3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
1IBLQ 1HZ9A 5E7NA 2KCMA 1QUQA 1C9OA 2B63G 3S15H 3STBD 4NXMQ 4IFDJ 4IOCA 2Q2HA 1B70B 5IYDH 4QQBX 1HH2P 3G71A 2F52A 3M3YH 2WP8J 5IP7H 4QL5A 4C2MH 1Y14B 2ZTCA 2XTIA 1VQEA 5M5XH 2I0QA 4JI0Q 1XPRA 4BY7G 4AQYL 3PV0A 3J81c 3ULJA 4A3DH 3KYHC 1FVIA 4A3FH 5FLXc 4LF6Q 1HNWL 3PIPA 1X65A 3NBHB 4YWKA 2HHHL 2JA5H 1CKNB 4LFBQ 1X56A 1I50H 2ATWA 1X55A 4GOPC 1PA6A 2L15A 4DR4L 3U4VA 4A76A 2UUAL 3I2ZA 1VCIA 1XMOL 1C7YA 1YZ7A 1PYBA 5GQOA 3A5UA 3F8TA 5K36G 1V1QA 2UXCL 2IX1A 4LW1A 1YITA 2YTVA 1XJVA 3E0EA 1E24A 1S72A 3ER0A 1HNZQ 2GVAA 4X6AH 1AE2A 1HZCA 3HOVG 3PIOA 2CWPA 3JAMi 2VUMG 2OWOA 5C0XI 3HKZG 2PMZE 1UE7A 2HT1A 4APVA 1OTCA 1EUJA 4KHZA 1SFOH 4DV0Q 2KHIA 1K8GA 4B3TQ 2D62A 2JA6G 3GTKH 3KJPA 2WB1G 4HJAA 1M90C 1SMXA 1L0WA 1PYSB 3ICEA 1TWGH 2ES2A 4JI1L 4BBRG 2OQKA 4LF9Q 2R92H 1VQHA 3CC7A 4B3SL 3CQZH 4LUZA 4DV2L 5M3FG 2MO0A 4B3MQ 4A3JH 4GNXB 4MTNA 4BXXH 2E5LQ 5IWAL 2YYZA 2JQOA 2WFWA 1IBML 5LMUL 1FJGQ 1BBUA 2ZM6Q 4PG3A 4OWXB 4PZ8A 4DUZL 1EYGA 2HIXA 3EN2A 3VDYA 1GM5A 3K81C 1Q46A 2Z0SA 1E3PA 4ME3A 4DAYB 1HNXL 2YU9H 4A3IH 2CQOA 2VY3A 4GKJL 1AE3A 2K5HA 4LFCQ 5IE8A 5M3MG 1N34L 4HIDA 2OTJA 1X6OA 2NVXH 1P16A 3W5OA 1JMCA 4DR1L 4JOIC 3U50C 4YCWA 1PH6A 4LF5L 4DV1L 3LGJA 2HIVA 3CCRA 5LMUQ 1FJGL 1IBMQ 2WAQE 3M7NA 1P8LA 2H5XA 1SR3A 3AFQA 1VQDA 1IBKQ 4X64L 1YZ6A 1VQBA 4Y52H 3AEVA 3G48A 2N3SA 3K0XA 4JI1Q 3S1NH 2Y0SE 4NXNQ 1X54A 3U58A 4LFCL 2BA0A 1EIYB 2Q2IA 4HIKA 2PQAB 2GN5A 2VQEL 5IYDG 1Q1EA 1WJJA 2E2HH 1CSPA 3PUYA 1KHIA 3BZKA 4DNIA 1IYJB 1G6PA 3MEFA 3J81i 1ASYA 4DV7Q 1NJIC 5C4JH 1QZGA 4JI5L 5IYBG 4YY3L 1NE3A 1X3FA 4A3FG 2BH8A 3GTGH 3EBEA 1JE5A 4X64Q 4DK6C 3CD6A 3S16H 2K4KA 2R93G 4AYBG 4GNXA 4JI6L 4JI7Q 4BA2I 1XPUA 4LNQA 4DV4Q 1Q12A 2AWOA 4JI8L 1N33Q 3PCOB 3PSIA 4ALPA 3GTOH 1VQPA 3I4NH 4JBKA 3F2DA 1XNRL 3ULPA 4POGA 3BZCA 3OTOQ 1E22A 3K7AH 1D8LA 4A3JG 2DUDA 1GO3E 2NZHA 1N34Q 4DV6L 1VQKA 5ELOA 1E7ZA 3OW2A 1W3SA 2Y0SG 4JI4L 2ASBA 4BA1I 2ZTDA 1HNZL 2QA4A 3K80C 3HOUH 1K8AC 4LF6L 2B63H 1NY4A 2ZTEA 2E2JH 1VQNA 2A19A 1SLJA 2UXCQ 4UP8A 1IL2A 3UDFA 2XGTA 5M3MH 4PZ6A 4B3ML 3RR5A 4DV2Q 1FGUA 2R7DA 1YHBA 3ERSX 1PVOA 3TREA 4GN5A 1RIPA 1MKHA 2PQAA 1VQOA 2JA6H 5IYCG 4DUYQ 1K83H 3CXCA 1TWFH 4LWCA 3BJUA 1RL2A 1E1OA 4DR3Q 1S40A 4LFAQ 3E9IA 3CCSA 3KDFA 4HJ9A 1WI5A 5GROA 2MNAA 4LF4Q 3S1QH 4J15A 3A5ZB 3HKSA 1V43A 3HOYG 1I94L 5IWAQ 4IFDG 2UXDL 3TS2A 2AMCB 3PF5A 4H02A 4EQ5A 1Y1VH 4DPGA 3JC66 3KJOA 4X65Q 2ZJPA 3RNUA 4B3SQ 2NVTH 1HZBA 1WYDA 1G51A 4UPAA 2UUCQ 3HOWG 4A3IG 3PGZA 2ZJQA 1LTLA 1YVCA 3KOJA 4IPGA 1PH2A 2RCNA 5C0XG 3TS0A 1M1KC 3BU2A 2R7ZH 1PH3A 5IP9G 3PO3H 1N32Q 3E9HA 1YEZA 2N8NA 1IBLL 1EOVA 4DV0L 1A8VA 2EQSA 1PH1A 1K0RA 2UUAQ 4L5QA 5C44G 1T9HA 3EIVA 1J6QA 3ZJYC 3CCLA 2VQFQ 2UUBQ 3DLLA 2A8VA 1OXXK 3T1YL 3CMAA 5IT9c 5C44H 4DV5L 3TQYA 4YHHQ 3PF4A 3U4ZA 3PUVA 4AH6A 3D31A 4HIOA 1KAWA 1B7YB 4P72A 4L5SA 5GAEC 2R93H 4JBWA 2R92G 2VZAA 2JA8H 2JEBI 1OXTA 2NVQH 1HR0W 1KC8C 2UU9Q 5BR8Q 4DR5Q 4GN4B 4DV5Q 3A0JA 3CAMA 1JJGA 2FXQA 4P73A 5IY0A 3UDIA 3GTLH 5C0XJ 5JEAJ 3JAMc 4IFDI 4WJ3M 1Q81C 1HZAA 3S24A 1A0IA 4A3GG 3KLWA 1VQCA 2I5HA 4X66L 4A3MG 1I3QH 1NBWA 4OWTB 3PO2G 4A3BG 4BBSG 1K73C 2PI2E 1VQ8A 2JEAI 1X9NA 1WOCA 2AKWB 4A3GH 4JI2Q 1VQ4A 4JBMA 1D7QA 1Q7YC 4GN3B 4JI0L 1KL9A 4X65L 1XMQQ 1W2BA 2NVYH 4YHHL 3GD7A 1EQQA 1N36L 5GAHC 3T1YQ 5M5YH 2Z6KC 1X3GA 3J81j 2OCEA 3J80i 2K5NA 4JCVE 3Q8DA 4KI0A 4LF7Q 2C35B 4UP9A 1OXVA 1V9PA 1L2FA 1X3EA 2WB1E 4OX9L 1WCMG 4JOIA 3KF6B 3HOZH 2B29A 5IP7G 4R4IA 1LM0A 1IXRA 4DR6L 3G4SA 1HJPA 3UE1A 1K9MC 4P74A 1Q86C 4NPSA 4MNOA 3I7FA 4JG2A 2UXDQ 2ID0A 5JEAG 1JJCB 4QY7A 4JI3L 1I94Q 1GD7A 1KRSA 1QUQB 3CP0A 2Q2UA 3H3VH 4DR7L 2Q2TA 1FL0A 3AQQA 2V1CC 1CSQA 2R7FA 3L0OA 3NEMA 4OO1I 2R7ZG 5EAYA 2JE6I 3FP9A 4L5TA 2AWNA 2GVBA 4DR3L 4JI4Q 1PH7A 1MJCA 2IX0A 4FDBA 2UXBL 5HGQA 2CWAA 3L2PA 1KIXA 1XNQL 3I4NG 4DV3L 2K14A 1XNRQ 1PH9A 1MIUA 2VS1A 2YTXA 5BR8L 1YI2A 1O7IA 1Y1WG 4R4TA 2K5VA 1BBWA 3CPFA 1UE6A 3T1HL 3CCEA 2A1AA 4GNXC 4JV5L 4JI6Q 3TRZA 3FKIH 5LMNL 5H1SE 1A63A 1R9TH 4A93G 2DGYA 4YY3Q 2UUBL 4BBSH 1UE5A 3FKIG 5FJ8H 4UY8C 1PHJA 3PUXA 4BY1G 5M5WH 1QVGA 1TWCH 4DR2L 4NB3A 2QGQA 1GKHA 4LFAL 2IY5B 1N32L 3I55A 1JJ2A 5JJLA 3MXNB 4DUYL 1HR0Q 4JI8Q 4MZ9A 2UUCL 4GKKQ 1PH4A 2JA8G 1Q1BA 4R4OA 2I5MX 1EQRA 3CCVA 4A3EH 3GTQH 4O2DA 4A3CG 4DK3C 3HKZE 1PH8A 3GTJH 1YIJA 2LXJA 1VQJA 1U0LA 4LF8L 5HY6A 4HJ5A 1IZ6A 3AYHB 3RN2A 4HJ7A 4C3IH 5M3FH 2LXKA 3F1ZA 3B6YA 3HOXH 3CCUA 3PUWA 2Z6KA 2BA1A 1WFQA 3K7UC 4DR1Q 1VQMA 5JJIA 2VL6A 3DM3A 5C3EH 1BVSA 2D0PA 4A3MH 3KF8B 1L1OB 4BY7H 1EIFA 4DV6Q 3PUZA 1Q8KA 1I5FA 5FLMH 2CKZB 4A3LG 4NXNL 5IP9H 3PO3G 3UE0A 4KHPL 1KXLA 1IBKL 2JA9A 5AJ3L 5IYCH 2JA5G 4LUOA 2ZM6L 1N33L 3M4OH 4QGUA 4LF8Q 2R6GA 3I4OA 5DLQE 3RZDH 1G291 2E8GA 3K8AA 4LF5Q 4A3DG 2KBNA 4YCVA 3F2BA 1TWAH 4GKKL 1Y1WH 2NZOA 1VS0A 5J3BA 1C0AA 3GDEA 1H95A 4OO1G 3I4MH 3KFUA 2EIFA 3OTOL 1UWVA 1GVPA 2QN6B 1EWIA 1I6HH 1VQFA 3M9BA 4IJHA 4IJLA 4GOPA 2VQEQ 4A3KH 1VQLA 3HOWH 4DUZQ 3H0GH 1VQ5A 4DV4L 3S17H 3CC4A 4K0KQ 