1Z4OA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 78
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4oA01
1LTQA 3RFUA 5FP0A 3ZVNA 1RLTA 2G07A 4GXTA 3NRJA 1QYIA 3WKDA 2RBKA 2NO4A 2AH5A 4L6AA 4BNDA 3A3YA 1QQ5A 5AVUA 1SWVA 3KD3A 3L1UA 5AW2A 5IS2A 4CNQA 4BEVA 2I54A 2HCFA 3QUCA 1S2OA 3NANA 2GHQA 4OFZA 4YCNA 4PNHA 2YJ4A 3I76A 1N9KA 3NAMA 4OD0A 3QLEA 3R9KA 2G08A 1Z88A 5T41A 2OA0A 3KC2A 1IWOA 5ALLA 4Y2XA 2FPUA 2ZBFA 4BX3A 2WHEA 2ZOSA 5AKLA 1YMQA 2YMMA 3WKCA 1FEZA 2WF9A 3E8MA 3U13A 5ALQA 5AVXA 2WF7A 1VJ5A 1U2TA 2WF8A 2Q5EA 5AKIA 4YIKA 2C4NA 5IT0A 2YJ6A 3L0YA 5AVTA 5AW5A 3VAYA 1JUDA 3R4CA 5AW1A 1Z4KA 4EX7A 2B8EA 3TLMA 2PKEA 2Q4RA 2G06A 4CE6A 4Y2YA 3UMCA 4HGRA 3ZI4A 5AIBA 4FFDA 4FYPA 1L7OA 4BX0A 4Y2QA 1LVHA 4J2TA 3UMGA 2B1RA 5AW7A 5IT4A 3IB6A 3U7GA 5AVVA 2AMYA 2VKQA 1RQLA 1WZCA 1Z5UA 3CZ4A 2MU1A 1RMTA 4HGNA 1ZS9A 3HLTA 5ALRA 3ET4A 2CFTA 2HI0A 3MN1A 3WKBA 2YMPA 2YMLA 2YMQA 3BA6A 4YGYA 2RARA 4BNDB 1J8DA 2IA5A 3ZX5A 4UARA 4BBJA 3ZVLA 2EATA 2CFSA 2EARA 1QQ7A 3U7EB 5ALZA 1YDFA 1NF2A 2NO5A 4ZEVA 3ZW7A 2MSNA 5AM1A 4BX2A 2HF2A 4KX3A 1Z4QA 3WKAA 2ZBDA 3NASA 3L8HA 4G63A 5AK6A 5E0OA 1MH9A 4B6JA 5ALOA 1RPZA 1Z4IA 1ZD4A 4RESA 1RRCA 3B9RA 1ZRNA 4UMFA 4DWOA 3WGUA 4KNVA 4YH1A 3L7YA 2R8YA 4UM5A 3QU5A 2WF6A 4DCCA 1Z4JA 3AR4A 3WK4A 2CN1A 3SMVA 3W5AA 2WM8A 3D6JA 3ZU6A 3QU7A 4UMVA 2FUEA 1X42A 1YNSA 1QQ6A 1EK1A 5ALPA 5ALJA 3W5BA 3SD7A 4XOUA 1T9ZA 4I9GA 3HYCA 4IFTA 4CF3A 4C4TA 5AHXA 5AM3A 4Y2UA 1L7MA 3M9LA 3QU4A 3WKEA 5ALWA 3A1DA 2I6XA 3FPBA 2W4MA 1RKQA 3KBBA 1VJRA 2P69A 1Z4LA 4C4SA 3OCYA 2YY6A 2B1QA 3U26A 1SWWA 3AR2A 1Q92A 3EPRA 4NABA 2WFAA 5AW8A 4IG4A 1YV9A 4QJBA 3L0CA 1N8NA 4G9BA 3RF6A 2B8JA 4YCMA 1EK2A 2OM6A 1T5SA 1U2SA 2HX1A 3ESRA 2YJ3A 2MU2A 4F72A 1RC8A 2FPWA 3I6BA 5ALTA 3SHQA 3CNHA 5JJBA 5AM5A 1Z4PX 3N07A 3E84A 4HGQA 3FPSA 2YJ5A 2B30A 3DV9A 2O2XA 5ALFA 3EF0A 3ET5A 4HGOA 2JGAA 4KX5A 1ZJJA 1QH9A 5AKZA 3S6JA 2GFHA 2R8ZA 2W11A 2GMWA 5ALNA 2AUTA 4QQFA 3ZUPA 5AKHA 2YBDA 2O9JA 1L6RA 4Y2RA 5AI8A 3QYPA 4UU1A 4E88A 5AW4A 4Y2TA 2IOHA 5AI6A 2HEGA 3EF1A 4DW8A 1XPJA 1YJ5A 4AS3A 4XE5A 1RLMA 2G1AA 2BDEA 4EX6A 1SU4A 2JAWA 2C9MA 3SLRA 3ZWKA 4MWOA 2G0AA 3KOOA 5A3SA 4UAUA 4Y2SA 3N1UA 3L0BA 4XPZA 1Q91A 1O08A 1L7PA 4NAVA 3L1VA 4FE3A 3U19A 4HYTA 2QLTA 2JARA 2ZXEA 4JB3A 3WK9A 4Y2JA 3FZQA 3L8FA 4RETA 5AVYA 5AK5A 2P27A 5AVQA 4UMDA 3QXGA 5ALEA 4NWIA 4OHFA 1ZRMA 2IYEA 2FPSA 1TJ5A 3FVVA 3WK5A 3A1EA 5ALDA 5ALVA 2IOFK 4L57A 2G09A 3QX7A 4EENA 5ALMA 2FUCA 3DDHA 3F9RA 2I55A 2HOQA 3AR6A 3P96A 3KDPA 3ZX4A 2HDOA 5AI5A 5AM2A 3QUTA 2FPXA 3WGVA 1T5TA 4UASA 5AI4A 4NV0A 5AVSA 4EELA 1L7NA 1CR6A 4CF5A 3FGOA 5AKGA 1TJ3A 2JAOA 5A3QA 2FPRA 5AKKA 1Z4OA 5AM0A 2R8EA 3W5CA 3ZVMA 1ZOLA 4F71A 1NNLA 1RDFA 3M1YA 3J7TA 2I33A 4UMEA 3N5KA 3K1ZA 4HAIA 5AI0A 4UM7A 3I28A 5ALSA 1WR8A 4BKMA 3AR7A 1TJ4A 2AGVA 3OCUA 2CFRA 3ED5A 5AKYA 4CF4A 3DAOA 2X4DA 4I9FA 3R09A 1U7PA 1Z4MA 4Y2VA 3ZTWA 2HO4A 1RKVA 2QYHA 3B8EA 1XVIA 2R8XA 4HGPA 1Z4NA 3L8GA 5A3RA 2B82A 3A1CA 2D2VA 4KNWA 1CQZA 1U02A 3AR9A 4EEKA 2C88A 3IRUA 2Q4TA 5AESA 1PW5A 4ZEXA 1RQNA 4OCZA 5AM4A 3PGVA 2IOFA 2WF5A 1TA0A 2G80A 4AS2A 2PR7A 3PGLA 1Z5GA 2YFYA 3GYGA 2NYVA 1S8OA 3OCXA 1YS9A 3QUBA 2ZBEA 2BDUA 3L8EA 4BYGA 3QU2A 1L8OA 1O03A 2W43A 4GIBA 4EZEA 4KYTA 5ALHA 1XP5A 1TE2A 5ALUA 4XQ0A 5ALKA 5AKEA 4UU0A 3MMZA 4H1WA 3U7FB 5AI9A 4YIHA 2OYCA 4J03A 3WK8A 2P9JA 3E58A 3IJ5A 1RMQA 2I7DA 2OBBA 4L6CA 3WK6A 3EWIA 1K1EA 5ALGA 1AQ6A 2FEAA 2P11A 4UAVA 5ALXA 2RAVA 2JAUA 2FI1A 1WPGA 4Y3UA 3I1YA 4ZEWA 3U7HB 5ALYA 1KYTA 2ZG6A 3AR5A 2BY4A 3QUQA 3B9BA 3OCWA 5AW0A 2C8KA 5AIAA 2B0CA 1RMYA 2DQSA 4UATA 3FM9A 3N28A 4YCLA 4JDPA 1NRWA 2PQ0A 3SKYA 3ONNA 5ALIA 2ZBGA 2I34A 5AW9A 5AW3A 3NALA 5AKXA 2EAUA 3MPOA 1ZD5A 2GHTA 3ZWDA 4DFDA 3L5KA 3NUQA 3SF0A 4AP9A 3OCVA 3OCZA 3KZXA 3OPXA 3PDWA 1RLOA 5AVZA 4O8CA 2GO7A 1Y8AA 5AVWA 3ZTYA 5AK3A 3NIWA 4NFLA 4UW9A 3WK7A 2HHLA 3E81A 3QU9A 1J97A 4MUMA 1RKUA 4Y2PA 3OTQA 3SKXA 5AK4A 2YN4A 1VFPA 3MC1A 4C4RA 3AR3A 3QGMA 3DNPA 1ZD2P 1ZD3A 1F5SA 3AR8A 2HSZA 3BWVA 3QNMA 2ODAA 2C8LA 3N8GA 2HF7A 4KN8A 3UM9A 5AKJA 1L8LA 5AVRA 3PCTA 5AW6A 4BEWA 2RB5A 1U7OA 3W5DA 5AICA 2FDRA 3UMBA 1WVIA 3ESQA
chains in the Genus database with same CATH superfamily
2ZJ5A 1E79D 4C87A 3S2GA 3GAZA 4H4EA 5KAMA 4GOJA 3HR4A 5KDLA 1QYIA 1WDTA 3AI3A 5ECGC 3RV4A 2NT4A 5JUMA 4E46A 4DQDA 1M8JA 1WMEA 2ZJ0A 1G8YA 5J0QA 3X2EA 3QXJA 3T7EA 1Y4SA 1ED1A 3VYWA 1F4LA 1SD2A 2QR2A 2OV2A 3K1TA 3LO8A 3NVZA 2JEGA 1BDBA 4KN6A 5DV9A 1PFVA 2XT0A 4QOGA 2Y1FA 3GD7A 5DOZA 1WMBA 5AO9A 5EGNA 1LBIA 1FW6A 2IXFA 2WP8J 1SQ5A 4GYKA 1U1DA 4OQNA 2XXAB 1QS0B 4R1QA 1T0UA 5CD1A 1N2JA 3JD4A 2VJBA 1BWPA 3HDVA 4C14A 3W2TA 3MD0A 3A37A 3EIQA 1WNFA 5DIZA 1CZRA 1VE3A 3EQ6A 4W8OA 4D4JA 3WDLA 3NAMA 2QJWA 3V7LA 2GLUA 1P5ZB 4UVGA 4WDQA 3PUJA 2AJBA 5JSHA 2DPYA 3SHOA 4QPNA 3AEQA 1YWGO 3LSYA 1R0WA 4W7HA 5IDYA 3TQIA 1W87A 3IIJA 3HU5A 3KJXA 4NYIQ 1V3UA 3P9NA 2I2FA 3EQ7A 4F8RA 3KU4A 3WKCA 3BH6A 2GCEA 2Y9MB 1A4RA 3JAKA 3PUIA 2OBNA 4ZQCB 3U13A 3GY0A 1ZZEA 1WPQA 2VA9A 4INOA 4WOBA 4O0IA 