2KP7A

Solution nmr structure of the mus81 n-terminal hhh. northeast structural genomics consortium target mmt1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
80
structure length
80
Chain Sequence
b'RPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crossover junction endonuclease MUS81
publication title Solution NMR structure and DNA binding mode of the Mus81 n-terminal helix-hairpin-helix domain
rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 25
structure length 80
sequence length 80
ec nomenclature ec 3.1.22.-:
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2kp7A01
4Z6EA 3C2KA 5J0XA 4QZAA 5J2JA 4M2YA 2KP7A 4RPYA 3RJIA 4KLSA 1BPYA 9ICBA 4UB1A 8ICAA 3UXPA 4PGYA 2PFPA 4YMNA 4O5KA 5J29A 2BCSA 4JWNA 3HW8A 7ICEA 1ZQKA 8ICVA 8ICQA 4I2JA 7ICJA 7ICNA 4KLGA 3AUOA 5BOMA 4M0AA 4UB4A 8ICMA 5IIOA 9ICHA 8ICLA 4F5OA 3B0XA 1BPDA 7ICHA 2PFQA 8ICTA 4RPXA 3UXOA 9ICEA 4KLIA 4I2CA 7ICPA 1ZJMA 1HUZA 4NM2A 1RZTA 2I9GA 5D46A 4I2GA 9ICLA 2BCVA 4QZBA 4UB2A 7ICLA 3MGIA 8ICHA 4NLZA 4K4IA 4F5QA 4I2AA 1JMSA 5DB6A 8ICWA 1XSPA 3RH6A 3UQ0A 4RPZA 4I2FA 8ICKA 4YCXA 2PFOA 1ZJNA 4IQWA 4Z6FA 4F5NA 3RJEA 2BPFA 1NZPA 3GDXA 1MQ2A 7ICKA 4RQ0A 4LZDA 4O5EA 1ZQOA 3C5GA 4X5VA 3C2MA 5J0UA 4KLDA 8ICXA 5J0WA 4RQ3A 9ICAA 1ZQIA 4NM1A 4KLHA 7ICRA 4I2HA 9ICXA 3V72A 4LVSA 1BPEA 4QZ8A 3TFSA 4RQ4A 5IILA 9ICCA 1ZQGA 5J0PA 4R66A 5HHHA 3RJKA 8ICGA 3JPNA 8ICYA 5J0SA 9ICUA 3UQ2A 2BCQA 4PHPA 4KLTA 3TFRA 4Z6DA 5HHIA 4NY8A 5IIMA 4TURA 3ISDA 5J0TA 4PPXA 4Z6CA 8ICOA 5DBAA 4DOAA 4KLFA 3MBYA 4MFCA 1ZQJA 5J2FA 4RQ7A 3JPSA 2BPGA 4K4HA 3HX0A 8ICBA 7ICTA 7ICGA 8ICPA 3PMNA 4UAYA 1ZQCA 1ZQHA 4GXKA 4QZHA 5TZVA 4YN4A 4PHAA 1ZQDA 4M9JA 2W9MA 4QZEA 4K4GA 4IQTA 5D4BA 4M9LA 4UAZA 5CWRA 4TUQA 9ICGA 3JPRA 3RJFA 2P66A 1ZQQA 2FMQA 7ICMA 4YD1A 1ZQFA 9ICRA 9ICOA 3JPPA 4MFFA 3MDCA 7ICUA 2FMSA 4I2BA 2GWSA 3RJGA 4M04A 4KLJA 5EOZA 1ZQAA 7ICQA 3RJJA 9ICTA 1ZQSA 5J2CA 1HUOA 4M9GA 4MFAA 9ICIA 2ISPA 4YMMA 9ICSA 4MF8A 4KLLA 1ZQPA 3PMLA 3PNCA 8ICEA 8ICUA 1ZQEA 1DK3A 4M9NA 4GXIA 4RT2A 4GXJA 8ICFA 8ICCA 4RQ2A 1DK2A 1ZQRA 3V7LA 4UBCA 3V7JA 9ICMA 5J0RA 5J0OA 1ZQLA 9ICPA 3RH4A 9ICWA 5DB7A 3C2LA 3RH5A 4R65A 3JPOA 2IHMA 3AU2A 5J2AA 5J2GA 3OGUA 4RQ1A 4UB3A 3UXNA 8ICRA 5IINA 4XUSA 4XA5A 3RJHA 4PHEA 4RQ8A 5IIKA 1KDHA 2BCRA 9ICJA 3V7KA 4NLNA 4I27A 5IIIA 5J2BA 4F5PA 5DKWA 4QZGA 5BPCA 5DB9A 8ICZA 4RT3A 4QZDA 4UAWA 1ZQNA 1BPZA 4QZ9A 5DBCA 5J0QA 3AU6A 1TV9A 5J2HA 4NXZA 8ICJA 4DOCA 9ICNA 1MQ3A 4P2HA 5CB1A 5J2IA 4KLUA 1BNPA 9ICVA 7ICSA 4I2DA 4PHDA 1TVAA 4MF2A 4DO9A 4YMOA 1XSLA 1BPXA 4QZCA 5DB8A 3JPQA 1BNOA 7ICFA 2ISOA 3C5FA 9ICFA 8ICSA 4KLEA 4JWMA 3ISCA 2PFNA 3B0YA 4RQ6A 4YD2A 3UPQA 1ZQBA 2FMPA 4O9MA 5IIJA 4R64A 7ICOA 5J2KA 8ICIA 4PGQA 4UBBA 4LZGA 1KEJA 4QZIA 4TUSA 3LK9A 2BCUA 1XSNA 4KLQA 3HWTA 5J2DA 4TUPA 4PH5A 5DBBA 5DDYA 4M47A 4FO6A 4M9HA 4IQVA 9ICKA 4QZFA 4UB5A 4O5CA 3JPTA 7ICIA 3ISBA 5D49A 5J2EA 4PGXA 3MGHA 4I28A 9ICQA 4KLOA 7ICVA 1ZQMA 4RQ5A 4F5RA 4R63A 3MDAA 2PXIA 1ZQTA 4NLKA 5BOLA 4KLMA 4I2EA 4I29A 8ICNA 4IQUA 4DOBA 4I2IA 5J0YA
chains in the Genus database with same CATH superfamily
5J0XA 4C8NA 1N5XA 5DLGA 3RJIA 3RBDA 1D9FA 4E0DA 2A1JB 3Q8QB 9ICBA 1IM4A 4XQ8A 3WK8A 3GIKA 1J2NA 2KZMA 5AK4A 4O0IA 1S0MA 4O5KA 2M0NA 3RAQA 3HW8A 3KHHA 2WB1C 2NYVA 1K1QA 8ICQA 5ALYA 3GIJA 3BQ7A 1KQQA 4RNNA 4BWJA 1IIPA 1V97A 4DS4A 4DQPA 4YVZA 3CP8A 5KG0A 2WB1F 1NK7A 4M0AA 2W3SA 4UB4A 1O08A 1XU4A 4J9OA 5HP4A 8ICMA 4F72A 2HHQA 3H0RB 4EX7A 3SAFA 2KIWA 2C2DA 3CW2C 2J6TA 3ZDAA 1JI7A 1L8OA 1TK8A 3QU7A 2ZIUA 2P6UA 2HI0A 4KLIA 2W7OA 1NKEA 1FFUA 1HUZA 2DL0A 2QB0A 3B9JA 5ALZA 2KKPA 4NLCA 5EE3A 9ICLA 3NGDA 4QZBA 2MU2A 4UB2A 7ICLA 1N61A 1SGGA 2I1QA 3PR5B 4K4IA 2ZUCA 3BJYA 1IV8A 3G6XA 4OO1J 2G5HB 2A19A 4DCCA 4YCXA 2PFOA 4FBUA 2IMWP 1RXWA 2IOFA 3C1ZA 3PV8A 1K5OA 2I6XA 5DG8A 1YT3A 3D6JA 4KX5A 2DPJA 4UB8U 4YXMA 7ICKA 4C7ZA 2KJ5A 5KFWA 4LZDA 5GTHU 4QWCA 3R9KA 3IHQB 2JZBA 4USAA 4CF4A 5J0UA 5JUMA 1SV4A 1PUZA 8ICXA 2WAQC 4DSLA 3H8SA 2FLLA 4F4XA 3ZI4A 3MR2A 3M7DA 1TE2A 4KTQA 4BXOB 4PL1A 3AMZA 2HVIA 3EYZA 1YZ7A 1D8YA 3L5KA 5IILA 2HSZA 1ZQGA 4F2SA 5HHHA 1CI4A 4DF4A 5KFBA 1SZHA 2Y9UA 5J0SA 4B9MA 9ICUA 2BCQA 3RRHA 4PHPA 2DGZA 4F2RA 2F1IA 5KAIU 4IC9A 3TFRA 3M8RA 5AKHA 1KBUA 4DSJA 4F93B 2KICA 2JXJA 4CRXA 2LM4A 4AYBC 4Z6CA 4A8EA 5DBAA 2JH1A 4BGDA 4K4HA 3HX0A 2KZ3A 2YMQA 2H3VA 1TAQA 1B0XA 3BS5B 4AYBF 5L9XA 3PMNA 3ZDDA 4GXKA 2KTQA 4QZHA 3KHRA 3PW4A 1XO0A 2WTFA 3GFKB 3MFIA 4YXJA 1ZQXA 5TZVA 3V6KA 3GV8B 2W9MA 5EE0A 3KFUF 2E1EA 2OHFA 3PVXA 1SWVA 2JV3A 2V9WA 2EAOA 3ETLA 4F4ZA 3TAPA 4J9LA 1QSYA 2G0AA 2B21A 2FMQA 2K60A 3UM9A 2NO4A 2W8KA 9ICRA 2A3VA 4G3IA 2J6SA 1T94A 2UVRA 1N2XA 3M8SA 2KV2A 3C1YA 3PW0A 5ALTA 5EWGA 1L5UA 3MC1A 4KLJA 3Q8SB 3RJJA 2HHVA 2K8CB 1UT5A 3EPIA 4ED7A 1CRXA 5AKZA 2XC9A 1ZQPA 2YB4A 4M9NA 4DFPA 3IN5A 3HJEA 5DQHA 2WF6A 4GXJA 8ICFA 4RQ2A 2ATLA 5KT2A 5HNKA 5J0RA 3U26A 3PO4A 4P0PB 1Q3VA 5J8YA 4O3RA 9ICWA 3C2LA 3AM9A 2ZIWA 3RH5A 3QYPA 3WKEA 3JPOA 3IG8A 4KX3A 3FM9A 5KFFA 5J2GA 3FAHA 2Q0ZX 4BX9C 1JN3A 2HCFA 3GILA 5AM5A 4ECRA 3UXNA 3PZPA 3LYSA 1KW4A 3KHLA 4FS1A 1S77D 5IIKA 1V9PA 4ECTA 4CCHA 2FDRA 2IOFK 2H3IA 2AJQA 2DPIA 4F8RA 3PSFA 3SMVA 2XIDA 3LWMA 4OJPA 