2KP7A

Solution nmr structure of the mus81 n-terminal hhh. northeast structural genomics consortium target mmt1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
80
structure length
80
Chain Sequence
RPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Crossover junction endonuclease MUS81
publication title Solution NMR structure and DNA binding mode of the Mus81 n-terminal helix-hairpin-helix domain
rcsb
source organism Mus musculus
total genus 25
structure length 80
sequence length 80
ec nomenclature ec 3.1.22.-:
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2kp7A01
3ISDA 4M0AA 5DBCA 1ZQEA 4Z6DA 4F5RA 4QZEA 4QZBA 1XSLA 4M9NA 4PGXA 3JPRA 4RPYA 8ICWA 9ICVA 9ICFA 5EOZA 2BCVA 4QZIA 5IIMA 9ICUA 5DKWA 4I2HA 4O5CA 9ICRA 3V7KA 5J2KA 2BCUA 5DB9A 5J2JA 5DB7A 8ICSA 4PHDA 4R63A 3RJGA 4KLMA 4QZAA 4O5KA 7ICFA 4IQUA 4LZGA 4O5EA 8ICZA 5J0RA 4NY8A 5CWRA 4I2AA 1BPEA 4RQ5A 4RQ6A 3JPOA 4NXZA 3RJKA 1ZQSA 8ICMA 9ICTA 1DK3A 3RJHA 4RT2A 4KLDA 4PGYA 5J0YA 5J0OA 4NM1A 8ICKA 3MBYA 7ICHA 3RH5A 3JPPA 4XUSA 2I9GA 4X5VA 2BCSA 4NM2A 4QZFA 4RQ8A 9ICMA 5IIOA 1ZQJA 4I2EA 4M9HA 7ICTA 4IQTA 2GWSA 1ZQGA 4F5OA 4RQ2A 4DOCA 4M9GA 4KLGA 5J0PA 9ICAA 5IIIA 8ICLA 4Z6EA 4DO9A 5J0QA 4RQ4A 8ICNA 8ICJA 9ICLA 3RJEA 4JWMA 4UAYA 8ICVA 5DBBA 7ICPA 4M9LA 2FMPA 4PGQA 4DOBA 2FMQA 5J2DA 8ICAA 2PFNA 5D49A 4RPXA 1DK2A 3JPTA 4IQVA 4K4GA 8ICOA 4R66A 4IQWA 1ZQHA 8ICCA 1ZQFA 4I2IA 8ICHA 5J2BA 4KLJA 9ICJA 4Z6FA 4M47A 2PFQA 4QZCA 7ICEA 4UB4A 1ZQPA 3PMNA 4F5NA 3HX0A 5DDYA 4KLOA 3AU6A 7ICIA 3AUOA 5IINA 2IHMA 1ZQOA 1TV9A 5IILA 7ICNA 3RH4A 4RT3A 1BPZA 9ICXA 8ICIA 4YCXA 5J2IA 9ICKA 4RQ3A 9ICIA 1MQ2A 1XSNA 1HUZA 4PHPA 9ICOA 5DB6A 3B0XA 5J2CA 4RQ7A 8ICUA 4YN4A 4UB3A 1ZQAA 8ICYA 4K4IA 4R64A 9ICPA 5J0XA 4RQ1A 4GXJA 4NLKA 4UBBA 8ICPA 5DB8A 4I2BA 9ICCA 1BPYA 9ICQA 3V7JA 4KLUA 4NLZA 3OGUA 2BCRA 5IIKA 3PNCA 4FO6A 4UAZA 4M2YA 9ICHA 4QZ8A 3PMLA 4TUQA 4GXKA 4YD1A 4KLQA 9ICGA 4YD2A 3C2LA 3UPQA 1ZQBA 3V7LA 5J0SA 4F5PA 4UB1A 1BNPA 5BOLA 4QZDA 3MDAA 3UXOA 7ICRA 2ISPA 7ICGA 1ZQDA 4JWNA 5D46A 1BPDA 1BPXA 1ZQQA 5J0UA 4LZDA 9ICEA 3RJIA 3TFSA 5BPCA 7ICMA 5J2FA 4NLNA 9ICNA 1HUOA 1ZQKA 1ZQNA 1ZQLA 2PFOA 7ICJA 4I27A 2BCQA 4I29A 4PPXA 3MGHA 4RQ0A 4YMMA 5HHHA 2PXIA 7ICSA 4GXIA 2BPFA 4KLTA 8ICGA 7ICVA 7ICQA 3RH6A 9ICSA 5J2EA 8ICBA 3JPSA 4UB5A 4TUPA 5BOMA 4UBCA 5J0WA 1ZQRA 9ICWA 3C5FA 4KLIA 1KEJA 3MDCA 2W9MA 3RJFA 4DOAA 3JPNA 4QZGA 3C5GA 3GDXA 4MFAA 5J2AA 4UAWA 3TFRA 4M04A 5HHIA 1ZJMA 4QZHA 1RZTA 2KP7A 4MFFA 4KLSA 4XA5A 4R65A 3HWTA 4M9JA 7ICUA 1MQ3A 3HW8A 4MF8A 5J2GA 1NZPA 4KLHA 3B0YA 1ZJNA 4K4HA 4UB2A 3UQ2A 4YMOA 4I2JA 3UXNA 3RJJA 4KLLA 5J2HA 2PFPA 1ZQMA 4I2DA 3LK9A 4F5QA 1XSPA 4YMNA 4Z6CA 2ISOA 4MF2A 8ICXA 5CB1A 5DBAA 4RPZA 4O9MA 7ICKA 4MFCA 2BPGA 9ICBA 4I2CA 1ZQCA 8ICEA 8ICRA 3JPQA 5D4BA 4I2GA 1ZQIA 3AU2A 3V72A 1TVAA 2P66A 3UXPA 1JMSA 4TUSA 3C2KA 4PHAA 4PHEA 3C2MA 4I28A 4KLEA 4QZ9A 5J29A 4LVSA 8ICTA 3MGIA 3UQ0A 8ICFA 1ZQTA 3ISCA 7ICLA 2FMSA 4P2HA 3ISBA 5IIJA 8ICQA 5J0TA 4KLFA 4TURA 4PH5A 5TZVA 7ICOA 4I2FA 1BNOA 1KDHA
chains in the Genus database with same CATH superfamily
2C22A 2H3QA 3ISDA 2UVRA 4JUZA 4NLGA 1ZQEA 1NK4A 4YFKA 4ECVA 5KT6A 4JK1A 1TAMA 4UAVA 4DFPA 2LYBA 1SL1A 8ICWA 9ICFA 5EOZA 2OEHA 3WKAA 5DKWA 4DLEA 1Q3VA 5KAFU 5HMMA 9ICRA 2BCUA 3DDHA 5DB9A 3TAQA 3H0MB 3RB4A 2WF7A 4O3QA 4O5KA 7ICFA 4LZGA 3HP6A 3RFAA 4FBUA 2BHNA 1IXRA 2K8AA 1JI7A 4RQMA 4QNLA 2H3VA 1ZQ1C 3RJKA 8ICMA 4CNQA 9ICTA 5ALXA 5DQHA 1NJZA 1X9WA 5AI6A 3RJHA 2ATLA 4KLDA 4PGYA 3TADA 2ASDA 4NM1A 3IHQB 2BQUA 2Y0SF 3NVYA 5L1KA 2XO7A 2O6KA 3EYZA 2KSOA 4NM2A 4Y2JA 3GIMA 5L1JA 9ICMA 1LKYB 5F9NA 5KFJA 4M9HA 2W7PA 4RNOA 1ZQGA 4YR3A 4DF8A 5KNIA 4F92B 1LV5A 2P6RA 1NKEA 3FC4A 2ZIUA 2ZJ5A 2E8NA 2JH7A 2ZIVB 1GO3F 5J0PA 2EAMA 2AXTU 5TISU 5IIIA 3BJYA 3SAFA 2Y0SC 3PSTA 1CRXA 1MSWD 2RHFA 4O3SA 8ICJA 9ICLA 3RAXA 4JWMA 1XNSA 3KTQA 4UAYA 1XS9D 7ICPA 5KG1A 1X40A 3BQ0A 2W03A 4GC6A 2HVIA 4DOBA 1RDFA 2AJQA 2JGAA 4DCCA 1KLNA 4BWJA 2BDUA 2PKEA 2L5YA 2PFNA 5KT5A 3ETRA 1NK5A 4RPXA 1DK2A 3GIJA 4UB8U 2D3DA 2ASLA 4K4GA 4EBDA 4O3RA 2FPLA 2HBKA 3N7PD 3RF9A 2W8KA 4CF4A 2AH5A 1VJ5A 8ICCA 2W55A 4YP3A 2KV2A 4YR2A 5J2BA 4Z6FA 3FDSA 5L1LA 4F8RA 3FYHA 2K89A 3PMNA 2XCPA 4KLOA 2ZIXB 2OH2A 7ICIA 4C8NA 5KG2A 5KFOA 3PSIA 2VJ4A 7ICNA 1OUQA 2HHWA 3RH4A 4BJQA 4PL2A 4IS7A 2XGPA 5KG6A 4JV2A 5A0LA 2EH9A 1TE2A 4AP9A 1SWWA 2IMWP 5ALGA 2IOHA 1XC9A 9ICOA 4PHPA 1D8BA 4Y2UA 2UVVA 2HHVA 4YN4A 1N5XA 4UB3A 8ICYA 5T14A 3D2NA 1N63A 5AI9A 1D9FA 5J0XA 4NLKA 1T94A 4UB6U 4GXJA 4UBBA 3WKBA 9ICCA 1FFVA 3V7JA 4KLUA 3KKAC 1X6IA 5AKXA 3PX6A 3U26A 5ALHA 2BR0A 2LPEA 3H8SA 1DGSA 5HP4A 1N48A 3CP8A 4BDPA 2WAQF 4ED8A 2JEGA 5AKZA 5L1MA 4P4MA 5EWGA 3C2LA 1L3VA 4ZOHC 1PZNA 2RDIA 3EUB2 3KHGA 1ZQBA 5J0SA 1S77D 3RB3A 3QUTA 4DL5A 4F5PA 1RXWA 2Q4TA 4UB1A 1BNPA 3F2DA 1A0PA 5AKYA 1F5SA 5DQGA 3KBBA 3MDAA 3KFUF 5D46A 2Y1JA 2GO7A 1BPXA 1ZQQA 4Y2QA 4J9NA 3RR8A 3WK9A 3M8RA 3OPXA 4DLGA 4Y2RA 2WAQC 4F50A 2LI6A 2BQRA 2J6UA 4KN4A 1ZQNA 2PFOA 7ICJA 2WFAA 1VDVA 1N56A 2BCQA 4I29A 3AM9A 1YT3A 3MGHA 1ZETA 1LB2B 4J03A 4Y2PA 1PVRA 2BPFA 3UMCA 8ICGA 3VC8A 5KFBA 2KEYA 5HNKA 1RG6A 1O08A 4Q8FA 5ALUA 3F5AA 3ZI4A 4CDGA 4IC9A 2EAPA 5AK4A 1S0MA 2E1FA 