2KP7A

Solution nmr structure of the mus81 n-terminal hhh. northeast structural genomics consortium target mmt1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
80
structure length
80
Chain Sequence
RPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure and DNA binding mode of the Mus81 n-terminal helix-hairpin-helix domain
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Crossover junction endonuclease MUS81
total genus 25
structure length 80
sequence length 80
ec nomenclature ec 3.1.22.-:
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2kp7A01
3B0YA 4UB2A 3JPRA 3RJJA 5BOMA 5DDYA 4KLSA 4TUPA 1ZQBA 4R65A 4NM1A 3B0XA 5J2CA 3UQ2A 4XA5A 4RQ6A 3JPQA 4DOAA 1ZQGA 2FMPA 4KLJA 5J2EA 3PNCA 3MGIA 5EOZA 3UXOA 4O5CA 5J0XA 2BCRA 4O5KA 1KDHA 3RJGA 9ICTA 4QZ8A 4O9MA 5J2KA 3RH6A 4PH5A 9ICUA 3UXNA 4M47A 3ISDA 3ISCA 8ICCA 3MGHA 5J2IA 8ICAA 4I2GA 1BPXA 8ICLA 9ICGA 4M9GA 4I2EA 4I2AA 1BNOA 4R63A 4PHEA 4F5RA 7ICJA 5J0SA 5IIMA 2BPFA 4KLHA 5TZVA 4RPXA 4R66A 1BPEA 4O5EA 3JPOA 4RQ4A 5J0UA 4PHAA 4PGYA 1BPDA 4PHDA 5J0PA 4Z6FA 5HHHA 8ICQA 4I2DA 4R64A 2FMSA 8ICWA 3AUOA 4JWMA 1KEJA 5J29A 2ISOA 1RZTA 1BNPA 3C2MA 3LK9A 7ICTA 8ICBA 1ZQSA 4UAWA 9ICFA 5DBBA 5IINA 9ICAA 4M9LA 4RPZA 4LZDA 1DK2A 4I2JA 8ICNA 4QZGA 4NY8A 4QZFA 4F5QA 5J0OA 4F5OA 1ZQQA 3RH4A 2GWSA 5BOLA 7ICMA 7ICHA 4I27A 5DBCA 7ICSA 3HW8A 4YCXA 4JWNA 3C2LA 4Z6DA 4QZDA 5DB9A 4NLNA 8ICOA 4Z6EA 4YD1A 1BPYA 9ICBA 4M2YA 4Z6CA 5J0WA 1ZJNA 5J0YA 9ICQA 1ZQNA 2BCUA 1TVAA 2ISPA 2I9GA 1ZQRA 4K4HA 4KLUA 5J0QA 8ICXA 1TV9A 1ZQLA 3RJHA 4KLIA 1MQ2A 4YMOA 5J2JA 4FO6A 5J2BA 4I2BA 4RQ3A 5J2DA 4I2CA 4DOBA 3RJFA 9ICRA 7ICOA 7ICEA 2PFOA 3RJIA 5IIIA 4UB5A 7ICLA 4I29A 5DBAA 2KP7A 8ICMA 8ICPA 1XSNA 4K4IA 2PFQA 4TURA 4LZGA 3V7KA 5IILA 1ZQHA 5DB8A 7ICRA 5CB1A 2PFPA 4YN4A 1ZQDA 4NLZA 1DK3A 5DB7A 8ICZA 4MF8A 4UAYA 4M9JA 9ICPA 7ICUA 4RT3A 4RT2A 4M04A 3UQ0A 4KLQA 4KLMA 9ICIA 3JPTA 4QZCA 4NLKA 3HX0A 2BCQA 4QZIA 4PGXA 1XSLA 4MF2A 3UPQA 1ZQEA 4UBBA 7ICKA 4GXKA 1ZQCA 3MDAA 4YMNA 9ICSA 4UB3A 9ICCA 4F5NA 5DKWA 8ICKA 4M9HA 8ICHA 3TFRA 1ZQTA 4RPYA 9ICHA 4K4GA 3MBYA 4RQ1A 5J0RA 4I2FA 4PPXA 8ICSA 8ICUA 3V72A 3V7JA 5J2AA 8ICEA 4PHPA 3AU2A 4KLTA 5J0TA 2FMQA 9ICMA 4PGQA 7ICNA 2BCVA 3JPSA 7ICPA 5IIOA 4KLGA 9ICKA 2BPGA 4GXJA 3C5GA 2P66A 9ICNA 1ZQKA 4I28A 9ICVA 4KLEA 8ICRA 4QZAA 3AU6A 4P2HA 4RQ0A 5DB6A 5IIJA 4UB4A 4YD2A 4I2IA 4UB1A 1HUZA 4KLFA 9ICLA 1ZQIA 4LVSA 1XSPA 2PXIA 3GDXA 3RJEA 5J2FA 4QZEA 4QZHA 5J2HA 1ZQMA 3JPPA 3RH5A 4DO9A 3OGUA 4KLDA 4IQUA 5D49A 5D46A 4IQWA 4RQ2A 8ICTA 8ICJA 1BPZA 8ICIA 3UXPA 9ICOA 1ZQOA 4KLLA 7ICQA 2PFNA 8ICFA 1MQ3A 1ZQPA 8ICVA 9ICJA 3C2KA 7ICIA 1JMSA 5IIKA 3JPNA 4I2HA 4RQ5A 4IQVA 4M0AA 4MFAA 4RQ8A 4KLOA 4NXZA 9ICWA 4M9NA 4XUSA 4YMMA 1HUOA 2IHMA 4TUSA 3HWTA 1ZQFA 3MDCA 2BCSA 7ICGA 3PMLA 7ICVA 3C5FA 5CWRA 3ISBA 4TUQA 4MFCA 3PMNA 4NM2A 9ICXA 7ICFA 4MFFA 2W9MA 4RQ7A 9ICEA 4QZBA 4UBCA 4IQTA 3RJKA 4QZ9A 5BPCA 4GXIA 8ICGA 5D4BA 3V7LA 5HHIA 4DOCA 1ZQJA 1NZPA 8ICYA 1ZJMA 1ZQAA 4F5PA 4X5VA 3TFSA 4UAZA 5J2GA
chains in the Genus database with same CATH superfamily
3OJUA 1F44A 3H0RB 4UB2A 3AM9A 4JK1A 1SWWA 1T7PA 4Y2QA 5BOMA 5HMLA 4AP9A 2ZTEA 4TUPA 1NKEA 2LM4A 3TQ1A 5J2CA 2ZIUB 4RQ6A 2KG5A 3JPQA 2EZYA 4O0IA 2WAQC 2G09A 1ZQGA 1SXEA 1LB2B 5KG1A 5J2EA 4ED1A 4O5CA 1DXSA 3H8JA 3ZI4A 4NV0A 5DG8A 5J0XA 3THVA 3CRXA 2NRVA 2DKZA 3HILA 2KIVA 5ALNA 5F9LA 5EE3A 3UXNA 4US8A 3KD3A 4C8OA 3BDPA 2EH9A 2FLLA 2E1EA 3KZIU 1T94A 1XWLA 1Z1BA 1X9WA 4C4SA 2HHVA 1NK8A 4QJFB 1BNOA 4PHEA 4EX6A 5IIMA 4DL5A 4ICAA 4ECXA 2IA6A 5ALRA 1NZBA 4CRXA 3G6XA 4R66A 3WKEA 5KG3A 2XIDA 4RQ4A 5J0UA 3H7IA 4J9PA 2HBJA 4UAVA 4PGYA 2VJ4A 1SKRA 3PW2A 5HHHA 1XC9A 2F8KA 2FMSA 4ED7A 1KEJA 5J29A 5EWFA 3TADA 4Y2XA 3C28A 1L6NA 1ZQSA 3K1RB 9ICFA 3K4GA 2W43A 2OWOA 2AGPA 2VA2A 5AM0A 9ICAA 4C80A 1URJA 4RPZA 3MFIA 4LZDA 1U9LA 2A1JB 2HBLA 1RYSA 2UVUA 3QZ7A 3E2EA 4KN4A 4CCHA 3RFAA 3GZFA 3H0MB 4Y2SA 1RYRA 2MUTB 2HHSA 2HOFA 2PMZF 2JV3A 1NI3A 3BJYA 4YR3A 4I27A 1X6IA 3NASA 1Z19A 2R18A 4QW8A 3RR7A 4RUCA 4JWNA 2R8IA 5AI4A 4Z6DA 5ALJA 4ZH4A 2QARA 5HMMA 4MEXA 2R8JA 3IP4B 4Y2PA 1RG6A 2KHQA 4NLNA 2MAXA 3KOOA 4FFDA 1D9DA 2WFAA 1BPYA 2Z7JA 4DCCA 2CXYA 1LVHA 1NNLA 4PJ0U 4RU9A 3H0LB 4LJXA 3OSPA 2KZ3A 2K4IA 3IM1A 3RJHA 1MQ2A 2XY5A 5J2JA 2ZUCA 1KQQA 3WKCA 4FO6A 5KFXA 2OEHA 2E5SA 3GFKB 3RAQA 4BXOA 4DL7A 3C23A 5AKEA 3SR6A 2F2AB 4JUZA 3HT3A 4I2CA 5T14A 4DOBA 3RJFA 2KFNA 2ZJ5A 1NJXA 2Y0SF 1KSPA 1ZQXA 2EZXA 1WCNA 4YR2A 4ECYA 4UB5A 2C2EA 1L7PA 1TK0A 4EENA 5DBAA 3G6VA 2XY6A 3C29A 3ORYA 3MABA 3KHHA 3V7KA 1NK6A 2NO4A 2W11A 4G3IA 1Z00A 1NK0A 5GTIU 1ZQDA 4NLZA 5DQHA 1DK3A 2R8HA 1COKA 2AXTU 4M9JA 3N97B 3UMGA 1ED1A 1AQ6A 4O3NA 3UQ0A 9ICIA 4QZCA 2LPEA 4P0QB 1IG6A 2NYVA 4QZIA 4MF2A 4J9SA 3UPQA 1ZQEA 4FBTA 7ICKA 3NS1A 3UMCA 4J9OA 3QX7A 4P0PA 1KRPA 1MA7A 9ICSA 1OUQA 2VA8A 4F72A 1S76D 2W3RA 2EANA 2JXJA 2YB1A 3EW9A 2WF6A 4B9MA 3SZ2A 4ECTA 4J9LA 4RQ1A 4F50A 5J0RA 3KHRA 3V7JA 3RR8A 2ZIXA 8ICEA 2LI6A 3JPSA 5JRTA 2XY7A 3TI0A 3WK5A 2BPGA 2K4EA 1L7MA 1KFTA 2J6TA 1U49A 9ICVA 4KLEA 3BZKA 3RF9A 4P2HA 4OCZA 5DB6A 2W9BA 1MC8A 4O3QA 3BQ1A 4UB1A 4KLFA 9ICLA 4ELTA 1JI7A 4UW9A 4B9TA 3M8RA 1ZRNA 3EPIA 2PI5A 1QH9A 1TFRA 3RH5A 