2KP7A

Solution nmr structure of the mus81 n-terminal hhh. northeast structural genomics consortium target mmt1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
80
structure length
80
Chain Sequence
RPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Solution NMR structure and DNA binding mode of the Mus81 n-terminal helix-hairpin-helix domain
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 25
structure length 80
sequence length 80
ec nomenclature ec 3.1.22.-:
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2kp7A01
4DOAA 4RQ3A 4PGQA 4RT3A 8ICQA 4I2FA 1ZQJA 2ISOA 4NY8A 4I2DA 4I2HA 4GXIA 4O5KA 4TURA 1BPZA 4K4GA 9ICSA 4RQ6A 4PHPA 1BPYA 4UB4A 4I28A 4F5OA 4M0AA 1XSPA 4UB1A 4RQ4A 4P2HA 1MQ2A 9ICMA 4KLEA 3JPNA 4RPYA 2PFOA 4KLUA 3PNCA 3HX0A 4RQ0A 8ICWA 1ZQHA 5J0OA 4PHDA 8ICIA 1BPDA 1BPEA 4RT2A 3PMNA 4MFAA 3C2MA 7ICIA 9ICLA 8ICMA 4Z6FA 4TUSA 9ICOA 4UB5A 4I2EA 4KLHA 3UXPA 4O5EA 5J0SA 4RQ2A 1XSLA 8ICYA 4R63A 8ICCA 2PFNA 3JPRA 5DKWA 5J2EA 4RQ8A 4JWMA 9ICWA 3V7LA 5D49A 5J2IA 1ZQSA 7ICPA 5J0PA 2I9GA 5J0YA 1DK3A 4QZFA 1MQ3A 1ZQMA 1KEJA 4PPXA 4YN4A 8ICLA 3B0YA 3ISDA 4DOBA 1ZQCA 9ICKA 4NLKA 5IIOA 7ICMA 5D46A 3GDXA 5J2FA 1JMSA 1HUZA 5IIJA 1BPXA 4M04A 7ICHA 1ZQKA 4UB2A 5IINA 1ZQAA 7ICJA 2BPGA 1ZQLA 8ICFA 3C2KA 2BCVA 4KLDA 4Z6EA 3RH5A 4YMMA 3MDAA 4YMNA 5J2JA 8ICTA 4UAYA 5HHIA 4UB3A 4R64A 1ZQQA 7ICLA 4QZBA 4MFFA 4RQ1A 1RZTA 4UBBA 4UAZA 4R66A 8ICNA 7ICEA 7ICKA 4KLGA 4YD2A 5J2DA 8ICXA 4YCXA 2BCUA 9ICXA 1ZQPA 3TFRA 5DB6A 5DBAA 4I27A 4KLFA 4KLSA 4I2CA 4NM2A 4QZCA 7ICTA 1TVAA 4DO9A 3UPQA 5CB1A 2BCRA 5CWRA 3RH4A 4KLOA 1ZJNA 8ICBA 4UAWA 1ZQRA 9ICAA 2KP7A 8ICJA 7ICGA 4X5VA 3V7JA 1DK2A 8ICHA 3C5GA 7ICQA 1NZPA 5DB9A 3V7KA 4I2JA 9ICGA 3ISCA 1ZQBA 9ICIA 1BNOA 8ICSA 5HHHA 5J29A 1XSNA 3ISBA 5IIKA 8ICZA 7ICUA 9ICQA 4F5QA 8ICPA 4RQ7A 5J2GA 1ZQTA 5DB8A 3JPOA 3RJFA 2IHMA 5DBBA 8ICOA 9ICHA 4K4IA 4F5PA 4M9GA 3AU2A 7ICRA 4RPXA 9ICBA 2W9MA 4RPZA 4M2YA 2PXIA 4PHEA 4LZGA 3LK9A 5J2KA 4KLLA 7ICOA 4YD1A 3UXNA 5EOZA 5BOMA 9ICFA 4I2BA 4NLZA 3V72A 3HW8A 5J0RA 2ISPA 2FMSA 1BNPA 4DOCA 3HWTA 1ZQFA 7ICNA 4TUPA 4PGYA 4FO6A 2FMPA 4O9MA 4IQTA 8ICUA 8ICAA 7ICVA 3RJGA 1ZJMA 4IQWA 4QZEA 5BPCA 5DDYA 2BCQA 4R65A 4I2IA 4F5RA 9ICJA 1ZQDA 3UXOA 3RH6A 5DB7A 4PGXA 4KLIA 3C2LA 4GXJA 4I29A 8ICRA 3AUOA 3JPQA 4Z6DA 7ICSA 3C5FA 9ICEA 3MGHA 4TUQA 1ZQEA 4MF2A 4QZIA 3UQ0A 2PFPA 9ICNA 3JPTA 4M9NA 4M47A 4O5CA 8ICVA 4I2GA 2PFQA 3PMLA 4KLQA 4XUSA 5J2AA 4PH5A 3B0XA 5D4BA 4QZ8A 4YMOA 4NLNA 2GWSA 9ICCA 5J2CA 4QZDA 1HUOA 5BOLA 2FMQA 3TFSA 3RJEA 9ICVA 4I2AA 3AU6A 4QZHA 2P66A 4QZ9A 4Z6CA 8ICGA 4KLTA 7ICFA 3RJHA 5J0WA 4XA5A 5IILA 4LZDA 4F5NA 1KDHA 2BCSA 4GXKA 3RJJA 5IIMA 9ICRA 5DBCA 5J2HA 4QZAA 4QZGA 4NM1A 3MGIA 8ICEA 4K4HA 4KLJA 1ZQOA 5IIIA 3RJKA 5J0TA 4M9HA 4M9JA 1ZQNA 4PHAA 8ICKA 9ICUA 5J0XA 3RJIA 4KLMA 4IQUA 3UQ2A 1ZQIA 4JWNA 3MBYA 4UBCA 9ICPA 3OGUA 5TZVA 4RQ5A 4IQVA 1ZQGA 1TV9A 2BPFA 9ICTA 5J2BA 4MFCA 5J0QA 5J0UA 4LVSA 4M9LA 4NXZA 3JPSA 4MF8A 3MDCA 3JPPA
chains in the Genus database with same CATH superfamily
4PGQA 1V38A 3L5KA 4I2FA 1ZQJA 5T14A 4C8LA 3Q8SB 2F1HA 3HKZF 5L1JA 3BQTA 3SQIA 4RQ6A 5JTIA 5DQGA 2B6GA 4F5OA 2DPIA 4FZLA 4RQ4A 4P2HA 5KFCA 3GIJA 2KNJA 1YZ7A 5GTIU 2PKEA 4EBCA 2H3QA 5AKIA 4FZNA 1S97A 4UB6U 3PNCA 4C80A 4UQGA 3RR7A 3GIKA 4FFDA 3MR2A 1N63A 4MFAA 1JUDA 2EAOA 3PW7A 4EEYA 3QEBZ 4TUSA 1A6SA 4OJ5A 2GO7A 2JH7A 2HVHA 2W3RA 3NTUA 3UXPA 1C20A 5ALTA 2WHEA 1HIWA 4O5EA 2VA3A 1Z1VA 3M9OB 4R63A 3F2DA 2HOQA 1RQLA 1QSLA 2ZXIA 4C7ZA 4OO1J 2KVCA 4ZOHC 5ALYA 5DKWA 4RQ8A 1QSYA 9ICWA 1YT3A 3GFKB 3V7LA 5KFZA 2HVIA 1ZQSA 7ICPA 1KEJA 2Q4TA 2LYAA 5ALGA 2VIXA 4DOBA 9ICKA 5KT3A 5GTHU 5KT7A 3GDXA 1KKXA 3RR8A 4ECYA 5KFPA 1NKBA 1U45A 2ASLA 3LYSA 3ZDEA 4F72A 2NO5A 4UB2A 5IINA 2VKQA 5AM5A 2Y9TA 7ICJA 1C7YA 3PZPA 4EX7A 4KLDA 2DPJA 3RH5A 1L3UA 2KZZA 2BDPA 2DQNB 3MDAA 5J2JA 3H8SA 3M9NB 3ZDDA 5KFFA 3M8RA 1DOQA 3BS7A 2DF4B 1JX4A 1L8LA 2F44A 2KSOA 2OH2A 1L5UA 4OD0A 4UAZA 1SL1A 1KL9A 1ZQUA 8ICNA 1D9FA 1QLNA 7ICEA 4Y2SA 4KLGA 3VC8A 4QNLA 1JXEA 1L7OA 3WK9A 1QTMA 1ZYQA 2HBKA 4FZMA 2KTQA 2W3SA 4YR0A 3OHBA 4I27A 2HHWA 4KLSA 2YMPA 5G5HA 4NM2A 2P6UA 4DO9A 3WK7A 1WCLA 3RB6A 1XS9D 8ICBA 4DFJA 3MC1A 2NO4A 4UAWA 5J8YA 2ZUCA 5HMLA 3OTQA 1SXDA 3MFIA 5EWGA 4X5VA 2YB1A 4P0PB 1DK2A 1NJXA 4YXJA 8ICHA 5AKEA 2IHNA 1U4BA 5DB9A 3V7KA 4PZOA 1K5OA 2QKQA 2XC9A 2JR5A 5J8YC 4JV0A 1KTQA 1V85A 2W9BB 1BNOA 2Y9UA 2LKYA 4UARA 2OM6A 5KFKA 1S8OA 2JEGA 8ICZA 5HR7A 3F5EA 2BDUA 3NVWA 4F2RA 2YB4A 4F5QA 2KICA 1PVPA 4BGDA 4J9QA 1ZQTA 1EXNA 5DB8A 4ED0A 4PL1A 4KN7A 5B66U 1V9PA 3HRDD 5DBBA 2OCEA 4Y2RA 9ICHA 3T5HA 1NK9A 1ECWA 4M2YA 1QQ6A 5KFMA 3LVWA 5J2KA 3UM9A 5E79U 3ALRA 4E0DA 1WG8A 2KK0A 5EOZA 3IM1A 4R8UA 1JN3A 5DG7A 2K60A 5KNIA 5AICA 4YVZA 3MABA 5ALLA 3SI8A 2KKVA 3LWLA 4Y2UA 4TQSA 4ECXA 3N4MB 5KG4A 4DFDA 2Z7JA 2W03A 2ZUBA 4USAA 1ZQFA 2HOIA 4FO6A 5JU5A 8ICAA 1ZJMA 2WF5A 2ZJ8A 2JH1A 5AKJA 2R8IA 5AI9A 2HHUA 2KJ8A 4B9VA 3H8JA 3PY8A 3VCBA 4O3RA 9ICJA 5ALHA 2ZIUB 3ZI4A 4BXOA 1ZQXA 4O3QA 2HDOA 3K4GA 5CEHA 5AK4A 1UHUA 2Y0SC 4P0QB 4RNMA 4J9PA 4GXJA 5AIBA 3I1YA 4IR1A 2F77X 2FI1A 3JPQA 3FAHA 3TADC 1NZBA 4P4MA 1TFRA 3M7DA 7ICSA 9ICEA 2WAQC 1PK1B 2LYBA 1ZQEA 