4BGDA 4KLIA 3PY8A 3SYZA 2MUTB 3C23A 2G08A 3RJFA 4UAUA 2W04A 3RBDA 2H5XA 3M1YA 5AKJA 4BXOA 4KX5A 2W9CB 1J2MA 4M04A 2E8PA 3C1YA 5G5GA 2BQ3A 2QKQA 3GV7B 3Q8RB 2DWQA 2W9BB 3RB6A 4R65A 3HWTA 2I6XA 4ECTA 2MA1A 1KN5A 4KLHA 3B0YA 4ED2A 1ZJNA 2G5HB 4OD0A 1L3TA 1UHUA 3UQ2A 5ALYA 2OM6A 1J2NA 4DL7A 5ALJA 2K4HA 3SD7A 4KLLA 5J2HA 4C7YA 1ZD4A 1ZQMA 3F5EA 2EZXA 1ZD3A 1XSPA 1YZ6A 4FS1A 3QE9Y 5CB1A 1TFRA 4KTQA 1Z00B 7ICKA 2G0AA 2GH1A 2ES6A 5DGBA 3QXGA 1M6YA 5D4BA 5ALRA 3NVWA 1SXEA 3PX0A 1QTMA 1COKA 2P66A 5AK3A 4XRHA 1V97A 3ZDAA 4Y2YA 3QX7A 1T3NA 3C2MA 3D2QA 2Y9UA 1HIWA 4QW9A 1TK8A 3SQIA 1ZQZA 4P0PA 4GFJA 4OCZA 3M9OB 1IG6A 2I1QA 2H3ZA 2B6GA 1QSLA 7ICLA 1D8LA 5KG4A 5KFFA 1JIHA 5J0TA 4F4YA 2HOIA 1TKDA 2HHQA 2KKPA 3OSNA 2NRVA 5KG7A 4NWIA 1SIJA 4Q44A 1JRPA 3Q8SB 4J9OA 3F2BA 3NASA 3EPGA 4M0AA 3H40A 5J8YC 3LWLA 4Y2XA 2I5HA 2UVWA 2HOFA 5AHXA 2EANA 1XSLA 2F2AB 2J6SA 4M9NA 4PGXA 1ZOLA 3JPRA 4RPYA 9ICVA 4R8UB 5IIMA 4NL9A 2LKYA 2UVUA 4DFDA 5J2KA 1QLNA 3SV3A 4Q43A 1XO0A 3V6JA 4PHDA 4R63A 4KLMA 1BGXT 4DL3A 4J9MA 2ZIWB 2A1JB 4PZOA 4O5EA 4NY8A 5CWRA 5AI0A 4U7CA 4RQ5A 3H4BA 4NXZA 2QLTA 3M6KA 2V4RA 2NRTA 5KT2A 4DSIA 1A76A 2W3RA 3H0LB 4A8EA 3QYPA 2HHXA 2B21A 2KZ3A 4CE6A 1RYSA 4F2SA 2DF4B 5J0YA 5J0OA 1Z3EB 2IBKA 3MR6A 4ELUA 3WKEA 7ICHA 5E79U 1U48A 1X2IA 2MSNA 3K1RB 2LM1A 2KMDA 1SXDA 5G5HA 3OJUA 4RQ2A 4DOCA 3SAHA 4M9GA 4F91B 1LKYA 1KQQA 2KFNA 4FZNA 1MA7A 2C2RA 1NK6A 2KHQA 3LVWA 4B9MA 1S5LU 3BS7A 1JN3A 3K1ZA 1JXLA 2BGWA 4B9NA 8ICLA 3AQEA 4EEYA 4C8KA 4Z6EA 2ZIVA 5J0QA 2ESEA 4G9BA 5KFRA 1WYGA 2KKVA 3B9JA 2DQNB 1KW4A 4YXJA 5DBBA 2FMPA 2W43A 1SWVA 1XO1A 5AIBA 2P6UA 4KN7A 5F9LA 2ZXIA 8ICAA 1JALA 3BQ7A 3M7DA 2CPRA 3QU4A 3JPTA 4IQVA 8ICOA 4IQWA 2FLLA 2JMGA 2HVHA 4B9SA 1ZQXA 3HJEA 3GZFA 5AICA 2RDJA 2KNJA 4I2IA 3CW2C 3PV8A 4M47A 5AKIA 5FP0A 1XU4A 3GQCA 4QJFB 1ZD5A 3AUOA 3OSPA 3WK4A 3A0HU 3Q8LA 2IHMA 3HKZF 5ALPA 2ZIXA 4RT3A 2RP5A 2JRZA 4F4WA 1ZYQA 4RQ3A 5EE0A 3EZ5A 1U49A 9ICIA 2KJ9A 1XSNA 2NYVA 5ALFA 3B0XA 3H0RB 4TQSA 3M9NB 2OCEA 4K4IA 4FE3A 9ICPA 5KFNA 3HKZC 3GILA 2ALZA 3ZDDA 4RUCA 5EE3A 4C0ZA 1L8OA 2WTFA 1L5UA 1BPYA 1IIPA 3PW0A 4NLZA 3OGUA 4DL6A 2KG5A 3TANA 3G6VA 5IIKA 1RM6C 5KFIA 3PNCA 1RPLA 4Q8EA 4YR0A 9ICHA 3BZCA 4EBEA 1JXEA 1MC8A 4QWEA 4GXKA 5KFDA 1NJXA 4PJ0U 3F53A 3UMBA 3TARA 9ICGA 2YX8A 4YD2A 3DV9A 1ZRMA 2WF9A 3TAPA 3L4PA 4F4KA 4P0QB 4DF4A 5C0YA 1B0XA 1P7DA 3QEAZ 3UXOA 2GLEA 4NLBA 1L8LA 2E5SA 1ZQDA 1BPDA 2RRDA 2HBMA 3WKDA 5J0UA 2NO5A 3UMGA 5KAIU 2F3NA 5DLGA 5BPCA 4US9A 3D6JA 2QARB 5KFZA 3Q8QB 4NLNA 9ICNA 3GV8B 3SAGA 4EX6A 5CEHA 3SZ2A 5ALSA 5ALLA 3MGVA 2XICA 3R9KA 3QUBA 5DQIA 2KTQA 1IV8A 4RQ0A 3M9MB 2PXIA 2FLPA 2KFZA 4GXIA 4KLTA 1L7NA 4IR1A 2VA3A 4CF3A 7ICQA 5ALTA 5KFVA 1K1QA 4UB5A 4M6WB 4TUPA 4DSLA 3GIIA 3IG5A 1Q3UA 5HR7A 2IHNA 3LVVA 1ZQRA 3E0FA 3BDPA 1KEJA 3MC1A 1D9DA 2LHTA 5DGAA 2J6TA 3AEVA 4DS5A 2AGOA 4P4OA 2MUTA 3KHHA 3JPNA 1NKBA 3GDXA 3TI0A 5DLFA 2DPIA 2EQYA 2H3IA 2HBJA 2W9CA 2VJ5A 2YB4A 5HHIA 4DQIA 2VKQA 1CUKA 2HHTA 2ZTDA 3QU5A 3E58A 4US8A 1X66A 1ZRNA 2YY6A 5JRTA 1ZXIA 4J9LA 3HW8A 4DS4A 4MF8A 1L7MA 2K4PA 2W9BA 1D8YA 4ECZA 1DRGA 2YTUA 4C80A 1L7PA 1RQLA 2KICA 1S97A 1Z1VA 3N7SC 4F5QA 3ZD9A 3MR5A 2R8JA 3AMZA 8ICXA 5KFLA 4I2CA 2LM4A 3RTVA 1ZQCA 1Z00A 3GFKB 1C7YA 4FBTA 1ZQIA 5ALZA 2LMRA 3V72A 1S10A 1L3UA 5KG3A 3T79A 1TVAA 4OJ6A 1KBUA 1WCLA 4B9LA 3H4DA 1X9MA 4F4ZA 4CRXA 4C7ZA 2AHOB 3ONNA 3QU2A 4FS2A 2AGQA 5ALQA 2XGQA 4KX3A 3BQ2A 2NO4A 1RYUA 1SV0A 2F1IA 4QIWF 3C29A 3UQ0A 4ECUA 4EX7A 2KK0A 5C5JA 1ZQTA 1OXJA 3MABA 2FMSA 1ZQVA 2V4QA 2HW3A 2MRLA 4OJ5A 3ISBA 5IIJA 1URJA 2V9WA 2E1EA 2XC9A 2VIXA 4DSFA 2AQ0A 4ED3A 3IDWA 2HCFA 7ICOA 1IM4A 4EELA 1F44A 4ECXA 4EYIB 4DEZA 5K4LA 5CJ7A 3ZDBA 4JMUA 2KOBA 3KKAA 3QZ7A 4QIWC 3MFIA 3RRHA 4QZBA 5KFPA 3RRGA 5DG7A 2OYYA 1V9PA 5F3XB 1Z19A 2XY5A 2BCVA 4QZIA 4I2HA 4O5CA 3IRUA 2BPCA 3AQFA 4R8UA 5J2JA 2VANA 4ICAA 5CA7A 5DB7A 3DEEA 8ICSA 3RJGA 2W9AA 4C4TA 1Y88A 4RQNA 5AK5A 3Q8PB 4B9VA 3I76A 1NZBA 2K4IA 2WB1F 8ICZA 4DL4A 1NOMA 4FFDA 4I2AA 2A1JA 4C4SA 3PZPA 4RQ6A 3JPOA 2G09A 5GTHU 1ZQUA 4YXMA 4QWCA 1DK3A 2D8CA 1NJWA 4DSEA 4ECQA 3KHRA 1HEKA 2JZBB 3KD3A 2WB1C 1QCKA 2ZJ8A 1N60A 2CN1A 3RH5A 2KHVA 3RBEA 4QWDA 2R8IA 4QZFA 3D2SA 5KTQA 4I2EA 4C8MA 2KZMA 1WWVA 7ICTA 2GWSA 3T5HA 2F44A 3J81j 4DFKA 2R8KA 3I28A 4YQWA 1Z4NA 4NL9C 2M0NA 1T4GA 1SZHA 2Y1IA 4KLGA 4RZRA 2DFLA 3H8MA 4EYHB 1DOQA 3SENA 9ICAA 2HBLA 3O0FA 2K8CB 3NVZA 4DO9A 5KT3A 1TK0A 2F76X 3TQ1A 5AK6A 1U45A 8ICVA 2NRZA 4M9LA 4ECWA 1O03A 2KJ5A 5AKHA 5KFGA 2OXOA 3ORYA 4PGQA 4C8LA 1L7OA 4ZH4A 1T7PA 1QQ6A 3KOOA 3VCBA 3S6JA 4J9PA 3GV5B 1PK1B 3NS1A 4J9QA 2KZZA 1FO4A 4R66A 4DQRA 1ZQHA 3QEBZ 3TACB 2MU2A 3ALRA 1UPHA 4LJXA 1ZQFA 8ICHA 2W3SA 1JX4A 4DSJA 1RQNA 4QZCA 1AQ6A 7ICEA 2HHSA 2LYHA 1U4BA 2JEIA 4OJLA 4F5NA 2ZUDA 3EW9A 4C4RA 3V6HA 1EXNA 1ZQWA 5IINA 1NKCA 3PX4A 2JV3A 1TV9A 4BXOB 5B5EU 1KRPA 9ICXA 8ICIA 4RUAA 2PI4A 5AKKA 4KITB 1WWUA 3L5KA 5JTIA 3PW7A 2DKXA 3KHLA 4O3PA 2AQ4A 1PK3A 1MQ2A 3SMVA 3N7RC 5ALKA 4RQ7A 1L3SA 4NJ8A 4IRKA 2GOLA 1SV4A 1QQ5A 1QH9A 2Q0ZX 2F8LA 1TAQA 4RQ1A 5DB8A 3CRXA 9ICQA 1S0VA 4KMOB 2G5IB 1KFSA 2FPMA 2BCRA 4UAZA 3PMLA 1UCVA 4TUQA 3C28A 3PO5A 4YD1A 2FLNA 5J8YA 1SGGA 2YMPA 1WCNA 3UPQA 2YB1A 