3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 18S rRNA
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
3H3VI 1E3PA 4AH6A 4L5TA 1QZGA 4OONA 1XNQL 4BXXG 4OWXB 3M3YH 4DR5L 4JI1Q 2N3SA 1S72A 1G6PA 2Y0SG 2UXCL 3L0OA 1AE2A 1YNXA 4JI8L 3UE1A 5JEAG 3OW2A 3GTGH 2N8NA 4O2DA 4A75A 1JB7A 3S14H 5JJIA 4GLVB 2F52A 1QUQB 4GKKL 5IP7G 1YZ7A 3J81c 3UDFA 4DAMA 3RR5A 2VQFQ 5BR8L 3T1YQ 4A3MH 2YYZA 1Q7YC 2VS1A 3CCVA 1A8VA 1G291 1QZHA 1IBKQ 5JJLA 4PZ6A 1V1QA 1IL2A 4NXNL 3CC4A 2VUMH 3I56A 3CPWA 4YY3Q 2E5LL 3AFPA 4APVA 5LMNQ 1SMXA 1CKMA 2KENA 4NPSA 2R7ZG 4PMWA 5M3FH 3GTMH 2N78A 4IPDA 4P75A 4DR7L 4JOIA 5M3MH 1TWAH 3EBEA 4MZ9A 1L0WA 1K9MC 2K75A 2RHQB 3HOVG 2JA7H 1KRSA 1Q1EA 4PZ7A 4X62Q 2HQLA 1VQHA 1XJVA 1Z9FA 5IT9c 1K3RA 4JI7L 1UE7A 4C3HH 1HNWL 2KCTA 3A0JA 2ZJPA 3S2DH 4DV6Q 4GNXA 3K8AA 3CCRA 5C4XG 1BKBA 2F4VQ 4YWLA 1VQNA 1JJ2A 1EUJA 3HOXG 3S2HH 1YEZA 3ULPA 1YHBA 4LF9L 4IPHA 3PF5A 4X6AH 4IOAA 3PUZA 2Z0SA 2VNUD 2R7FA 4POFA 1NE3A 3S16H 3T1HL 1C9OA 3F2CA 4B3TQ 4NXML 2OCEA 2DGYA 4A3FH 3CCQA 5C0XI 1OXVA 2UXDL 3CMEA 1N34Q 1WCMG 2AMCB 2BH2A 1E24A 3UDXA 4A93H 2Q2HA 2I5MX 1JJCB 1SROA 4XIGS 3OTOL 1X65A 4QL5A 4DV2Q 2ZTEA 3ERSX 1J5EL 2JA5G 1C7YA 2ALYB 3E0EA 4DUZL 2K4KA 1MKHA 4C3JH 4DK3C 2GVBA 3CD6A 1Q8KA 1E1OA 3RN2A 3RZOH 4DV3Q 2JA8G 1UE1A 1YHAA 3AFQA 4BY1H 2B63H 3M4OH 1EWIA 2KCMA 4LUVA 2H5XA 3KDFA 4PG3A 4BBRH 5IYCG 4LF4Q 4UP9A 3I4MH 4O0AA 1VQBA 5E7NA 1L2FA 3TQYA 2MO0A 3TS2A 3L7ZC 4ALPA 4H02A 3G6EA 1FJGQ 3H0GG 4K0KL 2UXBL 1B8AA 2LSSA 2D0OA 2ZTCA 4P74A 3KF6A 3PUXA 1HNXL 1YBYA 2HIVA 1VQLA 3PO2H 5K36G 1XNQQ 4LF6Q 1V9PA 4DR5Q 2PNHA 5C0XG 3KYHC 4HIOA 1VQ5A 4B3SQ 2UXCQ 3CP0A 4DV0L 1X54A 4AYBE 1HNZL 2F3IA 3GO5A 3HFZB 2ES2A 4OO1I 4GKKQ 4JI0L 2ZM6L 2A1AA 4JV5Q 4BY7G 1KHIA 2Q2TA 5BR8Q 4A76A 4BA2I 1J6QA 1CSPA 1VQ4A 1K73C 1A0IA 5M5XH 4LFCL 1IBLL 4X65L 1LTLA 4KLKA 1ASYA 1XMQL 2RCNA 2IT1A 1WJJA 2HHHL 3GD7A 4AQYL 3RZDH 3D31A 3AEVA 2JQOA 5GAGC 1PHJA 2UUAL 1CUKA 4JBWA 5IY0A 4HJ8A 4A3BH 3PSIA 1UEBA 4DR7Q 2IHEA 4UP7A 1DGSA 4BBSH 3S24A 1EYGA 1D7QA 3ICEA 5FLXc 1X3EA 4DR2L 2EQSA 2LXKA 2E2JH 4R4OA 5EAYA 3HKZE 4EX5A 3CCJA 4R4QA 5LMUL 3TEHB 3RLOA 4YCWA 2VY3A 2JEAI 2BA0A 4QGUA 1MIUA 3KJOA 4A3EG 4A3KH 4A3CG 1B7YB 1HR0L 4OO1G 1HNWQ 4X64L 2JJQA 3D0FA 3BZKA 2EXDA 4LUZA 3U50C 4X66L 1R9TH 3I55A 1PH6A 3K81C 4GOPB 4JI6Q 4A3MG 2RHSB 4LF9Q 4QQBX 1IZ6A 1KC8C 5IWAL 1I50H 5HGQA 1IBKL 1LM0A 2IHFA 2YTXA 5IP9H 4DV4L 3T1HQ 4LFAL 2JK8A 2Y0SE 3F8TA 4DNIA 1WOCA 3ULLA 5IYBH 2VQEQ 3RNUA 4NXMQ 2B63G 2IX0A 3SGIA 2VUMG 1N32Q 3HOYG 3NELA 1B70B 4GNXC 4UY8C 1K83H 4IPGA 4DUYL 1EIFA 1QVGA 1J5EQ 2UU9L 3HOWH 2WB1G 4DUZQ 4C3IH 3G71A 3HOZG 4XTCS 4DR1Q 1NTGA 3A5UA 4DR3L 1GM5A 4JBKA 1G51A 3NBHB 3E9IA 3TRZA 1KAWA 2NN6G 4OXPA 4P73A 3PO3H 2EIFA 4IPCA 2K50A 1TXYA 5FLMH 2JA6G 1CKNB 4DV7L 1KD1C 4A3DH 4JI3Q 2R93H 2R92H 3STBD 1HZ9A 3CC7A 3I4NG 1UWVA 4L5QA 3PF4A 2QMUB 2YTYA 3A5ZB 4DR6Q 2XGTA 4OX9L 3GDEA 3FP9A 4K0KQ 2NVQH 2K5VA 1HNXQ 1VQ6A 2QGQA 3ER0A 4YWKA 2ASBA 3CCMA 1L1OC 5FJ8G 1YITA 1SRUA 4JC0A 1K0RA 4HIKA 4JBMA 3DM3A 4OWWB 4LF8L 1WI5A 1S40A 1BVSA 4DV5Q 4BXXH 1Y1WG 4DV1L 1VQ7A 4IFDG 3HOUG 1VQEA 4P71A 4A3FG 2LXJA 4IJHA 1X3GA 1VQPA 2UUCQ 5M5YH 1KQSA 2ZM6Q 1NJIC 4B3RQ 1YVCA 4DR4Q 3RN5A 4A93G 1VS0A 4YCUA 1GKHA 1Y1VG 1VQGA 3E9HA 4Y7NH 3PIPA 2MO1A 2PQAB 1IBLQ 4X65Q 2UUBL 5H1SE 1QVCA 4GN4B 3U4ZA 4LFCQ 1V43A 1XMQQ 3K80C 3BZCA 2NVYH 3WWVA 4JI2L 3TS0A 4R1JA 4B3ML 1M90C 2UUAQ 4JYAL 1MJEA 2WAQG 1HZCA 4MTNA 2OQKA 1AE3A 1VQFA 5AJ3Q 2I5HA 2YV5A 4YHHQ 1VQ8A 1XPOA 2R7ZH 3EN2A 2ZJQA 1OXTA 1X55A 4DR2Q 2JE6I 1L1OA 1VQMA 1XTDA 2C35B 4DPGA 3H3VH 4GKJL 5LMUQ 4JI4L 1XMOL 3KF8B 4HIMA 4GOPA 3HOVH 1HR0W 3NENA 3G4SA 1X6OA 3CCLA 2ID0A 1N9WA 1HR0Q 1A62A 5GAEC 1JE5A 4NB3A 4X66Q 1H95A 1KXLA 1I94Q 3PCOB 3A74A 5C4XH 1QUQA 2D0PA 3FKIH 4L5RC 4HIDA 3HOXH 5IWAQ 2VQFL 1IXRA 2XTIA 2K5NA 2YTVA 4LW1A 4A3JG 4LFAQ 4DV4Q 1Q46A 1PV4A 4PZ8A 5C3EG 2WP8J 1K8GA 3FHWA 3G48A 1CSQA 3K7UC 3CMAA 2A8VA 4WJ4A 4JI8Q 2BH8A 2BA1A 3S17H 2AHOB 2R7DA 4LF5L 2K5HA 1TWCH 2B3GA 4HJAA 4IFDJ 2E8GA 3TREA 4BA1I 5C44G 3GTOH 1X3FA 4A3IH 5IYDH 1WCMH 1PVOA 5LMNL 1VQCA 3CPFA 3BU2A 2KBNA 1EIYB 2AKWB 1E22A 1U5KA 1PH4A 4JCVE 4LNQA 3S1MH 2N49A 3J81j 4NXNQ 1FVIA 4A4IA 2QN6B 2JA8H 2E5LQ 1W2BA 3EIVA 4JG2A 1Q12A 3M4PA 5IYCH 4JI5L 2CCZA 2Q2IA 1EOVA 1HH2P 3M4QA 4A3GG 5DLQE 1PFSA 4OX9Q 4A3LG 1EQRA 1I5FA 1NMFA 1RL2A 3J7ZC 4LWCA 2A19A 3DLLA 3H0GH 4DV6L 2ZJRA 3M7NA 3MXNB 3PGZA 2VZAA 1GVPA 3U4VA 4LF8Q 1I6HH 2NN6I 3QSYB 2VL6A 3CCEA 4JI4Q 4JI7Q 1I3QH 3W5OA 1PH2A 1IBML 4TQUS 3W1BA 1PH7A 1ASZA 1XNRL 3UE0A 1TWFH 4GNXB 5JEAJ 1WYDA 4GN5A 4LFBL 2PMZE 4UPAA 1Q81C 2Z6KA 2K52A 3KFUA 4DV2L 1CKOA 2UUBQ 4BY7H 2DUDA 2FXQA 3CQZH 1PYBA 3W1GA 1PA6A 4KHZA 1KRTA 2AWOA 1RIPA 1SN8A 4JI2Q 1BBUA 1PH5A 2MFIA 3J80i 4A3DG 2GVAA 3ULJA 4IFDI 1YZ6A 2OTLA 3CW2C 2R92G 4JYAQ 2UXDQ 2JA9A 4QIWE 4ME3A 1W3SA 2RF4A 3OTOQ 3S1NH 4WJ3M 5M3FG 4OWTB 2WB1E 5M3MG 1HJPA 2ATWA 1I94L 4GKJQ 2YU9H 3LGJA 1XMOQ 1N36L 1K8AC 5GROA 2JA7G 2CFMA 3B6YA 5JJKA 1PYSB 4Y52H 1NY4A 3KDFB 1X56A 4LF6L 4UP8A 3GTJH 2E2IH 