2KP7A

Solution nmr structure of the mus81 n-terminal hhh. northeast structural genomics consortium target mmt1a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
80
structure length
80
Chain Sequence
RPLPVCPNPLFVRWLTEWRDEAASRGRHTRFVFQKALRSLQRYPLPLRSGKEAKILQHFGDRLCRMLDEKLKQHLASGGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure and DNA binding mode of the Mus81 n-terminal helix-hairpin-helix domain
rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Crossover junction endonuclease MUS81
total genus 25
structure length 80
sequence length 80
ec nomenclature ec 3.1.22.-:
pdb deposition date 2009-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 2kp7A01
5IIIA 4MFCA 4R66A 4M0AA 4YCXA 2BCQA 3PMNA 1ZQSA 4PHDA 4MF2A 5D4BA 3RJIA 5J2DA 3RJHA 2BCSA 4TUSA 7ICQA 8ICKA 4DOAA 4IQTA 4O5KA 4M9JA 4YMMA 7ICOA 4PH5A 2PFOA 7ICJA 4KLHA 4MFAA 1ZQEA 4IQUA 4NM2A 4KLMA 5J2EA 4F5OA 3C2MA 4PHAA 5J2KA 8ICQA 3UQ0A 2P66A 1JMSA 5J0RA 2BCUA 4RT3A 2ISOA 4QZGA 3C5GA 4O5CA 4QZ9A 3RJFA 8ICBA 1XSPA 7ICUA 4M9LA 4PGYA 4YMNA 4I2AA 3UXNA 5DB9A 3PNCA 4UBBA 4UB2A 1DK2A 4LZGA 5J0WA 3V72A 5DDYA 1BNPA 4YN4A 2PFNA 4NLZA 4PPXA 4RQ4A 5DBAA 4KLTA 3UXOA 4QZDA 3JPPA 4K4HA 3ISBA 4I2IA 4JWMA 3B0XA 9ICOA 4QZAA 5DB6A 1ZQCA 5J0PA 8ICLA 4I2DA 2IHMA 3UPQA 9ICBA 4NM1A 4DOBA 9ICRA 5J2HA 4PGQA 1ZQJA 5J29A 2PFQA 5IIKA 4RPXA 1ZQIA 5TZVA 3OGUA 4NXZA 3V7LA 8ICZA 7ICNA 1KDHA 4O9MA 4RPYA 8ICFA 3C2LA 1HUOA 3AU6A 4IQVA 5J2FA 8ICRA 4K4GA 1ZJNA 1XSLA 8ICUA 4NY8A 5J2AA 2BCVA 8ICNA 3AU2A 7ICVA 4MFFA 9ICSA 9ICAA 5J2BA 5IIMA 4QZEA 5EOZA 1RZTA 4IQWA 5IIOA 1TVAA 1ZQDA 4UBCA 3MGIA 9ICCA 4RPZA 3RH6A 5J0UA 3UQ2A 4RT2A 5IINA 4KLOA 1BPYA 2PFPA 3RH5A 4I2EA 4UAZA 8ICPA 3MBYA 8ICWA 9ICFA 4I2HA 5DKWA 3HW8A 3B0YA 4QZ8A 4F5NA 4PGXA 1KEJA 5BOMA 3MGHA 5J0TA 3C2KA 4UB1A 9ICKA 5J2JA 1DK3A 7ICLA 9ICIA 9ICGA 5D49A 3GDXA 5J2CA 1ZQOA 3TFRA 4I29A 3AUOA 5J0SA 8ICTA 4R64A 4RQ3A 1BPEA 3RJKA 3JPTA 4M04A 4KLLA 1ZQLA 4UB3A 2FMPA 4UAYA 3ISDA 8ICJA 4TUQA 8ICCA 4KLGA 5HHIA 1ZQRA 4GXIA 4Z6CA 8ICVA 1NZPA 1ZQTA 2KP7A 7ICPA 9ICEA 1BPXA 5IILA 4GXKA 7ICFA 7ICSA 4RQ5A 5DB8A 3RH4A 7ICIA 1ZQPA 7ICGA 3V7JA 3LK9A 3MDCA 1ZQKA 4RQ0A 8ICHA 3ISCA 4KLJA 4X5VA 8ICIA 4YMOA 5BPCA 4FO6A 8ICAA 4Z6FA 4M9GA 5BOLA 4DOCA 4YD1A 3V7KA 8ICGA 5DB7A 2BPGA 3RJJA 2BCRA 5J0QA 4UAWA 8ICMA 4XA5A 4I2CA 7ICTA 9ICLA 3TFSA 1ZQGA 4R63A 1BNOA 4I28A 4YD2A 2PXIA 3JPNA 9ICPA 4Z6DA 2GWSA 4KLQA 9ICVA 3JPQA 7ICKA 4QZBA 5J0OA 5J2GA 4RQ1A 4QZCA 4UB4A 5J0YA 4F5QA 4JWNA 4M9NA 3HX0A 4P2HA 8ICXA 1ZJMA 4I27A 7ICRA 5D46A 8ICOA 2I9GA 7ICMA 4KLIA 5J0XA 5CWRA 4M2YA 3JPRA 4QZFA 4NLKA 4RQ2A 9ICHA 4O5EA 1ZQQA 4RQ6A 9ICUA 9ICMA 7ICHA 9ICWA 4KLEA 4PHPA 4MF8A 4KLDA 4R65A 1ZQHA 3RJGA 2BPFA 5HHHA 1ZQFA 4XUSA 4UB5A 4TURA 4PHEA 3PMLA 9ICNA 4I2BA 8ICSA 2ISPA 1BPZA 3RJEA 8ICEA 4KLUA 4I2FA 1XSNA 9ICTA 3JPSA 4F5PA 4KLSA 2FMQA 3JPOA 1ZQAA 5DBBA 4QZHA 3UXPA 5IIJA 5DBCA 1HUZA 7ICEA 4NLNA 4K4IA 5CB1A 1ZQBA 4KLFA 1ZQNA 9ICXA 1BPDA 4I2JA 4Z6EA 4QZIA 1ZQMA 4TUPA 4DO9A 2FMSA 1MQ3A 5J2IA 2W9MA 4M9HA 1TV9A 9ICQA 3HWTA 4GXJA 4F5RA 9ICJA 4RQ7A 4LVSA 4M47A 3MDAA 4RQ8A 3C5FA 8ICYA 4I2GA 4LZDA 1MQ2A
chains in the Genus database with same CATH superfamily
5IIIA 4MFCA 4R66A 5ALTA 1TE2A 3BQ1A 4M0AA 3PSFA 2I1QA 5KFCA 4TQRA 1H38A 5AKYA 2HW3A 3UMBA 5AIBA 2HOIA 4MF2A 2DL0A 4KMUA 7ICQA 2YB4A 4DL3A 3N4MB 4YMMA 4PH5A 2ZXHA 2WF6A 1B0XA 4MFAA 1S8OA 2WAQC 2C2RA 4NM2A 1S0NA 4PHAA 4U6PA 2AGQA 2WB1C 5EWGA 3EZ5A 2AHOB 1Z3EB 2BCUA 2K8CB 1FIQA 4ED8A 5JRTA 1NK0A 3H4BA 4QZ9A 8ICBA 5A0LA 4O3NA 1D9DA 4BX9C 3IDWA 2OEHA 4I2AA 5KG3A 4F92B 3ZDAA 3WKBA 3I76A 4ED0A 4QWCA 3T5LA 2WF8A 3QX7A 4ECVA 2IOFK 4QWEA 5KFIA 3V72A 5ALHA 4J9NA 3RB0A 3CNHA 4DWIA 2KKVA 5DDYA 5EE3A 3PR4A 1JALA 2ZTDA 1JUDA 4ECTA 4YP3A 3R9KA 2MUTA 4DF8A 3KKAA 3JPPA 3T3FA 5L1JA 1NK8A 4UQGA 3D2NA 4I2IA 3ZDCA 4DSFA 5ALIA 1B43A 3NVYA 3IRUA 4JK1A 4QJFB 3TI0A 1ZETA 3IM1A 4DOBA 4IRKA 4IR9A 5J2HA 5J29A 1ZQJA 2PFQA 5KT7A 3RB4A 2FDRA 3QU9A 5KFFA 1K1SA 2F2AB 5AIAA 4C8MA 3QUTA 1L8LA 2BPCA 4RPXA 3BJYA 2LYBA 2KNJA 3QZ8A 3MR6A 3OGUA 2C2EA 3ONNA 3V7LA 1O08A 3O0FA 1V85A 5ALRA 4ZOHC 3VCBA 1PK3A 2W55A 3H7IA 2FLPA 3AU6A 1KFTA 3FDSA 2LM1A 5ALEA 3SV3A 1ZJNA 5ALUA 2EH9A 1XSLA 5DLFA 2BCVA 8ICNA 2OXOA 5AM5A 4NL9A 5KFRA 4C4RA 4QZEA 5KT3A 2KJ5A 1A77A 1RM6C 4DL2A 3TARA 3M7DA 1ZQDA 1DOQA 4UBCA 3WK4A 3MGIA 1L6NA 5KFAA 3WKDA 3CP8A 2BHNA 5L9XA 4O3QA 3T79A 1DRGA 1SKRA 2HCFA 2PFPA 2AGPA 3ZD9A 2YMQA 1S0VA 8ICPA 1WWVA 2NO5A 1NK9A 2DF4B 3TQ1A 8ICWA 2W7PA 4CNQA 2R8IA 4F5NA 2HHVA 1KEJA 5BOMA 3MGHA 4DQPA 2G08A 3ORYA 2WF7A 1V38A 3ED5A 4NV0A 2ZUCA 3UMGA 3RAXA 3TFRA 5J0SA 3AUOA 2OHFA 1JIHA 4UB6U 3L3FX 5DDMA 4RQ3A 1BPEA 4G9BA 2AQ0A 2KTQA 4M04A 4UW9A 4QWDA 5DGAA 4CF3A 1J2NA 3E58A 3GU3A 2KZZA 3ICXA 5DQHA 4TUQA 8ICCA 3PSPA 5HHIA 2OM6A 2HOFA 1NZPA 5HP4A 1ZQTA 1HJPA 2KP7A 5GTHU 7ICPA 2FLNA 2KE7A 4C8OA 2K4EA 2FPKA 4FFDA 3ZI4A 5CA7A 2RQ5A 1S5LU 2Y9UA 1ZQKA 4F71A 3ISCA 1BVSA 5BPCA 4FO6A 2K8BB 5KT5A 4Z6FA 3AQFA 4EEKA 4OO1J 2AH5A 2EAMA 3V6KA 1ECWA 2D3DA 3VC8A 1MSWD 4KITB 1RPLA 5DQIA 5J0QA 2EAPA 4I2CA 1RDFA 3PSTA 9ICLA 2YMMA 1ZQGA 2HDOA 2HBKA 2MUTB 2HVIA 9ICPA 3QXGA 1OUQA 1V9PA 1V97A 5AK5A 9ICVA 2PKEA 3JPQA 7ICKA 1X66A 1SIJA 1TAUA 