4G8JA 4D99A 5M04A 1NP3A 1FLAA 2WHPB 3L4PA 4PTLA 2XUGA 1BA2A 1ZUNA 1UFRA 3ECAA 3EIWA 4FYMA 5CLLA 1A6SA 4AFNA 1MX5A 2J85A 4DSLA 3DXXA 1JXLA 3G68A 2EFJA 2VT6A 5C46F 3E1SA 1EB9A 1B2RA 4ALLA 1M33A 9ICXA 1NHWA 2UXCB 4BFVA 2HOFA 1E2GA 5L4SA 2NTEA 2J1LA 4ZI7F 3F2BA 1TJNA 2GERA 3U48A 1TT5B 2POQX 1P7ZA 4TTJA 2YHUA 3INTA 3LC1O 1K4MA 3HBAA 3K6RA 2ZUTA 1CEYA 5D3MB 1JVNA 2ZREA 4IQ0A 1BU5A 4INZA 3VR4H 3R3UA 3CTMA 4TN5A 2ZRGA 3UMRA 5I7WA 3P94A 2DH6A 4XRHA 3MBKA 4Q4AA 4RPZA 2CSXA 3PJDA 3U49A 4GPIB 4RE6A 2JG3A 1DSSG 1Z1BA 4KUEA 5HSGA 2BCRA 3LYAA 1DQYA 8ICLA 2QW0X 4QWWA 3C85A 3RBEA 4TWJA 3BHMA 3C21A 3HEBA 3N2IA 1T4BA 4ZVMA 4YQWA 4TT8A 1EXNA 4F8JA 3M6LA 3ET4A 1HC7A 2EZ9A 2IY7A 3WNZA 4D9KA 1ZM7A 4R1LA 5JJIA 2HTFA 3PV0A 3AX6A 2P9ZA 2XCQA 1L5SA 3KXPA 3EYZA 1J8DA 1PSWA 1LF0A 2JD2A 3CKMA 1QYCA 2IE0A 3RUHA 3E0XA 1KI7A 2G5IB 3K15A 3L79A 2ZI4A 8ICVA 1L4KA 4FGLA 3SHFA 3TB6A 2IWHA 5JH7F 4AY3A 2H52A 2NO5A 4D80A 1WCIA 4L3VA 1U5AA 1GN9A 3LECA 1VLHA 3DBRA 5LZ5A 4BNTA 2I6UA 4O1MA 2JJ8A 3U09A 4C3UA 4F3NA 1ZM2A 1CR4A 4D8TA 2ZYIA 2W42A 3NIFB 4C05A 1JTEA 5F76A 4ZI3A 5ALOA 2ET6A 4EYEA 1Z4IA 1I5OA 1F8FA 3EEIA 4GYYA 5HG0A 4RQ1A 1E60A 2QY9A 1SKBA 4LV8B 3DHVA 4QBHA 1II9A 5C0OE 4DNPA 5LR6A 1TV9A 1IEVA 3H7AA 3T7CA 4B17A 3SE0A 5T8KA 3I73A 2E5WA 1Z4JA 4NJMB 1SA0A 5IP5A 4C21A 3FF1A 3VR0A 2VP2A 1VJTA 1XU9A 2P9FA 3RB3A 3OIWA 2D7JA 2DZDA 3TL3A 3WI7A 4C0XA 5GMOA 3I4CA 1AGNA 1IXSB 1VL2A 3PNPA 2CV2A 4JWNA 4LVCA 1SBZA 3MTJA 3EDCA 4CV1A 4PV7A 2CF5A 3OBIA 1ZRSA 4RMNA 4BFUA 2J6IA 4HDRB 2VJ4A 1PT7A 4K8OA 3EVNA 3R0JA 1T2DA 3NRZA 1X7WB 3KKEA 3JQBC 3V7WA 1T9BA 5C8VA 1SCIA 3CWZA 2QZPA 2F17A 1Y3AA 4RM3A 1JEYB 3A1DA 2FN7A 5K6AA 4PYLA 2I6XA 3FKQA 4DEZA 2BFEB 4JLJA 1PVPA 3MB8A 3IOYA 2GCNA 3CF2A 2J48A 4N7RA 3WGTA 3HI4A 5KOJB 4KOAA 1SKUA 1TYCA 3BSFA 4YJ2B 1TK9A 3ETLA 1NQ5A 3AF3A 1Z4LA 1A0PA 3ONDA 1KAMA 3C70A 4OY3A 5E6RB 2GEFA 5H0IA 1X80B 2VZLA 2VF4X 1O4WA 1PIWA 1QWOA 3K1AB 3IV6A 2YZMA 2PUJA 2OFFA 3V7NA 4IIYA 3NT4A 3W9UA 4C0KA 2JASA 2W00A 3QIAA 5TMEA 3C45A 3AQEA 3TEMA 5BW5A 4RQ5A 4MUNA 4EB0A 4EHNA 5AW8A 5JC8A 1W4BA 3LFUA 5EJ9A 4C8LA 1LLQA 3IR7A 4ZZ0A 4ZD6A 4MCIA 5J4HA 4V1CA 2IS4A 3BF8A 3MGHA 3BIFA 3LK6A 4GLBA 4Y1RB 1EK2A 3D1VA 1BA3A 2JEFA 5KX5A 1USGA 1REQB 2EWMA 3W79A 3ADCA 2V03A 4NJMA 2CDBA 4RY8A 3RNOA 5B58C 1CY6A 1GLVA 1QANA 9ICBA 2FSHA 2ZRDA 4RJJA 2G72A 3SZUA 3DBOB 5UKDA 3CRW1 2E1EA 3DOHA 4GE3A 4XAQA 3A14A 5JJBA 5LDHA 2Y6UA 1Z6PA 3KFXA 3QQ5A 3BZUA 5THKA 1Q3VA 1O97D 1Y7TA 1AV7A 3ESAA 1IEQA 3MTEA 5C7LO 4ZH4A 2D0PB 1AHIA 2YJ5A 1FUYB 1USVA 3KKNA 4DV6B 2BFDA 3HACA 1VKNA 2GF9A 1SN7A 4WERA 3GZFA 1ZOIA 4ARVA 4IDPA 3WO1A 2WD7B 1H2RS 3L0DA 4DM7A 4AJLA 5BQOA 2BJWA 3JR3A 1CX9B 3TI9A 4W5RA 4KQHA 3WG9A 3NHUA 2I7VA 1HT2E 3DC7A 4QFBA 3O4HA 1L6RA 4YJHA 1E58A 3A27A 3PFFA 1PHPA 5SYMA 5TC4A 1ISMA 4XFJA 5AHKA 3ZQUA 1GFSA 3M4XA 3C6YA 3BZCA 1WUTA 2ZETA 4REOA 1TRHA 3NATA 2H3ZA 3COPA 3PPXA 1FRQA 4AKTA 4AG6A 1RCFA 1TM1E 4ZN6A 1HNZB 4C0HA 4CFSA 4MRMB 1HMPA 3HSKA 2Q41A 2YWRA 5FTJA 4AAYA 1WLSA 4UPEA 3G2QA 1NXPA 5KUTA 4CUJA 1I7QB 1Z2NX 1YB5A 3C3CA 3W5HA 4TSRA 4YCSA 4Y2SA 4D8YA 3ZDCA 1TVKA 3JPWA 3CPHA 1J56A 1GGEA 4I0WB 4LDAA 5DCUA 1DRJA 1C1DB 1UBHS 2Y1LA 5IC6A 3G0HA 2XEDA 3PLNA 4WOKA 4WESB 3KKLA 4CMAA 2PT9A 5LYJA 2PUCA 4MZDA 4HEJA 4UFOA 4D25A 1XS9D 4MP8A 4U6QA 3DEFA 4D56A 2DTXA 1Z0UA 5A62A 1U7DA 1WL8A 1X6JA 2HLPA 2O4CA 3E4CA 1UWVA 1KKUA 1N8KA 5REQB 3OPQA 4AYXA 1MOZA 4E12A 3OQMA 3UMYA 1TEHA 2WU4A 1U7UA 3E0QA 3WHKA 1WD5A 1T1JA 1KRHA 3PNSA 4MPJA 5J23A 1K97A 4FHCA 4N39A 2VH5R 4JBGA 1MORA 4G24A 5EY5B 4D9IA 2WQ6A 1PJTA 4RA6A 4AMBA 3P9PA 2IXEA 1N3BA 2PXHA 2X8BA 1JAYA 1WTCA 2R60A 2PYIA 3GEHA 2X1MA 3CUUA 2XMDA 4MV6A 4C0BA 2HQSA 1KNXA 1BPBA 3GLVA 4ND5A 5LD2B 1W96A 2ONCA 2IZ7A 3A4IA 4QU8A 2R2GA 4M1SA 1YR8A 4DQQA 1A98A 4L57A 5CPFA 3THXA 4LNUA 1Q74A 2O1XA 3X2FA 4DIDA 5B4VA 5ITVA 3M8KA 1AQLA 5AOVA 1AURA 1SCUA 4YI3A 3RIGA 3WR5A 3FF4A 1PVOA 5KQMA 4DOBA 7ICOA 4YMHA 4YT4A 2P90A 3QE4A 3AEQB 1PS9A 1NP6A 4D2IA 6PFKA 1JIVA 1GD1O 2IUEA 1NVFA 1PFUA 3IEPA 2B4RO 4KYUA 3GGPA 3TADC 4I66A 2JGKA 2GJ8A 2NYUA 3FZGA 3NAZA 4IVNA 5AXCA 2CW5A 5K99A 1BE1A 1F0MA 4QG3A 3AG6A 3LKZA 1I1HA 1RJWA 3IM1A 2R8EA 5HJEA 4MWCA 3W5CA 4NONA 1V38A 4DFPA 3TANA 3D8TA 1E8NA 5K3BA 2PAAA 3ENVA 1NXSA 5EFOA 1XJ0A 4MV8A 4UAJA 5G53C 1UC5B 4IMIB 4P98A 2IYSA 1HYHA 3FHLA 4B84A 1X9MA 4HAIA 1M54A 1QGYA 5DNDA 2YZKA 4WUTA 2XCTB 1G1AA 4JVMA 1LB2B 3BIXA 3UPTA 4PTZA 1I1OA 2GZ1A 2KVCA 2PS9A 3LDAA 3RS0A 5LQNA 2GN1A 1H2FA 2VJAA 3NVAA 4OFBA 4B3GA 2CLDX 1Z8FA 3V4LA 3M9WA 1VI6A 4UOZA 2K4PA 5FLEX 4OHUA 4ZDKA 4PGAA 5BQPA 3I5AA 1GP2A 1ABBA 1YZLA 3R41A 1XYVA 5BP7A 3IHQB 1ZI6A 1GGHA 3NDJA 4IHJA 4XWAA 3DLBA 5B6JA 3OT5A 1QSSA 1I7PA 2BAGA 4IIVA 1GCOA 4YCCA 4NBKA 4D02A 2R47A 3CLRC 4ZQBA 4R1OA 5FTLA 2AN3A 3D8NA 2QRKA 5EMKA 3LBYA 4IOLA 2C1EA 2R8XA 2ZTUA 2HCBA 3HBMA 4CLHA 3ZCQA 1T1RA 1ZVVA 3WLRA 3V6KA 3G8BA 4U2FA 4UZEA 5A3RA 1G55A 2A1UB 2VJOA 1EFAA 3FUXA 1QH1B 3BMNA 4QZHA 2ID7A 5G02A 7ICHA 1U02A 5CDYA 2HHUA 2F00A 4B3XA 3BRSA 3K8ZA 1YTUA 3EIUA 3ENNA 4FS1A 4K9OA 