1HZBA 2KHIA 3KJPA 3F2BA 3KOJA 2D62A 4A3EH 1VQOA 3CCSA 4KI0A 4B3SL 4L5SA 3S15H 2HIXA 4A3CH 3F2DA 4QY7A 2UXBQ 1UE6A 3KF6B 4POGA 1LUZA 1FL0A 3CAMA 2QA4A 1YJNA 4HJ5A 1IYJB 4DK6C 1KIXA 4JV5L 4HJ9A 4GOPC 1YHQA 1LYLA 4HJ7A 2CWPA 1N8RC 1O7IA 4FDBA 4DV0Q 3RLNA 1OXUA 1HNZQ 4KHPL 4LF5Q 1OTCA 2E2HH 2KHJA 3K7AH 4JI0Q 5LMNW 3HOYH 4EQ5A 1FGUA 3U58A 4TVAB 3I2ZA 3J80c 1XPRA 5IP7H 1EFWA 2CQOA 4LF7L 2HT1A 2PI2A 3GTQH 3VDYA 1D8LA 5IE8A 3HOZH 3MEFA 4BY1G 2HHHQ 4P72A 2L15A 2VW9A 4AQYQ 1PH9A 3CXCA 1N33L 4BBRG 2WAQE 4R4IA 3GTKH 2JA6H 2CKZB 4JI5Q 3I4MG 1YJWA 3PUVA 1HZAA 3I4NH 1BBWA 3K0XA 2I5LX 5GADC 3PO2G 1VCIA 1XPUA 3FKIG 2B29A 2OQ0A 5GQOA 5FJ8H 2QEXA 4JI6L 1AH9A 3M9BA 5ELOA 1UE5A 3STBC 3OYYA 5C0XJ 1IBMQ 4JI1L 1VQIA 4X64Q 1Y1WH 1XNRQ 3HOUH 4IJLA 1T9HA 3AQQA 4RG1A 2VQEL 1Q82C 3GTPH 3J7A5 3CF5A 4LFBQ 1N32L 5IYDG 4A3IG 3L2PA 1GD7A 5C4JH 3UDIA 1GO3E 3UDGA 1Y14B 4GS3A 4YWMA 3T1YL 1C0AA 1Y1VH 1SE8A 4IO9A 4DR1L 1VQ9A 2Q2UA 2CWAA 1Q1BA 1TWGH 2OWOA 4GN3B 1E7ZA 2IX1A 4A3BG 1YI2A 1EQQA 4DAYB 1CKNA 5HY6A 3ZJYC 4JI3L 4YY3L 2UU9Q 2R6GA 3I4OA 4DUYQ 4BBSG 2NZOA 3IRBA 2Z6KC 4YCVA 1OXSC 2JA5H 3JAMi 4GLXA 4MNOA 4DR3Q 1VQKA 3GTLH 4DKAC 4DR6L 1QVFA 1PH1A 1N36Q 3M85A 1Q86C 3F1ZA 4AIMA 1MJCA 4DV7Q 4JBJA 1YJ9A 1E1TA 4A3KG 4X62L 1VQDA 4DV5L 1M1KC 3H15A 4R4TA 5GAHC 4AYBG 2NZHA 2UUCL 1VQAA 1NMGA 4RMFA 2JEBI 1JT8A 4B3RL 4DR4L 3AYHB 2F4VL 1P8LA 2GN5A 5IP9G 3CCUA 2MNAA 3PIOA 4DV1Q 2PQAA 4A3JH 1JMCA 5IYBG 1SFOH 5C3EH 4KHPQ 2AWNA 4B3TL 1VQJA 1Z47A 3Q8DA 3J81i 3RLFA 4GLAC 1WFQA 2I0QA 5M5WH 1N34L 3HOWG 1KL9A 5C44H 4IOCA 3CC2A 4J15A 1SR3A 3PUYA 4R4CA 5AJ3L 4YHHL 4LF7Q 4QJFA 1U0LA 2PI2E 3KLWA 4C2MH 1PH3A 1PH8A 2MQHA 3PV0A 3PO3G 3BJUA 1N33Q 3S1QH 5FLMG 1SLJA 3HKZG 3JAMc 4DV3L 2OTJA 1S3OA 1NBWA 4B3MQ 2R93G 2V1CC 3NEMA 3S1RH 2IY5B 1A63A 2NVTH 4LF4L 4LUOA 1X9NA 3I7FA 3JC66 5ELNA 4A3GH 1JJGA 2ZTDA 1TWHH 3HKSA 1L1OB 1FJGL 4A3LH 1YIJA 2NVXH 4JOIC 3PUWA 5J3BA 2K14A 2WFWA 1P16A 1OXXK
chains in the Genus database with same CATH superfamily
1REVB 5J0OA 2HSZA 2MZSA 3KLVA 1NZAA 2ZBCA 3OXLA 1EQTA 1X32A 3PSTA 2F44A 4K2JA 3N7RC 5KFCA 2YB1A 4GLVB 4Q7AA 3EPIA 1CTMA 3PFEA 1V8QA 3T5KA 3K59A 1DJ0A 1A8VA 5CBEE 2MKYA 3F73A 3QFHA 2EXUA 4UB4A 1XTZA 3SVMA 5ALDA 1EQVA 1C4QA 1FNWA 1X31C 5IC6B 2PCFB 1Q5YA 1IKYB 5A6PA 2WOMA 1DOLA 3LVVA 1WCMB 1HI0P 4ZJQA 2ZFHA 1RWUA 3SCJE 1RCXB 3KBXA 2JC1A 3P4UB 1FA0A 4I2GA 3K58A 1PGZA 4QYZK 3Q8QB 1OPZA 2DYAA 4LJXA 1UFKA 1K3BC 4F5NA 2DNOA 3QPIA 3M4YA 4M5JA 2NRVA 5KAKA 2NZ4A 2OEKA 1H74A 2HUGA 4DK3C 1YJTA 3MDAA 2GVBA 1Q8KA 1GHJA 4DV3Q 3MM6B 5J0PA 3V81A 1Z2LA 2AQ1B 4DSIA 2B9YA 1UPPA 4LRCA 4F25A 2VV5A 4DV0F 1Q4RA 2NO5A 2MO0A 2WTFA 4ALPA 3TS2A 5LOQA 3J80U 1C0TB 3KF6A 5EWFA 2KVMA 1H9RA 2BJ3A 2Y1LB 3BDEA 1K44A 2PN6A 1QE6A 2UXCQ 1EP4A 3UVJB 1TTHB 2HMIA 1HR0J 1AFPA 4M5NA 1IBMJ 1KFTA 2K8BB 3WKBA 4PHAA 1LTLA 2DJGC 1T9XA 4ED3A 1RD9D 4XRHA 1C2PA 2B0GA 1UWAA 1TV6B 5E5NA 5A8KA 4NL9C 4LBHA 4CTAB 4DR7Q 2A3JA 4CH0S 3ICEA 2HBKA 5DM6Q 1NJIT 2M9VA 1Q8IA 3ZFVA 3FM9A 1RXWA 3ZZPA 3K5OA 5F2DA 1D8BA 4J9PA 5L8RC 1XEZA 1MSGA 2K4PA 4ILRA 3TZZA 2OGUA 4OD0A 3H5YA 2PFOA 4G1QA 3IG1A 1UUPA 1S5LU 2SEBD 1WC4A 4NXMQ 1RKNA 1WOCA 4USMA 1DYQA 4KLOA 2H1EA 1JLFA 2ZD1B 2KO1A 1IKXA 4DUZQ 3GTPB 2QSFA 3DYAB 5ALUA 2KJVA 3E9IA 2L9WA 3VCDA 2JA6G 4DV7L 2XMVA 1ILPA 3CC7A 1N33J 2OXPA 2WAQD 4C3JB 3Q8SB 4NLZA 4WU2A 2DXFA 3I76A 1QM9A 4YG2A 3I5BA 3DM3A 1XMOJ 2WB4A 4OI3A 5L1IA 1SKRA 1GK8A 1URNA 2JEGA 2AZ3A 4MKAA 1KDBA 2DN8A 3UMBA 1OSDA 2DNGA 3MPWA 4WFZA 2OEOA 4PCQA 3TX0A 4Y7NH 3V4IA 4HKQA 4X65Q 1QVCA 3I90A 1FKPB 4KR0B 3MM9A 3PR4A 4IR9A 3C15B 3D4WA 3GJSB 3N7SC 4PGXA 1R89A 1FDDA 1KEJA 3RR7A 3RW6A 1YG0A 1A6SA 4M5HA 5E3QA 1Y5IB 3MHBA 2CPRA 2DH8A 1L0YB 4DL0C 3S1RB 5DM7Q 2YWFA 2F0PA 3BYYB 4E2FB 4HHJA 1FNVA 1VDHA 3AM9A 4USJC 2YWWA 4NLRA 2MKCA 4TU9A 3ENWA 1R9TB 1WG4A 2OPQA 3KWMA 2W1BA 2A6HC 3D28A 2F0MA 1BXTA 1ZS6A 4DA2A 2E1FA 4KC5A 3TKAA 4LRAA 1UFWA 3KKAA 1WC6A 4CWBA 2R3VA 3RH4A 3NQIA 3MC1A 1LK7A 2LDYA 3HKZD 4C56C 3H0PA 2U1AA 5HBMB 3TAPA 1SAPA 5BN4A 5JVHQ 4NLCA 5ALHA 1HARA 1K1SA 1QUVA 4M5DB 1F0XA 2JH7A 4IG0A 1JRPA 2CNLB 2Z57B 3M2UB 1RWKB 4DR5J 4LFBL 1NNXA 2CQAA 4DSKA 2CJXB 5FD1A 3KFUA 2Z6KA 4UOFA 2MJUA 3FGVA 1G2TA 4CLSA 2KM8B 5KG3A 1HD0A 2DR6A 4ZCIA 2KRBA 2GZOA 4ZDNA 5L39A 3A55A 1XNQF 2MKHA 2R92G 3U02A 2CA9A 1X5TA 5G3LF 5EPLA 1RAJA 3ITHB 3BSOA 1H9SA 1AROP 3PYDA 3ENVA 3I32A 4C48A 4B3SL 3MI7X 3F2DA 3OWFA 3BS9A 1PFMA 4H4OA 1TVXA 3OPKA 3JSMA 1SZPA 4LF9J 1DQAA 2FJAB 2BJ9A 3VR1A 8ICZA 1NKBA 2OFHX 7ICRA 4PR6A 1YDLA 3I5CA 2MZ1A 3CXCR 1F0MA 4CDDC 4ED4A 3TUIC 5HQLA 1RT4B 1CJTB 3GTKH 1KN6A 1HHQA 4GXIA 1N62A 3DHQA 5M5XB 2ZBPA 1IXKA 1PAEX 2VDIA 3MMCB 4JI3J 4OJ3A 1TT2A 3WK5A 3CJ4A 3PO2G 4ID5B 4DSEA 2XZWA 1V1PA 3J7YI 1LT4D 2GGPA 3MXPA 3H90A 4JI1L 1LTRD 3HGBA 1TKDA 4N76A 3TARA 3TP7A 4KBIA 1YT3A 5IYDG 1T02A 4IQVA 5F41A 2IRUA 4CO1A 1EY9A 1NK8A 1R0AB 4K0KF 2ZUDA 2BJEA 3FMCA 3HFKA 1PUZA 4DAYB 3EJMA 3A3NB 1I50B 3BS1A 2IHR1 5ALKA 1F2YA 1PC4A 4CLPA 5AJ3J 1WG5A 4DR4F 2E76C 2EEYA 2RMLA 1K83B 1YJ9A 2BRLA 2F9DA 