4MHVA 3LDAA 3V7LA 1NK7A 3TKAA 5BOLA 2IOFK 4P0QA 2C2DA 5KL1B 2G07A 7ICRA 1QSSA 7ICGA 4JWNA 2WF8A 2XIDA 1FFUA 4JV0A 4U6PA 3RJIA 4CGZA 2XCAA 3TFSA 3BS5B 2KIWA 2YMMA 4Q45A 7ICMA 5J2FA 4IR9A 1ZQKA 1ZQLA 4MEXA 2QARA 4I27A 3TADC 4F4XA 2W8LA 3N28A 1NK9A 4YMMA 3PVXA 2B0CA 7ICSA 1SZPA 5J2EA 3SV4A 3NRZA 4P4PA 5B66U 5BOMA 4ELTA 5AM3A 3HRDD 4UBCA 5J0WA 4O0IA 2W54A 3UM9A 3PR5B 2KIVA 3QUCA 4M6WA 3ZD8A 2XY6A 3C5FA 4USAA 3E2EA 2JEFA 5CP2A 2E8OA 2N1RA 4XQ8A 1AROP 5AM2A 5KFWA 3T5LA 3C5GA 2DKZA 4J9SA 4MFAA 2HDOA 5EWEA 3GU3A 3GIKA 5ALMA 1COOA 3MFHA 1FEZA 1ZJMA 3N97B 1KFDA 4O3NA 4ECSA 1RZTA 3OJSA 2KP7A 4O3OA 1PVPA 2VA8A 5AKGA 4M9JA 1MQ3A 1PVQA 5AIAA 4Y2VA 1NZPA 5KG5A 1CI4A 1FIQA 5EE9A 4I2JA 3UXNA 1U47A 3RR7A 2KJ8A 1B43A 4I2DA 2W11A 3T5JA 3LK9A 3ICXA 4DFJA 4YMNA 4Z6CA 2ISOA 4ACOA 3AN1A 5DBAA 4QWAA 2YMQA 4RPZA 1Q46A 4O9MA 4UASA 3RAQA 4MFCA 4YG2A 1N5WA 2ZTCA 5KFKA 1ZD2P 8ICEA 2K60A 3JPQA 4I2GA 3M8SA 2DGZA 3N4MB 1NK0A 3AU2A 1ZQYA 5EWFA 5AI8A 4TUSA 3C2KA 4PHAA 5CHGA 2R18A 3Q8KA 4TQRA 2OHFA 4I28A 5DDMA 2QB1A 5KFCA 4EENA 8ICTA 3MGIA 8ICFA 4ECRA 3ISCA 1V38A 3NVVA 4BX9C 1MN8A 1SKSA 3FAHA 4F3OA 3PW5A 5ALNA 5ALDA 8ICQA 3THVA 4KLFA 2QB0B 4TURA 4PH5A 3LWMA 4FZMA 4CF5A 4I2FA 3A0BU 3EPIA 5HR6A 1KDHA 3OHBA 3WK7A 5DBCA 2P35A 2EZYA 4Z6DA 4F5RA 3L3FX 4QZEA 5KT4A 3H8JA 2K8BB 3IP4B 9ICUA 2W7OA 1SB3C 2F1JA 1NK8A 3V7KA 4DSKA 3ZDCA 3T3FA 4AYBF 4ED1A 4HYKA 1UT8A 4QZAA 3PSPA 2DUYA 4MEYA 4IQUA 2WF6A 2ZUBA 2C2EA 2DBYA 4E0DA 3G6YA 5HMLA 4F72A 1KKXA 3H8WA 1H38A 4ELVA 5J0RA 1SV0C 5AM1A 4B6JA 1S9FA 1YZ7A 2KN7A 1BPEA 5DG8A 1ZQSA 1Z4OA 2XY7A 3PO4A 2F77X 1CEZA 1X42A 4AYBC 4RT2A 4HAIA 2KSOB 2EDUA 4PZNA 2E3TA 3RB0A 1N62A 2AGPA 8ICKA 3MBYA 1SL0A 3JPPA 4XUSA 4X5VA 2I9GA 3BQ1A 2BCSA 4DWIA 4RQ8A 2JZBA 5IIOA 3T5KA 1ZQJA 5AI5A 2ZIUB 4IQTA 5ALIA 5KFAA 4F5OA 2EAOA 2WHEA 2RQ5A 1PUZA 4DQQA 2MAXA 2ASJA 2FE9A 1S0NA 3HT3A 3BZKA 1KSPA 4WJ3B 1ED1A 4RQ4A 2K4EA 4DQSA 1N61A 2KVCA 8ICNA 2DL0A 3OHAA 5CR0A 3NTUA 3RJEA 1QSYA 5KFQA 4UARA 1C20A 5GTIU 2R8HA 1S8OA 3F2CA 4OJPA 3QU7A 2FMQA 5AM4A 5J2DA 1ECWA 3FM9A 3Q8MA 3IN5A 1QQ7A 5D49A 1NNLA 4IRDA 3IG8A 5AKLA 1UQVA 2YMLA 1V85A 2NRWA 1HJPA 2BDPA 2ZUCA 2HMXA 1S0OA 1PK1A 4PL1A 4KLJA 9ICJA 2PFQA 4GC7A 1NJYA 1JUDA 4UB4A 1ZQPA 2Z7JA 1DXSA 2IA6A 2Y9TA 2JXJA 3HX0A 5DDYA 5AM5A 3AU6A 2A1AA 4EEKA 5KFUA 1L6NA 1KFTA 3NGDA 1SL2A 1X9SA 2HOQA 1ZQOA 5IILA 3ED5A 1OW5A 1BPZA 4YCXA 5J2IA 2ZJAA 9ICKA 1DGJA 4ED6A 1N2XA 2E8MA 3C21A 4RNMA 2ZIWA 5ALWA 4G3IA 1B4FA 1SKRA 1HUZA 4DFMA 5DB6A 4RNNA 5J2CA 2VA2A 8ICUA 4QWBA 2F1HA 2C28A 1ZQAA 3QZ8A 4R64A 2JR5A 5L1IA 3ETLA 3ZDEA 5AKEA 4B9TA 1Z1BA 8ICPA 4I2BA 2FI1A 5AI4A 3MR2A 3IM1A 2H3FA 5JU5A 4FO6A 4M2YA 4NV0A 2NRXA 1BVSA 4QZ8A 4IL6U 2BZFA 3QUQA 4DL2A 1J97A 2FDRA 2F8KA 4FZLA 5KL8B 2EZZA 4KLQA 4JB3A 5DG9A 4Y2TA 3M6ZA 5KFEA 2KD1A 5KT7A 4O3MA 4BWMA 4ED0A 2OWOA 4QZDA 4EZ6A 3IV6A 2ISPA 4CCHA 3KZIU 1A77A 4EZ9A 2PI5A 1T3QA 5JUMA 3WK5A 3PW4A 2M9NA 4LZDA 9ICEA 4QW8A 2JH1A 1F0MA 5KFSA 4JV1A 3SEIA 1TAUA 2AU0A 4NLCA 4J9RA 3BS5A 3SR6A 3WU2U 1K1SA 1X9XA 1HUOA 4ECYA 2JEJA 4IRCA 1XWLA 1WUDA 3WK6A 4F71A 2A3VA 3WKCA 4PPXA 3LYSA 5HHHA 1K5OA 3I1YA 2IOFA 2FJ6A 2LBOA 2R8GA 1RYRA 7ICVA 3EWAA 3RH6A 9ICSA 4UATA 8ICBA 5ALEA 1B22A 3JPSA 1X6JA 2KE7A 5KG0A 4KMUA 1SKWA 9ICWA 2CXYA 3NUQA 2HHUA 3MDCA 2W9MA 3WK8A 3NRWA 5H2FU 3H7IA 4ED7A 4DOAA 1S76D 4QZGA 4OO1J 2HI0A 1WG8A 4UQGA 5J2AA 5KFYA 4UAWA 3TFRA 2ZTEA 3PW2A 2RLTA 1RXVA 2YN4A 1KL9A 1BPBA 1UA0A 2FPKA 5L9XA 4QZHA 4F2RA 4MFFA 3MR3A 4KLSA 4XA5A 4RU9A 1U9LA 7ICUA 4F93B 2CRXA 3C1ZA 5J2GA 1TK5A 2NV3A 4C8OA 4OJOA 4UW9A 4K4HA 4UB2A 4YMOA 2A19A 3RJJA 4Y2SA 4BUGA 2WF5A 1T8EA 3QU9A 2PFPA 1UT5A 3BQTA 5ALVA 1Q8KA 2KVSA 5KFHA 4MF2A 3OTQA 1JROA 3AL0B 4B9UA 5AM0A 2BPGA 9ICBA 4J9KA 1VLBA 1LVHA 1UA1A 4GIBA 3CYMA 8ICRA 3V6KA 3SI8A 3K75D 2LYAA 3UXPA 1JMSA 5CRXA 4PHEA 4P0PB 2PMZF 5ALOA 2HSZA 4DQPA 3QNMA 2ZG6A 1NI3A 5EE1A 5KFTA 4KLEA 4EBCA 4QZ9A 2JHDA 5J29A 2D6FC 3PR4A 4LVSA 2ZXHA 2YQEA 1KTQA 4GLXA 5KFXA 3PSFA 2XVTA 3CNHA 4P2HA 3HILA 5KFMA 3G6XA 3HPOA 1A6SA 2BKEA 2ODGA 2PMZC 2XI9A 5TZVA 2G06A 3KZXA 2DPJA 1BNOA 2QB0A 4YVZA 3K4GA
chains in the Genus database with same CATH topology
3ISDA 4M0AA 5DBCA 1ZQEA 4Z6DA 4F5RA 4QZEA 4QZBA 1XSLA 4M9NA 4PGXA 3JPRA 4RPYA 8ICWA 9ICVA 9ICFA 5EOZA 2BCVA 4QZIA 5IIMA 9ICUA 5DKWA 4I2HA 4O5CA 9ICRA 3V7KA 5J2KA 2BCUA 5DB9A 5J2JA 5DB7A 8ICSA 4PHDA 4R63A 3RJGA 4KLMA 4QZAA 4O5KA 7ICFA 4IQUA 4LZGA 4O5EA 8ICZA 5J0RA 4NY8A 5CWRA 4I2AA 1BPEA 4RQ5A 4RQ6A 3JPOA 4NXZA 3RJKA 1ZQSA 8ICMA 9ICTA 1DK3A 3RJHA 4RT2A 4KLDA 4PGYA 5J0YA 5J0OA 4NM1A 8ICKA 3MBYA 7ICHA 3RH5A 3JPPA 4XUSA 2I9GA 4X5VA 2BCSA 4NM2A 4QZFA 4RQ8A 9ICMA 5IIOA 1ZQJA 4I2EA 4M9HA 7ICTA 4IQTA 2GWSA 1ZQGA 4F5OA 4RQ2A 4DOCA 4M9GA 4KLGA 5J0PA 9ICAA 5IIIA 8ICLA 4Z6EA 4DO9A 5J0QA 4RQ4A 8ICNA 8ICJA 9ICLA 3RJEA 4JWMA 4UAYA 8ICVA 5DBBA 7ICPA 4M9LA 2FMPA 4PGQA 4DOBA 2FMQA 5J2DA 8ICAA 2PFNA 5D49A 4RPXA 1DK2A 3JPTA 4IQVA 4K4GA 8ICOA 4R66A 4IQWA 1ZQHA 8ICCA 1ZQFA 4I2IA 8ICHA 5J2BA 4KLJA 9ICJA 4Z6FA 4M47A 2PFQA 4QZCA 7ICEA 4UB4A 1ZQPA 3PMNA 4F5NA 3HX0A 5DDYA 4KLOA 3AU6A 7ICIA 3AUOA 5IINA 2IHMA 1ZQOA 1TV9A 5IILA 7ICNA 3RH4A 4RT3A 1BPZA 9ICXA 8ICIA 4YCXA 5J2IA 9ICKA 4RQ3A 9ICIA 1MQ2A 