1DK3A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
b'MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 18
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk3A00
4UB4A 2FMQA 4YCXA 5IIIA 4I2EA 5DBAA 3LK9A 8ICSA 9ICTA 4LVSA 4RQ7A 4NY8A 4O5CA 4PHEA 4RQ6A 4KLLA 9ICXA 5J0TA 3RJGA 4M0AA 5J0RA 3C2KA 5J2IA 4NLZA 4M9LA 8ICNA 4QZHA 3RJEA 1BNPA 9ICQA 3AUOA 3RJKA 3C2LA 4PHPA 2BCRA 9ICRA 9ICUA 5D4BA 3PMNA 4F5NA 4O9MA 1KEJA 4XA5A 4RQ4A 1ZQTA 9ICOA 5IIOA 3AU6A 3RH5A 5DB8A 4QZCA 5DB9A 5BOLA 1BPXA 2FMPA 4KLOA 4KLDA 4Z6EA 4UB2A 4DOBA 4RQ5A 1ZJMA 2BCVA 1ZQCA 1ZQEA 4M2YA 1ZQRA 3RJHA 4UB5A 3V7JA 7ICVA 4QZ9A 4RT2A 1TVAA 4RQ1A 5DBBA 4GXIA 7ICOA 4F5QA 1HUZA 1ZQFA 5J2EA 4I2CA 4M9NA 8ICWA 1ZJNA 2ISPA 4RQ2A 3HX0A 8ICUA 4QZIA 3JPRA 3ISBA 4KLJA 4I2GA 4QZAA 4YMNA 1DK2A 4UAWA 9ICLA 7ICTA 8ICTA 7ICJA 1ZQMA 5J2AA 4QZBA 4RPZA 1MQ3A 5J2BA 8ICVA 4KLQA 7ICGA 4RPXA 9ICFA 4YMOA 4PHAA 8ICZA 3B0YA 3MDCA 3C2MA 8ICJA 9ICNA 1RZTA 7ICRA 5J2HA 5IIJA 3PNCA 4KLEA 3UQ2A 2FMSA 3JPTA 1XSPA 2I9GA 4Z6DA 5J2GA 4JWMA 3UXOA 3ISCA 4QZ8A 4I2FA 1BNOA 4KLFA 4IQTA 5HHHA 4M9JA 7ICKA 2PFQA 4IQUA 7ICPA 5J2KA 9ICVA 3V7LA 5J0UA 4GXKA 7ICUA 1ZQQA 2IHMA 4X5VA 9ICWA 1JMSA 5IIMA 3JPOA 4F5PA 3RJIA 4RPYA 3TFRA 4K4IA 3RH6A 2BPFA 1XSLA 4YMMA 9ICSA 1BPDA 4TUSA 7ICLA 8ICQA 3UQ0A 9ICPA 9ICHA 2W9MA 4YD2A 1BPZA 4QZDA 3HW8A 4I2AA 4M47A 4MFAA 8ICYA 4I27A 4MF8A 3TFSA 4MFCA 3V72A 9ICBA 4NLKA 1NZPA 5J0QA 4NXZA 3V7KA 5J0OA 5J2JA 3UPQA 4M9HA 4P2HA 5TZVA 9ICKA 4LZGA 2P66A 2BPGA 1ZQSA 2GWSA 4XUSA 7ICNA 4DOCA 4I28A 4UBCA 4PHDA 7ICIA 4NM1A 1ZQAA 8ICXA 9ICEA 7ICEA 4QZEA 5D46A 4JWNA 4R66A 5IILA 3RJJA 5J2CA 9ICJA 3OGUA 1ZQIA 8ICEA 8ICPA 5J2DA 2BCSA 7ICQA 4RQ3A 4FO6A 3B0XA 4Z6FA 3MDAA 4R63A 4DO9A 8ICRA 5HHIA 4F5OA 4I29A 4Z6CA 1BPYA 1ZQKA 3GDXA 3PMLA 5DB7A 3C5FA 4PGQA 4R64A 1HUOA 4KLHA 9ICAA 9ICIA 1MQ2A 3HWTA 5IIKA 3JPSA 4O5EA 3RH4A 5J0XA 4TUPA 8ICOA 5J2FA 2KP7A 3C5GA 4PPXA 1BPEA 4I2IA 5J0YA 7ICFA 1ZQOA 4I2BA 4RQ0A 4NLNA 4I2HA 4K4HA 5CWRA 5J0WA 3JPQA 3MBYA 3JPPA 5BPCA 1ZQGA 4O5KA 9ICGA 4KLMA 4MF2A 2PFOA 4UAYA 4YD1A 2PFNA 4R65A 5EOZA 8ICGA 2ISOA 8ICKA 4QZGA 5DB6A 1ZQNA 2BCUA 1ZQPA 3UXPA 3AU2A 4YN4A 4PH5A 4M9GA 3UXNA 5CB1A 8ICLA 1ZQHA 8ICAA 5J29A 4KLGA 4F5RA 4M04A 5DBCA 1KDHA 4I2DA 4KLTA 5DDYA 4UB1A 8ICBA 8ICHA 4IQWA 1TV9A 4NM2A 4KLSA 4QZFA 3ISDA 1ZQDA 4KLIA 8ICCA 9ICCA 7ICHA 3MGHA 4PGYA 4RQ8A 8ICMA 1ZQJA 3JPNA 8ICFA 4GXJA 4TURA 4K4GA 2BCQA 1ZQBA 4DOAA 1XSNA 4KLUA 9ICMA 5IINA 5J0SA 5DKWA 7ICSA 3MGIA 4PGXA 4UBBA 1DK3A 8ICIA 4RT3A 5D49A 1ZQLA 3RJFA 4I2JA 2PXIA 4UB3A 4UAZA 2PFPA 4LZDA 4IQVA 5BOMA 4TUQA 7ICMA 5J0PA 4MFFA
chains in the Genus database with same CATH superfamily
2KOBA 2YMMA 2FMQA 4YCXA 2ZUBA 5ALNA 5IIIA 2MUTA 3LK9A 2OM6A 1QQ6A 5KFRA 1Q46A 4RQMA 3TANA 2ALZA 1CI4A 1U47A 2LYHA 1Z3EB 2FDRA 4M0AA 5J2IA 4NLZA 8ICNA 2HW3A 2W54A 4EBEA 2KFZA 3KHGA 3RJEA 1KSPA 2KD1A 3V6HA 2K4IA 5KG4A 3AMZA 4P4OA 9ICQA 1X9MA 4YXMA 2V4RA 5AKJA 4DFJA 1NZBA 5AM1A 2Y1IA 1L7NA 1RDFA 3QU7A 4F5NA 1SV0C 4FZNA 4FZMA 4KX3A 4RQ4A 2NRVA 5IIOA 2E8MA 1L5UA 2KZMA 1ZRNA 2XO7A 4QZCA 1URJA 4HYKA 5DB9A 4KLOA 2KNJA 1WG8A 2E8NA 3HKZF 4DFPA 4QWEA 4DLEA 4KLDA 1NK6A 4B6JA 2I6XA 3ZDAA 4HAIA 3H4DA 3SR6A 1JRPA 2W11A 5KFCA 1RYUA 1KQQA 2WF6A 2LHTA 4US9A 4YXJA 2V9WA 2E1EA 5EWGA 5ALUA 4UB5A 1TFRA 7ICVA 1L8LA 4QZ9A 3IG8A 1SKWA 1MSWD 4J9PA 3H7IA 3N4MB 3UMBA 5DBBA 4DSIA 4Y2VA 5KFYA 4F5QA 1BVSA 3K75D 1CEZA 1ZQFA 1HEKA 4Y2JA 4RQ2A 4QZIA 4ICAA 3JPRA 4ECXA 3M9MB 4QZAA 2KK0A 1DK2A 1JI7A 2VA8A 3Q8RB 3KTQA 3NRZA 1SXDA 2F76X 3KHHA 1XU4A 1KL9A 2PMZC 3VCBA 5J2BA 3TI0A 2MU2A 9ICFA 4YMOA 2K8BB 3CNHA 5J2HA 4C8KA 2K89A 5AM0A 3RB3A 1BPBA 2FMSA 2VA2A 2R8HA 2DKZA 5AICA 2BGWA 4Z6DA 3OSPA 4IRCA 2IHNA 1UCVA 1KN5A 2ASDA 4IS7A 1BNOA 3RBDA 1ZXIA 1HJPA 3ZD8A 4BWMA 3C28A 2WB1F 4RZRA 4DS4A 5KG7A 5CJ7A 3BQTA 2PFQA 5J2KA 4ED3A 4MEYA 5J0UA 4O3RA 2A1AA 9ICWA 2RDIA 5IIMA 5ALQA 3RJIA 1HIWA 3DV9A 4RPYA 1V97A 4DCCA 4FS1A 4K4IA 3RH6A 5HR7A 4YMMA 9ICSA 2GO7A 1SZHA 2ZTDA 1RXWA 1BGXT 4PJ0U 4ZH4A 2M9NA 1C7YA 7ICLA 1Q3VA 3UQ0A 5GTIU 4YD2A 3E2EA 3SYZA 4MFAA 3IP4B 2HOIA 4I27A 2YB4A 3TFSA 4MFCA 1NNLA 2Q0ZX 3FYHA 3SMVA 4O3SA 5AI0A 2NYVA 1NZPA 5J0QA 3CRXA 4NXZA 2XVTA 2FLLA 2EQYA 4JUZA 5J0OA 4C4RA 4DEZA 1CUKA 5TZVA 2Y9TA 4UW9A 2P66A 1ZQSA 4F2SA 2GWSA 1Z00A 1RG6A 4DOCA 3CP8A 3H8MA 5JTIA 4ELUA 2HBLA 1TAUA 3SENA 2AQ4A 2OHFA 3I76A 1NK9A 3EYZA 2XY6A 5EE9A 2NV3A 5J2CA 3OGUA 2BPCA 4MHVA 4C0ZA 4BDPA 4DLGA 2BCSA 5AKEA 1VJ5A 1O03A 3I28A 2DWQA 3BZKA 1SZPA 1PVPA 4Z6CA 2W9AA 4F8RA 1ZQKA 1N60A 4G9BA 4B9LA 1U48A 2ZXIA 4MEXA 4O3MA 3KHLA 2G5IB 1ZOLA 2H3IA 3JPSA 4O5EA 4CF4A 4M6WA 2I1QA 2W7OA 1SWVA 5AHXA 1DXSA 1L3VA 5CRXA 1OUQA 5J2FA 2HOQA 3F53A 1T3NA 3OTQA 4F91B 4ELVA 2WHEA 4AYBC 3MFHA 4PZOA 4ECWA 7ICFA 3ONNA 2XY7A 5AKZA 3HJEA 4NLNA 1N5WA 4Q8FA 2VJ4A 4K4HA 3SV3A 1QSLA 3O0FA 3TKAA 1U45A 4F4XA 4F4KA 4RNOA 3Q8KA 3BQ1A 9ICGA 4B9VA 1L7MA 2ES6A 3QYPA 3BQ7A 3HPOA 2JEGA 3BS5B 1S9FA 5AKLA 5ALWA 3WKDA 4R8UB 1TAMA 2BR0A 5CHGA 4QIWF 3BS5A 2G08A 1PK1B 4P0QB 5EOZA 2ISOA 2EAMA 3QU2A 1PK1A 1FEZA 1ZQNA 2KEYA 3PV8A 2BCUA 4KN7A 1PZNA 3PX6A 2EAPA 2R8KA 4PH5A 5DDMA 5ALRA 8ICLA 5TISU 1COOA 