1Z4OA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 78
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4oA01
4C4RA 2W4MA 4Y3UA 4XQ0A 3HYCA 3QXGA 3SD7A 2IOFA 3SKXA 2G1AA 3NASA 1QQ7A 2O2XA 3W5BA 1YV9A 4Y2TA 1Z5UA 3KC2A 1Q92A 3NUQA 3U13A 3QNMA 5AK4A 2YJ5A 2HO4A 3ESQA 1ZD4A 3R4CA 3FPSA 3WK4A 1YMQA 4NV0A 2FPRA 2W43A 3E8MA 1N9KA 2FUEA 5AVUA 3IRUA 4DFDA 5AI5A 3FVVA 3BWVA 5FP0A 3OPXA 3PGLA 2YY6A 2HOQA 5AM0A 4NWIA 5ALLA 3U7FB 4HAIA 4KNVA 1ZRMA 4GIBA 4EX6A 2O9JA 4KX5A 4OD0A 5AESA 5ALHA 1QH9A 4G63A 3SLRA 1Z4IA 3B8EA 4DW8A 4PNHA 3OCUA 2YMMA 3S6JA 1ZD2P 3U7GA 1FEZA 1PW5A 2RAVA 1CQZA 4JDPA 2CFRA 2G09A 4CE6A 1L7PA 2EAUA 5AW7A 3I76A 3CZ4A 4Y2YA 2B82A 2CN1A 3DDHA 5AKEA 4YCNA 5AVRA 3U19A 2GMWA 3QU7A 5ALZA 2EARA 1XVIA 5AKHA 2YJ4A 1U2TA 3N28A 4KN8A 2C4NA 5ALMA 1RQLA 3FM9A 3QYPA 4YIHA 2I34A 1RPZA 4FE3A 3P96A 4UM5A 5AW1A 2ODAA 1X42A 4H1WA 3W5DA 4BBJA 4F71A 1MH9A 5ALFA 2FPWA 1QQ5A 4XE5A 3L8GA 5ALEA 4YIKA 2B1QA 5AVQA 4L6CA 1U7OA 1CR6A 4UMDA 4NABA 4B6JA 4C4TA 4NFLA 1RKQA 2OA0A 3A1EA 3N07A 2D2VA 5AHXA 3MPOA 2B8EA 5ALVA 5ALSA 3OCXA 4BX3A 3L5KA 4HGRA 4Y2SA 1K1EA 1Z4KA 3ZI4A 2VKQA 1YNSA 4YH1A 4Y2UA 5AIAA 2B1RA 3QLEA 4HGQA 3ED5A 4UW9A 1F5SA 4KX3A 2G08A 3EF0A 4OFZA 3M9LA 5AM2A 4O8CA 5AW3A 5AW9A 2YBDA 1ZRNA 4UMEA 3UMGA 3RFUA 3AR2A 3U26A 2PQ0A 3FPBA 3GYGA 3M1YA 3CNHA 1U2SA 2HHLA 4Y2XA 1YDFA 2W11A 4J03A 5ALYA 3R9KA 1NRWA 1ZD5A 4FYPA 3A1DA 3N8GA 1L7MA 2AH5A 2WF5A 1LVHA 2I55A 5AVTA 3L8EA 3K1ZA 5AM3A 1RRCA 5AVYA 2JARA 5AKKA 1Z4NA 1ZD3A 4Y2VA 1TJ3A 5AM4A 3L0CA 2QLTA 5AM1A 2FEAA 1YS9A 3FZQA 2ZBEA 1RLTA 4CF3A 1T9ZA 2FUCA 2HX1A 1RLOA 2GHTA 3SMVA 4L57A 3BA6A 5AI6A 4MUMA 2I7DA 2I6XA 3KOOA 4G9BA 2CFSA 3L0YA 3I28A 4JB3A 3B9BA 5ALKA 2R8YA 5AK5A 3ZX5A 5AVVA 2BDEA 3QUTA 2JAUA 4BX0A 4EX7A 1RMYA 2WF8A 4HYTA 1J97A 5AKXA 5ALRA 4YGYA 3ZTYA 5AKIA 5A3RA 1ZS9A 3B9RA 1L7OA 1WZCA 2P69A 3QUBA 5AVSA 1T5SA 5AI4A 3ONNA 4CF5A 4EZEA 3MN1A 4I9FA 3QX7A 5AW5A 3AR8A 3UMBA 2FI1A 3NAMA 3WK6A 1T5TA 4IFTA 1YJ5A 1Z4OA 1VJ5A 3L0BA 4HGOA 2NO5A 4Y2JA 4UU1A 4C4SA 3U7HB 4MWOA 3NALA 4E88A 2YFYA 3NIWA 5IT0A 3A1CA 2HF7A 3ZWDA 2ZOSA 3PCTA 3SF0A 2P11A 4QQFA 3KD3A 2ZXEA 3L8HA 2R8EA 3AR9A 3AR4A 1SWVA 3QU2A 4OHFA 3DNPA 5A3SA 5AVWA 1U7PA 1L6RA 3VAYA 1VFPA 5AI9A 3OCVA 3OCZA 1AQ6A 2AGVA 2C9MA 3J7TA 2BY4A 1RDFA 4EELA 5T41A 1U02A 4RESA 4BNDA 3WKAA 2QYHA 5AW0A 4UU0A 2ZBFA 1WPGA 4AS3A 5ALWA 3F9RA 5AM5A 2OYCA 4KNWA 3KZXA 2PKEA 1EK2A 1WVIA 3QU5A 3E84A 4YCMA 3TLMA 3DV9A 4J2TA 4BEWA 1QQ6A 4ZEWA 1TE2A 1N8NA 1QYIA 4UMVA 1Z88A 2NO4A 5AKYA 2JAWA 2FDRA 3L1VA 4UMFA 2X4DA 3W5AA 1L7NA 5AVXA 1EK1A 3EF1A 2BDUA 1XPJA 2G0AA 3MMZA 2PR7A 3E58A 2IA5A 1NNLA 2JGAA 2OBBA 3WKEA 1ZOLA 2GHQA 3WKCA 2B30A 3WGUA 1NF2A 3HLTA 1RC8A 1RKUA 2WF7A 3L8FA 2OM6A 4AS2A 1TJ5A 2AMYA 1VJRA 4ZEXA 2AUTA 3WK5A 4BYGA 3QUCA 3R09A 5AW8A 5ALPA 1KYTA 1Z4LA 4I9GA 2WFAA 5ALOA 4DCCA 5AIBA 3U7EB 2P27A 2WM8A 5ALQA 3RF6A 1Z5GA 4UAVA 5AKZA 5AW2A 2G80A 5ALGA 1S2OA 2HEGA 3UM9A 5AW6A 1S8OA 4Y2QA 5AVZA 1RQNA 4UAUA 4Y2PA 2FPSA 5AICA 2C8LA 4EENA 2R8ZA 4UATA 3ZVMA 2I54A 2R8XA 4XPZA 4Y2RA 2ZG6A 4QJBA 5AK3A 2B8JA 3OCYA 1XP5A 4ZEVA 3OTQA 5AKGA 2IOHA 2FPUA 2DQSA 1RKVA 3D6JA 3UMCA 1O03A 3N1UA 1Z4MA 2C8KA 4BNDB 3PGVA 2MU1A 4L6AA 3FGOA 3ET4A 2RARA 4UM7A 3W5CA 4UASA 3WK8A 3AR5A 3NANA 4CNQA 4BKMA 3OCWA 2YMQA 5ALXA 3ZUPA 2EATA 1RLMA 3N5KA 1L8LA 1JUDA 2Q4TA 2P9JA 4BX2A 1Q91A 2ZBDA 3ZVNA 5AKJA 3ZX4A 5AK6A 2WF6A 1RMTA 3L1UA 5IS2A 3ESRA 2RB5A 5JJBA 3DAOA 2HI0A 4BEVA 2C88A 1WR8A 4DWOA 3QU9A 2GO7A 2HCFA 5AI0A 1SWWA 5AKLA 3A3YA 2GFHA 3ZW7A 3PDWA 1RMQA 2ZBGA 1TA0A 4IG4A 2YMPA 1Z4JA 5ALNA 4HGPA 2WF9A 3WK7A 2IOFK 4FFDA 3ZWKA 3I1YA 2WHEA 2MU2A 3ET5A 5IT4A 3SHQA 3KDPA 2IYEA 5E0OA 4RETA 1SU4A 1Y8AA 4AP9A 3KBBA 1O08A 3QU4A 3AR7A 1Z4PX 3ZU6A 1Z4QA 3MC1A 5ALDA 2YJ3A 2G06A 3NRJA 2HSZA 3EWIA 3QGMA 2Q5EA 3WK9A 4YCLA 4CF4A 3WKBA 5AI8A 3IJ5A 5ALJA 2Q4RA 5A3QA 1J8DA 5ALTA 5ALIA 2HF2A 4EEKA 2YN4A 4UARA 3ZVLA 4HGNA 3L7YA 2JAOA 2NYVA 2FPXA 2I33A 2CFTA 3EPRA 4OCZA 2HDOA 3E81A 2RBKA 2YJ6A 3QUQA 1L8OA 3AR3A 4GXTA 3SKYA 3WKDA 3IB6A 2G07A 1LTQA 1TJ4A 1ZJJA 1IWOA 4XOUA 2B0CA 5AW4A 5ALUA 3WGVA 4F72A 3I6BA 4KYTA 3AR6A 3ZTWA 2YMLA 2MSNA 4NAVA
chains in the Genus database with same CATH superfamily
4FKZA 2GNPA 2HV9A 2ADOA 3KQSA 3PJFA 2C9DA 4P92A 1E3JA 3WDLA 1KEPA 2M6LA 3PX6A 1IM8A 3IQIX 1MF7A 3O8CA 3SEZA 3ZXYA 2WC1A 5C0OE 1GQRA 1ECWA 2Y0SC 2XXJA 4JUDX 1ZK1A 3B89A 4MGHA 5CNMA 2BHLA 2P0AA 3PVSA 3RM3A 3T9CA 3GV8B 2ZB4A 1OAKA 2H9AA 4MGZR 3VU9A 5EJMA 4DQUA 4OJPA 1FE8A 5F7ZA 3EMKA 2ZUBA 1SKMA 2ZRGA 4WZAB 1FLDA 3EXHC 4AMYA 2QRHA 1R8QA 1VYVA 1JFRA 1M0SA 4K9KA 2GWRA 3LVWA 4QAJA 1TO2E 4BNHA 4M9NA 3IRUA 2A33A 2QRGA 2HK9A 3PSPA 2YOGA 2LCQA 5JHGB 4Q00A 4Q9IA 3O1JC 2IH2A 4Z4FA 3P9IA 1U49A 1ZM2A 2NTNA 2VZLA 4ZJYA 4EECA 1VL1A 2MCFA 1PX2A 1QIGA 5EQFA 5EG5A 4EDHA 2VCYA 2IBSA 2NX2A 5L1LA 2V9ZA 5E1BA 1X38A 1DIRA 1J8QA 4JUZA 1GZDA 2C2KA 2Q3LA 4L2IB 4C87A 5E95A 1J2YA 2P3SA 1KS2A 4F45A 4Z49A 4D9HA 1E8MA 1G0NA 1ML3A 4IOKA 2VJDA 3WRXC 1CY7A 3MR2A 2B7BA 3U7FB 1FVOA 1PT7A 2NUPA 2HSEA 