1XSNA 1HUZA 4PHPA 9ICOA 5DB6A 3B0XA 5J2CA 4RQ7A 8ICUA 4YN4A 4UB3A 1ZQAA 8ICYA 4K4IA 4R64A 9ICPA 5J0XA 4RQ1A 4GXJA 4NLKA 4UBBA 8ICPA 5DB8A 4I2BA 9ICCA 1BPYA 9ICQA 3V7JA 4KLUA 4NLZA 3OGUA 2BCRA 5IIKA 3PNCA 4FO6A 4UAZA 4M2YA 9ICHA 4QZ8A 3PMLA 4TUQA 4GXKA 4YD1A 4KLQA 9ICGA 4YD2A 3C2LA 3UPQA 1ZQBA 3V7LA 5J0SA 4F5PA 4UB1A 1BNPA 5BOLA 4QZDA 3MDAA 3UXOA 7ICRA 2ISPA 7ICGA 1ZQDA 4JWNA 5D46A 1BPDA 1BPXA 1ZQQA 5J0UA 4LZDA 9ICEA 3RJIA 3TFSA 5BPCA 7ICMA 5J2FA 4NLNA 9ICNA 1HUOA 1ZQKA 1ZQNA 1ZQLA 2PFOA 7ICJA 4I27A 2BCQA 4I29A 4PPXA 3MGHA 4RQ0A 4YMMA 5HHHA 2PXIA 7ICSA 4GXIA 2BPFA 4KLTA 8ICGA 7ICVA 7ICQA 3RH6A 9ICSA 5J2EA 8ICBA 3JPSA 4UB5A 4TUPA 5BOMA 4UBCA 5J0WA 1ZQRA 9ICWA 3C5FA 4KLIA 1KEJA 3MDCA 2W9MA 3RJFA 4DOAA 3JPNA 4QZGA 3C5GA 3GDXA 4MFAA 5J2AA 4UAWA 3TFRA 4M04A 5HHIA 1ZJMA 4QZHA 1RZTA 2KP7A 4MFFA 4KLSA 4XA5A 4R65A 3HWTA 4M9JA 7ICUA 1MQ3A 3HW8A 4MF8A 5J2GA 1NZPA 4KLHA 3B0YA 1ZJNA 4K4HA 4UB2A 3UQ2A 4YMOA 4I2JA 3UXNA 3RJJA 4KLLA 5J2HA 2PFPA 1ZQMA 4I2DA 3LK9A 4F5QA 1XSPA 4YMNA 4Z6CA 2ISOA 4MF2A 8ICXA 5CB1A 5DBAA 4RPZA 4O9MA 7ICKA 4MFCA 2BPGA 9ICBA 4I2CA 1ZQCA 8ICEA 8ICRA 3JPQA 5D4BA 4I2GA 1ZQIA 3AU2A 3V72A 1TVAA 2P66A 3UXPA 1JMSA 4TUSA 3C2KA 4PHAA 4PHEA 3C2MA 4I28A 4KLEA 4QZ9A 5J29A 4LVSA 8ICTA 3MGIA 3UQ0A 8ICFA 1ZQTA 3ISCA 7ICLA 2FMSA 4P2HA 3ISBA 5IIJA 8ICQA 5J0TA 4KLFA 4TURA 4PH5A 5TZVA 7ICOA 4I2FA 1BNOA 1KDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISD A;  4M0A A;  5DBC A;  1ZQE A;  4Z6D A;  4F5R A;  4QZE A;  4QZB A;  1XSL A;  4M9N A;  4PGX A;  3JPR A;  4RPY A;  8ICW A;  9ICV A;  9ICF A;  5EOZ A;  2BCV A;  4QZI A;  5IIM A;  9ICU A;  5DKW A;  4I2H A;  4O5C A;  9ICR A;  3V7K A;  5J2K A;  2BCU A;  5DB9 A;  5J2J A;  5DB7 A;  8ICS A;  4PHD A;  4R63 A;  3RJG A;  4KLM A;  4QZA A;  4O5K A;  7ICF A;  4IQU A;  4LZG A;  4O5E A;  8ICZ A;  5J0R A;  4NY8 A;  5CWR A;  4I2A A;  1BPE A;  4RQ5 A;  4RQ6 A;  3JPO A;  4NXZ A;  3RJK A;  1ZQS A;  8ICM A;  9ICT A;  1DK3 A;  3RJH A;  4RT2 A;  4KLD A;  4PGY A;  5J0Y A;  5J0O A;  4NM1 A;  8ICK A;  3MBY A;  7ICH A;  3RH5 A;  3JPP A;  4XUS A;  2I9G A;  4X5V A;  2BCS A;  4NM2 A;  4QZF A;  4RQ8 A;  9ICM A;  5IIO A;  1ZQJ A;  4I2E A;  4M9H A;  7ICT A;  4IQT A;  2GWS A;  1ZQG A;  4F5O A;  4RQ2 A;  4DOC A;  4M9G A;  4KLG A;  5J0P A;  9ICA A;  5III A;  8ICL A;  4Z6E A;  4DO9 A;  5J0Q A;  4RQ4 A;  8ICN A;  8ICJ A;  9ICL A;  3RJE A;  4JWM A;  4UAY A;  8ICV A;  5DBB A;  7ICP A;  4M9L A;  2FMP A;  4PGQ A;  4DOB A;  2FMQ A;  5J2D A;  8ICA A;  2PFN A;  5D49 A;  4RPX A;  1DK2 A;  3JPT A;  4IQV A;  4K4G A;  8ICO A;  4R66 A;  4IQW A;  1ZQH A;  8ICC A;  1ZQF A;  4I2I A;  8ICH A;  5J2B A;  4KLJ A;  9ICJ A;  4Z6F A;  4M47 A;  2PFQ A;  4QZC A;  7ICE A;  4UB4 A;  1ZQP A;  3PMN A;  4F5N A;  3HX0 A;  5DDY A;  4KLO A;  3AU6 A;  7ICI A;  3AUO A;  5IIN A;  2IHM A;  1ZQO A;  1TV9 A;  5IIL A;  7ICN A;  3RH4 A;  4RT3 A;  1BPZ A;  9ICX A;  8ICI A;  4YCX A;  5J2I A;  9ICK A;  4RQ3 A;  9ICI A;  1MQ2 A;  1XSN A;  1HUZ A;  4PHP A;  9ICO A;  5DB6 A;  3B0X A;  5J2C A;  4RQ7 A;  8ICU A;  4YN4 A;  4UB3 A;  1ZQA A;  8ICY A;  4K4I A;  4R64 A;  9ICP A;  5J0X A;  4RQ1 A;  4GXJ A;  4NLK A;  4UBB A;  8ICP A;  5DB8 A;  4I2B A;  9ICC A;  1BPY A;  9ICQ A;  3V7J A;  4KLU A;  4NLZ A;  3OGU A;  2BCR A;  5IIK A;  3PNC A;  4FO6 A;  4UAZ A;  4M2Y A;  9ICH A;  4QZ8 A;  3PML A;  4TUQ A;  4GXK A;  4YD1 A;  4KLQ A;  9ICG A;  4YD2 A;  3C2L A;  3UPQ A;  1ZQB A;  3V7L A;  5J0S A;  4F5P A;  4UB1 A;  1BNP A;  5BOL A;  4QZD A;  3MDA A;  3UXO A;  7ICR A;  2ISP A;  7ICG A;  1ZQD A;  4JWN A;  5D46 A;  1BPD A;  1BPX A;  1ZQQ A;  5J0U A;  4LZD A;  9ICE A;  3RJI A;  3TFS A;  5BPC A;  7ICM A;  5J2F A;  4NLN A;  9ICN A;  1HUO A;  1ZQK A;  1ZQN A;  1ZQL A;  2PFO A;  7ICJ A;  4I27 A;  2BCQ A;  4I29 A;  4PPX A;  3MGH A;  4RQ0 A;  4YMM A;  5HHH A;  2PXI A;  7ICS A;  4GXI A;  2BPF A;  4KLT A;  8ICG A;  7ICV A;  7ICQ A;  3RH6 A;  9ICS A;  5J2E A;  8ICB A;  3JPS A;  4UB5 A;  4TUP A;  5BOM A;  4UBC A;  5J0W A;  1ZQR A;  9ICW A;  3C5F A;  4KLI A;  1KEJ A;  3MDC A;  2W9M A;  3RJF A;  4DOA A;  3JPN A;  4QZG A;  3C5G A;  3GDX A;  4MFA A;  5J2A A;  4UAW A;  3TFR A;  4M04 A;  5HHI A;  1ZJM A;  4QZH A;  1RZT A;  2KP7 A;  4MFF A;  4KLS A;  4XA5 A;  4R65 A;  3HWT A;  4M9J A;  7ICU A;  1MQ3 A;  3HW8 A;  4MF8 A;  5J2G A;  1NZP A;  4KLH A;  3B0Y A;  1ZJN A;  4K4H A;  4UB2 A;  3UQ2 A;  4YMO A;  4I2J A;  3UXN A;  3RJJ A;  4KLL A;  5J2H A;  2PFP A;  1ZQM A;  4I2D A;  3LK9 A;  4F5Q A;  1XSP A;  4YMN A;  4Z6C A;  2ISO A;  4MF2 A;  8ICX A;  5CB1 A;  5DBA A;  4RPZ A;  4O9M A;  7ICK A;  4MFC A;  2BPG A;  9ICB A;  4I2C A;  1ZQC A;  8ICE A;  8ICR A;  3JPQ A;  5D4B A;  4I2G A;  1ZQI A;  3AU2 A;  3V72 A;  1TVA A;  2P66 A;  3UXP A;  1JMS A;  4TUS A;  3C2K A;  4PHA A;  4PHE A;  3C2M A;  4I28 A;  4KLE A;  4QZ9 A;  5J29 A;  4LVS A;  8ICT A;  3MGI A;  3UQ0 A;  8ICF A;  1ZQT A;  3ISC A;  7ICL A;  2FMS A;  4P2H A;  3ISB A;  5IIJ A;  8ICQ A;  5J0T A;  4KLF A;  4TUR A;  4PH5 A;  5TZV A;  7ICO A;  4I2F A;  1BNO A;  1KDH A; 
#chains in the Genus database with same CATH topology
