1Z4OA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
total genus 78
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4oA01
1TJ5A 1ZD2P 3EWIA 1SWWA 3N5KA 4Y2SA 1Z4IA 2WF5A 2FPUA 3MN1A 1LVHA 3L0BA 1RLTA 5ALOA 4BX0A 3N1UA 1N8NA 4YIKA 3KC2A 4Y2VA 3I1YA 2B1QA 3B9BA 3SKYA 5AVUA 4OHFA 3QUQA 3ZUPA 3BWVA 3ZWDA 2G09A 5IT0A 3QUCA 3QUBA 1ZRMA 1Z4JA 4BNDA 1T5SA 5AW4A 3UMCA 3ZWKA 4CF4A 3DNPA 2P11A 1EK2A 1EK1A 3OCZA 1JUDA 1MH9A 4BEVA 3AR5A 1ZD3A 1RKVA 2I7DA 4CE6A 2MU1A 3PDWA 3OCXA 3AR6A 1F5SA 1RKUA 5ALFA 4CF3A 2GFHA 2JAWA 4AP9A 4EELA 2RARA 5FP0A 1AQ6A 3MC1A 3WKDA 3SHQA 3QU4A 2B30A 1RQLA 1T9ZA 3ET5A 2GO7A 4C4TA 3N07A 3N28A 1L6RA 3PCTA 3NASA 2CFRA 4OFZA 4UMDA 3ZVLA 3SLRA 1S8OA 3ZTWA 2C8LA 4QQFA 5AI0A 4B6JA 4G9BA 1QH9A 3QX7A 4EZEA 3ZX5A 2IA5A 2JGAA 1Z4MA 2GHTA 1RKQA 5ALLA 1WZCA 1L7NA 4Y2JA 2G1AA 2HF7A 1CR6A 4YCLA 3R09A 5AW3A 5AIBA 2YMQA 2BY4A 1QYIA 5ALKA 4XPZA 1XPJA 3HLTA 1U7PA 5AW6A 3DDHA 2QYHA 2W11A 4NV0A 2JARA 5AI9A 3W5AA 4UATA 1VFPA 3KD3A 2D2VA 2ZXEA 3M1YA 2HF2A 2OM6A 2B82A 5ALQA 3EPRA 3VAYA 1CQZA 4UMVA 3IJ5A 2B8JA 2ZOSA 3N8GA 4OCZA 3ZVNA 3OCWA 2PKEA 1Z4NA 3OTQA 1Z88A 1NNLA 5IT4A 3L1UA 2YMMA 3AR9A 2FPWA 4YH1A 4QJBA 3W5BA 3L5KA 2ZBGA 4JDPA 2P27A 1Z4KA 5IS2A 4EENA 3OCUA 5AW1A 1NF2A 3IB6A 1QQ7A 1ZRNA 3AR4A 2VKQA 3A1EA 1Q92A 1N9KA 3A1DA 4MWOA 5AK3A 5ALZA 2CN1A 1FEZA 3L1VA 4UW9A 4AS3A 4YGYA 3OPXA 3L7YA 2PQ0A 5A3RA 2IOFK 3WKCA 5AKGA 5AK4A 3QU5A 2ZG6A 3ONNA 2ZBEA 3TLMA 4NAVA 2I6XA 5AVQA 1Z4QA 2FDRA 5AK5A 5AW2A 2WFAA 3QNMA 2YJ3A 1K1EA 3L8FA 4MUMA 3GYGA 2YJ5A 2G07A 3RF6A 4CF5A 5AM0A 2FI1A 5ALNA 2CFTA 2FUCA 5AM4A 4XQ0A 3WK5A 3QXGA 2Q5EA 2B1RA 2NO4A 2MSNA 3KBBA 1J97A 4UMFA 4BKMA 2I55A 4BX2A 4JB3A 3E8MA 2R8EA 5AVXA 2RBKA 1Q91A 5AM5A 3R9KA 3L0CA 1YJ5A 3QUTA 1Z4PX 3WGUA 3KZXA 2FPXA 1ZD5A 4HGPA 1Y8AA 5AW9A 2I33A 2IYEA 4J03A 4CNQA 3NANA 3U7FB 2G80A 5A3SA 4I9FA 5AKEA 3PGLA 4DFDA 3L8GA 2WHEA 4KYTA 2GMWA 4EX6A 2G0AA 3ZW7A 4HAIA 4Y2YA 4DCCA 2BDUA 3RFUA 3WGVA 5AI5A 2AGVA 4IG4A 4HGRA 4Y2UA 2EARA 2DQSA 2HHLA 5AICA 1ZD4A 1TA0A 3A3YA 2IOHA 2W43A 1TE2A 3AR2A 4KX5A 2FUEA 4AS2A 5ALYA 2OBBA 2HDOA 1RMYA 4FE3A 3QU9A 3WK8A 4UARA 2HO4A 3UM9A 1RRCA 4FYPA 4F71A 4YCMA 2IOFA 3CZ4A 1O08A 1ZOLA 3QLEA 3I6BA 4BNDB 3ED5A 3U7EB 3W5CA 5AHXA 5AK6A 3WKBA 4E88A 2YJ4A 3FPBA 4O8CA 5AW0A 4G63A 3ESQA 4NWIA 2WF8A 4RESA 3BA6A 3ZX4A 4FFDA 1QQ5A 4KX3A 3SD7A 2R8ZA 5ALUA 4UASA 5AVTA 2JAOA 4PNHA 3DV9A 3L8HA 3DAOA 4F72A 3QYPA 4DWOA 2YY6A 3QU2A 2EAUA 3U7GA 4L6AA 1YV9A 3NALA 4Y2QA 3AR8A 1U7OA 1RPZA 3KOOA 1XVIA 1YNSA 1YMQA 4HGOA 5AIAA 2YMPA 3FVVA 3IRUA 4KN8A 2B0CA 4UAUA 4C4SA 3K1ZA 5AI8A 5A3QA 2AUTA 4EEKA 2X4DA 1L7OA 2R8YA 1U2TA 1S2OA 5AW7A 2P69A 3P96A 3F9RA 2MU2A 1WR8A 4UU1A 2YN4A 2HX1A 4H1WA 4I9GA 3PGVA 5ALVA 1L7PA 2O9JA 4Y2PA 2YMLA 5AI6A 1U2SA 5AVRA 3OCYA 3FZQA 3WKAA 3WK6A 5AVWA 1LTQA 3EF1A 1XP5A 5AKZA 5AVZA 5AKLA 1YDFA 4NFLA 3S6JA 2FEAA 5ALGA 1Z4LA 1Z4OA 5T41A 3ZI4A 3SMVA 4KNWA 5AVSA 4GXTA 5ALHA 3FM9A 2HEGA 3QGMA 3U13A 5AKKA 1KYTA 3L0YA 3WK7A 4XOUA 4ZEWA 5AM2A 4L57A 3CNHA 2HI0A 3ESRA 5AESA 3OCVA 3WK4A 5AW8A 3SF0A 1RQNA 2HSZA 2AH5A 5ALSA 1RMTA 2B8EA 1U02A 2FPRA 2WF9A 1NRWA 1TJ3A 4KNVA 4NABA 2WF7A 2WF6A 2NYVA 2Q4RA 4C4RA 4YIHA 3ZTYA 5AM3A 3B8EA 3NRJA 3ZVMA 2NO5A 4BBJA 4IFTA 4UM7A 1YS9A 4YCNA 1T5TA 4J2TA 5AKXA 1Z5UA 1L8OA 2ODAA 1TJ4A 2W4MA 1RMQA 1PW5A 2AMYA 5AKHA 4Y2XA 2R8XA 3MMZA 1WVIA 4HGNA 3I28A 5AKJA 3R4CA 5ALRA 3WKEA 4RETA 2C8KA 3E84A 3U26A 1QQ6A 5JJBA 1RDFA 1L7MA 4UU0A 3KDPA 2OA0A 2YJ6A 4UM5A 3U19A 2YBDA 5ALEA 1X42A 5AVYA 3SKXA 3ZU6A 4BYGA 3E58A 1VJRA 2C88A 2P9JA 5ALTA 1L8LA 2ZBDA 4L6CA 3L8EA 3E81A 1Z5GA 3AR7A 4EX7A 3QU7A 1RC8A 1J8DA 1ZJJA 2QLTA 2RB5A 4OD0A 4HYTA 1IWOA 1SU4A 2RAVA 3NIWA 5E0OA 1SWVA 2YFYA 2ZBFA 2O2XA 4HGQA 5AVVA 5AKYA 3WK9A 4Y3UA 2OYCA 5AKIA 1RLMA 4DW8A 3U7HB 4GIBA 2WM8A 3AR3A 4XE5A 3MPOA 2I34A 2CFSA 5ALDA 3EF0A 1ZS9A 5AW5A 2G08A 4UMEA 2C9MA 2G06A 2HOQA 2C4NA 3FGOA 2Q4TA 4BEWA 1RLOA 2I54A 3UMGA 3HYCA 5ALXA 3J7TA 1WPGA 1O03A 5AM1A 3A1CA 2EATA 3ET4A 2JAUA 3I76A 3UMBA 5ALJA 2PR7A 4ZEVA 5ALWA 2FPSA 4UAVA 5ALIA 3NAMA 2BDEA 2GHQA 3W5DA 5ALMA 4Y2TA 4ZEXA 4BX3A 3M9LA 1VJ5A 3B9RA 5ALPA 2HCFA 3NUQA 5AI4A 4Y2RA 3D6JA 3FPSA
chains in the Genus database with same CATH superfamily
2HPZA 1NF9A 4ECZA 3DO6A 5BRNA 2GK7A 4JI4B 5L7YA 4AJKA 5KMGA 3O90A 4ARIA 3B3AA 3N0WA 4DLAA 1WRBA 1FS4A 5IJ9A 1FRZA 2FPLA 2HYDA 3NP7A 2YASA 3GP3A 2P9ZA 3A1NA 5B36A 5HK8A 4JUAA 3K0SA 2HA0A 1NK0A 2KHVA 1NTOA 9ICPA 3ESBA 1M2KA 4MRVA 4PLGA 4LECA 1M33A 4B3SB 4XWAA 1O87A 3R5FA 1DBVO 4ZQFA 1P44A 3OE1A 1CRPA 4RH1A 1GADO 3WGIA 2W11A 3GUCA 1MB2A 4NV0A 3VR6D 3FIJA 3AESB 2FLPA 1NSTA 3M1YA 2C3MA 2YWEA 3AUXA 1OFHA 1DG3A 4RQAA 4N0EA 3WX0A 3MJVA 1L3TA 2PSHA 3SJZA 4QIHA 1NBMD 3E1GA 3AGPA 4M1WA 4EENA 1U47A 3Q3GE 1KDYA 4AURA 2VWQA 1JIXA 3N2EA 2IVFA 3W4IA 6GPBA 4LQLA 4EHAA 5DBGA 2BEWA 3DVSX 3LC7O 2H4YA 3CEPB 4ED7A 1YL6A 2L19A 5F64A 2HLDD 3R3UA 3C6KA 4DNFA 4LDRA 5DTEA 4JVOA 3BXZA 3BE8A 3HZZA 5D85A 3QVOA 4XEHA 4RE6A 1M2OB 2HTEA 1UC9A 2B8TA 3RVNA 1BE0A 1LI5A 3R9IA 3CG0A 3T5BA 