA 8ICOA 4CGZA 1UEUA 4X84A 5J0RA 2MPMA 4XYQA 1Z19A 4FDFA 4CLYA 1QB5D 1XMQL 4A47A 2JA5B 2A6HC 3JC66 2F0EA 4QIWE 1H7WA 4LRBA 3R27A 2C35B 3F73A 3PO2G 5IGDA 4I7FA 5A2QE 1BXNA 1HUZA 1TL3B 4PGXA 4IO9Q 3V05A 3SCJE 4OJ3A 1ZM2A 1SNOA 2KB2A 3A12A 1RTJA 4I1TA 4MJKA 2K7JA 2BHNA 1S49A 7ICHA 3BG3A 3H90A 2R93H 4HHUA 2F4FA 3K17A 5EUHA 4Y2AA 2IOFA 2R7QA 2BYCA 4DHVA 5JVGQ 1YQHA 1KDHA 4Y2IA 2K14A 2DGXA 2M7SA 2K06A 1M1KT 1A76A 3H40A 1S0NA 2A68C 4C2MH 1SYGA 2WV6D 2BCOA 2FLOA 1CKNB 4CF5A 4HCSA 1PBAA 4ZKBB 3ETRA 1QY7A 2GX8A 3UPFA 5LOQA 2WF5A 2JEBI 1RUSA 1UAWA 1JB7A 1LOUA 3D2WA 2F2AB 3CCMA 1TWGH 1X6JA 1VQ6S 5D77A 1ET6A 2GCFA 3SCLE 1CBKA 2LKZA 3S1TA 2G07A 1RA7A 1CQFA 3UXPA 4KN4A 5ALZA 2LEAA 1V3ZA 4LF9Q 3BJYA 3FGVA 2RSQA 2N3SA 2AX0A 1SV0A 4CHTB 5DAUA 4GXIA 3VR3A 3HZEA 1FJGF 5C42A 2DGYA 4QZDA 1X7VA 3CDUA 4OJOA 2ZJQQ 1RU1A 1NU4A 2X1AA 3UMBA 1X65A 1YNJD 4IRCA 2WTFA 3PO4A 3TKAA 3EJMA 4DX7A 3P1HA 1R8CA 1YJNS 4IYQA 5AM2A 4LNQA 4R8IA 2F63A 4A3EB 3DEPA 4P0QA 4CYUA 2RSOA 1FERA 3ETLA 2OD6A 4RUHA 2K5NA 2KXNB 1IBCB 4M6WA 2IA6A 2KFZA 1KKHA 2B39A 2IM2A 1UETA 2YNIA 1Y5LB 1WJJA 3M9BA 1ZQLA 1JIHA 4YEAA 3SCIE 4DV0J 4O3OA 5K4LA 3PW5A 2VG7B 5IQ6A 1W6KA 3HSDA 1VMBA 4LBPA 4XIUA 3M7GA 2Z7JA 4OZ0A 3BZDB 1I4RA 3PO3H 2LMIA 4QIWD 3UCZP 3HP6A 1C4CA 4IOCA 2B0CA 3OSOA 1U6BA 2MO1A 2DNQA 3H8JA 1FJGQ 3H59A 4LBHA 2EXDA 3RJHA 1SUQA 5B0EA 3IRXA 3GTJH 3J80i 2AWZA 2BE7D 4IPHA 2FTRA 3W1BA 4RWSC 1S4EA 1RTHB 4ECQA 2HD3A 3S8SA 4EGVA 4OX9Q 1HYSB 2KE7A 3C29A 4X65Q 2VKZG 2M0NA 2Z4HA 3BF4A 3BDOA 4PHPA 2LXIA 4LF4L 4NCBA 3GFHA 3JPTA 2YMLA 3BS5A 2EVZA 3R1LA 7FD1A 4DL0C 3L3FX 1R4QB 3S17H 1SV4A 1OJ4A 4DFKA 4ZLJA 1N32J 1RISA 1XO1A 1P6TA 2C2NA 2Z0SA 4AL6A 1W2BR 1OXJA 5BPCA 3W8PA 3M8SA 1MN8A 2MU2A 1GXLA 4DR1F 2B7CB 2NVXH 5HLFA 4C0HA 1CG2A 2HHPA 1X3GA 2NO4A 1KDCA 3ISZA 1J8IA 1Q79A 2GLEA 2EYMA 3NNCA 3F5AA 3A0HU 1RT5A 1HARA 3T1HJ 4RWWA 3K7AB 1PIEA 4LT6A 5LMNJ 4PG7A 5D0HA 3TREA 2DRBA 2F5GA 3CF5Q 3DOLA 5C5JA 4DNTB 5J2JA 4O42A 5KG0A 2F3NA 2WACA 1HR0Q 2KD1A 3W5ZA 2POKA 1O7ZA 4MK7A 2GS8A 1LT6D 2DGQA 3I0RA 4OX7A 1SYCA 1R0AA 3U4VA 5IYCH 1JLCB 4HTJA 4C3IB 2PA8D 3PIO3 2OEHA 2W8KA 4LFCJ 1GUNA 4QIEA 3T1YQ 3KLGB 3M8QB 3JQKA 4TU9A 4DUYJ 4DR1Q 2DUYA 3B9JA 5KG2A 4BA2I 4K0KQ 1XTCD 1S0MA 1H72C 1LT3D 2B3TB 1IKVB 1X66A 1F9EB 2JZ5A 3CJ8A 3SK8A 2VA8A 5K8PA 4P2CB 1SE2A 3W5OA 2KXFA 1IBMJ 5ALPA 3CEDA 3QU5A 2XTIA 4PG8A 3SR6A 3D6TB 4MEYA 5AI0A 3A8IA 3SZ2A 1IBLF 3DI6B 2RQ5A 3SSQA 1YIJA 3G82B 2CJYB 3K81C 1KHIA 4KH0B 3T6BA 3QGHA 5K14A 2VG5B 5C0YA 2B7BB 4WK1A 5L9XA 2DIUA 5DZ6A 2E5LL 2EG2A 5M3MB 4L5QA 5J2KA 2RKIA 4DSJA 1S1UB 4BC9A 3MXHP 4QL5A 4POFA 2CZVC 2E1AA 9ICGA 2BOAA 3DXJC 2L08A 3NRZA 2DPIA 3IRWP 2MRLA 3K5MA 4YQWA 3AU7A 3R5JB 2EFQA 3RBZA 5M5XB 1A0PA 2XIDA 2PI2E 3J81Y 1ZD4A 1PH1A 2XLJA 4LZDA 2B4VA 4A8KA 1JKHB 2FPKA 2CRXA 1Y1VG 3QPIA 5HVGA 1L7PA 3GTYX 3OL9A 4CI0B 3WWVA 3KLSA 1K1SA 1JT8A 4OELB 3PZPA 2F03A 4OLPA 1HNIB 1JJHA 3FBCA 1IN0A 3BS9A 4EYIB 9ICSA 1UP1A 4JI7J 1TY2A 1HI8A 4FP9A 1OMSA 4PV1C 3OFFA 1UEAB 5JVH3 4RR5A 2F1IA 5E3FA 2OTJS 3OYYA 3E0JA 3W3SA 2HLTA 3DWQA 5IYDG 2G0CA 1VBYA 5C0XG 3TAPA 3CYMA 3CJKA 2HQ3A 3GLJA 2ZUCA 2CA9A 3OT9A 3ULHA 1NZPA 4A3DB 3I4LA 4NCGA 4BUGA 2CQ0A 2K89A 5DBCA 4EENA 2K75A 4K4SA 4WIQA 3U27A 1S9GA 3K8VA 3M4PA 3SMZA 2F0GA 2IBOA 2H1EA 3P6YC 4OHVA 2A19A 3CJ3A 2GJFA 1TWHH 2ZM6F 4MTNA 2PFFB 5CA5A 3N97B 2OCEA 3WK5A 2ZXIA 1MGSA 3I4MG 2MQLA 1FRHA 8ICFA 2FMMA 4DN0A 3EA6A 2KKPA 1NNDA 3W2DA 2E2HH 2HFOA 2VOPA 3MCOA 4O3NA 2O2LD 4DV0L 4MKVA 1YWXA 4BBRB 4HR7B 1DOKA 1WKLA 4Y6IA 3Q8PB 3MECB 3H4DA 4PXCA 4F0HA 5C5LA 2UXCJ 1QQ7A 4MYUA 3NY0A 1EKRA 4EELA 5KFVA 1U7LA 5E2QA 2HFZA 2I5HA 2GWSA 3L2PA 1RT2B 3D2SA 2A6EC 4ZOSA 4C11A 1FE4A 3VR6A 1RTIB 1RKNA 1TL1A 3DEEA 3KF8A 1W2IA 1Y4ZB 2QKQA 4IN3A 4EUVA 5IT9c 2M52A 2P9EA 1HBMB 3RW6A 1GUWA 1Z2LA 1SQGA 3QEAZ 4NZ7A 2HBJA 3T5JA 4DV2F 2ZM6Q 3KXDA 3T56B 2A73B 3TZWA 4B3SQ 2YV5A 2ZKUA 2FY8A 1GH8A 2XNQA 1KLMB 5B0GA 1GFWB 3I3CA 1RK8A 3FEXB 