5KFRA 4FS2A 5KT5A 1ZQNA 4EBDA 1JRPA 1N5WA 4JV1A 5DBCA 4F3OA 5J0QA 3AU6A 3H0MB 2JEJA 1A77A 5F3XB 5AI4A 2ODGA 3QU4A 9ICNA 5AM0A 4YQWA 1XC9A 2LI6A 2ZIXB 5J2IA 9ICVA 4OD0A 3C28A 4I2DA 4PHDA 1T8EA 3NRWA 2W55A 1XSLA 1RXVA 2W9CB 2DQNB 1BNOA 2VJ5A 2ISOA 1WCLA 2ZUBA 5ALKA 2EQYA 2W8LA 5ALSA 1L6NA 2ZXHA 1NJYA 3RR7A 4YD2A 5AI5A 1L3UA 2JEFA 4R64A 7ICOA 5ALIA 8ICIA 4PGQA 1L7NA 2EZXA 4UBBA 2H3QA 2OEHA 5KFAA 1KEJA 3LK9A 4TUSA 5J2DA 1X6JA 4M47A 4DQSA 3S6JA 3MR6A 4O5CA 3ISBA 1S97A 5J2EA 1NKCA 5KG3A 4PGXA 4I28A 2XICA 4RQ5A 4F5RA 2BQRA 2OCEA 4R63A 2AGOA 1Z1VA 4NLKA 5CR0A 5BOLA 3H40A 3T5KA 2K4EA 2Y1IA 4IR1A 4I29A 1NK9A 4IL6U 5B66U 4JV0A 5EE1A 2QARB 4ACOA 4ED6A 5KAFU 4Z6EA 4QZAA 5J2JA 1S0OA 2EAPA 4QNLA 4OJ6A 4KLSA 4DF8A 4RU9A 4CF5A 2R8HA 3ETRA 3RB6A 4OJOA 2NV3A 1H38A 3WK7A 2LM1A 1Z4NA 2PFPA 2JEGA 1SXEA 5J29A 5L1MA 4Y2RA 1ZRMA 3QUBA 1ED1A 3G6VA 1X2IA 2HHWA 4ED0A 1ZQZA 3NUQA 1QH9A 4DL5A 2KZZA 5KFYA 3OJUA 1KFDA 7ICNA 4KLGA 1LKYA 5AKKA 3WK5A 4ECUA 3PO5A 5ALEA 4M6WB 4DSEA 9ICHA 4ZH4A 8ICLA 1L7MA 3OJSA 3B0XA 1BPDA 1PZNA 8ICTA 1DGSA 1NOMA 2HBLA 2K4IA 2V4QA 1U4BA 2KD1A 2ZJ5A 1NJXA 4QWEA 1PVQA 2FLPA 1RZTA 4RUAA 1UCVA 1RYRA 3MGIA 3MFHA 3QU5A 2IBKA 4NLZA 3H7IA 3ORYA 1SL0A 5CRXA 4F5QA 4DFJA 2XGPA 1JMSA 2BDUA 3VCBA 3VC8A 3MR5A 3V6JA 2KSOA 4GIBA 4DEZA 2ZXIA 3RH6A 2D8CA 1QSLA 3GZFA 4RQMA 2GLEA 1TAUA 3TACB 4KITB 4J9KA 2VIXA 2F77X 1PK3A 3EZ5A 3AQFA 2QB1A 4F5NA 2AH5A 3DDHA 3Q8LA 2A1JA 4B9UA 2HHTA 1MQ2A 2RRDA 1P7DA 4QWBA 4RQ0A 1Z3EB 2C28A 1T3QA 4UB6U 5KG2A 4Y2SA 4RZRA 3DV9A 2KHQA 4X5VA 2HBKA 3KZIU 1QLNA 2B6GA 4KLDA 2HHSA 5J0WA 3N4MB 4RQ3A 3SV4A 2Q4TA 2RP5A 4Q43A 3NASA 3ICXA 1ZQIA 4B9SA 2KMDA 5DG9A 4P4OA 7ICRA 2ZG6A 3V72A 1WWVA 4RQ4A 4DLEA 5KFMA 4ELUA 2FLNA 4EENA 5J0PA 3PX6A 4O3PA 5KFKA 5KFLA 3KKAC 4MEXA 2Y1JA 3UQ2A 2BZFA 4TQSA 1SZPA 5AKXA 5ALWA 2QLTA 1N60A 4Z6DA 4F4KA 4Q45A 4EBCA 1S9FA 4NY8A 2W11A 1S5LU 4UAVA 5IIMA 3WKBA 3K1ZA 4YFKA 4PPXA 4JB3A 2HMXA 8ICOA 4C0ZA 3MBYA 4O3MA 3KBBA 2FPKA 4RQ7A 3JPSA 2ASDA 1N48A 7ICTA 3H4DA 4ECWA 4HYKA 8ICPA 1Z4OA 1NNLA 1ZQCA 4EBEA 3D2QA 1CEZA 1NZBA 4Y2UA 4GC6A 4EEYA 3OPXA 2JH7A 1M6YA 2ZTDA 2Z7JA 3H8JA 1WUDA 1VJ5A 1KL9A 3QUCA 1F44A 1ZQDA 5JTIA 5L1JA 4M9JA 5AI0A 4FZMA 4QZEA 2HW3A 1SL1A 4IQTA 5HR6A 5KT7A 4UAZA 5CWRA 2E1FA 4DL6A 9ICGA 1XS9D 3RJFA 2CXYA 4CNQA 2XY7A 4DSFA 4B9VA 4J9RA 4YD1A 2P35A 3Q8PB 4O3OA 4BDPA 4BXOA 7ICUA 3OHBA 3RJGA 1QCKA 4DL3A 1KSPA 1ZETA 4M04A 2D3DA 2XCAA 1ZQAA 7ICQA 3KD3A 5L1LA 2F2AB 3QX7A 1ZQ1C 1ZQSA 4M9GA 1D8BA 9ICIA 2HOQA 2VKQA 4JV2A 4OCZA 1PK1B 4MF8A 4KLLA 4F92B 8ICEA 1ZQEA 5KFSA 3PSTA 2DWQA 4GXIA 3C29A 2E3TA 3AL0B 2KE7A 1TK5A 2C2RA 1ZRNA 5FP0A 1U9LA 1DK2A 2KFNA 3V7LA 5H2FU 2MUTB 5KFXA 2YY6A 3V7JA 2RLTA 1L3TA 2WF8A 4DL7A 2WAQF 1BVSA 2R8IA 5DB7A 2KG5A 3K4GA 4F4YA 3BS5A 2HHXA 4WJ3B 4UARA 2HBJA 2JHDA 1DRGA 3OGUA 1J97A 2BHNA 4NLGA 4RQ1A 1MSWD 3K75D 3HT3A 4FFDA 4UB3A 1VLBA 4PHEA 1N62A 3GV7B 4J03A 1KDHA 5KFHA 2OXOA 4IRCA 1PVPA 4NLNA 3DEEA 1QQ6A 5J2BA 1Z1BA 5DKWA 2VANA 1U49A 4QZDA 1OUQA 5ALNA 2GOLA 1NJWA 5KFUA 2ZTEA 4C4TA 3SAHA 3PSIA 1V38A 2IA6A 1X9WA 4EZ6A 1X9MA 3WK6A 2AQ4A 2NRVA 2W43A 4NXZA 1T3NA 1KN5A 4OJLA 1MQ3A 5CB1A 1QQ5A 2ZIVB 4QIWC 4KLUA 5ALJA 5AM1A 3F2CA 1BNPA 2KVCA 7ICSA 2HOIA 2YMPA 4OJ5A 3CYMA 1B22A 3QEAZ 2W04A 4QIWF 5ALPA 4YMOA 3D2NA 3RBEA 5L1IA 4QW8A 2AQ0A 3QUTA 5DQGA 2BKEA 5DB8A 4DSIA 4FE3A 4RQNA 1WYGA 5ALHA 5G5GA 8ICSA 1RYSA 4F91B 4B9LA 4RQ6A 2R8GA 1ZQBA 4PL2A 3QU2A 4P0PA 3NS1A 5J2KA 1RM6C 3GQCA 3WKCA 1DXSA 2BCUA 3AEVA 2F44A 4TUPA 4B6JA 2XY5A 4QZFA 4UB5A 3JPTA 1SV0C 2LPEA 4C8OA 5D49A 4ECSA 2V4RA 1V85A 5E79U 2PXIA 1ZQTA 2AXTU 2WF7A 4I2EA 5KT3A 3HILA 3HKZC 1XWLA 4LJXA 4I2IA 5KFOA 2KVSA 4DWIA 2NRWA 1RPLA 4M2YA 4QWAA 3SENA 4RPYA 2VA8A 2KNJA 3HKZF 1IXRA 1BPYA 2ZIXA 2P6RA 4UB1A 4JMUA 1ZD5A 3L3FX 2KJ9A 3M1YA 4U6PA 2K4HA 3EPGA 3SYZA 2RHFA 2LHTA 4NWIA 4PGYA 2R8JA 2XVTA 2VA2A 4JWNA 2W9CA 4C80A 3Q8KA 1X9XA 2OH2A 1MC8A 7ICEA 1ZQKA 1S0NA 3M9MB 4I2JA 5CEHA 7ICJA 4DFDA 5KG1A 1TFRA 3RR8A 3AUOA 4RNMA 4CF3A 3NVVA 4P4PA 3OSNA 4F5OA 3T5LA 1KFSA 1UHUA 2H3FA 4KMOB 1Q8KA 4UASA 3UXOA 9ICEA 3T79A 1D8LA 1U45A 2CRXA 3BDPA 4NM2A 2I9GA 4DS5A 4I2GA 3RFAA 2BCVA 5KG7A 4YR2A 2LYBA 3C21A 8ICHA 3TAQA 4C8MA 2EDUA 4YP3A 1B4FA 2HBMA 8ICWA 5GTIU 2W9AA 2PMZC 5ALFA 5AKIA 3UQ0A 2F76X 2BPCA 4RPZA 8ICKA 2L5YA 4UAUA 2QARA 3QE9Y 4Y2TA 5AKYA 4DQIA 4IQWA 1L3VA 1QQ7A 4JUZA 3PW7A 2PMZF 1T7PA 3RJEA 1L7PA 3GIIA 2BPFA 3BZKA 3WKDA 4P0QB 2DF4B 5AKEA 5KT6A 4ECQA 3AQEA 5ALXA 5KL1B 2G07A 4EELA 1EXNA 5KG5A 2AU0A 4Y2QA 5B5EU 2YN4A 1T4GA 2KN7A 2OYYA 3LVVA 5AM2A 3N7PD 3LDAA 5ALUA 1Z00B 1SIJA 5KG4A 1ZD4A 4R8UB 2DKXA 1NK5A 3PSPA 4I2HA 1WG8A 4Y2PA 1UQVA 4LVSA 5ALDA 3TFSA 5AK6A 4O3NA 1S0VA 2F1HA 4QW9A 4M6WA 3HP6A 2F1JA 8ICGA 4ECYA 8ICYA 2XY6A 3TI0A 5AICA 2RDIA 5AM4A 2NRTA 4C4SA 1JUDA 1QTMA 1L3SA 4KMUA 2ES6A 4U7CA 1JROA 3KZXA 4C8KA 3NVZA 2BQ3A 2KK0A 1Y88A 3KKAA 3WKAA 2JMGA 3Q8RB 4KLFA 4DL2A 2BPGA 8ICBA 3M6KA 3SD7A 4J9QA 3BQ0A 1HIWA 2NRXA 3E0FA 2N1RA 4UAYA 1ZQHA 5EWEA 2OWOA 5KFQA 4DLGA 4PHAA 5EWFA 1MN8A 1IG6A 1XNSA 2OM6A 5AK3A 4FZNA 3RF9A 3BS7A 4TUQA 4M9LA 4IRDA 3JPRA 3TQ1A 3E58A 2P66A 2LKYA 1COOA 1LVHA 5ALLA 4US8A 2KJ8A 4Y2JA 4O3SA 1RDFA 7ICMA 1KKXA 4HAIA 1SKRA 4US9A 1KLNA 