5AKYA 4EX6A 1SZPA 1UPHA 3BS5B 3V6HA 2WB1C 2PFPA 2ATLA 4IRDA 2LBOA 4YXMA 2XY7A 9ICNA 2G09A 4M9NA 4O5CA 3NS1A 3BQ1A 4I2GA 1SV4A 2PFQA 3RTVA 2E3TA 5L1MA 4KLQA 2K4PA 3C28A 2RHFA 2H5XA 1RXWA 2A3VA 5D4BA 2HHTA 1KSPA 1QCKA 5KFSA 2GWSA 2IOHA 3PR4A 9ICCA 4QZDA 4F8RA 1HUOA 3CP8A 3RJEA 3QNMA 1Q46A 4I2AA 4QWBA 5AKXA 1N56A 2KHVA 5KG7A 4RUAA 2D3DA 2W43A 2ZIXA 4GLXA 1WCNA 1U9LA 2A1JA 7ICFA 1UCVA 4P4PA 2JHDA 1L6NA 2JZBB 5EWFA 4XA5A 5IILA 4HAIA 1PVRA 2BCSA 4GXKA 1J2NA 3ZDBA 4JK1A 2HI0A 1NI3A 1FO4A 1N48A 9ICRA 3EPGA 5DBCA 4EELA 5J2HA 3T5LA 2EZZA 4NM1A 3OSNA 8ICEA 3IHQB 3J81j 4RUCA 3MFHA 3D2SA 1S77D 3RJKA 3SAHA 5AM2A 4DL5A 4QJFB 4Y2JA 5DDMA 1ZD3A 1ZQNA 4BWMA 3H8MA 4Q8EA 9ICUA 3LVVA 3HP6A 3L4PA 4KLMA 4ECTA 3H4BA 2KVSA 3ICXA 2W54A 1X9XA 4WJ3B 5ALXA 2QB0B 3NGDA 1TV9A 1SKSA 5ALPA 4B9SA 2XY5A 3SAFA 1Q3UA 5KFYA 4ZH4A 4OJOA 1MN8A 2M0NA 4M9LA 3JPSA 3RBDA 3C21A 4P0PA 2BQ3A 4RT3A 8ICQA 4NY8A 2ISOA 4I2DA 1T4GA 4I2HA 4FS2A 4BX9C 5KFBA 4O5KA 4TURA 3M8SA 1SWWA 4PHPA 2G08A 5KFJA 2HCFA 4UB4A 3M6KA 5KTQA 4JV1A 2NRVA 1XSPA 4UB1A 1Z3EB 3NRWA 2W9AA 3FC4A 2PFOA 3EPIA 2MSNA 1KQQA 4CNQA 3HX0A 5J0OA 2F3NA 3M6ZA 1BPDA 5F9LA 2WF7A 2E1EA 2G07A 4RT2A 3QEAZ 7ICIA 9ICLA 1DGSA 5AI4A 2M9NA 3Q8MA 9ICOA 4UB5A 4I2EA 3GILA 2JEIA 4KN4A 4ACOA 4KLHA 2F2AB 2JEFA 1JRPA 5FP0A 4FS1A 5J0SA 1XSLA 2PMZC 3OSPA 2UVVA 5KT4A 4Q43A 2PFNA 5KG0A 3JPRA 5J2EA 4Y2QA 1Y88A 5J0YA 4ECWA 4QZFA 1MQ3A 5AKLA 8ICLA 4AYBC 1K1QA 2XGPA 4DS5A 2KJ9A 4F4XA 2K8AA 1ZQCA 3WKBA 4NLKA 5D46A 2G5HB 3BZKA 1HUZA 1BVSA 3NVYA 5DGAA 4Y2TA 1FIQA 5IIJA 5AM4A 2MUTA 3CYMA 1PK3A 2DL0A 2C2DA 4IRCA 2NV3A 2G06A 4EBEA 5HR6A 7ICHA 2F1JA 4BUGA 2QARB 3F5AA 4Q45A 4Z6EA 1X6IA 2ZIUA 3OHAA 2EQYA 3WKAA 4YMNA 4UAYA 4R64A 1K1SA 3GU3A 2FLNA 1OW5A 5DG8A 1Z00A 3Q8RB 2A1AA 4MFFA 1X42A 5KFLA 4XRHA 3LDAA 1PVQA 4DL4A 4R66A 1N2XA 4F4ZA 2ZJ5A 1TAMA 8ICXA 3IRUA 3ONNA 1IM4A 3QZ7A 3TFRA 5DB6A 1NK6A 4KMOB 1SB3C 1NOMA 3PX6A 4O3PA 3PSIA 1T8EA 3IG5A 2RDJA 4YQWA 4DEZA 2RQ5A 3UPQA 5CB1A 1RM6C 5G5GA 5CWRA 4KX5A 4O3MA 4KLOA 1ZJNA 2KP7A 1JIHA 1VLBA 4DSJA 3OPXA 7ICQA 3T3FA 2YQEA 4F92B 1L3TA 2G5IB 4OJ6A 2F76X 1ZQBA 4FBUA 1N5XA 4J9RA 1COOA 1X2IA 4FE3A 2AXTU 2P35A 5J29A 5IIKA 3OJSA 2W55A 9ICQA 1U48A 8ICPA 3N97B 4CGZA 5J2GA 3IN5A 4J9SA 2KFNA 4C8KA 3JPOA 3WKDA 5KG5A 2BQRA 2D6FC 1UQVA 4DSEA 8ICOA 2WF8A 5EE9A 2BQUA 5L1IA 5CRXA 4F5PA 1L3VA 1D8BA 3AU2A 7ICRA 2Y0SF 5KFUA 2ASDA 4DQIA 4KX3A 2NRXA 1L7PA 1KFDA 2PXIA 5CR0A 1SV0A 1FFUA 2GLEA 1RG6A 1L3SA 2YY6A 3E0FA 2YMLA 3N28A 2WAQF 5AIAA 4M6WB 3F53A 2ODGA 2FPLA 2KIVA 2WB1F 5ALUA 2LI6A 2YMMA 3O0FA 5J0RA 1OUQA 1SV0C 2FMSA 2KMDA 5B5EU 4DOCA 1B43A 4DFPA 3C1YA 7ICNA 1TK8A 1VJ5A 4UATA 4B6JA 1NKCA 4O9MA 2H3IA 2I6XA 4ECSA 2K8BB 4CF4A 1NK0A 1X6JA 2KFZA 2YN4A 1SKRA 2ZTDA 3E2EA 1ZD5A 1VDVA 4BJQA 2XCPA 2IOFK 5EE0A 1ZQDA 3QUBA 3WKEA 5KT6A 4PGXA 4KLIA 3RB0A 2I5HA 2KV2A 3AUOA 1XO1A 1S0OA 2ZXHA 2IOFA 3CNHA 3TI0A 3KFUF 4UB8U 5F9NA 4CE6A 4TUQA 4PZNA 4MF2A 2JV3A 2KG5A 5AKGA 5ALJA 4ED1A 3R9KA 4EENA 2C22A 2C2EA 3Q8PB 2XCAA 3D2QA 1JROA 4IRKA 3ED5A 2KKPA 5KFQA 1M6YA 5J2CA 2K4IA 2Y1IA 2K4EA 4J9MA 3QYPA 3KHLA 3ETLA 2PI4A 2E5SA 2JXJA 3AU6A 4NL9C 3KHRA 3TKAA 3BDPA 2P6RA 4QZHA 4YR3A 4C7YA 2MA1A 1SZHA 2UVRA 2WTFA 5KFVA 2BHNA 2HOFA 1CUKA 3SZ2A 2BZFA 1TK0A 3RJJA 4EBDA 4BWJA 3G6VA 5KFEA 3RBEA 4K4HA 2XVTA 2BPCA 4OJLA 4ED2A 4DSLA 1LB2B 4M9HA 2W7PA 1A77A 3DV9A 4GIBA 4ED7A 3Q8QB 3RJIA 4IQUA 3H8WA 2ZIWA 3UQ2A 1ZQIA 4JWNA 3MBYA 3Q8KA 4UBCA 2AGPA 3RFAA 1JXLA 4RQ5A 4TQRA 2KZ3A 1WYGA 3TADA 4RNOA 5L1KA 2IMWP 9ICTA 3WU2U 4U7CA 5EE3A 4BDPA 3OJUA 1SKWA 4J03A 1WWUA 5J0UA 1S9FA 2LM1A 1TK5A 2PMZF 1RPLA 4CCHA 1MC8A 1RYUA 2V9WA 3MDCA 2V4RA 3JPPA 4DL6A 3I28A 4ED3A 4RQ3A 3QUQA 5AM0A 4F2SA 5KFXA 5KFNA 1JALA 5AI6A 2J6UA 1BPZA 4AYBF 4K4GA 3SEIA 3QX7A 2YTUA 1BPYA 1S10A 3S6JA 4QWEA 1CRXA 4M0AA 4NLCA 2HHXA 5C5JA 2R8HA 4KLEA 3JPNA 1ZQZA 4RPYA 2ASJA 1LKYB 4B9LA 4ED8A 3K75D 4LJXA 5AHXA 2BKEA 3KZXA 4RQ0A 2FE9A 1A0PA 8ICWA 3SYZA 2Y1JA 3ZDCA 5KT2A 4QIWC 2RDIA 3H40A 1BPEA 2CPRA 3PMNA 3GQCA 3SENA 1NJWA 4RQNA 4QW9A 1V97A 2E8NA 8ICYA 8ICCA 1LV5A 5DGBA 2E8PA 2W11A 2OEHA 3THVA 1NK4A 2FDRA 3QUTA 1ZQWA 4DL2A 4JWMA 1HJPA 5ALKA 5D49A 5J2IA 4EYIB 2HHSA 3IV6A 5J0PA 1O08A 2I9GA 1DK3A 4PPXA 4YN4A 4NLGA 3ISDA 4RNNA 2VJ4A 4O3NA 5ALQA 1ZETA 1XWLA 4IC9A 2NYVA 1JMSA 1Z1BA 5AKHA 2IBKA 1X40A 5ALNA 3QU2A 4EEKA 1TAQA 1Z19A 3PW2A 3NASA 1BPXA 2ZTEA 5AKZA 2K4HA 1ZQKA 5ALVA 1ZQAA 2AGQA 1ZQLA 1MA7A 8ICFA 2BCVA 4Y2YA 3EWAA 3GV5B 4DQSA 5AK5A 3A0HU 3AN1A 3WK8A 8ICTA 5JUMA 4UASA 3I76A 3TANA 4CF5A 5KFGA 2UVWA 4O0IA 1HEKA 7ICLA 5KL8B 4RQ1A 4UBBA 4JUZA 3PO4A 2YX8A 2HW3A 1CEZA 5J2DA 2LM4A 1DGJA 3EUB2 3FDSA 3NVVA 1ZQPA 2GH1A 1SXEA 5DBAA 1KBUA 4KLFA 2HBJA 3IDWA 4QWCA 4DL7A 1TVAA 3H7IA 1KN5A 2W9BA 3QU9A 4DQPA 2HHQA 3G6XA 3RH4A 3KHGA 4ELVA 3AMZA 1O03A 4ECZA 2V4QA 8ICJA 3NUQA 2WF6A 4C4RA 3PX0A 4CF3A 2O6KA 3C5GA 2KOBA 1H38A 3IP4B 1D8YA 1T7PA 4C8NA 1L8OA 1ZRMA 3PSTA 5KFTA 1XNSA 4GC7A 3K1RB 2FPKA 4J9KA 8ICSA 1RXVA 5HHHA 1X9SA 3B9JA 2FPMA 4O3SA 7ICUA 5DLFA 3GIMA 3PX4A 4RQ7A 1WUDA 5KFAA 3RJFA 2ES6A 4ECVA 5KT5A 3N7SC 1S0NA 1S0MA 4RPXA 4RPZA 5ALDA 3FYHA 4P4OA 1ZD2P 4PHEA 2NRWA 4LZGA 1AQ6A 3LK9A 5ALFA 4KLLA 1YZ6A 3UXNA 5BOMA 4UAUA 