5KFHA 4UB4A 5EE0A 4QNLA 4P2HA 1CRXA 4I27A 7ICRA 5D46A 8ICOA 4O3PA 7ICMA 4KLIA 4MHVA 1RYSA 4RUAA 2FE9A 4Q43A 4M2YA 3OSNA 4O3MA 3Q8PB 4QZFA 5B5EU 5KFOA 3PW4A 4NLKA 1ZQQA 5EWFA 9ICMA 4PHPA 5CRXA 2KEYA 4Y2SA 2C28A 1WCLA 1IM4A 3OSPA 2HVHA 4B9NA 1D9FA 4R65A 2LBOA 1TK0A 5ALOA 2ZIVB 1UHUA 1TK5A 3MFIA 1ZQHA 2BQ3A 5AM3A 3QU5A 4C8NA 4C4TA 3HRDD 4ECSA 3SAFA 4PZOA 1NK4A 1S10A 4TURA 4UB5A 3SR6A 4PHEA 5ALFA 1L7PA 3Q8QB 2Q4TA 3H8MA 2VANA 2DQNB 3M9NB 1T3NA 4IRDA 8ICSA 3RJEA 4IC9A 2JEGA 3NRZA 5AK6A 2HMXA 1XSNA 1IIPA 1JROA 4M6WA 3PX4A 2FMQA 2UVWA 4P0PA 4A8EA 1ZQAA 4F4KA 5DBBA 4QZHA 1FO4A 2BR0A 5IIJA 1HUZA 3LYSA 3DDHA 3RTVA 4KLFA 2E8OA 1BPDA 5J8YA 1ZQMA 4TUPA 4DO9A 3RF9A 3PR5B 3MR2A 2ZG6A 5ALWA 4F5RA 9ICJA 4PL1A 4M47A 4C7YA 4XRHA 3C5FA 2W9AA 2E1EA 3PW0A 1SGGA 3KOOA 3AMZA 4OJLA 4YCXA 2BCQA 5G5GA 4PL2A 4B9UA 1URJA 2ALZA 5J2DA 3BDPA 4TUSA 1SL2A 2G06A 4FBUA 4O5KA 4UAUA 1UQVA 3TKAA 7ICOA 3C21A 3GV5B 4EBCA 1XNSA 4IQUA 3IHQB 4KLMA 1YZ7A 1YT3A 3ETLA 3HKZF 1N61A 4US9A 4YR0A 3UQ0A 8ICQA 2JEIA 4Q8EA 2V4RA 2P66A 1JMSA 2XIDA 1X9XA 2ISOA 4DS4A 4O5CA 1QQ6A 4EYIB 4MEYA 2H5XA 4IL6U 2AJQA 3UXNA 3K1ZA 5DB9A 3H8SA 3PNCA 5AKKA 2JZBB 2GLEA 4QWBA 2P6UA 4KX3A 4UB2A 1KN5A 4LZGA 4UARA 5J8YC 4J9PA 2NRWA 2KHQA 4FZNA 2MU2A 1BNPA 2PFNA 5DBAA 4KLTA 3GIJA 3N7RC 1NK5A 2DUYA 1RQNA 2XGQA 2A3VA 1PVPA 3ZDBA 3HJEA 4RU9A 4JWMA 3B0XA 2XY5A 4QZAA 2IOHA 3F53A 3QUBA 2F3NA 1KSPA 3C28A 4NM1A 2AU0A 2VA2A 4Y2QA 3WK8A 4PGQA 2EQYA 1XC9A 1HEKA 1LVHA 1ZOLA 2NV3A 2HHUA 3RB3A 1TAMA 1L7MA 1CI4A 2F8LA 2FJ6A 1ZD2P 2KICA 4KTQA 5ALKA 2P35A 1ZQWA 2E5SA 3WK6A 2ZTEA 8ICZA 3M6ZA 4YR2A 4F93B 2W9BA 2XICA 5ALMA 4DQSA 4IQVA 4JB3A 4B9TA 2Z7JA 3BS5B 1NJWA 7ICVA 3WKEA 2QB1A 3EUB2 2NRXA 2XC9A 5ALDA 5EOZA 4FBTA 1TK8A 1RZTA 3IP4B 4B9LA 4IQWA 2A1JA 1TVAA 2QB0A 3Q8RB 5L1IA 3NASA 4RPZA 1L3TA 5J0UA 1M6YA 3LWMA 4UB8U 4RT2A 2AQ4A 3ALRA 3RH5A 4C80A 3OPXA 3MBYA 4DFDA 2C2DA 1SZHA 2PMZF 4I2HA 4Q8FA 5DKWA 2ZIUB 2GH1A 5DG8A 4PGXA 3NGDA 2XO7A 1F44A 4F2SA 5KFVA 3SQIA 4GC7A 5J2JA 1BPBA 1DK3A 3C29A 7ICLA 2F44A 4DQQA 5D49A 1TAQA 4DFMA 1JN3A 1Z00B 3C23A 5J2CA 2XY7A 5ALXA 4I29A 4R64A 1SWWA 1FFVA 2WF9A 5HMMA 3IG8A 2ZIWA 2WTFA 2CXYA 2ZJAA 3AM9A 3JPTA 2BDUA 4F91B 2D6FC 2E1FA 4J9QA 1XO0A 4UB3A 2FMPA 4DSIA 3A0HU 4UAYA 8ICJA 2DGZA 2KHVA 3GFKB 5CHGA 4F3OA 1ZQRA 3QUCA 4GXIA 4EEYA 2W04A 1NK6A 5KNIA 4YXMA 1S9FA 4ED7A 9ICEA 1X40A 2GOLA 7ICFA 4F4YA 2F76X 4P4OA 2KMDA 1A76A 1F5SA 7ICSA 1MN8A 5DB8A 3N7PD 4EX7A 1X42A 4LJXA 3V7JA 2NRVA 3TAQA 4RQ0A 2HSZA 4AYBC 1ZQUA 3F5AA 5AI4A 2K4PA 5KFZA 2R8KA 5AM0A 1NK7A 4B9MA 1S76D 5BOLA 3BQ2A 2EDUA 4YD1A 2WF5A 3NVWA 1QCKA 1JRPA 2ZUBA 3C1ZA 3IG5A 2KD1A 4UAWA 3FAHA 1KRPA 2RRDA 3KHRA 1U48A 2JXJA 4C0ZA 1X6IA 2ZTCA 4I28A 2CN1A 4Z6DA 1AQ6A 2CPRA 5AK3A 3BZKA 3EPIA 3QE9Y 1UA1A 1KFDA 4F4WA 4IRCA 4RQ1A 5KG5A 2OCEA 5J0YA 4JWNA 5B66U 4NJ8A 4M9NA 3F2DA 4HYKA 3HX0A 2W3RA 2LPEA 3CYMA 2VJ5A 4YVZA 4EX6A 3QNMA 1SWVA 2ES6A 3GILA 4DFKA 2JRZA 3J81j 3N7SC 3JPRA 1HIWA 4UATA 5AM1A 1NKEA 1L3UA 1NKBA 4OJ5A 4RQ2A 2JGAA 1Z4NA 5AM4A 1J2MA 5DLGA 1IG6A 2G09A 2KJ9A 2I6XA 1SXEA 3UM9A 4ECRA 1QTMA 2JV3A 1LKYA 5KFKA 1QLNA 2HHXA 2M0NA 3RJGA 4EELA 2JR5A 1FFUA 2ZXIA 4BWJA 1KW4A 1LV5A 2Y1JA 2QARB 2BPFA 1ZQFA 1Z1BA 4FS1A 2EAOA 4XUSA 4G3IA 2QB0B 4RNMA 3H0LB 1JXLA 1Q46A 4I2BA 4QIWC 4ECWA 4DL4A 5AK4A 1MA7A 3SENA 3OHAA 2DPJA 2KIWA 1EXNA 2Y0SF 4U7CA 4ACOA 5KL1B 4KLUA 1DXSA 5KFEA 4F5PA 2LKYA 1ZQYA 3JPOA 1A6SA 4FZLA 3UXPA 1Q3VA 5DBCA 1ZD4A 7ICEA 4K4IA 3L4PA 2KJ8A 4I2JA 4Z6EA 1U45A 1MQ3A 2YMLA 4M9HA 1TV9A 5KFJA 5T14A 2W9CB 5AKGA 1SB3C 9ICQA 3T5JA 2DPIA 4ELVA 3HWTA 1X9SA 4J9OA 3RAQA 4LVSA 1SXDA 3M8SA 1C20A 3MDAA 4QW9A 4RQ8A 3RR8A 3CW2C 5KAFU 1NJYA 4I2GA 4LZDA 3UMCA 5F9NA 1C7YA 3KHHA 4CDGA 2Y9TA 2YX8A 1QSSA 3EYZA 2HHWA 4CF5A 1DGSA 2GO7A 2BZFA 5KG7A 3PMNA 5AKXA 4YXJA 2VA8A 1ZYQA 4MEXA 4P4PA 5D4BA 2H3IA 2Y1IA 3RJHA 5DGBA 4C4SA 3SV4A 4E0DA 4JV0A 4IQTA 2KSOA 4M9JA 1B4FA 1N62A 2PFOA 7ICJA 3THVA 5HR7A 1ZQEA 1X9MA 4ED2A 1U47A 5AKZA 5KFTA 4F5OA 1QH9A 3DV9A 4USAA 5J0RA 4RT3A 4J9LA 3HKZC 3T5KA 3AN1A 3C5GA 5KFWA 4KMOB 1ZD5A 1XSPA 1X6JA 4M9LA 4YMNA 3G6XA 4UBBA 2W8KA 1U9LA 2O6KA 3D2QA 3H8JA 1RQLA 4DL6A 1DK2A 4IS7A 4P0PB 5J0WA 4GC6A 2QKQA 4ICAA 4WJ3B 4PPXA 4RQ4A 3F5EA 3WK7A 5C0YA 1U4BA 4DLEA 2LYAA 4O3RA 3UXOA 2ASDA 4K4HA 1SZPA 9ICOA 5L1KA 3K4GA 5J0PA 2G0AA 2J6TA 1NJZA 4CE6A 1CEZA 9ICRA 4DSEA 4KN4A 2XY6A 5IIKA 2R8HA 3OTQA 5KTQA 5CEHA 1IXRA 4DS5A 2KOBA 5AKEA 3ETRA 5TZVA 4NXZA 5JUMA 1P7DA 2JH1A 3QU7A 1RG6A 4EENA 3SI8A 2I5HA 4B9VA 3BQ7A 2WB1F 4O9MA 4NLBA 4RPYA 8ICFA 4FZMA 2AXTU 5KG0A 8ICRA 4K4GA 1ZD3A 5GTIU 8ICUA 2HBLA 2K8AA 5JU5A 5KFBA 1XU4A 4DSJA 3Q8MA 2N1RA 2R8JA 1XO1A 1QSYA 3TANA 9ICSA 5AM2A 2JEJA 4NL9C 5IIMA 9ICAA 2EZYA 5IIOA 2F1JA 3ZDDA 2K4IA 3EW9A 2BQRA 3RH6A 3PW7A 3F2BA 1KKXA 2RHFA 3UQ2A 3PW5A 3RRGA 5KL8B 5IINA 3D2SA 1BPYA 5KFSA 2PI5A 2VA3A 2RDIA 5KT2A 4YFKA 2K4HA 3QU2A 2H3QA 4RNOA 3H40A 3Q8SB 5KT6A 3QEBZ 3HILA 3H4DA 2FI1A 3NVZA 2VIXA 3KBBA 3D6JA 4OCZA 9ICIA 2BGWA 9ICGA 2G5HB 4BJQA 2V9WA 3LWLA 3RB6A 1SL1A 1ZQOA 2LHTA 4EYHB 8ICTA 1L7OA 5ALVA 3TADC 1UPHA 1ZQ1C 5ALLA 5KFMA 5KAIU 2YTUA 3RJKA 1YZ6A 3OJSA 1Z00A 3ISDA 3I28A 4CCHA 8ICVA 2KG5A 5EE1A 2LYHA 2ZIWB 3H0RB 1JXEA 3MR3A 3RBDA 1BPXA 3GV7B 