1Z4OA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-phosphoglucomutase
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 78
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4oA01
5AVXA 2QLTA 3A1CA 3WK9A 2WFAA 3WGVA 3SMVA 2YMPA 1KYTA 2O2XA 2P27A 2YMMA 3OCVA 2HF7A 3DNPA 5ALUA 1NF2A 3IJ5A 4Y2YA 5ALDA 4KN8A 1L8OA 1YS9A 1QH9A 3W5AA 2G09A 4CNQA 4FYPA 2HOQA 5IS2A 1T9ZA 5AVZA 2B8EA 3CNHA 5AKEA 3ZTWA 3KC2A 2JAUA 4HGNA 3UMGA 2HDOA 2IOHA 5AIAA 2GFHA 5AW0A 3AR2A 4F71A 5AKIA 3B9RA 1Z4KA 4PNHA 4CF5A 4C4TA 2YFYA 5AM4A 3VAYA 2VKQA 4G9BA 4AP9A 1YMQA 2AH5A 3GYGA 4Y2PA 1TJ5A 4UU0A 4JB3A 3EWIA 4OFZA 1U7OA 5ALNA 1CR6A 5AVTA 2C88A 2NO5A 2CN1A 4ZEWA 2G08A 3M1YA 2G0AA 4F72A 2I54A 1L7PA 5AVWA 3E58A 5AVUA 4XOUA 4Y3UA 5AW9A 3U19A 5ALQA 1YNSA 1YJ5A 5ALLA 2ODAA 3ZX4A 4GXTA 3MN1A 4IG4A 2FPSA 1Z88A 1TE2A 1Z4NA 1TJ4A 4UMFA 3AR9A 4BBJA 1TA0A 2HO4A 2YJ6A 5AESA 3IB6A 2CFTA 3B9BA 3WGUA 2FUCA 1IWOA 3EPRA 3FPBA 4EZEA 5AW6A 4IFTA 4BX0A 3UMBA 5ALVA 5ALRA 1ZD3A 2GMWA 3M9LA 1LVHA 3CZ4A 3I1YA 5AW4A 2AMYA 3L8FA 2PKEA 4I9GA 2RARA 3DAOA 2B1QA 5AKKA 2I55A 1RC8A 4DWOA 5AKJA 2R8YA 3E8MA 4CF3A 2MU2A 3OCXA 2BY4A 4RESA 2P11A 4UARA 3I28A 4ZEVA 1J97A 3FGOA 3NALA 1O08A 1Z5UA 3OPXA 2JAOA 3ZVMA 2YBDA 2YN4A 4QQFA 5AI6A 1K1EA 1VJ5A 3B8EA 3QUBA 3SF0A 3L5KA 4O8CA 4XQ0A 4ZEXA 1QQ6A 3ZI4A 1Y8AA 2OYCA 1RLOA 1T5TA 5ALXA 4MWOA 4C4SA 4Y2UA 2D2VA 1RKQA 5ALSA 1Z4PX 3SHQA 3SKYA 5AW2A 4Y2VA 1YDFA 3DDHA 3NANA 2C8LA 2DQSA 2P69A 4NV0A 3L1UA 3L8GA 3EF0A 1SWVA 1RMYA 3NUQA 3ZX5A 4BKMA 5E0OA 5AW1A 3R9KA 2X4DA 4OD0A 2ZBFA 1Q91A 4DCCA 3QX7A 1SU4A 3U13A 3TLMA 3HLTA 3QU5A 2IA5A 2HHLA 2R8EA 2O9JA 1ZRNA 2BDEA 3L8EA 2HF2A 3NAMA 4YGYA 3OCUA 3ZVLA 5AM5A 2C9MA 4UAVA 4Y2QA 3ONNA 3WK6A 2HI0A 4OHFA 4UW9A 3ZTYA 3RF6A 5AVRA 1ZS9A 1FEZA 3QUTA 5ALFA 5ALOA 3N1UA 3QUCA 3WKDA 3FM9A 3PDWA 1Z4LA 2GHQA 3ZVNA 2FPXA 1VJRA 4NFLA 2FDRA 5AKHA 5AKZA 3A1DA 5A3QA 3WKAA 4FE3A 2QYHA 3N5KA 1L7MA 4UAUA 2WF7A 4BX3A 3WKBA 4UASA 5AVYA 1U02A 4J2TA 2PQ0A 3PCTA 1RQLA 2B82A 3L1VA 1XPJA 3K1ZA 5ALTA 3ZWKA 3FZQA 3N07A 3L0BA 2G1AA 4MUMA 4HYTA 4EX7A 4UM5A 1RRCA 3EF1A 1WVIA 1YV9A 5AK5A 3DV9A 3ZUPA 2HX1A 2OM6A 1RKUA 4UMVA 3FPSA 5ALPA 2C4NA 1X42A 3D6JA 2R8ZA 3QU7A 3L7YA 1Z5GA 5AI0A 5AI5A 3SKXA 2BDUA 1ZOLA 2ZBEA 2NO4A 1MH9A 4I9FA 4CF4A 3BA6A 4KNWA 4UM7A 5IT0A 4HGRA 2CFSA 2PR7A 2RB5A 4B6JA 2IYEA 2I33A 3QGMA 2I7DA 2B1RA 3I6BA 2G06A 1ZD4A 3F9RA 3KBBA 4KX5A 4YCNA 2RBKA 2ZXEA 2EARA 3BWVA 2NYVA 4KYTA 4DW8A 4L6CA 5AW5A 3R4CA 3ZW7A 5AI8A 1L6RA 2IOFK 5AHXA 3A1EA 2FPWA 5AM0A 4BNDA 5AKLA 2FPRA 4Y2TA 2YJ3A 5ALMA 1EK2A 4FFDA 3PGLA 1ZJJA 4NAVA 4KNVA 3WKCA 5AK3A 2YMQA 2B8JA 3KDPA 4JDPA 2R8XA 2IOFA 2AUTA 5ALZA 5ALEA 3P96A 5A3SA 1U7PA 1EK1A 3RFUA 1AQ6A 2YJ5A 2WF9A 5ALKA 4QJBA 3E84A 4KX3A 2EAUA 4BEVA 1NNLA 5A3RA 2W11A 4G63A 3S6JA 4NWIA 2FPUA 1RMQA 1S8OA 4YIHA 2MSNA 1TJ3A 4UATA 1JUDA 1ZRMA 2FEAA 3W5DA 1Z4IA 5AVSA 3QU9A 2WM8A 2HCFA 1XVIA 2Q4TA 2Q5EA 3ZU6A 3NIWA 3QXGA 3U7HB 3ESQA 1QQ5A 1XP5A 3WK8A 3MPOA 5AICA 5T41A 3AR3A 4C4RA 5AKXA 3KOOA 4L6AA 3KD3A 5AKGA 2FUEA 1RLTA 5AM3A 1U2TA 2ZBDA 3AR4A 5JJBA 5AI4A 3L0CA 4J03A 1RDFA 5ALIA 2ZBGA 2YMLA 5ALHA 3ZWDA 3AR5A 3AR8A 3W5BA 3PGVA 4YCLA 1NRWA 1U2SA 3QNMA 2I34A 3R09A 4EEKA 3QU2A 1CQZA 1QYIA 1RLMA 3OCYA 2W4MA 4YH1A 3OTQA 2GO7A 4EENA 1S2OA 2P9JA 1ZD5A 1SWWA 4Y2XA 5IT4A 5AK6A 1PW5A 1VFPA 3QLEA 2G80A 2EATA 2G07A 5AVQA 3NASA 3A3YA 4DFDA 3SLRA 4H1WA 1ZD2P 3U7FB 5AW8A 2GHTA 4HGPA 4EX6A 4HAIA 5AW3A 2Q4RA 3NRJA 3UMCA 1Z4QA 3W5CA 3FVVA 4E88A 3ESRA 3I76A 3SD7A 5ALJA 1RPZA 2WF8A 2JGAA 4UU1A 3UM9A 1L7NA 2B30A 1L7OA 2YJ4A 1WR8A 2HEGA 4BNDB 3OCWA 1N9KA 4UMEA 2OA0A 4Y2JA 4CE6A 3WK5A 1Q92A 1RQNA 4OCZA 5AM2A 2FI1A 4GIBA 4AS2A 2WF6A 3U26A 5AKYA 3MMZA 4HGQA 1RKVA 5ALWA 3L8HA 4HGOA 2YY6A 5ALGA 4RETA 2RAVA 2JARA 1RMTA 5AVVA 3U7GA 1WPGA 2W43A 3MC1A 1Z4MA 1N8NA 3QUQA 3ET4A 3HYCA 3OCZA 2JAWA 5FP0A 1O03A 1QQ7A 3J7TA 3IRUA 2ZOSA 3L0YA 3WKEA 5AK4A 3WK4A 4XPZA 4AS3A 3KZXA 3N8GA 3N28A 1J8DA 2CFRA 3WK7A 4Y2SA 2MU1A 4NABA 4XE5A 5AI9A 3U7EB 3E81A 3ED5A 2I6XA 2OBBA 1WZCA 2WHEA 3QU4A 5AIBA 1LTQA 1Z4OA 2WF5A 4EELA 4BX2A 4Y2RA 5AW7A 4YIKA 2AGVA 2C8KA 4BEWA 5ALYA 1F5SA 3AR7A 3ET5A 2B0CA 1L8LA 1Z4JA 2HSZA 3AR6A 4L57A 4BYGA 4YCMA 3QYPA 4UMDA 1T5SA 5AM1A 2ZG6A
chains in the Genus database with same CATH superfamily
