1DK3A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 18
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk3A00
2BCSA 1NZPA 5BOMA 4QZHA 4RQ6A 4GXKA 4NLKA 7ICJA 4PH5A 9ICJA 4YMOA 4P2HA 8ICJA 4O9MA 5DBAA 7ICQA 3LK9A 1ZQFA 4I29A 1BNOA 4YMMA 8ICOA 4RQ2A 5DB9A 1ZQLA 9ICLA 2PFQA 8ICCA 1BPYA 7ICOA 7ICMA 4RPZA 3V72A 4R64A 1ZQIA 4I28A 4RPXA 5D49A 7ICLA 4QZ8A 1XSNA 4I2FA 7ICVA 1MQ2A 3JPQA 4YN4A 8ICKA 1ZQAA 4M9JA 1ZQQA 5DBBA 4KLHA 4KLEA 8ICUA 7ICNA 3JPOA 4KLDA 2I9GA 4IQWA 4F5PA 8ICGA 3PNCA 4QZIA 4IQUA 3C5GA 4QZDA 3JPSA 3MGIA 4TUSA 4NLNA 2BCVA 4KLJA 4JWNA 3HWTA 3TFRA 9ICHA 9ICBA 8ICYA 4QZGA 4QZAA 4QZEA 5J2JA 1KEJA 8ICLA 3RJGA 4MF2A 4RQ1A 5CWRA 3PMNA 4RQ8A 9ICFA 1DK2A 9ICRA 4KLMA 4Z6DA 3TFSA 8ICAA 8ICTA 4NLZA 8ICFA 7ICGA 8ICRA 7ICFA 5IIIA 4R66A 4I2EA 1KDHA 3B0YA 4RQ0A 8ICXA 4KLSA 3HW8A 5IIOA 2KP7A 4KLQA 4MFAA 8ICEA 4I2BA 1BPXA 5J2GA 2BCUA 4YD2A 5DB7A 4K4IA 4LVSA 1ZQDA 3AU2A 3JPNA 5J2FA 5J0XA 4FO6A 4RQ5A 4YD1A 5J2DA 1ZQGA 2PFPA 5J0WA 4UBBA 3JPRA 1ZJMA 5J2IA 4NM2A 5DB6A 1ZQPA 5BOLA 4M9NA 4MF8A 4O5KA 4TUPA 1ZQHA 4DOAA 9ICXA 4I2JA 4I2DA 1ZQNA 8ICWA 5J0TA 4DOCA 4QZBA 4UAWA 3V7LA 9ICTA 5J2BA 1BPZA 4RT2A 4YMNA 4F5OA 3MDAA 4RPYA 1BPDA 4M9HA 3RJJA 3HX0A 5J0OA 3ISDA 4KLOA 4F5RA 2FMQA 5CB1A 2IHMA 2GWSA 3ISBA 8ICNA 8ICMA 8ICZA 8ICHA 3C2KA 1RZTA 2BPGA 1ZQMA 8ICIA 1XSLA 4PGXA 9ICCA 5J0QA 2W9MA 1XSPA 1ZQBA 5J29A 9ICOA 3OGUA 2P66A 4QZFA 9ICKA 9ICPA 9ICVA 9ICSA 4R65A 2BCRA 1HUZA 4GXIA 2PFNA 9ICGA 1JMSA 1ZQRA 3RJFA 9ICUA 4M47A 5J2KA 3RH5A 4RQ7A 3GDXA 5IILA 4NXZA 5HHIA 3UPQA 4PPXA 3JPTA 9ICWA 4NY8A 5EOZA 1TV9A 4KLLA 5DBCA 4Z6CA 4LZDA 4RQ3A 4RQ4A 4R63A 4UAYA 5J0SA 4KLUA 5J0RA 4KLTA 9ICIA 3C2MA 5J0UA 5DKWA 4IQVA 5TZVA 1BNPA 5J2CA 3RJHA 2PFOA 3RH4A 2FMSA 5D4BA 4K4GA 4M9GA 2ISPA 4K4HA 3UXOA 8ICVA 4PHDA 1TVAA 3ISCA 4PHPA 4I27A 4UB4A 1ZQOA 5J2HA 4M2YA 2FMPA 1ZQCA 4I2CA 5IINA 4PHEA 5BPCA 3RJEA 4UB3A 4DO9A 7ICRA 1ZQSA 9ICEA 4O5EA 4UBCA 4NM1A 4M04A 4X5VA 1ZQKA 3UQ2A 4O5CA 4QZ9A 8ICSA 4YCXA 4KLFA 5J2EA 4F5NA 4QZCA 4MFCA 8ICBA 4M0AA 3AU6A 9ICNA 4LZGA 4KLIA 7ICEA 4I2HA 4RT3A 7ICSA 7ICTA 4Z6FA 4JWMA 3C2LA 3B0XA 5IIMA 3AUOA 3UXPA 4F5QA 3RJIA 3MDCA 7ICKA 7ICHA 4XA5A 1ZQEA 3UXNA 5D46A 5IIJA 3RJKA 4PGQA 7ICIA 9ICMA 4Z6EA 4I2AA 7ICPA 1BPEA 5IIKA 4KLGA 4I2GA 9ICAA 8ICQA 1HUOA 4IQTA 3V7KA 2ISOA 2PXIA 3V7JA 1ZQTA 3C5FA 1ZJNA 2BCQA 4UB2A 4PHAA 5J2AA 5DDYA 2BPFA 4I2IA 5HHHA 5DB8A 4PGYA 4UAZA 1MQ3A 1ZQJA 9ICQA 4DOBA 4MFFA 1DK3A 3UQ0A 4XUSA 4TUQA 3PMLA 4GXJA 3RH6A 4UB1A 7ICUA 8ICPA 4M9LA 3JPPA 4TURA 4UB5A 5J0YA 3MGHA 5J0PA 3MBYA
chains in the Genus database with same CATH superfamily
5CEHA 4DSKA 2ZIUB 5BOMA 4TQSA 2PI4A 1KQQA 3IG8A 1S0MA 4RQ6A 5AI8A 4UB8U 1COOA 3H8MA 3PW7A 4NLKA 7ICJA 4J9LA 2LBOA 8ICJA 1TK8A 2XY5A 1TAQA 2YMPA 4NWIA 1ZQFA 1CRXA 4YMMA 3T3FA 3PW5A 3GFKB 4B9MA 2BQUA 5DB9A 2MAXA 3QEAZ 3GZFA 2ZXHA 1BPYA 2DWQA 4QWEA 1X9MA 4EEYA 1COKA 3ONNA 4C7YA 4RPZA 1SIJA 2W55A 2FPKA 3V72A 2BDPA 4I28A 5D49A 2HHXA 3NS1A 5AI9A 3HT3A 2OCEA 3NRWA 4UAVA 4NL9C 1XSNA 4F2RA 3SR6A 3WK9A 5AKEA 4YN4A 4GIBA 3DDHA 5DBBA 4DFKA 4B9NA 4KLDA 4MHVA 3CP8A 1N5WA 4IQWA 1ZQ1C 1ZD5A 4Q43A 2OYYA 3CRXA 3SAGA 2KICA 1IXRA 3E2EA 4GFJA 5AM1A 2EZYA 5HMLA 4QZDA 3PZPA 3J81j 3MGIA 4EBEA 3NVZA 1SB3C 4QWAA 3A0HU 1HIWA 3HKZC 4KLJA 4JWNA 3PO5A 4ELUA 2HVIA 9ICHA 2A1AA 4OJLA 4C4SA 2XC9A 5CRXA 9ICBA 4QZAA 4P0PB 3EZ5A 2RDIA 5ALLA 5CHGA 2KSOB 3UMBA 4RQ1A 5CWRA 3AL0B 3BS7A 3TARA 5AKXA 9ICFA 4KLMA 1N48A 3I1YA 2ZIVB 4DSEA 2V4RA 1TKDA 1OXJA 2LPEA 2V9WA 2W3SA 4RUCA 8ICFA 1U47A 5HR6A 3RBDA 3TADC 2ESEA 1QQ5A 4MEXA 3RRGA 1WCNA 4YXJA 1BGXT 4Q8FA 3K1ZA 4C8KA 1XS9D 7ICFA 3MGVA 5EWFA 4R66A 1KDHA 1SGGA 1Z4NA 3B0YA 4PL1A 4F4WA 1SV0A 3SV4A 2KZZA 5AM3A 5IIOA 2KP7A 2WAQF 4B9LA 8ICEA 4I2BA 1BPXA 1JALA 1V9PA 1L8LA 2F2AB 2ALZA 2HBJA 2W43A 4K4IA 4LVSA 3AU2A 3JPNA 4AP9A 5C5JA 4IRCA 2A19A 4FO6A 1L7NA 2G07A 5DG7A 1ZQGA 2MRLA 3GV5B 1F5SA 2KJ9A 3PX0A 1B22A 2L5YA 5AM2A 1AQ6A 4DF4A 4Y2TA 5KFKA 4DLGA 4NM2A 2QARB 5DB6A 3F53A 2BQ3A 3H0LB 4BWMA 1X6JA 4BWJA 1QCKA 3KBBA 2ZIUA 4MF8A 2XVTA 4DL4A 3GIJA 4O5KA 5KFDA 3PX6A 2W54A 1IG6A 8ICWA 5J0TA 3WK6A 4QZBA 4DQPA 1WUDA 1BPZA 4ICAA 2P6RA 4Y2SA 1K1SA 3PR4A 3QEBZ 1X42A 3Q8SB 3OTQA 2DKZA 3MFHA 1S0OA 1D9DA 2HW3A 1T3NA 3RB3A 2H3VA 1YZ6A 2Y0SF 3SYZA 2XCAA 3KZIU 4C4RA 1IIPA 2NRZA 2W03A 4A8EA 8ICMA 4Y2XA 4RZRA 5J29A 1LV5A 4YVZA 3T5HA 2NYVA 3N28A 4ECUA 9ICOA 1X9WA 9ICKA 4R65A 4YQWA 4DF8A 3AMZA 3KKAA 2PFNA 1JMSA 2H3ZA 2HMXA 1UA0A 9ICUA 3PW0A 4KX5A 3GDXA 1T4GA 1VJ5A 2CXYA 1ZQVA 2WF8A 2KJ8A 5ALJA 2KN7A 3H8WA 2BDUA 2C28A 2EAOA 4PPXA 4EBDA 2KV2A 4EELA 1YT3A 5KFSA 5EOZA 2XGQA 2RRDA 2IA6A 4RQ4A 4P0PA 1CEZA 2KFNA 5J0RA 2KSOA 2YB1A 2K89A 5ALOA 2YTUA 4RQMA 5KL1B 2PFOA 5KT3A 3RH4A 2HBKA 2ISPA 4K4HA 2ZIVA 2CRXA 4BGDA 3UXOA 1WCLA 4J03A 1TVAA 3MR6A 2G0AA 3ETLA 3KHGA 5KFIA 5ALYA 2KEYA 3RAQA 1LVHA 4UB4A 2Z7JA 5KFQA 2PKEA 4RNOA 4C7ZA 5J2HA 1X9SA 1DRGA 5IINA 1FO4A 3RJEA 2NO4A 1UHUA 3NVVA 1RXVA 5KG3A 3RFAA 2DPIA 3U26A 3BS5B 4DFJA 2H3QA 1EXNA 4M04A 1T3QA 4DFMA 4ED7A 3ZDDA 3K1RB 4QZ9A 4KLFA 2MSNA 4QZCA 8ICBA 3VCBA 1ECWA 2JEJA 4QIWC 4FZLA 2FPMA 4Q8EA 2XIDA 1ZQWA 1SWWA 3KHHA 3HP6A 4ECYA 