1QKJA 2C1XA 4UUBA 5KFLA 2QVBA 3DDOA 5CFMA 5D01A 2H92A 1J39A 2LWIA 3RYHA 2WF5A 2B78A 2PPLA 2Q6OA 1EK0A 1ODLA 3FVQA 3OO1A 4O02B 1CUDA 1ZD9A 5BR1A 2E2WA 2RFLA 2AN4A 1S77D 1JYEA 3KS9A 3OBBA 4WXRA 3GRZA 3QQPA 3KVVA 5CX1A 4BU1A 1SIWA 5IXJA 2HHJA 3HVRA 4LJLA 3A4TA 4KGZA 2QJTA 5AK0A 1ZUIA 4UB3A 1RTTA 2LV8A 5CM9C 3D8BA 3GYGA 3G6XA 1EVLA 1JAZA 2JVKA 2I3DA 1GPJA 1PGOA 3DR3A 4HZIA 2P9TA 2ZSAA 3VDMA 2OO7A 4A73A 4QAJA 4RTLA 1JEQA 2J6UA 2W8BA 3MJVA 4OOEA 3TIIA 2QTVA 3HP4A 3L8EA 1P2SA 5KYYA 3L9XA 3E2PA 1ZPDA 1Z75A 4ECWA 2JDID 1X6IA 2BHTA 4QGHA 3BQ9A 2CJWA 3ESDA 1WWVA 3DC2A 4MGYR 3X3HA 1X39A 4JNKA 4XYBA 2KE7A 2FPPB 1ZETA 1GCUA 1QTQA 4J9LA 4AL4A 1SQFA 2HAEA 4F6RA 2HQRA 3C6MA 1SOMA 1AQIA 2P8SA 2VP9A 3FOAA 1P31A 4N5HX 4GGOA 1YU9A 2CBXA 1SHTX 3OLQA 4BN4A 1VYVA 5EKSA 4H1WA 4ZAVA 4RZHA 3K1YA 1KIMA 3OA2A 4TV8F 1JG3A 1E7MA 4NYJR 3OECA 1BD4A 4XCQA 2GNOA 3DFMA 2O8EB 1JSXA 3ODGA 1CK4A 5HJ7A 3K71B 4A8EA 1SXEA 4YRPA 2O8FB 1JG6A 2DBVO 4O08A 4MR7B 1NF9A 4QPZA 3WIOA 1AJEA 2JLRA 1N5XA 4FR5A 4X8OA 2BH9A 4WNIA 2HM7A 1JI7A 4RTJA 5EP4A 3LIPA 3LY7A 4TLAA 1AKNA 4N3NA 3LLSA 2E4VA 1IRXA 4K05A 3H8VA 1W581 3SICE 3Q8QB 1LJLA 1PDVA 1E1CB 1TO6A 3I34X 3IP9A 1JDSA 4G5QA 5EIFA 4DM4A 3DEKA 1X9GA 3SYLA 1Z3IX 4KYVA 4UU7A 4F97A 1XEFA 3H97A 4FR0A 3P19A 3MJTA 5FEMA 2XNJA 4KKVA 5LU8A 1G9TA 3D2AA 4AJOA 2CNKA 4KLHA 3AFOA 2AK2A 3G82C 3HJCA 1QOQB 3SJCA 2EZZA 3T0IA 4Z4HA 1FSSA 3BC1A 3THSA 2I34A 3RRXA 1PDOA 1EP2B 3SC4A 3GLIE 4LDNA 4S3MA 2QDXA 4KH1A 4EJ6A 4EVRA 3SZ2A 1AY0A 2VJMA 1XYGA 3L40A 4O4LB 5EUBA 1YIDA 3SKVA 4B2PA 3VJRA 1JLSA 1D8BA 1CUZA 4I1OA 2OFPA 4PNPA 5HNKA 1QYDA 2M1XA 3LUBA 1FS4A 3IQZA 4TKUA 2X2FA 1RLOA 3OQPA 4EY5A 1GYPA 3V1KA 4YRMA 4BJ5A 3RSQA 4AYBF 1T15A 3L49A 4HDNA 2VRWA 4UTXA 3G2IA 1RYFA 5JSQA 1V0JA 5TGTA 1XDDA 1LA2A 5EJ7A 4H0CA 3LGSA 2XUFA 2VZ8A 4J2OA 1TEXA 4KIJA 2F8TA 1K7CA 3AINA 1E4EB 3BMQB 4S1WA 5LWHA 1CE8A 3P20A 2F2AB 3OTQA 2QD3A 5GM2A 1BCRB 3N0XA 4MI9A 4EITA 4G4JA 2BLLA 3C8UA 4OQQA 1SL1A 1PYGA 2DP4E 3ZWVA 4C7KA 4QBKA 2QUKA 4OH1A 4UQPA 2OESA 1U4OA 5L8VA 1UEXC 4ARSA 3BWVA 3UJ6A 4BGIA 1BU8A 5BORA 1W46A 2ODAA 1OZGA 2Y1OA 3R7DA 4F85A 1Y9EA 4KO8A 2WAQC 3A0HU 1MX3A 1WW8A 4IV0A 1HNWB 3G88A 4RHUA 4ZC1A 3ASUA 8ICMA 3UH1A 3UJDA 4EMUA 2JI8A 2PSEA 4KUHA 4YRJA 8AT1A 2J3DA 4YV2A 3PSFA 4F5OA 4O3SA 2OECA 3F6CA 4EOGA 1RLTA 2IGBA 2IP4A 4FDAA 4F4UA 3FPCA 3CUWA 3G5TA 2BGIA 4RNNA 2ODQA 1GEEA 3OTWA 4HH3C 5CJPA 4X3PA 2AYXA 3FDJA 4X54A 2FK7A 4E31A 3BRWA 3M2TA 4Q6WA 3ZU4A 5KOHB 2OG2A 2WICA 1Y3IA 2D1FA 1NC3A 2F64A 1QCYA 5HIIA 2HDHA 1W5TA 2CXPA 4ZZIA 1TU3A 2QMOA 3G8DA 1SWVA 2QGZA 2FSIA 5K0SA 2L19A 2R7LA 4RUAA 2GTHA 5AW2A 2C2RA 3FAZA 4WE3A 4BEVA 3WA6A 16PKA 3IVCA 1X7ZA 1PEKE 1MP0A 1K88A 3KWMA 4MA4A 1NDUA 4PFQA 2NSYA 4CU5A 4E30A 4G84A 2FNAA 1X0VA 3RRZA 2QTZA 1U8EA 2SKEA 4RABA 2DBRA 1TPYA 1Y80A 3BHNA 4O2BA 4RKWA 5A6SA 3RM3A 1K7FB 2VWPA 1VJ1A 3DFKA 3AHJA 3ZX5A 3FNGA 2W37A 4LDQA 3V9PA 2ECFA 3DMDA 1BCSB 4NNJA 2PBZA 1S2NA 2IYYA 2F8KA 1KU0A 3PI6A 4RHEA 3U0BA 4DMUB 3HDHA 5KAPA 1BC5A 3K0KA 2YMMA 3CM0A 3A6EA 3TPCA 1Z6ZA 3T52A 1NBHA 2FRVA 3AFIA 4I81A 4ZEMA 2ZUFA 1FSPA 1TL7C 5E7JA 3E8XA 1H23A 3IGFA 2XA9A 4Q05A 2I71A 3JZDA 2V3WA 1NR7A 2B6NA 3UV6A 4IEFB 1HRKA 2XUDA 5TQVA 2NLOA 3G5LA 5EE0A 5AHOA 4Z4CA 8MHTA 3CV3A 3QFTA 9ICMA 3HDYA 5C8XA 2FB9A 2XT6A 1FMJA 1OSNA 1RYMA 1RRVA 5KFIA 1XZCA 3BS4A 4JR2A 5DFAA 2GBFA 4LBWA 3EIEA 3VI3B 5CDHA 3REQA 2D2XA 2WZCA 4ITVA 2GK3A 4A1OA 1SUSA 4RK6A 3CVUA 4LXXA 1MAHA 4NNOA 1BXRB 2BTEA 3GNTA 2EAOA 5D2CA 5EVCA 4JP3A 1ZSNA 1JWBB 8ICYA 2RI1A 4KE9A 4XDHA 4J9MA 4PC7A 3KWJA 5D51S 4BC0A 4FYPA 1M2FA 4M89A 5KFSA 1V8DA 1ZIOA 3LQFA 1N5IA 1Z36A 4CM6A 4M1TA 1Y3HA 4YS6A 1RYEA 2C92A 3EXAA 4QOIA 4EVIA 5M2QA 2BFWA 2XBMA 3KYIB 3QKIA 3LPLA 4IIHA 3MLBA 4MJ7A 1WZCA 5D5HA 2OMEA 1F44A 3W3AA 3WJ7A 1LI4A 4MR9B 1QORA 4KB5A 1P0MA 4G8BA 5K8CA 3LK7A 3DLHA 1DVRA 2WMOB 3AF1A 3RRHA 4AULA 2ZCUA 4LJ7A 1KYIA 2HYDA 2X77A 2DG2A 2ZDGA 3UWPA 4JGGA 5JYCA 2HI0A 2PWBA 2GGSA 2B4QA 5DRTA 4BP3A 3WJAA 4AJEA 4YRSA 1JAXA 1ORWA 1TVEA 4MV7A 4O2LA 4BNDB 4GLJA 3ONFA 3HKCB 3IELA 4BAUA 3N0VA 3ZE9A 4YV1A 2VKTA 4I6GA 5E2AA 1JR4A 1QHHA 1FTQA 3WE7A 5GTHU 4ZHQF 1N6PA 4O3RA 4JV0A 4LOJA 4H6PA 4MQ5A 4N7BA 3UPQA 5FL3A 3R0ZA 1OTXA 3NYQA 1MTZA 3TD2A 2ZBDA 1G6KA 2A2ZA 2WIDA 1VB3A 2YXEA 4HXEB 4ZQHA 1LPSA 5AJWA 4BFWA 3ILYA 4HG2A 1DARA 1QCZA 3R4VA 3TAUA 5J29A 3EMKA 4CIYA 2MR6A 3OY2A 1M34B 4V2IA 1TDJA 5EIHA 2IELA 2ZSBA 4MVJF 1QO0D 1TNDA 1UPAA 1C9EA 2SECE 4D0NA 1Z0JA 5TJ9A 1NF3A 4PZZA 5HTOA 2G40A 1JHPA 2KTQA 4I55F 4R1SA 5HEKA 3RSGA 3U4CA 5LMCA 3UGJA 5CT9A 1VG0B 1N6LA 2JNWA 2WM8A 2XE6A 3Q5DA 2VJDA 2KICA 3NWBA 4U7WA 5D3KA 3H5LA 3LDUA 1BKYA 2BEWA 7ICLA 4HB2A 1NULA 5A6VA 3BOSA 2J5XA 4GRDA 4J4TA 4DYVA 7ICJA 2I1QA 2HHAA 3QMWA 4HAVA 3BH7A 1SEPA 2PFQA 1T9ZA 5FULA 4CMGA 3PQ6A 2XGQA 1JBQA 2JANA 3AEKA 3CH5A 4DIFA 2HU8A 4M1YA 4ZHQA 1B14A 4DIKA 4TSFD 5ANRB 5ADVA 2OPHA 4C0JA 3OIUA 4IJQA 4MF2A 1Y1QA 1ZN8A 2VIXA 1JN0A 2H2HA 5KFDA 1YNOA 2YTZA 9GPBA 1TT7A 1T3TA 2VYNA 3NNNA 4QOFA 3ZBPA 1XRSB 2WJPA 3E82A 3OAAD 4BYGA 