3F3YA 4PPGA 2F8TA 1YMUA 5T5QA 3SNHA 4C0QC 2HCRA 2IPNA 3OHPA 3JPSA 3WLKX 2MIIA 1O7JA 5A71A 4BCDA 3PSHA 1NI5A 1E1RA 1UFRA 3HPRA 3OX3A 4G0UA 4JD5A 3GJTA 3IBGA 4P83A 3UKDA 4RNDB 2GJKA 2LYHA 1G8YA 4K9KA 5J1TB 2CPRA 2X2EA 4JFAA 1T6YA 4EUFA 1V5WA 1LFAA 1ETUA 1S2NA 4B3CA 3L40A 4NPAA 3M9WA 5L7TA 4FGKA 4LYEA 1KTVA 1LBIA 1LQUA 3OY7A 2P6NA 2IEDA 2HH9A 4YR3A 1ZEMA 4RY8A 2XIJA 4GOOD 4PLYA 1JDVA 4RMNA 1I0LA 5B1YA 5DQHA 1RI3A 1G8MA 3KXKA 3SIXA 1PZGA 2HI0A 4IQ0A 1I13A 3UUEA 4M47A 1CUDA 1CJKC 1NRWA 2DH5A 3V6HA 3RIMA 3RUHA 1Y3BE 3GGPA 4O2BF 1TGYA 3H2IA 1XZGA 4JUFA 1FC0A 4W5QA 1DAEA 3K16A 3E5MA 2BP7B 1VLJA 4F5QA 3NTOA 3L7IA 1WL8A 4GC5A 3EZLA 4UU0A 1RWWA 3I9LA 3M4XA 1JIHA 2QJWA 3JPNA 3B85A 2RAUA 1ONSA 1AGNA 3TRHA 1JLHA 5I7UA 3K53A 2BEUA 4BUGA 2ECQA 2I4NA 4EX7A 3CPSA 1E2FA 2JJ2A 3VYTB 1FFBA 2YYZA 4MHSA 5AKYA 5A3VA 4LW8A 5A7HA 5PGMA 3QYJA 3R44A 5LZ8A 1NK9A 4QFDA 5EIAA 2VJOA 9ICRA 3UJ8A 2XKKA 4DOAA 2FSPA 2W9BB 1IWPB 4M9JA 3SXPA 4ZJPA 1MBZA 1NC1A 3ZIDA 1QU3A 1GR1A 3UXNA 3Q0TA 4C6RA 1UCFA 5C4IA 1C0LA 3E8XA 3DCNA 1PG2A 1PFQA 5FBLB 3PX2A 4KJXA 5BVGA 1KDRA 3DO8A 2JRZA 2ORIA 2HCJB 4MIKA 4BAUA 3SS7X 5J4KA 3RB8A 1D8AA 3O2JA 3CF6R 4ZVLA 1UKBA 3GLIA 2B34A 4XYGA 1Q3KA 1I80A 2SBTA 4KIFA 2VANA 4J9PA 1CP3A 1U0JA 3VH2A 4D97A 1LCIA 4R1SA 2H5EA 2G40A 4DS3A 4BLUA 2ZSKA 1WTCA 4WXPA 5TF0A 2GHIA 3TFRA 3HGQA 1R6VA 4IJWA 5CT5A 3TLXA 1K9VF 4H7FA 1ZJ5A 1KOGA 3EDMA 1O57A 2GLTA 4CNBA 1OBCA 4GDFA 3PQDA 3H0MB 1MOPA 3GDGA 1BPYA 1N8SA 2DQKA 5THKA 1KMNA 3AHGA 3R0VA 5FORA 1TEHA 1UUFA 2ZJ2A 2QRLA 2FH5B 2OKGA 1MJGA 5F35A 1UEJA 1RXIA 2FZ5A 3CF2A 3WLQA 1KE1A 5ABPA 3UXOA 5IC6A 1CUUA 4QZFA 4D6PA 3F9IA 3RAPR 1JXLA 1DRUA 4YDHB 1GU1A 2AR7A 1L4HA 1AZSC 1P5FA 2VN8A 4XQ8A 5KFAA 1UMBB 3O21A 2XMBA 4QWEA 1QBGA 3DGFC 3BQ0A 4D46A 2IHZA 4F85A 2XCPA 5ER6A 5C8VA 3O3CA 1KI9A 1Z83A 3G82C 5D01A 3RFAA 4H3KB 2R8OA 2E4VA 3ZE8A 5B1HA 1XTPA 4YRLA 1D2RA 1FBNA 4FFMA 1AKEA 4COOA 2E5SA 4DLPA 4J90A 3K0BA 2R9VA 1CRZA 2VA2A 5B2FA 2KV2A 1ODLA 4U9IS 1CUHA 3CT4A 3OLZA 4EUSA 4M9LA 4UFNA 5LXTF 1QP7A 1G42A 2H3QA 3LPAA 3ND8A 3PUVA 1D5CA 1QQ5A 3C7DB 4R6XA 1U2DC 1DFHA 2J3DA 3CQ9A 5BOLA 2TMKA 2FE1A 4F72A 5JI2E 1YC2A 4F60A 1UWVA 1XTZA 1YMQA 2PU5A 1R8XA 5JDIA 1RU3A 2PZ8A 3PE3A 4HX5A 1NNEA 3E03A 2ZRKA 5KYGA 1CRQA 5BORA 2II6A 1N2JA 4GKVA 4QUAA 5CAEA 3AUJB 1U2SA 4WY2A 2D2IA 1H22A 4D5EA 4QSMA 5LA6A 1RI4A 1OC4A 3OJCA 4EG1A 1QLWA 5CDHA 4FFBA 2G9UA 1ZK2A 1CW2B 2PSEA 4LF5B 2Y0DA 4LK3A 3HO6A 3A8TA 4YMSA 3RE1A 3CLKA 1K63A 5DHFA 2K5UA 2VT3A 1YASA 1PR2A 2HHTA 3PQ7A 2HZ7A 3OQBA 3IP1A 1PAUA 1T0JB 4NICA 5KTSA 1T1EA 4F7DA 2F1RA 4JUIA 1FFHA 3V46A 3D6VA 2ZI6A 3PK0A 4YXWA 4HDKA 4JUCA 3RVDA 4ZAGA 4RTJA 1J33A 1XQ9A 1V11A 5EMNA 1JQBA 4LX0A 5IW8A 1DL5A 5SY4A 3WMGA 4K9MA 3K0FA 5FWAA 5K8TA 4YJ3B 3CUTA 3LQRA 1RT9A 5DGHA 3Q87B 4E5YA 2G06A 4RK6A 4TSFD 3UK0A 3IDQA 2HMWA 3IUPA 5EZ5A 1T1GA 3I9NA 1I1OA 2RSLA 3Q8QB 5EL0A 3EN0A 1Q1EA 3DE5X 1NNUA 5A9RA 3K15A 4ONEA 2AG0A 3CX6A 1E62A 3JQGB 3DLCA 3FTQA 1RYZA 2OCBA 3TW8B 1DC7A 3K0AA 5EWJB 1MEEA 2K89A 4I8DA 1UM9A 3RKUA 4ZEOA 1N5MA 4RAQA 3WHPA 4GKAA 2I9GA 4BNKA 3D4IA 3DAYA 4BMYA 4BNHA 2BMFA 3HEBA 2OFWA 2J3HA 2C2EA 3N07A 2ZIZA 4ZXPA 1IHDA 3KB8A 1ENZA 4Z4IA 4JCCA 3DEEA 2LKYA 3KCQA 4I55B 2QJTA 3HQ4O 3LFHA 5FPTA 1RI5A 3MTAA 2KHZA 3OIFA 3KOXA 4BEBA 1GQSA 3DDUA 4UATA 2FLWA 4WGGA 3NGXA 4CHGA 1SBNE 1FXWA 3IDFA 1CQZA 1FSGA 3LD9A 3DDWA 4B84A 3HKDA 4ZICA 4P0PB 5JJLA 4GOKA 1JIVA 1II8B 3BIJA 3ERCA 2XOEA 4ED9A 5A4IS 4OV6B 1TJPB 4ZQBA 4MI1A 3F6PA 3A4TA 3NDPA 2RIRA 2WZQA 3WJAA 3ADKA 3KQUA 2Q8QA 2VUUA 2DHQA 1SH7A 5C8YF 1R37A 1V25A 3DDOA 2CEKA 4WCDA 4EW6A 3S8MA 5KYYA 4KUEA 4OM8A 3RRMA 1X13A 3ER9A 2R1ZA 3AT1A 4NBKA 2Q5EA 3FCUB 1X6VA 4MKGA 1MC4A 4GZ5A 3V6KA 1ZJ6A 5LP6F 3D81A 4HS4A 1XMSA 2RCYA 2V45A 3GAZA 2P66A 3RRBA 1L7RA 5FV4A 5KWJA 3QBTA 2DQSA 4E21A 1ADFA 2R18A 3JYLA 1TZJA 4R1LA 4H3SA 2XIQA 2Q21A 5FADA 4N9QA 1B14A 2KS6A 2I7XA 4JMLA 1JBKA 4AZWA 2AB0A 3WLEA 1ZOLA 3NT5A 3ZY6A 1PWYE 1KVTA 2IH2A 1XRMA 4WCVA 2WF8A 3K6RA 4O4LF 1T4CB 3ROMA 3WLFA 4QXRA 4J4TA 5JH7A 1Y89A 1ESCA 1CDDA 1V45E 1YB6A 1OIVA 2GARA 1EJ0A 4R9RA 3WRYC 3OOHA 2YS6A 1LXCA 1FFXB 4M46A 3WP1B 1XD8A 1ZNXA 1MOZA 2WJHA 1CY6A 1EIZA 1MH1A 4RVCA 3S29A 3M1LA 4LF6B 4CEIB 3SMVA 2V58A 3B1WA 3PEUA 3OLXA 1JFSA 1XZ8A 5DWDA 3H1FA 3FCYA 4RJKA 1JIIA 3MR2A 2J67A 1T2AA 2QX9A 2YHIA 2FR8A 1JR3E 4E5UA 5CXUA 1IH8A 5HQTA 4FS2A 2NRWA 5AOBA 5SZIA 2AK3A 2ZYSA 5KS2A 2W6QA 5HS4A 1A9YA 4FLMA 1MQSA 1RXCA 3SHFA 1FZTA 2IY7A 1K4KA 2OHJA 5AKHA 4OQPA 4K1XA 2DX7A 1GN9A 3S40A 4A0HA 4CLHA 4RPCA 2Q2OA 3VNVA 2PR2A 4KACA 4Q3NA 3U4AA 4BN4A 2J9RA 3QMVA 5EJGA 3W9BA 3DVLA 2B4KA 4BNMA 4B9MA 4RDIA 3O8QB 3DEJA 3HW8A 4PTZA 4QZ8A 1VXRA 4MKRA 1QG6A 2NXNA 3VKHA 1SHZA 3JARA 3ACCA 5U9CA 4QE3A 1B4DA 4LYHA 5BT9A 4MWEA 1U0LA 4DKJA 2X15A 1O03A 2RAFA 2H4ZA 1NJFA 1UMKA 4EUHA 4C7ZA 4CLOA 4OLFA 2R8KA 5DHUA 4B73A 5BY2A 3LPLA 1BWSA 3VOAA 1Z82A 2PAFA 3E7FA 4TXNA 4PZ0A 5ER9A 3K2BA 3C7AA 1SK9A 2W98A 3ZJ5A 3EY9A 1VCNA 3LV8A 1GZ4A 3M33A 1PT5A 4LDJA 2LBPA 3DZDA 5LU8A 2PA3A 5LA6F 3UANA 4PSAA 1RZRA 