2CRXA 4NLZA 3V72A 3C29A 1S0VA 2XGQA 3TARA 2KZMA 4A8EA 4OJPA 1DXSA 4F93B 1U47A 4F4YA 2ISPA 4P0QA 1NKEA 4PL2A 4PGYA 1RYSA 2FMPA 8ICUA 7ICVA 3RJGA 1IV8A 2W7OA 4Y2VA 2RP5A 4IQWA 4QZEA 3ORYA 1ZOLA 5BPCA 1NNLA 4B9MA 4R8UB 1PK1A 4KITB 2W8LA 2NRZA 3BS5A 2FLPA 2EZXA 5ALZA 2H3FA 3UXOA 4FBTA 2QLTA 5DB7A 5A0LA 2DBYA 4JV2A 2GOLA 8ICRA 1RDFA 4C0ZA 2J6SA 3HPOA 2B0CA 3SV3A 3QUCA 2AHOB 4DQRA 3TQ1A 1T94A 4MHVA 3V6KA 2LMRA 5KFOA 4DFKA 5KL1B 5KG1A 4GC6A 3UQ0A 4IL6U 2I1QA 3N7PD 4B9NA 2KIWA 3GV7B 1NK5A 2W04A 2HBLA 3JPTA 4M47A 4BXOB 3D2NA 2W9CB 8ICVA 4IR9A 2JZBA 2ZIVB 3PMLA 1UA1A 4XUSA 5J2AA 4DFMA 2QB1A 1N5WA 2A19A 1F44A 4YR2A 1XO0A 5AKKA 5BOLA 2FMQA 3TFSA 4ELUA 1AROP 9ICVA 3C23A 3UMCA 1QQ7A 3NVZA 2JEJA 3TACB 3DDHA 4ED6A 4YG2A 4QZ9A 5F3XB 3CW2C 3ZD9A 1D9DA 1MSWD 3SD7A 1RYRA 3ZDAA 5J0WA 4ECRA 1TE2A 4B9UA 2ESEA 5K4LA 4LZDA 4F4WA 2MAXA 3PR5B 5KAFU 2ALZA 2AU0A 3TAPA 1SWVA 2F8KA 2QB0A 3QXGA 4C8MA 1UT5A 4QZGA 2ZUDA 3SR6A 1SIJA 1XC9A 4KLJA 1SL2A 1ZQOA 3ZD8A 3PW0A 2EAPA 5J0TA 2ZIXB 3EW9A 5DQHA 2A1JB 3T79A 3PVXA 2MU2A 1Z4NA 2HBMA 2W8KA 5ALIA 2OXOA 5KG6A 4DS4A 3MR3A 1PUZA 2JRZA 3MR5A 9ICPA 5CJ7A 1B4FA 3BQ2A 2AJQA 2OYYA 1ZQGA 2R8KA 4QIWF 3SMVA 4NLBA 3D6JA 4PJ0U 4ICAA 4EYHB 1BGXT 2BPFA 4YP3A 5J2BA 3H0MB 2ZTCA 1T3QA 4QWDA 1KRPA 5J0QA 5HP4A 5EE1A 3C1ZA 2AQ4A 5KG2A 2UVUA 2ZG6A 2VA8A 1F5SA 4OCZA 4NXZA 4DL3A 3AQEA 1FFVA 4F50A 3PSPA 5DQIA 4MF8A 5L1LA 4DLEA 3QU5A 4DOAA 2WF9A 1N60A 1TAUA 1TKDA 1QQ5A 5AM3A 2K89A 4GXIA 2VJ5A 2E8OA 1NJZA 1PZNA 3AQFA 4C4SA 4G9BA 9ICSA 3PW5A 4CDGA 2DWQA 4I28A 1QH9A 3BZCA 4NL9A 2L5YA 1MQ2A 9ICMA 2AQ0A 2HHVA 1Q8KA 5CHGA 4KLUA 5ALWA 1L7MA 1ZQHA 5AK3A 4PHDA 8ICIA 3H0RB 3WK4A 2KHQA 3H0LB 3RAQA 3C2MA 4F3OA 3A0BU 1QSSA 8ICMA 3HILA 4Z6FA 4J9LA 1UA0A 4RZRA 5KAIU 1NK7A 5C0YA 5L9XA 4AP9A 4RQ2A 2E1FA 3M1YA 4IS7A 3QE9Y 4QWAA 3UMBA 1J2MA 4O3OA 3GIIA 4B9TA 4GFJA 2FJ6A 1ZQMA 2QARA 2K8CB 4YFKA 5JRTA 3KKAA 3TAQA 3HKZC 3B0YA 2AH5A 3WK6A 5ALRA 1ZQYA 7ICMA 5IIOA 5J2FA 1RQNA 4C4TA 3F2CA 5CP2A 2BGWA 2YMQA 4QW8A 3ETRA 4M04A 3KKAC 5H2FU 3Q8LA 1X9MA 3KZIU 2BPGA 3C2KA 3H4DA 3SV4A 3GZFA 4YMMA 2R8GA 2C2RA 5HHIA 4UB3A 4DQQA 1S76D 1ZQQA 4CRXA 1S5LU 4QZBA 4DCCA 1RZTA 1KW4A 2KEYA 2MUTB 7ICKA 4YD2A 4YCXA 2F8LA 2BCUA 9ICXA 3MGVA 5AM1A 1KFTA 4EZ9A 2W9CA 3HT3A 4J9NA 2ZIVA 4I2CA 5DLGA 4QZCA 2RRDA 7ICTA 2ZJAA 2EANA 2R8JA 1Z00B 2BR0A 5AI8A 2BCRA 3SAGA 5DG9A 3KHHA 1ZQRA 2XIDA 9ICAA 2DFLA 4NV0A 2EDUA 3QU7A 3U26A 7ICGA 1ZRNA 3V7JA 3M9MB 2XO7A 5KFHA 1NZPA 2D8CA 2G0AA 2IA6A 1KFSA 4I2JA 9ICGA 1Q3VA 1X9WA 4ELTA 2HMXA 3ISCA 9ICIA 1A76A 2NRTA 5KFDA 1XSNA 3ISBA 2E8MA 4UW9A 3L3FX 4M6WA 4KMUA 2C28A 3LWMA 4XQ8A 2IHMA 2LHTA 5KFIA 4DF4A 4K4IA 2F1IA 4JB3A 4MEXA 4M9GA 5EWEA 5TISU 3BJYA 2XY6A 2OHFA 2W9MA 9ICBA 5CA7A 3EZ5A 2CXYA 1N61A 1NK8A 2KD1A 7ICOA 3V6JA 4YD1A 3KD3A 2B21A 9ICFA 4I2BA 4NJ8A 2OWOA 4Y2XA 4DLGA 2JGAA 1U49A 2H3ZA 3HW8A 1D8LA 2FLLA 4DF8A 3FM9A 3WK5A 1BNPA 3HWTA 4TUPA 3E58A 1Z4OA 4IQTA 1LVHA 4Y2PA 2EH9A 3IG8A 5HNKA 1COKA 5DDYA 2BCQA 4R65A 2RLTA 4I2IA 3QZ8A 4F5RA 2DKXA 2EZYA 2JMGA 3RH6A 1XU4A 1URJA 3F2BA 1NJYA 3MR6A 4C8OA 1B22A 3C2LA 4DSIA 4I29A 1OXJA 1GO3F 3BQ7A 4NWIA 2KSOB 1IXRA 4Z6DA 3C5FA 1IG6A 5KFRA 3MGHA 3PSFA 2WFAA 4MEYA 3RF9A 4QZIA 4KTQA 1ED1A 4DWIA 4HYKA 5AI0A 3PW4A 2EAMA 2N1RA 4JMUA 2KE7A 5ALSA 4PH5A 3AL0B 3B0XA 1DRGA 3RB3A 4QZ8A 4YMOA 2DKZA 4US9A 4NLNA 3PV8A 2R18A 1KLNA 1JI7A 5HMMA 1SL0A 3KBBA 2P66A 3PO5A 1T3NA 3G6YA 4Z6CA 3T5KA 3GV8B 1WWVA 5ALEA 8ICGA 4KLTA 4UAVA 4RU9A 3RJHA 1BPBA 3HJEA 3T5JA 4F5NA 1KDHA 3AM9A 3RRHA 1ZXIA 2LPEA 5IIMA 5KFWA 2J6TA 4EZ6A 3NRZA 1ZQ1C 4QZAA 4DSKA 2MRLA 2PI5A 2VANA 2HSZA 1N62A 2KN7A 3MGIA 3K1ZA 1F0MA 1CI4A 2LYHA 1FEZA 5IIIA 4DSFA 2XICA 2Q0ZX 4U6PA 4M9JA 1UT8A 4PHAA 1X66A 4J9OA 8ICKA 5ALMA 3RB4A 5J0XA 2DUYA 3EYZA 1B0XA 3CRXA 1J97A 3QU4A 3OGUA 3DEEA 2CN1A 2H3VA 5TZVA 4Q8FA 3RRGA 3KOOA 4F91B 2XI9A 4IQVA 4US8A 2VA2A 3N7RC 1IIPA 4RQMA 4G3IA 4F4KA 4ECQA 1SGGA 1ZD4A 2KJ5A 3WKCA 3UMGA 1L7NA 5ALOA 5KG3A 4MFCA 1P7DA 5AI5A 4F71A 3BQ0A 2DGZA 3RAXA 3AEVA 4ECUA 4LVSA 1LKYA 5AK6A 2ZIWB 1ZQVA 3KTQA 4Q44A 2AGOA
chains in the Genus database with same CATH topology
4DOAA 4RQ3A 4PGQA 4RT3A 8ICQA 4I2FA 1ZQJA 2ISOA 4NY8A 4I2DA 4I2HA 4GXIA 4O5KA 4TURA 1BPZA 4K4GA 9ICSA 4RQ6A 4PHPA 1BPYA 4UB4A 4I28A 4F5OA 4M0AA 1XSPA 4UB1A 4RQ4A 4P2HA 1MQ2A 9ICMA 4KLEA 3JPNA 4RPYA 2PFOA 4KLUA 3PNCA 3HX0A 4RQ0A 8ICWA 1ZQHA 5J0OA 4PHDA 8ICIA 1BPDA 1BPEA 4RT2A 3PMNA 4MFAA 3C2MA 7ICIA 9ICLA 8ICMA 4Z6FA 4TUSA 9ICOA 4UB5A 4I2EA 4KLHA 3UXPA 4O5EA 5J0SA 4RQ2A 1XSLA 8ICYA 4R63A 8ICCA 2PFNA 3JPRA 5DKWA 5J2EA 4RQ8A 4JWMA 9ICWA 3V7LA 5D49A 5J2IA 1ZQSA 7ICPA 5J0PA 2I9GA 5J0YA 1DK3A 4QZFA 1MQ3A 1ZQMA 1KEJA 4PPXA 4YN4A 8ICLA 3B0YA 3ISDA 4DOBA 1ZQCA 9ICKA 4NLKA 5IIOA 7ICMA 5D46A 3GDXA 5J2FA 1JMSA 1HUZA 5IIJA 1BPXA 4M04A 7ICHA 1ZQKA 4UB2A 5IINA 1ZQAA 7ICJA 2BPGA 1ZQLA 8ICFA 3C2KA 2BCVA 4KLDA 4Z6EA 3RH5A 4YMMA 3MDAA 4YMNA 5J2JA 8ICTA 4UAYA 5HHIA 4UB3A 4R64A 1ZQQA 7ICLA 4QZBA 4MFFA 4RQ1A 1RZTA 4UBBA 4UAZA 4R66A 8ICNA 7ICEA 7ICKA 4KLGA 4YD2A 5J2DA 8ICXA 4YCXA 2BCUA 9ICXA 1ZQPA 3TFRA 5DB6A 5DBAA 4I27A 4KLFA 4KLSA 4I2CA 4NM2A 4QZCA 7ICTA 1TVAA 4DO9A 3UPQA 5CB1A 2BCRA 5CWRA 3RH4A 4KLOA 1ZJNA 8ICBA 4UAWA 