4GXKA 2C22A 3AEVA 2HHQA 3QUQA 4DL5A 2XGPA 4RQ5A 2F1IA 4J03A 2Q0ZX 1ZQPA 1IV8A 2B0CA 2NYVA 2E8PA 7ICGA 4JUZA 4DSLA 4YR3A 2ZIXB 3MDCA 3MFHA 8ICHA 4F8RA 8ICIA 2RLTA 8ICAA 1VDVA 2FLLA 4M9GA 4DOCA 1KFSA 1FEZA 2PMZC 8ICGA 5DB7A 3KD3A 3OHBA 3KZXA 2BCRA 3DEEA 5ALSA 1PK1B 4XA5A 4Q44A 2IOFA 2L5YA 3TFSA 1BNOA 4OJPA 3PX6A 2PXIA 2VJ4A 4Y2TA 3N97B 3LDAA 2ZJ5A 2KK0A 4PZNA 4KLQA 5HMLA 2W9BB 5AI0A 5AI9A 5CJ7A 4QZCA 2W8LA 2FPLA 4F5QA 3Q8KA 4RZRA 2YB1A 4B6JA 1ZJMA 3RFAA 2CRXA 1D8LA 3BQTA 2I9GA 3SAGA 3GIMA 5KFPA 4FS2A 1WWUA 1KTQA 1RXVA 2ODGA 5EE9A 1K5OA 4EZ6A 3SYZA 1L7NA 1Y88A 9ICUA 2ZIUA 3PVXA 5DG7A 1UT8A 4KLEA 4J9KA 1XWLA 3K1RB 4MF8A 1JI7A 4DLGA 1GO3F 3RBEA 2VKQA 5KFGA 5EWEA 2ZIVA 3SAHA 1O03A 5ALNA 2W3SA 4DFPA 4PJ0U 2MAXA 1CUKA 1NNLA 1Q3UA 4F72A 1QQ7A 3MC1A 1K1QA 3QEAZ 1PVRA 2ZUDA 2JZBA 5CP2A 2LI6A 1Z4OA 1N63A 8ICEA 1T8EA 2KFZA 4BGDA 1ZQXA 4ED1A 1ZQZA 4I2FA 3LVVA 1DGJA 5H2FU 4OD0A 4Y2VA 2NRTA 2W7OA 5AHXA 5CB1A 1ZQBA 3G6VA 2MRLA 4ECZA 2FMSA 3RRHA 1PK1A 1KQQA 4GXJA 4HAIA 4RQ7A 2IMWP 3KHLA 2JEFA 8ICYA 3Q8LA 1SL0A 4F50A 2B21A 1D8YA 4QWAA 1N5XA 5DQGA 2MA1A 2RP5A 1OW5A 4Q45A 3NVVA 2HBMA 2H3VA 1SV0A 1ZQSA 2F8KA 4PHDA 4O3SA 3GIKA 3RJIA 3OJUA 3G6YA 2BCSA 2ZIXA 8ICKA 4DOAA 2FPMA 3PW2A 1UA0A 5AI8A 3TACB 4QW8A 4KLHA 3GIIA 3MABA 2F1HA 2XCPA 5J2EA 4ED3A 2E8NA 4OJ6A 3C2MA 2KN7A 5J2KA 4O0IA 3PO4A 1Q8KA 3NUQA 3TADA 2JHDA 3CRXA 4IR1A 1AROP 4QZGA 2J6UA 3GV8B 3GQCA 4Y2PA 1QSLA 3M9MB 3RJFA 4TQSA 2G5IB 2G07A 5ALZA 4DSKA 7ICUA 4PGYA 5KFLA 1S0OA 2HOQA 3PO5A 4CRXA 5ALPA 4DCCA 5KG6A 1L3SA 4BXOA 4J9RA 3SMVA 2KV2A 4C7ZA 2IBKA 2MSNA 4M6WB 2EZZA 3MGVA 4EZ9A 3WKCA 5KG2A 4YN4A 4NLZA 1F0MA 4KX5A 2Y0SC 4UASA 2W11A 1SV0C 1T94A 4QZDA 3WK5A 1OXJA 2KIVA 5F3XB 5JTIA 4Y2YA 3ISBA 1SKSA 3HP6A 1S0MA 5DB6A 1ZQCA 8ICLA 4I2DA 2IHMA 1T4GA 4JV1A 3UPQA 9ICBA 4F4ZA 2KKPA 4BWMA 4FE3A 3NTUA 2ZJ8A 4ELTA 1PUZA 1UT5A 3QZ7A 5KFNA 3LVWA 1N5WA 3B9JA 2ASLA 3KHGA 1ZQIA 4OJOA 3PX0A 2DFLA 5KFXA 1X9WA 4GIBA 3SZ2A 3NS1A 1COKA 3ZD8A 3WU2U 4NLCA 7ICNA 1KDHA 2W9CA 3C2LA 1HUOA 5KG1A 2DBYA 4UAVA 2A1AA 5J2FA 2K89A 3SD7A 4NY8A 5J2AA 4RQMA 1T3QA 5KFDA 2YQEA 1NOMA 4JMUA 3AU2A 4MFFA 3TAPA 4P4MA 2ATLA 3T5HA 4F2RA 2XVTA 5J2BA 2UVUA 2WAQF 3HPOA 4QIWF 1JX4A 3MR5A 4ECXA 1B22A 5FP0A 1L5UA 1MC8A 4RUCA 3PY8A 9ICCA 4DFJA 4DQIA 3I1YA 3RR7A 1ED1A 5F9LA 4AYBF 2KSOB 4KLOA 3M6KA 4I2EA 2E8MA 4UAZA 3FC4A 1UCVA 1RYUA 5AICA 4RNNA 9ICFA 2A19A 3HW8A 3B0YA 4QZ8A 2EANA 1N60A 3A0BU 4C8LA 2EZXA 1BGXT 3QYPA 3FYHA 3AQEA 1N56A 3H8WA 5J0TA 2OH2A 3C2KA 4O3OA 1WUDA 4UB1A 2W54A 9ICKA 1Z19A 2B6GA 3WK9A 4NWIA 4ELUA 1D8BA 2AGOA 3GDXA 1NJXA 5L1MA 3M8RA 4BUGA 2IHNA 2M9NA 5AKIA 5AKLA 2OWOA 1L3VA 1WYGA 4KLLA 1LB2B 2H3FA 1NI3A 5AI6A 1ZQLA 3PV8A 2HI0A 2RDJA 2UVRA 4Y2RA 2V4QA 2J6SA 3M1YA 4KLGA 4F4XA 4GLXA 2UVVA 2H3ZA 4Z6CA 1SKWA 3H0MB 4YG2A 2KVCA 5IILA 1N48A 2YY6A 2KZMA 1X2IA 2DKXA 4ECYA 3RH4A 3KZIU 7ICIA 3E2EA 5ALGA 5HNKA 4AP9A 3LK9A 2D8CA 4ED6A 2QARA 5KFQA 4EBDA 4KLJA 4X5VA 1TFRA 3FM9A 1ZRNA 5KG4A 1N2XA 4YMOA 4B9SA 2XI9A 2KFNA 3V6HA 1A0PA 4R8UA 4BDPA 3WKAA 4C8KA 4DL7A 1WG8A 3V7KA 1S97A 4RQNA 3PSIA 3EWAA 2BPGA 3RJJA 4J9MA 2YN4A 4DF4A 1PVQA 8ICMA 1Z1VA 1KBUA 7ICTA 2XCAA 3ZDEA 3GZFA 1U49A 4R63A 2K60A 4P0QB 1KL9A 4YD2A 3JPNA 2WFAA 5ALJA 3EPGA 2HBJA 2GWSA 1NZBA 5K4LA 2IA6A 5AKJA 2LM4A 4QZBA 4Y2UA 4ECUA 2HHSA 5J0OA 5J2GA 2BDPA 3C1YA 3IN5A 5KT4A 3BS5A 1KLNA 8ICXA 3KTQA 5AI5A 5KFYA 4ECQA 2BKEA 4XQ8A 4CGZA 1NKCA 3K75D 1S77D 5J0XA 1QQ5A 5CWRA 4JV2A 2W43A 2NO4A 5ALYA 3U26A 3HT3A 1WCNA 2KZ3A 3PZPA 1COOA 9ICHA 3SEIA 4O5EA 4P0QA 1J97A 1XS9D 1L8OA 4RQ6A 2QLTA 5E79U 1VLBA 4CF4A 7ICHA 4ZH4A 2W03A 9ICWA 3L5KA 3M9OB 3IV6A 2PI4A 3AL0B 1LKYB 4DQRA 2F77X 3F2CA 2HHTA 3BZCA 4Y2XA 1T7PA 1ZQVA 5KFUA 4KLDA 4EBEA 2DWQA 4R8UB 3QU4A 4NLGA 2NRZA 1PZNA 2ESEA 3E0FA 5HR6A 5HHHA 4BXOB 2WHEA 4Y2JA 5AKHA 3PMLA 9ICNA 4US8A 2ISPA 4GFJA 1BPZA 2ASJA 1VJ5A 2LMRA 2E3TA 4YQWA 4DEZA 5G5HA 1RXWA 5DG9A 1RYRA 9ICTA 2JH7A 5ALQA 3BS7A 3JPSA 1TKDA 3KKAC 4KLSA 3N28A 4KN7A 2A1JB 5CR0A 4NLNA 5TISU 2OYYA 2DKZA 1ZXIA 3S6JA 2YMPA 5C5JA 2R8GA 5L1LA 1ZQNA 9ICXA 2P6RA 4J9SA 3NRWA 4QZIA 2KVSA 5J2IA 2W9MA 3KFUF 1SV4A 2BQUA 3BQ0A 3V6JA 1ZRMA 2JMGA 2R18A 1MQ2A
chains in the Genus database with same CATH topology
5IIIA 4MFCA 4R66A 4M0AA 4YCXA 2BCQA 3PMNA 1ZQSA 4PHDA 4MF2A 5D4BA 3RJIA 5J2DA 3RJHA 2BCSA 4TUSA 7ICQA 8ICKA 4DOAA 4IQTA 4O5KA 4M9JA 4YMMA 7ICOA 4PH5A 2PFOA 7ICJA 4KLHA 4MFAA 1ZQEA 4IQUA 4NM2A 4KLMA 5J2EA 4F5OA 3C2MA 4PHAA 5J2KA 8ICQA 3UQ0A 2P66A 1JMSA 5J0RA 2BCUA 4RT3A 2ISOA 4QZGA 3C5GA 4O5CA 4QZ9A 3RJFA 8ICBA 1XSPA 7ICUA 4M9LA 4PGYA 4YMNA 4I2AA 3UXNA 5DB9A 3PNCA 4UBBA 4UB2A 1DK2A 4LZGA 5J0WA 3V72A 5DDYA 1BNPA 4YN4A 2PFNA 4NLZA 4PPXA 4RQ4A 5DBAA 4KLTA 3UXOA 4QZDA 3JPPA 4K4HA 3ISBA 4I2IA 4JWMA 3B0XA 9ICOA 4QZAA 5DB6A 1ZQCA 5J0PA 8ICLA 4I2DA 2IHMA 3UPQA 9ICBA 4NM1A 4DOBA 9ICRA 5J2HA 4PGQA 1ZQJA 5J29A 2PFQA 5IIKA 4RPXA 1ZQIA 5TZVA 3OGUA 4NXZA 3V7LA 8ICZA 7ICNA 1KDHA 4O9MA 4RPYA 8ICFA 3C2LA 1HUOA 3AU6A 4IQVA 5J2FA 8ICRA 4K4GA 1ZJNA 1XSLA 8ICUA 4NY8A 5J2AA 2BCVA 8ICNA 3AU2A 7ICVA 4MFFA 9ICSA 9ICAA 5J2BA 5IIMA 4QZEA 5EOZA 1RZTA 4IQWA 5IIOA 1TVAA 1ZQDA 4UBCA 3MGIA 9ICCA 4RPZA 3RH6A 5J0UA 3UQ2A 4RT2A 5IINA 4KLOA 1BPYA 2PFPA 