3W6ZA 4Q66C 3WGVA 2VCHA 3SMVA 1KYTA 2CD9A 2RDIA 1V96A 1LD3A 1TMKA 3K09A 1OFIA 5CDUA 1R5OA 2CF6A 4C78A 4OHBA 1U98A 4DA4A 4YUAA 1EZ1A 2K4PA 4EBDA 4OIFA 3PJGA 4LQDA 2O3QA 2GO1A 4ECXA 1GFIA 4WH0A 3RJZA 3W7AA 4CEIB 1K3TA 1J2TA 1KI1A 4DLSA 4RLSA 3QYAA 3AEKB 4NF2A 3MTGA 1KKMA 2NO9A 4LNAA 4M0CA 4PZCA 1WXHA 4QPNA 4YCSA 1KFBB 1GNVA 1GGEA 2RGXA 4R1TA 2NVBA 4PFQA 3NM5A 5AKKA 1OXKB 4GBMA 2Y6UA 4EJ6A 2FF7A 1TU4A 2OHGA 4DF4A 5K8VA 3DWIA 3DBHA 9ICSA 1YFZA 1HY3A 4BWGA 3OOJA 3Q5DA 1W5EA 5B7PA 1MQ2A 2WJ3A 1DIGA 5CCBA 1F9AA 2FHSA 4AXXA 1YR9A 5DRTA 1USWA 2X0DA 2ETXA 2QT0A 4BLVA 2I6UA 4MQ4A 5DPMA 1QIHA 3KHGA 4BB9A 4M9LA 2B2NA 1E2NA 1QQTA 1RHQA 3FHCB 3KKQA 3Q41A 4F97A 1KS9A 1Q22A 3C7DB 1EFVA 2XA1A 4Y6GB 2VIIA 4HNVA 3RPEA 2YWFA 1DCTA 3UATA 5MFZA 1GAJA 2NZVG 1PDOA 4TV9F 3QKSB 3RWOA 4JODA 5EQFA 3E70C 4COKA 4MGKR 1Z0DA 1QLNA 1JKXA 2G8NA 1QNLA 2ETVA 4ZOLF 2QROA 1C9KA 2WU8A 4HGYA 2X86A 2H31A 1OZGA 3AU9A 5KFWA 2HL6A 1U1GA 1ZQRA 3LLUA 1ZOLA 1KOJA 2ZTDA 4MDYA 3TANA 1GO2A 1N5IA 4Q82A 1FO4A 1WMEA 4V0SA 3PUJA 3B7WA 1ORTA 4JWNA 2G5IB 5LOVA 4LJRA 4RHCA 4LZJA 3CH7A 4AWXA 1M33A 4O2BA 4RY9A 2KFNA 4C8LA 4CJXA 3DBOB 2BGIA 4ALLA 2X0JA 5AOVA 2RI6A 3LUDA 2B3DA 3M82A 2G4LA 5HILA 2QI9C 3E84A 2J9FB 3ZWAA 3TUJC 1G1AA 4M1WA 1P7WA 4NECA 4ZIRA 4R81A 4NCIA 4RVCA 5IKOA 1B0ZA 1WSAA 1NYLA 4GMHA 4M83A 1KAHA 5L3RA 4RPKA 1T5LA 2TECE 5LMNB 2AZ4A 5KG7A 3RSCA 3S99A 3ZY2A 1C30A 4DE5A 3AJDA 2QTHA 1SKYB 3ZV7A 5CYGA 1MJHA 1D1TA 2C28A 4WLNA 3IMFA 5TMEA 4B8WA 4H1UA 4GMFA 2KSOA 3WYDA 1O57A 2NTEA 4XVRA 4DLNA 2P9TA 1JIHA 4K6HA 2ODPA 3O21A 2PSFA 1YZUA 1OQAA 1AF7A 4UAGA 2Y1GA 2XGPA 4MUGA 1IVNA 1Q1QA 1ODKA 1DMSA 2VZ9A 1TEVA 1TVMA 1CZUA 5F64A 1AURA 2YXDA 4KLNA 3GLTA 3IG8A 5J23A 3AL2A 4TLLB 3KAPA 2C7OA 2HXYA 4YXJA 1XQ1A 1VLBA 3NAGA 3LY5A 1Q16A 5AI9A 4JVLA 3ZCQA 3P2YA 3RLFA 2OBBA 1X1TA 4JC0A 1BS9A 3E8SA 3UB2A 1S3IA 4QDXA 3LO8A 1MIOB 1GGFA 3KTAA 4CIVA 3TSWA 5HRCA 3GV0A 3A1CA 2D0PB 2XWJI 4IIYA 1NW4A 3DZBA 2EF1A 1SC6A 3G7SA 3WHLA 5CBPB 2J45A 1ZH0A 3WYFA 4O2LA 3DOOA 1KSPA 3WLJA 5KWVA 1ML3A 3CV3A 4QPCA 4LWZA 1C0KA 4MKRA 1E1NA 4P54A 3DFZA 4I5EA 3DXFA 4L9WA 3LYSA 2HHAA 3ROPA 3AFHA 3RM3A 1KZ7B 4XX0B 1G55A 5CDFE 3ESDA 4JLJA 2O0LA 5FJIA 4YRMA 2L82A 4UD6A 2EQ5A 3RGGA 3LKDA 3PPVA 5DQHA 4I99A 3AVQA 3CHYA 4LHWA 2A6PA 4X6UA 2ZT5A 1I6MA 1M34E 3HWRA 3A37A 1PJTA 3K0CC 4TTIA 3JATB 4I8IA 2RRDA 3K0KA 3A4TA 2P35A 2IY9A 3EMKA 4X90A 2R47A 3CW8X 2PZ8A 1X7WA 4RX1A 3UXOA 5DNDA 2WJIA 5IILA 1PGOA 2KK0A 4NAUA 3JPNA 2AFIA 3LPNA 1YDFA 2BE7A 5HNKA 1ZK1A 3IN5A 3HR4A 1U0EA 3HUUA 4EBFA 4RQUA 2A0WA 1P3JA 4QXPA 1G7SA 2UUBB 1D2RA 2JA1A 2VQ3A 3L6BA 3ZVLA 2PS9A 3DAPA 3ETDA 3CFYA 1CRQA 4QU8A 4CODB 5GONA 1Z4LA 1XQYA 2YN2A 1EP2B 3DE4X 3TI9A 2VJKA 4XAQA 3UK6A 3AFNA 3DZCA 2O7VA 5EY5B 1ZN9A 2A88A 4IIFA 3TBHA 4MQFA 1VTKA 3EEFA 4RIGA 1ZI6A 1S7GA 1P7PA 2WLSA 2IYTA 3H1PA 4AL4A 1RLJA 2Y0SC 1KYVA 3EZGA 4LXGA 1W4BA 1Z2PX 3CU5A 4ELTA 3I6QA 4QEKA 2I8LA 4OREX 4ZYUA 2BVNA 1CFZA 3WC4A 4LF8B 2P9ZA 1FVFA 3UWPA 4TMFA 1BCSB 2HWYA 1JEQA 4HNGA 4BVAA 2C9BA 1MLDA 2W6MA 1CQWA 4GD3Q 3U40A 2QORA 3ZLVA 3WLPA 3S8MA 1E2PA 2W7TA 2A5FA 4I4IA 2XRYA 4JSTA 2I33A 1RT9A 2DC1A 3OD5A 2I9GA 4K86A 2DLCX 4F2RA 4JX9A 4EH1A 3AU6A 4YCNA 2QPAA 2GEJA 2CNBA 4YMVA 5DXAA 3K30A 5F4BA 1L6RA 2HJ9A 2XLCA 2AXTU 2Y1WA 2YJ3A 1I4WA 2PPLA 5AK3A 3LYAA 5CIWA 4R16A 3PW2A 4QJBA 1YONA 1SUAA 1CJMA 3WLQA 1V47A 1UPXA 2VWQA 3AY0A 7MHTA 3BMQA 1E61A 3GUYA 3W5DA 1DRWA 5BWBA 3O8QB 3M81A 1BZYA 4PX5A 4RULA 3LLCA 1P1RA 4G09A 1N57A 4EGSA 1E94E 4FLMA 1DBVO 2I66A 1QYWA 1NN0A 3D7RA 5E6RB 5THKA 3H2JA 1T9DA 1SBQA 5BN1A 4TUYA 2ET6A 4L4RA 1SHZA 1YIOA 4B9UA 5KT5A 2M6LA 2GS9A 4OY3A 3OA2A 3W0LB 3FLEA 1YJXA 2OESA 5JADA 1SBIA 4IWYA 1PEAA 3VOAA 4EMBA 3QVWA 3WI7A 4RHFA 1N1MA 4UU1A 2GAAA 3RKSA 1XAHA 5BYAA 3MS7A 2G1KA 1XG5A 1FJGB 2ZDGA 4FHZA 3LRXA 4IHQA 5D46A 3DO5A 1BCRB 4BIMA 4DTIA 1HYHA 2QVLA 1A88A 3TUIC 1H8EA 1EFLA 1ESMA 2QIOA 4BFXA 1SXJB 5TSDA 4BWMA 3EIEA 4GMXA 3CXUA 4G2TA 2KLBA 4UDNA 2LUOA 3RU2A 5LMCA 2JCVA 2ZE5A 1Z16A 4TLMB 5AOBA 1B8PA 4YBZA 2AQIA 1MO5A 4X1YA 3DFMA 3SHFA 3KTDA 2NNWB 3DV0B 1Z19A 2FSIA 4H6VA 1WMFA 4PBTA 2AJQA 4YRPA 4R9RA 1PO7A 2I62A 1TAQA 5IF3A 2Q2VA 1J2NA 5D87A 5JDCA 2JBAA 4GC6A 2PZJA 8ICHA 1G8GA 1Y63A 4MCAA 1XQ9A 4H3SA 4J49A 4YMSA 5AJXA 1FVXA 4YVFA 1XNHA 1MOZA 1R9NA 3LBHA 1HE8B 1P3Y1 2KHVA 2YW9A 1RQ7A 4TVOA 3OLWA 1KXJA 2MT9A 5ITWA 3U80A 2CVZA 4U7WA 4TL9A 4IG4A 4AUNA 2XKJE 1Z4NA 4Q12A 4XEHA 1L3VA 4R01A 1EFPB 3ZZMA 3ZWMA 4HI0E 3DBHB 4YI5A 4KE7A 4HCJA 5F51A 3PNQA 5EFOA 4A7PA 4FZ5A 2UVPA 4JI0B 2UVRA 1IN7A 3ND8A 3PVZA 5BR1A 5HA5A 3K4HA 4D97A 5IC4A 1M6HA 3ED1A 1UKEA 1ZVJA 4RESA 3EWSA 5KDLA 1XVAA 1ZHHA 5FUBA 2YN4A 1LJ8A 3DLAA 3H1TA 4D1YA 4BX8A 2C77A 1U5BA 4Q15A 1M83A 1H2BA 1TOAA 5L4SA 2P69A 5DXJA 1ZI9A 1L5QA 2PX8A 4LDRA 3VZPA 1FP4B 1SUCA 1LFAA 2CLCX 5E0OA 3R5JA 2IP4A 2NN3C 1Q91A 1WXEA 2P0YA 1EFVB 2ZVJA 3UENA 5DT2A 2GZAA 2PGIA 4P7GA 4UW9A 5BRJA 3MPUA 5HZHA 5K45A 1U2ZA 4M99A 3UA4A 3WYNA 2ZR8A 4M8LA 1Z68A 3LBIA 1CIPA 1RHJA 2PKCA 4HUQA 2VXBA 1NUAA 2GI4A 4AYTA 4KQ1A 4JLPA 5K6RA 3L05A 2RHOA 3L0ZA 3AV0B 1X19A 1ACMA 4QDKA 4ZWNA 3D02A 4BNWA 5E4JA 3H0KA 3AEVA 4J1TC 5ALPA 3TMKA 1AY0A 4S1OA 4PCVA 1SVSA 5KT6A 3ZYCA 2JPDA 1XT6A 3SJUA 4HWPA 5GWXA 3IX7A 2AIRA 1RM5A 3EGWA 2CHGA 1DBSA 3RJHA 1NBAA 5DRYA 1U0BB 1G18A 2D1TA 4AJHA 1SU7A 1ZD4A 2XOXA 3K4GA 4ZIRB 3D3WA 2Y2UA 3M2TA 2G88A 4TTRA 4KB5A 2Y99A 3GH3A 1XA0A 3O3CA 2X9NA 4TTQA 3FHJA 4CTJA 3L4SO 5JANA 2QD5A 5C51B 2FQYA 2C3MA 2XBUA 4Y1EA 4Z0PA 1PYGA 2E4YA 2P77A 4FNAA 2VJQA 1HNNA 2IJGX 2WA1A 3HEAA 3ONVA 4AX8A 3LXXA 2QUZA 3B36A 1YZTA 3CW2A 1HSOA 1Y5LA 3T06B 4DSFA 4RJ2A 4P84A 3SXPA 5A6VA 3H65A 5FI0B 1F7UA 2ZIEA 1ZCJA 3ZHTA 3KB6A 2QMEA 2WVAA 1SB9A 1QE3A 1ZH6A 2V5AA 3BQ9A 3G2PA 2X9LA 3SD7A 3KZOA 4NBRA 1DI0A 4RXMA 4JUFA 4B4VA 3ONEA 3CLRC 2PKQO 