4QWCA 1S0VA 5ALXA 1J97A 3Q8MA 3I76A 4U6PA 3IG8A 2W7OA 4BGDA 5D46A 3KFUF 4AYBC 4IQWA 5AKXA 2VJ5A 1ZQOA 3ED5A 3SV3A 5J8YC 4E0DA 5AM5A 2NRTA 8ICFA 1MQ3A 1X2IA 1SB3C 3CNHA 2W8LA 4UQGA 7ICIA 3ZD8A 3ZDCA 2IOFA 3JPNA 3L3FX 3TAQA 1O08A 3ICXA 4M0AA 4RQ8A 3F53A 3N7RC 3Q8PB 2QB0A 2W9AA 3BS7A 4M9NA 4RNOA 4XUSA 4YMMA 2IHMA 1IM4A 2HBKA 1ZQFA 3NVVA 4IS7A 4DEZA 2W9CB 2HI0A 2BCSA 1HJPA 1S5LU 3C5FA 4EYIB 1A76A 3M8SA 2KSOB 5KAFU 3T5HA 3ZDBA 4ED8A 5HP4A 2NRZA 2W9MA 3KKAC 4P4OA 1XO0A 2HOIA 4QZBA 1DRGA 2KIWA 2K4PA 3RJKA 1KW4A 4F4ZA 2AU0A 5D4BA 1PVRA 4ECUA 4ELUA 1SZHA 2F1IA 5HHIA 1ZQJA 1K5OA 1SV4A 3T3FA 3BZCA 8ICYA 5EE9A 3M9MB 3A0BU 4F5PA 3TFSA 5J0QA 2HHUA 4ECSA 3B0YA 2LMRA 3JPRA 4Y2TA 5KFGA 3RJJA 2A19A 2Y1IA 4R65A 2R8GA 4Y2YA 1X6JA 1FIQA 5HNKA 2BQUA 4XA5A 5ALMA 1ZQWA 2W55A 1KKXA 3A0HU 5KFAA 2FMPA 4YFKA 5EOZA 2B6GA 1V97A 1JRPA 4O5KA 5ALGA 4DSIA 4CDGA 1RYUA 1ZD5A 4C7ZA 2ASLA 1JN3A 9ICTA 1UA0A 2BR0A 5AK6A 1L3SA 4C8LA 3D2QA 8ICCA 3MGHA 1SKWA 1S8OA 2HHXA 5JUMA 5J2IA 2A3VA 1KFDA 3H40A 3WK8A 3F2DA 5AKGA 5F3XB 4I2EA 2KNJA 2ODGA 5J0SA 2J6SA 3RBEA 4KLHA 3TKAA 1IXRA 4JV0A 5KNIA 1BPEA 3EYZA 4KX3A 3N28A 3PSPA 4PHAA 5AIBA 1BPDA 4PHDA 4F4WA 5J0PA 2OH2A 8ICQA 4IR1A 3MR2A 3ALRA 2P6UA 4I2DA 4R64A 3Q8SB 3PW4A 4NLBA 4M6WA 2ISOA 1PUZA 2W54A 1N5XA 1BNPA 5HR6A 4NJ8A 4TQSA 8ICBA 4UAWA 2BDUA 2W03A 5DBBA 3V6KA 5B66U 2DKXA 1DK2A 3GU3A 2LHTA 8ICNA 2W3SA 2JR5A 5L1KA 4QZFA 2GO7A 5ALYA 5J0OA 1L7NA 5ALQA 3I1YA 1ZRMA 1Z4OA 2J6UA 2JRZA 2JZBA 4NL9A 1TK5A 5ALVA 3SAFA 2YY6A 3WK6A 4OJLA 2HVIA 1WYGA 4QZDA 2GLEA 5DB9A 1S0NA 3QU2A 5CR0A 3H8MA 3PO4A 4F2SA 5KFUA 3OTQA 3GV7B 4DQIA 5ALTA 3C1ZA 5KT2A 2YTUA 3RB3A 2KSOA 4XRHA 4F2RA 9ICQA 1ZQNA 5AKYA 1TVAA 2G5HB 3K1ZA 4R8UB 1RDFA 4KLUA 5ALSA 2GOLA 3QEBZ 1D8YA 3CP8A 2P6RA 2RDJA 5AKIA 5KG2A 3MR6A 2YB4A 5KFLA 1U4BA 4DL2A 3F2CA 1ZQZA 2ALZA 5DGBA 2DPJA 5CJ7A 1TK8A 4I2BA 5DGAA 1F0MA 2KJ5A 3RJIA 1YT3A 2ZIWB 2OCEA 2DBYA 5AM2A 3PX4A 7ICLA 4I29A 4BUGA 3AMZA 5KFHA 8ICMA 5KFSA 1D8BA 1U47A 4LZGA 3BQ0A 1QSLA 3GIMA 1N48A 4YN4A 4PZOA 2HSZA 3O0FA 4DFKA 2KN7A 4MF8A 5DQGA 1QQ6A 2AGOA 4BWMA 7ICUA 4RT3A 3E58A 2E1FA 1COOA 3AQEA 4KLQA 5KAIU 3HX0A 3C1YA 1IV8A 2QARB 3EZ5A 5KG4A 3GIIA 4JMUA 2A1JA 4M6WB 5DG7A 3ZDAA 2NV3A 5EE1A 3BQ7A 1K1SA 3MDAA 4YMNA 4UB3A 9ICCA 4C8KA 1T3NA 1F5SA 4F5NA 3IHQB 4Y2UA 3OJSA 8ICKA 4M9HA 1ZQTA 3IN5A 3BS5A 1SV0C 3MBYA 3KHLA 4DF4A 3TAPA 1ZD2P 3SD7A 5KFJA 4I2FA 1V9PA 4PPXA 8ICUA 3SV4A 3V72A 5J2AA 1SV0A 3HKZC 4KLTA 4TQRA 4ECWA 2ZTCA 5ALPA 9ICMA 2HCFA 4PGQA 2H3QA 2RQ5A 3ZD9A 4BX9C 3QUCA 1M6YA 2DL0A 2P66A 9ICNA 1RXVA 1UT5A 1O03A 4B6JA 3PY8A 2M9NA 5AI9A 4IRKA 1YZ6A 3QUTA 4RQ0A 1RQLA 3ONNA 3PW7A 1WWVA 2JH1A 2K8CB 3RRHA 1L3UA 4DS4A 5G5GA 1XSPA 4ED0A 4EX7A 4C0ZA 5J2FA 2YN4A 4A8EA 4QZHA 2YMPA 2PKEA 3JPPA 4DSEA 4KITB 4B9UA 5KG6A 5AI8A 2ASDA 4DQPA 2ZJ8A 4QWBA 3PW0A 2C22A 3WU2U 4RQ2A 1L8OA 1JIHA 4KLLA 1DGSA 3M9OB 4KN7A 3HKZF 1LV5A 4Q8EA 4DF8A 4DL4A 2BZFA 2KTQA 4KMUA 3C2KA 1XNSA 2FDRA 4UASA 1D8LA 2AH5A 4YQWA 3WKAA 1A0PA 3CW2C 4PL1A 4RQ5A 4I2HA 3TANA 1WCLA 4F4KA 2F76X 4CE6A 2CPRA 4TUSA 1KLNA 2DWQA 2KKVA 2WF9A 4ECRA 1MSWD 2WHEA 4DFPA 3PMLA 7ICVA 5KFBA 4YXMA 1JX4A 3S6JA 4TUQA 5KG7A 1RQNA 1S77D 3PMNA 1QQ7A 4NM2A 2K89A 7ICFA 3GIJA 2H3ZA 2N1RA 5KT3A 4C7YA 4Q8FA 2K4HA 3LYSA 3F2BA 2QLTA 5AI5A 5AI6A 3SI8A 5BPCA 2M0NA 2P35A 1NJYA 2ZXHA 8ICGA 1H38A 2G08A 2KZZA 2R8KA 4DOCA 1ZXIA 4PZNA 2CN1A 2MA1A 2F44A 2V9WA 1ZQAA 4MHVA 3T5JA 5J2GA 5F9NA 2FPLA 3Q8RB 1ZQUA 2FPMA 3RRGA 1Q8KA 2XGPA 4KLSA 4G9BA 1SWVA 3H8SA 2W9CA 1N5WA 4ZOHC 1Z1VA 1WWUA 3V6HA 1U45A 4DOAA 1ZQ1C 3SMVA 3PNCA 5TISU 2Y9TA 1PVPA 2BCRA 4IRCA 1KDHA 5CA7A 3RJGA 2HW3A 4DS5A 1TAQA 2LYAA 1MN8A 5AHXA 2DGZA 2YMMA 4QZ8A 4O9MA 3RH6A 4PH5A 3L5KA 4BWJA 4M47A 5ALDA 2VANA 2RDIA 5KT5A 3RTVA 4C4TA 8ICAA 1BPXA 2W7PA 3MR5A 3QUBA 4UARA 9ICGA 3GIKA 4M9GA 4I2AA 3FYHA 4R63A 4EELA 1N61A 4RZRA 2NO5A 2EAMA 4QIWF 5TZVA 1J2NA 2KE7A 2HMXA 3JPOA 2O6KA 3NVZA 3Q8QB 3V6JA 2AJQA 2KVCA 1ECWA 1S9FA 3AUOA 5GTHU 2IHNA 3I28A 3C2MA 2B0CA 7ICTA 3GV8B 1PK1B 2H5XA 2BQ3A 1SZPA 5ALIA 4OJPA 2XGQA 4IC9A 3PZPA 2ZIUA 3FM9A 4I2JA 4QZGA 2KHVA 4O3OA 4U7CA 2E8OA 4NY8A 5KFQA 3FDSA 1XO1A 5AM1A 3WK7A 5FP0A 4F5OA 4US9A 1BVSA 3RH4A 2GWSA 3OHAA 1QQ5A 5BOLA 2BKEA 4FS1A 4F4YA 7ICMA 4WJ3B 7ICSA 5AKHA 3HW8A 4J9MA 3EWAA 4NLGA 3HJEA 1T3QA 5KFKA 5L1MA 4ACOA 1IIPA 1LKYB 8ICOA 2XI9A 1L5UA 5AK4A 5CHGA 4NLCA 2EAPA 2QKQA 5KFOA 4ECZA 1ZJNA 5J0WA 3DEEA 2BCUA 5AI0A 4CNQA 4EZ6A 2I9GA 1ZQRA 5ALLA 4K4HA 2Y1JA 2LKYA 2YMLA 2FLNA 5EWEA 2HHTA 1DGJA 4DFJA 1TV9A 2H3VA 3FAHA 5KFPA 4FS2A 4F4XA 4KLIA 4YMOA 3OSNA 3QU9A 5J2BA 3PR5B 1QLNA 1SGGA 3J81j 2KEYA 4CGZA 4Y2VA 1BPBA 3KTQA 2QB1A 1SIJA 4RQ3A 5J2DA 1RXWA 2ZIWA 1Q3VA 9ICRA 7ICOA 1PZNA 2OXOA 7ICEA 2PFOA 5AM4A 2RP5A 3F5AA 3SAHA 5AKZA 4DLGA 3PR4A 1J2MA 1Q46A 4DSKA 4CF4A 4FZMA 4FE3A 2XVTA 1XSNA 4K4IA 3G6YA 3GQCA 3AL0B 1PVQA 1B43A 1WG8A 4TURA 3Q8KA 2D3DA 2MUTA 4DSJA 5IILA 1ZQHA 1UA1A 5DB8A 3PV8A 7ICRA 2PFPA 2YMQA 5DB7A 8ICZA 1JROA 9ICPA 1KFSA 4Q45A 4M04A 5KFNA 4ELVA 4GIBA 1S0MA 2RHFA 1A77A 1ZQVA 3K75D 4KLMA 2PI4A 4NLKA 4UB8U 2ZIVB 1VJ5A 3M6KA 4AYBF 3IRUA 2F1HA 2EAOA 4RNMA 2W8KA 3AEVA 5ALEA 1Z3EB 5HR7A 1XS9D 4IRDA 1ZETA 1KN5A 3M6ZA 1NK4A 3SQIA 2G5IB 5DKWA 