3RH5A 4I2EA 4UAZA 8ICPA 3MBYA 8ICWA 9ICFA 4I2HA 5DKWA 3HW8A 3B0YA 4QZ8A 4F5NA 4PGXA 1KEJA 5BOMA 3MGHA 5J0TA 3C2KA 4UB1A 9ICKA 5J2JA 1DK3A 7ICLA 9ICIA 9ICGA 5D49A 3GDXA 5J2CA 1ZQOA 3TFRA 4I29A 3AUOA 5J0SA 8ICTA 4R64A 4RQ3A 1BPEA 3RJKA 3JPTA 4M04A 4KLLA 1ZQLA 4UB3A 2FMPA 4UAYA 3ISDA 8ICJA 4TUQA 8ICCA 4KLGA 5HHIA 1ZQRA 4GXIA 4Z6CA 8ICVA 1NZPA 1ZQTA 2KP7A 7ICPA 9ICEA 1BPXA 5IILA 4GXKA 7ICFA 7ICSA 4RQ5A 5DB8A 3RH4A 7ICIA 1ZQPA 7ICGA 3V7JA 3LK9A 3MDCA 1ZQKA 4RQ0A 8ICHA 3ISCA 4KLJA 4X5VA 8ICIA 4YMOA 5BPCA 4FO6A 8ICAA 4Z6FA 4M9GA 5BOLA 4DOCA 4YD1A 3V7KA 8ICGA 5DB7A 2BPGA 3RJJA 2BCRA 5J0QA 4UAWA 8ICMA 4XA5A 4I2CA 7ICTA 9ICLA 3TFSA 1ZQGA 4R63A 1BNOA 4I28A 4YD2A 2PXIA 3JPNA 9ICPA 4Z6DA 2GWSA 4KLQA 9ICVA 3JPQA 7ICKA 4QZBA 5J0OA 5J2GA 4RQ1A 4QZCA 4UB4A 5J0YA 4F5QA 4JWNA 4M9NA 3HX0A 4P2HA 8ICXA 1ZJMA 4I27A 7ICRA 5D46A 8ICOA 2I9GA 7ICMA 4KLIA 5J0XA 5CWRA 4M2YA 3JPRA 4QZFA 4NLKA 4RQ2A 9ICHA 4O5EA 1ZQQA 4RQ6A 9ICUA 9ICMA 7ICHA 9ICWA 4KLEA 4PHPA 4MF8A 4KLDA 4R65A 1ZQHA 3RJGA 2BPFA 5HHHA 1ZQFA 4XUSA 4UB5A 4TURA 4PHEA 3PMLA 9ICNA 4I2BA 8ICSA 2ISPA 1BPZA 3RJEA 8ICEA 4KLUA 4I2FA 1XSNA 9ICTA 3JPSA 4F5PA 4KLSA 2FMQA 3JPOA 1ZQAA 5DBBA 4QZHA 3UXPA 5IIJA 5DBCA 1HUZA 7ICEA 4NLNA 4K4IA 5CB1A 1ZQBA 4KLFA 1ZQNA 9ICXA 1BPDA 4I2JA 4Z6EA 4QZIA 1ZQMA 4TUPA 4DO9A 2FMSA 1MQ3A 5J2IA 2W9MA 4M9HA 1TV9A 9ICQA 3HWTA 4GXJA 4F5RA 9ICJA 4RQ7A 4LVSA 4M47A 3MDAA 4RQ8A 3C5FA 8ICYA 4I2GA 4LZDA 1MQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5III A;  4MFC A;  4R66 A;  4M0A A;  4YCX A;  2BCQ A;  3PMN A;  1ZQS A;  4PHD A;  4MF2 A;  5D4B A;  3RJI A;  5J2D A;  3RJH A;  2BCS A;  4TUS A;  7ICQ A;  8ICK A;  4DOA A;  4IQT A;  4O5K A;  4M9J A;  4YMM A;  7ICO A;  4PH5 A;  2PFO A;  7ICJ A;  4KLH A;  4MFA A;  1ZQE A;  4IQU A;  4NM2 A;  4KLM A;  5J2E A;  4F5O A;  3C2M A;  4PHA A;  5J2K A;  8ICQ A;  3UQ0 A;  2P66 A;  1JMS A;  5J0R A;  2BCU A;  4RT3 A;  2ISO A;  4QZG A;  3C5G A;  4O5C A;  4QZ9 A;  3RJF A;  8ICB A;  1XSP A;  7ICU A;  4M9L A;  4PGY A;  4YMN A;  4I2A A;  3UXN A;  5DB9 A;  3PNC A;  4UBB A;  4UB2 A;  1DK2 A;  4LZG A;  5J0W A;  3V72 A;  5DDY A;  1BNP A;  4YN4 A;  2PFN A;  4NLZ A;  4PPX A;  4RQ4 A;  5DBA A;  4KLT A;  3UXO A;  4QZD A;  3JPP A;  4K4H A;  3ISB A;  4I2I A;  4JWM A;  3B0X A;  9ICO A;  4QZA A;  5DB6 A;  1ZQC A;  5J0P A;  8ICL A;  4I2D A;  2IHM A;  3UPQ A;  9ICB A;  4NM1 A;  4DOB A;  9ICR A;  5J2H A;  4PGQ A;  1ZQJ A;  5J29 A;  2PFQ A;  5IIK A;  4RPX A;  1ZQI A;  5TZV A;  3OGU A;  4NXZ A;  3V7L A;  8ICZ A;  7ICN A;  1KDH A;  4O9M A;  4RPY A;  8ICF A;  3C2L A;  1HUO A;  3AU6 A;  4IQV A;  5J2F A;  8ICR A;  4K4G A;  1ZJN A;  1XSL A;  8ICU A;  4NY8 A;  5J2A A;  2BCV A;  8ICN A;  3AU2 A;  7ICV A;  4MFF A;  9ICS A;  9ICA A;  5J2B A;  5IIM A;  4QZE A;  5EOZ A;  1RZT A;  4IQW A;  5IIO A;  1TVA A;  1ZQD A;  4UBC A;  3MGI A;  9ICC A;  4RPZ A;  3RH6 A;  5J0U A;  3UQ2 A;  4RT2 A;  5IIN A;  4KLO A;  1BPY A;  2PFP A;  3RH5 A;  4I2E A;  4UAZ A;  8ICP A;  3MBY A;  8ICW A;  9ICF A;  4I2H A;  5DKW A;  3HW8 A;  3B0Y A;  4QZ8 A;  4F5N A;  4PGX A;  1KEJ A;  5BOM A;  3MGH A;  5J0T A;  3C2K A;  4UB1 A;  9ICK A;  5J2J A;  1DK3 A;  7ICL A;  9ICI A;  9ICG A;  5D49 A;  3GDX A;  5J2C A;  1ZQO A;  3TFR A;  4I29 A;  3AUO A;  5J0S A;  8ICT A;  4R64 A;  4RQ3 A;  1BPE A;  3RJK A;  3JPT A;  4M04 A;  4KLL A;  1ZQL A;  4UB3 A;  2FMP A;  4UAY A;  3ISD A;  8ICJ A;  4TUQ A;  8ICC A;  4KLG A;  5HHI A;  1ZQR A;  4GXI A;  4Z6C A;  8ICV A;  1NZP A;  1ZQT A;  2KP7 A;  7ICP A;  9ICE A;  1BPX A;  5IIL A;  4GXK A;  7ICF A;  7ICS A;  4RQ5 A;  5DB8 A;  3RH4 A;  7ICI A;  1ZQP A;  7ICG A;  3V7J A;  3LK9 A;  3MDC A;  1ZQK A;  4RQ0 A;  8ICH A;  3ISC A;  4KLJ A;  4X5V A;  8ICI A;  4YMO A;  5BPC A;  4FO6 A;  8ICA A;  4Z6F A;  4M9G A;  5BOL A;  4DOC A;  4YD1 A;  3V7K A;  8ICG A;  5DB7 A;  2BPG A;  3RJJ A;  2BCR A;  5J0Q A;  4UAW A;  8ICM A;  4XA5 A;  4I2C A;  7ICT A;  9ICL A;  3TFS A;  1ZQG A;  4R63 A;  1BNO A;  4I28 A;  4YD2 A;  2PXI A;  3JPN A;  9ICP A;  4Z6D A;  2GWS A;  4KLQ A;  9ICV A;  3JPQ A;  7ICK A;  4QZB A;  5J0O A;  5J2G A;  4RQ1 A;  4QZC A;  4UB4 A;  5J0Y A;  4F5Q A;  4JWN A;  4M9N A;  3HX0 A;  4P2H A;  8ICX A;  1ZJM A;  4I27 A;  7ICR A;  5D46 A;  8ICO A;  2I9G A;  7ICM A;  4KLI A;  5J0X A;  5CWR A;  4M2Y A;  3JPR A;  4QZF A;  4NLK A;  4RQ2 A;  9ICH A;  4O5E A;  1ZQQ A;  4RQ6 A;  9ICU A;  9ICM A;  7ICH A;  9ICW A;  4KLE A;  4PHP A;  4MF8 A;  4KLD A;  4R65 A;  1ZQH A;  3RJG A;  2BPF A;  5HHH A;  1ZQF A;  4XUS A;  4UB5 A;  4TUR A;  4PHE A;  3PML A;  9ICN A;  4I2B A;  8ICS A;  2ISP A;  1BPZ A;  3RJE A;  8ICE A;  4KLU A;  4I2F A;  1XSN A;  9ICT A;  3JPS A;  4F5P A;  4KLS A;  2FMQ A;  3JPO A;  1ZQA A;  5DBB A;  4QZH A;  3UXP A;  5IIJ A;  5DBC A;  1HUZ A;  7ICE A;  4NLN A;  4K4I A;  5CB1 A;  1ZQB A;  4KLF A;  1ZQN A;  9ICX A;  1BPD A;  4I2J A;  4Z6E A;  4QZI A;  1ZQM A;  4TUP A;  4DO9 A;  2FMS A;  1MQ3 A;  5J2I A;  2W9M A;  4M9H A;  1TV9 A;  9ICQ A;  3HWT A;  4GXJ A;  4F5R A;  9ICJ A;  4RQ7 A;  4LVS A;  4M47 A;  3MDA A;  4RQ8 A;  3C5F A;  8ICY A;  4I2G A;  4LZD A;  1MQ2 A; 
#chains in the Genus database with same CATH topology
