1Z4OA

Structure of beta-phosphoglucomutase with inhibitor bound alpha-galactose 1-phosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
220
structure length
219
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical Confirmation of a Pentavalent Phosphorane in Complex with beta-Phosphoglucomutase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords Beta-phosphoglucomutase
total genus 78
structure length 219
sequence length 220
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2005-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 1z4oA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 1z4oA01
3RFUA 4C4RA 3NRJA 3MC1A 2C9MA 5AW3A 1ZJJA 1RKQA 3N8GA 5ALFA 1T5TA 3N07A 3N1UA 3WGUA 4IG4A 2I6XA 5AKEA 4UARA 5ALIA 1TJ4A 2EATA 4UU0A 4UW9A 1ZD3A 3QGMA 3AR9A 4AS3A 3MMZA 3OPXA 2YBDA 2WF5A 4QQFA 3ZVMA 3L0YA 5AVVA 2FDRA 3N5KA 2HO4A 3W5AA 3RF6A 2IA5A 3L0BA 2GO7A 3SD7A 4EEKA 1O03A 4DW8A 1L7PA 1EK2A 3U7GA 3UM9A 2I55A 4Y2PA 1S8OA 2YMQA 5A3QA 3WKDA 5AI9A 2WM8A 3CNHA 5ALRA 5IS2A 4RETA 4JB3A 1T9ZA 1L7OA 5AVQA 1J8DA 4F72A 4HGNA 4XPZA 5AM3A 4Y2RA 4Y2VA 2FPSA 1FEZA 4YCNA 3PGLA 4Y2YA 5AVZA 3FM9A 3AR8A 5ALOA 3QU5A 3M9LA 4BX0A 2C4NA 4BKMA 3A1CA 3OCYA 3QUTA 4C4TA 1LTQA 2AUTA 3L0CA 5AKZA 2YFYA 4YGYA 5AIBA 3E8MA 3SHQA 3WKAA 2WF9A 4EELA 2FUCA 3DNPA 3FPSA 3AR7A 1YS9A 1QQ5A 5AKLA 5AK5A 2DQSA 2G07A 3ET5A 3QU4A 3NIWA 2HI0A 5A3RA 5AVXA 4RESA 1RLTA 2WHEA 3E84A 4UM7A 3F9RA 3QU7A 2EARA 2ZOSA 3FGOA 5ALKA 1ZS9A 3U26A 4B6JA 2IOHA 5AM4A 4HGPA 3I76A 4GIBA 3EF1A 3WK4A 5AKGA 5ALVA 1WZCA 3I6BA 4UMEA 3GYGA 1YJ5A 4MWOA 2WF8A 3OCZA 2BY4A 1ZD4A 4DWOA 5AW5A 1ZD2P 1KYTA 2YJ4A 4Y2UA 4BX3A 2G0AA 3QUBA 3ZW7A 3N28A 3WGVA 4E88A 4HAIA 4UM5A 3QU2A 4NWIA 5ALPA 5ALYA 2PR7A 3OCUA 4F71A 1Z4JA 1RKUA 2FI1A 2FUEA 3L8EA 4EZEA 2EAUA 1EK1A 3SF0A 5ALLA 3PGVA 5AKJA 5AK4A 4OFZA 1CR6A 5ALDA 4CNQA 2RB5A 4BNDB 5AM1A 3AR6A 1WR8A 5AW4A 3WK5A 5AK3A 3ZX5A 4KYTA 4EX6A 2OBBA 4ZEVA 2ZBGA 5ALJA 5ALXA 3U7FB 3QUQA 2YY6A 3SKYA 3M1YA 1ZOLA 4FE3A 5ALUA 3WK7A 1TJ5A 3ESQA 1NRWA 5AI6A 2W4MA 5AKIA 5ALGA 1U02A 3QXGA 5AKXA 2R8ZA 3KD3A 2HCFA 3L8GA 4NV0A 3K1ZA 2JAOA 5AK6A 3A1DA 3KZXA 3EWIA 1Q91A 3WKBA 2YJ6A 4DCCA 4CE6A 2CFRA 2JAUA 5AVRA 3E81A 4G63A 4Y3UA 2PKEA 2AGVA 3WKEA 5AKHA 3OCXA 2G06A 3L5KA 5AW9A 4HYTA 4XOUA 3S6JA 1U2SA 2HF2A 1YMQA 2HEGA 4KX5A 3R09A 3IB6A 3L1VA 2B0CA 4AP9A 3OTQA 2FPWA 2HDOA 4BBJA 2B8JA 3DV9A 4UAVA 2HOQA 5AI0A 3ZWDA 4BYGA 2OA0A 5AIAA 1RQLA 1CQZA 2Q5EA 3L7YA 3HLTA 2WF6A 3KDPA 3OCVA 2BDUA 2JAWA 5AESA 1ZRNA 1NNLA 5AW7A 3L8HA 3A3YA 2ZXEA 1XP5A 2C8KA 2C8LA 5AI8A 3NALA 4BEWA 2MSNA 2YMLA 2CFSA 3L1UA 4YIKA 1RRCA 2FPUA 2I34A 2VKQA 2R8XA 4EENA 3B9RA 4UU1A 4Y2QA 3AR3A 1L8OA 1SWWA 4YCLA 4HGQA 4QJBA 1QQ7A 2ZBFA 4GXTA 3U7EB 1Z4IA 1YV9A 4CF3A 4KNVA 2O9JA 2NO5A 3ZU6A 3L8FA 4DFDA 5A3SA 2FEAA 1L6RA 2O2XA 3W5CA 3NASA 2OM6A 2I7DA 5T41A 5AI5A 1IWOA 2QYHA 1X42A 1Z5GA 3PDWA 1TA0A 3QX7A 4Y2XA 5ALQA 4ZEWA 1QH9A 1QYIA 1RLOA 4KNWA 1Z5UA 4UATA 3UMBA 4BNDA 2ZG6A 5JJBA 3I1YA 2B30A 4I9GA 1LVHA 2AH5A 4O8CA 5AW1A 4Y2SA 5FP0A 1VJRA 4L6CA 2RBKA 3MN1A 3D6JA 1SWVA 2WFAA 3PCTA 2I54A 2P27A 3R4CA 1WVIA 3NAMA 3BWVA 3EPRA 1K1EA 1Z4MA 2YMPA 2RARA 3NANA 2W43A 2CFTA 5ALSA 3ET4A 5AW0A 3DAOA 4NFLA 3SLRA 2ZBDA 3UMCA 1N9KA 2AMYA 3E58A 5AKKA 4I9FA 1Z4LA 5AKYA 4CF5A 1F5SA 4IFTA 5ALHA 2YJ3A 3QUCA 5AM0A 3IJ5A 1Z4PX 1U7PA 2B1RA 4UMDA 3QYPA 1RMTA 3CZ4A 2GHTA 2I33A 3W5BA 3EF0A 4XE5A 5ALWA 5AM2A 3ONNA 1RC8A 4J2TA 2IOFA 3AR2A 1RDFA 4H1WA 3AR5A 2CN1A 3BA6A 3ZUPA 4BEVA 3SMVA 3QU9A 3ZTWA 3TLMA 3W5DA 4PNHA 3IRUA 4Y2TA 1YNSA 2P69A 3ZTYA 2JARA 1TE2A 3P96A 3OCWA 4J03A 3ZWKA 1Z4KA 2G09A 4G9BA 3AR4A 3U19A 5AI4A 2QLTA 2GHQA 2P11A 1RLMA 3U13A 4HGOA 3SKXA 4OHFA 1Z88A 3A1EA 1RMYA 1ZD5A 5ALZA 2X4DA 5AVYA 3QNMA 2HX1A 1JUDA 1L8LA 4NAVA 2HHLA 2GMWA 4KN8A 1RMQA 4ZEXA 2G08A 2ZBEA 4OCZA 5AVUA 2YN4A 1U2TA 4C4SA 4UASA 5ALNA 3MPOA 4L6AA 4L57A 5ALMA 5AW8A 1ZRMA 1SU4A 2Q4TA 3WK9A 3WKCA 2JGAA 5E0OA 2ODAA 2Q4RA 3KOOA 1QQ6A 3WK8A 2B1QA 3KC2A 5IT4A 5AHXA 3QLEA 4UAUA 2GFHA 4FYPA 4UMFA 4CF4A 5IT0A 2G1AA 2C88A 3FPBA 1WPGA 2YMMA 3ZX4A 1Z4QA 3UMGA 1U7OA 1VJ5A 2R8YA 5ALTA 1MH9A 2IOFK 2P9JA 2PQ0A 1NF2A 4OD0A 5AVTA 2B8EA 1XPJA 2R8EA 1J97A 3FZQA 5AW2A 4UMVA 1RPZA 1RQNA 1L7MA 1PW5A 1Y8AA 1O08A 2WF7A 2MU2A 5AVSA 4BX2A 1VFPA 1YDFA 2HSZA 3KBBA 4MUMA 1Z4NA 1RKVA 1Q92A 4NABA 5AICA 2NYVA 3ED5A 1S2OA 1T5SA 2HF7A 3NUQA 3U7HB 4FFDA 3J7TA 4YH1A 3I28A 3B9BA 3VAYA 4Y2JA 2W11A 4JDPA 4YIHA 3R9KA 2D2VA 4HGRA 1XVIA 2FPXA 1Z4OA 2IYEA 4AS2A 2OYCA 3HYCA 2NO4A 2G80A 3B8EA 5AW6A 5AM5A 3FVVA 4KX3A 1L7NA 2FPRA 3DDHA 2RAVA 3WK6A 1TJ3A 4YCMA 1AQ6A 4EX7A 1N8NA 2B82A 3ESRA 5AVWA 2BDEA 2YJ5A 3ZVNA 5ALEA 4XQ0A 3ZVLA 3ZI4A 2MU1A
chains in the Genus database with same CATH superfamily