3EK2A 2CJWA 4FQ7A 4KWCA 4IDPA 4GIBA 2I4IA 4WADA 4K1XA 4D3FA 2ZTUA 2DFDA 1ORWA 4I55F 5CURA 3KQNA 4FO6A 2Q0SA 1VGRA 3ONVA 4GC7A 4MW7A 4ACOA 4GI5A 1QBKC 4I9HA 4ZRNA 4AMZA 3OEWA 2B4QA 4JJEA 4M2LA 4Q03A 2OCGA 1T4CA 3JQQA 2AKEA 2COUA 3BICA 4ZANA 3OPQA 3B52X 3AEKB 3IAHA 3DM5A 3PFNA 4A8TA 4DPKA 3I62A 1SEVA 1BCRA 1AQYA 1PNQA 4QOIA 3GCGA 1Z6GA 3SN6A 3SNHA 3UH1A 2X6QA 3TNLA 1ISSA 4DB2A 4MQFB 3SAHA 1AB5A 2R7NA 3PGA1 4HO1X 3MCZA 3QMMA 4HNHA 4MKGA 1MSWD 1UUFA 1T4GA 2IDZA 2Z9CA 3AY7A 2O1XA 4HN4B 4C3VA 1DQNA 3F4BA 3ISDA 1F3OA 1MPTA 4A6PA 5BQ3A 1LTKA 4P31A 1L4UA 5COQA 3SX2A 5CFNA 4N0MA 4OUDA 8ICNA 1I14A 2CHGA 2J33A 3PUIA 4GX0A 4ZAFA 5JZMA 2VF7A 3TLGB 2UUBB 3CEPB 1JE1A 3G13A 1J07A 5AKHA 3SICE 3AHCA 1JQ5A 4MLPA 2GCPA 3JYHA 2IIPA 3UA3A 3MWLA 4NCIA 3UPDA 2KICA 4DWIA 1XD9A 3D2QA 2REOA 1WPQA 4UM8B 4C0KA 4EGAA 4YRIA 4TKLA 3WB0A 5L45A 1UMBB 3OZGA 5C8VA 3MXTA 1JX4A 1AK2A 1RQLA 3FM9A 2YXLA 4JNKA 3LFUA 1QYVA 3KTAA 3HKEA 3NWOA 1OW5A 2GILA 16PKA 4X7PA 5DXAA 4DSAA 5TIIA 3H11B 4KLIA 2NU6B 4YQFA 3H8MA 3FSRA 4ZCTA 3L01A 4HAUA 2X6TA 1A4IA 2CL6X 4ZVLA 2WJVA 3UBTA 2V1UA 4CEIA 4B76A 4B5LA 3OGUA 4DCGA 3OE7D 5LSAA 3OF2A 4QBGB 3USES 1S5LU 2RGUA 2UYGA 3IT0A 4UQPA 1QTQA 2J0EA 1EP2B 4HVCA 4NLLA 3SSAA 2FG7C 3W2IA 2DECA 5DTRA 4AZ3B 3KFUF 1JFTA 3TEMA 3UXHA 3UJPA 2FF7A 2VUUA 3T95A 3IPYA 5DOVA 5KTNA 1YT3A 1RYUA 4JT2A 3H8SA 3GH1A 4HUQB 1UBMS 1ZJ5A 2L0XA 4DZRA 3DLBA 1ZEMA 3PYLA 4I4LA 2BCRA 2WWHA 4PO8A 4KQGA 4UD6A 4Y1RA 3WNCA 1K1EA 4ZOBA 1ZIXA 4NARA 4QD3A 1V39A 3UWPA 5KNCA 4GP6A 1VCHA 1YZHA 2G77B 2O2DA 3OOWA 1BS2A 1OC2A 2OUIA 3OPYB 5E1MA 1KBOA 2CXRA 3R8XA 5I4CA 1G6Q1 2G72A 1RLJA 4P3NA 4QHSA 2WZCA 3I6ZA 4H1UA 3R76A 2XDQB 3EF0A 4U9HS 5C8ZA 2Q3JA 2JI9A 1Z2OX 4C7VA 1LS1A 4FFNA 2VTBB 2XRFA 1S7GA 1JEOA 3TNDA 5C1OA 3JR3A 5AW9A 1VJTA 4CLRA 4UE3S 5TJ9A 1DRWA 2BL4A 3ACBA 1CC1S 1M6HA 2BLNA 2WUFA 4D9NA 1V25A 2WJGA 2IE0A 2HAEA 1E6LA 4EI9A 1Y3BE 3AY3A 1PV4A 3FGPA 4TURA 4X63A 3OIGA 2ZUDA 5HUJA 4YLYA 3MIIA 4H6VA 1PT5A 1YDFA 2IYLD 5TQVA 2QW0X 5KT5A 2AT1A 1IVSA 3I9V6 1ZEJA 4DSTA 3L7OA 1QP7A 4ZK2A 3ZV3A 5F52A 1NW9B 1L7MA 3M81A 3O8QA 3VR6H 1HZZC 4JT9A 3W5VA 3M9XA 4JFRA 1L9XA 3FMGA 5GV8A 2I55A 2RKOA 1QKIA 1YULA 4QHTA 5THKA 1NN3A 7ICUA 5A71A 1YZGA 5EKUA 4LFCB 4E0BA 4Q44A 1C0KA 2OHOA 1KSJA 3N7AA 4IRMA 4D3DA 4MUAA 4W1SA 2OGTA 3DFMA 3CSUA 3NU1A 1QGAA 4C6TA 2ZWIA 1RLTA 2HT6A 3CZ5A 4NX2A 1EB9A 3DO5A 1L5GB 1S9HA 5K51A 4DA7A 4YQWA 2FN9A 4L74A 4XJSA 4JLPA 4LISA 3SMVA 2ASJA 1FNCA 3PFWO 4NJMA 3V8PA 4QUHA 2CZGA 4MIYA 3VX3A 5KI6A 2BCVA 1VHDA 3K09C 5IILA 1K27A 2P5SA 4QZIA 3LWLA 1HKHA 3RU7A 3D54D 2HJ9A 3KQHA 3DWGA 3LZCA 3OIWA 2UDPA 5ICFA 1V38A 5KTTA 4MKFA 1FU7A 3OO1A 5FT9A 1VIVA 1SHKA 2PT5A 2WKSA 2E5FA 1OZAA 3AVTA 4OAQA 4BMDA 1VDMA 4HRAA 3S2IA 4ATNA 2WDPA 2FK8A 5LP1A 4FCVA 4UAYA 1MB2A 1HFEL 1R0XA 2VDUE 4ZCLA 3VVCA 1FFWA 2XQVA 2X7HA 4BU1A 2AK3A 2JK0A 4A8HA 3IC5A 5G4LA 4WA7A 1YR6A 1N0VC 2VTDA 4LJKA 5LQAA 4XGNA 4LXYA 1HDYA 3L6RA 1WU8A 3EUEA 2OQRA 4Z6KA 5AVSA 4RD4A 3GBPA 2H52A 1E2IA 3SBEA 3HTXA 4EUEA 2Z98A 4WKBA 3TUIC 4OX9Y 2NV3A 1ORTA 3LX6A 4LJ9A 3UAZA 4PH5A 2NO6A 5B1YA 1NUPA 4NH0A 1J8VA 2P2DA 2DCMA 3QKTA 4Q1VA 4XGKA 1BU5A 1ZZEA 3U7QA 3TZKA 4KTVE 5DP1A 4ALKA 4F5QA 1DRUA 1H93A 3INGA 1W36D 5IUJC 4Q43A 2XXBA 2RHCA 3FUVA 4E88A 2VFAA 1H2YA 1MU0A 2EW2A 4QSMA 4R54A 4LRXA 1N1EA 4RH0A 1T0IA 5D51S 1UJ6A 3WNBA 1E2KA 9ICKA 1SXHA 1KFBB 3ZCPA 1MO2A 3PE6A 5HHHA 2GYYA 1SHLA 3MMXA 3O94A 4BNJA 4RTPA 5CCEA 2ZUUA 1IU9A 1C1YA 4Z6EA 1NXXA 4Y9RA 4F4DA 7ICOA 1SCNE 1QS0B 2BR0A 4IR1A 2C98A 2CYBA 5A03A 4JWKA 4YXFA 4M1YA 3ZNNA 4G0QA 4U1RA 1AQ6A 2QTZA 3RPEA 1Q6ZA 1RDFA 2L18A 1R8XA 2DUYA 2P3QA 3TRKA 4EG0A 4HL6A 1RZRD 1YO6A 4WASA 2HTFA 2QYHA 3QEOA 4W8OA 3OX3A 2LR0A 3KBOA 3RK1A 3Q7QA 4MQ4A 2WMYA 3T34A 1SR8A 3H2JA 4BNZA 3QU5A 4A6EA 1U5BB 4J9QA 4M0KA 1EFRD 4UBCA 4UZEA 4ZICA 3VSAA 3I8SA 1IL0A 1IK4A 1DKNA 4K03A 1SVMA 2ZRCA 1QYIA 1ZI8A 1XR3A 1Z88A 2WSSD 3BKXA 3QEMB 4KODA 4X7BA 4A6XA 5KQRA 4O3MA 2JAWA 2R8GA 3CWCA 3M83A 4OXQA 4RJKA 5KTOA 2MYNA 4U7CA 4Z9YA 1G4UR 1Q0ZA 4IDDA 3LU1A 3UV6A 4NLCA 4ZYLA 1EK1A 2KQUA 1Y81A 4KFRA 1QQAA 5D3ZA 1W5SA 4EJ6A 5BNIA 1MFPA 1E2DA 4KO1S 3V6JA 1BD3A 1PVDA 4MUEA 4UDOA 5GQSA 3HKZF 3HJBA 4LJSA 2HUNA 1T34A 5IJAA 2GSWA 3VPBA 2XITA 2VP5A 1FSFA 1MJFA 1NMZA 2O3JA 2OV6A 2JGDA 1BA2A 2O54A 1C4KA 1GZHB 4YRTA 1TU0A 1RKUA 2FPIA 4AK9A 1RXIA 3SJ7A 1NY6A 4P36A 2P9TA 1AM4D 5IDQA 2OC9A 5TZVA 1CE8B 1F2UB 1IY0A 1N2JA 1SCJA 1K2WA 4RQ7A 1P31A 2EKLA 2FPGA 3IOMA 3V8MA 1ZBQA 2NU8B 4GXRA 1KJYA 1M6EX 4LTMA 4YDSA 3QOWA 1Y5LA 4HGYA 5FB3A 4LE2A 4ZV7A 4LUCA 1UBRS 2ZPTX 3IDZA 4MIEA 4U39A 1Y8CA 7YASA 1Z75A 4XUDA 5KFEA 3FD8A 5AW6A 4JI7B 1PFYA 5DB4A 3AOEC 3HDHA 1KVTA 5BMVF 4UAUA 1PD1A 1T0PA 5LDGA 1P9OA 5AICA 3BF7A 4JQCA 1U0HC 1SG9A 1W4CA 2F7SA 2OHIA 4ALLA 5DU2A 3LE8A 1Q3UA 3LQQA 3LUAA 1KAHA 3P26A 1B43A 2CUKA 2NXJA 4DLYA 4G1BA 3U31A 4F3CA 1Z22A 1KP3A 4X6LA 2FZGA 3TTVA 5BWOA 5IF9A 4G4JA 4NLKA 4HUJA 1VZ2A 1Q12A 4I08A 2VANA 2VDNB 5GTDA 1WXFA 1G5FA 4R63A 3OTQA 2ZSUA 3DUWA 3ZE1B 3I9JA 1PVQA 2YY5A 2PUAA 2WWYA 1M54A 