 5III A;  4MFC A;  4R66 A;  5ALT A;  1TE2 A;  3BQ1 A;  4M0A A;  3PSF A;  2I1Q A;  5KFC A;  4TQR A;  1H38 A;  5AKY A;  2HW3 A;  3UMB A;  5AIB A;  2HOI A;  4MF2 A;  2DL0 A;  4KMU A;  7ICQ A;  2YB4 A;  4DL3 A;  3N4M B;  4YMM A;  4PH5 A;  2ZXH A;  2WF6 A;  1B0X A;  4MFA A;  1S8O A;  2WAQ C;  2C2R A;  4NM2 A;  1S0N A;  4PHA A;  4U6P A;  2AGQ A;  2WB1 C;  5EWG A;  3EZ5 A;  2AHO B;  1Z3E B;  2BCU A;  2K8C B;  1FIQ A;  4ED8 A;  5JRT A;  1NK0 A;  3H4B A;  4QZ9 A;  8ICB A;  5A0L A;  4O3N A;  1D9D A;  4BX9 C;  3IDW A;  2OEH A;  4I2A A;  5KG3 A;  4F92 B;  3ZDA A;  3WKB A;  3I76 A;  4ED0 A;  4QWC A;  3T5L A;  2WF8 A;  3QX7 A;  4ECV A;  2IOF K;  4QWE A;  5KFI A;  3V72 A;  5ALH A;  4J9N A;  3RB0 A;  3CNH A;  4DWI A;  2KKV A;  5DDY A;  5EE3 A;  3PR4 A;  1JAL A;  2ZTD A;  1JUD A;  4ECT A;  4YP3 A;  3R9K A;  2MUT A;  4DF8 A;  3KKA A;  3JPP A;  3T3F A;  5L1J A;  1NK8 A;  4UQG A;  3D2N A;  4I2I A;  3ZDC A;  4DSF A;  5ALI A;  1B43 A;  3NVY A;  3IRU A;  4JK1 A;  4QJF B;  3TI0 A;  1ZET A;  3IM1 A;  4DOB A;  4IRK A;  4IR9 A;  5J2H A;  5J29 A;  1ZQJ A;  2PFQ A;  5KT7 A;  3RB4 A;  2FDR A;  3QU9 A;  5KFF A;  1K1S A;  2F2A B;  5AIA A;  4C8M A;  3QUT A;  1L8L A;  2BPC A;  4RPX A;  3BJY A;  2LYB A;  2KNJ A;  3QZ8 A;  3MR6 A;  3OGU A;  2C2E A;  3ONN A;  3V7L A;  1O08 A;  3O0F A;  1V85 A;  5ALR A;  4ZOH C;  3VCB A;  1PK3 A;  2W55 A;  3H7I A;  2FLP A;  3AU6 A;  1KFT A;  3FDS A;  2LM1 A;  5ALE A;  3SV3 A;  1ZJN A;  5ALU A;  2EH9 A;  1XSL A;  5DLF A;  2BCV A;  8ICN A;  2OXO A;  5AM5 A;  4NL9 A;  5KFR A;  4C4R A;  4QZE A;  5KT3 A;  2KJ5 A;  1A77 A;  1RM6 C;  4DL2 A;  3TAR A;  3M7D A;  1ZQD A;  1DOQ A;  4UBC A;  3WK4 A;  3MGI A;  1L6N A;  5KFA A;  3WKD A;  3CP8 A;  2BHN A;  5L9X A;  4O3Q A;  3T79 A;  1DRG A;  1SKR A;  2HCF A;  2PFP A;  2AGP A;  3ZD9 A;  2YMQ A;  1S0V A;  8ICP A;  1WWV A;  2NO5 A;  1NK9 A;  2DF4 B;  3TQ1 A;  8ICW A;  2W7P A;  4CNQ A;  2R8I A;  4F5N A;  2HHV A;  1KEJ A;  5BOM A;  3MGH A;  4DQP A;  2G08 A;  3ORY A;  2WF7 A;  1V38 A;  3ED5 A;  4NV0 A;  2ZUC A;  3UMG A;  3RAX A;  3TFR A;  5J0S A;  3AUO A;  2OHF A;  1JIH A;  4UB6 U;  3L3F X;  5DDM A;  4RQ3 A;  1BPE A;  4G9B A;  2AQ0 A;  2KTQ A;  4M04 A;  4UW9 A;  4QWD A;  5DGA A;  4CF3 A;  1J2N A;  3E58 A;  3GU3 A;  2KZZ A;  3ICX A;  5DQH A;  4TUQ A;  8ICC A;  3PSP A;  5HHI A;  2OM6 A;  2HOF A;  1NZP A;  5HP4 A;  1ZQT A;  1HJP A;  2KP7 A;  5GTH U;  7ICP A;  2FLN A;  2KE7 A;  4C8O A;  2K4E A;  2FPK A;  4FFD A;  3ZI4 A;  5CA7 A;  2RQ5 A;  1S5L U;  2Y9U A;  1ZQK A;  4F71 A;  3ISC A;  1BVS A;  5BPC A;  4FO6 A;  2K8B B;  5KT5 A;  4Z6F A;  3AQF A;  4EEK A;  4OO1 J;  2AH5 A;  2EAM A;  3V6K A;  1ECW A;  2D3D A;  3VC8 A;  1MSW D;  4KIT B;  1RPL A;  5DQI A;  5J0Q A;  2EAP A;  4I2C A;  1RDF A;  3PST A;  9ICL A;  2YMM A;  1ZQG A;  2HDO A;  2HBK A;  2MUT B;  2HVI A;  9ICP A;  3QXG A;  1OUQ A;  1V9P A;  1V97 A;  5AK5 A;  9ICV A;  2PKE A;  3JPQ A;  7ICK A;  1X66 A;  1SIJ A;  1TAU A;  5KFH A;  4UB4 A;  5EE0 A;  4QNL A;  4P2H A;  1CRX A;  4I27 A;  7ICR A;  5D46 A;  8ICO A;  4O3P A;  7ICM A;  4KLI A;  4MHV A;  1RYS A;  4RUA A;  2FE9 A;  4Q43 A;  4M2Y A;  3OSN A;  4O3M A;  3Q8P B;  4QZF A;  5B5E U;  5KFO A;  3PW4 A;  4NLK A;  1ZQQ A;  5EWF A;  9ICM A;  4PHP A;  5CRX A;  2KEY A;  4Y2S A;  2C28 A;  1WCL A;  1IM4 A;  3OSP A;  2HVH A;  4B9N A;  1D9F A;  4R65 A;  2LBO A;  1TK0 A;  5ALO A;  2ZIV B;  1UHU A;  1TK5 A;  3MFI A;  1ZQH A;  2BQ3 A;  5AM3 A;  3QU5 A;  4C8N A;  4C4T A;  3HRD D;  4ECS A;  3SAF A;  4PZO A;  1NK4 A;  1S10 A;  4TUR A;  4UB5 A;  3SR6 A;  4PHE A;  5ALF A;  1L7P A;  3Q8Q B;  2Q4T A;  3H8M A;  2VAN A;  2DQN B;  3M9N B;  1T3N A;  4IRD A;  8ICS A;  3RJE A;  4IC9 A;  2JEG A;  3NRZ A;  5AK6 A;  2HMX A;  1XSN A;  1IIP A;  1JRO A;  4M6W A;  3PX4 A;  2FMQ A;  2UVW A;  4P0P A;  4A8E A;  1ZQA A;  4F4K A;  5DBB A;  4QZH A;  1FO4 A;  2BR0 A;  5IIJ A;  1HUZ A;  3LYS A;  3DDH A;  3RTV A;  4KLF A;  2E8O A;  1BPD A;  5J8Y A;  1ZQM A;  4TUP A;  4DO9 A;  3RF9 A;  3PR5 B;  3MR2 A;  2ZG6 A;  5ALW A;  4F5R A;  9ICJ A;  4PL1 A;  4M47 A;  4C7Y A;  4XRH A;  3C5F A;  2W9A A;  2E1E A;  3PW0 A;  1SGG A;  3KOO A;  3AMZ A;  4OJL A;  4YCX A;  2BCQ A;  5G5G A;  4PL2 A;  4B9U A;  1URJ A;  2ALZ A;  5J2D A;  3BDP A;  4TUS A;  1SL2 A;  2G06 A;  4FBU A;  4O5K A;  4UAU A;  1UQV A;  3TKA A;  7ICO A;  3C21 A;  3GV5 B;  4EBC A;  1XNS A;  4IQU A;  3IHQ B;  4KLM A;  1YZ7 A;  1YT3 A;  3ETL A;  3HKZ F;  1N61 A;  4US9 A;  4YR0 A;  3UQ0 A;  8ICQ A;  2JEI A;  4Q8E A;  2V4R A;  2P66 A;  1JMS A;  2XID A;  1X9X A;  2ISO A;  4DS4 A;  4O5C A;  1QQ6 A;  4EYI B;  4MEY A;  2H5X A;  4IL6 U;  2AJQ A;  3UXN A;  3K1Z A;  5DB9 A;  3H8S A;  3PNC A;  5AKK A;  2JZB B;  2GLE A;  4QWB A;  2P6U A;  4KX3 A;  4UB2 A;  1KN5 A;  4LZG A;  4UAR A;  5J8Y C;  4J9P A;  2NRW A;  2KHQ A;  4FZN A;  2MU2 A;  1BNP A;  2PFN A;  5DBA A;  4KLT A;  3GIJ A;  3N7R C;  1NK5 A;  2DUY A;  1RQN A;  2XGQ A;  2A3V A;  1PVP A;  3ZDB A;  3HJE A;  4RU9 A;  4JWM A;  3B0X A;  2XY5 A;  4QZA A;  2IOH A;  3F53 A;  3QUB A;  2F3N A;  1KSP A;  3C28 A;  4NM1 A;  2AU0 A;  2VA2 A;  4Y2Q A;  3WK8 A;  4PGQ A;  2EQY A;  1XC9 