1DK3A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA POLYMERASE BETA
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 18
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk3A00
4QZAA 4JWNA 8ICOA 4F5OA 5DB6A 7ICOA 8ICHA 4UB1A 3GDXA 4M9HA 1XSLA 4NM2A 4UAYA 4TURA 3TFSA 4I29A 4LVSA 3UXPA 4RQ6A 1ZQMA 4KLIA 5D49A 4PHAA 3HW8A 3JPNA 5IIIA 5DDYA 2FMQA 4RQ4A 3MGIA 4I2FA 4QZDA 9ICGA 5J0YA 4QZFA 7ICMA 4NM1A 3PNCA 3TFRA 3C2MA 3C2LA 5J0TA 3ISCA 4DOAA 7ICFA 2P66A 4IQVA 9ICWA 4KLFA 3RJFA 4QZIA 2BCQA 4TUSA 4Z6DA 9ICFA 1ZQGA 1HUZA 2W9MA 4QZ8A 8ICFA 4UAZA 8ICGA 5J2BA 3UQ0A 7ICVA 3UXOA 1BNOA 8ICVA 8ICBA 4RPYA 4K4IA 4I2IA 4NXZA 4MFAA 2PFOA 4KLUA 8ICZA 1ZQLA 2BCSA 4KLJA 5D46A 4K4GA 8ICYA 8ICXA 5BPCA 2ISOA 3ISDA 4I2AA 8ICUA 2ISPA 9ICPA 5J2CA 9ICNA 8ICSA 5J2AA 5BOLA 4QZ9A 4O9MA 3OGUA 3AUOA 7ICNA 3JPPA 7ICHA 4GXKA 5J2DA 3RH6A 9ICKA 3PMNA 3RJHA 4KLOA 3MDAA 1HUOA 2BCRA 4YD2A 4M0AA 5BOMA 4XA5A 1BPZA 1NZPA 7ICTA 5J0XA 4XUSA 4RQ0A 9ICQA 5HHIA 4F5NA 1ZQQA 7ICSA 4PGXA 4X5VA 4KLHA 5J2EA 4F5QA 3C5GA 4TUPA 5DBCA 4RQ8A 5DBBA 3JPRA 2KP7A 8ICEA 4YN4A 1KDHA 8ICJA 4KLSA 4M47A 5J2KA 3AU6A 4UB4A 4YMNA 7ICUA 1ZQNA 4PPXA 8ICCA 4DO9A 4JWMA 4I2JA 4KLTA 7ICJA 3RH4A 4R66A 3UXNA 4UB2A 4Z6EA 4QZEA 3V7JA 4NLNA 4KLEA 3UPQA 1ZJNA 4QZGA 4I27A 4R65A 3RH5A 9ICOA 1ZQSA 3JPSA 8ICPA 4YMMA 2BPGA 4MF8A 1ZQCA 3RJJA 9ICSA 1ZQPA 4LZGA 3UQ2A 9ICAA 4P2HA 5CB1A 7ICQA 4RQ1A 5J0RA 1ZQFA 4I2BA 5J0UA 1MQ3A 4GXJA 4UBBA 4I2GA 4PHDA 3JPOA 8ICKA 1ZQJA 1BPEA 4KLLA 9ICMA 3B0YA 8ICNA 8ICLA 4M9JA 9ICCA 8ICMA 1TV9A 4KLQA 3HX0A 9ICVA 4PHPA 4I2DA 8ICQA 5IIMA 4QZHA 5J2JA 4M04A 4RQ3A 4M9NA 4FO6A 1DK3A 5DB9A 4UB3A 2GWSA 1RZTA 4NY8A 5J2GA 1ZQRA 2PFNA 7ICRA 1KEJA 4RPZA 4M2YA 9ICUA 5IIJA 4QZCA 5IIOA 4GXIA 4K4HA 5TZVA 3HWTA 4QZBA 5DKWA 4F5PA 3MBYA 2PFPA 1BNPA 2BPFA 3PMLA 1JMSA 4Z6FA 3RJEA 4YD1A 3RJKA 9ICTA 4DOCA 4Z6CA 3RJGA 3V7KA 4M9GA 4IQTA 1ZQEA 4PH5A 2I9GA 4I2HA 1ZQAA 9ICLA 9ICIA 9ICHA 4MF2A 4TUQA 7ICEA 5IINA 4O5KA 1XSPA 5J2HA 5IILA 4IQWA 4PGYA 7ICKA 3JPTA 8ICRA 1ZJMA 4RQ5A 9ICRA 5J2IA 4PGQA 4LZDA 4I2EA 4DOBA 1DK2A 9ICJA 7ICIA 5J0SA 4R64A 4M9LA 4MFCA 3LK9A 1BPXA 2IHMA 4RQ7A 2PFQA 1MQ2A 5J0PA 3V72A 5HHHA 3C2KA 5IIKA 1BPDA 4F5RA 9ICBA 4IQUA 9ICEA 2FMPA 5EOZA 1ZQBA 2FMSA 4KLMA 5DBAA 9ICXA 1ZQTA 4YCXA 4O5EA 1TVAA 5J0WA 4UAWA 3JPQA 4MFFA 3B0XA 8ICWA 4UBCA 7ICGA 4KLGA 3AU2A 4YMOA 5DB7A 5J2FA 1ZQHA 1ZQKA 4PHEA 4UB5A 3RJIA 3V7LA 4RQ2A 5J29A 8ICIA 2BCVA 5J0QA 3ISBA 4R63A 8ICAA 1BPYA 2BCUA 4I28A 5DB8A 5J0OA 5CWRA 1ZQIA 8ICTA 4RPXA 4NLZA 1ZQDA 4KLDA 5D4BA 4O5CA 1ZQOA 3MGHA 3C5FA 2PXIA 7ICPA 4RT3A 7ICLA 4I2CA 4NLKA 3MDCA 4RT2A 1XSNA
chains in the Genus database with same CATH superfamily
1S0MA 3LVVA 3PO5A 1YZ6A 4OCZA 5ALNA 4B9TA 4OJ5A 8ICOA 4F5OA 5DB6A 5G5HA 5DGAA 7ICOA 2DL0A 4DFJA 1XSLA 1WUDA 3ZDAA 3TFSA 2LYHA 4IRKA 3GIJA 1LVHA 4EZ6A 4KLIA 2HHXA 3T79A 4Y2QA 3HW8A 1LB2B 2BGWA 4DQQA 2FMQA 4RQ4A 1LV5A 4I2FA 9ICGA 3IG8A 3QNMA 2C2DA 1OUQA 1WCLA 3KTQA 2JZBB 2ZTDA 4DOAA 2ZIUB 5KL1B 4DSLA 4ED3A 4YXJA 1RQLA 4Z6DA 3AL0B 3D6JA 8ICFA 1ZQ1C 4PJ0U 3PY8A 3UQ0A 3FAHA 3Q8PB 1L7MA 2XGQA 3AMZA 2F1HA 4R8UB 3M8RA 3G6VA 4RNMA 2BR0A 3EPIA 1KLNA 4KMOB 4ECWA 1RYUA 3QX7A 2K4IA 2R8JA 4A8EA 5JU5A 1ZRNA 2ZIXB 2F44A 2KFNA 2C22A 8ICYA 4DS5A 2MUTA 1CEZA 2D8CA 2ISOA 4I2AA 3ZD9A 2HVIA 3H7IA 2ISPA 5J2CA 1T8EA 2K89A 2KICA 3SAFA 5J2AA 2HBLA 5KFYA 4F50A 4EBDA 3AUOA 7ICNA 1WYGA 2NRVA 3RH6A 9ICKA 2F8KA 2Z7JA 3RJHA 4M0AA 2ZXIA 3TARA 5AM1A 7ICTA 1RG6A 3MR2A 5ALJA 1KFSA 4Y2JA 3OSNA 1QTMA 4PGXA 5AKLA 2JRZA 5J2EA 2AJQA 2H5XA 4TUPA 4RQ8A 1ECWA 2W3SA 3JPRA 1FFUA 8ICEA 2I6XA 1KDHA 3NTUA 2XY5A 4KLSA 4ECVA 3AU6A 4UB4A 5CR0A 3IN5A 5HR7A 4BGDA 2ESEA 1O08A 2R18A 3QU9A 1JROA 5C0YA 3I28A 1X9SA 1KBUA 3QYPA 1N5XA 2V4RA 3G6XA 4QZEA 3V7JA 1TAQA 4ED7A 2BKEA 1JXLA 4QZGA 2HVHA 4UATA 1IM4A 2FPKA 1S9FA 2LI6A 4YXMA 3C28A 2XO7A 4EYHB 4MF8A 3C21A 2JGAA 4LZGA 1U49A 5B66U 4O3PA 1S10A 4P2HA 2XICA 1ZQFA 5J0RA 1MN8A 1SL0A 4JMUA 1X2IA 4DSFA 2K8CB 2W3RA 5KFHA 4CNQA 2KD1A 1IV8A 4PHDA 4B9LA 1SWWA 2W9CA 2DKZA 2LPEA 5EE3A 3JPOA 2HHVA 4C7YA 4HAIA 1S0NA 2BHNA 4KLLA 1JUDA 4CGZA 2HBMA 1K5OA 5CHGA 2K60A 1SKSA 1JXEA 2KJ9A 2VIXA 1TV9A 1QQ7A 1LKYA 3MFHA 2JH1A 2RDJA 1EXNA 1HEKA 3WK4A 2HMXA 2P35A 1D9FA 4QZHA 4M04A 3WKBA 2OYYA 3PX0A 1D8YA 2ZUBA 1RDFA 4DLEA 1DK3A 2J6SA 4O3NA 3E58A 2A1AA 2KIVA 1T3NA 2RP5A 2XGPA 7ICRA 4YR0A 4NLBA 2MSNA 2AXTU 5AKJA 5KFSA 5IIOA 2IOHA 4K4HA 3F2DA 3MFIA 5KFMA 2FPLA 1VDVA 2ZIWA 5CA7A 1DGJA 2LBOA 2I1QA 3PMLA 3DV9A 4Z6FA 1NK4A 2G06A 5AKEA 9ICTA 1N5WA 3PX6A 3RJGA 1FFVA 4QW9A 4M9GA 4J9MA 4BX9C 1J2MA 4EEYA 5KFPA 2AH5A 1V38A 2FLPA 2I9GA 3AM9A 4QNLA 1J97A 4Y2UA 3N7RC 2G07A 2RQ5A 3KD3A 1TE2A 9ICIA 4TUQA 1NK7A 4O5KA 3J81j 2UVVA 5ALTA 4MHVA 2MAXA 2K8BB 3JPTA 2EAPA 2E1EA 2YTUA 3SV4A 9ICRA 1VLBA 5AICA 1Z4NA 3AQFA 5KFZA 1ZQWA 2YB4A 1QLNA 2BDPA 4R64A 4M9LA 3CP8A 5ALRA 4AYBF 3GQCA 1L3VA 4DF8A 3ORYA 4DSEA 2ZTCA 2EH9A 2W11A 4ED6A 9ICBA 1T4GA 1U47A 4U6PA 5ALQA 2R8IA 5EOZA 2FDRA 2FMPA 2FMSA 3WK9A 3ZDBA 1ZQTA 3UM9A 2PKEA 5C5JA 2WHEA 2KNJA 1K1SA 4C8KA 5L9XA 4MFFA 1SV0C 1PK3A 7ICGA 4NJ8A 4NL9A 1KFTA 1ZQHA 4DSKA 1XO0A 4PHEA 3RJIA 4Y2PA 4FE3A 