4HVLA 5BR4A 1MJNA 4LQ4A 3RCBA 4PX3A 3B89A 4BMXA 5CFLA 3I5YA 3R9XB 1PR3A 1OREA 4R7TA 3G0CA 4QLBA 1CUFA 2F2TA 1NUUA 1YUMA 4IDGA 3ZQJA 4C4SA 1CJCA 3KG2A 5SZKB 3T9AA 2HTEA 2ID8A 3GP5A 3LCVB 3MBIA 3MWJA 1X9WA 1QHNA 4L8YA 5F1YA 4BQFA 1E3WA 3W2IA 4UDYX 4D9JA 2NAFA 3KD2A 4Z9BA 1G7CA 2REQA 2NXCA 2EEZA 3K0EA 3R44A 5LA6F 4U7TB 4EB6A 1XRLA 4GMXA 4XYGA 5IN4A 4YASA 2QRVB 3H2KA 4LXYA 5J4LA 9ICJA 4X24A 5DXJA 4H3SA 4JYBA 3GRVA 2AJ8A 4NCHA 3C7TA 3JX9A 2JLYA 4B9MA 1RTKA 1M75A 1TI7A 1ORRA 2QX4A 4RL6A 2R3SA 4W6QA 3K6SB 2W6PA 2EW2A 2WTAA 9ICAA 5D85A 3C7CB 2OD7A 2HMYB 3MGIA 2VQ6A 1HBJA 3AV0B 3ND8A 1BS2A 1GHTA 4EF4A 1HFKA 3SYTA 1EQ2A 1JQEA 2JJ1A 2G9NA 1SVMA 2OHIA 3EF3A 1XHEA 2AFIE 3HABA 4DZRA 4Q19A 3ABRB 2F43B 3OCJA 3ELDA 3PXBA 4WLEA 5FTMA 3D2BA 1ONPA 1P2TA 3I6BA 4ACAA 4R8LA 5J2GA 1HORA 3NHWA 3KUXA 3BD7A 3EA4A 3MBOA 2B3DA 1IHPA 3K73O 4HWKA 4Q3EA 5ECYA 1NVXQ 3BTSA 4J0HA 5IHPA 4U8GA 3QLVC 3QX8A 3TCKA 3NW9A 1JKIA 4C07A 3K8YA 2FFRA 2HLHA 2R8JA 3NO4A 4JU8A 1O9GA 3INGA 4HGOA 2X1LA 2LD4A 2JGAA 4P22A 4NBLA 3WLAA 4MWZA 1EX9A 3RUFA 3SQDA 1OT5A 3ZTTA 1SQ6A 3JQEA 2R8ZA 4ZAFA 5A5EA 4IXTA 5HVNA 1XFDA 2WWTA 3GLHE 2QUZA 5AXAA 5H3CA 2W6QA 3ASVA 4L22A 3ZV7A 2FGKA 4B73A 2QRUA 4EGJA 4FMBB 3DZCA 1J0DA 2OBMA 3EF1A 3MUFA 3OZEA 4JHXA 5TARA 1SOUA 1XRMA 1JE0A 2OENG 4KQ6A 2ZB7A 4BO3A 1V97A 3CLUC 1XDWA 1LKZA 2DHEA 1T0JB 3H1AA 3KZ1E 3N59A 2ZRNA 4JS0A 4RVGA 3SX4A 5EI5A 4B3IA 4X93A 4OXRA 2AGQA 5F5XA 2G0AA 2GCGA 4F3RA 2LCIA 3Q7EA 1FJHA 4P3PA 2QLMA 5BQ5A 5KFCA 1Q5PA 2VJ5A 3ICOA 4J4HA 4AJ1A 4EKIA 4IQWA 4DCGA 2EIXA 1AOXA 2NO7A 4KRXA 3KR1A 4HVAA 3NEPX 2C2DA 4X6XA 2QYSA 1BKDR 3LQQA 4FOSA 1Y5LA 4P0QA 5TISU 2Z83A 1A95A 4WEQA 4RSHA 3EISA 2WFLA 5ICEA 3ZWCA 3A11A 5AVYA 2R96A 3QJYA 3N6RA 4AWBA 4MWBA 1PR9A 2XC9A 1HMYA 4YRDA 1KO8A 4R01A 3T6KA 4BVAA 4QSHA 1WVGA 5J2HA 1H4TA 2HFKA 3BKWA 2KQUA 3D0OA 5EKTA 4CIBA 4ZDJA 5KYKA 2JJ2A 3REFA 4UAYA 3TEFA 2RDMA 4KTTE 2O0LA 5J2TA 2BHRA 9LDBA 3H2GA 3KQYA 7ICEA 4WVLA 4OHFA 2V98A 2JW5A 5BVHA 1ZRMA 4Z6FA 4IUBS 4MW7A 4YDSA 1QC5A 3VC8A 3GJ0A 1XWIA 4EF6A 3NWEA 3RC7A 3TFQA 3EDMA 5IJ9B 5LP1A 1TJ5A 2MYUA 4NPHA 4ZV4A 4BNNA 3TTYA 4QZFA 2KBEA 3CEJA 4KLOA 3MQ4A 2HYIC 1MOQA 3JQ9C 4C7MA 1CVIA 3WGOA 3KTFA 5EWLB 3EUFA 3Q10A 4Z4GA 1YKGA 2P6PA 3NNDA 3WGJA 1N33B 4EUSA 1E1YA 3F3SA 4F5DA 2Y99A 2HOQA 4HXGA 5GY7A 2HBZA 2ASDA 1IIPA 3KZIU 1ZMRA 4D92A 1JQBA 1C7QA 1P0PA 1Z5ZA 2AOTB 5DNAA 3WGVA 4HQ6A 1BO6A 1B7GO 3HX0A 1C8KA 2GAAA 2IE8A 2X7JA 4OQXA 5IT5A 3FDSA 4EPWA 1QTIA 3EFBA 4DTIA 3UXYA 4CQLA 3KUUA 1HE8B 4TSFA 3E35A 4UM8B 1JQDA 2WUFA 4UUPA 1NX9A 2WSLA 2WQ7A 3HZHA 4CNBA 2SICE 4OYRA 4DKJA 1BE6A 4RMGA 5DHSA 3SZMA 4DV1B 5L9XA 3ZYZA 4ZFNA 1D2GA 3NHMA 1BNOA 5E6SA 2PKQO 3GFRA 2F8MA 2VYCA 3K1ZA 3OJCA 1WUJS 2Q5HA 4QT0A 5ALSA 1U7XA 1J2TA 1O2DA 2QAGA 3HUEA 3JAWA 4UDNA 3HJEA 2OCIA 4UNQA 2Q7OE 5FFNA 3RVRA 1Y82A 4O2AB 1O6BA 2ANBA 1LV5A 2G76A 2J3JA 3C97A 3MQ2A 1KK1A 2IPMA 3O8NA 2DR2A 1U9IA 2V9PA 4DDVA 5FBVB 1EPUA 4TV8B 4C8KA 1DC5A 1K4KA 3Q8XB 3C6XA 4DRZA 5BUZA 5HIKA 4A5OA 3C5WP 4HFMA 4I3GA 2IIPA 1M2NA 5BPFA 3IKVA 1OLXB 3Q12A 2HJVA 3DO8A 3D3EA 3BM5A 4B2IA 4D0RA 1H9CA 1V8ZA 1U6KA 5EA2A 3C5FA 4D9GA 1JG2A 4I29A 1VXRA 3FFXA 4BVKA 1W44A 3T7AA 3NR2A 2B82A 4B7XA 4TZ6A 1BG6A 1CR2A 1SM4A 3FLEA 3BJYA 3FMVA 1QPBA 4JA0A 3R7WA 4F4WA 1TZJA 4R83A 3M6KA 1RHUA 4QG7A 1GTVA 4PFKA 3TXXA 3OF3A 3OC6A 3E2MA 3KSAC 2PKQP 5MFZA 2HWWA 4C4XA 5BOMA 1S2MA 2PWZA 1HA3A 5E6UB 4MGKR 1OZHA 4US0R 3IG5A 3B82A 3TYXA 4AKGA 4Y1RA 3O5AA 4IM7A 2VP6A 2QTAA 4GPAA 1B2LA 2YWXA 3V3KA 5LQRA 1PJSA 4M8LA 4EPYA 1UC9A 2OE2A 2BTOA 3BD9A 3RREA 5A0LA 4RMJA 1ZQBA 2OHFA 1JI3A 2BM9A 3ITNA 1E2DA 3PDJA 2M0NA 4HJRA 4HY3A 1O5OA 2IH2A 1E0DA 4CMEA 4NBRA 3L1KA 3MTAA 5FTNA 4KR7A 4L9SA 2FR0A 4YJFB 2JI6A 3F6PA 3FCAA 1X8LA 1XAJA 1HKHA 3PF8A 3ZLBA 5B7QA 1N32B 3G6VA 2JMGA 3SI8A 4BNIA 3QU2A 1U2PA 1YDMA 2FMIA 2I8CA 4P4LA 4TUYB 1S2LA 2W93A 3TUJC 4LF5B 2J9ZB 4QPJC 4B3TB 3IULA 3M5CA 1Y34E 4UB8U 3C8DA 3E5NA 2V8OA 1PK1A 1C7ZA 1TTQB 3O94A 2R4TA 3PTZA 3RIYA 5JAPA 5JO0A 1JEEA 1K92A 2FEOA 2UV8A 4UU0A 1AD2A 4US1R 1Z12A 2XMZA 1AUPA 1L1RA 4RHXA 5BN4B 3U17A 5EYPB 2JFBA 4D8VA 1CQJB 2WC1A 2LM1A 3P9QA 2SCUA 1U1IA 2B21A 3D6AA 3T06B 3OI7A 1U0HC 3RVKA 1KW4A 3CNQS 5JCXA 2HQOA 4N5MA 1WVMA 2DX7A 1KGSA 1OT3A 3IPAA 5K0JA 1AQ6A 1FXSA 5J2UF 4UAVA 2KZZA 1JB9A 3EXHA 4B2LA 2J0UA 5FJJA 3GLGE 3RQIA 4M3NA 1CF2O 1H6AA 1M0WA 1ZQAA 2W6OA 2EHDA 2WVHA 3BJMA 4H59A 3U7HB 4BB5A 1PYDA 5DB7A 3TFSA 4MYRA 1NU8A 2W2VA 1KBQA 3SENA 5IK2A 1DQRA 4G09A 4X6LA 3R8FA 2JGDB 2EZYA 4G4GA 1T5HX 2X19A 1TLFA 1GPNA 8ICIA 3WZLA 2QJOA 1KMHA 3N8NA 2Q6KA 5G1PA 5C34B 4HL6A 2A5JA 5AUOB 2CVPA 2OM2A 4ZODA 5IASA 5J5VA 3M7IA 4II2A 4MRPA 1WOYA 5KVQA 2IOQA 3V55A 2PT5A 2BMDA 2A94A 4KQ2A 3O2JA 1W5AA 3OP4A 1Y89A 1BN7A 1DUSA 4OXXA 4E09A 4U4AA 1YRHA 2M2IA 5IHXA 1I6WA 1SBCA 1WBJB 5DX8A 3KZXA 1N0IA 4BATA 3VHLB 2Q45A 4KRGA 1HM5A 2Z2YA 4MWGA 2RH4A 3GR6A 1CJSA 2RDIA 1G5TA 4S1OA 5LXTB 3L4JA 3C3PA 3SQNA 3CXRA 3FY4A 3FLMA 3ZUGA 4AICA 3SYKA 4BASA 4KVZA 4YK7A 4Z7NB 4B6EA 3WK7A 2BN4A 2AXPA 2QP3A 1RIIA 3QWIA 