1YBYA 3NELA 4JC0A 4JI7L 3KDFB 1LUZA 2K52A 4YWLA 2PI2A 4IO9A 2I5LX 2N78A 3CPWA 3PO2H 1K3RA 2RHQB 1QZHA 2OTLA 4JI5Q 4JV5Q 4K0KL 2NN6G 2RF4A 4DV7L 1KQSA 4DR7Q 5C4XH 2LSSA 5AJ3Q 3G6EA 1SE8A 3F2CA 1XTDA 4EX5A 4DV1Q 1YNXA 3CCMA 4HJ8A 3CC2A 4DR2Q 2VNUD 5C4XG 3WWVA 4HIMA 1Z47A 4BXXG 4YCUA 3GTPH 3HOUG 4XTCS 4OXPA 2YTYA 2KCTA 3STBC 1SROA 3GTMH 2UXBQ 4DKAC 3SGIA 4LFBL 2OQ0A 4XIGS 4PZ7A 1SRUA 3A74A 5ELNA 1VQ6A 5C3EG 1L1OC 3RN5A 1XPOA 4A3CH 2CFMA 2EXDA 3T1HQ 2E5LL 2JK8A 4A4IA 4GLVB 3GO5A 3UDXA 1VQIA 1N9WA 4KHPQ 4YWMA 4LF9L 1UEBA 3CMEA 2IT1A 3S1MH 4R4CA 4DR4Q 1HR0L 4KLKA 1NTGA 1UE1A 2F3IA 2IHEA 3KF6A 4NXML 4OWWB 1B8AA 4P75A 4GKJQ 3S2HH 4OONA 1VQ9A 2KENA 4O0AA 1CKOA 2RHSB 4BBRH 1HNXQ 2E2IH 3H3VI 3CF5A 2KHJA 5LMNW 4B3TL 4A3LH 3FHWA 2QEXA 3HOZG 1PFSA 4IPHA 2PNHA 1DGSA 4L5RC 4LF7L 1Y1VG 1ASZA 3AFPA 2B3GA 3TEHB 1N8RC 1U5KA 4IPCA 1CKMA 4IPDA 2D0OA 1OXUA 3ULLA 4GS3A 2JA7H 3HOYH 1S3OA 1WCMH 1E1TA 4AYBE 3H0GG 4POFA 1YHQA 3J7A5 2MQHA 1Q82C 2JA7G 3J7ZC 5FLMG 1MJEA 3IRBA 4X66Q 2MFIA 1YJNA 4P71A 3L7ZC 1YHAA 3I4MG 1XMOQ 1Z9FA 1NMFA 3CCQA 4DV3Q 4A75A 1XNQQ 3CW2C 1A62A 1LYLA 2ZJRA 1J5EL 3I56A 4A3KG 3J80c 4RMFA 4BY1H 4IOAA 3NENA 3RLOA 1YJWA 1N36Q 4DAMA 2HHHQ 3OYYA 4DR5L 2K50A 1SN8A 1VQGA 2YV5A 4AIMA 2UU9L 5LMNQ 1KD1C 4JYAQ 4R1JA 3W1BA 4C3HH 4C3JH 1BKBA 4GOPB 2IHFA 3M4PA 1EFWA 4JI3Q 4QJFA 4AQYQ 2BH2A 2MO1A 4GLAC 4TQUS 4JYAL 3M85A 1JT8A 3D0FA 3RLNA 4LUVA 2VUMH 5GAGC 4UP7A 5FJ8G 3S1RH 1KRTA 2F4VL 4DR6Q 2VQFL 1TXYA 3W1GA 1JB7A 1J5EQ 4A3BH 1PH5A 3RLFA 1NMGA 2NN6I 2AHOB 4PMWA 2F4VQ 1TWHH 2JJQA 4JBJA 5IYBH 2VW9A 1VQ7A 1YJ9A 1CKNA 3S14H 2ALYB 3HFZB 4A93H 1CUKA 2N49A 4TVAB 1HNWQ 1PV4A 4R4QA 3HOVH 3RZOH 4Y7NH 2WAQG 1AH9A 1QVFA 4A3EG 4X62Q 4B3RL 3M4QA 1QVCA 1L1OA 2CCZA 4RG1A 1XMQL 4WJ4A 4X62L 4B3RQ 2HQLA 2K75A 4JI2L 5GADC 3S2DH 3H15A 3HOXG 4QIWE 3CCJA 2QMUB 1VQAA 1OXSC 4LF4L 4OX9Q 3UDGA 3QSYB 4GLXA 5JJKA
chains in the Genus database with same CATH superfamily
1HWKA 1TFWA 1RU2A 5F8IA 4RWWA 2JA5B 2MKHA 3QUBA 8ICQA 3AB9A 2ZITA 1HH2P 2TMPA 2B6AA 2I0QA 4JI0Q 1QCKA 2F0WA 2Z2ZA 3ULJA 3GV3A 4MTKA 1FD2A 2KG0A 2YNHA 1HNWL 3BKUA 2JMGA 4J90A 4PXDA 2EAPA 1TWGB 5L1KA 3KHGA 4ZAIA 2NZCA 2XMTA 3CCWA 2QB0A 1C7YA 4Z2XA 4FDFA 2RMLA 2FJXA 3A1YG 2C2KB 4JPBW 4UATA 1XK8A 1JXVA 3DKDA 1XJVA 3OR1B 2CDQA 3PIP3 1T9UA 4DO9A 3NTHA 2W7AA 3JAMi 1I3QB 1R6YA 2HS3A 3AA9A 2OD4A 4C80A 1EUJA 4KHZA 4JK1C 3EZUA 4WFYA 3K5MA 3OTDA 3OJSA 4YG2A 2LKZA 4YMNA 3ONAB 3D6HB 1QE1B 3TARA 1SIJA 3PRDA 2YYZA 1SB6A 1BDOA 4GVBA 1KN5A 4DR7F 2I38A 3OR1A 3VDYA 2A0FB 4RGMA 5AKJA 3B78A 3R5CA 2ICEC 3OMGA 4NYPA 2MU2A 2RDGA 4MJKA 1F3FA 1B7FA 3C1ZA 1N5TA 1N34F 4F2SA 1CBKA 4WIQA 3PZPA 3W5OA 2ACYA 2KJ5A 4JOIC 4ZK7M 1PH6A 3J81L 3BBBA 2GC8A 5LMUQ 3FAHA 1YKWA 3AFQA 4P2XA 3HZXA 1D9FA 4DV3J 4NM1A 3MR2A 2FYXA 3K75D 1RT4B 1L7OA 3G4SS 5IYDG 2E2HH 1ZQBA 2KQ3A 2QYGA 5TISU 3T19A 3DWPA 4FXKC 4HSPA 5IYBG 2LQ9A 1JNRB 1YJVA 3OGUA 5GMKa 4AYBG 2HS0A 3E58A 1A3VA 2CQHA 1XPUA 1RJJA 3M05A 1B3AA 2B7BB 1LV5A 3SZ2A 4OJPA 3CNHA 2F1IA 1WTOA 4KMUA 2XHWA 1GNKA 4OIJA 2FFKB 2BHNA 2ZTEA 3DWAA 5J2MA 2UXCQ 4UP8A 3ILLA 1JWMD 5A35A 1RISA 4E98A 3QAEA 1GUNA 3H0PA 3H5SA 1YBUA 4TY8A 1EY4A 2A2CA 5IYCG 1S6QB 1Y88A 2GMLA 3PY8A 2HYIB 3S7RA 4QJVA 1RZTA 4BBYA 3QJPA 4ZCLA 1LEOA 2SNMA 2ROPA 4K0KJ 3N7RC 3N6RA 3GLJA 4Q8FA 2F0JA 5C0XG 2FMSA 5IP9G 3GTOB 3MFYA 1A0OB 2AYGA 2EQSA 4I2CA 3TP5A 3BVGA 2UUAQ 2R7QA 3P3DA 4Y2UA 3AXKA 1J6QA 3RTVA 2KB2A 3X1LB 5K36H 1IKYA 3MF5A 3DU6A 3P6YC 2KN7A 4OI3A 1S1VB 2NZ1D 4C3HG 5LOQA 1T02A 4IDKB 1JJGA 4ZPCA 2LM1A 1LOUA 2QRRA 1K0TA 1UJ4A 3LF0A 5AKLA 1EWCA 5JPMC 4CF5A 4ZVFA 4EBDA 2PGCA 3RR8A 4FNHA 3MABA 3SENA 3MA2B 1TKZB 3GJQB 2VA2A 2RVJA 2Q3PA 2HFNA 3M7VA 3UMBA 3M8YA 4K4IA 3IWNC 2RCFA 1EQQA 1TQLA 2D8CA 1FO1A 1YBTA 4YD1A 2K5NA 4FZLA 4USWA 1EFID 3M4OB 3GFKB 4ETXA 2UUCJ 3ITHA 4WWSA 1DAXA 1HBOB 4OHZA 1GK8A 5EPJA 2A10A 3OVBA 2DBYA 2B29A 2YN4A 3PEHA 1T5EA 4P74A 3QGGA 1C4AA 3QE9Y 4DL0C 3SYZA 2YKQA 3NVVA 4ZHRA 4JI3F 4PWDA 4QY7A 1G4CA 4QIFA 4K50A 2HHXA 3S9WA 4AQYJ 1MJCA 3A8IE 3OW2R 4OL8A 2CWAA 2CJXB 4ZHRB 4PWDB 4KN7A 2H4YB 5DDPC 1HNWF 3TA1A 1IJFB 9ICTA 2B2TC 1FFGB 4OZLA 4NLXA 3GQCA 4JV5L 3J80Y 4JI6Q 3HT0A 3OWEB 5AKIA 4TQRA 2PZTA 2WVBA 2YNGA 3NVWA 4YEAA 2EY1A 3QIDA 1N54B 4UY8C 4GXJA 4DR2L 4NB3A 4LFAL 2IY5B 4IS7A 3IBWA 2EYMA 2CJYB 9ICAA 1WF2A 2C22A 4GKKQ 3B9JA 3DHWC 4PZVA 3QIPB 1S99A 5DEHA 1RBAA 4O2DA 3Q6SA 1KLGD 5HY6A 7FDRA 2K5QA 2YH1A 2HBKA 4KY5A 5M5XB 2AGOA 3T41A 4BCAA 1NUCA 1EIFA 1NHVA 5FLMH 4A3LG 2E1CA 1O80A 3Q2SC 4KKTA 3W5XA 2FHTA 3PX0A 2EW9A 4NL9A 4ANDA 2LDIA 3MM8B 4A3DG 2XIWA 5D46A 4KH0B 4Y2JA 4NLRA 1RGVA 3NSWA 3KOAA 1LQ9A 3R27A 5AI4A 3GSIA 5C4HA 3KFUA 5AE1A 4OYZA 1UCVA 2BZFA 1ZPVA 4LVOP 4LIWA 5KG7A 2JA6B 2H1EA 2J9CA 3MEDB 2LU2A 5AXMA 4DV4L 3W9JA 2M0NA 4CIOA 2B2TA 1F9SA 5J2FA 2R2UA 5JPNC 2VASA 3PO2H 1KONA 2OEOA 2OTLA 2QEXS 1RHQB 4KV6A 4DR6J 1IKWA 1T0TV 2BVZA 3BO4A 5KT3A 1RCXB 1YNXA 4RW4B 2HCIA 2VNUD 3M8SA 3LWUA 3VTIA 1D8BA 5KG0A 1A6XA 2VG6A 3R5JB 4F5NA 1EOTA 5J2CA 4PZ7A 4X65J 4P52A 1NK4A 3C21A 