3LDUA 5F4ZA 3WBFA 1ONNA 2UVQA 3PPVA 4RQBA 1GT91 4LISA 3JR3A 4X64B 3GZJA 1YIOA 3ZGYA 3ER9A 1DOHA 4QFMA 4YJ3F 5IVIA 4ZJYA 1F2VA 1ZOOA 1XTZA 2FPIA 2R47A 4MP3A 2HBKA 4JR0A 4XFKA 2MSLA 1K6JA 3UFXA 1QRTA 1O3YA 2R6DA 1LPMA 3VYUB 1M2WA 5B2ZA 1VOTA 4OJQA 1HNWB 2AVDA 1J24A 1P77A 4N8SA 3P1JA 4FCWA 3KIPA 1A7KA 3IQHX 3BGOS 1SOWA 2JJYA 4G6ZA 2EEPA 4KFUA 2R4UA 3S1LA 3BMQA 3NI2A 3GDFA 2HO4A 3FNGA 3X2SA 4CDNA 3U4QA 1SOUA 2JFVA 3CLSC 3E35A 3K9CA 4TOIA 5LYJB 1WB5A 4RQMA 4UAJA 2F67A 1P3Y1 2HPHA 2JLAA 4W7IA 1EK2A 4NM2A 1MDFA 1RYZA 2FE1A 3O3OB 2I55A 1XMIA 3ZQKA 4AQ7A 2QU7A 2ZRQA 4FOPA 4G0WA 3WKDA 1T8UA 2GFIA 2YYYA 3R3HA 5CFZA 2J8ZA 3IM1A 1K7CA 1I33A 4F92B 3E15A 2XSZD 5G4LA 1BROA 4UDOA 3Q9LA 3RC8A 1PEAA 2ZT7A 3PB3A 1LTKA 4XPZA 4I4TB 3S7TA 5LDDC 4ESOA 4WADA 5CB4B 5IZCC 4NXMB 4KVGA 2WYUA 1L3BA 4C2UA 1FLVA 2M6LA 2A88A 4BO8A 2UVVA 3WLTA 5LWHA 1ZQLA 1ZD8A 4QTTB 3MJRA 5A9SA 1N7GA 5BR1A 3ICPA 2E4VA 4G8CA 1NBHA 4QRDA 2ISQA 2GM4A 1PJ2A 1JDBB 1MF7A 3TZ6A 4DL5A 3NV7A 3NXKA 5A7FA 1E1RD 2ERYA 3RQIA 4DZTA 5J2TA 3BGDA 5JXWA 1ZONA 4C08A 4BXOA 4QSHA 3LIIA 1OLXB 2REOA 4BVAA 5KNBA 2Q3BA 4KO2S 5FXMA 3H18A 3DE3X 2GZ2A 2EERA 2HBRA 3H4IA 5F78A 1VPEA 2ANBA 3AIMA 1KRPA 3VUFA 1ETUA 3RC2A 4E6PA 1ZM3A 5A4KA 3ITEA 3KWJA 4FXPA 4JLPA 3T12A 4YUZA 2JL1A 2PRIA 2Q3FA 3NHFA 5TT0A 1IJBA 2C7RA 1UM9B 2ZYAA 1UBGA 3O2NA 4PRZA 4XDZA 3WIBA 4WXMA 4F4UA 5A3RA 5C1DA 1V45E 4RESA 1XZDA 2NTNA 5AVXA 3UEOA 2VJMA 3SFZA 3N6VA 4XRHA 2M0NA 5L9XA 4OXRA 1JLRA 3AKCA 1XNSA 5HS6A 2IPMA 4M1MA 5E1DA 3QPVA 2CMFA 4L6IA 2VIIA 2C8JA 4ZQGA 4JC4A 1BFUA 1QE3A 2ZREA 5E0KB 5IW8A 1H3EA 1XRPA 4ZN6A 1XC9A 5ALVA 1AQYA 3TOCA 1GO3F 2HJVA 4ZIRA 3TG8A 4R81A 1JQEA 2JFQA 2AMJA 4F3OA 4RQNA 4B73A 3HVUA 3HJCA 3MIIA 4EB0A 3C45A 4F6RB 2QJFA 4W7SA 5AHKA 3HBNA 1Z0KA 1DPFA 5FEUA 3EA5A 2OZLA 2XNDA 3ZW7A 3NT5A 1HM5A 3GA7A 3VR4H 1M2FA 1RYHA 3ENWA 2A57A 3D4NA 3LVFO 1C3OB 2IUSA 2A9RA 2BFCB 2MHCA 1KJIA 2VDLB 4A2CA 1RKUA 1D1TA 1Z0AA 3OPYB 3WIEA 5KNDD 3V8EA 2ZYSA 3TG2A 1JTEA 3W1EA 3BZBA 8ATCA 4LFAB 1V8FA 3I2GA 4L4SA 3DOOA 1PDWA 4MVXA 5B55A 2QD1A 2X76A 2WOJA 3G17A 2A2ZA 3INTA 3IQIX 1DBPA 3A4IA 2UVPB 4OFZA 1W94A 1Y3DE 2H0AA 4C6SA 4Z2YA 1PR9A 3A0RB 1JE0A 3WK5A 3Q15C 5ARDA 3DTVB 5BMVB 3MYRA 4JB8A 3N7PD 4DANA 4CTOA 2CE2X 3QLVC 4RVFA 3CUTA 2KICA 4CGZA 4LZLA 3KOMA 4Q24A 5FWYA 3DNMA 3OX2A 4EYGA 3OP4A 4KUEA 4D8YA 2EZYA 3GEHA 5C0YA 1L4EA 3VMMA 1BWSA 3ZHSA 4ES6A 5M3BA 5I51A 1ITZA 2WAAA 4XTRA 4ZZ1A 4WESA 1SPBS 2JXJA 1MHTA 5EFZA 1Y9DA 4L76A 4TQGA 4QZ8A 4FQ7A 1ISHA 3KETA 3ME5A 4OI2A 4C7MA 2BRUA 5CDFA 5AK6A 2ISCA 2ISSD 1IPHA 2GEJA 4POAA 3FI0A 4GOLD 4TYMA 3LRXA 4PHHA 4PLZA 1NY5A 3O73A 3L05A 4RFLA 5ARBA 1FDSA 5CCXA 1E3WA 4HLNA 3W4JA 3EVFA 1VFNA 3JD4A 2IIPA 2PZBA 2GH1A 1DWPA 4IV0A 2QLJA 3DVQX 1CZHA 9ICKA 1BVHA 4GBJA 2HEGA 4U9UA 5DN6D 4CQMB 4RDHA 3N6RA 2JHFA 1Y3CE 4L1KA 1LX6A 2ZAMA 3HRHA 1ZQFA 1BVUA 2FK8A 2H2FA 2FZ4A 1A2QA 4IJKA 4MGYR 4NPHA 1TK8A 4D3DA 1KEKA 4EY8A 4TYQA 4PFSA 1Z75A 4R3WA 4DL7A 4PYJA 5I3CA 3L07A 3MPUA 2OXCA 4M87A 3C2KA 1QHGA 1Y6JA 3AGPA 3CUYA 5K0LA 1CEQA 2HQSA 2EKLA 4NZMA 1EGVB 5CFNA 5A9RA 1MT3A 1SVKA 2C42A 3WNDA 1P7ZA 2G67A 2I4IA 2X41A 2FEMA 3IP9A 4US0R 2ERCA 2AEFA 2Q5EA 4JENA 4FFLA 2VLIA 1DMSA 1OF1A 2IYFA 3OO1A 4QVIA 3HR7A 2EJWA 3RYIA 5E3JA 3K0FA 2JDIA 3IA2A 1AC5A 3HXLA 3G8AA 3LAWA 5DWDA 4AROA 3E27A 1N62A 2AK2A 2R7NA 4JBXA 2ZJ4A 1V1RB 2CXOA 2I0FA 4H59A 3RK4A 3GCXA 3MGCA 1LPSA 2HNAA 4Q7QA 5B37A 4DSFA 1IIBA 1GRQA 3PPWA 4PSDA 5TVGA 3TF5A 1UDXA 4Z9AA 3EEOA 4YRLA 1VL0A 1V1JA 1RPAA 1G60A 2QT0A 1D09A 3N58A 2UDPA 1FPQA 4KMOB 1OKKA 3C3XA 3HVKA 3PUWA 2FPUA 1ADBA 3EXHA 3PNLA 3UHOA 4FZMA 4KQEA 2JZCA 1JX4A 1XKXA 2NPIA 2QJRA 2WTEA 3KJIA 2WJ3A 1NZFA 3BH7A 3M6AA 1BWQA 4MQLA 3TB4A 4CRXA 2H4JA 3BRQA 1FTQA 5KT4A 3EVNA 3FKJA 4JUFA 1O95A 2F8LA 5JRTA 2YIMA 4X95A 1WQ3A 5GQSA 1RYNA 2VXYA 5B7NA 3GLFA 4P0PA 4GMGA 5LMUB 3AIKA 4I5DA 1MR3F 2AU0A 2Z6VA 3H1GA 3EGWA 1C8LA 2QTTA 3CJQA 1G8JA 3L6BA 3NHLA 1JIJA 3GFPA 3QY0A 1KY5A 2FW1A 5IC5A 4NSNA 1MO5A 1V9CA 4OYHA 3DUFB 1KEEA 2W2OA 2WV9A 4EATA 1JAYA 2JHDA 5K3OA 1BDIA 2P3QA 3D7RA 3H2SA 2GVNA 3D5TA 5AUQA 4I5EA 2QB1A 1PZNA 3SV3A 4U2KA 2DWOA 4PHGA 3NS1A 3RTCA 5FNVA 2OHFA 5EWJB 2H9YA 5BR7A 4L4XA 4FFPA 3V1LA 3FZGA 2ZUTA 4BJ5A 4BX8A 1HDIA 3O4FA 1WU8A 3GNLA 1ZEJA 5DBOA 3C28A 3RR8A 3NH6A 2OLKA 1GPDG 4JLVA 1NJ8A 4I1PA 2CKMA 2CSUA 4FMCF 2QTVB 1RWMA 3EH1A 3AF6A 1XWWA 3EVDA 5HM6A 2IYRA 2H85A 1TKRA 2X0FA 8ICYA 4B7ZA 5TDHA 5JE8A 1GITA 2XTMA 2WIKA 3GQCA 1VJRA 1YQEA 1ZINA 3PHIA 2BW0A 2OHIA 2WK1A 2JVIA 1N8SA 3K5HA 1VJTA 4GLLA 4HZIA 4NCKA 2E6UX 4LZJA 3WYDA 1QF7A 4GL4A 1KKUA 1CUSA 1KEUA 1U11A 2AL7A 3ZY6A 5CA0A 1E9DA 3HP7A 2Q7XA 4R8MA 1Q0ZA 1WVIA 1ZIDA 1JJFA 4ICIA 4CW7A 2XJ4A 5K8LA 3VC2A 3IP1A 1T0IA 3UVEA 4B9VA 4HVCA 3O47A 5BVHB 1NJGA 2RGUA 3W9YA 5IX8A 1C3VA 1V11A 1AK2A 3ADKA 3IAUA 4JXKA 1P0MA 2IHMA 4K9PA 4YT2A 1PR0A 5KUTA 1X1TA 1L4YA 1RKXA 2GM9A 4U9HS 3GAFA 4LXYA 4UB5A 2ZJ6A 3DP7A 2PCJA 3IT1A 4A27A 2R5WA 3IVRA 1FMTA 2OHVA 3GOHA 5G53C 2R7MA 2A1JA 1IG0A 4WA8A 2UVPA 4AS1A 3EX7C 1SIBE 3U3KA 2WJWA 3IBYA 4OJKA 5DDIP 4M0KA 3KB8A 3QUCA 2VSYA 3QXCA 5ITSA 2Q3JA 4DR5B 3PQEA 1P4AA 3MS4A 1G0OA 1BYIA 1U65A 4MRMA 1WP4A 2XRFA 1QH1A 1BHJA 1I10A 2Z3ZA 3W0LB 3A1TA 3TQOA 4X7RA 3KUXA 1S5PA 3E2MA 2GTHA 4F60A 2XHEA 4V3CA 1NPTO 3D8UA 4HQ6A 4U7PB 1MENA 4ECWA 1IZ0A 1P0PA 2HREA 2YZNA 2VNIA 3GLTA 5AM2A 3DB2A 1XRNA 3KHRA 4O4LA 3EA0A 3P45A 2B5WA 4BCDA 1RWXA 2IOFA 1TEXA 4XWYA 1N9ZA 4A8EA 2JCSA 2RK4A 1OFUX 3QRWA 4V0NA 