2KJ9A 3WKDA 5B5EU 2E8NA 4ED2A 3TFRA 5CEHA 4QNLA 9ICHA 4K4GA 4B9SA 1ZQYA 4B9LA 2KVSA 2W9BB 2V4RA 3M9NB 3PX6A 1B0XA 8ICSA 3D6JA 5DLGA 3MGVA 4PHPA 4F91B 7ICNA 5AM3A 2BCVA 7ICPA 1VDVA 5IIOA 9ICKA 2MRLA 3C5GA 1FFUA 1L7OA 4I28A 1NJZA 8ICRA 1UCVA 1RPLA 5KFFA 4DLEA 3LVVA 3AU6A 4KTQA 2D8CA 5IIJA 3QU5A 3HPOA 4UB4A 4YD2A 2NRWA 1ZQIA 1ZD3A 5KFVA 3RJEA 3WK9A 4EEYA 1V38A 5KFDA 5DG9A 2XICA 3WKBA 3H8WA 1N63A 4DWIA 5ALUA 2WF5A 4EBCA 1JUDA 1GO3F 4DO9A 4KLDA 1Q3UA 4JV1A 3ZDEA 4IQUA 5D49A 4J9KA 2ZUDA 2YX8A 2OHFA 5KFTA 4DFDA 1QTMA 3BQ2A 8ICTA 8ICJA 1BPZA 8ICIA 3C21A 9ICOA 5CRXA 4OJOA 4EYHB 2HBMA 2K8AA 1N2XA 3BQTA 2G06A 1TKDA 9ICJA 1VLBA 5KG5A 4IR9A 2I5HA 1JMSA 2H3IA 3QYPA 4J03A 2VIXA 1JXEA 3BS5B 4J9NA 5ALHA 1HEKA 3KBBA 9ICWA 1JALA 2H3FA 1X9XA 3AN1A 3D2SA 2OYYA 3MDCA 5KL8B 3NRZA 1Z00B 1UHUA 4YR0A 7ICGA 4JB3A 3IV6A 2ZJAA 3ISBA 1ZD4A 2C2DA 4MFCA 2JHDA 3B9JA 2LBOA 9ICXA 2KK0A 4Q44A 1SL2A 4YXJA 4MFFA 2KKPA 3MC1A 3NGDA 5ALOA 3MR3A 4UBCA 4IQTA 1T4GA 2NRXA 2HVHA 1AROP 1OXJA 2UVWA 5AK5A 2Q4TA 1A6SA 1C20A 2A1AA 3PW5A 4BXOB 1S97A 1NZPA 2ES6A 5KFEA 4DSLA 2IOHA 1C7YA 1ZJMA 4X5VA 4FZLA 2EDUA 4F3OA 1NOMA 4ECQA 3PSTA 4UB6U 3NTUA 3SYZA 5C0YA 5DDYA 2Y0SC 4OD0A 1V85A 1K1QA 1ZQBA 4JV2A 4NM1A 2ZIVA 2DQNB 2KOBA 3B0XA 3UQ2A 2IBKA 4CF3A 2F77X 4GC6A 4OO1J 1TAUA 2K8BB 4O3SA 3AQFA 4KLJA 2PMZC 5DQIA 3MGIA 4HAIA 4PL2A 3UXOA 5L1LA 3QU7A 4F93B 2KICA 4QWAA 2DFLA 2XCAA 3H4DA 5KFYA 4BDPA 2BGWA 1D9FA 5J2KA 9ICUA 4GLXA 2ASJA 5G5HA 3ISDA 3ISCA 4CF5A 1KBUA 4I2GA 1SXDA 2WB1F 5KT7A 8ICLA 2FE9A 4P0PB 5L1IA 4FZNA 1UPHA 7ICJA 3U26A 4F5RA 5KFZA 4DQQA 3T79A 2BPFA 4RPXA 1NJWA 2V4QA 3TACB 4O5EA 3PX0A 5JTIA 2JH7A 4Z6FA 5AICA 8ICWA 1N62A 3DV9A 4JWMA 1Y88A 5AKKA 2JEGA 1RZTA 2XC9A 2WB1C 1QCKA 3LK9A 1WUDA 3RB0A 3WK4A 4MEYA 5IINA 1P7DA 2K60A 2LYBA 1NKBA 4QWDA 4M9LA 5AK3A 4HYKA 2MSNA 2DPIA 3MFHA 1Z4NA 1PK3A 3QZ8A 4F5QA 3QXGA 3NVWA 4KX5A 1B22A 1CUKA 2FPKA 1ZQQA 5DDMA 2AGQA 3T5LA 2VA3A 7ICHA 2DUYA 5DBCA 1S0OA 4F8RA 4YCXA 5ALKA 3C2LA 2HOQA 2LYHA 1EXNA 1X66A 1T8EA 1CI4A 4QWEA 4Z6EA 4YD1A 3GILA 1NK7A 3IG5A 3KKAA 5EWGA 9ICBA 4M2YA 5KG0A 3CYMA 4Z6CA 1UQVA 5J0YA 4C8NA 4Q43A 2BQRA 3NVYA 2ISPA 3PO5A 3RBDA 4KMOB 3D2NA 1X40A 4ED3A 5DLFA 4Y2JA 2JEIA 8ICXA 4XQ8A 1ZQLA 2YQEA 3VC8A 1BGXT 4QW9A 3HRDD 1NK5A 3OPXA 3M1YA 4RQNA 5KTQA 4B9VA 1L8LA 2E3TA 4EBDA 3F5EA 2C2RA 1SKSA 5IIIA 2JGAA 2W04A 3TADC 3LWLA 4P4PA 2FLPA 4R8UA 2KV2A 3QNMA 3EPGA 4P0QA 3GV5B 2ATLA 3KHGA 1KTQA 2KP7A 5ALWA 2QB0B 8ICPA 5ALFA 1LKYA 4J9QA 4ED6A 2PFQA 3DDHA 4DQRA 1N56A 2FJ6A 2IOFK 5KFIA 5CB1A 3EUB2 3M7DA 3KZXA 3SEIA 4O3MA 2ZUBA 4UAYA 2HDOA 4GFJA 3Q8LA 4RT2A 2XO7A 4P4MA 2AHOB 3HP6A 4GC7A 2RLTA 4USAA 5JU5A 2F1JA 2KMDA 3JPTA 4F71A 2BCQA 4EZ9A 5KL1B 4PGXA 2AQ0A 3N7SC 1XSLA 4DQSA 5AIAA 1YZ7A 5CP2A 4UBBA 1ZOLA 2EZZA 5ALZA 2F3NA 4GXKA 1ZQCA 2B21A 4DL6A 2Q0ZX 2AQ4A 3ZDDA 3LWMA 1PK1A 1CRXA 5C5JA 2BPCA 2IMWP 8ICHA 3SENA 5L1JA 2HHWA 2FI1A 3RB6A 4RPYA 5A0LA 2Y9UA 2GH1A 2WF8A 3RAXA 1S10A 3T5KA 2LM1A 5L9XA 4BJQA 2RRDA 3QU4A 4RNNA 3AU2A 3UMBA 3H4BA 2XCPA 5J0TA 2KD1A 2FMQA 1U48A 2JMGA 4IL6U 2BHNA 1CEZA 4FBUA 4KLGA 4DL3A 2ZTDA 4GXJA 1X9MA 2KJ8A 4QIWC 1NK9A 1TE2A 2G07A 3L4PA 1ZQKA 2E8PA 2ESEA 2E8MA 4QZAA 4ECVA 2EQYA 2G0AA 3NRWA 5KT6A 5E79U 4I2IA 1HUZA 1FFVA 1L3TA 4LVSA 2WAQF 2PXIA 3GDXA 5KFRA 4QZEA 5K4LA 5AKJA 5J2HA 1X42A 2UVVA 1ZQMA 1B4FA 1DOQA 3FC4A 3OHBA 5EE0A 3TARA 1QSSA 4EBEA 4J9RA 3RB4A 1SL0A 1TAMA 3E0FA 3OGUA 4OJ6A 1HIWA 3UXPA 2ZG6A 3LVWA 4EEKA 7ICQA 2HHQA 1ZYQA 1QSYA 2PFNA 4DFMA 1FO4A 4B9NA 2KFZA 3SAGA 1ZQPA 8ICVA 2F8LA 3QE9Y 2KZMA 3PSIA 5IIKA 1OW5A 1NKCA 2BDPA 2WTFA 4IQVA 1RM6C 2D6FC 4MFAA 1KL9A 2CRXA 2JEFA 4KLOA 1SL1A 4NXZA 2UVRA 3NUQA 2I6XA 1FEZA 3LDAA 2C28A 1HUOA 3N7PD 5J8YA 2ZXIA 3HWTA 2ZIXB 2L5YA 4RQMA 5KT4A 2I1QA 4C8MA 5CWRA 4YP3A 4DSFA 5KFMA 4Y2RA 5AKLA 4O3PA 4YVZA 3R9KA 4OJ5A 4RQ7A 3VCBA 3PSFA 4UATA 9ICEA 4F92B 1L3VA 2VKQA 1XU4A 2DF4B 2MU2A 3N4MB 3UM9A 4YG2A 4QZ9A 1JXLA 3IDWA 5H2FU 4C4RA 4GXIA 3QEAZ 1N60A 4UAUA 2WF7A 3V7LA 1X9SA 3PVXA 4NWIA 3QUQA 3ETRA 1UT8A 5KFWA 4RUAA 2JEJA 5KFCA 3ETLA 4NL9C 2JZBB 4O3RA 2OM6A 4UAZA
chains in the Genus database with same CATH topology
3B0YA 4UB2A 3JPRA 3RJJA 5BOMA 5DDYA 4KLSA 4TUPA 1ZQBA 4R65A 4NM1A 3B0XA 5J2CA 3UQ2A 4XA5A 4RQ6A 3JPQA 4DOAA 1ZQGA 2FMPA 4KLJA 5J2EA 3PNCA 3MGIA 5EOZA 3UXOA 4O5CA 5J0XA 2BCRA 4O5KA 1KDHA 3RJGA 9ICTA 4QZ8A 4O9MA 5J2KA 3RH6A 4PH5A 9ICUA 3UXNA 4M47A 3ISDA 3ISCA 8ICCA 3MGHA 5J2IA 8ICAA 4I2GA 1BPXA 8ICLA 9ICGA 4M9GA 4I2EA 4I2AA 1BNOA 4R63A 4PHEA 4F5RA 7ICJA 5J0SA 5IIMA 2BPFA 4KLHA 5TZVA 4RPXA 4R66A 1BPEA 4O5EA 3JPOA 4RQ4A 5J0UA 4PHAA 4PGYA 1BPDA 4PHDA 5J0PA 4Z6FA 5HHHA 8ICQA 4I2DA 4R64A 2FMSA 8ICWA 3AUOA 4JWMA 1KEJA 5J29A 2ISOA 1RZTA 1BNPA 3C2MA 3LK9A 7ICTA 8ICBA 1ZQSA 4UAWA 9ICFA 5DBBA 5IINA 9ICAA 4M9LA 4RPZA 4LZDA 1DK2A 4I2JA 8ICNA 4QZGA 4NY8A 4QZFA 4F5QA 5J0OA 4F5OA 1ZQQA 3RH4A 2GWSA 5BOLA 7ICMA 7ICHA 4I27A 5DBCA 7ICSA 3HW8A 4YCXA 4JWNA 3C2LA 4Z6DA 4QZDA 5DB9A 4NLNA 8ICOA 4Z6EA 4YD1A 1BPYA 9ICBA 4M2YA 4Z6CA 5J0WA 1ZJNA 5J0YA 9ICQA 1ZQNA 2BCUA 1TVAA 2ISPA 2I9GA 1ZQRA 4K4HA 4KLUA 5J0QA 8ICXA 1TV9A 1ZQLA 3RJHA 4KLIA 1MQ2A 4YMOA 5J2JA 4FO6A 5J2BA 4I2BA 4RQ3A 5J2DA 4I2CA 4DOBA 3RJFA 9ICRA 