1DK3A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords DNA POLYMERASE BETA
total genus 18
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk3A00
4XUSA 1ZQKA 4KLGA 1HUOA 2BCVA 1ZQCA 1KEJA 7ICIA 4LVSA 8ICXA 4DO9A 2I9GA 8ICLA 2BPGA 3UXNA 3RJHA 4UB5A 2ISOA 3B0XA 4I2BA 1MQ3A 1ZQQA 4KLFA 4RT3A 3AUOA 5IILA 4M9NA 5J0XA 7ICEA 5J0QA 3V7LA 9ICJA 3RJGA 4IQWA 3C2LA 4NY8A 1ZQNA 3JPNA 4QZDA 4GXKA 5J2GA 5IIOA 4KLEA 7ICHA 4QZGA 5J2DA 3JPPA 5BOMA 3JPSA 3JPTA 4QZHA 7ICSA 2PFNA 1ZQMA 8ICQA 8ICJA 5J2JA 4UAWA 8ICMA 4M9HA 7ICTA 5J2IA 4NLKA 3MDCA 4I2IA 4PHEA 4UAZA 4MFCA 4RQ6A 5J0YA 3C5FA 2PXIA 2GWSA 8ICTA 5EOZA 4KLMA 1XSLA 4TUSA 1BPZA 1ZQSA 3ISDA 1BNOA 9ICMA 5IIJA 4QZ9A 3C5GA 3MGHA 4Z6EA 8ICNA 7ICUA 4UBBA 4R65A 5DDYA 3PNCA 4QZCA 5HHIA 5J0SA 3AU6A 2BPFA 4I29A 4YMNA 4M2YA 4RQ5A 5J0UA 4K4GA 1ZJNA 4I2DA 1ZQLA 5J2HA 4PHDA 5J29A 5IINA 5DBAA 4IQVA 4NXZA 2KP7A 3HW8A 3V72A 4Z6FA 4KLJA 3JPOA 4MFAA 8ICFA 3MGIA 5J2BA 5DBBA 5IIMA 4QZBA 4GXJA 9ICKA 9ICOA 1BPDA 9ICNA 5BOLA 7ICLA 4YD2A 9ICRA 1ZQPA 2ISPA 5DB6A 4I2CA 4K4IA 9ICFA 8ICSA 4M9GA 7ICMA 4M9JA 4GXIA 8ICWA 4TURA 5TZVA 3C2KA 2PFOA 4MFFA 5J2CA 3UXPA 1ZQEA 4IQTA 8ICGA 2PFQA 8ICZA 1JMSA 3RJJA 4RQ7A 4I2GA 4JWNA 7ICVA 1HUZA 7ICGA 3RH4A 4LZGA 4NM1A 7ICFA 3RJKA 2BCSA 4RQ2A 4RQ1A 4KLSA 1DK3A 9ICAA 3MBYA 4RPZA 8ICYA 4PGYA 7ICPA 4YN4A 4UBCA 4YMOA 4JWMA 4DOCA 4NLNA 4F5OA 4PGQA 5J0RA 3PMLA 3PMNA 3UPQA 3RH5A 4MF8A 3UQ2A 2BCQA 4O5EA 4RQ0A 5J2FA 3C2MA 4F5RA 7ICOA 4O5KA 1TVAA 4PPXA 5J2KA 4UB3A 3ISBA 4I2HA 5J2AA 3RJFA 4M0AA 7ICRA 4QZEA 4PH5A 2W9MA 8ICCA 1RZTA 8ICBA 9ICPA 5HHHA 4RPYA 3GDXA 4DOAA 8ICVA 9ICBA 3JPQA 1XSNA 1BNPA 4M04A 4UAYA 4R63A 1ZQFA 1ZQJA 3AU2A 1ZQGA 5J2EA 4R66A 1NZPA 4K4HA 8ICEA 4O9MA 4MF2A 4KLDA 4NM2A 1ZJMA 4UB2A 8ICKA 4Z6CA 8ICHA 8ICRA 1BPYA 2FMSA 2FMQA 7ICKA 5IIKA 4RQ3A 4F5QA 1ZQBA 4KLOA 5IIIA 3B0YA 4F5PA 4FO6A 4I2JA 4R64A 4QZAA 5J0OA 2P66A 4KLIA 4M9LA 3TFSA 8ICIA 2PFPA 5J0PA 4M47A 5DB7A 3UQ0A 8ICOA 5BPCA 9ICCA 4KLQA 4F5NA 4KLHA 4QZFA 8ICPA 5CWRA 5DBCA 9ICHA 4I2FA 4XA5A 2BCRA 7ICJA 5DB9A 4IQUA 9ICEA 9ICTA 3V7KA 1MQ2A 5J0WA 7ICQA 4RPXA 8ICUA 4DOBA 3HX0A 4PHPA 4I28A 9ICQA 3RJIA 9ICSA 4I2AA 4NLZA 1ZQIA 4RT2A 2FMPA 3UXOA 4YD1A 5CB1A 8ICAA 5J0TA 4YMMA 2BCUA 9ICIA 2IHMA 4TUQA 1DK2A 3MDAA 3V7JA 3RJEA 1ZQAA 9ICVA 4QZIA 4X5VA 3LK9A 9ICUA 4UB4A 4PHAA 4QZ8A 4KLLA 4Z6DA 4PGXA 1ZQHA 1KDHA 1XSPA 3TFRA 5DB8A 1BPEA 7ICNA 4P2HA 3JPRA 4YCXA 4UB1A 3ISCA 9ICWA 4I27A 1ZQRA 4KLUA 9ICLA 3HWTA 1ZQDA 5D49A 3RH6A 4I2EA 4O5CA 4RQ4A 1ZQTA 5D4BA 9ICXA 4LZDA 1TV9A 9ICGA 1BPXA 4KLTA 5DKWA 4TUPA 5D46A 3OGUA 1ZQOA 4RQ8A
chains in the Genus database with same CATH superfamily
1ZQKA 2HW3A 1NK5A 1O08A 2BCVA 2HBLA 1ZQCA 2YN4A 4LVSA 5L1KA 4DO9A 2XGQA 5CJ7A 1A77A 2E8PA 3S6JA 3B0XA 2G0AA 1MQ3A 1WYGA 4KN4A 3SI8A 3C28A 4RT3A 5IILA 1P7DA 1T7PA 3QUBA 2A3VA 2FE9A 4YR2A 5KAFU 4NWIA 3EUB2 2D8CA 2HHVA 3KHGA 1KFDA 1SV0A 1J2NA 3SEIA 2YB4A 3G6XA 4NY8A 3OSNA 2Y0SC 3BQ7A 2CPRA 2ZIUA 5AKEA 5L1JA 1LV5A 4P4MA 5CRXA 2VKQA 5CEHA 4Q43A 2P6RA 4QZGA 4ED7A 1L5UA 3OHAA 4ECRA 1RG6A 1SV4A 5KNIA 2PFNA 4IS7A 8ICQA 8ICMA 3QNMA 2ZUDA 4B9VA 4I2IA 2JZBB 2J6TA 3TAPA 1QSSA 1UHUA 3LWMA 1RYRA 4BDPA 1SL2A 3C5FA 1S5LU 2GWSA 5HR7A 3UM9A 5EOZA 4KLMA 2RP5A 4OD0A 2HOIA 2KKVA 1Z19A 9ICMA 3C5GA 3PSPA 2AJQA 3TKAA 3MGHA 8ICNA 5HP4A 7ICUA 3HJEA 4R65A 1NJYA 2ZIXA 1MC8A 4QIWC 3PNCA 5HHIA 4G3IA 3D2SA 2BPFA 1N62A 2QKQA 1RYSA 5J0UA 5ALVA 4K4GA 1ZJNA 1ZQLA 2QARB 1ZRMA 4DQPA 1KTQA 3SQIA 1TK0A 1KFSA 5KFQA 1SWVA 3HRDD 5DBAA 2XO7A 1U9LA 3L4PA 2GOLA 2R18A 2W54A 5KFWA 4OO1J 4NXZA 3QXGA 2F8LA 4DS5A 3D2QA 2VIXA 1RPLA 2KJ8A 4F92B 3MR6A 1U48A 3HW8A 3SMVA 3SR6A 4KLJA 2L5YA 1M6YA 4MFAA 3TACB 8ICFA 3H8MA 3K4GA 1L3VA 3E0FA 5IIMA 9ICOA 9ICNA 1D9FA 2NRXA 1T3QA 2E5SA 2AGPA 2JRZA 4R8UB 3TADC 2W9BB 2C2RA 2LBOA 1TFRA 2FJ6A 4J9OA 1URJA 1F0MA 3J81j 1F5SA 4GXIA 4ECQA 1XO0A 4BX9C 5DGBA 4DS4A 2PFOA 3PR5B 5KFSA 3CRXA 1X40A 5A0LA 3PW7A 4IQTA 8ICGA 2ZXIA 1JMSA 3RJJA 3BQ2A 2KOBA 2DL0A 3Q8RB 1KL9A 4UW9A 2I5HA 1HUZA 4PL2A 3RH4A 1AQ6A 2VA3A 2H3QA 4RQ2A 4FS1A 3TQ1A 1COKA 2JV3A 4KITB 1CUKA 1B22A 4PGYA 3CNHA 7ICPA 3C1YA 5EWFA 1B4FA 4ED3A 3AN1A 2JEJA 2RLTA 5AHXA 5KT5A 2HCFA 1IIPA 5DG9A 4NLNA 3HKZF 5ALXA 4PGQA 4O3SA 3KHRA 1HJPA 5ALZA 2FDRA 3CW2C 3NASA 4MF8A 2BCQA 4B9TA 4O5EA 4RQ0A 4KN7A 3M9OB 2B21A 3C2MA 4O5KA 1KLNA 5CR0A 4P4PA 4I2HA 1PVRA 1VJ5A 4PZOA 1PZNA 2HHXA 1A0PA 4QZEA 4YXJA 4GC6A 2JZBA 4ICAA 2ZJ5A 4Y2UA 5KFPA 2JH1A 5DQHA 1QQ5A 4RPYA 3OPXA 3UMGA 4DL4A 1UA0A 4M04A 4P4OA 2ZTDA 1Z1VA 4C80A 2ASDA 3NGDA 5J2EA 3V6KA 4UARA 5HMLA 4O9MA 1L6NA 1QCKA 4NM2A 4O3MA 1ZJMA 4UB2A 3WKDA 2YMPA 1BPYA 2YY6A 2WFAA 4F50A 2FMSA 2H5XA 3RR7A 5J8YA 2IHNA 5IIKA 5L1MA 4F5QA 4KLOA 5AKXA 4RUAA 2UVRA 4F5PA 1Y88A 3ZD8A 3H4BA 3UMBA 4DFKA 5ALGA 3T5LA 2EAPA 1VLBA 1Q46A 1DRGA 2ASLA 3TFSA 8ICIA 4EX6A 1DOQA 4US8A 4P0PA 1CEZA 3UQ0A 4ZH4A 8ICOA 1J2MA 2OCEA 4QZFA 3MC1A 5CWRA 4AYBC 3EPIA 2BCRA 1UQVA 2LPEA 2WTFA 4DQIA 5H2FU 3SV3A 4DOBA 1XNSA 1S0OA 3DDHA 1X9WA 4F2RA 2XI9A 3ZDAA 4QNLA 2W55A 3RJIA 4FFDA 2WF5A 2AQ4A 4JV0A 4RZRA 5ALQA 3K1ZA 2K60A 1DGJA 4YMMA 2HSZA 2O6KA 3TANA 3V7JA 4C7ZA 3IRUA 3CP8A 5KG1A 2HOFA 