3AHDA 2ZJ8A 1G42A 3KXKA 3LFUA 4JCCA 4W1QA 2F6RA 1SBYA 3ZWYA 3PSFA 1NXQA 4N7JA 3RV4A 3U4IA 5EJ6A 4K26A 4ZI3A 4CMEC 4IPTA 4QGHA 3W5DA 2KOBA 2CJPA 2QVGA 3AUOA 1Y3FE 2ID7A 3P26A 5H0IA 2PGNA 2ON6A 2F3TA 4UBCA 1DKLA 5J2FA 2Q0XA 1OZAA 2X2FA 2C3PA 3CZRA 3ORFA 3UH0A 1R5JA 4YWJA 3VDXA 2AG0A 1Y5IA 2Z58A 1K5GA 4PYRA 1P7YA 3GA5A 3SNKA 5EUQB 3PQ7A 5CCDA 2P41A 3M9WA 3KX2A 4FSDA 4E5YA 5GV8A 2Y0SC 2A9KA 4M7WA 2B9VA 1NNUA 3QH4A 3TZHA 3SKXA 2NUPA 8ICTA 1WSWA 3FWYA 4JVSB 1SB3C 5EHIA 4ID3A 3GRZA 1B2LA 3PC3A 2DBRA 5JMTA 1UPTA 1O4WA 2EQAA 2QRZA 1YRYE 2I03A 4HZUA 4KPUB 4EB6A 3GFRA 3EXEB 2FRVA 3QBEA 1CZKA 4OIMA 1ZGGA 1CYDA 3O9ZA 4FONA 3B0YA 1UFKA 1U47A 1UKBA 2R00C 2E1EA 3VHXA 4CTMA 3RTGA 1BPXA 3TLXA 3A9TA 5E6UA 1OFUA 4H1HA 3A11A 4WA7A 4QOHA 4ZEXA 3GZNB 3K9BA 2JH1A 4PVDA 4B3FX 2A86A 3SYMA 1F4PA 4DS4A 3C24A 4ZEMA 3HILA 1S8AA 2IBTA 2JJMA 4L2IB 1QS0B 4M88A 3HN6A 5FTNA 1G3UA 4AQYB 1BXRA 4UASA 4D3XA 4QYIB 4GPBA 3MPOA 4QRIA 4CMIA 2W4IA 5ALMA 5AW8A 4E33A 2B61A 5KFEA 3V7KA 2Q4TA 1TFRA 2EDUA 1MAVA 2C2GA 2GHRA 3JAKB 4IVRA 3RWOA 3NJRA 4QSMA 3HGMA 3KOOA 3ISCA 4WUTA 3U6KA 4D9HA 4Z4EA 4BU1A 4J4BA 1SV0C 3H1EA 4Q1CA 1XL0A 1GAJA 2JJ2A 3ITDA 4JT8A 5I47A 3EG9B 1Z7GA 1WF3A 2IZZA 4V02A 1M2JA 4AWXA 1HLGA 3CBGA 3PRYA 1OHHD 4C6RA 4D92A 3PS9A 4DFKA 2HJWA 2XKKA 4D82A 1OWOA 4GYKA 2O8EB 5KNCD 3DOEA 4YB8A 5LQRA 1RPTA 3DAPA 4MJ3A 3ZWCA 2PQ0A 1OAAA 4OD0A 2PWPA 1N5RA 1SUSA 4IQ4A 3UQ2A 5CB1A 1EFPA 1NXXA 2WZDA 4JP3A 1BHQ1 1EX1A 1KJJA 2Z8YM 4UZSA 5AW2A 5BSHA 4RUKA 3BWYA 2NO9A 3FCEA 3RT9A 3N2KA 4NV3A 3USCS 4KR0A 5BW4A 4AUEA 3D4OA 4ZAZA 1HL7A 1Z6XA 1Y48E 4UTOA 4NF2A 4CTJA 4DR3B 1DFIA 1DUSA 2ONCA 3T7EA 1JX6A 4B8YA 2JFXA 5EXPA 3VJRA 4A8JC 1AUQA 1FFDA 2CBXA 4GLOA 1A50B 4O4HF 3F0TA 2OD2A 2ZU6A 1J0XO 3HLKA 4C14A 4D7AA 2BQ3A 2WHPB 1SXJD 2FW8A 4N8DA 3I28A 3USES 5MHTA 2AI2A 1A5SB 1UM9A 2E8NA 1AIPA 1I4WA 3FNFA 5EWMA 5TVKA 3TJMA 1G7CA 3QVUA 3WRVA 2B37A 3OJCA 4HK4A 2J32A 1YZVA 4RY0A 3LWDA 3JQEA 3R77A 2PWAA 5D85A 5CPFA 3ULKA 4FNAA 4N49A 3TAUA 5EE9A 2F2AB 2PMZC 1SKBA 3AVXA 1ZM7A 2HA6A 3JPWA 1INLA 4QDZA 3VAZA 4NL9A 2OCLA 2WJPA 3HJTA 5K3FA 3BXOA 1A7AA 1YRWA 2V8OA 3AWIA 4M9CA 5LCXA 4Q3KA 3TQCA 3I0ZA 4BFLA 1SG6A 2GCGA 3T4PA 4MDYA 4OQLA 2SBTA 1OWLA 3ZY2A 9ICWA 2YVQA 3DFUA 2C2YA 2RAVA 1ECLA 3BC1A 3JZAA 4IOMA 2GGSA 1PYDA 3OE7D 3TBKA 3M89A 5FOVA 3OUUA 4MWSA 2AA3A 1OIVA 4MV7A 1THTA 5AVWA 2IC5A 2Y9UA 4BNIA 3HRIA 1GGJA 3QHPA 3ZVNA 1QQAA 2W7PA 2IVZA 3IA7A 4J94A 1LNSA 3MNFA 3CS3A 1LSOA 3UGJA 2EFGA 1ZGCA 1T6ZA 4DLXA 1ZJZA 2BEUA 3OFVA 1B6TA 5BWLA 3N07A 1VRWA 2KVSA 2FKNA 3PKZA 1ZLXA 1T4GA 1M1XB 4H7FA 4KQ9A 4B4DA 3I5XA 3ITNA 3DMTC 4UU0A 3FR7A 4D56A 5G41A 3RTBA 1FFXB 3WI7A 4ZV9A 1NZBA 1CY7A 1OJ7A 1YB1A 2XMQA 2QL9A 3H7AA 1RM4A 4G1EB 3ZYCA 3ABRB 4B43A 5KX5F 1QC5A 3G85A 2P5YA 2PT6A 1H9BA 2NU8B 2CLFB 3N3AC 3K0AB 3IN5A 2SNIE 5K3AA 3VPFA 2AHOB 4MRAA 5FWNA 2FDRA 4V38A 2QVLA 3LLMA 4S0XA 1J2EA 1RLUA 2KIVA 2MINB 2X6QA 4ZQHA 3VUEA 1AROP 1KMIY 4QBKA 3U81A 4AYWA 1QCDA 4W9NC 5EYPA 1WW2A 3QPDA 2VT6A 3SJCA 5LOVB 1WS6A 3KQKA 4CKCB 3VKUA 5IT5A 2ZJOA 1B8OA 4RUAA 2O23A 3FPKA 5ERYA 3DMGA 4X65B 2D2XA 1GTZA 2CHFA 3R9XB 4P98A 2DG2A 5J43A 1D6SA 3AY0A 3I4CA 2ZB2A 5EIHA 1Z08A 5IJAA 4US1R 4JB3A 3ROPA 4E32A 2C9DA 3ESAA 4TKVB 3UJ8A 1G38A 1EQ2A 3CRQA 3R5SA 1Y1PA 1SA0B 1TVEA 3SF8A 4P6VF 4ARBA 1FEZA 1YL7A 4P4PA 4HDMB 2C77A 4NP6A 2G0TA 4DS3A 2H2DA 3RRHA 4O6VA 3TSZA 4DV2B 5LD2B 2HRCA 3VSAA 4KITB 1U1DA 1NDHA 3WZLA 1DRUA 5B4UA 5E4JA 4M86A 2H4HA 1L8QA 1GYRA 2JCVA 3Q6MA 4JJ4A 1EWQA 2CXRA 2QAGA 2QPOA 1HDZA 2HMUA 2YRXA 4DN6A 4QTYA 3SXUB 4ABTA 1CJUC 4MA5A 2VP4A 4PC7A 2Q45A 4PQFA 1JQAA 3JQGB 4TLLB 6Q21A 5KU7A 2Q4EA 5A9SB 4PL1A 5HF6A 2G9QA 3I42A 3ADBA 2YV1A 1O77A 4RY2A 1N7IA 4DCJA 2PR2A 4U6NA 3CH6A 2AYXA 3U3DA 5BMVA 2CHGA 5KYYB 2WB2A 5DG7A 2ZI7A 2PJRA 5CXXA 1FSZA 1YS9A 1AO3A 3FJ1A 2I6TA 4PCVA 4OHZA 1WBBA 5FD8A 3IPAA 5AK5A 4BNNA 3DAYA 2F00A 3GNTA 1W36C 4LBZA 5GVRA 1C7FA 2ZSIA 3I9V6 3FRHA 4M1YA 1W6UA 1T9HA 2RONA 1T9DA 3L0OA 5KTTA 2I5PO 3LYUA 1JXMA 4PG4A 1W44A 3HFJA 4O5AA 3ISTA 2JFWA 4EYSA 1JU9A 1J2NA 5FH9A 5THKA 1DXSA 1UIRA 2YHIA 1KJ9A 3JQFC 3OIWA 4Y6RA 1PK7A 2PL9A 3V8BA 5GGXA 5ALKA 1MJHA 3CC8A 1BEZA 4LV5B 4OVKA 5GMOA 3IIEA 1RT9A 3I76A 4GIBA 1A04A 2JKZA 3EF1A 2HHAA 4HNGA 3TD2A 3ES9A 4MMXB 1P2GA 4W5WA 1YJ5A 4L9WA 2PUWA 2WF8A 3O91A 3WGYA 2BPGA 2BY4A 2VJAA 3OZSA 4BLSA 3SSOA 1EXWA 1I2AA 4YRZA 2G1PA 3DZGA 4QGAA 5KFGA 2GPYA 3OEHA 3T1OA 3V1UA 1EK0A 2OVBA 2PVSA 2YJ4A 4M0MA 1KEZA 1E1QD 2VDPB 1R8YA 3SR0A 3UXYA 3AP2A 1S77D 5J5AA 2XQVA 3N28A 5HR5A 5JAZA 3BE8A 4PGHA 3UG7A 3AOEC 3LT5A 2EX1A 3H4TA 5A2GA 1CBUA 2CJYA 1JA1A 3IV6A 1H69A 2O0KA 3U31A 3L8EA 3GCZA 3DMHA 4QDOA 1NIJA 1ORWA 4NNOA 5FL3A 3ZZ1A 5J4LA 1YHYA 1IHUA 1TC2A 1E9VA 1BHSA 3OE7A 4DQXA 5JAIA 5EC8A 4J76A 5H80A 1P6UA 1P8AA 2Y76A 3BCHA 2O1XA 3WFJA 2HMWA 4IQ0A 1EVIA 3IHTA 4PGYA 1K4KA 4LJ7A 7MDHA 3NRWA 2V6FA 4RPIA 3BGVA 3ORQA 3AESA 4GC7A 1C8VB 1VL6A 2QVBA 1UXKA 2I99A 3CF4A 3WHIA 5J2JA 2HHTA 2WABA 4KCGA 2XUFA 4TUSA 1V8ZA 2N9UA 4LK3A 3VC1A 3EXIB 4JQSA 5HCNA 3SWWA 3QTBA 3AVQA 3CW2A 1Q12A 3RS2A 2LGJA 1D03A 1ZFNA 1JEDA 3C70A 2ZULA 4CM9A 