4FZNA 1TK5A 5KNIA 1SXDA 2QARA 2AH5A 4EX6A 4JWMA 2W9CB 1KRPA 1F0MA 5IIMA 3HRDD 3UXPA 4F5QA 3MDCA 7ICKA 3HPOA 5D46A 3BDPA 2Q4TA 4P0QB 5DLGA 3GV7B 2K8AA 3LYSA 3PSIA 1C20A 1N5XA 2JEIA 1KFTA 3Q8PB 3IM1A 1UT5A 8ICQA 1C7YA 3NASA 3O0FA 3M9MB 1N56A 3SI8A 4ED1A 1ZQTA 2R8JA 5L1IA 2E8PA 1AROP 2C2EA 3PY8A 2W7PA 3N97B 2NRXA 5GTHU 3FYHA 3WU2U 2R8IA 1X66A 1QSYA 5KFFA 3Q8RB 5DB8A 4KN4A 5KG7A 5J8YA 3RR8A 4DFDA 5L1MA 3QU4A 2AQ0A 3IRUA 3QUBA 4DLEA 1KBUA 2JRZA 5ALUA 5DGAA 3OSNA 4AYBC 1NK5A 4F4XA 5DQHA 4TURA 4YR3A 4DQSA 2HHUA 2WB1F 4UB5A 5J0YA 5TISU 5AI0A 4IC9A 2NRWA 1NZPA 1NJZA 4YXMA 3MABA 5AK5A 5FP0A 2JMGA 2H3FA 4P2HA 4QNLA 5DBAA 1ZETA 4NL9A 3LK9A 2G5IB 4F4YA 2F3NA 4CNQA 4O3QA 1CUKA 4FS1A 4PZNA 1TAMA 2HOIA 3UM9A 3QZ8A 3H0RB 4BJQA 4EYHB 2GOLA 9ICLA 1NKCA 2Y1IA 3T79A 2ATLA 3DV9A 1Z4OA 1A0PA 3H8SA 2IOHA 4O0IA 2VANA 5KG1A 4R64A 4RPXA 3ORYA 2RDJA 1WWVA 3BZCA 5ALDA 2ZUCA 1NOMA 2EAPA 2PMZF 2Y9TA 3L3FX 1O03A 4M9JA 4KLHA 4KLEA 8ICUA 3I28A 3JPOA 3IDWA 2K4IA 2I9GA 3QE9Y 3BS5A 4F5PA 4PL2A 1UCVA 1F44A 4Y2YA 4IQUA 2FJ6A 2KJ5A 2DQNB 1SWVA 4NLNA 3MFIA 2ZUDA 4IL6U 1SKSA 2VA3A 3TFRA 1X9XA 1UPHA 4RU9A 4JV2A 3ZI4A 4QZGA 2W9BB 3Q8QB 8ICLA 1PVPA 2F1IA 1NK9A 4RQ8A 2FI1A 5AKKA 5ALKA 4BUGA 2LYHA 8ICAA 1MA7A 8ICTA 2R8KA 4P0QA 3WK8A 5JTIA 3F2DA 2DUYA 1RG6A 2M9NA 5DGBA 1ZD2P 3PR5B 2W7OA 3RB6A 2E1FA 4I2EA 2OXOA 1BPBA 4Q45A 2HOQA 4KLQA 2BHNA 5J2GA 4ECZA 4YD2A 3QXGA 2BPCA 3LDAA 5DB7A 5ALVA 5KFNA 3M1YA 4YD1A 1VDVA 2R18A 2PFPA 4EZ6A 2DBYA 3BJYA 1Q46A 5C0YA 3WKCA 1Q8KA 4NLCA 4RNMA 3JPRA 1ZQZA 1ZJMA 2C2RA 1U49A 4DS5A 5KAIU 1CI4A 3OJUA 5BOLA 2FLPA 4F92B 4TUPA 4IRKA 2R8GA 4QJFB 3M9NB 4DOAA 4I2JA 1ZQNA 3PSPA 5AKLA 4UW9A 3D2NA 4DOCA 2DL0A 2RLTA 4UAWA 2Y0SC 5DLFA 5ALTA 4C80A 4DQIA 2KE7A 4RPYA 4IR9A 3WKEA 1DOQA 3RJJA 3FC4A 3HX0A 1U45A 2KZMA 3ISDA 4KLOA 5ALPA 5EE1A 2GWSA 3N7SC 3ISBA 1JXEA 8ICZA 5HR7A 3NTUA 3GIKA 3HILA 1S76D 8ICIA 4PGXA 9ICCA 5J0QA 1XSPA 2K8CB 5KT4A 3MR3A 5KFLA 4GLXA 4C8OA 3OGUA 3C1YA 9ICVA 2BCRA 3QNMA 2QLTA 4GXIA 2KD1A 1ZQRA 2W9AA 1QQ6A 2J6TA 5KFWA 5KFOA 4EYIB 2K4HA 3SAHA 4RQ7A 2HDOA 5IILA 2BZFA 4ECQA 1ED1A 1V97A 5AIBA 2D8CA 9ICWA 2EZZA 2V4QA 1L7PA 4Z6CA 4RQ3A 1PZNA 3HJEA 4DFPA 2W9BA 4KLUA 1N61A 9ICIA 1SL0A 4OJ5A 4Q44A 1Z3EB 1A6SA 5J2CA 2QB1A 2FMSA 3PSFA 3OJSA 4CE6A 5EE0A 4M9GA 3GV8B 3D2SA 1PK1B 1B4FA 3H4BA 4OCZA 5E79U 8ICVA 3GIMA 4NJ8A 4B9VA 2JGAA 3G6YA 5CJ7A 4I27A 2JHDA 4US8A 3LWMA 1ZQOA 4YP3A 3SQIA 1NK6A 5HNKA 4M2YA 1MC8A 2FMPA 4Y2VA 1S77D 5KT2A 2W8LA 4UB3A 2HOFA 9ICEA 3WK7A 4TQRA 4ECRA 4OJ6A 2F8KA 1QQ7A 4UBCA 4G9BA 5DQIA 4O5CA 2JEGA 3TANA 5KFAA 3RAXA 4YCXA 2ZJ8A 4F5NA 1P7DA 9ICNA 2YMMA 4YR2A 3QUQA 2G08A 5AICA 4KLIA 3M7DA 4JV1A 4Y2QA 2XGPA 1ZYQA 4I2HA 7ICSA 1IM4A 1HJPA 3QU9A 3BQ1A 3AUOA 1SZHA 4DL6A 3GU3A 2E8MA 1ZQEA 3AM9A 2F44A 1KLNA 2F77X 3AEVA 5IIJA 5KG5A 1L3TA 2QKQA 3BZKA 4PGQA 1JX4A 4P4OA 7ICIA 3NVYA 2W8KA 5AKZA 5ALXA 1BPEA 1DGSA 3KFUF 4JK1A 2BKEA 3PSTA 3QU7A 2FE9A 4J9NA 5KFCA 4I2GA 9ICAA 3EPGA 4HAIA 2RHFA 4IQTA 3QZ7A 1TAUA 2ISOA 4M6WB 3V7JA 5H2FU 4OJOA 4UB2A 3HKZF 1RM6C 3KHRA 2BPFA 3PV8A 3QUCA 4PGYA 4DEZA 4QW9A 4YG2A 9ICQA 2I1QA 2M0NA 3G6XA 3K75D 4CF3A 1DXSA 3MR5A 2R8HA 4QWDA 2W3RA 5B5EU 2E1EA 2EZXA 4CF5A 4F50A 4UB1A 1L6NA 4J9OA 3KD3A 4KN7A 3WK4A 3JPPA 4ED2A 3QU5A 1UQVA 2BCSA 4ELTA 2I5HA 2A1JB 3KTQA 2WTFA 1SKWA 1N2XA 3PW2A 4RNNA 4GXKA 4YMOA 2Q0ZX 4F3OA 4O9MA 1XWLA 5KFYA 4C8LA 2YQEA 7ICQA 4ECXA 4XRHA 1MN8A 5AI5A 2WFAA 1BNOA 1S0NA 8ICOA 2K4PA 2F8LA 5KAFU 1ZD3A 3EW9A 3WKAA 3QYPA 3QX7A 1ZQLA 1RYUA 5AKHA 3TACB 2PFQA 8ICCA 2EAMA 4CDGA 7ICMA 2HHTA 5ALEA 3T5LA 1SV0C 2KZ3A 1PK1A 1Z1BA 3PO4A 4O3SA 1A77A 5AK4A 1N62A 1JXLA 2WF6A 3A0BU 5AK6A 4QZ8A 1NJWA 4YFKA 3JPQA 3MC1A 2HHQA 1ZQQA 5L1LA 4DL5A 4ECVA 1T8EA 3NUQA 8ICGA 1PK3A 3PNCA 2ZXIA 4QZIA 4UARA 1L3VA 2IMWP 2UVWA 4FFDA 3JPSA 5K4LA 2KHQA 2IOFA 4TUSA 2BCVA 3EPIA 3HWTA 2JR5A 5L9XA 1SV4A 1YZ7A 1UA1A 4QZEA 2MU2A 5J2JA 3QUTA 3ZD8A 1KEJA 2NRTA 5AKIA 2F1HA 5ALNA 4MF2A 3ZDBA 2AJQA 1JI7A 1Y88A 2VKQA 2Y9UA 4ELVA 2AU0A 1L8OA 1ZXIA 1L7MA 4ZOHC 4UAUA 3TFSA 2KG5A 3TKAA 4GC6A 5KFHA 1N63A 2JV3A 1WWUA 1J97A 1VLBA 2IOFK 5ALMA 1D8YA 7ICGA 1KFSA 5GTIU 8ICRA 1XNSA 4F93B 1RYRA 1XO0A 5IIIA 2OWOA 4R8UB 1N60A 1QH9A 2JH1A 4M6WA 4F4ZA 8ICXA 3T5KA 3L4PA 3SAFA 3RTVA 4JV0A 1QSLA 3KKAC 2BCUA 4JB3A 4F72A 2ZTCA 3D6JA 1K5OA 1Z1VA 5J2FA 5J0XA 1KSPA 1RDFA 2CPRA 3SEIA 2MA1A 3M8RA 1JUDA 2XI9A 5J0WA 4LJXA 4BDPA 3PVXA 1WYGA 4US9A 4F2SA 5J2IA 4G3IA 2YMQA 3F2CA 1KKXA 3ZDEA 2JEFA 1QLNA 4UB6U 4YR0A 4FBTA 4M9NA 2MUTB 5AI4A 2A1JA 1ZQHA 3G6VA 3NVWA 4I2DA 4J9MA 3D2QA 2ES6A 1KL9A 4F71A 5J2BA 4ED0A 4RT2A 3QU2A 3WKDA 2DGZA 4YMNA 2ODGA 3MDAA 3N7RC 1BPDA 2H5XA 3S6JA 1PUZA 3THVA 2G09A 2PI5A 4Y2JA 4U7CA 2ASJA 2FPLA 4F5RA 2GLEA 2QB0B 2ZJAA 5CB1A 2HBMA 2IHMA 3RF9A 8ICNA 4QIWF 2VA2A 1L3UA 3FM9A 1RZTA 3TADA 2BPGA 5EE3A 2KIWA 5KFZA 5KFMA 3EWAA 1JN3A 3M8SA 1ZQBA 5KFTA 1URJA 1KFDA 3Q8MA 2P66A 2C2DA 4QZFA 1OUQA 1FFUA 2F1JA 2J6SA 4C8MA 2WF9A 2D6FC 2EANA 4DSFA 4OD0A 2ZIXB 4CF4A 5KG2A 3RJFA 4M47A 3VC8A 1JRPA 3RH5A 1PVQA 1SL1A 2JZBB 3SV3A 4NXZA 2WAQC 4P4PA 1S10A 3ETRA 5HHIA 4ECTA 4Y2UA 4UATA 4ED3A 2G06A 4PZOA 3OHAA 3JPTA 3MR2A 1FFVA 