5GM1A 3RJZA 5J40A 4HDCA 2QP3A 1EEHA 1CDEA 3K9CA 2ORED 1I3LA 3PHIA 4EW3A 1ZJMA 2O14A 4BE4A 1T4BA 3PE4A 1QP8A 2ESRA 1JZTA 2QZZA 1J2TA 2C2XA 4WZAE 1P9LA 2R8PA 3D6HA 4JBLA 5K8UA 2ZAIA 4HNAB 2BY4A 4H17A 3OOYA 1V5FA 2YWCA 3H9JA 5GIPE 2JD0A 4W5HA 2IZ0A 4NYMR 4D0LB 4D80A 4ARUA 5FOTA 5CPFA 4N0PA 3O3MB 2IXTA 1EVEA 1U31A 3VMMA 4NEQA 1Z88A 1RLIA 2X5XA 1PJBA 5TC4A 2X6TA 3COWA 1EM8B 1N32B 3EUWA 5E1DA 3CX7A 1QR6A 1ZD1A 1FEZA 4P4TA 1P3Y1 3DE2X 1SZJG 1XCOA 1DX4A 2OQVA 2VDPB 3W6NA 2HSGA 3EIXA 4HXEB 2AYXA 2DBZA 4CF5A 2VDNB 1HFEL 7ICJA 5KFGA 3U40A 5JWHA 4DA0A 2ZJ5A 3TLBA 4BUZA 3H4IA 1UMDB 3DKIA 4IUCS 1OXJA 4UB1A 4MW9A 4N0MA 1UWKA 1RYNA 3GVIA 4JP5A 3ESXA 8ICQA 5H3LA 4I2GA 2PVSA 4N76A 1XVTA 4PHEA 1TUGA 4IR9A 4PBRA 4KIJA 5IAAA 2R8IA 5HJ2A 3EQ7A 4TT3D 3BHNA 3OEHD 1NYLA 2QRQA 5D49A 4XAQA 4JIMA 3QE9Y 1RMYA 3GAFA 4MROA 3G9TA 4IIHA 2LMRA 4U2DA 1X9SA 2QV7A 4X7RA 3L92A 5ARCA 2PUGA 2NGRA 4JBIA 2J31A 2KK0A 4NQRA 1N57A 4G63A 521PA 1XN4A 4QG7A 1XYVA 2J9GA 8ICBA 3BCSA 3HS3A 5DNUA 4PCLA 2BGJA 1LFDB 2EBHX 3NT4A 1W49A 4Q24A 4NJEB 5IJ0A 3LY5A 4U6QA 4FS1A 2Q0SA 3SQOA 5L6MB 2WC1A 4BMDA 4BU1A 3ND7A 2ISPA 1YDHA 5AW7A 2C00A 3T9AA 3OT5A 1ZESA 3BMOB 1MRNA 4Z8XA 4I08A 1XJQA 1U4BA 2VJ4A 5ILGA 1ANKA 5CDUA 3L3BA 1KMQA 4RMGA 1NPTO 1DQRA 2IEGA 3KEOA 3P0HA 2BMAA 3H0CA 3ZV6A 3QNWA 4ZKDA 3U7QB 3C1ZA 5D3MB 1KKUA 1X66A 1ZQKA 1OAAA 3E61A 1XT6A 4EYSA 4KR0A 1ZQGA 3U1TA 5EQDA 1A27A 2LYAA 9LDTA 4NL9C 1C7EA 1LSJA 4NXZA 1OX4A 5KPDA 1CS0A 2Y1GA 2CJFA 3JQQA 1KKXA 2CXPA 1WW3A 1ECBA 2PFNA 4FD3A 4HJXA 2Z08A 2AQIA 1G4AE 1EZZA 4FWBA 1WA5A 3TVDA 4WXRA 3CVWA 1YI8A 3AEZA 4MITA 3DE7X 3H1GA 3H99A 4H2DA 3BMNA 4WN9A 2YC2C 4AY3A 2YRXA 2C04A 3KKKA 2HWUA 4IGEA 5G41A 5I4BA 3RC7A 4PGXA 1ZRHA 4FHDA 3KUCA 1H4TA 2J07A 2O4UX 1IXKA 2Q1YA 2VHJA 9ICCA 9ATCA 2K4PA 9ICGA 4HNVA 1T8TA 5EJ7A 3A6DA 3DL2A 2VTBB 4TROA 1J70A 1AKNA 4ZVMA 1B8NA 5CDGA 2XW6A 1LKZA 3NIBA 4C89A 3C3PA 1QC5A 5DKWA 3HB5X 3MD0A 3RRZA 4BNNA 3O31A 4B9NA 2VZEA 1ZY2A 4UCXA 2PH5A 1E4YA 3M1AA 1ZOSA 3HFGA 2Q5IA 3X2SA 3ZDFA 3V97A 3AKYA 4C01A 5FLEX 1KF0A 1PKXA 1BO6A 3SJUA 4MV4A 4GYJA 4ZAZA 2GN4A 2CMGA 3V2GA 1N5LA 4MGZR 4ILKA 3EZ9A 1U5BB 1IEWA 3HXLA 3HKBA 1MAAA 1Y1LA 4NY8A 3IEKA 7ICKA 2O1EA 2PN1A 2MU1A 3WBBA 1ZU4A 4RTSA 4BHTA 4O4JB 2OEPA 4B43A 4KKVA 5DX0A 4RL4A 1JSRA 1PGOA 3R3ZA 4AVYA 4I19A 1RQ7A 5EJIA 2Y6VA 1ZN2A 4YQFA 1CR6A 4QGBA 3RAGA 2NNLD 4EG5A 4HT3B 1XL0A 1X70A 3UMJA 2OVFA 1SC4A 5C1PA 4YCCA 3LYAA 3PO4A 4EG7A 3CUUA 2I1WA 2QTMA 4TUPA 1Y48E 3Q6NA 1PDVA 4GNKA 3I2JA 4GLXA 3AWIA 1RCTE 2GESA 3L0SA 2QRKA 3P27A 3AEQA 3PP8A 1QCYA 4GP9A 4BDPA 2NM0A 1G5RA 1NKVA 3GA5A 1KK2A 4QXOA 1L4GA 3V7KA 2AC7A 1HE2A 1VQ1A 3KSBC 4Z7JA 4P2GA 2DSNA 4A16A 3ONNA 2GSDA 3C97A 4NZYA 3H0KA 2D54A 2NV2B 1ZOPA 2VRCA 3TARA 4EB8A 2FDRA 1C50A 2I6UA 3O26A 1ZQBA 3D3WA 2B78A 2GXQA 4Z7QB 2Q6OA 1WCLA 1FQKA 3TSOA 1E60A 2NU7B 1GVNB 1HDOA 3WGYA 2X7JA 4G25A 4CM5A 4HGPA 2VT6A 1YJQA 2M6LA 1OV6A 1BN6A 1MDBA 2QAGB 1W87A 3HVJA 3DYVA 5ED4A 3AHHA 3PXUA 3Q6MA 1VJ0A 1XZNA 3IB3A 2DC1A 2K4IA 4WJLA 4WSOA 1BZYA 3SEZA 2W2XA 3MWDB 1KJYA 2YJZA 4YXMA 3EEQA 1GGJA 3ICVA 1Z16A 2EWMA 1HETA 2J48A 4WKPA 3ILHA 3W77A 1W5BA 4AKGA 2G9ZA 3ETDA 3H65A 4V24A 4AZ0A 5KJEA 5KHOC 5HRCA 4R8LA 2P30A 3FVVA 3PL5A 2P3SA 2I0FA 3JV7A 1OR8A 1ZYQA 4UE6A 2BDPA 3EHDA 1C41A 3DOJA 4YC7A 1LD3A 1WY7A 1VIYA 4I9GA 4B4KA 5LZ4A 5CX4A 2YICA 3SYZA 4A2PA 4KO8A 5FBKA 1KJNA 1L5LA 1AC5A 2O3UA 1YD7A 5CFPA 3RLIA 3U13A 4J0GA 4KE6A 3NBQA 4COKA 2AOUB 2ZTHA 1BYIA 2B1GA 2F3RA 4AJ9A 2JRCA 4ZT5A 1XF9A 1E2PA 4UNPA 2GLEA 2GN2A 1TKCA 4UEWA 4U1RA 4RVUA 3N2LA 3GK3A 2NYVA 3L1JA 1J2EA 5CA1B 3QKRB 1IOVA 1H2EA 5CLGA 3Q98A 1SCDA 4ZMSA 4WLNA 5FBZA 4BGEA 4G5YA 3BL6A 2ZWPA 1ZNQO 2R8XA 3BT7A 4X97A 3LYSA 3HEMA 3LP5A 4YP0A 4I50A 5HBRA 5BYKA 2WHPB 2BTOA 2R2AA 2HHSA 5KFDA 3L05A 3MQ2A 2OV2A 2XKAA 2VYCA 5BR1A 1V38A 4WIAA 5AMXA 1TYDE 1M2EA 4EVIA 5TPZA 2HZBA 2FJ6A 2Y68A 4HPWA 3L41A 1YS1X 2G08A 4KDRA 2RKOA 3RUIA 2PL3A 2XH8A 4GI7A 3P0EA 2PZMA 2GJSA 4AY5A 3CKLA 1K3FA 1AV6A 2XKBA 4OGKA 3TPFA 5JNUA 1M1NA 2PYZA 2ISSD 5DN6A 1VLHA 2ZYAA 4X8HA 1UFVA 4GX0A 1JTEA 3RSZA 5BNZA 1V8BA 3I1YA 2EDCA 2L42A 2VNJA 2JFVA 1BTOA 2QPTA 4CIXA 1WHSB 2IPXA 3TZBA 2NV6A 3IPRA 3RKSA 4URXR 3F78A 4F2DA 4PQRA 5JCOC 2XD9A 3MFYA 4ABYA 5EJEA 4Q4AB 1VP9A 5KQMA 1OPRA 2JH8A 3ET5A 4HLUA 5KTQA 1X8KA 4JXXA 5JSZB 4TQSA 1J1UA 3QSYA 4XX1A 4C9BA 1S89A 3S4YA 2CLOB 3RBAA 4MRAA 2QUAA 4DXDA 2XNSA 1KAGA 1ABFA 4K6MA 1JG3A 1DO0A 1ULHA 3NDBB 5LUAA 4CUKA 2OXIA 3CPHA 3HHEA 1RNLA 1SHTX 4L3WA 1PJTA 1X7GA 1TFRA 4W1PA 1U4OA 3D4BA 3QA9A 4BB0A 3ZV7A 2PMDA 3D1VA 3BS5B 3S44A 5L1JA 2XQVA 3M6LA 4KREA 1G21B 1Z4KA 3IN5A 4QOIA 3LVVA 3V2IA 3ZZNA 2NSJA 2GTPA 4IXTA 2ZJZA 2FF5A 2OPHA 4IH9A 4EFDA 1U8UA 1HM5A 3TVYA 2B2NA 3ABIA 4MW0A 1DBSA 2YJ3A 4HAOA 1V8OA 5LM3A 3V7NA 7ICTA 1FVHA 4I4IA 3WA7A 3UW3A 4A6DA 4BX2A 1CSEE 3X1JA 4EABA 2EX0A 3VTKA 1DSSG 4Z2YA 2XB9A 4Q34A 4WKCA 3PRYA 5DB8A 4GKBA 1U1GA 3P2JA 1WTAA 2J41A 2A57A 4Y8VA 4YONB 1YL7A 4BRWA 4CM8A 4KGZA 4J76A 5L3QA 4L0DA 1AV7A 1GFZA 4D2IA 4AKIA 2A0YA 4YUAA 3OM1A 