1HBUA 3JPPA 4PQAA 1PK1B 4OELB 5C4JB 1YRTA 4KHPQ 5G0RB 4YQWA 2UXDF 1UE1A 1TWHB 7ICMA 1NAQA 3AU7A 3HKZF 2KJVA 2QILA 2BANA 4LR9A 1RTHB 1KTQA 2VF3A 1MWQA 3SR1A 2NUCA 1Q1KA 1SJFA 2HHVA 1SV0C 2JA7H 3EZ5A 2WKCA 3BH7B 1FFSB 1VC6A 1YHQA 5FLMG 1XNQQ 1P6TA 2YU9B 3NNAA 1OQ6A 3GTPB 4OV1A 3CJTA 4DR5L 3BS5B 2DNZA 2Z57B 3MFIA 4CBVA 2WZ1A 3M4PA 3H0GB 3HHLC 4DFKA 7ICUA 3D0FA 2VUMH 1XJWB 4C7YA 3F44A 4RA8A 1ZD4A 4F3OA 1TWCB 3W1YC 1VQSA 5AIAA 2NO4A 2M8HA 1JWWA 5T1GA 3TAPA 1DQ8A 1Y4ZB 3J81U 2CQAA 3HJEA 3OJUA 2F9JA 2BXJA 2CXYA 2HBLA 4X2BA 9ICFA 1MC8A 3OFGA 4CGZA 2LKVA 3PW4A 3M32B 3MUVP 2F44A 2WF9A 3G8SA 1H98A 3OSNA 5F3TA 3IRWP 3K2YA 4Q2MA 2ZIWA 4LF6Q 2YWKA 1VQ7S 4RZRA 1I6HB 4AE5A 3F53A 4GOPC 4AXJA 4ECYA 4M04A 1JB0C 4RQ1A 5B09A 4ZPBA 1TKZA 2IX1A 2ZH5A 4BBSB 3EXCX 4AL7A 2K7KA 1H9SB 3PIOA 5C42A 5C0XI 1NK9A 3BYRA 5JVGQ 3HSJA 5F8JA 1SYEA 2QSFA 5GADI 3AQFA 3D4JA 2HHPA 3ICEA 2DRDA 3R9KA 4ZVUB 2VPZB 2BJ9A 4B3MQ 4A3JH 4WBFA 4AFFA 4LAAA 1KEKA 2DN8A 2O01C 4R0JA 4QPXA 1B64A 4A3IH 1HW8A 5M3MG 1N34L 5A8KB 1X6OA 2NVXH 2ZIVA 3LUYA 5B0GA 2HIVA 2UUAF 3CCRA 1IBMQ 4FYVB 3KK1A 1L8OA 3QOLA 4F88A 1SR3A 4KHPJ 3HJFA 1HHQA 5E0OA 4Y52H 3TFRA 3QLHA 1O7YA 2PQAB 4C1NK 1Q1EA 1WC5A 4DV5F 5AI0A 4ZCIA 5EDWA 3S14B 3JPNA 3MEFA 1G7CB 5L1JA 2YPZA 5T14A 1S79A 2QLXA 1KHWA 4DLEA 4X64Q 3KUGA 3HXMA 4QZCA 2QX0A 4EBEA 3Q8LA 2AWOA 4FF3A 3I8ZA 3F73A 2C1EB 4CKBA 3VR3A 5IT4A 3KUEA 2KVMA 2MQPA 5FO9B 2QE5A 4Z7CA 2WFAA 2VJVA 1XIQA 2VL1A 3FRYA 2BQRA 2JVRA 1SZPA 2HG4A 3Q8KA 4PZ6A 2N88A 4GKKJ 4DV2Q 1FGUA 4I2IA 1FDAA 3TREA 1RIPA 4IC9A 2MXYA 5DDOC 1MKHA 2HWTA 4N8X1 3QJJA 4KJNA 2VU5A 1K83H 4US8A 3HOWB 3OTOJ 2WB4A 1RK8A 2IFXA 3J80U 1JXEA 1Q5YA 1NOMA 1HPZB 4X65Q 1RYSA 2A1JB 5HLFB 4A3IG 4TUPA 3PGZA 1GJXA 4JW0A 1NZBA 3TN2A 4QZGA 2FZKB 1A8VA 3MCMA 1PH1A 1F0MA 3SEBA 5M2PA 4YDXA 4NCGB 3DLLA 5C44H 4KSEB 3QSIA 2D41A 2KYZA 1HR0F 4KLMA 1JB3A 3BGLA 4OHVA 2QLFB 1HIYA 3T1AA 1BY9A 5IY0A 5BR8J 1ZYRD 5JUMA 1FWLA 4ED8A 4W98A 1Q81C 5AKGA 4DCOB 5D3DA 3CC7S 4F4AA 3EJIA 1C2PA 4Q5VA 5IWAF 5F3ZA 4JI2Q 1Q7YC 4ZS6A 2W55A 4X65L 2NVYH 4YHHL 1HQEA 4O44A 5A8WB 5CABA 2ZIUA 5B5EU 1C1BA 3D7SB 2DVIA 3QU2A 1GUGA 1TMJA 1OXVA 3RW6A 5IGEA 4OX9L 3OIPA 2GJIA 4DXLA 1JNZB 4NLTA 4DR6L 2ROGA 3ICXA 3OTQA 2IC3B 3ILOA 3IFDA 4MHVA 4K4TA 1PFNA 3T5JA 3Q22A 5KT2A 3HVTA 2ID0A 5JEAG 4M9JA 1Q8LA 5LL6d 2NXUA 1GD7A 4K7QA 3CIZA 1JCKB 2FTRA 5ETLA 2ABYA 3NEMA 1ZQFA 3F0NA 1R8HA 2ZWPA 4XYQA 4XQ8A 1JK9B 3WK8A 4XYOA 1XSLA 5AE3A 5E4XA 4Y2KA 3SI8A 1X4FA 1D8YA 1N88A 4C9DA 5ELBA 1EL0A 4YY3Q 1ECWA 2ZHAA 2ZBRA 1I50B 1MW7A 1UFLA 3VR2A 1ZQKA 1FT8A 4ZPTR 1QVGA 1PAEX 5ALUA 1GKHA 1RKNA 1I6JA 4HT5A 3PIPQ 2Y0SD 1PZJD 4DSJA 4Z37A 2UUCL 4DR7J 4YD2A 4DAYA 4ECSA 3ZZTA 4DK3C 3C66A 2YMQA 3AYHB 3HG9A 4HJ7A 3CDEA 4YVZA 1CSJA 2LEPA 4LFAJ 3GG1A 3DM3A 4G7OC 4BY7H 1WUUA 2G06A 1Q8KA 2ZH4A 1X9WA 1V9OA 3D28A 3MCSA 3JAML 1KXLA 1X66A 2AGQA 3R2DJ 5CQGA 3M4XA 3LGHA 4ZCMA 4NLYA 4LF8Q 5I42A 3DFEA 2QTWA 3T1HF 1D0EA 3HP6A 2K1BA 2HS4A 1X4CA 1SNDA 3MM7A 2IM1A 4G1PA 4LMZA 2NXEA 4KKSA 2F8KA 4RQ4A 1RYUA 4O5EA 3IS9A 2LFNA 5IGCA 4A3KH 1WTXA 1FE0A 3HVAA 2XEXA 2RQXA 3S1RB 3Q86A 5E2QA 2B7CB 2F40A 3N6NA 4ECQA 2RHQB 1QZHA 4K0KL 3DDKA 2JA8B 1PMRA 3G6EA 1SE8A 4EX5A 1LWFA 8ICBA 2W3SA 5K8OA 3NRZA 2IRYA 4CT8A 4D3GA 1RA6A 2YTYA 2H3IA 1GUOA 2R3VA 3HHDA 1FD8A 4EYHB 1XPOA 2HUGA 3O5TB 2DPJA 5A76A 4LF5F 4R8NA 4UAUA 4NLGA 1EKSA 1PYOB 3KF8A 3EW9A 3MM5A 2CJ9A 4J9VA 1Q7YT 2AX0A 2IHEA 2DTJA 1CKOA 5LMNW 4F5OA 4Z6FA 4O3SA 2VUMB 1MGSA 2DUYA 4RNMA 3K7RA 1FHTA 3T1YF 4QZBA 3J7A5 2MQHA 1Q82C 4FVCA 2ILYA 1YJNA 3KBBA 1YHAA 1X4BA 4LRCA 4M9GA 2NV3A 5C24B 3IC1A 3MFGA 1RT5B 1YG0A 2FIUA 1S1WA 1JLBA 1IKYB 2E8PA 4TY8B 3M85A 4ZOHC 5KG5A 4LUVA 3GJSB 1OQ3A 2F4VL 1RT5A 2CPXA 1I5OB 4DLGA 5IYBH 2KOLA 1K8OA 2E5HA 2D3ZA 3SR6A 4G1QB 4A3EG 6FDRA 2V63A 4B3RL 1RBLA 4N8OA 3ISZA 3MDCA 3D54A 2EE1A 4PAAA 4UB8U 5M2RA 4OMFG 2QYCA 2F7VA 1WTWA 3L4PA 4M5NA 5J1NA 4PJ0U 1OJ4A 3QSYB 3BPSP 4O3NA 3ICLA 4WFZA 3IMQJ 1Q4RA 1T5XD 2COLA 4WKRA 1NMEB 3EPGA 2DXFA 2QKQA 4KHPF 2YNIA 2D74B 2CKWA 3KYHC 2G2OA 2XCPA 1KKXA 5FLXc 1CHPD 1X6IA 1R43A 2BDUA 4HDGA 3MEKA 4U8VA 4LRDA 3TRGA 1X9XA 2FVRA 3VV2B 3ISBA 1X3QA 1SNPA 1YJUA 2WBMA 3SSQA 5KFYA 3A5UA 5NUCA 2KECA 4HYKA 1LO5D 4FF4A 2A1BA 4BC9A 1DRZA 2DGWA 3EVWA 3M30B 3OPXA 2CDRB 1R31A 4LR7A 1YQHA 2Y0SB 5CYQA 5AKEA 1KFSA 1OTCA 2E44A 4TQSA 1RAOA 1PJ5A 2W9CA 2A6MA 2VG5A 3WKDA 1TWGH 1RT7A 2OQKA 4B08A 5J2KA 4FZMA 3SMVA 1FO4A 5FK9C 4WU3A 1GAOA 4OWXB 3EN2A 3D6JA 3CP8A 2OT2A 4KYZA 1MU2B 5IIOA 1B53A 2PZWA 5CYJA 1VOMA 1BUVT 1PLFA 1SYCA 4WE1B 2AJQA 1L0YB 2PT0A 2HBZB 1RTIB 2ASDA 1EYDA 1KVIA 2WW4A 2Z2YB 5IIKA 2BOSA 1TUGB 2B6AB 3U58A 2FVPA 2VQEL 1JKHA 5BR8F 2NVQB 4PL2A 3FUYA 1OYDA 4KN7C 1KW4A 3IG1A 4Q0BB 4QNLA 5ETNA 5F2DA 2KJ9A 3AJ2A 4JI8L 1TT2A 1CULA 3KLVA 5AM4A 2ZZTA 3GTOH 2BMBA 1XWEA 1FRLA 3GWCA 5KFTA 1RKJA 3CJRA 1D8LA 1N5VA 2B9EA 3MECB 1KLMA 4OX6A 3ETRA 3D2QA 1XN9A 1XBWA 4B9LA 1PSDA 1REVA 2JSXA 4EI2A 1CM9A 1RWVB 4WJ3B 3POTA 3LP1B 3DRXA 1S0VA 3GFHA 1FX4A 2C2EA 3SCLE 2JA6H 3V6JA 3CRLC 4XXEA 