5J29A 2G09A 4F5RA 2ZIWB 4DFDA 1TK0A 5DDYA 8ICBA 2XC9A 2ZIWA 1JIHA 1TV9A 1UHUA 2Y0SC 4QZFA 4YR2A 1LVHA 5KFJA 2IBKA 1ZQDA 4J9SA 4OCZA 5HR6A 2R8JA 4Y2UA 4ACOA 4KLIA 4UAUA 3SAHA 1KLNA 3HRDD 4PGYA 2UVVA 3M6KA 1XS9D 5KFZA 5CR0A 2CXYA 4TURA 5L1KA 2BCQA 1L6NA 3D2NA 4C7ZA 4F93B 4DOAA 2W55A 4KLUA 5J0SA 1RXVA 1NJXA 1PUZA 2ASLA 1ZRMA 2MSNA 2VANA 4UASA 2DUYA 1Z1BA 4DSJA 5D49A 5KT2A 3Q8SB 3EPGA 1Z1VA 1S97A 3S6JA 3TAQA 3N7RC 2PXIA 3QU9A 1TKDA 4UQGA 4J9KA 2HBJA 3NRWA 4IQVA 3PW0A 3PX4A 3GFKB 2ATLA 4TUQA 5J0PA 1D8YA 1NI3A 4UB4A 3C23A 2R18A 2JEIA 5A0LA 3T5JA 3SV4A 2BDPA 5ALKA 2KJ9A 1Y88A 1U4BA 1KW4A 4NY8A 4WJ3B 2HVHA 2KJ8A 4PHEA 3MR6A 3WK9A 5KT6A 5J0RA 3ZDEA 2DBYA 2FPMA 1MN8A 3HKZC 1RYSA 3GIMA 3AUOA 2QB0B 2BCRA 4F4YA 5KG3A 9ICRA 2HDOA 2KTQA 3PX0A 1J2MA 4RUCA 2LYAA 5D4BA 4F3OA 1ZD3A 2BQ3A 1NKEA 4G3IA 5B5EU 1KFTA 3SEIA 4TQSA 1ZQTA 9ICOA 2W9CB 4OJPA 5F3XB 5KFGA 3ALRA 2W9CA 4YVZA 3RF9A 3LWMA 5KT7A 1BPXA 1JXEA 2J6UA 2JEFA 3SD7A 2OEHA 1L7PA 2W3RA 2BDUA 3BJYA 4UB2A 4E0DA 3AM9A 3N7SC 1V38A 4C80A 1P7DA 2BCVA 2H5XA 1ZQCA 3LVVA 2G5HB 3KD3A 3WK6A 1YT3A 2KIWA 5ALOA 5ALHA 3KFUF 3G6XA 1D8BA 2M0NA 2C22A 3PW5A 5DQGA 3H8JA 3M8SA 1B0XA 1JN3A 1HUZA 3LDAA 2YQEA 2C2EA 3QE9Y 2F3NA 4ECYA 4ZOHC 2OCEA 4EEYA 3HX0A 8ICUA 2GOLA 1SV0A 2EAOA 4YMNA 3WKAA 3F2DA 3QZ7A 4ED8A 1WWVA 2JHDA 1NK7A 7ICJA 3H0RB 5J2AA 2FI1A 4QWDA 4DSFA 1MQ3A 1KRPA 7ICGA 5EE3A 4YG2A 4F2RA 5KL1B 4CDGA 4RPXA 2WB1C 1A77A 4PHAA 3H4BA 4DSEA 2FLPA 1WUDA 4BXOB 1J97A 8ICJA 9ICNA 2ZIUB 3GIKA 3EPIA 2N1RA 4KLEA 5KG1A 4BXOA 2F77X 2JXJA 5AM3A 4O0IA 2ZXHA 2LMRA 3IN5A 1LB2B 3ISCA 4FZLA 3IG5A 3C29A 3BS7A 3M1YA 2W8KA 1B4FA 4M9JA 1N62A 5AKXA 5KT3A 5AKIA 4IQUA 2V4QA 4ECRA 9ICVA 3V7LA 1DGJA 3QX7A 1QQ5A 3WK5A 1WYGA 4GXKA 7ICUA 2IHMA 4UATA 2JR5A 5KFBA 4X5VA 1JMSA 2RP5A 4F5PA 5ALDA 4O3QA 1UT5A 1PVRA 1D9FA 2JEJA 2DKXA 3NUQA 2J6TA 4TUSA 3ED5A 2A1JB 8ICQA 9ICHA 2DPIA 2H3ZA 2W9MA 2GLEA 2B0CA 4QZDA 3HW8A 4DL2A 2BQRA 4PL2A 3GV7B 1MA7A 3V72A 5EWEA 4ED7A 3E58A 4NLKA 4EYIB 2AHOB 2OH2A 2KE7A 5G5HA 3EUB2 3V7KA 2UVUA 5KT4A 3MABA 1KKXA 4P2HA 5KG5A 9ICKA 1ZYQA 2ZG6A 2BPGA 3OHAA 3WK4A 2P6UA 3SQIA 4IL6U 1JUDA 3BDPA 1ECWA 4EENA 2KN7A 7ICIA 4NM1A 3PW4A 3QEBZ 5KFQA 2ZIVB 9ICEA 5KFPA 3ZDCA 3GILA 4R66A 5IILA 2B21A 4DL4A 3RJJA 1SL0A 2F1JA 1NK8A 3WKEA 3I1YA 4QWCA 1NKCA 2RRDA 2HOFA 2XGQA 4A8EA 4UAVA 2LKYA 2QLTA 1ZD5A 2KZZA 4EBCA 4FO6A 4Z6FA 2DGZA 3MDAA 4C8NA 3T5LA 3GV5B 5L1IA 3QUTA 8ICRA 2WF7A 4DSKA 2QB1A 4Q43A 3GIJA 2IA6A 5DB7A 3AL0B 1KTQA 4BWJA 2JGAA 3HWTA 4KITB 5IIKA 1SB3C 1ZQ1C 3H40A 3NVZA 5AI6A 3UMCA 2R8GA 4FE3A 3C5GA 4DS5A 4QIWC 1IG6A 1BPEA 3C1ZA 3MR5A 4I2IA 5KFHA 5J0YA 2HHSA 3G6YA 2RHFA 3CYMA 4F71A 1KBUA 3ZD9A 4C8OA 5KAIU 5CWRA 5J0WA 3MBYA 4EELA 4OJ6A 4RNNA 3JPPA 4FBUA 3KZIU 4O3PA 4O5KA 2UVRA 2PFOA 3VC8A 4YFKA 4UAYA 2JH1A 2ZJ8A 2XY5A 2C2RA 2Y9UA 5AKHA 2VA3A 3N97B 8ICKA 3PSTA 2FLNA 1ZQPA 2YX8A 3AU2A 5L1JA 3M9NB 1A0PA 3UXNA 1ZQHA 1UPHA 4YQWA 2IOFK 3A0BU 5DQIA 4M04A 4Q45A 1VDVA 3TQ1A 1LV5A 4KLTA 5ALPA 2K60A 3ISDA 2IMWP 2KSOB 3RRGA 3WK8A 2QKQA 3ZI4A 7ICHA 4DQSA 8ICMA 2E3TA 5ALJA 5GTHU 1NKBA 2Y1JA 2YY6A 3MR3A 4EZ6A 1MC8A 5K4LA 3GQCA 1QTMA 4NLCA 5DGBA 3L4PA 2YMPA 4OJLA 2FPKA 1KFDA 7ICSA 4USAA 1SKRA 4PGXA 5ALMA 2MAXA 4UBBA 4NJ8A 1DK3A 3H0MB 8ICIA 3V6KA 4Y2TA 4P4PA 2CPRA 2BHNA 4YR0A 3RJFA 5KAFU 2OWOA 1OW5A 4Q8EA 4F4WA 4FS2A 4YR3A 4OJOA 3SZ2A 4MFFA 4ELTA 4KTQA 4UARA 2LM1A 3G6VA 3PSIA 4I2EA 5DBAA 3EWAA 2C28A 8ICSA 2A3VA 2JZBB 1FFUA 3J81j 4LVSA 1JALA 4RQ7A 4O5CA 2W8LA 2JV3A 2JZBA 2XCAA 4J9NA 9ICXA 5J0TA 4M9LA 4O3OA 2F1HA 5EWFA 2KFNA 4UB6U 4Y2QA 2YTUA 1NK5A 1BNPA 2QARB 2ZTEA 3QUQA 3QUCA 4RQNA 2HI0A 1C20A 2WF9A 2FJ6A 3PMNA 2DF4B 5F9LA 4O9MA 4J03A 4XA5A 2EZXA 5AM2A 3GZFA 1TE2A 4OO1J 2BZFA 4US8A 3SAFA 3RH5A 4DQQA 5DB8A 4B9NA 3WKBA 4R8UA 3GU3A 2H3QA 4ED0A 2FMPA 4P0QA 2HMXA 5HNKA 3SAGA 1UT8A 1ZQUA 4OD0A 5KFOA 4RQ5A 1XWLA 2KKPA 4CE6A 2NRZA 4M2YA 1L3UA 3U26A 3RFAA 4IRKA 3V7JA 4DL6A 5DG7A 1TVAA 1IXRA 2LYBA 4GXIA 3F5EA 1SGGA 4C4SA 2HBMA 2F8KA 5KG6A 5J2EA 4I2CA 5AM5A 1SV4A 3KKAA 1ZJNA 2A19A 4KLJA 3ISBA 3DDHA 1X9XA 3H0LB 5ALYA 2K4HA 2MRLA 8ICTA 1SKSA 1F44A 2E8PA 5KT5A 1ZQMA 5G5GA 4RPZA 4J9MA 4B9UA 4J9RA 5KG2A 3K4GA 3AQFA 3B0YA 3UM9A 3ZDDA 1LKYB 3MDCA 2LI6A 1AROP 4EBDA 1RZTA 2HHWA 3PNCA 1LKYA 3UQ2A 3GIIA 3EZ5A 2Q4TA 2HVIA 4JV0A 1XSPA 4Y2YA 4QNLA 5DQHA 1XO1A 2NRTA 3RB4A 4P0PB 1TK8A 3NS1A 3N7PD 4KLFA 3RAQA 4IQTA 4EYHB 5HHHA 4P0PA 3B9JA 3T5KA 5AKGA 4J9QA 4DQRA 2K8CB 2W03A 5AI8A 5KL8B 7ICPA 3KKAC 3PR4A 1B22A 2LM4A 1ZQQA 2QB0A 1NK4A 3WK7A 2OYYA 3KHRA 3R9KA 3V6JA 4CNQA 4NL9A 3TFRA 5KFUA 2BPFA 1J2NA 2Z7JA 3QU5A 1BPDA 4CGZA 2HHVA 2LPEA 4CRXA 2HHUA 5ALFA 1X40A 5T14A 4DQPA 4I2AA 2RLTA 8ICYA 3HT3A 3OPXA 2WFAA 1X42A 3MFIA 1FIQA 3F2CA 1H38A 3T79A 1K1QA 4ECUA 4C4TA 2KG5A 4Y2PA 5J2JA 3UPQA 4M9HA 4LZGA 5AM4A 2L5YA 7ICNA 4I28A 1QH9A 1QQ7A 1NJYA 1RQNA 4UBCA 1K5OA 1RM6C 1B43A 3T5HA 1ZQAA 7ICEA 2KVCA 4QZEA 5D46A 4JWNA 5C5JA 3C21A 1Q3UA 1X66A 5ALTA 5ALXA 4NL9C 3D2QA 4NWIA 1ZQIA 2H3VA 8ICPA 5J2DA 4TQRA 3PY8A 7ICQA 3QEAZ 5KFDA 3B0XA 2WAQF 4F4ZA 4C7YA 1F0MA 1XC9A 5ALVA 5HHIA 4I29A 2ZIUA 2NO5A 5KFIA 1BPYA 3IV6A 5KFFA 4GLXA 3RB0A 3PVXA 2AGPA 