4NY8A 2C22A 3V6HA 4DL3A 1TV9A 1LB2B 5A0LA 5F9LA 4LZDA 2P35A 1T94A 4UAYA 5J0SA 4KLTA 3C2MA 5J0UA 1K1QA 5DKWA 4IQVA 1BNPA 4Y2PA 3F5EA 2XO7A 5D4BA 3V6KA 1QTMA 1LKYB 2AGOA 3AQFA 5F9NA 4OO1J 4PHDA 3ISCA 1RQLA 4PHPA 4JMUA 1HEKA 1FIQA 4AYBF 5J8YC 1NI3A 3OHBA 2YB4A 4ECWA 4DL2A 4CGZA 2IBKA 1S9FA 4PHEA 4IR1A 5CA7A 4R8UA 3F5AA 4DO9A 7ICRA 3EUB2 3ALRA 2HHWA 4C4TA 4O5EA 1X6IA 3BQ0A 3RR7A 2ZIWB 3OPXA 5DG8A 1TE2A 3UQ2A 1ZQKA 2OH2A 8ICSA 5HP4A 5J2EA 3LVWA 5KT7A 3C23A 3IV6A 3AU6A 2P6UA 3B9JA 1ZD4A 4LZGA 2AGQA 4EBCA 2ZTEA 3ZDAA 2HBLA 4RT3A 4Z6FA 3C2LA 4GC7A 3BQ2A 3B0XA 2EDUA 3RJIA 2MUTA 5ALHA 1S8OA 3UXNA 2ASDA 1KN5A 1ZQUA 1NK7A 4Z6EA 4FS2A 1SXEA 5CR0A 1TK0A 7ICPA 2LM1A 2VJ4A 5IIKA 2XY7A 3Q8LA 2LI6A 1T7PA 1D8LA 3ICXA 4EENA 2A3VA 4UASA 2JH7A 5AKGA 2B6GA 2KMDA 4RQNA 1ZJNA 2QB0A 2ZG6A 2HI0A 4PHAA 5J2AA 2E8OA 4UAZA 1MQ3A 4B9SA 1ZQJA 4IS7A 5AK3A 1JROA 3TAQA 1Q3VA 1DK3A 3C29A 3UQ0A 4MFFA 2ZTDA 3PW4A 4NV0A 4DQQA 5KT6A 1U48A 2XCPA 4GXJA 1XC9A 2KVCA 4U6PA 2K4EA 3E0FA 4M9LA 4KTQA 1S5LU 1NK4A 2ZIXA 1DGJA 5J0PA 5L1KA 3E58A 2DFLA 1S97A 4DL7A 1J2NA 3BQTA 4QZHA 2ZJ5A 3ZD9A 4ED8A 1M6YA 4KMUA 2JZBA 2KIVA 4PH5A 9ICJA 2FLNA 5KFRA 4CRXA 2KNJA 4KITB 5B66U 5KG0A 3UMGA 5ALSA 4I29A 2KKPA 2VA8A 3OSPA 2AQ4A 4RQ2A 2YN4A 4QWCA 1TFRA 2YX8A 1GO3F 3RB4A 3H0MB 5EWGA 2WHEA 7ICOA 2LM4A 2LYAA 4USAA 2E3TA 4O3PA 4B9TA 4ACOA 2B21A 1LKYA 4CCHA 3KHLA 4B9UA 4J9KA 3C28A 1ZQIA 1ZQYA 1NK0A 4Y2RA 4UQGA 2DPJA 7ICLA 3KOOA 2LKYA 1U9LA 3N4MB 4I2FA 1QSSA 7ICVA 1MQ2A 2EQYA 3F2BA 3C1ZA 5ALGA 8ICKA 1L7OA 2KVSA 1ZQAA 2AHOB 3GILA 2BQRA 5L1JA 7ICNA 4QW8A 4KMOB 4HYKA 2UVRA 5EWEA 2ZIWA 5F3XB 2G5HB 5DQGA 3C5GA 4DQRA 3DEEA 2W11A 3SD7A 3V6JA 4NLGA 1KTQA 2KTQA 3IP4B 8ICYA 1ZRNA 1UT8A 5DDMA 1PVRA 5JU5A 3RBEA 3RJGA 3PMNA 2ZUBA 5ALIA 1RQNA 2DF4B 5KG4A 1DK2A 9ICRA 2H3IA 4Z6DA 2WB1C 3RRHA 3SZ2A 4EZ9A 4NLZA 3UMCA 5AIAA 2HVHA 2AGPA 4FBUA 1S0VA 5AM4A 3PX4A 3M6KA 3H40A 4DSLA 5AI6A 2J6UA 4O3RA 1V38A 3T5JA 2CN1A 4RQ0A 4KLSA 3FAHA 3TQ1A 3HW8A 3GQCA 3RB0A 4MFAA 1SZPA 1ZRMA 1ZOLA 1ZQDA 3H4DA 4RQ5A 5J2DA 2B0CA 1U4BA 3IHQB 5AM0A 4UBBA 2VJ5A 3N7PD 2IHNA 5JUMA 4DCCA 1ZQXA 5KFPA 1XU4A 2RP5A 4MEYA 4ZH4A 4KX3A 2LYBA 5AKJA 1X40A 4QWBA 2PMZC 1ZQPA 4J9SA 5G5GA 4XQ8A 3BQ7A 5ALZA 4EX7A 1FEZA 3ED5A 9ICXA 1Z00B 1JIHA 4BXOB 5ALRA 4DWIA 5KFBA 2OHFA 3V7LA 9ICTA 2ASLA 4F5OA 5DG9A 2K8BB 1D8BA 1H38A 2K60A 1L3SA 4M9HA 4E0DA 4DSIA 3H8JA 4PJ0U 5AHXA 4ECSA 3C21A 2KOBA 5J0OA 1NZBA 2FMQA 4F91B 3L5KA 1Z19A 5KTQA 2E8NA 1V85A 2KHVA 1NK8A 8ICHA 3C2KA 4J9RA 1ZQMA 3NGDA 4OJPA 1XSLA 2HHSA 3TI0A 5HMMA 2W9MA 3IG5A 4B6JA 1RXWA 9ICPA 9ICSA 5AM5A 1HUZA 3NRZA 9ICGA 4ED6A 2NRVA 5KG6A 3ZDCA 2LHTA 5J2KA 1J2MA 3EYZA 4WJ3B 4F4KA 2FLLA 2YMLA 3UPQA 4RUAA 2KKVA 3LWLA 3AN1A 4IRDA 4O3NA 5KFUA 2D3DA 3IN5A 4KLLA 4J9PA 5AKYA 5DBCA 5KL8B 2BR0A 2EH9A 2JXJA 1NKBA 3TAPA 3SENA 4R63A 1BVSA 3K4GA 1OW5A 2GO7A 5T14A 3H7IA 1NKEA 5JRTA 5TZVA 3RJHA 1NJXA 1RPLA 3FDSA 4K4GA 2WF5A 1L5UA 5EE9A 1D9FA 1B43A 2UVVA 2DKXA 2N1RA 1RYSA 4DSJA 4P4MA 3SMVA 5KFGA 1ZQCA 4I2CA 2XICA 5BPCA 1NJYA 3WK5A 2RQ5A 4EEKA 1ZQSA 3LVVA 5KFJA 5ALFA 1KW4A 1MSWD 1SKRA 4NM1A 5G5HA 4O3OA 4X5VA 4F8RA 5ALQA 2OEHA 1O08A 2HCFA 4MFCA 4M0AA 3KZXA 1A76A 5KT5A 2NO5A 4FZMA 7ICEA 7ICTA 1B0XA 2WF7A 3R9KA 4NLBA 3Q8KA 2I6XA 2UVUA 7ICHA 4XA5A 3RJKA 4FE3A 1WG8A 4C0ZA 9ICMA 2LMRA 2FDRA 4I2AA 1Z00A 4BXOA 5KFXA 4JUZA 1SL2A 4KLGA 2HHVA 4J9QA 4DS4A 1HUOA 1X2IA 2VIXA 2Y1JA 3V7KA 4O3MA 2PXIA 2OM6A 2O6KA 2F76X 2YY6A 3M9OB 3C5FA 3CNHA 3AQEA 3CW2C 2KK0A 2W9CA 3WKBA 2BCQA 3GIIA 1IV8A 5DDYA 3CYMA 5KFVA 4I2IA 5HHHA 2KFZA 2XY6A 2GH1A 5KFEA 2BGWA 4DOBA 5ALWA 3M6ZA 1NNLA 4XUSA 4TUQA 2AXTU 2HSZA 1Q3UA 2NV3A 3I76A 4C8NA 2W04A 3PMLA 2E5SA 3RH6A 5CP2A 1XO1A 7ICUA 8ICPA 4BX9C 3MGHA 3MBYA
chains in the Genus database with same CATH topology
2BCSA 1NZPA 5BOMA 4QZHA 4RQ6A 4GXKA 4NLKA 7ICJA 4PH5A 9ICJA 4YMOA 4P2HA 8ICJA 4O9MA 5DBAA 7ICQA 3LK9A 1ZQFA 4I29A 1BNOA 4YMMA 8ICOA 4RQ2A 5DB9A 1ZQLA 9ICLA 2PFQA 8ICCA 1BPYA 7ICOA 7ICMA 4RPZA 3V72A 4R64A 1ZQIA 4I28A 4RPXA 5D49A 7ICLA 4QZ8A 1XSNA 4I2FA 7ICVA 1MQ2A 3JPQA 4YN4A 8ICKA 1ZQAA 4M9JA 1ZQQA 5DBBA 4KLHA 4KLEA 8ICUA 7ICNA 3JPOA 4KLDA 2I9GA 4IQWA 4F5PA 8ICGA 3PNCA 4QZIA 4IQUA 3C5GA 4QZDA 3JPSA 3MGIA 4TUSA 4NLNA 2BCVA 4KLJA 4JWNA 3HWTA 3TFRA 9ICHA 9ICBA 8ICYA 4QZGA 4QZAA 4QZEA 5J2JA 1KEJA 8ICLA 3RJGA 4MF2A 4RQ1A 5CWRA 3PMNA 4RQ8A 9ICFA 1DK2A 9ICRA 4KLMA 4Z6DA 3TFSA 8ICAA 8ICTA 4NLZA 8ICFA 7ICGA 8ICRA 7ICFA 5IIIA 4R66A 4I2EA 1KDHA 3B0YA 4RQ0A 8ICXA 4KLSA 3HW8A 5IIOA 2KP7A 4KLQA 4MFAA 8ICEA 4I2BA 1BPXA 5J2GA 2BCUA 4YD2A 5DB7A 4K4IA 4LVSA 1ZQDA 3AU2A 3JPNA 5J2FA 5J0XA 4FO6A 4RQ5A 4YD1A 5J2DA 1ZQGA 2PFPA 5J0WA 4UBBA 3JPRA 1ZJMA 5J2IA 4NM2A 5DB6A 1ZQPA 5BOLA 4M9NA 4MF8A 4O5KA 4TUPA 1ZQHA 4DOAA 9ICXA 4I2JA 4I2DA 1ZQNA 8ICWA 5J0TA 4DOCA 4QZBA 4UAWA 3V7LA 9ICTA 5J2BA 1BPZA 4RT2A 4YMNA 4F5OA 3MDAA 4RPYA 1BPDA 4M9HA 3RJJA 3HX0A 5J0OA 3ISDA 4KLOA 4F5RA 2FMQA 5CB1A 2IHMA 2GWSA 3ISBA 8ICNA 8ICMA 8ICZA 8ICHA 3C2KA 1RZTA 2BPGA 1ZQMA 8ICIA 1XSLA 4PGXA 9ICCA 5J0QA 2W9MA 1XSPA 1ZQBA 5J29A 9ICOA 3OGUA 2P66A 4QZFA 9ICKA 9ICPA 9ICVA 9ICSA 4R65A 2BCRA 1HUZA 4GXIA 2PFNA 9ICGA 