5KTTA 2YOFA 4CFZA 3WRYA 2ZUFA 2HRZA 3AMZA 3P1JA 2QD4A 2FUEA 2OP1A 2VTEA 3NHPA 4E07A 4G0NA 4Y67A 3WK8A 4MYUA 2Y2VA 1WDMA 1ONBA 2ZUTA 3K9BA 2IA6A 3AKCA 2IKQA 3IHQB 1DXHA 1NPDA 4PNHA 2Q7XA 3I9FA 1E6WA 2ZULA 5TARA 4MCIA 5IIOA 1GQ2A 3PVCA 4EY4A 3VU8A 4YRAA 1AKTA 2EIXA 2ZTEA 3D5EA 2G82A 3DDSA 3EWSA 4UNNA 4UBCA 4DS5A 3PGVA 3ZUGA 2D13A 4A9AA 3RRNA 3F5SA 2CLFB 5B6JA 3GVHA 2V9WA 2RGEA 4DRZA 2ZIWB 2C9OA 1WUIS 2OCEA 3A10A 3PENA 4DOMA 1PK3A 2JNWA 1H3FA 1QP0A 4HDMA 4E2ZA 2VAVA 4XYEA 3EE6A 5CCXA 3AUSA 2QAGC 1H69A 4LGYA 2HSWA 3M6XA 4OXRA 2BRUC 2X9LA 3CT6A 4PCUA 4J0KA 1WUYA 2EAMA 1QRDA 1TYZA 3TM4A 2H1RA 2OXCA 4JSRA 2IXGA 2JFQA 3VR2A 1ABEA 5B4UA 5JUMA 2X8JA 4IJUA 5K51A 1B76A 1HT2E 4DN6A 2BQUA 1VG9B 2IRWA 2JA1A 5G02A 4M1ZA 3G0CA 3DC7A 3GD5A 5BMVF 4ECVA 5BN5B 3KJFA 1TYCA 2IQIA 3LBIA 1K0UA 5IULC 1IOWA 3B6EA 4UE2A 1E2QA 3NRBA 2E7ZA 3TD6A 3M5DA 3HB0A 4U2EA 3OZFA 2IS6A 1Q0LA 1YULA 2NZUG 3P2OA 4KQ1A 4L9RA 3LCUA 2PX0A 3BG5A 3EQ6A 4LHXA 3AFNA 2YVLA 4MIOA 2JZOA 1VCHA 3UGKA 2E1PA 4GE3A 1YKSA 1NX6A 5TQVA 5CFOA 3KVNA 5I4IA 4WI1A 1KC3A 4U9UA 2LM4A 1L3CA 2VQ3A 2WKWA 5HXAA 1UBEA 3IV9A 3QEMB 2KM1A 4R31A 2WUGA 5KHLB 2O8BB 4CTOA 3PT5A 5D2CA 1E1KA 4YAGA 5DEIA 1TO6A 2A9VA 3PRJA 1KJIA 5IVDA 3MAGA 1JUDA 4R2LA 3S2ZA 4FDLA 3STVA 4ZYUA 5AQEA 3DTTA 4AMUA 5KWIA 5C81A 1JDTA 4YV2A 1T5OA 2GA9A 3E9CA 3IP7A 4RWZA 1ULUA 1DIOB 3ZWAA 4BQRA 4FW9A 4EHFA 5LNK6 3UICA 3CKYA 4NBUA 4BB6A 4MR9B 4RCYA 4ILEA 1UAGA 5KQLA 5C1OA 3ABSB 3THOA 2ZS7A 1PP4A 4F4FA 3IT3A 1KYQA 1JJ7A 3GMDA 1IXYA 3AV3A 5C1DA 4CM4A 5DT2A 2C4HA 3G1WA 3M9MB 5I4KA 4UTNA 3COZA 3I09A 1ZIDA 4PM4A 5JQGB 3TRKA 2QARA 2KVSA 1XD9A 4BZZA 3PXCX 2MT9A 1MQ3A 3QV2A 4L5YA 1H8ED 3GEGA 1Z8NA 4ZHSA 2W6JA 1GUBA 5AUPB 1RE1A 5G0SA 4M54A 2W0SA 1GU0A 1ZUD1 3Q3VA 2MSNA 3C7TA 1YOVB 1M1YE 1Q1AA 4MGHA 3ZXXA 3D5QA 4JP1A 3H2BA 1H6CA 4IHAA 2NX2A 1A97A 4EHLA 3EXG1 4N5MA 4FHEA 3MJEA 4XVRA 3WAJA 2B94A 1F1JA 2CE2X 2DERA 4GOLD 3TECE 2IDMA 3H87A 1GNPA 1XELA 1DV1A 16PKA 3ZY5A 1O9HA 1I2MA 3D54D 4JI5B 1TOAA 1DLJA 2OBLA 4HMQA 1JKMA 4BFVA 2CLEB 1YAJA 3TR6A 1WS6A 3ZJTA 2JGDA 4Q9KA 3FDXA 1X8JA 3KEMA 1L5SA 2IF2A 3MMNA 2OCYC 1GL7A 1OYVA 1CZRA 3C1YA 1HT3A 1XVIA 2ZPUA 2RGXA 4EY5A 5DOVA 5J2DA 3KKZA 3D2NA 4JV2A 5KSOA 2ODWA 3VDNB 2O8CB 4D1YA 4U39A 1WR8A 4Q16A 1RCFA 3MEQA 4UBKA 1CF9A 2JI4A 3MB8A 1KAQA 4L95C 1Q16A 3R74A 2D5BA 3SHOA 9ICIA 1YS4A 1FRVA 3P4XA 3QZ8A 5BUCA 1XEXA 3HR8A 1E1CB 4RNMA 4PR0A 4ED8A 2OZEA 4K28A 5DWQA 3MPUA 3EXEA 1GPYA 1UK9A 5CDFA 1E2DA 4AS1A 4UM7A 3EFEA 4DT1B 2VVTA 2Q2NA 4OO3A 1F4LA 1TYAE 3JQAB 4Y98A 1JR2A 4RELA 3DPUA 1L4YA 4TRNA 4PN3A 3CW8X 3GRVA 5LXTA 1I32A 9ICEA 4M2LA 5ADWA 3OO0A 3IFSA 2GZRA 3G0HA 4O3RA 4GLJA 3ISTA 1F0NA 2UUOA 3VDXA 2RGBA 1U5CA 4YN4A 3U4HA 4NJOA 2CYBA 1Z06A 2I76A 3DQZA 1BA2A 4ZO6A 1CCWA 2PUWA 3EYAA 4IH1A 4G5OA 2PYDA 5EXXA 4HNUA 3PIRA 1QIGA 3KLOA 3AR7A 3D6TB 1HDGO 2KYRA 4X63A 4PFKA 2HXGA 5KG7A 5L1KA 3K32A 5CR0A 4KFRA 1AHNA 1VJTA 2I2XB 2J1LA 2GILA 4AI6A 2CNNA 3E9YA 2E4AA 3ZDDA 4BEWA 3WQRA 1U7HA 3ZKWB 2P2LA 2OECA 2N0SA 2AXEA 4KV7A 3I9KA 4S1VA 1B15A 4M8NE 3SYNA 2IP2A 4Q12A 3ZI7A 5H59A 1DRWA 3G7UA 4F3OA 1F0KA 1GZVA 1V4VA 1Q20A 3H5LA 2VHXA 5BR4A 2O07A 3WGQA 4G4SO 4MW2A 1QCKA 4NAUA 1WEKA 5ITVA 5EMJA 2CNDA 1U9IA 4ZI3A 2D0DA 1OGIA 2J59A 2HA7A 3GU3A 4AP9A 4M0EA 4PGYA 4JJZA 5I9BA 5CXSA 2YV2A 1E1MA 2LKCA 4YN3A 1V16B 4NENA 5GJWC 4C8OA 2WDPA 4BWVA 1FLAA 1YE8A 1BAPA 1Z13A 5FOUA 1FVOA 3EVTA 3N8DA 1KH2A 4TX1A 5KYUB 2QG4A 4ML3A 2DKZA 5A1JA 4G0PA 2XGGA 1Z26A 1BKYA 1DPGA 3PCXA 4J94A 1O5IA 4CIDA 3DO5A 1T9HA 2OM6A 3JPOA 3HV0A 4HYQA 1UPBA 2RGAA 3H8MA 1AKQA 4OB6A 5TQ2A 4Y1GA 3DTVD 1WQ1R 4PVCA 2A1UB 2GBPA 3R7WB 3PNPA 2XBMA 2CXOA 1EA7A 4EY3A 4UVIA 5CVCA 4J9LA 1SGWA 5KOHA 3N7PD 2IYAA 2XDWA 4ZVVA 1VPEA 3PI7A 5EE5B 4CU2A 4US8A 5AUOB 1UBKS 1XZQA 4JL8A 1RD4A 2H5JA 3EZGA 4AJPA 2VK2A 4DDMA 3FSRA 4PVDA 1P75A 2HBRA 3O93A 1LJLA 3R9KA 2EFCB 4PY2A 1R4AA 2OAP1 3VPBA 1R1DA 4PFSA 1SCAA 4L8LA 3PC6A 1MEOA 3A7EA 3AERB 1M66A 1ZMRA 4EA9A 3LLVA 1ZD4A 4OKSA 4MVJD 1DJPA 4B4DA 1AS0A 3ULKA 1XKLA 3TLGB 1TMKA 3PDJA 3A6LA 4QC2A 3OA0A 3QLEA 5CG2A 1RYEA 2AL7A 2ZBRA 1KYIA 1KBUA 1W96A 4FMCB 5ALUA 2UZ3A 1DBQA 3ZNNA 4I5FA 1LH0A 2WFLA 1SUEA 1U7OA 3H5RA 4XD2A 5H5JA 1YO6A 4FHFA 1OBHA 5C8YA 4KN8A 4ZCIA 2R00C 3SG0A 4L07A 3VZSA 5CW1A 1L7OA 4PANA 2NACA 2DU8A 1MB9A 4EYHB 2ATXA 3EOZA 2FPOA 4IZOA 1PWXA 2VT2A 4G9GA 1DC3A 5A4DA 4X92A 4ARVA 2B4TO 4ER7A 4JEMA 4OIFA 3CEJA 5KSYA 2OYSA 2HEGA 5LP6A 3R3YA 4MCAA 1A0OA 1XU7A 1ZHHA 2IXAA 1ZQDA 3RG2A 1XTRA 1IUPA 1EA5A 5L9XA 4WVLA 5BSWA 4R01A 3EIWA 3A3PA 3QUAA 4N40A 3OT1A 2V7QD 1CDZA 4BO8A 3NJ8A 3R0JA 4I55F 3T4UA 2XYHA 1XXHE 3M9NB 5ADUS 1D7AA 4DSUA 3BH0A 4DCGA 1J0XO 5COQA 2AKYA 2OG1A 3BK2A 1H6AA 3WGGA 3FFTA 1KRPA 5K3EA 1BEUB 1VMEA 3FNHA 4AY4A 4O4LA 2J4DA 4WNYA 4M0MA 3EDYA 3PUKA 2WINI 1SUBA 1HUQA 4D74A 2C0CA 1E5XA 3LHSA 3PFIA 2C95A 2V59A 1W36D 1I4LD 3K8YA 1XZMA 1NLUA 1DGJA 3OQPA 5DRYA 3H18A 2WMDA 4HNQA 2H00A 3Q8PB 4OJLA 1W76A 1V1MB 1KMMA 1OREA 1JR6A 4HDOB 4QWMA 3DLTA 5KTOA 3DLHA 5EKSA 3VGPA 3NP9A 1QVRA 5EG5A 3U49A 