3J81j

Cryoem structure of a partial yeast 48s preinitiation complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
263
structure length
252
Chain Sequence
TSHCRFYENKYPEIDDIVMVNVQQIAEMGAYVKLLEYDNIEGMILLSELSRRRIRSIQKLIRVGKNDVAVVLRVDKEKGYIDLSKRRVSSEDIIKCEEKYQKSKTVHSILRYCAEKFQIPLEELYKTIAWPLSRKFGHAYEAFKLSIIDETVWEGIEPPSKDVLDELKNYISAVKIRADVEVSCFSYEGIDAIKDALKSAEDMSVKVKLVAAPLYVLTTQALDKQKGIEQLESAIEKITEVITKYGGVCNIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes enable start codon recognition by the eukaryotic translation initiation complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ribosome
molecule keywords 18S rRNA
total genus 52
structure length 252
sequence length 263
ec nomenclature
pdb deposition date 2014-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
j PF00575 S1 S1 RNA binding domain
j PF07541 EIF_2_alpha Eukaryotic translation initiation factor 2 alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.190 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Translation initiation factor 2; subunit 1; domain 2 3j81j02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3j81j01
3.30.70.1130 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits EIF_2_alpha 3j81j03
1EIYB 4KHPL 1V1QA 1Q8KA 1XMOL 4GN5A 3CCJA 1TWCH 1VQKA 1C9OA 2WB1E 4DUZQ 4PG3A 1Y1WH 1X6OA 3K7UC 1HJPA 2VNUD 3VDYA 2B63H 3PO3G 4DV7Q 4YCVA 3HOVH 4JG2A 2CWPA 1FJGL 3I4MH 4JV5Q 2D0OA 3H0GG 4DK3C 3A5ZB 4GOPA 1CKNB 2IX0A 1EQQA 2A1AA 1X3GA 2ZTCA 4B3RQ 3RN5A 2OTJA 1PH6A 4X65Q 1KRTA 1E3PA 3EN2A 4IOAA 1AH9A 5JJLA 4HJ8A 4BY1G 3T1YQ 4YWMA 4AQYL 1L1OB 1P8LA 5K36G 2Q2HA 1K3RA 4LFAQ 3OTOQ 4HJ7A 2MO0A 3MEFA 1O7IA 3PO2G 2IHFA 4OO1I 1XMOQ 3GO5A 4JI6L 3KF8B 4DV2L 4YWKA 4XTCS 2K5VA 1YI2A 3K0XA 3HOWH 3HOZG 4A93G 2F4VL 1WYDA 2PQAB 2EXDA 1EFWA 3M4PA 1ASZA 1N33L 1HNWL 1EWIA 1OXVA 1SE8A 3T1HQ 4L5RC 1LYLA 4JYAL 2UXCL 1CSQA 3JC66 3J7ZC 4JI2L 2JA5G 1A0IA 3H3VH 2XGTA 4JI1Q 1XPOA 5AJ3Q 3KOJA 3S24A 2HQLA 1CKOA 2UUBL 4DV6L 3STBC 1VQGA 4A3LG 4L5QA 4B3SQ 4A3DG 3HOYH 3F2BA 1PH3A 1L2FA 3S1NH 2K5HA 3HOZH 3RLNA 1I94Q 4UP9A 4XIGS 1RIPA 1UE1A 3RLFA 5M3MG 4X64L 1Q82C 3L0OA 4DV4Q 1XNQQ 1MJEA 1HZ9A 5M5XH 5C0XJ 4GKKQ 4DR2Q 1PH1A 1W3SA 1YBYA 4R4OA 1N34L 2WP8J 4QJFA 3U4ZA 2I0QA 4DV6Q 1VQBA 4UPAA 3K8AA 5JEAJ 3RZOH 5FLXc 4BXXH 2WB1G 1UE5A 2KHIA 2WFWA 4A3EH 2F3IA 5IY0A 4LWCA 1NMFA 3NEMA 4NPSA 3PF5A 4K0KQ 2NN6I 1W2BA 1CSPA 3PO3H 3A74A 1Q46A 4LF6Q 3TEHB 3FHWA 1K83H 4LF5L 3CPWA 4RMFA 4DV4L 2ZJPA 2I5LX 2Z0SA 1QVCA 4GLXA 5GADC 3T1YL 1EUJA 4OWXB 3BZKA 1N9WA 3SGIA 1ASYA 1A62A 2C35B 1AE2A 2A19A 4DAYB 2A8VA 4BY7H 4UY8C 1P16A 3NELA 3CF5A 3CW2C 4JV5L 1D8LA 1PHJA 2UU9Q 3CP0A 3UDXA 3CAMA 3RR5A 1VQFA 4X65L 2ID0A 1LUZA 5HGQA 1PFSA 1VQ6A 1PYBA 1LM0A 4A3BH 4DKAC 1VQDA 4YY3Q 1JJGA 2VY3A 1Y14B 1JT8A 3I2ZA 1NBWA 4DR5L 4LF9L 4JI8L 1GD7A 1MKHA 4P72A 4ALPA 4UP7A 2OWOA 4HIDA 1CKNA 1J6QA 4GOPB 1VQ7A 3G48A 4BY1H 5DLQE 3HKZE 1S3OA 2ZM6L 2ZJQA 2ES2A 2MQHA 5ELNA 5GQOA 4AYBG 4GKKL 1X54A 1NY4A 2L15A 3HOXG 1A63A 1KXLA 2VQEL 1VS0A 4OO1G 3PUYA 3HOVG 2UXBL 1PVOA 2CKZB 3KF6A 3GD7A 4AIMA 4IO9A 2AWNA 4A4IA 3E0EA 3G6EA 4NXMQ 4KHPQ 3KJOA 5C3EH 4BA2I 5M3FG 3A0JA 1NE3A 2BH8A 1RL2A 3PGZA 4A3MG 3WWVA 3IRBA 1XNRQ 1SR3A 1Z47A 1SFOH 1GKHA 1BKBA 2YTXA 2JA8G 4GLAC 3E9IA 2YU9H 3U58A 5IP7G 3GTQH 2UXDL 1GM5A 2CWAA 4FDBA 1E7ZA 3HOUH 4JI4L 1TWFH 5FJ8H 3UE1A 4O2DA 2HHHQ 4JBJA 4DR3Q 2K4KA 1HH2P 2JA7H 3TRZA 5IYDH 1VQ9A 4LF5Q 1SRUA 3AEVA 2VQEQ 1KC8C 3HOUG 2KHJA 1N8RC 4A3DH 5LMNL 4GN4B 2UUBQ 2F52A 1HR0Q 4A3GH 3W1BA 4LF7Q 3TREA 4H02A 5IP9H 2JA6H 5IT9c 3KYHC 4LFBQ 3CQZH 4C3IH 1T9HA 1HNXL 4IPDA 4DNIA 4POGA 2DGYA 1B8AA 1YIJA 3PUVA 2V1CC 3J81j 4EX5A 4X62L 1HNZQ 4A3CH 3I56A 5H1SE 4JOIA 2UU9L 2H5XA 2MO1A 1XMQL 1OXSC 1Q12A 1YEZA 3ER0A 1PH4A 3OYYA 5BR8L 3CCQA 1S40A 3KDFB 3CPFA 5C44G 2DUDA 4AH6A 1VQEA 1NTGA 2YTVA 5AJ3L 1L0WA 4EQ5A 5C0XG 1UE7A 1V9PA 1YJWA 4A93H 4R1JA 4C3JH 1VQPA 1X65A 3CD6A 4BXXG 3M4QA 1UE6A 1XMQQ 1C7YA 1WCMH 4YWLA 3F2DA 3RN2A 2AWOA 3PO2H 4JBMA 2OQKA 3A5UA 1VQAA 4JC0A 4LF4Q 1G291 4MZ9A 1HZAA 1FVIA 5C4JH 1PYSB 4PZ8A 4HIOA 4DR1L 4JCVE 4PZ7A 2VQFQ 3STBD 4A3BG 3BJUA 2NZHA 3PIOA 4A3FG 3RNUA 1XJVA 1E1OA 5FJ8G 2MNAA 3GTJH 3F2CA 4LF8L 1A8VA 1VQLA 3KLWA 1IBKQ 4BY7G 4QL5A 3DLLA 1J5EQ 4B3TL 4TQUS 4DV3Q 2UUAL 3UDFA 4A3MH 1Q86C 2AHOB 5M3FH 3CC7A 1VQOA 1NJIC 2E8GA 1I94L 2HHHL 2RF4A 2N78A 1OXTA 4LUZA 3G71A 5GROA 2NVYH 1QVFA 1YZ7A 4O0AA 2B3GA 1V43A 1K8GA 1Q1EA 2ALYB 3KDFA 1PH9A 5GAHC 1B70B 3LGJA 3PV0A 5IWAQ 3BU2A 3ULJA 4DR7Q 1UEBA 1KL9A 5IYDG 2Q2TA 5M5WH 2VL6A 1HNXQ 2Y0SG 1VQHA 3UE0A 1WFQA 3W1GA 3H0GH 2K50A 5IP9G 4A3IG 1Q81C 4OWWB 2JA6G 2NVTH 2E5LQ 4IFDJ 5ELOA 2E2IH 1U0LA 5J3BA 5IE8A 4MNOA 4KLKA 4JI6Q 4DR3L 3J81i 4JI0L 3ULLA 3S15H 1KQSA 2ZTEA 5JJKA 5JJIA 3K7AH 1Y1WG 1YHBA 2UUCQ 1C0AA 5M3MH 4JYAQ 2UXCQ 3GTLH 2KCTA 2JK8A 3J81c 2XTIA 1Q7YC 1PA6A 1GO3E 3H15A 2I5MX 2KCMA 4B3MQ 2NZOA 3I4MG 4JI7L 3Q8DA 2K75A 3CMEA 2WAQE 4YHHL 1VQMA 1CKMA 2ATWA 2CFMA 3M9BA 1K9MC 4JI3Q 2YV5A 2JJQA 3GTGH 4DR7L 2BA0A 4WJ4A 1YZ6A 2IT1A 1TWAH 4LUVA 1OXXK 2JA9A 3ULPA 4A3FH 1R9TH 5C3EG 1XNQL 3GTPH 1OXUA 4IFDG 4DR4L 1HZBA 3DM3A 2R92G 5M5YH 2UXBQ 4DPGA 2YTYA 4DR5Q 4LF9Q 