1JMSA 1ZQRA 3RJFA 9ICUA 4M47A 5J2KA 3RH5A 4RQ7A 3GDXA 5IILA 4NXZA 5HHIA 3UPQA 4PPXA 3JPTA 9ICWA 4NY8A 5EOZA 1TV9A 4KLLA 5DBCA 4Z6CA 4LZDA 4RQ3A 4RQ4A 4R63A 4UAYA 5J0SA 4KLUA 5J0RA 4KLTA 9ICIA 3C2MA 5J0UA 5DKWA 4IQVA 5TZVA 1BNPA 5J2CA 3RJHA 2PFOA 3RH4A 2FMSA 5D4BA 4K4GA 4M9GA 2ISPA 4K4HA 3UXOA 8ICVA 4PHDA 1TVAA 3ISCA 4PHPA 4I27A 4UB4A 1ZQOA 5J2HA 4M2YA 2FMPA 1ZQCA 4I2CA 5IINA 4PHEA 5BPCA 3RJEA 4UB3A 4DO9A 7ICRA 1ZQSA 9ICEA 4O5EA 4UBCA 4NM1A 4M04A 4X5VA 1ZQKA 3UQ2A 4O5CA 4QZ9A 8ICSA 4YCXA 4KLFA 5J2EA 4F5NA 4QZCA 4MFCA 8ICBA 4M0AA 3AU6A 9ICNA 4LZGA 4KLIA 7ICEA 4I2HA 4RT3A 7ICSA 7ICTA 4Z6FA 4JWMA 3C2LA 3B0XA 5IIMA 3AUOA 3UXPA 4F5QA 3RJIA 3MDCA 7ICKA 7ICHA 4XA5A 1ZQEA 3UXNA 5D46A 5IIJA 3RJKA 4PGQA 7ICIA 9ICMA 4Z6EA 4I2AA 7ICPA 1BPEA 5IIKA 4KLGA 4I2GA 9ICAA 8ICQA 1HUOA 4IQTA 3V7KA 2ISOA 2PXIA 3V7JA 1ZQTA 3C5FA 1ZJNA 2BCQA 4UB2A 4PHAA 5J2AA 5DDYA 2BPFA 4I2IA 5HHHA 5DB8A 4PGYA 4UAZA 1MQ3A 1ZQJA 9ICQA 4DOBA 4MFFA 1DK3A 3UQ0A 4XUSA 4TUQA 3PMLA 4GXJA 3RH6A 4UB1A 7ICUA 8ICPA 4M9LA 3JPPA 4TURA 4UB5A 5J0YA 3MGHA 5J0PA 3MBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCS A;  1NZP A;  5BOM A;  4QZH A;  4RQ6 A;  4GXK A;  4NLK A;  7ICJ A;  4PH5 A;  9ICJ A;  4YMO A;  4P2H A;  8ICJ A;  4O9M A;  5DBA A;  7ICQ A;  3LK9 A;  1ZQF A;  4I29 A;  1BNO A;  4YMM A;  8ICO A;  4RQ2 A;  5DB9 A;  1ZQL A;  9ICL A;  2PFQ A;  8ICC A;  1BPY A;  7ICO A;  7ICM A;  4RPZ A;  3V72 A;  4R64 A;  1ZQI A;  4I28 A;  4RPX A;  5D49 A;  7ICL A;  4QZ8 A;  1XSN A;  4I2F A;  7ICV A;  1MQ2 A;  3JPQ A;  4YN4 A;  8ICK A;  1ZQA A;  4M9J A;  1ZQQ A;  5DBB A;  4KLH A;  4KLE A;  8ICU A;  7ICN A;  3JPO A;  4KLD A;  2I9G A;  4IQW A;  4F5P A;  8ICG A;  3PNC A;  4QZI A;  4IQU A;  3C5G A;  4QZD A;  3JPS A;  3MGI A;  4TUS A;  4NLN A;  2BCV A;  4KLJ A;  4JWN A;  3HWT A;  3TFR A;  9ICH A;  9ICB A;  8ICY A;  4QZG A;  4QZA A;  4QZE A;  5J2J A;  1KEJ A;  8ICL A;  3RJG A;  4MF2 A;  4RQ1 A;  5CWR A;  3PMN A;  4RQ8 A;  9ICF A;  1DK2 A;  9ICR A;  4KLM A;  4Z6D A;  3TFS A;  8ICA A;  8ICT A;  4NLZ A;  8ICF A;  7ICG A;  8ICR A;  7ICF A;  5III A;  4R66 A;  4I2E A;  1KDH A;  3B0Y A;  4RQ0 A;  8ICX A;  4KLS A;  3HW8 A;  5IIO A;  2KP7 A;  4KLQ A;  4MFA A;  8ICE A;  4I2B A;  1BPX A;  5J2G A;  2BCU A;  4YD2 A;  5DB7 A;  4K4I A;  4LVS A;  1ZQD A;  3AU2 A;  3JPN A;  5J2F A;  5J0X A;  4FO6 A;  4RQ5 A;  4YD1 A;  5J2D A;  1ZQG A;  2PFP A;  5J0W A;  4UBB A;  3JPR A;  1ZJM A;  5J2I A;  4NM2 A;  5DB6 A;  1ZQP A;  5BOL A;  4M9N A;  4MF8 A;  4O5K A;  4TUP A;  1ZQH A;  4DOA A;  9ICX A;  4I2J A;  4I2D A;  1ZQN A;  8ICW A;  5J0T A;  4DOC A;  4QZB A;  4UAW A;  3V7L A;  9ICT A;  5J2B A;  1BPZ A;  4RT2 A;  4YMN A;  4F5O A;  3MDA A;  4RPY A;  1BPD A;  4M9H A;  3RJJ A;  3HX0 A;  5J0O A;  3ISD A;  4KLO A;  4F5R A;  2FMQ A;  5CB1 A;  2IHM A;  2GWS A;  3ISB A;  8ICN A;  8ICM A;  8ICZ A;  8ICH A;  3C2K A;  1RZT A;  2BPG A;  1ZQM A;  8ICI A;  1XSL A;  4PGX A;  9ICC A;  5J0Q A;  2W9M A;  1XSP A;  1ZQB A;  5J29 A;  9ICO A;  3OGU A;  2P66 A;  4QZF A;  9ICK A;  9ICP A;  9ICV A;  9ICS A;  4R65 A;  2BCR A;  1HUZ A;  4GXI A;  2PFN A;  9ICG A;  1JMS A;  1ZQR A;  3RJF A;  9ICU A;  4M47 A;  5J2K A;  3RH5 A;  4RQ7 A;  3GDX A;  5IIL A;  4NXZ A;  5HHI A;  3UPQ A;  4PPX A;  3JPT A;  9ICW A;  4NY8 A;  5EOZ A;  1TV9 A;  4KLL A;  5DBC A;  4Z6C A;  4LZD A;  4RQ3 A;  4RQ4 A;  4R63 A;  4UAY A;  5J0S A;  4KLU A;  5J0R A;  4KLT A;  9ICI A;  3C2M A;  5J0U A;  5DKW A;  4IQV A;  5TZV A;  1BNP A;  5J2C A;  3RJH A;  2PFO A;  3RH4 A;  2FMS A;  5D4B A;  4K4G A;  4M9G A;  2ISP A;  4K4H A;  3UXO A;  8ICV A;  4PHD A;  1TVA A;  3ISC A;  4PHP A;  4I27 A;  4UB4 A;  1ZQO A;  5J2H A;  4M2Y A;  2FMP A;  1ZQC A;  4I2C A;  5IIN A;  4PHE A;  5BPC A;  3RJE A;  4UB3 A;  4DO9 A;  7ICR A;  1ZQS A;  9ICE A;  4O5E A;  4UBC A;  4NM1 A;  4M04 A;  4X5V A;  1ZQK A;  3UQ2 A;  4O5C A;  4QZ9 A;  8ICS A;  4YCX A;  4KLF A;  5J2E A;  4F5N A;  4QZC A;  4MFC A;  8ICB A;  4M0A A;  3AU6 A;  9ICN A;  4LZG A;  4KLI A;  7ICE A;  4I2H A;  4RT3 A;  7ICS A;  7ICT A;  4Z6F A;  4JWM A;  3C2L A;  3B0X A;  5IIM A;  3AUO A;  3UXP A;  4F5Q A;  3RJI A;  3MDC A;  7ICK A;  7ICH A;  4XA5 A;  1ZQE A;  3UXN A;  5D46 A;  5IIJ A;  3RJK A;  4PGQ A;  7ICI A;  9ICM A;  4Z6E A;  4I2A A;  7ICP A;  1BPE A;  5IIK A;  4KLG A;  4I2G A;  9ICA A;  8ICQ A;  1HUO A;  4IQT A;  3V7K A;  2ISO A;  2PXI A;  3V7J A;  1ZQT A;  3C5F A;  1ZJN A;  2BCQ A;  4UB2 A;  4PHA A;  5J2A A;  5DDY A;  2BPF A;  4I2I A;  5HHH A;  5DB8 A;  4PGY A;  4UAZ A;  1MQ3 A;  1ZQJ A;  9ICQ A;  4DOB A;  4MFF A;  1DK3 A;  3UQ0 A;  4XUS A;  4TUQ A;  3PML A;  4GXJ A;  3RH6 A;  4UB1 A;  7ICU A;  8ICP A;  4M9L A;  3JPP A;  4TUR A;  4UB5 A;  5J0Y A;  3MGH A;  5J0P A;  3MBY A; 
#chains in the Genus database with same CATH topology