3BM7A 1KTVA 1BGXT 3EGZA 4LF4Q 4IO9Q 4K8RA 1CLFA 4WTOB 2GAGC 5K8PA 4N9TA 3DN9A 1G51A 1CJUA 5CR0A 3FSIA 4FF2A 2R7ZH 4LBIA 2F8MA 3N01A 1KNAA 1K0RA 1HEKA 2RDJA 2DH8A 2NYIA 5LMUF 2HOFA 4WXOA 2KHVA 1X2IA 1U1NA 2V2ZA 1M5PC 3PUVA 4AH6A 3P1HA 1VRUB 3IRXB 5GAHU 1FVQA 1WG1A 1VMCA 3W9HA 2NN6H 5A8RB 1GX6A 2KZ3A 3AODA 2HFUA 3LA0A 2UVUA 3DCAA 3TA0A 4DGZA 2NSBA 1CRXA 4Q44A 3S24A 1WF1A 2B51A 3NASA 1Q82T 3EQLC 3UXNA 3FMCA 3K59A 1ZQVA 1VQ4A 2OSRA 3C6TA 3ZZYA 2B9XA 2YQ1A 1U1KA 3BO3A 3UN3A 2YQEA 1HRJA 3JSYA 4EGVA 9ICWA 1DTQB 1B3TA 4IUFA 1RDFA 8ICGA 4IQMA 1U1OA 1HJPA 3M1VA 1RLCL 2XS2A 2FPKA 1MSGA 3I7FA 3KFUF 4ZLPA 2EANA 1SV0A 3CP0A 1Z4NA 2XSCA 4JV1A 4CLLA 4ED0A 4M5DB 4FDBA 2LCWA 2VODA 3OVAA 2CPEA 2E74C 1MROB 3HF5A 2MZ1A 2FHKA 4NYZA 4KLUA 2BKOA 2XI2A 2G2YA 4YN3B 3FKIH 5H1SE 3E3XA 2MPMA 5D65A 1R9TH 2VJUA 3HHLA 1S1UB 5ALHA 2XWBB 2KJ8A 4IFVA 4MKBA 2RKSA 4USJC 3TA2A 3PUXA 1BQNB 4YP3A 2OF1A 9ICEA 3FCVA 3OTEA 5HBMB 1HD1A 5IIFA 2KG5A 2CQCA 2PFFB 2UU9F 1PH4A 3CJSA 3GTQH 3CCVA 4LF5J 1DZ5A 4JI1J 3GTJH 2RP5A 3WZ0A 4LF8L 4NA3A 2I2YA 4HN7A 5KFSA 4PXCA 1IM4A 5HVFA 3V6DB 2JP1A 4KKUA 3PO3G 3N79A 3W64A 2W9BA 1CEZA 4O3QA 1HHTP 2P8IA 2E8GA 2E8NA 1EY5A 4OZNA 2EDGA 5EBCA 1WOPA 5J3BA 4I27A 4OO1G 4DXFA 3MUMP 1SH0A 2KJWA 4U8YA 3N4WA 4GOPA 1NNXA 1ZQYA 1RT2B 4DR3F 2FDRA 3H0GH 2PQEA 3FC9A 1GO3F 2YB4A 4JC0A 2UZAA 1QG7A 4P7VA 3LP2B 3KK2A 1VQKS 1MQ2A 2DNRA 1FNXH 5CZXA 2KA7A 2EYJA 4DV1Q 2DGTA 1PK3A 4F50A 4YCUA 3HOUG 2L41A 3PIO3 1NJXA 3H09A 4RGTA 1FE4A 1LLRD 3SGIA 4DKAC 1S0OA 3PW7A 2J9DE 1RTIA 2KUMA 3US5A 3FRPB 4WE1A 3HJVA 4OYXA 3JSMA 2YMPA 2ZH2A 1VQIA 3I6PA 4LBHA 3M32A 4C6AA 4OI2A 4IPHA 4R0EA 2KCCA 2GO7A 2B3GA 4HI1A 2CPZA 4KV8A 1I4RA 2ZJAA 1JICA 1IUJA 4DU9A 1E6YA 4DV4F 4H4KA 3ZTPA 2B3TB 1N5YA 1U4BA 3J7ZC 2RBMA 2B8GA 3NUQA 4X3TA 1PFMA 2DRAA 2MYFA 4ZJLA 1UEAB 5J0RA 3EICA 2F8LA 4C8NA 4IUNA 4X4UA 2XZWA 3TADC 1QSSA 1H73A 1D3WA 5A2QU 7ICSA 5AKKA 2KN4A 1VQ7A 3VR5A 1VDVA 2KP7A 3TX0A 4DHVA 1SEBD 1RODA 4ZPDA 3R5BA 2ZZNA 3J7YU 1BNOA 5IWAJ 1HUNA 3LAMA 2E29A 3V6KA 5KG6A 1F77A 1APSA 1S5LU 2QCPX 2CJKA 4USIA 3SFGA 1B50A 4ZMMA 1VLOA 3CHBD 4C8MA 1EIHA 3W3AA 5G5GA 3M7GA 2WAQD 2X6GA 1RAEB 1Y5NB 1YITS 5FLXE 3KJVB 1HNZJ 5IP7H 1Y14B 2LPEA 4QIWF 4HEA9 3KKFA 4H4KC 4PQUA 3NBHB 2ZKUA 2FHJD 1CKNB 4A3KB 2BM1A 2ATWA 1ZQIA 1PA6A 3G86A 2FVSA 3U4VA 4C1NI 4A76A 2GH1A 5B0BA 3V81A 1XMOL 4O44B 5A8WA 4ZVHA 3PEJA 2AIRB 1XO0A 4O3RA 1V1QA 1E6YB 2Z1CA 3TAQA 1JOKA 2CADA 1MN8A 2A69C 4G7ZC 5KNCA 2OAUA 3I55S 3CCLS 3ER0A 2GVAA 4KQZA 3GQBA 4P4PA 3K58A 1NDCA 3HKZG 2D9PA 5D0EA 5A6PA 1TR5A 2O5JC 1FDNA 2VV5A 1SE2A 1UETA 2KO1A 4DCJB 4B3OB 5JU5A 4M9HA 1S9GB 3IKJA 3QO2A 4CRXA 3O6QA 5AI5A 4FFDA 4LUZA 3RD4A 4BXXH 4C8LA 4O1NA 4M5KA 4BHQA 1NU4A 4ES3A 1O08A 1EYGA 1YNJC 4XAKA 2Z7JA 2XC9A 4DFJA 1UP1A 2HHHJ 1S59A 7ICFA 1MN7A 2ADCA 1XO1A 1Z7TA 4L8JA 5HLFA 4IQZA 2IC3A 3I4HX 4DV6J 5KT4A 1JMCA 4AL6A 4AL5A 2HMIA 1FIQA 1IM6A 4K5VA 2GHWA 4QR0A 5F3XB 4I0WA 2IM2A 1I1GA 4IR1A 4OHYA 1GUSA 3IRUA 2GVZB 4M63A 4LUBA 1SC4B 2IHMA 2WSCC 1VQ6S 1DOLA 4YB1P 2XB2D 4RJVA 2O1PA 1Q81T 2VB2X 4NASA 1OPZA 1HMVB 1RWPB 1N33Q 4F4XA 2CHBD 3PCOB 5BN4A 2MUTB 1PGZA 3F2DA 3ULHA 2DNNA 1NR2A 3Q0AA 1TVAA 2BPFA 4DUTA 4UZCA 2JJ4D 2A6OA 2GIQA 4IN3A 2ZJ5A 5ALPA 2DQNB 4CDIA 2AWZA 3J80L 5IILA 4N8NA 3EVMA 1LK5A 3KK7A 3CXCA 3BZQA 3E51A 1ZQ1C 3Q24A 4K8IA 1ZQHA 1TELA 3PJXA 5FIIA 1MMDA 3K8VA 3BVZA 3HOWG 2UUCQ 3ETLA 3GYXB 4XQNA 1RACB 2G1HA 5K8NA 1CJTB 2EPBA 4U9RA 2UUBQ 4ICLB 5E41A 2KXHA 4KFBA 3G96A 3ZDBA 4IOCQ 3KG4A 3DOKA 2UU9J 2QEJC 3LNNA 1IR0A 2R92G 3FK4A 4UHVA 2JA8H 2JEBI 2F1FA 4I2QA 5KG1A 3HHNB 1E2WA 2LYBA 2KFNA 3BG3A 2DHSA 3GTLH 4Y2IA 5JJZA 3MMCB 2F4IA 4J9RA 1MBYA 1NR4A 1CG2A 4QWCA 3KLFB 2CQIA 4OWTB 4CLFA 2D7SA 1VQ8A 4NLBA 2CQPA 3SBMA 3T5LA 2V4JB 5D8HB 2EJFC 5CXTA 3NRWA 1TU0B 4KV8B 3GD7A 2Z56B 5L9NA 4CDCC 5M5YH 2YNFA 1DQ9A 2WF6A 4TLQA 2C35B 5E3PA 1JROA 2KEEA 5IV3A 5F8MA 3U7JA 1KLMB 2HRTA 1X0PA 5J0WA 2Z4PA 1HI0P 2JX2A 2NTTA 2Y0BB 3M6KA 1KEJA 4K2KA 2OMLA 2QL5B 4AT1B 3AQQA 4OO1I 4O5CA 3I0SA 4M1KA 4ZIWA 1UVKA 4J9UE 2AJFE 2C28A 1LWEB 3TW0A 3MGIA 2F5GA 1MA7A 3I4NG 9ICRA 1S57A 3ZDCA 4NV0A 2FC8A 5AKZA 4EEYA 5M5YB 5EOZA 1TIID 1Y8NB 4GNXC 4UOHA 1XTZA 3DNCA 2NCKL 2GMJA 4IQWA 5E7OB 3AQEA 1XTCD 4FKYA 3E5SA 5DB6A 1U0SA 3I1YA 2JYOA 4K2XA 4UW9A 9ICQA 2DKOB 2KEDA 1EQRA 3DMJA 3CUNA 5E3CA 3G87A 3C23A 1PTOD 2Z30B 1DGJA 5DQIA 1FFWB 4OJLA 4KITB 3B6YA 3HOXH 5DRKA 2E8MA 4PWUA 4PHPA 3T13A 3JQMA 1LTRD 3V6DA 1Z00B 2Z0GA 1BQMA 1ZQGA 3PTWA 5J2HA 1ZQWA 4R5PA 2F0VA 3IGVA 3DMUA 1PJ6A 1JJHA 3WKCA 2KBNA 3ZD9A 3D4WA 2J7UA 4GKKL 3AT1B 1C0AA 3GDEA 4ZP7A 1BXNA 2MZQA 2G2ZA 2LXIA 4KLEA 3M9BA 4IJHA 1HWUA 3IBFB 5LXRA 3DRPA 1PILA 1B99A 3M1YA 2PMZC 2KHCA 1WDTA 5DJBA 2DNEA 4WFN3 4DV7L 1SGGA 5AJ3Q 4BWGB 4DR2Q 2ATLA 1CQVA 5C4XG 3GTMH 2ATCB 2FLPA 2NRWA 1JQYD 2ZIXA 4C3MA 1BPDA 1NPRA 5L46A 4PGQA 1Q78A 1H0HB 3OXGA 2V4RA 2EC2A 1QQ6A 2XN9C 4X66J 4C3IG 4BBRB 2MY8A 1N8RT 1UT8A 4R4CA 3QMQA 1NTGA 4O0AA 4B3TL 4CDGA 1XR7A 5ALZA 1QUPA 1ASZA 2F0UA 1TVRA 1RXOB 4P2HA 3K0YA 3B4DA 1EQTA 