5DG7A 4KX3A 4X5VA 2P35A 1JIHA 3MABA 2AGOA 1X42A 1Z3EB 5AM3A 1JXEA 2YMLA 1KDHA 3QE9Y 2QARA 2W3RA 3SV4A 1BPEA 1NZBA 4CDGA 3JPRA 4UB1A 1B0XA 3ISCA 1X9XA 1KSPA 3EYZA 4B9MA 2XC9A 2R8GA 3HWTA 1L8OA 3OJSA 5FP0A 2KFZA 2W04A 1XS9D 4DQSA 3M8SA 5KG6A 1U4BA 2JEIA 4Y2PA 3V6HA 4HYKA 1SB3C 2JEFA 4KLTA 5DKWA 2F44A 2KKPA 1KRPA 3GQCA 2GO7A 3M1YA 4IL6U 2A1AA 3KD3A 3F2DA 4EX7A 1HUOA 1KEJA 2KIVA 8ICLA 4KMUA 2F8KA 3RFAA 3IG5A 2HBKA 4NJ8A 4GLXA 2J6UA 4Y2SA 1ZQQA 5KG5A 4KLFA 4O3OA 4AP9A 1RM6C 3ZDBA 2LMRA 3QEAZ 3WKAA 5EWGA 3O0FA 2BKEA 4G9BA 7ICEA 2LYHA 3V7LA 1S0MA 3RJGA 3AMZA 3OTQA 4DSEA 5KFOA 5KL1B 3AL0B 3PSFA 2A19A 3NVZA 3LYSA 4QZDA 1PK3A 4ED1A 4J9RA 4KLEA 1Z00A 2GH1A 3M6ZA 4IRDA 3JPSA 2LI6A 5BOMA 4J9MA 3KKAC 2PMZC 5AIAA 5EE9A 4M9HA 1Q8KA 5J2IA 3MDCA 1AROP 4C7YA 4C8LA 5AKYA 4RQ6A 4MEYA 4R8UA 5J0YA 4EEYA 2UVWA 1V97A 2KZZA 5CA7A 8ICTA 1JALA 4PL1A 2W7PA 1L8LA 5ALOA 4F4KA 3F5AA 4TUSA 2JMGA 1ZQSA 1D8LA 4QZ9A 3HP6A 4Z6EA 3Q8SB 5KG4A 1NJWA 3MR2A 3QZ7A 3G6VA 4TQRA 1LVHA 3G6YA 1V85A 3MR5A 3PW5A 4ECXA 4I29A 4M2YA 5KFGA 5AM4A 4YG2A 2HHWA 4I2DA 5C0YA 5J2HA 2DF4B 5J29A 5IINA 2E8MA 2ES6A 2PI5A 4IQVA 2ATLA 1PUZA 2VJ5A 3QEBZ 4M6WB 4BWJA 4NLGA 3T5JA 9ICKA 1BPDA 5BOLA 4GFJA 3VC8A 5KFIA 5F9LA 2YX8A 4ED8A 1KBUA 3KFUF 4DQQA 1ZYQA 1ZQPA 5E79U 5L1LA 4IC9A 2ZIWA 2KIWA 4FE3A 9ICFA 5KFEA 1L7MA 3IM1A 2IBKA 1X6JA 4JV2A 3GFKB 4TURA 2E8NA 1S77D 3WK8A 5TZVA 3BS7A 4RUCA 2IA6A 4XQ8A 4UAVA 5AKJA 2B6GA 2OYYA 1Z4NA 3N28A 3NS1A 1C7YA 2QB0A 2WHEA 4DSFA 4I2GA 2WF6A 3GZFA 2HHUA 3H4DA 3MFIA 1VDVA 2YTUA 5KFAA 2WAQC 3RJKA 2BCSA 4C8KA 4KLSA 2OEHA 1TKDA 2WB1C 1JXLA 5AK5A 3MBYA 2FLPA 2E8OA 4YN4A 3RF9A 4DSKA 2V4QA 1YZ7A 2E1FA 5DG8A 4YMOA 2ZIUB 2MSNA 3Q8KA 4EZ9A 4JWMA 3EZ5A 1NK6A 3MR3A 1UT8A 2KEYA 1SKRA 2F1JA 4F5OA 2QB1A 1NKBA 5CP2A 3PMNA 4PJ0U 3ETRA 3UPQA 1FFVA 4DWIA 3UQ2A 2NYVA 1BPBA 5J2FA 2H3ZA 1N63A 2XGPA 4NLBA 4F5RA 2Y9UA 3HKZC 3K75D 5KG3A 4OCZA 1Q3UA 2HDOA 2V4RA 4M0AA 1CRXA 2W43A 4JMUA 8ICCA 1QLNA 3QU4A 2NV3A 2EZXA 2BHNA 3TI0A 3GDXA 3M9MB 4DOAA 1Z4OA 2KN7A 2WF8A 3JPQA 2FPMA 4UAYA 3SYZA 4QWBA 1ZQFA 1ZQJA 5ALSA 3A0BU 3NTUA 1NNLA 4KLDA 4JV1A 5JTIA 8ICKA 1ZXIA 4Q8FA 2JR5A 2NRVA 2ZIXB 8ICRA 4YR3A 2FI1A 1KN5A 4UB6U 2ESEA 1TE2A 1SWWA 3B0YA 4FO6A 4WJ3B 3FC4A 2N1RA 4R64A 3RAXA 1NK0A 1T8EA 4Y2VA 5AKLA 4OJOA 5AI8A 2KK0A 5AK3A 4M9LA 2HMXA 3T5KA 4ECWA 5EE3A 5L1IA 5KFCA 1WCNA 4JK1A 4KMOB 5KFFA 2HVHA 1S10A 2D6FC 3PW4A 2RDIA 4I2FA 4XA5A 2KJ5A 1N60A 1A76A 3RB6A 2R8IA 5HNKA 9ICEA 2LYBA 9ICTA 5ALHA 3HX0A 3BZKA 1C20A 2WB1F 9ICQA 3H8WA 4YP3A 1TK5A 3FM9A 1X9MA 1T4GA 4NLZA 3BQ0A 1ZQIA 2FLNA 2ALZA 5CB1A 1T94A 2DKXA 2CN1A 3OSPA 9ICIA 1LKYA 3RJEA 1JI7A 1UT5A 3TARA 1ZQAA 4IR1A 3WKEA 1V38A 3H0RB 4QWEA 4QWDA 1JX4A 3QU7A 4CE6A 2I6XA 4Y2XA 4UB4A 4PHAA 4QZ8A 4EENA 4U7CA 1X66A 5J8YC 2W3SA 2XIDA 4F4XA 3C21A 3HPOA 3KOOA 5DB8A 2ZUBA 4RNOA 4P2HA 4Q8EA 2OXOA 2W8KA 2DWQA 4YCXA 5HMMA 4C8OA 2C28A 1ZQDA 5D49A 3RB4A 4I2EA 3K1RB 4ED2A 3Q8QB 4F91B 4O5CA 1N5WA 3H40A 1ZQTA 5AICA 4LZDA 2CRXA 1H38A 1TV9A 9ICGA 5KFJA 1QQ7A 2K8BB 1RXWA 5D46A 2FLLA 4FBTA 2WF7A 1KQQA 1SL1A 5KFNA 2KHQA 5KT4A 1ED1A 4XUSA 2QB0B 4YR0A 1T3NA 1RQLA 7ICIA 5AKHA 1RQNA 2A1JA 2MU2A 2BPGA 3RJHA 4UB5A 3ORYA 4I2BA 4ECUA 1O03A 4DSLA 3AUOA 1L7PA 3OHBA 2ZXHA 1SKSA 2XCAA 2G07A 5J0QA 5AI5A 5AI9A 1HEKA 9ICJA 3N7SC 3A0HU 3JPNA 4ECVA 4GXKA 2KVSA 2MA1A 1NK9A 5IIOA 5KFUA 3M7DA 7ICHA 4DLGA 5ALDA 1X2IA 3PX4A 4U6PA 4UB8U 4EBEA 4XRHA 5DQGA 2MUTA 7ICSA 1ZQMA 1SXDA 2QLTA 1WG8A 3KZIU 4UAWA 3PW2A 2KHVA 2JGAA 1V9PA 2H3VA 4UAZA 1JROA 2LYAA 4MFCA 5K4LA 5KL8B 1N61A 4O3NA 3SAHA 1XSLA 4ECYA 1U49A 2AH5A 1TAQA 1WUDA 4UQGA 5L9XA 1L7OA 2NRTA 2KZMA 3ISDA 2BQ3A 4CF3A 1RXVA 3TADA 2W9CA 4F93B 1L3UA 4UBBA 4JB3A 5DDYA 4KTQA 2VJ4A 1LKYB 4QZCA 3AU6A 1BVSA 1U45A 3BZCA 1ZD4A 1QQ6A 2XVTA 4Q45A 3SD7A 4F8RA 4FZNA 1K1QA 3M9NB 3H7IA 3BQ1A 2MAXA 4QJFB 4C4SA 3H8SA 4F2SA 1ZD5A 2KP7A 3IV6A 3ZDEA 3QUQA 2RRDA 3L3FX 4BXOB 2IMWP 3F5EA 3ZI4A 5KFRA 4ED6A 5EE0A 1IG6A 2K8AA 4DLEA 4MEXA 2K4HA 1D8BA 3RBDA 3N7RC 3GV8B 3PSTA 4YD2A 9ICRA 2PKEA 2YMQA 2Y0SF 2ISPA 1ZRNA 5DB6A 3RR8A 3ONNA 4I2CA 4BGDA 4M9GA 5JU5A 3THVA 4M9JA 5AK4A 5KFXA 3T79A 2M9NA 4Y2QA 5ALMA 5HR6A 2XICA 4MFFA 5J2CA 1ZD2P 3UXPA 3PW0A 1UPHA 3T3FA 2VANA 1NJZA 3NUQA 4RQ7A 3NRZA 4JWNA 7ICVA 2A1JB 3E2EA 4CRXA 5AM2A 3WKBA 5KT3A 5KFTA 1Q3VA 4LZGA 4NM1A 5GTIU 4RQ1A 4P0QB 3AM9A 1Z00B 1FIQA 2M0NA 3LVWA 2JHDA 8ICYA 5DDMA 5AK6A 3WKCA 1DGSA 3DEEA 2DPIA 2EH9A 4Y2YA 2W03A 3ETLA 5J0RA 2BZFA 2LHTA 1N48A 4DL3A 3PMLA 3DV9A 3ZD9A 3NVYA 1XO1A 2V9WA 4NLCA 2R8KA 2KG5A 5KTQA 4ACOA 7ICOA 5G5GA 3GILA 1TVAA 4UB3A 4DFMA 3PR4A 3T5HA 2H3IA 2K4IA 4ELTA 2IOFK 1KW4A 5KFKA 1YZ6A 3RJFA 5AIBA 4DFJA 3GIJA 2BGWA 4B9SA 4EBCA 2B0CA 2YMMA 9ICPA 4UAUA 3KKAA 4ECTA 5KFLA 5KT6A 1K5OA 2ZJ8A 4O3RA 3GV5B 1XSNA 3WK6A 1MN8A 4R63A 5ALPA 3AQEA 2DKZA 4TQSA 3PZPA 1ZQGA 4R66A 2W11A 5KFVA 1NZPA 1BGXT 3MGVA 1IM4A 2W7OA 4MF2A 1X6IA 1ZQ1C 3C1ZA 3FYHA 5AM5A 1NOMA 4E0DA 8ICHA 4ELVA 3LWLA 3IHQB 2G08A 2FMQA 4OJLA 1UCVA 1F44A 7ICKA 2LM4A 1ZQBA 1X9SA 5IIIA 2OWOA 4MHVA 2OHFA 3ZDCA 4C4TA 4M6WA 4DQRA 3QUTA 2W9BA 4QZAA 1ZQVA 3I1YA 4IRCA 2F3NA 5J0OA 3FDSA 4RU9A 4DSIA 4EELA 3UMCA 2UVUA 