2XLCA 1S2IA 3EGXA 3KKAC 3NVZA 3K1ZA 4IIJA 1XDDA 5AVJA 1DKPA 2JAOA 2PSSA 2BHRA 3IERA 5DW0A 1CYEA 2VZLA 4E2YA 4F46A 3DPSA 2KK0A 2EJCA 2B4QA 2D5LA 2OLJA 1HQDA 2YJ6A 4X0EA 2HIGA 4I1IA 4JBWA 4NRDA 3DHNA 5JW6A 2C5FA 3ABOB 2AN5A 3L8ZA 1JKMA 3OF3A 2BM1A 2YHAA 2LDXA 4BPBA 4B4OA 1AN9A 3IKLA 3UQZA 5CDUA 1YB4A 4ME6A 3GRVA 3HFGA 4HTFA 5MN6A 1XIVA 3QELB 4CT4B 5C9ZA 2JAHA 1UJNA 5JSFA 3ZVKA 5F98A 3TJZA 3BM5A 1E9CA 3I04A 2PUHA 1YMQA 4M9XA 1JPNA 2A58A 3SAFA 1YZKA 1MORA 4L7VA 4KX5A 1U8YA 1CPYA 3KR2A 3UXPA 3AF5A 4KLTA 2CUZA 2V5VA 4P4NA 4E31A 2I9KA 4FFVA 1QCZA 1HEYA 1B8NA 4M0LA 4FD3A 3VSEA 4OP3A 5IAAA 4QU8A 1RXEA 2K7FA 3GVCA 3UXEA 4LJRA 2O2IA 2HOQA 3A28A 1ZQYA 3M6UA 3NPAA 3EE6A 4BYGA 1US8A 3QF4B 1X7ZA 2X8AA 1AQUA 4JODA 3J7AC 1TVMA 4JVLA 1MAUA 4S1PA 5JZMA 3WL3A 3TAHA 3SR6A 1L1EA 1ZI6A 2C9OA 4WQMA 1JG4A 5B3KA 3L8HA 5SYAA 2GCPA 5KPDA 1I7NA 3TL2A 4JC5A 2RHTA 2YW2A 5TGDA 2BF7A 4G1UC 2XR1A 4K9MA 4FR2A 3RFTA 8ICLA 2RK3A 4OU4A 2EX4A 4DV5B 4Y18A 1THZA 1T9AA 2NU7A 1OREA 3AUFA 5DBEX 3ZXUB 1TYZA 3G2JA 3LPNA 3L1UA 5DWVA 2I34A 2IYTA 5EWFA 1BH2A 3DJYA 3IPXA 1KJ8A 4LJLA 3FCUB 1E3QA 5CM2Z 4XDYA 3I2KA 3NDPA 2WKWA 1X7XB 2Z9DA 5KQSA 2PGXA 1COKA 2R86A 2BZFA 5KNDH 3GLFE 2JLVA 1UFQA 5KAIU 1X1BA 1Q57A 3WS7A 2QRNA 2I3AA 5CDHA 4ENVA 2OUKA 5F9FA 3H2JA 3N59A 4CF3A 4EB6B 3EFHA 3R5TA 4URZR 2X2PA 1QDEA 5DN9A 4MUNA 2B4KA 3C15C 3MEQA 1L6RA 1VZ3A 2J0UB 5E1OA 4EJ2A 2Y0DA 1IXZA 4CCAA 3K0BA 4OHKA 3G2MA 4DVGA 3AZOA 2Y9PB 1NLMA 4XR4A 1ZQZA 4AZVA 1ONBA 3ETEA 4PZZA 3D3QA 5K3SA 5LSAA 1JIIA 2FPOA 1NMXA 3PEFA 2H11A 4U2EA 6GPBA 2QLMA 4JV1A 1F5NA 2VG8A 4G5XA 1DPGA 1GTSA 1FFWA 3CM0A 3ETJA 1NW5A 2CVOA 2NSHA 1A2OA 4QUEA 4QYIA 1NKTA 2C5AA 4AZTA 4B7AA 4DLYA 5D3ZA 4F9FA 2B35A 3TS1A 3FPFA 1XRLA 4LXGA 4IY1A 4FFSA 1WMEA 3IOBA 4F11A 3KZNA 1H2FA 2B0JA 3PNYA 4ID9A 4MULA 1WWVA 3LBFA 1Y88A 4ZVMA 2YY7A 3GQBA 1A9XA 1HE2A 1QGAA 2BZ0A 2JGIA 1RLIA 3RKSA 5KTRA 1GL7A 4RVUA 3KHHA 1GT6A 1O94C 1A9ZA 2BGLA 3S29A 4ZZ3A 4B3XA 5KFFA 5J0OA 1AKTA 2QR2A 3ENNA 5IINA 2XT6A 4F96A 1AVTA 1E66A 5CK5A 3DE4X 4DA0A 3R44A 1I7PA 2J4DA 4QJ4A 3RB0A 1L1FA 3MR5A 4ARZB 3D8RA 4D8VA 3L6OO 1R0KA 1QDLB 2Q0HA 3L7IA 1CXZA 3PNKA 2WP8J 1MB0A 4ZVKA 1V38A 2IYLD 4B6SA 4BMYA 1R6DA 4ZGBA 2NU9A 4PV7A 1UPFA 2ASEA 3DT8A 2QHXA 2G36A 2Q8QA 2CZCA 1NSTA 2MOKA 4LDJA 5BOLA 2NUPB 4WY5A 4YJHA 3SS7X 3E58A 2XC9A 3SDZA 3B20A 3QFHA 2GRJA 3QVKA 1JHPA 3VBCA 5IKXA 2HLDD 4YASA 4YRKA 2PSEA 4R5MA 3THWB 1FUUA 2B3DA 4E1VA 4MGIR 4O0MA 2DVMA 1V11B 2JCXA 1WYGA 2ZKIA 4P7GA 3LVBA 2Q6TA 1VKHA 3ZWQA 8ICFA 3WGNA 4Q02A 1QH8B 2O3SA 4ZOAA 3EGOA 3ZPXA 4BO3A 3K05A 3MBOA 2REXB 1L4KA 3I04M 4CI0B 2WWYA 4Z5XA 2PFPA 4KLDA 1U7HA 2AI1A 5CPBA 4MUXA 3C1ZA 4O4IB 4JVOA 1VG9B 5CIYA 4J16C 3W6OA 3O1JC 1J8YF 4RGYA 5EJMA 2IF2A 1MC4A 2RHGB 3O2QB 2Y67A 2O5RA 3N3BC 1HDGO 3U9TA 1N2SA 4KYVA 2PHZA 4YROA 4U7JA 2DM6A 3W6UA 3EUAA 5L8VA 1GFZA 4RMJA 3NGLA 4ZT4A 4EBEA 3P9ZA 3IRUA 1NQXA 3K8QA 1BVRA 4Y2TA 3EPIA 2NGRA 1Y1LA 2YVUA 1OWNA 2ZJZA 1JXLA 1N0IA 2GI4A 3AT1A 4S2UA 4UM9D 3ZTYA 1TE2A 5CTAA 5A7HA 4JUIA 5EQTA 3TAXA 4KK4A 2QRHA 4F50A 4ZU6X 4BRSA 5EI5A 3CRMA 3C6QA 3MWJA 3OOWA 3CX3A 4Y6QA 4B2YA 4C22A 2R751 3HABA 3N86A 5DEOA 3WRYC 4DLKA 1IC6A 1IY0A 3JQPA 3E23A 1P72A 4U0KA 3L4BA 5AJXA 2RHRA 1ULHA 1NK9A 2JFYA 3RC1A 2CLIB 1NY6A 5EWGA 2FLWA 4YRIA 3DLTA 4G1MB 4DIBA 2OHHA 1HR0B 3WWZA 5J2EA 3RU3A 1BGWA 3X1XA 4ASUD 2BHSA 1QK4A 3A1EA 3NM4A 4Z4QA 1RWPA 1BQ4A 2P2NA 2VHZA 4UU8A 1T0HB 2JEZA 3K31A 2YOFA 4RO0A 1NI4B 3R1IA 2VQDA 1KZ4A 2VDMB 4GZ3A 4XIGS 3WO1A 2ETXA 3OC6A 1C7IA 4GKVA 4JYPA 5FBLB 1SC3A 4R6XA 3X1YA 1IOZA 3HA3A 2HLPA 1T6YA 3D8NA 4BY9E 3L1JA 4PC2A 3R0QA 3MDCA 4KN8A 4MRMB 4PPNA 1T26A 5AUPB 3EWAA 1OBOA 1AK1A 1O2DA 4UREA 1JEJA 3P9IA 5T8KA 4BVKA 2XI9A 4C5AA 4Q39A 3C6ZA 2A0XA 5J0WA 3HPQA 1F2UB 2OCAA 2VAMA 4YMWA 4NYMR 3X43A 3MR6A 3JPPA 3A36A 4M21A 2HQRA 1QHFA 2IV2X 4Y7CA 4E1BA 2WSYB 2Q0SA 2ZYDA 1LY1A 3V2GA 3WLKX 2EFEB 2V0CA 4BDTA 3O1LA 4EEZA 4TT3A 1NUUA 5JSQA 5FYQA 2KX7A 2W0SA 4L2IA 1BA3A 4L08A 3E0QA 1S7CA 2QYTA 4QUHA 3VSBA 3R3JA 1JB9A 4W5HA 4BQIA 2O2CA 2YCBA 4MI6A 2B2NA 1I4OA 4D0GA 3CZPA 4HYYA 4JNCA 1YB2A 3ZQUA 3FDZB 5A71A 3UMGA 1SBIA 8OHMA 4P53A 1CUDA 3JYQA 1QSLA 4BV8A 1KWGA 4LNUB 2IOFK 3MD9A 3A32A 1HV8A 4FILA 3LXRA 2QZJA 4ISCA 5JJLA 1EU1A 1XPJA 5EIOA 2GN4A 2X8LA 3N4MB 2AOUA 3GLKA 4W9MC 4OQXA 1M0EA 1WDWB 3C8DA 5KFYA 5TARA 3K0SA 5U9CA 1N8TA 1ZBQA 4KH1A 2PXHA 1IG6A 6CHYA 2JH9A 3H9BA 4R7ZA 3VR5H 3BWDD 2EVWX 2VYNA 3BMNB 3GK3A 4FZVA 2ZPAA 2VWGA 4H35A 4JUZA 2FN4A 1GUAA 5K9ZA 5JAMA 3PQ6A 1KSFX 4RAQA 3KB1A 2MCFA 4PHCA 2O6HA 3VXKA 4L5JA 3PLNA 2YOHA 3B85A 5KBYA 1Y89A 5HQTA 3OC0A 4NJOA 1LQUA 4LYYA 2UZ0A 4NENA 1WOMA 4J6EA 5JZSA 4FB4A 1KNQA 1OUMA 4H3KB 3RJEA 3IFSA 3CRZA 2HHVA 3N7TA 5K0EA 4RHUA 3B9JA 2Q46A 2RGWA 1QWSA 3SJZA 1EFAA 2AXEA 3TACB 3PV8A 1GGKA 1QB8A 4GC5A 4R2WA 3ZHUA 1QSGA 1PZFA 3JVDA 3QE3A 4HDQB 3ERCA 4RQ4A 3GUCA 2IYEA 1IUNA 4I3GA 1BJTA 3I6MA 3OCCA 2MMGA 1X8LA 2CHQA 4YXWD 3RVQA 4G36A 4OHBA 1DCMA 4IICA 4OYRA 5A3VA 3TLYA 2BMFA 2HFKA 1BKDR 4OQEA 5TPZA 4CVNA 3HYNA 4R9UC 3PTLA 4F56A 3MHTA 1P9RA 3PJEA 2Q6OA 5DYYA 5AUNB 5EQJB 5H5JA 3EGXB 3EWNA 