2YMQA 3PMLA 4Y2XA 2ZUDA 4PGQA 5AKYA 3RTVA 1NK0A 1HUOA 4KLHA 9ICAA 3TAPA 2F44A 3RH4A 2ZTCA 5HMLA 4TUPA 4BUGA 8ICOA 2R8IA 3DEEA 2K4EA 2KP7A 1IM4A 1A6SA 2UVWA 2G07A 2JRZA 4JK1A 1JX4A 4I2BA 4I2HA 4O3NA 1EXNA 5L1MA 1T94A 4GFJA 4BGDA 5HMMA 4EX6A 1S0OA 4IRDA 5BPCA 2AJQA 2HBKA 1XO0A 1Z4NA 5ALGA 4MF2A 2O6KA 2G06A 1UQVA 2A1JA 4NV0A 1JROA 2PFNA 1D9DA 4DFKA 4B9TA 2W7PA 5B66U 8ICGA 3RB6A 1N56A 5DB6A 2LBOA 1SIJA 5AIBA 4F92B 3TACB 4KMOB 3Q8MA 5CB1A 2IOHA 4IC9A 1WCNA 3QZ8A 4C8LA 1N5XA 4ED6A 4DQIA 5EE1A 4I2DA 1ZQYA 4UB1A 3M8RA 2ASJA 2NO4A 4IQWA 2C2DA 3MGVA 4KLSA 4ECSA 4DSLA 1S77D 2KVSA 1TK5A 3FAHA 4RUAA 4PL1A 5AK6A 2ZIVA 2ZJAA 3BQ2A 1YZ6A 3MGHA 4RQ8A 4PZNA 5KG0A 3JPNA 2FPLA 1ZQBA 3ETRA 3NGDA 3RAXA 1T7PA 1QSSA 3PSPA 2VKQA 3IDWA 2VJ5A 4KMUA 5IINA 2PI4A 4CCHA 5ALIA 1IIPA 3MGIA 4NLBA 1SXEA 5AI9A 3QU4A 2XCPA 5KFMA 4RT3A 2JH7A 5KFSA 4B9SA 4KN4A 1D8LA 4I2JA 4UB3A 2PFPA 5DG8A 4NLGA 2AXTU 4Y2SA 1N2XA 5BOMA 4JB3A 5J8YA 7ICMA 3D2SA 5C0YA 2H3FA 1A76A 2KKVA 9ICTA 1X6IA 4LJXA 4XQ8A 3N28A 1RYRA 4CF3A 1DGSA 1Z4OA 3GV8B 2CN1A 4YP3A 4RQ6A 5JUMA 2PKEA 3F2BA 4KLLA 5FP0A 3RJGA 3C2KA 3AN1A 1ZETA 3PO4A 4J9LA 3T3FA 4QZHA 3OSNA 3IRUA 4U6PA 3RJKA 3C2LA 2YN4A 3EW9A 4PHPA 4GC7A 4QWBA 9ICUA 4C8MA 4ECQA 2KV2A 1KEJA 3BZCA 3K1RB 3M7DA 3RR8A 4ECZA 2W9BB 1DRGA 1V9PA 4F72A 3AU6A 3HILA 2W9BA 5BOLA 3NVYA 1RPLA 3ZDBA 3BQ0A 2DL0A 2AH5A 5J8YC 3RBEA 3PSFA 3PR5B 2WF8A 2ZUCA 3Q8PB 4Z6EA 4DOBA 3NTUA 5L1LA 1NOMA 2OXOA 1S0NA 1ZJMA 5CP2A 2K4PA 4EEKA 1SWWA 1ZD2P 1ZQEA 4QWAA 5AI4A 5AK4A 1ZQRA 3RJHA 2YB1A 4FFDA 2KIVA 4DF8A 2F2AB 2WTFA 4RU9A 4RT2A 1Z00B 1DOQA 4RQ1A 1UA1A 2J6SA 2VIXA 7ICOA 5DG9A 5JU5A 2KSOA 3SI8A 2W04A 4M9NA 8ICWA 3Q8QB 1RQLA 1KFSA 2ISPA 1IV8A 2DQNB 2I5HA 4I2GA 1Z19A 2HSZA 5CA7A 3OJUA 4UAWA 9ICLA 3FM9A 3L5KA 7ICTA 4J9OA 4QZBA 8ICVA 4KLQA 5KFWA 2ESEA 5AKKA 3H8SA 3PO5A 1WCLA 8ICZA 1PVQA 4FBTA 2WF5A 1TAQA 3AEVA 3C2MA 7ICRA 3MR2A 5IIJA 1CRXA 2D8CA 1Q8KA 4JV1A 3JPTA 5H2FU 2W3SA 4OJ5A 3F5AA 2I9GA 5J2GA 2ODGA 4JWMA 1L3SA 5DGAA 3QNMA 3UXOA 4M6WB 4AP9A 4F50A 2PMZF 1M6YA 1X6JA 4CF5A 4U7CA 2AGQA 4QZ8A 4I2FA 1NJWA 5KFTA 4DWIA 3PW2A 1PK3A 2IOFA 7ICKA 3H8WA 1QCKA 2FE9A 3L3FX 3PW7A 1FO4A 2QARA 5KFXA 3JPOA 3ORYA 1X9WA 5KFLA 2EH9A 1YZ7A 2HHXA 4ECTA 1XSLA 3A0HU 3NVWA 1QSYA 2F8LA 1V85A 9ICPA 5ALZA 3KBBA 2W43A 1BPZA 4EX7A 2AGOA 4M47A 1S5LU 2RDJA 4MF8A 3OJSA 9ICBA 4DL7A 3MC1A 5KFAA 2ZIXB 2E8OA 4Q44A 1ZQWA 4DF4A 2EZZA 5L9XA 2ZIXA 5DLFA 3IM1A 2JMGA 2F1IA 4XUSA 4BX9C 1S10A 2WAQC 1F5SA 2EZYA 3RRHA 2KICA 1VLBA 1S0VA 4PHDA 2DFLA 2P6RA 2YMLA 8ICXA 4UB8U 2KHVA 4DL3A 1U9LA 5KTQA 1L3TA 9ICJA 8ICEA 2G0AA 5EE0A 2EDUA 2RQ5A 1ED1A 2AQ0A 5KFNA 2HCFA 1SL2A 1ZQVA 2DPJA 2D6FC 1T8EA 4RQ3A 2XI9A 5ALLA 4R63A 1O08A 3E0FA 4GIBA 2KZ3A 4DO9A 4QJFB 4DFMA 2KMDA 3AQEA 3RR7A 4F5OA 1JXLA 1U49A 2CRXA 5KFEA 1ZD4A 3GDXA 3NASA 2E5SA 4JV2A 3C5FA 3D6JA 4R64A 3M9OB 4QW9A 5E79U 4ED2A 2B6GA 4JMUA 2K8AA 3QXGA 9ICIA 1MQ2A 3TADA 3NVVA 3PZPA 5AIAA 5HP4A 4P4MA 2EANA 5J0XA 1T3QA 2BQUA 1ZQZA 3FC4A 4B9MA 2AU0A 1QLNA 1OXJA 4PPXA 3IHQB 3HP6A 2HHTA 3QUBA 3Q8LA 2D3DA 1ZQOA 2P35A 4RQ0A 1X2IA 4DL5A 1X9SA 3LWLA 2KHQA 1L8OA 3ICXA 1N61A 3JPQA 5ALEA 1ZQGA 4KLMA 1L7OA 3M6ZA 3KZXA 4YD1A 1XNSA 4EZ9A 3K1ZA 1AQ6A 2NRXA 3C1YA 4R65A 5KNIA 4AYBF 2XICA 1S76D 1UA0A 5F9NA 5AK3A 5AI5A 5AK5A 1SL1A 4QZGA 3UXPA 2NRWA 4BJQA 4XRHA 4YN4A 1K1SA 4M9GA 4QW8A 3TADC 3ETLA 8ICAA 4RNMA 3FDSA 3UMGA 2E1FA 4KLGA 1NJZA 5DLGA 3OHBA 5DBCA 1KDHA 2HHQA 3CW2C 2GH1A 3WU2U 1S8OA 8ICHA 1COKA 4NM2A 4IR1A 3THVA 2XIDA 4ECVA 1N48A 3KOOA 5ALSA 2BKEA 4KX5A 8ICCA 2KJ5A 1N63A 9ICCA 3WKCA 2ZJ5A 1FFVA 1ZQJA 2MA1A 8ICFA 4GXJA 4K4GA 3TARA 5KFVA 1S0MA 5CEHA 1ZQXA 3LVWA 4IR9A 5JRTA 1XSNA 9ICMA 1WWUA 5DKWA 2PI5A 1GO3F 2Y0SF 4GC6A 1ZQLA 1T4GA 5KFKA 4Y2RA 3LYSA 4UAZA 4LZDA 2MUTB 2XGPA 4ED1A
chains in the Genus database with same CATH topology
4UB4A 2FMQA 4YCXA 5IIIA 4I2EA 5DBAA 3LK9A 8ICSA 9ICTA 4LVSA 4RQ7A 4NY8A 4O5CA 4PHEA 4RQ6A 4KLLA 9ICXA 5J0TA 3RJGA 4M0AA 5J0RA 3C2KA 5J2IA 4NLZA 4M9LA 8ICNA 4QZHA 3RJEA 1BNPA 9ICQA 3AUOA 3RJKA 3C2LA 4PHPA 2BCRA 9ICRA 9ICUA 5D4BA 3PMNA 4F5NA 4O9MA 1KEJA 4XA5A 4RQ4A 1ZQTA 9ICOA 5IIOA 3AU6A 3RH5A 5DB8A 4QZCA 5DB9A 5BOLA 1BPXA 2FMPA 4KLOA 4KLDA 4Z6EA 4UB2A 4DOBA 4RQ5A 1ZJMA 2BCVA 1ZQCA 1ZQEA 4M2YA 1ZQRA 3RJHA 4UB5A 3V7JA 7ICVA 4QZ9A 4RT2A 1TVAA 4RQ1A 5DBBA 4GXIA 7ICOA 4F5QA 1HUZA 1ZQFA 5J2EA 4I2CA 4M9NA 8ICWA 1ZJNA 2ISPA 4RQ2A 3HX0A 8ICUA 4QZIA 3JPRA 3ISBA 4KLJA 4I2GA 4QZAA 4YMNA 1DK2A 4UAWA 9ICLA 7ICTA 8ICTA 7ICJA 1ZQMA 5J2AA 4QZBA 4RPZA 1MQ3A 5J2BA 8ICVA 4KLQA 7ICGA 4RPXA 9ICFA 4YMOA 4PHAA 8ICZA 3B0YA 3MDCA 3C2MA 8ICJA 9ICNA 1RZTA 7ICRA 5J2HA 5IIJA 3PNCA 4KLEA 3UQ2A 2FMSA 3JPTA 1XSPA 2I9GA 4Z6DA 5J2GA 4JWMA 3UXOA 3ISCA 4QZ8A 4I2FA 1BNOA 4KLFA 4IQTA 5HHHA 4M9JA 7ICKA 2PFQA 4IQUA 7ICPA 5J2KA 9ICVA 3V7LA 5J0UA 4GXKA 7ICUA 1ZQQA 2IHMA 4X5VA 9ICWA 1JMSA 5IIMA 3JPOA 4F5PA 3RJIA 4RPYA 3TFRA 4K4IA 3RH6A 2BPFA 1XSLA 4YMMA 9ICSA 1BPDA 4TUSA 7ICLA 8ICQA 3UQ0A 9ICPA 9ICHA 2W9MA 4YD2A 1BPZA 4QZDA 3HW8A 4I2AA 4M47A 4MFAA 8ICYA 4I27A 4MF8A 3TFSA 4MFCA 3V72A 9ICBA 4NLKA 1NZPA 5J0QA 4NXZA 3V7KA 5J0OA 5J2JA 3UPQA 4M9HA 4P2HA 5TZVA 9ICKA 4LZGA 