7ICOA 7ICEA 2PFOA 3RJIA 5IIIA 4UB5A 7ICLA 4I29A 5DBAA 2KP7A 8ICMA 8ICPA 1XSNA 4K4IA 2PFQA 4TURA 4LZGA 3V7KA 5IILA 1ZQHA 5DB8A 7ICRA 5CB1A 2PFPA 4YN4A 1ZQDA 4NLZA 1DK3A 5DB7A 8ICZA 4MF8A 4UAYA 4M9JA 9ICPA 7ICUA 4RT3A 4RT2A 4M04A 3UQ0A 4KLQA 4KLMA 9ICIA 3JPTA 4QZCA 4NLKA 3HX0A 2BCQA 4QZIA 4PGXA 1XSLA 4MF2A 3UPQA 1ZQEA 4UBBA 7ICKA 4GXKA 1ZQCA 3MDAA 4YMNA 9ICSA 4UB3A 9ICCA 4F5NA 5DKWA 8ICKA 4M9HA 8ICHA 3TFRA 1ZQTA 4RPYA 9ICHA 4K4GA 3MBYA 4RQ1A 5J0RA 4I2FA 4PPXA 8ICSA 8ICUA 3V72A 3V7JA 5J2AA 8ICEA 4PHPA 3AU2A 4KLTA 5J0TA 2FMQA 9ICMA 4PGQA 7ICNA 2BCVA 3JPSA 7ICPA 5IIOA 4KLGA 9ICKA 2BPGA 4GXJA 3C5GA 2P66A 9ICNA 1ZQKA 4I28A 9ICVA 4KLEA 8ICRA 4QZAA 3AU6A 4P2HA 4RQ0A 5DB6A 5IIJA 4UB4A 4YD2A 4I2IA 4UB1A 1HUZA 4KLFA 9ICLA 1ZQIA 4LVSA 1XSPA 2PXIA 3GDXA 3RJEA 5J2FA 4QZEA 4QZHA 5J2HA 1ZQMA 3JPPA 3RH5A 4DO9A 3OGUA 4KLDA 4IQUA 5D49A 5D46A 4IQWA 4RQ2A 8ICTA 8ICJA 1BPZA 8ICIA 3UXPA 9ICOA 1ZQOA 4KLLA 7ICQA 2PFNA 8ICFA 1MQ3A 1ZQPA 8ICVA 9ICJA 3C2KA 7ICIA 1JMSA 5IIKA 3JPNA 4I2HA 4RQ5A 4IQVA 4M0AA 4MFAA 4RQ8A 4KLOA 4NXZA 9ICWA 4M9NA 4XUSA 4YMMA 1HUOA 2IHMA 4TUSA 3HWTA 1ZQFA 3MDCA 2BCSA 7ICGA 3PMLA 7ICVA 3C5FA 5CWRA 3ISBA 4TUQA 4MFCA 3PMNA 4NM2A 9ICXA 7ICFA 4MFFA 2W9MA 4RQ7A 9ICEA 4QZBA 4UBCA 4IQTA 3RJKA 4QZ9A 5BPCA 4GXIA 8ICGA 5D4BA 3V7LA 5HHIA 4DOCA 1ZQJA 1NZPA 8ICYA 1ZJMA 1ZQAA 4F5PA 4X5VA 3TFSA 4UAZA 5J2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0Y A;  4UB2 A;  3JPR A;  3RJJ A;  5BOM A;  5DDY A;  4KLS A;  4TUP A;  1ZQB A;  4R65 A;  4NM1 A;  3B0X A;  5J2C A;  3UQ2 A;  4XA5 A;  4RQ6 A;  3JPQ A;  4DOA A;  1ZQG A;  2FMP A;  4KLJ A;  5J2E A;  3PNC A;  3MGI A;  5EOZ A;  3UXO A;  4O5C A;  5J0X A;  2BCR A;  4O5K A;  1KDH A;  3RJG A;  9ICT A;  4QZ8 A;  4O9M A;  5J2K A;  3RH6 A;  4PH5 A;  9ICU A;  3UXN A;  4M47 A;  3ISD A;  3ISC A;  8ICC A;  3MGH A;  5J2I A;  8ICA A;  4I2G A;  1BPX A;  8ICL A;  9ICG A;  4M9G A;  4I2E A;  4I2A A;  1BNO A;  4R63 A;  4PHE A;  4F5R A;  7ICJ A;  5J0S A;  5IIM A;  2BPF A;  4KLH A;  5TZV A;  4RPX A;  4R66 A;  1BPE A;  4O5E A;  3JPO A;  4RQ4 A;  5J0U A;  4PHA A;  4PGY A;  1BPD A;  4PHD A;  5J0P A;  4Z6F A;  5HHH A;  8ICQ A;  4I2D A;  4R64 A;  2FMS A;  8ICW A;  3AUO A;  4JWM A;  1KEJ A;  5J29 A;  2ISO A;  1RZT A;  1BNP A;  3C2M A;  3LK9 A;  7ICT A;  8ICB A;  1ZQS A;  4UAW A;  9ICF A;  5DBB A;  5IIN A;  9ICA A;  4M9L A;  4RPZ A;  4LZD A;  1DK2 A;  4I2J A;  8ICN A;  4QZG A;  4NY8 A;  4QZF A;  4F5Q A;  5J0O A;  4F5O A;  1ZQQ A;  3RH4 A;  2GWS A;  5BOL A;  7ICM A;  7ICH A;  4I27 A;  5DBC A;  7ICS A;  3HW8 A;  4YCX A;  4JWN A;  3C2L A;  4Z6D A;  4QZD A;  5DB9 A;  4NLN A;  8ICO A;  4Z6E A;  4YD1 A;  1BPY A;  9ICB A;  4M2Y A;  4Z6C A;  5J0W A;  1ZJN A;  5J0Y A;  9ICQ A;  1ZQN A;  2BCU A;  1TVA A;  2ISP A;  2I9G A;  1ZQR A;  4K4H A;  4KLU A;  5J0Q A;  8ICX A;  1TV9 A;  1ZQL A;  3RJH A;  4KLI A;  1MQ2 A;  4YMO A;  5J2J A;  4FO6 A;  5J2B A;  4I2B A;  4RQ3 A;  5J2D A;  4I2C A;  4DOB A;  3RJF A;  9ICR A;  7ICO A;  7ICE A;  2PFO A;  3RJI A;  5III A;  4UB5 A;  7ICL A;  4I29 A;  5DBA A;  2KP7 A;  8ICM A;  8ICP A;  1XSN A;  4K4I A;  2PFQ A;  4TUR A;  4LZG A;  3V7K A;  5IIL A;  1ZQH A;  5DB8 A;  7ICR A;  5CB1 A;  2PFP A;  4YN4 A;  1ZQD A;  4NLZ A;  1DK3 A;  5DB7 A;  8ICZ A;  4MF8 A;  4UAY A;  4M9J A;  9ICP A;  7ICU A;  4RT3 A;  4RT2 A;  4M04 A;  3UQ0 A;  4KLQ A;  4KLM A;  9ICI A;  3JPT A;  4QZC A;  4NLK A;  3HX0 A;  2BCQ A;  4QZI A;  4PGX A;  1XSL A;  4MF2 A;  3UPQ A;  1ZQE A;  4UBB A;  7ICK A;  4GXK A;  1ZQC A;  3MDA A;  4YMN A;  9ICS A;  4UB3 A;  9ICC A;  4F5N A;  5DKW A;  8ICK A;  4M9H A;  8ICH A;  3TFR A;  1ZQT A;  4RPY A;  9ICH A;  4K4G A;  3MBY A;  4RQ1 A;  5J0R A;  4I2F A;  4PPX A;  8ICS A;  8ICU A;  3V72 A;  3V7J A;  5J2A A;  8ICE A;  4PHP A;  3AU2 A;  4KLT A;  5J0T A;  2FMQ A;  9ICM A;  4PGQ A;  7ICN A;  2BCV A;  3JPS A;  7ICP A;  5IIO A;  4KLG A;  9ICK A;  2BPG A;  4GXJ A;  3C5G A;  2P66 A;  9ICN A;  1ZQK A;  4I28 A;  9ICV A;  4KLE A;  8ICR A;  4QZA A;  3AU6 A;  4P2H A;  4RQ0 A;  5DB6 A;  5IIJ A;  4UB4 A;  4YD2 A;  4I2I A;  4UB1 A;  1HUZ A;  4KLF A;  9ICL A;  1ZQI A;  4LVS A;  1XSP A;  2PXI A;  3GDX A;  3RJE A;  5J2F A;  4QZE A;  4QZH A;  5J2H A;  1ZQM A;  3JPP A;  3RH5 A;  4DO9 A;  3OGU A;  4KLD A;  4IQU A;  5D49 A;  5D46 A;  4IQW A;  4RQ2 A;  8ICT A;  8ICJ A;  1BPZ A;  8ICI A;  3UXP A;  9ICO A;  1ZQO A;  4KLL A;  7ICQ A;  2PFN A;  8ICF A;  1MQ3 A;  1ZQP A;  8ICV A;  9ICJ A;  3C2K A;  7ICI A;  1JMS A;  5IIK A;  3JPN A;  4I2H A;  4RQ5 A;  4IQV A;  4M0A A;  4MFA A;  4RQ8 A;  4KLO A;  4NXZ A;  9ICW A;  4M9N A;  4XUS A;  4YMM A;  1HUO A;  2IHM A;  4TUS A;  3HWT A;  1ZQF A;  3MDC A;  2BCS A;  7ICG A;  3PML A;  7ICV A;  3C5F A;  5CWR A;  3ISB A;  4TUQ A;  4MFC A;  3PMN A;  4NM2 A;  9ICX A;  7ICF A;  4MFF A;  2W9M A;  4RQ7 A;  9ICE A;  4QZB A;  4UBC A;  4IQT A;  3RJK A;  4QZ9 A;  5BPC A;  4GXI A;  8ICG A;  5D4B A;  3V7L A;  5HHI A;  4DOC A;  1ZQJ A;  1NZP A;  8ICY A;  1ZJM A;  1ZQA A;  4F5P A;  4X5V A;  3TFS A;  4UAZ A;  5J2G A; 
#chains in the Genus database with same CATH topology