4RQ2A 2LMRA 1SXEA 8ICIA 2H3IA 4EEKA 1L8OA 4QJFB 3ISBA 8ICAA 1SGGA 2BCUA 1KW4A 5AI9A 1ZD2P 5J0OA 2V9WA 2KZMA 5CJ7A 1RYRA 4B9SA 2W04A 1D8LA 5KG0A 3UMGA 3PSPA 4KLDA 3KBBA 4EX7A 2DBYA 4BXOA 5ALVA 3QUBA 3MGHA 3UMCA 1S5LU 1L7PA 5KFWA 4F2RA 1P7DA 2O6KA 2A1JA 4RT2A 4TQRA 4JWNA 4ECYA 2M0NA 4UB1A 1C20A 3NASA 2ZIVA 4UAYA 1J2NA 4TURA 3SMVA 2JHDA 3T5KA 4LVSA 2F8LA 4RQ6A 2OH2A 2NV3A 1N63A 2QARB 3NRZA 4ECSA 5D49A 5KFLA 2ZUDA 2V4QA 5KG5A 5DDYA 4OJ6A 2HDOA 4QWEA 1X40A 2XIDA 3MGIA 2W7OA 1B0XA 4ECQA 4QZDA 4NL9C 5J0YA 4QZFA 7ICMA 1V85A 2HSZA 1UQVA 1QQ5A 2DGZA 2XCAA 2P66A 1TAUA 2HI0A 2C2EA 2KKVA 3E2EA 1U9LA 5EE9A 1OXJA 4QZIA 1SIJA 3H8SA 1ZXIA 4ED2A 4QWDA 5KT5A 1ZQGA 1HUZA 2W9MA 1TAMA 5KAIU 2AQ4A 1Z19A 5J2BA 7ICVA 5KT3A 2K8AA 3N4MB 2H3QA 3QEAZ 4DL4A 2BQRA 3CW2C 2PI4A 1DXSA 8ICVA 3BQ1A 3SENA 1ZQXA 2PMZC 2GLEA 5F9LA 4JV0A 1NK6A 4MFAA 5DLFA 2NRWA 2RDIA 4Q44A 4YG2A 8ICZA 2HOIA 3PW5A 4NLGA 3T3FA 3RB6A 1L6NA 4K4GA 4RQMA 3H0LB 3QUQA 2JEIA 4UW9A 5AKGA 5ALOA 2VJ5A 3ISDA 5ALLA 8ICUA 5EE1A 9ICPA 2JXJA 2HBJA 2KJ5A 2WB1F 5KG3A 4J9SA 3T5HA 2H3FA 4QZ9A 5BOLA 1K1QA 1SL1A 3OGUA 2QKQA 1B4FA 5AKXA 3SI8A 2VA2A 2LYAA 4GXKA 4LJXA 1XS9D 2GH1A 4YD2A 1X6JA 2H3VA 1BPZA 2DF4B 4XUSA 3LDAA 3T5LA 2P6UA 4F5NA 1ZQQA 4KLHA 4C0ZA 2HOQA 5DBBA 3PW4A 4YN4A 4UQGA 8ICJA 1NKCA 4F4KA 1IXRA 2Q0ZX 1N62A 3GIKA 2QB0B 2A3VA 4UB6U 3SAGA 4AYBC 3UXNA 4DSIA 1SXDA 4Z6EA 2E8MA 3IDWA 5DG9A 1DGSA 4P4PA 4ECZA 1ZJNA 4UASA 2XY7A 4I27A 3BS5A 4O3OA 3RH5A 2J6TA 1UA1A 4P0QA 4EENA 4Y2YA 2ASLA 5KFBA 2JH7A 3ZD8A 2BPGA 1ZQPA 4DLGA 5DQGA 2AGOA 3S6JA 3E0FA 3PSFA 3D2QA 5J0UA 4KX3A 1ZQUA 3PX4A 2NRXA 2PI5A 3GIMA 3HRDD 3BQTA 3WKDA 3QZ7A 2F1IA 3HKZF 3G6YA 4J9QA 3RRHA 2E8OA 4DFPA 9ICMA 1X9MA 2G5IB 2KK0A 5ALEA 4E0DA 2R8HA 1ZYQA 8ICLA 3OHBA 4M9JA 9ICCA 2OEHA 4KLQA 4J9RA 2K4EA 4EELA 5GTHU 3C29A 3HX0A 4IL6U 3IHQB 2YX8A 1XU4A 1S76D 1Z00B 1PVRA 1QQ6A 5HR6A 4EBEA 4PHPA 5T14A 1PK1B 1F5SA 1TK0A 2WF9A 3OPXA 2IMWP 4M9NA 5AK6A 4F4ZA 1TK8A 3GILA 5J8YA 2KZZA 2BDUA 2FJ6A 2BQUA 2GWSA 4KN7A 1JRPA 2NYVA 2AGQA 2NRZA 2KSOB 5J2GA 3EZ5A 4M2YA 9ICUA 1MSWD 5KG4A 3SZ2A 5KT6A 3B9JA 2EZXA 1PVQA 3A0HU 1QSSA 4YR2A 3TI0A 3K75D 3WK7A 1NK8A 1UT8A 1IG6A 1CI4A 2QB1A 4QWBA 3Q8QB 3KOOA 4DL7A 2VJ4A 3M9OB 3RJKA 4IR1A 3M6KA 2RLTA 2DFLA 2EDUA 3V7KA 1S77D 4GC7A 4J9PA 5CP2A 1U4BA 3MGVA 5ALWA 5AM3A 4DQRA 4I2HA 4C80A 1ZQAA 2W43A 1JI7A 1Z4OA 3I1YA 5AI8A 4J9OA 1C7YA 5AM4A 3V6JA 2HHTA 4PGYA 5ALGA 1QSLA 3H4BA 1NK5A 1ZJMA 3IG5A 5KNIA 5KFKA 3L3FX 1WG8A 3QXGA 4PGQA 2C2RA 4I2EA 3IV6A 3NGDA 2OM6A 3IM1A 4C8MA 1S0OA 5J8YC 2VANA 1DK2A 2Q4TA 3KZXA 1KKXA 9ICJA 4F4YA 2CXYA 4JV1A 2XVTA 2WB1C 4ECRA 3VC8A 4Q43A 3BQ0A 5L1JA 3LK9A 1BPXA 1KL9A 2JEGA 4P0PA 2KV2A 3SAHA 1MQ2A 3V72A 5HHHA 1PUZA 3C2KA 1FO4A 1V9PA 4CF5A 4BWJA 4G3IA 1BPDA 5KFIA 2K4PA 2MUTB 5KT4A 1KN5A 1U48A 4FZNA 9ICEA 2DWQA 4ELVA 1VJ5A 3H0RB 3THVA 4IRDA 1SZPA 5DBAA 3BQ2A 3TAQA 4KMUA 4NV0A 4YCXA 1D8BA 4UAWA 3JPQA 4YR3A 2G09A 3ETRA 4OJLA 4QWCA 4YMOA 4ICAA 2FE9A 3KFUF 2NO4A 1XO1A 4UB5A 5AI0A 2PMZF 4P4MA 4F4WA 3EW9A 3GV5B 2KG5A 3V6HA 1IIPA 2F3NA 1BPYA 3HILA 4Y2TA 1NK0A 4OJPA 3H8MA 1NNLA 5DB8A 4I28A 3NRWA 2ATLA 4RPXA 3TAPA 5D4BA 2EAOA 1RM6C 4CE6A 1X66A 4NLKA 4RUCA 3MDCA 1XSNA 2KE7A 2BPCA 4QZAA 2Y1IA 2OCEA 3SQIA 2G08A 8ICHA 3GV8B 3GDXA 4M9HA 5GTIU 3N28A 5KT7A 4P4OA 3CRXA 2EZYA 4CDGA 2WTFA 4ELTA 2ZUCA 5AI4A 3JPNA 3HKZC 3M1YA 4GC6A 5JTIA 1YT3A 4ED8A 2CN1A 4FFDA 1L3SA 4NM1A 3SV3A 3PNCA 1WCNA 3C2MA 4M6WA 5J0TA 2QLTA 3ISCA 7ICFA 2W9CB 5AKKA 5ALHA 3EYZA 2CPRA 4KLFA 5KFXA 4TUSA 9ICFA 4JK1A 2AGPA 4ACOA 3IP4B 4RUAA 2K4HA 8ICGA 2IA6A 3RAXA 1XC9A 1AROP 2FLNA 3BZCA 1U45A 3QU2A 4PZNA 4RU9A 3GZFA 8ICBA 3QZ8A 3DEEA 2LYBA 1F0MA 4RPYA 2EQYA 4K4IA 4I2IA 3RR8A 4UAVA 2PFOA 4C8OA 2YMLA 4KLUA 5AK3A 2E3TA 5H2FU 4ED0A 5KFUA 4OO1J 1ZQLA 2F2AB 2BCSA 1SV4A 4XQ8A 4EZ9A 2KN7A 3H8WA 1NK9A 5BPCA 5AIBA 3TQ1A 4C8LA 1HJPA 2HHSA 2W9BB 3DDHA 4J9LA 4J03A 3PO4A 9ICNA 8ICSA 5EWEA 1B22A 5ALZA 1ZOLA 1B43A 1MC8A 4O9MA 2OXOA 3JPPA 4Y2RA 4C4TA 2E8PA 2F76X 4C8NA 1H38A 5AM0A 3PMNA 4KLOA 3UMBA 1HUOA 3TKAA 4IC9A 5BOMA 1NZPA 3ICXA 5J0XA 2ZIWB 5TISU 3R9KA 4RQ0A 5HHIA 2YQEA 4PZOA 2CRXA 1AQ6A 3RB3A 2KVSA 4F5QA 5DBCA 3NVVA 1M6YA 2KP7A 3SR6A 4F91B 5HP4A 5E79U 2ASJA 2Y0SF 5FP0A 4M47A 3GV7B 1X9WA 5EE0A 3SD7A 2E1FA 5AIAA 3F2BA 4JWMA 2JEFA 4Y2VA 7ICJA 4WJ3B 2G0AA 5CEHA 4F93B 4NLNA 2WF8A 2IOFA 1SKRA 4DWIA 1RQNA 4XRHA 1S8OA 5ALYA 4UAUA 2NRTA 5AKYA 9ICOA 1ZQSA 3LVWA 3KHRA 4AP9A 3GU3A 4DQSA 3Q8LA 3RJJA 3MR3A 5CRXA 3NVYA 5F3XB 2UVWA 5CB1A 4B6JA 4RNOA 4US8A 1ZQZA 1X42A 4I2BA 4FS1A 3QUTA 1MQ3A 3PW0A 2LHTA 3SYZA 5A0LA 1S0VA 4I2GA 2JZBA 4B9MA 5KTQA 3C23A 4OD0A 5ALSA 2ZIUA 5DG8A 2DUYA 4FZLA 1DRGA 4DFMA 1BPEA 1SKWA 4RNNA 4C4SA 1X6IA 5KFQA 5G5GA 2W03A 8ICNA 5ALFA 4R8UA 2LKYA 1BGXT 1L8LA 2B21A 1Q8KA 1NZBA 2JEJA 1UT5A 1ZQVA 4GIBA 2N1RA 3M8SA 2HOFA 5AKZA 2HHWA 4I2DA 5KFJA 1JALA 1N48A 2ZIXA 4UARA 5IIMA 5J2JA 2B6GA 4F2SA 4BXOB 3OJUA 2FI1A 3IRUA 3OHAA 1JX4A 5DB9A 2W9AA 3NVZA 2AHOB 2ES6A 2WF6A 2ZXHA 5KFTA 3KKAA 3RB0A 4NY8A 1ZQRA 2XI9A 2FLLA 5IIJA 4QZCA 1T3QA 3Q8SB 5AM5A 4GXIA 2D6FC 2NO5A 4F72A 5TZVA 3HWTA 4CF3A 3HPOA 3KHGA 5AK5A 3BZKA 2BZFA 1UHUA 3HJEA 1RXWA 