 5CEH A;  4DSK A;  2ZIU B;  5BOM A;  4TQS A;  2PI4 A;  1KQQ A;  3IG8 A;  1S0M A;  4RQ6 A;  5AI8 A;  4UB8 U;  1COO A;  3H8M A;  3PW7 A;  4NLK A;  7ICJ A;  4J9L A;  2LBO A;  8ICJ A;  1TK8 A;  2XY5 A;  1TAQ A;  2YMP A;  4NWI A;  1ZQF A;  1CRX A;  4YMM A;  3T3F A;  3PW5 A;  3GFK B;  4B9M A;  2BQU A;  5DB9 A;  2MAX A;  3QEA Z;  3GZF A;  2ZXH A;  1BPY A;  2DWQ A;  4QWE A;  1X9M A;  4EEY A;  1COK A;  3ONN A;  4C7Y A;  4RPZ A;  1SIJ A;  2W55 A;  2FPK A;  3V72 A;  2BDP A;  4I28 A;  5D49 A;  2HHX A;  3NS1 A;  5AI9 A;  3HT3 A;  2OCE A;  3NRW A;  4UAV A;  4NL9 C;  1XSN A;  4F2R A;  3SR6 A;  3WK9 A;  5AKE A;  4YN4 A;  4GIB A;  3DDH A;  5DBB A;  4DFK A;  4B9N A;  4KLD A;  4MHV A;  3CP8 A;  1N5W A;  4IQW A;  1ZQ1 C;  1ZD5 A;  4Q43 A;  2OYY A;  3CRX A;  3SAG A;  2KIC A;  1IXR A;  3E2E A;  4GFJ A;  5AM1 A;  2EZY A;  5HML A;  4QZD A;  3PZP A;  3J81 j;  3MGI A;  4EBE A;  3NVZ A;  1SB3 C;  4QWA A;  3A0H U;  1HIW A;  3HKZ C;  4KLJ A;  4JWN A;  3PO5 A;  4ELU A;  2HVI A;  9ICH A;  2A1A A;  4OJL A;  4C4S A;  2XC9 A;  5CRX A;  9ICB A;  4QZA A;  4P0P B;  3EZ5 A;  2RDI A;  5ALL A;  5CHG A;  2KSO B;  3UMB A;  4RQ1 A;  5CWR A;  3AL0 B;  3BS7 A;  3TAR A;  5AKX A;  9ICF A;  4KLM A;  1N48 A;  3I1Y A;  2ZIV B;  4DSE A;  2V4R A;  1TKD A;  1OXJ A;  2LPE A;  2V9W A;  2W3S A;  4RUC A;  8ICF A;  1U47 A;  5HR6 A;  3RBD A;  3TAD C;  2ESE A;  1QQ5 A;  4MEX A;  3RRG A;  1WCN A;  4YXJ A;  1BGX T;  4Q8F A;  3K1Z A;  4C8K A;  1XS9 D;  7ICF A;  3MGV A;  5EWF A;  4R66 A;  1KDH A;  1SGG A;  1Z4N A;  3B0Y A;  4PL1 A;  4F4W A;  1SV0 A;  3SV4 A;  2KZZ A;  5AM3 A;  5IIO A;  2KP7 A;  2WAQ F;  4B9L A;  8ICE A;  4I2B A;  1BPX A;  1JAL A;  1V9P A;  1L8L A;  2F2A B;  2ALZ A;  2HBJ A;  2W43 A;  4K4I A;  4LVS A;  3AU2 A;  3JPN A;  4AP9 A;  5C5J A;  4IRC A;  2A19 A;  4FO6 A;  1L7N A;  2G07 A;  5DG7 A;  1ZQG A;  2MRL A;  3GV5 B;  1F5S A;  2KJ9 A;  3PX0 A;  1B22 A;  2L5Y A;  5AM2 A;  1AQ6 A;  4DF4 A;  4Y2T A;  5KFK A;  4DLG A;  4NM2 A;  2QAR B;  5DB6 A;  3F53 A;  2BQ3 A;  3H0L B;  4BWM A;  1X6J A;  4BWJ A;  1QCK A;  3KBB A;  2ZIU A;  4MF8 A;  2XVT A;  4DL4 A;  3GIJ A;  4O5K A;  5KFD A;  3PX6 A;  2W54 A;  1IG6 A;  8ICW A;  5J0T A;  3WK6 A;  4QZB A;  4DQP A;  1WUD A;  1BPZ A;  4ICA A;  2P6R A;  4Y2S A;  1K1S A;  3PR4 A;  3QEB Z;  1X42 A;  3Q8S B;  3OTQ A;  2DKZ A;  3MFH A;  1S0O A;  1D9D A;  2HW3 A;  1T3N A;  3RB3 A;  2H3V A;  1YZ6 A;  2Y0S F;  3SYZ A;  2XCA A;  3KZI U;  4C4R A;  1IIP A;  2NRZ A;  2W03 A;  4A8E A;  8ICM A;  4Y2X A;  4RZR A;  5J29 A;  1LV5 A;  4YVZ A;  3T5H A;  2NYV A;  3N28 A;  4ECU A;  9ICO A;  1X9W A;  9ICK A;  4R65 A;  4YQW A;  4DF8 A;  3AMZ A;  3KKA A;  2PFN A;  1JMS A;  2H3Z A;  2HMX A;  1UA0 A;  9ICU A;  3PW0 A;  4KX5 A;  3GDX A;  1T4G A;  1VJ5 A;  2CXY A;  1ZQV A;  2WF8 A;  2KJ8 A;  5ALJ A;  2KN7 A;  3H8W A;  2BDU A;  2C28 A;  2EAO A;  4PPX A;  4EBD A;  2KV2 A;  4EEL A;  1YT3 A;  5KFS A;  5EOZ A;  2XGQ A;  2RRD A;  2IA6 A;  4RQ4 A;  4P0P A;  1CEZ A;  2KFN A;  5J0R A;  2KSO A;  2YB1 A;  2K89 A;  5ALO A;  2YTU A;  4RQM A;  5KL1 B;  2PFO A;  5KT3 A;  3RH4 A;  2HBK A;  2ISP A;  4K4H A;  2ZIV A;  2CRX A;  4BGD A;  3UXO A;  1WCL A;  4J03 A;  1TVA A;  3MR6 A;  2G0A A;  3ETL A;  3KHG A;  5KFI A;  5ALY A;  2KEY A;  3RAQ A;  1LVH A;  4UB4 A;  2Z7J A;  5KFQ A;  2PKE A;  4RNO A;  4C7Z A;  5J2H A;  1X9S A;  1DRG A;  5IIN A;  1FO4 A;  3RJE A;  2NO4 A;  1UHU A;  3NVV A;  1RXV A;  5KG3 A;  3RFA A;  2DPI A;  3U26 A;  3BS5 B;  4DFJ A;  2H3Q A;  1EXN A;  4M04 A;  1T3Q A;  4DFM A;  4ED7 A;  3ZDD A;  3K1R B;  4QZ9 A;  4KLF A;  2MSN A;  4QZC A;  8ICB A;  3VCB A;  1ECW A;  2JEJ A;  4QIW C;  4FZL A;  2FPM A;  4Q8E A;  2XID A;  1ZQW A;  1SWW A;  3KHH A;  3HP6 A;  4ECY A;  4FZN A;  1TK5 A;  5KNI A;  1SXD A;  2QAR A;  2AH5 A;  4EX6 A;  4JWM A;  2W9C B;  1KRP A;  1F0M A;  5IIM A;  3HRD D;  3UXP A;  4F5Q A;  3MDC A;  7ICK A;  3HPO A;  5D46 A;  3BDP A;  2Q4T A;  4P0Q B;  5DLG A;  3GV7 B;  2K8A A;  3LYS A;  3PSI A;  1C20 A;  1N5X A;  2JEI A;  1KFT A;  3Q8P B;  3IM1 A;  1UT5 A;  8ICQ A;  1C7Y A;  3NAS A;  3O0F A;  3M9M B;  1N56 A;  3SI8 A;  4ED1 A;  1ZQT A;  2R8J A;  5L1I A;  2E8P A;  1ARO P;  2C2E A;  3PY8 A;  2W7P A;  3N97 B;  2NRX A;  5GTH U;  3FYH A;  3WU2 U;  2R8I A;  1X66 A;  1QSY A;  5KFF A;  3Q8R B;  5DB8 A;  4KN4 A;  5KG7 A;  5J8Y A;  3RR8 A;  4DFD A;  5L1M A;  3QU4 A;  2AQ0 A;  3IRU A;  3QUB A;  4DLE A;  1KBU A;  2JRZ A;  5ALU A;  5DGA A;  3OSN A;  4AYB C;  1NK5 A;  4F4X A;  5DQH A;  4TUR A;  4YR3 A;  4DQS A;  2HHU A;  2WB1 F;  4UB5 A;  5J0Y A;  5TIS U;  5AI0 A;  4IC9 A;  2NRW A;  1NZP A;  1NJZ A;  4YXM A;  3MAB A;  5AK5 A;  5FP0 A;  2JMG A;  2H3F A;  4P2H A;  4QNL A;  5DBA A;  1ZET A;  4NL9 A;  3LK9 A;  2G5I B;  4F4Y A;  2F3N A;  4CNQ A;  4O3Q A;  1CUK A;  4FS1 A;  4PZN A;  1TAM A;  2HOI A;  3UM9 A;  3QZ8 A;  3H0R B;  4BJQ A;  4EYH B;  2GOL A;  9ICL A;  1NKC A;  2Y1I A;  3T79 A;  2ATL A;  3DV9 A;  1Z4O A;  1A0P A;  3H8S A;  2IOH A;  4O0I A;  2VAN A;  5KG1 A;  4R64 A;  4RPX A;  3ORY A;  2RDJ A;  1WWV A;  3BZC A;  5ALD A;  2ZUC A;  1NOM A;  2EAP A;  2PMZ F;  2Y9T A;  3L3F X;  1O03 A;  4M9J A;  4KLH A;  4KLE A;  8ICU A;  3I28 A;  3JPO A;  3IDW A;  2K4I A;  2I9G A;  3QE9 Y;  3BS5 A;  4F5P A;  4PL2 A;  1UCV A;  1F44 A;  4Y2Y A;  4IQU A;  2FJ6 A;  2KJ5 A;  2DQN B;  1SWV A;  4NLN A;  3MFI A;  2ZUD A;  4IL6 