 3OJU A;  1F44 A;  3H0R B;  4UB2 A;  3AM9 A;  4JK1 A;  1SWW A;  1T7P A;  4Y2Q A;  5BOM A;  5HML A;  4AP9 A;  2ZTE A;  4TUP A;  1NKE A;  2LM4 A;  3TQ1 A;  5J2C A;  2ZIU B;  4RQ6 A;  2KG5 A;  3JPQ A;  2EZY A;  4O0I A;  2WAQ C;  2G09 A;  1ZQG A;  1SXE A;  1LB2 B;  5KG1 A;  5J2E A;  4ED1 A;  4O5C A;  1DXS A;  3H8J A;  3ZI4 A;  4NV0 A;  5DG8 A;  5J0X A;  3THV A;  3CRX A;  2NRV A;  2DKZ A;  3HIL A;  2KIV A;  5ALN A;  5F9L A;  5EE3 A;  3UXN A;  4US8 A;  3KD3 A;  4C8O A;  3BDP A;  2EH9 A;  2FLL A;  2E1E A;  3KZI U;  1T94 A;  1XWL A;  1Z1B A;  1X9W A;  4C4S A;  2HHV A;  1NK8 A;  4QJF B;  1BNO A;  4PHE A;  4EX6 A;  5IIM A;  4DL5 A;  4ICA A;  4ECX A;  2IA6 A;  5ALR A;  1NZB A;  4CRX A;  3G6X A;  4R66 A;  3WKE A;  5KG3 A;  2XID A;  4RQ4 A;  5J0U A;  3H7I A;  4J9P A;  2HBJ A;  4UAV A;  4PGY A;  2VJ4 A;  1SKR A;  3PW2 A;  5HHH A;  1XC9 A;  2F8K A;  2FMS A;  4ED7 A;  1KEJ A;  5J29 A;  5EWF A;  3TAD A;  4Y2X A;  3C28 A;  1L6N A;  1ZQS A;  3K1R B;  9ICF A;  3K4G A;  2W43 A;  2OWO A;  2AGP A;  2VA2 A;  5AM0 A;  9ICA A;  4C80 A;  1URJ A;  4RPZ A;  3MFI A;  4LZD A;  1U9L A;  2A1J B;  2HBL A;  1RYS A;  2UVU A;  3QZ7 A;  3E2E A;  4KN4 A;  4CCH A;  3RFA A;  3GZF A;  3H0M B;  4Y2S A;  1RYR A;  2MUT B;  2HHS A;  2HOF A;  2PMZ F;  2JV3 A;  1NI3 A;  3BJY A;  4YR3 A;  4I27 A;  1X6I A;  3NAS A;  1Z19 A;  2R18 A;  4QW8 A;  3RR7 A;  4RUC A;  4JWN A;  2R8I A;  5AI4 A;  4Z6D A;  5ALJ A;  4ZH4 A;  2QAR A;  5HMM A;  4MEX A;  2R8J A;  3IP4 B;  4Y2P A;  1RG6 A;  2KHQ A;  4NLN A;  2MAX A;  3KOO A;  4FFD A;  1D9D A;  2WFA A;  1BPY A;  2Z7J A;  4DCC A;  2CXY A;  1LVH A;  1NNL A;  4PJ0 U;  4RU9 A;  3H0L B;  4LJX A;  3OSP A;  2KZ3 A;  2K4I A;  3IM1 A;  3RJH A;  1MQ2 A;  2XY5 A;  5J2J A;  2ZUC A;  1KQQ A;  3WKC A;  4FO6 A;  5KFX A;  2OEH A;  2E5S A;  3GFK B;  3RAQ A;  4BXO A;  4DL7 A;  3C23 A;  5AKE A;  3SR6 A;  2F2A B;  4JUZ A;  3HT3 A;  4I2C A;  5T14 A;  4DOB A;  3RJF A;  2KFN A;  2ZJ5 A;  1NJX A;  2Y0S F;  1KSP A;  1ZQX A;  2EZX A;  1WCN A;  4YR2 A;  4ECY A;  4UB5 A;  2C2E A;  1L7P A;  1TK0 A;  4EEN A;  5DBA A;  3G6V A;  2XY6 A;  3C29 A;  3ORY A;  3MAB A;  3KHH A;  3V7K A;  1NK6 A;  2NO4 A;  2W11 A;  4G3I A;  1Z00 A;  1NK0 A;  5GTI U;  1ZQD A;  4NLZ A;  5DQH A;  1DK3 A;  2R8H A;  1COK A;  2AXT U;  4M9J A;  3N97 B;  3UMG A;  1ED1 A;  1AQ6 A;  4O3N A;  3UQ0 A;  9ICI A;  4QZC A;  2LPE A;  4P0Q B;  1IG6 A;  2NYV A;  4QZI A;  4MF2 A;  4J9S A;  3UPQ A;  1ZQE A;  4FBT A;  7ICK A;  3NS1 A;  3UMC A;  4J9O A;  3QX7 A;  4P0P A;  1KRP A;  1MA7 A;  9ICS A;  1OUQ A;  2VA8 A;  4F72 A;  1S76 D;  2W3R A;  2EAN A;  2JXJ A;  2YB1 A;  3EW9 A;  2WF6 A;  4B9M A;  3SZ2 A;  4ECT A;  4J9L A;  4RQ1 A;  4F50 A;  5J0R A;  3KHR A;  3V7J A;  3RR8 A;  2ZIX A;  8ICE A;  2LI6 A;  3JPS A;  5JRT A;  2XY7 A;  3TI0 A;  3WK5 A;  2BPG A;  2K4E A;  1L7M A;  1KFT A;  2J6T A;  1U49 A;  9ICV A;  4KLE A;  3BZK A;  3RF9 A;  4P2H A;  4OCZ A;  5DB6 A;  2W9B A;  1MC8 A;  4O3Q A;  3BQ1 A;  4UB1 A;  4KLF A;  9ICL A;  4ELT A;  1JI7 A;  4UW9 A;  4B9T A;  3M8R A;  1ZRN A;  3EPI A;  2PI5 A;  1QH9 A;  1TFR A;  3RH5 A;  4QWC A;  1S0V A;  5ALX A;  1J97 A;  3Q8M A;  3I76 A;  4U6P A;  3IG8 A;  2W7O A;  4BGD A;  5D46 A;  3KFU F;  4AYB C;  4IQW A;  5AKX A;  2VJ5 A;  1ZQO A;  3ED5 A;  3SV3 A;  5J8Y C;  4E0D A;  5AM5 A;  2NRT A;  8ICF A;  1MQ3 A;  1X2I A;  1SB3 C;  3CNH A;  2W8L A;  4UQG A;  7ICI A;  3ZD8 A;  3ZDC A;  2IOF A;  3JPN A;  3L3F X;  3TAQ A;  1O08 A;  3ICX A;  4M0A A;  4RQ8 A;  3F53 A;  3N7R C;  3Q8P B;  2QB0 A;  2W9A A;  3BS7 A;  4M9N A;  4RNO A;  4XUS A;  4YMM A;  2IHM A;  1IM4 A;  2HBK A;  1ZQF A;  3NVV A;  4IS7 A;  4DEZ A;  2W9C B;  2HI0 A;  2BCS A;  1HJP A;  1S5L U;  3C5F A;  4EYI B;  1A76 A;  3M8S A;  2KSO B;  5KAF U;  3T5H A;  3ZDB A;  4ED8 A;  5HP4 A;  2NRZ A;  2W9M A;  3KKA C;  4P4O A;  1XO0 A;  2HOI A;  4QZB A;  1DRG A;  2KIW A;  2K4P A;  3RJK A;  1KW4 A;  4F4Z A;  2AU0 A;  5D4B A;  1PVR A;  4ECU A;  4ELU A;  1SZH A;  2F1I A;  5HHI A;  1ZQJ A;  1K5O A;  1SV4 A;  3T3F A;  3BZC A;  8ICY A;  5EE9 A;  3M9M B;  3A0B U;  4F5P A;  3TFS A;  5J0Q A;  2HHU A;  4ECS A;  3B0Y A;  2LMR A;  3JPR A;  4Y2T A;  5KFG A;  3RJJ A;  2A19 A;  2Y1I A;  4R65 A;  2R8G A;  4Y2Y A;  1X6J A;  1FIQ A;  5HNK A;  2BQU A;  4XA5 A;  5ALM A;  1ZQW A;  2W55 A;  1KKX A;  3A0H U;  5KFA A;  2FMP A;  4YFK A;  5EOZ A;  2B6G A;  1V97 A;  1JRP A;  4O5K A;  5ALG A;  4DSI A;  4CDG A;  1RYU A;  1ZD5 A;  4C7Z A;  2ASL A;  1JN3 A;  9ICT A;  1UA0 A;  2BR0 A;  5AK6 A;  1L3S A;  4C8L A;  3D2Q A;  8ICC A;  3MGH A;  1SKW A;  1S8O A;  2HHX A;  5JUM A;  5J2I A;  2A3V A;  1KFD A;  3H40 A;  3WK8 A;  3F2D A;  5AKG A;  5F3X B;  4I2E A;  2KNJ A;  2ODG A;  5J0S A;  2J6S A;  3RBE A;  4KLH A;  3TKA A;  1IXR A;  4JV0 A;  5KNI A;  1BPE A;  3EYZ A;  4KX3 A;  3N28 A;  3PSP A;  4PHA A;  5AIB A;  1BPD A;  4PHD A;  4F4W A;  5J0P A;  2OH2 A;  8ICQ A;  4IR1 A;  3MR2 A;  3ALR A;  2P6U A;  4I2D A;  4R64 A;  3Q8S B;  3PW4 A;  4NLB A;  4M6W A;  2ISO A;  1PUZ A;  2W54 A;  1N5X A;  1BNP A;  5HR6 A;  4NJ8 A;  4TQS A;  8ICB A;  4UAW A;  2BDU A;  2W03 A;  5DBB A;  3V6K A;  5B66 U;  2DKX A;  1DK2 A;  3GU3 A;  2LHT A;  8ICN A;  2W3S A;  