2P66A 4KLIA 1UA1A 2D3DA 5DB7A 5ALJA 3L5KA 5BPCA 9ICCA 4DCCA 4KLQA 2EZZA 4Q44A 4F5NA 3PX6A 3EWAA 4RQMA 5AM1A 2KSOB 2AXTU 5DBCA 7ICJA 4IQUA 1ECWA 3B9JA 4FZMA 2W9AA 1MQ2A 5J0WA 7ICQA 4RPXA 3R9KA 8ICUA 3Q8PB 2NRZA 2C2EA 1KKXA 2DUYA 2DFLA 4PHPA 4O3PA 3V6JA 4QW9A 4I2AA 2G09A 4RT2A 2FMPA 4YD1A 5KG7A 4UASA 5KFBA 3QU5A 2HBMA 3GU3A 2BCUA 4TUQA 1DK2A 2I1QA 3QYPA 5B5EU 3GIIA 1FO4A 4HAIA 3LK9A 4CF5A 9ICUA 3VCBA 4QWCA 3PVXA 1S8OA 1COOA 4KLLA 1RDFA 3QU2A 3RB3A 4F4WA 4Y2RA 4CF4A 1XSPA 3C29A 3TFRA 4ED0A 3C23A 1K1SA 4YQWA 4J9PA 2IOFA 4USAA 1SZHA 2YQEA 1PVPA 3BJYA 9ICWA 1ZQRA 5ALTA 9ICLA 2KJ9A 2ZIVA 2RDJA 1ZD3A 2HVIA 4IR9A 2XY5A 3ALRA 5F3XB 2HHSA 1WWVA 3AEVA 5ALFA 5ALEA 4TUPA 2DGZA 1ZQOA 2KV2A 5AI4A 1RYUA 5G5HA 3RRHA 3D2NA 2HHTA 4RQ8A 1HIWA 5ALLA 4KLGA 4J9LA 1S76D 3IP4B 2RQ5A 4F71A 8ICXA 2I9GA 2Y1JA 3UXNA 4B9LA 1TAUA 4BJQA 2ISOA 5AM0A 4EZ6A 3KZXA 4ZOHC 4M9NA 3ZDDA 5C5JA 5J0XA 1J97A 3AQFA 1KFTA 4DFDA 4IQWA 3C2LA 2EQYA 4P0PB 4J03A 1ZQNA 4DF4A 2JH7A 5J2GA 1DXSA 2DQNB 5AI0A 2RHFA 1N5XA 2H3FA 2KVCA 3BS5B 5J2DA 3JPPA 4RNNA 3JPTA 2XCPA 3RB0A 4QZHA 4GIBA 3N4MB 3H0LB 4GC7A 3SZ2A 8ICJA 5J2JA 1PK1B 2LM1A 7ICTA 4NLKA 3KTQA 2ZG6A 2R8HA 4PHEA 4DL7A 4JUZA 2AHOB 2HBJA 2K89A 2Z7JA 1L3TA 4DL6A 2PXIA 5DLGA 4B9UA 1MA7A 1ZQUA 4J9KA 4NL9A 3PV8A 4CNQA 4QIWF 1NKEA 1BPZA 2NO5A 5KFHA 4FZLA 1BNOA 5T14A 5IIJA 5JUMA 2XY6A 4F4YA 1S97A 5ALUA 3I76A 2EDUA 2BDPA 5J0SA 2ODGA 5KG0A 1SIJA 4YMNA 3SAGA 4RQ5A 4B9NA 1NI3A 4PHDA 2EAMA 3PX0A 2LKYA 2F1HA 3N97B 3KHLA 3V72A 4Z6FA 3SAFA 3JPOA 3MGIA 5J2BA 5DBBA 5DQIA 4QZBA 4GXJA 2OH2A 1Z1BA 4OJPA 7ICLA 1QSLA 1ZQWA 1N2XA 4QW8A 2G5IB 3WU2U 3QZ8A 2AGQA 2GLEA 3WK5A 3GIKA 1MSWD 4K4IA 8ICSA 3QUCA 5KFZA 3N7PD 4EBDA 7ICMA 4PZNA 4F72A 3RRGA 3PSIA 8ICWA 4CGZA 4OJ5A 3C2KA 1OW5A 2KSOA 2KMDA 3IN5A 4F4ZA 1NK8A 4DL2A 1NK7A 3EPGA 1XC9A 1ZQEA 1JN3A 4BUGA 2PFQA 8ICZA 4IRKA 4BWMA 2DBYA 4C8MA 2PI4A 7ICGA 2BPCA 4O0IA 3BDPA 7ICFA 2ZUCA 2VA2A 2NO4A 3CYMA 3F2CA 2ZJAA 3F2BA 1DK3A 1ZQXA 9ICAA 4RPZA 3PY8A 1B43A 3RTVA 5KG2A 1TK8A 2WF9A 4UBCA 5AKKA 5AKIA 2MRLA 4DOCA 2F77X 4YFKA 4LJXA 3PO5A 3NRWA 1TAMA 4YVZA 2Q0ZX 1N56A 3RH5A 2ZIVB 2EANA 2HI0A 5KT2A 1QH9A 1WCLA 3RBEA 5ALKA 4PPXA 5DLFA 5J2KA 1L7NA 2ASJA 3ISBA 5J2AA 4C4RA 1QSYA 1A6SA 2KE7A 1SZPA 1SGGA 7ICRA 2OM6A 5TISU 4PH5A 2W9MA 2Y9TA 2R8JA 3QX7A 4ECSA 4QWAA 4NL9C 1RZTA 1QTMA 5HHHA 1NJXA 8ICBA 5ALIA 8ICVA 2P6UA 1S9FA 9ICBA 3M8RA 1S0VA 1BNPA 4OJ6A 1SKWA 3I28A 4F3OA 4EYHB 3WK7A 2EAOA 4A8EA 3AU2A 2E1EA 2E3TA 2CXYA 3Q8MA 5ALNA 1D9DA 4K4HA 8ICEA 3U26A 5KFMA 1ZOLA 2K8CB 2KTQA 1SV0C 2DPJA 2AQ0A 4DF8A 1XWLA 4Z6CA 1ZQYA 2Q4TA 5KFDA 4J9SA 1EXNA 1S0NA 5F9NA 2BDUA 3ED5A 2JXJA 5GTHU 1ZETA 4AYBF 4RQ3A 2ZTEA 5AKZA 2HOQA 4NV0A 4RNMA 4I2JA 3SENA 1SL0A 3D6JA 1FFUA 1IXRA 3MFHA 1FEZA 2K4EA 2K4PA 1YT3A 2IOHA 5EWEA 4KX5A 3OJUA 3BQTA 4Y2TA 3BS5A 1PK1A 3NVWA 3RAQA 4CCHA 2PFPA 5J0PA 4M47A 5AKGA 3NVVA 1LB2B 4KLHA 5CHGA 2HHQA 2BQUA 1JUDA 4ECZA 3KHHA 2BQRA 8ICPA 1OUQA 9ICHA 5DGAA 1NK4A 3IDWA 5B66U 5AI6A 4C0ZA 5DB9A 4DFPA 3F53A 2MUTB 2ZIWB 3QU9A 1L3SA 3V7KA 3ICXA 2W8LA 2F1IA 2FPLA 2KZ3A 4J9NA 3FAHA 3IG8A 1OXJA 1PVQA 3WK4A 2W9CB 4I28A 3GV7B 5ALYA 3PO4A 2F2AB 4UATA 9ICSA 3TAQA 2C22A 3H0MB 4FBUA 5KFYA 3H8JA 3UXOA 8ICAA 2KICA 5J0TA 3M6KA 2IHMA 1IV8A 3MDAA 2YB1A 4DSJA 2XY7A 2G06A 1SXEA 1D8YA 9ICVA 4P0QA 2ZTCA 4QZIA 4J9QA 3E58A 4FS2A 5ALWA 3LVVA 4B6JA 3KBBA 1ZQZA 2G5HB 4Z6DA 4PGXA 1WWUA 5EE1A 5JRTA 3EW9A 1CI4A 4DEZA 4ELUA 4Y2JA 1ZQHA 2J6SA 3LDAA 3GIMA 3HILA 5KAIU 4YXMA 4C8NA 1JRPA 1GO3F 1NKCA 5ALRA 2C2DA 2UVVA 7ICNA 2PMZF 4RQNA 2BR0A 4O3QA 2FPKA 4I27A 4KLUA 3HT3A 3Q8LA 3RH6A 2F76X 2EZYA 2VA8A 4RQ4A 4EYIB 5D4BA 4BXOA 9ICXA 3WK9A 4DL5A 1BPXA 2NRWA 1U47A 2Y1IA 2KFNA 4EEKA 3OGUA 2WAQF 2KD1A 2AU0A 2KNJA 4US9A 1XU4A 2JEGA 5KT7A
chains in the Genus database with same CATH topology
4XUSA 1ZQKA 4KLGA 1HUOA 2BCVA 1ZQCA 1KEJA 7ICIA 4LVSA 8ICXA 4DO9A 2I9GA 8ICLA 2BPGA 3UXNA 3RJHA 4UB5A 2ISOA 3B0XA 4I2BA 1MQ3A 1ZQQA 4KLFA 4RT3A 3AUOA 5IILA 4M9NA 5J0XA 7ICEA 5J0QA 3V7LA 9ICJA 3RJGA 4IQWA 3C2LA 4NY8A 1ZQNA 3JPNA 4QZDA 4GXKA 5J2GA 5IIOA 4KLEA 7ICHA 4QZGA 5J2DA 3JPPA 5BOMA 3JPSA 3JPTA 4QZHA 7ICSA 2PFNA 1ZQMA 8ICQA 8ICJA 5J2JA 4UAWA 8ICMA 4M9HA 7ICTA 5J2IA 4NLKA 3MDCA 4I2IA 4PHEA 4UAZA 4MFCA 4RQ6A 5J0YA 3C5FA 2PXIA 2GWSA 8ICTA 5EOZA 4KLMA 1XSLA 4TUSA 1BPZA 1ZQSA 3ISDA 1BNOA 9ICMA 5IIJA 4QZ9A 3C5GA 3MGHA 4Z6EA 8ICNA 7ICUA 4UBBA 4R65A 5DDYA 3PNCA 4QZCA 5HHIA 5J0SA 3AU6A 2BPFA 4I29A 4YMNA 4M2YA 4RQ5A 5J0UA 4K4GA 1ZJNA 4I2DA 1ZQLA 5J2HA 4PHDA 5J29A 5IINA 5DBAA 4IQVA 4NXZA 2KP7A 3HW8A 3V72A 4Z6FA 4KLJA 3JPOA 4MFAA 8ICFA 3MGIA 5J2BA 5DBBA 5IIMA 4QZBA 4GXJA 9ICKA 9ICOA 1BPDA 9ICNA 5BOLA 7ICLA 4YD2A 9ICRA 1ZQPA 2ISPA 5DB6A 4I2CA 4K4IA 9ICFA 8ICSA 4M9GA 7ICMA 4M9JA 4GXIA 8ICWA 4TURA 5TZVA 3C2KA 2PFOA 4MFFA 5J2CA 3UXPA 1ZQEA 4IQTA 8ICGA 2PFQA 8ICZA 1JMSA 3RJJA 4RQ7A 4I2GA 4JWNA 7ICVA 1HUZA 7ICGA 3RH4A 4LZGA 4NM1A 7ICFA 3RJKA 2BCSA 4RQ2A 4RQ1A 4KLSA 1DK3A 9ICAA 3MBYA 4RPZA 8ICYA 4PGYA 7ICPA 4YN4A 4UBCA 4YMOA 4JWMA 4DOCA 4NLNA 4F5OA 4PGQA 5J0RA 3PMLA 3PMNA 3UPQA 3RH5A 4MF8A 3UQ2A 2BCQA 4O5EA 4RQ0A 5J2FA 3C2MA 4F5RA 7ICOA 4O5KA 1TVAA 