4OQ4A 1ZQJA 1KFDA 3O8OA 4YCMA 2BFFA 3A6EA 1Q5PA 2BDEA 4QAJA 1HE5A 1V3TA 1BO6A 3WV5A 1OU4A 5B36A 3QV2A 4DIDA 2D2IA 3IVXA 3O9MA 2JIBA 2WSBA 3RAEC 4W5JA 1VB5A 1EWKA 1Z56C 2NXEA 3C98A 1OH6A 4E46A 1UBUS 1WUJS 4FHGA 1G8SA 5BYKA 4AY2A 2ID9A 3NTQA 1R7RA 1SUAA 4LZOA 5DBIA 5DTJA 5BSVA 1TJNA 4RJIA 2JGRA 2I6XA 1GSIA 1LK0A 2VO1A 4MW4A 3VGJA 4CLEA 5F3WB 4UW9A 3BMQB 1GILA 5DCWA 2ZM6B 4BE9A 2ODTX 4R1NA 3WHLA 3H9EO 1ZD3A 5J0SA 2IIBA 3PFCA 4BP3A 4EVRA 3OQOA 3HC7A 4G3IA 3NYQA 3OX3A 5T7BA 1W34A 1ZMOA 3WHPA 2OLEA 4A2WA 1HTTA 1FJ2A 4Q7MB 4QBIA 1XQWA 2JHPA 1W1IA 5LR6A 4FOSA 1LQ2A 1GCGA 1S2NA 2WUGA 1HK7A 4RHEA 1V8DA 4F4FA 1CF9A 1I0LA 2ZIEA 1E2QA 2BJWA 2C1EA 2LV8A 3CUEF 3ZV6A 1D7AA 2BHNA 2ORWA 1ZG3A 4UEJA 4DMUB 2VJMB 1VA4A 2ACWA 1X2BA 4XQ8A 1YE5A 2VPYA 1PYOA 2O8CB 1O03A 4HLQB 4WFKA 2PIDA 2D54A 2DTXA 4FI3C 4DQLA 1OYOA 4C4XA 2C2HA 2PH7A 4DSEA 2OGSA 4PZ9A 5LYYA 4GPZA 3EH2A 4HCJA 3Q7TA 5BV2P 1DC5A 2J3EA 1DG9A 2HY7A 2D3WA 3F71A 4K9NA 3NOQA 4CG0A 1J8DA 1AV6A 1VYTA 4QICA 1G1AA 1GJRA 5GAJA 4F6RA 2QY6A 3EZNA 1V95A 2HIMA 3PGLA 2YUIA 3U39A 3FM9A 2VJLA 2J9RA 4N3NA 5BN5B 1GU7A 1LK7A 4I4CA 2DFTA 4H15A 4JYCA 3NWBA 5FLYA 1YF3A 1T36A 2H2AA 4D9GA 1CR0A 2XE4A 2OWEA 5JI3E 6YASA 2P6PA 4DB2A 2XB4A 1SXJC 1X0VA 1DJLA 1G20B 3B5IA 1PEDA 3G8CA 4INPA 4R68A 4UD6A 4D26A 1EQUA 5LZ4A 2PYIA 1NU8A 2RGNA 4PZCA 4RKYA 5IN5A 4O3NA 1LRJA 4D81A 2Z09A 1TT5A 3F2IA 1NAHA 3LH5A 1VL8A 4MUKA 5U4XA 1X86B 3DDNA 1R18A 3DMFA 2C5GA 3U40A 4CN9A 1ESMA 1IDN1 3TZQA 3M8SA 2IY8A 1M0SA 2CNWD 1RABA 3UJNA 1G7SA 3L0DA 3QU4A 1E9EA 1RJDA 4FJ2A 4KVZA 4LQLA 4CQJA 4Z1OA 5JCXA 2FFQA 5AHWA 4ALKA 3JPTA 4TYNA 2QSUA 3B1WA 1P3JA 2H1IA 5CFQA 1GUZA 1VKRA 1L7QA 5B1HA 1XTTA 4TN5A 4AP5A 4RV4A 3RRZA 1O6CA 3FRIA 3CSDA 3PBKA 1OU0A 2H59A 3TE7A 4TTAA 3FGOA 3IRVA 3LPDA 2AVNA 3LHSA 3SVLA 3KFLA 2QMYA 1W47A 2W6OA 2HJRA 4K6OA 3TIGA 2EG9A 4AZ3B 3ED1A 4RLFA 2B7LA 2Q6LA 1THGA 2BFNA 1KEPA 4MUJA 4S2EA 5EXTA 3STUA 2JJ2D 2I76A 4M0FA 3FCXA 3V1TC 4DSZA 1L7EA 3L6RA 3PJFA 1NV9A 1U2PA 2BEJA 2PX0A 4HXGA 5I9MA 2XV1A 2Y92A 5DQHA 2H1FA 5AW5A 1L0BA 1QHXA 2HK9A 3BQ0A 1LB1B 4FIZA 4JBIA 4JR2A 3LTEA 5K3DA 1WXWA 4DLEA 2F2TA 2JGJA 2XY5A 3S8EA 1XD2B 2P68A 3C5VA 4X00A 3CA8A 4X5OA 4EHJA 4BFXA 2CYAA 1T8EA 3OCUA 4WJLA 4DEZA 3MK31 4KI7A 4Y9DA 1F0MA 3S55A 2V97A 2JG3A 1X9SA 1HE4A 1X9XA 1P44A 3OURA 3V8PA 3SXUA 2KLBA 4C0KA 1IE3A 3W9UA 4B6FA 4ZJZA 4JEMA 4IDAA 2BVNA 4WV3A 2ONYA 1UK7A 2H1HA 1UOPA 4EY4A 3NGMA 2GVZC 3I8OA 3DBIA 1NI3A 1CR6A 1I3KA 1GPMA 4BGDA 4ZOLB 3LZCA 4CNQA 2AJTA 2BMWA 4WESB 2FR8A 2O3QA 4GI7A 2XMCA 1SQ5A 2WM9B 4IBOA 4IL5A 4N1AA 4OGKA 3Q3CA 2X6TA 3C1YA 1RQXA 2R6R1 4OBEA 2BGRA 4DWVA 3G1WA 5DNYB 2P7HA 3BQ9A 4MO2A 3TR0A 4F04A 3D5QA 4Z1MD 3R6TA 2QVYX 5EN4A 1RQRA 3M1YA 3LX6A 4V0KA 1ODIA 1IOLA 1TUBB 2PRYA 1DOQA 2W8BB 2BPCA 2P3LA 1FSGA 4DL4A 1MXFA 2WJ4A 3Q2KA 1FMFA 3QJ5A 5BN1A 2O7VA 1UEJA 3N2EA 2P7IA 4NZZA 5DXAA 3IEUA 5H59A 5AKIA 1U02A 5DB8A 4XFJA 3AJAA 2O54A 3VH2A 1OTYA 1OT5A 4QUGA 1FRZA 1QG2A 3KJNA 5ECDA 5BP7A 3I30X 1EM8A 2IZ7A 4NV0A 1O97D 2F3RA 3OM8A 2QEQA 2J3QA 1RIIA 4LYJA 2IUTA 1IUKA 1T0UA 2KVCA 4NG4A 4CLRA 2H4ZA 2Q3HA 5D2CA 1TF5A 1UJCA 2DERA 2L18A 4ZHQB 4M99A 3ENQA 1S0MA 1UANA 3W2HA 5HOEA 2Z98A 4BNHA 5CXSA 4EL0A 1Y80A 3BXFA 3NP9A 3TDNA 3UYLA 3CP8A 1IHPA 2R2AA 3DAGA 5KQLA 3B1ZA 3EHEA 4X54A 2JJQA 2XD4A 1XCOA 4UUPA 2G06A 3G0GA 3AVOA 2ARKA 2BM9A 1EZZA 5HVNA 4NLLA 5DX0A 1U2SA 4MINA 1QRDA 3H8MA 1RZVA 1P60A 1ZVJA 2EJTA 2CYCA 4IRMA 2E8MA 3JPYA 4GS5A 4BFYA 1PUIA 3CRVA 3PIDA 4QYXA 4KLLA 4U3JA 4OHYA 2FDXA 2GN0A 1KBQA 1TZBA 1GTRA 1ECBA 3SKVA 1D5CA 3WIDA 4KFSA 1AMNA 4V03A 2KKVA 1RYUA 4M9NA 3E1KA 3SQWA 1MC1A 2DUYA 2VYVD 4PLHA 4QASA 1GDTA 2I4OA 2YJNA 4RK4A 4QW9A 4WZBB 4RMGA 3VHQA 3ZWDA 8ICRA 2XWPA 2YV3A 5ESWA 1E7RA 2ES4A 1ML4A 4DIUA 5DDMA 2FW6A 4IV8A 4YD2A 1WNFA 3O74A 5DGHA 4OB6A 3WLPA 5GZ3A 4KKXB 2R6HA 4IZHA 4N82A 3VOAA 1I2CA 5J5VA 2HTFA 5CA7A 1ECWA 1C1YA 3MJSA 5BOMA 1C5KA 3HI6A 1W5SA 4IUBS 5ESDA 6LDHA 5I48A 3LZDA 2O2GA 4EBFA 3TK1A 1ICEA 3TX6A 5IK2D 4NECA 1XYGA 3KHKA 5KNBD 3A0HU 4XGRA 1NC1A 2DFNA 1V8OA 1HY3A 4WBSA 3E8SA 2D8CA 2P35A 3HYTA 3MG9A 1FX1A 4DZRA 1WX1A 2J9XB 2NAFA 5J1SB 3W2TA 5DYGA 2BZ1A 2X40A 2UUOA 3HKCA 4FKZA 1YBMA 4GNKA 1A8QA 4HRAA 4DA8A 3TKYA 4YCLA 2UZ3A 5TISU 1PT7A 4MI9A 5KNIA 5B64A 5BNWA 1P2FA 1PAUA 1T1GA 2F9FA 2JBWA 3ETGA 3G8DA 3T7CA 5KYNA 1Q20A 4B3MB 5CLLA 1MJGM 3W05A 4DDHA 121PA 3PQ5A 3MXOA 1PGPA 3B48A 3R7BA 1YS7A 4TLCA 3TTWA 1N3LA 4EFMA 3ROZA 4HD8A 2K4PA 5KJ1A 3L8FA 3KG2A 1Q83A 1TU0A 4RBNA 5HHIA 2DGZA 5CGQB 2BTQB 4TVSA 1TOAA 3ANTA 1L5NA 3A9SA 3SIRA 3PKIA 3UH1A 2PJDA 4RXMA 5AI5A 1UBCA 3KQQA 4QPNA 1SVLA 2FGJA 4G4IA 4LF9B 2VJKA 3IEPA 5TQ0A 3SI8A 1H8EA 1QOPB 4G67A 3MJFA 1AUOA 3P32A 3S44A 5ALQA 3RJJA 4UBKA 4ZFNA 1SXPA 5IIKA 1QYVA 1B8UA 1DO0A 2JIRA 2WYIA 1SKMA 4AMGA 2VTBB 4TRMA 4CEHA 3DBLB 2O07A 1HT3A 2CCJA 5EMHA 3EEBA 1ISRA 4HRYA 4G5OA 4IO0A 4L3OA 3LX5A 4S0ZA 5TE9A 3JAMA 1EGAA 1V96A 2IEAA 1GDDA 3TZKA 3LO8A 3NS7A 3AINA 1J6UA 1Z2AA 1KDRA 4NPCA 1T0JB 5KYVA 3PC7A 4CCYB 5C7IO 5CWRA 3D6JA 2HRQA 1N56A 1EVLA 4HS4A 3N5CA 4C6TB 2XVYA 4MLPA 3EARA 1Y1QA 4TM8A 3EGIA 2PSFA 5EFOA 