4LFCF 1Z00A 3KJQB 2NXEA 2Y0BB 3KXDA 4WKYA 2EC2A 1T3QA 4B6JA 1Y9OA 3A3OB 4AYBG 3I0RA 4DQIA 1VQAA 3BDLA 2RSNA 4KSEB 5L37A 1SWVA 1P27B 3QO9B 3OTBA 2W2MP 2IJ0A 4RAUC 1ZD4A 3BVGA 2CZ9A 1C8CA 4WFBQ 3M30B 2V8GA 2XN9C 2CYYA 1AZSA 4TUPA 4YXJA 4YHHL 1D6EC 5KG1A 4LSZB 3M9MB 1I94F 3BJUA 4PPZA 2LQ5A 1SSOA 3N28A 1SYEA 2O4XA 1KWMA 4WFYA 1VQMS 1HNVB 4N56A 5FJ4A 1NK7A 2V2QA 1G91A 4CZCA 3MM7B 4ZP6A 2KT3A 3IFEA 2K4EA 2R7ZB 2GV1A 1LV9A 1EY8A 2YWGA 4R8NA 3S14H 2F52A 1ZJNA 2B6AA 1YZ7A 3Q24A 4NASA 4Y2VA 5ELBA 1RJJA 4GO5X 3HJEA 1T9UA 1F9HA 3F5AA 4NXNL 5C4XB 2Q3PA 3N0VA 3D0GE 2YB4A 4PMWA 2N78A 2R61A 4IPDA 2YBVA 4NPOA 2E1CA 4NZ7A 3RG6A 3ZDBA 3LA0A 4QIEA 4GC6A 2PC6A 3GQBA 1XSPA 1DURA 2F0QA 2MGSA 3RJHA 5FLXY 3K8AA 2EYFA 4FF2A 3G8QA 4XO0A 1AT1B 1MI2A 3FCVA 5DQHA 4X6AH 4WORA 5K8PA 1WC1A 2GOLA 4RKLA 2AJQA 4AE5A 1SYBA 1DOQA 1RXOB 2CQ0A 1I6HB 3OTOL 3TANA 2HPUA 2ALYB 1Y00A 1TWFB 1BWEA 8ICBA 5DO2A 1S5CD 1U1RA 3I4MH 4C2MB 2GIRA 1VC5A 5KFMA 3B0YA 2EFNA 2F0GA 1X2IA 3G6EA 3ICLA 5IT4A 2UXBL 2WW8A 4PRFA 2DEJA 4F93B 2C22A 2VG6A 4HDHA 1VJWA 2JLFA 3GR0A 1KBUA 2VPWB 2QA4S 2PW7A 2BX6A 3M8SA 3HFZB 2B2UC 2A1AA 4A76A 2KG5A 3LANA 2E8NA 1VQ4A 3F5EA 5A76A 1XMQL 2I9GA 3IRXB 1T11A 3CKIB 3PG9A 3QQCD 3ORYA 1ZAXA 2VBZA 5GAGC 1PYTA 3MPYA 1UEBA 4LRFA 3JPTA 4RPYA 3P3DA 4M47A 1D1IA 3RLOA 2FLNA 3FMWA 3BO4A 4A3CG 4RKBA 2WB1B 1RACB 5KFWA 3DFEA 3GG0A 9ICOA 1RT2B 1RHQB 1J5OB 1RA6A 1V85A 3C23A 2LS01 1IBKL 1RHKB 2GW8A 2H65B 2JK8A 3MUTP 1N0UA 2M4MA 3HOYG 3T41A 3AQFA 2A1JA 2XEXA 1EIFA 1U9RA 1JLGA 2ASJA 2KJWA 3HOZG 2R7TA 4Y2JA 3IFTA 2ICIA 4IPCA 4A93B 1Y10A 1KD1C 2DIVA 1PTOB 1QUPA 4P2SA 3TA0A 2CQ4A 5AM2A 2K3IA 5HK4A 4O4RA 1HNXQ 4YWKA 5J2PB 3CCMA 4FXVA 2ILYA 2MY8A 1GUWA 4JBMA 4R0JA 1WI5A 4P2FA 4DV1L 2EWHA 2B7CB 2RKIA 3CIMA 1X3GA 1QAJA 5B08A 2M2BA 2RHFA 2ZM6Q 4Q0FA 5MAOA 4ZN1A 1YSJA 5A0YA 4ED8A 2CRXA 1V43A 3C19A 2HFOA 1S10A 3EVQA 1F2MA 2WAQG 3I6PA 1WI6A 1VQFA 5BJRA 4OFZA 4YY3J 4HCEA 3KYLA 3K7RA 1L1OA 5IM0B 1VK8A 4A48A 1KKHA 2OD4A 1A15A 4KKOB 2XS5A 1GUTA 4TUSA 3HSZA 2O6KA 1N5SA 1H95A 2WVDA 1F60B 3FKIH 3HOXH 2VQFL 1PV4A 4LFAQ 4DV4Q 1AW7A 2KI2A 5HMLA 4XDDA 2NVXB 1E6YB 3JSRA 5I2YA 5ALNA 2R7DA 2K5HA 4HJAA 2E8GA 2HW3A 3PSPA 4Z6DA 1S0MA 1UA1A 4A3IH 3OJUA 3J81Y 3RRHA 1Y5NB 3M6WA 4DV6F 3OBIA 4FN5A 4MFBB 2J0XA 2Q6CA 1X9WA 3M4QA 1QH9A 4J9VA 1HA5A 2CVRA 3DDNA 3V72A 1N34F 3UMGA 4DOZA 3QRRA 3IP4B 2OKQA 5FOBB 4G6VB 4X4SA 5IT9L 1OQ3A 1RT1B 2XWYA 4DWIA 1MQ2A 2RVJA 3CCRS 2KUMA 5LXYA 3GE9A 1Q81C 5EWEA 4DV2L 2CPYA 3KDOA 2OH2A 2X1FA 2DGUA 1T5EA 2JFKA 3BN7A 3UO0A 1I6JA 2YMPA 5BR8J 1YZ6A 3M7GA 1NNLA 3NOCA 3M4OB 4KLDA 4A8MP 2W25A 3OHBA 1MHWC 2LBOA 3MABA 2LKYA 2IOFA 5T7LB 4GKJQ 4I2EA 1H0HB 3OMCA 2MHEA 2RQ4A 4F02A 2I2YA 2KHIA 2X3DA 4BWMA 1NKCA 4C3HG 1JI7A 3S15H 3CAMA 3OL9A 1C1BA 2CNNB 1YJ9S 1U1LA 1S4EA 1KIXA 1JB0C 3VGUA 4DN4M 2WZ1A 4YB1P 1BF4A 4PUOB 2CWPA 2YPYA 4M1KA 4QR0A 3G87A 4CLFA 2KU7A 4C3JG 2HT1A 2R7UA 1DQ8A 4ERDA 4EZ6A 4BY1G 3PEHA 2DNRA 2QYCA 2BCOA 3CCJS 1N63A 2RQ5A 3DOKA 5GAHI 4CJ2C 4DR6J 3M9BA 5ELOA 1UE5A 3STBC 3E8OA 1YBAA 1ZTTA 2E2JB 1Q82C 5CBAE 2B2YC 4A3KB 2P6SA 4RW4B 1TY0A 5IIOA 4J8QA 1C0AA 1N5WA 4N77A 3MBYA 2CDRB 4CP5A 3EA6A 4BBSG 2GO7A 4KJIA 2W11A 3JAMi 1JLEA 3WZ0A 1PH1A 4JBCA 4Y2UA 1E1TA 5AKJA 4X62L 4DQPA 1KTKA 1UW4A 5LMUJ 5KRUA 2YU9B 3H15A 3GFYA 2NO4A 1EY6A 1NMGA 1QQ5A 4ETXA 4F71A 3JSYA 2B9EA 3DM2B 4OZ1A 2DIUA 1L7NA 4ED2A 2Z6BA 3QX7A 1WTBA 2CN1A 3KNGA 2O5JC 3J81i 3RLFA 3W61A 5G3LD 2HFZA 5HLFA 1JQGA 4E98A 3FDSA 4QJFA 5DLFA 2IBKA 1CJUB 4NMXA 1HRJA 3CJ2A 1QAXA 1S3OA 1NO8A 3R9LA 2E9ZA 3AD9C 1A0PA 1RISA 4EBEA 2E5LJ 1BQQT 4NY8A 4O4GB 1E22A 3HHLB 2YNFB 1S72A 1R4QB 3QGPA 3X3UA 4DV7F 1NR2A 3EZUA 1D0EA 2G5DA 1H9JA 5IP7G 3ILIA 1FRIA 1IYVA 2V8DA 1QSLA 2KM8C 4PZ6A 5C4JB 2QFJA 3FBCA 2RDDA 3D3CJ 4NYOA 4DFJA 5IIFA 2KYZA 1VQ4S 3OSNA 3QWNA 4JOIA 1X0FA 1V3RA 3B4DA 2VG5B 1CZWA 4B9WA 2RCFA 2AJFE 4DSFA 1Q1EA 1ZQOA 1MN8A 1OYEA 1F2LA 1RAEB 4DFDA 4KH0B 3LVWA 3H6MA 4MAKA 4GNXA 5EE0A 5B0CA 2DPJA 2EVBA 2Q4TA 3VYTA 3PUZA 1RQLA 3ZDEA 1STHA 2R7FA 1NDLA 5D8HB 3NSWA 4J9MA 1QDUB 1VMBA 4A8FA 3CE8A 2C9OA 3DRSB 2DGTA 4RQ5A 2HBMA 4A3JB 5D4LA 1Y8OB 3HX9A 2JA5G 1UT5A 2AUKA 3DWPA 1E2VA 3RZOH 4HSVA 4IR1A 7ICNA 1EWIA 3BQ1A 3CQZB 4PV1C 4AQYJ 4GIBA 1Y7PA 2A1BA 1ZETA 1WTVA 4ELTA 4KT0C 4ES1A 1UKUA 4OYMA 3FEZA 4PNYA 4UY8T 5T1IA 4CT9A 3PIPQ 2LI6A 4IL6U 1ESRA 4M6WB 1XR7A 2RAQA 1X5SA 5AIAA 3CCMS 1Z3EB 2WCXA 4RQMA 1M5VC 2M8DB 3NS7B 5F9NA 1MMNA 3DXSX 4DU7A 3TMEA 4U67Q 2AXTU 4DXLA 4DUTA 4V1Ak 3GD7A 4H0LC 4ECYA 2HQDA 2HBLA 3MMAB 3PYGA 4HEDA 1SUQA 2JX2A 5ALTA 4LFBF 1D7QA 3OVAA 4LSNA 1S97A 1KLGD 1UCNA 2XMUA 4EQOA 3I4LA 3MEEB 5AIBA 5F8GA 2A68D 5F3TA 4EEYA 1WTWA 1ZQWA 1HR0L 3N6MA 4P0QB 3SSSA 3NGTA 3H42A 1H2TZ 5EE1A 2L0CA 2OFGX 4RUCA 4M63A 4JI6Q 1LTTD 4FF1A 1IZ6A 2F1IA 4DR3F 3GSDA 1LM0A 3UXNA 3RNUA 4C8YA 4OZNA 4UOGA 3Q8RB 2IX0A 2VA8A 1N32Q 2EAPA 3WDNA 3QGGA 1TKXA 2HRUA 2LU1A 3NRWA 1VDZA 2FJXA 4ZPVR 4EEKA 3C6TA 4XTCS 4I2JA 4G3IA 4I6WA 2PQEA 4LF7J 3PO3H 2G13A 2Y0SC 3EXCX 4ES2A 3PNCA 5FLMH 2Q43A 2QILA 2CPXA 1RE1B 1UJ6A 