 2C22 A;  2H3Q A;  3ISD A;  2UVR A;  4JUZ A;  4NLG A;  1ZQE A;  1NK4 A;  4YFK A;  4ECV A;  5KT6 A;  4JK1 A;  1TAM A;  4UAV A;  4DFP A;  2LYB A;  1SL1 A;  8ICW A;  9ICF A;  5EOZ A;  2OEH A;  3WKA A;  5DKW A;  4DLE A;  1Q3V A;  5KAF U;  5HMM A;  9ICR A;  2BCU A;  3DDH A;  5DB9 A;  3TAQ A;  3H0M B;  3RB4 A;  2WF7 A;  4O3Q A;  4O5K A;  7ICF A;  4LZG A;  3HP6 A;  3RFA A;  4FBU A;  2BHN A;  1IXR A;  2K8A A;  1JI7 A;  4RQM A;  4QNL A;  2H3V A;  1ZQ1 C;  3RJK A;  8ICM A;  4CNQ A;  9ICT A;  5ALX A;  5DQH A;  1NJZ A;  1X9W A;  5AI6 A;  3RJH A;  2ATL A;  4KLD A;  4PGY A;  3TAD A;  2ASD A;  4NM1 A;  3IHQ B;  2BQU A;  2Y0S F;  3NVY A;  5L1K A;  2XO7 A;  2O6K A;  3EYZ A;  2KSO A;  4NM2 A;  4Y2J A;  3GIM A;  5L1J A;  9ICM A;  1LKY B;  5F9N A;  5KFJ A;  4M9H A;  2W7P A;  4RNO A;  1ZQG A;  4YR3 A;  4DF8 A;  5KNI A;  4F92 B;  1LV5 A;  2P6R A;  1NKE A;  3FC4 A;  2ZIU A;  2ZJ5 A;  2E8N A;  2JH7 A;  2ZIV B;  1GO3 F;  5J0P A;  2EAM A;  2AXT U;  5TIS U;  5III A;  3BJY A;  3SAF A;  2Y0S C;  3PST A;  1CRX A;  1MSW D;  2RHF A;  4O3S A;  8ICJ A;  9ICL A;  3RAX A;  4JWM A;  1XNS A;  3KTQ A;  4UAY A;  1XS9 D;  7ICP A;  5KG1 A;  1X40 A;  3BQ0 A;  2W03 A;  4GC6 A;  2HVI A;  4DOB A;  1RDF A;  2AJQ A;  2JGA A;  4DCC A;  1KLN A;  4BWJ A;  2BDU A;  2PKE A;  2L5Y A;  2PFN A;  5KT5 A;  3ETR A;  1NK5 A;  4RPX A;  1DK2 A;  3GIJ A;  4UB8 U;  2D3D A;  2ASL A;  4K4G A;  4EBD A;  4O3R A;  2FPL A;  2HBK A;  3N7P D;  3RF9 A;  2W8K A;  4CF4 A;  2AH5 A;  1VJ5 A;  8ICC A;  2W55 A;  4YP3 A;  2KV2 A;  4YR2 A;  5J2B A;  4Z6F A;  3FDS A;  5L1L A;  4F8R A;  3FYH A;  2K89 A;  3PMN A;  2XCP A;  4KLO A;  2ZIX B;  2OH2 A;  7ICI A;  4C8N A;  5KG2 A;  5KFO A;  3PSI A;  2VJ4 A;  7ICN A;  1OUQ A;  2HHW A;  3RH4 A;  4BJQ A;  4PL2 A;  4IS7 A;  2XGP A;  5KG6 A;  4JV2 A;  5A0L A;  2EH9 A;  1TE2 A;  4AP9 A;  1SWW A;  2IMW P;  5ALG A;  2IOH A;  1XC9 A;  9ICO A;  4PHP A;  1D8B A;  4Y2U A;  2UVV A;  2HHV A;  4YN4 A;  1N5X A;  4UB3 A;  8ICY A;  5T14 A;  3D2N A;  1N63 A;  5AI9 A;  1D9F A;  5J0X A;  4NLK A;  1T94 A;  4UB6 U;  4GXJ A;  4UBB A;  3WKB A;  9ICC A;  1FFV A;  3V7J A;  4KLU A;  3KKA C;  1X6I A;  5AKX A;  3PX6 A;  3U26 A;  5ALH A;  2BR0 A;  2LPE A;  3H8S A;  1DGS A;  5HP4 A;  1N48 A;  3CP8 A;  4BDP A;  2WAQ F;  4ED8 A;  2JEG A;  5AKZ A;  5L1M A;  4P4M A;  5EWG A;  3C2L A;  1L3V A;  4ZOH C;  1PZN A;  2RDI A;  3EUB 2;  3KHG A;  1ZQB A;  5J0S A;  1S77 D;  3RB3 A;  3QUT A;  4DL5 A;  4F5P A;  1RXW A;  2Q4T A;  4UB1 A;  1BNP A;  3F2D A;  1A0P A;  5AKY A;  1F5S A;  5DQG A;  3KBB A;  3MDA A;  3KFU F;  5D46 A;  2Y1J A;  2GO7 A;  1BPX A;  1ZQQ A;  4Y2Q A;  4J9N A;  3RR8 A;  3WK9 A;  3M8R A;  3OPX A;  4DLG A;  4Y2R A;  2WAQ C;  4F50 A;  2LI6 A;  2BQR A;  2J6U A;  4KN4 A;  1ZQN A;  2PFO A;  7ICJ A;  2WFA A;  1VDV A;  1N56 A;  2BCQ A;  4I29 A;  3AM9 A;  1YT3 A;  3MGH A;  1ZET A;  1LB2 B;  4J03 A;  4Y2P A;  1PVR A;  2BPF A;  3UMC A;  8ICG A;  3VC8 A;  5KFB A;  2KEY A;  5HNK A;  1RG6 A;  1O08 A;  4Q8F A;  5ALU A;  3F5A A;  3ZI4 A;  4CDG A;  4IC9 A;  2EAP A;  5AK4 A;  1S0M A;  2E1F A;  4BGD A;  4KLI A;  3PY8 A;  3SYZ A;  2MUT B;  3C23 A;  2G08 A;  3RJF A;  4UAU A;  2W04 A;  3RBD A;  2H5X A;  3M1Y A;  5AKJ A;  4BXO A;  4KX5 A;  2W9C B;  1J2M A;  4M04 A;  2E8P A;  3C1Y A;  5G5G A;  2BQ3 A;  2QKQ A;  3GV7 B;  3Q8R B;  2DWQ A;  2W9B B;  3RB6 A;  4R65 A;  3HWT A;  2I6X A;  4ECT A;  2MA1 A;  1KN5 A;  4KLH A;  3B0Y A;  4ED2 A;  1ZJN A;  2G5H B;  4OD0 A;  1L3T A;  1UHU A;  3UQ2 A;  5ALY A;  2OM6 A;  1J2N A;  4DL7 A;  5ALJ A;  2K4H A;  3SD7 A;  4KLL A;  5J2H A;  4C7Y A;  1ZD4 A;  1ZQM A;  3F5E A;  2EZX A;  1ZD3 A;  1XSP A;  1YZ6 A;  4FS1 A;  3QE9 Y;  5CB1 A;  1TFR A;  4KTQ A;  1Z00 B;  7ICK A;  2G0A A;  2GH1 A;  2ES6 A;  5DGB A;  3QXG A;  1M6Y A;  5D4B A;  5ALR A;  3NVW A;  1SXE A;  3PX0 A;  1QTM A;  1COK A;  2P66 A;  5AK3 A;  4XRH A;  1V97 A;  3ZDA A;  4Y2Y A;  3QX7 A;  1T3N A;  3C2M A;  3D2Q A;  2Y9U A;  1HIW A;  4QW9 A;  1TK8 A;  3SQI A;  1ZQZ A;  4P0P A;  4GFJ A;  4OCZ A;  3M9O B;  1IG6 A;  2I1Q A;  2H3Z A;  2B6G A;  1QSL A;  7ICL A;  1D8L A;  5KG4 A;  5KFF A;  1JIH A;  5J0T A;  4F4Y A;  2HOI A;  1TKD A;  2HHQ A;  2KKP A;  3OSN A;  2NRV A;  5KG7 A;  4NWI A;  1SIJ A;  4Q44 A;  1JRP A;  3Q8S B;  4J9O A;  3F2B A;  3NAS A;  3EPG A;  4M0A A;  3H40 A;  5J8Y C;  3LWL A;  4Y2X A;  2I5H A;  2UVW A;  2HOF A;  5AHX A;  2EAN A;  1XSL A;  2F2A B;  2J6S A;  4M9N A;  4PGX A;  1ZOL A;  3JPR A;  4RPY A;  9ICV A;  4R8U B;  5IIM A;  4NL9 A;  2LKY A;  2UVU A;  4DFD A;  5J2K A;  1QLN A;  3SV3 A;  4Q43 A;  1XO0 A;  3V6J A;  4PHD A;  4R63 A;  4KLM A;  1BGX T;  4DL3 A;  4J9M A;  2ZIW B;  2A1J B;  4PZO A;  4O5E A;  4NY8 A;  5CWR A;  5AI0 A;  4U7C A;  4RQ5 A;  3H4B A;  4NXZ A;  2QLT A;  3M6K A;  2V4R A;  2NRT A;  5KT2 A;  4DSI A;  1A76 A;  2W3R A;  3H0L B;  4A8E A;  3QYP A;  2HHX A;  2B21 A;  2KZ3 A;  4CE6 A;  1RYS A;  4F2S A;  2DF4 B;  5J0Y A;  5J0O A;  1Z3E B;  2IBK A;  3MR6 A;  4ELU A;  3WKE A;  7ICH A;  5E79 U;  1U48 A;  1X2I A;  2MSN A;  3K1R B;  2LM1 A;  2KMD A;  1SXD A;  5G5H A;  3OJU A;  4RQ2 A;  4DOC A;  3SAH A;  4M9G A;  4F91 B;  1LKY A;  1KQQ A;  2KFN A;  4FZN A;  