3KJVA 4LSLB 2QA1A 4LFAJ 4AXIA 1VS3A 2LYBA 2JWNA 1ZETA 2UUBQ 3CCUA 1KHWA 2H4OA 3UXNA 2EYOA 1AB8A 1N32L 3EWAA 2OQKA 1DRGA 5KT3A 2IAJA 2MKJA 4BXXH 3V2TA 4N8NA 5K36G 3HX0A 5F8HA 1FRJA 1HW9A 2QA4G 3MM7A 2DKXA 3OD2A 2QA2A 3FCVA 3P5TL 4IQZA 3VQSA 4YFUA 5U47A 4TRDA 5KIXA 3C46A 1KOOA 4NZ0A 2OPPB 4ILRA 3R97A 4QUFA 1VQ7A 3TRGA 4KLDA 1UVNA 4CLLA 1ZKOA 2K1BA 5JAVA 1OPIA 3JSMA 3UFCX 5IT9U 1DY3A 4KLIA 3SE0A 3BGUA 2JA7H 1CJKA 4OWXB 5LMNL 1IKWB 1RA6A 5IWAF 2NYIA 2KRBA 1QE1A 8ICNA 4DV2Q 2L1BA 1KXLA 1JJCB 1FYCA 1KRSA 3MTJA 2TMPA 1KNAA 3QGPA 2LDIA 2W8LA 2Q6CA 4ECUA 2OGUA 3MAHA 4K4XA 4LZGA 4C9DA 1Y7PA 1A3VA 2A1JA 1SNQA 1SIJA 1Y8OB 2A1AA 1D0EA 2Q43A 3A8JA 4V19J 4NJ8A 4BBSH 1TMJA 3RLOA 2LECA 1RWWB 1L6NA 4DFAA 1IR2A 1L3TA 4DR3Q 1VQHA 4K5SA 1XMOJ 4GVBB 4DUYL 1B3TA 2HIVA 2E2IH 3CCLS 1L0YB 4C3JB 5C4JB 1PH3A 4OIXA 2VQEF 3MCSA 3FHWA 2X3DA 1LFPA 4HN7A 1J5EF 5JJIA 4OFZA 1IBML 2CNLB 1Q12A 3UDCA 2PYKA 1HZBA 4LF8L 4KHPL 2ZXRA 2XGPA 5IWAQ 3SQOP 1NJIC 4LFBJ 2PNHA 2NXCA 4GLAC 2CPJA 4XT1B 4Q43A 4U6PA 4R5PA 4OI0A 9ICRA 2CH4A 3ZDBA 3QATA 3QT5A 1BWVA 3H20A 5I3UA 2H4YB 4LSNB 2MKSA 4HACA 3NUQA 1RT1A 2DD8S 2H5EA 1B43A 4H4MA 4NLXA 3VYUA 5KFIA 5NUCA 3GFXA 5AICA 1MLAA 2OEOA 2B8PA 4ZVQB 3G4SS 4F3QA 1RHRB 2KA7A 1IL8A 2DNPA 2ASDA 3HHLC 1B4FA 2P35A 4YFKA 2VPXB 2SNMA 4DV5F 2A0FB 3H8MA 3TADC 3UDXA 4E2FB 3QUQA 2HYIB 4A3LG 5IYBH 2B6AB 4Y28C 5CABA 3MMAA 5FJ4A 3UNYA 3QSIA 5HQ8A 2NXUA 4KJOA 1S5LU 1AW7A 4IH7A 2XTJP 2VQEQ 4C3KA 2EG1A 2MLYA 1J2NA 3WU2U 4KQZA 1PK3A 1J5EQ 4C97A 4IQUA 1S79A 2MSTA 4F71A 2BJDA 2CRLA 3STBC 3IDWA 4M63A 1U2RA 4AE5A 4GKJJ 1ET9A 4IO9A 3HZXA 2K8CB 4ZS6A 1XNRF 4M47A 3JPQA 2E8MA 2YWGA 1TQOA 2MEWA 1GXTA 2K5DA 2F4VJ 4LBIA 1YVFA 2EZZA 1JMSA 3OTCA 1N5TA 4JI7L 2R93B 2IL8A 3E8OA 2EAPA 1LTLA 3AQPA 2FDRA 3R5BA 3E2EA 4UW9A 4O9MA 3RH4A 2W11A 1G8ZD 1KEKA 1NJYA 2UXDF 3J80E 4A48A 3KLRA 3M1VA 1ASZA 3BU2A 4RL1A 5BYQA 4C2MB 2V5HG 4DR4Q 5J2NA 2H9ZA 3RF9A 3S14H 2CPYA 4DV5Q 2IW3A 3VAFA 1JLBB 2C22A 4LF7Q 2I46A 3G6JB 3OTDA 3WC0A 1SMYC 2R7DA 2OPRB 3R5GA 4F36A 3I76A 5FOBB 2BKOA 3Q0AA 2B9YA 1ZQYA 1U1LA 2R92G 2RS2A 1WDDA 4BBYA 3OGUA 1IBKQ 2W9AA 2O4XA 2ZJQA 1ENFA 3HP3A 2JH3A 2KU7A 3H0RB 4F02A 3T79A 1J9OA 4RGMA 5I2YA 2AWNA 4X4PA 1N33F 4DNIA 1HHTP 2YTXA 3D4RA 4A4JA 5CH7B 2UU9L 3CD6S 4ZK9B 4KHVA 3Q83A 5HMLA 2YKMB 1RB0A 4DUZJ 1C1BB 1A77A 5HK4A 3TJ8A 2EE1A 1VQ8A 4JI2J 3DLKB 2UXCL 2UXDQ 4RGOS 2OHDA 4EX7A 3HKZF 4F8RA 1U5KA 4B9MA 3BDEA 5H1SE 3AQOA 1EB0A 3CC2A 5D3GA 1GUSA 3QIDA 4FZNA 3PO3B 1V5VA 5FKAC 5CV6A 2AIRB 3Q2SC 2AJQA 2Y3YA 1IXRA 3KBGA 3W9HA 2KQ3A 2F77X 9ICMA 2OP5A 1EY6A 2OTLS 5JRTA 3SAGA 3EN2A 1UWBB 2FVSA 4ZRZA 3GTJB 4NA2A 1NDPA 1N33Q 3AYHB 2XCAA 1H73A 1ZQHA 4K4VA 4K2KA 2SXLA 3IFDA 2PE8A 3ZO7A 1PKUA 2VHGA 4RAUC 4NMXA 1B22A 2J7ZA 1QZHA 1QTMA 5C3WA 1L7NA 1S1TB 3GV7B 1UE7A 3NRWA 3OJUA 4J9NA 4M9LA 3V72A 1OXUA 1HMVA 1NSPA 1OWXA 3AB9A 2ZH3A 2LU2A 2XMKA 1UFWA 3DUZA 1HD0A 2LLZA 2J8AA 2M3DA 4LIRA 3S17B 3VGUA 2P66A 2OLWA 3OUYB 1REVB 1VQLS 5GADC 5C44H 4K4YA 1XNQJ 1OS5A 2E29A 1G51A 5K8NA 2YWWA 1V38A 2DISA 2IYGA 1STYA 4PG4A 1SJFA 4ZCKA 2NVXB 5ETPA 1Q82T 3D1HA 3IG8A 1QOHA 5CV9A 5J2FA 2H48B 3ZZRA 2PMWA 3L0OA 4KLOA 2Z2ZA 3GTMH 1S72S 4A3MG 1Q0NA 3NCRA 4RQ0A 3I55A 4RNFA 4MTPA 4K6LA 7ICMA 2HRYA 4OGQC 4IQMA 3VAKA 4R63A 3KJQB 2V8VA 2WAQG 3UDEA 3CE8A 3X1LB 5KFAA 3CD7A 4YXMA 3NGUA 4QU6A 2B5JA 4KKUA 3HHKA 1SJHD 3NE5B 3QBCA 1TKTB 5G0RB 3P4UB 4RX6A 3CF5A 1KBUA 1JCKB 1CA6A 4B3RF 4Y2SA 4F5QA 2CQ2A 2G09A 4L73A 3QZ7A 1LWFB 1TY0A 2B2TC 3O6QA 3W64A 2QARB 3W7BA 4F93B 3H09A 1GO3F 4Y65A 3D68A 3CUNA 1WD0A 3ZNJ1 1WI6A 2VL6A 4PXBA 3R7NB 1EARA 3MM9B 1XMQF 2DNYA 4ZHRA 1KAAA 1PFSA 3N52A 4YP3A 1XMOL 3MMBB 5L9NA 4IFDJ 2C2DA 2IX3A 1T02A 1LFWA 4JOUA 5KOWA 4B3TL 4IJHA 2BW2A 4L72B 3H3VC 5IT9Y 2E5GA 4DV7J 3CJQA 1V85A 1A6LA 4EQOA 2WVFA 3LVWA 4F25A 1D9FA 4DV1J 3IGVA 2IC3B 4IUTA 1I94Q 2C3UA 4EVOA 4IUNA 2NZOA 2GQCA 3OSNA 4U67Q 4YOEA 2PZUA 4ZPCA 1Z2ZA 3WIVA 1LWEA 2A69D 4KD3A 4MKAA 4NXNQ 