2W22A 3NTUA 3KKOA 3LY9A 1KTQA 3JASA 2VF5X 1WVMA 2OP1A 4U7GA 1FSGA 2PSDA 1N34B 3AHIA 2B1IA 4OTZA 3GLGE 2XB9A 3KTAB 4MUHA 1J5XA 3AERB 1TUGA 3MOIA 3BF7A 1T1SA 1F8XA 2C8KA 4D46A 4NJMA 2HSZA 4PAMA 5J2JA 2X1HA 2A94A 5F3RA 5AVTA 3I5YA 5AVXA 3ZXYA 3QIAA 3ABZA 3NXKA 2XVMA 4HN4B 4AYBF 2YZKA 4KN8A 1U2PA 1Z8FA 3LVFO 4U2BA 5D00A 2BISA 1ENOA 5DNCA 5EE3A 4W5RA 2XWPA 2QN3A 3OM0A 5T57A 3QBVA 3ENVA 2NX2A 2E21A 2AGPA 3C16C 5B55A 1EDZA 2XTZA 2PLAA 2ZUTA 3K0EA 3HRDD 4RVNA 2D1RA 1Z39A 1CEZA 4G41A 4QYXA 5DIFA 4DS5A 1SVLA 4KNYA 2D3WA 4MW2A 3KQMA 4F5QA 3ZWNA 1DC4A 3OKFA 2C07A 4M0UA 1ZVKA 4QZCA 5ICMA 2XE4A 1T9KA 5IEBA 2DH5A 2EKQA 5IT9A 1B76A 4PPYA 1ETHA 3OSUA 3H5AA 3M4XA 3M9MB 1GPBA 2AR0A 3CLRD 3ASVA 4JBWA 1W96A 1K4KA 5GY7A 4KXWA 4F2SA 3FFAA 5BNZA 1DAEA 1BPEA 3K1AA 1PBNA 5KJCA 2FE4A 5FEMA 4U0KA 3UAXA 1BWPA 4FCWA 3NTXA 3NDBB 1HEIA 5EXPA 2WYUA 1XV5A 3CKMA 2BEUA 3R7WA 1VHDA 3R7FA 8AT1A 3EFEA 4CTOA 2CB0A 5GONB 1M1ZA 1I5EA 1Y4UA 4EW3A 2XR1A 1SUPA 2ZCVA 3MZ0A 2UXDB 2QYOA 1ZW1A 2Y1IA 3UUEA 2Q5OA 4MQFB 5ETJA 1A8SA 1K7FB 2J33A 4QGGA 3GARA 4AULA 2AOTA 2ZJ8A 4OP3A 1OXMA 3OPYA 4BQSA 4YAJA 3A58B 2GHRA 2J9ZB 2R6JA 1SQSA 3AUTA 5JS7A 1E8DA 2XQIA 3LSYA 2V96A 1Y9EA 4B6QA 2PN1A 2VOEA 4O4JF 1JEOA 3UG6A 1I0ZA 5CW1A 2KHZA 1BEEA 4W7SA 5ESRA 2PK3A 3DTVA 1IIRA 4UAZA 2FW0A 2A5LA 2PRSA 1IHXA 1K7SN 4AMVA 4PN3A 1K9VF 4LBZA 2IBKA 4B3RB 8ICKA 4YRJA 2B1JA 1KN5A 3UN1A 4JLUA 3RARA 1NKVA 3WIUA 2JRCA 1KFDA 4ZI3A 3C2MA 5K4GA 4HGRA 1L4EA 1TLFA 3W2GA 5JYDA 4CM1A 1MT3A 3GNTA 3LDUA 1NF8A 4AM8A 1N7GA 5AXCA 3BMQB 1U0TA 5ISMA 3VVCA 3IUSA 3QVMA 1C2YA 4TSFD 1E3LA 2UZ3A 5KFIA 3RH6A 1IOWA 1TA4A 1YQQA 1KQPA 1R16A 4R0VA 3SFTA 3CZPA 3DLIA 5E38A 2P6PA 4FE4A 1U11A 2PY6A 3BXEA 4DHEA 4TUYB 1YJCA 3W5SA 4MQ6A 1SXJC 2K5UA 2CMDA 2F67A 1OUMA 1Q95A 2KQUA 2PX6A 4NZNA 4QA9A 1FTWA 4H6XA 1KDOA 2G9QA 4GWLA 2SNIE 3BXOA 4Q1VA 3T9EA 3E2PA 3ISCA 2C5BA 2IHYA 1RLMA 1R0BA 3RTBA 3WHKA 3O8LA 2P9JA 2QZ9A 3HQ4O 4OI4A 1JEYB 1RQPA 2WUVA 4KVZA 3AXSA 2V6GA 5AW3A 2E5FA 3RKUA 3RAXA 3DSRA 3KR0A 1Z6YA 2R00C 3QVSA 2HJGA 2CV2A 4Y2HA 1T15A 4RTSA 3AFOA 4E30A 3U2QA 4MNTA 2PWZA 2IPLA 4K03A 1QOPB 5LLTA 3OEEA 1ZAYA 4X1YB 3M1AA 2ZRCA 4JENA 1HQCA 4C4XA 2GQ0A 3PW5A 2TYSB 4NU8X 3VZRA 4A16A 4ZDIA 2J9RA 4MS3A 1DBIA 4X1OA 1E8MA 1TT5A 4GZ6A 1S7CA 2PWYA 1AN0A 3UA3A 1QRAA 2Z6AA 2C4TA 4YV0A 3VHXA 5KFZA 3O8OA 4D43A 1MENA 4MV8A 3T1HB 2MMGA 3CNQS 1I1HA 1DEHA 5AW9A 3KUUA 3C5GA 1YRHA 5JAZA 1HZJA 3VJLA 1WDKA 1PD1A 3ROFA 2E89A 1Q1ZA 1I14A 5HBRA 1W52X 2E8OA 4JEMA 4MWGA 1BA3A 4ER7A 4EHKA 2HDOA 3ZWBA 5MN5A 1ZQIA 4NMMA 1SXJD 3KUXA 3P1JA 4BLUA 1RR6A 1OWOA 2FHPA 3QVUA 2ATVA 2NO5A 4TMTA 2QMYA 1K06A 1QAOA 1VLHA 1EP1B 4EY4A 5IWAB 2J59A 1XL0A 3R7NA 2MTBA 3QNWA 1ZL0A 1VLMA 4CW7A 3BZBA 3BWMA 3K0CA 2C03A 2W6ZA 1Y6JA 4YMLA 2BGMA 1QCDA 3K1JA 4M37A 4DEYA 3IP4B 2VAVA 2OLJA 3CZ4A 1XWLA 1QV9A 1N2JA 2I4TA 4Z4FA 3EMDA 1QIKA 4XEUA 3N2EA 2B94A 3K8QA 2DFPA 3TZLA 2PUFA 4BV8A 5LLSA 4X60A 3MXTA 1K5DA 4QXOA 3LL4A 4OI0A 4RQ1A 2VDMB 1X87A 3EW9A 2V7GA 2OYCA 2IZ0A 3TIXB 1Y3HA 4ZMRA 4TV8F 2ACWA 1I1QB 3TOCA 3QMMA 2CD7A 3BGVA 1F0MA 3MWDA 4OQYA 4ODIA 2ZB4A 4B6EA 4QZFA 3C6BA 2QNRA 4DCCA 3NT2A 4B3IA 4HUQB 3SZGA 3J81k 3DDCA 3M3DA 4GUAA 8ICCA 3CPHA 2JAPA 1AQYA 3IQEA 3M5CA 2DBYA 4ESHA 2MJLA 4MWTA 5JI3E 4TVKA 5BSRA 1YB7A 3V6HA 5K0TA 3GEDA 4I1UA 4DQSA 2HNAA 1XDUA 4O9MA 4E1BA 1YRYE 5CNJA 5ICEA 2G04A 3IVAA 2AW5A 1RW4A 3DXYA 5AXAA 3VZCA 4DXDA 2CJPA 3PZRA 2FWAA 1FUUA 5FBZA 4NK5A 2GPSA 3OD1A 3M3HA 1DFHA 2PMCA 3BJYA 3P9NA 4HKTA 4CGYA 3AK4A 2RCYA 5K03A 4DLAA 3D3WB 2RGBA 4Q7JB 1E79A 4H3HB 4YECA 1ISRA 1E6UA 3F4BA 2CFOA 3G5AA 1EK6A 5HE8A 2XGOA 3MUOA 1J7KA 4KBYA 4YROA 4D57A 4NE9A 2R68A 3KQKA 4H7EA 1ZMXA 2GLTA 4HYKA 3KZCA 1SA0A 4WFJA 2IOFA 3PNYA 3KJGA 1AQ6A 4OP2A 1GGMA 4RTMA 2PQMA 4G23A 4U5QA 1UODA 3JQ7A 1FRZA 1P2FA 4JJKA 2ZBRA 4W9NC 1KPIA 2J8ZA 5KYGA 3DEIA 4YV7A 3LDAA 2Y9MB 2ZIWA 1CUUA 1GFSA 1KNXA 3KKKA 1JEDA 1XCJA 4OHUA 4PO8A 3FTCA 2JHDA 3SC2A 3MBYA 2NRWA 2EZXA 3WBJA 4K9KA 3SBXA 1PWEA 2GO7A 3EZ9A 1T9CA 3B89A 4YMMA 4PW0A 4TWRA 3BGWA 2X8JB 4Z3KA 2YJGA 3JASB 1UBFA 3RHFA 5D84A 3VH2A 1FJ2A 1IXSB 3GGPA 3FDSA 3JARA 4CDGA 4OA8A 3CCCA 4C30A 1QGZA 4OHYA 3AIIA 4HFRA 4HGOA 3N2NA 1LX6A 1WS6A 2IZ7A 4P4OA 2XODA 1RAHA 3FHOA 3Q3CA 1MP0A 1BEZA 4I4CA 4AZWA 4TKLA 4IG9A 1B8OA 3N3AC 3AEKA 5F2EA 3QI2A 3EIXA 1VBMA 5B7QA 4LAFA 1K2WA 1GUYA 1I51A 4ZGBA 4QXRA 4DZRA 4L6IA 3JAMA 5J2IA 4MA0A 5BW4A 2HTFA 3UJHA 3PNBA 4JP3A 4DCUA 3DTNA 4G8JA 2G72A 1JE1A 3BE8A 3KWMA 1TL7C 3OJFA 4I2AA 3F6BX 3UJAA 3H5OA 2RHBA 4U02A 1W1WA 4AKEA 1NIJA 3PSPA 1IWPB 3HB4X 5A3JA 4QHSA 4QFDA 3KL2A 3KQQA 4DLZA 4AQ7A 2GASA 2ZXFA 2YXBA 2EDAA 1T8PA 3B53X 1K98A 4O0IA 4Q6BA 3WBKA 2IIPA 3GEHA 4BP9A 3Q9UA 4CU2A 1A69A 2BFCA 3MJVA 2B4QA 4RD2A 4OLBA 3OFVA 1SKWA 5A02A 1R50A 1H8HA 3JD0A 1QO0D 3LGAA 1X1QA 3N2ZB 3C1OA 2P6MA 3W2FA 4EECA 3NRZA 5DULA 1IEXA 4FYVA 3K1AB 3STWA 4PU0A 2WD8A 3DOCA 2C29D 3V72A 2CLEB 2D1SA 2EAOA 2KICA 4US2R 1D1PA 2W2MA 1RXVA 1XU9A 3G85A 3E6AA 4ZCMA 3ORRA 5H02A 1DZIA 4NONA 3OCXA 4OJ6A 1C4KA 3R7WB 4M1YA 1N92A 3G9XA 1SB3C 