1MA7 A;  2C2R A;  1NK6 A;  2KHQ A;  3LVW A;  4B9M A;  1S5L U;  3BS7 A;  1JN3 A;  3K1Z A;  1JXL A;  2BGW A;  4B9N A;  8ICL A;  3AQE A;  4EEY A;  4C8K A;  4Z6E A;  2ZIV A;  5J0Q A;  2ESE A;  4G9B A;  5KFR A;  1WYG A;  2KKV A;  3B9J A;  2DQN B;  1KW4 A;  4YXJ A;  5DBB A;  2FMP A;  2W43 A;  1SWV A;  1XO1 A;  5AIB A;  2P6U A;  4KN7 A;  5F9L A;  2ZXI A;  8ICA A;  1JAL A;  3BQ7 A;  3M7D A;  2CPR A;  3QU4 A;  3JPT A;  4IQV A;  8ICO A;  4IQW A;  2FLL A;  2JMG A;  2HVH A;  4B9S A;  1ZQX A;  3HJE A;  3GZF A;  5AIC A;  2RDJ A;  2KNJ A;  4I2I A;  3CW2 C;  3PV8 A;  4M47 A;  5AKI A;  5FP0 A;  1XU4 A;  3GQC A;  4QJF B;  1ZD5 A;  3AUO A;  3OSP A;  3WK4 A;  3A0H U;  3Q8L A;  2IHM A;  3HKZ F;  5ALP A;  2ZIX A;  4RT3 A;  2RP5 A;  2JRZ A;  4F4W A;  1ZYQ A;  4RQ3 A;  5EE0 A;  3EZ5 A;  1U49 A;  9ICI A;  2KJ9 A;  1XSN A;  2NYV A;  5ALF A;  3B0X A;  3H0R B;  4TQS A;  3M9N B;  2OCE A;  4K4I A;  4FE3 A;  9ICP A;  5KFN A;  3HKZ C;  3GIL A;  2ALZ A;  3ZDD A;  4RUC A;  5EE3 A;  4C0Z A;  1L8O A;  2WTF A;  1L5U A;  1BPY A;  1IIP A;  3PW0 A;  4NLZ A;  3OGU A;  4DL6 A;  2KG5 A;  3TAN A;  3G6V A;  5IIK A;  1RM6 C;  5KFI A;  3PNC A;  1RPL A;  4Q8E A;  4YR0 A;  9ICH A;  3BZC A;  4EBE A;  1JXE A;  1MC8 A;  4QWE A;  4GXK A;  5KFD A;  1NJX A;  4PJ0 U;  3F53 A;  3UMB A;  3TAR A;  9ICG A;  2YX8 A;  4YD2 A;  3DV9 A;  1ZRM A;  2WF9 A;  3TAP A;  3L4P A;  4F4K A;  4P0Q B;  4DF4 A;  5C0Y A;  1B0X A;  1P7D A;  3QEA Z;  3UXO A;  2GLE A;  4NLB A;  1L8L A;  2E5S A;  1ZQD A;  1BPD A;  2RRD A;  2HBM A;  3WKD A;  5J0U A;  2NO5 A;  3UMG A;  5KAI U;  2F3N A;  5DLG A;  5BPC A;  4US9 A;  3D6J A;  2QAR B;  5KFZ A;  3Q8Q B;  4NLN A;  9ICN A;  3GV8 B;  3SAG A;  4EX6 A;  5CEH A;  3SZ2 A;  5ALS A;  5ALL A;  3MGV A;  2XIC A;  3R9K A;  3QUB A;  5DQI A;  2KTQ A;  1IV8 A;  4RQ0 A;  3M9M B;  2PXI A;  2FLP A;  2KFZ A;  4GXI A;  4KLT A;  1L7N A;  4IR1 A;  2VA3 A;  4CF3 A;  7ICQ A;  5ALT A;  5KFV A;  1K1Q A;  4UB5 A;  4M6W B;  4TUP A;  4DSL A;  3GII A;  3IG5 A;  1Q3U A;  5HR7 A;  2IHN A;  3LVV A;  1ZQR A;  3E0F A;  3BDP A;  1KEJ A;  3MC1 A;  1D9D A;  2LHT A;  5DGA A;  2J6T A;  3AEV A;  4DS5 A;  2AGO A;  4P4O A;  2MUT A;  3KHH A;  3JPN A;  1NKB A;  3GDX A;  3TI0 A;  5DLF A;  2DPI A;  2EQY A;  2H3I A;  2HBJ A;  2W9C A;  2VJ5 A;  2YB4 A;  5HHI A;  4DQI A;  2VKQ A;  1CUK A;  2HHT A;  2ZTD A;  3QU5 A;  3E58 A;  4US8 A;  1X66 A;  1ZRN A;  2YY6 A;  5JRT A;  1ZXI A;  4J9L A;  3HW8 A;  4DS4 A;  4MF8 A;  1L7M A;  2K4P A;  2W9B A;  1D8Y A;  4ECZ A;  1DRG A;  2YTU A;  4C80 A;  1L7P A;  1RQL A;  2KIC A;  1S97 A;  1Z1V A;  3N7S C;  4F5Q A;  3ZD9 A;  3MR5 A;  2R8J A;  3AMZ A;  8ICX A;  5KFL A;  4I2C A;  2LM4 A;  3RTV A;  1ZQC A;  1Z00 A;  3GFK B;  1C7Y A;  4FBT A;  1ZQI A;  5ALZ A;  2LMR A;  3V72 A;  1S10 A;  1L3U A;  5KG3 A;  3T79 A;  1TVA A;  4OJ6 A;  1KBU A;  1WCL A;  4B9L A;  3H4D A;  1X9M A;  4F4Z A;  4CRX A;  4C7Z A;  2AHO B;  3ONN A;  3QU2 A;  4FS2 A;  2AGQ A;  5ALQ A;  2XGQ A;  4KX3 A;  3BQ2 A;  2NO4 A;  1RYU A;  1SV0 A;  2F1I A;  4QIW F;  3C29 A;  3UQ0 A;  4ECU A;  4EX7 A;  2KK0 A;  5C5J A;  1ZQT A;  1OXJ A;  3MAB A;  2FMS A;  1ZQV A;  2V4Q A;  2HW3 A;  2MRL A;  4OJ5 A;  3ISB A;  5IIJ A;  1URJ A;  2V9W A;  2E1E A;  2XC9 A;  2VIX A;  4DSF A;  2AQ0 A;  4ED3 A;  3IDW A;  2HCF A;  7ICO A;  1IM4 A;  4EEL A;  1F44 A;  4ECX A;  4EYI B;  4DEZ A;  5K4L A;  5CJ7 A;  3ZDB A;  4JMU A;  2KOB A;  3KKA A;  3QZ7 A;  4QIW C;  3MFI A;  3RRH A;  4QZB A;  5KFP A;  3RRG A;  5DG7 A;  2OYY A;  1V9P A;  5F3X B;  1Z19 A;  2XY5 A;  2BCV A;  4QZI A;  4I2H A;  4O5C A;  3IRU A;  2BPC A;  3AQF A;  4R8U A;  5J2J A;  2VAN A;  4ICA A;  5CA7 A;  5DB7 A;  3DEE A;  8ICS A;  3RJG A;  2W9A A;  4C4T A;  1Y88 A;  4RQN A;  5AK5 A;  3Q8P B;  4B9V A;  3I76 A;  1NZB A;  2K4I A;  2WB1 F;  8ICZ A;  4DL4 A;  1NOM A;  4FFD A;  4I2A A;  2A1J A;  4C4S A;  3PZP A;  4RQ6 A;  3JPO A;  2G09 A;  5GTH U;  1ZQU A;  4YXM A;  4QWC A;  1DK3 A;  2D8C A;  1NJW A;  4DSE A;  4ECQ A;  3KHR A;  1HEK A;  2JZB B;  3KD3 A;  2WB1 C;  1QCK A;  2ZJ8 A;  1N60 A;  2CN1 A;  3RH5 A;  2KHV A;  3RBE A;  4QWD A;  2R8I A;  4QZF A;  3D2S A;  5KTQ A;  4I2E A;  4C8M A;  2KZM A;  1WWV A;  7ICT A;  2GWS A;  3T5H A;  2F44 A;  3J81 j;  4DFK A;  2R8K A;  3I28 A;  4YQW A;  1Z4N A;  4NL9 C;  2M0N A;  1T4G A;  1SZH A;  2Y1I A;  4KLG A;  4RZR A;  2DFL A;  3H8M A;  4EYH B;  1DOQ A;  3SEN A;  9ICA A;  2HBL A;  3O0F A;  2K8C B;  3NVZ A;  4DO9 A;  5KT3 A;  1TK0 A;  2F76 X;  3TQ1 A;  5AK6 A;  1U45 A;  8ICV A;  2NRZ A;  4M9L A;  4ECW A;  1O03 A;  2KJ5 A;  5AKH A;  5KFG A;  2OXO A;  3ORY A;  4PGQ A;  4C8L A;  1L7O A;  4ZH4 A;  1T7P A;  1QQ6 A;  3KOO A;  3VCB A;  3S6J A;  4J9P A;  3GV5 B;  1PK1 B;  3NS1 A;  4J9Q A;  2KZZ A;  1FO4 A;  4R66 A;  4DQR A;  1ZQH A;  3QEB Z;  3TAC B;  2MU2 A;  3ALR A;  1UPH A;  4LJX A;  1ZQF A;  8ICH A;  2W3S A;  1JX4 A;  4DSJ A;  1RQN A;  4QZC A;  1AQ6 A;  7ICE A;  2HHS A;  2LYH A;  1U4B A;  2JEI A;  4OJL A;  4F5N A;  2ZUD A;  3EW9 A;  4C4R A;  3V6H A;  1EXN A;  1ZQW A;  5IIN A;  1NKC A;  3PX4 A;  2JV3 A;  1TV9 A;  4BXO B;  5B5E U;  1KRP A;  9ICX A;  8ICI A;  4RUA A;  2PI4 