2BW7A 4LFBL 1YJVA 2CQ1A 3CCQS 3D0FA 1YJWA 1TK0A 5DG9A 1QD1A 3TEGA 5CQGA 3F56A 4M8AA 5HP4A 1O7IA 1TL4A 3J7ZT 1BMQB 5DKWA 1I6HB 4B3RQ 4ECRA 3A56A 5DM6Q 4DPYA 3WX4A 3OTOL 3LP1B 4QOTA 4J03A 3LAMA 1WVLA 1N8RC 2HOIA 3PSTA 2PI2A 4K8RA 5FLXU 1H2UX 3C1ZA 1YZ6A 2E9RX 1HQRD 2A8VA 3VF0B 3KNGA 4HVZA 4CO1A 1YBAA 2E8NA 2F4IA 1FFSB 4N8FA 1HIYA 3GONA 1AA1B 4G4KA 4JWNA 4R1JA 1MWYA 2Q8RE 3D6MB 1Y0HA 2EJGC 5K9FA 3ENVA 1XXGA 5J0XA 4USIA 4QYZJ 2HZVA 3EXCX 1MW7A 2I5JB 1P1TA 2VBWA 4ZPDA 3LOUA 4GRSA 2Y0BB 5G4DA 2QJ3A 2DHXA 5DLQE 2XMTA 2HIXA 4KKSA 1KFTA 3W2VB 4ED2A 1PAUB 3TP7A 4XQJA 4GKJL 1MQ3A 2A6HD 4OYAA 5ELCA 1YRTA 4ZP7A 4KTQA 5ETTA 3QU4A 1IYJB 1P1LA 2M88A 3J7A1 2EY5A 2KIWA 1U1NA 3CWJA 3GTKH 5EE3A 5KL1B 5G3LD 2HLUA 5B66U 3SQIA 1FNVA 4K14A 3OIPA 1O7YA 4HSVA 4PNYA 3N6MA 1PYSB 3FVQA 4Y52H 4GIBA 1EOTA 3OV7A 1VQJA 2PMZF 4ILWA 1F5BA 2H5IB 3Q22A 2FZCB 4B3OA 4M9GA 4NLPA 1JLAA 3PKMA 3QT7A 2Y0SB 1Q4RA 1SL1A 1EZ6A 1LWCB 4S3SA 2E8OA 2DXDA 1NAQA 3KWMA 1V1OA 3LWUA 1PZID 1FI4A 2EYPA 2MHNA 3R5DA 1VQAA 1PK1B 3NASA 3R8BA 1SKRA 1E7ZA 3R2CJ 4ENOA 3DMUA 1YNND 4IZ8A 2C2OB 1BDOA 5IP9H 3OL8A 4ID5B 5DGBA 4LW1A 4DSLA 1HYSA 4HTHA 2EFGA 1VMPA 4IURA 1ZJNA 4F4YA 3ER0A 5KT2A 2W9MA 4PHEA 2VJ4A 4C0ZA 1G7CB 1CSJA 3N79A 1XMBA 2WSCC 1K8GA 1UUPA 4HIOA 1SFOH 3B54A 4HI1A 2YX1A 2DFLA 1TWHB 2KHCA 1WNEA 1X3PA 5DDQC 1FDNA 4USMA 4US9A 4RQ3A 2F0OA 2HBYB 4DUZL 1FFUA 3K58A 4DGZA 3G48A 5F8NA 4JI2L 2NWGA 2E2HB 3K57A 1ZA2B 2JEGA 4B9TA 3QFHA 1Q3VA 4DR5Q 3WBZA 3CJ5A 2LCWA 4ECYA 1F2MA 1JX4A 3RU0A 2HBRB 2R9LA 4NRTA 1N56A 3DHQA 2K01A 3EBEA 2HRUA 3JAMi 5KFBA 3HHLA 2KZMA 3G7LA 2IPOB 3TBIB 1LVHA 3T51B 1K44A 3TADA 2DEIA 4O0NA 2HWHA 2RF4A 4NASA 2OMOA 7ICUA 4EQNA 2E7XA 4TSSA 1B53A 4RBUA 3W2WB 2JEJA 2CJQA 3H15A 1JJ2A 2KOBA 3E01A 5CWRA 1NLKL 4RUAA 2YWHA 3KK2B 1UEVA 2E1FA 3WZ0A 5IM0A 2W9CA 4PH5A 2CAJA 1YLXA 4JI4J 2FLPA 1ZQIA 2B8QA 2XGQA 2F65A 2NCKL 2KXHA 5GADU 4CH7A 5J2MA 1AW0A 3KLGA 4DV6J 3UQSA 2V8DA 1X4GA 4UB3A 1WG4A 1N5XA 2D5DA 2BRLA 1OO0B 3I7FA 2V2QA 1JLEB 4JI6J 1WCMG 4KPYA 1PVOA 1V1PB 2NUHA 4WYWA 3IBCB 3BJUA 2F44A 3QMQA 1CVJA 4WXWA 4NKLA 2EK6A 2MQPA 4C0BA 3OW2A 4EQPA 5IIFA 3OXLA 1ESFA 4UB1A 4NOHA 1DTTB 4RW7B 2DGVA 4GKKJ 2OFGX 3EFXD 1D9AA 2JXJA 3F8TA 2JA7B 4CO2A 2BR0A 4YY3F 4PRFA 2VPYB 3VR2A 1N34J 1QNKA 4I2DA 2BE5C 3OTQA 4HH0A 5HN0A 3I9ZA 1AZSB 1ZOTA 5E3AA 3J81j 3UDGA 2FLNA 1JWUD 3VWSA 3QO9A 2VUMH 1ZRNA 4CCHA 3N6RA 5AJ3J 2CQ3A 1RWOB 2DHHA 1DOMA 1VOMA 1II3A 3EIVA 5HP1A 1RGVA 5B0BA 2B21A 1FCAA 2R8JA 2F1HA 1RTZA 5J2PA 2G4BA 3H25A 4BBSB 3J7Z5 1WHVA 3KUHA 2IRUA 4JC0A 1NSKL 4RWXA 1KQKA 3D3RA 3I73A 2WAQC 4DV7L 3URYA 2MQHA 3L4BC 4UOHA 4DV1L 1AUDA 2NO5A 4DFPA 2E5SA 1EY5A 4UB8U 2HGNA 2JH7A 3Q8QB 4X5VA 1R8HA 1R8BA 3T16A 2W03A 1H2VZ 3NGTA 2Z8QA 4JP8A 1HBNB 2ZBRA 1WUUA 1WF1A 4PUOB 1QNUA 1RWVB 3DRRA 3W9IA 3QLHA 4UY8C 4YY3Q 3T13A 5KG4A 1WSRA 4GNXC 1FNMA 4I2FA 4OJ5A 1WC5A 4KHRA 1ULRA 1B0VA 2VD3A 7ICEA 3P7JA 1NBEB 1NUCA 2W25A 2PMZC 1WORA 4MMOA 4YUDA 2XSCA 3DLGA 3MFIA 2N4DA 3HVAA 3RZOH 1X5PA 4ZPTR 5KG3A 3V81A 3UN2A 1V9PA 1WF0A 1R8PA 1L0XB 4APVA 3FZBA 2Y8WA 4DEZA 2MJUA 4Z6FA 1O51A 2I8EA 1I3OB 5I3PA 2H5JB 2Y0SE 1NM2A 4DQQA 1SGGA 5IOCA 2IM0A 5ETOA 3G71A 4P2SA 4NEZA 3ULJA 3UDIA 3HOUH 3PYDA 3S1MH 5CRXA 1T03A 1CKMA 5BN5A 4TLQA 3OBIA 1WTWA 1ZD2P 2K60A 2VBZA 2E5JA 4DV0F 1STNA 5KFSA 3R5AA 4B9LA 4C3HH 2WF7A 3S6EA 5KGUA 3KK7A 2MJ8A 5J1PA 3ISCA 1PYOB 4ZDNA 5BR8F 4H54A 4RPYA 2VNUD 1WG8A 2QLTA 4M2YA 3S15H 2DNNA 4JI0L 4LMZA 4F2SA 4OONA 2CFXA 2CG4A 2K3IA 1ZQPA 5JJZA 2QA4A 3ZZUA 4A8WA 4PQXA 1SR3A 2B2TA 2F8MA 4JVZA 4X64Q 4BY1B 4BS2A 1EEFD 1AUSL 2HFNA 4M5DB 4RUCA 1MJCA 1VQDA 1S57A 1GMWD 4JBCA 4U8YA 3S14B 4ED1A 1KRTA 3WDNA 4DK0A 1HBMA 2CJKA 3I8ZA 2YX8A 4HJ8A 1VBXA 1E6YB 1AFJA 8ICGA 2V67A 3I90A 2VASA 1HZAA 2QYCA 3VGSA 2B63G 2ZH7A 1D8BA 3C6UB 3NXZA 3HOYG 5T41A 2MQOA 1KLMA 2J9CA 1YGYA 1RYUA 2L5TA 1X4FA 4LSLA 3IRUA 5I4DA 4ZN3A 5IODA 4LVSA 5LL6d 3K0YA 2RP5A 4OO1H 4BGDA 2XI3A 4TY8B 4FXWA 2GAHC 