4PPXA 5J2KA 4UB3A 3ISBA 4I2HA 5J2AA 3RJFA 4M0AA 7ICRA 4QZEA 4PH5A 2W9MA 8ICCA 1RZTA 8ICBA 9ICPA 5HHHA 4RPYA 3GDXA 4DOAA 8ICVA 9ICBA 3JPQA 1XSNA 1BNPA 4M04A 4UAYA 4R63A 1ZQFA 1ZQJA 3AU2A 1ZQGA 5J2EA 4R66A 1NZPA 4K4HA 8ICEA 4O9MA 4MF2A 4KLDA 4NM2A 1ZJMA 4UB2A 8ICKA 4Z6CA 8ICHA 8ICRA 1BPYA 2FMSA 2FMQA 7ICKA 5IIKA 4RQ3A 4F5QA 1ZQBA 4KLOA 5IIIA 3B0YA 4F5PA 4FO6A 4I2JA 4R64A 4QZAA 5J0OA 2P66A 4KLIA 4M9LA 3TFSA 8ICIA 2PFPA 5J0PA 4M47A 5DB7A 3UQ0A 8ICOA 5BPCA 9ICCA 4KLQA 4F5NA 4KLHA 4QZFA 8ICPA 5CWRA 5DBCA 9ICHA 4I2FA 4XA5A 2BCRA 7ICJA 5DB9A 4IQUA 9ICEA 9ICTA 3V7KA 1MQ2A 5J0WA 7ICQA 4RPXA 8ICUA 4DOBA 3HX0A 4PHPA 4I28A 9ICQA 3RJIA 9ICSA 4I2AA 4NLZA 1ZQIA 4RT2A 2FMPA 3UXOA 4YD1A 5CB1A 8ICAA 5J0TA 4YMMA 2BCUA 9ICIA 2IHMA 4TUQA 1DK2A 3MDAA 3V7JA 3RJEA 1ZQAA 9ICVA 4QZIA 4X5VA 3LK9A 9ICUA 4UB4A 4PHAA 4QZ8A 4KLLA 4Z6DA 4PGXA 1ZQHA 1KDHA 1XSPA 3TFRA 5DB8A 1BPEA 7ICNA 4P2HA 3JPRA 4YCXA 4UB1A 3ISCA 9ICWA 4I27A 1ZQRA 4KLUA 9ICLA 3HWTA 1ZQDA 5D49A 3RH6A 4I2EA 4O5CA 4RQ4A 1ZQTA 5D4BA 9ICXA 4LZDA 1TV9A 9ICGA 1BPXA 4KLTA 5DKWA 4TUPA 5D46A 3OGUA 1ZQOA 4RQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUS A;  1ZQK A;  4KLG A;  1HUO A;  2BCV A;  1ZQC A;  1KEJ A;  7ICI A;  4LVS A;  8ICX A;  4DO9 A;  2I9G A;  8ICL A;  2BPG A;  3UXN A;  3RJH A;  4UB5 A;  2ISO A;  3B0X A;  4I2B A;  1MQ3 A;  1ZQQ A;  4KLF A;  4RT3 A;  3AUO A;  5IIL A;  4M9N A;  5J0X A;  7ICE A;  5J0Q A;  3V7L A;  9ICJ A;  3RJG A;  4IQW A;  3C2L A;  4NY8 A;  1ZQN A;  3JPN A;  4QZD A;  4GXK A;  5J2G A;  5IIO A;  4KLE A;  7ICH A;  4QZG A;  5J2D A;  3JPP A;  5BOM A;  3JPS A;  3JPT A;  4QZH A;  7ICS A;  2PFN A;  1ZQM A;  8ICQ A;  8ICJ A;  5J2J A;  4UAW A;  8ICM A;  4M9H A;  7ICT A;  5J2I A;  4NLK A;  3MDC A;  4I2I A;  4PHE A;  4UAZ A;  4MFC A;  4RQ6 A;  5J0Y A;  3C5F A;  2PXI A;  2GWS A;  8ICT A;  5EOZ A;  4KLM A;  1XSL A;  4TUS A;  1BPZ A;  1ZQS A;  3ISD A;  1BNO A;  9ICM A;  5IIJ A;  4QZ9 A;  3C5G A;  3MGH A;  4Z6E A;  8ICN A;  7ICU A;  4UBB A;  4R65 A;  5DDY A;  3PNC A;  4QZC A;  5HHI A;  5J0S A;  3AU6 A;  2BPF A;  4I29 A;  4YMN A;  4M2Y A;  4RQ5 A;  5J0U A;  4K4G A;  1ZJN A;  4I2D A;  1ZQL A;  5J2H A;  4PHD A;  5J29 A;  5IIN A;  5DBA A;  4IQV A;  4NXZ A;  2KP7 A;  3HW8 A;  3V72 A;  4Z6F A;  4KLJ A;  3JPO A;  4MFA A;  8ICF A;  3MGI A;  5J2B A;  5DBB A;  5IIM A;  4QZB A;  4GXJ A;  9ICK A;  9ICO A;  1BPD A;  9ICN A;  5BOL A;  7ICL A;  4YD2 A;  9ICR A;  1ZQP A;  2ISP A;  5DB6 A;  4I2C A;  4K4I A;  9ICF A;  8ICS A;  4M9G A;  7ICM A;  4M9J A;  4GXI A;  8ICW A;  4TUR A;  5TZV A;  3C2K A;  2PFO A;  4MFF A;  5J2C A;  3UXP A;  1ZQE A;  4IQT A;  8ICG A;  2PFQ A;  8ICZ A;  1JMS A;  3RJJ A;  4RQ7 A;  4I2G A;  4JWN A;  7ICV A;  1HUZ A;  7ICG A;  3RH4 A;  4LZG A;  4NM1 A;  7ICF A;  3RJK A;  2BCS A;  4RQ2 A;  4RQ1 A;  4KLS A;  1DK3 A;  9ICA A;  3MBY A;  4RPZ A;  8ICY A;  4PGY A;  7ICP A;  4YN4 A;  4UBC A;  4YMO A;  4JWM A;  4DOC A;  4NLN A;  4F5O A;  4PGQ A;  5J0R A;  3PML A;  3PMN A;  3UPQ A;  3RH5 A;  4MF8 A;  3UQ2 A;  2BCQ A;  4O5E A;  4RQ0 A;  5J2F A;  3C2M A;  4F5R A;  7ICO A;  4O5K A;  1TVA A;  4PPX A;  5J2K A;  4UB3 A;  3ISB A;  4I2H A;  5J2A A;  3RJF A;  4M0A A;  7ICR A;  4QZE A;  4PH5 A;  2W9M A;  8ICC A;  1RZT A;  8ICB A;  9ICP A;  5HHH A;  4RPY A;  3GDX A;  4DOA A;  8ICV A;  9ICB A;  3JPQ A;  1XSN A;  1BNP A;  4M04 A;  4UAY A;  4R63 A;  1ZQF A;  1ZQJ A;  3AU2 A;  1ZQG A;  5J2E A;  4R66 A;  1NZP A;  4K4H A;  8ICE A;  4O9M A;  4MF2 A;  4KLD A;  4NM2 A;  1ZJM A;  4UB2 A;  8ICK A;  4Z6C A;  8ICH A;  8ICR A;  1BPY A;  2FMS A;  2FMQ A;  7ICK A;  5IIK A;  4RQ3 A;  4F5Q A;  1ZQB A;  4KLO A;  5III A;  3B0Y A;  4F5P A;  4FO6 A;  4I2J A;  4R64 A;  4QZA A;  5J0O A;  2P66 A;  4KLI A;  4M9L A;  3TFS A;  8ICI A;  2PFP A;  5J0P A;  4M47 A;  5DB7 A;  3UQ0 A;  8ICO A;  5BPC A;  9ICC A;  4KLQ A;  4F5N A;  4KLH A;  4QZF A;  8ICP A;  5CWR A;  5DBC A;  9ICH A;  4I2F A;  4XA5 A;  2BCR A;  7ICJ A;  5DB9 A;  4IQU A;  9ICE A;  9ICT A;  3V7K A;  1MQ2 A;  5J0W A;  7ICQ A;  4RPX A;  8ICU A;  4DOB A;  3HX0 A;  4PHP A;  4I28 A;  9ICQ A;  3RJI A;  9ICS A;  4I2A A;  4NLZ A;  1ZQI A;  4RT2 A;  2FMP A;  3UXO A;  4YD1 A;  5CB1 A;  8ICA A;  5J0T A;  4YMM A;  2BCU A;  9ICI A;  2IHM A;  4TUQ A;  1DK2 A;  3MDA A;  3V7J A;  3RJE A;  1ZQA A;  9ICV A;  4QZI A;  4X5V A;  3LK9 A;  9ICU A;  4UB4 A;  4PHA A;  4QZ8 A;  4KLL A;  4Z6D A;  4PGX A;  1ZQH A;  1KDH A;  1XSP A;  3TFR A;  5DB8 A;  1BPE A;  7ICN A;  4P2H A;  3JPR A;  4YCX A;  4UB1 A;  3ISC A;  9ICW A;  4I27 A;  1ZQR A;  4KLU A;  9ICL A;  3HWT A;  1ZQD A;  5D49 A;  3RH6 A;  4I2E A;  4O5C A;  4RQ4 A;  1ZQT A;  5D4B A;  9ICX A;  4LZD A;  1TV9 A;  9ICG A;  1BPX A;  4KLT A;  5DKW A;  4TUP A;  5D46 A;  3OGU A;  1ZQO A;  4RQ8 A; 
#chains in the Genus database with same CATH topology