4OWTB 4QIWE 4AQYQ 1IBKL 3PSIA 4NXML 4IPHA 3CCRA 4B3TQ 2UXDQ 1KRSA 4DV5Q 1PH2A 5IYBG 1PH7A 1EQRA 3AFPA 2JEBI 3I7FA 2ZM6Q 3AYHB 1VCIA 4GNXC 1FGUA 3PF4A 3PUWA 4P71A 4GKJL 3ERSX 1X56A 4DV0L 4TVAB 5JEAG 3GTMH 1N32Q 3GTKH 3S1QH 3CC2A 3I55A 2Q2IA 4LF4L 2WAQG 1M1KC 1G51A 4DV1L 1KIXA 4HJ5A 1X55A 4A3KH 1JE5A 1X3EA 4R4CA 1X9NA 1HR0W 2JA5H 1VQNA 3S17H 3AFQA 4JI5Q 1BVSA 3KFUA 1DGSA 3KJPA 1JMCA 1JB7A 3E9HA 4JOIC 3L7ZC 1KHIA 1Y1VG 4LFCL 2LXJA 2RHQB 1KD1C 1HR0L 1SN8A 1FJGQ 4JI8Q 4A3CG 1N32L 4IOCA 3F1ZA 5LMNW 2EQSA 4A3EG 4R4IA 2N8NA 4RG1A 1IBML 3W5OA 4DUZL 2PI2A 2OQ0A 4L5SA 4IPGA 4JI7Q 1E22A 1MIUA 4DV0Q 1H95A 4IJLA 3CCUA 2R7ZH 2JE6I 5BR8Q 1PH8A 1LTLA 3MXNB 2BA1A 4HJAA 1QUQA 4DR2L 3CCVA 2VUMH 4DR6L 1I50H 4JBWA 2R93H 4X6AH 2YYZA 2R7DA 4GS3A 3M4OH 3JAMc 5IYCH 2Q2UA 5LMNQ 4QQBX 2R93G 1AE3A 1BBUA 5IP7H 4JBKA 3NBHB 4YCUA 1N34Q 4LFBL 4OX9Q 5C44H 3OW2A 4K0KL 2R6GA 4R4TA 4A76A 1YVCA 1Q1BA 4JI2Q 4BBRH 5C4XG 4NB3A 4GKJQ 2D62A 2ZTDA 1YNXA 4DUYL 4L5TA 4J15A 1G6PA 2OTLA 3AQQA 3T1HL 1JJCB 3TS0A 3J80c 4PZ6A 2EIFA 3RLOA 1QZGA 3FKIH 4Y52H 2QN6B 1HNWQ 3TQYA 3HKSA 2BH2A 2JQOA 4MTNA 4JI1L 4WJ3M 4APVA 2K52A 3KF6B 4DV3L 2AKWB 1CUKA 2K5NA 2UUAQ 4B3SL 2IY5B 4DV2Q 3S14H 3CC4A 4BBSH 3FP9A 4GLVB 2Z6KA 1YHQA 3S1MH 4X64Q 1JJ2A 4P74A 2B29A 5E7NA 2QMUB 2QGQA 4DAMA 1IBLQ 3CXCA 3JAMi 2GVBA 1IBMQ 2NVXH 1IZ6A 1L1OC 4LFCQ 3HFZB 4A75A 1I5FA 3UDGA 3GTOH 1WCMG 4KHZA 2VQFL 3S16H 5IWAL 2HT1A 3NENA 3TS2A 3CMAA 1XPRA 2N49A 3U50C 4X66Q 1GVPA 1WI5A 3CCSA 2VS1A 4LF8Q 1TWHH 4DR6Q 4QGUA 3S1RH 3ZJYC 1QVGA 2QEXA 5C0XI 1VQ8A 2CCZA 1SLJA 4HJ9A 3L2PA 4DV5L 2E5LL 1M90C 2LXKA 2Y0SE 2R7ZG 1XTDA 1YITA 4IJHA 2QA4A 4DR1Q 4BBSG 1X3FA 1E1TA 1WOCA 3I4NG 4A3KG 4YY3L 3I4OA 4DV1Q 1IBLL 3J7A5 1K73C 3H3VI 1VQ4A 1VQJA 1N36L 3M3YH 4LFAL 2IHEA 4QY7A 2B63G 4LF6L 2GN5A 2PNHA 1VQCA 2PMZE 3PUXA 4GOPC 4NXNL 1QUQB 4B3RL 3PIPA 3I4NH 1EIFA 2K14A 4R4QA 2PI2E 3U4VA 1TXYA 3PUZA 4BA1I 4BBRG 4C3HH 5C4XH 3RZDH 2IX1A 3B6YA 2NVQH 4P73A 2VUMG 3CCMA 4A3GG 1SMXA 1TWGH 4GN3B 5HY6A 2KENA 4HIKA 2ZJRA 1YJNA 1J5EL 1EOVA 2R92H 2I5HA 4A3IH 3CCLA 2E2HH 3ICEA 4LF7L 4IPCA 2LSSA 5IYCG 4DUYQ 1HZCA 2UUCL 2JA7G 1I6HH 5LMUQ 1L1OA 5IYBH 3D31A 4DV7L 1Z9FA 3EIVA 3S2HH 2OCEA 4B3ML 1YHAA 2D0PA 1FL0A 4YCWA 4YHHQ 2JA8H 3QSYB 4UP8A 2GVAA 4X62Q 1HNZL 3G4SA 3FKIG 2FXQA 1IYJB 4ME3A 3F8TA 2KBNA 3CCEA 1YJ9A 1U5KA 4OXPA 4AYBE 4JI0Q 4LW1A 4X66L 2VZAA 2N3SA 3HKZG 3M85A 1XNRL 1VQ5A 4P75A 4LNQA 2R7FA 3OTOL 3M7NA 2VW9A 5EAYA 1PH5A 4OX9L 5GAEC 1D7QA 1WJJA 2AMCB 1PV4A 4JI4Q 4OONA 1NMGA 3D0FA 4A3JH 1Y1VH 1E24A 2CQOA 3HOXH 2RCNA 1QZHA 1IL2A 3S2DH 1IXRA 4DR4Q 5LMUL 3HOWG 2ASBA 1XPUA 3BZCA 4GNXA 2MFIA 2PQAA 1MJCA 3UDIA 5FLMG 1EYGA 1N36Q 1B7YB 5GAGC 1BBWA 3K81C 4LUOA 1OTCA 4JI3L 2Z6KC 1KAWA 4C2MH 1N33Q 1UWVA 2HIXA 1VQIA 3J80i 4DK6C 2NN6G 5FLMH 1K8AC 4Y7NH 1I3QH 3K80C 1S72A 4IFDI 4JI5L 2JEAI 4POFA 4NXNQ 4HIMA 2F4VQ 3EBEA 4PMWA 3HOYG 4GNXB 4A3JG 4A3LH 2E2JH 2HIVA 2RHSB 1SROA 3GDEA 1K0RA 4KI0A 3PCOB
chains in the Genus database with same CATH superfamily
5ISRA 3JQKA 4OJOA 2DK2A 5AKEA 1CEZA 1TS4A 4GN5A 4L74A 4WRDA 4XQQA 4PG3A 3KJNB 2MJ8A 3QNMA 4NE9C 1EYDA 3VDYA 5C6AA 2AYGA 4U7CA 5J22A 3SQGB 4C48A 4GOPA 3BGRA 2IX0A 5ETOA 4XK8C 1STGA 4FVMA 1VGYA 3RZAA 1ZM4A 2ZH5A 4JV1A 1P8LA 4K4HA 1RGVA 9ICNA 4ULLA 3PR5B 1I3OB 2NSCA 4NYPA 2LLZA 4K6DA 4C11A 3HOZG 2M5YA 1WYDA 3FRZA 2RJZA 5J0RA 5LOQA 3TQ1A 2L9WA 2UU9J 4JV5J 1REVA 1EEID 4R8UA 1XR7A 2WVEA 4RW4A 4DV1J 1YBUA 4ILRA 4PR6A 2XGTA 5AJ3Q 1X4EA 4QIWC 2K5HA 3HVAA 2MQPA 5FDLB 4ZLJA 5F9LA 1MJEA 4OI4A 1RHMB 2BJ3A 4R4OA 3MC1A 4LBPA 1I6HB 5KFFA 2GQ2A 1FO1A 3VAIA 4TYBA 3J80E 2KFNA 1N36J 4JBCA 5FIIA 5IT0A 5J2NB 2KM8C 2RQKA 4TUPA 1CSPA 1JLGA 1HHSA 3FCVA 3LP1B 4JI4J 4LF5L 1XR6A 3CPWA 4M0AA 4KSEB 1EUJA 1ASYA 2B8GA 4O5KA 1W7WA 1T9XA 3MEGA 1XWLA 1LT5D 3NS7B 1FK9A 2I2YA 4ERDA 3GDXA 4C56C 3MUVP 5FO7B 1F9RA 2BR0A 3RR5A 1VQFA 2W4PA 4KAIA 3Q8MA 1SNCA 4YY3Q 5IODA 3KLSX 3CJRA 3MXGA 2RDJA 1MKHA 3C23A 1FGBD 8ICVA 1CKNA 3IFDA 3IKJA 4PMCA 3EVOA 1SH0A 3TACB 2EAOA 5AI4A 2FMMA 4NLWA 3AQEA 3DLHA 1MQ2A 2IHNA 3ZDEA 1RHQB 2UXBL 1V97A 3UN5A 1SXDA 5DBCA 4C8NA 1NCLA 1FNWA 4ZP8A 4PJ0U 1PGZA 2YNGB 4KFBA 3W9JA 1FTRA 2ZC4A 1HQUA 1HNVB 4JI0F 4FDBA 3NXWA 3VGUA 5FJ8H 3F41A 3MMAB 4YMOA 3PIP3 4NRTA 1MU2B 1H7WA 1VQ9A 5J0YA 1DAXA 3N7RC 5KG7A 3D2NA 4A3GH 4H02A 1I50B 1KFTA 4LFBQ 1H3DA 1M1KT 1WHWA 4ZVRB 4KGVB 2RQMA 1XWEA 3HILA 1WHXA 3PSFA 4NV0A 3H0GB 2QE5A 5ETKA 3IRUA 1V1PA 1PFNA 3NP8A 1SNOA 2B2UC 1OSCA 4ECVA 2OEMA 4ABNA 1YJWA 4A93H 4C3JH 3JSMA 2Y0SF 3M4QA 1JKHB 4ZYSA 1A2TA 4TYAA 4LQ9A 4K4VA 2AWOA 1QCKA 3GFYA 3QAUA 3ED5A 4FVCA 2CJKA 1IKLA 4B3TL 4TQUS 1RT7A 1RODA 1HW8A 4KPYA 1OUQA 5HROA 3IGVA 2XS5A 3C19A 1YZ7A 2DXEA 1RT1A 2WV6D 5I2YA 3PV0A 1SYCA 3LW5C 4QBUA 3CCRS 2HAFA 1KLUD 2ENBA 1CVJA 5DLFA 4P9SA 5A8KB 3POTB 9ICIA 5ELOA 2E2IH 2EXUA 4Y65A 5IT9E 2FQQB 4KLKA 5JMNA 1VHIA 2RIJA 2DTJA 2LY7A 4CDEC 3ISNC 1PA6A 4LMZA 3CMES 2CFMA 2W9AA 8ICPA 4LJMA 4EBCA 4FF1A 2C1EB 2CXEA 5KFLA 4JW0A 3ITPA 1PZNA 4DAPA 2F1HA 2PZWA 4MEYA 1WCLA 2UXBQ 2QARA 4HMJA 3GV6A 3I4LA 1PH2A 1V9OA 2BHNA 5IYBG 3PF4A 2MKHA 4RUBA 1SQEA 1DK2A 3JSRA 4Z6CA 1BPZA 1AN8A 2I0XA 4CJ0B 1G51A 1LTAD 1IYVA 4IG3B 1WOSA 