1CR0A 1EJBA 2EKLA 4J91A 3DDSA 3SYNA 2JFXA 3WWZA 3T1QA 3UYKA 1P6XA 1N34B 5JBQA 4CT5A 2AQHA 4ZKEA 1T3QA 3NHFA 2FSVC 4IHKA 5LP6B 3KQLA 1RC8A 5KNCD 1G6Q1 5ITWA 1VHWA 3LTEA 4QVKA 1XZHA 1MEJA 5ED4A 1N25A 1PF7E 1MABA 2B2XA 2QRVA 1VIVA 4DNXA 5DYIA 3UJCA 5EIBD 2BFPA 2D5CA 1YACA 4G4IA 4GM1A 3L1HA 4QXMA 1FDIA 4YCAA 1WVIA 4IUDS 3G6YA 1GTMA 3ZNOA 2LZ0A 1WQ1R 3T41A 5HKAA 2PFNA 4P35A 3PX7A 2KW5A 1D9XA 5EXPA 2C28A 4WD3A 4N0DA 5TE9A 2OWDA 3RC2A 4EG5A 1PR2A 2GN2A 1C50A 2OV3A 4CLOA 4CLEA 1F60A 1WDMA 3RYHB 2I2BA 4H7HA 3DMRA 1QQ5A 1AS2A 1P77A 4HS9A 2N3ZA 1D8TA 3NONA 3ILHA 2J8ZA 4MOWA 3ZGYA 2L0XA 1E18A 2V6FA 4UUQA 3I5UA 5HZHA 4UNPA 3V4OA 4EPVA 1ZQCA 4N76A 4DL4A 2A4KA 3ZKAA 4TKMA 1KWKA 4MK4A 3SQMA 3UJ8A 4FJ1A 3VR4D 1E63A 3O8QA 4RPLA 2OHOA 4W63A 3GJSA 2WSBA 5J0OA 4EA7A 4E5UA 1R4MA 3PXEA 1LFAA 2AF4C 4DCVA 1TU0A 2TS1A 5FHQA 2PZEA 3K6KA 5A7HA 4M0FA 2PU7A 2Q4BA 4BBAA 1E0KA 2JIPA 4KOEC 2W03A 1YGYA 4RTMA 2IXBA 1RQGA 1EMDA 5T4HA 3R5XA 4FYJA 1JPJA 3AJ9A 5B66U 3ITKA 3VNRA 3VPBA 4OI0A 3CE6A 3UXMA 2O20A 1QZTA 2PFSA 3B51X 1T3ZA 3ZJUA 3HTXA 2O8BB 4RPHA 4PQYA 4P5PA 4X7RA 1J09A 1DO8A 1UPXA 3UAOA 5CG2A 1CHNA 2OEHA 2QNBA 1ND5A 3WFJA 2WABA 4CMIA 2XSZD 3ROEA 2HMSA 3QXHA 3ZQKA 3B9QA 3CY6A 4H35A 2R6FA 4UEWA 5SZJA 4PZDA 1EEHA 2GEVA 2ZTEA 2W4IA 3MMNA 4EX7A 1CQWA 4GKJB 4FIDA 4DLGA 1DWUA 3OQ1A 2WAOA 3NDRA 1WW3A 3USCS 5KBYA 2Q3DA 1KI8A 2CMKA 3D1LA 1HURA 3OQIB 4KFRA 4BX0A 5TMBA 4V0KA 4EO9A 1J9ZA 1BDHA 3LQKA 1E2LA 2BSXA 3NAGA 4TXNA 3VMFA 2WYWA 4KIUA 2ZB8A 1OWPA 4E15A 5HR5A 1Q1AA 2Y0DA 5EIAA 5B1EA 4EHLA 2D1RA 5LDDC 4M7RA 2IEBA 3PICA 3I01A 1S9HA 2FG7C 3TI7A 4HDAA 1EHCA 2Q6LA 2KM1A 4IXNA 4K3VA 2QL9A 1SIUA 5E8JA 1LPBB 5K8UA 2BGJA 5DB8A 1MA0A 4ETMA 1NG9A 2CFTA 1Y6GA 4YMNA 1DEAA 2GF2A 2XYRA 2JIZA 2YMPA 3CS3A 3HMQA 4E5PA 4GP9A 1PR0A 1X7YB 1XK7A 1P44A 1FSGA 1I2BA 2H5LA 1N2OA 2QS9A 3PA6A 1JEAA 2QOEA 3DQZA 4PS0A 5EC8A 3TZLA 4D98A 4QREA 2CFSA 2HFJA 3HYNA 1KC1A 2X15A 3GVPA 3O0TA 3P32A 3U7EB 5CEEA 1HFWA 3GGSA 4DCUA 1XDBA 4UPVA 1P80A 4ZEVA 2C1ZA 4L2IB 3O2QB 5K8TA 1JMKC 3BDPA 1KQ3A 3PKJA 1ISGA 3IP1A 2OV4A 3GJ7A 3TEJA 1EUQA 3TGLA 2FH5B 3E7XA 4OATA 4B3SB 1E2JA 3HWWA 4DV3B 5KAIU 1G7TA 1PR4A 3GRFA 4RLSA 1CEZA 1T9GR 1U0JA 1N7GA 1SV4A 3EUAA 4X61A 1LUAA 3K05A 3DTNA 5KNDH 1ZH4A 4RF5A 4UMFA 4D3ZA 4KLUA 1POWA 2I0FA 2YNMC 2F44A 2K2QB 4Z9XA 1Y3DE 1R6XA 3NVKI 3QY0A 4YP7A 5J43A 4N0MA 1UBJS 3L7YA 4UBIA 3KAQA 3TIFA 1TD1A 2F48A 1JSZA 1JFVA 4GSYA 3CBQA 3CRXA 2RH8A 5KOJA 2VA2A 4X65B 4G1CA 2YWHA 4JQOA 3WIUA 1PS0A 2QNRA 5KYTA 3RF9A 2JIMA 3LT2A 4FBTA 3DWEX 4RFSB 1TZ2A 5E7QA 2OBLA 2ZKLA 1TCAA 2CXHA 3HYRA 4N8DA 1ZJZA 4Q4AB 1G0NA 2VLIA 2HK9A 3K0FA 3N2YA 3P0EA 3QFFA 4L75A 2ZRCA 4B46A 2G0NA 2DEUA 1RW4A 3WTBA 1UMCB 1ZLYA 2FUG1 2CPRA 4QJIA 4XCXA 5K51A 2HIHA 1V1RA 2P3QA 8ABPA 1Q3TA 2X3FA 1GPAA 2VCYA 4G9GA 1YR9A 1OHHA 3O8LA 4G97A 3OFNA 3N2GB 5BSKA 2A5DA 3SCZA 3KR2A 2DY0A 3ZHZA 1J22A 3DZIA 1PL8A 4I2FA 2ZTSA 1LH0A 4PANA 3RJMA 4EVQA 2WE7A 1D8AA 3PRJA 4OI2A 4U6SA 1TEVA 2BPOA 1Q0PA 2W4MA 1Z74A 1CIPA 2ADMA 3FA2A 3UJHA 2V1UA 1RKQA 2CGEA 5GGXA 3DGEC 3RYIB 3OCYA 3RW9A 1VCMA 4TQSA 1DFHA 2RRDA 3SEIA 1SD5A 2KOBA 3CIFA 3L92A 4F91B 3U31A 5CFPA 4DSOA 3ILXA 1XZIA 4ZT5A 1KPHA 5FHRA 1KTVA 9ICUA 1E9BA 2WFAA 3LNCA 2OFXA 3LHSA 1KOLA 1K6IA 1JEOA 2J41A 3L7DA 2X0EA 1CZOA 3BZBA 4M1QA 4TPKA 3KZVA 4WJKB 5TR9A 1PVQA 1JMYA 2ZE5A 3UF0A 4IQGA 2VNIA 1EBFA 3G2LA 5TPZD 5SICE 1Q84A 4Q9JA 5B7GA 1G5QA 1Y5NA 3GPDG 3DV0A 4JXKA 1I3CA 5B2ZA 2E4XA 4ZMRA 3WB1A 4FGJA 1KJQA 5BYJA 4RK0A 2B8JA 1LPMA 2JLZA 5KSWB 1JKJA 2WJYA 2EBUA 3E7FA 5HQ3B 4MB0A 4PHEA 3MR5A 3QYFA 2XW6A 1Q21A 4FPXA 4YI5A 4E0BA 5J2AA 1E4YA 2CXXA 3GJ6A 3TZQA 1I51A 3ABOB 4ECZA 4R9NA 4TOIA 4FNMA 1SUDA 3B6EA 3BD6A 4L0CA 3PW7A 3ZDQA 4K4GA 1B6RA 2Z3WA 2CXOA 2FN9A 4ZVVA 1RYRA 1COZA 1PN3A 2Q3BA 5CM2Z 5FBRB 3U4AA 1VA4A 2KE5A 3FKJA 5ALFA 3IEUA 2FP4A 2OAEA 3LV8A 3GXBA 1TZKA 4HYYA 1XT6A 1UBFA 4MVJI 4MQEB 5DISB 2DXIA 4N6OA 1I30A 1R2QA 2EQBA 3VKWA 1SIOA 3HZZA 4PYOA 1GGKA 2ZIGA 4QTXA 5DM0A 3LY8A 4ZCSA 5KNBA 3GGDA 1SXDA 3AMZA 1A0OA 3GMSA 5AI8A 4ZO8A 2J5KA 4Q4DA 5AI6A 2O05A 3N0WA 3MJSA 2ZB2A 1LC3A 2ZT7A 2YFHA 3V8NA 1XMIA 2HXYA 1AS0A 1VMDA 2MOKA 1GCGA 1NUHA 5GQSA 1L4LA 5F73A 4B81A 5KNIA 2G1AA 2BDEA 2G5PA 5EEHA 4EW1A 1GTSA 2CLSA 2XYPA 4GOOD 5DHRA 3RT9A 4DLVA 3VGPA 4BO7A 3E3NA 1BX0A 2BFFB 2I4RA 3QLUA 4PHAA 1EBUA 4HDQB 5JFGA 5L1JA 5FBLB 3NBXX 3RC3A 3JQPA 1RWOA 2ECPA 2ERCA 5DX0A 5E95A 1H69A 1DAMA 2ECQA 2ZXEA 3X1XA 4BCBA 4EA9A 1E2UA 1SULA 1UK7A 3L8FA 2G17A 3RUIA 5LUAA 1NNEA 3MQFA 1HQDA 4OO3A 3EPKA 5AK5A 1CUIA 1RSZA 1YRAA 4M0DA 4S12A 2H17A 5KYXB 2CLIB 2WAXA 1HR0B 2YY7A 4RS3A 4DXDA 4YQFA 1M2JA 1DHRA 2IIBA 5CB4B 5JNTA 3LC2O 3PJGA 1KOJA 2I65A 4QYIB 1XQWA 3I30X 1O6ZA 1ZA2A 3FYUC 5HK8A 4EJMA 1XAGA 4ILEA 1VGQA 3QKWA 1HT0A 2NUPA 3FNQA 1NAHA 2P2NA 5DTEA 1FXUA 3SIXA 3RV3A 4U2GA 1PG2A 2W2NA 1NOJA 3SIRA 1WA5A 2CVHA 1ZQNA 3S27A 1X6VA 4R66A 3O8QB 1MO6A 2G09A 4N5DA 3OJWA 3LUCA 3N74A 4GSKA 4KAFA 4TXLA 4Z9AA 2FUCA 2ZAMA 2OXEA 4PXSA 3C3MA 3H8WA 3D9QX 4QHTA 2Q7DA 3TCNA 5K4HA 4CKZA 5JU6A 