A;  1HEK A;  1LVH A;  1ZOL A;  2NV3 A;  2HHU A;  3RB3 A;  1TAM A;  1L7M A;  1CI4 A;  2F8L A;  2FJ6 A;  1ZD2 P;  2KIC A;  4KTQ A;  5ALK A;  2P35 A;  1ZQW A;  2E5S A;  3WK6 A;  2ZTE A;  8ICZ A;  3M6Z A;  4YR2 A;  4F93 B;  2W9B A;  2XIC A;  5ALM A;  4DQS A;  4IQV A;  4JB3 A;  4B9T A;  2Z7J A;  3BS5 B;  1NJW A;  7ICV A;  3WKE A;  2QB1 A;  3EUB 2;  2NRX A;  2XC9 A;  5ALD A;  5EOZ A;  4FBT A;  1TK8 A;  1RZT A;  3IP4 B;  4B9L A;  4IQW A;  2A1J A;  1TVA A;  2QB0 A;  3Q8R B;  5L1I A;  3NAS A;  4RPZ A;  1L3T A;  5J0U A;  1M6Y A;  3LWM A;  4UB8 U;  4RT2 A;  2AQ4 A;  3ALR A;  3RH5 A;  4C80 A;  3OPX A;  3MBY A;  4DFD A;  2C2D A;  1SZH A;  2PMZ F;  4I2H A;  4Q8F A;  5DKW A;  2ZIU B;  2GH1 A;  5DG8 A;  4PGX A;  3NGD A;  2XO7 A;  1F44 A;  4F2S A;  5KFV A;  3SQI A;  4GC7 A;  5J2J A;  1BPB A;  1DK3 A;  3C29 A;  7ICL A;  2F44 A;  4DQQ A;  5D49 A;  1TAQ A;  4DFM A;  1JN3 A;  1Z00 B;  3C23 A;  5J2C A;  2XY7 A;  5ALX A;  4I29 A;  4R64 A;  1SWW A;  1FFV A;  2WF9 A;  5HMM A;  3IG8 A;  2ZIW A;  2WTF A;  2CXY A;  2ZJA A;  3AM9 A;  3JPT A;  2BDU A;  4F91 B;  2D6F C;  2E1F A;  4J9Q A;  1XO0 A;  4UB3 A;  2FMP A;  4DSI A;  3A0H U;  4UAY A;  8ICJ A;  2DGZ A;  2KHV A;  3GFK B;  5CHG A;  4F3O A;  1ZQR A;  3QUC A;  4GXI A;  4EEY A;  2W04 A;  1NK6 A;  5KNI A;  4YXM A;  1S9F A;  4ED7 A;  9ICE A;  1X40 A;  2GOL A;  7ICF A;  4F4Y A;  2F76 X;  4P4O A;  2KMD A;  1A76 A;  1F5S A;  7ICS A;  1MN8 A;  5DB8 A;  3N7P D;  4EX7 A;  1X42 A;  4LJX A;  3V7J A;  2NRV A;  3TAQ A;  4RQ0 A;  2HSZ A;  4AYB C;  1ZQU A;  3F5A A;  5AI4 A;  2K4P A;  5KFZ A;  2R8K A;  5AM0 A;  1NK7 A;  4B9M A;  1S76 D;  5BOL A;  3BQ2 A;  2EDU A;  4YD1 A;  2WF5 A;  3NVW A;  1QCK A;  1JRP A;  2ZUB A;  3C1Z A;  3IG5 A;  2KD1 A;  4UAW A;  3FAH A;  1KRP A;  2RRD A;  3KHR A;  1U48 A;  2JXJ A;  4C0Z A;  1X6I A;  2ZTC A;  4I28 A;  2CN1 A;  4Z6D A;  1AQ6 A;  2CPR A;  5AK3 A;  3BZK A;  3EPI A;  3QE9 Y;  1UA1 A;  1KFD A;  4F4W A;  4IRC A;  4RQ1 A;  5KG5 A;  2OCE A;  5J0Y A;  4JWN A;  5B66 U;  4NJ8 A;  4M9N A;  3F2D A;  4HYK A;  3HX0 A;  2W3R A;  2LPE A;  3CYM A;  2VJ5 A;  4YVZ A;  4EX6 A;  3QNM A;  1SWV A;  2ES6 A;  3GIL A;  4DFK A;  2JRZ A;  3J81 j;  3N7S C;  3JPR A;  1HIW A;  4UAT A;  5AM1 A;  1NKE A;  1L3U A;  1NKB A;  4OJ5 A;  4RQ2 A;  2JGA A;  1Z4N A;  5AM4 A;  1J2M A;  5DLG A;  1IG6 A;  2G09 A;  2KJ9 A;  2I6X A;  1SXE A;  3UM9 A;  4ECR A;  1QTM A;  2JV3 A;  1LKY A;  5KFK A;  1QLN A;  2HHX A;  2M0N A;  3RJG A;  4EEL A;  2JR5 A;  1FFU A;  2ZXI A;  4BWJ A;  1KW4 A;  1LV5 A;  2Y1J A;  2QAR B;  2BPF A;  1ZQF A;  1Z1B A;  4FS1 A;  2EAO A;  4XUS A;  4G3I A;  2QB0 B;  4RNM A;  3H0L B;  1JXL A;  1Q46 A;  4I2B A;  4QIW C;  4ECW A;  4DL4 A;  5AK4 A;  1MA7 A;  3SEN A;  3OHA A;  2DPJ A;  2KIW A;  1EXN A;  2Y0S F;  4U7C A;  4ACO A;  5KL1 B;  4KLU A;  1DXS A;  5KFE A;  4F5P A;  2LKY A;  1ZQY A;  3JPO A;  1A6S A;  4FZL A;  3UXP A;  1Q3V A;  5DBC A;  1ZD4 A;  7ICE A;  4K4I A;  3L4P A;  2KJ8 A;  4I2J A;  4Z6E A;  1U45 A;  1MQ3 A;  2YML A;  4M9H A;  1TV9 A;  5KFJ A;  5T14 A;  2W9C B;  5AKG A;  1SB3 C;  9ICQ A;  3T5J A;  2DPI A;  4ELV A;  3HWT A;  1X9S A;  4J9O A;  3RAQ A;  4LVS A;  1SXD A;  3M8S A;  1C20 A;  3MDA A;  4QW9 A;  4RQ8 A;  3RR8 A;  3CW2 C;  5KAF U;  1NJY A;  4I2G A;  4LZD A;  3UMC A;  5F9N A;  1C7Y A;  3KHH A;  4CDG A;  2Y9T A;  2YX8 A;  1QSS A;  3EYZ A;  2HHW A;  4CF5 A;  1DGS A;  2GO7 A;  2BZF A;  5KG7 A;  3PMN A;  5AKX A;  4YXJ A;  2VA8 A;  1ZYQ A;  4MEX A;  4P4P A;  5D4B A;  2H3I A;  2Y1I A;  3RJH A;  5DGB A;  4C4S A;  3SV4 A;  4E0D A;  4JV0 A;  4IQT A;  2KSO A;  4M9J A;  1B4F A;  1N62 A;  2PFO A;  7ICJ A;  3THV A;  5HR7 A;  1ZQE A;  1X9M A;  4ED2 A;  1U47 A;  5AKZ A;  5KFT A;  4F5O A;  1QH9 A;  3DV9 A;  4USA A;  5J0R A;  4RT3 A;  4J9L A;  3HKZ C;  3T5K A;  3AN1 A;  3C5G A;  5KFW A;  4KMO B;  1ZD5 A;  1XSP A;  1X6J A;  4M9L A;  4YMN A;  3G6X A;  4UBB A;  2W8K A;  1U9L A;  2O6K A;  3D2Q A;  3H8J A;  1RQL A;  4DL6 A;  1DK2 A;  4IS7 A;  4P0P B;  5J0W A;  4GC6 A;  2QKQ A;  4ICA A;  4WJ3 B;  4PPX A;  4RQ4 A;  3F5E A;  3WK7 A;  5C0Y A;  1U4B A;  4DLE A;  2LYA A;  4O3R A;  3UXO A;  2ASD A;  4K4H A;  1SZP A;  9ICO A;  5L1K A;  3K4G A;  5J0P A;  2G0A A;  2J6T A;  1NJZ A;  4CE6 A;  1CEZ A;  9ICR A;  4DSE A;  4KN4 A;  2XY6 A;  5IIK A;  2R8H A;  3OTQ A;  5KTQ A;  5CEH A;  1IXR A;  4DS5 A;  2KOB A;  5AKE A;  3ETR A;  5TZV A;  4NXZ A;  5JUM A;  1P7D A;  2JH1 A;  3QU7 A;  1RG6 A;  4EEN A;  3SI8 A;  2I5H A;  4B9V A;  3BQ7 A;  2WB1 F;  4O9M A;  4NLB A;  4RPY A;  8ICF A;  4FZM A;  2AXT U;  5KG0 A;  8ICR A;  4K4G A;  1ZD3 A;  5GTI U;  8ICU A;  2HBL A;  2K8A A;  5JU5 A;  5KFB A;  1XU4 A;  4DSJ A;  3Q8M A;  2N1R A;  2R8J A;  1XO1 A;  1QSY A;  3TAN A;  9ICS A;  5AM2 A;  2JEJ A;  4NL9 C;  5IIM A;  9ICA A;  2EZY A;  5IIO A;  2F1J A;  3ZDD A;  2K4I A;  3EW9 A;  2BQR A;  3RH6 A;  3PW7 A;  3F2B A;  1KKX A;  2RHF A;  3UQ2 A;  3PW5 A;  3RRG A;  5KL8 B;  5IIN A;  3D2S A;  1BPY A;  5KFS A;  2PI5 A;  2VA3 A;  2RDI A;  5KT2 A;  4YFK A;  2K4H A;  3QU2 A;  2H3Q A;  4RNO A;  3H40 A;  3Q8S B;  5KT6 A;  3QEB Z;  3HIL A;  3H4D A;  2FI1 A;  3NVZ A;  2VIX A;  