1VQNA 2CPDA 3OVSA 4LSNB 4M5DA 1DGSA 3MCMA 3E9HA 2CQ0A 3D6TB 4RNMA 1JE4A 2WHOA 3F1ZA 5LMNW 1SH3A 2C9OA 1TVAA 2ZNZA 4A8WA 2F0EA 5E3AA 3T13A 1MHWC 5J0SA 5EE0A 2YX1A 1GT8A 4RLEA 2AQ4A 2R93H 2AJ4A 2DNOA 2VANA 3OFFA 4WYLA 2OXPA 4N47A 1GK8A 1D8ZA 1TFYA 3NBHB 3OW7A 4C7YA 5M3FB 3UVJA 1IWGA 2W03A 3GILA 4NB3A 4I2EA 2D2CC 4EQNA 1BUXA 1SI9A 2EZXA 1RBLA 3NHHA 1QZGA 1VLBA 5JJBA 4X62F 2XCPA 1URJA 2DKOB 2BH2A 2JQOA 1CI3M 4J9UE 4DL6A 2B51A 1MA7A 4M47A 1SYEA 3M2UA 3EYZA 1KR4A 3K4GA 2HBRB 1EIHA 4PQUA 4L6TB 4WP8A 2BE9B 3NWTA 2I8EA 1HPZA 1WEXA 4ZVGA 3ZJYC 2BE2B 2QEXA 5C0XI 1TWFB 1M90C 2M0GB 3ALRA 4GXKA 1E1TA 3UD5A 1HNWJ 1SUQA 2HQIA 3BVZA 3KOAA 1ZD2P 3PYEA 5HNKA 3W3SA 4PWDB 3U9OA 8ICRA 1T3OA 2BKEA 1QD1A 4GOPC 4PG7A 3CKIB 3HHEA 5C4XH 3GJQB 4CNYA 3PFEA 3N4WA 5AE2A 2HSEB 1SMXA 4GN3B 1HNZF 1JLQA 4A3IH 1BNPA 3BYTB 2RT3A 2LCWA 2XEXA 1JXVA 4GXJA 4YHHQ 2FHOB 3QSYB 2GVAA 1LWXA 1HNZL 4V190 2VZAA 1G2TA 2ZUAA 2QA2A 1NHKL 3V6DA 1S1UA 1X3QA 3OTOL 3M7NA 1D7QA 1PH5A 2V2KA 3F73A 4DR5F 2K3IA 2ZXHA 3HLUA 2RCNA 4ECSA 3NBPA 1FJ7A 1K0TA 1T05A 4ZCIA 1UW4A 2MFIA 3FBCA 3TRZA 1ZQEA 3SCLE 1XSNA 2KCNA 2KXHA 4C2MH 1SYDA 1RAHB 4RCOA 1I3QH 3L9ZA 2ZT9C 4B9NA 3AA8A 1RADB 3KUHA 1S1TB 3BKUA 1B43A 4YP3A 1ZZFA 1CBKA 3NEKA 2CQIA 4DL4A 2XWYA 3UQSA 3D54A 1NJZA 1Q81C 3JPNA 1HBOB 1EIYB 2HDLA 3OMGA 2UUAF 4X4QA 5D14A 2NO5A 1S5FD 1RAJA 4KE5A 1YJRA 4Q45A 2IW3A 3AAWB 1VISA 5ALZA 2KZMA 3RU0A 4XT3B 1R3NA 3N28A 5ELDA 4YHHJ 2Z0GA 4K8JA 1URNA 4ZP6A 6FDRA 2OPSB 1GXDC 5EX3A 1SUQB 3IBFB 4OYWA 1VQSA 4EX6A 1O7IA 2XGQA 5C42A 3BSNA 1U2RA 2V8GA 2MAXA 2DR7A 5CV4A 5CD4H 1VLOA 3JS9A 3J80U 1VR6A 3K59A 4E0DA 5DG7A 3WHIA 2KG0A 3U1MA 2W9BA 3H5YA 1R6VA 1RZTA 3ONNA 1PFMA 2C5CA 1OQ6A 4TUSA 5F3XB 5CJ7A 2V8PA 4K6LA 1KQFB 4YY3F 4JI1Q 2VDIA 1NM2A 3E0FA 3ZTPA 1VQGA 4L5QA 2AD9A 2IRUA 3R2IA 4XIGS 3G96A 1CQVA 2NTSA 1SV0C 3CCSS 3H2VE 4LVSA 2FD2A 1N34L 5KG1A 1M5HA 1AP0A 2HS3A 3AB4B 5KT7A 4NLKA 4O3OA 2QT7A 1ZQDA 3DRYA 1HWUA 4NPSA 4KH0B 2FIUA 1JQGA 5ALIA 2F0OA 2G06A 8ICZA 3MHYA 2DWQA 5A8RB 2UUCF 2C2NA 2ZJPA 1I4GA 4ZK9B 3T1YL 5DAUA 2PT0A 1F2YA 1N33F 2Q43A 3FBEA 5AKGA 1PXUA 3NELA 2V8DA 3A0BU 3FRPB 2YH0A 2Y8YA 5HGQA 2HDMA 1VQ6A 5AI8A 3BV8A 2YNGA 5EBCA 2ZVIA 4K5SA 1Y14B 4DR5L 1NBWA 1T9TA 3TJ9A 4FXKC 4OLOA 5LJ5Y 2B2TA 4QF4A 2N7YA 1A9NB 2MZSA 1Q3LA 1ZETA 2MQHA 2AJ1A 1TVRA 2ZIWB 1SNDA 1FDBA 4F50A 3S15B 4BLGA 5C5LA 3VR1A 4ANEA 2VC1A 2AJFE 5J2MB 1UWAA 4C8ZA 5F8MA 3KG4A 3U9SA 4CDFC 3V7KA 3SV4A 3A0JA 1WC1A 3M8YA 2G9DA 1SJFA 2JMGA 1LO5D 1PTOC 2QEXS 3E9IA 5D77A 5KYLA 4NLCA 4B3RF 5BOMA 3HOUH 1DONA 4HAEA 2WZ1A 3K5NA 3KMSA 2LVWA 4GMKA 2HHHQ 5B0BA 2QA4S 3PACA 2RRAA 4DPYA 3L3CA 2JGAA 2POKA 5LMNL 2JJ4D 5FJ4A 1PK1B 3TSSA 4I2GA 1L3UA 2KVQE 3QJLA 3NGSA 1Y3KA 2GOLA 3FM9A 5HJYA 5EDWA 1ZS6A 5AXLA 2Z30B 3D4JA 2HG4A 1UAPA 2K01A 1HNXL 5DRKA 1HMVA 2PGCA 3K7AB 3M8PB 4X62L 1FKPB 1T5EA 1PO6A 2DXDA 3SD7A 1KTVA 2HFNA 2YN4A 1FYCA 4DZ6A 3KDFB 4USHA 4OHJA 2UVVA 2JHEA 2E5SA 2RU3A 2NB0A 1S97A 1YJWS 1HPCA 1X65A 1HUMA 1MMNA 3TKAA 5CZVA 1WCMH 1ZQCA 2VPXB 1XS9D 2F77X 2JSOA 4RT3A 1IR1A 2FLPA 4K2JA 4O9MA 3STBD 5CB1A 3PIOA 3MM7B 4CDDC 4LR7A 3RW7A 3EE3A 4ZDNA 3C1YA 4A3FB 3CJTA 3MPWA 1ZQ1C 1STAA 4GXIA 1REGX 1ZD4A 1RAFB 3AM9A 3OPXA 3WKDA 1I94L 5GVQA 5IIFA 4F4ZA 4C4RA 2ALYB 4RBVA 5B0AA 3L4PA 2W11A 7ICLA 4W98A 2OM6A 4OJLA 3EROA 1UMJA 2AUKA 1V5IB 2V2QA 1N62A 3BREA 3MCOA 3QIPA 3QEAZ 1WFQA 2K50A 2D5DA 2E5LQ 2IFXA 3BKFA 3SE0A 1FNOA 4JI0L 3KD3A 5JJKA 3TI0A 2EQYA 5ETVA 3M8RA 3R5AA 3IP4B 2OH2A 4NRUA 2MZTA 1S6PB 1KTQA 1KDBA 2QMXA 4ED1A 3CIMA 5DS7A 4FF2A 4WJ4A 4IUFA 1HZBA 2MKSA 2F76X 2YTYA 2Z1CA 4OHWA 5DM7Q 2VFUA 2BM0A 1PH7A 4E2FB 3AT1B 4Y2QA 3AFPA 4MFAA 1P27B 5CYQA 2K03A 2YQ1A 1WTXA 2MPMA 3BYRA 3GYGA 2WAQG 2HHWA 4CLTA 4A3KH 1JE5A 4KIAA 3ZZPA 4C0BA 3L7ZC 2M2BA 3GCXP 2AGOA 4R66A 3URYA 4Y2UA 4JI0J 2K8BB 4DNRB 2U2FA 1X2IA 3I6PA 3N5FA 1TL5A 4RO0A 3Q8QB 2BQRA 5D6GA 3IG8A 2YPZA 3ITHA 3V81B 9ICGA 1ICFB 1AE3A 2WVDA 4U67Q 4URQU 2YTCA 4JMUA 4R4TA 4A76A 1FWPA 3K0YA 2LYBA 3AD7C 1XU4A 2MZJA 2YKAA 3FKIH 2CPHA 1YGYA 2BCRA 3MAQA 3T6BA 3A8KA 1SIWB 4RPFA 3G6VA 3Q8PB 1ZA1B 1JMSA 3D7SB 3SV3A 1QAYA 2RDIA 2XSCA 4NWIA 1TVRB 5KGUA 2L9DA 1RWPB 2NUCA 2DY9A 5KFIA 1LV5A 4NWBA 2HT1A 4KKTA 3CCQS 3ULHA 1QAIA 3LA0A 4Q8FA 4ZVPB 4L3KA 4EVOA 2IBKA 5T41A 4OZ0A 4IL6U 5IWAJ 4O3PA 2QA4A 5B0EA 1T3NA 3GIMA 4DV1Q 1QM9A 3ZC4A 1VBZA 1VQ4A 3VC8A 3PUXA 3OW2R 1EIFA 3B78A 5AK3A 4P0PA 3RFAA 4F2RA 1V3ZA 1RLDA 1TAQA 5K8MA 3MR3A 4C4SA 5HVGA 3C14B 3AU2A 2BOSA 1Y11A 5T7LA 3MFGA 2A3VA 5AE3A 1YKWA 1KP6A 1Z4NA 3QX7A 2VG6B 4O1NA 1MW7A 4X66L 2CPRA 1GJXA 4X4UA 1VQ5A 3M30B 4IG0A 2OD6A 4LF9F 3OPKA 2QZ8A 2O4XA 3OLBA 3HOWG 3JPOA 5KAIU 5KNBA 1Q78A 1CULA 2BKPA 3TAPA 1QNKA 4JI3L 1ZOTA 7ICNA 1N33Q 3NNAA 4B3RJ 1W6KA 3T79A 3V96A 2FVQA 1HQUB 3MECB 2B7BB 3FVQA 2XS7A 1WD1A 3HOYG 2M88A 3LP2B 1HUNA 4UARA 1RD9D 3KK2B 5ALOA 3IG1B 2UXDF 1WCNA 2ALZA 2OPQA 2NBFA 2W2OP 2DH8A 1D0EA 4C6AA 3SFUA 2DNPA 2MQLA 5KOWA 1NZBA 3FEXB 2B63H 4HHHA 1H9RA 4K2LA 2KJWA 3FEZA 2JX2A 3R5JB 3I4MH 4Y34A 1CKNB 4DLEA 4JI6J 5ETNA 4XIUA 1DY3A 3M6KA 9ICEA 2CQ1A 3MGVA 3PNIA 4F5PA 2CRXA 2F3JA 4OZ1A 2JL9A 1Z4OA 3C28A 1BQXA 3AMUA 1XMBA 2NV3A 3AU7A 3HMJG 3EWAA 4EI2A 4NW2A 1DOMA 