3CJSA 1N32F 3BH6B 4LF9J 2WB1F 2C3YA 5I2XA 1VGYA 2D9UA 3AXKA 4PWDB 2DO4A 4NX9A 5BR8Q 4NL5A 1KRPA 2XG8A 3FP9A 3S24A 2R6GA 4CDCC 2NRVA 4YHHF 2KIVA 1RU2A 2E5IA 3A5ZB 3A7LA 4P0PA 3N28A 1FWLA 1A6XA 1WUDA 2BCQA 2Y0SD 3GDEA 4DAMA 3L3CA 2WOMB 1CTMA 9ICOA 3T1HF 1KFDA 1IWGA 5EJWA 1BF4A 2KOLA 1N88A 1ZQSA 5LMNF 2CFMA 1SZPA 2E75C 4OZNA 3TS2A 4LUVA 4C3MA 4Y2CA 1XR7A 2QO3A 2D41A 3WKEA 2EY1A 1MBYA 4O1NA 2IRYA 3AXMA 1Q7LB 3Q8LA 4I2AA 1W3SA 2OUGA 4PQUA 3HOXH 1QAIA 2PPBC 5HVHA 4R4QA 3H7IA 5LSOA 1SQFA 5JXSA 4B17A 2VPWB 3IFEA 2JOQA 1WHXA 2XULA 2DNCA 4ZJLA 4K5VA 3S1NH 5KFMA 3KD3A 2LM4A 5DB6A 4JI4L 1WI8A 2NZCA 2FE9A 4X4SA 1I3QH 1RF2D 5C4HA 4ZVEA 1DAXA 5AKZA 3V5RA 4LFCF 4A3JH 1TV9A 1A0IA 5JJLA 1FJGJ 3HOZB 2KFYA 4BY7H 3GSDA 4CE6A 2AYBA 4IKAA 2BKPA 4OHXA 2QIFA 4DV6L 1BPYA 1UW4A 1Y3KA 4PJ0U 2H3EB 3ITHA 4YHHQ 1H74A 4CO3A 1PG5B 4QZAA 6FDRA 2RRBA 3MM6B 2VQFQ 4OX9J 4JI6L 3QIAA 1IBMF 5M2RA 3K5NA 2O3DA 4X65J 4PL1A 4ZPVR 4ECVA 2F0NA 3BV8A 5C44B 1B0PA 3BYYB 3DCAA 3IP4B 5EBCA 4QY7A 2LQJA 2KRRA 3FDSA 3QNMA 2VFUA 1VISA 3GYNA 4ZN1A 1BC6A 3G87A 5CZVA 4GKKL 4YB7A 4TU8A 1ZYQA 4YR0A 3DWPA 1X56A 3P45B 2R7VA 1L1OB 2DR7A 2ZWOA 1WWHA 3GTMB 5TISU 1WTXA 3HWTA 2BANA 4CT9A 1XX8A 3T9NA 2KZZA 1NCLA 1B0XA 2IOHA 3BBCA 2NRXA 1PZKD 4OV1A 2K32A 1TV6B 2XS5A 1S9EA 3H0GG 1W7WA 2GIRA 3KHRA 1B4SA 5T7LA 2DKOB 4IC9A 4HDGA 2RQ4A 1PJ5A 2QGFB 3NVVA 1FRMA 2F52A 2RDGA 2SDFA 3GSIA 3O5TB 3UNGC 3CMAS 1LK7A 1VIOA 4KY5A 5CYQA 1OW5A 2GVAA 2ISPA 3GCWP 1BCPB 1NHKL 1HNXL 1HR0J 4I29A 2R61A 3KLEB 2ZJ5A 4DV4Q 3R9LA 3LVVA 3ND8A 1ZQQA 5FIIA 2CADA 4OV6A 1SC3B 3RUBL 3GFZA 1TU2B 4ECSA 3KDFB 2XYPB 3AB4B 3IFTA 3GP7A 1M5VC 4ZYSA 4NPSA 3PNCA 4MZ9A 1V3SA 3IRBA 1Q16B 4JI7F 3NP5A 3IC1A 3G96A 4L5RC 1AFPA 4CLFA 2Z6BA 4HJ9A 1ZA1B 1BPXA 3BN4A 3IR7B 3T1YJ 2Q2IA 1HNVB 3GIKA 5M3FH 5KFXA 4DR1J 1C1CB 2LS01 1S5DD 4ERDA 1UPMB 4K0KJ 2CHBD 1VQ5A 1GHJA 3M30A 2HW3A 2RDFA 3N5FA 4H4KA 4M1KA 1VQ4A 3FKBA 3GV5B 1Q78A 1SZHA 5JU5A 1WFQA 4I2HA 1C48A 1FFGB 4UAVA 1RZMA 3EDQB 4R4CA 1A3TA 1JLBA 5J0TA 1HQEB 2KN7A 1QWYA 3GTOB 3T1AA 2JJ4D 2ADBA 2OPRA 2H3FA 1EIYB 4MHEA 2O6KA 1YHQS 1U9LA 4N8OA 2AXTU 5M2UA 3F2BA 5AK6A 2AUJD 1T3NA 2QLXA 4ZVHA 3VAIA 3CHBD 5EKIA 3HKZB 4RW9B 3S2HH 4N47A 3FFIB 4I7AA 1E22A 2NZ1D 3F2CA 3HCXA 3BB5A 2BPCA 5C7PA 1S6PB 4U96A 1TWAH 2W9BB 3H0MB 4O4GA 2ZIUB 2BJ7A 4PWUA 5HMXA 4RU9A 4OJGA 2W43A 2JZBB 4YS2A 2O66A 2VB2X 2F1JA 3RG6A 4LRAA 5HMZA 1D1KA 2PT0A 5DZ7A 2VPZB 2P9CA 4R4TA 2VA3A 2MKYA 1U47A 3JAME 2PDAA 5C24B 3CCJS 3D4WA 1LTAD 4YCUA 2AHOB 2DH9A 2AD9A 2SEBD 2PD1A 3R2IA 2UXCF 2QYGA 5J0QA 1ZQCA 2IRXA 3SR1A 3AU6A 1RG6A 3IS9A 1ZD3A 2RB7A 4TQRA 4WFNQ 1F2GA 3GTKB 2A5HA 4IOAQ 1ILPA 2JFDA 4AYBB 3O8WA 1ROFA 2MLXA 2B4PA 3HOVH 3IHQB 4CO0A 2CKWA 5CP2A 2B2VA 5FJ8H 3N6NA 5B08A 5IT9L 3BO3A 2N3LA 3UMGA 8ICZA 2HNZA 3FCWA 1TVAA 1N54B 1JLFA 4AD6A 4A8SA 4QZEA 1SH3A 1Y3JA 1VRUA 2YX7A 1VLYA 1YEZA 5COYA 5F9NA 1QCKA 5G5GA 3C1YA 1YZ7A 3M4XA 4Q8FA 1SYDA 4Y0FA 2XVSA 5HBMB 4LFAF 4NYPA 2YXLA 5J2AA 4O44B 4TN2A 1SMYD 5GAGC 3D1QA 3C16A 3RLFA 3QWNA 5IS2A 1I4HA 1T8EA 4A93H 2I6XA 4XPEA 1X42A 2Q8TA 2H65B 5IIOA 1ZQKA 1X9SA 5CV4A 4LF9L 2ZUGA 4ZAIA 3T41A 1Y1WB 4AL5A 4WTYA 5GAEC 4BXOB 2KEDA 5HVFA 1DK2A 2ZNYA 1C7YA 2FJAB 2Q79A 5H9EJ 3ZI4A 1RQLA 3B82A 4OX6A 2WBMA 5AKHA 4J5OA 2ZBQA 3C14A 4RMFA 2CH4W 2RBMA 1P9QC 1Y69U 3ILIA 3PMFA 3MEKA 2COLA 5FO8B 3HOWG 4OI1A 4A3IH 3NENA 3V6JA 3M4QA 4I28A 2BE2B 4X66Q 3DRSA 3MVVA 2DB1A 1DK3A 2P6SA 2ZIVA 2ZOGA 1LO5D 1NR2A 3NBIA 1B8AA 1KLUD 1TKTA 1XTDA 3K7RA 3U26A 1NKEA 4MIWA 1RYRA 1ZQZA 3VZHA 1LWFA 2AEMA 2CWPA 5FO9B 1K8AC 4NI2A 4LREA 4HDHA 1RYSA 1U4LA 4N9TA 1BQMB 3MF5A 3I82A 4QJVA 2VH7A 1FJGL 3MXUA 1AZPA 1XMOF 4O3PA 1S76D 2I5LX 2HS0A 2FQQB 3MMBA 1F5CA 2FD2A 2W7OA 3MEEB 4FNHA 1S6QA 2NVQB 1XNSA 2LQBA 3OTBA 2UVWA 2MZRA 2ZM6J 4UBBA 4QCLA 4B3SJ 4YDXA 5KOXA 5GTHU 1CQNA 1NB7A 3F2UA 4YMOA 2IC3A 3R3OA 1XYIA 8ICHA 1BNPA 1FKPB 3EVMA 4KT0C 1RAGB 1R43A 4JBJA 3NQTA 3KDOA 2UUBJ 2AKWB 4QQBA 3BVZA 4JK1A 