1R5NA 5FV7A 2IOYA 1PVOA 5EZSA 3TDNA 4M3NA 3S8EA 1X86B 3LIPA 1XDZA 4YAUA 2JFVA 3GUVA 3SHQA 1XIVA 4CKCB 4Q34A 1PP4A 2A58A 1D5WA 3OPYB 3L1UA 4DC9A 4Z3OA 2PUDA 4JV0A 3DW3X 1M6EX 4EW2A 1GU1A 2N3ZA 3OMWA 4K6CA 2P30A 1E9SA 3U13A 4BQFA 4UZFA 1XLUA 3Q88A 4YXMA 1YB5A 4LHYA 4JMLA 3AHDA 5DN9A 5ALOA 3WKDA 2Z58A 2J9FA 2QRUA 4IRKA 3C3MA 2CVQA 2OSBA 1JSZA 3GJ7A 1GIAA 5BUZA 3DTVB 3ZDZB 4PYMA 3IQXA 5HIKA 1L7MA 2NPIA 3CINA 1THGA 4TXHA 5KYTA 4AJIA 3VBEA 2PD3A 3H0MB 4OLHA 3KS9A 4OYHA 3GFOA 1WY7A 1LJUA 4FPXA 2ZUWA 1YS1X 4DZZA 1NDQA 4L50A 2J3LA 1WVIA 3GAMA 3C74A 4OMCA 1QGED 1PFKA 4LYGA 5AR1A 1GZVA 5EZ5A 4ES6A 5I7WA 1I7SB 3P0FA 1XZCA 2X2PA 2OHJA 4CKXA 2VP2A 1OH6A 2F1HA 1A7UA 4KFUA 4EATA 2XVXA 2HXGA 3EG9A 5FUWA 3ZLUA 2CXOA 4MCHA 3EIOA 3GFTA 1PJ8A 3CEMA 3A1EA 4C1NA 3D3JA 4IZOA 1UUFA 2XQFA 3S4YA 3A9CA 2ZXHA 1YCGA 2A33A 2ZI7A 4B4DA 4AVYA 1B14A 2L18A 4ZDWA 2YHBA 1S8OA 3JD2A 1PR1A 1E5VA 3L8DA 1QQ5A 1N5JA 4E13A 2PXXA 4YAOA 4JI7B 4ECQA 2C4MA 1QPGA 4QFMA 3I23A 2B2XA 5C2JB 3MG9A 2UYGA 3PPIA 2H5EA 1OB5A 3CUKA 3VNRA 5G0WA 1CUFA 3HO1A 1MIOA 8OHMA 2FWNA 5AO9A 4ML3A 1KYWA 4C7KA 5J0RA 9ICGA 3IP6A 1C1DA 4KMOB 5CBPA 2EZ4A 2BPOA 4PG6A 4G2NA 4R41A 4J9KA 2P2YA 4FBTA 3OZXA 1I10A 3UWMA 3RQIA 5H4GA 2VSFA 3L7JA 1QZ3A 3D2SA 2AN1A 2BFOA 4HXEB 3RC7A 2RSLA 2X42A 4YBRA 2GWSA 1A4UA 3FBGA 4MS3B 1TT5B 1FFCA 2JARA 4XX0A 2UDPA 3HI6A 3WOHA 4IXTA 3EYAA 3VHXB 3O8OB 1QC5B 2Z5FA 3A7EA 4QVIA 4ECWA 3K9HA 1PJBA 4ESEA 3VGPA 2P7IA 3F6EX 1U47A 3ORQA 3MD0A 3JATA 2QJWA 3P9ZA 4NC9A 3FWKA 2LPMA 4ECRA 5LJIA 1F5SA 4MHSA 3L84A 1ZQDA 4AX4A 4BIIA 1H8ED 2Q1SA 4NXMB 5AM1A 1X66A 1PNRA 1NI3A 5I7EA 4V0RA 3PZBA 1FYFA 2EG9A 5CVTA 1VZ3A 4DL3A 2O2CA 4WZBE 1KKXA 4P2HA 4QBTA 2BSAA 3KJEA 3PB3A 2GPYA 1UZLA 4YDHB 3WL3A 5IBPA 1SURA 4HMPA 3GJRA 2NM0A 4CTNA 2YIVX 1I4DD 2MCFA 9ICKA 3TBFA 5FI5A 3CT4A 4GXTA 5BUSA 3GVHA 2GX6A 1G3IA 3DONA 3IALA 3VPBA 1QANA 1DOZA 3STVA 1T2DA 2GJ9A 2R2AA 1U9CA 3TR6A 4MVJF 5H4HA 4C0XA 3C98A 1I36A 1S76D 2E4ZA 4NX2A 4UCXA 2FGKA 4GZMA 2ZPUA 3H9GA 3FGOA 3ZZNA 3MWDB 1Z5UA 2YBDA 4Y9TA 1U3TA 4HS9A 3ZI4A 2P4EA 4ZQHA 4RTKA 5HK9A 4LQ4A 1WZIA 2Z1NA 1UFOA 3ANLA 5BOLA 3TAXA 1A5TA 1JHXA 1E3IA 4F5DA 2XTMA 1FQWA 3OC0A 2R6AA 3LYLA 3SF8A 4EY6A 3KR1A 1E6WA 2FUG1 1WWKA 4FYMA 4K9DA 2AQ8A 4O29A 3LCCA 1E64A 3LC1O 4KQXA 5CB0A 5K0BA 3KJFA 4WZAE 2IYFA 2O9JA 2GK6A 3BB4A 4QTXA 4UVIA 2GPAA 3LK7A 4MJLA 1AG9A 1Z63A 2UVQA 2BAGA 4A2QA 3FYSA 3S2GA 2JCXA 2KKPA 8ICUA 3DLCA 4A8TA 1M8KA 4JN6B 1P1JA 3QPUA 4X93A 2Q5HA 3E61A 1UBNA 5J5VA 3O8QA 1Q0QA 5J0UA 2OMEA 2VI5A 1ZA1A 3JRXA 1PS0A 3MAJA 5JI2E 3L49A 3NO4A 3DE3X 4RQBA 1R6BX 2Q9UA 2AEMA 3R6LA 4M9JA 1RAAA 1SHJA 3ELWA 2OFOA 4I1VA 4DFKA 4M60A 4D3XA 4PZ9A 2EFEB 2FVXA 2RK3A 1IXZA 4HAXA 1DO0A 2DT5A 1NQOA 1VPTA 1G3MA 1QP4A 3H04A 1X1DA 1WTCA 1ESCA 2MDTA 4UEWA 2KKVA 4DW8A 2BLLA 2GCPA 3JQ7B 4GFJA 5CT8A 1GITA 2PLRA 1EA7A 2QG4A 4Z1OA 4YMUA 4YUXA 3EZNA 2AUTA 1BCRA 7ICUA 3RFUA 1Z38A 3WNCA 3UV6A 3BCSA 2K8BB 2PKRA 1SXJA 3GVIA 2XITA 2H9YA 2IZZA 1XB2A 3AGPA 3E9CA 3KOZA 5JY6A 5HBGA 5HCUA 3AYZB 4I27A 3OY7A 2M6KA 2R6FA 1GYRA 1T6NA 4NU5A 5DM2A 4F5OA 4XRHA 1MQ8B 3UJBA 2IXEA 2X22A 3EVDA 2HK6A 5JS1A 3DV0A 1EDDA 2GVZC 4UM9B 3NM6B 4WNYA 3JARB 4UVHA 1NMQA 5CM8B 5KTRA 4JJ8A 1UCFA 4XIYA 3V4OA 721PA 4A82A 5BWCA 2WYOA 4GX1A 3KB1A 4FGLA 4BNHA 2WAAA 4C04A 2R00A 1SH7A 4LG1A 4KPUB 1TTQB 4DR2B 1Z83A 3RUHA 3C3EA 2YWHA 2K2WA 2HSWA 5DTEA 3RIMA 5C1OA 2ZW9A 3OBIA 1CUAA 3OCWA 1GRVA 4BKUA 3OHMA 5FWYB 1S3GA 2NZUG 4KGZA 1SKBA 1E7YA 4KLAA 4EA8A 3LM8A 1M1NB 3ET4A 3OJ0A 3VH4A 4E11A 1JLSA 1RYYA 1GO3F 4ETIA 4ZVRA 4DSAA 2BWJA 2UAGA 1EFPA 4P4NA 1ZGBA 1LPBB 1WD7A 1H0HA 2Y6VA 3PITA 1Z1BA 1NW9B 1SD1A 3SZ2A 4TS4A 3PF8A 1UF9A 3RH0A 5FV4A 3HN7A 3IDAA 1I5OA 4C5AA 2DL0A 3IBGA 4PC7A 4OAQA 3EULA 2CXSA 1XCMA 3NBFA 4MKGA 1FPQA 1NJZA 3AQIA 3U17A 2BFCB 3OG9A 4OQLA 3ZHVA 1L5YA 1TO2E 2O7NA 4RC9A 1NR5A 3Q2OA 2R1UA 4GYKA 2HOQA 1BO6A 3TVYA 2CL5A 1XAIA 1L1QA 4L9RA 2EFDB 1FP4A 3AF0A 2D0OB 4BV2A 2H1IA 3B6MA 1IM2A 4ZEWA 5L1JA 4BRWA 5T64A 1KZ9A 5BUQA 3RLIA 3ZX4A 3H0RB 2ZIVB 1A2QA 5ARCA 4IFEA 4AUEA 1OYWA 1G8AA 4RGYA 2MSWA 3CGGA 3W3AA 4UAYA 1ECJA 2JHGA 4X44A 3STHA 3LIIA 2WYIA 5KFKA 3I9OA 2C2KA 1NNI1 1XSNA 3H3XA 4PCLA 2OUKA 1NVFA 4IPTA 2Z57A 1RRKA 3N97B 2A9PA 2UZ4A 3E18A 4M21A 3I2HA 1MT0A 1SQ6A 3EZ7A 3KYDA 1GDHA 1NVMB 3LSTA 3DL0A 4QICA 1A72A 1CUCA 3E3NA 4QW9A 4H1HA 1AGXA 3PX7A 2R6HA 3MOSA 1XJQA 1KE1A 2QQEA 1HDIA 3BS4A 3S2IA 1AQLA 2JF0A 4BNXA 1IY2A 2RJOA 1M2WA 2Y27A 1YFLA 1YVDA 1AZSC 3MT9A 4V1CI 3VNVA 2IYAA 1KMHB 3SIWA 2ZBUA 4F4XA 3RSGA 4I1PA 4DL9A 2QMUA 2KJ9A 1VB3A 1EJBA 4BUJA 3AOGA 1Q3HA 3SSAA 4EZ6A 3FSGD 3C5HA 3KQHA 2QRGA 2WK1A 1DK2A 3ZV6A 3EG9B 4YB8A 2X5OA 3GVCA 3QRWA 2JR5A 4F93B 3OIFA 1JTFA 2E5WA 2C9CA 2JFWA 2Q7OE 5HDQA 1U2DA 1UKAA 4B6JA 4J3NA 2RP5A 5U4QA 4J0GA 3M5PA 1A0PA 4G25A 5FYQA 1WY5A 3DTVD 1IY8A 2C99A 1AUOA 1I7DA 5DBBA 1DKRA 1PJ2A 4RNNA 1HT3A 4Y9UA 4AIIA 4LQLA 4W9NA 4D9MA 3FG9A 1CDZA 2R62A 4ZOCA 1KK2A 4L4ZA 1JUDA 1BXZA 2UVWA 2AUNA 4BZQA 1NK4A 2VR1A 3B1JA 2HDNB 5T41A 4R4JA 5IKEA 4PZ0A 4PGQA 4GP9A 1VP9A 3AERA 