3OZXA 4I2JA 5KT3A 4XTCS 4QDTA 4DB2A 4ML3A 1EX1A 4YMIA 1A7JA 5KSYA 4O5AA 1W85A 4M0PA 4OUDA 1ZQMA 2AC4A 2JKZA 2VP4A 1Z82A 3R7SA 4CEIA 1PR5A 4XWOA 4NV0A 3I1IA 1UFKA 3IB3A 2JH8A 1SURA 5IFKA 3BXPA 1DMSA 3L1JA 1XWFA 5DLQC 3S1AA 3T9CA 5LNK1 3HFJA 2AG6A 4XD7D 5DTMA 3O1IC 8ICNA 1T9HA 4LMRA 4F8YA 2WAQF 4PYRA 3RYFB 2H0QA 2WJ6A 4RTPA 2HBLA 4OK6A 1UJ6A 3MS4A 3LDHA 1TT5A 3OSZA 4CIXA 1JDVA 2ZRKA 3TZCA 4D97A 4DTCA 3HP6A 1SU8A 2O3RA 2Z5LA 2JD1A 2GM9A 3AJAA 3DOIA 5C52B 4FGUA 3CT6A 4WN9B 4C0ZA 3VPXA 2MIIA 3KCNA 4U2DA 2FZEA 4ARZB 4L74A 1XU4A 2Y71A 4Q3LA 4CIAA 5JYEA 2VC2B 3FFWA 4K81B 2CLKB 3FAKA 3Q7TA 5FLKA 1YUBA 1EUDA 3GFKB 2RAPA 1N0WA 2GA9A 1K89A 2E4ZA 1N2CB 1T2AA 2G70A 3C3DA 3ZXSA 5LQAA 1AH2A 3LQRA 1QG6A 4IZHA 2PL1A 5IVDA 4AUNA 5K01A 1SVSA 1NW6A 2OD9A 1BCRA 4E14A 2J3KA 5AHRA 1N9GA 2PBRA 2C4MA 2PGOA 2NZ2A 2XUIA 3NCHA 4IGFA 4M0MA 3IUJA 4DL7A 5F52A 4TVSA 3MF4A 4CLRA 3KQNA 2V4UA 3AJ8A 1Z4NA 4S1PA 3TRIA 2PUWA 1JGTA 3AZOA 4HWTA 4RVUA 2CUNA 1XLVA 3KYCA 4V0SA 4JBNA 3AR9A 1LDEA 5AESA 5M34A 1XQ1A 4ZOCA 1UIRA 3LCMA 5JAZA 2BFCA 4OI4A 1EFLA 1OPRA 5ELLA 2H4HA 3RPEA 3W7VA 2VF7A 3RWMB 5KFMA 1RR6A 2UYYA 4I28A 2P0EA 3JW8A 5KFEA 4GR4A 2QXUA 3ENZA 4AS2A 4EUHA 4P32A 2NX2A 3D4PA 2R9VA 4D57A 2LUOA 1FU7A 2JCXA 4FUTA 5CLJA 1K7XB 2H3FA 4QFCA 5K09A 2ZJ3A 3N53A 2QP4A 3GFQA 1PAUA 1BSVA 2Y2UA 2BFEA 1T4CA 4BUCA 4WXHA 3SC2B 2R44A 2AEFA 3FXAA 1IXYA 3SF8A 3JS5A 1BGVA 1XN1A 1PNQA 5C1DA 2RB4A 3QVOA 4ZTBA 1ZM4A 2VHXA 1JQAA 2VPWA 2OBFA 4LK2A 1QQAA 1F5NA 2PPVA 4MW6A 3QVVA 1MAAA 3B70A 3ST7A 4B79A 4J0GA 4Z6EA 4Z7OB 2OV1A 4GOND 4X3CA 3WLSA 5B2FA 4YP3A 4UNIA 3COJA 1UKAA 4Y9RA 2IY8A 2GJKA 4MKZA 4BB6A 4CN8A 3IIKA 4LFBB 4YROA 4WRRA 4RPIA 1SA0B 4RJKA 5TSDA 3ZU5A 2GXUA 3QUAA 3GL9A 4EL0A 4FVTA 2HL6A 3T7JA 3TH5A 2W6ZA 5GZ6A 1XV5A 2PA3A 3CNBA 2P9JA 3O8RA 3E58A 5JSZB 5H8WA 4EZ9A 1JLHA 1VMIA 2IS6A 2Y4OA 1TK8A 3LU1A 2FOLA 1H4SA 1K1EA 1VE5A 1P91A 3EUWA 5KYWB 1OVGA 3H86A 2B4YA 1IPFA 3L6UA 4MH0R 2RAVA 5IKXA 3BWDD 4Q01A 1PD0A 1U7HA 1BPDA 2QI9F 3CB4A 5HOQA 4ZVPA 4KRFA 2PS1A 4V3BA 1WPGA 3EH1A 3P9RA 3B1WA 3ZVRA 5JI2E 2BFCB 2QL7A 2ZEJA 2XB2A 2M1ZA 5CA0A 3QELA 2VAWA 1DG1G 1W6RA 1OMOA 1RC0A 3FN4A 4Y6QA 4KN7A 2CLLB 2JJ1D 4ZT6A 3SZRA 2CNDA 2I7TA 1T5LA 1V1MB 2DPJA 2GN0A 4JBXA 5L3RA 4PLTA 3S81A 4JB2A 4LRWA 2XRFA 4LY6A 1WS6A 2PRKA 3VUFA 1XJCA 4CM4B 2PQ0A 4BFTA 3W5JA 2WRZA 1NN1A 5J2UB 2JCSA 2ZUSA 3PUWA 1ODFA 3ZNNA 2AX4A 4C1NA 4TMWA 3GUHA 2QV0A 1CDEA 2BFBA 4M1EA 1L9XA 3OO0A 3NHPA 2W55A 4XX0A 1DTWB 4Y6RA 4CI9A 4WOCA 3FVWA 4EBDA 3ZBQA 4D4IA 1NW5A 4Q3DA 2K7ZA 2FCAA 2FPPA 4LRXA 4RJIA 2BBWA 3H4IA 1OTHA 2YXLA 5K5EA 3QFHA 5EE1A 1FP4B 2IFTA 4DA7A 1TIKA 4UTPA 3H11B 4RPYA 2Y0EA 1LI5A 2E7ZA 1M3SA 3NVWA 3TFRA 4OYYA 3ZZMA 1GCIA 2HGSA 9ICEA 1RKUA 2YNMA 2HA3A 2NTNA 3EQ9A 1RM4A 2XZTA 4DT1B 2BUAA 1MB9A 1LDBA 1ZWKA 2CVOA 2JZNA 2YIMA 1T9DA 4OGWA 4RY0A 1UT8A 2PSFA 2YW9A 3C3AA 4CCHA 1KI6A 2XVAA 4TMTA 2H3VA 1DBVO 2W9CB 2XMGA 4TTAA 3TLXA 3UAGA 3VU9A 5C2JB 1ZI9A 2BGGA 4ER7A 3M2PA 3SEQA 4HNUA 1BJTA 3AB3A 5EWJB 5F9NA 2HF7A 3H0KA 4KN8A 2RAUA 3GQCA 3I64A 3PC3A 4MZXA 3AERB 4PYJA 4IDDA 3C43A 1POXA 3HM2A 5G40A 2R7NA 4BZQA 4RIEA 4PQFA 3UT6A 1DPFA 1OBFO 4QU9A 2DYKA 3A1UA 3C24A 3FMFA 2WE8A 5THXA 3D8RA 3UK1A 3DUFB 4IV5A 9LDTA 2ARKA 4U5XA 4GXTA 1ISIA 4E6PA 4Y0NA 3CVXA 2QRLA 5DDMA 1LPOA 1EE1A 1QO7A 3W1VA 1GADO 8ATCA 2FJPA 5DW3A 1V3QE 3JYHA 4BNHA 4FMDB 4E1VA 1ENOA 3LP5A 4ITUA 4L6AA 1C9KA 4P84A 2R6CA 2DQYA 4YFKA 1YBAA 1S2IA 2Z43A 3KT3A 3LC7O 2G25A 1TMOA 4LWZA 1OKKA 4ZU1X 5K3EA 3HT3A 4GC6A 2FWMX 2PMEA 5EKXA 1GNSA 5I7HA 3WAJA 4JQZA 2HREA 4EO4A 4ZARA 5JT1A 2WD8A 1HG0A 3ETHA 4O4HA 3VR5A 3TSYA 1JLMA 2YYSA 1JR3E 3AP3A 4KDCA 1S2OA 1Y8RA 4MROA 4L50A 1L6NA 4TRRA 2X6QA 1XZLA 4WN3A 1NI4A 5I6DA 4HDMB 1XO0A 4FFLA 3IP8A 4P2GA 1RBQA 1CQIB 1O96A 2JPDA 1UZMA 5F78A 4KLEA 1LDYA 1H1LA 1UKZA 3COVA 3PDIB 4MAFA 2QARA 4XVQA 2FPUA 4HH4A 5DNWA 4C06A 4ZZ1A 3VR5H 3CISA 5L7TA 5CK4A 5LB4A 3E1KA 4LVNA 2QTMA 4V3CA 1G20B 1LBQA 4PYKA 2AKEA 1DJNA 4DQVA 1FUIA 3QVJA 4L95C 1GZSA 2WF9A 2QZZA 3ZHRA 3ROZA 2AYZA 4TS1A 2F77X 3RNLA 2XQFA 5BN5B 5DP1A 5AVOA 3RU2A 1U7TA 4DV0B 4RTQA 3LX4A 1Y6JA 5GINE 2NO1A 2PY6A 1W1UA 1Y63A 2HIMA 5AKIA 2VP0A 2IPAB 3A4LA 4GH5A 4L1KA 1L4YA 4B4DA 3EAGA 1ZAYA 3IHLA 3L0YA 4N1AA 2ASEA 3ZE1B 2QMQA 2PBFA 4PW0A 4AUEA 3U61B 3ZJVA 4HLUA 1UQVA 1G3QA 1D4ZA 3PI7A 1NJZA 1JSLA 1Z2CA 3SFTA 7YASA 5JCJD 2K89A 3T7DA 3G2OA 1CFZA 1M8PA 4D9MA 2JL1A 1E3SA 1ULTA 4FNAA 4CMJA 3UUFA 2PKEA 5EZ5A 2KKVA 2Q4RA 1J8FA 2R62A 1ZONA 3FX2A 3E22A 3V4FA 1PUXA 3FTQA 3T35A 3DF9A 2QK4A 4NL9C 1WUHS 2GLTA 4J9NA 1WHTA 4Q4JA 3PRHA 1W7AA 2J6CA 4L72A 3IB6A 1KN5A 4GBED 2J6HA 3GDOA 1O0BA 1AB6A 4DJ5X 1BFUA 2AG5A 1E3QA 1UKVY 1K0UA 2AK3A 2AMYA 4P36A 3WL3A 5KWSA 3ER8A 1Z5UA 2Z9CA 3ZV3A 5JXHA 4B6OA 1PW7A 5J47A 1NK6A 4TMVA 5EHXA 1CRLA 2CB9A 3V4SA 3USZA 1P4GA 1UWKA 1E5TA 1WXFA 3QWAA 3LUDA 4FZVA 2EX1A 4DQIA 1A8QA 2WTXA 4HGNA 4CKEA 2AR9A 5BXYA 1SKWA 4QWBA 3OZDA 2NZ8A 1J9GA 1NVBA 1XCBA 1JKMA 4G0MA 5LJIA 5AOCA 4HB0A 2P8JA 2B35A 1F51E 1P73A 3DKVA 4AZWA 5KTKA 2HB6A 3DPSA 2JHGA 