1HDGO 3LPNA 4Z7QB 2UZ3A 2Q2OA 1G3MA 1MAAA 1GP2A 1LWNA 3EXHB 3EXIB 4F6CA 4MVJA 4TRMA 1JLSA 4OL9A 3COSA 1IM2A 1BVHA 1TAQA 3G85A 2HHUA 4WNYA 1YZQA 4LX0A 5L4SA 3H2ZA 2O3SA 1CIVA 1NL3A 2AZMA 2R1UA 3CR3C 4JMUA 3DAGA 3E9EA 2H2AA 2CXHA 2FCRA 2GN4A 3O3NB 4JHXA 2XHZA 4RD0A 1KE1A 2EWMA 1NVBA 2Z1MA 4Q4DA 2ZYHA 4IDQA 3VOBA 1NG9A 4BWMA 1S0UA 1ENPA 1UDBA 5ALXA 1FFAA 2YNMD 3DLPX 3JD3A 4IIDA 1Y6JA 3ROGA 1XJWA 3V6LA 3NNNA 3IE1A 1JUDA 1BDHA 2AKAB 3CN9A 3VVMA 3G82C 3N58A 1WBJB 3FCSB 1VE3A 2JIOA 1L4KA 3OLQA 3RANA 4TL9A 2NVWA 3M34A 4XWYA 3EXEA 2Q3DA 3O95A 1UBSB 4ED9A 2HI0A 3P0IA 1C2TA 4KP7A 3IP9A 1V9SA 2OK8A 3KU4A 5DT9A 5EP4A 3RUDA 3BWBA 1NVEA 4HYQA 4DWOA 3DE3X 3FVWA 2XMSA 5J2IA 1K5DA 2BGLA 2ZR8A 3B3GA 3I6MA 3P9NA 4IIYA 5ECYA 5F21A 3VI4B 5IXYA 1EXMA 1CP3A 1NQOA 1Q22A 2P4SA 3EVZA 1I2DA 3E7DA 4LMRA 2Q7OE 3EUB2 3FROA 2QT0A 2FSIA 4X97A 1GPUA 1J2JA 2FYTA 2OXRA 2XSZA 3N2ZB 3ITNA 3R0JA 4HDMB 2CNDA 5HRAA 2YFHA 4CN9A 1ZDMA 4D5EA 2L17A 4YP0A 5KG5A 4HNUA 2HMYB 1RZVA 1WL8A 4X1IA 5HIMA 1QPZA 3L7CA 3LP6A 1WQ4A 4O2AF 2FW9A 3SYRA 3CLUC 1XFAA 3A7DA 3D6AA 4KUHA 1GGKA 4ND7A 1SU4A 3NP7A 2QT1A 4CKWA 1TQ2A 4CM4A 3OIYA 5G41A 4FYJA 4IEFB 3X43A 4EJMA 3ORSA 3DDCA 3LY5A 5CLGA 1DBPA 1R3UA 1XMOB 1FS5A 1L7RA 1QTRA 1R00A 3C2QA 3AHHA 4W5RA 2ZB8A 1US8A 2OSVA 5EZSA 3PPIA 4NZZA 4Z99A 5EMJA 1MP0A 3B60A 1ZMBA 4NQZA 3N4MB 2AV6A 2QRLA 3L07A 4RH3A 4W4TA 2IHUA 1NVTA 2PVSA 1G4HA 4MS1A 3SZOA 4BDTA 2ZVPX 3NVKI 1RYDA 2VBCA 2AJDA 4LYFA 4POAA 4PWYA 1XU4A 1FYEA 1Z62A 4IIJB 5LA6A 1JG4A 4WOCA 8ICEA 3HHPA 5J9FA 3REFA 2PL3A 3H05A 4RULA 1NQVA 4MVJF 3IB3A 4GM1A 1A8QA 4X85A 3GVPA 3ZVLA 1V1MB 2XY5A 2JAOA 4LNAA 4Q1DA 1YGYA 3GLGB 4F8RA 4OXIA 2C1ZA 1XPOA 5ULLA 1IHYA 1IIBA 1K75A 4XA5A 4HLUA 3B6MA 1X1RA 2XKAA 4M22A 4KSCA 4R2IA 3AUYA 3U3MA 3ZU4A 4ERNA 5LYJB 421PA 5CFQA 2PMWB 5BSTA 3U62A 1D4ZA 3N2GB 4X8MA 3UHFA 4G4GA 1LQTA 1R12A 4IXMA 5DOZA 2XDAA 5AP9A 3JU3A 2A9RA 3L8DA 1ZRHA 1P0CA 4ZDWA 2G07A 2AR7A 2UVQA 5K3CA 1RHRA 2QN6A 3VTKA 1UQTA 2WRZA 4HH0A 3UJNA 4URFA 5HOEA 2J48A 5FJJA 3OJ0A 1C3EA 3LK6A 2A0FA 3I4CA 4KR7A 1UKBA 4CG1A 5AW4A 1R7RA 3LCUA 1X7ZB 4TL6A 2AZDA 1AOXA 3N0TA 1JSXA 4RD2A 5DLQC 1W5EA 3E0QA 4EF5A 5DCUA 1I6WA 2I87A 4INAA 4F4XA 2RBEA 5GZ3A 4B71A 4BVFA 2K89A 4R6WA 1BXRA 4R3UC 3U81A 2HK7A 2X42A 3IAUA 4PLGA 1D2GA 1GDHA 4DR6B 2DUWA 2QSZA 2VDJA 4O3RA 4OQ4A 5JI2E 1G6HA 1SELA 1IPHA 1JR3D 3HP4A 3SKXA 1ZMXA 3D59A 1GNTA 4Y7DA 4GZLA 1PZEA 1ZQVA 13PKA 1YQDA 3AFGA 4HDRB 3W5BA 4JQSA 2AMLA 4J49A 4CKBB 1XTPA 1XTKA 1Q92A 2X0JA 3U13A 2AN4A 3HFSA 3IJRA 1OE0A 4ZV4A 3VOAA 4BKOA 3BCRA 2BTOA 2ZTCA 1TZ2A 1F8FA 4NE7A 3RYFA 4UEWA 2OM2A 3EBOA 3GP3A 3HFRA 3LRXA 3N76A 5KYYA 1YXMA 1F8XA 4V0SA 2ZJ2A 4U8GA 2YRXA 5FULA 6NULA 2OHJA 1ULZA 2G36A 3V7WA 4XX1A 5F4ZA 4NBUA 2XZTA 5K0FA 2ACEA 3QXSA 2VK8A 2OAEA 3FHLA 4W9NA 3NAGA 1OPRA 3RGWS 4QFDA 1GDTA 4XSGA 4FYMA 2ET6A 4GMKA 3FVVA 4P58A 5H4HA 1V5IA 1ZK3A 2VQFB 1U7WA 2GZSA 3PUHA 3V2HA 2E9SA 4JKIA 2I9PA 4XIFA 4XFKA 4DJTA 1SK9A 1SPXA 3EGXA 3O73A 4IICA 2VJ5A 2R8IA 1OZGA 4IDBA 2P2CA 4KMMA 4US1R 5I7HA 2GD2A 5TVKA 3ZKAA 4MHTA 1YTUA 3VV3A 3SMQA 4OA5A 4R8RA 5INTA 1E61A 4G4IA 4B7ZA 3B12A 2PMBA 3H4BA 1IHDA 1Q0RA 1YOVB 2JZNA 2WWRA 3VR3D 3ZCXA 4D8TA 2PZJA 2XGPA 3KZMA 4BJQA 4KJXA 1XNQB 2V1XA 5J3JA 5EL0A 3FHCB 4WN9B 4BO6A 1FPQA 1DWOA 2OYSA 5CVUA 2VK2A 3QXJA 3RYCA 1WNTA 1Q0HA 1SIWA 4RQAA 2BC9A 4G63A 4KN7A 1GNVA 1NK8A 3H0KA 5FNVF 3K2IA 4XDHA 3L9WA 4AECA 4ZOQI 1ECCA 5CFZA 1W4RA 5EXXA 4DR7B 4GOKA 3Q1KA 2EU8A 2XODA 3Q3JB 4WXEA 4XYLA 2Y0BA 4BMYA 1RWMA 3B85A 2Q1XA 2I4LA 1BEEA 2Q07A 4DF4A 2WG2A 2QPTA 1CQZA 3DYBA 3G0OA 2Y2UA 3GRVA 4FHFA 4L4SA 5D5PA 3AI3A 4RHYA 3VU1A 4B4OA 5EJ8A 2WU1A 1SBYA 5I4BA 2QLNA 4YMMA 1XN1A 2C20A 2W04A 3ZV6A 3LAWA 4ZOLB 1THZA 2CVHA 3EHEA 1OF1A 1N0HA 5LQRA 3EPHA 1XXLA 7ICHA 3GRUA 4EFLA 5BPCA 9ICQA 5KTMA 1RACA 3V2UA 4EW2A 3UYLA 4G0OA 1DG9A 4PZPA 1U2TA 2H4JA 4NBNA 5F3XB 4M1MA 2OZKA 3M6XA 3SGLA 5MGBA 4HPXB 5ALMA 2F3QA 1NK0A 3L4SO 4UUQA 3TJZA 1K89A 4BNYA 1WXGA 3WLOA 3IEMA 2HSJA 3RFVA 1K8ZB 3CURA 4BVKA 3GLHE 3NXSA 4M36A 4MTLA 5LKAA 2B5WA 5DTQA 3NQ41 1RHQA 4DABA 5EC8A 1T2UA 3HCNA 3LC1O 2L2QA 1IOVA 3L4BA 1D6SA 2CLFB 2VDWB 4A8JB 3G2KA 1XC9A 1K8QA 4WAUA 4V0KA 1U8XX 2BZSA 1L3SA 1QIKA 1UXOA 4BWGA 4LF5B 2W2NA 1WWUA 1ZQDA 3BK7A 3JVDA 3C4VA 1NW3A 5I7UA 1IUKA 1TTPB 4QGGA 4I5IA 4PHHA 2JAXA 5ARDA 2IITA 4JWMA 2OG2A 3CMMA 1ZK4A 1ZFNA 3A26A 4RAOA 4U6NA 5LC1A 3DEHA 5SZHB 1ODSA 1JEAA 1ISJA 1UPTA 2O3UA 5CLFA 3CF2A 4W8GA 3UGKA 4WFJA 3WNZA 2Y1LA 4B45A 4M0PA 3UMYA 2J3DA 1U3DA 2ORWA 3CP8A 1QYRA 3EZFA 4H77A 3REQB 4NZPA 5KCMA 4MARA 5FPKA 5ENZA 5JHHB 4D81A 2GBLA 1DQRA 2E37A 3UUWA 2NRWA 1G2IA 1NKVA 4KXNA 5ICMA 4FW9A 4WCFA 4R3WA 3SXPA 3KAJA 4EZ6A 1PJZA 4EBCA 3OSPA 2HLNA 3NXKA 2BTEA 4ZO8A 3FI9A 2VDVE 3M9LA 4OQDA 3F0TA 3D8RA 2C5FA 3IOEA 3D3EA 5EFOA 5IM5A 5DLFA 2ID8A 2ONKA 2WIAA 1X9GA 2Z9BA 3BDIA 4C08A 3EC2A 1N2EA 4QU9A 4URYR 3EXAA 2JAPA 3HBFA 4EG1A 2YZ2A 1SCAA 3K5IA 4HR7A 3FCAA 2W00A 3O2QB 4ARCA 4BNLA 1W581 5F12A 3AKEA 3KKPA 2H2IA 2F00A 2ZCVA 2WE7A 2CD7A 3G8YA 3AUXA 3GFBA 