3QPUA 4Y2TA 4S05A 1XMVA 3KUDA 3BZUA 4JLOA 4C7OA 4GBED 2KEYA 4FGJA 2H4WA 4O4HB 4MARA 1I0ZA 4A0RA 1IJKA 2IHKA 5C5CA 4UHBA 2W9CB 4J0EA 2NVUA 4QATA 2HWKA 2H3HA 2VJCA 1A8IA 1NYQA 3S99A 3QLUC 5IT5A 1NV8A 1QB7A 4W5NA 5HFAA 4BFYA 4DEZA 1SKQA 4TXMA 3W1EA 5HF5A 1B8VA 4QZCA 1E9SA 3LK6A 2FLNA 4EZIA 3D2SA 1PUZA 2R6HA 4B9LA 1XSPA 4M49A 4YJGA 4EW1A 3HHPA 3H9UA 4A82A 5EP1A 1NMYA 4X1OA 2PBFA 2IW3A 1DI0A 4F4KA 1C0KA 3TXXA 4B3BA 4OKNA 3C21A 3W5AA 4JYCA 2O7QA 1ZCZA 4PC2A 1I7PA 4EYEA 5KNLA 7ICLA 4WRRA 1SXJA 1TVCA 3HNRA 1VLBA 4IVQA 1M2HA 2WM3A 3HBAA 2A84A 3NOQA 5U4QA 2X5JO 1KKMA 5A6SA 5IUJC 4M0FA 3K70D 1NUTA 4MB6A 5DQIA 3OZXA 3L7YA 1GTRA 1W0JD 1ENYA 3AOEA 2I6XA 1FDUA 1KI6A 1G98A 1PR4A 4MWZA 4QXMA 3KT8A 3IAUA 3ZZ0A 2PI5A 3PRKE 1JBQA 4OMCA 1DRKA 3WXMA 3LXUX 1LZLA 3STTA 2B61A 1KY2A 1KEEB 3G9ZA 3CBQA 1YB5A 2G80A 1HA3A 1LTHR 2CXRA 3HFSA 3OG9A 2VL7A 2PJDA 1Y6RA 4ZHQB 3LDAA 3OC0A 3TDNA 1JEJA 4E32A 3C28A 2NZ2A 4ZXFA 3RYCB 1NIJA 2IHMA 2VLBA 1HLPA 3FOCA 3HL0A 2E2WA 3OEEA 4GPD1 4EJ2A 1J2RA 1QMGA 2LPEA 1QUFA 4NCBA 2PMCA 3UPDA 3Q3HA 4B0PA 3WQBA 2OPBA 3TR0A 1S5PA 3NVDA 1RPZA 4ROSA 1R8SA 1JXEA 3C6XA 2QPOA 3C6MA 4P5EA 2AUTA 1SUSA 1I3MA 1Z2PX 5ULLA 2EKDA 3F9RA 3HYSA 4TYYA 3PC7A 1W2GA 3NDJA 2Q45A 3ZHZA 1Y8CA 4FW8A 3D64A 1A98A 1EFDN 3PTZA 2VF2A 4ALNA 5JD6A 2P6UA 5I3CA 4I9UA 4P81A 3NUGA 2G5CA 4LJYA 1XLUA 1GRRA 3ETJA 5IIJA 3MYYA 1XQVA 2DUUA 2HY7A 2PE5A 2V5AA 3FWNA 2CXYA 1WUJS 3TTUA 2DKNA 5IBPA 5KVQA 1TK8A 2F2TA 5L51A 1ZNZA 4DBVO 3QF4B 5BSKA 1T6ZA 1ZK1A 2BFDB 4Y6OA 2IHYA 3CO5A 1Z6XA 4ECXA 3PQFA 4D3XA 5DXAA 1RM5A 4BLWA 5TGDA 2JHCA 1TYEB 1Q0QA 2PJRA 2QRVA 1DDGA 3QQPA 2XDQA 4KE7A 2F44A 2DQ4A 1R27A 4N49A 5CD9A 5DNEA 4YWJA 2P2GA 1UJ4A 4IDDA 4E6PA 4NV1A 1Q12A 3UAGA 5ERGB 1UP7A 3EDRA 3K9LA 1H1LA 2V5UA 1W5TA 1W7AA 2FFJA 1T5IA 1C3OA 3CH6A 2ZI9A 1RRMA 3NGDA 4C8NA 4DWIA 1AA6A 4BO0A 3E7XA 3NT2A 4L16A 2G83A 2XE8A 3DV0A 1BQ4A 4F92B 2MSDB 3I6YA 2I99A 1FMLA 3PGMA 4ZH4A 4IQ8A 4YEDA 2HBQA 4G09A 1T9KA 3R0QA 8ICYA 3I2GA 1AGYA 3D8TA 2XX3A 2VHCA 3LY7A 3ICOA 4HUJA 1OB2A 4ZVOA 1BROA 4MGYR 1ZFNA 2CGEA 4MW7A 3TTXA 3QUCA 2QV0A 4HEA6 3U7JA 3BE6A 1P2VA 1HQKA 1KRHA 3PXAA 3DNPA 1QDLB 2BGTA 5H68A 3VFDA 4LF7B 3ROXA 2CNBA 3EWNA 5A03A 3WNVA 1IK6A 3AR6A 5LMUB 3K6SB 4BLQA 3ZBPA 4OTZA 5EUMA 1FYEA 5BUZA 3EZ6A 5HSGA 5K0BA 1S2MA 4UAGA 1GCUA 1J07A 1F2UA 1KEPA 4G1MB 3U4MA 1M2NA 3FPCA 4EO7A 3KHRA 3D8BA 1C9DB 1FLVA 1P1BA 3SAGA 1A5TA 5A7GA 1X39A 1ND5A 3PHCA 4F06A 3ZY2A 2BQRA 3AY3A 1BH2A 1Z6TA 2OCXA 4OSPA 4XASA 3C6QA 2HOFA 3Q5EA 2K87A 5F3XB 1QX3A 2J0EA 4WMLA 2CNLA 4Y30A 2FWAA 4S2UA 4QU9A 1MT3A 2R5NA 1V8DA 1Z35A 1TYBE 3KEQA 4IRXA 4RZQA 2GPTA 1DCKA 2DULA 1L5OA 2AOWA 1VSTA 1ZISA 1SHKA 3QIAA 3IV6A 3RJMA 4DSKA 5BOVA 4PX9A 1YGYA 2H1VA 1C3XA 4Q3CA 2GWHA 3W9UA 4JB3A 2JLUA 4GZMA 4DIMA 1UBHS 1DOQA 2H2IA 2DPLA 1QGED 3UAYA 5GINE 4NHEA 1F9AA 3E0QA 4IDNA 3IE2A 2OP0A 2ZYVX 4ZIRB 1TKAA 3ZW7A 1XDZA 3P26A 4B80A 2PI4A 5LN1A 3BFXA 1QYVA 4JC4A 4NBTA 4OQXA 4ELUA 4LMBA 3Q15C 1UCVA 4MWCA 5DF1A 4QYMA 5CRIA 4F5RA 2KFNA 2EJTA 4FYPA 2DFVA 4JYPA 3SJAA 3GIWA 3T5HA 1PL0A 5DSTA 2CMHA 2P3OA 2AFIB 4RK0A 5GADl 5C7LO 1U4NA 2FFQA 3EODA 2IU3A 1O4WA 3WJ7A 3SYRA 2X22A 4ZVSA 4DQIA 1A1VA 4G37A 3C29A 2VJMA 2A7XA 1FMCA 1E7RA 1VSBA 1Z56C 3NJRA 1D8LA 3KEFA 4LZGA 3R7SA 1QH8A 3ZWOA 5G0VA 3DHNA 3ODPA 3GQBB 4JBYA 2XE4A 4K0RA 4L76A 4RPXA 3NV9A 4JXKA 3DE6X 1DKUA 4N3NA 5HFNA 2ZAGA 3DDCA 4UEQA 1KQGA 3P8ZA 3HT3A 5F9FA 3GLGA 2HBMA 1TKBA 2HSZA 4O4JF 3ROFA 1NUQA 3HKCA 3TL3A 1Y5MA 2GCNA 3GHHA 4MK4A 4MQUA 3VMFA 5JJCA 4EVQA 3ZC3A 2GJ8A 4WLFA 3F67A 4OREX 3LK7A 2VQFB 4OHCA 1GZ5A 4N3AA 1W34A 1GG8A 1U6KA 3ELYA 3ANMA 3GFFA 1K08A 3EDOA 1E1NA 3BIXA 3EHEA 1WDKA 1UK6A 4D4JA 1ONOA 4D0SA 4UOEA 1PGNA 2Y71A 4UVGA 3T1TA 3RB4A 1CTQA 1ZSNA 3BWBA 3GEHA 2GN8A 1EQ2A 1FXUA 3BEDA 4MYDA 4QM7A 3ZLTA 2R48A 3W4KA 5KG1A 1IQ0A 1MORA 2ACKA 2GCIA 3O8OB 2O8VA 3AEKB 3H1PA 3WRVA 3QFTA 3IS3A 3FOEC 2N1BA 3VAZA 4YHBA 1SWVA 4FFLA 4F4UA 5I5EA 4ZOLB 5FFFA 1QOQB 4V0RA 4EYGA 1PJQA 3MW8A 3KT6A 5FWDA 3CTMA 3V80A 1PK1B 1NFQA 3ZWWA 3D4PA 1COZA 4F2WA 1HTTA 4DJEC 4RV5A 4DANA 1HE1C 2XOKD 5EGNA 4GG1A 2WIKA 4RBNA 1SCBA 5D86A 4B9SA 2Y76A 5TPWB 2KZMA 1YZUA 4P58A 3TW0A 1X38A 1JDJA 4JJEA 2O8EB 3DEFA 3AJDA 2WMNB 2AXNA 4E1AA 8ICEA 2GA8A 4Q93A 5EVJA 2VHQA 1Z4JA 4BNDA 1P18A 2WYWA 1TO2E 4JGIA 4CKXA 4EDFA 3PWTA 2ZUDA 3IV7A 2I22A 5T3YA 4QYWA 3KWFA 3BRWA 2GZ2A 3UOAB 1D2AA 3S2EA 3AHEA 4R9NA 3NBYC 1LKYA 4ZT6A 3RJEA 3E9RA 4ZT2A 2A9PA 3NBFA 4JZKA 2XXAA 3UMVA 2Z2ZA 3LUBA 3P32A 5FL7A 3G88A 3THWA 4YCLA 1CUCA 1JYFA 2Z58A 1E0DA 1UR5A 4NULA 5G3ZA 2W9MA 1V35A 1GO3F 2WJYA 5LLDA 3VAYA 3KWLA 2EQAA 2OC4A 3RVBA 1GPDG 5DXJA 5C9ZA 2ZUSA 4MLPA 3N0TA 1FUIA 4KXVA 4DFKA 3ISBA 4JDPA 1ZGBA 4RQ2A 1NWHA 5JO9A 3OIGA 3RR7A 3L6DA 2WKRA 1GV0A 3A1DA 5IF3A 1JKXA 3GJXC 4XLTA 3B1VA 5DEOA 1BXZA 4L4RA 3WWCA 3TLMA 1B0PA 1XP8A 1X9XA 2EQ5A 4HB4A 3VH3A 4CIAA 2FI1A 1XHLA 2SCUA 2VQSA 2NLOA 3ZXUB 4LSGA 1N6PA 4LCEA 2GAFA 3H0LB 4TGLA 4WFJA 5LP1A 3GDHA 4LF9B 3Q9LA 1CI4A 1C1DA 4XPIA 5HP4A 2J30A 3U7FB 2EEZA 3PGLA 1QIDA 2WHEA 1OXMA 