3EFHA 1PVDA 1NN0A 4OHRA 3EY4A 3I3SR 4ZZ3A 3FUTA 3G2MA 4ZVSA 1JJBA 4UBJA 2FWBA 1C8LA 4WWHA 4HLCA 4XDYA 2ZQ5A 1JRLA 1C3OB 1N2GA 2GKSA 5DBFA 2GRAA 3ILVA 2A14A 4GW3A 4RANA 1MD9A 3PD1A 3HCDA 5IIIA 2FPMA 3GAMA 5LZ8A 1EVQA 2O52A 2N47A 3AESB 1OFGA 2C0QA 1T3NA 1KI1A 3BTVA 3NM6B 3KLBA 3OM1A 1T5DX 3VR6D 2WA2A 3BB3A 4B43A 5CDFE 3JAMA 5PNTA 3VZQA 1THMA 3QPAA 2DCMA 1F2TB 3FUWA 3L2OB 1X8XA 2GD0A 1NZJA 2W5UA 3AOEA 3OT1B 3PYMA 4DQ0A 1FFGA 1LPNA 1ZRNA 3B9RA 4HWPA 1I4DD 1R8JA 2MJLA 1ZGJA 3FBGA 3NKFA 4GX1A 4K2AA 2XXBA 4QO7A 3ESCA 3ZGVA 4KNVA 4A8JA 3CCFA 3L0OA 4WOJA 5H16A 5HF5A 2GUGA 1XD2A 1D1SA 3CRQA 4KRYA 4MR7A 1RADA 1IV8A 2XUOA 4LWOA 2BR0A 2EHJA 4NU8X 5BV2P 3CPSA 3M83A 4N0PA 4JSYA 2A8YA 2DSTA 2MSCB 1ZQYA 1F4VA 5KVAA 2AJLI 1EDOA 3WBFA 5BWCA 5LXTA 3OESA 3Q0EA 4RVHA 1HTWA 5FT9A 3KUKA 5ALJA 2R8BA 3O8DA 5KG6A 3R5SA 5I7FA 1TCVA 4JEMA 1T4DA 1QVWA 2HBYA 2IHTA 1N6RA 2VHYA 2QQFA 2X2OA 4LYFA 4XARA 1NV9A 4WKCA 1M7HA 2B7CA 4IFTA 3L41A 3HPOA 2QTFA 2WUWE 2WILA 3O1LA 2E4UA 4R1NA 4EFLA 5FBZA 2RP5A 1ST2A 1E2QA 2HRQA 3FGZA 1X70A 3IJEB 3Q9UA 6YASA 4MVJA 3PFWO 2YYZA 4LJ4A 5AJUA 1C3LA 4NPAA 5EQJB 5FWXB 2TECE 3DPIA 4HZGA 1OFUX 4BWJA 2Z5GA 1KY2A 3SOZA 5K6TA 4G41A 3AW9A 4TKUB 5EHIA 4H3VA 4Q4HA 2QM3A 4M9UA 1UK9A 3DWGA 2IA6A 2OK8A 1CS0B 2YV1A 3CN9A 2CFOA 4R69A 4W6ZA 5H59A 1M6NA 3STYA 4F3YA 4GZ6A 2CL6X 2I87A 3FKSD 1IEXA 3U26A 1RI5A 2PEZA 2FN3A 3TN7A 4F2GA 3BCHA 4ZREA 2PUFA 1EZ1A 3LBIA 4NABA 4QWAA 5IW8A 2CXQA 3A1NA 1DTSA 4J9SA 3NC4A 2A1IA 3B2QA 3TSAA 3BS5A 1Z00B 3BS7A 5BMVA 1I3OA 3UT5B 3ZVNA 3H2ZA 5IEJA 1CJUC 4DCMA 5AQ1A 4AMYA 1MG5A 3NFYA 2FZCA 3KK0A 3TAXA 1ODSA 2PIDA 5JAHA 2Z9BA 4RLFA 4MUHA 2X2EA 3GA0A 4Q02A 2QBYB 1IVSA 5CU7A 5LIRA 2CKDA 2Q5OA 4ELTA 4H15A 5TF4A 3BB4A 3DL2A 3SM3A 4XJTA 3A9UA 5JMWA 3AB8A 3MBYA 2WIJA 4GQBA 2ZFUA 3TIVA 1KAQA 2Q7XA 2OQ2A 5CWRA 2GXSA 3DXYA 4MJLA 2M6KA 4OJOA 5FOUA 2JI9A 4D6XA 3ZY5A 1FIUA 2I7CA 3NH6A 2HVIA 2ST1A 4DA6A 1NJSA 4P7KA 1H4VB 3D5TA 3QV2A 1LEHA 4WUVA 3A2KA 1Z5OA 3FROA 4RD3A 4V0LA 2VSXA 1OXSC 3D8HA 3EHEA 5IAJA 4EGFA 5J2UA 1K63A 4QWMA 3DWIA 5ALNA 2GMWA 5KSOA 3ADBA 2YC2C 1U31A 2W04A 1DTEA 1PQWA 1E96A 1SVOA 1UZAA 2JEOA 1FDWA 2PKYX 2WM2A 3HDGA 5DCLA 2LXNA 3TMAA 2JEJA 2N0SA 3GLIB 1AUXA 3VCBA 4YBRA 1OAOA 3L3BA 1E6WA 2N1MA 3H5RA 4KN9S 4YR7A 4MYDA 3EPHA 3A1TA 3NBZC 1EGAA 1SC3A 5JNVA 2QB0B 1YS7A 2ORVA 2C9MA 3BTOA 3JWEA 5CA0F 3L7IA 4AQ7A 1D03A 1M7BA 1QIHA 1GKYA 2VAPA 2X8LA 4X90A 3QVTA 3WWOA 4CL8A 1PS8A 4EW6A 1MQSA 2HWUA 1N5WA 3FZEA 1P5JA 3N1UA 3GRPA 4N6GA 1MXHA 1FFYA 4TWIA 1K8XB 3J7AC 4GBJA 2E8MA 2ZWVA 4N41A 5B6PA 1EZ4A 3U19A 2RK3A 4FCTA 5J0XA 2XMCA 1N2HA 2QLTA 2P40A 1BQ4A 2XAUA 3AVPA 2V74B 4P2BA 4QPDA 3SG0A 1D9ZA 2O8NA 3E53A 3K2QA 1THGA 1ZL2A 3R2JA 4OJPA 3IMGA 4MDFA 1CUKA 3O38A 1AGYA 2FMTA 3S68A 1TKRA 2J09A 4F4JA 4XH9B 1MN8A 1U2QA 1JHXA 2QUHA 3QIVA 3S1LA 2V65A 2ZSJA 4EYGA 5JZMA 1QHIA 4BXOA 1YKSA 2VI5A 4LJRA 3G23A 3TE7A 2GTPA 2ASJA 3R75A 1UBUS 3LCCA 4Y1FA 3DB1A 4O63O 1W9HA 1A2KC 3NBYC 2EXXA 1KS9A 4WLNA 5B6IA 1DO2A 5FNVA 4ZV9A 4JL5A 3D31A 4QWDA 4HR7A 1ZCBA 2WWHA 4IEEA 1Q14A 1GZ6A 4OQLA 5IM4F 5JQGF 4R05A 1NJ5A 3DDHA 4M87A 3BJEA 3OKPA 1YIAA 5ELXA 3VX3A 1B16A 2C4VA 1X7HA 2KJQA 5CT4A 3RR2A 2X9GA 2ZE7A 3DTVD 3I2IA 2QRMA 4H0NA 5AI4A 2Y1IA 4GI5A 4IF4A 1ZQ1C 5BV7A 4O2RA 1Y1RA 2OYSA 2FDCA 4EELA 1KY4A 1SK9A 4O3FA 3RVDA 3K94A 1KY3A 4YJHB 1FJGB 3KSZO 2FPRA 3TOZA 3I9NA 3AY6A 2JF0A 3LLCA 4W9RA 4C43A 1TW2A 5FUVA 1ZMOA 2BH2A 3OHBA 1P2FA 4F71A 1RPLA 2XITA 2A3VA 1NN3A 2H00A 3PEWA 1TK5A 4W9NA 4EA6A 3IP3A 4QGFA 3V8PA 2I4OA 3GF4A 5E4YA 2DUYA 3MGAA 4P54A 5KU7A 1YR3A 3ICCA 5AI0A 1C2YA 1KVRA 2ZJ1A 3O8OB 2NVWA 2OGTA 4KQGA 4UEKA 3AY7A 1MZVA 3EMDA 3PC8A 4K9LA 5B3AA 3U4GA 1OXJA 5JYBA 4K6CA 2AGVA 1U4SA 2O0JA 2KZMA 2B5OA 3PXUA 1BX3A 2D3TA 2F4NA 1EQUA 1G8FA 2P62A 3BCSA 2C5EA 2WY2D 5FDFA 4BP9A 4U7HA 3OVMA 5K20A 4ITRC 1QGAA 2A5LA 3LVFO 4ZVOA 3GLHA 1RWPA 1BYUA 4LYDA 1RJ9B 3OF2A 4OJLA 1G21E 4I50F 1GKUB 2W6JA 2CL7X 2HXSA 3A9RA 3LDGA 4A0HA 3UV3A 1DQPA 4YG2A 1AXGA 2D2IA 1CQZA 1YD7A 4KEAA 1MCZA 5KKCA 1AZLA 4M49A 3LW8A 4C20A 4IFEA 2Z6QA 2JFPA 2Z6AA 2BWJA 3A1FA 3MGKA 3ZJYA 5E3HA 3SYZA 1PO7A 1TKBA 1PT5A 3S7ZA 7GPBA 4JQCA 3IURA 3GG9A 2HRZA 3I4FA 2ZK7A 1T43A 3G5AA 3VOAA 2JIZD 1NKCA 2FF7A 3FCUB 1D4OA 1PLJA 4HEA6 4IVQA 4G25A 2A1AA 1C14A 3P26A 3FOCA 2DWCA 5H3HA 5CDTA 4L08A 3RAEC 4ABYA 1EI9A 3PGLA 2IY9A 1WXIA 1OASA 1CZHA 3A6JA 3PHBE 3WBJA 4QYTA 1NMYA 3NJ8A 4PLVA 3BXZA 4ZGGA 3TK1A 5IKPA 4L02A 3IQDB 4DQKA 5CFNA 1QRSA 1Z9BA 3TNFA 2AZMA 5H82A 4F3KA 1YJ8A 2YQEA 5D7BA 5HPYB 4D9HA 3VU1A 2ZXHA 4TQAA 1HLFA 4C4YA 1EFPB 4CKYA 4LYGA 4KPEC 5CA1B 2UUOA 2RGRA 2J3HA 2ZWOA 4LYJA 4XR9A 3GBPA 2XD4A 1SKYB 5ALHA 1M6EX 3CCCA 3NOQA 2JIDA 2VSOA 2BFAA 4NJEA 4URWR 5J0YA 1YK0A 1B41A 3PF9A 1WOMA 3PUKA 4R98A 5G0WA 2W3SA 2FRDA 3STXA 4MHSA 3UWMA 4HN2A 3KDSE 1XEXB 4DXHA 5EE5B 3S2ZA 1QGUB 2NM0A 2HHHB 4EYIB 1TGVA 2VJNA 3C7AA 3T15A 3SK0A 2J5RA 2DFPA 4QC2A 1RJ9A 4ICAA 1IULA 1H3NA 4KR2A 4RLHA 3UHJA 4NCBA 1KQNA 1IHUA 3GXOA 3AM9A 2RHRA 1NBEA 4B8ZA 1R4ZA 3OOHA 4Q3AA 4DDHA 3JWHA 