2W9CB 2LYAA 1UWVA 2E75C 5CHCB 2ZIXA 1ZPVA 2OP5A 3GDEA 2NVQH 4K2XA 1F9FA 2W7AA 2JMGA 3MGIA 4DV5Q 1UL3A 1Y1WG 4IFDG 5KG6A 1N5YB 2VD3A 3SQOP 4F8MA 4PQUA 2K5WA 1BBXC 4FYDA 1KQSA 1WKKA 1IWAA 2GIFA 3HJVA 8ICUA 1EOTA 2CPZA 1U1NA 2MO1A 3DLKB 2GHPA 1UAWA 1RCVD 2NPIA 4M5KA 1ZPWX 3R2TA 4K8JA 2RJZA 2ACMA 4JI1F 1VQ8A 1U47A 5AKGA 7ICIA 3UDEA 5D3IB 4RW7A 4IUQA 5LMNJ 2A74C 1PDQA 4ED6A 1XMOL 1F5BA 2V4DA 3BQ0A 3HOVH 1KONA 2PFQA 2GVDA 1A62A 3CHBD 5KYLA 4TXSA 3S1QB 3MGVA 3CEDA 3K89A 1URJA 3CJ5A 3TDQA 3K5MA 3H8WA 3M32A 2F4VJ 2KHDA 1WKJA 5KG0A 2CPJA 3KLGB 2AHOB 2GCFA 4K4HA 3QZ7A 4CDIA 1JOOA 1DHMA 4PG4A 1NXIA 3CC4S 5ITHA 3KK2B 1UW9A 4OV6A 1PSDA 4PEOA 5HP4A 3BO3A 4LWCA 2E5SA 2UVVA 3EE3A 1F3VA 1L8OA 3MXNB 1OY8A 4KD3A 4IO9Q 3NGKA 2CFXA 4MT1A 2FPMA 3W5OA 2PI4A 2MXYA 4TQUS 2Y3YA 4C3KA 5JVGQ 3ICXA 3VHQA 2HFNA 2QDBA 2Y9TA 2DNZA 3RZAA 3RJGA 4CBVA 3D4DA 3W1GA 1N52B 3QGHA 1CM9A 1PVRA 4F5QA 1KQQA 2UXDQ 3NNHA 2ZJ8A 1B9MA 2JA9A 3KUEA 1A0OB 4OWTB 2J4XA 2R8GA 4HDGA 5K5MA 1CK1A 2ZJRQ 2BV3A 1FEHA 2ROGA 5JJKA 3PIOQ 5IIMA 1UJ5A 1WD0A 1OY9A 2G4BA 2F0DA 4P2CB 4DN0A 5CR3A 2HIXA 1RHMB 2D6FC 4NCGB 4I4BA 4IQWA 3QUQA 4DPTA 2MQQA 1LW0B 1ZQEA 3DM1A 3C21A 5I3UA 2FY1A 1HNZQ 5MLCV 3U58A 4CCHA 2LECA 4RWXA 2OSQA 2F0LA 3RJMB 3G8SA 2HOQA 3Q0AA 1FDBA 3GTQH 3J7ZT 2XB2D 5C5MA 2G0JA 3LNNA 1STNA 2CNKB 1FRLA 3UW1A 5LJ3Y 1TS3A 1YJWA 2E9RX 5T1GA 3I8ZA 1BBWA 2IX3A 1PTOC 3ISCA 8ICJA 3SEOA 3UI2A 3QU2A 2AH5A 2QEXA 3NWGA 1BE4A 2QL5B 2EZYA 4C0BA 7ICVA 4WCEQ 1XNRQ 2MLYA 1JWUD 3J7A5 3I55S 3T13A 1FXDA 3HHDA 2F0IA 1FO1A 2UXBF 1SE8A 2NRWA 1H7XA 2LM1A 1FWKA 3GV7B 3UNGC 4CQ1A 2CPHA 2OWOA 2NZCA 2IX1A 1ED1A 4A3BG 3PX4A 1BCPD 4UW2A 1EU3A 4JI3L 3D1OA 5EUHA 3NVZA 8ICVA 2UUAJ 2CQ1A 2UUCF 1FKOA 3GTLH 1QNUA 4NLWA 2AF6A 3HOWB 1QOHA 1SNPA 1XMQF 3TAMB 4X3KA 1EETB 4QWEA 2EE1A 3HKZB 2F40A 3SSQA 2LXUA 3WK6A 2VPXB 3DEPA 1K47A 2XULA 5IWAJ 4GLAC 1S6PB 3DLJA 5M5WH 1BPZA 2AJ2A 3TVKA 2PT0A 4B3OB 5AJ3L 4KJOA 3ZD8A 1AFJA 1QAIA 2BDUA 3A8IE 2COLA 1I4QA 1IBKF 2MLXA 1KBRA 3RJKA 3HS0C 4BHQA 1HIYA 3ZXWA 2R7RA 1GTHA 3I7FA 2PA8D 2I9SA 3NS5A 2O1PA 1C0UA 2F0VA 1AEXA 1YIJA 2J9CA 4AH6A 1BNZA 4I2IA 4HTJA 4OWXB 4A8EA 4XUSA 1AE2A 3PDNA 2QF7A 2HWTA 4GKKL 4UBCA 3BKFA 3ZZTA 3HX0A 2HS0A 2NREA 2F2AB 4P6QA 1C4AA 3FEYB 1FRMA 5BN3A 1IL2A 4RUBA 1ECWA 5E3CA 1FNXH 4ODGA 3VF0B 2DGVA 7ICUA 5J2GA 4EMDA 1BQNA 5GAEU 2QLXA 5L1KA 3K5LA 2RT3A 4WTYA 4DL7A 1U1PA 3ZZRA 3RBXA 1QCKA 4J9LA 2IC3B 3DLEB 4CM0A 4QZ9A 3DGPA 1JOKA 2ZIVB 3IS9A 1SV5B 3D2WA 4C0HA 5DBCA 1IKWB 3DRRB 2BANB 2HQEA 1OXVA 4K4XA 2R7VA 4DV0J 1X65A 2K4KA 5HMWA 1KQKA 3RN2A 2HEKA 3VAGA 1YHAA 4KLJA 4NI2A 2V5HG 3MXGA 2EBEA 2KKHA 4RQ4A 4LF4Q 7ICKA 3TQYA 3C5GA 2G2YA 2HK2A 2F8MA 3S1NB 3DWAA 4N8OA 2YN4A 2XLKA 2V4JA 1V9PA 4QYRA 5C0XG 1H2VZ 2OEMA 1I5OB 1D5ZC 4YD1A 3GO5A 4M1UB 5ALWA 1YNJD 3IRUA 1KHIA 4BA2I 1SJ1A 1PG5B 1Q53A 1WJJA 3U1NA 3EUB2 4PG5A 2DBBA 2ZBQA 3PXGa 5EKLA 4HJ8A 1FTRA 2QLWA 4X64F 4IFYB 2GMLA 1MW7A 4DUYJ 4DR2L 1SEBD 4I1TA 5DEHA 2ZXPA 5G0RA 2KDOA 4KN7A 2HBQB 4YCWA 3KJOA 4A3EG 2W04A 4OO1G 2I1RA 1ZOTA 2W3RA 2UU9F 2V8PA 1VF7A 2JRZA 3A7LA 3P75A 5CQGA 1VRTB 5HGQA 1KTQA 2Y0SE 3ULLA 2VQEQ 1W26A 5H9FJ 4DG1B 1L3KA 4Y2KA 1MQ3A 3ZNUA 4HACB 4OZ0A 5GADU 4UB3A 1BOSA 1R8CA 4RQ8A 2R93H 2K3KA 5HGTA 4M9JA 2JV3A 2MHVA 4DNRB 1Y1VB 5FO9B 4XQJA 1ZA1B 1LTGD 1FFUA 3R6LB 4OX9L 2ZH2A 1M5HA 1SRUA 1RT5A 4JC0A 1ZAWA 4GKJJ 2ZE2B 3HHLC 2VOOA 2LXJA 2BJDA 2BCUA 2FZKB 4XQNA 2GWSA 4B3RQ 1WHWA 2CHBD 2PFPA 2I38A 4OLPA 1WC3A 2R7WA 1D9AA 3RBDA 1QCBD 4KYZA 1DTQB 1EQ0A 4JYAL 4G7HC 3W2VA 1HZCA 1U25A 3AB2B 4USVA 4CLWA 1SQGA 4US8A 4U68A 2DJWA 1IV8A 2ZITA 2BKEA 4F3MA 3LP1A 1IN0A 1FE4A 2ZZMA 3KHHA 5C44B 3Q8LA 4U8VA 3OR1A 3I82A 1WUDA 3V7KA 4O3SA 3CRKC 4DPOA 3DLHA 4I69A 5ALRA 5CWRA 2BPFA 1ZAVA 3RRKA 2IPOB 1UVNA 4OIXA 4A3JG 1U4MA 3NEKA 1LV5A 7ICFA 3CMAA 2J0TD 3KBGA 4QZVB 4O3MA 4X62F 4X4VA 3H2UB 4EX7A 5J2EA 3TADA 2HMXA 3G6VA 4K4SA 1PH4A 1R31A 5K14A 2GJIA 3S1MH 5K5PA 4F4KA 1W6KA 4OZ5A 1L5UA 4JVZA 2W4PA 4EK2A 3D6FB 3D68A 1PFSA 4IG3A 2VA3A 4DK0A 3HDSA 5IOCA 5CJ7A 3MTJA 3HKWA 2C2MB 2DNCA 3KZXA 2W2NP 1ZQVA 2Y9HA 1S5FD 5IT9Y 1XNQJ 3M8ZA 1Q78A 2D3DA 3OIQA 2RU9A 1HFNA 1QTMA 3M8YA 4KQZA 2UUBQ 4BY7H 3ENAA 1JLBB 1RM6C 5IGDA 3ILLA 2Z1CA 2BOSA 2ILZA 3BS7A 2DCUB 4M5IA 4LF6F 1KOHA 3K75D 3AQPA 1N5XA 4ZLNA 1UWBB 1VC0A 3LOUA 2WB1E 4QPTA 4F36A 4I2PA 3N7PD 2G0IA 2A10A 1WEXA 1N36L 1EB0A 1RDPD 2A6EC 2VG7B 2V34A 2B0CA 2KK0A 3M8RA 3K17A 3MMBA 5K8MA 1XO1A 4LBIA 1RZMA 1FL0A 1CJVB 3FBEA 4BBRB 4CNYA 1WC5A 1XK8A 1KLNA 4WFN3 4CYUB 5J2IA 4WFAQ 1ZQCA 1RTJB 3C6UA 3LWMA 4PWDB 3FKIB 1HNIB 5C42A 4JI0Q 3EUNA 3HOXB 5J2NA 5DB8A 3J80c 1D3WA 3W2WA 2K5QA 1KHVA 4I2DA 3CXCA 4A3IB 1XN9A 1NHKL 2XWJB 4JI5Q 4L63B 2X51A 5GMKa 2JZBB 1CC7A 1ILQA 1NK4A 2OQ0A 2NS1B 4I67A 5ETSA 4DR1F 4TKOB 3OYYA 1S9GA 5C0XJ 5EWGA 3K5PA 2F63A 1ZXIA 2JHEA 4FF3A 4TLRA 3DC2A 4IZ8A 2IM3A 1MWYA 4KFBA 4GS3A 1LTBD 4KN4C 4DR4J 4HI2A 1EEFD 4JWNA 4BLGA 4P4MA 4LFCJ 3CDUA 1GQEA 5HY6A 3SK5A 1NPKA 4DR6L 5HP1A 1VQKA 1R27B 3POTA 1IKMA 2XWBB 2BE2B 4YCXA 2DR9A 3CF5Q 1J97A 4OO1J 