 1ZQK A;  2HW3 A;  1NK5 A;  1O08 A;  2BCV A;  2HBL A;  1ZQC A;  2YN4 A;  4LVS A;  5L1K A;  4DO9 A;  2XGQ A;  5CJ7 A;  1A77 A;  2E8P A;  3S6J A;  3B0X A;  2G0A A;  1MQ3 A;  1WYG A;  4KN4 A;  3SI8 A;  3C28 A;  4RT3 A;  5IIL A;  1P7D A;  1T7P A;  3QUB A;  2A3V A;  2FE9 A;  4YR2 A;  5KAF U;  4NWI A;  3EUB 2;  2D8C A;  2HHV A;  3KHG A;  1KFD A;  1SV0 A;  1J2N A;  3SEI A;  2YB4 A;  3G6X A;  4NY8 A;  3OSN A;  2Y0S C;  3BQ7 A;  2CPR A;  2ZIU A;  5AKE A;  5L1J A;  1LV5 A;  4P4M A;  5CRX A;  2VKQ A;  5CEH A;  4Q43 A;  2P6R A;  4QZG A;  4ED7 A;  1L5U A;  3OHA A;  4ECR A;  1RG6 A;  1SV4 A;  5KNI A;  2PFN A;  4IS7 A;  8ICQ A;  8ICM A;  3QNM A;  2ZUD A;  4B9V A;  4I2I A;  2JZB B;  2J6T A;  3TAP A;  1QSS A;  1UHU A;  3LWM A;  1RYR A;  4BDP A;  1SL2 A;  3C5F A;  1S5L U;  2GWS A;  5HR7 A;  3UM9 A;  5EOZ A;  4KLM A;  2RP5 A;  4OD0 A;  2HOI A;  2KKV A;  1Z19 A;  9ICM A;  3C5G A;  3PSP A;  2AJQ A;  3TKA A;  3MGH A;  8ICN A;  5HP4 A;  7ICU A;  3HJE A;  4R65 A;  1NJY A;  2ZIX A;  1MC8 A;  4QIW C;  3PNC A;  5HHI A;  4G3I A;  3D2S A;  2BPF A;  1N62 A;  2QKQ A;  1RYS A;  5J0U A;  5ALV A;  4K4G A;  1ZJN A;  1ZQL A;  2QAR B;  1ZRM A;  4DQP A;  1KTQ A;  3SQI A;  1TK0 A;  1KFS A;  5KFQ A;  1SWV A;  3HRD D;  5DBA A;  2XO7 A;  1U9L A;  3L4P A;  2GOL A;  2R18 A;  2W54 A;  5KFW A;  4OO1 J;  4NXZ A;  3QXG A;  2F8L A;  4DS5 A;  3D2Q A;  2VIX A;  1RPL A;  2KJ8 A;  4F92 B;  3MR6 A;  1U48 A;  3HW8 A;  3SMV A;  3SR6 A;  4KLJ A;  2L5Y A;  1M6Y A;  4MFA A;  3TAC B;  8ICF A;  3H8M A;  3K4G A;  1L3V A;  3E0F A;  5IIM A;  9ICO A;  9ICN A;  1D9F A;  2NRX A;  1T3Q A;  2E5S A;  2AGP A;  2JRZ A;  4R8U B;  3TAD C;  2W9B B;  2C2R A;  2LBO A;  1TFR A;  2FJ6 A;  4J9O A;  1URJ A;  1F0M A;  3J81 j;  1F5S A;  4GXI A;  4ECQ A;  1XO0 A;  4BX9 C;  5DGB A;  4DS4 A;  2PFO A;  3PR5 B;  5KFS A;  3CRX A;  1X40 A;  5A0L A;  3PW7 A;  4IQT A;  8ICG A;  2ZXI A;  1JMS A;  3RJJ A;  3BQ2 A;  2KOB A;  2DL0 A;  3Q8R B;  1KL9 A;  4UW9 A;  2I5H A;  1HUZ A;  4PL2 A;  3RH4 A;  1AQ6 A;  2VA3 A;  2H3Q A;  4RQ2 A;  4FS1 A;  3TQ1 A;  1COK A;  2JV3 A;  4KIT B;  1CUK A;  1B22 A;  4PGY A;  3CNH A;  7ICP A;  3C1Y A;  5EWF A;  1B4F A;  4ED3 A;  3AN1 A;  2JEJ A;  2RLT A;  5AHX A;  5KT5 A;  2HCF A;  1IIP A;  5DG9 A;  4NLN A;  3HKZ F;  5ALX A;  4PGQ A;  4O3S A;  3KHR A;  1HJP A;  5ALZ A;  2FDR A;  3CW2 C;  3NAS A;  4MF8 A;  2BCQ A;  4B9T A;  4O5E A;  4RQ0 A;  4KN7 A;  3M9O B;  2B21 A;  3C2M A;  4O5K A;  1KLN A;  5CR0 A;  4P4P A;  4I2H A;  1PVR A;  1VJ5 A;  4PZO A;  1PZN A;  2HHX A;  1A0P A;  4QZE A;  4YXJ A;  4GC6 A;  2JZB A;  4ICA A;  2ZJ5 A;  4Y2U A;  5KFP A;  2JH1 A;  5DQH A;  1QQ5 A;  4RPY A;  3OPX A;  3UMG A;  4DL4 A;  1UA0 A;  4M04 A;  4P4O A;  2ZTD A;  1Z1V A;  4C80 A;  2ASD A;  3NGD A;  5J2E A;  3V6K A;  4UAR A;  5HML A;  4O9M A;  1L6N A;  1QCK A;  4NM2 A;  4O3M A;  1ZJM A;  4UB2 A;  3WKD A;  2YMP A;  1BPY A;  2YY6 A;  2WFA A;  4F50 A;  2FMS A;  2H5X A;  3RR7 A;  5J8Y A;  2IHN A;  5IIK A;  5L1M A;  4F5Q A;  4KLO A;  5AKX A;  4RUA A;  2UVR A;  4F5P A;  1Y88 A;  3ZD8 A;  3H4B A;  3UMB A;  4DFK A;  5ALG A;  3T5L A;  2EAP A;  1VLB A;  1Q46 A;  1DRG A;  2ASL A;  3TFS A;  8ICI A;  4EX6 A;  1DOQ A;  4US8 A;  4P0P A;  1CEZ A;  3UQ0 A;  4ZH4 A;  8ICO A;  1J2M A;  2OCE A;  4QZF A;  3MC1 A;  5CWR A;  4AYB C;  3EPI A;  2BCR A;  1UQV A;  2LPE A;  2WTF A;  4DQI A;  5H2F U;  3SV3 A;  4DOB A;  1XNS A;  1S0O A;  3DDH A;  1X9W A;  4F2R A;  2XI9 A;  3ZDA A;  4QNL A;  2W55 A;  3RJI A;  4FFD A;  2WF5 A;  2AQ4 A;  4JV0 A;  4RZR A;  5ALQ A;  3K1Z A;  2K60 A;  1DGJ A;  4YMM A;  2HSZ A;  2O6K A;  3TAN A;  3V7J A;  4C7Z A;  3IRU A;  3CP8 A;  5KG1 A;  2HOF A;  5DG7 A;  4KX3 A;  4X5V A;  2P35 A;  1JIH A;  3MAB A;  2AGO A;  1X42 A;  1Z3E B;  5AM3 A;  1JXE A;  2YML A;  1KDH A;  3QE9 Y;  2QAR A;  2W3R A;  3SV4 A;  1BPE A;  1NZB A;  4CDG A;  3JPR A;  4UB1 A;  1B0X A;  3ISC A;  1X9X A;  1KSP A;  3EYZ A;  4B9M A;  2XC9 A;  2R8G A;  3HWT A;  1L8O A;  3OJS A;  5FP0 A;  2KFZ A;  2W04 A;  1XS9 D;  4DQS A;  3M8S A;  5KG6 A;  1U4B A;  2JEI A;  4Y2P A;  3V6H A;  4HYK A;  1SB3 C;  2JEF A;  4KLT A;  5DKW A;  2F44 A;  2KKP A;  1KRP A;  3GQC A;  2GO7 A;  3M1Y A;  4IL6 U;  2A1A A;  3KD3 A;  3F2D A;  4EX7 A;  1HUO A;  1KEJ A;  2KIV A;  8ICL A;  4KMU A;  2F8K A;  3RFA A;  3IG5 A;  2HBK A;  4NJ8 A;  4GLX A;  2J6U A;  4Y2S A;  1ZQQ A;  5KG5 A;  4KLF A;  4O3O A;  4AP9 A;  1RM6 C;  3ZDB A;  2LMR A;  3QEA Z;  3WKA A;  5EWG A;  3O0F A;  2BKE A;  4G9B A;  7ICE A;  2LYH A;  3V7L A;  1S0M A;  3RJG A;  3AMZ A;  3OTQ A;  4DSE A;  5KFO A;  5KL1 B;  3AL0 B;  3PSF A;  2A19 A;  3NVZ A;  3LYS A;  4QZD A;  1PK3 A;  4ED1 A;  4J9R A;  4KLE A;  1Z00 A;  2GH1 A;  3M6Z A;  4IRD A;  3JPS A;  2LI6 A;  5BOM A;  4J9M A;  3KKA C;  2PMZ C;  5AIA A;  5EE9 A;  4M9H A;  1Q8K A;  5J2I A;  3MDC A;  1ARO P;  4C7Y A;  4C8L A;  5AKY A;  4RQ6 A;  4MEY A;  4R8U A;  5J0Y A;  4EEY A;  2UVW A;  1V97 A;  2KZZ A;  5CA7 A;  8ICT A;  1JAL A;  4PL1 A;  2W7P A;  1L8L A;  5ALO A;  4F4K A;  3F5A A;  4TUS A;  2JMG A;  1ZQS A;  1D8L A;  4QZ9 A;  3HP6 A;  4Z6E A;  3Q8S B;  5KG4 A;  1NJW A;  3MR2 A;  3QZ7 A;  3G6V A;  4TQR A;  1LVH A;  3G6Y A;  1V85 A;  3MR5 A;  3PW5 A;  4ECX A;  4I29 A;  4M2Y A;  5KFG A;  5AM4 A;  4YG2 A;  2HHW A;  4I2D A;  5C0Y A;  5J2H A;  2DF4 B;  5J29 A;  5IIN A;  2E8M A;  2ES6 A;  