2P66A 2BPGA 1ZQSA 2GWSA 4XUSA 7ICNA 4DOCA 4I28A 4UBCA 4PHDA 7ICIA 4NM1A 1ZQAA 8ICXA 9ICEA 7ICEA 4QZEA 5D46A 4JWNA 4R66A 5IILA 3RJJA 5J2CA 9ICJA 3OGUA 1ZQIA 8ICEA 8ICPA 5J2DA 2BCSA 7ICQA 4RQ3A 4FO6A 3B0XA 4Z6FA 3MDAA 4R63A 4DO9A 8ICRA 5HHIA 4F5OA 4I29A 4Z6CA 1BPYA 1ZQKA 3GDXA 3PMLA 5DB7A 3C5FA 4PGQA 4R64A 1HUOA 4KLHA 9ICAA 9ICIA 1MQ2A 3HWTA 5IIKA 3JPSA 4O5EA 3RH4A 5J0XA 4TUPA 8ICOA 5J2FA 2KP7A 3C5GA 4PPXA 1BPEA 4I2IA 5J0YA 7ICFA 1ZQOA 4I2BA 4RQ0A 4NLNA 4I2HA 4K4HA 5CWRA 5J0WA 3JPQA 3MBYA 3JPPA 5BPCA 1ZQGA 4O5KA 9ICGA 4KLMA 4MF2A 2PFOA 4UAYA 4YD1A 2PFNA 4R65A 5EOZA 8ICGA 2ISOA 8ICKA 4QZGA 5DB6A 1ZQNA 2BCUA 1ZQPA 3UXPA 3AU2A 4YN4A 4PH5A 4M9GA 3UXNA 5CB1A 8ICLA 1ZQHA 8ICAA 5J29A 4KLGA 4F5RA 4M04A 5DBCA 1KDHA 4I2DA 4KLTA 5DDYA 4UB1A 8ICBA 8ICHA 4IQWA 1TV9A 4NM2A 4KLSA 4QZFA 3ISDA 1ZQDA 4KLIA 8ICCA 9ICCA 7ICHA 3MGHA 4PGYA 4RQ8A 8ICMA 1ZQJA 3JPNA 8ICFA 4GXJA 4TURA 4K4GA 2BCQA 1ZQBA 4DOAA 1XSNA 4KLUA 9ICMA 5IINA 5J0SA 5DKWA 7ICSA 3MGIA 4PGXA 4UBBA 1DK3A 8ICIA 4RT3A 5D49A 1ZQLA 3RJFA 4I2JA 2PXIA 4UB3A 4UAZA 2PFPA 4LZDA 4IQVA 5BOMA 4TUQA 7ICMA 5J0PA 4MFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB4 A;  2FMQ A;  4YCX A;  5III A;  4I2E A;  5DBA A;  3LK9 A;  8ICS A;  9ICT A;  4LVS A;  4RQ7 A;  4NY8 A;  4O5C A;  4PHE A;  4RQ6 A;  4KLL A;  9ICX A;  5J0T A;  3RJG A;  4M0A A;  5J0R A;  3C2K A;  5J2I A;  4NLZ A;  4M9L A;  8ICN A;  4QZH A;  3RJE A;  1BNP A;  9ICQ A;  3AUO A;  3RJK A;  3C2L A;  4PHP A;  2BCR A;  9ICR A;  9ICU A;  5D4B A;  3PMN A;  4F5N A;  4O9M A;  1KEJ A;  4XA5 A;  4RQ4 A;  1ZQT A;  9ICO A;  5IIO A;  3AU6 A;  3RH5 A;  5DB8 A;  4QZC A;  5DB9 A;  5BOL A;  1BPX A;  2FMP A;  4KLO A;  4KLD A;  4Z6E A;  4UB2 A;  4DOB A;  4RQ5 A;  1ZJM A;  2BCV A;  1ZQC A;  1ZQE A;  4M2Y A;  1ZQR A;  3RJH A;  4UB5 A;  3V7J A;  7ICV A;  4QZ9 A;  4RT2 A;  1TVA A;  4RQ1 A;  5DBB A;  4GXI A;  7ICO A;  4F5Q A;  1HUZ A;  1ZQF A;  5J2E A;  4I2C A;  4M9N A;  8ICW A;  1ZJN A;  2ISP A;  4RQ2 A;  3HX0 A;  8ICU A;  4QZI A;  3JPR A;  3ISB A;  4KLJ A;  4I2G A;  4QZA A;  4YMN A;  1DK2 A;  4UAW A;  9ICL A;  7ICT A;  8ICT A;  7ICJ A;  1ZQM A;  5J2A A;  4QZB A;  4RPZ A;  1MQ3 A;  5J2B A;  8ICV A;  4KLQ A;  7ICG A;  4RPX A;  9ICF A;  4YMO A;  4PHA A;  8ICZ A;  3B0Y A;  3MDC A;  3C2M A;  8ICJ A;  9ICN A;  1RZT A;  7ICR A;  5J2H A;  5IIJ A;  3PNC A;  4KLE A;  3UQ2 A;  2FMS A;  3JPT A;  1XSP A;  2I9G A;  4Z6D A;  5J2G A;  4JWM A;  3UXO A;  3ISC A;  4QZ8 A;  4I2F A;  1BNO A;  4KLF A;  4IQT A;  5HHH A;  4M9J A;  7ICK A;  2PFQ A;  4IQU A;  7ICP A;  5J2K A;  9ICV A;  3V7L A;  5J0U A;  4GXK A;  7ICU A;  1ZQQ A;  2IHM A;  4X5V A;  9ICW A;  1JMS A;  5IIM A;  3JPO A;  4F5P A;  3RJI A;  4RPY A;  3TFR A;  4K4I A;  3RH6 A;  2BPF A;  1XSL A;  4YMM A;  9ICS A;  1BPD A;  4TUS A;  7ICL A;  8ICQ A;  3UQ0 A;  9ICP A;  9ICH A;  2W9M A;  4YD2 A;  1BPZ A;  4QZD A;  3HW8 A;  4I2A A;  4M47 A;  4MFA A;  8ICY A;  4I27 A;  4MF8 A;  3TFS A;  4MFC A;  3V72 A;  9ICB A;  4NLK A;  1NZP A;  5J0Q A;  4NXZ A;  3V7K A;  5J0O A;  5J2J A;  3UPQ A;  4M9H A;  4P2H A;  5TZV A;  9ICK A;  4LZG A;  2P66 A;  2BPG A;  1ZQS A;  2GWS A;  4XUS A;  7ICN A;  4DOC A;  4I28 A;  4UBC A;  4PHD A;  7ICI A;  4NM1 A;  1ZQA A;  8ICX A;  9ICE A;  7ICE A;  4QZE A;  5D46 A;  4JWN A;  4R66 A;  5IIL A;  3RJJ A;  5J2C A;  9ICJ A;  3OGU A;  1ZQI A;  8ICE A;  8ICP A;  5J2D A;  2BCS A;  7ICQ A;  4RQ3 A;  4FO6 A;  3B0X A;  4Z6F A;  3MDA A;  4R63 A;  4DO9 A;  8ICR A;  5HHI A;  4F5O A;  4I29 A;  4Z6C A;  1BPY A;  1ZQK A;  3GDX A;  3PML A;  5DB7 A;  3C5F A;  4PGQ A;  4R64 A;  1HUO A;  4KLH A;  9ICA A;  9ICI A;  1MQ2 A;  3HWT A;  5IIK A;  3JPS A;  4O5E A;  3RH4 A;  5J0X A;  4TUP A;  8ICO A;  5J2F A;  2KP7 A;  3C5G A;  4PPX A;  1BPE A;  4I2I A;  5J0Y A;  7ICF A;  1ZQO A;  4I2B A;  4RQ0 A;  4NLN A;  4I2H A;  4K4H A;  5CWR A;  5J0W A;  3JPQ A;  3MBY A;  3JPP A;  5BPC A;  1ZQG A;  4O5K A;  9ICG A;  4KLM A;  4MF2 A;  2PFO A;  4UAY A;  4YD1 A;  2PFN A;  4R65 A;  5EOZ A;  8ICG A;  2ISO A;  8ICK A;  4QZG A;  5DB6 A;  1ZQN A;  2BCU A;  1ZQP A;  3UXP A;  3AU2 A;  4YN4 A;  4PH5 A;  4M9G A;  3UXN A;  5CB1 A;  8ICL A;  1ZQH A;  8ICA A;  5J29 A;  4KLG A;  4F5R A;  4M04 A;  5DBC A;  1KDH A;  4I2D A;  4KLT A;  5DDY A;  4UB1 A;  8ICB A;  8ICH A;  4IQW A;  1TV9 A;  4NM2 A;  4KLS A;  4QZF A;  3ISD A;  1ZQD A;  4KLI A;  8ICC A;  9ICC A;  7ICH A;  3MGH A;  4PGY A;  4RQ8 A;  8ICM A;  1ZQJ A;  3JPN A;  8ICF A;  4GXJ A;  4TUR A;  4K4G A;  2BCQ A;  1ZQB A;  4DOA A;  1XSN A;  4KLU A;  9ICM A;  5IIN A;  5J0S A;  5DKW A;  7ICS A;  3MGI A;  4PGX A;  4UBB A;  1DK3 A;  8ICI A;  4RT3 A;  5D49 A;  1ZQL A;  3RJF A;  4I2J A;  2PXI A;  4UB3 A;  4UAZ A;  2PFP A;  4LZD A;  4IQV A;  5BOM A;  4TUQ A;  7ICM A;  5J0P A;  4MFF A; 
#chains in the Genus database with same CATH topology