2Z0GA 1Q53A 4JI8F 2M0GB 3LPEA 2DGTA 3MXPA 1F1BB 2V8PA 1T05A 5DDYA 3W1YC 8ICPA 3GU0A 5ALSA 2I5MX 5L1LA 1U9RA 3R3TA 1H38A 3K6OA 3BQ2A 5IY0A 3ILLA 2WCXA 5H9FK 2MGZB 5ALEA 2HAFA 3NOCA 1ZQAA 3ZZ0A 5D4LA 3MGVA 2KT5A 1RDFA 4DX5A 4RA8A 3I4NB 2HCCA 9ICJA 3UI3A 2DRDA 3J7AN 2ZTDA 1DJ0A 1R0BG 5JMNA 3MUVP 2WFAA 3OPKA 5IT0A 4I27A 2VUMB 2CPIA 3F41A 1H9SB 1XPOA 3RLNA 5LSRA 5A35A 4FS1A 1SH2A 2O1PA 1C9OA 3J7YU 2I5JA 2FDNA 5F8JA 1NY4A 3K1RB 2IJ0A 2GVZB 2YNFB 2X1FA 4OI3A 1HR0L 4ZPAA 5J2HA 4Y2UA 4O5EA 5ALVA 3TYTA 4GKJF 1TELA 2OJ3A 1E2ZA 1UWAA 4QZ9A 2HBKA 3TO8A 2L4NA 2YB1A 2G13A 2F4VF 4HIMA 1RDRA 3QGGA 1NPPA 4HIKA 2XWBB 3HKZE 5EX0A 4JI8Q 3MEDB 2UUAF 1KS2A 4J9QA 4JBMA 5KEEA 2MB0B 1R9TH 4C7QA 1ZQNA 4DR3J 3E9HA 4OHZA 4G1QA 3DV9A 2FMQA 2KVSA 3T53B 4DR1L 3MUMP 2KFNA 2FC9A 3GMGA 1XBWA 2YH0A 3GV8B 4K0KL 4ZVFA 3IM8A 3PRBA 4UASA 2J9EA 5CXTA 1T5EA 2CVRA 4Q2MA 1WOPA 1PDQA 3ZZTA 1PH9A 2VUMG 3NLCA 4RNMA 3CTRA 1SV5A 2KJ8A 5EDWA 2PEBA 4DQIA 4OYIA 2PQAB 2PZTA 1PK1A 4L6V3 5IWAJ 1TS2A 3ITPA 7ICLA 4AYBE 3RZOB 2IYIA 1AZQA 2MMYA 1BCPD 2VB6A 2QEJC 2FYXA 5L39A 1VQSA 4I2IA 1EU4A 1F5AA 1N60A 2ACMA 1S77D 1TQLA 1D1IA 5DDOC 3G6YA 5FO7B 3PUVA 4FPIA 1SXDA 1JC7A 4OI6A 5DRKA 5E3QA 2QSFA 5ELFA 4R4OA 4ME3A 2IHNA 4KITB 3X3MA 1WEZA 3QUCA 2UUAQ 3HOUB 2KV2A 3S1MB 1VR6A 3N7RC 4C8YA 3I4OA 1KBRA 1Q7YT 4JI2F 3NTKA 4ME5A 4GZYC 1VC6A 2E1PA 1S1WA 5K5MA 3T5LA 4C3HB 5J1ZA 3KF6B 3BS7A 2VQEJ 1PUZA 3MXGA 2Y1IA 2HCIA 3KTQA 4O3MA 1IM4A 1J5EJ 1HFNA 2HNDA 2GO9A 2KJXA 2NXJA 3S15B 5KFUA 2M4MA 4I6AA 3KK3B 1NPKA 3P75A 3N7PD 1P8LA 2Q2UA 4WBFA 2N82B 3ISDA 1G3OA 1SJRA 1T95A 5LMUF 3NCQA 3M7DA 1HCZA 1FD2A 4NM1A 2OI2A 4M95A 5AKXA 3S16H 3W2WA 1WYDA 3HEJA 2MZQA 4TURA 3HKZD 4A8XA 5GAGU 3PRVA 3JYTB 2EXUA 2E1CA 3Q8VA 3OFGA 1RKJA 2JN4A 1PMRA 5D46A 4TYBA 3KK2A 3CKIB 4X3SA 3B0YA 4Q5VA 2EBGA 1YHBA 4G7OC 2HIYA 3WK6A 2WONB 3FC4A 2A3JA 4DR4J 1DBDA 3FQLA 2LHTA 2QEXA 1JXVA 1ZH5A 5C5MA 5GAEU 1AEXA 1HFEL 1SN8A 4J15A 4XYOA 5DS7A 4DPWA 7ICOA 4DV5J 1I50H 3QAUA 1KW4A 1IHZA 4N5SA 8ICSA 2B2UC 1MA7A 4A3EH 5KFKA 4QYRA 4LF7J 2A6OA 1RODA 4RBTA 1UNSA 3D0GE 3KJNB 4PYAA 5D4NA 2MQ8A 4CNQA 4HHHA 1XNQF 3GB0A 2EJFC 3BSAA 3CC7S 2AJFE 2EH9A 1IBKJ 1JLEA 5D3IB 1NJWA 4GOPA 3L7UA 3VALA 3JAMc 2IJNA 4AYBD 1RT6B 2F1MA 1HWKA 2ZXHA 2GGPB 1YJ9S 2C3PA 1I6JA 3KBBA 3KYHC 2DCLA 2OAUA 4OWWB 2MGSA 4PZVA 2WSEC 1VQOS 3JQJA 1JLQB 4N56A 1V1QA 2JP1A 5LMUQ 1DTTA 5D15A 3W65A 3HS0C 4QZCA 1S5BD 4MK8A 2DUDA 1J5OB 5KFEA 1C8CA 4JOIC 1MJEA 4I69A 2MY8A 2F0HA 1VQ9S 1TZ0A 4WE1B 2R7OA 5D4OA 1SAPA 4WIIA 4ILLA 5CC4A 2DNHA 3B78A 4PGYA 1L7OA 2XMVA 1B3QA 4Y2KA 1VRTA 1A15A 5FLXL 3HOXB 2KNJA 2KJ5A 1FKOB 1KL9A 2JH1A 3I56A 1TKZB 4YMEA 2MKKA 5KFWA 3NEMA 4AIMA 1WJ9A 3AY0A 3MZ5A 3S1NB 1A3UA 2RAQA 4CDEC 5D4BA 1WC3A 3K2YA 1WTVA 1F2ZA 1KKXA 1SNCA 1XNQQ 2CVIA 1I3QB 1SROA 1IKYB 4IRDA 2GJIA 2FMPA 1CI3M 4GMKA 2VIHA 1HFGA 4H44C 1COOA 2C2EA 4A3JB 1Z00B 2FIUA 4BY7B 2XRQD 1JOOA 4DV7F 9ICCA 3FMCA 2ZM6L 4LF6F 4B3SL 2HG4A 1KD1C 5THWA 4ED8A 1FRXA 1N33J 1VQGA 1EIFA 2TSSA 1MWZA 1RQ0A 4NMLA 4A4IA 2CZ9A 4HJAA 4RKLA 2LXUA 2YTCA 3TZUA 1XEZA 2UUBL 1TAUA 1PH2A 1HBNA 1E6VB 1WSVA 2WB4A 1TKXB 4H4OB 3I5BA 1X4AA 2CQDA 1GKHA 2A3VA 1HW8A 4RPZA 2A74C 1VQCA 2J0TD 1LABA 3EGWB 4ITSA 2R8GA 4GLVB 5EE0A 5EWFA 5AM0A 4KH1B 3TP6A 1AQ6A 2DR8A 1F44A 1VF5C 5KFCA 3IM1A 5KFFA 1CJUB 1KR4A 1VI7A 2CN1A 3HMJG 4F92B 3BZQA 3OFEA 2OO4A 4CJ2C 1VQEA 2C42A 3I2ZA 1BHNA 1MWQA 2XS7A 1U1PA 4R8NA 3PW0A 2KKVA 2MA1A 3MDAA 1YNXA 1F9QA 1OQ3A 3OMCA 2R7FA 2ZUDA 1VRQC 4KLLA 2K28A 1OUQA 1DLOB 2R2UA 3BQ7A 4DV2L 2D2CC 3M9MB 4LF6Q 1CFMA 8ICYA 4C3IH 5D78A 1B70B 1EHWA 1YRXA 1S97A 2P2CB 1PRTF 4DSIA 4I2PB 2VIXA 2XICA 2XHWA 4RJVA 4IFYB 5TSSA 1S6UA 2QL5B 3PUYA 3D67A 2NBFA 5KNCA 5AKGA 5AKYA 2HHQA 3KDNA 1CC7A 2UUTA 3S1RH 2VC1A 3QT6A 3KKAC 4PKDB 2OIHA 4DR3L 3DLEB 1Y88A 4GN5A 4LIWA 4NLBA 3MR3A 2RCNA 4A75A 1LQ9A 5ELEA 1A6SA 3HXMA 4DSEA 1YJTA 4CM0A 1ELOA 1GX6A 3D0HE 1ZPWX 3CD0A 5M3FB 5SZTA 1FJEB 2RF2A 1I94J 9ICUA 