2HBKA 1NJXA 2BPFA 1JMSA 3RFAA 3MABA 5KFVA 3BJYA 2MA1A 1ZRMA 2KOBA 3WKCA 2KSOA 3TANA 4O0IA 5KFNA 4BDPA 4B9VA 4IQTA 3GFKB 1ZQEA 1NJYA 5KFFA 4GFJA 2WF7A 2DKXA 5DG7A 1ZETA 4DF4A 4DSJA 4MF2A 3OTQA 7ICEA 4DL6A 1XSPA 5J2HA 5IILA 4IQWA 1UA0A 3EPGA 2L5YA 8ICRA 5DDMA 2W54A 2WFAA 5J2IA 5ALMA 2P6RA 5KG2A 1O03A 5KT2A 2AQ0A 4BJQA 2XCPA 1RXVA 3MC1A 7ICIA 2VA8A 3KKAC 4MEXA 5HMLA 3T5JA 4MFCA 4U7CA 2W55A 5J0PA 1L5UA 2LM1A 4O3MA 3SEIA 5IIKA 2WAQC 4F5RA 3CYMA 3L5KA 1L3TA 4IQUA 1JN3A 4KLMA 2KFZA 2W8KA 1QH9A 2ALZA 2ZJAA 3CNHA 3WU2U 3BDPA 3RBEA 2YMPA 4DL5A 5J0WA 2D3DA 1V97A 5AKHA 4EYIB 3FDSA 8ICWA 1SL2A 1Y88A 5DB7A 4DQIA 3F53A 2KVCA 5J2FA 2Y0SC 2GO7A 5ALKA 4RQNA 3V7LA 4QIWF 4DS4A 1CRXA 4Y2XA 4USAA 5J29A 2BCVA 1F44A 2YY6A 5KFAA 5J0QA 1NKBA 4R63A 2W7PA 2HHQA 1DOQA 1PZNA 3K1ZA 5CWRA 1ZQIA 3QEBZ 4CCHA 8ICTA 1N56A 1ZD5A 4QW8A 3PSIA 5KG1A 4NLZA 1L7NA 3O0FA 4O5CA 3ALRA 1UCVA 1A77A 1MA7A 4GLXA 1ZQOA 3C5FA 2PXIA 4RT3A 7ICLA 2YMMA 4KITB 1SZHA 2VA3A 2EAMA 4F4XA 3H4DA 4US9A 3RTVA 5KL8B 1Z1VA 4DFKA 4F92B 3BS5B 4NM2A 4ECXA 4C7ZA 2KTQA 4RZRA 5L1LA 2W8LA 4I29A 4EBCA 4YFKA 3UXPA 1A0PA 1XWLA 1NOMA 4TQSA 4P0QB 1ZQMA 4PHAA 2ZG6A 1XNSA 1CUKA 5DQIA 5IIIA 3PW7A 4F3OA 2IHNA 3QE9Y 1Z1BA 4BWMA 4KX5A 5KFRA 2RRDA 3AEVA 3TFRA 3C2LA 4ZH4A 5DGBA 3RR7A 1KQQA 4IQVA 9ICWA 1L3UA 4G9BA 1KSPA 1FEZA 5JRTA 3RJFA 2BCQA 3EWAA 2VKQA 5AK4A 4F8RA 1UPHA 1COKA 4NWIA 3NVWA 4QZ8A 3ONNA 4UAZA 2WF5A 3Q8KA 3EUB2 3UXOA 4FBUA 1N60A 5AKIA 5AI5A 1BNOA 5L1IA 4F71A 3ED5A 4FS2A 4NXZA 1ZQYA 4DL2A 1WWUA 4PL2A 3PR4A 3C1ZA 3LWLA 2IOFK 4KLJA 1Z3EB 5D46A 3MR6A 5AHXA 1PVPA 2HW3A 3WKAA 2E8NA 8ICXA 1D9DA 5DQHA 3QU7A 3RF9A 4QWAA 4HYKA 2I5HA 3FM9A 4O3QA 3D2SA 2DQNB 3KHLA 5B5EU 4DFDA 7ICHA 4BUGA 1BPBA 3VCBA 5L1MA 1A6SA 5J2DA 4DCCA 4DEZA 2EANA 3MDAA 3BQ7A 2BCRA 2C28A 3HT3A 4DQPA 4ELUA 5HNKA 4XA5A 2KIWA 2W9BA 5KG7A 3FYHA 9ICQA 1SWVA 4Q8FA 5ALDA 2YN4A 1GO3F 7ICSA 3TADA 4X5VA 2ZTEA 3I76A 5KFGA 4ECTA 1Q46A 3C5GA 3LYSA 3NS1A 3ZDDA 5ALUA 5L1KA 2LM4A 5J2KA 3NUQA 4KN4A 1NKEA 3AQEA 1NI3A 4YMNA 7ICUA 1ZQNA 4PPXA 8ICCA 5F9NA 3F2CA 4DO9A 4I2JA 4KLTA 4O3SA 1KFDA 3GIIA 3RH4A 1KRPA 4R66A 4UB2A 4ECUA 4KLEA 1SV0A 2BQ3A 1NJZA 3UPQA 3N7SC 2XY6A 4R65A 2EZZA 3PR5B 1N2XA 2M9NA 1Q3VA 3JPSA 4FZMA 8ICPA 4FBTA 4YMMA 2QARA 2XC9A 3MR5A 1ZQCA 9ICSA 3H0MB 3UQ2A 2MU2A 9ICAA 4P0PB 7ICQA 3K4GA 1S97A 3PV8A 4RQ1A 4GXJA 2YMQA 4UBBA 5KG6A 3M7DA 3ZDEA 3FC4A 4IS7A 2JR5A 3WK6A 4QIWC 1N61A 3TADC 2KKPA 2KEYA 3Q8MA 1X9XA 8ICKA 1ZQJA 1LKYB 2FPMA 2KMDA 4ED1A 3LWMA 5JUMA 1T94A 2KHVA 3K1RB 3B0YA 2KZ3A 4O3RA 1NJWA 8ICMA 4IRCA 3QU5A 2F1JA 5KFCA 2IBKA 1ZD4A 3RRGA 3WK5A 2JV3A 4YQWA 9ICVA 2KJ8A 3QU4A 5K4LA 3OSPA 1BVSA 8ICQA 3RBDA 5KFOA 2WAQF 2ASDA 3H8JA 3N7PD 3V6KA 2UVUA 4RQ3A 2GOLA 3RAQA 4FO6A 2A19A 4B9NA 5DLGA 4UB3A 1URJA 2G5HB 1TFRA 4Y2SA 1RZTA 2R8KA 2PFNA 1KEJA 1RPLA 4RPZA 2ODGA 3HP6A 5KAFU 2Y9TA 3BS7A 2OHFA 3AN1A 4QZBA 2ZJ8A 5DKWA 2B0CA 4F5PA 4B9UA 4JUZA 3MBYA 2PFPA 1BNPA 2F77X 2E5SA 4YP3A 1ED1A 3RJEA 3ZDCA 4YD1A 4DOCA 4Z6CA 4C4RA 3KHHA 5ALIA 3PSTA 2AU0A 5KFDA 3TACB 3PZPA 4J9KA 4ZOHC 4PH5A 4M6WB 9ICLA 3OJSA 1JIHA 2QB0A 4IR9A 4JV2A 2JMGA 9ICHA 1FIQA 4YVZA 4CF4A 2HHUA 1WWVA 5IINA 4MEYA 1COOA 7ICKA 3H40A 3ETLA 3D2NA 3QUCA 3A0BU 4RQ5A 3RB4A 4LZDA 1SB3C 2DPIA 4DOBA 1QCKA 2RHFA 4PL1A 3WK8A 3M9MB 2HCFA 5J0SA 5ALPA 5HMMA 3N97B 2IHMA 5EWFA 4RQ7A 2PFQA 1HIWA 3PW2A 5AM2A 2YB1A 2Y9UA 3C1YA 2UVRA 2R8GA 1ZQBA 3M9NB 9ICXA 5ALXA 3F5AA 4O5EA 5AI6A 1TVAA 2H3ZA 2OWOA 3B0XA 4UBCA 3KZIU 4KLGA 3AU2A 1ZD3A 1T7PA 1ZQKA 4UB8U 1QSYA 2DPJA 3U26A 3M6ZA 4DL3A 1RYSA 1Q3UA 3PVXA 3WKEA 2J6UA 2A1JB 4JB3A 4Q45A 4J9NA 2Y1JA 5EWGA 3F5EA 1Z00A 1YZ7A 3L4PA 2KHQA 1TKDA 4Q8EA 1PK1A 4KTQA 2ZIVB 1ZQDA 1L7OA 4NLCA 1OW5A 5KFEA 2MRLA 1A76A 4CRXA 3ZI4A 7ICPA 1TK5A 4OJOA 4I2CA 2ZJ5A 4EX6A 1KTQA 3Q8RB
chains in the Genus database with same CATH topology
4QZAA 4JWNA 8ICOA 4F5OA 5DB6A 7ICOA 8ICHA 4UB1A 3GDXA 4M9HA 1XSLA 4NM2A 4UAYA 4TURA 3TFSA 4I29A 4LVSA 3UXPA 4RQ6A 1ZQMA 4KLIA 5D49A 4PHAA 3HW8A 3JPNA 5IIIA 5DDYA 2FMQA 4RQ4A 3MGIA 4I2FA 4QZDA 9ICGA 5J0YA 4QZFA 7ICMA 4NM1A 3PNCA 3TFRA 3C2MA 3C2LA 5J0TA 3ISCA 4DOAA 7ICFA 2P66A 4IQVA 9ICWA 4KLFA 3RJFA 4QZIA 2BCQA 4TUSA 4Z6DA 9ICFA 1ZQGA 1HUZA 2W9MA 4QZ8A 8ICFA 4UAZA 8ICGA 5J2BA 3UQ0A 7ICVA 3UXOA 1BNOA 8ICVA 8ICBA 4RPYA 4K4IA 4I2IA 4NXZA 4MFAA 2PFOA 4KLUA 8ICZA 1ZQLA 2BCSA 4KLJA 5D46A 4K4GA 8ICYA 8ICXA 5BPCA 2ISOA 3ISDA 4I2AA 8ICUA 2ISPA 9ICPA 5J2CA 9ICNA 8ICSA 5J2AA 5BOLA 4QZ9A 4O9MA 3OGUA 3AUOA 7ICNA 3JPPA 7ICHA 4GXKA 5J2DA 3RH6A 9ICKA 3PMNA 3RJHA 4KLOA 3MDAA 1HUOA 2BCRA 4YD2A 4M0AA 5BOMA 4XA5A 1BPZA 1NZPA 7ICTA 5J0XA 4XUSA 4RQ0A 9ICQA 5HHIA 4F5NA 1ZQQA 7ICSA 4PGXA 4X5VA 4KLHA 5J2EA 4F5QA 3C5GA 4TUPA 5DBCA 4RQ8A 5DBBA 3JPRA 2KP7A 8ICEA 4YN4A 1KDHA 8ICJA 4KLSA 4M47A 5J2KA 3AU6A 4UB4A 4YMNA 7ICUA 1ZQNA 4PPXA 8ICCA 4DO9A 4JWMA 4I2JA 4KLTA 7ICJA 3RH4A 4R66A 3UXNA 4UB2A 4Z6EA 4QZEA 3V7JA 4NLNA 4KLEA 3UPQA 1ZJNA 4QZGA 4I27A 4R65A 3RH5A 9ICOA 1ZQSA 3JPSA 8ICPA 4YMMA 2BPGA 4MF8A 1ZQCA 3RJJA 9ICSA 1ZQPA 4LZGA 3UQ2A 9ICAA 4P2HA 5CB1A 7ICQA 4RQ1A 5J0RA 1ZQFA 4I2BA 5J0UA 1MQ3A 4GXJA 4UBBA 4I2GA 4PHDA 3JPOA 8ICKA 1ZQJA 1BPEA 