2FGOA 3GCXP 4FYYB 1TAMA 3PO5A 2LEBA 1I94J 1G8ZD 1JMCA 4KHPQ 4RX6A 2ZIUA 3E5SA 1WWUA 1BQXA 1AXQA 9ICEA 2I0QA 3JPSA 1HR0F 3CC2A 2K1BA 3LWLA 1SR3A 4RKUC 3D3RA 2RE1A 3EX7B 5KFBA 5BOLA 1SLJA 4DV3L 1NBWA 3NGDA 2YWKA 3IC1A 9ATCB 2L55A 2KEDA 4I2FA 4A3GH 2KJ5A 1OPIA 3RJEA 5HR6A 2PYKA 4ZVGA 4U9RA 3PUWA 2ESEA 5A8RA 4JI4Q 2WFWA 4C3LA 3W5YA 3S1TA 1E3PA 2KZ3A 5KOWA 4L5TA 3M3YH 1WG1A 1ONLA 2YWHA 2UXCL 4G57A 4A75A 2DWQA 4GO7X 2PSZA 1EX8A 1RKIA 1YKWA 4F3QA 3VAIA 2OEHA 2F0WA 1SIZA 2OI2A 4DZDA 2JVOA 1UVMA 1HQEA 2QB0B 2IL8A 2E5LL 3L5KA 2GAHC 4DCOB 4MYUA 1RWMB 3Q83A 1I51B 4MKVA 3UE2A 4DR7L 1N5TA 4DMZA 2GC8A 1NK9A 3KK3A 4OHYA 2HHQA 2JEJA 4MZ9A 5C25B 3VAMA 1L0WA 2FTRA 3HSGA 4I2AA 1H6KX 4HH0A 1BXNA 3M9NB 3D0HE 3SIPB 4DS4A 4F7XA 5E41A 4KLEA 4PL2A 3NNAA 1K3RA 1B44D 5FP0A 1S79A 1SNCA 1BKBA 3QU4A 1S9EA 3DRPA 4OHWA 3ZZZA 1ZQBA 2LEAA 1ZQPA 2WAQC 2R18A 1XMOF 4NXML 3H0GB 3CCQA 4I7FB 5K8NA 5A8WA 1GMWA 3C16B 2I5MX 2NUCA 1JIHA 3O5TB 5GAGI 3AJ1A 3VC8A 4DUZL 1SMYD 3FSYA 3UR3C 3MAAA 3ZZYA 3AFQA 3GJQB 3IL8A 4B9LA 3L7ZC 1JWWA 5IV4A 3QT7A 4V190 1DCZA 1VQLA 5HMMA 1Y8NB 1PO6A 3OGUA 1VQ5A 4JB3A 1OMSA 3SV3A 3NP5A 2ZKTA 1Y0HA 1UMJA 1ZQZA 4GC7A 1FRHA 4QZGA 2DHXA 4OI6A 4X65L 4CDGA 1ZQLA 2IT1A 4AQYL 1T3OA 4OYZA 2JQOA 2V9WA 3PR5B 2HI0A 4A8XA 4I2HA 3IR6B 4UP7A 4FYXB 4U7CA 3SXHA 3MEDB 2LYHA 4EX5A 5CH7B 3TEHB 9ICFA 3LP2B 2KECA 4OZLA 2BACA 4J9OA 4GZYC 3HKZC 5ISRA 1HFGA 2NYVA 4TUQA 1FF2A 1HBMA 2YVSA 5ETRA 1XNSA 3KHGA 1S5BD 2EVZA 2HAFA 1EWCA 3I4PA 1ZQQA 2B2TC 4L74A 3CMAS 3QJYA 1TL7B 3A8JE 1NTGA 4C0ZA 3O0FA 1GM5A 2L48A 3QIPB 4PPDA 1SJFA 1B22A 5TZVA 1HKAA 6AT1B 5KNIA 2JWNA 1QJHA 3AY0A 1DZ5A 1TWGB 3DI6B 1PLFA 1QAYA 4PMCA 4LSLB 2A2DA 1KQGB 3R7NB 2EYPA 5ELDA 2BVZA 4LVOP 5HJXA 4MTKA 4B3MF 2H51B 5AICA 1PVQA 2I5JB 2E8PA 1BY9A 3RN5A 3JYTB 1YLXA 5HAOA 3SI8A 1GKHA 2AEJA 1IBLQ 4UB5A 4NLTA 1XC9A 1VMPA 1SGGA 3FSXA 2H3VA 2F4IA 3H5UA 3AJ2A 5AI5A 5BN5A 2MZTA 2YV5A 2YMQA 3BDOA 4RHRA 2XY5A 5FDLB 5A0LA 2DNMA 2Q79A 4KE5A 3MR5A 4DL2A 1YNND 5DGBA 2MLZA 1SQEA 1RGVA 2CQ3A 1NU4A 1II3A 2YNGA 4W4MA 1LXNA 3BQ2A 3HK2A 1Z6HA 4KKTA 4X66Q 3IGNA 5B09A 3Q22A 1KOOA 3L3OC 3W8PA 4DV6J 5BXIA 9ICSA 1HUMA 4LW1A 1CULB 1Y5LB 3K5NA 4I28A 4RBTA 4QZAA 4JI8Q 4H4OB 3S17H 2XM3A 2W43A 4KHMA 5J8YA 3HILA 2B3GA 1FHTA 3FFIB 1WCMH 2ZOMA 5LMNL 1HA6A 3D6CA 2WFAA 3NVVA 1G4CA 4TYBA 4WFXA 5CCMA 1ZZFA 4TU7A 2FUG9 2LVWA 3HLUA 1AQ6A 2KD1A 2BYCA 3CJKA 4IQXA 2KJ9A 1X4BA 1JK9B 3J7ZC 3NNCA 1ENCA 1HHVA 5AJ3F 1RU2A 1UEKA 4TY8A 1FX2A 3KG4A 1BQMB 1EWHA 3Q6SA 4HHHA 4OX7A 2NN6I 1ZQMA 2MU2A 2G1DA 3TFSA 2NVQB 3OUYB 4FNHA 4X4OA 1A2TA 4OMFG 4P2HA 4GN5A 2QARB 2IA6A 1XIQA 3K1ZA 2DXEA 2HRYA 2GH1A 4C3IG 1HI8A 5H9FK 2P2CB 3NL0A 1FFVA 2YKMA 4YN3B 4FP9A 1KLMB 1GUGA 2GVAA 2OTLA 3S2HB 4X3TA 2BM1A 3VZHA 3HT0A 4MIUA 4CHTB 4N47A 3FNNA 7ICOA 4C8KA 2RF2B 2L5TA 2F0HA 1HJPA 1WSRA 4ULLA 2DRAA 4GKKF 1I4XA 2JSXA 4LUBA 2D7SA 3LGJA 3GP7A 4J1MA 3SSRA 4ZYSA 3TUPA 2GAGC 1PYSB 3DHWC 3C46A 1S5DD 4HHUA 4HVZA 4ECUA 3E6ZX 1VQKS 1VQOA 3EVWA 3NTHA 4KTAA 5HHHA 2OSRA 4CE6A 1LUZA 1OWXA 3VR6A 2HAIA 1EY7A 3CDEA 4HJ7A 2HDOA 3RLNA 1WHYA 4LF5Q 2PIIA 3RFAA 2E2HH 4AD6A 4HLBA 5J1EA 2AQ0A 3I2ZA 1ZZNA 4XYQA 4FVMA 3C14B 3VDYA 5IE8A 3BDCA 3EW9A 3CJ3A 2HHHQ 1VLOA 4ER8A 5F8HA 2NN6H 1FX4A 2KHCA 3UQ0A 4W90B 2CKZB 3I4MG 2IM0A 2XNAC 2D9OA 3N5FA 2ASLA 4ZA1A 3C2LA 3EJIA 2KSOA 4X4QA 1X5PA 2WINB 2G9OA 5KT3A 2BRKA 3M1VB 2EPBA 3CTRA 3GTPH 3AQQA 4FO6A 4RG1A 4Y2XA 4O3RA 3QT5A 2QL9B 3VGVA 1SIJA 5DG7A 4YWMA 3V96A 3UDGA 3G82B 5I2XA 3WDOA 1DTTA 4RW9A 2VPZB 1VQ9A 1U1OA 4ILMA 3NBHA 2BCVA 3MR7A 1RT3B 5AI6A 1J2NA 2OLWA 2RRNA 1EYCA 1NCVA 1I4HA 3QNWB 2V9KA 1T95A 3FCHA 4F88A 1YGYA 4ZKBB 1SC1B 2LFVA 1YITS 2NZHA 3KLFB 3RMHA 2W3SA 3I91A 1B53A 1HCZA 3AYHB 1VQ7S 1X8DA 3OQ2A 3AL0B 1K0TA 2EY6A 4DR2F 2X3GA 2DY9A 2KHVA 4ZVOB 3HRDD 2G1HA 1SDFA 2LKZA 2C28A 2NRXA 2W24A 7ICQA 3S1RH 5CYQA 2CVEA 3TACB 3GTQB 3QAUA 1ZQTA 2J0SD 3VGTA 1ET6A 2XI9A 5BYRA 3G4SS 2AYBA 3B9JA 4KMUC 5GMEA 5KNCA 4M5GA 2ZEJA 1G6PA 1R7IA 1BUXA 2KT5A 4YDDB 2HURA 1QILA 4NLPA 2ZZNA 2QE5A 3RU0A 1HBNB 5FLXU 3QEBZ 4DAMA 1F5AA 3CPWR 2I46A 4OX9F 3TN2A 4KITB 4ZPAA 1UNSA 1QZHA 2E7VA 3KZIU 5IXUA 1XTCD 4JI7F 5BYSA 2W8LA 1CKMA 1QG7A 2RS2A 1XXGA 4M5MA 1D8ZA 4TQSA 1K9MC 2FJBB 2HRTA 2K75A 3Q8VA 4ICLA 3D2NA 4Q0BA 3T51B 2MHNA 4ENOA 1HMVB 1G3OA 1UE7A 4JYAF 2JA8B 1IR1A 3Q2TC 4YWLA 1WOOA 3HOXG 2FE9A 1O0PA 3C2MA 5EJWA 4IOAA 2Q8TA 1NE3A 4F72A 9ICJA 1C9OA 4UZCA 1LLRD 1VIOA 4HIKA 1JJCB 1VI7A 1COOA 6FDRA 3UQSA 5EX3A 3ZZUA 2RDHA 4ZUIA 5AI0A 3CD6A 3M6UA 1T9WA 4FKXA 4USKA 3BG3A 4YS2A 4DFMA 3FMBA 2J6SA 4UP9A 4DCCA 1KRPA 4ZHRA 3M8PB 1ZQ1C 1HNXL 2HS3A 1ZXTA 3I31A 4LJMA 2HIYA 3ISBA 2PNHA 2JLEA 1D8YA 2Q8RE 1FNUA 3CP0A 4DV0L 3CJ8A 5HN0A 4ECTA 2ZM6L 4LFBJ 2E1PA 2OPPA 5M5XH 1T9YA 2HVIA 5CC4A 2RKIB 2PMZB 2KIWA 3AEVA 2PW5A 5M2RA 4CNQA 1ENAA 2DNHA 1B50A 1DGSA 5IV3A 4J7CA 3S24A 5IOLA 3N6RA 1NPPA 3AU7A 3K7AB 4TQRA 3HKZE 3HO1A 3JB9k 4DR3J 5KIXA 1DY3A 1AUSL 2RLTA 3M8WA 1MIUA 1DAXA 1O03A 2K04A 3AQOA 4IQUA 2JJQA 1PH6A 1BLUA 3K81C 5AKIA 4A3MG 5CGKA 3DLGA 2JXMB 