1C20A 3CIMA 3NCPA 5HMWA 1SQGA 2K6AA 1NEEA 1SMYD 3I4MG 3U1MA 2MB0B 2GJ2A 4DPTA 1A62A 3VA5A 2DR9A 4Y34A 4BY1H 4RBTA 4XUSA 1H74A 5JRTA 2K50A 1VQGA 3A7LA 2IJNA 3R7BB 1DOQA 4JI4J 3GU3A 4O0NA 1V8QA 4UP7A 4TU8A 3JAMY 3W1GA 1NB2A 5C3XA 2F4VQ 2JJQA 2VW9A 1CKNA 2B4UA 1I4QA 2DT9A 2XULA 2XNAC 1WG5A 1DHMA 3QX7A 2CCZA 5ELCA 1N5WA 2K04A 5J0UA 3KLIB 2NB0A 2K4EA 3S8SA 5ALJA 2XSJA 2QKIC 3P5TL 4ODGA 2EPIA 4A48A 2G9HD 4FBTA 3GU0A 4J37A 3QIPA 3IG8A 2FQQB 2Q2HA 5CJ7A 2F52A 1WACA 4AQYL 3OLAA 4KT0C 1FVIA 1NCVA 5HP1B 1W2IA 3TACB 1YJTA 3OMCA 2Q8TA 4DOZA 1NXIA 5I9PA 4JV5F 4FP9A 2FMQA 4LFCF 3M6WA 1H7WA 1Y1WB 2WACA 1YZ7A 1RXVA 1K1QA 2CPDA 5K36G 2UXCL 4K4GA 1OO0B 1UAPA 3I4PA 1S72A 3T79A 1V5VA 5DBBA 3T5HA 2P9GA 4XTTA 2ZC4A 2OWOA 4WK3A 2EJGC 2I1QA 1NK5A 3C15A 3LWEA 2YKMB 8ICPA 1QM9A 4DSFA 1RCVD 1ZD3A 2IRUA 2GQQA 3W7BA 1V3ZA 1PYSB 2JH7A 2NO5A 2MQMA 5M3FG 2V4QA 2EFPA 5AM2A 2KHQA 5LMUL 2XLJA 3DLKA 3MZ5A 3DLGB 4KO0B 5C44B 1F1BB 3PSFA 1VBYA 1TFYA 2BANB 4QUCA 5DM73 4KX5A 2KXNB 3M2UA 2VBXA 1QJOA 2YPYA 4HAIA 2NXJA 1UWAA 1YSJA 2ROEA 1IBKQ 4UBCA 4ZVRB 4ED4A 3HSZA 4R66A 1LTAD 3M8QB 4DR3J 1L6NA 1W6KA 2C5CA 2UXBJ 1NO8A 2GN5A 1RWUA 2BJ1A 1FESA 1KQGB 5K14A 2MUYA 3S1MB 1IYJB 1G6PA 3CC2S 2HWHA 2UXCJ 2WSEC 3RYLA 3M6XA 4A3FB 2A18A 1STGA 2XMMA 3SK5A 4ILRA 2I07B 4FBUA 3AUOA 2HQIA 4BA2I 4DV4Q 4DF7A 4RLEA 1JLGA 2BA9A 4C3HB 3VYTA 1VBXA 1HCZA 4XQJA 2B0CA 2ADBA 3MAAA 2VFSA 3U27A 4DX7A 4ZVQB 1RTDA 1NY4A 3I3CA 2E2JH 1KKHA 1UZDA 3IP0A 2EYPA 2ZJPQ 3GTGB 3RB0A 4DV0F 3ERSX 1TE2A 1NJWA 1VQOA 2KICA 3PMLA 3RJEA 2EKNA 3G6ES 1HFEL 4UB6U 3PYDA 1UFWA 3Q8RB 3NPPA 1FXLA 1WI5A 1XU4A 1S48A 2G13A 3TMEA 2OD6A 2NVTH 2DKXA 2W8LA 5KG4A 1YVCA 1PH2A 4X64J 1F2GA 2CPRA 4DL3A 3TS0A 1WD6A 1SWVA 1NLKL 2HDLA 2PCFB 5I4DA 4Q45A 5EWGA 2BBEA 3L7PA 4ZA1A 2MAXA 5IOCA 5ISRA 4YHHQ 3OFFA 3U4ZA 3UE2A 5G5HA 1B7YB 3W8GA 2R93H 1GT8A 5CV8A 2XI9A 3DDHA 3CQZB 4RWXA 3M9OB 4C0HA 4GN4B 1X7VA 5FOBB 3PX6A 2A68C 4M9LA 1EETB 2NLWA 4NCAA 2GIRA 4AYBB 2EXZA 4J9PA 4QYZJ 4M5DA 1HZAA 4A3GG 5CC4A 3RZDB 2UV8A 3CCJS 1K73C 1U6FA 5C2CA 1BCPF 1W2BA 4RW6A 3K5NA 1Q90A 4UY85 1MI2A 1D5MC 3J81j 4DXGA 3ZTRA 1NKBA 1Q3LA 2ZJRQ 3Q8DA 5CYMA 2IVFB 4IFVB 3VR1A 3HOXB 1CJKA 2K2PA 1HBOA 4B9VA 3OUYB 2QLTA 4JOIA 3ISNC 3NXZA 2DD8S 1WYGA 4C4TA 1LM0A 2XS7A 3IG5A 4WJWA 1UW9A 4DF8A 1EAYC 4UB1A 4WFXA 3BDOA 3HP3A 2HQDA 4CJ2C 4OZ5A 8ICWA 4B02A 5CP2A 2Q0ZX 1PH7A 3GYGA 1CK1A 4PPDA 4DMZA 3FDTA 3JPOA 4KD3A 4I2EA 2C2DA 3WKBA 1CJVB 5I3UA 2B2YA 2F0TA 2RDFA 4ELTA 2OEHA 4R4TA 3HILA 2HI0A 1UE6A 2WOMA 5AIBA 2ICIA 4X4SA 4QQBA 4WKYA 4JI0J 3J7YW 1PC4A 4OIXA 3C16B 2OSQA 4FNFA 1FNMA 1PHJA 3FC4A 1SVDA 1Y3JA 2CZ9A 3NNHA 1NI3A 4NXZA 4EENA 3AB2B 4FXGC 1U8SA 2MQNA 4TKTA 3OPOA 1RT3A 3NS6A 4R4OA 3GTJB 1GMWA 3MUTP 5D4NA 1TL7B 2FVQA 2G4BA 4CT9A 5ALXA 3W60A 1HHVA 1S77D 4DAVA 4LF7J 3D3CJ 1U0HB 1N0UA 2JA5G 4JWNA 2L5TA 5IYCH 3M4OH 2N3OA 3I56S 1LTSD 3M6ZA 4DX8H 3H8JA 1N56A 2X3DA 3QQCD 2L9HA 2HRUA 2DRBA 2HEKA 4M47A 4B3MJ 1Y1WH 5DLFA 2AX1A 3VAHA 3SV3A 2VKZG 4OV6A 1P9QC 4RPZA 4OEMB 1IN0A 4QYZK 4IURA 3U1NA 3ONNA 4PG7A 2EG1A 2HFZA 4Y2VA 5KFJA 2H1YA 4GKKF 4K0KQ 2IAJA 2K52A 4C3JG 3GJTB 2DHAA 4B17A 3DLHA 5KNBA 2RF4A 4DR7Q 4H44C 5ALFA 5EE0A 2C42A 5HANA 4CH7A 3MHBA 2Q6CA 5H9FK 9ICSA 1RWKB 2JZBB 2R8GA 2KVCA 4P10A 5AM5A 2R7UA 1FRHA 3C3LA 1S76D 3HS0C 1V6HA 1GHKA 1RT6B 2R3ZA 2K89A 3ZFVA 4QWDA 3FHWA 1S9EB 2KDOA 1J9OA 4IYQA 4EYIB 1TFRA 2G1DA 4LFCJ 3EPIA 2O67A 3BV8A 1U5KA 1FKPA 4IPCA 1S4ZA 2MKIA 2AEMA 1LT4D 4M5JA 4EQOA 2CPYA 2HBJA 3BQ0A 4EVOA 1UHUA 2IA6A 5DB8A 2W01A 2AV5A 3R1LA 4L76A 5C3WA 1U4PA 1EXNA 5F0WA 1BXTA 1P9YA 3VYRA 5AICA 2MRLA 1ZH5A 3QU9A 1CTMA 2BH2A 3AM9A 4TQUS 5DB9A 3GTQB 1VRQC 3DXSX 1SIZA 4OIKA 4JV0A 1B9NA 5FJ8G 2F0FA 3D67A 3UD5A 2X7IA 5HHIA 2RHFA 2KI2A 3ZXWA 1TWHH 1T8EA 3LWMA 2J0TD 5M5WB 1CC8A 4ZP6A 4WZQA 2VIXA 2A1JA 3V2UC 3E0JA 3K0JA 3KHHA 1P8GA 3LH2S 3M4QA 1YJ7A 5J0QA 1SKSA 3NNCA 1FRIA 1T4GA 7ICTA 3CO9A 1QVFR 2VUGA 2A69D 1AW0A 1HZ9A 5E7NA 3QNMA 1C9OA 2QW7A 2RKIA 2W4CA 3N6MA 2GA7A 3DYAB 3MEGB 4UB3A 4OZ3A 3H94A 1ROFA 2C2MB 3URYA 4P2MA 1L7NA 2LQJA 4OZ2A 3NGRA 2DEIA 5DO2A 2Z6BA 1TK8A 3ISND 1F2ZA 2KHSA 2FB0A 2O4XA 4UDUC 4UUWA 3RH6A 1JLQA 1FEEA 3AD7C 1COKA 4C97A 2NRTA 3N97B 3BGFA 4R9WA 3D0HE 4MFFA 3LOUA 3PW0A 1HUOA 5KFAA 1LTGD 1JLBB 4KC5A 2JEGA 3TFSA 5CRXA 2XCAA 1D1IA 2IDLA 1AE2A 1HZCA 3NP5A 5IGGA 3TJ8A 2GIFA 1K8GA 2KHIA 2LA6A 3R6LB 2R7RA 1IQZA 4IQUA 4I69A 1PK1A 3UMGA 2ACMA 4F7XA 3TKAA 4KFBB 3NTIA 3D6FB 2WFWA 1YK9A 4A3DB 2EYOA 1ITPA 3W2VA 1S4EA 3K81C 4UBBA 2CAJA 2AEJA 2CQOA 3OTOF 4RNHA 5A2QY 1UVNA 4RW4A 2H3ZA 3U50C 2LFVA 5GTIU 2KIWA 2B2UC 5ALEA 3CJQA 2F0GA 5D77A 2RS2A 3R7NB 4F8RA 4P2FA 2N55A 3K0XA 1PYTA 1BPYA 4EUVA 1A9NB 4ZVSB 4LF4J 3CJ2A 3Q8SB 1QCBD 2A73B 5A6WA 3MWBA 4MIAA 1U2RA 1K8MA 5K4LA 4DV7Q 4YY3L 3U9OA 3FKBA 4LF6F 2R7VA 3K5OA 4DK6C 3S16H 2K4KA 7ICRA 4BS9A 4ER8A 2HLTA 2F0PA 3BZCA 3RAMA 2NZHA 1AEXA 4AYBD 1ELOA 3JQJA 3D2WA 4JOUA 2YY6A 4BA1I 1HNZL 5AE2A 1A3TA 1D1UA 2DKZA 2NPFA 2YWGA 2YNFB 5A0YA 3IAM9 2XMWA 3M8RA 3H40A 1NSNS 2QG9B 4DOAA 2YKNB 