2JR5 A;  5L1K A;  4QZF A;  2GO7 A;  5ALY A;  5J0O A;  1L7N A;  5ALQ A;  3I1Y A;  1ZRM A;  1Z4O A;  2J6U A;  2JRZ A;  2JZB A;  4NL9 A;  1TK5 A;  5ALV A;  3SAF A;  2YY6 A;  3WK6 A;  4OJL A;  2HVI A;  1WYG A;  4QZD A;  2GLE A;  5DB9 A;  1S0N A;  3QU2 A;  5CR0 A;  3H8M A;  3PO4 A;  4F2S A;  5KFU A;  3OTQ A;  3GV7 B;  4DQI A;  5ALT A;  3C1Z A;  5KT2 A;  2YTU A;  3RB3 A;  2KSO A;  4XRH A;  4F2R A;  9ICQ A;  1ZQN A;  5AKY A;  1TVA A;  2G5H B;  3K1Z A;  4R8U B;  1RDF A;  4KLU A;  5ALS A;  2GOL A;  3QEB Z;  1D8Y A;  3CP8 A;  2P6R A;  2RDJ A;  5AKI A;  5KG2 A;  3MR6 A;  2YB4 A;  5KFL A;  1U4B A;  4DL2 A;  3F2C A;  1ZQZ A;  2ALZ A;  5DGB A;  2DPJ A;  5CJ7 A;  1TK8 A;  4I2B A;  5DGA A;  1F0M A;  2KJ5 A;  3RJI A;  1YT3 A;  2ZIW B;  2OCE A;  2DBY A;  5AM2 A;  3PX4 A;  7ICL A;  4I29 A;  4BUG A;  3AMZ A;  5KFH A;  8ICM A;  5KFS A;  1D8B A;  1U47 A;  4LZG A;  3BQ0 A;  1QSL A;  3GIM A;  1N48 A;  4YN4 A;  4PZO A;  2HSZ A;  3O0F A;  4DFK A;  2KN7 A;  4MF8 A;  5DQG A;  1QQ6 A;  2AGO A;  4BWM A;  7ICU A;  4RT3 A;  3E58 A;  2E1F A;  1COO A;  3AQE A;  4KLQ A;  5KAI U;  3HX0 A;  3C1Y A;  1IV8 A;  2QAR B;  3EZ5 A;  5KG4 A;  3GII A;  4JMU A;  2A1J A;  4M6W B;  5DG7 A;  3ZDA A;  2NV3 A;  5EE1 A;  3BQ7 A;  1K1S A;  3MDA A;  4YMN A;  4UB3 A;  9ICC A;  4C8K A;  1T3N A;  1F5S A;  4F5N A;  3IHQ B;  4Y2U A;  3OJS A;  8ICK A;  4M9H A;  1ZQT A;  3IN5 A;  3BS5 A;  1SV0 C;  3MBY A;  3KHL A;  4DF4 A;  3TAP A;  1ZD2 P;  3SD7 A;  5KFJ A;  4I2F A;  1V9P A;  4PPX A;  8ICU A;  3SV4 A;  3V72 A;  5J2A A;  1SV0 A;  3HKZ C;  4KLT A;  4TQR A;  4ECW A;  2ZTC A;  5ALP A;  9ICM A;  2HCF A;  4PGQ A;  2H3Q A;  2RQ5 A;  3ZD9 A;  4BX9 C;  3QUC A;  1M6Y A;  2DL0 A;  2P66 A;  9ICN A;  1RXV A;  1UT5 A;  1O03 A;  4B6J A;  3PY8 A;  2M9N A;  5AI9 A;  4IRK A;  1YZ6 A;  3QUT A;  4RQ0 A;  1RQL A;  3ONN A;  3PW7 A;  1WWV A;  2JH1 A;  2K8C B;  3RRH A;  1L3U A;  4DS4 A;  5G5G A;  1XSP A;  4ED0 A;  4EX7 A;  4C0Z A;  5J2F A;  2YN4 A;  4A8E A;  4QZH A;  2YMP A;  2PKE A;  3JPP A;  4DSE A;  4KIT B;  4B9U A;  5KG6 A;  5AI8 A;  2ASD A;  4DQP A;  2ZJ8 A;  4QWB A;  3PW0 A;  2C22 A;  3WU2 U;  4RQ2 A;  1L8O A;  1JIH A;  4KLL A;  1DGS A;  3M9O B;  4KN7 A;  3HKZ F;  1LV5 A;  4Q8E A;  4DF8 A;  4DL4 A;  2BZF A;  2KTQ A;  4KMU A;  3C2K A;  1XNS A;  2FDR A;  4UAS A;  1D8L A;  2AH5 A;  4YQW A;  3WKA A;  1A0P A;  3CW2 C;  4PL1 A;  4RQ5 A;  4I2H A;  3TAN A;  1WCL A;  4F4K A;  2F76 X;  4CE6 A;  2CPR A;  4TUS A;  1KLN A;  2DWQ A;  2KKV A;  2WF9 A;  4ECR A;  1MSW D;  2WHE A;  4DFP A;  3PML A;  7ICV A;  5KFB A;  4YXM A;  1JX4 A;  3S6J A;  4TUQ A;  5KG7 A;  1RQN A;  1S77 D;  3PMN A;  1QQ7 A;  4NM2 A;  2K89 A;  7ICF A;  3GIJ A;  2H3Z A;  2N1R A;  5KT3 A;  4C7Y A;  4Q8F A;  2K4H A;  3LYS A;  3F2B A;  2QLT A;  5AI5 A;  5AI6 A;  3SI8 A;  5BPC A;  2M0N A;  2P35 A;  1NJY A;  2ZXH A;  8ICG A;  1H38 A;  2G08 A;  2KZZ A;  2R8K A;  4DOC A;  1ZXI A;  4PZN A;  2CN1 A;  2MA1 A;  2F44 A;  2V9W A;  1ZQA A;  4MHV A;  3T5J A;  5J2G A;  5F9N A;  2FPL A;  3Q8R B;  1ZQU A;  2FPM A;  3RRG A;  1Q8K A;  2XGP A;  4KLS A;  4G9B A;  1SWV A;  3H8S A;  2W9C A;  1N5W A;  4ZOH C;  1Z1V A;  1WWU A;  3V6H A;  1U45 A;  4DOA A;  1ZQ1 C;  3SMV A;  3PNC A;  5TIS U;  2Y9T A;  1PVP A;  2BCR A;  4IRC A;  1KDH A;  5CA7 A;  3RJG A;  2HW3 A;  4DS5 A;  1TAQ A;  2LYA A;  1MN8 A;  5AHX A;  2DGZ A;  2YMM A;  4QZ8 A;  4O9M A;  3RH6 A;  4PH5 A;  3L5K A;  4BWJ A;  4M47 A;  5ALD A;  2VAN A;  2RDI A;  5KT5 A;  3RTV A;  4C4T A;  8ICA A;  1BPX A;  2W7P A;  3MR5 A;  3QUB A;  4UAR A;  9ICG A;  3GIK A;  4M9G A;  4I2A A;  3FYH A;  4R63 A;  4EEL A;  1N61 A;  4RZR A;  2NO5 A;  2EAM A;  4QIW F;  5TZV A;  1J2N A;  2KE7 A;  2HMX A;  3JPO A;  2O6K A;  3NVZ A;  3Q8Q B;  3V6J A;  2AJQ A;  2KVC A;  1ECW A;  1S9F A;  3AUO A;  5GTH U;  2IHN A;  3I28 A;  3C2M A;  2B0C A;  7ICT A;  3GV8 B;  1PK1 B;  2H5X A;  2BQ3 A;  1SZP A;  5ALI A;  4OJP A;  2XGQ A;  4IC9 A;  3PZP A;  2ZIU A;  3FM9 A;  4I2J A;  4QZG A;  2KHV A;  4O3O A;  4U7C A;  2E8O A;  4NY8 A;  5KFQ A;  3FDS A;  1XO1 A;  5AM1 A;  3WK7 A;  5FP0 A;  4F5O A;  4US9 A;  1BVS A;  3RH4 A;  2GWS A;  3OHA A;  1QQ5 A;  5BOL A;  2BKE A;  4FS1 A;  4F4Y A;  7ICM A;  4WJ3 B;  7ICS A;  5AKH A;  3HW8 A;  4J9M A;  3EWA A;  4NLG A;  3HJE A;  1T3Q A;  5KFK A;  5L1M A;  4ACO A;  1IIP A;  1LKY B;  8ICO A;  2XI9 A;  1L5U A;  5AK4 A;  5CHG A;  4NLC A;  2EAP A;  2QKQ A;  5KFO A;  4ECZ A;  1ZJN A;  5J0W A;  3DEE A;  2BCU A;  5AI0 A;  4CNQ A;  4EZ6 A;  2I9G A;  1ZQR A;  5ALL A;  4K4H A;  2Y1J A;  2LKY A;  2YML A;  2FLN A;  5EWE A;  2HHT A;  1DGJ A;  4DFJ A;  1TV9 A;  2H3V A;  3FAH A;  5KFP A;  4FS2 A;  4F4X A;  4KLI A;  4YMO A;  3OSN A;  3QU9 A;  5J2B A;  3PR5 B;  1QLN A;  1SGG A;  3J81 j;  2KEY A;  4CGZ A;  4Y2V A;  1BPB A;  3KTQ A;  2QB1 A;  1SIJ A;  4RQ3 A;  5J2D A;  1RXW A;  2ZIW A;  1Q3V A;  9ICR A;  7ICO A;  1PZN A;  2OXO A;  7ICE A;  2PFO A;  5AM4 A;  2RP5 A;  3F5A A;  3SAH A;  5AKZ A;  4DLG A;  3PR4 A;  1J2M A;  1Q46 A;  4DSK A;  4CF4 A;  4FZM A;  4FE3 A;  2XVT A;  1XSN A;  4K4I A;  3G6Y A;  3GQC A;  3AL0 B;  1PVQ A;  1B43 A;  1WG8 A;  4TUR A;  