9ICOA 3K1RB 1FEZA 3JPPA 4MFFA 1X66A 5DGAA 2W9BA 4MEYA 2KHVA 2LMRA 3EWAA 2FMSA 4I2BA 2YQEA 5AI8A 5AKJA 4FZLA 2QKQA 2W3RA 3C23A 5C5JA 5DLFA 9ICTA 2C2EA 2EZYA 4ICAA 5J2CA 1HUOA 3RAXA 4GFJA 1UA1A 3QU9A 3IM1A 4YMMA 4C8LA 9ICSA 3V6HA 3PMLA 3OSPA 8ICUA 2WFAA 3IV6A 5JU5A 1TK0A 8ICCA 2LYHA 1RYUA 4DFMA 2EH9A 1SXDA 1ZQRA 4J9MA 4UBCA 9ICMA 5KFTA 1ZQLA 1URJA 9ICPA 5ALMA 3QEBZ 3RH4A 3HRDD 2G09A 3A0HU 3RB3A 5ALGA 5DDMA 4PJ0U 2IHMA 1NK8A 3L4PA 2BGWA 2YMMA 3PX0A 3TKAA 2FPMA 1FO4A 2A1AA 4XUSA 4KN4A 3T5JA 5KFCA 4RUCA 1ZXIA 2EZZA 4RQ8A 4YR3A 1VDVA 3I76A 5KNIA 1X6IA 3GV5B 4FBTA 4GLXA 9ICJA 2DUYA 5T14A 3V7KA 4F5PA 4ELTA 5BPCA 1F5SA 4O3QA 4RT3A 2MSNA 3QNMA 4UAWA 4Y2YA 3IP4B 1TAMA 1DOQA 5KL8B 2KFZA 3T3FA 3SV3A 1BPZA 1OXJA 5CHGA 4KN7A 2UVUA 3D2SA 3QUQA 5AHXA 3WK9A 4EX6A 1MA7A 5J2HA 4P2HA 3GU3A 2DKZA 2E8MA 3UMGA 4ELVA 3THVA 2XI9A 1TVAA 3M6ZA 5DG7A 1D9DA 1PK1A 1ZOLA 1BPXA 3JPQA 4NLBA 7ICFA 5G5HA 3C5FA 4PZNA 9ICFA 1NJZA 2YMLA 4EEKA 2MUTA 2KOBA 4CGZA 2FMPA 1BPBA 2NRZA 1N63A 3IRUA 3FC4A 3TADA 2EAMA 1Z19A 3PY8A 5DQIA 5KFVA 2PKEA 2ZJAA 5AKLA 3KTQA 1XSNA 2MRLA 2ZIUB 2Y0SC 5L1KA 4FO6A 4M9HA 3MGVA 4CE6A 2HOFA 1ECWA 2E5SA 7ICIA 4EYIB 2QB0B 3MR3A 1LB2B 3HPOA 3MGHA 2JGAA 2Y0SF 5HMLA 4KLOA 7ICVA 4IRKA 2MAXA 3ZDEA 3ONNA 4AP9A 1A6SA 4TQRA 5F9NA 1B43A 4KLMA 4XRHA 3QZ7A 5AM3A 8ICNA 4IQUA 2R18A 1SV0A 4DQQA 2B0CA 3IDWA 5J0YA 3C2KA 3F5EA 2KP7A 4IS7A 1GO3F 4IR9A 2PI4A 2ZIVA 3BZCA 4MHVA 1AROP 2YX8A 3RTVA 3UXPA 8ICAA 4QJFB 5KFDA 3SI8A 4YMNA 2JZBB 1X42A 1U48A 2BCSA 3BQTA 3ED5A 1DGJA 1O03A 2O6KA 2ASJA 2JR5A 3PW5A 3OHAA 1Q3UA 8ICVA 5KFPA 1RG6A 5A0LA 3KOOA 2IOHA 2F8LA 1L7OA 4UATA 1F0MA 1HJPA 2GO7A 4EYHB 5BOMA 4J9SA 1N56A 5IIOA 3CRXA 2W7PA 1S10A 3H0LB 3WU2U 2FJ6A 4F4WA 1NK4A 3J81j 1ZD3A 2F8KA 2HDOA 1ZYQA 4NV0A 7ICHA 3CNHA 3TADC 2PFQA 2JRZA 4RPXA 3AN1A 5KT4A 5KFNA 2E8PA 1QSSA 4I2CA 7ICPA 1ZJMA 4RNOA 5D46A 1SB3C 1C7YA 5K4LA 3ALRA 1A76A 3NVWA 2XCPA 2W03A 1S76D 2M9NA 1ZQVA 4BUGA 2C22A 4I2AA 2ZUDA 5DB6A 1HEKA 1XSPA 1YZ6A 2AGPA 4I2FA 1COKA 3UMBA 3SQIA 1ZJNA 4Z6FA 1NK0A 2CN1A 3I28A 3H4BA 2K8AA 3OTQA 3SZ2A 5AKGA 2KIVA 2WF9A 1NZPA 3RRGA 3GDXA 4DL4A 1RQNA 2AGQA 5C0YA 2FI1A 1NKBA 2GH1A 3RB4A 2XO7A 3MABA 4DFKA 4B9TA 4O5EA 3LWLA 4J9PA 2VJ4A 1ZQOA 3C5GA 5CP2A 4B9NA 4C7YA 3C2MA 1PVRA 4CDGA 5KG6A 4BWMA 2DBYA 4ECZA 9ICAA 1FFVA 3TANA 4NM1A 4KLHA 9ICXA 3BQ2A 2MA1A 5EE9A 2G08A 1BPEA 4QZ8A 3Q8MA 4JK1A 9ICCA 5ALOA 2K89A 4R66A 3T5HA 2LYAA 3RJKA 3JPNA 1UT8A 4P4MA 1FIQA 3N7SC 1NK6A 3ZDCA 3IG5A 5KFJA 4KLTA 2G06A 5ALRA 2KKVA 5HHIA 2PI5A 2G5IB 5CA7A 4TURA 3ISDA 2E8NA 5J0TA 3GIMA 1AQ6A 2FE9A 4DOAA 4MFCA 1U47A 1ZQJA 5J2FA 2Y9TA 4BJQA 4PZOA 2LBOA 3PW2A 2ASLA 2ZIWB 1A0PA 7ICGA 1UPHA 3SAGA 4F71A 5F9LA 2YB1A 3QZ8A 4J9NA 1SKSA 5CJ7A 3EUB2 4YN4A 1ZD2P 4Y2XA 5JRTA 4K4GA 4P0QA 1C20A 1RQLA 5D4BA 5KFIA 1NI3A 3M9OB 4ED2A 3BQ1A 2EANA 1S8OA 2DFLA 1ZQQA 4DSKA 1ZQFA 1Z00A 1J2MA 5TISU 3F53A 5ALQA 4R8UA 3F2DA 1ZQWA 3MDCA 4QWDA 2I5HA 5KFEA 1JX4A 3RB0A 2GWSA 3EW9A 5EOZA 2K4PA 4NL9A 1JIHA 2E8OA 4MFAA 3LVWA 5J8YC 2ISPA 2CPRA 2HHUA 1LV5A 5AK5A 2VA3A 5KFGA 5ALVA 2WHEA 4YR0A 3PNCA 3TARA 1DK3A 3N7RC 4RT2A 3F5AA 5HR7A 3ZD9A 3I1YA 1OW5A 3PR4A 4ED3A 2R8KA 4G9BA 5J0OA 3NRZA 2NO5A 3H8WA 5HMMA 2BR0A 4Q44A 1Q46A 1L8LA 2UVVA 5AIBA 5AI9A 5AIAA 4R65A 2HVHA 3FYHA 4UQGA 3AU2A 5J2AA 1UA0A 3SEIA 1JALA 4ZOHC 8ICRA 2FPLA 5IINA 2IHNA 4XA5A 3G6YA 3RJHA 3KHGA 2UVWA 5AI6A 1SWWA 1BGXT 2BCRA 1ZQUA 5DGBA 4I27A 5IIIA 4NJ8A 4QZGA 5DB9A 8ICZA 2BQUA 1K1SA 5KTQA 1SKWA 2RDJA 4YG2A 4QZ9A 2BDPA 3SR6A 1TV9A 8ICJA 4DOCA 3UMCA 1WCNA 1ZQYA 1TKDA 4ED8A 3ZD8A 2ALZA 3PX4A 2RQ5A 4Y2VA 5KFZA 4MF2A 4DO9A 3NTUA 1X9SA 3ZDBA 4QZCA 4NL9C 1KFTA 1CUKA 2KEYA 2H3ZA 2H5XA 4KLEA 4C4RA 4JWMA 3FDSA 3ISCA 2PFNA 3B0YA 3UPQA 4O9MA 5IIJA 4EZ9A 1KRPA 2WF5A 3N97B 1LKYB 4ED1A 3N28A 3M9NB 4Q8EA 3F2BA 1SL2A 2JEIA 4LZGA 1WWUA 1JXEA 2ZJ8A 1X40A 1JXLA 4QZIA 4KLQA 2F3NA 3HWTA 3E2EA 4PH5A 2XGQA 5DBBA 4ECXA 5DDYA 1XO1A 2ESEA 4F50A 4IQVA 9ICKA 2J6UA 2YTUA 3QXGA 2W54A 3WK4A 9ICQA 4DQRA 4ECVA 2D6FC 1ZQMA 4Q8FA 3O0FA 3MDAA 1KTQA 4UW9A 3H8MA 2AHOB 2K8BB 2KSOB 3NVYA 2ZTCA 3A0BU 4DOBA 2W9BB 4GC7A
chains in the Genus database with same CATH topology
4Z6EA 3C2KA 5J0XA 4QZAA 5J2JA 4M2YA 2KP7A 4RPYA 3RJIA 4KLSA 1BPYA 9ICBA 4UB1A 8ICAA 3UXPA 4PGYA 2PFPA 4YMNA 4O5KA 5J29A 2BCSA 4JWNA 3HW8A 7ICEA 1ZQKA 8ICVA 8ICQA 4I2JA 7ICJA 7ICNA 4KLGA 3AUOA 5BOMA 4M0AA 4UB4A 8ICMA 5IIOA 9ICHA 8ICLA 4F5OA 3B0XA 1BPDA 7ICHA 2PFQA 8ICTA 4RPXA 3UXOA 9ICEA 4KLIA 4I2CA 7ICPA 1ZJMA 1HUZA 4NM2A 1RZTA 2I9GA 5D46A 4I2GA 9ICLA 2BCVA 4QZBA 4UB2A 7ICLA 3MGIA 8ICHA 4NLZA 4K4IA 4F5QA 4I2AA 1JMSA 5DB6A 8ICWA 1XSPA 3RH6A 3UQ0A 4RPZA 4I2FA 8ICKA 4YCXA 2PFOA 1ZJNA 4IQWA 4Z6FA 4F5NA 3RJEA 2BPFA 1NZPA 3GDXA 1MQ2A 7ICKA 4RQ0A 4LZDA 4O5EA 1ZQOA 3C5GA 4X5VA 3C2MA 5J0UA 4KLDA 8ICXA 5J0WA 4RQ3A 9ICAA 1ZQIA 4NM1A 4KLHA 7ICRA 4I2HA 9ICXA 3V72A 4LVSA 1BPEA 4QZ8A 3TFSA 4RQ4A 5IILA 9ICCA 1ZQGA 5J0PA 4R66A 5HHHA 3RJKA 8ICGA 3JPNA 8ICYA 5J0SA 9ICUA 3UQ2A 2BCQA 4PHPA 4KLTA 3TFRA 4Z6DA 5HHIA 4NY8A 5IIMA 4TURA 3ISDA 5J0TA 4PPXA 4Z6CA 8ICOA 5DBAA 4DOAA 4KLFA 3MBYA 4MFCA 1ZQJA 5J2FA 4RQ7A 3JPSA 2BPGA 4K4HA 3HX0A 8ICBA 7ICTA 7ICGA 8ICPA 3PMNA 4UAYA 1ZQCA 1ZQHA 4GXKA 