 2KOB A;  2YMM A;  2FMQ A;  4YCX A;  2ZUB A;  5ALN A;  5III A;  2MUT A;  3LK9 A;  2OM6 A;  1QQ6 A;  5KFR A;  1Q46 A;  4RQM A;  3TAN A;  2ALZ A;  1CI4 A;  1U47 A;  2LYH A;  1Z3E B;  2FDR A;  4M0A A;  5J2I A;  4NLZ A;  8ICN A;  2HW3 A;  2W54 A;  4EBE A;  2KFZ A;  3KHG A;  3RJE A;  1KSP A;  2KD1 A;  3V6H A;  2K4I A;  5KG4 A;  3AMZ A;  4P4O A;  9ICQ A;  1X9M A;  4YXM A;  2V4R A;  5AKJ A;  4DFJ A;  1NZB A;  5AM1 A;  2Y1I A;  1L7N A;  1RDF A;  3QU7 A;  4F5N A;  1SV0 C;  4FZN A;  4FZM A;  4KX3 A;  4RQ4 A;  2NRV A;  5IIO A;  2E8M A;  1L5U A;  2KZM A;  1ZRN A;  2XO7 A;  4QZC A;  1URJ A;  4HYK A;  5DB9 A;  4KLO A;  2KNJ A;  1WG8 A;  2E8N A;  3HKZ F;  4DFP A;  4QWE A;  4DLE A;  4KLD A;  1NK6 A;  4B6J A;  2I6X A;  3ZDA A;  4HAI A;  3H4D A;  3SR6 A;  1JRP A;  2W11 A;  5KFC A;  1RYU A;  1KQQ A;  2WF6 A;  2LHT A;  4US9 A;  4YXJ A;  2V9W A;  2E1E A;  5EWG A;  5ALU A;  4UB5 A;  1TFR A;  7ICV A;  1L8L A;  4QZ9 A;  3IG8 A;  1SKW A;  1MSW D;  4J9P A;  3H7I A;  3N4M B;  3UMB A;  5DBB A;  4DSI A;  4Y2V A;  5KFY A;  4F5Q A;  1BVS A;  3K75 D;  1CEZ A;  1ZQF A;  1HEK A;  4Y2J A;  4RQ2 A;  4QZI A;  4ICA A;  3JPR A;  4ECX A;  3M9M B;  4QZA A;  2KK0 A;  1DK2 A;  1JI7 A;  2VA8 A;  3Q8R B;  3KTQ A;  3NRZ A;  1SXD A;  2F76 X;  3KHH A;  1XU4 A;  1KL9 A;  2PMZ C;  3VCB A;  5J2B A;  3TI0 A;  2MU2 A;  9ICF A;  4YMO A;  2K8B B;  3CNH A;  5J2H A;  4C8K A;  2K89 A;  5AM0 A;  3RB3 A;  1BPB A;  2FMS A;  2VA2 A;  2R8H A;  2DKZ A;  5AIC A;  2BGW A;  4Z6D A;  3OSP A;  4IRC A;  2IHN A;  1UCV A;  1KN5 A;  2ASD A;  4IS7 A;  1BNO A;  3RBD A;  1ZXI A;  1HJP A;  3ZD8 A;  4BWM A;  3C28 A;  2WB1 F;  4RZR A;  4DS4 A;  5KG7 A;  5CJ7 A;  3BQT A;  2PFQ A;  5J2K A;  4ED3 A;  4MEY A;  5J0U A;  4O3R A;  2A1A A;  9ICW A;  2RDI A;  5IIM A;  5ALQ A;  3RJI A;  1HIW A;  3DV9 A;  4RPY A;  1V97 A;  4DCC A;  4FS1 A;  4K4I A;  3RH6 A;  5HR7 A;  4YMM A;  9ICS A;  2GO7 A;  1SZH A;  2ZTD A;  1RXW A;  1BGX T;  4PJ0 U;  4ZH4 A;  2M9N A;  1C7Y A;  7ICL A;  1Q3V A;  3UQ0 A;  5GTI U;  4YD2 A;  3E2E A;  3SYZ A;  4MFA A;  3IP4 B;  2HOI A;  4I27 A;  2YB4 A;  3TFS A;  4MFC A;  1NNL A;  2Q0Z X;  3FYH A;  3SMV A;  4O3S A;  5AI0 A;  2NYV A;  1NZP A;  5J0Q A;  3CRX A;  4NXZ A;  2XVT A;  2FLL A;  2EQY A;  4JUZ A;  5J0O A;  4C4R A;  4DEZ A;  1CUK A;  5TZV A;  2Y9T A;  4UW9 A;  2P66 A;  1ZQS A;  4F2S A;  2GWS A;  1Z00 A;  1RG6 A;  4DOC A;  3CP8 A;  3H8M A;  5JTI A;  4ELU A;  2HBL A;  1TAU A;  3SEN A;  2AQ4 A;  2OHF A;  3I76 A;  1NK9 A;  3EYZ A;  2XY6 A;  5EE9 A;  2NV3 A;  5J2C A;  3OGU A;  2BPC A;  4MHV A;  4C0Z A;  4BDP A;  4DLG A;  2BCS A;  5AKE A;  1VJ5 A;  1O03 A;  3I28 A;  2DWQ A;  3BZK A;  1SZP A;  1PVP A;  4Z6C A;  2W9A A;  4F8R A;  1ZQK A;  1N60 A;  4G9B A;  4B9L A;  1U48 A;  2ZXI A;  4MEX A;  4O3M A;  3KHL A;  2G5I B;  1ZOL A;  2H3I A;  3JPS A;  4O5E A;  4CF4 A;  4M6W A;  2I1Q A;  2W7O A;  1SWV A;  5AHX A;  1DXS A;  1L3V A;  5CRX A;  1OUQ A;  5J2F A;  2HOQ A;  3F53 A;  1T3N A;  3OTQ A;  4F91 B;  4ELV A;  2WHE A;  4AYB C;  3MFH A;  4PZO A;  4ECW A;  7ICF A;  3ONN A;  2XY7 A;  5AKZ A;  3HJE A;  4NLN A;  1N5W A;  4Q8F A;  2VJ4 A;  4K4H A;  3SV3 A;  1QSL A;  3O0F A;  3TKA A;  1U45 A;  4F4X A;  4F4K A;  4RNO A;  3Q8K A;  3BQ1 A;  9ICG A;  4B9V A;  1L7M A;  2ES6 A;  3QYP A;  3BQ7 A;  3HPO A;  2JEG A;  3BS5 B;  1S9F A;  5AKL A;  5ALW A;  3WKD A;  4R8U B;  1TAM A;  2BR0 A;  5CHG A;  4QIW F;  3BS5 A;  2G08 A;  1PK1 B;  4P0Q B;  5EOZ A;  2ISO A;  2EAM A;  3QU2 A;  1PK1 A;  1FEZ A;  1ZQN A;  2KEY A;  3PV8 A;  2BCU A;  4KN7 A;  1PZN A;  3PX6 A;  2EAP A;  2R8K A;  4PH5 A;  5DDM A;  5ALR A;  8ICL A;  5TIS U;  1COO A;  5J29 A;  2G09 A;  4F5R A;  2ZIW B;  4DFD A;  1TK0 A;  5DDY A;  8ICB A;  2XC9 A;  2ZIW A;  1JIH A;  1TV9 A;  1UHU A;  2Y0S C;  4QZF A;  4YR2 A;  1LVH A;  5KFJ A;  2IBK A;  1ZQD A;  4J9S A;  4OCZ A;  5HR6 A;  2R8J A;  4Y2U A;  4ACO A;  4KLI A;  4UAU A;  3SAH A;  1KLN A;  3HRD D;  4PGY A;  2UVV A;  3M6K A;  1XS9 D;  5KFZ A;  5CR0 A;  2CXY A;  4TUR A;  5L1K A;  2BCQ A;  1L6N A;  3D2N A;  4C7Z A;  4F93 B;  4DOA A;  2W55 A;  4KLU A;  5J0S A;  1RXV A;  1NJX A;  1PUZ A;  2ASL A;  1ZRM A;  2MSN A;  2VAN A;  4UAS A;  2DUY A;  1Z1B A;  4DSJ A;  5D49 A;  5KT2 A;  3Q8S B;  3EPG A;  1Z1V A;  1S97 A;  3S6J A;  3TAQ A;  3N7R C;  2PXI A;  3QU9 A;  1TKD A;  4UQG A;  4J9K A;  2HBJ A;  3NRW A;  4IQV A;  3PW0 A;  3PX4 A;  3GFK B;  2ATL A;  4TUQ A;  5J0P A;  1D8Y A;  1NI3 A;  4UB4 A;  3C23 A;  2R18 A;  2JEI A;  5A0L A;  3T5J A;  3SV4 A;  2BDP A;  5ALK A;  2KJ9 A;  1Y88 A;  1U4B A;  1KW4 A;  4NY8 A;  4WJ3 B;  2HVH A;  2KJ8 A;  4PHE A;  3MR6 A;  3WK9 A;  5KT6 A;  5J0R A;  3ZDE A;  2DBY A;  2FPM A;  1MN8 A;  3HKZ C;  1RYS A;  3GIM A;  3AUO A;  2QB0 B;  2BCR A;  4F4Y A;  5KG3 A;  9ICR A;  2HDO A;  2KTQ A;  3PX0 A;  1J2M A;  4RUC A;  2LYA A;  5D4B A;  4F3O A;  1ZD3 A;  2BQ3 A;  1NKE A;  4G3I A;  5B5E U;  1KFT A;  3SEI A;  4TQS A;  1ZQT A;  9ICO A;  2W9C B;  4OJP A;  5F3X B;  5KFG A;  3ALR A;  2W9C A;  4YVZ A;  3RF9 A;  3LWM A;  5KT7 A;  1BPX A;  1JXE A;  2J6U A;  2JEF A;  3SD7 A;  2OEH A;  1L7P A;  2W3R A;  2BDU A;  3BJY A;  4UB2 A;  4E0D A;  3AM9 A;  3N7S C;  1V38 A;  4C80 A;  1P7D A;  2BCV A;  2H5X A;  1ZQC A;  3LVV A;  2G5H B;  3KD3 A;  3WK6 A;  1YT3 A;  2KIW A;  5ALO A;  5ALH A;  3KFU F;  3G6X A;  1D8B A;  2M0N A;  