3KBB A;  3D6J A;  4OCZ A;  9ICI A;  2BGW A;  9ICG A;  2G5H B;  4BJQ A;  2V9W A;  3LWL A;  3RB6 A;  1SL1 A;  1ZQO A;  2LHT A;  4EYH B;  8ICT A;  1L7O A;  5ALV A;  3TAD C;  1UPH A;  1ZQ1 C;  5ALL A;  5KFM A;  5KAI U;  2YTU A;  3RJK A;  1YZ6 A;  3OJS A;  1Z00 A;  3ISD A;  3I28 A;  4CCH A;  8ICV A;  2KG5 A;  5EE1 A;  2LYH A;  2ZIW B;  3H0R B;  1JXE A;  3MR3 A;  3RBD A;  1BPX A;  3GV7 B;  4GXK A;  2C22 A;  3AEV A;  2HHQ A;  3QUQ A;  4DL5 A;  2XGP A;  4RQ5 A;  2F1I A;  4J03 A;  2Q0Z X;  1ZQP A;  1IV8 A;  2B0C A;  2NYV A;  2E8P A;  7ICG A;  4JUZ A;  4DSL A;  4YR3 A;  2ZIX B;  3MDC A;  3MFH A;  8ICH A;  4F8R A;  8ICI A;  2RLT A;  8ICA A;  1VDV A;  2FLL A;  4M9G A;  4DOC A;  1KFS A;  1FEZ A;  2PMZ C;  8ICG A;  5DB7 A;  3KD3 A;  3OHB A;  3KZX A;  2BCR A;  3DEE A;  5ALS A;  1PK1 B;  4XA5 A;  4Q44 A;  2IOF A;  2L5Y A;  3TFS A;  1BNO A;  4OJP A;  3PX6 A;  2PXI A;  2VJ4 A;  4Y2T A;  3N97 B;  3LDA A;  2ZJ5 A;  2KK0 A;  4PZN A;  4KLQ A;  5HML A;  2W9B B;  5AI0 A;  5AI9 A;  5CJ7 A;  4QZC A;  2W8L A;  2FPL A;  4F5Q A;  3Q8K A;  4RZR A;  2YB1 A;  4B6J A;  1ZJM A;  3RFA A;  2CRX A;  1D8L A;  3BQT A;  2I9G A;  3SAG A;  3GIM A;  5KFP A;  4FS2 A;  1WWU A;  1KTQ A;  1RXV A;  2ODG A;  5EE9 A;  1K5O A;  4EZ6 A;  3SYZ A;  1L7N A;  1Y88 A;  9ICU A;  2ZIU A;  3PVX A;  5DG7 A;  1UT8 A;  4KLE A;  4J9K A;  1XWL A;  3K1R B;  4MF8 A;  1JI7 A;  4DLG A;  1GO3 F;  3RBE A;  2VKQ A;  5KFG A;  5EWE A;  2ZIV A;  3SAH A;  1O03 A;  5ALN A;  2W3S A;  4DFP A;  4PJ0 U;  2MAX A;  1CUK A;  1NNL A;  1Q3U A;  4F72 A;  1QQ7 A;  3MC1 A;  1K1Q A;  3QEA Z;  1PVR A;  2ZUD A;  2JZB A;  5CP2 A;  2LI6 A;  1Z4O A;  1N63 A;  8ICE A;  1T8E A;  2KFZ A;  4BGD A;  1ZQX A;  4ED1 A;  1ZQZ A;  4I2F A;  3LVV A;  1DGJ A;  5H2F U;  4OD0 A;  4Y2V A;  2NRT A;  2W7O A;  5AHX A;  5CB1 A;  1ZQB A;  3G6V A;  2MRL A;  4ECZ A;  2FMS A;  3RRH A;  1PK1 A;  1KQQ A;  4GXJ A;  4HAI A;  4RQ7 A;  2IMW P;  3KHL A;  2JEF A;  8ICY A;  3Q8L A;  1SL0 A;  4F50 A;  2B21 A;  1D8Y A;  4QWA A;  1N5X A;  5DQG A;  2MA1 A;  2RP5 A;  1OW5 A;  4Q45 A;  3NVV A;  2HBM A;  2H3V A;  1SV0 A;  1ZQS A;  2F8K A;  4PHD A;  4O3S A;  3GIK A;  3RJI A;  3OJU A;  3G6Y A;  2BCS A;  2ZIX A;  8ICK A;  4DOA A;  2FPM A;  3PW2 A;  1UA0 A;  5AI8 A;  3TAC B;  4QW8 A;  4KLH A;  3GII A;  3MAB A;  2F1H A;  2XCP A;  5J2E A;  4ED3 A;  2E8N A;  4OJ6 A;  3C2M A;  2KN7 A;  5J2K A;  4O0I A;  3PO4 A;  1Q8K A;  3NUQ A;  3TAD A;  2JHD A;  3CRX A;  4IR1 A;  1ARO P;  4QZG A;  2J6U A;  3GV8 B;  3GQC A;  4Y2P A;  1QSL A;  3M9M B;  3RJF A;  4TQS A;  2G5I B;  2G07 A;  5ALZ A;  4DSK A;  7ICU A;  4PGY A;  5KFL A;  1S0O A;  2HOQ A;  3PO5 A;  4CRX A;  5ALP A;  4DCC A;  5KG6 A;  1L3S A;  4BXO A;  4J9R A;  3SMV A;  2KV2 A;  4C7Z A;  2IBK A;  2MSN A;  4M6W B;  2EZZ A;  3MGV A;  4EZ9 A;  3WKC A;  5KG2 A;  4YN4 A;  4NLZ A;  1F0M A;  4KX5 A;  2Y0S C;  4UAS A;  2W11 A;  1SV0 C;  1T94 A;  4QZD A;  3WK5 A;  1OXJ A;  2KIV A;  5F3X B;  5JTI A;  4Y2Y A;  3ISB A;  1SKS A;  3HP6 A;  1S0M A;  5DB6 A;  1ZQC A;  8ICL A;  4I2D A;  2IHM A;  1T4G A;  4JV1 A;  3UPQ A;  9ICB A;  4F4Z A;  2KKP A;  4BWM A;  4FE3 A;  3NTU A;  2ZJ8 A;  4ELT A;  1PUZ A;  1UT5 A;  3QZ7 A;  5KFN A;  3LVW A;  1N5W A;  3B9J A;  2ASL A;  3KHG A;  1ZQI A;  4OJO A;  3PX0 A;  2DFL A;  5KFX A;  1X9W A;  4GIB A;  3SZ2 A;  3NS1 A;  1COK A;  3ZD8 A;  3WU2 U;  4NLC A;  7ICN A;  1KDH A;  2W9C A;  3C2L A;  1HUO A;  5KG1 A;  2DBY A;  4UAV A;  2A1A A;  5J2F A;  2K89 A;  3SD7 A;  4NY8 A;  5J2A A;  4RQM A;  1T3Q A;  5KFD A;  2YQE A;  1NOM A;  4JMU A;  3AU2 A;  4MFF A;  3TAP A;  4P4M A;  2ATL A;  3T5H A;  4F2R A;  2XVT A;  5J2B A;  2UVU A;  2WAQ F;  3HPO A;  4QIW F;  1JX4 A;  3MR5 A;  4ECX A;  1B22 A;  5FP0 A;  1L5U A;  1MC8 A;  4RUC A;  3PY8 A;  9ICC A;  4DFJ A;  4DQI A;  3I1Y A;  3RR7 A;  1ED1 A;  5F9L A;  4AYB F;  2KSO B;  4KLO A;  3M6K A;  4I2E A;  2E8M A;  4UAZ A;  3FC4 A;  1UCV A;  1RYU A;  5AIC A;  4RNN A;  9ICF A;  2A19 A;  3HW8 A;  3B0Y A;  4QZ8 A;  2EAN A;  1N60 A;  3A0B U;  4C8L A;  2EZX A;  1BGX T;  3QYP A;  3FYH A;  3AQE A;  1N56 A;  3H8W A;  5J0T A;  2OH2 A;  3C2K A;  4O3O A;  1WUD A;  4UB1 A;  2W54 A;  9ICK A;  1Z19 A;  2B6G A;  3WK9 A;  4NWI A;  4ELU A;  1D8B A;  2AGO A;  3GDX A;  1NJX A;  5L1M A;  3M8R A;  4BUG A;  2IHN A;  2M9N A;  5AKI A;  5AKL A;  2OWO A;  1L3V A;  1WYG A;  4KLL A;  1LB2 B;  2H3F A;  1NI3 A;  5AI6 A;  1ZQL A;  3PV8 A;  2HI0 A;  2RDJ A;  2UVR A;  4Y2R A;  2V4Q A;  2J6S A;  3M1Y A;  4KLG A;  4F4X A;  4GLX A;  2UVV A;  2H3Z A;  4Z6C A;  1SKW A;  3H0M B;  4YG2 A;  2KVC A;  5IIL A;  1N48 A;  2YY6 A;  2KZM A;  1X2I A;  2DKX A;  4ECY A;  3RH4 A;  3KZI U;  7ICI A;  3E2E A;  5ALG A;  5HNK A;  4AP9 A;  3LK9 A;  2D8C A;  4ED6 A;  2QAR A;  5KFQ A;  4EBD A;  4KLJ A;  4X5V A;  1TFR A;  3FM9 A;  1ZRN A;  5KG4 A;  1N2X A;  4YMO A;  4B9S A;  2XI9 A;  2KFN A;  3V6H A;  1A0P A;  4R8U A;  4BDP A;  3WKA A;  4C8K A;  4DL7 A;  1WG8 A;  3V7K A;  1S97 A;  4RQN A;  3PSI A;  3EWA A;  2BPG A;  3RJJ A;  4J9M A;  2YN4 A;  4DF4 A;  1PVQ A;  8ICM A;  1Z1V A;  1KBU A;  7ICT A;  2XCA A;  3ZDE A;  3GZF A;  1U49 A;  4R63 A;  2K60 A;  4P0Q B;  