2E2HB 4NXNJ 2F4VF 1N36J 3CCSA 3KDFA 4BLGA 2QF7A 9ICMA 4UF4A 1OSCA 2ISPA 4N5SA 2MDAA 2BOPA 4RR5A 2B2UA 1S1XB 3J7AF 4ICAA 4CDDC 2DH9A 2VANA 3DI6A 4B3RF 1S9FA 3KOJA 3BU2A 2E66A 1PH3A 1RAGB 4QZVB 2B63B 2VJ4A 1UA0A 1BUXA 3ZJYC 3TZZA 3WK4A 2D5DA 3H4BA 3DC2A 5I42B 2DB1A 3PF4A 3F2UA 4B3TF 2V94A 1I4PA 4A8QA 2K33A 2BE2B 5G0RA 3D9BA 1LWXA 3WHIA 1IWAA 4H4MB 1PZNA 3H6MA 3FBBA 4JI4F 4YR0A 2B56A 3IR7B 1EYAA 1ZKOA 2UUBJ 1PRTB 3W5YA 1D7QA 1ZQQA 1AUSL 2NVXB 4ZUJA 1O51A 2CQBA 2FZCB 3BQTA 3QG1A 1QD1A 4I2DA 1AT1B 1RADB 2R42A 5J0YA 4HACB 4LF7Q 5FD1A 3UFCX 3KLGA 3CMAS 2J7WA 4U96A 1D2BA 3IM9A 4QZ8A 1Y69U 2OKQA 4R4IA 4IUTA 4DR4J 3SMZA 4A3JB 4FO2A 4A3EB 1S6QA 1LKZA 4LF9F 2VG7A 1HWIA 3TQ1A 2I6WA 8ICKA 3JSMB 4JI3L 1RHMB 1NSQA 3HM9A 1HLWA 3MM8A 5EAYA 1YNJD 4JI4Q 2XG8A 3H5UA 2M70A 3MAAB 1AROP 4ATNA 2V69A 3AOCA 1PH9A 2Y8WA 3RB6A 4E6IA 5GAEU 4RCNA 2DGSA 3T1HL 3MDFA 8ICFA 4OYMA 1UEUA 3TRZA 3MMBB 1S97A 4J1MA 1ET9A 3FZBA 2NTSA 3EMTA 2DGYA 1U47A 3PV8A 2UUBL 2EZYA 1UE5A 1XMQJ 3DLEA 4KHVA 3IL8A 3TUJC 2QGQA 2K03A 3VA7A 2CIMA 5I4MA 5EPKA 4KX3A 3HKZC 3W2WA 4P4OA 4ZPAA 4JI5J 2LS01 4IL6U 3M2RB 4NLKA 1EARA 4EU0A 3DHXA 2KKVA 3KJNB 2OPRA 3EVOA 2PC6A 2BA1A 3T5KA 1EQMA 2A6EC 4H4MA 4KLTA 4ZVEA 2D3O1 4G3IA 3PUZA 2DISA 5C4ZA 1WC0A 2B6GA 3NL0A 2XZTB 3IN5A 1XQIA 2AJ0A 5C25B 4G4KA 2ZOGA 2HZVA 5KFHA 2RQMA 2MLYA 4TRDA 2EFQA 2FHOB 3K8WA 2XRQD 8ICCA 3NG8A 1JJ4A 3WIUA 3HHEA 1XSNA 2HHQA 1V5IB 4HHUA 4QPTA 4IJLA 1WTVA 4TU7A 1SUQA 2CG8A 5E3QA 1ZQCA 3M8QA 4KIAA 1OS5A 3NGTA 5J2IA 2MKYA 5E3RA 3P4UB 1H38A 1ZQPA 3QWPA 4JI5Q 3WK9A 5FO7B 1Q5VA 1GUTA 4BY1B 2N3LA 1Y1VB 3DRSB 2YY3A 1SRUA 2F0LA 1VQ6A 2QJ3A 1OW5A 5E79U 4HI2A 4XA5A 1VR6A 4DF4A 4P2CB 4X4OA 5ETPA 3M1VB 4YWMA 2JA7B 3WBZA 2HOQA 3S1MH 1C0TB 2F3IA 4I28A 2DHXA 2E2IH 4A3LH 2W1BA 4F72A 2UP1A 5E3FA 1PO6A 5HROA 5J0TA 4RW7A 1I4XA 3R2TA 4UAYA 2WK4A 3WQPA 3HOUB 2G9DA 3OQ2A 4EQNA 2BABA 4OCZA 3CJ0A 3IM1A 3ZZZA 2XGQA 2MQLA 2H3FA 2JEJA 1DK2A 2B21A 2E1MC 1XMOQ 4ZRZA 4YOEA 1ICFB 3I56A 4RMFA 4IOAA 3DOLA 5A8RA 1N36Q 2SDFA 1WOOA 3C2LA 2YV5A 4ABNA 3M8ZA 1GQEA 2PPBC 3GR0A 4JI3Q 2WHOA 3P49B 1S0NA 2J0WA 3ETMA 1SYGA 3B54A 2VQFL 1TXYA 3FMBA 4M5GA 4A3BH 4HKQA 3THTA 2FE9A 3O8WA 1I94J 4Y7NH 2B4VA 2AUJD 9ICLA 2CVIA 3H2UB 1TP7A 4YY3J 1SQFA 1GOZA 5GADC 4NRUA 5BJRA 1VIXA 2E9ZA 3MPUB 4LF4L 4IQXA 3IP4B 1ZD5A 3FBCA 2K32A 4UQGA 3H0LB 1SC3B 1EZ6A 5GADU 4QCLA 4Y0FA 3STBD 1W26A 1HQEB 2KSOA 5ALQA 4J7CA 5C4XB 3GR1A 3M3YH 4N77A 4QL5A 4C2MH 1VQEA 1Z6HA 9ICNA 2K8CB 1QSYA 4BXOB 1Q3UA 4LF6J 1WWUA 4A3FH 2KV2A 4K5RA 3G8TA 3KBXA 1F9EB 1U1MA 2QLJB 1X56A 2HNDA 1X55A 2KNJA 4DV1F 2IWHA 4B9NA 2BW7A 7FD1A 4F0HA 4Y65A 1QLNA 4CO2A 2G07A 2BCQA 1CVJA 2V9KA 1MG7A 2G0JA 2CWPA 3JSRA 1T94A 5CCLA 1X0FA 1A3UA 2I1RA 3G82B 1RT7B 3G82A 2VG5B 3MZIA 3QYYA 4EELA 2R93B 5IFMA 1BMQB 4OJ5A 5J0OA 2ZM6Q 2IMOA 3PRBA 1K0SA 1RT3B 5I2YA 1HWJA 5H1SV 4LK1C 2OMOA 1MU2A 5IE8A 4HIDA 2EAMA 3QIAA 4FYYB 4EGLA 4DV1L 3LGJA 1Q95G 1M0SA 3D6CA 2GVDB 2WB1C 3M7NA 1VJ5A 3H8WA 2J7KA 1VQBA 1UJ6A 3CPWR 1B43A 1SXEA 3NKYA 3S1NH 2PMZF 3UR0A 4CH1A 3OR2A 4MEYA 4LFCL 1DM0B 3SXLA 3TUZC 1S8OA 4HIKA 5AM0A 2HNZB 4OYPA 3HD2A 2FJBB 3JS9A 4U7UK 2BJ8A 4QZHA 5ALGA 2ZH8A 1WI8A 4F71A 4NEYA 3NTKA 5KFQA 4OO1J 4JI6L 3HRDD 1SZHA 1RAIB 1M1GA 8AT1B 2GVZA 1VQ5S 2I8EA 4ALPA 3LWLA 2XO7A 1VQPA 3EGVA 1IYVA 2HQEA 1V97A 3NE5B 1RT1B 1N34Q 2QV6A 3I28A 5ELOA 3OW2A 7ICIA 2KVSA 2Y9UA 3KNGA 4CO4A 2MQ8A 5C7PA 3VAMA 2HHHF 2YMMA 3TZXA 1SSOA 4U7CA 3AJDA 2QDLA 4X4QA 3RRHA 1QB5D 4B3ML 1F9QA 4RW6B 1PVOA 2AF6A 3VWSA 9ICIA 5AI9A 3PYEA 3ZDAA 1E1OA 1PTOC 4HJ9A 5J1EB 2VDHA 1RTZA 2E2IB 1F2LA 2IL8A 2HGNA 2IAJB 3HKSA 3U1LA 3ZNJ1 3VC8A 4EK2A 4XPCA 3CB4A 3PF5A 2WBRA 4H02A 5D4BA 4RPYA 3J7YI 1HZBA 5KGUA 3PMNA 5HL7Q 2J8AA 1IBMJ 1PIEA 1JLGB 2BQ3A 1HKAA 4QZAA 4HL9A 4OI0A 4UW2A 2R7OA 3NBPA 3PO5A 1R3NA 4NA1A 5HI7A 2RF2B 2KM8C 2F1JA 3QYPA 4NE9C 1KAWA 5GAEC 5GAGU 2OI2A 3Q23A 4NX9A 4H54A 1C0TA 2VG7B 4DQRA 1K73T 4JVZA 2AQ4A 3QFWA 4IH6A 2LYHA 4L75A 2HHUA 2Q1LA 3C1EA 1SB3C 3B0XA 4K4YA 1BD6A 2PMWA 4RKLA 4A3MG 2AH5A 2PI2E 5CV7A 1TK5A 4DFAA 1WC6A 4JI0L 3GIKA 1OPIA 2B8QA 4PEOA 4LSNB 3FPUB 2QB1A 3CTRA 4OZ0A 4B3RJ 3C16A 2XYGB 3OV7A 3TVYA 5EKKA 4P9SA 3DRRB 1WCMG 4F04B 5ALNA 3KLEA 9ATCB 3SV4A 1JRPA 4BY7B 2J0QD 5U47A 4K2JA 2VDIA 4F92B 4KLDA 4JG2A 4NLOA 2BDOA 3V2TA 2WONB 2DY7A 2E8OA 4RNFA 2OEKA 1J5EF 4GXKA 2UXBL 3P7JA 1GXUA 1QILA 3D4RA 4Y2XA 4RNOA 5IOLA 4F0MA 2CW0C 4YB7A 3CPFA 3I76A 5AXKA 4X4TA 2BZ2A 1ONLA 3NWSA 4UTGA 1WC1A 4XQQA 4A93G 3S1TA 1MN9A 2F9DA 2HMIB 2GO9A 5BN5A 1J97A 5GAEI 3HHKA 3LK9A 1SKWA 2CJAA 4N76A 2CFXA 2EWHA 4AP9A 3HVWA 1YIJA 3LGMA 1VQJA 3HOZB 3RH5A 2MY7A 4QZFA 5CV4A 5AJ3F 2D0PA 4DR2F 4A3MH 4DSIA 1L1OB 2WV6D 3H8SA 1RQ0A 4HEDA 4KB7A 1IVZA 1RTOA 2CG4A 2B5JA 8ICSA 3MAHA 3UQSA 1G291 1N4LA 5EE3A 2ZBQA 2RQ4A 1UVIA 1S10A 1TL1B 1L3KA 1X32A 4DUYF 1HNIB 2DGQA 3MM5B 4B3OA 1UWVA 1ZS6A 4X4VA 1I6HH 1RAJA 2D69A 2VQEQ 2RILA 2RU3A 3MPDA 3MMJA 2P6RA 3PM9A 3CC4A 1X3PA 3HZEA 2X51A 2DY9A 4R65A 2MJNA 1KQSA 1R4PB 4G1IA 1XTDA 3R93A 3K57A 2OXOA 4DS4A 1TY2A 