1ZQRA 9ICAA 2KP7A 8ICJA 7ICGA 4X5VA 3V7JA 1DK2A 8ICHA 3C5GA 7ICQA 1NZPA 5DB9A 3V7KA 4I2JA 9ICGA 3ISCA 1ZQBA 9ICIA 1BNOA 8ICSA 5HHHA 5J29A 1XSNA 3ISBA 5IIKA 8ICZA 7ICUA 9ICQA 4F5QA 8ICPA 4RQ7A 5J2GA 1ZQTA 5DB8A 3JPOA 3RJFA 2IHMA 5DBBA 8ICOA 9ICHA 4K4IA 4F5PA 4M9GA 3AU2A 7ICRA 4RPXA 9ICBA 2W9MA 4RPZA 4M2YA 2PXIA 4PHEA 4LZGA 3LK9A 5J2KA 4KLLA 7ICOA 4YD1A 3UXNA 5EOZA 5BOMA 9ICFA 4I2BA 4NLZA 3V72A 3HW8A 5J0RA 2ISPA 2FMSA 1BNPA 4DOCA 3HWTA 1ZQFA 7ICNA 4TUPA 4PGYA 4FO6A 2FMPA 4O9MA 4IQTA 8ICUA 8ICAA 7ICVA 3RJGA 1ZJMA 4IQWA 4QZEA 5BPCA 5DDYA 2BCQA 4R65A 4I2IA 4F5RA 9ICJA 1ZQDA 3UXOA 3RH6A 5DB7A 4PGXA 4KLIA 3C2LA 4GXJA 4I29A 8ICRA 3AUOA 3JPQA 4Z6DA 7ICSA 3C5FA 9ICEA 3MGHA 4TUQA 1ZQEA 4MF2A 4QZIA 3UQ0A 2PFPA 9ICNA 3JPTA 4M9NA 4M47A 4O5CA 8ICVA 4I2GA 2PFQA 3PMLA 4KLQA 4XUSA 5J2AA 4PH5A 3B0XA 5D4BA 4QZ8A 4YMOA 4NLNA 2GWSA 9ICCA 5J2CA 4QZDA 1HUOA 5BOLA 2FMQA 3TFSA 3RJEA 9ICVA 4I2AA 3AU6A 4QZHA 2P66A 4QZ9A 4Z6CA 8ICGA 4KLTA 7ICFA 3RJHA 5J0WA 4XA5A 5IILA 4LZDA 4F5NA 1KDHA 2BCSA 4GXKA 3RJJA 5IIMA 9ICRA 5DBCA 5J2HA 4QZAA 4QZGA 4NM1A 3MGIA 8ICEA 4K4HA 4KLJA 1ZQOA 5IIIA 3RJKA 5J0TA 4M9HA 4M9JA 1ZQNA 4PHAA 8ICKA 9ICUA 5J0XA 3RJIA 4KLMA 4IQUA 3UQ2A 1ZQIA 4JWNA 3MBYA 4UBCA 9ICPA 3OGUA 5TZVA 4RQ5A 4IQVA 1ZQGA 1TV9A 2BPFA 9ICTA 5J2BA 4MFCA 5J0QA 5J0UA 4LVSA 4M9LA 4NXZA 3JPSA 4MF8A 3MDCA 3JPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DOA A;  4RQ3 A;  4PGQ A;  4RT3 A;  8ICQ A;  4I2F A;  1ZQJ A;  2ISO A;  4NY8 A;  4I2D A;  4I2H A;  4GXI A;  4O5K A;  4TUR A;  1BPZ A;  4K4G A;  9ICS A;  4RQ6 A;  4PHP A;  1BPY A;  4UB4 A;  4I28 A;  4F5O A;  4M0A A;  1XSP A;  4UB1 A;  4RQ4 A;  4P2H A;  1MQ2 A;  9ICM A;  4KLE A;  3JPN A;  4RPY A;  2PFO A;  4KLU A;  3PNC A;  3HX0 A;  4RQ0 A;  8ICW A;  1ZQH A;  5J0O A;  4PHD A;  8ICI A;  1BPD A;  1BPE A;  4RT2 A;  3PMN A;  4MFA A;  3C2M A;  7ICI A;  9ICL A;  8ICM A;  4Z6F A;  4TUS A;  9ICO A;  4UB5 A;  4I2E A;  4KLH A;  3UXP A;  4O5E A;  5J0S A;  4RQ2 A;  1XSL A;  8ICY A;  4R63 A;  8ICC A;  2PFN A;  3JPR A;  5DKW A;  5J2E A;  4RQ8 A;  4JWM A;  9ICW A;  3V7L A;  5D49 A;  5J2I A;  1ZQS A;  7ICP A;  5J0P A;  2I9G A;  5J0Y A;  1DK3 A;  4QZF A;  1MQ3 A;  1ZQM A;  1KEJ A;  4PPX A;  4YN4 A;  8ICL A;  3B0Y A;  3ISD A;  4DOB A;  1ZQC A;  9ICK A;  4NLK A;  5IIO A;  7ICM A;  5D46 A;  3GDX A;  5J2F A;  1JMS A;  1HUZ A;  5IIJ A;  1BPX A;  4M04 A;  7ICH A;  1ZQK A;  4UB2 A;  5IIN A;  1ZQA A;  7ICJ A;  2BPG A;  1ZQL A;  8ICF A;  3C2K A;  2BCV A;  4KLD A;  4Z6E A;  3RH5 A;  4YMM A;  3MDA A;  4YMN A;  5J2J A;  8ICT A;  4UAY A;  5HHI A;  4UB3 A;  4R64 A;  1ZQQ A;  7ICL A;  4QZB A;  4MFF A;  4RQ1 A;  1RZT A;  4UBB A;  4UAZ A;  4R66 A;  8ICN A;  7ICE A;  7ICK A;  4KLG A;  4YD2 A;  5J2D A;  8ICX A;  4YCX A;  2BCU A;  9ICX A;  1ZQP A;  3TFR A;  5DB6 A;  5DBA A;  4I27 A;  4KLF A;  4KLS A;  4I2C A;  4NM2 A;  4QZC A;  7ICT A;  1TVA A;  4DO9 A;  3UPQ A;  5CB1 A;  2BCR A;  5CWR A;  3RH4 A;  4KLO A;  1ZJN A;  8ICB A;  4UAW A;  1ZQR A;  9ICA A;  2KP7 A;  8ICJ A;  7ICG A;  4X5V A;  3V7J A;  1DK2 A;  8ICH A;  3C5G A;  7ICQ A;  1NZP A;  5DB9 A;  3V7K A;  4I2J A;  9ICG A;  3ISC A;  1ZQB A;  9ICI A;  1BNO A;  8ICS A;  5HHH A;  5J29 A;  1XSN A;  3ISB A;  5IIK A;  8ICZ A;  7ICU A;  9ICQ A;  4F5Q A;  8ICP A;  4RQ7 A;  5J2G A;  1ZQT A;  5DB8 A;  3JPO A;  3RJF A;  2IHM A;  5DBB A;  8ICO A;  9ICH A;  4K4I A;  4F5P A;  4M9G A;  3AU2 A;  7ICR A;  4RPX A;  9ICB A;  2W9M A;  4RPZ A;  4M2Y A;  2PXI A;  4PHE A;  4LZG A;  3LK9 A;  5J2K A;  4KLL A;  7ICO A;  4YD1 A;  3UXN A;  5EOZ A;  5BOM A;  9ICF A;  4I2B A;  4NLZ A;  3V72 A;  3HW8 A;  5J0R A;  2ISP A;  2FMS A;  1BNP A;  4DOC A;  3HWT A;  1ZQF A;  7ICN A;  4TUP A;  4PGY A;  4FO6 A;  2FMP A;  4O9M A;  4IQT A;  8ICU A;  8ICA A;  7ICV A;  3RJG A;  1ZJM A;  4IQW A;  4QZE A;  5BPC A;  5DDY A;  2BCQ A;  4R65 A;  4I2I A;  4F5R A;  9ICJ A;  1ZQD A;  3UXO A;  3RH6 A;  5DB7 A;  4PGX A;  4KLI A;  3C2L A;  4GXJ A;  4I29 A;  8ICR A;  3AUO A;  3JPQ A;  4Z6D A;  7ICS A;  3C5F A;  9ICE A;  3MGH A;  4TUQ A;  1ZQE A;  4MF2 A;  4QZI A;  3UQ0 A;  2PFP A;  9ICN A;  3JPT A;  4M9N A;  4M47 A;  4O5C A;  8ICV A;  4I2G A;  2PFQ A;  3PML A;  4KLQ A;  4XUS A;  5J2A A;  4PH5 A;  3B0X A;  5D4B A;  4QZ8 A;  4YMO A;  4NLN A;  2GWS A;  9ICC A;  5J2C A;  4QZD A;  1HUO A;  5BOL A;  2FMQ A;  3TFS A;  3RJE A;  9ICV A;  4I2A A;  3AU6 A;  4QZH A;  2P66 A;  4QZ9 A;  4Z6C A;  8ICG A;  4KLT A;  7ICF A;  3RJH A;  5J0W A;  4XA5 A;  5IIL A;  4LZD A;  4F5N A;  1KDH A;  2BCS A;  4GXK A;  3RJJ A;  5IIM A;  9ICR A;  5DBC A;  5J2H A;  4QZA A;  4QZG A;  4NM1 A;  3MGI A;  8ICE A;  4K4H A;  4KLJ A;  1ZQO A;  5III A;  3RJK A;  5J0T A;  4M9H A;  4M9J A;  1ZQN A;  4PHA A;  8ICK A;  9ICU A;  5J0X A;  3RJI A;  4KLM A;  4IQU A;  3UQ2 A;  1ZQI A;  4JWN A;  3MBY A;  4UBC A;  9ICP A;  3OGU A;  5TZV A;  4RQ5 A;  4IQV A;  1ZQG A;  1TV9 A;  2BPF A;  9ICT A;  5J2B A;  4MFC A;  5J0Q A;  5J0U A;  4LVS A;  4M9L A;  4NXZ A;  3JPS A;  4MF8 A;  3MDC A;  3JPP A; 
#chains in the Genus database with same CATH topology