3Q8K A;  2D3D A;  2MUT A;  4DSJ A;  5IIL A;  1ZQH A;  1UA1 A;  5DB8 A;  3PV8 A;  7ICR A;  2PFP A;  2YMQ A;  5DB7 A;  8ICZ A;  1JRO A;  9ICP A;  1KFS A;  4Q45 A;  4M04 A;  5KFN A;  4ELV A;  4GIB A;  1S0M A;  2RHF A;  1A77 A;  1ZQV A;  3K75 D;  4KLM A;  2PI4 A;  4NLK A;  4UB8 U;  2ZIV B;  1VJ5 A;  3M6K A;  4AYB F;  3IRU A;  2F1H A;  2EAO A;  4RNM A;  2W8K A;  3AEV A;  5ALE A;  1Z3E B;  5HR7 A;  1XS9 D;  4IRD A;  1ZET A;  1KN5 A;  3M6Z A;  1NK4 A;  3SQI A;  2G5I B;  5DKW A;  2KJ9 A;  3WKD A;  5B5E U;  2E8N A;  4ED2 A;  3TFR A;  5CEH A;  4QNL A;  9ICH A;  4K4G A;  4B9S A;  1ZQY A;  4B9L A;  2KVS A;  2W9B B;  2V4R A;  3M9N B;  3PX6 A;  1B0X A;  8ICS A;  3D6J A;  5DLG A;  3MGV A;  4PHP A;  4F91 B;  7ICN A;  5AM3 A;  2BCV A;  7ICP A;  1VDV A;  5IIO A;  9ICK A;  2MRL A;  3C5G A;  1FFU A;  1L7O A;  4I28 A;  1NJZ A;  8ICR A;  1UCV A;  1RPL A;  5KFF A;  4DLE A;  3LVV A;  3AU6 A;  4KTQ A;  2D8C A;  5IIJ A;  3QU5 A;  3HPO A;  4UB4 A;  4YD2 A;  2NRW A;  1ZQI A;  1ZD3 A;  5KFV A;  3RJE A;  3WK9 A;  4EEY A;  1V38 A;  5KFD A;  5DG9 A;  2XIC A;  3WKB A;  3H8W A;  1N63 A;  4DWI A;  5ALU A;  2WF5 A;  4EBC A;  1JUD A;  1GO3 F;  4DO9 A;  4KLD A;  1Q3U A;  4JV1 A;  3ZDE A;  4IQU A;  5D49 A;  4J9K A;  2ZUD A;  2YX8 A;  2OHF A;  5KFT A;  4DFD A;  1QTM A;  3BQ2 A;  8ICT A;  8ICJ A;  1BPZ A;  8ICI A;  3C21 A;  9ICO A;  5CRX A;  4OJO A;  4EYH B;  2HBM A;  2K8A A;  1N2X A;  3BQT A;  2G06 A;  1TKD A;  9ICJ A;  1VLB A;  5KG5 A;  4IR9 A;  2I5H A;  1JMS A;  2H3I A;  3QYP A;  4J03 A;  2VIX A;  1JXE A;  3BS5 B;  4J9N A;  5ALH A;  1HEK A;  3KBB A;  9ICW A;  1JAL A;  2H3F A;  1X9X A;  3AN1 A;  3D2S A;  2OYY A;  3MDC A;  5KL8 B;  3NRZ A;  1Z00 B;  1UHU A;  4YR0 A;  7ICG A;  4JB3 A;  3IV6 A;  2ZJA A;  3ISB A;  1ZD4 A;  2C2D A;  4MFC A;  2JHD A;  3B9J A;  2LBO A;  9ICX A;  2KK0 A;  4Q44 A;  1SL2 A;  4YXJ A;  4MFF A;  2KKP A;  3MC1 A;  3NGD A;  5ALO A;  3MR3 A;  4UBC A;  4IQT A;  1T4G A;  2NRX A;  2HVH A;  1ARO P;  1OXJ A;  2UVW A;  5AK5 A;  2Q4T A;  1A6S A;  1C20 A;  2A1A A;  3PW5 A;  4BXO B;  1S97 A;  1NZP A;  2ES6 A;  5KFE A;  4DSL A;  2IOH A;  1C7Y A;  1ZJM A;  4X5V A;  4FZL A;  2EDU A;  4F3O A;  1NOM A;  4ECQ A;  3PST A;  4UB6 U;  3NTU A;  3SYZ A;  5C0Y A;  5DDY A;  2Y0S C;  4OD0 A;  1V85 A;  1K1Q A;  1ZQB A;  4JV2 A;  4NM1 A;  2ZIV A;  2DQN B;  2KOB A;  3B0X A;  3UQ2 A;  2IBK A;  4CF3 A;  2F77 X;  4GC6 A;  4OO1 J;  1TAU A;  2K8B B;  4O3S A;  3AQF A;  4KLJ A;  2PMZ C;  5DQI A;  3MGI A;  4HAI A;  4PL2 A;  3UXO A;  5L1L A;  3QU7 A;  4F93 B;  2KIC A;  4QWA A;  2DFL A;  2XCA A;  3H4D A;  5KFY A;  4BDP A;  2BGW A;  1D9F A;  5J2K A;  9ICU A;  4GLX A;  2ASJ A;  5G5H A;  3ISD A;  3ISC A;  4CF5 A;  1KBU A;  4I2G A;  1SXD A;  2WB1 F;  5KT7 A;  8ICL A;  2FE9 A;  4P0P B;  5L1I A;  4FZN A;  1UPH A;  7ICJ A;  3U26 A;  4F5R A;  5KFZ A;  4DQQ A;  3T79 A;  2BPF A;  4RPX A;  1NJW A;  2V4Q A;  3TAC B;  4O5E A;  3PX0 A;  5JTI A;  2JH7 A;  4Z6F A;  5AIC A;  8ICW A;  1N62 A;  3DV9 A;  4JWM A;  1Y88 A;  5AKK A;  2JEG A;  1RZT A;  2XC9 A;  2WB1 C;  1QCK A;  3LK9 A;  1WUD A;  3RB0 A;  3WK4 A;  4MEY A;  5IIN A;  1P7D A;  2K60 A;  2LYB A;  1NKB A;  4QWD A;  4M9L A;  5AK3 A;  4HYK A;  2MSN A;  2DPI A;  3MFH A;  1Z4N A;  1PK3 A;  3QZ8 A;  4F5Q A;  3QXG A;  3NVW A;  4KX5 A;  1B22 A;  1CUK A;  2FPK A;  1ZQQ A;  5DDM A;  2AGQ A;  3T5L A;  2VA3 A;  7ICH A;  2DUY A;  5DBC A;  1S0O A;  4F8R A;  4YCX A;  5ALK A;  3C2L A;  2HOQ A;  2LYH A;  1EXN A;  1X66 A;  1T8E A;  1CI4 A;  4QWE A;  4Z6E A;  4YD1 A;  3GIL A;  1NK7 A;  3IG5 A;  3KKA A;  5EWG A;  9ICB A;  4M2Y A;  5KG0 A;  3CYM A;  4Z6C A;  1UQV A;  5J0Y A;  4C8N A;  4Q43 A;  2BQR A;  3NVY A;  2ISP A;  3PO5 A;  3RBD A;  4KMO B;  3D2N A;  1X40 A;  4ED3 A;  5DLF A;  4Y2J A;  2JEI A;  8ICX A;  4XQ8 A;  1ZQL A;  2YQE A;  3VC8 A;  1BGX T;  4QW9 A;  3HRD D;  1NK5 A;  3OPX A;  3M1Y A;  4RQN A;  5KTQ A;  4B9V A;  1L8L A;  2E3T A;  4EBD A;  3F5E A;  2C2R A;  1SKS A;  5III A;  2JGA A;  2W04 A;  3TAD C;  3LWL A;  4P4P A;  2FLP A;  4R8U A;  2KV2 A;  3QNM A;  3EPG A;  4P0Q A;  3GV5 B;  2ATL A;  3KHG A;  1KTQ A;  2KP7 A;  5ALW A;  2QB0 B;  8ICP A;  5ALF A;  1LKY A;  4J9Q A;  4ED6 A;  2PFQ A;  3DDH A;  4DQR A;  1N56 A;  2FJ6 A;  2IOF K;  5KFI A;  5CB1 A;  3EUB 2;  3M7D A;  3KZX A;  3SEI A;  4O3M A;  2ZUB A;  4UAY A;  2HDO A;  4GFJ A;  3Q8L A;  4RT2 A;  2XO7 A;  4P4M A;  2AHO B;  3HP6 A;  4GC7 A;  2RLT A;  4USA A;  5JU5 A;  2F1J A;  2KMD A;  3JPT A;  4F71 A;  2BCQ A;  4EZ9 A;  5KL1 B;  4PGX A;  2AQ0 A;  3N7S C;  1XSL A;  4DQS A;  5AIA A;  1YZ7 A;  5CP2 A;  4UBB A;  1ZOL A;  2EZZ A;  5ALZ A;  2F3N A;  4GXK A;  1ZQC A;  2B21 A;  4DL6 A;  2Q0Z X;  2AQ4 A;  3ZDD A;  3LWM A;  1PK1 A;  1CRX A;  5C5J A;  2BPC A;  2IMW P;  8ICH A;  3SEN A;  5L1J A;  2HHW A;  2FI1 A;  3RB6 A;  4RPY A;  5A0L A;  2Y9U A;  2GH1 A;  2WF8 A;  3RAX A;  1S10 A;  3T5K A;  2LM1 A;  5L9X A;  4BJQ A;  2RRD A;  3QU4 A;  4RNN A;  3AU2 A;  3UMB A;  3H4B A;  2XCP A;  5J0T A;  2KD1 A;  2FMQ A;  1U48 A;  2JMG A;  4IL6 U;  2BHN A;  1CEZ A;  4FBU A;  4KLG A;  4DL3 A;  2ZTD A;  4GXJ A;  1X9M A;  2KJ8 A;  4QIW