5COYA 1WHXA 5CA5A 3BKTA 4HHHA 2Z8QA 2YKAA 3JAMU 3H0MB 1NZPA 1Q79A 3A74A 3LX0A 3TSSA 4N56A 3RN5A 4I6WA 1Q16B 2GV1A 1DJRD 2EXDA 3HVTB 3AHPA 1FERA 4Y2SA 4WYLA 2NXCA 2DR7A 2BPCA 3I0RA 5HATA 2JNJA 3A13A 3MPYA 3KF6A 2AYEA 1NJZA 4ALZA 1JMTA 4YHHJ 5HAOA 1VK8A 1EY0A 3HOZG 3SEOA 3JAME 3NAIA 1ZQRA 1Z2LA 2K7JA 2E2JB 3PKMA 2ZUDA 1N8RC 1DURA 3EGNA 4IPDA 1MWYA 1TV6A 2WCXA 4XT3B 4AYBE 4V19X 4DA2A 1S1XA 4QU7A 5HJXA 2B9YA 3DI6B 1IG6A 3RUZA 4ZOSA 2DNYA 2EBEA 4X4PA 3GFXA 3UDCA 3ITHB 1F0XA 3BGRA 3J80c 4NXMF 4P2SA 3J80E 4M5IA 4EMDA 1PZID 3KDOA 4J03A 2XZDB 2YKNA 2CZVC 2IHFA 2G5HB 2WAQF 5H2FU 2MO1A 1FCAA 3FEXB 2L4NA 2R2TA 1CZGA 3NVZA 1JT8A 2LMCB 3OVSA 1BCPD 1K9MT 3DLKB 2R8HA 2PFOA 3L95X 2L9DA 3TZYA 1RKIA 4DOBA 4ZIVA 1CUKA 2UXDJ 3WX8A 4EFAC 2CRXA 4YDDB 3K1RB 5HSPA 3LTOA 1Z00A 2KD1A 1UWBB 1UTAA 3SAFA 4DK1A 3V7JA 2W2PP 1VLYA 2IJRA 5CEHA 1JUDA 2MQQA 3A4TA 4K8JA 2FPMA 2B63G 2BGWA 5T7LA 1AZPA 3KLIA 4UOCA 4CTAB 1VHFA 4XK8C 2KTQA 2AYBA 4KGXB 1JALA 2ZTCA 2HHSA 4BY7G 1NDKA 3SHLA 1EQVA 1HQUA 1WHVA 2SXLA 5DDQC 3S01A 1ICEB 4DBQA 1JJ2R 3K89A 5LSOA 2VHGA 3H0RB 3LP2A 3KK2B 4PNYA 5HP1A 5AKXA 2BOAA 2XWJB 3BS7A 1UT5A 2L15A 3I4MB 4P0PA 4LVSA 3NVYA 4LVNP 2A6HD 4KLQA 3WIVA 5A8KA 3IGNA 1YITA 2QIFA 5KYLA 1E24A 2GAHC 3KJFB 4X3UA 3HOVG 2J5AA 3ZTQA 2PMZE 1J27A 5B0CA 1QAJA 1OY9A 3OHAA 3NGUA 3D68A 1ZM2A 1S1VA 1AFJA 1WC4A 1T9VA 1UUPA 1VC0A 4O3OA 1URJA 4BBRG 4C3IB 5DS7A 2IHNA 4XDXA 1A15A 3BDPA 3ISCA 1IBML 2YXLA 1D5XC 3LALA 5J2PB 2KFYA 1ZQLA 2MA1A 1GM5A 1ICWA 2P5VA 3A8JA 1S1TB 3HGBA 3EA6A 2FGOA 2V4JA 1T95A 2LKYA 2VKQA 1FK9B 1REVB 4NJ8A 5EJWA 2Q8IB 4NPOA 5EX3A 1ZJNA 1T05A 3IWXA 4QIEA 5J1ZA 1YZ6A 2PFDA 3JXOA 3QAUA 4MYTA 4NXNQ 4M5HA 4XRHA 2MGZA 2VFRA 3GIRA 4Z6CA 3MTKA 4P4MA 4CTAA 1KHIA 5E1FA 4QIWC 1ZQXA 1M5SA 1G2SA 1WJ9A 1TS4A 1JE5A 2JOQA 4OX9J 2Y9HA 3HHLB 5G3LF 2IPOB 3GV6A 3PSIA 5ETQA 2HKEA 4E2FB 1XNRF 1B1ZA 3MMAA 3ADAC 3TJ9A 1E22A 2OHDA 2RRBA 3GPAA 1E7ZA 3JYTB 2OIHA 4F93B 1Z1VA 1QH9A 3K80C 1L5UA 5AKHA 8ICYA 4LF6L 2Y1LB 3Q83A 3NK9A 4A8XA 5BN3A 1IL2A 3MCOA 4L72B 1DK3A 2AYMA 2RNEA 3CJKB 4CI0B 2PQAA 1WD0A 2RB7A 1SQEA 3FM9A 3NWTA 4TNOA 4A3BB 1XX8A 3LQVA 1DTQA 4HCEA 3S1QH 3AQPA 5KFGA 3GIIA 3V7LA 3OFEA 4W92B 4CRJA 3A5ZB 4YR2A 4IFDG 2CXEA 5AKYA 1SH3A 3TS2A 4DV5J 5E4WC 2HK3A 2WOMB 4DX6A 3ENQA 8ICXA 4F5PA 1J5EJ 4PHAA 3Q89A 2WF8A 4USUA 3I4NB 4RW9A 4DV0L 2XMJA 3U9SA 2VQFJ 2MLXA 2CQ0A 2PXIA 2P5ZX 1WHYA 4CM0A 1TS2A 2M9KA 3GMGA 1UJ5A 5IT9c 3DU5A 4DNTB 3ENWA 4JBWA 4RQ3A 2W2MP 2RRDA 2VC0A 2FLLA 3FQKA 4KHRA 1OXTA 2NVQH 4LR8A 4PXBA 2MGZB 4DR5Q 1C0UA 1GMVA 5KAIU 2EZZA 3UDIA 3CC4S 4RU9A 2E75C 5JEAJ 2DHGA 4QR1A 3M2RA 1E0BA 2DXDA 3KLWA 4F4WA 1I3QH 1RI7A 4CO5A 2BJEA 2M52A 2QLBB 1FK9A 1X9NA 5F0UA 4Q8EA 1KL9A 1BC6A 2IRXA 4HT7A 4HH0A 3QLHB 4IUPA 1X3GA 4Z6DA 3TUPA 1IKWB 1IBMF 1KOOA 2CJBA 1T05B 3FQLA 3CVKA 1OMSA 4MKYA 4OHJA 4URSA 4LF2A 1IXRA 2Y1JA 3Q8UA 4W4MA 3UQ0A 3L7UA 1JJCB 2HK2A 3L0OA 4EX7A 1KQFB 2DBBA 2R7ZG 2K01A 2JE6I 2FGCA 1XSPA 2RDHA 3QGHA 1HW9A 1NH8A 2BE9B 3SAGA 1IW7C 5KIXA 3QATA 1J5OB 1JOOA 1SC1B 1N52B 1CFMA 1S5CD 5EE1A 1PTOB 1URNA 2BJDA 5C42B 1BWVA 3DHQA 5KTQA 3KLGB 4WFAQ 1B4OA 1PTOH 4JI1F 3KG0A 3A12A 4WFBQ 2ZIWB 2PA3A 2PZUA 1A2TA 8RUCA 3RH4A 1QOHA 2ZIVB 2NUHA 4IG3A 3I87A 4C7ZA 1RHUB 1NSAA 3VYSA 3I5AA 3NOGA 2HLUA 4MZ9A 3S6EA 2E1FA 5HVGA 4PHDA 2ZBIA 3BS5A 3BBCA 5GMDA 3NLCA 5HROB 1IKMA 2JLEA 4NI2B 4IZ8A 4DU8A 3K7UC 1I51B 2EI5A 2B43A 3OL9A 3A3OB 2R8KA 4HTHA 1HTLD 4DJBA 2Q66A 4A4JA 2M9VA 3W65A 2JA9A 5AJ3L 4NXMJ 4LUOA 3FMWA 4I29A 1F5CA 1GUWA 1RABB 2R6GA 4Q7AA 1K1SA 1CJTA 4KJIA 1VQLS 4FYDA 1S12A 1RWOB 3OSPA 3TOQA 1UVMA 2BACA 2NZOA 1DARA 3QUCA 4PV1C 2C2ZB 3I4MH 2YX7A 4C48A 1E2ZA 1KTKA 4TXSA 3C2MA 5B0AA 4C8ZA 2JHEA 1YBYA 4GFJA 3H91A 2R18A 2GQ2A 5C0YA 2RE1A 3E8OA 2R2SA 4JV5Q 4LT6A 4NLWA 1FKOB 1N5YB 3LPEA 2HAFA 2EZVA 3DWQA 2ZC3A 3IXQA 4RU2A 4ILMA 1DRGA 2EFOA 3ZZOA 1TAMA 2WVFA 5RUBA 4JI3J 3KK3A 1WSRA 1L1OC 2HBRB 1ACMB 2FPLA 1Y0HA 1WSVA 3GO5A 3UDXA 1N61A 3I0RB 3NTUA 4QU6A 2XBPA 4OWWB 1FR3A 4TU9A 2RHSB 2DJGC 1CJKB 3UM9A 3P75A 3HZGA 5FP0A 1GMWD 1NJYA 1QJHA 4QOTA 4PKDB 1X5SA 1SE3A 3AXMA 4O4GB 1LTID 4N7TA 3IHQB 1PBAA 3IRBA 1HI1A 2DNMA 5KNDA 3BN4A 1XNQJ 1XR5A 2WVEA 3AMZA 4RW8B 5J1EA 7ICLA 3BVMA 7ICQA 5G4DA 2YNIB 4P0QB 1E6VA 3PHTA 3DEPA 4GOPB 5BXIA 5DBCA 3N0VA 5AK3A 3ET6B 4ZJQA 3NGKA 4IOBA 3S1RH 1ZQOA 4C0BA 5KFPA 1OY6A 1SIWB 1X4AA 1N32J 2XMKA 1IR2A 1XMOJ 3FSXA 5ETMA 4O0IA 5EQ0A 1S9GA 3GB0A 3HDSA 1Z1ZA 1L1OA 3CO0P 4AYBC 4WZMA 3ZD8A 3ZTOA 1LW0B 1NPPA 4KK7A 4OI4A 4CQ1A 1W6JA 1S5DD 2QA4G 1S5FD 4FXWA 4GLXA 2HPUA 2KCMA 2GHPA 5B7WA 3D66A 3GFZA 2Y0SC 3ET6A 4X84A 5AM3A 5KFMA 3G71A 2WP8J 2M2LA 2HNZA 4FVMA 4HR7B 1SV4A 5EUHA 4USHA 3OR2B 1F9PA 1HARA 3GP9A 3PIPA 4LFBQ 3MPWA 4FO6A 2EH9A 2F3VA 1KDBA 4XDCA 5EKLA 3CCZA 3IS9B 4DEZA 2KM8B 1S5BD 1EP4B 4MFBA 1NNLA 4KLHA 1Y8OB 3VR4A 3MEGA 5A0YB 5AT1B 1DBDA 1X6JA 1BOSA 4X6AH 1H3DA 4UQTA 3SSSA 2LM4A 2P6UA 4Y28C 3QO9B 3SQIA 3VYUA 2BCUA 4DFDA 4RNNA 1EQ0A 4JI1L 2BV3A 1CZWA 3ZI4A 2R92H 3LP0A 3F5AA 2HZCA 1BBUA 2H4WB 1Q46A 4MFBB 1E3PA 