1KL9 A;  4YD2 A;  3JPN A;  2WFA A;  5ALJ A;  3EPG A;  2HBJ A;  2GWS A;  1NZB A;  5K4L A;  2IA6 A;  5AKJ A;  2LM4 A;  4QZB A;  4Y2U A;  4ECU A;  2HHS A;  5J0O A;  5J2G A;  2BDP A;  3C1Y A;  3IN5 A;  5KT4 A;  3BS5 A;  1KLN A;  8ICX A;  3KTQ A;  5AI5 A;  5KFY A;  4ECQ A;  2BKE A;  4XQ8 A;  4CGZ A;  1NKC A;  3K75 D;  1S77 D;  5J0X A;  1QQ5 A;  5CWR A;  4JV2 A;  2W43 A;  2NO4 A;  5ALY A;  3U26 A;  3HT3 A;  1WCN A;  2KZ3 A;  3PZP A;  1COO A;  9ICH A;  3SEI A;  4O5E A;  4P0Q A;  1J97 A;  1XS9 D;  1L8O A;  4RQ6 A;  2QLT A;  5E79 U;  1VLB A;  4CF4 A;  7ICH A;  4ZH4 A;  2W03 A;  9ICW A;  3L5K A;  3M9O B;  3IV6 A;  2PI4 A;  3AL0 B;  1LKY B;  4DQR A;  2F77 X;  3F2C A;  2HHT A;  3BZC A;  4Y2X A;  1T7P A;  1ZQV A;  5KFU A;  4KLD A;  4EBE A;  2DWQ A;  4R8U B;  3QU4 A;  4NLG A;  2NRZ A;  1PZN A;  2ESE A;  3E0F A;  5HR6 A;  5HHH A;  4BXO B;  2WHE A;  4Y2J A;  5AKH A;  3PML A;  9ICN A;  4US8 A;  2ISP A;  4GFJ A;  1BPZ A;  2ASJ A;  1VJ5 A;  2LMR A;  2E3T A;  4YQW A;  4DEZ A;  5G5H A;  1RXW A;  5DG9 A;  1RYR A;  9ICT A;  2JH7 A;  5ALQ A;  3BS7 A;  3JPS A;  1TKD A;  3KKA C;  4KLS A;  3N28 A;  4KN7 A;  2A1J B;  5CR0 A;  4NLN A;  5TIS U;  2OYY A;  2DKZ A;  1ZXI A;  3S6J A;  2YMP A;  5C5J A;  2R8G A;  5L1L A;  1ZQN A;  9ICX A;  2P6R A;  4J9S A;  3NRW A;  4QZI A;  2KVS A;  5J2I A;  2W9M A;  3KFU F;  1SV4 A;  2BQU A;  3BQ0 A;  3V6J A;  1ZRM A;  2JMG A;  2R18 A;  1MQ2 A; 
#chains in the Genus database with same CATH homology
 5III A;  4MFC A;  4R66 A;  4M0A A;  4YCX A;  2BCQ A;  3PMN A;  1ZQS A;  4PHD A;  4MF2 A;  5D4B A;  3RJI A;  5J2D A;  3RJH A;  2BCS A;  4TUS A;  7ICQ A;  8ICK A;  4DOA A;  4IQT A;  4O5K A;  4M9J A;  4YMM A;  7ICO A;  4PH5 A;  2PFO A;  7ICJ A;  4KLH A;  4MFA A;  1ZQE A;  4IQU A;  4NM2 A;  4KLM A;  5J2E A;  4F5O A;  3C2M A;  4PHA A;  5J2K A;  8ICQ A;  3UQ0 A;  2P66 A;  1JMS A;  5J0R A;  2BCU A;  4RT3 A;  2ISO A;  4QZG A;  3C5G A;  4O5C A;  4QZ9 A;  3RJF A;  8ICB A;  1XSP A;  7ICU A;  4M9L A;  4PGY A;  4YMN A;  4I2A A;  3UXN A;  5DB9 A;  3PNC A;  4UBB A;  4UB2 A;  1DK2 A;  4LZG A;  5J0W A;  3V72 A;  5DDY A;  1BNP A;  4YN4 A;  2PFN A;  4NLZ A;  4PPX A;  4RQ4 A;  5DBA A;  4KLT A;  3UXO A;  4QZD A;  3JPP A;  4K4H A;  3ISB A;  4I2I A;  4JWM A;  3B0X A;  9ICO A;  4QZA A;  5DB6 A;  1ZQC A;  5J0P A;  8ICL A;  4I2D A;  2IHM A;  3UPQ A;  9ICB A;  4NM1 A;  4DOB A;  9ICR A;  5J2H A;  4PGQ A;  1ZQJ A;  5J29 A;  2PFQ A;  5IIK A;  4RPX A;  1ZQI A;  5TZV A;  3OGU A;  4NXZ A;  3V7L A;  8ICZ A;  7ICN A;  1KDH A;  4O9M A;  4RPY A;  8ICF A;  3C2L A;  1HUO A;  3AU6 A;  4IQV A;  5J2F A;  8ICR A;  4K4G A;  1ZJN A;  1XSL A;  8ICU A;  4NY8 A;  5J2A A;  2BCV A;  8ICN A;  3AU2 A;  7ICV A;  4MFF A;  9ICS A;  9ICA A;  5J2B A;  5IIM A;  4QZE A;  5EOZ A;  1RZT A;  4IQW A;  5IIO A;  1TVA A;  1ZQD A;  4UBC A;  3MGI A;  9ICC A;  4RPZ A;  3RH6 A;  5J0U A;  3UQ2 A;  4RT2 A;  5IIN A;  4KLO A;  1BPY A;  2PFP A;  3RH5 A;  4I2E A;  4UAZ A;  8ICP A;  3MBY A;  8ICW A;  9ICF A;  4I2H A;  5DKW A;  3HW8 A;  3B0Y A;  4QZ8 A;  4F5N A;  4PGX A;  1KEJ A;  5BOM A;  3MGH A;  5J0T A;  3C2K A;  4UB1 A;  9ICK A;  5J2J A;  1DK3 A;  7ICL A;  9ICI A;  9ICG A;  5D49 A;  3GDX A;  5J2C A;  1ZQO A;  3TFR A;  4I29 A;  3AUO A;  5J0S A;  8ICT A;  4R64 A;  4RQ3 A;  1BPE A;  3RJK A;  3JPT A;  4M04 A;  4KLL A;  1ZQL A;  4UB3 A;  2FMP A;  4UAY A;  3ISD A;  8ICJ A;  4TUQ A;  8ICC A;  4KLG A;  5HHI A;  1ZQR A;  4GXI A;  4Z6C A;  8ICV A;  1NZP A;  1ZQT A;  2KP7 A;  7ICP A;  9ICE A;  1BPX A;  5IIL A;  4GXK A;  7ICF A;  7ICS A;  4RQ5 A;  5DB8 A;  3RH4 A;  7ICI A;  1ZQP A;  7ICG A;  3V7J A;  3LK9 A;  3MDC A;  1ZQK A;  4RQ0 A;  8ICH A;  3ISC A;  4KLJ A;  4X5V A;  8ICI A;  4YMO A;  5BPC A;  4FO6 A;  8ICA A;  4Z6F A;  4M9G A;  5BOL A;  4DOC A;  4YD1 A;  3V7K A;  8ICG A;  5DB7 A;  2BPG A;  3RJJ A;  2BCR A;  5J0Q A;  4UAW A;  8ICM A;  4XA5 A;  4I2C A;  7ICT A;  9ICL A;  3TFS A;  1ZQG A;  4R63 A;  1BNO A;  4I28 A;  4YD2 A;  2PXI A;  3JPN A;  9ICP A;  4Z6D A;  2GWS A;  4KLQ A;  9ICV A;  3JPQ A;  7ICK A;  4QZB A;  5J0O A;  5J2G A;  4RQ1 A;  4QZC A;  4UB4 A;  5J0Y A;  4F5Q A;  4JWN A;  4M9N A;  3HX0 A;  4P2H A;  8ICX A;  1ZJM A;  4I27 A;  7ICR A;  5D46 A;  8ICO A;  2I9G A;  7ICM A;  4KLI A;  5J0X A;  5CWR A;  4M2Y A;  3JPR A;  4QZF A;  4NLK A;  4RQ2 A;  9ICH A;  4O5E A;  1ZQQ A;  4RQ6 A;  9ICU A;  9ICM A;  7ICH A;  9ICW A;  4KLE A;  4PHP A;  4MF8 A;  4KLD A;  4R65 A;  1ZQH A;  3RJG A;  2BPF A;  5HHH A;  1ZQF A;  4XUS A;  4UB5 A;  4TUR A;  4PHE A;  3PML A;  9ICN A;  4I2B A;  8ICS A;  2ISP A;  1BPZ A;  3RJE A;  8ICE A;  4KLU A;  4I2F A;  1XSN A;  9ICT A;  3JPS A;  4F5P A;  4KLS A;  2FMQ A;  3JPO A;  1ZQA A;  5DBB A;  4QZH A;  3UXP A;  5IIJ A;  5DBC A;  1HUZ A;  7ICE A;  4NLN A;  4K4I A;  5CB1 A;  1ZQB A;  4KLF A;  1ZQN A;  9ICX A;  1BPD A;  4I2J A;  4Z6E A;  4QZI A;  1ZQM A;  4TUP A;  4DO9 A;  2FMS A;  1MQ3 A;  5J2I A;  2W9M A;  4M9H A;  1TV9 A;  9ICQ A;  3HWT A;  4GXJ A;  4F5R A;  9ICJ A;  4RQ7 A;  4LVS A;  4M47 A;  3MDA A;  4RQ8 A;  3C5F A;  8ICY A;  4I2G A;  4LZD A;  1MQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...