1ZXIA 1A7GE 4Y2RA 1M8AA 4CYUA 1E6YA 1ASZA 1S5LU 3GR0A 1TL1A 1U4PA 3QLHA 3JC66 4JI5F 4DU8A 3J7ZC 1UPHA 2B63B 2E1RA 4Z6EA 3ZZRA 2FPHX 2UUBL 2MLXA 2G0IA 5DDPC 2B21A 5CR0A 3RB0A 4DFAA 3KMQA 1O7YA 3RLNA 3RLFA 4O0IA 3RB3A 9ICOA 3IRWP 5CWRA 1JLFA 2I0QA 3FK4A 2C3YA 3PMLA 5C25A 3MMCB 2BPFA 1UFLA 3N4MB 1KKXA 1KVKA 4GO5X 3PF5A 2EWHA 4K0KQ 2G4BA 4CM2A 4OHXA 1PUZA 1Q46A 1GTHA 1IBMF 3VA7A 3PHTA 4DR3J 1QVCA 2K7VA 2MQQA 3I56S 1NBEB 3D6MB 1PHJA 1RXWA 1U45A 4DN0A 7ICOA 5B66U 4YHHF 2JFDA 1L7OA 5KT5A 1S4FA 3NVWA 4JI8L 5DG9A 1TQLA 2HQFA 1MD2D 2GVDB 2RE1A 2GIFA 2ZXOA 3LWUA 3W2VA 3GFHA 4LFAJ 4JI1J 4AYBG 3CDEA 1KXLA 1WELA 3ZZZA 4XRHA 1U0HB 2E5LF 4AIMA 4I2PA 4BA2I 2GWSA 1YQHA 5TZVA 1TKXB 4KY7A 4DV0F 2WVCA 2OSQA 5H9EJ 1XNRQ 2ZHOA 3D4WA 1YNNC 2HQDA 3U58A 1F9QA 1VRQC 3MZIA 2V68A 1SNPA 3UVJB 2PMZD 1KKHA 2PQEA 2FINB 5DZ7A 3IG5A 1B0TA 5HLFA 1IHZA 4NEYA 3KYHC 4KY3A 1EYCA 2QV6A 2F0QA 5M9OA 1FFWB 4K4UA 1YIJA 4MIBA 2ZOGA 2KN4A 1DGJA 1C0TB 4DF4A 3UI2A 2UU9L 1S1WA 4KY5A 2EYMA 3ZDAA 2MTLA 2XZDB 4LUBA 2FJWA 2HQ3A 4WZMA 3MDCA 3KKAC 1NTGA 1HNIB 2ZUGA 3QGGA 1LWFA 2EY2A 4YWLA 2F0IA 4M6WA 2ZXRA 3OIQA 4Y3CA 1FVIA 5C4JH 3F44A 1PYSB 2VG5A 1M6YA 2PDAA 3GTJH 4I4BA 1CJVA 4TXSA 1VQLS 3ILIA 3JSYA 1ZZNA 1EZ8A 5AI6A 3QGIA 3C6UB 2AXTU 3OL9A 2HHHL 3A8JA 3S01A 3ZDBA 3DDNA 2DISA 4XT1B 3DNCA 3WX4A 1GX6A 4KX5A 1Y5IB 1D9DA 3KBGA 1VQ7S 2DPIA 2IA0A 1M5SA 1UEBA 4MK8A 2AX1A 2VL6A 2IRYA 3V6DB 4JV0A 1NR2A 3PHEA 1LWFB 3M8WA 4JI8F 1S6UA 2DKXA 2YNHB 5F41A 1B2TA 3FC9A 1WF0A 4RZRA 4O44A 3FDSA 1PLFA 2W3RA 5ALYA 7FD1A 3VVTA 1WHVA 1Q5YA 4WP3A 4A3MB 3ZYYX 4C3HB 3J7YU 1T9WA 3OD2A 1ZAWA 2NRZA 1TUWA 1W2BR 2JA9A 1QVGR 3HVTB 4PG4A 3KUPA 1SJ3P 5AM2A 2LS01 2UXCJ 9ICPA 1U8WA 1KRSA 1WKKA 1DQ9A 2VB2X 4NLVA 4F88A 5JEAG 1N32Q 3PW5A 1FI4A 1OMSA 3JQMA 4DQQA 4DV1L 4G7ZC 3C66A 2B4UA 1L7PA 2FHKA 3GPAA 2CH4W 3TUJC 4NLOA 2MUTB 2ZJQQ 4Y2YA 2RHQB 1HI1A 2QILA 8ICBA 2ZJRQ 3QIAA 4OELB 2E9ZA 1NJYA 2G2OA 3CD6S 3M9OB 4OX9J 2PI2A 4DL5A 2P9GA 3EJIA 5I42B 2K5DA 1TIID 2XN9C 1XMOF 3NUQA 4M04A 2HS0A 4LVNP 2ZJPQ 3CCTA 4ED6A 2R93G 1P9QC 2NVYB 4NX9A 2R6GA 2MP1A 2OP5A 4QZIA 4QPTA 1Y00A 2ERRA 1G6PA 2X3GA 1BCPC 2RVLA 4LK1C 1T9VA 3PMFA 2PPBC 1DLOB 3DGPA 2PMHA 2A2CA 4IOCQ 3TA2A 4WIQA 4DG1B 3MPUB 4Z9CB 1TMJA 4X4OA 3R5CA 1VMPA 4DV2Q 3FP9A 1U7LA 4MYUA 3HZXA 2BPGA 2B29A 4KLGA 5C25B 3MWBA 2LYVA 1N0VC 1O5JA 2I6XA 3GTOH 5EWEA 1C4CA 2OEHA 1ZQLA 3HPOA 3BQ0A 3TWZA 4CO0A 5F8JA 1KLMA 2RQCA 4QR0A 1H2VZ 2LXKA 2R7ZG 1Z1BA 4N5SA 4H0LC 2HIQA 1GO3F 5KFYA 4DBQA 1BQQT 1GXLA 3KUGA 1YRXA 1JLGB 5A0LA 3BSCA 5F2DA 1VFJA 1YIJS 1Q86T 1IIPA 1YJNA 3CJSA 5EJWA 4H4OA 4LREA 3CTRA 4B3SJ 3JPPA 1I6HH 3HI9A 2AYEA 2FJBB 4LF4J 2JC1A 4DQPA 1XN9A 1BPDA 4BHQA 3HD2A 1I5OB 5HI7A 1CJTB 3G4SA 5KL8B 1DXMA 4ME3A 1R7IA 1YG0A 4IURA 4AYBE 4ZJLA 2ZH3A 3HKZG 2Z56B 4X3KA 2ZH4A 1CZWA 4QYRA 4CNQA 4OHYA 2P2CB 1IL2A 2QB1A 3PFOA 4DR4Q 4UBCA 2EYPA 2L4NA 4A46A 4NZ7A 5B08A 5GAGC 4A3JB 5AXMA 3J80i 1OQ3A 3R5DA 3JTOA 1S72A 2KOLA 1IR2A 3J81E 1WWUA 5LL6X 3EQLC 3SSSA 3DEOA 2Y1LB 5ALSA 3PYFA 2CWXA 1PRTD 2MU2A 1C0UB 3K75D 1NSKL 2WB1E 1XIQA 3QUQA 3W63A 3R5GA 5EKLA 2NRXA 2ZJ8A 1CZGA 4IQWA 2YX8A 4Z6DA 5G4DA 2GIQA 2N3LA 2MZ1A 2XS2A 1F5AA 2PFDA 1L5UA 5JVHQ 5D4PA 4PHDA 3G82B 2OTJA 2ZTCA 1X5OA 2K4EA 4ZA1A 3A3PB 1DJRD 4F4XA 4MYTA 3QB3A 3UXOA 2JH7A 3D4DA 2Q2HA 3MEFA 3PO2G 3KZXA 3WOEA 1B3QA 2KYZA 2F0DA 3GO5A 4OYXA 2FLLA 4EBEA 2BMBA 1BDOA 1N33L 1EWIA 2X3DA 4L5RC 1LYLA 3OWFA 4NA1A 5JAVA 2R7WA 2JA5G 1TR0A 2KO1A 1ML0D 1AQ6A 3RRHA 3BS7A 1GUGA 3EZOA 3SQOP 4XYOA 3HOZH 1XJWB 4F7VA 1XNQQ 4DV4Q 1HCZA 2A5HA 1RUSA 4KFBB 4GKKQ 2P6TA 3T41A 2CNKB 2DNLA 3QWNA 4KKOA 3J81Y 2E1PA 2PKEA 4N8FA 1N48A 3K8AA 3EXYA 3UPQA 4YR3A 1R8BA 3ZDCA 2JYOA 4DGZA 5A8WA 4ICAA 3FPUB 1PBAA 3QLHB 1VIOA 2ISPA 3TEHB 1L7MA 3V72A 5IIJA 3GFXA 4QOTA 4CO3A 2Z0SA 1AE2A 1VK3A 3SXLA 2OXOA 1HWJA 2LMIA 2DR6A 5J2KA 2BV3A 4C7QA 4I7FA 2LM4A 4X4PA 1HR0J 1PFSA 4NY8A 1FKOB 4TY9A 1K1QA 1ESRA 4ZPCA 5EQ0A 5D0HA 4ALPA 4A3EB 3NKYA 4UP7A 2OWOA 3A3OB 3OTOJ 3CJ0A 2VASA 2OFGX 1BY9A 3BDOA 2LPEA 3VAHA 1B0VA 2IDEA 4CE6A 2EFVA 1YJ7A 4NDXA 4ZVEA 4IO9A 2B2WC 2AWNA 2BJ8A 2UUTA 3MC0B 1FJGJ 5M3FG 4A3MG 4R8NA 4CYUB 3BSOA 3L95X 2VKRA 2Y0SB 3QBCA 2BDOA 4JWMA 5IS2A 2YNIB 1TWFH 4P2FA 4YIJA 5IYDH 5FOBB 4LF5Q 4A3DH 2FC8A 1M5OC 4YOEA 1L3TA 4PGYA 4YB1P 4YXJA 3SMZA 3WIUA 4P52A 3PUVA 1SXTA 1QWYA 4O3MA 3OPOA 3J81j 4YB7A 5F0UA 4I7ZC 2OFHX 5K14B 2YMPA 5CBEE 1XMQL 1C1BB 1SKWA 5KFGA 2QB0A 4CO2A 4H4MB 4ZVUB 3BPDA 4MKBA 4IQMA 2O3DA 4CO4A 1S0VA 3CPFA 2V0NA 5K5MA 3A8IA 3MECA 2DY7A 3GG1A 3GIJA 4Y28C 1L0WA 1YK9A 4X3TA 1ET9A 2BA9A 3H3VC 2P6SA 3T1YF 4IFYA 3ND8A 5AKYA 1JRPA 3OSOA 2BYCA 2UUAJ 2EVZA 4HIOA 4PZ8A 1N6QB 2LEPA 1WDDA 3S6JA 3MM8A 3B4MA 3J7AV 3OTCA 3NAIA 2YPYA 2KXNB 4ES3A 4HTJA 3AL0B 2OI2A 3GYNA 3MMBA 3DLLA 5EWFA 5LSOA 3Q86A 1Z19A 4MHEA 1Q86C 2FDNA 1Y4ZB 1HNVA 4LUZA 3DRSA 2JSXA 3ETRA 3P1HA 2HHVA 3QZ8A 4G4KA 3R1HA 1AT1B 2I9SA 1OWXA 3HULA 4XQNA 2DR5A 2WB1F 3NWGA 3SZ2A 2NVTH 2ZM6J 5L46A 5KYIA 3FZ2A 4H4KA 4G6VB 4JI6Q 3ULLA 1H74A 4DJBA 1UEUA 5GAEI 2CNLB 2XTIA 3E6ZX 4B3MQ 1X4DA 4YHHL 4JI3Q 2F65A 3MFYA 1Z3EB 2KFZA 3V4IB 2NXUA 2IT1A 3HGBA 2TSSA 5C3EG 3GU0A 3TQEA 1S48A 2D9PA 2IM1A 4GFJA 3ITHB 3V81A 