2PI5 A;  4IQV A;  2ATL A;  1PUZ A;  2VJ5 A;  3QEB Z;  4M6W B;  4BWJ A;  4NLG A;  3T5J A;  9ICK A;  1BPD A;  5BOL A;  4GFJ A;  3VC8 A;  5KFI A;  5F9L A;  2YX8 A;  4ED8 A;  1KBU A;  3KFU F;  4DQQ A;  1ZYQ A;  1ZQP A;  5E79 U;  5L1L A;  4IC9 A;  2ZIW A;  2KIW A;  4FE3 A;  9ICF A;  5KFE A;  1L7M A;  3IM1 A;  2IBK A;  1X6J A;  4JV2 A;  3GFK B;  4TUR A;  2E8N A;  1S77 D;  3WK8 A;  5TZV A;  3BS7 A;  4RUC A;  2IA6 A;  4XQ8 A;  4UAV A;  5AKJ A;  2B6G A;  2OYY A;  1Z4N A;  3N28 A;  3NS1 A;  1C7Y A;  2QB0 A;  2WHE A;  4DSF A;  4I2G A;  2WF6 A;  3GZF A;  2HHU A;  3H4D A;  3MFI A;  1VDV A;  2YTU A;  5KFA A;  2WAQ C;  3RJK A;  2BCS A;  4C8K A;  4KLS A;  2OEH A;  1TKD A;  2WB1 C;  1JXL A;  5AK5 A;  3MBY A;  2FLP A;  2E8O A;  4YN4 A;  3RF9 A;  4DSK A;  2V4Q A;  1YZ7 A;  2E1F A;  5DG8 A;  4YMO A;  2ZIU B;  2MSN A;  3Q8K A;  4EZ9 A;  4JWM A;  3EZ5 A;  1NK6 A;  3MR3 A;  1UT8 A;  2KEY A;  1SKR A;  2F1J A;  4F5O A;  2QB1 A;  1NKB A;  5CP2 A;  3PMN A;  4PJ0 U;  3ETR A;  3UPQ A;  1FFV A;  4DWI A;  3UQ2 A;  2NYV A;  1BPB A;  5J2F A;  2H3Z A;  1N63 A;  2XGP A;  4NLB A;  4F5R A;  2Y9U A;  3HKZ C;  3K75 D;  5KG3 A;  4OCZ A;  1Q3U A;  2HDO A;  2V4R A;  4M0A A;  1CRX A;  2W43 A;  4JMU A;  8ICC A;  1QLN A;  3QU4 A;  2NV3 A;  2EZX A;  2BHN A;  3TI0 A;  3GDX A;  3M9M B;  4DOA A;  1Z4O A;  2KN7 A;  2WF8 A;  3JPQ A;  2FPM A;  4UAY A;  3SYZ A;  4QWB A;  1ZQF A;  1ZQJ A;  5ALS A;  3A0B U;  3NTU A;  1NNL A;  4KLD A;  4JV1 A;  5JTI A;  8ICK A;  1ZXI A;  4Q8F A;  2JR5 A;  2NRV A;  2ZIX B;  8ICR A;  4YR3 A;  2FI1 A;  1KN5 A;  4UB6 U;  2ESE A;  1TE2 A;  1SWW A;  3B0Y A;  4FO6 A;  4WJ3 B;  3FC4 A;  2N1R A;  4R64 A;  3RAX A;  1NK0 A;  1T8E A;  4Y2V A;  5AKL A;  4OJO A;  5AI8 A;  2KK0 A;  5AK3 A;  4M9L A;  2HMX A;  3T5K A;  4ECW A;  5EE3 A;  5L1I A;  5KFC A;  1WCN A;  4JK1 A;  4KMO B;  5KFF A;  2HVH A;  1S10 A;  2D6F C;  3PW4 A;  2RDI A;  4I2F A;  4XA5 A;  2KJ5 A;  1N60 A;  1A76 A;  3RB6 A;  2R8I A;  5HNK A;  9ICE A;  2LYB A;  9ICT A;  5ALH A;  3HX0 A;  3BZK A;  1C20 A;  2WB1 F;  9ICQ A;  3H8W A;  4YP3 A;  1TK5 A;  3FM9 A;  1X9M A;  1T4G A;  4NLZ A;  3BQ0 A;  1ZQI A;  2FLN A;  2ALZ A;  5CB1 A;  1T94 A;  2DKX A;  2CN1 A;  3OSP A;  9ICI A;  1LKY A;  3RJE A;  1JI7 A;  1UT5 A;  3TAR A;  1ZQA A;  4IR1 A;  3WKE A;  1V38 A;  3H0R B;  4QWE A;  4QWD A;  1JX4 A;  3QU7 A;  4CE6 A;  2I6X A;  4Y2X A;  4UB4 A;  4PHA A;  4QZ8 A;  4EEN A;  4U7C A;  1X66 A;  5J8Y C;  2W3S A;  2XID A;  4F4X A;  3C21 A;  3HPO A;  3KOO A;  5DB8 A;  2ZUB A;  4RNO A;  4P2H A;  4Q8E A;  2OXO A;  2W8K A;  2DWQ A;  4YCX A;  5HMM A;  4C8O A;  2C28 A;  1ZQD A;  5D49 A;  3RB4 A;  4I2E A;  3K1R B;  4ED2 A;  3Q8Q B;  4F91 B;  4O5C A;  1N5W A;  3H40 A;  1ZQT A;  5AIC A;  4LZD A;  2CRX A;  1H38 A;  1TV9 A;  9ICG A;  5KFJ A;  1QQ7 A;  2K8B B;  1RXW A;  5D46 A;  2FLL A;  4FBT A;  2WF7 A;  1KQQ A;  1SL1 A;  5KFN A;  2KHQ A;  5KT4 A;  1ED1 A;  4XUS A;  2QB0 B;  4YR0 A;  1T3N A;  1RQL A;  7ICI A;  5AKH A;  1RQN A;  2A1J A;  2MU2 A;  2BPG A;  3RJH A;  4UB5 A;  3ORY A;  4I2B A;  4ECU A;  1O03 A;  4DSL A;  3AUO A;  1L7P A;  3OHB A;  2ZXH A;  1SKS A;  2XCA A;  2G07 A;  5J0Q A;  5AI5 A;  5AI9 A;  1HEK A;  9ICJ A;  3N7S C;  3A0H U;  3JPN A;  4ECV A;  4GXK A;  2KVS A;  2MA1 A;  1NK9 A;  5IIO A;  5KFU A;  3M7D A;  7ICH A;  4DLG A;  5ALD A;  1X2I A;  3PX4 A;  4U6P A;  4UB8 U;  4EBE A;  4XRH A;  5DQG A;  2MUT A;  7ICS A;  1ZQM A;  1SXD A;  2QLT A;  1WG8 A;  3KZI U;  4UAW A;  3PW2 A;  2KHV A;  2JGA A;  1V9P A;  2H3V A;  4UAZ A;  1JRO A;  2LYA A;  4MFC A;  5K4L A;  5KL8 B;  1N61 A;  4O3N A;  3SAH A;  1XSL A;  4ECY A;  1U49 A;  2AH5 A;  1TAQ A;  1WUD A;  4UQG A;  5L9X A;  1L7O A;  2NRT A;  2KZM A;  3ISD A;  2BQ3 A;  4CF3 A;  1RXV A;  3TAD A;  2W9C A;  4F93 B;  1L3U A;  4UBB A;  4JB3 A;  5DDY A;  4KTQ A;  2VJ4 A;  1LKY B;  4QZC A;  3AU6 A;  1BVS A;  1U45 A;  3BZC A;  1ZD4 A;  1QQ6 A;  2XVT A;  4Q45 A;  3SD7 A;  4F8R A;  4FZN A;  1K1Q A;  3M9N B;  3H7I A;  3BQ1 A;  2MAX A;  4QJF B;  4C4S A;  3H8S A;  4F2S A;  1ZD5 A;  2KP7 A;  3IV6 A;  3ZDE A;  3QUQ A;  2RRD A;  3L3F X;  4BXO B;  2IMW P;  3F5E A;  3ZI4 A;  5KFR A;  4ED6 A;  5EE0 A;  1IG6 A;  2K8A A;  4DLE A;  4MEX A;  2K4H A;  1D8B A;  3RBD A;  3N7R C;  3GV8 B;  3PST A;  4YD2 A;  9ICR A;  2PKE A;  2YMQ A;  2Y0S F;  2ISP A;  1ZRN A;  5DB6 A;  3RR8 A;  3ONN A;  4I2C A;  4BGD A;  4M9G A;  5JU5 A;  3THV A;  4M9J A;  5AK4 A;  5KFX A;  3T79 A;  2M9N A;  4Y2Q A;  5ALM A;  5HR6 A;  2XIC A;  4MFF A;  5J2C A;  1ZD2 P;  3UXP A;  3PW0 A;  1UPH A;  3T3F A;  2VAN A;  1NJZ A;  3NUQ A;  4RQ7 A;  3NRZ A;  4JWN A;  7ICV A;  2A1J B;  3E2E A;  4CRX A;  5AM2 A;  3WKB A;  5KT3 A;  5KFT A;  1Q3V A;  4LZG A;  4NM1 A;  5GTI U;  4RQ1 A;  4P0Q B;  3AM9 A;  1Z00 B;  1FIQ A;  2M0N A;  3LVW A;  2JHD A;  8ICY A;  5DDM A;  5AK6 A;  3WKC A;  1DGS A;  3DEE A;  2DPI A;  2EH9 A;  4Y2Y A;  2W03 A;  3ETL A;  5J0R A;  2BZF A;  2LHT A;  1N48 A;  4DL3 A;  3PML A;  3DV9 A;  3ZD9 A;  3NVY A;  1XO1 A;  2V9W A;  4NLC A;  2R8K A;  2KG5 A;  5KTQ A;  4ACO A;  7ICO A;  5G5G A;  3GIL