2C22 A;  3PW5 A;  5DQG A;  3H8J A;  3M8S A;  1B0X A;  1JN3 A;  1HUZ A;  3LDA A;  2YQE A;  2C2E A;  3QE9 Y;  2F3N A;  4ECY A;  4ZOH C;  2OCE A;  4EEY A;  3HX0 A;  8ICU A;  2GOL A;  1SV0 A;  2EAO A;  4YMN A;  3WKA A;  3F2D A;  3QZ7 A;  4ED8 A;  1WWV A;  2JHD A;  1NK7 A;  7ICJ A;  3H0R B;  5J2A A;  2FI1 A;  4QWD A;  4DSF A;  1MQ3 A;  1KRP A;  7ICG A;  5EE3 A;  4YG2 A;  4F2R A;  5KL1 B;  4CDG A;  4RPX A;  2WB1 C;  1A77 A;  4PHA A;  3H4B A;  4DSE A;  2FLP A;  1WUD A;  4BXO B;  1J97 A;  8ICJ A;  9ICN A;  2ZIU B;  3GIK A;  3EPI A;  2N1R A;  4KLE A;  5KG1 A;  4BXO A;  2F77 X;  2JXJ A;  5AM3 A;  4O0I A;  2ZXH A;  2LMR A;  3IN5 A;  1LB2 B;  3ISC A;  4FZL A;  3IG5 A;  3C29 A;  3BS7 A;  3M1Y A;  2W8K A;  1B4F A;  4M9J A;  1N62 A;  5AKX A;  5KT3 A;  5AKI A;  4IQU A;  2V4Q A;  4ECR A;  9ICV A;  3V7L A;  1DGJ A;  3QX7 A;  1QQ5 A;  3WK5 A;  1WYG A;  4GXK A;  7ICU A;  2IHM A;  4UAT A;  2JR5 A;  5KFB A;  4X5V A;  1JMS A;  2RP5 A;  4F5P A;  5ALD A;  4O3Q A;  1UT5 A;  1PVR A;  1D9F A;  2JEJ A;  2DKX A;  3NUQ A;  2J6T A;  4TUS A;  3ED5 A;  2A1J B;  8ICQ A;  9ICH A;  2DPI A;  2H3Z A;  2W9M A;  2GLE A;  2B0C A;  4QZD A;  3HW8 A;  4DL2 A;  2BQR A;  4PL2 A;  3GV7 B;  1MA7 A;  3V72 A;  5EWE A;  4ED7 A;  3E58 A;  4NLK A;  4EYI B;  2AHO B;  2OH2 A;  2KE7 A;  5G5H A;  3EUB 2;  3V7K A;  2UVU A;  5KT4 A;  3MAB A;  1KKX A;  4P2H A;  5KG5 A;  9ICK A;  1ZYQ A;  2ZG6 A;  2BPG A;  3OHA A;  3WK4 A;  2P6U A;  3SQI A;  4IL6 U;  1JUD A;  3BDP A;  1ECW A;  4EEN A;  2KN7 A;  7ICI A;  4NM1 A;  3PW4 A;  3QEB Z;  5KFQ A;  2ZIV B;  9ICE A;  5KFP A;  3ZDC A;  3GIL A;  4R66 A;  5IIL A;  2B21 A;  4DL4 A;  3RJJ A;  1SL0 A;  2F1J A;  1NK8 A;  3WKE A;  3I1Y A;  4QWC A;  1NKC A;  2RRD A;  2HOF A;  2XGQ A;  4A8E A;  4UAV A;  2LKY A;  2QLT A;  1ZD5 A;  2KZZ A;  4EBC A;  4FO6 A;  4Z6F A;  2DGZ A;  3MDA A;  4C8N A;  3T5L A;  3GV5 B;  5L1I A;  3QUT A;  8ICR A;  2WF7 A;  4DSK A;  2QB1 A;  4Q43 A;  3GIJ A;  2IA6 A;  5DB7 A;  3AL0 B;  1KTQ A;  4BWJ A;  2JGA A;  3HWT A;  4KIT B;  5IIK A;  1SB3 C;  1ZQ1 C;  3H40 A;  3NVZ A;  5AI6 A;  3UMC A;  2R8G A;  4FE3 A;  3C5G A;  4DS5 A;  4QIW C;  1IG6 A;  1BPE A;  3C1Z A;  3MR5 A;  4I2I A;  5KFH A;  5J0Y A;  2HHS A;  3G6Y A;  2RHF A;  3CYM A;  4F71 A;  1KBU A;  3ZD9 A;  4C8O A;  5KAI U;  5CWR A;  5J0W A;  3MBY A;  4EEL A;  4OJ6 A;  4RNN A;  3JPP A;  4FBU A;  3KZI U;  4O3P A;  4O5K A;  2UVR A;  2PFO A;  3VC8 A;  4YFK A;  4UAY A;  2JH1 A;  2ZJ8 A;  2XY5 A;  2C2R A;  2Y9U A;  5AKH A;  2VA3 A;  3N97 B;  8ICK A;  3PST A;  2FLN A;  1ZQP A;  2YX8 A;  3AU2 A;  5L1J A;  3M9N B;  1A0P A;  3UXN A;  1ZQH A;  1UPH A;  4YQW A;  2IOF K;  3A0B U;  5DQI A;  4M04 A;  4Q45 A;  1VDV A;  3TQ1 A;  1LV5 A;  4KLT A;  5ALP A;  2K60 A;  3ISD A;  2IMW P;  2KSO B;  3RRG A;  3WK8 A;  2QKQ A;  3ZI4 A;  7ICH A;  4DQS A;  8ICM A;  2E3T A;  5ALJ A;  5GTH U;  1NKB A;  2Y1J A;  2YY6 A;  3MR3 A;  4EZ6 A;  1MC8 A;  5K4L A;  3GQC A;  1QTM A;  4NLC A;  5DGB A;  3L4P A;  2YMP A;  4OJL A;  2FPK A;  1KFD A;  7ICS A;  4USA A;  1SKR A;  4PGX A;  5ALM A;  2MAX A;  4UBB A;  4NJ8 A;  1DK3 A;  3H0M B;  8ICI A;  3V6K A;  4Y2T A;  4P4P A;  2CPR A;  2BHN A;  4YR0 A;  3RJF A;  5KAF U;  2OWO A;  1OW5 A;  4Q8E A;  4F4W A;  4FS2 A;  4YR3 A;  4OJO A;  3SZ2 A;  4MFF A;  4ELT A;  4KTQ A;  4UAR A;  2LM1 A;  3G6V A;  3PSI A;  4I2E A;  5DBA A;  3EWA A;  2C28 A;  8ICS A;  2A3V A;  2JZB B;  1FFU A;  3J81 j;  4LVS A;  1JAL A;  4RQ7 A;  4O5C A;  2W8L A;  2JV3 A;  2JZB A;  2XCA A;  4J9N A;  9ICX A;  5J0T A;  4M9L A;  4O3O A;  2F1H A;  5EWF A;  2KFN A;  4UB6 U;  4Y2Q A;  2YTU A;  1NK5 A;  1BNP A;  2QAR B;  2ZTE A;  3QUQ A;  3QUC A;  4RQN A;  2HI0 A;  1C20 A;  2WF9 A;  2FJ6 A;  3PMN A;  2DF4 B;  5F9L A;  4O9M A;  4J03 A;  4XA5 A;  2EZX A;  5AM2 A;  3GZF A;  1TE2 A;  4OO1 J;  2BZF A;  4US8 A;  3SAF A;  3RH5 A;  4DQQ A;  5DB8 A;  4B9N A;  3WKB A;  4R8U A;  3GU3 A;  2H3Q A;  4ED0 A;  2FMP A;  4P0Q A;  2HMX A;  5HNK A;  3SAG A;  1UT8 A;  1ZQU A;  4OD0 A;  5KFO A;  4RQ5 A;  1XWL A;  2KKP A;  4CE6 A;  2NRZ A;  4M2Y A;  1L3U A;  3U26 A;  3RFA A;  4IRK A;  3V7J A;  4DL6 A;  5DG7 A;  1TVA A;  1IXR A;  2LYB A;  4GXI A;  3F5E A;  1SGG A;  4C4S A;  2HBM A;  2F8K A;  5KG6 A;  5J2E A;  4I2C A;  5AM5 A;  1SV4 A;  3KKA A;  1ZJN A;  2A19 A;  4KLJ A;  3ISB A;  3DDH A;  1X9X A;  3H0L B;  5ALY A;  2K4H A;  2MRL A;  8ICT A;  1SKS A;  1F44 A;  2E8P A;  5KT5 A;  1ZQM A;  5G5G A;  4RPZ A;  4J9M A;  4B9U A;  4J9R A;  5KG2 A;  3K4G A;  3AQF A;  3B0Y A;  3UM9 A;  3ZDD A;  1LKY B;  3MDC A;  2LI6 A;  1ARO P;  4EBD A;  1RZT A;  2HHW A;  3PNC A;  1LKY A;  3UQ2 A;  3GII A;  3EZ5 A;  2Q4T A;  2HVI A;  4JV0 A;  1XSP A;  4Y2Y A;  4QNL A;  5DQH A;  1XO1 A;  2NRT A;  3RB4 A;  4P0P B;  1TK8 A;  3NS1 A;  3N7P D;  4KLF A;  3RAQ A;  4IQT A;  4EYH B;  5HHH A;  4P0P A;  3B9J A;  3T5K A;  5AKG A;  4J9Q A;  4DQR A;  2K8C B;  2W03 A;  5AI8 A;  5KL8 B;  7ICP A;  3KKA C;  3PR4 A;  1B22 A;  2LM4 A;  1ZQQ A;  2QB0 A;  1NK4 A;  3WK7 A;  2OYY A;  3KHR A;  3R9K A;  3V6J A;  4CNQ A;  4NL9 A;  3TFR A;  5KFU A;  2BPF A;  