3LF0A 3MDAA 1XK8A 3A8EA 4AQYQ 4QZEA 2UXDJ 3PSIA 2KJVA 4ID5A 4IPHA 4B3TQ 3EGWB 2CPXA 2V69A 1FE4A 1RTNA 2O1PA 3AYHB 1VCIA 1JOKA 1EX8A 4TVAB 1S1VA 4Q2MA 4BWMA 5A2QY 5J2DA 3EA6A 1BOSA 4ZVFA 4IDKA 8ICGA 1FERA 3TDQA 2PZUA 4OJHA 4I67A 2MJNA 1KD1C 1XERA 3QT5A 2HNYA 4OI1A 4Q0BA 2AQ0A 9ICQA 2W55A 4NLNA 3W9HA 4PABA 4A4JA 1N34J 2FDRA 3ICXA 1R8AA 3A54A 5E3FA 3SK4A 1MIUA 1U1RA 1PH8A 3UCGA 1KHWA 2J6UA 1G91A 4KN7A 1PAEX 3U26A 2BA1A 2ZHBA 1UAWA 1Y0HA 4DR6L 2DHGA 3FCWA 1CRXA 2GQCA 3I28A 2KK0A 3MVVA 4H4KC 1HHTP 3S1RB 4JBKA 4ZKBB 2RUGA 3KZIU 4U6PA 2MLYA 3W8GA 2PW7A 2WF6A 1WTQA 2FHTA 1XO1A 5J1EB 4F71A 1U1NA 1RB0A 2EIFA 4DUTA 1BO0A 3TQYA 5DDYA 4NJ8A 1Z1ZA 1M5VC 2KQ3A 5AKLA 1BXTA 2IVMA 2Z6KA 1NB7A 2B39A 1LWEB 3OT9A 5D0GA 4DAMA 4LFCQ 3C8YA 1EFID 4DV5J 1ZQMA 1MROB 2XMAA 1L7NA 4NXZA 3NENA 4L75A 4DI6A 1RTZA 2VF3A 1U4BA 1CG2A 4CF3A 5CV5A 1VQ8A 1SLJA 2E5LL 4D3GA 3CCES 2WVBA 5J2CA 2W24A 1NK6A 4CLZA 1PC5A 1JROA 1WG4A 3CJ3A 1WD0A 3VYRA 1N36L 2JEFA 3I3CA 3G87A 1KC8T 2LM1A 5K4LA 4RQ4A 2CQ3A 5KFNA 2FTRA 1KQQA 4AL6A 4LF7J 3PIPA 4P4MA 4GZYC 2ZBPA 2JVOA 3B6YA 8ICHA 2KENA 5BYSA 1RM6C 3M1YA 2R92H 4NI2A 5L8RC 5EKIA 1TL7A 2X6GA 3WOFA 2IOFK 1BE4A 1H73A 3HO1A 2CKWA 2HMXA 1YHAA 1G7CB 2B9YA 4DQSA 1D1IA 2F8MA 1UJ5A 1ZQXA 4MTPA 1U1OA 2R8HA 1VBXA 1VJQA 1WNEA 3RJIA 3G8TA 5KFUA 2E2DC 5CH7B 9ICRA 2K8AA 1J27A 1TP7A 1E24A 1QZHA 9ICLA 3IC1A 3BYPA 4R65A 3N6MA 1RF2D 4CQ1A 1D2BA 1DBDA 2FHMA 4DX5A 4X2BA 3CT9A 2FJ6A 4OX7A 4O4RA 1V3RA 4AFFA 4DN9A 2E8PA 3W65A 4KO0A 3DLGB 2JNJA 1HQMC 3SBMA 3IFEA 2HBQB 4RFBA 4A3LH 1YJVA 3QU9A 2ZHAA 2OMLA 3J7A1 4DXGA 4OLPA 2EAMA 3BZDB 4FPIA 4ECUA 2ZJ5A 4GKJJ 4DOCA 3UI3A 2A1JA 1UVLA 1KRTA 2M4MA 3S14B 4BBSB 4BY1G 2J7KA 4PXBA 2KE7A 2CWKA 4UBBA 5DM73 2RDDA 4Y00A 4OO1I 1B4OA 4C8KA 4ZIWA 3R1LA 3PRBA 1YI2S 4PL2A 2CPFA 5E3QA 2F0FA 1ZQVA 4A93G 2WOMA 5I2XA 3BKTA 2G13A 3KJFB 5KFSA 3PY8A 4R0JA 3T1HQ 2BCVA 4JYAL 4GVBB 4X65F 2E3TA 4ECRA 1I4XA 1I4QA 5H9EK 3H90A 1C4AA 1N32F 1TAMA 1CKOA 4K5VA 3I55S 4KLMA 3KLGA 2HI0A 1I94Q 3W61A 3IAM9 4M5GA 5ALGA 3VVUA 2NN6H 1WJ9A 1GUSA 1PH1A 4S0MA 1YBYA 3ONAB 3ETOA 4AYBC 1JLBB 2Q4TA 3I0SB 3RZOH 4FO2A 2A18A 1PJ5A 1KLGD 3UN3A 4DSFA 1U9LA 4PHPA 4NPOA 4X4TA 2OELA 3NL0A 4IKAA 4ZJOA 2YU9B 3SGIA 1A62A 5J2BA 2A19A 4RNOA 3KWMA 3G2XA 4NLQA 2J5AA 3ORYA 3Q83A 4DCCA 3N79A 3V6JA 4IQVA 4TUQA 5L1JA 2GCFA 3QAEA 4I6YA 1PYBA 3TP7A 5KIXA 1SJ1A 1RZMA 4O5EA 3H8SA 1J6QA 4BY1H 2XI9A 5DLQE 4ZAIA 3CE8A 1HUZA 1SJQA 5CV6A 4J9OA 2KMDA 3F53A 4RW8B 3PUYA 2NWGA 3Q8VA 5GAGI 4A4IA 3HCXA 4YFKA 2BZFA 1ZH5A 4M9GA 2V4JA 2NYVA 2B0CA 3RJJA 1EU3A 1VC5A 3MEKA 1KTKA 1VRUA 2A6ED 3WU2U 2QA1A 2EYFA 4G7OC 2HWHA 2GH1A 1E2VA 3D68A 2R42A 4LF8J 4QQBA 1VS3A 1U0SA 5C4XB 2L9NA 4MK9A 4WKRA 3W1BA 3DFEA 5IP9H 5CR3A 2CH4A 3OSNA 1KSPA 1STEA 2CFXA 3I56A 1U6BA 5KFPA 3UQ2A 3C15A 2MA1A 1U1LA 3O2IA 2MMYA 4RNNA 1HBMB 4U96A 5F8LA 3OUYB 1RQNA 3M6VA 1YBAA 4CZCA 4DPOA 4NMLA 2EBEA 1M5KC 1XR5A 4NZ0A 3RUBL 2N4DA 3ETLA 4ZLNA 1M0SA 2IWHA 2G09A 1JLEB 3B4DA 2KEEA 5LMUJ 1G291 3RB6A 4DR1L 4WPAA 3EUNA 2LMRA 1E1OA 4J9PA 5DQGA 3F2CA 1U4LA 2CHBD 1BLUA 4LFCF 5EE3A 5IM0A 4QL5A 3M6WA 1NR4A 1QJHA 3GJSB 1RBAA 3V4IA 1KQGB 4DSEA 3ZTOA 4DV3J 5AM3A 4ZS6A 1G3OA 2F3VA 1F1BB 2LDIA 5J0QA 5IWAQ 2KNJA 2XYPB 2X1AA 1TS3A 3N97B 3EZ5A 1DZ1A 1PYTA 2F0UA 2BW7A 2B2TC 2Y0SG 4RT2A 5AFWA 4DSLA 3H0GH 2RH3A 1NNDA 3RF9A 1JICA 1U0LA 5C7PA 2ZUDA 2LU1A 1ZD3A 4DR3L 4IN3A 4TSSA 2VPZB 3IG1A 4AQYJ 1HUOA 2QLBB 5M5YB 2CW0C 4RWSC 2G2YA 4CWBA 3H15A 1TWGB 5IIOA 4X64J 1UP1A 2AQ3B 2L11A 2CDRB 4DR1J 5ALHA 1B53A 3OXGA 2BPCA 2XLIA 4FN5A 4GKKF 1X5PA 1NUCA 4YN3B 8ICIA 4LF9Q 4CLSA 2CVEA 3T51B 1VOMA 4ZPWR 4XYQA 4LRBA 3QSIA 5I6YA 1FGUA 3R7SB 4X4RA 1HQRD 1H9MA 4GIBA 3I55A 3J7AN 1TWAB 2XNQA 1V6HA 3O8WA 1BVSA 3T9ZA 3VYUA 4DPWA 5L1MA 4MKYA 1YJTA 4OQJA 1SN8A 1G2EA 3MTKA 3OTQA 4RG1A 3UCZP 5FO8B 5ALTA 1VQ5S 2MB0B 5BR8Q 4WYWA 5KEEA 4UB3A 4HJAA 4B3OA 3RRKA 4K4XA 2YYZA 2B8QA 1RHUB 1SC1B 3KTQA 2CQ2A 2FVCA 2ADCA 3UMCA 1BBUA 2A6HD 1R31A 3DHWC 3KF8A 2DGUA 2D3UA 2PA3A 3GTGB 4DUYL 4QZAA 3QZ7A 4ED7A 4ZUJA 5HN0A 3J80c 2W8KA 3FBBA 4ETZA 2V4RA 2RSOA 1XYIA 2LDYA 4IDKB 1RTDB 3D28A 3S1MB 1RK8A 2O67A 4HN7A 1NU4A 5K8NA 2GJFA 1HXYD 3QATA 4U8YA 3T4AC 1YDLA 2HD3A 1T9UA 5ALFA 1TUGB 2KH9A 4C1NI 2CJAA 1WI5A 2F40A 3JB9k 2VS1A 3U02A 5HMMA 1PDQA 3OHXC 4DR6Q 1KOHA 5HROB 1TAUA 1D8BA 4OEMB 1RYSA 3D67A 2VB3X 2AT1B 4WU2A 3LH2S 3BB5A 1Y5NB 1U6FA 4IH6A 4YY3L 2VFSA 4O0NA 3ET6B 5B09A 1KQSR 3FFIA 4LF6L 4DR7F 1JMTA 3IA0A 3LALA 1F3VA 4X62J 4DV2F 1NK9A 3BDPA 5A8WB 4ED3A 1Y10A 1RDPD 4A3GG 2DGOA 1J5EL 2MY8A 2YKMA 2W1BA 5IYCG 1XC9A 4F7XA 4DFMA 2WFAA 4D3HA 1FWLA 1WC5A 3T53B 4YCWA 4TKTA 2FJVA 3QO2A 5HQLA 1ZQNA 4FZLA 1U5KA 3PKYA 3O44A 4LVOP 1PV4A 3ZXWA 1QUVA 4BWGB 1YVFA 4HDGA 5KFCA 1TKTA 4CGYB 4IFYB 2F4VJ 2HNZA 1B7YB 1N56A 1UWVA 2LYAA 4OIXA 2AF6A 4BX9C 2JEAI 1UWBA 4POFA 2RU9A 2F4VQ 4RNHA 2XHWA 4X84A 4J9MA 2H4WB 3EDRB 3VQTA 2E2JH 3C2MA 1NB2A 4NYOA 2E7VA 1NUEA 3VGTA 3CJ8A 3OR1B 3M8QA 1UZDA 3QIPB 2Y0BB 4K8IA 3K8VA 4RBTA 4RKLA 4X3UA 3P75A 3D6JA 3RN5A 2YY3A 2ZBRA 5JJLA 4EUVA 2VA2A 2MQMA 2N1RA 2MHNA 5LMNF 1K3RA 3GG0A 1I94J 3MDFA 1LTID 3D1QA 1XMOQ 1YI2A 4M5MA 2CXYA 1HMVB 3OL6A 4G7HC 4CNZA 4N9PA 4A3DB 2B9WA 