4JJZA 1N9GB 4E3ZA 2VPZA 3EEBA 4ZI7B 3BCUA 3BJEA 2DR2A 3RHZA 4NBWA 9ICIA 1KFEB 3QWFA 2ZSJA 3COYA 1IZ7A 4Q7QA 3N8GA 5BSGA 2NMVA 4I2CA 2JMGA 1ZAKA 1GRVA 1CNFA 1NR1A 3GZTB 4KN9S 2YXNA 3LQYA 4BX9A 3QEAZ 1EVLA 3L7NA 1PL6A 4AX4A 3TIFA 4DXDA 4B2PA 5LIPA 2BGIA 2FDCA 5CG2A 4BB6A 4R01A 4MPJA 3TSAA 3KE8A 5KC9A 1B16A 3QNWA 1VSTA 5EOVA 3MD0A 3W6NA 3KHSA 1U81A 2XCSB 4A7PA 3I64A 2OPHA 5DM1A 3FZQA 2MSCB 5BN4B 1YFZA 2F1RA 3AG5A 3OUUA 4O4IF 5BURA 2ZU0C 4CKCB 4O1MA 1JZTA 5IT5A 3JTEA 1GAWA 1V7PC 1YRLA 2R8RA 2PI5A 5LUAA 2JG3A 4E5NA 1ZJ6A 1DEOA 4U8HA 5JUMA 1QDUA 4RBNA 4UBJA 2GN2A 1V3QE 1WPRA 2O3RA 1FP4A 3JQPA 4DFPA 3B9QA 3UT6A 2CFSA 4AY2A 2VXYA 5ALKA 5D6OA 4O0IA 1T2CA 1I0IA 2OB2A 2O0JA 3BMNA 2IV2X 1S96A 5JUWA 2VYNA 3QLUA 2RG1A 1M34B 3CR8A 3H4TA 4HYTA 4QU0A 4KPUB 4DC1A 2Y1XA 3JYQA 1Y8RB 1I10A 1QK3A 5ALRA 2W4QA 2AFHA 3F2IA 3PYMA 4XASA 4GL2A 2QI9F 4GBJA 5E2IA 1B2LA 5CFLA 1JQLB 2CHUA 2QN2A 2YIDA 5C1DA 2YZ7A 4GDFA 1ULHA 2G7MC 3FDZB 1DTWB 3FTEA 5CCDA 1GPKA 1BMFA 1BVUA 1GLVA 1P9RA 1VBKA 7ICRA 4IIGA 3VPHA 4FE4A 2GVZC 3RAXA 1PVRA 5CHEA 4B33A 4BFSA 4PYLA 5J8YA 1F8GA 2QRKA 4I9FA 1ZOPA 4BCDA 2ZBPA 3H5OA 2W2TA 3U6KA 4GNKA 4JZKA 1P7PA 7ICJA 3G3EA 1G8SA 2PRYA 2AFIB 4HGOA 4LZPA 1A8IA 3E6AA 4C5CA 1RYYA 4QPPA 4FGSA 1GO3F 4PX9A 3VPGA 4JR1A 5CA1F 1X15A 3CRVA 3CFYA 3HPRA 3DOOA 3GLFB 2PBRA 1DEKA 3NTOA 1FYVA 1LK5A 1WB6A 2VYCA 3LCMA 3S27A 3MSCA 3W6PA 4U9IS 4QUKA 1ZNZA 2CFIA 3IDSA 3MMPA 4DVJA 3GFVA 2W22A 2VK1A 1RJ9B 4JWNA 1AS3A 1LQUA 2P9YA 3IUYA 4NBVA 1EWRA 4YR2A 4QGFA 3EDRA 2IXEA 5KAPA 1URPA 2I03A 1UBGA 2LD4A 1YQUA 4I3FA 4ECUA 1OASA 2QU8A 1MOPA 4RH1A 4ES6A 4CIYA 5JU5A 1YWGO 3GOHA 2IXBA 1Y9EA 2QPLA 4M49A 4YQEA 3S7ZA 1ECFA 1O0BA 1RKXA 4EG6A 4QULA 2WAQC 2NTEA 4ZVTA 3O38A 1VHWA 2WHYA 2WYHA 5BQPA 3TE7A 3W9YA 5IHXA 1HE8B 4UU0A 2I2DA 4OKNA 1R64A 1W93A 3DOJA 3PQFA 4V3BA 2XADA 4ZAXA 1F48A 2IIQA 4LVCA 5NLLA 3ZGLA 3LLUA 5KVSA 1NVXQ 3TLMA 3NX4A 4R0MA 4H31A 2FG5A 4MZDA 1NSYA 2FQQA 1XDBA 3BB3A 4MR7B 3RVSA 1E2LA 5CG1A 3VKVA 4FT4A 5TC4A 4DCTA 4UMVA 2PN1A 3LGAA 2PCLA 1YZ6A 1UMCB 1D07A 1H1DA 2Y1CA 2OO3A 2DGZA 621PA 2X3UA 4BGVA 4V0RA 2C5GA 1X80A 1BXKA 1IWPB 1TCBA 3ND7A 3DD5A 3LCVB 4G4SO 1TD9A 2XUIA 5JZ9A 4I2JA 3PSFA 2OQIA 3C74A 5JH7B 4DL3A 3JQFC 4L9SA 4BNFA 1QGOA 1S2MA 4PYIA 1T9KA 1FIQA 3E5MA 3A4TA 4YCJA 2FX5A 3OFVA 2C3OA 4L9RA 4RLHA 3GFRA 3KXKA 4BS9A 5JISA 4Y1GA 1ZRSA 2ZSKA 3P9SA 4Q01A 1K7XB 4O33A 1WCNA 5EWMA 2BEWA 3RSCA 2G83A 2ZYAA 3QBVA 4XGRA 4UJ3A 1Z2PX 2C97A 2VXBA 1C30A 3JASB 4ZQCB 3TSWA 1BHQ1 1H8ED 1KI8A 3PNYA 3IAS1 3BGDA 3EVNA 1DAPA 5DGIA 4MRNA 4M4SA 1U65A 2A3NA 3MTBA 4COOA 4BFVA 3OZ7A 4DLZA 4QXMA 3LTEA 1YCGA 5CEHA 1QSGA 1UK7A 4AJPA 1XEWX 5E3JA 1N62A 4BYGA 2BBSA 1WOMA 5JFOA 1Z4LA 1N6NA 2VPXA 1SBQA 3KEMA 3E3MA 3QKRB 3Q6NA 4JBNA 3ZU3A 1OLUB 2JGKA 1J0CA 4EJ0A 1T36A 1NZBA 4OGKA 4R16A 3AV0B 2M6RA 1QVVA 4QZDA 2Y1JA 1A9OA 2Y0EA 1XZGA 2O7RA 4YK7A 5EXEA 4FOTA 3R5JA 5EE0A 1DT5A 2Q0ZX 2A1IA 5AQ1A 1T0UA 1YQ9A 3UM9A 2XCTB 1BVSA 3ENZA 2X3FA 1SGGA 1B42A 5J4LA 3CE6A 4BLQA 2ZIUA 3YASA 1A7JA 1X8JA 4RY8A 4Z86A 1L0BA 2QMEA 3G0GA 4AWXA 2ZVDA 3N8KA 3I2FA 1P9NA 3COJA 3T5LA 3HU2A 4U9UA 2KW5A 5KFIA 3ZY5A 4BC1A 4PHAA 5BT9A 4XEUA 4UQLA 4YT5A 3T9AA 4FFWA 1T5DX 4EG5A 2VQSA 1JXQA 3NG1A 4PZ0A 4BO1A 1YHYA 4CJXA 5JSZB 3K0AB 2HA2A 4II3A 5AXBA 2XUPA 1M2GA 1P17A 4KG7A 2BFPA 3CEJA 4B3XA 2WAYA 2KKPA 1DOQA 1OX4B 2FQ1A 2Q0QA 2QLFA 2WTXA 2FPUA 2YJNA 4TTRA 5HZMA 1I7QB 5LU9A 2BN4A 3LNTA 3KKAC 1VBFA 2J3LA 2OBLA 2PY6A 4KZPA 5FFNA 3U61B 1QRSA 1FRFS 1W85A 1EWYA 2AA3A 3LCJA 4I0WB 4Q19A 1XCLA 4EAAA 1FS4A 2WHQA 3BEOA 1U9JA 4LRWA 5DCYA 2VZ9A 4GLXA 2NZYA 4OOFA 5FTWA 2MTBA 2X0KA 5DB9A 1TO6A 4NMMA 1JKJB 4B09A 4UXHA 5G53C 3C85A 3ADDA 5FL7A 3HPOA 1R0RE 1U2ZA 1SCBA 2DPXA 1IC6A 1NT4A 2PX4A 3TQCA 1CUCA 1QJ4A 4M8LA 3U4DA 3IIMA 4C7YA 2VRBA 3HFJA 3E0FA 4JBLA 1H22A 3T1QA 2H1RA 1VSQA 5E6SA 1ZD1A 1RZUA 3GMDA 3L0PA 2HA7A 4FNMA 4IJQA 4V0LA 1SIJA 3M6VA 5JQGA 5K03A 2FXVA 3NCTA 1S0NA 3WGYA 2CPRA 1JVBA 1RS0A 1PJBA 3VMFA 3Q10A 4C7BA 5DK6A 1QIDA 2JEFA 1U5AA 1S0OA 2AUMA 2KTQA 1QUEA 2CW5A 3AVQA 4HY3A 3QFTA 1UDRA 4OLBA 2LKDA 2UYOA 3K6RA 4AZ3A 4OQQA 2JFHA 3OOHA 5CUQA 4ZTBA 1JMVA 3I2IA 3MJDA 4MROA 5DYWA 2JEOA 1FDIA 2NACA 4X1YA 4TTQA 4MKZA 3GJ3A 3NBZC 3NB0A 4C06A 2EKQA 2EYUA 3DE6X 3E4DA 5DYIA 5A5FA 3I5AA 5KVVA 2ZUFA 1D6JA 4ZHSA 3CLUD 1UDWA 4O1HA 2Y93A 4OPMA 4CKBA 3O5AA 3NHZA 4X7MA 4XLTA 1DUIA 4HMPA 3RC3A 2VH5R 1BRMA 1WAMA 3I1YA 2Y1GA 3CZRA 3HXTA 1PJRA 4RZXA 1O0CA 3M7IA 3SHQA 3GLUA 1Z38A 3R5FA 5BSRA 1LH0A 3D7KA 3R74A 4E5YA 3QU4A 2O3TA 3PX7A 4CKYA 1IHUA 4GGMX 2QUHA 2F6RA 1II8B 5CT6A 1VMDA 1XEWY 1QC5B 3LLSA 4X6UA 5HFJA 3F71A 3JQ6A 1DO8A 5L7YA 1LDYA 3IKLA 5BN1A 5I48A 5DGCA 1USIA 2JH1A 5KREA 1MO4A 1GUYA 2BZGA 3RV4A 1Q6YA 3TRHA 1GPBA 5LXTA 3UAVA 1XKLA 1ZK2A 2O8EB 4HQKA 2YN4A 1T2DA 2EIHA 3VR1A 1ZVKA 5SY4A 3HJUA 4RTNA 2WVGA 2KKVA 3OQNA 1S0MA 2Q5IA 3VNRA 2CJFA 3IEUA 4WUTA 1XHLA 2CMGA 3L82B 3LHFA 3NEYA 4OGLA 3V7NA 4B83A 1DQZA 1GOTA 1K3TA 2DTXA 2WFLA 4G1FA 2BFEB 3BA1A 1EUDB 4PZUA 1J9ZA 3T1OA 2ZRPA 2DJIA 3DULA 5LYYA 1B74A 