1C1DB 3A4IA 4GZ3A 2CCKA 1QO0A 3DOFA 5CB1A 2C61A 1W85A 4EL0A 3BT7A 3FRJA 4AQDA 3HADA 3PT9A 4I6GA 4IIJF 3V4ZA 2JD1A 3FVWA 1R4MA 2OB2A 4TRJA 1AQJA 2D2FA 5B1EA 4R1LA 3QEKA 4YPFA 2OBNA 3CURA 3N9IA 3CLSC 4HGPA 3V97A 3UJ9A 3CCBA 1T5HX 2BE9A 4D41A 5C34B 3USZA 3ZIDA 4J9VA 3ALRA 4N8DA 1GLNA 5H81A 3I5UA 5J4LA 5AKYA 1ZJ6A 4XW2A 1Y4ZA 1HFEL 2EQAA 2YY6A 1PGPA 5DX0A 2JI9A 621PA 4KV7A 2HBMA 4XWWA 5DH9A 3GRYA 4QZBA 2ZWPA 2BHTA 4DQQA 3P9SA 3UAGA 4AUKA 3TLKA 4ZEMA 3JVVA 4KGVA 5DQGA 4EHNA 2AXNA 2QBYB 1BRMA 2J6HA 4TM8A 2JIQA 3SQDA 1DCKA 1E6LA 3MQ4A 2ZCJA 1AHHA 1JA9A 2XICA 3ZIUA 5HF9A 3SHVA 3OEED 2EL7A 4U6SA 4NJ8A 3BMOA 2G1PA 4JI6B 3GT0A 4AP6A 2C9DA 2QRLA 4YX9A 3WP1B 2WG1A 2ACEA 1Q11A 1EB8A 4L8GA 2O7SA 1KRPA 2ZJZA 2FZ4A 2AUMA 3LT4A 4GMKA 3RE1A 3MJ4A 2NUBA 3AX6A 1BVSA 8ICPA 1IB6A 1OSNA 2ONYA 2PL1A 8ADHA 2AL7A 3T5BA 4ZK6A 1ZQPA 4YCDA 2RC6A 1L6IA 3ZE8A 1TK2A 3CZQA 4N0EA 4HTAA 2WAMA 3HDJA 3PQDA 4FB5A 4K9LA 3VO2A 5C46F 3QTLA 2Z1MA 3OI7A 5F3XB 2C84A 3CLSD 5AD1A 3ZE2B 1RYDA 2ZRNA 5CLQA 1XCPA 2BGGA 2BDPA 3NOQA 2V7BA 4WXEA 3HTXA 1EGMB 1EX6A 1L5ZA 3IT2A 1KNQA 4U2CA 4EA6A 2CF5A 5C5DA 4FEYA 3W7VA 3MRVA 1XQXA 3SF8B 2VH2A 2Z2JA 3ETGA 3KOUA 4RPIA 4IS2A 1ESEA 1QHGA 3EZYA 2P4HX 3D3QA 1P31A 1M2JA 1YRQA 4M8NE 2GK7A 4KZPA 2D8CA 3AN1A 1TVKB 2LBOA 4UUQA 4TZTA 3TJMA 3EEIA 2IS2A 1LWOA 2B7LA 5DKWA 4RGQA 5E1OA 4I28A 2H7CA 1ZGGA 8ICEA 6AT1A 1UZNA 3L79A 1SOWA 3MQ2A 9ICVA 1L1RA 1X6IA 2MSDB 4OD0A 3HXLA 4X66B 5L53A 2H2WA 4LVSA 5JAUA 3RJIA 3SSNA 1SVKA 2XDWA 2KEYA 5DWDA 2JLXA 1M8PA 2WFLB 2Y9PB 4OHFA 4RNMA 2ZSJA 4P3OA 3ROZA 1V0JA 4OHVA 1CX9B 2NU8A 3V1YA 4OKSA 3PDIA 4JHXA 1KGSA 3TOVA 2GGSA 2W9BB 2XI4A 3ZGVA 5B7NA 4I46A 3ZWWA 1WG8A 2MUTB 4L1KA 4OK6A 2YX1A 5EIBC 4FHCA 2ZSIA 1FFHA 1E2BA 3QLVA 3LUFA 1D4OA 2IHZA 5F98A 4MB0A 3GDFA 1C0LA 4P7BA 3QU7A 2FWIA 3K9CA 4GM0A 2BDUA 5C1BA 3ZCPA 5KJ1A 4LDNA 3G9TA 1SHKA 4L8LA 1JEYA 4ND8B 1WUHS 4KQCA 1WPQA 3HXQA 3OWOA 3OFJA 2XRFA 3JWEA 1JN0A 2GETA 2NYVA 1X7YA 3B85A 1Q3VA 2QN6A 5JS8A 1IQ0A 3WLLA 4U8GA 4BJ6A 3S3TA 1DWPA 3R7SA 1WB6A 5GJWC 3PW4A 1V16B 5JYEA 3Q8MA 4GX0A 1FSSA 4LZWA 4ED6A 3C1UA 1E79D 4TT3A 1Y7TA 2IPMA 3RS3A 3K6RA 2FPIB 1ZK0A 3OJSA 5ADUS 4H2DA 4F85A 1HRKA 3ZCUA 2WW8A 2BPCA 1RYHA 1NQWA 5HGXA 1JILA 5FOQA 4EHAA 1NW5A 1Z7YA 3GVPA 3TR0A 2Y66A 3ZEIA 3QENA 4EEKA 2QMZA 1XVLA 2IXAA 3PHGA 3HL4A 3LI2A 1CRLA 4EENA 4RDXA 3EPIA 4IIBA 1AM4D 4UPEA 2P9HA 5TGDA 5CFMA 1MO3A 3H5NA 4WBNA 1PT7A 5JMPA 2E6KA 3CF4G 4R05A 3KFXA 1TO6A 4CFSA 3SICE 5EMLA 1L7QA 5F9FA 2SICE 3TS1A 5L1KA 3HT3A 5EIBD 5J3JA 1SOAA 4II3A 3RIEA 4NDNE 5IHXA 1XVTA 1GUBA 4R8RA 3FMPB 5AP9A 5HZKA 4ZCTA 3KR2A 2F4VB 2EHJA 2WUDA 2XWQA 1QCKA 2RQ5A 5B4TA 4DV7B 4LJYA 5BXYA 3PHCA 4UM9D 5AOCA 4LDQA 2YXPX 3ONDA 3UQ2A 5HUJA 2P6OA 5A4AA 5K0NA 4ENWA 2Z6QA 2ZKIA 4I8XA 5EN4A 2QKQA 1VP3A 2GEKA 3C3AA 3HZZA 3O83A 3KFUF 4V3BA 1NK0A 1U8CB 4HD8A 2F3QA 3W9UA 1Q5PA 3O0TA 2NIPA 5TV2A 1SEVA 4N76A 3ZTWA 1EWQA 1XZNA 4EW1A 1D2MA 1VLZA 4YRFA 5DHPA 2XOKA 1Y8CA 1X8KA 3N8NA 2DUYA 3SQWA 2FXIA 3RSOA 4RPYA 1E9RA 2C9OA 5GV8A 3AI3A 5T5QA 1SC1A 2C92A 1BYUA 2XUQA 3H1GA 1FUIA 1PR9A 1PYDA 2QRHA 1YNSA 1BN7A 2JH8A 1JFTA 2BZFA 1DKLA 1KH1A 2QE7D 1SQ0A 4IEIA 1IG6A 2B4YA 4DFPA 3DO6A 2RD2A 1XXHE 3LAWA 5JAHA 5B58T 2UU9B 4P5DA 4CLEA 1LDBA 3C6QA 3F2DA 2W6CX 3KYDB 3X1MA 5KJ6A 1ONBA 3SK0A 3G8DA 5J4KA 3W5VA 2XLBA 4L7VA 4DRXB 5D1HA 1H8HD 3LUGA 4F8JA 4EFDA 1K5PA 3EVAA 1GNQA 2JCGA 3NWEA 4QTYA 4J90A 3DMTA 2HV8A 1FFBA 1OLUA 1T1RA 1ZO8A 3HNPA 3EWNA 2F44A 1I9GA 2CXQA 3SR4A 1YASA 3TIIA 1FB5A 1ZONA 3FTEA 4F3RA 1MOSA 3IPLA 4OSPA 5KQSA 3OLVA 3QX7A 2BFNA 5BN5B 4JL5A 2W4QA 3RIXA 1UC9A 1DU4A 4GC7A 4E7PA 3MB5A 2LP4Y 3KWFA 3NVZA 2RGCA 1R0CA 1G8MA 5JMWA 3QE0A 3PR3A 1GRCA 1VIAA 5B1YA 3FSJX 5DHSA 3TFSA 2DUWA 3TACB 1Y3DE 1YB2A 4DIBA 5LMZA 1HDEA 2X0FA 2G0TA 3FCAA 1SIBE 3CG0A 2C2YA 4J9PA 3NT5A 4A8PA 2H1CA 2H2IA 4IKEA 3N07A 1KH3A 4E03A 2GLUA 3INNA 4JLWA 8ICAA 4RHTA 4HS4A 1T4CB 3RTAA 3MSXA 4FFSA 1X42A 4DOMA 3GELA 3VR1A 3WLEA 3STYA 3A32A 3UBMA 3KXLA 2ODEA 1U0OC 1ESDA 4I4LA 6ADHA 3QHQA 2X8JA 3EAQA 1ZM7A 3FDIA 4E51A 1ZJYA 4YJFA 3VFDA 3ZDRA 4ZV9A 4CM3A 3RUEA 4RHXA 2BFDA 2PIAA 4D2IA 3WHIA 3CB4A 3LKBA 4ZT2A 3FTNA 5C5EA 2O48X 2YTZA 1OLSB 4N82A 4MF8A 1H3FA 3TSOA 4PGGA 2D5AA 5BWMA 2IEIA 4DT1A 3G3EA 3S6JA 4H59A 3EGXA 2YS7A 1W85B 1UZUA 3TCNA 4RTRA 2Z6UA 4RY0A 3X1ZA 3C8MA 3BHJA 1OREA 4I2NA 5K09A 1R4MB 2P5SA 5B6IA 1AV7A 3WLRA 3G2MA 1IAVA 4IVQA 1YK1A 3NM4A 4G9EA 4PG5A 1NJ1A 2Y93A 3KD3A 3K5HA 4GOKA 3KP1A 1B93A 4E46A 4N48A 1E0JA 1AKWA 3HBNA 3MJTA 1OY1A 2QQFA 3O84A 5KL8B 2JGIA 3BCUA 4MEAA 5KHAA 1ZD5A 1AZWA 3HYLA 3WGQA 1Q2XA 3U4GA 3ROTA 5A0LA 5ICCA 4EX6A 3MGGA 3WMRA 2FOXA 4CMAA 4E32A 4UNNA 1ZSVA 4B9VA 1NSYA 3LJKA 2NO1A 3ABOB 5JSZA 3IHWA 4XIGS 4KPYA 2VTBA 2R11A 2ZOSA 2DAPA 3K9QO 2CLSA 1E6MA 1LGYA 2IW1A 2W2QA 3BMOB 3UHOA 2NGRA 4YQWA 1NW8A 2PYDA 5LUBA 4IH4A 2J09A 4FT4A 2CZQA 1FDIA 1AT1A 3SGLA 4BX2A 3ZHCA 4JLAA 4L3VA 4ID3A 1L8LA 1E59A 1H1DA 4JQOA 4ERXA 1YQWA 2VQFB 3LNCA 3K9BA 2CVHA 1C4WA 4DLYA 1Y3BE 5DTQA 3OX3A 3PMLA 3NVDA 4KPGA 1G2QA 2DHEA 2PIDA 3JX9A 