A;  1TVA A;  4UB3 A;  4DFM A;  3PR4 A;  3T5H A;  2H3I A;  2K4I A;  4ELT A;  2IOF K;  1KW4 A;  5KFK A;  1YZ6 A;  3RJF A;  5AIB A;  4DFJ A;  3GIJ A;  2BGW A;  4B9S A;  4EBC A;  2B0C A;  2YMM A;  9ICP A;  4UAU A;  3KKA A;  4ECT A;  5KFL A;  5KT6 A;  1K5O A;  2ZJ8 A;  4O3R A;  3GV5 B;  1XSN A;  3WK6 A;  1MN8 A;  4R63 A;  5ALP A;  3AQE A;  2DKZ A;  4TQS A;  3PZP A;  1ZQG A;  4R66 A;  2W11 A;  5KFV A;  1NZP A;  1BGX T;  3MGV A;  1IM4 A;  2W7O A;  4MF2 A;  1X6I A;  1ZQ1 C;  3C1Z A;  3FYH A;  5AM5 A;  1NOM A;  4E0D A;  8ICH A;  4ELV A;  3LWL A;  3IHQ B;  2G08 A;  2FMQ A;  4OJL A;  1UCV A;  1F44 A;  7ICK A;  2LM4 A;  1ZQB A;  1X9S A;  5III A;  2OWO A;  4MHV A;  2OHF A;  3ZDC A;  4C4T A;  4M6W A;  4DQR A;  3QUT A;  2W9B A;  4QZA A;  1ZQV A;  3I1Y A;  4IRC A;  2F3N A;  5J0O A;  3FDS A;  4RU9 A;  4DSI A;  4EEL A;  3UMC A;  2UVU A;  2P66 A;  4KLI A;  1UA1 A;  2D3D A;  5DB7 A;  5ALJ A;  3L5K A;  5BPC A;  9ICC A;  4DCC A;  4KLQ A;  2EZZ A;  4Q44 A;  4F5N A;  3PX6 A;  3EWA A;  4RQM A;  5AM1 A;  2KSO B;  2AXT U;  5DBC A;  7ICJ A;  4IQU A;  1ECW A;  3B9J A;  4FZM A;  2W9A A;  1MQ2 A;  5J0W A;  7ICQ A;  4RPX A;  3R9K A;  8ICU A;  3Q8P B;  2NRZ A;  2C2E A;  1KKX A;  2DUY A;  2DFL A;  4PHP A;  4O3P A;  3V6J A;  4QW9 A;  4I2A A;  2G09 A;  4RT2 A;  2FMP A;  4YD1 A;  5KG7 A;  4UAS A;  5KFB A;  3QU5 A;  2HBM A;  3GU3 A;  2BCU A;  4TUQ A;  1DK2 A;  2I1Q A;  3QYP A;  5B5E U;  3GII A;  1FO4 A;  4HAI A;  3LK9 A;  4CF5 A;  9ICU A;  3VCB A;  4QWC A;  3PVX A;  1S8O A;  1COO A;  4KLL A;  1RDF A;  3QU2 A;  3RB3 A;  4F4W A;  4Y2R A;  4CF4 A;  1XSP A;  3C29 A;  3TFR A;  4ED0 A;  3C23 A;  1K1S A;  4YQW A;  4J9P A;  2IOF A;  4USA A;  1SZH A;  2YQE A;  1PVP A;  3BJY A;  9ICW A;  1ZQR A;  5ALT A;  9ICL A;  2KJ9 A;  2ZIV A;  2RDJ A;  1ZD3 A;  2HVI A;  4IR9 A;  2XY5 A;  3ALR A;  5F3X B;  2HHS A;  1WWV A;  3AEV A;  5ALF A;  5ALE A;  4TUP A;  2DGZ A;  1ZQO A;  2KV2 A;  5AI4 A;  1RYU A;  5G5H A;  3RRH A;  3D2N A;  2HHT A;  4RQ8 A;  1HIW A;  5ALL A;  4KLG A;  4J9L A;  1S76 D;  3IP4 B;  2RQ5 A;  4F71 A;  8ICX A;  2I9G A;  2Y1J A;  3UXN A;  4B9L A;  1TAU A;  4BJQ A;  2ISO A;  5AM0 A;  4EZ6 A;  3KZX A;  4ZOH C;  4M9N A;  3ZDD A;  5C5J A;  5J0X A;  1J97 A;  3AQF A;  1KFT A;  4DFD A;  4IQW A;  3C2L A;  2EQY A;  4P0P B;  4J03 A;  1ZQN A;  4DF4 A;  2JH7 A;  5J2G A;  1DXS A;  2DQN B;  5AI0 A;  2RHF A;  1N5X A;  2H3F A;  2KVC A;  3BS5 B;  5J2D A;  3JPP A;  4RNN A;  3JPT A;  2XCP A;  3RB0 A;  4QZH A;  4GIB A;  3N4M B;  3H0L B;  4GC7 A;  3SZ2 A;  8ICJ A;  5J2J A;  1PK1 B;  2LM1 A;  7ICT A;  4NLK A;  3KTQ A;  2ZG6 A;  2R8H A;  4PHE A;  4DL7 A;  4JUZ A;  2AHO B;  2HBJ A;  2K89 A;  2Z7J A;  1L3T A;  4DL6 A;  2PXI A;  5DLG A;  4B9U A;  1MA7 A;  1ZQU A;  4J9K A;  4NL9 A;  3PV8 A;  4CNQ A;  4QIW F;  1NKE A;  1BPZ A;  2NO5 A;  5KFH A;  4FZL A;  1BNO A;  5T14 A;  5IIJ A;  5JUM A;  2XY6 A;  4F4Y A;  1S97 A;  5ALU A;  3I76 A;  2EDU A;  2BDP A;  5J0S A;  2ODG A;  5KG0 A;  1SIJ A;  4YMN A;  3SAG A;  4RQ5 A;  4B9N A;  1NI3 A;  4PHD A;  2EAM A;  3PX0 A;  2LKY A;  2F1H A;  3N97 B;  3KHL A;  3V72 A;  4Z6F A;  3SAF A;  3JPO A;  3MGI A;  5J2B A;  5DBB A;  5DQI A;  4QZB A;  4GXJ A;  2OH2 A;  1Z1B A;  4OJP A;  7ICL A;  1QSL A;  1ZQW A;  1N2X A;  4QW8 A;  2G5I B;  3WU2 U;  3QZ8 A;  2AGQ A;  2GLE A;  3WK5 A;  3GIK A;  1MSW D;  4K4I A;  8ICS A;  3QUC A;  5KFZ A;  3N7P D;  4EBD A;  7ICM A;  4PZN A;  4F72 A;  3RRG A;  3PSI A;  8ICW A;  4CGZ A;  4OJ5 A;  3C2K A;  1OW5 A;  2KSO A;  2KMD A;  3IN5 A;  4F4Z A;  1NK8 A;  4DL2 A;  1NK7 A;  3EPG A;  1XC9 A;  1ZQE A;  1JN3 A;  4BUG A;  2PFQ A;  8ICZ A;  4IRK A;  4BWM A;  2DBY A;  4C8M A;  2PI4 A;  7ICG A;  2BPC A;  4O0I A;  3BDP A;  7ICF A;  2ZUC A;  2VA2 A;  2NO4 A;  3CYM A;  3F2C A;  2ZJA A;  3F2B A;  1DK3 A;  1ZQX A;  9ICA A;  4RPZ A;  3PY8 A;  1B43 A;  3RTV A;  5KG2 A;  1TK8 A;  2WF9 A;  4UBC A;  5AKK A;  5AKI A;  2MRL A;  4DOC A;  2F77 X;  4YFK A;  4LJX A;  3PO5 A;  3NRW A;  1TAM A;  4YVZ A;  2Q0Z X;  1N56 A;  3RH5 A;  2ZIV B;  2EAN A;  2HI0 A;  5KT2 A;  1QH9 A;  1WCL A;  3RBE A;  5ALK A;  4PPX A;  5DLF A;  5J2K A;  1L7N A;  2ASJ A;  3ISB A;  5J2A A;  4C4R A;  1QSY A;  1A6S A;  2KE7 A;  1SZP A;  1SGG A;  7ICR A;  2OM6 A;  5TIS U;  4PH5 A;  2W9M A;  2Y9T A;  2R8J A;  3QX7 A;  4ECS A;  4QWA A;  4NL9 C;  1RZT A;  1QTM A;  5HHH A;  1NJX A;  8ICB A;  5ALI A;  8ICV A;  2P6U A;  1S9F A;  9ICB A;  3M8R A;  1S0V A;  1BNP A;  4OJ6 A;  1SKW A;  3I28 A;  4F3O A;  4EYH B;  3WK7 A;  2EAO A;  4A8E A;  3AU2 A;  2E1E A;  2E3T A;  2CXY A;  3Q8M A;  5ALN A;  1D9D A;  4K4H A;  8ICE A;  3U26 A;  5KFM A;  1ZOL A;  2K8C B;  2KTQ A;  1SV0 C;  2DPJ A;  2AQ0 A;  4DF8 A;  1XWL A;  4Z6C A;  1ZQY A;  2Q4T A;  5KFD A;  4J9S A;  1EXN A;  1S0N A;  5F9N A;  2BDU A;  3ED5 A;  2JXJ A;  5GTH U;  1ZET A;  4AYB F;  4RQ3 A;  2ZTE A;  5AKZ A;  2HOQ A;  4NV0 A;  4RNM A;  4I2J A;  3SEN A;  1SL0 A;  3D6J A;  1FFU A;  1IXR A;  3MFH A;  1FEZ A;  2K4E A;  2K4P A;  1YT3 A;  2IOH A;  5EWE A;  4KX5 A;  3OJU A;  3BQT A;  4Y2T A;  3BS5 A;  1PK1 A;  3NVW A;  