3HGTA 2WUEA 3K9BA 3RYCB 1AKVA 3KELA 4OM8A 1ZQMA 2J5KA 3AR3A 3R3HA 4XQGA 4OSOA 2XKBA 4MVCA 2E48A 4Q39A 3RU9A 4F8YA 4RGYA 1KFCB 3ZHCA 2DKNA 5F7XA 3F3YA 1UPCA 1P44A 1QIEA 2TRSB 3T94A 5BWBA 1RRFA 5IZCC 3GPLA 2W6QA 3VKGA 1N1DA 1V1RA 1GUAA 2HOFA 1DK2A 1DJLA 4UKDA 1KNXA 4XOUA 4GWLA 1J42A 4MFAA 1USUA 4DDTA 1V45E 3LGSA 2HGSA 4EZIA 4F72A 1U94A 3KXIA 4HDCA 3L46A 2HU8A 3D4PA 3GUCA 5FWNA 3H9CA 3OJEA 5I9LA 4WBXC 3ZDZB 1PK1A 1GG9A 3OOJA 3V32A 4DXAA 5DMXA 4LXXA 3OSZA 2QYTA 3LYLA 1T36B 2YHBA 1OU0A 1KFKB 3FPCA 1JXOA 4GQAA 2I1QA 2EQ5A 4F91B 1AUPA 2IC5A 3CIOA 1A9SA 2G1AA 3NHFA 3T06B 4BNTA 3JQAA 4PAGA 5JWRA 4YHBA 3Q2KA 1NLZA 1YV9A 1EGVB 5HKAA 3JSAA 3B3QA 4BEBA 3ROPA 2J31A 4DWJA 5JLJA 5BQOA 3WC4A 4L5IA 2I1VB 2Q1UA 1YVEI 1WYGA 8ADHA 3M2PA 4WDQA 2HO4A 1O96B 3ZCUA 2UYCA 4YUZA 4YDHB 3BIWA 1W6UA 4BUGA 1ZD4A 4BAZA 3NVZA 1CS0B 2JLQA 5L1JA 3A8TA 2BI8A 3GLHB 3WMGA 4YRGA 2XQKA 3LQ4A 1L8XA 3RUIA 3E8MA 3R7AA 3TOSA 2A5GA 1RM4A 5LP6A 1ESDA 3HVIA 4MR8A 1XA3A 5JAIA 3BGSA 4G5OA 4US9A 1KHHA 3PNKA 2NZ2A 2PIDA 3URKA 3OZCA 2FVXA 2IUYA 2PGDA 4URZR 4IJ5A 3SZLA 2JPDA 4F9GA 4RJLA 1H2XA 4U02A 4PR3A 3E2MA 4ADSG 1TADA 1GG8A 2Y4OA 3LVRE 3IURA 5BSVA 4LHYA 5AOBA 4PGMA 5T3YA 4DEVA 4OJTA 5K0BA 4O08A 2UU9B 1UBKS 4BO4A 4QXRA 9ICLA 1DX4A 4X44A 4MYHA 1E1MA 3M5CA 1DRKA 4EX6A 1SC9A 2W2MA 1M1YA 2KSQA 4KU4A 5FNVA 2RG7A 4JLAA 5ARCA 1QO7A 2QB1A 2F2TA 2HA0A 2EFHB 1QG4A 3SZ2A 1A5ZA 3PQ3A 3R9IA 3O4HA 3SLRA 3EGXB 1YD7A 1BXZA 2FXIA 3IBCA 4BYMA 2JXJA 3EYAA 1XL1A 3RSHA 3V1MA 4AZ0A 2RGAA 3NAZA 3S6JA 3C6ZA 2IZOA 1P5ZB 4R2HA 4YRBA 5JAPA 4ND3A 4RQUA 3AUFA 2PA3A 2QTNA 2DHDA 2EX1A 4TKVA 4BZPA 3A9TA 5LWQA 1Z0IA 3I3SR 3K5HA 3SYLA 5A2QA 5J0TA 2OEHA 4Y2YA 5EE3A 3FFAA 3QYAA 5EIXA 4KR6A 4KKVA 1FLNA 4ZI7A 3BXEA 1KK0A 4UDXX 1D2MA 1ZG3A 3K53A 1S9FA 3UMVA 4BO0A 4U5QA 1XQYA 1CI4A 3FPKA 3HN6A 4LNUB 4QXPA 3RABA 4TLMB 1LSJA 4H6PA 1EBBA 2YINC 4KN8A 1PEDA 1J24A 2LCFA 4C0BA 6CHYA 3U6BA 3A9SA 5IU6A 4F04A 2J3QA 4GP7A 3S44A 2JFUA 5WRFA 5IKEA 3MGKA 2WNIA 4H08A 1A9RA 1OFUA 3PHLA 4PLTA 2Q2QA 4OXYA 4RO0A 2GFIA 4F2HA 3MWEB 5KNCD 3B70A 3KLBA 2NZ8A 1Z68A 3N0RA 1OXVA 5ANRB 2EFYA 4LZAA 1KMHA 4B9NA 3WSTA 2ODPA 5D46A 1ULTA 3F5AA 5K45A 5HJEA 2FK7A 1ZQBA 2H5XA 3GFOA 4F06A 3NVMB 2JBHA 2VC2B 1Z83A 2LRHA 2TECE 3SCZA 2O0LA 2NT3A 1KWKA 3A9RA 2WA1A 5IABA 1DGQA 1SN7A 1X7DA 4EHLA 1NK6A 3AP3A 2ORED 4IWXA 1TVKA 4MUGA 3TD9A 3N2EA 4UFOA 3H86A 1XTRA 3AU2A 1BQEA 4B9LA 1MTZA 2IIBA 4AZVA 1Q1BA 1YJCA 5JSFA 3H0RB 4UDYX 5LNK1 4FGJA 2C92A 2I62A 1E0DA 5AHXA 2AOXA 2UKDA 3GN1A 3HXLA 3Q72A 3TAHA 3TPFA 1T9BA 3IEIA 3JXEA 4RPZA 4JJKA 4NU8X 1PJQA 5LOVF 2C2MA 3VA7A 2CLHB 1XLWA 4DLTA 2WWFA 3OZIA 4AJ2A 3CH7A 3ZHOA 4ARBA 1XFDA 1E96A 1RTKA 3GJRA 3RJEA 2BW0A 1N5DA 1SCQA 2OZLA 4PFQA 4CMEC 5JSQA 3EGWA 3RWBA 3AF1A 3VYTB 4OFZA 4XCXA 1S4QA 1VJCA 2FJ0A 1AG9A 1O77A 4NESA 4H3SA 3D2NA 5AM2A 4RDCA 4ZOCA 2PTHA 1MQ3A 3AB7A 3KQTA 4NZNA 4XA8A 5GJVC 3P2IA 3CZ9A 3D4IA 3KOWA 3AESA 4QBTA 4W1QA 3WRYC 4O2BF 1IZ9A 5J0XA 5C18A 4YJ2F 5LM3A 1CEYA 2XUHA 2YC4C 3NRZA 3BHNA 1IQ0A 3GY0A 4AN1A 3HI6A 3IIJA 1V9PA 1ZK0A 1ENOA 2OKGA 2H1FA 4MUKA 4TVKA 4RNNA 3OPYA 1LPBB 4OGFA 4OP1A 2PE5A 1XPRA 2JFGA 4UB3A 2FPLA 2GO1A 2JHGA 1GXSB 1ZINA 4RKRA 3EG9A 2JRLA 4HSGA 4UCQA 4ZYYA 1IMOA 4BKQA 1YVRA 1D6MA 4RQ3A 1H23A 2C5BA 2XE4A 4HP8A 3PQ2A 4PTZA 3T7RA 2RGEA 3CRXA 4B3TB 1KJ8A 4DSNA 4OH1A 2GBGA 1QHXA 3EUFA 1SIOA 3M4JA 4MLZA 2GXSA 4CUKA 2FJ6A 3T5BA 3ABZA 1FDWA 3IERA 3K1ZA 3VO8A 4O6VA 5BN3A 4J0DA 3KTAB 4GYWA 1ZWLA 3AEUA 1F4VA 2WIJA 3RF9A 4AG3A 2P9CA 1VYUA 4ZJPA 2QTWB 3GT4A 4F5YA 3SHOA 1G8AA 2FSHA 3RFFA 1WSDA 2D5CA 3N2IA 2G1PA 4IXWA 1FQOA 4MR8B 1ZQKA 2ZETA 4YPOA 4TMTA 2HX1A 1BOOA 2GM9A 2Q6LA 1J5XA 2XY4A 3OQHA 4LXUA 2BBOA 5FYQA 1NV9A 2G4VA 4YCAA 4EUKA 5A9SB 1THMA 3BRSA 4D26A 5FJIA 5EUBA 3WB9A 3PXDA 2H57A 4NK4A 4RTRA 4UTPA 1UK8A 2I6XA 2CXYA 3ZWXA 4DMFA 3C2KA 1N36B 1WEHA 3E9MA 3FVQA 3CW2C 5IK2A 2OORC 1U1EA 2CHVA 4JLNA 4R1SA 4EQ6B 2GDJA 3IPAA 5A4IS 3S7TA 3WSWA 1XZNA 3PVXA 3L8ZA 1QRDA 2IYOA 2IOQA 3G8BA 4RTLA 5JXGA 3V4RA 1X1SA 2BDEA 1P4AA 3QFSA 4EX7A 1RMYA 1QU2A 1P2UA 3VI3B 4CCYB 4EJSA 2J9YB 2XMPA 2L42A 5HXAA 5IMSA 3WYGA 1VHTA 3TAQA 1GRRA 5E79U 1O5OA 3RJIA 2HZBA 1XMIA 1RJDA 3B6JA 5AYVA 5A2GA 5A6VA 2ONCA 1BXGA 4NYJQ 4OI4A 1CZUA 5CLQA 3RIHA 4GZ3A 1HWYA 4PGYA 3C5WP 4BOYA 1JFLA 3QUBA 4K2AA 1V6CA 4IDAA 1A2KC 3TF5A 2ZI7A 3K1RB 5CNIA 3R7FA 4AQDA 3RUPA 1TM2A 1OGYA 5CR0A 2QMZA 4R6XA 1QUFA 1BU8A 3HGQA 1JIQA 4ARZA 1FUYB 5J2TB 1V85A 4WNCA 5DM4A 1P0MA 2F8MA 2Z43A 2J3EA 3IUSA 4RD1A 4EZEA 1M34A 3B8HA 3AP1A 4J07A 3UBMA 3NVWA 4ECEA 3JPOA 4W7IA 4UM9B 3F1KA 3WRYA 5REQA 1WHTB 2KE5A 2BMDA 3HACA 3L0BA 3RASA 5DX0A 1EYZA 2VEOA 3OQIA 3NALA 2JASA 2EAPA 3NIWA 3TD2A 4D8YA 5IT0A 2VK4A 3ZQUA 3JQBA 3A1CA 1UR5A 1Y6QA 3Q4GA 4DYHA 1M67A 1UK9A 2VHCA 4LPSA 2X1LA 4LRTB 4QRIA 1QF7A 2CV1A 5A0TA 2WY2D 1VLVA 3E8SA 4CUJA 2HW8A 4MQUA 2NAFA 1N92A 3CLHA 2LYAA 1E9EA 1MORA 3MFQA 3MLAA 1YE8A 4CVNA 4L8WB 5KT3A 1QVRA 1JQBA 4O25A 5JSYA 2HQ1A 1V5WA 3IGFA 3IVAA 4PYMA 5FHQA 5B7PA 5AVWA 3HVRA 2CBXA 1XEXA 2QD5A 3TH5A 1VMAA 