4YD2A 4RPJA 3JPOA 3CZMA 4ESOA 4PC2A 3QG1A 4CKCA 3FSGA 4B9LA 1XU7A 3B2EA 1Y9JA 4Q1CA 4UPDA 4QHTA 1N62A 5HFNA 3R76A 3OZDA 4OVKA 2VQSA 4MV6A 1S5PA 3H42B 3HO8A 5GVSA 4NR0A 3KZIU 1NK8A 5BNWA 4BASA 3KG2A 1RKBA 1N5KA 3GJZA 1AMNA 1T0JB 2YWEA 2VDWB 3WGUA 1G16A 3NBXX 2Q9BA 4NCXA 5DEOA 3M6VA 1RM0A 2G5TA 1H66A 4FQ7A 3DAOA 5HUQA 2O3TA 2GSDA 4A5OA 3AQFA 2B5VA 2AFIE 1I1NA 4TL6A 4XVUA 4PQEA 4Z4CA 4XB2A 5DHTA 2ORED 3AVYA 3N7AA 4XGQA 3WL5A 2QRPA 3VA7A 3RFVA 3PK0A 3A3KA 1SXGA 2Q21A 4JELA 2PUWA 2H0QA 2HQRA 2WDPA 4E70A 3EXHB 2NU8B 3PDIB 4ZV7A 5TEVA 2P3SA 3R8FA 2C9MA 3EZ2A 2YCLA 1NVBA 2QTTA 2B1GA 3WHPA 5AUOB 3O75A 1UFQA 2O0JA 1DG9A 3X3HA 5IKPA 1U80A 5EE1A 1Q14A 4X8MA 4QWWA 1JPUA 5FL3A 4FS3A 2H7YA 1M5UA 3ROGA 4INPA 3BRWD 2PH3A 2G9RA 4NBVA 2Y1DA 2WA2A 1P0IA 1KLNA 1E58A 3ZDFA 3OJXA 2KI5A 1X7YB 5I7SA 5GPBA 2PI5A 4WKOA 1CYDA 4W5JA 3HHPA 5EZQA 3EN0A 4KMOA 4YJDA 1NLFA 3D81A 5L1MA 5IM5A 3VR6H 5FOTA 5FLKA 3N76A 3NHBA 3DDWA 1PL6A 1PW7A 4ED7A 2JZNA 4W8HA 3U7JA 5L40A 1NLMA 1OPRA 4LE1A 3BF8A 3DL2A 2XRMA 2YFKA 3O4GA 5FDFA 3V6KA 1SXDA 4DIUA 3MUFA 4TRRA 1MORA 3DZ8A 4S1PA 2GPJA 3GIDA 4IIDA 1QC5A 1HBJA 5C5IA 2Q5JA 4KCGA 1C1HA 5ERGB 3I6MA 3RS9A 1NXXA 4G65A 1EFHA 3R20A 2OAP1 3LCUA 2SKCA 2ZJAA 4WBNB 3EPHA 5DBIA 1X1CA 4C88A 2JLVA 4E21A 4N5HX 3OP4A 1QQBA 1YZYA 2H16A 4MSUA 3SBOA 1YHZA 3QQPA 1LX7A 1G3QA 4UBKA 2CXYA 1VDMA 4GU5A 1LBSA 1YA4A 4CL8A 2E8NA 1UFRA 2X76A 3AYXB 4MW7A 5I8ZA 4P38A 4IKPA 4MV5A 5D6OA 1IMJA 2ID9A 2AXEA 1PKXA 4K3UA 3VO8A 2OK8A 2JH9A 2PFPA 3E35A 4OG2A 3GMTA 4FZJA 1IBKB 1ZQGA 4O3FA 3UFBA 4Z6KA 1AQUA 3PXBA 4HQFA 1VDZA 3ETEA 5EOVA 1EFCA 1KH2A 4JJ6A 3KLOA 3E9ZA 1U3UA 3FKQA 4HQLA 2I5PO 3PRHA 5E4YA 3D0RA 5J0OA 1USVA 1IWBB 2OL4A 2ZYIA 2NXWA 4TZ0A 1UBSB 1WKBA 4B8ZA 4NYMR 3BC1A 4EKNB 2GJAA 4LHEA 3IP9A 4GQAA 3E3MA 2JJYA 1NF2A 2JZCA 1E4VA 2OV4A 3AESB 1YI0A 2BGUA 1WVGA 4AIRA 3GPDG 2R84A 1SBNE 3A0BU 1FBNA 1ISMA 2LNDA 2QDXA 1O8BA 2WTXA 5JJIA 4MGZR 2W58A 3THXA 2ZRAA 4EG3A 4TN1A 5TVGA 3W2HA 2KMDA 2GBFA 2OFPA 4QIHA 1ZM2A 3Q7SA 4BL5A 4U6QA 4WZZA 1LBHA 2AHRA 4FFVA 1U3DA 4GLOA 2E82A 5I51A 1MTOA 4K28A 4JXKA 5KWJA 4HTFB 4X7MA 1L5LA 3CWQA 1OLUB 2EW2A 4A92A 4CCWA 2O1XA 3HLYA 3A31A 3CUUA 5J2CA 4HHEA 4ED2A 5EJ9A 2OGSA 3GFVA 1UANA 2O2ZA 4QU9A 1OX4A 4TMXA 1U2DC 1QIJA 3JAWA 3T79A 3QUBA 1DC5A 5EKDA 1YC2A 3WWEA 1KAQA 3W3AD 3WE7A 4C4AA 1T0IA 4P6VF 3C3KA 4GECA 2WKPA 4ZV4A 3EIWA 3FTDA 1TD9A 4DR3B 2GZ2A 1RSZA 4KOEC 3I0NA 1L1FA 2VDQB 2FUG6 1DDGA 1BE1A 2FK7A 2IEGA 7ICRA 1XNSA 1D4ZA 1TK5A 3GW8A 2B8TA 3MRSA 5I3CA 2OO3A 3PGXA 4XUGB 4FR0A 2G4VA 3D6HA 1BJRE 3BWXA 2RHGB 3TTWA 9ICXA 1RHRA 1P2TA 3UOGA 4Q7LA 1TZJA 3UMMA 2RHTA 1OTHA 5AHWA 5KKNB 4EYHB 4DRYA 2JMGA 3O3OB 3BFJA 1JDJA 5IN5A 2AI3A 3D31A 1KDVA 1BVYF 4TWIA 1EPUA 4YJFB 1T7PA 3WLTA 4IL6U 2BFDB 4QD3A 1FDRA 1NOKA 3HP6A 1OTYA 1HZZC 3PNLA 5KWEA 4IRMA 2V1UA 1BW9B 1QBGA 1XTSA 9ICJA 4KPUA 4RV4A 3ZH9B 2HA0A 4DT1B 2C94A 2NRTA 3EGXB 2HJHA 1QOZA 1KK3A 3KHUA 2B8JA 5FWYA 4CVNA 1KJ9A 7ABPA 5BT9A 5FBVB 5BY2A 4HDCA 1M1NA 2EFGA 3B7PA 2V0GA 2H6EA 1K7EB 4I2IA 5AVSA 1R6TA 3HA7A 3IPAA 3PHIA 1DQPA 4JA2A 2TMDA 3U7HB 3H5RA 5AICA 2C3PA 2ANCA 2D5IA 4DCVA 2HHHB 3GFSA 5AKGA 3RRXA 1Z22A 5JFOA 1X7XA 1F0YA 2QE7A 1B0PA 1QU3A 2UXCB 1SO8A 4V2IA 4ZMSA 4X6XA 4YCJA 2D1QA 3CR3C 5KG6A 3SU8A 4GVLA 1XNRB 1RWKA 3IPRA 1G6OA 1DGSA 2LD4A 2KFZA 2NO6A 4CM7A 1UCVA 5KTTA 5JSZB 1W44A 4G89A 4PNZA 3NEPX 2VTBB 3S2EA 4RSRA 4QZVA 1HURA 4G0NA 5JVDA 1CR2A 3LV8A 1EJ0A 2DKZA 1UK9A 3F4KA 2VH1A 2ZIFA 1DIBA 3W1EA 2IDJA 1W0KD 3M6MD 4Z2YA 3F90A 5LQSA 4ZRMA 4PRKA 4GHWA 2W43A 1XC7A 4FBUA 2FKNA 2PUEA 1YT5A 2LHTA 4DIKA 2ZIVA 3AY6A 1KPHA 1LQUA 4JJIA 4E22A 3GGOA 4KTTE 3GG2A 2C4VA 1XF1A 5IXSA 4AZVA 4URWR 4ZT6A 4Q19A 3P0JA 1Z4OA 5SICE 1SZPA 4LSGA 3A0RB 4BTLA 2ONKA 4L8FA 2A35A 2ZRPA 4DXHA 4I2JA 3N70A 2DLNA 3CKKA 3RBAA 3ZGNA 1WZ2A 2XZLA 4HYYA 3DNPA 3GV8B 5LKAA 5ALDA 1QXSA 1Q7EA 1ZQUA 1NUSA 2GCGA 1URPA 3CX8A 1IJKA 2A9JA 5A4IS 4BFCA 4NV3A 5EWLA 2H2AA 3GGDA 1JQJC 4QECA 3MGCA 4NLNA 3R5KA 3LBNA 2Z9DA 4YWJA 2HTEA 1N6IA 3IUNA 2PKWA 3EXHC 1XZPA 3O4JA 3I45A 4UUAA 1KMHA 1JIIA 1XWIA 5IAJA 4DWIA 3ZWXA 1P1IA 1RAFA 1FRVA 4WUVA 3M9LA 4NULA 3U9TA 1A9TA 3UCFA 3QLVC 3LPCA 2C1XA 3FC4A 1G6Q1 3D6FA 3PSIA 1H4SA 5TR9A 1EE1A 2OE2A 1XCOA 3V2GA 4HPXB 2D2IA 2BI4A 4ABTA 3ZD7A 2FOLA 3ICQB 2ZS9A 3ML1A 4GOJA 2Q0ZX 1LWNA 4UDOA 4KTQA 4Z4GA 2I3BA 3W9SA 1JHAA 1KJJA 1ODJA 2CE2X 3SJCA 5DHUA 4HDQB 3JVEA 3HBLA 4M0AA 4PAWA 2VJOA 2ZJ6A 3CY6A 4K4GA 4IF6A 4P3KA 3JS5A 4F9GA 2R7LA 3V55A 1Z34A 2X5XA 3MD9A 1TDJA 2EKBA 3JD1A 2IPXA 5ILOA 4MA4A 4OFWA 4Z6EA 1P0QA 2Z2IA 4IWXA 4QAJA 2Z3ZA 1D9FA 3QBJA 3U09A 4B9AA 4JHLA 2LPEA 1RLUA 2IMWP 4W1PA 3FNRA 3LHSA 1YE5A 3BFXA 1CUJA 4QODA 3F2BA 1PZXA 2GJ4A 4LUCA 1OHHD 1PX0A 3BBLA 2XWSA 3U5ZB 4II7A 2RB4A 2P3OA 4K87A 5JUMA 4X65B 3EC2A 3Q1KA 3ZV4A 4EUNA 2GBGA 3D6UA 2FLVA 4NLLA 3H8WA 3RS7A 2AKYA 1B3RA 1TPYA 4OMUA 4Z4QA 2QRVA 5BRAA 1R5JA 4G8DA 1N8TA 3LMKA 4BUCA 1Z17A 1HK7A 3MR3A 3UOAB 2I4RA 4GXNA 3NBZC 3I6BA 3T7TA 3EGIA 2LIVA 2H8KA 5HHHA 2J32A 3Q8WA 5BMOA 2O1WA 1DKOA 2NV3A 3MELA 3H5IA 2JKZA 