5E38A 3EPIA 3R9WA 5BUSA 3RASA 2AF4C 4OMUA 4ZVQA 4TKVB 3IMGA 3LXXA 4RK5A 2P79A 1P5HA 3AR2A 5I3ZA 2FMTA 1X7WA 1X1AA 4D8UA 3D8RA 5DK4A 1UH5A 2RDIA 1MABB 3BWYA 3TTTA 2RHHA 1RWPA 4JROA 3LRPA 4B4UA 1MO3A 5I7AA 3KVRA 3MAAC 2FPPA 2M6RA 4YK7A 1EINA 2MA1A 2BFFB 1V37A 4B9TA 1P1IA 3LOPA 1O8BA 3NHJA 2CLMB 3LUGA 4Q37A 2PV0A 4ZANA 2PJUA 2Q6KA 1XSNA 1KPIA 2ZDGA 4FFVA 2P69A 1BE8A 4EA7A 2AE1A 2JI9A 2FDCA 4X20A 4QZGA 2RBEA 2OBXA 1N2ZA 5HQ3B 1EPUA 1GO2A 3WK6A 5I8PA 1NBAA 3JZDA 4M6WA 2C7VA 3NYRA 2QN2A 2COEA 4MJXA 2QM7A 1K8ZB 3LFUA 3PXBA 2WG2A 5KT4A 3BWCA 4DRXA 5EWGA 4FZLA 1RWBA 4G23A 1BHQ1 4X9XA 4C4RA 5IKMA 3NWJA 4I6EA 5EFOA 3M8SA 2XBUA 5IXSA 3GNQA 1T5TA 3D6UA 2BLLA 3M6ZA 2QMEA 1E4EA 5P8WA 4BMNA 4XD7A 4WNIA 2ZRIA 4CMEC 3HU5A 4Z6EA 1XMOB 2ZJ3A 4HRXA 2DPXA 1S01A 2P9GA 5EIFA 2C2OA 3V32A 3VOSA 5JY6A 1V97A 3BXGA 2UZIR 3D7RA 1Q0UA 1A72A 1FK8A 1Z3CA 1JQEA 4B9AA 3D2QA 1X9MA 1PJAA 4JUBA 4BZQA 4ZDIA 2C2KA 5BQ5A 1FP6A 4DW8A 4ASUA 5BWMA 3PNKA 2Y0SC 2I54A 2PT5A 1UOPA 2PKWA 3QPCA 4V0MA 5JIBA 5J0TA 5SYAA 1TM1E 1CUAA 3O4IA 1VLLA 1DUSA 1K5OA 4M0PA 3UXEA 1G5TA 1NPYA 2FPUA 2FOIA 2RE8A 5EQFA 4DSOA 3Q8SB 5IX8A 2JGJA 4AG5A 3HUDA 3TLEA 2D1FA 2R86A 1OW5A 2EYQA 1XSLA 3W7VA 1H94A 3OQ1A 1V7QA 4JDUA 1PE0A 4KFSA 4YMTA 2IE0A 4TL7A 1SGGA 5AK0A 3MTIA 1U2DA 2EFEB 3BL8A 4HFNA 2E55A 5BMVA 1L6RA 3V1YA 1E1DA 3ZLUA 5IWCA 4XRHA 2QL5A 2FYTA 2HJWA 3UENA 4DQQA 3M3PA 1Z4MA 1PL8A 2G1AA 4GT1A 4RQBA 4OYRA 3VA7A 4ZVKA 4DWJA 2ZBPA 4KWCA 1MU0A 1YZFA 2VCYA 2ZWVA 2NO1A 4KO3S 1UAYA 5IKXA 5HFJA 2B20A 1P1JA 3RT9A 2CLKB 1NVBA 3NPAA 5CYFA 1NNLA 2VQDA 3C3CA 4IEIA 1M2OA 3LFTA 4AUNA 1I6WA 5IS2A 3WL4A 2IYVA 1BHJA 4IUDS 1WB5A 2ZTDA 1DG9A 4WXHA 1TW2A 3AVQA 1UBRS 1TLLA 1DAOA 4UB3A 4MP6A 2OQ2A 4CI0B 4K8RB 4OK6A 5HUHA 1GAQA 3CB4A 3TLCA 2YJ5A 4RZRA 1JKIA 3A4MA 2VSYA 1GG5A 4XX0B 3GC6A 1Q22A 3DHWC 1P7WA 4QNNA 2PY6A 2JIMA 4IMRA 5EUCA 3L0CA 2E3JA 3BUSA 1JLRA 1G291 4PPXA 1RJFA 2EGGA 2DBYA 3RUDA 1Z45A 3K30A 2ZR0A 4WOJA 2XB2A 4LSMA 4O2RA 4A10A 5DGXA 4DAOA 1I30A 4QUJA 2XI4A 3Q2KA 3HWRA 3O75A 2ANCA 3A3YA 2KJ5A 3PZRA 3ONDA 5L4SA 4AUEA 2FUKA 4KZKA 5HPYB 3Q41A 5H9VA 1M2JA 1RRCA 4E0DA 5H81A 3NZEA 5BQOA 2CLLB 2OM2A 1I6KA 3D8UA 4O4IB 3R7FA 3SBEA 4PONA 1NXPA 4DG5A 5EUQB 3NTLA 3VU3A 2XUHA 4JWMA 2H4HA 1OLSB 5KKNB 4OY3A 3LVWA 3TTWA 2K6GA 4GX2A 1IZ8A 4UHJA 1SUDA 2PSDA 4OJMX 5FF9A 3H5OA 1D9ZA 4K6FA 2ZROA 3P96A 3C0KA 2ZRDA 2V1XA 4HAWA 2JKYA 4BUCA 2PFPA 2R7MA 4AN0A 4ED0A 1LTQA 3IIIA 1M0WA 1JVSA 4MXDA 4CYMA 4QOFA 2HHVA 1N6NA 1JPUA 2I1VB 4JX9A 3L7CA 5BOSB 1E18A 5LD2B 1P3DA 3PNOA 3OFJA 4IX1A 4ZWNA 4C8MA 3R3WA 4BJ1A 1L7XA 2IELA 2BKVA 1QNFA 1X1EA 4QOEA 1PWHA 3R7NA 4M0LA 1UDRA 4P33A 3TCNA 3DM9B 4BBJA 3IPCA 3JALB 2P6RA 3MBOA 4NCKA 1Z5UA 4CMCA 3HZOA 9LDBA 1P2BA 1I4OA 1JL3A 4F4XA 2JEOA 2ZRAA 4O59O 1NF8A 2UZ1B 4DQPA 3ILYA 1UPHA 3U26A 2W9BA 3W5JA 2G5GX 2XUPA 2ZZMA 3VO1A 1VYHA 4BVGA 5T4HA 5KAPA 4EECA 3U2QA 3SDBA 4DY6A 3NCHA 2JI8A 2CLSA 1EVLA 3LQYA 3DD1A 2R11A 2ZIEA 1X1TA 1ID1A 5JQGF 1IWOA 1N63A 3PC4A 3WK9A 2IOYA 3TSAA 1FTWA 3IHWA 4EFNA 1Y3FE 4KVFA 1JU3A 2YZNA 5ECDA 4QULA 1SKSA 4Z7OB 2H3ZA 3KFXA 2WD8A 2IEYA 2P9CA 1Z36A 4H7JA 1I14A 1B6RA 2BFWA 4J6FA 2V0CA 4MZDA 4TMVA 1D0VA 1SKUA 4IIYA 1Z8HA 2OHOA 1D09A 3BS4A 3C1OA 5J1SB 3C3JA 4Q1DA 2ZIUB 1LNZA 4CKYA 4XM1A 5JATA 3E9MA 2UZ4A 4RADA 4A8EA 8ICXA 1W46A 1IBMB 4I99A 5EXPA 1YS6A 3QXHA 3LBAA 1PT9A 3SXJA 1QQAA 2NN3C 4K5QA 4IDQA 2WR8A 4GICA 2YJGA 4ZMBA 1ORTA 2QLMA 3C2MA 1H3NA 1MT0A 4CLDA 3EIUA 2F9FA 2C54A 1U9LA 4JP3A 3G9UA 1I10A 1RPTA 3P9PA 4P4SB 3VH4A 3VV2A 4Y1FA 5GZ6A 4ZV4A 1FP7A 5GV7A 2C2YA 4TZ6A 3QKSB 5BV2P 2GZSA 2XYRA 2ZJYA 4M86A 2DY0A 3IQDB 2DY1A 3SE7A 3VR4A 5DIZA 2VSXA 2WAYA 5IDWA 1DBRA 4IIUA 3W8EA 3M7DA 2PQ2A 4N5LA 5E4JA 3H4TA 2O3RA 4Z4FA 3F7MA 4CDMA 4FYVA 3IMFA 2PSSA 1E6LA 3PJFA 5JFOA 5J2IA 4Z0NA 1GYPA 3IUEA 4EJ6A 2CN1A 3FCAA 1BVUA 3PW7A 4IO0A 2AN3A 5CX1B 4Y6RA 2WG0A 2HRDA 3CJRA 1LF5A 5GVSA 1L5ZA 2PZEA 3SR3A 4MUMA 5J8YC 1KVRA 3SXUB 1F6BA 4NH0A 4AJ1A 1XNHA 3E2PA 5DM4A 3KFUF 1W35A 3UY4A 2J32A 1R0WA 2CV2A 1M10A 1BYUA 3MZ0A 4B3XA 3JQCA 2P77A 2OK7A 4CNQA 3BYZA 4JI2B 1IAQA 4QDXA 3A1FA 2CV0A 4EJSB 1Y8QA 1YA4A 3FKJA 1HT0A 4HDSB 1EM6A 3L3FX 3C1AA 3NONA 3GLHB 3HLYA 4Q3AA 5F7OA 4JT4A 3ZW9A 1VLZA 2DH6A 3BXXA 2ID7A 2XLCA 5K8LA 1E61A 1WVMA 2WQ7A 1YJAA 1DX9A 3W3ZB 4RORA 3IPXA 5JC1A 4MHTA 3NIGB 2D3TA 2DWCA 3AJRA 3FFBA 2XV1A 1OHHA 3J80A 2EZUA 2DHRA 3MDCA 3ND6A 4DFPA 1UDWA 3QW4B 4H6PA 4FNGA 4I1UA 5AI8A 1Q7TA 2X3FA 2ZSFA 2G4VA 2HU8A 5BSHA 1TZ2A 1CUEA 3LVQE 4OLJA 4NU5A 2HCTA 1BVHA 5HILA 5AVZA 2CLIB 1J1ZA 3QGMA 5LJLA 1A5AB 3E15A 4MB0A 1A5ZA 4JWNA 2VYNA 3I9JA 1VBFA 1UKZA 1DIGA 4KXNA 4YRGA 2C4TA 2W6IA 4NLCA 2XWSA 2W2OA 2O2IA 4B3IA 1VDVA 4TM8A 3BSYA 3MWGA 4HX9A 1Q83A 1H2AS 2ZRLA 5HUQA 2J7PA 1VMKA 2RK6A 1IBRA 2BR0A 1PR1A 3HR7A 2JJYA 2V6BA 3EBLA 1GT6A 3WLLA 2CVPA 4AMZA 2UVDA 4NE2A 3AILA 4GO1A 2Q4EA 3E3OA 2A1AA 2PUTA 4AM8A 4BJHB 1ZGCA 1LF0A 4ZOBA 1BPEA 2BFPA 1DINA 4XIIA 2WTXA 1DKMA 3CVOA 4UB8U 5AJWA 2OFFA 4AJ2A 2QLTA 3VC8A 3JQGA 1OWPA 1AKWA 1QKKA 3AB7A 4GOJA 2HBZA 4MNTA 