4QZHA 5TZVA 4YN4A 4PHAA 1ZQDA 4M9JA 2W9MA 4QZEA 4K4GA 4IQTA 5D4BA 4M9LA 4UAZA 5CWRA 4TUQA 9ICGA 3JPRA 3RJFA 2P66A 1ZQQA 2FMQA 7ICMA 4YD1A 1ZQFA 9ICRA 9ICOA 3JPPA 4MFFA 3MDCA 7ICUA 2FMSA 4I2BA 2GWSA 3RJGA 4M04A 4KLJA 5EOZA 1ZQAA 7ICQA 3RJJA 9ICTA 1ZQSA 5J2CA 1HUOA 4M9GA 4MFAA 9ICIA 2ISPA 4YMMA 9ICSA 4MF8A 4KLLA 1ZQPA 3PMLA 3PNCA 8ICEA 8ICUA 1ZQEA 1DK3A 4M9NA 4GXIA 4RT2A 4GXJA 8ICFA 8ICCA 4RQ2A 1DK2A 1ZQRA 3V7LA 4UBCA 3V7JA 9ICMA 5J0RA 5J0OA 1ZQLA 9ICPA 3RH4A 9ICWA 5DB7A 3C2LA 3RH5A 4R65A 3JPOA 2IHMA 3AU2A 5J2AA 5J2GA 3OGUA 4RQ1A 4UB3A 3UXNA 8ICRA 5IINA 4XUSA 4XA5A 3RJHA 4PHEA 4RQ8A 5IIKA 1KDHA 2BCRA 9ICJA 3V7KA 4NLNA 4I27A 5IIIA 5J2BA 4F5PA 5DKWA 4QZGA 5BPCA 5DB9A 8ICZA 4RT3A 4QZDA 4UAWA 1ZQNA 1BPZA 4QZ9A 5DBCA 5J0QA 3AU6A 1TV9A 5J2HA 4NXZA 8ICJA 4DOCA 9ICNA 1MQ3A 4P2HA 5CB1A 5J2IA 4KLUA 1BNPA 9ICVA 7ICSA 4I2DA 4PHDA 1TVAA 4MF2A 4DO9A 4YMOA 1XSLA 1BPXA 4QZCA 5DB8A 3JPQA 1BNOA 7ICFA 2ISOA 3C5FA 9ICFA 8ICSA 4KLEA 4JWMA 3ISCA 2PFNA 3B0YA 4RQ6A 4YD2A 3UPQA 1ZQBA 2FMPA 4O9MA 5IIJA 4R64A 7ICOA 5J2KA 8ICIA 4PGQA 4UBBA 4LZGA 1KEJA 4QZIA 4TUSA 3LK9A 2BCUA 1XSNA 4KLQA 3HWTA 5J2DA 4TUPA 4PH5A 5DBBA 5DDYA 4M47A 4FO6A 4M9HA 4IQVA 9ICKA 4QZFA 4UB5A 4O5CA 3JPTA 7ICIA 3ISBA 5D49A 5J2EA 4PGXA 3MGHA 4I28A 9ICQA 4KLOA 7ICVA 1ZQMA 4RQ5A 4F5RA 4R63A 3MDAA 2PXIA 1ZQTA 4NLKA 5BOLA 4KLMA 4I2EA 4I29A 8ICNA 4IQUA 4DOBA 4I2IA 5J0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6E A;  3C2K A;  5J0X A;  4QZA A;  5J2J A;  4M2Y A;  2KP7 A;  4RPY A;  3RJI A;  4KLS A;  1BPY A;  9ICB A;  4UB1 A;  8ICA A;  3UXP A;  4PGY A;  2PFP A;  4YMN A;  4O5K A;  5J29 A;  2BCS A;  4JWN A;  3HW8 A;  7ICE A;  1ZQK A;  8ICV A;  8ICQ A;  4I2J A;  7ICJ A;  7ICN A;  4KLG A;  3AUO A;  5BOM A;  4M0A A;  4UB4 A;  8ICM A;  5IIO A;  9ICH A;  8ICL A;  4F5O A;  3B0X A;  1BPD A;  7ICH A;  2PFQ A;  8ICT A;  4RPX A;  3UXO A;  9ICE A;  4KLI A;  4I2C A;  7ICP A;  1ZJM A;  1HUZ A;  4NM2 A;  1RZT A;  2I9G A;  5D46 A;  4I2G A;  9ICL A;  2BCV A;  4QZB A;  4UB2 A;  7ICL A;  3MGI A;  8ICH A;  4NLZ A;  4K4I A;  4F5Q A;  4I2A A;  1JMS A;  5DB6 A;  8ICW A;  1XSP A;  3RH6 A;  3UQ0 A;  4RPZ A;  4I2F A;  8ICK A;  4YCX A;  2PFO A;  1ZJN A;  4IQW A;  4Z6F A;  4F5N A;  3RJE A;  2BPF A;  1NZP A;  3GDX A;  1MQ2 A;  7ICK A;  4RQ0 A;  4LZD A;  4O5E A;  1ZQO A;  3C5G A;  4X5V A;  3C2M A;  5J0U A;  4KLD A;  8ICX A;  5J0W A;  4RQ3 A;  9ICA A;  1ZQI A;  4NM1 A;  4KLH A;  7ICR A;  4I2H A;  9ICX A;  3V72 A;  4LVS A;  1BPE A;  4QZ8 A;  3TFS A;  4RQ4 A;  5IIL A;  9ICC A;  1ZQG A;  5J0P A;  4R66 A;  5HHH A;  3RJK A;  8ICG A;  3JPN A;  8ICY A;  5J0S A;  9ICU A;  3UQ2 A;  2BCQ A;  4PHP A;  4KLT A;  3TFR A;  4Z6D A;  5HHI A;  4NY8 A;  5IIM A;  4TUR A;  3ISD A;  5J0T A;  4PPX A;  4Z6C A;  8ICO A;  5DBA A;  4DOA A;  4KLF A;  3MBY A;  4MFC A;  1ZQJ A;  5J2F A;  4RQ7 A;  3JPS A;  2BPG A;  4K4H A;  3HX0 A;  8ICB A;  7ICT A;  7ICG A;  8ICP A;  3PMN A;  4UAY A;  1ZQC A;  1ZQH A;  4GXK A;  4QZH A;  5TZV A;  4YN4 A;  4PHA A;  1ZQD A;  4M9J A;  2W9M A;  4QZE A;  4K4G A;  4IQT A;  5D4B A;  4M9L A;  4UAZ A;  5CWR A;  4TUQ A;  9ICG A;  3JPR A;  3RJF A;  2P66 A;  1ZQQ A;  2FMQ A;  7ICM A;  4YD1 A;  1ZQF A;  9ICR A;  9ICO A;  3JPP A;  4MFF A;  3MDC A;  7ICU A;  2FMS A;  4I2B A;  2GWS A;  3RJG A;  4M04 A;  4KLJ A;  5EOZ A;  1ZQA A;  7ICQ A;  3RJJ A;  9ICT A;  1ZQS A;  5J2C A;  1HUO A;  4M9G A;  4MFA A;  9ICI A;  2ISP A;  4YMM A;  9ICS A;  4MF8 A;  4KLL A;  1ZQP A;  3PML A;  3PNC A;  8ICE A;  8ICU A;  1ZQE A;  1DK3 A;  4M9N A;  4GXI A;  4RT2 A;  4GXJ A;  8ICF A;  8ICC A;  4RQ2 A;  1DK2 A;  1ZQR A;  3V7L A;  4UBC A;  3V7J A;  9ICM A;  5J0R A;  5J0O A;  1ZQL A;  9ICP A;  3RH4 A;  9ICW A;  5DB7 A;  3C2L A;  3RH5 A;  4R65 A;  3JPO A;  2IHM A;  3AU2 A;  5J2A A;  5J2G A;  3OGU A;  4RQ1 A;  4UB3 A;  3UXN A;  8ICR A;  5IIN A;  4XUS A;  4XA5 A;  3RJH A;  4PHE A;  4RQ8 A;  5IIK A;  1KDH A;  2BCR A;  9ICJ A;  3V7K A;  4NLN A;  4I27 A;  5III A;  5J2B A;  4F5P A;  5DKW A;  4QZG A;  5BPC A;  5DB9 A;  8ICZ A;  4RT3 A;  4QZD A;  4UAW A;  1ZQN A;  1BPZ A;  4QZ9 A;  5DBC A;  5J0Q A;  3AU6 A;  1TV9 A;  5J2H A;  4NXZ A;  8ICJ A;  4DOC A;  9ICN A;  1MQ3 A;  4P2H A;  5CB1 A;  5J2I A;  4KLU A;  1BNP A;  9ICV A;  7ICS A;  4I2D A;  4PHD A;  1TVA A;  4MF2 A;  4DO9 A;  4YMO A;  1XSL A;  1BPX A;  4QZC A;  5DB8 A;  3JPQ A;  1BNO A;  7ICF A;  2ISO A;  3C5F A;  9ICF A;  8ICS A;  4KLE A;  4JWM A;  3ISC A;  2PFN A;  3B0Y A;  4RQ6 A;  4YD2 A;  3UPQ A;  1ZQB A;  2FMP A;  4O9M A;  5IIJ A;  4R64 A;  7ICO A;  5J2K A;  8ICI A;  4PGQ A;  4UBB A;  4LZG A;  1KEJ A;  4QZI A;  4TUS A;  3LK9 A;  2BCU A;  1XSN A;  4KLQ A;  3HWT A;  5J2D A;  4TUP A;  4PH5 A;  5DBB A;  5DDY A;  4M47 A;  4FO6 A;  4M9H A;  4IQV A;  9ICK A;  4QZF A;  4UB5 A;  4O5C A;  3JPT A;  7ICI A;  3ISB A;  5D49 A;  5J2E A;  4PGX A;  3MGH A;  4I28 A;  9ICQ A;  4KLO A;  7ICV A;  1ZQM A;  4RQ5 A;  4F5R A;  4R63 A;  3MDA A;  2PXI A;  1ZQT A;  4NLK A;  5BOL A;  4KLM A;  4I2E A;  4I29 A;  8ICN A;  4IQU A;  4DOB A;  4I2I A;  5J0Y A; 
#chains in the Genus database with same CATH topology