1RI1A 1XD9A 3D2BA 3B7PA 2GZRA 1UA0A 1X2EA 4I2IA 2NU6B 2W71A 1YXMA 3M3PA 4EO9A 1TKCA 2C2MA 4MK4A 1ENOA 4TWRA 5TEWA 3PU6A 3WGZA 2VHYA 1WVMA 2JZOA 4HP8A 4MW6A 3CN9A 3VPBA 2FPLA 4MV8A 1YL5A 3UHPA 5CW1A 3OFSA 1G8MA 5AW0A 3MOGA 4IDPA 3AI1A 5C0OE 4HAXA 1V16B 3F6EX 3KR9A 4NK5A 1ZMXA 3I4LA 1UPBA 2P8SA 4G0QA 3IQXA 3K09C 4CF5A 2C2KA 1WZNA 2H5LA 1YRAA 2HUPA 2WMDA 2XKAA 4GW3A 1KI6B 2OBXA 4YDRA 5JQGF 2PM8A 1GFIA 1SRRA 3IPLA 2HHHB 3VH1A 1KPGA 9LDTA 2B21A 1RWKA 2VPIA 2VYQA 4RVNA 8ICEA 1V8BA 3QY9A 2EW1A 2Y0PA 3DWGA 2P5TB 3K73O 2HBLA 2VH1A 4H1TA 1PNRA 1N6LA 4UD2A 3T0GA 2JW5A 5JNUA 1RPJA 1MAAA 4B81A 2XQJA 1UOQA 1E6WA 3FFXA 1BXRB 2PKCA 4GC9A 5CHEA 4Z9YA 4EKYA 1I7DA 4MMZB 3VAAA 5MN4A 1Q3KA 1TTHA 1RU3A 1HOTA 1K6MA 2A84A 5B53A 4D3ZA 5HW0A 1UIMA 4QUKA 3GB9A 1IG3A 4BJQA 4PPYA 4KPYA 1PK8A 1TIBA 1J5PA 3ETRA 1JI3A 1GPUA 2B98A 2HBQA 1RXVA 4K9SA 4XVRA 3N0RA 7YASA 2XMPA 2YZMA 3B52X 4J7CA 1Y37A 2ACVA 1DQNA 1LF0A 2WMYA 2ZVQX 4W99A 2AOTA 4DQVA 3IO3A 3M9MB 5DOZA 2FLPA 2LNDA 2PBRA 4YRNA 4BKQA 3M1IA 1Q1QA 1T0BA 2VAWA 8GPBA 1HBJA 1QP8A 3FNIA 2EAMA 2QLTA 2ISOA 3LI2A 4FOOA 3T5GA 5EE3A 1FFBA 3AF4A 3I0MA 3GMSA 1XEXA 1E1RA 1ZQMA 1DKOA 1PZXA 1Z13A 4E5PA 2H1VA 3EIQA 5KQRA 5ESRA 3F46A 5TMDA 3OTOB 3UATA 3GFOA 4I2DA 5BW5A 4W5NA 5FOWA 4ECVA 3ZNQA 3H65A 1OBFO 2ZQYA 3UCEA 2OBYA 5CH3A 3B2QA 4CTKA 3T9CA 5BUQA 1WDKA 3H83A 3BZKA 3V48A 2QBYA 2PWYA 3T3HA 1ZR4A 2AXTU 8ICZA 8AT1A 2XZLA 3DXYA 4GSLA 2QW1A 3DF9A 5LQSA 5F12A 4ED0A 1YZFA 2FETA 3PD1A 4FWBA 2FHPA 2RI0A 1O7JA 3LOUA 3QWHA 4JLJA 2OMKA 1R8SA 2IXGA 3G5UA 3O84A 4OXYA 4DJJA 1IEVA 1QR6A 1NI4A 1TJPB 2DUJA 1Z06A 4LK2A 5DKFA 4WVFA 4C4SA 1PD1A 4B6QA 1YRBA 5A62A 3PFBA 3ZE7A 1VRCA 3AJ9A 3CZQA 4J29A 4D8WA 4EGAA 1J25A 5CVEA 1PVRA 1P9LA 3WK9A 4C1NA 2EKBA 2CRXA 2ODAA 2Z4SA 4KPFC 1KI9A 2I4LA 1Y42X 2CNBA 3DH0A 3FB1A 3HADA 2RGXA 4Q1AA 3UC5A 4K46A 4GVXA 2OZEA 1Z1VA 1CJSA 3AUYA 2G9RA 3HJHA 4KUHA 3IOCA 4PC1A 2QTCA 4GYYA 4Q21A 2OQIA 4LKOA 2W2KB 1USIA 3I6YA 2WVGA 3DG9A 4PU0A 4X45A 1F8GA 2AZXA 4EGQA 4EO4A 3K4HA 3QOWA 4LVCA 3UB2A 4BMNA 3MRVA 1D2HA 1Y8RB 5KFZA 1OGJA 2GLTA 3WDMA 1U7OA 1YBHA 1KIFA 2R8YA 1CJBA 3O1HB 4EA6A 5JZBA 5HS4A 1DT3A 1I1QB 3FZQA 5A4AA 4DARA 1QGED 4DOAA 1RPZA 8ICKA 2G9VA 3TW4A 1SBZA 1U48A 1K7XB 3LSYA 4IOJA 3ZC3A 5CYPA 1YI8A 1P6QA 1LLDA 2OR3A 4HB2A 3KL2A 3PEYA 2MU2A 4DSJA 4GPD1 4YQYA 4O4HA 3JVEA 1LCIA 4E5NA 3V8VA 2NZJA 3RIGA 4ZCQA 1W96A 3EIFA 5BV0A 1B42A 1HI9A 2V6MA 3DOHA 9ICTA 1MN8A 1URPA 2WE7A 3FUXA 3ZQ4A 5JC8A 3AL2A 2O59A 4FYYA 2OHOA 4NABA 3M81A 2FAXA 2WQ6A 1J8VA 3NIGB 4WOPA 4YNBA 5JH7B 1S2OA 1T5SA 5CP2A 4UAWA 1B6SA 3QLTA 4B48A 5DG9A 5FCDA 3GDWA 1ECJA 3KLBA 4EKDA 4FZNA 4LEIA 5J4YA 1TRHA 4IHQA 1ZIOA 3BKXA 1HX7A 4NJEA 4RCZA 3SY8A 4MKHA 1PDOA 5FR1A 5KZMB 4FN4A 4BAGA 3P2OA 4PRKA 3BXGA 4DT1A 4M9GA 1CZUA 2CLKB 3RI3A 5LNK6 4FHDA 1IHDA 1JI7A 5LKAA 3L01A 3P4XA 2NNLD 3HBLA 3HM2A 2AX4A 1L6NA 1PWYE 3RFVA 2ZXHA 3R7WB 2R6GA 4WZAA 3O95A 4BASA 4QQNA 4JV5B 2OCXA 3MHPA 3E3AA 5CRXA 5DSZA 3DO8A 4Q4JA 3TNJA 1KY3A 2Y93A 5K2OA 1MRSA 2Q07A 2YYZA 3GMIA 3VNUA 1SM4A 3FDZA 1CEXA 3RW9A 4EI8A 4M1OA 4F2HA 3IAM1 5U1PA 2HM7A 2ZJAA 1GA1A 3RBZA 3DOUA 1GFWA 3H16A 3IQEA 2IP1A 3IH5A 2CDAA 3Q9UA 4PGQA 3MIZA 1KS9A 4HDKA 3THXB 3N2ZB 2RC5A 3HEMA 4UDYX 1ZXBA 2G72A 3SZUA 4A9AA 2NRTA 1RACA 1U28C 3L84A 4YMIA 4BUZA 1E1CA 5FI5A 5GWXA 1YCFA 4WOKA 5CVDA 1UAGA 5LZ8A 2JEGA 3BSWA 3OOSA 4UC0A 1E92A 4BBPA 4DR6B 2CVFA 3KPVA 2PQ6A 3UAOA 1TA4A 1RQGA 5I01A 1IMJA 1Z82A 3GNQA 1E96A 1CKEA 1PV2A 1W73A 3KT3A 4HBGA 3TYXA 2A14A 5KVCA 1BGVA 1NXSA 3UW1A 3CEPB 1FNDA 5IM5A 1H94A 1KE1A 4RCYA 4OJOA 1KY2A 3ZNNA 5L6MB 4EUNA 3MMZA 5DYTA 1H8HA 3H84A 2WFZA 2WIFA 2M6RA 5IUNC 1LUAA 1ZICA 4RPLA 1OZGA 3QYAA 1Y7LA 2XTZA 3F6CA 4LMBA 1JFSA 1VG0B 4CLXA 1OVMA 2NUAB 2YNMD 4DREA 3PNCA 4Q93A 1PHPA 1RYEA 3VVLA 1C1XB 5D87A 3SD7A 5I9SA 3GNSA 1GYQA 2JGDB 3N8HA 4WL0A 3AW9A 2OCYC 1GAEO 1SG0A 1QGYA 2I1WA 1PZHA 1UC4B 2G88A 4QM6A 5DBFA 4A16A 4EI7A 3EOAI 2EFCB 3ACBA 3NJ4A 5B58C 4C8KA 1X1RA 2JBHA 2W7TA 5AVQA 2AQKA 2G63A 2FXIA 3RJMA 3T6KA 3VZRA 2KBEA 4CM4A 4HLUA 3U16A 4RZUA 4R65A 2CL7X 4MYTA 4INOA 1J23A 3I61A 5J2AA 3D4LA 1JHAA 1O95C 1TCUA 4OJ5A 1JAIA 3PWTA 4KZPA 4D4GA 4Q4CA 3UJBA 5CVJA 1EUQA 4I28A 2VT3A 3RARA 1GGHA 5IKOA 1Z0SA 1GNPA 4PG6A 4FEEA 1ZWLA 1IVYA 1GTG1 1HL3A 3EY4A 1AGYA 2KD1A 3QUTA 1N9GA 1P9NA 1Q1GA 1QBGA 3NONA 4MVJM 4XZ3A 1AXRA 1T6BY 2W6NA 1DKNA 1Y9AA 3MWKA 4LC9A 2AUTA 2BFDA 4GM0A 2HJHA 4DFJA 5HYVA 3CRXA 2YFYA 2BGKA 3AF2A 3PKJA 4QXPA 4ASUA 2HA0A 1WLYA 2EFYA 4AM8A 3VTFA 1WCNA 1CUBA 2FUCA 3OLXA 1OZHA 4JD5A 4JKOA 4XPIA 4LHEA 4H3SA 1NR5A 3DNPA 2ODWA 4LZZA 3CIFA 1Z5ZA 3DZIA 5IT9A 2CK3D 9ICOA 2JA1A 1DG1G 1CQXA 3B1XA 3FPSA 5JUWA 3NFRA 4RTSA 1GAWA 1AG9A 4ZZIA 4BZQA 4G0NA 3W06A 2D1SA 3F67A 2QWXA 3PHJA 3SXPA 4A8TA 2BCUA 2JFZA 3V34A 4Z7NB 3IR7A 4IS2A 4ZJUA 2J87A 1X14A 5T6MA 1S3IA 1CRLA 1V48A 3EG9A 3RHTA 1FQKA 2LM4A 3A05A 4EY3A 3ZLBA 1TO1E 1ZSYA 3TARA 2WNSA 3RDPA 1B23P 2ZT8A 1ADJA 2X7XA 1MV5A 3T4UA 3IE1A 5FA6A 2GRAA 3QU7A 1W25A 4H6WA 4XQ9A 3EZ9A 3EDOA 5COBA 1XJQA 5DXJA 4B8ZA 2G4CA 2GJAA 3DBVO 5JJKA 4N40A 2FP4A 3C39A 4TQAA 3INNA 5G4KA 4YWHA 