U;  1SKS A;  2VA3 A;  3TFR A;  1X9X A;  1UPH A;  4RU9 A;  4JV2 A;  3ZI4 A;  4QZG A;  2W9B B;  3Q8Q B;  8ICL A;  1PVP A;  2F1I A;  1NK9 A;  4RQ8 A;  2FI1 A;  5AKK A;  5ALK A;  4BUG A;  2LYH A;  8ICA A;  1MA7 A;  8ICT A;  2R8K A;  4P0Q A;  3WK8 A;  5JTI A;  3F2D A;  2DUY A;  1RG6 A;  2M9N A;  5DGB A;  1ZD2 P;  3PR5 B;  2W7O A;  3RB6 A;  2E1F A;  4I2E A;  2OXO A;  1BPB A;  4Q45 A;  2HOQ A;  4KLQ A;  2BHN A;  5J2G A;  4ECZ A;  4YD2 A;  3QXG A;  2BPC A;  3LDA A;  5DB7 A;  5ALV A;  5KFN A;  3M1Y A;  4YD1 A;  1VDV A;  2R18 A;  2PFP A;  4EZ6 A;  2DBY A;  3BJY A;  1Q46 A;  5C0Y A;  3WKC A;  1Q8K A;  4NLC A;  4RNM A;  3JPR A;  1ZQZ A;  1ZJM A;  2C2R A;  1U49 A;  4DS5 A;  5KAI U;  1CI4 A;  3OJU A;  5BOL A;  2FLP A;  4F92 B;  4TUP A;  4IRK A;  2R8G A;  4QJF B;  3M9N B;  4DOA A;  4I2J A;  1ZQN A;  3PSP A;  5AKL A;  4UW9 A;  3D2N A;  4DOC A;  2DL0 A;  2RLT A;  4UAW A;  2Y0S C;  5DLF A;  5ALT A;  4C80 A;  4DQI A;  2KE7 A;  4RPY A;  4IR9 A;  3WKE A;  1DOQ A;  3RJJ A;  3FC4 A;  3HX0 A;  1U45 A;  2KZM A;  3ISD A;  4KLO A;  5ALP A;  5EE1 A;  2GWS A;  3N7S C;  3ISB A;  1JXE A;  8ICZ A;  5HR7 A;  3NTU A;  3GIK A;  3HIL A;  1S76 D;  8ICI A;  4PGX A;  9ICC A;  5J0Q A;  1XSP A;  2K8C B;  5KT4 A;  3MR3 A;  5KFL A;  4GLX A;  4C8O A;  3OGU A;  3C1Y A;  9ICV A;  2BCR A;  3QNM A;  2QLT A;  4GXI A;  2KD1 A;  1ZQR A;  2W9A A;  1QQ6 A;  2J6T A;  5KFW A;  5KFO A;  4EYI B;  2K4H A;  3SAH A;  4RQ7 A;  2HDO A;  5IIL A;  2BZF A;  4ECQ A;  1ED1 A;  1V97 A;  5AIB A;  2D8C A;  9ICW A;  2EZZ A;  2V4Q A;  1L7P A;  4Z6C A;  4RQ3 A;  1PZN A;  3HJE A;  4DFP A;  2W9B A;  4KLU A;  1N61 A;  9ICI A;  1SL0 A;  4OJ5 A;  4Q44 A;  1Z3E B;  1A6S A;  5J2C A;  2QB1 A;  2FMS A;  3PSF A;  3OJS A;  4CE6 A;  5EE0 A;  4M9G A;  3GV8 B;  3D2S A;  1PK1 B;  1B4F A;  3H4B A;  4OCZ A;  5E79 U;  8ICV A;  3GIM A;  4NJ8 A;  4B9V A;  2JGA A;  3G6Y A;  5CJ7 A;  4I27 A;  2JHD A;  4US8 A;  3LWM A;  1ZQO A;  4YP3 A;  3SQI A;  1NK6 A;  5HNK A;  4M2Y A;  1MC8 A;  2FMP A;  4Y2V A;  1S77 D;  5KT2 A;  2W8L A;  4UB3 A;  2HOF A;  9ICE A;  3WK7 A;  4TQR A;  4ECR A;  4OJ6 A;  2F8K A;  1QQ7 A;  4UBC A;  4G9B A;  5DQI A;  4O5C A;  2JEG A;  3TAN A;  5KFA A;  3RAX A;  4YCX A;  2ZJ8 A;  4F5N A;  1P7D A;  9ICN A;  2YMM A;  4YR2 A;  3QUQ A;  2G08 A;  5AIC A;  4KLI A;  3M7D A;  4JV1 A;  4Y2Q A;  2XGP A;  1ZYQ A;  4I2H A;  7ICS A;  1IM4 A;  1HJP A;  3QU9 A;  3BQ1 A;  3AUO A;  1SZH A;  4DL6 A;  3GU3 A;  2E8M A;  1ZQE A;  3AM9 A;  2F44 A;  1KLN A;  2F77 X;  3AEV A;  5IIJ A;  5KG5 A;  1L3T A;  2QKQ A;  3BZK A;  4PGQ A;  1JX4 A;  4P4O A;  7ICI A;  3NVY A;  2W8K A;  5AKZ A;  5ALX A;  1BPE A;  1DGS A;  3KFU F;  4JK1 A;  2BKE A;  3PST A;  3QU7 A;  2FE9 A;  4J9N A;  5KFC A;  4I2G A;  9ICA A;  3EPG A;  4HAI A;  2RHF A;  4IQT A;  3QZ7 A;  1TAU A;  2ISO A;  4M6W B;  3V7J A;  5H2F U;  4OJO A;  4UB2 A;  3HKZ F;  1RM6 C;  3KHR A;  2BPF A;  3PV8 A;  3QUC A;  4PGY A;  4DEZ A;  4QW9 A;  4YG2 A;  9ICQ A;  2I1Q A;  2M0N A;  3G6X A;  3K75 D;  4CF3 A;  1DXS A;  3MR5 A;  2R8H A;  4QWD A;  2W3R A;  5B5E U;  2E1E A;  2EZX A;  4CF5 A;  4F50 A;  4UB1 A;  1L6N A;  4J9O A;  3KD3 A;  4KN7 A;  3WK4 A;  3JPP A;  4ED2 A;  3QU5 A;  1UQV A;  2BCS A;  4ELT A;  2I5H A;  2A1J B;  3KTQ A;  2WTF A;  1SKW A;  1N2X A;  3PW2 A;  4RNN A;  4GXK A;  4YMO A;  2Q0Z X;  4F3O A;  4O9M A;  1XWL A;  5KFY A;  4C8L A;  2YQE A;  7ICQ A;  4ECX A;  4XRH A;  1MN8 A;  5AI5 A;  2WFA A;  1BNO A;  1S0N A;  8ICO A;  2K4P A;  2F8L A;  5KAF U;  1ZD3 A;  3EW9 A;  3WKA A;  3QYP A;  3QX7 A;  1ZQL A;  1RYU A;  5AKH A;  3TAC B;  2PFQ A;  8ICC A;  2EAM A;  4CDG A;  7ICM A;  2HHT A;  5ALE A;  3T5L A;  1SV0 C;  2KZ3 A;  1PK1 A;  1Z1B A;  3PO4 A;  4O3S A;  1A77 A;  5AK4 A;  1N62 A;  1JXL A;  2WF6 A;  3A0B U;  5AK6 A;  4QZ8 A;  1NJW A;  4YFK A;  3JPQ A;  3MC1 A;  2HHQ A;  1ZQQ A;  5L1L A;  4DL5 A;  4ECV A;  1T8E A;  3NUQ A;  8ICG A;  1PK3 A;  3PNC A;  2ZXI A;  4QZI A;  4UAR A;  1L3V A;  2IMW P;  2UVW A;  4FFD A;  3JPS A;  5K4L A;  2KHQ A;  2IOF A;  4TUS A;  2BCV A;  3EPI A;  3HWT A;  2JR5 A;  5L9X A;  1SV4 A;  1YZ7 A;  1UA1 A;  4QZE A;  2MU2 A;  5J2J A;  3QUT A;  3ZD8 A;  1KEJ A;  2NRT A;  5AKI A;  2F1H A;  5ALN A;  4MF2 A;  3ZDB A;  2AJQ A;  1JI7 A;  1Y88 A;  2VKQ A;  2Y9U A;  4ELV A;  2AU0 A;  1L8O A;  1ZXI A;  1L7M A;  4ZOH C;  4UAU A;  3TFS A;  2KG5 A;  3TKA A;  4GC6 A;  5KFH A;  1N63 A;  2JV3 A;  1WWU A;  1J97 A;  1VLB A;  2IOF K;  5ALM A;  1D8Y A;  7ICG A;  1KFS A;  5GTI U;  8ICR A;  1XNS A;  4F93 B;  1RYR A;  1XO0 A;  5III A;  2OWO A;  4R8U B;  1N60 A;  1QH9 A;  2JH1 A;  4M6W A;  4F4Z A;  8ICX A;  3T5K A;  3L4P A;  3SAF A;  3RTV A;  4JV0 A;  1QSL A;  3KKA C;  2BCU A;  4JB3 A;  4F72 A;  2ZTC A;  3D6J A;  1K5O A;  1Z1V A;  5J2F A;  5J0X A;  1KSP A;  1RDF A;  2CPR A;  3SEI A;  2MA1 A;  3M8R A;  1JUD A;  2XI9 A;  5J0W A;  4LJX A;  4BDP A;  3PVX A;  1WYG A;  4US9 A;  4F2S A;  5J2I A;  4G3I A;  2YMQ A;  3F2C A;  1KKX A;  3ZDE A;  2JEF A;  1QLN A;  4UB6 U;  4YR0 A;  4FBT A;  4M9N A;  2MUT B;  5AI4 A;  2A1J A;  1ZQH A;  3G6V A;  3NVW