2YU9H 4GMKA 1RSCA 3D6TB 1BCPB 2AEFA 5ALIA 5FLXL 4RCOA 2MJ8A 4ZUIA 1C48A 2BE7D 1P8LA 1RCOB 1DONA 4A8OA 4C0OC 3FFIA 2N3SA 2F0HA 4UB2A 4DZ6A 2BM0A 1G1XA 5H9EJ 4RHRA 1ZAXA 3ALRA 3KHLA 3GJRB 3T6BA 1PXUA 4PPZA 9ICUA 1QZGA 2WW8A 3CD6A 2V4DA 3HRZC 4PABA 4DDFA 4GNXA 2IOFK 4UAVA 4R5PB 2WB1F 1H7XA 7ICGA 4CDEC 1NJIT 3ULPA 5FO8B 4RUHA 4QBUA 1X60A 1F5AA 1VQKA 4WIIA 4RUAA 2V0NA 2W2OP 4KGMA 1SBRA 4WF9Q 4IO1A 5T1IA 4MIWA 4LSNA 2A19A 2R7ZB 1WDDA 1IBKF 3FRZA 2OFGX 2R7DA 2HSEB 2NVTB 4OQJA 3V7KA 3D3RA 2QL7B 2KK0A 1RE1B 1BNPA 1QDUB 4LWCA 1RL2A 1HFGA 4LFAQ 8ICMA 1WCNA 5ALMA 2ZH3A 1YVFA 4X62J 1Q0NA 4RO0A 3RMHA 1T03B 1N6QA 2AMCB 1WG8A 3BS1A 4FN5A 1LTLA 4CNZA 1A77A 1U49A 1QWYA 4O3PA 4JI7J 2N8NA 1TAQA 2CVRA 1GMUA 9ICCA 1T9HA 4Q0FA 2JFKA 1RA7A 4USMA 3C14B 2PFPA 4QMGA 4RQMA 1OXXK 3T1YL 1EU3A 4GXIA 5M2UA 1G2EA 1KABA 3BQ2A 4PG4A 1Y7PA 4JI0F 3NWRA 5CHCB 4LRFA 1RZMA 2WB1B 5EKIA 5ALOA 1REGX 3J7A1 5DQHA 4DV0J 1SMYC 4FNIA 5DKWA 1RD9D 4OD0A 4CYUA 1ZETA 2VC1A 2W4PA 2RAQA 3WK6A 4A3BG 2W2QP 1CT1D 2ZDOA 3L4BC 4NLDA 1K28A 1GHJA 2YMLA 2CUYA 4UASA 2Z9HA 3V4IA 4JI2J 2DY1A 4KTQA 1MSWD 2BJ3A 2W43A 5ALLA 2RJZA 3G8QA 4H13C 2BYCA 3NRBA 1SWWA 1U4LA 2YQ3A 4Y2PA 1S1UA 1BBXC 4FYWB 4FKXA 4YXMA 3QBCA 3ZZ0A 1Z19A 2EYLA 2BPGA 4LZDA 1CQNA 2CQGA 4NPSA 4QIVA 3VGVA 1FXRA 3I31A 1HNWJ 4QF4A 2IYGA 4MFCA 1UKUA 1FL0A 3KOOA 2R7FA 3SK6A 3TDQA 3F56A 4F8MA 3P8BB 1NRKA 3IBCB 3SDEA 2IIHA 4L5TA 5E5NA 2AZ3A 2YTXA 2A3JA 3A8IA 1BBWA 3SVMA 3VAGA 4M9NA 1JWSD 4NLCA 5IT9E 5LMNL 3PXGa 2WTFA 3SQGB 1VRUA 1YJRA 2EDUA 2QARB 4AUKA 2W2NP 3GV5B 4CCHA 3DRPB 2RQCA 2CN1A 2DNOA 4TURA 2G5DA 3MM9B 1CC7A 1LT5D 3IDWA 7ICOA 2ZDPA 2IX3A 4FPIA 4KGKA 3ITPA 1PH8A 2EY2A 1HHSA 1T03A 4MMOA 2R7SA 4LF4F 1C4QA 1FRKA 3OSOA 2RH3A 3R3TA 3VQSA 1LKYA 1ZM9A 4CNYA 3CCES 5C3EH 1MD2D 3FBFA 1IIPA 3HD1A 1KS2A 2DJFC 2O5DA 2Q43A 4ZVPB 1SNMA 4G1QA 3NS7B 4Y3CA 1AN8A 1XNQF 3ZZRA 1YJWS 3PIOQ 3RJIA 3KUHA 3K8AA 3TANA 4LF5Q 2E1AA 5KFEA 4HSVA 1H95A 2YX1A 1CQFA 4WYWA 2VFTA 2FLOA 3QUTA 1GVPA 1VQFA 1QVGR 2ZH7A 2PO4A 2PFQA 3MOZA 4C3JB 1N6QB 3S17H 5KAKA 3UCZP 3R7SB 1D5ZC 4C2MB 3BYYB 1K3RA 1PRTD 2QFJA 1Z3EB 5C4XH 1SDFA 3H90A 1RHPA 2CH4W 2EYHA 2HNYB 3A8KA 2VD3A 1J8IA 2CH4A 1SAPA 5ETSA 4KN4C 1U45A 4LF7F 4MTPA 7ICEA 4FS1A 2GS8A 2VH7A 1R27B 1JLFB 2XWYA 1JWUD 5J2JA 1SUQB 2FDNA 5IQ6A 3QZ8A 1QE6A 2XI3A 2P9CA 1CULB 4DR4Q 2JXMB 4J8QA 1ZAVA 1ZZFA 4US9A 5GMEA 3H3VI 2KHJA 3NHHA 2FUG9 2RVLA 1O6XA 3SDEB 1Y1VG 3AFPA 2KXFA 1QAXA 1L3VA 2OTJS 1O7LA 3HOYH 1S3OA 2RSOA 3WC2A 3H0GG 2JA7G 1LT6D 1SYBA 3R5DA 4P0PB 4DSKA 2MFIA 3L7ZC 1NKCA 9ICXA 4AYBF 2LYVA 4DZDA 4YR3A 3FBEA 2HHTA 2V8PA 3H8YA 3AOBA 3J7ZT 3DOKB 2DHHA 4AQYQ 5J2DA 1G6BA 4HHJA 4YMMA 5KNIA 3GIJA 2K60A 4DUZF 3W63A 4DR4F 3BDLA 3GTKB 2JWNA 3E01B 3DLEB 4PMWA 3QZ7A 3HFZB 5HN0A 1HNWQ 4ZJOA 2H3EB 4PHEA 1QVFA 2B9WA 1Y8PB 3H7HB 4HH1A 4RG1A 2K75A 3HOXG 5HNKA 4OL7A 4OX9Q 4I56A 4L74A 2OHFA 2R8JA 1PRTC 1U1QA 1IV8A 1ZQEA 2IJ0A 1XR6A 2ZG6A 5DNFA 5CHGA 2BQUA 2V8HA 3MFHA 4A3DH 2W7PA 5EBDA 4DQQA 1S5ED 1HBUB 3H2LA 4O5KA 2EZXA 3I32A 1WKJA 1M5OC 1LABA 5J8YC 3PR4A 3MXHP 1SJHD 1ZQSA 5SZTA 3NGSA 4GO7X 1VCIA 5CD4H 2DNGA 2XVSA 4LW1A 2EEYA 2P9EA 2BKPA 3MR6A 5HMXA 3OHXC 2K5WA 5CBEE 4MYUA 2V50A 4W90B 2E5SA 1HPCA 2VUMG 5IC4B 1VMBA 2ZH6A 4B3TQ 3MD3A 1YT3A 5D6GA 2ZVSA 1S6PA 5D0HA 4OJ1A 2BE2A 2APOA 4RGOS 2RIJA 2WINB 1JMSA 2E5LQ 2E5GA 5CV6A 2KRBA 3TI0A 1ZOLA 4PG3A 4KE5A 1ZXIA 2FINB 1TUWA 2ZIUB 1S5ZA 2VY3A 3MEEB 3UW1A 2ZXRA 2UXBF 4DR1L 4X4RA 3BREA 1KBRA 1PDQA 3V81B 2DGVA 5KG3A 3ENVA 3DEOA 1RTDB 1PFBA 4KR0B 4I6YA 2MPUA 1O03A 1A6LA 1WWHA 2Y0SE 2KE7A 2PDAA 1HYSA 3J81Y 2BE5D 5KFFA 1EHWA 3A54A 2R7XA 1QQ7A 3AU6A 5L1IA 3KJVA 2ILZA 4I2AA 5J2QA 2ESEA 5C4JH 5B66U 3QB3A 4NY8A 4A3FG 4NA2A 1C8CA 1KDCA 1LACA 4Y2AA 4DSLA 3TP7A 1U1RA 1QTNB 4JI2F 3OOCA 2E5JA 1FJEB 3I4NH 1HI8A 4K4XA 1NM2A 3H98A 1NKEA 1HPZA 2B4PA 3HOYB 1W3SA 4PWWA 5L8RC 3EX7B 2QA4A 3MXGA 3HOUH 3NQTA 3T53B 4NCBA 4IRCA 1TS3A 5KFXA 2IM0A 3A8KE 3UDFA 3HW8A 3L09A 4IFYA 2G0AA 4LJZC 1TU2B 1TWFH 1LWCA 5KFVA 1S40A 1T9TA 1Z4UA 4DN9A 4L73A 3CJ4A 5HQLA 2MNAA 2VBYA 3PMFA 4MAKA 3MAQA 4F91B 3ZTSA 3MR5A 2QO3A 1LWCB 5KOXA 4UPAA 1VLBA 2PKEA 5IODA 3BGOP 2B8FA 3I73A 4DV2J 3RBDA 3MM7B 9ICBA 2R61A 1ESFA 5C44G 1FEHA 4A3MB 4YY3F 2ES6A 1WTHA 3C29A 1VQNS 4Z9CB 4FF1A 3D31A 1UVJA 4KLIA 5DM63 4J9QA 1IYUA 2IBOA 2V8VA 1LXNA 4C4SA 2H3QA 2DNCA 3VF0B 4DV5Q 4XT1B 4NI2A 1ENCA 3FVYA 2GOLA 3OL6A 1KFTA 1AA1B 2FHJA 4LJMA 8ICIA 5JOBA 4IUUA 3PO2G 4JI5F 1WOCA 4RT2A 1FKAF 4WP9A 4QZEA 5IGBA 1GEHA 1NSPA 3C5FA 5KFNA 8ICLA 3T1YQ 2RS8A 1KNZA 3VR6A 4RW8A 3MTSA 3MCNA 3UQ2A 2XSJB 1URRA 3PW5A 3NUCA 5IP7G 4QIGA 3KLHA 1RTJA 3AOAA 2V2QA 4ILLA 2M2BA 3SCIE 1KNEA 1I94Q 1COOA 2K05A 3H3VH 2Q2TA 1CPZA 4OYBA 3D0GE 4EX6A 4DI6A 3NBPB 5DGAA 2F0OA 2EQYA 2B39A 5ELDA 1O78A 1EWHA 1BNZA 1RWMB 5J0XA 2SNSA 1KAAA 2K5VA 4NOHA 3ED5A 1NNDA 2K1RB 1K47A 3TZDA 4BBSH 3FKIG 2J6SA 1TWCH 3LVVA 5GVQA 2NR0A 1R0AA 1R6VA 2V6AA 1B4SA 3KNAA 1Z2ZA 3OL8A 5KFZA 4A3EH 3L7OA 1FNUA 2R7TA 1AB8A 5DG9A 4HJ5A 1RP5A 3HLUA 2VONA 2Z6KA 4DR1Q 3UXOA 5K