3ZWQA 4E09A 2KZZA 3IG8A 2HWYA 4UVGA 1TC2A 1BJTA 2C0PA 3J7TA 4B48A 4IJKA 4IIUA 5EXSA 5J4HA 4PLYA 1KO8A 3I58A 4BNDA 3D8TA 4INOA 1Y1PA 2R4TA 4KSYA 3KQLA 5LD2B 4EA8A 4AVYA 3DBHB 1ISMA 3ZCVA 3MWDA 4IH9A 1Z33A 2Q9CA 4PSVA 4PYNA 1HDCA 2OXEA 3NBMA 4ERXA 4ZHQF 3IN5A 4J7XA 2XNHA 4P4PA 3GIJA 2Z83A 4MUJA 3BUSA 3OM9A 1PSDA 1YACA 3VX4A 1YA8A 2P6NA 1SKSA 1PNVA 1OBVA 4DDUA 1XCMA 3BQMB 4US8A 3MDCA 4RSHA 3RSZA 4NG5A 1G5TA 2IYXA 2XA2A 4YMLA 1X87A 1OREA 3LBNA 3OJCA 5CYPA 2JGRA 1Q5PA 1E0KA 1Z6ZA 3AM5A 3PFGA 2FSUA 2KHZA 3ED1A 2PMKA 1WXQA 2W0SA 3I1FA 2JH7A 1AGRA 1N5WA 1LRJA 1WQ1R 2DKXA 2IUFA 2WABA 3DOFA 1OYOA 4I2VA 4E4RA 3LF1A 4MI3A 4DCOA 1ADGA 3UATA 1NDQA 3OZVA 1JPVA 4RKEA 5EQJB 1EFKA 3H1GA 4DLEA 2EL7A 5G0VA 3ST7A 4KLAA 4ZEMA 3WHIA 1KRXA 3WX0A 2N1MA 1P3Y1 4KWIA 4KLUA 1RXYA 4G5SA 3SOPA 3GUZA 1SU7A 2V97A 1AZWA 3BQ9A 1JQJC 3S8MA 3EHDA 2BQ3A 1AQLA 4QYIB 1E3MA 4YCCA 2C3MA 1R9JA 4XQCA 3HN7A 3ZQ4A 3JVUA 1GUDA 2ERCA 2IHTA 4PE5B 3P2JA 4S1OA 4DANA 3DFZA 2ZUWA 4ECTA 4HZUB 2BEWB 3WJ7A 1Z5GA 1ZOOA 4WFQA 3SQNA 2CSUA 3IT2A 3EOAI 3IP7A 4TS3A 2XTZA 3CLVA 1S9DA 2JFBA 3OZUA 5EIAA 1IV8A 3AF3A 1OXSC 1W85B 4Q3NA 4EYHB 2Q7XA 1C7IA 3KAQA 3FYUC 3H3XA 3FNEA 1JKIA 2BFFA 3OMWA 3ELWA 4XIIA 5EUCA 4P33A 3W8NA 3RARA 5LCXA 1BEUB 1CXZA 2A88A 5AOAA 4D9JA 3Q9NA 1OFIA 2C3YA 4B2LA 1GFZA 3MJRA 1GCIA 3ENWA 4Z54A 4D41A 2E21A 2EGUA 2W2KB 3GPBA 4YJ3F 3WZMA 3A14A 5FOVA 4NJEA 1KRWA 1DDIA 3CSDA 3KX2A 3AN1A 4OQMA 3WNQA 2DQSA 4TXJA 5I7VA 1V4NA 1RKVA 4MRMB 5CNJA 3GZNA 1T5OA 1E69A 1T5BA 3MS4A 2R4UA 3PKJA 3VPAA 3ZI7A 3N53A 1HM5A 3GWZA 4B34A 1N5RA 2OK7A 2P66A 3IP6A 4NEHB 2OFXA 2VZ8A 1F4LA 1HDEA 1HYBA 1U11A 2G5TA 2QSJA 4OIMA 1M74A 1XZLA 3C29A 3OI7A 4J9KA 3PHHA 4M1SA 2WM3A 1MC8A 2J5RA 5E2AA 4K9PA 4QREA 4RZQA 1ONSA 1VQ1A 4FMBB 4L4YA 5JRJA 2BFDB 2WPNA 5HM6A 3Q3VA 4Q6BA 4U3JA 3SXUB 4QEDA 5JD5A 2P9HA 1B22A 2YZGA 3HMQA 4WJKB 4QWEA 3UMSA 4KE9A 1M2VB 3DBLA 1JZQA 1UM9B 2P9JA 3ZDXB 1JG6A 1LX6A 2FEXA 4MUIA 1RYZA 3C6QA 1X66A 2EEPA 3PR1A 2KOBA 1M1YE 1FZQA 5JAHA 3ITEA 4Z4GA 3RR7A 2WF6A 1QPBA 2D3WA 2GZRA 3FMPB 4FMDF 2OEPA 2Y77A 2A14A 2IEGA 3EZYA 3AILA 2VT6A 5TF4A 4PGXA 1SOAA 2PX6A 2XOKA 3IQZA 4AO6A 3NNDA 3TMKA 3BQ2A 2BFWA 5L9AA 1KJZA 1WR8A 4OHOA 4GPTA 2NRVA 1XMVA 1Y6RA 4J94A 3PX3A 4K6HA 2NN3C 4P2GA 4QPCA 3RRFA 2FUKA 5BOVA 3E9CA 2PPVA 3DH0A 4JOSA 4R51A 1OUMA 4PL1A 2GFHA 2G5GX 5HSGA 1YHZA 3KE9A 7ADHA 4F12A 2LP4Y 4TGLA 1QVWA 1SUFA 3AEYA 4UAGA 4M46A 3GRYA 3AJEA 4PZCA 2C59A 4KO3S 3H6GA 5KHLB 4TV9F 1HH4A 1R8JA 4HEJA 1XLVA 4KW7A 4U7WA 4AUNA 3MGAA 2FKAA 1YMUA 2IYPA 5TLSA 1NP3A 5C32A 5DG9A 2IYEA 1V96A 2QRPA 5E0OA 4B3BA 4ZO9A 1ZQYA 3Q8RB 1UXJA 2DBRA 4MEBA 4UDNA 1QHFA 2ECFA 4IHKA 1DFHA 1JHZA 4NCAA 2VOJA 2AJLI 2MOKA 1W4AA 3VBCA 4PPQA 1UA1A 4C0LA 3ASYA 4JV1A 1PS9A 2VYND 2YJ3A 4I50F 3ANXA 3RSGA 2BGGA 3R7WA 1R4NA 3BIJA 4HB3A 4YJ3A 1LBIA 5BYKA 1OYWA 1XQ1A 1DTSA 2ZJAA 1USKA 1IPEA 1JQKA 5GZ1A 1ARZA 1CZNA 2OO5C 2VJPA 2WHRA 3T0GA 3MAGA 5IIOA 1B4FA 3BXPA 1AJEA 5ALIA 4ZCSA 1PF7E 4EEKA 1MHPA 4G07A 3QBTA 1GTSA 4DTIA 3KQKA 4HGNA 2OP1A 2WJ6A 2OO7A 4EITA 5JPDA 4W5HA 4C7ZA 3Q8KA 1W76A 4WESA 1AHIA 1P77A 1SKYE 2EXXA 1RADA 4P86A 4AICA 4X8HA 1NBHA 1NQUA 3EPRA 5L8VA 1U3CA 1QIIA 1KFDA 2RBKA 2Q4DA 4EFKA 4H3HB 3CJRA 1C81A 2HQBA 2IU6A 3OP4A 1EVYA 4I1UA 4OFXA 2OMEA 5IAKA 5D1HA 3P0RA 2DM6A 5LA6B 3RB8A 1YU9A 4II2A 4KQWA 1IE3A 3VDNB 5HILA 3QE9Y 5TPZD 4ARSA 3WIBA 1FO4A 4MHVA 1OYVA 4WV3A 5BO5A 4HDSA 3VTZA 2B0CA 2QJFA 4Y0VA 4BN5A 1SL0A 3RRYA 4GYYA 1PDOA 5F4BA 3T3OA 3I6BA 4RIIA 2E8NA 4KYTA 1I33A 4MW2A 1RPAA 2ZIXA 2Q41A 4BY9E 4G0ZA 3PO5A 8ICRA 1JFFB 2B3DA 5KHAA 1QDEA 2WP0A 1Y4ZA 4C0JA 3V1UA 2O4CA 3BDVA 1D8LA 3ASZA 3HCOA 1DWUA 2E5LB 4QTYA 2ZB2A 5T57A 1HSZA 2QD2A 1ZM3A 3KOMA 2I5PO 5SZJA 1PGQA 4K3VA 4WVFA 4G0XA 1ZZGA 2O2XA 4XVRA 4KRYA 4U7DA 3FTFA 1S3IA 1SBCA 1G9TA 1IAVA 4TXMA 5MHTA 4TWRA 1NJGA 3A10A 1YONA 4V02A 4EHJA 2VJYA 2ZRIA 1B7GO 3B5JA 2MSWA 3LT2A 4INPA 4BV2A 4EYGA 1ATIA 2G0NA 3K32A 1PQUA 3C97A 2KJ9A 1GG2A 3D6UA 4AG5A 3ORQA 3ER8A 4HNAA 4ESEA 1NURA 5I8PA 3GUUA 3FMFA 3OZAA 4WMLA 4IRKA 4W5JA 1E3QA 4YRDA 2W6ZA 4O2LA 5D00A 4DFDA 3FR7A 4G8BA 4UVIA 4KQ6A 4RK4A 2GASA 4M9UA 1Q84A 3TRJA 1M73E 2A86A 1F44A 2JCVA 1ESZA 3DPIA 4R4JA 2ZATA 5J43A 4BV8A 1MXHA 2NU7B 3JQ8B 3WLAA 1R4AA 5IPFA 3SV3A 1D1TA 1SBIA 4IZOA 3VZBA 3LHIA 4G85A 4A8EA 5FWDA 5DF1A 2AJTA 1NW6A 2AIRA 3G5TA 3DHYA 3MTQA 1HIWA 1R0WA 1KOJA 1SVIA 3H40A 1QK4A 2N42A 1L7AA 2G1KA 2RHOA 3CCCA 3A6DA 4A0RA 1S8NA 2M1XA 3PEEA 4XWOA 3LUKA 2K2QB 1QB7A 3VYUB 2XUFA 4CXMA 3NHKA 3K9GA 4OXRA 3PNPA 2GGSA 4HH3C 1NVUQ 5AESA 2O2IA 1ZGAA 3T5KA 1E1CB 2IHJA 2WJ3A 2P0EA 3EZ2A 4D02A 1V3VA 3HXKA 2W2OA 1SXJD 2DKZA 2G9UA 4JL8A 4JJIA 5B3LA 4IV8A 5J0OA 2AVNA 3OMLA 4JUBA 4MTCA 5LYJA 2EX4A 3G2MA 3H84A 2PANA 1EFCA 2N1RA 1UPAA 2ZR0A 2ON6A 4FMPA 5UKDA 2QARB 4ZO4A 1R6UA 1U3FA 3VH1A 4AKIA 1U1FA 4RHTA 2CFRA 5CYFA 3AIOA 3TBFA 4BX8A 3BGWA 1ZQLA 2WTFA 2P2GA 3QFHA 1DO0A 2JKYA 3EG9B 1RM6C 3JD2A 4TOIA 2GMWA 1C9YA 2MDTA 3K9NA 5EKTA 1VM6A 4ECAA 3K6SB 3FDJA 1CR1A 3T41A 2JHDA 5JXWA 2WM2A 2ZVQX 2VCEA 1HOXA 1BNCA 