2Y67A 3UHAA 1CJBA 2BC9A 3C7CB 4J9MA 1TD9A 2K7ZA 4QQRA 1ELOA 1YZNA 1XO1A 1OB5A 1ZXIA 5TV2A 1PZMA 5A0LA 4W7SA 1WPRA 1OX6A 4WOPA 4FZ5A 2VPXA 5LD2C 3GWZA 2BF7A 1TW3A 4Q39A 1K88A 2P90A 2QVBA 2JD2A 3P9SA 3UJBA 3MYRA 4FBUA 4BX0A 4AROA 4I55A 3KC2A 2VIIA 8ICMA 5HKBA 2FY8A 1TRHA 3DB2A 2WJ6A 2G3YA 5IDQA 3D43A 1RKBA 2IIPA 4DF3A 3CZMA 4U7DA 1K9SA 3DONA 3WLIA 3MHTA 5FI1B 4I5DA 1Q77A 4L9WA 3RIGA 4BLOA 3DAHA 2EERA 3N6XA 3HBNA 4FMCF 1II8A 1YJCA 1T25A 1VZ3A 2PG3A 2Y1LA 2VDRB 4G9BA 2YJTD 4L27A 1WSWA 1ZUIA 1BSVA 1GQYA 1S3GA 5AIBA 3JRNA 1QYIA 2MJLA 2VPTA 1HUZA 2R87A 3TX6A 2GM4A 2VHUA 1WXFA 2I2FA 2ZRBA 2F6RA 4TS3A 1TIKA 4M8IA 3EX7C 2QX6A 3H4MA 3NOXA 2B9VA 3S8EA 4NYIR 3FI0A 3BK7A 2JH7A 1JJBA 3JYQA 2WVJA 5IT4A 4KRYA 2I6TA 5AH0A 4AF7A 3BF8A 2YNMD 1BXRB 2J6IA 1EJ2A 2VZ8A 1COWA 1ZJYA 4TL8A 3JXEA 1YQWA 3KPWA 1SQFA 4MWOA 4YXWD 1DT3A 2YVQA 1I1QB 3NYQA 3BFKA 5JU6A 3K31A 2QZ4A 4TZTA 5L3VA 4F1WA 4J0FA 2R1VA 4NL9A 4I2NA 1WVGA 2GKOA 4D45A 2O6LA 2JHAA 2JLBA 4G2NA 2EANA 2QGNA 2WHRA 1VLVA 5DLYA 2AZDA 1FPQA 4XUEA 2ZCJA 3I01M 1DIRA 4YRSA 1Z5WA 2QSZA 1XPOA 3GMIA 4G5XA 3VC2A 2VZ9A 4YXFA 1NKCA 2Z2JA 2ODNA 1NVXQ 2R5WA 1OZAA 3MSXA 4DCCA 4TMYA 4BMCA 3CIFA 2ORYA 2CB0A 2FE9A 3EDQA 1GGEA 4Y1RB 1KAMA 3N0RA 3P9ZA 4BNZA 4NBWA 1H9AA 1TA0A 4UUOA 1FFXA 3FWZA 2GUGA 4YMIA 2HDOA 3WL8A 2QVZX 1Q44A 3ZS9A 4HQRA 1J25A 3G3EA 4CEIA 1X8LA 1OY1A 2M2IA 3LVBA 1RIFA 4W6ZA 4O1IA 4XDZA 1KFDA 1YV9A 3KOOA 2LDXA 5EWLB 4O4HF 1TCCA 5CK5A 4CMBA 1ZK3A 3RBDA 2IX9A 1G8AA 2JGKA 4RU9A 1TVKB 4HXFB 1OLXA 1VLMA 3NI2A 2WV9A 5F52A 3ZIAD 1Z2CA 3IODA 3IR5A 4GF5A 1U8XX 1ZN9A 3KYBA 3T52A 3WGJA 2XGJA 4I2CA 3G7SA 2OWDA 1YZ6A 3FDFA 1R10A 4JYBA 1ESZA 4HNTA 5DCLA 1GAEO 3QIVA 4OHYA 2BZ0A 5DBCA 5THQA 5MF6A 3DXYA 3SDSA 3O5AA 1FW6A 1Q7EA 1JIUA 2VXYA 1DIBA 3MXOA 4KLEA 5DNWA 5A62A 3O8QA 4UHFA 3O91A 4FYYA 3AI3A 2NT4A 4J2TA 4NZNA 4WXYB 4EJSC 4YJHB 4N8EA 4YGXB 2XQIA 5C7YA 3OSPA 1NGSA 3U7IA 1USVA 3T4EA 1H6BA 2H4FA 4NOLA 4DLWA 4ENRA 4DCNA 1W0KD 2YBDA 2M9MA 1S3SA 1DQNA 2HGZA 5JRTA 2BGWA 3U5TA 1IHOA 2F90A 1HR0B 3DVRX 1GCAA 2J8ZA 4ZKEA 2FLVA 2MINB 1DADA 4MJ7A 1KKLA 1Z5ZA 3GDOA 1WKVA 3IDSA 1V8PA 4TMWA 2Q7OE 1GZHB 4JLSA 3TZLA 3W5DA 3ITKA 2Y6UA 4RHXA 3CRW1 3UKJA 4M1TA 4W6QA 3E9DA 4DDUA 5KAFU 1FTGA 4LIPD 2OBNA 2EEPA 1BMFD 1KRXA 3MERA 1INLA 4QNMA 2XCAA 3D0OA 1BW9B 1P1FA 2BBSA 2JF0A 5HKAA 3AGQA 3F7TA 1B3RA 2H9AA 3ECSA 4ZHQF 2V55B 1Y80A 4P53A 3HYTA 2FSSA 1IQUA 1WXHA 5KT5A 4B8WA 4I28A 5E79U 4D56A 3FPGA 5B1DA 1G3IA 2PO7A 3K71B 3V7LA 1MB4A 2G76A 3LYHA 4LBYA 2WKSA 3GRRA 1NY6A 5JXWA 3TBFA 3HPQA 3STUA 1XRRA 4JLDA 4CIVA 5K8IA 3O0DA 5DCWA 4YJ3F 2GYYA 2PUBA 3FNFA 3TIVA 2WY2D 1VJ1A 1X80B 4OYYA 3B6IA 5F2OA 2NO7A 1S0NA 1OVMA 5ALQA 3FZNA 4F5ZA 2OG2A 3OE7D 3WDSA 1P5ZB 2ADOA 6ABPA 2O5CA 5KNDD 2EDAA 2BUBA 1UMDA 1ZVJA 4QHYA 2I4OA 3R7BA 3L1UA 3EW9A 4QZHA 4I5EA 3OZEA 3W5BA 2ZBVA 3HKZC 4EI8A 2JH3A 4DLBA 1QK5A 3CLRC 4PU0A 3VR5H 1HWYA 3BJMA 2O8FB 4MEXA 5U1PA 2PRKA 3HNOA 1BPDA 4Q7JB 5JV5A 2B2CA 3T9BA 1R16A 4XOIA 1WXGA 3RB6A 4D8VA 3R9XA 3C3MA 4QTXA 2OAGA 4FSHA 2VTDA 2P7HA 1AQYA 4BASA 1U80A 2XECA 5C8ZA 4RACA 2W6MA 3SIRA 1QHFA 5SZJA 3TO5A 1UJMA 3T3PB 2VJNA 4KO4S 4HVLA 2ZBQA 1ZUNA 4QARA 1YOBA 3NANA 1H5UA 4LI0A 2QYSA 2VH1A 1E77A 3FDJA 3NHRA 4NJEA 2ZSHA 3LO5A 1FP4A 4HP8A 1H6DA 3JYPA 1D2GA 1Q7GA 3VU9B 4L0QA 4QTTB 3BMOA 4RQ1A 1R18A 3VPHA 3K1JA 4QNRA 1K4MA 3HEAA 4BGDA 1RZRD 1ZOIA 3WY9A 4M9XA 4X1IB 4KLFA 1QQTA 4JQCA 5CJJA 5K8CA 3I3OA 4D9GA 4CFYA 2ZYHA 3GLFB 2YY6A 3RI3A 3WYNA 1H2ZA 1X86B 2O50A 4KLAA 4C4SA 3T0FA 1SL0A 2X41A 4EHIA 4BLSA 3RYFA 1AQNA 5HRAA 2W2VA 2Y1EA 4WZBB 2ALZA 2X86A 2E1EA 1U5AA 1IQRA 4AF6A 1I4EB 3K0CC 4WZ6A 3P5BA 5JCOA 4P36A 4Q45A 5KFMA 1SCIA 1YQGA 2NWQA 3UMYA 4JJ7A 3IT0A 4QYTA 5TS3A 2DETA 4RAOA 1QQBA 1IIBA 3DEIA 1NKBA 4YNBA 4HDRB 5HIAA 3JZIA 2P9HA 2TS1A 1PEKE 1P2SA 2XWBF 1OT3A 4KWHA 1U3VA 1FUYB 3CC8A 3LBFA 4PLTA 3W06A 4TMZA 4NOJA 4TTSA 5FQNA 1KO8A 2FN9A 4NBNA 3DJFA 4F1KA 4G0MA 3DOUA 1FDRA 4XWKA 2HMUA 1CNFA 5DH9A 5JANA 2P5SA 3PSAA 4P0TA 3VZQA 5KYWB 2WSYB 5BO5A 3Q1LA 3KZ1E 3JASB 4B7XA 1RBMA 4E33A 2KIWA 1ZQFA 3V8RA 4C1BA 1QIKA 4AB1A 1R8JA 3QM1A 3P2YA 3RVSA 2HHHB 1KW4A 3PQ8A 4BIMA 1K4YA 1LK5A 5DHQA 4O3PA 4E4YA 1Q0TA 1W6RA 2MSWA 1X6IA 3A1CA 4RMHA 3DUWA 421PA 3QWHA 3O9VA 1BFDA 1ZC3A 3ZEAA 4BNXA 4O4JA 4D92A 5I9NA 4LHEA 1AG9A 3WZ2A 4CN9A 3ANLA 3VC3A 5M7EA 1QK3A 3OJ0A 1S96A 4GHWA 4YCBA 3HCOA 4QRDA 4Z4CA 1REQB 4G5GA 3E7WA 3L7KA 1U8FO 5GTHU 1TK2A 4YAJA 3G49A 3PCRB 1QF9A 2ZCVA 5LBIA 3QEBZ 3L93A 1NW4A 1F44A 4FBLA 1G8SA 2R6FA 5AI0A 3LWLA 1M8JA 2YX8A 4IMIB 1OWMA 3KOUA 5DI3B 4MINA 4UTZA 2A9RA 3DEZA 5B66U 3AI2A 4AYTA 1QRAA 1SUIA 4PHHA 3N53A 1EVJA 4UEJA 1AXEA 1QFYA 3N75A 2IYNA 2Y0SF 3C43A 3NBAA 4ZALA 4HX2A 2BCUA 4NNOA 5TT1A 1KDOA 4BL5A 2NU7A 4BQEA 4XYMA 4JUDX 1DAHA 1W88A 2WP0A 2P9QA 3BKXA 3ZHQA 1NULA 3KPYA 4O25A 1RZ3A 1E3WB 2OGTA 4MEBA 4LVNA 3O82A 2QAGA 7ICRA 1FOEB 2GAIA 4R69A 3W3AA 1ONPA 1C7YA 1UDAA 1ND6A 2BRUA 1H38A 3HZHA 3ZCSA 2C4UA 2N46A 3AKDA 3MUOA 3ETGA 2H1OA 2ZSIA 1F2VA 3CW9A 2R4TA 4L4XA 4KSYA 3MWDA 1K8XB 3FCXA 3KQKA 