4KLLA 9ICMA 3B0YA 8ICNA 8ICLA 4M9JA 9ICCA 8ICMA 1TV9A 4KLQA 3HX0A 9ICVA 4PHPA 4I2DA 8ICQA 5IIMA 4QZHA 5J2JA 4M04A 4RQ3A 4M9NA 4FO6A 1DK3A 5DB9A 4UB3A 2GWSA 1RZTA 4NY8A 5J2GA 1ZQRA 2PFNA 7ICRA 1KEJA 4RPZA 4M2YA 9ICUA 5IIJA 4QZCA 5IIOA 4GXIA 4K4HA 5TZVA 3HWTA 4QZBA 5DKWA 4F5PA 3MBYA 2PFPA 1BNPA 2BPFA 3PMLA 1JMSA 4Z6FA 3RJEA 4YD1A 3RJKA 9ICTA 4DOCA 4Z6CA 3RJGA 3V7KA 4M9GA 4IQTA 1ZQEA 4PH5A 2I9GA 4I2HA 1ZQAA 9ICLA 9ICIA 9ICHA 4MF2A 4TUQA 7ICEA 5IINA 4O5KA 1XSPA 5J2HA 5IILA 4IQWA 4PGYA 7ICKA 3JPTA 8ICRA 1ZJMA 4RQ5A 9ICRA 5J2IA 4PGQA 4LZDA 4I2EA 4DOBA 1DK2A 9ICJA 7ICIA 5J0SA 4R64A 4M9LA 4MFCA 3LK9A 1BPXA 2IHMA 4RQ7A 2PFQA 1MQ2A 5J0PA 3V72A 5HHHA 3C2KA 5IIKA 1BPDA 4F5RA 9ICBA 4IQUA 9ICEA 2FMPA 5EOZA 1ZQBA 2FMSA 4KLMA 5DBAA 9ICXA 1ZQTA 4YCXA 4O5EA 1TVAA 5J0WA 4UAWA 3JPQA 4MFFA 3B0XA 8ICWA 4UBCA 7ICGA 4KLGA 3AU2A 4YMOA 5DB7A 5J2FA 1ZQHA 1ZQKA 4PHEA 4UB5A 3RJIA 3V7LA 4RQ2A 5J29A 8ICIA 2BCVA 5J0QA 3ISBA 4R63A 8ICAA 1BPYA 2BCUA 4I28A 5DB8A 5J0OA 5CWRA 1ZQIA 8ICTA 4RPXA 4NLZA 1ZQDA 4KLDA 5D4BA 4O5CA 1ZQOA 3MGHA 3C5FA 2PXIA 7ICPA 4RT3A 7ICLA 4I2CA 4NLKA 3MDCA 4RT2A 1XSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZA A;  4JWN A;  8ICO A;  4F5O A;  5DB6 A;  7ICO A;  8ICH A;  4UB1 A;  3GDX A;  4M9H A;  1XSL A;  4NM2 A;  4UAY A;  4TUR A;  3TFS A;  4I29 A;  4LVS A;  3UXP A;  4RQ6 A;  1ZQM A;  4KLI A;  5D49 A;  4PHA A;  3HW8 A;  3JPN A;  5III A;  5DDY A;  2FMQ A;  4RQ4 A;  3MGI A;  4I2F A;  4QZD A;  9ICG A;  5J0Y A;  4QZF A;  7ICM A;  4NM1 A;  3PNC A;  3TFR A;  3C2M A;  3C2L A;  5J0T A;  3ISC A;  4DOA A;  7ICF A;  2P66 A;  4IQV A;  9ICW A;  4KLF A;  3RJF A;  4QZI A;  2BCQ A;  4TUS A;  4Z6D A;  9ICF A;  1ZQG A;  1HUZ A;  2W9M A;  4QZ8 A;  8ICF A;  4UAZ A;  8ICG A;  5J2B A;  3UQ0 A;  7ICV A;  3UXO A;  1BNO A;  8ICV A;  8ICB A;  4RPY A;  4K4I A;  4I2I A;  4NXZ A;  4MFA A;  2PFO A;  4KLU A;  8ICZ A;  1ZQL A;  2BCS A;  4KLJ A;  5D46 A;  4K4G A;  8ICY A;  8ICX A;  5BPC A;  2ISO A;  3ISD A;  4I2A A;  8ICU A;  2ISP A;  9ICP A;  5J2C A;  9ICN A;  8ICS A;  5J2A A;  5BOL A;  4QZ9 A;  4O9M A;  3OGU A;  3AUO A;  7ICN A;  3JPP A;  7ICH A;  4GXK A;  5J2D A;  3RH6 A;  9ICK A;  3PMN A;  3RJH A;  4KLO A;  3MDA A;  1HUO A;  2BCR A;  4YD2 A;  4M0A A;  5BOM A;  4XA5 A;  1BPZ A;  1NZP A;  7ICT A;  5J0X A;  4XUS A;  4RQ0 A;  9ICQ A;  5HHI A;  4F5N A;  1ZQQ A;  7ICS A;  4PGX A;  4X5V A;  4KLH A;  5J2E A;  4F5Q A;  3C5G A;  4TUP A;  5DBC A;  4RQ8 A;  5DBB A;  3JPR A;  2KP7 A;  8ICE A;  4YN4 A;  1KDH A;  8ICJ A;  4KLS A;  4M47 A;  5J2K A;  3AU6 A;  4UB4 A;  4YMN A;  7ICU A;  1ZQN A;  4PPX A;  8ICC A;  4DO9 A;  4JWM A;  4I2J A;  4KLT A;  7ICJ A;  3RH4 A;  4R66 A;  3UXN A;  4UB2 A;  4Z6E A;  4QZE A;  3V7J A;  4NLN A;  4KLE A;  3UPQ A;  1ZJN A;  4QZG A;  4I27 A;  4R65 A;  3RH5 A;  9ICO A;  1ZQS A;  3JPS A;  8ICP A;  4YMM A;  2BPG A;  4MF8 A;  1ZQC A;  3RJJ A;  9ICS A;  1ZQP A;  4LZG A;  3UQ2 A;  9ICA A;  4P2H A;  5CB1 A;  7ICQ A;  4RQ1 A;  5J0R A;  1ZQF A;  4I2B A;  5J0U A;  1MQ3 A;  4GXJ A;  4UBB A;  4I2G A;  4PHD A;  3JPO A;  8ICK A;  1ZQJ A;  1BPE A;  4KLL A;  9ICM A;  3B0Y A;  8ICN A;  8ICL A;  4M9J A;  9ICC A;  8ICM A;  1TV9 A;  4KLQ A;  3HX0 A;  9ICV A;  4PHP A;  4I2D A;  8ICQ A;  5IIM A;  4QZH A;  5J2J A;  4M04 A;  4RQ3 A;  4M9N A;  4FO6 A;  1DK3 A;  5DB9 A;  4UB3 A;  2GWS A;  1RZT A;  4NY8 A;  5J2G A;  1ZQR A;  2PFN A;  7ICR A;  1KEJ A;  4RPZ A;  4M2Y A;  9ICU A;  5IIJ A;  4QZC A;  5IIO A;  4GXI A;  4K4H A;  5TZV A;  3HWT A;  4QZB A;  5DKW A;  4F5P A;  3MBY A;  2PFP A;  1BNP A;  2BPF A;  3PML A;  1JMS A;  4Z6F A;  3RJE A;  4YD1 A;  3RJK A;  9ICT A;  4DOC A;  4Z6C A;  3RJG A;  3V7K A;  4M9G A;  4IQT A;  1ZQE A;  4PH5 A;  2I9G A;  4I2H A;  1ZQA A;  9ICL A;  9ICI A;  9ICH A;  4MF2 A;  4TUQ A;  7ICE A;  5IIN A;  4O5K A;  1XSP A;  5J2H A;  5IIL A;  4IQW A;  4PGY A;  7ICK A;  3JPT A;  8ICR A;  1ZJM A;  4RQ5 A;  9ICR A;  5J2I A;  4PGQ A;  4LZD A;  4I2E A;  4DOB A;  1DK2 A;  9ICJ A;  7ICI A;  5J0S A;  4R64 A;  4M9L A;  4MFC A;  3LK9 A;  1BPX A;  2IHM A;  4RQ7 A;  2PFQ A;  1MQ2 A;  5J0P A;  3V72 A;  5HHH A;  3C2K A;  5IIK A;  1BPD A;  4F5R A;  9ICB A;  4IQU A;  9ICE A;  2FMP A;  5EOZ A;  1ZQB A;  2FMS A;  4KLM A;  5DBA A;  9ICX A;  1ZQT A;  4YCX A;  4O5E A;  1TVA A;  5J0W A;  4UAW A;  3JPQ A;  4MFF A;  3B0X A;  8ICW A;  4UBC A;  7ICG A;  4KLG A;  3AU2 A;  4YMO A;  5DB7 A;  5J2F A;  1ZQH A;  1ZQK A;  4PHE A;  4UB5 A;  3RJI A;  3V7L A;  4RQ2 A;  5J29 A;  8ICI A;  2BCV A;  5J0Q A;  3ISB A;  4R63 A;  8ICA A;  1BPY A;  2BCU A;  4I28 A;  5DB8 A;  5J0O A;  5CWR A;  1ZQI A;  8ICT A;  4RPX A;  4NLZ A;  1ZQD A;  4KLD A;  5D4B A;  4O5C A;  1ZQO A;  3MGH A;  3C5F A;  2PXI A;  7ICP A;  4RT3 A;  7ICL A;  4I2C A;  4NLK A;  3MDC A;  4RT2 A;  1XSN A; 
#chains in the Genus database with same CATH topology