3RAQ A;  4CCH A;  2PFP A;  5J0P A;  4M47 A;  5AKG A;  3NVV A;  1LB2 B;  4KLH A;  5CHG A;  2HHQ A;  2BQU A;  1JUD A;  4ECZ A;  3KHH A;  2BQR A;  8ICP A;  1OUQ A;  9ICH A;  5DGA A;  1NK4 A;  3IDW A;  5B66 U;  5AI6 A;  4C0Z A;  5DB9 A;  4DFP A;  3F53 A;  2MUT B;  2ZIW B;  3QU9 A;  1L3S A;  3V7K A;  3ICX A;  2W8L A;  2F1I A;  2FPL A;  2KZ3 A;  4J9N A;  3FAH A;  3IG8 A;  1OXJ A;  1PVQ A;  3WK4 A;  2W9C B;  4I28 A;  3GV7 B;  5ALY A;  3PO4 A;  2F2A B;  4UAT A;  9ICS A;  3TAQ A;  2C22 A;  3H0M B;  4FBU A;  5KFY A;  3H8J A;  3UXO A;  8ICA A;  2KIC A;  5J0T A;  3M6K A;  2IHM A;  1IV8 A;  3MDA A;  2YB1 A;  4DSJ A;  2XY7 A;  2G06 A;  1SXE A;  1D8Y A;  9ICV A;  4P0Q A;  2ZTC A;  4QZI A;  4J9Q A;  3E58 A;  4FS2 A;  5ALW A;  3LVV A;  4B6J A;  3KBB A;  1ZQZ A;  2G5H B;  4Z6D A;  4PGX A;  1WWU A;  5EE1 A;  5JRT A;  3EW9 A;  1CI4 A;  4DEZ A;  4ELU A;  4Y2J A;  1ZQH A;  2J6S A;  3LDA A;  3GIM A;  3HIL A;  5KAI U;  4YXM A;  4C8N A;  1JRP A;  1GO3 F;  1NKC A;  5ALR A;  2C2D A;  2UVV A;  7ICN A;  2PMZ F;  4RQN A;  2BR0 A;  4O3Q A;  2FPK A;  4I27 A;  4KLU A;  3HT3 A;  3Q8L A;  3RH6 A;  2F76 X;  2EZY A;  2VA8 A;  4RQ4 A;  4EYI B;  5D4B A;  4BXO A;  9ICX A;  3WK9 A;  4DL5 A;  1BPX A;  2NRW A;  1U47 A;  2Y1I A;  2KFN A;  4EEK A;  3OGU A;  2WAQ F;  2KD1 A;  2AU0 A;  2KNJ A;  4US9 A;  1XU4 A;  2JEG A;  5KT7 A; 
#chains in the Genus database with same CATH homology
 4XUS A;  1ZQK A;  4KLG A;  1HUO A;  2BCV A;  1ZQC A;  1KEJ A;  7ICI A;  4LVS A;  8ICX A;  4DO9 A;  2I9G A;  8ICL A;  2BPG A;  3UXN A;  3RJH A;  4UB5 A;  2ISO A;  3B0X A;  4I2B A;  1MQ3 A;  1ZQQ A;  4KLF A;  4RT3 A;  3AUO A;  5IIL A;  4M9N A;  5J0X A;  7ICE A;  5J0Q A;  3V7L A;  9ICJ A;  3RJG A;  4IQW A;  3C2L A;  4NY8 A;  1ZQN A;  3JPN A;  4QZD A;  4GXK A;  5J2G A;  5IIO A;  4KLE A;  7ICH A;  4QZG A;  5J2D A;  3JPP A;  5BOM A;  3JPS A;  3JPT A;  4QZH A;  7ICS A;  2PFN A;  1ZQM A;  8ICQ A;  8ICJ A;  5J2J A;  4UAW A;  8ICM A;  4M9H A;  7ICT A;  5J2I A;  4NLK A;  3MDC A;  4I2I A;  4PHE A;  4UAZ A;  4MFC A;  4RQ6 A;  5J0Y A;  3C5F A;  2PXI A;  2GWS A;  8ICT A;  5EOZ A;  4KLM A;  1XSL A;  4TUS A;  1BPZ A;  1ZQS A;  3ISD A;  1BNO A;  9ICM A;  5IIJ A;  4QZ9 A;  3C5G A;  3MGH A;  4Z6E A;  8ICN A;  7ICU A;  4UBB A;  4R65 A;  5DDY A;  3PNC A;  4QZC A;  5HHI A;  5J0S A;  3AU6 A;  2BPF A;  4I29 A;  4YMN A;  4M2Y A;  4RQ5 A;  5J0U A;  4K4G A;  1ZJN A;  4I2D A;  1ZQL A;  5J2H A;  4PHD A;  5J29 A;  5IIN A;  5DBA A;  4IQV A;  4NXZ A;  2KP7 A;  3HW8 A;  3V72 A;  4Z6F A;  4KLJ A;  3JPO A;  4MFA A;  8ICF A;  3MGI A;  5J2B A;  5DBB A;  5IIM A;  4QZB A;  4GXJ A;  9ICK A;  9ICO A;  1BPD A;  9ICN A;  5BOL A;  7ICL A;  4YD2 A;  9ICR A;  1ZQP A;  2ISP A;  5DB6 A;  4I2C A;  4K4I A;  9ICF A;  8ICS A;  4M9G A;  7ICM A;  4M9J A;  4GXI A;  8ICW A;  4TUR A;  5TZV A;  3C2K A;  2PFO A;  4MFF A;  5J2C A;  3UXP A;  1ZQE A;  4IQT A;  8ICG A;  2PFQ A;  8ICZ A;  1JMS A;  3RJJ A;  4RQ7 A;  4I2G A;  4JWN A;  7ICV A;  1HUZ A;  7ICG A;  3RH4 A;  4LZG A;  4NM1 A;  7ICF A;  3RJK A;  2BCS A;  4RQ2 A;  4RQ1 A;  4KLS A;  1DK3 A;  9ICA A;  3MBY A;  4RPZ A;  8ICY A;  4PGY A;  7ICP A;  4YN4 A;  4UBC A;  4YMO A;  4JWM A;  4DOC A;  4NLN A;  4F5O A;  4PGQ A;  5J0R A;  3PML A;  3PMN A;  3UPQ A;  3RH5 A;  4MF8 A;  3UQ2 A;  2BCQ A;  4O5E A;  4RQ0 A;  5J2F A;  3C2M A;  4F5R A;  7ICO A;  4O5K A;  1TVA A;  4PPX A;  5J2K A;  4UB3 A;  3ISB A;  4I2H A;  5J2A A;  3RJF A;  4M0A A;  7ICR A;  4QZE A;  4PH5 A;  2W9M A;  8ICC A;  1RZT A;  8ICB A;  9ICP A;  5HHH A;  4RPY A;  3GDX A;  4DOA A;  8ICV A;  9ICB A;  3JPQ A;  1XSN A;  1BNP A;  4M04 A;  4UAY A;  4R63 A;  1ZQF A;  1ZQJ A;  3AU2 A;  1ZQG A;  5J2E A;  4R66 A;  1NZP A;  4K4H A;  8ICE A;  4O9M A;  4MF2 A;  4KLD A;  4NM2 A;  1ZJM A;  4UB2 A;  8ICK A;  4Z6C A;  8ICH A;  8ICR A;  1BPY A;  2FMS A;  2FMQ A;  7ICK A;  5IIK A;  4RQ3 A;  4F5Q A;  1ZQB A;  4KLO A;  5III A;  3B0Y A;  4F5P A;  4FO6 A;  4I2J A;  4R64 A;  4QZA A;  5J0O A;  2P66 A;  4KLI A;  4M9L A;  3TFS A;  8ICI A;  2PFP A;  5J0P A;  4M47 A;  5DB7 A;  3UQ0 A;  8ICO A;  5BPC A;  9ICC A;  4KLQ A;  4F5N A;  4KLH A;  4QZF A;  8ICP A;  5CWR A;  5DBC A;  9ICH A;  4I2F A;  4XA5 A;  2BCR A;  7ICJ A;  5DB9 A;  4IQU A;  9ICE A;  9ICT A;  3V7K A;  1MQ2 A;  5J0W A;  7ICQ A;  4RPX A;  8ICU A;  4DOB A;  3HX0 A;  4PHP A;  4I28 A;  9ICQ A;  3RJI A;  9ICS A;  4I2A A;  4NLZ A;  1ZQI A;  4RT2 A;  2FMP A;  3UXO A;  4YD1 A;  5CB1 A;  8ICA A;  5J0T A;  4YMM A;  2BCU A;  9ICI A;  2IHM A;  4TUQ A;  1DK2 A;  3MDA A;  3V7J A;  3RJE A;  1ZQA A;  9ICV A;  4QZI A;  4X5V A;  3LK9 A;  9ICU A;  4UB4 A;  4PHA A;  4QZ8 A;  4KLL A;  4Z6D A;  4PGX A;  1ZQH A;  1KDH A;  1XSP A;  3TFR A;  5DB8 A;  1BPE A;  7ICN A;  4P2H A;  3JPR A;  4YCX A;  4UB1 A;  3ISC A;  9ICW A;  4I27 A;  1ZQR A;  4KLU A;  9ICL A;  3HWT A;  1ZQD A;  5D49 A;  3RH6 A;  4I2E A;  4O5C A;  4RQ4 A;  1ZQT A;  5D4B A;  9ICX A;  4LZD A;  1TV9 A;  9ICG A;  1BPX A;  4KLT A;  5DKW A;  4TUP A;  5D46 A;  3OGU A;  1ZQO A;  4RQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...