1J2N A;  2Z7J A;  3QU5 A;  1BPD A;  4CGZ A;  2HHV A;  2LPE A;  4CRX A;  2HHU A;  5ALF A;  1X40 A;  5T14 A;  4DQP A;  4I2A A;  2RLT A;  8ICY A;  3HT3 A;  3OPX A;  2WFA A;  1X42 A;  3MFI A;  1FIQ A;  3F2C A;  1H38 A;  3T79 A;  1K1Q A;  4ECU A;  4C4T A;  2KG5 A;  4Y2P A;  5J2J A;  3UPQ A;  4M9H A;  4LZG A;  5AM4 A;  2L5Y A;  7ICN A;  4I28 A;  1QH9 A;  1QQ7 A;  1NJY A;  1RQN A;  4UBC A;  1K5O A;  1RM6 C;  1B43 A;  3T5H A;  1ZQA A;  7ICE A;  2KVC A;  4QZE A;  5D46 A;  4JWN A;  5C5J A;  3C21 A;  1Q3U A;  1X66 A;  5ALT A;  5ALX A;  4NL9 C;  3D2Q A;  4NWI A;  1ZQI A;  2H3V A;  8ICP A;  5J2D A;  4TQR A;  3PY8 A;  7ICQ A;  3QEA Z;  5KFD A;  3B0X A;  2WAQ F;  4F4Z A;  4C7Y A;  1F0M A;  1XC9 A;  5ALV A;  5HHI A;  4I29 A;  2ZIU A;  2NO5 A;  5KFI A;  1BPY A;  3IV6 A;  5KFF A;  4GLX A;  3RB0 A;  3PVX A;  2AGP A;  2YMQ A;  3PML A;  4Y2X A;  2ZUD A;  4PGQ A;  5AKY A;  3RTV A;  1NK0 A;  1HUO A;  4KLH A;  9ICA A;  3TAP A;  2F44 A;  3RH4 A;  2ZTC A;  5HML A;  4TUP A;  4BUG A;  8ICO A;  2R8I A;  3DEE A;  2K4E A;  2KP7 A;  1IM4 A;  1A6S A;  2UVW A;  2G07 A;  2JRZ A;  4JK1 A;  1JX4 A;  4I2B A;  4I2H A;  4O3N A;  1EXN A;  5L1M A;  1T94 A;  4GFJ A;  4BGD A;  5HMM A;  4EX6 A;  1S0O A;  4IRD A;  5BPC A;  2AJQ A;  2HBK A;  1XO0 A;  1Z4N A;  5ALG A;  4MF2 A;  2O6K A;  2G06 A;  1UQV A;  2A1J A;  4NV0 A;  1JRO A;  2PFN A;  1D9D A;  4DFK A;  4B9T A;  2W7P A;  5B66 U;  8ICG A;  3RB6 A;  1N56 A;  5DB6 A;  2LBO A;  1SIJ A;  5AIB A;  4F92 B;  3TAC B;  4KMO B;  3Q8M A;  5CB1 A;  2IOH A;  4IC9 A;  1WCN A;  3QZ8 A;  4C8L A;  1N5X A;  4ED6 A;  4DQI A;  5EE1 A;  4I2D A;  1ZQY A;  4UB1 A;  3M8R A;  2ASJ A;  2NO4 A;  4IQW A;  2C2D A;  3MGV A;  4KLS A;  4ECS A;  4DSL A;  1S77 D;  2KVS A;  1TK5 A;  3FAH A;  4RUA A;  4PL1 A;  5AK6 A;  2ZIV A;  2ZJA A;  3BQ2 A;  1YZ6 A;  3MGH A;  4RQ8 A;  4PZN A;  5KG0 A;  3JPN A;  2FPL A;  1ZQB A;  3ETR A;  3NGD A;  3RAX A;  1T7P A;  1QSS A;  3PSP A;  2VKQ A;  3IDW A;  2VJ5 A;  4KMU A;  5IIN A;  2PI4 A;  4CCH A;  5ALI A;  1IIP A;  3MGI A;  4NLB A;  1SXE A;  5AI9 A;  3QU4 A;  2XCP A;  5KFM A;  4RT3 A;  2JH7 A;  5KFS A;  4B9S A;  4KN4 A;  1D8L A;  4I2J A;  4UB3 A;  2PFP A;  5DG8 A;  4NLG A;  2AXT U;  4Y2S A;  1N2X A;  5BOM A;  4JB3 A;  5J8Y A;  7ICM A;  3D2S A;  5C0Y A;  2H3F A;  1A76 A;  2KKV A;  9ICT A;  1X6I A;  4LJX A;  4XQ8 A;  3N28 A;  1RYR A;  4CF3 A;  1DGS A;  1Z4O A;  3GV8 B;  2CN1 A;  4YP3 A;  4RQ6 A;  5JUM A;  2PKE A;  3F2B A;  4KLL A;  5FP0 A;  3RJG A;  3C2K A;  3AN1 A;  1ZET A;  3PO4 A;  4J9L A;  3T3F A;  4QZH A;  3OSN A;  3IRU A;  4U6P A;  3RJK A;  3C2L A;  2YN4 A;  3EW9 A;  4PHP A;  4GC7 A;  4QWB A;  9ICU A;  4C8M A;  4ECQ A;  2KV2 A;  1KEJ A;  3BZC A;  3K1R B;  3M7D A;  3RR8 A;  4ECZ A;  2W9B B;  1DRG A;  1V9P A;  4F72 A;  3AU6 A;  3HIL A;  2W9B A;  5BOL A;  3NVY A;  1RPL A;  3ZDB A;  3BQ0 A;  2DL0 A;  2AH5 A;  5J8Y C;  3RBE A;  3PSF A;  3PR5 B;  2WF8 A;  2ZUC A;  3Q8P B;  4Z6E A;  4DOB A;  3NTU A;  5L1L A;  1NOM A;  2OXO A;  1S0N A;  1ZJM A;  5CP2 A;  2K4P A;  4EEK A;  1SWW A;  1ZD2 P;  1ZQE A;  4QWA A;  5AI4 A;  5AK4 A;  1ZQR A;  3RJH A;  2YB1 A;  4FFD A;  2KIV A;  4DF8 A;  2F2A B;  2WTF A;  4RU9 A;  4RT2 A;  1Z00 B;  1DOQ A;  4RQ1 A;  1UA1 A;  2J6S A;  2VIX A;  7ICO A;  5DG9 A;  5JU5 A;  2KSO A;  3SI8 A;  2W04 A;  4M9N A;  8ICW A;  3Q8Q B;  1RQL A;  1KFS A;  2ISP A;  1IV8 A;  2DQN B;  2I5H A;  4I2G A;  1Z19 A;  2HSZ A;  5CA7 A;  3OJU A;  4UAW A;  9ICL A;  3FM9 A;  3L5K A;  7ICT A;  4J9O A;  4QZB A;  8ICV A;  4KLQ A;  5KFW A;  2ESE A;  5AKK A;  3H8S A;  3PO5 A;  1WCL A;  8ICZ A;  1PVQ A;  4FBT A;  2WF5 A;  1TAQ A;  3AEV A;  3C2M A;  7ICR A;  3MR2 A;  5IIJ A;  1CRX A;  2D8C A;  1Q8K A;  4JV1 A;  3JPT A;  5H2F U;  2W3S A;  4OJ5 A;  3F5A A;  2I9G A;  5J2G A;  2ODG A;  4JWM A;  1L3S A;  5DGA A;  3QNM A;  3UXO A;  4M6W B;  4AP9 A;  4F50 A;  2PMZ F;  1M6Y A;  1X6J A;  4CF5 A;  4U7C A;  2AGQ A;  4QZ8 A;  4I2F A;  1NJW A;  5KFT A;  4DWI A;  3PW2 A;  1PK3 A;  2IOF A;  7ICK A;  3H8W A;  1QCK A;  2FE9 A;  3L3F X;  3PW7 A;  1FO4 A;  2QAR A;  5KFX A;  3JPO A;  3ORY A;  1X9W A;  5KFL A;  2EH9 A;  1YZ7 A;  2HHX A;  4ECT A;  1XSL A;  3A0H U;  3NVW A;  1QSY A;  2F8L A;  1V85 A;  9ICP A;  5ALZ A;  3KBB A;  2W43 A;  1BPZ A;  4EX7 A;  2AGO A;  4M47 A;  1S5L U;  2RDJ A;  4MF8 A;  3OJS A;  9ICB A;  4DL7 A;  3MC1 A;  5KFA A;  2ZIX B;  2E8O A;  4Q44 A;  1ZQW A;  4DF4 A;  2EZZ A;  5L9X A;  2ZIX A;  5DLF A;  3IM1 A;  2JMG A;  2F1I A;  4XUS A;  4BX9 C;  1S10 A;  2WAQ C;  1F5S A;  2EZY A;  3RRH A;  2KIC A;  1VLB A;  1S0V A;  4PHD A;  2DFL A;  2P6R A;  2YML A;  8ICX A;  4UB8 U;  2KHV A;  4DL3 A;  1U9L A;  5KTQ A;  1L3T A;  9ICJ A;  8ICE A;  2G0A A;  5EE0 A;  2EDU A;  2RQ5 A;  1ED1 A;  2AQ0 A;  5KFN A;  2HCF A;  1SL2 A;  1ZQV A;  2DPJ A;  2D6F C;  1T8E A;  4RQ3 A;  2XI9 A;  5ALL A;  4R63 A;  1O08 A;  3E0F A;  4GIB A;  2KZ3 A;  4DO9 A;  4QJF B;  4DFM A;  2KMD A;  3AQE A;  3RR7 A;  4F5O A;  1JXL A;  1U49 A;  2CRX A;  5KFE A;  1ZD4 A;  3GDX A;  3NAS A;  2E5S A;  4JV2 A;  3C5F A;  3D6J A;  4R64 A;  3M9O B;  