A;  5AKK A;  4KIT B;  1WWU A;  3L5K A;  5JTI A;  3PW7 A;  2DKX A;  3KHL A;  4O3P A;  2AQ4 A;  1PK3 A;  1MQ2 A;  3SMV A;  3N7R C;  5ALK A;  4RQ7 A;  1L3S A;  4NJ8 A;  4IRK A;  2GOL A;  1SV4 A;  1QQ5 A;  1QH9 A;  2Q0Z X;  2F8L A;  1TAQ A;  4RQ1 A;  5DB8 A;  3CRX A;  9ICQ A;  1S0V A;  4KMO B;  2G5I B;  1KFS A;  2FPM A;  2BCR A;  4UAZ A;  3PML A;  1UCV A;  4TUQ A;  3C28 A;  3PO5 A;  4YD1 A;  2FLN A;  5J8Y A;  1SGG A;  2YMP A;  1WCN A;  3UPQ A;  2YB1 A;  4MHV A;  3LDA A;  3V7L A;  1NK7 A;  3TKA A;  5BOL A;  2IOF K;  4P0Q A;  2C2D A;  5KL1 B;  2G07 A;  7ICR A;  1QSS A;  7ICG A;  4JWN A;  2WF8 A;  2XID A;  1FFU A;  4JV0 A;  4U6P A;  3RJI A;  4CGZ A;  2XCA A;  3TFS A;  3BS5 B;  2KIW A;  2YMM A;  4Q45 A;  7ICM A;  5J2F A;  4IR9 A;  1ZQK A;  1ZQL A;  4MEX A;  2QAR A;  4I27 A;  3TAD C;  4F4X A;  2W8L A;  3N28 A;  1NK9 A;  4YMM A;  3PVX A;  2B0C A;  7ICS A;  1SZP A;  5J2E A;  3SV4 A;  3NRZ A;  4P4P A;  5B66 U;  5BOM A;  4ELT A;  5AM3 A;  3HRD D;  4UBC A;  5J0W A;  4O0I A;  2W54 A;  3UM9 A;  3PR5 B;  2KIV A;  3QUC A;  4M6W A;  3ZD8 A;  2XY6 A;  3C5F A;  4USA A;  3E2E A;  2JEF A;  5CP2 A;  2E8O A;  2N1R A;  4XQ8 A;  1ARO P;  5AM2 A;  5KFW A;  3T5L A;  3C5G A;  2DKZ A;  4J9S A;  4MFA A;  2HDO A;  5EWE A;  3GU3 A;  3GIK A;  5ALM A;  1COO A;  3MFH A;  1FEZ A;  1ZJM A;  3N97 B;  1KFD A;  4O3N A;  4ECS A;  1RZT A;  3OJS A;  2KP7 A;  4O3O A;  1PVP A;  2VA8 A;  5AKG A;  4M9J A;  1MQ3 A;  1PVQ A;  5AIA A;  4Y2V A;  1NZP A;  5KG5 A;  1CI4 A;  1FIQ A;  5EE9 A;  4I2J A;  3UXN A;  1U47 A;  3RR7 A;  2KJ8 A;  1B43 A;  4I2D A;  2W11 A;  3T5J A;  3LK9 A;  3ICX A;  4DFJ A;  4YMN A;  4Z6C A;  2ISO A;  4ACO A;  3AN1 A;  5DBA A;  4QWA A;  2YMQ A;  4RPZ A;  1Q46 A;  4O9M A;  4UAS A;  3RAQ A;  4MFC A;  4YG2 A;  1N5W A;  2ZTC A;  5KFK A;  1ZD2 P;  8ICE A;  2K60 A;  3JPQ A;  4I2G A;  3M8S A;  2DGZ A;  3N4M B;  1NK0 A;  3AU2 A;  1ZQY A;  5EWF A;  5AI8 A;  4TUS A;  3C2K A;  4PHA A;  5CHG A;  2R18 A;  3Q8K A;  4TQR A;  2OHF A;  4I28 A;  5DDM A;  2QB1 A;  5KFC A;  4EEN A;  8ICT A;  3MGI A;  8ICF A;  4ECR A;  3ISC A;  1V38 A;  3NVV A;  4BX9 C;  1MN8 A;  1SKS A;  3FAH A;  4F3O A;  3PW5 A;  5ALN A;  5ALD A;  8ICQ A;  3THV A;  4KLF A;  2QB0 B;  4TUR A;  4PH5 A;  3LWM A;  4FZM A;  4CF5 A;  4I2F A;  3A0B U;  3EPI A;  5HR6 A;  1KDH A;  3OHB A;  3WK7 A;  5DBC A;  2P35 A;  2EZY A;  4Z6D A;  4F5R A;  3L3F X;  4QZE A;  5KT4 A;  3H8J A;  2K8B B;  3IP4 B;  9ICU A;  2W7O A;  1SB3 C;  2F1J A;  1NK8 A;  3V7K A;  4DSK A;  3ZDC A;  3T3F A;  4AYB F;  4ED1 A;  4HYK A;  1UT8 A;  4QZA A;  3PSP A;  2DUY A;  4MEY A;  4IQU A;  2WF6 A;  2ZUB A;  2C2E A;  2DBY A;  4E0D A;  3G6Y A;  5HML A;  4F72 A;  1KKX A;  3H8W A;  1H38 A;  4ELV A;  5J0R A;  1SV0 C;  5AM1 A;  4B6J A;  1S9F A;  1YZ7 A;  2KN7 A;  1BPE A;  5DG8 A;  1ZQS A;  1Z4O A;  2XY7 A;  3PO4 A;  2F77 X;  1CEZ A;  1X42 A;  4AYB C;  4RT2 A;  4HAI A;  2KSO B;  2EDU A;  4PZN A;  2E3T A;  3RB0 A;  1N62 A;  2AGP A;  8ICK A;  3MBY A;  1SL0 A;  3JPP A;  4XUS A;  4X5V A;  2I9G A;  3BQ1 A;  2BCS A;  4DWI A;  4RQ8 A;  2JZB A;  5IIO A;  3T5K A;  1ZQJ A;  5AI5 A;  2ZIU B;  4IQT A;  5ALI A;  5KFA A;  4F5O A;  2EAO A;  2WHE A;  2RQ5 A;  1PUZ A;  4DQQ A;  2MAX A;  2ASJ A;  2FE9 A;  1S0N A;  3HT3 A;  3BZK A;  1KSP A;  4WJ3 B;  1ED1 A;  4RQ4 A;  2K4E A;  4DQS A;  1N61 A;  2KVC A;  8ICN A;  2DL0 A;  3OHA A;  5CR0 A;  3NTU A;  3RJE A;  1QSY A;  5KFQ A;  4UAR A;  1C20 A;  5GTI U;  2R8H A;  1S8O A;  3F2C A;  4OJP A;  3QU7 A;  2FMQ A;  5AM4 A;  5J2D A;  1ECW A;  3FM9 A;  3Q8M A;  3IN5 A;  1QQ7 A;  5D49 A;  1NNL A;  4IRD A;  3IG8 A;  5AKL A;  1UQV A;  2YML A;  1V85 A;  2NRW A;  1HJP A;  2BDP A;  2ZUC A;  2HMX A;  1S0O A;  1PK1 A;  4PL1 A;  4KLJ A;  9ICJ A;  2PFQ A;  4GC7 A;  1NJY A;  1JUD A;  4UB4 A;  1ZQP A;  2Z7J A;  1DXS A;  2IA6 A;  2Y9T A;  2JXJ A;  3HX0 A;  5DDY A;  5AM5 A;  3AU6 A;  2A1A A;  4EEK A;  5KFU A;  1L6N A;  1KFT A;  3NGD A;  1SL2 A;  1X9S A;  2HOQ A;  1ZQO A;  5IIL A;  3ED5 A;  1OW5 A;  1BPZ A;  4YCX A;  5J2I A;  2ZJA A;  9ICK A;  1DGJ A;  4ED6 A;  1N2X A;  2E8M A;  3C21 A;  4RNM A;  2ZIW A;  5ALW A;  4G3I A;  1B4F A;  1SKR A;  1HUZ A;  4DFM A;  5DB6 A;  4RNN A;  5J2C A;  2VA2 A;  8ICU A;  4QWB A;  2F1H A;  2C28 A;  1ZQA A;  3QZ8 A;  4R64 A;  2JR5 A;  5L1I A;  3ETL A;  3ZDE A;  5AKE A;  4B9T A;  1Z1B A;  8ICP A;  4I2B A;  2FI1 A;  5AI4 A;  3MR2 A;  3IM1 A;  2H3F A;  5JU5 A;  4FO6 A;  4M2Y A;  4NV0 A;  2NRX A;  1BVS A;  4QZ8 A;  4IL6 U;  2BZF A;  3QUQ A;  4DL2 A;  1J97 A;  2FDR A;  2F8K A;  4FZL A;  5KL8 B;  2EZZ A;  4KLQ A;  4JB3 A;  5DG9 A;  4Y2T A;  3M6Z A;  5KFE A;  2KD1 A;  5KT7 A;  4O3M A;  4BWM A;  4ED0 A;  2OWO A;  4QZD A;  4EZ6 A;  3IV6 A;  2ISP A;  4CCH A;  3KZI U;  1A77 A;  4EZ9 A;  2PI5 A;  1T3Q A;  5JUM A;  3WK5 A;  3PW4 A;  2M9N A;  4LZD A;  9ICE A;  4QW8 A;  2JH1 A;  1F0M A;  5KFS A;  4JV1 A;  3SEI A;  1TAU A;  2AU0 A;  4NLC A;  4J9R A;  3BS5 A;  3SR6 A;  3WU2 U;  1K1S A;  1X9X A;  1HUO A;  4ECY A;  2JEJ A;  4IRC A;  1XWL A;  1WUD A;  3WK6 A;  4F71 A;  2A3V A;  3WKC A;  4PPX A;  3LYS A;  5HHH A;  1K5O A;  3I1Y A;  2IOF A;  2FJ6 A;  