1I50H 2IHFA 3T1HQ 2XSFA 4DV4L 4LFAL 3EGVA 1N36F 3M8QB 4UOHA 1SYDA 3TAQA 5EKIA 3RGIA 1Q95G 4J9SA 1K83H 4DUYL 2ZJ5A 3G6YA 3PVXA 5CV9A 4RU9A 3NS1A 2XBPA 2XO6A 5ALJA 2OPSB 5AI4A 4KKUA 1R8HA 2E1MC 4WP9A 2IHNA 3ZDAA 4IOBA 4DAPA 2K89A 2JH1A 4K2LA 4RNFA 2YX8A 2BE9B 1S40A 3CJRA 4JV1A 4RPZA 2H3QA 2A69C 2IHMA 4RGOS 4JI1J 4RPFA 4XXEA 1JB3A 1M1GA 3IDWA 4TN2A 2PQAB 5H1SE 4RQ0A 4J90A 3VQSA 1VHIA 3NBPA 3P8BB 3ZTQA 1T05B 2XS2A 5ETTA 3T56B 4IALA 1TKTA 1EIHA 1S0OA 3UPFA 3H98A 1SFOB 4EVOA 1XPOA 2R7ZH 2EFPA 3J81U 1NAQA 4F5RA 2H48B 2IWHA 2OTLS 1LW2A 2XLJA 4GKJL 1REVA 1KC8T 2VF3A 4EZ9A 4ZCLA 1NDCA 4XT1B 2YTUA 1NKEA 5C4XH 2D0PA 4DR6F 2DNYA 3Q8PB 3G48A 2DNLA 3K7UC 4OYBA 2JVRA 1RKJA 1VYAA 4IKAA 3BO2A 2L12A 3G6XA 3LGHA 4K5SA 4EGVA 4HYKA 1LVHA 2MPMA 1V3ZA 3MPUB 2BKOA 2BHNA 4NM2A 1HYSB 5CYMB 1RTIB 5CCLA 5B0EA 1IKYA 4DNTB 1AZQA 4F91B 4DU8A 9ICAA 1DM0B 2W7PA 3DRXA 1EOVA 1AB8A 3BYRA 3MPDA 1EQRA 1SNMA 1WOSA 4IH6A 5H9EJ 1PFNA 1I6HH 5K36H 1EKSA 1FRKA 2GFFA 2DRDA 5I6WA 4DV3F 1TWFH 2HHPA 5JVH3 3JS9A 5I9OA 1GMWD 3G96A 4CDEC 4JV5J 1KRTA 2KRRA 1S1VB 2F76X 2NXNA 3MM6A 1SJED 4JW0A 1RT7B 2CQHA 4TLQA 4AFFA 1WHXA 2UXCF 4O3NA 3PX0A 3S16B 1VQ9S 5KT6A 1C0TA 2K06A 1K8AC 3R9KA 1S7IA 1UEAB 1T4GA 3JTNA 1H72C 4CT8A 1B9NA 2L9NA 2OAUA 3UVJA 1FR3A 4Q2LA 2F3NA 3TA2A 5HMZA 6FD1A 3MEGB 1EY5A 3VR5A 4DR7F 4DK6C 1PZNA 2HNYB 1IKVB 5DGAA 2ZH9A 3OPOA 4FDBA 1I4RA 4MK8A 1TV6A 5CV8A 1WDDA 4URQU 2CQOA 1U0HB 1AZPA 1U49A 2VFUA 3BGFA 4GMKA 1M8AA 1U1QA 3W66A 5J0RA 4FBUA 4CF3A 1SJRA 2FHTA 2DKOB 3KLEB 1KLUD 4NXMF 4MKYA 4XTTA 1MN7A 1HTPA 3S1MB 2FINB 2FB0A 2DH9A 2DHSA 4RW6B 3CMQA 3W7BA 4DL4A 1V3SA 5BPCA 3E0JA 4DUZF 4ITSA 9ICTA 3ONNA 1QTNB 2H5JB 1TU2B 4I64A 2MP1A 2JH3A 4MEXA 2UUCJ 2ZD1A 4Y2QA 1PTOH 3JPNA 1N88A 2EAOA 3DYAA 2G2ZA 2CWAA 8ICYA 1Q1BA 4K5RA 4X2BA 2UV8A 4XIUA 1QVFR 1XMQJ 4TKTA 4CO3A 1NH8A 2Z6KC 2RSQA 2ES6A 1VJ5A 8ICWA 1CPZA 3HZEA 4DV7Q 5KFHA 2A2CA 2XWXA 4X65F 1Y8PB 5E3RA 4AQYF 5KT5A 2DEIA 4DR4L 1S5ED 1YK9A 2ASYA 2MNAA 3KK1B 2HQ3A 1VQPS 3SR1A 3QR8A 1FKPA 1L3VA 1CRXA 3DDIA 3Q8DA 4JV2A 2DY8A 2H54B 4DZ6A 5JPMC 4QIWD 3Q8KA 2XYPB 8ICAA 2NYIA 4LJZC 1G6ZA 4AP9A 3PO3G 3TO8A 4G9BA 5FLMG 2OTJA 4ZVTB 4RNNA 4XQQA 1XERA 3IR5B 3OTCA 3P5TL 5AI9A 3SQIA 4LUOA 5F8LA 2KN4A 5DBBA 4E0DA 4KD4A 1S7HA 2NVXH 1I94L 3BH7B 3OW2R 4NXZA 3H3VI 1TZ0A 4OONA 4CLTA 5ALOA 1KS2A 2C42A 3I72A 4TSSA 5JJIA 4QZDA 2LLZA 3CO9A 2RKSA 1N2XA 4IFVB 5KYIA 3V6DB 1IR0A 1N0VC 4KV8B 3R1LA 5KG7A 3RH6A 5D49A 2D3ZA 5HBMA 4UT4A 1KKXA 2HLTA 4R8UB 4M5DA 3A8IA 5A2QE 3HOVG 2JA7H 5LHY1 3M2UA 7ICJA 1XJVA 5D15A 1RYSA 1JKHB 3I0SA 1VQNA 2AT1B 2Y8YA 2W4DA 2HYIB 3CCES 5CB1A 2PZWA 2Z0SA 3DU6A 2HCIA 3RB6A 2E5IA 2MUYA 4B3TQ 1RCOB 5C0XI 4FS2A 5I42B 2XIDA 2NSCA 2VJ4A 5GTIU 2IOFK 1MU2A 1Y4ZB 7ICSA 3ITHA 5L9XA 1X40A 2B8FA 5C5LA 5C5JA 2O01C 2PO4A 2V4QA 2B51A 3M6KA 5J29A 2CVIA 3KDNA 4LRBA 1FJGQ 3PRVA 1U4LA 4UUWA 1IYUA 5LM7E 3VVUA 5LMNF 3JPQA 2AQ4A 1Q7YT 4A3GB 4USAA 1AUDA 4FS1A 4B3SQ 4QU7A 2DB1A 2WKCA 4GXJA 2IW3A 3MVVA 1NZ8A 3SR6A 1KD1T 3WX8A 1QQ7A 4OO1I 3KNAA 3T9ZA 2DHGA 4X64J 1S1UA 4DS5A 3M3YB 4BS9A 3CP8A 4X66J 3GU0A 1M1HA 1KR4A 4ZCKA 1NMEB 1RT4A 3T6BA 4OI2A 4O0IA 3G86A 1LKYA 1TFYA 1PHJA 2WONB 1M5OC 2EKNA 5HR7A 3MMCA 3KJVB 4UY85 2B5JA 2UU9J 3ONAB 2FJWA 2E2JH 3QLHB 2OF1A 3AJDA 4ID5A 3SV4A 3WU2U 4HSPA 2BDPA 2H3EB 1JALA 4A3KH 1YWXA 3WK8A 4F4XA 3EFXD 1S12A 1DGJA 5JJZA 4W98A 2EKYA 3HULA 2QRRA 4L6V3 3HHEA 3Q89A 2RHSB 3K8VA 3D6HB 2MQNA 1XJWB 2RRBA 3GYGA 1DK3A 4KMOB 3NAHA 5ELEA 1EU4A 2WVEA 2PDAA 2ZJAA 5CAAA 2G9DA 2BQUA 4OXPA 4P73A 4PYAA 5ALGA 4EI2A 1P9QC 4QW9A 2BQRA 2HGMA 2J76E 4M95A 2R92H 4LR7A 2OO4A 4MFAA 4L5QA 2FVSA 2AYMA 4K5VA 2GNKA 2ASBA 1PJ5A 1N48A 1D09B 3E01B 4FE3A 2XCPA 2N82B 1GMVA 3QGIA 2A5HA 4A3FG 1RA7A 5CEHA 3UD4P 3HXMA 3ET6B 3M30A 4J37A 4FF4A 1YVCA 3NQTA 3GJTB 4X4PA 5CHGA 4TYAA 1NDKA 4DEZA 2LYVA 5KFSA 1QLNA 4Z7YA 1HBUB 2GLEA 2OT2A 2NVYH 2C2RA 4FP5D 2R7QA 3BGUA 2KFNA 5IGGA 8ICTA 4WIQA 3UD5A 1S1TA 1AE3A 1ZTWA 4FNFA 3T16A 3N6LA 4ZVPB 4YHHQ 5C3XA 1HNVA 2ZXIA 1WTXA 2ZJQA 1Q79A 5B5EU 1Q81T 3J7YU 5C0YA 3MM7A 2CDQA 1EXNA 3GFZA 3QU5A 4M94A 3R8YA 2IIHA 4OJPA 4P0PB 5KFPA 4QZFA 1GTEA 4X62J 5HVFA 3FK4A 4LZGA 3KFWX 3PCOB 1EYAA 5AKHA 4HIDA 1FK9B 2EDGA 2XTIA 2YTCA 1K8GA 2B4UA 5AT1B 2NB0A 3FHWA 3HHNB 4ECZA 5CRXA 1ENFA 5IYDH 4N7TA 2QG9B 4S3SA 2KBNA 3ND9A 5D4NA 2FVQA 1AYEA 4NXNQ 2ATCB 2XCAA 1LTSD 2G5HB 2QZ8A 5DLQE 4DHVA 2GQ2A 3NWTA 2EYLA 5HNKA 3VR3A 4N41A 4ZVQB 2A19A 3DLLA 4DV6L 2QX0A 1HQUA 3A0HU 3TJ8A 1BCPC 4CGZA 2CJYB 5HMXA 8ICXA 5M3MB 1TWAB 2K03A 4CKCA 1XNRL 4LF6J 1M90T 2VODA 2VKRA 3W63A 2SDFA 2E5HA 3MAQA 2Y8WA 1LT5D 8ATCB 3CQZH 1B0TA 5ETVA 2XO7A 3D2SA 3AOBA 3MM8B 4OZ2A 1O08A 5JMNA 2Y0SF 4N9TA 1I4PA 1RF2D 3OTOQ 4C6AA 4DX6A 3AAWB 4C2MA 1Q82T 5L46A 3WOFA 5IQ6A 5J0YA 2AP6A 4MYTA 5DBAA 4HH1A 5C2CA 4L5SA 2J0WA 4UAWA 2N3LA 4M5LA 2UXBQ 3IO1A 5HSPA 3WKCA 3IM9A 1IVZA 4HJ5A 3RAMA 3A8KA 2RP5A 4ETZA 3AXKA 5K8OA 1TQOA 3IRXA 8ICCA 4ZVFA 1OTCA 5DDYA 4LQ3A 2ZUGA 2ROPA 1EFWA 2QC3A 3QFWA 1CA5A 3S17B 2CW0D 5A6WA 1U4BA 3LH2S 4DR1J 1D9DA 5DZ7A 