4QW9 A;  5E79 U;  4ED2 A;  2B6G A;  4JMU A;  2K8A A;  3QXG A;  9ICI A;  1MQ2 A;  3TAD A;  3NVV A;  3PZP A;  5AIA A;  5HP4 A;  4P4M A;  2EAN A;  5J0X A;  1T3Q A;  2BQU A;  1ZQZ A;  3FC4 A;  4B9M A;  2AU0 A;  1QLN A;  1OXJ A;  4PPX A;  3IHQ B;  3HP6 A;  2HHT A;  3QUB A;  3Q8L A;  2D3D A;  1ZQO A;  2P35 A;  4RQ0 A;  1X2I A;  4DL5 A;  1X9S A;  3LWL A;  2KHQ A;  1L8O A;  3ICX A;  1N61 A;  3JPQ A;  5ALE A;  1ZQG A;  4KLM A;  1L7O A;  3M6Z A;  3KZX A;  4YD1 A;  1XNS A;  4EZ9 A;  3K1Z A;  1AQ6 A;  2NRX A;  3C1Y A;  4R65 A;  5KNI A;  4AYB F;  2XIC A;  1S76 D;  1UA0 A;  5F9N A;  5AK3 A;  5AI5 A;  5AK5 A;  1SL1 A;  4QZG A;  3UXP A;  2NRW A;  4BJQ A;  4XRH A;  4YN4 A;  1K1S A;  4M9G A;  4QW8 A;  3TAD C;  3ETL A;  8ICA A;  4RNM A;  3FDS A;  3UMG A;  2E1F A;  4KLG A;  1NJZ A;  5DLG A;  3OHB A;  5DBC A;  1KDH A;  2HHQ A;  3CW2 C;  2GH1 A;  3WU2 U;  1S8O A;  8ICH A;  1COK A;  4NM2 A;  4IR1 A;  3THV A;  2XID A;  4ECV A;  1N48 A;  3KOO A;  5ALS A;  2BKE A;  4KX5 A;  8ICC A;  2KJ5 A;  1N63 A;  9ICC A;  3WKC A;  2ZJ5 A;  1FFV A;  1ZQJ A;  2MA1 A;  8ICF A;  4GXJ A;  4K4G A;  3TAR A;  5KFV A;  1S0M A;  5CEH A;  1ZQX A;  3LVW A;  4IR9 A;  5JRT A;  1XSN A;  9ICM A;  1WWU A;  5DKW A;  2PI5 A;  1GO3 F;  2Y0S F;  4GC6 A;  1ZQL A;  1T4G A;  5KFK A;  4Y2R A;  3LYS A;  4UAZ A;  4LZD A;  2MUT B;  2XGP A;  4ED1 A; 
#chains in the Genus database with same CATH homology
 4UB4 A;  2FMQ A;  4YCX A;  5III A;  4I2E A;  5DBA A;  3LK9 A;  8ICS A;  9ICT A;  4LVS A;  4RQ7 A;  4NY8 A;  4O5C A;  4PHE A;  4RQ6 A;  4KLL A;  9ICX A;  5J0T A;  3RJG A;  4M0A A;  5J0R A;  3C2K A;  5J2I A;  4NLZ A;  4M9L A;  8ICN A;  4QZH A;  3RJE A;  1BNP A;  9ICQ A;  3AUO A;  3RJK A;  3C2L A;  4PHP A;  2BCR A;  9ICR A;  9ICU A;  5D4B A;  3PMN A;  4F5N A;  4O9M A;  1KEJ A;  4XA5 A;  4RQ4 A;  1ZQT A;  9ICO A;  5IIO A;  3AU6 A;  3RH5 A;  5DB8 A;  4QZC A;  5DB9 A;  5BOL A;  1BPX A;  2FMP A;  4KLO A;  4KLD A;  4Z6E A;  4UB2 A;  4DOB A;  4RQ5 A;  1ZJM A;  2BCV A;  1ZQC A;  1ZQE A;  4M2Y A;  1ZQR A;  3RJH A;  4UB5 A;  3V7J A;  7ICV A;  4QZ9 A;  4RT2 A;  1TVA A;  4RQ1 A;  5DBB A;  4GXI A;  7ICO A;  4F5Q A;  1HUZ A;  1ZQF A;  5J2E A;  4I2C A;  4M9N A;  8ICW A;  1ZJN A;  2ISP A;  4RQ2 A;  3HX0 A;  8ICU A;  4QZI A;  3JPR A;  3ISB A;  4KLJ A;  4I2G A;  4QZA A;  4YMN A;  1DK2 A;  4UAW A;  9ICL A;  7ICT A;  8ICT A;  7ICJ A;  1ZQM A;  5J2A A;  4QZB A;  4RPZ A;  1MQ3 A;  5J2B A;  8ICV A;  4KLQ A;  7ICG A;  4RPX A;  9ICF A;  4YMO A;  4PHA A;  8ICZ A;  3B0Y A;  3MDC A;  3C2M A;  8ICJ A;  9ICN A;  1RZT A;  7ICR A;  5J2H A;  5IIJ A;  3PNC A;  4KLE A;  3UQ2 A;  2FMS A;  3JPT A;  1XSP A;  2I9G A;  4Z6D A;  5J2G A;  4JWM A;  3UXO A;  3ISC A;  4QZ8 A;  4I2F A;  1BNO A;  4KLF A;  4IQT A;  5HHH A;  4M9J A;  7ICK A;  2PFQ A;  4IQU A;  7ICP A;  5J2K A;  9ICV A;  3V7L A;  5J0U A;  4GXK A;  7ICU A;  1ZQQ A;  2IHM A;  4X5V A;  9ICW A;  1JMS A;  5IIM A;  3JPO A;  4F5P A;  3RJI A;  4RPY A;  3TFR A;  4K4I A;  3RH6 A;  2BPF A;  1XSL A;  4YMM A;  9ICS A;  1BPD A;  4TUS A;  7ICL A;  8ICQ A;  3UQ0 A;  9ICP A;  9ICH A;  2W9M A;  4YD2 A;  1BPZ A;  4QZD A;  3HW8 A;  4I2A A;  4M47 A;  4MFA A;  8ICY A;  4I27 A;  4MF8 A;  3TFS A;  4MFC A;  3V72 A;  9ICB A;  4NLK A;  1NZP A;  5J0Q A;  4NXZ A;  3V7K A;  5J0O A;  5J2J A;  3UPQ A;  4M9H A;  4P2H A;  5TZV A;  9ICK A;  4LZG A;  2P66 A;  2BPG A;  1ZQS A;  2GWS A;  4XUS A;  7ICN A;  4DOC A;  4I28 A;  4UBC A;  4PHD A;  7ICI A;  4NM1 A;  1ZQA A;  8ICX A;  9ICE A;  7ICE A;  4QZE A;  5D46 A;  4JWN A;  4R66 A;  5IIL A;  3RJJ A;  5J2C A;  9ICJ A;  3OGU A;  1ZQI A;  8ICE A;  8ICP A;  5J2D A;  2BCS A;  7ICQ A;  4RQ3 A;  4FO6 A;  3B0X A;  4Z6F A;  3MDA A;  4R63 A;  4DO9 A;  8ICR A;  5HHI A;  4F5O A;  4I29 A;  4Z6C A;  1BPY A;  1ZQK A;  3GDX A;  3PML A;  5DB7 A;  3C5F A;  4PGQ A;  4R64 A;  1HUO A;  4KLH A;  9ICA A;  9ICI A;  1MQ2 A;  3HWT A;  5IIK A;  3JPS A;  4O5E A;  3RH4 A;  5J0X A;  4TUP A;  8ICO A;  5J2F A;  2KP7 A;  3C5G A;  4PPX A;  1BPE A;  4I2I A;  5J0Y A;  7ICF A;  1ZQO A;  4I2B A;  4RQ0 A;  4NLN A;  4I2H A;  4K4H A;  5CWR A;  5J0W A;  3JPQ A;  3MBY A;  3JPP A;  5BPC A;  1ZQG A;  4O5K A;  9ICG A;  4KLM A;  4MF2 A;  2PFO A;  4UAY A;  4YD1 A;  2PFN A;  4R65 A;  5EOZ A;  8ICG A;  2ISO A;  8ICK A;  4QZG A;  5DB6 A;  1ZQN A;  2BCU A;  1ZQP A;  3UXP A;  3AU2 A;  4YN4 A;  4PH5 A;  4M9G A;  3UXN A;  5CB1 A;  8ICL A;  1ZQH A;  8ICA A;  5J29 A;  4KLG A;  4F5R A;  4M04 A;  5DBC A;  1KDH A;  4I2D A;  4KLT A;  5DDY A;  4UB1 A;  8ICB A;  8ICH A;  4IQW A;  1TV9 A;  4NM2 A;  4KLS A;  4QZF A;  3ISD A;  1ZQD A;  4KLI A;  8ICC A;  9ICC A;  7ICH A;  3MGH A;  4PGY A;  4RQ8 A;  8ICM A;  1ZQJ A;  3JPN A;  8ICF A;  4GXJ A;  4TUR A;  4K4G A;  2BCQ A;  1ZQB A;  4DOA A;  1XSN A;  4KLU A;  9ICM A;  5IIN A;  5J0S A;  5DKW A;  7ICS A;  3MGI A;  4PGX A;  4UBB A;  1DK3 A;  8ICI A;  4RT3 A;  5D49 A;  1ZQL A;  3RJF A;  4I2J A;  2PXI A;  4UB3 A;  4UAZ A;  2PFP A;  4LZD A;  4IQV A;  5BOM A;  4TUQ A;  7ICM A;  5J0P A;  4MFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...