 4PGQ A;  1V38 A;  3L5K A;  4I2F A;  1ZQJ A;  5T14 A;  4C8L A;  3Q8S B;  2F1H A;  3HKZ F;  5L1J A;  3BQT A;  3SQI A;  4RQ6 A;  5JTI A;  5DQG A;  2B6G A;  4F5O A;  2DPI A;  4FZL A;  4RQ4 A;  4P2H A;  5KFC A;  3GIJ A;  2KNJ A;  1YZ7 A;  5GTI U;  2PKE A;  4EBC A;  2H3Q A;  5AKI A;  4FZN A;  1S97 A;  4UB6 U;  3PNC A;  4C80 A;  4UQG A;  3RR7 A;  3GIK A;  4FFD A;  3MR2 A;  1N63 A;  4MFA A;  1JUD A;  2EAO A;  3PW7 A;  4EEY A;  3QEB Z;  4TUS A;  1A6S A;  4OJ5 A;  2GO7 A;  2JH7 A;  2HVH A;  2W3R A;  3NTU A;  3UXP A;  1C20 A;  5ALT A;  2WHE A;  1HIW A;  4O5E A;  2VA3 A;  1Z1V A;  3M9O B;  4R63 A;  3F2D A;  2HOQ A;  1RQL A;  1QSL A;  2ZXI A;  4C7Z A;  4OO1 J;  2KVC A;  4ZOH C;  5ALY A;  5DKW A;  4RQ8 A;  1QSY A;  9ICW A;  1YT3 A;  3GFK B;  3V7L A;  5KFZ A;  2HVI A;  1ZQS A;  7ICP A;  1KEJ A;  2Q4T A;  2LYA A;  5ALG A;  2VIX A;  4DOB A;  9ICK A;  5KT3 A;  5GTH U;  5KT7 A;  3GDX A;  1KKX A;  3RR8 A;  4ECY A;  5KFP A;  1NKB A;  1U45 A;  2ASL A;  3LYS A;  3ZDE A;  4F72 A;  2NO5 A;  4UB2 A;  5IIN A;  2VKQ A;  5AM5 A;  2Y9T A;  7ICJ A;  1C7Y A;  3PZP A;  4EX7 A;  4KLD A;  2DPJ A;  3RH5 A;  1L3U A;  2KZZ A;  2BDP A;  2DQN B;  3MDA A;  5J2J A;  3H8S A;  3M9N B;  3ZDD A;  5KFF A;  3M8R A;  1DOQ A;  3BS7 A;  2DF4 B;  1JX4 A;  1L8L A;  2F44 A;  2KSO A;  2OH2 A;  1L5U A;  4OD0 A;  4UAZ A;  1SL1 A;  1KL9 A;  1ZQU A;  8ICN A;  1D9F A;  1QLN A;  7ICE A;  4Y2S A;  4KLG A;  3VC8 A;  4QNL A;  1JXE A;  1L7O A;  3WK9 A;  1QTM A;  1ZYQ A;  2HBK A;  4FZM A;  2KTQ A;  2W3S A;  4YR0 A;  3OHB A;  4I27 A;  2HHW A;  4KLS A;  2YMP A;  5G5H A;  4NM2 A;  2P6U A;  4DO9 A;  3WK7 A;  1WCL A;  3RB6 A;  1XS9 D;  8ICB A;  4DFJ A;  3MC1 A;  2NO4 A;  4UAW A;  5J8Y A;  2ZUC A;  5HML A;  3OTQ A;  1SXD A;  3MFI A;  5EWG A;  4X5V A;  2YB1 A;  4P0P B;  1DK2 A;  1NJX A;  4YXJ A;  8ICH A;  5AKE A;  2IHN A;  1U4B A;  5DB9 A;  3V7K A;  4PZO A;  1K5O A;  2QKQ A;  2XC9 A;  2JR5 A;  5J8Y C;  4JV0 A;  1KTQ A;  1V85 A;  2W9B B;  1BNO A;  2Y9U A;  2LKY A;  4UAR A;  2OM6 A;  5KFK A;  1S8O A;  2JEG A;  8ICZ A;  5HR7 A;  3F5E A;  2BDU A;  3NVW A;  4F2R A;  2YB4 A;  4F5Q A;  2KIC A;  1PVP A;  4BGD A;  4J9Q A;  1ZQT A;  1EXN A;  5DB8 A;  4ED0 A;  4PL1 A;  4KN7 A;  5B66 U;  1V9P A;  3HRD D;  5DBB A;  2OCE A;  4Y2R A;  9ICH A;  3T5H A;  1NK9 A;  1ECW A;  4M2Y A;  1QQ6 A;  5KFM A;  3LVW A;  5J2K A;  3UM9 A;  5E79 U;  3ALR A;  4E0D A;  1WG8 A;  2KK0 A;  5EOZ A;  3IM1 A;  4R8U A;  1JN3 A;  5DG7 A;  2K60 A;  5KNI A;  5AIC A;  4YVZ A;  3MAB A;  5ALL A;  3SI8 A;  2KKV A;  3LWL A;  4Y2U A;  4TQS A;  4ECX A;  3N4M B;  5KG4 A;  4DFD A;  2Z7J A;  2W03 A;  2ZUB A;  4USA A;  1ZQF A;  2HOI A;  4FO6 A;  5JU5 A;  8ICA A;  1ZJM A;  2WF5 A;  2ZJ8 A;  2JH1 A;  5AKJ A;  2R8I A;  5AI9 A;  2HHU A;  2KJ8 A;  4B9V A;  3H8J A;  3PY8 A;  3VCB A;  4O3R A;  9ICJ A;  5ALH A;  2ZIU B;  3ZI4 A;  4BXO A;  1ZQX A;  4O3Q A;  2HDO A;  3K4G A;  5CEH A;  5AK4 A;  1UHU A;  2Y0S C;  4P0Q B;  4RNM A;  4J9P A;  4GXJ A;  5AIB A;  3I1Y A;  4IR1 A;  2F77 X;  2FI1 A;  3JPQ A;  3FAH A;  3TAD C;  1NZB A;  4P4M A;  1TFR A;  3M7D A;  7ICS A;  9ICE A;  2WAQ C;  1PK1 B;  2LYB A;  1ZQE A;  5AKY A;  4EX6 A;  1SZP A;  1UPH A;  3BS5 B;  3V6H A;  2WB1 C;  2PFP A;  2ATL A;  4IRD A;  2LBO A;  4YXM A;  2XY7 A;  9ICN A;  2G09 A;  4M9N A;  4O5C A;  3NS1 A;  3BQ1 A;  4I2G A;  1SV4 A;  2PFQ A;  3RTV A;  2E3T A;  5L1M A;  4KLQ A;  2K4P A;  3C28 A;  2RHF A;  2H5X A;  1RXW A;  2A3V A;  5D4B A;  2HHT A;  1KSP A;  1QCK A;  5KFS A;  2GWS A;  2IOH A;  3PR4 A;  9ICC A;  4QZD A;  4F8R A;  1HUO A;  3CP8 A;  3RJE A;  3QNM A;  1Q46 A;  4I2A A;  4QWB A;  5AKX A;  1N56 A;  2KHV A;  5KG7 A;  4RUA A;  2D3D A;  2W43 A;  2ZIX A;  4GLX A;  1WCN A;  1U9L A;  2A1J A;  7ICF A;  1UCV A;  4P4P A;  2JHD A;  1L6N A;  2JZB B;  5EWF A;  4XA5 A;  5IIL A;  4HAI A;  1PVR A;  2BCS A;  4GXK A;  1J2N A;  3ZDB A;  4JK1 A;  2HI0 A;  1NI3 A;  1FO4 A;  1N48 A;  9ICR A;  3EPG A;  5DBC A;  4EEL A;  5J2H A;  3T5L A;  2EZZ A;  4NM1 A;  3OSN A;  8ICE A;  3IHQ B;  3J81 j;  4RUC A;  3MFH A;  3D2S A;  1S77 D;  3RJK A;  3SAH A;  5AM2 A;  4DL5 A;  4QJF B;  4Y2J A;  5DDM A;  1ZD3 A;  1ZQN A;  4BWM A;  3H8M A;  4Q8E A;  9ICU A;  3LVV A;  3HP6 A;  3L4P A;  4KLM A;  4ECT A;  3H4B A;  2KVS A;  3ICX A;  2W54 A;  1X9X A;  4WJ3 B;  5ALX A;  2QB0 B;  3NGD A;  1TV9 A;  1SKS A;  5ALP A;  4B9S A;  2XY5 A;  3SAF A;  1Q3U A;  5KFY A;  4ZH4 A;  4OJO A;  1MN8 A;  2M0N A;  4M9L A;  3JPS A;  3RBD A;  3C21 A;  4P0P A;  2BQ3 A;  4RT3 A;  8ICQ A;  4NY8 A;  2ISO A;  4I2D A;  1T4G A;  4I2H A;  4FS2 A;  4BX9 C;  5KFB A;  4O5K A;  4TUR A;  3M8S A;  1SWW A;  4PHP A;  2G08 A;  5KFJ A;  2HCF A;  4UB4 A;  3M6K A;  5KTQ A;  4JV1 A;  2NRV A;  1XSP A;  4UB1 A;  1Z3E B;  3NRW A;  2W9A A;  3FC4 A;  2PFO A;  3EPI A;  2MSN A;  1KQQ A;  4CNQ A;  3HX0 A;  5J0O A;  2F3N A;  3M6Z A;  1BPD A;  5F9L A;  2WF7 A;  2E1E A;  2G07 A;  4RT2 A;  3QEA Z;  7ICI A;  9ICL A;  1DGS A;  5AI4 A;  2M9N A;  3Q8M A;  9ICO A;  4UB5 A;  4I2E A;  3GIL A;  2JEI A;  4KN4 A;  4ACO A;  4KLH A;  2F2A B;  2JEF A;  1JRP A;  5FP0 A;  4FS1 A;  5J0S A;  1XSL A;  2PMZ C;  3OSP A;  2UVV A;  5KT4 A;  4Q43 A;  2PFN A;  5KG0 A;  3JPR A;  