 1S0M A;  3LVV A;  3PO5 A;  1YZ6 A;  4OCZ A;  5ALN A;  4B9T A;  4OJ5 A;  8ICO A;  4F5O A;  5DB6 A;  5G5H A;  5DGA A;  7ICO A;  2DL0 A;  4DFJ A;  1XSL A;  1WUD A;  3ZDA A;  3TFS A;  2LYH A;  4IRK A;  3GIJ A;  1LVH A;  4EZ6 A;  4KLI A;  2HHX A;  3T79 A;  4Y2Q A;  3HW8 A;  1LB2 B;  2BGW A;  4DQQ A;  2FMQ A;  4RQ4 A;  1LV5 A;  4I2F A;  9ICG A;  3IG8 A;  3QNM A;  2C2D A;  1OUQ A;  1WCL A;  3KTQ A;  2JZB B;  2ZTD A;  4DOA A;  2ZIU B;  5KL1 B;  4DSL A;  4ED3 A;  4YXJ A;  1RQL A;  4Z6D A;  3AL0 B;  3D6J A;  8ICF A;  1ZQ1 C;  4PJ0 U;  3PY8 A;  3UQ0 A;  3FAH A;  3Q8P B;  1L7M A;  2XGQ A;  3AMZ A;  2F1H A;  4R8U B;  3M8R A;  3G6V A;  4RNM A;  2BR0 A;  3EPI A;  1KLN A;  4KMO B;  4ECW A;  1RYU A;  3QX7 A;  2K4I A;  2R8J A;  4A8E A;  5JU5 A;  1ZRN A;  2ZIX B;  2F44 A;  2KFN A;  2C22 A;  8ICY A;  4DS5 A;  2MUT A;  1CEZ A;  2D8C A;  2ISO A;  4I2A A;  3ZD9 A;  2HVI A;  3H7I A;  2ISP A;  5J2C A;  1T8E A;  2K89 A;  2KIC A;  3SAF A;  5J2A A;  2HBL A;  5KFY A;  4F50 A;  4EBD A;  3AUO A;  7ICN A;  1WYG A;  2NRV A;  3RH6 A;  9ICK A;  2F8K A;  2Z7J A;  3RJH A;  4M0A A;  2ZXI A;  3TAR A;  5AM1 A;  7ICT A;  1RG6 A;  3MR2 A;  5ALJ A;  1KFS A;  4Y2J A;  3OSN A;  1QTM A;  4PGX A;  5AKL A;  2JRZ A;  5J2E A;  2AJQ A;  2H5X A;  4TUP A;  4RQ8 A;  1ECW A;  2W3S A;  3JPR A;  1FFU A;  8ICE A;  2I6X A;  1KDH A;  3NTU A;  2XY5 A;  4KLS A;  4ECV A;  3AU6 A;  4UB4 A;  5CR0 A;  3IN5 A;  5HR7 A;  4BGD A;  2ESE A;  1O08 A;  2R18 A;  3QU9 A;  1JRO A;  5C0Y A;  3I28 A;  1X9S A;  1KBU A;  3QYP A;  1N5X A;  2V4R A;  3G6X A;  4QZE A;  3V7J A;  1TAQ A;  4ED7 A;  2BKE A;  1JXL A;  4QZG A;  2HVH A;  4UAT A;  1IM4 A;  2FPK A;  1S9F A;  2LI6 A;  4YXM A;  3C28 A;  2XO7 A;  4EYH B;  4MF8 A;  3C21 A;  2JGA A;  4LZG A;  1U49 A;  5B66 U;  4O3P A;  1S10 A;  4P2H A;  2XIC A;  1ZQF A;  5J0R A;  1MN8 A;  1SL0 A;  4JMU A;  1X2I A;  4DSF A;  2K8C B;  2W3R A;  5KFH A;  4CNQ A;  2KD1 A;  1IV8 A;  4PHD A;  4B9L A;  1SWW A;  2W9C A;  2DKZ A;  2LPE A;  5EE3 A;  3JPO A;  2HHV A;  4C7Y A;  4HAI A;  1S0N A;  2BHN A;  4KLL A;  1JUD A;  4CGZ A;  2HBM A;  1K5O A;  5CHG A;  2K60 A;  1SKS A;  1JXE A;  2KJ9 A;  2VIX A;  1TV9 A;  1QQ7 A;  1LKY A;  3MFH A;  2JH1 A;  2RDJ A;  1EXN A;  1HEK A;  3WK4 A;  2HMX A;  2P35 A;  1D9F A;  4QZH A;  4M04 A;  3WKB A;  2OYY A;  3PX0 A;  1D8Y A;  2ZUB A;  1RDF A;  4DLE A;  1DK3 A;  2J6S A;  4O3N A;  3E58 A;  2A1A A;  2KIV A;  1T3N A;  2RP5 A;  2XGP A;  7ICR A;  4YR0 A;  4NLB A;  2MSN A;  2AXT U;  5AKJ A;  5KFS A;  5IIO A;  2IOH A;  4K4H A;  3F2D A;  3MFI A;  5KFM A;  2FPL A;  1VDV A;  2ZIW A;  5CA7 A;  1DGJ A;  2LBO A;  2I1Q A;  3PML A;  3DV9 A;  4Z6F A;  1NK4 A;  2G06 A;  5AKE A;  9ICT A;  1N5W A;  3PX6 A;  3RJG A;  1FFV A;  4QW9 A;  4M9G A;  4J9M A;  4BX9 C;  1J2M A;  4EEY A;  5KFP A;  2AH5 A;  1V38 A;  2FLP A;  2I9G A;  3AM9 A;  4QNL A;  1J97 A;  4Y2U A;  3N7R C;  2G07 A;  2RQ5 A;  3KD3 A;  1TE2 A;  9ICI A;  4TUQ A;  1NK7 A;  4O5K A;  3J81 j;  2UVV A;  5ALT A;  4MHV A;  2MAX A;  2K8B B;  3JPT A;  2EAP A;  2E1E A;  2YTU A;  3SV4 A;  9ICR A;  1VLB A;  5AIC A;  1Z4N A;  3AQF A;  5KFZ A;  1ZQW A;  2YB4 A;  1QLN A;  2BDP A;  4R64 A;  4M9L A;  3CP8 A;  5ALR A;  4AYB F;  3GQC A;  1L3V A;  4DF8 A;  3ORY A;  4DSE A;  2ZTC A;  2EH9 A;  2W11 A;  4ED6 A;  9ICB A;  1T4G A;  1U47 A;  4U6P A;  5ALQ A;  2R8I A;  5EOZ A;  2FDR A;  2FMP A;  2FMS A;  3WK9 A;  3ZDB A;  1ZQT A;  3UM9 A;  2PKE A;  5C5J A;  2WHE A;  2KNJ A;  1K1S A;  4C8K A;  5L9X A;  4MFF A;  1SV0 C;  1PK3 A;  7ICG A;  4NJ8 A;  4NL9 A;  1KFT A;  1ZQH A;  4DSK A;  1XO0 A;  4PHE A;  3RJI A;  4Y2P A;  4FE3 A;  4RQ2 A;  2LMR A;  1SXE A;  8ICI A;  2H3I A;  4EEK A;  1L8O A;  4QJF B;  3ISB A;  8ICA A;  1SGG A;  2BCU A;  1KW4 A;  5AI9 A;  1ZD2 P;  5J0O A;  2V9W A;  2KZM A;  5CJ7 A;  1RYR A;  4B9S A;  2W04 A;  1D8L A;  5KG0 A;  3UMG A;  3PSP A;  4KLD A;  3KBB A;  4EX7 A;  2DBY A;  4BXO A;  5ALV A;  3QUB A;  3MGH A;  3UMC A;  1S5L U;  1L7P A;  5KFW A;  4F2R A;  1P7D A;  2O6K A;  2A1J A;  4RT2 A;  4TQR A;  4JWN A;  4ECY A;  2M0N A;  4UB1 A;  1C20 A;  3NAS A;  2ZIV A;  4UAY A;  1J2N A;  4TUR A;  3SMV A;  2JHD A;  3T5K A;  4LVS A;  2F8L A;  4RQ6 A;  2OH2 A;  2NV3 A;  1N63 A;  2QAR B;  3NRZ A;  4ECS A;  5D49 A;  5KFL A;  2ZUD A;  2V4Q A;  5KG5 A;  5DDY A;  4OJ6 A;  2HDO A;  4QWE A;  1X40 A;  2XID A;  3MGI A;  2W7O A;  1B0X A;  4ECQ A;  4QZD A;  4NL9 C;  5J0Y A;  4QZF A;  7ICM A;  1V85 A;  2HSZ A;  1UQV A;  1QQ5 A;  2DGZ A;  2XCA A;  2P66 A;  1TAU A;  2HI0 A;  2C2E A;  2KKV A;  3E2E A;  1U9L A;  5EE9 A;  1OXJ A;  4QZI A;  1SIJ A;  3H8S A;  1ZXI A;  4ED2 A;  4QWD A;  5KT5 A;  1ZQG A;  1HUZ A;  2W9M A;  1TAM A;  5KAI U;  2AQ4 A;  1Z19 A;  5J2B A;  7ICV A;  5KT3 A;  2K8A A;  3N4M B;  2H3Q A;  3QEA Z;  4DL4 A;  2BQR A;  3CW2 C;  2PI4 A;  1DXS A;  8ICV A;  3BQ1 A;  3SEN A;  1ZQX A;  2PMZ C;  2GLE A;  5F9L A;  4JV0 A;  1NK6 A;  4MFA A;  5DLF A;  2NRW A;  2RDI A;  4Q44 A;  4YG2 A;  8ICZ A;  2HOI A;  3PW5 A;  4NLG A;  3T3F A;  3RB6 A;  1L6N A;  4K4G A;  4RQM A;  3H0L B;  3QUQ A;  2JEI A;  4UW9 A;  5AKG A;  5ALO A;  2VJ5 A;  3ISD A;  5ALL A;  8ICU A;  5EE1 A;  9ICP A;  2JXJ A;  2HBJ A;  2KJ5 A;  2WB1 F;  5KG3 A;  4J9S A;  3T5H A;  2H3F A;  4QZ9 A;  5BOL A;  1K1Q A;  1SL1 A;  3OGU A;  2QKQ A;  1B4F A;  5AKX A;  3SI8 A;  2VA2 A;  2LYA