3CJKB 1WTBA 3I4HX 4F8MA 1LWCA 3IP0A 2RILA 3PIPQ 4DU9A 5LSRA 1SWWA 4HCEA 1DOKA 1WYGA 2UXCL 2IYGA 1VRTA 3M32B 3D2SA 1Y88A 2X1FA 1PH3A 3S1NH 3IM8A 3IV6A 1L0YB 1UE1A 5M3MG 1D5MC 5BN5A 3RYLA 2I46A 2C2MB 2KVSA 5CGKA 2K4IA 1HZ9A 1XTCD 2YBVA 4B9UA 1K47A 3K6OA 4FF3A 5KFMA 4PYDA 5IQQA 3O1LA 4NMZA 3PW4A 2ZIVB 5FLXc 2YWEA 2D9OA 2ZIWA 2KHIA 3LVWA 1N52B 1LXJA 3NEMA 5CYQB 5F3ZA 3LP1A 1HWIA 1U1MA 4OZLA 1MLAA 1PK1A 3RBEA 1IBCB 2C3PA 3QGPA 3BR9A 5IFMA 4CIOA 4U673 3PXGa 2ASLA 1NK5A 2WB4A 2OMOA 2DIUA 2WBMA 2FY1A 1N5VA 3BR8A 2Q8TA 4XDCA 4QWBA 1SNMA 5A8RA 2F4IA 3BVGA 2FJAB 1VQ7A 4GOPB 2J0WA 3G48A 5HANA 4A8XA 2C2RA 4WTOB 5B0CA 4Q8EA 4BY1B 2BJDA 1R0CB 4JI7J 4NL9A 4QPXA 2NUUG 1S7IA 2VJ5A 3NRBA 4I6WA 1YLXA 4DG1A 5E4WC 3HOZB 5HK4A 2EY6A 2EXZA 3WKCA 1IR0A 1SL0A 1NE3A 1MMDA 2EJFC 4B6JA 1G2SA 1RU1A 4M9JA 1EZ6A 3HG9A 3OOCA 3D9BA 3ILOA 1Z00A 1JXEA 4CM0A 1HH2P 1PRTC 1DYQA 3AEVA 3MOJB 2FJEB 2NZCA 3N6RA 4LF7Q 2QGFB 5K20B 4KRWA 4DUYF 3OVAA 4PZNA 4EX5A 4DWIA 4H7BA 3PM9A 5J2QA 1COOA 1NMEB 3MZ5A 1KFDA 1OXSC 1B1ZA 2VD3A 4DS5A 2CPEA 2XGPA 5BR8L 1S40A 2A69C 2HOFA 1HYSB 4A8FA 1NSQA 1H9SB 5C44G 1LK7A 2YWWA 3IS9A 3F56A 5C44B 4J9VA 2IM0A 2CA9A 2VBWA 3R6GB 2CPYA 1Y8OB 4G3IA 4I0WA 1KDAA 5DEHA 4HLBA 5DB9A 3G6ES 3T5LA 3HZEA 4AYBD 1XJVA 9ICFA 3KK3B 8ICCA 1VQLA 4ILMA 2V8HA 4EYHB 3QOLA 2EYOA 5CV7A 1SGGA 1N8RT 2AZ1A 4JI1F 5C42B 3Q8UA 3RH6A 1NJIC 2H51B 4O23A 2Q0ZX 5DJBA 9RUBA 1K8GA 2RS8A 1NZPA 1V85A 1DQAA 2HQEA 2O5JC 1JX4A 3H5SA 1HFEL 1HNXQ 2J7UA 5LXRA 3BH7B 2X1BA 1WTPA 1OY8A 1G6BA 3LNNA 4J8QA 3P3DA 1J2NA 4MNOA 3M6UA 2D9UA 2VUGA 5J2EA 1IBMJ 2IPKD 5KFJA 5M3MH 2P9EA 3NLCA 3E58A 2M9NA 1Q7YC 1O80A 3I4MG 3EGZA 1OIAA 2Z58B 3OIPA 1CK1A 2CAJA 5ALJA 3RB4A 2I1QA 3S17B 3EZUA 3GTGH 4ZN3A 4NXMF 4DR7L 4LF6F 3R93A 3RBXA 2VBXA 3IM9A 1T94A 4ZVQB 3NY0A 1A77A 4ECTA 3KLSA 2W43A 4X66J 2XO6A 3V2UC 3SIPB 4LFBJ 1X4FA 4RQ0A 2XBPA 2JEBI 4P71A 3UW1A 1JJ2R 3IR6B 3FZBA 4TY8A 8ICMA 1X55A 4R4CA 1YX2A 5G5HA 2R7TA 4JI3J 4RGOS 3GB0A 2BUNA 3HKZF 4J9SA 3BGFA 2Q6CA 3RBDA 3MGJA 4CRJA 2WACA 2LXFA 4A3EG 2G9HD 1WF2A 4A3BB 2DRBA 3S1TA 1EL0A 4US9A 1T8EA 4CBVA 3DXSX 3GTJB 3R5BA 3V5RA 4UTGA 2B4OA 1TL4A 4F4AA 2R7DA 4WFNQ 4JI6F 1IKVA 1HKAA 1UA1A 4FYYB 3U1LA 1XMQJ 1QSSA 4LJZC 1XEZA 2ZBQA 3EXCX 3E0JA 5AI9A 4IUVA 2XULA 3H8YA 4UATA 4OYBA 4KITB 5IT9Y 1FTCA 3RLOA 2K33A 2VPWB 2AJ2A 3BPSP 4JI1L 2K04A 1LTGD 3KLGB 1PBUA 2E2IB 4X64Q 1JJ2A 1IYUA 4OX6A 5E7NA 2QGQA 4KJIA 1IKMA 2JXMB 1L1OC 3W2DA 2F8KA 1KBRA 1AFJA 2JEJA 4HTHA 3GV5B 2XMWA 2K7KA 1HTLD 2GHWA 5IC6B 1YITS 2JRSA 1N5SA 4FFDA 2RSNA 3NBHA 5AJ3J 3FKBA 1X0FA 1FE0A 4URSA 3AJ2A 1NK7A 4RL1A 3V7LA 4OYMA 3OHAA 3PRVA 2WTFA 1MNEA 2PMZE 2NXEA 4XO0A 1D5ZC 4BBRG 2MKKA 5C3XA 2VXWA 1Y1VB 4EMDA 3CC2S 5DQHA 1Z2LA 4QU6A 3R27A 1O08A 3LWMA 2H5EA 2W3SA 4Y2SA 3G71S 3EIVA 3A55A 1SKRA 2H1EA 4AYBB 2IYIA 3RH5A 1LK5A 2G5IB 2CPZA 2K2PA 1S4EA 1JN3A 3W1YC 5IIKA 3LGNA 1KDCA 2O5DA 1E2ZA 4DUZJ 9ICTA 3OL8A 1ELOA 4NLTA 3S2DH 4PWDA 1EP4A 4K4WA 4QZGA 2NVQB 1H2UX 2DO4A 2PQAA 3UDVA 4XAKA 5B5EU 3SXHA 1VQ8S 1VQIA 3GTLB 1LKYB 5CYJA 4OI0A 5AKZA 4HIMA 4USJC 5C4JB 4PMWA 5J39A 5L38A 2NVTB 2C42A 4M5JA 3JAME 1FD8A 1PKUA 4UAUA 5J2AA 1GOZA 4M2YA 3RBZA 1NPKA 3IHQB 4ILLA 2D0OA 1XO0A 3AQOA 3A5ZB 3EICA 1EKSA 2YKQA 3RZDB 4HJ8A 8ICXA 5K36G 1S49A 3CJ2A 5G0RB 4OGQC 5I3QA 4KPCA 4DV2L 5KFXA 3FSXA 7ICSA 1IQTA 2KG5A 3MD1A 3MM5B 2IIHA 4JI7F 4DSKA 4BJQA 1HNWL 3I9ZA 4A47A 1OXVA 2ODGA 3SAHA 1WUUA 5JTIA 5KAKA 1ZQBA 4JI2L 3M1VB 4CKCA 2FHJA 2E8NA 3HWTA 3QJYA 3SEBA 2EYLA 3STBC 4G1QB 3UFCX 4F3OA 2EFQA 3MGIA 1OO0B 4RQ1A 4HT5A 4DF7A 3TAMB 1W3SA 4MKAA 2DHAA 1ZM2A 4UPAA 1X4AA 2NSBA 2BANB 4FP5D 2QLJB 1HA1A 1O7LA 3WK9A 2P6UA 5IIIA 3PO3H 1MWYA 1RAEB 3A74A 1SE2A 1QE1A 1RXOB 3H91A 5CYMB 1D3WA 3NTHA 1B3AA 4HH0A 3BDEA 1KNZA 4JV5L 3HK2A 1WC4A 2NQPA 1KONA 2NZ4A 1WVLA 5HQ8A 5KFAA 3VGVA 1WOPA 2VY3A 3T56B 4R0EA 4FDFA 1IXKA 1B64A 1GX5A 3GP7A 4C8OA 1X60A 2YMQA 3HOVG 2JEGA 2CKZB 3I82A 3Q2SC 4FNIA 4PXEA 2D3OR 3MUMP 2OPRA 5LMNJ 3MXPA 2MKJA 5IP7G 2J8SA 4FF4A 4FYDA 1JC7A 2HCIA 4JI4L 4H54A 2WVFA 1SJRA 2F0LA 1DRZA 2D6FC 1HR0Q 2W7AA 3AOCA 4YDDB 3J80Y 2JA6H 4XXEA 3TFRA 2F9DA 1D8YA 1T9HA 3UE2A 3VGSA 5J0OA 5KNIA 5JOBA 2FLOA 3ZFVA 1CA5A 1JKHA 4I68A 3DWAA 1N34F 4KMUA 3W62A 2YTUA 4NL9C 4X4NA 2QL7B 2KFYA 1FD7D 1IVZA 2EK1A 4IUTA 3PMNA 3DYAB 4ZPDA 2JZ5A 1STBA 1DXSA 1ZQTA 4KKSA 1YBTA 4AP9A 4AH6A 1Q8IA 4KGKA 4UOCA 2HUGA 4Y2AA 1UE7A 1JOOA 5CMDA 2MXYA 4BXXG 4HI1A 5EE9A 4FBTA 4J7CA 2DNYA 1B9NA 3FJ2A 3I4NB 3MMJA 3EW9A 1N4LA 1U09A 5LJ3Y 4ECYA 1NH7A 4AL5A 4NLPA 2P5ZX 3TARA 2M0NA 1MSWD 2DXFA 5DDMA 2F44A 2AYMA 1PTOB 1RT2B 1J5EQ 1Z00B 2EY5A 2E5HA 3CD7A 2E8GA 2RF4A 5GROA 2NVYH 1IKYA 1Q1EA 1EQTA 4BCAA 4DAVA 5LM7E 2BDPA 4OX8A 2PMZF 3ZTQA 3DU6A 2SEBD 5DGAA 2G5DA 4HVZA 3VAJA 2GW8A 3DWQA 3A4TA 4EU0A 1QB5D 1ED1A 2QLFB 4K50A 1RTHA 3D3CJ 2WKCA 1T11A 1W25A 3NAHA 2VPYB 4X5VA 5HATA 2JK8A 4NCAA 2MRLA 1TV6B 3MURP 1AW0A 1LT4D 3H0RB 1F5CA 4DFDA 1EAYC 2AJQA 2HGMA 3D2QA 5J2PB 3TAQA 2PXIA 3MEGB 1FT8A 4UW9A 3GCWP 3SEOA 1U48A 1SDFA 1O51A 2R92G 4LF2A 5GAGU 2CJ9A 2EFPA 3AH6A 3LDAA 1PG5B 1HFGA 1GTEA 1NHVA 3CC4S 4C1NK 3JPRA 4DV0L 5F8IA 4LF5J 1VBKA 4LFAF 3DLEA 4CLYA 1X9NA 2DGTA 3TP5A 2AW0A 3QO9B 1N60A 