5J2E A;  4Y2Q A;  1Y88 A;  5J0Y A;  4ECW A;  4QZF A;  1MQ3 A;  5AKL A;  8ICL A;  4AYB C;  1K1Q A;  2XGP A;  4DS5 A;  2KJ9 A;  4F4X A;  2K8A A;  1ZQC A;  3WKB A;  4NLK A;  5D46 A;  2G5H B;  3BZK A;  1HUZ A;  1BVS A;  3NVY A;  5DGA A;  4Y2T A;  1FIQ A;  5IIJ A;  5AM4 A;  2MUT A;  3CYM A;  1PK3 A;  2DL0 A;  2C2D A;  4IRC A;  2NV3 A;  2G06 A;  4EBE A;  5HR6 A;  7ICH A;  2F1J A;  4BUG A;  2QAR B;  3F5A A;  4Q45 A;  4Z6E A;  1X6I A;  2ZIU A;  3OHA A;  2EQY A;  3WKA A;  4YMN A;  4UAY A;  4R64 A;  1K1S A;  3GU3 A;  2FLN A;  1OW5 A;  5DG8 A;  1Z00 A;  3Q8R B;  2A1A A;  4MFF A;  1X42 A;  5KFL A;  4XRH A;  3LDA A;  1PVQ A;  4DL4 A;  4R66 A;  1N2X A;  4F4Z A;  2ZJ5 A;  1TAM A;  8ICX A;  3IRU A;  3ONN A;  1IM4 A;  3QZ7 A;  3TFR A;  5DB6 A;  1NK6 A;  4KMO B;  1SB3 C;  1NOM A;  3PX6 A;  4O3P A;  3PSI A;  1T8E A;  3IG5 A;  2RDJ A;  4YQW A;  4DEZ A;  2RQ5 A;  3UPQ A;  5CB1 A;  1RM6 C;  5G5G A;  5CWR A;  4KX5 A;  4O3M A;  4KLO A;  1ZJN A;  2KP7 A;  1JIH A;  1VLB A;  4DSJ A;  3OPX A;  7ICQ A;  3T3F A;  2YQE A;  4F92 B;  1L3T A;  2G5I B;  4OJ6 A;  2F76 X;  1ZQB A;  4FBU A;  1N5X A;  4J9R A;  1COO A;  1X2I A;  4FE3 A;  2AXT U;  2P35 A;  5J29 A;  5IIK A;  3OJS A;  2W55 A;  9ICQ A;  1U48 A;  8ICP A;  3N97 B;  4CGZ A;  5J2G A;  3IN5 A;  4J9S A;  2KFN A;  4C8K A;  3JPO A;  3WKD A;  5KG5 A;  2BQR A;  2D6F C;  1UQV A;  4DSE A;  8ICO A;  2WF8 A;  5EE9 A;  2BQU A;  5L1I A;  5CRX A;  4F5P A;  1L3V A;  1D8B A;  3AU2 A;  7ICR A;  2Y0S F;  5KFU A;  2ASD A;  4DQI A;  4KX3 A;  2NRX A;  1L7P A;  1KFD A;  2PXI A;  5CR0 A;  1SV0 A;  1FFU A;  2GLE A;  1RG6 A;  1L3S A;  2YY6 A;  3E0F A;  2YML A;  3N28 A;  2WAQ F;  5AIA A;  4M6W B;  3F53 A;  2ODG A;  2FPL A;  2KIV A;  2WB1 F;  5ALU A;  2LI6 A;  2YMM A;  3O0F A;  5J0R A;  1OUQ A;  1SV0 C;  2FMS A;  2KMD A;  5B5E U;  4DOC A;  1B43 A;  4DFP A;  3C1Y A;  7ICN A;  1TK8 A;  1VJ5 A;  4UAT A;  4B6J A;  1NKC A;  4O9M A;  2H3I A;  2I6X A;  4ECS A;  2K8B B;  4CF4 A;  1NK0 A;  1X6J A;  2KFZ A;  2YN4 A;  1SKR A;  2ZTD A;  3E2E A;  1ZD5 A;  1VDV A;  4BJQ A;  2XCP A;  2IOF K;  5EE0 A;  1ZQD A;  3QUB A;  3WKE A;  5KT6 A;  4PGX A;  4KLI A;  3RB0 A;  2I5H A;  2KV2 A;  3AUO A;  1XO1 A;  1S0O A;  2ZXH A;  2IOF A;  3CNH A;  3TI0 A;  3KFU F;  4UB8 U;  5F9N A;  4CE6 A;  4TUQ A;  4PZN A;  4MF2 A;  2JV3 A;  2KG5 A;  5AKG A;  5ALJ A;  4ED1 A;  3R9K A;  4EEN A;  2C22 A;  2C2E A;  3Q8P B;  2XCA A;  3D2Q A;  1JRO A;  4IRK A;  3ED5 A;  2KKP A;  5KFQ A;  1M6Y A;  5J2C A;  2K4I A;  2Y1I A;  2K4E A;  4J9M A;  3QYP A;  3KHL A;  3ETL A;  2PI4 A;  2E5S A;  2JXJ A;  3AU6 A;  4NL9 C;  3KHR A;  3TKA A;  3BDP A;  2P6R A;  4QZH A;  4YR3 A;  4C7Y A;  2MA1 A;  1SZH A;  2UVR A;  2WTF A;  5KFV A;  2BHN A;  2HOF A;  1CUK A;  3SZ2 A;  2BZF A;  1TK0 A;  3RJJ A;  4EBD A;  4BWJ A;  3G6V A;  5KFE A;  3RBE A;  4K4H A;  2XVT A;  2BPC A;  4OJL A;  4ED2 A;  4DSL A;  1LB2 B;  4M9H A;  2W7P A;  1A77 A;  3DV9 A;  4GIB A;  4ED7 A;  3Q8Q B;  3RJI A;  4IQU A;  3H8W A;  2ZIW A;  3UQ2 A;  1ZQI A;  4JWN A;  3MBY A;  3Q8K A;  4UBC A;  2AGP A;  3RFA A;  1JXL A;  4RQ5 A;  4TQR A;  2KZ3 A;  1WYG A;  3TAD A;  4RNO A;  5L1K A;  2IMW P;  9ICT A;  3WU2 U;  4U7C A;  5EE3 A;  4BDP A;  3OJU A;  1SKW A;  4J03 A;  1WWU A;  5J0U A;  1S9F A;  2LM1 A;  1TK5 A;  2PMZ F;  1RPL A;  4CCH A;  1MC8 A;  1RYU A;  2V9W A;  3MDC A;  2V4R A;  3JPP A;  4DL6 A;  3I28 A;  4ED3 A;  4RQ3 A;  3QUQ A;  5AM0 A;  4F2S A;  5KFX A;  5KFN A;  1JAL A;  5AI6 A;  2J6U A;  1BPZ A;  4AYB F;  4K4G A;  3SEI A;  3QX7 A;  2YTU A;  1BPY A;  1S10 A;  3S6J A;  4QWE A;  1CRX A;  4M0A A;  4NLC A;  2HHX A;  5C5J A;  2R8H A;  4KLE A;  3JPN A;  1ZQZ A;  4RPY A;  2ASJ A;  1LKY B;  4B9L A;  4ED8 A;  3K75 D;  4LJX A;  5AHX A;  2BKE A;  3KZX A;  4RQ0 A;  2FE9 A;  1A0P A;  8ICW A;  3SYZ A;  2Y1J A;  3ZDC A;  5KT2 A;  4QIW C;  2RDI A;  3H40 A;  1BPE A;  2CPR A;  3PMN A;  3GQC A;  3SEN A;  1NJW A;  4RQN A;  4QW9 A;  1V97 A;  2E8N A;  8ICY A;  8ICC A;  1LV5 A;  5DGB A;  2E8P A;  2W11 A;  2OEH A;  3THV A;  1NK4 A;  2FDR A;  3QUT A;  1ZQW A;  4DL2 A;  4JWM A;  1HJP A;  5ALK A;  5D49 A;  5J2I A;  4EYI B;  2HHS A;  3IV6 A;  5J0P A;  1O08 A;  2I9G A;  1DK3 A;  4PPX A;  4YN4 A;  4NLG A;  3ISD A;  4RNN A;  2VJ4 A;  4O3N A;  5ALQ A;  1ZET A;  1XWL A;  4IC9 A;  2NYV A;  1JMS A;  1Z1B A;  5AKH A;  2IBK A;  1X40 A;  5ALN A;  3QU2 A;  4EEK A;  1TAQ A;  1Z19 A;  3PW2 A;  3NAS A;  1BPX A;  2ZTE A;  5AKZ A;  2K4H A;  1ZQK A;  5ALV A;  1ZQA A;  2AGQ A;  1ZQL A;  1MA7 A;  8ICF A;  2BCV A;  4Y2Y A;  3EWA A;  3GV5 B;  4DQS A;  5AK5 A;  3A0H U;  3AN1 A;  3WK8 A;  8ICT A;  5JUM A;  4UAS A;  3I76 A;  3TAN A;  4CF5 A;  5KFG A;  2UVW A;  4O0I A;  1HEK A;  7ICL A;  5KL8 B;  4RQ1 A;  4UBB A;  4JUZ A;  3PO4 A;  2YX8 A;  2HW3 A;  1CEZ A;  5J2D A;  2LM4 A;  1DGJ A;  3EUB 2;  3FDS A;  3NVV A;  1ZQP A;  2GH1 A;  1SXE A;  5DBA A;  1KBU A;  4KLF A;  2HBJ A;  3IDW A;  4QWC A;  4DL7 A;  1TVA A;  3H7I A;  1KN5 A;  2W9B A;  3QU9 A;  4DQP A;  2HHQ A;  3G6X A;  3RH4 A;  3KHG A;  4ELV A;  3AMZ A;  1O03 A;  4ECZ A;  2V4Q A;  8ICJ A;  3NUQ A;  2WF6 A;  4C4R A;  3PX0 A;  4CF3 A;  