A;  4GXK A;  4LJX A;  1XS9 D;  2GH1 A;  4YD2 A;  1X6J A;  2H3V A;  1BPZ A;  2DF4 B;  4XUS A;  3LDA A;  3T5L A;  2P6U A;  4F5N A;  1ZQQ A;  4KLH A;  4C0Z A;  2HOQ A;  5DBB A;  3PW4 A;  4YN4 A;  4UQG A;  8ICJ A;  1NKC A;  4F4K A;  1IXR A;  2Q0Z X;  1N62 A;  3GIK A;  2QB0 B;  2A3V A;  4UB6 U;  3SAG A;  4AYB C;  3UXN A;  4DSI A;  1SXD A;  4Z6E A;  2E8M A;  3IDW A;  5DG9 A;  1DGS A;  4P4P A;  4ECZ A;  1ZJN A;  4UAS A;  2XY7 A;  4I27 A;  3BS5 A;  4O3O A;  3RH5 A;  2J6T A;  1UA1 A;  4P0Q A;  4EEN A;  4Y2Y A;  2ASL A;  5KFB A;  2JH7 A;  3ZD8 A;  2BPG A;  1ZQP A;  4DLG A;  5DQG A;  2AGO A;  3S6J A;  3E0F A;  3PSF A;  3D2Q A;  5J0U A;  4KX3 A;  1ZQU A;  3PX4 A;  2NRX A;  2PI5 A;  3GIM A;  3HRD D;  3BQT A;  3WKD A;  3QZ7 A;  2F1I A;  3HKZ F;  3G6Y A;  4J9Q A;  3RRH A;  2E8O A;  4DFP A;  9ICM A;  1X9M A;  2G5I B;  2KK0 A;  5ALE A;  4E0D A;  2R8H A;  1ZYQ A;  8ICL A;  3OHB A;  4M9J A;  9ICC A;  2OEH A;  4KLQ A;  4J9R A;  2K4E A;  4EEL A;  5GTH U;  3C29 A;  3HX0 A;  4IL6 U;  3IHQ B;  2YX8 A;  1XU4 A;  1S76 D;  1Z00 B;  1PVR A;  1QQ6 A;  5HR6 A;  4EBE A;  4PHP A;  5T14 A;  1PK1 B;  1F5S A;  1TK0 A;  2WF9 A;  3OPX A;  2IMW P;  4M9N A;  5AK6 A;  4F4Z A;  1TK8 A;  3GIL A;  5J8Y A;  2KZZ A;  2BDU A;  2FJ6 A;  2BQU A;  2GWS A;  4KN7 A;  1JRP A;  2NYV A;  2AGQ A;  2NRZ A;  2KSO B;  5J2G A;  3EZ5 A;  4M2Y A;  9ICU A;  1MSW D;  5KG4 A;  3SZ2 A;  5KT6 A;  3B9J A;  2EZX A;  1PVQ A;  3A0H U;  1QSS A;  4YR2 A;  3TI0 A;  3K75 D;  3WK7 A;  1NK8 A;  1UT8 A;  1IG6 A;  1CI4 A;  2QB1 A;  4QWB A;  3Q8Q B;  3KOO A;  4DL7 A;  2VJ4 A;  3M9O B;  3RJK A;  4IR1 A;  3M6K A;  2RLT A;  2DFL A;  2EDU A;  3V7K A;  1S77 D;  4GC7 A;  4J9P A;  5CP2 A;  1U4B A;  3MGV A;  5ALW A;  5AM3 A;  4DQR A;  4I2H A;  4C80 A;  1ZQA A;  2W43 A;  1JI7 A;  1Z4O A;  3I1Y A;  5AI8 A;  4J9O A;  1C7Y A;  5AM4 A;  3V6J A;  2HHT A;  4PGY A;  5ALG A;  1QSL A;  3H4B A;  1NK5 A;  1ZJM A;  3IG5 A;  5KNI A;  5KFK A;  3L3F X;  1WG8 A;  3QXG A;  4PGQ A;  2C2R A;  4I2E A;  3IV6 A;  3NGD A;  2OM6 A;  3IM1 A;  4C8M A;  1S0O A;  5J8Y C;  2VAN A;  1DK2 A;  2Q4T A;  3KZX A;  1KKX A;  9ICJ A;  4F4Y A;  2CXY A;  4JV1 A;  2XVT A;  2WB1 C;  4ECR A;  3VC8 A;  4Q43 A;  3BQ0 A;  5L1J A;  3LK9 A;  1BPX A;  1KL9 A;  2JEG A;  4P0P A;  2KV2 A;  3SAH A;  1MQ2 A;  3V72 A;  5HHH A;  1PUZ A;  3C2K A;  1FO4 A;  1V9P A;  4CF5 A;  4BWJ A;  4G3I A;  1BPD A;  5KFI A;  2K4P A;  2MUT B;  5KT4 A;  1KN5 A;  1U48 A;  4FZN A;  9ICE A;  2DWQ A;  4ELV A;  1VJ5 A;  3H0R B;  3THV A;  4IRD A;  1SZP A;  5DBA A;  3BQ2 A;  3TAQ A;  4KMU A;  4NV0 A;  4YCX A;  1D8B A;  4UAW A;  3JPQ A;  4YR3 A;  2G09 A;  3ETR A;  4OJL A;  4QWC A;  4YMO A;  4ICA A;  2FE9 A;  3KFU F;  2NO4 A;  1XO1 A;  4UB5 A;  5AI0 A;  2PMZ F;  4P4M A;  4F4W A;  3EW9 A;  3GV5 B;  2KG5 A;  3V6H A;  1IIP A;  2F3N A;  1BPY A;  3HIL A;  4Y2T A;  1NK0 A;  4OJP A;  3H8M A;  1NNL A;  5DB8 A;  4I28 A;  3NRW A;  2ATL A;  4RPX A;  3TAP A;  5D4B A;  2EAO A;  1RM6 C;  4CE6 A;  1X66 A;  4NLK A;  4RUC A;  3MDC A;  1XSN A;  2KE7 A;  2BPC A;  4QZA A;  2Y1I A;  2OCE A;  3SQI A;  2G08 A;  8ICH A;  3GV8 B;  3GDX A;  4M9H A;  5GTI U;  3N28 A;  5KT7 A;  4P4O A;  3CRX A;  2EZY A;  4CDG A;  2WTF A;  4ELT A;  2ZUC A;  5AI4 A;  3JPN A;  3HKZ C;  3M1Y A;  4GC6 A;  5JTI A;  1YT3 A;  4ED8 A;  2CN1 A;  4FFD A;  1L3S A;  4NM1 A;  3SV3 A;  3PNC A;  1WCN A;  3C2M A;  4M6W A;  5J0T A;  2QLT A;  3ISC A;  7ICF A;  2W9C B;  5AKK A;  5ALH A;  3EYZ A;  2CPR A;  4KLF A;  5KFX A;  4TUS A;  9ICF A;  4JK1 A;  2AGP A;  4ACO A;  3IP4 B;  4RUA A;  2K4H A;  8ICG A;  2IA6 A;  3RAX A;  1XC9 A;  1ARO P;  2FLN A;  3BZC A;  1U45 A;  3QU2 A;  4PZN A;  4RU9 A;  3GZF A;  8ICB A;  3QZ8 A;  3DEE A;  2LYB A;  1F0M A;  4RPY A;  2EQY A;  4K4I A;  4I2I A;  3RR8 A;  4UAV A;  2PFO A;  4C8O A;  2YML A;  4KLU A;  5AK3 A;  2E3T A;  5H2F U;  4ED0 A;  5KFU A;  4OO1 J;  1ZQL A;  2F2A B;  2BCS A;  1SV4 A;  4XQ8 A;  4EZ9 A;  2KN7 A;  3H8W A;  1NK9 A;  5BPC A;  5AIB A;  3TQ1 A;  4C8L A;  1HJP A;  2HHS A;  2W9B B;  3DDH A;  4J9L A;  4J03 A;  3PO4 A;  9ICN A;  8ICS A;  5EWE A;  1B22 A;  5ALZ A;  1ZOL A;  1B43 A;  1MC8 A;  4O9M A;  2OXO A;  3JPP A;  4Y2R A;  4C4T A;  2E8P A;  2F76 X;  4C8N A;  1H38 A;  5AM0 A;  3PMN A;  4KLO A;  3UMB A;  1HUO A;  3TKA A;  4IC9 A;  5BOM A;  1NZP A;  3ICX A;  5J0X A;  2ZIW B;  5TIS U;  3R9K A;  4RQ0 A;  5HHI A;  2YQE A;  4PZO A;  2CRX A;  1AQ6 A;  3RB3 A;  2KVS A;  4F5Q A;  5DBC A;  3NVV A;  1M6Y A;  2KP7 A;  3SR6 A;  4F91 B;  5HP4 A;  5E79 U;  2ASJ A;  2Y0S F;  5FP0 A;  4M47 A;  3GV7 B;  1X9W A;  5EE0 A;  3SD7 A;  2E1F A;  5AIA A;  3F2B A;  4JWM A;  2JEF A;  4Y2V A;  7ICJ A;  4WJ3 B;  2G0A A;  5CEH A;  4F93 B;  4NLN A;  2WF8 A;  2IOF A;  1SKR A;  4DWI A;  1RQN A;  4XRH A;  1S8O A;  5ALY A;  4UAU A;  2NRT A;  5AKY A;  9ICO A;  1ZQS A;  3LVW A;  3KHR A;  4AP9 A;  3GU3 A;  4DQS A;  3Q8L A;  3RJJ A;  3MR3 A;  5CRX A;  3NVY A;  5F3X B;  2UVW A;  5CB1 A;  4B6J A;  4RNO A;  4US8 A;  1ZQZ A;  1X42 A;  4I2B A;  4FS1 A;  3QUT A;  1MQ3 A;  3PW0 A;  2LHT A;  3SYZ A;  5A0L A;  1S0V