 5J0X A;  4C8N A;  1N5X A;  5DLG A;  3RJI A;  3RBD A;  1D9F A;  4E0D A;  2A1J B;  3Q8Q B;  9ICB A;  1IM4 A;  4XQ8 A;  3WK8 A;  3GIK A;  1J2N A;  2KZM A;  5AK4 A;  4O0I A;  1S0M A;  4O5K A;  2M0N A;  3RAQ A;  3HW8 A;  3KHH A;  2WB1 C;  2NYV A;  1K1Q A;  8ICQ A;  5ALY A;  3GIJ A;  3BQ7 A;  1KQQ A;  4RNN A;  4BWJ A;  1IIP A;  1V97 A;  4DS4 A;  4DQP A;  4YVZ A;  3CP8 A;  5KG0 A;  2WB1 F;  1NK7 A;  4M0A A;  2W3S A;  4UB4 A;  1O08 A;  1XU4 A;  4J9O A;  5HP4 A;  8ICM A;  4F72 A;  2HHQ A;  3H0R B;  4EX7 A;  3SAF A;  2KIW A;  2C2D A;  3CW2 C;  2J6T A;  3ZDA A;  1JI7 A;  1L8O A;  1TK8 A;  3QU7 A;  2ZIU A;  2P6U A;  2HI0 A;  4KLI A;  2W7O A;  1NKE A;  1FFU A;  1HUZ A;  2DL0 A;  2QB0 A;  3B9J A;  5ALZ A;  2KKP A;  4NLC A;  5EE3 A;  9ICL A;  3NGD A;  4QZB A;  2MU2 A;  4UB2 A;  7ICL A;  1N61 A;  1SGG A;  2I1Q A;  3PR5 B;  4K4I A;  2ZUC A;  3BJY A;  1IV8 A;  3G6X A;  4OO1 J;  2G5H B;  2A19 A;  4DCC A;  4YCX A;  2PFO A;  4FBU A;  2IMW P;  1RXW A;  2IOF A;  3C1Z A;  3PV8 A;  1K5O A;  2I6X A;  5DG8 A;  1YT3 A;  3D6J A;  4KX5 A;  2DPJ A;  4UB8 U;  4YXM A;  7ICK A;  4C7Z A;  2KJ5 A;  5KFW A;  4LZD A;  5GTH U;  4QWC A;  3R9K A;  3IHQ B;  2JZB A;  4USA A;  4CF4 A;  5J0U A;  5JUM A;  1SV4 A;  1PUZ A;  8ICX A;  2WAQ C;  4DSL A;  3H8S A;  2FLL A;  4F4X A;  3ZI4 A;  3MR2 A;  3M7D A;  1TE2 A;  4KTQ A;  4BXO B;  4PL1 A;  3AMZ A;  2HVI A;  3EYZ A;  1YZ7 A;  1D8Y A;  3L5K A;  5IIL A;  2HSZ A;  1ZQG A;  4F2S A;  5HHH A;  1CI4 A;  4DF4 A;  5KFB A;  1SZH A;  2Y9U A;  5J0S A;  4B9M A;  9ICU A;  2BCQ A;  3RRH A;  4PHP A;  2DGZ A;  4F2R A;  2F1I A;  5KAI U;  4IC9 A;  3TFR A;  3M8R A;  5AKH A;  1KBU A;  4DSJ A;  4F93 B;  2KIC A;  2JXJ A;  4CRX A;  2LM4 A;  4AYB C;  4Z6C A;  4A8E A;  5DBA A;  2JH1 A;  4BGD A;  4K4H A;  3HX0 A;  2KZ3 A;  2YMQ A;  2H3V A;  1TAQ A;  1B0X A;  3BS5 B;  4AYB F;  5L9X A;  3PMN A;  3ZDD A;  4GXK A;  2KTQ A;  4QZH A;  3KHR A;  3PW4 A;  1XO0 A;  2WTF A;  3GFK B;  3MFI A;  4YXJ A;  1ZQX A;  5TZV A;  3V6K A;  3GV8 B;  2W9M A;  5EE0 A;  3KFU F;  2E1E A;  2OHF A;  3PVX A;  1SWV A;  2JV3 A;  2V9W A;  2EAO A;  3ETL A;  4F4Z A;  3TAP A;  4J9L A;  1QSY A;  2G0A A;  2B21 A;  2FMQ A;  2K60 A;  3UM9 A;  2NO4 A;  2W8K A;  9ICR A;  2A3V A;  4G3I A;  2J6S A;  1T94 A;  2UVR A;  1N2X A;  3M8S A;  2KV2 A;  3C1Y A;  3PW0 A;  5ALT A;  5EWG A;  1L5U A;  3MC1 A;  4KLJ A;  3Q8S B;  3RJJ A;  2HHV A;  2K8C B;  1UT5 A;  3EPI A;  4ED7 A;  1CRX A;  5AKZ A;  2XC9 A;  1ZQP A;  2YB4 A;  4M9N A;  4DFP A;  3IN5 A;  3HJE A;  5DQH A;  2WF6 A;  4GXJ A;  8ICF A;  4RQ2 A;  2ATL A;  5KT2 A;  5HNK A;  5J0R A;  3U26 A;  3PO4 A;  4P0P B;  1Q3V A;  5J8Y A;  4O3R A;  9ICW A;  3C2L A;  3AM9 A;  2ZIW A;  3RH5 A;  3QYP A;  3WKE A;  3JPO A;  3IG8 A;  4KX3 A;  3FM9 A;  5KFF A;  5J2G A;  3FAH A;  2Q0Z X;  4BX9 C;  1JN3 A;  2HCF A;  3GIL A;  5AM5 A;  4ECR A;  3UXN A;  3PZP A;  3LYS A;  1KW4 A;  3KHL A;  4FS1 A;  1S77 D;  5IIK A;  1V9P A;  4ECT A;  4CCH A;  2FDR A;  2IOF K;  2H3I A;  2AJQ A;  2DPI A;  4F8R A;  3PSF A;  3SMV A;  2XID A;  3LWM A;  4OJP A;  5KFR A;  4FS2 A;  5KT5 A;  1ZQN A;  4EBD A;  1JRP A;  1N5W A;  4JV1 A;  5DBC A;  4F3O A;  5J0Q A;  3AU6 A;  3H0M B;  2JEJ A;  1A77 A;  5F3X B;  5AI4 A;  2ODG A;  3QU4 A;  9ICN A;  5AM0 A;  4YQW A;  1XC9 A;  2LI6 A;  2ZIX B;  5J2I A;  9ICV A;  4OD0 A;  3C28 A;  4I2D A;  4PHD A;  1T8E A;  3NRW A;  2W55 A;  1XSL A;  1RXV A;  2W9C B;  2DQN B;  1BNO A;  2VJ5 A;  2ISO A;  1WCL A;  2ZUB A;  5ALK A;  2EQY A;  2W8L A;  5ALS A;  1L6N A;  2ZXH A;  1NJY A;  3RR7 A;  4YD2 A;  5AI5 A;  1L3U A;  2JEF A;  4R64 A;  7ICO A;  5ALI A;  8ICI A;  4PGQ A;  1L7N A;  2EZX A;  4UBB A;  2H3Q A;  2OEH A;  5KFA A;  1KEJ A;  3LK9 A;  4TUS A;  5J2D A;  1X6J A;  4M47 A;  4DQS A;  3S6J A;  3MR6 A;  4O5C A;  3ISB A;  1S97 A;  5J2E A;  1NKC A;  5KG3 A;  4PGX A;  4I28 A;  2XIC A;  4RQ5 A;  4F5R A;  2BQR A;  2OCE A;  4R63 A;  2AGO A;  1Z1V A;  4NLK A;  5CR0 A;  5BOL A;  3H40 A;  3T5K A;  2K4E A;  2Y1I A;  4IR1 A;  4I29 A;  1NK9 A;  4IL6 U;  5B66 U;  4JV0 A;  5EE1 A;  2QAR B;  4ACO A;  4ED6 A;  5KAF U;  4Z6E A;  4QZA A;  5J2J A;  1S0O A;  2EAP A;  4QNL A;  4OJ6 A;  4KLS A;  4DF8 A;  4RU9 A;  4CF5 A;  2R8H A;  3ETR A;  3RB6 A;  4OJO A;  2NV3 A;  1H38 A;  3WK7 A;  2LM1 A;  1Z4N A;  2PFP A;  2JEG A;  1SXE A;  5J29 A;  5L1M A;  4Y2R A;  1ZRM A;  3QUB A;  1ED1 A;  3G6V A;  1X2I A;  2HHW A;  4ED0 A;  1ZQZ A;  3NUQ A;  1QH9 A;  4DL5 A;  2KZZ A;  5KFY A;  3OJU A;  1KFD A;  7ICN A;  4KLG A;  1LKY A;  5AKK A;  3WK5 A;  4ECU A;  3PO5 A;  5ALE A;  4M6W B;  4DSE A;  9ICH A;  4ZH4 A;  8ICL A;  1L7M A;  3OJS A;  3B0X A;  1BPD A;  1PZN A;  8ICT A;  1DGS A;  1NOM A;  2HBL A;  2K4I A;  2V4Q A;  1U4B A;  2KD1 A;  2ZJ5 A;  1NJX A;  4QWE A;  1PVQ A;  2FLP A;  1RZT A;  4RUA A;  1UCV A;  1RYR A;  3MGI A;  3MFH A;  3QU5 A;  2IBK A;  4NLZ A;  3H7I A;  3ORY A;  1SL0 A;  5CRX A;  4F5Q A;  4DFJ A;  2XGP A;  1JMS A;  2BDU A;  3VCB A;  3VC8 A;  3MR5 A;  3V6J A;  2KSO A;  4GIB A;  4DEZ A;  2ZXI A;  3RH6 A;  2D8C A;  1QSL A;  3GZF A;  4RQM A;  2GLE A;  1TAU A;  3TAC B;  4KIT B;  4J9K A;  2VIX A;  2F77 X;  1PK3 A;  3EZ5 A;  3AQF A;  2QB1 A;  4F5N