4OHXA 4JI0B 3KS9A 4MZDA 2OFFA 1GPKA 9ICAA 1E2MA 1WZCA 4GAEA 3O8NA 1GV1A 2ZUVA 2YTZA 1U8AA 2R6ZA 4KBFA 4URVR 4ENTA 5KWSA 1II8B 3LBNA 2ZRNA 2WB4A 3SIWA 3GHYA 3VZQA 3G2PA 4QRHA 1XA4A 2WKSA 3AMVA 5DCLA 1Y33E 2I6FA 2FPGA 5BPCA 4IDDA 1KEEB 3F4BA 3JYOA 1L1RA 4XAQA 1P33A 1HEUA 5BNTA 5ALPA 5C7OO 1GSAA 4OA8A 4X3PA 4OI1A 2BGGA 3Q6IA 4J9KA 2Z56A 3FNEA 3MILA 4ICAA 7ADHA 4EZEA 3H8SA 1WXQA 4D44A 2PI4A 1Z6YA 1FU7A 2AR9A 1VCOA 2HK7A 1V47A 4KJXA 4OGLA 5LWQA 5JPIA 4WE3A 4F85A 1LDGA 4NH4A 3ICXA 2FW9A 4BNTA 1O0BA 1CHDA 1MRZA 4LZGA 4DLNA 2XITA 4LC0A 3QVJA 1QTNA 3MSXA 4RS3A 5DHTA 4CKBA 5C5DA 4GM4A 1SJ9A 3LF1A 3O4VA 4N39A 1VHDA 4G5QA 2C29D 2CE7A 4TQRA 4BNGA 2VTDA 2JEFA 3B7GA 2DKZA 5ALXA 2AMLA 2EQYA 2GPTA 2YWEA 1VLLA 3QBVA 4R0MA 4JL8A 3LUKA 1BDBA 3P2KA 1IIPA 4WZAE 1H9CA 4E0BA 1NBME 4GYWA 3V2IA 4XWWA 3B5JA 1TJ5A 1O57A 4GOMD 1A9PA 1HMPA 2ODBA 2Q8PA 2Y6VA 4BAUA 3GFBA 1ZH4A 4HQKA 1E5VA 1YIAA 4K6KA 4NU8X 4FNMA 5IBRA 4QNLA 3KUKA 1EVJA 3IKJA 1MOPA 5H83A 2O57A 3CX7A 3EIUA 1ODJA 2PMWB 4KBGA 3V55A 3ZDXB 2H29A 4B46A 4EGJA 4MR9A 5A3JA 5CDYA 4MOWA 1QG0A 2DPJA 3KZXA 4DSLA 3JWJA 3GJ7A 4R8KA 5BSKA 1ZXLA 2QI9F 4YXWA 1I2DA 4WBNA 3KPJA 4KR7A 4ZAFA 3QFCA 1FMLA 1ELOA 2FZCA 5JJIA 4GZ6A 4IUCS 1GR0A 4S3MA 1SU8A 1EHIA 1KMMA 4IEEA 4Y1RB 3V4PB 1P5HA 3MGKA 1FF9A 1SA0A 3EGCA 1LI5A 4EQZA 3UMSA 1KR2A 2AGVA 4LE1A 3HKEB 2HSJA 2WJGA 2R6CA 5AKHA 1H38A 4PZNA 4GXJA 1MABB 3X44A 3L5KA 3AJ8A 3M4JA 5KG4A 4JLBA 4Z3DA 3IVGA 5HG0A 3TUJC 4YAJA 1NWCA 5KYKA 1P73A 5FQOA 2HF2A 3F5QA 3IEIA 2GUGA 2FHSA 3W2IA 1XF9A 3O82A 4KXQA 3R8FA 4GKJB 2KSQA 2VATA 1HDXA 3LHKA 2B1GA 2G17A 2XRMA 4QGSA 2B0CA 5K09A 1VMAA 4XYEA 5DB7A 4JCOA 2ZTMA 4RY8A 1QTMA 5KFKA 2ZJ0A 2QN9A 2AN3A 4IS3A 3OJXA 4NMHA 2LIVA 3NMUF 1YJCA 3A7DA 4FZ5A 4G9EA 2Z6QA 3QX3A 3VX3A 1GTVA 1NN1A 3K2EA 3ZD9A 3LMKA 1NTOA 4UULA 3K5IA 4WCFC 4BB5A 4S04A 3CNOA 4MAAA 3FDFA 4LV8B 3N70A 3OG9A 5JASA 2GCNA 3BQMB 2FZVA 2ECPA 5GIPE 3AFNA 3MM4A 5IUKC 1NK8A 3S70A 9ICXA 4N5NA 2EWWA 1BWRA 1GEEA 1P1JA 2EGUA 3BH0A 5GZ1A 3QZ8A 5T4EA 4M60A 4DMLA 2CUTA 2P66A 1YBVA 2HGSA 3TOSA 4D0RA 1TAMA 2ZANA 2XUQA 721PA 2W22A 2YZ2A 5KNCA 1K2VN 2PKQO 1K8ZB 2O2DA 1MGPA 2CLSA 3EEYA 4IKPA 1FE8A 3E9MA 2NU6A 4AJKA 1Z3IX 3GUYA 4TTRA 2FLNA 2P2SA 4HR7A 2WU4A 2D6FC 4R2JA 4H7EA 4KO8A 2PLAA 3RK0A 5J3JA 2XKJE 3GIDA 1GKYA 2FG7C 2AN4A 1SWWA 1PK9A 4EPVA 3TQRA 2H5XA 1RHRA 2XBUA 1PJQA 3HE3A 5FYDA 5L3QB 3C2MA 1XEXB 2VDQB 4ECUA 1SK9A 3TE6A 3ZBPA 2V6IA 2IHJA 4P3NA 3LP6A 2N3ZA 1L4BA 4L0DA 5A0LA 3HSSA 4N0QA 1PK1A 1J2YA 1GGMA 4LGVA 5BQ5A 2NO5A 4FS1A 2ADMA 1NWHA 2CHUA 1KI6A 3OLZA 5EERA 3ZHRA 2WPDA 1XZCA 2VCEA 1AZTA 3HCAA 3ADPA 1HORA 3BE6A 4J8PA 3V7JA 4ON9A 3Q3EA 4QDJA 1P2DA 4BO5A 4DMGA 1BN6A 1LDYA 2WJIA 4I4LA 1ST3A 2YC2C 3IO5A 1OYVA 2BMAA 3LUHA 4NBUA 4C8MA 1UA1A 2QKYA 1VQ1A 3RWMB 1H6BA 1AX9A 2ZKLA 1VLHA 1P4GA 1R4AA 1JLHA 2VDVE 1CZNA 4BKPA 4UATA 3HT3A 1KY4A 2BTQA 4B09A 2X22A 2B30A 3CHYA 4CV0A 9MHTA 4ECRA 3DEEA 2ZSFA 4I1YA 1I94B 1AH2A 1N2XA 4E15A 1I3LA 5AW1A 2JS7A 1SL2A 1L7VC 2ZIFA 3FGZA 3ND8A 2FP4B 3GFFA 1VHWA 3KT0A 1XK7A 4GSKA 4LYFA 4N4AA 1LRLA 2ZYTX 4EY7A 3LLCA 4AXBA 4DLWA 2EBWA 1RS0A 2OBLA 4LMRA 3WSTA 1QG4A 1Z6QA 1PV1A 4H1UA 5KFAA 1ZSVA 1ZMBA 1K6IA 3O38A 5FOUA 2J5XA 3UV3A 2AGOA 3E9RA 1IN6A 3PJDA 4KTTE 5HF8A 1N4AA 2C4VA 1XKTA 2K4EA 3A3PA 5KOHB 4LHYA 3Q3GE 1YDGA 5HIKA 2I71A 1Y4AE 2QTRA 2QTZA 4OSOA 1PGNA 4CKYA 4MPJA 3GJ4A 5I5GA 2WP0A 3USZA 4EPTA 3PSHA 3WJAA 1FIQA 2YMPA 1Z73A 2C59A 3WGGA 1XMXA 3IPRA 3NANA 1BMQA 1R0ZA 3EQ7A 1ZHHA 4ECAA 5FI3A 2W9CA 1VE3A 2Z5VA 3HCBA 3P9NA 1KZYC 1U3VA 3H5NA 4BDSA 4YREA 5LD2C 3TUIC 1N9KA 1YULA 3UYKA 4JN6B 3AEYA 1EMDA 4TKLA 3LVVA 2D0PB 4HO1X 4XVUA 3PFWO 2DQ4A 3H1FA 4LMPA 3IMGA 4UE3S 3QBDA 2LRHA 3DCJA 1EP3B 1ZQ1C 2P6UA 2P0YA 2PKYX 5JNWA 3HVHA 4JBLA 2IPNA 1Q0UA 1F0NA 1N6IA 2C96A 3QEOA 5K01A 5FWXA 3U6BA 2V03A 1SU7A 4ED9A 4MR7A 5CNIA 4BWJA 1M2VB 4PX5A 4XB6B 1D5WA 3BULA 2B20A 3HO6A 3HH8A 3WAGA 4ELVA 2DP4E 2JJ1A 2RHWA 3C48A 2BISA 1G6HA 2X4GA 1KNXA 1SZJG 4K3UA 4KE7A 4L4YA 1E6LA 2UVUA 1QO0D 2G40A 1IXSB 2QUJA 3FAHA 3HRDD 3DQZA 1VE1A 4MR8A 5KB3A 1Q2UA 2GUWA 3DEHA 1PQWA 4JQZA 2FVXA 1NKSA 3EMKA 4HB4A 7ICOA 3HG7A 2BOVA 1ZJMA 1TLTA 1BD4A 2AJLI 4LECA 1NZJA 2FSGA 3T34A 1P0IA 1MQSA 1P0QA 3VU1A 1IL0A 3KJXA 1HE8B 3MT7A 2XUGA 4J1SA 4DPLA 4AG5A 1VSBA 2I9PA 1G63A 3IV9A 3FLAA 3PW0A 4AUKA 1SCUB 2QMHA 2WTXA 5G1NA 1K3FA 2IT1A 3RVNA 1BQEA 5LU8A 3O8DA 4I7EA 3VA7A 3V6LA 2CNDA 2G09A 2FX5A 3LYAA 3GP5A 3JRNA 3TTTA 1Y8CA 1YAHA 7AT1A 4TQSA 1W1UA 1WCIA 2E9SA 3KFVA 4Q18A 3H2KA 2QRGA 3Q3IA 3E0XA 4YJDA 3UK7A 4F21A 1EIZA 1LKZA 1T24A 1WOYA 1T15A 1H23A 2VTVA 2ZUUA 1MO2A 3L7CA 3QV1A 1DQRA 1L1QA 3K71B 2B92A 3T9FA 4MHTA 1EUZA 4NL9C 3IUNA 1E4EA 4G07A 4WK4B 4YFVA 1AZLA 1VMKA 1QPGA 1UC8A 1I13A 3FTPA 3MTDA 4P0QB 4KRXA 1Q17A 4S1NA 1FW6A 1X7ZB 3SG0A 2P2DA 4IKEA 1LJUA 3H40A 1RBMA 4P82A 1G2PA 2QAGB 2PS3A 1QC5B 2J85A 3OF5A 1QORA 3HWTA 1NRIA 4JOCA 1LBEA 3R5JA 2G08A 3ADDA 1LDMA 3SHOA 3GIWA 2O4CA 4ZC8A 2YIVX 4F8YA 5CGZA 2G71A 4MGHA 1UP7A 3DONA 1BE6A 4GC6A 1U1IA 2IH2A 3FKSD 4FWIB 3JQQA 3WWEA 4I4IA 1UDCA 4JK1A 2GILA 2P4QA 3BIXA 4H0NA 3RVJA 5L51A 4KLQA 