A;  4I2G A;  2JZB A;  4B9M A;  5KTQ A;  3C23 A;  4OD0 A;  5ALS A;  2ZIU A;  5DG8 A;  2DUY A;  4FZL A;  1DRG A;  4DFM A;  1BPE A;  1SKW A;  4RNN A;  4C4S A;  1X6I A;  5KFQ A;  5G5G A;  2W03 A;  8ICN A;  5ALF A;  4R8U A;  2LKY A;  1BGX T;  1L8L A;  2B21 A;  1Q8K A;  1NZB A;  2JEJ A;  1UT5 A;  1ZQV A;  4GIB A;  2N1R A;  3M8S A;  2HOF A;  5AKZ A;  2HHW A;  4I2D A;  5KFJ A;  1JAL A;  1N48 A;  2ZIX A;  4UAR A;  5IIM A;  5J2J A;  2B6G A;  4F2S A;  4BXO B;  3OJU A;  2FI1 A;  3IRU A;  3OHA A;  1JX4 A;  5DB9 A;  2W9A A;  3NVZ A;  2AHO B;  2ES6 A;  2WF6 A;  2ZXH A;  5KFT A;  3KKA A;  3RB0 A;  4NY8 A;  1ZQR A;  2XI9 A;  2FLL A;  5IIJ A;  4QZC A;  1T3Q A;  3Q8S B;  5AM5 A;  4GXI A;  2D6F C;  2NO5 A;  4F72 A;  5TZV A;  3HWT A;  4CF3 A;  3HPO A;  3KHG A;  5AK5 A;  3BZK A;  2BZF A;  1UHU A;  3HJE A;  1RXW A;  2HBK A;  1NJX A;  2BPF A;  1JMS A;  3RFA A;  3MAB A;  5KFV A;  3BJY A;  2MA1 A;  1ZRM A;  2KOB A;  3WKC A;  2KSO A;  3TAN A;  4O0I A;  5KFN A;  4BDP A;  4B9V A;  4IQT A;  3GFK B;  1ZQE A;  1NJY A;  5KFF A;  4GFJ A;  2WF7 A;  2DKX A;  5DG7 A;  1ZET A;  4DF4 A;  4DSJ A;  4MF2 A;  3OTQ A;  7ICE A;  4DL6 A;  1XSP A;  5J2H A;  5IIL A;  4IQW A;  1UA0 A;  3EPG A;  2L5Y A;  8ICR A;  5DDM A;  2W54 A;  2WFA A;  5J2I A;  5ALM A;  2P6R A;  5KG2 A;  1O03 A;  5KT2 A;  2AQ0 A;  4BJQ A;  2XCP A;  1RXV A;  3MC1 A;  7ICI A;  2VA8 A;  3KKA C;  4MEX A;  5HML A;  3T5J A;  4MFC A;  4U7C A;  2W55 A;  5J0P A;  1L5U A;  2LM1 A;  4O3M A;  3SEI A;  5IIK A;  2WAQ C;  4F5R A;  3CYM A;  3L5K A;  1L3T A;  4IQU A;  1JN3 A;  4KLM A;  2KFZ A;  2W8K A;  1QH9 A;  2ALZ A;  2ZJA A;  3CNH A;  3WU2 U;  3BDP A;  3RBE A;  2YMP A;  4DL5 A;  5J0W A;  2D3D A;  1V97 A;  5AKH A;  4EYI B;  3FDS A;  8ICW A;  1SL2 A;  1Y88 A;  5DB7 A;  4DQI A;  3F53 A;  2KVC A;  5J2F A;  2Y0S C;  2GO7 A;  5ALK A;  4RQN A;  3V7L A;  4QIW F;  4DS4 A;  1CRX A;  4Y2X A;  4USA A;  5J29 A;  2BCV A;  1F44 A;  2YY6 A;  5KFA A;  5J0Q A;  1NKB A;  4R63 A;  2W7P A;  2HHQ A;  1DOQ A;  1PZN A;  3K1Z A;  5CWR A;  1ZQI A;  3QEB Z;  4CCH A;  8ICT A;  1N56 A;  1ZD5 A;  4QW8 A;  3PSI A;  5KG1 A;  4NLZ A;  1L7N A;  3O0F A;  4O5C A;  3ALR A;  1UCV A;  1A77 A;  1MA7 A;  4GLX A;  1ZQO A;  3C5F A;  2PXI A;  4RT3 A;  7ICL A;  2YMM A;  4KIT B;  1SZH A;  2VA3 A;  2EAM A;  4F4X A;  3H4D A;  4US9 A;  3RTV A;  5KL8 B;  1Z1V A;  4DFK A;  4F92 B;  3BS5 B;  4NM2 A;  4ECX A;  4C7Z A;  2KTQ A;  4RZR A;  5L1L A;  2W8L A;  4I29 A;  4EBC A;  4YFK A;  3UXP A;  1A0P A;  1XWL A;  1NOM A;  4TQS A;  4P0Q B;  1ZQM A;  4PHA A;  2ZG6 A;  1XNS A;  1CUK A;  5DQI A;  5III A;  3PW7 A;  4F3O A;  2IHN A;  3QE9 Y;  1Z1B A;  4BWM A;  4KX5 A;  5KFR A;  2RRD A;  3AEV A;  3TFR A;  3C2L A;  4ZH4 A;  5DGB A;  3RR7 A;  1KQQ A;  4IQV A;  9ICW A;  1L3U A;  4G9B A;  1KSP A;  1FEZ A;  5JRT A;  3RJF A;  2BCQ A;  3EWA A;  2VKQ A;  5AK4 A;  4F8R A;  1UPH A;  1COK A;  4NWI A;  3NVW A;  4QZ8 A;  3ONN A;  4UAZ A;  2WF5 A;  3Q8K A;  3EUB 2;  3UXO A;  4FBU A;  1N60 A;  5AKI A;  5AI5 A;  1BNO A;  5L1I A;  4F71 A;  3ED5 A;  4FS2 A;  4NXZ A;  1ZQY A;  4DL2 A;  1WWU A;  4PL2 A;  3PR4 A;  3C1Z A;  3LWL A;  2IOF K;  4KLJ A;  1Z3E B;  5D46 A;  3MR6 A;  5AHX A;  1PVP A;  2HW3 A;  3WKA A;  2E8N A;  8ICX A;  1D9D A;  5DQH A;  3QU7 A;  3RF9 A;  4QWA A;  4HYK A;  2I5H A;  3FM9 A;  4O3Q A;  3D2S A;  2DQN B;  3KHL A;  5B5E U;  4DFD A;  7ICH A;  4BUG A;  1BPB A;  3VCB A;  5L1M A;  1A6S A;  5J2D A;  4DCC A;  4DEZ A;  2EAN A;  3MDA A;  3BQ7 A;  2BCR A;  2C28 A;  3HT3 A;  4DQP A;  4ELU A;  5HNK A;  4XA5 A;  2KIW A;  2W9B A;  5KG7 A;  3FYH A;  9ICQ A;  1SWV A;  4Q8F A;  5ALD A;  2YN4 A;  1GO3 F;  7ICS A;  3TAD A;  4X5V A;  2ZTE A;  3I76 A;  5KFG A;  4ECT A;  1Q46 A;  3C5G A;  3LYS A;  3NS1 A;  3ZDD A;  5ALU A;  5L1K A;  2LM4 A;  5J2K A;  3NUQ A;  4KN4 A;  1NKE A;  3AQE A;  1NI3 A;  4YMN A;  7ICU A;  1ZQN A;  4PPX A;  8ICC A;  5F9N A;  3F2C A;  4DO9 A;  4I2J A;  4KLT A;  4O3S A;  1KFD A;  3GII A;  3RH4 A;  1KRP A;  4R66 A;  4UB2 A;  4ECU A;  4KLE A;  1SV0 A;  2BQ3 A;  1NJZ A;  3UPQ A;  3N7S C;  2XY6 A;  4R65 A;  2EZZ A;  3PR5 B;  1N2X A;  2M9N A;  1Q3V A;  3JPS A;  4FZM A;  8ICP A;  4FBT A;  4YMM A;  2QAR A;  2XC9 A;  3MR5 A;  1ZQC A;  9ICS A;  3H0M B;  3UQ2 A;  2MU2 A;  9ICA A;  4P0P B;  7ICQ A;  3K4G A;  1S97 A;  3PV8 A;  4RQ1 A;  4GXJ A;  2YMQ A;  4UBB A;  5KG6 A;  3M7D A;  3ZDE A;  3FC4 A;  4IS7 A;  2JR5 A;  3WK6 A;  4QIW C;  1N61 A;  3TAD C;  2KKP A;  2KEY A;  3Q8M A;  1X9X A;  8ICK A;  1ZQJ A;  1LKY B;  2FPM A;  2KMD A;  4ED1 A;  3LWM A;  5JUM A;  1T94 A;  2KHV A;  3K1R B;  3B0Y A;  2KZ3 A;  4O3R A;  1NJW A;  8ICM A;  4IRC A;  3QU5 A;  2F1J A;  5KFC A;  2IBK A;  1ZD4 A;  3RRG A;  3WK5 A;  2JV3 A;  4YQW A;  9ICV A;  2KJ8 A;  3QU4 A;  5K4L A;  3OSP A;  1BVS A;  8ICQ A;  3RBD A;  5KFO A;  2WAQ F;  2ASD A;  3H8J A;  3N7P D;  3V6K A;  2UVU A;  4RQ3 A;  2GOL A;  3RAQ A;  4FO6 A;  2A19 A;  4B9N A;  5DLG A;  4UB3 A;  1URJ A;  2G5H B;  1TFR A;  4Y2S A;  1RZT A;  2R8K A;  2PFN A;  1KEJ A;  1RPL A;  4RPZ A;  2ODG A;  3HP6 A;  5KAF U;  2Y9T A;  3BS7 