A;  2AH5 A;  3DDH A;  3Q8L A;  2A1J A;  4B9U A;  2HHT A;  1MQ2 A;  2RRD A;  1P7D A;  4QWB A;  4RQ0 A;  1Z3E B;  2C28 A;  1T3Q A;  4UB6 U;  5KG2 A;  4Y2S A;  4RZR A;  3DV9 A;  2KHQ A;  4X5V A;  2HBK A;  3KZI U;  1QLN A;  2B6G A;  4KLD A;  2HHS A;  5J0W A;  3N4M B;  4RQ3 A;  3SV4 A;  2Q4T A;  2RP5 A;  4Q43 A;  3NAS A;  3ICX A;  1ZQI A;  4B9S A;  2KMD A;  5DG9 A;  4P4O A;  7ICR A;  2ZG6 A;  3V72 A;  1WWV A;  4RQ4 A;  4DLE A;  5KFM A;  4ELU A;  2FLN A;  4EEN A;  5J0P A;  3PX6 A;  4O3P A;  5KFK A;  5KFL A;  3KKA C;  4MEX A;  2Y1J A;  3UQ2 A;  2BZF A;  4TQS A;  1SZP A;  5AKX A;  5ALW A;  2QLT A;  1N60 A;  4Z6D A;  4F4K A;  4Q45 A;  4EBC A;  1S9F A;  4NY8 A;  2W11 A;  1S5L U;  4UAV A;  5IIM A;  3WKB A;  3K1Z A;  4YFK A;  4PPX A;  4JB3 A;  2HMX A;  8ICO A;  4C0Z A;  3MBY A;  4O3M A;  3KBB A;  2FPK A;  4RQ7 A;  3JPS A;  2ASD A;  1N48 A;  7ICT A;  3H4D A;  4ECW A;  4HYK A;  8ICP A;  1Z4O A;  1NNL A;  1ZQC A;  4EBE A;  3D2Q A;  1CEZ A;  1NZB A;  4Y2U A;  4GC6 A;  4EEY A;  3OPX A;  2JH7 A;  1M6Y A;  2ZTD A;  2Z7J A;  3H8J A;  1WUD A;  1VJ5 A;  1KL9 A;  3QUC A;  1F44 A;  1ZQD A;  5JTI A;  5L1J A;  4M9J A;  5AI0 A;  4FZM A;  4QZE A;  2HW3 A;  1SL1 A;  4IQT A;  5HR6 A;  5KT7 A;  4UAZ A;  5CWR A;  2E1F A;  4DL6 A;  9ICG A;  1XS9 D;  3RJF A;  2CXY A;  4CNQ A;  2XY7 A;  4DSF A;  4B9V A;  4J9R A;  4YD1 A;  2P35 A;  3Q8P B;  4O3O A;  4BDP A;  4BXO A;  7ICU A;  3OHB A;  3RJG A;  1QCK A;  4DL3 A;  1KSP A;  1ZET A;  4M04 A;  2D3D A;  2XCA A;  1ZQA A;  7ICQ A;  3KD3 A;  5L1L A;  2F2A B;  3QX7 A;  1ZQ1 C;  1ZQS A;  4M9G A;  1D8B A;  9ICI A;  2HOQ A;  2VKQ A;  4JV2 A;  4OCZ A;  1PK1 B;  4MF8 A;  4KLL A;  4F92 B;  8ICE A;  1ZQE A;  5KFS A;  3PST A;  2DWQ A;  4GXI A;  3C29 A;  2E3T A;  3AL0 B;  2KE7 A;  1TK5 A;  2C2R A;  1ZRN A;  5FP0 A;  1U9L A;  1DK2 A;  2KFN A;  3V7L A;  5H2F U;  2MUT B;  5KFX A;  2YY6 A;  3V7J A;  2RLT A;  1L3T A;  2WF8 A;  4DL7 A;  2WAQ F;  1BVS A;  2R8I A;  5DB7 A;  2KG5 A;  3K4G A;  4F4Y A;  3BS5 A;  2HHX A;  4WJ3 B;  4UAR A;  2HBJ A;  2JHD A;  1DRG A;  3OGU A;  1J97 A;  2BHN A;  4NLG A;  4RQ1 A;  1MSW D;  3K75 D;  3HT3 A;  4FFD A;  4UB3 A;  1VLB A;  4PHE A;  1N62 A;  3GV7 B;  4J03 A;  1KDH A;  5KFH A;  2OXO A;  4IRC A;  1PVP A;  4NLN A;  3DEE A;  1QQ6 A;  5J2B A;  1Z1B A;  5DKW A;  2VAN A;  1U49 A;  4QZD A;  1OUQ A;  5ALN A;  2GOL A;  1NJW A;  5KFU A;  2ZTE A;  4C4T A;  3SAH A;  3PSI A;  1V38 A;  2IA6 A;  1X9W A;  4EZ6 A;  1X9M A;  3WK6 A;  2AQ4 A;  2NRV A;  2W43 A;  4NXZ A;  1T3N A;  1KN5 A;  4OJL A;  1MQ3 A;  5CB1 A;  1QQ5 A;  2ZIV B;  4QIW C;  4KLU A;  5ALJ A;  5AM1 A;  3F2C A;  1BNP A;  2KVC A;  7ICS A;  2HOI A;  2YMP A;  4OJ5 A;  3CYM A;  1B22 A;  3QEA Z;  2W04 A;  4QIW F;  5ALP A;  4YMO A;  3D2N A;  3RBE A;  5L1I A;  4QW8 A;  2AQ0 A;  3QUT A;  5DQG A;  2BKE A;  5DB8 A;  4DSI A;  4FE3 A;  4RQN A;  1WYG A;  5ALH A;  5G5G A;  8ICS A;  1RYS A;  4F91 B;  4B9L A;  4RQ6 A;  2R8G A;  1ZQB A;  4PL2 A;  3QU2 A;  4P0P A;  3NS1 A;  5J2K A;  1RM6 C;  3GQC A;  3WKC A;  1DXS A;  2BCU A;  3AEV A;  2F44 A;  4TUP A;  4B6J A;  2XY5 A;  4QZF A;  4UB5 A;  3JPT A;  1SV0 C;  2LPE A;  4C8O A;  5D49 A;  4ECS A;  2V4R A;  1V85 A;  5E79 U;  2PXI A;  1ZQT A;  2AXT U;  2WF7 A;  4I2E A;  5KT3 A;  3HIL A;  3HKZ C;  1XWL A;  4LJX A;  4I2I A;  5KFO A;  2KVS A;  4DWI A;  2NRW A;  1RPL A;  4M2Y A;  4QWA A;  3SEN A;  4RPY A;  2VA8 A;  2KNJ A;  3HKZ F;  1IXR A;  1BPY A;  2ZIX A;  2P6R A;  4UB1 A;  4JMU A;  1ZD5 A;  3L3F X;  2KJ9 A;  3M1Y A;  4U6P A;  2K4H A;  3EPG A;  3SYZ A;  2RHF A;  2LHT A;  4NWI A;  4PGY A;  2R8J A;  2XVT A;  2VA2 A;  4JWN A;  2W9C A;  4C80 A;  3Q8K A;  1X9X A;  2OH2 A;  1MC8 A;  7ICE A;  1ZQK A;  1S0N A;  3M9M B;  4I2J A;  5CEH A;  7ICJ A;  4DFD A;  5KG1 A;  1TFR A;  3RR8 A;  3AUO A;  4RNM A;  4CF3 A;  3NVV A;  4P4P A;  3OSN A;  4F5O A;  3T5L A;  1KFS A;  1UHU A;  2H3F A;  4KMO B;  1Q8K A;  4UAS A;  3UXO A;  9ICE A;  3T79 A;  1D8L A;  1U45 A;  2CRX A;  3BDP A;  4NM2 A;  2I9G A;  4DS5 A;  4I2G A;  3RFA A;  2BCV A;  5KG7 A;  4YR2 A;  2LYB A;  3C21 A;  8ICH A;  3TAQ A;  4C8M A;  2EDU A;  4YP3 A;  1B4F A;  2HBM A;  8ICW A;  5GTI U;  2W9A A;  2PMZ C;  5ALF A;  5AKI A;  3UQ0 A;  2F76 X;  2BPC A;  4RPZ A;  8ICK A;  2L5Y A;  4UAU A;  2QAR A;  3QE9 Y;  4Y2T A;  5AKY A;  4DQI A;  4IQW A;  1L3V A;  1QQ7 A;  4JUZ A;  3PW7 A;  2PMZ F;  1T7P A;  3RJE A;  1L7P A;  3GII A;  2BPF A;  3BZK A;  3WKD A;  4P0Q B;  2DF4 B;  5AKE A;  5KT6 A;  4ECQ A;  3AQE A;  5ALX A;  5KL1 B;  2G07 A;  4EEL A;  1EXN A;  5KG5 A;  2AU0 A;  4Y2Q A;  5B5E U;  2YN4 A;  1T4G A;  2KN7 A;  2OYY A;  3LVV A;  5AM2 A;  3N7P D;  3LDA A;  5ALU A;  1Z00 B;  1SIJ A;  5KG4 A;  1ZD4 A;  4R8U B;  2DKX A;  1NK5 A;  3PSP A;  4I2H A;  1WG8 A;  4Y2P A;  1UQV A;  4LVS A;  5ALD A;  3TFS A;  5AK6 A;  4O3N A;  1S0V A;  2F1H A;  4QW9 A;  4M6W A;  3HP6 A;  2F1J A;  8ICG A;  4ECY A;  8ICY A;  2XY6 A;  3TI0 A;  5AIC A;  2RDI A;  5AM4 A;  2NRT A;  4C4S A;  1JUD A;  1QTM A;  1L3S A;  4KMU A;  2ES6 A;  4U7C A;  1JRO A;  3KZX A;  4C8K A;  3NVZ A;  2BQ3 A;  2KK0 A;  1Y88 A;  3KKA A;  3WKA A;  2JMG A;  3Q8R B;  4KLF