C;  1NK9 A;  1TE2 A;  2G07 A;  3L4P A;  1ZQK A;  2E8P A;  2ESE A;  2E8M A;  4QZA A;  4ECV A;  2EQY A;  2G0A A;  3NRW A;  5KT6 A;  5E79 U;  4I2I A;  1HUZ A;  1FFV A;  1L3T A;  4LVS A;  2WAQ F;  2PXI A;  3GDX A;  5KFR A;  4QZE A;  5K4L A;  5AKJ A;  5J2H A;  1X42 A;  2UVV A;  1ZQM A;  1B4F A;  1DOQ A;  3FC4 A;  3OHB A;  5EE0 A;  3TAR A;  1QSS A;  4EBE A;  4J9R A;  3RB4 A;  1SL0 A;  1TAM A;  3E0F A;  3OGU A;  4OJ6 A;  1HIW A;  3UXP A;  2ZG6 A;  3LVW A;  4EEK A;  7ICQ A;  2HHQ A;  1ZYQ A;  1QSY A;  2PFN A;  4DFM A;  1FO4 A;  4B9N A;  2KFZ A;  3SAG A;  1ZQP A;  8ICV A;  2F8L A;  3QE9 Y;  2KZM A;  3PSI A;  5IIK A;  1OW5 A;  1NKC A;  2BDP A;  2WTF A;  4IQV A;  1RM6 C;  2D6F C;  4MFA A;  1KL9 A;  2CRX A;  2JEF A;  4KLO A;  1SL1 A;  4NXZ A;  2UVR A;  3NUQ A;  2I6X A;  1FEZ A;  3LDA A;  2C28 A;  1HUO A;  3N7P D;  5J8Y A;  2ZXI A;  3HWT A;  2ZIX B;  2L5Y A;  4RQM A;  5KT4 A;  2I1Q A;  4C8M A;  5CWR A;  4YP3 A;  4DSF A;  5KFM A;  4Y2R A;  5AKL A;  4O3P A;  4YVZ A;  3R9K A;  4OJ5 A;  4RQ7 A;  3VCB A;  3PSF A;  4UAT A;  9ICE A;  4F92 B;  1L3V A;  2VKQ A;  1XU4 A;  2DF4 B;  2MU2 A;  3N4M B;  3UM9 A;  4YG2 A;  4QZ9 A;  1JXL A;  3IDW A;  5H2F U;  4C4R A;  4GXI A;  3QEA Z;  1N60 A;  4UAU A;  2WF7 A;  3V7L A;  1X9S A;  3PVX A;  4NWI A;  3QUQ A;  3ETR A;  1UT8 A;  5KFW A;  4RUA A;  2JEJ A;  5KFC A;  3ETL A;  4NL9 C;  2JZB B;  4O3R A;  2OM6 A;  4UAZ A; 
#chains in the Genus database with same CATH homology
 3B0Y A;  4UB2 A;  3JPR A;  3RJJ A;  5BOM A;  5DDY A;  4KLS A;  4TUP A;  1ZQB A;  4R65 A;  4NM1 A;  3B0X A;  5J2C A;  3UQ2 A;  4XA5 A;  4RQ6 A;  3JPQ A;  4DOA A;  1ZQG A;  2FMP A;  4KLJ A;  5J2E A;  3PNC A;  3MGI A;  5EOZ A;  3UXO A;  4O5C A;  5J0X A;  2BCR A;  4O5K A;  1KDH A;  3RJG A;  9ICT A;  4QZ8 A;  4O9M A;  5J2K A;  3RH6 A;  4PH5 A;  9ICU A;  3UXN A;  4M47 A;  3ISD A;  3ISC A;  8ICC A;  3MGH A;  5J2I A;  8ICA A;  4I2G A;  1BPX A;  8ICL A;  9ICG A;  4M9G A;  4I2E A;  4I2A A;  1BNO A;  4R63 A;  4PHE A;  4F5R A;  7ICJ A;  5J0S A;  5IIM A;  2BPF A;  4KLH A;  5TZV A;  4RPX A;  4R66 A;  1BPE A;  4O5E A;  3JPO A;  4RQ4 A;  5J0U A;  4PHA A;  4PGY A;  1BPD A;  4PHD A;  5J0P A;  4Z6F A;  5HHH A;  8ICQ A;  4I2D A;  4R64 A;  2FMS A;  8ICW A;  3AUO A;  4JWM A;  1KEJ A;  5J29 A;  2ISO A;  1RZT A;  1BNP A;  3C2M A;  3LK9 A;  7ICT A;  8ICB A;  1ZQS A;  4UAW A;  9ICF A;  5DBB A;  5IIN A;  9ICA A;  4M9L A;  4RPZ A;  4LZD A;  1DK2 A;  4I2J A;  8ICN A;  4QZG A;  4NY8 A;  4QZF A;  4F5Q A;  5J0O A;  4F5O A;  1ZQQ A;  3RH4 A;  2GWS A;  5BOL A;  7ICM A;  7ICH A;  4I27 A;  5DBC A;  7ICS A;  3HW8 A;  4YCX A;  4JWN A;  3C2L A;  4Z6D A;  4QZD A;  5DB9 A;  4NLN A;  8ICO A;  4Z6E A;  4YD1 A;  1BPY A;  9ICB A;  4M2Y A;  4Z6C A;  5J0W A;  1ZJN A;  5J0Y A;  9ICQ A;  1ZQN A;  2BCU A;  1TVA A;  2ISP A;  2I9G A;  1ZQR A;  4K4H A;  4KLU A;  5J0Q A;  8ICX A;  1TV9 A;  1ZQL A;  3RJH A;  4KLI A;  1MQ2 A;  4YMO A;  5J2J A;  4FO6 A;  5J2B A;  4I2B A;  4RQ3 A;  5J2D A;  4I2C A;  4DOB A;  3RJF A;  9ICR A;  7ICO A;  7ICE A;  2PFO A;  3RJI A;  5III A;  4UB5 A;  7ICL A;  4I29 A;  5DBA A;  2KP7 A;  8ICM A;  8ICP A;  1XSN A;  4K4I A;  2PFQ A;  4TUR A;  4LZG A;  3V7K A;  5IIL A;  1ZQH A;  5DB8 A;  7ICR A;  5CB1 A;  2PFP A;  4YN4 A;  1ZQD A;  4NLZ A;  1DK3 A;  5DB7 A;  8ICZ A;  4MF8 A;  4UAY A;  4M9J A;  9ICP A;  7ICU A;  4RT3 A;  4RT2 A;  4M04 A;  3UQ0 A;  4KLQ A;  4KLM A;  9ICI A;  3JPT A;  4QZC A;  4NLK A;  3HX0 A;  2BCQ A;  4QZI A;  4PGX A;  1XSL A;  4MF2 A;  3UPQ A;  1ZQE A;  4UBB A;  7ICK A;  4GXK A;  1ZQC A;  3MDA A;  4YMN A;  9ICS A;  4UB3 A;  9ICC A;  4F5N A;  5DKW A;  8ICK A;  4M9H A;  8ICH A;  3TFR A;  1ZQT A;  4RPY A;  9ICH A;  4K4G A;  3MBY A;  4RQ1 A;  5J0R A;  4I2F A;  4PPX A;  8ICS A;  8ICU A;  3V72 A;  3V7J A;  5J2A A;  8ICE A;  4PHP A;  3AU2 A;  4KLT A;  5J0T A;  2FMQ A;  9ICM A;  4PGQ A;  7ICN A;  2BCV A;  3JPS A;  7ICP A;  5IIO A;  4KLG A;  9ICK A;  2BPG A;  4GXJ A;  3C5G A;  2P66 A;  9ICN A;  1ZQK A;  4I28 A;  9ICV A;  4KLE A;  8ICR A;  4QZA A;  3AU6 A;  4P2H A;  4RQ0 A;  5DB6 A;  5IIJ A;  4UB4 A;  4YD2 A;  4I2I A;  4UB1 A;  1HUZ A;  4KLF A;  9ICL A;  1ZQI A;  4LVS A;  1XSP A;  2PXI A;  3GDX A;  3RJE A;  5J2F A;  4QZE A;  4QZH A;  5J2H A;  1ZQM A;  3JPP A;  3RH5 A;  4DO9 A;  3OGU A;  4KLD A;  4IQU A;  5D49 A;  5D46 A;  4IQW A;  4RQ2 A;  8ICT A;  8ICJ A;  1BPZ A;  8ICI A;  3UXP A;  9ICO A;  1ZQO A;  4KLL A;  7ICQ A;  2PFN A;  8ICF A;  1MQ3 A;  1ZQP A;  8ICV A;  9ICJ A;  3C2K A;  7ICI A;  1JMS A;  5IIK A;  3JPN A;  4I2H A;  4RQ5 A;  4IQV A;  4M0A A;  4MFA A;  4RQ8 A;  4KLO A;  4NXZ A;  9ICW A;  4M9N A;  4XUS A;  4YMM A;  1HUO A;  2IHM A;  4TUS A;  3HWT A;  1ZQF A;  3MDC A;  2BCS A;  7ICG A;  3PML A;  7ICV A;  3C5F A;  5CWR A;  3ISB A;  4TUQ A;  4MFC A;  3PMN A;  4NM2 A;  9ICX A;  7ICF A;  4MFF A;  2W9M A;  4RQ7 A;  9ICE A;  4QZB A;  4UBC A;  4IQT A;  3RJK A;  4QZ9 A;  5BPC A;  4GXI A;  8ICG A;  5D4B A;  3V7L A;  5HHI A;  4DOC A;  1ZQJ A;  1NZP A;  8ICY A;  1ZJM A;  1ZQA A;  4F5P A;  4X5V A;  3TFS A;  4UAZ A;  5J2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...