2O6K A;  3C5G A;  2KOB A;  1H38 A;  3IP4 B;  1D8Y A;  1T7P A;  4C8N A;  1L8O A;  1ZRM A;  3PST A;  5KFT A;  1XNS A;  4GC7 A;  3K1R B;  2FPK A;  4J9K A;  8ICS A;  1RXV A;  5HHH A;  1X9S A;  3B9J A;  2FPM A;  4O3S A;  7ICU A;  5DLF A;  3GIM A;  3PX4 A;  4RQ7 A;  1WUD A;  5KFA A;  3RJF A;  2ES6 A;  4ECV A;  5KT5 A;  3N7S C;  1S0N A;  1S0M A;  4RPX A;  4RPZ A;  5ALD A;  3FYH A;  4P4O A;  1ZD2 P;  4PHE A;  2NRW A;  4LZG A;  1AQ6 A;  3LK9 A;  5ALF A;  4KLL A;  1YZ6 A;  3UXN A;  5BOM A;  4UAU A;  2CRX A;  4NLZ A;  3V72 A;  3C29 A;  1S0V A;  2XGQ A;  3TAR A;  2KZM A;  4A8E A;  4OJP A;  1DXS A;  4F93 B;  1U47 A;  4F4Y A;  2ISP A;  4P0Q A;  1NKE A;  4PL2 A;  4PGY A;  1RYS A;  2FMP A;  8ICU A;  7ICV A;  3RJG A;  1IV8 A;  2W7O A;  4Y2V A;  2RP5 A;  4IQW A;  4QZE A;  3ORY A;  1ZOL A;  5BPC A;  1NNL A;  4B9M A;  4R8U B;  1PK1 A;  4KIT B;  2W8L A;  2NRZ A;  3BS5 A;  2FLP A;  2EZX A;  5ALZ A;  2H3F A;  3UXO A;  4FBT A;  2QLT A;  5DB7 A;  5A0L A;  2DBY A;  4JV2 A;  2GOL A;  8ICR A;  1RDF A;  4C0Z A;  2J6S A;  3HPO A;  2B0C A;  3SV3 A;  3QUC A;  2AHO B;  4DQR A;  3TQ1 A;  1T94 A;  4MHV A;  3V6K A;  2LMR A;  5KFO A;  4DFK A;  5KL1 B;  5KG1 A;  4GC6 A;  3UQ0 A;  4IL6 U;  2I1Q A;  3N7P D;  4B9N A;  2KIW A;  3GV7 B;  1NK5 A;  2W04 A;  2HBL A;  3JPT A;  4M47 A;  4BXO B;  3D2N A;  2W9C B;  8ICV A;  4IR9 A;  2JZB A;  2ZIV B;  3PML A;  1UA1 A;  4XUS A;  5J2A A;  4DFM A;  2QB1 A;  1N5W A;  2A19 A;  1F44 A;  4YR2 A;  1XO0 A;  5AKK A;  5BOL A;  2FMQ A;  3TFS A;  4ELU A;  1ARO P;  9ICV A;  3C23 A;  3UMC A;  1QQ7 A;  3NVZ A;  2JEJ A;  3TAC B;  3DDH A;  4ED6 A;  4YG2 A;  4QZ9 A;  5F3X B;  3CW2 C;  3ZD9 A;  1D9D A;  1MSW D;  3SD7 A;  1RYR A;  3ZDA A;  5J0W A;  4ECR A;  1TE2 A;  4B9U A;  2ESE A;  5K4L A;  4LZD A;  4F4W A;  2MAX A;  3PR5 B;  5KAF U;  2ALZ A;  2AU0 A;  3TAP A;  1SWV A;  2F8K A;  2QB0 A;  3QXG A;  4C8M A;  1UT5 A;  4QZG A;  2ZUD A;  3SR6 A;  1SIJ A;  1XC9 A;  4KLJ A;  1SL2 A;  1ZQO A;  3ZD8 A;  3PW0 A;  2EAP A;  5J0T A;  2ZIX B;  3EW9 A;  5DQH A;  2A1J B;  3T79 A;  3PVX A;  2MU2 A;  1Z4N A;  2HBM A;  2W8K A;  5ALI A;  2OXO A;  5KG6 A;  4DS4 A;  3MR3 A;  1PUZ A;  2JRZ A;  3MR5 A;  9ICP A;  5CJ7 A;  1B4F A;  3BQ2 A;  2AJQ A;  2OYY A;  1ZQG A;  2R8K A;  4QIW F;  3SMV A;  4NLB A;  3D6J A;  4PJ0 U;  4ICA A;  4EYH B;  1BGX T;  2BPF A;  4YP3 A;  5J2B A;  3H0M B;  2ZTC A;  1T3Q A;  4QWD A;  1KRP A;  5J0Q A;  5HP4 A;  5EE1 A;  3C1Z A;  2AQ4 A;  5KG2 A;  2UVU A;  2ZG6 A;  2VA8 A;  1F5S A;  4OCZ A;  4NXZ A;  4DL3 A;  3AQE A;  1FFV A;  4F50 A;  3PSP A;  5DQI A;  4MF8 A;  5L1L A;  4DLE A;  3QU5 A;  4DOA A;  2WF9 A;  1N60 A;  1TAU A;  1TKD A;  1QQ5 A;  5AM3 A;  2K89 A;  4GXI A;  2VJ5 A;  2E8O A;  1NJZ A;  1PZN A;  3AQF A;  4C4S A;  4G9B A;  9ICS A;  3PW5 A;  4CDG A;  2DWQ A;  4I28 A;  1QH9 A;  3BZC A;  4NL9 A;  2L5Y A;  1MQ2 A;  9ICM A;  2AQ0 A;  2HHV A;  1Q8K A;  5CHG A;  4KLU A;  5ALW A;  1L7M A;  1ZQH A;  5AK3 A;  4PHD A;  8ICI A;  3H0R B;  3WK4 A;  2KHQ A;  3H0L B;  3RAQ A;  3C2M A;  4F3O A;  3A0B U;  1QSS A;  8ICM A;  3HIL A;  4Z6F A;  4J9L A;  1UA0 A;  4RZR A;  5KAI U;  1NK7 A;  5C0Y A;  5L9X A;  4AP9 A;  4RQ2 A;  2E1F A;  3M1Y A;  4IS7 A;  3QE9 Y;  4QWA A;  3UMB A;  1J2M A;  4O3O A;  3GII A;  4B9T A;  4GFJ A;  2FJ6 A;  1ZQM A;  2QAR A;  2K8C B;  4YFK A;  5JRT A;  3KKA A;  3TAQ A;  3HKZ C;  3B0Y A;  2AH5 A;  3WK6 A;  5ALR A;  1ZQY A;  7ICM A;  5IIO A;  5J2F A;  1RQN A;  4C4T A;  3F2C A;  5CP2 A;  2BGW A;  2YMQ A;  4QW8 A;  3ETR A;  4M04 A;  3KKA C;  5H2F U;  3Q8L A;  1X9M A;  3KZI U;  2BPG A;  3C2K A;  3H4D A;  3SV4 A;  3GZF A;  4YMM A;  2R8G A;  2C2R A;  5HHI A;  4UB3 A;  4DQQ A;  1S76 D;  1ZQQ A;  4CRX A;  1S5L U;  4QZB A;  4DCC A;  1RZT A;  1KW4 A;  2KEY A;  2MUT B;  7ICK A;  4YD2 A;  4YCX A;  2F8L A;  2BCU A;  9ICX A;  3MGV A;  5AM1 A;  1KFT A;  4EZ9 A;  2W9C A;  3HT3 A;  4J9N A;  2ZIV A;  4I2C A;  5DLG A;  4QZC A;  2RRD A;  7ICT A;  2ZJA A;  2EAN A;  2R8J A;  1Z00 B;  2BR0 A;  5AI8 A;  2BCR A;  3SAG A;  5DG9 A;  3KHH A;  1ZQR A;  2XID A;  9ICA A;  2DFL A;  4NV0 A;  2EDU A;  3QU7 A;  3U26 A;  7ICG A;  1ZRN A;  3V7J A;  3M9M B;  2XO7 A;  5KFH A;  1NZP A;  2D8C A;  2G0A A;  2IA6 A;  1KFS A;  4I2J A;  9ICG A;  1Q3V A;  1X9W A;  4ELT A;  2HMX A;  3ISC A;  9ICI A;  1A76 A;  2NRT A;  5KFD A;  1XSN A;  3ISB A;  2E8M A;  4UW9 A;  3L3F X;  4M6W A;  4KMU A;  2C28 A;  3LWM A;  4XQ8 A;  2IHM A;  2LHT A;  5KFI A;  4DF4 A;  4K4I A;  2F1I A;  4JB3 A;  4MEX A;  4M9G A;  5EWE A;  5TIS U;  3BJY A;  2XY6 A;  2OHF A;  2W9M A;  9ICB A;  5CA7 A;  3EZ5 A;  2CXY A;  1N61 A;  1NK8 A;  2KD1 A;  7ICO A;  3V6J A;  4YD1 A;  3KD3 A;  2B21 A;  9ICF A;  4I2B A;  4NJ8 A;  2OWO A;  4Y2X A;  4DLG A;  2JGA A;  1U49 A;  2H3Z A;  3HW8 A;  1D8L A;  2FLL A;  4DF8 A;  3FM9 A;  3WK5 A;  1BNP A;  3HWT A;  4TUP A;  3E58 A;  1Z4O A;  4IQT A;  1LVH A;  4Y2P A;  2EH9 A;  3IG8 A;  5HNK A;  1COK A;  5DDY A;  2BCQ A;  4R65 A;  2RLT A;  4I2I A;  3QZ8 A;  4F5R A;  2DKX A;  2EZY A;  2JMG A;  3RH6 A;  1XU4 A;  1URJ A;  3F2B A;  1NJY A;  3MR6 A;  4C8O A;  1B22 A;  3C2L A;  4DSI A;  4I29 A;  1OXJ A;  