4BHQA 2PFOA 1RAOA 5BOLA 4IPCA 3C66A 4C0OC 4PZ7A 4NRUA 4US8A 2WB1B 4Y3CA 1J27A 1HZCA 2KCCA 5IWAL 5K20B 3D2NA 5HNKA 1KDBA 4NXNJ 1R4PB 4Y2TA 4BJQA 4LUOA 4HI2A 1N5SA 1DD2A 2MQNA 1RWUA 5JVG3 2CQIA 2PMZD 3O3LA 1IIPA 2DGOA 1M1KC 2VU5A 3C6UA 2F1FA 3MEGB 4JWMA 5KTQA 1HBUB 1Q5VA 4B3RJ 4ACOA 3EJIA 2VZAA 2AJ4A 3OXFA 2YNHB 3MABA 1ZTTA 5JJBA 3LYSA 2BRKA 2RVJA 5IILA 3S2HB 4TNOA 3Q8UA 5HGQA 2ZJAA 4RW6A 2DQNB 3C1FA 5GAHC 2V8GA 4WF9Q 1TVRB 2DY7A 2I0XA 3R2DJ 1TWAB 2IX1A 3CJ0A 4XRHA 1K5OA 2PIIA 1IL2A 3UR0A 3LP2B 2D3UA 4OYXA 2YQ0A 1A9NB 2HWTA 3HI9A 5M3FG 4OLOA 4IG0B 2HQIA 2MAXA 2RHFA 2VQEL 1RBAA 1B4OA 2L9WA 3MGHA 3NMAA 3C5GA 4R64A 2KH9A 3WK9A 4J37A 1J5EL 1JJ2R 1S7HA 2RRDA 1P8GA 4DUTA 2K5HA 3A3OB 4CGYB 3TP5A 3TR5A 1S6OA 3KJPA 3S2DB 2BACA 3R8YA 1VQ6A 5B0CA 3J7AV 3PF4A 4Q45A 1T4GA 4F7XA 3HOVB 2QB0B 1UEKA 3MPYA 2LFVA 4Q8EA 2FUG9 1U1OA 4IQTA 2KO1A 1NBWA 1XQIA 2DWQA 1HQ2A 2MXYA 1S5CD 1EETA 4CRXA 2B0GA 5HO4A 1J6QA 3I5AA 1RXVA 1RD9D 4JI4F 4NLKA 4DR4L 3TA1A 2BQ3A 4RT3A 2IX0A 3NAHA 1AE2A 1IKMA 4DV5L 1YJNA 1L0WA 3ZXWA 3FEWX 1STHA 1V3RA 1GMVA 2KL8A 3DU6A 4A93B 1Y9OA 3OW2R 3VR4A 2D1CA 3CJTA 4Q7AA 5C4ZA 1WF2A 4JI6F 3NS1A 3CAMA 1IBKL 3M2UB 3LF0A 3NNHA 1TR5A 3QZ8A 4X4VA 3DHWC 2KHJA 4ID6A 3VCBA 3BGLA 3GTQH 5A0YB 3HPOA 4DFMA 5E1FA 4QF4A 1BLUA 2M8HA 3OSPA 1XNRL 3E5SA 5FJ8G 3K8AA 2XMAA 3L7PA 2LQ5A 5KAFU 1KONA 4G57A 1VDHA 3NPPA 2DNMA 2B51A 4DR2F 1L1OA 3GD7A 1N34F 1BBUA 1MSHA 1U0HB 9ICLA 1N5VA 2IY5B 4KI0A 4IFVA 3F0NA 2UXDL 2YQ1A 3IWLA 4DR5J 1WG5A 1IR0A 2MPUA 3IO1A 3IG5A 4CTAA 4K4GA 4OWTB 1E1TA 5AJ3F 4CDFC 3MPDA 3QX7A 1ASYA 4WFAQ 3C2MA 3DYAB 4O3SA 2AV5A 5ALFA 4IALA 1JWMD 2HS4A 2BM1A 2QL7B 1LNQA 3K1ZA 3CU7A 3DRYA 1EQRA 1NK6A 3SEBA 1XU4A 1EEID 3DRPB 3FZ2A 1S48A 1CJVB 4DWIA 1U48A 2IJFA 4USWA 4FKYA 1TFRA 4OO1I 2RQMA 3ZZPA 2JVOA 2FJ2A 1N33L 2CJBA 2GMLA 1ZOLA 4DSFA 4RPFA 2FHTA 4A3IG 1ZTWA 3E9IA 2HVEA 3DMJA 3KDFA 4Q0BB 2C3MA 1KP6A 2XVTA 3RJGA 3DKDA 1VJ5A 5CYMA 3U7JA 3H2VE 8ICEA 3W62A 2LM1A 4DR2Q 4DX6A 1G1XA 3HDSA 1N62A 1VQBA 2W2PP 5CHGA 4ZJOA 2K4PA 5DG8A 3PYEA 1C1CA 1PO6A 1EUJA 2HHHQ 2LFNA 5KFYA 3CO0P 4JYAQ 2KG1A 2OPSA 1SJ3P 2JHEA 2DXEA 4J9SA 1XSLA 3TARA 4QBUA 3BYPA 2M2LA 1SJED 1ZZFA 2XQCA 2BDPA 3SAFA 3JAMY 2GHVC 2LU1A 2KT3A 3I9V9 4NYZA 3AOAA 2BUNA 4NE9C 4ZJQA 1T9VA 2EC2A 4L3NA 5HY6A 1WC4A 4NV0A 1JE5A 4QIWF 4HTIA 1FR3A 3RYLA 3ZDAA 4RW9A 1EZ8A 4RQMA 2NUCA 3FFIA 1ZQWA 2WB1E 1LK5A 2GO8A 1S6PA 3BGRA 1RHUB 2ZIUA 7ICRA 1RHJB 3EZOA 2E9TA 5KT7A 1PH6A 4RZRA 1K0RA 4C3JH 2HAIA 4CBVA 1YJRA 3CPFA 2D3ZA 2C2KB 4A3KG 3FK4A 5J2EA 1LXJA 2DT9A 4BLGA 1F2HA 1AFIA 2A1BA 3A74A 1Q95G 2XM3A 4RU2A 2F0FA 3C1EA 4JOIA 1O80A 2CKZB 2EI5A 2BPGA 2J7WA 5MLCV 1NK5A 3K4GA 3J81U 4FKXA 1SXTA 2HIQA 3HVTA 4CNYA 3TRZA 5B5EU 2CQGA 4W92B 2AQ0A 1UL3A 1R9TB 1PFNA 2BM0A 2HT1A 4M94A 3J7YI 3KLWA 1X4DA 1AP0A 2OXPA 1XK8A 4WCEQ 3NWGA 1I94L 5ALDA 5C4XH 2OHFA 5KG7A 2B3GA 2GV1A 3UQ2A 1YI2A 3BR8A 1GJXA 4XT3B 2QC3A 2EFVA 5B0FA 4MFBB 2AQ4A 2CQAA 4UB6U 4K59A 4RCNA 1KVIA 3G8SA 4F0MA 2D9PA 2E3TA 2P9GA 1VC5A 4W90B 2O5IC 3UCUP 4LF8Q 3GJRB 4KHPQ 4YY3J 5M9OA 2HK3A 2LQ8A 4KX3A 1X3QA 1RT4A 4B3RL 4NLTA 1E24A 4O44A 9ICQA 1FWKA 1N6QA 2EW9A 5GAHU 4I56A 3GDXA 5F2DA 4R9WA 2KYXA 3HT0A 4NLOA 3OLBA 4O5CA 2J7UA 3OR2A 4M9HA 2O01C 3C8YA 2VANA 1Y10A 5K5PA 4S0MA 4BXOA 5KT4A 3PHTA 5HHHA 3LWEA 2WZ1A 1VCIA 4XPCA 2LEBA 3C2LA 2ABYA 5CV8A 1VK8A 4P4MA 4FZVA 5BYSA 4BS9A 5EBDA 4J90A 2KM8B 4ANCA 2ZNZA 3GPAA 2E1MC 2AF6A 2KHSA 2GA7A 1CJTB 3UE1A 3H5YA 3QSYB 4L5SA 4M5HA 3OR1A 4X4NA 1NCVA 1HPZB 4TQUS 9ICNA 2FVCA 3M2VA 5CAAA 4ELUA 2OPQB 1N5WA 2ICIA 3CCEA 4FXVA 2WB1D 3N4MB 2OTJA 2YYZA 2RKSA 1TFYA 4U9RA 1FNWA 4AQYF 2J4XA 1K8MA 5ETNA 2R7XA 2HNYB 2HQCA 2YKAA 3PUWA 3RRGA 4EMDA 5EHHA 3PSFA 3T5HA 3CMQA 3SGIA 4DF8A 4KLTA 5AIBA 2XYHB 2PW7A 3LTOA 3PV8A 2BZFA 2IVYA 3DOKA 3AFQA 1KTVA 1LW0A 4K5XA 3S16B 1FFWB 4LRDA 3Q23A 2JA5G 4QW8A 3MXNA 5DBBA 1RSCA 4YN4A 5IP7H 4C4WA 3HHNB 3EVWA 4X64J 5FDLB 3FM9A 1BNOA 3VAGA 2LA6A 3LWMA 