A;  4I2D A;  4J9M A;  3D2Q A;  2ES6 A;  1KL9 A;  4F71 A;  5J2B A;  4ED0 A;  4RT2 A;  3QU2 A;  3WKD A;  2DGZ A;  4YMN A;  2ODG A;  3MDA A;  3N7R C;  1BPD A;  2H5X A;  3S6J A;  1PUZ A;  3THV A;  2G09 A;  2PI5 A;  4Y2J A;  4U7C A;  2ASJ A;  2FPL A;  4F5R A;  2GLE A;  2QB0 B;  2ZJA A;  5CB1 A;  2HBM A;  2IHM A;  3RF9 A;  8ICN A;  4QIW F;  2VA2 A;  1L3U A;  3FM9 A;  1RZT A;  3TAD A;  2BPG A;  5EE3 A;  2KIW A;  5KFZ A;  5KFM A;  3EWA A;  1JN3 A;  3M8S A;  1ZQB A;  5KFT A;  1URJ A;  1KFD A;  3Q8M A;  2P66 A;  2C2D A;  4QZF A;  1OUQ A;  1FFU A;  2F1J A;  2J6S A;  4C8M A;  2WF9 A;  2D6F C;  2EAN A;  4DSF A;  4OD0 A;  2ZIX B;  4CF4 A;  5KG2 A;  3RJF A;  4M47 A;  3VC8 A;  1JRP A;  3RH5 A;  1PVQ A;  1SL1 A;  2JZB B;  3SV3 A;  4NXZ A;  2WAQ C;  4P4P A;  1S10 A;  3ETR A;  5HHI A;  4ECT A;  4Y2U A;  4UAT A;  4ED3 A;  2G06 A;  4PZO A;  3OHA A;  3JPT A;  3MR2 A;  1FFV A;  4NY8 A;  2C22 A;  3V6H A;  4DL3 A;  1TV9 A;  1LB2 B;  5A0L A;  5F9L A;  4LZD A;  2P35 A;  1T94 A;  4UAY A;  5J0S A;  4KLT A;  3C2M A;  5J0U A;  1K1Q A;  5DKW A;  4IQV A;  1BNP A;  4Y2P A;  3F5E A;  2XO7 A;  5D4B A;  3V6K A;  1QTM A;  1LKY B;  2AGO A;  3AQF A;  5F9N A;  4OO1 J;  4PHD A;  3ISC A;  1RQL A;  4PHP A;  4JMU A;  1HEK A;  1FIQ A;  4AYB F;  5J8Y C;  1NI3 A;  3OHB A;  2YB4 A;  4ECW A;  4DL2 A;  4CGZ A;  2IBK A;  1S9F A;  4PHE A;  4IR1 A;  5CA7 A;  4R8U A;  3F5A A;  4DO9 A;  7ICR A;  3EUB 2;  3ALR A;  2HHW A;  4C4T A;  4O5E A;  1X6I A;  3BQ0 A;  3RR7 A;  2ZIW B;  3OPX A;  5DG8 A;  1TE2 A;  3UQ2 A;  1ZQK A;  2OH2 A;  8ICS A;  5HP4 A;  5J2E A;  3LVW A;  5KT7 A;  3C23 A;  3IV6 A;  3AU6 A;  2P6U A;  3B9J A;  1ZD4 A;  4LZG A;  2AGQ A;  4EBC A;  2ZTE A;  3ZDA A;  2HBL A;  4RT3 A;  4Z6F A;  3C2L A;  4GC7 A;  3BQ2 A;  3B0X A;  2EDU A;  3RJI A;  2MUT A;  5ALH A;  1S8O A;  3UXN A;  2ASD A;  1KN5 A;  1ZQU A;  1NK7 A;  4Z6E A;  4FS2 A;  1SXE A;  5CR0 A;  1TK0 A;  7ICP A;  2LM1 A;  2VJ4 A;  5IIK A;  2XY7 A;  3Q8L A;  2LI6 A;  1T7P A;  1D8L A;  3ICX A;  4EEN A;  2A3V A;  4UAS A;  2JH7 A;  5AKG A;  2B6G A;  2KMD A;  4RQN A;  1ZJN A;  2QB0 A;  2ZG6 A;  2HI0 A;  4PHA A;  5J2A A;  2E8O A;  4UAZ A;  1MQ3 A;  4B9S A;  1ZQJ A;  4IS7 A;  5AK3 A;  1JRO A;  3TAQ A;  1Q3V A;  1DK3 A;  3C29 A;  3UQ0 A;  4MFF A;  2ZTD A;  3PW4 A;  4NV0 A;  4DQQ A;  5KT6 A;  1U48 A;  2XCP A;  4GXJ A;  1XC9 A;  2KVC A;  4U6P A;  2K4E A;  3E0F A;  4M9L A;  4KTQ A;  1S5L U;  1NK4 A;  2ZIX A;  1DGJ A;  5J0P A;  5L1K A;  3E58 A;  2DFL A;  1S97 A;  4DL7 A;  1J2N A;  3BQT A;  4QZH A;  2ZJ5 A;  3ZD9 A;  4ED8 A;  1M6Y A;  4KMU A;  2JZB A;  2KIV A;  4PH5 A;  9ICJ A;  2FLN A;  5KFR A;  4CRX A;  2KNJ A;  4KIT B;  5B66 U;  5KG0 A;  3UMG A;  5ALS A;  4I29 A;  2KKP A;  2VA8 A;  3OSP A;  2AQ4 A;  4RQ2 A;  2YN4 A;  4QWC A;  1TFR A;  2YX8 A;  1GO3 F;  3RB4 A;  3H0M B;  5EWG A;  2WHE A;  7ICO A;  2LM4 A;  2LYA A;  4USA A;  2E3T A;  4O3P A;  4B9T A;  4ACO A;  2B21 A;  1LKY A;  4CCH A;  3KHL A;  4B9U A;  4J9K A;  3C28 A;  1ZQI A;  1ZQY A;  1NK0 A;  4Y2R A;  4UQG A;  2DPJ A;  7ICL A;  3KOO A;  2LKY A;  1U9L A;  3N4M B;  4I2F A;  1QSS A;  7ICV A;  1MQ2 A;  2EQY A;  3F2B A;  3C1Z A;  5ALG A;  8ICK A;  1L7O A;  2KVS A;  1ZQA A;  2AHO B;  3GIL A;  2BQR A;  5L1J A;  7ICN A;  4QW8 A;  4KMO B;  4HYK A;  2UVR A;  5EWE A;  2ZIW A;  5F3X B;  2G5H B;  5DQG A;  3C5G A;  4DQR A;  3DEE A;  2W11 A;  3SD7 A;  3V6J A;  4NLG A;  1KTQ A;  2KTQ A;  3IP4 B;  8ICY A;  1ZRN A;  1UT8 A;  5DDM A;  1PVR A;  5JU5 A;  3RBE A;  3RJG A;  3PMN A;  2ZUB A;  5ALI A;  1RQN A;  2DF4 B;  5KG4 A;  1DK2 A;  9ICR A;  2H3I A;  4Z6D A;  2WB1 C;  3RRH A;  3SZ2 A;  4EZ9 A;  4NLZ A;  3UMC A;  5AIA A;  2HVH A;  2AGP A;  4FBU A;  1S0V A;  5AM4 A;  3PX4 A;  3M6K A;  3H40 A;  4DSL A;  5AI6 A;  2J6U A;  4O3R A;  1V38 A;  3T5J A;  2CN1 A;  4RQ0 A;  4KLS A;  3FAH A;  3TQ1 A;  3HW8 A;  3GQC A;  3RB0 A;  4MFA A;  1SZP A;  1ZRM A;  1ZOL A;  1ZQD A;  3H4D A;  4RQ5 A;  5J2D A;  2B0C A;  1U4B A;  3IHQ B;  5AM0 A;  4UBB A;  2VJ5 A;  3N7P D;  2IHN A;  5JUM A;  4DCC A;  1ZQX A;  5KFP A;  1XU4 A;  2RP5 A;  4MEY A;  4ZH4 A;  4KX3 A;  2LYB A;  5AKJ A;  1X40 A;  4QWB A;  2PMZ C;  1ZQP A;  4J9S A;  5G5G A;  4XQ8 A;  3BQ7 A;  5ALZ A;  4EX7 A;  1FEZ A;  3ED5 A;  9ICX A;  1Z00 B;  1JIH A;  4BXO B;  5ALR A;  4DWI A;  5KFB A;  2OHF A;  3V7L A;  9ICT A;  2ASL A;  4F5O A;  5DG9 A;  2K8B B;  1D8B A;  1H38 A;  2K60 A;  1L3S A;  4M9H A;  4E0D A;  4DSI A;  3H8J A;  4PJ0 U;  5AHX A;  4ECS A;  3C21 A;  2KOB A;  5J0O A;  1NZB A;  2FMQ A;  4F91 B;  3L5K A;  1Z19 A;  5KTQ A;  2E8N A;  1V85 A;  2KHV A;  1NK8 A;  8ICH A;  3C2K A;  4J9R A;  1ZQM A;  3NGD A;  4OJP A;  1XSL A;  2HHS A;  3TI0 A;  5HMM A;  2W9M A;  3IG5 A;  4B6J A;  1RXW A;  9ICP A;  9ICS A;  5AM5 A;  1HUZ A;  3NRZ A;  9ICG A;  4ED6 A;  2NRV A;  5KG6 A;  3ZDC A;  2LHT A;  5J2K A;  1J2M A;  3EYZ A;  4WJ3 B;  4F4K A;  2FLL A;  2YML A;  3UPQ A;  4RUA A;  2KKV A;  3LWL A;  3AN1 A;  4IRD A;  4O3N A;  5KFU A;  2D3D A;  3IN5 A;  4KLL A;  4J9P A;  5AKY A;  5DBC A;  5KL8 B;  2BR0 A;  2EH9 A;  2JXJ A;  1NKB