1NBMA 3IJPA 5L3QB 5AJVB 2Q8NA 3CX7A 4CGZA 1EVJA 1JQAA 4JJ6A 2ZXUA 3QVMA 2WSYB 3NBUA 1B1CA 1F2TB 1B0ZA 1UKZA 1FX0A 3IAXA 4PX3A 3I9OA 4LMAA 4Y2GA 2L5YA 1N7GA 1V1MA 3NC4A 3GLGA 5AVJA 5JVDF 4V2IA 2PZKA 5L7WA 1R9GA 3RVBA 1AA6A 3CCBA 4K4IA 4Q8FA 2ZJBA 5SICE 2NU9B 5H81A 1V48A 4U63A 4XGIA 2BM0A 2D00A 3EEOA 2ODAA 4NQRA 4M21A 1B93A 1U28A 3W8EA 5EHIA 4ZAGA 3WL5A 1YFKA 2LTAA 1KQ3A 3CRQA 2QSUA 1ED1A 1QQ5A 2AGPA 5FPHA 5EXTA 4PAQA 5EIOA 5IH7A 1Z00B 1B6SA 3FUTA 3NHSA 4OFBA 4XDGA 3PWKA 3FH0A 4Q9HA 4DM3A 5D2CA 4ENTA 5AVQA 4CZ2A 3B6KA 1ZYUA 1Q1NA 1XJ5A 2NW6A 1Q19A 1L4EA 2WKRA 2AWNA 3G17A 3IIEA 1WPXA 1UMDB 2GJ8A 3AUTA 1WP4A 1H85A 3EJWA 3K0EA 5EGSA 1RXUA 4OHUA 1PBNA 3BKWA 4KYUA 3ZZNA 2OSBA 2WA2A 3N07A 3W5JA 3ZI0A 1FY2A 1NNI1 3OJFA 5IRCD 5K1ZA 1MMFB 1R9MA 1BXRB 1H05A 1W6RA 5I7SA 3TTXA 1XC7A 1H4QA 3ZN2A 4CDGA 1BC5A 3TB4A 2ODNA 4LWOA 1LDMA 5LFAA 3GELA 3JS5A 5IIIA 2POQX 2P91A 3DGEC 2RKWA 2XA1A 1GDDA 1KLNA 2DKFA 2YH2A 3A36A 4P3XA 3STHA 3WGNA 5CXSA 5BWMA 3OESA 5BP7A 1JIUA 4K9DA 4C4PA 3ZLJA 1Z0AA 3JWEA 3L4PA 4DV1B 3C1YA 3GU3A 4G0YA 3A6JA 4IGAA 4BMZA 1POXA 4M9RA 3O2NA 5CVVA 2EDCA 5G0SA 5L3RA 3KSZO 8ICJA 2JBAB 2ZYTX 1DAHA 3O82A 1PTJC 2ZIXB 2WV7A 2C2GA 4I6JA 5I9IA 1JLKA 2WT9A 3JPRA 2QV7A 3CX6A 3C21A 1JFFA 3MJFA 4QL3A 2YKGA 3QKSA 5JZVA 3SJZA 4DG9A 3U26A 3TAPA 1IY2A 3Q12A 2Y68A 3GK3A 1SIUA 3JQRA 3KLNA 3O4JA 1W73A 3GDHA 4QZBA 1U98A 1QH8A 4BMCA 2W11A 1W0KA 2BAGA 1T3QA 1NPYA 2BIFA 2GPAA 4UNQA 5FI1B 4URXR 2MSEB 1K6MA 1XRRA 2PL5A 1NZJA 4RT2A 1AV7A 3FNGA 3R75A 4IXTA 3WLSA 1YA6A 1N8KA 1TTHA 3IL2A 3G7UA 2H3FA 2HJSA 1JDVA 4ETNA 5TE9A 2CWWA 2GBFA 2ZYVX 1FTGA 1Y42X 4JJ4A 3JV7A 3GAFA 3W3AA 4FQ8A 1H9BA 3AHIA 5E9QA 1AK1A 1R37A 5CVCA 2ZPUA 2LDBA 4XUEA 5BXQC 3DONA 2W48A 2IY9A 1PWYE 1G8FA 4AYBF 5J0PA 1C9KA 3KS9A 4MVJG 5AM1A 5E4TA 5FA6A 1E66A 3CVYA 1VYTA 1W9HA 1JDJA 1MC4A 1QWSA 5TGDA 3TLBA 3EW9A 4F6RB 5JEEA 5ED4A 1I0ZA 1PJ4A 1ZKMA 5DULA 3ABIA 3A4IA 3HUFA 4XTCS 5CDFE 5ICCA 3DLIA 4ZHQA 5CCXA 2I7DA 2ARKA 1SD2A 3RNLA 3A4LA 3KIPA 4KPEC 4JGGA 1Y3FE 2XRZA 1B0XA 3WLMA 4TUQA 1FS6A 5L40A 1NF9A 3C6YA 3QSYA 4ZAVA 4BHTA 5AK5A 1M2FA 3FN4A 4OQPA 5C8XA 3RBAA 3BJRA 1X1CA 2XUJA 3EQ9A 1GYPA 1QO0A 5G40A 2HIAA 3L1JA 4YGYA 1RWQA 2AQ8A 3AFHA 1E1CA 1E1NA 5ES4B 3OU7A 4MYSA 1TQ4A 1D7OA 3KQWA 4LI0A 3GFFA 1CDOA 4J9LA 1V16A 3W4JA 5L95A 2HA4A 4NPAA 4G0WA 4GG1A 3ZDFA 4S2EA 3TARA 3DMTC 4I5GA 1UOEA 5JYBA 2Z2KA 3TDMA 3EZ5A 1E7YA 2BSXA 1EXVA 1A2BA 3W5SA 3UANA 3JPTA 7ICFA 2J4FA 2QM7A 5AW5A 1X7WB 3O1IC 3GDGA 3ODGA 4ACAA 1YSCA 4D3SA 5ELXA 3IDWA 3FIJA 3QHQA 1Z4OA 5IK2D 2IGBA 2GLUA 3LH5A 5GTHU 4LEIA 1B41A 1U6JA 3PPVA 3H4VA 5E4JA 2HPAA 3HZOA 3ETLA 1M5UA 2J5QA 4B9UA 5ILOA 4L8FA 4II7A 1HYGA 1K06A 3IIIA 2A7QA 4EPTA 2X2PA 3O93A 9ICUA 4TT3A 1TAHA 4ECZA 4C1NA 4USAA 3PDUA 4J7AA 4BTEA 4UB6U 4IMJB 2YYSA 5HDBB 4KC0A 4V1CI 3N0XA 4BFZA 3DE5X 3DMHA 3VZCA 2BCUA 1TK5A 1GN9A 2AX3A 1E77A 2B35A 2C4WA 3QM1A 4OQNA 2CT8A 1ZM4A 3GJ7A 2D5AA 3BORA 4GM0A 1RAHA 5FUQA 1VIDA 3DJYA 1EKXA 4XD7D 1OWMA 2P41A 1JEEA 3KXDA 4NL9C 1J7KA 4L73A 1BA3A 4RLQA 1OXJA 1ZL0A 4V0QA 4LE1A 4DSIA 1KK3A 2ZAOA 4NBTA 1UKAA 3T5AA 4UBBA 5AW0A 4NFSA 2ZT8A 3ZWMA 1JB1A 3D7MA 2F17A 1RWPA 4ZXFA 2OHXA 2WAXA 3EDCA 4F60A 3DCIA 2W6ID 1WVIA 2UAGA 1PZFA 2H06A 1Z45A 3LSTA 3EPJA 3LVQE 2B6NA 1R0BA 2J7KA 5J2DA 3WIUA 3LLCA 2PSJA 1WSBA 1XEXB 1WOYA 4O5OA 2ORVA 3WLJA 3TACB 2ERYA 2R6DA 3I3OA 4GW3A 4CTKA 1M2KA 4ESOA 1K6XA 2A9FA 4NCXA 2VHEA 3FCCA 4IKPA 4TTIA 2WM9B 3HSSA 1M7BA 1MOZA 2AJBA 3AW8A 4FR2A 3BXXA 1M66A 5A1TA 5A5EA 2QLMA 2AEFA 1F06A 4REQA 4KGVA 2EF0A 1JIJA 2IPOA 3GZJA 2AYXA 3C3CA 4M76B 4HFMA 5A4AA 1LW6E 1I4WA 2XWQA 3MLBA 3MCWA 4HVLA 3MMZA 1CP2A 2QHXA 1QZXA 2GHQA 2DLNA 1OHHA 3KT0A 4P38A 4BQRA 3HLTA 4EUNA 5HBRA 2A1JA 9ICRA 2VAWA 3M4NA 2UVPB 4LC9A 2JGNA 4O3SA 4Z0PA 2A35A 3OC0A 4JXKA 1QKKA 5KWVA 1WXEA 4TV8B 4CEIB 5BUZA 4M8IA 4WINA 5EOZA 1ZCZA 1Z29A 3IQDB 3L43A 4HTFA 4Z2AA 1G16A 4NENA 4PAWA 5E1DA 3I01M 3U9TA 1II9A 2ZJ6A 1WUJS 2ZXHA 3DT6A 2WIDA 2INGX 3IMFA 4K88A 2P27A 2XY7A 2A4MA 5CJJA 3SM9A 4J1QA 3U7EB 2OCEA 4LAFA 3N39C 3WMFA 4HNTA 1X86B 5FIUA 5T6MA 2QT9A 5DZSA 1PR1A 3P20A 3VR3A 1CUDA 2CVQA 3ADCA 2HIHA 3ESCA 1G7RA 1ZETA 3AVOA 3ETCA 4RTQA 4RVCA 3L3BA 3DVSX 5DBCA 1S01A 4JU8A 2G82A 3TQHA 3TZ6A 4DARA 5KYXA 5KG3A 2R8ZA 2R6FA 3TL3A 9ICJA 2B6HA 4CMBA 3TG8A 3P0HA 5TARA 1IXRC 4UATA 3QLTA 3ZYZA 1VL0A 2VN8A 4HNQA 3SC6A 2R44A 5JH7A 4GXJA 3B78A 2VHTA 2Q1TA 1YBVA 1W96A 1BGWA 3IKVA 2PBZA 1VPTA 2FX3A 3BXZA 2YTZA 3KB2A 4IUYA 4H59A 1MIOA 1X8XA 4F97A 1WV0A 4DADA 4ZEVA 3VV2A 3FCYA 4C07A 1G8KA 3EA5A 1TAUA 3I04M 5T4BA 3EFEA 1U2DC 1W5TA 3FLBA 2ZJFA 4FBUA 4IF4A 1L6IA 3MINB 1KO7A 5EKXA 2ZR9A 3ZHBA 1PQPA 1RYHA 5KB3A 4IHJB 4KOAA 3K0BA 3K94A 3U7IA 2C8KA 1PNOA 3UKJA 1T9AA 4C8MA 4JJ7A 1XSLA 1VB3A 1C8LA 3LK7A 1XJ0A 2PAFA 3R40A 4ZVOA 2JRCA 4H9GA 4D9KA 4UASA 1CQPA 2P9GA 3NANA 3IVCA 1OHHD 3HR8A 3B0YA 4NHOA 4OREX 3VR6A 2X8AA 2BFBA 3TI9A 4HQNA 1RLMA 3AJRA 2P35A 4M37A 3S55A 2J67A 3ZCQA 1HBJA 1IHXA 3L41A 4GWKA 3HKZC 4R8UA 2VA3A 2HLPA 3SR3A 3QPUA 1ILEA 2R1TA 2V4ZA 2O1SA 