A;  2OHF A;  3AN1 A;  4QZB A;  2ZJ8 A;  5DKW A;  2B0C A;  4F5P A;  4B9U A;  4JUZ A;  3MBY A;  2PFP A;  1BNP A;  2F77 X;  2E5S A;  4YP3 A;  1ED1 A;  3RJE A;  3ZDC A;  4YD1 A;  4DOC A;  4Z6C A;  4C4R A;  3KHH A;  5ALI A;  3PST A;  2AU0 A;  5KFD A;  3TAC B;  3PZP A;  4J9K A;  4ZOH C;  4PH5 A;  4M6W B;  9ICL A;  3OJS A;  1JIH A;  2QB0 A;  4IR9 A;  4JV2 A;  2JMG A;  9ICH A;  1FIQ A;  4YVZ A;  4CF4 A;  2HHU A;  1WWV A;  5IIN A;  4MEY A;  1COO A;  7ICK A;  3H40 A;  3ETL A;  3D2N A;  3QUC A;  3A0B U;  4RQ5 A;  3RB4 A;  4LZD A;  1SB3 C;  2DPI A;  4DOB A;  1QCK A;  2RHF A;  4PL1 A;  3WK8 A;  3M9M B;  2HCF A;  5J0S A;  5ALP A;  5HMM A;  3N97 B;  2IHM A;  5EWF A;  4RQ7 A;  2PFQ A;  1HIW A;  3PW2 A;  5AM2 A;  2YB1 A;  2Y9U A;  3C1Y A;  2UVR A;  2R8G A;  1ZQB A;  3M9N B;  9ICX A;  5ALX A;  3F5A A;  4O5E A;  5AI6 A;  1TVA A;  2H3Z A;  2OWO A;  3B0X A;  4UBC A;  3KZI U;  4KLG A;  3AU2 A;  1ZD3 A;  1T7P A;  1ZQK A;  4UB8 U;  1QSY A;  2DPJ A;  3U26 A;  3M6Z A;  4DL3 A;  1RYS A;  1Q3U A;  3PVX A;  3WKE A;  2J6U A;  2A1J B;  4JB3 A;  4Q45 A;  4J9N A;  2Y1J A;  5EWG A;  3F5E A;  1Z00 A;  1YZ7 A;  3L4P A;  2KHQ A;  1TKD A;  4Q8E A;  1PK1 A;  4KTQ A;  2ZIV B;  1ZQD A;  1L7O A;  4NLC A;  1OW5 A;  5KFE A;  2MRL A;  1A76 A;  4CRX A;  3ZI4 A;  7ICP A;  1TK5 A;  4OJO A;  4I2C A;  2ZJ5 A;  4EX6 A;  1KTQ A;  3Q8R B; 
#chains in the Genus database with same CATH homology
 4QZA A;  4JWN A;  8ICO A;  4F5O A;  5DB6 A;  7ICO A;  8ICH A;  4UB1 A;  3GDX A;  4M9H A;  1XSL A;  4NM2 A;  4UAY A;  4TUR A;  3TFS A;  4I29 A;  4LVS A;  3UXP A;  4RQ6 A;  1ZQM A;  4KLI A;  5D49 A;  4PHA A;  3HW8 A;  3JPN A;  5III A;  5DDY A;  2FMQ A;  4RQ4 A;  3MGI A;  4I2F A;  4QZD A;  9ICG A;  5J0Y A;  4QZF A;  7ICM A;  4NM1 A;  3PNC A;  3TFR A;  3C2M A;  3C2L A;  5J0T A;  3ISC A;  4DOA A;  7ICF A;  2P66 A;  4IQV A;  9ICW A;  4KLF A;  3RJF A;  4QZI A;  2BCQ A;  4TUS A;  4Z6D A;  9ICF A;  1ZQG A;  1HUZ A;  2W9M A;  4QZ8 A;  8ICF A;  4UAZ A;  8ICG A;  5J2B A;  3UQ0 A;  7ICV A;  3UXO A;  1BNO A;  8ICV A;  8ICB A;  4RPY A;  4K4I A;  4I2I A;  4NXZ A;  4MFA A;  2PFO A;  4KLU A;  8ICZ A;  1ZQL A;  2BCS A;  4KLJ A;  5D46 A;  4K4G A;  8ICY A;  8ICX A;  5BPC A;  2ISO A;  3ISD A;  4I2A A;  8ICU A;  2ISP A;  9ICP A;  5J2C A;  9ICN A;  8ICS A;  5J2A A;  5BOL A;  4QZ9 A;  4O9M A;  3OGU A;  3AUO A;  7ICN A;  3JPP A;  7ICH A;  4GXK A;  5J2D A;  3RH6 A;  9ICK A;  3PMN A;  3RJH A;  4KLO A;  3MDA A;  1HUO A;  2BCR A;  4YD2 A;  4M0A A;  5BOM A;  4XA5 A;  1BPZ A;  1NZP A;  7ICT A;  5J0X A;  4XUS A;  4RQ0 A;  9ICQ A;  5HHI A;  4F5N A;  1ZQQ A;  7ICS A;  4PGX A;  4X5V A;  4KLH A;  5J2E A;  4F5Q A;  3C5G A;  4TUP A;  5DBC A;  4RQ8 A;  5DBB A;  3JPR A;  2KP7 A;  8ICE A;  4YN4 A;  1KDH A;  8ICJ A;  4KLS A;  4M47 A;  5J2K A;  3AU6 A;  4UB4 A;  4YMN A;  7ICU A;  1ZQN A;  4PPX A;  8ICC A;  4DO9 A;  4JWM A;  4I2J A;  4KLT A;  7ICJ A;  3RH4 A;  4R66 A;  3UXN A;  4UB2 A;  4Z6E A;  4QZE A;  3V7J A;  4NLN A;  4KLE A;  3UPQ A;  1ZJN A;  4QZG A;  4I27 A;  4R65 A;  3RH5 A;  9ICO A;  1ZQS A;  3JPS A;  8ICP A;  4YMM A;  2BPG A;  4MF8 A;  1ZQC A;  3RJJ A;  9ICS A;  1ZQP A;  4LZG A;  3UQ2 A;  9ICA A;  4P2H A;  5CB1 A;  7ICQ A;  4RQ1 A;  5J0R A;  1ZQF A;  4I2B A;  5J0U A;  1MQ3 A;  4GXJ A;  4UBB A;  4I2G A;  4PHD A;  3JPO A;  8ICK A;  1ZQJ A;  1BPE A;  4KLL A;  9ICM A;  3B0Y A;  8ICN A;  8ICL A;  4M9J A;  9ICC A;  8ICM A;  1TV9 A;  4KLQ A;  3HX0 A;  9ICV A;  4PHP A;  4I2D A;  8ICQ A;  5IIM A;  4QZH A;  5J2J A;  4M04 A;  4RQ3 A;  4M9N A;  4FO6 A;  1DK3 A;  5DB9 A;  4UB3 A;  2GWS A;  1RZT A;  4NY8 A;  5J2G A;  1ZQR A;  2PFN A;  7ICR A;  1KEJ A;  4RPZ A;  4M2Y A;  9ICU A;  5IIJ A;  4QZC A;  5IIO A;  4GXI A;  4K4H A;  5TZV A;  3HWT A;  4QZB A;  5DKW A;  4F5P A;  3MBY A;  2PFP A;  1BNP A;  2BPF A;  3PML A;  1JMS A;  4Z6F A;  3RJE A;  4YD1 A;  3RJK A;  9ICT A;  4DOC A;  4Z6C A;  3RJG A;  3V7K A;  4M9G A;  4IQT A;  1ZQE A;  4PH5 A;  2I9G A;  4I2H A;  1ZQA A;  9ICL A;  9ICI A;  9ICH A;  4MF2 A;  4TUQ A;  7ICE A;  5IIN A;  4O5K A;  1XSP A;  5J2H A;  5IIL A;  4IQW A;  4PGY A;  7ICK A;  3JPT A;  8ICR A;  1ZJM A;  4RQ5 A;  9ICR A;  5J2I A;  4PGQ A;  4LZD A;  4I2E A;  4DOB A;  1DK2 A;  9ICJ A;  7ICI A;  5J0S A;  4R64 A;  4M9L A;  4MFC A;  3LK9 A;  1BPX A;  2IHM A;  4RQ7 A;  2PFQ A;  1MQ2 A;  5J0P A;  3V72 A;  5HHH A;  3C2K A;  5IIK A;  1BPD A;  4F5R A;  9ICB A;  4IQU A;  9ICE A;  2FMP A;  5EOZ A;  1ZQB A;  2FMS A;  4KLM A;  5DBA A;  9ICX A;  1ZQT A;  4YCX A;  4O5E A;  1TVA A;  5J0W A;  4UAW A;  3JPQ A;  4MFF A;  3B0X A;  8ICW A;  4UBC A;  7ICG A;  4KLG A;  3AU2 A;  4YMO A;  5DB7 A;  5J2F A;  1ZQH A;  1ZQK A;  4PHE A;  4UB5 A;  3RJI A;  3V7L A;  4RQ2 A;  5J29 A;  8ICI A;  2BCV A;  5J0Q A;  3ISB A;  4R63 A;  8ICA A;  1BPY A;  2BCU A;  4I28 A;  5DB8 A;  5J0O A;  5CWR A;  1ZQI A;  8ICT A;  4RPX A;  4NLZ A;  1ZQD A;  4KLD A;  5D4B A;  4O5C A;  1ZQO A;  3MGH A;  3C5F A;  2PXI A;  7ICP A;  4RT3 A;  7ICL A;  4I2C A;  4NLK A;  3MDC A;  4RT2 A;  1XSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...