1KLNA 3NGDA 1LTRD 3BSCA 4ZH4A 3KKAA 3P3DA 1OY8A 3C15B 3AFGA 3MEEA 1I50B 2MQQA 5KRUA 4OX9F 4UOGA 3FEZA 2QE5A 3V4IB 3TX8A 1DQ8A 3IAS9 5AIAA 4X65F 1Q90A 5T14A 1S0VA 3CCRA 3RTVA 1OPZA 3WC2A 3FAHA 2P5VA 4NL9C 2Z2YB 1OSCA 3L7ZC 5HR6A 3PF5A 1FKPA 3D1OA 1X6OA 1N5YA 2XS2A 4RQ6A 5D0EA 4AQYQ 1QJHA 1MROB 1ZQ1C 1LTID 1K73T 2KZ3A 5J0WA 2MYFA 3SDEB 1KOHA 1UE5A 5GAEI 1WOOA 2RSNA 1KSPA 1X31C 4NLNA 2EYLA 2O5DA 4DR7F 5BR8J 2UU9Q 3AH6A 1D8ZA 4OMFG 1X4BA 4DQPA 4DR5L 2ZD1A 2KSOB 4G6VB 3UVJB 1U8SA 1U8WA 4DAYB 3FMBA 1K3RA 2MGZA 1MIUA 2YTYA 2K2PA 1TS5A 1RHKB 3WHIA 3SI8A 3R6GB 2I9SA 4ZKAA 1IKXA 4A3EG 3I70A 2BA1A 4I7FB 2FHJA 1RKIA 4P75A 3A1YG 3MR5A 3H5UA 4I2QA 1F2LA 2UXBF 1HRJA 1ZS6A 1HR0F 2XGTA 3IP0A 4ED3A 5ALYA 2N3OA 3DN9A 4QIWC 3D6CA 5T1IA 2F40A 2FMSA 1CUKA 2A2DA 5J2IA 2V2VA 4Z6EA 2ZDOA 4DX8H 3H2UB 4F4WA 4A3FH 3MWBA 4KX5A 1NJZA 3EGVA 4ZPWR 2J0QD 1S1VB 2NR0A 5LHY1 5BXIA 3TP2A 3I0SB 1SB3C 3MEDA 3SEIA 1VQFA 8ICKA 5JUMA 4USKA 4DR7Q 3T1YF 4L75A 1QSLA 2X3GA 4K0KF 2AJ0A 4YHHJ 2G9DA 1IVZA 2MKHA 3SHLA 2AUKA 2VQFJ 1FT8A 1URNA 5ALHA 2MZ1A 2N4CA 3C19A 1N5QA 1P16A 3ADAC 5EGYA 5D0GA 3G2XA 1STBA 2ASYA 5L37A 1L8OA 8ICAA 1GVPA 4CYUB 1XPUA 3DXBA 3ERQA 1LM0A 5A8WA 2UXBQ 1Z4OA 3M7VA 1WWUA 1HHQA 1YRUA 5DG7A 4KKOA 1A8VA 3PXGa 3AOCA 2DNEA 3V96A 1UTAA 1RWMB 2OEJA 8ICQA 4MFAA 2YNIB 3BZKA 3UE0A 2NSCA 4QIFA 4KSEB 5CA7A 2FZGB 3RD4A 3CCLA 3SXHA 2VS1A 2FGOA 3VR1A 1UPHA 1NEEA 1S99A 3SV4A 3TACB 1TKDA 2HK2A 1CK1A 2LKYA 5ISRA 5EOZA 5CBEE 2ZUAA 1X60A 2DY1A 1Q8LA 3SFGA 1RTOA 3S1RB 3BPDA 3HZGA 5C2CA 5ITHA 4WJ3M 2OMLA 1WHYA 1HBOB 3GJSB 3IRXB 4DV4J 2XCPA 1Z47A 2HVHA 4XDDA 3L4PA 1JMCA 1LXNA 1QVFA 1I6HH 2ZXPA 4J9RA 2DGZA 5I4MA 2G5HB 3S1QH 1ZQXA 4QZFA 3G4SA 4R8UA 3WIUA 2JK8A 1SRUA 2J6SA 1YI2S 4XK8C 3TVKA 1QTNB 4YY3L 4C3IG 2HHTA 3JYTA 2D8CA 2VG6A 5HJYA 1PILA 5JOBA 1UAPA 4A8OA 1JB3A 2QTWA 3MPUB 2DNZA 2XY5A 4J9KA 2HBZB 5J0YA 1NE3A 3BKTA 1K0VA 4ES2A 5DLFA 3D6JA 4LJXA 1EFWA 4N8X1 2HVZA 3OTOQ 1YITA 3PO2H 5AI5A 2K1RA 5AKIA 4IUVA 1FK9B 1VQPS 1QSSA 3F1ZA 5K8MA 3ET6A 5DM7Q 4USUA 5ALRA 4DPGA 1BBXC 1RLDA 2ICEC 3M8WA 2HVDA 5LJ3Y 1CULB 1M5KC 3H5SA 4CWBA 2GGPA 1RTDA 4WFZA 2JSXA 3U58A 1CM9A 5HMWA 3AL0B 1S5FD 2VICA 5HL7Q 3DOLB 2JRSA 3FUYA 5M3MG 4XUSA 1S10A 1JLQA 3ENQA 8AT1B 2K50A 3GIMA 2IJRA 2GW8A 2WW4A 2KYZA 1TS3A 3D8GA 3RUZA 4ZKCB 3KK1B 3CCES 2W01A 4UW2A 3ALRA 5ELDA 4KLMA 5FLMG 3I0RB 3RR5A 3AQQA 1WG1A 4C8MA 1IM6A 9ICFA 3Q8YA 5A76A 1S12A 4DAPA 1JORA 3ICEA 3MPVA 4IQXA 2NS1B 1ONLA 3P5BP 1PBUA 4X64L 2ZH8A 1TKZA 5EWEA 5MAOA 4B08A 4B9NA 2E7WA 1OXTA 2L5YA 4RHSA 1OIAA 1SIZA 3O44A 4UP7A 4PL2A 1T0TV 3DGPA 1JXEA 2FJBB 3CD6A 4UUXA 1HD1A 3M8PA 2W7AA 3KHLA 4B3SF 1LKYA 3CGIA 1ESRA 3QGIA 3M6ZA 1ICWA 4KGXB 1NSQA 3NTUA 2RS8A 2JJQA 4DCOB 2I6WA 2UUBF 2EQYA 4NLUA 2CPRA 2GA4B 2GMJA 5AM3A 3TQEA 1DOQA 4EQ5A 3DXSX 1JOKA 3GTQB 1E6VA 3CCRS 4F4KA 1UJ5A 3CNHA 4X4QA 3FNNA 1O08A 3KZIU 4H4OA 3M2RB 1YJUA 5BR8L 3IAYA 4RH6A 3CC4S 1FNUA 4A3DG 2ROEA 3N01A 1Q81T 2W54A 3NELA 5IIJA 2QX0A 1TIID 1CKOA 3HKSA 1PRTB 2MKIA 2NN6I 1Q1BA 4L63B 1G6ZA 4WWSA 3RR7A 2JSOA 1BOSA 3ED5A 2OTLA 1GTEA 3DLBA 1G2SA 1X0FA 2N78A 3A4TA 1HXYD 2FJWA 3WKCA 2AQ1B 2HI0A 1ZAVA 1P7DA 4ALZA 3QOLA 4KFBA 3CJ2A 2CWXA 1Q82C 1M5SA 3TI0A 3RAMA 4X66J 3C2PA 3FCHA 5IFMA 1DLOA 2I38A 3GILA 5TZVA 5DB7A 1HNZQ 3VVUA 1CS4B 4Y2RA 2K52A 1GXDC 1UMJA 1SI9A 5A2QU 1BUXA 2ASBA 1PTOF 2ZVIA 4BBRG 3NSWA 3NWTA 3HVRA 4DLGA 3M8RA 1JOQA 1VQLA 4IFYA 2MZJA 1WD1A 1SYBA 5KFPA 3PW2A 3BEGB 1X9NA 1T5XD 3BBBA 2NRWA 4HEDA 4DR3F 2ZIWA 3W66A 1Z9FA 4RQNA 1O6XA 2LXFA 2RILA 3DLEA 4I4BA 5AM4A 4F91B 1RXOB 2JL9A 2F3JA 4YHHL 1S72A 4DOCA 3M05A 1Y14B 2VQFL 3DLJA 1BQNB 4NCGB 1NMGA 1ZAWA 2HOFA 3BVGA 3CCSS 2ASLA 2R7SA 2HBQB 5KG1A 3T1HL 3ICLA 1EU3A 5I9PA 3OFHA 4DN9A 1WOSA 3R7BB 3AA9A 3J7YW 1H0HB 2RIJA 2XI2A 5FD1A 3MR2A 1S1XA 1SH0A 4DSKA 3HILA 4U673 3MM5B 2X1BA 1Q46A 3UN5A 3FRPB 4ZIVA 3F5EA 3MEHA 2Q1LA 3JQMA 3B6BA 4A8EA 4RQ8A 3D3CJ 3GYGA 2IVMA 3MAAB 3DLLA 2L9DA 1TUWA 1KTQA 