A;  3TAP A;  3SEN A;  4R63 A;  1BVS A;  3K4G A;  1OW5 A;  2GO7 A;  5T14 A;  3H7I A;  1NKE A;  5JRT A;  5TZV A;  3RJH A;  1NJX A;  1RPL A;  3FDS A;  4K4G A;  2WF5 A;  1L5U A;  5EE9 A;  1D9F A;  1B43 A;  2UVV A;  2DKX A;  2N1R A;  1RYS A;  4DSJ A;  4P4M A;  3SMV A;  5KFG A;  1ZQC A;  4I2C A;  2XIC A;  5BPC A;  1NJY A;  3WK5 A;  2RQ5 A;  4EEK A;  1ZQS A;  3LVV A;  5KFJ A;  5ALF A;  1KW4 A;  1MSW D;  1SKR A;  4NM1 A;  5G5H A;  4O3O A;  4X5V A;  4F8R A;  5ALQ A;  2OEH A;  1O08 A;  2HCF A;  4MFC A;  4M0A A;  3KZX A;  1A76 A;  5KT5 A;  2NO5 A;  4FZM A;  7ICE A;  7ICT A;  1B0X A;  2WF7 A;  3R9K A;  4NLB A;  3Q8K A;  2I6X A;  2UVU A;  7ICH A;  4XA5 A;  3RJK A;  4FE3 A;  1WG8 A;  4C0Z A;  9ICM A;  2LMR A;  2FDR A;  4I2A A;  1Z00 A;  4BXO A;  5KFX A;  4JUZ A;  1SL2 A;  4KLG A;  2HHV A;  4J9Q A;  4DS4 A;  1HUO A;  1X2I A;  2VIX A;  2Y1J A;  3V7K A;  4O3M A;  2PXI A;  2OM6 A;  2O6K A;  2F76 X;  2YY6 A;  3M9O B;  3C5F A;  3CNH A;  3AQE A;  3CW2 C;  2KK0 A;  2W9C A;  3WKB A;  2BCQ A;  3GII A;  1IV8 A;  5DDY A;  3CYM A;  5KFV A;  4I2I A;  5HHH A;  2KFZ A;  2XY6 A;  2GH1 A;  5KFE A;  2BGW A;  4DOB A;  5ALW A;  3M6Z A;  1NNL A;  4XUS A;  4TUQ A;  2AXT U;  2HSZ A;  1Q3U A;  2NV3 A;  3I76 A;  4C8N A;  2W04 A;  3PML A;  2E5S A;  3RH6 A;  5CP2 A;  1XO1 A;  7ICU A;  8ICP A;  4BX9 C;  3MGH A;  3MBY A; 
#chains in the Genus database with same CATH homology
 2BCS A;  1NZP A;  5BOM A;  4QZH A;  4RQ6 A;  4GXK A;  4NLK A;  7ICJ A;  4PH5 A;  9ICJ A;  4YMO A;  4P2H A;  8ICJ A;  4O9M A;  5DBA A;  7ICQ A;  3LK9 A;  1ZQF A;  4I29 A;  1BNO A;  4YMM A;  8ICO A;  4RQ2 A;  5DB9 A;  1ZQL A;  9ICL A;  2PFQ A;  8ICC A;  1BPY A;  7ICO A;  7ICM A;  4RPZ A;  3V72 A;  4R64 A;  1ZQI A;  4I28 A;  4RPX A;  5D49 A;  7ICL A;  4QZ8 A;  1XSN A;  4I2F A;  7ICV A;  1MQ2 A;  3JPQ A;  4YN4 A;  8ICK A;  1ZQA A;  4M9J A;  1ZQQ A;  5DBB A;  4KLH A;  4KLE A;  8ICU A;  7ICN A;  3JPO A;  4KLD A;  2I9G A;  4IQW A;  4F5P A;  8ICG A;  3PNC A;  4QZI A;  4IQU A;  3C5G A;  4QZD A;  3JPS A;  3MGI A;  4TUS A;  4NLN A;  2BCV A;  4KLJ A;  4JWN A;  3HWT A;  3TFR A;  9ICH A;  9ICB A;  8ICY A;  4QZG A;  4QZA A;  4QZE A;  5J2J A;  1KEJ A;  8ICL A;  3RJG A;  4MF2 A;  4RQ1 A;  5CWR A;  3PMN A;  4RQ8 A;  9ICF A;  1DK2 A;  9ICR A;  4KLM A;  4Z6D A;  3TFS A;  8ICA A;  8ICT A;  4NLZ A;  8ICF A;  7ICG A;  8ICR A;  7ICF A;  5III A;  4R66 A;  4I2E A;  1KDH A;  3B0Y A;  4RQ0 A;  8ICX A;  4KLS A;  3HW8 A;  5IIO A;  2KP7 A;  4KLQ A;  4MFA A;  8ICE A;  4I2B A;  1BPX A;  5J2G A;  2BCU A;  4YD2 A;  5DB7 A;  4K4I A;  4LVS A;  1ZQD A;  3AU2 A;  3JPN A;  5J2F A;  5J0X A;  4FO6 A;  4RQ5 A;  4YD1 A;  5J2D A;  1ZQG A;  2PFP A;  5J0W A;  4UBB A;  3JPR A;  1ZJM A;  5J2I A;  4NM2 A;  5DB6 A;  1ZQP A;  5BOL A;  4M9N A;  4MF8 A;  4O5K A;  4TUP A;  1ZQH A;  4DOA A;  9ICX A;  4I2J A;  4I2D A;  1ZQN A;  8ICW A;  5J0T A;  4DOC A;  4QZB A;  4UAW A;  3V7L A;  9ICT A;  5J2B A;  1BPZ A;  4RT2 A;  4YMN A;  4F5O A;  3MDA A;  4RPY A;  1BPD A;  4M9H A;  3RJJ A;  3HX0 A;  5J0O A;  3ISD A;  4KLO A;  4F5R A;  2FMQ A;  5CB1 A;  2IHM A;  2GWS A;  3ISB A;  8ICN A;  8ICM A;  8ICZ A;  8ICH A;  3C2K A;  1RZT A;  2BPG A;  1ZQM A;  8ICI A;  1XSL A;  4PGX A;  9ICC A;  5J0Q A;  2W9M A;  1XSP A;  1ZQB A;  5J29 A;  9ICO A;  3OGU A;  2P66 A;  4QZF A;  9ICK A;  9ICP A;  9ICV A;  9ICS A;  4R65 A;  2BCR A;  1HUZ A;  4GXI A;  2PFN A;  9ICG A;  1JMS A;  1ZQR A;  3RJF A;  9ICU A;  4M47 A;  5J2K A;  3RH5 A;  4RQ7 A;  3GDX A;  5IIL A;  4NXZ A;  5HHI A;  3UPQ A;  4PPX A;  3JPT A;  9ICW A;  4NY8 A;  5EOZ A;  1TV9 A;  4KLL A;  5DBC A;  4Z6C A;  4LZD A;  4RQ3 A;  4RQ4 A;  4R63 A;  4UAY A;  5J0S A;  4KLU A;  5J0R A;  4KLT A;  9ICI A;  3C2M A;  5J0U A;  5DKW A;  4IQV A;  5TZV A;  1BNP A;  5J2C A;  3RJH A;  2PFO A;  3RH4 A;  2FMS A;  5D4B A;  4K4G A;  4M9G A;  2ISP A;  4K4H A;  3UXO A;  8ICV A;  4PHD A;  1TVA A;  3ISC A;  4PHP A;  4I27 A;  4UB4 A;  1ZQO A;  5J2H A;  4M2Y A;  2FMP A;  1ZQC A;  4I2C A;  5IIN A;  4PHE A;  5BPC A;  3RJE A;  4UB3 A;  4DO9 A;  7ICR A;  1ZQS A;  9ICE A;  4O5E A;  4UBC A;  4NM1 A;  4M04 A;  4X5V A;  1ZQK A;  3UQ2 A;  4O5C A;  4QZ9 A;  8ICS A;  4YCX A;  4KLF A;  5J2E A;  4F5N A;  4QZC A;  4MFC A;  8ICB A;  4M0A A;  3AU6 A;  9ICN A;  4LZG A;  4KLI A;  7ICE A;  4I2H A;  4RT3 A;  7ICS A;  7ICT A;  4Z6F A;  4JWM A;  3C2L A;  3B0X A;  5IIM A;  3AUO A;  3UXP A;  4F5Q A;  3RJI A;  3MDC A;  7ICK A;  7ICH A;  4XA5 A;  1ZQE A;  3UXN A;  5D46 A;  5IIJ A;  3RJK A;  4PGQ A;  7ICI A;  9ICM A;  4Z6E A;  4I2A A;  7ICP A;  1BPE A;  5IIK A;  4KLG A;  4I2G A;  9ICA A;  8ICQ A;  1HUO A;  4IQT A;  3V7K A;  2ISO A;  2PXI A;  3V7J A;  1ZQT A;  3C5F A;  1ZJN A;  2BCQ A;  4UB2 A;  4PHA A;  5J2A A;  5DDY A;  2BPF A;  4I2I A;  5HHH A;  5DB8 A;  4PGY A;  4UAZ A;  1MQ3 A;  1ZQJ A;  9ICQ A;  4DOB A;  4MFF A;  1DK3 A;  3UQ0 A;  4XUS A;  4TUQ A;  3PML A;  4GXJ A;  3RH6 A;  4UB1 A;  7ICU A;  8ICP A;  4M9L A;  3JPP A;  4TUR A;  4UB5 A;  5J0Y A;  3MGH A;  5J0P A;  3MBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...