A;  4DL2 A;  2BPG A;  8ICB A;  3M6K A;  3SD7 A;  4J9Q A;  3BQ0 A;  1HIW A;  2NRX A;  3E0F A;  2N1R A;  4UAY A;  1ZQH A;  5EWE A;  2OWO A;  5KFQ A;  4DLG A;  4PHA A;  5EWF A;  1MN8 A;  1IG6 A;  1XNS A;  2OM6 A;  5AK3 A;  4FZN A;  3RF9 A;  3BS7 A;  4TUQ A;  4M9L A;  4IRD A;  3JPR A;  3TQ1 A;  3E58 A;  2P66 A;  2LKY A;  1COO A;  1LVH A;  5ALL A;  4US8 A;  2KJ8 A;  4Y2J A;  4O3S A;  1RDF A;  7ICM A;  1KKX A;  4HAI A;  1SKR A;  4US9 A;  1KLN A;  9ICO A;  3K1R B;  1FEZ A;  3JPP A;  4MFF A;  1X66 A;  5DGA A;  2W9B A;  4MEY A;  2KHV A;  2LMR A;  3EWA A;  2FMS A;  4I2B A;  2YQE A;  5AI8 A;  5AKJ A;  4FZL A;  2QKQ A;  2W3R A;  3C23 A;  5C5J A;  5DLF A;  9ICT A;  2C2E A;  2EZY A;  4ICA A;  5J2C A;  1HUO A;  3RAX A;  4GFJ A;  1UA1 A;  3QU9 A;  3IM1 A;  4YMM A;  4C8L A;  9ICS A;  3V6H A;  3PML A;  3OSP A;  8ICU A;  2WFA A;  3IV6 A;  5JU5 A;  1TK0 A;  8ICC A;  2LYH A;  1RYU A;  4DFM A;  2EH9 A;  1SXD A;  1ZQR A;  4J9M A;  4UBC A;  9ICM A;  5KFT A;  1ZQL A;  1URJ A;  9ICP A;  5ALM A;  3QEB Z;  3RH4 A;  3HRD D;  2G09 A;  3A0H U;  3RB3 A;  5ALG A;  5DDM A;  4PJ0 U;  2IHM A;  1NK8 A;  3L4P A;  2BGW A;  2YMM A;  3PX0 A;  3TKA A;  2FPM A;  1FO4 A;  2A1A A;  4XUS A;  4KN4 A;  3T5J A;  5KFC A;  4RUC A;  1ZXI A;  2EZZ A;  4RQ8 A;  4YR3 A;  1VDV A;  3I76 A;  5KNI A;  1X6I A;  3GV5 B;  4FBT A;  4GLX A;  9ICJ A;  2DUY A;  5T14 A;  3V7K A;  4F5P A;  4ELT A;  5BPC A;  1F5S A;  4O3Q A;  4RT3 A;  2MSN A;  3QNM A;  4UAW A;  4Y2Y A;  3IP4 B;  1TAM A;  1DOQ A;  5KL8 B;  2KFZ A;  3T3F A;  3SV3 A;  1BPZ A;  1OXJ A;  5CHG A;  4KN7 A;  2UVU A;  3D2S A;  3QUQ A;  5AHX A;  3WK9 A;  4EX6 A;  1MA7 A;  5J2H A;  4P2H A;  3GU3 A;  2DKZ A;  2E8M A;  3UMG A;  4ELV A;  3THV A;  2XI9 A;  1TVA A;  3M6Z A;  5DG7 A;  1D9D A;  1PK1 A;  1ZOL A;  1BPX A;  3JPQ A;  4NLB A;  7ICF A;  5G5H A;  3C5F A;  4PZN A;  9ICF A;  1NJZ A;  2YML A;  4EEK A;  2MUT A;  2KOB A;  4CGZ A;  2FMP A;  1BPB A;  2NRZ A;  1N63 A;  3IRU A;  3FC4 A;  3TAD A;  2EAM A;  1Z19 A;  3PY8 A;  5DQI A;  5KFV A;  2PKE A;  2ZJA A;  5AKL A;  3KTQ A;  1XSN A;  2MRL A;  2ZIU B;  2Y0S C;  5L1K A;  4FO6 A;  4M9H A;  3MGV A;  4CE6 A;  2HOF A;  1ECW A;  2E5S A;  7ICI A;  4EYI B;  2QB0 B;  3MR3 A;  1LB2 B;  3HPO A;  3MGH A;  2JGA A;  2Y0S F;  5HML A;  4KLO A;  7ICV A;  4IRK A;  2MAX A;  3ZDE A;  3ONN A;  4AP9 A;  1A6S A;  4TQR A;  5F9N A;  1B43 A;  4KLM A;  4XRH A;  3QZ7 A;  5AM3 A;  8ICN A;  4IQU A;  2R18 A;  1SV0 A;  4DQQ A;  2B0C A;  3IDW A;  5J0Y A;  3C2K A;  3F5E A;  2KP7 A;  4IS7 A;  1GO3 F;  4IR9 A;  2PI4 A;  2ZIV A;  3BZC A;  4MHV A;  1ARO P;  2YX8 A;  3RTV A;  3UXP A;  8ICA A;  4QJF B;  5KFD A;  3SI8 A;  4YMN A;  2JZB B;  1X42 A;  1U48 A;  2BCS A;  3BQT A;  3ED5 A;  1DGJ A;  1O03 A;  2O6K A;  2ASJ A;  2JR5 A;  3PW5 A;  3OHA A;  1Q3U A;  8ICV A;  5KFP A;  1RG6 A;  5A0L A;  3KOO A;  2IOH A;  2F8L A;  1L7O A;  4UAT A;  1F0M A;  1HJP A;  2GO7 A;  4EYH B;  5BOM A;  4J9S A;  1N56 A;  5IIO A;  3CRX A;  2W7P A;  1S10 A;  3H0L B;  3WU2 U;  2FJ6 A;  4F4W A;  1NK4 A;  3J81 j;  1ZD3 A;  2F8K A;  2HDO A;  1ZYQ A;  4NV0 A;  7ICH A;  3CNH A;  3TAD C;  2PFQ A;  2JRZ A;  4RPX A;  3AN1 A;  5KT4 A;  5KFN A;  2E8P A;  1QSS A;  4I2C A;  7ICP A;  1ZJM A;  4RNO A;  5D46 A;  1SB3 C;  1C7Y A;  5K4L A;  3ALR A;  1A76 A;  3NVW A;  2XCP A;  2W03 A;  1S76 D;  2M9N A;  1ZQV A;  4BUG A;  2C22 A;  4I2A A;  2ZUD A;  5DB6 A;  1HEK A;  1XSP A;  1YZ6 A;  2AGP A;  4I2F A;  1COK A;  3UMB A;  3SQI A;  1ZJN A;  4Z6F A;  1NK0 A;  2CN1 A;  3I28 A;  3H4B A;  2K8A A;  3OTQ A;  3SZ2 A;  5AKG A;  2KIV A;  2WF9 A;  1NZP A;  3RRG A;  3GDX A;  4DL4 A;  1RQN A;  2AGQ A;  5C0Y A;  2FI1 A;  1NKB A;  2GH1 A;  3RB4 A;  2XO7 A;  3MAB A;  4DFK A;  4B9T A;  4O5E A;  3LWL A;  4J9P A;  2VJ4 A;  1ZQO A;  3C5G A;  5CP2 A;  4B9N A;  4C7Y A;  3C2M A;  1PVR A;  4CDG A;  5KG6 A;  4BWM A;  2DBY A;  4ECZ A;  9ICA A;  1FFV A;  3TAN A;  4NM1 A;  4KLH A;  9ICX A;  3BQ2 A;  2MA1 A;  5EE9 A;  2G08 A;  1BPE A;  4QZ8 A;  3Q8M A;  4JK1 A;  9ICC A;  5ALO A;  2K89 A;  4R66 A;  3T5H A;  2LYA A;  3RJK A;  3JPN A;  1UT8 A;  4P4M A;  1FIQ A;  3N7S C;  1NK6 A;  3ZDC A;  3IG5 A;  5KFJ A;  4KLT A;  2G06 A;  5ALR A;  2KKV A;  5HHI A;  2PI5 A;  2G5I B;  5CA7 A;  4TUR A;  3ISD A;  2E8N A;  5J0T A;  3GIM A;  1AQ6 A;  2FE9 A;  4DOA A;  4MFC A;  1U47 A;  1ZQJ A;  5J2F A;  2Y9T A;  4BJQ A;  4PZO A;  2LBO A;  3PW2 A;  2ASL A;  2ZIW B;  1A0P A;  7ICG A;  1UPH A;  3SAG A;  4F71 A;  5F9L A;  2YB1 A;  3QZ8 A;  4J9N A;  1SKS A;  5CJ7 A;  3EUB 2;  4YN4 A;  1ZD2 P;  4Y2X A;  5JRT A;  4K4G A;  4P0Q A;  1C20 A;  1RQL A;  5D4B A;  5KFI A;  1NI3 A;  3M9O B;  4ED2 A;  3BQ1 A;  2EAN A;  1S8O A;  2DFL A;  1ZQQ A;  4DSK A;  1ZQF A;  1Z00 A;  1J2M A;  5TIS U;  3F53 A;  5ALQ A;  4R8U A;  3F2D A;  1ZQW A;  3MDC A;  4QWD A;  2I5H A;  5KFE A;  1JX4 A;  3RB0 A;  2GWS A;  3EW9 A;  5EOZ A;  2K4P A;  4NL9 A;  1JIH A;  2E8O A;  4MFA A;  3LVW A;  5J8Y C;  2ISP A;  2CPR A;  2HHU A;  1LV5 A;  5AK5 A;  2VA3 A;  5KFG A;  5ALV A;  2WHE A;  4YR0 A;  3PNC A;  3TAR A;  1DK3 A;  3N7R C;  4RT2 A;  3F5A A;  5HR7 A;  3ZD9 A;  3I1Y A;  1OW5 A;  