4B9NA 2OZKA 3S2IA 2CMDA 3BXFA 2R8HA 4I9HA 5K3DA 1U3UA 5A2QA 1A76A 4OK3A 5L3QA 2PLRA 4YLGA 3RSZA 2DFVA 3N0TA 1AKVA 3RUDA 1C8BA 1MJGM 5EJMA 1YO6A 4PC3A 5BYBA 2H59A 1FU8A 2ZT8A 1JE1A 1B93A 1CJKC 2HEIA 3AB7A 3B9BA 4IQ4A 5HFJA 5JV5A 3OCWA 1JDBC 3STTA 1TZMA 2YX1A 4XIYA 6NULA 5DXAA 4MVJH 1N5RA 2ZJOA 3OJLA 2B0CA 2MYNA 1JHAA 3GIMA 1FFEA 5JCOC 1MPXA 1QHXA 4WHMA 1FQJA 3G02A 1KAGA 3JWIA 1NC1A 1X7YA 4PGFA 2PYZA 3SR3A 4RXUA 5AW3A 1KIFA 4ZI7A 3U4MA 5GM1A 4AF6A 2NV3A 1E2MA 1GNTA 5IU6A 3NP9A 1S0UA 1QIFA 3INYA 4Y98A 2FMHA 1JDPA 4OA8A 4XOIA 4B82A 1U0FA 1XTIA 5AVZA 3FDIA 1KYYA 4QZEA 2TMDA 4HJXA 1WPRA 1NTOA 3ZCUA 1YULA 4JODA 4YLYA 3SC3A 4F93B 1X1TA 4BV8A 2IXDA 1F0YA 1SCKA 5AK3A 1J1IA 3RJJA 1SXJB 1ZVMA 3EEQA 2GSWA 2PX8A 3KLMX 2IIVA 3HXTA 4OXIA 2HA6A 1PI3A 2VH1A 3VSAA 3G0GA 4A8JC 2V8BA 1JIXA 3EGOA 4Q34A 3RJTA 1RFGE 4KLRA 2A58A 2BGTA 4FDUA 2ZUEA 2RSLA 1KDZA 4DL6A 1AIPA 3MC1A 4ISCA 3SNKA 4C4RA 2AVDA 4OHWA 1L3VA 2WTMA 3OZRA 1WQ4A 4MYSA 3AHGA 2X0JA 1QTRA 1LW7A 4JITA 3HRIA 1GXSB 1U0RA 3R7BA 7ABPA 3ZCPA 4G1FA 4MRNA 1GO3F 4JA2A 4QDJA 1K5GA 3R6TA 2WVJA 1E2IA 4BEWA 4ZU3A 3ITEA 5DKFA 1Z08A 5EJGA 2WKSA 2WSYB 4R2WA 4DIEA 4P5DA 1E5LA 3RU9A 3ESQA 1FNNA 3UMJA 1PWXA 1YXMA 3E9YA 3VI4B 5BSEA 1BVHA 1P8JA 4QUAA 4ZA2A 4KLJA 4P0PA 1XRJA 1K5HA 2QYOA 1EUYA 4LK3A 3CVYA 4MKHA 5BSRA 1Q0HA 2GTIA 3VKUA 4IS7A 4EJSA 3L8MA 3WYNA 3HFGA 5DWDA 2QMYA 5BV1A 2YB4A 4M4SA 3DL4A 4NYIR 3H19A 4EZ6A 2ALZA 2EDCA 3WX0A 9MHTA 4HQNA 3V7KA 2JLSA 3AF5A 1ZG3A 3DDCA 5CVCA 5BSTA 4Z7QB 1BZYA 2EF1A 4BVHA 1NMZA 5EJ5A 3V32A 4EUEA 1FRFS 2QMEA 3QUCA 3EGXB 2I62A 4OHBA 4OFZA 3QSGA 5DGHA 2F55A 3PFHA 1DJQA 1OF1A 1NVEA 2Q2WA 4O8ZA 4BLPA 4IOJA 3WRXC 2VNHA 4K1XA 2HMAA 3NHSA 3RVOA 5DT9A 5A4IS 5J2TB 1H1DA 3PC6A 3Q8RB 1U2ZA 3QLEA 5I01A 1HG1A 1TAGA 2XGJA 2FLLA 2PO5A 3WQSB 1IWOA 2DPLA 1OBHA 5J8YA 3EVDA 2XUHA 2H54A 3DV2A 4Z4QA 1WZEA 4DF3A 3ZGOA 4RKRA 2VVTA 2YOGA 3BX1A 3UQZA 3VTKA 2WHEA 5C0YA 3CJRA 4G0UA 2E1FA 4MFCA 1KEWA 1RZUA 4NOLA 3DCYA 3VV3A 2C2GA 4LC9A 3OURA 4D41A 4F1JA 4HATA 5CJ7A 2C3UA 4X1KB 3IQGX 2L2QA 5J2JA 2KX7A 3RSLA 1QP0A 1L3TA 3IFSA 2H1OA 4GICA 4KO3S 1A50B 3ZD7A 2ZAIA 3F73A 1M1ZA 2Q0QA 2A92A 1OLXA 3H3XA 4WZBA 3PR3A 1MO4A 4YR2A 1BIFA 4H7IA 5IT0A 1F7UA 4YMOA 1FX0A 3BFKA 2BF7A 2REOA 1RYBA 2LE0A 4DQUA 3LJKA 1L5WA 1MB4A 3N9IA 4MQEA 4NZMA 1GAQA 1SXJE 1E4EA 1YDHA 2ODWA 3W6PA 5JOQA 3IUYA 1U6JA 3VHRA 1CBUA 1JU4A 1XTRA 2M9NA 1EXMA 4DL5A 2PSHA 2FE1A 3H5AA 3O8BA 3QE3A 1GU0A 4G86A 3HUTA 1TU4A 1EWRA 1XA3A 3BZWA 1NVKA 4WNCA 4ND7A 4XEHA 5HOEA 2J7PD 2DH5A 4ED8A 2RH9B 1Q6ZA 3M6UA 5A6SB 3ZE6A 5ADUS 5IAGA 4TVBA 2HDNB 1YGPA 1WCYA 2OL4A 2W7TA 4HDSA 4DA4A 3DFFA 3HSYA 4AKSA 5DBIA 3W4JA 4BGUA 5DHFA 3WLJA 4XD7A 1RQPA 3OKCA 1OWOA 4UBMA 5EERA 4YRKA 3MYYA 4YUWA 1XCGB 3W1EA 4DRXA 1JW9B 3TR6A 3DO5A 4DSKA 2NQ8A 4CDNA 1ZUNB 4M8NE 2CUTA 1ZS9A 3B7WA 2Y1JA 2XZLA 4HNHA 4QQRA 3WB0A 4ZDIA 3EXIB 1FXWF 3CX7A 4NJ8A 2V9CA 3MN1A 4XQCA 1QJCA 1T2EA 1ZQKA 1M73E 3KSUA 3QI7A 4M6WA 1GV1A 3CBGA 4BZPA 3IBYA 4YRAA 1ZJNA 9ICIA 2D13A 2QT1A 3LFHA 1EK5A 4F9TA 2ZJFA 1I2ZA 3KHTA 2C59A 3K6SA 3TI0A 1B6SA 1GNRA 2Q2OA 3ZPXA 1WRBA 3B5IA 3DYVA 2ZYRA 4NBNA 4LSZA 4FD3A 2I6QA 2WYUA 4P3OA 1EHYA 4KFUA 2YJNA 6GPBA 3ZHSA 4XW2A 4AZVA 2VBFA 2Q21A 5IKOA 2ATCA 4R8KA 4RXMA 2Q27A 2BEUA 3G9QA 3QV1A 4ZYTA 1QJ4A 3EXHB 3UC9A 3PFBA 4ZOLF 1NYLA 2FETA 3E48A 4Z0HO 3BK7A 2HJGA 1BPXA 2TYSB 4DJTA 3QU5A 4PICA 5EPEA 4HGZA 1QRDA 1X2BA 4JKYA 2AE2A 3BHJA 3AR4A 1CUUA 2JK1A 3WLEA 4CEIB 2VS1A 2OCDA 5CIWA 3PYLA 1ETUA 4PAGA 3RBDA 2FMKA 1EWTA 1O3YA 1TOAA 2HMUA 3FJOA 2OHHA 4HBGA 3MJRA 5BUQA 3F9IA 2XKBA 3COSA 2JCGA 2GYYA 1Z7BA 5D6NA 1FP4A 3WGNA 1O8BA 1OZAA 1LLCA 2CVFA 4NR0A 4PPYA 4XUCA 1W8IA 2AXQA 4OBWA 4GPEA 1V7ZA 2BLNA 2F9FA 1LBEA 1P7YA 4HQOA 4YRFA 5KJFA 4QU0A 2F1OA 3D4NA 4CT4B 2ILTA 2OUIA 1D1TA 3LGXA 1S01A 1ABEA 5AM3A 1L7MA 2OHJA 4J0QA 1T3LA 2IEAA 1AKRA 3D6FA 2FFJA 4WH0A 4QFDA 4NCAA 4OPMA 1XZFA 1NKEA 2ORWA 2IYQA 4FYIA 4QYMA 4JI1B 2PV0A 3AEXA 2UVUA 4FE4A 5EUQB 1ECPA 2YX8A 2HT6A 1JFTA 4RPXA 4YR0A 3KBBA 1VJRA 3PVZA 3BQ2A 5CA7A 1WSWA 4RMIA 4C89A 2I3GA 3MTQA 1WKVA 2ZJAA 3QF4A 4DIOA 1OXKB 1IEWA 1TQ2A 3G0IA 4M36A 2XWPA 1ZQJA 3RJFA 1CUEA 2OCYC 3H3JA 3AUUA 3AF2A 3CX8A 4PZOA 1E6LA 1T8PA 3E7PA 3F8SA 2XUKA 3ETDA 2FUNB 1T36A 4OB6A 3WRXA 1X13A 1JMVA 5ENDA 4KZPA 2FEMA 3D64A 5JNSA 5TB5A 1SBHA 4G0WA 2I8AA 3I6MA 4LE2A 1IG6A 1T8UA 1UUFA 1V3TA 3PG5A 4B2YA 5LU9A 1XMOB 1ZUD1 4YCMA 3NHYA 1Z5NA 1SB9A 1T5SA 2QMUA 4YCDA 3HKCA 5KCMA 1F8UA 5EZYF 5A5VA 4Y0AA 1UJCA 4DJFC 1LWOA 3DEHA 3ZD9A 5FI5A 5H83A 3ZXIA 4OQFA 3FFBA 1G4UR 2FPWA 1RAAA 5ALTA 3TGWA 1VXOA 4QE3A 1F06A 5JDCA 1DIOB 3OOSA 3MELA 1N3IA 2Z1DA 1Z37A 3ACCA 1Z4PX 3SVTA 1KO1A 2ZIAA 5B4UA 1ACMA 4QXOA 1TD9A 1CRXA 5HRAA 5L4NA 2IGTA 2A86A 3FGPA 1THZA 4IDAA 3S70A 4EFDA 4R71A 1E3WB 1RXEA 2WJWA 3KE8A 1FFXA 3C3JA 5IM4A 2J6BA 3L43A 3ZUPA 3PC8C 2C82A 4E3ZA 4NVRA 5AKHA 1FTSA 1HZZC 1JYSA 1UPTA 2H29A 1PQYA 3PNMA 4QOSA 3U1VA 1VSQA 5HIJA 1LRLA 2R66A 2AN9A 2PH1A 2YR0A 1TECE 2ATEA 4KXNA 2DULA 2RHCA 4PC6A 5AW4A 5KJ1A 4GL2A 3FCSB 2P9BA 3KYDA 4KMRA<