2LBO A;  2R8G A;  1RYR A;  7ICV A;  3EWA A;  3RH6 A;  9ICS A;  4UAT A;  8ICB A;  5ALE A;  1B22 A;  3JPS A;  1X6J A;  2KE7 A;  5KG0 A;  4KMU A;  1SKW A;  9ICW A;  2CXY A;  3NUQ A;  2HHU A;  3MDC A;  2W9M A;  3WK8 A;  3NRW A;  5H2F U;  3H7I A;  4ED7 A;  4DOA A;  1S76 D;  4QZG A;  4OO1 J;  2HI0 A;  1WG8 A;  4UQG A;  5J2A A;  5KFY A;  4UAW A;  3TFR A;  2ZTE A;  3PW2 A;  2RLT A;  1RXV A;  2YN4 A;  1KL9 A;  1BPB A;  1UA0 A;  2FPK A;  5L9X A;  4QZH A;  4F2R A;  4MFF A;  3MR3 A;  4KLS A;  4XA5 A;  4RU9 A;  1U9L A;  7ICU A;  4F93 B;  2CRX A;  3C1Z A;  5J2G A;  1TK5 A;  2NV3 A;  4C8O A;  4OJO A;  4UW9 A;  4K4H A;  4UB2 A;  4YMO A;  2A19 A;  3RJJ A;  4Y2S A;  4BUG A;  2WF5 A;  1T8E A;  3QU9 A;  2PFP A;  1UT5 A;  3BQT A;  5ALV A;  1Q8K A;  2KVS A;  5KFH A;  4MF2 A;  3OTQ A;  1JRO A;  3AL0 B;  4B9U A;  5AM0 A;  2BPG A;  9ICB A;  4J9K A;  1VLB A;  1LVH A;  1UA1 A;  4GIB A;  3CYM A;  8ICR A;  3V6K A;  3SI8 A;  3K75 D;  2LYA A;  3UXP A;  1JMS A;  5CRX A;  4PHE A;  4P0P B;  2PMZ F;  5ALO A;  2HSZ A;  4DQP A;  3QNM A;  2ZG6 A;  1NI3 A;  5EE1 A;  5KFT A;  4KLE A;  4EBC A;  4QZ9 A;  2JHD A;  5J29 A;  2D6F C;  3PR4 A;  4LVS A;  2ZXH A;  2YQE A;  1KTQ A;  4GLX A;  5KFX A;  3PSF A;  2XVT A;  3CNH A;  4P2H A;  3HIL A;  5KFM A;  3G6X A;  3HPO A;  1A6S A;  2BKE A;  2ODG A;  2PMZ C;  2XI9 A;  5TZV A;  2G06 A;  3KZX A;  2DPJ A;  1BNO A;  2QB0 A;  4YVZ A;  3K4G A; 
#chains in the Genus database with same CATH homology
 3ISD A;  4M0A A;  5DBC A;  1ZQE A;  4Z6D A;  4F5R A;  4QZE A;  4QZB A;  1XSL A;  4M9N A;  4PGX A;  3JPR A;  4RPY A;  8ICW A;  9ICV A;  9ICF A;  5EOZ A;  2BCV A;  4QZI A;  5IIM A;  9ICU A;  5DKW A;  4I2H A;  4O5C A;  9ICR A;  3V7K A;  5J2K A;  2BCU A;  5DB9 A;  5J2J A;  5DB7 A;  8ICS A;  4PHD A;  4R63 A;  3RJG A;  4KLM A;  4QZA A;  4O5K A;  7ICF A;  4IQU A;  4LZG A;  4O5E A;  8ICZ A;  5J0R A;  4NY8 A;  5CWR A;  4I2A A;  1BPE A;  4RQ5 A;  4RQ6 A;  3JPO A;  4NXZ A;  3RJK A;  1ZQS A;  8ICM A;  9ICT A;  1DK3 A;  3RJH A;  4RT2 A;  4KLD A;  4PGY A;  5J0Y A;  5J0O A;  4NM1 A;  8ICK A;  3MBY A;  7ICH A;  3RH5 A;  3JPP A;  4XUS A;  2I9G A;  4X5V A;  2BCS A;  4NM2 A;  4QZF A;  4RQ8 A;  9ICM A;  5IIO A;  1ZQJ A;  4I2E A;  4M9H A;  7ICT A;  4IQT A;  2GWS A;  1ZQG A;  4F5O A;  4RQ2 A;  4DOC A;  4M9G A;  4KLG A;  5J0P A;  9ICA A;  5III A;  8ICL A;  4Z6E A;  4DO9 A;  5J0Q A;  4RQ4 A;  8ICN A;  8ICJ A;  9ICL A;  3RJE A;  4JWM A;  4UAY A;  8ICV A;  5DBB A;  7ICP A;  4M9L A;  2FMP A;  4PGQ A;  4DOB A;  2FMQ A;  5J2D A;  8ICA A;  2PFN A;  5D49 A;  4RPX A;  1DK2 A;  3JPT A;  4IQV A;  4K4G A;  8ICO A;  4R66 A;  4IQW A;  1ZQH A;  8ICC A;  1ZQF A;  4I2I A;  8ICH A;  5J2B A;  4KLJ A;  9ICJ A;  4Z6F A;  4M47 A;  2PFQ A;  4QZC A;  7ICE A;  4UB4 A;  1ZQP A;  3PMN A;  4F5N A;  3HX0 A;  5DDY A;  4KLO A;  3AU6 A;  7ICI A;  3AUO A;  5IIN A;  2IHM A;  1ZQO A;  1TV9 A;  5IIL A;  7ICN A;  3RH4 A;  4RT3 A;  1BPZ A;  9ICX A;  8ICI A;  4YCX A;  5J2I A;  9ICK A;  4RQ3 A;  9ICI A;  1MQ2 A;  1XSN A;  1HUZ A;  4PHP A;  9ICO A;  5DB6 A;  3B0X A;  5J2C A;  4RQ7 A;  8ICU A;  4YN4 A;  4UB3 A;  1ZQA A;  8ICY A;  4K4I A;  4R64 A;  9ICP A;  5J0X A;  4RQ1 A;  4GXJ A;  4NLK A;  4UBB A;  8ICP A;  5DB8 A;  4I2B A;  9ICC A;  1BPY A;  9ICQ A;  3V7J A;  4KLU A;  4NLZ A;  3OGU A;  2BCR A;  5IIK A;  3PNC A;  4FO6 A;  4UAZ A;  4M2Y A;  9ICH A;  4QZ8 A;  3PML A;  4TUQ A;  4GXK A;  4YD1 A;  4KLQ A;  9ICG A;  4YD2 A;  3C2L A;  3UPQ A;  1ZQB A;  3V7L A;  5J0S A;  4F5P A;  4UB1 A;  1BNP A;  5BOL A;  4QZD A;  3MDA A;  3UXO A;  7ICR A;  2ISP A;  7ICG A;  1ZQD A;  4JWN A;  5D46 A;  1BPD A;  1BPX A;  1ZQQ A;  5J0U A;  4LZD A;  9ICE A;  3RJI A;  3TFS A;  5BPC A;  7ICM A;  5J2F A;  4NLN A;  9ICN A;  1HUO A;  1ZQK A;  1ZQN A;  1ZQL A;  2PFO A;  7ICJ A;  4I27 A;  2BCQ A;  4I29 A;  4PPX A;  3MGH A;  4RQ0 A;  4YMM A;  5HHH A;  2PXI A;  7ICS A;  4GXI A;  2BPF A;  4KLT A;  8ICG A;  7ICV A;  7ICQ A;  3RH6 A;  9ICS A;  5J2E A;  8ICB A;  3JPS A;  4UB5 A;  4TUP A;  5BOM A;  4UBC A;  5J0W A;  1ZQR A;  9ICW A;  3C5F A;  4KLI A;  1KEJ A;  3MDC A;  2W9M A;  3RJF A;  4DOA A;  3JPN A;  4QZG A;  3C5G A;  3GDX A;  4MFA A;  5J2A A;  4UAW A;  3TFR A;  4M04 A;  5HHI A;  1ZJM A;  4QZH A;  1RZT A;  2KP7 A;  4MFF A;  4KLS A;  4XA5 A;  4R65 A;  3HWT A;  4M9J A;  7ICU A;  1MQ3 A;  3HW8 A;  4MF8 A;  5J2G A;  1NZP A;  4KLH A;  3B0Y A;  1ZJN A;  4K4H A;  4UB2 A;  3UQ2 A;  4YMO A;  4I2J A;  3UXN A;  3RJJ A;  4KLL A;  5J2H A;  2PFP A;  1ZQM A;  4I2D A;  3LK9 A;  4F5Q A;  1XSP A;  4YMN A;  4Z6C A;  2ISO A;  4MF2 A;  8ICX A;  5CB1 A;  5DBA A;  4RPZ A;  4O9M A;  7ICK A;  4MFC A;  2BPG A;  9ICB A;  4I2C A;  1ZQC A;  8ICE A;  8ICR A;  3JPQ A;  5D4B A;  4I2G A;  1ZQI A;  3AU2 A;  3V72 A;  1TVA A;  2P66 A;  3UXP A;  1JMS A;  4TUS A;  3C2K A;  4PHA A;  4PHE A;  3C2M A;  4I28 A;  4KLE A;  4QZ9 A;  5J29 A;  4LVS A;  8ICT A;  3MGI A;  3UQ0 A;  8ICF A;  1ZQT A;  3ISC A;  7ICL A;  2FMS A;  4P2H A;  3ISB A;  5IIJ A;  8ICQ A;  5J0T A;  4KLF A;  4TUR A;  4PH5 A;  5TZV A;  7ICO A;  4I2F A;  1BNO A;  1KDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...