2HNYB 7ICPA 3KFUA 1HA6A 1PIEA 5ALDA 4CLFA 4B9VA 4RGNA 1K5OA 5EE1A 3LOUA 4IUQA 3NCRA 1S10A 3H4BA 2C3OA 4MFCA 4RW9A 5J0XA 4UB4A 2NRVA 3PW2A 2E1AA 4B08A 5D15A 2D3O1 4DOZA 1BNZA 2H5IB 1D9FA 4DR2L 2VUMH 2NYZD 5AJ3F 4JBWA 3WK5A 3QMQA 3ZDDA 4A3GB 3IRXA 3PZPA 5IP7H 3SK5A 3H8WA 3KLIA 4NA2A 4DDFA 1Q1BA 3I5BA 1LOUA 3GQCA 2VFVA 1ROFA 2ZZTA 4MTNA 1F0MA 2E1EA 3LWLA 1UJ4A 3A7LA 1VF7A 4DPUA 2K5NA 4P2CB 1YWXA 3ILLA 4JK1A 2HLUA 2HCFA 1I5FA 3PEHA 5M2RA 3S16H 5IWAL 4FZNA 1N63A 4DZDA 2IX3A 4M1UB 3I31A 3GFZA 3MM9A 4YMMA 2HK3A 4KBIA 3L2PA 2HQGA 2IJ0A 1YITA 3NXZA 3D8GA 4CJ1B 3LYSA 3I4NG 4ECXA 2PN6A 1KAAA 4FZVA 4DEZA 3TW0A 4MIWA 4N7TA 3MM8B 3KKAA 1DJ0A 5FD1A 2N82B 4XQ8A 3PO3B 1VQCA 3P7JA 3B9JA 4R4QA 1VC0A 3AODA 1JLAB 1K0SA 2I5JA 4QR1A 2KM8B 5JUMA 3PTWA 1WI6A 1B99A 2R2SA 2E2HH 2XC9A 4DV3F 3QRQA 3ETMA 1N54B 1LQ9A 5ALVA 3D31A 4C98A 1XNRJ 1NXIA 3S2HH 3QU7A 2YX4A 4EO6A 4IOAQ 3FKIG 2CZ4A 3BO2A 5ETLA 3S6EA 2FPMA 3PIO3 2LFVA 2CQBA 1KEKA 4DV7J 1F77A 1R4QB 3CVKA 3THTA 3QQCD 5EAYA 5GMKa 1K83B 1GHJA 4OONA 4RU9A 2F8LA 2CQOA 3FFIB 3MR2A 5LMUL 1WSVA 4HT7A 3M4XA 4B9SA 4KN7C 3H5UA 1S1TA 3VHQA 4C3MA 4EO8A 2HIXA 4F92B 2A6MA 1KFSA 2ZBCA 5KT4A 4IFDI 2OTLS 3A56A 4EGLA 1S1XA 3LP0A 4QQBX 1O6XA 4YCUA 4DAYB 1SB6A 1SV5B 1WC6A 2HZCA 1T3QA 4RGTA 1MWZA 4RQ8A 4PV1C 4PQXA 3K7UC 3H98A 2BQ3A 1S79A 2DCUB 4DMZA 1IKWA 1KWMA 1GUWA 4F87A 5IGBA 4IALA 5L1KA 2HS4A 4CGZA 5D4NA 1E3PA 1K9MT 1AH9A 3CRKC 5J1ZA 2VHGA 4YWMA 1HBMA 4AQYL 2W25A 2XO7A 3OTOQ 5SUHA 3W3AA 5IWAF 3KF8B 1BF4A 2N88A 2KVCA 3N7SC 2LFNA 2WAQD 4AXIA 1HD1A 1EFWA 2QTWA 1X32A 4IO9Q 2VG5B 2X1GA 1R0AA 3WK8A 3K0JA 3Q89A 3H3VH 3DI6A 1Y1WB 1NNLA 2RDGA 5ETMA 4MFBB 1QAXA 5LT5A 4YR0A 2R7SA 2KT2A 2FPLA 2BDNA 3H25A 2M00A 1BPBA 2SNSA 3CDBA 2PO4A 4LF4F 1EU4A 1S1WB 1XNSA 2SNMA 3M4YA 3V4MA 1Q1KA 3VQSA 4DX7A 1BCPD 2GO7A 2LXIA 4IR9A 5CQGA 4IZ8A 1JB0C 5E2QA 3R7BB 3UQ0A 2EJMA 9ATCB 1YRTA 1X8DA 4CDIA 2VKQA 4QW8A 2A69D 3OTDA 3PW7A 4N8X1 4UY8C 1N5TA 3CF5A 3CW2C 1EHWA 5E5NA 1ZBTA 5J0PA 2QRRA 4X65L 3TAMA 2N55A 4DKAC 1JT8A 2CRLA 4LZGA 4OCZA 1STHA 1UL3A 2CZVC 2AU0A 2D7SA 1ILQA 2ES2A 4GKKL 3DXBA 2H3VA 4OO1G 1B7FA 1FRMA 1CM9A 3KHRA 3GD7A 4UDUC 4KHPJ 3O0FA 3G6EA 5C3EH 2VJ4A 4HEA9 4LF1A 3PGZA 2KI2A 4BY7B 3P6YC 2BABA 4FKXA 3G6XA 2B43A 3W9IA 3E01B 4FYWB 2K4KA 3ZD8A 4HI2A 3NOCA 2AUJD 5T1IA 2AIRB 1JR0D 2OYYA 5IT9c 1NH8A 4EELA 1HNZQ 2CQAA 5H1SE 1WUDA 4NEZA 4Q0BB 1UEAB 4Q0FA 1SL2A 1UEVA 3OYYA 4OL8A 2CVRA 3N6LA 1CC8A 1NCVA 1ENAA 1SJ4P 3FC4A 2J7ZA 8ICTA 3D3RA 3TVKA 1CJVB 4JBMA 1BUVT 3MEEB 1M5PC 2EH9A 5CD4A 1PYWD 1Z6HA 3NBPB 4DXFA 2OO4A 3BJUA 5D0RA 3RNUA 1H6KX 2MNAA 3GU3A 2WSCC 1JWWA 1RI7A 3DUZA 3D1HA 3GV3A 2PEBA 5B7WA 3MABA 2B3TB 4P7TA 3PO4A 4LIRA 4BDPA 1TFWA 1RT7B 1J97A 4WE1B 2XNAC 2F0TA 2B3GA 3SCJE 2KA7A 3DRXA 4CH1A 1UVKA 2JA5B 3EGNA 2YMLA 4PCQA 2EDUA 3GTOB 1KL9A 2Q2TA 4NLXA 4LF7F 2HVHA 4EWTA 2J9DE 5EHHA 1SC3B 2Y9HA 1W2IA 3VTIA 2M2LA 1LTRD 1FR3A 1IL8A 2PFPA 5HL7Q 3N7PD 5KG6A 1P7DA 1ZAVA 3BO4A 4RNFA 1SV5A 4JI4F 1G4CA 2CG8A 5J0UA 4A3IB 3GTLH 3J81c 2B5JA 2UVRA 4CT9A 3NTIA 5ALRA 4PGQA 1HHQA 4I65A 4JI7L 2ZC3A 2E8OA 1VQMA 1OY6A 5B0FA 1CKMA 2ATWA 3I91A 3QRPA 1N36F 1ULRA 4QZHA 1J2VA 2EKNA 3MBYA 5C5MA 3Q24A 4A3FH 1K8MA 2HMIA 1Y3JA 4B9MA 3GTPH 1HBUB 3RAXA 5IILA 3M8SA 4JYAJ 2YWKA 4OWTB 2WB1B 2V4DA 2W4DA 2DNNA 5DG8A 1FFUA 1EQRA 1YNND 3I7FA 3X3UA 4GKJL 4JV2A 2Z8QA 4QZCA 3P49B 3NGUA 3VAFA 3F5EA 1FX4A 1GXTA 4EBDA 1X3EA 2R61A 2JFKA 2KHCA 1UQVA 5HMLA 3CUNA 2DJFC 3KJPA 1EXNA 1ZPVA 5CCLA 4UY85 5BN3A 2B4VA 3IR5B 2E5JA 1WF1A 1JUDA 5DDQC 1JJHA 1N5WA 5IGEA 3A3NB 1RWKB 5AICA 1LWEA 2GFFA 3DCAA 2F4FA 1N5YB 2YWFA 4F4WA 3MXNB 2K4HA 1KD1T 2D8CA 4UB2A 3NVVA 4P4PA 1RAGB 1QAJA 4ZITA 1RPLA 2BGWA 5ELEA 5KTQA 4Z7YA 2ASJA 3U7JA 4A48A 4I28A 3OW2A 2HRYA 1YNXA 2E1CA 2W01A 3BH6B 5E41A 2XWBB 2WBRA 4PZ6A 1JIHA 2QYCA 5DGBA 2VH7A 2HFVA 2Z4IA 3DV9A 4A8SA 2A1JB 3AB2B 3KF6B 4ELVA 4IG3A 2AKWB 2G1DA 4UY8T 5C4HA 4GLVB 4KLHA 2VG7A 2MUYA 1IBLQ 4ZMMA 1FKAF 3C5GA 1AA1B 2W2PP 1IZ6A 2XMMA 3UDGA 1G6ZA 4K4GA 4ZVSB 3PNCA 2E5GA 1SJHD 1Q5VA 1XPRA 2VDHA 1FXLA 4LF8Q 1FKOA 4QGUA 5ETRA 4UAIA 4KO0B 1B4FA 5EPLA 1FK9B 1L3SA 5J2IA 2K60A 4C8YA 5D49A 5E1FA 5FLXL 2EG2A 2I6WA 2ZD1B 4ZHRB 2CUYA 1KDHA 5F8GA 3DXJC 2IHEA 5J8YA 2XZWA 5A76A 1R9TB 2J9EA 3OBIA 1D09B 5ALPA 1ZPWX 4I7AA 2RRDA 2DGSA 3H7HB 3KHHA 4DX6A 2Y9TA 5AM4A 5AT1B 4ZCMA 3C2PA 2G0JA 3TADA 5D3IB 3IS9B 4DAYA 2ZXIA 2KT3A 3QGHA 3D6HB 2FJ2A 4LSLA 2OCEA 3A8JE 4DN4M 5B0DA 3UDEA 3K17A 3JSBA 3Q22A 3B0YA 1F9SA 2U1AA 4IUNA 5BR8F 1XNRL 3RG6A 4B9WA 1QQ6A 4OX9L 3SFGA 1WG1A 4J03A 4BXOB 1Y1VH 2XI2A 4OD0A 1HL6A 3QU5A 1KABA 3VAKA 1XPUA 2NXJA 7ICFA 1CC7A 1WEYA 2DRAA 3UDIA 2RKIA 1N36Q 2KJ5A 4C11B 1IBLF 3RJMB 1F2GA 2ASYA 2YKOA 4Y7NH 3ELHA 2Y0SD 4JI5L 2R8IA 2F9JA 2BKOA 1V1PB 5ELCA 3GDEA 3FUYA 4KI0A 2BRKA 4FXDA 2XICA 1QTMA 1V1QA 2GO9A 2F0HA 4KGZB 2NPFA 3J80L 3SQIA 4CLLA 5A35A 4DUZQ 3L09A 3KBBA 2F1FA 4EQPA 4XA5A 2LU2A 2GMLA 3W2VB 2QW7A 4JG2A 1FJGL 4JV5Q 5KFDA 2K3KA 2OT2A 4NA3A 3PSPA 3V6KA 1KLNA 3QR8A 2XY5A 2MSTA 4LFAQ 1OJ4A 2MO0A 2PEHA 1FJGF 5EN1A 1ZQKA 4F0HA 4JYAF 2K5VA 3QYYA 4PH5A 2O5IC 1P1LA 5AIBA 4P7VA 3MM7A 4Y2VA 4V1Ak 1GUTA 3UN2A 3D4RA 1JWMD 2CQCA 3IWLA 1OW5A 2BRLA 3MMCA 3T6JA 