1XWLA 1B22A 3THRA 3RTDA 4QWBA 5IIMA 3V72A 4D57A 2OCPA 3L0PA 4WK2B 4JWNA 3M1LA 2FF7A 3ZK8A 4UUQA 4CMAA 3VNAA 4WEQA 5A6SB 4FYVA 4RPCA 1NKEA 1DRWA 3NEPX 3UCXA 2IUYA 3CKKA 3ZBTA 4E70A 2WD7B 4WKOA 3CGWA 2JH7A 4BWMA 4W9RA 2C88A 1LSSA 3GLHE 5JCJA 4U6QA 4MRNA 4YJ3A 2F3QA 5AUOB 3W5JA 4LGYA 1KQGA 2AV6A 2J09A 2OC4A 1PYGA 2DQNB 2QPLA 2VNAA 4UOZA 5CLHA 3BICA 2JPDA 5BOSA 1C0EA 5F1PA 3RFAA 1MH9A 3K5PA 2BCSA 2PD3A 4H4CA 2P9JA 3EK2A 2C04A 4KAJA 4DEVA 3KQHA 2JFPA 4ZH4A 1A5ZA 4YAWA 5LQDA 5DASA 2IYSA 2CVHA 2A67A 2GZ1A 2HF8A 3NBAA 4PC6A 4ZKEA 1GU1A 3E3LA 1NSFA 2FGKA 1RQNA 1NLZA 2R60A 3FBWA 3ON5A 1KQFA 3QFRA 1B74A 5FHRA 4BPRA 1Q7CA 2JI8A 5J8YA 1D2CA 3L43A 2YB1A 4MS4B 1W48A 4H0CA 2IE8A 3IHWA 5DQGA 1FTGA 5K6RA 1YA8A 3U7QB 4R66A 3ODGA 4JJAA 5IM4A 2FMQA 1GNLA 1MV8A 2G9ZA 1FUEA 2J4FA 2Q21A 2VZ9A 4UUNA 1JFLA 1DK2A 3G6XA 3UJPA 1VE7A 5KG1A 1SZPA 1ZL2A 2GWSA 2OC9A 5EJIA 3IVAA 2AFRA 4K5QA 3IAS1 4Y1GA 1XD8A 3VR1A 4QEDA 2VF4X 3ONFA 2EJBA 4FZRA 4ECXA 2PX4A 3PQCA 1VDMA 3F6BX 3T7DA 2E4YA 2QYSA 3HCNA 3PXEA 1KSPA 3VAYA 3KTFA 1VGVA 3VMFA 1Z0JA 2ZWPA 3EDQA 3OE4A 4MI1A 2ONZA 3PVXA 5K51A 1SHTX 4YIHA 4J9MA 3FBGA 5I8ZA 4FGSA 1TM4E 3LECA 2JRCA 1WHSA 4D4HA 4H60A 3BJYA 1BA2A 4HDRB 4UTNA 1GTL1 3DSRA 3WB1A 5EQFA 4UCQA 3EUEA 4LDAA 2HA2A 5C32A 1QTQA 4ZGGA 1KZ7B 5T14A 5HRCA 2LVBA 1P7CA 5JUMA 1AF7A 1D4OA 4IVNA 2DQYA 3G1TA 1DRJA 3R0XA 2Z2ZA 4MJXA 1YBFA 4YRRA 4JLAA 2CLOB 3I5MA 1SXIA 4NMLA 3V80A 4E5VA 5HUHA 2Q29A 1WABA 2WTAA 1E8NA 1Z00B 4DUPA 1PG5A 1I2MA 5ALEA 3FCOA 3WLFA 4KWEA 4E2FA 3ZEAA 4ETMA 4IRKA 1W6RA 1Y1TA 1W52X 2R7KA 5F1OA 2MU1A 5IJ0A 3AB7A 3KAPA 3SEAA 1RRPA 3MC1A 2BE7A 3JVVA 3WL7A 4YMGA 1E69A 1FFCA 2BI7A 3IQGX 1PFGA 4FP9A 5A03A 3OM0A 3GZTB 4J0GA 5BY2A 1WMBA 5HOQA 3DKIA 5KO2A 5M34A 1P45A 2HHUA 4EAAA 3VI3B 1V26A 2H2WA 1DEKA 1PVQA 5IU6A 3THXA 2KE7A 3PL1A 4TTTS 3OLVA 3HZZA 4Y0NA 3I3SR 3MUOA 4LI0A 1QRUA 1YJBA 1EGMB 3OIFA 2QOEA 3EFOB 3RT7A 2GBFA 2ZS8A 2JCGA 5AP9A 2V4UA 1I0ZA 5CRIA 1YQTA 1IPEA 2WF5A 1GQYA 3ETDA 7ICFA 1YS4A 5EWLB 4ZVOA 4ENUA 2XA1A 1FQOA 2YW9A 1NF3A 3KJGA 5E7MA 4CMCA 2ZXIA 2AEJA 4JBGA 3D02A 3DBRA 3EVTA 3H2IA 2A3VA 3WG9A 3RF6A 5BW8A 1V5WA 5JHGB 3W5AA 3L0BA 4TVKA 4WXYB 2H8GA 3QNUA 4PONA 3IUMA 1PLKA 1SUBA 4E5DA 1G5FA 1GCIA 2A7XA 3QYFA 4HXFB 4IIEA 1ESEA 1WXFA 4QNRA 2FZKA 2XCTB 2RD2A 3FB4A 3ZZUA 1W30A 1JLMA 3NCHA 4LVUA 1O8CA 1V9SA 5BN5A 3PVCA 4FKMA 4I4NA 1Z9BA 1ZU4A 3BMOA 1R8JA 1KKLA 1TTPB 2DF8A 1TKAA 2G8LA 2IXDA 2Y05A 3BD6A 3FMIA 3IJPA 3PXUA 1PJ8A 3SC6A 1JFTA 2I8LA 3P20A 4TVOA 1AQLA 2N42A 4JB2A 5JSZB 3NT4A 1ENPA 4DPKA 2DUNA 1G20A 1R12A 4MPTA 1GCAA 1X1SA 2VRNA 3ICVA 5AW4A 5IILA 1ZN9A 3DZBA 2F64A 3P8ZA 2JLWA 1YFZA 3AB8A 4L5CA 1JSXA 1SXGA 2LE0A 4QWCA 4QHSA 1YFKA 4BQQA 2I2CA 1NNSA 4XLLA 3MVEA 5DRTA 4YMNA 3TLBA 1FC0A 1IH8A 1MQ2A 1FFEA 3SP1A 5HGXA 1KWKA 3MSCA 2C3MA 3U4DA 2HU2A 5DGCA 5JG7A 4YT4A 2YFHA 1PK1B 4RSGA 4KAXA 2VHXA 3MFIA 1QH0A 2IU3A 3D3EA 4YGYA 1GRCA 4DUGA 1RWOA 3S1AB 2QRLA 3IDFA 5BO5A 4RLHA 5J2KA 3UOAB 2CMHA 4JASB 2PH3A 2JZBB 4ONEA 5CW2A 2ET6A 3RUDA 2Z57A 2GZHA 3DDUA 3ZZNA 3CQ9A 2HAEA 2A5JA 3BXHA 1R6AA 5JVDB 5AD1A 1EDBA 7ICNA 3T5PA 2WY2D 3OPNA 3F2BA 3QLUA 3QBTA 4N3GA 1FDRA 2HI0A 2FTKE 2VDUE 3RUFA 2OZPA 1UFOA 2B6NA 2ZWOA 1XRMA 1JDJA 3LBIA 3FMFA 4IIUA 4LXHA 4UFNA 4DJDC 2YY5A 5JQGA 4TTJA 4J0QA 4B83A 3WWOA 2R79A 4JV0A 4GLXA 4N0PA 4N7RA 3H99A 3JQBA 2IDZA 2IOHA 4PQYA 3W8EA 1H2EA 2H3HA 3QVXA 4UTRA 2E21A 1UEIA 3IMCA 4G8JA 3EVBA 4KWTA 3TLCA 1VKZA 2G83A 3V5NA 1CCWA 3EAFA 5B1IA 3R9WA 4KHZA 3KXPA 4KREA 1E3TA 1XHLA 3IQFA 5C3MA 4IDGA 2XQIA 4ECZA 1U0LA 2CHVA 3O1IC 3G6VA 1N5KA 3NWJA 2V0NA 4LXXA 1X6IA 1KO4A 3L8CA 4Z86A 1GQOA 5AOAA 3SR4A 3GCDA 1TK5A 3QVTA 2BCJQ 4PZUA 1Y82A 4XVHA 5LBUA 4AXXA 4YMUA 2QRKA 3VR4A 3EFBA 4K4HA 2C4UA 5LXTF 3V4ZA 2Z9BA 5TSDA 3V7LA 4OLFA 3TL3A 2PZKA 2I6QA 5EMNA 1KPIA 4N03A 1DEXA 1UJBA 4FMDB 4JFRA 3V4LA 4V1CA 5K0CA 1DELA 5FNVB 1C8BA 3ZWWA 4E4YA 4KMSA 3IDZA 1WXHA 3EDMA 1W87A 4MQEA 4MTCA 4ZXPA 5BWMA 5IJZA 3K92A 2LCFA 3V2HA 1CY1A 4OOEA 5E6RA 1RBYA 4OOFA 2KW5A 4AN0A 3S28A 3U60B 4RIEA 4OG2A 3A4TA 1C3OA 2VQSA 2QKQA 2QTVA 3UAWA 4D8XA 2Z3VA 1JLKA 3ZX5A 4O3RA 3BTOA 3CJTA 3ZNPA 4COKA 5GJCA 1B3RA 3QUQA 2YY6A 3FNHA 1WB4A 4QXMA 5DHFA 3SAJA 5D6NA 3UHAA 5IDWA 4WY2A 2KEYA 3NC4A 2UZ4A 4KUGA 4DCPA 1RRGA 3AHEA 2RIPA 1QUFA 3QYJA 4C7KA 1U3CA 2PX6A 1WZEA 3LY9A 1ZPDA 2RHCA 2Q3LA 5ADUS 1PL8A 3VSCA 2EJVA 1CETA 4B3TB 2Z9CA 4OXNA 1KGDA 3DTVD 4J3FA 4X6LA 2QV7A 4IHJF 1NC3A 4GEGA 2QTFA 1YOBA 3EXHB 1M33A 2WBLC 4R8UA 4D4JA 4WLUA 5EOVA 1YT3A 1ZQUA 1KSGA 4CM3A 1I51A 2O8CA 1H2ZA 4DCCA 4FDTA 4CE6A 3CLUD 1U45A 1YR8A 1J06A 3I5AA 3O31A 4K87A 3ZE0B 1FSPA 4FVTA 4AY4A 2V59A 1JHRA 4I4TA 3GLUA 5HIMA 3EZ6A 5DKWA 5CX4A 2EDCA 2YC4C 3ZDBA 4L8GA 4PGMA 5IZ4A 1TKDA 1KORA 1XDGA 2WG1A 1K0UA 2ZRLA 3EUWA 3B78A 3T3FA 1E94E 3TLJA 2OZKA 3BGIA 1WCV1 4CEJA 1U8UA 4WBNB 2PWBA 2WU3A 5C5IA 5LQMA 1G98A 1NM5A 2PQ2A 3OPYA 4LIPD 3ZJYA 3SX4A 2O2ZA 4TUQA 1XTUA 2VHCA 4Y1RA 3VV3A 4BJ1A 4L16A 4WDRA 4X8HA 4C88A 4I2JA 1PZGA 2FKAA 3CLTC 4CFZA 1U6JA 4GYJA 2WTMA 3TNYA 3FHTA 4NVRA 3R3XA 3IMKA 3R3ZA 4J0IA 5A4DA 1JGTA 4GUAA 1XPRA 1USKA 1JDNA 1II0A<