2Z4HA 3LALA 1CSJA 2K28A 2PZUA 5ALQA 4KLLA 4YB5A 3A13A 3K0XA 1BC6A 3LP0A 4KLFA 2E66A 2A18A 3X1LB 1XPUA 1RT2A 1J5OA 5FJ8H 2W8KA 2OPRA 2H3ZA 3GDXA 4QW8A 2QJ3A 4IJLA 1T9HA 4Q2MA 2EY5A 1C0UB 4I2CA 1TL3B 3MXUA 3UDIA 4CLKA 4DJBA 3R2DJ 2ZUBA 3PTWA 1COKA 3H5SA 1HNXF 4OCZA 5DS7A 2R2SA 2ZOFA 3PFOA 4HT5A 3I5AA 4KLQA 2SNMA 1R43A 2QKIC 4GFJA 3LWEA 2ZC4A 3P7JA 1GX6A 3CB4A 3VAJA 4NLGA 2ZM6F 4ZLLA 2N55A 5KNBA 5J2PA 2YX7A 3F1ZA 4K50A 2KTQA 2IMWP 2L5YA 2PZTA 4PQAA 9ICGA 1SKUB 4IDKA 5H9EK 4PL1A 2G0AA 5AXMA 4YFKA 3CCUA 4DV1Q 2YKNA 4C11B 5AM5A 2WHOA 4UASA 3N5BA 1GAOA 5ETMA 4I2QA 2P8IA 1R3NA 1XS9D 1SL2A 4LMQD 1CS4B 3UN2A 2E2HB 1EYDA 3S1QH 4H44C 5IM0A 2R93G 4KKOA 3TA1A 2I6XA 1FE0A 5BOMA 4PMBA 1FYCA 4DV4F 4LFAF 3IAM9 4LF4L 5DQGA 1U1MA 2N4CA 3NCQA 4OYWA 2WVCA 4YMOA 2K60A 3FJ2A 2O3DA 2WB1F 2K14A 4DUYF 2XMTA 3FVQA 3NPPA 3ULHA 3IG5A 3AQEA 1OSCA 1V5IB 1E6YA 2KVQE 4TY9A 3ZDCA 4DPWA 3K57A 1XU4A 2CWXA 1CHQD 2VQFQ 1SWWA 4WJWA 4NWBA 2YQ1A 2FMQA 1HWJA 4C0OC 3I56A 2EY1A 9ICUA 4KLMA 3L7PA 4DL6A 5M3FH 4P75A 5KFIA 1JICA 4C8MA 1PTOF 3E51A 3EROA 4DFAA 3MTSA 2K7JA 5KT7A 3GTOB 3TUJC 1JJ2R 1RT1A 1UPHA 4HMJA 1RHRB 3S6JA 2IRYA 1TS2A 9RUBA 1JQYD 4QWDA 2A6MA 1RADB 2YY6A 3LO3A 4GKJF 1GEHA 2B2WC 4QZHA 3SFUA 3TBIB 2PMWA 2BH2A 1OY6A 1E24A 4DV2Q 4DO9A 1K0SA 5D0RA 2XMWA 4EYHB 1ZYQA 5T7LA 1F44A 1LXJA 4NEYA 5CMDA 1HQRD 3OXGA 3NRZA 3ZTSA 4O0AA 3G6JB 1N6QB 3M2RB 2KJXA 2Z9HA 1YBYA 4UZBA 1IL8A 4PUOA 2WSCC 4JP8A 1T3NA 2VU5A 3ZTRA 3BR9A 4BC7A 1YJNS 1OO9B 1I1GA 2F3VA 5IQQA 4BY7G 1S1WB 1F9RA 3EGNA 5L1MA 2VBXA 4UQGA 3PIP3 2UZAA 1QWYA 3RZDH 2F8KA 3M4XA 9ICKA 2HQGA 5KG2A 1NK6A 3O13A 2BE7D 2J5AA 3VAHA 5ALVA 2LQ9A 4MEYA 2KL8A 5KAFU 1PK3A 2W03A 1PRTB 3AHPA 4ZQ3A 2NRTA 2DGOA 3QYPA 4O5KA 1SZHA 5T41A 3D0FA 1HIWA 4ACOA 1D1KA 3L09A 5J2MB 3DXJC 1KC8C 3I4NB 4RW4A 1SXTA 4Y2IA 1HW9A 2VUMG 3VWSA 1JLAB 5AK5A 4NRUA 4I6AA 1SH3A 4GNXC 2Z7JA 1J5EQ 3HOWH 2NXUA 3HOUB 2LQ8A 3D6MB 1KDAA 4DR3L 1KAWA 2GO8A 4FKYA 2VKQA 3CJTA 1CQMA 2I1QA 1MWQA 4WJBA 2P6RA 1T7PA 3FZ2A 3STBD 2VONA 2KICA 1X4CA 4DX5A 4B3MJ 1FJ7A 4H4MB 3HFVA 3FP9A 8ICLA 3TJ9A 2K5VA 1B1ZA 3ER0A 3H5XA 3CUNA 3QRQA 1K0RA 3FVYA 1SBBB 2R4FA 3DM2A 2XYGB 1HPZB 4EU0A 3TP5A 1TS5A 1WF2A 4AT1B 2UUBL 3PIPA 1O7ZA 2M9KA 3BJYA 1CJUA 1HBOB 2HNDB 1JLQB 1P8GA 1U2CA 1U7LA 3B6BA 4US9A 3BKTA 4A8OA 2VFSA 3MR2A 9ICPA 3A8JA 5DKWA 5GAHU 4DX7A 1FJEB 4O4GA 2MSNA 1SKWA 3KF8B 1SYCA 4GOPA 4W92B 2D74B 3HHLA 1X6OA 1FT8A 3SEBA 4FZNA 2EYHA 1IM4A 4LBPA 1JOQA 4RGTA 3GILA 2CPFA 2NVTB 5TSSA 1WEYA 1DOKA 2W9MA 2YTVA 1NDPA 1TWHB 3H2LA 3MMJA 1JLCB 4Z7CA 5IT9U 4IH5A 3TREA 5LXRA 1WCNA 1S0NA 3IKJA 2VG5A 1FVIA 3T5LA 2HQIA 2KA7A 2HCCA 4MTPA 4A8SA 4QPXA 4OHZA 1JUDA 2VJ5A 4JI5L 2HNZB 4A3GG 2J6UA 2N7CA 4CO4A 5AE3A 2UVRA 5KFTA 3FSIA 3IGVA 3L95X 1ZM2A 3U4VA 1YBUA 1JNRB 2VKZG 3FRZA 2VOPA 4N9PA 2QCPX 1S99A 3W1BA 4C7ZA 1B64A 3B82A 1QE1B 2D2CC 2PMZE 4QWBA 1FFSB 3DRSA 2DKXA 2VL1A 2K4IA 4GKKJ 2K8CB 2Y0SB 4KHZA 5JJBA 4HI1A 2AWOA 1BBUA 4A3DG 5COYA 1WF0A 1ACMB 2F1JA 3S1NH 1LT6D 3A54A 3X3MA 1K28A 1EQMA 4NLDA 3BYPA 3HRZC 2ZXOA 5CV7A 8ICIA 2CFMA 4ZITA 4Y52H 4O9MA 3TZUA 3KDFB 3DEOA 3NMAA 3UR0A 3DV9A 3CCSA 4M6WA 4QY7A 1PZJD 1UE6A 3VCBA 3POTB 4IOCQ 2B63B 2AJ1A 4Q5VA 4JV5L 2I0XA 1ZQJA 2O5IC 2YKAA 4KHPL 4PHPA 2J9DE 5ETQA 3GV3A 4P10A 3MMAA 3CCUS 1UHUA 2ZIWA 5IP7H 4KKSA 2FC8A 3MGJA 2CQPA 1TU0B 2UP1A 4V19J 5A2QL 3BBBA 2C1EB 2EFQA 4ZH4A 4JI6F 3LTOA 3MEEA 1TVAA 2HGNA 2YNHA 4PPXA 4P0QA 2F0UA 1N32F 2XRSD 3HW8A 3FPPA 1RAOA 3DMUA 4K14A 5GQOA 4KLTA 4IYQA 1VRQC 4JK1C 4NL5A 2X6GA 5EN1A 1IBMQ 2IVFB 1P1LA 5DB6A 4CJ0B 1STGA 3S8SA 2GVZB 3CDBA 4FYVB 1M5KC 1UVLA 1Y1VH 1RWXB 4WE1B 4IO9A 3MECB 2Q2UA 1NSKL 2G07A 2K2PA 1H98A 2MAXA 2HWHA 2HVDA 3OFEA 2YKQA 2QSWA 1XR6A 4DV5F 5F0UA 3I4OA 1E2ZA 2W9CA 3JTOA 2JA5H 1SH0A 1DQ9A 1CHPD 3DLBA 3CC7S 4JBJA 4DR2J 3SMZA 4OQJA 5D0GA 2ALZA 1Q5VA 4X4UA 4BXOB 4NLKA 1N5YA 2E29A 4CRXA 4B9XA 2ABYA 4OYIA 5HQMA 2UUCL 3VYUA 2C3OA 1FD2A 1MNEA 3TQEA 4IC9A 1RK8A 4O44B 3MC0B 1HWIA 3R2IA 2R3ZA 4MHEA 4F04B 1E0BA 3PIOA 3H59A 3R5CA 4OELB 3M05A 3A8EA 3DLKA 2WVFA 3FBFA 1ET9A 1HLWA 2BDOA 1S9EB 3DRPB 5CP2A 5C44H 2YKOA 4R4CA 2B8PA 2D3UA 5K9FA 3PV0A 1N33Q 1U6BA 2IY5B 3D3BJ 2FLOA 5E3PA 2YNIA 5JPNC 5ELNA 2ZTDA 4WFNQ 5G5GA 1PZID 4WP8A 1YHQA 4OX9J 3RH5A 4BS2A 3PMNA 2DFLA 4B9VA 3RAXA 2V4RA 2B43A 3L0OA 1U1KA 3KLGA 4FO2A 4JI7J 5C6AA 2VIXA 3TW0A 1QUQB 4LR9A 4YN4A 2JP1A 3KJNB 1Q7YC 2VS1A 3CCVA 2LXIA 4HMIA 1V1QA 4IN3A 3CPWA 3UFCX 5E79U 1SJ3P 3GTGB 2V2ZA 4JYAJ 2H5EA 5EX0A 1TAUA 4DI6A 1X4AA 2O2LD 2V8HA 2ZBIA 3CD5A 3QB3A 4CIOA 3OL7A 1W7WA 2Q8IB 3MXNA 2HQLA 1FGBD 2CKWA 1URRA 2QL7B 3PHTA 3KHRA 2UXDF 2TMPA 1Z1BA 2FVPA 1RAIB 4Q44A 4Y2PA 3PZPA 4IURA 2WIIB 3UCZP 4LMZA 2WSFC 4IFDH 5IGFA 1UVKA 1E6VB 2CJ9A 4LF1A 1WCMG 3UDXA 4CGYB 2DNEA 1SROA 3I87A 4DAVA 1SC4B 1L7MA 1TVRB 3UPQA 3E0EA 2E3TA 4RT3A 1X4HA 5DLGA 4BBRH 3ZYYX 1HNZF 1L2FA 2B4VA 5D3DA 1FERA 3E2EA 4A46A 2PGCA 2LSSA 3IBCB 2ACYA 2LEPA 1LW0A 3M2VB 4DR5Q 4F67A 8ICEA 3H40A 2F3IA 2ES2A 4K4YA 3F2UA 1RBLA 2MUTB 2NTSA 1J6QA 1RHJB 4F5PA 1ZM9A 1IBLL 2NPFA 4NM1A 