3PR4 A;  4ED3 A;  2R8K A;  4G9B A;  5J0O A;  3NRZ A;  2NO5 A;  3H8W A;  5HMM A;  2BR0 A;  4Q44 A;  1Q46 A;  1L8L A;  2UVV A;  5AIB A;  5AI9 A;  5AIA A;  4R65 A;  2HVH A;  3FYH A;  4UQG A;  3AU2 A;  5J2A A;  1UA0 A;  3SEI A;  1JAL A;  4ZOH C;  8ICR A;  2FPL A;  5IIN A;  2IHN A;  4XA5 A;  3G6Y A;  3RJH A;  3KHG A;  2UVW A;  5AI6 A;  1SWW A;  1BGX T;  2BCR A;  1ZQU A;  5DGB A;  4I27 A;  5III A;  4NJ8 A;  4QZG A;  5DB9 A;  8ICZ A;  2BQU A;  1K1S A;  5KTQ A;  1SKW A;  2RDJ A;  4YG2 A;  4QZ9 A;  2BDP A;  3SR6 A;  1TV9 A;  8ICJ A;  4DOC A;  3UMC A;  1WCN A;  1ZQY A;  1TKD A;  4ED8 A;  3ZD8 A;  2ALZ A;  3PX4 A;  2RQ5 A;  4Y2V A;  5KFZ A;  4MF2 A;  4DO9 A;  3NTU A;  1X9S A;  3ZDB A;  4QZC A;  4NL9 C;  1KFT A;  1CUK A;  2KEY A;  2H3Z A;  2H5X A;  4KLE A;  4C4R A;  4JWM A;  3FDS A;  3ISC A;  2PFN A;  3B0Y A;  3UPQ A;  4O9M A;  5IIJ A;  4EZ9 A;  1KRP A;  2WF5 A;  3N97 B;  1LKY B;  4ED1 A;  3N28 A;  3M9N B;  4Q8E A;  3F2B A;  1SL2 A;  2JEI A;  4LZG A;  1WWU A;  1JXE A;  2ZJ8 A;  1X40 A;  1JXL A;  4QZI A;  4KLQ A;  2F3N A;  3HWT A;  3E2E A;  4PH5 A;  2XGQ A;  5DBB A;  4ECX A;  5DDY A;  1XO1 A;  2ESE A;  4F50 A;  4IQV A;  9ICK A;  2J6U A;  2YTU A;  3QXG A;  2W54 A;  3WK4 A;  9ICQ A;  4DQR A;  4ECV A;  2D6F C;  1ZQM A;  4Q8F A;  3O0F A;  3MDA A;  1KTQ A;  4UW9 A;  3H8M A;  2AHO B;  2K8B B;  2KSO B;  3NVY A;  2ZTC A;  3A0B U;  4DOB A;  2W9B B;  4GC7 A; 
#chains in the Genus database with same CATH homology
 4Z6E A;  3C2K A;  5J0X A;  4QZA A;  5J2J A;  4M2Y A;  2KP7 A;  4RPY A;  3RJI A;  4KLS A;  1BPY A;  9ICB A;  4UB1 A;  8ICA A;  3UXP A;  4PGY A;  2PFP A;  4YMN A;  4O5K A;  5J29 A;  2BCS A;  4JWN A;  3HW8 A;  7ICE A;  1ZQK A;  8ICV A;  8ICQ A;  4I2J A;  7ICJ A;  7ICN A;  4KLG A;  3AUO A;  5BOM A;  4M0A A;  4UB4 A;  8ICM A;  5IIO A;  9ICH A;  8ICL A;  4F5O A;  3B0X A;  1BPD A;  7ICH A;  2PFQ A;  8ICT A;  4RPX A;  3UXO A;  9ICE A;  4KLI A;  4I2C A;  7ICP A;  1ZJM A;  1HUZ A;  4NM2 A;  1RZT A;  2I9G A;  5D46 A;  4I2G A;  9ICL A;  2BCV A;  4QZB A;  4UB2 A;  7ICL A;  3MGI A;  8ICH A;  4NLZ A;  4K4I A;  4F5Q A;  4I2A A;  1JMS A;  5DB6 A;  8ICW A;  1XSP A;  3RH6 A;  3UQ0 A;  4RPZ A;  4I2F A;  8ICK A;  4YCX A;  2PFO A;  1ZJN A;  4IQW A;  4Z6F A;  4F5N A;  3RJE A;  2BPF A;  1NZP A;  3GDX A;  1MQ2 A;  7ICK A;  4RQ0 A;  4LZD A;  4O5E A;  1ZQO A;  3C5G A;  4X5V A;  3C2M A;  5J0U A;  4KLD A;  8ICX A;  5J0W A;  4RQ3 A;  9ICA A;  1ZQI A;  4NM1 A;  4KLH A;  7ICR A;  4I2H A;  9ICX A;  3V72 A;  4LVS A;  1BPE A;  4QZ8 A;  3TFS A;  4RQ4 A;  5IIL A;  9ICC A;  1ZQG A;  5J0P A;  4R66 A;  5HHH A;  3RJK A;  8ICG A;  3JPN A;  8ICY A;  5J0S A;  9ICU A;  3UQ2 A;  2BCQ A;  4PHP A;  4KLT A;  3TFR A;  4Z6D A;  5HHI A;  4NY8 A;  5IIM A;  4TUR A;  3ISD A;  5J0T A;  4PPX A;  4Z6C A;  8ICO A;  5DBA A;  4DOA A;  4KLF A;  3MBY A;  4MFC A;  1ZQJ A;  5J2F A;  4RQ7 A;  3JPS A;  2BPG A;  4K4H A;  3HX0 A;  8ICB A;  7ICT A;  7ICG A;  8ICP A;  3PMN A;  4UAY A;  1ZQC A;  1ZQH A;  4GXK A;  4QZH A;  5TZV A;  4YN4 A;  4PHA A;  1ZQD A;  4M9J A;  2W9M A;  4QZE A;  4K4G A;  4IQT A;  5D4B A;  4M9L A;  4UAZ A;  5CWR A;  4TUQ A;  9ICG A;  3JPR A;  3RJF A;  2P66 A;  1ZQQ A;  2FMQ A;  7ICM A;  4YD1 A;  1ZQF A;  9ICR A;  9ICO A;  3JPP A;  4MFF A;  3MDC A;  7ICU A;  2FMS A;  4I2B A;  2GWS A;  3RJG A;  4M04 A;  4KLJ A;  5EOZ A;  1ZQA A;  7ICQ A;  3RJJ A;  9ICT A;  1ZQS A;  5J2C A;  1HUO A;  4M9G A;  4MFA A;  9ICI A;  2ISP A;  4YMM A;  9ICS A;  4MF8 A;  4KLL A;  1ZQP A;  3PML A;  3PNC A;  8ICE A;  8ICU A;  1ZQE A;  1DK3 A;  4M9N A;  4GXI A;  4RT2 A;  4GXJ A;  8ICF A;  8ICC A;  4RQ2 A;  1DK2 A;  1ZQR A;  3V7L A;  4UBC A;  3V7J A;  9ICM A;  5J0R A;  5J0O A;  1ZQL A;  9ICP A;  3RH4 A;  9ICW A;  5DB7 A;  3C2L A;  3RH5 A;  4R65 A;  3JPO A;  2IHM A;  3AU2 A;  5J2A A;  5J2G A;  3OGU A;  4RQ1 A;  4UB3 A;  3UXN A;  8ICR A;  5IIN A;  4XUS A;  4XA5 A;  3RJH A;  4PHE A;  4RQ8 A;  5IIK A;  1KDH A;  2BCR A;  9ICJ A;  3V7K A;  4NLN A;  4I27 A;  5III A;  5J2B A;  4F5P A;  5DKW A;  4QZG A;  5BPC A;  5DB9 A;  8ICZ A;  4RT3 A;  4QZD A;  4UAW A;  1ZQN A;  1BPZ A;  4QZ9 A;  5DBC A;  5J0Q A;  3AU6 A;  1TV9 A;  5J2H A;  4NXZ A;  8ICJ A;  4DOC A;  9ICN A;  1MQ3 A;  4P2H A;  5CB1 A;  5J2I A;  4KLU A;  1BNP A;  9ICV A;  7ICS A;  4I2D A;  4PHD A;  1TVA A;  4MF2 A;  4DO9 A;  4YMO A;  1XSL A;  1BPX A;  4QZC A;  5DB8 A;  3JPQ A;  1BNO A;  7ICF A;  2ISO A;  3C5F A;  9ICF A;  8ICS A;  4KLE A;  4JWM A;  3ISC A;  2PFN A;  3B0Y A;  4RQ6 A;  4YD2 A;  3UPQ A;  1ZQB A;  2FMP A;  4O9M A;  5IIJ A;  4R64 A;  7ICO A;  5J2K A;  8ICI A;  4PGQ A;  4UBB A;  4LZG A;  1KEJ A;  4QZI A;  4TUS A;  3LK9 A;  2BCU A;  1XSN A;  4KLQ A;  3HWT A;  5J2D A;  4TUP A;  4PH5 A;  5DBB A;  5DDY A;  4M47 A;  4FO6 A;  4M9H A;  4IQV A;  9ICK A;  4QZF A;  4UB5 A;  4O5C A;  3JPT A;  7ICI A;  3ISB A;  5D49 A;  5J2E A;  4PGX A;  3MGH A;  4I28 A;  9ICQ A;  4KLO A;  7ICV A;  1ZQM A;  4RQ5 A;  4F5R A;  4R63 A;  3MDA A;  2PXI A;  1ZQT A;  4NLK A;  5BOL A;  4KLM A;  4I2E A;  4I29 A;  8ICN A;  4IQU A;  4DOB A;  4I2I A;  5J0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...