5DO2A 4B3SQ 1STNA 2QKIC 1LTSD 1NPRA 5HBMA 5E3RA 1U1KA 2GMJA 3BQ1A 2OF1A 2QCPX 3MAHA 5D65A 5ALXA 3QO9A 2BQUA 4R8IA 4WFXA 2WFWA 2FMPA 1VRTB 2QX0A 1WDTA 3TZYA 2TMPA 2ZH6A 1GMUA 3IRXB 2R7XA 1C2PA 1VIXA 4KR0B 1H72C 4J91A 2F3WA 2APOA 5ALLA 2ZH9A 5GADC 3BN4A 4YFUA 1KS2A 1GNKA 3KNAA 2HYIB 4U7UK 1X9WA 3TMEA 2B6AA 2CNOB 4BY7H 1WG5A 1R8HA 3CP0A 4NLBA 1LUZA 1S5BD 4ZOSA 4WKYA 5ALMA 3TUIC 5JXSA 4QZDA 3JPSA 5CAAA 3O3LA 3CCJS 3ADAC 2VKZG 1GMWD 4OO1J 4EX7A 4LZDA 1NY4A 1SC4B 8ICLA 2HAIA 2HWIA 5NUCA 2M8DB 4QJFB 1S77D 2A6EC 4HAIA 3IBCB 2JH3A 4TLRA 3CYMA 3IRBA 3S2HB 1TVXA 2FMQA 4G1IA 2YTXA 2JA8G 4DUYJ 2CWAA 3MFHA 3EPGA 3NGDA 4O2DA 1TV6A 2KHJA 4NXNJ 1OYDA 1BXNA 1TKTB 2JOQA 2X7IA 4FO6A 3VZIA 1NKBA 3OLAA 1RWXB 4IPDA 1PRTB 1U24A 3B8HA 1N5YA 3MAAB 1S6OA 4OHVA 3SAFA 2HMIB 2MQNA 1AUDA 2HHPA 4K4TA 2N3OA 4UQTA 2JVRA 1OYEA 2MO1A 2O2LD 3ER0A 4YB6A 3OWEB 3CCQA 1N32J 5JVH3 5T7LB 2DNCA 4IH7A 2AEFA 2QFJA 3SSQA 2VB6A 2ZBIA 5ALNA 3GIIA 7ICRA 4R1JA 2BJ7A 2F8HA 1VQKS 5K9FA 1ECWA 1RT2A 3CB4A 1C7YA 4KLFA 4I69A 2F8EX 2DNZA 3LX0A 1E6VB 2DGWA 4AD6A 1U6ZA 4P2XA 3HVTA 2E1FA 2W2MP 2KG1A 1U26A 4B17A 2ZZNA 1SB3C 4K4YA 1VK8A 2FZGB 1T03A 4GKJF 3PEJA 4UAWA 2DGQA 1R8PA 1L3KA 4DQIA 3HOUB 4ZLPA 4RQ3A 2HCCA 2O66A 4RAUC 2R93B 3DMJA 8ICOA 8RUCA 4QIGA 4C0OC 4A3IG 3M8PA 2B4PA 2WAQC 4IFDJ 3TA0A 1SE4A 3TVZA 3WX8A 5AKHA 2G07A 3CJ5A 1PJ6A 3I76A 5IOLA 3RMHA 4MMOA 4F8RA 1Y1WG 1J5EJ 2W9CA 4PPXA 3HFVA 1VQMS 4JVZA 1VYAA 4P4OA 3EDQB 3BZQA 3C6UA 2OUGA 2V9WA 1YZ6A 3ULPA 1BWVA 3FNNA 1XNQL 3VR4A 1SKUB 5FP0A 2V9KA 3CCRA 1X5TA 3EX7B 2RQ5A 3QWPA 1I94F 2ZM6Q 9ICXA 4GNXC 3G9CA 4Y2IA 2HRUA 2XMUA 2IHMA 4CKEA 4KLOA 4RPXA 4DV4J 2ZWOA 1XSLA 5D8HB 3CNQP 1DURA 1ZKOA 2RKSA 4GC6A 4JOIC 4KD4A 2F0SA 1JK9B 2JV3A 2QDLA 4MH8A 4AE5A 3K1ZA 3SEIA 1T95A 4G1QA 2PI5A 4JI8J 4PYAA 4JI7Q 2C2EA 2ILZA 4Y2XA 4M8AA 1MN9A 3BEGB 3AMZA 4K59A 5IT9L 4GS3A 3WK4A 1GXUA 2RDFA 1DLOA 3JAMc 3BF4A 1ZQJA 1RT5A 2V94A 2F4VF 4Q44A 3DM1A 4F26A 4WFN3 2BANA 3GTPB 2DITA 1Q53A 4OX9Q 3UNGC 3JAML 3M2VB 3M7DA 9ICCA 5C4XG 4JI2Q 1Q81T 2D62A 3T1HL 1JJCB 1PTOH 4KN4A 1DTTA 4NM2A 1HNWQ 3IDWA 3QUTA 1CJKB 2K52A 4MIAA 3PYGA 4MAKA 3CC4A 2J0QD 2RVJA 4P74A 1F60B 4UASA 3H2LA 3R2DJ 2Y8WA 3C3LA 2UP1A 3HFZB 5JEAH 4KC5A 1F5SA 2VQFL 2HSZA 3MEDB 3NPPA 4KQZA 1PCAA 3U50C 3M8ZA 3FQKA 3I96A 2J0TD 1QVGA 2GC8A 3HHLA 3RGIA 2ZJAA 4DV6F 4J9KA 2E2JB 3JXOA 3A1YG 5K8OA 1X3FA 4F5RA 3NQTA 5DBBA 3G86A 2XYGB 2KRRA 4X4VA 4DL2A 4A3KG 2L9HA 2XSFA 1PAUB 1JORA 4NLSA 4QY7A 2PW5A 1RA7A 1F2HA 2VA3A 5GAEU 2W8LA 3RJHA 3BDCA 4USUA 1UT8A 3RZDH 1ILPA 2IX1A 4RQNA 4QWAA 4P73A 1OPZA 5ALKA 1ZAXA 2KTQA 2J6SA 3J7AF 2QLXA 4MIUA 1AFIA 2I5HA 4RHSA 3DC2A 4DUYQ 2UUCL 2JA7G 5HMYA 5A2QU 5L39A 3TJAA 4DV0J 5C0XH 2A10A 1QVFR 4ZK7M 2Z8LA 3GLJA 2AQ1B 2JA8B 3L7OA 2QYGA 3KFWX 2EKYA 3OR2A 5AHXA 7ICIA 1WJJA 2AMCB 4LJXA 1X3PA 2A1BA 2HGLA 3H4DA 1FXDA 2HFSA 3MM6A 2ASBA 4CHTB 5H1SV 1K73T 3UDCA 1SZHA 3K57A 2ROEA 2BXJA 3ZD9A 2B7CB 4Z2XA 4RW7A 2JRZA 5CBAE 3K80C 2IDLA 3NCQA 2J9CA 3HHLC 3KKFA 2IL8A 3HM9A 1IM6A 1U2FA 4JPBW 3C15B 1HWLA 3CULA 3NGTA 5GAHU 1HJPA 2QF7A 3KLFB 3HP3A 2MY7A 3TZWA 2HGNA 1EY8A 1I4PA 4PZOA 1FXRA 5J2GA 4KLIA 2PC6A 2ZFHA 3TBIB 1HLWA 3VR5A 2I9GA 1EQQA 1A3VA 1X3GA 4X65Q 2SDFA 1HEKA 5EPKA 4JK1C 3JAMU 4I2QA 1L1OB 2KN7A 5I4MA 5ALWA 3SAGA 4C3IB 1GMVA 3K0XA 4OYZA 4YMNA 1JWSD 1CT1D 3M4PA 4R5PA 4BC9A 1IKVB 3HOXB 2ES6A 1HQEA 4P0QA 1BCPB 2MZQA 3WKBA 1CSQA 3CO0P 3UMBA 4DSJA 2ZH2A 1KN6A 3HHKA 1BCPF 1ZOLA 1TWCB 3KOJA 2HQLA 1RAIB 4KYZA 1ZQGA 1RIPA 3HS0C 3QFHA 3QNWB 5C0XJ 2DN8A 1RCVD 3GYXB 4DV6J 1DCZA 2KCCA 4DV6Q 2LKVA 4AXJA 2B0GA 4LWCA 1S9FA 2BJ1A 3KLHB 3LO3A 2MKCA 2NN6I 2HIYA 1HQEB 3K89A 3I0RA 5HP4A 4Y2MA 3W5XA 4OFZA 4F0KA 3WIVA 4OWXB 2B2VC 5G3LF 4K7QA 2XHCA 3RJGA 2RBMA 4A3BH 3EPIA 4USAA 3R3OA 1FA0A 2H3EB 3BYYB 4C7ZA 1S0MA 1ZQFA 1SSOA 2IAJA 4MFBA 2PIIA 1FDNA 5ELNA 5GQOA 2W2QP 4UB6U 2VQEL 4ZVTB 2EC2A 3HD1A 4BGDA 4XPEA 3NNCA 3TNVA 1GH8A 3DRPA 4C3IG 2RMLA 3WWVA 4KB7A 1SR3A 3L5KA 1SFOH 3VWSA 4I6AA 3I72A 2DYAA 3SI8A 1ACMB 3M05A 3UE1A 4JBJA 2D1CA 3HSJA 3HOUG 1KC8C 1FESA 1WC0A 5U47A 4GN4B 2F52A 4O42A 3I8ZA 4WZQA 3HHDA 5GADU 2UV8G 3IR7B 3RZOB 4OJPA 1NPPA 1FIQA 4U8VA 5DBAA 4F4YA 2E66A 2Q3PA 3QT8A 9ICVA 1GUOA 2DHSA 3QUBA 1SYFA 2XRQD 1RJTA 2B6GA 1YEZA 1WWHA 3CDAA 2EVBA 3LP0B 3ENVA 3TO8A 4OZJA 5B0GA 4DOAA 2YTVA 3P5BP 3CD6A 1LW2A 3OTEA 4N8OA 5J2QB 3R7NB 3D0GE 3R8YA 3M8QB 3F2DA 3PO2H 3HHNB 1MSGA 3LGHA 2GJ2A 4A3BG 2RAQA 1TUVA 2J76E 3T3FA 3K7RA 4FNFA 3CIZA 3KLRA 2F3NA 1IBKQ 1N88A 2OPPB 1Q82T 4MFFA 3UDFA 3DRRA 3NTUA 4ED4A 3N6NA 3VR3A 4LSZB 2HNZB 2VONA 2JA7B 2ZNYA 5J2FA 4O0AA 2XSJA 2CG4A 1R27B 4MK7A 1V3SA 4K0KF 5HR7A 3MEDA 1S5CD 1SYBA 1COKA 2R8GA 2CQHA 2LHTA 4LQ3A 3AA9A 1J2MA 2WF9A 4DLGA 4IG0B 3MPDA 5BOLA 1PZKD 3H0LB 5IE8A 1UZHA 3HF5A 1WD6A 5D4BA 1DRGA 2KB2A 3TUZC 4DU7A 2NZOA 1P1TA 3MCSA 1VDZA 4M8LA 4W90B 3AXMA 2BE5C 3M9BA 5AXKA 5J1EA 2LECA 3DRRB 1I6VC 4ZRZA 1UCNA 2HPUA 4NL5A 1C1CB 2L5YA 1S0OA 2XM3A 3IGNA 4P0PB 1CA6A 4KLUA 2W7PA 1I6JA 3SK8A 1O78A 3VZHA 4JI2J 4J9RA 3E8OA 4YUDA 4QIWB 4KY6A 3FMWA 3ZO7A 3FRYA 1RHJB 4NLZA 1K8OA 2KHVA 2KYXA 3UWTA 3TP6A 1LW2B 1AEXA 4HJ5A 1HR0W 4E8UA 4QNLA 4NXNF 4B3SF 3KJQB 2OIHA 4N8NA 3D6CA 4TNOA 1J