2BPGA 3WC2A 1O78A 1L3SA 1X42A 3CO0P 2VASA 1ICEB 1XNRF 2HQCA 1U4PA 1EYGA 3CDWA 2WB1D 1X3EA 4NYPA 1X4DA 1HD1A 1DBDA 4QIWB 3FEWX 2BA0A 1N36J 3OHXC 5JOBA 2MA1A 4Z6EA 3E0FA 3OMGA 4X64L 5KT4A 5D46A 2JA7B 4X66L 1Z2ZA 4ZPDA 2JA6B 4LF9Q 1IJFB 1WWVA 5IP9H 5IYBH 4EQNA 4K4GA 3GCWP 5FK9C 1RTZA 4JWMA 2UU9L 3BSCA 1PTOD 3G71A 3AU6A 3TP8A 2H3FA 2DHHA 4KGZB 2NN6G 3N52A 2CRLA 2K50A 1CKNB 4JI3Q 4F2SA 1WD1A 1HPCA 4MF2A 5C4HA 3TAMA 2YQEA 1EETA 3NY0A 1AN8A 2XQCA 2JZ5A 2O5DA 2FJ6A 1LEOA 1K73T 4BXXH 2CQGA 1UP1A 3THVA 2B9WA 3MCNA 2JNJA 2UV8G 1S6PA 2LA4A 3KLHB 4B3OA 2WF5A 2DGZA 4ELVA 3K80C 1ELOA 2G06A 2MTLA 3D66A 5BYQA 2CNOB 1M90C 3PQIA 1MJEA 1UQVA 5EBDA 3OT9A 2OUGA 5AJ3Q 4DDFA 4DPXA 2DITA 1N5VA 1T94A 1PBAA 4DPGA 3MM5B 1FEEA 4HIMA 4B9NA 4KGMA 5DQIA 4ATNA 3GZFA 2YX1A 1S6QB 4M9LA 4YVZA 1MSWD 2MKIA 4Y3CA 2WHEA 1U8WA 5HO4A 1EZ6A 2RRDA 1SQFA 3CCSS 1IXRA 4CDCC 3TQ1A 3O6QA 3PJ9A 1Z4OA 4PZ8A 2N7YA 1FEZA 1B99A 3DKDA 4LF5L 2N1RA 1TWCH 3NUQA 3AB9A 2MKSA 2R7XA 5ALPA 1SJ4P 4ZLJA 1PJ7A 1IHZA 4KJNA 5AM0A 2RDIA 2K8GA 5KFNA 1NK0A 2CQDA 4D3GA 1SXLA 1F2HA 3LQVA 2JEFA 2MJNA 4DV3J 4DPYA 2JYOA 3J80E 4I7AA 4F87A 2KHSA 4PZOA 3H0GH 3UDCA 2IC3A 2R92B 3DLEA 1RXVA 2ZIVA 3NTIA 3HKZF 4WPAA 1SV5A 3TEGA 2VL6A 1IKWA 3DRRA 2BANA 2JL9A 2Z0GA 4CO5A 2UXCJ 4LF4F 1RYRA 2XI2A 1T8EA 2K52A 2XI3A 2DUDA 2CPIA 4CO0A 4NLVA 1QSYA 4EUVA 1RIPA 4JI2Q 3NMRA 1PH5A 3TR5A 3ULJA 3QIDA 1DOMA 1CJKB 4ME3A 1F3FA 3UM9A 3DOMB 3PW5A 1F77A 2C5CA 2NVYB 1PZKD 1JC7A 4ED7A 1BNOA 4DR7J 5GROA 4ANEA 4NE9C 1EIGA 1N60A 1X56A 2HOFA 4LF6L 1IBCB 7FDRA 2XY6A 4YB6A 3ETLA 3R5BA 3G6ES 1PRTC 1VQSA 4KY6A 1MN9A 2L41A 3OL6A 4POGA 2KXNB 2QEJC 2EG1A 1KQSR 5AHXA 4DL5A 3SQGB 4KLSA 4P2XA 4HAIA 3AMZA 4DCPB 2WF6A 3H8MA 1RAGB 2BW2A 4NXMJ 3DNCA 3J7YW 2IJRA 4J91A 3EVMA 4IFYA 3WC0A 2PI2A 4OV1A 1D8LA 4ZVHA 4R66A 4P72A 4DUZJ 4F0MA 4DCJB 4BJQA 1U6ZA 2F3WA 2E1AA 5E2QA 1FKAF 1SNOA 2EZVA 7ICGA 2QLFB 3EQLC 1I3OB 2H4OA 2VQEF 3BDPA 3L3CA 3TADC 4C4SA 3KJFB 2V8VA 4CKBA 2UUTA 1LWFB 4UDUC 2JHDA 1S76D 2JN4A 1VRTA 3GB0A 3Q8UA 4DG1A 3ADAC 2EYJA 1R6VA 2M3DA 1TMMA 2UVWA 5CXTA 1GO3E 2EBGA 2NR0A 1Y14B 4F26A 3R3OA 4LF2A 5F8NA 2JSOA 4DR1L 1LWXA 4HACA 4AYBB 4DL3A 1TWGH 3ZDDA 5J1ZA 4X65J 4PGYA 4MHVA 1U02A 2ZH4A 4F8RA 5AE1A 4UBBA 1EQQA 5KFAA 3WKAA 2R6GA 3VYSA 2ZJPQ 3IRBA 5ELFA 2B6GA 1OXSC 1W25A 3BPSP 3VQTA 2RDJA 2ZC3A 4B3RF 1QVFA 5KFGA 3NWRA 1RTNA 1QNKA 4Y28C 2ZE2A 4NDXA 5ALMA 5EE3A 5EKKA 3VTIA 2C2KB 2LKVA 5I3QA 2B21A 2GN5A 1S1XA 5J22A 2IYIA 1TMJA 4QWCA 3CCWA 3A3PB 2HD3A 1DTQA 1RQ0A 9ICLA 3V2UC 4CLUA 4OI0A 2HVEA 3CVKA 1ZD5A 1QJOA 1S59A 2XRQD 3ZZ0A 3PUYA 3P45B 2FHMA 4YXMA 2EC0A 1FI4A 3JAMc 3BS5B 1JJ4A 2KOLA 3TX8A 2BR0A 2R7OA 2V63A 3HHLD 3QWPA 2CH4A 4IUPA 5DG9A 4NLBA 3UD3P 2ZNYA 5FIIA 3G9CA 4A8YA 5J0TA 2J8AA 2IJFA 4JMUA 2DKZA 1NHVA 1RBOB 4MH8A 2Y0SG 1T0TV 3UE1A 1YNXA 3OW2A 3QATA 1NH7A 1JB7A 3QU9A 3PV8A 5J2QB 3RB0A 2EYMA 1DZ1A 3J81c 4OLOA 1TR5A 1EL0A 3KMSA 3MUVP 2MKKA 3F53A 2EG2A 5J2FA 4AXIA 1KNZA 1X4EA 4YY3Q 5KT2A 2VA2A 3DOLB 3H91A 3IG8A 2GJFA 2R7ZG 1GJXA 4KHRA 4CF4A 1SC3B 4USHA 1J5EJ 9ICCA 4Z37A 1Q3LA 3V5RA 2BDNA 2UUBF 1MMLA 2MZQA 3H20A 3MURP 2NQPA 5KFRA 5L9NA 3L3FX 5KFJA 2MSSA 4F7VA 1MBYA 1C1CB 3I9V9 5C4XG 4LK1C 2VZ9A 3S2HH 3ULPA 2WSEC 2G09A 4POFA 1JLBA 2IJNA 3FUYA 3T1HL 1F9EB 3ETMA 2U2FA 2SXLA 4MIBA 2FZGB 2F7VA 1Y11A 2Q2HA 1UWBA 4GVBB 3CGIA 4ILWA 2ZOGA 5J39A 5DDMA 3EZOA 1MKHA 5H1SV 2LPEA 2DNPA 2EAMA 4NJ8A 2VG7A 3OFGA 4KX5A 4K7QA 3PKYA 4OJOA 1G2EA 1STYA 4KGXB 4JI0F 1B8AA 2D0OA 4P74A 2MSTA 1FDNA 4ZVUB 1K1QA 4OL7A 3C2PA 4IOAQ 1TELA 3CYMA 5K36G 1LNQA 5ALXA 3ZO7A 4CYUA 5HI7A 2FI1A 1RTJA 2E5GA 2HKEA 1S6UA 1C4CA 4WXOA 3SCIE 1RAFB 4PWDA 1HNIA 4JI5F 4K4ZA 1RI7A 1ZQFA 2LQBA 2DRBA 4DOBA 3SCLE 5BR8Q 1CQNA 2LU2A 3BGOP 1CSPA 2GMJA 3US5A 5FKAC 1A0IA 2F9JA 2AGPA 2GMHA 5U47A 2XGPA 3UQ2A 1CBKA 2HVZA 5CV5A 4WBFA 2EK1A 4KY3A 2IHEA 3QMQA 2P9CA 1NZBA 3OR2A 1WHVA 2JZBA 3OLBA 2EQSA 4CLLA 5HROB 4Y2CA 5J1PA 2AUJD 5DRKA 5M3FB 5AXKA 1B7YB 2RNEA 3HOZB 1DRZA 4RW8B 3RTVA 5IGCA 3BZKA 4HCSA 5F8IA 1SV0A 1BR9A 3PNIA 4Y2TA 4OJGA 2IM2A 3I4HX 2MQMA 2XZDB 1QVGR 4URGA 1FDAA 4PYDA 3QBCA 2ZKUA 3RYLA 1TFWA 1TKZB 1RDFA 1Q0NA 2XG8A 4IQZA 1RTHB 2WB1G 4WTOB 3CT9A 4NA1A 4R5PB 1R8PA 3A5UA 4P7VA 1G51A 3TRZA 3OD2A 1KP6A 3HT3A 4JV5F 3ISZA 1RJTA 3DGVA 2A0FB 1RWPB 2BE2A 1LWEB 1HZ9A 2L4NA 2NZ1D 4KHPF 4DR6Q 3OVBA 4OIKA 2DK2A 3O8WA 1REGX 1B3AA 2WAQB 2GA7A 2W9BB 3CNHA 2BA9A 2BE5D 2DGSA 3O44A 3GG1A 1PKUA 3EDQB 2DHAA 1WTFA 2JOQA 2VDHA 4A93G 3C1FA 4H7BA 3QEAZ 4WZMA 3GWCA 3MOJB 1IW7C 2VC0A 1Q3VA 1KAAA 4JI4F 1UT8A 1E2WA 3R7SB 2DF4B 4R1JA 4B3ML 2PA3A 2OQKA 4B9TA 4MFFA 3M6ZA 5J2CA 3GJRB 1OXTA 1VQMA 2DNQA 4ZPBA 1XTDA 4IO1A 3QUCA 3RZDB 4YQWA 5LMUQ 4UAUA 4CI0B 5KG5A 3HG9A 5ALYA 5THWA 2M00A 2ICEC 1RSCA 5AM3A 3KLSA 3MWBA 1Y3KA 2Y1RI 1MWZA 2RQKA 2OELA 1YRXA 2Z2MA 3DHXA 4UB1A 4G4KA 1RP5A 1A76A 3HM9A 1S72S 3NCRA 4ME5A 2A8VA 2WP8J 4FPIA 2K05A 3WIUA 2QDLA 2QB0A 2ZBRA 4ECXA 4BA1I 3W3SA 2R8KA 1WKLA 1PVOA 3NTUA 3EYZA 1B3QA 4DFKA 5C25A 4PABA 5I4DA 1VHFA 1IG6A 2JA8H 2E5LQ 2BPCA 1O5JA 3W65A