3J7ZC 3TVZA 4KLJA 4Z2XA 2VZ9A 5IE8A 4NL9A 3AD9C 2FJEB 4JV5Q 3VGVA 3NBHB 5HROB 8ICUA 5GTIU 5DM63 4ZCIA 9ICVA 2ATWA 4UHVA 4A3BH 4KHZA 4P73A 1TVRA 4EZ6A 4LFCL 4OIJA 4DR6F 1GM5A 3LX0A 2ZH5A 3PMLA 3TN2A 1X9MA 4M0AA 3LP2A 3SEOA 4MEXA 3CW2C 3GFKB 4J9MA 3PUZA 4IUFA 3CCQA 4LQ3A 4ED7A 2DNRA 1TL1B 1BQXA 4X3KA 2V68A 2EIFA 1H98A 1SJ1A 1QLNA 3Q24A 3R93A 3TANA 1BQQT 4OD0A 4GO5X 1JNZB 1O8BA 3JPNA 4BCAA 4KGZB 1T3QA 2B43A 1X5SA 3KUGA 1SSOA 4I7ZC 4JI8J 3H2LA 5JEAG 5C4XB 1X0PA 4JI1J 2C9OA 3PMNA 4RFBA 3QB3A 2X6LA 4PPZA 3KJVB 3DFEA 4C3LA 1ICEB 1K83H 1O03A 1QUQA 1RQNA 3OVBA 1UCNA 1ZJMA 4DR4F 1EQTA 1CEZA 1F0XA 5KYIA 2IAJB 5AT1B 7ICPA 4PPXA 4QZIA 3LK9A 3K8WA 4C3JG 3MM7B 2B4OA 4P2MA 4LF7F 4DR6Q 2RDHA 2K5VA 2KHQA 3JSYA 2K7VA 4ZVTB 4NLWA 4R0EA 1I51B 3ZD9A 3LQVA 2DXFA 4DI6A 2CW0D 1Y1VH 1S7IA 1B99A 1IBKF 2V1CC 3B4DA 2JQOA 5I42A 4XDCA 1LW2A 2V34A 1LB2B 1FKAF 2YNGA 2CCZA 3UW1A 1YITS 3JSMB 1QQ6A 2OWOA 5LMNW 2EY6A 5L38A 1EY8A 3VCDA 2Z2LA 4DU7A 5A0YA 3IG1A 8ICMA 1CJKB 2FINB 4ECWA 1OY9A 2DBYA 2RD5C 2MSNA 3VYSA 5FP0A 1C0TA 4KTAA 1FEHA 1HUMA 3K5OA 2BOSA 4P7TA 3RB3A 3F2DA 1QE1B 4IG3A 2CWAA 2CWKA 1U09A 4K4IA 4UATA 1UPPA 2RH3A 4CF3A 1TE2A 1TWCH 4DLEA 4G7HC 2UUAJ 3A8IE 4J9VA 4WJ3B 1GTHA 4AT1B 3DDIA 1YVCA 4P71A 1PVPA 1EJ7L 4HHJA 1DARA 4N76A 2K4HA 5IYDH 4NXMF 3QWUA 3DDNA 4A8YA 5C0XH 1SJQA 4Y2QA 2HHXA 5GQOA 4BY1H 1U0HA 4KGMA 2HQEA 2ZJPQ 2A1JB 1SLJA 2JEFA 2OYYA 4LQ9A 1MN7A 3HJVA 3TNVA 2ILZA 2OF1A 2FJVA 5D3DA 2XO7A 2WIIB 4GN4B 1WC6A 1ZQGA 1B7YB 4FE3A 1UFKA 6AT1B 2Z30B 1UVKA 4JI0Q 3THPA 5AXNA 4X2BA 2HQDA 3WKBA 2Y8YA 5J0UA 3MI7X 2R2SA 3DRPA 1VDZA 5JTIA 1CJVA 3VYRA 5BYRA 4PWWA 3H98A 4V19X 2PFDA 3C3LA 1KTKA 4I2CA 1ML0D 3KUPA 1GUOA 3PYGA 4I0WA 2U1AA 4DL2A 1PH4A 4C8ZA 1JLGB 3ZTQA 2R93G 3E0FA 1PTOC 3CVKA 5B0DA 4IQVA 1Y8NB 2NZHA 5B7WA 3MHBA 4X3UA 3IR5B 3RW7A 1EIGA 1BBWA 3HVWA 3GE9A 2YMPA 1YDLA 2K7KA 1K8OA 1BPBA 1I4XA 1UT8A 4HACB 1SKWA 4H4MB 2VKQA 3AQEA 3ZC4A 2BQRA 4X4OA 3VVTA 4NXMQ 4YCWA 2F76X 4GXJA 5DDPC 4YWLA 4IFDI 4KB7A 2IIHA 4C98A 1TL7B 2JHDA 4ZPBA 2XIWA 2IVFB 2WHEA 3QIPB 2MY7A 1SYEA 4EX5A 1NXIA 1D09B 4TUQA 2X7IA 4NW2A 1TUVA 5IP7G 3I72A 5A8RB 2EC0A 1F3FA 2RLTA 3PR5B 5SUHA 1SMXA 1PAEX 4DV3Q 5EE9A 3HW8A 4LSZB 1PC4A 3QNWB 2PFNA 1K9MT 1RAAB 4WJBA 2H5XA 3TQYA 2H3QA 5J2BA 5CR3A 5LMUJ 2DF4B 4DXFA 4F04B 4LF5F 2ZHAA 2LP4A 4R25A 5GMDA 4E0DA 4CT8A 3I1YA 3E0EA 1Z3EB 4GXKA 3VR5A 2R7UA 2EZXA 1LT5D 5DLGA 3HOZH 4LFAL 3OHXC 3SDZA 3IR6B 3G6VA 5KFNA 4QWAA 1TAQA 1FVQA 4USHA 5J1EA 4P9SA 3GV3A 1UZDA 1VQMS 1OO9B 4TY9A 1AROP 1FA0A 1JQGA 3JPOA 1F9PA 2EYHA 1VLOA 2W2MP 4A3FB 3M1VB 3X3UA 2QFIA 3AM9A 3OL7A 3PO3G 5C3EB 1SBRA 3NBPA 3X3NA 3V7JA 1H6KX 1PRTD 2MFIA 3K0XA 1YKWA 4ZVSB 3GJTB 1FIQA 1TWFH 4F2RA 2YKNB 5A8KA 2CQOA 3PKYA 1CQVA 1I94F 2FVQA 1GAOA 3H3VH 4UF4A 1RCVD 1GUGA 3EVQA 4H0LC 3Q86A 1UZHA 2H3ZA 1H9MA 2HPUA 3PSIA 1Y00A 3ICXA 4KV8A 4DFDA 2BOPA 4NXNF 3LGJA 5IIKA 3IN5A 2ID0A 1RCOB 2K4KA 1X9XA 2ZFHA 4ZUIA 3TS0A 4RQ2A 4UAWA 4LF5Q 5A2QY 4L3KA 4TUSA 2Y9UA 2E1EA 2L0CA 5F0UA 4K6DA 4WK3A 8ICWA 4LF4J 3M9OB 2FC8A 1DGSA 2W3SA 2VONA 2CXEA 3R9KA 1L3UA 4M9NA 4U68A 3KJOA 3IWXA 2HZAA 2ZVSA 3B4MA 3D9BA 4HAIA 3SV3A 1PCAA 1VIXA 1HJPA 5L46A 1HHVA 5CHCB 1REGX 1MKHA 2V4JB 2BMBA 4G1PA 3HJFA 2PEHA 4ICLB 1ILQA 3D3BJ 4B9UA 2F0TA 1NMEB 4QWBA 1VF7A 4RW4B 1CPZA 3QQCD 2YN4A 2F0VA 2JX2A 5D3GB 4A3GH 5IZHA 5AK4A 1TL3A 4IR1A 3KFUA 2BA0A 4LF6J 4UZBA 2HGMA 1M5OC 1HPZA 1CSPA 4DU9A 2CJ9A 4NA1A 4MF2A 1EP4B 2RHSB 1EXNA 3NOGA 2OPQA 4NA3A 1TL5A 3W63A 3D28A 3GR0A 2HDLA 2JA6B 4RKUC 2CPHA 2F3VA 4JV0A 1HNXQ 4M8LA 1S40A 1PH7A 1GOZA 4JI8L 1CKNA 1ENCA 5IGEA 1D5ZC 2KK0A 1SNPA 2JA8B 2EANA 4BWJA 2CNNB 5CCLA 1R27B 2QW7A 4CH1A 2EDUA 2YTVA 3GTOH 2JLGA 3S1QB 3HM9A 2KG5A 3ZZYA 2ZUBA 2OQ0A 2L9HA 1FNXH 3RGIA 1T7PA 4HL9A 2AW0A 4WPAA 4UARA 1HMVB 2XEXA 1MSGA 5IYCG 3DOMB 3EQLC 4WJWA 5FDLA 2J7KA 2A69C 3QRRA 3AU2A 4AP9A 3L9ZA 3SCKE 3H94A 3C15A 2VFRA 2WAQF 2EPIA 2CQBA 2QMWA 1RJTA 3KOOA 2CDQA 4HIDA 3PO2B 3V4IA