4OKIA 3GNQA 4ERNA 2HLHA 1E1LA 3KXDA 2BHRA 2XEDA 3GLIB 1V7QA 2MYPA 3TIVA 4OB6A 3IOMA 2R1TA 4XGRA 1PFQA 4P35A 2Y0EA 1PT9A 1RHUA 5D7BA 2E5SA 2QBYA 3Q72A 4P4UA 5HOEA 2R66A 3GGSA 1KOGA 5JH7F 4J03A 1JAHA 1QONA 3BHMA 4TT3D 3OM8A 4ZZ0A 1V8PA 3ZD9A 2FSPA 3DOHA 4Y2XA 2OKCA 3MUEA 3ASUA 4F6RA 4W6QA 1ZWLA 4KQ2A 3RO7A 1GNSA 1DLIA 2FFHA 3T0GA 4YRLA 8ABPA 1MIHA 2FMQA 3DVAB 4YY3B 1IV8A 1IHOA 4M9NA 3RTEA 3OURA 3DS8A 1WPGA 1J2RA 3RK1A 4RLFA 4KN6A 3T5KA 3GAZA 3ROMA 5JJ5A 2X8BA 4O4LF 4LN1A 4XM1A 4RTQA 3JYQA 2Y1FA 2CV0A 4MI6A 4PWZA 2W2TA 1KRHA 3JQPA 1PT8A 4DL6A 5AW7A 3QIVA 3F47A 3ANSA 3DHYA 5JCZA 2ZE8A 4BYGA 1V8FA 3N7RC 4U3JA 4NBKA 2WFZA 3FCCA 3DMTC 2XB8A 1YS2X 2QW0X 2C97A 2HO5A 3OZTA 3THXB 1E9AA 3QEAZ 2HNKA 2PUAA 3BRWA 1F2DA 4NEQA 1J9GA 1TVKA 2YHAA 4UB5A 2B8EA 3ISJA 1VGVA 5HRAA 3PSAA 5BYKA 1CR6A 4WNCA 1NA5A 4KO1S 5CXUA 1UP6A 3M4NA 3TZBA 1P44A 1PWHA 2WFLA 2DECA 1DIAA 5IN4A 4TV8B 1BD4A 9ICFA 4LOLA 5FQOA 1JH8A 3T5HA 4CMJA 4KLEA 4EYGA 4HLDA 5HJ5A 3E23A 2OBXA 2XOKD 4NFYA 3C23A 1OX4B 3JAWB 1NNEA 2W9BA 4D4HA 3BSYA 1ZD1A 1G2PA 2MUTA 4PHHA 5J0YA 5BSTA 4QVGA 5KFPA 3HDVA 3REGA 3HILA 2AQ0A 3QEMA 4UARA 3TKYA 2R8OA 1P2DA 3LP6A 3QZ8A 4QWMA 3JPTA 1TT7A 1KI8A 1ZJZA 1CF9A 2D2VA 3WGZA 1UPUA 4ND8A 2Q4BA 1XZHA 1CNFA 4LOJA 5JC8A 3PJEA 1ILWA 3CNEA 3I73A 2Z5VA 3HNOA 5IZCA 3OX1A 1SPBS 4LFCB 4BLPA 2E87A 3D0QA 1PJ3A 4EVRA 4EARA 3ZHZA 3GEMA 4C8OA 1V16A 1Z75A 4FK8A 1QYXA 2JGKA 4KK3A 5HKOA 2H51A 4XLLA 5D3KA 3OTOB 5J2UF 5I9LA 4QDTA 4UNIA 4QWEA 4P32A 4XWTA 2FPIA 1R4ZA 3IVCA 4FDVA 4KIFA 4O5AA 3KXIA 1K6MA 4KSYA 2Q3LA 3K1ZA 4MO2A 1EE2A 1KDZA 1ZEJA 1V6SA 1SOVA 1YJ8A 2VHTA 1RKUA 3RIYA 1C2TA 2RGUA 1X8XA 3BG5A 3B3FA 2NRVA 4GLJA 3IOCA 1YULA 5TJHA 3HPQA 4X71A 4XIFA 5JRDS 1OFUA 1A97A 3RABA 5LNK6 3D5TA 3ZQ6A 4DEVA 4B7CA 3OQVA 1WXWA 3ZK9A 4L6CA 4UTXA 3PR2B 2PGJA 5HFJA 5KTSA 5FUYA 5EIWA 3HRIA 3LOQA 3BL6A 2B78A 3DCJA 3P96A 1GQOA 1MAVA 1YKGA 2XWBF 3TZCA 3KQTA 2B36A 3T9DA 1TVEA 1X7XB 4M22A 1AMOA 4NPCA 3KT8A 1XK6A 2AOUB 2GERA 4DANA 3O94A 4AYBC 3O6VA 2CEKA 4ACOA 4RWZA 1MB4A 5D1NA 1NW3A 4R51A 3Q15C 2P40A 4Q93A 2FUEA 1KEKA 1ADFA 1GKLA 2ZBGA 4JNCA 5LU8A 3VGJA 2BFMA 3WL8A 3VUEA 3NNNA 4Y30A 3UF0A 5DI9A 3H2HA 4Q1DA 4INOA 1AOXA 5JVDB 1ABEA 4Y0NA 3DCNA 1K4YA 4NCKA 1ECGA 1FNNA 3RK0A 2REXB 3WVNA 1QRRA 5AW8A 2HHQA 1D9XA 4JY7A 1MR3F 3VPAA 1FLAA 4P4LA 2J6TA 2AI2A 2OYYA 1WPRA 3K94A 2OA0A 3H5VA 1VKNA 3DEEA 5KYXB 2WSYB 4XA8A 4YUWA 2RFLA 3SZMA 3L1JA 2IF2A 2FVYA 1WXIA 3Q6IA 5FA6A 2WM2A 1YBHA 4MW1A 3L0YA 2A78A 5HIJA 1I7LA 3PVCA 1NDUA 5M34A 1QYRA 1HFWA 1Q1NA 5LZ8A 4OLJA 5IC6A 1NVUQ 5FLEX 3U7EB 3BE6A 1X7GA 1QGUB 5LKRA 3RRGA 4HEQA 4N7MA 4CKYA 4OA5A 3UHFA 4JSRA 1Q0HA 3AWIA 1Y0BA 3BL8A 4DRXA 1YZLA 5FTWA 3PGKA 3HB9A 4BO1A 5EWMB 3NHSA 5EWLB 3N0XA 3NEAA 1YXMA 5JAOA 1CY1A 2PMFA 3DKRA 3V6JA 3E3OA 1NZJA 1CZLA 2YZGA 3QF7A 1QH9A 3ZBTA 4TV9A 4QARA 4DQVA 1G64A 2A5GA 521PA 4FILA 1YMQA 1FTQA 1I33A 2O6LA 4KW7A 2C4HA 4ZOLA 1S9DA 5CJJA 2IEAA 5BN5A 3NCHA 5DXFA 3ESAA 4AY6A 3F6RA 2SCUB 5ESDA 5B1DA 4ZCSA 1PVQA 1FFSA 1NZFA 1AX9A 3TOSA 5AQ1A 4IS7A 4O5CA 5JCPA 1BDIA 3CKYA 5IXYA 4FZLA 1WMDA 4PAQA 2EGGA 3O2QB 3ITNA 4YMNA 3MT7A 1SZJG 1ISSA 2EKLA 1L4GA 4BEBA 1VCHA 3BK7A 1ZQQA 2BCGY 3C3YA 4HB4A 3TQRA 1QPBA 4RF2A 3WLMA 1UC8A 1SKUA 3C70A 1T4CA 5J2AA 3AJEA 1MX9A 2IUFA 2CNNA 3VPDA 1P4RA 4IDQA 5M04A 3FUWA 2V3CC 1JI3A 5LC1A 4C4SA 4BVGA 4D9NA 3U44B 4Y2VA 2Z4SA 1AO3A 1C7ZA 1TK3A 1AH2A 2LDBA 3PTLA 4OOEA 3DMHA 3BRCA 1Q83A 1V37A 4J0QA 3CJRA 5C8VA 2ZTHA 2G36A 1QHHB 9ICTA 3P26A 3E9NA 4DM7A 4QO7A 3OQHA 3QWBA 4YREA 4BVEA 5LP6F 1OLSA 4JEHA 2RC5A 5K0ZA 3A3NA 1Y6FA 2FQXA 2F77X 1H93A 4D3DA 1SFRA 3ADKA 1RWMA 2DJIA 1JPJA 2AA3A 1HGXA 4KXYA 5ESWA 1W0KA 2WIDA 2QRVB 3M6KA 1C9MA 1OH5A 1SKYE 5CFNA 3PE6A 3STTA 2CRXA 4DFMA 4XDZA 4BLOA 5HHIA 1HZZA 1CUVA 3WFZA 1RXSA 4YC7A 5CCDA 1TM2A 1NN1A 4ZQIA 3I2FA 3NXSA 5D3ZA 3IEVA 1PDWA 2EAPA 2CXTA 3L1IA 5JNLA 4Z6CA 3DF9A 2JBHA 3DL4A 4MWSA 2B99A 1JAIA 4DMKA 2A0UA 3D4PA 4N03A 4Z9YA 2R1TB 4CIWA 1ILEA 2YFQA 3Q85A 3N05A 1MZVA 1E1MA 2P5YA 5WRFA 3JD3A 2BF4A 4LMRA 3WGLA 4XIJA 2OAEA 1JVBA 3IEMA 1M2GA 2VUSA 1E9CA 2Q45A 5I8WA 2B6NA 5TF4A 3LO5A 1XVIA 4TQ9A 2NT3A 3AVTA 4DF8A 1X1BA 1JP7A 1KI3A 5M2QA 1OV6A 4HX2A 4PYNA 4V03A 1I80A 1E0KA 2ATCA 2QTNA 4CL2A 2BFFB 2WM3A 4XVQA 3UAVA 4F6RB 4QDZA 3KV3O 2GD1O 4IOMA 5AH0A 1AE1A 1MC8A 4ARUA 3N2YA 2JK1A 1DBQA 1CDOA 5IT4A 1KY2A 3MRXA 3TW4A 5H1YA 4J4TA 4RK5A 4Z0NA 1XKXA 1JDZA 4H1WA 4YCAA 4EBBA 5DG9A 2I4OA 5DM0A 3SLGA 1UXGA 1G8KA 1N8SA 2WR8A 5AJUA 3PQ6A 4EBEA 4EB0A 2RDJA 3WDSA 2QD2A 2AQHA 3WR5A 1EQAA 3E5MA 5ICFA 3QXHA 2ERYA 1BKSB 1KQOA 2FUNB 4JBYA 1Z5OA 5KIAA 3F7MA 3QUQA 2B20A 5EXTA 3DXZA 1V9PA 3LWDA 3CVWA 2PXCA 2OFXA 3PR4A 3WJ2A 3UV7A 3HVUA 7AT1A 4U3JB 2CFRA 1V7CA 3OO0A 1B8NA 2VDWA 3K0AA 3KCQA 1F3LA 1NYRA 2W7PA 3PS9A 7YASA 1CY0A 5JNWA 1GILA 3F0TA 4M1MA 3HCPA 5IIIA 2AV6A 4UHHA 4Z0TA 2IFTA 5BVHA 3KE9A 3A6DA 4B2LA 1W75A 1OHHA 4YONB 2ZAYA 2XI9A 3OJCA 3W1WA 4EG5A 4TQUS 1FNSA 1TIKA 1Q20A 3NT4A 2Q2NA 1AU9A 1CI4A 5AKEA 3OE4A 4ZAZA 3R8CA 3K71B 4JITA 2PX4A 9ICEA 1RACA 4W99A 2ZUCA 