1GO3 F;  3BQ7 A;  4NWI A;  2KSO B;  1IXR A;  4Z6D A;  3C5F A;  1IG6 A;  5KFR A;  3MGH A;  3PSF A;  2WFA A;  4MEY A;  3RF9 A;  4QZI A;  4KTQ A;  1ED1 A;  4DWI A;  4HYK A;  5AI0 A;  3PW4 A;  2EAM A;  2N1R A;  4JMU A;  2KE7 A;  5ALS A;  4PH5 A;  3AL0 B;  3B0X A;  1DRG A;  3RB3 A;  4QZ8 A;  4YMO A;  2DKZ A;  4US9 A;  4NLN A;  3PV8 A;  2R18 A;  1KLN A;  1JI7 A;  5HMM A;  1SL0 A;  3KBB A;  2P66 A;  3PO5 A;  1T3N A;  3G6Y A;  4Z6C A;  3T5K A;  3GV8 B;  1WWV A;  5ALE A;  8ICG A;  4KLT A;  4UAV A;  4RU9 A;  3RJH A;  1BPB A;  3HJE A;  3T5J A;  4F5N A;  1KDH A;  3AM9 A;  3RRH A;  1ZXI A;  2LPE A;  5IIM A;  5KFW A;  2J6T A;  4EZ6 A;  3NRZ A;  1ZQ1 C;  4QZA A;  4DSK A;  2MRL A;  2PI5 A;  2VAN A;  2HSZ A;  1N62 A;  2KN7 A;  3MGI A;  3K1Z A;  1F0M A;  1CI4 A;  2LYH A;  1FEZ A;  5III A;  4DSF A;  2XIC A;  2Q0Z X;  4U6P A;  4M9J A;  1UT8 A;  4PHA A;  1X66 A;  4J9O A;  8ICK A;  5ALM A;  3RB4 A;  5J0X A;  2DUY A;  3EYZ A;  1B0X A;  3CRX A;  1J97 A;  3QU4 A;  3OGU A;  3DEE A;  2CN1 A;  2H3V A;  5TZV A;  4Q8F A;  3RRG A;  3KOO A;  4F91 B;  2XI9 A;  4IQV A;  4US8 A;  2VA2 A;  3N7R C;  1IIP A;  4RQM A;  4G3I A;  4F4K A;  4ECQ A;  1SGG A;  1ZD4 A;  2KJ5 A;  3WKC A;  3UMG A;  1L7N A;  5ALO A;  5KG3 A;  4MFC A;  1P7D A;  5AI5 A;  4F71 A;  3BQ0 A;  2DGZ A;  3RAX A;  3AEV A;  4ECU A;  4LVS A;  1LKY A;  5AK6 A;  2ZIW B;  1ZQV A;  3KTQ A;  4Q44 A;  2AGO A; 
#chains in the Genus database with same CATH homology
 4DOA A;  4RQ3 A;  4PGQ A;  4RT3 A;  8ICQ A;  4I2F A;  1ZQJ A;  2ISO A;  4NY8 A;  4I2D A;  4I2H A;  4GXI A;  4O5K A;  4TUR A;  1BPZ A;  4K4G A;  9ICS A;  4RQ6 A;  4PHP A;  1BPY A;  4UB4 A;  4I28 A;  4F5O A;  4M0A A;  1XSP A;  4UB1 A;  4RQ4 A;  4P2H A;  1MQ2 A;  9ICM A;  4KLE A;  3JPN A;  4RPY A;  2PFO A;  4KLU A;  3PNC A;  3HX0 A;  4RQ0 A;  8ICW A;  1ZQH A;  5J0O A;  4PHD A;  8ICI A;  1BPD A;  1BPE A;  4RT2 A;  3PMN A;  4MFA A;  3C2M A;  7ICI A;  9ICL A;  8ICM A;  4Z6F A;  4TUS A;  9ICO A;  4UB5 A;  4I2E A;  4KLH A;  3UXP A;  4O5E A;  5J0S A;  4RQ2 A;  1XSL A;  8ICY A;  4R63 A;  8ICC A;  2PFN A;  3JPR A;  5DKW A;  5J2E A;  4RQ8 A;  4JWM A;  9ICW A;  3V7L A;  5D49 A;  5J2I A;  1ZQS A;  7ICP A;  5J0P A;  2I9G A;  5J0Y A;  1DK3 A;  4QZF A;  1MQ3 A;  1ZQM A;  1KEJ A;  4PPX A;  4YN4 A;  8ICL A;  3B0Y A;  3ISD A;  4DOB A;  1ZQC A;  9ICK A;  4NLK A;  5IIO A;  7ICM A;  5D46 A;  3GDX A;  5J2F A;  1JMS A;  1HUZ A;  5IIJ A;  1BPX A;  4M04 A;  7ICH A;  1ZQK A;  4UB2 A;  5IIN A;  1ZQA A;  7ICJ A;  2BPG A;  1ZQL A;  8ICF A;  3C2K A;  2BCV A;  4KLD A;  4Z6E A;  3RH5 A;  4YMM A;  3MDA A;  4YMN A;  5J2J A;  8ICT A;  4UAY A;  5HHI A;  4UB3 A;  4R64 A;  1ZQQ A;  7ICL A;  4QZB A;  4MFF A;  4RQ1 A;  1RZT A;  4UBB A;  4UAZ A;  4R66 A;  8ICN A;  7ICE A;  7ICK A;  4KLG A;  4YD2 A;  5J2D A;  8ICX A;  4YCX A;  2BCU A;  9ICX A;  1ZQP A;  3TFR A;  5DB6 A;  5DBA A;  4I27 A;  4KLF A;  4KLS A;  4I2C A;  4NM2 A;  4QZC A;  7ICT A;  1TVA A;  4DO9 A;  3UPQ A;  5CB1 A;  2BCR A;  5CWR A;  3RH4 A;  4KLO A;  1ZJN A;  8ICB A;  4UAW A;  1ZQR A;  9ICA A;  2KP7 A;  8ICJ A;  7ICG A;  4X5V A;  3V7J A;  1DK2 A;  8ICH A;  3C5G A;  7ICQ A;  1NZP A;  5DB9 A;  3V7K A;  4I2J A;  9ICG A;  3ISC A;  1ZQB A;  9ICI A;  1BNO A;  8ICS A;  5HHH A;  5J29 A;  1XSN A;  3ISB A;  5IIK A;  8ICZ A;  7ICU A;  9ICQ A;  4F5Q A;  8ICP A;  4RQ7 A;  5J2G A;  1ZQT A;  5DB8 A;  3JPO A;  3RJF A;  2IHM A;  5DBB A;  8ICO A;  9ICH A;  4K4I A;  4F5P A;  4M9G A;  3AU2 A;  7ICR A;  4RPX A;  9ICB A;  2W9M A;  4RPZ A;  4M2Y A;  2PXI A;  4PHE A;  4LZG A;  3LK9 A;  5J2K A;  4KLL A;  7ICO A;  4YD1 A;  3UXN A;  5EOZ A;  5BOM A;  9ICF A;  4I2B A;  4NLZ A;  3V72 A;  3HW8 A;  5J0R A;  2ISP A;  2FMS A;  1BNP A;  4DOC A;  3HWT A;  1ZQF A;  7ICN A;  4TUP A;  4PGY A;  4FO6 A;  2FMP A;  4O9M A;  4IQT A;  8ICU A;  8ICA A;  7ICV A;  3RJG A;  1ZJM A;  4IQW A;  4QZE A;  5BPC A;  5DDY A;  2BCQ A;  4R65 A;  4I2I A;  4F5R A;  9ICJ A;  1ZQD A;  3UXO A;  3RH6 A;  5DB7 A;  4PGX A;  4KLI A;  3C2L A;  4GXJ A;  4I29 A;  8ICR A;  3AUO A;  3JPQ A;  4Z6D A;  7ICS A;  3C5F A;  9ICE A;  3MGH A;  4TUQ A;  1ZQE A;  4MF2 A;  4QZI A;  3UQ0 A;  2PFP A;  9ICN A;  3JPT A;  4M9N A;  4M47 A;  4O5C A;  8ICV A;  4I2G A;  2PFQ A;  3PML A;  4KLQ A;  4XUS A;  5J2A A;  4PH5 A;  3B0X A;  5D4B A;  4QZ8 A;  4YMO A;  4NLN A;  2GWS A;  9ICC A;  5J2C A;  4QZD A;  1HUO A;  5BOL A;  2FMQ A;  3TFS A;  3RJE A;  9ICV A;  4I2A A;  3AU6 A;  4QZH A;  2P66 A;  4QZ9 A;  4Z6C A;  8ICG A;  4KLT A;  7ICF A;  3RJH A;  5J0W A;  4XA5 A;  5IIL A;  4LZD A;  4F5N A;  1KDH A;  2BCS A;  4GXK A;  3RJJ A;  5IIM A;  9ICR A;  5DBC A;  5J2H A;  4QZA A;  4QZG A;  4NM1 A;  3MGI A;  8ICE A;  4K4H A;  4KLJ A;  1ZQO A;  5III A;  3RJK A;  5J0T A;  4M9H A;  4M9J A;  1ZQN A;  4PHA A;  8ICK A;  9ICU A;  5J0X A;  3RJI A;  4KLM A;  4IQU A;  3UQ2 A;  1ZQI A;  4JWN A;  3MBY A;  4UBC A;  9ICP A;  3OGU A;  5TZV A;  4RQ5 A;  4IQV A;  1ZQG A;  1TV9 A;  2BPF A;  9ICT A;  5J2B A;  4MFC A;  5J0Q A;  5J0U A;  4LVS A;  4M9L A;  4NXZ A;  3JPS A;  4MF8 A;  3MDC A;  3JPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...