5EFZA 1NV9A 1I7DA 4E6EA 3OGUA 3ABRB 4DCMA 2FOXA 4CQMB 5TF4A 5AW9A 1YJ8A 2O5VA 4CR7A 3BTOA 3LM8A 3MIIA 2ZKIA 3PW4A 2G9NA 5EKTA 1ZIXA 3GR6A 2KW5A 3THRA 1AS3A 2Y77A 2KICA 2OHGA 3TUZC 4K9QA 2PIDA 5DYYA 4NYIQ 3UXHA 3AFHA 3PZBA 4DMFA 3Q2IA 4Q1EA 4MVXA 1QS0A 1D2MA 5LMNB 4QLOA 3OSNA 3SE0A 2PS9A 3FBGA 3DAOA 4FOPA 4DEVA 2JASA 3LPMA 5J5VA 4QHTA 2CV1A 2J9YB 3ITNA 2AKAB 4F4HA 3QKRA 3JQ8A 3AHFA 1D9XA 1M5TA 4KR9A 4LF4B 5AI6A 1ZIYA 4KEAA 3DE1X 1NXVA 2BKXA 3QV1A 4IYRA 2GK3A 2FXIA 4P6VF 2EG5A 5DM1A 3RHTA 1QB8A 4KH1A 5AM2A 1KEWA 2HLNA 3UCXA 3MCTA 5EZ6B 1ZIOA 5CHGA 1JLLB 2F1KA 2FPRA 1NAIA 2WHPA 5M3BA 1WZNA 4RJJA 4ZZIA 8AT1A 2Z6UA 1C7JA 3SZGA 2DLNA 4LXXA 1Y3DE 3IAS1 2VIXA 1QO9A 3M6WA 3L77A 4QNLA 1LLUA 3IOMA 5TZVA 1S8AA 1BG6A 2M1XA 2VRCD 3QEJA 4B9UA 2HREA 4W7IA 2QZSA 4IVRA 4Z1MA 3M6FA 3TRIA 3ZV3A 3NKLA 4EA8A 2X3YA 1ZQZA 5EN4A 1SG0A 5IKPA 1VKRA 2XUOA 1YZQA 5K0EA 2I3GA 3AP2A 1XDSA 1SU7A 1GT91 1T0UA 4CM9A 1QYCA 4B6SA 4HTFB 3OM0A 4YLYA 3B89A 4MUYA 1Z0AA 2V96A 1WHSA 3R3HA 4J0DA 1I9GA 2YC4C 4RM2A 1Y1KE 3RAFC 2PZFA 3LHIA 3EGOA 3SZOA 1TIBA 3C4QA 3MQFA 4IF6A 1PJLA 1XZIA 4Q4AA 3H7AA 3TIGA 2PZKA 4R2KA 3RFVA 4P32A 2D2EA 3OQIB 2PAAA 1VBKA 3EULA 2SKDA 3PPIA 4ERXA 4BP9A 2JD1A 2A1JA 2H2FA 4DQUA 2UZ0A 3I3SR 4EHKA 2B7LA 4E11A 4YP5A 3G59A 2JFFA 3TFOA 2WVGA 4R8UB 5IIKA 4D98A 2XVZA 1GTL1 4U9HS 3JTEA 3TCXB 5FUBA 1VE3A 1RKVA 4NU6A 1GZUA 3UGTA 4RVOA 1G21A 2IUYA 3X1ZA 1Q1ZA 1HH4A 1MN6A 3RD5A 1GG2A 2PVCA 1NAHA 1ZSYA 1U3CA 1JFFB 1R0XA 1JDPA 3DDHA 1M34E 3HSKA 5BWBA 1I1NA 3I61A 4CZ2A 2IMWP 1HMYA 4Z0PA 2FZEA 4UXJA 4HZIA 3GQVA 4DR1B 1I3OA 5JR3A 5C34B 3CUKA 3H75A 3MTQA 4QJBA 3CRQA 1WMFA 1KEUA 4Y6PA 1XMJA 4QFCA 4LXGA 1TU3A 3GH1A 3DBRB 2VHWA 4BO1A 3WJ1A 4UW9A 3AL2A 3PI6A 2CCKA 2BELA 4ARSA 1VJGA 2XB8A 3SHWA 3ROGA 5EHZA 3GLTA 2EBFX 3EXHB 3LJKA 3L8CA 2XQJA 1P0PA 2MYTA 4ZK6A 1NUPA 5H80A 1A1SA 3IIEA 9ICWA 3NBKA 4PO3X 3KZNA 4RZIA 5CA0B 2E82A 3BSWA 4DSIA 1ACJA 1ORWA 1M2GA 3OSUA 2BEJA 3U1VA 2VKTA 2P0EA 3GZ4A 3HABA 1Y63A 1UJ5A 1WKBA 2YIVX 1IEQA 2GZ1A 3U62A 5BWNA 3G2MA 4HCJA 1EWYA 2VJLA 4O6VA 1AH2A 4R2IA 2W7OA 3LBYA 3CM0A 4F5OA 3OZWA 3IVAA 3DBVO 3MELA 3ZDYB 3LUCA 2FZGA 4D0RA 2ZIWA 3SC4A 3GA7A 1HLDA 5IZCC 4EVSA 1L5NA 4E3ZA 1P0FA 2QAJA 5B57C 4CM7A 2Q5FA 5GZ1A 1YHZA 4Q1FA 4RMIA 3VR3A 3ETEA 2FJPA 4I4TB 4LY6A 4OBBA 4F4IA 1JU4A 1YUBA 3PR4A 1FYXA 4ALKA 4GX1A 3SX2A 1J8MF 4NFLA 4V1CB 2NQ2C 2AQ8A 5HDBB 1IU9A 3AUYA 4R16A 1GDDA 4E1VA 4EPVA 3W9YA 5KYXB 2R79A 5T67A 2C4VA 1DFGA 1DJLA 2PBLA 1FS5A 3WRXC 5BN5A 4MR7B 1TJ3A 3G0DA 1YR9A 3HK2A 3NVYA 4A26A 3A28A 3B8EA 3JD2A 5DT9A 2GR9A 4C8KA 4IOMA 3C48A 3PHLA 4CT4B 3AL3A 2ODAA 4BWYA 2QF7A 3B60A 2EYUA 3GPCA 3EUFA 8ICPA 1FRQA 1W8DA 1LC3A 3ODGA 5KZMB 5F9NA 4V0NA 1N34B 1IY2A 1SBHA 1UBLS 1TGVA 1FNBA 3QEOA 1DAMA 4YP1A 4ND5A 5J47A 3D7NA 4PG6A 2RQ5A 3A6PC 4P2HA 3JW8A 2V3WA 4G1VA 4JL5A 2HK9A 1M0SA 3QEMA 2OCAA 1T2FA 4MQMA 1IBCA 2O8BA 1FIUA 1ZQMA 4RZXA 3PFFA 2CFSA 3EF0A 3ZZ1A 3KZCA 4NY1A 3FUXA 3SHTA 4TVBA 2XSZD 2R62A 5AJHA 3LDHA 2ZUUA 4MS4B 2PZAA 4K3UA 3E82A 3IHTA 4I2JA 1KTIA 1PS0A 5B58T 2Z1DA 3AU2A 1MD9A 1WB9A 4QWBA 1O0BA 5CA1F 1QYWA 2JLAA 3PD0A 3QVGB 3AVYA 3ENWA 3OFNA 1RCUA 1NSYA 3R2JA 4MR9A 5CUQA 4K9PA 4RUKA 5JYDA 3UJHA 1KJQA 5KSPA 3U3XA 3GEBA 5JD4A 3IQXA 5CW2A 4CDNA 4DQDA 5F1YA 3U61B 1K68A 3Q3CA 1QE5A 4H31A 1NX9A 2KN7A 4H7PA 4PGMA 2CFRA 3CRRA 4FDMA 4LKOA 4WAUA 2I3DA 5C8DA 3DLPX 4ZRNA 1HURA 2R00A 5JQGA 3T61A 1NJZA 4IICA 3RGWS 1XPJA 4C07A 1R0LA 3UF0A 3SDZA 5EJ8A 4I1OA 4LQCA 5BYJA 3ZGLA 3H0RB 4Z4EA 5K0NA 4U5QA 3DZJA 4I1PA 3TMYA 4M4SA 8ICZA 1ZRNA 3BQ1A 3I9V1 2H0AA 2JLWA 5E2IA 1EP1B 1XX6A 7ABPA 3OPXA 3SAHA 4B7UA 3HJEA 2GEJA 3HJAA 3YASA 2A1TS 1Z4QA 1FNNA 4KC0A 1E1QA 3EGIA 3EC2A 2FEXA 5JRZA 1T2CA 1XU4A 2R1UA 3RTDA 3Q7PA 1FFYA 4WW0A 2R8GA 5JNSA 4QVGA 3JPRA 1WF6A 5P21A 4PAQA 2GX6A 3RBVA 3PDHA 1Z0IA 3EFBA 1Q74A 4V0SA 3U31A 1Z00B 2M98A 4X8MA 5AI5A 1A50B 2CHEA 2PMBA 4JP2A 3PQEA 4AS2A 5CH8A 5C4MA 1TV9A 3QHAA 4YMHA 1KDPA 2WWWA 3G2IA 5DHPA 4PINA 2OWEA 1VHLA 4MR8B 3MRTA 2ESEA 3VKGA 4F97A 4TRJA 4MGKR 1DS6A 3A6FA 4PZEA 3PF9A 2JAOA 3H2GA 4QRHA 1R2QA 2VXBA 4BN5A 3I42A 5EKDA 1E1CA 4N7BA 4EB0A 2A4KA 2Z8YM 3DFUA 5A3QA 4HUTA 3QLUA 2EL9A 3RJ5A 3DYIA 4DT1A 1BE6A 3AW8A 3JQAA 4AULA 4I3HA 2LM1A 5HMMA 5HZHA 4LDAA 2W70A 3R7LA 3R6WA 1JPNA 5CB6A 1E2UA 2CD9A 1O94C 2R8RA 3GZNB 4OH7A 1RHKA 2J09A 1PZEA 2HHAA 4DDTA 3ZV4A 3PLAE 1GPH1 4F38A 3G8DA 3MWEB 3VI4B 1WCV1 1UDXA 3UQZA 4QDKA 4Q9HA 3TUIC 3A6KA 1QG2A 3AESA 4IFTA 1YS9A 2I78A 4CL2A 1JPJA 6YASA 3U48A 1Q0PA 2O8NA 4US2R 1G41A 2GKSA 3G8AA 1WQ4A 4ZC8A 3ZOZA 1T6BY 1H5QA 2DHEA 1YZ7A 4EL0A 3JWJA 3STHA 3ZKWA 1Z08A 3E84A 4DCJA 3TSWA 3I12A 4LNAA 4YCDA 1U1CA 3V4FA 2ODGA 1CUIA 1VBMA 2WYUA 5LKRA 4CCYB 1M1ZA 3WTBA 4EO9A 3E58A 3RJHA 1A4RA 4EG0A 5JO0A 4D4MA 3UFXB 3VOBA 1RYDA 4HD8A 5ALDA 4B44A 1GEEA 2PRIA 2Q4TA 5SV2A 2H1CA 3T4XA 3WO0A 1UQTA 3J7TA 2MDTA 4I2BA 2GQ0A 3C3EA 1SKWA 2F8SA 4KVAA 4F93B 4K05A 2W71A 4DOBA 4UDNA 4CUJA 2VI5A 4X3OA 2HSJA 3DCIA 2Y9MB 5CTAA 4W8HA 3QRWA 4TVKA 1V16A 4ZO7A 5JSYA 2WMOB 2QI9C 1MPXA 1BCRB 4J0IA