1D8YA 3EXHA 3R0ZA 4RCYA 3D8UA 5J0PA 2J9GA 1MPTA 3K9NA 5EMJA 5DB8A 3TGLA 2VRWA 3A9WA 3M5DA 3BX1A 3IEXA 5A2QA 1DV1A 4G07A 4URHA 5KFCA 4QLBA 4DWVA 3QBDA 3QEMB 4AURA 1C0IA 1L5VA 2IZ6A 1J9ZA 2QRKA 4IFTA 1GUZA 3ORHA 2F3UA 2OHXA 3SM3A 5LNK1 5K3AA 1X92A 2ZJ5A 3IVRA 4URXR 1JR3A 1LBTA 3C8HA 2ZI3A 4UUMA 4OQFA 3ST7A 1SZCA 2QY6A 2NUTA 1XTRA 4QRIA 4ECUA 1YH3A 2EX0A 4YT4A 2WJAA 4WRRA 1EM8A 1K66A 2JNWA 3BIFA 3O4VA 1ZRHA 2I03A 3PG5A 1B74A 3U39A 3A36A 2ANBA 1TZMA 2F00A 3AUJB 2RHHA 1RXUA 4XOIA 3DC7A 4YJKA 1FNBA 1TNDA 2K2QB 3B9PA 3G1TA 4BDPA 2WNHA 2ZBFA 1E0SA 3OOWA 1EYZA 3IKMB 5IDXA 1FTYA 1OFVA 1YQDA 1TM5E 2IU4A 3KPVA 3NU1A 2BBSA 4AJ4A 4B7UA 4M1OA 4PL2A 2HRDA 1WUDA 1R66A 4O4IF 2JIRA 1U8FO 3G82C 3NI2A 3FYHA 3PWKA 2A9OA 5AVYA 2XQGA 2BELA 4ZVKA 1E60A 4HNSA 2HDHA 1WMAA 4FX2A 1EAMA 1ISJA 3ROQA 4P9NA 2V5UA 4HYTA 1JIKA 3HB1A 5FOVA 3MCVA 2J87A 4LXYA 3THWA 3GFGA 2ZSAA 4FUTA 1W59A 4WJZA 4REOA 5FO0A 3GEIA 3ETHA 3V3TA 1W581 3D2LA 1S8FA 2PUVA 1DE0A 1X9IA 1BG6A 2PMBA 3E9EA 3IV7A 1DJPA 2JDID 4P7FA 1GTJ1 4F3YA 2F1RA 3KAKA 1DRJA 3NOXA 3IHTA 1QS0B 5TISU 4HAUA 4A3SA 1SXJE 3DZDA 1AV6A 1VJTA 1JT9A 4D6PA 2R65A 3UJPA 2OBFA 3AMVA 4QYIB 3I83A 1T43A 4BEVA 2XECA 4RGBA 2YWRA 5TB5A 1DAFA 3AEUB 2PI4A 1PKEA 1QF6A 4KDEA 1QJCA 4K6OA 3X44A 1PNQA 3HRKA 1QYDA 3HPOA 3VYRB 1HDYA 4G56A 1QLWA 3OQMA 3QWIA 3EDQA 5KFLA 3A1WA 2DULA 2XE8A 1LLUA 4RU9A 1G8FA 2WIKA 3VKFA 4I2GA 1GR0A 2GNOA 4P4GA 3I3SR 1RBZA 1C8BA 2HWXA 1X9GA 4KN9S 4QOHA 2WQ7A 4F06A 2AJDA 3MGAA 4QFCA 3CLUC 3U3RA 2XB2A 1P8AA 3AESA 2Q8QA 2F3RA 1TYBE 1QBKC 3ZJVA 2JGAA 3UGQA 3NHLA 1UKVY 2Y0CA 3GRRA 3PR5B 5GZ6A 1X9XA 2V9WA 3A04A 2ERXA 3U26A 3L7DA 4USAA 1G4AE 2PT7A 2YR0A 1ABFA 3C5EA 2PUJA 2RJ3A 1NOMA 1IUPA 3R75A 3UJ6A 2Q5IA 1R0SA 4CIAA 4JZKA 5GIPE 5A9SB 1J0EA 3HJGA 4ZANA 4ZI5A 5AK4A 5HKBA 5BSKA 3NONA 2WUFA 4YI3A 2X13A 4DMLA 3NHUA 4LCEA 3D4IA 4CIXA 1X7ZB 2RGYA 5J4HA 3I8XA 4HTFA 1T26A 1Z12A 4IIEA 2X8LA 1IAQA 2NACA 4TYYA 5IG2A 1K2VN 4TV9B 3CB2A 5CVVA 4TWBA 1G3RA 2IUTA 2DTEA 4AG6A 4FDTA 3ELYA 5C8YF 4ZOLB 3A6FA 2ES6A 1JR6A 2V7UA 3VDRA 1BDJA 1NUPA 1H1TA 4LVNA 4Y6LA 1N0WA 4OHXA 4URUR 1QU2A 4FDLA 5IUNC 2E1PA 4BB6A 4F7WA 4MYUA 2BCEA 4QO8A 3U9LA 5BMVF 4ICAA 2UZIR 1EUDB 1RS0A 1WYGA 4Q00A 5MDHA 3OEHA 5CH8A 4C43A 1PLLA 1GRRA 4BJHB 5I45A 1K97A 4Z6FA 4CR7A 4MQ5A 3QYJA 1RVV1 4XARA 2GEVA 2W3SA 3GQBA 3G5MA 5AESA 2C3YA 2GILA 5DCWA 1DJMA 3CLUD 2VTDA 2M1ZA 3G23A 4B47A 4OAPA 1DJQA 3ACDA 1ZUIA 3LA8A 3RSFA 1FS4A 3OKCA 5J59A 3BEDA 4DS4A 5IANA 1ODSA 3HDYA 4BO7A 1NZBA 2Y77A 3TGWA 3TM5A 5ALXA 2W2NA 1GYPA 3RB8A 2YUTA 4G8CA 3M4YA 3HCCA 1Y6GA 1BW9A 2BF7A 5DTRA 2I7VA 2ES4A 4BCDA 1NQAO 4JV1A 3PO4A 3ZQKA 2XUHA 3ZCTA 4Q7MB 4RNCA 3EZ5A 3U6BA 3NAQA 4YGYA 2VLIA 4H4CA 4MGIR 3G7NA 4YMOA 2GPNA 1TM3E 3MDCA 3U31A 1Z8HA 4X63A 1XFAA 3ZW9A 2ZTSA 3KKZA 2DHCA 4QZ9A 5CVEA 4OV6B 3DZHA 5K99A 3DKVA 4YR2A 2X1VA 3OVMA 1L7VC 5JXIA 2ZWAA 4H9GA 1SUDA 2L19A 1DFIA 3L7LA 4KVGA 4JJ4A 4FLEA 1MZPA 4KLTA 4YAGA 2J4DA 4YDQA 1KEEB 4UC0A 1THZA 2Q3FA 2W37A 2IHKA 4S05A 1KU6A 1LQ2A 1P4AA 3EIQA 4D9EA 1KR2A 3KDPA 4OSEA 1VG1A 4EUEA 2O2DA 3BIWA 2OGUA 3UWKA 4L0DA 2ZYDA 1QGAA 3FZYA 1UK8A 4MPRA 1DARA 2QU7A 3O8CA 2QPOA 4BBPA 3ICXA 4EHBA 2C5FA 3QXGA 2H9AA 4YJ3F 3TLJA 2VDUE 3R44A 1UA1A 2ZUDA 4JU9A 1J20A 1W76A 1KVSA 3RJTA 1MEEA 2TMGA 5TRTA 2XXJA 3PUZA 2XKBA 3BTVA 3PXDA 1A9XA 4F4FA 3L2OB 3HX0A 4KMUA 4UE2A 1QORA 3MCZA 3TLXA 2FOIA 5CIQA 5DCLA 2HMYB 3LHIA 1NMXA 5TPZD 3GJ0A 1KJYA 4TZ6A 4CUKA 3FI9A 4NYIQ 1HDRA 4RZQA 1W4CA 2HEGA 3MGBA 1NJ6A 4KLJA 2FWPA 2YWBA 5L3VA 3K0AB 3C8UA 4C6TB 4WN3A 1ZUNA 3ETLA 1LRLA 2I5HA 3UV3A 4ID9A 4PINA 4O33A 2E37A 3FUXA 1S2IA 3IEUA 4GI5A 2ONJA 4ELUA 2CSXA 4ZVSA 2VDNB 5BVHB 3TNLA 2ONCA 5EHZA 4D0LB 4MVXA 1E4EA 1GN9A 3LP8A 2DRIA 3WBBA 3PQ5A 4DMFA 4NHOA 1OWPA 1P61B 4NG4A 2B0CA 4LGMA 2D00A 4JFRA 3EUEA 2BSXA 6YASA 3L8MA 4JXZA 4C5CA 3H9JA 7ICIA 4FGUA 3AIOA 2DP4E 3I62A 1JJVA 1Z5ZA 3W5AA 4E2FA 3KOMA 1U9JA 4O4JA 1CEXA 3PQ3A 2FJ6A 4UB4A 1CJSA 2AHOA 2EZ9A 5IZCC 2BBTA 2FEKA 2VKTA 5CXSA 3W8DA 4W1SA 3AC0A 3P4UA 2FW8A 1G66A 3FMVA 3T8YA 2I6SA 3EAGA 4UOQA 2VJLA 1L7PA 2JJ2D 5D5QA 4ARAA 2FP3A 1N5XA 3TFOA 3DEAA 3SPXA 3ABSB 3BK2A 2W0MA 1M0WA 1HNWB 1K3UB 1LU9A 3L9XA 1PVDA 3P8ZA 4YQZA 2NUTB 4DNPA 4DNOA 1IOLA 3REOA 4GPD1 1O9HA 4RMGA 2X23A 5T67A 1JKJB 1EM8B 1HDXA 4EYQA 1OXJA 2BZ1A 2Z98A 2OCXA 3TVDA 1ZBDA 3RODA 9LDTA 4OHKA 3C28A 3KJNA 4ND1A 2WJ6A 4XM0A 1OBHA 1DKMA 1O0SA 2KX7A 4F1WA 3IEKA 3K72B 4FWBA 2JHCA 4ND4A 1H2RS 3WGIA 3ACCA 2PKYX 4LQCA 1T5TA 3OUUA 3IESA 2J9XB 3DDSA 1YUBA 5A7HA 3OF2A 2QL6A 3LC7O 2I4IA 2GAFA 3BTOA 2ZJ1A 4HH4A 2D74A 4QJ3A 1N2EA 3DE7X 1QRDA 1T25A 4Q21A 1SBCA 1E2MA 2HHLA 5M29A 4Q7KA 1PGNA 5K8IA 3FZGA 2KP7A 2FB9A 3DYVA 5F9HA 3WWYA 2QL7A 4DSIA 3GLIA 5ALFA 3PDWA 1U8TA 3UWSA 2DQNB 5ERXA 3LW7A 3IQGX 3QE3A 1H0RA 5DN6A 4F1KA 3WMXA 3THWB 5EZYF 2I91A 4NATA 1D2AA 1HDZA 2I4LA 1NWCA 4Q6WA 2BFPA 1YNOA 3PD1A 4BJ1A 2RJNA 3A9UA 2K4IA 3UQ0A 3V7WA 3FPKA 3E48A 4OJYA 1H2FA 4RQ0A 1DKQA 1HETA 1V4NA 3ZWOA 1N2SA 3AUFA 1VSQA 5EKXA 1HA3A 4CDRA 1GY8A 4GKVA 1IBLB 4B1FA 4F84A 4PL1A 4X61A