2ZT7A 2J3MA 4AULA 1HUOA 4JFAA 8OHMA 1I1HA 5BSWA 2ES6A 3T5HA 1RMTA 3EZNA 4QOHA 5DNVA 5EPEA 5IS2A 2YXBA 1GR1A 3W1VA 1MVLA 1ADCA 2HMSA 4MI9A 1Y8ZA 4TN1A 5AK0A 4FWIB 1M3SA 3OLXA 1GYQA 2RJOA 3G89A 3JZIA 2BGWA 3IALA 3ACDA 3HRKA 1XZPA 2GO7A 3OFJA 4LRSB 1SWWA 3IE0A 1L5HA 3V80A 4B7XA 4E2YA 3O90A 4EARA 4F0JA 1I7SB 1J9GA 1RVDA 2XNKA 2V3WA 4DB4A 4Z4CA 3M6AA 2AOVA 2NVUB 2IHYA 3PDWA 4OLAA 1GFSA 2XB9A 1YL7A 3SIRA 3I6QA 4HN9A 3IDOA 3QKRA 4D44A 2RI6A 5ALNA 3ISTA 4HGPA 4FZLA 1QQTA 4G5QA 3PFBA 4IR9A 2QMQA 4LYAA 1E9VA 3GLQA 3K0CC 4PLCA 2YZNA 3SP1A 2QUZA 2KWIA 2ZRMA 1Q0UA 4DLPA 2RP5A 4UHFA 5IT4A 5LLDA 3OZWA 4UHCA 3K70D 1EZZA 3WI7A 4BX3A 2LKCA 5DMHA 3VDQA 3GJ8A 4Q3EA 4WXMA 3CB2A 4EHAA 2D3TA 3HYNA 2QS9A 1BDMA 1R6AA 3RB0A 3KWLA 1Z4QA 3QVGB 5EIBD 3FF4A 2QBYB 3GFQA 5ALDA 1GNRA 3RS9A 3FI0A 3ISJA 2JB9A 2P6RA 2ZDHA 4M8SA 4MWEA 3O0TA 1YZLA 4KQMA 3WK9A 2ZU6A 1GAEO 3UIEA 1I0LA 5K0TA 1SCKA 3EODA 4WK4B 1H8HA 4RWZA 3P9QA 4REMA 3GRKA 1IBMB 1IH8A 3S1SA 3PW2A 4TUSA 4QA9A 1YAHA 3PW7A 4DLAA 4KO4S 3S8EA 1WCIA 1FMLA 5EI5A 4UARA 2WUVA 3D6HA 4D9FA 1L5YA 2FWBA 2K4HA 4UZSA 2V8BA 3RCBA 2X0DA 3GJ5A 2VRCA 4CHTA 4FYIA 3VYVA 4CQLA 2ATXA 4ED7A 4IG9A 3DSRA 3SEAA 4RHEA 4L0QA 4DLUA 5MFZA 1NYTA 4P7GA 1QHHB 1U0OC 5F3RA 4F5WA 2XCAA 3H7IA 1DCFA 3Q3CA 3ROFA 5ER9A 5IWCA 4ZV9A 1L8OA 4HWKA 4GXTA 5IJ9A 2XWBF 2ZITA 1X1AA 4ENPA 5FDFA 1G59A 4BXOB 4FKBA 4HXFB 3LKVA 3E35A 1YL5A 2Q3MA 4HRVA 5DNDA 4BJ6A 2I6SA 1MABA 4ZCQA 2A5FA 3AEQA 3B6EA 1GU1A 1VOTA 2MYTA 2O4UX 4JVMA 4M54A 4QNNA 5EZ5A 1JHPA 4B2IA 5ITZA 1GAJA 4GXKA 2O57A 1DRJA 3WLTA 2ZDQA 4KZKA 3WLEA 1Q7RA 3WFJA 2NRZA 1OROA 4Z3KA 2KMLA 3GH3A 3OCCA 3QVKA 4LZDA 4G09A 4YAEA 4E21A 2GETA 2LCIA 3G5LA 3KQMA 4IJVA 1YDMA 4AMVA 4YVZA 1X92A 1QHGA 1AUOA 1WV1A 2B20A 2ZVJA 4KXVA 1QIFA 5JMTA 5BR4A 3HEMA 4DNFA 2IYQA 2Y05A 3AETA 2AG8A 2DHQA 4LOKA 3UH0A 2RK3A 1XEFA 1H1LA 1T1RA 2RGDA 4M87A 1YF3A 2NP7A 4R2LA 3MDAA 4OK6A 2QDKA 4QRHA 2F1IA 4YP5A 4ZMSA 2FVYA 3KEGA 1A9TA 4PXAA 3NUQA 5DBOA 1S1CA 1NYQA 4QJ4A 3D2SA 1SKAA 2GCEA 3MUOA 5H3CA 3RE1A 2IU0A 2ZQZA 1DX6A 2IPXA 4CR8A 1F14A 1N7IA 5IG2A 1L5QA 4GEKA 3M1IA 3OLWA 3I92A 3FPSA 4JEIA 4DNOA 3RYIB 5KFWA 1QRRA 1TF5A 3OLCX 2UVWA 4PLFA 1A95A 2FUEA 3P4YA 2P3LA 3OPMA 2ILTA 4R1TA 4G5GA 2HRRA 1A3CA 1E18A 2ID4A 1ZJWA 1T6YA 5LBTA 1ICIA 1T0JB 2HMUA 3FLEA 3OHSX 4MVJP 3KO8A 3I9KA 3HNRA 5REQB 2E82A 4B87A 4J4BA 1NKSA 3KPUA 5CB0A 2NV6A 1FLVA 2BR4A 2OGZA 2V6IA 4FXOA 4G1VA 1G0OA 1NM5A 2FB9A 1PG5A 4OQZA 1RC0A 2FN4A 2X19A 3CHYA 5IXJA 5CTJA 1XZAA 4P2HA 3PNQA 1DQPA 3HUDA 3QVSA 4XPIB 3ZXSA 1L4LA 2CDRA 4HYYA 3RVPA 1N0WA 4CMEA 3V7YA 3RBVA 1E6WA 1XD2A 2GUGA 3EXG2 4GZ5A 4Z9XA 1G9XA 1VE7A 3ANMA 4JR0A 4KO2S 4WECA 1X0XA 2D0IA 4MULA 1I2BA 4DNPA 1ISGA 1U8YA 4ASUA 4AM8A 5LZ9A 1IJBA 2B94A 2DULA 3G7SA 5KX5B 3OE4A 4QJFB 3ZIAD 3VOTA 3U7GA 2NUTA 2YVQA 5ESDA 1BX3A 1HYQA 4FK8A 4RANA 3KSRA 4JDPA 2G09A 2A8YA 2ZAIA 3EZGA 3GBSA 4EVSA 5HS4A 3UZUA 1VL2A 3KKKA 4U2KA 2ONZA 4R40A 5ENDA 4EMTA 2A7XA 2Q1WA 2VTKA 2NVUA 5HJ5A 4CFYA 2QZZA 3BTUA 3KL2A 4JR2A 3UAWA 1W1WA 3FJ1A 3QYFA 3QLVC 4L22A 4PAOA 1T4DA 2XW6A 5GOTA 3CKMA 1E3IA 2ODWA 4G86A 4OJ6A 4RVOA 4KMOA 3HJCA 1REQB 3CJQA 1NY5A 3OM8A 3IHLA 3OQBA 1RYMA 1DJMA 1PGJA 1RPZA 2ZEJA 3HHEA 3TLJA 4DCPA 4NECA 2BKXA 2VAMA 1E1YA 1K8RA 1KKMA 2RMKA 4X1KB 4GHWA 1UP7A 4G41A 3MR6A 1XRLA 2HWWA 3KT3A 2IEBA 4J0HA 3KHRA 1L1QA 3K1TA 4LWQA 2KJ8A 3WMWA 5CH3A 4J29A 1Z07A 3ASVA 4PTLA 3WLHA 1CJCA 4BEWA 1I6LA 2V55B 1L3IA 1ESNA 1KFTA 1GSOA 1ZQ1C 2GKGA 2ZQYA 4OBEA 2JVKA 4UFNA 3SLKA 3TQIA 5DNWA 1A5AB 5LB4A 5KNDH 4QNLA 2YIMA 2OWDA 4X7RA 4GLBA 2IOYA 1AS0A 4E6PA 4TKVB 1WLYA 4N49A 5EGNA 1Y8RA 3A6FA 3LY8A 3KXLA 4DGSA 3HXMA 5GMOA 1CY6A 3HA3A 4GPBA 1CUGA 1GPH1 5GPBA 1CRXA 4N3AA 4CMIB 5FBLB 2VYFA 1D09A 4UQGA 5KFGA 1UPUA 2ALJA 2ENWA 1TCUA 2VF2A 3B1FA 2IT1A 1RW4A 4B9TA 2Y71A 3FKSA 3G5AA 4MI6A 2IZZA 1ZJNA 4KQ1A 1G5HA 4NEQA 3NHAA 1ORRA 1KIFA 1LX7A 3MYYA 2QM8A 3ZY6A 3GJYA 4QDKA 1QH8B 1HKUA 2CV2A 3RDPA 4EL5A 1AKYA 4HGQA 4LF6B 2IDJA 4IMIB 3ORFA 3EY4A 4YJ2A 4XLZA 5IBQA 3ZWNA 4DXHA 1GPYA 2FR1A 2OCLA 4DC9A 3V4PB 1A71A 4Z7OB 1N5OX 5TDHA 3RODA 1RHMA 1BPZA 3MS7A 5I9TA 4MEJA 2DU8A 2HLDD 1CRWG 5COBA 2GZ3A 2FOIA 4XRHA 3P4UA 4BVEA 1QK5A 2UYQA 4R2KA 2LUOA 5FA8A 3D2LA 3GUHA 3KZKA 5K0CA 5F2OA 2PQ0A 2D2XA 4FCTA 3KQYA 4UB8U 1F12A 3EEYA 3OZXA 3CNHA 1QWOA 1AGYA 2X1MA 4O0LA 5HEKA 3CUEF 3PRJA 1KE2A 4ALNA 1B8OA 1O95D 3I30X 2VF4X 1UBUS 2B25A 1O0SA 1OI4A 2CYAA 4NL9A 3QELB 2DWOA 4LDQA 1VLHA 5F7JA 5TGZA 3M5DA 5BNTA 4H1VA 3C41J 4L50A 3A1DA 1IVYA 2ZJ3A 4QWBA 3BHIA 2RC6A 3O75A 1TYBE 2WJWA 1OJ7A 2QX6A 2WK1A 2JBAA 4M9XA 4TLEA 3JATB 2C8VA 1MAHA 2W9AA 1GZ3A 4AF8A 4D9IA 1E3SA 1A97A 1JA9A 2X22A 4M1OA 4CEJB 4HLUC 4TL7A 3WG9A 4FILA 2O5EA 4UAZA 4RL6A 2F59A 1KF0A 1WE2A 2Z3VA 2WKPA 2WT8A 1GADO 3UW1A 3ZY3A 5J2UF 2VLIA 1SQ6A 1TJ3A 1KQQA 1WDWB 3WLPA 4FDTA 3L0CA 5DEIA 4QUEA 4JLBA 3BQ1A 4RCVA 4IQ8A 3TFSA 5CIQA 3HM2A 1A4UA 3BS4A 1J70A 4X6XA 2VHUA 5E7IA 2PVCA 3V55A 8AT1A 2FLPA 5HCIA 5BSMA 4ZH4A 1SUSA 9LDTA 5KT7A 1DEXA 3DXXA 4QPDA 5A05A 4BKRA 5HQTA 2P1ZA 2QGZA 3LVFO<